1QMCA

C-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Refined Solution Structure of the C-Terminal DNA-Binding Domain of Human Immunovirus-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords HIV-1 INTEGRASE
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1qmcA00
4FW1A 4FW2A 5D7UA 1C1AA 1IHWA 1EX4A 1QMCA 1C0MA 1IHVA 1C6VX
chains in the Genus database with same CATH superfamily
2QDLA 2LP5A 1ZSZC 5D7UA 2DZ9A 4J9IA 4HVWA 1LCKA 1X69A 3CCJQ 3CCET 5AYFA 2Y4YA 1YJNQ 4F7UG 2LCLA 5GAOr 4IUPA 4E6RA 3DB4A 1RLPC 2K3XA 1UGRB 2RMOA 3H0HA 3MJXA 2EQKA 1SSHA 4XU0A 2P0PA 4FSSA 4HT8A 4KUDK 1VQ8Q 3M5AA 2FRWA 1DJ7B 3C12A 1WPYA 3R6OA 5GAMf 3FJ5A 3RUXA 3NHNA 4XTYA 2MWPA 4QT7A 3SWNA 5LJ3d 3RMSA 5CCAA 3QZ9B 2XK0A 2ZCFB 4OMNA 2HKQB 1D1BA 2LJ3A 4BDZA 1Q86R 1QCFA 2X4YA 3QKJA 1YJWT 1MNEA 2JTFA 1K9MR 1QVPA 4GY5A 1M27C 3EFRA 3L2VA 5KE2A 4GLMA 1TG0A 2KQWA 3PIPA 4R56A 5KYYB 2VUBA 3L2QA 1N6AA 4FW1A 2E12A 3EG3A 1FMKA 3UF4A 4M7AB 4C5HA 3HHTB 5GAMd 4A4EA 2DL7A 1BU1A 3MP1A 1VQ8A 5CKHA 4C92A 4EPCA 2I2LA 3BW1A 1G8XA 1VQ6T 3BDUA 3C4SA 2EYWA 4BUGA 5HKCA 1M1KC 1K73U 1OI1A 2KSSA 3G7ZA 2BZYA 4C5IA 4LXCA 3JCMX 3GPLA 1T3LA 3MO8A 1VQOA 1E6GA 1VQ7Q 4NS5A 1PSFA 1PHTA 2L3PA 4MDWA 2KE9A 4RKUE 1NPPA 3REBB 3JCMJ 1XTDA 2EGCA 5L8RE 1ZSZA 5GMKl 1ARKA 2VXFA 4HCKA 2A28A 2DYIA 4CC3A 2K79A 1UTIA 2FO0A 4DBHA 1XQHA 2OTJQ 4YTLA 5FRMA 2E6ZA 1RLQC 2HD0A 2HKNA 2CP0A 3FC3A 3GNGA 3G71Q 3O8VA 2E65A 1TTHB 2DF6A 4FU6A 3QDFA 5CO7A 1PCXA 1X27A 3M57A 1MMDA 1K8AC 2K7AA 4BI8B 3EG9A 2P0QA 1YHQT 3E19A 1MMAA 1EIFA 2EGAA 1LJOA 1M30A 4KRTA 3CCST 1IXDA 2DFUA 2LT4A 1UEBA 4IKFA 2M0YA 4DBFA 1N9RA 2X3WD 2GQIA 1KK7A 4OB0B 4TVRA 2CUDA 1RAIB 1Q81C 2DVEA 2KBTA 2HZYA 3OYNA 2XICA 1YITA 1NZ9A 1BKBA 3JCMQ 1GFDA 4C8QC 2DX1A 5GAN8 2QA4Q 3CQTA 2JOYA 3UA7A 1G2BA 2ZPFB 4C92B 2KYBA 4HCCA 1VQMQ 4JRIA 5CKBA 3CMEQ 4M7AC 2RNAA 1BIBA 2QDYB 4XAXB 5HCKA 1M1KR 3E2UA 1ZX6A 2KNBB 3UATA 5IXFA 1VOMA 1IZ6A 1TUCA 4Z88A 1QVGS 5ECAA 1N27A 4OB1B 2G3RA 2MYSA 1Q81R 5FU7C 1K9MU 5I2MA 4M4ZA 4M75B 4F04B 4FYVB 2KEAA 4C0FA 3OYMA 3DB3A 1SEMA 1TH7A 3IQLA 2DD4A 4JRQA 2DL3A 4OGEA 3CCSA 2IG0A 3NPFA 1H3ZA 2IPOB 2RD1A 2LVMA 4CI0C 2F69A 2E64A 2KRNA 3RBBB 1EZZB 1N5ZA 4C0DC 2QEXT 2AHJB 2QQBA 3KFVA 3G6EQ 2O2OA 4J5YA 2DPPB 2F5KA 3HRUA 4JZ4A 2VVKA 3SB2A 4Z89A 1M90C 1NLOC 1MUZA 1ZLMA 2YWWA 4WCIA 4O6JA 1PG5B 2E4HA 5IH2A 1D3BB 4FYXB 4M78B 4QKUA 3A1PA 3A8LB 1JB0E 4B9WA 3OBYA 4PKCC 3CCLT 4P5NA 2XDBA 1BCMA 4IUUA 3VUZA 3HFNA 4FL6A 4ZN3A 6AT1B 2EQMA 2ED0A 3QWXX 1U3OA 2J7IA 5D6WA 3GF5A 1WNLA 2JMCA 5GAOm 2L89A 2RQUA 2DXBA 3LX7A 4PJMA 1ZUYA 2YUQA 4HT9A 3CC4Q 4RTXA 3SWNC 1QVGP 3T9NA 4M78A 4J7FA 2CDTA 2YT6A 2ESWA 3H9NA 2X51A 1U1TA 1M2VB 1M8VA 2FZGB 1YCSB 4JS5A 2DZCA 1JXMA 2XU8A 4ME7A 4BE0A 2J6OA 2BE9B 4M77E 1AWXA 3L42A 3PE0A 1GFCA 1PSEA 3P8HA 2MAMA 2YRDA 3GLXA 2X35A 1Q86C 2PVGB 4PL6A 3O5ZA 4M78C 1ZA2B 2A08A 2JT4A 3I55Q 2CGHA 5GAN5 1YNZA 4PJJA 4M78E 1YI2A 2DYBA 2VC8A 1BCOA 5GAN7 4KT0E 1M90U 3PMIA 1S72T 3JAME 2NUPB 1UJYA 2FZCB 3A8HB 3MP8A 1T3SA 1VQPQ 3PFSA 2HQHA 3CC7Q 2XD0A 4C92E 2BZ8A 3CCMA 1U1SA 4M7AE 2L3QA 1UGSB 1UUEA 2QTXA 3KUFA 1BBZA 3D7SB 3META 1UDLA 2YUNA 1HSQA 1D0YA 4E7ZA 2C0IA 1C6VX 4C8QF 2VXEA 4DOWA 4OP0A 1G5VA 5CKDA 3NGPA 2PUKB 4E7SA 2RHIA 2COYA 4UC4A 5LJ3f 3EG2A 3FIFA 3SDZA 1JO8A 1P92A 2E1HA 2QGFB 4FYWB 4M75A 4AFUC 3LWHA 4M7DG 1O9SA 3RDVA 5C6SA 3VYGA 5GANd 1Q7YR 1O75A 5GAOn 3CBPA 1X43A 4M7AD 2FHDA 2JW4A 2X4JA 3V8JA 1IO6A 4PJOD 1UB4A 2QTVA 4ZTFA 2BTTA 2RJCA 1YJNT 1VQ5A 2C06A 4PJOE 2KXCA 5IHKA 1U5SA 7AT1B 1Y57A 5FWBA 2K6DA 1KQSP 2FYKA 3EGDA 1VQ9Q 2DEQA 4HCZA 2L2PA 4M75G 4OVAA 4M78F 2QXFA 4OB2B 2K5LA 4HVUA 3CCQA 4ZGDB 4JUVA 3OYBA 2A3LA 3KBGA 2YHTA 1JJ2P 4PJOG 3G4SQ 5FLXE 1LPLA 4RTVA 4OB3B 2KMTA 3DKMA 2M9UA 2PVDB 1ZSZB 1QCNA 4ELZC 2DBKA 1WHLA 1D0ZA 1VQ5Q 4A53A 2E3IA 2F5TX 1WX6A 3QYGB 5D6XA 2GBQA 1GCQC 1K76A 1WIEA 3NFCA 2EQJA 4V2SA 2JS0A 1QKWA 2OTLQ 4IIMA 4MZTA 1VQ5T 4DOVA 1K4US 2OX7A 2HBWA 2ZPEB 4KGZB 1MGQA 2DO3A 2E6NA 1AOJA 1QP3A 2KY9A 5LJ5j 3JB9D 1TWBA 4ELYC 3MHXA 2QI2A 4RTYA 2X9HA 2NYSA 3EAEA 1YIJT 1VQMT 2GTJA 1M2VA 1PD1A 3A8MB 2DE0X 1ZA1B 2EKHA 1K0SA 4M7DA 1RAGB 2DNUA 2GGRA 1KQ1A 1G3TA 5GANg 1YJ9T 4J83A 4RUGA 4J9EA 2AK5A 4OF1A 2OTJA 1X01A 3AHUA 4M7AA 5IHIA 2KRSA 1W2BA 4EMGA 3V8LA 2O9VA 3HTRA 2B86A 3JB9G 1VYVA 4X9DA 3OYHA 1QKXA 2DTIA 3JB9J 3QXEB 4D8DA 2JXBA 2YUOA 1UGVA 2CZ1B 2NLUA 3CCSQ 2CZ6B 4K11A 1MV3A 5I11A 5HY6A 3G71A 1R0CB 1NJIC 3CBMA 3P8BB 4LUEA 3CD6Q 2EW3A 5GAOq 3S3NA 3LW5E 2CP5A 3GNFB 2CZ0B 4JJNK 3TREA 2EJ9A 4JJBA 2LJ1A 3BFMA 2YUPA 4RTZA 1M90R 4R0KA 4KGVB 1Y07A 1Q86U 4EDUA 1VQKT 4B9XA 4QQDA 2P0KA 4MMLA 2V8IA 1K73C 4J6XA 4OMQA 3EG0A 4VUBA 4RTUA 3QUIA 2VB6A 3V7RA 1Z9QA 3ULRB 1X6GA 2WSCE 1Q82C 1C1AA 3OYAA 1HD3A 3L2UA 3L2ZA 5FROA 3OW2A 1QVGA 4RCCA 2K5IA 2HAXA 3QPHA 2HMAA 5GANh 4C8QD 3CCUA 4HA8A 3OSVA 4O5VA 1AZEA 1ZUUA 2DKGA 3H6ZA 3TSWA 2ROTA 2FRYA 1YJNA 4KGXB 1IB8A 2FPFA 4F7UB 3JB9I 1AT1B 4LDVA 1RL2A 1VUBA 4RG8A 1NLPC 2QQSA 2EJFA 4FIBA 1OYXA 5GAN4 4A4GA 3HRTA 1ZQ1A 1W70A 1X6BA 2RB6A 4JZ3A 4OMFB 1GBQA 1Y96A 3NTIA 3M9QA 3VRYA 3OSSC 1D0XA 1OU9A 4ORZA 1UECA 5LJ5h 2MOXA 1HXDA 1IGQA 2V1QA 1WZOA 2RF0A 4M77B 1AWOA 5GMKh 1YI2T 3FRNA 3LH0A 1FX7A 2EQUA 4LUDA 2M1HA 2VGNA 5GAN3 1R0BG 4BI3A 1Q81U 2H3EB 2FZKB 3M55A 2A37A 2HL5C 1D09B 1PKTA 2EYYA 2CSIA 1GCPA 3M0QA 1R8OB 4JS4A 2PVOB 1ACMB 4AT1B 3HKSA 3HPWA 3EHQA 5LL6S 1VQLA 2LNVA 1MHNA 2AZVA 1T0JA 5KCOA 2EIFA 1VQ6Q 3GP8A 2A0FB 2QQAA 4PNOA 2VYTA 5AT1B 2RI2A 3OYYA 4JJDA 2I0NA 3TEEA 1M4ZA 3PNWC 3URGA 1NJIU 3EGXB 3X24B 2RK1A 1JRIA 3BE3A 2YLCA 2RHYA 1BK2A 1VQMA 2EPDA 3QYHB 3L2WA 4X34A 2CSQA 4ZNXA 4M75C 5CK9A 3CPWS 4AFQC 4KH1B 2RHUA 1WQ7A 3FJPA 2GCXA 2QG9B 2M0OA 1W1FA 3JCMW 1N9SA 2CP2A 2NUTB 3MPUB 1TSFA 5J26A 4M77G 5C0MA 3VV0A 4PFPA 1NE8A 3NTHA 1YITT 5IAYA 3CCRA 3TSZA 2FL7A 4PJLA 1YJWA 2D0NA 2HL3A 5GANf 4QQGA 5CKFA 3VU3C 2DMOA 1VQLT 3CC4T 2D0QB 2R5MA 2PUOB 2DXUA 3EGDB 5DM7R 1OOTA 2QYZA 5I21A 1G3SA 2XI9A 1JEGA 3ME9A 2RJFA 4RG2A 3GIBA 3UDCA 1NYFA 2FPEA 4C92G 5KYNA 2CYZB 4GBQA 4DBQA 3SHWA 5I22A 5IT9E 1T0HA 1XOVA 4LE9A 3M0UA 3MKDA 4Z8AA 4CC7A 3QDRB 1JJ2S 3OBWA 4HCBA 8AT1B 1JQQA 2HDAA 1TS9A 3I5SA 1MMNA 2GFAA 1I4K1 2QASA 1OU8A 2ABLA 3EHRA 4ZGJB 2O31A 2LX9A 3R6NA 2QGGA 2CT4A 3CCUQ 2KK4A 4EMHA 1MMGA 4E47A 4F14A 2JM8A 2BKDN 1OV3A 1MV0B 4XU2A 2OTLT 2ATCB 5M9OA 2FEIA 4E7LA 3ZBDA 2QA4A 1JXOA 3PMTA 2MCNA 4MDXA 5I2SA 5KH6A 2COZA 2YSQA 4F16A 1YJ9Q 1Q7YC 2Y90A 4AG1C 2XDPA 2K3BA 3CC7T 5GMKe 2XKOC 1XJWB 3OS0A 1UJ0A 1PRMC 3S3OA 5LJ5g 2SEMA 3RKWA 4CC4B 5CIUA 1R77A 4OMLA 3J7AF 1VQ7A 1E7OA 1YJ9A 1A0NB 2JN0A 1E6HA 4ANJA 2VGMA 2KT8A 4JRKA 4MZPA 3J81E 2BE7D 4RTTA 1VQ4T 4LDYA 2PTKA 4FT2A 4PJNA 2V1RA 3FDRA 5GANe 2DBMA 2E5KA 2WACA 1YJWQ 4ZTJA 1YP5A 4HXJA 3LLRA 5A0GA 2HQEA 4XQ3A 4X1VA 1X6OA 1NJIR 2Z0WA 2EAYA 3V8KA 3MEAA 1B07A 2DVJA 2K4YA 4ZN1A 2DXTA 1M1GA 1UE9A 1J3TA 2DA9A 4F7UF 4AG2C 3QO3A 2BUDA 5LJ3j 3OYGA 1M3BA 4OMOA 1NG2A 2DJQA 4LDWA 3CMAQ 2DJZA 1N8RR 3P8DA 4LDXA 1LNXA 5KCHA 1OPKA 2ZGWA 2EJGA 4C8QB 2R5AA 3PVQA 2DRMA 3A8GB 1NYGA 3OA6A 3PTAA 2AKLA 5KYWB 2ED1A 2QQ9A 2RA2A 1KHCA 5DLOA 5GAMj 2ZZDA 2LNHB 3M58A 3VS5A 4J9BA 1W6XA 2LX7A 3EFOA 3EFOB 2DTHA 4KULA 3I56A 1KHIA 2EVRA 2QEXA 3VS2A 2DETA 3X25B 1ABOA 1PD0A 4DEXA 2KROA 1ABQA 4B6MA 2P4TA 5DLQE 3RMQA 3ASKA 3JB9F 2RI5A 1BI2A 4EMKC 4RCBA 5CKEA 1ZHIA 1OULA 2JZ2A 5GAOl 1QW1A 1OQKA 3CCMQ 2FG0A 3SFMA 5GAMh 1QP2A 3FB9A 4HVVA 4CC2A 1RUWA 3J80E 3CCVA 4DQ2A 1GRIA 2M02A 3HP9A 4IUQA 2LQWA 2LMJA 1VQLQ 1QVFP 2J6KA 4J8OA 5IN1A 2P4RA 4WF2A 1WHHA 3CCEA 3VS0A 1CSKA 4A4FA 1IHVA 1U8RA 4BD3A 1QQJA 5J39A 2M16A 3M59A 3QG1A 2BZXA 4C8QE 3MEUA 3OYDA 1RAHB 1VYUA 2EYZA 1OEBA 2LTOA 1KD1R 3EGUA 2KDSA 1KD1U 4XTZA 3N5BB 4N4IA 1S72Q 2B8AA 3CC2A 3Q1JA 5FWCA 1I81A 1BI0A 4JDSA 2K57A 3L2RA 4ZGEB 4LD9K 1FMVA 2MIOA 2MPXC 2CH4W 3GBQA 2QA4T 3I9QA 3FEOA 1NEGA 3QWYA 4MZMA 2O4XB 2GFUA 4XK8E 3G4SA 1VQNQ 1UHFA 3OMCA 2KYMA 2W0ZA 3G1JA 3OW2S 2HCKA 3HL8A 1QVFS 3EGXA 1BYMA 2ZPGB 5D6YA 8ATCB 1VIEA 1Y0MA 1GBRA 1VQ6A 2L3RA 4XU3A 5L23A 2D6FA 5KE3A 1JBMA 3JV3A 3GOXA 1B3QA 3FLGA 1N8RC 1Y71A 3VRZA 2KAFA 4ESRA 3CMET 4C0DB 5FRNA 2DERA 4AFSC 2H3JA 4EMKB 2EGEA 2LJ0A 5KYUB 2ENMA 4QW2A 2IVWA 3QZ5B 4C92C 1VQNA 2GF7A 2RM4A 4N4HA 2VWFA 2L8DA 2DM1A 1SG5A 3S6WA 3QJ6A 3OYIA 3UT1A 4A63B 2FVUA 3A5ZB 2SRCA 3F70A 4C92D 3JCMg 1KC8R 5FU7B 5A2QE 2W10A 4HKEA 2JUFA 1WFWA 3QJYA 1WGSA 1TUGB 3CC2Q 5CR2A 3CD6T 2LDMA 2JTMA 2JTEA 2DL4A 3JCMV 4OMMA 5GJWB 4M7DD 3UPUA 4JJCA 2DL8A 3MCAB 3VUBA 2GNCA 3QHSA 4AFZC 4LDUA 1RADB 1VQOQ 4FT4A 3JCMe 2OI3A 1Z9ZA 2QQRA 4JPBW 3JB9H 3VS7A 4C0GA 2KR3A 3EG9B 1RAEB 2G6FX 2EYQA 2DTOA 1B34B 2YDLA 4XTVA 4M7DF 2MWOA 2YLBA 1X2QA 5HK3A 3I35A 3HRSA 1VQNT 5LJ5e 2HSPA 3CCLQ 4BY6B 2PNIA 3LH5A 3I56T 5HK0A 2E5QA 4F7UE 1VQ9A 1FYNA 1QVFA 2FB7A 1KFZA 1VA7A 4BI4A 1ZBJA 3L1AA 2GTOA 2DXCA 4FM4B 3VS4A 1TOVA 2MK5A 3A8OB 2ZPIB 2RHXA 4PJOB 2QAZA 2IIMA 3JCMb 1YFNA 2JS2A 1WI7A 3C94A 3H0IA 3A98A 3BY7A 2CUBA 1OX9A 2HNIA 1AHJB 1W2BS 3LYIA 1SRMA 2LRQA 1PWTA 2K5FA 2KRMA 1GCQA 4FW2A 4NL3A 4GLKA 4FSXA 1VQPT 2XDDA 3I55T 4FYYB 4QVZA 2RH2A 2D8HA 1VQ4A 2CREA 4M77C 4C5EA 3CCEQ 1X75C 2LZ6B 5KYXB 4E7KA 3U23A 1M5Q1 1S72A 4BE1A 3QSUA 4PFZA 1AWWA 3CCUT 2RQWA 2P84A 1Q82U 3CMAA 1SKUB 1K9MC 1H8KA 2D9TA 5LJ3h 4BY6C 2KGTA 1IGUA 2MMPA 3NMZC 3PVLA 1AEYA 2X4WA 5GAOp 3JCMf 5LJ3e 3OW2P 1UG1A 5KYUA 1WYXA 2V8JA 3QIIA 4E7IA 2O4XA 2XHCA 1ZUKA 4L6V5 3OY9A 3M0PA 1YIJA 1LVKA 4A4KA 2RJEA 2RHZA 4M7AF 1EFNA 1WJQA 3CMEA 4PJOC 1CKAA 4LD6A 5LJ3g 1Q7YU 2L3SA 4WTOB 1QLYA 2RQRA 3I55A 1MNDA 2OTJT 1BI3A 1M1KU 1YITQ 4Z02A 3CXCS 1HK9A 1D1AA 1D1CA 1I07A 2CZ7B 3RIRA 3LGFA 3CMAT 1WXBA 4Y28E 1QWFA 2ROLA 2K9GA 3EG1A 1FWZA 3RNJA 4L5GA 2DEUA 3CEYA 1V29B 3E9FA 4QVDA 2RJDA 3H8ZA 3V7SA 4M78D 1VQ4Q 1V1CA 3M0RA 5CVIA 2OTLA 4C5GA 1PRLC 3HFOA 4OMPA 1HJDA 3CPWP 1YWOA 4IUTA 5FW9A 1YN8A 3CD6A 2VASA 2A36A 3VYHB 1AVZC 3OYCA 1Y96B 2NUZA 1W4SA 2VV5A 5CQYA 4M77D 5GJVB 3KXTA 1TUDA 4XU1A 1NBEB 2DIQA 4R55A 1IRXA 4MMKA 2E41A 1VQ8T 2R58A 1KQSS 3QBYA 3RKYA 2O88A 4BDYA 1I5OB 1SF9A 4RMOA 2F1LA 1WA7A 3CCVT 2GQVA 3WVDB 5CAIA 3OMGA 1QMCA 3MEVA 3CPFA 1I1JA 1FMWA 3WXMB 4PJOA 1OX8A 3CPWA 1YWPA 4NL2A 3UA6A 2JM9A 2CKKA 4M75E 3V7CA 4M75F 3CCJA 1KQ2A 5LJ5f 4BACA 4A54A 1TU0B 3CCRT 2KXDA 1WXUA 2ECZA 3M0TA 1PNJA 3PT9A 1KIKA 3MEWA 2C0OA 3VS3A 4C92F 1UHCA 5EG2A 3RKXA 1OZ3A 2AKKA 2AZSA 1M3CA 1WHKA 2D1XA 1K9AA 2YRVA 4M77A 1Q82R 4IIOA 2DIGA 3JCMh 2K2MA 3CXCA 2CH4A 3G4ST 3DLMA 3HSBA 1YHQA 5DY9A 1WJRA 1SHGA 3RR6A 2JNGA 3JCMc 2DRKA 1JJ2A 4BE2A 4IUVA 2OAUA 4E7JA 3LWIA 2RQTA 2EQIA 1OZ2A 3THKA 4LNPA 1SSFA 2V8KA 2JMAA 1V76A 3AT1B 4E2FB 2PU9B 4JLGA 4D8KA 1VQPA 9ATCB 2HBPA 2HEQA 3CCJT 2DLPA 2FPDA 1ZSGA 2R57A 4M77F 1LOJA 4M7DC 1K0XA 2LQ8A 2LC4A 3SWNB 4N0AA 1I0CA 3H0FA 4C0ZA 4J9CA 1B7TA 3SEMA 3OQ5A 4J6WA 3TCJA 1UFFA 3JSCA 2MF2A 3M56A 2X4XA 3X26B 4DA4A 1NM7A 3C0CA 1KC8C 1WJSA 4C8QG 2QEXQ 1PC0A 3SD4A 3OYLA 4DBRA 4XTUA 4IURA 3TU4K 2CP6A 1WQWA 3UWNA 4PLIA 4PK4A 1RI9A 3MP6A 3CCQT 1KJWA 1VQOT 2KT1A 5GMKj 1VQ7T 4ATOA 3M4YA 1VIFA 3G6EA 3WVEB 1U06A 1SHFA 3S3MA 4X9CA 2VKNA 2HSEB 1G3WA 3OYFA 1M3AA 2J05A 5KYWA 4J9FA 1W2BP 1WHMA 2PQWA 3CC2T 2QK0A 4J9HA 4RTWA 2EBPA 3EH2A 2JJ9A 3LGLA 3OS1A 1VQ9T 2XIDA 1YBYA 2KI7A 3CCMT 5A0LA 2DD5A 4KH0B 2ZPHB 4M78G 4J9GA 1NEBA 2HQXA 5FU6B 1WLPB 1IREB 2PZ1A 1K8AU 3E9GA 4OGCA 2OAWA 4L59A 3CC4A 1AWJA 2K3YA 4Q5WA 3E1SA 5GAMg 3RERA 5GAN2 1GXIE 4M75D 4LN2A 3I56Q 2DK3A 3VS6A 1VYTA 1B34A 3ER0A 4PJOF 1UGQB 3PGGA 5J3BA 2LCCA 2RI3A 1HYOA 1RABB 4J7IA 2E70A 1YI2Q 5FU6C 5KYXA 4N4GA 2CP7A 1KD1C 3NTKA 2CS7A 1M2OA 2KVQG 4QVCA 1JU5C 3I5RA 3CCRQ 3ZEHA 2E10A 2NUPA 1SRLA 3DLLA 3VS1A 2RPNA 2AT1B 5GMKi 4M7DB 1AD5A 1RACB 5CQXA 5A0DA 3OYKA 1H92A 1S1NA 3CBOA 1RI0A 4E7HA 2Y4XA 4M7DE 1K1ZA 2CT3A 2C0TA 4F17A 4AMCA 1FXXA 4A4HA 2DAQA 1OPLA 2EWNA 4KUIA 1M8MA 1QCOA 3OS2A 2K2VA 2E3HA 4EIKA 5GMKm 2ZAEA 2ZPBB 1KQSA 2WSFE 2DILA 2AIRB 2YXYA 1M9SA 2RK2A 2J06A 3OYJA 1WXTA 4JLIA 3JCMd 2L0AA 4BB7A 3M0SA 4J6YA 1BB9A 1PM3A 3OB9A 4PFOA 3M54A 4EMKA 3REAB 4Y92A 2M51A 5EC7A 2OJ2A 4FCYA 4PLLA 4KBMB 1KG1A 4CRIA 1AZGB 2H8HA 2D8JA 3BDLA 1GL5A 3EFSA 2WSEE 5KYYA 5GAMe 1WDXA 2LQNA 4XTXA 3X20B 1TXQA 2LCSA 4JRPA 2NUTA 4C8QA 1XNIA 1PKSA 3VJPA 1K73R 5IHNA 2EFIA 1KC8U 3M4GA 2L5QA 3M53A 5GAN6 1M1FA 2CP3A 1EX4A 3EH1A 2EYXA 1RAAB 4Y91A 1ZBXA 1D3BA 2A7YA 2JVVA 2RN8A 3ZFJA 1BIAA 3CCLA 1I8FA 3G6ET 3CCVQ 2LQKA 1F1BB 4D6WA 3PIOA 1VQKQ 3OS5A 1QWEA 3INZA 3TQ7P 5LJ5d 1I5LA 2F2XA 2O01E 1C0MA 1BI1A 2F2WA 1K8AR 2X3XD 2MI6A 1X2KA 2J6FA 4XTWA 4M7AG 1NPRA 1Y7XA 2XG8D 4J9DA 1N8RU 2XMFA 3RESA 2YRCA 3H41A 3CCQQ 1SPKA 1YIJQ 1YHQQ 4NOYA 3OYEA 5GANj 1UGPB 3X28B 1H3HA 5IXBA 2DL5A 4DEYA 4N0AC 2F2VA 3ZL7C 2EKOA 2RO0A 3JCMP 2V26A 1IHWA 3G71T 2RQVA 1RAFB 3CC7A 3C95A 1KSWA 3TVTA 4QQ6A 1WHGA 1YCYA 1VQKA 2COWA 1G3YA 1Q95G 2LT1A 2NWMA 4II1A 4F7UA 3CXCP 2BIVA 3VKIA 1G83A 1CKBA 2O9SA 1WHJA 1H641 3JRZA
chains in the Genus database with same CATH topology
4FW1A 4FW2A 5D7UA 1C1AA 1IHWA 1EX4A 1QMCA 1C0MA 1IHVA 1C6VX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW1 A;  4FW2 A;  5D7U A;  1C1A A;  1IHW A;  1EX4 A;  1QMC A;  1C0M A;  1IHV A;  1C6V X; 
#chains in the Genus database with same CATH topology
 2QDL A;  2LP5 A;  1ZSZ C;  5D7U A;  2DZ9 A;  4J9I A;  4HVW A;  1LCK A;  1X69 A;  3CCJ Q;  3CCE T;  5AYF A;  2Y4Y A;  1YJN Q;  4F7U G;  2LCL A;  5GAO r;  4IUP A;  4E6R A;  3DB4 A;  1RLP C;  2K3X A;  1UGR B;  2RMO A;  3H0H A;  3MJX A;  2EQK A;  1SSH A;  4XU0 A;  2P0P A;  4FSS A;  4HT8 A;  4KUD K;  1VQ8 Q;  3M5A A;  2FRW A;  1DJ7 B;  3C12 A;  1WPY A;  3R6O A;  5GAM f;  3FJ5 A;  3RUX A;  3NHN A;  4XTY A;  2MWP A;  4QT7 A;  3SWN A;  5LJ3 d;  3RMS A;  5CCA A;  3QZ9 B;  2XK0 A;  2ZCF B;  4OMN A;  2HKQ B;  1D1B A;  2LJ3 A;  4BDZ A;  1Q86 R;  1QCF A;  2X4Y A;  3QKJ A;  1YJW T;  1MNE A;  2JTF A;  1K9M R;  1QVP A;  4GY5 A;  1M27 C;  3EFR A;  3L2V A;  5KE2 A;  4GLM A;  1TG0 A;  2KQW A;  3PIP A;  4R56 A;  5KYY B;  2VUB A;  3L2Q A;  1N6A A;  4FW1 A;  2E12 A;  3EG3 A;  1FMK A;  3UF4 A;  4M7A B;  4C5H A;  3HHT B;  5GAM d;  4A4E A;  2DL7 A;  1BU1 A;  3MP1 A;  1VQ8 A;  5CKH A;  4C92 A;  4EPC A;  2I2L A;  3BW1 A;  1G8X A;  1VQ6 T;  3BDU A;  3C4S A;  2EYW A;  4BUG A;  5HKC A;  1M1K C;  1K73 U;  1OI1 A;  2KSS A;  3G7Z A;  2BZY A;  4C5I A;  4LXC A;  3JCM X;  3GPL A;  1T3L A;  3MO8 A;  1VQO A;  1E6G A;  1VQ7 Q;  4NS5 A;  1PSF A;  1PHT A;  2L3P A;  4MDW A;  2KE9 A;  4RKU E;  1NPP A;  3REB B;  3JCM J;  1XTD A;  2EGC A;  5L8R E;  1ZSZ A;  5GMK l;  1ARK A;  2VXF A;  4HCK A;  2A28 A;  2DYI A;  4CC3 A;  2K79 A;  1UTI A;  2FO0 A;  4DBH A;  1XQH A;  2OTJ Q;  4YTL A;  5FRM A;  2E6Z A;  1RLQ C;  2HD0 A;  2HKN A;  2CP0 A;  3FC3 A;  3GNG A;  3G71 Q;  3O8V A;  2E65 A;  1TTH B;  2DF6 A;  4FU6 A;  3QDF A;  5CO7 A;  1PCX A;  1X27 A;  3M57 A;  1MMD A;  1K8A C;  2K7A A;  4BI8 B;  3EG9 A;  2P0Q A;  1YHQ T;  3E19 A;  1MMA A;  1EIF A;  2EGA A;  1LJO A;  1M30 A;  4KRT A;  3CCS T;  1IXD A;  2DFU A;  2LT4 A;  1UEB A;  4IKF A;  2M0Y A;  4DBF A;  1N9R A;  2X3W D;  2GQI A;  1KK7 A;  4OB0 B;  4TVR A;  2CUD A;  1RAI B;  1Q81 C;  2DVE A;  2KBT A;  2HZY A;  3OYN A;  2XIC A;  1YIT A;  1NZ9 A;  1BKB A;  3JCM Q;  1GFD A;  4C8Q C;  2DX1 A;  5GAN 8;  2QA4 Q;  3CQT A;  2JOY A;  3UA7 A;  1G2B A;  2ZPF B;  4C92 B;  2KYB A;  4HCC A;  1VQM Q;  4JRI A;  5CKB A;  3CME Q;  4M7A C;  2RNA A;  1BIB A;  2QDY B;  4XAX B;  5HCK A;  1M1K R;  3E2U A;  1ZX6 A;  2KNB B;  3UAT A;  5IXF A;  1VOM A;  1IZ6 A;  1TUC A;  4Z88 A;  1QVG S;  5ECA A;  1N27 A;  4OB1 B;  2G3R A;  2MYS A;  1Q81 R;  5FU7 C;  1K9M U;  5I2M A;  4M4Z A;  4M75 B;  4F04 B;  4FYV B;  2KEA A;  4C0F A;  3OYM A;  3DB3 A;  1SEM A;  1TH7 A;  3IQL A;  2DD4 A;  4JRQ A;  2DL3 A;  4OGE A;  3CCS A;  2IG0 A;  3NPF A;  1H3Z A;  2IPO B;  2RD1 A;  2LVM A;  4CI0 C;  2F69 A;  2E64 A;  2KRN A;  3RBB B;  1EZZ B;  1N5Z A;  4C0D C;  2QEX T;  2AHJ B;  2QQB A;  3KFV A;  3G6E Q;  2O2O A;  4J5Y A;  2DPP B;  2F5K A;  3HRU A;  4JZ4 A;  2VVK A;  3SB2 A;  4Z89 A;  1M90 C;  1NLO C;  1MUZ A;  1ZLM A;  2YWW A;  4WCI A;  4O6J A;  1PG5 B;  2E4H A;  5IH2 A;  1D3B B;  4FYX B;  4M78 B;  4QKU A;  3A1P A;  3A8L B;  1JB0 E;  4B9W A;  3OBY A;  4PKC C;  3CCL T;  4P5N A;  2XDB A;  1BCM A;  4IUU A;  3VUZ A;  3HFN A;  4FL6 A;  4ZN3 A;  6AT1 B;  2EQM A;  2ED0 A;  3QWX X;  1U3O A;  2J7I A;  5D6W A;  3GF5 A;  1WNL A;  2JMC A;  5GAO m;  2L89 A;  2RQU A;  2DXB A;  3LX7 A;  4PJM A;  1ZUY A;  2YUQ A;  4HT9 A;  3CC4 Q;  4RTX A;  3SWN C;  1QVG P;  3T9N A;  4M78 A;  4J7F A;  2CDT A;  2YT6 A;  2ESW A;  3H9N A;  2X51 A;  1U1T A;  1M2V B;  1M8V A;  2FZG B;  1YCS B;  4JS5 A;  2DZC A;  1JXM A;  2XU8 A;  4ME7 A;  4BE0 A;  2J6O A;  2BE9 B;  4M77 E;  1AWX A;  3L42 A;  3PE0 A;  1GFC A;  1PSE A;  3P8H A;  2MAM A;  2YRD A;  3GLX A;  2X35 A;  1Q86 C;  2PVG B;  4PL6 A;  3O5Z A;  4M78 C;  1ZA2 B;  2A08 A;  2JT4 A;  3I55 Q;  2CGH A;  5GAN 5;  1YNZ A;  4PJJ A;  4M78 E;  1YI2 A;  2DYB A;  2VC8 A;  1BCO A;  5GAN 7;  4KT0 E;  1M90 U;  3PMI A;  1S72 T;  3JAM E;  2NUP B;  1UJY A;  2FZC B;  3A8H B;  3MP8 A;  1T3S A;  1VQP Q;  3PFS A;  2HQH A;  3CC7 Q;  2XD0 A;  4C92 E;  2BZ8 A;  3CCM A;  1U1S A;  4M7A E;  2L3Q A;  1UGS B;  1UUE A;  2QTX A;  3KUF A;  1BBZ A;  3D7S B;  3MET A;  1UDL A;  2YUN A;  1HSQ A;  1D0Y A;  4E7Z A;  2C0I A;  1C6V X;  4C8Q F;  2VXE A;  4DOW A;  4OP0 A;  1G5V A;  5CKD A;  3NGP A;  2PUK B;  4E7S A;  2RHI A;  2COY A;  4UC4 A;  5LJ3 f;  3EG2 A;  3FIF A;  3SDZ A;  1JO8 A;  1P92 A;  2E1H A;  2QGF B;  4FYW B;  4M75 A;  4AFU C;  3LWH A;  4M7D G;  1O9S A;  3RDV A;  5C6S A;  3VYG A;  5GAN d;  1Q7Y R;  1O75 A;  5GAO n;  3CBP A;  1X43 A;  4M7A D;  2FHD A;  2JW4 A;  2X4J A;  3V8J A;  1IO6 A;  4PJO D;  1UB4 A;  2QTV A;  4ZTF A;  2BTT A;  2RJC A;  1YJN T;  1VQ5 A;  2C06 A;  4PJO E;  2KXC A;  5IHK A;  1U5S A;  7AT1 B;  1Y57 A;  5FWB A;  2K6D A;  1KQS P;  2FYK A;  3EGD A;  1VQ9 Q;  2DEQ A;  4HCZ A;  2L2P A;  4M75 G;  4OVA A;  4M78 F;  2QXF A;  4OB2 B;  2K5L A;  4HVU A;  3CCQ A;  4ZGD B;  4JUV A;  3OYB A;  2A3L A;  3KBG A;  2YHT A;  1JJ2 P;  4PJO G;  3G4S Q;  5FLX E;  1LPL A;  4RTV A;  4OB3 B;  2KMT A;  3DKM A;  2M9U A;  2PVD B;  1ZSZ B;  1QCN A;  4ELZ C;  2DBK A;  1WHL A;  1D0Z A;  1VQ5 Q;  4A53 A;  2E3I A;  2F5T X;  1WX6 A;  3QYG B;  5D6X A;  2GBQ A;  1GCQ C;  1K76 A;  1WIE A;  3NFC A;  2EQJ A;  4V2S A;  2JS0 A;  1QKW A;  2OTL Q;  4IIM A;  4MZT A;  1VQ5 T;  4DOV A;  1K4U S;  2OX7 A;  2HBW A;  2ZPE B;  4KGZ B;  1MGQ A;  2DO3 A;  2E6N A;  1AOJ A;  1QP3 A;  2KY9 A;  5LJ5 j;  3JB9 D;  1TWB A;  4ELY C;  3MHX A;  2QI2 A;  4RTY A;  2X9H A;  2NYS A;  3EAE A;  1YIJ T;  1VQM T;  2GTJ A;  1M2V A;  1PD1 A;  3A8M B;  2DE0 X;  1ZA1 B;  2EKH A;  1K0S A;  4M7D A;  1RAG B;  2DNU A;  2GGR A;  1KQ1 A;  1G3T A;  5GAN g;  1YJ9 T;  4J83 A;  4RUG A;  4J9E A;  2AK5 A;  4OF1 A;  2OTJ A;  1X01 A;  3AHU A;  4M7A A;  5IHI A;  2KRS A;  1W2B A;  4EMG A;  3V8L A;  2O9V A;  3HTR A;  2B86 A;  3JB9 G;  1VYV A;  4X9D A;  3OYH A;  1QKX A;  2DTI A;  3JB9 J;  3QXE B;  4D8D A;  2JXB A;  2YUO A;  1UGV A;  2CZ1 B;  2NLU A;  3CCS Q;  2CZ6 B;  4K11 A;  1MV3 A;  5I11 A;  5HY6 A;  3G71 A;  1R0C B;  1NJI C;  3CBM A;  3P8B B;  4LUE A;  3CD6 Q;  2EW3 A;  5GAO q;  3S3N A;  3LW5 E;  2CP5 A;  3GNF B;  2CZ0 B;  4JJN K;  3TRE A;  2EJ9 A;  4JJB A;  2LJ1 A;  3BFM A;  2YUP A;  4RTZ A;  1M90 R;  4R0K A;  4KGV B;  1Y07 A;  1Q86 U;  4EDU A;  1VQK T;  4B9X A;  4QQD A;  2P0K A;  4MML A;  2V8I A;  1K73 C;  4J6X A;  4OMQ A;  3EG0 A;  4VUB A;  4RTU A;  3QUI A;  2VB6 A;  3V7R A;  1Z9Q A;  3ULR B;  1X6G A;  2WSC E;  1Q82 C;  1C1A A;  3OYA A;  1HD3 A;  3L2U A;  3L2Z A;  5FRO A;  3OW2 A;  1QVG A;  4RCC A;  2K5I A;  2HAX A;  3QPH A;  2HMA A;  5GAN h;  4C8Q D;  3CCU A;  4HA8 A;  3OSV A;  4O5V A;  1AZE A;  1ZUU A;  2DKG A;  3H6Z A;  3TSW A;  2ROT A;  2FRY A;  1YJN A;  4KGX B;  1IB8 A;  2FPF A;  4F7U B;  3JB9 I;  1AT1 B;  4LDV A;  1RL2 A;  1VUB A;  4RG8 A;  1NLP C;  2QQS A;  2EJF A;  4FIB A;  1OYX A;  5GAN 4;  4A4G A;  3HRT A;  1ZQ1 A;  1W70 A;  1X6B A;  2RB6 A;  4JZ3 A;  4OMF B;  1GBQ A;  1Y96 A;  3NTI A;  3M9Q A;  3VRY A;  3OSS C;  1D0X A;  1OU9 A;  4ORZ A;  1UEC A;  5LJ5 h;  2MOX A;  1HXD A;  1IGQ A;  2V1Q A;  1WZO A;  2RF0 A;  4M77 B;  1AWO A;  5GMK h;  1YI2 T;  3FRN A;  3LH0 A;  1FX7 A;  2EQU A;  4LUD A;  2M1H A;  2VGN A;  5GAN 3;  1R0B G;  4BI3 A;  1Q81 U;  2H3E B;  2FZK B;  3M55 A;  2A37 A;  2HL5 C;  1D09 B;  1PKT A;  2EYY A;  2CSI A;  1GCP A;  3M0Q A;  1R8O B;  4JS4 A;  2PVO B;  1ACM B;  4AT1 B;  3HKS A;  3HPW A;  3EHQ A;  5LL6 S;  1VQL A;  2LNV A;  1MHN A;  2AZV A;  1T0J A;  5KCO A;  2EIF A;  1VQ6 Q;  3GP8 A;  2A0F B;  2QQA A;  4PNO A;  2VYT A;  5AT1 B;  2RI2 A;  3OYY A;  4JJD A;  2I0N A;  3TEE A;  1M4Z A;  3PNW C;  3URG A;  1NJI U;  3EGX B;  3X24 B;  2RK1 A;  1JRI A;  3BE3 A;  2YLC A;  2RHY A;  1BK2 A;  1VQM A;  2EPD A;  3QYH B;  3L2W A;  4X34 A;  2CSQ A;  4ZNX A;  4M75 C;  5CK9 A;  3CPW S;  4AFQ C;  4KH1 B;  2RHU A;  1WQ7 A;  3FJP A;  2GCX A;  2QG9 B;  2M0O A;  1W1F A;  3JCM W;  1N9S A;  2CP2 A;  2NUT B;  3MPU B;  1TSF A;  5J26 A;  4M77 G;  5C0M A;  3VV0 A;  4PFP A;  1NE8 A;  3NTH A;  1YIT T;  5IAY A;  3CCR A;  3TSZ A;  2FL7 A;  4PJL A;  1YJW A;  2D0N A;  2HL3 A;  5GAN f;  4QQG A;  5CKF A;  3VU3 C;  2DMO A;  1VQL T;  3CC4 T;  2D0Q B;  2R5M A;  2PUO B;  2DXU A;  3EGD B;  5DM7 R;  1OOT A;  2QYZ A;  5I21 A;  1G3S A;  2XI9 A;  1JEG A;  3ME9 A;  2RJF A;  4RG2 A;  3GIB A;  3UDC A;  1NYF A;  2FPE A;  4C92 G;  5KYN A;  2CYZ B;  4GBQ A;  4DBQ A;  3SHW A;  5I22 A;  5IT9 E;  1T0H A;  1XOV A;  4LE9 A;  3M0U A;  3MKD A;  4Z8A A;  4CC7 A;  3QDR B;  1JJ2 S;  3OBW A;  4HCB A;  8AT1 B;  1JQQ A;  2HDA A;  1TS9 A;  3I5S A;  1MMN A;  2GFA A;  1I4K 1;  2QAS A;  1OU8 A;  2ABL A;  3EHR A;  4ZGJ B;  2O31 A;  2LX9 A;  3R6N A;  2QGG A;  2CT4 A;  3CCU Q;  2KK4 A;  4EMH A;  1MMG A;  4E47 A;  4F14 A;  2JM8 A;  2BKD N;  1OV3 A;  1MV0 B;  4XU2 A;  2OTL T;  2ATC B;  5M9O A;  2FEI A;  4E7L A;  3ZBD A;  2QA4 A;  1JXO A;  3PMT A;  2MCN A;  4MDX A;  5I2S A;  5KH6 A;  2COZ A;  2YSQ A;  4F16 A;  1YJ9 Q;  1Q7Y C;  2Y90 A;  4AG1 C;  2XDP A;  2K3B A;  3CC7 T;  5GMK e;  2XKO C;  1XJW B;  3OS0 A;  1UJ0 A;  1PRM C;  3S3O A;  5LJ5 g;  2SEM A;  3RKW A;  4CC4 B;  5CIU A;  1R77 A;  4OML A;  3J7A F;  1VQ7 A;  1E7O A;  1YJ9 A;  1A0N B;  2JN0 A;  1E6H A;  4ANJ A;  2VGM A;  2KT8 A;  4JRK A;  4MZP A;  3J81 E;  2BE7 D;  4RTT A;  1VQ4 T;  4LDY A;  2PTK A;  4FT2 A;  4PJN A;  2V1R A;  3FDR A;  5GAN e;  2DBM A;  2E5K A;  2WAC A;  1YJW Q;  4ZTJ A;  1YP5 A;  4HXJ A;  3LLR A;  5A0G A;  2HQE A;  4XQ3 A;  4X1V A;  1X6O A;  1NJI R;  2Z0W A;  2EAY A;  3V8K A;  3MEA A;  1B07 A;  2DVJ A;  2K4Y A;  4ZN1 A;  2DXT A;  1M1G A;  1UE9 A;  1J3T A;  2DA9 A;  4F7U F;  4AG2 C;  3QO3 A;  2BUD A;  5LJ3 j;  3OYG A;  1M3B A;  4OMO A;  1NG2 A;  2DJQ A;  4LDW A;  3CMA Q;  2DJZ A;  1N8R R;  3P8D A;  4LDX A;  1LNX A;  5KCH A;  1OPK A;  2ZGW A;  2EJG A;  4C8Q B;  2R5A A;  3PVQ A;  2DRM A;  3A8G B;  1NYG A;  3OA6 A;  3PTA A;  2AKL A;  5KYW B;  2ED1 A;  2QQ9 A;  2RA2 A;  1KHC A;  5DLO A;  5GAM j;  2ZZD A;  2LNH B;  3M58 A;  3VS5 A;  4J9B A;  1W6X A;  2LX7 A;  3EFO A;  3EFO B;  2DTH A;  4KUL A;  3I56 A;  1KHI A;  2EVR A;  2QEX A;  3VS2 A;  2DET A;  3X25 B;  1ABO A;  1PD0 A;  4DEX A;  2KRO A;  1ABQ A;  4B6M A;  2P4T A;  5DLQ E;  3RMQ A;  3ASK A;  3JB9 F;  2RI5 A;  1BI2 A;  4EMK C;  4RCB A;  5CKE A;  1ZHI A;  1OUL A;  2JZ2 A;  5GAO l;  1QW1 A;  1OQK A;  3CCM Q;  2FG0 A;  3SFM A;  5GAM h;  1QP2 A;  3FB9 A;  4HVV A;  4CC2 A;  1RUW A;  3J80 E;  3CCV A;  4DQ2 A;  1GRI A;  2M02 A;  3HP9 A;  4IUQ A;  2LQW A;  2LMJ A;  1VQL Q;  1QVF P;  2J6K A;  4J8O A;  5IN1 A;  2P4R A;  4WF2 A;  1WHH A;  3CCE A;  3VS0 A;  1CSK A;  4A4F A;  1IHV A;  1U8R A;  4BD3 A;  1QQJ A;  5J39 A;  2M16 A;  3M59 A;  3QG1 A;  2BZX A;  4C8Q E;  3MEU A;  3OYD A;  1RAH B;  1VYU A;  2EYZ A;  1OEB A;  2LTO A;  1KD1 R;  3EGU A;  2KDS A;  1KD1 U;  4XTZ A;  3N5B B;  4N4I A;  1S72 Q;  2B8A A;  3CC2 A;  3Q1J A;  5FWC A;  1I81 A;  1BI0 A;  4JDS A;  2K57 A;  3L2R A;  4ZGE B;  4LD9 K;  1FMV A;  2MIO A;  2MPX C;  2CH4 W;  3GBQ A;  2QA4 T;  3I9Q A;  3FEO A;  1NEG A;  3QWY A;  4MZM A;  2O4X B;  2GFU A;  4XK8 E;  3G4S A;  1VQN Q;  1UHF A;  3OMC A;  2KYM A;  2W0Z A;  3G1J A;  3OW2 S;  2HCK A;  3HL8 A;  1QVF S;  3EGX A;  1BYM A;  2ZPG B;  5D6Y A;  8ATC B;  1VIE A;  1Y0M A;  1GBR A;  1VQ6 A;  2L3R A;  4XU3 A;  5L23 A;  2D6F A;  5KE3 A;  1JBM A;  3JV3 A;  3GOX A;  1B3Q A;  3FLG A;  1N8R C;  1Y71 A;  3VRZ A;  2KAF A;  4ESR A;  3CME T;  4C0D B;  5FRN A;  2DER A;  4AFS C;  2H3J A;  4EMK B;  2EGE A;  2LJ0 A;  5KYU B;  2ENM A;  4QW2 A;  2IVW A;  3QZ5 B;  4C92 C;  1VQN A;  2GF7 A;  2RM4 A;  4N4H A;  2VWF A;  2L8D A;  2DM1 A;  1SG5 A;  3S6W A;  3QJ6 A;  3OYI A;  3UT1 A;  4A63 B;  2FVU A;  3A5Z B;  2SRC A;  3F70 A;  4C92 D;  3JCM g;  1KC8 R;  5FU7 B;  5A2Q E;  2W10 A;  4HKE A;  2JUF A;  1WFW A;  3QJY A;  1WGS A;  1TUG B;  3CC2 Q;  5CR2 A;  3CD6 T;  2LDM A;  2JTM A;  2JTE A;  2DL4 A;  3JCM V;  4OMM A;  5GJW B;  4M7D D;  3UPU A;  4JJC A;  2DL8 A;  3MCA B;  3VUB A;  2GNC A;  3QHS A;  4AFZ C;  4LDU A;  1RAD B;  1VQO Q;  4FT4 A;  3JCM e;  2OI3 A;  1Z9Z A;  2QQR A;  4JPB W;  3JB9 H;  3VS7 A;  4C0G A;  2KR3 A;  3EG9 B;  1RAE B;  2G6F X;  2EYQ A;  2DTO A;  1B34 B;  2YDL A;  4XTV A;  4M7D F;  2MWO A;  2YLB A;  1X2Q A;  5HK3 A;  3I35 A;  3HRS A;  1VQN T;  5LJ5 e;  2HSP A;  3CCL Q;  4BY6 B;  2PNI A;  3LH5 A;  3I56 T;  5HK0 A;  2E5Q A;  4F7U E;  1VQ9 A;  1FYN A;  1QVF A;  2FB7 A;  1KFZ A;  1VA7 A;  4BI4 A;  1ZBJ A;  3L1A A;  2GTO A;  2DXC A;  4FM4 B;  3VS4 A;  1TOV A;  2MK5 A;  3A8O B;  2ZPI B;  2RHX A;  4PJO B;  2QAZ A;  2IIM A;  3JCM b;  1YFN A;  2JS2 A;  1WI7 A;  3C94 A;  3H0I A;  3A98 A;  3BY7 A;  2CUB A;  1OX9 A;  2HNI A;  1AHJ B;  1W2B S;  3LYI A;  1SRM A;  2LRQ A;  1PWT A;  2K5F A;  2KRM A;  1GCQ A;  4FW2 A;  4NL3 A;  4GLK A;  4FSX A;  1VQP T;  2XDD A;  3I55 T;  4FYY B;  4QVZ A;  2RH2 A;  2D8H A;  1VQ4 A;  2CRE A;  4M77 C;  4C5E A;  3CCE Q;  1X75 C;  2LZ6 B;  5KYX B;  4E7K A;  3U23 A;  1M5Q 1;  1S72 A;  4BE1 A;  3QSU A;  4PFZ A;  1AWW A;  3CCU T;  2RQW A;  2P84 A;  1Q82 U;  3CMA A;  1SKU B;  1K9M C;  1H8K A;  2D9T A;  5LJ3 h;  4BY6 C;  2KGT A;  1IGU A;  2MMP A;  3NMZ C;  3PVL A;  1AEY A;  2X4W A;  5GAO p;  3JCM f;  5LJ3 e;  3OW2 P;  1UG1 A;  5KYU A;  1WYX A;  2V8J A;  3QII A;  4E7I A;  2O4X A;  2XHC A;  1ZUK A;  4L6V 5;  3OY9 A;  3M0P A;  1YIJ A;  1LVK A;  4A4K A;  2RJE A;  2RHZ A;  4M7A F;  1EFN A;  1WJQ A;  3CME A;  4PJO C;  1CKA A;  4LD6 A;  5LJ3 g;  1Q7Y U;  2L3S A;  4WTO B;  1QLY A;  2RQR A;  3I55 A;  1MND A;  2OTJ T;  1BI3 A;  1M1K U;  1YIT Q;  4Z02 A;  3CXC S;  1HK9 A;  1D1A A;  1D1C A;  1I07 A;  2CZ7 B;  3RIR A;  3LGF A;  3CMA T;  1WXB A;  4Y28 E;  1QWF A;  2ROL A;  2K9G A;  3EG1 A;  1FWZ A;  3RNJ A;  4L5G A;  2DEU A;  3CEY A;  1V29 B;  3E9F A;  4QVD A;  2RJD A;  3H8Z A;  3V7S A;  4M78 D;  1VQ4 Q;  1V1C A;  3M0R A;  5CVI A;  2OTL A;  4C5G A;  1PRL C;  3HFO A;  4OMP A;  1HJD A;  3CPW P;  1YWO A;  4IUT A;  5FW9 A;  1YN8 A;  3CD6 A;  2VAS A;  2A36 A;  3VYH B;  1AVZ C;  3OYC A;  1Y96 B;  2NUZ A;  1W4S A;  2VV5 A;  5CQY A;  4M77 D;  5GJV B;  3KXT A;  1TUD A;  4XU1 A;  1NBE B;  2DIQ A;  4R55 A;  1IRX A;  4MMK A;  2E41 A;  1VQ8 T;  2R58 A;  1KQS S;  3QBY A;  3RKY A;  2O88 A;  4BDY A;  1I5O B;  1SF9 A;  4RMO A;  2F1L A;  1WA7 A;  3CCV T;  2GQV A;  3WVD B;  5CAI A;  3OMG A;  1QMC A;  3MEV A;  3CPF A;  1I1J A;  1FMW A;  3WXM B;  4PJO A;  1OX8 A;  3CPW A;  1YWP A;  4NL2 A;  3UA6 A;  2JM9 A;  2CKK A;  4M75 E;  3V7C A;  4M75 F;  3CCJ A;  1KQ2 A;  5LJ5 f;  4BAC A;  4A54 A;  1TU0 B;  3CCR T;  2KXD A;  1WXU A;  2ECZ A;  3M0T A;  1PNJ A;  3PT9 A;  1KIK A;  3MEW A;  2C0O A;  3VS3 A;  4C92 F;  1UHC A;  5EG2 A;  3RKX A;  1OZ3 A;  2AKK A;  2AZS A;  1M3C A;  1WHK A;  2D1X A;  1K9A A;  2YRV A;  4M77 A;  1Q82 R;  4IIO A;  2DIG A;  3JCM h;  2K2M A;  3CXC A;  2CH4 A;  3G4S T;  3DLM A;  3HSB A;  1YHQ A;  5DY9 A;  1WJR A;  1SHG A;  3RR6 A;  2JNG A;  3JCM c;  2DRK A;  1JJ2 A;  4BE2 A;  4IUV A;  2OAU A;  4E7J A;  3LWI A;  2RQT A;  2EQI A;  1OZ2 A;  3THK A;  4LNP A;  1SSF A;  2V8K A;  2JMA A;  1V76 A;  3AT1 B;  4E2F B;  2PU9 B;  4JLG A;  4D8K A;  1VQP A;  9ATC B;  2HBP A;  2HEQ A;  3CCJ T;  2DLP A;  2FPD A;  1ZSG A;  2R57 A;  4M77 F;  1LOJ A;  4M7D C;  1K0X A;  2LQ8 A;  2LC4 A;  3SWN B;  4N0A A;  1I0C A;  3H0F A;  4C0Z A;  4J9C A;  1B7T A;  3SEM A;  3OQ5 A;  4J6W A;  3TCJ A;  1UFF A;  3JSC A;  2MF2 A;  3M56 A;  2X4X A;  3X26 B;  4DA4 A;  1NM7 A;  3C0C A;  1KC8 C;  1WJS A;  4C8Q G;  2QEX Q;  1PC0 A;  3SD4 A;  3OYL A;  4DBR A;  4XTU A;  4IUR A;  3TU4 K;  2CP6 A;  1WQW A;  3UWN A;  4PLI A;  4PK4 A;  1RI9 A;  3MP6 A;  3CCQ T;  1KJW A;  1VQO T;  2KT1 A;  5GMK j;  1VQ7 T;  4ATO A;  3M4Y A;  1VIF A;  3G6E A;  3WVE B;  1U06 A;  1SHF A;  3S3M A;  4X9C A;  2VKN A;  2HSE B;  1G3W A;  3OYF A;  1M3A A;  2J05 A;  5KYW A;  4J9F A;  1W2B P;  1WHM A;  2PQW A;  3CC2 T;  2QK0 A;  4J9H A;  4RTW A;  2EBP A;  3EH2 A;  2JJ9 A;  3LGL A;  3OS1 A;  1VQ9 T;  2XID A;  1YBY A;  2KI7 A;  3CCM T;  5A0L A;  2DD5 A;  4KH0 B;  2ZPH B;  4M78 G;  4J9G A;  1NEB A;  2HQX A;  5FU6 B;  1WLP B;  1IRE B;  2PZ1 A;  1K8A U;  3E9G A;  4OGC A;  2OAW A;  4L59 A;  3CC4 A;  1AWJ A;  2K3Y A;  4Q5W A;  3E1S A;  5GAM g;  3RER A;  5GAN 2;  1GXI E;  4M75 D;  4LN2 A;  3I56 Q;  2DK3 A;  3VS6 A;  1VYT A;  1B34 A;  3ER0 A;  4PJO F;  1UGQ B;  3PGG A;  5J3B A;  2LCC A;  2RI3 A;  1HYO A;  1RAB B;  4J7I A;  2E70 A;  1YI2 Q;  5FU6 C;  5KYX A;  4N4G A;  2CP7 A;  1KD1 C;  3NTK A;  2CS7 A;  1M2O A;  2KVQ G;  4QVC A;  1JU5 C;  3I5R A;  3CCR Q;  3ZEH A;  2E10 A;  2NUP A;  1SRL A;  3DLL A;  3VS1 A;  2RPN A;  2AT1 B;  5GMK i;  4M7D B;  1AD5 A;  1RAC B;  5CQX A;  5A0D A;  3OYK A;  1H92 A;  1S1N A;  3CBO A;  1RI0 A;  4E7H A;  2Y4X A;  4M7D E;  1K1Z A;  2CT3 A;  2C0T A;  4F17 A;  4AMC A;  1FXX A;  4A4H A;  2DAQ A;  1OPL A;  2EWN A;  4KUI A;  1M8M A;  1QCO A;  3OS2 A;  2K2V A;  2E3H A;  4EIK A;  5GMK m;  2ZAE A;  2ZPB B;  1KQS A;  2WSF E;  2DIL A;  2AIR B;  2YXY A;  1M9S A;  2RK2 A;  2J06 A;  3OYJ A;  1WXT A;  4JLI A;  3JCM d;  2L0A A;  4BB7 A;  3M0S A;  4J6Y A;  1BB9 A;  1PM3 A;  3OB9 A;  4PFO A;  3M54 A;  4EMK A;  3REA B;  4Y92 A;  2M51 A;  5EC7 A;  2OJ2 A;  4FCY A;  4PLL A;  4KBM B;  1KG1 A;  4CRI A;  1AZG B;  2H8H A;  2D8J A;  3BDL A;  1GL5 A;  3EFS A;  2WSE E;  5KYY A;  5GAM e;  1WDX A;  2LQN A;  4XTX A;  3X20 B;  1TXQ A;  2LCS A;  4JRP A;  2NUT A;  4C8Q A;  1XNI A;  1PKS A;  3VJP A;  1K73 R;  5IHN A;  2EFI A;  1KC8 U;  3M4G A;  2L5Q A;  3M53 A;  5GAN 6;  1M1F A;  2CP3 A;  1EX4 A;  3EH1 A;  2EYX A;  1RAA B;  4Y91 A;  1ZBX A;  1D3B A;  2A7Y A;  2JVV A;  2RN8 A;  3ZFJ A;  1BIA A;  3CCL A;  1I8F A;  3G6E T;  3CCV Q;  2LQK A;  1F1B B;  4D6W A;  3PIO A;  1VQK Q;  3OS5 A;  1QWE A;  3INZ A;  3TQ7 P;  5LJ5 d;  1I5L A;  2F2X A;  2O01 E;  1C0M A;  1BI1 A;  2F2W A;  1K8A R;  2X3X D;  2MI6 A;  1X2K A;  2J6F A;  4XTW A;  4M7A G;  1NPR A;  1Y7X A;  2XG8 D;  4J9D A;  1N8R U;  2XMF A;  3RES A;  2YRC A;  3H41 A;  3CCQ Q;  1SPK A;  1YIJ Q;  1YHQ Q;  4NOY A;  3OYE A;  5GAN j;  1UGP B;  3X28 B;  1H3H A;  5IXB A;  2DL5 A;  4DEY A;  4N0A C;  2F2V A;  3ZL7 C;  2EKO A;  2RO0 A;  3JCM P;  2V26 A;  1IHW A;  3G71 T;  2RQV A;  1RAF B;  3CC7 A;  3C95 A;  1KSW A;  3TVT A;  4QQ6 A;  1WHG A;  1YCY A;  1VQK A;  2COW A;  1G3Y A;  1Q95 G;  2LT1 A;  2NWM A;  4II1 A;  4F7U A;  3CXC P;  2BIV A;  3VKI A;  1G83 A;  1CKB A;  2O9S A;  1WHJ A;  1H64 1;  3JRZ A; 
#chains in the Genus database with same CATH homology
 4FW1 A;  4FW2 A;  5D7U A;  1C1A A;  1IHW A;  1EX4 A;  1QMC A;  1C0M A;  1IHV A;  1C6V X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...