1VQLQ

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqlQ00
3CMEQ 1N8RR 3G6EQ 1VQOQ 1K9MR 1M1KR 2QA4Q 1K73R 3CCSQ 1Q7YR 1VQNQ 3CCMQ 3CCQQ 1YHQQ 1VQ8Q 3OW2P 3CCUQ 1YITQ 1Q82R 1VQLQ 2OTJQ 3CC4Q 3I56Q 3CXCP 1VQ9Q 1VQ5Q 3CC7Q 1QVFP 1NJIR 2OTLQ 1VQ4Q 3CPWP 3CCLQ 1YIJQ 1S72Q 1VQPQ 1M90R 3CD6Q 1KD1R 3CC2Q 1KQSP 3CCVQ 1YI2Q 1Q86R 1Q81R 1QVGP 3CMAQ 1KC8R 1K8AR 1JJ2P 3CCEQ 1VQ6Q 2QEXQ 1W2BP 3CCJQ 1YJ9Q 3I55Q 3G71Q 1YJNQ 1VQ7Q 1VQKQ 3CCRQ 1YJWQ 1VQMQ 3G4SQ
chains in the Genus database with same CATH superfamily
1VQ4T 4N4GA 3MEVA 1K9AA 3EHQA 1KHCA 1YHQQ 1PRLC 5AYFA 4PLIA 2X4XA 2X3XD 1VQMT 4M7AF 3CCJA 2ZGWA 2COZA 4M77C 2EAYA 3CPWS 2JTMA 5GAMh 1K76A 4DBQA 5I11A 4JJCA 2QI2A 4LUEA 2O88A 5DM7R 2OTLA 1V29B 1VQLQ 2H3EB 3G4ST 3CD6Q 1SPKA 2D8HA 4F7UF 1VIFA 5LJ5d 3OSVA 5GANj 2JJ9A 3MKDA 3DKMA 5GAN8 3ASKA 5GMKe 2F2VA 1B34A 4JDSA 1TOVA 3OSSC 1ZBXA 2LDMA 2YXYA 1JU5C 4BI3A 5GAN4 4HA8A 2RB6A 3H0IA 5EG2A 5HK0A 2RQTA 4M78A 1IO6A 3CPWP 2L8DA 1LNXA 2RI2A 2SRCA 1S1NA 2DL5A 2Y90A 5M9OA 4HKEA 4PNOA 3A8HB 4PKCC 1WJQA 5GAMg 4QQDA 1VQ9A 2IVWA 3FLGA 3OS2A 3TSZA 1S72A 3REBB 5CKDA 4C92A 3IQLA 2B8AA 3M4YA 1Y71A 2DL8A 2CP5A 1M30A 1R0BG 1YI2Q 3MEWA 3JB9H 5CKEA 2CSIA 4A54A 3JB9I 3CCUA 4C5GA 3HFOA 4CC3A 1T0HA 2EGAA 4OP0A 1K73R 5GAN5 5GAN2 5HY6A 5GANh 4A4KA 5AT1B 1UEBA 2DO3A 3L2WA 4GY5A 5GAN7 1Q86U 3OS5A 2LTOA 3OYKA 3CEYA 3META 3VUBA 3TSWA 4N0AA 2JS2A 5D7UA 1ZA1B 2DVJA 1VQOQ 4WTOB 4O6JA 1V1CA 1VQ4A 3ZL7C 2K3BA 2ZAEA 4BDZA 1YIJQ 1JJ2A 1M27C 1K8AR 1AWXA 1VQMA 2HSEB 4A4FA 2RMOA 2ROLA 4Z89A 5FWCA 1Q81C 4CC4B 1Y7XA 2KRNA 2KXDA 3JCMd 2C0OA 4XU2A 3VRZA 3MP6A 1I8FA 1U1SA 1WQWA 1K9MC 2A28A 2EJ9A 4BD3A 4JLGA 1VA7A 5GANg 1SG5A 1Q81R 3G4SA 2CT3A 2DTOA 2HEQA 2LQNA 4OB2B 4XTZA 1TSFA 1WLPB 2R57A 3A1PA 1I4K1 1KG1A 1CSKA 2CH4W 5KE2A 4PJOD 2J6OA 2GNCA 1EFNA 3EG9B 4RCCA 2O31A 3VS1A 3H9NA 1QVGA 8AT1B 4MZTA 4M7DA 2WACA 3BDUA 2O01E 3OYHA 3A8LB 4C8QG 1IGUA 4RTYA 3SWNB 1IREB 1PKSA 4RTWA 1UGVA 1E7OA 5CCAA 2YRDA 4KBMB 4C0GA 2DRMA 1LOJA 4A53A 2PU9B 4MZMA 3CQTA 4HT9A 2C0TA 1GFDA 4MZPA 2BKDN 4C8QE 1M1KC 2DX1A 5LJ5h 3HKSA 4FSXA 4M75G 2XI9A 2J06A 1OPKA 1WIEA 2QXFA 4LN2A 2VASA 3GP8A 2QDLA 3X20B 3JB9J 1WJRA 1NJIU 2KXCA 3X28B 1TTHB 2DZCA 3QXEB 2LT1A 4B9XA 2AZSA 4DBRA 5HCKA 1MNDA 3OYBA 1JJ2S 1RADB 5FW9A 4JLIA 3CCET 4B9WA 1YN8A 2QEXT 1YFNA 5IHIA 4DEXA 4M77A 2CS7A 1PWTA 1JXOA 2EKOA 2KAFA 1BYMA 1NPRA 3L2UA 3FC3A 1KHIA 2GF7A 4BE2A 2E3IA 4LDXA 2MK5A 2K2VA 3H6ZA 2J6KA 1UGPB 2CUBA 2PVOB 3G71T 2F1LA 4UC4A 4ZTJA 4PJJA 1QCOA 1OEBA 4LE9A 4JS5A 1JJ2P 2C0IA 4YTLA 2L3QA 4LUDA 3LWHA 4C8QF 2RJDA 2LZ6B 1VQNQ 3CC7T 4EIKA 1IZ6A 1QCFA 2HNIA 1RLQC 4JRPA 4J7IA 5GMKl 1JQQA 3OYGA 1WXUA 4KGXB 5GMKm 4FYWB 1BIBA 4M7AA 3SFMA 4AT1B 2LRQA 5IXBA 5I2SA 2CZ6B 2CUDA 2JOYA 4M75F 1D0ZA 3NFCA 3O8VA 2WSFE 3QWYA 4Z88A 2VVKA 2O4XB 4F17A 1KC8C 1Q95G 1JRIA 2E1HA 3V7CA 4L59A 4RG8A 4PJLA 2JVVA 1HXDA 3O5ZA 2JUFA 3RDVA 2GBQA 5GAOp 1XQHA 3MO8A 3OBWA 4QW2A 1MHNA 2M9UA 1X6BA 1Q86R 1QVGP 2DJZA 2QA4T 2RF0A 3JSCA 3LGFA 1G8XA 2GTJA 1VQ5T 3JCMh 1WPYA 1N27A 3UPUA 1B34B 2K5IA 4DOVA 2BZYA 1ABQA 1M5Q1 1XJWB 1PSEA 4OB1B 4FL6A 1KD1R 4XAXB 2QGFB 4M78B 4BUGA 4DOWA 3M9QA 5L8RE 2E12A 2LCLA 2PNIA 1YJNQ 2HSPA 3QG1A 2RQUA 2RN8A 2X51A 2EPDA 3M0SA 4R0KA 4Y91A 5A2QE 4J6YA 3QBYA 4QQ6A 4DBHA 3CCEA 3L1AA 7AT1B 4C92B 2QEXA 2E65A 1D1BA 2DE0X 2QYZA 3S3NA 1VQ6Q 4M78C 4KUIA 1U1TA 1YJWQ 2EQUA 1TXQA 5CKHA 2EQMA 1WHJA 3INZA 2ZPIB 2PUKB 4KGVB 2PZ1A 3EG3A 4RCBA 1Q7YR 3JCMg 4GLKA 4E7HA 2OTJQ 2P4TA 1OX8A 4F04B 1OPLA 2EYYA 1YCSB 3G71A 2JMCA 2QG9B 2P0KA 3CMAQ 3M56A 4C92C 3OYCA 1NG2A 3FJPA 1JBMA 4OMLA 1M2VA 3X25B 1BI2A 4KH0B 2JS0A 3RIRA 2KVQG 5HKCA 3OW2A 2RJCA 4J7FA 3CC7A 3CCMQ 3S6WA 1NEGA 2Y4XA 3CCJT 1DJ7B 1B7TA 3PNWC 3PMTA 1M3AA 2QQBA 2DA9A 3FJ5A 4JRQA 2X4JA 2E3HA 2FPEA 3TEEA 1MMGA 1MV3A 4EMGA 1G3TA 4WCIA 2ZPHB 1G3WA 1OU9A 3SHWA 1VQ7T 8ATCB 1QW1A 4FSSA 1O9SA 2X3WD 3RMQA 4LD9K 2KQWA 3SWNA 2ATCB 2RHZA 2P0PA 3E2UA 4FYYB 3EFRA 3CC4T 2QA4A 3HRTA 3I56T 2DAQA 1OQKA 1VQ5A 2YHTA 1F1BB 4MMKA 2YUOA 3VS7A 1YBYA 5GANd 1OU8A 1CKAA 4KGZB 3V7SA 4FU6A 2DXCA 2EYWA 3OBYA 2K5LA 1VQ8Q 1RI0A 1YWPA 1VQ9T 3DB3A 2XD0A 2DBKA 1ZQ1A 3A8GB 2OX7A 2V1RA 2P0QA 3UWNA 1IHWA 4ESRA 3R6OA 2CYZB 4F7UG 3RNJA 3OS1A 1TG0A 1AWWA 2LQ8A 1Q81U 3CCVQ 3OW2S 4HVUA 1D3BB 1N9SA 2XK0A 2DD4A 3P8HA 1NLPC 3QYGB 3RKYA 1K9MU 4M4ZA 4M7DC 2QTVA 3C12A 2J6FA 1D0YA 2DXUA 3NTIA 3SEMA 3OYLA 3CCRT 2AK5A 2GFAA 3F70A 4ELYC 1ACMB 4IIOA 1FMKA 1RL2A 2EYXA 3I55Q 4HVWA 1SRLA 1BI0A 2L2PA 3PGGA 3OW2P 2RI3A 4M7DD 2F69A 5D6YA 5I22A 1VQKT 2M0YA 3BW1A 2J7IA 2FHDA 4Y28E 2K2MA 2O4XA 4AFSC 1X2QA 2DPPB 3CBMA 2DRKA 4C8QA 2FZKB 2YLBA 2KY9A 3TCJA 2D1XA 3M55A 3NMZC 3V7RA 1M1KU 1SEMA 2KSSA 5GAN6 2ZZDA 4GLMA 5IN1A 2E6ZA 2KEAA 2KDSA 2LMJA 4PJOG 3M54A 2VKNA 4M75A 1EIFA 4OMOA 5IAYA 1VQ7A 2DL7A 4M7AB 4PJNA 1G3SA 1M3BA 1ZBJA 1NPPA 1OV3A 1YITT 4JZ4A 4E7JA 4IIMA 4IUPA 3OYIA 4PJOE 2YT6A 3QO3A 2NUPB 3CC4A 3RERA 1M1FA 3EH1A 2PVDB 3I56A 2FB7A 2Y4YA 4M77D 5LJ3f 3OYAA 3VS0A 4ELZC 4HCZA 2JTEA 2NLUA 1E6HA 5DLQE 5KYUB 2R58A 3CMET 4VUBA 3LWIA 1P92A 2CREA 4F7UB 5CK9A 1LCKA 1NZ9A 5GAN3 1YJ9Q 4M7AC 4J5YA 2HBPA 3CBPA 2M0OA 5C0MA 3CCLT 3NTHA 3BDLA 2AKKA 3CC2T 2RHIA 1U06A 3VRYA 1W2BS 1RUWA 2ZPFB 2V26A 1M8MA 2K9GA 3AHUA 1GBRA 1IGQA 2E64A 5EC7A 2X4WA 1I81A 2BIVA 2RHXA 3C4SA 4ZN3A 1VQPT 5IT9E 1SF9A 3CCSQ 2MAMA 3JB9D 4BDYA 5CVIA 4PJOF 1GL5A 2L5QA 2BTTA 1W70A 2K3XA 3CCRA 2LT4A 2P84A 1W2BP 2ZPGB 1WHLA 1KIKA 2R5MA 3RKXA 3G6EQ 4IKFA 2CZ0B 1UJYA 5CAIA 3CXCA 3CCQQ 5IHKA 3OYYA 2RA2A 1KD1U 1K4US 1GCQC 1NBEB 2KK4A 5CO7A 3M0RA 4D8DA 1VQKA 1HJDA 3OYMA 1YHQT 4TVRA 2A7YA 1H3HA 1B3QA 1TUGB 3LH0A 2A37A 2RH2A 2QQSA 3VS4A 1M2VB 5FWBA 4Z8AA 1M4ZA 3EHRA 3C0CA 3GIBA 1YWOA 3UDCA 1G2BA 1RAEB 1YP5A 1NE8A 4PL6A 2VB6A 3PFSA 5D6XA 5GAMf 1RAGB 3EGUA 1KQ2A 3OMGA 4BE1A 1VQLT 3PIPA 4C5HA 1G5VA 1YITA 3CD6T 5GMKj 3NGPA 1K9MR 1Q7YU 2ABLA 4HCKA 1M1GA 5FRNA 2KT8A 4L6V5 4V2SA 3KUFA 1IB8A 2KBTA 4QVDA 1ZSZB 1MV0B 2KE9A 1RAFB 3G1JA 3HPWA 2H3JA 3M57A 2LC4A 4MMLA 4F16A 3MP1A 1R8OB 3VYGA 3CMEA 1KQSA 1BI3A 2M02A 1QP3A 2BE9B 1D0XA 2NUTB 1QVPA 4ATOA 4LDYA 2NWMA 3CCLA 5DLOA 4OMMA 3CC2A 2ECZA 3PT9A 3QWXX 5GAOq 4J9DA 3KFVA 2O9VA 1FYNA 1D3BA 1AEYA 1B07A 2V8JA 1VQ8A 1TUCA 2XG8D 4JJNK 4XK8E 1SHFA 2CDTA 2JM8A 4FYVB 1QQJA 4J83A 3SWNC 4IURA 4IUVA 4EDUA 1M1KR 4NS5A 1YI2T 1VQPA 4Q5WA 4HXJA 4OMNA 3QHSA 2OAWA 3VJPA 4WF2A 4DBFA 3MJXA 3A8MB 2GFUA 2DLPA 4LD6A 5GMKh 2DTIA 2EW3A 4HT8A 3QJYA 2EVRA 4QVZA 3L42A 3J80E 1NM7A 2VUBA 5CQYA 2MMPA 2EJGA 3OB9A 2KR3A 1BK2A 4KT0E 5LJ3e 4JRKA 1GBQA 3UF4A 2AT1B 1D09B 2JM9A 4KRTA 2LNVA 1VQOT 2KYBA 3OY9A 4N4HA 3OS0A 4P5NA 1ZSGA 1UGRB 1M2OA 4HVVA 3FB9A 4M78E 4D6WA 3EH2A 1YHQA 4GBQA 1YIJT 4QQGA 1D1CA 2OJ2A 5FRMA 3VU3C 5GJWB 1QVGS 2E5KA 2L3RA 3GOXA 3TU4K 3DLMA 1UFFA 3LW5E 1I5LA 3EG2A 1WGSA 2DNUA 3MPUB 2H8HA 1PM3A 2AKLA 3JCMX 1TH7A 1VYUA 2CP7A 3MEUA 2NUPA 1NYFA 3JRZA 1BBZA 1W4SA 1NLOC 2DYIA 3TVTA 4MDXA 4C8QB 1VQLA 3I5SA 4OGCA 1WJSA 4FT2A 5KYUA 3R6NA 3CD6A 2LVMA 4AFZC 4E7ZA 3HRSA 3WVDB 2OTLQ 4F7UA 4AG2C 4DQ2A 2W0ZA 1G83A 1KC8R 1RAHB 2M1HA 5KYWA 1K0XA 3M0UA 4M75B 1Y0MA 4JRIA 3A98A 5CQXA 4KULA 1UGSB 3G7ZA 2FL7A 2DIGA 1X69A 1HSQA 3VS6A 2K5FA 3GLXA 4A4EA 4C8QC 3MP8A 1W1FA 3LX7A 1TUDA 3H0HA 4QVCA 3ULRB 4FW1A 1BI1A 3ZBDA 3JCMW 3M0QA 3QDRB 4E2FB 4M75C 2ED1A 2KGTA 1WYXA 1OZ3A 3DLLA 2HL5C 1R0CB 2BE7D 1QWEA 4J9BA 1GCQA 5LJ5f 3E9GA 4BI8B 1N8RC 1YI2A 2XHCA 2K79A 1S72Q 1ABOA 1Q82C 4RKUE 1WFWA 1FX7A 3ZFJA 2DM1A 1BCOA 3J81E 2DD5A 2KT1A 2L0AA 5GAMe 5KYXB 1AWOA 1Y57A 4Z02A 2ESWA 1N8RR 1H3ZA 2LX9A 1ZUKA 3RR6A 1Y07A 5I2MA 3CCUQ 1Q82R 2XDDA 1WHHA 4PJOA 2ZPBB 2LJ0A 3FRNA 3MCAB 2DEUA 5GAOn 1KJWA 5LJ3j 3D7SB 2EWNA 3UA6A 5KYYA 2JT4A 2F5TX 2EJFA 1VQOA 2LX7A 4RTUA 2FZGB 4ME7A 3RBBB 4CRIA 1T3SA 1ZA2B 1LVKA 3VUZA 4EMKA 4M7DE 1MMDA 4M78D 1QKWA 2KMTA 1YIJA 4O5VA 2HKNA 3LH5A 2FPFA 4J9FA 1VQ4Q 3N5BB 1VQNT 4ZN1A 6AT1B 3GPLA 1C0MA 1EX4A 3H8ZA 2LCCA 1PNJA 3SD4A 3RUXA 2DZ9A 1SHGA 1VQMQ 3V8LA 4LNPA 4C92D 5HK3A 3UATA 1ZSZA 2G3RA 1ZUYA 4N4IA 2HMAA 2JN0A 3X26B 3GBQA 3BE3A 2HL3A 2A36A 2RQWA 1UUEA 3AT1B 2AHJB 2LJ1A 2O9SA 5IXFA 4R56A 5A0LA 4J9IA 2F5KA 4HCCA 2E70A 2NUTA 1PG5B 3RESA 1BCMA 2YRCA 3G4SQ 4M77E 2PTKA 2CP0A 5IHNA 1RI9A 1HK9A 4CC2A 3ME9A 1Y96A 3ZEHA 3VS3A 5KYNA 1QKXA 2JNGA 3PTAA 2BZXA 4M7DF 1OULA 1MMAA 1IHVA 3JCMf 4X34A 1YCYA 4J9HA 2QQRA 2WSCE 3V8KA 5J39A 1KSWA 1QP2A 2PUOB 3BFMA 2EKHA 1VYVA 2RQRA 3EGDB 3P8DA 2FG0A 1T3LA 4EMHA 1G3YA 3JCMJ 1YJNT 3JB9G 4DA4A 2QASA 2KNBB 3Q1JA 2G6FX 3S3OA 1AD5A 2E6NA 4CC7A 2ED0A 3URGA 2M16A 2RNAA 1TS9A 5J26A 4M7AE 3L2VA 5GAMj 4JS4A 2B86A 1C6VX 2YDLA 2JZ2A 4PFOA 2E4HA 1VQ6T 1VOMA 2DYBA 2ZPEB 4LXCA 1FMVA 1YJWT 2XKOC 2HQEA 4M77F 2DL3A 2P4RA 4AFUC 3J7AF 2VV5A 1M90C 3EFSA 2OTJT 1AZEA 1OYXA 3WXMB 2O2OA 3E1SA 2XDBA 2OI3A 4AMCA 2PQWA 4RTZA 3EAEA 3CMAT 3BY7A 1TU0B 2WSEE 3JAME 4FT4A 3MEAA 3EGXB 1M90R 3A5ZB 3M53A 1VQNA 3THKA 2F2XA 3M58A 2D6FA 2CP2A 1BB9A 3CCMT 1WHGA 1H8KA 2RK1A 3OYEA 4J8OA 2YUPA 3RMSA 2DEQA 4BE0A 5KCHA 2A3LA 5LJ5e 2MWOA 1C1AA 3JB9F 1BU1A 3H41A 1WXBA 1PHTA 1GRIA 1D1AA 2EYQA 1PSFA 1PKTA 2A08A 3QYHB 1AHJB 2KI7A 2VGNA 2YUNA 3M0TA 2DJQA 1XNIA 2C06A 3VS5A 5CIUA 3HSBA 1T0JA 4JJDA 1FWZA 1KK7A 3PIOA 3V8JA 2RI5A 1QWFA 2RPNA 1WHKA 2K7AA 5KYWB 1VYTA 5GAOl 4J9CA 2E41A 2OAUA 2KYMA 1I1JA 5GAOm 2HQHA 3HRUA 2VC8A 5KH6A 2RO0A 3CBOA 4OB0B 4PFZA 2PVGB 3L2QA 4PFPA 1VQ8T 1XTDA 1UE9A 1ZHIA 2DKGA 1TWBA 4JJBA 4RMOA 2LP5A 1YJNA 3NHNA 3S3MA 5KYXA 1RLPC 1EZZB 4C5EA 3HTRA 2YLCA 1ARKA 4XTWA 3HL8A 3C94A 2DMOA 1CKBA 3TREA 3QDFA 4NOYA 2RHUA 4XTXA 3CCVT 4M7AD 1X6GA 1OI1A 3OYNA 1OZ2A 1WQ7A 1K73C 1VQ6A 4X9CA 1KC8U 4RTVA 1YJWA 2M51A 3CCEQ 2FO0A 2HCKA 1QMCA 4NL2A 3M59A 2QEXQ 2LQWA 1MGQA 1W6XA 1SRMA 2LJ3A 4FYXB 2OTJA 2X35A 3OYFA 4IUUA 1PD0A 3I55T 3CMAA 3EFOA 3UA7A 1PRMC 4E7SA 4C0ZA 4PJOB 1RACB 2AZVA 2MOXA 3G71Q 2DIQA 2I2LA 1K8AC 1UHFA 5KYYB 3JCMe 3CCMA 2X9HA 4FCYA 2EBPA 5ECAA 1NEBA 3JCMc 3FIFA 1WX6A 2VXFA 3JCMP 1QVFA 4EMKB 1WXTA 3CC7Q 4R55A 1PC0A 1SSFA 2MYSA 5LJ5j 5D6WA 3U23A 2MIOA 2EQKA 3QZ9B 4ZNXA 4PJOC 4BACA 4OF1A 4EPCA 1N8RU 1OX9A 1U5SA 2EIFA 4OMFB 3GNGA 5I21A 1Q82U 4NL3A 2CKKA 2F2WA 2L89A 4EMKC 1QLYA 3M0PA 1X6OA 4C0FA 3HHTB 3SDZA 2LCSA 2MWPA 1J3TA 3EGDA 1A0NB 1X01A 2QA4Q 4BB7A 3QUIA 5A0DA 2EGCA 5CKBA 3RKWA 4C0DB 2EFIA 2RHYA 5KE3A 5GAOr 1YJ9T 1I07A 4ZGEB 1VQ5Q 1Y96B 1U3OA 1UECA 3QPHA 1ZSZC 2VGMA 4K11A 1Z9QA 4ZGJB 2DETA 2EGEA 3CXCS 2CP3A 3PE0A 4QKUA 5CKFA 2DVEA 4E7LA 4RTTA 3KBGA 2JW4A 2L3SA 4PJMA 4A63B 2COYA 2LNHB 3CCVA 4C0DC 1UDLA 2JXBA 3OA6A 4DEYA 5FU6B 3CCST 2KRMA 2IIMA 2XU8A 3EG0A 2XDPA 4LDUA 3L2RA 3PVQA 2CZ7B 1QVFS 2DERA 3GF5A 2CT4A 2AIRB 2MPXC 4M75E 2Z0WA 2I0NA 3VS2A 3EGXA 5GANf 2IG0A 4M78G 4PLLA 4LDWA 3CXCP 4BI4A 1U8RA 3FDRA 2QQAA 1WI7A 3LGLA 3QJ6A 3EG1A 2COWA 3G6ET 3I55A 2BZ8A 1X2KA 1FXXA 4PK4A 4ANJA 2ROTA 3CCQT 2YUQA 5FU6C 4Y92A 2IPOB 2QGGA 4JZ3A 4C92G 4AFQC 1KQSS 2GTOA 1QVFP 5LJ3d 4OVAA 5LJ5g 1HYOA 2V8IA 2JMAA 2L3PA 1ZLMA 3LYIA 3CCJQ 2GQVA 1ZUUA 2FYKA 1UG1A 4C92E 2MF2A 3PMIA 1UJ0A 1PD1A 1QCNA 2D9TA 1AZGB 1BIAA 4ORZA 4IUQA 2YSQA 3JCMQ 2A0FB 1M3CA 1N5ZA 2HDAA 2KRSA 3OQ5A 1GXIE 4AG1C 2XICA 4OB3B 1VQ7Q 2DTHA 1Q86C 1KQSP 4KH1B 2K3YA 4XTUA 4XTVA 4X9DA 2D0NA 4OMPA 3L2ZA 2HD0A 3NPFA 1HD3A 1LJOA 3NTKA 3CPFA 1R77A 2DL4A 3CC4Q 5L23A 5GMKi 4ZGDB 3I56Q 1M90U 4M78F 1YJ9A 1UTIA 2DBMA 3JV3A 1KD1C 4B6MA 2JTFA 2V1QA 1XOVA 2FZCB 3WVEB 1VUBA 5FLXE 3OYJA 2CP6A 1PCXA 2KROA 4BY6B 4C92F 5J3BA 1VQ9Q 3E9FA 4ZTFA 4KUDK 4J9EA 1FMWA 1I0CA 1KFZA 4C8QD 2BUDA 3ER0A 3T9NA 1RABB 3CCSA 1UB4A 1K0SA 2EYZA 1WHMA 3SB2A 2QDYB 2RM4A 1MUZA 4M75D 5C6SA 4L5GA 2MI6A 2ENMA 2LQKA 3PVLA 1O75A 1Q7YC 4BY6C 4XQ3A 4M7DG 3C95A 4IUTA 3G6EA 1WA7A 3CCRQ 3VYHB 1ZX6A 1RAAB 3CCQA 3QSUA 1IRXA 3FEOA 5GAMd 4FIBA 3E19A 3VKIA 2CGHA 1YNZA 2FRYA 2GQIA 3M4GA 4MDWA 1MMNA 3P8BB 2HQXA 3HFNA 4FW2A 4OMQA 4E7IA 2CH4A 2DXBA 2HAXA 1JO8A 3EFOB 1IXDA 5A0GA 2VWFA 1VQKQ 2FRWA 2HKQB 2D8JA 1MNEA 2FEIA 2RJEA 3QKJA 4RUGA 1AVZC 2QTXA 1NJIC 2CSQA 2R5AA 1WDXA 4M77G 2YWWA 1GCPA 4RTXA 1WNLA 3X24B 4A4GA 2K4YA 2CZ1B 3I5RA 2YRVA 1BKBA 3MHXA 3M5AA 2XMFA 1NJIR 4XTYA 5LL6S 1Z9ZA 3I35A 5CR2A 4A4HA 2RQVA 5GJVB 1K73U 2OTLT 4F14A 3EG9A 3TQ7P 1LPLA 1SKUB 2XIDA 4N0AC 4XU0A 1YITQ 4E47A 1UGQB 4XU1A 1E6GA 2QAZA 5GANe 3A8OB 5LJ3h 1RAIB 4J6WA 1JB0E 1VIEA 3KXTA 3OMCA 2J05A 5FROA 3HP9A 4D8KA 2NYSA 3CMEQ 4XU3A 5IH2A 1H92A 1I5OB 2V8KA 4C5IA 2FPDA 2GGRA 4E7KA 2D0QB 3CPWA 4M7AG 3OYDA 2ZCFB 3VV0A 2DF6A 4FM4B 3CCLQ 1UHCA 2W10A 2FVUA 1K8AU 1JEGA 1OOTA 2EQJA 3CC2Q 4OGEA 2HZYA 1K1ZA 1AWJA 1X75C 1SSHA 2RD1A 2RK2A 4M7DB 4J9GA 2HBWA 4CI0C 1NYGA 5KCOA 1S72T 3JCMb 3I9QA 1M9SA 1KQ1A 5DY9A 3REAB 2EQIA 1AT1B 2K6DA 2K57A 4II1A 1AOJA 3UT1A 4X1VA 1N9RA 2RJFA 5FU7B 1VQPQ 1X43A 2E5QA 5LJ3g 2VXEA 2DFUA 4E6RA 2NUZA 4LDVA 2DILA 3CCUT 2SEMA 1WZOA 4RG2A 1M8VA 3JCMV 4HCBA 4F7UE 2MCNA 3QZ5B 3DB4A 2VYTA 1H641 1N6AA 2DXTA 4JUVA 4J6XA 3H0FA 1V76A 2QQ9A 5FU7C 9ATCB 1W2BA 2QK0A 1JXMA 1GFCA 1X27A 4M77B 3GNFB 3QIIA 2GCXA 4QT7A 2E10A 2X4YA 3LLRA 2DK3A 4JPBW
chains in the Genus database with same CATH topology
3CMEQ 1N8RR 3G6EQ 1VQOQ 1K9MR 1M1KR 2QA4Q 1K73R 3CCSQ 1Q7YR 1VQNQ 3CCMQ 3CCQQ 1YHQQ 1VQ8Q 3OW2P 3CCUQ 1YITQ 1Q82R 1VQLQ 2OTJQ 3CC4Q 3I56Q 3CXCP 1VQ9Q 1VQ5Q 3CC7Q 1QVFP 1NJIR 2OTLQ 1VQ4Q 3CPWP 3CCLQ 1YIJQ 1S72Q 1VQPQ 1M90R 3CD6Q 1KD1R 3CC2Q 1KQSP 3CCVQ 1YI2Q 1Q86R 1Q81R 1QVGP 3CMAQ 1KC8R 1K8AR 1JJ2P 3CCEQ 1VQ6Q 2QEXQ 1W2BP 3CCJQ 1YJ9Q 3I55Q 3G71Q 1YJNQ 1VQ7Q 1VQKQ 3CCRQ 1YJWQ 1VQMQ 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Q;  1N8R R;  3G6E Q;  1VQO Q;  1K9M R;  1M1K R;  2QA4 Q;  1K73 R;  3CCS Q;  1Q7Y R;  1VQN Q;  3CCM Q;  3CCQ Q;  1YHQ Q;  1VQ8 Q;  3OW2 P;  3CCU Q;  1YIT Q;  1Q82 R;  1VQL Q;  2OTJ Q;  3CC4 Q;  3I56 Q;  3CXC P;  1VQ9 Q;  1VQ5 Q;  3CC7 Q;  1QVF P;  1NJI R;  2OTL Q;  1VQ4 Q;  3CPW P;  3CCL Q;  1YIJ Q;  1S72 Q;  1VQP Q;  1M90 R;  3CD6 Q;  1KD1 R;  3CC2 Q;  1KQS P;  3CCV Q;  1YI2 Q;  1Q86 R;  1Q81 R;  1QVG P;  3CMA Q;  1KC8 R;  1K8A R;  1JJ2 P;  3CCE Q;  1VQ6 Q;  2QEX Q;  1W2B P;  3CCJ Q;  1YJ9 Q;  3I55 Q;  3G71 Q;  1YJN Q;  1VQ7 Q;  1VQK Q;  3CCR Q;  1YJW Q;  1VQM Q;  3G4S Q; 
#chains in the Genus database with same CATH topology
 1VQ4 T;  4N4G A;  3MEV A;  1K9A A;  3EHQ A;  1KHC A;  1YHQ Q;  1PRL C;  5AYF A;  4PLI A;  2X4X A;  2X3X D;  1VQM T;  4M7A F;  3CCJ A;  2ZGW A;  2COZ A;  4M77 C;  2EAY A;  3CPW S;  2JTM A;  5GAM h;  1K76 A;  4DBQ A;  5I11 A;  4JJC A;  2QI2 A;  4LUE A;  2O88 A;  5DM7 R;  2OTL A;  1V29 B;  1VQL Q;  2H3E B;  3G4S T;  3CD6 Q;  1SPK A;  2D8H A;  4F7U F;  1VIF A;  5LJ5 d;  3OSV A;  5GAN j;  2JJ9 A;  3MKD A;  3DKM A;  5GAN 8;  3ASK A;  5GMK e;  2F2V A;  1B34 A;  4JDS A;  1TOV A;  3OSS C;  1ZBX A;  2LDM A;  2YXY A;  1JU5 C;  4BI3 A;  5GAN 4;  4HA8 A;  2RB6 A;  3H0I A;  5EG2 A;  5HK0 A;  2RQT A;  4M78 A;  1IO6 A;  3CPW P;  2L8D A;  1LNX A;  2RI2 A;  2SRC A;  1S1N A;  2DL5 A;  2Y90 A;  5M9O A;  4HKE A;  4PNO A;  3A8H B;  4PKC C;  1WJQ A;  5GAM g;  4QQD A;  1VQ9 A;  2IVW A;  3FLG A;  3OS2 A;  3TSZ A;  1S72 A;  3REB B;  5CKD A;  4C92 A;  3IQL A;  2B8A A;  3M4Y A;  1Y71 A;  2DL8 A;  2CP5 A;  1M30 A;  1R0B G;  1YI2 Q;  3MEW A;  3JB9 H;  5CKE A;  2CSI A;  4A54 A;  3JB9 I;  3CCU A;  4C5G A;  3HFO A;  4CC3 A;  1T0H A;  2EGA A;  4OP0 A;  1K73 R;  5GAN 5;  5GAN 2;  5HY6 A;  5GAN h;  4A4K A;  5AT1 B;  1UEB A;  2DO3 A;  3L2W A;  4GY5 A;  5GAN 7;  1Q86 U;  3OS5 A;  2LTO A;  3OYK A;  3CEY A;  3MET A;  3VUB A;  3TSW A;  4N0A A;  2JS2 A;  5D7U A;  1ZA1 B;  2DVJ A;  1VQO Q;  4WTO B;  4O6J A;  1V1C A;  1VQ4 A;  3ZL7 C;  2K3B A;  2ZAE A;  4BDZ A;  1YIJ Q;  1JJ2 A;  1M27 C;  1K8A R;  1AWX A;  1VQM A;  2HSE B;  4A4F A;  2RMO A;  2ROL A;  4Z89 A;  5FWC A;  1Q81 C;  4CC4 B;  1Y7X A;  2KRN A;  2KXD A;  3JCM d;  2C0O A;  4XU2 A;  3VRZ A;  3MP6 A;  1I8F A;  1U1S A;  1WQW A;  1K9M C;  2A28 A;  2EJ9 A;  4BD3 A;  4JLG A;  1VA7 A;  5GAN g;  1SG5 A;  1Q81 R;  3G4S A;  2CT3 A;  2DTO A;  2HEQ A;  2LQN A;  4OB2 B;  4XTZ A;  1TSF A;  1WLP B;  2R57 A;  3A1P A;  1I4K 1;  1KG1 A;  1CSK A;  2CH4 W;  5KE2 A;  4PJO D;  2J6O A;  2GNC A;  1EFN A;  3EG9 B;  4RCC A;  2O31 A;  3VS1 A;  3H9N A;  1QVG A;  8AT1 B;  4MZT A;  4M7D A;  2WAC A;  3BDU A;  2O01 E;  3OYH A;  3A8L B;  4C8Q G;  1IGU A;  4RTY A;  3SWN B;  1IRE B;  1PKS A;  4RTW A;  1UGV A;  1E7O A;  5CCA A;  2YRD A;  4KBM B;  4C0G A;  2DRM A;  1LOJ A;  4A53 A;  2PU9 B;  4MZM A;  3CQT A;  4HT9 A;  2C0T A;  1GFD A;  4MZP A;  2BKD N;  4C8Q E;  1M1K C;  2DX1 A;  5LJ5 h;  3HKS A;  4FSX A;  4M75 G;  2XI9 A;  2J06 A;  1OPK A;  1WIE A;  2QXF A;  4LN2 A;  2VAS A;  3GP8 A;  2QDL A;  3X20 B;  3JB9 J;  1WJR A;  1NJI U;  2KXC A;  3X28 B;  1TTH B;  2DZC A;  3QXE B;  2LT1 A;  4B9X A;  2AZS A;  4DBR A;  5HCK A;  1MND A;  3OYB A;  1JJ2 S;  1RAD B;  5FW9 A;  4JLI A;  3CCE T;  4B9W A;  1YN8 A;  2QEX T;  1YFN A;  5IHI A;  4DEX A;  4M77 A;  2CS7 A;  1PWT A;  1JXO A;  2EKO A;  2KAF A;  1BYM A;  1NPR A;  3L2U A;  3FC3 A;  1KHI A;  2GF7 A;  4BE2 A;  2E3I A;  4LDX A;  2MK5 A;  2K2V A;  3H6Z A;  2J6K A;  1UGP B;  2CUB A;  2PVO B;  3G71 T;  2F1L A;  4UC4 A;  4ZTJ A;  4PJJ A;  1QCO A;  1OEB A;  4LE9 A;  4JS5 A;  1JJ2 P;  2C0I A;  4YTL A;  2L3Q A;  4LUD A;  3LWH A;  4C8Q F;  2RJD A;  2LZ6 B;  1VQN Q;  3CC7 T;  4EIK A;  1IZ6 A;  1QCF A;  2HNI A;  1RLQ C;  4JRP A;  4J7I A;  5GMK l;  1JQQ A;  3OYG A;  1WXU A;  4KGX B;  5GMK m;  4FYW B;  1BIB A;  4M7A A;  3SFM A;  4AT1 B;  2LRQ A;  5IXB A;  5I2S A;  2CZ6 B;  2CUD A;  2JOY A;  4M75 F;  1D0Z A;  3NFC A;  3O8V A;  2WSF E;  3QWY A;  4Z88 A;  2VVK A;  2O4X B;  4F17 A;  1KC8 C;  1Q95 G;  1JRI A;  2E1H A;  3V7C A;  4L59 A;  4RG8 A;  4PJL A;  2JVV A;  1HXD A;  3O5Z A;  2JUF A;  3RDV A;  2GBQ A;  5GAO p;  1XQH A;  3MO8 A;  3OBW A;  4QW2 A;  1MHN A;  2M9U A;  1X6B A;  1Q86 R;  1QVG P;  2DJZ A;  2QA4 T;  2RF0 A;  3JSC A;  3LGF A;  1G8X A;  2GTJ A;  1VQ5 T;  3JCM h;  1WPY A;  1N27 A;  3UPU A;  1B34 B;  2K5I A;  4DOV A;  2BZY A;  1ABQ A;  1M5Q 1;  1XJW B;  1PSE A;  4OB1 B;  4FL6 A;  1KD1 R;  4XAX B;  2QGF B;  4M78 B;  4BUG A;  4DOW A;  3M9Q A;  5L8R E;  2E12 A;  2LCL A;  2PNI A;  1YJN Q;  2HSP A;  3QG1 A;  2RQU A;  2RN8 A;  2X51 A;  2EPD A;  3M0S A;  4R0K A;  4Y91 A;  5A2Q E;  4J6Y A;  3QBY A;  4QQ6 A;  4DBH A;  3CCE A;  3L1A A;  7AT1 B;  4C92 B;  2QEX A;  2E65 A;  1D1B A;  2DE0 X;  2QYZ A;  3S3N A;  1VQ6 Q;  4M78 C;  4KUI A;  1U1T A;  1YJW Q;  2EQU A;  1TXQ A;  5CKH A;  2EQM A;  1WHJ A;  3INZ A;  2ZPI B;  2PUK B;  4KGV B;  2PZ1 A;  3EG3 A;  4RCB A;  1Q7Y R;  3JCM g;  4GLK A;  4E7H A;  2OTJ Q;  2P4T A;  1OX8 A;  4F04 B;  1OPL A;  2EYY A;  1YCS B;  3G71 A;  2JMC A;  2QG9 B;  2P0K A;  3CMA Q;  3M56 A;  4C92 C;  3OYC A;  1NG2 A;  3FJP A;  1JBM A;  4OML A;  1M2V A;  3X25 B;  1BI2 A;  4KH0 B;  2JS0 A;  3RIR A;  2KVQ G;  5HKC A;  3OW2 A;  2RJC A;  4J7F A;  3CC7 A;  3CCM Q;  3S6W A;  1NEG A;  2Y4X A;  3CCJ T;  1DJ7 B;  1B7T A;  3PNW C;  3PMT A;  1M3A A;  2QQB A;  2DA9 A;  3FJ5 A;  4JRQ A;  2X4J A;  2E3H A;  2FPE A;  3TEE A;  1MMG A;  1MV3 A;  4EMG A;  1G3T A;  4WCI A;  2ZPH B;  1G3W A;  1OU9 A;  3SHW A;  1VQ7 T;  8ATC B;  1QW1 A;  4FSS A;  1O9S A;  2X3W D;  3RMQ A;  4LD9 K;  2KQW A;  3SWN A;  2ATC B;  2RHZ A;  2P0P A;  3E2U A;  4FYY B;  3EFR A;  3CC4 T;  2QA4 A;  3HRT A;  3I56 T;  2DAQ A;  1OQK A;  1VQ5 A;  2YHT A;  1F1B B;  4MMK A;  2YUO A;  3VS7 A;  1YBY A;  5GAN d;  1OU8 A;  1CKA A;  4KGZ B;  3V7S A;  4FU6 A;  2DXC A;  2EYW A;  3OBY A;  2K5L A;  1VQ8 Q;  1RI0 A;  1YWP A;  1VQ9 T;  3DB3 A;  2XD0 A;  2DBK A;  1ZQ1 A;  3A8G B;  2OX7 A;  2V1R A;  2P0Q A;  3UWN A;  1IHW A;  4ESR A;  3R6O A;  2CYZ B;  4F7U G;  3RNJ A;  3OS1 A;  1TG0 A;  1AWW A;  2LQ8 A;  1Q81 U;  3CCV Q;  3OW2 S;  4HVU A;  1D3B B;  1N9S A;  2XK0 A;  2DD4 A;  3P8H A;  1NLP C;  3QYG B;  3RKY A;  1K9M U;  4M4Z A;  4M7D C;  2QTV A;  3C12 A;  2J6F A;  1D0Y A;  2DXU A;  3NTI A;  3SEM A;  3OYL A;  3CCR T;  2AK5 A;  2GFA A;  3F70 A;  4ELY C;  1ACM B;  4IIO A;  1FMK A;  1RL2 A;  2EYX A;  3I55 Q;  4HVW A;  1SRL A;  1BI0 A;  2L2P A;  3PGG A;  3OW2 P;  2RI3 A;  4M7D D;  2F69 A;  5D6Y A;  5I22 A;  1VQK T;  2M0Y A;  3BW1 A;  2J7I A;  2FHD A;  4Y28 E;  2K2M A;  2O4X A;  4AFS C;  1X2Q A;  2DPP B;  3CBM A;  2DRK A;  4C8Q A;  2FZK B;  2YLB A;  2KY9 A;  3TCJ A;  2D1X A;  3M55 A;  3NMZ C;  3V7R A;  1M1K U;  1SEM A;  2KSS A;  5GAN 6;  2ZZD A;  4GLM A;  5IN1 A;  2E6Z A;  2KEA A;  2KDS A;  2LMJ A;  4PJO G;  3M54 A;  2VKN A;  4M75 A;  1EIF A;  4OMO A;  5IAY A;  1VQ7 A;  2DL7 A;  4M7A B;  4PJN A;  1G3S A;  1M3B A;  1ZBJ A;  1NPP A;  1OV3 A;  1YIT T;  4JZ4 A;  4E7J A;  4IIM A;  4IUP A;  3OYI A;  4PJO E;  2YT6 A;  3QO3 A;  2NUP B;  3CC4 A;  3RER A;  1M1F A;  3EH1 A;  2PVD B;  3I56 A;  2FB7 A;  2Y4Y A;  4M77 D;  5LJ3 f;  3OYA A;  3VS0 A;  4ELZ C;  4HCZ A;  2JTE A;  2NLU A;  1E6H A;  5DLQ E;  5KYU B;  2R58 A;  3CME T;  4VUB A;  3LWI A;  1P92 A;  2CRE A;  4F7U B;  5CK9 A;  1LCK A;  1NZ9 A;  5GAN 3;  1YJ9 Q;  4M7A C;  4J5Y A;  2HBP A;  3CBP A;  2M0O A;  5C0M A;  3CCL T;  3NTH A;  3BDL A;  2AKK A;  3CC2 T;  2RHI A;  1U06 A;  3VRY A;  1W2B S;  1RUW A;  2ZPF B;  2V26 A;  1M8M A;  2K9G A;  3AHU A;  1GBR A;  1IGQ A;  2E64 A;  5EC7 A;  2X4W A;  1I81 A;  2BIV A;  2RHX A;  3C4S A;  4ZN3 A;  1VQP T;  5IT9 E;  1SF9 A;  3CCS Q;  2MAM A;  3JB9 D;  4BDY A;  5CVI A;  4PJO F;  1GL5 A;  2L5Q A;  2BTT A;  1W70 A;  2K3X A;  3CCR A;  2LT4 A;  2P84 A;  1W2B P;  2ZPG B;  1WHL A;  1KIK A;  2R5M A;  3RKX A;  3G6E Q;  4IKF A;  2CZ0 B;  1UJY A;  5CAI A;  3CXC A;  3CCQ Q;  5IHK A;  3OYY A;  2RA2 A;  1KD1 U;  1K4U S;  1GCQ C;  1NBE B;  2KK4 A;  5CO7 A;  3M0R A;  4D8D A;  1VQK A;  1HJD A;  3OYM A;  1YHQ T;  4TVR A;  2A7Y A;  1H3H A;  1B3Q A;  1TUG B;  3LH0 A;  2A37 A;  2RH2 A;  2QQS A;  3VS4 A;  1M2V B;  5FWB A;  4Z8A A;  1M4Z A;  3EHR A;  3C0C A;  3GIB A;  1YWO A;  3UDC A;  1G2B A;  1RAE B;  1YP5 A;  1NE8 A;  4PL6 A;  2VB6 A;  3PFS A;  5D6X A;  5GAM f;  1RAG B;  3EGU A;  1KQ2 A;  3OMG A;  4BE1 A;  1VQL T;  3PIP A;  4C5H A;  1G5V A;  1YIT A;  3CD6 T;  5GMK j;  3NGP A;  1K9M R;  1Q7Y U;  2ABL A;  4HCK A;  1M1G A;  5FRN A;  2KT8 A;  4L6V 5;  4V2S A;  3KUF A;  1IB8 A;  2KBT A;  4QVD A;  1ZSZ B;  1MV0 B;  2KE9 A;  1RAF B;  3G1J A;  3HPW A;  2H3J A;  3M57 A;  2LC4 A;  4MML A;  4F16 A;  3MP1 A;  1R8O B;  3VYG A;  3CME A;  1KQS A;  1BI3 A;  2M02 A;  1QP3 A;  2BE9 B;  1D0X A;  2NUT B;  1QVP A;  4ATO A;  4LDY A;  2NWM A;  3CCL A;  5DLO A;  4OMM A;  3CC2 A;  2ECZ A;  3PT9 A;  3QWX X;  5GAO q;  4J9D A;  3KFV A;  2O9V A;  1FYN A;  1D3B A;  1AEY A;  1B07 A;  2V8J A;  1VQ8 A;  1TUC A;  2XG8 D;  4JJN K;  4XK8 E;  1SHF A;  2CDT A;  2JM8 A;  4FYV B;  1QQJ A;  4J83 A;  3SWN C;  4IUR A;  4IUV A;  4EDU A;  1M1K R;  4NS5 A;  1YI2 T;  1VQP A;  4Q5W A;  4HXJ A;  4OMN A;  3QHS A;  2OAW A;  3VJP A;  4WF2 A;  4DBF A;  3MJX A;  3A8M B;  2GFU A;  2DLP A;  4LD6 A;  5GMK h;  2DTI A;  2EW3 A;  4HT8 A;  3QJY A;  2EVR A;  4QVZ A;  3L42 A;  3J80 E;  1NM7 A;  2VUB A;  5CQY A;  2MMP A;  2EJG A;  3OB9 A;  2KR3 A;  1BK2 A;  4KT0 E;  5LJ3 e;  4JRK A;  1GBQ A;  3UF4 A;  2AT1 B;  1D09 B;  2JM9 A;  4KRT A;  2LNV A;  1VQO T;  2KYB A;  3OY9 A;  4N4H A;  3OS0 A;  4P5N A;  1ZSG A;  1UGR B;  1M2O A;  4HVV A;  3FB9 A;  4M78 E;  4D6W A;  3EH2 A;  1YHQ A;  4GBQ A;  1YIJ T;  4QQG A;  1D1C A;  2OJ2 A;  5FRM A;  3VU3 C;  5GJW B;  1QVG S;  2E5K A;  2L3R A;  3GOX A;  3TU4 K;  3DLM A;  1UFF A;  3LW5 E;  1I5L A;  3EG2 A;  1WGS A;  2DNU A;  3MPU B;  2H8H A;  1PM3 A;  2AKL A;  3JCM X;  1TH7 A;  1VYU A;  2CP7 A;  3MEU A;  2NUP A;  1NYF A;  3JRZ A;  1BBZ A;  1W4S A;  1NLO C;  2DYI A;  3TVT A;  4MDX A;  4C8Q B;  1VQL A;  3I5S A;  4OGC A;  1WJS A;  4FT2 A;  5KYU A;  3R6N A;  3CD6 A;  2LVM A;  4AFZ C;  4E7Z A;  3HRS A;  3WVD B;  2OTL Q;  4F7U A;  4AG2 C;  4DQ2 A;  2W0Z A;  1G83 A;  1KC8 R;  1RAH B;  2M1H A;  5KYW A;  1K0X A;  3M0U A;  4M75 B;  1Y0M A;  4JRI A;  3A98 A;  5CQX A;  4KUL A;  1UGS B;  3G7Z A;  2FL7 A;  2DIG A;  1X69 A;  1HSQ A;  3VS6 A;  2K5F A;  3GLX A;  4A4E A;  4C8Q C;  3MP8 A;  1W1F A;  3LX7 A;  1TUD A;  3H0H A;  4QVC A;  3ULR B;  4FW1 A;  1BI1 A;  3ZBD A;  3JCM W;  3M0Q A;  3QDR B;  4E2F B;  4M75 C;  2ED1 A;  2KGT A;  1WYX A;  1OZ3 A;  3DLL A;  2HL5 C;  1R0C B;  2BE7 D;  1QWE A;  4J9B A;  1GCQ A;  5LJ5 f;  3E9G A;  4BI8 B;  1N8R C;  1YI2 A;  2XHC A;  2K79 A;  1S72 Q;  1ABO A;  1Q82 C;  4RKU E;  1WFW A;  1FX7 A;  3ZFJ A;  2DM1 A;  1BCO A;  3J81 E;  2DD5 A;  2KT1 A;  2L0A A;  5GAM e;  5KYX B;  1AWO A;  1Y57 A;  4Z02 A;  2ESW A;  1N8R R;  1H3Z A;  2LX9 A;  1ZUK A;  3RR6 A;  1Y07 A;  5I2M A;  3CCU Q;  1Q82 R;  2XDD A;  1WHH A;  4PJO A;  2ZPB B;  2LJ0 A;  3FRN A;  3MCA B;  2DEU A;  5GAO n;  1KJW A;  5LJ3 j;  3D7S B;  2EWN A;  3UA6 A;  5KYY A;  2JT4 A;  2F5T X;  2EJF A;  1VQO A;  2LX7 A;  4RTU A;  2FZG B;  4ME7 A;  3RBB B;  4CRI A;  1T3S A;  1ZA2 B;  1LVK A;  3VUZ A;  4EMK A;  4M7D E;  1MMD A;  4M78 D;  1QKW A;  2KMT A;  1YIJ A;  4O5V A;  2HKN A;  3LH5 A;  2FPF A;  4J9F A;  1VQ4 Q;  3N5B B;  1VQN T;  4ZN1 A;  6AT1 B;  3GPL A;  1C0M A;  1EX4 A;  3H8Z A;  2LCC A;  1PNJ A;  3SD4 A;  3RUX A;  2DZ9 A;  1SHG A;  1VQM Q;  3V8L A;  4LNP A;  4C92 D;  5HK3 A;  3UAT A;  1ZSZ A;  2G3R A;  1ZUY A;  4N4I A;  2HMA A;  2JN0 A;  3X26 B;  3GBQ A;  3BE3 A;  2HL3 A;  2A36 A;  2RQW A;  1UUE A;  3AT1 B;  2AHJ B;  2LJ1 A;  2O9S A;  5IXF A;  4R56 A;  5A0L A;  4J9I A;  2F5K A;  4HCC A;  2E70 A;  2NUT A;  1PG5 B;  3RES A;  1BCM A;  2YRC A;  3G4S Q;  4M77 E;  2PTK A;  2CP0 A;  5IHN A;  1RI9 A;  1HK9 A;  4CC2 A;  3ME9 A;  1Y96 A;  3ZEH A;  3VS3 A;  5KYN A;  1QKX A;  2JNG A;  3PTA A;  2BZX A;  4M7D F;  1OUL A;  1MMA A;  1IHV A;  3JCM f;  4X34 A;  1YCY A;  4J9H A;  2QQR A;  2WSC E;  3V8K A;  5J39 A;  1KSW A;  1QP2 A;  2PUO B;  3BFM A;  2EKH A;  1VYV A;  2RQR A;  3EGD B;  3P8D A;  2FG0 A;  1T3L A;  4EMH A;  1G3Y A;  3JCM J;  1YJN T;  3JB9 G;  4DA4 A;  2QAS A;  2KNB B;  3Q1J A;  2G6F X;  3S3O A;  1AD5 A;  2E6N A;  4CC7 A;  2ED0 A;  3URG A;  2M16 A;  2RNA A;  1TS9 A;  5J26 A;  4M7A E;  3L2V A;  5GAM j;  4JS4 A;  2B86 A;  1C6V X;  2YDL A;  2JZ2 A;  4PFO A;  2E4H A;  1VQ6 T;  1VOM A;  2DYB A;  2ZPE B;  4LXC A;  1FMV A;  1YJW T;  2XKO C;  2HQE A;  4M77 F;  2DL3 A;  2P4R A;  4AFU C;  3J7A F;  2VV5 A;  1M90 C;  3EFS A;  2OTJ T;  1AZE A;  1OYX A;  3WXM B;  2O2O A;  3E1S A;  2XDB A;  2OI3 A;  4AMC A;  2PQW A;  4RTZ A;  3EAE A;  3CMA T;  3BY7 A;  1TU0 B;  2WSE E;  3JAM E;  4FT4 A;  3MEA A;  3EGX B;  1M90 R;  3A5Z B;  3M53 A;  1VQN A;  3THK A;  2F2X A;  3M58 A;  2D6F A;  2CP2 A;  1BB9 A;  3CCM T;  1WHG A;  1H8K A;  2RK1 A;  3OYE A;  4J8O A;  2YUP A;  3RMS A;  2DEQ A;  4BE0 A;  5KCH A;  2A3L A;  5LJ5 e;  2MWO A;  1C1A A;  3JB9 F;  1BU1 A;  3H41 A;  1WXB A;  1PHT A;  1GRI A;  1D1A A;  2EYQ A;  1PSF A;  1PKT A;  2A08 A;  3QYH B;  1AHJ B;  2KI7 A;  2VGN A;  2YUN A;  3M0T A;  2DJQ A;  1XNI A;  2C06 A;  3VS5 A;  5CIU A;  3HSB A;  1T0J A;  4JJD A;  1FWZ A;  1KK7 A;  3PIO A;  3V8J A;  2RI5 A;  1QWF A;  2RPN A;  1WHK A;  2K7A A;  5KYW B;  1VYT A;  5GAO l;  4J9C A;  2E41 A;  2OAU A;  2KYM A;  1I1J A;  5GAO m;  2HQH A;  3HRU A;  2VC8 A;  5KH6 A;  2RO0 A;  3CBO A;  4OB0 B;  4PFZ A;  2PVG B;  3L2Q A;  4PFP A;  1VQ8 T;  1XTD A;  1UE9 A;  1ZHI A;  2DKG A;  1TWB A;  4JJB A;  4RMO A;  2LP5 A;  1YJN A;  3NHN A;  3S3M A;  5KYX A;  1RLP C;  1EZZ B;  4C5E A;  3HTR A;  2YLC A;  1ARK A;  4XTW A;  3HL8 A;  3C94 A;  2DMO A;  1CKB A;  3TRE A;  3QDF A;  4NOY A;  2RHU A;  4XTX A;  3CCV T;  4M7A D;  1X6G A;  1OI1 A;  3OYN A;  1OZ2 A;  1WQ7 A;  1K73 C;  1VQ6 A;  4X9C A;  1KC8 U;  4RTV A;  1YJW A;  2M51 A;  3CCE Q;  2FO0 A;  2HCK A;  1QMC A;  4NL2 A;  3M59 A;  2QEX Q;  2LQW A;  1MGQ A;  1W6X A;  1SRM A;  2LJ3 A;  4FYX B;  2OTJ A;  2X35 A;  3OYF A;  4IUU A;  1PD0 A;  3I55 T;  3CMA A;  3EFO A;  3UA7 A;  1PRM C;  4E7S A;  4C0Z A;  4PJO B;  1RAC B;  2AZV A;  2MOX A;  3G71 Q;  2DIQ A;  2I2L A;  1K8A C;  1UHF A;  5KYY B;  3JCM e;  3CCM A;  2X9H A;  4FCY A;  2EBP A;  5ECA A;  1NEB A;  3JCM c;  3FIF A;  1WX6 A;  2VXF A;  3JCM P;  1QVF A;  4EMK B;  1WXT A;  3CC7 Q;  4R55 A;  1PC0 A;  1SSF A;  2MYS A;  5LJ5 j;  5D6W A;  3U23 A;  2MIO A;  2EQK A;  3QZ9 B;  4ZNX A;  4PJO C;  4BAC A;  4OF1 A;  4EPC A;  1N8R U;  1OX9 A;  1U5S A;  2EIF A;  4OMF B;  3GNG A;  5I21 A;  1Q82 U;  4NL3 A;  2CKK A;  2F2W A;  2L89 A;  4EMK C;  1QLY A;  3M0P A;  1X6O A;  4C0F A;  3HHT B;  3SDZ A;  2LCS A;  2MWP A;  1J3T A;  3EGD A;  1A0N B;  1X01 A;  2QA4 Q;  4BB7 A;  3QUI A;  5A0D A;  2EGC A;  5CKB A;  3RKW A;  4C0D B;  2EFI A;  2RHY A;  5KE3 A;  5GAO r;  1YJ9 T;  1I07 A;  4ZGE B;  1VQ5 Q;  1Y96 B;  1U3O A;  1UEC A;  3QPH A;  1ZSZ C;  2VGM A;  4K11 A;  1Z9Q A;  4ZGJ B;  2DET A;  2EGE A;  3CXC S;  2CP3 A;  3PE0 A;  4QKU A;  5CKF A;  2DVE A;  4E7L A;  4RTT A;  3KBG A;  2JW4 A;  2L3S A;  4PJM A;  4A63 B;  2COY A;  2LNH B;  3CCV A;  4C0D C;  1UDL A;  2JXB A;  3OA6 A;  4DEY A;  5FU6 B;  3CCS T;  2KRM A;  2IIM A;  2XU8 A;  3EG0 A;  2XDP A;  4LDU A;  3L2R A;  3PVQ A;  2CZ7 B;  1QVF S;  2DER A;  3GF5 A;  2CT4 A;  2AIR B;  2MPX C;  4M75 E;  2Z0W A;  2I0N A;  3VS2 A;  3EGX A;  5GAN f;  2IG0 A;  4M78 G;  4PLL A;  4LDW A;  3CXC P;  4BI4 A;  1U8R A;  3FDR A;  2QQA A;  1WI7 A;  3LGL A;  3QJ6 A;  3EG1 A;  2COW A;  3G6E T;  3I55 A;  2BZ8 A;  1X2K A;  1FXX A;  4PK4 A;  4ANJ A;  2ROT A;  3CCQ T;  2YUQ A;  5FU6 C;  4Y92 A;  2IPO B;  2QGG A;  4JZ3 A;  4C92 G;  4AFQ C;  1KQS S;  2GTO A;  1QVF P;  5LJ3 d;  4OVA A;  5LJ5 g;  1HYO A;  2V8I A;  2JMA A;  2L3P A;  1ZLM A;  3LYI A;  3CCJ Q;  2GQV A;  1ZUU A;  2FYK A;  1UG1 A;  4C92 E;  2MF2 A;  3PMI A;  1UJ0 A;  1PD1 A;  1QCN A;  2D9T A;  1AZG B;  1BIA A;  4ORZ A;  4IUQ A;  2YSQ A;  3JCM Q;  2A0F B;  1M3C A;  1N5Z A;  2HDA A;  2KRS A;  3OQ5 A;  1GXI E;  4AG1 C;  2XIC A;  4OB3 B;  1VQ7 Q;  2DTH A;  1Q86 C;  1KQS P;  4KH1 B;  2K3Y A;  4XTU A;  4XTV A;  4X9D A;  2D0N A;  4OMP A;  3L2Z A;  2HD0 A;  3NPF A;  1HD3 A;  1LJO A;  3NTK A;  3CPF A;  1R77 A;  2DL4 A;  3CC4 Q;  5L23 A;  5GMK i;  4ZGD B;  3I56 Q;  1M90 U;  4M78 F;  1YJ9 A;  1UTI A;  2DBM A;  3JV3 A;  1KD1 C;  4B6M A;  2JTF A;  2V1Q A;  1XOV A;  2FZC B;  3WVE B;  1VUB A;  5FLX E;  3OYJ A;  2CP6 A;  1PCX A;  2KRO A;  4BY6 B;  4C92 F;  5J3B A;  1VQ9 Q;  3E9F A;  4ZTF A;  4KUD K;  4J9E A;  1FMW A;  1I0C A;  1KFZ A;  4C8Q D;  2BUD A;  3ER0 A;  3T9N A;  1RAB B;  3CCS A;  1UB4 A;  1K0S A;  2EYZ A;  1WHM A;  3SB2 A;  2QDY B;  2RM4 A;  1MUZ A;  4M75 D;  5C6S A;  4L5G A;  2MI6 A;  2ENM A;  2LQK A;  3PVL A;  1O75 A;  1Q7Y C;  4BY6 C;  4XQ3 A;  4M7D G;  3C95 A;  4IUT A;  3G6E A;  1WA7 A;  3CCR Q;  3VYH B;  1ZX6 A;  1RAA B;  3CCQ A;  3QSU A;  1IRX A;  3FEO A;  5GAM d;  4FIB A;  3E19 A;  3VKI A;  2CGH A;  1YNZ A;  2FRY A;  2GQI A;  3M4G A;  4MDW A;  1MMN A;  3P8B B;  2HQX A;  3HFN A;  4FW2 A;  4OMQ A;  4E7I A;  2CH4 A;  2DXB A;  2HAX A;  1JO8 A;  3EFO B;  1IXD A;  5A0G A;  2VWF A;  1VQK Q;  2FRW A;  2HKQ B;  2D8J A;  1MNE A;  2FEI A;  2RJE A;  3QKJ A;  4RUG A;  1AVZ C;  2QTX A;  1NJI C;  2CSQ A;  2R5A A;  1WDX A;  4M77 G;  2YWW A;  1GCP A;  4RTX A;  1WNL A;  3X24 B;  4A4G A;  2K4Y A;  2CZ1 B;  3I5R A;  2YRV A;  1BKB A;  3MHX A;  3M5A A;  2XMF A;  1NJI R;  4XTY A;  5LL6 S;  1Z9Z A;  3I35 A;  5CR2 A;  4A4H A;  2RQV A;  5GJV B;  1K73 U;  2OTL T;  4F14 A;  3EG9 A;  3TQ7 P;  1LPL A;  1SKU B;  2XID A;  4N0A C;  4XU0 A;  1YIT Q;  4E47 A;  1UGQ B;  4XU1 A;  1E6G A;  2QAZ A;  5GAN e;  3A8O B;  5LJ3 h;  1RAI B;  4J6W A;  1JB0 E;  1VIE A;  3KXT A;  3OMC A;  2J05 A;  5FRO A;  3HP9 A;  4D8K A;  2NYS A;  3CME Q;  4XU3 A;  5IH2 A;  1H92 A;  1I5O B;  2V8K A;  4C5I A;  2FPD A;  2GGR A;  4E7K A;  2D0Q B;  3CPW A;  4M7A G;  3OYD A;  2ZCF B;  3VV0 A;  2DF6 A;  4FM4 B;  3CCL Q;  1UHC A;  2W10 A;  2FVU A;  1K8A U;  1JEG A;  1OOT A;  2EQJ A;  3CC2 Q;  4OGE A;  2HZY A;  1K1Z A;  1AWJ A;  1X75 C;  1SSH A;  2RD1 A;  2RK2 A;  4M7D B;  4J9G A;  2HBW A;  4CI0 C;  1NYG A;  5KCO A;  1S72 T;  3JCM b;  3I9Q A;  1M9S A;  1KQ1 A;  5DY9 A;  3REA B;  2EQI A;  1AT1 B;  2K6D A;  2K57 A;  4II1 A;  1AOJ A;  3UT1 A;  4X1V A;  1N9R A;  2RJF A;  5FU7 B;  1VQP Q;  1X43 A;  2E5Q A;  5LJ3 g;  2VXE A;  2DFU A;  4E6R A;  2NUZ A;  4LDV A;  2DIL A;  3CCU T;  2SEM A;  1WZO A;  4RG2 A;  1M8V A;  3JCM V;  4HCB A;  4F7U E;  2MCN A;  3QZ5 B;  3DB4 A;  2VYT A;  1H64 1;  1N6A A;  2DXT A;  4JUV A;  4J6X A;  3H0F A;  1V76 A;  2QQ9 A;  5FU7 C;  9ATC B;  1W2B A;  2QK0 A;  1JXM A;  1GFC A;  1X27 A;  4M77 B;  3GNF B;  3QII A;  2GCX A;  4QT7 A;  2E10 A;  2X4Y A;  3LLR A;  2DK3 A;  4JPB W; 
#chains in the Genus database with same CATH homology
 3CME Q;  1N8R R;  3G6E Q;  1VQO Q;  1K9M R;  1M1K R;  2QA4 Q;  1K73 R;  3CCS Q;  1Q7Y R;  1VQN Q;  3CCM Q;  3CCQ Q;  1YHQ Q;  1VQ8 Q;  3OW2 P;  3CCU Q;  1YIT Q;  1Q82 R;  1VQL Q;  2OTJ Q;  3CC4 Q;  3I56 Q;  3CXC P;  1VQ9 Q;  1VQ5 Q;  3CC7 Q;  1QVF P;  1NJI R;  2OTL Q;  1VQ4 Q;  3CPW P;  3CCL Q;  1YIJ Q;  1S72 Q;  1VQP Q;  1M90 R;  3CD6 Q;  1KD1 R;  3CC2 Q;  1KQS P;  3CCV Q;  1YI2 Q;  1Q86 R;  1Q81 R;  1QVG P;  3CMA Q;  1KC8 R;  1K8A R;  1JJ2 P;  3CCE Q;  1VQ6 Q;  2QEX Q;  1W2B P;  3CCJ Q;  1YJ9 Q;  3I55 Q;  3G71 Q;  1YJN Q;  1VQ7 Q;  1VQK Q;  3CCR Q;  1YJW Q;  1VQM Q;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...