1HD3A

A-spectrin sh3 domain f52y mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
GKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGYVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytoskeleton
molecule keywords SPECTRIN ALPHA CHAIN
publication title Unspecific Hydrophobic Stabilization of Folding Transition States
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hd3A00
3M0QA 2NWMA 4OMNA 2YSQA 2W0ZA 4CC7A 3RBBB 3VRZA 1Y57A 1AZGB 3UA7A 1JU5C 1AVZC 1FYNA 2DRMA 2DVJA 2AZSA 2EPDA 1KJWA 1A0NB 1TUDA 1LCKA 2LNHB 2CH4A 2CDTA 1H3HA 1E6GA 5I11A 2C0IA 2J6FA 2AKLA 2DJQA 2M51A 2AKKA 3NGPA 2RQTA 4IIMA 1X27A 1M3CA 2EVRA 2FRYA 3NMZC 1X6GA 4JZ3A 4J9IA 4AG1C 1SRMA 2M0YA 1QCFA 5IHIA 4QT7A 1WFWA 1K76A 1PWTA 4HXJA 2ECZA 4LNPA 3EG0A 1BBZA 4Z88A 2K2MA 2DBKA 3UF4A 2RQWA 2PTKA 2BZXA 1UGVA 1PRLC 1NM7A 2DILA 3TVTA 2V1QA 4GLMA 1UUEA 2DNUA 2FO0A 2J06A 2LX7A 1T0HA 1YWPA 1B07A 1HJDA 1M3AA 2K9GA 2YUNA 2HBWA 2A36A 2ED1A 2KBTA 4JPBW 1FMKA 4J9HA 3M0UA 4KRTA 1YN8A 1WYXA 3QWYA 2E5KA 5GJVB 1EFNA 2EYXA 2H8HA 4F17A 1K9AA 1NLOC 2LJ3A 2KYMA 1H8KA 1W70A 2KXDA 2O31A 1GRIA 2ABLA 4JZ4A 1VYTA 3SHWA 1KSWA 2O2OA 2EQIA 1XOVA 2P4RA 3PVQA 2L3SA 2FRWA 3A98A 2K3BA 2GNCA 2KR3A 1CKBA 2KYBA 4AG2C 2HCKA 4JJBA 1IO6A 2DMOA 2ED0A 3VS3A 2D8HA 2OJ2A 4R0KA 1AD5A 4AFSC 2EKHA 4LN2A 3REBB 2V1RA 1KFZA 2DL3A 4CC2A 2X3XD 2J6OA 1NYFA 1ABQA 2YUQA 2FPFA 2ENMA 2GTOA 2KRSA 1AWJA 1M27C 2RQUA 4HVVA 1OPKA 3PE0A 3I5RA 1WIEA 4F14A 1CKAA 4OMLA 2YUPA 2K79A 4RTZA 1UJ0A 2A37A 3VS0A 3UATA 2L0AA 5FW9A 1WDXA 3VS2A 1NLPC 1ARKA 4ORZA 1ZX6A 2D0NA 1UDLA 1GFCA 2DF6A 4HCKA 4J9GA 1QLYA 4RTUA 4E6RA 2CT3A 3M0SA 2RF0A 1NEGA 2DA9A 1BU1A 1OOTA 4J9CA 2KE9A 1RLQC 4ZNXA 2EYWA 4OMMA 2PZ1A 1PKSA 1I0CA 2RMOA 2JT4A 2EYZA 2OAWA 1U3OA 4LUEA 1QKWA 1E6HA 2ROLA 1M3BA 1UJYA 5IH2A 1MV3A 1YP5A 1K0XA 2AZVA 4LUDA 1I07A 1OPLA 3M0RA 1VYUA 4Z8AA 1WXUA 1Y0MA 1M30A 4X1VA 2KEAA 2EBPA 3NPFA 3SEMA 3QWXX 2W10A 2CT4A 3GBQA 2CSQA 1AWWA 3VS1A 1TUCA 1RLPC 2DX1A 1K1ZA 4ESRA 3IQLA 1ZUUA 1N5ZA 4RTVA 4WCIA 2KT1A 2CREA 3NHNA 3H0IA 1BK2A 2YT6A 3VS7A 3VS5A 2DL8A 2DM1A 3PVLA 3VS4A 2L2PA 2X3WD 2JS0A 4RUGA 2VWFA 2EYYA 4A63B 3THKA 1WX6A 4CC4B 2LMJA 1TG0A 1JEGA 1G83A 3VRYA 2MIOA 2KRNA 2DLPA 1U5SA 1GCQA 2KNBB 2LCSA 1U06A 1T0JA 1MV0B 2AK5A 1YWOA 2J6KA 3UA6A 1GCPA 4LE9A 2JMCA 3LH5A 2OI3A 3CQTA 1SHGA 1OV3A 1AZEA 1X2QA 1AWXA 3TSWA 2C0TA 2FEIA 2NUZA 2EW3A 1NYGA 2L3QA 1AOJA 2K7AA 1W1FA 2RPNA 2RNAA 2CSIA 1QWEA 4K11A 4RTYA 1HD3A 5L23A 1S1NA 1X6BA 3H41A 1PNJA 3H0HA 2GQIA 1VA7A 1M8MA 1E7OA 2LZ6B 3R6NA 1V1CA 2BZ8A 1SEMA 5FWCA 2J7IA 1UG1A 3KFVA 3ZL7C 1AWOA 2MCNA 1ZUKA 2L3PA 1PRMC 2B86A 2HSPA 4J9DA 2GTJA 4RTWA 4JJCA 1UECA 1X43A 2EGEA 1B3QA 1KIKA 4J9BA 2CUBA 3M0PA 3I9QA 1WA7A 3EG1A 2KGTA 2LJ0A 1MUZA 5EC7A 1ZBJA 2JM8A 2VKNA 2VVKA 2A28A 1RUWA 2O9VA 4RTTA 5I22A 2DBMA 1UFFA 1W6XA 2ESWA 3I35A 2SRCA 2EGCA 1ABOA 2KRMA 3TSZA 3H0FA 2JW4A 2KROA 1UHCA 2YDLA 1NG2A 1GCQC 2HDAA 2XMFA 2MOXA 1GBRA 2F2WA 1T3SA 2J05A 4OMPA 1BB9A 1CSKA 3EGUA 5ECAA 2D8JA 2I0NA 2PNIA 2JXBA 1YNZA 5IXFA 2SEMA 3EG2A 2LP5A 3U23A 2DYBA 2JM9A 2JMAA 2LJ1A 4DEXA 2DRKA 3ULRB 3EG3A 2EGAA 2CUDA 2F2XA 1JO8A 1HSQA 3VS6A 2KXCA 2IIMA 2JS2A 2GGRA 2LQNA 1WLPB 3EHRA 5IHKA 1GL5A 4D8DA 4GBQA 4FSSA 1Z9QA 1I1JA 2DL5A 2HEQA 1Z9ZA 2QDLA 1SPKA 1NEBA 1JXOA 2FPEA 3M0TA 1PHTA 1K0SA 2DE0X 2YUOA 1OEBA 2O88A 1K4US 1YCSB 2JTEA 3O5ZA 5FWBA 4AFUC 1AEYA 5IHNA 2RQVA 2CH4W 4AFZC 1WI7A 4D8KA 2G6FX 1QWFA 2DL4A 1SHFA 2LQWA 1ZLMA 2BZYA 1SRLA 2ROTA 1ZSGA 4DEYA 2RQRA 4F16A 4JJDA 2O9SA 2BTTA 3C0CA 1PKTA 2FG0A 2K6DA 3RNJA 4J9EA 5GJWB 1X2KA 3EHQA 1GBQA 1JQQA 3REAB 4HVWA 1WXBA 4M4ZA 1T3LA 1ZUYA 2DL7A 3JV3A 4OMOA 1SSHA 1WXTA 1VYVA 1H92A 4EIKA 2A08A 1RI9A 1UE9A 1X69A 1QKXA 2KT8A 4IIOA 4RTXA 5IXBA 4J9FA 4Y92A 2RN8A 2FPDA 4AFQC 2C0OA 2F2VA 1J3TA 4CC3A 4HVUA 2GBQA 1GFDA 2D1XA 1UTIA 1UHFA 3FJ5A 1JXMA 4OMQA 5HCKA 1G2BA 4Z89A 3I5SA
chains in the Genus database with same CATH superfamily
3JCMc 2YSQA 1RACB 4CC7A 3V8JA 1Y57A 5KCHA 4ELYC 2CZ0B 2Y90A 1A0NB 3M57A 1VQKT 5LJ5d 2VASA 1RL2A 1PD1A 1H3HA 4IIMA 4DBFA 1WNLA 3CMEA 2G3RA 3LGLA 3LWHA 3ASKA 1NJIR 2M0YA 4HKEA 4LDVA 1WFWA 2H3JA 1K76A 2RH2A 4JRKA 4M78E 4RCBA 2ECZA 4X34A 3HFNA 3JCMW 1YBYA 5HK0A 1BBZA 4Z88A 5A0DA 5GAMd 2WSFE 3A8OB 3CCQQ 2WSCE 4M75E 2E41A 4AT1B 4GLMA 2FO0A 2J06A 3GF5A 1YWPA 5LJ3d 1B07A 2LQ8A 1M3AA 2YUNA 3JCMe 2HBWA 3JCMg 5GAOn 1BKBA 2B8AA 5CKDA 4M77B 4JPBW 2JNGA 4KRTA 3CEYA 5CIUA 4C8QA 4CRIA 2H8HA 4BI4A 5A2QE 2LJ3A 3OQ5A 4BDZA 2KYMA 2VGMA 1K9MC 4LDWA 4JZ4A 1N27A 4FYVB 3CCJQ 3FIFA 2P4RA 4EPCA 2L3SA 2FRWA 3A98A 2D0QB 3X24B 3HKSA 1UGQB 2QASA 3JB9F 1D0XA 4EMGA 3ER0A 1XTDA 3ME9A 3OBWA 3CCEA 4BY6C 4CI0C 2D8HA 4C8QF 4BUGA 1D1CA 3UPUA 1WQ7A 1AD5A 4AFSC 2V26A 4CC2A 1H3ZA 2DTOA 2X3XD 3PT9A 4XAXB 3OYDA 2RA2A 4KGXB 2YUQA 3GPLA 2ENMA 3CCRA 5C0MA 3HHTB 1AWJA 1O75A 1EIFA 4FSXA 1MNDA 3I5RA 5FLXE 4F7UE 2EJGA 3CCSQ 3OYHA 2L0AA 1S72T 3OYBA 1XJWB 2CYZB 2GFAA 1NLPC 4JLIA 1UDLA 4A54A 4M7DD 4J9GA 3ZFJA 3FC3A 1N6AA 1BU1A 2RHXA 4M77C 1NPRA 4BE2A 3OW2P 1VQKQ 4J9CA 2KE9A 2EYWA 3C4SA 2EYZA 1KHCA 1WGSA 4M78D 1QVGS 2E3IA 4LUEA 4E7HA 1MMGA 3CCLA 2E6NA 1WHHA 2ROLA 1KHIA 2RD1A 2K4YA 2CP7A 4AMCA 3OB9A 5GAN5 1MV3A 1VQLT 1K0XA 3CBOA 4LUDA 1M5Q1 1VYUA 3OYJA 4Z8AA 1SF9A 1WXUA 1K73U 2MWOA 1Y0MA 1M30A 5KYWB 3SEMA 1AHJB 3HRTA 5L8RE 3G4SA 1H641 1TUCA 1WPYA 2DX1A 3SD4A 4LDYA 1HYOA 3CC4A 2ZCFB 3JCMV 4WCIA 1Q7YR 4IUTA 1TWBA 1N9SA 2X9HA 3EFSA 3VS4A 2X3WD 2YRDA 2OTJA 3OYKA 3THKA 3QHSA 4DOWA 2LMJA 1M1FA 2LCCA 1G83A 1RAFB 2DTIA 1U5SA 4RG2A 4OMFB 3L2QA 5KYYB 1T0JA 2ZPGB 4XTZA 4PJJA 4C92C 1IZ6A 5I21A 1AZEA 2E12A 4Y28E 3PGGA 2XDBA 1YI2T 2HKQB 3QYHB 2L3QA 2EQUA 3RMSA 1AOJA 3V7SA 2RNAA 2GQVA 2CSIA 1QWEA 4YTLA 1S72Q 4FL6A 4RTYA 5L23A 3QIIA 4M78B 1X6BA 3H41A 1VQ4A 1FMWA 1VA7A 2KMTA 2OAUA 2KVQG 1BI2A 3R6NA 1QCOA 3F70A 4FT2A 1TXQA 4M75B 3M4GA 3KFVA 1B34A 3MEAA 3QDFA 1QP3A 1ZUKA 4JS5A 1YJWA 3OS1A 2Y4YA 3CC2T 1SKUB 2ZPIB 2FZKB 1X43A 2DD5A 4WF2A 5GANh 4MMLA 1W2BP 3OS0A 5GMKh 3L2VA 2RB6A 2LJ0A 3QKJA 1VQLQ 3CCUA 2VKNA 2NLUA 1RUWA 4RTTA 3CC7A 1YJ9A 1UFFA 1W6XA 2ESWA 3I35A 4R55A 2SRCA 3E2UA 3JAME 4HT8A 5HKCA 4BI8B 1NG2A 3WXMB 5CR2A 2HDAA 5GMKl 1GBRA 1YIJA 5D6WA 2J05A 1BB9A 1BCOA 1R0CB 1CSKA 3QO3A 5ECAA 4DOVA 2P0PA 3META 2JXBA 5J3BA 2BE7D 2VV5A 5GANj 4ZTJA 3EG2A 3RMQA 3V7RA 3U23A 2DYBA 4ZGEB 2D6FA 6AT1B 2DRKA 5GMKj 3EG3A 5GAOp 2F2XA 4FIBA 4F7UB 3L2RA 3M4YA 4Z02A 1JO8A 3S3NA 3MEUA 4ANJA 1Q7YC 1YFNA 2HD0A 4QVCA 2LQNA 1WLPB 3EH1A 1QQJA 5IHKA 5CKFA 2L89A 2QK0A 2YWWA 4M75C 1ZSZC 4C5HA 4M7DG 4M7AD 2V8KA 1M90U 2QDLA 2FPEA 1K0SA 1YI2Q 1K4US 3GNGA 2RJEA 4M78G 2DZCA 2QAZA 3CPWP 3HFOA 4UC4A 1Y96B 3UT1A 4AFZC 2AIRB 2NUTB 4C0DB 3M59A 4B9XA 1SHFA 1U1SA 1JB0E 1BI1A 4C0FA 4DBQA 1VQOT 1NBEB 1JBMA 3C0CA 3RNJA 1RADB 3V8LA 3CMAT 2COYA 2M0OA 3HRUA 3EHQA 2HSEB 3CC2Q 4HVWA 1ZUYA 1YJNA 2HBPA 2JJ9A 1KC8U 4MZTA 2RHZA 4DBRA 3L2ZA 1H92A 1RI9A 1UE9A 4FM4B 4IIOA 3A1PA 1VQ8A 2DZ9A 5GAOm 4PJOF 4Y92A 4VUBA 2RN8A 2C0OA 1JJ2A 4XTWA 2XI9A 3OYMA 5GANe 1GFDA 4OB1B 5GANg 2D1XA 5GAN7 5GMKe 3OYYA 5KYXA 3M0QA 1WQWA 2NWMA 2W0ZA 1FX7A 1JU5C 3EH2A 4ZN1A 1AVZC 2DRMA 2DVJA 2AZSA 3Q1JA 2DFUA 2RO0A 2JTMA 1NE8A 3FLGA 4XTYA 2JZ2A 2DJQA 1PM3A 1C6VX 2M51A 3S6WA 5KH6A 3CBMA 1X27A 2CS7A 2FRYA 1X6GA 4AG1C 4C0DC 1SRMA 5FU6B 3X26B 3SWNC 1YHQT 4ATOA 1PWTA 2EIFA 3M53A 2VB6A 4C5GA 3G71T 3EG0A 4KUIA 4E7JA 1RABB 2PTKA 2BZXA 3JCMh 5DLOA 3CXCA 4XU3A 2QEXA 2V1QA 2DNUA 3OW2S 4RG8A 1HJDA 1VQMA 1TOVA 2KBTA 1YN8A 4RMOA 3MP6A 4C92E 1WJQA 5GJVB 1EFNA 1M1KU 2PQWA 4F17A 1NLOC 4OF1A 2EWNA 3CPFA 4NOYA 3PTAA 1W70A 2O31A 5CVIA 5CKHA 3BFMA 9ATCB 3D7SB 1VQOQ 2ZPFB 2JN0A 2A7YA 5KYYA 2O2OA 2K2VA 4N0AC 5D6YA 3RESA 3L2UA 3G6EA 2KR3A 2QXFA 8ATCB 2KYBA 3CMAQ 2HCKA 4M77D 2BE9B 2ED0A 4M7DA 1KD1R 2OJ2A 2DL3A 2J6OA 2MK5A 2RQUA 4JLGA 3I56A 1R8OB 1WIEA 4M78A 2HAXA 1CKAA 4PNOA 5FU6C 3TEEA 4O6JA 2YUPA 4IUQA 3WVDB 4PL6A 4RTZA 2A37A 3VS0A 3UATA 2X4XA 5FW9A 3JCMd 2EQKA 4M7DF 3MP8A 4ORZA 1ZX6A 2D0NA 3KBGA 2NYSA 4B6MA 2CT3A 3H8ZA 4KT0E 4M7AG 3CCMT 1NEGA 2DJZA 2KI7A 4MZMA 2DA9A 1VQNA 2O4XB 2X4WA 3CD6A 1KQSA 4ZNXA 5GAN2 3LYIA 1Q82U 4BY6B 4OMMA 1I0CA 4JRIA 3N5BB 2M16A 5CKBA 5DLQE 1OZ3A 5LJ5f 2LX9A 1G8XA 1YHQQ 2HZYA 2RK2A 3A8MB 1M3BA 1UJYA 2EQJA 5IH2A 1D3BA 3RKWA 3G71Q 1QP2A 1MMNA 1RAHB 2DEUA 1PSEA 1VQPA 2VGNA 4N4IA 2DXUA 2VC8A 1TU0B 4C92D 4EMHA 3NPFA 3QWXX 2VUBA 5GAMf 2AT1B 4KULA 1AWWA 1Q81U 1Q86C 1M8VA 2E1HA 3VS1A 3PMTA 1K1ZA 4ESRA 4HCZA 3A5ZB 5LJ3f 2ZGWA 3OS2A 4A53A 4MZPA 4RTVA 1W2BS 1BK2A 2XIDA 3VS7A 3VS5A 2L2PA 1I8FA 2VWFA 5D7UA 1M1KR 1VQ5T 2QA4A 3E1SA 3VRYA 3QJYA 2LC4A 2CKKA 2DLPA 3KXTA 1GCQA 2QG9B 1U06A 1JJ2P 1AT1B 2AK5A 1YWOA 1GCPA 4QVDA 4LE9A 2JMCA 1OV3A 1LPLA 1KD1C 3TSWA 1Y96A 3ZEHA 4FYXB 2XK0A 2C0TA 2NUZA 1VQ6T 3HL8A 3JB9H 5LJ5g 1N8RU 4MDXA 2LTOA 1QW1A 3OYEA 1I5OB 2K3YA 3L42A 5FRMA 3BW1A 1BI3A 1OX8A 3S3OA 1PNJA 3H0HA 4IUPA 5GAN8 4QQGA 1YITT 2BZ8A 3KUFA 5FWCA 3CCMQ 2J7IA 1VIFA 3VU3C 3ZL7C 4ELZC 1AWOA 2K3XA 5GAMg 2L3PA 1C1AA 1F1BB 4XU1A 1WHLA 2EGEA 1B3QA 2PUKB 3TQ7P 4C92B 2CP2A 4DBHA 5LJ3g 3CPWS 4L59A 3CXCP 1BIBA 3LH0A 2X4YA 2O01E 2XICA 3QZ9B 2KGTA 3I55T 1MUZA 1VQ9T 4PJMA 1BYMA 1D0ZA 2A28A 2O9VA 2P0KA 4M75D 1BIAA 3I56T 4E7IA 3H0FA 1ZQ1A 3CCVA 1NJIC 4OP0A 2JTFA 4M77G 2F2WA 4M7AA 2XU8A 3SFMA 3OYCA 1MHNA 3HTRA 5IXFA 2F5KA 2LP5A 2LJ1A 2F1LA 1Q81R 4BD3A 1HK9A 5GAOq 4PJOC 3RKXA 4PLIA 2CP6A 3VS6A 1R77A 3R6OA 1VQ5Q 4HT9A 2IIMA 3EGDA 1OULA 1EZZB 2OTLA 4M7AF 3OYGA 2LRQA 4D8DA 5D6XA 1M1KC 3JCMP 2DL5A 2HEQA 1Z9ZA 2EJ9A 3CMET 1PHTA 2YUOA 3JCMX 3LGFA 1OEBA 4DQ2A 4J7IA 2FVUA 1VQ6Q 3M58A 2HNIA 2FZCB 4HCCA 3TCJA 5FWBA 4Y91A 4AFUC 4C0ZA 1QCNA 3CBPA 4OGCA 2CH4W 4KGZB 4D8KA 1QWFA 2VXEA 5IN1A 1OU8A 4RKUE 1ZLMA 1KQSP 3C94A 1SRLA 1WJSA 4DEYA 2RQRA 1YITQ 4V2SA 2BTTA 3EGXA 1TH7A 2FG0A 4E7LA 2PVGB 1N8RR 2QQSA 1QMCA 4J9EA 3V8KA 2XDPA 1VQ7A 4C92G 3OMCA 3MKDA 2MF2A 3NFCA 1ZSZB 1ZA2B 1KG1A 2HQXA 3INZA 4GLKA 1WXTA 1VYVA 1W4SA 4LD9K 2A08A 1RAIB 3I55Q 3H9NA 1VQ9Q 5IXBA 2COZA 3OYIA 1M2VA 3CCET 1G3SA 2DKGA 4EMKB 3QZ5B 2ZPEB 3BDUA 3EFOB 1UHFA 5A0GA 1K8AU 4E7KA 3URGA 4PJLA 3CCRT 2RHIA 4PLLA 4OMOA 3I5SA 1KQ1A 2RM4A 4TVRA 5EG2A 5GAN3 1KJWA 2EJFA 3QDRB 1TUDA 5GMKm 1LCKA 2LNHB 1E6GA 1K73R 2C0IA 2J6FA 2AKLA 3NGPA 3VV0A 4A4GA 1KQ2A 1PC0A 5FROA 1U8RA 3CCQA 1M3CA 1MMAA 2EVRA 3NMZC 2CP0A 1HXDA 4J9IA 3OYFA 1QCFA 4PJNA 2L3RA 3M54A 4HXJA 1D1AA 2K2MA 3M5AA 3UF4A 2RQWA 1IHWA 1UGVA 2DILA 1TSFA 3CMEQ 2AHJB 3CCLT 1PCXA 2LX7A 4QQ6A 2K9GA 2LT4A 4M77A 2A36A 4A4FA 1FMKA 1VIEA 2L8DA 5GANd 3CCJA 3M0UA 3QWYA 2CZ6B 2BKDN 3GP8A 2K5IA 2EYXA 4C8QB 2MAMA 2KK4A 2HKNA 1P92A 2DTHA 1H8KA 1GRIA 4EMKC 3OA6A 4Q5WA 1VYTA 3SHWA 3EAEA 3FDRA 3G4ST 3MPUB 4BE1A 2YXYA 3J80E 2K3BA 4M75G 2E3HA 2GNCA 3LX7A 4M77F 3SWNB 2EKOA 1K9MU 5FRNA 1CKBA 4EDUA 4AG2C 3CC4T 2DMOA 1TTHB 3C12A 1BCMA 3CCSA 2EKHA 1KFZA 5GMKi 2OTJT 1NZ9A 2FPFA 2GTOA 1M27C 2C06A 1OPKA 2FZGB 2K5FA 2M9UA 3CCEQ 4OMLA 3L2WA 2EYQA 1Q95G 2HL3A 2HL5C 4FCYA 1VQKA 3QJ6A 1ARKA 2WSEE 3CCRQ 4KBMB 4RTUA 3OYAA 4E6RA 1OYXA 1JJ2S 3A8HB 2YRVA 2RF0A 4C92A 1RAAB 1O9SA 1K8AR 4LDUA 3J81E 1RLQC 2RMOA 1PKSA 5HK3A 4XU0A 3JB9J 2F5TX 4C8QC 1VQ4T 2OAWA 2DAQA 1U3OA 4F7UG 1QKWA 2H3EB 1K73C 3LW5E 4KH0B 1YP5A 2JVVA 3OSVA 2P0QA 5CQYA 1YJWT 1I07A 1OPLA 3M0RA 2RI2A 5CKEA 4OVAA 4C92F 5KYUB 4PJOE 5KYWA 1XQHA 2R57A 3CCLQ 2KEAA 4PFZA 2EBPA 2W10A 5CCAA 1OX9A 3NTHA 3CCUT 1RLPC 2RHUA 5FU7C 3CC7T 1YJ9T 3PIPA 4N4GA 3DLMA 1ZUUA 1TS9A 1N5ZA 3CXCS 4J7FA 2CREA 3NHNA 2HQHA 3H0IA 2BIVA 4E7SA 2YT6A 3JB9I 4C5IA 3OW2A 3PVLA 1M90R 4KUDK 2Y4XA 3C95A 3G4SQ 3WVEB 2JS0A 1YIJT 2XKOC 4QW2A 2VXFA 4OGEA 3CC4Q 1JEGA 1ZBXA 3JRZA 2KNBB 2LCSA 3T9NA 2RI3A 1S72A 2OTJQ 3L1AA 3LH5A 2QGFB 1SHGA 1X2QA 1AWXA 5LJ5h 2E5QA 4LXCA 2FEIA 2EW3A 4BE0A 4FW1A 3OSSC 2K7AA 3RR6A 1W1FA 2RPNA 4ZGDB 4K11A 1D1BA 1HD3A 1U1TA 2MWPA 1KC8R 1E7OA 1PD0A 2LZ6B 2DK3A 2RHYA 4M75A 1PG5B 1V1CA 1ZSZA 1FXXA 4J5YA 5GAMh 1G3TA 2HQEA 1MNEA 1VQLA 1PRMC 5LJ3h 4QKUA 1B34B 1M1GA 2GTJA 4JJCA 1VQ4Q 1UECA 4J8OA 4A4KA 5LJ5j 2IG0A 1QVFA 4M78F 1KIKA 3M0PA 3I9QA 4JRPA 3AT1B 4X9CA 5CAIA 4PJOD 3EG1A 1IXDA 1ZBJA 4M75F 2JM8A 1KQSS 4IKFA 1YJWQ 2VVKA 3AHUA 2XG8D 1YCYA 2A3LA 4HA8A 2DBMA 3QG1A 1YJNT 1WHKA 2KRMA 4J6YA 3TSZA 2XHCA 2IVWA 1XNIA 2JW4A 2KROA 3O8VA 5GAMj 3G1JA 3MHXA 1VQ8T 1RAEB 1RI0A 2XMFA 1T3SA 2Z0WA 3CCUQ 2QYZA 4M7DE 4OMPA 3EGUA 3CC7Q 1YJ9Q 5LJ3j 2CGHA 3RUXA 2D8JA 2JOYA 2PNIA 1YNZA 2SEMA 1I4K1 2DO3A 2DXBA 3PFSA 4DEXA 4F7UA 1OU9A 3ULRB 4JUVA 3M56A 1YIJQ 1FMVA 2X35A 1OI1A 3OYNA 3PNWC 2KXCA 5I2SA 4XTUA 1V29B 2QI2A 2JS2A 1X75C 1YI2A 2GGRA 1M90C 4JS4A 1W2BA 5KE2A 3NTKA 1IHVA 5HY6A 1SSFA 1UGSB 2GF7A 4GBQA 1SG5A 1Q7YU 1Z9QA 1EX4A 3SDZA 2IPOB 3VYHB 1SPKA 1NEBA 2CP5A 1JXOA 3RIRA 3M0TA 2A0FB 2DYIA 4F7UF 3PMIA 4E2FB 1G3WA 2F69A 1YCSB 2JTEA 3H6ZA 4A4HA 4II1A 3O5ZA 4J6WA 2NUTA 2DD4A 5I2MA 2QEXT 3SWNA 3BDLA 1WI7A 2G6FX 2DL4A 3CC2A 5LJ5e 1VQMT 2K57A 4F16A 2OX7A 3BY7A 3QXEB 2GCXA 4PJOB 4NS5A 4XK8E 1KC8C 3OY9A 4BI3A 2QTXA 2DIGA 5GJWB 1X2KA 3QBYA 4QVZA 1GBQA 1JQQA 3JV3A 2DL7A 5GAMe 4E47A 3E9FA 5GAN6 2YRCA 2KT8A 1X69A 1QKXA 3G6ET 4RTXA 4J9FA 5LJ3e 2KQWA 4AFQC 4E7ZA 1J3TA 4HVUA 4C8QE 1IGUA 2GBQA 1YJNQ 4N0AA 1V76A 1UTIA 1Q82R 5LL6S 1Y07A 3FJ5A 3CPWA 3E19A 1VQ8Q 4FYWB 1UB4A 1QVGA 1ZHIA 1G2BA 4Z89A 5GAOr 4OMNA 3RBBB 3VRZA 1AZGB 3UA7A 5KYXB 3FRNA 1FYNA 2EPDA 3X28B 2P4TA 2I2LA 4L5GA 2GFUA 2E6ZA 2CH4A 2CDTA 5I11A 2AKKA 2QQRA 2RQTA 4J83A 3GNFB 2ZAEA 2NUPB 2WACA 4F04B 4ZGJB 4JZ3A 4NL3A 5KYUA 4ZTFA 5IHIA 4QT7A 2QQ9A 2MPXC 2PUOB 1VQNT 3CD6T 2X4JA 4LNPA 2DBKA 4FU6A 2X51A 2YHTA 1PRLC 2LQKA 1NM7A 1LVKA 3TVTA 1UUEA 1T0HA 2E10A 2DIQA 2ED1A 1VQOA 3EG9B 3GOXA 4J9HA 4ZN3A 1WYXA 2E5KA 1WHJA 1K9AA 1VQPT 3CMAA 4B9WA 2QEXQ 3OMGA 1NPPA 3MEWA 2EAYA 4PJOG 1I5LA 1VQMQ 2QQBA 2KXDA 3HP9A 2ABLA 2LNVA 3EFRA 2CZ1B 1RAGB 1KSWA 2EQIA 3OS5A 2LCLA 1XOVA 3PVQA 1GXIE 3RKYA 1QVFP 5M9OA 1D0YA 3X25B 2FHDA 4JJBA 5GAN4 5CO7A 1IO6A 2R58A 4D6WA 3VS3A 3JB9D 1JRIA 2PVDB 4XTVA 1FWZA 4R0KA 4M7DB 1LOJA 4LN2A 4KGVB 3REBB 4JJNK 2V1RA 5J39A 4M7AE 2KY9A 4C8QD 1NYFA 1ABQA 2E65A 8AT1B 1M2OA 3G6EQ 2KRSA 4HVVA 2QA4T 1DJ7B 3PE0A 4F14A 3DB3A 2K79A 4XU2A 1UJ0A 2KDSA 4FT4A 1WDXA 3VS2A 3G7ZA 1M4ZA 4HCKA 1GFCA 2DF6A 1MGQA 2KAFA 1QLYA 3I56Q 3V7CA 3JSCA 1Q82C 1TUGB 3JCMQ 3M0SA 1YHQA 2YLBA 4IUVA 2O4XA 2CP3A 1OOTA 3G71A 3MEVA 2PZ1A 2MYSA 2JT4A 2E64A 2MI6A 3HRSA 4X9DA 2EQMA 5IAYA 1WZOA 1VUBA 5KYNA 1E6HA 2VYTA 2QGGA 4KH1B 3RDVA 2XDDA 1VQNQ 1UGRB 3CD6Q 2BUDA 2AZVA 4N4HA 1D3BB 2COWA 3LLRA 3VYGA 3VKIA 4A4EA 2FYKA 3MP1A 1IGQA 2R5AA 4J6XA 1Q81C 4X1VA 2DPPB 4XQ3A 2PU9B 4M7DC 4PFPA 2E70A 2CT4A 4OB0B 3PIOA 3GBQA 2CSQA 1WJRA 5C6SA 3J7AF 2P84A 3IQLA 3A8LB 3TREA 1VQPQ 4GY5A 2KT1A 3QSUA 2FL7A 1Q86U 1KK7A 5GANf 4M78C 3CCVT 5IT9E 2DL8A 2DM1A 3GLXA 2L5QA 2E4HA 1Y7XA 2D9TA 4RUGA 2QQAA 2EYYA 5DY9A 4A63B 1WX6A 2RI5A 3JCMJ 4CC4B 1R0BG 3MCAB 4WTOB 1TG0A 1D09B 5DM7R 1OZ2A 2MIOA 2KRNA 2DEQA 2DXCA 4LDXA 2DXTA 2DVEA 2V8JA 1PSFA 1MV0B 4MMKA 2J6KA 3UA6A 5CQXA 3DLLA 2OI3A 3CQTA 1WHMA 3HSBA 1N8RC 2LDMA 2V8IA 2QA4Q 1VOMA 1LJOA 4HCBA 1ZA1B 2OTLT 3OBYA 5AT1B 1NYGA 4BACA 1QVGP 4FW2A 2M02A 3CCMA 5FU7B 1KD1U 3NTIA 4PJOA 4JDSA 1I81A 3RERA 2XD0A 1S1NA 1IREB 3P8HA 2GQIA 3M55A 2ATCB 3M9QA 1M8MA 4L6V5 4C5EA 1SEMA 2CZ7B 7AT1B 4IURA 1UG1A 3P8BB 4PKCC 2MCNA 4J9DA 2B86A 2HSPA 4RTWA 3QPHA 4M77E 1G3YA 5GAOl 2K5LA 5AYFA 1X6OA 2EFIA 4MDWA 4J9BA 2CUBA 1WA7A 2RK1A 1C0MA 5EC7A 1VQ7T 2DETA 2JUFA 5I22A 3QUIA 3MO8A 2RJDA 2FB7A 3TU4K 2EGCA 1ABOA 1UHCA 2YDLA 4C0GA 1GCQC 3VUZA 4P5NA 2PVOB 2MOXA 3JB9G 1MMDA 1UGPB 2ZPBB 3UDCA 3BE3A 4M7AB 1NJIU 2NUPA 1VQ5A 2I0NA 4C8QG 3VJPA 2YLCA 3CCVQ 1N9RA 2JM9A 2JMAA 3DKMA 3DB4A 2HMAA 2ZZDA 3X20B 4IUUA 1QVPA 3MJXA 2EGAA 2CUDA 4BDYA 1LNXA 4LD6A 1HSQA 2ZPHB 1M9SA 2KSSA 3UWNA 3ZBDA 1Q86R 5KCOA 1VQ6A 1X01A 3EHRA 3EGDB 2DERA 1GL5A 1OQKA 4FSSA 3EG9A 1I1JA 3GIBA 3CCQT 1UEBA 2DE0X 2O88A 4R56A 4O5VA 2OTLQ 1YITA 2QTVA 1K9MR 3OYLA 2M1HA 4JRQA 3S3MA 4XTXA 4QQDA 4PK4A 3FEOA 4PFOA 2RJFA 3FB9A 1AEYA 5A0LA 5IHNA 2RQVA 4FYYB 3FJPA 1BI0A 2LQWA 1IB8A 2RJCA 2BZYA 5J26A 2ROTA 1ZSGA 5KE3A 2R5MA 4JJDA 2O9SA 3JCMb 4DA4A 4BB7A 3CCJT 1PKTA 2K6DA 2QDYB 3EGXB 3I55A 1VQ9A 1IRXA 3A8GB 3JCMf 4M7AC 2MMPA 1G5VA 3P8DA 3REAB 3VUBA 1WXBA 4M4ZA 1T3LA 1SSHA 5CK9A 1Y71A 4EIKA 2LT1A 1VQ7Q 2FPDA 2F2VA 4OB2B 1K8AC 1M2VB 4NL2A 4CC3A 4EMKA 1ACMB 3EFOA 3CCST 3HPWA 4OB3B 1B7TA 1QVFS 1WHGA 1JXMA 4OMQA 3LWIA 3QYGB 4ME7A 2LVMA 5HCKA 3SB2A 3E9GA 4RCCA
chains in the Genus database with same CATH topology
3M0QA 2NWMA 4OMNA 2YSQA 2W0ZA 4CC7A 3RBBB 3VRZA 1Y57A 1AZGB 3UA7A 1JU5C 1AVZC 1FYNA 2DRMA 2DVJA 2AZSA 2EPDA 1KJWA 1A0NB 1TUDA 1LCKA 2LNHB 2CH4A 2CDTA 1H3HA 1E6GA 5I11A 2C0IA 2J6FA 2AKLA 2DJQA 2M51A 2AKKA 3NGPA 2RQTA 4IIMA 1X27A 1M3CA 2EVRA 2FRYA 3NMZC 1X6GA 4JZ3A 4J9IA 4AG1C 1SRMA 2M0YA 1QCFA 5IHIA 4QT7A 1WFWA 1K76A 1PWTA 4HXJA 2ECZA 4LNPA 3EG0A 1BBZA 4Z88A 2K2MA 2DBKA 3UF4A 2RQWA 2PTKA 2BZXA 1UGVA 1PRLC 1NM7A 2DILA 3TVTA 2V1QA 4GLMA 1UUEA 2DNUA 2FO0A 2J06A 2LX7A 1T0HA 1YWPA 1B07A 1HJDA 1M3AA 2K9GA 2YUNA 2HBWA 2A36A 2ED1A 2KBTA 4JPBW 1FMKA 4J9HA 3M0UA 4KRTA 1YN8A 1WYXA 3QWYA 2E5KA 5GJVB 1EFNA 2EYXA 2H8HA 4F17A 1K9AA 1NLOC 2LJ3A 2KYMA 1H8KA 1W70A 2KXDA 2O31A 1GRIA 2ABLA 4JZ4A 1VYTA 3SHWA 1KSWA 2O2OA 2EQIA 1XOVA 2P4RA 3PVQA 2L3SA 2FRWA 3A98A 2K3BA 2GNCA 2KR3A 1CKBA 2KYBA 4AG2C 2HCKA 4JJBA 1IO6A 2DMOA 2ED0A 3VS3A 2D8HA 2OJ2A 4R0KA 1AD5A 4AFSC 2EKHA 4LN2A 3REBB 2V1RA 1KFZA 2DL3A 4CC2A 2X3XD 2J6OA 1NYFA 1ABQA 2YUQA 2FPFA 2ENMA 2GTOA 2KRSA 1AWJA 1M27C 2RQUA 4HVVA 1OPKA 3PE0A 3I5RA 1WIEA 4F14A 1CKAA 4OMLA 2YUPA 2K79A 4RTZA 1UJ0A 2A37A 3VS0A 3UATA 2L0AA 5FW9A 1WDXA 3VS2A 1NLPC 1ARKA 4ORZA 1ZX6A 2D0NA 1UDLA 1GFCA 2DF6A 4HCKA 4J9GA 1QLYA 4RTUA 4E6RA 2CT3A 3M0SA 2RF0A 1NEGA 2DA9A 1BU1A 1OOTA 4J9CA 2KE9A 1RLQC 4ZNXA 2EYWA 4OMMA 2PZ1A 1PKSA 1I0CA 2RMOA 2JT4A 2EYZA 2OAWA 1U3OA 4LUEA 1QKWA 1E6HA 2ROLA 1M3BA 1UJYA 5IH2A 1MV3A 1YP5A 1K0XA 2AZVA 4LUDA 1I07A 1OPLA 3M0RA 1VYUA 4Z8AA 1WXUA 1Y0MA 1M30A 4X1VA 2KEAA 2EBPA 3NPFA 3SEMA 3QWXX 2W10A 2CT4A 3GBQA 2CSQA 1AWWA 3VS1A 1TUCA 1RLPC 2DX1A 1K1ZA 4ESRA 3IQLA 1ZUUA 1N5ZA 4RTVA 4WCIA 2KT1A 2CREA 3NHNA 3H0IA 1BK2A 2YT6A 3VS7A 3VS5A 2DL8A 2DM1A 3PVLA 3VS4A 2L2PA 2X3WD 2JS0A 4RUGA 2VWFA 2EYYA 4A63B 3THKA 1WX6A 4CC4B 2LMJA 1TG0A 1JEGA 1G83A 3VRYA 2MIOA 2KRNA 2DLPA 1U5SA 1GCQA 2KNBB 2LCSA 1U06A 1T0JA 1MV0B 2AK5A 1YWOA 2J6KA 3UA6A 1GCPA 4LE9A 2JMCA 3LH5A 2OI3A 3CQTA 1SHGA 1OV3A 1AZEA 1X2QA 1AWXA 3TSWA 2C0TA 2FEIA 2NUZA 2EW3A 1NYGA 2L3QA 1AOJA 2K7AA 1W1FA 2RPNA 2RNAA 2CSIA 1QWEA 4K11A 4RTYA 1HD3A 5L23A 1S1NA 1X6BA 3H41A 1PNJA 3H0HA 2GQIA 1VA7A 1M8MA 1E7OA 2LZ6B 3R6NA 1V1CA 2BZ8A 1SEMA 5FWCA 2J7IA 1UG1A 3KFVA 3ZL7C 1AWOA 2MCNA 1ZUKA 2L3PA 1PRMC 2B86A 2HSPA 4J9DA 2GTJA 4RTWA 4JJCA 1UECA 1X43A 2EGEA 1B3QA 1KIKA 4J9BA 2CUBA 3M0PA 3I9QA 1WA7A 3EG1A 2KGTA 2LJ0A 1MUZA 5EC7A 1ZBJA 2JM8A 2VKNA 2VVKA 2A28A 1RUWA 2O9VA 4RTTA 5I22A 2DBMA 1UFFA 1W6XA 2ESWA 3I35A 2SRCA 2EGCA 1ABOA 2KRMA 3TSZA 3H0FA 2JW4A 2KROA 1UHCA 2YDLA 1NG2A 1GCQC 2HDAA 2XMFA 2MOXA 1GBRA 2F2WA 1T3SA 2J05A 4OMPA 1BB9A 1CSKA 3EGUA 5ECAA 2D8JA 2I0NA 2PNIA 2JXBA 1YNZA 5IXFA 2SEMA 3EG2A 2LP5A 3U23A 2DYBA 2JM9A 2JMAA 2LJ1A 4DEXA 2DRKA 3ULRB 3EG3A 2EGAA 2CUDA 2F2XA 1JO8A 1HSQA 3VS6A 2KXCA 2IIMA 2JS2A 2GGRA 2LQNA 1WLPB 3EHRA 5IHKA 1GL5A 4D8DA 4GBQA 4FSSA 1Z9QA 1I1JA 2DL5A 2HEQA 1Z9ZA 2QDLA 1SPKA 1NEBA 1JXOA 2FPEA 3M0TA 1PHTA 1K0SA 2DE0X 2YUOA 1OEBA 2O88A 1K4US 1YCSB 2JTEA 3O5ZA 5FWBA 4AFUC 1AEYA 5IHNA 2RQVA 2CH4W 4AFZC 1WI7A 4D8KA 2G6FX 1QWFA 2DL4A 1SHFA 2LQWA 1ZLMA 2BZYA 1SRLA 2ROTA 1ZSGA 4DEYA 2RQRA 4F16A 4JJDA 2O9SA 2BTTA 3C0CA 1PKTA 2FG0A 2K6DA 3RNJA 4J9EA 5GJWB 1X2KA 3EHQA 1GBQA 1JQQA 3REAB 4HVWA 1WXBA 4M4ZA 1T3LA 1ZUYA 2DL7A 3JV3A 4OMOA 1SSHA 1WXTA 1VYVA 1H92A 4EIKA 2A08A 1RI9A 1UE9A 1X69A 1QKXA 2KT8A 4IIOA 4RTXA 5IXBA 4J9FA 4Y92A 2RN8A 2FPDA 4AFQC 2C0OA 2F2VA 1J3TA 4CC3A 4HVUA 2GBQA 1GFDA 2D1XA 1UTIA 1UHFA 3FJ5A 1JXMA 4OMQA 5HCKA 1G2BA 4Z89A 3I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0Q A;  2NWM A;  4OMN A;  2YSQ A;  2W0Z A;  4CC7 A;  3RBB B;  3VRZ A;  1Y57 A;  1AZG B;  3UA7 A;  1JU5 C;  1AVZ C;  1FYN A;  2DRM A;  2DVJ A;  2AZS A;  2EPD A;  1KJW A;  1A0N B;  1TUD A;  1LCK A;  2LNH B;  2CH4 A;  2CDT A;  1H3H A;  1E6G A;  5I11 A;  2C0I A;  2J6F A;  2AKL A;  2DJQ A;  2M51 A;  2AKK A;  3NGP A;  2RQT A;  4IIM A;  1X27 A;  1M3C A;  2EVR A;  2FRY A;  3NMZ C;  1X6G A;  4JZ3 A;  4J9I A;  4AG1 C;  1SRM A;  2M0Y A;  1QCF A;  5IHI A;  4QT7 A;  1WFW A;  1K76 A;  1PWT A;  4HXJ A;  2ECZ A;  4LNP A;  3EG0 A;  1BBZ A;  4Z88 A;  2K2M A;  2DBK A;  3UF4 A;  2RQW A;  2PTK A;  2BZX A;  1UGV A;  1PRL C;  1NM7 A;  2DIL A;  3TVT A;  2V1Q A;  4GLM A;  1UUE A;  2DNU A;  2FO0 A;  2J06 A;  2LX7 A;  1T0H A;  1YWP A;  1B07 A;  1HJD A;  1M3A A;  2K9G A;  2YUN A;  2HBW A;  2A36 A;  2ED1 A;  2KBT A;  4JPB W;  1FMK A;  4J9H A;  3M0U A;  4KRT A;  1YN8 A;  1WYX A;  3QWY A;  2E5K A;  5GJV B;  1EFN A;  2EYX A;  2H8H A;  4F17 A;  1K9A A;  1NLO C;  2LJ3 A;  2KYM A;  1H8K A;  1W70 A;  2KXD A;  2O31 A;  1GRI A;  2ABL A;  4JZ4 A;  1VYT A;  3SHW A;  1KSW A;  2O2O A;  2EQI A;  1XOV A;  2P4R A;  3PVQ A;  2L3S A;  2FRW A;  3A98 A;  2K3B A;  2GNC A;  2KR3 A;  1CKB A;  2KYB A;  4AG2 C;  2HCK A;  4JJB A;  1IO6 A;  2DMO A;  2ED0 A;  3VS3 A;  2D8H A;  2OJ2 A;  4R0K A;  1AD5 A;  4AFS C;  2EKH A;  4LN2 A;  3REB B;  2V1R A;  1KFZ A;  2DL3 A;  4CC2 A;  2X3X D;  2J6O A;  1NYF A;  1ABQ A;  2YUQ A;  2FPF A;  2ENM A;  2GTO A;  2KRS A;  1AWJ A;  1M27 C;  2RQU A;  4HVV A;  1OPK A;  3PE0 A;  3I5R A;  1WIE A;  4F14 A;  1CKA A;  4OML A;  2YUP A;  2K79 A;  4RTZ A;  1UJ0 A;  2A37 A;  3VS0 A;  3UAT A;  2L0A A;  5FW9 A;  1WDX A;  3VS2 A;  1NLP C;  1ARK A;  4ORZ A;  1ZX6 A;  2D0N A;  1UDL A;  1GFC A;  2DF6 A;  4HCK A;  4J9G A;  1QLY A;  4RTU A;  4E6R A;  2CT3 A;  3M0S A;  2RF0 A;  1NEG A;  2DA9 A;  1BU1 A;  1OOT A;  4J9C A;  2KE9 A;  1RLQ C;  4ZNX A;  2EYW A;  4OMM A;  2PZ1 A;  1PKS A;  1I0C A;  2RMO A;  2JT4 A;  2EYZ A;  2OAW A;  1U3O A;  4LUE A;  1QKW A;  1E6H A;  2ROL A;  1M3B A;  1UJY A;  5IH2 A;  1MV3 A;  1YP5 A;  1K0X A;  2AZV A;  4LUD A;  1I07 A;  1OPL A;  3M0R A;  1VYU A;  4Z8A A;  1WXU A;  1Y0M A;  1M30 A;  4X1V A;  2KEA A;  2EBP A;  3NPF A;  3SEM A;  3QWX X;  2W10 A;  2CT4 A;  3GBQ A;  2CSQ A;  1AWW A;  3VS1 A;  1TUC A;  1RLP C;  2DX1 A;  1K1Z A;  4ESR A;  3IQL A;  1ZUU A;  1N5Z A;  4RTV A;  4WCI A;  2KT1 A;  2CRE A;  3NHN A;  3H0I A;  1BK2 A;  2YT6 A;  3VS7 A;  3VS5 A;  2DL8 A;  2DM1 A;  3PVL A;  3VS4 A;  2L2P A;  2X3W D;  2JS0 A;  4RUG A;  2VWF A;  2EYY A;  4A63 B;  3THK A;  1WX6 A;  4CC4 B;  2LMJ A;  1TG0 A;  1JEG A;  1G83 A;  3VRY A;  2MIO A;  2KRN A;  2DLP A;  1U5S A;  1GCQ A;  2KNB B;  2LCS A;  1U06 A;  1T0J A;  1MV0 B;  2AK5 A;  1YWO A;  2J6K A;  3UA6 A;  1GCP A;  4LE9 A;  2JMC A;  3LH5 A;  2OI3 A;  3CQT A;  1SHG A;  1OV3 A;  1AZE A;  1X2Q A;  1AWX A;  3TSW A;  2C0T A;  2FEI A;  2NUZ A;  2EW3 A;  1NYG A;  2L3Q A;  1AOJ A;  2K7A A;  1W1F A;  2RPN A;  2RNA A;  2CSI A;  1QWE A;  4K11 A;  4RTY A;  1HD3 A;  5L23 A;  1S1N A;  1X6B A;  3H41 A;  1PNJ A;  3H0H A;  2GQI A;  1VA7 A;  1M8M A;  1E7O A;  2LZ6 B;  3R6N A;  1V1C A;  2BZ8 A;  1SEM A;  5FWC A;  2J7I A;  1UG1 A;  3KFV A;  3ZL7 C;  1AWO A;  2MCN A;  1ZUK A;  2L3P A;  1PRM C;  2B86 A;  2HSP A;  4J9D A;  2GTJ A;  4RTW A;  4JJC A;  1UEC A;  1X43 A;  2EGE A;  1B3Q A;  1KIK A;  4J9B A;  2CUB A;  3M0P A;  3I9Q A;  1WA7 A;  3EG1 A;  2KGT A;  2LJ0 A;  1MUZ A;  5EC7 A;  1ZBJ A;  2JM8 A;  2VKN A;  2VVK A;  2A28 A;  1RUW A;  2O9V A;  4RTT A;  5I22 A;  2DBM A;  1UFF A;  1W6X A;  2ESW A;  3I35 A;  2SRC A;  2EGC A;  1ABO A;  2KRM A;  3TSZ A;  3H0F A;  2JW4 A;  2KRO A;  1UHC A;  2YDL A;  1NG2 A;  1GCQ C;  2HDA A;  2XMF A;  2MOX A;  1GBR A;  2F2W A;  1T3S A;  2J05 A;  4OMP A;  1BB9 A;  1CSK A;  3EGU A;  5ECA A;  2D8J A;  2I0N A;  2PNI A;  2JXB A;  1YNZ A;  5IXF A;  2SEM A;  3EG2 A;  2LP5 A;  3U23 A;  2DYB A;  2JM9 A;  2JMA A;  2LJ1 A;  4DEX A;  2DRK A;  3ULR B;  3EG3 A;  2EGA A;  2CUD A;  2F2X A;  1JO8 A;  1HSQ A;  3VS6 A;  2KXC A;  2IIM A;  2JS2 A;  2GGR A;  2LQN A;  1WLP B;  3EHR A;  5IHK A;  1GL5 A;  4D8D A;  4GBQ A;  4FSS A;  1Z9Q A;  1I1J A;  2DL5 A;  2HEQ A;  1Z9Z A;  2QDL A;  1SPK A;  1NEB A;  1JXO A;  2FPE A;  3M0T A;  1PHT A;  1K0S A;  2DE0 X;  2YUO A;  1OEB A;  2O88 A;  1K4U S;  1YCS B;  2JTE A;  3O5Z A;  5FWB A;  4AFU C;  1AEY A;  5IHN A;  2RQV A;  2CH4 W;  4AFZ C;  1WI7 A;  4D8K A;  2G6F X;  1QWF A;  2DL4 A;  1SHF A;  2LQW A;  1ZLM A;  2BZY A;  1SRL A;  2ROT A;  1ZSG A;  4DEY A;  2RQR A;  4F16 A;  4JJD A;  2O9S A;  2BTT A;  3C0C A;  1PKT A;  2FG0 A;  2K6D A;  3RNJ A;  4J9E A;  5GJW B;  1X2K A;  3EHQ A;  1GBQ A;  1JQQ A;  3REA B;  4HVW A;  1WXB A;  4M4Z A;  1T3L A;  1ZUY A;  2DL7 A;  3JV3 A;  4OMO A;  1SSH A;  1WXT A;  1VYV A;  1H92 A;  4EIK A;  2A08 A;  1RI9 A;  1UE9 A;  1X69 A;  1QKX A;  2KT8 A;  4IIO A;  4RTX A;  5IXB A;  4J9F A;  4Y92 A;  2RN8 A;  2FPD A;  4AFQ C;  2C0O A;  2F2V A;  1J3T A;  4CC3 A;  4HVU A;  2GBQ A;  1GFD A;  2D1X A;  1UTI A;  1UHF A;  3FJ5 A;  1JXM A;  4OMQ A;  5HCK A;  1G2B A;  4Z89 A;  3I5S A; 
#chains in the Genus database with same CATH topology
 3JCM c;  2YSQ A;  1RAC B;  4CC7 A;  3V8J A;  1Y57 A;  5KCH A;  4ELY C;  2CZ0 B;  2Y90 A;  1A0N B;  3M57 A;  1VQK T;  5LJ5 d;  2VAS A;  1RL2 A;  1PD1 A;  1H3H A;  4IIM A;  4DBF A;  1WNL A;  3CME A;  2G3R A;  3LGL A;  3LWH A;  3ASK A;  1NJI R;  2M0Y A;  4HKE A;  4LDV A;  1WFW A;  2H3J A;  1K76 A;  2RH2 A;  4JRK A;  4M78 E;  4RCB A;  2ECZ A;  4X34 A;  3HFN A;  3JCM W;  1YBY A;  5HK0 A;  1BBZ A;  4Z88 A;  5A0D A;  5GAM d;  2WSF E;  3A8O B;  3CCQ Q;  2WSC E;  4M75 E;  2E41 A;  4AT1 B;  4GLM A;  2FO0 A;  2J06 A;  3GF5 A;  1YWP A;  5LJ3 d;  1B07 A;  2LQ8 A;  1M3A A;  2YUN A;  3JCM e;  2HBW A;  3JCM g;  5GAO n;  1BKB A;  2B8A A;  5CKD A;  4M77 B;  4JPB W;  2JNG A;  4KRT A;  3CEY A;  5CIU A;  4C8Q A;  4CRI A;  2H8H A;  4BI4 A;  5A2Q E;  2LJ3 A;  3OQ5 A;  4BDZ A;  2KYM A;  2VGM A;  1K9M C;  4LDW A;  4JZ4 A;  1N27 A;  4FYV B;  3CCJ Q;  3FIF A;  2P4R A;  4EPC A;  2L3S A;  2FRW A;  3A98 A;  2D0Q B;  3X24 B;  3HKS A;  1UGQ B;  2QAS A;  3JB9 F;  1D0X A;  4EMG A;  3ER0 A;  1XTD A;  3ME9 A;  3OBW A;  3CCE A;  4BY6 C;  4CI0 C;  2D8H A;  4C8Q F;  4BUG A;  1D1C A;  3UPU A;  1WQ7 A;  1AD5 A;  4AFS C;  2V26 A;  4CC2 A;  1H3Z A;  2DTO A;  2X3X D;  3PT9 A;  4XAX B;  3OYD A;  2RA2 A;  4KGX B;  2YUQ A;  3GPL A;  2ENM A;  3CCR A;  5C0M A;  3HHT B;  1AWJ A;  1O75 A;  1EIF A;  4FSX A;  1MND A;  3I5R A;  5FLX E;  4F7U E;  2EJG A;  3CCS Q;  3OYH A;  2L0A A;  1S72 T;  3OYB A;  1XJW B;  2CYZ B;  2GFA A;  1NLP C;  4JLI A;  1UDL A;  4A54 A;  4M7D D;  4J9G A;  3ZFJ A;  3FC3 A;  1N6A A;  1BU1 A;  2RHX A;  4M77 C;  1NPR A;  4BE2 A;  3OW2 P;  1VQK Q;  4J9C A;  2KE9 A;  2EYW A;  3C4S A;  2EYZ A;  1KHC A;  1WGS A;  4M78 D;  1QVG S;  2E3I A;  4LUE A;  4E7H A;  1MMG A;  3CCL A;  2E6N A;  1WHH A;  2ROL A;  1KHI A;  2RD1 A;  2K4Y A;  2CP7 A;  4AMC A;  3OB9 A;  5GAN 5;  1MV3 A;  1VQL T;  1K0X A;  3CBO A;  4LUD A;  1M5Q 1;  1VYU A;  3OYJ A;  4Z8A A;  1SF9 A;  1WXU A;  1K73 U;  2MWO A;  1Y0M A;  1M30 A;  5KYW B;  3SEM A;  1AHJ B;  3HRT A;  5L8R E;  3G4S A;  1H64 1;  1TUC A;  1WPY A;  2DX1 A;  3SD4 A;  4LDY A;  1HYO A;  3CC4 A;  2ZCF B;  3JCM V;  4WCI A;  1Q7Y R;  4IUT A;  1TWB A;  1N9S A;  2X9H A;  3EFS A;  3VS4 A;  2X3W D;  2YRD A;  2OTJ A;  3OYK A;  3THK A;  3QHS A;  4DOW A;  2LMJ A;  1M1F A;  2LCC A;  1G83 A;  1RAF B;  2DTI A;  1U5S A;  4RG2 A;  4OMF B;  3L2Q A;  5KYY B;  1T0J A;  2ZPG B;  4XTZ A;  4PJJ A;  4C92 C;  1IZ6 A;  5I21 A;  1AZE A;  2E12 A;  4Y28 E;  3PGG A;  2XDB A;  1YI2 T;  2HKQ B;  3QYH B;  2L3Q A;  2EQU A;  3RMS A;  1AOJ A;  3V7S A;  2RNA A;  2GQV A;  2CSI A;  1QWE A;  4YTL A;  1S72 Q;  4FL6 A;  4RTY A;  5L23 A;  3QII A;  4M78 B;  1X6B A;  3H41 A;  1VQ4 A;  1FMW A;  1VA7 A;  2KMT A;  2OAU A;  2KVQ G;  1BI2 A;  3R6N A;  1QCO A;  3F70 A;  4FT2 A;  1TXQ A;  4M75 B;  3M4G A;  3KFV A;  1B34 A;  3MEA A;  3QDF A;  1QP3 A;  1ZUK A;  4JS5 A;  1YJW A;  3OS1 A;  2Y4Y A;  3CC2 T;  1SKU B;  2ZPI B;  2FZK B;  1X43 A;  2DD5 A;  4WF2 A;  5GAN h;  4MML A;  1W2B P;  3OS0 A;  5GMK h;  3L2V A;  2RB6 A;  2LJ0 A;  3QKJ A;  1VQL Q;  3CCU A;  2VKN A;  2NLU A;  1RUW A;  4RTT A;  3CC7 A;  1YJ9 A;  1UFF A;  1W6X A;  2ESW A;  3I35 A;  4R55 A;  2SRC A;  3E2U A;  3JAM E;  4HT8 A;  5HKC A;  4BI8 B;  1NG2 A;  3WXM B;  5CR2 A;  2HDA A;  5GMK l;  1GBR A;  1YIJ A;  5D6W A;  2J05 A;  1BB9 A;  1BCO A;  1R0C B;  1CSK A;  3QO3 A;  5ECA A;  4DOV A;  2P0P A;  3MET A;  2JXB A;  5J3B A;  2BE7 D;  2VV5 A;  5GAN j;  4ZTJ A;  3EG2 A;  3RMQ A;  3V7R A;  3U23 A;  2DYB A;  4ZGE B;  2D6F A;  6AT1 B;  2DRK A;  5GMK j;  3EG3 A;  5GAO p;  2F2X A;  4FIB A;  4F7U B;  3L2R A;  3M4Y A;  4Z02 A;  1JO8 A;  3S3N A;  3MEU A;  4ANJ A;  1Q7Y C;  1YFN A;  2HD0 A;  4QVC A;  2LQN A;  1WLP B;  3EH1 A;  1QQJ A;  5IHK A;  5CKF A;  2L89 A;  2QK0 A;  2YWW A;  4M75 C;  1ZSZ C;  4C5H A;  4M7D G;  4M7A D;  2V8K A;  1M90 U;  2QDL A;  2FPE A;  1K0S A;  1YI2 Q;  1K4U S;  3GNG A;  2RJE A;  4M78 G;  2DZC A;  2QAZ A;  3CPW P;  3HFO A;  4UC4 A;  1Y96 B;  3UT1 A;  4AFZ C;  2AIR B;  2NUT B;  4C0D B;  3M59 A;  4B9X A;  1SHF A;  1U1S A;  1JB0 E;  1BI1 A;  4C0F A;  4DBQ A;  1VQO T;  1NBE B;  1JBM A;  3C0C A;  3RNJ A;  1RAD B;  3V8L A;  3CMA T;  2COY A;  2M0O A;  3HRU A;  3EHQ A;  2HSE B;  3CC2 Q;  4HVW A;  1ZUY A;  1YJN A;  2HBP A;  2JJ9 A;  1KC8 U;  4MZT A;  2RHZ A;  4DBR A;  3L2Z A;  1H92 A;  1RI9 A;  1UE9 A;  4FM4 B;  4IIO A;  3A1P A;  1VQ8 A;  2DZ9 A;  5GAO m;  4PJO F;  4Y92 A;  4VUB A;  2RN8 A;  2C0O A;  1JJ2 A;  4XTW A;  2XI9 A;  3OYM A;  5GAN e;  1GFD A;  4OB1 B;  5GAN g;  2D1X A;  5GAN 7;  5GMK e;  3OYY A;  5KYX A;  3M0Q A;  1WQW A;  2NWM A;  2W0Z A;  1FX7 A;  1JU5 C;  3EH2 A;  4ZN1 A;  1AVZ C;  2DRM A;  2DVJ A;  2AZS A;  3Q1J A;  2DFU A;  2RO0 A;  2JTM A;  1NE8 A;  3FLG A;  4XTY A;  2JZ2 A;  2DJQ A;  1PM3 A;  1C6V X;  2M51 A;  3S6W A;  5KH6 A;  3CBM A;  1X27 A;  2CS7 A;  2FRY A;  1X6G A;  4AG1 C;  4C0D C;  1SRM A;  5FU6 B;  3X26 B;  3SWN C;  1YHQ T;  4ATO A;  1PWT A;  2EIF A;  3M53 A;  2VB6 A;  4C5G A;  3G71 T;  3EG0 A;  4KUI A;  4E7J A;  1RAB B;  2PTK A;  2BZX A;  3JCM h;  5DLO A;  3CXC A;  4XU3 A;  2QEX A;  2V1Q A;  2DNU A;  3OW2 S;  4RG8 A;  1HJD A;  1VQM A;  1TOV A;  2KBT A;  1YN8 A;  4RMO A;  3MP6 A;  4C92 E;  1WJQ A;  5GJV B;  1EFN A;  1M1K U;  2PQW A;  4F17 A;  1NLO C;  4OF1 A;  2EWN A;  3CPF A;  4NOY A;  3PTA A;  1W70 A;  2O31 A;  5CVI A;  5CKH A;  3BFM A;  9ATC B;  3D7S B;  1VQO Q;  2ZPF B;  2JN0 A;  2A7Y A;  5KYY A;  2O2O A;  2K2V A;  4N0A C;  5D6Y A;  3RES A;  3L2U A;  3G6E A;  2KR3 A;  2QXF A;  8ATC B;  2KYB A;  3CMA Q;  2HCK A;  4M77 D;  2BE9 B;  2ED0 A;  4M7D A;  1KD1 R;  2OJ2 A;  2DL3 A;  2J6O A;  2MK5 A;  2RQU A;  4JLG A;  3I56 A;  1R8O B;  1WIE A;  4M78 A;  2HAX A;  1CKA A;  4PNO A;  5FU6 C;  3TEE A;  4O6J A;  2YUP A;  4IUQ A;  3WVD B;  4PL6 A;  4RTZ A;  2A37 A;  3VS0 A;  3UAT A;  2X4X A;  5FW9 A;  3JCM d;  2EQK A;  4M7D F;  3MP8 A;  4ORZ A;  1ZX6 A;  2D0N A;  3KBG A;  2NYS A;  4B6M A;  2CT3 A;  3H8Z A;  4KT0 E;  4M7A G;  3CCM T;  1NEG A;  2DJZ A;  2KI7 A;  4MZM A;  2DA9 A;  1VQN A;  2O4X B;  2X4W A;  3CD6 A;  1KQS A;  4ZNX A;  5GAN 2;  3LYI A;  1Q82 U;  4BY6 B;  4OMM A;  1I0C A;  4JRI A;  3N5B B;  2M16 A;  5CKB A;  5DLQ E;  1OZ3 A;  5LJ5 f;  2LX9 A;  1G8X A;  1YHQ Q;  2HZY A;  2RK2 A;  3A8M B;  1M3B A;  1UJY A;  2EQJ A;  5IH2 A;  1D3B A;  3RKW A;  3G71 Q;  1QP2 A;  1MMN A;  1RAH B;  2DEU A;  1PSE A;  1VQP A;  2VGN A;  4N4I A;  2DXU A;  2VC8 A;  1TU0 B;  4C92 D;  4EMH A;  3NPF A;  3QWX X;  2VUB A;  5GAM f;  2AT1 B;  4KUL A;  1AWW A;  1Q81 U;  1Q86 C;  1M8V A;  2E1H A;  3VS1 A;  3PMT A;  1K1Z A;  4ESR A;  4HCZ A;  3A5Z B;  5LJ3 f;  2ZGW A;  3OS2 A;  4A53 A;  4MZP A;  4RTV A;  1W2B S;  1BK2 A;  2XID A;  3VS7 A;  3VS5 A;  2L2P A;  1I8F A;  2VWF A;  5D7U A;  1M1K R;  1VQ5 T;  2QA4 A;  3E1S A;  3VRY A;  3QJY A;  2LC4 A;  2CKK A;  2DLP A;  3KXT A;  1GCQ A;  2QG9 B;  1U06 A;  1JJ2 P;  1AT1 B;  2AK5 A;  1YWO A;  1GCP A;  4QVD A;  4LE9 A;  2JMC A;  1OV3 A;  1LPL A;  1KD1 C;  3TSW A;  1Y96 A;  3ZEH A;  4FYX B;  2XK0 A;  2C0T A;  2NUZ A;  1VQ6 T;  3HL8 A;  3JB9 H;  5LJ5 g;  1N8R U;  4MDX A;  2LTO A;  1QW1 A;  3OYE A;  1I5O B;  2K3Y A;  3L42 A;  5FRM A;  3BW1 A;  1BI3 A;  1OX8 A;  3S3O A;  1PNJ A;  3H0H A;  4IUP A;  5GAN 8;  4QQG A;  1YIT T;  2BZ8 A;  3KUF A;  5FWC A;  3CCM Q;  2J7I A;  1VIF A;  3VU3 C;  3ZL7 C;  4ELZ C;  1AWO A;  2K3X A;  5GAM g;  2L3P A;  1C1A A;  1F1B B;  4XU1 A;  1WHL A;  2EGE A;  1B3Q A;  2PUK B;  3TQ7 P;  4C92 B;  2CP2 A;  4DBH A;  5LJ3 g;  3CPW S;  4L59 A;  3CXC P;  1BIB A;  3LH0 A;  2X4Y A;  2O01 E;  2XIC A;  3QZ9 B;  2KGT A;  3I55 T;  1MUZ A;  1VQ9 T;  4PJM A;  1BYM A;  1D0Z A;  2A28 A;  2O9V A;  2P0K A;  4M75 D;  1BIA A;  3I56 T;  4E7I A;  3H0F A;  1ZQ1 A;  3CCV A;  1NJI C;  4OP0 A;  2JTF A;  4M77 G;  2F2W A;  4M7A A;  2XU8 A;  3SFM A;  3OYC A;  1MHN A;  3HTR A;  5IXF A;  2F5K A;  2LP5 A;  2LJ1 A;  2F1L A;  1Q81 R;  4BD3 A;  1HK9 A;  5GAO q;  4PJO C;  3RKX A;  4PLI A;  2CP6 A;  3VS6 A;  1R77 A;  3R6O A;  1VQ5 Q;  4HT9 A;  2IIM A;  3EGD A;  1OUL A;  1EZZ B;  2OTL A;  4M7A F;  3OYG A;  2LRQ A;  4D8D A;  5D6X A;  1M1K C;  3JCM P;  2DL5 A;  2HEQ A;  1Z9Z A;  2EJ9 A;  3CME T;  1PHT A;  2YUO A;  3JCM X;  3LGF A;  1OEB A;  4DQ2 A;  4J7I A;  2FVU A;  1VQ6 Q;  3M58 A;  2HNI A;  2FZC B;  4HCC A;  3TCJ A;  5FWB A;  4Y91 A;  4AFU C;  4C0Z A;  1QCN A;  3CBP A;  4OGC A;  2CH4 W;  4KGZ B;  4D8K A;  1QWF A;  2VXE A;  5IN1 A;  1OU8 A;  4RKU E;  1ZLM A;  1KQS P;  3C94 A;  1SRL A;  1WJS A;  4DEY A;  2RQR A;  1YIT Q;  4V2S A;  2BTT A;  3EGX A;  1TH7 A;  2FG0 A;  4E7L A;  2PVG B;  1N8R R;  2QQS A;  1QMC A;  4J9E A;  3V8K A;  2XDP A;  1VQ7 A;  4C92 G;  3OMC A;  3MKD A;  2MF2 A;  3NFC A;  1ZSZ B;  1ZA2 B;  1KG1 A;  2HQX A;  3INZ A;  4GLK A;  1WXT A;  1VYV A;  1W4S A;  4LD9 K;  2A08 A;  1RAI B;  3I55 Q;  3H9N A;  1VQ9 Q;  5IXB A;  2COZ A;  3OYI A;  1M2V A;  3CCE T;  1G3S A;  2DKG A;  4EMK B;  3QZ5 B;  2ZPE B;  3BDU A;  3EFO B;  1UHF A;  5A0G A;  1K8A U;  4E7K A;  3URG A;  4PJL A;  3CCR T;  2RHI A;  4PLL A;  4OMO A;  3I5S A;  1KQ1 A;  2RM4 A;  4TVR A;  5EG2 A;  5GAN 3;  1KJW A;  2EJF A;  3QDR B;  1TUD A;  5GMK m;  1LCK A;  2LNH B;  1E6G A;  1K73 R;  2C0I A;  2J6F A;  2AKL A;  3NGP A;  3VV0 A;  4A4G A;  1KQ2 A;  1PC0 A;  5FRO A;  1U8R A;  3CCQ A;  1M3C A;  1MMA A;  2EVR A;  3NMZ C;  2CP0 A;  1HXD A;  4J9I A;  3OYF A;  1QCF A;  4PJN A;  2L3R A;  3M54 A;  4HXJ A;  1D1A A;  2K2M A;  3M5A A;  3UF4 A;  2RQW A;  1IHW A;  1UGV A;  2DIL A;  1TSF A;  3CME Q;  2AHJ B;  3CCL T;  1PCX A;  2LX7 A;  4QQ6 A;  2K9G A;  2LT4 A;  4M77 A;  2A36 A;  4A4F A;  1FMK A;  1VIE A;  2L8D A;  5GAN d;  3CCJ A;  3M0U A;  3QWY A;  2CZ6 B;  2BKD N;  3GP8 A;  2K5I A;  2EYX A;  4C8Q B;  2MAM A;  2KK4 A;  2HKN A;  1P92 A;  2DTH A;  1H8K A;  1GRI A;  4EMK C;  3OA6 A;  4Q5W A;  1VYT A;  3SHW A;  3EAE A;  3FDR A;  3G4S T;  3MPU B;  4BE1 A;  2YXY A;  3J80 E;  2K3B A;  4M75 G;  2E3H A;  2GNC A;  3LX7 A;  4M77 F;  3SWN B;  2EKO A;  1K9M U;  5FRN A;  1CKB A;  4EDU A;  4AG2 C;  3CC4 T;  2DMO A;  1TTH B;  3C12 A;  1BCM A;  3CCS A;  2EKH A;  1KFZ A;  5GMK i;  2OTJ T;  1NZ9 A;  2FPF A;  2GTO A;  1M27 C;  2C06 A;  1OPK A;  2FZG B;  2K5F A;  2M9U A;  3CCE Q;  4OML A;  3L2W A;  2EYQ A;  1Q95 G;  2HL3 A;  2HL5 C;  4FCY A;  1VQK A;  3QJ6 A;  1ARK A;  2WSE E;  3CCR Q;  4KBM B;  4RTU A;  3OYA A;  4E6R A;  1OYX A;  1JJ2 S;  3A8H B;  2YRV A;  2RF0 A;  4C92 A;  1RAA B;  1O9S A;  1K8A R;  4LDU A;  3J81 E;  1RLQ C;  2RMO A;  1PKS A;  5HK3 A;  4XU0 A;  3JB9 J;  2F5T X;  4C8Q C;  1VQ4 T;  2OAW A;  2DAQ A;  1U3O A;  4F7U G;  1QKW A;  2H3E B;  1K73 C;  3LW5 E;  4KH0 B;  1YP5 A;  2JVV A;  3OSV A;  2P0Q A;  5CQY A;  1YJW T;  1I07 A;  1OPL A;  3M0R A;  2RI2 A;  5CKE A;  4OVA A;  4C92 F;  5KYU B;  4PJO E;  5KYW A;  1XQH A;  2R57 A;  3CCL Q;  2KEA A;  4PFZ A;  2EBP A;  2W10 A;  5CCA A;  1OX9 A;  3NTH A;  3CCU T;  1RLP C;  2RHU A;  5FU7 C;  3CC7 T;  1YJ9 T;  3PIP A;  4N4G A;  3DLM A;  1ZUU A;  1TS9 A;  1N5Z A;  3CXC S;  4J7F A;  2CRE A;  3NHN A;  2HQH A;  3H0I A;  2BIV A;  4E7S A;  2YT6 A;  3JB9 I;  4C5I A;  3OW2 A;  3PVL A;  1M90 R;  4KUD K;  2Y4X A;  3C95 A;  3G4S Q;  3WVE B;  2JS0 A;  1YIJ T;  2XKO C;  4QW2 A;  2VXF A;  4OGE A;  3CC4 Q;  1JEG A;  1ZBX A;  3JRZ A;  2KNB B;  2LCS A;  3T9N A;  2RI3 A;  1S72 A;  2OTJ Q;  3L1A A;  3LH5 A;  2QGF B;  1SHG A;  1X2Q A;  1AWX A;  5LJ5 h;  2E5Q A;  4LXC A;  2FEI A;  2EW3 A;  4BE0 A;  4FW1 A;  3OSS C;  2K7A A;  3RR6 A;  1W1F A;  2RPN A;  4ZGD B;  4K11 A;  1D1B A;  1HD3 A;  1U1T A;  2MWP A;  1KC8 R;  1E7O A;  1PD0 A;  2LZ6 B;  2DK3 A;  2RHY A;  4M75 A;  1PG5 B;  1V1C A;  1ZSZ A;  1FXX A;  4J5Y A;  5GAM h;  1G3T A;  2HQE A;  1MNE A;  1VQL A;  1PRM C;  5LJ3 h;  4QKU A;  1B34 B;  1M1G A;  2GTJ A;  4JJC A;  1VQ4 Q;  1UEC A;  4J8O A;  4A4K A;  5LJ5 j;  2IG0 A;  1QVF A;  4M78 F;  1KIK A;  3M0P A;  3I9Q A;  4JRP A;  3AT1 B;  4X9C A;  5CAI A;  4PJO D;  3EG1 A;  1IXD A;  1ZBJ A;  4M75 F;  2JM8 A;  1KQS S;  4IKF A;  1YJW Q;  2VVK A;  3AHU A;  2XG8 D;  1YCY A;  2A3L A;  4HA8 A;  2DBM A;  3QG1 A;  1YJN T;  1WHK A;  2KRM A;  4J6Y A;  3TSZ A;  2XHC A;  2IVW A;  1XNI A;  2JW4 A;  2KRO A;  3O8V A;  5GAM j;  3G1J A;  3MHX A;  1VQ8 T;  1RAE B;  1RI0 A;  2XMF A;  1T3S A;  2Z0W A;  3CCU Q;  2QYZ A;  4M7D E;  4OMP A;  3EGU A;  3CC7 Q;  1YJ9 Q;  5LJ3 j;  2CGH A;  3RUX A;  2D8J A;  2JOY A;  2PNI A;  1YNZ A;  2SEM A;  1I4K 1;  2DO3 A;  2DXB A;  3PFS A;  4DEX A;  4F7U A;  1OU9 A;  3ULR B;  4JUV A;  3M56 A;  1YIJ Q;  1FMV A;  2X35 A;  1OI1 A;  3OYN A;  3PNW C;  2KXC A;  5I2S A;  4XTU A;  1V29 B;  2QI2 A;  2JS2 A;  1X75 C;  1YI2 A;  2GGR A;  1M90 C;  4JS4 A;  1W2B A;  5KE2 A;  3NTK A;  1IHV A;  5HY6 A;  1SSF A;  1UGS B;  2GF7 A;  4GBQ A;  1SG5 A;  1Q7Y U;  1Z9Q A;  1EX4 A;  3SDZ A;  2IPO B;  3VYH B;  1SPK A;  1NEB A;  2CP5 A;  1JXO A;  3RIR A;  3M0T A;  2A0F B;  2DYI A;  4F7U F;  3PMI A;  4E2F B;  1G3W A;  2F69 A;  1YCS B;  2JTE A;  3H6Z A;  4A4H A;  4II1 A;  3O5Z A;  4J6W A;  2NUT A;  2DD4 A;  5I2M A;  2QEX T;  3SWN A;  3BDL A;  1WI7 A;  2G6F X;  2DL4 A;  3CC2 A;  5LJ5 e;  1VQM T;  2K57 A;  4F16 A;  2OX7 A;  3BY7 A;  3QXE B;  2GCX A;  4PJO B;  4NS5 A;  4XK8 E;  1KC8 C;  3OY9 A;  4BI3 A;  2QTX A;  2DIG A;  5GJW B;  1X2K A;  3QBY A;  4QVZ A;  1GBQ A;  1JQQ A;  3JV3 A;  2DL7 A;  5GAM e;  4E47 A;  3E9F A;  5GAN 6;  2YRC A;  2KT8 A;  1X69 A;  1QKX A;  3G6E T;  4RTX A;  4J9F A;  5LJ3 e;  2KQW A;  4AFQ C;  4E7Z A;  1J3T A;  4HVU A;  4C8Q E;  1IGU A;  2GBQ A;  1YJN Q;  4N0A A;  1V76 A;  1UTI A;  1Q82 R;  5LL6 S;  1Y07 A;  3FJ5 A;  3CPW A;  3E19 A;  1VQ8 Q;  4FYW B;  1UB4 A;  1QVG A;  1ZHI A;  1G2B A;  4Z89 A;  5GAO r;  4OMN A;  3RBB B;  3VRZ A;  1AZG B;  3UA7 A;  5KYX B;  3FRN A;  1FYN A;  2EPD A;  3X28 B;  2P4T A;  2I2L A;  4L5G A;  2GFU A;  2E6Z A;  2CH4 A;  2CDT A;  5I11 A;  2AKK A;  2QQR A;  2RQT A;  4J83 A;  3GNF B;  2ZAE A;  2NUP B;  2WAC A;  4F04 B;  4ZGJ B;  4JZ3 A;  4NL3 A;  5KYU A;  4ZTF A;  5IHI A;  4QT7 A;  2QQ9 A;  2MPX C;  2PUO B;  1VQN T;  3CD6 T;  2X4J A;  4LNP A;  2DBK A;  4FU6 A;  2X51 A;  2YHT A;  1PRL C;  2LQK A;  1NM7 A;  1LVK A;  3TVT A;  1UUE A;  1T0H A;  2E10 A;  2DIQ A;  2ED1 A;  1VQO A;  3EG9 B;  3GOX A;  4J9H A;  4ZN3 A;  1WYX A;  2E5K A;  1WHJ A;  1K9A A;  1VQP T;  3CMA A;  4B9W A;  2QEX Q;  3OMG A;  1NPP A;  3MEW A;  2EAY A;  4PJO G;  1I5L A;  1VQM Q;  2QQB A;  2KXD A;  3HP9 A;  2ABL A;  2LNV A;  3EFR A;  2CZ1 B;  1RAG B;  1KSW A;  2EQI A;  3OS5 A;  2LCL A;  1XOV A;  3PVQ A;  1GXI E;  3RKY A;  1QVF P;  5M9O A;  1D0Y A;  3X25 B;  2FHD A;  4JJB A;  5GAN 4;  5CO7 A;  1IO6 A;  2R58 A;  4D6W A;  3VS3 A;  3JB9 D;  1JRI A;  2PVD B;  4XTV A;  1FWZ A;  4R0K A;  4M7D B;  1LOJ A;  4LN2 A;  4KGV B;  3REB B;  4JJN K;  2V1R A;  5J39 A;  4M7A E;  2KY9 A;  4C8Q D;  1NYF A;  1ABQ A;  2E65 A;  8AT1 B;  1M2O A;  3G6E Q;  2KRS A;  4HVV A;  2QA4 T;  1DJ7 B;  3PE0 A;  4F14 A;  3DB3 A;  2K79 A;  4XU2 A;  1UJ0 A;  2KDS A;  4FT4 A;  1WDX A;  3VS2 A;  3G7Z A;  1M4Z A;  4HCK A;  1GFC A;  2DF6 A;  1MGQ A;  2KAF A;  1QLY A;  3I56 Q;  3V7C A;  3JSC A;  1Q82 C;  1TUG B;  3JCM Q;  3M0S A;  1YHQ A;  2YLB A;  4IUV A;  2O4X A;  2CP3 A;  1OOT A;  3G71 A;  3MEV A;  2PZ1 A;  2MYS A;  2JT4 A;  2E64 A;  2MI6 A;  3HRS A;  4X9D A;  2EQM A;  5IAY A;  1WZO A;  1VUB A;  5KYN A;  1E6H A;  2VYT A;  2QGG A;  4KH1 B;  3RDV A;  2XDD A;  1VQN Q;  1UGR B;  3CD6 Q;  2BUD A;  2AZV A;  4N4H A;  1D3B B;  2COW A;  3LLR A;  3VYG A;  3VKI A;  4A4E A;  2FYK A;  3MP1 A;  1IGQ A;  2R5A A;  4J6X A;  1Q81 C;  4X1V A;  2DPP B;  4XQ3 A;  2PU9 B;  4M7D C;  4PFP A;  2E70 A;  2CT4 A;  4OB0 B;  3PIO A;  3GBQ A;  2CSQ A;  1WJR A;  5C6S A;  3J7A F;  2P84 A;  3IQL A;  3A8L B;  3TRE A;  1VQP Q;  4GY5 A;  2KT1 A;  3QSU A;  2FL7 A;  1Q86 U;  1KK7 A;  5GAN f;  4M78 C;  3CCV T;  5IT9 E;  2DL8 A;  2DM1 A;  3GLX A;  2L5Q A;  2E4H A;  1Y7X A;  2D9T A;  4RUG A;  2QQA A;  2EYY A;  5DY9 A;  4A63 B;  1WX6 A;  2RI5 A;  3JCM J;  4CC4 B;  1R0B G;  3MCA B;  4WTO B;  1TG0 A;  1D09 B;  5DM7 R;  1OZ2 A;  2MIO A;  2KRN A;  2DEQ A;  2DXC A;  4LDX A;  2DXT A;  2DVE A;  2V8J A;  1PSF A;  1MV0 B;  4MMK A;  2J6K A;  3UA6 A;  5CQX A;  3DLL A;  2OI3 A;  3CQT A;  1WHM A;  3HSB A;  1N8R C;  2LDM A;  2V8I A;  2QA4 Q;  1VOM A;  1LJO A;  4HCB A;  1ZA1 B;  2OTL T;  3OBY A;  5AT1 B;  1NYG A;  4BAC A;  1QVG P;  4FW2 A;  2M02 A;  3CCM A;  5FU7 B;  1KD1 U;  3NTI A;  4PJO A;  4JDS A;  1I81 A;  3RER A;  2XD0 A;  1S1N A;  1IRE B;  3P8H A;  2GQI A;  3M55 A;  2ATC B;  3M9Q A;  1M8M A;  4L6V 5;  4C5E A;  1SEM A;  2CZ7 B;  7AT1 B;  4IUR A;  1UG1 A;  3P8B B;  4PKC C;  2MCN A;  4J9D A;  2B86 A;  2HSP A;  4RTW A;  3QPH A;  4M77 E;  1G3Y A;  5GAO l;  2K5L A;  5AYF A;  1X6O A;  2EFI A;  4MDW A;  4J9B A;  2CUB A;  1WA7 A;  2RK1 A;  1C0M A;  5EC7 A;  1VQ7 T;  2DET A;  2JUF A;  5I22 A;  3QUI A;  3MO8 A;  2RJD A;  2FB7 A;  3TU4 K;  2EGC A;  1ABO A;  1UHC A;  2YDL A;  4C0G A;  1GCQ C;  3VUZ A;  4P5N A;  2PVO B;  2MOX A;  3JB9 G;  1MMD A;  1UGP B;  2ZPB B;  3UDC A;  3BE3 A;  4M7A B;  1NJI U;  2NUP A;  1VQ5 A;  2I0N A;  4C8Q G;  3VJP A;  2YLC A;  3CCV Q;  1N9R A;  2JM9 A;  2JMA A;  3DKM A;  3DB4 A;  2HMA A;  2ZZD A;  3X20 B;  4IUU A;  1QVP A;  3MJX A;  2EGA A;  2CUD A;  4BDY A;  1LNX A;  4LD6 A;  1HSQ A;  2ZPH B;  1M9S A;  2KSS A;  3UWN A;  3ZBD A;  1Q86 R;  5KCO A;  1VQ6 A;  1X01 A;  3EHR A;  3EGD B;  2DER A;  1GL5 A;  1OQK A;  4FSS A;  3EG9 A;  1I1J A;  3GIB A;  3CCQ T;  1UEB A;  2DE0 X;  2O88 A;  4R56 A;  4O5V A;  2OTL Q;  1YIT A;  2QTV A;  1K9M R;  3OYL A;  2M1H A;  4JRQ A;  3S3M A;  4XTX A;  4QQD A;  4PK4 A;  3FEO A;  4PFO A;  2RJF A;  3FB9 A;  1AEY A;  5A0L A;  5IHN A;  2RQV A;  4FYY B;  3FJP A;  1BI0 A;  2LQW A;  1IB8 A;  2RJC A;  2BZY A;  5J26 A;  2ROT A;  1ZSG A;  5KE3 A;  2R5M A;  4JJD A;  2O9S A;  3JCM b;  4DA4 A;  4BB7 A;  3CCJ T;  1PKT A;  2K6D A;  2QDY B;  3EGX B;  3I55 A;  1VQ9 A;  1IRX A;  3A8G B;  3JCM f;  4M7A C;  2MMP A;  1G5V A;  3P8D A;  3REA B;  3VUB A;  1WXB A;  4M4Z A;  1T3L A;  1SSH A;  5CK9 A;  1Y71 A;  4EIK A;  2LT1 A;  1VQ7 Q;  2FPD A;  2F2V A;  4OB2 B;  1K8A C;  1M2V B;  4NL2 A;  4CC3 A;  4EMK A;  1ACM B;  3EFO A;  3CCS T;  3HPW A;  4OB3 B;  1B7T A;  1QVF S;  1WHG A;  1JXM A;  4OMQ A;  3LWI A;  3QYG B;  4ME7 A;  2LVM A;  5HCK A;  3SB2 A;  3E9G A;  4RCC A; 
#chains in the Genus database with same CATH homology
 3M0Q A;  2NWM A;  4OMN A;  2YSQ A;  2W0Z A;  4CC7 A;  3RBB B;  3VRZ A;  1Y57 A;  1AZG B;  3UA7 A;  1JU5 C;  1AVZ C;  1FYN A;  2DRM A;  2DVJ A;  2AZS A;  2EPD A;  1KJW A;  1A0N B;  1TUD A;  1LCK A;  2LNH B;  2CH4 A;  2CDT A;  1H3H A;  1E6G A;  5I11 A;  2C0I A;  2J6F A;  2AKL A;  2DJQ A;  2M51 A;  2AKK A;  3NGP A;  2RQT A;  4IIM A;  1X27 A;  1M3C A;  2EVR A;  2FRY A;  3NMZ C;  1X6G A;  4JZ3 A;  4J9I A;  4AG1 C;  1SRM A;  2M0Y A;  1QCF A;  5IHI A;  4QT7 A;  1WFW A;  1K76 A;  1PWT A;  4HXJ A;  2ECZ A;  4LNP A;  3EG0 A;  1BBZ A;  4Z88 A;  2K2M A;  2DBK A;  3UF4 A;  2RQW A;  2PTK A;  2BZX A;  1UGV A;  1PRL C;  1NM7 A;  2DIL A;  3TVT A;  2V1Q A;  4GLM A;  1UUE A;  2DNU A;  2FO0 A;  2J06 A;  2LX7 A;  1T0H A;  1YWP A;  1B07 A;  1HJD A;  1M3A A;  2K9G A;  2YUN A;  2HBW A;  2A36 A;  2ED1 A;  2KBT A;  4JPB W;  1FMK A;  4J9H A;  3M0U A;  4KRT A;  1YN8 A;  1WYX A;  3QWY A;  2E5K A;  5GJV B;  1EFN A;  2EYX A;  2H8H A;  4F17 A;  1K9A A;  1NLO C;  2LJ3 A;  2KYM A;  1H8K A;  1W70 A;  2KXD A;  2O31 A;  1GRI A;  2ABL A;  4JZ4 A;  1VYT A;  3SHW A;  1KSW A;  2O2O A;  2EQI A;  1XOV A;  2P4R A;  3PVQ A;  2L3S A;  2FRW A;  3A98 A;  2K3B A;  2GNC A;  2KR3 A;  1CKB A;  2KYB A;  4AG2 C;  2HCK A;  4JJB A;  1IO6 A;  2DMO A;  2ED0 A;  3VS3 A;  2D8H A;  2OJ2 A;  4R0K A;  1AD5 A;  4AFS C;  2EKH A;  4LN2 A;  3REB B;  2V1R A;  1KFZ A;  2DL3 A;  4CC2 A;  2X3X D;  2J6O A;  1NYF A;  1ABQ A;  2YUQ A;  2FPF A;  2ENM A;  2GTO A;  2KRS A;  1AWJ A;  1M27 C;  2RQU A;  4HVV A;  1OPK A;  3PE0 A;  3I5R A;  1WIE A;  4F14 A;  1CKA A;  4OML A;  2YUP A;  2K79 A;  4RTZ A;  1UJ0 A;  2A37 A;  3VS0 A;  3UAT A;  2L0A A;  5FW9 A;  1WDX A;  3VS2 A;  1NLP C;  1ARK A;  4ORZ A;  1ZX6 A;  2D0N A;  1UDL A;  1GFC A;  2DF6 A;  4HCK A;  4J9G A;  1QLY A;  4RTU A;  4E6R A;  2CT3 A;  3M0S A;  2RF0 A;  1NEG A;  2DA9 A;  1BU1 A;  1OOT A;  4J9C A;  2KE9 A;  1RLQ C;  4ZNX A;  2EYW A;  4OMM A;  2PZ1 A;  1PKS A;  1I0C A;  2RMO A;  2JT4 A;  2EYZ A;  2OAW A;  1U3O A;  4LUE A;  1QKW A;  1E6H A;  2ROL A;  1M3B A;  1UJY A;  5IH2 A;  1MV3 A;  1YP5 A;  1K0X A;  2AZV A;  4LUD A;  1I07 A;  1OPL A;  3M0R A;  1VYU A;  4Z8A A;  1WXU A;  1Y0M A;  1M30 A;  4X1V A;  2KEA A;  2EBP A;  3NPF A;  3SEM A;  3QWX X;  2W10 A;  2CT4 A;  3GBQ A;  2CSQ A;  1AWW A;  3VS1 A;  1TUC A;  1RLP C;  2DX1 A;  1K1Z A;  4ESR A;  3IQL A;  1ZUU A;  1N5Z A;  4RTV A;  4WCI A;  2KT1 A;  2CRE A;  3NHN A;  3H0I A;  1BK2 A;  2YT6 A;  3VS7 A;  3VS5 A;  2DL8 A;  2DM1 A;  3PVL A;  3VS4 A;  2L2P A;  2X3W D;  2JS0 A;  4RUG A;  2VWF A;  2EYY A;  4A63 B;  3THK A;  1WX6 A;  4CC4 B;  2LMJ A;  1TG0 A;  1JEG A;  1G83 A;  3VRY A;  2MIO A;  2KRN A;  2DLP A;  1U5S A;  1GCQ A;  2KNB B;  2LCS A;  1U06 A;  1T0J A;  1MV0 B;  2AK5 A;  1YWO A;  2J6K A;  3UA6 A;  1GCP A;  4LE9 A;  2JMC A;  3LH5 A;  2OI3 A;  3CQT A;  1SHG A;  1OV3 A;  1AZE A;  1X2Q A;  1AWX A;  3TSW A;  2C0T A;  2FEI A;  2NUZ A;  2EW3 A;  1NYG A;  2L3Q A;  1AOJ A;  2K7A A;  1W1F A;  2RPN A;  2RNA A;  2CSI A;  1QWE A;  4K11 A;  4RTY A;  1HD3 A;  5L23 A;  1S1N A;  1X6B A;  3H41 A;  1PNJ A;  3H0H A;  2GQI A;  1VA7 A;  1M8M A;  1E7O A;  2LZ6 B;  3R6N A;  1V1C A;  2BZ8 A;  1SEM A;  5FWC A;  2J7I A;  1UG1 A;  3KFV A;  3ZL7 C;  1AWO A;  2MCN A;  1ZUK A;  2L3P A;  1PRM C;  2B86 A;  2HSP A;  4J9D A;  2GTJ A;  4RTW A;  4JJC A;  1UEC A;  1X43 A;  2EGE A;  1B3Q A;  1KIK A;  4J9B A;  2CUB A;  3M0P A;  3I9Q A;  1WA7 A;  3EG1 A;  2KGT A;  2LJ0 A;  1MUZ A;  5EC7 A;  1ZBJ A;  2JM8 A;  2VKN A;  2VVK A;  2A28 A;  1RUW A;  2O9V A;  4RTT A;  5I22 A;  2DBM A;  1UFF A;  1W6X A;  2ESW A;  3I35 A;  2SRC A;  2EGC A;  1ABO A;  2KRM A;  3TSZ A;  3H0F A;  2JW4 A;  2KRO A;  1UHC A;  2YDL A;  1NG2 A;  1GCQ C;  2HDA A;  2XMF A;  2MOX A;  1GBR A;  2F2W A;  1T3S A;  2J05 A;  4OMP A;  1BB9 A;  1CSK A;  3EGU A;  5ECA A;  2D8J A;  2I0N A;  2PNI A;  2JXB A;  1YNZ A;  5IXF A;  2SEM A;  3EG2 A;  2LP5 A;  3U23 A;  2DYB A;  2JM9 A;  2JMA A;  2LJ1 A;  4DEX A;  2DRK A;  3ULR B;  3EG3 A;  2EGA A;  2CUD A;  2F2X A;  1JO8 A;  1HSQ A;  3VS6 A;  2KXC A;  2IIM A;  2JS2 A;  2GGR A;  2LQN A;  1WLP B;  3EHR A;  5IHK A;  1GL5 A;  4D8D A;  4GBQ A;  4FSS A;  1Z9Q A;  1I1J A;  2DL5 A;  2HEQ A;  1Z9Z A;  2QDL A;  1SPK A;  1NEB A;  1JXO A;  2FPE A;  3M0T A;  1PHT A;  1K0S A;  2DE0 X;  2YUO A;  1OEB A;  2O88 A;  1K4U S;  1YCS B;  2JTE A;  3O5Z A;  5FWB A;  4AFU C;  1AEY A;  5IHN A;  2RQV A;  2CH4 W;  4AFZ C;  1WI7 A;  4D8K A;  2G6F X;  1QWF A;  2DL4 A;  1SHF A;  2LQW A;  1ZLM A;  2BZY A;  1SRL A;  2ROT A;  1ZSG A;  4DEY A;  2RQR A;  4F16 A;  4JJD A;  2O9S A;  2BTT A;  3C0C A;  1PKT A;  2FG0 A;  2K6D A;  3RNJ A;  4J9E A;  5GJW B;  1X2K A;  3EHQ A;  1GBQ A;  1JQQ A;  3REA B;  4HVW A;  1WXB A;  4M4Z A;  1T3L A;  1ZUY A;  2DL7 A;  3JV3 A;  4OMO A;  1SSH A;  1WXT A;  1VYV A;  1H92 A;  4EIK A;  2A08 A;  1RI9 A;  1UE9 A;  1X69 A;  1QKX A;  2KT8 A;  4IIO A;  4RTX A;  5IXB A;  4J9F A;  4Y92 A;  2RN8 A;  2FPD A;  4AFQ C;  2C0O A;  2F2V A;  1J3T A;  4CC3 A;  4HVU A;  2GBQ A;  1GFD A;  2D1X A;  1UTI A;  1UHF A;  3FJ5 A;  1JXM A;  4OMQ A;  5HCK A;  1G2B A;  4Z89 A;  3I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...