1HD3A

A-spectrin sh3 domain f52y mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'GKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGYVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
molecule tags Cytoskeleton
source organism Gallus gallus
publication title Unspecific Hydrophobic Stabilization of Folding Transition States
pubmed doi rcsb
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hd3A00
1SRMA 1MV3A 2F2VA 3EG3A 2ED1A 2X3WD 3UA7A 1UG1A 1X27A 2DRMA 3CQTA 1MUZA 4AG1C 4CC2A 4J9EA 5FW9A 1NEBA 3EGUA 2KT1A 1WXUA 4J9DA 2LJ3A 1YWPA 1OEBA 1K9AA 2BZYA 2KE9A 3M0RA 1PKSA 2JM9A 2K79A 1VYVA 2K2MA 1QCFA 2A28A 1UJ0A 4J9CA 2JMAA 1E7OA 1PRLC 2A36A 2GNCA 2KXCA 3I5RA 1YWOA 4AFUC 1AWXA 4AG2C 2KXDA 2CSQA 2PTKA 1SPKA 3A98A 4QT7A 1CSKA 1W1FA 2PZ1A 1FYNA 5IHNA 1UTIA 4RUGA 1EFNA 2LX7A 1GBQA 1RI9A 1Z9ZA 1ZSGA 1U3OA 2RQUA 4LUEA 1Y0MA 4AFSC 4D8DA 1HD3A 2E5KA 4HVWA 1ABQA 2V1RA 1GL5A 4OMNA 3M0SA 1PWTA 2HSPA 4JJBA 1NEGA 2YSQA 4CC3A 1M8MA 1Z9QA 2KT8A 3NHNA 4RTWA 1W6XA 1GCPA 2J7IA 2O9VA 1HSQA 1CKBA 2ESWA 2RQRA 3H0FA 4JJCA 2JM8A 1JEGA 2O88A 4OMPA 1X69A 5IH2A 2F2WA 1AWWA 2AKLA 2H8HA 2CDTA 1VA7A 1UHFA 1IO6A 2RQVA 1H8KA 1OV3A 2KNBB 3VRYA 1SHGA 1M30A 1OOTA 2F2XA 5FWBA 4RTUA 1JXMA 3LH5A 2DA9A 3M0QA 1WLPB 2CT4A 1VYUA 1BK2A 1UDLA 1BU1A 4OMQA 4FSSA 3RNJA 4LE9A 1BBZA 2ABLA 2J05A 2EGEA 2DL5A 1JU5C 4J9GA 2RQTA 2CSIA 2CUBA 2DL3A 1U06A 1PHTA 1K0SA 1I1JA 2GBQA 2K6DA 5HCKA 2CT3A 2DYBA 2KYMA 2ROTA 2AZVA 1WX6A 2KRNA 3GBQA 2JW4A 1AWJA 1SEMA 4A63B 3NMZC 3TSWA 2FPFA 1WA7A 1K1ZA 2EVRA 2M0YA 3VS4A 4HVUA 1WXTA 3EG1A 1T0HA 4JPBW 2QDLA 2B86A 4E6RA 5GJWB 1X2QA 1E6GA 1GCQA 1I07A 1QWEA 1ZUUA 2DX1A 1QLYA 2MIOA 1UJYA 2FG0A 2O2OA 3EHQA 4Z8AA 3SEMA 1FMKA 5EC7A 4RTTA 3EHRA 3QWXX 1NYGA 4D8KA 3QWYA 1LCKA 5IXFA 1TUCA 2KRSA 3PVQA 2DVJA 1BB9A 3TSZA 4AFQC 1RLQC 1NLPC 2DNUA 4F14A 1WI7A 4GBQA 2KYBA 3U23A 1UUEA 2C0IA 4GLMA 1ARKA 2M51A 2ED0A 1AZGB 1ZX6A 2J6OA 1AD5A 2OI3A 5ECAA 1B3QA 4F16A 2JS2A 2KBTA 1YNZA 1NM7A 4F17A 1ZUYA 1RLPC 1TUDA 1X6BA 3VS5A 4CC7A 3IQLA 3KFVA 2C0TA 2FPEA 3PVLA 1CKAA 2MOXA 2DE0X 2DRKA 1T3SA 4Z89A 2NWMA 1K0XA 5I11A 3M0PA 2LMJA 1GFDA 1GCQC 2EYXA 3EG2A 2DBMA 1WYXA 2GTOA 1U5SA 2EPDA 1M3AA 1K76A 2GTJA 1WDXA 1UFFA 2A08A 2C0OA 2CH4W 3NPFA 1NG2A 1X6GA 3NGPA 2EYZA 2YT6A 1KSWA 1AEYA 3O5ZA 3REAB 1JXOA 1UHCA 2HBWA 1X43A 2AZSA 1HJDA 2GGRA 1SSHA 2DM1A 5I22A 2RN8A 2OAWA 2ECZA 1H92A 1GBRA 2EKHA 1WFWA 4LNPA 2LQNA 2BTTA 1OPKA 2PNIA 4OMMA 2DF6A 2YUQA 2LNHB 4EIKA 3RBBB 1AOJA 2EQIA 2K9GA 1I0CA 2EW3A 1PKTA 1KFZA 3ZL7C 2KGTA 1UE9A 2YUOA 4J9HA 1KIKA 2BZXA 1NLOC 2J6FA 2J6KA 2LP5A 2RF0A 3ULRB 4JZ3A 4RTZA 4ESRA 2G6FX 2VKNA 1AVZC 2D1XA 1VYTA 4M4ZA 2CUDA 1QWFA 1G83A 2EYYA 2EBPA 2L3QA 2RMOA 4HVVA 2D8JA 3C0CA 1ABOA 4HXJA 2XMFA 3VS6A 2FRWA 2JS0A 1JO8A 1KJWA 2JXBA 3VS0A 1PNJA 4CC4B 5IHKA 2JMCA 4X1VA 2IIMA 2JTEA 3VS3A 1PRMC 2KROA 4K11A 2CH4A 5IXBA 1XOVA 2EGAA 1QKXA 2HCKA 1GRIA 4JZ4A 2K3BA 2YUNA 4AFZC 5GJVB 2L3SA 1ZLMA 2D8HA 2YUPA 1MV0B 2LQWA 4J9BA 4Z88A 2FEIA 2JT4A 2EGCA 2DILA 1UGVA 2RPNA 1V1CA 5FWCA 3FJ5A 1E6HA 2K7AA 1ZUKA 1H3HA 3VS7A 4HCKA 2LZ6B 4J9FA 2LCSA 1YCSB 3H0HA 2HDAA 1TG0A 2RNAA 3EG0A 2YDLA 4RTVA 1YN8A 4JJDA 1QKWA 2DL8A 2O31A 1M3BA 1JQQA 1NYFA 1ZBJA 2DJQA 2VWFA 2DBKA 3UF4A 3UA6A 1AZEA 2DL4A 2DL7A 3SHWA 2D0NA 2KR3A 3VS1A 3H41A 4IIMA 2W10A 1A0NB 2NUZA 1YP5A 1T3LA 2LJ0A 1AWOA 1B07A 3I35A 3JV3A 4KRTA 2A37A 3R6NA 3VS2A 1WIEA 4WCIA 3I9QA 5L23A 2EYWA 2FO0A 2DLPA 4DEXA 1SRLA 4DEYA 1UECA 4ZNXA 1J3TA 2MCNA 4IIOA 2FRYA 2ROLA 1G2BA 3PE0A 1GFCA 1M3CA 2L3PA 4R0KA 1M27C 3TVTA 3THKA 2X3XD 4ORZA 2O9SA 4LUDA 4LN2A 4J9IA 4OMLA 1S1NA 3UATA 2ENMA 3H0IA 2FPDA 2CREA 2V1QA 2HEQA 1W70A 2L0AA 1SHFA 2J06A 2P4RA 2RQWA 2SEMA 4OMOA 4RTXA 2W0ZA 2AK5A 2KRMA 2DMOA 2LJ1A 2VVKA 3VRZA 1RUWA 3I5SA 2AKKA 2I0NA 4RTYA 1T0JA 1X2KA 1WXBA 2L2PA 1N5ZA 1Y57A 2BZ8A 2KEAA 5IHIA 3M0TA 2OJ2A 4Y92A 3M0UA 2GQIA 1OPLA 2SRCA 1K4US 3REBB
chains in the Genus database with same CATH superfamily
1SRMA 2F2VA 1WQWA 1G3TA 3EG3A 2FL7A 2JJ9A 2X3WD 1UG1A 1VQ8A 4AG1C 4M7DG 2OTLA 4J9EA 3EGUA 4M77A 4J9DA 1WZOA 3CC4Q 4DBFA 3CCST 2KE9A 2JM9A 2K79A 3EG9A 2K2MA 2A28A 3I56T 3OYAA 5CK9A 4F7UA 3RMQA 2A36A 2KXCA 4NL2A 5LJ5f 5A0DA 2O01E 1JBMA 3CC4A 3A98A 4XTWA 2PZ1A 5LJ3j 1QVGS 1RI9A 5LJ3d 1Z9ZA 1ZSGA 1YJ9T 2RQUA 4LUEA 1UGSB 2DTIA 4M7DF 3L42A 4OMNA 4HT9A 3M0SA 1Q81R 1SKUB 2R58A 1RAFB 3C95A 3LGFA 1K73U 1NEGA 4ELYC 2RJCA 1UGQB 4IUUA 2KT8A 3NHNA 1RAAB 1FXXA 5GANe 1GCPA 2DXTA 2J7IA 1VQ9A 2O9VA 4FCYA 1UGRB 2ESWA 2RQRA 1W2BA 2H8HA 5AYFA 3LWHA 1KG1A 1VA7A 4C0GA 1YHQT 4B6MA 1H8KA 1OOTA 4HA8A 3A8MB 1QVFA 1VIFA 2XU8A 4QKUA 1JXMA 3MKDA 2RO0A 5CAIA 1S72Q 4M78B 1N8RC 4M78E 4FYWB 2WSFE 1MMDA 3VU3C 4EMHA 1BK2A 3URGA 1UDLA 3M53A 4MDWA 3CD6Q 4OMQA 2KVQG 5GAN6 1BBZA 2ABLA 5DM7R 2DL5A 3RKXA 2RQTA 3SWNB 2GF7A 2QEXA 3ZEHA 3HKSA 1U06A 3NTHA 2GBQA 2K6DA 5M9OA 4JRPA 1WJQA 4E7ZA 4ZGJB 1VQ7Q 1SEMA 3TSWA 1YI2A 5A2QE 3TU4K 5GAOn 3CCMT 4M7AA 2IVWA 1OU8A 2G3RA 1RAIB 1I81A 2GFAA 2QG9B 1LNXA 1LPLA 3V8JA 1D3BA 3A5ZB 1T0HA 3FJPA 2QDLA 1ZSZC 2E64A 4FYYB 3CMAT 1I07A 3VUBA 2V8IA 2JTMA 1Q82U 3EHQA 1ZHIA 3TEEA 4Z8AA 3SEMA 1FMKA 2D0QB 4V2SA 4B9WA 4PJOF 9ATCB 5KCOA 3EHRA 5IXFA 4PNOA 2ZCFB 3M58A 4HKEA 1VQ4A 4J83A 3G1JA 3QHSA 4E7JA 3MPUB 1SG5A 2C0IA 1VQ6T 3M54A 4GLKA 2M51A 3RR6A 2VV5A 1YHQA 1AZGB 1ZX6A 4XU1A 1AD5A 3MP6A 2Y4XA 5ECAA 2DPPB 2MAMA 3Q1JA 1ZUYA 2LDMA 3FDRA 1JJ2A 1EX4A 3DB3A 4EPCA 3OYCA 1CKAA 2MOXA 1VQLQ 1UB4A 2NWMA 2DEQA 2LMJA 2PUKB 4IUQA 2DBMA 1WYXA 2GTOA 1VQ8Q 3T9NA 2MPXC 1QVPA 4BB7A 1G3YA 1VQOT 4BE1A 1R0CB 3CC4T 1KSWA 1AEYA 1RAGB 2O4XA 3REAB 3G4SQ 1Y71A 2PVDB 2A0FB 1ACMB 1SSHA 3QXEB 3FEOA 3JCMP 3ER0A 4PJLA 2MWOA 1PD1A 1VQ7A 1W2BS 3CCLA 2NUPA 5GANf 3C94A 2DF6A 2YUQA 4F7UG 2L3RA 2QEXQ 3L2RA 3CCUQ 1W2BP 3CCMQ 2K9GA 5CKFA 1D0ZA 4M77G 3QJYA 3PMTA 1UE9A 1YJ9Q 1OI1A 1KIKA 2BZXA 4AMCA 2PVGB 1NLOC 2J6FA 2J6KA 2LP5A 4YTLA 3JCMg 3R6OA 3ULRB 1QCNA 1X6OA 3M59A 5LJ5d 3M57A 4M4ZA 1QP2A 3CEYA 4DBHA 4N4IA 2M02A 2EBPA 1YITT 4IURA 2F5TX 5A0LA 1KQSP 4A4FA 4HVVA 4BUGA 3C0CA 4HXJA 2JTFA 3PFSA 5KYWA 1JO8A 4M77F 4CC4B 2DIQA 5IHKA 4X1VA 3CCRT 4A4EA 2KROA 2HCKA 3X26B 1GRIA 3VYGA 2HNIA 2QASA 5GJVB 3CC2Q 2IPOB 4QW2A 1WHGA 2YUPA 3CC7T 4J9BA 2JT4A 1RAHB 2E3HA 2QTXA 1UGVA 5CR2A 3JCMJ 2K7AA 3HP9A 1ZUKA 4OB3B 4C92C 2HDAA 3M5AA 1KK7A 4M7AE 5LJ5g 1YN8A 4JJDA 3G6EA 1IB8A 4C92D 2DL8A 1MMNA 1M3BA 1JQQA 1NYFA 3MP8A 2V26A 1QVFP 2E41A 1NPPA 2VWFA 5CCAA 3UPUA 3UF4A 3UWNA 4TVRA 3F70A 2GQVA 2OTLQ 4RCBA 2DL7A 2RHZA 3SHWA 4M7AG 4ZTFA 3H41A 4IIMA 2W10A 3CCVT 1YP5A 2LJ0A 1AWOA 4D6WA 2B8AA 1OZ3A 2RHYA 3I9QA 2K5IA 4C5GA 2EYWA 1D0YA 2FO0A 3G7ZA 2QEXT 2VB6A 1KHIA 1WHJA 1SRLA 4DEYA 2X4JA 5GMKi 3HSBA 2VASA 3I55Q 3L2VA 4C92G 2FHDA 2VXFA 3LYIA 2DAQA 5GANh 2M0OA 4R0KA 3CMEA 1M27C 2X3XD 1VQMA 3N5BB 4JRIA 2O9SA 4LN2A 4J9IA 2XKOC 4C0ZA 2ENMA 3H0IA 1OZ2A 4XU2A 4JJNK 1KQ1A 2D6FA 1NE8A 1PSFA 2W0ZA 1M1KR 4M77B 2VVKA 3OYMA 2QAZA 3PT9A 1Y96B 2LTOA 3FC3A 2CZ1B 2RJEA 1T0JA 4XTXA 1WXBA 1VQPQ 1Y57A 3NFCA 3PNWC 3CBPA 1MGQA 4Y92A 5D6YA 5FU7C 3A8HB 1TTHB 4OF1A 3OYIA 1OYXA 3OYNA 3S3MA 1IGQA 1YCYA 1HYOA 5CO7A 3OQ5A 3QZ5B 1X27A 3CQTA 2E6NA 3QDRB 5FW9A 1NEBA 1WXUA 2XDBA 2DIGA 2HZYA 2LJ3A 2KQWA 3I56A 2RH2A 3NTIA 1OEBA 3SWNC 2JVVA 3M0RA 3KUFA 2VUBA 5I2SA 3A8OB 4ZTJA 3LW5E 2GNCA 3I5RA 5GAMd 3EFOB 2LX9A 4AFUC 1AWXA 3CCJA 5GAN4 4EMKB 3UDCA 1K73R 1VQ4T 2KXDA 3EFSA 4F04B 2FZGB 1DJ7B 1SPKA 2PTKA 1U8RA 1HK9A 1CSKA 1W1FA 2X9HA 5KYWB 3OS2A 1Y0MA 4AFSC 1JRIA 1QVGA 4D8DA 1HD3A 2HQXA 4HVWA 1ABQA 1GXIE 2KY9A 1PWTA 4ZN1A 4RMOA 3P8DA 2QGGA 5J3BA 1M8MA 1VQMT 1RAEB 2VYTA 4RTWA 3AHUA 2FZKB 3CMAA 4Z02A 3OYDA 1HSQA 1CKBA 3H0FA 4JJCA 2JM8A 2O88A 1X69A 2VXEA 3CC7Q 2DO3A 4M78C 4A4KA 4IKFA 4C8QG 2F2XA 4KULA 2RA2A 2YWWA 2K57A 2YHTA 2DD5A 3OSVA 1YJNQ 2XICA 1VYUA 1M90C 4KGVB 3HRSA 2M16A 4GY5A 5FU6C 4FT4A 4LE9A 3CCJQ 1YIJT 2J05A 5I2MA 3CCQT 1JU5C 1M2VA 1BKBA 1Q7YR 4EDUA 3SDZA 1XTDA 1KD1U 1WX6A 4OB2B 3GBQA 2CYZB 2E65A 2HBPA 2NUTB 3I56Q 4LDXA 2EQUA 2FPFA 2K2VA 1WA7A 1K1ZA 2M0YA 1WXTA 3EG1A 2EKOA 3JB9I 4E6RA 1BCOA 4LDYA 3DLLA 1QWEA 1ZUUA 5CQXA 3V7SA 1C1AA 2DX1A 1QLYA 3JB9G 5GAN2 2A7YA 4LD6A 2DJZA 4WF2A 2ZPBB 1Q82R 1LCKA 1TUCA 3CCRA 4DA4A 1BB9A 2P84A 1TSFA 4OMFB 3CXCP 4BD3A 4QQDA 1NLPC 2DNUA 4F14A 1WI7A 1NJIC 3QYHB 3G6ET 3U23A 3QYGB 2J6OA 1KD1C 1K8AR 4N4HA 1VQMQ 2OI3A 2LC4A 3AT1B 3BW1A 4IUVA 5LL6S 4F17A 4R56A 1RLPC 2CP3A 4AT1B 3CC7A 2VGNA 2DZCA 2IG0A 2C0TA 1M8VA 2QQAA 3SFMA 3PVLA 2CS7A 5IAYA 4KH1B 4XTUA 4O5VA 4M7DB 2CZ0B 3MO8A 4XTZA 3OS0A 1GFDA 2WSEE 2DFUA 2EYXA 2NUPB 2KMTA 3EG2A 2X4WA 3OB9A 5EG2A 2L5QA 4C0DB 2BIVA 2EPDA 1M3AA 5DY9A 2A08A 2WSCE 1N6AA 3VJPA 3NGPA 4XTVA 2EYZA 2YT6A 4F7UE 1UHCA 1YIJQ 2AZSA 2DK3A 3CCQQ 4M7DE 1M9SA 4RKUE 3CMET 1VQ5A 4E7HA 2RN8A 3RESA 1VQOA 4B9XA 1M1GA 3MEWA 2OAWA 3CMAQ 2ECZA 1H92A 2EKHA 1WFWA 4LNPA 4E2FB 5KYXB 2LQNA 3OW2P 4OB1B 4OMMA 3HHTB 4EIKA 1AOJA 2JZ2A 2ZGWA 3E2UA 1Q81U 1KFZA 5A0GA 3OYFA 5CQYA 2BE9B 1FMWA 2YUOA 2V8KA 4J9HA 2RF0A 1K73C 5FU6B 4J6XA 2HKQB 3RKWA 1KD1R 3HFOA 3CCVA 2LCCA 4ESRA 3QKJA 2VKNA 2D1XA 1D0XA 1VYTA 3CC2A 2BKDN 2X51A 1N8RR 3CCEQ 5KYUA 2YRCA 2RMOA 1PD0A 2MK5A 4M78A 1XQHA 1KJWA 3VS0A 1PNJA 2F5KA 2E5QA 3RMSA 3QSUA 3VS3A 1PRMC 5D6WA 2DD4A 4C92E 3EFRA 2CH4A 5KYNA 1N8RU 2EGAA 2DVEA 1VQLT 2YUNA 3OYLA 4AFZC 1LOJA 2JUFA 2PVOB 2D9TA 1ZSZB 1ZLMA 4PLIA 2QDYB 1VQKT 1TWBA 2LQWA 2F1LA 2RI5A 1OQKA 4Z88A 2HD0A 2FEIA 1VQPA 2DILA 3OS1A 2HL3A 4M7DD 1V1CA 2DTHA 4ZGEB 1VUBA 4M7AD 1H3HA 4E7LA 2K4YA 2YRDA 2COZA 2LZ6B 1KC8U 1R0BG 1UGPB 3H0HA 5CKDA 4M7AC 1BYMA 5KE3A 2YDLA 2H3JA 5GAN3 1IREB 3OYYA 5C6SA 1QKWA 2EJ9A 5HY6A 1B34B 2AHJB 3X24B 2EJGA 1M1FA 3QBYA 4J5YA 2DJQA 2LRQA 2HAXA 3UA6A 1AZEA 2YXYA 3KBGA 4X9DA 3CMEQ 1JJ2S 4C8QC 2NUZA 1Q81C 1T3LA 3JCMW 3NTKA 4KRTA 3R6NA 3VS2A 4M75C 4M75F 5D7UA 2OAUA 2YLBA 3I55A 5GAMj 1JJ2P 5KCHA 2DZ9A 2Y4YA 3OBWA 5LJ5h 2QA4T 4BY6C 5HK3A 1VOMA 4MMLA 2R5AA 3EGDA 3OYBA 5KYXA 1P92A 1YI2T 4JUVA 2KAFA 4NOYA 1M3CA 3QO3A 2QQSA 3JCMd 4ORZA 2LQKA 1KC8C 1FX7A 5GMKm 1Y07A 3SB2A 2XDDA 2EFIA 1D1CA 2V1QA 2FVUA 2HEQA 1WQ7A 4OB0B 2E1HA 4IUPA 1SHFA 4DOVA 1H3ZA 2QGFB 3VV0A 4PJNA 2LJ1A 2X4YA 3VRZA 1RUWA 3OMCA 2JNGA 3M55A 1B7TA 2I0NA 4RTYA 1G3SA 2E10A 4PJOD 4M78F 1BIBA 2KEAA 1YJWA 4M75A 1IZ6A 1JB0E 2OJ2A 2P0QA 3DKMA 3M0UA 2GQIA 3QUIA 2RD1A 2M1HA 1IGUA 4FW1A 4KUIA 3QDFA 1MUZA 5GAN8 5DLQE 1KQSA 4BI8B 2KT1A 3H6ZA 3UT1A 2BZYA 1PKSA 3LWIA 1YJ9A 1I8FA 1VYVA 4Y28E 3GOXA 1OX8A 1QCFA 1UJ0A 5GAOm 4J9CA 2JMAA 1PRLC 4IUTA 5LJ3e 4M75E 3JCMc 6AT1B 4JLGA 2MWPA 3ZFJA 2Z0WA 2XHCA 4QT7A 1QQJA 5IHNA 3BDLA 3RUXA 1EFNA 2LX7A 5GAOp 3PTAA 4HT8A 3G4SA 2P0KA 4FM4B 3QPHA 4FU6A 2P4TA 3CBMA 3META 3A1PA 2YSQA 3JAME 4CC3A 3L1AA 1Z9QA 1NBEB 1N9SA 1W6XA 1VQLA 2DYIA 2CZ6B 5J39A 1JEGA 4OMPA 1PC0A 5IH2A 1AHJB 1N27A 2CDTA 2ZPEB 3E19A 3JCMV 1UHFA 1IO6A 4M77C 2CZ7B 2KNBB 3OS5A 4C8QF 1SHGA 1O9SA 3EGDB 1M30A 5GANd 2KI7A 5FWBA 5GMKh 2RHXA 1D3BB 2EQJA 3MJXA 3LH5A 2DA9A 1WLPB 4MZTA 3C12A 3OYEA 2EWNA 4JDSA 3RNJA 3VUZA 1V29B 1ZA1B 1H641 8ATCB 1S72T 2COWA 1NJIU 4J9GA 1WHKA 1KQ2A 4XU3A 2DL3A 1PHTA 5HCKA 2CT3A 3OYHA 2KYMA 2HMAA 4PJOG 3P8BB 3BY7A 5AT1B 2E70A 3QZ9B 4QVZA 4A63B 2EVRA 2QQRA 3MCAB 3VS4A 2O4XB 4R55A 1M90R 2B86A 1VQ4Q 3FLGA 2K3XA 5GJWB 3KXTA 4E7SA 1E6GA 1GCQA 2QA4Q 4FYVB 4HCZA 2MIOA 1WGSA 4M75G 2ZZDA 1YI2Q 4C8QA 1WPYA 4E7KA 2YLCA 1UEBA 4RTTA 3QWXX 1NYGA 4EMKA 2DKGA 3QWYA 1M4ZA 2DVJA 3CCSA 3TSZA 5GMKl 1VQ6Q 1BI2A 2KSSA 4AFQC 1M1KU 1RL2A 1ZQ1A 4GBQA 1ZA2B 2MF2A 2KK4A 4XAXB 1UUEA 3MEAA 3LX7A 3OSSC 2NYSA 2R57A 1X01A 4GLMA 2RHUA 1ARKA 2ED0A 5KH6A 1I5OB 5GAMf 1BI1A 4PJJA 2FYKA 4NS5A 2E3IA 3MEVA 2KBTA 1RACB 3J80E 1NM7A 2K5LA 3OW2A 4A4HA 1TUDA 3IQLA 1BI3A 5GAOr 2FPEA 3QG1A 1O75A 5LJ3f 2RK2A 1U1SA 3CCLQ 3CD6A 2DRKA 1VQ9Q 1T3SA 4Z89A 1K0XA 2L8DA 2ATCB 2VC8A 2Y90A 2XG8D 4PJMA 4XU0A 3OA6A 4DBQA 3G4ST 5KYYA 3LH0A 3H8ZA 2QA4A 1RABB 3CPWA 2XIDA 1U5SA 2GTJA 1K76A 1WDXA 2CH4W 4RG8A 1Y96A 1OULA 2RJFA 2HBWA 3P8HA 1X43A 2PUOB 3GF5A 4ELZC 4BDZA 4A4GA 2M9UA 2BTTA 1OPKA 4PK4A 2LNHB 3RBBB 4MDXA 5KYUB 1I0CA 4MZMA 2EW3A 1MHNA 4ME7A 3JCMb 2XD0A 3M9QA 3CCUT 2JOYA 4JZ3A 1VQ5Q 4RTZA 3OYJA 3EG9B 2CP7A 2G6FX 4C5IA 3X28B 2DXBA 2HL5C 2NLUA 3EAEA 2ZPFB 3WVEB 1QWFA 2QXFA 2X35A 2KDSA 2EYYA 4FT2A 4JLIA 1OU9A 1ABOA 2E6ZA 5FRNA 2XMFA 4OVAA 2DEUA 2FRWA 1LVKA 1Q7YC 4M78G 2QK0A 3PMIA 4LDWA 1WHMA 4KBMB 1U1TA 2EJFA 4K11A 3FRNA 5GAOq 4L6V5 2K3BA 3GP8A 4LXCA 2CP2A 1QVGP 4HCBA 2EYQA 2RB6A 2L3SA 3WXMB 5I21A 4OP0A 1QW1A 2LT4A 5FWCA 1IXDA 1YJWT 2CKKA 3CCLT 3OMGA 4J9FA 1VQ9T 1IRXA 1TG0A 2LCLA 2RNAA 3EG0A 1TS9A 4RTVA 5GAMg 2OTLT 3V8LA 2O31A 1ZBJA 5KYYB 4PJOB 2DBKA 2QI2A 3CPFA 1X75C 2BE7D 4J7FA 2YRVA 3VS1A 1M2VB 5LJ3g 4C92B 4M77E 3BFMA 5GAN7 3CCSQ 1B07A 3JV3A 2A37A 3BDUA 3CPWS 2ZPGB 4ZN3A 1K8AC 1K9MC 3ME9A 4KT0E 4WCIA 5L23A 8AT1B 3MEUA 4UC4A 3CXCS 2DLPA 3INZA 4DEXA 1UECA 2EQKA 4PL6A 3OW2S 3JCMX 1J3TA 1WNLA 2QQBA 2MCNA 2QQ9A 4XQ3A 1G2BA 3PE0A 2MYSA 3CCEA 2LT1A 3OYKA 4PJOC 2K5FA 5CKHA 3JB9H 4VUBA 4LUDA 2JN0A 1LJOA 1S1NA 3UATA 1C6VX 4M7AF 1MMAA 3OY9A 2FPDA 5IN1A 3TQ7P 1W70A 2RK1A 2RQWA 2SEMA 4OMOA 5FU7B 2AK5A 4Q5WA 3GNFB 2KRMA 1QVFS 2I2LA 5DLOA 1TXQA 1WJRA 1Y7XA 2CP6A 7AT1B 1N5ZA 4XK8E 3GIBA 3M0TA 3TCJA 3CCQA 1OPLA 1YIJA 1K4US 4M7DC 2HQEA 3JCMh 1MV3A 4BE2A 5FLXE 2ED1A 4M7AB 1KQSS 3UA7A 1VQKA 2DRMA 2RI2A 4CC2A 1QMCA 1C0MA 3S3OA 5FRMA 4P5NA 5GMKe 1YWPA 2CP0A 2DETA 1K9AA 1KHCA 3G71A 4QQ6A 3HPWA 4L59A 1K8AU 2AIRB 1N9RA 1E7OA 4FL6A 3L2QA 3GLXA 1VQ5T 1NJIR 4MMKA 1YWOA 4AG2C 1IHWA 2LVMA 5CVIA 4ATOA 4X9CA 2CSQA 2QTVA 1FYNA 1UTIA 2E12A 4RUGA 1GBQA 5GAMe 1NPRA 2COYA 1U3OA 4PJOE 2CGHA 2E5KA 2V1RA 1GL5A 3C4SA 2HSPA 5KE2A 3RKYA 4JJBA 4ANJA 1PM3A 4X34A 3EFOA 3HTRA 5J26A 2R5MA 1ZSZA 3V7RA 4KUDK 3DB4A 3LGLA 3HFNA 3HRTA 5GAN5 3D7SB 1ZBXA 4QVCA 1MNDA 5CKEA 2VGMA 1AWWA 1WHHA 2F2WA 2AKLA 4J6WA 1VQNA 2C06A 5L8RE 2RQVA 3L2ZA 1OV3A 3VRYA 3SD4A 3SWNA 5D6XA 3PIPA 4RTUA 1YJWQ 3M0QA 2CP5A 4C92A 2CT4A 1XJWB 3CBOA 1BU1A 4FSSA 2OTJA 3X25B 2EGEA 3V7CA 1YJNT 4RG2A 1W4SA 1F1BB 2CSIA 2X4XA 3S6WA 2CUBA 4OGEA 4A53A 1K0SA 3CCJT 1I1JA 1R8OB 2EIFA 4M77D 2DYBA 1VQ8T 2ROTA 1Q95G 2AZVA 4JS4A 2KRNA 1G8XA 2JW4A 2RM4A 1AWJA 3GPLA 3NMZC 1VQOQ 4C0FA 1OX9A 1YJNA 4HVUA 2BUDA 1K9MU 2GCXA 2OTJT 4FSXA 4JPBW 4BE0A 2MMPA 1D1BA 3E9FA 5GANj 1X2QA 2K3YA 3E9GA 4CI0C 1M5Q1 4PFZA 3O8VA 1UJYA 1B34A 3H9NA 2FG0A 2O2OA 5HKCA 1V76A 4MZPA 3TREA 3FIFA 2H3EB 4E7IA 5EC7A 4C5EA 4M78D 4BI3A 4EMGA 4D8KA 3G6EQ 4C92F 2KRSA 3PVQA 4O6JA 3X20B 4DQ2A 4F7UB 3CPWP 2AT1B 1RLQC 3HL8A 4FIBA 2KYBA 5HK0A 4C8QB 4PLLA 3J7AF 3MP1A 4N0AA 1YITQ 1RADB 1RI0A 5FROA 4CRIA 1B3QA 2RI3A 4F16A 1QCOA 2JS2A 1WJSA 2XI9A 1YNZA 2HKNA 1X6BA 4QQGA 3VS5A 3L2WA 4CC7A 3CCRQ 3JB9F 3KFVA 1Q86U 3JRZA 2L89A 1I5LA 1EZZB 4J7IA 2DE0X 3LLRA 2RJDA 5I11A 3RDVA 2XK0A 3CC2T 3M0PA 2HQHA 1GCQC 2A3LA 1PG5B 4LDUA 3E1SA 1AT1B 3FB9A 2C0OA 1UFFA 1IHVA 3NPFA 1NG2A 1X6GA 3RIRA 4KGZB 3O5ZA 2EQMA 3GNGA 1VQNQ 1JXOA 1YFNA 1Q7YU 5CKBA 1HJDA 2GGRA 2F69A 2DM1A 4M7DA 5I22A 2LQ8A 2MI6A 4XTYA 1GBRA 3HRUA 1MNEA 5GAOl 1K9MR 2PNIA 3PIOA 2DXUA 3CCMA 3CCUA 2EQIA 1G3WA 4N0AC 2NUTA 2HSEB 1PKTA 1KC8R 4LDVA 3ZL7C 2KGTA 3G71Q 3JB9J 3EH1A 4C8QE 5C0MA 3JCMQ 3CCVQ 1YITA 1BIAA 4DOWA 5GANg 1Q86C 3EH2A 3WVDB 2DXCA 1PSEA 1AVZC 3M4GA 3EGXA 4KH0B 2CUDA 4JRKA 1HXDA 1G83A 2FB7A 3I55T 2L3QA 4A54A 2D8JA 3VS6A 3JB9D 3CCET 4PKCC 3M56A 1YBYA 3ASKA 2JS0A 4BACA 1BI0A 2JXBA 4J6YA 4E47A 4KGXB 2JMCA 2IIMA 2JTEA 4C5HA 1PCXA 5IXBA 1XOVA 1QKXA 4BDYA 1VQKQ 3MHXA 3VKIA 4JZ4A 4WTOB 1WHLA 4NL3A 4QVDA 3QIIA 4PFOA 1D09B 2QYZA 2DERA 2D8HA 4FW2A 3DLMA 1MV0B 5LJ3h 1YHQQ 2ZAEA 2EGCA 4PJOA 2RPNA 3FJ5A 1E6HA 4J8OA 3RERA 3VS7A 4HCKA 3OBYA 1VQPT 1R77A 2LCSA 5CIUA 1YCSB 4FYXB 1EIFA 2P0PA 2WACA 4F7UF 1M90U 4M75B 2OTJQ 2DTOA 2LNVA 1Q86R 1BCMA 1SF9A 3OYGA 1FMVA 4Y91A 3A8LB 2DL4A 3EGXB 4C8QD 4HCCA 4DBRA 2D0NA 5GMKj 1TU0B 2KR3A 2PU9B 1VQ7T 1NZ9A 4M75D 1A0NB 1VIEA 2OX7A 1QP3A 4II1A 3I35A 1G5VA 2PQWA 2E4HA 1TOVA 4EMKC 1WIEA 2ZPHB 2GFUA 5LJ5j 1M1KC 1I4K1 3JCMe 2FZCB 4OGCA 4ZGDB 3G71T 3QJ6A 4ZNXA 1D1AA 2ZPIB 4IIOA 2FRYA 3J81E 3L2UA 1TH7A 5LJ5e 2ROLA 3VYHB 1GFCA 1M2OA 2L3PA 4L5GA 3TVTA 3THKA 1MMGA 3M4YA 3ZBDA 3JSCA 3S3NA 4OMLA 3PGGA 1XNIA 4C0DC 2V8JA 4N4GA 2CREA 4PFPA 2RHIA 3BE3A 1S72A 2L0AA 1TUGB 2J06A 2P4RA 3JCMf 4RTXA 1VQ6A 4LD9K 2DMOA 3A8GB 4BI4A 3CD6T 3I5SA 2AKKA 1Q82C 4RCCA 3CXCA 1SSFA 2EAYA 1X2KA 2L2PA 4JS5A 3V8KA 2XDPA 2BZ8A 1FWZA 4JRQA 5GAMh 1VQNT 5IHIA 4BY6B 5IT9E 2SRCA 3REBB
chains in the Genus database with same CATH topology
1SRMA 1MV3A 2F2VA 3EG3A 2ED1A 2X3WD 3UA7A 1UG1A 1X27A 2DRMA 3CQTA 1MUZA 4AG1C 4CC2A 4J9EA 5FW9A 1NEBA 3EGUA 2KT1A 1WXUA 4J9DA 2LJ3A 1YWPA 1OEBA 1K9AA 2BZYA 2KE9A 3M0RA 1PKSA 2JM9A 2K79A 1VYVA 2K2MA 1QCFA 2A28A 1UJ0A 4J9CA 2JMAA 1E7OA 1PRLC 2A36A 2GNCA 2KXCA 3I5RA 1YWOA 4AFUC 1AWXA 4AG2C 2KXDA 2CSQA 2PTKA 1SPKA 3A98A 4QT7A 1CSKA 1W1FA 2PZ1A 1FYNA 5IHNA 1UTIA 4RUGA 1EFNA 2LX7A 1GBQA 1RI9A 1Z9ZA 1ZSGA 1U3OA 2RQUA 4LUEA 1Y0MA 4AFSC 4D8DA 1HD3A 2E5KA 4HVWA 1ABQA 2V1RA 1GL5A 4OMNA 3M0SA 1PWTA 2HSPA 4JJBA 1NEGA 2YSQA 4CC3A 1M8MA 1Z9QA 2KT8A 3NHNA 4RTWA 1W6XA 1GCPA 2J7IA 2O9VA 1HSQA 1CKBA 2ESWA 2RQRA 3H0FA 4JJCA 2JM8A 1JEGA 2O88A 4OMPA 1X69A 5IH2A 2F2WA 1AWWA 2AKLA 2H8HA 2CDTA 1VA7A 1UHFA 1IO6A 2RQVA 1H8KA 1OV3A 2KNBB 3VRYA 1SHGA 1M30A 1OOTA 2F2XA 5FWBA 4RTUA 1JXMA 3LH5A 2DA9A 3M0QA 1WLPB 2CT4A 1VYUA 1BK2A 1UDLA 1BU1A 4OMQA 4FSSA 3RNJA 4LE9A 1BBZA 2ABLA 2J05A 2EGEA 2DL5A 1JU5C 4J9GA 2RQTA 2CSIA 2CUBA 2DL3A 1U06A 1PHTA 1K0SA 1I1JA 2GBQA 2K6DA 5HCKA 2CT3A 2DYBA 2KYMA 2ROTA 2AZVA 1WX6A 2KRNA 3GBQA 2JW4A 1AWJA 1SEMA 4A63B 3NMZC 3TSWA 2FPFA 1WA7A 1K1ZA 2EVRA 2M0YA 3VS4A 4HVUA 1WXTA 3EG1A 1T0HA 4JPBW 2QDLA 2B86A 4E6RA 5GJWB 1X2QA 1E6GA 1GCQA 1I07A 1QWEA 1ZUUA 2DX1A 1QLYA 2MIOA 1UJYA 2FG0A 2O2OA 3EHQA 4Z8AA 3SEMA 1FMKA 5EC7A 4RTTA 3EHRA 3QWXX 1NYGA 4D8KA 3QWYA 1LCKA 5IXFA 1TUCA 2KRSA 3PVQA 2DVJA 1BB9A 3TSZA 4AFQC 1RLQC 1NLPC 2DNUA 4F14A 1WI7A 4GBQA 2KYBA 3U23A 1UUEA 2C0IA 4GLMA 1ARKA 2M51A 2ED0A 1AZGB 1ZX6A 2J6OA 1AD5A 2OI3A 5ECAA 1B3QA 4F16A 2JS2A 2KBTA 1YNZA 1NM7A 4F17A 1ZUYA 1RLPC 1TUDA 1X6BA 3VS5A 4CC7A 3IQLA 3KFVA 2C0TA 2FPEA 3PVLA 1CKAA 2MOXA 2DE0X 2DRKA 1T3SA 4Z89A 2NWMA 1K0XA 5I11A 3M0PA 2LMJA 1GFDA 1GCQC 2EYXA 3EG2A 2DBMA 1WYXA 2GTOA 1U5SA 2EPDA 1M3AA 1K76A 2GTJA 1WDXA 1UFFA 2A08A 2C0OA 2CH4W 3NPFA 1NG2A 1X6GA 3NGPA 2EYZA 2YT6A 1KSWA 1AEYA 3O5ZA 3REAB 1JXOA 1UHCA 2HBWA 1X43A 2AZSA 1HJDA 2GGRA 1SSHA 2DM1A 5I22A 2RN8A 2OAWA 2ECZA 1H92A 1GBRA 2EKHA 1WFWA 4LNPA 2LQNA 2BTTA 1OPKA 2PNIA 4OMMA 2DF6A 2YUQA 2LNHB 4EIKA 3RBBB 1AOJA 2EQIA 2K9GA 1I0CA 2EW3A 1PKTA 1KFZA 3ZL7C 2KGTA 1UE9A 2YUOA 4J9HA 1KIKA 2BZXA 1NLOC 2J6FA 2J6KA 2LP5A 2RF0A 3ULRB 4JZ3A 4RTZA 4ESRA 2G6FX 2VKNA 1AVZC 2D1XA 1VYTA 4M4ZA 2CUDA 1QWFA 1G83A 2EYYA 2EBPA 2L3QA 2RMOA 4HVVA 2D8JA 3C0CA 1ABOA 4HXJA 2XMFA 3VS6A 2FRWA 2JS0A 1JO8A 1KJWA 2JXBA 3VS0A 1PNJA 4CC4B 5IHKA 2JMCA 4X1VA 2IIMA 2JTEA 3VS3A 1PRMC 2KROA 4K11A 2CH4A 5IXBA 1XOVA 2EGAA 1QKXA 2HCKA 1GRIA 4JZ4A 2K3BA 2YUNA 4AFZC 5GJVB 2L3SA 1ZLMA 2D8HA 2YUPA 1MV0B 2LQWA 4J9BA 4Z88A 2FEIA 2JT4A 2EGCA 2DILA 1UGVA 2RPNA 1V1CA 5FWCA 3FJ5A 1E6HA 2K7AA 1ZUKA 1H3HA 3VS7A 4HCKA 2LZ6B 4J9FA 2LCSA 1YCSB 3H0HA 2HDAA 1TG0A 2RNAA 3EG0A 2YDLA 4RTVA 1YN8A 4JJDA 1QKWA 2DL8A 2O31A 1M3BA 1JQQA 1NYFA 1ZBJA 2DJQA 2VWFA 2DBKA 3UF4A 3UA6A 1AZEA 2DL4A 2DL7A 3SHWA 2D0NA 2KR3A 3VS1A 3H41A 4IIMA 2W10A 1A0NB 2NUZA 1YP5A 1T3LA 2LJ0A 1AWOA 1B07A 3I35A 3JV3A 4KRTA 2A37A 3R6NA 3VS2A 1WIEA 4WCIA 3I9QA 5L23A 2EYWA 2FO0A 2DLPA 4DEXA 1SRLA 4DEYA 1UECA 4ZNXA 1J3TA 2MCNA 4IIOA 2FRYA 2ROLA 1G2BA 3PE0A 1GFCA 1M3CA 2L3PA 4R0KA 1M27C 3TVTA 3THKA 2X3XD 4ORZA 2O9SA 4LUDA 4LN2A 4J9IA 4OMLA 1S1NA 3UATA 2ENMA 3H0IA 2FPDA 2CREA 2V1QA 2HEQA 1W70A 2L0AA 1SHFA 2J06A 2P4RA 2RQWA 2SEMA 4OMOA 4RTXA 2W0ZA 2AK5A 2KRMA 2DMOA 2LJ1A 2VVKA 3VRZA 1RUWA 3I5SA 2AKKA 2I0NA 4RTYA 1T0JA 1X2KA 1WXBA 2L2PA 1N5ZA 1Y57A 2BZ8A 2KEAA 5IHIA 3M0TA 2OJ2A 4Y92A 3M0UA 2GQIA 1OPLA 2SRCA 1K4US 3REBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRM A;  1MV3 A;  2F2V A;  3EG3 A;  2ED1 A;  2X3W D;  3UA7 A;  1UG1 A;  1X27 A;  2DRM A;  3CQT A;  1MUZ A;  4AG1 C;  4CC2 A;  4J9E A;  5FW9 A;  1NEB A;  3EGU A;  2KT1 A;  1WXU A;  4J9D A;  2LJ3 A;  1YWP A;  1OEB A;  1K9A A;  2BZY A;  2KE9 A;  3M0R A;  1PKS A;  2JM9 A;  2K79 A;  1VYV A;  2K2M A;  1QCF A;  2A28 A;  1UJ0 A;  4J9C A;  2JMA A;  1E7O A;  1PRL C;  2A36 A;  2GNC A;  2KXC A;  3I5R A;  1YWO A;  4AFU C;  1AWX A;  4AG2 C;  2KXD A;  2CSQ A;  2PTK A;  1SPK A;  3A98 A;  4QT7 A;  1CSK A;  1W1F A;  2PZ1 A;  1FYN A;  5IHN A;  1UTI A;  4RUG A;  1EFN A;  2LX7 A;  1GBQ A;  1RI9 A;  1Z9Z A;  1ZSG A;  1U3O A;  2RQU A;  4LUE A;  1Y0M A;  4AFS C;  4D8D A;  1HD3 A;  2E5K A;  4HVW A;  1ABQ A;  2V1R A;  1GL5 A;  4OMN A;  3M0S A;  1PWT A;  2HSP A;  4JJB A;  1NEG A;  2YSQ A;  4CC3 A;  1M8M A;  1Z9Q A;  2KT8 A;  3NHN A;  4RTW A;  1W6X A;  1GCP A;  2J7I A;  2O9V A;  1HSQ A;  1CKB A;  2ESW A;  2RQR A;  3H0F A;  4JJC A;  2JM8 A;  1JEG A;  2O88 A;  4OMP A;  1X69 A;  5IH2 A;  2F2W A;  1AWW A;  2AKL A;  2H8H A;  2CDT A;  1VA7 A;  1UHF A;  1IO6 A;  2RQV A;  1H8K A;  1OV3 A;  2KNB B;  3VRY A;  1SHG A;  1M30 A;  1OOT A;  2F2X A;  5FWB A;  4RTU A;  1JXM A;  3LH5 A;  2DA9 A;  3M0Q A;  1WLP B;  2CT4 A;  1VYU A;  1BK2 A;  1UDL A;  1BU1 A;  4OMQ A;  4FSS A;  3RNJ A;  4LE9 A;  1BBZ A;  2ABL A;  2J05 A;  2EGE A;  2DL5 A;  1JU5 C;  4J9G A;  2RQT A;  2CSI A;  2CUB A;  2DL3 A;  1U06 A;  1PHT A;  1K0S A;  1I1J A;  2GBQ A;  2K6D A;  5HCK A;  2CT3 A;  2DYB A;  2KYM A;  2ROT A;  2AZV A;  1WX6 A;  2KRN A;  3GBQ A;  2JW4 A;  1AWJ A;  1SEM A;  4A63 B;  3NMZ C;  3TSW A;  2FPF A;  1WA7 A;  1K1Z A;  2EVR A;  2M0Y A;  3VS4 A;  4HVU A;  1WXT A;  3EG1 A;  1T0H A;  4JPB W;  2QDL A;  2B86 A;  4E6R A;  5GJW B;  1X2Q A;  1E6G A;  1GCQ A;  1I07 A;  1QWE A;  1ZUU A;  2DX1 A;  1QLY A;  2MIO A;  1UJY A;  2FG0 A;  2O2O A;  3EHQ A;  4Z8A A;  3SEM A;  1FMK A;  5EC7 A;  4RTT A;  3EHR A;  3QWX X;  1NYG A;  4D8K A;  3QWY A;  1LCK A;  5IXF A;  1TUC A;  2KRS A;  3PVQ A;  2DVJ A;  1BB9 A;  3TSZ A;  4AFQ C;  1RLQ C;  1NLP C;  2DNU A;  4F14 A;  1WI7 A;  4GBQ A;  2KYB A;  3U23 A;  1UUE A;  2C0I A;  4GLM A;  1ARK A;  2M51 A;  2ED0 A;  1AZG B;  1ZX6 A;  2J6O A;  1AD5 A;  2OI3 A;  5ECA A;  1B3Q A;  4F16 A;  2JS2 A;  2KBT A;  1YNZ A;  1NM7 A;  4F17 A;  1ZUY A;  1RLP C;  1TUD A;  1X6B A;  3VS5 A;  4CC7 A;  3IQL A;  3KFV A;  2C0T A;  2FPE A;  3PVL A;  1CKA A;  2MOX A;  2DE0 X;  2DRK A;  1T3S A;  4Z89 A;  2NWM A;  1K0X A;  5I11 A;  3M0P A;  2LMJ A;  1GFD A;  1GCQ C;  2EYX A;  3EG2 A;  2DBM A;  1WYX A;  2GTO A;  1U5S A;  2EPD A;  1M3A A;  1K76 A;  2GTJ A;  1WDX A;  1UFF A;  2A08 A;  2C0O A;  2CH4 W;  3NPF A;  1NG2 A;  1X6G A;  3NGP A;  2EYZ A;  2YT6 A;  1KSW A;  1AEY A;  3O5Z A;  3REA B;  1JXO A;  1UHC A;  2HBW A;  1X43 A;  2AZS A;  1HJD A;  2GGR A;  1SSH A;  2DM1 A;  5I22 A;  2RN8 A;  2OAW A;  2ECZ A;  1H92 A;  1GBR A;  2EKH A;  1WFW A;  4LNP A;  2LQN A;  2BTT A;  1OPK A;  2PNI A;  4OMM A;  2DF6 A;  2YUQ A;  2LNH B;  4EIK A;  3RBB B;  1AOJ A;  2EQI A;  2K9G A;  1I0C A;  2EW3 A;  1PKT A;  1KFZ A;  3ZL7 C;  2KGT A;  1UE9 A;  2YUO A;  4J9H A;  1KIK A;  2BZX A;  1NLO C;  2J6F A;  2J6K A;  2LP5 A;  2RF0 A;  3ULR B;  4JZ3 A;  4RTZ A;  4ESR A;  2G6F X;  2VKN A;  1AVZ C;  2D1X A;  1VYT A;  4M4Z A;  2CUD A;  1QWF A;  1G83 A;  2EYY A;  2EBP A;  2L3Q A;  2RMO A;  4HVV A;  2D8J A;  3C0C A;  1ABO A;  4HXJ A;  2XMF A;  3VS6 A;  2FRW A;  2JS0 A;  1JO8 A;  1KJW A;  2JXB A;  3VS0 A;  1PNJ A;  4CC4 B;  5IHK A;  2JMC A;  4X1V A;  2IIM A;  2JTE A;  3VS3 A;  1PRM C;  2KRO A;  4K11 A;  2CH4 A;  5IXB A;  1XOV A;  2EGA A;  1QKX A;  2HCK A;  1GRI A;  4JZ4 A;  2K3B A;  2YUN A;  4AFZ C;  5GJV B;  2L3S A;  1ZLM A;  2D8H A;  2YUP A;  1MV0 B;  2LQW A;  4J9B A;  4Z88 A;  2FEI A;  2JT4 A;  2EGC A;  2DIL A;  1UGV A;  2RPN A;  1V1C A;  5FWC A;  3FJ5 A;  1E6H A;  2K7A A;  1ZUK A;  1H3H A;  3VS7 A;  4HCK A;  2LZ6 B;  4J9F A;  2LCS A;  1YCS B;  3H0H A;  2HDA A;  1TG0 A;  2RNA A;  3EG0 A;  2YDL A;  4RTV A;  1YN8 A;  4JJD A;  1QKW A;  2DL8 A;  2O31 A;  1M3B A;  1JQQ A;  1NYF A;  1ZBJ A;  2DJQ A;  2VWF A;  2DBK A;  3UF4 A;  3UA6 A;  1AZE A;  2DL4 A;  2DL7 A;  3SHW A;  2D0N A;  2KR3 A;  3VS1 A;  3H41 A;  4IIM A;  2W10 A;  1A0N B;  2NUZ A;  1YP5 A;  1T3L A;  2LJ0 A;  1AWO A;  1B07 A;  3I35 A;  3JV3 A;  4KRT A;  2A37 A;  3R6N A;  3VS2 A;  1WIE A;  4WCI A;  3I9Q A;  5L23 A;  2EYW A;  2FO0 A;  2DLP A;  4DEX A;  1SRL A;  4DEY A;  1UEC A;  4ZNX A;  1J3T A;  2MCN A;  4IIO A;  2FRY A;  2ROL A;  1G2B A;  3PE0 A;  1GFC A;  1M3C A;  2L3P A;  4R0K A;  1M27 C;  3TVT A;  3THK A;  2X3X D;  4ORZ A;  2O9S A;  4LUD A;  4LN2 A;  4J9I A;  4OML A;  1S1N A;  3UAT A;  2ENM A;  3H0I A;  2FPD A;  2CRE A;  2V1Q A;  2HEQ A;  1W70 A;  2L0A A;  1SHF A;  2J06 A;  2P4R A;  2RQW A;  2SEM A;  4OMO A;  4RTX A;  2W0Z A;  2AK5 A;  2KRM A;  2DMO A;  2LJ1 A;  2VVK A;  3VRZ A;  1RUW A;  3I5S A;  2AKK A;  2I0N A;  4RTY A;  1T0J A;  1X2K A;  1WXB A;  2L2P A;  1N5Z A;  1Y57 A;  2BZ8 A;  2KEA A;  5IHI A;  3M0T A;  2OJ2 A;  4Y92 A;  3M0U A;  2GQI A;  1OPL A;  2SRC A;  1K4U S;  3REB B; 
#chains in the Genus database with same CATH topology
 1SRM A;  2F2V A;  1WQW A;  1G3T A;  3EG3 A;  2FL7 A;  2JJ9 A;  2X3W D;  1UG1 A;  1VQ8 A;  4AG1 C;  4M7D G;  2OTL A;  4J9E A;  3EGU A;  4M77 A;  4J9D A;  1WZO A;  3CC4 Q;  4DBF A;  3CCS T;  2KE9 A;  2JM9 A;  2K79 A;  3EG9 A;  2K2M A;  2A28 A;  3I56 T;  3OYA A;  5CK9 A;  4F7U A;  3RMQ A;  2A36 A;  2KXC A;  4NL2 A;  5LJ5 f;  5A0D A;  2O01 E;  1JBM A;  3CC4 A;  3A98 A;  4XTW A;  2PZ1 A;  5LJ3 j;  1QVG S;  1RI9 A;  5LJ3 d;  1Z9Z A;  1ZSG A;  1YJ9 T;  2RQU A;  4LUE A;  1UGS B;  2DTI A;  4M7D F;  3L42 A;  4OMN A;  4HT9 A;  3M0S A;  1Q81 R;  1SKU B;  2R58 A;  1RAF B;  3C95 A;  3LGF A;  1K73 U;  1NEG A;  4ELY C;  2RJC A;  1UGQ B;  4IUU A;  2KT8 A;  3NHN A;  1RAA B;  1FXX A;  5GAN e;  1GCP A;  2DXT A;  2J7I A;  1VQ9 A;  2O9V A;  4FCY A;  1UGR B;  2ESW A;  2RQR A;  1W2B A;  2H8H A;  5AYF A;  3LWH A;  1KG1 A;  1VA7 A;  4C0G A;  1YHQ T;  4B6M A;  1H8K A;  1OOT A;  4HA8 A;  3A8M B;  1QVF A;  1VIF A;  2XU8 A;  4QKU A;  1JXM A;  3MKD A;  2RO0 A;  5CAI A;  1S72 Q;  4M78 B;  1N8R C;  4M78 E;  4FYW B;  2WSF E;  1MMD A;  3VU3 C;  4EMH A;  1BK2 A;  3URG A;  1UDL A;  3M53 A;  4MDW A;  3CD6 Q;  4OMQ A;  2KVQ G;  5GAN 6;  1BBZ A;  2ABL A;  5DM7 R;  2DL5 A;  3RKX A;  2RQT A;  3SWN B;  2GF7 A;  2QEX A;  3ZEH A;  3HKS A;  1U06 A;  3NTH A;  2GBQ A;  2K6D A;  5M9O A;  4JRP A;  1WJQ A;  4E7Z A;  4ZGJ B;  1VQ7 Q;  1SEM A;  3TSW A;  1YI2 A;  5A2Q E;  3TU4 K;  5GAO n;  3CCM T;  4M7A A;  2IVW A;  1OU8 A;  2G3R A;  1RAI B;  1I81 A;  2GFA A;  2QG9 B;  1LNX A;  1LPL A;  3V8J A;  1D3B A;  3A5Z B;  1T0H A;  3FJP A;  2QDL A;  1ZSZ C;  2E64 A;  4FYY B;  3CMA T;  1I07 A;  3VUB A;  2V8I A;  2JTM A;  1Q82 U;  3EHQ A;  1ZHI A;  3TEE A;  4Z8A A;  3SEM A;  1FMK A;  2D0Q B;  4V2S A;  4B9W A;  4PJO F;  9ATC B;  5KCO A;  3EHR A;  5IXF A;  4PNO A;  2ZCF B;  3M58 A;  4HKE A;  1VQ4 A;  4J83 A;  3G1J A;  3QHS A;  4E7J A;  3MPU B;  1SG5 A;  2C0I A;  1VQ6 T;  3M54 A;  4GLK A;  2M51 A;  3RR6 A;  2VV5 A;  1YHQ A;  1AZG B;  1ZX6 A;  4XU1 A;  1AD5 A;  3MP6 A;  2Y4X A;  5ECA A;  2DPP B;  2MAM A;  3Q1J A;  1ZUY A;  2LDM A;  3FDR A;  1JJ2 A;  1EX4 A;  3DB3 A;  4EPC A;  3OYC A;  1CKA A;  2MOX A;  1VQL Q;  1UB4 A;  2NWM A;  2DEQ A;  2LMJ A;  2PUK B;  4IUQ A;  2DBM A;  1WYX A;  2GTO A;  1VQ8 Q;  3T9N A;  2MPX C;  1QVP A;  4BB7 A;  1G3Y A;  1VQO T;  4BE1 A;  1R0C B;  3CC4 T;  1KSW A;  1AEY A;  1RAG B;  2O4X A;  3REA B;  3G4S Q;  1Y71 A;  2PVD B;  2A0F B;  1ACM B;  1SSH A;  3QXE B;  3FEO A;  3JCM P;  3ER0 A;  4PJL A;  2MWO A;  1PD1 A;  1VQ7 A;  1W2B S;  3CCL A;  2NUP A;  5GAN f;  3C94 A;  2DF6 A;  2YUQ A;  4F7U G;  2L3R A;  2QEX Q;  3L2R A;  3CCU Q;  1W2B P;  3CCM Q;  2K9G A;  5CKF A;  1D0Z A;  4M77 G;  3QJY A;  3PMT A;  1UE9 A;  1YJ9 Q;  1OI1 A;  1KIK A;  2BZX A;  4AMC A;  2PVG B;  1NLO C;  2J6F A;  2J6K A;  2LP5 A;  4YTL A;  3JCM g;  3R6O A;  3ULR B;  1QCN A;  1X6O A;  3M59 A;  5LJ5 d;  3M57 A;  4M4Z A;  1QP2 A;  3CEY A;  4DBH A;  4N4I A;  2M02 A;  2EBP A;  1YIT T;  4IUR A;  2F5T X;  5A0L A;  1KQS P;  4A4F A;  4HVV A;  4BUG A;  3C0C A;  4HXJ A;  2JTF A;  3PFS A;  5KYW A;  1JO8 A;  4M77 F;  4CC4 B;  2DIQ A;  5IHK A;  4X1V A;  3CCR T;  4A4E A;  2KRO A;  2HCK A;  3X26 B;  1GRI A;  3VYG A;  2HNI A;  2QAS A;  5GJV B;  3CC2 Q;  2IPO B;  4QW2 A;  1WHG A;  2YUP A;  3CC7 T;  4J9B A;  2JT4 A;  1RAH B;  2E3H A;  2QTX A;  1UGV A;  5CR2 A;  3JCM J;  2K7A A;  3HP9 A;  1ZUK A;  4OB3 B;  4C92 C;  2HDA A;  3M5A A;  1KK7 A;  4M7A E;  5LJ5 g;  1YN8 A;  4JJD A;  3G6E A;  1IB8 A;  4C92 D;  2DL8 A;  1MMN A;  1M3B A;  1JQQ A;  1NYF A;  3MP8 A;  2V26 A;  1QVF P;  2E41 A;  1NPP A;  2VWF A;  5CCA A;  3UPU A;  3UF4 A;  3UWN A;  4TVR A;  3F70 A;  2GQV A;  2OTL Q;  4RCB A;  2DL7 A;  2RHZ A;  3SHW A;  4M7A G;  4ZTF A;  3H41 A;  4IIM A;  2W10 A;  3CCV T;  1YP5 A;  2LJ0 A;  1AWO A;  4D6W A;  2B8A A;  1OZ3 A;  2RHY A;  3I9Q A;  2K5I A;  4C5G A;  2EYW A;  1D0Y A;  2FO0 A;  3G7Z A;  2QEX T;  2VB6 A;  1KHI A;  1WHJ A;  1SRL A;  4DEY A;  2X4J A;  5GMK i;  3HSB A;  2VAS A;  3I55 Q;  3L2V A;  4C92 G;  2FHD A;  2VXF A;  3LYI A;  2DAQ A;  5GAN h;  2M0O A;  4R0K A;  3CME A;  1M27 C;  2X3X D;  1VQM A;  3N5B B;  4JRI A;  2O9S A;  4LN2 A;  4J9I A;  2XKO C;  4C0Z A;  2ENM A;  3H0I A;  1OZ2 A;  4XU2 A;  4JJN K;  1KQ1 A;  2D6F A;  1NE8 A;  1PSF A;  2W0Z A;  1M1K R;  4M77 B;  2VVK A;  3OYM A;  2QAZ A;  3PT9 A;  1Y96 B;  2LTO A;  3FC3 A;  2CZ1 B;  2RJE A;  1T0J A;  4XTX A;  1WXB A;  1VQP Q;  1Y57 A;  3NFC A;  3PNW C;  3CBP A;  1MGQ A;  4Y92 A;  5D6Y A;  5FU7 C;  3A8H B;  1TTH B;  4OF1 A;  3OYI A;  1OYX A;  3OYN A;  3S3M A;  1IGQ A;  1YCY A;  1HYO A;  5CO7 A;  3OQ5 A;  3QZ5 B;  1X27 A;  3CQT A;  2E6N A;  3QDR B;  5FW9 A;  1NEB A;  1WXU A;  2XDB A;  2DIG A;  2HZY A;  2LJ3 A;  2KQW A;  3I56 A;  2RH2 A;  3NTI A;  1OEB A;  3SWN C;  2JVV A;  3M0R A;  3KUF A;  2VUB A;  5I2S A;  3A8O B;  4ZTJ A;  3LW5 E;  2GNC A;  3I5R A;  5GAM d;  3EFO B;  2LX9 A;  4AFU C;  1AWX A;  3CCJ A;  5GAN 4;  4EMK B;  3UDC A;  1K73 R;  1VQ4 T;  2KXD A;  3EFS A;  4F04 B;  2FZG B;  1DJ7 B;  1SPK A;  2PTK A;  1U8R A;  1HK9 A;  1CSK A;  1W1F A;  2X9H A;  5KYW B;  3OS2 A;  1Y0M A;  4AFS C;  1JRI A;  1QVG A;  4D8D A;  1HD3 A;  2HQX A;  4HVW A;  1ABQ A;  1GXI E;  2KY9 A;  1PWT A;  4ZN1 A;  4RMO A;  3P8D A;  2QGG A;  5J3B A;  1M8M A;  1VQM T;  1RAE B;  2VYT A;  4RTW A;  3AHU A;  2FZK B;  3CMA A;  4Z02 A;  3OYD A;  1HSQ A;  1CKB A;  3H0F A;  4JJC A;  2JM8 A;  2O88 A;  1X69 A;  2VXE A;  3CC7 Q;  2DO3 A;  4M78 C;  4A4K A;  4IKF A;  4C8Q G;  2F2X A;  4KUL A;  2RA2 A;  2YWW A;  2K57 A;  2YHT A;  2DD5 A;  3OSV A;  1YJN Q;  2XIC A;  1VYU A;  1M90 C;  4KGV B;  3HRS A;  2M16 A;  4GY5 A;  5FU6 C;  4FT4 A;  4LE9 A;  3CCJ Q;  1YIJ T;  2J05 A;  5I2M A;  3CCQ T;  1JU5 C;  1M2V A;  1BKB A;  1Q7Y R;  4EDU A;  3SDZ A;  1XTD A;  1KD1 U;  1WX6 A;  4OB2 B;  3GBQ A;  2CYZ B;  2E65 A;  2HBP A;  2NUT B;  3I56 Q;  4LDX A;  2EQU A;  2FPF A;  2K2V A;  1WA7 A;  1K1Z A;  2M0Y A;  1WXT A;  3EG1 A;  2EKO A;  3JB9 I;  4E6R A;  1BCO A;  4LDY A;  3DLL A;  1QWE A;  1ZUU A;  5CQX A;  3V7S A;  1C1A A;  2DX1 A;  1QLY A;  3JB9 G;  5GAN 2;  2A7Y A;  4LD6 A;  2DJZ A;  4WF2 A;  2ZPB B;  1Q82 R;  1LCK A;  1TUC A;  3CCR A;  4DA4 A;  1BB9 A;  2P84 A;  1TSF A;  4OMF B;  3CXC P;  4BD3 A;  4QQD A;  1NLP C;  2DNU A;  4F14 A;  1WI7 A;  1NJI C;  3QYH B;  3G6E T;  3U23 A;  3QYG B;  2J6O A;  1KD1 C;  1K8A R;  4N4H A;  1VQM Q;  2OI3 A;  2LC4 A;  3AT1 B;  3BW1 A;  4IUV A;  5LL6 S;  4F17 A;  4R56 A;  1RLP C;  2CP3 A;  4AT1 B;  3CC7 A;  2VGN A;  2DZC A;  2IG0 A;  2C0T A;  1M8V A;  2QQA A;  3SFM A;  3PVL A;  2CS7 A;  5IAY A;  4KH1 B;  4XTU A;  4O5V A;  4M7D B;  2CZ0 B;  3MO8 A;  4XTZ A;  3OS0 A;  1GFD A;  2WSE E;  2DFU A;  2EYX A;  2NUP B;  2KMT A;  3EG2 A;  2X4W A;  3OB9 A;  5EG2 A;  2L5Q A;  4C0D B;  2BIV A;  2EPD A;  1M3A A;  5DY9 A;  2A08 A;  2WSC E;  1N6A A;  3VJP A;  3NGP A;  4XTV A;  2EYZ A;  2YT6 A;  4F7U E;  1UHC A;  1YIJ Q;  2AZS A;  2DK3 A;  3CCQ Q;  4M7D E;  1M9S A;  4RKU E;  3CME T;  1VQ5 A;  4E7H A;  2RN8 A;  3RES A;  1VQO A;  4B9X A;  1M1G A;  3MEW A;  2OAW A;  3CMA Q;  2ECZ A;  1H92 A;  2EKH A;  1WFW A;  4LNP A;  4E2F B;  5KYX B;  2LQN A;  3OW2 P;  4OB1 B;  4OMM A;  3HHT B;  4EIK A;  1AOJ A;  2JZ2 A;  2ZGW A;  3E2U A;  1Q81 U;  1KFZ A;  5A0G A;  3OYF A;  5CQY A;  2BE9 B;  1FMW A;  2YUO A;  2V8K A;  4J9H A;  2RF0 A;  1K73 C;  5FU6 B;  4J6X A;  2HKQ B;  3RKW A;  1KD1 R;  3HFO A;  3CCV A;  2LCC A;  4ESR A;  3QKJ A;  2VKN A;  2D1X A;  1D0X A;  1VYT A;  3CC2 A;  2BKD N;  2X51 A;  1N8R R;  3CCE Q;  5KYU A;  2YRC A;  2RMO A;  1PD0 A;  2MK5 A;  4M78 A;  1XQH A;  1KJW A;  3VS0 A;  1PNJ A;  2F5K A;  2E5Q A;  3RMS A;  3QSU A;  3VS3 A;  1PRM C;  5D6W A;  2DD4 A;  4C92 E;  3EFR A;  2CH4 A;  5KYN A;  1N8R U;  2EGA A;  2DVE A;  1VQL T;  2YUN A;  3OYL A;  4AFZ C;  1LOJ A;  2JUF A;  2PVO B;  2D9T A;  1ZSZ B;  1ZLM A;  4PLI A;  2QDY B;  1VQK T;  1TWB A;  2LQW A;  2F1L A;  2RI5 A;  1OQK A;  4Z88 A;  2HD0 A;  2FEI A;  1VQP A;  2DIL A;  3OS1 A;  2HL3 A;  4M7D D;  1V1C A;  2DTH A;  4ZGE B;  1VUB A;  4M7A D;  1H3H A;  4E7L A;  2K4Y A;  2YRD A;  2COZ A;  2LZ6 B;  1KC8 U;  1R0B G;  1UGP B;  3H0H A;  5CKD A;  4M7A C;  1BYM A;  5KE3 A;  2YDL A;  2H3J A;  5GAN 3;  1IRE B;  3OYY A;  5C6S A;  1QKW A;  2EJ9 A;  5HY6 A;  1B34 B;  2AHJ B;  3X24 B;  2EJG A;  1M1F A;  3QBY A;  4J5Y A;  2DJQ A;  2LRQ A;  2HAX A;  3UA6 A;  1AZE A;  2YXY A;  3KBG A;  4X9D A;  3CME Q;  1JJ2 S;  4C8Q C;  2NUZ A;  1Q81 C;  1T3L A;  3JCM W;  3NTK A;  4KRT A;  3R6N A;  3VS2 A;  4M75 C;  4M75 F;  5D7U A;  2OAU A;  2YLB A;  3I55 A;  5GAM j;  1JJ2 P;  5KCH A;  2DZ9 A;  2Y4Y A;  3OBW A;  5LJ5 h;  2QA4 T;  4BY6 C;  5HK3 A;  1VOM A;  4MML A;  2R5A A;  3EGD A;  3OYB A;  5KYX A;  1P92 A;  1YI2 T;  4JUV A;  2KAF A;  4NOY A;  1M3C A;  3QO3 A;  2QQS A;  3JCM d;  4ORZ A;  2LQK A;  1KC8 C;  1FX7 A;  5GMK m;  1Y07 A;  3SB2 A;  2XDD A;  2EFI A;  1D1C A;  2V1Q A;  2FVU A;  2HEQ A;  1WQ7 A;  4OB0 B;  2E1H A;  4IUP A;  1SHF A;  4DOV A;  1H3Z A;  2QGF B;  3VV0 A;  4PJN A;  2LJ1 A;  2X4Y A;  3VRZ A;  1RUW A;  3OMC A;  2JNG A;  3M55 A;  1B7T A;  2I0N A;  4RTY A;  1G3S A;  2E10 A;  4PJO D;  4M78 F;  1BIB A;  2KEA A;  1YJW A;  4M75 A;  1IZ6 A;  1JB0 E;  2OJ2 A;  2P0Q A;  3DKM A;  3M0U A;  2GQI A;  3QUI A;  2RD1 A;  2M1H A;  1IGU A;  4FW1 A;  4KUI A;  3QDF A;  1MUZ A;  5GAN 8;  5DLQ E;  1KQS A;  4BI8 B;  2KT1 A;  3H6Z A;  3UT1 A;  2BZY A;  1PKS A;  3LWI A;  1YJ9 A;  1I8F A;  1VYV A;  4Y28 E;  3GOX A;  1OX8 A;  1QCF A;  1UJ0 A;  5GAO m;  4J9C A;  2JMA A;  1PRL C;  4IUT A;  5LJ3 e;  4M75 E;  3JCM c;  6AT1 B;  4JLG A;  2MWP A;  3ZFJ A;  2Z0W A;  2XHC A;  4QT7 A;  1QQJ A;  5IHN A;  3BDL A;  3RUX A;  1EFN A;  2LX7 A;  5GAO p;  3PTA A;  4HT8 A;  3G4S A;  2P0K A;  4FM4 B;  3QPH A;  4FU6 A;  2P4T A;  3CBM A;  3MET A;  3A1P A;  2YSQ A;  3JAM E;  4CC3 A;  3L1A A;  1Z9Q A;  1NBE B;  1N9S A;  1W6X A;  1VQL A;  2DYI A;  2CZ6 B;  5J39 A;  1JEG A;  4OMP A;  1PC0 A;  5IH2 A;  1AHJ B;  1N27 A;  2CDT A;  2ZPE B;  3E19 A;  3JCM V;  1UHF A;  1IO6 A;  4M77 C;  2CZ7 B;  2KNB B;  3OS5 A;  4C8Q F;  1SHG A;  1O9S A;  3EGD B;  1M30 A;  5GAN d;  2KI7 A;  5FWB A;  5GMK h;  2RHX A;  1D3B B;  2EQJ A;  3MJX A;  3LH5 A;  2DA9 A;  1WLP B;  4MZT A;  3C12 A;  3OYE A;  2EWN A;  4JDS A;  3RNJ A;  3VUZ A;  1V29 B;  1ZA1 B;  1H64 1;  8ATC B;  1S72 T;  2COW A;  1NJI U;  4J9G A;  1WHK A;  1KQ2 A;  4XU3 A;  2DL3 A;  1PHT A;  5HCK A;  2CT3 A;  3OYH A;  2KYM A;  2HMA A;  4PJO G;  3P8B B;  3BY7 A;  5AT1 B;  2E70 A;  3QZ9 B;  4QVZ A;  4A63 B;  2EVR A;  2QQR A;  3MCA B;  3VS4 A;  2O4X B;  4R55 A;  1M90 R;  2B86 A;  1VQ4 Q;  3FLG A;  2K3X A;  5GJW B;  3KXT A;  4E7S A;  1E6G A;  1GCQ A;  2QA4 Q;  4FYV B;  4HCZ A;  2MIO A;  1WGS A;  4M75 G;  2ZZD A;  1YI2 Q;  4C8Q A;  1WPY A;  4E7K A;  2YLC A;  1UEB A;  4RTT A;  3QWX X;  1NYG A;  4EMK A;  2DKG A;  3QWY A;  1M4Z A;  2DVJ A;  3CCS A;  3TSZ A;  5GMK l;  1VQ6 Q;  1BI2 A;  2KSS A;  4AFQ C;  1M1K U;  1RL2 A;  1ZQ1 A;  4GBQ A;  1ZA2 B;  2MF2 A;  2KK4 A;  4XAX B;  1UUE A;  3MEA A;  3LX7 A;  3OSS C;  2NYS A;  2R57 A;  1X01 A;  4GLM A;  2RHU A;  1ARK A;  2ED0 A;  5KH6 A;  1I5O B;  5GAM f;  1BI1 A;  4PJJ A;  2FYK A;  4NS5 A;  2E3I A;  3MEV A;  2KBT A;  1RAC B;  3J80 E;  1NM7 A;  2K5L A;  3OW2 A;  4A4H A;  1TUD A;  3IQL A;  1BI3 A;  5GAO r;  2FPE A;  3QG1 A;  1O75 A;  5LJ3 f;  2RK2 A;  1U1S A;  3CCL Q;  3CD6 A;  2DRK A;  1VQ9 Q;  1T3S A;  4Z89 A;  1K0X A;  2L8D A;  2ATC B;  2VC8 A;  2Y90 A;  2XG8 D;  4PJM A;  4XU0 A;  3OA6 A;  4DBQ A;  3G4S T;  5KYY A;  3LH0 A;  3H8Z A;  2QA4 A;  1RAB B;  3CPW A;  2XID A;  1U5S A;  2GTJ A;  1K76 A;  1WDX A;  2CH4 W;  4RG8 A;  1Y96 A;  1OUL A;  2RJF A;  2HBW A;  3P8H A;  1X43 A;  2PUO B;  3GF5 A;  4ELZ C;  4BDZ A;  4A4G A;  2M9U A;  2BTT A;  1OPK A;  4PK4 A;  2LNH B;  3RBB B;  4MDX A;  5KYU B;  1I0C A;  4MZM A;  2EW3 A;  1MHN A;  4ME7 A;  3JCM b;  2XD0 A;  3M9Q A;  3CCU T;  2JOY A;  4JZ3 A;  1VQ5 Q;  4RTZ A;  3OYJ A;  3EG9 B;  2CP7 A;  2G6F X;  4C5I A;  3X28 B;  2DXB A;  2HL5 C;  2NLU A;  3EAE A;  2ZPF B;  3WVE B;  1QWF A;  2QXF A;  2X35 A;  2KDS A;  2EYY A;  4FT2 A;  4JLI A;  1OU9 A;  1ABO A;  2E6Z A;  5FRN A;  2XMF A;  4OVA A;  2DEU A;  2FRW A;  1LVK A;  1Q7Y C;  4M78 G;  2QK0 A;  3PMI A;  4LDW A;  1WHM A;  4KBM B;  1U1T A;  2EJF A;  4K11 A;  3FRN A;  5GAO q;  4L6V 5;  2K3B A;  3GP8 A;  4LXC A;  2CP2 A;  1QVG P;  4HCB A;  2EYQ A;  2RB6 A;  2L3S A;  3WXM B;  5I21 A;  4OP0 A;  1QW1 A;  2LT4 A;  5FWC A;  1IXD A;  1YJW T;  2CKK A;  3CCL T;  3OMG A;  4J9F A;  1VQ9 T;  1IRX A;  1TG0 A;  2LCL A;  2RNA A;  3EG0 A;  1TS9 A;  4RTV A;  5GAM g;  2OTL T;  3V8L A;  2O31 A;  1ZBJ A;  5KYY B;  4PJO B;  2DBK A;  2QI2 A;  3CPF A;  1X75 C;  2BE7 D;  4J7F A;  2YRV A;  3VS1 A;  1M2V B;  5LJ3 g;  4C92 B;  4M77 E;  3BFM A;  5GAN 7;  3CCS Q;  1B07 A;  3JV3 A;  2A37 A;  3BDU A;  3CPW S;  2ZPG B;  4ZN3 A;  1K8A C;  1K9M C;  3ME9 A;  4KT0 E;  4WCI A;  5L23 A;  8AT1 B;  3MEU A;  4UC4 A;  3CXC S;  2DLP A;  3INZ A;  4DEX A;  1UEC A;  2EQK A;  4PL6 A;  3OW2 S;  3JCM X;  1J3T A;  1WNL A;  2QQB A;  2MCN A;  2QQ9 A;  4XQ3 A;  1G2B A;  3PE0 A;  2MYS A;  3CCE A;  2LT1 A;  3OYK A;  4PJO C;  2K5F A;  5CKH A;  3JB9 H;  4VUB A;  4LUD A;  2JN0 A;  1LJO A;  1S1N A;  3UAT A;  1C6V X;  4M7A F;  1MMA A;  3OY9 A;  2FPD A;  5IN1 A;  3TQ7 P;  1W70 A;  2RK1 A;  2RQW A;  2SEM A;  4OMO A;  5FU7 B;  2AK5 A;  4Q5W A;  3GNF B;  2KRM A;  1QVF S;  2I2L A;  5DLO A;  1TXQ A;  1WJR A;  1Y7X A;  2CP6 A;  7AT1 B;  1N5Z A;  4XK8 E;  3GIB A;  3M0T A;  3TCJ A;  3CCQ A;  1OPL A;  1YIJ A;  1K4U S;  4M7D C;  2HQE A;  3JCM h;  1MV3 A;  4BE2 A;  5FLX E;  2ED1 A;  4M7A B;  1KQS S;  3UA7 A;  1VQK A;  2DRM A;  2RI2 A;  4CC2 A;  1QMC A;  1C0M A;  3S3O A;  5FRM A;  4P5N A;  5GMK e;  1YWP A;  2CP0 A;  2DET A;  1K9A A;  1KHC A;  3G71 A;  4QQ6 A;  3HPW A;  4L59 A;  1K8A U;  2AIR B;  1N9R A;  1E7O A;  4FL6 A;  3L2Q A;  3GLX A;  1VQ5 T;  1NJI R;  4MMK A;  1YWO A;  4AG2 C;  1IHW A;  2LVM A;  5CVI A;  4ATO A;  4X9C A;  2CSQ A;  2QTV A;  1FYN A;  1UTI A;  2E12 A;  4RUG A;  1GBQ A;  5GAM e;  1NPR A;  2COY A;  1U3O A;  4PJO E;  2CGH A;  2E5K A;  2V1R A;  1GL5 A;  3C4S A;  2HSP A;  5KE2 A;  3RKY A;  4JJB A;  4ANJ A;  1PM3 A;  4X34 A;  3EFO A;  3HTR A;  5J26 A;  2R5M A;  1ZSZ A;  3V7R A;  4KUD K;  3DB4 A;  3LGL A;  3HFN A;  3HRT A;  5GAN 5;  3D7S B;  1ZBX A;  4QVC A;  1MND A;  5CKE A;  2VGM A;  1AWW A;  1WHH A;  2F2W A;  2AKL A;  4J6W A;  1VQN A;  2C06 A;  5L8R E;  2RQV A;  3L2Z A;  1OV3 A;  3VRY A;  3SD4 A;  3SWN A;  5D6X A;  3PIP A;  4RTU A;  1YJW Q;  3M0Q A;  2CP5 A;  4C92 A;  2CT4 A;  1XJW B;  3CBO A;  1BU1 A;  4FSS A;  2OTJ A;  3X25 B;  2EGE A;  3V7C A;  1YJN T;  4RG2 A;  1W4S A;  1F1B B;  2CSI A;  2X4X A;  3S6W A;  2CUB A;  4OGE A;  4A53 A;  1K0S A;  3CCJ T;  1I1J A;  1R8O B;  2EIF A;  4M77 D;  2DYB A;  1VQ8 T;  2ROT A;  1Q95 G;  2AZV A;  4JS4 A;  2KRN A;  1G8X A;  2JW4 A;  2RM4 A;  1AWJ A;  3GPL A;  3NMZ C;  1VQO Q;  4C0F A;  1OX9 A;  1YJN A;  4HVU A;  2BUD A;  1K9M U;  2GCX A;  2OTJ T;  4FSX A;  4JPB W;  4BE0 A;  2MMP A;  1D1B A;  3E9F A;  5GAN j;  1X2Q A;  2K3Y A;  3E9G A;  4CI0 C;  1M5Q 1;  4PFZ A;  3O8V A;  1UJY A;  1B34 A;  3H9N A;  2FG0 A;  2O2O A;  5HKC A;  1V76 A;  4MZP A;  3TRE A;  3FIF A;  2H3E B;  4E7I A;  5EC7 A;  4C5E A;  4M78 D;  4BI3 A;  4EMG A;  4D8K A;  3G6E Q;  4C92 F;  2KRS A;  3PVQ A;  4O6J A;  3X20 B;  4DQ2 A;  4F7U B;  3CPW P;  2AT1 B;  1RLQ C;  3HL8 A;  4FIB A;  2KYB A;  5HK0 A;  4C8Q B;  4PLL A;  3J7A F;  3MP1 A;  4N0A A;  1YIT Q;  1RAD B;  1RI0 A;  5FRO A;  4CRI A;  1B3Q A;  2RI3 A;  4F16 A;  1QCO A;  2JS2 A;  1WJS A;  2XI9 A;  1YNZ A;  2HKN A;  1X6B A;  4QQG A;  3VS5 A;  3L2W A;  4CC7 A;  3CCR Q;  3JB9 F;  3KFV A;  1Q86 U;  3JRZ A;  2L89 A;  1I5L A;  1EZZ B;  4J7I A;  2DE0 X;  3LLR A;  2RJD A;  5I11 A;  3RDV A;  2XK0 A;  3CC2 T;  3M0P A;  2HQH A;  1GCQ C;  2A3L A;  1PG5 B;  4LDU A;  3E1S A;  1AT1 B;  3FB9 A;  2C0O A;  1UFF A;  1IHV A;  3NPF A;  1NG2 A;  1X6G A;  3RIR A;  4KGZ B;  3O5Z A;  2EQM A;  3GNG A;  1VQN Q;  1JXO A;  1YFN A;  1Q7Y U;  5CKB A;  1HJD A;  2GGR A;  2F69 A;  2DM1 A;  4M7D A;  5I22 A;  2LQ8 A;  2MI6 A;  4XTY A;  1GBR A;  3HRU A;  1MNE A;  5GAO l;  1K9M R;  2PNI A;  3PIO A;  2DXU A;  3CCM A;  3CCU A;  2EQI A;  1G3W A;  4N0A C;  2NUT A;  2HSE B;  1PKT A;  1KC8 R;  4LDV A;  3ZL7 C;  2KGT A;  3G71 Q;  3JB9 J;  3EH1 A;  4C8Q E;  5C0M A;  3JCM Q;  3CCV Q;  1YIT A;  1BIA A;  4DOW A;  5GAN g;  1Q86 C;  3EH2 A;  3WVD B;  2DXC A;  1PSE A;  1AVZ C;  3M4G A;  3EGX A;  4KH0 B;  2CUD A;  4JRK A;  1HXD A;  1G83 A;  2FB7 A;  3I55 T;  2L3Q A;  4A54 A;  2D8J A;  3VS6 A;  3JB9 D;  3CCE T;  4PKC C;  3M56 A;  1YBY A;  3ASK A;  2JS0 A;  4BAC A;  1BI0 A;  2JXB A;  4J6Y A;  4E47 A;  4KGX B;  2JMC A;  2IIM A;  2JTE A;  4C5H A;  1PCX A;  5IXB A;  1XOV A;  1QKX A;  4BDY A;  1VQK Q;  3MHX A;  3VKI A;  4JZ4 A;  4WTO B;  1WHL A;  4NL3 A;  4QVD A;  3QII A;  4PFO A;  1D09 B;  2QYZ A;  2DER A;  2D8H A;  4FW2 A;  3DLM A;  1MV0 B;  5LJ3 h;  1YHQ Q;  2ZAE A;  2EGC A;  4PJO A;  2RPN A;  3FJ5 A;  1E6H A;  4J8O A;  3RER A;  3VS7 A;  4HCK A;  3OBY A;  1VQP T;  1R77 A;  2LCS A;  5CIU A;  1YCS B;  4FYX B;  1EIF A;  2P0P A;  2WAC A;  4F7U F;  1M90 U;  4M75 B;  2OTJ Q;  2DTO A;  2LNV A;  1Q86 R;  1BCM A;  1SF9 A;  3OYG A;  1FMV A;  4Y91 A;  3A8L B;  2DL4 A;  3EGX B;  4C8Q D;  4HCC A;  4DBR A;  2D0N A;  5GMK j;  1TU0 B;  2KR3 A;  2PU9 B;  1VQ7 T;  1NZ9 A;  4M75 D;  1A0N B;  1VIE A;  2OX7 A;  1QP3 A;  4II1 A;  3I35 A;  1G5V A;  2PQW A;  2E4H A;  1TOV A;  4EMK C;  1WIE A;  2ZPH B;  2GFU A;  5LJ5 j;  1M1K C;  1I4K 1;  3JCM e;  2FZC B;  4OGC A;  4ZGD B;  3G71 T;  3QJ6 A;  4ZNX A;  1D1A A;  2ZPI B;  4IIO A;  2FRY A;  3J81 E;  3L2U A;  1TH7 A;  5LJ5 e;  2ROL A;  3VYH B;  1GFC A;  1M2O A;  2L3P A;  4L5G A;  3TVT A;  3THK A;  1MMG A;  3M4Y A;  3ZBD A;  3JSC A;  3S3N A;  4OML A;  3PGG A;  1XNI A;  4C0D C;  2V8J A;  4N4G A;  2CRE A;  4PFP A;  2RHI A;  3BE3 A;  1S72 A;  2L0A A;  1TUG B;  2J06 A;  2P4R A;  3JCM f;  4RTX A;  1VQ6 A;  4LD9 K;  2DMO A;  3A8G B;  4BI4 A;  3CD6 T;  3I5S A;  2AKK A;  1Q82 C;  4RCC A;  3CXC A;  1SSF A;  2EAY A;  1X2K A;  2L2P A;  4JS5 A;  3V8K A;  2XDP A;  2BZ8 A;  1FWZ A;  4JRQ A;  5GAM h;  1VQN T;  5IHI A;  4BY6 B;  5IT9 E;  2SRC A;  3REB B; 
#chains in the Genus database with same CATH homology
 1SRM A;  1MV3 A;  2F2V A;  3EG3 A;  2ED1 A;  2X3W D;  3UA7 A;  1UG1 A;  1X27 A;  2DRM A;  3CQT A;  1MUZ A;  4AG1 C;  4CC2 A;  4J9E A;  5FW9 A;  1NEB A;  3EGU A;  2KT1 A;  1WXU A;  4J9D A;  2LJ3 A;  1YWP A;  1OEB A;  1K9A A;  2BZY A;  2KE9 A;  3M0R A;  1PKS A;  2JM9 A;  2K79 A;  1VYV A;  2K2M A;  1QCF A;  2A28 A;  1UJ0 A;  4J9C A;  2JMA A;  1E7O A;  1PRL C;  2A36 A;  2GNC A;  2KXC A;  3I5R A;  1YWO A;  4AFU C;  1AWX A;  4AG2 C;  2KXD A;  2CSQ A;  2PTK A;  1SPK A;  3A98 A;  4QT7 A;  1CSK A;  1W1F A;  2PZ1 A;  1FYN A;  5IHN A;  1UTI A;  4RUG A;  1EFN A;  2LX7 A;  1GBQ A;  1RI9 A;  1Z9Z A;  1ZSG A;  1U3O A;  2RQU A;  4LUE A;  1Y0M A;  4AFS C;  4D8D A;  1HD3 A;  2E5K A;  4HVW A;  1ABQ A;  2V1R A;  1GL5 A;  4OMN A;  3M0S A;  1PWT A;  2HSP A;  4JJB A;  1NEG A;  2YSQ A;  4CC3 A;  1M8M A;  1Z9Q A;  2KT8 A;  3NHN A;  4RTW A;  1W6X A;  1GCP A;  2J7I A;  2O9V A;  1HSQ A;  1CKB A;  2ESW A;  2RQR A;  3H0F A;  4JJC A;  2JM8 A;  1JEG A;  2O88 A;  4OMP A;  1X69 A;  5IH2 A;  2F2W A;  1AWW A;  2AKL A;  2H8H A;  2CDT A;  1VA7 A;  1UHF A;  1IO6 A;  2RQV A;  1H8K A;  1OV3 A;  2KNB B;  3VRY A;  1SHG A;  1M30 A;  1OOT A;  2F2X A;  5FWB A;  4RTU A;  1JXM A;  3LH5 A;  2DA9 A;  3M0Q A;  1WLP B;  2CT4 A;  1VYU A;  1BK2 A;  1UDL A;  1BU1 A;  4OMQ A;  4FSS A;  3RNJ A;  4LE9 A;  1BBZ A;  2ABL A;  2J05 A;  2EGE A;  2DL5 A;  1JU5 C;  4J9G A;  2RQT A;  2CSI A;  2CUB A;  2DL3 A;  1U06 A;  1PHT A;  1K0S A;  1I1J A;  2GBQ A;  2K6D A;  5HCK A;  2CT3 A;  2DYB A;  2KYM A;  2ROT A;  2AZV A;  1WX6 A;  2KRN A;  3GBQ A;  2JW4 A;  1AWJ A;  1SEM A;  4A63 B;  3NMZ C;  3TSW A;  2FPF A;  1WA7 A;  1K1Z A;  2EVR A;  2M0Y A;  3VS4 A;  4HVU A;  1WXT A;  3EG1 A;  1T0H A;  4JPB W;  2QDL A;  2B86 A;  4E6R A;  5GJW B;  1X2Q A;  1E6G A;  1GCQ A;  1I07 A;  1QWE A;  1ZUU A;  2DX1 A;  1QLY A;  2MIO A;  1UJY A;  2FG0 A;  2O2O A;  3EHQ A;  4Z8A A;  3SEM A;  1FMK A;  5EC7 A;  4RTT A;  3EHR A;  3QWX X;  1NYG A;  4D8K A;  3QWY A;  1LCK A;  5IXF A;  1TUC A;  2KRS A;  3PVQ A;  2DVJ A;  1BB9 A;  3TSZ A;  4AFQ C;  1RLQ C;  1NLP C;  2DNU A;  4F14 A;  1WI7 A;  4GBQ A;  2KYB A;  3U23 A;  1UUE A;  2C0I A;  4GLM A;  1ARK A;  2M51 A;  2ED0 A;  1AZG B;  1ZX6 A;  2J6O A;  1AD5 A;  2OI3 A;  5ECA A;  1B3Q A;  4F16 A;  2JS2 A;  2KBT A;  1YNZ A;  1NM7 A;  4F17 A;  1ZUY A;  1RLP C;  1TUD A;  1X6B A;  3VS5 A;  4CC7 A;  3IQL A;  3KFV A;  2C0T A;  2FPE A;  3PVL A;  1CKA A;  2MOX A;  2DE0 X;  2DRK A;  1T3S A;  4Z89 A;  2NWM A;  1K0X A;  5I11 A;  3M0P A;  2LMJ A;  1GFD A;  1GCQ C;  2EYX A;  3EG2 A;  2DBM A;  1WYX A;  2GTO A;  1U5S A;  2EPD A;  1M3A A;  1K76 A;  2GTJ A;  1WDX A;  1UFF A;  2A08 A;  2C0O A;  2CH4 W;  3NPF A;  1NG2 A;  1X6G A;  3NGP A;  2EYZ A;  2YT6 A;  1KSW A;  1AEY A;  3O5Z A;  3REA B;  1JXO A;  1UHC A;  2HBW A;  1X43 A;  2AZS A;  1HJD A;  2GGR A;  1SSH A;  2DM1 A;  5I22 A;  2RN8 A;  2OAW A;  2ECZ A;  1H92 A;  1GBR A;  2EKH A;  1WFW A;  4LNP A;  2LQN A;  2BTT A;  1OPK A;  2PNI A;  4OMM A;  2DF6 A;  2YUQ A;  2LNH B;  4EIK A;  3RBB B;  1AOJ A;  2EQI A;  2K9G A;  1I0C A;  2EW3 A;  1PKT A;  1KFZ A;  3ZL7 C;  2KGT A;  1UE9 A;  2YUO A;  4J9H A;  1KIK A;  2BZX A;  1NLO C;  2J6F A;  2J6K A;  2LP5 A;  2RF0 A;  3ULR B;  4JZ3 A;  4RTZ A;  4ESR A;  2G6F X;  2VKN A;  1AVZ C;  2D1X A;  1VYT A;  4M4Z A;  2CUD A;  1QWF A;  1G83 A;  2EYY A;  2EBP A;  2L3Q A;  2RMO A;  4HVV A;  2D8J A;  3C0C A;  1ABO A;  4HXJ A;  2XMF A;  3VS6 A;  2FRW A;  2JS0 A;  1JO8 A;  1KJW A;  2JXB A;  3VS0 A;  1PNJ A;  4CC4 B;  5IHK A;  2JMC A;  4X1V A;  2IIM A;  2JTE A;  3VS3 A;  1PRM C;  2KRO A;  4K11 A;  2CH4 A;  5IXB A;  1XOV A;  2EGA A;  1QKX A;  2HCK A;  1GRI A;  4JZ4 A;  2K3B A;  2YUN A;  4AFZ C;  5GJV B;  2L3S A;  1ZLM A;  2D8H A;  2YUP A;  1MV0 B;  2LQW A;  4J9B A;  4Z88 A;  2FEI A;  2JT4 A;  2EGC A;  2DIL A;  1UGV A;  2RPN A;  1V1C A;  5FWC A;  3FJ5 A;  1E6H A;  2K7A A;  1ZUK A;  1H3H A;  3VS7 A;  4HCK A;  2LZ6 B;  4J9F A;  2LCS A;  1YCS B;  3H0H A;  2HDA A;  1TG0 A;  2RNA A;  3EG0 A;  2YDL A;  4RTV A;  1YN8 A;  4JJD A;  1QKW A;  2DL8 A;  2O31 A;  1M3B A;  1JQQ A;  1NYF A;  1ZBJ A;  2DJQ A;  2VWF A;  2DBK A;  3UF4 A;  3UA6 A;  1AZE A;  2DL4 A;  2DL7 A;  3SHW A;  2D0N A;  2KR3 A;  3VS1 A;  3H41 A;  4IIM A;  2W10 A;  1A0N B;  2NUZ A;  1YP5 A;  1T3L A;  2LJ0 A;  1AWO A;  1B07 A;  3I35 A;  3JV3 A;  4KRT A;  2A37 A;  3R6N A;  3VS2 A;  1WIE A;  4WCI A;  3I9Q A;  5L23 A;  2EYW A;  2FO0 A;  2DLP A;  4DEX A;  1SRL A;  4DEY A;  1UEC A;  4ZNX A;  1J3T A;  2MCN A;  4IIO A;  2FRY A;  2ROL A;  1G2B A;  3PE0 A;  1GFC A;  1M3C A;  2L3P A;  4R0K A;  1M27 C;  3TVT A;  3THK A;  2X3X D;  4ORZ A;  2O9S A;  4LUD A;  4LN2 A;  4J9I A;  4OML A;  1S1N A;  3UAT A;  2ENM A;  3H0I A;  2FPD A;  2CRE A;  2V1Q A;  2HEQ A;  1W70 A;  2L0A A;  1SHF A;  2J06 A;  2P4R A;  2RQW A;  2SEM A;  4OMO A;  4RTX A;  2W0Z A;  2AK5 A;  2KRM A;  2DMO A;  2LJ1 A;  2VVK A;  3VRZ A;  1RUW A;  3I5S A;  2AKK A;  2I0N A;  4RTY A;  1T0J A;  1X2K A;  1WXB A;  2L2P A;  1N5Z A;  1Y57 A;  2BZ8 A;  2KEA A;  5IHI A;  3M0T A;  2OJ2 A;  4Y92 A;  3M0U A;  2GQI A;  1OPL A;  2SRC A;  1K4U S;  3REB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...