1VQLQ

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqlQ00
1VQPQ 1S72Q 2OTJQ 1VQ4Q 1VQ7Q 1NJIR 1Q7YR 3G4SQ 1KD1R 3CCQQ 2QA4Q 1VQOQ 1M90R 3CCVQ 3CMEQ 3CC7Q 3CCSQ 1VQMQ 1KC8R 1VQ6Q 3G71Q 3CMAQ 3CCUQ 1YITQ 1K9MR 2OTLQ 1QVFP 3OW2P 1YHQQ 1JJ2P 1YJWQ 3I56Q 3CCMQ 1QVGP 3CCRQ 3CPWP 1N8RR 1VQ9Q 3I55Q 1VQ5Q 3CXCP 3G6EQ 1Q86R 1VQNQ 1K73R 1K8AR 3CC2Q 1YJNQ 1W2BP 1YJ9Q 3CCJQ 3CCLQ 1M1KR 1KQSP 3CCEQ 3CD6Q 1YI2Q 1VQ8Q 1VQKQ 1Q81R 1YIJQ 3CC4Q 1Q82R 1VQLQ 2QEXQ
chains in the Genus database with same CATH superfamily
2CUBA 1HK9A 3OW2S 3ER0A 3S6WA 3CCQT 3JB9J 5FW9A 2EQIA 1AWXA 1QKXA 3S3NA 4QQ6A 3BFMA 4J6WA 2DILA 4M77G 2CZ0B 1UGQB 2JVVA 1KK7A 2V1QA 4KGZB 2EYZA 1SRLA 4PKCC 3OYIA 4XU3A 4OVAA 1RLPC 1I1JA 5DM7R 3REBB 4AFSC 2LMJA 1K8AU 2E1HA 1CKBA 1OZ2A 4GY5A 4DEXA 3HP9A 5CR2A 3JAME 1ZSGA 1TH7A 2PVGB 4J9BA 3ZEHA 1TUCA 2DTOA 3QDFA 4FL6A 1W2BP 1DJ7B 5HCKA 2AT1B 1KQSP 2KROA 4BY6B 3OS0A 3M0RA 3G1JA 4RCCA 1VQ5A 3C4SA 4ELZC 2LCLA 2R5AA 5KYUB 1OU9A 3REAB 4DBHA 2LNHB 2QA4T 1R8OB 2DL3A 3L2QA 4ESRA 2COYA 1MGQA 1UHCA 1N8RR 1BYMA 2BE9B 4QQDA 2YSQA 3CCRT 3MHXA 2RJFA 3V7CA 4XTWA 1ABOA 5IH2A 2E65A 3M53A 1VQKT 2QGGA 5CCAA 3MP6A 3CC4Q 4PJOF 5LJ3e 1X6BA 1ZUYA 1QVPA 4F04B 1G2BA 3FEOA 1WFWA 3JCMW 2XG8D 4M78C 2M9UA 2DF6A 2LCSA 3CMAQ 2QASA 3QZ9B 2DXUA 3I55T 2HDAA 1AZEA 1NM7A 2KT8A 2KXDA 4UC4A 1W1FA 3SB2A 1B34B 2DYBA 3ASKA 4JUVA 4CRIA 3S3OA 1K4US 2HQHA 2ABLA 3OYBA 3G4SQ 2PU9B 1K9MR 1TWBA 1K76A 4C0GA 1M8VA 3NPFA 3WXMB 5GAMg 2ECZA 5HY6A 2VVKA 1WHGA 2ZPEB 3CCJT 1YIJQ 4Y92A 2ROTA 4JPBW 4C92F 4PK4A 2A0FB 3L2ZA 3M0SA 2KI7A 3TCJA 1UGPB 1Q81C 4E6RA 4F16A 3NTHA 1V1CA 1PC0A 4ZNXA 1SHFA 1KIKA 2VKNA 3M0QA 3UF4A 2Z0WA 4PJOA 3I56A 4GLMA 3LLRA 4KH0B 2DPPB 2AKLA 3VS5A 4J9HA 1YCSB 5GAMj 3GNFB 2JTFA 3T9NA 2R57A 3OYCA 2QTXA 1WHMA 2EAYA 5LJ5d 2M1HA 3C12A 4MDWA 1QVGA 2PZ1A 2L5QA 3HRTA 1OULA 2DTIA 5GMKm 4J9DA 2JM9A 1VQ6A 1JBMA 4OF1A 3QWXX 1YJ9T 1GCQC 4M7DG 2FO0A 3MP1A 2DL7A 2EYYA 1TUGB 3FB9A 4KUDK 1UFFA 1QW1A 4JZ4A 4A54A 2IPOB 2OTLT 2K3YA 2QG9B 4M7AD 5GMKh 4JJDA 1N6AA 2LX7A 4C5HA 1IHWA 2KMTA 2DL4A 1M8MA 1H92A 1VQPT 1MMNA 4M7AE 4A4GA 5CQYA 1VA7A 3EG0A 4DOVA 2CZ7B 3LWHA 2JN0A 4O6JA 4PFPA 1P92A 4OP0A 3G6EQ 4FYYB 4MZTA 1RI9A 1K73R 5LJ5j 2AK5A 2JZ2A 5IXBA 1Q7YU 1N5ZA 1IGUA 2NUPA 4IUQA 4DQ2A 2RK2A 1N8RU 1VQ7T 2CP3A 3HRSA 2E5QA 1BB9A 3QHSA 1M2OA 3X25B 2RQVA 3G7ZA 3QZ5B 4NS5A 4FIBA 5LJ3g 2KDSA 5KYYA 3CCMT 1B7TA 1VQ9T 4KH1B 3OYAA 3JB9D 1MNDA 3RKXA 4C0DB 2CSIA 2MK5A 1WHKA 2L2PA 5KYWB 3G71A 2DZCA 4C5GA 3NTIA 2OX7A 4BI8B 3P8HA 4J7IA 4M75C 4HVUA 1UB4A 1G8XA 4C8QC 1M3CA 1G3TA 4N4IA 4PJJA 1JRIA 4AFQC 1YHQQ 2K3BA 2CH4W 3QYHB 4BD3A 2E4HA 3EFRA 3E2UA 1U1SA 3H41A 1VQOA 5GAN7 4IUTA 2OJ2A 2K4YA 7AT1B 4E7JA 3TSWA 1ZA2B 3CCEQ 2K5IA 1NBEB 2ESWA 5GANd 4M78A 1K9MU 3E9GA 4JRIA 4EMHA 4F7UE 5GAN6 8ATCB 3M56A 2D0QB 4M75D 2SRCA 1D3BA 2RF0A 4KT0E 4C8QD 1IREB 1D1AA 1FX7A 3BW1A 3Q1JA 2LT4A 3EH2A 5GMKl 1WXTA 2CP0A 1X2QA 1KD1U 2DVEA 1VQLQ 2HL5C 4D8DA 3RKWA 2KAFA 1RAHB 4XTYA 2F2XA 4JRKA 4RG2A 3CMEQ 4QVZA 1H8KA 1TSFA 4MMKA 4L6V5 4LDUA 1MMDA 2FZCB 2O4XA 4N0AC 4LDWA 1G3SA 2MCNA 4M77E 3EG9A 4RTWA 1ZHIA 2OTJQ 5FRNA 3OYLA 1RAFB 2MOXA 1ZUUA 2ATCB 5GANj 4F17A 2LP5A 3UWNA 3EGDA 4RTYA 4WCIA 4XU1A 3EGXB 1O9SA 2ZZDA 1WJQA 1OEBA 3QWYA 1KG1A 2EWNA 3OY9A 2RQRA 4HCZA 3NFCA 3CCRA 5FLXE 3RIRA 2DXCA 4EMGA 3CCVT 1VQKA 3VS0A 5GMKj 1BIBA 3JCMh 1IHVA 1OYXA 3M4GA 1GCQA 4QT7A 3BE3A 2EQJA 4XTXA 1MV3A 3A8LB 3OS1A 1VQNQ 3QJ6A 1EIFA 1PSFA 2HCKA 1M1KR 5I2MA 4LDVA 1S72Q 1YN8A 1NLPC 5AT1B 2KGTA 1VQ4Q 1JJ2S 1WIEA 3QUIA 2KNBB 2YHTA 1JXOA 2NYSA 2JTEA 1U8RA 1K73U 2V26A 3RDVA 1WA7A 3CPWP 2EQMA 4BUGA 2F2WA 3I56T 1W4SA 2HZYA 2MAMA 4ZN1A 4M7AB 1YCYA 1YWPA 3OYDA 1U5SA 2C06A 3KFVA 1QP2A 2QQ9A 4IIOA 1WZOA 1AT1B 2L3SA 5FU6C 4JZ3A 1AOJA 4E7LA 1Q82C 3OBWA 3M57A 2E6NA 2VWFA 5D6YA 3A8GB 1OQKA 2LZ6B 1UTIA 2HAXA 4C0FA 1YHQA 2CP6A 4J8OA 2RQWA 4XU2A 3H0IA 3MEVA 2RJCA 4M7AG 4E7SA 3LX7A 1XNIA 1YWOA 4LNPA 2GTOA 1UUEA 3CPFA 1W2BS 1KQSS 3PIOA 3MCAB 1HJDA 4LD6A 2E64A 3MEAA 1X6GA 2HSEB 1RABB 2LNVA 2DXTA 4L59A 4DBFA 3CCLQ 3E9FA 1ZSZB 3MO8A 2CT4A 2GQIA 4BDYA 5GAOq 4FYXB 4KULA 1XTDA 1MNEA 4WTOB 1AEYA 4J5YA 3ME9A 3O8VA 1QVGS 2DX1A 3EGUA 3FJ5A 3KUFA 4EMKB 1VYUA 1X27A 3V8KA 1QVFA 1OU8A 2CP5A 2QDYB 4M7DE 3CC4T 3LH5A 1IO6A 3JB9G 1TS9A 2K79A 1X43A 4PJOC 3E1SA 2ZPIB 3QIIA 1VQPA 3CMAT 3A8OB 5CO7A 2KYBA 3BDUA 3JV3A 3JCMg 3OYNA 2PVOB 2GBQA 3MP8A 4Y91A 2NUZA 1JEGA 5I22A 1Q81R 3AT1B 3M0TA 3L2RA 4PLLA 2F1LA 1PM3A 4F7UG 3G4ST 1KQ1A 4PJOD 2YUQA 1QCNA 4M77B 4N0AA 4HKEA 4Z89A 2RI5A 2V8IA 3J81E 4R55A 1HD3A 3PVLA 4M75G 5A2QE 2H8HA 4PJOE 2QQBA 4C8QG 3CQTA 4A53A 5GJVB 3ZFJA 1NPPA 1TG0A 1M1FA 4PJMA 3CCMA 1YIJT 1VQNA 4N4HA 1K9AA 3H0HA 3FDRA 1G3WA 2FZKB 4C92C 2C0TA 1XOVA 1KC8R 1S72A 2J6OA 1M1KU 2EQKA 1AZGB 1M1KC 1RLQC 5CQXA 4HVVA 3CXCP 1IRXA 2EJ9A 4ZGJB 2DBKA 2K7AA 1VQ8Q 2E6ZA 1Y96B 2R5MA 3JCMX 4IUVA 4F14A 4CC2A 1EX4A 4A63B 4R56A 2YDLA 2QAZA 1PWTA 2NWMA 3ULRB 1QCOA 3GNGA 4PFOA 3OA6A 1XJWB 3EH1A 1MHNA 2LTOA 2V8JA 4AT1B 1SG5A 2XU8A 2EBPA 2FHDA 1M2VA 4DBQA 1UGSB 1C6VX 1HSQA 1WNLA 2GCXA 4Y28E 2RN8A 4KRTA 2RM4A 1WGSA 2DNUA 3GOXA 3LGLA 2DERA 1GFDA 1M4ZA 1V29B 2QYZA 3VYHB 1FMKA 1M9SA 1IXDA 2RPNA 3OYKA 3VUBA 1KSWA 6AT1B 2E5KA 3KXTA 3ZBDA 5A0DA 2JT4A 3VS4A 2YRVA 3LGFA 1IGQA 2RI2A 3SWNA 1YJNQ 2YUNA 4J9EA 2KY9A 2K5LA 2E10A 2JM8A 2YUOA 2NLUA 1H641 2P84A 5FU7C 1QVGP 2FL7A 3MEUA 2FPEA 4PNOA 1PKTA 1UJYA 2RQTA 1PNJA 2XK0A 1SRMA 3M55A 3VKIA 1RACB 1V76A 4BI3A 3G6ET 2X3WD 5C0MA 5GAMd 2L0AA 2D8JA 1AWJA 4C5EA 1ACMB 2CZ6B 2EW3A 2EYXA 3TQ7P 4FT2A 5LJ5f 3CXCA 3NTKA 1TU0B 2QGFB 2DK3A 1D0XA 1VQMQ 1T0JA 5LJ3h 4M78D 2M51A 4HT9A 1JU5C 4FYVB 1MMAA 2V1RA 4RCBA 2DKGA 3CCVA 4QW2A 2JTMA 4M78E 1ARKA 5IXFA 4BI4A 2FB7A 3WVDB 3UPUA 3CC7Q 1B3QA 1TUDA 2JJ9A 2J05A 2ZPHB 1Q81U 4MMLA 2E41A 1YHQT 4M7DB 3QBYA 1MV0B 2A28A 3TVTA 3JCMV 1NPRA 3P8DA 1JQQA 3OYGA 1YI2Q 5CIUA 3VS2A 4IIMA 3J80E 1T3SA 3CBMA 4DOWA 5GANe 4J9FA 3TEEA 1BK2A 1Y71A 3JCMJ 3WVEB 1VUBA 2HQEA 2LQKA 5IN1A 2DFUA 4E2FB 3RMSA 4BE0A 4XK8E 1WJSA 3OYJA 2DJZA 2DETA 4M4ZA 3A1PA 4JLGA 2K2MA 2LT1A 2WACA 3OYFA 2BE7D 3U23A 2COZA 1KC8C 3I5RA 1ZX6A 1VQLT 2VXFA 2RHXA 2K5FA 2MMPA 4TVRA 4E7HA 3SD4A 1VIFA 3CCSQ 3CMET 2DYIA 3M4YA 1YITQ 3OQ5A 3A8MB 4JJBA 2Y4YA 2ZPBB 1QWEA 2LVMA 2X9HA 3L2UA 4PL6A 4C92A 4JLIA 2GTJA 3SEMA 4NL2A 4Z8AA 1GRIA 2X3XD 3GLXA 1WXUA 2ENMA 4JS4A 2OAUA 2CH4A 4PJOG 5LJ3d 5GANf 3M59A 5GAN5 4FSXA 1YP5A 5FWBA 1K0XA 4PLIA 5KH6A 5KYNA 1QCFA 3CC4A 4GLKA 1YJWQ 2LDMA 3M0PA 2GFAA 5CKDA 2X4WA 2D8HA 3DB3A 1VQNT 2JMCA 2ROLA 1BI1A 3CMAA 2BZ8A 2FG0A 3HRUA 1Q82R 2DVJA 3OW2A 1WX6A 1S72T 1VQ4T 5HK3A 2KE9A 2P4TA 3CPWS 5KE2A 2I0NA 4HT8A 2RH2A 4O5VA 2NUPB 2F2VA 4AG2C 1E6HA 1W6XA 2O9SA 3G4SA 4JRPA 4IKFA 1VQMA 3X24B 1X6OA 2A08A 2DD5A 4OMMA 1WHHA 2HMAA 4GBQA 2K6DA 5KYYB 5LJ3j 1UECA 5A0GA 3BY7A 3RBBB 4C5IA 2MYSA 1YIJA 1CKAA 2CDTA 4XTVA 1PHTA 4KGVB 2RI3A 1AWWA 2FZGB 4M75E 1EFNA 2AZSA 1NZ9A 4ORZA 2O88A 4C8QE 5I11A 2XDDA 3CBPA 2D1XA 1K0SA 2KT1A 2Y4XA 3NHNA 1YI2A 4DA4A 4XTZA 2YXYA 4M7AF 3VS3A 2HD0A 4M78B 2RJEA 2EQUA 3F70A 2F5KA 4IUPA 2MPXC 3OYYA 5D6WA 4LUEA 1NYGA 2CZ1B 3HSBA 3CCLT 3PNWC 2EPDA 2DO3A 4JJNK 1U06A 2RHYA 1I8FA 2LJ0A 2JMAA 4J7FA 4WF2A 5DY9A 2E12A 4CC4B 4PFZA 2OTLQ 4KGXB 4X34A 4LN2A 5IAYA 2P0QA 2CS7A 3CCSA 2DL8A 2X35A 2ZGWA 1YITA 3M0UA 4M78G 4B9XA 5IHNA 2DIGA 4A4HA 2HKQB 5IHKA 5I2SA 2MWPA 1FWZA 1FMWA 2BUDA 4FT4A 2QI2A 2EJFA 4FU6A 2PUKB 3EG9B 3JB9F 1M3AA 2KQWA 4BE2A 3GPLA 3OYHA 3JRZA 2DMOA 3L1AA 1PD1A 1WLPB 3I5SA 1NJIC 3NMZC 3CC2Q 4BY6C 2XMFA 4AG1C 1BKBA 3G6EA 2EJGA 1LPLA 3OSSC 3R6OA 4Z02A 2YWWA 2DE0X 4HCBA 2D0NA 1QVFP 4CI0C 4J6XA 4BDZA 2LQWA 2B86A 1M5Q1 2R58A 2KR3A 2XI9A 3C94A 3TREA 2JS2A 1C1AA 4XAXB 5CKHA 4MZMA 2HEQA 3SWNC 8AT1B 2RJDA 1OZ3A 1PRLC 2YRCA 1NLOC 4OMFB 2L8DA 2NUTB 5DLOA 4ZTFA 1GBRA 3CXCS 3CCUQ 2E70A 5DLQE 1ZQ1A 1Q82U 3HFNA 2J7IA 1Y07A 5KYXA 3DB4A 1OOTA 2A36A 1VQ8T 4M77F 4LE9A 2L3PA 1PCXA 3HKSA 2MI6A 4RUGA 2YLCA 3VU3C 2RK1A 3HHTB 4LXCA 3EAEA 5I21A 3CCEA 2VGNA 5FRMA 1LCKA 1PD0A 4RTUA 2HNIA 2VYTA 1VQ5Q 1K1ZA 4X9DA 1WDXA 3MPUB 2DLPA 3PVQA 3META 3DKMA 2C0OA 2KRMA 4N4GA 3EFOA 3UDCA 3QSUA 1VYVA 1GXIE 4JDSA 1PG5B 2EIFA 3I9QA 3MJXA 2BZYA 2JW4A 3S3MA 1AVZC 2H3EB 3PMTA 1E7OA 1H3HA 2RMOA 1UGRB 1FXXA 1G3YA 1U3OA 3GF5A 3QXEB 4HA8A 1VQLA 4LD9K 1D0YA 2CP2A 2EKOA 3PIPA 2VC8A 2XDPA 1Y7XA 4Z88A 1W70A 2D9TA 1SSHA 2DL5A 1M3BA 2F69A 3FRNA 3CMEA 4OB0B 4F7UB 3PMIA 1YJNT 3JCMP 3JCMd 4E7IA 2DEQA 3VJPA 2KRNA 5CVIA 5GAN8 4QVDA 2CSQA 1Q86C 2AIRB 4M75B 4MZPA 3RKYA 2YT6A 3OMGA 4A4FA 4C8QB 2OTJA 5FWCA 2DRMA 1LVKA 1ZBXA 2DJQA 3QDRB 1NEBA 3EHRA 2Y90A 4M77A 2XICA 4ATOA 1ZA1B 5GAMe 2WSFE 4PJLA 2XD0A 1I5OB 3DLMA 2E3IA 1VQMT 1BBZA 1JXMA 1SKUB 3L2WA 3C95A 4J6YA 1O75A 2XIDA 2BZXA 2HBWA 3N5BB 1AD5A 2FRYA 2PQWA 4Q5WA 1NYFA 2H3JA 3SFMA 1NEGA 5GAOr 4KUIA 5D7UA 4OGEA 1UE9A 1I4K1 5AYFA 3A5ZB 3C0CA 3PTAA 4A4EA 5KCHA 1VQ4A 3I56Q 5GAOp 4HXJA 2CKKA 4JS5A 2VV5A 3EHQA 3QKJA 5HKCA 1CSKA 1M90C 2A37A 4ZGDB 1UGVA 1YI2T 1ZUKA 5GMKi 2QEXQ 4BACA 3NGPA 3EG2A 4QQGA 4J9IA 4C92D 2O9VA 2MWOA 2RO0A 4FM4B 1VQ6Q 5GAOm 4OB2B 3LW5E 4BB7A 5CKBA 4C0DC 1UJ0A 2GGRA 5KYUA 5LJ5e 5GAMf 2EVRA 3CCUA 4C92E 4K11A 1Y57A 2KK4A 4J9CA 3H9NA 4II1A 3OB9A 4M7DF 2L89A 1K8AC 4OMLA 3CCST 1YITT 1Z9ZA 1ZBJA 1OPKA 2FRWA 4EPCA 4FCYA 5HK0A 3LYIA 4OB1B 3VUZA 1RI0A 3OS2A 2P0PA 4CC7A 2A3LA 1S1NA 2BIVA 3LH0A 1NE8A 5LJ5h 1RUWA 4NL3A 4HVWA 4J9GA 4OB3B 1Q7YR 3J7AF 3KBGA 1M2VB 3OYEA 3EFSA 3UA6A 3CCLA 1BIAA 2DAQA 1OX8A 4IUUA 2CUDA 2YRDA 1OPLA 4RKUE 1VIEA 1B34A 4C0ZA 2YLBA 3ZL7C 2L3RA 4X1VA 1JJ2A 1TTHB 3SWNB 1X2KA 2ED1A 4VUBA 2DA9A 1XQHA 3RMQA 1TXQA 2KVQG 3G71Q 1NG2A 3H0FA 1C0MA 2HKNA 5FU6B 1YJWT 2M16A 1X69A 2M0OA 2ZAEA 2HL3A 3VRYA 4M7DA 5J3BA 1D1CA 2PUOB 2RHIA 1VQOQ 1G5VA 2BTTA 2GQVA 1IZ6A 2IG0A 3QYGB 1KFZA 2DIQA 2RB6A 2AZVA 4QVCA 5EG2A 3PE0A 2LRQA 2XHCA 1WXBA 1Q95G 3CEYA 3CD6Q 1UDLA 1PSEA 3CCET 2BKDN 2P0KA 2DXBA 4A4KA 1X01A 1FYNA 2O2OA 1WQ7A 3CCQQ 1KD1R 2MF2A 1W2BA 1KHCA 2ZCFB 1KQSA 1RAEB 5GAOl 3OW2P 2CT3A 1IB8A 3OBYA 3QJYA 5LJ3f 2OI3A 2DZ9A 2HBPA 2F5TX 5IT9E 2DD4A 3EG1A 3THKA 3JB9I 2KRSA 3D7SB 2X4JA 1MUZA 1KC8U 3X26B 3LWIA 1GFCA 2M02A 1RAIB 1E6GA 2W10A 1GBQA 3A98A 2D6FA 5GMKe 1VQ8A 1BCOA 2QEXA 4PJOB 2K9GA 4JJCA 4M7AC 5GANh 4AFUC 1LOJA 3VYGA 2ZPGB 3PFSA 1QP3A 1I5LA 2ED0A 1D09B 2QTVA 1B07A 4AMCA 4QKUA 2MIOA 3QPHA 4KBMB 2X51A 3A8HB 4D8KA 4B9WA 2EFIA 2I2LA 1NJIR 1HXDA 2OTJT 1SHGA 3VS7A 5LJ5g 2O31A 1F1BB 3R6NA 2QA4Q 4OMQA 2LC4A 1BU1A 3JCMb 4RG8A 2WSEE 4V2SA 3MEWA 1TOVA 4HCCA 3CCRQ 3M9QA 3MKDA 1OV3A 2ZPFB 1R0BG 1UEBA 1VQKQ 4D6WA 2GF7A 2VXEA 1AHJB 4LDXA 2SEMA 2LJ3A 2RNAA 4M78F 3HL8A 2QQRA 2EYQA 1YJNA 4B6MA 3FJPA 2PVDB 5KYWA 3V8LA 4C92B 2JXBA 3I55Q 4RTVA 2K57A 1Q7YC 1ZSZC 2DEUA 5M9OA 3CC2T 1H3ZA 2OAWA 2RA2A 1SF9A 1GCPA 3AHUA 3GBQA 3QO3A 1QVFS 3UT1A 1N8RC 2QK0A 1I07A 3TU4K 5CAIA 2LCCA 2KSSA 4ELYC 3OSVA 3JCMc 3L42A 4EMKC 5EC7A 3RNJA 3HPWA 1QQJA 2VB6A 1WPYA 1WI7A 5GAN4 4C92G 1PRMC 2B8AA 1WQWA 3CCJQ 2EGCA 5GJWB 2G6FX 2X4XA 2RHUA 1G83A 4OMPA 2DM1A 1BI2A 4RTTA 5LL6S 1QLYA 2EKHA 3CCUT 5FROA 3PGGA 5GAN3 5L23A 2AHJB 3CC7A 4DBRA 2M0YA 5KE3A 1K9MC 4ZGEB 2LX9A 2EGAA 2O01E 5FU7B 1T3LA 1WYXA 3PT9A 2J06A 3L2VA 3EG3A 4M77C 3CD6A 5ECAA 3URGA 1QKWA 2CREA 1ZLMA 2QDLA 1M30A 3SDZA 3CCQA 4FW2A 1VQ5T 3H6ZA 1Q86R 2V8KA 1D3BB 5GANg 1YJ9Q 1KD1C 2IIMA 1BI0A 1WJRA 5D6XA 5C6SA 1LNXA 3EGXA 2LQ8A 4M77D 3BDLA 1RAAB 1WHLA 5L8RE 1AWOA 2IVWA 2JUFA 1WHJA 3O5ZA 4YTLA 2KXCA 1Z9QA 1U1TA 2KYMA 2QXFA 1MMGA 5J26A 1X75C 2K2VA 1A0NB 3HTRA 2W0ZA 1BI3A 1VQPQ 1FMVA 3JCMe 2CYZB 3M58A 2WSCE 3OYMA 2O4XB 4E7KA 3FC3A 1SEMA 4R0KA 3M5AA 2QA4A 3VV0A 2C0IA 4LDYA 1NJIU 3H8ZA 2X4YA 4FW1A 2DRKA 3EGDB 1VQ7Q 5CKFA 2CP7A 5KCOA 4BE1A 4M7AA 1PKSA 1M90R 4J83A 3X20B 5CK9A 4FYWB 4F7UF 4OGCA 4ME7A 2VASA 1I0CA 3DLLA 2EGEA 3CCMQ 1VQ9Q 9ATCB 2KBTA 3UA7A 2NUTA 3M54A 2LQNA 2JOYA 5A0LA 1YFNA 4M75F 1YJWA 3I55A 4FSSA 4EIKA 2XDBA 1BCMA 4C8QF 2FVUA 1QWFA 1YBYA 4RTXA 1K73C 3JB9H 2JNGA 2QQSA 2HSPA 1KHIA 3FLGA 1VOMA 4IURA 1JO8A 5CKEA 3VS1A 1D0ZA 3I35A 3JCMf 3HFOA 2JS0A 1K8AR 2COWA 3RESA 3JCMQ 5GAN2 2FPDA 2QEXT 2XKOC 1N9RA 1SSFA 5J39A 1N27A 4HCKA 2AKKA 5IHIA 3CCJA 3IQLA 4AFZC 1VQ6T 2EYWA 1ZSZA 1M27C 3UATA 3P8BB 1N9SA 4JRQA 4E7ZA 1HYOA 1YNZA 3GIBA 3VS6A 3INZA 4EDUA 4L5GA 2RHZA 1UHFA 1JB0E 4PJNA 3RERA 4EMKA 5KYXB 4F7UA 4M7DC 4ZN3A 1OI1A 1I81A 4E47A 1GL5A 1R0CB 3RR6A 4M75A 2J6KA 3E19A 2FPFA 1J3TA 4C8QA 3GP8A 1Y0MA 3FIFA 2GNCA 3SHWA 4RMOA 1D1BA 4ZTJA 1KJWA 1VYTA 1YJ9A 1M1GA 1Q86U 3X28B 1LJOA 3EFOB 4XU0A 4XQ3A 4M7DD 3QG1A 3V7SA 1KQ2A 1RL2A 3TSZA 1R77A 3RUXA 2OTLA 1QMCA 4MDXA 3V8JA 2LJ1A 2DBMA 3CPWA 2L3QA 3OS5A 2GFUA 2VUBA 3OMCA 4OMNA 1UG1A 3CCVQ 1T0HA 3G71T 2CGHA 2PNIA 2FYKA 2YUPA 1RADB 1SPKA 3JSCA 2VGMA 5GAOn 3CBOA 3V7RA 1ABQA 4LUDA 4P5NA 4ANJA 2RQUA 2PTKA 4X9CA 2QQAA 4DEYA 2DTHA 2E3HA 3CC2A 2RD1A 2P4RA 4OMOA 4RTZA 2FEIA 1OX9A 2K3XA 1VQOT 1RAGB 2J6FA 3CC7T 4XTUA 4CC3A 1Y96A 2G3RA 3VRZA 5GAMh 1VQ7A 1JJ2P 2A7YA 2HQXA 4NOYA 1M90U 1EZZB 2KEAA 3CD6T 1VQ9A
chains in the Genus database with same CATH topology
1VQPQ 1S72Q 2OTJQ 1VQ4Q 1VQ7Q 1NJIR 1Q7YR 3G4SQ 1KD1R 3CCQQ 2QA4Q 1VQOQ 1M90R 3CCVQ 3CMEQ 3CC7Q 3CCSQ 1VQMQ 1KC8R 1VQ6Q 3G71Q 3CMAQ 3CCUQ 1YITQ 1K9MR 2OTLQ 1QVFP 3OW2P 1YHQQ 1JJ2P 1YJWQ 3I56Q 3CCMQ 1QVGP 3CCRQ 3CPWP 1N8RR 1VQ9Q 3I55Q 1VQ5Q 3CXCP 3G6EQ 1Q86R 1VQNQ 1K73R 1K8AR 3CC2Q 1YJNQ 1W2BP 1YJ9Q 3CCJQ 3CCLQ 1M1KR 1KQSP 3CCEQ 3CD6Q 1YI2Q 1VQ8Q 1VQKQ 1Q81R 1YIJQ 3CC4Q 1Q82R 1VQLQ 2QEXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP Q;  1S72 Q;  2OTJ Q;  1VQ4 Q;  1VQ7 Q;  1NJI R;  1Q7Y R;  3G4S Q;  1KD1 R;  3CCQ Q;  2QA4 Q;  1VQO Q;  1M90 R;  3CCV Q;  3CME Q;  3CC7 Q;  3CCS Q;  1VQM Q;  1KC8 R;  1VQ6 Q;  3G71 Q;  3CMA Q;  3CCU Q;  1YIT Q;  1K9M R;  2OTL Q;  1QVF P;  3OW2 P;  1YHQ Q;  1JJ2 P;  1YJW Q;  3I56 Q;  3CCM Q;  1QVG P;  3CCR Q;  3CPW P;  1N8R R;  1VQ9 Q;  3I55 Q;  1VQ5 Q;  3CXC P;  3G6E Q;  1Q86 R;  1VQN Q;  1K73 R;  1K8A R;  3CC2 Q;  1YJN Q;  1W2B P;  1YJ9 Q;  3CCJ Q;  3CCL Q;  1M1K R;  1KQS P;  3CCE Q;  3CD6 Q;  1YI2 Q;  1VQ8 Q;  1VQK Q;  1Q81 R;  1YIJ Q;  3CC4 Q;  1Q82 R;  1VQL Q;  2QEX Q; 
#chains in the Genus database with same CATH topology
 2CUB A;  1HK9 A;  3OW2 S;  3ER0 A;  3S6W A;  3CCQ T;  3JB9 J;  5FW9 A;  2EQI A;  1AWX A;  1QKX A;  3S3N A;  4QQ6 A;  3BFM A;  4J6W A;  2DIL A;  4M77 G;  2CZ0 B;  1UGQ B;  2JVV A;  1KK7 A;  2V1Q A;  4KGZ B;  2EYZ A;  1SRL A;  4PKC C;  3OYI A;  4XU3 A;  4OVA A;  1RLP C;  1I1J A;  5DM7 R;  3REB B;  4AFS C;  2LMJ A;  1K8A U;  2E1H A;  1CKB A;  1OZ2 A;  4GY5 A;  4DEX A;  3HP9 A;  5CR2 A;  3JAM E;  1ZSG A;  1TH7 A;  2PVG B;  4J9B A;  3ZEH A;  1TUC A;  2DTO A;  3QDF A;  4FL6 A;  1W2B P;  1DJ7 B;  5HCK A;  2AT1 B;  1KQS P;  2KRO A;  4BY6 B;  3OS0 A;  3M0R A;  3G1J A;  4RCC A;  1VQ5 A;  3C4S A;  4ELZ C;  2LCL A;  2R5A A;  5KYU B;  1OU9 A;  3REA B;  4DBH A;  2LNH B;  2QA4 T;  1R8O B;  2DL3 A;  3L2Q A;  4ESR A;  2COY A;  1MGQ A;  1UHC A;  1N8R R;  1BYM A;  2BE9 B;  4QQD A;  2YSQ A;  3CCR T;  3MHX A;  2RJF A;  3V7C A;  4XTW A;  1ABO A;  5IH2 A;  2E65 A;  3M53 A;  1VQK T;  2QGG A;  5CCA A;  3MP6 A;  3CC4 Q;  4PJO F;  5LJ3 e;  1X6B A;  1ZUY A;  1QVP A;  4F04 B;  1G2B A;  3FEO A;  1WFW A;  3JCM W;  2XG8 D;  4M78 C;  2M9U A;  2DF6 A;  2LCS A;  3CMA Q;  2QAS A;  3QZ9 B;  2DXU A;  3I55 T;  2HDA A;  1AZE A;  1NM7 A;  2KT8 A;  2KXD A;  4UC4 A;  1W1F A;  3SB2 A;  1B34 B;  2DYB A;  3ASK A;  4JUV A;  4CRI A;  3S3O A;  1K4U S;  2HQH A;  2ABL A;  3OYB A;  3G4S Q;  2PU9 B;  1K9M R;  1TWB A;  1K76 A;  4C0G A;  1M8V A;  3NPF A;  3WXM B;  5GAM g;  2ECZ A;  5HY6 A;  2VVK A;  1WHG A;  2ZPE B;  3CCJ T;  1YIJ Q;  4Y92 A;  2ROT A;  4JPB W;  4C92 F;  4PK4 A;  2A0F B;  3L2Z A;  3M0S A;  2KI7 A;  3TCJ A;  1UGP B;  1Q81 C;  4E6R A;  4F16 A;  3NTH A;  1V1C A;  1PC0 A;  4ZNX A;  1SHF A;  1KIK A;  2VKN A;  3M0Q A;  3UF4 A;  2Z0W A;  4PJO A;  3I56 A;  4GLM A;  3LLR A;  4KH0 B;  2DPP B;  2AKL A;  3VS5 A;  4J9H A;  1YCS B;  5GAM j;  3GNF B;  2JTF A;  3T9N A;  2R57 A;  3OYC A;  2QTX A;  1WHM A;  2EAY A;  5LJ5 d;  2M1H A;  3C12 A;  4MDW A;  1QVG A;  2PZ1 A;  2L5Q A;  3HRT A;  1OUL A;  2DTI A;  5GMK m;  4J9D A;  2JM9 A;  1VQ6 A;  1JBM A;  4OF1 A;  3QWX X;  1YJ9 T;  1GCQ C;  4M7D G;  2FO0 A;  3MP1 A;  2DL7 A;  2EYY A;  1TUG B;  3FB9 A;  4KUD K;  1UFF A;  1QW1 A;  4JZ4 A;  4A54 A;  2IPO B;  2OTL T;  2K3Y A;  2QG9 B;  4M7A D;  5GMK h;  4JJD A;  1N6A A;  2LX7 A;  4C5H A;  1IHW A;  2KMT A;  2DL4 A;  1M8M A;  1H92 A;  1VQP T;  1MMN A;  4M7A E;  4A4G A;  5CQY A;  1VA7 A;  3EG0 A;  4DOV A;  2CZ7 B;  3LWH A;  2JN0 A;  4O6J A;  4PFP A;  1P92 A;  4OP0 A;  3G6E Q;  4FYY B;  4MZT A;  1RI9 A;  1K73 R;  5LJ5 j;  2AK5 A;  2JZ2 A;  5IXB A;  1Q7Y U;  1N5Z A;  1IGU A;  2NUP A;  4IUQ A;  4DQ2 A;  2RK2 A;  1N8R U;  1VQ7 T;  2CP3 A;  3HRS A;  2E5Q A;  1BB9 A;  3QHS A;  1M2O A;  3X25 B;  2RQV A;  3G7Z A;  3QZ5 B;  4NS5 A;  4FIB A;  5LJ3 g;  2KDS A;  5KYY A;  3CCM T;  1B7T A;  1VQ9 T;  4KH1 B;  3OYA A;  3JB9 D;  1MND A;  3RKX A;  4C0D B;  2CSI A;  2MK5 A;  1WHK A;  2L2P A;  5KYW B;  3G71 A;  2DZC A;  4C5G A;  3NTI A;  2OX7 A;  4BI8 B;  3P8H A;  4J7I A;  4M75 C;  4HVU A;  1UB4 A;  1G8X A;  4C8Q C;  1M3C A;  1G3T A;  4N4I A;  4PJJ A;  1JRI A;  4AFQ C;  1YHQ Q;  2K3B A;  2CH4 W;  3QYH B;  4BD3 A;  2E4H A;  3EFR A;  3E2U A;  1U1S A;  3H41 A;  1VQO A;  5GAN 7;  4IUT A;  2OJ2 A;  2K4Y A;  7AT1 B;  4E7J A;  3TSW A;  1ZA2 B;  3CCE Q;  2K5I A;  1NBE B;  2ESW A;  5GAN d;  4M78 A;  1K9M U;  3E9G A;  4JRI A;  4EMH A;  4F7U E;  5GAN 6;  8ATC B;  3M56 A;  2D0Q B;  4M75 D;  2SRC A;  1D3B A;  2RF0 A;  4KT0 E;  4C8Q D;  1IRE B;  1D1A A;  1FX7 A;  3BW1 A;  3Q1J A;  2LT4 A;  3EH2 A;  5GMK l;  1WXT A;  2CP0 A;  1X2Q A;  1KD1 U;  2DVE A;  1VQL Q;  2HL5 C;  4D8D A;  3RKW A;  2KAF A;  1RAH B;  4XTY A;  2F2X A;  4JRK A;  4RG2 A;  3CME Q;  4QVZ A;  1H8K A;  1TSF A;  4MMK A;  4L6V 5;  4LDU A;  1MMD A;  2FZC B;  2O4X A;  4N0A C;  4LDW A;  1G3S A;  2MCN A;  4M77 E;  3EG9 A;  4RTW A;  1ZHI A;  2OTJ Q;  5FRN A;  3OYL A;  1RAF B;  2MOX A;  1ZUU A;  2ATC B;  5GAN j;  4F17 A;  2LP5 A;  3UWN A;  3EGD A;  4RTY A;  4WCI A;  4XU1 A;  3EGX B;  1O9S A;  2ZZD A;  1WJQ A;  1OEB A;  3QWY A;  1KG1 A;  2EWN A;  3OY9 A;  2RQR A;  4HCZ A;  3NFC A;  3CCR A;  5FLX E;  3RIR A;  2DXC A;  4EMG A;  3CCV T;  1VQK A;  3VS0 A;  5GMK j;  1BIB A;  3JCM h;  1IHV A;  1OYX A;  3M4G A;  1GCQ A;  4QT7 A;  3BE3 A;  2EQJ A;  4XTX A;  1MV3 A;  3A8L B;  3OS1 A;  1VQN Q;  3QJ6 A;  1EIF A;  1PSF A;  2HCK A;  1M1K R;  5I2M A;  4LDV A;  1S72 Q;  1YN8 A;  1NLP C;  5AT1 B;  2KGT A;  1VQ4 Q;  1JJ2 S;  1WIE A;  3QUI A;  2KNB B;  2YHT A;  1JXO A;  2NYS A;  2JTE A;  1U8R A;  1K73 U;  2V26 A;  3RDV A;  1WA7 A;  3CPW P;  2EQM A;  4BUG A;  2F2W A;  3I56 T;  1W4S A;  2HZY A;  2MAM A;  4ZN1 A;  4M7A B;  1YCY A;  1YWP A;  3OYD A;  1U5S A;  2C06 A;  3KFV A;  1QP2 A;  2QQ9 A;  4IIO A;  1WZO A;  1AT1 B;  2L3S A;  5FU6 C;  4JZ3 A;  1AOJ A;  4E7L A;  1Q82 C;  3OBW A;  3M57 A;  2E6N A;  2VWF A;  5D6Y A;  3A8G B;  1OQK A;  2LZ6 B;  1UTI A;  2HAX A;  4C0F A;  1YHQ A;  2CP6 A;  4J8O A;  2RQW A;  4XU2 A;  3H0I A;  3MEV A;  2RJC A;  4M7A G;  4E7S A;  3LX7 A;  1XNI A;  1YWO A;  4LNP A;  2GTO A;  1UUE A;  3CPF A;  1W2B S;  1KQS S;  3PIO A;  3MCA B;  1HJD A;  4LD6 A;  2E64 A;  3MEA A;  1X6G A;  2HSE B;  1RAB B;  2LNV A;  2DXT A;  4L59 A;  4DBF A;  3CCL Q;  3E9F A;  1ZSZ B;  3MO8 A;  2CT4 A;  2GQI A;  4BDY A;  5GAO q;  4FYX B;  4KUL A;  1XTD A;  1MNE A;  4WTO B;  1AEY A;  4J5Y A;  3ME9 A;  3O8V A;  1QVG S;  2DX1 A;  3EGU A;  3FJ5 A;  3KUF A;  4EMK B;  1VYU A;  1X27 A;  3V8K A;  1QVF A;  1OU8 A;  2CP5 A;  2QDY B;  4M7D E;  3CC4 T;  3LH5 A;  1IO6 A;  3JB9 G;  1TS9 A;  2K79 A;  1X43 A;  4PJO C;  3E1S A;  2ZPI B;  3QII A;  1VQP A;  3CMA T;  3A8O B;  5CO7 A;  2KYB A;  3BDU A;  3JV3 A;  3JCM g;  3OYN A;  2PVO B;  2GBQ A;  3MP8 A;  4Y91 A;  2NUZ A;  1JEG A;  5I22 A;  1Q81 R;  3AT1 B;  3M0T A;  3L2R A;  4PLL A;  2F1L A;  1PM3 A;  4F7U G;  3G4S T;  1KQ1 A;  4PJO D;  2YUQ A;  1QCN A;  4M77 B;  4N0A A;  4HKE A;  4Z89 A;  2RI5 A;  2V8I A;  3J81 E;  4R55 A;  1HD3 A;  3PVL A;  4M75 G;  5A2Q E;  2H8H A;  4PJO E;  2QQB A;  4C8Q G;  3CQT A;  4A53 A;  5GJV B;  3ZFJ A;  1NPP A;  1TG0 A;  1M1F A;  4PJM A;  3CCM A;  1YIJ T;  1VQN A;  4N4H A;  1K9A A;  3H0H A;  3FDR A;  1G3W A;  2FZK B;  4C92 C;  2C0T A;  1XOV A;  1KC8 R;  1S72 A;  2J6O A;  1M1K U;  2EQK A;  1AZG B;  1M1K C;  1RLQ C;  5CQX A;  4HVV A;  3CXC P;  1IRX A;  2EJ9 A;  4ZGJ B;  2DBK A;  2K7A A;  1VQ8 Q;  2E6Z A;  1Y96 B;  2R5M A;  3JCM X;  4IUV A;  4F14 A;  4CC2 A;  1EX4 A;  4A63 B;  4R56 A;  2YDL A;  2QAZ A;  1PWT A;  2NWM A;  3ULR B;  1QCO A;  3GNG A;  4PFO A;  3OA6 A;  1XJW B;  3EH1 A;  1MHN A;  2LTO A;  2V8J A;  4AT1 B;  1SG5 A;  2XU8 A;  2EBP A;  2FHD A;  1M2V A;  4DBQ A;  1UGS B;  1C6V X;  1HSQ A;  1WNL A;  2GCX A;  4Y28 E;  2RN8 A;  4KRT A;  2RM4 A;  1WGS A;  2DNU A;  3GOX A;  3LGL A;  2DER A;  1GFD A;  1M4Z A;  1V29 B;  2QYZ A;  3VYH B;  1FMK A;  1M9S A;  1IXD A;  2RPN A;  3OYK A;  3VUB A;  1KSW A;  6AT1 B;  2E5K A;  3KXT A;  3ZBD A;  5A0D A;  2JT4 A;  3VS4 A;  2YRV A;  3LGF A;  1IGQ A;  2RI2 A;  3SWN A;  1YJN Q;  2YUN A;  4J9E A;  2KY9 A;  2K5L A;  2E10 A;  2JM8 A;  2YUO A;  2NLU A;  1H64 1;  2P84 A;  5FU7 C;  1QVG P;  2FL7 A;  3MEU A;  2FPE A;  4PNO A;  1PKT A;  1UJY A;  2RQT A;  1PNJ A;  2XK0 A;  1SRM A;  3M55 A;  3VKI A;  1RAC B;  1V76 A;  4BI3 A;  3G6E T;  2X3W D;  5C0M A;  5GAM d;  2L0A A;  2D8J A;  1AWJ A;  4C5E A;  1ACM B;  2CZ6 B;  2EW3 A;  2EYX A;  3TQ7 P;  4FT2 A;  5LJ5 f;  3CXC A;  3NTK A;  1TU0 B;  2QGF B;  2DK3 A;  1D0X A;  1VQM Q;  1T0J A;  5LJ3 h;  4M78 D;  2M51 A;  4HT9 A;  1JU5 C;  4FYV B;  1MMA A;  2V1R A;  4RCB A;  2DKG A;  3CCV A;  4QW2 A;  2JTM A;  4M78 E;  1ARK A;  5IXF A;  4BI4 A;  2FB7 A;  3WVD B;  3UPU A;  3CC7 Q;  1B3Q A;  1TUD A;  2JJ9 A;  2J05 A;  2ZPH B;  1Q81 U;  4MML A;  2E41 A;  1YHQ T;  4M7D B;  3QBY A;  1MV0 B;  2A28 A;  3TVT A;  3JCM V;  1NPR A;  3P8D A;  1JQQ A;  3OYG A;  1YI2 Q;  5CIU A;  3VS2 A;  4IIM A;  3J80 E;  1T3S A;  3CBM A;  4DOW A;  5GAN e;  4J9F A;  3TEE A;  1BK2 A;  1Y71 A;  3JCM J;  3WVE B;  1VUB A;  2HQE A;  2LQK A;  5IN1 A;  2DFU A;  4E2F B;  3RMS A;  4BE0 A;  4XK8 E;  1WJS A;  3OYJ A;  2DJZ A;  2DET A;  4M4Z A;  3A1P A;  4JLG A;  2K2M A;  2LT1 A;  2WAC A;  3OYF A;  2BE7 D;  3U23 A;  2COZ A;  1KC8 C;  3I5R A;  1ZX6 A;  1VQL T;  2VXF A;  2RHX A;  2K5F A;  2MMP A;  4TVR A;  4E7H A;  3SD4 A;  1VIF A;  3CCS Q;  3CME T;  2DYI A;  3M4Y A;  1YIT Q;  3OQ5 A;  3A8M B;  4JJB A;  2Y4Y A;  2ZPB B;  1QWE A;  2LVM A;  2X9H A;  3L2U A;  4PL6 A;  4C92 A;  4JLI A;  2GTJ A;  3SEM A;  4NL2 A;  4Z8A A;  1GRI A;  2X3X D;  3GLX A;  1WXU A;  2ENM A;  4JS4 A;  2OAU A;  2CH4 A;  4PJO G;  5LJ3 d;  5GAN f;  3M59 A;  5GAN 5;  4FSX A;  1YP5 A;  5FWB A;  1K0X A;  4PLI A;  5KH6 A;  5KYN A;  1QCF A;  3CC4 A;  4GLK A;  1YJW Q;  2LDM A;  3M0P A;  2GFA A;  5CKD A;  2X4W A;  2D8H A;  3DB3 A;  1VQN T;  2JMC A;  2ROL A;  1BI1 A;  3CMA A;  2BZ8 A;  2FG0 A;  3HRU A;  1Q82 R;  2DVJ A;  3OW2 A;  1WX6 A;  1S72 T;  1VQ4 T;  5HK3 A;  2KE9 A;  2P4T A;  3CPW S;  5KE2 A;  2I0N A;  4HT8 A;  2RH2 A;  4O5V A;  2NUP B;  2F2V A;  4AG2 C;  1E6H A;  1W6X A;  2O9S A;  3G4S A;  4JRP A;  4IKF A;  1VQM A;  3X24 B;  1X6O A;  2A08 A;  2DD5 A;  4OMM A;  1WHH A;  2HMA A;  4GBQ A;  2K6D A;  5KYY B;  5LJ3 j;  1UEC A;  5A0G A;  3BY7 A;  3RBB B;  4C5I A;  2MYS A;  1YIJ A;  1CKA A;  2CDT A;  4XTV A;  1PHT A;  4KGV B;  2RI3 A;  1AWW A;  2FZG B;  4M75 E;  1EFN A;  2AZS A;  1NZ9 A;  4ORZ A;  2O88 A;  4C8Q E;  5I11 A;  2XDD A;  3CBP A;  2D1X A;  1K0S A;  2KT1 A;  2Y4X A;  3NHN A;  1YI2 A;  4DA4 A;  4XTZ A;  2YXY A;  4M7A F;  3VS3 A;  2HD0 A;  4M78 B;  2RJE A;  2EQU A;  3F70 A;  2F5K A;  4IUP A;  2MPX C;  3OYY A;  5D6W A;  4LUE A;  1NYG A;  2CZ1 B;  3HSB A;  3CCL T;  3PNW C;  2EPD A;  2DO3 A;  4JJN K;  1U06 A;  2RHY A;  1I8F A;  2LJ0 A;  2JMA A;  4J7F A;  4WF2 A;  5DY9 A;  2E12 A;  4CC4 B;  4PFZ A;  2OTL Q;  4KGX B;  4X34 A;  4LN2 A;  5IAY A;  2P0Q A;  2CS7 A;  3CCS A;  2DL8 A;  2X35 A;  2ZGW A;  1YIT A;  3M0U A;  4M78 G;  4B9X A;  5IHN A;  2DIG A;  4A4H A;  2HKQ B;  5IHK A;  5I2S A;  2MWP A;  1FWZ A;  1FMW A;  2BUD A;  4FT4 A;  2QI2 A;  2EJF A;  4FU6 A;  2PUK B;  3EG9 B;  3JB9 F;  1M3A A;  2KQW A;  4BE2 A;  3GPL A;  3OYH A;  3JRZ A;  2DMO A;  3L1A A;  1PD1 A;  1WLP B;  3I5S A;  1NJI C;  3NMZ C;  3CC2 Q;  4BY6 C;  2XMF A;  4AG1 C;  1BKB A;  3G6E A;  2EJG A;  1LPL A;  3OSS C;  3R6O A;  4Z02 A;  2YWW A;  2DE0 X;  4HCB A;  2D0N A;  1QVF P;  4CI0 C;  4J6X A;  4BDZ A;  2LQW A;  2B86 A;  1M5Q 1;  2R58 A;  2KR3 A;  2XI9 A;  3C94 A;  3TRE A;  2JS2 A;  1C1A A;  4XAX B;  5CKH A;  4MZM A;  2HEQ A;  3SWN C;  8AT1 B;  2RJD A;  1OZ3 A;  1PRL C;  2YRC A;  1NLO C;  4OMF B;  2L8D A;  2NUT B;  5DLO A;  4ZTF A;  1GBR A;  3CXC S;  3CCU Q;  2E70 A;  5DLQ E;  1ZQ1 A;  1Q82 U;  3HFN A;  2J7I A;  1Y07 A;  5KYX A;  3DB4 A;  1OOT A;  2A36 A;  1VQ8 T;  4M77 F;  4LE9 A;  2L3P A;  1PCX A;  3HKS A;  2MI6 A;  4RUG A;  2YLC A;  3VU3 C;  2RK1 A;  3HHT B;  4LXC A;  3EAE A;  5I21 A;  3CCE A;  2VGN A;  5FRM A;  1LCK A;  1PD0 A;  4RTU A;  2HNI A;  2VYT A;  1VQ5 Q;  1K1Z A;  4X9D A;  1WDX A;  3MPU B;  2DLP A;  3PVQ A;  3MET A;  3DKM A;  2C0O A;  2KRM A;  4N4G A;  3EFO A;  3UDC A;  3QSU A;  1VYV A;  1GXI E;  4JDS A;  1PG5 B;  2EIF A;  3I9Q A;  3MJX A;  2BZY A;  2JW4 A;  3S3M A;  1AVZ C;  2H3E B;  3PMT A;  1E7O A;  1H3H A;  2RMO A;  1UGR B;  1FXX A;  1G3Y A;  1U3O A;  3GF5 A;  3QXE B;  4HA8 A;  1VQL A;  4LD9 K;  1D0Y A;  2CP2 A;  2EKO A;  3PIP A;  2VC8 A;  2XDP A;  1Y7X A;  4Z88 A;  1W70 A;  2D9T A;  1SSH A;  2DL5 A;  1M3B A;  2F69 A;  3FRN A;  3CME A;  4OB0 B;  4F7U B;  3PMI A;  1YJN T;  3JCM P;  3JCM d;  4E7I A;  2DEQ A;  3VJP A;  2KRN A;  5CVI A;  5GAN 8;  4QVD A;  2CSQ A;  1Q86 C;  2AIR B;  4M75 B;  4MZP A;  3RKY A;  2YT6 A;  3OMG A;  4A4F A;  4C8Q B;  2OTJ A;  5FWC A;  2DRM A;  1LVK A;  1ZBX A;  2DJQ A;  3QDR B;  1NEB A;  3EHR A;  2Y90 A;  4M77 A;  2XIC A;  4ATO A;  1ZA1 B;  5GAM e;  2WSF E;  4PJL A;  2XD0 A;  1I5O B;  3DLM A;  2E3I A;  1VQM T;  1BBZ A;  1JXM A;  1SKU B;  3L2W A;  3C95 A;  4J6Y A;  1O75 A;  2XID A;  2BZX A;  2HBW A;  3N5B B;  1AD5 A;  2FRY A;  2PQW A;  4Q5W A;  1NYF A;  2H3J A;  3SFM A;  1NEG A;  5GAO r;  4KUI A;  5D7U A;  4OGE A;  1UE9 A;  1I4K 1;  5AYF A;  3A5Z B;  3C0C A;  3PTA A;  4A4E A;  5KCH A;  1VQ4 A;  3I56 Q;  5GAO p;  4HXJ A;  2CKK A;  4JS5 A;  2VV5 A;  3EHQ A;  3QKJ A;  5HKC A;  1CSK A;  1M90 C;  2A37 A;  4ZGD B;  1UGV A;  1YI2 T;  1ZUK A;  5GMK i;  2QEX Q;  4BAC A;  3NGP A;  3EG2 A;  4QQG A;  4J9I A;  4C92 D;  2O9V A;  2MWO A;  2RO0 A;  4FM4 B;  1VQ6 Q;  5GAO m;  4OB2 B;  3LW5 E;  4BB7 A;  5CKB A;  4C0D C;  1UJ0 A;  2GGR A;  5KYU A;  5LJ5 e;  5GAM f;  2EVR A;  3CCU A;  4C92 E;  4K11 A;  1Y57 A;  2KK4 A;  4J9C A;  3H9N A;  4II1 A;  3OB9 A;  4M7D F;  2L89 A;  1K8A C;  4OML A;  3CCS T;  1YIT T;  1Z9Z A;  1ZBJ A;  1OPK A;  2FRW A;  4EPC A;  4FCY A;  5HK0 A;  3LYI A;  4OB1 B;  3VUZ A;  1RI0 A;  3OS2 A;  2P0P A;  4CC7 A;  2A3L A;  1S1N A;  2BIV A;  3LH0 A;  1NE8 A;  5LJ5 h;  1RUW A;  4NL3 A;  4HVW A;  4J9G A;  4OB3 B;  1Q7Y R;  3J7A F;  3KBG A;  1M2V B;  3OYE A;  3EFS A;  3UA6 A;  3CCL A;  1BIA A;  2DAQ A;  1OX8 A;  4IUU A;  2CUD A;  2YRD A;  1OPL A;  4RKU E;  1VIE A;  1B34 A;  4C0Z A;  2YLB A;  3ZL7 C;  2L3R A;  4X1V A;  1JJ2 A;  1TTH B;  3SWN B;  1X2K A;  2ED1 A;  4VUB A;  2DA9 A;  1XQH A;  3RMQ A;  1TXQ A;  2KVQ G;  3G71 Q;  1NG2 A;  3H0F A;  1C0M A;  2HKN A;  5FU6 B;  1YJW T;  2M16 A;  1X69 A;  2M0O A;  2ZAE A;  2HL3 A;  3VRY A;  4M7D A;  5J3B A;  1D1C A;  2PUO B;  2RHI A;  1VQO Q;  1G5V A;  2BTT A;  2GQV A;  1IZ6 A;  2IG0 A;  3QYG B;  1KFZ A;  2DIQ A;  2RB6 A;  2AZV A;  4QVC A;  5EG2 A;  3PE0 A;  2LRQ A;  2XHC A;  1WXB A;  1Q95 G;  3CEY A;  3CD6 Q;  1UDL A;  1PSE A;  3CCE T;  2BKD N;  2P0K A;  2DXB A;  4A4K A;  1X01 A;  1FYN A;  2O2O A;  1WQ7 A;  3CCQ Q;  1KD1 R;  2MF2 A;  1W2B A;  1KHC A;  2ZCF B;  1KQS A;  1RAE B;  5GAO l;  3OW2 P;  2CT3 A;  1IB8 A;  3OBY A;  3QJY A;  5LJ3 f;  2OI3 A;  2DZ9 A;  2HBP A;  2F5T X;  5IT9 E;  2DD4 A;  3EG1 A;  3THK A;  3JB9 I;  2KRS A;  3D7S B;  2X4J A;  1MUZ A;  1KC8 U;  3X26 B;  3LWI A;  1GFC A;  2M02 A;  1RAI B;  1E6G A;  2W10 A;  1GBQ A;  3A98 A;  2D6F A;  5GMK e;  1VQ8 A;  1BCO A;  2QEX A;  4PJO B;  2K9G A;  4JJC A;  4M7A C;  5GAN h;  4AFU C;  1LOJ A;  3VYG A;  2ZPG B;  3PFS A;  1QP3 A;  1I5L A;  2ED0 A;  1D09 B;  2QTV A;  1B07 A;  4AMC A;  4QKU A;  2MIO A;  3QPH A;  4KBM B;  2X51 A;  3A8H B;  4D8K A;  4B9W A;  2EFI A;  2I2L A;  1NJI R;  1HXD A;  2OTJ T;  1SHG A;  3VS7 A;  5LJ5 g;  2O31 A;  1F1B B;  3R6N A;  2QA4 Q;  4OMQ A;  2LC4 A;  1BU1 A;  3JCM b;  4RG8 A;  2WSE E;  4V2S A;  3MEW A;  1TOV A;  4HCC A;  3CCR Q;  3M9Q A;  3MKD A;  1OV3 A;  2ZPF B;  1R0B G;  1UEB A;  1VQK Q;  4D6W A;  2GF7 A;  2VXE A;  1AHJ B;  4LDX A;  2SEM A;  2LJ3 A;  2RNA A;  4M78 F;  3HL8 A;  2QQR A;  2EYQ A;  1YJN A;  4B6M A;  3FJP A;  2PVD B;  5KYW A;  3V8L A;  4C92 B;  2JXB A;  3I55 Q;  4RTV A;  2K57 A;  1Q7Y C;  1ZSZ C;  2DEU A;  5M9O A;  3CC2 T;  1H3Z A;  2OAW A;  2RA2 A;  1SF9 A;  1GCP A;  3AHU A;  3GBQ A;  3QO3 A;  1QVF S;  3UT1 A;  1N8R C;  2QK0 A;  1I07 A;  3TU4 K;  5CAI A;  2LCC A;  2KSS A;  4ELY C;  3OSV A;  3JCM c;  3L42 A;  4EMK C;  5EC7 A;  3RNJ A;  3HPW A;  1QQJ A;  2VB6 A;  1WPY A;  1WI7 A;  5GAN 4;  4C92 G;  1PRM C;  2B8A A;  1WQW A;  3CCJ Q;  2EGC A;  5GJW B;  2G6F X;  2X4X A;  2RHU A;  1G83 A;  4OMP A;  2DM1 A;  1BI2 A;  4RTT A;  5LL6 S;  1QLY A;  2EKH A;  3CCU T;  5FRO A;  3PGG A;  5GAN 3;  5L23 A;  2AHJ B;  3CC7 A;  4DBR A;  2M0Y A;  5KE3 A;  1K9M C;  4ZGE B;  2LX9 A;  2EGA A;  2O01 E;  5FU7 B;  1T3L A;  1WYX A;  3PT9 A;  2J06 A;  3L2V A;  3EG3 A;  4M77 C;  3CD6 A;  5ECA A;  3URG A;  1QKW A;  2CRE A;  1ZLM A;  2QDL A;  1M30 A;  3SDZ A;  3CCQ A;  4FW2 A;  1VQ5 T;  3H6Z A;  1Q86 R;  2V8K A;  1D3B B;  5GAN g;  1YJ9 Q;  1KD1 C;  2IIM A;  1BI0 A;  1WJR A;  5D6X A;  5C6S A;  1LNX A;  3EGX A;  2LQ8 A;  4M77 D;  3BDL A;  1RAA B;  1WHL A;  5L8R E;  1AWO A;  2IVW A;  2JUF A;  1WHJ A;  3O5Z A;  4YTL A;  2KXC A;  1Z9Q A;  1U1T A;  2KYM A;  2QXF A;  1MMG A;  5J26 A;  1X75 C;  2K2V A;  1A0N B;  3HTR A;  2W0Z A;  1BI3 A;  1VQP Q;  1FMV A;  3JCM e;  2CYZ B;  3M58 A;  2WSC E;  3OYM A;  2O4X B;  4E7K A;  3FC3 A;  1SEM A;  4R0K A;  3M5A A;  2QA4 A;  3VV0 A;  2C0I A;  4LDY A;  1NJI U;  3H8Z A;  2X4Y A;  4FW1 A;  2DRK A;  3EGD B;  1VQ7 Q;  5CKF A;  2CP7 A;  5KCO A;  4BE1 A;  4M7A A;  1PKS A;  1M90 R;  4J83 A;  3X20 B;  5CK9 A;  4FYW B;  4F7U F;  4OGC A;  4ME7 A;  2VAS A;  1I0C A;  3DLL A;  2EGE A;  3CCM Q;  1VQ9 Q;  9ATC B;  2KBT A;  3UA7 A;  2NUT A;  3M54 A;  2LQN A;  2JOY A;  5A0L A;  1YFN A;  4M75 F;  1YJW A;  3I55 A;  4FSS A;  4EIK A;  2XDB A;  1BCM A;  4C8Q F;  2FVU A;  1QWF A;  1YBY A;  4RTX A;  1K73 C;  3JB9 H;  2JNG A;  2QQS A;  2HSP A;  1KHI A;  3FLG A;  1VOM A;  4IUR A;  1JO8 A;  5CKE A;  3VS1 A;  1D0Z A;  3I35 A;  3JCM f;  3HFO A;  2JS0 A;  1K8A R;  2COW A;  3RES A;  3JCM Q;  5GAN 2;  2FPD A;  2QEX T;  2XKO C;  1N9R A;  1SSF A;  5J39 A;  1N27 A;  4HCK A;  2AKK A;  5IHI A;  3CCJ A;  3IQL A;  4AFZ C;  1VQ6 T;  2EYW A;  1ZSZ A;  1M27 C;  3UAT A;  3P8B B;  1N9S A;  4JRQ A;  4E7Z A;  1HYO A;  1YNZ A;  3GIB A;  3VS6 A;  3INZ A;  4EDU A;  4L5G A;  2RHZ A;  1UHF A;  1JB0 E;  4PJN A;  3RER A;  4EMK A;  5KYX B;  4F7U A;  4M7D C;  4ZN3 A;  1OI1 A;  1I81 A;  4E47 A;  1GL5 A;  1R0C B;  3RR6 A;  4M75 A;  2J6K A;  3E19 A;  2FPF A;  1J3T A;  4C8Q A;  3GP8 A;  1Y0M A;  3FIF A;  2GNC A;  3SHW A;  4RMO A;  1D1B A;  4ZTJ A;  1KJW A;  1VYT A;  1YJ9 A;  1M1G A;  1Q86 U;  3X28 B;  1LJO A;  3EFO B;  4XU0 A;  4XQ3 A;  4M7D D;  3QG1 A;  3V7S A;  1KQ2 A;  1RL2 A;  3TSZ A;  1R77 A;  3RUX A;  2OTL A;  1QMC A;  4MDX A;  3V8J A;  2LJ1 A;  2DBM A;  3CPW A;  2L3Q A;  3OS5 A;  2GFU A;  2VUB A;  3OMC A;  4OMN A;  1UG1 A;  3CCV Q;  1T0H A;  3G71 T;  2CGH A;  2PNI A;  2FYK A;  2YUP A;  1RAD B;  1SPK A;  3JSC A;  2VGM A;  5GAO n;  3CBO A;  3V7R A;  1ABQ A;  4LUD A;  4P5N A;  4ANJ A;  2RQU A;  2PTK A;  4X9C A;  2QQA A;  4DEY A;  2DTH A;  2E3H A;  3CC2 A;  2RD1 A;  2P4R A;  4OMO A;  4RTZ A;  2FEI A;  1OX9 A;  2K3X A;  1VQO T;  1RAG B;  2J6F A;  3CC7 T;  4XTU A;  4CC3 A;  1Y96 A;  2G3R A;  3VRZ A;  5GAM h;  1VQ7 A;  1JJ2 P;  2A7Y A;  2HQX A;  4NOY A;  1M90 U;  1EZZ B;  2KEA A;  3CD6 T;  1VQ9 A; 
#chains in the Genus database with same CATH homology
 1VQP Q;  1S72 Q;  2OTJ Q;  1VQ4 Q;  1VQ7 Q;  1NJI R;  1Q7Y R;  3G4S Q;  1KD1 R;  3CCQ Q;  2QA4 Q;  1VQO Q;  1M90 R;  3CCV Q;  3CME Q;  3CC7 Q;  3CCS Q;  1VQM Q;  1KC8 R;  1VQ6 Q;  3G71 Q;  3CMA Q;  3CCU Q;  1YIT Q;  1K9M R;  2OTL Q;  1QVF P;  3OW2 P;  1YHQ Q;  1JJ2 P;  1YJW Q;  3I56 Q;  3CCM Q;  1QVG P;  3CCR Q;  3CPW P;  1N8R R;  1VQ9 Q;  3I55 Q;  1VQ5 Q;  3CXC P;  3G6E Q;  1Q86 R;  1VQN Q;  1K73 R;  1K8A R;  3CC2 Q;  1YJN Q;  1W2B P;  1YJ9 Q;  3CCJ Q;  3CCL Q;  1M1K R;  1KQS P;  3CCE Q;  3CD6 Q;  1YI2 Q;  1VQ8 Q;  1VQK Q;  1Q81 R;  1YIJ Q;  3CC4 Q;  1Q82 R;  1VQL Q;  2QEX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...