1QMCA

C-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
b'MIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 INTEGRASE
publication title Refined Solution Structure of the C-Terminal DNA-Binding Domain of Human Immunovirus-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1qmcA00
1QMCA 1C1AA 1C0MA 4FW2A 1IHVA 1C6VX 4FW1A 1IHWA 5D7UA 1EX4A
chains in the Genus database with same CATH superfamily
4BE1A 1AD5A 1BI0A 4C8QB 3RNJA 5GANh 1M90C 2HSPA 2LZ6B 4BE0A 2HBWA 2YLBA 1QWFA 5LJ5d 1WQWA 3P8DA 2XICA 1U8RA 2A28A 3REBB 1UECA 5KYYB 1SF9A 4M75C 1NYFA 2F2WA 4RTUA 3OYHA 1JJ2P 3GPLA 5GAOm 3QBYA 3VS6A 1HD3A 1VQ5A 2F1LA 2CP0A 2QI2A 2VKNA 1QVGS 2Y4YA 5A0DA 2FHDA 4ZGJB 4QKUA 2EFIA 2RHXA 2OAUA 5GAMh 1XNIA 3JCMW 3CC2T 2NUTB 1NBEB 5FU7B 2H3JA 4A53A 5IAYA 1JBMA 1V29B 1Q81R 1PSFA 5IHIA 1QVPA 2KYMA 2LX9A 3ZBDA 1VQ9Q 3CC4T 2E6NA 2YWWA 1RLPC 3HL8A 1ACMB 2XU8A 4X1VA 2K2VA 2HBPA 4PK4A 1I8FA 4J9DA 2FO0A 5GAN2 3CPWP 4CC7A 1Q95G 5GAOl 3BY7A 1OEBA 2HQXA 1D0XA 2VC8A 3J80E 4RUGA 4WF2A 2E12A 5KYWB 1OX8A 1EZZB 4N4GA 2X4WA 2QEXQ 1JQQA 1K8AR 1ZBXA 2COZA 1TOVA 2M0YA 4JRQA 3RKXA 1I5OB 4NOYA 5HCKA 2M9UA 4M4ZA 2FL7A 2ZZDA 2LMJA 1QP2A 3OSVA 4ZTJA 1KK7A 3OYCA 2EYZA 1KHCA 1OU8A 1NPRA 1WJRA 4L5GA 1M30A 3M5AA 2D0NA 3OYMA 4M7DA 4HCCA 5CR2A 3J7AF 4R55A 3L2WA 4M75G 4EIKA 4LUEA 3M0TA 4XTVA 1G3WA 4KULA 2AKLA 2JS0A 2LT4A 3RKYA 3M54A 2RJCA 1EX4A 1VQ8Q 1CKBA 2KRNA 2LC4A 1N8RU 4EMKC 2HZYA 1VQ9A 5IN1A 3CCSQ 3EG9B 4FL6A 3OSSC 2GFUA 4C0FA 2J6FA 5J39A 5LJ5h 4J9GA 1RACB 2RI2A 1VQ8T 3JCMc 4M77G 2ZGWA 1YIJQ 1M1KC 5I22A 1VIEA 2R57A 1QMCA 3M0UA 3CCST 2JZ2A 2DF6A 1KC8R 3X24B 4J5YA 1YIJT 4II1A 1Q86C 2LJ3A 5GANe 1TU0B 4PJOD 4IURA 1K9MR 4V2SA 2COWA 4IUQA 2AT1B 1GFCA 3TCJA 2K5IA 1NEGA 4ZN1A 3EFOB 2IG0A 4PJNA 5LJ3d 1KIKA 1QVFP 1KD1R 1M2VB 4N4IA 1LPLA 2KI7A 4XQ3A 3JB9J 3META 3PVQA 4RG8A 3VS7A 2DFUA 2LQ8A 3ZFJA 1ZA1B 2MMPA 2JM8A 3A8LB 4OMLA 2KAFA 3OYKA 4M75B 1ZA2B 5FROA 2CUDA 1VA7A 5GAMe 4ELYC 3HFOA 1VQ8A 5A0GA 3I5RA 1UGPB 3JCMJ 3BW1A 3F70A 3CCSA 4JJNK 4FW1A 1UJYA 4N0AC 1Y57A 2CP3A 1YIJA 4ORZA 1ZHIA 3VS3A 2XDBA 4F04B 1T0JA 4M77B 5CKEA 3ZL7C 1WDXA 1VQMQ 1OZ3A 1TTHB 2CZ0B 5LL6S 4PJOC 1Y96A 4OF1A 1WHHA 4XU2A 1UGSB 3WXMB 1I5LA 5GAN5 4N4HA 3OS0A 1AWWA 3EAEA 2GCXA 4RMOA 1U1TA 1WHKA 3M0SA 1B34B 2E5KA 2DILA 2MK5A 2G6FX 3VV0A 1K0XA 5GAOr 1WXTA 3ME9A 1YJ9T 5GMKh 1HK9A 2JOYA 1RAGB 2A0FB 3JCMV 3C95A 1E6GA 3VKIA 2MWOA 4C8QF 1VQ4Q 1D1AA 2HKNA 2HMAA 3V8LA 1NJIC 3EH2A 1K76A 1VUBA 1G2BA 4EMHA 2RHYA 2PUKB 1W2BS 2DYIA 3G4SQ 1G3SA 1ZSZC 2EYQA 3VS5A 4A4KA 2NYSA 3GP8A 4RG2A 4CI0C 1VQMA 2JN0A 5LJ5f 4EMKB 3DLLA 5LJ3h 3JCMh 2FVUA 4PFZA 1Y7XA 2KVQG 1IB8A 2F2XA 4GLMA 4QQDA 4E7KA 1OULA 4DBQA 5GAOn 2NUZA 2M02A 5C6SA 1X75C 2JUFA 4ELZC 1B7TA 2YUPA 3LH5A 5IHKA 2L0AA 2A3LA 4IUVA 3ULRB 4BD3A 3BE3A 3C12A 1AWOA 3CCMQ 4M75E 4BI3A 3FB9A 1VQ4A 1Y07A 4OB3B 5CCAA 1RLQC 3OS5A 4JJBA 3DKMA 2XDPA 4AMCA 3CCMT 1GCQC 2RPNA 1PRLC 2EAYA 5GANg 2E3HA 1F1BB 3TEEA 3JB9D 2NUPB 3M57A 4M77E 3FDRA 1XJWB 5GAOp 4E7LA 3CMAT 4RTTA 2KMTA 2L2PA 1KFZA 1S72T 4J6XA 5EG2A 2EJGA 1WX6A 2EYXA 3M0PA 1W70A 3GOXA 1Q7YR 3VU3C 4C8QC 1TUCA 3BFMA 3QYHB 3I55Q 1OOTA 3CCUT 3CPWA 1A0NB 1K73R 5GAMg 4JLGA 4MMKA 1SG5A 1PHTA 2AHJB 2DA9A 1UHCA 4OGCA 1I81A 1KQSS 1RI9A 3RKWA 3CCQT 1QCNA 4IKFA 4OB2B 2RJFA 4IIOA 1AWXA 3KFVA 3CCMA 2HD0A 3CD6T 2DETA 1MHNA 3UPUA 3KXTA 4OGEA 3O8VA 2KBTA 3L2VA 2CREA 1IXDA 2RB6A 1PCXA 4CC3A 4LD6A 3CMAA 1OQKA 2P84A 4PL6A 1U3OA 3GNFB 4J7FA 2LT1A 4HA8A 1T3SA 2DXCA 1O9SA 3LH0A 1YCYA 4ZGDB 4FM4B 3CCUA 3V8JA 3C0CA 2EKOA 2FZGB 4QQGA 1AWJA 2V1QA 4X9DA 3QIIA 4RTWA 1SHFA 1EIFA 1SSHA 4C92G 5KYYA 2MYSA 4M75F 5GAN6 3JCMe 2VVKA 2QDLA 1N6AA 3S6WA 3CCQA 3OW2S 2CS7A 5LJ3f 3JCMf 1D3BA 3MEWA 3MEAA 3M4YA 4RKUE 5KYUB 2JJ9A 3MJXA 3DLMA 3M0QA 1JO8A 3GIBA 3M58A 4AFZC 2NUTA 1OU9A 2X4XA 4XAXB 1M27C 3A8HB 4LDWA 3HHTB 1AHJB 1M90U 2O9VA 1OPLA 3GBQA 3G6ET 4M77F 5CO7A 1M8MA 3M9QA 4R0KA 2QTXA 2DL8A 2P4RA 1G5VA 4J8OA 5HK0A 5DLOA 1PKTA 4PLIA 3EFSA 4OB1B 3JCMb 4M7AG 2RF0A 2HCKA 3SWNB 1Q82C 1BCOA 3MP1A 1OX9A 5GJVB 4J83A 4OMNA 2MWPA 1IHVA 1C6VX 5GAN7 1T0HA 3CBOA 4C5GA 4JRIA 2BZYA 4D8DA 1YHQQ 2DBKA 3MP8A 1PM3A 4PNOA 2C06A 3HRTA 3O5ZA 2HDAA 2DXUA 2XKOC 1YP5A 2EVRA 1FMVA 1OI1A 3H8ZA 2XG8D 2L3QA 2Y4XA 5KE2A 3EG3A 5D6YA 4C92B 2GTJA 2K6DA 2CH4A 4PJOE 2CT4A 5KCOA 1UGRB 4AG1C 1WIEA 1YFNA 3PTAA 1PSEA 5HY6A 2K3YA 2CP6A 3X26B 2RMOA 2J6OA 4PFPA 3LYIA 3FEOA 1NE8A 3MCAB 2DAQA 2QASA 4J6WA 2QA4T 4KGXB 4RTXA 4DEXA 2EIFA 2WSEE 1GCPA 3M55A 4J6YA 4RTYA 1YI2Q 4F7UG 3L2ZA 3EGXB 3QPHA 3CC2Q 1QVGP 4FW2A 2RH2A 2KXDA 2QYZA 3JB9H 4BACA 4M7AB 1UEBA 2DIGA 3MKDA 2A7YA 1YI2T 5FRMA 3G71T 3A8MB 3CC4Q 2FG0A 2ROLA 4Y91A 2RD1A 5GAOq 5KCHA 2PUOB 1YHQA 1W2BA 3NPFA 4M77C 3X25B 2X51A 4BE2A 1IRXA 1BIAA 2CT3A 3CPFA 4F17A 3EFOA 1M2VA 2EQKA 4LUDA 1QKXA 2F2VA 5AYFA 1JRIA 4A63B 6AT1B 1M1KU 2QA4A 3LGLA 2GTOA 2RI3A 2QAZA 2Y90A 3ER0A 3MP6A 5KYNA 4M75A 4IUPA 1IGUA 4O5VA 1KQ1A 2B8AA 2KE9A 3RERA 2E10A 3FJ5A 4QVZA 4HT9A 2OTJQ 5J3BA 3OYJA 2AK5A 2L3PA 4UC4A 2X3WD 1ZQ1A 1G8XA 1Q86U 4HVVA 5LJ5j 1M1FA 4LE9A 1S1NA 2FPFA 1HYOA 4C0GA 3NTHA 4ZN3A 2W0ZA 1CKAA 1MMDA 1YI2A 3QYGB 2OTJT 3EGDB 4J9FA 3CC2A 4M78D 1M3AA 2V8JA 2VASA 4NL2A 1VQ7T 5FWBA 1TH7A 2EKHA 2YT6A 4PJOF 3OYGA 1LNXA 2V8KA 3CC4A 4XU1A 2IPOB 3TSZA 2O4XB 4E7SA 2L8DA 3I56Q 2EQUA 5CKBA 1X43A 3VJPA 1BI2A 2DD5A 1NEBA 4OMPA 1I1JA 5CAIA 4PLLA 2WSCE 3OYIA 3M56A 1WHGA 2A08A 1MMNA 2C0OA 1GBQA 3I56T 4ATOA 2ZAEA 1OYXA 3NTKA 2G3RA 4QW2A 1YJWQ 2B86A 4C8QE 3I9QA 2YRVA 1SRMA 4OMMA 4NS5A 2E41A 4VUBA 5GMKl 2AZVA 3THKA 2X4YA 1WJSA 4P5NA 3L1AA 1Y0MA 3NHNA 5CQYA 1YJWT 2OTJA 1IREB 2H3EB 1E6HA 2LCSA 2RI5A 2LQWA 2ESWA 3G1JA 3OB9A 4M78C 4DOVA 2VWFA 3L2QA 2E65A 2LCCA 1C0MA 1NLPC 1X27A 4XU3A 1UGVA 3PFSA 9ATCB 3I5SA 1VIFA 4EMKA 2WACA 3CCVQ 1BK2A 2P0KA 2PZ1A 1MV3A 4XTZA 4J7IA 1VQLT 2CZ7B 2KDSA 2ROTA 2L3RA 4JLIA 3I56A 1N5ZA 2MIOA 1NJIU 3LGFA 3CCVT 2LTOA 2QQBA 3QHSA 2RA2A 5GMKj 4DA4A 4LDVA 2SRCA 2OX7A 3CCRT 5D6WA 3TQ7P 5HK3A 5KYXB 2W10A 1YJWA 2KSSA 4E6RA 4QVDA 4LDXA 2DD4A 1UG1A 4BI4A 4FU6A 2K57A 2DKGA 4Y28E 3TVTA 1Q81C 1RAIB 3QKJA 3OW2A 2VV5A 2EW3A 4Z02A 4L6V5 3EG0A 1WNLA 4ZGEB 1U06A 4WTOB 2EQJA 3TSWA 3A8OB 1YJ9Q 4LXCA 2FZKB 3CQTA 1WHMA 2CGHA 3H0FA 2A37A 3NFCA 3A1PA 1XQHA 1N27A 2HSEB 1H8KA 1YBYA 2FRWA 2JW4A 3G7ZA 4C0ZA 1K8AC 1AZGB 1TWBA 2ABLA 5LJ3j 1VQLA 1PWTA 4M78G 1X69A 2DMOA 4QT7A 2DM1A 2EQIA 3CCVA 4GY5A 4MDXA 2DK3A 2J06A 2J7IA 4N0AA 3T9NA 2KEAA 2KT8A 4KUDK 2R58A 1X6GA 2C0IA 1H641 2DJQA 3L42A 4A4FA 5CKHA 4FYYB 1W2BP 2OJ2A 3OYLA 4PJOA 3E9FA 3EH1A 1LCKA 4A4HA 4FYXB 5LJ5e 1YN8A 5I2MA 3RMSA 4C92D 4E7JA 1HSQA 1GXIE 3VUBA 3QXEB 3WVEB 3KBGA 2BE7D 2QTVA 4HVWA 1SPKA 1QCFA 1UJ0A 4JS4A 3JB9F 1K0SA 2K2MA 2K79A 2DLPA 1SEMA 1YJ9A 4K11A 3SEMA 1ZUYA 4JJCA 3OYAA 1WHJA 1VQNT 1IGQA 5I21A 1TUGB 1YNZA 1KC8C 3HRUA 4QQ6A 2VGNA 1VQOT 3SWNC 2RHZA 1TG0A 3CCLT 3NGPA 2KGTA 1K9MC 2DO3A 2KT1A 3RESA 4M78B 1ZSZA 2HL3A 4MZMA 3JV3A 3V7RA 2CKKA 4M7AD 4C5EA 2YUQA 3EG2A 5IHNA 2MOXA 1QVGA 2Z0WA 3EHQA 3CCJQ 1R77A 5FW9A 5HKCA 1U5SA 4ESRA 1KD1C 2LQNA 3UWNA 2COYA 2LVMA 3LX7A 3CMAQ 3EGUA 3HKSA 1S72Q 4PKCC 4CRIA 1WXBA 1M5Q1 5J26A 3CCJT 1Y96B 4C92C 1RAFB 1U1SA 1UHFA 3CCUQ 1XTDA 1KHIA 3M53A 4BUGA 2LDMA 1VQPQ 2O31A 4HVUA 1KG1A 3E19A 3V8KA 5GAN8 2RM4A 2YRCA 3HPWA 4IIMA 2CP7A 1VQNA 1BCMA 1YWPA 1R0CB 2SEMA 3OYEA 1VQPT 3CCQQ 1VQOA 1YJNQ 2YXYA 4JZ4A 2DIQA 2BKDN 4BI8B 3QUIA 1KQSP 3CCLA 3CD6Q 1W6XA 2JTFA 1H3ZA 2YUOA 2BTTA 3CXCS 2GGRA 2P0QA 2RQWA 2QQRA 3PGGA 2JT4A 3JRZA 2DVEA 3VRYA 1YJNT 2ZPEB 2D8JA 1GCQA 1M3BA 1ARKA 4JS5A 5D7UA 5GMKe 4M7AC 8ATCB 1KSWA 5EC7A 2KQWA 3JCMX 2XDDA 5CQXA 2X35A 4CC2A 4XTXA 3VS4A 1UFFA 2JS2A 1LJOA 2DE0X 2CYZB 4Z89A 1E7OA 3CCJA 2DEQA 2K7AA 1GFDA 1S72A 2K3BA 1Q82U 3U23A 1HJDA 4C8QA 3CC7Q 3N5BB 3KUFA 1YCSB 3SD4A 5IXFA 1RI0A 1PG5B 1VQPA 5GANd 3HFNA 1FWZA 3P8HA 3CC7T 1WJQA 1JXOA 5LJ3e 1RABB 5DM7R 2LP5A 3OW2P 2XIDA 4Q5WA 3EGXA 2FRYA 1UDLA 4LDUA 2DJZA 2LCLA 4RCCA 2PU9B 4KT0E 1YJNA 2BIVA 3CCEQ 4MMLA 1BIBA 3OYFA 3G6EQ 4E47A 3CD6A 1VQKQ 5KH6A 2BUDA 3OA6A 1D1CA 2VB6A 1JEGA 5FWCA 3A98A 3CCET 2FZCB 1ZSGA 4M78E 3V7SA 3FC3A 4A4GA 5LJ5g 2LJ0A 5GAMd 2DXBA 1QKWA 1VQKT 3X20B 1PRMC 2K9GA 3FJPA 1QWEA 2AIRB 3MEUA 4XTUA 4EDUA 1ZLMA 2JMCA 2RQVA 3CBMA 2DL5A 2LNHB 2RJEA 2I2LA 1H92A 4DQ2A 1VOMA 1NM7A 4AT1B 2CP5A 2MPXC 3CC7A 1BYMA 4PJJA 1Z9ZA 1N9SA 5KYWA 3OMCA 3VRZA 1WPYA 2YRDA 3I35A 4BB7A 5DY9A 4KH0B 1LVKA 1VYTA 3OY9A 2P4TA 2EPDA 3WVDB 3CEYA 2V26A 3LW5E 1M1KR 2RQRA 2PQWA 3CCEA 1X01A 4O6JA 4JZ3A 3G6EA 2M16A 1VQ5T 4L59A 2FPDA 1VQKA 2QA4Q 1WA7A 4JDSA 1Q7YC 4M7DD 1BI3A 4FYVB 4FT4A 1QW1A 3PMTA 5A2QE 4LDYA 2ZPGB 4ZNXA 2FPEA 4ZTFA 3OYYA 3VYGA 1FYNA 2PVDB 1K73C 2QGGA 2RK2A 3EG9A 1O75A 5CK9A 1NG2A 3G71Q 3PNWC 2QK0A 2ECZA 1NYGA 1D09B 3QDRB 2KRMA 4OP0A 4JPBW 3GLXA 1M3CA 2HNIA 4AFQC 3ZEHA 1RL2A 2HQHA 1WLPB 2MCNA 2LX7A 4C0DC 1WZOA 1N8RR 2RK1A 2J6KA 2R5AA 1WGSA 1WQ7A 1D3BB 1AOJA 2RQUA 5GMKi 1WHLA 1G3YA 3QO3A 1JJ2S 4M78F 1QLYA 4FSSA 2F69A 5I2SA 3UF4A 1B07A 2D0QB 3QWYA 5D6XA 2L89A 3HSBA 2LJ1A 4X34A 3H6ZA 4M7DC 3DB4A 2CSIA 4EMGA 3UA6A 2RJDA 1DJ7B 2J05A 2KNBB 1D1BA 2DTOA 2C0TA 4DEYA 2BZXA 4JRKA 2OAWA 1PNJA 2LRQA 2VUBA 1NZ9A 1WFWA 1X6OA 2XI9A 4YTLA 2DTIA 1NLOC 2VYTA 1VQ9T 1VQ7Q 3CPWS 1HXDA 2GFAA 2ZPIB 3URGA 4DBHA 5KYXA 1J3TA 3G71A 3JCMg 1D0ZA 3GNGA 5LJ3g 2CH4W 2DRMA 3DB3A 1UTIA 1GRIA 2ZPFB 3UT1A 2MI6A 4GBQA 4F7UB 4HCZA 4M77A 3EG1A 3PT9A 5GMKm 1YWOA 4RCBA 1FMKA 4R56A 3S3NA 2EGAA 1GL5A 2QEXT 1UGQB 2JNGA 1NJIR 3QSUA 4HKEA 2O2OA 4J9HA 4E7HA 2M1HA 2L5QA 3H0IA 1IHWA 3QWXX 1B34A 4C92E 1PKSA 3MPUB 1M2OA 2BZ8A 2HAXA 5GAN4 2E70A 2JMAA 3MHXA 1Y71A 1K1ZA 1M9SA 3QZ9B 3SFMA 2K3XA 2P0PA 1SSFA 3SB2A 2EQMA 3LWIA 4PJMA 4BY6B 5L23A 3VYHB 2CUBA 1Q81U 4M7DG 3M0RA 4Z88A 2PNIA 3VS1A 2E6ZA 2KK4A 1PC0A 3C94A 3CXCA 1KQSA 4OVAA 1VQ7A 5FU6C 2E5QA 1N9RA 4F14A 2E3IA 4AG2C 2DX1A 4FIBA 4IUTA 4HCBA 5GJWB 1VQ6Q 4M7AE 3D7SB 2QEXA 4E2FB 2X3XD 2E4HA 1VQLQ 1OPKA 3JCMP 1K8AU 2V1RA 4QVCA 5AT1B 5GANf 2EYWA 1VQ6T 2L3SA 1V76A 2OTLQ 1KJWA 2DERA 1UB4A 3CCRQ 5IXBA 1GBRA 2EJ9A 3JCMd 2R5MA 4LD9K 3IQLA 1AZEA 3OYBA 1Z9QA 1QVFS 3E1SA 3OYDA 1JB0E 1T3LA 2OTLT 5I11A 4DOWA 2XK0A 4XTYA 3SDZA 1ZX6A 2EGEA 1ZBJA 2I0NA 4C0DB 4MZPA 4JUVA 4XK8E 1N8RC 4BDYA 1CSKA 4J9BA 1TS9A 4KGVB 2YHTA 8AT1B 4MZTA 5GAMf 1MUZA 4M78A 2WSFE 2H8HA 1BKBA 2A36A 2BE9B 2D9TA 2DL7A 3MEVA 2GQIA 1MMGA 1RAEB 3RR6A 5A0LA 5GAN3 2MF2A 3EFRA 2FB7A 2RNAA 3PVLA 1G83A 2DNUA 2DL4A 4M7DB 1W4SA 2NUPA 2KROA 2YSQA 3A8GB 4FYWB 5L8RE 1C1AA 1M8VA 1MNDA 4F7UE 1VQ6A 4TVRA 4C92F 2JXBA 2EJFA 3TU4K 2RQTA 1KC8U 2RO0A 1JU5C 1QP3A 1QCOA 3OQ5A 4NL3A 1G3TA 4OB0B 1VQMT 5FRNA 2KY9A 1TSFA 2M0OA 4B9XA 2OTLA 2XD0A 3QJ6A 1K9MU 2LNVA 3MO8A 4HXJA 2KR3A 3CCRA 4E7IA 2ATCB 2DZCA 4AFSC 1PD1A 2E64A 3UA7A 3C4SA 1K9AA 5IH2A 3L2UA 4PJLA 5IT9E 4J9IA 3PIOA 4KH1B 1KD1U 1I4K1 3FRNA 2DYBA 3M4GA 3RDVA 2IIMA 2CSQA 1MGQA 3OS2A 4KBMB 2QXFA 4M7AF 3PIPA 1B3QA 1SHGA 2VXFA 3E9GA 1VQ4T 1WI7A 1LOJA 1UUEA 2D8HA 1VQNQ 2CDTA 2V8IA 2D1XA 3NMZC 3PE0A 2ED0A 2DEUA 4KGZB 1VQOQ 1WXUA 3P8BB 3Q1JA 4LN2A 3CCLQ 1ZUUA 3G4ST 5CKFA 1I0CA 2PTKA 4B9WA 2GF7A 3H0HA 3CBPA 3PMIA 4PFOA 1H3HA 1X2KA 3HTRA 2VXEA 4C8QD 3M59A 3QJYA 2D6FA 3OMGA 2NWMA 2MAMA 4ANJA 4PJOG 1M1GA 2RHUA 5FU6B 4FT2A 4FSXA 1RUWA 2LQKA 2AKKA 1Q82R 2CZ6B 4KUIA 3OBWA 2QQSA 5KYUA 1BBZA 5C0MA 3L2RA 2O88A 4JJDA 3J81E 1EFNA 1FMWA 4J9CA 2K5FA 1BI1A 2E1HA 2JM9A 2O01E 2PVGB 3TREA 4FCYA 1JJ2A 1FX7A 4A4EA 4F7UF 3RMQA 3AT1B 4OMOA 4JRPA 1R0BG 2QQAA 2JVVA 1YITQ 3H9NA 1ABOA 4ME7A 3HP9A 3G4SA 5M9OA 5ECAA 4M7DE 4RTZA 1AT1B 3SWNA 3BDUA 4CC4B 1YITT 5CIUA 3RBBB 4HT8A 4C5IA 1SKUB 3CXCP 2HQEA 3NTIA 1TUDA 2KYBA 3LWHA 3HRSA 1M90R 3QZ5B 4D8KA 3JSCA 1I07A 4AFUC 3E2UA 1OV3A 3S3MA 2CP2A 2GNCA 3VS2A 1W1FA 2DZ9A 4OMFB 2K5LA 2YUNA 2HL5C 1ZUKA 3JAME 2GBQA 3I55T 2AZSA 1IZ6A 4PJOB 4Y92A 2ZPHB 1D0YA 2QG9B 4KRTA 4C92A 2KRSA 3UDCA 3QG1A 3VUZA 2M51A 3JCMQ 1FXXA 2IVWA 4B6MA 3VS0A 4RTVA 4BDZA 3AHUA 4HCKA 4IUUA 3JB9I 2F5TX 1NPPA 2EWNA 5FU7C 2OI3A 2PVOB 1QQJA 1RAAB 2GQVA 1BU1A 2ZCFB 2EBPA 1X2QA 3UATA 5CKDA 1YITA 2RN8A 2ED1A 1MV0B 3EHRA 2YDLA 3V7CA 5KE3A 1WYXA 2XHCA 2X4JA 1RADB 1X6BA 1BB9A 3FLGA 3GF5A 3INZA 2CZ1B 4DBFA 4OMQA 2KXCA 1AVZC 3X28B 3BDLA 2JTMA 4XTWA 5FLXE 4M7AA 1PD0A 1K4US 1MMAA 2EGCA 2ZPBB 3CMEQ 2O9SA 4WCIA 1ZSZB 3I55A 1Q7YU 3ASKA 2DXTA 2DVJA 1TXQA 4D6WA 1RAHB 1R8OB 2HEQA 4X9CA 2JTEA 4C8QG 3LLRA 3CMET 1UE9A 4DBRA 1K73U 3REAB 3R6OA 2ENMA 3FIFA 4XU0A 3R6NA 2HKQB 4Z8AA 2DRKA 4M7DF 2YLCA 4A54A 5CVIA 3QDFA 3S3OA 2XMFA 2DL3A 2NLUA 1QVFA 4EPCA 3OBYA 1SRLA 4C5HA 3OYNA 4M75D 1ABQA 3OS1A 1V1CA 2QGFB 1P92A 4LNPA 1VQ5Q 5GANj 1VYVA 5DLQE 4E7ZA 4BY6C 3JB9G 3EGDA 1KQ2A 1MNEA 2VGMA 2X9HA 2DPPB 2F5KA 1IO6A 2FEIA 3RIRA 4F7UA 2FYKA 7AT1B 4GLKA 2QDYB 2RHIA 1AEYA 1XOVA 2DTHA 3CMEA 1JXMA 1OZ2A 2K4YA 4F16A 1VYUA 2O4XA 4M77D 4J9EA 3SHWA 1Q86R 2QQ9A 1YHQT 2DBMA 1M4ZA 3A5ZB 3RUXA 4MDWA 2EYYA 3H41A 5GAMj
chains in the Genus database with same CATH topology
1QMCA 1C1AA 1C0MA 4FW2A 1IHVA 1C6VX 4FW1A 1IHWA 5D7UA 1EX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMC A;  1C1A A;  1C0M A;  4FW2 A;  1IHV A;  1C6V X;  4FW1 A;  1IHW A;  5D7U A;  1EX4 A; 
#chains in the Genus database with same CATH topology
 4BE1 A;  1AD5 A;  1BI0 A;  4C8Q B;  3RNJ A;  5GAN h;  1M90 C;  2HSP A;  2LZ6 B;  4BE0 A;  2HBW A;  2YLB A;  1QWF A;  5LJ5 d;  1WQW A;  3P8D A;  2XIC A;  1U8R A;  2A28 A;  3REB B;  1UEC A;  5KYY B;  1SF9 A;  4M75 C;  1NYF A;  2F2W A;  4RTU A;  3OYH A;  1JJ2 P;  3GPL A;  5GAO m;  3QBY A;  3VS6 A;  1HD3 A;  1VQ5 A;  2F1L A;  2CP0 A;  2QI2 A;  2VKN A;  1QVG S;  2Y4Y A;  5A0D A;  2FHD A;  4ZGJ B;  4QKU A;  2EFI A;  2RHX A;  2OAU A;  5GAM h;  1XNI A;  3JCM W;  3CC2 T;  2NUT B;  1NBE B;  5FU7 B;  2H3J A;  4A53 A;  5IAY A;  1JBM A;  1V29 B;  1Q81 R;  1PSF A;  5IHI A;  1QVP A;  2KYM A;  2LX9 A;  3ZBD A;  1VQ9 Q;  3CC4 T;  2E6N A;  2YWW A;  1RLP C;  3HL8 A;  1ACM B;  2XU8 A;  4X1V A;  2K2V A;  2HBP A;  4PK4 A;  1I8F A;  4J9D A;  2FO0 A;  5GAN 2;  3CPW P;  4CC7 A;  1Q95 G;  5GAO l;  3BY7 A;  1OEB A;  2HQX A;  1D0X A;  2VC8 A;  3J80 E;  4RUG A;  4WF2 A;  2E12 A;  5KYW B;  1OX8 A;  1EZZ B;  4N4G A;  2X4W A;  2QEX Q;  1JQQ A;  1K8A R;  1ZBX A;  2COZ A;  1TOV A;  2M0Y A;  4JRQ A;  3RKX A;  1I5O B;  4NOY A;  5HCK A;  2M9U A;  4M4Z A;  2FL7 A;  2ZZD A;  2LMJ A;  1QP2 A;  3OSV A;  4ZTJ A;  1KK7 A;  3OYC A;  2EYZ A;  1KHC A;  1OU8 A;  1NPR A;  1WJR A;  4L5G A;  1M30 A;  3M5A A;  2D0N A;  3OYM A;  4M7D A;  4HCC A;  5CR2 A;  3J7A F;  4R55 A;  3L2W A;  4M75 G;  4EIK A;  4LUE A;  3M0T A;  4XTV A;  1G3W A;  4KUL A;  2AKL A;  2JS0 A;  2LT4 A;  3RKY A;  3M54 A;  2RJC A;  1EX4 A;  1VQ8 Q;  1CKB A;  2KRN A;  2LC4 A;  1N8R U;  4EMK C;  2HZY A;  1VQ9 A;  5IN1 A;  3CCS Q;  3EG9 B;  4FL6 A;  3OSS C;  2GFU A;  4C0F A;  2J6F A;  5J39 A;  5LJ5 h;  4J9G A;  1RAC B;  2RI2 A;  1VQ8 T;  3JCM c;  4M77 G;  2ZGW A;  1YIJ Q;  1M1K C;  5I22 A;  1VIE A;  2R57 A;  1QMC A;  3M0U A;  3CCS T;  2JZ2 A;  2DF6 A;  1KC8 R;  3X24 B;  4J5Y A;  1YIJ T;  4II1 A;  1Q86 C;  2LJ3 A;  5GAN e;  1TU0 B;  4PJO D;  4IUR A;  1K9M R;  4V2S A;  2COW A;  4IUQ A;  2AT1 B;  1GFC A;  3TCJ A;  2K5I A;  1NEG A;  4ZN1 A;  3EFO B;  2IG0 A;  4PJN A;  5LJ3 d;  1KIK A;  1QVF P;  1KD1 R;  1M2V B;  4N4I A;  1LPL A;  2KI7 A;  4XQ3 A;  3JB9 J;  3MET A;  3PVQ A;  4RG8 A;  3VS7 A;  2DFU A;  2LQ8 A;  3ZFJ A;  1ZA1 B;  2MMP A;  2JM8 A;  3A8L B;  4OML A;  2KAF A;  3OYK A;  4M75 B;  1ZA2 B;  5FRO A;  2CUD A;  1VA7 A;  5GAM e;  4ELY C;  3HFO A;  1VQ8 A;  5A0G A;  3I5R A;  1UGP B;  3JCM J;  3BW1 A;  3F70 A;  3CCS A;  4JJN K;  4FW1 A;  1UJY A;  4N0A C;  1Y57 A;  2CP3 A;  1YIJ A;  4ORZ A;  1ZHI A;  3VS3 A;  2XDB A;  4F04 B;  1T0J A;  4M77 B;  5CKE A;  3ZL7 C;  1WDX A;  1VQM Q;  1OZ3 A;  1TTH B;  2CZ0 B;  5LL6 S;  4PJO C;  1Y96 A;  4OF1 A;  1WHH A;  4XU2 A;  1UGS B;  3WXM B;  1I5L A;  5GAN 5;  4N4H A;  3OS0 A;  1AWW A;  3EAE A;  2GCX A;  4RMO A;  1U1T A;  1WHK A;  3M0S A;  1B34 B;  2E5K A;  2DIL A;  2MK5 A;  2G6F X;  3VV0 A;  1K0X A;  5GAO r;  1WXT A;  3ME9 A;  1YJ9 T;  5GMK h;  1HK9 A;  2JOY A;  1RAG B;  2A0F B;  3JCM V;  3C95 A;  1E6G A;  3VKI A;  2MWO A;  4C8Q F;  1VQ4 Q;  1D1A A;  2HKN A;  2HMA A;  3V8L A;  1NJI C;  3EH2 A;  1K76 A;  1VUB A;  1G2B A;  4EMH A;  2RHY A;  2PUK B;  1W2B S;  2DYI A;  3G4S Q;  1G3S A;  1ZSZ C;  2EYQ A;  3VS5 A;  4A4K A;  2NYS A;  3GP8 A;  4RG2 A;  4CI0 C;  1VQM A;  2JN0 A;  5LJ5 f;  4EMK B;  3DLL A;  5LJ3 h;  3JCM h;  2FVU A;  4PFZ A;  1Y7X A;  2KVQ G;  1IB8 A;  2F2X A;  4GLM A;  4QQD A;  4E7K A;  1OUL A;  4DBQ A;  5GAO n;  2NUZ A;  2M02 A;  5C6S A;  1X75 C;  2JUF A;  4ELZ C;  1B7T A;  2YUP A;  3LH5 A;  5IHK A;  2L0A A;  2A3L A;  4IUV A;  3ULR B;  4BD3 A;  3BE3 A;  3C12 A;  1AWO A;  3CCM Q;  4M75 E;  4BI3 A;  3FB9 A;  1VQ4 A;  1Y07 A;  4OB3 B;  5CCA A;  1RLQ C;  3OS5 A;  4JJB A;  3DKM A;  2XDP A;  4AMC A;  3CCM T;  1GCQ C;  2RPN A;  1PRL C;  2EAY A;  5GAN g;  2E3H A;  1F1B B;  3TEE A;  3JB9 D;  2NUP B;  3M57 A;  4M77 E;  3FDR A;  1XJW B;  5GAO p;  4E7L A;  3CMA T;  4RTT A;  2KMT A;  2L2P A;  1KFZ A;  1S72 T;  4J6X A;  5EG2 A;  2EJG A;  1WX6 A;  2EYX A;  3M0P A;  1W70 A;  3GOX A;  1Q7Y R;  3VU3 C;  4C8Q C;  1TUC A;  3BFM A;  3QYH B;  3I55 Q;  1OOT A;  3CCU T;  3CPW A;  1A0N B;  1K73 R;  5GAM g;  4JLG A;  4MMK A;  1SG5 A;  1PHT A;  2AHJ B;  2DA9 A;  1UHC A;  4OGC A;  1I81 A;  1KQS S;  1RI9 A;  3RKW A;  3CCQ T;  1QCN A;  4IKF A;  4OB2 B;  2RJF A;  4IIO A;  1AWX A;  3KFV A;  3CCM A;  2HD0 A;  3CD6 T;  2DET A;  1MHN A;  3UPU A;  3KXT A;  4OGE A;  3O8V A;  2KBT A;  3L2V A;  2CRE A;  1IXD A;  2RB6 A;  1PCX A;  4CC3 A;  4LD6 A;  3CMA A;  1OQK A;  2P84 A;  4PL6 A;  1U3O A;  3GNF B;  4J7F A;  2LT1 A;  4HA8 A;  1T3S A;  2DXC A;  1O9S A;  3LH0 A;  1YCY A;  4ZGD B;  4FM4 B;  3CCU A;  3V8J A;  3C0C A;  2EKO A;  2FZG B;  4QQG A;  1AWJ A;  2V1Q A;  4X9D A;  3QII A;  4RTW A;  1SHF A;  1EIF A;  1SSH A;  4C92 G;  5KYY A;  2MYS A;  4M75 F;  5GAN 6;  3JCM e;  2VVK A;  2QDL A;  1N6A A;  3S6W A;  3CCQ A;  3OW2 S;  2CS7 A;  5LJ3 f;  3JCM f;  1D3B A;  3MEW A;  3MEA A;  3M4Y A;  4RKU E;  5KYU B;  2JJ9 A;  3MJX A;  3DLM A;  3M0Q A;  1JO8 A;  3GIB A;  3M58 A;  4AFZ C;  2NUT A;  1OU9 A;  2X4X A;  4XAX B;  1M27 C;  3A8H B;  4LDW A;  3HHT B;  1AHJ B;  1M90 U;  2O9V A;  1OPL A;  3GBQ A;  3G6E T;  4M77 F;  5CO7 A;  1M8M A;  3M9Q A;  4R0K A;  2QTX A;  2DL8 A;  2P4R A;  1G5V A;  4J8O A;  5HK0 A;  5DLO A;  1PKT A;  4PLI A;  3EFS A;  4OB1 B;  3JCM b;  4M7A G;  2RF0 A;  2HCK A;  3SWN B;  1Q82 C;  1BCO A;  3MP1 A;  1OX9 A;  5GJV B;  4J83 A;  4OMN A;  2MWP A;  1IHV A;  1C6V X;  5GAN 7;  1T0H A;  3CBO A;  4C5G A;  4JRI A;  2BZY A;  4D8D A;  1YHQ Q;  2DBK A;  3MP8 A;  1PM3 A;  4PNO A;  2C06 A;  3HRT A;  3O5Z A;  2HDA A;  2DXU A;  2XKO C;  1YP5 A;  2EVR A;  1FMV A;  1OI1 A;  3H8Z A;  2XG8 D;  2L3Q A;  2Y4X A;  5KE2 A;  3EG3 A;  5D6Y A;  4C92 B;  2GTJ A;  2K6D A;  2CH4 A;  4PJO E;  2CT4 A;  5KCO A;  1UGR B;  4AG1 C;  1WIE A;  1YFN A;  3PTA A;  1PSE A;  5HY6 A;  2K3Y A;  2CP6 A;  3X26 B;  2RMO A;  2J6O A;  4PFP A;  3LYI A;  3FEO A;  1NE8 A;  3MCA B;  2DAQ A;  2QAS A;  4J6W A;  2QA4 T;  4KGX B;  4RTX A;  4DEX A;  2EIF A;  2WSE E;  1GCP A;  3M55 A;  4J6Y A;  4RTY A;  1YI2 Q;  4F7U G;  3L2Z A;  3EGX B;  3QPH A;  3CC2 Q;  1QVG P;  4FW2 A;  2RH2 A;  2KXD A;  2QYZ A;  3JB9 H;  4BAC A;  4M7A B;  1UEB A;  2DIG A;  3MKD A;  2A7Y A;  1YI2 T;  5FRM A;  3G71 T;  3A8M B;  3CC4 Q;  2FG0 A;  2ROL A;  4Y91 A;  2RD1 A;  5GAO q;  5KCH A;  2PUO B;  1YHQ A;  1W2B A;  3NPF A;  4M77 C;  3X25 B;  2X51 A;  4BE2 A;  1IRX A;  1BIA A;  2CT3 A;  3CPF A;  4F17 A;  3EFO A;  1M2V A;  2EQK A;  4LUD A;  1QKX A;  2F2V A;  5AYF A;  1JRI A;  4A63 B;  6AT1 B;  1M1K U;  2QA4 A;  3LGL A;  2GTO A;  2RI3 A;  2QAZ A;  2Y90 A;  3ER0 A;  3MP6 A;  5KYN A;  4M75 A;  4IUP A;  1IGU A;  4O5V A;  1KQ1 A;  2B8A A;  2KE9 A;  3RER A;  2E10 A;  3FJ5 A;  4QVZ A;  4HT9 A;  2OTJ Q;  5J3B A;  3OYJ A;  2AK5 A;  2L3P A;  4UC4 A;  2X3W D;  1ZQ1 A;  1G8X A;  1Q86 U;  4HVV A;  5LJ5 j;  1M1F A;  4LE9 A;  1S1N A;  2FPF A;  1HYO A;  4C0G A;  3NTH A;  4ZN3 A;  2W0Z A;  1CKA A;  1MMD A;  1YI2 A;  3QYG B;  2OTJ T;  3EGD B;  4J9F A;  3CC2 A;  4M78 D;  1M3A A;  2V8J A;  2VAS A;  4NL2 A;  1VQ7 T;  5FWB A;  1TH7 A;  2EKH A;  2YT6 A;  4PJO F;  3OYG A;  1LNX A;  2V8K A;  3CC4 A;  4XU1 A;  2IPO B;  3TSZ A;  2O4X B;  4E7S A;  2L8D A;  3I56 Q;  2EQU A;  5CKB A;  1X43 A;  3VJP A;  1BI2 A;  2DD5 A;  1NEB A;  4OMP A;  1I1J A;  5CAI A;  4PLL A;  2WSC E;  3OYI A;  3M56 A;  1WHG A;  2A08 A;  1MMN A;  2C0O A;  1GBQ A;  3I56 T;  4ATO A;  2ZAE A;  1OYX A;  3NTK A;  2G3R A;  4QW2 A;  1YJW Q;  2B86 A;  4C8Q E;  3I9Q A;  2YRV A;  1SRM A;  4OMM A;  4NS5 A;  2E41 A;  4VUB A;  5GMK l;  2AZV A;  3THK A;  2X4Y A;  1WJS A;  4P5N A;  3L1A A;  1Y0M A;  3NHN A;  5CQY A;  1YJW T;  2OTJ A;  1IRE B;  2H3E B;  1E6H A;  2LCS A;  2RI5 A;  2LQW A;  2ESW A;  3G1J A;  3OB9 A;  4M78 C;  4DOV A;  2VWF A;  3L2Q A;  2E65 A;  2LCC A;  1C0M A;  1NLP C;  1X27 A;  4XU3 A;  1UGV A;  3PFS A;  9ATC B;  3I5S A;  1VIF A;  4EMK A;  2WAC A;  3CCV Q;  1BK2 A;  2P0K A;  2PZ1 A;  1MV3 A;  4XTZ A;  4J7I A;  1VQL T;  2CZ7 B;  2KDS A;  2ROT A;  2L3R A;  4JLI A;  3I56 A;  1N5Z A;  2MIO A;  1NJI U;  3LGF A;  3CCV T;  2LTO A;  2QQB A;  3QHS A;  2RA2 A;  5GMK j;  4DA4 A;  4LDV A;  2SRC A;  2OX7 A;  3CCR T;  5D6W A;  3TQ7 P;  5HK3 A;  5KYX B;  2W10 A;  1YJW A;  2KSS A;  4E6R A;  4QVD A;  4LDX A;  2DD4 A;  1UG1 A;  4BI4 A;  4FU6 A;  2K57 A;  2DKG A;  4Y28 E;  3TVT A;  1Q81 C;  1RAI B;  3QKJ A;  3OW2 A;  2VV5 A;  2EW3 A;  4Z02 A;  4L6V 5;  3EG0 A;  1WNL A;  4ZGE B;  1U06 A;  4WTO B;  2EQJ A;  3TSW A;  3A8O B;  1YJ9 Q;  4LXC A;  2FZK B;  3CQT A;  1WHM A;  2CGH A;  3H0F A;  2A37 A;  3NFC A;  3A1P A;  1XQH A;  1N27 A;  2HSE B;  1H8K A;  1YBY A;  2FRW A;  2JW4 A;  3G7Z A;  4C0Z A;  1K8A C;  1AZG B;  1TWB A;  2ABL A;  5LJ3 j;  1VQL A;  1PWT A;  4M78 G;  1X69 A;  2DMO A;  4QT7 A;  2DM1 A;  2EQI A;  3CCV A;  4GY5 A;  4MDX A;  2DK3 A;  2J06 A;  2J7I A;  4N0A A;  3T9N A;  2KEA A;  2KT8 A;  4KUD K;  2R58 A;  1X6G A;  2C0I A;  1H64 1;  2DJQ A;  3L42 A;  4A4F A;  5CKH A;  4FYY B;  1W2B P;  2OJ2 A;  3OYL A;  4PJO A;  3E9F A;  3EH1 A;  1LCK A;  4A4H A;  4FYX B;  5LJ5 e;  1YN8 A;  5I2M A;  3RMS A;  4C92 D;  4E7J A;  1HSQ A;  1GXI E;  3VUB A;  3QXE B;  3WVE B;  3KBG A;  2BE7 D;  2QTV A;  4HVW A;  1SPK A;  1QCF A;  1UJ0 A;  4JS4 A;  3JB9 F;  1K0S A;  2K2M A;  2K79 A;  2DLP A;  1SEM A;  1YJ9 A;  4K11 A;  3SEM A;  1ZUY A;  4JJC A;  3OYA A;  1WHJ A;  1VQN T;  1IGQ A;  5I21 A;  1TUG B;  1YNZ A;  1KC8 C;  3HRU A;  4QQ6 A;  2VGN A;  1VQO T;  3SWN C;  2RHZ A;  1TG0 A;  3CCL T;  3NGP A;  2KGT A;  1K9M C;  2DO3 A;  2KT1 A;  3RES A;  4M78 B;  1ZSZ A;  2HL3 A;  4MZM A;  3JV3 A;  3V7R A;  2CKK A;  4M7A D;  4C5E A;  2YUQ A;  3EG2 A;  5IHN A;  2MOX A;  1QVG A;  2Z0W A;  3EHQ A;  3CCJ Q;  1R77 A;  5FW9 A;  5HKC A;  1U5S A;  4ESR A;  1KD1 C;  2LQN A;  3UWN A;  2COY A;  2LVM A;  3LX7 A;  3CMA Q;  3EGU A;  3HKS A;  1S72 Q;  4PKC C;  4CRI A;  1WXB A;  1M5Q 1;  5J26 A;  3CCJ T;  1Y96 B;  4C92 C;  1RAF B;  1U1S A;  1UHF A;  3CCU Q;  1XTD A;  1KHI A;  3M53 A;  4BUG A;  2LDM A;  1VQP Q;  2O31 A;  4HVU A;  1KG1 A;  3E19 A;  3V8K A;  5GAN 8;  2RM4 A;  2YRC A;  3HPW A;  4IIM A;  2CP7 A;  1VQN A;  1BCM A;  1YWP A;  1R0C B;  2SEM A;  3OYE A;  1VQP T;  3CCQ Q;  1VQO A;  1YJN Q;  2YXY A;  4JZ4 A;  2DIQ A;  2BKD N;  4BI8 B;  3QUI A;  1KQS P;  3CCL A;  3CD6 Q;  1W6X A;  2JTF A;  1H3Z A;  2YUO A;  2BTT A;  3CXC S;  2GGR A;  2P0Q A;  2RQW A;  2QQR A;  3PGG A;  2JT4 A;  3JRZ A;  2DVE A;  3VRY A;  1YJN T;  2ZPE B;  2D8J A;  1GCQ A;  1M3B A;  1ARK A;  4JS5 A;  5D7U A;  5GMK e;  4M7A C;  8ATC B;  1KSW A;  5EC7 A;  2KQW A;  3JCM X;  2XDD A;  5CQX A;  2X35 A;  4CC2 A;  4XTX A;  3VS4 A;  1UFF A;  2JS2 A;  1LJO A;  2DE0 X;  2CYZ B;  4Z89 A;  1E7O A;  3CCJ A;  2DEQ A;  2K7A A;  1GFD A;  1S72 A;  2K3B A;  1Q82 U;  3U23 A;  1HJD A;  4C8Q A;  3CC7 Q;  3N5B B;  3KUF A;  1YCS B;  3SD4 A;  5IXF A;  1RI0 A;  1PG5 B;  1VQP A;  5GAN d;  3HFN A;  1FWZ A;  3P8H A;  3CC7 T;  1WJQ A;  1JXO A;  5LJ3 e;  1RAB B;  5DM7 R;  2LP5 A;  3OW2 P;  2XID A;  4Q5W A;  3EGX A;  2FRY A;  1UDL A;  4LDU A;  2DJZ A;  2LCL A;  4RCC A;  2PU9 B;  4KT0 E;  1YJN A;  2BIV A;  3CCE Q;  4MML A;  1BIB A;  3OYF A;  3G6E Q;  4E47 A;  3CD6 A;  1VQK Q;  5KH6 A;  2BUD A;  3OA6 A;  1D1C A;  2VB6 A;  1JEG A;  5FWC A;  3A98 A;  3CCE T;  2FZC B;  1ZSG A;  4M78 E;  3V7S A;  3FC3 A;  4A4G A;  5LJ5 g;  2LJ0 A;  5GAM d;  2DXB A;  1QKW A;  1VQK T;  3X20 B;  1PRM C;  2K9G A;  3FJP A;  1QWE A;  2AIR B;  3MEU A;  4XTU A;  4EDU A;  1ZLM A;  2JMC A;  2RQV A;  3CBM A;  2DL5 A;  2LNH B;  2RJE A;  2I2L A;  1H92 A;  4DQ2 A;  1VOM A;  1NM7 A;  4AT1 B;  2CP5 A;  2MPX C;  3CC7 A;  1BYM A;  4PJJ A;  1Z9Z A;  1N9S A;  5KYW A;  3OMC A;  3VRZ A;  1WPY A;  2YRD A;  3I35 A;  4BB7 A;  5DY9 A;  4KH0 B;  1LVK A;  1VYT A;  3OY9 A;  2P4T A;  2EPD A;  3WVD B;  3CEY A;  2V26 A;  3LW5 E;  1M1K R;  2RQR A;  2PQW A;  3CCE A;  1X01 A;  4O6J A;  4JZ3 A;  3G6E A;  2M16 A;  1VQ5 T;  4L59 A;  2FPD A;  1VQK A;  2QA4 Q;  1WA7 A;  4JDS A;  1Q7Y C;  4M7D D;  1BI3 A;  4FYV B;  4FT4 A;  1QW1 A;  3PMT A;  5A2Q E;  4LDY A;  2ZPG B;  4ZNX A;  2FPE A;  4ZTF A;  3OYY A;  3VYG A;  1FYN A;  2PVD B;  1K73 C;  2QGG A;  2RK2 A;  3EG9 A;  1O75 A;  5CK9 A;  1NG2 A;  3G71 Q;  3PNW C;  2QK0 A;  2ECZ A;  1NYG A;  1D09 B;  3QDR B;  2KRM A;  4OP0 A;  4JPB W;  3GLX A;  1M3C A;  2HNI A;  4AFQ C;  3ZEH A;  1RL2 A;  2HQH A;  1WLP B;  2MCN A;  2LX7 A;  4C0D C;  1WZO A;  1N8R R;  2RK1 A;  2J6K A;  2R5A A;  1WGS A;  1WQ7 A;  1D3B B;  1AOJ A;  2RQU A;  5GMK i;  1WHL A;  1G3Y A;  3QO3 A;  1JJ2 S;  4M78 F;  1QLY A;  4FSS A;  2F69 A;  5I2S A;  3UF4 A;  1B07 A;  2D0Q B;  3QWY A;  5D6X A;  2L89 A;  3HSB A;  2LJ1 A;  4X34 A;  3H6Z A;  4M7D C;  3DB4 A;  2CSI A;  4EMG A;  3UA6 A;  2RJD A;  1DJ7 B;  2J05 A;  2KNB B;  1D1B A;  2DTO A;  2C0T A;  4DEY A;  2BZX A;  4JRK A;  2OAW A;  1PNJ A;  2LRQ A;  2VUB A;  1NZ9 A;  1WFW A;  1X6O A;  2XI9 A;  4YTL A;  2DTI A;  1NLO C;  2VYT A;  1VQ9 T;  1VQ7 Q;  3CPW S;  1HXD A;  2GFA A;  2ZPI B;  3URG A;  4DBH A;  5KYX A;  1J3T A;  3G71 A;  3JCM g;  1D0Z A;  3GNG A;  5LJ3 g;  2CH4 W;  2DRM A;  3DB3 A;  1UTI A;  1GRI A;  2ZPF B;  3UT1 A;  2MI6 A;  4GBQ A;  4F7U B;  4HCZ A;  4M77 A;  3EG1 A;  3PT9 A;  5GMK m;  1YWO A;  4RCB A;  1FMK A;  4R56 A;  3S3N A;  2EGA A;  1GL5 A;  2QEX T;  1UGQ B;  2JNG A;  1NJI R;  3QSU A;  4HKE A;  2O2O A;  4J9H A;  4E7H A;  2M1H A;  2L5Q A;  3H0I A;  1IHW A;  3QWX X;  1B34 A;  4C92 E;  1PKS A;  3MPU B;  1M2O A;  2BZ8 A;  2HAX A;  5GAN 4;  2E70 A;  2JMA A;  3MHX A;  1Y71 A;  1K1Z A;  1M9S A;  3QZ9 B;  3SFM A;  2K3X A;  2P0P A;  1SSF A;  3SB2 A;  2EQM A;  3LWI A;  4PJM A;  4BY6 B;  5L23 A;  3VYH B;  2CUB A;  1Q81 U;  4M7D G;  3M0R A;  4Z88 A;  2PNI A;  3VS1 A;  2E6Z A;  2KK4 A;  1PC0 A;  3C94 A;  3CXC A;  1KQS A;  4OVA A;  1VQ7 A;  5FU6 C;  2E5Q A;  1N9R A;  4F14 A;  2E3I A;  4AG2 C;  2DX1 A;  4FIB A;  4IUT A;  4HCB A;  5GJW B;  1VQ6 Q;  4M7A E;  3D7S B;  2QEX A;  4E2F B;  2X3X D;  2E4H A;  1VQL Q;  1OPK A;  3JCM P;  1K8A U;  2V1R A;  4QVC A;  5AT1 B;  5GAN f;  2EYW A;  1VQ6 T;  2L3S A;  1V76 A;  2OTL Q;  1KJW A;  2DER A;  1UB4 A;  3CCR Q;  5IXB A;  1GBR A;  2EJ9 A;  3JCM d;  2R5M A;  4LD9 K;  3IQL A;  1AZE A;  3OYB A;  1Z9Q A;  1QVF S;  3E1S A;  3OYD A;  1JB0 E;  1T3L A;  2OTL T;  5I11 A;  4DOW A;  2XK0 A;  4XTY A;  3SDZ A;  1ZX6 A;  2EGE A;  1ZBJ A;  2I0N A;  4C0D B;  4MZP A;  4JUV A;  4XK8 E;  1N8R C;  4BDY A;  1CSK A;  4J9B A;  1TS9 A;  4KGV B;  2YHT A;  8AT1 B;  4MZT A;  5GAM f;  1MUZ A;  4M78 A;  2WSF E;  2H8H A;  1BKB A;  2A36 A;  2BE9 B;  2D9T A;  2DL7 A;  3MEV A;  2GQI A;  1MMG A;  1RAE B;  3RR6 A;  5A0L A;  5GAN 3;  2MF2 A;  3EFR A;  2FB7 A;  2RNA A;  3PVL A;  1G83 A;  2DNU A;  2DL4 A;  4M7D B;  1W4S A;  2NUP A;  2KRO A;  2YSQ A;  3A8G B;  4FYW B;  5L8R E;  1C1A A;  1M8V A;  1MND A;  4F7U E;  1VQ6 A;  4TVR A;  4C92 F;  2JXB A;  2EJF A;  3TU4 K;  2RQT A;  1KC8 U;  2RO0 A;  1JU5 C;  1QP3 A;  1QCO A;  3OQ5 A;  4NL3 A;  1G3T A;  4OB0 B;  1VQM T;  5FRN A;  2KY9 A;  1TSF A;  2M0O A;  4B9X A;  2OTL A;  2XD0 A;  3QJ6 A;  1K9M U;  2LNV A;  3MO8 A;  4HXJ A;  2KR3 A;  3CCR A;  4E7I A;  2ATC B;  2DZC A;  4AFS C;  1PD1 A;  2E64 A;  3UA7 A;  3C4S A;  1K9A A;  5IH2 A;  3L2U A;  4PJL A;  5IT9 E;  4J9I A;  3PIO A;  4KH1 B;  1KD1 U;  1I4K 1;  3FRN A;  2DYB A;  3M4G A;  3RDV A;  2IIM A;  2CSQ A;  1MGQ A;  3OS2 A;  4KBM B;  2QXF A;  4M7A F;  3PIP A;  1B3Q A;  1SHG A;  2VXF A;  3E9G A;  1VQ4 T;  1WI7 A;  1LOJ A;  1UUE A;  2D8H A;  1VQN Q;  2CDT A;  2V8I A;  2D1X A;  3NMZ C;  3PE0 A;  2ED0 A;  2DEU A;  4KGZ B;  1VQO Q;  1WXU A;  3P8B B;  3Q1J A;  4LN2 A;  3CCL Q;  1ZUU A;  3G4S T;  5CKF A;  1I0C A;  2PTK A;  4B9W A;  2GF7 A;  3H0H A;  3CBP A;  3PMI A;  4PFO A;  1H3H A;  1X2K A;  3HTR A;  2VXE A;  4C8Q D;  3M59 A;  3QJY A;  2D6F A;  3OMG A;  2NWM A;  2MAM A;  4ANJ A;  4PJO G;  1M1G A;  2RHU A;  5FU6 B;  4FT2 A;  4FSX A;  1RUW A;  2LQK A;  2AKK A;  1Q82 R;  2CZ6 B;  4KUI A;  3OBW A;  2QQS A;  5KYU A;  1BBZ A;  5C0M A;  3L2R A;  2O88 A;  4JJD A;  3J81 E;  1EFN A;  1FMW A;  4J9C A;  2K5F A;  1BI1 A;  2E1H A;  2JM9 A;  2O01 E;  2PVG B;  3TRE A;  4FCY A;  1JJ2 A;  1FX7 A;  4A4E A;  4F7U F;  3RMQ A;  3AT1 B;  4OMO A;  4JRP A;  1R0B G;  2QQA A;  2JVV A;  1YIT Q;  3H9N A;  1ABO A;  4ME7 A;  3HP9 A;  3G4S A;  5M9O A;  5ECA A;  4M7D E;  4RTZ A;  1AT1 B;  3SWN A;  3BDU A;  4CC4 B;  1YIT T;  5CIU A;  3RBB B;  4HT8 A;  4C5I A;  1SKU B;  3CXC P;  2HQE A;  3NTI A;  1TUD A;  2KYB A;  3LWH A;  3HRS A;  1M90 R;  3QZ5 B;  4D8K A;  3JSC A;  1I07 A;  4AFU C;  3E2U A;  1OV3 A;  3S3M A;  2CP2 A;  2GNC A;  3VS2 A;  1W1F A;  2DZ9 A;  4OMF B;  2K5L A;  2YUN A;  2HL5 C;  1ZUK A;  3JAM E;  2GBQ A;  3I55 T;  2AZS A;  1IZ6 A;  4PJO B;  4Y92 A;  2ZPH B;  1D0Y A;  2QG9 B;  4KRT A;  4C92 A;  2KRS A;  3UDC A;  3QG1 A;  3VUZ A;  2M51 A;  3JCM Q;  1FXX A;  2IVW A;  4B6M A;  3VS0 A;  4RTV A;  4BDZ A;  3AHU A;  4HCK A;  4IUU A;  3JB9 I;  2F5T X;  1NPP A;  2EWN A;  5FU7 C;  2OI3 A;  2PVO B;  1QQJ A;  1RAA B;  2GQV A;  1BU1 A;  2ZCF B;  2EBP A;  1X2Q A;  3UAT A;  5CKD A;  1YIT A;  2RN8 A;  2ED1 A;  1MV0 B;  3EHR A;  2YDL A;  3V7C A;  5KE3 A;  1WYX A;  2XHC A;  2X4J A;  1RAD B;  1X6B A;  1BB9 A;  3FLG A;  3GF5 A;  3INZ A;  2CZ1 B;  4DBF A;  4OMQ A;  2KXC A;  1AVZ C;  3X28 B;  3BDL A;  2JTM A;  4XTW A;  5FLX E;  4M7A A;  1PD0 A;  1K4U S;  1MMA A;  2EGC A;  2ZPB B;  3CME Q;  2O9S A;  4WCI A;  1ZSZ B;  3I55 A;  1Q7Y U;  3ASK A;  2DXT A;  2DVJ A;  1TXQ A;  4D6W A;  1RAH B;  1R8O B;  2HEQ A;  4X9C A;  2JTE A;  4C8Q G;  3LLR A;  3CME T;  1UE9 A;  4DBR A;  1K73 U;  3REA B;  3R6O A;  2ENM A;  3FIF A;  4XU0 A;  3R6N A;  2HKQ B;  4Z8A A;  2DRK A;  4M7D F;  2YLC A;  4A54 A;  5CVI A;  3QDF A;  3S3O A;  2XMF A;  2DL3 A;  2NLU A;  1QVF A;  4EPC A;  3OBY A;  1SRL A;  4C5H A;  3OYN A;  4M75 D;  1ABQ A;  3OS1 A;  1V1C A;  2QGF B;  1P92 A;  4LNP A;  1VQ5 Q;  5GAN j;  1VYV A;  5DLQ E;  4E7Z A;  4BY6 C;  3JB9 G;  3EGD A;  1KQ2 A;  1MNE A;  2VGM A;  2X9H A;  2DPP B;  2F5K A;  1IO6 A;  2FEI A;  3RIR A;  4F7U A;  2FYK A;  7AT1 B;  4GLK A;  2QDY B;  2RHI A;  1AEY A;  1XOV A;  2DTH A;  3CME A;  1JXM A;  1OZ2 A;  2K4Y A;  4F16 A;  1VYU A;  2O4X A;  4M77 D;  4J9E A;  3SHW A;  1Q86 R;  2QQ9 A;  1YHQ T;  2DBM A;  1M4Z A;  3A5Z B;  3RUX A;  4MDW A;  2EYY A;  3H41 A;  5GAM j; 
#chains in the Genus database with same CATH homology
 1QMC A;  1C1A A;  1C0M A;  4FW2 A;  1IHV A;  1C6V X;  4FW1 A;  1IHW A;  5D7U A;  1EX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...