1WJRA

Solution structure of the 2nd mbt domain from human kiaa1617 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
GSSGSSGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 2nd mbt domain from human KIAA1617 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords KIAA1617 protein
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjrA00
2R5AA 2GFUA 4C5HA 2RHXA 2EQKA 2CKKA 4PLIA 3S3OA 1WJQA 4E7KA 2LTOA 3L2UA 5C0MA 2R57A 5KH6A 4QQDA 3PMIA 3MEWA 3OYHA 3OYKA 2P0KA 3OYLA 2BUDA 4IKFA 2JTFA 3OYEA 3L2QA 4BDYA 2EFIA 3OA6A 5KE3A 2LCCA 2DIQA 3PNWC 1G5VA 1KHCA 2HQEA 2EQJA 4LD6A 2K3YA 3SD4A 4QVZA 4B9WA 5D6WA 3L2VA 3MEUA 4IUUA 2X4XA 3NTKA 3S6WA 1OZ2A 4A4GA 2G3RA 2EQMA 4OVAA 2K3XA 4IUPA 4C5GA 3OY9A 2RI2A 2XK0A 1H3ZA 1SSFA 5CIUA 5J26A 1WJRA 5D6YA 1OZ3A 5KCOA 4N4HA 3H8ZA 3F70A 3UWNA 2GFAA 2RJDA 3MP6A 2O4XB 2QQSA 4UC4A 3NTIA 2YRVA 3ASKA 3LGFA 2R5MA 3OYDA 2RHUA 3UT1A 2IG0A 3M9QA 3MP8A 1OYXA 2X4YA 3OYAA 5FRMA 3FDRA 3OS2A 2HQXA 2RHIA 4Q5WA 1MHNA 3OMGA 1WGSA 2BKDN 2RJEA 4C5EA 4ZTJA 4IUQA 3S3MA 2MWOA 2L8DA 2O4XA 3MEVA 4ZTFA 1N27A 3DB3A 4E7LA 4IUVA 4N4IA 4HCZA 4E7JA 3META 2X4WA 3OYNA 3FC3A 4NS5A 4QW2A 3OB9A 3FLGA 3NTHA 2B8AA 4Z02A 3LLRA 5FRNA 3E9GA 3MP1A 2L89A 3KUFA 4EDUA 3LX7A 2NLUA 3OMCA 3Q1JA 2E6NA 2DIGA 3GOXA 4BE1A 4PL6A 5IAYA 4FL6A 2EQUA 4QQGA 1WJSA 2RI5A 2VYTA 3ZEHA 3OS1A 5M9OA 3S3NA 3QIIA 3OS0A 4QQ6A 3L2WA 3O8VA 5IN1A 3QJ6A 3ME9A 2D9TA 2QQRA 4BDZA 1OI1A 4B9XA 4RG2A 5KE2A 2LVMA 3PMTA 4PLLA 2RHYA 2LDMA 4BACA 5J39A 4IUTA 2FHDA 2PQWA 3LH0A 5FROA 3PFSA 3E9FA 3OYBA 4A4EA 3MO8A 4BE2A 4E7IA 2L3RA 3P8DA 3FEOA 2R58A 3QKJA 2M0OA 4BD3A 2XDPA 5C6SA 3MEAA 2RO0A 2RJCA 2DAQA 3OQ5A 3DB4A 4CRIA 2WACA 3LYIA 3BDLA 4L59A 4X34A 2JZ2A 3CEYA 4A4FA 2M1HA 2LRQA 3H6ZA 4GY5A 2EKOA 3OYGA 3OYIA 4FU6A 2X35A 5KCHA 5D6XA 3C4SA 3L42A 3OYCA 1RI0A 2MWPA 2RHZA 3EAEA 2E5QA 3QBYA 2RJFA 4C5IA 3OYJA 2F5KA 3LGLA 4IURA 3P8HA 1XNIA 3L2RA 4II1A 3OYMA 2M16A 2RI3A 3OYFA 2BIVA 4A4HA 4BE0A 2GF7A 4N4GA 4E7HA 3DLMA
chains in the Genus database with same CATH superfamily
2HMAA 3PE0A 4HVUA 2GFUA 2ZZDA 1WZOA 4Z88A 4K11A 1AZEA 3L2QA 2LZ6B 1OX8A 1F1BB 2ZPEB 1IXDA 2J6FA 4AFUC 4BI8B 1KHCA 3RMQA 2J7IA 3SD4A 4QVZA 3G4ST 2YHTA 4HVWA 2QDYB 3JCMP 2E70A 1SSHA 2SRCA 3OSSC 1KHIA 1H8KA 4DBQA 5GAOn 2GFAA 5HCKA 3M54A 1RAIB 2YRVA 2W0ZA 1GCQA 3CCLA 3UT1A 2IG0A 3SWNC 1UGRB 1UEBA 4JRKA 4RTYA 5IHIA 1WHHA 1NBEB 1Q82R 3EG2A 4Z8AA 2D6FA 1N27A 4MDWA 2RH2A 2PTKA 2QGGA 1YWPA 2LC4A 3BE3A 1E6GA 2QA4Q 1BI2A 2W10A 4EDUA 1QVGS 1RLQC 1K4US 5CKHA 2EQUA 1OU8A 3EG1A 1HSQA 4ELZC 3UF4A 2RNAA 2MAMA 3JCMd 2F5TX 1V1CA 1M27C 2P0QA 2ENMA 5IXFA 3CMET 1AWOA 2CP7A 5FWCA 3M57A 5CQYA 5KYNA 1KK7A 3CMEA 3DLLA 5A2QE 2XDDA 1XOVA 2LNHB 1BCOA 2K7AA 3BDLA 1PC0A 1VQ9Q 2JZ2A 1SKUB 4D6WA 4OB3B 1IGUA 2CP5A 3H0HA 3OYCA 5KYWB 1QLYA 3OYJA 4M7DE 2VWFA 1GCQC 1WNLA 2M02A 1YITA 2KVQG 3L2RA 2L5QA 3GLXA 2JUFA 3ZBDA 1GL5A 2RHXA 2CP3A 3KXTA 1K9MU 1UB4A 3GP8A 2KK4A 1PRLC 1XQHA 1G3WA 2FEIA 2K4YA 1MMNA 1NEBA 4KH0B 3VS1A 3PNWC 3CMAT 1SRMA 4LE9A 1VQ8Q 1N8RR 3CCJT 3OY9A 2QTVA 1G83A 1H3ZA 2JN0A 2QYZA 1I4K1 2RQTA 5A0DA 2EIFA 1YWOA 2R5MA 4FW1A 1QVGA 2A7YA 1CSKA 2JMAA 2KYMA 4E6RA 2CSIA 1D1BA 2BKDN 1VQMA 3CC4Q 3M58A 2DTHA 4TVRA 2O88A 5GAOm 1AWJA 2CZ6B 1VQNA 3OB9A 4JS5A 1K73C 3LLRA 2P4TA 3VYGA 2DTOA 2NLUA 4DQ2A 1S72T 5IAYA 3MKDA 1P92A 4OF1A 3S3NA 2DETA 2NUTB 3RESA 1K9MR 4PK4A 4JJNK 1FX7A 1RABB 4J7IA 1VQMQ 3OYBA 4OMLA 1EZZB 2CZ1B 3HRSA 4JJBA 4E7IA 2KXDA 3QKJA 5C6SA 1M90U 4KBMB 2EBPA 2RJCA 2DAQA 1ABQA 4J5YA 5GANf 3SDZA 2RN8A 4DEYA 4AFZC 2DL3A 2RJFA 3EG0A 2O9VA 3OYFA 1UGVA 2AZSA 4BE0A 2K5FA 4XQ3A 2VGNA 3J81E 1E6HA 4QQDA 1OU9A 2FZGB 2X4JA 2GGRA 5IHKA 3N5BB 4EPCA 4ESRA 1QWEA 1HXDA 1NJIC 2YLCA 5CK9A 4C5GA 2FG0A 1WYXA 1MNEA 5CIUA 1WJRA 2YRDA 2EGCA 5KCOA 4X9DA 1FMKA 3M4YA 3LGFA 3CPWP 2ZPIB 3OYDA 4LUDA 1Z9QA 4F16A 4M77E 1CKAA 4RTXA 3V7SA 4Q5WA 3CC2T 2O01E 1VQNQ 1QVFP 2GCXA 5AT1B 2QA4T 4E7LA 1VQNT 4IUVA 2X4WA 4M78D 1MMAA 3NTHA 3CCRQ 3EFSA 2HZYA 2KBTA 4M78C 2K57A 5I2MA 3SB2A 3HHTB 1PD1A 4QQ6A 3CCVQ 3ME9A 1BBZA 1ZSZC 4BDZA 4B9XA 1ZSZA 5ECAA 2MPXC 4IIMA 2DXTA 5LJ5f 4M7AG 3CBPA 4JRPA 3INZA 1FWZA 2QXFA 3UA6A 5KYUB 2BTTA 3H9NA 1QW1A 4M75E 1EIFA 4OGCA 1OPLA 2HEQA 3CCST 4N0AC 2DILA 2DKGA 4X34A 4C0DC 4A63B 3LWIA 3OYGA 2BZXA 2J6OA 3RERA 4PJMA 3M56A 2LQKA 1QKXA 1W6XA 3QYHB 4J6WA 4M77D 1YITT 2AKLA 2VXEA 3OYMA 2CP6A 2RI3A 4OB1B 4N4GA 1YIJQ 1RAEB 2ZAEA 4BB7A 2QQ9A 2R57A 5EG2A 4F7UA 5GAN5 2PNIA 3OSVA 3CMAQ 2JTFA 1JQQA 1OEBA 4L5GA 3VS7A 4C8QF 1G5VA 4OMPA 1U5SA 1Y57A 4OB2B 1VYUA 2HD0A 3X20B 3CCUT 2KT8A 3JB9D 1DJ7B 2YSQA 3EG3A 2LT4A 4OMNA 4PJOE 3CCSQ 2DFUA 3M0SA 2MK5A 3CCSA 3JCMg 1IREB 2QI2A 2KROA 4DA4A 3M0QA 4D8KA 1NEGA 4HCKA 4R0KA 1K1ZA 2RMOA 1WQ7A 1TUCA 1VQLQ 1AWWA 2XMFA 4EMKA 2RJEA 4HKEA 5CR2A 1WHMA 4ZTFA 1MMDA 3QYGB 4Z02A 2YXYA 2CGHA 2E3HA 1VQ6Q 1T0HA 4C8QD 1VQPT 1Y71A 3QIIA 2LQNA 3CBOA 3O8VA 1KSWA 4EMGA 1KQ2A 4PJOB 3LH5A 1PM3A 1YIJT 1I8FA 1RAFB 3LH0A 1LCKA 4ELYC 1TXQA 3I9QA 2GNCA 1R0BG 4QT7A 4A4KA 2BE7D 2EWNA 4A4FA 3QSUA 1OV3A 1KD1U 2CZ7B 8ATCB 2PZ1A 3M0RA 2YRCA 4C5IA 3CPWS 4M7DC 1LPLA 2VKNA 4LD9K 2CYZB 2BIVA 4M7DD 1SEMA 2YUPA 3BFMA 5DLOA 2JT4A 1UHFA 3CCVT 2DJZA 2RD1A 5KYUA 1W1FA 2VV5A 2FYKA 3EFOB 2QGFB 3S6WA 4OVAA 4M78F 4M7AE 2D0NA 4XTVA 2E4HA 3DKMA 1FMVA 1PG5B 2MF2A 4JJCA 4M77B 1VQ6T 2A0FB 1YNZA 1TOVA 1O9SA 2HQXA 4MMLA 2F2WA 2JNGA 2DL5A 4DBRA 2LJ0A 1ZSGA 3OYNA 1YJWA 2ESWA 1X6GA 1M4ZA 1RLPC 4M75F 4BI4A 4BY6C 4MZPA 3E19A 3EH1A 3X25B 3CCJA 1ZSZB 2ECZA 1YI2A 2RM4A 4AFQC 3JCMV 2AT1B 2OAWA 5IN1A 3LWHA 2CUDA 1VQ5T 1BI0A 2JMCA 1M5Q1 2XICA 2LVMA 3V7CA 1KC8R 1VQ9T 3L1AA 4M75C 2DEQA 5IHNA 1Q81R 1R77A 4IUTA 1ZHIA 1AD5A 3EHRA 1U1SA 5CVIA 3CCMA 4JS4A 2F2VA 4OB0B 4C92B 4XU2A 2L3RA 3FEOA 2J06A 2VUBA 2VC8A 4CRIA 1M8VA 1G3YA 2KGTA 2L3PA 1B3QA 2JW4A 1ZBJA 1YI2Q 2MIOA 2MI6A 5A0LA 2WSCE 1AHJB 4E7ZA 2V8JA 3PGGA 3CCQA 4MDXA 1M2VA 2H3EB 4JRIA 2JOYA 4MZMA 5LJ3h 3FB9A 3C94A 1FYNA 5GJVB 2PVOB 2DLPA 4R55A 5LJ3g 1AZGB 3JCMf 2X4XA 1BI3A 4LXCA 4GLMA 1WFWA 4BUGA 2DM1A 1AT1B 3JCMX 2X9HA 1BYMA 1HK9A 3OYYA 1PHTA 1D3BA 3GNFB 1LOJA 1IHVA 2NUZA 4M7AB 3M9QA 2L3QA 2COYA 2QDLA 3A98A 5LJ5e 5FRMA 3I5RA 4F7UF 1YJ9A 5A0GA 4EIKA 2MMPA 3NFCA 1VQ5Q 3G6ET 2LCLA 4E7JA 5GAOq 4M78B 3FC3A 1I07A 3VS5A 4J7FA 4FM4B 2F2XA 2DPPB 3V8JA 1KIKA 3EFOA 1YJ9T 1Q7YU 2E12A 1G3TA 3MCAB 3PVLA 1OULA 3EGDB 1Q86U 1TS9A 4BACA 1VIFA 3A8LB 5GAN8 1UHCA 1UGSB 3GNGA 3WXMB 1VYVA 1GBQA 1KQSA 2RO0A 5FW9A 4C0ZA 1WHJA 3OQ5A 2EAYA 1YCSB 3TEEA 3G6EQ 2DF6A 2KYBA 1PNJA 3G4SA 7AT1B 1WDXA 1B7TA 1WA7A 4PJNA 5CKEA 2JM9A 3FRNA 4GBQA 4M7AF 4N0AA 4A4HA 2GF7A 1W2BA 3I5SA 2CKKA 1U1TA 4HT8A 5KH6A 9ATCB 1I1JA 3PTAA 2P0KA 3QHSA 1I0CA 2DZ9A 1VQ4T 4M7AC 3HRTA 1LNXA 2LCCA 1VQLA 4FT4A 2ABLA 2CP0A 3G7ZA 3MEUA 3ULRB 1BU1A 5GAN3 4RKUE 2EYXA 5GANj 4JJDA 1OZ3A 2DZCA 4FW2A 1M1KU 2VASA 4KRTA 1U3OA 2QQSA 4FYWB 2Y90A 5KYWA 2KY9A 2JS2A 4EMKB 4DOWA 2IPOB 3J7AF 1KG1A 2QEXT 5LJ5g 1WGSA 1WHGA 4E7SA 3CD6Q 4PJOF 1WHLA 4RTWA 2DYBA 2JTMA 3M53A 2MOXA 5LJ5j 2LJ1A 2OI3A 1WXTA 1VQ7T 2OTJQ 3CCLQ 2A08A 4FL6A 4EMKC 3A8GB 3R6OA 3QZ9B 1WJSA 1D0XA 5KYYB 1K0SA 4O6JA 1TTHB 2QQRA 1OI1A 1X01A 4PFOA 2DL8A 3CXCA 1VQKT 3MO8A 4BE2A 2AIRB 2R58A 2IVWA 2NUPB 5GANh 1NLPC 4MMKA 1D0ZA 5L23A 5GAMf 2E1HA 1K73R 2DA9A 3SHWA 2O31A 2ED0A 3QWXX 1ZLMA 2KE9A 2ZGWA 1SRLA 3HL8A 1C1AA 4PJLA 4HCCA 4XTXA 2RQUA 5GANe 2A28A 2AKKA 2LT1A 1X27A 3CCLT 2DYIA 3RIRA 1K9MC 2EQKA 1NZ9A 2Z0WA 2HNIA 1MV3A 2LQWA 2Y4XA 2RQRA 3OYKA 2RQVA 2HDAA 1PSEA 2K9GA 2M51A 4IUUA 4BY6B 1N9SA 2P4RA 1UGQB 5GAMj 2PVGB 3JB9H 1SSFA 4KT0E 3CCEQ 5J26A 1VUBA 4N4HA 4M77A 1Q81C 2LX9A 2JVVA 5FU7C 2RHUA 1B34A 2DMOA 2EVRA 4FYVB 3FDRA 3OS2A 3VUBA 2DRKA 3CCRA 1U06A 4M78E 1RUWA 3A8MB 4IUQA 4HCZA 3FLGA 2B8AA 1M30A 1IZ6A 3Q1JA 2DRMA 2DNUA 1K8AU 3EFRA 3RKYA 1G8XA 4XTUA 2CH4W 4ZGEB 3I56A 2DBKA 3M5AA 3SWNB 3CCEA 4RG2A 5KE2A 2LNVA 2F69A 5HK0A 2WSEE 1BB9A 4M75A 3CCET 2FHDA 2PQWA 1ABOA 4M75D 3M55A 2C06A 2M0YA 1CKBA 3UDCA 5GMKj 2E3IA 4ZN3A 1SHFA 5GAMd 1YJNA 4PJOC 3CCMQ 3AT1B 1X69A 2CS7A 1UGPB 3MEAA 5I11A 4CC4B 4L59A 2A3LA 1TWBA 1B34B 5HY6A 2GTOA 3EG9A 3HRUA 5FWBA 1KJWA 1PCXA 2MWPA 1XTDA 2DJQA 2F5KA 3E1SA 2FPEA 3I55T 2YLBA 2G6FX 4OMMA 1VQOT 2YUNA 5I2SA 1GCPA 2FO0A 2VB6A 4MZTA 2DXCA 1WQWA 3RBBB 2E5KA 1ZA1B 3OYLA 2BUDA 4IKFA 1IB8A 2V26A 3SFMA 3A5ZB 1NJIU 3L2VA 3TSZA 3VJPA 1W4SA 3CCRT 2ROLA 3R6NA 2EQMA 4WF2A 2RI2A 4ZGDB 2XG8D 2D8JA 3VKIA 1BIBA 3H8ZA 1Z9ZA 2FRWA 3F70A 2RJDA 2HBWA 3MP6A 2O4XB 2XIDA 3UPUA 3JCMQ 3BY7A 3PIPA 1SPKA 1V29B 2EJ9A 1H3HA 4QKUA 2BE9B 2KAFA 3QZ5B 4C5EA 4VUBA 4Z89A 4ZTJA 1M1KR 1WXUA 4R56A 4J6YA 2K5LA 4QW2A 5FRNA 2HQHA 3G71A 2EYZA 2L89A 5I21A 1QQJA 1M2VB 5GMKm 4DOVA 2RF0A 1WIEA 3ZL7C 3C0CA 3RNJA 4M78A 5J39A 1V76A 2EKHA 4LDWA 2EQIA 3REAB 1H92A 3RKWA 3QG1A 1H641 2EYQA 2QAZA 1PKSA 1NM7A 1D3BB 2EGAA 3QPHA 4J9BA 2J6KA 1I5LA 4HCBA 4GY5A 3EGDA 1GXIE 2YUOA 3C4SA 4KGZB 2ATCB 2RHZA 4QVCA 2V1QA 3LGLA 4Y28E 3P8HA 5IH2A 1GRIA 1S1NA 3G4SQ 1YN8A 4PJJA 4KGVB 2HL3A 4E7HA 3JB9F 1SG5A 2HKNA 1M8MA 4J9IA 5LJ5h 4PLIA 1WJQA 3CCQT 3L2UA 3PMIA 2BZYA 1NLOC 4RG8A 3OYEA 4O5VA 4M4ZA 1C0MA 5GAMg 1VQLT 1S72A 2EQJA 3MHXA 2FPDA 4M7AD 1W70A 2BZ8A 2X3WD 1QCFA 1N5ZA 1VQ4A 5GAN6 2DTIA 4F04B 4A4GA 1KQSS 3A1PA 2HL5C 3VS6A 4RCCA 3EGXA 3HFOA 3PT9A 1TH7A 2EPDA 3ASKA 1I81A 5GAOr 3C95A 2CP2A 1NPRA 2E6ZA 3CCUA 4J9HA 2ZPHB 3KFVA 4CC2A 4AMCA 4FYXB 2FB7A 4N4IA 2LJ3A 3BW1A 3RUXA 4KH1B 4FSXA 2V1RA 4WTOB 2KRMA 3E9GA 4AT1B 3D7SB 3I55Q 2RK1A 2DVJA 4PL6A 3O5ZA 4QQGA 2PUKB 2MCNA 2FZCB 2P0PA 2E41A 3ZEHA 2PVDB 1N8RC 3OS0A 4DEXA 5GMKl 3RMSA 4EMHA 4PJOG 4GLKA 1UFFA 1UDLA 5CKDA 5GANd 1MNDA 1E7OA 2I0NA 5FROA 2OTLT 1VQ6A 3E2UA 4XTYA 1OX9A 4OMQA 4F17A 1VQKQ 2VGMA 4HA8A 2XDPA 3V8LA 3JCMJ 2E65A 3DB4A 3WVDB 2CT3A 2WACA 3CC7T 4F7UE 3CEYA 1JU5C 3CC2Q 3TCJA 3OYIA 2CSQA 3RKXA 1MV0B 2X35A 5GAMh 3BDUA 1G2BA 1RI0A 4LDYA 4NL2A 1RAHB 6AT1B 4NL3A 2OJ2A 2QTXA 2OAUA 2CDTA 3DLMA 4C0FA 4C0GA 4C5HA 3GBQA 3U23A 1RAGB 4ATOA 2JJ9A 2VVKA 1KQSP 4J6XA 3THKA 4XAXB 3C12A 4C0DB 4M7DA 2GTJA 2OTLQ 1YITQ 4AG2C 5D6WA 1JRIA 1M9SA 1KQ1A 3JCMc 2G3RA 4IUPA 2XU8A 3A8OB 1BI1A 2KMTA 3IQLA 4KUDK 4ANJA 4PFPA 1Y96A 2MYSA 3PIOA 1K73U 1M1KC 1UJYA 2DO3A 1YFNA 2AZVA 1PSFA 4M77G 1BCMA 4X1VA 2L3SA 4ZGJB 3OW2S 2X4YA 3MJXA 1T3SA 3OMGA 1ZUKA 2MWOA 3MEVA 1PKTA 5GMKi 4NS5A 1ACMB 4KULA 1TUGB 1QKWA 3GOXA 1T3LA 2O2OA 3CCMT 3QUIA 1Q86R 4J8OA 2K2VA 5AYFA 5GAOp 1FMWA 2KT1A 2D8HA 2C0OA 5LJ3f 1QP2A 2LDMA 4FT2A 1MMGA 2K2MA 3PFSA 4M7DG 1VQKA 2DXBA 1RAAB 3P8DA 2KXCA 4RTUA 3I56T 2LQ8A 3NGPA 5FU6B 3UATA 4JLGA 1QVFS 2P84A 1VIEA 4Y92A 2X51A 1PD0A 1VQPQ 2EKOA 2RK2A 5CKBA 2V8KA 3ZFJA 2O9SA 1JB0E 4M77C 1U8RA 3TSWA 5J3BA 2LX7A 2HBPA 4II1A 3URGA 4XTZA 2OTJT 5GAMe 4C92D 2R5AA 4ME7A 1ZBXA 4LDUA 2LTOA 1JJ2S 5C0MA 1O75A 4M78G 3OS5A 2ZPBB 4RMOA 1D09B 3EG9B 3OW2A 2LMJA 2EFIA 3CCUQ 2DK3A 2XI9A 3I35A 1YJNT 5CKFA 4M7DB 2K3XA 1M3CA 2HKQB 1OQKA 3JCMW 3OBWA 4F14A 2DERA 2HSEB 1Y96B 2DX1A 1TUDA 2FL7A 1S72Q 1IGQA 2GQVA 1C6VX 3CC2A 2V8IA 1QWFA 3CMAA 1JEGA 3G71T 3VUZA 1VOMA 3DB3A 3JCMh 4FYYB 3FJPA 3LX7A 3OMCA 4L6V5 1KC8C 3HFNA 4E47A 1IO6A 4ORZA 1WPYA 2RI5A 2VYTA 1AOJA 4C8QA 1M3AA 2KSSA 4C8QC 2IIMA 1T0JA 3QJ6A 2D9TA 1Y7XA 3M0UA 3PMTA 2XDBA 4J9EA 1BKBA 4LN2A 2CH4A 4LNPA 4M77F 3JSCA 5DY9A 2AK5A 5LJ3e 5DLQE 1R8OB 1M90C 1LJOA 2EYYA 3NHNA 1VQ7Q 3CCQQ 1OPKA 2COWA 3H41A 3QO3A 1UTIA 3LYIA 5CQXA 1A0NB 4Y91A 3JB9I 2QK0A 3QDRB 2FRYA 4OP0A 4C92E 1Y07A 3M4GA 4B6MA 1XNIA 2QQAA 2YUQA 2F1LA 5GAOl 2I2LA 1D1CA 2J05A 1TU0B 3HPWA 3S3OA 1N9RA 4RUGA 4E7KA 1JBMA 4JDSA 1NJIR 3V7RA 3MEWA 1UECA 1PWTA 1JXMA 3CC4T 3OA6A 1GBRA 5KE3A 3CBMA 4JZ4A 3GIBA 4C8QG 1JO8A 3JAME 4LUEA 1UUEA 1I5OB 3VS3A 1OZ2A 3X26B 1QVFA 1VQOQ 3VYHB 2C0IA 3I56Q 1NYFA 3JB9J 5KYYA 3NMZC 1LVKA 2QEXA 1KD1R 2EYWA 2OTLA 1PRMC 2HSPA 3OYAA 1WX6A 1NPPA 3EGUA 3S3MA 3VS4A 3P8BB 5LJ3j 2L8DA 3QWYA 2NUPA 3META 4RTVA 2LCSA 2C0TA 1GFCA 1ZX6A 4C8QE 5KYXA 1Q81U 4A53A 4PNOA 2QEXQ 5M9OA 4V2SA 2OTJA 3EHQA 4D8DA 1ARKA 2X3XD 1JJ2P 2RHYA 4JUVA 5CAIA 1K8AR 2YT6A 5D7UA 3HKSA 1KD1C 3CC4A 1UE9A 3E9FA 4A4EA 1Q7YC 1Y0MA 2M0OA 4J83A 3X24B 2DD5A 3QDFA 1X2QA 2M9UA 1YJ9Q 2A37A 4X9CA 2ED1A 4OMFB 4XTWA 1VQ4Q 2FVUA 2H8HA 4M75G 2KR3A 4XU3A 5LJ5d 2L2PA 5EC7A 1K8AC 1SF9A 3M59A 3JB9G 2QASA 2Y4YA 2YWWA 1X6OA 2FZKB 1YIJA 4OGEA 2QG9B 1Q7YR 2K5IA 1YP5A 1FXXA 2DIQA 1B07A 5CO7A 4LD6A 4B9WA 1ZUYA 2H3JA 3NTKA 3CXCS 2RA2A 2EJGA 3JCMb 2XK0A 3G6EA 4J9FA 4JLIA 5CCAA 2HCKA 1TG0A 4AG1C 5GAN2 1OYXA 4PFZA 3X28B 4BI3A 1WHKA 2O4XA 1K9AA 4KUIA 3AHUA 1IRXA 1MUZA 3CC7A 2SEMA 4CI0C 2ZPFB 1YCYA 4JRQA 3VRZA 4HT9A 1ZQ1A 2FPFA 2E6NA 5GANg 4OMOA 5GAN4 4F7UG 3NPFA 1X75C 3OS1A 1X6BA 4IIOA 4YTLA 2LP5A 2RPNA 1OOTA 3KBGA 5IXBA 1YHQA 4C92F 1QVPA 1VQ7A 4HVVA 2JM8A 1HYOA 3CMEQ 1SHGA 3CPFA 4KGXB 2JTEA 1MGQA 4RTTA 4BD3A 1WLPB 2KQWA 2QQBA 1QCOA 1ZUUA 3M0PA 2PU9B 3JV3A 1X2KA 2CZ0B 2M1HA 3ER0A 2KRSA 2K3BA 5KYXB 2DBMA 1M3BA 3CPWA 2KEAA 3QBYA 3JRZA 1JXOA 1M2OA 4PJOA 3TU4K 1RADB 1HD3A 4FIBA 3HSBA 1KFZA 1VQ9A 4J9CA 2KRNA 2D0QB 3CC7Q 1KC8U 1VQ5A 2DL4A 5LL6S 3OBYA 3CD6A 3CD6T 2NUTA 2A36A 4BDYA 1R0CB 3TQ7P 4WCIA 3WVEB 3J80E 2HQEA 2K3YA 2K6DA 2DL7A 4J9DA 4J9GA 5DM7R 4A54A 1YJWT 1YHQQ 1M1FA 4NOYA 1YHQT 5D6YA 3GPLA 1QMCA 1Q82U 1UJ0A 2XKOC 3NTIA 4PKCC 2EJFA 3MP8A 1JJ2A 4RTZA 4ZNXA 2QA4A 1QCNA 2ZPGB 2RHIA 1EX4A 1MHNA 1M90R 3A8HB 3UA7A 2KI7A 1D1AA 3TVTA 4FSSA 1NE8A 4RCBA 4HXJA 1G3SA 5HK3A 2JS0A 2DIGA 4BE1A 8AT1B 4C8QB 2DEUA 2EGEA 4AFSC 3L2WA 3QXEB 1K76A 1GFDA 1YJWQ 1VYTA 4PLLA 4LDXA 3REBB 4F7UB 3EH2A 3QJYA 2PUOB 1X43A 5GMKh 4E2FB 3EGXB 2CREA 1RL2A 2VXFA 3G1JA 1IHWA 3H0FA 2DVEA 3VV0A 2CT4A 2AHJB 3CXCP 3V8KA 1UG1A 3LW5E 2WSFE 3VU3C 3VS0A 3H6ZA 2DD4A 2NYSA 4FU6A 5GJWB 1EFNA 5KCHA 5FU7B 3CCVA 5D6XA 4XU1A 1QVGP 2NWMA 5FU6C 3EAEA 3H0IA 2K79A 1YBYA 4IURA 1XJWB 2XD0A 3T9NA 2KNBB 4CC3A 2RQWA 2M16A 3L2ZA 5L8RE 3FJ5A 3HP9A 1N8RU 5GAN7 4FCYA 4CC7A 5IT9E 3TREA 3RR6A 2COZA 2CUBA 2JXBA 3OYHA 2B86A 2YDLA 4DBHA 3VS2A 4DBFA 3PVQA 3HTRA 1W2BP 3SEMA 2E10A 2XHCA 3GF5A 2GBQA 1NG2A 2E64A 1AEYA 4JZ3A 5HKCA 1VQOA 2DE0X 3M0TA 4C92G 1Q82C 3UWNA 4UC4A 1J3TA 2EW3A 4C92A 5GMKe 2D1XA 4QVDA 1VQPA 1BIAA 1M1GA 2L0AA 4M7DF 1YJNQ 1N6AA 3MP1A 3KUFA 4P5NA 1RACB 3OW2P 4ZN1A 3RDVA 1QP3A 3JCMe 4M75B 4JPBW 4XK8E 2DXUA 3I55A 1K0XA 5FLXE 3G71Q 1AWXA 1HJDA 2RB6A 1NYGA 1VQ8A 3CCJQ 1WI7A 2HAXA 1VA7A 2ROTA 1TSFA 1ZA2B 3SWNA 1WXBA 1Q95G 1RI9A 1AVZC 1VQMT 2GQIA 5LJ3d 4PJOD 4XU0A 3MPUB 2KDSA 1D0YA 2LRQA 5I22A 3CQTA 2ZCFB 3L42A 3VRYA 1VQ8T 4M7AA 1BK2A 2E5QA 1Q86C 4C92C 2OX7A 1YI2T 1W2BS 3FIFA 4LDVA
chains in the Genus database with same CATH topology
3HPWA 3RERA 2GFUA 1VQOT 2ZZDA 5I2SA 3S3OA 1N9RA 4E7KA 3BFMA 1JBMA 4JDSA 3V7RA 4MZTA 5DLOA 2DXCA 3MEWA 1WQWA 3CCVT 2DJZA 2RD1A 3OYLA 3CC4T 2BUDA 4IKFA 3L2QA 2ZPEB 3OA6A 5KE3A 3CBMA 4BI8B 2VV5A 1KHCA 3RMQA 3SFMA 3GIBA 3A5ZB 2FYKA 4C8QG 3SD4A 4QVZA 3G4ST 3JAME 1NJIU 3L2VA 3VJPA 3CCRT 1W4SA 2YHTA 3S6WA 3X26B 1OZ2A 1QVFA 2EQMA 2QDYB 4OVAA 3JCMP 2E70A 4WF2A 2RI2A 3OSSC 1KHIA 2XG8D 4M78F 4ZGDB 3VYHB 4M7AE 3JB9J 4XTVA 3VKIA 5GAOn 1BIBA 3H8ZA 3DKMA 3F70A 2GFAA 2RJDA 3MP6A 2QEXA 2O4XB 2XIDA 3M54A 2YRVA 2MF2A 4M77B 3UPUA 3JCMQ 3BY7A 3CCLA 3PIPA 1VQ6T 1V29B 2EJ9A 2IG0A 3SWNC 3UT1A 1UGRB 1UEBA 2OTLA 3OYAA 1NPPA 4JRKA 1O9SA 2HQXA 4MMLA 2KAFA 2JNGA 3QZ5B 4C5EA 4VUBA 4ZTJA 3S3MA 3P8BB 5LJ3j 2L8DA 2D6FA 1N27A 4MDWA 4R56A 3META 3OYNA 4J6YA 2RH2A 2K5LA 4QW2A 1YJWA 5FRNA 2LC4A 3G71A 1Q81U 1M4ZA 4C8QE 4A53A 1BI2A 2L89A 4EDUA 4M75F 1QVGS 4BI4A 4BY6C 4MZPA 5I21A 3E19A 5CKHA 2EQUA 4PNOA 5GMKm 3X25B 3CCJA 5M9OA 4V2SA 4DOVA 1YI2A 2RM4A 2OTJA 4ELZC 3JCMV 5IN1A 3LWHA 1VQ5T 1BI0A 2MAMA 1M5Q1 2XICA 2LVMA 3V7CA 3JCMd 1VQ9T 2RHYA 3L1AA 4JUVA 4M75C 2F5TX 5CAIA 2DEQA 4M78A 2P0QA 5J39A 4IUTA 3HKSA 1ZHIA 3CMET 1KD1C 3CC4A 3M57A 1U1SA 4LDWA 3E9FA 5CQYA 5CVIA 3CCMA 4JS4A 4A4EA 1Q7YC 4OB0B 4C92B 4XU2A 2L3RA 3RKWA 3FEOA 5A2QE 3QG1A 2M0OA 4J83A 2XDDA 3X24B 3DLLA 1XOVA 2VUBA 1H641 2EYQA 2DD5A 2VC8A 4CRIA 1D3BB 3QPHA 3BDLA 1I5LA 1M8VA 1G3YA 2JZ2A 4HCBA 2M9UA 4GY5A 4D6WA 4OB3B 1GXIE 4X9CA 3C4SA 3OYCA 2MI6A 2RHZA 4OMFB 4XTWA 4QVCA 2FVUA 3OYJA 5A0LA 4M7DE 1WNLA 2WSCE 3LGLA 4M75G 3P8HA 2KVQG 4Y28E 1YITA 1AHJB 3L2RA 2L5QA 3GLXA 2JUFA 4E7HA 3ZBDA 2V8JA 4XU3A 5LJ5d 3JB9F 3PGGA 5LJ5h 2RHXA 4PLIA 1WJQA 3KXTA 1K9MU 1UB4A 3CCQT 1K8AC 3CCQA 3L2UA 3GP8A 4MDXA 2KK4A 3M59A 3PMIA 3JB9G 1XQHA 1G3WA 4JRIA 2JOYA 2K4YA 4MZMA 5LJ3h 3FB9A 4RG8A 2Y4YA 3C94A 3OYEA 4O5VA 1X6OA 1YIJA 4OGEA 2K5IA 2DIQA 1FXXA 3PNWC 5GAMg 1VQLT 3CMAT 5CO7A 2EQJA 3MHXA 4LD6A 1S72A 4B9WA 2PVOB 4R55A 4M7AD 2H3JA 5LJ3g 3JCMf 2X4XA 1VQ4A 3NTKA 5GAN6 3CXCS 2DTIA 1BI3A 2RA2A 4A4GA 2EJGA 3CCJT 3JCMb 3OY9A 2XK0A 3G6EA 1KQSS 1H3ZA 4BUGA 2JN0A 4JLIA 5CCAA 3JCMX 1I4K1 1BYMA 4RCCA 5A0DA 1HK9A 3HFOA 3OYYA 3PT9A 1TH7A 1D3BA 3GNFB 1I81A 1LOJA 2EIFA 3ASKA 3C95A 5GAOr 2R5MA 5GAN2 1QVGA 4M7AB 1NPRA 2E6ZA 3M9QA 1OYXA 5LJ5e 5FRMA 3CCUA 2A7YA 3X28B 2ZPHB 4BI3A 4F7UF 1YJ9A 1VQMA 2BKDN 5A0GA 3M58A 2DTHA 2MMPA 4TVRA 3NFCA 2O4XA 5GAOm 2FB7A 4KUIA 3G6ET 2CZ6B 2LCLA 3AHUA 4N4IA 4E7JA 3BW1A 4M78B 3RUXA 5GAOq 3FC3A 3CC7A 1VQNA 4FSXA 3OB9A 4CI0C 4JS5A 1K73C 3LLRA 2ZPFB 2P4TA 1YCYA 3E9GA 4JRQA 3VYGA 2DTOA 4J7FA 4FM4B 1ZQ1A 4HT9A 2NLUA 2E6NA 2DPPB 3V8JA 5GANg 2RK1A 4DQ2A 1S72T 4PL6A 5IAYA 5GAN4 4F7UG 4QQGA 1P92A 2PUKB 1X75C 4OF1A 3OS1A 2P0PA 2E41A 4YTLA 3ZEHA 2E12A 2PVDB 3S3NA 3OS0A 1YJ9T 1Q7YU 1N8RC 5GMKl 1G3TA 3MCAB 3RMSA 3RESA 4EMHA 3KBGA 4JJNK 1YHQA 1Q86U 4PJOG 4GLKA 1FX7A 4C92F 5CKDA 1QVPA 4BACA 5GANd 1VQ7A 1VIFA 3A8LB 5GAN8 4J7IA 5FROA 2OTLT 1UGSB 3GNGA 3WXMB 1VQ6A 4XTYA 3OYBA 2CZ1B 3CPFA 3HRSA 4E7IA 3QKJA 2VGMA 1MGQA 4HA8A 1KQSA 4BD3A 2XDPA 5C6SA 1M90U 2RO0A 4C0ZA 3V8LA 2KQWA 2QQBA 4KBMB 2E65A 2DAQA 2EAYA 2RJCA 3DB4A 3OQ5A 3WVDB 3JCMJ 2PU9B 2WACA 3CC7T 4J5YA 4F7UE 5GANf 3CEYA 3SDZA 2CZ0B 2M1HA 3TCJA 3OYIA 3RKXA 3TEEA 3ER0A 2X35A 5GAMh 3BDUA 3G4SA 3CPWA 1RI0A 4LDYA 3QBYA 4NL2A 2RJFA 3JRZA 5CKEA 3FRNA 4NL3A 4PJOA 3OYFA 4M7AF 4N0AA 4A4HA 2GF7A 4BE0A 2QTXA 2OAUA 3TU4K 4FIBA 2K5FA 3DLMA 1W2BA 3HSBA 4XQ3A 4C0FA 4C0GA 4C5HA 2VGNA 2CKKA 1VQ9A 1U1TA 2D0QB 4HT8A 3J81E 4ATOA 5KH6A 4QQDA 1KC8U 1VQ5A 3PTAA 2X4JA 5LL6S 3OBYA 4J6XA 2P0KA 3CD6A 3QHSA 3CD6T 4XAXB 2DZ9A 3C12A 4BDYA 4C0DB 3N5BB 1VQ4T 4M7AC 3HRTA 4EPCA 1LNXA 1HXDA 2LCCA 3WVEB 4FT4A 3J80E 1VQLA 4M7DA 2HQEA 2K3YA 1NJIC 5D6WA 1JRIA 1M9SA 3G7ZA 3MEUA 2YLCA 5CK9A 1KQ1A 3JCMc 5DM7R 5GAN3 4RKUE 4A54A 1YJWT 2G3RA 4C5GA 4IUPA 2XU8A 5GANj 1M1FA 1BI1A 2KMTA 3A8OB 4NOYA 5CIUA 1YHQT 4KUDK 1WJRA 5D6YA 1OZ3A 2DZCA 1Y96A 5KCOA 1M1KU 3GPLA 4X9DA 1Q82U 3PIOA 2QQSA 1K73U 1M1KC 2DO3A 2XKOC 3NTIA 3M4YA 3LGFA 1PSFA 2ZPIB 4PKCC 2Y90A 4M77G 3OYDA 2KY9A 2EJFA 3MP8A 3CMEA 4EMKB 1JJ2A 4DOWA 4ZGJB 3OW2S 2X4YA 1KG1A 2QA4A 3J7AF 2QEXT 4M77E 2ZPGB 3V7SA 2RHIA 4Q5WA 1MHNA 3OMGA 1WGSA 5LJ5g 2O01E 3CC2T 4PJOF 2GCXA 2MWOA 3A8HB 3MEVA 2JTMA 2QA4T 3M53A 4E7LA 4IUVA 1VQNT 2X4WA 4M78D 5GMKi 5LJ5j 4NS5A 1NE8A 4KULA 3NTHA 4RCBA 3EFSA 1G3SA 5HK3A 1VQ7T 4M78C 2DIGA 2K57A 3GOXA 5I2MA 4BE1A 4FL6A 4C8QB 4EMKC 3CCMT 3A8GB 3QUIA 3R6OA 3QZ9B 2K2VA 1WJSA 4J8OA 3HHTB 5AYFA 3SB2A 5GAOp 4QQ6A 3L2WA 4O6JA 3QXEB 3ME9A 2QQRA 5LJ3f 4BDZA 1OI1A 1QP2A 4B9XA 1X01A 4PLLA 4LDXA 4F7UB 2LDMA 4FT2A 3QJYA 2PUOB 5GMKh 2DXTA 3CXCA 5LJ5f 3PFSA 4M7DG 1VQKA 3CBPA 4JRPA 4M7AG 1VQKT 2DXBA 1FWZA 2QXFA 3INZA 1RL2A 3MO8A 1QW1A 2VXFA 4BE2A 1EIFA 3P8DA 4M75E 2DVEA 2IVWA 2R58A 4OGCA 5GANh 3I56T 2LQ8A 5FU6B 4MMKA 3VV0A 4JLGA 1QVFS 3CCST 2AHJB 4N0AC 3V8KA 1VIEA 3LW5E 2DKGA 4X34A 5GAMf 2WSFE 3VU3C 4C0DC 2E1HA 3LWIA 3H6ZA 3OYGA 2DD4A 2EKOA 2RK2A 5CKBA 2V8KA 4FU6A 3ZFJA 5KCHA 5FU7B 3CCVA 1JB0E 2ZGWA 3HL8A 4M77C 4XU1A 5D6XA 1U8RA 3M56A 2LQKA 5J3BA 5FU6C 4HCCA 3EAEA 2HBPA 4XTXA 1YBYA 3QYHB 4J6WA 4M77D 5GANe 4IURA 1YITT 2XD0A 3T9NA 2LT1A 2VXEA 4II1A 3URGA 3OYMA 2M16A 3L2ZA 2RI3A 4XTZA 3CCLT 2OTJT 5L8RE 4OB1B 4N4GA 5GAMe 3HP9A 4C92D 1N8RU 3RIRA 1K9MC 5GAN7 2R5AA 2EQKA 4ME7A 4BB7A 1ZBXA 4LDUA 1NZ9A 5IT9E 2LTOA 3TREA 2QQ9A 1JJ2S 5C0MA 2HNIA 2R57A 1O75A 5EG2A 4M78G 3OS5A 4F7UA 5GAN5 2ZPBB 2Y4XA 4RMOA 3OYHA 3OSVA 3OYKA 2JTFA 3OW2A 4L5GA 1PSEA 2EFIA 4C8QF 1G5VA 2DK3A 2E10A 2XI9A 4OB2B 4IUUA 2HD0A 3X20B 2XHCA 1N9SA 4BY6B 3CCUT 1UGQB 1YJNT 5CKFA 2PVGB 5GAMj 3JB9D 1DJ7B 4M7DB 3GF5A 2K3XA 3JB9H 2LT4A 2E64A 1SSFA 4KT0E 4PJOE 5J26A 3CCSA 5HKCA 3JCMg 3JCMW 1VQOA 1IREB 1VUBA 2QI2A 4N4HA 4C92G 4DA4A 1Q82C 3OBWA 4M77A 3UWNA 1Q81C 4UC4A 2LX9A 2JVVA 1WQ7A 5FU7C 1Y96B 2RHUA 4C92A 2FL7A 5GMKe 1B34A 2GQVA 3FDRA 4QVDA 3OS2A 3VUBA 4EMKA 3CCRA 1VQPA 3CC2A 4M78E 2RJEA 2V8IA 1BIAA 4HKEA 3CMAA 5CR2A 3G71T 3A8MB 4IUQA 3VUZA 4ZTFA 1M1GA 3DB3A 3JCMh 4HCZA 3QYGB 4Z02A 3FLGA 2B8AA 4M7DF 1IZ6A 1N6AA 3MP1A 3FJPA 3KUFA 3LX7A 3OMCA 3Q1JA 2CGHA 4L6V5 4P5NA 1KC8C 3HFNA 4E47A 4ZN1A 1K8AU 1QP3A 3JCMe 4M75B 4C8QD 3EFRA 3RKYA 1WPYA 2RI5A 2VYTA 1VQPT 1Y71A 4XK8E 4C8QA 3QIIA 4XTUA 3CBOA 2DXUA 2KSSA 4C8QC 3O8VA 4ZGEB 3I55A 4EMGA 3I56A 3QJ6A 3M5AA 3SWNB 3CCEA 2D9TA 1Y7XA 5FLXE 1KQ2A 4RG2A 5KE2A 2LNVA 4PJOB 3PMTA 2F69A 2RB6A 5HK0A 1VQ8A 2WSEE 2XDBA 4M75A 1YIJT 1BKBA 1I8FA 3CCET 2FHDA 2PQWA 2HAXA 3LH0A 4M75D 3M55A 2C06A 4M77F 3UDCA 3SWNA 3JSCA 5DY9A 5GMKj 4ZN3A 4ELYC 5GAMd 1YJNA 5LJ3e 4PJOC 1VQMT 2CS7A 5DLQE 1R8OB 1UGPB 1LJOA 3MEAA 5LJ3d 4A4KA 1M90C 4PJOD 3QO3A 4XU0A 3LYIA 4L59A 2EWNA 2KDSA 5CQXA 2A3LA 4A4FA 3QSUA 4Y91A 2LRQA 3JB9I 1B34B 3QDRB 5HY6A 1KD1U 2ZCFB 2CZ7B 3HRUA 4OP0A 3L42A 1VQ8T 4M7AA 2MWPA 4C5IA 2E5QA 1XTDA 4C92E 1Y07A 3CPWS 2F5KA 3M4GA 1Q86C 4M7DC 4C92C 3E1SA 1XNIA 2QQAA 5GAOl 2CYZB 2I2LA 1YI2T 4LD9K 1W2BS 2BIVA 3FIFA 2YLBA 4LDVA 3I55T 4M7DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5A A;  2GFU A;  4C5H A;  2RHX A;  2EQK A;  2CKK A;  4PLI A;  3S3O A;  1WJQ A;  4E7K A;  2LTO A;  3L2U A;  5C0M A;  2R57 A;  5KH6 A;  4QQD A;  3PMI A;  3MEW A;  3OYH A;  3OYK A;  2P0K A;  3OYL A;  2BUD A;  4IKF A;  2JTF A;  3OYE A;  3L2Q A;  4BDY A;  2EFI A;  3OA6 A;  5KE3 A;  2LCC A;  2DIQ A;  3PNW C;  1G5V A;  1KHC A;  2HQE A;  2EQJ A;  4LD6 A;  2K3Y A;  3SD4 A;  4QVZ A;  4B9W A;  5D6W A;  3L2V A;  3MEU A;  4IUU A;  2X4X A;  3NTK A;  3S6W A;  1OZ2 A;  4A4G A;  2G3R A;  2EQM A;  4OVA A;  2K3X A;  4IUP A;  4C5G A;  3OY9 A;  2RI2 A;  2XK0 A;  1H3Z A;  1SSF A;  5CIU A;  5J26 A;  1WJR A;  5D6Y A;  1OZ3 A;  5KCO A;  4N4H A;  3H8Z A;  3F70 A;  3UWN A;  2GFA A;  2RJD A;  3MP6 A;  2O4X B;  2QQS A;  4UC4 A;  3NTI A;  2YRV A;  3ASK A;  3LGF A;  2R5M A;  3OYD A;  2RHU A;  3UT1 A;  2IG0 A;  3M9Q A;  3MP8 A;  1OYX A;  2X4Y A;  3OYA A;  5FRM A;  3FDR A;  3OS2 A;  2HQX A;  2RHI A;  4Q5W A;  1MHN A;  3OMG A;  1WGS A;  2BKD N;  2RJE A;  4C5E A;  4ZTJ A;  4IUQ A;  3S3M A;  2MWO A;  2L8D A;  2O4X A;  3MEV A;  4ZTF A;  1N27 A;  3DB3 A;  4E7L A;  4IUV A;  4N4I A;  4HCZ A;  4E7J A;  3MET A;  2X4W A;  3OYN A;  3FC3 A;  4NS5 A;  4QW2 A;  3OB9 A;  3FLG A;  3NTH A;  2B8A A;  4Z02 A;  3LLR A;  5FRN A;  3E9G A;  3MP1 A;  2L89 A;  3KUF A;  4EDU A;  3LX7 A;  2NLU A;  3OMC A;  3Q1J A;  2E6N A;  2DIG A;  3GOX A;  4BE1 A;  4PL6 A;  5IAY A;  4FL6 A;  2EQU A;  4QQG A;  1WJS A;  2RI5 A;  2VYT A;  3ZEH A;  3OS1 A;  5M9O A;  3S3N A;  3QII A;  3OS0 A;  4QQ6 A;  3L2W A;  3O8V A;  5IN1 A;  3QJ6 A;  3ME9 A;  2D9T A;  2QQR A;  4BDZ A;  1OI1 A;  4B9X A;  4RG2 A;  5KE2 A;  2LVM A;  3PMT A;  4PLL A;  2RHY A;  2LDM A;  4BAC A;  5J39 A;  4IUT A;  2FHD A;  2PQW A;  3LH0 A;  5FRO A;  3PFS A;  3E9F A;  3OYB A;  4A4E A;  3MO8 A;  4BE2 A;  4E7I A;  2L3R A;  3P8D A;  3FEO A;  2R58 A;  3QKJ A;  2M0O A;  4BD3 A;  2XDP A;  5C6S A;  3MEA A;  2RO0 A;  2RJC A;  2DAQ A;  3OQ5 A;  3DB4 A;  4CRI A;  2WAC A;  3LYI A;  3BDL A;  4L59 A;  4X34 A;  2JZ2 A;  3CEY A;  4A4F A;  2M1H A;  2LRQ A;  3H6Z A;  4GY5 A;  2EKO A;  3OYG A;  3OYI A;  4FU6 A;  2X35 A;  5KCH A;  5D6X A;  3C4S A;  3L42 A;  3OYC A;  1RI0 A;  2MWP A;  2RHZ A;  3EAE A;  2E5Q A;  3QBY A;  2RJF A;  4C5I A;  3OYJ A;  2F5K A;  3LGL A;  4IUR A;  3P8H A;  1XNI A;  3L2R A;  4II1 A;  3OYM A;  2M16 A;  2RI3 A;  3OYF A;  2BIV A;  4A4H A;  4BE0 A;  2GF7 A;  4N4G A;  4E7H A;  3DLM A; 
#chains in the Genus database with same CATH topology
 2HMA A;  3PE0 A;  4HVU A;  2GFU A;  2ZZD A;  1WZO A;  4Z88 A;  4K11 A;  1AZE A;  3L2Q A;  2LZ6 B;  1OX8 A;  1F1B B;  2ZPE B;  1IXD A;  2J6F A;  4AFU C;  4BI8 B;  1KHC A;  3RMQ A;  2J7I A;  3SD4 A;  4QVZ A;  3G4S T;  2YHT A;  4HVW A;  2QDY B;  3JCM P;  2E70 A;  1SSH A;  2SRC A;  3OSS C;  1KHI A;  1H8K A;  4DBQ A;  5GAO n;  2GFA A;  5HCK A;  3M54 A;  1RAI B;  2YRV A;  2W0Z A;  1GCQ A;  3CCL A;  3UT1 A;  2IG0 A;  3SWN C;  1UGR B;  1UEB A;  4JRK A;  4RTY A;  5IHI A;  1WHH A;  1NBE B;  1Q82 R;  3EG2 A;  4Z8A A;  2D6F A;  1N27 A;  4MDW A;  2RH2 A;  2PTK A;  2QGG A;  1YWP A;  2LC4 A;  3BE3 A;  1E6G A;  2QA4 Q;  1BI2 A;  2W10 A;  4EDU A;  1QVG S;  1RLQ C;  1K4U S;  5CKH A;  2EQU A;  1OU8 A;  3EG1 A;  1HSQ A;  4ELZ C;  3UF4 A;  2RNA A;  2MAM A;  3JCM d;  2F5T X;  1V1C A;  1M27 C;  2P0Q A;  2ENM A;  5IXF A;  3CME T;  1AWO A;  2CP7 A;  5FWC A;  3M57 A;  5CQY A;  5KYN A;  1KK7 A;  3CME A;  3DLL A;  5A2Q E;  2XDD A;  1XOV A;  2LNH B;  1BCO A;  2K7A A;  3BDL A;  1PC0 A;  1VQ9 Q;  2JZ2 A;  1SKU B;  4D6W A;  4OB3 B;  1IGU A;  2CP5 A;  3H0H A;  3OYC A;  5KYW B;  1QLY A;  3OYJ A;  4M7D E;  2VWF A;  1GCQ C;  1WNL A;  2M02 A;  1YIT A;  2KVQ G;  3L2R A;  2L5Q A;  3GLX A;  2JUF A;  3ZBD A;  1GL5 A;  2RHX A;  2CP3 A;  3KXT A;  1K9M U;  1UB4 A;  3GP8 A;  2KK4 A;  1PRL C;  1XQH A;  1G3W A;  2FEI A;  2K4Y A;  1MMN A;  1NEB A;  4KH0 B;  3VS1 A;  3PNW C;  3CMA T;  1SRM A;  4LE9 A;  1VQ8 Q;  1N8R R;  3CCJ T;  3OY9 A;  2QTV A;  1G83 A;  1H3Z A;  2JN0 A;  2QYZ A;  1I4K 1;  2RQT A;  5A0D A;  2EIF A;  1YWO A;  2R5M A;  4FW1 A;  1QVG A;  2A7Y A;  1CSK A;  2JMA A;  2KYM A;  4E6R A;  2CSI A;  1D1B A;  2BKD N;  1VQM A;  3CC4 Q;  3M58 A;  2DTH A;  4TVR A;  2O88 A;  5GAO m;  1AWJ A;  2CZ6 B;  1VQN A;  3OB9 A;  4JS5 A;  1K73 C;  3LLR A;  2P4T A;  3VYG A;  2DTO A;  2NLU A;  4DQ2 A;  1S72 T;  5IAY A;  3MKD A;  1P92 A;  4OF1 A;  3S3N A;  2DET A;  2NUT B;  3RES A;  1K9M R;  4PK4 A;  4JJN K;  1FX7 A;  1RAB B;  4J7I A;  1VQM Q;  3OYB A;  4OML A;  1EZZ B;  2CZ1 B;  3HRS A;  4JJB A;  4E7I A;  2KXD A;  3QKJ A;  5C6S A;  1M90 U;  4KBM B;  2EBP A;  2RJC A;  2DAQ A;  1ABQ A;  4J5Y A;  5GAN f;  3SDZ A;  2RN8 A;  4DEY A;  4AFZ C;  2DL3 A;  2RJF A;  3EG0 A;  2O9V A;  3OYF A;  1UGV A;  2AZS A;  4BE0 A;  2K5F A;  4XQ3 A;  2VGN A;  3J81 E;  1E6H A;  4QQD A;  1OU9 A;  2FZG B;  2X4J A;  2GGR A;  5IHK A;  3N5B B;  4EPC A;  4ESR A;  1QWE A;  1HXD A;  1NJI C;  2YLC A;  5CK9 A;  4C5G A;  2FG0 A;  1WYX A;  1MNE A;  5CIU A;  1WJR A;  2YRD A;  2EGC A;  5KCO A;  4X9D A;  1FMK A;  3M4Y A;  3LGF A;  3CPW P;  2ZPI B;  3OYD A;  4LUD A;  1Z9Q A;  4F16 A;  4M77 E;  1CKA A;  4RTX A;  3V7S A;  4Q5W A;  3CC2 T;  2O01 E;  1VQN Q;  1QVF P;  2GCX A;  5AT1 B;  2QA4 T;  4E7L A;  1VQN T;  4IUV A;  2X4W A;  4M78 D;  1MMA A;  3NTH A;  3CCR Q;  3EFS A;  2HZY A;  2KBT A;  4M78 C;  2K57 A;  5I2M A;  3SB2 A;  3HHT B;  1PD1 A;  4QQ6 A;  3CCV Q;  3ME9 A;  1BBZ A;  1ZSZ C;  4BDZ A;  4B9X A;  1ZSZ A;  5ECA A;  2MPX C;  4IIM A;  2DXT A;  5LJ5 f;  4M7A G;  3CBP A;  4JRP A;  3INZ A;  1FWZ A;  2QXF A;  3UA6 A;  5KYU B;  2BTT A;  3H9N A;  1QW1 A;  4M75 E;  1EIF A;  4OGC A;  1OPL A;  2HEQ A;  3CCS T;  4N0A C;  2DIL A;  2DKG A;  4X34 A;  4C0D C;  4A63 B;  3LWI A;  3OYG A;  2BZX A;  2J6O A;  3RER A;  4PJM A;  3M56 A;  2LQK A;  1QKX A;  1W6X A;  3QYH B;  4J6W A;  4M77 D;  1YIT T;  2AKL A;  2VXE A;  3OYM A;  2CP6 A;  2RI3 A;  4OB1 B;  4N4G A;  1YIJ Q;  1RAE B;  2ZAE A;  4BB7 A;  2QQ9 A;  2R57 A;  5EG2 A;  4F7U A;  5GAN 5;  2PNI A;  3OSV A;  3CMA Q;  2JTF A;  1JQQ A;  1OEB A;  4L5G A;  3VS7 A;  4C8Q F;  1G5V A;  4OMP A;  1U5S A;  1Y57 A;  4OB2 B;  1VYU A;  2HD0 A;  3X20 B;  3CCU T;  2KT8 A;  3JB9 D;  1DJ7 B;  2YSQ A;  3EG3 A;  2LT4 A;  4OMN A;  4PJO E;  3CCS Q;  2DFU A;  3M0S A;  2MK5 A;  3CCS A;  3JCM g;  1IRE B;  2QI2 A;  2KRO A;  4DA4 A;  3M0Q A;  4D8K A;  1NEG A;  4HCK A;  4R0K A;  1K1Z A;  2RMO A;  1WQ7 A;  1TUC A;  1VQL Q;  1AWW A;  2XMF A;  4EMK A;  2RJE A;  4HKE A;  5CR2 A;  1WHM A;  4ZTF A;  1MMD A;  3QYG B;  4Z02 A;  2YXY A;  2CGH A;  2E3H A;  1VQ6 Q;  1T0H A;  4C8Q D;  1VQP T;  1Y71 A;  3QII A;  2LQN A;  3CBO A;  3O8V A;  1KSW A;  4EMG A;  1KQ2 A;  4PJO B;  3LH5 A;  1PM3 A;  1YIJ T;  1I8F A;  1RAF B;  3LH0 A;  1LCK A;  4ELY C;  1TXQ A;  3I9Q A;  2GNC A;  1R0B G;  4QT7 A;  4A4K A;  2BE7 D;  2EWN A;  4A4F A;  3QSU A;  1OV3 A;  1KD1 U;  2CZ7 B;  8ATC B;  2PZ1 A;  3M0R A;  2YRC A;  4C5I A;  3CPW S;  4M7D C;  1LPL A;  2VKN A;  4LD9 K;  2CYZ B;  2BIV A;  4M7D D;  1SEM A;  2YUP A;  3BFM A;  5DLO A;  2JT4 A;  1UHF A;  3CCV T;  2DJZ A;  2RD1 A;  5KYU A;  1W1F A;  2VV5 A;  2FYK A;  3EFO B;  2QGF B;  3S6W A;  4OVA A;  4M78 F;  4M7A E;  2D0N A;  4XTV A;  2E4H A;  3DKM A;  1FMV A;  1PG5 B;  2MF2 A;  4JJC A;  4M77 B;  1VQ6 T;  2A0F B;  1YNZ A;  1TOV A;  1O9S A;  2HQX A;  4MML A;  2F2W A;  2JNG A;  2DL5 A;  4DBR A;  2LJ0 A;  1ZSG A;  3OYN A;  1YJW A;  2ESW A;  1X6G A;  1M4Z A;  1RLP C;  4M75 F;  4BI4 A;  4BY6 C;  4MZP A;  3E19 A;  3EH1 A;  3X25 B;  3CCJ A;  1ZSZ B;  2ECZ A;  1YI2 A;  2RM4 A;  4AFQ C;  3JCM V;  2AT1 B;  2OAW A;  5IN1 A;  3LWH A;  2CUD A;  1VQ5 T;  1BI0 A;  2JMC A;  1M5Q 1;  2XIC A;  2LVM A;  3V7C A;  1KC8 R;  1VQ9 T;  3L1A A;  4M75 C;  2DEQ A;  5IHN A;  1Q81 R;  1R77 A;  4IUT A;  1ZHI A;  1AD5 A;  3EHR A;  1U1S A;  5CVI A;  3CCM A;  4JS4 A;  2F2V A;  4OB0 B;  4C92 B;  4XU2 A;  2L3R A;  3FEO A;  2J06 A;  2VUB A;  2VC8 A;  4CRI A;  1M8V A;  1G3Y A;  2KGT A;  2L3P A;  1B3Q A;  2JW4 A;  1ZBJ A;  1YI2 Q;  2MIO A;  2MI6 A;  5A0L A;  2WSC E;  1AHJ B;  4E7Z A;  2V8J A;  3PGG A;  3CCQ A;  4MDX A;  1M2V A;  2H3E B;  4JRI A;  2JOY A;  4MZM A;  5LJ3 h;  3FB9 A;  3C94 A;  1FYN A;  5GJV B;  2PVO B;  2DLP A;  4R55 A;  5LJ3 g;  1AZG B;  3JCM f;  2X4X A;  1BI3 A;  4LXC A;  4GLM A;  1WFW A;  4BUG A;  2DM1 A;  1AT1 B;  3JCM X;  2X9H A;  1BYM A;  1HK9 A;  3OYY A;  1PHT A;  1D3B A;  3GNF B;  1LOJ A;  1IHV A;  2NUZ A;  4M7A B;  3M9Q A;  2L3Q A;  2COY A;  2QDL A;  3A98 A;  5LJ5 e;  5FRM A;  3I5R A;  4F7U F;  1YJ9 A;  5A0G A;  4EIK A;  2MMP A;  3NFC A;  1VQ5 Q;  3G6E T;  2LCL A;  4E7J A;  5GAO q;  4M78 B;  3FC3 A;  1I07 A;  3VS5 A;  4J7F A;  4FM4 B;  2F2X A;  2DPP B;  3V8J A;  1KIK A;  3EFO A;  1YJ9 T;  1Q7Y U;  2E12 A;  1G3T A;  3MCA B;  3PVL A;  1OUL A;  3EGD B;  1Q86 U;  1TS9 A;  4BAC A;  1VIF A;  3A8L B;  5GAN 8;  1UHC A;  1UGS B;  3GNG A;  3WXM B;  1VYV A;  1GBQ A;  1KQS A;  2RO0 A;  5FW9 A;  4C0Z A;  1WHJ A;  3OQ5 A;  2EAY A;  1YCS B;  3TEE A;  3G6E Q;  2DF6 A;  2KYB A;  1PNJ A;  3G4S A;  7AT1 B;  1WDX A;  1B7T A;  1WA7 A;  4PJN A;  5CKE A;  2JM9 A;  3FRN A;  4GBQ A;  4M7A F;  4N0A A;  4A4H A;  2GF7 A;  1W2B A;  3I5S A;  2CKK A;  1U1T A;  4HT8 A;  5KH6 A;  9ATC B;  1I1J A;  3PTA A;  2P0K A;  3QHS A;  1I0C A;  2DZ9 A;  1VQ4 T;  4M7A C;  3HRT A;  1LNX A;  2LCC A;  1VQL A;  4FT4 A;  2ABL A;  2CP0 A;  3G7Z A;  3MEU A;  3ULR B;  1BU1 A;  5GAN 3;  4RKU E;  2EYX A;  5GAN j;  4JJD A;  1OZ3 A;  2DZC A;  4FW2 A;  1M1K U;  2VAS A;  4KRT A;  1U3O A;  2QQS A;  4FYW B;  2Y90 A;  5KYW A;  2KY9 A;  2JS2 A;  4EMK B;  4DOW A;  2IPO B;  3J7A F;  1KG1 A;  2QEX T;  5LJ5 g;  1WGS A;  1WHG A;  4E7S A;  3CD6 Q;  4PJO F;  1WHL A;  4RTW A;  2DYB A;  2JTM A;  3M53 A;  2MOX A;  5LJ5 j;  2LJ1 A;  2OI3 A;  1WXT A;  1VQ7 T;  2OTJ Q;  3CCL Q;  2A08 A;  4FL6 A;  4EMK C;  3A8G B;  3R6O A;  3QZ9 B;  1WJS A;  1D0X A;  5KYY B;  1K0S A;  4O6J A;  1TTH B;  2QQR A;  1OI1 A;  1X01 A;  4PFO A;  2DL8 A;  3CXC A;  1VQK T;  3MO8 A;  4BE2 A;  2AIR B;  2R58 A;  2IVW A;  2NUP B;  5GAN h;  1NLP C;  4MMK A;  1D0Z A;  5L23 A;  5GAM f;  2E1H A;  1K73 R;  2DA9 A;  3SHW A;  2O31 A;  2ED0 A;  3QWX X;  1ZLM A;  2KE9 A;  2ZGW A;  1SRL A;  3HL8 A;  1C1A A;  4PJL A;  4HCC A;  4XTX A;  2RQU A;  5GAN e;  2A28 A;  2AKK A;  2LT1 A;  1X27 A;  3CCL T;  2DYI A;  3RIR A;  1K9M C;  2EQK A;  1NZ9 A;  2Z0W A;  2HNI A;  1MV3 A;  2LQW A;  2Y4X A;  2RQR A;  3OYK A;  2RQV A;  2HDA A;  1PSE A;  2K9G A;  2M51 A;  4IUU A;  4BY6 B;  1N9S A;  2P4R A;  1UGQ B;  5GAM j;  2PVG B;  3JB9 H;  1SSF A;  4KT0 E;  3CCE Q;  5J26 A;  1VUB A;  4N4H A;  4M77 A;  1Q81 C;  2LX9 A;  2JVV A;  5FU7 C;  2RHU A;  1B34 A;  2DMO A;  2EVR A;  4FYV B;  3FDR A;  3OS2 A;  3VUB A;  2DRK A;  3CCR A;  1U06 A;  4M78 E;  1RUW A;  3A8M B;  4IUQ A;  4HCZ A;  3FLG A;  2B8A A;  1M30 A;  1IZ6 A;  3Q1J A;  2DRM A;  2DNU A;  1K8A U;  3EFR A;  3RKY A;  1G8X A;  4XTU A;  2CH4 W;  4ZGE B;  3I56 A;  2DBK A;  3M5A A;  3SWN B;  3CCE A;  4RG2 A;  5KE2 A;  2LNV A;  2F69 A;  5HK0 A;  2WSE E;  1BB9 A;  4M75 A;  3CCE T;  2FHD A;  2PQW A;  1ABO A;  4M75 D;  3M55 A;  2C06 A;  2M0Y A;  1CKB A;  3UDC A;  5GMK j;  2E3I A;  4ZN3 A;  1SHF A;  5GAM d;  1YJN A;  4PJO C;  3CCM Q;  3AT1 B;  1X69 A;  2CS7 A;  1UGP B;  3MEA A;  5I11 A;  4CC4 B;  4L59 A;  2A3L A;  1TWB A;  1B34 B;  5HY6 A;  2GTO A;  3EG9 A;  3HRU A;  5FWB A;  1KJW A;  1PCX A;  2MWP A;  1XTD A;  2DJQ A;  2F5K A;  3E1S A;  2FPE A;  3I55 T;  2YLB A;  2G6F X;  4OMM A;  1VQO T;  2YUN A;  5I2S A;  1GCP A;  2FO0 A;  2VB6 A;  4MZT A;  2DXC A;  1WQW A;  3RBB B;  2E5K A;  1ZA1 B;  3OYL A;  2BUD A;  4IKF A;  1IB8 A;  2V26 A;  3SFM A;  3A5Z B;  1NJI U;  3L2V A;  3TSZ A;  3VJP A;  1W4S A;  3CCR T;  2ROL A;  3R6N A;  2EQM A;  4WF2 A;  2RI2 A;  4ZGD B;  2XG8 D;  2D8J A;  3VKI A;  1BIB A;  3H8Z A;  1Z9Z A;  2FRW A;  3F70 A;  2RJD A;  2HBW A;  3MP6 A;  2O4X B;  2XID A;  3UPU A;  3JCM Q;  3BY7 A;  3PIP A;  1SPK A;  1V29 B;  2EJ9 A;  1H3H A;  4QKU A;  2BE9 B;  2KAF A;  3QZ5 B;  4C5E A;  4VUB A;  4Z89 A;  4ZTJ A;  1M1K R;  1WXU A;  4R56 A;  4J6Y A;  2K5L A;  4QW2 A;  5FRN A;  2HQH A;  3G71 A;  2EYZ A;  2L89 A;  5I21 A;  1QQJ A;  1M2V B;  5GMK m;  4DOV A;  2RF0 A;  1WIE A;  3ZL7 C;  3C0C A;  3RNJ A;  4M78 A;  5J39 A;  1V76 A;  2EKH A;  4LDW A;  2EQI A;  3REA B;  1H92 A;  3RKW A;  3QG1 A;  1H64 1;  2EYQ A;  2QAZ A;  1PKS A;  1NM7 A;  1D3B B;  2EGA A;  3QPH A;  4J9B A;  2J6K A;  1I5L A;  4HCB A;  4GY5 A;  3EGD A;  1GXI E;  2YUO A;  3C4S A;  4KGZ B;  2ATC B;  2RHZ A;  4QVC A;  2V1Q A;  3LGL A;  4Y28 E;  3P8H A;  5IH2 A;  1GRI A;  1S1N A;  3G4S Q;  1YN8 A;  4PJJ A;  4KGV B;  2HL3 A;  4E7H A;  3JB9 F;  1SG5 A;  2HKN A;  1M8M A;  4J9I A;  5LJ5 h;  4PLI A;  1WJQ A;  3CCQ T;  3L2U A;  3PMI A;  2BZY A;  1NLO C;  4RG8 A;  3OYE A;  4O5V A;  4M4Z A;  1C0M A;  5GAM g;  1VQL T;  1S72 A;  2EQJ A;  3MHX A;  2FPD A;  4M7A D;  1W70 A;  2BZ8 A;  2X3W D;  1QCF A;  1N5Z A;  1VQ4 A;  5GAN 6;  2DTI A;  4F04 B;  4A4G A;  1KQS S;  3A1P A;  2HL5 C;  3VS6 A;  4RCC A;  3EGX A;  3HFO A;  3PT9 A;  1TH7 A;  2EPD A;  3ASK A;  1I81 A;  5GAO r;  3C95 A;  2CP2 A;  1NPR A;  2E6Z A;  3CCU A;  4J9H A;  2ZPH B;  3KFV A;  4CC2 A;  4AMC A;  4FYX B;  2FB7 A;  4N4I A;  2LJ3 A;  3BW1 A;  3RUX A;  4KH1 B;  4FSX A;  2V1R A;  4WTO B;  2KRM A;  3E9G A;  4AT1 B;  3D7S B;  3I55 Q;  2RK1 A;  2DVJ A;  4PL6 A;  3O5Z A;  4QQG A;  2PUK B;  2MCN A;  2FZC B;  2P0P A;  2E41 A;  3ZEH A;  2PVD B;  1N8R C;  3OS0 A;  4DEX A;  5GMK l;  3RMS A;  4EMH A;  4PJO G;  4GLK A;  1UFF A;  1UDL A;  5CKD A;  5GAN d;  1MND A;  1E7O A;  2I0N A;  5FRO A;  2OTL T;  1VQ6 A;  3E2U A;  4XTY A;  1OX9 A;  4OMQ A;  4F17 A;  1VQK Q;  2VGM A;  4HA8 A;  2XDP A;  3V8L A;  3JCM J;  2E65 A;  3DB4 A;  3WVD B;  2CT3 A;  2WAC A;  3CC7 T;  4F7U E;  3CEY A;  1JU5 C;  3CC2 Q;  3TCJ A;  3OYI A;  2CSQ A;  3RKX A;  1MV0 B;  2X35 A;  5GAM h;  3BDU A;  1G2B A;  1RI0 A;  4LDY A;  4NL2 A;  1RAH B;  6AT1 B;  4NL3 A;  2OJ2 A;  2QTX A;  2OAU A;  2CDT A;  3DLM A;  4C0F A;  4C0G A;  4C5H A;  3GBQ A;  3U23 A;  1RAG B;  4ATO A;  2JJ9 A;  2VVK A;  1KQS P;  4J6X A;  3THK A;  4XAX B;  3C12 A;  4C0D B;  4M7D A;  2GTJ A;  2OTL Q;  1YIT Q;  4AG2 C;  5D6W A;  1JRI A;  1M9S A;  1KQ1 A;  3JCM c;  2G3R A;  4IUP A;  2XU8 A;  3A8O B;  1BI1 A;  2KMT A;  3IQL A;  4KUD K;  4ANJ A;  4PFP A;  1Y96 A;  2MYS A;  3PIO A;  1K73 U;  1M1K C;  1UJY A;  2DO3 A;  1YFN A;  2AZV A;  1PSF A;  4M77 G;  1BCM A;  4X1V A;  2L3S A;  4ZGJ B;  3OW2 S;  2X4Y A;  3MJX A;  1T3S A;  3OMG A;  1ZUK A;  2MWO A;  3MEV A;  1PKT A;  5GMK i;  4NS5 A;  1ACM B;  4KUL A;  1TUG B;  1QKW A;  3GOX A;  1T3L A;  2O2O A;  3CCM T;  3QUI A;  1Q86 R;  4J8O A;  2K2V A;  5AYF A;  5GAO p;  1FMW A;  2KT1 A;  2D8H A;  2C0O A;  5LJ3 f;  1QP2 A;  2LDM A;  4FT2 A;  1MMG A;  2K2M A;  3PFS A;  4M7D G;  1VQK A;  2DXB A;  1RAA B;  3P8D A;  2KXC A;  4RTU A;  3I56 T;  2LQ8 A;  3NGP A;  5FU6 B;  3UAT A;  4JLG A;  1QVF S;  2P84 A;  1VIE A;  4Y92 A;  2X51 A;  1PD0 A;  1VQP Q;  2EKO A;  2RK2 A;  5CKB A;  2V8K A;  3ZFJ A;  2O9S A;  1JB0 E;  4M77 C;  1U8R A;  3TSW A;  5J3B A;  2LX7 A;  2HBP A;  4II1 A;  3URG A;  4XTZ A;  2OTJ T;  5GAM e;  4C92 D;  2R5A A;  4ME7 A;  1ZBX A;  4LDU A;  2LTO A;  1JJ2 S;  5C0M A;  1O75 A;  4M78 G;  3OS5 A;  2ZPB B;  4RMO A;  1D09 B;  3EG9 B;  3OW2 A;  2LMJ A;  2EFI A;  3CCU Q;  2DK3 A;  2XI9 A;  3I35 A;  1YJN T;  5CKF A;  4M7D B;  2K3X A;  1M3C A;  2HKQ B;  1OQK A;  3JCM W;  3OBW A;  4F14 A;  2DER A;  2HSE B;  1Y96 B;  2DX1 A;  1TUD A;  2FL7 A;  1S72 Q;  1IGQ A;  2GQV A;  1C6V X;  3CC2 A;  2V8I A;  1QWF A;  3CMA A;  1JEG A;  3G71 T;  3VUZ A;  1VOM A;  3DB3 A;  3JCM h;  4FYY B;  3FJP A;  3LX7 A;  3OMC A;  4L6V 5;  1KC8 C;  3HFN A;  4E47 A;  1IO6 A;  4ORZ A;  1WPY A;  2RI5 A;  2VYT A;  1AOJ A;  4C8Q A;  1M3A A;  2KSS A;  4C8Q C;  2IIM A;  1T0J A;  3QJ6 A;  2D9T A;  1Y7X A;  3M0U A;  3PMT A;  2XDB A;  4J9E A;  1BKB A;  4LN2 A;  2CH4 A;  4LNP A;  4M77 F;  3JSC A;  5DY9 A;  2AK5 A;  5LJ3 e;  5DLQ E;  1R8O B;  1M90 C;  1LJO A;  2EYY A;  3NHN A;  1VQ7 Q;  3CCQ Q;  1OPK A;  2COW A;  3H41 A;  3QO3 A;  1UTI A;  3LYI A;  5CQX A;  1A0N B;  4Y91 A;  3JB9 I;  2QK0 A;  3QDR B;  2FRY A;  4OP0 A;  4C92 E;  1Y07 A;  3M4G A;  4B6M A;  1XNI A;  2QQA A;  2YUQ A;  2F1L A;  5GAO l;  2I2L A;  1D1C A;  2J05 A;  1TU0 B;  3HPW A;  3S3O A;  1N9R A;  4RUG A;  4E7K A;  1JBM A;  4JDS A;  1NJI R;  3V7R A;  3MEW A;  1UEC A;  1PWT A;  1JXM A;  3CC4 T;  3OA6 A;  1GBR A;  5KE3 A;  3CBM A;  4JZ4 A;  3GIB A;  4C8Q G;  1JO8 A;  3JAM E;  4LUE A;  1UUE A;  1I5O B;  3VS3 A;  1OZ2 A;  3X26 B;  1QVF A;  1VQO Q;  3VYH B;  2C0I A;  3I56 Q;  1NYF A;  3JB9 J;  5KYY A;  3NMZ C;  1LVK A;  2QEX A;  1KD1 R;  2EYW A;  2OTL A;  1PRM C;  2HSP A;  3OYA A;  1WX6 A;  1NPP A;  3EGU A;  3S3M A;  3VS4 A;  3P8B B;  5LJ3 j;  2L8D A;  3QWY A;  2NUP A;  3MET A;  4RTV A;  2LCS A;  2C0T A;  1GFC A;  1ZX6 A;  4C8Q E;  5KYX A;  1Q81 U;  4A53 A;  4PNO A;  2QEX Q;  5M9O A;  4V2S A;  2OTJ A;  3EHQ A;  4D8D A;  1ARK A;  2X3X D;  1JJ2 P;  2RHY A;  4JUV A;  5CAI A;  1K8A R;  2YT6 A;  5D7U A;  3HKS A;  1KD1 C;  3CC4 A;  1UE9 A;  3E9F A;  4A4E A;  1Q7Y C;  1Y0M A;  2M0O A;  4J83 A;  3X24 B;  2DD5 A;  3QDF A;  1X2Q A;  2M9U A;  1YJ9 Q;  2A37 A;  4X9C A;  2ED1 A;  4OMF B;  4XTW A;  1VQ4 Q;  2FVU A;  2H8H A;  4M75 G;  2KR3 A;  4XU3 A;  5LJ5 d;  2L2P A;  5EC7 A;  1K8A C;  1SF9 A;  3M59 A;  3JB9 G;  2QAS A;  2Y4Y A;  2YWW A;  1X6O A;  2FZK B;  1YIJ A;  4OGE A;  2QG9 B;  1Q7Y R;  2K5I A;  1YP5 A;  1FXX A;  2DIQ A;  1B07 A;  5CO7 A;  4LD6 A;  4B9W A;  1ZUY A;  2H3J A;  3NTK A;  3CXC S;  2RA2 A;  2EJG A;  3JCM b;  2XK0 A;  3G6E A;  4J9F A;  4JLI A;  5CCA A;  2HCK A;  1TG0 A;  4AG1 C;  5GAN 2;  1OYX A;  4PFZ A;  3X28 B;  4BI3 A;  1WHK A;  2O4X A;  1K9A A;  4KUI A;  3AHU A;  1IRX A;  1MUZ A;  3CC7 A;  2SEM A;  4CI0 C;  2ZPF B;  1YCY A;  4JRQ A;  3VRZ A;  4HT9 A;  1ZQ1 A;  2FPF A;  2E6N A;  5GAN g;  4OMO A;  5GAN 4;  4F7U G;  3NPF A;  1X75 C;  3OS1 A;  1X6B A;  4IIO A;  4YTL A;  2LP5 A;  2RPN A;  1OOT A;  3KBG A;  5IXB A;  1YHQ A;  4C92 F;  1QVP A;  1VQ7 A;  4HVV A;  2JM8 A;  1HYO A;  3CME Q;  1SHG A;  3CPF A;  4KGX B;  2JTE A;  1MGQ A;  4RTT A;  4BD3 A;  1WLP B;  2KQW A;  2QQB A;  1QCO A;  1ZUU A;  3M0P A;  2PU9 B;  3JV3 A;  1X2K A;  2CZ0 B;  2M1H A;  3ER0 A;  2KRS A;  2K3B A;  5KYX B;  2DBM A;  1M3B A;  3CPW A;  2KEA A;  3QBY A;  3JRZ A;  1JXO A;  1M2O A;  4PJO A;  3TU4 K;  1RAD B;  1HD3 A;  4FIB A;  3HSB A;  1KFZ A;  1VQ9 A;  4J9C A;  2KRN A;  2D0Q B;  3CC7 Q;  1KC8 U;  1VQ5 A;  2DL4 A;  5LL6 S;  3OBY A;  3CD6 A;  3CD6 T;  2NUT A;  2A36 A;  4BDY A;  1R0C B;  3TQ7 P;  4WCI A;  3WVE B;  3J80 E;  2HQE A;  2K3Y A;  2K6D A;  2DL7 A;  4J9D A;  4J9G A;  5DM7 R;  4A54 A;  1YJW T;  1YHQ Q;  1M1F A;  4NOY A;  1YHQ T;  5D6Y A;  3GPL A;  1QMC A;  1Q82 U;  1UJ0 A;  2XKO C;  3NTI A;  4PKC C;  2EJF A;  3MP8 A;  1JJ2 A;  4RTZ A;  4ZNX A;  2QA4 A;  1QCN A;  2ZPG B;  2RHI A;  1EX4 A;  1MHN A;  1M90 R;  3A8H B;  3UA7 A;  2KI7 A;  1D1A A;  3TVT A;  4FSS A;  1NE8 A;  4RCB A;  4HXJ A;  1G3S A;  5HK3 A;  2JS0 A;  2DIG A;  4BE1 A;  8AT1 B;  4C8Q B;  2DEU A;  2EGE A;  4AFS C;  3L2W A;  3QXE B;  1K76 A;  1GFD A;  1YJW Q;  1VYT A;  4PLL A;  4LDX A;  3REB B;  4F7U B;  3EH2 A;  3QJY A;  2PUO B;  1X43 A;  5GMK h;  4E2F B;  3EGX B;  2CRE A;  1RL2 A;  2VXF A;  3G1J A;  1IHW A;  3H0F A;  2DVE A;  3VV0 A;  2CT4 A;  2AHJ B;  3CXC P;  3V8K A;  1UG1 A;  3LW5 E;  2WSF E;  3VU3 C;  3VS0 A;  3H6Z A;  2DD4 A;  2NYS A;  4FU6 A;  5GJW B;  1EFN A;  5KCH A;  5FU7 B;  3CCV A;  5D6X A;  4XU1 A;  1QVG P;  2NWM A;  5FU6 C;  3EAE A;  3H0I A;  2K79 A;  1YBY A;  4IUR A;  1XJW B;  2XD0 A;  3T9N A;  2KNB B;  4CC3 A;  2RQW A;  2M16 A;  3L2Z A;  5L8R E;  3FJ5 A;  3HP9 A;  1N8R U;  5GAN 7;  4FCY A;  4CC7 A;  5IT9 E;  3TRE A;  3RR6 A;  2COZ A;  2CUB A;  2JXB A;  3OYH A;  2B86 A;  2YDL A;  4DBH A;  3VS2 A;  4DBF A;  3PVQ A;  3HTR A;  1W2B P;  3SEM A;  2E10 A;  2XHC A;  3GF5 A;  2GBQ A;  1NG2 A;  2E64 A;  1AEY A;  4JZ3 A;  5HKC A;  1VQO A;  2DE0 X;  3M0T A;  4C92 G;  1Q82 C;  3UWN A;  4UC4 A;  1J3T A;  2EW3 A;  4C92 A;  5GMK e;  2D1X A;  4QVD A;  1VQP A;  1BIA A;  1M1G A;  2L0A A;  4M7D F;  1YJN Q;  1N6A A;  3MP1 A;  3KUF A;  4P5N A;  1RAC B;  3OW2 P;  4ZN1 A;  3RDV A;  1QP3 A;  3JCM e;  4M75 B;  4JPB W;  4XK8 E;  2DXU A;  3I55 A;  1K0X A;  5FLX E;  3G71 Q;  1AWX A;  1HJD A;  2RB6 A;  1NYG A;  1VQ8 A;  3CCJ Q;  1WI7 A;  2HAX A;  1VA7 A;  2ROT A;  1TSF A;  1ZA2 B;  3SWN A;  1WXB A;  1Q95 G;  1RI9 A;  1AVZ C;  1VQM T;  2GQI A;  5LJ3 d;  4PJO D;  4XU0 A;  3MPU B;  2KDS A;  1D0Y A;  2LRQ A;  5I22 A;  3CQT A;  2ZCF B;  3L42 A;  3VRY A;  1VQ8 T;  4M7A A;  1BK2 A;  2E5Q A;  1Q86 C;  4C92 C;  2OX7 A;  1YI2 T;  1W2B S;  3FIF A;  4LDV A; 
#chains in the Genus database with same CATH homology
 3HPW A;  3RER A;  2GFU A;  1VQO T;  2ZZD A;  5I2S A;  3S3O A;  1N9R A;  4E7K A;  3BFM A;  1JBM A;  4JDS A;  3V7R A;  4MZT A;  5DLO A;  2DXC A;  3MEW A;  1WQW A;  3CCV T;  2DJZ A;  2RD1 A;  3OYL A;  3CC4 T;  2BUD A;  4IKF A;  3L2Q A;  2ZPE B;  3OA6 A;  5KE3 A;  3CBM A;  4BI8 B;  2VV5 A;  1KHC A;  3RMQ A;  3SFM A;  3GIB A;  3A5Z B;  2FYK A;  4C8Q G;  3SD4 A;  4QVZ A;  3G4S T;  3JAM E;  1NJI U;  3L2V A;  3VJP A;  3CCR T;  1W4S A;  2YHT A;  3S6W A;  3X26 B;  1OZ2 A;  1QVF A;  2EQM A;  2QDY B;  4OVA A;  3JCM P;  2E70 A;  4WF2 A;  2RI2 A;  3OSS C;  1KHI A;  2XG8 D;  4M78 F;  4ZGD B;  3VYH B;  4M7A E;  3JB9 J;  4XTV A;  3VKI A;  5GAO n;  1BIB A;  3H8Z A;  3DKM A;  3F70 A;  2GFA A;  2RJD A;  3MP6 A;  2QEX A;  2O4X B;  2XID A;  3M54 A;  2YRV A;  2MF2 A;  4M77 B;  3UPU A;  3JCM Q;  3BY7 A;  3CCL A;  3PIP A;  1VQ6 T;  1V29 B;  2EJ9 A;  2IG0 A;  3SWN C;  3UT1 A;  1UGR B;  1UEB A;  2OTL A;  3OYA A;  1NPP A;  4JRK A;  1O9S A;  2HQX A;  4MML A;  2KAF A;  2JNG A;  3QZ5 B;  4C5E A;  4VUB A;  4ZTJ A;  3S3M A;  3P8B B;  5LJ3 j;  2L8D A;  2D6F A;  1N27 A;  4MDW A;  4R56 A;  3MET A;  3OYN A;  4J6Y A;  2RH2 A;  2K5L A;  4QW2 A;  1YJW A;  5FRN A;  2LC4 A;  3G71 A;  1Q81 U;  1M4Z A;  4C8Q E;  4A53 A;  1BI2 A;  2L89 A;  4EDU A;  4M75 F;  1QVG S;  4BI4 A;  4BY6 C;  4MZP A;  5I21 A;  3E19 A;  5CKH A;  2EQU A;  4PNO A;  5GMK m;  3X25 B;  3CCJ A;  5M9O A;  4V2S A;  4DOV A;  1YI2 A;  2RM4 A;  2OTJ A;  4ELZ C;  3JCM V;  5IN1 A;  3LWH A;  1VQ5 T;  1BI0 A;  2MAM A;  1M5Q 1;  2XIC A;  2LVM A;  3V7C A;  3JCM d;  1VQ9 T;  2RHY A;  3L1A A;  4JUV A;  4M75 C;  2F5T X;  5CAI A;  2DEQ A;  4M78 A;  2P0Q A;  5J39 A;  4IUT A;  3HKS A;  1ZHI A;  3CME T;  1KD1 C;  3CC4 A;  3M57 A;  1U1S A;  4LDW A;  3E9F A;  5CQY A;  5CVI A;  3CCM A;  4JS4 A;  4A4E A;  1Q7Y C;  4OB0 B;  4C92 B;  4XU2 A;  2L3R A;  3RKW A;  3FEO A;  5A2Q E;  3QG1 A;  2M0O A;  4J83 A;  2XDD A;  3X24 B;  3DLL A;  1XOV A;  2VUB A;  1H64 1;  2EYQ A;  2DD5 A;  2VC8 A;  4CRI A;  1D3B B;  3QPH A;  3BDL A;  1I5L A;  1M8V A;  1G3Y A;  2JZ2 A;  4HCB A;  2M9U A;  4GY5 A;  4D6W A;  4OB3 B;  1GXI E;  4X9C A;  3C4S A;  3OYC A;  2MI6 A;  2RHZ A;  4OMF B;  4XTW A;  4QVC A;  2FVU A;  3OYJ A;  5A0L A;  4M7D E;  1WNL A;  2WSC E;  3LGL A;  4M75 G;  3P8H A;  2KVQ G;  4Y28 E;  1YIT A;  1AHJ B;  3L2R A;  2L5Q A;  3GLX A;  2JUF A;  4E7H A;  3ZBD A;  2V8J A;  4XU3 A;  5LJ5 d;  3JB9 F;  3PGG A;  5LJ5 h;  2RHX A;  4PLI A;  1WJQ A;  3KXT A;  1K9M U;  1UB4 A;  3CCQ T;  1K8A C;  3CCQ A;  3L2U A;  3GP8 A;  4MDX A;  2KK4 A;  3M59 A;  3PMI A;  3JB9 G;  1XQH A;  1G3W A;  4JRI A;  2JOY A;  2K4Y A;  4MZM A;  5LJ3 h;  3FB9 A;  4RG8 A;  2Y4Y A;  3C94 A;  3OYE A;  4O5V A;  1X6O A;  1YIJ A;  4OGE A;  2K5I A;  2DIQ A;  1FXX A;  3PNW C;  5GAM g;  1VQL T;  3CMA T;  5CO7 A;  2EQJ A;  3MHX A;  4LD6 A;  1S72 A;  4B9W A;  2PVO B;  4R55 A;  4M7A D;  2H3J A;  5LJ3 g;  3JCM f;  2X4X A;  1VQ4 A;  3NTK A;  5GAN 6;  3CXC S;  2DTI A;  1BI3 A;  2RA2 A;  4A4G A;  2EJG A;  3CCJ T;  3JCM b;  3OY9 A;  2XK0 A;  3G6E A;  1KQS S;  1H3Z A;  4BUG A;  2JN0 A;  4JLI A;  5CCA A;  3JCM X;  1I4K 1;  1BYM A;  4RCC A;  5A0D A;  1HK9 A;  3HFO A;  3OYY A;  3PT9 A;  1TH7 A;  1D3B A;  3GNF B;  1I81 A;  1LOJ A;  2EIF A;  3ASK A;  3C95 A;  5GAO r;  2R5M A;  5GAN 2;  1QVG A;  4M7A B;  1NPR A;  2E6Z A;  3M9Q A;  1OYX A;  5LJ5 e;  5FRM A;  3CCU A;  2A7Y A;  3X28 B;  2ZPH B;  4BI3 A;  4F7U F;  1YJ9 A;  1VQM A;  2BKD N;  5A0G A;  3M58 A;  2DTH A;  2MMP A;  4TVR A;  3NFC A;  2O4X A;  5GAO m;  2FB7 A;  4KUI A;  3G6E T;  2CZ6 B;  2LCL A;  3AHU A;  4N4I A;  4E7J A;  3BW1 A;  4M78 B;  3RUX A;  5GAO q;  3FC3 A;  3CC7 A;  1VQN A;  4FSX A;  3OB9 A;  4CI0 C;  4JS5 A;  1K73 C;  3LLR A;  2ZPF B;  2P4T A;  1YCY A;  3E9G A;  4JRQ A;  3VYG A;  2DTO A;  4J7F A;  4FM4 B;  1ZQ1 A;  4HT9 A;  2NLU A;  2E6N A;  2DPP B;  3V8J A;  5GAN g;  2RK1 A;  4DQ2 A;  1S72 T;  4PL6 A;  5IAY A;  5GAN 4;  4F7U G;  4QQG A;  1P92 A;  2PUK B;  1X75 C;  4OF1 A;  3OS1 A;  2P0P A;  2E41 A;  4YTL A;  3ZEH A;  2E12 A;  2PVD B;  3S3N A;  3OS0 A;  1YJ9 T;  1Q7Y U;  1N8R C;  5GMK l;  1G3T A;  3MCA B;  3RMS A;  3RES A;  4EMH A;  3KBG A;  4JJN K;  1YHQ A;  1Q86 U;  4PJO G;  4GLK A;  1FX7 A;  4C92 F;  5CKD A;  1QVP A;  4BAC A;  5GAN d;  1VQ7 A;  1VIF A;  3A8L B;  5GAN 8;  4J7I A;  5FRO A;  2OTL T;  1UGS B;  3GNG A;  3WXM B;  1VQ6 A;  4XTY A;  3OYB A;  2CZ1 B;  3CPF A;  3HRS A;  4E7I A;  3QKJ A;  2VGM A;  1MGQ A;  4HA8 A;  1KQS A;  4BD3 A;  2XDP A;  5C6S A;  1M90 U;  2RO0 A;  4C0Z A;  3V8L A;  2KQW A;  2QQB A;  4KBM B;  2E65 A;  2DAQ A;  2EAY A;  2RJC A;  3DB4 A;  3OQ5 A;  3WVD B;  3JCM J;  2PU9 B;  2WAC A;  3CC7 T;  4J5Y A;  4F7U E;  5GAN f;  3CEY A;  3SDZ A;  2CZ0 B;  2M1H A;  3TCJ A;  3OYI A;  3RKX A;  3TEE A;  3ER0 A;  2X35 A;  5GAM h;  3BDU A;  3G4S A;  3CPW A;  1RI0 A;  4LDY A;  3QBY A;  4NL2 A;  2RJF A;  3JRZ A;  5CKE A;  3FRN A;  4NL3 A;  4PJO A;  3OYF A;  4M7A F;  4N0A A;  4A4H A;  2GF7 A;  4BE0 A;  2QTX A;  2OAU A;  3TU4 K;  4FIB A;  2K5F A;  3DLM A;  1W2B A;  3HSB A;  4XQ3 A;  4C0F A;  4C0G A;  4C5H A;  2VGN A;  2CKK A;  1VQ9 A;  1U1T A;  2D0Q B;  4HT8 A;  3J81 E;  4ATO A;  5KH6 A;  4QQD A;  1KC8 U;  1VQ5 A;  3PTA A;  2X4J A;  5LL6 S;  3OBY A;  4J6X A;  2P0K A;  3CD6 A;  3QHS A;  3CD6 T;  4XAX B;  2DZ9 A;  3C12 A;  4BDY A;  4C0D B;  3N5B B;  1VQ4 T;  4M7A C;  3HRT A;  4EPC A;  1LNX A;  1HXD A;  2LCC A;  3WVE B;  4FT4 A;  3J80 E;  1VQL A;  4M7D A;  2HQE A;  2K3Y A;  1NJI C;  5D6W A;  1JRI A;  1M9S A;  3G7Z A;  3MEU A;  2YLC A;  5CK9 A;  1KQ1 A;  3JCM c;  5DM7 R;  5GAN 3;  4RKU E;  4A54 A;  1YJW T;  2G3R A;  4C5G A;  4IUP A;  2XU8 A;  5GAN j;  1M1F A;  1BI1 A;  2KMT A;  3A8O B;  4NOY A;  5CIU A;  1YHQ T;  4KUD K;  1WJR A;  5D6Y A;  1OZ3 A;  2DZC A;  1Y96 A;  5KCO A;  1M1K U;  3GPL A;  4X9D A;  1Q82 U;  3PIO A;  2QQS A;  1K73 U;  1M1K C;  2DO3 A;  2XKO C;  3NTI A;  3M4Y A;  3LGF A;  1PSF A;  2ZPI B;  4PKC C;  2Y90 A;  4M77 G;  3OYD A;  2KY9 A;  2EJF A;  3MP8 A;  3CME A;  4EMK B;  1JJ2 A;  4DOW A;  4ZGJ B;  3OW2 S;  2X4Y A;  1KG1 A;  2QA4 A;  3J7A F;  2QEX T;  4M77 E;  2ZPG B;  3V7S A;  2RHI A;  4Q5W A;  1MHN A;  3OMG A;  1WGS A;  5LJ5 g;  2O01 E;  3CC2 T;  4PJO F;  2GCX A;  2MWO A;  3A8H B;  3MEV A;  2JTM A;  2QA4 T;  3M53 A;  4E7L A;  4IUV A;  1VQN T;  2X4W A;  4M78 D;  5GMK i;  5LJ5 j;  4NS5 A;  1NE8 A;  4KUL A;  3NTH A;  4RCB A;  3EFS A;  1G3S A;  5HK3 A;  1VQ7 T;  4M78 C;  2DIG A;  2K57 A;  3GOX A;  5I2M A;  4BE1 A;  4FL6 A;  4C8Q B;  4EMK C;  3CCM T;  3A8G B;  3QUI A;  3R6O A;  3QZ9 B;  2K2V A;  1WJS A;  4J8O A;  3HHT B;  5AYF A;  3SB2 A;  5GAO p;  4QQ6 A;  3L2W A;  4O6J A;  3QXE B;  3ME9 A;  2QQR A;  5LJ3 f;  4BDZ A;  1OI1 A;  1QP2 A;  4B9X A;  1X01 A;  4PLL A;  4LDX A;  4F7U B;  2LDM A;  4FT2 A;  3QJY A;  2PUO B;  5GMK h;  2DXT A;  3CXC A;  5LJ5 f;  3PFS A;  4M7D G;  1VQK A;  3CBP A;  4JRP A;  4M7A G;  1VQK T;  2DXB A;  1FWZ A;  2QXF A;  3INZ A;  1RL2 A;  3MO8 A;  1QW1 A;  2VXF A;  4BE2 A;  1EIF A;  3P8D A;  4M75 E;  2DVE A;  2IVW A;  2R58 A;  4OGC A;  5GAN h;  3I56 T;  2LQ8 A;  5FU6 B;  4MMK A;  3VV0 A;  4JLG A;  1QVF S;  3CCS T;  2AHJ B;  4N0A C;  3V8K A;  1VIE A;  3LW5 E;  2DKG A;  4X34 A;  5GAM f;  2WSF E;  3VU3 C;  4C0D C;  2E1H A;  3LWI A;  3H6Z A;  3OYG A;  2DD4 A;  2EKO A;  2RK2 A;  5CKB A;  2V8K A;  4FU6 A;  3ZFJ A;  5KCH A;  5FU7 B;  3CCV A;  1JB0 E;  2ZGW A;  3HL8 A;  4M77 C;  4XU1 A;  5D6X A;  1U8R A;  3M56 A;  2LQK A;  5J3B A;  5FU6 C;  4HCC A;  3EAE A;  2HBP A;  4XTX A;  1YBY A;  3QYH B;  4J6W A;  4M77 D;  5GAN e;  4IUR A;  1YIT T;  2XD0 A;  3T9N A;  2LT1 A;  2VXE A;  4II1 A;  3URG A;  3OYM A;  2M16 A;  3L2Z A;  2RI3 A;  4XTZ A;  3CCL T;  2OTJ T;  5L8R E;  4OB1 B;  4N4G A;  5GAM e;  3HP9 A;  4C92 D;  1N8R U;  3RIR A;  1K9M C;  5GAN 7;  2R5A A;  2EQK A;  4ME7 A;  4BB7 A;  1ZBX A;  4LDU A;  1NZ9 A;  5IT9 E;  2LTO A;  3TRE A;  2QQ9 A;  1JJ2 S;  5C0M A;  2HNI A;  2R57 A;  1O75 A;  5EG2 A;  4M78 G;  3OS5 A;  4F7U A;  5GAN 5;  2ZPB B;  2Y4X A;  4RMO A;  3OYH A;  3OSV A;  3OYK A;  2JTF A;  3OW2 A;  4L5G A;  1PSE A;  2EFI A;  4C8Q F;  1G5V A;  2DK3 A;  2E10 A;  2XI9 A;  4OB2 B;  4IUU A;  2HD0 A;  3X20 B;  2XHC A;  1N9S A;  4BY6 B;  3CCU T;  1UGQ B;  1YJN T;  5CKF A;  2PVG B;  5GAM j;  3JB9 D;  1DJ7 B;  4M7D B;  3GF5 A;  2K3X A;  3JB9 H;  2LT4 A;  2E64 A;  1SSF A;  4KT0 E;  4PJO E;  5J26 A;  3CCS A;  5HKC A;  3JCM g;  3JCM W;  1VQO A;  1IRE B;  1VUB A;  2QI2 A;  4N4H A;  4C92 G;  4DA4 A;  1Q82 C;  3OBW A;  4M77 A;  3UWN A;  1Q81 C;  4UC4 A;  2LX9 A;  2JVV A;  1WQ7 A;  5FU7 C;  1Y96 B;  2RHU A;  4C92 A;  2FL7 A;  5GMK e;  1B34 A;  2GQV A;  3FDR A;  4QVD A;  3OS2 A;  3VUB A;  4EMK A;  3CCR A;  1VQP A;  3CC2 A;  4M78 E;  2RJE A;  2V8I A;  1BIA A;  4HKE A;  3CMA A;  5CR2 A;  3G71 T;  3A8M B;  4IUQ A;  3VUZ A;  4ZTF A;  1M1G A;  3DB3 A;  3JCM h;  4HCZ A;  3QYG B;  4Z02 A;  3FLG A;  2B8A A;  4M7D F;  1IZ6 A;  1N6A A;  3MP1 A;  3FJP A;  3KUF A;  3LX7 A;  3OMC A;  3Q1J A;  2CGH A;  4L6V 5;  4P5N A;  1KC8 C;  3HFN A;  4E47 A;  4ZN1 A;  1K8A U;  1QP3 A;  3JCM e;  4M75 B;  4C8Q D;  3EFR A;  3RKY A;  1WPY A;  2RI5 A;  2VYT A;  1VQP T;  1Y71 A;  4XK8 E;  4C8Q A;  3QII A;  4XTU A;  3CBO A;  2DXU A;  2KSS A;  4C8Q C;  3O8V A;  4ZGE B;  3I55 A;  4EMG A;  3I56 A;  3QJ6 A;  3M5A A;  3SWN B;  3CCE A;  2D9T A;  1Y7X A;  5FLX E;  1KQ2 A;  4RG2 A;  5KE2 A;  2LNV A;  4PJO B;  3PMT A;  2F69 A;  2RB6 A;  5HK0 A;  1VQ8 A;  2WSE E;  2XDB A;  4M75 A;  1YIJ T;  1BKB A;  1I8F A;  3CCE T;  2FHD A;  2PQW A;  2HAX A;  3LH0 A;  4M75 D;  3M55 A;  2C06 A;  4M77 F;  3UDC A;  3SWN A;  3JSC A;  5DY9 A;  5GMK j;  4ZN3 A;  4ELY C;  5GAM d;  1YJN A;  5LJ3 e;  4PJO C;  1VQM T;  2CS7 A;  5DLQ E;  1R8O B;  1UGP B;  1LJO A;  3MEA A;  5LJ3 d;  4A4K A;  1M90 C;  4PJO D;  3QO3 A;  4XU0 A;  3LYI A;  4L59 A;  2EWN A;  2KDS A;  5CQX A;  2A3L A;  4A4F A;  3QSU A;  4Y91 A;  2LRQ A;  3JB9 I;  1B34 B;  3QDR B;  5HY6 A;  1KD1 U;  2ZCF B;  2CZ7 B;  3HRU A;  4OP0 A;  3L42 A;  1VQ8 T;  4M7A A;  2MWP A;  4C5I A;  2E5Q A;  1XTD A;  4C92 E;  1Y07 A;  3CPW S;  2F5K A;  3M4G A;  1Q86 C;  4M7D C;  4C92 C;  3E1S A;  1XNI A;  2QQA A;  5GAO l;  2CYZ B;  2I2L A;  1YI2 T;  4LD9 K;  1W2B S;  2BIV A;  3FIF A;  2YLB A;  4LDV A;  3I55 T;  4M7D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...