1QMCA

C-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Refined Solution Structure of the C-Terminal DNA-Binding Domain of Human Immunovirus-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords HIV-1 INTEGRASE
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1qmcA00
1C0MA 1IHVA 1C1AA 1QMCA 5D7UA 1EX4A 1C6VX 4FW1A 4FW2A 1IHWA
chains in the Genus database with same CATH superfamily
3H6ZA 3SB2A 4L5GA 4Z89A 1I4K1 3CBMA 1QP3A 2DL3A 2MMPA 4PFZA 2KSSA 2X3XD 3PIPA 1C1AA 3MP6A 2OJ2A 1KQ1A 4ZGDB 3EFSA 1I07A 3BDUA 2OTLQ 1SG5A 5CQYA 3I56A 3NMZC 3V7RA 4RCBA 1RAAB 4AFQC 2VXEA 4RTYA 2LRQA 4OMPA 1FYNA 1NJIC 2MPXC 2KMTA 3CC2A 4HVVA 4PL6A 4DA4A 1MV0B 2OAWA 2R58A 4ZTJA 3A1PA 4RG8A 3KFVA 1UECA 5CR2A 4OGCA 1V29B 3L2RA 2L89A 1M3CA 1AD5A 3CBOA 3VV0A 2HBWA 4PLLA 4MMLA 2LCLA 3A8MB 4BE1A 2L2PA 2EQMA 2XICA 2PQWA 2KE9A 1X27A 1ZBXA 4RTUA 1GCQC 2MK5A 2XU8A 1AT1B 5I11A 2COZA 1QCNA 3BY7A 2DXCA 2YLBA 3RDVA 4A4EA 1WFWA 3ASKA 1WLPB 1IHVA 4M78A 4M7DF 4JRQA 3QHSA 3G6ET 3NTKA 1R8OB 3VS1A 3EG1A 1DJ7B 2KROA 1ACMB 3OSSC 4XTXA 1YJWT 3JB9G 2ED1A 2HNIA 2DVJA 3VS0A 4AFUC 2CT3A 4OB1B 5LJ5d 3OS1A 1JO8A 3LLRA 4OGEA 2CP7A 5GAOq 4EMHA 1K0SA 3EFOA 4XTZA 3X20B 3RUXA 2DL4A 3MEWA 1K73U 1GFDA 5GAN3 4PK4A 4PJMA 4N4GA 2RN8A 4LXCA 1RADB 3J81E 3U23A 1Q95G 2DVEA 1N6AA 5GAN4 5J26A 2D1XA 1UGQB 5GANh 3KBGA 1YJ9T 2RPNA 2DXBA 2H3JA 1MMNA 4WTOB 1XJWB 1QVGP 2ZGWA 2QA4A 1VQPT 4E47A 2OTLA 1YIJQ 1NJIR 2RMOA 1BYMA 2G3RA 3QBYA 2YRCA 4HKEA 1XNIA 4FCYA 1W4SA 2LQKA 3JCMg 1Y57A 4GLKA 4BE2A 1JXMA 1B7TA 4M7AC 5KYNA 4PFPA 3MO8A 1SSFA 4J6WA 3OW2A 1YJNA 3MHXA 1D0YA 1D0ZA 4Z88A 2V1RA 1YHQQ 1K9MU 5GAMg 2F1LA 2O88A 3SDZA 4XAXB 1BU1A 1VQKT 1UTIA 1G8XA 2CGHA 3WXMB 1BI3A 3OYMA 5LJ5h 5L23A 4AG2C 3CXCA 1SF9A 1H641 2EYWA 2O9VA 2JMAA 3VS2A 2ZAEA 3OY9A 2DZCA 5GMKm 1SHGA 1C0MA 5GAN6 1NPRA 2GBQA 1YITA 2MI6A 4LNPA 1RLQC 2KGTA 1BK2A 2EGAA 4QW2A 1VQNT 5KYXB 1T0JA 2DYBA 2QI2A 1ZHIA 1U8RA 2D8JA 2P0KA 4ZTFA 4C92D 2QTXA 3LH5A 3CCST 1RAFB 4CC4B 3N5BB 1YFNA 5LJ3d 2CSIA 1WHHA 2VC8A 2EBPA 4Y91A 4X1VA 1D1AA 2B8AA 1YJNQ 1R0BG 5FW9A 3VUZA 2FYKA 1NBEB 2DEQA 2L3RA 3EG0A 1ZA2B 4HA8A 4PNOA 3MP8A 1RI0A 1X2QA 5GANd 1WZOA 4J9EA 1X01A 5ECAA 3FC3A 2ZPBB 1VQKQ 4BI3A 2VUBA 3QJYA 5I21A 2DIQA 1YHQA 2RJDA 4N4IA 2BTTA 3H41A 1QW1A 4J9BA 1GFCA 3HP9A 2E5KA 4C0ZA 3BFMA 3EHRA 4M78B 4RTXA 1D09B 2CSQA 1IREB 1MV3A 3NPFA 1U06A 2Y4XA 2D0NA 5FWCA 5EC7A 1RABB 2F2VA 2RO0A 3JRZA 1Q82R 2DEUA 5FWBA 1LNXA 2EFIA 4OMQA 4JZ3A 3QDFA 4QT7A 4XTYA 4C0GA 5A0LA 1UJ0A 2HD0A 4KGXB 2NYSA 4F14A 3CQTA 2K4YA 1AOJA 5GANe 5GAMe 3M59A 3GOXA 2DMOA 4DBQA 2LC4A 3CC2T 3QWXX 2CDTA 1TOVA 3TCJA 2V8KA 2YUPA 2DXUA 1H3ZA 2RB6A 3C94A 4D8KA 3JB9F 1YNZA 3CCRA 2AK5A 2PVOB 4CC3A 3QJ6A 1Y71A 4J9FA 4M75G 5CKBA 3ZBDA 3EGXA 1OU8A 4M7AB 2L8DA 2NUPB 3TU4K 3RMQA 1U1SA 3M0SA 4ELYC 4JRKA 1VA7A 2QK0A 2KYBA 3C0CA 1YJ9A 3INZA 1GXIE 1VQ7A 2K3YA 2JT4A 2FB7A 2KRMA 2M51A 1P92A 2EYQA 2DM1A 2MAMA 3HTRA 5FU6B 2LQWA 1PSEA 3EGDA 4EMKA 3CCEQ 4ZN3A 4M7AG 2IIMA 2HKNA 2VYTA 3LYIA 4JDSA 1YJWQ 1SKUB 4CC7A 4DOWA 4RCCA 2ROTA 1UGSB 4C5EA 3CCSQ 4QKUA 1KIKA 4QVZA 1QWEA 1IB8A 4A4FA 1NM7A 1I5LA 2DBMA 2E70A 3V7CA 1CSKA 3VJPA 4AT1B 2LNHB 2DRKA 4R56A 2RHZA 5L8RE 3CPWS 3M54A 3EHQA 2V26A 4C8QG 1WJRA 3M9QA 1WPYA 3AT1B 3JSCA 2QDYB 1VQ8Q 3M58A 2EJGA 2K2VA 2XI9A 3CMAT 3E2UA 1VQ6T 2VGNA 1VQPA 1YWOA 4J9IA 1VQ8A 3CCMT 5A0GA 3I55T 3TREA 3PVQA 1NYFA 3JCMe 4L6V5 1RAIB 5GJVB 2KBTA 4M75B 4CI0C 4IURA 4PLIA 2DE0X 2COYA 4J6XA 3ZFJA 2J6OA 4A54A 5IT9E 1RACB 1IO6A 3JCMV 1N9SA 1UGRB 2EGCA 3LGLA 4B9WA 5FRMA 4LDYA 3P8BB 4LDXA 4D6WA 4M78C 5C0MA 5LJ3f 5LJ3e 2C0OA 1AEYA 1M2VA 3I56T 1W1FA 2QGFB 2YDLA 4JJCA 1AVZC 3FJ5A 3GF5A 1XOVA 4AFSC 3CC4A 3M0QA 2X9HA 1EIFA 3EG2A 2DFUA 3CCEA 1G3SA 5EG2A 1AWOA 3PTAA 2KQWA 2LDMA 5KYWA 1M5Q1 3UWNA 3PMIA 3OYAA 3P8HA 2XDDA 1VQ7Q 2PUOB 2EYZA 3EAEA 1JJ2P 2HDAA 2BIVA 3CCRQ 1X43A 2HKQB 2I0NA 2ABLA 4X34A 1WYXA 3HFNA 4C8QD 1B3QA 1B34B 1E6GA 1BI1A 1KD1C 3HRUA 3CCLA 1WA7A 5KYUA 3CC7Q 2P4RA 3L2UA 1YCYA 1BIAA 2QQRA 1B07A 1G2BA 2KRSA 3CCQQ 3VRZA 1M4ZA 3FLGA 1QVFA 2YRVA 5HCKA 2X4YA 2YT6A 5FROA 4JS4A 4WCIA 1UJYA 5KE3A 2CS7A 2FRYA 2FPEA 3RBBB 4JJDA 2ATCB 3CPWA 2LQ8A 1Q82U 1LOJA 2XK0A 3I55A 4FYWB 1NJIU 5M9OA 5FU7C 3CMEA 2PTKA 2RK1A 3CCRT 4C0FA 3OYDA 3CMEQ 2HZYA 3G4SQ 4MZMA 2HCKA 4AFZC 3EGDB 3H0FA 4HT8A 4PJOB 1N5ZA 1D1CA 5HY6A 1EZZB 2LCSA 1NPPA 2JZ2A 1WJQA 1OU9A 2DERA 3I5RA 3RERA 4XU2A 1Y0MA 5CCAA 2EW3A 3BW1A 3MEAA 4B9XA 1QVFP 4M7DC 1AZEA 3OSVA 1KQSA 3EGXB 2RHUA 3QWYA 5D6YA 4ANJA 1OEBA 3GP8A 4NS5A 3LWHA 1BI0A 5GMKj 1IHWA 4ME7A 2VKNA 5KYWB 2VVKA 1RLPC 1K9AA 2QQSA 1UGPB 1Y96A 5GJWB 3SWNB 4FT2A 3HPWA 2JNGA 1G5VA 1YITQ 1YN8A 5FLXE 3OA6A 4J7FA 5GAN7 3QSUA 1WX6A 2EQUA 5GAN5 4M7AD 2DTHA 4QQDA 1HD3A 3M5AA 2DO3A 4D8DA 2OX7A 4HVWA 3E1SA 3WVEB 3JB9J 3X25B 3QDRB 3DKMA 1TH7A 1OX8A 3L2QA 4P5NA 5GAOl 3QG1A 1YI2A 1WHLA 3JCMf 3EH1A 3UPUA 1HJDA 4PJOE 4EDUA 1G3TA 2D6FA 4E2FB 4XK8E 1M1KU 2KVQG 4JZ4A 1YI2T 5CO7A 1M8VA 2A0FB 5LJ3h 2EJFA 1PKSA 1KSWA 3RNJA 3SEMA 2CP2A 2LVMA 3URGA 1QVGS 3LGFA 4KH0B 2DA9A 3FEOA 2V1QA 3H0HA 2KT8A 3EFOB 4F7UE 1KQ2A 3X28B 4C92F 4HCZA 2XDBA 1K4US 1VOMA 3X24B 2D9TA 2RQUA 3FRNA 4M77D 3QYGB 2AKKA 4JJBA 4LD9K 2ED0A 2DD4A 1TSFA 4HCKA 1TXQA 1U1TA 4M75C 4EMKC 3TSZA 1SSHA 1ZUYA 1VQ4A 8AT1B 3KUFA 1TUDA 1ZA1B 4PJOG 3G4ST 2KXCA 2HSPA 1YCSB 1MNEA 2A3LA 1WQ7A 5KYYB 2HQHA 4OVAA 2JXBA 1R0CB 2FPDA 4IUQA 3L2ZA 3MPUB 2DK3A 4LN2A 1KC8C 1N8RC 1TWBA 1YBYA 1ZUKA 1YJWA 1I5OB 2LZ6B 1K76A 1WIEA 2CH4A 5LL6S 3VS4A 1VQLT 3ZEHA 1VQ5Q 1FWZA 1M2VB 2LT1A 3HL8A 3RKXA 1M8MA 2ENMA 9ATCB 3M56A 3CCET 2L3PA 2JOYA 1K73R 1OULA 4F7UG 4M7AF 5CK9A 4EIKA 2ESWA 2R5MA 3M0RA 1YHQT 2CP3A 3CD6Q 2E10A 2JM9A 1VQ5A 5A2QE 4M78E 2GTJA 2FZGB 4XQ3A 1OOTA 3OBYA 3ULRB 2DETA 4HVUA 2QAZA 3CC7T 1NZ9A 5LJ5g 1HK9A 2JJ9A 3CD6T 4J9CA 2W0ZA 1KD1R 4ZGJB 3SD4A 5CAIA 1F1BB 3JB9H 1RUWA 4C8QF 1G83A 2WSEE 3G71T 1NYGA 2GQVA 5CVIA 2KXDA 3E9GA 5I2SA 1VQ6Q 1Q81U 4J9DA 4M77G 3F70A 2GNCA 2LQNA 1Q86U 3L42A 4OP0A 2NUTA 2HAXA 4ELZC 3I56Q 1VQOT 1WHMA 3META 2FHDA 1PD1A 4RKUE 3TQ7P 5KH6A 3OYHA 1K9MC 2BKDN 4AMCA 2JTMA 2NLUA 4E7SA 2XDPA 2HBPA 2P4TA 1YWPA 4M75E 1VQKA 1AHJB 1OZ2A 2DNUA 3G71A 5IHIA 2YSQA 3A98A 4J6YA 1BB9A 3JV3A 2RHXA 1HYOA 1PRMC 2CP6A 1PG5B 2EAYA 3CCJQ 2XIDA 3JB9I 1KQSP 2DL8A 1KK7A 1TU0B 5KYUB 4F7UB 2FRWA 4O5VA 3OYCA 1WXTA 5HKCA 5J3BA 5IH2A 3GLXA 4L59A 2BZYA 3RR6A 1VQMT 1Y07A 1Y96B 1ABOA 3A8GB 1M90C 3ER0A 4BDZA 3OS2A 2RF0A 3M0PA 2DIGA 1QKWA 2RM4A 2VXFA 3RKWA 1VQ9T 1KFZA 1VQ5T 1UG1A 1H92A 2EKOA 1PHTA 4IUPA 3THKA 3MEVA 1IGQA 2E41A 3CMET 2G6FX 4XTVA 4VUBA 2DL7A 4FSXA 5I2MA 1M90U 1CKBA 2GTOA 2DJQA 1WHJA 1JU5C 2X4JA 4V2SA 1H3HA 3OYJA 4OMMA 4ZGEB 2DL5A 2DRMA 2P84A 1VYVA 2RI2A 5GMKe 3OQ5A 3H9NA 1WXUA 3JCMW 4PKCC 2FEIA 4HCCA 1GL5A 4E7JA 2VV5A 2ZZDA 3NHNA 1WI7A 4E7IA 3CCUQ 2DTIA 4KUDK 5GAN2 4A4GA 3S3MA 4A4HA 1OPKA 4O6JA 2DD5A 2ECZA 1TTHB 2KEAA 2KI7A 1AZGB 3RMSA 2E3HA 2B86A 2XHCA 3R6NA 1A0NB 2QYZA 4DEYA 1M3BA 4M7AE 3IQLA 2KT1A 1S72A 2OTJA 1M1KR 3SWNC 1VQOA 4LDUA 3OW2P 2M0YA 3D7SB 3I55Q 1OPLA 4RMOA 5CKEA 3VU3C 1MHNA 1Q7YR 3VKIA 2I2LA 4KRTA 1S72Q 2QQ9A 2OTJQ 1M1KC 1YIJT 1ZQ1A 4DEXA 3EFRA 2AKLA 1D1BA 4C0DB 3NFCA 4HT9A 4N0AC 2AT1B 4BY6C 2E1HA 1CKAA 1NE8A 2YUNA 4R55A 4MMKA 4PJOC 1PRLC 4KGZB 1KG1A 3FJPA 2HQXA 2DYIA 2VB6A 4A53A 2DTOA 4Y92A 3PGGA 2XD0A 4HCBA 3CCQA 2IPOB 2RJCA 2XKOC 4FU6A 1I8FA 3DB3A 1AWJA 3CCUA 1WGSA 1JJ2A 3DLMA 4N4HA 1KJWA 3CC7A 3QUIA 3CCLQ 3QKJA 3C12A 4KT0E 2X3WD 2K3BA 2ROLA 4PJNA 3PFSA 2CH4W 5CQXA 1XTDA 3PNWC 4MDXA 4JS5A 1TG0A 1G3WA 1PCXA 2RQTA 1WNLA 1GBRA 4QQ6A 1UDLA 2L3SA 3I5SA 3JB9D 4OB3B 5LJ5f 2DXTA 2NWMA 1VQLA 1X6GA 4JJNK 3OYIA 2X4XA 4J9HA 4CC2A 1W6XA 3NTHA 2J6KA 4EMKB 2JTFA 3OS0A 4KBMB 4FT4A 2EGEA 1QMCA 2Y90A 2LTOA 3MKDA 4JRPA 4FM4B 1IRXA 2EVRA 1KHCA 1X75C 4Y28E 5IHKA 5GANg 5GAOr 1JB0E 2KR3A 3CCLT 3PMTA 1KHIA 2QQAA 3MCAB 1Z9QA 2A28A 1UE9A 2R5AA 2YXYA 3OYLA 5IXFA 1SRLA 2M0OA 1KD1U 3GIBA 4FIBA 1UB4A 2QA4Q 3CC2Q 3REBB 2FPFA 2DJZA 4OB2B 1VQPQ 4E7HA 6AT1B 1PM3A 2Z0WA 2RJEA 5KYYA 4M78D 1ZSGA 5GMKh 1NG2A 1OI1A 2X4WA 1NEGA 2KDSA 3CC4T 2DBKA 1WQWA 2LX7A 3ZL7C 4M75A 2QXFA 3OBWA 1N9RA 5DY9A 3GNFB 2CKKA 4FYVB 1K1ZA 1UFFA 1ZSZA 4E7ZA 3GPLA 2GQIA 3QO3A 2MOXA 1JJ2S 1Q7YU 1IZ6A 3QZ9B 1UGVA 1I1JA 1VYUA 2VGMA 3CCMQ 1RL2A 3SHWA 1MMDA 3S3OA 1YI2Q 3PVLA 1WHKA 3CPFA 2L5QA 2J7IA 5D6WA 2EYYA 3LH0A 2DILA 2ZPIB 2AHJB 2LCCA 2FZCB 2BZ8A 3QIIA 2GCXA 1M1GA 3PIOA 1VQ8T 2COWA 4XU1A 1B34A 1RAGB 4XU0A 3OMCA 3FDRA 2F5TX 4EMGA 3QYHB 4RG2A 4B6MA 2E3IA 1E6HA 4DBFA 2CZ0B 2E64A 4NOYA 3GNGA 4IIMA 4HXJA 2O9SA 3FB9A 3HRTA 2P0QA 1MUZA 1YJ9Q 4F7UF 3HFOA 2F2XA 1NEBA 1UHFA 5IXBA 1WDXA 1QCOA 2CP5A 5KCOA 4OMOA 1VQNQ 5DLOA 3OS5A 3JCMd 4F17A 4ESRA 4Q5WA 4F04B 1W2BS 2LT4A 2M16A 3A8OB 3CCVQ 1FMWA 4II1A 2GFAA 4LUDA 3OYNA 4BUGA 2LJ1A 1J3TA 5FU7B 4Z02A 2GFUA 3LW5E 2QTVA 2L3QA 2MCNA 7AT1B 4ATOA 3CCQT 4XTUA 2K3XA 2XG8D 2LNVA 2HEQA 3VYGA 1K9MR 2E6NA 2W10A 1Q86R 1GBQA 5HK0A 4M7DG 2DF6A 4OB0B 4FYXB 1LJOA 2OI3A 3DLLA 2RI3A 1LPLA 2JM8A 1GRIA 1AWXA 2MYSA 2K5IA 4E7KA 3M4GA 5A0DA 3CEYA 2DX1A 3CMAA 3RIRA 4XTWA 2V8JA 2K7AA 1SRMA 3M53A 2XMFA 2C0IA 1M9SA 2X35A 1OX9A 4JLIA 1VQMA 1BI2A 4C92A 1EX4A 4X9CA 2QQBA 4IUVA 5CKHA 2QEXA 1QVFS 2JTEA 4OF1A 1JBMA 2O4XA 1FXXA 1QVPA 4FYYB 2BE9B 3OB9A 1SPKA 3VS5A 1SEMA 4Z8AA 3M4YA 1D3BB 3R6OA 4WF2A 2RD1A 3EH2A 4YTLA 3JAME 3J80E 1JRIA 2YRDA 1PNJA 2YUOA 2RK2A 1K8AR 2YWWA 4RTZA 1W70A 4LDWA 1RI9A 3S3NA 4C92B 3VS7A 1X2KA 3MEUA 2QA4T 5KE2A 2QEXT 2JMCA 2E5QA 3VS3A 4DBHA 4PJJA 3UT1A 3TEEA 4PJLA 1WHGA 4JRIA 4MDWA 1M27C 2EQIA 3REAB 4IUUA 2JW4A 4C0DC 3G6EQ 2GGRA 1VQ7T 5FRNA 5I22A 3EG9B 4IKFA 2KYMA 1H8KA 3PE0A 2K79A 2AZSA 2NUZA 2QASA 2D8HA 5DM7R 2WSCE 2RQRA 5GMKl 4M75F 2IVWA 1ZX6A 3L1AA 2E6ZA 2FZKB 1W2BP 2CZ1B 2OAUA 4NL2A 3OYEA 3MJXA 4M77B 1JQQA 3OYGA 3WVDB 1VUBA 1UEBA 2PVDB 2CYZB 1TUGB 2K9GA 1Q86C 5GAOp 1SHFA 4ORZA 1BCOA 2HL3A 4LUEA 4E7LA 3CCJA 2ZPEB 4PFOA 1ZLMA 1IXDA 1FMVA 2BE7D 4IUTA 4KH1B 3JCMQ 2FL7A 5D6XA 1G3YA 3CPWP 3CXCP 1YIJA 2J06A 3VRYA 4M78G 5GAOm 2F2WA 5C6SA 5HK3A 1U3OA 3HSBA 3OYBA 3JCMb 2HSEB 1TUCA 4RTTA 3X26B 1MMGA 1FX7A 2X51A 1PWTA 3VS6A 1YP5A 1VQMQ 4LE9A 2RNAA 4GLMA 4DOVA 2OTLT 1HXDA 1VQ6A 4OMFB 4M77F 3CMAQ 1WJSA 1VQOQ 1Q81C 1N8RU 1KC8U 1XQHA 4BDYA 1V1CA 4DBRA 3UDCA 1K8AC 1EFNA 1M3AA 4RTVA 2RHIA 3V8LA 1KQSS 3TVTA 3JCMc 1K0XA 4M4ZA 2LX9A 1PD0A 2A08A 4C5GA 5GAMd 4OMLA 3CD6A 2PNIA 4RTWA 2DPPB 4LD6A 1ZBJA 3RESA 3CCVA 3UA7A 4C8QA 4BACA 2C06A 1NLPC 5GAMf 2EQJA 4A4KA 3ME9A 3BE3A 2A7YA 2QG9B 1M1FA 1VQ9Q 2LJ3A 4C8QE 4QVCA 3RKYA 2E65A 2HL5C 3S6WA 4C92E 1VQ9A 2NUTB 2DKGA 1VQNA 2M02A 3G1JA 2CREA 3G7ZA 2CUDA 3P8DA 2PVGB 3C95A 3OYKA 2K2MA 1BCMA 2M1HA 5AT1B 2KNBB 1I81A 4XU3A 5GAN8 3CCUT 1Y7XA 4C92C 3CCJT 3HHTB 4M77C 2EYXA 2CUBA 4MZPA 3C4SA 4FL6A 2SEMA 3I9QA 3CCVT 2ZPGB 4PJOF 1ZSZB 1Q82C 1VQ4Q 2H3EB 3QZ5B 5LJ3g 2KY9A 5KYXA 4M7DB 2DZ9A 3UATA 8ATCB 1Z9ZA 1WXBA 2ZPHB 5D7UA 3OYYA 4FW2A 2CZ7B 4FSSA 3CCMA 2O4XB 2HQEA 2K57A 2BUDA 5IHNA 4M75D 3JCMJ 4JLGA 4ZN1A 4C5IA 1YJNT 3M57A 3KXTA 1ABQA 1X6BA 3HRSA 4C5HA 3OW2S 1RAEB 4JPBW 5IAYA 2CT4A 4J5YA 1Q81R 3UA6A 3EG3A 5J39A 4J7IA 2RQVA 3MP1A 1UUEA 2FO0A 2EWNA 4IIOA 2NUPA 3Q1JA 4FW1A 1OZ3A 4AG1C 2WSFE 4X9DA 1TS9A 1M2OA 1PC0A 5AYFA 3NGPA 3LX7A 5LJ3j 2CZ6B 2RH2A 1VIFA 4M7DE 4BY6B 2LMJA 3LWIA 3A8HB 3JCMh 2ZCFB 2L0AA 4BI4A 1VQ4T 1UHCA 4E6RA 2KK4A 2QDLA 3PT9A 1D3BA 2A37A 4OMNA 3CCSA 2J05A 3V8KA 3TSWA 1V76A 2QGGA 2VWFA 2P0PA 4BB7A 2D0QB 3E9FA 5LJ5j 3EGUA 4GY5A 2GF7A 3QXEB 3A5ZB 3M55A 4M77E 1JEGA 1QLYA 2RI5A 2FVUA 2HMAA 4BD3A 1VQLQ 1T3LA 1T0HA 2YLCA 2JVVA 1S1NA 3T9NA 3GBQA 2K5LA 2Y4YA 2LP5A 5LJ5e 4M77A 3FIFA 2JN0A 2A36A 3V8JA 1K73C 1BKBA 3QPHA 1PKTA 3JCMP 5GAOn 1I0CA 1VYTA 2JUFA 3EG9A 1S72T 4BE0A 2OTJT 1QKXA 4K11A 2WACA 3L2VA 1ARKA 2O31A 2E12A 2O01E 1VIEA 4BI8B 1FMKA 3M0UA 5DLQE 1BBZA 3E19A 5CKDA 3G4SA 2O2OA 4C8QC 2YHTA 1RAHB 4J83A 3VYHB 2E4HA 1OV3A 4R0KA 2F5KA 2MIOA 3JCMX 1O9SA 5CIUA 2ZPFB 3DB4A 4M78F 2K6DA 1MNDA 3J7AF 1K8AU 4A63B 5GMKi 1M30A 2J6FA 4RUGA 4TVRA 1QWFA 4NL3A 1QVGA 4M7AA 1LCKA 1OQKA 4QVDA 1BIBA 4EPCA 2AIRB 5KCHA 2V8IA 1MGQA 4ZNXA 5GANf 1ZUUA 5CKFA 2BZXA 4PJOD 5FU6C 2RHYA 2AZVA 4DQ2A 2EPDA 2MF2A 1X69A 2M9UA 2FG0A 4QQGA 4M7DD 3O5ZA 3VUBA 1KC8R 1N8RR 1GCPA 1JXOA 2KAFA 4LDVA 4KULA 3L2WA 4KUIA 4CRIA 3V7SA 1Q7YC 1AWWA 3AHUA 3G6EA 2PZ1A 2F69A 1QP2A 2PU9B 1OYXA 4KGVB 1W2BA 1YITT 2JS2A 3SFMA 2CP0A 4J9GA 3M0TA 5GANj 1X6OA 3OMGA 1QCFA 4JUVA 3CBPA 1E7OA 3H0IA 4M7DA 2SRCA 2H8HA 1U5SA 3BDLA 2K5FA 2IG0A 2C0TA 3NTIA 2JS0A 4UC4A 1LVKA 5GAMj 4GBQA 3A8LB 3HKSA 4PJOA 3I35A 4J8OA 1HSQA 4C8QB 2VASA 1IGUA 1D0XA 2MWOA 2R57A 4N0AA 3CC4Q 2RQWA 2KRNA 1ZSZC 4F16A 1C6VX 1O75A 2RA2A 5IN1A 1MMAA 4MZTA 4C92G 1GCQA 1T3SA 2EIFA 1N27A 1M90R 3G71Q 3O8VA 5GAMh 3H8ZA 2PUKB 3UF4A 2DAQA 3SWNA 2EKHA 3CXCS 1NLOC 1R77A 2MWPA 2YUQA 2LJ0A 3OYFA 1QQJA 1PSFA 4F7UA 2EQKA 2DLPA 2RJFA 2EJ9A 2QEXQ
chains in the Genus database with same CATH topology
1C0MA 1IHVA 1C1AA 1QMCA 5D7UA 1EX4A 1C6VX 4FW1A 4FW2A 1IHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0M A;  1IHV A;  1C1A A;  1QMC A;  5D7U A;  1EX4 A;  1C6V X;  4FW1 A;  4FW2 A;  1IHW A; 
#chains in the Genus database with same CATH topology
 3H6Z A;  3SB2 A;  4L5G A;  4Z89 A;  1I4K 1;  3CBM A;  1QP3 A;  2DL3 A;  2MMP A;  4PFZ A;  2KSS A;  2X3X D;  3PIP A;  1C1A A;  3MP6 A;  2OJ2 A;  1KQ1 A;  4ZGD B;  3EFS A;  1I07 A;  3BDU A;  2OTL Q;  1SG5 A;  5CQY A;  3I56 A;  3NMZ C;  3V7R A;  4RCB A;  1RAA B;  4AFQ C;  2VXE A;  4RTY A;  2LRQ A;  4OMP A;  1FYN A;  1NJI C;  2MPX C;  2KMT A;  3CC2 A;  4HVV A;  4PL6 A;  4DA4 A;  1MV0 B;  2OAW A;  2R58 A;  4ZTJ A;  3A1P A;  4RG8 A;  3KFV A;  1UEC A;  5CR2 A;  4OGC A;  1V29 B;  3L2R A;  2L89 A;  1M3C A;  1AD5 A;  3CBO A;  3VV0 A;  2HBW A;  4PLL A;  4MML A;  2LCL A;  3A8M B;  4BE1 A;  2L2P A;  2EQM A;  2XIC A;  2PQW A;  2KE9 A;  1X27 A;  1ZBX A;  4RTU A;  1GCQ C;  2MK5 A;  2XU8 A;  1AT1 B;  5I11 A;  2COZ A;  1QCN A;  3BY7 A;  2DXC A;  2YLB A;  3RDV A;  4A4E A;  1WFW A;  3ASK A;  1WLP B;  1IHV A;  4M78 A;  4M7D F;  4JRQ A;  3QHS A;  3G6E T;  3NTK A;  1R8O B;  3VS1 A;  3EG1 A;  1DJ7 B;  2KRO A;  1ACM B;  3OSS C;  4XTX A;  1YJW T;  3JB9 G;  2ED1 A;  2HNI A;  2DVJ A;  3VS0 A;  4AFU C;  2CT3 A;  4OB1 B;  5LJ5 d;  3OS1 A;  1JO8 A;  3LLR A;  4OGE A;  2CP7 A;  5GAO q;  4EMH A;  1K0S A;  3EFO A;  4XTZ A;  3X20 B;  3RUX A;  2DL4 A;  3MEW A;  1K73 U;  1GFD A;  5GAN 3;  4PK4 A;  4PJM A;  4N4G A;  2RN8 A;  4LXC A;  1RAD B;  3J81 E;  3U23 A;  1Q95 G;  2DVE A;  1N6A A;  5GAN 4;  5J26 A;  2D1X A;  1UGQ B;  5GAN h;  3KBG A;  1YJ9 T;  2RPN A;  2DXB A;  2H3J A;  1MMN A;  4WTO B;  1XJW B;  1QVG P;  2ZGW A;  2QA4 A;  1VQP T;  4E47 A;  2OTL A;  1YIJ Q;  1NJI R;  2RMO A;  1BYM A;  2G3R A;  3QBY A;  2YRC A;  4HKE A;  1XNI A;  4FCY A;  1W4S A;  2LQK A;  3JCM g;  1Y57 A;  4GLK A;  4BE2 A;  1JXM A;  1B7T A;  4M7A C;  5KYN A;  4PFP A;  3MO8 A;  1SSF A;  4J6W A;  3OW2 A;  1YJN A;  3MHX A;  1D0Y A;  1D0Z A;  4Z88 A;  2V1R A;  1YHQ Q;  1K9M U;  5GAM g;  2F1L A;  2O88 A;  3SDZ A;  4XAX B;  1BU1 A;  1VQK T;  1UTI A;  1G8X A;  2CGH A;  3WXM B;  1BI3 A;  3OYM A;  5LJ5 h;  5L23 A;  4AG2 C;  3CXC A;  1SF9 A;  1H64 1;  2EYW A;  2O9V A;  2JMA A;  3VS2 A;  2ZAE A;  3OY9 A;  2DZC A;  5GMK m;  1SHG A;  1C0M A;  5GAN 6;  1NPR A;  2GBQ A;  1YIT A;  2MI6 A;  4LNP A;  1RLQ C;  2KGT A;  1BK2 A;  2EGA A;  4QW2 A;  1VQN T;  5KYX B;  1T0J A;  2DYB A;  2QI2 A;  1ZHI A;  1U8R A;  2D8J A;  2P0K A;  4ZTF A;  4C92 D;  2QTX A;  3LH5 A;  3CCS T;  1RAF B;  4CC4 B;  3N5B B;  1YFN A;  5LJ3 d;  2CSI A;  1WHH A;  2VC8 A;  2EBP A;  4Y91 A;  4X1V A;  1D1A A;  2B8A A;  1YJN Q;  1R0B G;  5FW9 A;  3VUZ A;  2FYK A;  1NBE B;  2DEQ A;  2L3R A;  3EG0 A;  1ZA2 B;  4HA8 A;  4PNO A;  3MP8 A;  1RI0 A;  1X2Q A;  5GAN d;  1WZO A;  4J9E A;  1X01 A;  5ECA A;  3FC3 A;  2ZPB B;  1VQK Q;  4BI3 A;  2VUB A;  3QJY A;  5I21 A;  2DIQ A;  1YHQ A;  2RJD A;  4N4I A;  2BTT A;  3H41 A;  1QW1 A;  4J9B A;  1GFC A;  3HP9 A;  2E5K A;  4C0Z A;  3BFM A;  3EHR A;  4M78 B;  4RTX A;  1D09 B;  2CSQ A;  1IRE B;  1MV3 A;  3NPF A;  1U06 A;  2Y4X A;  2D0N A;  5FWC A;  5EC7 A;  1RAB B;  2F2V A;  2RO0 A;  3JRZ A;  1Q82 R;  2DEU A;  5FWB A;  1LNX A;  2EFI A;  4OMQ A;  4JZ3 A;  3QDF A;  4QT7 A;  4XTY A;  4C0G A;  5A0L A;  1UJ0 A;  2HD0 A;  4KGX B;  2NYS A;  4F14 A;  3CQT A;  2K4Y A;  1AOJ A;  5GAN e;  5GAM e;  3M59 A;  3GOX A;  2DMO A;  4DBQ A;  2LC4 A;  3CC2 T;  3QWX X;  2CDT A;  1TOV A;  3TCJ A;  2V8K A;  2YUP A;  2DXU A;  1H3Z A;  2RB6 A;  3C94 A;  4D8K A;  3JB9 F;  1YNZ A;  3CCR A;  2AK5 A;  2PVO B;  4CC3 A;  3QJ6 A;  1Y71 A;  4J9F A;  4M75 G;  5CKB A;  3ZBD A;  3EGX A;  1OU8 A;  4M7A B;  2L8D A;  2NUP B;  3TU4 K;  3RMQ A;  1U1S A;  3M0S A;  4ELY C;  4JRK A;  1VA7 A;  2QK0 A;  2KYB A;  3C0C A;  1YJ9 A;  3INZ A;  1GXI E;  1VQ7 A;  2K3Y A;  2JT4 A;  2FB7 A;  2KRM A;  2M51 A;  1P92 A;  2EYQ A;  2DM1 A;  2MAM A;  3HTR A;  5FU6 B;  2LQW A;  1PSE A;  3EGD A;  4EMK A;  3CCE Q;  4ZN3 A;  4M7A G;  2IIM A;  2HKN A;  2VYT A;  3LYI A;  4JDS A;  1YJW Q;  1SKU B;  4CC7 A;  4DOW A;  4RCC A;  2ROT A;  1UGS B;  4C5E A;  3CCS Q;  4QKU A;  1KIK A;  4QVZ A;  1QWE A;  1IB8 A;  4A4F A;  1NM7 A;  1I5L A;  2DBM A;  2E70 A;  3V7C A;  1CSK A;  3VJP A;  4AT1 B;  2LNH B;  2DRK A;  4R56 A;  2RHZ A;  5L8R E;  3CPW S;  3M54 A;  3EHQ A;  2V26 A;  4C8Q G;  1WJR A;  3M9Q A;  1WPY A;  3AT1 B;  3JSC A;  2QDY B;  1VQ8 Q;  3M58 A;  2EJG A;  2K2V A;  2XI9 A;  3CMA T;  3E2U A;  1VQ6 T;  2VGN A;  1VQP A;  1YWO A;  4J9I A;  1VQ8 A;  3CCM T;  5A0G A;  3I55 T;  3TRE A;  3PVQ A;  1NYF A;  3JCM e;  4L6V 5;  1RAI B;  5GJV B;  2KBT A;  4M75 B;  4CI0 C;  4IUR A;  4PLI A;  2DE0 X;  2COY A;  4J6X A;  3ZFJ A;  2J6O A;  4A54 A;  5IT9 E;  1RAC B;  1IO6 A;  3JCM V;  1N9S A;  1UGR B;  2EGC A;  3LGL A;  4B9W A;  5FRM A;  4LDY A;  3P8B B;  4LDX A;  4D6W A;  4M78 C;  5C0M A;  5LJ3 f;  5LJ3 e;  2C0O A;  1AEY A;  1M2V A;  3I56 T;  1W1F A;  2QGF B;  2YDL A;  4JJC A;  1AVZ C;  3FJ5 A;  3GF5 A;  1XOV A;  4AFS C;  3CC4 A;  3M0Q A;  2X9H A;  1EIF A;  3EG2 A;  2DFU A;  3CCE A;  1G3S A;  5EG2 A;  1AWO A;  3PTA A;  2KQW A;  2LDM A;  5KYW A;  1M5Q 1;  3UWN A;  3PMI A;  3OYA A;  3P8H A;  2XDD A;  1VQ7 Q;  2PUO B;  2EYZ A;  3EAE A;  1JJ2 P;  2HDA A;  2BIV A;  3CCR Q;  1X43 A;  2HKQ B;  2I0N A;  2ABL A;  4X34 A;  1WYX A;  3HFN A;  4C8Q D;  1B3Q A;  1B34 B;  1E6G A;  1BI1 A;  1KD1 C;  3HRU A;  3CCL A;  1WA7 A;  5KYU A;  3CC7 Q;  2P4R A;  3L2U A;  1YCY A;  1BIA A;  2QQR A;  1B07 A;  1G2B A;  2KRS A;  3CCQ Q;  3VRZ A;  1M4Z A;  3FLG A;  1QVF A;  2YRV A;  5HCK A;  2X4Y A;  2YT6 A;  5FRO A;  4JS4 A;  4WCI A;  1UJY A;  5KE3 A;  2CS7 A;  2FRY A;  2FPE A;  3RBB B;  4JJD A;  2ATC B;  3CPW A;  2LQ8 A;  1Q82 U;  1LOJ A;  2XK0 A;  3I55 A;  4FYW B;  1NJI U;  5M9O A;  5FU7 C;  3CME A;  2PTK A;  2RK1 A;  3CCR T;  4C0F A;  3OYD A;  3CME Q;  2HZY A;  3G4S Q;  4MZM A;  2HCK A;  4AFZ C;  3EGD B;  3H0F A;  4HT8 A;  4PJO B;  1N5Z A;  1D1C A;  5HY6 A;  1EZZ B;  2LCS A;  1NPP A;  2JZ2 A;  1WJQ A;  1OU9 A;  2DER A;  3I5R A;  3RER A;  4XU2 A;  1Y0M A;  5CCA A;  2EW3 A;  3BW1 A;  3MEA A;  4B9X A;  1QVF P;  4M7D C;  1AZE A;  3OSV A;  1KQS A;  3EGX B;  2RHU A;  3QWY A;  5D6Y A;  4ANJ A;  1OEB A;  3GP8 A;  4NS5 A;  3LWH A;  1BI0 A;  5GMK j;  1IHW A;  4ME7 A;  2VKN A;  5KYW B;  2VVK A;  1RLP C;  1K9A A;  2QQS A;  1UGP B;  1Y96 A;  5GJW B;  3SWN B;  4FT2 A;  3HPW A;  2JNG A;  1G5V A;  1YIT Q;  1YN8 A;  5FLX E;  3OA6 A;  4J7F A;  5GAN 7;  3QSU A;  1WX6 A;  2EQU A;  5GAN 5;  4M7A D;  2DTH A;  4QQD A;  1HD3 A;  3M5A A;  2DO3 A;  4D8D A;  2OX7 A;  4HVW A;  3E1S A;  3WVE B;  3JB9 J;  3X25 B;  3QDR B;  3DKM A;  1TH7 A;  1OX8 A;  3L2Q A;  4P5N A;  5GAO l;  3QG1 A;  1YI2 A;  1WHL A;  3JCM f;  3EH1 A;  3UPU A;  1HJD A;  4PJO E;  4EDU A;  1G3T A;  2D6F A;  4E2F B;  4XK8 E;  1M1K U;  2KVQ G;  4JZ4 A;  1YI2 T;  5CO7 A;  1M8V A;  2A0F B;  5LJ3 h;  2EJF A;  1PKS A;  1KSW A;  3RNJ A;  3SEM A;  2CP2 A;  2LVM A;  3URG A;  1QVG S;  3LGF A;  4KH0 B;  2DA9 A;  3FEO A;  2V1Q A;  3H0H A;  2KT8 A;  3EFO B;  4F7U E;  1KQ2 A;  3X28 B;  4C92 F;  4HCZ A;  2XDB A;  1K4U S;  1VOM A;  3X24 B;  2D9T A;  2RQU A;  3FRN A;  4M77 D;  3QYG B;  2AKK A;  4JJB A;  4LD9 K;  2ED0 A;  2DD4 A;  1TSF A;  4HCK A;  1TXQ A;  1U1T A;  4M75 C;  4EMK C;  3TSZ A;  1SSH A;  1ZUY A;  1VQ4 A;  8AT1 B;  3KUF A;  1TUD A;  1ZA1 B;  4PJO G;  3G4S T;  2KXC A;  2HSP A;  1YCS B;  1MNE A;  2A3L A;  1WQ7 A;  5KYY B;  2HQH A;  4OVA A;  2JXB A;  1R0C B;  2FPD A;  4IUQ A;  3L2Z A;  3MPU B;  2DK3 A;  4LN2 A;  1KC8 C;  1N8R C;  1TWB A;  1YBY A;  1ZUK A;  1YJW A;  1I5O B;  2LZ6 B;  1K76 A;  1WIE A;  2CH4 A;  5LL6 S;  3VS4 A;  1VQL T;  3ZEH A;  1VQ5 Q;  1FWZ A;  1M2V B;  2LT1 A;  3HL8 A;  3RKX A;  1M8M A;  2ENM A;  9ATC B;  3M56 A;  3CCE T;  2L3P A;  2JOY A;  1K73 R;  1OUL A;  4F7U G;  4M7A F;  5CK9 A;  4EIK A;  2ESW A;  2R5M A;  3M0R A;  1YHQ T;  2CP3 A;  3CD6 Q;  2E10 A;  2JM9 A;  1VQ5 A;  5A2Q E;  4M78 E;  2GTJ A;  2FZG B;  4XQ3 A;  1OOT A;  3OBY A;  3ULR B;  2DET A;  4HVU A;  2QAZ A;  3CC7 T;  1NZ9 A;  5LJ5 g;  1HK9 A;  2JJ9 A;  3CD6 T;  4J9C A;  2W0Z A;  1KD1 R;  4ZGJ B;  3SD4 A;  5CAI A;  1F1B B;  3JB9 H;  1RUW A;  4C8Q F;  1G83 A;  2WSE E;  3G71 T;  1NYG A;  2GQV A;  5CVI A;  2KXD A;  3E9G A;  5I2S A;  1VQ6 Q;  1Q81 U;  4J9D A;  4M77 G;  3F70 A;  2GNC A;  2LQN A;  1Q86 U;  3L42 A;  4OP0 A;  2NUT A;  2HAX A;  4ELZ C;  3I56 Q;  1VQO T;  1WHM A;  3MET A;  2FHD A;  1PD1 A;  4RKU E;  3TQ7 P;  5KH6 A;  3OYH A;  1K9M C;  2BKD N;  4AMC A;  2JTM A;  2NLU A;  4E7S A;  2XDP A;  2HBP A;  2P4T A;  1YWP A;  4M75 E;  1VQK A;  1AHJ B;  1OZ2 A;  2DNU A;  3G71 A;  5IHI A;  2YSQ A;  3A98 A;  4J6Y A;  1BB9 A;  3JV3 A;  2RHX A;  1HYO A;  1PRM C;  2CP6 A;  1PG5 B;  2EAY A;  3CCJ Q;  2XID A;  3JB9 I;  1KQS P;  2DL8 A;  1KK7 A;  1TU0 B;  5KYU B;  4F7U B;  2FRW A;  4O5V A;  3OYC A;  1WXT A;  5HKC A;  5J3B A;  5IH2 A;  3GLX A;  4L59 A;  2BZY A;  3RR6 A;  1VQM T;  1Y07 A;  1Y96 B;  1ABO A;  3A8G B;  1M90 C;  3ER0 A;  4BDZ A;  3OS2 A;  2RF0 A;  3M0P A;  2DIG A;  1QKW A;  2RM4 A;  2VXF A;  3RKW A;  1VQ9 T;  1KFZ A;  1VQ5 T;  1UG1 A;  1H92 A;  2EKO A;  1PHT A;  4IUP A;  3THK A;  3MEV A;  1IGQ A;  2E41 A;  3CME T;  2G6F X;  4XTV A;  4VUB A;  2DL7 A;  4FSX A;  5I2M A;  1M90 U;  1CKB A;  2GTO A;  2DJQ A;  1WHJ A;  1JU5 C;  2X4J A;  4V2S A;  1H3H A;  3OYJ A;  4OMM A;  4ZGE B;  2DL5 A;  2DRM A;  2P84 A;  1VYV A;  2RI2 A;  5GMK e;  3OQ5 A;  3H9N A;  1WXU A;  3JCM W;  4PKC C;  2FEI A;  4HCC A;  1GL5 A;  4E7J A;  2VV5 A;  2ZZD A;  3NHN A;  1WI7 A;  4E7I A;  3CCU Q;  2DTI A;  4KUD K;  5GAN 2;  4A4G A;  3S3M A;  4A4H A;  1OPK A;  4O6J A;  2DD5 A;  2ECZ A;  1TTH B;  2KEA A;  2KI7 A;  1AZG B;  3RMS A;  2E3H A;  2B86 A;  2XHC A;  3R6N A;  1A0N B;  2QYZ A;  4DEY A;  1M3B A;  4M7A E;  3IQL A;  2KT1 A;  1S72 A;  2OTJ A;  1M1K R;  3SWN C;  1VQO A;  4LDU A;  3OW2 P;  2M0Y A;  3D7S B;  3I55 Q;  1OPL A;  4RMO A;  5CKE A;  3VU3 C;  1MHN A;  1Q7Y R;  3VKI A;  2I2L A;  4KRT A;  1S72 Q;  2QQ9 A;  2OTJ Q;  1M1K C;  1YIJ T;  1ZQ1 A;  4DEX A;  3EFR A;  2AKL A;  1D1B A;  4C0D B;  3NFC A;  4HT9 A;  4N0A C;  2AT1 B;  4BY6 C;  2E1H A;  1CKA A;  1NE8 A;  2YUN A;  4R55 A;  4MMK A;  4PJO C;  1PRL C;  4KGZ B;  1KG1 A;  3FJP A;  2HQX A;  2DYI A;  2VB6 A;  4A53 A;  2DTO A;  4Y92 A;  3PGG A;  2XD0 A;  4HCB A;  3CCQ A;  2IPO B;  2RJC A;  2XKO C;  4FU6 A;  1I8F A;  3DB3 A;  1AWJ A;  3CCU A;  1WGS A;  1JJ2 A;  3DLM A;  4N4H A;  1KJW A;  3CC7 A;  3QUI A;  3CCL Q;  3QKJ A;  3C12 A;  4KT0 E;  2X3W D;  2K3B A;  2ROL A;  4PJN A;  3PFS A;  2CH4 W;  5CQX A;  1XTD A;  3PNW C;  4MDX A;  4JS5 A;  1TG0 A;  1G3W A;  1PCX A;  2RQT A;  1WNL A;  1GBR A;  4QQ6 A;  1UDL A;  2L3S A;  3I5S A;  3JB9 D;  4OB3 B;  5LJ5 f;  2DXT A;  2NWM A;  1VQL A;  1X6G A;  4JJN K;  3OYI A;  2X4X A;  4J9H A;  4CC2 A;  1W6X A;  3NTH A;  2J6K A;  4EMK B;  2JTF A;  3OS0 A;  4KBM B;  4FT4 A;  2EGE A;  1QMC A;  2Y90 A;  2LTO A;  3MKD A;  4JRP A;  4FM4 B;  1IRX A;  2EVR A;  1KHC A;  1X75 C;  4Y28 E;  5IHK A;  5GAN g;  5GAO r;  1JB0 E;  2KR3 A;  3CCL T;  3PMT A;  1KHI A;  2QQA A;  3MCA B;  1Z9Q A;  2A28 A;  1UE9 A;  2R5A A;  2YXY A;  3OYL A;  5IXF A;  1SRL A;  2M0O A;  1KD1 U;  3GIB A;  4FIB A;  1UB4 A;  2QA4 Q;  3CC2 Q;  3REB B;  2FPF A;  2DJZ A;  4OB2 B;  1VQP Q;  4E7H A;  6AT1 B;  1PM3 A;  2Z0W A;  2RJE A;  5KYY A;  4M78 D;  1ZSG A;  5GMK h;  1NG2 A;  1OI1 A;  2X4W A;  1NEG A;  2KDS A;  3CC4 T;  2DBK A;  1WQW A;  2LX7 A;  3ZL7 C;  4M75 A;  2QXF A;  3OBW A;  1N9R A;  5DY9 A;  3GNF B;  2CKK A;  4FYV B;  1K1Z A;  1UFF A;  1ZSZ A;  4E7Z A;  3GPL A;  2GQI A;  3QO3 A;  2MOX A;  1JJ2 S;  1Q7Y U;  1IZ6 A;  3QZ9 B;  1UGV A;  1I1J A;  1VYU A;  2VGM A;  3CCM Q;  1RL2 A;  3SHW A;  1MMD A;  3S3O A;  1YI2 Q;  3PVL A;  1WHK A;  3CPF A;  2L5Q A;  2J7I A;  5D6W A;  2EYY A;  3LH0 A;  2DIL A;  2ZPI B;  2AHJ B;  2LCC A;  2FZC B;  2BZ8 A;  3QII A;  2GCX A;  1M1G A;  3PIO A;  1VQ8 T;  2COW A;  4XU1 A;  1B34 A;  1RAG B;  4XU0 A;  3OMC A;  3FDR A;  2F5T X;  4EMG A;  3QYH B;  4RG2 A;  4B6M A;  2E3I A;  1E6H A;  4DBF A;  2CZ0 B;  2E64 A;  4NOY A;  3GNG A;  4IIM A;  4HXJ A;  2O9S A;  3FB9 A;  3HRT A;  2P0Q A;  1MUZ A;  1YJ9 Q;  4F7U F;  3HFO A;  2F2X A;  1NEB A;  1UHF A;  5IXB A;  1WDX A;  1QCO A;  2CP5 A;  5KCO A;  4OMO A;  1VQN Q;  5DLO A;  3OS5 A;  3JCM d;  4F17 A;  4ESR A;  4Q5W A;  4F04 B;  1W2B S;  2LT4 A;  2M16 A;  3A8O B;  3CCV Q;  1FMW A;  4II1 A;  2GFA A;  4LUD A;  3OYN A;  4BUG A;  2LJ1 A;  1J3T A;  5FU7 B;  4Z02 A;  2GFU A;  3LW5 E;  2QTV A;  2L3Q A;  2MCN A;  7AT1 B;  4ATO A;  3CCQ T;  4XTU A;  2K3X A;  2XG8 D;  2LNV A;  2HEQ A;  3VYG A;  1K9M R;  2E6N A;  2W10 A;  1Q86 R;  1GBQ A;  5HK0 A;  4M7D G;  2DF6 A;  4OB0 B;  4FYX B;  1LJO A;  2OI3 A;  3DLL A;  2RI3 A;  1LPL A;  2JM8 A;  1GRI A;  1AWX A;  2MYS A;  2K5I A;  4E7K A;  3M4G A;  5A0D A;  3CEY A;  2DX1 A;  3CMA A;  3RIR A;  4XTW A;  2V8J A;  2K7A A;  1SRM A;  3M53 A;  2XMF A;  2C0I A;  1M9S A;  2X35 A;  1OX9 A;  4JLI A;  1VQM A;  1BI2 A;  4C92 A;  1EX4 A;  4X9C A;  2QQB A;  4IUV A;  5CKH A;  2QEX A;  1QVF S;  2JTE A;  4OF1 A;  1JBM A;  2O4X A;  1FXX A;  1QVP A;  4FYY B;  2BE9 B;  3OB9 A;  1SPK A;  3VS5 A;  1SEM A;  4Z8A A;  3M4Y A;  1D3B B;  3R6O A;  4WF2 A;  2RD1 A;  3EH2 A;  4YTL A;  3JAM E;  3J80 E;  1JRI A;  2YRD A;  1PNJ A;  2YUO A;  2RK2 A;  1K8A R;  2YWW A;  4RTZ A;  1W70 A;  4LDW A;  1RI9 A;  3S3N A;  4C92 B;  3VS7 A;  1X2K A;  3MEU A;  2QA4 T;  5KE2 A;  2QEX T;  2JMC A;  2E5Q A;  3VS3 A;  4DBH A;  4PJJ A;  3UT1 A;  3TEE A;  4PJL A;  1WHG A;  4JRI A;  4MDW A;  1M27 C;  2EQI A;  3REA B;  4IUU A;  2JW4 A;  4C0D C;  3G6E Q;  2GGR A;  1VQ7 T;  5FRN A;  5I22 A;  3EG9 B;  4IKF A;  2KYM A;  1H8K A;  3PE0 A;  2K79 A;  2AZS A;  2NUZ A;  2QAS A;  2D8H A;  5DM7 R;  2WSC E;  2RQR A;  5GMK l;  4M75 F;  2IVW A;  1ZX6 A;  3L1A A;  2E6Z A;  2FZK B;  1W2B P;  2CZ1 B;  2OAU A;  4NL2 A;  3OYE A;  3MJX A;  4M77 B;  1JQQ A;  3OYG A;  3WVD B;  1VUB A;  1UEB A;  2PVD B;  2CYZ B;  1TUG B;  2K9G A;  1Q86 C;  5GAO p;  1SHF A;  4ORZ A;  1BCO A;  2HL3 A;  4LUE A;  4E7L A;  3CCJ A;  2ZPE B;  4PFO A;  1ZLM A;  1IXD A;  1FMV A;  2BE7 D;  4IUT A;  4KH1 B;  3JCM Q;  2FL7 A;  5D6X A;  1G3Y A;  3CPW P;  3CXC P;  1YIJ A;  2J06 A;  3VRY A;  4M78 G;  5GAO m;  2F2W A;  5C6S A;  5HK3 A;  1U3O A;  3HSB A;  3OYB A;  3JCM b;  2HSE B;  1TUC A;  4RTT A;  3X26 B;  1MMG A;  1FX7 A;  2X51 A;  1PWT A;  3VS6 A;  1YP5 A;  1VQM Q;  4LE9 A;  2RNA A;  4GLM A;  4DOV A;  2OTL T;  1HXD A;  1VQ6 A;  4OMF B;  4M77 F;  3CMA Q;  1WJS A;  1VQO Q;  1Q81 C;  1N8R U;  1KC8 U;  1XQH A;  4BDY A;  1V1C A;  4DBR A;  3UDC A;  1K8A C;  1EFN A;  1M3A A;  4RTV A;  2RHI A;  3V8L A;  1KQS S;  3TVT A;  3JCM c;  1K0X A;  4M4Z A;  2LX9 A;  1PD0 A;  2A08 A;  4C5G A;  5GAM d;  4OML A;  3CD6 A;  2PNI A;  4RTW A;  2DPP B;  4LD6 A;  1ZBJ A;  3RES A;  3CCV A;  3UA7 A;  4C8Q A;  4BAC A;  2C06 A;  1NLP C;  5GAM f;  2EQJ A;  4A4K A;  3ME9 A;  3BE3 A;  2A7Y A;  2QG9 B;  1M1F A;  1VQ9 Q;  2LJ3 A;  4C8Q E;  4QVC A;  3RKY A;  2E65 A;  2HL5 C;  3S6W A;  4C92 E;  1VQ9 A;  2NUT B;  2DKG A;  1VQN A;  2M02 A;  3G1J A;  2CRE A;  3G7Z A;  2CUD A;  3P8D A;  2PVG B;  3C95 A;  3OYK A;  2K2M A;  1BCM A;  2M1H A;  5AT1 B;  2KNB B;  1I81 A;  4XU3 A;  5GAN 8;  3CCU T;  1Y7X A;  4C92 C;  3CCJ T;  3HHT B;  4M77 C;  2EYX A;  2CUB A;  4MZP A;  3C4S A;  4FL6 A;  2SEM A;  3I9Q A;  3CCV T;  2ZPG B;  4PJO F;  1ZSZ B;  1Q82 C;  1VQ4 Q;  2H3E B;  3QZ5 B;  5LJ3 g;  2KY9 A;  5KYX A;  4M7D B;  2DZ9 A;  3UAT A;  8ATC B;  1Z9Z A;  1WXB A;  2ZPH B;  5D7U A;  3OYY A;  4FW2 A;  2CZ7 B;  4FSS A;  3CCM A;  2O4X B;  2HQE A;  2K57 A;  2BUD A;  5IHN A;  4M75 D;  3JCM J;  4JLG A;  4ZN1 A;  4C5I A;  1YJN T;  3M57 A;  3KXT A;  1ABQ A;  1X6B A;  3HRS A;  4C5H A;  3OW2 S;  1RAE B;  4JPB W;  5IAY A;  2CT4 A;  4J5Y A;  1Q81 R;  3UA6 A;  3EG3 A;  5J39 A;  4J7I A;  2RQV A;  3MP1 A;  1UUE A;  2FO0 A;  2EWN A;  4IIO A;  2NUP A;  3Q1J A;  4FW1 A;  1OZ3 A;  4AG1 C;  2WSF E;  4X9D A;  1TS9 A;  1M2O A;  1PC0 A;  5AYF A;  3NGP A;  3LX7 A;  5LJ3 j;  2CZ6 B;  2RH2 A;  1VIF A;  4M7D E;  4BY6 B;  2LMJ A;  3LWI A;  3A8H B;  3JCM h;  2ZCF B;  2L0A A;  4BI4 A;  1VQ4 T;  1UHC A;  4E6R A;  2KK4 A;  2QDL A;  3PT9 A;  1D3B A;  2A37 A;  4OMN A;  3CCS A;  2J05 A;  3V8K A;  3TSW A;  1V76 A;  2QGG A;  2VWF A;  2P0P A;  4BB7 A;  2D0Q B;  3E9F A;  5LJ5 j;  3EGU A;  4GY5 A;  2GF7 A;  3QXE B;  3A5Z B;  3M55 A;  4M77 E;  1JEG A;  1QLY A;  2RI5 A;  2FVU A;  2HMA A;  4BD3 A;  1VQL Q;  1T3L A;  1T0H A;  2YLC A;  2JVV A;  1S1N A;  3T9N A;  3GBQ A;  2K5L A;  2Y4Y A;  2LP5 A;  5LJ5 e;  4M77 A;  3FIF A;  2JN0 A;  2A36 A;  3V8J A;  1K73 C;  1BKB A;  3QPH A;  1PKT A;  3JCM P;  5GAO n;  1I0C A;  1VYT A;  2JUF A;  3EG9 A;  1S72 T;  4BE0 A;  2OTJ T;  1QKX A;  4K11 A;  2WAC A;  3L2V A;  1ARK A;  2O31 A;  2E12 A;  2O01 E;  1VIE A;  4BI8 B;  1FMK A;  3M0U A;  5DLQ E;  1BBZ A;  3E19 A;  5CKD A;  3G4S A;  2O2O A;  4C8Q C;  2YHT A;  1RAH B;  4J83 A;  3VYH B;  2E4H A;  1OV3 A;  4R0K A;  2F5K A;  2MIO A;  3JCM X;  1O9S A;  5CIU A;  2ZPF B;  3DB4 A;  4M78 F;  2K6D A;  1MND A;  3J7A F;  1K8A U;  4A63 B;  5GMK i;  1M30 A;  2J6F A;  4RUG A;  4TVR A;  1QWF A;  4NL3 A;  1QVG A;  4M7A A;  1LCK A;  1OQK A;  4QVD A;  1BIB A;  4EPC A;  2AIR B;  5KCH A;  2V8I A;  1MGQ A;  4ZNX A;  5GAN f;  1ZUU A;  5CKF A;  2BZX A;  4PJO D;  5FU6 C;  2RHY A;  2AZV A;  4DQ2 A;  2EPD A;  2MF2 A;  1X69 A;  2M9U A;  2FG0 A;  4QQG A;  4M7D D;  3O5Z A;  3VUB A;  1KC8 R;  1N8R R;  1GCP A;  1JXO A;  2KAF A;  4LDV A;  4KUL A;  3L2W A;  4KUI A;  4CRI A;  3V7S A;  1Q7Y C;  1AWW A;  3AHU A;  3G6E A;  2PZ1 A;  2F69 A;  1QP2 A;  2PU9 B;  1OYX A;  4KGV B;  1W2B A;  1YIT T;  2JS2 A;  3SFM A;  2CP0 A;  4J9G A;  3M0T A;  5GAN j;  1X6O A;  3OMG A;  1QCF A;  4JUV A;  3CBP A;  1E7O A;  3H0I A;  4M7D A;  2SRC A;  2H8H A;  1U5S A;  3BDL A;  2K5F A;  2IG0 A;  2C0T A;  3NTI A;  2JS0 A;  4UC4 A;  1LVK A;  5GAM j;  4GBQ A;  3A8L B;  3HKS A;  4PJO A;  3I35 A;  4J8O A;  1HSQ A;  4C8Q B;  2VAS A;  1IGU A;  1D0X A;  2MWO A;  2R57 A;  4N0A A;  3CC4 Q;  2RQW A;  2KRN A;  1ZSZ C;  4F16 A;  1C6V X;  1O75 A;  2RA2 A;  5IN1 A;  1MMA A;  4MZT A;  4C92 G;  1GCQ A;  1T3S A;  2EIF A;  1N27 A;  1M90 R;  3G71 Q;  3O8V A;  5GAM h;  3H8Z A;  2PUK B;  3UF4 A;  2DAQ A;  3SWN A;  2EKH A;  3CXC S;  1NLO C;  1R77 A;  2MWP A;  2YUQ A;  2LJ0 A;  3OYF A;  1QQJ A;  1PSF A;  4F7U A;  2EQK A;  2DLP A;  2RJF A;  2EJ9 A;  2QEX Q; 
#chains in the Genus database with same CATH homology
 1C0M A;  1IHV A;  1C1A A;  1QMC A;  5D7U A;  1EX4 A;  1C6V X;  4FW1 A;  4FW2 A;  1IHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...