3JSCA

Ccdbvfi-formi-ph7.0
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
96
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and thermodynamic characterization of vibrio fischeri CCDB
pubmed doi rcsb
source organism Vibrio fischeri
molecule tags Toxin
molecule keywords CcdB
total genus 26
structure length 96
sequence length 104
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jscA00
4VUBA 5CCAA 5CO7A 4MZTA 3VUBA 4MZPA 5CQYA 2KMTA 2VUBA 5HK0A 3JRZA 3TCJA 4ELZC 3HPWA 3NFCA 2MF2A 4ME7A 4OF1A 5HK3A 5CKDA 1NE8A 5DLOA 4MZMA 4MDXA 5CKBA 5CK9A 1M1FA 5CKHA 4ELYC 5HKCA 1UB4A 3JSCA 5CR2A 2C06A 1VUBA 1X75C 5CKEA 4HKEA 5CQXA 5CKFA 3G7ZA
chains in the Genus database with same CATH superfamily
1BI2A 3OBWA 2AK5A 2E12A 5A2QE 2L5QA 2XDPA 4RTTA 4IIOA 4E7HA 1VQ4A 5GAOr 4FSXA 2VXFA 2ZPGB 5FRNA 3G71T 1U06A 3FDRA 4JZ4A 1UGPB 1FMVA 1QVPA 2DD4A 2OAUA 3UPUA 4XTVA 3RESA 2EKHA 2VC8A 4C92A 1I07A 1WYXA 4B9XA 4CC3A 4O5VA 1BI3A 4PJOA 1G3SA 1IHWA 1T3LA 2V1QA 1K73C 2AKKA 1UHFA 2AIRB 2E10A 3M0QA 1AHJB 2RD1A 3RMQA 2QQSA 3UATA 1TUCA 1LVKA 4TVRA 4LN2A 1MHNA 1N9SA 1M2VB 5KYWA 1VQ7A 2ZAEA 4LXCA 3FB9A 1K1ZA 5FLXE 2KGTA 3M5AA 3PTAA 2JTMA 2QQBA 1JB0E 1M1KU 3G4SQ 3CD6Q 2OTJA 4WF2A 3X20B 3CCLT 2FPDA 2MPXC 5FW9A 2SEMA 2J06A 1VYVA 1JU5C 2I0NA 2XG8D 2KAFA 1WDXA 4RCCA 4BD3A 1Q82C 1VQKQ 2ABLA 3I56T 5GANh 2KR3A 1VQKT 1M3CA 4M7DC 4QKUA 2BZYA 4FU6A 3A8GB 3M0TA 2VWFA 4PJOC 4C8QG 1UGQB 2O9SA 2OTJT 3EAEA 3A8LB 3JAME 5GAN5 2XU8A 5C6SA 3L2VA 2JNGA 3E19A 1UHCA 4XQ3A 3HFNA 5CO7A 3EHRA 2CUDA 3OYBA 1AWJA 2PNIA 4KGXB 1YWOA 4M7AG 1Y07A 2E65A 4JLGA 1VQ5T 3C95A 1YJ9A 1JBMA 2CZ6B 2LJ3A 3UF4A 3R6NA 1ZUUA 2FRYA 2JOYA 4OMMA 5KYYB 2LJ1A 1GCQA 4DA4A 4ZGDB 4LD9K 1KQSS 3GIBA 2BE7D 1IXDA 5I22A 2PU9B 1WPYA 3VS7A 3CC4T 1OU8A 5GAMd 3RMSA 4LDWA 3G71A 4BUGA 1RABB 2E1HA 1D1CA 2RK2A 1UJYA 1VQ9T 5KH6A 4E7SA 4C8QD 2O9VA 3QWXX 4GBQA 3KXTA 3JCMe 2KK4A 4E2FB 3CCSA 1VQMA 2DM1A 2MAMA 2RN8A 2E6ZA 3CCJQ 2ED1A 4LE9A 1ZX6A 1M30A 3A98A 3G6EQ 2R5AA 4IUPA 5CK9A 3TEEA 2AT1B 2J7IA 2FZGB 1U8RA 3M57A 5KYXB 4EMKB 3M53A 4JS4A 2E70A 1K0XA 5LJ3e 2CUBA 3V8LA 1GFDA 4FT4A 2D1XA 3RBBB 5A0LA 5L8RE 3QJYA 1S72T 1QW1A 1IGQA 3EGUA 2C0OA 2EGCA 4E7IA 1HD3A 4KH1B 4GY5A 3RKYA 1XNIA 5CKEA 1RAAB 5KYNA 2W0ZA 2CZ7B 3OYGA 2XD0A 1FMWA 3RKXA 3ME9A 2DRKA 1Y0MA 4N4HA 2NUTA 2JT4A 3A8HB 1TU0B 3C0CA 4M78B 1MNDA 1M8VA 5KE2A 1GCPA 4PKCC 4ZGJB 3LYIA 1VQOQ 1JXOA 3JCMX 2EFIA 2RI3A 2JUFA 2DNUA 1VQ5A 1MV3A 4M7DG 1M2OA 1K76A 2LC4A 2CSQA 4PJOG 5LJ5f 3LH5A 4LD6A 4N0AC 2LNHB 4C92G 2OI3A 1VOMA 2PQWA 2KEAA 3ASKA 4E7LA 2HQXA 2IVWA 1VQOA 5GAOn 1RUWA 1PRLC 4OMPA 2GTOA 3OS5A 4EIKA 1BB9A 1YJNA 4HT8A 1ARKA 3PFSA 2A37A 2A08A 2HL5C 1YITQ 1IREB 1G83A 3CC7T 3EH1A 1M90U 2WACA 2DVJA 2QK0A 5LJ3g 5GMKi 3SWNB 1OEBA 3OQ5A 1UGVA 2DE0X 5LJ5e 1M90R 4KGZB 1PCXA 4PLLA 4XTWA 3SWNA 1Y96B 3J7AF 3MEAA 3VS4A 1BIBA 4A4KA 2L2PA 4EMKC 2B8AA 1U1TA 4JJBA 2CSIA 2FG0A 2RHYA 4HT9A 2JS0A 2GNCA 4YTLA 1NZ9A 2QDLA 4FT2A 2R57A 3OSSC 2D0NA 1ZSZC 2RH2A 4C5HA 4QVDA 2DJQA 2OX7A 4F7UA 3JCMQ 3QYHB 3PNWC 3RUXA 3OW2S 1RAIB 1WHMA 5HY6A 3FJ5A 2KXCA 5GAN8 1B7TA 1KHIA 1S72A 3G71Q 3ER0A 1VQLQ 2E5KA 1VQ8T 2MF2A 1C0MA 2DFUA 3CC2Q 1KJWA 4M78C 1C6VX 3OYEA 4CC2A 3LH0A 2NUTB 2K2MA 3JB9J 2V8KA 2VKNA 5GANf 1WXUA 3HRSA 3NTKA 2XICA 1LOJA 3CCJA 5GAMf 2K57A 5LL6S 2FPFA 2K3XA 3EH2A 4L59A 1NEGA 3LX7A 3EFSA 1A0NB 3QZ5B 1VQ6T 1QVGS 1XJWB 2EJGA 2A3LA 1WJSA 1Z9ZA 3OYLA 2RO0A 1YI2A 4PNOA 3KFVA 1NPPA 2ROLA 3CEYA 4WTOB 1BIAA 5LJ5j 4BE0A 2KDSA 4C92E 2DJZA 3J80E 2L3RA 4E7ZA 1NLOC 2XIDA 1AEYA 4AFQC 2CGHA 2IPOB 2D8JA 4F17A 2E6NA 4OMQA 5FWBA 2CT3A 2PVDB 1G3YA 3HP9A 1H92A 4Z02A 1VUBA 4C8QA 4IUTA 1N5ZA 3G4ST 4C92C 2D6FA 2C0TA 2OTJQ 2M0OA 4JJNK 1G2BA 2QAZA 4Z8AA 3X24B 4CI0C 4FYWB 1C1AA 2DF6A 3FRNA 3OYJA 2JM9A 2DZ9A 1ZA1B 1NYFA 1YN8A 1PM3A 1FMKA 4HVVA 4M77E 4KUDK 4HVWA 4PFOA 3PIPA 4KT0E 1YIJQ 8AT1B 3WVEB 4FW1A 1JJ2S 1QP3A 2ZPEB 2YHTA 4PFZA 2RM4A 2KXDA 4A4GA 3O5ZA 4MZMA 2DIGA 1GL5A 1ZSGA 2XI9A 4M75C 5GANe 4XU3A 4BDYA 3JCMP 1OQKA 3JB9G 1Q82U 1IB8A 2DERA 2K5IA 2M0YA 4C8QF 2FYKA 4J9DA 2A36A 1LCKA 3A8MB 2V26A 1NM7A 1K73R 1ZSZA 3KUFA 3IQLA 1TTHB 1ABQA 4E47A 1B3QA 4OMFB 3A1PA 2V1RA 4AFSC 1VYUA 1PG5B 2RJEA 2QA4T 2HMAA 3JCMg 3QIIA 2FEIA 4M78E 4DQ2A 2C06A 3LWIA 2YXYA 3QWYA 2RQTA 1WJRA 3EGDA 1X01A 1RL2A 3OS2A 2ZGWA 5CIUA 2EYXA 3OMGA 4A53A 2V8IA 1SPKA 2XDDA 1G3WA 2F2VA 1YHQQ 2RK1A 2NWMA 1QLYA 1YJ9Q 2RQWA 4EMHA 1GBQA 1CKAA 2YT6A 1M3BA 5A0DA 4HCBA 5CQXA 1M8MA 1M9SA 3VJPA 3EFRA 2DKGA 1AZGB 1VQLA 1W1FA 1WHGA 4OB0B 1H641 5GAMe 1M2VA 5KYWB 1YI2Q 4F7UF 4F16A 3G6EA 3VKIA 4BB7A 5C0MA 1KQ1A 1N6AA 1UECA 3JB9F 1SRLA 3EGXB 2J6FA 3A5ZB 2CP5A 2E41A 2ENMA 3EGXA 4BI8B 4M7AF 3M55A 2DTOA 4C5EA 1JQQA 1NJIC 2CREA 3HKSA 2KMTA 2K5LA 4C0ZA 3I55Q 3MJXA 3CCRT 2BZ8A 2KI7A 1BU1A 3M0PA 4AG1C 1YFNA 2GBQA 3L2WA 5DY9A 4II1A 3P8HA 1PKSA 4ANJA 1VQNA 5GMKm 3CBOA 1M27C 2QG9B 2K7AA 2JTFA 3L2ZA 2CZ1B 1VIEA 4LDUA 3CCQT 2EGEA 2CKKA 1LNXA 3EG1A 2LQWA 2PUOB 2JMCA 3J81E 1QVGA 2ECZA 3VRYA 1YCSB 1I81A 1OX9A 3P8DA 3E9GA 1SKUB 3L1AA 1X2KA 4J9IA 4J9FA 5J39A 1BBZA 2QDYB 2COWA 1VQPA 1YJWA 4BY6C 1BI1A 4RUGA 2FHDA 2RHXA 4DBRA 4ELYC 4RTUA 1K9MC 1PHTA 1U1SA 5LJ5d 2GCXA 4Y91A 1OZ3A 3GP8A 3OB9A 1VQPQ 1AVZC 5GJVB 3QKJA 1WHKA 5IXFA 3CCEQ 3V8JA 2P0QA 3CCMT 3M54A 2K2VA 3AT1B 3VYGA 2EIFA 1Q7YR 3DLLA 4CC4B 3QHSA 3KBGA 1D0YA 2J6KA 3U23A 2JMAA 5CKFA 4ORZA 3JCMV 4VUBA 3RKWA 4M75E 3VYHB 3FIFA 5IH2A 1WQWA 4A54A 1M90C 2YUNA 2PUKB 3M0RA 1K8AR 4OB2B 3GNFB 2AKLA 1B34B 1OU9A 1MMGA 4XTUA 2QGGA 2L3PA 4RTZA 1NJIU 3CCLQ 1UE9A 3OW2A 1FYNA 1YP5A 3E2UA 3CC2T 2JM8A 2HDAA 1YWPA 3ZL7C 1VQMT 1RACB 3I5SA 1OULA 3V7SA 3I9QA 1G8XA 4M7AE 2X3WD 1W6XA 2M16A 3NFCA 1M1KC 2DK3A 2EKOA 2XK0A 2F5KA 3H0IA 4DOWA 3MKDA 3CPWP 4HVUA 2JS2A 3GF5A 4R0KA 3SDZA 3DB3A 2DL7A 5D6WA 2NYSA 3VS5A 2LDMA 1VQ6Q 2H3EB 4R55A 2E64A 3VU3C 1AT1B 1AD5A 4JPBW 1O9SA 1B07A 4R56A 3H0FA 1D1BA 3FJPA 4C0DB 4Z88A 3CCST 4RTVA 3THKA 4RG8A 1OPKA 4J5YA 4IUUA 4QT7A 3PGGA 2X51A 2QA4A 4JS5A 1HXDA 2X4JA 2RHZA 3VS1A 2CP0A 3BFMA 4M75D 1PNJA 4IURA 3CCUA 2RJCA 3RERA 1WQ7A 2X3XD 4M7AC 3QG1A 3CBPA 5GAMh 3I56Q 1D3BB 1YJWT 1AWOA 1NJIR 1JJ2P 2LTOA 1QVGP 1TUGB 1VA7A 1D3BA 5GMKl 2GTJA 8ATCB 4QQDA 1VQNQ 1D0ZA 4OP0A 1KD1U 2FZKB 2KE9A 2LVMA 1MNEA 3NPFA 4MZTA 5LJ5h 4C8QE 1WHHA 2KNBB 5GMKj 3TCJA 1TSFA 3LGFA 1VQ7Q 1V76A 3M4YA 1I5LA 1DJ7B 3S6WA 1Q81U 3OYAA 3TREA 4PJOB 5HCKA 3CMEA 3OYCA 1MUZA 4N4GA 1U5SA 2KBTA 1YIJA 1EIFA 1OX8A 3FLGA 3INZA 4PJOD 3OMCA 1IZ6A 1WGSA 4RCBA 4M7AD 4Q5WA 4M77A 1JEGA 4OGEA 1QQJA 2OJ2A 4RMOA 2BKDN 3CD6T 3TU4K 1R77A 2RNAA 3MO8A 2RQVA 2KT1A 3CC7A 3CMET 2HSEB 2QASA 3ULRB 4LDYA 2DTHA 4BE1A 5D6XA 3V7RA 5CQYA 4E7KA 2COZA 1I1JA 4ELZC 1EZZB 3HPWA 4F04B 3CCEA 2EQKA 1UTIA 3V8KA 4PJOE 1WI7A 1WX6A 3EFOB 2FRWA 3L2QA 1K9MR 1AWWA 3GOXA 2VYTA 2F2XA 1MV0B 2DETA 4J9HA 2HAXA 2MI6A 3OS0A 3RIRA 4M78A 3UWNA 1SHFA 1RAFB 4J9EA 3SWNC 1VIFA 3SHWA 1YNZA 2P84A 2BE9B 1ZLMA 1YCYA 1IHVA 1NBEB 2EYWA 2M1HA 1VQ8A 5GAN6 1BI0A 4OF1A 3CCLA 2Z0WA 4J7IA 4AFUC 1H3ZA 3L42A 4MDXA 3LWHA 2L8DA 3GPLA 3CCRQ 2M9UA 4DBQA 4F14A 1WXBA 3DKMA 1HSQA 2ZPFB 3JB9H 4GLMA 1HK9A 4JRIA 2AHJB 5IT9E 2GF7A 4EMKA 1D0XA 2HL3A 1FX7A 4MMLA 1N9RA 2LMJA 2LP5A 1ZQ1A 3S3OA 1E7OA 2DLPA 3NMZC 5I11A 1RAHB 2DXBA 2OTLQ 3JV3A 4O6JA 3I55A 3N5BB 4KBMB 1ABOA 3OYFA 1XOVA 4AG2C 3R6OA 1E6GA 2X4XA 1PSFA 3OYHA 2DVEA 1TH7A 1YBYA 1JJ2A 4BACA 2RI5A 3VS0A 4NL3A 3L2RA 1K0SA 2MMPA 3CPWA 2K4YA 1S1NA 4FL6A 4QW2A 5GAOm 2CP2A 3OYIA 2DX1A 3VS3A 2A7YA 2P0PA 3P8BB 4N0AA 3M0SA 4C0GA 2GQVA 2LJ0A 4NOYA 1LPLA 1SSFA 4ZGEB 2W10A 2HNIA 1Q95G 3CCVT 4C92B 4OMNA 3EHQA 5CKBA 2E3HA 2HBWA 1I4K1 1Q7YC 2YRVA 3C12A 1JXMA 3CCVQ 2ATCB 4RTWA 4QQGA 1XQHA 2EBPA 3E1SA 5ECAA 5IHKA 4P5NA 2LT4A 3ZBDA 1PD0A 3ZEHA 2MOXA 3CPWS 3CCET 2O31A 5IAYA 2QGFB 2CP7A 4FCYA 3GLXA 4XU0A 2ESWA 1GRIA 3CCVA 4AMCA 4D8KA 2XDBA 1QWFA 4CRIA 4JLIA 3M9QA 1WA7A 4E7JA 1Y71A 4M4ZA 1GXIE 2F2WA 3JCMJ 4RTYA 4C5GA 1OZ2A 2DL3A 3CCQQ 1YJNQ 1YITA 1NYGA 2F69A 1HYOA 3MCAB 1VQ8Q 4IIMA 2DAQA 3QUIA 1G5VA 5CKHA 2GGRA 1F1BB 1R0CB 1X6OA 4J9GA 1UB4A 1K9AA 5CR2A 1M1KR 2KRSA 1ZUYA 3NTHA 2ZPIB 1O75A 2ZZDA 3CBMA 4MZPA 1PKTA 1KC8R 4FM4B 2EVRA 2JTEA 4ZN3A 2MK5A 1OV3A 1YITT 1VQMQ 1J3TA 4F7UB 4OMOA 2DTIA 1IO6A 5D6YA 1VQ4Q 2X35A 2DYBA 4V2SA 2OTLA 2HCKA 1VQPT 3LGLA 4JJDA 1RADB 1ZA2B 3PE0A 1T0HA 5FROA 4M7AA 3CCSQ 4M7DA 2LRQA 3CCMQ 1MGQA 4HCZA 4ZNXA 2HEQA 3MP8A 4J83A 3EFOA 4J6YA 2L3QA 3LLRA 5FU7B 4M78G 1UEBA 3MHXA 1VQ6A 1QCOA 2YSQA 1BYMA 3CMAT 2K3BA 3VRZA 3CCMA 2DIQA 1WNLA 1P92A 5IHNA 1WZOA 1N8RU 4EDUA 5AT1B 3MEVA 3RNJA 1ZBJA 1T3SA 5KYYA 1BKBA 4KRTA 1WIEA 3HTRA 1VQLT 1Q81R 1M5Q1 4M77C 1BCMA 1SSHA 2QTVA 3LW5E 3JCMc 2YWWA 3CCUQ 1TXQA 5IN1A 2O4XB 1VQNT 2CT4A 3SEMA 4EMGA 3OBYA 1PSEA 4C8QB 2O88A 4FYYB 2LX7A 4DOVA 2RQUA 1PWTA 3REAB 4KGVB 2RHUA 5IHIA 1YHQT 1LJOA 5GANg 1X6BA 1W2BS 2LCCA 1SRMA 1VQ7T 2Y4XA 3I35A 3FC3A 2KYMA 1X2QA 2E5QA 2KY9A 2ZCFB 1N27A 3JCMW 4C8QC 4JRPA 2EQJA 1NG2A 1I8FA 3CMEQ 1VQ5Q 2LZ6B 4JJCA 1N8RR 1QCNA 1UDLA 2L0AA 1IRXA 2GFUA 5DLOA 1AZEA 5KYUA 2AZVA 4PJOF 5HKCA 2LQNA 2P0KA 5FWCA 3WXMB 4FW2A 3DLMA 5LJ3d 5DM7R 2G6FX 2K3YA 3META 1Y57A 2YRDA 2VUBA 1BK2A 2LCLA 2RJDA 2RHIA 3BW1A 1Y7XA 4KUIA 2WSEE 4A63B 3NHNA 2HQEA 1NEBA 3MEUA 1RLPC 1UFFA 5KYXA 2L3SA 1RI0A 1EX4A 2YUPA 3C4SA 4D8DA 4DBFA 5KE3A 3CCUT 2LT1A 2CYZB 2GFAA 3REBB 3DB4A 4E6RA 1YJWQ 3S3NA 2EGAA 2RQRA 3EG0A 1WHJA 2EYYA 4HA8A 5FRMA 3H9NA 1SHGA 1KHCA 3M0UA 2HD0A 1YJ9T 2O4XA 3HFOA 3HSBA 2XMFA 2JXBA 1Q86C 3SFMA 5I2SA 3QJ6A 3G6ET 2DEUA 4M7DD 3H0HA 3JSCA 3AHUA 4PFPA 3G7ZA 4LUDA 1V29B 4IUVA 1AWXA 3OYDA 4ATOA 3JCMf 1I5OB 2K5FA 4OB1B 1Q7YU 1VQ9Q 3OS1A 3I5RA 1S72Q 1PC0A 2G3RA 4DBHA 3H8ZA 2K6DA 3SD4A 4BDZA 1W2BP 2QQAA 4M75B 2D0QB 5KCHA 3CC4A 4JZ3A 3L2UA 5CVIA 2K79A 1M1GA 5GANd 3MP1A 1VQ9A 3M4GA 3TSWA 3QO3A 2R5MA 4JRKA 1VYTA 2VB6A 1R8OB 4M7DF 2F1LA 4M77G 1UUEA 3URGA 5AYFA 5IXBA 2EW3A 4XTYA 1KQSA 1CKBA 2WSFE 2HBPA 2XHCA 3BDLA 3NTIA 2KROA 3EG2A 3D7SB 2MWPA 1ZUKA 4PLIA 1TS9A 1E6HA 4C0DC 3GBQA 3HL8A 1D09B 1W2BA 2VV5A 2MYSA 3RR6A 1VQKA 4M7DB 2HKQB 3VS2A 3QDRB 1NPRA 4FSSA 4XU1A 5HK0A 2VGMA 1X27A 2L89A 3JRZA 4FIBA 4L5GA 2DO3A 3TSZA 5D7UA 2HQHA 2QA4Q 3MP6A 4OMLA 1KC8U 2A28A 2DL4A 4J9CA 3I56A 1RI9A 1KIKA 4PJNA 2PVOB 1KK7A 3BDUA 2I2LA 3CCJT 1QP2A 2JJ9A 2M02A 1M4ZA 2ROTA 2O2OA 2EAYA 2H3JA 1QKWA 5GAMj 2AZSA 1SF9A 1ZHIA 1UGSB 5GANj 2D9TA 1YJNT 4AFZC 2BIVA 2QTXA 2D8HA 2EJFA 4JDSA 4M75A 1N8RC 3HHTB 2RPNA 2IIMA 3QDFA 2YLCA 3CPFA 4UC4A 2E3IA 5LJ3f 2EJ9A 1VQ4T 2C0IA 2P4TA 3QPHA 3EG9A 2EQIA 2DYIA 1QVFP 2MWOA 3RDVA 4L6V5 4OB3B 4PJMA 4LDXA 5L23A 3MPUB 3CC2A 3JCMd 1OOTA 4PL6A 1YHQA 2GQIA 2KRNA 5DLQE 1RLQC 1X6GA 4BE2A 5GAMg 1KG1A 3G1JA 4QVCA 3M59A 1Q81C 2DL5A 3CCQA 2FPEA 5CCAA 3WVDB 2IG0A 3X25B 4IUQA 2RJFA 3V7CA 9ATCB 2HSPA 4LDVA 1TG0A 2QEXT 1QKXA 3MEWA 1KD1C 2DXUA 3OW2P 2RF0A 2HKNA 2DBKA 1QWEA 2CS7A 4RTXA 2ZPBB 2QYZA 3PT9A 1R0BG 1ZSZB 4X1VA 2CP3A 3C94A 1Q86U 3O8VA 2DA9A 2KQWA 1KD1R 3QSUA 3EG3A 1H8KA 4XU2A 1PRMC 3JCMh 2CDTA 2JZ2A 1CSKA 2KVQG 2DILA 3OYMA 3OY9A 4F7UE 4OGCA 4LNPA 4M75F 4QVZA 2M51A 2DBMA 1GBRA 1YIJT 2MIOA 1UJ0A 2NUPA 4J6XA 4J8OA 4PK4A 3UT1A 4N4IA 3CMAA 3FEOA 3CD6A 1WXTA 3M56A 2EWNA 1G3TA 2ED0A 4OVAA 4FYXB 4C5IA 1NLPC 2DXTA 2CP6A 1BCOA 2CZ0B 4HCKA 5KCOA 5FU6C 2DMOA 7AT1B 1FXXA 5GAOq 4M78F 3CMAQ 4M75G 1MMNA 5I21A 1EFNA 3UA6A 2H8HA 1T0JA 2DPPB 3T9NA 4D6WA 3PVQA 4JUVA 1M1FA 3HRTA 2RI2A 4DEYA 3CXCS 3VUZA 1SG5A 2A0FB 2VVKA 1IGUA 2Y4YA 5EG2A 5LJ3h 2EYZA 2PTKA 4ME7A 1K4US 4WCIA 4XTZA 4M7AB 2FL7A 2EPDA 2MCNA 4XK8E 2NLUA 3UA7A 5EC7A 2X4WA 1KQSP 4K11A 2QQRA 3Q1JA 1TWBA 1ACMB 5GAOl 4C92D 2NUZA 1KQ2A 2J05A 1OI1A 1X43A 4M77F 3BE3A 4M78D 1WFWA 2COYA 4NL2A 5GMKe 2FVUA 3A8OB 1KFZA 1TOVA 1AOJA 3PIOA 1NE8A 2NUPB 1RAEB 2FB7A 4QQ6A 4JRQA 4BI4A 2LNVA 2FZCB 1K9MU 1UGRB 1OYXA 2DZCA 2PVGB 3H6ZA 1Z9QA 1KC8C 2K9GA 3TVTA 2OTLT 2KYBA 1D1AA 4CC7A 2RMOA 4X9CA 3X28B 2EQUA 2E4HA 3I55T 4X34A 2LQKA 2VGNA 2X4YA 4LUEA 2JN0A 5LJ3j 2YUOA 1MMAA 3QZ9B 2QXFA 2R58A 5FU6B 2YUQA 1JO8A 1HJDA 3UDCA 4F7UG 4ZTFA 3NGPA 3QBYA 4X9DA 4AT1B 5CKDA 1QVFS 2RA2A 5KYUB 4FYVB 4A4HA 1V1CA 1WLPB 2KSSA 4HCCA 2CH4W 4Z89A 1W70A 5J3BA 2F5TX 1Y96A 5GAN3 3CXCA 3OSVA 2J6OA 1I0CA 1H3HA 3H41A 1FWZA 1YI2T 4XTXA 1WHLA 3EG9B 2QI2A 2BTTA 3PMIA 3M58A 2DXCA 1M3AA 5GJWB 6AT1B 3VS6A 3PMTA 1U3OA 4J6WA 4EPCA 3CC4Q 1JRIA 1B34A 4RG2A 4PJJA 2BUDA 3BY7A 5FU7C 3HRUA 5A0GA 1ZBXA 2OAWA 2BZXA 3QXEB 4M77B 3PVLA 1TUDA 2LX9A 3X26B 3G4SA 1UG1A 5GAN2 1QMCA 4RKUE 4A4EA 5CAIA 2XKOC 5GAN4 3JB9I 2B86A 3TQ7P 2VXEA 2DD5A 3JCMb 5GAN7 3F70A 3S3MA 5HK3A 1PD1A 4A4FA 2ZPHB 1XTDA 1K8AU 3VV0A 4ZTJA 5GMKh 1SEMA 1KSWA 4J7FA 1GCQC 2X9HA 2EQMA 4ESRA 4J9BA 2EYQA 4GLKA 4KULA 2QEXQ 3JB9D 3GNGA 5I2MA 1RAGB 2JW4A 1W4SA 4BI3A 2KT8A 4DEXA 1QVFA 2P4RA 2PZ1A 2YDLA 2RB6A 4C0FA 1WJQA 2VASA 4HKEA 3SB2A 3EGDB 4Y92A 1OPLA 3CC7Q 3VUBA 2QEXA 1K8AC 5M9OA 4Y28E 1X69A 4MMKA 4ZN1A 2JVVA 4MDWA 2YRCA 4B6MA 2DRMA 2DEQA 2O01E 2CH4A 3CXCP 4KH0B 1GFCA 4PJLA 4C92F 1VQOT 4BY6B 3CQTA 4B9WA 4M77D 1QCFA 4XAXB 2SRCA 4NS5A 2V8JA 5LJ5g 3OYYA 1Q86R 2Y90A 3OYKA 2HZYA 5GAOp 2QQ9A 3QYGB 3OYNA 2FO0A 1Q82R 2WSCE 4M7DE 3CCRA 5J26A 3ZFJA 4HXJA 2YLBA 1K73U 1MMDA 2LQ8A 3OA6A 2LCSA 3E9FA 4IKFA 1X75C 2KRMA 2DL8A
chains in the Genus database with same CATH topology
2PVOB 4M77E 1BI2A 4KUDK 3BDUA 3DKMA 2ZPFB 3OBWA 3PIPA 2E12A 2I2LA 4KT0E 2L5QA 2XDPA 5A2QE 3JB9H 3WVEB 1HK9A 4JRIA 2AHJB 3CCJT 5IT9E 1JJ2S 1QP2A 2GF7A 1QP3A 4E7HA 4EMKA 2ZPEB 1VQ4A 5GAOr 1FX7A 1M4ZA 2YHTA 4FSXA 4MMLA 2RM4A 2VXFA 1N9RA 2ZPGB 2EAYA 1ZQ1A 2H3JA 4A4GA 3S3OA 5FRNA 5GAMj 3G71T 4MZMA 1ZHIA 2DIGA 1UGSB 2XI9A 3FDRA 4M75C 2D9TA 5GANj 5GANe 2DXBA 4XU3A 1YJNT 4BDYA 3JCMP 2BIVA 1UGPB 2DD4A 1QVPA 2OAUA 4O6JA 2QTXA 3I55A 2K5IA 4XTVA 3UPUA 3JB9G 1Q82U 3N5BB 4KBMB 4C8QF 3RESA 2FYKA 3OYFA 2EJFA 1XOVA 3R6OA 3A8MB 4JDSA 2VC8A 4M75A 2X4XA 1N8RC 4C92A 3KUFA 1PSFA 3HHTB 3OYHA 2DVEA 4B9XA 1TH7A 1YBYA 4E47A 4O5VA 1JJ2A 1BI3A 4OMFB 4BACA 1G3SA 2RI5A 4PJOA 4NL3A 3L2RA 2MMPA 2YLCA 1K73C 3CPFA 3CPWA 2RJEA 2K4YA 2QA4T 4UC4A 4FL6A 4QW2A 5LJ3f 3JCMg 2EJ9A 3QIIA 5GAOm 1VQ4T 2P4TA 3QPHA 4M78E 2E10A 3OYIA 1AHJB 2RD1A 3RMQA 2QQSA 2A7YA 4DQ2A 2C06A 3LWIA 2P0PA 3P8BB 4TVRA 2MWOA 1MHNA 1N9SA 1WJRA 1VQ7A 4N0AA 4L6V5 4OB3B 4C0GA 3FB9A 4LDXA 2GQVA 1X01A 1RL2A 3OS2A 3JCMd 3CC2A 5FLXE 2ZGWA 5CIUA 4PL6A 4NOYA 3OMGA 1YHQA 3M5AA 4A53A 5DLQE 3PTAA 2JTMA 2V8IA 1SSFA 2QQBA 2XDDA 4ZGEB 4BE2A 1G3WA 5GAMg 1JB0E 2HNIA 1M1KU 3CCVT 4C92B 1KG1A 2OTJA 4WF2A 3X20B 3CCLT 4QVCA 3M59A 2RK1A 5CKBA 1I4K1 4EMHA 1Q7YC 2YRVA 1Q81C 3C12A 3CCQA 5A0DA 4HCBA 4QQGA 5CQXA 1XQHA 3E1SA 1M9SA 3VJPA 5CCAA 3WVDB 2IG0A 3X25B 3EFRA 2XG8D 2KAFA 2DKGA 4P5NA 2LT4A 1VQLA 4RCCA 4IUQA 2RJFA 4OB0B 3V7CA 3ZBDA 4BD3A 1H641 4LDVA 3ZEHA 5GAMe 1Q82C 4F7UF 3I56T 2QEXT 3CPWS 3CCET 3MEWA 3G6EA 1KD1C 3VKIA 4BB7A 5GANh 5IAYA 5C0MA 1KQ1A 1N6AA 1VQKT 4M7DC 2DXUA 4FU6A 3GLXA 3JB9F 3A8GB 4XU0A 3CCVA 2XDBA 3A5ZB 4C8QG 1UGQB 4PJOC 2OTJT 3EAEA 3A8LB 4CRIA 2CS7A 3JAME 2E41A 5GAN5 2XU8A 4BI8B 5C6SA 4M7AF 3M55A 4JLIA 2ZPBB 3M9QA 3L2VA 3PT9A 2JNGA 2DTOA 3E19A 4E7JA 4XQ3A 4C5EA 3HFNA 5CO7A 3OYBA 1NJIC 1Y71A 3HKSA 2KMTA 1GXIE 2K5LA 4C0ZA 3C94A 3CCRT 1Y07A 3O8VA 1Q86U 4M7AG 2E65A 3JCMJ 4JLGA 1VQ5T 3C95A 2KQWA 1YJ9A 3QSUA 4C5GA 1OZ2A 1JBMA 2CZ6B 4XU2A 1YITA 2F69A 3JCMh 3MCAB 1G5VA 2DAQA 3QUIA 5CKHA 2JOYA 1X6OA 2JZ2A 1UB4A 3L2WA 5CR2A 2KVQG 4DA4A 5DY9A 3NTHA 3OY9A 3OYMA 4F7UE 4ZGDB 2ZPIB 4II1A 1O75A 4OGCA 1KQSS 2ZZDA 4LD9K 3CBMA 3GIBA 4M75F 4MZPA 4QVZA 3P8HA 1VQNA 2PU9B 5GMKm 3CBOA 1YIJT 1WPYA 3CC4T 5GAMd 3RMSA 4FM4B 4J6XA 4J8OA 2JTFA 3L2ZA 2CZ1B 4LDWA 4ZN3A 1VIEA 3G71A 4LDUA 4BUGA 1YITT 3UT1A 4N4IA 2E1HA 4F7UB 3CMAA 3CCQT 3FEOA 2RK2A 2CKKA 1VQ9T 5KH6A 3CD6A 1LNXA 3M56A 2DTIA 4C8QD 2EWNA 1G3TA 3KXTA 4OVAA 3JCMe 2PUOB 5D6YA 2KK4A 2X35A 3CCSA 1VQMA 4C5IA 4V2SA 3J81E 1QVGA 2OTLA 2MAMA 2DXTA 1VQPT 3LGLA 2E6ZA 1I81A 2CZ0B 3P8DA 5KCOA 3E9GA 5FU6C 5FROA 1FXXA 3L1AA 4M7AA 5GAOq 4M7DA 4M78F 2LRQA 4M75G 5I21A 1MGQA 5J39A 2QDYB 4HCZA 1VQPA 1YJWA 4BY6C 2DPPB 1BI1A 2R5AA 3MP8A 4IUPA 4J83A 3T9NA 4J6YA 2FHDA 4D6WA 5CK9A 2RHXA 3TEEA 3LLRA 4JUVA 1M1FA 4ELYC 5FU7B 4M78G 1U8RA 1UEBA 3M57A 3MHXA 1VQ6A 3HRTA 4EMKB 1K9MC 1BYMA 3M53A 3CMAT 2RI2A 1U1SA 4JS4A 5LJ5d 2E70A 3VUZA 3CXCS 2GCXA 4Y91A 3CCMA 1OZ3A 5LJ3e 3GP8A 2DIQA 1WNLA 3V8LA 1P92A 3OB9A 4FT4A 5A0LA 2Y4YA 5L8RE 1N8RU 4EDUA 5EG2A 3QKJA 3QJYA 5LJ3h 1S72T 1QW1A 4ME7A 3MEVA 4XTZA 4M7AB 3V8JA 2P0QA 4E7IA 2FL7A 3CCMT 3M54A 2K2VA 4XK8E 1BKBA 4GY5A 3VYGA 1VQLT 2NLUA 2EIFA 3RKYA 3DLLA 3QHSA 1M5Q1 4M77C 1XNIA 3KBGA 5CKEA 5CKFA 3LW5E 2X4WA 3JCMV 3JCMc 4VUBA 2QQRA 3Q1JA 3RKWA 4M75E 3VYHB 5GAOl 4C92D 3FIFA 1WQWA 5IN1A 2CZ7B 3OYGA 1KQ2A 4A54A 1M90C 2XD0A 1OI1A 4M77F 2PUKB 4M78D 2O4XB 1VQNT 4EMGA 4OB2B 3GNFB 4NL2A 3OBYA 1PSEA 5GMKe 4C8QB 3RKXA 2FVUA 3ME9A 3A8OB 1B34B 4N4HA 4DOVA 3A8HB 4M78B 4XTUA 3PIOA 1M8VA 1NE8A 5KE2A 4JRQA 2FB7A 4QQ6A 4BI4A 2LNVA 2RHUA 4PKCC 1NJIU 4ZGJB 1YHQT 3OW2A 1K9MU 1LJOA 1UGRB 3CC2T 1OYXA 3LYIA 5GANg 1W2BS 2DZCA 2LCCA 2PVGB 3H6ZA 1KC8C 1VQ7T 3JCMX 2Y4XA 2EFIA 1VQMT 2RI3A 2JUFA 3FC3A 2OTLT 2E5QA 2KY9A 1VQ5A 4M7DG 3V7SA 2ZCFB 1N27A 2LC4A 4X9CA 3X28B 3JCMW 4M7AE 2EQUA 2M16A 3NFCA 4PJOG 4C8QC 3I55T 5LJ5f 4LD6A 4JRPA 4N0AC 4C92G 2EQJA 4X34A 1I8FA 2DK3A 2LQKA 2VGNA 2X4YA 1M1KC 2JN0A 5LJ3j 2EKOA 2GFUA 2PQWA 2XK0A 2F5KA 2QXFA 3ASKA 3QZ9B 2R58A 5DLOA 2HQXA 4E7LA 4DOWA 2IVWA 5FU6B 1VQOA 4PJOF 5HKCA 3UDCA 2P0KA 3WXMB 4F7UG 5GAOn 4ZTFA 4X9DA 3QBYA 3DLMA 3GF5A 5CKDA 5LJ3d 5DM7R 3SDZA 1QVFS 2RA2A 2K3YA 3META 3OS5A 3DB3A 4A4HA 5D6WA 2VUBA 1YJNA 4HT8A 2KSSA 4HCCA 2LDMA 3PFSA 2LCLA 2RJDA 2RHIA 4R55A 1IREB 3BW1A 1Y7XA 4KUIA 5J3BA 3CC7T 2WSEE 1M90U 2E64A 2HQEA 2WACA 3VU3C 2F5TX 1Y96A 5GAN3 3CXCA 5LJ3g 5GMKi 3SWNB 1O9SA 3OSVA 3OQ5A 4R56A 3MEUA 1FWZA 5LJ5e 3FJPA 4C0DB 1YI2T 4XTXA 4PLLA 1RI0A 4XTWA 3CCST 2QI2A 3PMIA 3C4SA 3SWNA 1Y96B 4RG8A 3M58A 5KE3A 3CCUT 2LT1A 2DXCA 2CYZB 2GFAA 3J7AF 3DB4A 3MEAA 4J5YA 1BIBA 4IUUA 3S3NA 3PGGA 4A4KA 4EMKC 2B8AA 3PMTA 2QA4A 4JS5A 1U1TA 4J6WA 1HXDA 4HT9A 2X4JA 2RHZA 1JRIA 2RHYA 4HA8A 4EPCA 1B34A 4RG2A 3BFMA 5FRMA 4M75D 4IURA 3CCUA 1KHCA 2BUDA 2HD0A 2RJCA 1YJ9T 1WQ7A 4YTLA 1NZ9A 3BY7A 3RERA 5FU7C 4M7AC 3HRUA 3QG1A 2O4XA 3CBPA 3HFOA 5GAMh 5A0GA 1D3BB 3HSBA 1Q86C 1ZBXA 4FT2A 3SFMA 5I2SA 1YJWT 2R57A 3QJ6A 3QXEB 2LTOA 3OSSC 4M77B 2RH2A 4C5HA 4QVDA 3G6ET 1D3BA 2LX9A 3X26B 3G4SA 5GMKl 4M7DD 3AHUA 3JSCA 4F7UA 4QQDA 3JCMQ 3G7ZA 3QYHB 3PNWC 4OP0A 3RUXA 5GAN2 1KD1U 2LVMA 4MZTA 3OW2S 1V29B 4IUVA 4C8QE 5LJ5h 4RKUE 4A4EA 5HY6A 2XKOC 5CAIA 3OYDA 5GAN4 5GMKj 5GAN8 3JB9I 3TCJA 1KHIA 3JCMf 4ATOA 1S72A 3ER0A 3LGFA 2VXEA 2DD5A 3JCMb 5GAN7 1VQ8T 2K5FA 3F70A 2MF2A 3S3MA 5HK3A 3M4YA 1I5LA 1DJ7B 4OB1B 3S6WA 1Q7YU 1Q81U 4M78C 3OYAA 3TREA 3OS1A 3OYEA 4PJOB 4A4FA 2ZPHB 2G3RA 1XTDA 3CMEA 1K8AU 3H8ZA 3LH0A 3OYCA 3SD4A 4N4GA 3VV0A 3JB9J 4ZTJA 5GMKh 2V8KA 4BDZA 1YIJA 2QQAA 4M75B 1EIFA 2D0QB 3FLGA 3INZA 5KCHA 3CC4A 4PJOD 3OMCA 4J7FA 5GANf 1IZ6A 3HRSA 3NTKA 2XICA 5CVIA 1LOJA 1WGSA 4RCBA 3L2UA 4M7AD 3CCJA 4Q5WA 5GAMf 4M77A 2EQMA 2EYQA 1M1GA 2K57A 4OGEA 5LL6S 4GLKA 5GANd 3MP1A 2K3XA 1VQ9A 3M4GA 4RMOA 4KULA 3JB9D 2BKDN 3CD6T 3GNGA 5I2MA 4L59A 3QO3A 1W4SA 3TU4K 2R5MA 4JRKA 4BI3A 3LX7A 3EFSA 3QZ5B 1R8OB 4M7DF 4M77G 1QVFA 3MO8A 3URGA 1VQ6T 2RB6A 1QVGS 5AYFA 3CC7A 4C0FA 1WJQA 4XTYA 3CMET 2EJGA 1KQSA 2A3LA 1WJSA 4LDYA 2DTHA 4HKEA 4BE1A 3SB2A 2WSFE 5D6XA 2RO0A 3V7RA 3OYLA 1YI2A 4PNOA 2HBPA 2XHCA 1NPPA 3VUBA 2QEXA 5CQYA 3CEYA 5M9OA 4Y28E 3BDLA 4E7KA 1K8AC 3NTIA 4MMKA 1BIAA 5LJ5j 4BE0A 2KDSA 4ELZC 3HPWA 4C92E 4ZN1A 2DJZA 3J80E 2L3RA 3CCEA 2EQKA 2JVVA 2MWPA 2XIDA 4PLIA 4MDWA 2DEQA 3V8KA 2O01E 4PJOE 4C0DC 3HL8A 3L2QA 2CGHA 3GOXA 2E6NA 2VYTA 1W2BA 2VV5A 2HAXA 2PVDB 1G3YA 2MI6A 1VQKA 3HP9A 3OS0A 4M7DB 3RIRA 4C92F 4M78A 3UWNA 4Z02A 1VQOT 1VUBA 4BY6B 3QDRB 4B9WA 1NPRA 4M77D 4XAXB 4C8QA 4IUTA 2V8JA 4NS5A 5LJ5g 3SWNC 3OYYA 4XU1A 1VIFA 2Y90A 4C92C 5HK0A 2VGMA 3G4ST 3JRZA 2L89A 4L5GA 4FIBA 3OYKA 2DO3A 2D6FA 1YCYA 2M0OA 2QQ9A 3QYGB 5GAOp 3OYNA 4JJNK 3X24B 4CI0C 1VQ8A 2M1HA 5GAN6 1BI0A 4OF1A 2WSCE 3CCLA 3FRNA 3MP6A 4J7IA 3OYJA 3CCRA 4M7DE 1KC8U 5J26A 3ZFJA 1H3ZA 3L42A 4MDXA 2YLBA 1K73U 2DZ9A 3LWHA 2LQ8A 3OA6A 2L8DA 3E9FA 4IKFA 3I56A 1X75C 3GPLA 2M9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4VUB A;  5CCA A;  5CO7 A;  4MZT A;  3VUB A;  4MZP A;  5CQY A;  2KMT A;  2VUB A;  5HK0 A;  3JRZ A;  3TCJ A;  4ELZ C;  3HPW A;  3NFC A;  2MF2 A;  4ME7 A;  4OF1 A;  5HK3 A;  5CKD A;  1NE8 A;  5DLO A;  4MZM A;  4MDX A;  5CKB A;  5CK9 A;  1M1F A;  5CKH A;  4ELY C;  5HKC A;  1UB4 A;  3JSC A;  5CR2 A;  2C06 A;  1VUB A;  1X75 C;  5CKE A;  4HKE A;  5CQX A;  5CKF A;  3G7Z A; 
#chains in the Genus database with same CATH topology
 1BI2 A;  3OBW A;  2AK5 A;  2E12 A;  5A2Q E;  2L5Q A;  2XDP A;  4RTT A;  4IIO A;  4E7H A;  1VQ4 A;  5GAO r;  4FSX A;  2VXF A;  2ZPG B;  5FRN A;  3G71 T;  1U06 A;  3FDR A;  4JZ4 A;  1UGP B;  1FMV A;  1QVP A;  2DD4 A;  2OAU A;  3UPU A;  4XTV A;  3RES A;  2EKH A;  2VC8 A;  4C92 A;  1I07 A;  1WYX A;  4B9X A;  4CC3 A;  4O5V A;  1BI3 A;  4PJO A;  1G3S A;  1IHW A;  1T3L A;  2V1Q A;  1K73 C;  2AKK A;  1UHF A;  2AIR B;  2E10 A;  3M0Q A;  1AHJ B;  2RD1 A;  3RMQ A;  2QQS A;  3UAT A;  1TUC A;  1LVK A;  4TVR A;  4LN2 A;  1MHN A;  1N9S A;  1M2V B;  5KYW A;  1VQ7 A;  2ZAE A;  4LXC A;  3FB9 A;  1K1Z A;  5FLX E;  2KGT A;  3M5A A;  3PTA A;  2JTM A;  2QQB A;  1JB0 E;  1M1K U;  3G4S Q;  3CD6 Q;  2OTJ A;  4WF2 A;  3X20 B;  3CCL T;  2FPD A;  2MPX C;  5FW9 A;  2SEM A;  2J06 A;  1VYV A;  1JU5 C;  2I0N A;  2XG8 D;  2KAF A;  1WDX A;  4RCC A;  4BD3 A;  1Q82 C;  1VQK Q;  2ABL A;  3I56 T;  5GAN h;  2KR3 A;  1VQK T;  1M3C A;  4M7D C;  4QKU A;  2BZY A;  4FU6 A;  3A8G B;  3M0T A;  2VWF A;  4PJO C;  4C8Q G;  1UGQ B;  2O9S A;  2OTJ T;  3EAE A;  3A8L B;  3JAM E;  5GAN 5;  2XU8 A;  5C6S A;  3L2V A;  2JNG A;  3E19 A;  1UHC A;  4XQ3 A;  3HFN A;  5CO7 A;  3EHR A;  2CUD A;  3OYB A;  1AWJ A;  2PNI A;  4KGX B;  1YWO A;  4M7A G;  1Y07 A;  2E65 A;  4JLG A;  1VQ5 T;  3C95 A;  1YJ9 A;  1JBM A;  2CZ6 B;  2LJ3 A;  3UF4 A;  3R6N A;  1ZUU A;  2FRY A;  2JOY A;  4OMM A;  5KYY B;  2LJ1 A;  1GCQ A;  4DA4 A;  4ZGD B;  4LD9 K;  1KQS S;  3GIB A;  2BE7 D;  1IXD A;  5I22 A;  2PU9 B;  1WPY A;  3VS7 A;  3CC4 T;  1OU8 A;  5GAM d;  3RMS A;  4LDW A;  3G71 A;  4BUG A;  1RAB B;  2E1H A;  1D1C A;  2RK2 A;  1UJY A;  1VQ9 T;  5KH6 A;  4E7S A;  4C8Q D;  2O9V A;  3QWX X;  4GBQ A;  3KXT A;  3JCM e;  2KK4 A;  4E2F B;  3CCS A;  1VQM A;  2DM1 A;  2MAM A;  2RN8 A;  2E6Z A;  3CCJ Q;  2ED1 A;  4LE9 A;  1ZX6 A;  1M30 A;  3A98 A;  3G6E Q;  2R5A A;  4IUP A;  5CK9 A;  3TEE A;  2AT1 B;  2J7I A;  2FZG B;  1U8R A;  3M57 A;  5KYX B;  4EMK B;  3M53 A;  4JS4 A;  2E70 A;  1K0X A;  5LJ3 e;  2CUB A;  3V8L A;  1GFD A;  4FT4 A;  2D1X A;  3RBB B;  5A0L A;  5L8R E;  3QJY A;  1S72 T;  1QW1 A;  1IGQ A;  3EGU A;  2C0O A;  2EGC A;  4E7I A;  1HD3 A;  4KH1 B;  4GY5 A;  3RKY A;  1XNI A;  5CKE A;  1RAA B;  5KYN A;  2W0Z A;  2CZ7 B;  3OYG A;  2XD0 A;  1FMW A;  3RKX A;  3ME9 A;  2DRK A;  1Y0M A;  4N4H A;  2NUT A;  2JT4 A;  3A8H B;  1TU0 B;  3C0C A;  4M78 B;  1MND A;  1M8V A;  5KE2 A;  1GCP A;  4PKC C;  4ZGJ B;  3LYI A;  1VQO Q;  1JXO A;  3JCM X;  2EFI A;  2RI3 A;  2JUF A;  2DNU A;  1VQ5 A;  1MV3 A;  4M7D G;  1M2O A;  1K76 A;  2LC4 A;  2CSQ A;  4PJO G;  5LJ5 f;  3LH5 A;  4LD6 A;  4N0A C;  2LNH B;  4C92 G;  2OI3 A;  1VOM A;  2PQW A;  2KEA A;  3ASK A;  4E7L A;  2HQX A;  2IVW A;  1VQO A;  5GAO n;  1RUW A;  1PRL C;  4OMP A;  2GTO A;  3OS5 A;  4EIK A;  1BB9 A;  1YJN A;  4HT8 A;  1ARK A;  3PFS A;  2A37 A;  2A08 A;  2HL5 C;  1YIT Q;  1IRE B;  1G83 A;  3CC7 T;  3EH1 A;  1M90 U;  2WAC A;  2DVJ A;  2QK0 A;  5LJ3 g;  5GMK i;  3SWN B;  1OEB A;  3OQ5 A;  1UGV A;  2DE0 X;  5LJ5 e;  1M90 R;  4KGZ B;  1PCX A;  4PLL A;  4XTW A;  3SWN A;  1Y96 B;  3J7A F;  3MEA A;  3VS4 A;  1BIB A;  4A4K A;  2L2P A;  4EMK C;  2B8A A;  1U1T A;  4JJB A;  2CSI A;  2FG0 A;  2RHY A;  4HT9 A;  2JS0 A;  2GNC A;  4YTL A;  1NZ9 A;  2QDL A;  4FT2 A;  2R57 A;  3OSS C;  2D0N A;  1ZSZ C;  2RH2 A;  4C5H A;  4QVD A;  2DJQ A;  2OX7 A;  4F7U A;  3JCM Q;  3QYH B;  3PNW C;  3RUX A;  3OW2 S;  1RAI B;  1WHM A;  5HY6 A;  3FJ5 A;  2KXC A;  5GAN 8;  1B7T A;  1KHI A;  1S72 A;  3G71 Q;  3ER0 A;  1VQL Q;  2E5K A;  1VQ8 T;  2MF2 A;  1C0M A;  2DFU A;  3CC2 Q;  1KJW A;  4M78 C;  1C6V X;  3OYE A;  4CC2 A;  3LH0 A;  2NUT B;  2K2M A;  3JB9 J;  2V8K A;  2VKN A;  5GAN f;  1WXU A;  3HRS A;  3NTK A;  2XIC A;  1LOJ A;  3CCJ A;  5GAM f;  2K57 A;  5LL6 S;  2FPF A;  2K3X A;  3EH2 A;  4L59 A;  1NEG A;  3LX7 A;  3EFS A;  1A0N B;  3QZ5 B;  1VQ6 T;  1QVG S;  1XJW B;  2EJG A;  2A3L A;  1WJS A;  1Z9Z A;  3OYL A;  2RO0 A;  1YI2 A;  4PNO A;  3KFV A;  1NPP A;  2ROL A;  3CEY A;  4WTO B;  1BIA A;  5LJ5 j;  4BE0 A;  2KDS A;  4C92 E;  2DJZ A;  3J80 E;  2L3R A;  4E7Z A;  1NLO C;  2XID A;  1AEY A;  4AFQ C;  2CGH A;  2IPO B;  2D8J A;  4F17 A;  2E6N A;  4OMQ A;  5FWB A;  2CT3 A;  2PVD B;  1G3Y A;  3HP9 A;  1H92 A;  4Z02 A;  1VUB A;  4C8Q A;  4IUT A;  1N5Z A;  3G4S T;  4C92 C;  2D6F A;  2C0T A;  2OTJ Q;  2M0O A;  4JJN K;  1G2B A;  2QAZ A;  4Z8A A;  3X24 B;  4CI0 C;  4FYW B;  1C1A A;  2DF6 A;  3FRN A;  3OYJ A;  2JM9 A;  2DZ9 A;  1ZA1 B;  1NYF A;  1YN8 A;  1PM3 A;  1FMK A;  4HVV A;  4M77 E;  4KUD K;  4HVW A;  4PFO A;  3PIP A;  4KT0 E;  1YIJ Q;  8AT1 B;  3WVE B;  4FW1 A;  1JJ2 S;  1QP3 A;  2ZPE B;  2YHT A;  4PFZ A;  2RM4 A;  2KXD A;  4A4G A;  3O5Z A;  4MZM A;  2DIG A;  1GL5 A;  1ZSG A;  2XI9 A;  4M75 C;  5GAN e;  4XU3 A;  4BDY A;  3JCM P;  1OQK A;  3JB9 G;  1Q82 U;  1IB8 A;  2DER A;  2K5I A;  2M0Y A;  4C8Q F;  2FYK A;  4J9D A;  2A36 A;  1LCK A;  3A8M B;  2V26 A;  1NM7 A;  1K73 R;  1ZSZ A;  3KUF A;  3IQL A;  1TTH B;  1ABQ A;  4E47 A;  1B3Q A;  4OMF B;  3A1P A;  2V1R A;  4AFS C;  1VYU A;  1PG5 B;  2RJE A;  2QA4 T;  2HMA A;  3JCM g;  3QII A;  2FEI A;  4M78 E;  4DQ2 A;  2C06 A;  3LWI A;  2YXY A;  3QWY A;  2RQT A;  1WJR A;  3EGD A;  1X01 A;  1RL2 A;  3OS2 A;  2ZGW A;  5CIU A;  2EYX A;  3OMG A;  4A53 A;  2V8I A;  1SPK A;  2XDD A;  1G3W A;  2F2V A;  1YHQ Q;  2RK1 A;  2NWM A;  1QLY A;  1YJ9 Q;  2RQW A;  4EMH A;  1GBQ A;  1CKA A;  2YT6 A;  1M3B A;  5A0D A;  4HCB A;  5CQX A;  1M8M A;  1M9S A;  3VJP A;  3EFR A;  2DKG A;  1AZG B;  1VQL A;  1W1F A;  1WHG A;  4OB0 B;  1H64 1;  5GAM e;  1M2V A;  5KYW B;  1YI2 Q;  4F7U F;  4F16 A;  3G6E A;  3VKI A;  4BB7 A;  5C0M A;  1KQ1 A;  1N6A A;  1UEC A;  3JB9 F;  1SRL A;  3EGX B;  2J6F A;  3A5Z B;  2CP5 A;  2E41 A;  2ENM A;  3EGX A;  4BI8 B;  4M7A F;  3M55 A;  2DTO A;  4C5E A;  1JQQ A;  1NJI C;  2CRE A;  3HKS A;  2KMT A;  2K5L A;  4C0Z A;  3I55 Q;  3MJX A;  3CCR T;  2BZ8 A;  2KI7 A;  1BU1 A;  3M0P A;  4AG1 C;  1YFN A;  2GBQ A;  3L2W A;  5DY9 A;  4II1 A;  3P8H A;  1PKS A;  4ANJ A;  1VQN A;  5GMK m;  3CBO A;  1M27 C;  2QG9 B;  2K7A A;  2JTF A;  3L2Z A;  2CZ1 B;  1VIE A;  4LDU A;  3CCQ T;  2EGE A;  2CKK A;  1LNX A;  3EG1 A;  2LQW A;  2PUO B;  2JMC A;  3J81 E;  1QVG A;  2ECZ A;  3VRY A;  1YCS B;  1I81 A;  1OX9 A;  3P8D A;  3E9G A;  1SKU B;  3L1A A;  1X2K A;  4J9I A;  4J9F A;  5J39 A;  1BBZ A;  2QDY B;  2COW A;  1VQP A;  1YJW A;  4BY6 C;  1BI1 A;  4RUG A;  2FHD A;  2RHX A;  4DBR A;  4ELY C;  4RTU A;  1K9M C;  1PHT A;  1U1S A;  5LJ5 d;  2GCX A;  4Y91 A;  1OZ3 A;  3GP8 A;  3OB9 A;  1VQP Q;  1AVZ C;  5GJV B;  3QKJ A;  1WHK A;  5IXF A;  3CCE Q;  3V8J A;  2P0Q A;  3CCM T;  3M54 A;  2K2V A;  3AT1 B;  3VYG A;  2EIF A;  1Q7Y R;  3DLL A;  4CC4 B;  3QHS A;  3KBG A;  1D0Y A;  2J6K A;  3U23 A;  2JMA A;  5CKF A;  4ORZ A;  3JCM V;  4VUB A;  3RKW A;  4M75 E;  3VYH B;  3FIF A;  5IH2 A;  1WQW A;  4A54 A;  1M90 C;  2YUN A;  2PUK B;  3M0R A;  1K8A R;  4OB2 B;  3GNF B;  2AKL A;  1B34 B;  1OU9 A;  1MMG A;  4XTU A;  2QGG A;  2L3P A;  4RTZ A;  1NJI U;  3CCL Q;  1UE9 A;  3OW2 A;  1FYN A;  1YP5 A;  3E2U A;  3CC2 T;  2JM8 A;  2HDA A;  1YWP A;  3ZL7 C;  1VQM T;  1RAC B;  3I5S A;  1OUL A;  3V7S A;  3I9Q A;  1G8X A;  4M7A E;  2X3W D;  1W6X A;  2M16 A;  3NFC A;  1M1K C;  2DK3 A;  2EKO A;  2XK0 A;  2F5K A;  3H0I A;  4DOW A;  3MKD A;  3CPW P;  4HVU A;  2JS2 A;  3GF5 A;  4R0K A;  3SDZ A;  3DB3 A;  2DL7 A;  5D6W A;  2NYS A;  3VS5 A;  2LDM A;  1VQ6 Q;  2H3E B;  4R55 A;  2E64 A;  3VU3 C;  1AT1 B;  1AD5 A;  4JPB W;  1O9S A;  1B07 A;  4R56 A;  3H0F A;  1D1B A;  3FJP A;  4C0D B;  4Z88 A;  3CCS T;  4RTV A;  3THK A;  4RG8 A;  1OPK A;  4J5Y A;  4IUU A;  4QT7 A;  3PGG A;  2X51 A;  2QA4 A;  4JS5 A;  1HXD A;  2X4J A;  2RHZ A;  3VS1 A;  2CP0 A;  3BFM A;  4M75 D;  1PNJ A;  4IUR A;  3CCU A;  2RJC A;  3RER A;  1WQ7 A;  2X3X D;  4M7A C;  3QG1 A;  3CBP A;  5GAM h;  3I56 Q;  1D3B B;  1YJW T;  1AWO A;  1NJI R;  1JJ2 P;  2LTO A;  1QVG P;  1TUG B;  1VA7 A;  1D3B A;  5GMK l;  2GTJ A;  8ATC B;  4QQD A;  1VQN Q;  1D0Z A;  4OP0 A;  1KD1 U;  2FZK B;  2KE9 A;  2LVM A;  1MNE A;  3NPF A;  4MZT A;  5LJ5 h;  4C8Q E;  1WHH A;  2KNB B;  5GMK j;  3TCJ A;  1TSF A;  3LGF A;  1VQ7 Q;  1V76 A;  3M4Y A;  1I5L A;  1DJ7 B;  3S6W A;  1Q81 U;  3OYA A;  3TRE A;  4PJO B;  5HCK A;  3CME A;  3OYC A;  1MUZ A;  4N4G A;  1U5S A;  2KBT A;  1YIJ A;  1EIF A;  1OX8 A;  3FLG A;  3INZ A;  4PJO D;  3OMC A;  1IZ6 A;  1WGS A;  4RCB A;  4M7A D;  4Q5W A;  4M77 A;  1JEG A;  4OGE A;  1QQJ A;  2OJ2 A;  4RMO A;  2BKD N;  3CD6 T;  3TU4 K;  1R77 A;  2RNA A;  3MO8 A;  2RQV A;  2KT1 A;  3CC7 A;  3CME T;  2HSE B;  2QAS A;  3ULR B;  4LDY A;  2DTH A;  4BE1 A;  5D6X A;  3V7R A;  5CQY A;  4E7K A;  2COZ A;  1I1J A;  4ELZ C;  1EZZ B;  3HPW A;  4F04 B;  3CCE A;  2EQK A;  1UTI A;  3V8K A;  4PJO E;  1WI7 A;  1WX6 A;  3EFO B;  2FRW A;  3L2Q A;  1K9M R;  1AWW A;  3GOX A;  2VYT A;  2F2X A;  1MV0 B;  2DET A;  4J9H A;  2HAX A;  2MI6 A;  3OS0 A;  3RIR A;  4M78 A;  3UWN A;  1SHF A;  1RAF B;  4J9E A;  3SWN C;  1VIF A;  3SHW A;  1YNZ A;  2P84 A;  2BE9 B;  1ZLM A;  1YCY A;  1IHV A;  1NBE B;  2EYW A;  2M1H A;  1VQ8 A;  5GAN 6;  1BI0 A;  4OF1 A;  3CCL A;  2Z0W A;  4J7I A;  4AFU C;  1H3Z A;  3L42 A;  4MDX A;  3LWH A;  2L8D A;  3GPL A;  3CCR Q;  2M9U A;  4DBQ A;  4F14 A;  1WXB A;  3DKM A;  1HSQ A;  2ZPF B;  3JB9 H;  4GLM A;  1HK9 A;  4JRI A;  2AHJ B;  5IT9 E;  2GF7 A;  4EMK A;  1D0X A;  2HL3 A;  1FX7 A;  4MML A;  1N9R A;  2LMJ A;  2LP5 A;  1ZQ1 A;  3S3O A;  1E7O A;  2DLP A;  3NMZ C;  5I11 A;  1RAH B;  2DXB A;  2OTL Q;  3JV3 A;  4O6J A;  3I55 A;  3N5B B;  4KBM B;  1ABO A;  3OYF A;  1XOV A;  4AG2 C;  3R6O A;  1E6G A;  2X4X A;  1PSF A;  3OYH A;  2DVE A;  1TH7 A;  1YBY A;  1JJ2 A;  4BAC A;  2RI5 A;  3VS0 A;  4NL3 A;  3L2R A;  1K0S A;  2MMP A;  3CPW A;  2K4Y A;  1S1N A;  4FL6 A;  4QW2 A;  5GAO m;  2CP2 A;  3OYI A;  2DX1 A;  3VS3 A;  2A7Y A;  2P0P A;  3P8B B;  4N0A A;  3M0S A;  4C0G A;  2GQV A;  2LJ0 A;  4NOY A;  1LPL A;  1SSF A;  4ZGE B;  2W10 A;  2HNI A;  1Q95 G;  3CCV T;  4C92 B;  4OMN A;  3EHQ A;  5CKB A;  2E3H A;  2HBW A;  1I4K 1;  1Q7Y C;  2YRV A;  3C12 A;  1JXM A;  3CCV Q;  2ATC B;  4RTW A;  4QQG A;  1XQH A;  2EBP A;  3E1S A;  5ECA A;  5IHK A;  4P5N A;  2LT4 A;  3ZBD A;  1PD0 A;  3ZEH A;  2MOX A;  3CPW S;  3CCE T;  2O31 A;  5IAY A;  2QGF B;  2CP7 A;  4FCY A;  3GLX A;  4XU0 A;  2ESW A;  1GRI A;  3CCV A;  4AMC A;  4D8K A;  2XDB A;  1QWF A;  4CRI A;  4JLI A;  3M9Q A;  1WA7 A;  4E7J A;  1Y71 A;  4M4Z A;  1GXI E;  2F2W A;  3JCM J;  4RTY A;  4C5G A;  1OZ2 A;  2DL3 A;  3CCQ Q;  1YJN Q;  1YIT A;  1NYG A;  2F69 A;  1HYO A;  3MCA B;  1VQ8 Q;  4IIM A;  2DAQ A;  3QUI A;  1G5V A;  5CKH A;  2GGR A;  1F1B B;  1R0C B;  1X6O A;  4J9G A;  1UB4 A;  1K9A A;  5CR2 A;  1M1K R;  2KRS A;  1ZUY A;  3NTH A;  2ZPI B;  1O75 A;  2ZZD A;  3CBM A;  4MZP A;  1PKT A;  1KC8 R;  4FM4 B;  2EVR A;  2JTE A;  4ZN3 A;  2MK5 A;  1OV3 A;  1YIT T;  1VQM Q;  1J3T A;  4F7U B;  4OMO A;  2DTI A;  1IO6 A;  5D6Y A;  1VQ4 Q;  2X35 A;  2DYB A;  4V2S A;  2OTL A;  2HCK A;  1VQP T;  3LGL A;  4JJD A;  1RAD B;  1ZA2 B;  3PE0 A;  1T0H A;  5FRO A;  4M7A A;  3CCS Q;  4M7D A;  2LRQ A;  3CCM Q;  1MGQ A;  4HCZ A;  4ZNX A;  2HEQ A;  3MP8 A;  4J83 A;  3EFO A;  4J6Y A;  2L3Q A;  3LLR A;  5FU7 B;  4M78 G;  1UEB A;  3MHX A;  1VQ6 A;  1QCO A;  2YSQ A;  1BYM A;  3CMA T;  2K3B A;  3VRZ A;  3CCM A;  2DIQ A;  1WNL A;  1P92 A;  5IHN A;  1WZO A;  1N8R U;  4EDU A;  5AT1 B;  3MEV A;  3RNJ A;  1ZBJ A;  1T3S A;  5KYY A;  1BKB A;  4KRT A;  1WIE A;  3HTR A;  1VQL T;  1Q81 R;  1M5Q 1;  4M77 C;  1BCM A;  1SSH A;  2QTV A;  3LW5 E;  3JCM c;  2YWW A;  3CCU Q;  1TXQ A;  5IN1 A;  2O4X B;  1VQN T;  2CT4 A;  3SEM A;  4EMG A;  3OBY A;  1PSE A;  4C8Q B;  2O88 A;  4FYY B;  2LX7 A;  4DOV A;  2RQU A;  1PWT A;  3REA B;  4KGV B;  2RHU A;  5IHI A;  1YHQ T;  1LJO A;  5GAN g;  1X6B A;  1W2B S;  2LCC A;  1SRM A;  1VQ7 T;  2Y4X A;  3I35 A;  3FC3 A;  2KYM A;  1X2Q A;  2E5Q A;  2KY9 A;  2ZCF B;  1N27 A;  3JCM W;  4C8Q C;  4JRP A;  2EQJ A;  1NG2 A;  1I8F A;  3CME Q;  1VQ5 Q;  2LZ6 B;  4JJC A;  1N8R R;  1QCN A;  1UDL A;  2L0A A;  1IRX A;  2GFU A;  5DLO A;  1AZE A;  5KYU A;  2AZV A;  4PJO F;  5HKC A;  2LQN A;  2P0K A;  5FWC A;  3WXM B;  4FW2 A;  3DLM A;  5LJ3 d;  5DM7 R;  2G6F X;  2K3Y A;  3MET A;  1Y57 A;  2YRD A;  2VUB A;  1BK2 A;  2LCL A;  2RJD A;  2RHI A;  3BW1 A;  1Y7X A;  4KUI A;  2WSE E;  4A63 B;  3NHN A;  2HQE A;  1NEB A;  3MEU A;  1RLP C;  1UFF A;  5KYX A;  2L3S A;  1RI0 A;  1EX4 A;  2YUP A;  3C4S A;  4D8D A;  4DBF A;  5KE3 A;  3CCU T;  2LT1 A;  2CYZ B;  2GFA A;  3REB B;  3DB4 A;  4E6R A;  1YJW Q;  3S3N A;  2EGA A;  2RQR A;  3EG0 A;  1WHJ A;  2EYY A;  4HA8 A;  5FRM A;  3H9N A;  1SHG A;  1KHC A;  3M0U A;  2HD0 A;  1YJ9 T;  2O4X A;  3HFO A;  3HSB A;  2XMF A;  2JXB A;  1Q86 C;  3SFM A;  5I2S A;  3QJ6 A;  3G6E T;  2DEU A;  4M7D D;  3H0H A;  3JSC A;  3AHU A;  4PFP A;  3G7Z A;  4LUD A;  1V29 B;  4IUV A;  1AWX A;  3OYD A;  4ATO A;  3JCM f;  1I5O B;  2K5F A;  4OB1 B;  1Q7Y U;  1VQ9 Q;  3OS1 A;  3I5R A;  1S72 Q;  1PC0 A;  2G3R A;  4DBH A;  3H8Z A;  2K6D A;  3SD4 A;  4BDZ A;  1W2B P;  2QQA A;  4M75 B;  2D0Q B;  5KCH A;  3CC4 A;  4JZ3 A;  3L2U A;  5CVI A;  2K79 A;  1M1G A;  5GAN d;  3MP1 A;  1VQ9 A;  3M4G A;  3TSW A;  3QO3 A;  2R5M A;  4JRK A;  1VYT A;  2VB6 A;  1R8O B;  4M7D F;  2F1L A;  4M77 G;  1UUE A;  3URG A;  5AYF A;  5IXB A;  2EW3 A;  4XTY A;  1KQS A;  1CKB A;  2WSF E;  2HBP A;  2XHC A;  3BDL A;  3NTI A;  2KRO A;  3EG2 A;  3D7S B;  2MWP A;  1ZUK A;  4PLI A;  1TS9 A;  1E6H A;  4C0D C;  3GBQ A;  3HL8 A;  1D09 B;  1W2B A;  2VV5 A;  2MYS A;  3RR6 A;  1VQK A;  4M7D B;  2HKQ B;  3VS2 A;  3QDR B;  1NPR A;  4FSS A;  4XU1 A;  5HK0 A;  2VGM A;  1X27 A;  2L89 A;  3JRZ A;  4FIB A;  4L5G A;  2DO3 A;  3TSZ A;  5D7U A;  2HQH A;  2QA4 Q;  3MP6 A;  4OML A;  1KC8 U;  2A28 A;  2DL4 A;  4J9C A;  3I56 A;  1RI9 A;  1KIK A;  4PJN A;  2PVO B;  1KK7 A;  3BDU A;  2I2L A;  3CCJ T;  1QP2 A;  2JJ9 A;  2M02 A;  1M4Z A;  2ROT A;  2O2O A;  2EAY A;  2H3J A;  1QKW A;  5GAM j;  2AZS A;  1SF9 A;  1ZHI A;  1UGS B;  5GAN j;  2D9T A;  1YJN T;  4AFZ C;  2BIV A;  2QTX A;  2D8H A;  2EJF A;  4JDS A;  4M75 A;  1N8R C;  3HHT B;  2RPN A;  2IIM A;  3QDF A;  2YLC A;  3CPF A;  4UC4 A;  2E3I A;  5LJ3 f;  2EJ9 A;  1VQ4 T;  2C0I A;  2P4T A;  3QPH A;  3EG9 A;  2EQI A;  2DYI A;  1QVF P;  2MWO A;  3RDV A;  4L6V 5;  4OB3 B;  4PJM A;  4LDX A;  5L23 A;  3MPU B;  3CC2 A;  3JCM d;  1OOT A;  4PL6 A;  1YHQ A;  2GQI A;  2KRN A;  5DLQ E;  1RLQ C;  1X6G A;  4BE2 A;  5GAM g;  1KG1 A;  3G1J A;  4QVC A;  3M59 A;  1Q81 C;  2DL5 A;  3CCQ A;  2FPE A;  5CCA A;  3WVD B;  2IG0 A;  3X25 B;  4IUQ A;  2RJF A;  3V7C A;  9ATC B;  2HSP A;  4LDV A;  1TG0 A;  2QEX T;  1QKX A;  3MEW A;  1KD1 C;  2DXU A;  3OW2 P;  2RF0 A;  2HKN A;  2DBK A;  1QWE A;  2CS7 A;  4RTX A;  2ZPB B;  2QYZ A;  3PT9 A;  1R0B G;  1ZSZ B;  4X1V A;  2CP3 A;  3C94 A;  1Q86 U;  3O8V A;  2DA9 A;  2KQW A;  1KD1 R;  3QSU A;  3EG3 A;  1H8K A;  4XU2 A;  1PRM C;  3JCM h;  2CDT A;  2JZ2 A;  1CSK A;  2KVQ G;  2DIL A;  3OYM A;  3OY9 A;  4F7U E;  4OGC A;  4LNP A;  4M75 F;  4QVZ A;  2M51 A;  2DBM A;  1GBR A;  1YIJ T;  2MIO A;  1UJ0 A;  2NUP A;  4J6X A;  4J8O A;  4PK4 A;  3UT1 A;  4N4I A;  3CMA A;  3FEO A;  3CD6 A;  1WXT A;  3M56 A;  2EWN A;  1G3T A;  2ED0 A;  4OVA A;  4FYX B;  4C5I A;  1NLP C;  2DXT A;  2CP6 A;  1BCO A;  2CZ0 B;  4HCK A;  5KCO A;  5FU6 C;  2DMO A;  7AT1 B;  1FXX A;  5GAO q;  4M78 F;  3CMA Q;  4M75 G;  1MMN A;  5I21 A;  1EFN A;  3UA6 A;  2H8H A;  1T0J A;  2DPP B;  3T9N A;  4D6W A;  3PVQ A;  4JUV A;  1M1F A;  3HRT A;  2RI2 A;  4DEY A;  3CXC S;  3VUZ A;  1SG5 A;  2A0F B;  2VVK A;  1IGU A;  2Y4Y A;  5EG2 A;  5LJ3 h;  2EYZ A;  2PTK A;  4ME7 A;  1K4U S;  4WCI A;  4XTZ A;  4M7A B;  2FL7 A;  2EPD A;  2MCN A;  4XK8 E;  2NLU A;  3UA7 A;  5EC7 A;  2X4W A;  1KQS P;  4K11 A;  2QQR A;  3Q1J A;  1TWB A;  1ACM B;  5GAO l;  4C92 D;  2NUZ A;  1KQ2 A;  2J05 A;  1OI1 A;  1X43 A;  4M77 F;  3BE3 A;  4M78 D;  1WFW A;  2COY A;  4NL2 A;  5GMK e;  2FVU A;  3A8O B;  1KFZ A;  1TOV A;  1AOJ A;  3PIO A;  1NE8 A;  2NUP B;  1RAE B;  2FB7 A;  4QQ6 A;  4JRQ A;  4BI4 A;  2LNV A;  2FZC B;  1K9M U;  1UGR B;  1OYX A;  2DZC A;  2PVG B;  3H6Z A;  1Z9Q A;  1KC8 C;  2K9G A;  3TVT A;  2OTL T;  2KYB A;  1D1A A;  4CC7 A;  2RMO A;  4X9C A;  3X28 B;  2EQU A;  2E4H A;  3I55 T;  4X34 A;  2LQK A;  2VGN A;  2X4Y A;  4LUE A;  2JN0 A;  5LJ3 j;  2YUO A;  1MMA A;  3QZ9 B;  2QXF A;  2R58 A;  5FU6 B;  2YUQ A;  1JO8 A;  1HJD A;  3UDC A;  4F7U G;  4ZTF A;  3NGP A;  3QBY A;  4X9D A;  4AT1 B;  5CKD A;  1QVF S;  2RA2 A;  5KYU B;  4FYV B;  4A4H A;  1V1C A;  1WLP B;  2KSS A;  4HCC A;  2CH4 W;  4Z89 A;  1W70 A;  5J3B A;  2F5T X;  1Y96 A;  5GAN 3;  3CXC A;  3OSV A;  2J6O A;  1I0C A;  1H3H A;  3H41 A;  1FWZ A;  1YI2 T;  4XTX A;  1WHL A;  3EG9 B;  2QI2 A;  2BTT A;  3PMI A;  3M58 A;  2DXC A;  1M3A A;  5GJW B;  6AT1 B;  3VS6 A;  3PMT A;  1U3O A;  4J6W A;  4EPC A;  3CC4 Q;  1JRI A;  1B34 A;  4RG2 A;  4PJJ A;  2BUD A;  3BY7 A;  5FU7 C;  3HRU A;  5A0G A;  1ZBX A;  2OAW A;  2BZX A;  3QXE B;  4M77 B;  3PVL A;  1TUD A;  2LX9 A;  3X26 B;  3G4S A;  1UG1 A;  5GAN 2;  1QMC A;  4RKU E;  4A4E A;  5CAI A;  2XKO C;  5GAN 4;  3JB9 I;  2B86 A;  3TQ7 P;  2VXE A;  2DD5 A;  3JCM b;  5GAN 7;  3F70 A;  3S3M A;  5HK3 A;  1PD1 A;  4A4F A;  2ZPH B;  1XTD A;  1K8A U;  3VV0 A;  4ZTJ A;  5GMK h;  1SEM A;  1KSW A;  4J7F A;  1GCQ C;  2X9H A;  2EQM A;  4ESR A;  4J9B A;  2EYQ A;  4GLK A;  4KUL A;  2QEX Q;  3JB9 D;  3GNG A;  5I2M A;  1RAG B;  2JW4 A;  1W4S A;  4BI3 A;  2KT8 A;  4DEX A;  1QVF A;  2P4R A;  2PZ1 A;  2YDL A;  2RB6 A;  4C0F A;  1WJQ A;  2VAS A;  4HKE A;  3SB2 A;  3EGD B;  4Y92 A;  1OPL A;  3CC7 Q;  3VUB A;  2QEX A;  1K8A C;  5M9O A;  4Y28 E;  1X69 A;  4MMK A;  4ZN1 A;  2JVV A;  4MDW A;  2YRC A;  4B6M A;  2DRM A;  2DEQ A;  2O01 E;  2CH4 A;  3CXC P;  4KH0 B;  1GFC A;  4PJL A;  4C92 F;  1VQO T;  4BY6 B;  3CQT A;  4B9W A;  4M77 D;  1QCF A;  4XAX B;  2SRC A;  4NS5 A;  2V8J A;  5LJ5 g;  3OYY A;  1Q86 R;  2Y90 A;  3OYK A;  2HZY A;  5GAO p;  2QQ9 A;  3QYG B;  3OYN A;  2FO0 A;  1Q82 R;  2WSC E;  4M7D E;  3CCR A;  5J26 A;  3ZFJ A;  4HXJ A;  2YLB A;  1K73 U;  1MMD A;  2LQ8 A;  3OA6 A;  2LCS A;  3E9F A;  4IKF A;  1X75 C;  2KRM A;  2DL8 A; 
#chains in the Genus database with same CATH homology
 2PVO B;  4M77 E;  1BI2 A;  4KUD K;  3BDU A;  3DKM A;  2ZPF B;  3OBW A;  3PIP A;  2E12 A;  2I2L A;  4KT0 E;  2L5Q A;  2XDP A;  5A2Q E;  3JB9 H;  3WVE B;  1HK9 A;  4JRI A;  2AHJ B;  3CCJ T;  5IT9 E;  1JJ2 S;  1QP2 A;  2GF7 A;  1QP3 A;  4E7H A;  4EMK A;  2ZPE B;  1VQ4 A;  5GAO r;  1FX7 A;  1M4Z A;  2YHT A;  4FSX A;  4MML A;  2RM4 A;  2VXF A;  1N9R A;  2ZPG B;  2EAY A;  1ZQ1 A;  2H3J A;  4A4G A;  3S3O A;  5FRN A;  5GAM j;  3G71 T;  4MZM A;  1ZHI A;  2DIG A;  1UGS B;  2XI9 A;  3FDR A;  4M75 C;  2D9T A;  5GAN j;  5GAN e;  2DXB A;  4XU3 A;  1YJN T;  4BDY A;  3JCM P;  2BIV A;  1UGP B;  2DD4 A;  1QVP A;  2OAU A;  4O6J A;  2QTX A;  3I55 A;  2K5I A;  4XTV A;  3UPU A;  3JB9 G;  1Q82 U;  3N5B B;  4KBM B;  4C8Q F;  3RES A;  2FYK A;  3OYF A;  2EJF A;  1XOV A;  3R6O A;  3A8M B;  4JDS A;  2VC8 A;  4M75 A;  2X4X A;  1N8R C;  4C92 A;  3KUF A;  1PSF A;  3HHT B;  3OYH A;  2DVE A;  4B9X A;  1TH7 A;  1YBY A;  4E47 A;  4O5V A;  1JJ2 A;  1BI3 A;  4OMF B;  4BAC A;  1G3S A;  2RI5 A;  4PJO A;  4NL3 A;  3L2R A;  2MMP A;  2YLC A;  1K73 C;  3CPF A;  3CPW A;  2RJE A;  2K4Y A;  2QA4 T;  4UC4 A;  4FL6 A;  4QW2 A;  5LJ3 f;  3JCM g;  2EJ9 A;  3QII A;  5GAO m;  1VQ4 T;  2P4T A;  3QPH A;  4M78 E;  2E10 A;  3OYI A;  1AHJ B;  2RD1 A;  3RMQ A;  2QQS A;  2A7Y A;  4DQ2 A;  2C06 A;  3LWI A;  2P0P A;  3P8B B;  4TVR A;  2MWO A;  1MHN A;  1N9S A;  1WJR A;  1VQ7 A;  4N0A A;  4L6V 5;  4OB3 B;  4C0G A;  3FB9 A;  4LDX A;  2GQV A;  1X01 A;  1RL2 A;  3OS2 A;  3JCM d;  3CC2 A;  5FLX E;  2ZGW A;  5CIU A;  4PL6 A;  4NOY A;  3OMG A;  1YHQ A;  3M5A A;  4A53 A;  5DLQ E;  3PTA A;  2JTM A;  2V8I A;  1SSF A;  2QQB A;  2XDD A;  4ZGE B;  4BE2 A;  1G3W A;  5GAM g;  1JB0 E;  2HNI A;  1M1K U;  3CCV T;  4C92 B;  1KG1 A;  2OTJ A;  4WF2 A;  3X20 B;  3CCL T;  4QVC A;  3M59 A;  2RK1 A;  5CKB A;  1I4K 1;  4EMH A;  1Q7Y C;  2YRV A;  1Q81 C;  3C12 A;  3CCQ A;  5A0D A;  4HCB A;  4QQG A;  5CQX A;  1XQH A;  3E1S A;  1M9S A;  3VJP A;  5CCA A;  3WVD B;  2IG0 A;  3X25 B;  3EFR A;  2XG8 D;  2KAF A;  2DKG A;  4P5N A;  2LT4 A;  1VQL A;  4RCC A;  4IUQ A;  2RJF A;  4OB0 B;  3V7C A;  3ZBD A;  4BD3 A;  1H64 1;  4LDV A;  3ZEH A;  5GAM e;  1Q82 C;  4F7U F;  3I56 T;  2QEX T;  3CPW S;  3CCE T;  3MEW A;  3G6E A;  1KD1 C;  3VKI A;  4BB7 A;  5GAN h;  5IAY A;  5C0M A;  1KQ1 A;  1N6A A;  1VQK T;  4M7D C;  2DXU A;  4FU6 A;  3GLX A;  3JB9 F;  3A8G B;  4XU0 A;  3CCV A;  2XDB A;  3A5Z B;  4C8Q G;  1UGQ B;  4PJO C;  2OTJ T;  3EAE A;  3A8L B;  4CRI A;  2CS7 A;  3JAM E;  2E41 A;  5GAN 5;  2XU8 A;  4BI8 B;  5C6S A;  4M7A F;  3M55 A;  4JLI A;  2ZPB B;  3M9Q A;  3L2V A;  3PT9 A;  2JNG A;  2DTO A;  3E19 A;  4E7J A;  4XQ3 A;  4C5E A;  3HFN A;  5CO7 A;  3OYB A;  1NJI C;  1Y71 A;  3HKS A;  2KMT A;  1GXI E;  2K5L A;  4C0Z A;  3C94 A;  3CCR T;  1Y07 A;  3O8V A;  1Q86 U;  4M7A G;  2E65 A;  3JCM J;  4JLG A;  1VQ5 T;  3C95 A;  2KQW A;  1YJ9 A;  3QSU A;  4C5G A;  1OZ2 A;  1JBM A;  2CZ6 B;  4XU2 A;  1YIT A;  2F69 A;  3JCM h;  3MCA B;  1G5V A;  2DAQ A;  3QUI A;  5CKH A;  2JOY A;  1X6O A;  2JZ2 A;  1UB4 A;  3L2W A;  5CR2 A;  2KVQ G;  4DA4 A;  5DY9 A;  3NTH A;  3OY9 A;  3OYM A;  4F7U E;  4ZGD B;  2ZPI B;  4II1 A;  1O75 A;  4OGC A;  1KQS S;  2ZZD A;  4LD9 K;  3CBM A;  3GIB A;  4M75 F;  4MZP A;  4QVZ A;  3P8H A;  1VQN A;  2PU9 B;  5GMK m;  3CBO A;  1YIJ T;  1WPY A;  3CC4 T;  5GAM d;  3RMS A;  4FM4 B;  4J6X A;  4J8O A;  2JTF A;  3L2Z A;  2CZ1 B;  4LDW A;  4ZN3 A;  1VIE A;  3G71 A;  4LDU A;  4BUG A;  1YIT T;  3UT1 A;  4N4I A;  2E1H A;  4F7U B;  3CMA A;  3CCQ T;  3FEO A;  2RK2 A;  2CKK A;  1VQ9 T;  5KH6 A;  3CD6 A;  1LNX A;  3M56 A;  2DTI A;  4C8Q D;  2EWN A;  1G3T A;  3KXT A;  4OVA A;  3JCM e;  2PUO B;  5D6Y A;  2KK4 A;  2X35 A;  3CCS A;  1VQM A;  4C5I A;  4V2S A;  3J81 E;  1QVG A;  2OTL A;  2MAM A;  2DXT A;  1VQP T;  3LGL A;  2E6Z A;  1I81 A;  2CZ0 B;  3P8D A;  5KCO A;  3E9G A;  5FU6 C;  5FRO A;  1FXX A;  3L1A A;  4M7A A;  5GAO q;  4M7D A;  4M78 F;  2LRQ A;  4M75 G;  5I21 A;  1MGQ A;  5J39 A;  2QDY B;  4HCZ A;  1VQP A;  1YJW A;  4BY6 C;  2DPP B;  1BI1 A;  2R5A A;  3MP8 A;  4IUP A;  4J83 A;  3T9N A;  4J6Y A;  2FHD A;  4D6W A;  5CK9 A;  2RHX A;  3TEE A;  3LLR A;  4JUV A;  1M1F A;  4ELY C;  5FU7 B;  4M78 G;  1U8R A;  1UEB A;  3M57 A;  3MHX A;  1VQ6 A;  3HRT A;  4EMK B;  1K9M C;  1BYM A;  3M53 A;  3CMA T;  2RI2 A;  1U1S A;  4JS4 A;  5LJ5 d;  2E70 A;  3VUZ A;  3CXC S;  2GCX A;  4Y91 A;  3CCM A;  1OZ3 A;  5LJ3 e;  3GP8 A;  2DIQ A;  1WNL A;  3V8L A;  1P92 A;  3OB9 A;  4FT4 A;  5A0L A;  2Y4Y A;  5L8R E;  1N8R U;  4EDU A;  5EG2 A;  3QKJ A;  3QJY A;  5LJ3 h;  1S72 T;  1QW1 A;  4ME7 A;  3MEV A;  4XTZ A;  4M7A B;  3V8J A;  2P0Q A;  4E7I A;  2FL7 A;  3CCM T;  3M54 A;  2K2V A;  4XK8 E;  1BKB A;  4GY5 A;  3VYG A;  1VQL T;  2NLU A;  2EIF A;  3RKY A;  3DLL A;  3QHS A;  1M5Q 1;  4M77 C;  1XNI A;  3KBG A;  5CKE A;  5CKF A;  3LW5 E;  2X4W A;  3JCM V;  3JCM c;  4VUB A;  2QQR A;  3Q1J A;  3RKW A;  4M75 E;  3VYH B;  5GAO l;  4C92 D;  3FIF A;  1WQW A;  5IN1 A;  2CZ7 B;  3OYG A;  1KQ2 A;  4A54 A;  1M90 C;  2XD0 A;  1OI1 A;  4M77 F;  2PUK B;  4M78 D;  2O4X B;  1VQN T;  4EMG A;  4OB2 B;  3GNF B;  4NL2 A;  3OBY A;  1PSE A;  5GMK e;  4C8Q B;  3RKX A;  2FVU A;  3ME9 A;  3A8O B;  1B34 B;  4N4H A;  4DOV A;  3A8H B;  4M78 B;  4XTU A;  3PIO A;  1M8V A;  1NE8 A;  5KE2 A;  4JRQ A;  2FB7 A;  4QQ6 A;  4BI4 A;  2LNV A;  2RHU A;  4PKC C;  1NJI U;  4ZGJ B;  1YHQ T;  3OW2 A;  1K9M U;  1LJO A;  1UGR B;  3CC2 T;  1OYX A;  3LYI A;  5GAN g;  1W2B S;  2DZC A;  2LCC A;  2PVG B;  3H6Z A;  1KC8 C;  1VQ7 T;  3JCM X;  2Y4X A;  2EFI A;  1VQM T;  2RI3 A;  2JUF A;  3FC3 A;  2OTL T;  2E5Q A;  2KY9 A;  1VQ5 A;  4M7D G;  3V7S A;  2ZCF B;  1N27 A;  2LC4 A;  4X9C A;  3X28 B;  3JCM W;  4M7A E;  2EQU A;  2M16 A;  3NFC A;  4PJO G;  4C8Q C;  3I55 T;  5LJ5 f;  4LD6 A;  4JRP A;  4N0A C;  4C92 G;  2EQJ A;  4X34 A;  1I8F A;  2DK3 A;  2LQK A;  2VGN A;  2X4Y A;  1M1K C;  2JN0 A;  5LJ3 j;  2EKO A;  2GFU A;  2PQW A;  2XK0 A;  2F5K A;  2QXF A;  3ASK A;  3QZ9 B;  2R58 A;  5DLO A;  2HQX A;  4E7L A;  4DOW A;  2IVW A;  5FU6 B;  1VQO A;  4PJO F;  5HKC A;  3UDC A;  2P0K A;  3WXM B;  4F7U G;  5GAO n;  4ZTF A;  4X9D A;  3QBY A;  3DLM A;  3GF5 A;  5CKD A;  5LJ3 d;  5DM7 R;  3SDZ A;  1QVF S;  2RA2 A;  2K3Y A;  3MET A;  3OS5 A;  3DB3 A;  4A4H A;  5D6W A;  2VUB A;  1YJN A;  4HT8 A;  2KSS A;  4HCC A;  2LDM A;  3PFS A;  2LCL A;  2RJD A;  2RHI A;  4R55 A;  1IRE B;  3BW1 A;  1Y7X A;  4KUI A;  5J3B A;  3CC7 T;  2WSE E;  1M90 U;  2E64 A;  2HQE A;  2WAC A;  3VU3 C;  2F5T X;  1Y96 A;  5GAN 3;  3CXC A;  5LJ3 g;  5GMK i;  3SWN B;  1O9S A;  3OSV A;  3OQ5 A;  4R56 A;  3MEU A;  1FWZ A;  5LJ5 e;  3FJP A;  4C0D B;  1YI2 T;  4XTX A;  4PLL A;  1RI0 A;  4XTW A;  3CCS T;  2QI2 A;  3PMI A;  3C4S A;  3SWN A;  1Y96 B;  4RG8 A;  3M58 A;  5KE3 A;  3CCU T;  2LT1 A;  2DXC A;  2CYZ B;  2GFA A;  3J7A F;  3DB4 A;  3MEA A;  4J5Y A;  1BIB A;  4IUU A;  3S3N A;  3PGG A;  4A4K A;  4EMK C;  2B8A A;  3PMT A;  2QA4 A;  4JS5 A;  1U1T A;  4J6W A;  1HXD A;  4HT9 A;  2X4J A;  2RHZ A;  1JRI A;  2RHY A;  4HA8 A;  4EPC A;  1B34 A;  4RG2 A;  3BFM A;  5FRM A;  4M75 D;  4IUR A;  3CCU A;  1KHC A;  2BUD A;  2HD0 A;  2RJC A;  1YJ9 T;  1WQ7 A;  4YTL A;  1NZ9 A;  3BY7 A;  3RER A;  5FU7 C;  4M7A C;  3HRU A;  3QG1 A;  2O4X A;  3CBP A;  3HFO A;  5GAM h;  5A0G A;  1D3B B;  3HSB A;  1Q86 C;  1ZBX A;  4FT2 A;  3SFM A;  5I2S A;  1YJW T;  2R57 A;  3QJ6 A;  3QXE B;  2LTO A;  3OSS C;  4M77 B;  2RH2 A;  4C5H A;  4QVD A;  3G6E T;  1D3B A;  2LX9 A;  3X26 B;  3G4S A;  5GMK l;  4M7D D;  3AHU A;  3JSC A;  4F7U A;  4QQD A;  3JCM Q;  3G7Z A;  3QYH B;  3PNW C;  4OP0 A;  3RUX A;  5GAN 2;  1KD1 U;  2LVM A;  4MZT A;  3OW2 S;  1V29 B;  4IUV A;  4C8Q E;  5LJ5 h;  4RKU E;  4A4E A;  5HY6 A;  2XKO C;  5CAI A;  3OYD A;  5GAN 4;  5GMK j;  5GAN 8;  3JB9 I;  3TCJ A;  1KHI A;  3JCM f;  4ATO A;  1S72 A;  3ER0 A;  3LGF A;  2VXE A;  2DD5 A;  3JCM b;  5GAN 7;  1VQ8 T;  2K5F A;  3F70 A;  2MF2 A;  3S3M A;  5HK3 A;  3M4Y A;  1I5L A;  1DJ7 B;  4OB1 B;  3S6W A;  1Q7Y U;  1Q81 U;  4M78 C;  3OYA A;  3TRE A;  3OS1 A;  3OYE A;  4PJO B;  4A4F A;  2ZPH B;  2G3R A;  1XTD A;  3CME A;  1K8A U;  3H8Z A;  3LH0 A;  3OYC A;  3SD4 A;  4N4G A;  3VV0 A;  3JB9 J;  4ZTJ A;  5GMK h;  2V8K A;  4BDZ A;  1YIJ A;  2QQA A;  4M75 B;  1EIF A;  2D0Q B;  3FLG A;  3INZ A;  5KCH A;  3CC4 A;  4PJO D;  3OMC A;  4J7F A;  5GAN f;  1IZ6 A;  3HRS A;  3NTK A;  2XIC A;  5CVI A;  1LOJ A;  1WGS A;  4RCB A;  3L2U A;  4M7A D;  3CCJ A;  4Q5W A;  5GAM f;  4M77 A;  2EQM A;  2EYQ A;  1M1G A;  2K57 A;  4OGE A;  5LL6 S;  4GLK A;  5GAN d;  3MP1 A;  2K3X A;  1VQ9 A;  3M4G A;  4RMO A;  4KUL A;  3JB9 D;  2BKD N;  3CD6 T;  3GNG A;  5I2M A;  4L59 A;  3QO3 A;  1W4S A;  3TU4 K;  2R5M A;  4JRK A;  4BI3 A;  3LX7 A;  3EFS A;  3QZ5 B;  1R8O B;  4M7D F;  4M77 G;  1QVF A;  3MO8 A;  3URG A;  1VQ6 T;  2RB6 A;  1QVG S;  5AYF A;  3CC7 A;  4C0F A;  1WJQ A;  4XTY A;  3CME T;  2EJG A;  1KQS A;  2A3L A;  1WJS A;  4LDY A;  2DTH A;  4HKE A;  4BE1 A;  3SB2 A;  2WSF E;  5D6X A;  2RO0 A;  3V7R A;  3OYL A;  1YI2 A;  4PNO A;  2HBP A;  2XHC A;  1NPP A;  3VUB A;  2QEX A;  5CQY A;  3CEY A;  5M9O A;  4Y28 E;  3BDL A;  4E7K A;  1K8A C;  3NTI A;  4MMK A;  1BIA A;  5LJ5 j;  4BE0 A;  2KDS A;  4ELZ C;  3HPW A;  4C92 E;  4ZN1 A;  2DJZ A;  3J80 E;  2L3R A;  3CCE A;  2EQK A;  2JVV A;  2MWP A;  2XID A;  4PLI A;  4MDW A;  2DEQ A;  3V8K A;  2O01 E;  4PJO E;  4C0D C;  3HL8 A;  3L2Q A;  2CGH A;  3GOX A;  2E6N A;  2VYT A;  1W2B A;  2VV5 A;  2HAX A;  2PVD B;  1G3Y A;  2MI6 A;  1VQK A;  3HP9 A;  3OS0 A;  4M7D B;  3RIR A;  4C92 F;  4M78 A;  3UWN A;  4Z02 A;  1VQO T;  1VUB A;  4BY6 B;  3QDR B;  4B9W A;  1NPR A;  4M77 D;  4XAX B;  4C8Q A;  4IUT A;  2V8J A;  4NS5 A;  5LJ5 g;  3SWN C;  3OYY A;  4XU1 A;  1VIF A;  2Y90 A;  4C92 C;  5HK0 A;  2VGM A;  3G4S T;  3JRZ A;  2L89 A;  4L5G A;  4FIB A;  3OYK A;  2DO3 A;  2D6F A;  1YCY A;  2M0O A;  2QQ9 A;  3QYG B;  5GAO p;  3OYN A;  4JJN K;  3X24 B;  4CI0 C;  1VQ8 A;  2M1H A;  5GAN 6;  1BI0 A;  4OF1 A;  2WSC E;  3CCL A;  3FRN A;  3MP6 A;  4J7I A;  3OYJ A;  3CCR A;  4M7D E;  1KC8 U;  5J26 A;  3ZFJ A;  1H3Z A;  3L42 A;  4MDX A;  2YLB A;  1K73 U;  2DZ9 A;  3LWH A;  2LQ8 A;  3OA6 A;  2L8D A;  3E9F A;  4IKF A;  3I56 A;  1X75 C;  3GPL A;  2M9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...