1QMCA

C-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HIV-1 INTEGRASE
publication title Refined Solution Structure of the C-Terminal DNA-Binding Domain of Human Immunovirus-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1qmcA00
4FW2A 5D7UA 4FW1A 1C0MA 1EX4A 1IHVA 1IHWA 1QMCA 1C1AA 1C6VX
chains in the Genus database with same CATH superfamily
3LH0A 3P8BB 2KRNA 1VQKQ 2EYXA 2FB7A 2E70A 1M8VA 4F7UB 2PNIA 2EGCA 1Y96B 3QDRB 3RIRA 2QQBA 1WHKA 2LDMA 5LJ3f 2JTMA 4JLIA 1M27C 3OQ5A 4ZGDB 3CBMA 3G71Q 2P0KA 1IRXA 5GMKi 1IHWA 4QT7A 1KQSP 2XHCA 5HK3A 1YJ9A 5ECAA 2DRMA 1WJQA 2XG8D 4E6RA 2KYMA 4OMNA 3QDFA 2YUOA 4PJOG 1IXDA 2CZ7B 5D6WA 3CQTA 1VQOT 2JUFA 2KNBB 1JO8A 1OULA 2LX9A 5IAYA 5D6YA 2OX7A 3KBGA 1BI0A 1WNLA 2PZ1A 3UWNA 3G1JA 4AG1C 2A7YA 2M51A 1TSFA 2LCCA 3E2UA 1BIBA 1VQ6Q 4J83A 3ULRB 2DERA 2DXCA 4AFUC 2J7IA 2QXFA 4F16A 4C8QE 1A0NB 3CCSQ 1YI2T 1M1GA 2KSSA 5LJ3d 2ED1A 5FU7C 1VQMQ 2RHZA 1D09B 3OS0A 1WX6A 2EPDA 2YRCA 1IHVA 2VWFA 2Y4YA 1QWFA 5LJ3g 1RI9A 2EKOA 1GCQC 3KXTA 2AIRB 2KRSA 4M7DB 1UHCA 3VS2A 5FWCA 4FU6A 4J7FA 1VQ8Q 1X2QA 3CD6T 4M7AC 4KUDK 4M7AG 2LQKA 3I55A 3OB9A 3PFSA 4C5IA 2CGHA 4HVWA 3G6EQ 2QASA 1YJNQ 3MO8A 2L3RA 3L2WA 5GAMe 3SD4A 1DJ7B 2RQVA 3RUXA 3CC2T 2RD1A 2HQXA 4LDUA 1E6GA 1AZGB 4R55A 2HKQB 1WHJA 3FIFA 3CPFA 2LZ6B 2K6DA 2XIDA 3JSCA 4HKEA 2O4XB 4NOYA 1VQ9Q 4EMGA 3CPWP 2KT1A 2YLBA 1VQ5T 2QTVA 3PMTA 1Q86U 1Q82C 2LCSA 1VQPA 3SWNB 2PU9B 1R8OB 2PTKA 2K2MA 3UA6A 2IPOB 3J7AF 2HNIA 2XDDA 2KVQG 3QXEB 3TCJA 3M0PA 3CCVT 2JXBA 2Z0WA 3OYBA 1PSEA 2RMOA 4FSSA 1FX7A 1K9MU 3OSVA 4ZNXA 2KT8A 1QVGP 4M75D 3DB3A 2HBWA 1RL2A 1PCXA 3A8MB 1T3LA 2GFAA 2X9HA 3INZA 3HKSA 2RH2A 2CP2A 2KR3A 1B34A 1RLPC 2CT3A 2EQJA 2OTLT 5I11A 2EIFA 2JM8A 2MWPA 9ATCB 2FPFA 3CC4Q 3CMAT 1D3BB 4RG2A 3GLXA 1KQSS 3Q1JA 2X35A 3CCUA 3UPUA 4PLIA 4LUEA 1I07A 4C92G 1M8MA 2QEXT 4RTTA 4QQGA 4XTWA 4M77C 1WI7A 1VQ7A 4M77G 1YITQ 2DX1A 1WZOA 3NTIA 3RMSA 1HD3A 3P8DA 3I56Q 1N8RC 5GANh 4XU0A 2DZ9A 4B9WA 3H41A 1GBRA 2CH4W 2V1QA 1YHQQ 3OBYA 2FG0A 2E64A 1ZUUA 3UT1A 4ZTFA 2KEAA 1BBZA 2E3IA 2RI2A 2MMPA 1PC0A 2D1XA 2AT1B 4C8QA 3LX7A 2CUDA 3CCQT 1JU5C 2YUPA 2LQWA 2HQHA 1FMWA 5KE3A 1SRLA 4A63B 2C0OA 3DB4A 4FM4B 1H641 2HSPA 1KQSA 1FXXA 3RNJA 4OMFB 1NZ9A 2QQSA 4OP0A 3NTHA 2QAZA 5L23A 1N9RA 2H3EB 1NG2A 2NLUA 1SHFA 2ZGWA 3M59A 5IHIA 4M7AF 1YJWQ 5GAMf 5KYWA 2YRVA 5KE2A 4J5YA 3OBWA 3UF4A 2DNUA 4BI3A 1YP5A 4KULA 4BY6B 3OYGA 4NL2A 3HFNA 4M7DC 3O8VA 1S1NA 4OMLA 2DXUA 3C95A 2O01E 2HKNA 1AT1B 3G71T 1RUWA 3TREA 1M2VB 3CCJQ 3I35A 3HPWA 3LWIA 4ATOA 1HK9A 4DEYA 3CPWS 4N4IA 2OTJA 2P0QA 4XTYA 4M78G 4GY5A 2RHUA 1YBYA 4E47A 4AFSC 1WHGA 2QDLA 2BUDA 1UUEA 2HEQA 3CXCS 1PD0A 3MP8A 2CP3A 2QQ9A 2NUZA 5HY6A 1VQ4A 4PKCC 5CKFA 3EFOB 2JN0A 1D1CA 5GAOl 2ECZA 2ROLA 2HBPA 2NUTB 1QVGS 1SEMA 1N6AA 1PHTA 2VXEA 4NS5A 4KT0E 4OVAA 3LWHA 1VQ6T 3D7SB 4B6MA 5GAMg 1QCNA 3HRSA 2AZSA 1M30A 3SDZA 2L3QA 4IUQA 2CKKA 3CC7A 2DPPB 5HCKA 1UGVA 1XOVA 2NUPB 3VYHB 4C92F 3OYKA 1QKXA 5GAN5 1MMAA 1T0JA 3VYGA 3FJ5A 3JB9I 1UGSB 2KRMA 3CPWA 4XU2A 2VC8A 1MMGA 4M77F 3PVQA 2V26A 2VGMA 2ATCB 2I2LA 3G6ET 1S72A 3JB9D 4XTXA 4EDUA 5KYXB 5HK0A 2OAUA 2W10A 2D9TA 4FL6A 5DM7R 3JRZA 3M57A 2HDAA 3JCMJ 5FROA 2H3JA 1H3HA 1QVGA 5GAN7 1J3TA 2AZVA 5C0MA 2COZA 1ZUYA 2DL4A 1PRMC 5GMKj 4AFZC 4XK8E 4M75E 3CD6Q 1G8XA 1JXMA 1VQNT 3A98A 2IG0A 5LJ5h 3E1SA 1K9MC 2QQAA 4PJOB 3OYJA 2KYBA 2KE9A 2D8JA 1TG0A 1BI2A 3JCMX 2AK5A 4KH0B 3VJPA 2ENMA 2LP5A 2V8JA 2ZPFB 2V8IA 2K9GA 1WJRA 3CCMA 3QYGB 1YIJQ 4O6JA 4Y92A 3META 2K3XA 4J8OA 1X43A 3CMEA 2DIQA 1KIKA 1KC8U 1Y7XA 2XI9A 5LJ3e 4Q5WA 5FRNA 4M7DF 4HCZA 4PK4A 1XQHA 1TU0B 4DOWA 1AWJA 3R6NA 1AEYA 4OF1A 1K8AU 4L6V5 4J9FA 2ABLA 3CCVQ 4HA8A 4GBQA 3WVEB 1Z9ZA 4ZGJB 4RCCA 3S3NA 4A4FA 1WPYA 2C0TA 3SEMA 4DBQA 4BY6C 1NPRA 2XKOC 5CR2A 4E7ZA 1M1FA 1AWWA 4KGXB 4A4KA 3I56T 3HTRA 1VQLA 5GAN3 2JT4A 5KCHA 1TOVA 2FPEA 4FT4A 2DL8A 1FMKA 2CP0A 3FC3A 1YHQT 2JS0A 5KCOA 3QJYA 1W4SA 2YWWA 5I22A 4X34A 5KYNA 2MK5A 2RO0A 3J80E 4OB1B 3UDCA 5GANf 4ZTJA 2MAMA 3PT9A 1NLOC 3A8GB 1HXDA 1Y07A 3VS6A 2HL5C 1WHHA 2FRYA 1KHCA 2LRQA 3QWYA 2J06A 2QI2A 3CCLA 1G3WA 2RN8A 3M0QA 4PJMA 2H8HA 3GOXA 2IIMA 3JB9H 2GQIA 3OYLA 1M1KU 2P84A 1YJWT 3X28B 3I55T 1BCOA 3CCQQ 4RTWA 2DL7A 5IHNA 1KD1R 3LYIA 3SFMA 2RJDA 4R0KA 3HRTA 2ZPGB 4MDWA 1UDLA 4F7UA 1Z9QA 1Y96A 2J6FA 4KGVB 2GNCA 2F2VA 3TSZA 1W1FA 1NEBA 4JDSA 3JCMQ 1D0YA 2LQNA 1BIAA 4EMHA 1JEGA 3RDVA 4JRPA 1RAHB 4BE1A 4BDZA 2EWNA 3RMQA 3CCJT 1TWBA 4RUGA 1GRIA 1RAEB 3QBYA 5GANd 2EYQA 3OYAA 2K5LA 2RJCA 2XICA 1MNEA 2DBMA 1WJSA 4C92B 1JBMA 2DA9A 5GANg 1U5SA 2CS7A 1VQPT 2M0YA 4M77B 1AD5A 3QKJA 4C0DB 2LNVA 4A4HA 2GGRA 2ZPHB 1EIFA 1WXUA 3T9NA 1I0CA 2HAXA 2OAWA 2EKHA 2V1RA 3MEUA 4ANJA 1D0XA 4QW2A 1ZQ1A 4C5EA 1RLQC 4XQ3A 3M56A 1X6GA 2E5KA 4PJOC 3CBPA 2K3YA 2XK0A 1O9SA 2KXCA 3O5ZA 3L2QA 3OYCA 2C0IA 2GBQA 4M7AD 4M75B 2CZ6B 2YSQA 2O9SA 3LGLA 1KG1A 3VRYA 4M7DA 1ZSZA 3JCMh 5FWBA 2LJ0A 1I5LA 4RTXA 4DQ2A 3BE3A 2CDTA 4O5VA 1G2BA 1V29B 2JMAA 4J9IA 4PLLA 2X4YA 3FB9A 1G3YA 3MCAB 1M3AA 1VIFA 3PE0A 2LT4A 2L0AA 1OU8A 2EYWA 2JW4A 1JB0E 3LH5A 2YDLA 5M9OA 3BDUA 1B3QA 1M90R 4E7LA 3EGXB 1VYTA 3CCEQ 1ABOA 3GIBA 3PIOA 3ASKA 4P5NA 1X69A 2DKGA 4PJNA 4YTLA 2DJQA 4JPBW 1LCKA 2B8AA 1NPPA 3OYDA 3M55A 3CCRA 2DLPA 5CCAA 2O4XA 1NBEB 4WCIA 1OZ2A 3OMGA 4ESRA 3GPLA 4J9GA 2LC4A 1ZLMA 1PWTA 4M78B 1D1BA 3M53A 5J39A 1W2BP 1F1BB 1JJ2P 4PNOA 4RG8A 2COWA 3OYEA 3C94A 2FPDA 3SWNA 1AWXA 1KC8C 3L2UA 3HRUA 1Q81R 1Y0MA 2DD5A 3PVLA 4CI0C 5FRMA 4HCCA 1UJYA 2CZ0B 1YIJT 4XU3A 2BE9B 1K8AC 3L42A 2MF2A 4DBFA 1VQNQ 1MV3A 1OYXA 4OMPA 2QDYB 2FYKA 4XTZA 2FZKB 4LUDA 5AT1B 2CH4A 5FW9A 5A0GA 2E4HA 2LVMA 3ZEHA 1CSKA 2A28A 5IXBA 4ME7A 2BIVA 2LJ1A 2NWMA 3C0CA 2M0OA 3QWXX 3DLLA 5I2MA 1O75A 3OY9A 2E12A 2MOXA 3EGUA 5GANj 4FYYB 1Q7YR 3OSSC 3ER0A 1OOTA 1PNJA 1ZA1B 2R57A 4A4GA 1EX4A 1W6XA 2VKNA 2M02A 3F70A 3E9GA 1YWOA 1YJ9Q 4LE9A 5LJ5d 1GL5A 4C92C 4B9XA 1NYFA 3JB9J 4PJOF 2QK0A 3VS7A 2QA4A 1KSWA 4LD9K 1ACMB 3L2VA 1VQOA 4LDWA 2F69A 2VV5A 3CC7T 1B07A 4A53A 4C0DC 4EPCA 3DLMA 1M1KC 3OYYA 3THKA 4JRIA 3I9QA 2CP5A 4PFOA 2DEUA 2BZ8A 1NJIR 1RAGB 5A0DA 2L3SA 3FLGA 1GFCA 2E65A 1WFWA 2D6FA 2VB6A 1VOMA 3EGDB 5FU6B 1K4US 4E7KA 1WXBA 1OX8A 2EYZA 4M7DD 4RCBA 3UA7A 4Z89A 1K73R 2L89A 5DLQE 1S72T 1N9SA 1B34B 2RF0A 3JCMV 1OEBA 1QMCA 1YI2A 3M0RA 4DBRA 1WDXA 4M75C 1YWPA 4M75G 3PTAA 3AHUA 1UECA 2M16A 1M2OA 1LNXA 2HQEA 1M3CA 3GBQA 2VYTA 2YRDA 5IN1A 2LCLA 1M2VA 2X4WA 2DZCA 3I55Q 2X4JA 3UATA 4OB2B 3H0IA 1W2BS 2GCXA 1JJ2S 1VUBA 4BE2A 1OV3A 1LVKA 1IREB 1SG5A 2SRCA 2XD0A 1LOJA 4M7AE 4J9DA 3G7ZA 3CC2A 3EFOA 1I5OB 3G4SA 2DMOA 2X3XD 4C8QB 4Y28E 2HCKA 2NUTA 3CMET 3A1PA 2JJ9A 2F1LA 3REAB 2CT4A 8ATCB 2LMJA 2CZ1B 3ZL7C 4N0AC 1R0BG 2DRKA 3GP8A 2GF7A 4M78C 4OMMA 2DJZA 5GMKm 1P92A 3A8HB 1K73U 1VQ5A 3EFSA 1VQPQ 2XMFA 4J6WA 4E7IA 3RR6A 2RM4A 4BDYA 1VYVA 2COYA 5LJ3h 4CC2A 1CKBA 1PD1A 3GF5A 1LJOA 5GAN8 1QWEA 3RKYA 4LDVA 3MPUB 3RKXA 4J7IA 2DETA 1NLPC 4J9CA 1BYMA 1QP3A 2M9UA 3QSUA 1W2BA 1JJ2A 1NM7A 1ZUKA 1R77A 3HSBA 2DXTA 3FRNA 5KYXA 2OTLA 2ESWA 2F2WA 2BTTA 1IZ6A 1G3TA 3CCUQ 1LPLA 3CMAA 2YUNA 2O31A 2KGTA 3CCET 2EJFA 2E3HA 2E10A 4MMKA 2BZXA 1MHNA 5GANe 2QEXA 1TTHB 3OYNA 2E6ZA 5GAOq 3H8ZA 1ZX6A 5LJ5j 1VQ7Q 4RTVA 4IUTA 2LJ3A 3PGGA 4JZ4A 5CIUA 2DD4A 1RADB 1ZBJA 2X3WD 5KYUB 5IT9E 1K0SA 1WIEA 1ZSGA 4PJOA 2L2PA 3VV0A 4F7UE 3EG0A 1XNIA 5GAOp 3WVDB 1KK7A 2GQVA 3LLRA 4KRTA 3PIPA 5KYYA 4HCKA 3JCMb 1UGQB 2JTEA 2DM1A 1X6OA 4M75F 3OYHA 1Y57A 1NE8A 1X2KA 1UTIA 2FO0A 1WHLA 1YN8A 3VUBA 3V8KA 1K76A 3JCMd 4BI4A 4WTOB 3VS0A 4FW1A 2E6NA 5FU6C 3HP9A 2JNGA 3U23A 1OX9A 4JZ3A 4C0FA 2DYIA 1I4K1 2O2OA 4DEXA 3NHNA 1GCPA 3EG2A 5HKCA 4ORZA 3H0HA 4PFPA 1GCQA 3VS5A 4HT8A 3OW2P 3VRZA 4IUUA 2RQTA 1VQKA 2D8HA 2A3LA 1M9SA 4AG2C 1OU9A 4M7AA 2FRWA 4KH1B 1T3SA 1UFFA 1N5ZA 4JJNK 1IGUA 4QVDA 4JJDA 1BKBA 1PM3A 4CC3A 2DIGA 4QQ6A 3JB9G 2K7AA 3MP6A 1SPKA 1E6HA 1AOJA 1YJ9T 3V7CA 3G71A 1G5VA 2OTJQ 4HVUA 2WSFE 3EFRA 4M7DE 3QG1A 4AT1B 1OPKA 4M78F 4E7JA 4Y91A 3ZBDA 2GTJA 2JVVA 1I1JA 4XTVA 2QTXA 2EFIA 1M5Q1 1KQ2A 4QKUA 4LXCA 2PUOB 4N4GA 4K11A 4F17A 1N8RR 3L2RA 2RPNA 1FWZA 2GFUA 2YUQA 1VQ4Q 1HYOA 3AT1B 3MEWA 4C8QC 3KFVA 4C8QG 3OYMA 3NGPA 3EG9B 4EMKB 3EHQA 3JCMW 3MHXA 1PKTA 4ELZC 2DTOA 2AKKA 4BB7A 2DFUA 4F14A 3H9NA 3E19A 1VQ6A 4IUVA 3N5BB 2G3RA 5C6SA 2RB6A 1QVFP 2EBPA 2A0FB 3CCSA 1G83A 1WYXA 3CC7Q 5LL6S 1VQMA 3HHTB 1IB8A 4FYXB 1QLYA 2FVUA 2CP6A 2QQRA 1H8KA 2YHTA 4FIBA 2DEQA 4MDXA 5D6XA 3CCRT 3ME9A 5CKDA 2RK1A 2ZCFB 4C5GA 3RBBB 1UGRB 4JS5A 1VQ8A 1S72Q 1ZBXA 2JTFA 4C92A 3G6EA 1YJNA 4FYWB 1UGPB 1WHMA 2DVEA 1JQQA 5GJWB 5AYFA 4M77A 3C4SA 4QVCA 5GAN2 1V1CA 3A8LB 4PJOD 5GAOn 1KFZA 5LJ5e 4Z8AA 5I21A 4BE0A 4RTYA 4PFZA 1K73C 1B7TA 1NYGA 5GAMh 1K0XA 3JCMc 1QW1A 3M4GA 5CO7A 2ZAEA 1VQ9A 1CKAA 2M1HA 1UHFA 2DTHA 2CSIA 1BI3A 4FSXA 3RESA 4XAXB 3QO3A 4Z88A 6AT1B 3CCMQ 5GMKe 1ARKA 1U06A 4BUGA 4IUPA 2DO3A 1JXOA 3EH1A 3BFMA 2XDBA 3OW2S 4VUBA 1GFDA 3CMEQ 1SHGA 1VYUA 2O9VA 5A0LA 1SF9A 1WQ7A 4E2FB 2XU8A 3FDRA 2CSQA 4J9HA 1K9AA 3FEOA 4OB0B 3JB9F 2NYSA 1KD1U 3CCUT 2PVDB 3CC4A 2G6FX 3EGXA 2PQWA 4JS4A 1HJDA 2QA4T 2EQMA 1M4ZA 3I5SA 2EJ9A 4MZPA 2BZYA 1VQ7T 2K57A 2EQIA 2K5IA 1YITA 2LTOA 1VQLQ 1K1ZA 2EYYA 4C0GA 3I56A 4J6YA 4N0AA 4C8QF 1W70A 1EZZB 2P4TA 4RKUE 2RNAA 4M78A 2R5AA 3OYFA 1IGQA 2KXDA 1MUZA 4CC4B 1YHQA 2P4RA 1BB9A 3TVTA 3OW2A 2L8DA 4PJJA 2OI3A 3VKIA 4FT2A 1N27A 2QGFB 4DA4A 1QVFS 1Q86R 2X4XA 3TSWA 3QZ9B 2LT1A 2PVOB 2VVKA 2IVWA 1ZHIA 3MEVA 1BK2A 3CCLQ 2ROTA 1K9MR 4EMKC 2ZZDA 5GJVB 1ZSZB 1AZEA 3LGFA 5J3BA 4KUIA 2KK4A 4QQDA 1U1SA 1YJWA 2F2XA 5IH2A 4D8DA 4LDYA 1U3OA 5LJ5f 3MP1A 2A37A 3PMIA 4OGEA 4UC4A 2MYSA 3V7RA 4XU1A 1UG1A 4C5HA 2CYZB 1VIEA 4C92D 3A8OB 3M4YA 3IQLA 1OI1A 4JUVA 4BD3A 1EFNA 1BU1A 2Y90A 3G4ST 2JS2A 2E1HA 4LN2A 4M77D 1QVFA 1D3BA 4DBHA 1OZ3A 2KY9A 3V8JA 3CCJA 2OTJT 1YCYA 5EG2A 1M90U 3QZ5B 2RHYA 2J6OA 1IO6A 3MKDA 4ZN1A 1GXIE 2J05A 4D8KA 5GAN4 2YT6A 1TH7A 2PUKB 1E7OA 3M9QA 4JRQA 1QCFA 2D0NA 2DL3A 2EQKA 3OS2A 1VQ4T 3CXCP 2FHDA 2YXYA 1MGQA 1ABQA 1YCSB 2KQWA 1TUDA 3QIIA 3NMZC 4PJLA 2VUBA 3EGDA 2P0PA 3M0TA 3JCMP 4F04B 1XTDA 5CAIA 1Q81U 3M58A 1RACB 4MZTA 5LJ5g 2DK3A 3JCMe 1FMVA 1TS9A 1X6BA 1OPLA 5DY9A 4L59A 3S3OA 1AVZC 4PJOE 2EW3A 3V8LA 2ZPEB 3TEEA 3VS3A 4FCYA 4F7UG 1QKWA 3R6OA 1KJWA 3I5RA 3EG1A 3EAEA 2I0NA 3LW5E 1KHIA 3GNFB 2QGGA 5CKBA 5GMKl 4J9EA 2PVGB 2DXBA 1Q7YU 2RK2A 4CC7A 4JJBA 1JRIA 4M78D 3A5ZB 1D0ZA 2DVJA 1V76A 2AHJB 3CCRQ 2L5QA 2RA2A 2KDSA 4J6XA 5IXFA 2K3BA 3CD6A 5D7UA 2W0ZA 5LJ3j 2LQ8A 3PNWC 2VXFA 2E5QA 1U1TA 3X25B 1BCMA 2EAYA 1XJWB 5GAN6 4RTUA 4MMLA 4RMOA 5EC7A 2V8KA 3CCMT 3P8HA 4BI8B 1MNDA 4OMQA 1YIJA 1NJIU 3BW1A 5L8RE 4IKFA 1SSHA 4JLGA 4WF2A 4A4EA 5DLOA 1VQKT 1KD1C 1VA7A 3H0FA 2F5KA 4JRKA 5KH6A 3QHSA 3OA6A 3L2ZA 2O88A 4KGZB 3ZFJA 4E7HA 1ZSZC 3OMCA 4M7DG 2DILA 2RQRA 2CUBA 2KMTA 1RI0A 4FW2A 1TXQA 4D6WA 2GTOA 2NUPA 5KYWB 2MCNA 2OJ2A 4ZGEB 3CCVA 1RAIB 2HD0A 3QYHB 3URGA 2DTIA 4R56A 4M4ZA 3HFOA 1WLPB 5I2SA 5A2QE 1UEBA 2HSEB 2RJEA 1MMDA 7AT1B 3NPFA 1NEGA 1VQLT 1H3ZA 1HSQA 5KYUA 4PL6A 5GAMd 2KBTA 2WSEE 1SKUB 2XDPA 3VS1A 4XTUA 4KBMB 2VGNA 3JCMf 1YFNA 2MIOA 3E9FA 2RJFA 4MZMA 2QA4Q 1Q95G 1C0MA 2DL5A 3CCST 2RQWA 1VQOQ 1C1AA 3SWNC 1VQMT 4Z02A 4ZN3A 2DBKA 4C92E 2FZGB 2JM9A 1SSFA 3CCLT 1QCOA 2ZPBB 3QJ6A 2K2VA 3VS4A 2FL7A 1I8FA 2WACA 1KC8R 1AWOA 4M77E 4F7UF 4ELYC 1VQ8T 1R0CB 4LD6A 2RQUA 3NTKA 3FJPA 3OS1A 3J81E 4IURA 1YI2Q 1YJNT 1K8AR 1C6VX 3CCQA 3CXCA 3S6WA 2BE7D 4JJCA 2RHIA 2DAQA 4E7SA 4RTZA 2MI6A 4IIOA 1M90C 3EHRA 3NFCA 3M0SA 2LX7A 1Q82R 1X75C 1QVPA 5GAOm 4LNPA 2RI5A 4AFQC 1Q86C 2J6KA 4L5GA 3EG3A 1MV0B 3JCMg 3MJXA 4II1A 1UB4A 1QP2A 2ED0A 1VQ9T 2JOYA 2WSCE 2R58A 3QPHA 4C8QD 3SHWA 2KROA 2EJGA 2VASA 3V7SA 1UJ0A 5CQYA 2RHXA 1SRMA 1YNZA 5CKEA 2C06A 2K79A 1PG5B 2YLCA 2LNHB 3CC2Q 3G4SQ 5KYYB 1Q81C 1TUCA 4X1VA 1GBQA 1Y71A 3EG9A 4EMKA 3M5AA 4A54A 1RAFB 2X51A 2HMAA 4CRIA 1ZA2B 4DOVA 2K4YA 2MWOA 3M0UA 4FYVB 1OQKA 3RKWA 3JV3A 4TVRA 5GMKh 2DF6A 1QQJA 4HVVA 4C0ZA 1VQ5Q 2KAFA 2BKDN 2FEIA 3WXMB 4V2SA 5FU7B 1M1KR 3MEAA 3X24B 3CC4T 1MMNA 1TUGB 1PSFA 2Y4XA 4M78E 4X9DA 3JAME 1Q82U 4EIKA 2EGEA 3EH2A 4GLMA 4HXJA 3OS5A 4OGCA 3BDLA 1Q7YC 1YITT 2D0QB 2QG9B 4M7AB 1FYNA 3CBOA 2EVRA 2OTLQ 3OYIA 2F5TX 4IIMA 2EQUA 3CMAQ 3TU4K 2MPXC 3VUZA 1G3SA 2DE0X 1D1AA 1U8RA 2JZ2A 4OB3B 2KI7A 5CK9A 5CQXA 3BY7A 1AHJB 5J26A 4AMCA 2HL3A 3CCEA 8AT1B 1WXTA 1RAAB 5GAMj 2QEXQ 3RERA 1PKSA 2ZPIB 1WQWA 2SEMA 5IHKA 1H92A 4J9BA 3DKMA 2AKLA 2CP7A 1KQ1A 2JMCA 1M3BA 2FZCB 2R5MA 3CEYA 1PRLC 5GAOr 3M54A 5CKHA 2RI3A 1UE9A 1NJIC 2K5FA 1X01A 3REBB 1I81A 3C12A 1X27A 2EGAA 1BI1A 3GNGA 1N8RU 2E41A 4HT9A 4N4HA 4QVZA 1WGSA 2B86A 3TQ7P 4GLKA 2DYBA 3HL8A 4X9CA 1VQNA 2QYZA 3X20B 3S3MA 2A36A 4OMOA 3X26B 4BACA 3QUIA 1RABB 4HCBA 3KUFA 5FLXE 3L1AA 2CREA 4M75A 1WA7A 5CVIA 1T0HA 3SB2A 2A08A 4LDXA 3H6ZA 2L3PA 3VU3C 4NL3A 2HZYA
chains in the Genus database with same CATH topology
4FW2A 5D7UA 4FW1A 1C0MA 1EX4A 1IHVA 1IHWA 1QMCA 1C1AA 1C6VX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW2 A;  5D7U A;  4FW1 A;  1C0M A;  1EX4 A;  1IHV A;  1IHW A;  1QMC A;  1C1A A;  1C6V X; 
#chains in the Genus database with same CATH topology
 3LH0 A;  3P8B B;  2KRN A;  1VQK Q;  2EYX A;  2FB7 A;  2E70 A;  1M8V A;  4F7U B;  2PNI A;  2EGC A;  1Y96 B;  3QDR B;  3RIR A;  2QQB A;  1WHK A;  2LDM A;  5LJ3 f;  2JTM A;  4JLI A;  1M27 C;  3OQ5 A;  4ZGD B;  3CBM A;  3G71 Q;  2P0K A;  1IRX A;  5GMK i;  1IHW A;  4QT7 A;  1KQS P;  2XHC A;  5HK3 A;  1YJ9 A;  5ECA A;  2DRM A;  1WJQ A;  2XG8 D;  4E6R A;  2KYM A;  4OMN A;  3QDF A;  2YUO A;  4PJO G;  1IXD A;  2CZ7 B;  5D6W A;  3CQT A;  1VQO T;  2JUF A;  2KNB B;  1JO8 A;  1OUL A;  2LX9 A;  5IAY A;  5D6Y A;  2OX7 A;  3KBG A;  1BI0 A;  1WNL A;  2PZ1 A;  3UWN A;  3G1J A;  4AG1 C;  2A7Y A;  2M51 A;  1TSF A;  2LCC A;  3E2U A;  1BIB A;  1VQ6 Q;  4J83 A;  3ULR B;  2DER A;  2DXC A;  4AFU C;  2J7I A;  2QXF A;  4F16 A;  4C8Q E;  1A0N B;  3CCS Q;  1YI2 T;  1M1G A;  2KSS A;  5LJ3 d;  2ED1 A;  5FU7 C;  1VQM Q;  2RHZ A;  1D09 B;  3OS0 A;  1WX6 A;  2EPD A;  2YRC A;  1IHV A;  2VWF A;  2Y4Y A;  1QWF A;  5LJ3 g;  1RI9 A;  2EKO A;  1GCQ C;  3KXT A;  2AIR B;  2KRS A;  4M7D B;  1UHC A;  3VS2 A;  5FWC A;  4FU6 A;  4J7F A;  1VQ8 Q;  1X2Q A;  3CD6 T;  4M7A C;  4KUD K;  4M7A G;  2LQK A;  3I55 A;  3OB9 A;  3PFS A;  4C5I A;  2CGH A;  4HVW A;  3G6E Q;  2QAS A;  1YJN Q;  3MO8 A;  2L3R A;  3L2W A;  5GAM e;  3SD4 A;  1DJ7 B;  2RQV A;  3RUX A;  3CC2 T;  2RD1 A;  2HQX A;  4LDU A;  1E6G A;  1AZG B;  4R55 A;  2HKQ B;  1WHJ A;  3FIF A;  3CPF A;  2LZ6 B;  2K6D A;  2XID A;  3JSC A;  4HKE A;  2O4X B;  4NOY A;  1VQ9 Q;  4EMG A;  3CPW P;  2KT1 A;  2YLB A;  1VQ5 T;  2QTV A;  3PMT A;  1Q86 U;  1Q82 C;  2LCS A;  1VQP A;  3SWN B;  2PU9 B;  1R8O B;  2PTK A;  2K2M A;  3UA6 A;  2IPO B;  3J7A F;  2HNI A;  2XDD A;  2KVQ G;  3QXE B;  3TCJ A;  3M0P A;  3CCV T;  2JXB A;  2Z0W A;  3OYB A;  1PSE A;  2RMO A;  4FSS A;  1FX7 A;  1K9M U;  3OSV A;  4ZNX A;  2KT8 A;  1QVG P;  4M75 D;  3DB3 A;  2HBW A;  1RL2 A;  1PCX A;  3A8M B;  1T3L A;  2GFA A;  2X9H A;  3INZ A;  3HKS A;  2RH2 A;  2CP2 A;  2KR3 A;  1B34 A;  1RLP C;  2CT3 A;  2EQJ A;  2OTL T;  5I11 A;  2EIF A;  2JM8 A;  2MWP A;  9ATC B;  2FPF A;  3CC4 Q;  3CMA T;  1D3B B;  4RG2 A;  3GLX A;  1KQS S;  3Q1J A;  2X35 A;  3CCU A;  3UPU A;  4PLI A;  4LUE A;  1I07 A;  4C92 G;  1M8M A;  2QEX T;  4RTT A;  4QQG A;  4XTW A;  4M77 C;  1WI7 A;  1VQ7 A;  4M77 G;  1YIT Q;  2DX1 A;  1WZO A;  3NTI A;  3RMS A;  1HD3 A;  3P8D A;  3I56 Q;  1N8R C;  5GAN h;  4XU0 A;  2DZ9 A;  4B9W A;  3H41 A;  1GBR A;  2CH4 W;  2V1Q A;  1YHQ Q;  3OBY A;  2FG0 A;  2E64 A;  1ZUU A;  3UT1 A;  4ZTF A;  2KEA A;  1BBZ A;  2E3I A;  2RI2 A;  2MMP A;  1PC0 A;  2D1X A;  2AT1 B;  4C8Q A;  3LX7 A;  2CUD A;  3CCQ T;  1JU5 C;  2YUP A;  2LQW A;  2HQH A;  1FMW A;  5KE3 A;  1SRL A;  4A63 B;  2C0O A;  3DB4 A;  4FM4 B;  1H64 1;  2HSP A;  1KQS A;  1FXX A;  3RNJ A;  4OMF B;  1NZ9 A;  2QQS A;  4OP0 A;  3NTH A;  2QAZ A;  5L23 A;  1N9R A;  2H3E B;  1NG2 A;  2NLU A;  1SHF A;  2ZGW A;  3M59 A;  5IHI A;  4M7A F;  1YJW Q;  5GAM f;  5KYW A;  2YRV A;  5KE2 A;  4J5Y A;  3OBW A;  3UF4 A;  2DNU A;  4BI3 A;  1YP5 A;  4KUL A;  4BY6 B;  3OYG A;  4NL2 A;  3HFN A;  4M7D C;  3O8V A;  1S1N A;  4OML A;  2DXU A;  3C95 A;  2O01 E;  2HKN A;  1AT1 B;  3G71 T;  1RUW A;  3TRE A;  1M2V B;  3CCJ Q;  3I35 A;  3HPW A;  3LWI A;  4ATO A;  1HK9 A;  4DEY A;  3CPW S;  4N4I A;  2OTJ A;  2P0Q A;  4XTY A;  4M78 G;  4GY5 A;  2RHU A;  1YBY A;  4E47 A;  4AFS C;  1WHG A;  2QDL A;  2BUD A;  1UUE A;  2HEQ A;  3CXC S;  1PD0 A;  3MP8 A;  2CP3 A;  2QQ9 A;  2NUZ A;  5HY6 A;  1VQ4 A;  4PKC C;  5CKF A;  3EFO B;  2JN0 A;  1D1C A;  5GAO l;  2ECZ A;  2ROL A;  2HBP A;  2NUT B;  1QVG S;  1SEM A;  1N6A A;  1PHT A;  2VXE A;  4NS5 A;  4KT0 E;  4OVA A;  3LWH A;  1VQ6 T;  3D7S B;  4B6M A;  5GAM g;  1QCN A;  3HRS A;  2AZS A;  1M30 A;  3SDZ A;  2L3Q A;  4IUQ A;  2CKK A;  3CC7 A;  2DPP B;  5HCK A;  1UGV A;  1XOV A;  2NUP B;  3VYH B;  4C92 F;  3OYK A;  1QKX A;  5GAN 5;  1MMA A;  1T0J A;  3VYG A;  3FJ5 A;  3JB9 I;  1UGS B;  2KRM A;  3CPW A;  4XU2 A;  2VC8 A;  1MMG A;  4M77 F;  3PVQ A;  2V26 A;  2VGM A;  2ATC B;  2I2L A;  3G6E T;  1S72 A;  3JB9 D;  4XTX A;  4EDU A;  5KYX B;  5HK0 A;  2OAU A;  2W10 A;  2D9T A;  4FL6 A;  5DM7 R;  3JRZ A;  3M57 A;  2HDA A;  3JCM J;  5FRO A;  2H3J A;  1H3H A;  1QVG A;  5GAN 7;  1J3T A;  2AZV A;  5C0M A;  2COZ A;  1ZUY A;  2DL4 A;  1PRM C;  5GMK j;  4AFZ C;  4XK8 E;  4M75 E;  3CD6 Q;  1G8X A;  1JXM A;  1VQN T;  3A98 A;  2IG0 A;  5LJ5 h;  3E1S A;  1K9M C;  2QQA A;  4PJO B;  3OYJ A;  2KYB A;  2KE9 A;  2D8J A;  1TG0 A;  1BI2 A;  3JCM X;  2AK5 A;  4KH0 B;  3VJP A;  2ENM A;  2LP5 A;  2V8J A;  2ZPF B;  2V8I A;  2K9G A;  1WJR A;  3CCM A;  3QYG B;  1YIJ Q;  4O6J A;  4Y92 A;  3MET A;  2K3X A;  4J8O A;  1X43 A;  3CME A;  2DIQ A;  1KIK A;  1KC8 U;  1Y7X A;  2XI9 A;  5LJ3 e;  4Q5W A;  5FRN A;  4M7D F;  4HCZ A;  4PK4 A;  1XQH A;  1TU0 B;  4DOW A;  1AWJ A;  3R6N A;  1AEY A;  4OF1 A;  1K8A U;  4L6V 5;  4J9F A;  2ABL A;  3CCV Q;  4HA8 A;  4GBQ A;  3WVE B;  1Z9Z A;  4ZGJ B;  4RCC A;  3S3N A;  4A4F A;  1WPY A;  2C0T A;  3SEM A;  4DBQ A;  4BY6 C;  1NPR A;  2XKO C;  5CR2 A;  4E7Z A;  1M1F A;  1AWW A;  4KGX B;  4A4K A;  3I56 T;  3HTR A;  1VQL A;  5GAN 3;  2JT4 A;  5KCH A;  1TOV A;  2FPE A;  4FT4 A;  2DL8 A;  1FMK A;  2CP0 A;  3FC3 A;  1YHQ T;  2JS0 A;  5KCO A;  3QJY A;  1W4S A;  2YWW A;  5I22 A;  4X34 A;  5KYN A;  2MK5 A;  2RO0 A;  3J80 E;  4OB1 B;  3UDC A;  5GAN f;  4ZTJ A;  2MAM A;  3PT9 A;  1NLO C;  3A8G B;  1HXD A;  1Y07 A;  3VS6 A;  2HL5 C;  1WHH A;  2FRY A;  1KHC A;  2LRQ A;  3QWY A;  2J06 A;  2QI2 A;  3CCL A;  1G3W A;  2RN8 A;  3M0Q A;  4PJM A;  2H8H A;  3GOX A;  2IIM A;  3JB9 H;  2GQI A;  3OYL A;  1M1K U;  2P84 A;  1YJW T;  3X28 B;  3I55 T;  1BCO A;  3CCQ Q;  4RTW A;  2DL7 A;  5IHN A;  1KD1 R;  3LYI A;  3SFM A;  2RJD A;  4R0K A;  3HRT A;  2ZPG B;  4MDW A;  1UDL A;  4F7U A;  1Z9Q A;  1Y96 A;  2J6F A;  4KGV B;  2GNC A;  2F2V A;  3TSZ A;  1W1F A;  1NEB A;  4JDS A;  3JCM Q;  1D0Y A;  2LQN A;  1BIA A;  4EMH A;  1JEG A;  3RDV A;  4JRP A;  1RAH B;  4BE1 A;  4BDZ A;  2EWN A;  3RMQ A;  3CCJ T;  1TWB A;  4RUG A;  1GRI A;  1RAE B;  3QBY A;  5GAN d;  2EYQ A;  3OYA A;  2K5L A;  2RJC A;  2XIC A;  1MNE A;  2DBM A;  1WJS A;  4C92 B;  1JBM A;  2DA9 A;  5GAN g;  1U5S A;  2CS7 A;  1VQP T;  2M0Y A;  4M77 B;  1AD5 A;  3QKJ A;  4C0D B;  2LNV A;  4A4H A;  2GGR A;  2ZPH B;  1EIF A;  1WXU A;  3T9N A;  1I0C A;  2HAX A;  2OAW A;  2EKH A;  2V1R A;  3MEU A;  4ANJ A;  1D0X A;  4QW2 A;  1ZQ1 A;  4C5E A;  1RLQ C;  4XQ3 A;  3M56 A;  1X6G A;  2E5K A;  4PJO C;  3CBP A;  2K3Y A;  2XK0 A;  1O9S A;  2KXC A;  3O5Z A;  3L2Q A;  3OYC A;  2C0I A;  2GBQ A;  4M7A D;  4M75 B;  2CZ6 B;  2YSQ A;  2O9S A;  3LGL A;  1KG1 A;  3VRY A;  4M7D A;  1ZSZ A;  3JCM h;  5FWB A;  2LJ0 A;  1I5L A;  4RTX A;  4DQ2 A;  3BE3 A;  2CDT A;  4O5V A;  1G2B A;  1V29 B;  2JMA A;  4J9I A;  4PLL A;  2X4Y A;  3FB9 A;  1G3Y A;  3MCA B;  1M3A A;  1VIF A;  3PE0 A;  2LT4 A;  2L0A A;  1OU8 A;  2EYW A;  2JW4 A;  1JB0 E;  3LH5 A;  2YDL A;  5M9O A;  3BDU A;  1B3Q A;  1M90 R;  4E7L A;  3EGX B;  1VYT A;  3CCE Q;  1ABO A;  3GIB A;  3PIO A;  3ASK A;  4P5N A;  1X69 A;  2DKG A;  4PJN A;  4YTL A;  2DJQ A;  4JPB W;  1LCK A;  2B8A A;  1NPP A;  3OYD A;  3M55 A;  3CCR A;  2DLP A;  5CCA A;  2O4X A;  1NBE B;  4WCI A;  1OZ2 A;  3OMG A;  4ESR A;  3GPL A;  4J9G A;  2LC4 A;  1ZLM A;  1PWT A;  4M78 B;  1D1B A;  3M53 A;  5J39 A;  1W2B P;  1F1B B;  1JJ2 P;  4PNO A;  4RG8 A;  2COW A;  3OYE A;  3C94 A;  2FPD A;  3SWN A;  1AWX A;  1KC8 C;  3L2U A;  3HRU A;  1Q81 R;  1Y0M A;  2DD5 A;  3PVL A;  4CI0 C;  5FRM A;  4HCC A;  1UJY A;  2CZ0 B;  1YIJ T;  4XU3 A;  2BE9 B;  1K8A C;  3L42 A;  2MF2 A;  4DBF A;  1VQN Q;  1MV3 A;  1OYX A;  4OMP A;  2QDY B;  2FYK A;  4XTZ A;  2FZK B;  4LUD A;  5AT1 B;  2CH4 A;  5FW9 A;  5A0G A;  2E4H A;  2LVM A;  3ZEH A;  1CSK A;  2A28 A;  5IXB A;  4ME7 A;  2BIV A;  2LJ1 A;  2NWM A;  3C0C A;  2M0O A;  3QWX X;  3DLL A;  5I2M A;  1O75 A;  3OY9 A;  2E12 A;  2MOX A;  3EGU A;  5GAN j;  4FYY B;  1Q7Y R;  3OSS C;  3ER0 A;  1OOT A;  1PNJ A;  1ZA1 B;  2R57 A;  4A4G A;  1EX4 A;  1W6X A;  2VKN A;  2M02 A;  3F70 A;  3E9G A;  1YWO A;  1YJ9 Q;  4LE9 A;  5LJ5 d;  1GL5 A;  4C92 C;  4B9X A;  1NYF A;  3JB9 J;  4PJO F;  2QK0 A;  3VS7 A;  2QA4 A;  1KSW A;  4LD9 K;  1ACM B;  3L2V A;  1VQO A;  4LDW A;  2F69 A;  2VV5 A;  3CC7 T;  1B07 A;  4A53 A;  4C0D C;  4EPC A;  3DLM A;  1M1K C;  3OYY A;  3THK A;  4JRI A;  3I9Q A;  2CP5 A;  4PFO A;  2DEU A;  2BZ8 A;  1NJI R;  1RAG B;  5A0D A;  2L3S A;  3FLG A;  1GFC A;  2E65 A;  1WFW A;  2D6F A;  2VB6 A;  1VOM A;  3EGD B;  5FU6 B;  1K4U S;  4E7K A;  1WXB A;  1OX8 A;  2EYZ A;  4M7D D;  4RCB A;  3UA7 A;  4Z89 A;  1K73 R;  2L89 A;  5DLQ E;  1S72 T;  1N9S A;  1B34 B;  2RF0 A;  3JCM V;  1OEB A;  1QMC A;  1YI2 A;  3M0R A;  4DBR A;  1WDX A;  4M75 C;  1YWP A;  4M75 G;  3PTA A;  3AHU A;  1UEC A;  2M16 A;  1M2O A;  1LNX A;  2HQE A;  1M3C A;  3GBQ A;  2VYT A;  2YRD A;  5IN1 A;  2LCL A;  1M2V A;  2X4W A;  2DZC A;  3I55 Q;  2X4J A;  3UAT A;  4OB2 B;  3H0I A;  1W2B S;  2GCX A;  1JJ2 S;  1VUB A;  4BE2 A;  1OV3 A;  1LVK A;  1IRE B;  1SG5 A;  2SRC A;  2XD0 A;  1LOJ A;  4M7A E;  4J9D A;  3G7Z A;  3CC2 A;  3EFO A;  1I5O B;  3G4S A;  2DMO A;  2X3X D;  4C8Q B;  4Y28 E;  2HCK A;  2NUT A;  3CME T;  3A1P A;  2JJ9 A;  2F1L A;  3REA B;  2CT4 A;  8ATC B;  2LMJ A;  2CZ1 B;  3ZL7 C;  4N0A C;  1R0B G;  2DRK A;  3GP8 A;  2GF7 A;  4M78 C;  4OMM A;  2DJZ A;  5GMK m;  1P92 A;  3A8H B;  1K73 U;  1VQ5 A;  3EFS A;  1VQP Q;  2XMF A;  4J6W A;  4E7I A;  3RR6 A;  2RM4 A;  4BDY A;  1VYV A;  2COY A;  5LJ3 h;  4CC2 A;  1CKB A;  1PD1 A;  3GF5 A;  1LJO A;  5GAN 8;  1QWE A;  3RKY A;  4LDV A;  3MPU B;  3RKX A;  4J7I A;  2DET A;  1NLP C;  4J9C A;  1BYM A;  1QP3 A;  2M9U A;  3QSU A;  1W2B A;  1JJ2 A;  1NM7 A;  1ZUK A;  1R77 A;  3HSB A;  2DXT A;  3FRN A;  5KYX A;  2OTL A;  2ESW A;  2F2W A;  2BTT A;  1IZ6 A;  1G3T A;  3CCU Q;  1LPL A;  3CMA A;  2YUN A;  2O31 A;  2KGT A;  3CCE T;  2EJF A;  2E3H A;  2E10 A;  4MMK A;  2BZX A;  1MHN A;  5GAN e;  2QEX A;  1TTH B;  3OYN A;  2E6Z A;  5GAO q;  3H8Z A;  1ZX6 A;  5LJ5 j;  1VQ7 Q;  4RTV A;  4IUT A;  2LJ3 A;  3PGG A;  4JZ4 A;  5CIU A;  2DD4 A;  1RAD B;  1ZBJ A;  2X3W D;  5KYU B;  5IT9 E;  1K0S A;  1WIE A;  1ZSG A;  4PJO A;  2L2P A;  3VV0 A;  4F7U E;  3EG0 A;  1XNI A;  5GAO p;  3WVD B;  1KK7 A;  2GQV A;  3LLR A;  4KRT A;  3PIP A;  5KYY A;  4HCK A;  3JCM b;  1UGQ B;  2JTE A;  2DM1 A;  1X6O A;  4M75 F;  3OYH A;  1Y57 A;  1NE8 A;  1X2K A;  1UTI A;  2FO0 A;  1WHL A;  1YN8 A;  3VUB A;  3V8K A;  1K76 A;  3JCM d;  4BI4 A;  4WTO B;  3VS0 A;  4FW1 A;  2E6N A;  5FU6 C;  3HP9 A;  2JNG A;  3U23 A;  1OX9 A;  4JZ3 A;  4C0F A;  2DYI A;  1I4K 1;  2O2O A;  4DEX A;  3NHN A;  1GCP A;  3EG2 A;  5HKC A;  4ORZ A;  3H0H A;  4PFP A;  1GCQ A;  3VS5 A;  4HT8 A;  3OW2 P;  3VRZ A;  4IUU A;  2RQT A;  1VQK A;  2D8H A;  2A3L A;  1M9S A;  4AG2 C;  1OU9 A;  4M7A A;  2FRW A;  4KH1 B;  1T3S A;  1UFF A;  1N5Z A;  4JJN K;  1IGU A;  4QVD A;  4JJD A;  1BKB A;  1PM3 A;  4CC3 A;  2DIG A;  4QQ6 A;  3JB9 G;  2K7A A;  3MP6 A;  1SPK A;  1E6H A;  1AOJ A;  1YJ9 T;  3V7C A;  3G71 A;  1G5V A;  2OTJ Q;  4HVU A;  2WSF E;  3EFR A;  4M7D E;  3QG1 A;  4AT1 B;  1OPK A;  4M78 F;  4E7J A;  4Y91 A;  3ZBD A;  2GTJ A;  2JVV A;  1I1J A;  4XTV A;  2QTX A;  2EFI A;  1M5Q 1;  1KQ2 A;  4QKU A;  4LXC A;  2PUO B;  4N4G A;  4K11 A;  4F17 A;  1N8R R;  3L2R A;  2RPN A;  1FWZ A;  2GFU A;  2YUQ A;  1VQ4 Q;  1HYO A;  3AT1 B;  3MEW A;  4C8Q C;  3KFV A;  4C8Q G;  3OYM A;  3NGP A;  3EG9 B;  4EMK B;  3EHQ A;  3JCM W;  3MHX A;  1PKT A;  4ELZ C;  2DTO A;  2AKK A;  4BB7 A;  2DFU A;  4F14 A;  3H9N A;  3E19 A;  1VQ6 A;  4IUV A;  3N5B B;  2G3R A;  5C6S A;  2RB6 A;  1QVF P;  2EBP A;  2A0F B;  3CCS A;  1G83 A;  1WYX A;  3CC7 Q;  5LL6 S;  1VQM A;  3HHT B;  1IB8 A;  4FYX B;  1QLY A;  2FVU A;  2CP6 A;  2QQR A;  1H8K A;  2YHT A;  4FIB A;  2DEQ A;  4MDX A;  5D6X A;  3CCR T;  3ME9 A;  5CKD A;  2RK1 A;  2ZCF B;  4C5G A;  3RBB B;  1UGR B;  4JS5 A;  1VQ8 A;  1S72 Q;  1ZBX A;  2JTF A;  4C92 A;  3G6E A;  1YJN A;  4FYW B;  1UGP B;  1WHM A;  2DVE A;  1JQQ A;  5GJW B;  5AYF A;  4M77 A;  3C4S A;  4QVC A;  5GAN 2;  1V1C A;  3A8L B;  4PJO D;  5GAO n;  1KFZ A;  5LJ5 e;  4Z8A A;  5I21 A;  4BE0 A;  4RTY A;  4PFZ A;  1K73 C;  1B7T A;  1NYG A;  5GAM h;  1K0X A;  3JCM c;  1QW1 A;  3M4G A;  5CO7 A;  2ZAE A;  1VQ9 A;  1CKA A;  2M1H A;  1UHF A;  2DTH A;  2CSI A;  1BI3 A;  4FSX A;  3RES A;  4XAX B;  3QO3 A;  4Z88 A;  6AT1 B;  3CCM Q;  5GMK e;  1ARK A;  1U06 A;  4BUG A;  4IUP A;  2DO3 A;  1JXO A;  3EH1 A;  3BFM A;  2XDB A;  3OW2 S;  4VUB A;  1GFD A;  3CME Q;  1SHG A;  1VYU A;  2O9V A;  5A0L A;  1SF9 A;  1WQ7 A;  4E2F B;  2XU8 A;  3FDR A;  2CSQ A;  4J9H A;  1K9A A;  3FEO A;  4OB0 B;  3JB9 F;  2NYS A;  1KD1 U;  3CCU T;  2PVD B;  3CC4 A;  2G6F X;  3EGX A;  2PQW A;  4JS4 A;  1HJD A;  2QA4 T;  2EQM A;  1M4Z A;  3I5S A;  2EJ9 A;  4MZP A;  2BZY A;  1VQ7 T;  2K57 A;  2EQI A;  2K5I A;  1YIT A;  2LTO A;  1VQL Q;  1K1Z A;  2EYY A;  4C0G A;  3I56 A;  4J6Y A;  4N0A A;  4C8Q F;  1W70 A;  1EZZ B;  2P4T A;  4RKU E;  2RNA A;  4M78 A;  2R5A A;  3OYF A;  1IGQ A;  2KXD A;  1MUZ A;  4CC4 B;  1YHQ A;  2P4R A;  1BB9 A;  3TVT A;  3OW2 A;  2L8D A;  4PJJ A;  2OI3 A;  3VKI A;  4FT2 A;  1N27 A;  2QGF B;  4DA4 A;  1QVF S;  1Q86 R;  2X4X A;  3TSW A;  3QZ9 B;  2LT1 A;  2PVO B;  2VVK A;  2IVW A;  1ZHI A;  3MEV A;  1BK2 A;  3CCL Q;  2ROT A;  1K9M R;  4EMK C;  2ZZD A;  5GJV B;  1ZSZ B;  1AZE A;  3LGF A;  5J3B A;  4KUI A;  2KK4 A;  4QQD A;  1U1S A;  1YJW A;  2F2X A;  5IH2 A;  4D8D A;  4LDY A;  1U3O A;  5LJ5 f;  3MP1 A;  2A37 A;  3PMI A;  4OGE A;  4UC4 A;  2MYS A;  3V7R A;  4XU1 A;  1UG1 A;  4C5H A;  2CYZ B;  1VIE A;  4C92 D;  3A8O B;  3M4Y A;  3IQL A;  1OI1 A;  4JUV A;  4BD3 A;  1EFN A;  1BU1 A;  2Y90 A;  3G4S T;  2JS2 A;  2E1H A;  4LN2 A;  4M77 D;  1QVF A;  1D3B A;  4DBH A;  1OZ3 A;  2KY9 A;  3V8J A;  3CCJ A;  2OTJ T;  1YCY A;  5EG2 A;  1M90 U;  3QZ5 B;  2RHY A;  2J6O A;  1IO6 A;  3MKD A;  4ZN1 A;  1GXI E;  2J05 A;  4D8K A;  5GAN 4;  2YT6 A;  1TH7 A;  2PUK B;  1E7O A;  3M9Q A;  4JRQ A;  1QCF A;  2D0N A;  2DL3 A;  2EQK A;  3OS2 A;  1VQ4 T;  3CXC P;  2FHD A;  2YXY A;  1MGQ A;  1ABQ A;  1YCS B;  2KQW A;  1TUD A;  3QII A;  3NMZ C;  4PJL A;  2VUB A;  3EGD A;  2P0P A;  3M0T A;  3JCM P;  4F04 B;  1XTD A;  5CAI A;  1Q81 U;  3M58 A;  1RAC B;  4MZT A;  5LJ5 g;  2DK3 A;  3JCM e;  1FMV A;  1TS9 A;  1X6B A;  1OPL A;  5DY9 A;  4L59 A;  3S3O A;  1AVZ C;  4PJO E;  2EW3 A;  3V8L A;  2ZPE B;  3TEE A;  3VS3 A;  4FCY A;  4F7U G;  1QKW A;  3R6O A;  1KJW A;  3I5R A;  3EG1 A;  3EAE A;  2I0N A;  3LW5 E;  1KHI A;  3GNF B;  2QGG A;  5CKB A;  5GMK l;  4J9E A;  2PVG B;  2DXB A;  1Q7Y U;  2RK2 A;  4CC7 A;  4JJB A;  1JRI A;  4M78 D;  3A5Z B;  1D0Z A;  2DVJ A;  1V76 A;  2AHJ B;  3CCR Q;  2L5Q A;  2RA2 A;  2KDS A;  4J6X A;  5IXF A;  2K3B A;  3CD6 A;  5D7U A;  2W0Z A;  5LJ3 j;  2LQ8 A;  3PNW C;  2VXF A;  2E5Q A;  1U1T A;  3X25 B;  1BCM A;  2EAY A;  1XJW B;  5GAN 6;  4RTU A;  4MML A;  4RMO A;  5EC7 A;  2V8K A;  3CCM T;  3P8H A;  4BI8 B;  1MND A;  4OMQ A;  1YIJ A;  1NJI U;  3BW1 A;  5L8R E;  4IKF A;  1SSH A;  4JLG A;  4WF2 A;  4A4E A;  5DLO A;  1VQK T;  1KD1 C;  1VA7 A;  3H0F A;  2F5K A;  4JRK A;  5KH6 A;  3QHS A;  3OA6 A;  3L2Z A;  2O88 A;  4KGZ B;  3ZFJ A;  4E7H A;  1ZSZ C;  3OMC A;  4M7D G;  2DIL A;  2RQR A;  2CUB A;  2KMT A;  1RI0 A;  4FW2 A;  1TXQ A;  4D6W A;  2GTO A;  2NUP A;  5KYW B;  2MCN A;  2OJ2 A;  4ZGE B;  3CCV A;  1RAI B;  2HD0 A;  3QYH B;  3URG A;  2DTI A;  4R56 A;  4M4Z A;  3HFO A;  1WLP B;  5I2S A;  5A2Q E;  1UEB A;  2HSE B;  2RJE A;  1MMD A;  7AT1 B;  3NPF A;  1NEG A;  1VQL T;  1H3Z A;  1HSQ A;  5KYU A;  4PL6 A;  5GAM d;  2KBT A;  2WSE E;  1SKU B;  2XDP A;  3VS1 A;  4XTU A;  4KBM B;  2VGN A;  3JCM f;  1YFN A;  2MIO A;  3E9F A;  2RJF A;  4MZM A;  2QA4 Q;  1Q95 G;  1C0M A;  2DL5 A;  3CCS T;  2RQW A;  1VQO Q;  1C1A A;  3SWN C;  1VQM T;  4Z02 A;  4ZN3 A;  2DBK A;  4C92 E;  2FZG B;  2JM9 A;  1SSF A;  3CCL T;  1QCO A;  2ZPB B;  3QJ6 A;  2K2V A;  3VS4 A;  2FL7 A;  1I8F A;  2WAC A;  1KC8 R;  1AWO A;  4M77 E;  4F7U F;  4ELY C;  1VQ8 T;  1R0C B;  4LD6 A;  2RQU A;  3NTK A;  3FJP A;  3OS1 A;  3J81 E;  4IUR A;  1YI2 Q;  1YJN T;  1K8A R;  1C6V X;  3CCQ A;  3CXC A;  3S6W A;  2BE7 D;  4JJC A;  2RHI A;  2DAQ A;  4E7S A;  4RTZ A;  2MI6 A;  4IIO A;  1M90 C;  3EHR A;  3NFC A;  3M0S A;  2LX7 A;  1Q82 R;  1X75 C;  1QVP A;  5GAO m;  4LNP A;  2RI5 A;  4AFQ C;  1Q86 C;  2J6K A;  4L5G A;  3EG3 A;  1MV0 B;  3JCM g;  3MJX A;  4II1 A;  1UB4 A;  1QP2 A;  2ED0 A;  1VQ9 T;  2JOY A;  2WSC E;  2R58 A;  3QPH A;  4C8Q D;  3SHW A;  2KRO A;  2EJG A;  2VAS A;  3V7S A;  1UJ0 A;  5CQY A;  2RHX A;  1SRM A;  1YNZ A;  5CKE A;  2C06 A;  2K79 A;  1PG5 B;  2YLC A;  2LNH B;  3CC2 Q;  3G4S Q;  5KYY B;  1Q81 C;  1TUC A;  4X1V A;  1GBQ A;  1Y71 A;  3EG9 A;  4EMK A;  3M5A A;  4A54 A;  1RAF B;  2X51 A;  2HMA A;  4CRI A;  1ZA2 B;  4DOV A;  2K4Y A;  2MWO A;  3M0U A;  4FYV B;  1OQK A;  3RKW A;  3JV3 A;  4TVR A;  5GMK h;  2DF6 A;  1QQJ A;  4HVV A;  4C0Z A;  1VQ5 Q;  2KAF A;  2BKD N;  2FEI A;  3WXM B;  4V2S A;  5FU7 B;  1M1K R;  3MEA A;  3X24 B;  3CC4 T;  1MMN A;  1TUG B;  1PSF A;  2Y4X A;  4M78 E;  4X9D A;  3JAM E;  1Q82 U;  4EIK A;  2EGE A;  3EH2 A;  4GLM A;  4HXJ A;  3OS5 A;  4OGC A;  3BDL A;  1Q7Y C;  1YIT T;  2D0Q B;  2QG9 B;  4M7A B;  1FYN A;  3CBO A;  2EVR A;  2OTL Q;  3OYI A;  2F5T X;  4IIM A;  2EQU A;  3CMA Q;  3TU4 K;  2MPX C;  3VUZ A;  1G3S A;  2DE0 X;  1D1A A;  1U8R A;  2JZ2 A;  4OB3 B;  2KI7 A;  5CK9 A;  5CQX A;  3BY7 A;  1AHJ B;  5J26 A;  4AMC A;  2HL3 A;  3CCE A;  8AT1 B;  1WXT A;  1RAA B;  5GAM j;  2QEX Q;  3RER A;  1PKS A;  2ZPI B;  1WQW A;  2SEM A;  5IHK A;  1H92 A;  4J9B A;  3DKM A;  2AKL A;  2CP7 A;  1KQ1 A;  2JMC A;  1M3B A;  2FZC B;  2R5M A;  3CEY A;  1PRL C;  5GAO r;  3M54 A;  5CKH A;  2RI3 A;  1UE9 A;  1NJI C;  2K5F A;  1X01 A;  3REB B;  1I81 A;  3C12 A;  1X27 A;  2EGA A;  1BI1 A;  3GNG A;  1N8R U;  2E41 A;  4HT9 A;  4N4H A;  4QVZ A;  1WGS A;  2B86 A;  3TQ7 P;  4GLK A;  2DYB A;  3HL8 A;  4X9C A;  1VQN A;  2QYZ A;  3X20 B;  3S3M A;  2A36 A;  4OMO A;  3X26 B;  4BAC A;  3QUI A;  1RAB B;  4HCB A;  3KUF A;  5FLX E;  3L1A A;  2CRE A;  4M75 A;  1WA7 A;  5CVI A;  1T0H A;  3SB2 A;  2A08 A;  4LDX A;  3H6Z A;  2L3P A;  3VU3 C;  4NL3 A;  2HZY A; 
#chains in the Genus database with same CATH homology
 4FW2 A;  5D7U A;  4FW1 A;  1C0M A;  1EX4 A;  1IHV A;  1IHW A;  1QMC A;  1C1A A;  1C6V X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...