3JSCA

Ccdbvfi-formi-ph7.0
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
96
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CcdB
publication title Structural and thermodynamic characterization of vibrio fischeri CCDB
pubmed doi rcsb
source organism Vibrio fischeri
total genus 26
structure length 96
sequence length 104
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jscA00
1VUBA 2KMTA 3JRZA 3VUBA 1M1FA 3NFCA 4MZMA 5CCAA 4VUBA 5CK9A 5DLOA 5CKHA 2C06A 5CKDA 1UB4A 2MF2A 3G7ZA 5CKBA 4ELYC 1X75C 3JSCA 4ME7A 5CKEA 5CO7A 5CR2A 4ELZC 5HKCA 2VUBA 1NE8A 5HK3A 4OF1A 5CKFA 3HPWA 5CQYA 5CQXA 5HK0A 4MDXA 4MZTA 4MZPA 4HKEA 3TCJA
chains in the Genus database with same CATH superfamily
4M78F 1SHGA 3VS1A 2M51A 2RPNA 1B34B 1V1CA 4JUVA 3WVDB 1QP2A 3CC7A 1F1BB 3CMEQ 4E7IA 1WDXA 4OMFB 5HY6A 3ZEHA 4DOVA 4BDZA 4OMPA 1NE8A 1X01A 1EIFA 4C5IA 1VQLQ 2E4HA 2ZPGB 2ABLA 1JO8A 3OYDA 3FB9A 2WSEE 2DVEA 1FMWA 5LJ3e 2EGAA 4BDYA 1Q7YC 4RTYA 2LCCA 2V26A 1VQKQ 2VYTA 4JJDA 1Y96B 4C92D 5L23A 3GIBA 1H8KA 5GAOr 4X9CA 4Z02A 4DBQA 2NYSA 4M7DD 4XTZA 2MOXA 3D7SB 4ZN3A 2QEXT 4E7LA 1RAHB 1FX7A 3RBBB 3A1PA 2K3BA 1M27C 2RD1A 3EFOA 4A63B 3JCMh 3P8DA 2DETA 5IHIA 1VQ6T 1IGUA 4XTYA 2X3XD 2RQVA 3NGPA 1S72Q 3GNFB 1IO6A 4D6WA 5I2SA 1K9MU 5IXFA 4JLIA 3OYMA 3VYHB 5FLXE 2E6ZA 4PJOG 2JM8A 4O6JA 2FZCB 4FW2A 4M77B 4ZGDB 4LDXA 1UGRB 3M0RA 5J39A 5GANf 1R0BG 3CCVQ 2MAMA 4CC2A 1SSFA 2MK5A 5FW9A 1VQ5Q 2P4TA 3V8LA 1M30A 2XMFA 5CQYA 1IRXA 1OEBA 2VC8A 2OTJT 2EYQA 1ACMB 5IAYA 4N4GA 2RI3A 1D1CA 1X6GA 2XIDA 1UJ0A 5FU7B 3TEEA 2KT1A 2MIOA 3FIFA 2MI6A 3RDVA 3SDZA 3G6ET 2J6OA 3E1SA 4FT2A 4BB7A 1NEGA 4XTUA 3UA7A 1Q95G 4J6YA 2G6FX 1VQ8T 1AHJB 3X26B 1ZQ1A 2DZ9A 1I1JA 4LDUA 4LD6A 2J05A 3C0CA 1FWZA 2NWMA 1SRLA 3JV3A 1IGQA 2EYZA 2M1HA 3OMGA 4IURA 4IKFA 1TS9A 5HK0A 2CUBA 1PWTA 2FRYA 3HRSA 4BI4A 2EAYA 1ZUYA 1GFCA 1YFNA 2HDAA 3L2WA 2OX7A 2HEQA 3OYYA 1UUEA 1RL2A 2OTLQ 1ZSZA 3OYIA 4DEXA 3VRZA 2DF6A 5GANh 3JCMJ 2QGFB 2CP5A 4M77D 4RTXA 2QTXA 2ATCB 1VQ6A 3H0HA 1YJNT 3MP1A 3QJ6A 3A8HB 2YUPA 1PHTA 2AKLA 4C0ZA 4JS4A 1OU9A 4OP0A 5LJ3f 3A8MB 3AT1B 5LJ3d 2DILA 4CI0C 1MMNA 3ZFJA 5GAN3 2NUTB 1KC8R 5LJ3j 4LUDA 2RI2A 5AT1B 3OW2P 2AZSA 3CQTA 1MGQA 2H3EB 5D6YA 1VQPQ 4J9CA 2ZZDA 2L3RA 3R6OA 3JCMb 1KQSA 3LGLA 2AKKA 2RJFA 3M0SA 4YTLA 1NZ9A 2A36A 4M75A 4GLKA 4KUIA 1UHFA 2PQWA 4QVDA 1VQMQ 2L8DA 4BE0A 1G3TA 4E7JA 2OTJA 3KXTA 3V8KA 4M75G 1OOTA 3VV0A 2EJFA 1BCMA 2D9TA 4KT0E 2L3SA 2FPEA 4ANJA 1Z9QA 4FYVB 1YJWA 2DXUA 3ME9A 4XTVA 2YUQA 2IIMA 1UEBA 2NUPB 4X9DA 3OY9A 3NPFA 4ME7A 2CP3A 2RI5A 2JN0A 3U23A 4NOYA 1G3YA 4E47A 1VQ8A 3S3NA 3I55Q 3RKWA 4CC3A 4JRPA 3H6ZA 3I5SA 3N5BB 9ATCB 1RABB 5IT9E 4JRKA 5KCOA 1M1KC 1HJDA 1ABQA 1XQHA 1M90R 1WHGA 1JXOA 2P0KA 2DBKA 3M57A 1VQ7Q 4HCZA 1WQ7A 1AWJA 4XQ3A 2EGEA 7AT1B 1YNZA 5GAOn 2GQIA 3JCMX 4HCKA 1NJIC 2EQJA 2ZPIB 5LL6S 1OI1A 3BDLA 5AYFA 1G2BA 1X27A 4MZMA 2O4XB 2X4XA 4B9XA 4BY6B 1OV3A 1WPYA 2E64A 3QHSA 2VKNA 3H0FA 2MYSA 4J83A 1NEBA 2A0FB 2FPFA 4LUEA 4KULA 3CMAQ 1Y07A 3I56T 3GPLA 1JU5C 2EYYA 1YJNA 4JPBW 1VQNT 2QQ9A 5CQXA 1ZA1B 3SD4A 3CBOA 4HCBA 1TG0A 1M1FA 2CZ0B 3CD6Q 2DYIA 1YITT 3L2ZA 1QCNA 4Y91A 4K11A 1M8VA 4ZN1A 1AZEA 4OB1B 3CMET 4MDWA 1AEYA 3O5ZA 1Y7XA 2E12A 3OYAA 4C8QB 3GBQA 3E9FA 2LTOA 1VQ9T 4LN2A 2LNVA 2E1HA 2RO0A 3MEVA 2I2LA 4DQ2A 2E70A 4C0FA 3UF4A 2WSFE 1TUDA 1EFNA 3QIIA 2PUKB 2F2WA 1RAIB 3O8VA 1TUCA 1YIJA 3CPWP 2KNBB 4M75F 3CCQQ 1JBMA 1NLOC 2CZ1B 2JTMA 4FYYB 5A0DA 1M3AA 3BFMA 3L42A 2W0ZA 3M56A 4ORZA 3CCUQ 1N8RC 4DA4A 1SPKA 3CC2Q 2G3RA 2EYXA 1JJ2P 4M77C 3VS5A 4C0GA 1WA7A 3CBMA 5D7UA 3HTRA 4QQDA 5I22A 5KYWA 3L2RA 2X9HA 4HA8A 1P92A 4C0DC 1QKWA 3EGDB 2CP2A 2CDTA 2GFAA 2DRMA 1K0SA 4D8KA 2IPOB 1RAEB 1LCKA 4R56A 2ECZA 1VQ5T 2O9SA 2K3YA 2LDMA 1UGPB 3NMZC 2D1XA 1E6GA 1QVGP 3OYCA 1LVKA 1SF9A 4C8QD 2DYBA 2FZGB 1NBEB 3A8OB 3TSWA 5KYYA 4LD9K 2FYKA 1WYXA 1VIFA 3NTIA 2DBMA 1GCPA 2BE9B 3DLLA 2CGHA 5I21A 1OX8A 3EG2A 3JB9J 1YITA 5LJ5e 2KMTA 4M78B 4RCCA 3HFOA 3T9NA 2PTKA 4OGEA 2FEIA 3QYGB 1HYOA 3M4YA 1UG1A 3ASKA 2Y90A 2MCNA 3CMEA 2KAFA 2QQAA 4XU2A 3LWHA 4BUGA 2VUBA 1WI7A 1QVFA 3E2UA 1OZ3A 1VQ9A 1K9MC 1ZLMA 4FT4A 2PVGB 1IZ6A 1LJOA 2JJ9A 2YDLA 3JCMg 4FL6A 1N5ZA 1KQ1A 2LCLA 5CK9A 4FU6A 1VQOT 3PIOA 2QASA 3NTKA 3H8ZA 2XDBA 2CKKA 2HQEA 5KYXA 2DJQA 5GAMh 3UA6A 4IIOA 5GAN2 1KJWA 3HL8A 2FB7A 2HBWA 3VYGA 3QZ5B 1KC8U 4EDUA 1SHFA 2LQWA 2LJ0A 1RADB 1WJSA 1Y57A 1EZZB 2KSSA 3X20B 1Q81R 2K5FA 2L3QA 2QG9B 4Z89A 3JCMc 1BB9A 1ABOA 3R6NA 2DE0X 1W2BP 1BBZA 3G71T 3OW2A 2KY9A 1AVZC 2HMAA 4IUPA 2DRKA 4AG2C 1M3BA 3SB2A 1ZX6A 2JS2A 2D0NA 5J26A 2CSIA 1QVPA 1YJ9A 2FL7A 1AWOA 2C06A 3H9NA 1VQPT 1RI9A 2KRMA 2XDPA 4E7HA 2M0OA 3DB4A 1XTDA 4M78D 1WJRA 2C0OA 1K1ZA 2F1LA 4F7UB 1VQ5A 4J9HA 3LLRA 3FEOA 1VQMT 1D1BA 2DX1A 2JUFA 4ELYC 1M1GA 1D1AA 3M59A 1PC0A 2RJEA 2XU8A 3CCMQ 1JQQA 2LVMA 2K4YA 5GMKh 2RQUA 2KR3A 5M9OA 4BE2A 1Y96A 1WIEA 1QKXA 5CKEA 3PNWC 4JJNK 3GP8A 4PL6A 3VS7A 1WGSA 3VS2A 3EG3A 2OAUA 5CVIA 1M90U 4O5VA 4PLIA 3QPHA 5CIUA 1BIAA 4DBRA 4PNOA 4TVRA 1WHHA 3VS6A 4E2FB 4C5EA 3RERA 4JZ3A 4GBQA 4J6WA 5EG2A 1IHVA 2CT3A 1PKSA 3C95A 5GANg 1VIEA 2O9VA 3EFRA 1MV3A 1X43A 3CCLT 2QDYB 1VQOA 2FZKB 2RNAA 1QVFS 2M16A 5LJ5f 1KIKA 3URGA 3CCRQ 3L2QA 5LJ5d 5D6WA 5FU6C 3CCJT 5IH2A 3HHTB 4M77A 4KGXB 1NYGA 2X35A 4R55A 5GMKm 5LJ5j 3G4ST 5GAOl 3I9QA 4VUBA 1I8FA 4A4HA 2XI9A 3JCMQ 5CKHA 2LJ3A 4XU0A 2O2OA 1YWPA 3OYHA 3UATA 2D8HA 4FCYA 3J81E 5KE3A 3OS1A 3G71A 2CP6A 4B9WA 1K73R 2SRCA 1FMKA 4OMQA 1BU1A 1TTHB 3EGXB 1GRIA 3PGGA 3MEUA 1QW1A 4AFQC 4PJOB 1PSEA 1VQPA 2HNIA 3EG0A 4Y92A 2DTOA 2JTFA 2KBTA 3OW2S 4J6XA 1V76A 3FJPA 1O9SA 2BKDN 5GAN5 4DBHA 2K57A 4OF1A 2AT1B 2XG8D 5IHKA 2YRCA 3IQLA 3TSZA 5GAN6 2ESWA 2VASA 4F16A 3CCSQ 4QVCA 1UE9A 4FYWB 3AHUA 3CC7Q 2EJGA 1U5SA 2KI7A 3BW1A 4E7KA 3OYKA 2IG0A 1BI0A 1JRIA 1TOVA 2HAXA 2DM1A 1Z9ZA 3GLXA 4N4HA 2R5MA 1K8AU 3ZL7C 2BUDA 2DD4A 2YUNA 3EH1A 3OYGA 2VXEA 1D0XA 1BI1A 2DEQA 3HPWA 3OYJA 2ZAEA 3CCUT 2EGCA 3CC2T 1U3OA 1R0CB 1NJIR 1YN8A 1RAGB 3V7CA 2MWOA 2R5AA 4ZGJB 3M9QA 5CAIA 1TH7A 3E9GA 2RH2A 3ULRB 4JZ4A 2AIRB 2K5IA 3M0PA 2QEXA 3NHNA 1JB0E 5FROA 3NTHA 4JJCA 3J7AF 5GMKi 3OSVA 3CCLA 2HL3A 4E7ZA 4KRTA 3OS5A 1D0ZA 2LRQA 4QW2A 2DO3A 2QA4Q 2FG0A 3CC4T 4FYXB 2YXYA 5DM7R 1Q86C 3CCJA 1OPLA 5GAOm 1Q82R 1QVGA 1VYUA 1PM3A 2RHXA 1YP5A 1EX4A 1M9SA 1UJYA 2JXBA 2DL3A 2V8JA 5HKCA 4PJOD 3G4SA 2HKNA 2E10A 1AOJA 3H41A 4FW1A 5FRMA 4LDVA 3JRZA 3MPUB 1ZSZB 1W1FA 2PVOB 2FHDA 2FO0A 1ZBXA 2A37A 4L5GA 2RJDA 2PZ1A 3LW5E 3JCMP 4C92E 2ZPHB 4C5HA 1UECA 2RJCA 4M7DE 2NUPA 4KGVB 2HZYA 4RTZA 1SKUB 2DLPA 5CCAA 4C92C 2F69A 2V8KA 3I35A 3THKA 1YI2Q 4E7SA 1U8RA 4M7DC 2F5KA 3G6EA 1UFFA 1MUZA 5C0MA 1MMAA 3VU3C 1LOJA 5KYUA 1N8RR 1W4SA 3PVLA 1R77A 2LT4A 4AMCA 4EMKB 1Q81U 4J9EA 2X3WD 3PMIA 3A8LB 1WXUA 1UTIA 1MMDA 3DB3A 5LJ3h 1X75C 2O4XA 1ZA2B 3OMCA 4F7UE 4KUDK 2P4RA 1W2BA 5I2MA 2DVJA 6AT1B 4ZTJA 1KG1A 3MKDA 4WCIA 2DL5A 1ZUUA 1M3CA 3PTAA 1G5VA 2KYBA 1JJ2S 2QQSA 3KUFA 3REAB 2A08A 3OYNA 1D0YA 1OQKA 3RIRA 4PJJA 3DLMA 2L2PA 3C12A 4C5GA 2H8HA 1D3BB 2K7AA 2QQRA 1T3SA 4KGZB 5ECAA 3EG9A 3CC4A 4LNPA 4AFUC 4J9IA 2P84A 5KYNA 1KK7A 2DIQA 1WLPB 2KVQG 2V1RA 4RTVA 3CCMT 4JRQA 1KD1C 2V8IA 2HSEB 2COZA 1I5LA 3H0IA 2PU9B 2ED1A 3INZA 4Q5WA 2EKOA 1PKTA 1QVGS 1WXTA 2HQXA 2LT1A 3Q1JA 3UPUA 5FWCA 4M7AB 5DLQE 3MEWA 1VQLT 3QUIA 1RLQC 2COYA 2KQWA 1WQWA 1KC8C 1VQKT 2ZGWA 2Y4XA 3E19A 1VQ4Q 5A0GA 2DTIA 5GAMg 3SWNB 4OB3B 4F14A 3JB9D 1YJWQ 2LX7A 4D8DA 4ATOA 3TVTA 2E5QA 4M77E 1QCOA 1G3SA 5L8RE 1KHCA 4RKUE 1UDLA 2K2VA 1X6BA 3BY7A 1H3ZA 3SEMA 1HSQA 1N9RA 2VB6A 1S72T 2DAQA 3L2UA 3CCRT 1PRMC 2JTEA 4LE9A 4PJOE 2RHUA 1RLPC 1K73U 1RAAB 3QG1A 2JNGA 4XTXA 4E6RA 1FMVA 4N0AC 1ZHIA 4PJOC 3QSUA 3EAEA 4UC4A 5CO7A 5GAN7 1WHLA 4HT8A 1K9AA 5FU7C 1K4US 2EQUA 3QWXX 2DK3A 1IXDA 3CCVT 2R57A 2EW3A 4CC4B 3WXMB 1M90C 1XOVA 5FWBA 3PIPA 5GAN8 1I4K1 1W2BS 1PG5B 4DBFA 2MPXC 2DTHA 1SSHA 2M0YA 2B86A 3I56A 1RI0A 2MF2A 4Z88A 1VQNA 4M7AD 4BI3A 4KBMB 2L89A 2X4WA 1PRLC 4KH1B 2RMOA 3OB9A 4LXCA 2LJ1A 4DOWA 2JZ2A 1ZBJA 2PVDB 1M2VA 4EMHA 1KSWA 1Q7YR 3CCST 3CC7T 3MP6A 1RAFB 1WJQA 3CXCP 1C0MA 2X51A 1OULA 3CCEQ 4ELZC 1SG5A 1H92A 2EWNA 4MDXA 1QCFA 1VQLA 4JRIA 2WSCE 4J7IA 4LDWA 4C92A 1ARKA 3FC3A 1KQSP 1VQKA 2RHYA 2K2MA 4FSXA 3JCMW 4EPCA 4OMNA 4M7DA 4OB0B 2SEMA 3V7RA 4C92G 2KK4A 4KH0B 4AT1B 3TREA 2K3XA 1YIJQ 1M4ZA 1Q82U 2OI3A 1WHKA 4M7DG 2OTLT 2YSQA 2RHZA 2VXFA 4X1VA 4A4GA 2DFUA 1BYMA 1S72A 2QA4T 1UB4A 3CCRA 2KEAA 2YUOA 5GMKl 2DZCA 2RN8A 2CH4W 2ROLA 3TU4K 1KFZA 2P0PA 1YWOA 3TCJA 2BZ8A 4OVAA 3NFCA 3BE3A 2GF7A 4F7UA 2M02A 1U1TA 1T0HA 2A7YA 4OMMA 1QWEA 2NLUA 2BE7D 1CKBA 4JJBA 1B34A 1AT1B 4ZTFA 4NL2A 4ZGEB 1OU8A 4AG1C 5I11A 3CCVA 3HRUA 2K5LA 1RACB 3S3OA 3MO8A 1ZSGA 1K8AC 2WACA 2C0TA 2K9GA 3M4GA 2GTOA 2MMPA 4NS5A 3RNJA 1N8RU 4GY5A 2B8AA 4EMKC 2DEUA 2AHJB 2LQ8A 1PCXA 1MV0B 2KDSA 1YI2T 3GF5A 2F5TX 2QK0A 1YITQ 2HL5C 1OPKA 2X4JA 3QWYA 2CH4A 1N27A 4PFPA 2GQVA 3CCSA 4RTUA 1M8MA 3WVEB 5GAOq 2ZPEB 1CKAA 3I55T 1T0JA 2DERA 2F2VA 1VQ9Q 2VVKA 4BY6C 1VQ7T 2KRSA 2VGNA 4MZTA 2MWPA 3HKSA 5J3BA 8AT1B 2XICA 4MMLA 1B7TA 4PFOA 1GBRA 1MHNA 1LNXA 1NPPA 2CZ6B 1Q86R 4CRIA 4OGCA 2KYMA 4FM4B 4C92F 2YLCA 2OTLA 1LPLA 3X28B 4JS5A 4HXJA 3LX7A 4C8QE 2A3LA 2QXFA 4XTWA 4M7AE 4M7DF 4IIMA 3CMAT 3L1AA 3M0UA 4II1A 4M77G 4OMOA 1E7OA 1VYVA 2EPDA 3X25B 2QA4A 3OBWA 3CEYA 3EGXA 1OYXA 2QDLA 4C8QC 2J6KA 3EHQA 4M7AC 4N0AA 3EFOB 3CD6T 3JAME 1QWFA 3QXEB 4PJOA 4XU3A 3JSCA 4BE1A 3OBYA 4FSSA 1YHQQ 4R0KA 4HKEA 2CT4A 2HCKA 1AD5A 1YJ9Q 5DY9A 3SWNC 1OX9A 1Q81C 2EBPA 3L2VA 2GTJA 2LX9A 2DL8A 3VJPA 3REBB 4J5YA 3OYFA 1MMGA 3FRNA 5GANd 2QI2A 1SEMA 3HSBA 5KH6A 4F7UF 1VQMA 4C0DB 1BKBA 3PVQA 3RUXA 3CPWA 5GANj 1VQ4T 1AWWA 4F04B 3J80E 1IHWA 2JS0A 2O01E 4BD3A 2GNCA 1YJWT 2E41A 2HKQB 3EH2A 1X2QA 2E3HA 1YI2A 3CCQT 2E5KA 1GFDA 3M58A 1G3WA 5LJ5h 1M1KR 2O31A 2CSQA 5LJ3g 1JJ2A 2KROA 1G8XA 4PKCC 8ATCB 5CKFA 1BIBA 1NM7A 1PD0A 4FIBA 3F70A 2CREA 1E6HA 2W10A 2QTVA 1VUBA 1H641 2L0AA 1M5Q1 1QQJA 1RUWA 1N9SA 1WNLA 3I55A 4B6MA 2DMOA 5GJVB 3FDRA 3QKJA 1X69A 2DNUA 4RUGA 2NUZA 1VQ7A 4P5NA 1QVFP 2KGTA 2VV5A 2YRDA 1VQOQ 4M78E 4RCBA 4Y28E 2NUTA 2DKGA 1TSFA 2DL7A 2PUOB 2PNIA 4A4EA 4F17A 4DEYA 3OS2A 3V7SA 2FRWA 2H3JA 4QT7A 2YT6A 2E6NA 1R8OB 4M78C 5IHNA 1NPRA 5CR2A 3CMAA 1WXBA 1Q7YU 2EQKA 4J8OA 1KD1R 2RQWA 1XJWB 2J6FA 3LYIA 2XHCA 4RMOA 3OA6A 3VRYA 1TXQA 3M54A 4M77F 4X34A 3KBGA 3CD6A 1HK9A 2RA2A 4BI8B 2RF0A 3CXCA 4XAXB 2RB6A 3RR6A 2EFIA 3G71Q 2ED0A 1WHMA 1VA7A 1KQ2A 2LNHB 3KFVA 2YHTA 3HFNA 2VWFA 3MHXA 3G1JA 3CCET 2J06A 4XU1A 2EVRA 4PJOF 3VUBA 3V8JA 3HP9A 1U06A 1Y0MA 2X4YA 2BIVA 4EMKA 1K76A 3ZBDA 4PJLA 2D0QB 1OZ2A 1K73C 3QDFA 5HCKA 2CYZB 1FXXA 2XK0A 4ZNXA 3QZ9B 2CP0A 3PE0A 2DA9A 4HCCA 3M55A 3S3MA 1UGVA 1VQ4A 4OB2B 3MJXA 1AWXA 1MNDA 3QJYA 1I0CA 2C0IA 3EGUA 2FVUA 3C4SA 3OQ5A 4M75B 1MNEA 2LQKA 1YIJT 3JB9H 5GAMe 4HVUA 3CCQA 3JB9G 2COWA 2GFUA 4WTOB 5DLOA 2O88A 1JEGA 2LQNA 1XNIA 1CSKA 1QP3A 3CPWS 1V29B 4V2SA 2DL4A 5CKBA 2E3IA 1JXMA 5C6SA 3VS0A 4A4KA 4QKUA 3CCUA 3CC2A 3RMSA 1D3BA 1GCQC 4RG2A 1QLYA 1NYFA 3QBYA 2RK2A 4PJMA 4AFSC 2QEXQ 5KYUB 1VOMA 2R58A 1H3HA 1N6AA 3I5RA 1W6XA 2L5QA 2RK1A 2QAZA 5GAN4 3CCLQ 2RHIA 3EFSA 4BACA 2QGGA 4A54A 1UGSB 5A2QE 1VQ6Q 2BZYA 2OJ2A 3VS4A 2JM9A 1AZGB 3JCMV 2D6FA 1I5OB 3QYHB 2EQIA 2XKOC 3CCJQ 4HVWA 1IREB 1X2KA 3RKXA 4MMKA 4Z8AA 4PFZA 2HQHA 3ER0A 4EIKA 4C8QA 3M53A 2LP5A 4M7AA 5GAOp 1DJ7B 3G4SQ 5KCHA 1IB8A 2M9UA 3SFMA 4HVVA 3RESA 1YCYA 3M0QA 4C8QG 5GMKe 4M7AG 5FU6B 1Q82C 3OYBA 2DXCA 1J3TA 1K9MR 2EKHA 3SWNA 4J9DA 2YWWA 2V1QA 1BI3A 2KT8A 3EG9B 5CKDA 2RQRA 2Y4YA 5A0LA 4M75D 1BI2A 2JT4A 3TQ7P 2OTJQ 5EC7A 3CCEA 1BCOA 5IXBA 2XD0A 1SRMA 1Q86U 5FRNA 3CXCS 1PNJA 2BZXA 1W70A 2KXDA 4RTTA 2KRNA 2IVWA 2CUDA 2RM4A 3QDRB 1D09B 1S1NA 3G6EQ 2ZPBB 3MEAA 2XDDA 3JCMe 3A8GB 3P8HA 3M0TA 3HRTA 3PT9A 3EGDA 1KQSS 5GJWB 2A28A 3PFSA 1VQ8Q 1UHCA 3VKIA 4IUUA 1UGQB 1VYTA 2Z0WA 4L6V5 4AFZC 2LCSA 4L59A 3RKYA 3VS3A 3JB9F 1GL5A 1WHJA 2LMJA 2LZ6B 3GOXA 1WX6A 4J9FA 4WF2A 4EMGA 4OMLA 1TUGB 4PLLA 2KE9A 2DXTA 1A0NB 3FJ5A 3PMTA 4RG8A 1K8AR 4PJNA 4LDYA 2VGMA 1YHQT 4M4ZA 1G83A 1WFWA 2DXBA 3GNGA 1PD1A 1C1AA 2GBQA 1O75A 5GAMf 1YJ9T 5GAMd 4M78A 2FPDA 4IUQA 3UT1A 3OYLA 1YJNQ 1NG2A 2RQTA 5KYWB 3CC4Q 1HXDA 3LH5A 4A4FA 4PK4A 2F2XA 5GAMj 1KHIA 4M78G 1M1KU 1T3LA 2GGRA 1M2OA 3M5AA 3A98A 4N4IA 4JDSA 3CCMA 1TWBA 2JMCA 1QMCA 4IUVA 4IUTA 1NJIU 2OAWA 1X6OA 3LGFA 4C8QF 4M7AF 1ZUKA 1I81A 2JVVA 4QQGA 5KYYB 3CBPA 2EJ9A 2EIFA 2L3PA 1U1SA 4JLGA 1FYNA 3LWIA 2K6DA 1TU0B 5IN1A 2CZ7B 2ZCFB 4CC7A 3OSSC 2YLBA 5D6XA 1I07A 3LH0A 1M2VB 2CP7A 2GCXA 4MZPA 3FLGA 2JMAA 2DIGA 3OYEA 2AK5A 1Y71A 2ZPFB 5GANe 1KD1U 2DD5A 3C94A 1WZOA 3SHWA 2HD0A 2LC4A 1PSFA 3G7ZA 2EYWA 1ZSZC 2JOYA 2AZVA 2EQMA 2CS7A 5GMKj 4C92B 1GXIE 3RMQA 4ESRA 1GCQA 2HSPA 4A53A 4M7DB 1B3QA 2P0QA 2JW4A 2I0NA 1GBQA 3MP8A 5KE2A 1B07A 1YBYA 5KYXB 3VUZA 3OS0A 4QVZA 2QQBA 2K79A 3S6WA 3UDCA 3X24B 1NLPC 4J7FA 4XK8E 4F7UG 5HK3A 1YCSB 3JCMf 1K0XA 2ENMA 4GLMA 4J9GA 3JCMd 2KXCA 4HT9A 4M75E 1YHQA 3BDUA 3JB9I 1HD3A 2E65A 3DKMA 4RTWA 1C6VX 2D8JA 3QO3A 2ROTA 3EG1A 3I56Q 2J7IA 4NL3A 2DPPB 3META 3MCAB 1VQNQ 4M75C 3EHRA 3UWNA 3CPFA 5LJ5g 2QYZA 4J9BA 2DJZA 2HBPA 3A5ZB 4QQ6A 2BTTA 1BK2A 2YRVA 3P8BB
chains in the Genus database with same CATH topology
3PTAA 1VUBA 4M78F 1G5VA 1JJ2S 1VQ5T 1H641 2K3YA 1M5Q1 2QQSA 2LDMA 1N9SA 1WNLA 3KUFA 3I55A 1UGPB 1B34B 4JUVA 3WVDB 1QP2A 3OYNA 3CC7A 3RIRA 4E7IA 3DLMA 3C12A 4C5GA 3OYCA 4C8QD 3FDRA 3QKJA 1D3BB 4OMFB 5HY6A 3A8OB 3ZEHA 4DOVA 4BDZA 1VQ7A 4LD9K 2FYKA 1VIFA 2QQRA 3NTIA 1NE8A 1X01A 4P5NA 1EIFA 4C5IA 3DLLA 2CGHA 5I21A 2ZPGB 3OYDA 3FB9A 2VV5A 3CC4A 2WSEE 2DVEA 3JB9J 1YITA 4M78E 4RCBA 5LJ3e 4Y28E 5LJ5e 2KMTA 4BDYA 1Q7YC 2LCCA 4M78B 4RCCA 3HFOA 2DKGA 3T9NA 2VYTA 1Y96B 4C92D 2PUOB 4OGEA 3QYGB 4A4EA 3GIBA 3OS2A 3M4YA 5GAOr 3V7SA 3ASKA 2Y90A 4X9CA 3CMEA 2H3JA 4Z02A 2KAFA 2QQAA 2DIQA 4XU2A 3LWHA 2E6NA 2KVQG 4M7DD 4XTZA 3CCMT 1R8OB 4JRQA 4M78C 1KD1C 1NPRA 2V8IA 4ZN3A 2QEXT 4E7LA 4BUGA 5CR2A 1I5LA 2VUBA 1FX7A 3CMAA 2PU9B 1QVFA 3INZA 4Q5WA 1OZ3A 2EKOA 1Q7YU 2EQKA 4J8OA 1QVGS 1VQ9A 2RD1A 1K9MC 2HQXA 2LT1A 4FT4A 3Q1JA 2PVGB 3LYIA 2XHCA 3P8DA 1IZ6A 3JCMh 4RMOA 3OA6A 3UPUA 1LJOA 3JCMg 4M7AB 4FL6A 1VQ6T 5DLQE 1KQ1A 2LCLA 5CK9A 3MEWA 3M54A 4M77F 1VQLT 3QUIA 4FU6A 3KBGA 4X34A 4XTYA 3CD6A 1HK9A 2RA2A 3GNFB 4BI8B 1VQOT 2KQWA 1WQWA 3PIOA 3NTKA 3H8ZA 1KC8C 3CXCA 2XDBA 4XAXB 2RB6A 2EFIA 1VQKT 2ZGWA 2CKKA 2Y4XA 2HQEA 3E19A 4D6WA 5I2SA 1K9MU 5A0GA 5GAMh 1KQ2A 2DTIA 5GAN2 5GAMg 3HL8A 3SWNB 4JLIA 2YHTA 3HFNA 2FB7A 3MHXA 4OB3B 3OYMA 3JB9D 3VYHB 3CCET 4XU1A 3VYGA 5FLXE 4ATOA 2E6ZA 4PJOG 4PJOF 3VUBA 3V8JA 3HP9A 3QZ5B 2E5QA 4O6JA 4M77E 1KC8U 2X4YA 2BIVA 1G3SA 5L8RE 4M77B 4EMKA 4EDUA 1KHCA 3ZBDA 4ZGDB 4LDXA 2D0QB 4RKUE 1OZ2A 1UGRB 2K2VA 1K73C 5J39A 2CYZB 1FXXA 2XK0A 3BY7A 1WJSA 5GANf 2KSSA 3QZ9B 3X20B 1H3ZA 2K5FA 4HCCA 2MAMA 3JCMc 1N9RA 1SSFA 1S72T 2DAQA 3M55A 3L2UA 3CCRT 3S3MA 1VQ4A 2P4TA 4OB2B 3QJYA 3V8LA 3G71T 3OW2A 2KY9A 5CQYA 4IUPA 2FVUA 2VC8A 2RHUA 4PJOE 2OTJT 3SB2A 2EYQA 3C4SA 3OQ5A 4M75B 2LQKA 5J26A 5IAYA 4N4GA 1YIJT 5GAMe 2RI3A 3JB9H 3CCQA 1K73U 3JB9G 1QVPA 2XIDA 2GFUA 5DLOA 3QG1A 1XNIA 2JNGA 1YJ9A 2FL7A 1QP3A 5FU7B 4XTXA 3TEEA 1V29B 3CPWS 2C06A 1VQPT 4V2SA 5CKBA 4N0AC 2XDPA 3FIFA 1ZHIA 2MI6A 5C6SA 4E7HA 2M0OA 3DB4A 3QSUA 1XTDA 3EAEA 4UC4A 5CO7A 3SDZA 4PJOC 4M78D 4A4KA 1WJRA 3G6ET 5GAN7 3E1SA 3CCUA 4HT8A 4FT2A 3CC2A 3RMSA 5FU7C 4F7UB 1VQ5A 1D3BA 2EQUA 2DK3A 4BB7A 3LLRA 3FEOA 3CCVT 1VQMT 4RG2A 4XTUA 2JUFA 2R57A 4ELYC 3WXMB 1M1GA 3QBYA 1M90C 1XOVA 2RK2A 3M59A 4J6YA 3PIPA 2RJEA 2XU8A 1VQ8T 1AHJB 3X26B 1I4K1 5GAN8 1ZQ1A 1W2BS 2LVMA 2R58A 2DTHA 2DZ9A 4LDUA 2K4YA 4LD6A 5GMKh 1N6AA 3I56A 1FWZA 1RI0A 2L5QA 2MF2A 5M9OA 2RK1A 5GAN4 1VQNA 2RHIA 1Y96A 3EFSA 4BACA 4BE2A 5CKEA 4M7AD 3PNWC 4JJNK 3GP8A 4PL6A 4A54A 1UGSB 4BI3A 4KBMB 1WGSA 5A2QE 2L89A 2X4WA 2OAUA 5CVIA 1M90U 3OB9A 4O5VA 4PLIA 2M1HA 3OMGA 4IURA 3QPHA 3JCMV 4IKFA 5HK0A 5CIUA 3QYHB 2D6FA 2XKOC 1BIAA 4PNOA 3HRSA 1IREB 4TVRA 2EAYA 2JZ2A 4BI4A 2PVDB 3RKXA 4DOWA 3L2WA 4MMKA 4EMHA 4C5EA 3ER0A 3OYYA 3RERA 4C8QA 3CCST 3M53A 4J6WA 4M7AA 3CC7T 5GAOp 5EG2A 1RL2A 3MP6A 1DJ7B 1WJQA 3OYIA 3C95A 5KCHA 2M9UA 5GANh 3SFMA 4ELZC 3RESA 3JCMJ 1YCYA 5GANg 4C8QG 1VIEA 4M77D 2EWNA 2QTXA 5GMKe 1VQ6A 3EFRA 4M7AG 4MDXA 1YJNT 3CCLT 3MP1A 3QJ6A 3A8HB 1VQLA 4JRIA 2WSCE 4J7IA 5FU6B 1Q82C 3OYBA 2QDYB 1VQOA 2DXCA 4LDWA 4C92A 4C0ZA 4JS4A 3SWNA 4OP0A 1QVFS 3FC3A 5LJ3f 2M16A 3A8MB 1VQKA 5LJ5f 1BI3A 2RHYA 3URGA 4FSXA 5LJ3d 3JCMW 4EPCA 4CI0C 5LJ5d 3L2QA 4M7DA 5D6WA 5CKDA 5FU6C 3CCJT 2Y4YA 3ZFJA 4OB0B 5GAN3 5A0LA 3V7RA 4C92G 2KK4A 3HHTB 4M75D 4M77A 1BI2A 3TREA 2K3XA 3CCEA 2X35A 1M4ZA 1Q82U 4R55A 5LJ3j 5GMKm 5LJ5j 2XD0A 4M7DG 2OTLT 2RI2A 1Q86U 5FRNA 3CXCS 3G4ST 2RHZA 5GAOl 2VXFA 1MGQA 5D6YA 2ZZDA 2IVWA 2L3RA 3R6OA 4VUBA 4A4GA 3JCMb 2RM4A 3QDRB 1I8FA 1KQSA 4A4HA 3LGLA 2XI9A 3JCMQ 2RJFA 1BYMA 2ZPBB 3MEAA 5CKHA 4YTLA 1NZ9A 1S72A 2XDDA 4M75A 1UB4A 4XU0A 4GLKA 4KUIA 3JCMe 3OYHA 3CCRA 2QA4T 3A8GB 3P8HA 4QVDA 2PQWA 3HRTA 5GMKl 3J81E 2L8DA 4BE0A 5KE3A 3OS1A 3PT9A 3G71A 1G3TA 1KQSS 4B9WA 2DZCA 4E7JA 3PFSA 2OTJA 3KXTA 3TU4K 3V8KA 3VKIA 4M75G 3VV0A 2EJFA 4IUUA 2P0PA 1UGQB 3PGGA 2D9TA 4KT0E 3TCJA 4L6V5 3MEUA 4OVAA 3NFCA 1QW1A 4L59A 1YJWA 2GF7A 2DXUA 3ME9A 1PSEA 3RKYA 4PJOB 4F7UA 1VQPA 4XTVA 3JB9F 2HNIA 1U1TA 2DTOA 2JTFA 2A7YA 3GOXA 3OW2S 4J6XA 2NLUA 1UEBA 4WF2A 4X9DA 3FJPA 1O9SA 3OY9A 2BKDN 4EMGA 5GAN5 4ME7A 1B34A 4ZTFA 4NL2A 4ZGEB 2RI5A 4PLLA 2JN0A 3CCVA 2K57A 3HRUA 2K5LA 4OF1A 2DXTA 2XG8D 3S3OA 3MO8A 4NOYA 1K8AC 1G3YA 5GAN6 2WACA 4E47A 1VQ8A 3S3NA 3PMTA 3RKWA 4RG8A 4JRPA 4QVCA 3AHUA 3H6ZA 2EJGA 3N5BB 4LDYA 2VGMA 3M4GA 1YHQT 5IT9E 2MMPA 4JRKA 4NS5A 5KCOA 2DXBA 3BW1A 3GNGA 2B8AA 4GY5A 4E7KA 1N8RU 1XQHA 1M1KC 4EMKC 2P0KA 2IG0A 3M57A 2AHJB 3OYKA 1O75A 1BI0A 5GAMf 1JRIA 4HCZA 1YJ9T 2LQ8A 2HAXA 5GAMd 1WQ7A 4M78A 2KDSA 3GLXA 4IUQA 4N4HA 4XQ3A 3UT1A 2R5MA 3OYLA 1YI2T 1K8AU 3GF5A 2F5TX 2BUDA 5GAOn 2DD4A 3JCMX 3OYGA 1HXDA 2VXEA 1NJIC 2EQJA 1BI1A 2DEQA 2X4JA 2ZPIB 3HPWA 5LL6S 4A4FA 1OI1A 3BDLA 3OYJA 3CCUT 5AYFA 3CC2T 1N27A 5GAMj 1KHIA 4M78G 1M1KU 3V7CA 2MWOA 3M5AA 2GQVA 2R5AA 4MZMA 3CCSA 3WVEB 5GAOq 2O4XB 2ZPEB 4ZGJB 2X4XA 4N4IA 4B9XA 4BY6B 3M9QA 5CAIA 1WPYA 2E64A 3QHSA 1TH7A 3E9GA 4JDSA 4J83A 2RH2A 3CCMA 3I55T 2K5IA 2QEXA 4KULA 4IUVA 4IUTA 1NJIU 1JB0E 1Y07A 3I56T 5FROA 3NTHA 3GPLA 3J7AF 5GMKi 1YJNA 3OSVA 4BY6C 3CCLA 1X6OA 1VQNT 3LGFA 1VQ7T 3OS5A 2QQ9A 4C8QF 5CQXA 3SD4A 2VGNA 4M7AF 4MZTA 2LRQA 3CBOA 2MWPA 4HCBA 4QW2A 2DO3A 1I81A 1M1FA 2JVVA 2CZ0B 3HKSA 3CC4T 4QQGA 5J3BA 1YITT 5DM7R 1Q86C 3CBPA 2XICA 4MMLA 3CCJA 2EJ9A 5GAOm 3L2ZA 1MHNA 1LNXA 1U1SA 1NPPA 2EIFA 4JLGA 4Y91A 2CZ6B 1QVGA 1M8VA 2RHXA 4ZN1A 3LWIA 4CRIA 1M9SA 4OB1B 5IN1A 4OGCA 4FM4B 3CMET 2CZ7B 4C92F 2V8JA 2YLCA 2ZCFB 4MDWA 5HKCA 2OTLA 4PJOD 3OSSC 3X28B 3G4SA 4JS5A 2YLBA 1Y7XA 3LX7A 2A3LA 2QXFA 5D6XA 2E10A 3LH0A 4XTWA 2E12A 4C8QE 4M7AE 3OYAA 5FRMA 4M7DF 2GCXA 3CMAT 4C8QB 4MZPA 3E9FA 2LTOA 3L1AA 3FLGA 2DIGA 3JRZA 4LDVA 3OYEA 1VQ9T 1Y71A 2LNVA 4II1A 4M77G 2E1HA 2RO0A 3MEVA 2I2LA 2PVOB 2FHDA 2ZPFB 3X25B 4DQ2A 5GANe 2QA4A 3OBWA 3CEYA 1KD1U 1ZBXA 2DD5A 3C94A 2E70A 1OYXA 4L5GA 4C0FA 2WSFE 2RJDA 4C8QC 2HD0A 4M7AC 2LC4A 4N0AA 1PSFA 3G7ZA 3CD6T 3LW5E 3QXEB 3JAME 4PJOA 3QIIA 4XU3A 4C92E 3JCMP 3JSCA 2ZPHB 4C5HA 2JOYA 4BE1A 2PUKB 3OBYA 5GMKj 2EQMA 2CS7A 1GXIE 4C92B 3RMQA 2RJCA 3O8VA 4M7DE 4A53A 1YIJA 4M75F 4HKEA 4M7DB 1JBMA 2P0QA 2CZ1B 5CCAA 4C92C 5DY9A 2F69A 2V8KA 3MP8A 5KE2A 3SWNC 1YBYA 1Q81C 3VUZA 3OS0A 3L2VA 4QVZA 2JTMA 5A0DA 1U8RA 3BFMA 2LX9A 3L42A 3OYFA 3VJPA 2QQBA 2F5KA 4J5YA 4M7DC 3M56A 3G6EA 3FRNA 5GANd 2QI2A 3S6WA 5C0MA 1N8RC 3UDCA 3HSBA 5KH6A 3X24B 4DA4A 3VU3C 2G3RA 4M77C 4J7FA 4XK8E 1LOJA 4F7UF 4F7UG 5HK3A 1VQMA 4C0GA 3JCMf 4C0DB 1W4SA 1BKBA 3RUXA 3JCMd 2LT4A 3CBMA 4HT9A 4M75E 3CPWA 3BDUA 4EMKB 3JB9I 1YHQA 5GANj 1VQ4T 1Q81U 4QQDA 2E65A 3DKMA 3PMIA 3L2RA 3J80E 3QO3A 3A8LB 2O01E 4HA8A 4BD3A 1P92A 4C0DC 4NL3A 2DPPB 3META 1YJWT 3MCAB 2E41A 1YI2A 3CCQT 3DB3A 4M75C 3M58A 5LJ3h 1G3WA 1X75C 2GFAA 2O4XA 5LJ5h 3UWNA 5LJ3g 3CPFA 3OMCA 5LJ5g 4F7UE 1JJ2A 2DJZA 4PKCC 4KUDK 5CKFA 1W2BA 1BIBA 2HBPA 3A5ZB 4QQ6A 4R56A 5I2MA 4FIBA 4ZTJA 3F70A 2YRVA 1KG1A 3P8BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VUB A;  2KMT A;  3JRZ A;  3VUB A;  1M1F A;  3NFC A;  4MZM A;  5CCA A;  4VUB A;  5CK9 A;  5DLO A;  5CKH A;  2C06 A;  5CKD A;  1UB4 A;  2MF2 A;  3G7Z A;  5CKB A;  4ELY C;  1X75 C;  3JSC A;  4ME7 A;  5CKE A;  5CO7 A;  5CR2 A;  4ELZ C;  5HKC A;  2VUB A;  1NE8 A;  5HK3 A;  4OF1 A;  5CKF A;  3HPW A;  5CQY A;  5CQX A;  5HK0 A;  4MDX A;  4MZT A;  4MZP A;  4HKE A;  3TCJ A; 
#chains in the Genus database with same CATH topology
 4M78 F;  1SHG A;  3VS1 A;  2M51 A;  2RPN A;  1B34 B;  1V1C A;  4JUV A;  3WVD B;  1QP2 A;  3CC7 A;  1F1B B;  3CME Q;  4E7I A;  1WDX A;  4OMF B;  5HY6 A;  3ZEH A;  4DOV A;  4BDZ A;  4OMP A;  1NE8 A;  1X01 A;  1EIF A;  4C5I A;  1VQL Q;  2E4H A;  2ZPG B;  2ABL A;  1JO8 A;  3OYD A;  3FB9 A;  2WSE E;  2DVE A;  1FMW A;  5LJ3 e;  2EGA A;  4BDY A;  1Q7Y C;  4RTY A;  2LCC A;  2V26 A;  1VQK Q;  2VYT A;  4JJD A;  1Y96 B;  4C92 D;  5L23 A;  3GIB A;  1H8K A;  5GAO r;  4X9C A;  4Z02 A;  4DBQ A;  2NYS A;  4M7D D;  4XTZ A;  2MOX A;  3D7S B;  4ZN3 A;  2QEX T;  4E7L A;  1RAH B;  1FX7 A;  3RBB B;  3A1P A;  2K3B A;  1M27 C;  2RD1 A;  3EFO A;  4A63 B;  3JCM h;  3P8D A;  2DET A;  5IHI A;  1VQ6 T;  1IGU A;  4XTY A;  2X3X D;  2RQV A;  3NGP A;  1S72 Q;  3GNF B;  1IO6 A;  4D6W A;  5I2S A;  1K9M U;  5IXF A;  4JLI A;  3OYM A;  3VYH B;  5FLX E;  2E6Z A;  4PJO G;  2JM8 A;  4O6J A;  2FZC B;  4FW2 A;  4M77 B;  4ZGD B;  4LDX A;  1UGR B;  3M0R A;  5J39 A;  5GAN f;  1R0B G;  3CCV Q;  2MAM A;  4CC2 A;  1SSF A;  2MK5 A;  5FW9 A;  1VQ5 Q;  2P4T A;  3V8L A;  1M30 A;  2XMF A;  5CQY A;  1IRX A;  1OEB A;  2VC8 A;  2OTJ T;  2EYQ A;  1ACM B;  5IAY A;  4N4G A;  2RI3 A;  1D1C A;  1X6G A;  2XID A;  1UJ0 A;  5FU7 B;  3TEE A;  2KT1 A;  2MIO A;  3FIF A;  2MI6 A;  3RDV A;  3SDZ A;  3G6E T;  2J6O A;  3E1S A;  4FT2 A;  4BB7 A;  1NEG A;  4XTU A;  3UA7 A;  1Q95 G;  4J6Y A;  2G6F X;  1VQ8 T;  1AHJ B;  3X26 B;  1ZQ1 A;  2DZ9 A;  1I1J A;  4LDU A;  4LD6 A;  2J05 A;  3C0C A;  1FWZ A;  2NWM A;  1SRL A;  3JV3 A;  1IGQ A;  2EYZ A;  2M1H A;  3OMG A;  4IUR A;  4IKF A;  1TS9 A;  5HK0 A;  2CUB A;  1PWT A;  2FRY A;  3HRS A;  4BI4 A;  2EAY A;  1ZUY A;  1GFC A;  1YFN A;  2HDA A;  3L2W A;  2OX7 A;  2HEQ A;  3OYY A;  1UUE A;  1RL2 A;  2OTL Q;  1ZSZ A;  3OYI A;  4DEX A;  3VRZ A;  2DF6 A;  5GAN h;  3JCM J;  2QGF B;  2CP5 A;  4M77 D;  4RTX A;  2QTX A;  2ATC B;  1VQ6 A;  3H0H A;  1YJN T;  3MP1 A;  3QJ6 A;  3A8H B;  2YUP A;  1PHT A;  2AKL A;  4C0Z A;  4JS4 A;  1OU9 A;  4OP0 A;  5LJ3 f;  3A8M B;  3AT1 B;  5LJ3 d;  2DIL A;  4CI0 C;  1MMN A;  3ZFJ A;  5GAN 3;  2NUT B;  1KC8 R;  5LJ3 j;  4LUD A;  2RI2 A;  5AT1 B;  3OW2 P;  2AZS A;  3CQT A;  1MGQ A;  2H3E B;  5D6Y A;  1VQP Q;  4J9C A;  2ZZD A;  2L3R A;  3R6O A;  3JCM b;  1KQS A;  3LGL A;  2AKK A;  2RJF A;  3M0S A;  4YTL A;  1NZ9 A;  2A36 A;  4M75 A;  4GLK A;  4KUI A;  1UHF A;  2PQW A;  4QVD A;  1VQM Q;  2L8D A;  4BE0 A;  1G3T A;  4E7J A;  2OTJ A;  3KXT A;  3V8K A;  4M75 G;  1OOT A;  3VV0 A;  2EJF A;  1BCM A;  2D9T A;  4KT0 E;  2L3S A;  2FPE A;  4ANJ A;  1Z9Q A;  4FYV B;  1YJW A;  2DXU A;  3ME9 A;  4XTV A;  2YUQ A;  2IIM A;  1UEB A;  2NUP B;  4X9D A;  3OY9 A;  3NPF A;  4ME7 A;  2CP3 A;  2RI5 A;  2JN0 A;  3U23 A;  4NOY A;  1G3Y A;  4E47 A;  1VQ8 A;  3S3N A;  3I55 Q;  3RKW A;  4CC3 A;  4JRP A;  3H6Z A;  3I5S A;  3N5B B;  9ATC B;  1RAB B;  5IT9 E;  4JRK A;  5KCO A;  1M1K C;  1HJD A;  1ABQ A;  1XQH A;  1M90 R;  1WHG A;  1JXO A;  2P0K A;  2DBK A;  3M57 A;  1VQ7 Q;  4HCZ A;  1WQ7 A;  1AWJ A;  4XQ3 A;  2EGE A;  7AT1 B;  1YNZ A;  5GAO n;  2GQI A;  3JCM X;  4HCK A;  1NJI C;  2EQJ A;  2ZPI B;  5LL6 S;  1OI1 A;  3BDL A;  5AYF A;  1G2B A;  1X27 A;  4MZM A;  2O4X B;  2X4X A;  4B9X A;  4BY6 B;  1OV3 A;  1WPY A;  2E64 A;  3QHS A;  2VKN A;  3H0F A;  2MYS A;  4J83 A;  1NEB A;  2A0F B;  2FPF A;  4LUE A;  4KUL A;  3CMA Q;  1Y07 A;  3I56 T;  3GPL A;  1JU5 C;  2EYY A;  1YJN A;  4JPB W;  1VQN T;  2QQ9 A;  5CQX A;  1ZA1 B;  3SD4 A;  3CBO A;  4HCB A;  1TG0 A;  1M1F A;  2CZ0 B;  3CD6 Q;  2DYI A;  1YIT T;  3L2Z A;  1QCN A;  4Y91 A;  4K11 A;  1M8V A;  4ZN1 A;  1AZE A;  4OB1 B;  3CME T;  4MDW A;  1AEY A;  3O5Z A;  1Y7X A;  2E12 A;  3OYA A;  4C8Q B;  3GBQ A;  3E9F A;  2LTO A;  1VQ9 T;  4LN2 A;  2LNV A;  2E1H A;  2RO0 A;  3MEV A;  2I2L A;  4DQ2 A;  2E70 A;  4C0F A;  3UF4 A;  2WSF E;  1TUD A;  1EFN A;  3QII A;  2PUK B;  2F2W A;  1RAI B;  3O8V A;  1TUC A;  1YIJ A;  3CPW P;  2KNB B;  4M75 F;  3CCQ Q;  1JBM A;  1NLO C;  2CZ1 B;  2JTM A;  4FYY B;  5A0D A;  1M3A A;  3BFM A;  3L42 A;  2W0Z A;  3M56 A;  4ORZ A;  3CCU Q;  1N8R C;  4DA4 A;  1SPK A;  3CC2 Q;  2G3R A;  2EYX A;  1JJ2 P;  4M77 C;  3VS5 A;  4C0G A;  1WA7 A;  3CBM A;  5D7U A;  3HTR A;  4QQD A;  5I22 A;  5KYW A;  3L2R A;  2X9H A;  4HA8 A;  1P92 A;  4C0D C;  1QKW A;  3EGD B;  2CP2 A;  2CDT A;  2GFA A;  2DRM A;  1K0S A;  4D8K A;  2IPO B;  1RAE B;  1LCK A;  4R56 A;  2ECZ A;  1VQ5 T;  2O9S A;  2K3Y A;  2LDM A;  1UGP B;  3NMZ C;  2D1X A;  1E6G A;  1QVG P;  3OYC A;  1LVK A;  1SF9 A;  4C8Q D;  2DYB A;  2FZG B;  1NBE B;  3A8O B;  3TSW A;  5KYY A;  4LD9 K;  2FYK A;  1WYX A;  1VIF A;  3NTI A;  2DBM A;  1GCP A;  2BE9 B;  3DLL A;  2CGH A;  5I21 A;  1OX8 A;  3EG2 A;  3JB9 J;  1YIT A;  5LJ5 e;  2KMT A;  4M78 B;  4RCC A;  3HFO A;  3T9N A;  2PTK A;  4OGE A;  2FEI A;  3QYG B;  1HYO A;  3M4Y A;  1UG1 A;  3ASK A;  2Y90 A;  2MCN A;  3CME A;  2KAF A;  2QQA A;  4XU2 A;  3LWH A;  4BUG A;  2VUB A;  1WI7 A;  1QVF A;  3E2U A;  1OZ3 A;  1VQ9 A;  1K9M C;  1ZLM A;  4FT4 A;  2PVG B;  1IZ6 A;  1LJO A;  2JJ9 A;  2YDL A;  3JCM g;  4FL6 A;  1N5Z A;  1KQ1 A;  2LCL A;  5CK9 A;  4FU6 A;  1VQO T;  3PIO A;  2QAS A;  3NTK A;  3H8Z A;  2XDB A;  2CKK A;  2HQE A;  5KYX A;  2DJQ A;  5GAM h;  3UA6 A;  4IIO A;  5GAN 2;  1KJW A;  3HL8 A;  2FB7 A;  2HBW A;  3VYG A;  3QZ5 B;  1KC8 U;  4EDU A;  1SHF A;  2LQW A;  2LJ0 A;  1RAD B;  1WJS A;  1Y57 A;  1EZZ B;  2KSS A;  3X20 B;  1Q81 R;  2K5F A;  2L3Q A;  2QG9 B;  4Z89 A;  3JCM c;  1BB9 A;  1ABO A;  3R6N A;  2DE0 X;  1W2B P;  1BBZ A;  3G71 T;  3OW2 A;  2KY9 A;  1AVZ C;  2HMA A;  4IUP A;  2DRK A;  4AG2 C;  1M3B A;  3SB2 A;  1ZX6 A;  2JS2 A;  2D0N A;  5J26 A;  2CSI A;  1QVP A;  1YJ9 A;  2FL7 A;  1AWO A;  2C06 A;  3H9N A;  1VQP T;  1RI9 A;  2KRM A;  2XDP A;  4E7H A;  2M0O A;  3DB4 A;  1XTD A;  4M78 D;  1WJR A;  2C0O A;  1K1Z A;  2F1L A;  4F7U B;  1VQ5 A;  4J9H A;  3LLR A;  3FEO A;  1VQM T;  1D1B A;  2DX1 A;  2JUF A;  4ELY C;  1M1G A;  1D1A A;  3M59 A;  1PC0 A;  2RJE A;  2XU8 A;  3CCM Q;  1JQQ A;  2LVM A;  2K4Y A;  5GMK h;  2RQU A;  2KR3 A;  5M9O A;  4BE2 A;  1Y96 A;  1WIE A;  1QKX A;  5CKE A;  3PNW C;  4JJN K;  3GP8 A;  4PL6 A;  3VS7 A;  1WGS A;  3VS2 A;  3EG3 A;  2OAU A;  5CVI A;  1M90 U;  4O5V A;  4PLI A;  3QPH A;  5CIU A;  1BIA A;  4DBR A;  4PNO A;  4TVR A;  1WHH A;  3VS6 A;  4E2F B;  4C5E A;  3RER A;  4JZ3 A;  4GBQ A;  4J6W A;  5EG2 A;  1IHV A;  2CT3 A;  1PKS A;  3C95 A;  5GAN g;  1VIE A;  2O9V A;  3EFR A;  1MV3 A;  1X43 A;  3CCL T;  2QDY B;  1VQO A;  2FZK B;  2RNA A;  1QVF S;  2M16 A;  5LJ5 f;  1KIK A;  3URG A;  3CCR Q;  3L2Q A;  5LJ5 d;  5D6W A;  5FU6 C;  3CCJ T;  5IH2 A;  3HHT B;  4M77 A;  4KGX B;  1NYG A;  2X35 A;  4R55 A;  5GMK m;  5LJ5 j;  3G4S T;  5GAO l;  3I9Q A;  4VUB A;  1I8F A;  4A4H A;  2XI9 A;  3JCM Q;  5CKH A;  2LJ3 A;  4XU0 A;  2O2O A;  1YWP A;  3OYH A;  3UAT A;  2D8H A;  4FCY A;  3J81 E;  5KE3 A;  3OS1 A;  3G71 A;  2CP6 A;  4B9W A;  1K73 R;  2SRC A;  1FMK A;  4OMQ A;  1BU1 A;  1TTH B;  3EGX B;  1GRI A;  3PGG A;  3MEU A;  1QW1 A;  4AFQ C;  4PJO B;  1PSE A;  1VQP A;  2HNI A;  3EG0 A;  4Y92 A;  2DTO A;  2JTF A;  2KBT A;  3OW2 S;  4J6X A;  1V76 A;  3FJP A;  1O9S A;  2BKD N;  5GAN 5;  4DBH A;  2K57 A;  4OF1 A;  2AT1 B;  2XG8 D;  5IHK A;  2YRC A;  3IQL A;  3TSZ A;  5GAN 6;  2ESW A;  2VAS A;  4F16 A;  3CCS Q;  4QVC A;  1UE9 A;  4FYW B;  3AHU A;  3CC7 Q;  2EJG A;  1U5S A;  2KI7 A;  3BW1 A;  4E7K A;  3OYK A;  2IG0 A;  1BI0 A;  1JRI A;  1TOV A;  2HAX A;  2DM1 A;  1Z9Z A;  3GLX A;  4N4H A;  2R5M A;  1K8A U;  3ZL7 C;  2BUD A;  2DD4 A;  2YUN A;  3EH1 A;  3OYG A;  2VXE A;  1D0X A;  1BI1 A;  2DEQ A;  3HPW A;  3OYJ A;  2ZAE A;  3CCU T;  2EGC A;  3CC2 T;  1U3O A;  1R0C B;  1NJI R;  1YN8 A;  1RAG B;  3V7C A;  2MWO A;  2R5A A;  4ZGJ B;  3M9Q A;  5CAI A;  1TH7 A;  3E9G A;  2RH2 A;  3ULR B;  4JZ4 A;  2AIR B;  2K5I A;  3M0P A;  2QEX A;  3NHN A;  1JB0 E;  5FRO A;  3NTH A;  4JJC A;  3J7A F;  5GMK i;  3OSV A;  3CCL A;  2HL3 A;  4E7Z A;  4KRT A;  3OS5 A;  1D0Z A;  2LRQ A;  4QW2 A;  2DO3 A;  2QA4 Q;  2FG0 A;  3CC4 T;  4FYX B;  2YXY A;  5DM7 R;  1Q86 C;  3CCJ A;  1OPL A;  5GAO m;  1Q82 R;  1QVG A;  1VYU A;  1PM3 A;  2RHX A;  1YP5 A;  1EX4 A;  1M9S A;  1UJY A;  2JXB A;  2DL3 A;  2V8J A;  5HKC A;  4PJO D;  3G4S A;  2HKN A;  2E10 A;  1AOJ A;  3H41 A;  4FW1 A;  5FRM A;  4LDV A;  3JRZ A;  3MPU B;  1ZSZ B;  1W1F A;  2PVO B;  2FHD A;  2FO0 A;  1ZBX A;  2A37 A;  4L5G A;  2RJD A;  2PZ1 A;  3LW5 E;  3JCM P;  4C92 E;  2ZPH B;  4C5H A;  1UEC A;  2RJC A;  4M7D E;  2NUP A;  4KGV B;  2HZY A;  4RTZ A;  1SKU B;  2DLP A;  5CCA A;  4C92 C;  2F69 A;  2V8K A;  3I35 A;  3THK A;  1YI2 Q;  4E7S A;  1U8R A;  4M7D C;  2F5K A;  3G6E A;  1UFF A;  1MUZ A;  5C0M A;  1MMA A;  3VU3 C;  1LOJ A;  5KYU A;  1N8R R;  1W4S A;  3PVL A;  1R77 A;  2LT4 A;  4AMC A;  4EMK B;  1Q81 U;  4J9E A;  2X3W D;  3PMI A;  3A8L B;  1WXU A;  1UTI A;  1MMD A;  3DB3 A;  5LJ3 h;  1X75 C;  2O4X A;  1ZA2 B;  3OMC A;  4F7U E;  4KUD K;  2P4R A;  1W2B A;  5I2M A;  2DVJ A;  6AT1 B;  4ZTJ A;  1KG1 A;  3MKD A;  4WCI A;  2DL5 A;  1ZUU A;  1M3C A;  3PTA A;  1G5V A;  2KYB A;  1JJ2 S;  2QQS A;  3KUF A;  3REA B;  2A08 A;  3OYN A;  1D0Y A;  1OQK A;  3RIR A;  4PJJ A;  3DLM A;  2L2P A;  3C12 A;  4C5G A;  2H8H A;  1D3B B;  2K7A A;  2QQR A;  1T3S A;  4KGZ B;  5ECA A;  3EG9 A;  3CC4 A;  4LNP A;  4AFU C;  4J9I A;  2P84 A;  5KYN A;  1KK7 A;  2DIQ A;  1WLP B;  2KVQ G;  2V1R A;  4RTV A;  3CCM T;  4JRQ A;  1KD1 C;  2V8I A;  2HSE B;  2COZ A;  1I5L A;  3H0I A;  2PU9 B;  2ED1 A;  3INZ A;  4Q5W A;  2EKO A;  1PKT A;  1QVG S;  1WXT A;  2HQX A;  2LT1 A;  3Q1J A;  3UPU A;  5FWC A;  4M7A B;  5DLQ E;  3MEW A;  1VQL T;  3QUI A;  1RLQ C;  2COY A;  2KQW A;  1WQW A;  1KC8 C;  1VQK T;  2ZGW A;  2Y4X A;  3E19 A;  1VQ4 Q;  5A0G A;  2DTI A;  5GAM g;  3SWN B;  4OB3 B;  4F14 A;  3JB9 D;  1YJW Q;  2LX7 A;  4D8D A;  4ATO A;  3TVT A;  2E5Q A;  4M77 E;  1QCO A;  1G3S A;  5L8R E;  1KHC A;  4RKU E;  1UDL A;  2K2V A;  1X6B A;  3BY7 A;  1H3Z A;  3SEM A;  1HSQ A;  1N9R A;  2VB6 A;  1S72 T;  2DAQ A;  3L2U A;  3CCR T;  1PRM C;  2JTE A;  4LE9 A;  4PJO E;  2RHU A;  1RLP C;  1K73 U;  1RAA B;  3QG1 A;  2JNG A;  4XTX A;  4E6R A;  1FMV A;  4N0A C;  1ZHI A;  4PJO C;  3QSU A;  3EAE A;  4UC4 A;  5CO7 A;  5GAN 7;  1WHL A;  4HT8 A;  1K9A A;  5FU7 C;  1K4U S;  2EQU A;  3QWX X;  2DK3 A;  1IXD A;  3CCV T;  2R57 A;  2EW3 A;  4CC4 B;  3WXM B;  1M90 C;  1XOV A;  5FWB A;  3PIP A;  5GAN 8;  1I4K 1;  1W2B S;  1PG5 B;  4DBF A;  2MPX C;  2DTH A;  1SSH A;  2M0Y A;  2B86 A;  3I56 A;  1RI0 A;  2MF2 A;  4Z88 A;  1VQN A;  4M7A D;  4BI3 A;  4KBM B;  2L89 A;  2X4W A;  1PRL C;  4KH1 B;  2RMO A;  3OB9 A;  4LXC A;  2LJ1 A;  4DOW A;  2JZ2 A;  1ZBJ A;  2PVD B;  1M2V A;  4EMH A;  1KSW A;  1Q7Y R;  3CCS T;  3CC7 T;  3MP6 A;  1RAF B;  1WJQ A;  3CXC P;  1C0M A;  2X51 A;  1OUL A;  3CCE Q;  4ELZ C;  1SG5 A;  1H92 A;  2EWN A;  4MDX A;  1QCF A;  1VQL A;  4JRI A;  2WSC E;  4J7I A;  4LDW A;  4C92 A;  1ARK A;  3FC3 A;  1KQS P;  1VQK A;  2RHY A;  2K2M A;  4FSX A;  3JCM W;  4EPC A;  4OMN A;  4M7D A;  4OB0 B;  2SEM A;  3V7R A;  4C92 G;  2KK4 A;  4KH0 B;  4AT1 B;  3TRE A;  2K3X A;  1YIJ Q;  1M4Z A;  1Q82 U;  2OI3 A;  1WHK A;  4M7D G;  2OTL T;  2YSQ A;  2RHZ A;  2VXF A;  4X1V A;  4A4G A;  2DFU A;  1BYM A;  1S72 A;  2QA4 T;  1UB4 A;  3CCR A;  2KEA A;  2YUO A;  5GMK l;  2DZC A;  2RN8 A;  2CH4 W;  2ROL A;  3TU4 K;  1KFZ A;  2P0P A;  1YWO A;  3TCJ A;  2BZ8 A;  4OVA A;  3NFC A;  3BE3 A;  2GF7 A;  4F7U A;  2M02 A;  1U1T A;  1T0H A;  2A7Y A;  4OMM A;  1QWE A;  2NLU A;  2BE7 D;  1CKB A;  4JJB A;  1B34 A;  1AT1 B;  4ZTF A;  4NL2 A;  4ZGE B;  1OU8 A;  4AG1 C;  5I11 A;  3CCV A;  3HRU A;  2K5L A;  1RAC B;  3S3O A;  3MO8 A;  1ZSG A;  1K8A C;  2WAC A;  2C0T A;  2K9G A;  3M4G A;  2GTO A;  2MMP A;  4NS5 A;  3RNJ A;  1N8R U;  4GY5 A;  2B8A A;  4EMK C;  2DEU A;  2AHJ B;  2LQ8 A;  1PCX A;  1MV0 B;  2KDS A;  1YI2 T;  3GF5 A;  2F5T X;  2QK0 A;  1YIT Q;  2HL5 C;  1OPK A;  2X4J A;  3QWY A;  2CH4 A;  1N27 A;  4PFP A;  2GQV A;  3CCS A;  4RTU A;  1M8M A;  3WVE B;  5GAO q;  2ZPE B;  1CKA A;  3I55 T;  1T0J A;  2DER A;  2F2V A;  1VQ9 Q;  2VVK A;  4BY6 C;  1VQ7 T;  2KRS A;  2VGN A;  4MZT A;  2MWP A;  3HKS A;  5J3B A;  8AT1 B;  2XIC A;  4MML A;  1B7T A;  4PFO A;  1GBR A;  1MHN A;  1LNX A;  1NPP A;  2CZ6 B;  1Q86 R;  4CRI A;  4OGC A;  2KYM A;  4FM4 B;  4C92 F;  2YLC A;  2OTL A;  1LPL A;  3X28 B;  4JS5 A;  4HXJ A;  3LX7 A;  4C8Q E;  2A3L A;  2QXF A;  4XTW A;  4M7A E;  4M7D F;  4IIM A;  3CMA T;  3L1A A;  3M0U A;  4II1 A;  4M77 G;  4OMO A;  1E7O A;  1VYV A;  2EPD A;  3X25 B;  2QA4 A;  3OBW A;  3CEY A;  3EGX A;  1OYX A;  2QDL A;  4C8Q C;  2J6K A;  3EHQ A;  4M7A C;  4N0A A;  3EFO B;  3CD6 T;  3JAM E;  1QWF A;  3QXE B;  4PJO A;  4XU3 A;  3JSC A;  4BE1 A;  3OBY A;  4FSS A;  1YHQ Q;  4R0K A;  4HKE A;  2CT4 A;  2HCK A;  1AD5 A;  1YJ9 Q;  5DY9 A;  3SWN C;  1OX9 A;  1Q81 C;  2EBP A;  3L2V A;  2GTJ A;  2LX9 A;  2DL8 A;  3VJP A;  3REB B;  4J5Y A;  3OYF A;  1MMG A;  3FRN A;  5GAN d;  2QI2 A;  1SEM A;  3HSB A;  5KH6 A;  4F7U F;  1VQM A;  4C0D B;  1BKB A;  3PVQ A;  3RUX A;  3CPW A;  5GAN j;  1VQ4 T;  1AWW A;  4F04 B;  3J80 E;  1IHW A;  2JS0 A;  2O01 E;  4BD3 A;  2GNC A;  1YJW T;  2E41 A;  2HKQ B;  3EH2 A;  1X2Q A;  2E3H A;  1YI2 A;  3CCQ T;  2E5K A;  1GFD A;  3M58 A;  1G3W A;  5LJ5 h;  1M1K R;  2O31 A;  2CSQ A;  5LJ3 g;  1JJ2 A;  2KRO A;  1G8X A;  4PKC C;  8ATC B;  5CKF A;  1BIB A;  1NM7 A;  1PD0 A;  4FIB A;  3F70 A;  2CRE A;  1E6H A;  2W10 A;  2QTV A;  1VUB A;  1H64 1;  2L0A A;  1M5Q 1;  1QQJ A;  1RUW A;  1N9S A;  1WNL A;  3I55 A;  4B6M A;  2DMO A;  5GJV B;  3FDR A;  3QKJ A;  1X69 A;  2DNU A;  4RUG A;  2NUZ A;  1VQ7 A;  4P5N A;  1QVF P;  2KGT A;  2VV5 A;  2YRD A;  1VQO Q;  4M78 E;  4RCB A;  4Y28 E;  2NUT A;  2DKG A;  1TSF A;  2DL7 A;  2PUO B;  2PNI A;  4A4E A;  4F17 A;  4DEY A;  3OS2 A;  3V7S A;  2FRW A;  2H3J A;  4QT7 A;  2YT6 A;  2E6N A;  1R8O B;  4M78 C;  5IHN A;  1NPR A;  5CR2 A;  3CMA A;  1WXB A;  1Q7Y U;  2EQK A;  4J8O A;  1KD1 R;  2RQW A;  1XJW B;  2J6F A;  3LYI A;  2XHC A;  4RMO A;  3OA6 A;  3VRY A;  1TXQ A;  3M54 A;  4M77 F;  4X34 A;  3KBG A;  3CD6 A;  1HK9 A;  2RA2 A;  4BI8 B;  2RF0 A;  3CXC A;  4XAX B;  2RB6 A;  3RR6 A;  2EFI A;  3G71 Q;  2ED0 A;  1WHM A;  1VA7 A;  1KQ2 A;  2LNH B;  3KFV A;  2YHT A;  3HFN A;  2VWF A;  3MHX A;  3G1J A;  3CCE T;  2J06 A;  4XU1 A;  2EVR A;  4PJO F;  3VUB A;  3V8J A;  3HP9 A;  1U06 A;  1Y0M A;  2X4Y A;  2BIV A;  4EMK A;  1K76 A;  3ZBD A;  4PJL A;  2D0Q B;  1OZ2 A;  1K73 C;  3QDF A;  5HCK A;  2CYZ B;  1FXX A;  2XK0 A;  4ZNX A;  3QZ9 B;  2CP0 A;  3PE0 A;  2DA9 A;  4HCC A;  3M55 A;  3S3M A;  1UGV A;  1VQ4 A;  4OB2 B;  3MJX A;  1AWX A;  1MND A;  3QJY A;  1I0C A;  2C0I A;  3EGU A;  2FVU A;  3C4S A;  3OQ5 A;  4M75 B;  1MNE A;  2LQK A;  1YIJ T;  3JB9 H;  5GAM e;  4HVU A;  3CCQ A;  3JB9 G;  2COW A;  2GFU A;  4WTO B;  5DLO A;  2O88 A;  1JEG A;  2LQN A;  1XNI A;  1CSK A;  1QP3 A;  3CPW S;  1V29 B;  4V2S A;  2DL4 A;  5CKB A;  2E3I A;  1JXM A;  5C6S A;  3VS0 A;  4A4K A;  4QKU A;  3CCU A;  3CC2 A;  3RMS A;  1D3B A;  1GCQ C;  4RG2 A;  1QLY A;  1NYF A;  3QBY A;  2RK2 A;  4PJM A;  4AFS C;  2QEX Q;  5KYU B;  1VOM A;  2R58 A;  1H3H A;  1N6A A;  3I5R A;  1W6X A;  2L5Q A;  2RK1 A;  2QAZ A;  5GAN 4;  3CCL Q;  2RHI A;  3EFS A;  4BAC A;  2QGG A;  4A54 A;  1UGS B;  5A2Q E;  1VQ6 Q;  2BZY A;  2OJ2 A;  3VS4 A;  2JM9 A;  1AZG B;  3JCM V;  2D6F A;  1I5O B;  3QYH B;  2EQI A;  2XKO C;  3CCJ Q;  4HVW A;  1IRE B;  1X2K A;  3RKX A;  4MMK A;  4Z8A A;  4PFZ A;  2HQH A;  3ER0 A;  4EIK A;  4C8Q A;  3M53 A;  2LP5 A;  4M7A A;  5GAO p;  1DJ7 B;  3G4S Q;  5KCH A;  1IB8 A;  2M9U A;  3SFM A;  4HVV A;  3RES A;  1YCY A;  3M0Q A;  4C8Q G;  5GMK e;  4M7A G;  5FU6 B;  1Q82 C;  3OYB A;  2DXC A;  1J3T A;  1K9M R;  2EKH A;  3SWN A;  4J9D A;  2YWW A;  2V1Q A;  1BI3 A;  2KT8 A;  3EG9 B;  5CKD A;  2RQR A;  2Y4Y A;  5A0L A;  4M75 D;  1BI2 A;  2JT4 A;  3TQ7 P;  2OTJ Q;  5EC7 A;  3CCE A;  1BCO A;  5IXB A;  2XD0 A;  1SRM A;  1Q86 U;  5FRN A;  3CXC S;  1PNJ A;  2BZX A;  1W70 A;  2KXD A;  4RTT A;  2KRN A;  2IVW A;  2CUD A;  2RM4 A;  3QDR B;  1D09 B;  1S1N A;  3G6E Q;  2ZPB B;  3MEA A;  2XDD A;  3JCM e;  3A8G B;  3P8H A;  3M0T A;  3HRT A;  3PT9 A;  3EGD A;  1KQS S;  5GJW B;  2A28 A;  3PFS A;  1VQ8 Q;  1UHC A;  3VKI A;  4IUU A;  1UGQ B;  1VYT A;  2Z0W A;  4L6V 5;  4AFZ C;  2LCS A;  4L59 A;  3RKY A;  3VS3 A;  3JB9 F;  1GL5 A;  1WHJ A;  2LMJ A;  2LZ6 B;  3GOX A;  1WX6 A;  4J9F A;  4WF2 A;  4EMG A;  4OML A;  1TUG B;  4PLL A;  2KE9 A;  2DXT A;  1A0N B;  3FJ5 A;  3PMT A;  4RG8 A;  1K8A R;  4PJN A;  4LDY A;  2VGM A;  1YHQ T;  4M4Z A;  1G83 A;  1WFW A;  2DXB A;  3GNG A;  1PD1 A;  1C1A A;  2GBQ A;  1O75 A;  5GAM f;  1YJ9 T;  5GAM d;  4M78 A;  2FPD A;  4IUQ A;  3UT1 A;  3OYL A;  1YJN Q;  1NG2 A;  2RQT A;  5KYW B;  3CC4 Q;  1HXD A;  3LH5 A;  4A4F A;  4PK4 A;  2F2X A;  5GAM j;  1KHI A;  4M78 G;  1M1K U;  1T3L A;  2GGR A;  1M2O A;  3M5A A;  3A98 A;  4N4I A;  4JDS A;  3CCM A;  1TWB A;  2JMC A;  1QMC A;  4IUV A;  4IUT A;  1NJI U;  2OAW A;  1X6O A;  3LGF A;  4C8Q F;  4M7A F;  1ZUK A;  1I81 A;  2JVV A;  4QQG A;  5KYY B;  3CBP A;  2EJ9 A;  2EIF A;  2L3P A;  1U1S A;  4JLG A;  1FYN A;  3LWI A;  2K6D A;  1TU0 B;  5IN1 A;  2CZ7 B;  2ZCF B;  4CC7 A;  3OSS C;  2YLB A;  5D6X A;  1I07 A;  3LH0 A;  1M2V B;  2CP7 A;  2GCX A;  4MZP A;  3FLG A;  2JMA A;  2DIG A;  3OYE A;  2AK5 A;  1Y71 A;  2ZPF B;  5GAN e;  1KD1 U;  2DD5 A;  3C94 A;  1WZO A;  3SHW A;  2HD0 A;  2LC4 A;  1PSF A;  3G7Z A;  2EYW A;  1ZSZ C;  2JOY A;  2AZV A;  2EQM A;  2CS7 A;  5GMK j;  4C92 B;  1GXI E;  3RMQ A;  4ESR A;  1GCQ A;  2HSP A;  4A53 A;  4M7D B;  1B3Q A;  2P0Q A;  2JW4 A;  2I0N A;  1GBQ A;  3MP8 A;  5KE2 A;  1B07 A;  1YBY A;  5KYX B;  3VUZ A;  3OS0 A;  4QVZ A;  2QQB A;  2K79 A;  3S6W A;  3UDC A;  3X24 B;  1NLP C;  4J7F A;  4XK8 E;  4F7U G;  5HK3 A;  1YCS B;  3JCM f;  1K0X A;  2ENM A;  4GLM A;  4J9G A;  3JCM d;  2KXC A;  4HT9 A;  4M75 E;  1YHQ A;  3BDU A;  3JB9 I;  1HD3 A;  2E65 A;  3DKM A;  4RTW A;  1C6V X;  2D8J A;  3QO3 A;  2ROT A;  3EG1 A;  3I56 Q;  2J7I A;  4NL3 A;  2DPP B;  3MET A;  3MCA B;  1VQN Q;  4M75 C;  3EHR A;  3UWN A;  3CPF A;  5LJ5 g;  2QYZ A;  4J9B A;  2DJZ A;  2HBP A;  3A5Z B;  4QQ6 A;  2BTT A;  1BK2 A;  2YRV A;  3P8B B; 
#chains in the Genus database with same CATH homology
 3PTA A;  1VUB A;  4M78 F;  1G5V A;  1JJ2 S;  1VQ5 T;  1H64 1;  2K3Y A;  1M5Q 1;  2QQS A;  2LDM A;  1N9S A;  1WNL A;  3KUF A;  3I55 A;  1UGP B;  1B34 B;  4JUV A;  3WVD B;  1QP2 A;  3OYN A;  3CC7 A;  3RIR A;  4E7I A;  3DLM A;  3C12 A;  4C5G A;  3OYC A;  4C8Q D;  3FDR A;  3QKJ A;  1D3B B;  4OMF B;  5HY6 A;  3A8O B;  3ZEH A;  4DOV A;  4BDZ A;  1VQ7 A;  4LD9 K;  2FYK A;  1VIF A;  2QQR A;  3NTI A;  1NE8 A;  1X01 A;  4P5N A;  1EIF A;  4C5I A;  3DLL A;  2CGH A;  5I21 A;  2ZPG B;  3OYD A;  3FB9 A;  2VV5 A;  3CC4 A;  2WSE E;  2DVE A;  3JB9 J;  1YIT A;  4M78 E;  4RCB A;  5LJ3 e;  4Y28 E;  5LJ5 e;  2KMT A;  4BDY A;  1Q7Y C;  2LCC A;  4M78 B;  4RCC A;  3HFO A;  2DKG A;  3T9N A;  2VYT A;  1Y96 B;  4C92 D;  2PUO B;  4OGE A;  3QYG B;  4A4E A;  3GIB A;  3OS2 A;  3M4Y A;  5GAO r;  3V7S A;  3ASK A;  2Y90 A;  4X9C A;  3CME A;  2H3J A;  4Z02 A;  2KAF A;  2QQA A;  2DIQ A;  4XU2 A;  3LWH A;  2E6N A;  2KVQ G;  4M7D D;  4XTZ A;  3CCM T;  1R8O B;  4JRQ A;  4M78 C;  1KD1 C;  1NPR A;  2V8I A;  4ZN3 A;  2QEX T;  4E7L A;  4BUG A;  5CR2 A;  1I5L A;  2VUB A;  1FX7 A;  3CMA A;  2PU9 B;  1QVF A;  3INZ A;  4Q5W A;  1OZ3 A;  2EKO A;  1Q7Y U;  2EQK A;  4J8O A;  1QVG S;  1VQ9 A;  2RD1 A;  1K9M C;  2HQX A;  2LT1 A;  4FT4 A;  3Q1J A;  2PVG B;  3LYI A;  2XHC A;  3P8D A;  1IZ6 A;  3JCM h;  4RMO A;  3OA6 A;  3UPU A;  1LJO A;  3JCM g;  4M7A B;  4FL6 A;  1VQ6 T;  5DLQ E;  1KQ1 A;  2LCL A;  5CK9 A;  3MEW A;  3M54 A;  4M77 F;  1VQL T;  3QUI A;  4FU6 A;  3KBG A;  4X34 A;  4XTY A;  3CD6 A;  1HK9 A;  2RA2 A;  3GNF B;  4BI8 B;  1VQO T;  2KQW A;  1WQW A;  3PIO A;  3NTK A;  3H8Z A;  1KC8 C;  3CXC A;  2XDB A;  4XAX B;  2RB6 A;  2EFI A;  1VQK T;  2ZGW A;  2CKK A;  2Y4X A;  2HQE A;  3E19 A;  4D6W A;  5I2S A;  1K9M U;  5A0G A;  5GAM h;  1KQ2 A;  2DTI A;  5GAN 2;  5GAM g;  3HL8 A;  3SWN B;  4JLI A;  2YHT A;  3HFN A;  2FB7 A;  3MHX A;  4OB3 B;  3OYM A;  3JB9 D;  3VYH B;  3CCE T;  4XU1 A;  3VYG A;  5FLX E;  4ATO A;  2E6Z A;  4PJO G;  4PJO F;  3VUB A;  3V8J A;  3HP9 A;  3QZ5 B;  2E5Q A;  4O6J A;  4M77 E;  1KC8 U;  2X4Y A;  2BIV A;  1G3S A;  5L8R E;  4M77 B;  4EMK A;  4EDU A;  1KHC A;  3ZBD A;  4ZGD B;  4LDX A;  2D0Q B;  4RKU E;  1OZ2 A;  1UGR B;  2K2V A;  1K73 C;  5J39 A;  2CYZ B;  1FXX A;  2XK0 A;  3BY7 A;  1WJS A;  5GAN f;  2KSS A;  3QZ9 B;  3X20 B;  1H3Z A;  2K5F A;  4HCC A;  2MAM A;  3JCM c;  1N9R A;  1SSF A;  1S72 T;  2DAQ A;  3M55 A;  3L2U A;  3CCR T;  3S3M A;  1VQ4 A;  2P4T A;  4OB2 B;  3QJY A;  3V8L A;  3G71 T;  3OW2 A;  2KY9 A;  5CQY A;  4IUP A;  2FVU A;  2VC8 A;  2RHU A;  4PJO E;  2OTJ T;  3SB2 A;  2EYQ A;  3C4S A;  3OQ5 A;  4M75 B;  2LQK A;  5J26 A;  5IAY A;  4N4G A;  1YIJ T;  5GAM e;  2RI3 A;  3JB9 H;  3CCQ A;  1K73 U;  3JB9 G;  1QVP A;  2XID A;  2GFU A;  5DLO A;  3QG1 A;  1XNI A;  2JNG A;  1YJ9 A;  2FL7 A;  1QP3 A;  5FU7 B;  4XTX A;  3TEE A;  1V29 B;  3CPW S;  2C06 A;  1VQP T;  4V2S A;  5CKB A;  4N0A C;  2XDP A;  3FIF A;  1ZHI A;  2MI6 A;  5C6S A;  4E7H A;  2M0O A;  3DB4 A;  3QSU A;  1XTD A;  3EAE A;  4UC4 A;  5CO7 A;  3SDZ A;  4PJO C;  4M78 D;  4A4K A;  1WJR A;  3G6E T;  5GAN 7;  3E1S A;  3CCU A;  4HT8 A;  4FT2 A;  3CC2 A;  3RMS A;  5FU7 C;  4F7U B;  1VQ5 A;  1D3B A;  2EQU A;  2DK3 A;  4BB7 A;  3LLR A;  3FEO A;  3CCV T;  1VQM T;  4RG2 A;  4XTU A;  2JUF A;  2R57 A;  4ELY C;  3WXM B;  1M1G A;  3QBY A;  1M90 C;  1XOV A;  2RK2 A;  3M59 A;  4J6Y A;  3PIP A;  2RJE A;  2XU8 A;  1VQ8 T;  1AHJ B;  3X26 B;  1I4K 1;  5GAN 8;  1ZQ1 A;  1W2B S;  2LVM A;  2R58 A;  2DTH A;  2DZ9 A;  4LDU A;  2K4Y A;  4LD6 A;  5GMK h;  1N6A A;  3I56 A;  1FWZ A;  1RI0 A;  2L5Q A;  2MF2 A;  5M9O A;  2RK1 A;  5GAN 4;  1VQN A;  2RHI A;  1Y96 A;  3EFS A;  4BAC A;  4BE2 A;  5CKE A;  4M7A D;  3PNW C;  4JJN K;  3GP8 A;  4PL6 A;  4A54 A;  1UGS B;  4BI3 A;  4KBM B;  1WGS A;  5A2Q E;  2L89 A;  2X4W A;  2OAU A;  5CVI A;  1M90 U;  3OB9 A;  4O5V A;  4PLI A;  2M1H A;  3OMG A;  4IUR A;  3QPH A;  3JCM V;  4IKF A;  5HK0 A;  5CIU A;  3QYH B;  2D6F A;  2XKO C;  1BIA A;  4PNO A;  3HRS A;  1IRE B;  4TVR A;  2EAY A;  2JZ2 A;  4BI4 A;  2PVD B;  3RKX A;  4DOW A;  3L2W A;  4MMK A;  4EMH A;  4C5E A;  3ER0 A;  3OYY A;  3RER A;  4C8Q A;  3CCS T;  3M53 A;  4J6W A;  4M7A A;  3CC7 T;  5GAO p;  5EG2 A;  1RL2 A;  3MP6 A;  1DJ7 B;  1WJQ A;  3OYI A;  3C95 A;  5KCH A;  2M9U A;  5GAN h;  3SFM A;  4ELZ C;  3RES A;  3JCM J;  1YCY A;  5GAN g;  4C8Q G;  1VIE A;  4M77 D;  2EWN A;  2QTX A;  5GMK e;  1VQ6 A;  3EFR A;  4M7A G;  4MDX A;  1YJN T;  3CCL T;  3MP1 A;  3QJ6 A;  3A8H B;  1VQL A;  4JRI A;  2WSC E;  4J7I A;  5FU6 B;  1Q82 C;  3OYB A;  2QDY B;  1VQO A;  2DXC A;  4LDW A;  4C92 A;  4C0Z A;  4JS4 A;  3SWN A;  4OP0 A;  1QVF S;  3FC3 A;  5LJ3 f;  2M16 A;  3A8M B;  1VQK A;  5LJ5 f;  1BI3 A;  2RHY A;  3URG A;  4FSX A;  5LJ3 d;  3JCM W;  4EPC A;  4CI0 C;  5LJ5 d;  3L2Q A;  4M7D A;  5D6W A;  5CKD A;  5FU6 C;  3CCJ T;  2Y4Y A;  3ZFJ A;  4OB0 B;  5GAN 3;  5A0L A;  3V7R A;  4C92 G;  2KK4 A;  3HHT B;  4M75 D;  4M77 A;  1BI2 A;  3TRE A;  2K3X A;  3CCE A;  2X35 A;  1M4Z A;  1Q82 U;  4R55 A;  5LJ3 j;  5GMK m;  5LJ5 j;  2XD0 A;  4M7D G;  2OTL T;  2RI2 A;  1Q86 U;  5FRN A;  3CXC S;  3G4S T;  2RHZ A;  5GAO l;  2VXF A;  1MGQ A;  5D6Y A;  2ZZD A;  2IVW A;  2L3R A;  3R6O A;  4VUB A;  4A4G A;  3JCM b;  2RM4 A;  3QDR B;  1I8F A;  1KQS A;  4A4H A;  3LGL A;  2XI9 A;  3JCM Q;  2RJF A;  1BYM A;  2ZPB B;  3MEA A;  5CKH A;  4YTL A;  1NZ9 A;  1S72 A;  2XDD A;  4M75 A;  1UB4 A;  4XU0 A;  4GLK A;  4KUI A;  3JCM e;  3OYH A;  3CCR A;  2QA4 T;  3A8G B;  3P8H A;  4QVD A;  2PQW A;  3HRT A;  5GMK l;  3J81 E;  2L8D A;  4BE0 A;  5KE3 A;  3OS1 A;  3PT9 A;  3G71 A;  1G3T A;  1KQS S;  4B9W A;  2DZC A;  4E7J A;  3PFS A;  2OTJ A;  3KXT A;  3TU4 K;  3V8K A;  3VKI A;  4M75 G;  3VV0 A;  2EJF A;  4IUU A;  2P0P A;  1UGQ B;  3PGG A;  2D9T A;  4KT0 E;  3TCJ A;  4L6V 5;  3MEU A;  4OVA A;  3NFC A;  1QW1 A;  4L59 A;  1YJW A;  2GF7 A;  2DXU A;  3ME9 A;  1PSE A;  3RKY A;  4PJO B;  4F7U A;  1VQP A;  4XTV A;  3JB9 F;  2HNI A;  1U1T A;  2DTO A;  2JTF A;  2A7Y A;  3GOX A;  3OW2 S;  4J6X A;  2NLU A;  1UEB A;  4WF2 A;  4X9D A;  3FJP A;  1O9S A;  3OY9 A;  2BKD N;  4EMG A;  5GAN 5;  4ME7 A;  1B34 A;  4ZTF A;  4NL2 A;  4ZGE B;  2RI5 A;  4PLL A;  2JN0 A;  3CCV A;  2K57 A;  3HRU A;  2K5L A;  4OF1 A;  2DXT A;  2XG8 D;  3S3O A;  3MO8 A;  4NOY A;  1K8A C;  1G3Y A;  5GAN 6;  2WAC A;  4E47 A;  1VQ8 A;  3S3N A;  3PMT A;  3RKW A;  4RG8 A;  4JRP A;  4QVC A;  3AHU A;  3H6Z A;  2EJG A;  3N5B B;  4LDY A;  2VGM A;  3M4G A;  1YHQ T;  5IT9 E;  2MMP A;  4JRK A;  4NS5 A;  5KCO A;  2DXB A;  3BW1 A;  3GNG A;  2B8A A;  4GY5 A;  4E7K A;  1N8R U;  1XQH A;  1M1K C;  4EMK C;  2P0K A;  2IG0 A;  3M57 A;  2AHJ B;  3OYK A;  1O75 A;  1BI0 A;  5GAM f;  1JRI A;  4HCZ A;  1YJ9 T;  2LQ8 A;  2HAX A;  5GAM d;  1WQ7 A;  4M78 A;  2KDS A;  3GLX A;  4IUQ A;  4N4H A;  4XQ3 A;  3UT1 A;  2R5M A;  3OYL A;  1YI2 T;  1K8A U;  3GF5 A;  2F5T X;  2BUD A;  5GAO n;  2DD4 A;  3JCM X;  3OYG A;  1HXD A;  2VXE A;  1NJI C;  2EQJ A;  1BI1 A;  2DEQ A;  2X4J A;  2ZPI B;  3HPW A;  5LL6 S;  4A4F A;  1OI1 A;  3BDL A;  3OYJ A;  3CCU T;  5AYF A;  3CC2 T;  1N27 A;  5GAM j;  1KHI A;  4M78 G;  1M1K U;  3V7C A;  2MWO A;  3M5A A;  2GQV A;  2R5A A;  4MZM A;  3CCS A;  3WVE B;  5GAO q;  2O4X B;  2ZPE B;  4ZGJ B;  2X4X A;  4N4I A;  4B9X A;  4BY6 B;  3M9Q A;  5CAI A;  1WPY A;  2E64 A;  3QHS A;  1TH7 A;  3E9G A;  4JDS A;  4J83 A;  2RH2 A;  3CCM A;  3I55 T;  2K5I A;  2QEX A;  4KUL A;  4IUV A;  4IUT A;  1NJI U;  1JB0 E;  1Y07 A;  3I56 T;  5FRO A;  3NTH A;  3GPL A;  3J7A F;  5GMK i;  1YJN A;  3OSV A;  4BY6 C;  3CCL A;  1X6O A;  1VQN T;  3LGF A;  1VQ7 T;  3OS5 A;  2QQ9 A;  4C8Q F;  5CQX A;  3SD4 A;  2VGN A;  4M7A F;  4MZT A;  2LRQ A;  3CBO A;  2MWP A;  4HCB A;  4QW2 A;  2DO3 A;  1I81 A;  1M1F A;  2JVV A;  2CZ0 B;  3HKS A;  3CC4 T;  4QQG A;  5J3B A;  1YIT T;  5DM7 R;  1Q86 C;  3CBP A;  2XIC A;  4MML A;  3CCJ A;  2EJ9 A;  5GAO m;  3L2Z A;  1MHN A;  1LNX A;  1U1S A;  1NPP A;  2EIF A;  4JLG A;  4Y91 A;  2CZ6 B;  1QVG A;  1M8V A;  2RHX A;  4ZN1 A;  3LWI A;  4CRI A;  1M9S A;  4OB1 B;  5IN1 A;  4OGC A;  4FM4 B;  3CME T;  2CZ7 B;  4C92 F;  2V8J A;  2YLC A;  2ZCF B;  4MDW A;  5HKC A;  2OTL A;  4PJO D;  3OSS C;  3X28 B;  3G4S A;  4JS5 A;  2YLB A;  1Y7X A;  3LX7 A;  2A3L A;  2QXF A;  5D6X A;  2E10 A;  3LH0 A;  4XTW A;  2E12 A;  4C8Q E;  4M7A E;  3OYA A;  5FRM A;  4M7D F;  2GCX A;  3CMA T;  4C8Q B;  4MZP A;  3E9F A;  2LTO A;  3L1A A;  3FLG A;  2DIG A;  3JRZ A;  4LDV A;  3OYE A;  1VQ9 T;  1Y71 A;  2LNV A;  4II1 A;  4M77 G;  2E1H A;  2RO0 A;  3MEV A;  2I2L A;  2PVO B;  2FHD A;  2ZPF B;  3X25 B;  4DQ2 A;  5GAN e;  2QA4 A;  3OBW A;  3CEY A;  1KD1 U;  1ZBX A;  2DD5 A;  3C94 A;  2E70 A;  1OYX A;  4L5G A;  4C0F A;  2WSF E;  2RJD A;  4C8Q C;  2HD0 A;  4M7A C;  2LC4 A;  4N0A A;  1PSF A;  3G7Z A;  3CD6 T;  3LW5 E;  3QXE B;  3JAM E;  4PJO A;  3QII A;  4XU3 A;  4C92 E;  3JCM P;  3JSC A;  2ZPH B;  4C5H A;  2JOY A;  4BE1 A;  2PUK B;  3OBY A;  5GMK j;  2EQM A;  2CS7 A;  1GXI E;  4C92 B;  3RMQ A;  2RJC A;  3O8V A;  4M7D E;  4A53 A;  1YIJ A;  4M75 F;  4HKE A;  4M7D B;  1JBM A;  2P0Q A;  2CZ1 B;  5CCA A;  4C92 C;  5DY9 A;  2F69 A;  2V8K A;  3MP8 A;  5KE2 A;  3SWN C;  1YBY A;  1Q81 C;  3VUZ A;  3OS0 A;  3L2V A;  4QVZ A;  2JTM A;  5A0D A;  1U8R A;  3BFM A;  2LX9 A;  3L42 A;  3OYF A;  3VJP A;  2QQB A;  2F5K A;  4J5Y A;  4M7D C;  3M56 A;  3G6E A;  3FRN A;  5GAN d;  2QI2 A;  3S6W A;  5C0M A;  1N8R C;  3UDC A;  3HSB A;  5KH6 A;  3X24 B;  4DA4 A;  3VU3 C;  2G3R A;  4M77 C;  4J7F A;  4XK8 E;  1LOJ A;  4F7U F;  4F7U G;  5HK3 A;  1VQM A;  4C0G A;  3JCM f;  4C0D B;  1W4S A;  1BKB A;  3RUX A;  3JCM d;  2LT4 A;  3CBM A;  4HT9 A;  4M75 E;  3CPW A;  3BDU A;  4EMK B;  3JB9 I;  1YHQ A;  5GAN j;  1VQ4 T;  1Q81 U;  4QQD A;  2E65 A;  3DKM A;  3PMI A;  3L2R A;  3J80 E;  3QO3 A;  3A8L B;  2O01 E;  4HA8 A;  4BD3 A;  1P92 A;  4C0D C;  4NL3 A;  2DPP B;  3MET A;  1YJW T;  3MCA B;  2E41 A;  1YI2 A;  3CCQ T;  3DB3 A;  4M75 C;  3M58 A;  5LJ3 h;  1G3W A;  1X75 C;  2GFA A;  2O4X A;  5LJ5 h;  3UWN A;  5LJ3 g;  3CPF A;  3OMC A;  5LJ5 g;  4F7U E;  1JJ2 A;  2DJZ A;  4PKC C;  4KUD K;  5CKF A;  1W2B A;  1BIB A;  2HBP A;  3A5Z B;  4QQ6 A;  4R56 A;  5I2M A;  4FIB A;  4ZTJ A;  3F70 A;  2YRV A;  1KG1 A;  3P8B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...