1WJRA

Solution structure of the 2nd mbt domain from human kiaa1617 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
GSSGSSGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords KIAA1617 protein
publication title Solution structure of the 2nd mbt domain from human KIAA1617 protein
rcsb
source organism Homo sapiens
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjrA00
1OI1A 2RHYA 2DIQA 2LRQA 3OYBA 3S3OA 3ME9A 3OYLA 3MEWA 5D6YA 3S3NA 4E7LA 2R5MA 3OYDA 3QJ6A 2LDMA 4C5IA 3LGFA 5FRNA 2NLUA 1XNIA 2R58A 4IUPA 2CKKA 4RG2A 4IUVA 3OS1A 3OMGA 5C6SA 3OQ5A 3MEAA 4C5GA 2MWPA 2RJEA 2B8AA 2D9TA 4L59A 3OY9A 3FEOA 1RI0A 2WACA 3CEYA 3MEVA 5D6XA 4BD3A 1MHNA 1OZ2A 2O4XB 2M1HA 2E5QA 1SSFA 4PLIA 4ZTFA 5KE3A 2F5KA 3P8DA 3Q1JA 2YRVA 4C5EA 4ZTJA 2IG0A 3OYJA 2G3RA 2EKOA 2P0KA 4A4HA 2EFIA 3UT1A 2PQWA 1WJRA 2RJFA 2HQXA 3S6WA 4UC4A 3E9GA 3LH0A 5CIUA 5IAYA 4QW2A 4N4IA 3OYAA 3MO8A 3L2VA 2RI2A 2QQSA 4OVAA 3LGLA 1KHCA 2GFUA 4E7KA 3PMIA 2M0OA 3FC3A 4HCZA 2R5AA 4E7JA 3P8HA 2LVMA 4BE1A 2EQUA 4CRIA 3QKJA 3QBYA 3FLGA 3L2WA 4LD6A 2XDPA 3MEUA 2JZ2A 3OYGA 1WJQA 4IUTA 4IUQA 5IN1A 5KCHA 3OYMA 2GFAA 4B9XA 2M16A 2RI5A 2HQEA 4EDUA 3L2UA 4A4GA 3LX7A 2K3XA 2RHIA 4Q5WA 2L89A 4FU6A 2DAQA 1WGSA 3DLMA 3META 2X4XA 4II1A 4FL6A 4A4FA 5KH6A 2QQRA 3PMTA 3MP6A 4C5HA 4BDZA 5KCOA 5J26A 3OYHA 4BDYA 2GF7A 4QQDA 4PLLA 3L42A 3NTHA 3OMCA 2K3YA 3H8ZA 2O4XA 3KUFA 5C0MA 2MWOA 3F70A 2EQKA 3EAEA 3UWNA 4BACA 1WJSA 4NS5A 3OYIA 3SD4A 3GOXA 2BKDN 2EQJA 3C4SA 4Z02A 3OYCA 5M9OA 4X34A 2E6NA 2VYTA 5D6WA 3OS0A 2JTFA 1OYXA 2X35A 3E9FA 3PNWC 4E7HA 4GY5A 2R57A 3OS2A 4IUUA 3LLRA 2LCCA 3NTKA 4IURA 3ZEHA 1OZ3A 3OYEA 3OA6A 2FHDA 3FDRA 2X4YA 2X4WA 2BIVA 2EQMA 3BDLA 3M9QA 3PFSA 5J39A 2RHXA 2RHUA 3OYFA 3L2QA 3DB3A 3OYNA 2RJCA 3ASKA 4BE0A 3OYKA 5FRMA 3O8VA 4QQ6A 4PL6A 1H3ZA 3MP8A 1G5VA 2LTOA 5FROA 3OB9A 3NTIA 5KE2A 3LYIA 4E7IA 4IKFA 2BUDA 2RI3A 2RO0A 2XK0A 3S3MA 3DB4A 2L3RA 3QIIA 4BE2A 2L8DA 4QVZA 3H6ZA 4N4HA 4A4EA 1N27A 2DIGA 2RJDA 3L2RA 4B9WA 3MP1A 4QQGA 4N4GA 2RHZA
chains in the Genus database with same CATH superfamily
1VQLA 4C0GA 2XDBA 3JCMf 3QYHB 2W0ZA 2MWPA 3LWIA 3E19A 2K6DA 1P92A 2DFUA 1MHNA 1SEMA 4KULA 3G71T 4BY6C 4A53A 2K7AA 4LDVA 2F5KA 3Q1JA 4C5EA 2HDAA 4M78A 2K3BA 1ZA1B 5GANh 2BE7D 4PNOA 2DTOA 1ZLMA 1KG1A 3DLLA 2DK3A 1KHIA 2DL5A 1Q81U 4OVAA 2XHCA 2CYZB 3CCSA 2KXCA 4HCZA 1SRMA 1YWOA 4PJLA 5GAN6 1YN8A 1H3HA 1I1JA 2M0YA 3OYGA 5FW9A 1X27A 2GFAA 1VQPQ 3L2UA 2RHIA 2KXDA 2VXEA 4E6RA 5CVIA 5EG2A 3M0TA 3VUBA 2FZKB 3NTHA 3OMCA 3BFMA 2NUTA 1X01A 4RMOA 4BY6B 1IGQA 2FZGB 4PJOG 3CCUA 1Q82C 1QCOA 1QVGA 2KYMA 4JRPA 3PGGA 2R57A 4F7UA 3ZEHA 1WIEA 2LT4A 2QDLA 3OA6A 4PK4A 2FHDA 3EGDA 3PFSA 1QVGP 1ACMB 4RCCA 1TOVA 2FVUA 1QW1A 2OAUA 3OB9A 4Z89A 1NLPC 2HBWA 3HRSA 4ELYC 2QASA 1M8VA 2JNGA 2H3EB 3QZ5B 2X3WD 3REAB 1MMAA 1VQ6T 3A8HB 2A08A 2DPPB 4E7LA 2YLBA 2CH4W 1HXDA 2XIDA 4OB3B 3UA7A 1AOJA 2CZ1B 1KK7A 4DQ2A 2COZA 4PJJA 1YFNA 2LX9A 4Y92A 2D8HA 1GCQC 4JJCA 1M3BA 2QEXA 3FB9A 3CC2A 1OOTA 3A8OB 2VV5A 4OMMA 2CP3A 4HKEA 2ROLA 3LH0A 4OF1A 4QW2A 3T9NA 2EBPA 4HVVA 5IHKA 1D3BB 1YIJQ 3I55A 1WHJA 4J9GA 2MAMA 1K8AU 3JCMW 3CCEQ 2AHJB 3E1SA 2QQAA 4IUTA 2CZ7B 1IGUA 2NUPA 4FIBA 3VKIA 2ED0A 2D1XA 3RBBB 3CCMQ 4JRKA 1G3WA 2LX7A 1O9SA 4K11A 1XQHA 5LL6S 3CCUT 1AWJA 4J8OA 1YBYA 3M0RA 4JPBW 1QVGS 2F2XA 4JJNK 2FZCB 4LDXA 5GAN2 1Y07A 4CC7A 3JCMV 2CP0A 1IZ6A 2BKDN 2D0NA 1RADB 2ECZA 4J7IA 1PRMC 1Q86U 2QTXA 5M9OA 2VYTA 5D6WA 5GMKe 1KQ1A 1LNXA 4QVCA 4RTXA 3PNWC 1FYNA 3I5SA 2JTEA 4XTYA 3QO3A 2FYKA 2RHXA 1FX7A 3MCAB 1NYGA 2K79A 3JB9G 2Y90A 3G4SQ 1SRLA 4EIKA 3NTIA 2Y4XA 1BBZA 3HP9A 1X6BA 3DB4A 5FU6C 6AT1B 1OPKA 3H6ZA 5LJ3j 4N0AC 1UGSB 2DIGA 1YITA 2RHZA 1V1CA 1VQ4T 3S3OA 2DLPA 4M75B 1MGQA 2WSEE 3A8GB 1W6XA 1JRIA 2NLUA 2CKKA 3OS1A 2ZCFB 3OMGA 5AT1B 3MEAA 1I5LA 3CC4A 4PJOF 3BY7A 1XJWB 4C8QF 3CC2T 3JAME 2D6FA 2DXUA 2KYBA 1IO6A 5GAMj 4XTZA 1JB0E 5GAOl 2M02A 3QPHA 2LZ6B 1W4SA 5KYXB 3M0SA 2F5TX 3HFOA 2DA9A 5GJVB 3H41A 1M2OA 4N4IA 2O9SA 2J6OA 1OU9A 4OGEA 3FC3A 1Y57A 3OW2P 5I21A 4E7JA 1PWTA 3SFMA 1BYMA 2DRMA 3QDFA 1S72Q 2EQUA 2Z0WA 4HVUA 2XDPA 4M7DF 5FU6B 3EG9A 5LJ5h 1C1AA 2KGTA 5L8RE 1OU8A 1RACB 1G83A 3JV3A 3WVEB 3QJYA 4RG8A 5KH6A 5IH2A 1EZZB 5KCOA 1FMWA 2LC4A 1RUWA 4OMOA 1VQ7Q 4M4ZA 2DVEA 2X51A 5GAN5 2CP6A 3ER0A 1AHJB 1VIFA 1GL5A 3HKSA 3UA6A 1MV0B 5GAN8 3QG1A 3M56A 5CKDA 3CMEQ 1VQLQ 1ARKA 4FYVB 1YITT 3JCMd 2DERA 1JJ2A 1QWEA 3S3MA 3I56Q 2L3RA 4BE2A 3GPLA 5GAN7 4QVZA 5AYFA 1RLQC 2E41A 3CXCA 4A4EA 1N27A 2OX7A 4J6WA 2CSQA 1JXOA 8AT1B 2RHYA 3CC4T 1I8FA 2ZAEA 4J6XA 5A2QE 3CCSQ 1G3TA 3QWYA 2HKNA 1KC8U 3OW2S 4R56A 1NJIR 3O5ZA 1PSFA 1E6GA 2QDYB 4JRIA 4A4HA 4OMNA 2CH4A 1K1ZA 1VQ9A 1HJDA 3X24B 3M0QA 3VS3A 1M2VA 1YI2T 3OYAA 5LJ5j 4JJDA 2DTIA 4DBFA 4FM4B 2LVMA 1WZOA 4CI0C 2LMJA 3L2WA 1K73C 1UJYA 5IN1A 2RI5A 4OP0A 2M9UA 2JJ9A 1R0CB 4C8QE 2DAQA 5ECAA 2X4XA 1VQNA 1VQKA 4C5HA 1I4K1 1NG2A 1MNEA 1W2BP 3VUZA 2J6KA 5C0MA 3F70A 2EQKA 1UG1A 3OYIA 2K5FA 2JTFA 4E7HA 4GY5A 1N6AA 1TWBA 3A5ZB 2EGEA 5LJ3f 3CCQT 4QKUA 1B7TA 1KSWA 2EPDA 2RA2A 1OULA 4M7DE 1KQSA 1H3ZA 4CC3A 2LTOA 4PJOD 1PD0A 5KYWB 2RI3A 4C8QD 2RO0A 3LWHA 1Q7YU 1BB9A 3FJPA 4M77C 5GAMf 5GANg 2O31A 3FJ5A 2X9HA 1YJNA 4M75G 1X2QA 2ZZDA 3QWXX 3R6NA 4A63B 2GTJA 3I55Q 1VQ5T 2HL5C 1BKBA 2DF6A 3GNFB 1ZUYA 1VQ9T 5D6XA 2F2WA 1TUGB 1WFWA 2AZVA 1WXTA 4ZTFA 3P8DA 1YNZA 4M7DD 1AZGB 2EKOA 3CCRA 4DEXA 2A28A 3EGXB 5FWBA 4F04B 1Q82R 5L23A 2HAXA 5GANe 1H641 1RAEB 2O9VA 3OSSC 1OPLA 2RI2A 1VQ8Q 1PRLC 4E7KA 1VYTA 2DL8A 3M57A 4MZPA 5HCKA 2ESWA 4CC4B 1UHFA 3EG1A 1C6VX 1PC0A 1FMVA 1Z9QA 4BE1A 1WHLA 1NEBA 3UATA 2AKLA 1W2BS 1VQKT 2LP5A 3CPWP 3A98A 4EDUA 2DBMA 2EGAA 4M77B 4A4GA 2ZGWA 2GQIA 3G71A 2PUKB 3META 2QQRA 4C92C 2GF7A 4QQDA 2L3QA 4PFPA 1U5SA 1WA7A 1E7OA 3KUFA 2NUZA 1QKXA 5CCAA 3RKWA 5GAN3 1OYXA 3X28B 1KQ2A 4HT9A 4M78B 4PKCC 4EMKA 1ZBXA 2HEQA 2JM9A 5FWCA 1M90C 2XICA 2EYWA 3M5AA 1GBRA 2ENMA 3O8VA 1NJIC 4C8QA 4RTWA 4E7IA 1YJNT 1GCPA 4J6YA 1X75C 4KH0B 3H8ZA 1VQMQ 1M1KU 2QGFB 3JB9D 1KC8C 1M1FA 4RCBA 3OQ5A 1C0MA 4OMLA 5LJ5f 1OEBA 1UB4A 2NUTB 1SSFA 5KYUA 4PLIA 4M7DA 1WQ7A 3FRNA 2P0KA 1D0YA 1LJOA 1K76A 1PCXA 3EG2A 3CPWS 4F7UB 1H8KA 2VGMA 4ESRA 5IHIA 4KBMB 2K4YA 1KHCA 3CMAQ 4LD9K 2DXCA 3MPUB 1T0HA 1VQ6A 4F16A 1NZ9A 2K5LA 3M53A 1RAAB 4E2FB 9ATCB 1TSFA 1Z9ZA 1PG5B 1Q95G 2LJ0A 2ZPEB 1X69A 4FL6A 5GMKi 2MF2A 2CDTA 1ZX6A 5A0GA 2YUOA 1SKUB 4LNPA 2VGNA 1YJ9T 4JS4A 4MZTA 4NS5A 2MOXA 1D1CA 5GANd 1ZSGA 1AT1B 4KUIA 2JVVA 1OQKA 4L5GA 1QLYA 2CT3A 4XTVA 1H92A 2JMCA 2DL4A 2EQMA 1D1AA 1CKAA 2C0TA 3OYFA 2HSEB 2OTLA 2AKKA 4QQ6A 2YUQA 2EW3A 1TTHB 1M27C 1TG0A 4DA4A 1YHQT 1MUZA 2MYSA 5GMKl 2VB6A 2RQUA 2NUPB 3OYLA 3J7AF 2KSSA 3GF5A 4J83A 5IXFA 2MI6A 3G7ZA 3H0FA 3RUXA 4KT0E 4ORZA 1VYUA 3SHWA 1RI0A 2X4JA 3VS7A 5HKCA 5CKEA 4JRQA 3TEEA 1AVZC 3ZL7C 4DBHA 1AZEA 3OYJA 2KRSA 3RMQA 1PNJA 1UGRB 3JCMJ 2L2PA 2RPNA 2F2VA 1UGQB 3S6WA 2I0NA 4RTZA 1M3CA 1VQNQ 4J9HA 3EFSA 3ULRB 2KROA 3L2VA 2QQSA 4WTOB 2RD1A 3PMIA 1W70A 1PHTA 3MJXA 1VOMA 1VQ4A 5LJ3h 1TXQA 4A54A 2VUBA 2HZYA 3FLGA 3JCMg 1B34B 3VJPA 1BI2A 4YTLA 3V8KA 1PD1A 4Q5WA 4M77G 4FU6A 4RTVA 4A4FA 2JN0A 4CC2A 3MP6A 4J9CA 3VRZA 3VYGA 3E2UA 5GAMh 2ZPHB 1NYFA 2CP5A 1QCFA 1MMDA 1RI9A 1NM7A 1RLPC 4MDXA 2EJGA 1XOVA 3GIBA 2QA4T 4KGZB 3JCMe 7AT1B 3J80E 3ZBDA 5I2MA 2OTLT 4ATOA 2DNUA 3EFOA 2QG9B 1SF9A 4M75C 4FSSA 2VC8A 2OTJT 2FG0A 2RHUA 2W10A 1UTIA 1NLOC 2GBQA 3I5RA 3OYKA 4VUBA 1M1KC 2BZXA 3CC7Q 2BUDA 1MMNA 2A7YA 2RH2A 5FLXE 4HCCA 4O6JA 3PTAA 3EG9B 3L2RA 1KD1U 4B9WA 3CCRQ 1K73R 4EMHA 5GAOq 3PIOA 2LT1A 1K9MU 3CD6T 1QVFA 4J9BA 3PT9A 2P0QA 3SB2A 2DKGA 4C92G 2B86A 4X9CA 3NMZC 2WACA 1PKSA 3M55A 2DD4A 1OZ2A 4GLMA 3R6OA 1GRIA 2QTVA 2KE9A 4NOYA 3C95A 2FO0A 5HK0A 3OBWA 1UE9A 2GQVA 4MDWA 4C0DB 3CCJT 2A0FB 3G71Q 4Y28E 3SEMA 4R0KA 4KGXB 3PVLA 4ELZC 2FB7A 3M54A 4BB7A 5EC7A 1ZSZA 4XQ3A 4ZNXA 4C0ZA 4XU2A 1RAHB 3QBYA 1G3SA 1X6GA 2E70A 1Q81C 3OYMA 1LCKA 2J06A 3DKMA 2DYBA 1U1TA 2K3XA 2EIFA 3X25B 5CAIA 3H0HA 3HRTA 2ZPIB 4D8DA 4J9DA 2K57A 2RMOA 5IHNA 4PLLA 3QHSA 3JSCA 3KXTA 1T3SA 3EHRA 4WF2A 1M1GA 3NPFA 2XKOC 1NE8A 2RK2A 1YJWQ 1YI2A 3M59A 3VS4A 3OYCA 2P0PA 4OMQA 3OS0A 2E6NA 4KUDK 1EFNA 4IUUA 1AD5A 2GTOA 2DX1A 2BIVA 2CZ6B 2VKNA 4LDUA 3CPFA 4OMPA 1F1BB 2HNIA 5KE2A 3CCVA 4IKFA 4LDWA 5LJ5d 1GCQA 2YUPA 1ZA2B 2C0OA 4M77F 3TCJA 1Y0MA 3MEWA 3CCLT 4M7AC 3N5BB 1N8RU 2V26A 1IB8A 4ZGDB 4MMKA 4HCBA 1VQ6Q 5DLQE 1JQQA 4L59A 1T0JA 3CCQA 4RTYA 3VS1A 3LW5E 2EYQA 5FU7C 1FWZA 2YHTA 1PKTA 2YDLA 2FRYA 4XTXA 1JJ2P 1YP5A 2E6ZA 3E9GA 3CXCP 1M9SA 3MO8A 2KY9A 1M90R 2O01E 2H3JA 3VYHB 2COYA 2XU8A 1X2KA 3HHTB 5KCHA 1VQ5A 2EYZA 1Y96A 4B9XA 4DOWA 2FEIA 1NBEB 3JB9F 4C92F 1K8AC 3DLMA 4II1A 4M7AB 5J3BA 5J26A 3G6ET 1VQOT 1KC8R 1GFCA 3C0CA 2O4XA 1K4US 2DZCA 1G8XA 2KRMA 3UWNA 3JB9J 3INZA 1ABQA 4N0AA 5FU7B 3CCUQ 2BTTA 2WSFE 2IIMA 1QVPA 5GAOr 4IIOA 3OS2A 3CCVT 4PJOE 2HSPA 1AEYA 1WXBA 1RL2A 1KD1C 1Q86C 2GNCA 3EH1A 4ZGEB 2RQWA 4C8QC 3C12A 1K9MC 2XK0A 3SWNA 3EGUA 1QQJA 3JCMP 2Y4YA 1EX4A 2ZPGB 4DBQA 3S3NA 4D8KA 3QDRB 2DJZA 2R5MA 1N5ZA 3QJ6A 1JJ2S 4RUGA 2DEUA 2MIOA 2L3PA 1OX8A 1VQ4Q 2C0IA 3CXCS 2CSIA 2EAYA 2YRDA 4F17A 2AZSA 4FT2A 4EPCA 1GXIE 2CGHA 4RTUA 5CKHA 4M7DC 4KH1B 2YRVA 2JOYA 5GAOm 1KQSP 4OB2B 2LQNA 3X20B 1WDXA 4D6WA 4Z8AA 1CSKA 3EG0A 2EYYA 2QEXQ 3NHNA 2PVDB 5GMKj 4FW1A 4EMKB 2RJFA 3CC2Q 2JTMA 5CIUA 2L3SA 1NPRA 1WI7A 2EWNA 3MKDA 3AT1B 1XTDA 3U23A 1VQPT 2E5KA 2DJQA 4XU0A 1IHWA 2FPDA 1YCSB 2SEMA 3CCEA 4C8QB 3QKJA 5I2SA 4LD6A 2JZ2A 1WJQA 5DLOA 1QP2A 2M51A 1N9SA 2KT8A 4M78C 2YWWA 1CKBA 1BU1A 3JRZA 3G1JA 3RDVA 3PMTA 8ATCB 1Q82U 3RMSA 3SDZA 1NEGA 3HPWA 2KQWA 2A36A 2OI3A 3ZFJA 3SD4A 4ZGJB 2HCKA 3NFCA 5KYUB 2CP2A 4M7DB 3BE3A 2J05A 4M77D 1QWFA 3JCMX 3WXMB 1SPKA 5KYYA 1VYVA 3M9QA 4QVDA 4IIMA 2JXBA 3EFRA 2LQWA 3G4SA 4EMGA 5A0DA 5HK3A 4TVRA 4OB0B 1BIBA 1S1NA 4KRTA 1N8RC 2YSQA 4C92E 1SHGA 1M3AA 4GLKA 2EGCA 2RNAA 3CBMA 4QQGA 1YITQ 3VS5A 2DZ9A 4MMLA 1KQSS 1YJ9A 3L1AA 5FRNA 5GAOn 2MMPA 2PZ1A 4IUPA 2R58A 2RN8A 4J9IA 2DXTA 5C6SA 3CC4Q 3VS6A 5KYWA 5LJ3g 2D8JA 3JB9H 4PJOA 3L2ZA 1QKWA 2J7IA 4FYXB 3RR6A 1YIJT 3THKA 1WHGA 3TU4K 1W1FA 1WQWA 2DMOA 1YHQA 3H0IA 3CCET 4C92D 2KNBB 4ANJA 1UECA 3LGLA 5GAMg 2RQTA 2JM8A 2KAFA 3P8HA 2EYXA 1U1SA 4CRIA 1BIAA 5LJ3e 3CCMT 1YI2Q 1M1KR 1E6HA 4PFOA 2QYZA 1TH7A 2DYIA 2DVJA 2VWFA 2G6FX 2P4RA 3CC7T 2EJ9A 2L89A 2LCLA 5CR2A 2DO3A 1LOJA 3EGDB 3OYHA 4M7AG 2EJFA 1RAFB 3V8LA 3M0UA 5GAMe 1UDLA 3RKXA 1UJ0A 3QZ9B 5I11A 4BACA 4DBRA 1YWPA 4DOVA 2J6FA 1N9RA 3G4ST 1VA7A 4M75F 4GBQA 3RERA 3NGPA 1FXXA 3LLRA 3CMEA 1WHHA 1JU5C 1G2BA 4XU3A 2QXFA 2O2OA 2YUNA 3GP8A 2CUDA 3P8BB 3LYIA 2CP7A 3I56A 3CCQQ 3MHXA 1UEBA 1X43A 4N4HA 2RJDA 1OI1A 1Q81R 3BDUA 3HL8A 2PVOB 3RESA 2LDMA 4C5IA 1Q7YC 1XNIA 2QA4A 4IUVA 1D0ZA 4MZMA 5CKFA 1AWWA 2KT1A 2O88A 1LPLA 2OAWA 3OBYA 3OYYA 4BD3A 2OJ2A 2EKHA 2OTJA 4BI3A 2FRWA 4ZTJA 1VQ5Q 4FSXA 1Y71A 3KFVA 3M0PA 3C94A 1R8OB 2EQIA 1MMGA 3EFOB 2PQWA 1VQ9Q 1S72T 4UC4A 5DM7R 1YJWT 4C92A 4O5VA 5IT9E 3EH2A 5GJWB 2M0OA 1ZSZC 3TSZA 3LH5A 3CD6A 4C8QG 3A8MB 4JZ3A 1B07A 4E47A 3D7SB 1VQ7T 2E1HA 2M16A 5LJ5g 4XK8E 2V1RA 3LX7A 3URGA 4BUGA 2F1LA 1VQKQ 4BDYA 1WNLA 3GBQA 3L42A 3JCMQ 3VV0A 3CCJA 1WX6A 1YCYA 2MWOA 3EAEA 3CMET 1BCOA 1VQLT 2HD0A 3C4SA 2KVQG 1BI1A 1I07A 2HL3A 4AMCA 4M7DG 5CKBA 2K2MA 2L0AA 3NTKA 5LJ5e 3OYEA 3VS2A 5GAOp 3FDRA 5J39A 3I56T 2HKQB 2DEQA 1X6OA 5GANj 4Y91A 1VUBA 2P84A 1RAIB 2V8KA 2FPFA 2VASA 5LJ3d 2C06A 5FRMA 2FL7A 5FROA 3M4YA 1ZSZB 1WHKA 4XU1A 1AWOA 3QYGB 2BZ8A 4AT1B 3CCST 2IVWA 4DEYA 2DIQA 3QUIA 2YLCA 4C0DC 3OYBA 4M7AF 4JDSA 2DILA 2COWA 1YJNQ 4M78G 2XD0A 3RNJA 5GAMd 1UFFA 3VU3C 1UGPB 4E7ZA 1JBMA 1K8AR 2RJEA 4OGCA 4AFSC 2D9TA 2QK0A 5I22A 3OY9A 3CEYA 1J3TA 2VVKA 4M75E 1B3QA 4HXJA 2E5QA 5D7UA 4ZN1A 3I35A 5KE3A 2KEAA 1JEGA 3UT1A 1WXUA 4NL3A 5IAYA 1K73U 5CQXA 2LQKA 1VQ8A 2FPEA 2A37A 1JXMA 4PJMA 1KD1R 1Q86R 3CCLA 2LNHB 1QVFP 4LXCA 2KK4A 4RKUE 4WCIA 1K9MR 1DJ7B 3FIFA 3GLXA 3JB9I 1R0BG 1VIEA 2LJ3A 2ATCB 4XTWA 1AWXA 4M75D 1I0CA 2RB6A 5KYNA 4AFUC 2V8IA 4F7UG 2QQBA 5CK9A 4AFZC 1WYXA 1I81A 3TQ7P 1PM3A 2QI2A 3EG3A 2XMFA 4FYWB 2MPXC 2ROTA 2D0QB 3VRYA 2EVRA 1A0NB 1B34A 2X35A 1G3YA 2I2LA 1YJ9Q 1KJWA 3BDLA 1D3BA 1IHVA 3L2QA 2RJCA 4BE0A 3I9QA 4JUVA 4LE9A 2QEXT 1K0SA 2MCNA 2QGGA 1EIFA 2KBTA 1ZQ1A 3SWNC 3QIIA 5HY6A 3TREA 1T3LA 2AT1B 2QQ9A 3A1PA 5GMKm 3G6EA 1VQOA 1O75A 4JJBA 3I55T 1M30A 2GCXA 1Y96B 3OW2A 1VQMA 2LRQA 2LNVA 3RKYA 1YHQQ 5D6YA 4AFQC 3OYDA 2RK1A 4NL2A 1M2VB 2B8AA 2K9GA 3PE0A 2O4XB 1D0XA 2M1HA 3KBGA 2CREA 2P4TA 4B6MA 2A3LA 4OB1B 1VQ8T 4A4KA 2XDDA 4C0FA 5A0LA 1Y7XA 1QVFS 1K0XA 2EFIA 1D09B 3V7SA 2HQXA 2DE0X 1ZUUA 2DM1A 2XG8D 3CMAA 2SRCA 3BW1A 4AG1C 4BI4A 4KGVB 2KR3A 2R5AA 2LJ1A 4BI8B 1SHFA 4E7SA 4JS5A 1KFZA 3JCMh 4M7AE 3SWNB 3UPUA 2E64A 2PTKA 4M78F 3V7RA 1N8RR 3QXEB 1OX9A 2HQEA 4M75A 1UHCA 2E12A 1WGSA 3CBPA 4L6V5 2JUFA 3GNGA 1WPYA 1ZBJA 3QSUA 5GANf 1M90U 2K5IA 1M5Q1 3GOXA 5GMKh 5KYXA 2KRNA 1VQPA 3E9FA 4AG2C 2RQRA 1NJIU 2JS2A 2BZYA 2HBPA 2PUOB 4IURA 4ZN3A 1OZ3A 2HQHA 4M7AD 2QA4Q 1BCMA 1BK2A 2AK5A 3DB3A 2OTLQ 3OSVA 4PL6A 2NYSA 1VQMT 2NWMA 2V1QA 2DTHA 3JCMc 2OTJQ 1I5OB 4P5NA 3OS5A 2ED1A 1FMKA 3MP1A 2JMAA 2DXBA 4HA8A 4F7UF 3ME9A 4EMKC 4XTUA 2E3HA 2PVGB 1OV3A 1TUDA 2PNIA 1TUCA 1UGVA 2V8JA 2JW4A 4FCYA 2DD5A 1HSQA 3MEVA 4PJOC 2CUBA 1ZHIA 3CD6Q 1QP3A 1U3OA 1QCNA 1GBQA 2IG0A 2QAZA 1U8RA 2ZPFB 3CMAT 4J9FA 1D1BA 1W2BA 2YRCA 5KYYB 4PJNA 2XI9A 2GFUA 4ME7A 4J9EA 5GAN4 3CCJQ 2VXFA 2E10A 2DL3A 3HTRA 2L5QA 3RIRA 1TU0B 4IUQA 3REBB 2BE9B 4QT7A 4FW2A 3TSWA 1HD3A 3CQTA 3V8JA 2CT4A 2GGRA 2PU9B 4BDZA 1YIJA 2X3XD 1BI0A 1Q7YR 2WSCE 4M77E 1MV3A 1TS9A 4PJOB 2RM4A 4V2SA 2AIRB 1WJSA 4Z02A 4J5YA 4RTTA 2DBKA 3PVQA 1HYOA 4F14A 2K2VA 4M7AA 5IXBA 1ABOA 4J7FA 2YXYA 2X4YA 2X4WA 4JZ4A 3JCMb 3CCMA 4LN2A 3ASKA 4OMFB 4LDYA 4M78E 5DY9A 3CC7A 2DL7A 2RQVA 1NPPA 2L8DA 2CS7A 4LUDA 2LCSA 4XAXB 4FYYB 3LGFA 4FT4A 4LUEA 4RG2A 3M4GA 1UUEA 2JS0A 3CPWA 4C5GA 1V76A 2DRKA 3PIPA 5CO7A 2KDSA 3FEOA 4HCKA 3CCLQ 2LQ8A 4HVWA 1M4ZA 1VQNT 1QMCA 3HFNA 3HSBA 5CQYA 3VS0A 2H8HA 1IRXA 2G3RA 3WVDB 1WLPB 4M78D 4X1VA 2KMTA 4JLIA 1WJRA 1JO8A 1RABB 1SSHA 1K9AA 1HK9A 1U06A 2YT6A 4X9DA 4Z88A 1RAGB 3EHQA 2RF0A 4F7UE 3X26B 3UDCA 3MEUA 4JLGA 2E4HA 1R77A 3J81E 1IXDA 3IQLA 1KIKA 2ABLA 1MNDA 1WHMA 1V29B 1ZUKA 2IPOB 1LVKA 2F69A 2K3YA 1S72A 1YJWA 2EQJA 3G6EQ 1VQOQ 4X34A 2JT4A 3HRUA 1PSEA 3EGXA 3CBOA 2LCCA 1SG5A 1BI3A 3H9NA 3UF4A 3M58A 4C92B 3OYNA 1M8MA 2CZ0B 3V7CA 1GFDA 1VQ7A 2DETA 3CCRT 3MP8A 1G5VA 4R55A 3A8LB 3CCVQ 4HT8A 3TVTA 1IREB 2HMAA 3AHUA 2E3IA 2KI7A 4PFZA 2ZPBB 2E65A 2MK5A 4N4GA 4M77A
chains in the Genus database with same CATH topology
5GAMf 5GANg 2DIQA 3QUIA 2YLCA 4C0DC 3OYBA 4M7AF 4JDSA 1YJNA 3MEWA 3CCLT 4M78G 4M7AC 3N5BB 1VQLA 2XD0A 1N8RU 4M75G 4C0GA 2XDBA 2ZZDA 5GAMd 3JCMf 3QYHB 3VU3C 1UGPB 4ZGDB 1JBMA 1VQ5T 4MMKA 1BKBA 4HCBA 2MWPA 2RJEA 3GNFB 4OGCA 2D9TA 4L59A 5DLQE 3OY9A 3LWIA 3E19A 3CEYA 1P92A 1VQ9T 4M75E 5D6XA 1MHNA 4KULA 3G71T 4BY6C 4A53A 3CCQA 2E5QA 3LW5E 4LDVA 4ZN1A 4ZTFA 5KE3A 2F5KA 2EYQA 3P8DA 3Q1JA 1FWZA 5FU7C 4C5EA 2YHTA 4M7DD 2EKOA 4M78A 3CCRA 4XTXA 5GANh 4PNOA 3UT1A 2DTOA 2E6ZA 2HAXA 1KG1A 5GANe 3E9GA 1H641 4NL3A 2DK3A 5IAYA 3DLLA 1K73U 1KHIA 5CQXA 3OSSC 1M9SA 2LQKA 3MO8A 1Q81U 2KY9A 1VQ8A 2RI2A 4OVAA 2XHCA 2O01E 2CYZB 3M57A 4MZPA 4E7KA 1KQ2A 3CCSA 4HCZA 2H3JA 3VYHB 4BE1A 5GAN6 3CCLA 2XU8A 2KK4A 1W2BS 3OYGA 4RKUE 1VQKT 3HHTB 5KCHA 1VQ5A 1DJ7B 2GFAA 3FIFA 3GLXA 3JB9I 1Y96A 4B9XA 1VIEA 4EDUA 3L2UA 4XTWA 4M77B 4A4GA 4DOWA 2ZGWA 4M75D 2RHIA 3JB9F 3G71A 4C92F 2PUKB 2RB6A 1K8AC 3DLMA 2VXEA 3META 4II1A 5CVIA 5EG2A 4M7AB 2QQRA 4C92C 2V8IA 5J3BA 3VUBA 4F7UG 5J26A 2GF7A 4QQDA 2QQBA 5CK9A 3G6ET 1VQOT 1I81A 3NTHA 3OMCA 2QI2A 2O4XA 3BFMA 3KUFA 2DZCA 3UWNA 3JB9J 4RMOA 1X01A 2D0QB 4BY6B 3INZA 4PJOG 5CCAA 4N0AA 3RKWA 1B34A 3CCUA 5FU7B 1Q82C 1QVGA 5GAN3 1OYXA 2X35A 2WSFE 1G3YA 3X28B 4JRPA 2I2LA 1QVPA 4M78B 4PKCC 5GAOr 3PGGA 4EMKA 1ZBXA 3OS2A 2R57A 4F7UA 3ZEHA 2LT4A 3CCVT 2XICA 1M90C 4PJOE 3OA6A 2FHDA 3BDLA 3PFSA 1D3BA 3M5AA 4RCCA 3L2QA 1RL2A 2RJCA 4BE0A 1Q86C 4JUVA 1KD1C 3O8VA 2QEXT 2FVUA 2OAUA 1QW1A 4ZGEB 3OB9A 1EIFA 1ZQ1A 1NJIC 3HRSA 4C8QA 4C8QC 4ELYC 4E7IA 3C12A 1K9MC 2XK0A 3SWNA 3SWNC 1YJNT 2JNGA 1M8VA 3QIIA 5HY6A 3TREA 2QQ9A 3QZ5B 4J6YA 5GMKm 2Y4YA 3G6EA 1X75C 1O75A 3I55T 3JCMP 2GCXA 1VQOA 2ZPGB 3H8ZA 1Y96B 3OW2A 1VQMA 1VQ6T 2LRQA 1M1KU 2LNVA 3A8HB 2DPPB 3RKYA 5D6YA 3S3NA 3QDRB 4E7LA 2YLBA 2DJZA 2R5MA 1M1FA 3QJ6A 4RCBA 3OYDA 2RK1A 3JB9D 1HXDA 4NL2A 2XIDA 1JJ2S 4OB3B 3OQ5A 2B8AA 3CXCS 2CZ1B 2EAYA 5LJ5f 2O4XB 1UB4A 4FT2A 4EPCA 2M1HA 3KBGA 4DQ2A 2P4TA 1GXIE 2CGHA 1SSFA 2LX9A 2A3LA 4PLIA 5CKHA 4M7DA 4OB1B 4M7DC 2YRVA 1WQ7A 2JOYA 3FRNA 4OB2B 4A4KA 5GAOm 3X20B 4C0FA 5A0LA 2XDDA 1VQ8T 4D6WA 1Y7XA 2P0KA 2QEXA 1QVFS 1LJOA 2EFIA 3FB9A 3CC2A 3A8OB 2VV5A 2PVDB 5GMKj 4EMKB 3V7SA 2RJFA 2HQXA 2JTMA 3CPWS 4F7UB 4HKEA 3LH0A 4OF1A 5CIUA 2VGMA 4QW2A 3T9NA 4KBMB 2K4YA 1D3BB 1NPRA 2XG8D 2EWNA 3CMAA 1KHCA 3I55A 3BW1A 1XTDA 4BI4A 1VQPT 4LD9K 2R5AA 4XU0A 2DXCA 1VQ6A 4BI8B 4JS5A 2MAMA 1K8AU 1NZ9A 3JCMh 3CCEA 4C8QB 3JCMW 2K5LA 3QKJA 5I2SA 2AHJB 3E1SA 4M7AE 3SWNB 3UPUA 3M53A 4LD6A 2E64A 2QQAA 2JZ2A 1WJQA 4IUTA 5DLOA 2CZ7B 4M78F 1QP2A 3V7RA 1N9SA 3QXEB 3VKIA 4FIBA 2HQEA 4M78C 4M75A 3JRZA 2E12A 1WGSA 2ZPEB 3CBPA 1G3WA 4FL6A 1O9SA 2JUFA 4JRKA 4L6V5 3PMTA 3GNGA 5GMKi 1Q82U 2MF2A 1XQHA 5LL6S 3CCUT 3RMSA 5A0GA 3SDZA 4J8OA 1YBYA 3HPWA 2KQWA 1WPYA 1QVGS 3QSUA 5GANf 2VGNA 1M90U 1YJ9T 2K5IA 1M5Q1 4JS4A 4JJNK 4MZTA 4LDXA 5GAN2 1Y07A 3ZFJA 4NS5A 3JCMV 3GOXA 3SD4A 1IZ6A 2BKDN 4ZGJB 5GMKh 3NFCA 4J7IA 1Q86U 2QTXA 5M9OA 5GANd 2VYTA 4M7DB 5D6WA 5GMKe 1VQPA 1LNXA 1KQ1A 3E9FA 4M77D 4QVCA 3PNWC 4KUIA 1NJIU 2JVVA 3JCMX 4L5GA 2HBPA 3WXMB 2PUOB 4IURA 4ZN3A 1OZ3A 4M7AD 4XTYA 4XTVA 3QO3A 3M9QA 2EQMA 4QVDA 2FYKA 2RHXA 1FX7A 3MCAB 3EFRA 3OYFA 3DB3A 3JB9G 2Y90A 2OTLA 4HT9A 3G4SA 3OSVA 4QQ6A 4PL6A 4EMGA 5A0DA 3NTIA 5HK3A 2Y4XA 1VQMT 3HP9A 4TVRA 4DA4A 1YHQT 2DTHA 3DB4A 4OB0B 1BIBA 1N8RC 5FU6C 3JCMc 4C92E 4P5NA 5GMKl 3H6ZA 5LJ3j 3OS5A 1UGSB 2DIGA 4N0AC 4GLKA 1YITA 3MP1A 3CBMA 4QQGA 2RHZA 2DXBA 2DZ9A 4HA8A 4MMLA 1VQ4T 4F7UF 3S3OA 3ME9A 3OYLA 3J7AF 4EMKC 2KSSA 4M75B 1YJ9A 1KQSS 3GF5A 4XTUA 1MGQA 2PVGB 2WSEE 3L1AA 4J83A 3A8GB 5GAOn 2MMPA 1JRIA 5FRNA 2NLUA 2R58A 4IUPA 2CKKA 2DXTA 2MI6A 3G7ZA 2ZCFB 3OMGA 3RUXA 5C6SA 2V8JA 3OS1A 3MEAA 1I5LA 3CC4A 2DD5A 4PJOF 3BY7A 4KT0E 4C8QF 5LJ3g 1RI0A 2X4JA 3MEVA 3CC2T 3JB9H 5HKCA 4PJOA 4PJOC 5CKEA 3L2ZA 3TEEA 3JAME 2DXUA 4JRQA 1ZHIA 2D6FA 1QP3A 5GAMj 4XTZA 1JB0E 5GAOl 1YIJT 3QPHA 2IG0A 3OYJA 1W4SA 1U8RA 2ZPFB 3RMQA 3CMAT 1UGRB 3JCMJ 2F5TX 3TU4K 1WQWA 1UGQB 3HFOA 1W2BA 3S6WA 1YHQA 3CCET 3CCST 4C92D 4N4IA 2XI9A 3EFSA 3L2VA 2QQSA 3LGLA 2GFUA 4OGEA 2RD1A 3PMIA 5GAMg 3FC3A 4ME7A 5I21A 4E7JA 1VQ4A 2KAFA 3SFMA 1BYMA 3P8HA 5LJ3h 5GAN4 2VXFA 2E10A 1U1SA 1KC8C 4A54A 2EQUA 4CRIA 1BIAA 2VUBA 5LJ3e 3FLGA 3JCMg 3CCMT 2L5QA 2XDPA 3RIRA 5FU6B 4M7DF 4IUQA 5LJ5h 1B34B 3VJPA 1TH7A 5L8RE 1BI2A 3V8JA 4YTLA 3V8KA 2EJ9A 3WVEB 3CC7T 4Q5WA 4M77G 2L89A 2LCLA 3QJYA 4FU6A 4RG8A 4A4FA 5KH6A 2DO3A 5CR2A 2JN0A 1LOJA 3MP6A 2PU9B 4BDZA 5KCOA 3OYHA 1YIJA 2EJFA 4M7AG 3VYGA 2LC4A 5GAMh 2ZPHB 3V8LA 1BI0A 2WSCE 4M77E 2DVEA 5GAMe 5GAN5 3ER0A 3RKXA 3QZ9B 4MDXA 2EJGA 4PJOB 4BACA 2RM4A 1AHJB 1VIFA 1WJSA 1XOVA 4V2SA 3GIBA 4Z02A 2QA4T 4DOVA 4J5YA 3HKSA 3JCMe 3J80E 1N9RA 5GAN8 3ZBDA 5I2MA 2OTLT 3G4ST 4ATOA 4M75F 3QG1A 3RERA 3M56A 1FXXA 2K2VA 3LLRA 4M75C 3CMEA 4M7AA 5CKDA 4J7FA 3JCMb 2X4YA 2X4WA 3CCMA 2VC8A 2OTJT 2RHUA 4XU3A 2QXFA 3ASKA 4OMFB 3OYKA 4LDYA 3GP8A 4VUBA 1YITT 4M78E 3JCMd 3P8BB 1M1KC 5DY9A 1JJ2A 3LYIA 3CC7A 2BUDA 3I56A 3S3MA 1NPPA 2A7YA 2L3RA 3MHXA 2RH2A 4BE2A 2L8DA 3GPLA 5FLXE 1UEBA 5GAN7 4HCCA 4QVZA 2CS7A 4O6JA 2E41A 5AYFA 3PTAA 3CXCA 4N4HA 4A4EA 1N27A 3L2RA 2RJDA 4J6WA 1KD1U 4B9WA 4EMHA 1OI1A 2RHYA 5GAOq 3CC4T 1I8FA 3BDUA 3PIOA 3HL8A 4XAXB 2LT1A 2PVOB 1K9MU 3RESA 3CD6T 2LDMA 4C5IA 3LGFA 4FT4A 1Q7YC 1QVFA 1XNIA 2QA4A 4RG2A 4IUVA 5CKFA 4MZMA 3PT9A 4J6XA 3M4GA 2P0QA 5A2QE 3SB2A 2DKGA 4C92G 3CPWA 4C5GA 1G3TA 3PIPA 4X9CA 5CO7A 3OBYA 2KDSA 3FEOA 2WACA 3M55A 2DD4A 3OYYA 1OZ2A 2LQ8A 4BD3A 3R6OA 1KC8U 3OW2S 1M4ZA 4R56A 1VQNT 3HFNA 3HSBA 2OTJA 5CQYA 4BI3A 4ZTJA 4NOYA 1PSFA 2QDYB 2G3RA 3C95A 4FSXA 1Y71A 4JRIA 5HK0A 3WVDB 3OBWA 4A4HA 3C94A 1R8OB 4M78D 2GQVA 2KMTA 4MDWA 4C0DB 4JLIA 3CCJT 2PQWA 1WJRA 1VQ9A 1S72T 4UC4A 4Y28E 5DM7R 1YJWT 3X24B 4C92A 1HK9A 3OYAA 1YI2T 5LJ5j 4O5VA 5IT9E 2DTIA 4ELZC 2M0OA 2FB7A 3M54A 4X9DA 4BB7A 4FM4B 4XQ3A 2LVMA 4C0ZA 4XU2A 4F7UE 3CD6A 3QBYA 4CI0C 3X26B 3UDCA 1G3SA 3L2WA 1K73C 3MEUA 4C8QG 3A8MB 2E70A 5IN1A 1Q81C 4E47A 4JLGA 3OYMA 3DKMA 2E1HA 2M16A 2RI5A 5LJ5g 3J81E 1VQ7T 4XK8E 4OP0A 3LX7A 1U1TA 2M9UA 2K3XA 3URGA 2EIFA 4C8QE 2DAQA 3X25B 2X4XA 4BUGA 5CAIA 3HRTA 1VQNA 2ZPIB 1VQKA 4C5HA 2K57A 4BDYA 1I4K1 1V29B 4PLLA 3QHSA 1WNLA 3L42A 3JSCA 3JCMQ 3KXTA 3VV0A 2F69A 4WF2A 3VUZA 2K3YA 3CCJA 1M1GA 5C0MA 2XKOC 1S72A 1YCYA 2MWOA 3F70A 2EQKA 3EAEA 3CMET 1YJWA 1VQLT 1NE8A 2RK2A 3OYIA 2HD0A 1YI2A 2EQJA 3C4SA 3M59A 3OYCA 2KVQG 2P0PA 1BI1A 4X34A 2E6NA 3OS0A 2K5FA 2JTFA 4KUDK 3HRUA 4M7DG 1PSEA 5CKBA 4E7HA 4GY5A 1N6AA 3A5ZB 4IUUA 3CBOA 2LCCA 3NTKA 5LJ3f 5LJ5e 3OYEA 5GAOp 3CCQT 3FDRA 5J39A 1BI3A 2BIVA 3I56T 3M58A 2CZ6B 4C92B 2RA2A 2DEQA 1X6OA 5GANj 4Y91A 1VUBA 4LDUA 3OYNA 2V8KA 4M7DE 2CZ0B 2C06A 3CPFA 5LJ3d 1KQSA 3V7CA 5FRMA 1VQ7A 1H3ZA 3CCRT 2HNIA 3MP8A 1G5VA 2FL7A 2LTOA 5FROA 4R55A 5KE2A 3M4YA 3CCVA 3A8LB 4PJOD 4HT8A 2RI3A 4C8QD 2RO0A 1IREB 4XU1A 3LWHA 4IKFA 1Q7YU 3AHUA 4LDWA 3QYGB 2ZPBB 5LJ5d 4M77F 3TCJA 2E65A 4M77A 3FJPA 4N4GA 2IVWA 4M77C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OI1 A;  2RHY A;  2DIQ A;  2LRQ A;  3OYB A;  3S3O A;  3ME9 A;  3OYL A;  3MEW A;  5D6Y A;  3S3N A;  4E7L A;  2R5M A;  3OYD A;  3QJ6 A;  2LDM A;  4C5I A;  3LGF A;  5FRN A;  2NLU A;  1XNI A;  2R58 A;  4IUP A;  2CKK A;  4RG2 A;  4IUV A;  3OS1 A;  3OMG A;  5C6S A;  3OQ5 A;  3MEA A;  4C5G A;  2MWP A;  2RJE A;  2B8A A;  2D9T A;  4L59 A;  3OY9 A;  3FEO A;  1RI0 A;  2WAC A;  3CEY A;  3MEV A;  5D6X A;  4BD3 A;  1MHN A;  1OZ2 A;  2O4X B;  2M1H A;  2E5Q A;  1SSF A;  4PLI A;  4ZTF A;  5KE3 A;  2F5K A;  3P8D A;  3Q1J A;  2YRV A;  4C5E A;  4ZTJ A;  2IG0 A;  3OYJ A;  2G3R A;  2EKO A;  2P0K A;  4A4H A;  2EFI A;  3UT1 A;  2PQW A;  1WJR A;  2RJF A;  2HQX A;  3S6W A;  4UC4 A;  3E9G A;  3LH0 A;  5CIU A;  5IAY A;  4QW2 A;  4N4I A;  3OYA A;  3MO8 A;  3L2V A;  2RI2 A;  2QQS A;  4OVA A;  3LGL A;  1KHC A;  2GFU A;  4E7K A;  3PMI A;  2M0O A;  3FC3 A;  4HCZ A;  2R5A A;  4E7J A;  3P8H A;  2LVM A;  4BE1 A;  2EQU A;  4CRI A;  3QKJ A;  3QBY A;  3FLG A;  3L2W A;  4LD6 A;  2XDP A;  3MEU A;  2JZ2 A;  3OYG A;  1WJQ A;  4IUT A;  4IUQ A;  5IN1 A;  5KCH A;  3OYM A;  2GFA A;  4B9X A;  2M16 A;  2RI5 A;  2HQE A;  4EDU A;  3L2U A;  4A4G A;  3LX7 A;  2K3X A;  2RHI A;  4Q5W A;  2L89 A;  4FU6 A;  2DAQ A;  1WGS A;  3DLM A;  3MET A;  2X4X A;  4II1 A;  4FL6 A;  4A4F A;  5KH6 A;  2QQR A;  3PMT A;  3MP6 A;  4C5H A;  4BDZ A;  5KCO A;  5J26 A;  3OYH A;  4BDY A;  2GF7 A;  4QQD A;  4PLL A;  3L42 A;  3NTH A;  3OMC A;  2K3Y A;  3H8Z A;  2O4X A;  3KUF A;  5C0M A;  2MWO A;  3F70 A;  2EQK A;  3EAE A;  3UWN A;  4BAC A;  1WJS A;  4NS5 A;  3OYI A;  3SD4 A;  3GOX A;  2BKD N;  2EQJ A;  3C4S A;  4Z02 A;  3OYC A;  5M9O A;  4X34 A;  2E6N A;  2VYT A;  5D6W A;  3OS0 A;  2JTF A;  1OYX A;  2X35 A;  3E9F A;  3PNW C;  4E7H A;  4GY5 A;  2R57 A;  3OS2 A;  4IUU A;  3LLR A;  2LCC A;  3NTK A;  4IUR A;  3ZEH A;  1OZ3 A;  3OYE A;  3OA6 A;  2FHD A;  3FDR A;  2X4Y A;  2X4W A;  2BIV A;  2EQM A;  3BDL A;  3M9Q A;  3PFS A;  5J39 A;  2RHX A;  2RHU A;  3OYF A;  3L2Q A;  3DB3 A;  3OYN A;  2RJC A;  3ASK A;  4BE0 A;  3OYK A;  5FRM A;  3O8V A;  4QQ6 A;  4PL6 A;  1H3Z A;  3MP8 A;  1G5V A;  2LTO A;  5FRO A;  3OB9 A;  3NTI A;  5KE2 A;  3LYI A;  4E7I A;  4IKF A;  2BUD A;  2RI3 A;  2RO0 A;  2XK0 A;  3S3M A;  3DB4 A;  2L3R A;  3QII A;  4BE2 A;  2L8D A;  4QVZ A;  3H6Z A;  4N4H A;  4A4E A;  1N27 A;  2DIG A;  2RJD A;  3L2R A;  4B9W A;  3MP1 A;  4QQG A;  4N4G A;  2RHZ A; 
#chains in the Genus database with same CATH topology
 1VQL A;  4C0G A;  2XDB A;  3JCM f;  3QYH B;  2W0Z A;  2MWP A;  3LWI A;  3E19 A;  2K6D A;  1P92 A;  2DFU A;  1MHN A;  1SEM A;  4KUL A;  3G71 T;  4BY6 C;  4A53 A;  2K7A A;  4LDV A;  2F5K A;  3Q1J A;  4C5E A;  2HDA A;  4M78 A;  2K3B A;  1ZA1 B;  5GAN h;  2BE7 D;  4PNO A;  2DTO A;  1ZLM A;  1KG1 A;  3DLL A;  2DK3 A;  1KHI A;  2DL5 A;  1Q81 U;  4OVA A;  2XHC A;  2CYZ B;  3CCS A;  2KXC A;  4HCZ A;  1SRM A;  1YWO A;  4PJL A;  5GAN 6;  1YN8 A;  1H3H A;  1I1J A;  2M0Y A;  3OYG A;  5FW9 A;  1X27 A;  2GFA A;  1VQP Q;  3L2U A;  2RHI A;  2KXD A;  2VXE A;  4E6R A;  5CVI A;  5EG2 A;  3M0T A;  3VUB A;  2FZK B;  3NTH A;  3OMC A;  3BFM A;  2NUT A;  1X01 A;  4RMO A;  4BY6 B;  1IGQ A;  2FZG B;  4PJO G;  3CCU A;  1Q82 C;  1QCO A;  1QVG A;  2KYM A;  4JRP A;  3PGG A;  2R57 A;  4F7U A;  3ZEH A;  1WIE A;  2LT4 A;  2QDL A;  3OA6 A;  4PK4 A;  2FHD A;  3EGD A;  3PFS A;  1QVG P;  1ACM B;  4RCC A;  1TOV A;  2FVU A;  1QW1 A;  2OAU A;  3OB9 A;  4Z89 A;  1NLP C;  2HBW A;  3HRS A;  4ELY C;  2QAS A;  1M8V A;  2JNG A;  2H3E B;  3QZ5 B;  2X3W D;  3REA B;  1MMA A;  1VQ6 T;  3A8H B;  2A08 A;  2DPP B;  4E7L A;  2YLB A;  2CH4 W;  1HXD A;  2XID A;  4OB3 B;  3UA7 A;  1AOJ A;  2CZ1 B;  1KK7 A;  4DQ2 A;  2COZ A;  4PJJ A;  1YFN A;  2LX9 A;  4Y92 A;  2D8H A;  1GCQ C;  4JJC A;  1M3B A;  2QEX A;  3FB9 A;  3CC2 A;  1OOT A;  3A8O B;  2VV5 A;  4OMM A;  2CP3 A;  4HKE A;  2ROL A;  3LH0 A;  4OF1 A;  4QW2 A;  3T9N A;  2EBP A;  4HVV A;  5IHK A;  1D3B B;  1YIJ Q;  3I55 A;  1WHJ A;  4J9G A;  2MAM A;  1K8A U;  3JCM W;  3CCE Q;  2AHJ B;  3E1S A;  2QQA A;  4IUT A;  2CZ7 B;  1IGU A;  2NUP A;  4FIB A;  3VKI A;  2ED0 A;  2D1X A;  3RBB B;  3CCM Q;  4JRK A;  1G3W A;  2LX7 A;  1O9S A;  4K11 A;  1XQH A;  5LL6 S;  3CCU T;  1AWJ A;  4J8O A;  1YBY A;  3M0R A;  4JPB W;  1QVG S;  2F2X A;  4JJN K;  2FZC B;  4LDX A;  5GAN 2;  1Y07 A;  4CC7 A;  3JCM V;  2CP0 A;  1IZ6 A;  2BKD N;  2D0N A;  1RAD B;  2ECZ A;  4J7I A;  1PRM C;  1Q86 U;  2QTX A;  5M9O A;  2VYT A;  5D6W A;  5GMK e;  1KQ1 A;  1LNX A;  4QVC A;  4RTX A;  3PNW C;  1FYN A;  3I5S A;  2JTE A;  4XTY A;  3QO3 A;  2FYK A;  2RHX A;  1FX7 A;  3MCA B;  1NYG A;  2K79 A;  3JB9 G;  2Y90 A;  3G4S Q;  1SRL A;  4EIK A;  3NTI A;  2Y4X A;  1BBZ A;  3HP9 A;  1X6B A;  3DB4 A;  5FU6 C;  6AT1 B;  1OPK A;  3H6Z A;  5LJ3 j;  4N0A C;  1UGS B;  2DIG A;  1YIT A;  2RHZ A;  1V1C A;  1VQ4 T;  3S3O A;  2DLP A;  4M75 B;  1MGQ A;  2WSE E;  3A8G B;  1W6X A;  1JRI A;  2NLU A;  2CKK A;  3OS1 A;  2ZCF B;  3OMG A;  5AT1 B;  3MEA A;  1I5L A;  3CC4 A;  4PJO F;  3BY7 A;  1XJW B;  4C8Q F;  3CC2 T;  3JAM E;  2D6F A;  2DXU A;  2KYB A;  1IO6 A;  5GAM j;  4XTZ A;  1JB0 E;  5GAO l;  2M02 A;  3QPH A;  2LZ6 B;  1W4S A;  5KYX B;  3M0S A;  2F5T X;  3HFO A;  2DA9 A;  5GJV B;  3H41 A;  1M2O A;  4N4I A;  2O9S A;  2J6O A;  1OU9 A;  4OGE A;  3FC3 A;  1Y57 A;  3OW2 P;  5I21 A;  4E7J A;  1PWT A;  3SFM A;  1BYM A;  2DRM A;  3QDF A;  1S72 Q;  2EQU A;  2Z0W A;  4HVU A;  2XDP A;  4M7D F;  5FU6 B;  3EG9 A;  5LJ5 h;  1C1A A;  2KGT A;  5L8R E;  1OU8 A;  1RAC B;  1G83 A;  3JV3 A;  3WVE B;  3QJY A;  4RG8 A;  5KH6 A;  5IH2 A;  1EZZ B;  5KCO A;  1FMW A;  2LC4 A;  1RUW A;  4OMO A;  1VQ7 Q;  4M4Z A;  2DVE A;  2X51 A;  5GAN 5;  2CP6 A;  3ER0 A;  1AHJ B;  1VIF A;  1GL5 A;  3HKS A;  3UA6 A;  1MV0 B;  5GAN 8;  3QG1 A;  3M56 A;  5CKD A;  3CME Q;  1VQL Q;  1ARK A;  4FYV B;  1YIT T;  3JCM d;  2DER A;  1JJ2 A;  1QWE A;  3S3M A;  3I56 Q;  2L3R A;  4BE2 A;  3GPL A;  5GAN 7;  4QVZ A;  5AYF A;  1RLQ C;  2E41 A;  3CXC A;  4A4E A;  1N27 A;  2OX7 A;  4J6W A;  2CSQ A;  1JXO A;  8AT1 B;  2RHY A;  3CC4 T;  1I8F A;  2ZAE A;  4J6X A;  5A2Q E;  3CCS Q;  1G3T A;  3QWY A;  2HKN A;  1KC8 U;  3OW2 S;  4R56 A;  1NJI R;  3O5Z A;  1PSF A;  1E6G A;  2QDY B;  4JRI A;  4A4H A;  4OMN A;  2CH4 A;  1K1Z A;  1VQ9 A;  1HJD A;  3X24 B;  3M0Q A;  3VS3 A;  1M2V A;  1YI2 T;  3OYA A;  5LJ5 j;  4JJD A;  2DTI A;  4DBF A;  4FM4 B;  2LVM A;  1WZO A;  4CI0 C;  2LMJ A;  3L2W A;  1K73 C;  1UJY A;  5IN1 A;  2RI5 A;  4OP0 A;  2M9U A;  2JJ9 A;  1R0C B;  4C8Q E;  2DAQ A;  5ECA A;  2X4X A;  1VQN A;  1VQK A;  4C5H A;  1I4K 1;  1NG2 A;  1MNE A;  1W2B P;  3VUZ A;  2J6K A;  5C0M A;  3F70 A;  2EQK A;  1UG1 A;  3OYI A;  2K5F A;  2JTF A;  4E7H A;  4GY5 A;  1N6A A;  1TWB A;  3A5Z B;  2EGE A;  5LJ3 f;  3CCQ T;  4QKU A;  1B7T A;  1KSW A;  2EPD A;  2RA2 A;  1OUL A;  4M7D E;  1KQS A;  1H3Z A;  4CC3 A;  2LTO A;  4PJO D;  1PD0 A;  5KYW B;  2RI3 A;  4C8Q D;  2RO0 A;  3LWH A;  1Q7Y U;  1BB9 A;  3FJP A;  4M77 C;  5GAM f;  5GAN g;  2O31 A;  3FJ5 A;  2X9H A;  1YJN A;  4M75 G;  1X2Q A;  2ZZD A;  3QWX X;  3R6N A;  4A63 B;  2GTJ A;  3I55 Q;  1VQ5 T;  2HL5 C;  1BKB A;  2DF6 A;  3GNF B;  1ZUY A;  1VQ9 T;  5D6X A;  2F2W A;  1TUG B;  1WFW A;  2AZV A;  1WXT A;  4ZTF A;  3P8D A;  1YNZ A;  4M7D D;  1AZG B;  2EKO A;  3CCR A;  4DEX A;  2A28 A;  3EGX B;  5FWB A;  4F04 B;  1Q82 R;  5L23 A;  2HAX A;  5GAN e;  1H64 1;  1RAE B;  2O9V A;  3OSS C;  1OPL A;  2RI2 A;  1VQ8 Q;  1PRL C;  4E7K A;  1VYT A;  2DL8 A;  3M57 A;  4MZP A;  5HCK A;  2ESW A;  4CC4 B;  1UHF A;  3EG1 A;  1C6V X;  1PC0 A;  1FMV A;  1Z9Q A;  4BE1 A;  1WHL A;  1NEB A;  3UAT A;  2AKL A;  1W2B S;  1VQK T;  2LP5 A;  3CPW P;  3A98 A;  4EDU A;  2DBM A;  2EGA A;  4M77 B;  4A4G A;  2ZGW A;  2GQI A;  3G71 A;  2PUK B;  3MET A;  2QQR A;  4C92 C;  2GF7 A;  4QQD A;  2L3Q A;  4PFP A;  1U5S A;  1WA7 A;  1E7O A;  3KUF A;  2NUZ A;  1QKX A;  5CCA A;  3RKW A;  5GAN 3;  1OYX A;  3X28 B;  1KQ2 A;  4HT9 A;  4M78 B;  4PKC C;  4EMK A;  1ZBX A;  2HEQ A;  2JM9 A;  5FWC A;  1M90 C;  2XIC A;  2EYW A;  3M5A A;  1GBR A;  2ENM A;  3O8V A;  1NJI C;  4C8Q A;  4RTW A;  4E7I A;  1YJN T;  1GCP A;  4J6Y A;  1X75 C;  4KH0 B;  3H8Z A;  1VQM Q;  1M1K U;  2QGF B;  3JB9 D;  1KC8 C;  1M1F A;  4RCB A;  3OQ5 A;  1C0M A;  4OML A;  5LJ5 f;  1OEB A;  1UB4 A;  2NUT B;  1SSF A;  5KYU A;  4PLI A;  4M7D A;  1WQ7 A;  3FRN A;  2P0K A;  1D0Y A;  1LJO A;  1K76 A;  1PCX A;  3EG2 A;  3CPW S;  4F7U B;  1H8K A;  2VGM A;  4ESR A;  5IHI A;  4KBM B;  2K4Y A;  1KHC A;  3CMA Q;  4LD9 K;  2DXC A;  3MPU B;  1T0H A;  1VQ6 A;  4F16 A;  1NZ9 A;  2K5L A;  3M53 A;  1RAA B;  4E2F B;  9ATC B;  1TSF A;  1Z9Z A;  1PG5 B;  1Q95 G;  2LJ0 A;  2ZPE B;  1X69 A;  4FL6 A;  5GMK i;  2MF2 A;  2CDT A;  1ZX6 A;  5A0G A;  2YUO A;  1SKU B;  4LNP A;  2VGN A;  1YJ9 T;  4JS4 A;  4MZT A;  4NS5 A;  2MOX A;  1D1C A;  5GAN d;  1ZSG A;  1AT1 B;  4KUI A;  2JVV A;  1OQK A;  4L5G A;  1QLY A;  2CT3 A;  4XTV A;  1H92 A;  2JMC A;  2DL4 A;  2EQM A;  1D1A A;  1CKA A;  2C0T A;  3OYF A;  2HSE B;  2OTL A;  2AKK A;  4QQ6 A;  2YUQ A;  2EW3 A;  1TTH B;  1M27 C;  1TG0 A;  4DA4 A;  1YHQ T;  1MUZ A;  2MYS A;  5GMK l;  2VB6 A;  2RQU A;  2NUP B;  3OYL A;  3J7A F;  2KSS A;  3GF5 A;  4J83 A;  5IXF A;  2MI6 A;  3G7Z A;  3H0F A;  3RUX A;  4KT0 E;  4ORZ A;  1VYU A;  3SHW A;  1RI0 A;  2X4J A;  3VS7 A;  5HKC A;  5CKE A;  4JRQ A;  3TEE A;  1AVZ C;  3ZL7 C;  4DBH A;  1AZE A;  3OYJ A;  2KRS A;  3RMQ A;  1PNJ A;  1UGR B;  3JCM J;  2L2P A;  2RPN A;  2F2V A;  1UGQ B;  3S6W A;  2I0N A;  4RTZ A;  1M3C A;  1VQN Q;  4J9H A;  3EFS A;  3ULR B;  2KRO A;  3L2V A;  2QQS A;  4WTO B;  2RD1 A;  3PMI A;  1W70 A;  1PHT A;  3MJX A;  1VOM A;  1VQ4 A;  5LJ3 h;  1TXQ A;  4A54 A;  2VUB A;  2HZY A;  3FLG A;  3JCM g;  1B34 B;  3VJP A;  1BI2 A;  4YTL A;  3V8K A;  1PD1 A;  4Q5W A;  4M77 G;  4FU6 A;  4RTV A;  4A4F A;  2JN0 A;  4CC2 A;  3MP6 A;  4J9C A;  3VRZ A;  3VYG A;  3E2U A;  5GAM h;  2ZPH B;  1NYF A;  2CP5 A;  1QCF A;  1MMD A;  1RI9 A;  1NM7 A;  1RLP C;  4MDX A;  2EJG A;  1XOV A;  3GIB A;  2QA4 T;  4KGZ B;  3JCM e;  7AT1 B;  3J80 E;  3ZBD A;  5I2M A;  2OTL T;  4ATO A;  2DNU A;  3EFO A;  2QG9 B;  1SF9 A;  4M75 C;  4FSS A;  2VC8 A;  2OTJ T;  2FG0 A;  2RHU A;  2W10 A;  1UTI A;  1NLO C;  2GBQ A;  3I5R A;  3OYK A;  4VUB A;  1M1K C;  2BZX A;  3CC7 Q;  2BUD A;  1MMN A;  2A7Y A;  2RH2 A;  5FLX E;  4HCC A;  4O6J A;  3PTA A;  3EG9 B;  3L2R A;  1KD1 U;  4B9W A;  3CCR Q;  1K73 R;  4EMH A;  5GAO q;  3PIO A;  2LT1 A;  1K9M U;  3CD6 T;  1QVF A;  4J9B A;  3PT9 A;  2P0Q A;  3SB2 A;  2DKG A;  4C92 G;  2B86 A;  4X9C A;  3NMZ C;  2WAC A;  1PKS A;  3M55 A;  2DD4 A;  1OZ2 A;  4GLM A;  3R6O A;  1GRI A;  2QTV A;  2KE9 A;  4NOY A;  3C95 A;  2FO0 A;  5HK0 A;  3OBW A;  1UE9 A;  2GQV A;  4MDW A;  4C0D B;  3CCJ T;  2A0F B;  3G71 Q;  4Y28 E;  3SEM A;  4R0K A;  4KGX B;  3PVL A;  4ELZ C;  2FB7 A;  3M54 A;  4BB7 A;  5EC7 A;  1ZSZ A;  4XQ3 A;  4ZNX A;  4C0Z A;  4XU2 A;  1RAH B;  3QBY A;  1G3S A;  1X6G A;  2E70 A;  1Q81 C;  3OYM A;  1LCK A;  2J06 A;  3DKM A;  2DYB A;  1U1T A;  2K3X A;  2EIF A;  3X25 B;  5CAI A;  3H0H A;  3HRT A;  2ZPI B;  4D8D A;  4J9D A;  2K57 A;  2RMO A;  5IHN A;  4PLL A;  3QHS A;  3JSC A;  3KXT A;  1T3S A;  3EHR A;  4WF2 A;  1M1G A;  3NPF A;  2XKO C;  1NE8 A;  2RK2 A;  1YJW Q;  1YI2 A;  3M59 A;  3VS4 A;  3OYC A;  2P0P A;  4OMQ A;  3OS0 A;  2E6N A;  4KUD K;  1EFN A;  4IUU A;  1AD5 A;  2GTO A;  2DX1 A;  2BIV A;  2CZ6 B;  2VKN A;  4LDU A;  3CPF A;  4OMP A;  1F1B B;  2HNI A;  5KE2 A;  3CCV A;  4IKF A;  4LDW A;  5LJ5 d;  1GCQ A;  2YUP A;  1ZA2 B;  2C0O A;  4M77 F;  3TCJ A;  1Y0M A;  3MEW A;  3CCL T;  4M7A C;  3N5B B;  1N8R U;  2V26 A;  1IB8 A;  4ZGD B;  4MMK A;  4HCB A;  1VQ6 Q;  5DLQ E;  1JQQ A;  4L59 A;  1T0J A;  3CCQ A;  4RTY A;  3VS1 A;  3LW5 E;  2EYQ A;  5FU7 C;  1FWZ A;  2YHT A;  1PKT A;  2YDL A;  2FRY A;  4XTX A;  1JJ2 P;  1YP5 A;  2E6Z A;  3E9G A;  3CXC P;  1M9S A;  3MO8 A;  2KY9 A;  1M90 R;  2O01 E;  2H3J A;  3VYH B;  2COY A;  2XU8 A;  1X2K A;  3HHT B;  5KCH A;  1VQ5 A;  2EYZ A;  1Y96 A;  4B9X A;  4DOW A;  2FEI A;  1NBE B;  3JB9 F;  4C92 F;  1K8A C;  3DLM A;  4II1 A;  4M7A B;  5J3B A;  5J26 A;  3G6E T;  1VQO T;  1KC8 R;  1GFC A;  3C0C A;  2O4X A;  1K4U S;  2DZC A;  1G8X A;  2KRM A;  3UWN A;  3JB9 J;  3INZ A;  1ABQ A;  4N0A A;  5FU7 B;  3CCU Q;  2BTT A;  2WSF E;  2IIM A;  1QVP A;  5GAO r;  4IIO A;  3OS2 A;  3CCV T;  4PJO E;  2HSP A;  1AEY A;  1WXB A;  1RL2 A;  1KD1 C;  1Q86 C;  2GNC A;  3EH1 A;  4ZGE B;  2RQW A;  4C8Q C;  3C12 A;  1K9M C;  2XK0 A;  3SWN A;  3EGU A;  1QQJ A;  3JCM P;  2Y4Y A;  1EX4 A;  2ZPG B;  4DBQ A;  3S3N A;  4D8K A;  3QDR B;  2DJZ A;  2R5M A;  1N5Z A;  3QJ6 A;  1JJ2 S;  4RUG A;  2DEU A;  2MIO A;  2L3P A;  1OX8 A;  1VQ4 Q;  2C0I A;  3CXC S;  2CSI A;  2EAY A;  2YRD A;  4F17 A;  2AZS A;  4FT2 A;  4EPC A;  1GXI E;  2CGH A;  4RTU A;  5CKH A;  4M7D C;  4KH1 B;  2YRV A;  2JOY A;  5GAO m;  1KQS P;  4OB2 B;  2LQN A;  3X20 B;  1WDX A;  4D6W A;  4Z8A A;  1CSK A;  3EG0 A;  2EYY A;  2QEX Q;  3NHN A;  2PVD B;  5GMK j;  4FW1 A;  4EMK B;  2RJF A;  3CC2 Q;  2JTM A;  5CIU A;  2L3S A;  1NPR A;  1WI7 A;  2EWN A;  3MKD A;  3AT1 B;  1XTD A;  3U23 A;  1VQP T;  2E5K A;  2DJQ A;  4XU0 A;  1IHW A;  2FPD A;  1YCS B;  2SEM A;  3CCE A;  4C8Q B;  3QKJ A;  5I2S A;  4LD6 A;  2JZ2 A;  1WJQ A;  5DLO A;  1QP2 A;  2M51 A;  1N9S A;  2KT8 A;  4M78 C;  2YWW A;  1CKB A;  1BU1 A;  3JRZ A;  3G1J A;  3RDV A;  3PMT A;  8ATC B;  1Q82 U;  3RMS A;  3SDZ A;  1NEG A;  3HPW A;  2KQW A;  2A36 A;  2OI3 A;  3ZFJ A;  3SD4 A;  4ZGJ B;  2HCK A;  3NFC A;  5KYU B;  2CP2 A;  4M7D B;  3BE3 A;  2J05 A;  4M77 D;  1QWF A;  3JCM X;  3WXM B;  1SPK A;  5KYY A;  1VYV A;  3M9Q A;  4QVD A;  4IIM A;  2JXB A;  3EFR A;  2LQW A;  3G4S A;  4EMG A;  5A0D A;  5HK3 A;  4TVR A;  4OB0 B;  1BIB A;  1S1N A;  4KRT A;  1N8R C;  2YSQ A;  4C92 E;  1SHG A;  1M3A A;  4GLK A;  2EGC A;  2RNA A;  3CBM A;  4QQG A;  1YIT Q;  3VS5 A;  2DZ9 A;  4MML A;  1KQS S;  1YJ9 A;  3L1A A;  5FRN A;  5GAO n;  2MMP A;  2PZ1 A;  4IUP A;  2R58 A;  2RN8 A;  4J9I A;  2DXT A;  5C6S A;  3CC4 Q;  3VS6 A;  5KYW A;  5LJ3 g;  2D8J A;  3JB9 H;  4PJO A;  3L2Z A;  1QKW A;  2J7I A;  4FYX B;  3RR6 A;  1YIJ T;  3THK A;  1WHG A;  3TU4 K;  1W1F A;  1WQW A;  2DMO A;  1YHQ A;  3H0I A;  3CCE T;  4C92 D;  2KNB B;  4ANJ A;  1UEC A;  3LGL A;  5GAM g;  2RQT A;  2JM8 A;  2KAF A;  3P8H A;  2EYX A;  1U1S A;  4CRI A;  1BIA A;  5LJ3 e;  3CCM T;  1YI2 Q;  1M1K R;  1E6H A;  4PFO A;  2QYZ A;  1TH7 A;  2DYI A;  2DVJ A;  2VWF A;  2G6F X;  2P4R A;  3CC7 T;  2EJ9 A;  2L89 A;  2LCL A;  5CR2 A;  2DO3 A;  1LOJ A;  3EGD B;  3OYH A;  4M7A G;  2EJF A;  1RAF B;  3V8L A;  3M0U A;  5GAM e;  1UDL A;  3RKX A;  1UJ0 A;  3QZ9 B;  5I11 A;  4BAC A;  4DBR A;  1YWP A;  4DOV A;  2J6F A;  1N9R A;  3G4S T;  1VA7 A;  4M75 F;  4GBQ A;  3RER A;  3NGP A;  1FXX A;  3LLR A;  3CME A;  1WHH A;  1JU5 C;  1G2B A;  4XU3 A;  2QXF A;  2O2O A;  2YUN A;  3GP8 A;  2CUD A;  3P8B B;  3LYI A;  2CP7 A;  3I56 A;  3CCQ Q;  3MHX A;  1UEB A;  1X43 A;  4N4H A;  2RJD A;  1OI1 A;  1Q81 R;  3BDU A;  3HL8 A;  2PVO B;  3RES A;  2LDM A;  4C5I A;  1Q7Y C;  1XNI A;  2QA4 A;  4IUV A;  1D0Z A;  4MZM A;  5CKF A;  1AWW A;  2KT1 A;  2O88 A;  1LPL A;  2OAW A;  3OBY A;  3OYY A;  4BD3 A;  2OJ2 A;  2EKH A;  2OTJ A;  4BI3 A;  2FRW A;  4ZTJ A;  1VQ5 Q;  4FSX A;  1Y71 A;  3KFV A;  3M0P A;  3C94 A;  1R8O B;  2EQI A;  1MMG A;  3EFO B;  2PQW A;  1VQ9 Q;  1S72 T;  4UC4 A;  5DM7 R;  1YJW T;  4C92 A;  4O5V A;  5IT9 E;  3EH2 A;  5GJW B;  2M0O A;  1ZSZ C;  3TSZ A;  3LH5 A;  3CD6 A;  4C8Q G;  3A8M B;  4JZ3 A;  1B07 A;  4E47 A;  3D7S B;  1VQ7 T;  2E1H A;  2M16 A;  5LJ5 g;  4XK8 E;  2V1R A;  3LX7 A;  3URG A;  4BUG A;  2F1L A;  1VQK Q;  4BDY A;  1WNL A;  3GBQ A;  3L42 A;  3JCM Q;  3VV0 A;  3CCJ A;  1WX6 A;  1YCY A;  2MWO A;  3EAE A;  3CME T;  1BCO A;  1VQL T;  2HD0 A;  3C4S A;  2KVQ G;  1BI1 A;  1I07 A;  2HL3 A;  4AMC A;  4M7D G;  5CKB A;  2K2M A;  2L0A A;  3NTK A;  5LJ5 e;  3OYE A;  3VS2 A;  5GAO p;  3FDR A;  5J39 A;  3I56 T;  2HKQ B;  2DEQ A;  1X6O A;  5GAN j;  4Y91 A;  1VUB A;  2P84 A;  1RAI B;  2V8K A;  2FPF A;  2VAS A;  5LJ3 d;  2C06 A;  5FRM A;  2FL7 A;  5FRO A;  3M4Y A;  1ZSZ B;  1WHK A;  4XU1 A;  1AWO A;  3QYG B;  2BZ8 A;  4AT1 B;  3CCS T;  2IVW A;  4DEY A;  2DIQ A;  3QUI A;  2YLC A;  4C0D C;  3OYB A;  4M7A F;  4JDS A;  2DIL A;  2COW A;  1YJN Q;  4M78 G;  2XD0 A;  3RNJ A;  5GAM d;  1UFF A;  3VU3 C;  1UGP B;  4E7Z A;  1JBM A;  1K8A R;  2RJE A;  4OGC A;  4AFS C;  2D9T A;  2QK0 A;  5I22 A;  3OY9 A;  3CEY A;  1J3T A;  2VVK A;  4M75 E;  1B3Q A;  4HXJ A;  2E5Q A;  5D7U A;  4ZN1 A;  3I35 A;  5KE3 A;  2KEA A;  1JEG A;  3UT1 A;  1WXU A;  4NL3 A;  5IAY A;  1K73 U;  5CQX A;  2LQK A;  1VQ8 A;  2FPE A;  2A37 A;  1JXM A;  4PJM A;  1KD1 R;  1Q86 R;  3CCL A;  2LNH B;  1QVF P;  4LXC A;  2KK4 A;  4RKU E;  4WCI A;  1K9M R;  1DJ7 B;  3FIF A;  3GLX A;  3JB9 I;  1R0B G;  1VIE A;  2LJ3 A;  2ATC B;  4XTW A;  1AWX A;  4M75 D;  1I0C A;  2RB6 A;  5KYN A;  4AFU C;  2V8I A;  4F7U G;  2QQB A;  5CK9 A;  4AFZ C;  1WYX A;  1I81 A;  3TQ7 P;  1PM3 A;  2QI2 A;  3EG3 A;  2XMF A;  4FYW B;  2MPX C;  2ROT A;  2D0Q B;  3VRY A;  2EVR A;  1A0N B;  1B34 A;  2X35 A;  1G3Y A;  2I2L A;  1YJ9 Q;  1KJW A;  3BDL A;  1D3B A;  1IHV A;  3L2Q A;  2RJC A;  4BE0 A;  3I9Q A;  4JUV A;  4LE9 A;  2QEX T;  1K0S A;  2MCN A;  2QGG A;  1EIF A;  2KBT A;  1ZQ1 A;  3SWN C;  3QII A;  5HY6 A;  3TRE A;  1T3L A;  2AT1 B;  2QQ9 A;  3A1P A;  5GMK m;  3G6E A;  1VQO A;  1O75 A;  4JJB A;  3I55 T;  1M30 A;  2GCX A;  1Y96 B;  3OW2 A;  1VQM A;  2LRQ A;  2LNV A;  3RKY A;  1YHQ Q;  5D6Y A;  4AFQ C;  3OYD A;  2RK1 A;  4NL2 A;  1M2V B;  2B8A A;  2K9G A;  3PE0 A;  2O4X B;  1D0X A;  2M1H A;  3KBG A;  2CRE A;  2P4T A;  4B6M A;  2A3L A;  4OB1 B;  1VQ8 T;  4A4K A;  2XDD A;  4C0F A;  5A0L A;  1Y7X A;  1QVF S;  1K0X A;  2EFI A;  1D09 B;  3V7S A;  2HQX A;  2DE0 X;  1ZUU A;  2DM1 A;  2XG8 D;  3CMA A;  2SRC A;  3BW1 A;  4AG1 C;  4BI4 A;  4KGV B;  2KR3 A;  2R5A A;  2LJ1 A;  4BI8 B;  1SHF A;  4E7S A;  4JS5 A;  1KFZ A;  3JCM h;  4M7A E;  3SWN B;  3UPU A;  2E64 A;  2PTK A;  4M78 F;  3V7R A;  1N8R R;  3QXE B;  1OX9 A;  2HQE A;  4M75 A;  1UHC A;  2E12 A;  1WGS A;  3CBP A;  4L6V 5;  2JUF A;  3GNG A;  1WPY A;  1ZBJ A;  3QSU A;  5GAN f;  1M90 U;  2K5I A;  1M5Q 1;  3GOX A;  5GMK h;  5KYX A;  2KRN A;  1VQP A;  3E9F A;  4AG2 C;  2RQR A;  1NJI U;  2JS2 A;  2BZY A;  2HBP A;  2PUO B;  4IUR A;  4ZN3 A;  1OZ3 A;  2HQH A;  4M7A D;  2QA4 Q;  1BCM A;  1BK2 A;  2AK5 A;  3DB3 A;  2OTL Q;  3OSV A;  4PL6 A;  2NYS A;  1VQM T;  2NWM A;  2V1Q A;  2DTH A;  3JCM c;  2OTJ Q;  1I5O B;  4P5N A;  3OS5 A;  2ED1 A;  1FMK A;  3MP1 A;  2JMA A;  2DXB A;  4HA8 A;  4F7U F;  3ME9 A;  4EMK C;  4XTU A;  2E3H A;  2PVG B;  1OV3 A;  1TUD A;  2PNI A;  1TUC A;  1UGV A;  2V8J A;  2JW4 A;  4FCY A;  2DD5 A;  1HSQ A;  3MEV A;  4PJO C;  2CUB A;  1ZHI A;  3CD6 Q;  1QP3 A;  1U3O A;  1QCN A;  1GBQ A;  2IG0 A;  2QAZ A;  1U8R A;  2ZPF B;  3CMA T;  4J9F A;  1D1B A;  1W2B A;  2YRC A;  5KYY B;  4PJN A;  2XI9 A;  2GFU A;  4ME7 A;  4J9E A;  5GAN 4;  3CCJ Q;  2VXF A;  2E10 A;  2DL3 A;  3HTR A;  2L5Q A;  3RIR A;  1TU0 B;  4IUQ A;  3REB B;  2BE9 B;  4QT7 A;  4FW2 A;  3TSW A;  1HD3 A;  3CQT A;  3V8J A;  2CT4 A;  2GGR A;  2PU9 B;  4BDZ A;  1YIJ A;  2X3X D;  1BI0 A;  1Q7Y R;  2WSC E;  4M77 E;  1MV3 A;  1TS9 A;  4PJO B;  2RM4 A;  4V2S A;  2AIR B;  1WJS A;  4Z02 A;  4J5Y A;  4RTT A;  2DBK A;  3PVQ A;  1HYO A;  4F14 A;  2K2V A;  4M7A A;  5IXB A;  1ABO A;  4J7F A;  2YXY A;  2X4Y A;  2X4W A;  4JZ4 A;  3JCM b;  3CCM A;  4LN2 A;  3ASK A;  4OMF B;  4LDY A;  4M78 E;  5DY9 A;  3CC7 A;  2DL7 A;  2RQV A;  1NPP A;  2L8D A;  2CS7 A;  4LUD A;  2LCS A;  4XAX B;  4FYY B;  3LGF A;  4FT4 A;  4LUE A;  4RG2 A;  3M4G A;  1UUE A;  2JS0 A;  3CPW A;  4C5G A;  1V76 A;  2DRK A;  3PIP A;  5CO7 A;  2KDS A;  3FEO A;  4HCK A;  3CCL Q;  2LQ8 A;  4HVW A;  1M4Z A;  1VQN T;  1QMC A;  3HFN A;  3HSB A;  5CQY A;  3VS0 A;  2H8H A;  1IRX A;  2G3R A;  3WVD B;  1WLP B;  4M78 D;  4X1V A;  2KMT A;  4JLI A;  1WJR A;  1JO8 A;  1RAB B;  1SSH A;  1K9A A;  1HK9 A;  1U06 A;  2YT6 A;  4X9D A;  4Z88 A;  1RAG B;  3EHQ A;  2RF0 A;  4F7U E;  3X26 B;  3UDC A;  3MEU A;  4JLG A;  2E4H A;  1R77 A;  3J81 E;  1IXD A;  3IQL A;  1KIK A;  2ABL A;  1MND A;  1WHM A;  1V29 B;  1ZUK A;  2IPO B;  1LVK A;  2F69 A;  2K3Y A;  1S72 A;  1YJW A;  2EQJ A;  3G6E Q;  1VQO Q;  4X34 A;  2JT4 A;  3HRU A;  1PSE A;  3EGX A;  3CBO A;  2LCC A;  1SG5 A;  1BI3 A;  3H9N A;  3UF4 A;  3M58 A;  4C92 B;  3OYN A;  1M8M A;  2CZ0 B;  3V7C A;  1GFD A;  1VQ7 A;  2DET A;  3CCR T;  3MP8 A;  1G5V A;  4R55 A;  3A8L B;  3CCV Q;  4HT8 A;  3TVT A;  1IRE B;  2HMA A;  3AHU A;  2E3I A;  2KI7 A;  4PFZ A;  2ZPB B;  2E65 A;  2MK5 A;  4N4G A;  4M77 A; 
#chains in the Genus database with same CATH homology
 5GAM f;  5GAN g;  2DIQ A;  3QUI A;  2YLC A;  4C0D C;  3OYB A;  4M7A F;  4JDS A;  1YJN A;  3MEW A;  3CCL T;  4M78 G;  4M7A C;  3N5B B;  1VQL A;  2XD0 A;  1N8R U;  4M75 G;  4C0G A;  2XDB A;  2ZZD A;  5GAM d;  3JCM f;  3QYH B;  3VU3 C;  1UGP B;  4ZGD B;  1JBM A;  1VQ5 T;  4MMK A;  1BKB A;  4HCB A;  2MWP A;  2RJE A;  3GNF B;  4OGC A;  2D9T A;  4L59 A;  5DLQ E;  3OY9 A;  3LWI A;  3E19 A;  3CEY A;  1P92 A;  1VQ9 T;  4M75 E;  5D6X A;  1MHN A;  4KUL A;  3G71 T;  4BY6 C;  4A53 A;  3CCQ A;  2E5Q A;  3LW5 E;  4LDV A;  4ZN1 A;  4ZTF A;  5KE3 A;  2F5K A;  2EYQ A;  3P8D A;  3Q1J A;  1FWZ A;  5FU7 C;  4C5E A;  2YHT A;  4M7D D;  2EKO A;  4M78 A;  3CCR A;  4XTX A;  5GAN h;  4PNO A;  3UT1 A;  2DTO A;  2E6Z A;  2HAX A;  1KG1 A;  5GAN e;  3E9G A;  1H64 1;  4NL3 A;  2DK3 A;  5IAY A;  3DLL A;  1K73 U;  1KHI A;  5CQX A;  3OSS C;  1M9S A;  2LQK A;  3MO8 A;  1Q81 U;  2KY9 A;  1VQ8 A;  2RI2 A;  4OVA A;  2XHC A;  2O01 E;  2CYZ B;  3M57 A;  4MZP A;  4E7K A;  1KQ2 A;  3CCS A;  4HCZ A;  2H3J A;  3VYH B;  4BE1 A;  5GAN 6;  3CCL A;  2XU8 A;  2KK4 A;  1W2B S;  3OYG A;  4RKU E;  1VQK T;  3HHT B;  5KCH A;  1VQ5 A;  1DJ7 B;  2GFA A;  3FIF A;  3GLX A;  3JB9 I;  1Y96 A;  4B9X A;  1VIE A;  4EDU A;  3L2U A;  4XTW A;  4M77 B;  4A4G A;  4DOW A;  2ZGW A;  4M75 D;  2RHI A;  3JB9 F;  3G71 A;  4C92 F;  2PUK B;  2RB6 A;  1K8A C;  3DLM A;  2VXE A;  3MET A;  4II1 A;  5CVI A;  5EG2 A;  4M7A B;  2QQR A;  4C92 C;  2V8I A;  5J3B A;  3VUB A;  4F7U G;  5J26 A;  2GF7 A;  4QQD A;  2QQB A;  5CK9 A;  3G6E T;  1VQO T;  1I81 A;  3NTH A;  3OMC A;  2QI2 A;  2O4X A;  3BFM A;  3KUF A;  2DZC A;  3UWN A;  3JB9 J;  4RMO A;  1X01 A;  2D0Q B;  4BY6 B;  3INZ A;  4PJO G;  5CCA A;  4N0A A;  3RKW A;  1B34 A;  3CCU A;  5FU7 B;  1Q82 C;  1QVG A;  5GAN 3;  1OYX A;  2X35 A;  2WSF E;  1G3Y A;  3X28 B;  4JRP A;  2I2L A;  1QVP A;  4M78 B;  4PKC C;  5GAO r;  3PGG A;  4EMK A;  1ZBX A;  3OS2 A;  2R57 A;  4F7U A;  3ZEH A;  2LT4 A;  3CCV T;  2XIC A;  1M90 C;  4PJO E;  3OA6 A;  2FHD A;  3BDL A;  3PFS A;  1D3B A;  3M5A A;  4RCC A;  3L2Q A;  1RL2 A;  2RJC A;  4BE0 A;  1Q86 C;  4JUV A;  1KD1 C;  3O8V A;  2QEX T;  2FVU A;  2OAU A;  1QW1 A;  4ZGE B;  3OB9 A;  1EIF A;  1ZQ1 A;  1NJI C;  3HRS A;  4C8Q A;  4C8Q C;  4ELY C;  4E7I A;  3C12 A;  1K9M C;  2XK0 A;  3SWN A;  3SWN C;  1YJN T;  2JNG A;  1M8V A;  3QII A;  5HY6 A;  3TRE A;  2QQ9 A;  3QZ5 B;  4J6Y A;  5GMK m;  2Y4Y A;  3G6E A;  1X75 C;  1O75 A;  3I55 T;  3JCM P;  2GCX A;  1VQO A;  2ZPG B;  3H8Z A;  1Y96 B;  3OW2 A;  1VQM A;  1VQ6 T;  2LRQ A;  1M1K U;  2LNV A;  3A8H B;  2DPP B;  3RKY A;  5D6Y A;  3S3N A;  3QDR B;  4E7L A;  2YLB A;  2DJZ A;  2R5M A;  1M1F A;  3QJ6 A;  4RCB A;  3OYD A;  2RK1 A;  3JB9 D;  1HXD A;  4NL2 A;  2XID A;  1JJ2 S;  4OB3 B;  3OQ5 A;  2B8A A;  3CXC S;  2CZ1 B;  2EAY A;  5LJ5 f;  2O4X B;  1UB4 A;  4FT2 A;  4EPC A;  2M1H A;  3KBG A;  4DQ2 A;  2P4T A;  1GXI E;  2CGH A;  1SSF A;  2LX9 A;  2A3L A;  4PLI A;  5CKH A;  4M7D A;  4OB1 B;  4M7D C;  2YRV A;  1WQ7 A;  2JOY A;  3FRN A;  4OB2 B;  4A4K A;  5GAO m;  3X20 B;  4C0F A;  5A0L A;  2XDD A;  1VQ8 T;  4D6W A;  1Y7X A;  2P0K A;  2QEX A;  1QVF S;  1LJO A;  2EFI A;  3FB9 A;  3CC2 A;  3A8O B;  2VV5 A;  2PVD B;  5GMK j;  4EMK B;  3V7S A;  2RJF A;  2HQX A;  2JTM A;  3CPW S;  4F7U B;  4HKE A;  3LH0 A;  4OF1 A;  5CIU A;  2VGM A;  4QW2 A;  3T9N A;  4KBM B;  2K4Y A;  1D3B B;  1NPR A;  2XG8 D;  2EWN A;  3CMA A;  1KHC A;  3I55 A;  3BW1 A;  1XTD A;  4BI4 A;  1VQP T;  4LD9 K;  2R5A A;  4XU0 A;  2DXC A;  1VQ6 A;  4BI8 B;  4JS5 A;  2MAM A;  1K8A U;  1NZ9 A;  3JCM h;  3CCE A;  4C8Q B;  3JCM W;  2K5L A;  3QKJ A;  5I2S A;  2AHJ B;  3E1S A;  4M7A E;  3SWN B;  3UPU A;  3M53 A;  4LD6 A;  2E64 A;  2QQA A;  2JZ2 A;  1WJQ A;  4IUT A;  5DLO A;  2CZ7 B;  4M78 F;  1QP2 A;  3V7R A;  1N9S A;  3QXE B;  3VKI A;  4FIB A;  2HQE A;  4M78 C;  4M75 A;  3JRZ A;  2E12 A;  1WGS A;  2ZPE B;  3CBP A;  1G3W A;  4FL6 A;  1O9S A;  2JUF A;  4JRK A;  4L6V 5;  3PMT A;  3GNG A;  5GMK i;  1Q82 U;  2MF2 A;  1XQH A;  5LL6 S;  3CCU T;  3RMS A;  5A0G A;  3SDZ A;  4J8O A;  1YBY A;  3HPW A;  2KQW A;  1WPY A;  1QVG S;  3QSU A;  5GAN f;  2VGN A;  1M90 U;  1YJ9 T;  2K5I A;  1M5Q 1;  4JS4 A;  4JJN K;  4MZT A;  4LDX A;  5GAN 2;  1Y07 A;  3ZFJ A;  4NS5 A;  3JCM V;  3GOX A;  3SD4 A;  1IZ6 A;  2BKD N;  4ZGJ B;  5GMK h;  3NFC A;  4J7I A;  1Q86 U;  2QTX A;  5M9O A;  5GAN d;  2VYT A;  4M7D B;  5D6W A;  5GMK e;  1VQP A;  1LNX A;  1KQ1 A;  3E9F A;  4M77 D;  4QVC A;  3PNW C;  4KUI A;  1NJI U;  2JVV A;  3JCM X;  4L5G A;  2HBP A;  3WXM B;  2PUO B;  4IUR A;  4ZN3 A;  1OZ3 A;  4M7A D;  4XTY A;  4XTV A;  3QO3 A;  3M9Q A;  2EQM A;  4QVD A;  2FYK A;  2RHX A;  1FX7 A;  3MCA B;  3EFR A;  3OYF A;  3DB3 A;  3JB9 G;  2Y90 A;  2OTL A;  4HT9 A;  3G4S A;  3OSV A;  4QQ6 A;  4PL6 A;  4EMG A;  5A0D A;  3NTI A;  5HK3 A;  2Y4X A;  1VQM T;  3HP9 A;  4TVR A;  4DA4 A;  1YHQ T;  2DTH A;  3DB4 A;  4OB0 B;  1BIB A;  1N8R C;  5FU6 C;  3JCM c;  4C92 E;  4P5N A;  5GMK l;  3H6Z A;  5LJ3 j;  3OS5 A;  1UGS B;  2DIG A;  4N0A C;  4GLK A;  1YIT A;  3MP1 A;  3CBM A;  4QQG A;  2RHZ A;  2DXB A;  2DZ9 A;  4HA8 A;  4MML A;  1VQ4 T;  4F7U F;  3S3O A;  3ME9 A;  3OYL A;  3J7A F;  4EMK C;  2KSS A;  4M75 B;  1YJ9 A;  1KQS S;  3GF5 A;  4XTU A;  1MGQ A;  2PVG B;  2WSE E;  3L1A A;  4J83 A;  3A8G B;  5GAO n;  2MMP A;  1JRI A;  5FRN A;  2NLU A;  2R58 A;  4IUP A;  2CKK A;  2DXT A;  2MI6 A;  3G7Z A;  2ZCF B;  3OMG A;  3RUX A;  5C6S A;  2V8J A;  3OS1 A;  3MEA A;  1I5L A;  3CC4 A;  2DD5 A;  4PJO F;  3BY7 A;  4KT0 E;  4C8Q F;  5LJ3 g;  1RI0 A;  2X4J A;  3MEV A;  3CC2 T;  3JB9 H;  5HKC A;  4PJO A;  4PJO C;  5CKE A;  3L2Z A;  3TEE A;  3JAM E;  2DXU A;  4JRQ A;  1ZHI A;  2D6F A;  1QP3 A;  5GAM j;  4XTZ A;  1JB0 E;  5GAO l;  1YIJ T;  3QPH A;  2IG0 A;  3OYJ A;  1W4S A;  1U8R A;  2ZPF B;  3RMQ A;  3CMA T;  1UGR B;  3JCM J;  2F5T X;  3TU4 K;  1WQW A;  1UGQ B;  3HFO A;  1W2B A;  3S6W A;  1YHQ A;  3CCE T;  3CCS T;  4C92 D;  4N4I A;  2XI9 A;  3EFS A;  3L2V A;  2QQS A;  3LGL A;  2GFU A;  4OGE A;  2RD1 A;  3PMI A;  5GAM g;  3FC3 A;  4ME7 A;  5I21 A;  4E7J A;  1VQ4 A;  2KAF A;  3SFM A;  1BYM A;  3P8H A;  5LJ3 h;  5GAN 4;  2VXF A;  2E10 A;  1U1S A;  1KC8 C;  4A54 A;  2EQU A;  4CRI A;  1BIA A;  2VUB A;  5LJ3 e;  3FLG A;  3JCM g;  3CCM T;  2L5Q A;  2XDP A;  3RIR A;  5FU6 B;  4M7D F;  4IUQ A;  5LJ5 h;  1B34 B;  3VJP A;  1TH7 A;  5L8R E;  1BI2 A;  3V8J A;  4YTL A;  3V8K A;  2EJ9 A;  3WVE B;  3CC7 T;  4Q5W A;  4M77 G;  2L89 A;  2LCL A;  3QJY A;  4FU6 A;  4RG8 A;  4A4F A;  5KH6 A;  2DO3 A;  5CR2 A;  2JN0 A;  1LOJ A;  3MP6 A;  2PU9 B;  4BDZ A;  5KCO A;  3OYH A;  1YIJ A;  2EJF A;  4M7A G;  3VYG A;  2LC4 A;  5GAM h;  2ZPH B;  3V8L A;  1BI0 A;  2WSC E;  4M77 E;  2DVE A;  5GAM e;  5GAN 5;  3ER0 A;  3RKX A;  3QZ9 B;  4MDX A;  2EJG A;  4PJO B;  4BAC A;  2RM4 A;  1AHJ B;  1VIF A;  1WJS A;  1XOV A;  4V2S A;  3GIB A;  4Z02 A;  2QA4 T;  4DOV A;  4J5Y A;  3HKS A;  3JCM e;  3J80 E;  1N9R A;  5GAN 8;  3ZBD A;  5I2M A;  2OTL T;  3G4S T;  4ATO A;  4M75 F;  3QG1 A;  3RER A;  3M56 A;  1FXX A;  2K2V A;  3LLR A;  4M75 C;  3CME A;  4M7A A;  5CKD A;  4J7F A;  3JCM b;  2X4Y A;  2X4W A;  3CCM A;  2VC8 A;  2OTJ T;  2RHU A;  4XU3 A;  2QXF A;  3ASK A;  4OMF B;  3OYK A;  4LDY A;  3GP8 A;  4VUB A;  1YIT T;  4M78 E;  3JCM d;  3P8B B;  1M1K C;  5DY9 A;  1JJ2 A;  3LYI A;  3CC7 A;  2BUD A;  3I56 A;  3S3M A;  1NPP A;  2A7Y A;  2L3R A;  3MHX A;  2RH2 A;  4BE2 A;  2L8D A;  3GPL A;  5FLX E;  1UEB A;  5GAN 7;  4HCC A;  4QVZ A;  2CS7 A;  4O6J A;  2E41 A;  5AYF A;  3PTA A;  3CXC A;  4N4H A;  4A4E A;  1N27 A;  3L2R A;  2RJD A;  4J6W A;  1KD1 U;  4B9W A;  4EMH A;  1OI1 A;  2RHY A;  5GAO q;  3CC4 T;  1I8F A;  3BDU A;  3PIO A;  3HL8 A;  4XAX B;  2LT1 A;  2PVO B;  1K9M U;  3RES A;  3CD6 T;  2LDM A;  4C5I A;  3LGF A;  4FT4 A;  1Q7Y C;  1QVF A;  1XNI A;  2QA4 A;  4RG2 A;  4IUV A;  5CKF A;  4MZM A;  3PT9 A;  4J6X A;  3M4G A;  2P0Q A;  5A2Q E;  3SB2 A;  2DKG A;  4C92 G;  3CPW A;  4C5G A;  1G3T A;  3PIP A;  4X9C A;  5CO7 A;  3OBY A;  2KDS A;  3FEO A;  2WAC A;  3M55 A;  2DD4 A;  3OYY A;  1OZ2 A;  2LQ8 A;  4BD3 A;  3R6O A;  1KC8 U;  3OW2 S;  1M4Z A;  4R56 A;  1VQN T;  3HFN A;  3HSB A;  2OTJ A;  5CQY A;  4BI3 A;  4ZTJ A;  4NOY A;  1PSF A;  2QDY B;  2G3R A;  3C95 A;  4FSX A;  1Y71 A;  4JRI A;  5HK0 A;  3WVD B;  3OBW A;  4A4H A;  3C94 A;  1R8O B;  4M78 D;  2GQV A;  2KMT A;  4MDW A;  4C0D B;  4JLI A;  3CCJ T;  2PQW A;  1WJR A;  1VQ9 A;  1S72 T;  4UC4 A;  4Y28 E;  5DM7 R;  1YJW T;  3X24 B;  4C92 A;  1HK9 A;  3OYA A;  1YI2 T;  5LJ5 j;  4O5V A;  5IT9 E;  2DTI A;  4ELZ C;  2M0O A;  2FB7 A;  3M54 A;  4X9D A;  4BB7 A;  4FM4 B;  4XQ3 A;  2LVM A;  4C0Z A;  4XU2 A;  4F7U E;  3CD6 A;  3QBY A;  4CI0 C;  3X26 B;  3UDC A;  1G3S A;  3L2W A;  1K73 C;  3MEU A;  4C8Q G;  3A8M B;  2E70 A;  5IN1 A;  1Q81 C;  4E47 A;  4JLG A;  3OYM A;  3DKM A;  2E1H A;  2M16 A;  2RI5 A;  5LJ5 g;  3J81 E;  1VQ7 T;  4XK8 E;  4OP0 A;  3LX7 A;  1U1T A;  2M9U A;  2K3X A;  3URG A;  2EIF A;  4C8Q E;  2DAQ A;  3X25 B;  2X4X A;  4BUG A;  5CAI A;  3HRT A;  1VQN A;  2ZPI B;  1VQK A;  4C5H A;  2K57 A;  4BDY A;  1I4K 1;  1V29 B;  4PLL A;  3QHS A;  1WNL A;  3L42 A;  3JSC A;  3JCM Q;  3KXT A;  3VV0 A;  2F69 A;  4WF2 A;  3VUZ A;  2K3Y A;  3CCJ A;  1M1G A;  5C0M A;  2XKO C;  1S72 A;  1YCY A;  2MWO A;  3F70 A;  2EQK A;  3EAE A;  3CME T;  1YJW A;  1VQL T;  1NE8 A;  2RK2 A;  3OYI A;  2HD0 A;  1YI2 A;  2EQJ A;  3C4S A;  3M59 A;  3OYC A;  2KVQ G;  2P0P A;  1BI1 A;  4X34 A;  2E6N A;  3OS0 A;  2K5F A;  2JTF A;  4KUD K;  3HRU A;  4M7D G;  1PSE A;  5CKB A;  4E7H A;  4GY5 A;  1N6A A;  3A5Z B;  4IUU A;  3CBO A;  2LCC A;  3NTK A;  5LJ3 f;  5LJ5 e;  3OYE A;  5GAO p;  3CCQ T;  3FDR A;  5J39 A;  1BI3 A;  2BIV A;  3I56 T;  3M58 A;  2CZ6 B;  4C92 B;  2RA2 A;  2DEQ A;  1X6O A;  5GAN j;  4Y91 A;  1VUB A;  4LDU A;  3OYN A;  2V8K A;  4M7D E;  2CZ0 B;  2C06 A;  3CPF A;  5LJ3 d;  1KQS A;  3V7C A;  5FRM A;  1VQ7 A;  1H3Z A;  3CCR T;  2HNI A;  3MP8 A;  1G5V A;  2FL7 A;  2LTO A;  5FRO A;  4R55 A;  5KE2 A;  3M4Y A;  3CCV A;  3A8L B;  4PJO D;  4HT8 A;  2RI3 A;  4C8Q D;  2RO0 A;  1IRE B;  4XU1 A;  3LWH A;  4IKF A;  1Q7Y U;  3AHU A;  4LDW A;  3QYG B;  2ZPB B;  5LJ5 d;  4M77 F;  3TCJ A;  2E65 A;  4M77 A;  3FJP A;  4N4G A;  2IVW A;  4M77 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...