4M7DC

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dC00
1H641 5LJ5h 1WNLA 5GAN2 1I5LA 2RD1A 3RKYA 4EMGA 4QVDA 3FIFA 1MGQA 5GMKe 4M78D 4NL2A 4EMKB 2Y90A 5LJ5e 2CGHA 5GAN5 5GAOn 3RERA 4EMKC 4F7UA 3JCMP 1I4K1 4M78G 4X9CA 5GMKi 5LJ5g 4M77B 4M7AE 4PNOA 4A54A 3PGGA 4M77C 1B34A 1YCYA 1I81A 4XTXA 5LJ5f 1M8VA 3JCMW 1WQ7A 4C92B 4C8QG 3JCMX 2DXUA 5GAMj 3RESA 2DKGA 2EJGA 3SWNB 4C92C 2EAYA 3JB9I 4M75E 2DXTA 4NOYA 4C8QE 1U1TA 3BY7A 4F7UB 4WF2A 4XTUA 3V7SA 5LJ5d 3JCMb 3FJPA 4M7AF 4M7DE 4V2SA 4RCCA 3L2ZA 5GMKj 3FB9A 4RCBA 3V7RA 4XTYA 1HK9A 4XU1A 4J6YA 2DTOA 3RKXA 5CAIA 4C92A 4M7AD 2FB7A 2EJ9A 3JB9J 1WQWA 1BIAA 4M75F 3SWNA 4M7AG 4C8QF 4HT8A 3QUIA 4M7DF 3BDUA 4M78A 3HFOA 3V8KA 5GANh 5GAOp 3RKWA 4XTWA 4EMHA 5GAN7 2I2LA 1LJOA 2ZGWA 1LOJA 2VC8A 4M75D 4C8QD 5GANe 5LJ3h 4M7DD 4PJOE 1BIBA 4M75G 4XTVA 5GANg 2E64A 4N0AA 4M7DG 5GAOl 2E41A 5GANf 5LJ3e 2EJFA 3SWNC 2VXFA 1JBMA 3QO3A 4M78B 5LJ3g 5GAN6 4M78C 5LJ3f 5GAMg 4NL3A 4HA8A 3L1AA 3JCMV 1X01A 4JRKA 2RA2A 1N9RA 3JCMh 4PJOF 3V7CA 4M77E 4DQ2A 4MMLA 5LJ5j 5GANd 1KQ2A 4JLIA 2DTHA 3AHUA 5I21A 3RUXA 4N0AC 4M7AA 4C92E 2DZ9A 5LJ3d 1N9SA 3V8JA 4PJOD 2K57A 3JCMg 2YLBA 3HSBA 1KQ1A 3JCMf 3JB9F 4PJOG 4OP0A 1U1SA 3QHSA 4F7UE 4J5YA 5GAOr 2QTXA 2JN0A 4M77F 4XU2A 3JCMJ 1HXDA 4M75A 4C8QA 3JCMQ 3JCMc 5GAMh 5GAOm 3INZA 4M7DA 4C92F 4M7AB 3RIRA 2EWNA 4J6WA 5GMKl 3JCMd 1I8FA 1D3BA 2HNIA 4M77D 3SB2A 3JB9G 4Y91A 4M7AC 5GAMe 4M77G 2DTIA 4F7UF 2DVEA 4C92D 3GIBA 5GMKh 2RB6A 5GAMf 2DJZA 5DY9A 5GAN3 4C92G 4M75B 2FYKA 4C8QB 1TH7A 3EFRA 2YHTA 4M75C 4M7DB 2E1HA 4X9DA 4C8QC 4M7DC 1Y96A 1D3BB 3JCMe 5GANj 4F7UG 4XQ3A 3M4GA 4JUVA 5GAMd 4XTZA 4PJOA 3EFSA 1JRIA 2VXEA 4JRIA 3BW1A 4M78E 5LJ3j 1M5Q1 2E65A 3BFMA 3VU3C 4QVCA 5GAN4 4HT9A 4A53A 3HFNA 3QSUA 5GMKm 3JB9D 1Y96B 4J6XA 2E10A 2DEQA 4EMKA 5GAN8 2DZCA 2RM4A 4XU0A 1B34B 1LNXA 4M77A 4PJOB 4PJOC 4XU3A 4M78F 2YLCA 3V8LA 5GAOq 3JB9H 1WPYA 4MMKA
chains in the Genus database with same CATH superfamily
5LJ5h 1OI1A 2QQAA 3NTHA 1VQ4T 1N8RR 4FIBA 3PGGA 1O75A 1I81A 1VYVA 4E6RA 1YP5A 1IZ6A 1YJ9A 2XK0A 1TUCA 1S72A 2LCSA 3CCQT 3I55A 1VQMQ 4DOVA 4FT2A 1QKXA 1G83A 4DOWA 2EQIA 4PLLA 1Q7YU 1KG1A 1X75C 1VQ7A 4EIKA 3CCJT 1W2BS 2V26A 4OMLA 3ZEHA 4QQ6A 2C0TA 2PTKA 4DBRA 1QWEA 1UE9A 2EJFA 3CMAA 3CCVA 1N9RA 3JCMh 3CMEQ 2C06A 1S1NA 1N9SA 2O2OA 2FZCB 4Z88A 2XMFA 2QAZA 1QCOA 2F2XA 5A0GA 2YT6A 3OYDA 3CCSA 2RQTA 1ABQA 3CC4Q 4ELYC 1K9MU 1UFFA 3X28B 1G5VA 5KYUA 1N8RC 3CD6A 3EG9B 2BKDN 2FYKA 1ZSZB 4M75C 3HKSA 2CREA 5CCAA 2CZ7B 2OAWA 3Q1JA 3NHNA 1UDLA 3CCEQ 2A28A 2CSQA 3ZL7C 2IIMA 4LNPA 4PJNA 3E19A 4EMKA 1BI0A 5GAN8 1RAGB 2E5KA 1JXOA 2KEAA 2H3JA 4Y92A 1MMAA 3O5ZA 2F5KA 2KAFA 4J9CA 5C0MA 2NUTB 5HCKA 2KYBA 2KVQG 2Y90A 3MP8A 5CKEA 2ZPEB 2HBWA 5LJ5g 3OYJA 2AT1B 2MYSA 3OYHA 2RH2A 2M0OA 1RAFB 5LJ5d 1QVGP 4GY5A 3FB9A 2LX9A 2K7AA 4ESRA 5IH2A 3M0QA 1YWPA 3X20B 4EPCA 2HAXA 3CC2A 4M7AG 2BZ8A 2R5AA 2VWFA 3M0PA 3H8ZA 1Q95G 4LDUA 9ATCB 1Q86U 2DPPB 1AOJA 2LQWA 2WSCE 2G6FX 2QEXA 5GJVB 3CXCP 2FVUA 3ZFJA 3CCLA 1RLQC 2COZA 4JJNK 3WVDB 4C92E 1GFDA 3EHQA 3JCMg 5HKCA 2RK1A 5D7UA 2AIRB 2QTXA 4PK4A 1OU8A 4XU2A 1RUWA 1NPRA 3VRZA 3M57A 5KYYB 4C92F 4C0ZA 5CR2A 2MMPA 4Q5WA 3JCMd 4Y28E 3CBOA 3X25B 3P8BB 5J26A 3GIBA 2EGEA 4J7FA 4DBQA 3NGPA 5GANj 4F7UG 1ABOA 4C5EA 1ZUKA 3OSSC 4HT9A 3I5SA 1X2KA 3CCMT 1PRLC 1PWTA 2ZPBB 4AFZC 2DVJA 3N5BB 1VQOT 3OYGA 3JAME 1B7TA 1I0CA 2LP5A 4D8DA 1YWOA 4CC2A 5LJ5e 1NE8A 4L59A 3M0RA 1M2OA 2QGFB 3LH5A 5HK0A 5LJ5f 1YCYA 1K8AU 3A8GB 4GLKA 3VS2A 3EG3A 2XI9A 1YFNA 4ZTFA 2JTMA 3QG1A 1YN8A 1MMDA 5KE2A 1DJ7B 1E7OA 2EW3A 3FJPA 1YI2A 2E4HA 4HVVA 1Q82R 4RCBA 3V7RA 1KSWA 1YJ9Q 5CAIA 2QG9B 1S72Q 3I55Q 2R5MA 5GAOp 2YDLA 3CCRA 2JUFA 3DB4A 1PHTA 4C8QD 4A4HA 2OTJT 1NZ9A 4J9HA 2XDBA 1XTDA 5GAOl 1VQ7Q 3DLMA 3QWYA 5GAMg 2LRQA 2KXCA 3U23A 1WXUA 5KYNA 2AKLA 1A0NB 2DL7A 1C6VX 1OEBA 4DEYA 2H3EB 3CMAQ 3SHWA 3CCVQ 3JCMf 2W0ZA 2L3RA 3LH0A 2QDYB 5FROA 2GNCA 3EAEA 1HXDA 1K1ZA 3ER0A 4NS5A 5IHKA 2B86A 2AZVA 1M2VB 3CCSQ 2L3SA 1YIJT 3QJ6A 5KYXB 4C8QB 2IPOB 3L2QA 2YHTA 1ZSZC 2PNIA 3G6EA 1M4ZA 2QI2A 2J6FA 3VS6A 3CD6Q 3REBB 5LJ3j 1R8OB 1N8RU 4HCBA 3BFMA 2DX1A 2Y4YA 4FT4A 3BDLA 2EQKA 2SRCA 1MUZA 2RN8A 2KDSA 2LCLA 1RI9A 1VQPA 2GQIA 5I11A 2KGTA 1UGSB 3PTAA 3C94A 4BI8B 2CUDA 1WNLA 2A08A 1I5LA 2NYSA 4PKCC 2QTVA 1VA7A 3M55A 4O6JA 5LL6S 2RJEA 1V76A 2YSQA 2YUPA 2OTLT 1X6OA 1VQNT 1B07A 3FJ5A 5GAMj 4LD9K 3QBYA 1WXBA 3JCMb 1CKAA 8ATCB 3FRNA 1TTHB 3CPWA 1VQ6A 1JJ2P 2DTOA 4M7AD 4ME7A 1UUEA 1OU9A 4ANJA 2MIOA 4HT8A 3QUIA 2O01E 1ZSGA 4AFQC 3NTIA 4DA4A 1Q7YC 2I2LA 1LOJA 4J9BA 2E41A 3CC2Q 3UWNA 2O88A 3UATA 3CCQA 2KQWA 4DEXA 2PUOB 4OVAA 2O4XB 2EYYA 1GCPA 3A98A 3L1AA 3VS5A 5KE3A 4DQ2A 4MMLA 3MCAB 2J06A 3RUXA 1ZLMA 2QEXQ 1MNEA 1RAIB 4MDWA 3V8JA 3CCJA 3HSBA 1KQ1A 2ZAEA 3CCLQ 4LDYA 4LN2A 3UF4A 2O9VA 1XJWB 2DXBA 2JXBA 2NUZA 3I56Q 1UB4A 2QXFA 4M7DA 4M7AB 3JB9G 2CT3A 4M77G 3RDVA 3GPLA 1BCMA 4RG8A 1K9MC 2QASA 4KH1B 3BE3A 1W2BP 4E7IA 3OMCA 3MJXA 4JRIA 3CCUT 3MP1A 2JS2A 3OW2S 3LYIA 4A53A 7AT1B 3QYGB 1Y96B 2E10A 3MKDA 1PD1A 1PSFA 5I2SA 5M9OA 1LNXA 1BI3A 4IUVA 4XU3A 1WYXA 2F1LA 2MWPA 4KGZB 1O9SA 5GMKe 5GAN5 3C0CA 4M78G 4X9CA 5CKBA 4PNOA 2GQVA 4XTXA 1FWZA 2CYZB 2RQRA 3RBBB 1SSFA 3PMTA 1VIFA 4F7UB 3G4ST 3SDZA 2DA9A 1VQKT 2HKNA 3M0UA 1IHVA 4J9EA 2GF7A 3SWNA 1YI2Q 1GBRA 2LT4A 4XTWA 3EG2A 4AFUC 1VIEA 5FW9A 3P8DA 1VYUA 2KBTA 4A4KA 2M02A 1Q86C 2EYWA 5GAN6 3CCRQ 4HA8A 2NLUA 1QKWA 3PT9A 1NJIR 2MWOA 4BB7A 3OB9A 1YHQA 1YITQ 4RTWA 4E7HA 1ZUUA 3QDFA 3VS1A 2XDDA 3EG0A 5CK9A 1U1SA 1V1CA 4PFZA 5KH6A 2CZ6B 2KMTA 2HD0A 2LCCA 1I8FA 5CO7A 1TS9A 3EFOA 1XQHA 1I1JA 1KQSS 1LCKA 3CC7T 3MEUA 1VQ9T 2LJ0A 4C0GA 1TH7A 3UDCA 4C8QC 4HKEA 2XKOC 2KR3A 1MMNA 2O9SA 5HK3A 2CP0A 4E7SA 3EFSA 4IURA 2L3PA 4JJBA 3EGDB 2FZKB 3EGXB 2GGRA 1OULA 5I2MA 3G6EQ 2CZ0B 2RI2A 2HL3A 2CS7A 1M8VA 2V1RA 1Y57A 1PD0A 1Q82U 4A63B 2FL7A 1VQPQ 2P4TA 2LMJA 2BZYA 2DL4A 4E7KA 2ROLA 4JLGA 3RR6A 2IG0A 2DXUA 4RUGA 5FRNA 4JS5A 3J80E 1T3LA 3CCMA 3JB9I 1N27A 4NOYA 4M7DE 1K8AC 5CKFA 2DBMA 3RKXA 1VQOA 1NEBA 4C92A 2E6ZA 1QVPA 3MEAA 1M3BA 4IIMA 1UTIA 2X51A 1NG2A 4JDSA 5GANh 4M7DF 1WJQA 1UGPB 1AT1B 5GAN7 1VQ6Q 1ACMB 3GNFB 2ZPGB 1WHLA 2XHCA 1QVGA 3PE0A 1J3TA 1JBMA 4E2FB 1VQ4Q 3OS5A 1YJNT 2HQHA 1X6GA 3UPUA 4F16A 1KQ2A 2DRMA 3O8VA 1ZA1B 3CPFA 4KH0B 4PJMA 3CCQQ 5IXFA 1VQ5T 4OMOA 3J81E 3JCMQ 2OTJA 3INZA 4OB3B 2DF6A 4M7AC 4M77D 3CCJQ 3OYIA 4KRTA 4HVUA 1Q81R 2PZ1A 3HL8A 4C92G 2WSEE 3META 4MDXA 1GFCA 4LDWA 3H41A 4LUDA 3HRUA 4PJOA 1G3SA 3CEYA 2H8HA 4CC3A 4FCYA 1TOVA 4RTYA 5FU6B 1P92A 1QQJA 3OA6A 1I5OB 3I5RA 4KGVB 2LJ1A 5J39A 2DEQA 1M90R 2X4WA 2RK2A 5CVIA 2RF0A 1YIJA 1WFWA 2RD1A 3RKYA 1MGQA 4M78D 1BBZA 2CP7A 4M77B 5KYWA 3G7ZA 3M5AA 2HZYA 1W4SA 2GBQA 1NYFA 3RESA 3LWIA 4HVWA 2EAYA 2K3BA 3G1JA 1U1TA 3EG1A 1LPLA 1PNJA 4PFPA 4QQDA 2KSSA 4XTYA 2C0OA 2LDMA 2CP3A 1KC8R 5IHIA 2OTLA 2HL5C 5LJ3h 1VQNA 4CRIA 4TVRA 5GANg 5FU7B 1FMKA 4QW2A 1UGQB 1FMWA 2LT1A 4M78B 2E12A 4JRPA 4NL3A 2GTJA 1AEYA 3CQTA 4Z02A 3OS0A 2RA2A 5J3BA 5GANd 4JLIA 1U5SA 2HDAA 3OSVA 2DMOA 4O5VA 1YHQT 1M90C 4RG2A 1XOVA 1UGVA 4OGEA 2M51A 4M75A 5GAMh 3KXTA 1YHQQ 1QP3A 1QCFA 1D3BA 2JZ2A 1D1CA 2DL5A 1K73R 1PC0A 2LNHB 2VUBA 1RABB 3M59A 3EFRA 4OMPA 2AHJB 3PNWC 1TG0A 2A0FB 1BCOA 3H6ZA 1UEBA 1W70A 1Z9QA 2A3LA 4QKUA 2YWWA 4XTZA 1JRIA 1M3AA 2AZSA 4KT0E 2ZPIB 2EQUA 4P5NA 3JSCA 2XD0A 2O31A 1UJYA 3PVQA 1G3YA 2M16A 1NBEB 5IN1A 2HCKA 1ARKA 4EMGA 1UHCA 4YTLA 1RL2A 1M9SA 4BE2A 2LQ8A 3JCMW 2FO0A 2CH4W 4LD6A 3CCUA 2K3XA 4J8OA 3JCMX 3SWNB 2JM9A 1K9AA 1X2QA 4M4ZA 4C5GA 2DXCA 3V7SA 3PIOA 1KHCA 1N6AA 1BKBA 3VUBA 4DBFA 4XU1A 4LDVA 4DBHA 2VGNA 2JW4A 3E9FA 1HJDA 2EJ9A 3CCMQ 2MI6A 2J05A 1NJIU 1K73C 1QVFS 3OYNA 3G71T 3GLXA 2JTEA 3HFOA 2JTFA 5GANe 3URGA 1Y71A 1GCQC 4JJDA 4PJOE 4XTVA 1VQOQ 1ZX6A 4J9IA 2KRSA 3OW2P 5GANf 4BUGA 3VJPA 4C0FA 4OB0B 5LJ3g 1FX7A 3G4SA 1JJ2A 1M1FA 1VQKA 2KNBB 2KYMA 4PJOF 3SEMA 3OYEA 4VUBA 3EFOB 5LJ3d 2RJCA 2JMCA 2MOXA 2YLBA 1IRXA 1M30A 2X4YA 3H0IA 5GAOr 2FEIA 5CIUA 3VYHB 4E7JA 1PRMC 3SB2A 2ZCFB 1E6HA 4RTZA 3SFMA 1T0HA 1WZOA 4C92D 5A0DA 2RB6A 3S6WA 2EKOA 2IVWA 2L3QA 1WJRA 3TSZA 2OTJQ 2JT4A 4X9DA 2HEQA 3JCMe 2SEMA 2K3YA 5GAMd 2KE9A 4N4HA 4AMCA 4EDUA 4FSXA 1OPKA 2VXEA 2VVKA 2HQEA 1KK7A 2FPDA 5FU6C 4FYVB 1CKBA 4RTXA 3PFSA 5GMKm 2WACA 2LNVA 1KD1R 1FMVA 2K2VA 4XU0A 1SRLA 4J9GA 2KY9A 3CC7A 4MMKA 2XU8A 1QMCA 1VQ9A 1W2BA 2K9GA 3TSWA 1G8XA 4OB1B 3OMGA 1HSQA 1WHMA 5FWCA 3OQ5A 2DD4A 3KFVA 4MZPA 4M77C 1Q82C 3JRZA 2M9UA 1YIJQ 4C92B 1AVZC 3QDRB 1BB9A 2V8IA 4M75E 4XAXB 2KT8A 1K4US 4RCCA 4FW2A 4OMFB 4JPBW 2HMAA 1KQSP 2RI3A 1IGQA 3ULRB 3CBMA 2RHUA 4M75F 3V8KA 4FW1A 3M0TA 3OS2A 4Z89A 2VYTA 4OGCA 1M1KR 1WDXA 2E3IA 5FU7C 5LJ3e 1QVGS 1MV0B 2JM8A 2K6DA 3OYBA 4BI3A 4M78C 5LJ3f 4OMQA 2OTLQ 1EX4A 1VQNQ 1M3CA 1ZBXA 1KD1C 4N0AC 3FDRA 4ZN1A 4GBQA 1PCXA 2L2PA 2D1XA 2M1HA 3AT1B 3EG9A 2DK3A 2RPNA 3RNJA 3JV3A 1ZSZA 3RIRA 4B9XA 4Y91A 5GAMe 1WHHA 2BE9B 1M90U 1YJNA 5GAMf 1R0CB 2DJZA 2GTOA 1WHKA 4CC7A 1U3OA 1NPPA 1ZUYA 4XK8E 5KYUB 1VQMA 3M4GA 4BDZA 2LX7A 2DIQA 2D8JA 1VQ5A 3VU3C 4QVCA 1GBQA 2KRMA 4A4EA 2NUTA 1SKUB 3QSUA 4ZNXA 1YJWT 4X1VA 2BUDA 1PKSA 2JNGA 2YLCA 4AFSC 1WPYA 2FPFA 1X27A 2D9TA 4BACA 5CQXA 4EMKB 5GAOn 3UA6A 1U8RA 2DE0X 3CMEA 1IGUA 1KC8U 4CI0C 2J6KA 2GFAA 2A36A 1ZBJA 1UECA 5GMKj 2A7YA 1HK9A 3CCUQ 2ECZA 2QQ9A 2EQJA 3OBWA 2RQVA 2XG8D 4EMHA 3P8HA 3FEOA 2K4YA 1C1AA 1EZZB 3R6OA 4M7DG 3VV0A 2RJFA 2NUPA 2FZGB 1PM3A 3QO3A 4ZGDB 2D6FA 3T9NA 3JCMV 1K73U 2C0IA 3NMZC 3NTKA 1RAHB 4HCKA 3OYMA 1NM7A 5KYYA 3A8MB 5I21A 4E7ZA 3X24B 4PFOA 4KBMB 1X43A 3G4SQ 1VQKQ 1SRMA 2HKQB 3HRSA 2VKNA 2X3XD 2LC4A 4ELZC 1AWWA 2ZZDA 3JCMc 4OB2B 3C12A 2WSFE 2E3HA 4AG2C 4OMNA 3UA7A 3OS1A 3L42A 3M56A 2LQNA 2PU9B 3QYHB 5GAN3 4IKFA 1FXXA 1MMGA 4OMMA 3ZBDA 4XQ3A 4BE0A 1HYOA 2E65A 1WX6A 4ZGJB 1KFZA 2YUNA 2XIDA 3TQ7P 3M53A 1ZA2B 3A5ZB 1RLPC 4WTOB 1VQ8T 2HSPA 1Y0MA 3KBGA 4LDXA 5GJWB 1IB8A 3JCMP 1IREB 1RI0A 1WHGA 2DM1A 1B34A 2DIGA 3CC7Q 3RMSA 2L89A 1VQ9Q 4IIOA 4C92C 2K5FA 1JXMA 3DB3A 5ECAA 2ED0A 5IHNA 4L6V5 3OYLA 2NWMA 1H8KA 3KUFA 4JRQA 3QJYA 2JOYA 4RMOA 2EFIA 1OOTA 2A37A 4JS4A 4J83A 1AWXA 3MP6A 2QA4T 3J7AF 4HCZA 1G3TA 1NJIC 2EKHA 1YBYA 5IT9E 1IO6A 3H9NA 1VQLT 2DEUA 2OAUA 2OX7A 1T3SA 2RO0A 1QWFA 4F14A 2DRKA 2QYZA 1M2VA 3G71A 1SHFA 2CSIA 4ATOA 5KCHA 5KYXA 1RAAB 4C8QA 2ED1A 3H0HA 1KIKA 5CKDA 1R0BG 2P4RA 1TUGB 1KD1U 2DTIA 5DY9A 3LX7A 3E1SA 3QXEB 2E1HA 2RQWA 3L2VA 1VQMT 1UJ0A 4IUQA 1SF9A 4JUVA 1YCSB 2KROA 1QVFP 2FHDA 1YJNQ 1TWBA 1R77A 2HQXA 1M5Q1 2P0PA 1OYXA 4GLMA 1ZQ1A 3CXCA 1E6GA 5DLOA 3JB9D 1SG5A 3SD4A 3QZ5B 2E70A 3PVLA 1VQ5Q 3ME9A 4OF1A 3OY9A 1WIEA 1D0ZA 2EQMA 2J6OA 2CGHA 3QWXX 4AT1B 4EMKC 2HSEB 5I22A 5EG2A 2DILA 3TVTA 2QQRA 4A54A 5CKHA 3CMET 1D0XA 4C8QG 1WA7A 4RKUE 2EJGA 2MK5A 1B3QA 3THKA 1M1KU 1AHJB 4XTUA 1GXIE 1JB0E 2EIFA 2MF2A 3CC4T 3L2RA 4RTTA 2GFUA 2BE7D 1AZGB 2QGGA 3JB9J 5FRMA 1CSKA 4PJJA 5AYFA 2O4XA 3RKWA 2YRVA 3OBYA 2VC8A 2MAMA 4M7DD 2JS0A 1XNIA 2E64A 3VS3A 3VYGA 1OZ3A 3QZ9B 4QT7A 5L23A 3CCET 2K79A 4FYWB 1UHFA 3CPWS 4M7AA 3OYYA 5CQYA 1PG5B 3S3NA 2COYA 4PJOG 3DKMA 5IAYA 1Q81C 3OW2A 3OYFA 3JCMJ 4HCCA 2XICA 2EWNA 4MZMA 2HNIA 1TUDA 2KK4A 3EH1A 2DVEA 1WGSA 3VRYA 4M7DB 3LWHA 1Y96A 4KGXB 1KHIA 2HBPA 2KRNA 2BZXA 1JEGA 2R57A 2PUKB 4FYXB 4RTVA 1QP2A 2DZCA 2F2WA 3DLLA 2ATCB 2ABLA 2VASA 1X69A 1GRIA 1U06A 4JZ3A 4BI4A 2X3WD 3REAB 3TEEA 4F7UA 3LLRA 2L0AA 2LJ3A 2VV5A 2KXDA 3C4SA 1WQ7A 1QCNA 3M9QA 3EHRA 2DKGA 4FSSA 3MEWA 1D1BA 4BD3A 2D8HA 1YJWA 4C8QE 4R56A 3L2WA 1KC8C 1Y07A 3OYCA 3OYKA 2QQBA 1FYNA 1OX9A 2EYXA 3I56A 3MEVA 3S3MA 4L5GA 3I9QA 2NUPB 5IXBA 4C8QF 1D0YA 3MHXA 2BTTA 4CC4B 5A2QE 4A4FA 2P0KA 2YXYA 4D8KA 4M75G 5DM7R 1JU5C 2DO3A 2B8AA 2CKKA 2PVOB 1KQSA 2D0QB 2MPXC 1X01A 1W1FA 5HY6A 5LJ5j 2COWA 2DTHA 2QDLA 4J9DA 3X26B 1SEMA 2DZ9A 4AG1C 2K57A 4A4GA 3QHSA 2V1QA 1Y7XA 1WXTA 4K11A 2JN0A 1TXQA 2YUOA 3VS7A 4ORZA 2YRDA 4RTUA 5GMKl 4N4GA 4E7LA 1IHWA 4BDYA 3G71Q 1D09B 4JZ4A 5GMKh 1V29B 3EGDA 3NPFA 2OJ2A 1WLPB 2E5QA 3EGXA 5A0LA 2LQKA 4ZGEB 2RHYA 3RMQA 2I0NA 1TSFA 3BW1A 1Z9ZA 1YJ9T 1G3WA 2KI7A 4KULA 2D0NA 1S72T 2PVDB 3I55T 4LXCA 2FG0A 4BE1A 1JQQA 1B34B 2CP2A 2G3RA 3C95A 4KUIA 3MPUB 5GAN2 2ZPFB 1VQ7T 1OV3A 4NL2A 1MHNA 3VS4A 2AKKA 3A1PA 4M7AE 4LUEA 1OPLA 4C0DB 1UG1A 1YITA 2L5QA 3EH2A 1M1GA 3CMAT 4MZTA 2DXTA 1EFNA 3CCVT 3BY7A 4M7AF 3PMIA 1VQ8A 3E2UA 3HTRA 1GCQA 4N4IA 1SPKA 3FC3A 3TCJA 3QKJA 2XDPA 2LZ6B 1BU1A 3CCST 2DD5A 1LJOA 2ZGWA 2DERA 1BI2A 2K2MA 3TREA 4FL6A 2DNUA 5FLXE 3LGFA 2ZPHB 3A8LB 1H92A 3CD6T 2LVMA 1W6XA 1Q7YR 1MNDA 1NLOC 3ASKA 3R6NA 1K76A 1YNZA 2RI5A 8AT1B 3EGUA 4PJOD 3I35A 4F04B 4WCIA 4B6MA 4F7UE 2DLPA 3NFCA 2QA4A 5GAOm 2RHIA 5KCOA 2MCNA 2RJDA 1LVKA 4J7IA 1VQLA 2EGAA 4F7UF 3VUZA 2RQUA 2VB6A 1Q81U 1H3HA 2P0QA 2DYIA 4M7DC 4D6WA 1M27C 2DL3A 2EYQA 1K9MR 4KUDK 2EGCA 3CXCS 1M8MA 3TU4K 3M4YA 1MV3A 1SHGA 2RM4A 4BY6B 2DFUA 5AT1B 2RMOA 4M77A 4PJOB 3IQLA 3QPHA 3V8LA 5GAOq 1JO8A 3GBQA 3JB9H 1IXDA 1H641 3WXMB 2P84A 3CC2T 3UT1A 1AWJA 2RNAA 4QVDA 2QK0A 1PSEA 3RERA 2EYZA 1VQ4A 5GMKi 2PVGB 3GNGA 5C6SA 2DL8A 4ZTJA 4II1A 5FWBA 1KJWA 1AD5A 1GL5A 2FRWA 2QEXT 2ESWA 2GCXA 3HHTB 3CCLT 1BI1A 1BK2A 5KYWB 4FU6A 1VYTA 4IUUA 1M1KC 3I56T 2CH4A 1BIAA 2RHXA 1YJWQ 4C5IA 4M78A 3FLGA 2DAQA 4J9FA 4M75D 3MO8A 1RAEB 4N0AA 3OYAA 3SWNC 2VXFA 1UGRB 2X35A 2Z0WA 3S3OA 5EC7A 4JRKA 3CBPA 3V7CA 4R55A 3CC4A 3AHUA 2DJQA 2KT1A 4UC4A 3WVEB 3HP9A 2PQWA 1Q86R 2YUQA 4OP0A 4PLIA 2CT4A 4J6WA 5D6YA 3VS0A 2K5IA 1AZEA 3CCEA 2M0YA 4M75B 1C0MA 1NYGA 1K0XA 2V8KA 2JJ9A 2RHZA 3H0FA 4IUPA 2E6NA 1D3BB 2X4JA 5D6WA 2W10A 3GF5A 2CP6A 2DYBA 2F5TX 4PL6A 3GP8A 2X9HA 4FYYB 4X34A 4JJCA 6AT1B 5GAN4 2R58A 1VOMA 1YI2T 1ZHIA 1H3ZA 4B9WA 3GOXA 4IUTA 4F17A 1BYMA 1T0JA 1OQKA 2DBKA 1QVFA 1AWOA 2FPEA 3FIFA 3D7SB 1EIFA 3CPWP 2F69A 2CZ1B 3LW5E 3CCRT 1I4K1 1OZ2A 1I07A 3A8HB 2OI3A 4C0DC 2CP5A 2JVVA 1NLPC 1YITT 4V2SA 4WF2A 2J7IA 4Z8AA 5D6XA 1X6BA 3L2ZA 2JMAA 2L8DA 1WHJA 2EPDA 1PKTA 4J6YA 3A8OB 4HXJA 2FB7A 1D1AA 1WQWA 2F2VA 2V8JA 3VKIA 2K5LA 2EBPA 3BDUA 1K8AR 1VQ8Q 2DETA 3M54A 1BIBA 1OX8A 1QW1A 1N5ZA 1RADB 2FRYA 2LTOA 4E47A 1HD3A 1NEGA 4QVZA 4M77E 1VUBA 2CUBA 3QIIA 1TU0B 2ENMA 2EVRA 3G6ET 2YRCA 3JB9F 5DLQE 3M0SA 1RACB 4J5YA 4M77F 4QQGA 2CDTA 2Y4XA 1VQPT 2QQSA 2VGMA 3M58A 2X4XA 4ZN3A 1SSHA 2ROTA 1K0SA 1JJ2S 2QA4Q 1WJSA 3L2UA 4PJLA 1VQLQ 5L8RE 3F70A 3HPWA 4R0KA 4M78E 4LE9A 1F1BB 1WI7A 3PIPA 1QLYA 3HFNA 2AK5A 4J6XA 3E9GA 4FM4B 2BIVA 3LGLA 4C5HA 3HRTA 4BY6C 1G2BA 4PJOC 1VQ6T 4M78F
chains in the Genus database with same CATH topology
2MWPA 2XU8A 5LJ5h 1OI1A 1VQ9A 2QQAA 1O9SA 4BI4A 1W2BA 3TEEA 5GMKe 5GAN5 4OB1B 3OMGA 3NTHA 4F7UA 1VQ4T 4M78G 3LLRA 4X9CA 3OQ5A 2DD4A 5CKBA 4FIBA 4MZPA 4PNOA 2GQVA 3PGGA 4M77C 1Q82C 1O75A 1I81A 1FWZA 2CYZB 3JRZA 2M9UA 2VV5A 4XTXA 3C4SA 1IZ6A 1WQ7A 4C92B 3M9QA 1YJ9A 2XK0A 2DKGA 3MEWA 3QDRB 1SSFA 2V8IA 1S72A 4M75E 3PMTA 4BD3A 3CCQT 1YJWA 1VIFA 4C8QE 4XAXB 3SDZA 4F7UB 4R56A 3I55A 3G4ST 1VQKT 4DOVA 4FT2A 4RCCA 3L2WA 4OMFB 1Y07A 3OYCA 1KC8C 3OYKA 2QQBA 2RI3A 4DOWA 4PLLA 1Q7YU 3I56A 1KG1A 3MEVA 1X75C 3S3MA 3CBMA 4L5GA 2GF7A 2RHUA 3SWNA 4M75F 1VQ7A 4C8QF 3CCJT 1W2BS 3V8KA 3MHXA 3OS2A 2LT4A 4XTWA 5A2QE 4A4FA 3ZEHA 1VIEA 2P0KA 2VYTA 4OGCA 4QQ6A 4M75G 3P8DA 5DM7R 5FU7C 2DO3A 2B8AA 2CKKA 5LJ3e 2EJFA 4A4KA 1QVGS 2PVOB 1KQSA 3CMAA 2D0QB 1Q86C 3CCVA 5GAN6 3OYBA 4BI3A 4M78C 5LJ3f 4HA8A 2NLUA 5HY6A 1X01A 1N9RA 3JCMh 5LJ5j 2C06A 2DTHA 3PT9A 3X26B 1ZBXA 2MWOA 3OB9A 4BB7A 1YHQA 4N0AC 1KD1C 2DZ9A 3FDRA 4ZN1A 1N9SA 4E7HA 2K57A 4A4GA 2XDDA 2M1HA 5CK9A 1U1SA 3QHSA 5A0GA 3OYDA 1Y7XA 3CCSA 2JN0A 5KH6A 2DK3A 2CZ6B 2KMTA 4ELYC 2HD0A 2LCCA 1K9MU 3RIRA 3X28B 1G5VA 5GMKl 1I8FA 5CO7A 4B9XA 4N4GA 4Y91A 4E7LA 1N8RC 1XQHA 5GAMe 4BDYA 1KQSS 1M90U 1YJNA 3CC7T 3CD6A 5GMKh 3MEUA 5GAMf 1V29B 2DJZA 1VQ9T 2BKDN 2FYKA 4C0GA 1TH7A 4M75C 2E5QA 5A0LA 3HKSA 3UDCA 2LQKA 1NPPA 4HKEA 4C8QC 2XKOC 4XK8E 1VQMA 3M4GA 4BDZA 4ZGEB 5CCAA 2RHYA 5HK3A 2CZ7B 3Q1JA 2DIQA 3EFSA 3RMQA 1VQ5A 3BW1A 4IURA 3VU3C 4QVCA 1YJ9T 1G3WA 4KULA 4A4EA 1S72T 3QSUA 2PVDB 1YJWT 3I55T 3E19A 4EMKA 1BI0A 5I2MA 5GAN8 4BE1A 1B34B 2BUDA 2CZ0B 2RI2A 2G3RA 2JNGA 2H3JA 2YLCA 3C95A 2CS7A 1M8VA 1WPYA 4KUIA 2F5KA 2KAFA 5GAN2 1Q82U 2ZPFB 5C0MA 1VQ7T 2D9TA 2FL7A 4BACA 2KVQG 4NL2A 5CQXA 1MHNA 2Y90A 2P4TA 4EMKB 5GAOn 3MP8A 5CKEA 2ZPEB 5LJ5g 4M7AE 3OYJA 3OYHA 4E7KA 4C0DB 1U8RA 4JLGA 3CMEA 2RH2A 2IG0A 2DXUA 1KC8U 5FRNA 4JS5A 2M0OA 3J80E 1YITA 2L5QA 3CCMA 1M1GA 3JB9I 4CI0C 3CMAT 4MZTA 1N27A 2GFAA 2DXTA 4NOYA 3CCVT 3BY7A 5LJ5d 4M7DE 1K8AC 4M7AF 3PMIA 4GY5A 5CKFA 1VQ8A 5GMKj 3FB9A 2LX9A 2A7YA 1HK9A 2QQ9A 4N4IA 3RKXA 4C92A 1VQOA 3FC3A 3X20B 2E6ZA 3TCJA 1QVPA 2EQJA 3QKJA 4EPCA 2HAXA 3CC2A 3MEAA 4M7AG 3OBWA 2XDPA 2R5AA 4JDSA 4M7DF 5GANh 3H8ZA 4LDUA 1WJQA 1UGPB 3CCST 2XG8D 4EMHA 3P8HA 2DD5A 2DPPB 1LJOA 2ZGWA 3FEOA 5GAN7 1Q86U 1BI2A 3TREA 2K4YA 3GNFB 2ZPGB 4FL6A 2XHCA 1QVGA 3R6OA 4M7DG 3VV0A 2RJFA 2WSCE 5FLXE 1JBMA 3LGFA 2QEXA 3QO3A 2D6FA 4ZGDB 2FVUA 3T9NA 2ZPHB 3A8LB 3ZFJA 3OS5A 1YJNT 3CCLA 3CD6T 2LVMA 3UPUA 3JCMV 4JJNK 1K73U 3ASKA 3NTKA 1KQ2A 3OYMA 3WVDB 3O8VA 3A8MB 5I21A 2RI5A 3CPFA 3X24B 4C92E 4KBMB 4PJOD 3JCMg 5HKCA 1VQ5T 2RK1A 4F7UE 3HRSA 2QTXA 4XU2A 3J81E 1NPRA 3NFCA 2LC4A 4ELZC 2QA4A 3M57A 2ZZDA 3JCMQ 3JCMc 5GAOm 2OTJA 2RHIA 3INZA 4OB3B 4C92F 4C0ZA 5CR2A 2MMPA 4OB2B 4Q5WA 3JCMd 5KCOA 4M77D 4M7AC 2RJDA 3C12A 3CBOA 2WSFE 4J7IA 4Y28E 3OYIA 3X25B 1VQLA 4F7UF 3P8BB 5J26A 3GIBA 3VUZA 3HL8A 4J7FA 3OS1A 3L42A 3M56A 3QYHB 2PU9B 4C92G 5GAN3 2WSEE 3META 4IKFA 1FXXA 4MDXA 1Q81U 2P0QA 4LDWA 4M7DC 3ZBDA 5GANj 4F7UG 4C5EA 4XQ3A 3HRUA 4D6WA 4PJOA 1G3SA 3CEYA 4BE0A 2E65A 3OSSC 2EYQA 4ZGJB 5FU6B 1P92A 4KUDK 4HT9A 3OA6A 3CCMT 2XIDA 3M53A 3CXCS 5J39A 3A5ZB 3TU4K 2DEQA 3M4YA 2RM4A 2X4WA 4BY6B 1VQ8T 2RK2A 5CVIA 4M77A 4PJOB 3QPHA 2ZPBB 3V8LA 5GAOq 3N5BB 3JB9H 3KBGA 1VQOT 3OYGA 1H641 1YIJA 4LDXA 3JAME 3WXMB 2RD1A 3CC2T 3RKYA 3UT1A 4QVDA 1MGQA 4M78D 5LJ5e 1PSEA 1NE8A 4L59A 3RERA 3JCMP 1VQ4A 5GMKi 2PVGB 4M77B 1IREB 1RI0A 3GNGA 5HK0A 5LJ5f 1B34A 1YCYA 3G7ZA 2DIGA 3M5AA 1W4SA 5C6SA 1K8AU 3RMSA 3A8GB 4ZTJA 2L89A 4GLKA 4II1A 3RESA 4C92C 3LWIA 2K5FA 2XI9A 2EAYA 2QEXT 3DB3A 4ZTFA 2GCXA 2JTMA 3QG1A 5KE2A 1U1TA 1DJ7B 3HHTB 3CCLT 1BI1A 3FJPA 1YI2A 4QQDA 4RCBA 4FU6A 3V7RA 2KSSA 4IUUA 4L6V5 4XTYA 3OYLA 1M1KC 3I56T 5CAIA 1BIAA 3KUFA 2RHXA 4JRQA 2R5MA 3QJYA 2JOYA 4C5IA 4M78A 5GAOp 4RMOA 3CCRA 2EFIA 2LDMA 3FLGA 2DAQA 2JUFA 4JS4A 4M75D 4J83A 3MP6A 2OTLA 3DB4A 4C8QD 5LJ3h 2QA4T 1VQNA 3J7AF 3MO8A 4HCZA 4A4HA 2OTJT 4CRIA 4TVRA 1G3TA 1NZ9A 5GANg 5FU7B 1NJIC 4N0AA 4QW2A 1XTDA 5GAOl 3OYAA 1UGQB 2XDBA 1YBYA 2LT1A 3DLMA 2VXFA 3SWNC 5IT9E 1VQLT 1UGRB 2OAUA 4M78B 2X35A 2E12A 4JRPA 5GAMg 4NL3A 3S3OA 2LRQA 4Z02A 4JRKA 3CBPA 2RA2A 5J3BA 3OS0A 3V7CA 2RO0A 5GANd 4R55A 3CC4A 4JLIA 3AHUA 3OSVA 4O5VA 1YHQT 4UC4A 1M90C 4RG2A 3WVEB 3HP9A 1XOVA 2PQWA 3JCMf 3G71A 4OP0A 2L3RA 3LH0A 4PLIA 2QDYB 4OGEA 5FROA 4ATOA 5KCHA 3EAEA 1HXDA 4M75A 3ER0A 4C8QA 4NS5A 5GAMh 3KXTA 1QP3A 4J6WA 5CKDA 1D3BA 2JZ2A 5D6YA 1KD1U 2DTIA 2K5IA 2VUBA 1YIJT 3CCEA 3M59A 5DY9A 3LX7A 4M75B 3QJ6A 4C8QB 3EFRA 3L2QA 2YHTA 3E1SA 3QXEB 2E1HA 2V8KA 2RHZA 4IUPA 2AHJB 2E6NA 1D3BB 3PNWC 3L2VA 2X4JA 1VQMT 1UEBA 3H6ZA 3GF5A 4IUQA 5D6WA 3G6EA 1M4ZA 2QI2A 2F5TX 2A3LA 4JUVA 4PL6A 4XTZA 3GP8A 2FHDA 1JRIA 4X34A 5LJ3j 1R8OB 2HQXA 1M5Q1 1N8RU 3BFMA 4HCBA 2Y4YA 2P0PA 5GAN4 4FT4A 3BDLA 2EQKA 1OYXA 2R58A 1ZQ1A 2KDSA 4KT0E 3CXCA 2LCLA 5DLOA 3JB9D 2ZPIB 2EQUA 3SD4A 1VQPA 1YI2T 3QZ5B 4P5NA 1UGSB 3JSCA 2XD0A 2E70A 3PTAA 1ZHIA 1H3ZA 1G3YA 3C94A 4BI8B 4B9WA 3GOXA 3ME9A 2M16A 4IUTA 1WNLA 4OF1A 5IN1A 3OY9A 1I5LA 1BYMA 4PKCC 1QVFA 4EMGA 3FIFA 2EQMA 1EIFA 3M55A 2CGHA 2F69A 2CZ1B 3LW5E 2RJEA 4O6JA 1RL2A 4YTLA 5LL6S 1I4K1 4EMKC 5EG2A 1M9SA 1OZ2A 3CCRT 2QQRA 4A54A 5CKHA 2OTLT 3A8HB 4BE2A 1X6OA 1VQNT 2LQ8A 3CMET 3JCMW 4C0DC 4LD6A 3CCUA 2K3XA 4J8OA 4C8QG 3JCMX 5GAMj 4RKUE 2EJGA 3SWNB 2JVVA 1YITT 4LD9K 1M1KU 3QBYA 1AHJB 4C5GA 3JCMb 2DXCA 4WF2A 4XTUA 3V7SA 4V2SA 1GXIE 3PIOA 3FRNA 1JB0E 1KHCA 1N6AA 2EIFA 1BKBA 2MF2A 3L2ZA 5D6XA 3VUBA 2L8DA 3CPWA 4XU1A 3CC4T 4LDVA 1VQ6A 3L2RA 4J6YA 2DTOA 2VGNA 3A8OB 3E9FA 4M7AD 2GFUA 2FB7A 4ME7A 2EJ9A 3JB9J 1WQWA 5FRMA 2MI6A 1K73C 1QVFS 2V8JA 1NJIU 4HT8A 3QUIA 3VKIA 2K5LA 3OYNA 3BDUA 5AYFA 3GLXA 3HFOA 2O01E 3G71T 2JTFA 2O4XA 3RKWA 2YRVA 3M54A 3NTIA 3OBYA 4DA4A 1Q7YC 2I2LA 1LOJA 2MAMA 2VC8A 5GANe 3URGA 1Y71A 4M7DD 4PJOE 1BIBA 4XTVA 1QW1A 1XNIA 2E64A 3VYGA 1OZ3A 2E41A 2LTOA 3QZ9B 4BUGA 5GANf 3UWNA 3VJPA 4C0FA 4OB0B 4E47A 5LJ3g 1FX7A 2KQWA 3G4SA 2PUOB 4OVAA 1M1FA 2O4XB 3CCQA 1JJ2A 1VQKA 3CCET 3L1AA 5KE3A 4PJOF 4QVZA 4M77E 4DQ2A 1VUBA 3MCAB 3QIIA 4MMLA 3OYEA 4VUBA 3CPWS 3RUXA 4M7AA 3OYYA 5LJ3d 3G6ET 5CQYA 2RJCA 3V8JA 4MDWA 3CCJA 2YLBA 3S3NA 3HSBA 1KQ1A 3JB9F 5DLQE 4PJOG 3DKMA 5IAYA 4LDYA 1Q81C 3OW2A 3OYFA 4J5YA 2X4YA 5GAOr 4M77F 3JCMJ 4QQGA 5CIUA 2DXBA 4HCCA 1UB4A 2XICA 2QXFA 2Y4XA 1VQPT 4M7AB 3VYHB 2EWNA 2QQSA 2VGMA 4MZMA 4E7JA 3M58A 3SB2A 2HNIA 2ZCFB 3JB9G 2X4XA 4ZN3A 2KK4A 4M77G 3SFMA 3GPLA 2DVEA 4C92D 4RG8A 5A0DA 1JJ2S 2RB6A 3S6WA 2EKOA 2IVWA 1WGSA 1K9MC 1WJRA 1WJSA 4M7DB 4X9DA 3L2UA 3LWHA 1Y96A 3JCMe 1KHIA 2HBPA 2K3YA 5L8RE 5GAMd 3F70A 4N4HA 2R57A 3HPWA 3OMCA 4EDUA 4FSXA 4E7IA 2VXEA 4JRIA 2PUKB 4M78E 3CCUT 2HQEA 3MP1A 3OW2S 3LYIA 5FU6C 4A53A 3PIPA 3HFNA 3QYGB 1QP2A 4M7DA 5GMKm 3PFSA 1Y96B 3E9GA 2WACA 2E10A 4FM4B 1PSFA 2LNVA 2DZCA 4J6XA 5I2SA 3DLLA 2BIVA 3LGLA 4C5HA 2K2VA 1LNXA 3HRTA 4XU0A 4BY6C 5M9OA 1BI3A 4IUVA 4M78F 4XU3A 1VQ6T 4PJOC 2KY9A 3CC7A 4MMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H64 1;  5LJ5 h;  1WNL A;  5GAN 2;  1I5L A;  2RD1 A;  3RKY A;  4EMG A;  4QVD A;  3FIF A;  1MGQ A;  5GMK e;  4M78 D;  4NL2 A;  4EMK B;  2Y90 A;  5LJ5 e;  2CGH A;  5GAN 5;  5GAO n;  3RER A;  4EMK C;  4F7U A;  3JCM P;  1I4K 1;  4M78 G;  4X9C A;  5GMK i;  5LJ5 g;  4M77 B;  4M7A E;  4PNO A;  4A54 A;  3PGG A;  4M77 C;  1B34 A;  1YCY A;  1I81 A;  4XTX A;  5LJ5 f;  1M8V A;  3JCM W;  1WQ7 A;  4C92 B;  4C8Q G;  3JCM X;  2DXU A;  5GAM j;  3RES A;  2DKG A;  2EJG A;  3SWN B;  4C92 C;  2EAY A;  3JB9 I;  4M75 E;  2DXT A;  4NOY A;  4C8Q E;  1U1T A;  3BY7 A;  4F7U B;  4WF2 A;  4XTU A;  3V7S A;  5LJ5 d;  3JCM b;  3FJP A;  4M7A F;  4M7D E;  4V2S A;  4RCC A;  3L2Z A;  5GMK j;  3FB9 A;  4RCB A;  3V7R A;  4XTY A;  1HK9 A;  4XU1 A;  4J6Y A;  2DTO A;  3RKX A;  5CAI A;  4C92 A;  4M7A D;  2FB7 A;  2EJ9 A;  3JB9 J;  1WQW A;  1BIA A;  4M75 F;  3SWN A;  4M7A G;  4C8Q F;  4HT8 A;  3QUI A;  4M7D F;  3BDU A;  4M78 A;  3HFO A;  3V8K A;  5GAN h;  5GAO p;  3RKW A;  4XTW A;  4EMH A;  5GAN 7;  2I2L A;  1LJO A;  2ZGW A;  1LOJ A;  2VC8 A;  4M75 D;  4C8Q D;  5GAN e;  5LJ3 h;  4M7D D;  4PJO E;  1BIB A;  4M75 G;  4XTV A;  5GAN g;  2E64 A;  4N0A A;  4M7D G;  5GAO l;  2E41 A;  5GAN f;  5LJ3 e;  2EJF A;  3SWN C;  2VXF A;  1JBM A;  3QO3 A;  4M78 B;  5LJ3 g;  5GAN 6;  4M78 C;  5LJ3 f;  5GAM g;  4NL3 A;  4HA8 A;  3L1A A;  3JCM V;  1X01 A;  4JRK A;  2RA2 A;  1N9R A;  3JCM h;  4PJO F;  3V7C A;  4M77 E;  4DQ2 A;  4MML A;  5LJ5 j;  5GAN d;  1KQ2 A;  4JLI A;  2DTH A;  3AHU A;  5I21 A;  3RUX A;  4N0A C;  4M7A A;  4C92 E;  2DZ9 A;  5LJ3 d;  1N9S A;  3V8J A;  4PJO D;  2K57 A;  3JCM g;  2YLB A;  3HSB A;  1KQ1 A;  3JCM f;  3JB9 F;  4PJO G;  4OP0 A;  1U1S A;  3QHS A;  4F7U E;  4J5Y A;  5GAO r;  2QTX A;  2JN0 A;  4M77 F;  4XU2 A;  3JCM J;  1HXD A;  4M75 A;  4C8Q A;  3JCM Q;  3JCM c;  5GAM h;  5GAO m;  3INZ A;  4M7D A;  4C92 F;  4M7A B;  3RIR A;  2EWN A;  4J6W A;  5GMK l;  3JCM d;  1I8F A;  1D3B A;  2HNI A;  4M77 D;  3SB2 A;  3JB9 G;  4Y91 A;  4M7A C;  5GAM e;  4M77 G;  2DTI A;  4F7U F;  2DVE A;  4C92 D;  3GIB A;  5GMK h;  2RB6 A;  5GAM f;  2DJZ A;  5DY9 A;  5GAN 3;  4C92 G;  4M75 B;  2FYK A;  4C8Q B;  1TH7 A;  3EFR A;  2YHT A;  4M75 C;  4M7D B;  2E1H A;  4X9D A;  4C8Q C;  4M7D C;  1Y96 A;  1D3B B;  3JCM e;  5GAN j;  4F7U G;  4XQ3 A;  3M4G A;  4JUV A;  5GAM d;  4XTZ A;  4PJO A;  3EFS A;  1JRI A;  2VXE A;  4JRI A;  3BW1 A;  4M78 E;  5LJ3 j;  1M5Q 1;  2E65 A;  3BFM A;  3VU3 C;  4QVC A;  5GAN 4;  4HT9 A;  4A53 A;  3HFN A;  3QSU A;  5GMK m;  3JB9 D;  1Y96 B;  4J6X A;  2E10 A;  2DEQ A;  4EMK A;  5GAN 8;  2DZC A;  2RM4 A;  4XU0 A;  1B34 B;  1LNX A;  4M77 A;  4PJO B;  4PJO C;  4XU3 A;  4M78 F;  2YLC A;  3V8L A;  5GAO q;  3JB9 H;  1WPY A;  4MMK A; 
#chains in the Genus database with same CATH topology
 5LJ5 h;  1OI1 A;  2QQA A;  3NTH A;  1VQ4 T;  1N8R R;  4FIB A;  3PGG A;  1O75 A;  1I81 A;  1VYV A;  4E6R A;  1YP5 A;  1IZ6 A;  1YJ9 A;  2XK0 A;  1TUC A;  1S72 A;  2LCS A;  3CCQ T;  3I55 A;  1VQM Q;  4DOV A;  4FT2 A;  1QKX A;  1G83 A;  4DOW A;  2EQI A;  4PLL A;  1Q7Y U;  1KG1 A;  1X75 C;  1VQ7 A;  4EIK A;  3CCJ T;  1W2B S;  2V26 A;  4OML A;  3ZEH A;  4QQ6 A;  2C0T A;  2PTK A;  4DBR A;  1QWE A;  1UE9 A;  2EJF A;  3CMA A;  3CCV A;  1N9R A;  3JCM h;  3CME Q;  2C06 A;  1S1N A;  1N9S A;  2O2O A;  2FZC B;  4Z88 A;  2XMF A;  2QAZ A;  1QCO A;  2F2X A;  5A0G A;  2YT6 A;  3OYD A;  3CCS A;  2RQT A;  1ABQ A;  3CC4 Q;  4ELY C;  1K9M U;  1UFF A;  3X28 B;  1G5V A;  5KYU A;  1N8R C;  3CD6 A;  3EG9 B;  2BKD N;  2FYK A;  1ZSZ B;  4M75 C;  3HKS A;  2CRE A;  5CCA A;  2CZ7 B;  2OAW A;  3Q1J A;  3NHN A;  1UDL A;  3CCE Q;  2A28 A;  2CSQ A;  3ZL7 C;  2IIM A;  4LNP A;  4PJN A;  3E19 A;  4EMK A;  1BI0 A;  5GAN 8;  1RAG B;  2E5K A;  1JXO A;  2KEA A;  2H3J A;  4Y92 A;  1MMA A;  3O5Z A;  2F5K A;  2KAF A;  4J9C A;  5C0M A;  2NUT B;  5HCK A;  2KYB A;  2KVQ G;  2Y90 A;  3MP8 A;  5CKE A;  2ZPE B;  2HBW A;  5LJ5 g;  3OYJ A;  2AT1 B;  2MYS A;  3OYH A;  2RH2 A;  2M0O A;  1RAF B;  5LJ5 d;  1QVG P;  4GY5 A;  3FB9 A;  2LX9 A;  2K7A A;  4ESR A;  5IH2 A;  3M0Q A;  1YWP A;  3X20 B;  4EPC A;  2HAX A;  3CC2 A;  4M7A G;  2BZ8 A;  2R5A A;  2VWF A;  3M0P A;  3H8Z A;  1Q95 G;  4LDU A;  9ATC B;  1Q86 U;  2DPP B;  1AOJ A;  2LQW A;  2WSC E;  2G6F X;  2QEX A;  5GJV B;  3CXC P;  2FVU A;  3ZFJ A;  3CCL A;  1RLQ C;  2COZ A;  4JJN K;  3WVD B;  4C92 E;  1GFD A;  3EHQ A;  3JCM g;  5HKC A;  2RK1 A;  5D7U A;  2AIR B;  2QTX A;  4PK4 A;  1OU8 A;  4XU2 A;  1RUW A;  1NPR A;  3VRZ A;  3M57 A;  5KYY B;  4C92 F;  4C0Z A;  5CR2 A;  2MMP A;  4Q5W A;  3JCM d;  4Y28 E;  3CBO A;  3X25 B;  3P8B B;  5J26 A;  3GIB A;  2EGE A;  4J7F A;  4DBQ A;  3NGP A;  5GAN j;  4F7U G;  1ABO A;  4C5E A;  1ZUK A;  3OSS C;  4HT9 A;  3I5S A;  1X2K A;  3CCM T;  1PRL C;  1PWT A;  2ZPB B;  4AFZ C;  2DVJ A;  3N5B B;  1VQO T;  3OYG A;  3JAM E;  1B7T A;  1I0C A;  2LP5 A;  4D8D A;  1YWO A;  4CC2 A;  5LJ5 e;  1NE8 A;  4L59 A;  3M0R A;  1M2O A;  2QGF B;  3LH5 A;  5HK0 A;  5LJ5 f;  1YCY A;  1K8A U;  3A8G B;  4GLK A;  3VS2 A;  3EG3 A;  2XI9 A;  1YFN A;  4ZTF A;  2JTM A;  3QG1 A;  1YN8 A;  1MMD A;  5KE2 A;  1DJ7 B;  1E7O A;  2EW3 A;  3FJP A;  1YI2 A;  2E4H A;  4HVV A;  1Q82 R;  4RCB A;  3V7R A;  1KSW A;  1YJ9 Q;  5CAI A;  2QG9 B;  1S72 Q;  3I55 Q;  2R5M A;  5GAO p;  2YDL A;  3CCR A;  2JUF A;  3DB4 A;  1PHT A;  4C8Q D;  4A4H A;  2OTJ T;  1NZ9 A;  4J9H A;  2XDB A;  1XTD A;  5GAO l;  1VQ7 Q;  3DLM A;  3QWY A;  5GAM g;  2LRQ A;  2KXC A;  3U23 A;  1WXU A;  5KYN A;  2AKL A;  1A0N B;  2DL7 A;  1C6V X;  1OEB A;  4DEY A;  2H3E B;  3CMA Q;  3SHW A;  3CCV Q;  3JCM f;  2W0Z A;  2L3R A;  3LH0 A;  2QDY B;  5FRO A;  2GNC A;  3EAE A;  1HXD A;  1K1Z A;  3ER0 A;  4NS5 A;  5IHK A;  2B86 A;  2AZV A;  1M2V B;  3CCS Q;  2L3S A;  1YIJ T;  3QJ6 A;  5KYX B;  4C8Q B;  2IPO B;  3L2Q A;  2YHT A;  1ZSZ C;  2PNI A;  3G6E A;  1M4Z A;  2QI2 A;  2J6F A;  3VS6 A;  3CD6 Q;  3REB B;  5LJ3 j;  1R8O B;  1N8R U;  4HCB A;  3BFM A;  2DX1 A;  2Y4Y A;  4FT4 A;  3BDL A;  2EQK A;  2SRC A;  1MUZ A;  2RN8 A;  2KDS A;  2LCL A;  1RI9 A;  1VQP A;  2GQI A;  5I11 A;  2KGT A;  1UGS B;  3PTA A;  3C94 A;  4BI8 B;  2CUD A;  1WNL A;  2A08 A;  1I5L A;  2NYS A;  4PKC C;  2QTV A;  1VA7 A;  3M55 A;  4O6J A;  5LL6 S;  2RJE A;  1V76 A;  2YSQ A;  2YUP A;  2OTL T;  1X6O A;  1VQN T;  1B07 A;  3FJ5 A;  5GAM j;  4LD9 K;  3QBY A;  1WXB A;  3JCM b;  1CKA A;  8ATC B;  3FRN A;  1TTH B;  3CPW A;  1VQ6 A;  1JJ2 P;  2DTO A;  4M7A D;  4ME7 A;  1UUE A;  1OU9 A;  4ANJ A;  2MIO A;  4HT8 A;  3QUI A;  2O01 E;  1ZSG A;  4AFQ C;  3NTI A;  4DA4 A;  1Q7Y C;  2I2L A;  1LOJ A;  4J9B A;  2E41 A;  3CC2 Q;  3UWN A;  2O88 A;  3UAT A;  3CCQ A;  2KQW A;  4DEX A;  2PUO B;  4OVA A;  2O4X B;  2EYY A;  1GCP A;  3A98 A;  3L1A A;  3VS5 A;  5KE3 A;  4DQ2 A;  4MML A;  3MCA B;  2J06 A;  3RUX A;  1ZLM A;  2QEX Q;  1MNE A;  1RAI B;  4MDW A;  3V8J A;  3CCJ A;  3HSB A;  1KQ1 A;  2ZAE A;  3CCL Q;  4LDY A;  4LN2 A;  3UF4 A;  2O9V A;  1XJW B;  2DXB A;  2JXB A;  2NUZ A;  3I56 Q;  1UB4 A;  2QXF A;  4M7D A;  4M7A B;  3JB9 G;  2CT3 A;  4M77 G;  3RDV A;  3GPL A;  1BCM A;  4RG8 A;  1K9M C;  2QAS A;  4KH1 B;  3BE3 A;  1W2B P;  4E7I A;  3OMC A;  3MJX A;  4JRI A;  3CCU T;  3MP1 A;  2JS2 A;  3OW2 S;  3LYI A;  4A53 A;  7AT1 B;  3QYG B;  1Y96 B;  2E10 A;  3MKD A;  1PD1 A;  1PSF A;  5I2S A;  5M9O A;  1LNX A;  1BI3 A;  4IUV A;  4XU3 A;  1WYX A;  2F1L A;  2MWP A;  4KGZ B;  1O9S A;  5GMK e;  5GAN 5;  3C0C A;  4M78 G;  4X9C A;  5CKB A;  4PNO A;  2GQV A;  4XTX A;  1FWZ A;  2CYZ B;  2RQR A;  3RBB B;  1SSF A;  3PMT A;  1VIF A;  4F7U B;  3G4S T;  3SDZ A;  2DA9 A;  1VQK T;  2HKN A;  3M0U A;  1IHV A;  4J9E A;  2GF7 A;  3SWN A;  1YI2 Q;  1GBR A;  2LT4 A;  4XTW A;  3EG2 A;  4AFU C;  1VIE A;  5FW9 A;  3P8D A;  1VYU A;  2KBT A;  4A4K A;  2M02 A;  1Q86 C;  2EYW A;  5GAN 6;  3CCR Q;  4HA8 A;  2NLU A;  1QKW A;  3PT9 A;  1NJI R;  2MWO A;  4BB7 A;  3OB9 A;  1YHQ A;  1YIT Q;  4RTW A;  4E7H A;  1ZUU A;  3QDF A;  3VS1 A;  2XDD A;  3EG0 A;  5CK9 A;  1U1S A;  1V1C A;  4PFZ A;  5KH6 A;  2CZ6 B;  2KMT A;  2HD0 A;  2LCC A;  1I8F A;  5CO7 A;  1TS9 A;  3EFO A;  1XQH A;  1I1J A;  1KQS S;  1LCK A;  3CC7 T;  3MEU A;  1VQ9 T;  2LJ0 A;  4C0G A;  1TH7 A;  3UDC A;  4C8Q C;  4HKE A;  2XKO C;  2KR3 A;  1MMN A;  2O9S A;  5HK3 A;  2CP0 A;  4E7S A;  3EFS A;  4IUR A;  2L3P A;  4JJB A;  3EGD B;  2FZK B;  3EGX B;  2GGR A;  1OUL A;  5I2M A;  3G6E Q;  2CZ0 B;  2RI2 A;  2HL3 A;  2CS7 A;  1M8V A;  2V1R A;  1Y57 A;  1PD0 A;  1Q82 U;  4A63 B;  2FL7 A;  1VQP Q;  2P4T A;  2LMJ A;  2BZY A;  2DL4 A;  4E7K A;  2ROL A;  4JLG A;  3RR6 A;  2IG0 A;  2DXU A;  4RUG A;  5FRN A;  4JS5 A;  3J80 E;  1T3L A;  3CCM A;  3JB9 I;  1N27 A;  4NOY A;  4M7D E;  1K8A C;  5CKF A;  2DBM A;  3RKX A;  1VQO A;  1NEB A;  4C92 A;  2E6Z A;  1QVP A;  3MEA A;  1M3B A;  4IIM A;  1UTI A;  2X51 A;  1NG2 A;  4JDS A;  5GAN h;  4M7D F;  1WJQ A;  1UGP B;  1AT1 B;  5GAN 7;  1VQ6 Q;  1ACM B;  3GNF B;  2ZPG B;  1WHL A;  2XHC A;  1QVG A;  3PE0 A;  1J3T A;  1JBM A;  4E2F B;  1VQ4 Q;  3OS5 A;  1YJN T;  2HQH A;  1X6G A;  3UPU A;  4F16 A;  1KQ2 A;  2DRM A;  3O8V A;  1ZA1 B;  3CPF A;  4KH0 B;  4PJM A;  3CCQ Q;  5IXF A;  1VQ5 T;  4OMO A;  3J81 E;  3JCM Q;  2OTJ A;  3INZ A;  4OB3 B;  2DF6 A;  4M7A C;  4M77 D;  3CCJ Q;  3OYI A;  4KRT A;  4HVU A;  1Q81 R;  2PZ1 A;  3HL8 A;  4C92 G;  2WSE E;  3MET A;  4MDX A;  1GFC A;  4LDW A;  3H41 A;  4LUD A;  3HRU A;  4PJO A;  1G3S A;  3CEY A;  2H8H A;  4CC3 A;  4FCY A;  1TOV A;  4RTY A;  5FU6 B;  1P92 A;  1QQJ A;  3OA6 A;  1I5O B;  3I5R A;  4KGV B;  2LJ1 A;  5J39 A;  2DEQ A;  1M90 R;  2X4W A;  2RK2 A;  5CVI A;  2RF0 A;  1YIJ A;  1WFW A;  2RD1 A;  3RKY A;  1MGQ A;  4M78 D;  1BBZ A;  2CP7 A;  4M77 B;  5KYW A;  3G7Z A;  3M5A A;  2HZY A;  1W4S A;  2GBQ A;  1NYF A;  3RES A;  3LWI A;  4HVW A;  2EAY A;  2K3B A;  3G1J A;  1U1T A;  3EG1 A;  1LPL A;  1PNJ A;  4PFP A;  4QQD A;  2KSS A;  4XTY A;  2C0O A;  2LDM A;  2CP3 A;  1KC8 R;  5IHI A;  2OTL A;  2HL5 C;  5LJ3 h;  1VQN A;  4CRI A;  4TVR A;  5GAN g;  5FU7 B;  1FMK A;  4QW2 A;  1UGQ B;  1FMW A;  2LT1 A;  4M78 B;  2E12 A;  4JRP A;  4NL3 A;  2GTJ A;  1AEY A;  3CQT A;  4Z02 A;  3OS0 A;  2RA2 A;  5J3B A;  5GAN d;  4JLI A;  1U5S A;  2HDA A;  3OSV A;  2DMO A;  4O5V A;  1YHQ T;  1M90 C;  4RG2 A;  1XOV A;  1UGV A;  4OGE A;  2M51 A;  4M75 A;  5GAM h;  3KXT A;  1YHQ Q;  1QP3 A;  1QCF A;  1D3B A;  2JZ2 A;  1D1C A;  2DL5 A;  1K73 R;  1PC0 A;  2LNH B;  2VUB A;  1RAB B;  3M59 A;  3EFR A;  4OMP A;  2AHJ B;  3PNW C;  1TG0 A;  2A0F B;  1BCO A;  3H6Z A;  1UEB A;  1W70 A;  1Z9Q A;  2A3L A;  4QKU A;  2YWW A;  4XTZ A;  1JRI A;  1M3A A;  2AZS A;  4KT0 E;  2ZPI B;  2EQU A;  4P5N A;  3JSC A;  2XD0 A;  2O31 A;  1UJY A;  3PVQ A;  1G3Y A;  2M16 A;  1NBE B;  5IN1 A;  2HCK A;  1ARK A;  4EMG A;  1UHC A;  4YTL A;  1RL2 A;  1M9S A;  4BE2 A;  2LQ8 A;  3JCM W;  2FO0 A;  2CH4 W;  4LD6 A;  3CCU A;  2K3X A;  4J8O A;  3JCM X;  3SWN B;  2JM9 A;  1K9A A;  1X2Q A;  4M4Z A;  4C5G A;  2DXC A;  3V7S A;  3PIO A;  1KHC A;  1N6A A;  1BKB A;  3VUB A;  4DBF A;  4XU1 A;  4LDV A;  4DBH A;  2VGN A;  2JW4 A;  3E9F A;  1HJD A;  2EJ9 A;  3CCM Q;  2MI6 A;  2J05 A;  1NJI U;  1K73 C;  1QVF S;  3OYN A;  3G71 T;  3GLX A;  2JTE A;  3HFO A;  2JTF A;  5GAN e;  3URG A;  1Y71 A;  1GCQ C;  4JJD A;  4PJO E;  4XTV A;  1VQO Q;  1ZX6 A;  4J9I A;  2KRS A;  3OW2 P;  5GAN f;  4BUG A;  3VJP A;  4C0F A;  4OB0 B;  5LJ3 g;  1FX7 A;  3G4S A;  1JJ2 A;  1M1F A;  1VQK A;  2KNB B;  2KYM A;  4PJO F;  3SEM A;  3OYE A;  4VUB A;  3EFO B;  5LJ3 d;  2RJC A;  2JMC A;  2MOX A;  2YLB A;  1IRX A;  1M30 A;  2X4Y A;  3H0I A;  5GAO r;  2FEI A;  5CIU A;  3VYH B;  4E7J A;  1PRM C;  3SB2 A;  2ZCF B;  1E6H A;  4RTZ A;  3SFM A;  1T0H A;  1WZO A;  4C92 D;  5A0D A;  2RB6 A;  3S6W A;  2EKO A;  2IVW A;  2L3Q A;  1WJR A;  3TSZ A;  2OTJ Q;  2JT4 A;  4X9D A;  2HEQ A;  3JCM e;  2SEM A;  2K3Y A;  5GAM d;  2KE9 A;  4N4H A;  4AMC A;  4EDU A;  4FSX A;  1OPK A;  2VXE A;  2VVK A;  2HQE A;  1KK7 A;  2FPD A;  5FU6 C;  4FYV B;  1CKB A;  4RTX A;  3PFS A;  5GMK m;  2WAC A;  2LNV A;  1KD1 R;  1FMV A;  2K2V A;  4XU0 A;  1SRL A;  4J9G A;  2KY9 A;  3CC7 A;  4MMK A;  2XU8 A;  1QMC A;  1VQ9 A;  1W2B A;  2K9G A;  3TSW A;  1G8X A;  4OB1 B;  3OMG A;  1HSQ A;  1WHM A;  5FWC A;  3OQ5 A;  2DD4 A;  3KFV A;  4MZP A;  4M77 C;  1Q82 C;  3JRZ A;  2M9U A;  1YIJ Q;  4C92 B;  1AVZ C;  3QDR B;  1BB9 A;  2V8I A;  4M75 E;  4XAX B;  2KT8 A;  1K4U S;  4RCC A;  4FW2 A;  4OMF B;  4JPB W;  2HMA A;  1KQS P;  2RI3 A;  1IGQ A;  3ULR B;  3CBM A;  2RHU A;  4M75 F;  3V8K A;  4FW1 A;  3M0T A;  3OS2 A;  4Z89 A;  2VYT A;  4OGC A;  1M1K R;  1WDX A;  2E3I A;  5FU7 C;  5LJ3 e;  1QVG S;  1MV0 B;  2JM8 A;  2K6D A;  3OYB A;  4BI3 A;  4M78 C;  5LJ3 f;  4OMQ A;  2OTL Q;  1EX4 A;  1VQN Q;  1M3C A;  1ZBX A;  1KD1 C;  4N0A C;  3FDR A;  4ZN1 A;  4GBQ A;  1PCX A;  2L2P A;  2D1X A;  2M1H A;  3AT1 B;  3EG9 A;  2DK3 A;  2RPN A;  3RNJ A;  3JV3 A;  1ZSZ A;  3RIR A;  4B9X A;  4Y91 A;  5GAM e;  1WHH A;  2BE9 B;  1M90 U;  1YJN A;  5GAM f;  1R0C B;  2DJZ A;  2GTO A;  1WHK A;  4CC7 A;  1U3O A;  1NPP A;  1ZUY A;  4XK8 E;  5KYU B;  1VQM A;  3M4G A;  4BDZ A;  2LX7 A;  2DIQ A;  2D8J A;  1VQ5 A;  3VU3 C;  4QVC A;  1GBQ A;  2KRM A;  4A4E A;  2NUT A;  1SKU B;  3QSU A;  4ZNX A;  1YJW T;  4X1V A;  2BUD A;  1PKS A;  2JNG A;  2YLC A;  4AFS C;  1WPY A;  2FPF A;  1X27 A;  2D9T A;  4BAC A;  5CQX A;  4EMK B;  5GAO n;  3UA6 A;  1U8R A;  2DE0 X;  3CME A;  1IGU A;  1KC8 U;  4CI0 C;  2J6K A;  2GFA A;  2A36 A;  1ZBJ A;  1UEC A;  5GMK j;  2A7Y A;  1HK9 A;  3CCU Q;  2ECZ A;  2QQ9 A;  2EQJ A;  3OBW A;  2RQV A;  2XG8 D;  4EMH A;  3P8H A;  3FEO A;  2K4Y A;  1C1A A;  1EZZ B;  3R6O A;  4M7D G;  3VV0 A;  2RJF A;  2NUP A;  2FZG B;  1PM3 A;  3QO3 A;  4ZGD B;  2D6F A;  3T9N A;  3JCM V;  1K73 U;  2C0I A;  3NMZ C;  3NTK A;  1RAH B;  4HCK A;  3OYM A;  1NM7 A;  5KYY A;  3A8M B;  5I21 A;  4E7Z A;  3X24 B;  4PFO A;  4KBM B;  1X43 A;  3G4S Q;  1VQK Q;  1SRM A;  2HKQ B;  3HRS A;  2VKN A;  2X3X D;  2LC4 A;  4ELZ C;  1AWW A;  2ZZD A;  3JCM c;  4OB2 B;  3C12 A;  2WSF E;  2E3H A;  4AG2 C;  4OMN A;  3UA7 A;  3OS1 A;  3L42 A;  3M56 A;  2LQN A;  2PU9 B;  3QYH B;  5GAN 3;  4IKF A;  1FXX A;  1MMG A;  4OMM A;  3ZBD A;  4XQ3 A;  4BE0 A;  1HYO A;  2E65 A;  1WX6 A;  4ZGJ B;  1KFZ A;  2YUN A;  2XID A;  3TQ7 P;  3M53 A;  1ZA2 B;  3A5Z B;  1RLP C;  4WTO B;  1VQ8 T;  2HSP A;  1Y0M A;  3KBG A;  4LDX A;  5GJW B;  1IB8 A;  3JCM P;  1IRE B;  1RI0 A;  1WHG A;  2DM1 A;  1B34 A;  2DIG A;  3CC7 Q;  3RMS A;  2L89 A;  1VQ9 Q;  4IIO A;  4C92 C;  2K5F A;  1JXM A;  3DB3 A;  5ECA A;  2ED0 A;  5IHN A;  4L6V 5;  3OYL A;  2NWM A;  1H8K A;  3KUF A;  4JRQ A;  3QJY A;  2JOY A;  4RMO A;  2EFI A;  1OOT A;  2A37 A;  4JS4 A;  4J83 A;  1AWX A;  3MP6 A;  2QA4 T;  3J7A F;  4HCZ A;  1G3T A;  1NJI C;  2EKH A;  1YBY A;  5IT9 E;  1IO6 A;  3H9N A;  1VQL T;  2DEU A;  2OAU A;  2OX7 A;  1T3S A;  2RO0 A;  1QWF A;  4F14 A;  2DRK A;  2QYZ A;  1M2V A;  3G71 A;  1SHF A;  2CSI A;  4ATO A;  5KCH A;  5KYX A;  1RAA B;  4C8Q A;  2ED1 A;  3H0H A;  1KIK A;  5CKD A;  1R0B G;  2P4R A;  1TUG B;  1KD1 U;  2DTI A;  5DY9 A;  3LX7 A;  3E1S A;  3QXE B;  2E1H A;  2RQW A;  3L2V A;  1VQM T;  1UJ0 A;  4IUQ A;  1SF9 A;  4JUV A;  1YCS B;  2KRO A;  1QVF P;  2FHD A;  1YJN Q;  1TWB A;  1R77 A;  2HQX A;  1M5Q 1;  2P0P A;  1OYX A;  4GLM A;  1ZQ1 A;  3CXC A;  1E6G A;  5DLO A;  3JB9 D;  1SG5 A;  3SD4 A;  3QZ5 B;  2E70 A;  3PVL A;  1VQ5 Q;  3ME9 A;  4OF1 A;  3OY9 A;  1WIE A;  1D0Z A;  2EQM A;  2J6O A;  2CGH A;  3QWX X;  4AT1 B;  4EMK C;  2HSE B;  5I22 A;  5EG2 A;  2DIL A;  3TVT A;  2QQR A;  4A54 A;  5CKH A;  3CME T;  1D0X A;  4C8Q G;  1WA7 A;  4RKU E;  2EJG A;  2MK5 A;  1B3Q A;  3THK A;  1M1K U;  1AHJ B;  4XTU A;  1GXI E;  1JB0 E;  2EIF A;  2MF2 A;  3CC4 T;  3L2R A;  4RTT A;  2GFU A;  2BE7 D;  1AZG B;  2QGG A;  3JB9 J;  5FRM A;  1CSK A;  4PJJ A;  5AYF A;  2O4X A;  3RKW A;  2YRV A;  3OBY A;  2VC8 A;  2MAM A;  4M7D D;  2JS0 A;  1XNI A;  2E64 A;  3VS3 A;  3VYG A;  1OZ3 A;  3QZ9 B;  4QT7 A;  5L23 A;  3CCE T;  2K79 A;  4FYW B;  1UHF A;  3CPW S;  4M7A A;  3OYY A;  5CQY A;  1PG5 B;  3S3N A;  2COY A;  4PJO G;  3DKM A;  5IAY A;  1Q81 C;  3OW2 A;  3OYF A;  3JCM J;  4HCC A;  2XIC A;  2EWN A;  4MZM A;  2HNI A;  1TUD A;  2KK4 A;  3EH1 A;  2DVE A;  1WGS A;  3VRY A;  4M7D B;  3LWH A;  1Y96 A;  4KGX B;  1KHI A;  2HBP A;  2KRN A;  2BZX A;  1JEG A;  2R57 A;  2PUK B;  4FYX B;  4RTV A;  1QP2 A;  2DZC A;  2F2W A;  3DLL A;  2ATC B;  2ABL A;  2VAS A;  1X69 A;  1GRI A;  1U06 A;  4JZ3 A;  4BI4 A;  2X3W D;  3REA B;  3TEE A;  4F7U A;  3LLR A;  2L0A A;  2LJ3 A;  2VV5 A;  2KXD A;  3C4S A;  1WQ7 A;  1QCN A;  3M9Q A;  3EHR A;  2DKG A;  4FSS A;  3MEW A;  1D1B A;  4BD3 A;  2D8H A;  1YJW A;  4C8Q E;  4R56 A;  3L2W A;  1KC8 C;  1Y07 A;  3OYC A;  3OYK A;  2QQB A;  1FYN A;  1OX9 A;  2EYX A;  3I56 A;  3MEV A;  3S3M A;  4L5G A;  3I9Q A;  2NUP B;  5IXB A;  4C8Q F;  1D0Y A;  3MHX A;  2BTT A;  4CC4 B;  5A2Q E;  4A4F A;  2P0K A;  2YXY A;  4D8K A;  4M75 G;  5DM7 R;  1JU5 C;  2DO3 A;  2B8A A;  2CKK A;  2PVO B;  1KQS A;  2D0Q B;  2MPX C;  1X01 A;  1W1F A;  5HY6 A;  5LJ5 j;  2COW A;  2DTH A;  2QDL A;  4J9D A;  3X26 B;  1SEM A;  2DZ9 A;  4AG1 C;  2K57 A;  4A4G A;  3QHS A;  2V1Q A;  1Y7X A;  1WXT A;  4K11 A;  2JN0 A;  1TXQ A;  2YUO A;  3VS7 A;  4ORZ A;  2YRD A;  4RTU A;  5GMK l;  4N4G A;  4E7L A;  1IHW A;  4BDY A;  3G71 Q;  1D09 B;  4JZ4 A;  5GMK h;  1V29 B;  3EGD A;  3NPF A;  2OJ2 A;  1WLP B;  2E5Q A;  3EGX A;  5A0L A;  2LQK A;  4ZGE B;  2RHY A;  3RMQ A;  2I0N A;  1TSF A;  3BW1 A;  1Z9Z A;  1YJ9 T;  1G3W A;  2KI7 A;  4KUL A;  2D0N A;  1S72 T;  2PVD B;  3I55 T;  4LXC A;  2FG0 A;  4BE1 A;  1JQQ A;  1B34 B;  2CP2 A;  2G3R A;  3C95 A;  4KUI A;  3MPU B;  5GAN 2;  2ZPF B;  1VQ7 T;  1OV3 A;  4NL2 A;  1MHN A;  3VS4 A;  2AKK A;  3A1P A;  4M7A E;  4LUE A;  1OPL A;  4C0D B;  1UG1 A;  1YIT A;  2L5Q A;  3EH2 A;  1M1G A;  3CMA T;  4MZT A;  2DXT A;  1EFN A;  3CCV T;  3BY7 A;  4M7A F;  3PMI A;  1VQ8 A;  3E2U A;  3HTR A;  1GCQ A;  4N4I A;  1SPK A;  3FC3 A;  3TCJ A;  3QKJ A;  2XDP A;  2LZ6 B;  1BU1 A;  3CCS T;  2DD5 A;  1LJO A;  2ZGW A;  2DER A;  1BI2 A;  2K2M A;  3TRE A;  4FL6 A;  2DNU A;  5FLX E;  3LGF A;  2ZPH B;  3A8L B;  1H92 A;  3CD6 T;  2LVM A;  1W6X A;  1Q7Y R;  1MND A;  1NLO C;  3ASK A;  3R6N A;  1K76 A;  1YNZ A;  2RI5 A;  8AT1 B;  3EGU A;  4PJO D;  3I35 A;  4F04 B;  4WCI A;  4B6M A;  4F7U E;  2DLP A;  3NFC A;  2QA4 A;  5GAO m;  2RHI A;  5KCO A;  2MCN A;  2RJD A;  1LVK A;  4J7I A;  1VQL A;  2EGA A;  4F7U F;  3VUZ A;  2RQU A;  2VB6 A;  1Q81 U;  1H3H A;  2P0Q A;  2DYI A;  4M7D C;  4D6W A;  1M27 C;  2DL3 A;  2EYQ A;  1K9M R;  4KUD K;  2EGC A;  3CXC S;  1M8M A;  3TU4 K;  3M4Y A;  1MV3 A;  1SHG A;  2RM4 A;  4BY6 B;  2DFU A;  5AT1 B;  2RMO A;  4M77 A;  4PJO B;  3IQL A;  3QPH A;  3V8L A;  5GAO q;  1JO8 A;  3GBQ A;  3JB9 H;  1IXD A;  1H64 1;  3WXM B;  2P84 A;  3CC2 T;  3UT1 A;  1AWJ A;  2RNA A;  4QVD A;  2QK0 A;  1PSE A;  3RER A;  2EYZ A;  1VQ4 A;  5GMK i;  2PVG B;  3GNG A;  5C6S A;  2DL8 A;  4ZTJ A;  4II1 A;  5FWB A;  1KJW A;  1AD5 A;  1GL5 A;  2FRW A;  2QEX T;  2ESW A;  2GCX A;  3HHT B;  3CCL T;  1BI1 A;  1BK2 A;  5KYW B;  4FU6 A;  1VYT A;  4IUU A;  1M1K C;  3I56 T;  2CH4 A;  1BIA A;  2RHX A;  1YJW Q;  4C5I A;  4M78 A;  3FLG A;  2DAQ A;  4J9F A;  4M75 D;  3MO8 A;  1RAE B;  4N0A A;  3OYA A;  3SWN C;  2VXF A;  1UGR B;  2X35 A;  2Z0W A;  3S3O A;  5EC7 A;  4JRK A;  3CBP A;  3V7C A;  4R55 A;  3CC4 A;  3AHU A;  2DJQ A;  2KT1 A;  4UC4 A;  3WVE B;  3HP9 A;  2PQW A;  1Q86 R;  2YUQ A;  4OP0 A;  4PLI A;  2CT4 A;  4J6W A;  5D6Y A;  3VS0 A;  2K5I A;  1AZE A;  3CCE A;  2M0Y A;  4M75 B;  1C0M A;  1NYG A;  1K0X A;  2V8K A;  2JJ9 A;  2RHZ A;  3H0F A;  4IUP A;  2E6N A;  1D3B B;  2X4J A;  5D6W A;  2W10 A;  3GF5 A;  2CP6 A;  2DYB A;  2F5T X;  4PL6 A;  3GP8 A;  2X9H A;  4FYY B;  4X34 A;  4JJC A;  6AT1 B;  5GAN 4;  2R58 A;  1VOM A;  1YI2 T;  1ZHI A;  1H3Z A;  4B9W A;  3GOX A;  4IUT A;  4F17 A;  1BYM A;  1T0J A;  1OQK A;  2DBK A;  1QVF A;  1AWO A;  2FPE A;  3FIF A;  3D7S B;  1EIF A;  3CPW P;  2F69 A;  2CZ1 B;  3LW5 E;  3CCR T;  1I4K 1;  1OZ2 A;  1I07 A;  3A8H B;  2OI3 A;  4C0D C;  2CP5 A;  2JVV A;  1NLP C;  1YIT T;  4V2S A;  4WF2 A;  2J7I A;  4Z8A A;  5D6X A;  1X6B A;  3L2Z A;  2JMA A;  2L8D A;  1WHJ A;  2EPD A;  1PKT A;  4J6Y A;  3A8O B;  4HXJ A;  2FB7 A;  1D1A A;  1WQW A;  2F2V A;  2V8J A;  3VKI A;  2K5L A;  2EBP A;  3BDU A;  1K8A R;  1VQ8 Q;  2DET A;  3M54 A;  1BIB A;  1OX8 A;  1QW1 A;  1N5Z A;  1RAD B;  2FRY A;  2LTO A;  4E47 A;  1HD3 A;  1NEG A;  4QVZ A;  4M77 E;  1VUB A;  2CUB A;  3QII A;  1TU0 B;  2ENM A;  2EVR A;  3G6E T;  2YRC A;  3JB9 F;  5DLQ E;  3M0S A;  1RAC B;  4J5Y A;  4M77 F;  4QQG A;  2CDT A;  2Y4X A;  1VQP T;  2QQS A;  2VGM A;  3M58 A;  2X4X A;  4ZN3 A;  1SSH A;  2ROT A;  1K0S A;  1JJ2 S;  2QA4 Q;  1WJS A;  3L2U A;  4PJL A;  1VQL Q;  5L8R E;  3F70 A;  3HPW A;  4R0K A;  4M78 E;  4LE9 A;  1F1B B;  1WI7 A;  3PIP A;  1QLY A;  3HFN A;  2AK5 A;  4J6X A;  3E9G A;  4FM4 B;  2BIV A;  3LGL A;  4C5H A;  3HRT A;  4BY6 C;  1G2B A;  4PJO C;  1VQ6 T;  4M78 F; 
#chains in the Genus database with same CATH homology
 2MWP A;  2XU8 A;  5LJ5 h;  1OI1 A;  1VQ9 A;  2QQA A;  1O9S A;  4BI4 A;  1W2B A;  3TEE A;  5GMK e;  5GAN 5;  4OB1 B;  3OMG A;  3NTH A;  4F7U A;  1VQ4 T;  4M78 G;  3LLR A;  4X9C A;  3OQ5 A;  2DD4 A;  5CKB A;  4FIB A;  4MZP A;  4PNO A;  2GQV A;  3PGG A;  4M77 C;  1Q82 C;  1O75 A;  1I81 A;  1FWZ A;  2CYZ B;  3JRZ A;  2M9U A;  2VV5 A;  4XTX A;  3C4S A;  1IZ6 A;  1WQ7 A;  4C92 B;  3M9Q A;  1YJ9 A;  2XK0 A;  2DKG A;  3MEW A;  3QDR B;  1SSF A;  2V8I A;  1S72 A;  4M75 E;  3PMT A;  4BD3 A;  3CCQ T;  1YJW A;  1VIF A;  4C8Q E;  4XAX B;  3SDZ A;  4F7U B;  4R56 A;  3I55 A;  3G4S T;  1VQK T;  4DOV A;  4FT2 A;  4RCC A;  3L2W A;  4OMF B;  1Y07 A;  3OYC A;  1KC8 C;  3OYK A;  2QQB A;  2RI3 A;  4DOW A;  4PLL A;  1Q7Y U;  3I56 A;  1KG1 A;  3MEV A;  1X75 C;  3S3M A;  3CBM A;  4L5G A;  2GF7 A;  2RHU A;  3SWN A;  4M75 F;  1VQ7 A;  4C8Q F;  3CCJ T;  1W2B S;  3V8K A;  3MHX A;  3OS2 A;  2LT4 A;  4XTW A;  5A2Q E;  4A4F A;  3ZEH A;  1VIE A;  2P0K A;  2VYT A;  4OGC A;  4QQ6 A;  4M75 G;  3P8D A;  5DM7 R;  5FU7 C;  2DO3 A;  2B8A A;  2CKK A;  5LJ3 e;  2EJF A;  4A4K A;  1QVG S;  2PVO B;  1KQS A;  3CMA A;  2D0Q B;  1Q86 C;  3CCV A;  5GAN 6;  3OYB A;  4BI3 A;  4M78 C;  5LJ3 f;  4HA8 A;  2NLU A;  5HY6 A;  1X01 A;  1N9R A;  3JCM h;  5LJ5 j;  2C06 A;  2DTH A;  3PT9 A;  3X26 B;  1ZBX A;  2MWO A;  3OB9 A;  4BB7 A;  1YHQ A;  4N0A C;  1KD1 C;  2DZ9 A;  3FDR A;  4ZN1 A;  1N9S A;  4E7H A;  2K57 A;  4A4G A;  2XDD A;  2M1H A;  5CK9 A;  1U1S A;  3QHS A;  5A0G A;  3OYD A;  1Y7X A;  3CCS A;  2JN0 A;  5KH6 A;  2DK3 A;  2CZ6 B;  2KMT A;  4ELY C;  2HD0 A;  2LCC A;  1K9M U;  3RIR A;  3X28 B;  1G5V A;  5GMK l;  1I8F A;  5CO7 A;  4B9X A;  4N4G A;  4Y91 A;  4E7L A;  1N8R C;  1XQH A;  5GAM e;  4BDY A;  1KQS S;  1M90 U;  1YJN A;  3CC7 T;  3CD6 A;  5GMK h;  3MEU A;  5GAM f;  1V29 B;  2DJZ A;  1VQ9 T;  2BKD N;  2FYK A;  4C0G A;  1TH7 A;  4M75 C;  2E5Q A;  5A0L A;  3HKS A;  3UDC A;  2LQK A;  1NPP A;  4HKE A;  4C8Q C;  2XKO C;  4XK8 E;  1VQM A;  3M4G A;  4BDZ A;  4ZGE B;  5CCA A;  2RHY A;  5HK3 A;  2CZ7 B;  3Q1J A;  2DIQ A;  3EFS A;  3RMQ A;  1VQ5 A;  3BW1 A;  4IUR A;  3VU3 C;  4QVC A;  1YJ9 T;  1G3W A;  4KUL A;  4A4E A;  1S72 T;  3QSU A;  2PVD B;  1YJW T;  3I55 T;  3E19 A;  4EMK A;  1BI0 A;  5I2M A;  5GAN 8;  4BE1 A;  1B34 B;  2BUD A;  2CZ0 B;  2RI2 A;  2G3R A;  2JNG A;  2H3J A;  2YLC A;  3C95 A;  2CS7 A;  1M8V A;  1WPY A;  4KUI A;  2F5K A;  2KAF A;  5GAN 2;  1Q82 U;  2ZPF B;  5C0M A;  1VQ7 T;  2D9T A;  2FL7 A;  4BAC A;  2KVQ G;  4NL2 A;  5CQX A;  1MHN A;  2Y90 A;  2P4T A;  4EMK B;  5GAO n;  3MP8 A;  5CKE A;  2ZPE B;  5LJ5 g;  4M7A E;  3OYJ A;  3OYH A;  4E7K A;  4C0D B;  1U8R A;  4JLG A;  3CME A;  2RH2 A;  2IG0 A;  2DXU A;  1KC8 U;  5FRN A;  4JS5 A;  2M0O A;  3J80 E;  1YIT A;  2L5Q A;  3CCM A;  1M1G A;  3JB9 I;  4CI0 C;  3CMA T;  4MZT A;  1N27 A;  2GFA A;  2DXT A;  4NOY A;  3CCV T;  3BY7 A;  5LJ5 d;  4M7D E;  1K8A C;  4M7A F;  3PMI A;  4GY5 A;  5CKF A;  1VQ8 A;  5GMK j;  3FB9 A;  2LX9 A;  2A7Y A;  1HK9 A;  2QQ9 A;  4N4I A;  3RKX A;  4C92 A;  1VQO A;  3FC3 A;  3X20 B;  2E6Z A;  3TCJ A;  1QVP A;  2EQJ A;  3QKJ A;  4EPC A;  2HAX A;  3CC2 A;  3MEA A;  4M7A G;  3OBW A;  2XDP A;  2R5A A;  4JDS A;  4M7D F;  5GAN h;  3H8Z A;  4LDU A;  1WJQ A;  1UGP B;  3CCS T;  2XG8 D;  4EMH A;  3P8H A;  2DD5 A;  2DPP B;  1LJO A;  2ZGW A;  3FEO A;  5GAN 7;  1Q86 U;  1BI2 A;  3TRE A;  2K4Y A;  3GNF B;  2ZPG B;  4FL6 A;  2XHC A;  1QVG A;  3R6O A;  4M7D G;  3VV0 A;  2RJF A;  2WSC E;  5FLX E;  1JBM A;  3LGF A;  2QEX A;  3QO3 A;  2D6F A;  4ZGD B;  2FVU A;  3T9N A;  2ZPH B;  3A8L B;  3ZFJ A;  3OS5 A;  1YJN T;  3CCL A;  3CD6 T;  2LVM A;  3UPU A;  3JCM V;  4JJN K;  1K73 U;  3ASK A;  3NTK A;  1KQ2 A;  3OYM A;  3WVD B;  3O8V A;  3A8M B;  5I21 A;  2RI5 A;  3CPF A;  3X24 B;  4C92 E;  4KBM B;  4PJO D;  3JCM g;  5HKC A;  1VQ5 T;  2RK1 A;  4F7U E;  3HRS A;  2QTX A;  4XU2 A;  3J81 E;  1NPR A;  3NFC A;  2LC4 A;  4ELZ C;  2QA4 A;  3M57 A;  2ZZD A;  3JCM Q;  3JCM c;  5GAO m;  2OTJ A;  2RHI A;  3INZ A;  4OB3 B;  4C92 F;  4C0Z A;  5CR2 A;  2MMP A;  4OB2 B;  4Q5W A;  3JCM d;  5KCO A;  4M77 D;  4M7A C;  2RJD A;  3C12 A;  3CBO A;  2WSF E;  4J7I A;  4Y28 E;  3OYI A;  3X25 B;  1VQL A;  4F7U F;  3P8B B;  5J26 A;  3GIB A;  3VUZ A;  3HL8 A;  4J7F A;  3OS1 A;  3L42 A;  3M56 A;  3QYH B;  2PU9 B;  4C92 G;  5GAN 3;  2WSE E;  3MET A;  4IKF A;  1FXX A;  4MDX A;  1Q81 U;  2P0Q A;  4LDW A;  4M7D C;  3ZBD A;  5GAN j;  4F7U G;  4C5E A;  4XQ3 A;  3HRU A;  4D6W A;  4PJO A;  1G3S A;  3CEY A;  4BE0 A;  2E65 A;  3OSS C;  2EYQ A;  4ZGJ B;  5FU6 B;  1P92 A;  4KUD K;  4HT9 A;  3OA6 A;  3CCM T;  2XID A;  3M53 A;  3CXC S;  5J39 A;  3A5Z B;  3TU4 K;  2DEQ A;  3M4Y A;  2RM4 A;  2X4W A;  4BY6 B;  1VQ8 T;  2RK2 A;  5CVI A;  4M77 A;  4PJO B;  3QPH A;  2ZPB B;  3V8L A;  5GAO q;  3N5B B;  3JB9 H;  3KBG A;  1VQO T;  3OYG A;  1H64 1;  1YIJ A;  4LDX A;  3JAM E;  3WXM B;  2RD1 A;  3CC2 T;  3RKY A;  3UT1 A;  4QVD A;  1MGQ A;  4M78 D;  5LJ5 e;  1PSE A;  1NE8 A;  4L59 A;  3RER A;  3JCM P;  1VQ4 A;  5GMK i;  2PVG B;  4M77 B;  1IRE B;  1RI0 A;  3GNG A;  5HK0 A;  5LJ5 f;  1B34 A;  1YCY A;  3G7Z A;  2DIG A;  3M5A A;  1W4S A;  5C6S A;  1K8A U;  3RMS A;  3A8G B;  4ZTJ A;  2L89 A;  4GLK A;  4II1 A;  3RES A;  4C92 C;  3LWI A;  2K5F A;  2XI9 A;  2EAY A;  2QEX T;  3DB3 A;  4ZTF A;  2GCX A;  2JTM A;  3QG1 A;  5KE2 A;  1U1T A;  1DJ7 B;  3HHT B;  3CCL T;  1BI1 A;  3FJP A;  1YI2 A;  4QQD A;  4RCB A;  4FU6 A;  3V7R A;  2KSS A;  4IUU A;  4L6V 5;  4XTY A;  3OYL A;  1M1K C;  3I56 T;  5CAI A;  1BIA A;  3KUF A;  2RHX A;  4JRQ A;  2R5M A;  3QJY A;  2JOY A;  4C5I A;  4M78 A;  5GAO p;  4RMO A;  3CCR A;  2EFI A;  2LDM A;  3FLG A;  2DAQ A;  2JUF A;  4JS4 A;  4M75 D;  4J83 A;  3MP6 A;  2OTL A;  3DB4 A;  4C8Q D;  5LJ3 h;  2QA4 T;  1VQN A;  3J7A F;  3MO8 A;  4HCZ A;  4A4H A;  2OTJ T;  4CRI A;  4TVR A;  1G3T A;  1NZ9 A;  5GAN g;  5FU7 B;  1NJI C;  4N0A A;  4QW2 A;  1XTD A;  5GAO l;  3OYA A;  1UGQ B;  2XDB A;  1YBY A;  2LT1 A;  3DLM A;  2VXF A;  3SWN C;  5IT9 E;  1VQL T;  1UGR B;  2OAU A;  4M78 B;  2X35 A;  2E12 A;  4JRP A;  5GAM g;  4NL3 A;  3S3O A;  2LRQ A;  4Z02 A;  4JRK A;  3CBP A;  2RA2 A;  5J3B A;  3OS0 A;  3V7C A;  2RO0 A;  5GAN d;  4R55 A;  3CC4 A;  4JLI A;  3AHU A;  3OSV A;  4O5V A;  1YHQ T;  4UC4 A;  1M90 C;  4RG2 A;  3WVE B;  3HP9 A;  1XOV A;  2PQW A;  3JCM f;  3G71 A;  4OP0 A;  2L3R A;  3LH0 A;  4PLI A;  2QDY B;  4OGE A;  5FRO A;  4ATO A;  5KCH A;  3EAE A;  1HXD A;  4M75 A;  3ER0 A;  4C8Q A;  4NS5 A;  5GAM h;  3KXT A;  1QP3 A;  4J6W A;  5CKD A;  1D3B A;  2JZ2 A;  5D6Y A;  1KD1 U;  2DTI A;  2K5I A;  2VUB A;  1YIJ T;  3CCE A;  3M59 A;  5DY9 A;  3LX7 A;  4M75 B;  3QJ6 A;  4C8Q B;  3EFR A;  3L2Q A;  2YHT A;  3E1S A;  3QXE B;  2E1H A;  2V8K A;  2RHZ A;  4IUP A;  2AHJ B;  2E6N A;  1D3B B;  3PNW C;  3L2V A;  2X4J A;  1VQM T;  1UEB A;  3H6Z A;  3GF5 A;  4IUQ A;  5D6W A;  3G6E A;  1M4Z A;  2QI2 A;  2F5T X;  2A3L A;  4JUV A;  4PL6 A;  4XTZ A;  3GP8 A;  2FHD A;  1JRI A;  4X34 A;  5LJ3 j;  1R8O B;  2HQX A;  1M5Q 1;  1N8R U;  3BFM A;  4HCB A;  2Y4Y A;  2P0P A;  5GAN 4;  4FT4 A;  3BDL A;  2EQK A;  1OYX A;  2R58 A;  1ZQ1 A;  2KDS A;  4KT0 E;  3CXC A;  2LCL A;  5DLO A;  3JB9 D;  2ZPI B;  2EQU A;  3SD4 A;  1VQP A;  1YI2 T;  3QZ5 B;  4P5N A;  1UGS B;  3JSC A;  2XD0 A;  2E70 A;  3PTA A;  1ZHI A;  1H3Z A;  1G3Y A;  3C94 A;  4BI8 B;  4B9W A;  3GOX A;  3ME9 A;  2M16 A;  4IUT A;  1WNL A;  4OF1 A;  5IN1 A;  3OY9 A;  1I5L A;  1BYM A;  4PKC C;  1QVF A;  4EMG A;  3FIF A;  2EQM A;  1EIF A;  3M55 A;  2CGH A;  2F69 A;  2CZ1 B;  3LW5 E;  2RJE A;  4O6J A;  1RL2 A;  4YTL A;  5LL6 S;  1I4K 1;  4EMK C;  5EG2 A;  1M9S A;  1OZ2 A;  3CCR T;  2QQR A;  4A54 A;  5CKH A;  2OTL T;  3A8H B;  4BE2 A;  1X6O A;  1VQN T;  2LQ8 A;  3CME T;  3JCM W;  4C0D C;  4LD6 A;  3CCU A;  2K3X A;  4J8O A;  4C8Q G;  3JCM X;  5GAM j;  4RKU E;  2EJG A;  3SWN B;  2JVV A;  1YIT T;  4LD9 K;  1M1K U;  3QBY A;  1AHJ B;  4C5G A;  3JCM b;  2DXC A;  4WF2 A;  4XTU A;  3V7S A;  4V2S A;  1GXI E;  3PIO A;  3FRN A;  1JB0 E;  1KHC A;  1N6A A;  2EIF A;  1BKB A;  2MF2 A;  3L2Z A;  5D6X A;  3VUB A;  2L8D A;  3CPW A;  4XU1 A;  3CC4 T;  4LDV A;  1VQ6 A;  3L2R A;  4J6Y A;  2DTO A;  2VGN A;  3A8O B;  3E9F A;  4M7A D;  2GFU A;  2FB7 A;  4ME7 A;  2EJ9 A;  3JB9 J;  1WQW A;  5FRM A;  2MI6 A;  1K73 C;  1QVF S;  2V8J A;  1NJI U;  4HT8 A;  3QUI A;  3VKI A;  2K5L A;  3OYN A;  3BDU A;  5AYF A;  3GLX A;  3HFO A;  2O01 E;  3G71 T;  2JTF A;  2O4X A;  3RKW A;  2YRV A;  3M54 A;  3NTI A;  3OBY A;  4DA4 A;  1Q7Y C;  2I2L A;  1LOJ A;  2MAM A;  2VC8 A;  5GAN e;  3URG A;  1Y71 A;  4M7D D;  4PJO E;  1BIB A;  4XTV A;  1QW1 A;  1XNI A;  2E64 A;  3VYG A;  1OZ3 A;  2E41 A;  2LTO A;  3QZ9 B;  4BUG A;  5GAN f;  3UWN A;  3VJP A;  4C0F A;  4OB0 B;  4E47 A;  5LJ3 g;  1FX7 A;  2KQW A;  3G4S A;  2PUO B;  4OVA A;  1M1F A;  2O4X B;  3CCQ A;  1JJ2 A;  1VQK A;  3CCE T;  3L1A A;  5KE3 A;  4PJO F;  4QVZ A;  4M77 E;  4DQ2 A;  1VUB A;  3MCA B;  3QII A;  4MML A;  3OYE A;  4VUB A;  3CPW S;  3RUX A;  4M7A A;  3OYY A;  5LJ3 d;  3G6E T;  5CQY A;  2RJC A;  3V8J A;  4MDW A;  3CCJ A;  2YLB A;  3S3N A;  3HSB A;  1KQ1 A;  3JB9 F;  5DLQ E;  4PJO G;  3DKM A;  5IAY A;  4LDY A;  1Q81 C;  3OW2 A;  3OYF A;  4J5Y A;  2X4Y A;  5GAO r;  4M77 F;  3JCM J;  4QQG A;  5CIU A;  2DXB A;  4HCC A;  1UB4 A;  2XIC A;  2QXF A;  2Y4X A;  1VQP T;  4M7A B;  3VYH B;  2EWN A;  2QQS A;  2VGM A;  4MZM A;  4E7J A;  3M58 A;  3SB2 A;  2HNI A;  2ZCF B;  3JB9 G;  2X4X A;  4ZN3 A;  2KK4 A;  4M77 G;  3SFM A;  3GPL A;  2DVE A;  4C92 D;  4RG8 A;  5A0D A;  1JJ2 S;  2RB6 A;  3S6W A;  2EKO A;  2IVW A;  1WGS A;  1K9M C;  1WJR A;  1WJS A;  4M7D B;  4X9D A;  3L2U A;  3LWH A;  1Y96 A;  3JCM e;  1KHI A;  2HBP A;  2K3Y A;  5L8R E;  5GAM d;  3F70 A;  4N4H A;  2R57 A;  3HPW A;  3OMC A;  4EDU A;  4FSX A;  4E7I A;  2VXE A;  4JRI A;  2PUK B;  4M78 E;  3CCU T;  2HQE A;  3MP1 A;  3OW2 S;  3LYI A;  5FU6 C;  4A53 A;  3PIP A;  3HFN A;  3QYG B;  1QP2 A;  4M7D A;  5GMK m;  3PFS A;  1Y96 B;  3E9G A;  2WAC A;  2E10 A;  4FM4 B;  1PSF A;  2LNV A;  2DZC A;  4J6X A;  5I2S A;  3DLL A;  2BIV A;  3LGL A;  4C5H A;  2K2V A;  1LNX A;  3HRT A;  4XU0 A;  4BY6 C;  5M9O A;  1BI3 A;  4IUV A;  4M78 F;  4XU3 A;  1VQ6 T;  4PJO C;  2KY9 A;  3CC7 A;  4MMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...