3JSCA

Ccdbvfi-formi-ph7.0
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
96
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcdB
publication title Structural and thermodynamic characterization of vibrio fischeri CCDB
pubmed doi rcsb
source organism Vibrio fischeri
molecule tags Toxin
total genus 26
structure length 96
sequence length 104
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jscA00
5HKCA 4MZTA 4ELYC 3HPWA 3NFCA 5CKHA 5CK9A 2VUBA 1NE8A 4MZPA 2MF2A 5DLOA 4HKEA 5HK3A 5CCAA 5CR2A 4MDXA 2KMTA 5HK0A 1VUBA 4OF1A 3G7ZA 5CQXA 2C06A 3JSCA 4ELZC 5CKEA 5CQYA 4MZMA 5CO7A 1X75C 4ME7A 4VUBA 5CKFA 5CKDA 3VUBA 5CKBA 3TCJA 3JRZA 1UB4A 1M1FA
chains in the Genus database with same CATH superfamily
4OMQA 3CPWP 3J80E 1H92A 1RAGB 2LX9A 3THKA 2A28A 2C06A 4JRIA 5GMKi 1YJWA 2KNBB 3VYHB 3M55A 3SWNB 1PD1A 4EMKB 4MMKA 3MJXA 5CKDA 2V8JA 4HA8A 4CC7A 2RMOA 5GAOm 2FVUA 1C1AA 3CMAQ 1FX7A 1TUGB 1K9MR 4X9DA 2YWWA 2O4XB 3CCVA 4N4GA 1AT1B 1I5OB 3OYLA 3EGXA 3TSZA 4BUGA 4F14A 1AZEA 5LJ5j 1VQNT 2VC8A 4M78B 1VYTA 1M9SA 3G1JA 2EQMA 2PUOB 3MP1A 1IZ6A 3OB9A 1JQQA 1N8RR 1VQ7Q 1YWOA 4C8QG 5CCAA 3S3NA 2MOXA 1NYFA 5FU6C 1ZBJA 2PNIA 2E3HA 4XK8E 3PVLA 3JCMh 3X24B 1IREB 4M75G 2DRKA 3QG1A 5I2SA 1S72T 1JRIA 1JXMA 3FJPA 4Y92A 2LCSA 3H8ZA 4R56A 5LJ5g 2VXEA 2HDAA 2DM1A 2V8IA 1OPLA 2A3LA 2F5KA 4OVAA 4WTOB 3EGUA 3M4GA 2E1HA 1BI2A 1NEBA 2X3XD 3OYFA 1HD3A 4PL6A 1WFWA 4E7HA 5LJ3f 3UT1A 2DVEA 3VKIA 1GBQA 3QXEB 1V76A 2M9UA 4AFQC 4JJBA 2K57A 1RI9A 1G3YA 5FROA 4HXJA 4M7DC 2D6FA 1CKBA 3E9GA 2GQIA 4JZ4A 3TREA 3I35A 1SF9A 1M4ZA 2DXCA 1NJIR 4R55A 1RABB 3CC2A 4R0KA 4EMGA 4ZGJB 2Z0WA 2EQIA 2D9TA 2HQEA 3OS5A 3FJ5A 4P5NA 2F2XA 2P4TA 4J6WA 3A8HB 5M9OA 5GJWB 1M1KC 1WHGA 4QW2A 2AKKA 2SRCA 3EG0A 1OI1A 4LDVA 2KY9A 1UGQB 1PRLC 1YI2T 2V26A 3G6EA 3LW5E 5KYYA 2CP5A 1I07A 4QQ6A 2BE9B 2E6ZA 4C0FA 5EG2A 5FWCA 3J81E 1VQ5Q 3QZ5B 2CDTA 2QDYB 2K5IA 2RA2A 2P0PA 2DXTA 4J7IA 1M90R 3BDUA 3QWXX 1IGUA 1VQPQ 4LXCA 2EYYA 2JT4A 4EMKC 4C0GA 4A4KA 1VQ6Q 5GMKm 1TTHB 1HJDA 1WHHA 4C92G 2DLPA 2EAYA 3RKWA 3CCUQ 3UA6A 1VQ4Q 1WJRA 8ATCB 1R77A 1ZSZB 1UGPB 1K76A 2CZ7B 2RJEA 4F7UG 1VQLQ 2CT3A 2EJFA 1AWJA 3PIPA 1LCKA 1K0XA 1WA7A 3X25B 1FMKA 2QXFA 1RL2A 2AZVA 4C8QB 1NG2A 3CMET 4M75B 2A7YA 2EFIA 5ECAA 3CD6T 3RESA 2FO0A 4IUQA 4RCBA 2E70A 1HYOA 2CH4W 1RUWA 1O75A 3CC4T 3LYIA 5GAN6 4E7ZA 5GAMg 5GAOl 3M4YA 1G2BA 2H8HA 2JOYA 4KGXB 1YJWQ 3PT9A 1VYVA 4E7SA 5CKHA 3NTKA 1EX4A 3MEUA 4C5IA 3V8LA 1D0YA 1GCQA 2AK5A 4ZGDB 3CCVQ 1FYNA 3NGPA 2BZYA 1RAHB 2KK4A 1BBZA 4OMMA 4KH0B 5IHKA 3U23A 5CAIA 2OTLA 2Y90A 1XOVA 1LVKA 2CZ1B 1VQOT 4PJOF 1ARKA 2MF2A 3LGFA 3NHNA 5A0LA 1TH7A 4OMOA 1W2BA 1CKAA 2LJ3A 4BE2A 4RTZA 1RAFB 2RQWA 4LUDA 3V7CA 3JB9I 4PJOA 2JS2A 3JRZA 3S3OA 4HVUA 3C4SA 3PFSA 2E3IA 1KC8U 1EFNA 1VIFA 3CCRT 1ACMB 2EQUA 1N27A 4C0DB 5LJ3h 1QP2A 2MWPA 3PGGA 2M51A 2JTMA 4QVZA 4M77F 2FHDA 1T3SA 2ABLA 3G71Q 2QGGA 2OTJT 2EPDA 5CKEA 4DQ2A 4F17A 4M7AE 3JCMQ 4M77E 1QWEA 4M77A 1LPLA 2K2VA 3EG2A 3JCMJ 2MI6A 1YITT 3EFSA 1Z9QA 4HT9A 2EGCA 1OU8A 2JW4A 1J3TA 3VUZA 4L6V5 4C92B 1YJNA 1D3BB 2MIOA 1UGVA 4J7FA 5GAN8 1WIEA 5I21A 1WHKA 4PKCC 2DIGA 4ME7A 3CC2Q 4KUDK 2J6OA 1M5Q1 3L1AA 4KBMB 4F7UB 1X27A 2A37A 1PSFA 4PFOA 2VKNA 3OSSC 2DMOA 3RNJA 3VS3A 2KYBA 2XKOC 2ZCFB 5LJ3d 4FU6A 3M0UA 2LDMA 1FMWA 2BZ8A 1OZ3A 4PJOD 4FYWB 1KIKA 1WYXA 1VQMA 1RAAB 2G6FX 2YRDA 5CKBA 3PMTA 2DD5A 1OX9A 2DILA 2QGFB 1IRXA 3LH0A 1B07A 4FT4A 2J7IA 4MZPA 3EG9A 5CR2A 4A54A 4QT7A 3CCLA 5A0DA 1IHWA 3FEOA 1X6BA 2DNUA 1TG0A 4E7LA 3E19A 1RAIB 1U06A 3MKDA 2KAFA 2DEUA 2NUPB 1WJSA 1QCFA 2KRSA 2AZSA 3HP9A 4B6MA 1B3QA 2OI3A 1Y7XA 2XG8D 3CCQA 1QKXA 1KQ1A 4PJLA 3GIBA 4J9DA 2CZ0B 4FW2A 2LQ8A 3TU4K 3OYHA 3GBQA 3EG3A 1U1SA 2JJ9A 2K7AA 4D6WA 5GANj 4BI4A 3OYCA 3KFVA 4J8OA 2EYXA 1BK2A 3HRSA 4LD6A 2EVRA 3I55T 4XQ3A 3VJPA 1K73C 2DERA 2GFAA 3UWNA 2RI5A 2JVVA 2DYBA 4HT8A 4M7DF 4Y91A 4A4HA 1PKTA 2R57A 3REBB 1U1TA 3TEEA 2ECZA 4EMHA 3DB4A 2DL8A 4J9HA 5GMKj 2KR3A 1Q81R 2VGNA 4M7DA 2RHYA 2RK1A 2FPEA 2CKKA 2FPDA 2ZAEA 2NLUA 1VQNA 1OPKA 1WX6A 2K4YA 4XU3A 2J05A 4GBQA 3WVDB 3BE3A 4LN2A 2DTHA 2HCKA 1VQ8T 2RO0A 2DYIA 3JCMc 1UDLA 1NYGA 2CGHA 1W1FA 3H6ZA 2I2LA 4EPCA 1UJ0A 2B86A 3QO3A 2HKNA 1M8MA 1YN8A 2CP2A 4RG2A 2FB7A 1RAEB 1S72A 3UDCA 1U5SA 2K79A 1T0JA 4EDUA 1H3HA 2DXBA 2DKGA 2ROLA 2OTLQ 2X35A 1KHIA 2E4HA 4ZTFA 3E2UA 2GTJA 4CC2A 4A4EA 2W0ZA 4DBHA 2LQWA 1C6VX 3L2UA 3OMGA 1WZOA 2E41A 1ZUKA 1BKBA 5KH6A 2DFUA 1SG5A 4FT2A 2VB6A 2XIDA 1MNDA 3OYMA 2YLCA 4EMKA 1R0CB 2ENMA 3JV3A 4AFSC 3M54A 1GBRA 2F5TX 3OYNA 3JCMb 2VGMA 4M7DD 1KQ2A 1UG1A 1Q86R 1OOTA 3CPFA 4M7AC 3JCMg 4Z89A 2FG0A 1YHQT 5HY6A 2HQHA 3G4ST 5FW9A 2LMJA 2D8JA 2COWA 3T9NA 2IG0A 2M16A 3EFRA 2Y4XA 4M78E 1MV3A 2LZ6B 2K9GA 1G5VA 2PU9B 2HL5C 2NUZA 3OMCA 4WF2A 1TSFA 4BI8B 2JMCA 1YI2A 1YIJQ 1W70A 1D1BA 3L2VA 1K73U 1WDXA 1PG5B 2IVWA 2O88A 1A0NB 1WNLA 4XTVA 2C0OA 2NUTB 4OMFB 1XTDA 1VQ7T 2M02A 4Z88A 4XTYA 1E6GA 2DXUA 4OGEA 3JCMV 3JB9F 4LE9A 3OYAA 2WACA 1R0BG 3OW2S 3VS5A 2KROA 1KD1C 4OB0B 1M3BA 1AOJA 5GAOp 3VU3C 4PFZA 2JUFA 5KYWB 3SDZA 1MMNA 2VWFA 1YCYA 1VQMQ 4ZN3A 3CC7Q 2RHZA 3LX7A 4KULA 4CC4B 1KSWA 2ZPBB 3F70A 4RTXA 4FL6A 1Y96B 4J6XA 2GGRA 2L89A 2RNAA 4BB7A 4ANJA 1MNEA 3FIFA 3C0CA 4HCBA 3QSUA 2KBTA 2LCCA 2CT4A 3D7SB 2PQWA 4BD3A 5DM7R 2ZPGB 2HEQA 3A8MB 2KGTA 1WI7A 3FB9A 4RUGA 3CMEA 3G7ZA 3QKJA 4X34A 5J39A 3CCJT 4O6JA 2KVQG 3CD6A 2HD0A 2X4XA 1MV0B 4CC3A 2R58A 3UF4A 4XAXB 1AWOA 4GY5A 1T0HA 1BI1A 2BTTA 3CC4A 1IXDA 2O01E 3OA6A 1RACB 3M0QA 1QKWA 2E64A 1K4US 4MDXA 4HCCA 3WVEB 1PCXA 3WXMB 1KC8R 4NOYA 2MAMA 4LUEA 2LT4A 4KH1B 4PJMA 3VS1A 4IKFA 3EH2A 3OS1A 4IUPA 1JXOA 2ZPEB 3RR6A 3OBWA 2QG9B 3FLGA 2EW3A 2RI2A 1VQPT 2X3WD 4A63B 2AIRB 1NLPC 2P0KA 5DY9A 2YDLA 2KQWA 1UGSB 1VQNQ 1YFNA 2E10A 4WCIA 5GANe 3OW2P 2O31A 4FW1A 1AVZC 2ZGWA 1VQOA 2XICA 1BI3A 2K3XA 1IGQA 3BDLA 2J06A 3A8GB 2EYZA 1K8AR 1W4SA 1Q7YC 3META 4LDXA 5GAN7 4C8QE 2RJFA 2ROTA 4J9CA 2EWNA 3VS7A 2CZ6B 2L2PA 4M75E 1KD1U 2EJGA 3CCRA 2KEAA 3VUBA 4F04B 1N8RC 2QEXT 4OMPA 2VASA 2OTJA 2PZ1A 1B34B 2CP3A 4AG2C 1IB8A 4XTUA 4FYYB 3SWNC 1M2OA 3E1SA 3A1PA 1WHLA 5GAN4 1YITA 2X9HA 1X6GA 2BE7D 2RHXA 2YXYA 1NBEB 1VQKT 1YJ9T 3SB2A 3CCMT 1AHJB 4YTLA 2VV5A 1ZBXA 2IPOB 4KRTA 1M2VA 4LD9K 4M78C 4B9WA 2DBMA 5GAMj 5LJ3g 5LJ5h 3OYYA 1WXUA 5I22A 5KYXB 3MPUB 2MK5A 2RD1A 2JTEA 1TOVA 4JLIA 5J26A 1YI2Q 1UEBA 3V7SA 2RI3A 3NFCA 3CPWA 1WPYA 2RJDA 1SHFA 2H3EB 5KYYB 4PJOG 1TS9A 2B8AA 3O8VA 5IHIA 4NL2A 2DL5A 4J9FA 3CCST 2RH2A 1V1CA 3FC3A 1SSFA 1X2QA 2DJQA 2PTKA 3GP8A 2ATCB 2WSCE 3DLMA 3I56T 3REAB 2RHUA 3L2WA 3G71T 4GLKA 4IURA 5LJ5d 3AHUA 2XHCA 3CCET 5L23A 3JB9J 1M1KU 4C92E 2GNCA 1S1NA 2E12A 2HSEB 4PFPA 1I5LA 1Q7YU 3M53A 3INZA 5IAYA 3RDVA 5IXFA 3URGA 3ZEHA 5DLOA 4RG8A 1ZHIA 5HCKA 4F7UE 2A08A 4Z8AA 3E9FA 1MUZA 2MCNA 3I55A 2COYA 3M0SA 5CIUA 1N8RU 2D0NA 3SFMA 4E47A 3L2ZA 4IUVA 3P8DA 5LJ5e 1X43A 3CD6Q 5IH2A 2DVJA 3L2RA 1YNZA 9ATCB 4M7AF 1X69A 3RKXA 4BY6B 2HMAA 2M0YA 1M3CA 4II1A 3CC4Q 1D1AA 4AT1B 1VQ8A 3CXCS 2LJ0A 4M7AA 1RADB 4DA4A 5KYUA 3H0FA 3QJYA 2QA4A 2CP0A 1KHCA 2K3BA 5GAN3 4CI0C 5GAN5 3HRTA 1Q82R 5C0MA 4IIMA 3HTRA 4OGCA 4TVRA 4AMCA 1WXBA 2L3PA 1UUEA 1WHJA 3ASKA 4RCCA 3OW2A 1OULA 2EGEA 4DOWA 4JJCA 2XDPA 4KGZB 4MDWA 3EAEA 3MO8A 1ZSZC 2E65A 3QDFA 2RQVA 2GQVA 4KT0E 4X1VA 2NWMA 1P92A 1GXIE 4KGVB 4XTWA 1QP3A 4MZTA 3KXTA 1VQOQ 1LOJA 3RMQA 4OMNA 3LH5A 1D1CA 4C8QC 4ZNXA 2KYMA 4XU0A 1MGQA 4M75C 1RLQC 2EQJA 3G6EQ 1TXQA 3OYIA 5LL6S 2QASA 3ZL7C 3NTIA 3OY9A 1TWBA 4PJOB 2HZYA 3CCRQ 1HK9A 1X2KA 5D7UA 6AT1B 1AWWA 1YHQA 2LTOA 5GANf 2OX7A 2BIVA 4XU1A 2OTJQ 1E6HA 2LP5A 3G4SA 5GMKl 2KE9A 5FU7B 4M7AD 4M77D 4M7DG 2CH4A 4J6YA 1BB9A 2EIFA 2EBPA 2RQTA 4A4GA 2K5FA 2HBWA 1CSKA 1V29B 2RN8A 1K1ZA 1ZA1B 1AD5A 5D6XA 1QQJA 3EH1A 3EFOA 1QWFA 2JM8A 1Y57A 1QVFS 4HVVA 1SSHA 2KI7A 4FYXB 3S6WA 5CQYA 3BW1A 3CXCP 1VQ7A 2RF0A 8AT1B 4DBRA 3I5RA 5IXBA 4J9BA 3QBYA 3JAME 2COZA 2D1XA 4N4HA 1ZUUA 1G8XA 1NZ9A 3SHWA 1PRMC 1AZGB 3EHRA 2HAXA 2HL3A 2QQBA 1KK7A 3GNFB 4Q5WA 4PK4A 3QYGB 4C0DC 3PIOA 5GAOn 4D8KA 2DEQA 3UATA 3A5ZB 3EHQA 3VV0A 2AKLA 4BDZA 2FL7A 3QPHA 5FLXE 3C95A 4J9EA 2QA4T 4DEYA 3R6OA 2YUPA 1SRMA 3TCJA 3VRYA 4EIKA 4C92C 3JCMX 2DZCA 3CCJA 1PM3A 3VRZA 2QTXA 2LNHB 1ABQA 3H0IA 1ZSGA 1I0CA 4OP0A 3MEAA 3OYEA 1QLYA 2ED1A 5CQXA 3VS4A 1KFZA 2P0QA 3EGDA 3RERA 1QCNA 2X4YA 4IIOA 5C6SA 1YIJT 1VQ9T 2R5MA 2RHIA 5FU6B 4DBQA 2QQ9A 1UGRB 1NPPA 3I55Q 3JCMW 2CSQA 3M9QA 1ZUYA 2BUDA 5GJVB 1M30A 4XU2A 1QVFP 1SKUB 1D0ZA 1VYUA 1OX8A 1C0MA 3C94A 3SWNA 1QMCA 3Q1JA 4XTXA 2HKQB 1XJWB 2ZPIB 1UE9A 1YP5A 1IO6A 2DTOA 1MMAA 1VQPA 2O4XA 1G3SA 2I0NA 2XK0A 1M1GA 4M78F 3CMAT 2RK2A 2OAWA 2DL7A 4M7DB 5FU7C 3QHSA 1FMVA 2FZCB 3CC7T 2ESWA 4HKEA 4M78A 1W2BS 1Q81C 3ER0A 2K2MA 4FSXA 1H641 2P4RA 1OU9A 5GAOq 4RMOA 3FRNA 4IUTA 1YJNQ 2VYTA 1JU5C 3I5SA 5LJ5f 5FRMA 2DRMA 4HCZA 4E2FB 4ZTJA 2DBKA 2DO3A 3LWIA 2QEXA 5CVIA 1OYXA 3KUFA 3OS0A 1KG1A 4D8DA 1U8RA 4RKUE 4JS5A 4AFZC 2DF6A 4Y28E 2JXBA 4E6RA 5GANh 2ED0A 4ELYC 2LVMA 2RJCA 2VUBA 3V7RA 1VQKA 5FRNA 1YJ9A 3CCMA 1Y71A 2DX1A 3RIRA 1UJYA 3OBYA 1H3ZA 3BY7A 1YHQQ 1BYMA 1PSEA 3G4SQ 5GMKh 3CCLQ 2D0QB 1K9AA 1WJQA 1GFDA 5KYNA 4M78D 2X4JA 4J9IA 5AT1B 1M1KR 2DPPB 3VS0A 2XI9A 1Q86C 1Q7YR 3CBPA 2KDSA 2LQNA 3RMSA 2GTOA 2LJ1A 2LX7A 2FRYA 2QI2A 4VUBA 3HL8A 1QVGS 3CCQQ 1WQWA 1E7OA 3CXCA 1JJ2S 1XQHA 1WHMA 2J6KA 2RM4A 2VXFA 3V8KA 4L5GA 4N4IA 2DE0X 5GANd 3RBBB 5AYFA 1MMDA 4RTVA 1SHGA 1W2BP 2RB6A 2DIQA 3ME9A 3CCSA 5D6WA 2C0IA 2M1HA 4JRQA 1VQ5T 2CS7A 1UHCA 3HFNA 1B34A 2XDDA 3I56A 3JB9D 1I4K1 1UB4A 2NYSA 3G71A 1WXTA 1I1JA 3CCEA 5EC7A 4BI3A 1Q81U 5L8RE 3HKSA 1JEGA 4E7IA 1SPKA 1PKSA 3EGXB 1VQ6T 1QVPA 1K9MC 4MZMA 3ULRB 4JRKA 3C12A 1PC0A 2JM9A 4QVCA 3GPLA 1N6AA 4HVWA 2J6FA 1ZSZA 4BACA 4C8QF 1SRLA 3ZBDA 1TUCA 4JLGA 3OYGA 3X28B 2XD0A 1FWZA 3OYDA 3CCUT 2CUBA 2CP6A 4M75F 1VQ4T 3LWHA 2BKDN 5KYXA 2MYSA 4J9GA 4C5HA 2C0TA 4E7JA 1DJ7B 5GMKe 2W10A 1M27C 4C8QA 3CCJQ 1S72Q 3JCMd 1VQLT 3N5BB 2OJ2A 1GFCA 2JS0A 3CQTA 4M75A 2YUOA 4PLIA 1KJWA 3QIIA 3IQLA 3AT1B 5GAMf 4OB3B 4N0AC 2QTVA 1XNIA 2LNVA 2L3QA 1M1FA 4CRIA 5LJ3j 3HPWA 1SEMA 3HRUA 3QWYA 4FM4B 1K0SA 1QVFA 1BIBA 3QUIA 3QDRB 2X51A 1KQSS 1WLPB 2DAQA 2L3RA 1MHNA 2LQKA 3JSCA 1ZX6A 1QVGP 1JJ2P 2JN0A 4OB2B 3M57A 1D0XA 1PD0A 3JCMe 1YJWT 2DA9A 2PUKB 3EG1A 1Q86U 1KC8C 2EKHA 3QYHB 1WGSA 2AHJB 1Z9ZA 2YT6A 4JDSA 2LCLA 4JRPA 2KRMA 1VUBA 2O9SA 4LDYA 4V2SA 2FYKA 4UC4A 3CCVT 1UFFA 2K6DA 2DZ9A 3A8LB 3TVTA 2ZZDA 1NJIC 1GL5A 1BIAA 3GOXA 2LRQA 4C8QD 4JPBW 3M59A 4M75D 2EQKA 1QCOA 4BDYA 1K8AC 1OEBA 1QW1A 2QEXQ 1M3AA 4OMLA 3TQ7P 2HNIA 1B7TA 3P8BB 2L5QA 3QJ6A 1ZLMA 1OV3A 2LC4A 2QAZA 2O2OA 1BI0A 3M5AA 4C92F 1K9MU 2XU8A 3X20B 3VYGA 2MWOA 5GAN2 2QYZA 1VQKQ 1YJ9Q 3CCMQ 1M90C 4M7AG 2PVGB 4M77G 3CEYA 2M0OA 4M4ZA 2GF7A 2CP7A 3SD4A 2GBQA 4C92A 3PE0A 1D3BA 2F2WA 1Y07A 4F7UF 5HKCA 3TSWA 4ZN1A 2HSPA 4MMLA 3ZFJA 1JBMA 1UECA 1KQSP 2WSEE 2H3JA 1TU0B 1M2VB 1BCMA 2XMFA 1X01A 4AG1C 4F7UA 2DTIA 2GCXA 4PLLA 3RKYA 2O9VA 2FRWA 3OQ5A 2PVOB 1YWPA 3CC2T 1F1BB 1R8OB 2BZXA 3CMEQ 1JB0E 1NEGA 1JO8A 1PNJA 2CYZB 2CSIA 2KT1A 2F69A 1W6XA 2L0AA 4DBFA 1TUDA 1PWTA 4LDWA 3CBMA 2KMTA 3H41A 1D09B 5KCHA 4ESRA 4PJOE 2YHTA 3G6ET 1FXXA 3MHXA 2PVDB 3CCSQ 3BFMA 3NPFA 4O5VA 3P8HA 2HBPA 3UPUA 3VS6A 3I56Q 1GRIA 1NE8A 4RTYA 2F1LA 2KXCA 4E7KA 2D8HA 5HK3A 3V8JA 4QQDA 2JTFA 5HK0A 2A36A 3CCEQ 2FZGB 2GFUA 3FDRA 1N5ZA 2F2VA 1VIEA 1YBYA 4C92D 1NJIU 2KT8A 2NUPA 3PMIA 1RLPC 2K3YA 1VOMA 3A98A 3PNWC 1ZQ1A 2DK3A 1G3TA 5IHNA 2ZPHB 3PTAA 4JZ3A 3M58A 1YIJA 1VQ9A 3HFOA 4ORZA 5I11A 2YUQA 2QK0A 4LNPA 1NM7A 1K73R 1VA7A 1K8AU 5GAMh 3MCAB 3DKMA 4C5GA 1NLOC 4A4FA 3O5ZA 2KRNA 3GNGA 3KBGA 3H0HA 3NMZC 3OYKA 1GCPA 2ZPFB 3NTHA 3UA7A 4BE1A 4XTZA 4KUIA 3L2QA 2DL3A 2X4WA 2WSFE 2DJZA 3R6NA 4LDUA 5FWBA 1NPRA 3CMAA 2XDBA 1M90U 5KCOA 4ATOA 4X9CA 2L8DA 1PHTA 2FZKB 4FSSA 1AEYA 3CC7A 1QVGA 1BCOA 1Y0MA 2V1QA 5KE2A 1JJ2A 3CBOA 4OB1B 1I8FA 1YITQ 2P84A 1G3WA 5A2QE 4M7AB 2SEMA 5KYUB 4M77B 4B9XA 4FIBA 4HCKA 5DLQE 3GF5A 3MP8A 2E5QA 3MEWA 1EZZB 1N9SA 1OQKA 5D6YA 4GLMA 4J5YA 4ELZC 4NS5A 5GAMd 2DD4A 5LJ3e 1AWXA 2K5LA 3DB3A 1X6OA 2EKOA 1Q82C 4DEXA 2YRCA 5IT9E 2JMAA 3OSVA 3M0TA 2EGAA 2RQRA 2Y4YA 1H8KA 1HXDA 3A8OB 2JZ2A 2QQSA 1WQ7A 4IUUA 3DLLA 2OTLT 4DOVA 3HHTB 3S3MA 1Q95G 3OS2A 5CO7A 2KXDA 2OAUA 3M56A 2DL4A 3LGLA 4PJJA 1LJOA 4L59A 2RPNA 3JCMf 3JB9H 4NL3A 4BY6C 4A53A 5GAMe 1T3LA 3JCMP 3J7AF 5CK9A 2KSSA 2MMPA 3L42A 4FYVB 1YCSB 1G83A 2EYQA 4RTWA 2YSQA 3EG9B 4QQGA 4M7DE 1UTIA 1ZA2B 5J3BA 3LLRA 2YLBA 4AFUC 4JUVA 3QZ9B 3CPWS 4C0ZA 4M78G 5GANg 2QQRA 7AT1B 2RQUA 3VS2A 1GCQC 1LNXA 3EFOB 1KQSA 3OYBA 2V1RA 4FCYA 1OZ2A 3MP6A 5I2MA 2E5KA 1RI0A 1YJNT 2CREA 2NUTA 4C5EA 2R5AA 4N0AA 2JNGA 5KE3A 1HSQA 3MEVA 1KD1R 1VQ5A 3M0RA 4JJNK 3I9QA 4RTTA 4K11A 2A0FB 3RUXA 3HSBA 4OF1A 5KYWA 4PJOC 2IIMA 3SEMA 4RTUA 2FPFA 2VVKA 2G3RA 3JB9G 2MPXC 1VQ6A 2FEIA 2YUNA 2CUDA 2E6NA 1VQ8Q 1VQMT 4QVDA 1Y96A 2QQAA 5GAOr 4PJNA 4QKUA 2QA4Q 5IN1A 1I81A 3OYJA 1Q82U 2LT1A 3CCUA 3X26B 1VQ4A 5CKFA 1M8VA 4M77C 2AT1B 3H9NA 4JS4A 4PNOA 4Z02A 3CCLT 4BE0A 2L3SA 1UHFA 1VQLA 1EIFA 3M0PA 1BU1A 1MMGA 5A0GA 2DETA 2EYWA 1U3OA 2QDLA 4F16A 4J83A 4JJDA 4ZGEB 2YRVA 2EJ9A 1N9RA 3PVQA 1O9SA 1X75C 1VQ9Q 3CCQT 1ABOA 2V8KA 3GLXA 2HQXA 3EGDB 1IHVA
chains in the Genus database with same CATH topology
3HRSA 4LD6A 3I55T 4CRIA 5LJ3j 4XQ3A 3HPWA 3VJPA 3J80E 1K73C 2GFAA 3UWNA 3HRUA 3L2RA 4FM4B 2RI5A 2JVVA 4HT8A 1QVFA 1BIBA 2LX9A 4M7DF 4M7AF 3QUIA 3QDRB 4Y91A 4A4HA 1KQSS 3RKXA 2L3RA 2DAQA 2R57A 4BY6B 1MHNA 3TEEA 1U1TA 2C06A 2LQKA 4JRIA 5GMKi 1YJWA 3JSCA 4II1A 3DB4A 3VYHB 4EMHA 3M55A 3SWNB 4EMKB 4MMKA 5CKDA 2JN0A 4OB2B 5GMKj 3CXCS 2V8JA 2VGNA 3M57A 4HA8A 1VQ8A 5GAOm 2FVUA 4M7AA 4M7DA 1FX7A 2RHYA 2RK1A 2CKKA 4DA4A 3QJYA 4X9DA 2NLUA 2QA4A 1VQNA 2O4XB 2K4YA 1KHCA 4XU3A 3JCMe 3CCVA 4N4GA 5GAN3 3WVDB 4CI0C 1YJWT 3OYLA 2DTHA 5GAN5 3HRTA 4BUGA 2PUKB 1Q86U 5C0MA 1KC8C 1VQ8T 2RO0A 3QYHB 1WGSA 2AHJB 4OGCA 5LJ5j 4JDSA 4TVRA 2LCLA 3JCMc 4JRPA 1VUBA 2CGHA 1VQNT 2VC8A 3H6ZA 4LDYA 4V2SA 2FYKA 2I2LA 3ASKA 4RCCA 4UC4A 4EPCA 3CCVT 3OW2A 4M78B 4DOWA 1M9SA 2XDPA 3QO3A 4MDWA 3EAEA 3MO8A 2E65A 2DZ9A 2EQMA 2PUOB 3A8LB 2GQVA 2ZZDA 4KT0E 1NJIC 1P92A 1GXIE 4RG2A 1BIAA 3MP1A 2FB7A 1IZ6A 4XTWA 1QP3A 1S72A 4MZTA 3UDCA 3KXTA 3OB9A 3GOXA 4EDUA 1LOJA 3RMQA 2LRQA 4C8QD 2DXBA 2DKGA 4C8QG 3M59A 5CCAA 3S3NA 2X35A 1KHIA 4C8QC 5FU6C 4M75D 2EQKA 4XK8E 4ZTFA 3X24B 4XU0A 3JCMh 1IREB 4M75G 3QG1A 4A4EA 5I2SA 1S72T 1JRIA 1MGQA 4M75C 4BDYA 3FJPA 2EQJA 1K8AC 3H8ZA 3OYIA 4R56A 1QW1A 5LL6S 5LJ5g 3NTIA 2VXEA 3OY9A 3L2UA 3OMGA 2HNIA 2E41A 2V8IA 4PJOB 3P8BB 2A3LA 1BKBA 1HK9A 2F5KA 2L5QA 3QJ6A 4FT2A 4OVAA 2LC4A 5KH6A 2XIDA 3M4GA 2E1HA 3OYMA 1BI2A 1BI0A 1YHQA 2LTOA 2YLCA 5GANf 3OYFA 4EMKA 3M5AA 4C92F 2BIVA 4XU1A 4PL6A 3G4SA 1K9MU 2XU8A 4E7HA 3M54A 5LJ3f 3X20B 3UT1A 2DVEA 3VKIA 2F5TX 2MWOA 3VYGA 5GMKl 3OYNA 3JCMb 2VGMA 3QXEB 5FU7B 1VQKA 2M9UA 5GAN2 4M7DD 4M7AD 1KQ2A 2K57A 4M77D 1M90C 4M7AG 4M7DG 2PVGB 1G3YA 5FROA 3CPFA 4J6YA 4M77G 2EIFA 2M0OA 3CEYA 3JCMg 2GF7A 4A4GA 2K5FA 1YHQT 4M7DC 5HY6A 2D6FA 1V29B 3SD4A 3E9GA 4C92A 3G4ST 1D3BA 1Y07A 4F7UF 5D6XA 5HKCA 3T9NA 2IG0A 2M16A 3EFRA 3TREA 4ZN1A 2Y4XA 4MMLA 1M4ZA 2DXCA 4M78E 4R55A 3ZFJA 1QVFS 1JBMA 3CC2A 4EMGA 1G5VA 4ZGJB 2WSEE 4C0DB 2H3JA 2PU9B 2D9TA 2HQEA 3OMCA 1X01A 4WF2A 4BI8B 4F7UA 2DTIA 3OS5A 3S6WA 2GCXA 4PLLA 3RKYA 5CQYA 3BW1A 1YI2A 3OQ5A 2PVOB 4P5NA 2P4TA 4J6WA 3A8HB 1VQ7A 5M9OA 3CC2T 1R8OB 1M1KC 1JB0E 4QW2A 3L2VA 5LJ5e 1K73U 2IVWA 1WNLA 1OI1A 4XTVA 4LDVA 2KY9A 2CYZB 1UGQB 4OMFB 1YI2T 1XTDA 3QBYA 3JAME 3G6EA 2F69A 3LW5E 1VQ7T 4LDWA 4QQ6A 3CBMA 4XTYA 2KMTA 4N4HA 2DXUA 4OGEA 2E6ZA 3JCMV 4C0FA 3JB9F 1NZ9A 5EG2A 3J81E 3OYAA 5KCHA 4PJOE 2WACA 2HAXA 3QZ5B 3OW2S 2QQBA 2YHTA 2QDYB 3G6ET 3GNFB 1FXXA 1KD1C 2K5IA 2RA2A 3MHXA 4OB0B 2P0PA 4Q5WA 2PVDB 3QYGB 4C0DC 3PIOA 2DXTA 3BFMA 4O5VA 5GAOp 4J7IA 3VU3C 3P8HA 5GAOn 2JUFA 3SDZA 2DEQA 2HBPA 1YCYA 3UPUA 3BDUA 3A5ZB 4ZN3A 1NE8A 2RHZA 3VV0A 3LX7A 4EMKC 4E7KA 4BDZA 5HK3A 4KULA 4C0GA 3V8JA 2FL7A 4QQDA 2JTFA 4A4KA 5HK0A 2ZPBB 5GMKm 3QPHA 5FLXE 3C95A 3F70A 2GFUA 3FDRA 4FL6A 2QA4T 1Y96B 4J6XA 3R6OA 1VIEA 1YBYA 2L89A 4C92D 1NJIU 4BB7A 3PMIA 3TCJA 3FIFA 4C92G 2K3YA 4C92C 4HCBA 3QSUA 2EAYA 3PNWC 3JCMX 1ZQ1A 2DK3A 2LCCA 2PQWA 3RKWA 4BD3A 1G3TA 2DZCA 3CCJA 5DM7R 2ZPGB 2ZPHB 1WJRA 3PTAA 2QTXA 3A8MB 3M58A 1UGPB 1YIJA 1VQ9A 2CZ7B 3HFOA 4OP0A 3MEAA 3FB9A 2RJEA 4F7UG 3OYEA 3CMEA 3G7ZA 5CQXA 3QKJA 2P0QA 2EJFA 4X34A 1K8AU 5J39A 5GAMh 3MCAB 3PIPA 3DKMA 4O6JA 3CCJT 4C5GA 2KVQG 3RERA 3X25B 3CD6A 2QXFA 2X4YA 1RL2A 2HD0A 4A4FA 2X4XA 5C6SA 1YIJT 4C8QB 1VQ9T 2R5MA 2RHIA 5FU6B 2QQ9A 3GNGA 1UGRB 1NPPA 3KBGA 3CMET 3JCMW 2R58A 3M9QA 4M75B 2BUDA 3OYKA 2A7YA 2EFIA 2ZPFB 3NTHA 4XAXB 4BE1A 4XTZA 4GY5A 4XU2A 3CD6T 1BI1A 4KUIA 3L2QA 3CC4A 2O01E 2X4WA 3RESA 3OA6A 2WSFE 4IUQA 2DJZA 2E64A 3C94A 4LDUA 4RCBA 3SWNA 4MDXA 2E70A 1NPRA 4HCCA 3WVEB 3Q1JA 3CMAA 2XDBA 4XTXA 3WXMB 1M90U 2ZPIB 1O75A 5KCOA 4NOYA 2MAMA 4ATOA 2DTOA 4X9CA 2L8DA 1VQPA 2LT4A 3CC4T 3LYIA 2O4XA 1G3SA 4IKFA 3CC7A 5GAN6 2XK0A 1QVGA 5GAMg 1M1GA 3M4YA 5KE2A 4M78F 5GAOl 1JJ2A 3CBOA 4OB1B 3OS1A 2JOYA 4IUPA 1I8FA 2ZPEB 3CMAT 2RK2A 3PT9A 1G3WA 5A2QE 3OBWA 3FLGA 2RI2A 1VQPT 4M7AB 4M7DB 5FU7C 5CKHA 3NTKA 3QHSA 4M77B 4B9XA 3CC7T 2P0KA 3MEUA 4C5IA 5DY9A 4FIBA 4HKEA 5DLQE 2KQWA 3V8LA 1UGSB 3GF5A 3MP8A 4M78A 2E5QA 3MEWA 1W2BS 1Q81C 2E10A 1N9SA 5D6YA 4ZGDB 3ER0A 4J5YA 5GANe 4FSXA 4ELZC 1H641 2ZGWA 4NS5A 5GAMd 2KK4A 2DD4A 1VQOA 5GAOq 5LJ3e 2XICA 4RMOA 3FRNA 1BI3A 4IUTA 2K3XA 2K5LA 2VYTA 3DB3A 1X6OA 2EKOA 5LJ5f 1Q82C 5CAIA 3BDLA 5CK9A 2OTLA 2Y90A 1XOVA 3A8GB 5FRMA 5IT9E 4HCZA 2CZ1B 1W4SA 4ZTJA 1Q7YC 3META 1VQOT 3OSVA 4PJOF 2Y4YA 4LDXA 2DO3A 5GAN7 3LWIA 1HXDA 3A8OB 2MF2A 3LGFA 4C8QE 5A0LA 2RJFA 2JZ2A 1TH7A 2QQSA 1WQ7A 4IUUA 2QEXA 3DLLA 5CVIA 1OYXA 3KUFA 4DOVA 3OS0A 1U8RA 2OTLT 1KG1A 2EWNA 4RKUE 1W2BA 2CZ6B 4JS5A 4M75E 3HHTB 4BE2A 4Y28E 1KD1U 2EJGA 3S3MA 3OS2A 3CCRA 5CO7A 2OAUA 3M56A 3LGLA 3V7CA 3JB9I 4PJOA 3VUBA 1LJOA 4L59A 3JCMf 3JRZA 1N8RC 2QEXT 3JB9H 3S3OA 3C4SA 3P8DA 4NL3A 2OTJA 3PFSA 5GANh 4BY6C 4A53A 1KC8U 4ELYC 5GAMe 1B34B 1VIFA 3CCRT 2EQUA 1N27A 3JCMP 2LVMA 2RJCA 5LJ3h 1QP2A 2MWPA 2VUBA 3PGGA 4XTUA 2KSSA 3V7RA 2MMPA 2JTMA 4QVZA 3SWNC 3CCMA 1YJ9A 1Y71A 5FRNA 4M77F 2FHDA 3E1SA 3RIRA 5GAN4 3L42A 1YITA 2OTJT 3OBYA 1H3ZA 3BY7A 5CKEA 2EYQA 4DQ2A 4M7AE 4QQGA 2RHXA 4M7DE 3JCMQ 1BYMA 4M77E 1VQKT 1YJ9T 3SB2A 3CCMT 3J7AF 5J3BA 1PSEA 3LLRA 4M77A 5GMKh 1AHJB 4YTLA 2K2VA 2VV5A 2D0QB 1ZBXA 2MI6A 1WJQA 2YLBA 4JUVA 3EFSA 3JCMJ 1YITT 4HT9A 3QZ9B 3CPWS 4C0ZA 3VUZA 4M78D 4L6V5 4LD9K 2X4JA 4M78G 4C92B 1YJNA 1D3BB 2DPPB 5GANg 2QQRA 4M78C 4B9WA 2XI9A 1LNXA 1Q86C 5GAMj 1KQSA 4J7FA 3CBPA 2KDSA 3OYYA 5LJ3g 5LJ5h 5GAN8 3OYBA 3RMSA 5I21A 1OZ2A 4PKCC 3MP6A 2DIGA 2QI2A 4ME7A 4VUBA 3HL8A 5I2MA 1RI0A 1QVGS 4KUDK 1WQWA 1YJNT 3CXCA 1JJ2S 1XQHA 1M5Q1 3L1AA 4KBMB 2RD1A 4C5EA 4F7UB 2RM4A 2R5AA 4N0AA 2JNGA 1PSFA 4JLIA 5KE3A 5J26A 3OSSC 3MEVA 2VXFA 3V8KA 4L5GA 1UEBA 4N4IA 1VQ5A 3V7SA 5GANd 2RI3A 3NFCA 3CPWA 5AYFA 2XKOC 2ZCFB 4JJNK 5LJ3d 4FU6A 2RB6A 1WPYA 2RJDA 2DIQA 2LDMA 3ME9A 3RUXA 3CCSA 5D6WA 3HSBA 4OF1A 1OZ3A 4PJOD 2M1HA 4PJOG 4JRQA 1VQ5T 2CS7A 3HFNA 4PJOC 1VQMA 2B8AA 3O8VA 1B34A 2XDDA 3I56A 5CKBA 3PMTA 3JB9D 4NL2A 2DD5A 1I4K1 2G3RA 1UB4A 3JB9G 3CCST 2RH2A 3G71A 1VQ6A 3FC3A 1SSFA 3CCEA 3GP8A 2WSCE 2E6NA 4BI3A 3LH0A 1VQMT 1Q81U 5L8RE 3DLMA 4FT4A 4MZPA 4QVDA 3I56T 1Y96A 3HKSA 2QQAA 5GAOr 5CR2A 4A54A 2RHUA 4E7IA 5A0DA 3L2WA 3FEOA 3CCLA 3G71T 4GLKA 4IURA 5IN1A 5LJ5d 1I81A 1VQ6T 3AHUA 2XHCA 3OYJA 3CCET 1QVPA 1Q82U 1K9MC 2LT1A 3CCUA 4MZMA 3X26B 4JRKA 3JB9J 3C12A 1VQ4A 5CKFA 1M1KU 1M8VA 4C92E 4QVCA 4M77C 3GPLA 4E7LA 3E19A 1N6AA 4JS4A 2E12A 1I5LA 4PNOA 4Z02A 3CCLT 4C8QF 3ZBDA 4BACA 4BE0A 1Q7YU 2KAFA 3INZA 3M53A 4JLGA 5IAYA 3X28B 3OYGA 2XD0A 1VQLA 1WJSA 1FWZA 3OYDA 3CCUT 1EIFA 4M75F 3HP9A 1VQ4T 5A0GA 3URGA 2BKDN 3ZEHA 3LWHA 1Y7XA 2XG8D 3CCQA 5DLOA 4RG8A 4C5HA 1ZHIA 4E7JA 1KQ1A 4F7UE 1DJ7B 3E9FA 5GMKe 3GIBA 4J83A 4C8QA 4ZGEB 2YRVA 2EJ9A 3I55A 1N9RA 2CZ0B 3JCMd 4M7AC 1VQLT 5CIUA 3N5BB 1N8RU 1O9SA 1X75C 4PLIA 4M75A 2LQ8A 3TU4K 3OYHA 3CCQT 3QIIA 2V8KA 3SFMA 5GAMf 4OB3B 3GLXA 1U1SA 3L2ZA 4N0AC 2HQXA 4D6WA 4E47A 5GANj 4IUVA 1XNIA 4BI4A 2LNVA 3OYCA 4J8OA 1M1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKC A;  4MZT A;  4ELY C;  3HPW A;  3NFC A;  5CKH A;  5CK9 A;  2VUB A;  1NE8 A;  4MZP A;  2MF2 A;  5DLO A;  4HKE A;  5HK3 A;  5CCA A;  5CR2 A;  4MDX A;  2KMT A;  5HK0 A;  1VUB A;  4OF1 A;  3G7Z A;  5CQX A;  2C06 A;  3JSC A;  4ELZ C;  5CKE A;  5CQY A;  4MZM A;  5CO7 A;  1X75 C;  4ME7 A;  4VUB A;  5CKF A;  5CKD A;  3VUB A;  5CKB A;  3TCJ A;  3JRZ A;  1UB4 A;  1M1F A; 
#chains in the Genus database with same CATH topology
 4OMQ A;  3CPW P;  3J80 E;  1H92 A;  1RAG B;  2LX9 A;  3THK A;  2A28 A;  2C06 A;  4JRI A;  5GMK i;  1YJW A;  2KNB B;  3VYH B;  3M55 A;  3SWN B;  1PD1 A;  4EMK B;  4MMK A;  3MJX A;  5CKD A;  2V8J A;  4HA8 A;  4CC7 A;  2RMO A;  5GAO m;  2FVU A;  1C1A A;  3CMA Q;  1FX7 A;  1TUG B;  1K9M R;  4X9D A;  2YWW A;  2O4X B;  3CCV A;  4N4G A;  1AT1 B;  1I5O B;  3OYL A;  3EGX A;  3TSZ A;  4BUG A;  4F14 A;  1AZE A;  5LJ5 j;  1VQN T;  2VC8 A;  4M78 B;  1VYT A;  1M9S A;  3G1J A;  2EQM A;  2PUO B;  3MP1 A;  1IZ6 A;  3OB9 A;  1JQQ A;  1N8R R;  1VQ7 Q;  1YWO A;  4C8Q G;  5CCA A;  3S3N A;  2MOX A;  1NYF A;  5FU6 C;  1ZBJ A;  2PNI A;  2E3H A;  4XK8 E;  3PVL A;  3JCM h;  3X24 B;  1IRE B;  4M75 G;  2DRK A;  3QG1 A;  5I2S A;  1S72 T;  1JRI A;  1JXM A;  3FJP A;  4Y92 A;  2LCS A;  3H8Z A;  4R56 A;  5LJ5 g;  2VXE A;  2HDA A;  2DM1 A;  2V8I A;  1OPL A;  2A3L A;  2F5K A;  4OVA A;  4WTO B;  3EGU A;  3M4G A;  2E1H A;  1BI2 A;  1NEB A;  2X3X D;  3OYF A;  1HD3 A;  4PL6 A;  1WFW A;  4E7H A;  5LJ3 f;  3UT1 A;  2DVE A;  3VKI A;  1GBQ A;  3QXE B;  1V76 A;  2M9U A;  4AFQ C;  4JJB A;  2K57 A;  1RI9 A;  1G3Y A;  5FRO A;  4HXJ A;  4M7D C;  2D6F A;  1CKB A;  3E9G A;  2GQI A;  4JZ4 A;  3TRE A;  3I35 A;  1SF9 A;  1M4Z A;  2DXC A;  1NJI R;  4R55 A;  1RAB B;  3CC2 A;  4R0K A;  4EMG A;  4ZGJ B;  2Z0W A;  2EQI A;  2D9T A;  2HQE A;  3OS5 A;  3FJ5 A;  4P5N A;  2F2X A;  2P4T A;  4J6W A;  3A8H B;  5M9O A;  5GJW B;  1M1K C;  1WHG A;  4QW2 A;  2AKK A;  2SRC A;  3EG0 A;  1OI1 A;  4LDV A;  2KY9 A;  1UGQ B;  1PRL C;  1YI2 T;  2V26 A;  3G6E A;  3LW5 E;  5KYY A;  2CP5 A;  1I07 A;  4QQ6 A;  2BE9 B;  2E6Z A;  4C0F A;  5EG2 A;  5FWC A;  3J81 E;  1VQ5 Q;  3QZ5 B;  2CDT A;  2QDY B;  2K5I A;  2RA2 A;  2P0P A;  2DXT A;  4J7I A;  1M90 R;  3BDU A;  3QWX X;  1IGU A;  1VQP Q;  4LXC A;  2EYY A;  2JT4 A;  4EMK C;  4C0G A;  4A4K A;  1VQ6 Q;  5GMK m;  1TTH B;  1HJD A;  1WHH A;  4C92 G;  2DLP A;  2EAY A;  3RKW A;  3CCU Q;  3UA6 A;  1VQ4 Q;  1WJR A;  8ATC B;  1R77 A;  1ZSZ B;  1UGP B;  1K76 A;  2CZ7 B;  2RJE A;  4F7U G;  1VQL Q;  2CT3 A;  2EJF A;  1AWJ A;  3PIP A;  1LCK A;  1K0X A;  1WA7 A;  3X25 B;  1FMK A;  2QXF A;  1RL2 A;  2AZV A;  4C8Q B;  1NG2 A;  3CME T;  4M75 B;  2A7Y A;  2EFI A;  5ECA A;  3CD6 T;  3RES A;  2FO0 A;  4IUQ A;  4RCB A;  2E70 A;  1HYO A;  2CH4 W;  1RUW A;  1O75 A;  3CC4 T;  3LYI A;  5GAN 6;  4E7Z A;  5GAM g;  5GAO l;  3M4Y A;  1G2B A;  2H8H A;  2JOY A;  4KGX B;  1YJW Q;  3PT9 A;  1VYV A;  4E7S A;  5CKH A;  3NTK A;  1EX4 A;  3MEU A;  4C5I A;  3V8L A;  1D0Y A;  1GCQ A;  2AK5 A;  4ZGD B;  3CCV Q;  1FYN A;  3NGP A;  2BZY A;  1RAH B;  2KK4 A;  1BBZ A;  4OMM A;  4KH0 B;  5IHK A;  3U23 A;  5CAI A;  2OTL A;  2Y90 A;  1XOV A;  1LVK A;  2CZ1 B;  1VQO T;  4PJO F;  1ARK A;  2MF2 A;  3LGF A;  3NHN A;  5A0L A;  1TH7 A;  4OMO A;  1W2B A;  1CKA A;  2LJ3 A;  4BE2 A;  4RTZ A;  1RAF B;  2RQW A;  4LUD A;  3V7C A;  3JB9 I;  4PJO A;  2JS2 A;  3JRZ A;  3S3O A;  4HVU A;  3C4S A;  3PFS A;  2E3I A;  1KC8 U;  1EFN A;  1VIF A;  3CCR T;  1ACM B;  2EQU A;  1N27 A;  4C0D B;  5LJ3 h;  1QP2 A;  2MWP A;  3PGG A;  2M51 A;  2JTM A;  4QVZ A;  4M77 F;  2FHD A;  1T3S A;  2ABL A;  3G71 Q;  2QGG A;  2OTJ T;  2EPD A;  5CKE A;  4DQ2 A;  4F17 A;  4M7A E;  3JCM Q;  4M77 E;  1QWE A;  4M77 A;  1LPL A;  2K2V A;  3EG2 A;  3JCM J;  2MI6 A;  1YIT T;  3EFS A;  1Z9Q A;  4HT9 A;  2EGC A;  1OU8 A;  2JW4 A;  1J3T A;  3VUZ A;  4L6V 5;  4C92 B;  1YJN A;  1D3B B;  2MIO A;  1UGV A;  4J7F A;  5GAN 8;  1WIE A;  5I21 A;  1WHK A;  4PKC C;  2DIG A;  4ME7 A;  3CC2 Q;  4KUD K;  2J6O A;  1M5Q 1;  3L1A A;  4KBM B;  4F7U B;  1X27 A;  2A37 A;  1PSF A;  4PFO A;  2VKN A;  3OSS C;  2DMO A;  3RNJ A;  3VS3 A;  2KYB A;  2XKO C;  2ZCF B;  5LJ3 d;  4FU6 A;  3M0U A;  2LDM A;  1FMW A;  2BZ8 A;  1OZ3 A;  4PJO D;  4FYW B;  1KIK A;  1WYX A;  1VQM A;  1RAA B;  2G6F X;  2YRD A;  5CKB A;  3PMT A;  2DD5 A;  1OX9 A;  2DIL A;  2QGF B;  1IRX A;  3LH0 A;  1B07 A;  4FT4 A;  2J7I A;  4MZP A;  3EG9 A;  5CR2 A;  4A54 A;  4QT7 A;  3CCL A;  5A0D A;  1IHW A;  3FEO A;  1X6B A;  2DNU A;  1TG0 A;  4E7L A;  3E19 A;  1RAI B;  1U06 A;  3MKD A;  2KAF A;  2DEU A;  2NUP B;  1WJS A;  1QCF A;  2KRS A;  2AZS A;  3HP9 A;  4B6M A;  1B3Q A;  2OI3 A;  1Y7X A;  2XG8 D;  3CCQ A;  1QKX A;  1KQ1 A;  4PJL A;  3GIB A;  4J9D A;  2CZ0 B;  4FW2 A;  2LQ8 A;  3TU4 K;  3OYH A;  3GBQ A;  3EG3 A;  1U1S A;  2JJ9 A;  2K7A A;  4D6W A;  5GAN j;  4BI4 A;  3OYC A;  3KFV A;  4J8O A;  2EYX A;  1BK2 A;  3HRS A;  4LD6 A;  2EVR A;  3I55 T;  4XQ3 A;  3VJP A;  1K73 C;  2DER A;  2GFA A;  3UWN A;  2RI5 A;  2JVV A;  2DYB A;  4HT8 A;  4M7D F;  4Y91 A;  4A4H A;  1PKT A;  2R57 A;  3REB B;  1U1T A;  3TEE A;  2ECZ A;  4EMH A;  3DB4 A;  2DL8 A;  4J9H A;  5GMK j;  2KR3 A;  1Q81 R;  2VGN A;  4M7D A;  2RHY A;  2RK1 A;  2FPE A;  2CKK A;  2FPD A;  2ZAE A;  2NLU A;  1VQN A;  1OPK A;  1WX6 A;  2K4Y A;  4XU3 A;  2J05 A;  4GBQ A;  3WVD B;  3BE3 A;  4LN2 A;  2DTH A;  2HCK A;  1VQ8 T;  2RO0 A;  2DYI A;  3JCM c;  1UDL A;  1NYG A;  2CGH A;  1W1F A;  3H6Z A;  2I2L A;  4EPC A;  1UJ0 A;  2B86 A;  3QO3 A;  2HKN A;  1M8M A;  1YN8 A;  2CP2 A;  4RG2 A;  2FB7 A;  1RAE B;  1S72 A;  3UDC A;  1U5S A;  2K79 A;  1T0J A;  4EDU A;  1H3H A;  2DXB A;  2DKG A;  2ROL A;  2OTL Q;  2X35 A;  1KHI A;  2E4H A;  4ZTF A;  3E2U A;  2GTJ A;  4CC2 A;  4A4E A;  2W0Z A;  4DBH A;  2LQW A;  1C6V X;  3L2U A;  3OMG A;  1WZO A;  2E41 A;  1ZUK A;  1BKB A;  5KH6 A;  2DFU A;  1SG5 A;  4FT2 A;  2VB6 A;  2XID A;  1MND A;  3OYM A;  2YLC A;  4EMK A;  1R0C B;  2ENM A;  3JV3 A;  4AFS C;  3M54 A;  1GBR A;  2F5T X;  3OYN A;  3JCM b;  2VGM A;  4M7D D;  1KQ2 A;  1UG1 A;  1Q86 R;  1OOT A;  3CPF A;  4M7A C;  3JCM g;  4Z89 A;  2FG0 A;  1YHQ T;  5HY6 A;  2HQH A;  3G4S T;  5FW9 A;  2LMJ A;  2D8J A;  2COW A;  3T9N A;  2IG0 A;  2M16 A;  3EFR A;  2Y4X A;  4M78 E;  1MV3 A;  2LZ6 B;  2K9G A;  1G5V A;  2PU9 B;  2HL5 C;  2NUZ A;  3OMC A;  4WF2 A;  1TSF A;  4BI8 B;  2JMC A;  1YI2 A;  1YIJ Q;  1W70 A;  1D1B A;  3L2V A;  1K73 U;  1WDX A;  1PG5 B;  2IVW A;  2O88 A;  1A0N B;  1WNL A;  4XTV A;  2C0O A;  2NUT B;  4OMF B;  1XTD A;  1VQ7 T;  2M02 A;  4Z88 A;  4XTY A;  1E6G A;  2DXU A;  4OGE A;  3JCM V;  3JB9 F;  4LE9 A;  3OYA A;  2WAC A;  1R0B G;  3OW2 S;  3VS5 A;  2KRO A;  1KD1 C;  4OB0 B;  1M3B A;  1AOJ A;  5GAO p;  3VU3 C;  4PFZ A;  2JUF A;  5KYW B;  3SDZ A;  1MMN A;  2VWF A;  1YCY A;  1VQM Q;  4ZN3 A;  3CC7 Q;  2RHZ A;  3LX7 A;  4KUL A;  4CC4 B;  1KSW A;  2ZPB B;  3F70 A;  4RTX A;  4FL6 A;  1Y96 B;  4J6X A;  2GGR A;  2L89 A;  2RNA A;  4BB7 A;  4ANJ A;  1MNE A;  3FIF A;  3C0C A;  4HCB A;  3QSU A;  2KBT A;  2LCC A;  2CT4 A;  3D7S B;  2PQW A;  4BD3 A;  5DM7 R;  2ZPG B;  2HEQ A;  3A8M B;  2KGT A;  1WI7 A;  3FB9 A;  4RUG A;  3CME A;  3G7Z A;  3QKJ A;  4X34 A;  5J39 A;  3CCJ T;  4O6J A;  2KVQ G;  3CD6 A;  2HD0 A;  2X4X A;  1MV0 B;  4CC3 A;  2R58 A;  3UF4 A;  4XAX B;  1AWO A;  4GY5 A;  1T0H A;  1BI1 A;  2BTT A;  3CC4 A;  1IXD A;  2O01 E;  3OA6 A;  1RAC B;  3M0Q A;  1QKW A;  2E64 A;  1K4U S;  4MDX A;  4HCC A;  3WVE B;  1PCX A;  3WXM B;  1KC8 R;  4NOY A;  2MAM A;  4LUE A;  2LT4 A;  4KH1 B;  4PJM A;  3VS1 A;  4IKF A;  3EH2 A;  3OS1 A;  4IUP A;  1JXO A;  2ZPE B;  3RR6 A;  3OBW A;  2QG9 B;  3FLG A;  2EW3 A;  2RI2 A;  1VQP T;  2X3W D;  4A63 B;  2AIR B;  1NLP C;  2P0K A;  5DY9 A;  2YDL A;  2KQW A;  1UGS B;  1VQN Q;  1YFN A;  2E10 A;  4WCI A;  5GAN e;  3OW2 P;  2O31 A;  4FW1 A;  1AVZ C;  2ZGW A;  1VQO A;  2XIC A;  1BI3 A;  2K3X A;  1IGQ A;  3BDL A;  2J06 A;  3A8G B;  2EYZ A;  1K8A R;  1W4S A;  1Q7Y C;  3MET A;  4LDX A;  5GAN 7;  4C8Q E;  2RJF A;  2ROT A;  4J9C A;  2EWN A;  3VS7 A;  2CZ6 B;  2L2P A;  4M75 E;  1KD1 U;  2EJG A;  3CCR A;  2KEA A;  3VUB A;  4F04 B;  1N8R C;  2QEX T;  4OMP A;  2VAS A;  2OTJ A;  2PZ1 A;  1B34 B;  2CP3 A;  4AG2 C;  1IB8 A;  4XTU A;  4FYY B;  3SWN C;  1M2O A;  3E1S A;  3A1P A;  1WHL A;  5GAN 4;  1YIT A;  2X9H A;  1X6G A;  2BE7 D;  2RHX A;  2YXY A;  1NBE B;  1VQK T;  1YJ9 T;  3SB2 A;  3CCM T;  1AHJ B;  4YTL A;  2VV5 A;  1ZBX A;  2IPO B;  4KRT A;  1M2V A;  4LD9 K;  4M78 C;  4B9W A;  2DBM A;  5GAM j;  5LJ3 g;  5LJ5 h;  3OYY A;  1WXU A;  5I22 A;  5KYX B;  3MPU B;  2MK5 A;  2RD1 A;  2JTE A;  1TOV A;  4JLI A;  5J26 A;  1YI2 Q;  1UEB A;  3V7S A;  2RI3 A;  3NFC A;  3CPW A;  1WPY A;  2RJD A;  1SHF A;  2H3E B;  5KYY B;  4PJO G;  1TS9 A;  2B8A A;  3O8V A;  5IHI A;  4NL2 A;  2DL5 A;  4J9F A;  3CCS T;  2RH2 A;  1V1C A;  3FC3 A;  1SSF A;  1X2Q A;  2DJQ A;  2PTK A;  3GP8 A;  2ATC B;  2WSC E;  3DLM A;  3I56 T;  3REA B;  2RHU A;  3L2W A;  3G71 T;  4GLK A;  4IUR A;  5LJ5 d;  3AHU A;  2XHC A;  3CCE T;  5L23 A;  3JB9 J;  1M1K U;  4C92 E;  2GNC A;  1S1N A;  2E12 A;  2HSE B;  4PFP A;  1I5L A;  1Q7Y U;  3M53 A;  3INZ A;  5IAY A;  3RDV A;  5IXF A;  3URG A;  3ZEH A;  5DLO A;  4RG8 A;  1ZHI A;  5HCK A;  4F7U E;  2A08 A;  4Z8A A;  3E9F A;  1MUZ A;  2MCN A;  3I55 A;  2COY A;  3M0S A;  5CIU A;  1N8R U;  2D0N A;  3SFM A;  4E47 A;  3L2Z A;  4IUV A;  3P8D A;  5LJ5 e;  1X43 A;  3CD6 Q;  5IH2 A;  2DVJ A;  3L2R A;  1YNZ A;  9ATC B;  4M7A F;  1X69 A;  3RKX A;  4BY6 B;  2HMA A;  2M0Y A;  1M3C A;  4II1 A;  3CC4 Q;  1D1A A;  4AT1 B;  1VQ8 A;  3CXC S;  2LJ0 A;  4M7A A;  1RAD B;  4DA4 A;  5KYU A;  3H0F A;  3QJY A;  2QA4 A;  2CP0 A;  1KHC A;  2K3B A;  5GAN 3;  4CI0 C;  5GAN 5;  3HRT A;  1Q82 R;  5C0M A;  4IIM A;  3HTR A;  4OGC A;  4TVR A;  4AMC A;  1WXB A;  2L3P A;  1UUE A;  1WHJ A;  3ASK A;  4RCC A;  3OW2 A;  1OUL A;  2EGE A;  4DOW A;  4JJC A;  2XDP A;  4KGZ B;  4MDW A;  3EAE A;  3MO8 A;  1ZSZ C;  2E65 A;  3QDF A;  2RQV A;  2GQV A;  4KT0 E;  4X1V A;  2NWM A;  1P92 A;  1GXI E;  4KGV B;  4XTW A;  1QP3 A;  4MZT A;  3KXT A;  1VQO Q;  1LOJ A;  3RMQ A;  4OMN A;  3LH5 A;  1D1C A;  4C8Q C;  4ZNX A;  2KYM A;  4XU0 A;  1MGQ A;  4M75 C;  1RLQ C;  2EQJ A;  3G6E Q;  1TXQ A;  3OYI A;  5LL6 S;  2QAS A;  3ZL7 C;  3NTI A;  3OY9 A;  1TWB A;  4PJO B;  2HZY A;  3CCR Q;  1HK9 A;  1X2K A;  5D7U A;  6AT1 B;  1AWW A;  1YHQ A;  2LTO A;  5GAN f;  2OX7 A;  2BIV A;  4XU1 A;  2OTJ Q;  1E6H A;  2LP5 A;  3G4S A;  5GMK l;  2KE9 A;  5FU7 B;  4M7A D;  4M77 D;  4M7D G;  2CH4 A;  4J6Y A;  1BB9 A;  2EIF A;  2EBP A;  2RQT A;  4A4G A;  2K5F A;  2HBW A;  1CSK A;  1V29 B;  2RN8 A;  1K1Z A;  1ZA1 B;  1AD5 A;  5D6X A;  1QQJ A;  3EH1 A;  3EFO A;  1QWF A;  2JM8 A;  1Y57 A;  1QVF S;  4HVV A;  1SSH A;  2KI7 A;  4FYX B;  3S6W A;  5CQY A;  3BW1 A;  3CXC P;  1VQ7 A;  2RF0 A;  8AT1 B;  4DBR A;  3I5R A;  5IXB A;  4J9B A;  3QBY A;  3JAM E;  2COZ A;  2D1X A;  4N4H A;  1ZUU A;  1G8X A;  1NZ9 A;  3SHW A;  1PRM C;  1AZG B;  3EHR A;  2HAX A;  2HL3 A;  2QQB A;  1KK7 A;  3GNF B;  4Q5W A;  4PK4 A;  3QYG B;  4C0D C;  3PIO A;  5GAO n;  4D8K A;  2DEQ A;  3UAT A;  3A5Z B;  3EHQ A;  3VV0 A;  2AKL A;  4BDZ A;  2FL7 A;  3QPH A;  5FLX E;  3C95 A;  4J9E A;  2QA4 T;  4DEY A;  3R6O A;  2YUP A;  1SRM A;  3TCJ A;  3VRY A;  4EIK A;  4C92 C;  3JCM X;  2DZC A;  3CCJ A;  1PM3 A;  3VRZ A;  2QTX A;  2LNH B;  1ABQ A;  3H0I A;  1ZSG A;  1I0C A;  4OP0 A;  3MEA A;  3OYE A;  1QLY A;  2ED1 A;  5CQX A;  3VS4 A;  1KFZ A;  2P0Q A;  3EGD A;  3RER A;  1QCN A;  2X4Y A;  4IIO A;  5C6S A;  1YIJ T;  1VQ9 T;  2R5M A;  2RHI A;  5FU6 B;  4DBQ A;  2QQ9 A;  1UGR B;  1NPP A;  3I55 Q;  3JCM W;  2CSQ A;  3M9Q A;  1ZUY A;  2BUD A;  5GJV B;  1M30 A;  4XU2 A;  1QVF P;  1SKU B;  1D0Z A;  1VYU A;  1OX8 A;  1C0M A;  3C94 A;  3SWN A;  1QMC A;  3Q1J A;  4XTX A;  2HKQ B;  1XJW B;  2ZPI B;  1UE9 A;  1YP5 A;  1IO6 A;  2DTO A;  1MMA A;  1VQP A;  2O4X A;  1G3S A;  2I0N A;  2XK0 A;  1M1G A;  4M78 F;  3CMA T;  2RK2 A;  2OAW A;  2DL7 A;  4M7D B;  5FU7 C;  3QHS A;  1FMV A;  2FZC B;  3CC7 T;  2ESW A;  4HKE A;  4M78 A;  1W2B S;  1Q81 C;  3ER0 A;  2K2M A;  4FSX A;  1H64 1;  2P4R A;  1OU9 A;  5GAO q;  4RMO A;  3FRN A;  4IUT A;  1YJN Q;  2VYT A;  1JU5 C;  3I5S A;  5LJ5 f;  5FRM A;  2DRM A;  4HCZ A;  4E2F B;  4ZTJ A;  2DBK A;  2DO3 A;  3LWI A;  2QEX A;  5CVI A;  1OYX A;  3KUF A;  3OS0 A;  1KG1 A;  4D8D A;  1U8R A;  4RKU E;  4JS5 A;  4AFZ C;  2DF6 A;  4Y28 E;  2JXB A;  4E6R A;  5GAN h;  2ED0 A;  4ELY C;  2LVM A;  2RJC A;  2VUB A;  3V7R A;  1VQK A;  5FRN A;  1YJ9 A;  3CCM A;  1Y71 A;  2DX1 A;  3RIR A;  1UJY A;  3OBY A;  1H3Z A;  3BY7 A;  1YHQ Q;  1BYM A;  1PSE A;  3G4S Q;  5GMK h;  3CCL Q;  2D0Q B;  1K9A A;  1WJQ A;  1GFD A;  5KYN A;  4M78 D;  2X4J A;  4J9I A;  5AT1 B;  1M1K R;  2DPP B;  3VS0 A;  2XI9 A;  1Q86 C;  1Q7Y R;  3CBP A;  2KDS A;  2LQN A;  3RMS A;  2GTO A;  2LJ1 A;  2LX7 A;  2FRY A;  2QI2 A;  4VUB A;  3HL8 A;  1QVG S;  3CCQ Q;  1WQW A;  1E7O A;  3CXC A;  1JJ2 S;  1XQH A;  1WHM A;  2J6K A;  2RM4 A;  2VXF A;  3V8K A;  4L5G A;  4N4I A;  2DE0 X;  5GAN d;  3RBB B;  5AYF A;  1MMD A;  4RTV A;  1SHG A;  1W2B P;  2RB6 A;  2DIQ A;  3ME9 A;  3CCS A;  5D6W A;  2C0I A;  2M1H A;  4JRQ A;  1VQ5 T;  2CS7 A;  1UHC A;  3HFN A;  1B34 A;  2XDD A;  3I56 A;  3JB9 D;  1I4K 1;  1UB4 A;  2NYS A;  3G71 A;  1WXT A;  1I1J A;  3CCE A;  5EC7 A;  4BI3 A;  1Q81 U;  5L8R E;  3HKS A;  1JEG A;  4E7I A;  1SPK A;  1PKS A;  3EGX B;  1VQ6 T;  1QVP A;  1K9M C;  4MZM A;  3ULR B;  4JRK A;  3C12 A;  1PC0 A;  2JM9 A;  4QVC A;  3GPL A;  1N6A A;  4HVW A;  2J6F A;  1ZSZ A;  4BAC A;  4C8Q F;  1SRL A;  3ZBD A;  1TUC A;  4JLG A;  3OYG A;  3X28 B;  2XD0 A;  1FWZ A;  3OYD A;  3CCU T;  2CUB A;  2CP6 A;  4M75 F;  1VQ4 T;  3LWH A;  2BKD N;  5KYX A;  2MYS A;  4J9G A;  4C5H A;  2C0T A;  4E7J A;  1DJ7 B;  5GMK e;  2W10 A;  1M27 C;  4C8Q A;  3CCJ Q;  1S72 Q;  3JCM d;  1VQL T;  3N5B B;  2OJ2 A;  1GFC A;  2JS0 A;  3CQT A;  4M75 A;  2YUO A;  4PLI A;  1KJW A;  3QII A;  3IQL A;  3AT1 B;  5GAM f;  4OB3 B;  4N0A C;  2QTV A;  1XNI A;  2LNV A;  2L3Q A;  1M1F A;  4CRI A;  5LJ3 j;  3HPW A;  1SEM A;  3HRU A;  3QWY A;  4FM4 B;  1K0S A;  1QVF A;  1BIB A;  3QUI A;  3QDR B;  2X51 A;  1KQS S;  1WLP B;  2DAQ A;  2L3R A;  1MHN A;  2LQK A;  3JSC A;  1ZX6 A;  1QVG P;  1JJ2 P;  2JN0 A;  4OB2 B;  3M57 A;  1D0X A;  1PD0 A;  3JCM e;  1YJW T;  2DA9 A;  2PUK B;  3EG1 A;  1Q86 U;  1KC8 C;  2EKH A;  3QYH B;  1WGS A;  2AHJ B;  1Z9Z A;  2YT6 A;  4JDS A;  2LCL A;  4JRP A;  2KRM A;  1VUB A;  2O9S A;  4LDY A;  4V2S A;  2FYK A;  4UC4 A;  3CCV T;  1UFF A;  2K6D A;  2DZ9 A;  3A8L B;  3TVT A;  2ZZD A;  1NJI C;  1GL5 A;  1BIA A;  3GOX A;  2LRQ A;  4C8Q D;  4JPB W;  3M59 A;  4M75 D;  2EQK A;  1QCO A;  4BDY A;  1K8A C;  1OEB A;  1QW1 A;  2QEX Q;  1M3A A;  4OML A;  3TQ7 P;  2HNI A;  1B7T A;  3P8B B;  2L5Q A;  3QJ6 A;  1ZLM A;  1OV3 A;  2LC4 A;  2QAZ A;  2O2O A;  1BI0 A;  3M5A A;  4C92 F;  1K9M U;  2XU8 A;  3X20 B;  3VYG A;  2MWO A;  5GAN 2;  2QYZ A;  1VQK Q;  1YJ9 Q;  3CCM Q;  1M90 C;  4M7A G;  2PVG B;  4M77 G;  3CEY A;  2M0O A;  4M4Z A;  2GF7 A;  2CP7 A;  3SD4 A;  2GBQ A;  4C92 A;  3PE0 A;  1D3B A;  2F2W A;  1Y07 A;  4F7U F;  5HKC A;  3TSW A;  4ZN1 A;  2HSP A;  4MML A;  3ZFJ A;  1JBM A;  1UEC A;  1KQS P;  2WSE E;  2H3J A;  1TU0 B;  1M2V B;  1BCM A;  2XMF A;  1X01 A;  4AG1 C;  4F7U A;  2DTI A;  2GCX A;  4PLL A;  3RKY A;  2O9V A;  2FRW A;  3OQ5 A;  2PVO B;  1YWP A;  3CC2 T;  1F1B B;  1R8O B;  2BZX A;  3CME Q;  1JB0 E;  1NEG A;  1JO8 A;  1PNJ A;  2CYZ B;  2CSI A;  2KT1 A;  2F69 A;  1W6X A;  2L0A A;  4DBF A;  1TUD A;  1PWT A;  4LDW A;  3CBM A;  2KMT A;  3H41 A;  1D09 B;  5KCH A;  4ESR A;  4PJO E;  2YHT A;  3G6E T;  1FXX A;  3MHX A;  2PVD B;  3CCS Q;  3BFM A;  3NPF A;  4O5V A;  3P8H A;  2HBP A;  3UPU A;  3VS6 A;  3I56 Q;  1GRI A;  1NE8 A;  4RTY A;  2F1L A;  2KXC A;  4E7K A;  2D8H A;  5HK3 A;  3V8J A;  4QQD A;  2JTF A;  5HK0 A;  2A36 A;  3CCE Q;  2FZG B;  2GFU A;  3FDR A;  1N5Z A;  2F2V A;  1VIE A;  1YBY A;  4C92 D;  1NJI U;  2KT8 A;  2NUP A;  3PMI A;  1RLP C;  2K3Y A;  1VOM A;  3A98 A;  3PNW C;  1ZQ1 A;  2DK3 A;  1G3T A;  5IHN A;  2ZPH B;  3PTA A;  4JZ3 A;  3M58 A;  1YIJ A;  1VQ9 A;  3HFO A;  4ORZ A;  5I11 A;  2YUQ A;  2QK0 A;  4LNP A;  1NM7 A;  1K73 R;  1VA7 A;  1K8A U;  5GAM h;  3MCA B;  3DKM A;  4C5G A;  1NLO C;  4A4F A;  3O5Z A;  2KRN A;  3GNG A;  3KBG A;  3H0H A;  3NMZ C;  3OYK A;  1GCP A;  2ZPF B;  3NTH A;  3UA7 A;  4BE1 A;  4XTZ A;  4KUI A;  3L2Q A;  2DL3 A;  2X4W A;  2WSF E;  2DJZ A;  3R6N A;  4LDU A;  5FWB A;  1NPR A;  3CMA A;  2XDB A;  1M90 U;  5KCO A;  4ATO A;  4X9C A;  2L8D A;  1PHT A;  2FZK B;  4FSS A;  1AEY A;  3CC7 A;  1QVG A;  1BCO A;  1Y0M A;  2V1Q A;  5KE2 A;  1JJ2 A;  3CBO A;  4OB1 B;  1I8F A;  1YIT Q;  2P84 A;  1G3W A;  5A2Q E;  4M7A B;  2SEM A;  5KYU B;  4M77 B;  4B9X A;  4FIB A;  4HCK A;  5DLQ E;  3GF5 A;  3MP8 A;  2E5Q A;  3MEW A;  1EZZ B;  1N9S A;  1OQK A;  5D6Y A;  4GLM A;  4J5Y A;  4ELZ C;  4NS5 A;  5GAM d;  2DD4 A;  5LJ3 e;  1AWX A;  2K5L A;  3DB3 A;  1X6O A;  2EKO A;  1Q82 C;  4DEX A;  2YRC A;  5IT9 E;  2JMA A;  3OSV A;  3M0T A;  2EGA A;  2RQR A;  2Y4Y A;  1H8K A;  1HXD A;  3A8O B;  2JZ2 A;  2QQS A;  1WQ7 A;  4IUU A;  3DLL A;  2OTL T;  4DOV A;  3HHT B;  3S3M A;  1Q95 G;  3OS2 A;  5CO7 A;  2KXD A;  2OAU A;  3M56 A;  2DL4 A;  3LGL A;  4PJJ A;  1LJO A;  4L59 A;  2RPN A;  3JCM f;  3JB9 H;  4NL3 A;  4BY6 C;  4A53 A;  5GAM e;  1T3L A;  3JCM P;  3J7A F;  5CK9 A;  2KSS A;  2MMP A;  3L42 A;  4FYV B;  1YCS B;  1G83 A;  2EYQ A;  4RTW A;  2YSQ A;  3EG9 B;  4QQG A;  4M7D E;  1UTI A;  1ZA2 B;  5J3B A;  3LLR A;  2YLB A;  4AFU C;  4JUV A;  3QZ9 B;  3CPW S;  4C0Z A;  4M78 G;  5GAN g;  2QQR A;  7AT1 B;  2RQU A;  3VS2 A;  1GCQ C;  1LNX A;  3EFO B;  1KQS A;  3OYB A;  2V1R A;  4FCY A;  1OZ2 A;  3MP6 A;  5I2M A;  2E5K A;  1RI0 A;  1YJN T;  2CRE A;  2NUT A;  4C5E A;  2R5A A;  4N0A A;  2JNG A;  5KE3 A;  1HSQ A;  3MEV A;  1KD1 R;  1VQ5 A;  3M0R A;  4JJN K;  3I9Q A;  4RTT A;  4K11 A;  2A0F B;  3RUX A;  3HSB A;  4OF1 A;  5KYW A;  4PJO C;  2IIM A;  3SEM A;  4RTU A;  2FPF A;  2VVK A;  2G3R A;  3JB9 G;  2MPX C;  1VQ6 A;  2FEI A;  2YUN A;  2CUD A;  2E6N A;  1VQ8 Q;  1VQM T;  4QVD A;  1Y96 A;  2QQA A;  5GAO r;  4PJN A;  4QKU A;  2QA4 Q;  5IN1 A;  1I81 A;  3OYJ A;  1Q82 U;  2LT1 A;  3CCU A;  3X26 B;  1VQ4 A;  5CKF A;  1M8V A;  4M77 C;  2AT1 B;  3H9N A;  4JS4 A;  4PNO A;  4Z02 A;  3CCL T;  4BE0 A;  2L3S A;  1UHF A;  1VQL A;  1EIF A;  3M0P A;  1BU1 A;  1MMG A;  5A0G A;  2DET A;  2EYW A;  1U3O A;  2QDL A;  4F16 A;  4J83 A;  4JJD A;  4ZGE B;  2YRV A;  2EJ9 A;  1N9R A;  3PVQ A;  1O9S A;  1X75 C;  1VQ9 Q;  3CCQ T;  1ABO A;  2V8K A;  3GLX A;  2HQX A;  3EGD B;  1IHV A; 
#chains in the Genus database with same CATH homology
 3HRS A;  4LD6 A;  3I55 T;  4CRI A;  5LJ3 j;  4XQ3 A;  3HPW A;  3VJP A;  3J80 E;  1K73 C;  2GFA A;  3UWN A;  3HRU A;  3L2R A;  4FM4 B;  2RI5 A;  2JVV A;  4HT8 A;  1QVF A;  1BIB A;  2LX9 A;  4M7D F;  4M7A F;  3QUI A;  3QDR B;  4Y91 A;  4A4H A;  1KQS S;  3RKX A;  2L3R A;  2DAQ A;  2R57 A;  4BY6 B;  1MHN A;  3TEE A;  1U1T A;  2C06 A;  2LQK A;  4JRI A;  5GMK i;  1YJW A;  3JSC A;  4II1 A;  3DB4 A;  3VYH B;  4EMH A;  3M55 A;  3SWN B;  4EMK B;  4MMK A;  5CKD A;  2JN0 A;  4OB2 B;  5GMK j;  3CXC S;  2V8J A;  2VGN A;  3M57 A;  4HA8 A;  1VQ8 A;  5GAO m;  2FVU A;  4M7A A;  4M7D A;  1FX7 A;  2RHY A;  2RK1 A;  2CKK A;  4DA4 A;  3QJY A;  4X9D A;  2NLU A;  2QA4 A;  1VQN A;  2O4X B;  2K4Y A;  1KHC A;  4XU3 A;  3JCM e;  3CCV A;  4N4G A;  5GAN 3;  3WVD B;  4CI0 C;  1YJW T;  3OYL A;  2DTH A;  5GAN 5;  3HRT A;  4BUG A;  2PUK B;  1Q86 U;  5C0M A;  1KC8 C;  1VQ8 T;  2RO0 A;  3QYH B;  1WGS A;  2AHJ B;  4OGC A;  5LJ5 j;  4JDS A;  4TVR A;  2LCL A;  3JCM c;  4JRP A;  1VUB A;  2CGH A;  1VQN T;  2VC8 A;  3H6Z A;  4LDY A;  4V2S A;  2FYK A;  2I2L A;  3ASK A;  4RCC A;  4UC4 A;  4EPC A;  3CCV T;  3OW2 A;  4M78 B;  4DOW A;  1M9S A;  2XDP A;  3QO3 A;  4MDW A;  3EAE A;  3MO8 A;  2E65 A;  2DZ9 A;  2EQM A;  2PUO B;  3A8L B;  2GQV A;  2ZZD A;  4KT0 E;  1NJI C;  1P92 A;  1GXI E;  4RG2 A;  1BIA A;  3MP1 A;  2FB7 A;  1IZ6 A;  4XTW A;  1QP3 A;  1S72 A;  4MZT A;  3UDC A;  3KXT A;  3OB9 A;  3GOX A;  4EDU A;  1LOJ A;  3RMQ A;  2LRQ A;  4C8Q D;  2DXB A;  2DKG A;  4C8Q G;  3M59 A;  5CCA A;  3S3N A;  2X35 A;  1KHI A;  4C8Q C;  5FU6 C;  4M75 D;  2EQK A;  4XK8 E;  4ZTF A;  3X24 B;  4XU0 A;  3JCM h;  1IRE B;  4M75 G;  3QG1 A;  4A4E A;  5I2S A;  1S72 T;  1JRI A;  1MGQ A;  4M75 C;  4BDY A;  3FJP A;  2EQJ A;  1K8A C;  3H8Z A;  3OYI A;  4R56 A;  1QW1 A;  5LL6 S;  5LJ5 g;  3NTI A;  2VXE A;  3OY9 A;  3L2U A;  3OMG A;  2HNI A;  2E41 A;  2V8I A;  4PJO B;  3P8B B;  2A3L A;  1BKB A;  1HK9 A;  2F5K A;  2L5Q A;  3QJ6 A;  4FT2 A;  4OVA A;  2LC4 A;  5KH6 A;  2XID A;  3M4G A;  2E1H A;  3OYM A;  1BI2 A;  1BI0 A;  1YHQ A;  2LTO A;  2YLC A;  5GAN f;  3OYF A;  4EMK A;  3M5A A;  4C92 F;  2BIV A;  4XU1 A;  4PL6 A;  3G4S A;  1K9M U;  2XU8 A;  4E7H A;  3M54 A;  5LJ3 f;  3X20 B;  3UT1 A;  2DVE A;  3VKI A;  2F5T X;  2MWO A;  3VYG A;  5GMK l;  3OYN A;  3JCM b;  2VGM A;  3QXE B;  5FU7 B;  1VQK A;  2M9U A;  5GAN 2;  4M7D D;  4M7A D;  1KQ2 A;  2K57 A;  4M77 D;  1M90 C;  4M7A G;  4M7D G;  2PVG B;  1G3Y A;  5FRO A;  3CPF A;  4J6Y A;  4M77 G;  2EIF A;  2M0O A;  3CEY A;  3JCM g;  2GF7 A;  4A4G A;  2K5F A;  1YHQ T;  4M7D C;  5HY6 A;  2D6F A;  1V29 B;  3SD4 A;  3E9G A;  4C92 A;  3G4S T;  1D3B A;  1Y07 A;  4F7U F;  5D6X A;  5HKC A;  3T9N A;  2IG0 A;  2M16 A;  3EFR A;  3TRE A;  4ZN1 A;  2Y4X A;  4MML A;  1M4Z A;  2DXC A;  4M78 E;  4R55 A;  3ZFJ A;  1QVF S;  1JBM A;  3CC2 A;  4EMG A;  1G5V A;  4ZGJ B;  2WSE E;  4C0D B;  2H3J A;  2PU9 B;  2D9T A;  2HQE A;  3OMC A;  1X01 A;  4WF2 A;  4BI8 B;  4F7U A;  2DTI A;  3OS5 A;  3S6W A;  2GCX A;  4PLL A;  3RKY A;  5CQY A;  3BW1 A;  1YI2 A;  3OQ5 A;  2PVO B;  4P5N A;  2P4T A;  4J6W A;  3A8H B;  1VQ7 A;  5M9O A;  3CC2 T;  1R8O B;  1M1K C;  1JB0 E;  4QW2 A;  3L2V A;  5LJ5 e;  1K73 U;  2IVW A;  1WNL A;  1OI1 A;  4XTV A;  4LDV A;  2KY9 A;  2CYZ B;  1UGQ B;  4OMF B;  1YI2 T;  1XTD A;  3QBY A;  3JAM E;  3G6E A;  2F69 A;  3LW5 E;  1VQ7 T;  4LDW A;  4QQ6 A;  3CBM A;  4XTY A;  2KMT A;  4N4H A;  2DXU A;  4OGE A;  2E6Z A;  3JCM V;  4C0F A;  3JB9 F;  1NZ9 A;  5EG2 A;  3J81 E;  3OYA A;  5KCH A;  4PJO E;  2WAC A;  2HAX A;  3QZ5 B;  3OW2 S;  2QQB A;  2YHT A;  2QDY B;  3G6E T;  3GNF B;  1FXX A;  1KD1 C;  2K5I A;  2RA2 A;  3MHX A;  4OB0 B;  2P0P A;  4Q5W A;  2PVD B;  3QYG B;  4C0D C;  3PIO A;  2DXT A;  3BFM A;  4O5V A;  5GAO p;  4J7I A;  3VU3 C;  3P8H A;  5GAO n;  2JUF A;  3SDZ A;  2DEQ A;  2HBP A;  1YCY A;  3UPU A;  3BDU A;  3A5Z B;  4ZN3 A;  1NE8 A;  2RHZ A;  3VV0 A;  3LX7 A;  4EMK C;  4E7K A;  4BDZ A;  5HK3 A;  4KUL A;  4C0G A;  3V8J A;  2FL7 A;  4QQD A;  2JTF A;  4A4K A;  5HK0 A;  2ZPB B;  5GMK m;  3QPH A;  5FLX E;  3C95 A;  3F70 A;  2GFU A;  3FDR A;  4FL6 A;  2QA4 T;  1Y96 B;  4J6X A;  3R6O A;  1VIE A;  1YBY A;  2L89 A;  4C92 D;  1NJI U;  4BB7 A;  3PMI A;  3TCJ A;  3FIF A;  4C92 G;  2K3Y A;  4C92 C;  4HCB A;  3QSU A;  2EAY A;  3PNW C;  3JCM X;  1ZQ1 A;  2DK3 A;  2LCC A;  2PQW A;  3RKW A;  4BD3 A;  1G3T A;  2DZC A;  3CCJ A;  5DM7 R;  2ZPG B;  2ZPH B;  1WJR A;  3PTA A;  2QTX A;  3A8M B;  3M58 A;  1UGP B;  1YIJ A;  1VQ9 A;  2CZ7 B;  3HFO A;  4OP0 A;  3MEA A;  3FB9 A;  2RJE A;  4F7U G;  3OYE A;  3CME A;  3G7Z A;  5CQX A;  3QKJ A;  2P0Q A;  2EJF A;  4X34 A;  1K8A U;  5J39 A;  5GAM h;  3MCA B;  3PIP A;  3DKM A;  4O6J A;  3CCJ T;  4C5G A;  2KVQ G;  3RER A;  3X25 B;  3CD6 A;  2QXF A;  2X4Y A;  1RL2 A;  2HD0 A;  4A4F A;  2X4X A;  5C6S A;  1YIJ T;  4C8Q B;  1VQ9 T;  2R5M A;  2RHI A;  5FU6 B;  2QQ9 A;  3GNG A;  1UGR B;  1NPP A;  3KBG A;  3CME T;  3JCM W;  2R58 A;  3M9Q A;  4M75 B;  2BUD A;  3OYK A;  2A7Y A;  2EFI A;  2ZPF B;  3NTH A;  4XAX B;  4BE1 A;  4XTZ A;  4GY5 A;  4XU2 A;  3CD6 T;  1BI1 A;  4KUI A;  3L2Q A;  3CC4 A;  2O01 E;  2X4W A;  3RES A;  3OA6 A;  2WSF E;  4IUQ A;  2DJZ A;  2E64 A;  3C94 A;  4LDU A;  4RCB A;  3SWN A;  4MDX A;  2E70 A;  1NPR A;  4HCC A;  3WVE B;  3Q1J A;  3CMA A;  2XDB A;  4XTX A;  3WXM B;  1M90 U;  2ZPI B;  1O75 A;  5KCO A;  4NOY A;  2MAM A;  4ATO A;  2DTO A;  4X9C A;  2L8D A;  1VQP A;  2LT4 A;  3CC4 T;  3LYI A;  2O4X A;  1G3S A;  4IKF A;  3CC7 A;  5GAN 6;  2XK0 A;  1QVG A;  5GAM g;  1M1G A;  3M4Y A;  5KE2 A;  4M78 F;  5GAO l;  1JJ2 A;  3CBO A;  4OB1 B;  3OS1 A;  2JOY A;  4IUP A;  1I8F A;  2ZPE B;  3CMA T;  2RK2 A;  3PT9 A;  1G3W A;  5A2Q E;  3OBW A;  3FLG A;  2RI2 A;  1VQP T;  4M7A B;  4M7D B;  5FU7 C;  5CKH A;  3NTK A;  3QHS A;  4M77 B;  4B9X A;  3CC7 T;  2P0K A;  3MEU A;  4C5I A;  5DY9 A;  4FIB A;  4HKE A;  5DLQ E;  2KQW A;  3V8L A;  1UGS B;  3GF5 A;  3MP8 A;  4M78 A;  2E5Q A;  3MEW A;  1W2B S;  1Q81 C;  2E10 A;  1N9S A;  5D6Y A;  4ZGD B;  3ER0 A;  4J5Y A;  5GAN e;  4FSX A;  4ELZ C;  1H64 1;  2ZGW A;  4NS5 A;  5GAM d;  2KK4 A;  2DD4 A;  1VQO A;  5GAO q;  5LJ3 e;  2XIC A;  4RMO A;  3FRN A;  1BI3 A;  4IUT A;  2K3X A;  2K5L A;  2VYT A;  3DB3 A;  1X6O A;  2EKO A;  5LJ5 f;  1Q82 C;  5CAI A;  3BDL A;  5CK9 A;  2OTL A;  2Y90 A;  1XOV A;  3A8G B;  5FRM A;  5IT9 E;  4HCZ A;  2CZ1 B;  1W4S A;  4ZTJ A;  1Q7Y C;  3MET A;  1VQO T;  3OSV A;  4PJO F;  2Y4Y A;  4LDX A;  2DO3 A;  5GAN 7;  3LWI A;  1HXD A;  3A8O B;  2MF2 A;  3LGF A;  4C8Q E;  5A0L A;  2RJF A;  2JZ2 A;  1TH7 A;  2QQS A;  1WQ7 A;  4IUU A;  2QEX A;  3DLL A;  5CVI A;  1OYX A;  3KUF A;  4DOV A;  3OS0 A;  1U8R A;  2OTL T;  1KG1 A;  2EWN A;  4RKU E;  1W2B A;  2CZ6 B;  4JS5 A;  4M75 E;  3HHT B;  4BE2 A;  4Y28 E;  1KD1 U;  2EJG A;  3S3M A;  3OS2 A;  3CCR A;  5CO7 A;  2OAU A;  3M56 A;  3LGL A;  3V7C A;  3JB9 I;  4PJO A;  3VUB A;  1LJO A;  4L59 A;  3JCM f;  3JRZ A;  1N8R C;  2QEX T;  3JB9 H;  3S3O A;  3C4S A;  3P8D A;  4NL3 A;  2OTJ A;  3PFS A;  5GAN h;  4BY6 C;  4A53 A;  1KC8 U;  4ELY C;  5GAM e;  1B34 B;  1VIF A;  3CCR T;  2EQU A;  1N27 A;  3JCM P;  2LVM A;  2RJC A;  5LJ3 h;  1QP2 A;  2MWP A;  2VUB A;  3PGG A;  4XTU A;  2KSS A;  3V7R A;  2MMP A;  2JTM A;  4QVZ A;  3SWN C;  3CCM A;  1YJ9 A;  1Y71 A;  5FRN A;  4M77 F;  2FHD A;  3E1S A;  3RIR A;  5GAN 4;  3L42 A;  1YIT A;  2OTJ T;  3OBY A;  1H3Z A;  3BY7 A;  5CKE A;  2EYQ A;  4DQ2 A;  4M7A E;  4QQG A;  2RHX A;  4M7D E;  3JCM Q;  1BYM A;  4M77 E;  1VQK T;  1YJ9 T;  3SB2 A;  3CCM T;  3J7A F;  5J3B A;  1PSE A;  3LLR A;  4M77 A;  5GMK h;  1AHJ B;  4YTL A;  2K2V A;  2VV5 A;  2D0Q B;  1ZBX A;  2MI6 A;  1WJQ A;  2YLB A;  4JUV A;  3EFS A;  3JCM J;  1YIT T;  4HT9 A;  3QZ9 B;  3CPW S;  4C0Z A;  3VUZ A;  4M78 D;  4L6V 5;  4LD9 K;  2X4J A;  4M78 G;  4C92 B;  1YJN A;  1D3B B;  2DPP B;  5GAN g;  2QQR A;  4M78 C;  4B9W A;  2XI9 A;  1LNX A;  1Q86 C;  5GAM j;  1KQS A;  4J7F A;  3CBP A;  2KDS A;  3OYY A;  5LJ3 g;  5LJ5 h;  5GAN 8;  3OYB A;  3RMS A;  5I21 A;  1OZ2 A;  4PKC C;  3MP6 A;  2DIG A;  2QI2 A;  4ME7 A;  4VUB A;  3HL8 A;  5I2M A;  1RI0 A;  1QVG S;  4KUD K;  1WQW A;  1YJN T;  3CXC A;  1JJ2 S;  1XQH A;  1M5Q 1;  3L1A A;  4KBM B;  2RD1 A;  4C5E A;  4F7U B;  2RM4 A;  2R5A A;  4N0A A;  2JNG A;  1PSF A;  4JLI A;  5KE3 A;  5J26 A;  3OSS C;  3MEV A;  2VXF A;  3V8K A;  4L5G A;  1UEB A;  4N4I A;  1VQ5 A;  3V7S A;  5GAN d;  2RI3 A;  3NFC A;  3CPW A;  5AYF A;  2XKO C;  2ZCF B;  4JJN K;  5LJ3 d;  4FU6 A;  2RB6 A;  1WPY A;  2RJD A;  2DIQ A;  2LDM A;  3ME9 A;  3RUX A;  3CCS A;  5D6W A;  3HSB A;  4OF1 A;  1OZ3 A;  4PJO D;  2M1H A;  4PJO G;  4JRQ A;  1VQ5 T;  2CS7 A;  3HFN A;  4PJO C;  1VQM A;  2B8A A;  3O8V A;  1B34 A;  2XDD A;  3I56 A;  5CKB A;  3PMT A;  3JB9 D;  4NL2 A;  2DD5 A;  1I4K 1;  2G3R A;  1UB4 A;  3JB9 G;  3CCS T;  2RH2 A;  3G71 A;  1VQ6 A;  3FC3 A;  1SSF A;  3CCE A;  3GP8 A;  2WSC E;  2E6N A;  4BI3 A;  3LH0 A;  1VQM T;  1Q81 U;  5L8R E;  3DLM A;  4FT4 A;  4MZP A;  4QVD A;  3I56 T;  1Y96 A;  3HKS A;  2QQA A;  5GAO r;  5CR2 A;  4A54 A;  2RHU A;  4E7I A;  5A0D A;  3L2W A;  3FEO A;  3CCL A;  3G71 T;  4GLK A;  4IUR A;  5IN1 A;  5LJ5 d;  1I81 A;  1VQ6 T;  3AHU A;  2XHC A;  3OYJ A;  3CCE T;  1QVP A;  1Q82 U;  1K9M C;  2LT1 A;  3CCU A;  4MZM A;  3X26 B;  4JRK A;  3JB9 J;  3C12 A;  1VQ4 A;  5CKF A;  1M1K U;  1M8V A;  4C92 E;  4QVC A;  4M77 C;  3GPL A;  4E7L A;  3E19 A;  1N6A A;  4JS4 A;  2E12 A;  1I5L A;  4PNO A;  4Z02 A;  3CCL T;  4C8Q F;  3ZBD A;  4BAC A;  4BE0 A;  1Q7Y U;  2KAF A;  3INZ A;  3M53 A;  4JLG A;  5IAY A;  3X28 B;  3OYG A;  2XD0 A;  1VQL A;  1WJS A;  1FWZ A;  3OYD A;  3CCU T;  1EIF A;  4M75 F;  3HP9 A;  1VQ4 T;  5A0G A;  3URG A;  2BKD N;  3ZEH A;  3LWH A;  1Y7X A;  2XG8 D;  3CCQ A;  5DLO A;  4RG8 A;  4C5H A;  1ZHI A;  4E7J A;  1KQ1 A;  4F7U E;  1DJ7 B;  3E9F A;  5GMK e;  3GIB A;  4J83 A;  4C8Q A;  4ZGE B;  2YRV A;  2EJ9 A;  3I55 A;  1N9R A;  2CZ0 B;  3JCM d;  4M7A C;  1VQL T;  5CIU A;  3N5B B;  1N8R U;  1O9S A;  1X75 C;  4PLI A;  4M75 A;  2LQ8 A;  3TU4 K;  3OYH A;  3CCQ T;  3QII A;  2V8K A;  3SFM A;  5GAM f;  4OB3 B;  3GLX A;  1U1S A;  3L2Z A;  4N0A C;  2HQX A;  4D6W A;  4E47 A;  5GAN j;  4IUV A;  1XNI A;  4BI4 A;  2LNV A;  3OYC A;  4J8O A;  1M1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...