1WJRA

Solution structure of the 2nd mbt domain from human kiaa1617 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
b'GSSGSSGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1617 protein
publication title Solution structure of the 2nd mbt domain from human KIAA1617 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjrA00
2EFIA 2RI5A 3P8HA 2LDMA 2QQRA 2EQKA 3MP8A 2P0KA 3P8DA 4C5EA 1G5VA 4QVZA 2RHXA 2LVMA 3OYMA 3GOXA 3L2RA 4N4IA 3S3MA 3FEOA 4A4HA 5FRMA 3UT1A 3PMTA 3H8ZA 3LYIA 3S3OA 3MP6A 1N27A 3OYDA 2BKDN 2LTOA 3S3NA 4C5HA 2RHIA 4BE1A 2EQJA 5D6XA 3MEAA 1KHCA 4QQ6A 3H6ZA 3QBYA 3LLRA 3OYKA 1RI0A 2NLUA 2EKOA 3QJ6A 4A4EA 3OYAA 2YRVA 5CIUA 3MO8A 3OY9A 4QQDA 4IUTA 4E7JA 2L8DA 4BACA 3CEYA 2R5MA 2RHYA 2PQWA 3E9FA 4HCZA 4CRIA 3OYNA 2G3RA 2GFAA 2IG0A 2EQMA 5IN1A 3S6WA 3OYGA 3LH0A 2CKKA 2E6NA 4PL6A 4RG2A 2O4XB 3C4SA 2M1HA 3SD4A 3ZEHA 5J26A 1WJRA 2JTFA 2HQEA 4UC4A 3OA6A 1WJQA 1XNIA 2HQXA 4Q5WA 5C0MA 2MWOA 3L2UA 5D6WA 3KUFA 2D9TA 3PFSA 5C6SA 2RJDA 3FC3A 1MHNA 3MEWA 4GY5A 5IAYA 2X4YA 4E7LA 2DIQA 2GF7A 3OYJA 3OMCA 3NTIA 5M9OA 2RI2A 3L2WA 2X4XA 3OMGA 4A4FA 3OYLA 3OYBA 1SSFA 4E7KA 3OYHA 4A4GA 4QQGA 2BUDA 2O4XA 3OYCA 2RHZA 1WJSA 3PNWC 4QW2A 4C5IA 3NTKA 4E7HA 2FHDA 2DAQA 2DIGA 3EAEA 3MP1A 2RHUA 3OYIA 4BE2A 4N4GA 4Z02A 4L59A 2L89A 2QQSA 3FDRA 3LGFA 2XK0A 4IURA 3OQ5A 2RO0A 4IUVA 2VYTA 4LD6A 4BDYA 2R57A 4EDUA 3OB9A 2EQUA 1WGSA 2K3XA 2E5QA 3LGLA 3QIIA 3E9GA 3L2QA 4C5GA 2R5AA 4FL6A 4PLLA 2RI3A 3L42A 4BD3A 2L3RA 1OI1A 3OS1A 1OYXA 3OYEA 5KH6A 2LCCA 4II1A 3MEUA 3PMIA 2MWPA 5KCHA 3F70A 5KE3A 3OS2A 3L2VA 3FLGA 4OVAA 2RJFA 3DB4A 3META 2GFUA 2M0OA 2WACA 3M9QA 4IKFA 3ASKA 5FROA 4X34A 3NTHA 4IUQA 2X4WA 3UWNA 1H3ZA 2LRQA 5KCOA 3DB3A 3DLMA 3QKJA 1OZ3A 4NS5A 4ZTJA 2RJCA 4B9WA 2RJEA 3LX7A 3OYFA 3BDLA 2BIVA 2XDPA 4IUUA 3MEVA 4BDZA 2K3YA 2X35A 2JZ2A 2F5KA 3Q1JA 4IUPA 2R58A 4PLIA 4BE0A 4E7IA 4ZTFA 4B9XA 4FU6A 3ME9A 3OS0A 3O8VA 2M16A 1OZ2A 4N4HA 5D6YA 5J39A 5FRNA 2B8AA 5KE2A
chains in the Genus database with same CATH superfamily
4HCKA 2PVDB 3QZ9B 1K9MU 4OB3B 3C95A 4N4IA 1K8AC 1I5LA 2E10A 1YJNT 5LJ3j 3LYIA 4M78F 2RHIA 3JCMe 3UA7A 1HK9A 2ZPBB 4J6XA 3CCMT 2YXYA 1I4K1 2YLBA 2X9HA 2NLUA 3CBPA 3JCMc 2EKOA 2R5MA 1K0SA 1K9AA 2GFAA 8AT1B 3FIFA 3P8BB 4C8QE 3C94A 4RMOA 3CCJQ 2F2WA 2M1HA 2DTOA 1OX9A 1WJRA 1S72A 1VQ8Q 5GAMf 5C0MA 2FO0A 1WFWA 2D9TA 1SG5A 3MEWA 2C0TA 1R77A 5I11A 1WZOA 2RI2A 2DD5A 3CMEQ 4A63B 3GIBA 3THKA 4QQGA 3N5BB 1BI0A 3QG1A 1SF9A 1Y0MA 4N4GA 3QZ5B 3CCVT 3FDRA 3CPFA 1B34B 3HTRA 3DLLA 4IUVA 1W1FA 1X2QA 5GMKj 2R5AA 2P0PA 4C0GA 2RI3A 2RH2A 4M7AG 1N5ZA 2LJ1A 3MEUA 3BDUA 1T3SA 3PMIA 3VKIA 3PIOA 1JQQA 2J6OA 4M7AD 1PRLC 4JS4A 2M0OA 2DERA 2X4WA 2Y4XA 2L2PA 3CPWS 4ZTJA 2RJCA 4VUBA 1KFZA 2RJEA 1Q81U 3URGA 3LW5E 5EG2A 2R58A 3G4SQ 4KGXB 2QA4A 3VS7A 4ZN3A 1AWXA 2D0QB 2EYYA 3EG0A 2EVRA 3H9NA 5A0GA 1UB4A 4BI8B 2P0KA 3OYMA 4MZTA 1TUCA 4FYXB 5GAOr 3PMTA 4EMKA 3CBMA 1U8RA 3EHQA 2QAZA 4BI3A 1N27A 5KYNA 3JCMb 4XTXA 1CSKA 3G71T 2F2XA 3UPUA 1OU9A 2CP2A 4RTYA 4KUDK 3I56T 1RAGB 3M53A 4M77F 1AWJA 1NG2A 2EYXA 4QQDA 1OPKA 4RTTA 3JB9J 4CRIA 1TG0A 2O4XB 2ZPGB 2FPEA 4HVVA 1QWEA 1VQ7T 4C8QC 3L2UA 2D0NA 4GY5A 1UECA 2KSSA 1K1ZA 1IGUA 4OGCA 1T0JA 1Y57A 4E7SA 4CC4B 4AG2C 4A4GA 4ATOA 2F69A 1M8MA 1KQ2A 4PJOE 2EGAA 2A7YA 4L59A 4IURA 5IXFA 2KYBA 1G83A 3CD6Q 1M1FA 4FSXA 3CCSQ 2DTHA 2COWA 2EW3A 3ZFJA 1Q82R 3L2ZA 1K8AR 2F1LA 4TVRA 4JZ4A 3UF4A 2ECZA 3OBYA 2YWWA 3CCJT 2BIVA 4IUUA 4JJDA 4IUPA 2FZCB 4ZTFA 3CC4Q 2FPFA 1I5OB 3M59A 1WLPB 2OTLQ 2D1XA 3H0HA 5GAOn 2EQKA 1G5VA 1N8RR 1XQHA 4PFZA 4F7UB 1KD1R 5KYXA 5FU7B 4M75D 2HEQA 1JU5C 2CH4A 1WNLA 3JSCA 5GANe 3I55Q 2ZZDA 1YP5A 2KXDA 4C5HA 4RTUA 1Q82U 4BE1A 2KT8A 2EQJA 2YUOA 1K8AU 4D6WA 4C92B 3SWNB 1Z9ZA 1RI0A 3V8JA 4OMPA 3CEYA 3G71A 1BKBA 1QP2A 5FWCA 3NGPA 5GAMd 3JB9F 4KUIA 5CQXA 1C0MA 2X4JA 1TTHB 3G4ST 3QWYA 1VQ6Q 4QVDA 1N8RU 1KD1U 4FT2A 3HHTB 2NUPA 5IT9E 1NPRA 2M02A 2X4XA 4A4FA 1D3BA 2JUFA 5CCAA 5KYYA 1PD0A 2XI9A 1UHFA 2FRWA 4ORZA 2CP5A 3JCMh 2V8JA 3PIPA 2LQNA 2RK2A 4J8OA 1VQNQ 2QGGA 2DVEA 3LH5A 3TSWA 2KAFA 2E5QA 1KQSP 4C5GA 2JW4A 1TSFA 1LOJA 2L3RA 3REBB 4CC7A 2RA2A 5CKBA 3QUIA 1WYXA 4EMGA 1GCPA 3M0TA 3DB4A 3KBGA 1EFNA 2CUDA 3ASKA 4M78G 2VV5A 1QCNA 2ZPHB 1ACMB 2O88A 1WHGA 4RTVA 1QVFP 5GMKe 4J9HA 2PVGB 2HSPA 2X35A 3V7CA 2CUBA 1NEBA 4E7IA 3H0FA 3CCJA 1NYFA 2JM9A 1BIAA 3X20B 2FEIA 2A0FB 2M16A 3A1PA 3PT9A 1VQ8A 1W2BA 4KBMB 3RKWA 2EFIA 1WX6A 1YCYA 4HVUA 1YJWQ 4LD9K 4J7FA 1V29B 1VYUA 1Y96A 1QVGA 1K76A 4DA4A 3OW2S 4JLGA 3CMEA 3QXEB 4ZGDB 3CCRQ 1JJ2P 2XHCA 2AZSA 2BKDN 2VWFA 3E1SA 1VQOQ 1EIFA 3CD6T 3CCST 5GAOl 5LJ3f 2EIFA 1G2BA 1ZQ1A 2RHYA 2K9GA 2EQMA 2RMOA 2KROA 4JRPA 1PG5B 3SD4A 3JCMP 3MHXA 3CXCP 4Y91A 2JTEA 1BCOA 5GAN5 3CC4T 3V7SA 1AWOA 5CKFA 2O9VA 2K5FA 1TWBA 2QTVA 2RQRA 4M7AA 2MOXA 2OTLT 3OYLA 1RAAB 1J3TA 1TOVA 1VUBA 2CZ7B 2HBPA 2YUQA 4Z02A 2QQSA 1HD3A 3I55T 2ZPFB 3WVEB 1X27A 2KNBB 1UE9A 4PJLA 2DLPA 2DRMA 4FL6A 2AK5A 4NL3A 5KH6A 4ELZC 3QWXX 5IHIA 2JTMA 3OS2A 1VQLQ 2GGRA 3GBQA 1YITT 3SFMA 4M7DB 2O9SA 2FYKA 1FYNA 4EMHA 2COZA 4M77G 2IVWA 4MMLA 2ZAEA 3JB9I 5LJ5h 4BE0A 1OOTA 1PD1A 1KIKA 2ED1A 4PJMA 1KQSS 3V7RA 1VQ6T 1AHJB 2EJFA 4O5VA 2L3QA 4J9GA 1X2KA 4M78C 4FYYB 4KRTA 2E12A 1LVKA 1X69A 3H8ZA 1QVFS 1JO8A 1VQNT 4LN2A 2K2MA 2KQWA 3QJ6A 1CKBA 2YRVA 5CIUA 3OY9A 1UJ0A 2HSEB 3CD6A 1BYMA 5GAOm 4PJOF 3CCSA 3LH0A 4CC3A 4PL6A 2DL3A 3ZEHA 1E7OA 1JJ2S 3A8MB 1YCSB 2DFUA 3FJ5A 1KK7A 3IQLA 3ZBDA 5GAN8 2RN8A 3QDRB 1FWZA 3CC4A 2CSIA 3OYBA 1YIJQ 4J7IA 5GANh 3TSZA 5LJ5j 1ZX6A 4JZ3A 4E7HA 1MV0B 2FVUA 4OB0B 3SB2A 2OTLA 2LCSA 2L89A 1PWTA 3C0CA 2XK0A 2KXCA 3JB9H 2RQVA 3CXCS 1TUGB 2K3XA 2DBMA 4JJNK 2E3IA 1VQOT 4PJJA 2MYSA 3EG9A 3OYEA 3I55A 3H41A 4M4ZA 2E6ZA 4F17A 2KR3A 3X24B 2RJFA 2BE9B 1PNJA 2MAMA 1OZ3A 4NS5A 5KYUA 2L3PA 1OPLA 2K57A 1K9MR 2DEUA 3M0SA 1X6GA 3Q1JA 4B9XA 2QTXA 1M3BA 1YI2Q 4FW1A 3M56A 3HKSA 1IO6A 4C92F 3JB9G 1M5Q1 5J39A 4LDYA 3OSVA 3M58A 3HPWA 5KE2A 1OULA 2LDMA 2OAWA 3JB9D 3RKXA 1VQ6A 1X6BA 2GBQA 5KYYB 5GAN7 1VQKQ 2BZYA 2DZ9A 2GNCA 4E6RA 4M77C 2RNAA 3RNJA 2EPDA 3AT1B 2X51A 4OGEA 3JRZA 2XD0A 5GAOp 2EYQA 4E7ZA 1HXDA 5LJ3d 1PHTA 4BY6B 5GANj 4C0DC 1JRIA 3QSUA 1QP3A 1VQNA 3EH2A 1NJIC 3G1JA 2L8DA 2FL7A 1VQLT 5GMKh 2AKLA 3RKYA 1M2VB 3CPWA 1NM7A 1UGPB 3JV3A 2KGTA 3OA6A 4PFOA 2DPPB 4MZPA 2YLCA 2P4TA 2RJDA 1MHNA 4E7LA 2HCKA 1MGQA 2DL5A 2RQTA 4QKUA 1WXBA 4LXCA 5FLXE 1IZ6A 4C8QB 1UGRB 2OX7A 4GLKA 2VUBA 3GPLA 1NE8A 4M78A 3OYIA 1Y96B 2F2VA 1WQWA 1ZBXA 5GAN4 1YJWA 2DXTA 1QW1A 3QIIA 4NL2A 4AFZC 3CBOA 5DLOA 3WVDB 2DYIA 1Q81R 1QKXA 3M0UA 3CCRA 3L2VA 1OX8A 3QYGB 1VQOA 2FB7A 5CVIA 1M1KC 2FZKB 2H8HA 3EFOB 5GMKm 3M0RA 1K73C 2EJGA 4Y28E 5D7UA 2ZGWA 2QK0A 2E41A 5GAMg 3ME9A 3CCUQ 3VS2A 3VS1A 3VS6A 3CC7Q 4RTWA 2VC8A 3HP9A 1UGSB 1VOMA 5GJVB 3RUXA 1RUWA 1X75C 3P8HA 2QQRA 2QGFB 1YIJT 1BI2A 1U3OA 5FRMA 2HNIA 4M7AE 2LP5A 1Q95G 4N0AA 3MP6A 5FU6B 2HD0A 3VYHB 2ROTA 3HFNA 2K6DA 1KHCA 3MKDA 3H6ZA 3TVTA 3LLRA 4XTUA 4GLMA 1VQ9A 4LDUA 2LNVA 2JS2A 4KULA 1YWPA 1GFDA 1VQLA 1Q86R 4OMOA 3JCMf 4J5YA 5HCKA 5HKCA 3BY7A 2CP7A 4J83A 1EZZB 3FC3A 1YI2T 5FWBA 1RADB 2EGEA 4JS5A 5I21A 1GCQC 3EGDA 3JCMQ 1WI7A 2C06A 1WJSA 3A8LB 3PNWC 2PUOB 1VQKT 1M9SA 1Z9QA 3EG2A 3LGFA 4M7DF 2LNHB 4J9CA 4J9IA 1RACB 4M77A 1XOVA 1B3QA 3L42A 1IHVA 2E65A 1BBZA 4XU3A 5LJ5e 1BIBA 4PJOB 1IXDA 4LDVA 5GMKi 1Q86U 4IKFA 1FX7A 4RKUE 3DB3A 1G8XA 2ABLA 1FXXA 1ZBJA 4B9WA 5IHKA 1UTIA 2QDLA 4QVCA 1Q7YC 3SEMA 3OS0A 3PGGA 4DEYA 4PKCC 3VS3A 1NJIR 5IHNA 1M90C 3CQTA 4PJOD 1B07A 4ELYC 3TQ7P 2NUTB 4KH0B 3A8OB 1M8VA 4QVZA 2DMOA 2A28A 3OBWA 3OW2P 2J06A 1V1CA 2DD4A 2ZPEB 2HMAA 2K79A 1HYOA 1WXUA 1YIJA 2QDYB 1VQ8T 1KG1A 8ATCB 4M7AC 3M5AA 2E4HA 1NPPA 1OV3A 2SEMA 1X6OA 4OMLA 1FMWA 4JRKA 2L3SA 3HL8A 1RAIB 2PQWA 4M75G 2JVVA 2WSFE 3CMET 1WDXA 3A8HB 1C6VX 5IN1A 1QVPA 1KC8C 4HT8A 2JTFA 1NJIU 5CAIA 2XKOC 1DJ7B 2MWOA 3AHUA 1W70A 3SHWA 3CCUT 2BE7D 3CC7T 4F7UG 1W4SA 2EGCA 3OYJA 5GAN6 2K5IA 2Y4YA 4JJBA 1YI2A 1K73R 4E7KA 2BZ8A 4BI4A 4J9FA 1FMVA 2DAQA 3EAEA 2RHUA 1NZ9A 2EYZA 4C92G 2VYTA 3G6EQ 2EQUA 3LGLA 1PRMC 4C92D 4HT9A 1VQKA 2EYWA 2GQVA 3NHNA 5LJ5f 2DF6A 3L1AA 4II1A 3ZL7C 4X9CA 1X43A 3M9QA 2Y90A 4FT4A 4OB2B 3X26B 4RUGA 3GNGA 2PTKA 1E6GA 2YSQA 2CGHA 3TCJA 2JZ2A 1M1GA 2KRNA 2KE9A 1ZSZA 3JCMW 3O8VA 1K73U 4HCBA 1AZEA 5D6YA 2XU8A 1BCMA 1QVGP 3U23A 2JS0A 1SHFA 4XAXB 1GCQA 1IB8A 1JBMA 2AHJB 3BW1A 1M2OA 1PCXA 2V8KA 2MIOA 2DK3A 2JXBA 3RMQA 4M78E 2LT1A 1AVZC 2P0QA 1WXTA 3CCLQ 5I2MA 1QWFA 3MO8A 1D1AA 2E3HA 5CKHA 4C8QF 3JCMd 1I0CA 2NWMA 5GANf 3OYGA 3JAME 1XNIA 2L0AA 5CR2A 5D6WA 3M54A 3GLXA 2DXCA 1KQSA 3M0QA 2XMFA 2ZCFB 1GRIA 3GNFB 4M75C 2FZGB 3T9NA 4FCYA 3CCUA 2Z0WA 3CC7A 3RDVA 4QW2A 1Y71A 2VASA 3ER0A 2DE0X 2KYMA 3VS5A 4KT0E 5CO7A 2C0IA 1Q7YR 3CCEQ 4DBFA 3MJXA 1QVFA 4BDYA 4EDUA 5KYWA 2CSQA 2GTOA 1NBEB 3OS1A 1D09B 4AMCA 2MWPA 4OVAA 1G3TA 5LJ3g 2YT6A 2LRQA 3JCMX 1B34A 4C92C 2DO3A 2CS7A 1IGQA 3OYFA 3BDLA 2IIMA 4GBQA 1VQ9Q 4EMKB 1JJ2A 2FG0A 1XJWB 2LX9A 3J80E 2HL5C 2HBWA 1PKTA 2A36A 2RK1A 1PM3A 2EQIA 1Q7YU 1BU1A 1KC8R 1M4ZA 4XTZA 1M90U 2DM1A 2KDSA 1SPKA 5CKDA 3RIRA 3CXCA 2ESWA 3G6ET 2PZ1A 2X3WD 4Y92A 5AYFA 3A8GB 4A4EA 3OYAA 4M7DG 1RABB 4X1VA 4HCZA 2FPDA 4M77E 1VQMQ 3OYYA 1JXOA 4M7DD 1YJNQ 1QVGS 1PC0A 2P84A 4JJCA 3C4SA 5J26A 3EFSA 5HK0A 1KSWA 3TEEA 3BFMA 2OAUA 3VRYA 1X01A 2A3LA 1VQ4Q 1KC8U 4KGZB 5IAYA 2COYA 2DTIA 2JOYA 3TREA 5GJWB 2VB6A 1T3LA 4FSSA 1QMCA 4XTYA 2BUDA 1D1BA 2O4XA 4L6V5 1OQKA 1MUZA 1RAFB 4HKEA 2DIGA 2DETA 2QQAA 2K3BA 3M4GA 2ENMA 2K5LA 5LJ5d 1I07A 2CP0A 1IRXA 4XQ3A 3EG3A 1ZSGA 4PFPA 3V8KA 2QG9B 1TXQA 3G7ZA 4PLLA 4LDXA 3CCLT 2V8IA 3CMAQ 1R8OB 5FROA 2BZXA 1G3WA 3CCVQ 1YJWT 3OSSC 4N0AC 5KYXB 2KRSA 1UJYA 2M51A 3QDFA 1YFNA 3MEVA 1MMGA 2PNIA 3CCRT 2JMAA 1GFCA 2DBKA 4OMMA 4OB1B 1VIEA 3LWHA 4R56A 1WHJA 1ZA2B 7AT1B 2KMTA 4C5EA 2E64A 1RAEB 2LVMA 4M75A 3V8LA 1UGVA 4ZNXA 4A4HA 1R0CB 5AT1B 2LCLA 3UT1A 2EJ9A 3OYDA 2PVOB 3CC2Q 2LT4A 5J3BA 4QQ6A 1TU0B 5HK3A 2RB6A 4KGVB 2YUPA 2CP3A 2EWNA 3I35A 5DM7R 2V1RA 2CZ6B 4FYWB 4HXJA 3G6EA 4F7UA 5GANd 1K4US 4BACA 1LCKA 3E9FA 2NUPB 1QKWA 1N9SA 1SSHA 4B6MA 2JT4A 3VYGA 1D3BB 1ARKA 2C0OA 4AFSC 1WQ7A 5ECAA 1ZUYA 1VQ9T 4C92A 3SWNA 1O9SA 1WA7A 3QPHA 4BUGA 4XU0A 4A54A 1SKUB 4M7DC 5M9OA 2VXEA 1K0XA 1SSFA 3NTKA 3EGXA 4WCIA 4BE2A 1C1AA 4RCCA 1V76A 2DX1A 2R57A 2O31A 3D7SB 3QYHB 2QXFA 2EBPA 1YJ9Q 1CKAA 4PK4A 4LDWA 1KHIA 2PUKB 5HY6A 2DL4A 2XIDA 1R0BG 1G3YA 3HSBA 4AFUC 1D1CA 3EG1A 2WSCE 1Q82C 1Y7XA 3HRSA 3RERA 2MF2A 1VQMT 3DLMA 1YN8A 3CCLA 5A0DA 2V26A 1H8KA 2K3YA 2F5KA 4PLIA 4C8QG 4FU6A 1YNZA 3KFVA 1VQ4T 3TU4K 4E2FB 2YHTA 4C8QD 2ZPIB 4N4HA 3P8DA 4DBRA 1M3AA 5GAOq 5L23A 1MMNA 3RMSA 1G3SA 1WHMA 2PU9B 1N8RC 1KD1C 3EGUA 4CC2A 1RLPC 3S3OA 4XK8E 3QBYA 5KYWB 2ATCB 4DOWA 5GAN3 2MMPA 3M0PA 3CCEA 4HCCA 4R55A 2AZVA 2LMJA 3EH1A 1I1JA 3JCMV 4DEXA 2LQ8A 2HKQB 4L5GA 3OYNA 3CMAT 2DKGA 4M7AB 1VQPA 4A4KA 1EX4A 3FJPA 4J6YA 1UFFA 2CDTA 4IIMA 5A2QE 2NYSA 2HQEA 1WJQA 4WF2A 2HQXA 6AT1B 2ROLA 1RLQC 2QEXQ 4C0ZA 1BI3A 1QCOA 2GF7A 2FRYA 2QASA 3NTIA 3OMGA 4P5NA 4MDXA 2RQUA 1WHKA 3OYCA 2RHZA 2AKKA 4X9DA 1U1TA 3VUZA 4QT7A 1ZSZC 2CH4W 2QQBA 1WGSA 3M55A 2EKHA 1ZUKA 3CC2T 1RI9A 1SRMA 3SDZA 2DL7A 4BD3A 1UEBA 2LC4A 3OS5A 3I9QA 4ZGEB 1VQ5Q 5FRNA 5KCHA 5KE3A 1HSQA 4JUVA 1W6XA 3BE3A 4IUQA 3UWNA 4BY6C 2DL8A 2WSEE 3MPUB 1RAHB 1QQJA 2YRDA 5EC7A 1VQMA 1XTDA 4ANJA 3JCMg 1YJNA 5DY9A 1F1BB 2KRMA 2V1QA 4J6WA 1Y07A 4OMQA 2KK4A 1VQ4A 3CCMA 2E1HA 1D0ZA 3LWIA 2VGNA 4D8KA 1QLYA 4LE9A 4M7DA 2DILA 2KY9A 3GP8A 3L2RA 5I2SA 3J7AF 3VS4A 2DNUA 1U5SA 2KI7A 2RQWA 4PJOG 2CT3A 1MMAA 3WXMB 3UA6A 1YJ9T 4D8DA 3X28B 3PE0A 2MPXC 3CCQQ 3E19A 3H0IA 2IG0A 5CK9A 5IXBA 3S6WA 4KH1B 2CKKA 4OMFB 4R0KA 1GBRA 2CREA 3CMAA 3KUFA 3I5RA 3CCVA 1BK2A 3EHRA 4XTWA 4DBQA 3O5ZA 1U1SA 1SEMA 3EG9B 1LPLA 5LL6S 1VYVA 1H641 1KQ1A 2D8HA 2JJ9A 2J6KA 2J6FA 2CZ0B 2D8JA 4M75B 5GAMh 3NMZC 5KYUB 2RM4A 3OQ5A 2H3JA 3UATA 3HRUA 5IH2A 3QO3A 1ABOA 4RTXA 3FRNA 4HVWA 4M75E 3VJPA 4JRIA 1OI1A 2DJQA 2RD1A 3CC2A 4DBHA 1M1KR 5FW9A 2VGMA 5FU6C 2W10A 3M4YA 4ESRA 1OEBA 5KCOA 2XDDA 3PVLA 1UDLA 4MMKA 3NFCA 3LX7A 3OW2A 4C0FA 2GCXA 4F7UE 4BDZA 3FB9A 1GBQA 3VS0A 2KBTA 4ZGJB 2LJ0A 2QEXT 2K2VA 4XU2A 4RCBA 5CKEA 4E47A 4C92E 5LJ3e 4ME7A 1YITQ 1UUEA 3I56A 2G6FX 2RHXA 2QYZA 2BTTA 4EIKA 2OTJQ 3EGXB 1D0YA 2KVQG 1YBYA 1FMKA 1AZGB 5D6XA 1AD5A 3R6NA 3MEAA 1YHQQ 1M1KU 1VQ7A 2DA9A 3OYKA 2CP6A 3VV0A 2IPOB 1W2BP 2DXBA 5LJ5g 4A53A 5GAMj 1SRLA 1AOJA 1VQ5T 1RL2A 2G3RA 1YJ9A 1MNDA 4F14A 1YWOA 2DXUA 5L8RE 4RG2A 4M78B 1WIEA 4UC4A 3JCMJ 4Q5WA 2H3EB 4PJOC 1BB9A 3PFSA 5C6SA 4BB7A 2LQKA 2O01E 1H3HA 2X3XD 5CQYA 1VA7A 1M2VA 4CI0C 3OYHA 2LJ3A 4C5IA 2DRKA 2FHDA 3NPFA 1PSEA 4M78D 1TH7A 3A98A 3ULRB 2E70A 2RO0A 2KT1A 4LD6A 3OB9A 1PSFA 4LUDA 2P4RA 3RBBB 4PJNA 2ED0A 4MDWA 2LZ6B 2NUZA 4C8QA 2M9UA 1U06A 2OI3A 3M57A 1GL5A 3FLGA 4J9BA 3META 3CCQT 4DOVA 1S72Q 2GFUA 2WACA 4O6JA 1AEYA 1AT1B 2SRCA 2W0ZA 2AT1B 4XU1A 5GANg 1ZHIA 4EPCA 1I81A 4Z8AA 1M90R 1K9MC 2LQWA 1VQPQ 2CT4A 1ZLMA 3HRTA 5FU7C 1JB0E 3RESA 1OZ2A 4HA8A 4RTZA 4F04B 2RI5A 1AWWA 3EFOA 2QEXA 1E6HA 2HL3A 3C12A 3VUBA 4FIBA 4M7AF 2I2LA 3S3MA 3FEOA 3DKMA 2E5KA 3SWNC 2HZYA 3PVQA 4FM4B 2YRCA 1ABQA 1B7TA 2O2OA 1VYTA 3HFOA 1WHHA 1BI1A 4JRQA 1D0XA 4AFQC 3I5SA 3G4SA 4IUTA 4JPBW 4NOYA 2VKNA 3EGDB 4JLIA 2QA4Q 2RPNA 2GQIA 1VQ5A 1TS9A 4JDSA 1A0NB 2K4YA 1UHCA 2YUNA 1M27C 4FW2A 2VXFA 4LUEA 2J05A 1SHGA 3MCAB 1HJDA 2RF0A 1N9RA 4AT1B 4M77B 4OF1A 1W2BS 1H92A 3EFRA 4C0DB 1I8FA 3MP1A 1TUDA 2AIRB 2A08A 2OTJT 2HAXA 1LNXA 1NEGA 1NYGA 2J7IA 3R6OA 4M77D 4WTOB 3L2QA 4M7DE 3CCMQ 2YDLA 1YHQT 2XDBA 3RR6A 1ZA1B 2QI2A 2MI6A 4LNPA 3F70A 4J9EA 1Q81C 1MMDA 1OU8A 1IHWA 2JM8A 3NTHA 3UDCA 1H3ZA 4RG8A 3CCQA 2HKNA 2XDPA 4PNOA 2CZ1B 2L5QA 2F5TX 2DEQA 3A5ZB 2XG8D 4FYVB 4PJOA 2DJZA 3E2UA 4DQ2A 2B8AA 1O75A 3GF5A 1LJOA 3MP8A 2DVJA 1WHLA 2DYBA 5I22A 3GOXA 1JXMA 3S3NA 2LTOA 2JNGA 2HQHA 4MZMA 2NUTA 2VVKA 4IIOA 1UGQB 4XTVA 5DLQE 4E7JA 9ATCB 2KEAA 2CYZB 2D6FA 1S72T 4V2SA 3X25B 2OJ2A 1GXIE 2E6NA 1MV3A 2GTJA 3PTAA 3J81E 1IREB 2JMCA 4M75F 3CCET 1Q86C 1T0HA 1MNEA 1VIFA 5GAMe 2LX7A 2X4YA 2DIQA 4Z88A 5LJ3h 3VRZA 5A0LA 3VU3C 1VQPT 4F16A 4Z89A 4K11A 2QQ9A 2B86A 3OMCA 3L2WA 2I0NA 5GMKl 3QHSA 1QCFA 4EMKC 3CPWP 2JN0A 2MK5A 4F7UF 2MCNA 1M30A 3INZA 3KXTA 1NLOC 2M0YA 1YITA 2DZCA 1KJWA 3REAB 2A37A 3E9GA 3G71Q 2OTJA 4AG1C 3I56Q 1OYXA 1ZUUA 2LCCA 1ZSZB 1S1NA 1PKSA 3QJYA 2K7AA 1M3CA 1NLPC 1YHQA 4X34A 5GAN2 3QKJA 2QA4T 1JEGA 2HDAA 1VQ7Q 1WPYA 4J9DA 1P92A 1N6AA 4ZN1A 1UG1A 4OP0A 4OMNA 2XICA 4YTLA 2EAYA
chains in the Genus database with same CATH topology
2E1HA 2PVDB 3QZ9B 3LWIA 1K9MU 2VGNA 4M7DA 4OB3B 2KY9A 3C95A 3GP8A 3L2RA 4N4IA 4XAXB 1K8AC 1I5LA 2E10A 5I2SA 1YJNT 5LJ3j 1JBMA 2AHJB 3BW1A 3H8ZA 3J7AF 3LYIA 1QVFS 1VQNT 2V8KA 4M78F 2RHIA 3JCMe 2DK3A 1HK9A 2KQWA 2ZPBB 4PJOG 3RMQA 4J6XA 3CCMT 4M78E 3WXMB 2LT1A 1YJ9T 1I4K1 2YLBA 3X28B 2NLUA 2P0QA 3CBPA 3JCMc 2EKOA 5I2MA 2XU8A 3QJ6A 2YRVA 5CIUA 3MO8A 3OY9A 3E19A 2R5MA 5CKHA 3CD6A 4C8QF 5GAOm 2D6FA 1BYMA 4PJOF 3CCSA 2GFAA 2IG0A 5CK9A 3FIFA 3JCMd 3P8BB 3S6WA 5GANf 4C8QE 3LH0A 3JAME 3OYGA 2CKKA 3C94A 4OMFB 4PL6A 4RMOA 2M1HA 3ZEHA 2DTOA 1WJRA 3CMAA 1S72A 1XNIA 5GAMf 5C0MA 5CR2A 5D6WA 3KUFA 3M54A 1JJ2S 2D9TA 3CCVA 3A8MB 3GLXA 3MEWA 2DXCA 4XTWA 1KQSA 2ZCFB 3GNFB 1U1SA 2RI2A 2DD5A 4M75C 3ZBDA 5GAN8 3GIBA 3QDRB 1FWZA 3CC4A 3T9NA 3OYBA 5LL6S 3CCUA 4J7IA 5GANh 3CC7A 4QQGA 1H641 1KQ1A 3N5BB 5LJ5j 4QW2A 1BI0A 1Y71A 3ER0A 4E7HA 2FVUA 4KT0E 5CO7A 4OB0B 2CZ0B 3QG1A 3SB2A 2OTLA 4N4GA 4M75B 5GAMh 3QZ5B 3CCVT 2L89A 3FDRA 3CPFA 2XK0A 1B34B 2RM4A 3OQ5A 1QVFA 3DLLA 4IUVA 3JB9H 4BDYA 2H3JA 3CXCS 4EDUA 3HRUA 3QO3A 2K3XA 5GMKj 2R5AA 2P0PA 4C0GA 4JJNK 3FRNA 1VQOT 2RI3A 4M75E 2RH2A 3VJPA 4JRIA 4M7AG 1OI1A 3OS1A 3OYEA 3I55A 3MEUA 3BDUA 3PMIA 2E6ZA 2MWPA 2RD1A 3VKIA 3PIOA 3X24B 3CC2A 4OVAA 2RJFA 4M7AD 2VGMA 1G3TA 2M0OA 4JS4A 5LJ3g 5FU6C 3M4YA 2MAMA 2X4WA 2Y4XA 2LRQA 5KCOA 2XDDA 3JCMX 1OZ3A 4NS5A 3CPWS 4ZTJA 1B34A 4C92C 2RJCA 4VUBA 2DO3A 4MMKA 2CS7A 2RJEA 3NFCA 1Q81U 3LX7A 3OYFA 3BDLA 4C0FA 3OW2A 2GCXA 4F7UE 3URGA 2K57A 4BDZA 3LW5E 4EMKB 5EG2A 3Q1JA 3FB9A 1JJ2A 2R58A 2QA4A 4B9XA 2QTXA 4ZGJB 2D0QB 2LX9A 4ZN3A 3J80E 2QEXT 3M56A 3HKSA 2K2VA 4C92F 3JB9G 1M5Q1 4XU2A 4LDYA 5J39A 3OSVA 3M58A 4RCBA 3HPWA 1UB4A 5A0GA 5CKEA 4E47A 2RK1A 4C92E 5KE2A 1Q7YU 4BI8B 5LJ3e 2LDMA 4ME7A 3JB9D 2P0KA 1M4ZA 4XTZA 3I56A 3RKXA 1VQ6A 2RHXA 3OYMA 5GAN7 4MZTA 1M90U 2DZ9A 4M77C 2KDSA 3PMTA 4EMKA 2KVQG 3CBMA 1YBYA 5GAOr 1U8RA 4OGEA 4BI3A 3JRZA 5CKDA 3RIRA 1N27A 2XD0A 5GAOp 3CXCA 2EYQA 5D6XA 3G6ET 1HXDA 3JCMb 3MEAA 5LJ3d 1M1KU 4BY6B 5GANj 4XTXA 4C0DC 1VQ7A 3G71T 5AYFA 3UPUA 1JRIA 3OYKA 3QSUA 1QP3A 3VV0A 4KUDK 2DXBA 3I56T 1VQNA 3A8GB 3M53A 4A53A 4M77F 4A4EA 5LJ5g 5GAMj 3OYAA 4QQDA 1NJIC 4M7DG 1VQ5T 2L8DA 2FL7A 1VQLT 1RL2A 4HCZA 4CRIA 4M77E 3JB9J 2G3RA 5GMKh 3OYYA 1YJ9A 4M7DD 1QVGS 3RKYA 2DXUA 5L8RE 4RG2A 3CPWA 2O4XB 3C4SA 2ZPGB 5J26A 1UGPB 3EFSA 5HK0A 1VQ7T 4M78B 4UC4A 3TEEA 3BFMA 3OA6A 3JCMJ 2OAUA 2DPPB 4Q5WA 4C8QC 3L2UA 1X01A 4MZPA 4PJOC 2A3LA 2YLCA 3PFSA 2P4TA 5C6SA 4BB7A 2LQKA 2RJDA 1MHNA 1KC8U 4GY5A 5IAYA 2KSSA 4E7LA 1MGQA 2DTIA 2JOYA 2O01E 4OGCA 3TREA 5FLXE 1IZ6A 4C8QB 1UGRB 5CQYA 4GLKA 2VUBA 4CI0C 3OYHA 4XTYA 4A4GA 2BUDA 2O4XA 3GPLA 4L6V5 1NE8A 4ATOA 4C5IA 2F69A 4HKEA 2FHDA 2DIGA 4M78D 1PSEA 4M78A 1KQ2A 3OYIA 4PJOE 1TH7A 2A7YA 1Y96B 4L59A 2QQAA 4IURA 3M4GA 1WQWA 2K5LA 2E70A 1ZBXA 2RO0A 4LD6A 5LJ5d 4XQ3A 2DXTA 1QW1A 5GAN4 3OB9A 1YJWA 3V8KA 1PSFA 3QIIA 4NL2A 3CBOA 1M1FA 3G7ZA 4FSXA 4MDWA 2DTHA 4PLLA 3WVDB 5DLOA 4C8QA 2M9UA 3CCRA 3ZFJA 4LDXA 3L2ZA 3M57A 2V8IA 3L2VA 3FLGA 3CCLT 3META 3CCQT 1R8OB 4DOVA 2GFUA 3QYGB 2WACA 4O6JA 1VQOA 2FB7A 5CVIA 5FROA 1M1KC 1G3WA 4TVRA 1YJWT 3OSSC 4N0AC 5GMKm 3OBYA 1K73C 2EJGA 3CCJT 4XU1A 5GANg 2BIVA 4IUUA 4Y28E 2ZGWA 3MEVA 1ZHIA 4EPCA 1I81A 2E41A 4IUPA 3CCRT 4ZTFA 5GAMg 3ME9A 1K9MC 4OB1B 3HRTA 5FU7C 1VIEA 3LWHA 4R56A 1JB0E 3RESA 1OZ2A 2VC8A 1UGSB 3HP9A 3M59A 4HA8A 3RUXA 1X75C 2KMTA 2RI5A 3P8HA 2QQRA 2EQKA 5GAOn 4C5EA 2QEXA 1XQHA 4F7UB 1G5VA 3C12A 2E64A 5FU7B 3VUBA 2LVMA 1YIJT 4FIBA 4M75D 4M7AF 4M75A 2I2LA 3V8LA 3S3MA 1BI2A 3FEOA 4A4HA 3DKMA 1WNLA 5FRMA 3JSCA 2LCLA 3UT1A 2EJ9A 2HNIA 5GANe 3SWNC 4M7AE 2ZZDA 4N0AA 3MP6A 5FU6B 2HD0A 3OYDA 2PVOB 4FM4B 4C5HA 1Q82U 2LT4A 4BE1A 2EQJA 5J3BA 3HFNA 3VYHB 1KHCA 4QQ6A 3H6ZA 5HK3A 2RB6A 4D6WA 3HFOA 4C92B 1K8AU 3LLRA 4XTUA 1BI1A 3SWNB 4JRQA 1RI0A 2EWNA 5DM7R 1VQ9A 2CZ6B 4LDUA 3V8JA 3G6EA 3G4SA 2LNVA 4IUTA 4F7UA 5GANd 4BACA 3CEYA 3E9FA 3G71A 4KULA 1N9SA 1BKBA 4NOYA 1QP2A 4JLIA 3VYGA 1D3BB 5GAMd 1VQ5A 1WQ7A 4JDSA 3JB9F 2K4YA 1VQLA 3JCMf 4J5YA 2VXFA 4KUIA 5CQXA 5HKCA 4C92A 1VQ9T 3MCAB 2X4JA 3BY7A 3SWNA 1O9SA 4J83A 3QPHA 3FC3A 1N9RA 3G4ST 4BUGA 4XU0A 4QVDA 1YI2T 4M77B 1N8RU 1KD1U 4FT2A 4A54A 4OF1A 4JS5A 3HHTB 4M7DC 1W2BS 5M9OA 5I21A 2VXEA 5IT9E 1NPRA 2X4XA 4A4FA 1D3BA 2JUFA 3JCMQ 1SSFA 5CCAA 3EFRA 4C0DB 2C06A 1I8FA 1WJSA 2XI9A 3A8LB 3PNWC 3NTKA 2PUOB 3MP1A 1VQKT 1M9SA 3JCMh 2V8JA 3PIPA 4BE2A 2OTJT 2HAXA 3LGFA 1LNXA 4RCCA 2RK2A 4J8OA 4M7DF 3VUZA 2DVEA 3R6OA 2R57A 2KAFA 2E5QA 4M77D 3QYHB 4M77A 2QXFA 3L2QA 4C5GA 4M7DE 1XOVA 3L42A 1LOJA 1YHQT 2XDBA 2L3RA 4LDWA 2QI2A 2RA2A 2MI6A 5CKBA 2E65A 3QUIA 1KHIA 2PUKB 5HY6A 4XU3A 3F70A 4EMGA 5LJ5e 1Q81C 1BIBA 2XIDA 3DB4A 1G3YA 3KBGA 4PJOB 3HSBA 4LDVA 5GMKi 1Q86U 4IKFA 3ASKA 2WSCE 1Q82C 1FX7A 1Y7XA 3NTHA 2VV5A 3HRSA 4M78G 3UDCA 3RERA 1H3ZA 2MF2A 4RKUE 3DB3A 2ZPHB 3DLMA 4RG8A 1VQMT 1FXXA 3CCLA 5A0DA 4B9WA 3CCQA 3CCMA 5GMKe 2XDPA 4PNOA 2CZ1B 2L5QA 2PVGB 2F5TX 2K3YA 2X35A 3V7CA 2F5KA 4PLIA 4C8QG 4QVCA 4E7IA 2DEQA 1Q7YC 4FU6A 3PGGA 3A5ZB 3OS0A 1VQ4T 3CCJA 4PKCC 3X20B 3TU4K 1BIAA 2XG8D 2YHTA 1M90C 4C8QD 2M16A 2ZPIB 4PJOD 3PT9A 4PJOA 1VQ8A 2DJZA 4N4HA 4ELYC 1W2BA 4KBMB 4DQ2A 2B8AA 3A8OB 3RKWA 1O75A 2EFIA 3GF5A 1LJOA 1YCYA 3MP8A 3P8DA 4LD9K 1M8VA 4QVZA 5GAOq 4J7FA 1V29B 3RMSA 3GOXA 1G3SA 3OBWA 1Y96A 1QVGA 2PU9B 1N8RC 1KD1C 4DA4A 3OW2S 2DD4A 4JLGA 3CMEA 2ZPEB 3QXEB 4ZGDB 3S3OA 1YIJA 2XHCA 2BKDN 2LTOA 3S3NA 2QDYB 1VQ8T 1KG1A 3E1SA 2JNGA 4XK8E 1EIFA 3QBYA 4MZMA 3CD6T 4M7AC 4DOWA 5GAN3 3M5AA 3CCST 2MMPA 3CCEA 4HCCA 1NPPA 4R55A 1UGQB 5GAOl 5LJ3f 4XTVA 2EIFA 5DLQE 3JCMV 1X6OA 2LQ8A 4E7JA 4JRKA 4L5GA 3HL8A 1ZQ1A 2CYZB 2PQWA 2RHYA 3OYNA 2DKGA 4M75G 2JVVA 2WSFE 4M7AB 3CMET 3A8HB 1VQPA 1S72T 4V2SA 2EQMA 5IN1A 1QVPA 3X25B 4A4KA 3FJPA 1KC8C 2E6NA 1GXIE 3PTAA 4JRPA 3J81E 4HT8A 1IREB 3SD4A 4J6YA 3JCMP 2JTFA 5A2QE 1NJIU 5CAIA 2HQEA 3MHXA 2XKOC 1WJQA 4WF2A 2HQXA 4M75F 1DJ7B 2MWOA 3CCET 4Y91A 3AHUA 1Q86C 5GAN5 1VIFA 3CC4T 4C0ZA 5GAMe 3V7SA 2X4YA 3CCUT 2DIQA 5LJ3h 3CC7T 4F7UG 1BI3A 5A0LA 3VU3C 1W4SA 1VQPT 5CKFA 2GF7A 2K5FA 3OYJA 2QQ9A 2K5IA 3NTIA 3OMCA 2Y4YA 5GAN6 4M7AA 2OTLT 3L2WA 5GMKl 3OMGA 3QHSA 3OYLA 4P5NA 4MDXA 1YI2A 4EMKC 4E7KA 3OYCA 4BI4A 2JN0A 2RHZA 4F7UF 4X9DA 1U1TA 2DAQA 1VUBA 2CZ7B 2HBPA 2RHUA 3EAEA 3INZA 1NZ9A 3KXTA 4Z02A 2QQSA 4C92G 3I55T 2VYTA 2DZCA 2QQBA 2ZPFB 3WVEB 1YITA 3CMAT 2EQUA 1WGSA 3LGLA 3M55A 4C92D 1VQKA 3E9GA 4HT9A 3CC2T 3SDZA 2GQVA 4FL6A 2OTJA 4BD3A 5LJ5f 1UEBA 3L1AA 4NL3A 2LC4A 3OS5A 1OYXA 5KH6A 2LCCA 4II1A 4ELZC 4X9CA 4ZGEB 5FRNA 5KCHA 5KE3A 2JTMA 3OS2A 3QJYA 3M9QA 4JUVA 1YHQA 2Y90A 4X34A 4FT4A 5GAN2 4IUQA 3UWNA 4OB2B 3QKJA 4BY6C 1YITT 3X26B 2QA4T 3GNGA 3SFMA 4M7DB 2FYKA 2WSEE 4EMHA 1WPYA 2CGHA 4M77G 3TCJA 1P92A 2IVWA 4MMLA 1XTDA 1N6AA 3JB9I 1VQMA 2JZ2A 1M1GA 4ZN1A 3JCMg 1YJNA 5LJ5h 4BE0A 5DY9A 4OP0A 1KQSS 3JCMW 3O8VA 1K73U 4J6WA 3V7RA 4HCBA 1AHJB 2EJFA 2XICA 4YTLA 1VQ6T 4O5VA 5D6YA 2EAYA 1Y07A 2KK4A 4M78C 1VQ4A 2E12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFI A;  2RI5 A;  3P8H A;  2LDM A;  2QQR A;  2EQK A;  3MP8 A;  2P0K A;  3P8D A;  4C5E A;  1G5V A;  4QVZ A;  2RHX A;  2LVM A;  3OYM A;  3GOX A;  3L2R A;  4N4I A;  3S3M A;  3FEO A;  4A4H A;  5FRM A;  3UT1 A;  3PMT A;  3H8Z A;  3LYI A;  3S3O A;  3MP6 A;  1N27 A;  3OYD A;  2BKD N;  2LTO A;  3S3N A;  4C5H A;  2RHI A;  4BE1 A;  2EQJ A;  5D6X A;  3MEA A;  1KHC A;  4QQ6 A;  3H6Z A;  3QBY A;  3LLR A;  3OYK A;  1RI0 A;  2NLU A;  2EKO A;  3QJ6 A;  4A4E A;  3OYA A;  2YRV A;  5CIU A;  3MO8 A;  3OY9 A;  4QQD A;  4IUT A;  4E7J A;  2L8D A;  4BAC A;  3CEY A;  2R5M A;  2RHY A;  2PQW A;  3E9F A;  4HCZ A;  4CRI A;  3OYN A;  2G3R A;  2GFA A;  2IG0 A;  2EQM A;  5IN1 A;  3S6W A;  3OYG A;  3LH0 A;  2CKK A;  2E6N A;  4PL6 A;  4RG2 A;  2O4X B;  3C4S A;  2M1H A;  3SD4 A;  3ZEH A;  5J26 A;  1WJR A;  2JTF A;  2HQE A;  4UC4 A;  3OA6 A;  1WJQ A;  1XNI A;  2HQX A;  4Q5W A;  5C0M A;  2MWO A;  3L2U A;  5D6W A;  3KUF A;  2D9T A;  3PFS A;  5C6S A;  2RJD A;  3FC3 A;  1MHN A;  3MEW A;  4GY5 A;  5IAY A;  2X4Y A;  4E7L A;  2DIQ A;  2GF7 A;  3OYJ A;  3OMC A;  3NTI A;  5M9O A;  2RI2 A;  3L2W A;  2X4X A;  3OMG A;  4A4F A;  3OYL A;  3OYB A;  1SSF A;  4E7K A;  3OYH A;  4A4G A;  4QQG A;  2BUD A;  2O4X A;  3OYC A;  2RHZ A;  1WJS A;  3PNW C;  4QW2 A;  4C5I A;  3NTK A;  4E7H A;  2FHD A;  2DAQ A;  2DIG A;  3EAE A;  3MP1 A;  2RHU A;  3OYI A;  4BE2 A;  4N4G A;  4Z02 A;  4L59 A;  2L89 A;  2QQS A;  3FDR A;  3LGF A;  2XK0 A;  4IUR A;  3OQ5 A;  2RO0 A;  4IUV A;  2VYT A;  4LD6 A;  4BDY A;  2R57 A;  4EDU A;  3OB9 A;  2EQU A;  1WGS A;  2K3X A;  2E5Q A;  3LGL A;  3QII A;  3E9G A;  3L2Q A;  4C5G A;  2R5A A;  4FL6 A;  4PLL A;  2RI3 A;  3L42 A;  4BD3 A;  2L3R A;  1OI1 A;  3OS1 A;  1OYX A;  3OYE A;  5KH6 A;  2LCC A;  4II1 A;  3MEU A;  3PMI A;  2MWP A;  5KCH A;  3F70 A;  5KE3 A;  3OS2 A;  3L2V A;  3FLG A;  4OVA A;  2RJF A;  3DB4 A;  3MET A;  2GFU A;  2M0O A;  2WAC A;  3M9Q A;  4IKF A;  3ASK A;  5FRO A;  4X34 A;  3NTH A;  4IUQ A;  2X4W A;  3UWN A;  1H3Z A;  2LRQ A;  5KCO A;  3DB3 A;  3DLM A;  3QKJ A;  1OZ3 A;  4NS5 A;  4ZTJ A;  2RJC A;  4B9W A;  2RJE A;  3LX7 A;  3OYF A;  3BDL A;  2BIV A;  2XDP A;  4IUU A;  3MEV A;  4BDZ A;  2K3Y A;  2X35 A;  2JZ2 A;  2F5K A;  3Q1J A;  4IUP A;  2R58 A;  4PLI A;  4BE0 A;  4E7I A;  4ZTF A;  4B9X A;  4FU6 A;  3ME9 A;  3OS0 A;  3O8V A;  2M16 A;  1OZ2 A;  4N4H A;  5D6Y A;  5J39 A;  5FRN A;  2B8A A;  5KE2 A; 
#chains in the Genus database with same CATH topology
 4HCK A;  2PVD B;  3QZ9 B;  1K9M U;  4OB3 B;  3C95 A;  4N4I A;  1K8A C;  1I5L A;  2E10 A;  1YJN T;  5LJ3 j;  3LYI A;  4M78 F;  2RHI A;  3JCM e;  3UA7 A;  1HK9 A;  2ZPB B;  4J6X A;  3CCM T;  2YXY A;  1I4K 1;  2YLB A;  2X9H A;  2NLU A;  3CBP A;  3JCM c;  2EKO A;  2R5M A;  1K0S A;  1K9A A;  2GFA A;  8AT1 B;  3FIF A;  3P8B B;  4C8Q E;  3C94 A;  4RMO A;  3CCJ Q;  2F2W A;  2M1H A;  2DTO A;  1OX9 A;  1WJR A;  1S72 A;  1VQ8 Q;  5GAM f;  5C0M A;  2FO0 A;  1WFW A;  2D9T A;  1SG5 A;  3MEW A;  2C0T A;  1R77 A;  5I11 A;  1WZO A;  2RI2 A;  2DD5 A;  3CME Q;  4A63 B;  3GIB A;  3THK A;  4QQG A;  3N5B B;  1BI0 A;  3QG1 A;  1SF9 A;  1Y0M A;  4N4G A;  3QZ5 B;  3CCV T;  3FDR A;  3CPF A;  1B34 B;  3HTR A;  3DLL A;  4IUV A;  1W1F A;  1X2Q A;  5GMK j;  2R5A A;  2P0P A;  4C0G A;  2RI3 A;  2RH2 A;  4M7A G;  1N5Z A;  2LJ1 A;  3MEU A;  3BDU A;  1T3S A;  3PMI A;  3VKI A;  3PIO A;  1JQQ A;  2J6O A;  4M7A D;  1PRL C;  4JS4 A;  2M0O A;  2DER A;  2X4W A;  2Y4X A;  2L2P A;  3CPW S;  4ZTJ A;  2RJC A;  4VUB A;  1KFZ A;  2RJE A;  1Q81 U;  3URG A;  3LW5 E;  5EG2 A;  2R58 A;  3G4S Q;  4KGX B;  2QA4 A;  3VS7 A;  4ZN3 A;  1AWX A;  2D0Q B;  2EYY A;  3EG0 A;  2EVR A;  3H9N A;  5A0G A;  1UB4 A;  4BI8 B;  2P0K A;  3OYM A;  4MZT A;  1TUC A;  4FYX B;  5GAO r;  3PMT A;  4EMK A;  3CBM A;  1U8R A;  3EHQ A;  2QAZ A;  4BI3 A;  1N27 A;  5KYN A;  3JCM b;  4XTX A;  1CSK A;  3G71 T;  2F2X A;  3UPU A;  1OU9 A;  2CP2 A;  4RTY A;  4KUD K;  3I56 T;  1RAG B;  3M53 A;  4M77 F;  1AWJ A;  1NG2 A;  2EYX A;  4QQD A;  1OPK A;  4RTT A;  3JB9 J;  4CRI A;  1TG0 A;  2O4X B;  2ZPG B;  2FPE A;  4HVV A;  1QWE A;  1VQ7 T;  4C8Q C;  3L2U A;  2D0N A;  4GY5 A;  1UEC A;  2KSS A;  1K1Z A;  1IGU A;  4OGC A;  1T0J A;  1Y57 A;  4E7S A;  4CC4 B;  4AG2 C;  4A4G A;  4ATO A;  2F69 A;  1M8M A;  1KQ2 A;  4PJO E;  2EGA A;  2A7Y A;  4L59 A;  4IUR A;  5IXF A;  2KYB A;  1G83 A;  3CD6 Q;  1M1F A;  4FSX A;  3CCS Q;  2DTH A;  2COW A;  2EW3 A;  3ZFJ A;  1Q82 R;  3L2Z A;  1K8A R;  2F1L A;  4TVR A;  4JZ4 A;  3UF4 A;  2ECZ A;  3OBY A;  2YWW A;  3CCJ T;  2BIV A;  4IUU A;  4JJD A;  4IUP A;  2FZC B;  4ZTF A;  3CC4 Q;  2FPF A;  1I5O B;  3M59 A;  1WLP B;  2OTL Q;  2D1X A;  3H0H A;  5GAO n;  2EQK A;  1G5V A;  1N8R R;  1XQH A;  4PFZ A;  4F7U B;  1KD1 R;  5KYX A;  5FU7 B;  4M75 D;  2HEQ A;  1JU5 C;  2CH4 A;  1WNL A;  3JSC A;  5GAN e;  3I55 Q;  2ZZD A;  1YP5 A;  2KXD A;  4C5H A;  4RTU A;  1Q82 U;  4BE1 A;  2KT8 A;  2EQJ A;  2YUO A;  1K8A U;  4D6W A;  4C92 B;  3SWN B;  1Z9Z A;  1RI0 A;  3V8J A;  4OMP A;  3CEY A;  3G71 A;  1BKB A;  1QP2 A;  5FWC A;  3NGP A;  5GAM d;  3JB9 F;  4KUI A;  5CQX A;  1C0M A;  2X4J A;  1TTH B;  3G4S T;  3QWY A;  1VQ6 Q;  4QVD A;  1N8R U;  1KD1 U;  4FT2 A;  3HHT B;  2NUP A;  5IT9 E;  1NPR A;  2M02 A;  2X4X A;  4A4F A;  1D3B A;  2JUF A;  5CCA A;  5KYY A;  1PD0 A;  2XI9 A;  1UHF A;  2FRW A;  4ORZ A;  2CP5 A;  3JCM h;  2V8J A;  3PIP A;  2LQN A;  2RK2 A;  4J8O A;  1VQN Q;  2QGG A;  2DVE A;  3LH5 A;  3TSW A;  2KAF A;  2E5Q A;  1KQS P;  4C5G A;  2JW4 A;  1TSF A;  1LOJ A;  2L3R A;  3REB B;  4CC7 A;  2RA2 A;  5CKB A;  3QUI A;  1WYX A;  4EMG A;  1GCP A;  3M0T A;  3DB4 A;  3KBG A;  1EFN A;  2CUD A;  3ASK A;  4M78 G;  2VV5 A;  1QCN A;  2ZPH B;  1ACM B;  2O88 A;  1WHG A;  4RTV A;  1QVF P;  5GMK e;  4J9H A;  2PVG B;  2HSP A;  2X35 A;  3V7C A;  2CUB A;  1NEB A;  4E7I A;  3H0F A;  3CCJ A;  1NYF A;  2JM9 A;  1BIA A;  3X20 B;  2FEI A;  2A0F B;  2M16 A;  3A1P A;  3PT9 A;  1VQ8 A;  1W2B A;  4KBM B;  3RKW A;  2EFI A;  1WX6 A;  1YCY A;  4HVU A;  1YJW Q;  4LD9 K;  4J7F A;  1V29 B;  1VYU A;  1Y96 A;  1QVG A;  1K76 A;  4DA4 A;  3OW2 S;  4JLG A;  3CME A;  3QXE B;  4ZGD B;  3CCR Q;  1JJ2 P;  2XHC A;  2AZS A;  2BKD N;  2VWF A;  3E1S A;  1VQO Q;  1EIF A;  3CD6 T;  3CCS T;  5GAO l;  5LJ3 f;  2EIF A;  1G2B A;  1ZQ1 A;  2RHY A;  2K9G A;  2EQM A;  2RMO A;  2KRO A;  4JRP A;  1PG5 B;  3SD4 A;  3JCM P;  3MHX A;  3CXC P;  4Y91 A;  2JTE A;  1BCO A;  5GAN 5;  3CC4 T;  3V7S A;  1AWO A;  5CKF A;  2O9V A;  2K5F A;  1TWB A;  2QTV A;  2RQR A;  4M7A A;  2MOX A;  2OTL T;  3OYL A;  1RAA B;  1J3T A;  1TOV A;  1VUB A;  2CZ7 B;  2HBP A;  2YUQ A;  4Z02 A;  2QQS A;  1HD3 A;  3I55 T;  2ZPF B;  3WVE B;  1X27 A;  2KNB B;  1UE9 A;  4PJL A;  2DLP A;  2DRM A;  4FL6 A;  2AK5 A;  4NL3 A;  5KH6 A;  4ELZ C;  3QWX X;  5IHI A;  2JTM A;  3OS2 A;  1VQL Q;  2GGR A;  3GBQ A;  1YIT T;  3SFM A;  4M7D B;  2O9S A;  2FYK A;  1FYN A;  4EMH A;  2COZ A;  4M77 G;  2IVW A;  4MML A;  2ZAE A;  3JB9 I;  5LJ5 h;  4BE0 A;  1OOT A;  1PD1 A;  1KIK A;  2ED1 A;  4PJM A;  1KQS S;  3V7R A;  1VQ6 T;  1AHJ B;  2EJF A;  4O5V A;  2L3Q A;  4J9G A;  1X2K A;  4M78 C;  4FYY B;  4KRT A;  2E12 A;  1LVK A;  1X69 A;  3H8Z A;  1QVF S;  1JO8 A;  1VQN T;  4LN2 A;  2K2M A;  2KQW A;  3QJ6 A;  1CKB A;  2YRV A;  5CIU A;  3OY9 A;  1UJ0 A;  2HSE B;  3CD6 A;  1BYM A;  5GAO m;  4PJO F;  3CCS A;  3LH0 A;  4CC3 A;  4PL6 A;  2DL3 A;  3ZEH A;  1E7O A;  1JJ2 S;  3A8M B;  1YCS B;  2DFU A;  3FJ5 A;  1KK7 A;  3IQL A;  3ZBD A;  5GAN 8;  2RN8 A;  3QDR B;  1FWZ A;  3CC4 A;  2CSI A;  3OYB A;  1YIJ Q;  4J7I A;  5GAN h;  3TSZ A;  5LJ5 j;  1ZX6 A;  4JZ3 A;  4E7H A;  1MV0 B;  2FVU A;  4OB0 B;  3SB2 A;  2OTL A;  2LCS A;  2L89 A;  1PWT A;  3C0C A;  2XK0 A;  2KXC A;  3JB9 H;  2RQV A;  3CXC S;  1TUG B;  2K3X A;  2DBM A;  4JJN K;  2E3I A;  1VQO T;  4PJJ A;  2MYS A;  3EG9 A;  3OYE A;  3I55 A;  3H41 A;  4M4Z A;  2E6Z A;  4F17 A;  2KR3 A;  3X24 B;  2RJF A;  2BE9 B;  1PNJ A;  2MAM A;  1OZ3 A;  4NS5 A;  5KYU A;  2L3P A;  1OPL A;  2K57 A;  1K9M R;  2DEU A;  3M0S A;  1X6G A;  3Q1J A;  4B9X A;  2QTX A;  1M3B A;  1YI2 Q;  4FW1 A;  3M56 A;  3HKS A;  1IO6 A;  4C92 F;  3JB9 G;  1M5Q 1;  5J39 A;  4LDY A;  3OSV A;  3M58 A;  3HPW A;  5KE2 A;  1OUL A;  2LDM A;  2OAW A;  3JB9 D;  3RKX A;  1VQ6 A;  1X6B A;  2GBQ A;  5KYY B;  5GAN 7;  1VQK Q;  2BZY A;  2DZ9 A;  2GNC A;  4E6R A;  4M77 C;  2RNA A;  3RNJ A;  2EPD A;  3AT1 B;  2X51 A;  4OGE A;  3JRZ A;  2XD0 A;  5GAO p;  2EYQ A;  4E7Z A;  1HXD A;  5LJ3 d;  1PHT A;  4BY6 B;  5GAN j;  4C0D C;  1JRI A;  3QSU A;  1QP3 A;  1VQN A;  3EH2 A;  1NJI C;  3G1J A;  2L8D A;  2FL7 A;  1VQL T;  5GMK h;  2AKL A;  3RKY A;  1M2V B;  3CPW A;  1NM7 A;  1UGP B;  3JV3 A;  2KGT A;  3OA6 A;  4PFO A;  2DPP B;  4MZP A;  2YLC A;  2P4T A;  2RJD A;  1MHN A;  4E7L A;  2HCK A;  1MGQ A;  2DL5 A;  2RQT A;  4QKU A;  1WXB A;  4LXC A;  5FLX E;  1IZ6 A;  4C8Q B;  1UGR B;  2OX7 A;  4GLK A;  2VUB A;  3GPL A;  1NE8 A;  4M78 A;  3OYI A;  1Y96 B;  2F2V A;  1WQW A;  1ZBX A;  5GAN 4;  1YJW A;  2DXT A;  1QW1 A;  3QII A;  4NL2 A;  4AFZ C;  3CBO A;  5DLO A;  3WVD B;  2DYI A;  1Q81 R;  1QKX A;  3M0U A;  3CCR A;  3L2V A;  1OX8 A;  3QYG B;  1VQO A;  2FB7 A;  5CVI A;  1M1K C;  2FZK B;  2H8H A;  3EFO B;  5GMK m;  3M0R A;  1K73 C;  2EJG A;  4Y28 E;  5D7U A;  2ZGW A;  2QK0 A;  2E41 A;  5GAM g;  3ME9 A;  3CCU Q;  3VS2 A;  3VS1 A;  3VS6 A;  3CC7 Q;  4RTW A;  2VC8 A;  3HP9 A;  1UGS B;  1VOM A;  5GJV B;  3RUX A;  1RUW A;  1X75 C;  3P8H A;  2QQR A;  2QGF B;  1YIJ T;  1BI2 A;  1U3O A;  5FRM A;  2HNI A;  4M7A E;  2LP5 A;  1Q95 G;  4N0A A;  3MP6 A;  5FU6 B;  2HD0 A;  3VYH B;  2ROT A;  3HFN A;  2K6D A;  1KHC A;  3MKD A;  3H6Z A;  3TVT A;  3LLR A;  4XTU A;  4GLM A;  1VQ9 A;  4LDU A;  2LNV A;  2JS2 A;  4KUL A;  1YWP A;  1GFD A;  1VQL A;  1Q86 R;  4OMO A;  3JCM f;  4J5Y A;  5HCK A;  5HKC A;  3BY7 A;  2CP7 A;  4J83 A;  1EZZ B;  3FC3 A;  1YI2 T;  5FWB A;  1RAD B;  2EGE A;  4JS5 A;  5I21 A;  1GCQ C;  3EGD A;  3JCM Q;  1WI7 A;  2C06 A;  1WJS A;  3A8L B;  3PNW C;  2PUO B;  1VQK T;  1M9S A;  1Z9Q A;  3EG2 A;  3LGF A;  4M7D F;  2LNH B;  4J9C A;  4J9I A;  1RAC B;  4M77 A;  1XOV A;  1B3Q A;  3L42 A;  1IHV A;  2E65 A;  1BBZ A;  4XU3 A;  5LJ5 e;  1BIB A;  4PJO B;  1IXD A;  4LDV A;  5GMK i;  1Q86 U;  4IKF A;  1FX7 A;  4RKU E;  3DB3 A;  1G8X A;  2ABL A;  1FXX A;  1ZBJ A;  4B9W A;  5IHK A;  1UTI A;  2QDL A;  4QVC A;  1Q7Y C;  3SEM A;  3OS0 A;  3PGG A;  4DEY A;  4PKC C;  3VS3 A;  1NJI R;  5IHN A;  1M90 C;  3CQT A;  4PJO D;  1B07 A;  4ELY C;  3TQ7 P;  2NUT B;  4KH0 B;  3A8O B;  1M8V A;  4QVZ A;  2DMO A;  2A28 A;  3OBW A;  3OW2 P;  2J06 A;  1V1C A;  2DD4 A;  2ZPE B;  2HMA A;  2K79 A;  1HYO A;  1WXU A;  1YIJ A;  2QDY B;  1VQ8 T;  1KG1 A;  8ATC B;  4M7A C;  3M5A A;  2E4H A;  1NPP A;  1OV3 A;  2SEM A;  1X6O A;  4OML A;  1FMW A;  4JRK A;  2L3S A;  3HL8 A;  1RAI B;  2PQW A;  4M75 G;  2JVV A;  2WSF E;  3CME T;  1WDX A;  3A8H B;  1C6V X;  5IN1 A;  1QVP A;  1KC8 C;  4HT8 A;  2JTF A;  1NJI U;  5CAI A;  2XKO C;  1DJ7 B;  2MWO A;  3AHU A;  1W70 A;  3SHW A;  3CCU T;  2BE7 D;  3CC7 T;  4F7U G;  1W4S A;  2EGC A;  3OYJ A;  5GAN 6;  2K5I A;  2Y4Y A;  4JJB A;  1YI2 A;  1K73 R;  4E7K A;  2BZ8 A;  4BI4 A;  4J9F A;  1FMV A;  2DAQ A;  3EAE A;  2RHU A;  1NZ9 A;  2EYZ A;  4C92 G;  2VYT A;  3G6E Q;  2EQU A;  3LGL A;  1PRM C;  4C92 D;  4HT9 A;  1VQK A;  2EYW A;  2GQV A;  3NHN A;  5LJ5 f;  2DF6 A;  3L1A A;  4II1 A;  3ZL7 C;  4X9C A;  1X43 A;  3M9Q A;  2Y90 A;  4FT4 A;  4OB2 B;  3X26 B;  4RUG A;  3GNG A;  2PTK A;  1E6G A;  2YSQ A;  2CGH A;  3TCJ A;  2JZ2 A;  1M1G A;  2KRN A;  2KE9 A;  1ZSZ A;  3JCM W;  3O8V A;  1K73 U;  4HCB A;  1AZE A;  5D6Y A;  2XU8 A;  1BCM A;  1QVG P;  3U23 A;  2JS0 A;  1SHF A;  4XAX B;  1GCQ A;  1IB8 A;  1JBM A;  2AHJ B;  3BW1 A;  1M2O A;  1PCX A;  2V8K A;  2MIO A;  2DK3 A;  2JXB A;  3RMQ A;  4M78 E;  2LT1 A;  1AVZ C;  2P0Q A;  1WXT A;  3CCL Q;  5I2M A;  1QWF A;  3MO8 A;  1D1A A;  2E3H A;  5CKH A;  4C8Q F;  3JCM d;  1I0C A;  2NWM A;  5GAN f;  3OYG A;  3JAM E;  1XNI A;  2L0A A;  5CR2 A;  5D6W A;  3M54 A;  3GLX A;  2DXC A;  1KQS A;  3M0Q A;  2XMF A;  2ZCF B;  1GRI A;  3GNF B;  4M75 C;  2FZG B;  3T9N A;  4FCY A;  3CCU A;  2Z0W A;  3CC7 A;  3RDV A;  4QW2 A;  1Y71 A;  2VAS A;  3ER0 A;  2DE0 X;  2KYM A;  3VS5 A;  4KT0 E;  5CO7 A;  2C0I A;  1Q7Y R;  3CCE Q;  4DBF A;  3MJX A;  1QVF A;  4BDY A;  4EDU A;  5KYW A;  2CSQ A;  2GTO A;  1NBE B;  3OS1 A;  1D09 B;  4AMC A;  2MWP A;  4OVA A;  1G3T A;  5LJ3 g;  2YT6 A;  2LRQ A;  3JCM X;  1B34 A;  4C92 C;  2DO3 A;  2CS7 A;  1IGQ A;  3OYF A;  3BDL A;  2IIM A;  4GBQ A;  1VQ9 Q;  4EMK B;  1JJ2 A;  2FG0 A;  1XJW B;  2LX9 A;  3J80 E;  2HL5 C;  2HBW A;  1PKT A;  2A36 A;  2RK1 A;  1PM3 A;  2EQI A;  1Q7Y U;  1BU1 A;  1KC8 R;  1M4Z A;  4XTZ A;  1M90 U;  2DM1 A;  2KDS A;  1SPK A;  5CKD A;  3RIR A;  3CXC A;  2ESW A;  3G6E T;  2PZ1 A;  2X3W D;  4Y92 A;  5AYF A;  3A8G B;  4A4E A;  3OYA A;  4M7D G;  1RAB B;  4X1V A;  4HCZ A;  2FPD A;  4M77 E;  1VQM Q;  3OYY A;  1JXO A;  4M7D D;  1YJN Q;  1QVG S;  1PC0 A;  2P84 A;  4JJC A;  3C4S A;  5J26 A;  3EFS A;  5HK0 A;  1KSW A;  3TEE A;  3BFM A;  2OAU A;  3VRY A;  1X01 A;  2A3L A;  1VQ4 Q;  1KC8 U;  4KGZ B;  5IAY A;  2COY A;  2DTI A;  2JOY A;  3TRE A;  5GJW B;  2VB6 A;  1T3L A;  4FSS A;  1QMC A;  4XTY A;  2BUD A;  1D1B A;  2O4X A;  4L6V 5;  1OQK A;  1MUZ A;  1RAF B;  4HKE A;  2DIG A;  2DET A;  2QQA A;  2K3B A;  3M4G A;  2ENM A;  2K5L A;  5LJ5 d;  1I07 A;  2CP0 A;  1IRX A;  4XQ3 A;  3EG3 A;  1ZSG A;  4PFP A;  3V8K A;  2QG9 B;  1TXQ A;  3G7Z A;  4PLL A;  4LDX A;  3CCL T;  2V8I A;  3CMA Q;  1R8O B;  5FRO A;  2BZX A;  1G3W A;  3CCV Q;  1YJW T;  3OSS C;  4N0A C;  5KYX B;  2KRS A;  1UJY A;  2M51 A;  3QDF A;  1YFN A;  3MEV A;  1MMG A;  2PNI A;  3CCR T;  2JMA A;  1GFC A;  2DBK A;  4OMM A;  4OB1 B;  1VIE A;  3LWH A;  4R56 A;  1WHJ A;  1ZA2 B;  7AT1 B;  2KMT A;  4C5E A;  2E64 A;  1RAE B;  2LVM A;  4M75 A;  3V8L A;  1UGV A;  4ZNX A;  4A4H A;  1R0C B;  5AT1 B;  2LCL A;  3UT1 A;  2EJ9 A;  3OYD A;  2PVO B;  3CC2 Q;  2LT4 A;  5J3B A;  4QQ6 A;  1TU0 B;  5HK3 A;  2RB6 A;  4KGV B;  2YUP A;  2CP3 A;  2EWN A;  3I35 A;  5DM7 R;  2V1R A;  2CZ6 B;  4FYW B;  4HXJ A;  3G6E A;  4F7U A;  5GAN d;  1K4U S;  4BAC A;  1LCK A;  3E9F A;  2NUP B;  1QKW A;  1N9S A;  1SSH A;  4B6M A;  2JT4 A;  3VYG A;  1D3B B;  1ARK A;  2C0O A;  4AFS C;  1WQ7 A;  5ECA A;  1ZUY A;  1VQ9 T;  4C92 A;  3SWN A;  1O9S A;  1WA7 A;  3QPH A;  4BUG A;  4XU0 A;  4A54 A;  1SKU B;  4M7D C;  5M9O A;  2VXE A;  1K0X A;  1SSF A;  3NTK A;  3EGX A;  4WCI A;  4BE2 A;  1C1A A;  4RCC A;  1V76 A;  2DX1 A;  2R57 A;  2O31 A;  3D7S B;  3QYH B;  2QXF A;  2EBP A;  1YJ9 Q;  1CKA A;  4PK4 A;  4LDW A;  1KHI A;  2PUK B;  5HY6 A;  2DL4 A;  2XID A;  1R0B G;  1G3Y A;  3HSB A;  4AFU C;  1D1C A;  3EG1 A;  2WSC E;  1Q82 C;  1Y7X A;  3HRS A;  3RER A;  2MF2 A;  1VQM T;  3DLM A;  1YN8 A;  3CCL A;  5A0D A;  2V26 A;  1H8K A;  2K3Y A;  2F5K A;  4PLI A;  4C8Q G;  4FU6 A;  1YNZ A;  3KFV A;  1VQ4 T;  3TU4 K;  4E2F B;  2YHT A;  4C8Q D;  2ZPI B;  4N4H A;  3P8D A;  4DBR A;  1M3A A;  5GAO q;  5L23 A;  1MMN A;  3RMS A;  1G3S A;  1WHM A;  2PU9 B;  1N8R C;  1KD1 C;  3EGU A;  4CC2 A;  1RLP C;  3S3O A;  4XK8 E;  3QBY A;  5KYW B;  2ATC B;  4DOW A;  5GAN 3;  2MMP A;  3M0P A;  3CCE A;  4HCC A;  4R55 A;  2AZV A;  2LMJ A;  3EH1 A;  1I1J A;  3JCM V;  4DEX A;  2LQ8 A;  2HKQ B;  4L5G A;  3OYN A;  3CMA T;  2DKG A;  4M7A B;  1VQP A;  4A4K A;  1EX4 A;  3FJP A;  4J6Y A;  1UFF A;  2CDT A;  4IIM A;  5A2Q E;  2NYS A;  2HQE A;  1WJQ A;  4WF2 A;  2HQX A;  6AT1 B;  2ROL A;  1RLQ C;  2QEX Q;  4C0Z A;  1BI3 A;  1QCO A;  2GF7 A;  2FRY A;  2QAS A;  3NTI A;  3OMG A;  4P5N A;  4MDX A;  2RQU A;  1WHK A;  3OYC A;  2RHZ A;  2AKK A;  4X9D A;  1U1T A;  3VUZ A;  4QT7 A;  1ZSZ C;  2CH4 W;  2QQB A;  1WGS A;  3M55 A;  2EKH A;  1ZUK A;  3CC2 T;  1RI9 A;  1SRM A;  3SDZ A;  2DL7 A;  4BD3 A;  1UEB A;  2LC4 A;  3OS5 A;  3I9Q A;  4ZGE B;  1VQ5 Q;  5FRN A;  5KCH A;  5KE3 A;  1HSQ A;  4JUV A;  1W6X A;  3BE3 A;  4IUQ A;  3UWN A;  4BY6 C;  2DL8 A;  2WSE E;  3MPU B;  1RAH B;  1QQJ A;  2YRD A;  5EC7 A;  1VQM A;  1XTD A;  4ANJ A;  3JCM g;  1YJN A;  5DY9 A;  1F1B B;  2KRM A;  2V1Q A;  4J6W A;  1Y07 A;  4OMQ A;  2KK4 A;  1VQ4 A;  3CCM A;  2E1H A;  1D0Z A;  3LWI A;  2VGN A;  4D8K A;  1QLY A;  4LE9 A;  4M7D A;  2DIL A;  2KY9 A;  3GP8 A;  3L2R A;  5I2S A;  3J7A F;  3VS4 A;  2DNU A;  1U5S A;  2KI7 A;  2RQW A;  4PJO G;  2CT3 A;  1MMA A;  3WXM B;  3UA6 A;  1YJ9 T;  4D8D A;  3X28 B;  3PE0 A;  2MPX C;  3CCQ Q;  3E19 A;  3H0I A;  2IG0 A;  5CK9 A;  5IXB A;  3S6W A;  4KH1 B;  2CKK A;  4OMF B;  4R0K A;  1GBR A;  2CRE A;  3CMA A;  3KUF A;  3I5R A;  3CCV A;  1BK2 A;  3EHR A;  4XTW A;  4DBQ A;  3O5Z A;  1U1S A;  1SEM A;  3EG9 B;  1LPL A;  5LL6 S;  1VYV A;  1H64 1;  1KQ1 A;  2D8H A;  2JJ9 A;  2J6K A;  2J6F A;  2CZ0 B;  2D8J A;  4M75 B;  5GAM h;  3NMZ C;  5KYU B;  2RM4 A;  3OQ5 A;  2H3J A;  3UAT A;  3HRU A;  5IH2 A;  3QO3 A;  1ABO A;  4RTX A;  3FRN A;  4HVW A;  4M75 E;  3VJP A;  4JRI A;  1OI1 A;  2DJQ A;  2RD1 A;  3CC2 A;  4DBH A;  1M1K R;  5FW9 A;  2VGM A;  5FU6 C;  2W10 A;  3M4Y A;  4ESR A;  1OEB A;  5KCO A;  2XDD A;  3PVL A;  1UDL A;  4MMK A;  3NFC A;  3LX7 A;  3OW2 A;  4C0F A;  2GCX A;  4F7U E;  4BDZ A;  3FB9 A;  1GBQ A;  3VS0 A;  2KBT A;  4ZGJ B;  2LJ0 A;  2QEX T;  2K2V A;  4XU2 A;  4RCB A;  5CKE A;  4E47 A;  4C92 E;  5LJ3 e;  4ME7 A;  1YIT Q;  1UUE A;  3I56 A;  2G6F X;  2RHX A;  2QYZ A;  2BTT A;  4EIK A;  2OTJ Q;  3EGX B;  1D0Y A;  2KVQ G;  1YBY A;  1FMK A;  1AZG B;  5D6X A;  1AD5 A;  3R6N A;  3MEA A;  1YHQ Q;  1M1K U;  1VQ7 A;  2DA9 A;  3OYK A;  2CP6 A;  3VV0 A;  2IPO B;  1W2B P;  2DXB A;  5LJ5 g;  4A53 A;  5GAM j;  1SRL A;  1AOJ A;  1VQ5 T;  1RL2 A;  2G3R A;  1YJ9 A;  1MND A;  4F14 A;  1YWO A;  2DXU A;  5L8R E;  4RG2 A;  4M78 B;  1WIE A;  4UC4 A;  3JCM J;  4Q5W A;  2H3E B;  4PJO C;  1BB9 A;  3PFS A;  5C6S A;  4BB7 A;  2LQK A;  2O01 E;  1H3H A;  2X3X D;  5CQY A;  1VA7 A;  1M2V A;  4CI0 C;  3OYH A;  2LJ3 A;  4C5I A;  2DRK A;  2FHD A;  3NPF A;  1PSE A;  4M78 D;  1TH7 A;  3A98 A;  3ULR B;  2E70 A;  2RO0 A;  2KT1 A;  4LD6 A;  3OB9 A;  1PSF A;  4LUD A;  2P4R A;  3RBB B;  4PJN A;  2ED0 A;  4MDW A;  2LZ6 B;  2NUZ A;  4C8Q A;  2M9U A;  1U06 A;  2OI3 A;  3M57 A;  1GL5 A;  3FLG A;  4J9B A;  3MET A;  3CCQ T;  4DOV A;  1S72 Q;  2GFU A;  2WAC A;  4O6J A;  1AEY A;  1AT1 B;  2SRC A;  2W0Z A;  2AT1 B;  4XU1 A;  5GAN g;  1ZHI A;  4EPC A;  1I81 A;  4Z8A A;  1M90 R;  1K9M C;  2LQW A;  1VQP Q;  2CT4 A;  1ZLM A;  3HRT A;  5FU7 C;  1JB0 E;  3RES A;  1OZ2 A;  4HA8 A;  4RTZ A;  4F04 B;  2RI5 A;  1AWW A;  3EFO A;  2QEX A;  1E6H A;  2HL3 A;  3C12 A;  3VUB A;  4FIB A;  4M7A F;  2I2L A;  3S3M A;  3FEO A;  3DKM A;  2E5K A;  3SWN C;  2HZY A;  3PVQ A;  4FM4 B;  2YRC A;  1ABQ A;  1B7T A;  2O2O A;  1VYT A;  3HFO A;  1WHH A;  1BI1 A;  4JRQ A;  1D0X A;  4AFQ C;  3I5S A;  3G4S A;  4IUT A;  4JPB W;  4NOY A;  2VKN A;  3EGD B;  4JLI A;  2QA4 Q;  2RPN A;  2GQI A;  1VQ5 A;  1TS9 A;  4JDS A;  1A0N B;  2K4Y A;  1UHC A;  2YUN A;  1M27 C;  4FW2 A;  2VXF A;  4LUE A;  2J05 A;  1SHG A;  3MCA B;  1HJD A;  2RF0 A;  1N9R A;  4AT1 B;  4M77 B;  4OF1 A;  1W2B S;  1H92 A;  3EFR A;  4C0D B;  1I8F A;  3MP1 A;  1TUD A;  2AIR B;  2A08 A;  2OTJ T;  2HAX A;  1LNX A;  1NEG A;  1NYG A;  2J7I A;  3R6O A;  4M77 D;  4WTO B;  3L2Q A;  4M7D E;  3CCM Q;  2YDL A;  1YHQ T;  2XDB A;  3RR6 A;  1ZA1 B;  2QI2 A;  2MI6 A;  4LNP A;  3F70 A;  4J9E A;  1Q81 C;  1MMD A;  1OU8 A;  1IHW A;  2JM8 A;  3NTH A;  3UDC A;  1H3Z A;  4RG8 A;  3CCQ A;  2HKN A;  2XDP A;  4PNO A;  2CZ1 B;  2L5Q A;  2F5T X;  2DEQ A;  3A5Z B;  2XG8 D;  4FYV B;  4PJO A;  2DJZ A;  3E2U A;  4DQ2 A;  2B8A A;  1O75 A;  3GF5 A;  1LJO A;  3MP8 A;  2DVJ A;  1WHL A;  2DYB A;  5I22 A;  3GOX A;  1JXM A;  3S3N A;  2LTO A;  2JNG A;  2HQH A;  4MZM A;  2NUT A;  2VVK A;  4IIO A;  1UGQ B;  4XTV A;  5DLQ E;  4E7J A;  9ATC B;  2KEA A;  2CYZ B;  2D6F A;  1S72 T;  4V2S A;  3X25 B;  2OJ2 A;  1GXI E;  2E6N A;  1MV3 A;  2GTJ A;  3PTA A;  3J81 E;  1IRE B;  2JMC A;  4M75 F;  3CCE T;  1Q86 C;  1T0H A;  1MNE A;  1VIF A;  5GAM e;  2LX7 A;  2X4Y A;  2DIQ A;  4Z88 A;  5LJ3 h;  3VRZ A;  5A0L A;  3VU3 C;  1VQP T;  4F16 A;  4Z89 A;  4K11 A;  2QQ9 A;  2B86 A;  3OMC A;  3L2W A;  2I0N A;  5GMK l;  3QHS A;  1QCF A;  4EMK C;  3CPW P;  2JN0 A;  2MK5 A;  4F7U F;  2MCN A;  1M30 A;  3INZ A;  3KXT A;  1NLO C;  2M0Y A;  1YIT A;  2DZC A;  1KJW A;  3REA B;  2A37 A;  3E9G A;  3G71 Q;  2OTJ A;  4AG1 C;  3I56 Q;  1OYX A;  1ZUU A;  2LCC A;  1ZSZ B;  1S1N A;  1PKS A;  3QJY A;  2K7A A;  1M3C A;  1NLP C;  1YHQ A;  4X34 A;  5GAN 2;  3QKJ A;  2QA4 T;  1JEG A;  2HDA A;  1VQ7 Q;  1WPY A;  4J9D A;  1P92 A;  1N6A A;  4ZN1 A;  1UG1 A;  4OP0 A;  4OMN A;  2XIC A;  4YTL A;  2EAY A; 
#chains in the Genus database with same CATH homology
 2E1H A;  2PVD B;  3QZ9 B;  3LWI A;  1K9M U;  2VGN A;  4M7D A;  4OB3 B;  2KY9 A;  3C95 A;  3GP8 A;  3L2R A;  4N4I A;  4XAX B;  1K8A C;  1I5L A;  2E10 A;  5I2S A;  1YJN T;  5LJ3 j;  1JBM A;  2AHJ B;  3BW1 A;  3H8Z A;  3J7A F;  3LYI A;  1QVF S;  1VQN T;  2V8K A;  4M78 F;  2RHI A;  3JCM e;  2DK3 A;  1HK9 A;  2KQW A;  2ZPB B;  4PJO G;  3RMQ A;  4J6X A;  3CCM T;  4M78 E;  3WXM B;  2LT1 A;  1YJ9 T;  1I4K 1;  2YLB A;  3X28 B;  2NLU A;  2P0Q A;  3CBP A;  3JCM c;  2EKO A;  5I2M A;  2XU8 A;  3QJ6 A;  2YRV A;  5CIU A;  3MO8 A;  3OY9 A;  3E19 A;  2R5M A;  5CKH A;  3CD6 A;  4C8Q F;  5GAO m;  2D6F A;  1BYM A;  4PJO F;  3CCS A;  2GFA A;  2IG0 A;  5CK9 A;  3FIF A;  3JCM d;  3P8B B;  3S6W A;  5GAN f;  4C8Q E;  3LH0 A;  3JAM E;  3OYG A;  2CKK A;  3C94 A;  4OMF B;  4PL6 A;  4RMO A;  2M1H A;  3ZEH A;  2DTO A;  1WJR A;  3CMA A;  1S72 A;  1XNI A;  5GAM f;  5C0M A;  5CR2 A;  5D6W A;  3KUF A;  3M54 A;  1JJ2 S;  2D9T A;  3CCV A;  3A8M B;  3GLX A;  3MEW A;  2DXC A;  4XTW A;  1KQS A;  2ZCF B;  3GNF B;  1U1S A;  2RI2 A;  2DD5 A;  4M75 C;  3ZBD A;  5GAN 8;  3GIB A;  3QDR B;  1FWZ A;  3CC4 A;  3T9N A;  3OYB A;  5LL6 S;  3CCU A;  4J7I A;  5GAN h;  3CC7 A;  4QQG A;  1H64 1;  1KQ1 A;  3N5B B;  5LJ5 j;  4QW2 A;  1BI0 A;  1Y71 A;  3ER0 A;  4E7H A;  2FVU A;  4KT0 E;  5CO7 A;  4OB0 B;  2CZ0 B;  3QG1 A;  3SB2 A;  2OTL A;  4N4G A;  4M75 B;  5GAM h;  3QZ5 B;  3CCV T;  2L89 A;  3FDR A;  3CPF A;  2XK0 A;  1B34 B;  2RM4 A;  3OQ5 A;  1QVF A;  3DLL A;  4IUV A;  3JB9 H;  4BDY A;  2H3J A;  3CXC S;  4EDU A;  3HRU A;  3QO3 A;  2K3X A;  5GMK j;  2R5A A;  2P0P A;  4C0G A;  4JJN K;  3FRN A;  1VQO T;  2RI3 A;  4M75 E;  2RH2 A;  3VJP A;  4JRI A;  4M7A G;  1OI1 A;  3OS1 A;  3OYE A;  3I55 A;  3MEU A;  3BDU A;  3PMI A;  2E6Z A;  2MWP A;  2RD1 A;  3VKI A;  3PIO A;  3X24 B;  3CC2 A;  4OVA A;  2RJF A;  4M7A D;  2VGM A;  1G3T A;  2M0O A;  4JS4 A;  5LJ3 g;  5FU6 C;  3M4Y A;  2MAM A;  2X4W A;  2Y4X A;  2LRQ A;  5KCO A;  2XDD A;  3JCM X;  1OZ3 A;  4NS5 A;  3CPW S;  4ZTJ A;  1B34 A;  4C92 C;  2RJC A;  4VUB A;  2DO3 A;  4MMK A;  2CS7 A;  2RJE A;  3NFC A;  1Q81 U;  3LX7 A;  3OYF A;  3BDL A;  4C0F A;  3OW2 A;  2GCX A;  4F7U E;  3URG A;  2K57 A;  4BDZ A;  3LW5 E;  4EMK B;  5EG2 A;  3Q1J A;  3FB9 A;  1JJ2 A;  2R58 A;  2QA4 A;  4B9X A;  2QTX A;  4ZGJ B;  2D0Q B;  2LX9 A;  4ZN3 A;  3J80 E;  2QEX T;  3M56 A;  3HKS A;  2K2V A;  4C92 F;  3JB9 G;  1M5Q 1;  4XU2 A;  4LDY A;  5J39 A;  3OSV A;  3M58 A;  4RCB A;  3HPW A;  1UB4 A;  5A0G A;  5CKE A;  4E47 A;  2RK1 A;  4C92 E;  5KE2 A;  1Q7Y U;  4BI8 B;  5LJ3 e;  2LDM A;  4ME7 A;  3JB9 D;  2P0K A;  1M4Z A;  4XTZ A;  3I56 A;  3RKX A;  1VQ6 A;  2RHX A;  3OYM A;  5GAN 7;  4MZT A;  1M90 U;  2DZ9 A;  4M77 C;  2KDS A;  3PMT A;  4EMK A;  2KVQ G;  3CBM A;  1YBY A;  5GAO r;  1U8R A;  4OGE A;  4BI3 A;  3JRZ A;  5CKD A;  3RIR A;  1N27 A;  2XD0 A;  5GAO p;  3CXC A;  2EYQ A;  5D6X A;  3G6E T;  1HXD A;  3JCM b;  3MEA A;  5LJ3 d;  1M1K U;  4BY6 B;  5GAN j;  4XTX A;  4C0D C;  1VQ7 A;  3G71 T;  5AYF A;  3UPU A;  1JRI A;  3OYK A;  3QSU A;  1QP3 A;  3VV0 A;  4KUD K;  2DXB A;  3I56 T;  1VQN A;  3A8G B;  3M53 A;  4A53 A;  4M77 F;  4A4E A;  5LJ5 g;  5GAM j;  3OYA A;  4QQD A;  1NJI C;  4M7D G;  1VQ5 T;  2L8D A;  2FL7 A;  1VQL T;  1RL2 A;  4HCZ A;  4CRI A;  4M77 E;  3JB9 J;  2G3R A;  5GMK h;  3OYY A;  1YJ9 A;  4M7D D;  1QVG S;  3RKY A;  2DXU A;  5L8R E;  4RG2 A;  3CPW A;  2O4X B;  3C4S A;  2ZPG B;  5J26 A;  1UGP B;  3EFS A;  5HK0 A;  1VQ7 T;  4M78 B;  4UC4 A;  3TEE A;  3BFM A;  3OA6 A;  3JCM J;  2OAU A;  2DPP B;  4Q5W A;  4C8Q C;  3L2U A;  1X01 A;  4MZP A;  4PJO C;  2A3L A;  2YLC A;  3PFS A;  2P4T A;  5C6S A;  4BB7 A;  2LQK A;  2RJD A;  1MHN A;  1KC8 U;  4GY5 A;  5IAY A;  2KSS A;  4E7L A;  1MGQ A;  2DTI A;  2JOY A;  2O01 E;  4OGC A;  3TRE A;  5FLX E;  1IZ6 A;  4C8Q B;  1UGR B;  5CQY A;  4GLK A;  2VUB A;  4CI0 C;  3OYH A;  4XTY A;  4A4G A;  2BUD A;  2O4X A;  3GPL A;  4L6V 5;  1NE8 A;  4ATO A;  4C5I A;  2F69 A;  4HKE A;  2FHD A;  2DIG A;  4M78 D;  1PSE A;  4M78 A;  1KQ2 A;  3OYI A;  4PJO E;  1TH7 A;  2A7Y A;  1Y96 B;  4L59 A;  2QQA A;  4IUR A;  3M4G A;  1WQW A;  2K5L A;  2E70 A;  1ZBX A;  2RO0 A;  4LD6 A;  5LJ5 d;  4XQ3 A;  2DXT A;  1QW1 A;  5GAN 4;  3OB9 A;  1YJW A;  3V8K A;  1PSF A;  3QII A;  4NL2 A;  3CBO A;  1M1F A;  3G7Z A;  4FSX A;  4MDW A;  2DTH A;  4PLL A;  3WVD B;  5DLO A;  4C8Q A;  2M9U A;  3CCR A;  3ZFJ A;  4LDX A;  3L2Z A;  3M57 A;  2V8I A;  3L2V A;  3FLG A;  3CCL T;  3MET A;  3CCQ T;  1R8O B;  4DOV A;  2GFU A;  3QYG B;  2WAC A;  4O6J A;  1VQO A;  2FB7 A;  5CVI A;  5FRO A;  1M1K C;  1G3W A;  4TVR A;  1YJW T;  3OSS C;  4N0A C;  5GMK m;  3OBY A;  1K73 C;  2EJG A;  3CCJ T;  4XU1 A;  5GAN g;  2BIV A;  4IUU A;  4Y28 E;  2ZGW A;  3MEV A;  1ZHI A;  4EPC A;  1I81 A;  2E41 A;  4IUP A;  3CCR T;  4ZTF A;  5GAM g;  3ME9 A;  1K9M C;  4OB1 B;  3HRT A;  5FU7 C;  1VIE A;  3LWH A;  4R56 A;  1JB0 E;  3RES A;  1OZ2 A;  2VC8 A;  1UGS B;  3HP9 A;  3M59 A;  4HA8 A;  3RUX A;  1X75 C;  2KMT A;  2RI5 A;  3P8H A;  2QQR A;  2EQK A;  5GAO n;  4C5E A;  2QEX A;  1XQH A;  4F7U B;  1G5V A;  3C12 A;  2E64 A;  5FU7 B;  3VUB A;  2LVM A;  1YIJ T;  4FIB A;  4M75 D;  4M7A F;  4M75 A;  2I2L A;  3V8L A;  3S3M A;  1BI2 A;  3FEO A;  4A4H A;  3DKM A;  1WNL A;  5FRM A;  3JSC A;  2LCL A;  3UT1 A;  2EJ9 A;  2HNI A;  5GAN e;  3SWN C;  4M7A E;  2ZZD A;  4N0A A;  3MP6 A;  5FU6 B;  2HD0 A;  3OYD A;  2PVO B;  4FM4 B;  4C5H A;  1Q82 U;  2LT4 A;  4BE1 A;  2EQJ A;  5J3B A;  3HFN A;  3VYH B;  1KHC A;  4QQ6 A;  3H6Z A;  5HK3 A;  2RB6 A;  4D6W A;  3HFO A;  4C92 B;  1K8A U;  3LLR A;  4XTU A;  1BI1 A;  3SWN B;  4JRQ A;  1RI0 A;  2EWN A;  5DM7 R;  1VQ9 A;  2CZ6 B;  4LDU A;  3V8J A;  3G6E A;  3G4S A;  2LNV A;  4IUT A;  4F7U A;  5GAN d;  4BAC A;  3CEY A;  3E9F A;  3G71 A;  4KUL A;  1N9S A;  1BKB A;  4NOY A;  1QP2 A;  4JLI A;  3VYG A;  1D3B B;  5GAM d;  1VQ5 A;  1WQ7 A;  4JDS A;  3JB9 F;  2K4Y A;  1VQL A;  3JCM f;  4J5Y A;  2VXF A;  4KUI A;  5CQX A;  5HKC A;  4C92 A;  1VQ9 T;  3MCA B;  2X4J A;  3BY7 A;  3SWN A;  1O9S A;  4J83 A;  3QPH A;  3FC3 A;  1N9R A;  3G4S T;  4BUG A;  4XU0 A;  4QVD A;  1YI2 T;  4M77 B;  1N8R U;  1KD1 U;  4FT2 A;  4A54 A;  4OF1 A;  4JS5 A;  3HHT B;  4M7D C;  1W2B S;  5M9O A;  5I21 A;  2VXE A;  5IT9 E;  1NPR A;  2X4X A;  4A4F A;  1D3B A;  2JUF A;  3JCM Q;  1SSF A;  5CCA A;  3EFR A;  4C0D B;  2C06 A;  1I8F A;  1WJS A;  2XI9 A;  3A8L B;  3PNW C;  3NTK A;  2PUO B;  3MP1 A;  1VQK T;  1M9S A;  3JCM h;  2V8J A;  3PIP A;  4BE2 A;  2OTJ T;  2HAX A;  3LGF A;  1LNX A;  4RCC A;  2RK2 A;  4J8O A;  4M7D F;  3VUZ A;  2DVE A;  3R6O A;  2R57 A;  2KAF A;  2E5Q A;  4M77 D;  3QYH B;  4M77 A;  2QXF A;  3L2Q A;  4C5G A;  4M7D E;  1XOV A;  3L42 A;  1LOJ A;  1YHQ T;  2XDB A;  2L3R A;  4LDW A;  2QI2 A;  2RA2 A;  2MI6 A;  5CKB A;  2E65 A;  3QUI A;  1KHI A;  2PUK B;  5HY6 A;  4XU3 A;  3F70 A;  4EMG A;  5LJ5 e;  1Q81 C;  1BIB A;  2XID A;  3DB4 A;  1G3Y A;  3KBG A;  4PJO B;  3HSB A;  4LDV A;  5GMK i;  1Q86 U;  4IKF A;  3ASK A;  2WSC E;  1Q82 C;  1FX7 A;  1Y7X A;  3NTH A;  2VV5 A;  3HRS A;  4M78 G;  3UDC A;  3RER A;  1H3Z A;  2MF2 A;  4RKU E;  3DB3 A;  2ZPH B;  3DLM A;  4RG8 A;  1VQM T;  1FXX A;  3CCL A;  5A0D A;  4B9W A;  3CCQ A;  3CCM A;  5GMK e;  2XDP A;  4PNO A;  2CZ1 B;  2L5Q A;  2PVG B;  2F5T X;  2K3Y A;  2X35 A;  3V7C A;  2F5K A;  4PLI A;  4C8Q G;  4QVC A;  4E7I A;  2DEQ A;  1Q7Y C;  4FU6 A;  3PGG A;  3A5Z B;  3OS0 A;  1VQ4 T;  3CCJ A;  4PKC C;  3X20 B;  3TU4 K;  1BIA A;  2XG8 D;  2YHT A;  1M90 C;  4C8Q D;  2M16 A;  2ZPI B;  4PJO D;  3PT9 A;  4PJO A;  1VQ8 A;  2DJZ A;  4N4H A;  4ELY C;  1W2B A;  4KBM B;  4DQ2 A;  2B8A A;  3A8O B;  3RKW A;  1O75 A;  2EFI A;  3GF5 A;  1LJO A;  1YCY A;  3MP8 A;  3P8D A;  4LD9 K;  1M8V A;  4QVZ A;  5GAO q;  4J7F A;  1V29 B;  3RMS A;  3GOX A;  1G3S A;  3OBW A;  1Y96 A;  1QVG A;  2PU9 B;  1N8R C;  1KD1 C;  4DA4 A;  3OW2 S;  2DD4 A;  4JLG A;  3CME A;  2ZPE B;  3QXE B;  4ZGD B;  3S3O A;  1YIJ A;  2XHC A;  2BKD N;  2LTO A;  3S3N A;  2QDY B;  1VQ8 T;  1KG1 A;  3E1S A;  2JNG A;  4XK8 E;  1EIF A;  3QBY A;  4MZM A;  3CD6 T;  4M7A C;  4DOW A;  5GAN 3;  3M5A A;  3CCS T;  2MMP A;  3CCE A;  4HCC A;  1NPP A;  4R55 A;  1UGQ B;  5GAO l;  5LJ3 f;  4XTV A;  2EIF A;  5DLQ E;  3JCM V;  1X6O A;  2LQ8 A;  4E7J A;  4JRK A;  4L5G A;  3HL8 A;  1ZQ1 A;  2CYZ B;  2PQW A;  2RHY A;  3OYN A;  2DKG A;  4M75 G;  2JVV A;  2WSF E;  4M7A B;  3CME T;  3A8H B;  1VQP A;  1S72 T;  4V2S A;  2EQM A;  5IN1 A;  1QVP A;  3X25 B;  4A4K A;  3FJP A;  1KC8 C;  2E6N A;  1GXI E;  3PTA A;  4JRP A;  3J81 E;  4HT8 A;  1IRE B;  3SD4 A;  4J6Y A;  3JCM P;  2JTF A;  5A2Q E;  1NJI U;  5CAI A;  2HQE A;  3MHX A;  2XKO C;  1WJQ A;  4WF2 A;  2HQX A;  4M75 F;  1DJ7 B;  2MWO A;  3CCE T;  4Y91 A;  3AHU A;  1Q86 C;  5GAN 5;  1VIF A;  3CC4 T;  4C0Z A;  5GAM e;  3V7S A;  2X4Y A;  3CCU T;  2DIQ A;  5LJ3 h;  3CC7 T;  4F7U G;  1BI3 A;  5A0L A;  3VU3 C;  1W4S A;  1VQP T;  5CKF A;  2GF7 A;  2K5F A;  3OYJ A;  2QQ9 A;  2K5I A;  3NTI A;  3OMC A;  2Y4Y A;  5GAN 6;  4M7A A;  2OTL T;  3L2W A;  5GMK l;  3OMG A;  3QHS A;  3OYL A;  4P5N A;  4MDX A;  1YI2 A;  4EMK C;  4E7K A;  3OYC A;  4BI4 A;  2JN0 A;  2RHZ A;  4F7U F;  4X9D A;  1U1T A;  2DAQ A;  1VUB A;  2CZ7 B;  2HBP A;  2RHU A;  3EAE A;  3INZ A;  1NZ9 A;  3KXT A;  4Z02 A;  2QQS A;  4C92 G;  3I55 T;  2VYT A;  2DZC A;  2QQB A;  2ZPF B;  3WVE B;  1YIT A;  3CMA T;  2EQU A;  1WGS A;  3LGL A;  3M55 A;  4C92 D;  1VQK A;  3E9G A;  4HT9 A;  3CC2 T;  3SDZ A;  2GQV A;  4FL6 A;  2OTJ A;  4BD3 A;  5LJ5 f;  1UEB A;  3L1A A;  4NL3 A;  2LC4 A;  3OS5 A;  1OYX A;  5KH6 A;  2LCC A;  4II1 A;  4ELZ C;  4X9C A;  4ZGE B;  5FRN A;  5KCH A;  5KE3 A;  2JTM A;  3OS2 A;  3QJY A;  3M9Q A;  4JUV A;  1YHQ A;  2Y90 A;  4X34 A;  4FT4 A;  5GAN 2;  4IUQ A;  3UWN A;  4OB2 B;  3QKJ A;  4BY6 C;  1YIT T;  3X26 B;  2QA4 T;  3GNG A;  3SFM A;  4M7D B;  2FYK A;  2WSE E;  4EMH A;  1WPY A;  2CGH A;  4M77 G;  3TCJ A;  1P92 A;  2IVW A;  4MML A;  1XTD A;  1N6A A;  3JB9 I;  1VQM A;  2JZ2 A;  1M1G A;  4ZN1 A;  3JCM g;  1YJN A;  5LJ5 h;  4BE0 A;  5DY9 A;  4OP0 A;  1KQS S;  3JCM W;  3O8V A;  1K73 U;  4J6W A;  3V7R A;  4HCB A;  1AHJ B;  2EJF A;  2XIC A;  4YTL A;  1VQ6 T;  4O5V A;  5D6Y A;  2EAY A;  1Y07 A;  2KK4 A;  4M78 C;  1VQ4 A;  2E12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...