4M7DC

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 11
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dC00
3JCMc 3V8KA 4EMGA 1LNXA 4C8QD 4M7DE 4M78E 4JUVA 5GMKe 3HSBA 3L1AA 3VU3C 2EJFA 4M75B 5GANf 5GAN8 1M5Q1 5GAOq 4HT8A 4WF2A 4M75D 4C8QA 3HFOA 3JB9H 4PJOB 3JB9G 5GMKi 3QUIA 1JBMA 4PJOD 5GANg 5GAOp 4PNOA 1WNLA 5GANd 5GAN2 1H641 4M75A 3BFMA 4NOYA 2DJZA 3M4GA 4OP0A 5I21A 5LJ3j 4M78D 4F7UF 4MMLA 4M77C 4M7DD 2EAYA 2E10A 5LJ5j 4PJOA 2RB6A 2RA2A 1KQ1A 3EFRA 5LJ3f 1WPYA 2FYKA 4M78A 4M7DA 5GANe 5LJ5f 4XU1A 3JCMh 4C92E 3BDUA 4XTUA 3FIFA 3RKXA 3AHUA 2YLBA 2K57A 4M77F 3JCMb 4C8QB 4XTYA 4RCCA 1I81A 3RIRA 4EMKC 4C8QG 4M7AE 4C92B 4N0AA 5GAOn 3EFSA 4M75C 3SWNC 4XU0A 4X9DA 4C92D 5LJ3e 1TH7A 1N9SA 4JLIA 4M75G 5LJ5e 5GMKh 2VXEA 3GIBA 4PJOG 3V7SA 4C92A 4M7AB 4M7DB 4M78B 4MMKA 4XTXA 3RUXA 1KQ2A 4M7DG 4M7AD 4M78G 1D3BA 1WQ7A 2VXFA 2E65A 4F7UE 5GAMj 4JRIA 1N9RA 2YLCA 3RKWA 3JB9F 1U1SA 2DTOA 4M7AA 2EJ9A 4J6XA 2FB7A 1BIAA 5GMKm 2VC8A 2RD1A 5GAMf 1LJOA 2DXTA 4J6WA 4A54A 5LJ3g 4NL2A 5GANh 1I4K1 4XU2A 3V7RA 2E1HA 5LJ3d 4F7UB 5LJ5g 3L2ZA 4C8QC 5GAMg 5LJ5d 3V8LA 4M77E 3RKYA 2DTHA 5GAMd 1U1TA 2DTIA 5GAOm 4J6YA 4QVDA 1LOJA 3RESA 4C92G 4F7UA 4Y91A 2DXUA 1HXDA 2CGHA 1D3BB 4EMHA 4PJOC 3FB9A 4XU3A 2DVEA 5GAMe 3INZA 4M77B 5LJ3h 4C8QF 1I5LA 3BY7A 4M78C 4M7DC 4M7AC 3JB9I 1JRIA 3PGGA 4M77D 4A53A 5LJ5h 1MGQA 3JCMP 4M7AG 2DZ9A 2QTXA 1BIBA 4M75F 2Y90A 4M77A 4PJOF 3JCMX 5GAN5 1WQWA 2RM4A 3JB9J 4HA8A 4M7DF 1X01A 2JN0A 4M78F 4N0AC 3BW1A 4XTVA 4EMKB 3JCMf 2E41A 3JCMV 2DEQA 2E64A 4F7UG 3RERA 1B34B 3SWNB 5GAOl 5GANj 3JCMg 4V2SA 4RCBA 4C92C 4X9CA 2HNIA 3JB9D 4EMKA 3JCMd 4J5YA 5GAN3 3SB2A 1Y96B 5CAIA 5GAN7 3V7CA 5GMKj 5GAOr 1M8VA 2DKGA 3QSUA 4DQ2A 1B34A 2EJGA 2I2LA 3SWNA 3JCMJ 2DZCA 3JCMW 5GAN4 4M77G 3JCMe 1Y96A 4C8QE 3HFNA 5GAMh 2YHTA 4XQ3A 4C92F 5GAN6 4XTZA 3FJPA 1HK9A 5DY9A 3JCMQ 3V8JA 4M75E 1YCYA 4JRKA 1I8FA 3QO3A 5GMKl 2EWNA 4QVCA 4PJOE 4HT9A 4NL3A 3QHSA 4XTWA 2ZGWA 4M7AF
chains in the Genus database with same CATH superfamily
1D0ZA 1UDLA 2E6ZA 3M4YA 1I5OB 4A4FA 1D1AA 1XNIA 2EYXA 4PJOD 4PNOA 5L23A 2VB6A 2YUOA 5I21A 4MMLA 4FW2A 5LJ5j 4HXJA 1KQ1A 3UF4A 2BZ8A 2DYBA 1KC8R 3CD6Q 3OYAA 2BZYA 5LJ5f 3REBB 2W0ZA 4LN2A 1YP5A 4LXCA 2P0PA 2K3XA 4XU0A 1N9SA 2X51A 3M56A 3HHTB 1AOJA 2PTKA 1QQJA 1HD3A 4C92A 2NYSA 1WGSA 4JRPA 1KQ2A 4OB2B 5GAMj 2J6KA 2LQKA 2A28A 4BE2A 2RD1A 5GAMf 1YJWA 5FU7B 2MCNA 3CCEQ 5CQYA 2CREA 2DL8A 1Q95G 4M77E 3OYCA 2MPXC 2DBMA 1X43A 3M58A 4PJMA 3GOXA 1OX8A 3RESA 3E1SA 4RTVA 3GLXA 1R8OB 4XU3A 3RNJA 2EQKA 1LVKA 2HSEB 1ZSZB 2GTJA 2OJ2A 4M7AG 1JB0E 1PKSA 1QCFA 2DM1A 3JCMX 2FZCB 1QVPA 5HKCA 3DKMA 4HA8A 2JN0A 1Y7XA 1VQ6T 4J9DA 5C0MA 2JTEA 2D0NA 2M51A 4F7UG 2DA9A 2DMOA 2LRQA 4WCIA 1PM3A 2RF0A 2LX7A 1AWJA 4TVRA 2EJGA 4KRTA 3DLLA 3J80E 1X6OA 3I55A 2ROTA 1G5VA 4QQGA 1WXTA 1OU9A 4ZN1A 4PKCC 2CP2A 8ATCB 1G2BA 4HCZA 1X75C 2V8KA 5CVIA 2GF7A 1OPKA 2JW4A 1GFDA 4HT8A 4J7IA 2DEUA 4PFZA 3M9QA 4LDYA 3M4GA 1WJSA 5DM7R 3VYHB 1N8RC 5CO7A 5KYXA 4DBQA 3EFRA 5D6YA 1JQQA 2PZ1A 2V1QA 1SHGA 2XDBA 2KY9A 3FIFA 1Q82R 1RAHB 4X34A 1M1GA 1NBEB 4E7HA 3WXMB 2OAUA 4ATOA 1NLOC 1K73R 1EIFA 4QW2A 1TH7A 1RAAB 1UGSB 1VQ6Q 3V7SA 4RTZA 5KH6A 2VXFA 2E65A 1N9RA 2XMFA 4PFOA 4KUIA 2VC8A 1YITA 3CCSA 4A54A 2C0TA 2L0AA 2MI6A 2OTLQ 1RI9A 1M3BA 1IRXA 5LJ5d 2RQWA 5IHNA 2A08A 4J9FA 3HL8A 2YRVA 2ZPIB 3C94A 3OYLA 3UDCA 4Q5WA 5IAYA 5HY6A 2E12A 3CPWS 5FLXE 4LDXA 1NPPA 5CQXA 3JB9J 4E7LA 1PRMC 2JT4A 3CXCS 2VUBA 4XTVA 4N4GA 3NGPA 5M9OA 4C0DB 2DEQA 3CCVQ 1OOTA 2LJ3A 1M2VA 3JCMg 1BCMA 4X9CA 3VUZA 5GAN7 1YI2A 1IGUA 2ZPEB 5CCAA 3A5ZB 3HFNA 2PVDB 4XQ3A 2JZ2A 5DY9A 1NZ9A 3MEAA 1VQKA 5AYFA 4EMGA 2HKQB 2RHXA 2F2VA 4M7DE 1SPKA 3OYYA 4LDVA 2DO3A 2QEXA 3I35A 3S3OA 1VQ5T 4R56A 4WF2A 2V8IA 2XHCA 4M75D 4C8QA 3M0QA 2O4XA 1H641 3BFMA 4NOYA 1K4US 2GFUA 5LJ3j 3PE0A 4B6MA 3TREA 5LJ3f 2MOXA 2YXYA 2O9SA 2L89A 2C0IA 4C0ZA 3EGXB 1K9MU 1I81A 2RO0A 1O9SA 3LGLA 2QQRA 2VXEA 3CBPA 3I9QA 5D6WA 4XTXA 3LH5A 1UGQB 2V26A 1UHCA 1Q86U 2P84A 2GCXA 1FMVA 1VIEA 3L2VA 2PQWA 2LVMA 5IHKA 1I4K1 3A8GB 4CC7A 3NTIA 2MWPA 3U23A 3CMAQ 4BDYA 4C92G 1HXDA 2CGHA 1D3BB 2JXBA 3EGDA 4R55A 4PJOC 1Y57A 2KYMA 2HZYA 2FPEA 5LJ5h 3PGGA 4M77D 3ZEHA 2SRCA 3E19A 1R0CB 1QCNA 2EGCA 1O75A 2F2XA 5A0GA 2BZXA 3JCMf 1NJIU 3JCMV 5HCKA 2CZ7B 2ABLA 3CCQA 5GAN3 1RABB 1RADB 3V7CA 4AFZC 4PLLA 3QDRB 2MF2A 4JJCA 2RQUA 3GNGA 2HKNA 5GAMh 3T9NA 3LW5E 2FZGB 1VQPA 3I55T 2EWNA 1YNZA 2E3IA 3PFSA 4NL3A 5IN1A 4J7FA 1LNXA 1AWWA 3HSBA 1K9AA 3JB9H 3JB9G 1QVFS 2NUTA 1ZA1B 2EQMA 2RI3A 4E6RA 3J81E 2KI7A 4Z02A 1IREB 2YUPA 3QXEB 3G71Q 4XTUA 4OMMA 1M8MA 1PG5B 2EPDA 2X9HA 1EFNA 1JU5C 1VYTA 2RPNA 1QW1A 2EKOA 5LJ5e 2QYZA 4RMOA 1BBZA 2DL7A 1N6AA 4M7AB 4M7DB 3DB3A 1TUDA 1Y71A 5I2SA 3HRTA 2XI9A 2EJ9A 2FB7A 2OAWA 4J6WA 2QI2A 3VS6A 5LJ3d 4F7UB 3VS0A 3X25B 4DEXA 1W2BS 4IIOA 1OULA 3CCST 2F5KA 3G4SA 3I55Q 5IXFA 1VQMQ 4Y91A 2KBTA 5GAMe 1UTIA 2P4TA 3L2RA 1QWFA 4XAXB 1VQ7Q 2DZ9A 2RQVA 1M4ZA 2AKKA 2RM4A 2MIOA 5FU7C 2QQAA 4M78F 1Q82C 3VYGA 3CPWA 2DFUA 1B34B 3EG9B 1K73C 3EG1A 5GMKj 3CXCA 1PSFA 2DKGA 1HYOA 1KHCA 3H6ZA 3A8OB 3VV0A 3CC2T 1YI2T 1M2OA 2DNUA 4PJNA 2E70A 3J7AF 1ZLMA 2K4YA 3QO3A 4FSSA 1M90C 1KSWA 1Q81U 5CIUA 1M1FA 3M0UA 3NMZC 3CCRQ 1ACMB 1BU1A 3L1AA 3VU3C 2CT4A 3I5RA 1VQKT 1T0HA 5GMKi 3RDVA 2KEAA 2HMAA 2QEXT 2DJZA 4M7DD 2NWMA 1PKTA 3A98A 1NLPC 3WVEB 1GBQA 2MYSA 4LUDA 1FYNA 3P8DA 2W10A 1K8AU 2GBQA 1YFNA 4C8QG 3L2WA 1JEGA 1WHGA 3CMEA 4BE1A 1WHMA 4EIKA 3QWXX 2KE9A 2PVGB 2KRMA 1FMWA 1WFWA 2CSQA 3D7SB 2BUDA 2DILA 1AT1B 4AG1C 3OYHA 3CC2Q 5LJ5g 4RTWA 2HBPA 4BACA 1ZUUA 2CP7A 1PCXA 2J6OA 4ZNXA 1XOVA 4M4ZA 3H41A 3INZA 3OYDA 5LJ3h 1MGQA 4J8OA 1YJNA 2O01E 4IUPA 4BB7A 3JSCA 4EMKB 2G6FX 4O5VA 4J9HA 2QQSA 2EYYA 1VQ9A 3MP6A 3RMQA 1VQNA 1GL5A 3VRYA 1YIJA 2I2LA 1VYVA 2EFIA 3A8HB 3CCQT 2FG0A 3CC7A 1WA7A 2YDLA 3E9FA 4QKUA 5LL6S 1HK9A 1R77A 3CC4A 5A2QE 3A8MB 3N5BB 3ZFJA 3JB9I 3GP8A 2KK4A 4M7AF 5CKFA 3OS2A 1VQPT 5KCHA 5IH2A 1H3HA 2QXFA 1GCQA 1YHQA 3E2UA 4OP0A 3ZBDA 4Z8AA 4F7UF 1K0XA 4M77C 4PJOA 2EAYA 2DK3A 1QVFA 3OYNA 3JCMh 1GCPA 2KNBB 4BI8B 4HVVA 2YLBA 4ANJA 1EX4A 1H8KA 2R5AA 4C92B 1ZBXA 1KK7A 2AHJB 2DJQA 2K2VA 5LJ3e 2P0QA 2CP3A 1K9MR 2O2OA 2WACA 1WYXA 2JUFA 1VQLA 3TSZA 1WXBA 1T3SA 1M27C 4MZPA 1RACB 3SFMA 4QT7A 1NEGA 1UGRB 4XU2A 2E1HA 5IHIA 2CDTA 2XIDA 2QDYB 3G6EA 5FWBA 2KQWA 3LX7A 2EYQA 3EAEA 2X4YA 2DL3A 2K9GA 2DRKA 3G4ST 1JXMA 1W2BA 3OYGA 1W6XA 2A0FB 2DE0X 3VS1A 1AVZC 4CRIA 1WQWA 4C5GA 3CCUA 3LH0A 4F04B 2XICA 2X3WD 5AT1B 1B7TA 4HCBA 4D8KA 3QSUA 3MEWA 1VYUA 4IIMA 3QYGB 4C0FA 2COZA 3JCMe 5KYWA 1SRLA 2G3RA 3BDLA 3H9NA 2R58A 2O88A 2COWA 2RJCA 3FJ5A 3HTRA 4JRKA 2QK0A 2ZGWA 4LUEA 1Z9ZA 4M78E 2HDAA 4JUVA 1SG5A 2QDLA 3L2QA 5KYXB 4FM4B 1YWOA 5KYUA 5GANd 1ZUKA 2RN8A 2EQUA 2RA2A 2K3YA 1WLPB 1ZX6A 3C0CA 4NS5A 4OB0B 2E3HA 3TSWA 3OS1A 2ENMA 3QZ9B 2J06A 2OTJA 3PNWC 5GAOn 1BK2A 1RL2A 1VQ8A 2QASA 1VQOT 1KHIA 4JLIA 4KGXB 5GMKh 1RAGB 1ZUYA 3SEMA 2YUQA 5A0LA 1WHKA 3CPWP 5I11A 3G7ZA 2K3BA 2DXBA 1OI1A 4JRIA 2YLCA 2KGTA 5GMKm 2HQHA 3CXCP 4ZGEB 5LJ3g 4NL2A 3AT1B 4II1A 1M30A 3O8VA 2AZSA 1MNEA 2RMOA 1OPLA 3CCMT 4J9GA 3FB9A 2KRNA 2RJDA 2FVUA 4M7DC 2YUNA 4M7AC 4MDWA 3VS7A 1M1KU 1QWEA 3OYMA 2HL5C 1KG1A 1M2VB 1M90R 4N0AC 1QVGS 3R6NA 1BI0A 2E5KA 1IXDA 1ZHIA 1D1CA 1IZ6A 1S72A 4DQ2A 1VQNT 1OZ3A 3JCMJ 4O6JA 4LD9K 4RKUE 1ZBJA 1YIJT 1UJYA 1VQOQ 1N27A 3TQ7P 4C92F 1ABQA 2AT1B 1JJ2A 1PD0A 4E7IA 1G3YA 3QHSA 1BCOA 4XTWA 4X1VA 1QMCA 2DL5A 1BYMA 1KJWA 4DOVA 3CC4T 4JPBW 2O4XB 1FXXA 2ZAEA 5GMKe 4YTLA 5J39A 4EPCA 2LT4A 2A36A 3EFOA 4M75A 2CKKA 3VS3A 3I56A 3OYIA 3CCMQ 1WPYA 1YHQT 1KQSS 1UUEA 3RKXA 3X28B 2L2PA 1YWPA 3PMTA 3M57A 4FL6A 3VJPA 4M7AE 2HL3A 2ECZA 2FZKB 2KDSA 3SWNC 4X9DA 1TS9A 3RR6A 4HKEA 4PLIA 4PJOG 3O5ZA 4M78B 2EIFA 1M3AA 1MMDA 3TVTA 4F7UE 5GJVB 3JB9F 1U1SA 2ZPGB 1ZSGA 2QA4A 1BKBA 4Y92A 1VQNQ 2MMPA 1VQLT 2RHZA 2DXTA 5CKBA 2MK5A 3ME9A 2M16A 1YIJQ 1UEBA 3V8LA 4ZTJA 3ULRB 3OSVA 1U1TA 2DTIA 5A0DA 5GAOm 1UGVA 1BI1A 4EMHA 1MMNA 3G6ET 3CC4Q 2DYIA 4CC2A 2RH2A 2KAFA 3SDZA 4M77A 1SHFA 1X27A 2RK2A 1V1CA 3BW1A 4MZTA 2LQWA 2X4WA 1NEBA 4ZGDB 2E41A 4F16A 1YHQQ 3CCUT 3GBQA 1WHHA 1YJWT 1QVFP 1X2KA 1KC8U 3IQLA 2B86A 1VQ4A 1K9MC 1MNDA 5L8RE 1VQ5Q 1LCKA 1YCSB 3EHRA 3X26B 4OB1B 1FMKA 1NM7A 4QVCA 4F17A 4L5GA 2FPDA 2D0QB 1U3OA 3QJ6A 2X3XD 1Q86C 4VUBA 2AKLA 2LCSA 1GFCA 4J83A 4M78D 4LE9A 2E10A 1E6GA 3MJXA 3G6EQ 4XU1A 3BE3A 3BDUA 1C6VX 1HSQA 3THKA 3GNFB 4E7KA 1W2BP 1Z9QA 3KBGA 3LYIA 1AWXA 2EGAA 2CZ6B 4ESRA 3RBBB 1NJIC 7AT1B 2OTJT 1XTDA 3C12A 1D3BA 1YJWQ 2VGMA 5KYNA 3H0HA 4FU6A 2DD4A 3NTKA 4JS5A 1LJOA 2C0OA 2PVOB 4XK8E 1WI7A 2ESWA 3M54A 3KUFA 1RLPC 2KT1A 4BI3A 1G83A 1I1JA 1WDXA 1D1BA 2F5TX 3CCEA 4HCKA 2EW3A 2GNCA 2DVEA 4OVAA 4OMFB 4C8QF 1MMAA 2LZ6B 3JRZA 3JCMP 2FEIA 3OS5A 1QKWA 2R57A 4BDZA 2YRCA 1SSHA 4FYWB 5IXBA 3M0PA 4LD6A 1YITT 4RCBA 2FO0A 1NG2A 3QWYA 5CAIA 2E5QA 1TTHB 2RNAA 2E6NA 2Y4YA 1QVGA 1M9SA 3L2UA 5C6SA 1S72T 1QP2A 2OTJQ 1BB9A 1Y0MA 4OMQA 8AT1B 4RTTA 3EHQA 3MP1A 3OYBA 2H8HA 2KVQG 1RUWA 5GAN8 2H3EB 4OMLA 3HFOA 2MAMA 3QUIA 5GANg 2D1XA 1OQKA 1WNLA 5GAN2 2K7AA 3JAME 2XU8A 1ZSZC 4HVWA 3LWIA 4E7JA 3EG0A 4M7DA 3I56T 3REAB 3FC3A 4OMNA 4IKFA 4C92E 2DAQA 1OX9A 1MV0B 4N0AA 1KQSA 2DX1A 5CR2A 4M75G 4OB3B 5HK0A 2KXDA 1X6GA 2NUPA 4MMKA 4M7AD 1YITQ 3CCSQ 1IGQA 1SRMA 4D6WA 5J3BA 4ELZC 2AIRB 2LTOA 1MHNA 4BY6B 3V7RA 2LQ8A 2VV5A 3ER0A 2QA4T 4L6V5 4JDSA 2LJ0A 2JS0A 2YWWA 2L3QA 4J6YA 1Q7YU 1G3TA 1AHJB 4PJJA 1JJ2P 2OTLA 1Q81C 2P0KA 4D8DA 1DJ7B 1E7OA 3EG9A 1E6HA 3A8LB 4DBRA 1JRIA 4CC4B 3I5SA 1S1NA 1BIBA 2QTXA 1ABOA 2DF6A 2JOYA 4FIBA 3P8HA 4OF1A 1MV3A 1X01A 2HEQA 3M53A 1NYGA 1YI2Q 2KYBA 5D6XA 4V2SA 1YBYA 1K8AC 1IHVA 1M8VA 3GPLA 3SWNA 3CCVA 1I0CA 3JCMW 4KUDK 4M77G 1VA7A 1VQKQ 2FPFA 2ATCB 2DBKA 3VS4A 4XTZA 4A4HA 1QLYA 3V8JA 4IUQA 4A4KA 4FYYB 2QEXQ 2VKNA 5ECAA 3DLMA 2D8HA 5GANj 3JCMc 2PUOB 1H3ZA 2V1RA 2EJFA 5GANf 4UC4A 5KE3A 4PJOB 1UJ0A 2FRYA 2JTFA 1JJ2S 1QKXA 2X4JA 2ZPFB 3QJYA 2BE9B 2EVRA 2HQEA 3OW2S 3OYKA 2M1HA 4JS4A 4C5IA 2LP5A 1RAIB 3PT9A 2K57A 2DL4A 2D8JA 4IUVA 1AWOA 3M0SA 4JJDA 1KD1U 1YN8A 4C0DC 2RQTA 2LNHB 3VS2A 1WHJA 1OU8A 2D6FA 4MZMA 3OYFA 2A7YA 2LMJA 3UATA 4K11A 2L5QA 2LDMA 3QG1A 2FRWA 2JMAA 4JZ3A 4J6XA 3P8BB 4PL6A 2WSFE 2FHDA 4PFPA 3L2ZA 1LPLA 2IVWA 4JJNK 1GBRA 2J05A 3CMAA 1I5LA 4M78C 3CCET 1PRLC 1KFZA 1SF9A 2K6DA 1I07A 2RHUA 3VRZA 4FSXA 1G3WA 4RG8A 5CK9A 1GXIE 3CCQQ 4PJLA 4L59A 2ED1A 3H0IA 1WX6A 5GAOl 4Y28E 1Q86R 3MEUA 4KT0E 3CCLA 3SB2A 5KYWB 5GAOr 1W4SA 4KGVB 5KE2A 1VQPQ 3Q1JA 1Y96A 2X4XA 4C8QE 4ELYC 3FJPA 5KYYA 3QPHA 3CCJA 2DERA 5FWCA 1XJWB 1C1AA 2SEMA 1V29B 3C4SA 1P92A 3NTHA 5KYUB 1HJDA 4BI4A 2IG0A 1W70A 1UGPB 1TSFA 1YJ9A 5EG2A 1NJIR 1AZEA 1CSKA 2OI3A 4J9BA 1U8RA 3OSSC 3EG3A 2RB6A 4C0GA 1PC0A 1SSFA 3ZL7C 2M0YA 2F2WA 3NFCA 3AHUA 5FU6B 1AEYA 9ATCB 3G71A 4OGCA 3HPWA 4Z88A 4C92D 1H92A 4HCCA 2M0OA 3GIBA 4WTOB 1B3QA 3RUXA 4M7DG 2DLPA 3RKWA 2EKHA 1F1BB 2JJ9A 1K0SA 3VUBA 4RUGA 3R6OA 3G4SQ 2COYA 1QVGP 3MHXA 3LGFA 4R0KA 2BKDN 2AZVA 2CP6A 3RKYA 2DTHA 4GBQA 1FX7A 4GLMA 5FROA 1N8RU 4QVDA 3EH1A 2RK1A 4PK4A 2Y4XA 3OBYA 3HRSA 2OX7A 4A53A 3CMET 1VQMA 2OTLT 1UFFA 2Y90A 4PJOF 1ZSZA 5GAN5 1VQ7A 3M5AA 2QQ9A 1UB4A 3S6WA 4ORZA 3PVQA 3NPFA 3JB9D 2QAZA 3UPUA 1T0JA 2DPPB 2CH4W 4N4IA 2XD0A 5GAN4 3CEYA 2KR3A 1ARKA 4RTUA 2DIGA 1TOVA 3CCVT 1KQSP 2B8AA 2CP0A 1I8FA 2L3SA 2A3LA 3V8KA 3HKSA 2XDPA 1YJNT 4FT2A 1C0MA 3EFOB 4M75B 1M5Q1 6AT1B 3CCRA 2CP5A 3X20B 4JJBA 3FRNA 2K79A 4IUTA 1VQ9T 4N4HA 4CI0C 3OBWA 1BI3A 5GJWB 1RAEB 3QYHB 4Z89A 1NE8A 3L42A 1JXOA 1X69A 2YSQA 3LLRA 4ZTFA 3CMEQ 4EDUA 1M1KC 3OW2A 3CC7T 4C8QB 4GLKA 3MPUB 4ME7A 1V76A 4AMCA 1Q81R 2KSSA 3GF5A 2VASA 1NPRA 2VYTA 1K1ZA 1WQ7A 1XQHA 5D7UA 5FW9A 2DTOA 4LNPA 2RHIA 4C5HA 4RTXA 1BIAA 5I22A 3H0FA 1VIFA 5GANh 1SKUB 2AK5A 2ROLA 4AFSC 5GAMd 1LOJA 3CC2A 1K8AR 4C5EA 3OYJA 3S3NA 2KMTA 2O31A 4GY5A 4M77B 1YJNQ 1Q7YR 1RLQC 1U06A 1KIKA 2RI5A 3CMAT 1VQ9Q 1OYXA 1ZA2B 4E47A 2RI2A 1K76A 4BY6C 1SEMA 4QVZA 2D9TA 3EGDB 2E64A 2DVJA 1VUBA 2EGEA 3HP9A 2JVVA 2CS7A 5FRMA 4QQ6A 1CKBA 3CC7Q 2KROA 3QKJA 3CCLT 2YHTA 5GAN6 4IUUA 2IPOB 2RQRA 2GQIA 3UA7A 4C8QD 3CCJT 5GAOq 1TWBA 4JRQA 1ZQ1A 1GRIA 2CSIA 2JM8A 3FEOA 3QDFA 3UWNA 5DLQE 2X35A 2ZCFB 2FL7A 2VWFA 3G1JA 1YJ9T 2ZZDA 3ASKA 3DB4A 2FYKA 4M78A 3WVDB 1Y07A 5GANe 2XG8D 1RAFB 2K5LA 2R5MA 4J9IA 2BIVA 3EGUA 3JCMb 1GCQC 4AFUC 2CH4A 4EMKC 1PNJA 3H8ZA 2NUTB 2XDDA 3URGA 3EGXA 1VQLQ 1OV3A 4KGZB 2HQXA 3G71T 1KD1R 1T3LA 2V8JA 5CKHA 1VOMA 2ZPHB 1PD1A 4LDWA 1PSEA 1KC8C 2HSPA 2E4HA 3KXTA 5DLOA 3E9GA 1X2QA 3CCLQ 1UECA 1QCOA 2ZPBB 3CD6A 3OMCA 2EYWA 3PIPA 1FWZA 2J7IA 5J26A 2EQJA 2EYZA 3M0TA 2K5IA 1BI2A 3PIOA 3CCJQ 3UT1A 3CCUQ 1VQ8T 2EQIA 1G8XA 5HK3A 4M75F 2M02A 2RJEA 1VQMT 2QGFB 1YJ9Q 1OEBA 3META 3JV3A 3SHWA 1VQ7T 3S3MA 4C92C 2P4RA 4QQDA 2NUZA 3VKIA 4KH1B 4B9WA 1JO8A 2GQVA 5CKEA 3PVLA 3RMSA 2KT8A 4FYXB 2LNVA 3JCMQ 1MMGA 3FLGA 1AD5A 4PJOE 2BTTA 3CQTA 3OY9A 2L3RA 2M9UA 2ED0A 4E2FB 2JMCA 1QP3A 2JNGA 4J9EA 1D09B 1WHLA 5GAOp 2JS2A 2KRSA 2K2MA 2HBWA 2JM9A 2CUBA 4CC3A 2CZ1B 3LWHA 1Q82U 3CCRT 3TCJA 1WIEA 4ZN3A 2L8DA 2BE7D 4BD3A 2QGGA 4OMOA 1B07A 1K73U 1VQ8Q 4BE0A 4M77F 3QIIA 2VGNA 4B9XA 2WSCE 2DETA 4ZGJB 2NUPB 4FYVB 1EZZB 2HCKA 4DBHA 1RI0A 3CPFA 3HRUA 3TEEA 1TUGB 2LCCA 1M90U 1WZOA 4P5NA 1W1FA 4M7AA 2I0NA 3VS5A 4IURA 5FU6C 3OS0A 1G3SA 3EH2A 3OB9A 3MO8A 2QTVA 3M59A 4F7UA 2DXUA 4KBMB 3CBOA 5I2MA 2RJFA 1J3TA 1N8RR 2XKOC 3OYEA 2K5FA 3MP8A 1VQ6A 2DD5A 2O9VA 2YT6A 3X24B 2GFAA 2DIQA 4MDXA 4A4GA 1S72Q 5EC7A 3RERA 3SWNB 4RTYA 1D0YA 4AFQC 3M55A 2HNIA 3JCMd 2LJ1A 2NLUA 4AT1B 1B34A 1D0XA 1N5ZA 1TU0B 3OW2P 2DZCA 2HD0A 4BUGA 1WXUA 3EG2A 3OQ5A 1YCYA 1IO6A 2WSEE 2PU9B 5GMKl 4KULA 4HT9A 1NYFA 2PUKB 1VQOA 4LDUA 1M1KR 1IB8A 3QBYA 4JLGA 2QG9B 3C95A 3I56Q 3TU4K 2CZ0B 2XK0A 4DOWA 4DBFA 4DEYA 3KFVA 2F1LA 1JBMA 2HAXA 3F70A 4AG2C 3QZ5B 3FDRA 2PNIA 4F14A 1Q7YC 1VQ4T 4FT4A 4E7ZA 5KCOA 3CCMA 2H3JA 4XTYA 2LC4A 4RCCA 3RIRA 1UHFA 1TUCA 4DA4A 4JZ4A 1A0NB 3MEVA 3EFSA 4M75C 4OMPA 2GGRA 4FCYA 2EBPA 3MKDA 1M3CA 1U5SA 2QA4Q 1PHTA 4M78G 5IT9E 1AZGB 2GTOA 5FRNA 3PTAA 2LCLA 3NHNA 3A1PA 2QQBA 3UA6A 4J9CA 2Z0WA 1TG0A 2RHYA 4C8QC 1CKAA 3M0RA 5GAMg 2LT1A 2DRMA 1PWTA 3PMIA 3OMGA 4KH0B 2F69A 3CD6T 1UG1A 1MUZA 2MWOA 2IIMA 4RG2A 4FW1A 2KXCA 3BY7A 2CYZB 3CBMA 4E7SA 2J6FA 4A4EA 1X6BA 1WJQA 4A63B 2LX9A 3MCAB 2JTMA 4M7DF 1WJRA 3SD4A 3OA6A 2L3PA 1VQ4Q 2A37A 4EMKA 4J5YA 1Y96B 2VVKA 2DXCA 4HVUA 1R0BG 2CUDA 1TXQA 1KD1C 5KYYB 4OGEA 2CT3A 2C06A 5CKDA 1IHWA 2LQNA 4M75E 1UE9A 1OZ2A 2YRDA 1VQ5A
chains in the Genus database with same CATH topology
2D0QB 2E6ZA 3V8KA 3HKSA 3M4YA 2XDPA 3QJ6A 1YJNT 4FT2A 3L1AA 3VU3C 4M75B 4A4FA 4VUBA 1Q86C 1M5Q1 1XNIA 1VQKT 5GMKi 3CCRA 3X20B 4PJOD 4PNOA 3FRNA 4IUTA 2QEXT 1VQ9T 2DJZA 4J83A 5I21A 4M7DD 4M78D 4MMLA 4N4HA 2E10A 5LJ5j 4CI0C 1KQ1A 3OBWA 1BI3A 3QYHB 1NE8A 3L42A 3OYAA 5LJ5f 3WVEB 4XU1A 3BDUA 3LLRA 4ZTFA 3P8DA 4EDUA 1M1KC 1K8AU 3GNFB 3OW2A 3CC7T 2P0PA 4C8QB 4E7KA 4GLKA 4C8QG 2K3XA 3L2WA 3KBGA 3LYIA 4ME7A 3CMEA 4BE1A 4XU0A 2CZ6B 1N9SA 3M56A 3HHTB 2KSSA 1NJIC 3GF5A 2OTJT 4C92A 1NPRA 1XTDA 1WGSA 2VYTA 4JRPA 2PVGB 3C12A 1KQ2A 1D3BA 1WQ7A 1XQHA 2VGMA 4OB2B 5GAMj 2LQKA 2DTOA 4BE2A 2RHIA 4C5HA 2BUDA 4FU6A 1BIAA 2DD4A 2RD1A 3NTKA 4JS5A 5GAMf 1LJOA 2PVOB 4XK8E 5FU7B 1YJWA 1VIFA 3OYHA 5GANh 3M54A 3KUFA 5LJ5g 5CQYA 2HBPA 4M77E 4BACA 5GAMd 3OYCA 3M58A 4BI3A 3GOXA 1LOJA 2F5TX 3RESA 3CCEA 3E1SA 3CC2A 3GLXA 4C5EA 1R8OB 1XOVA 3OYJA 4XU3A 2DVEA 2KMTA 3S3NA 4OVAA 3INZA 2EQKA 4GY5A 4M77B 4OMFB 5LJ3h 3JRZA 4C8QF 3OYDA 3JCMP 1MGQA 4M7AG 3OS5A 1JB0E 2RI5A 3CMAT 2R57A 4J8OA 3JCMX 4BDZA 1QVPA 1YJNA 2O01E 4IUPA 5HKCA 1OYXA 3DKMA 4E47A 2RI2A 4HA8A 4BB7A 2JN0A 4BY6C 1Y7XA 1VQ6T 4QVZA 3JSCA 4EMKB 4O5VA 5C0MA 2D9TA 2QQSA 2E64A 1VQ9A 4F7UG 4LD6A 3MP6A 3RMQA 1VQNA 1VUBA 1YITT 2LRQA 2JVVA 2CS7A 3HP9A 4RCBA 1Q82C 5FRMA 5CAIA 2E5QA 4QQ6A 1YIJA 2I2LA 2E6NA 2EJGA 2Y4YA 4TVRA 1QVGA 3DLLA 2EFIA 3A8HB 3J80E 1X6OA 3CCQT 1M9SA 3QKJA 3L2UA 3CCLT 3I55A 1G5VA 5C6SA 4QQGA 2YHTA 3CC7A 1S72T 5GAN6 3E9FA 4IUUA 1QP2A 5LL6S 1HK9A 4ZN1A 3CC4A 4PKCC 5A2QE 3A8MB 3N5BB 3ZFJA 3JB9I 3GP8A 2KK4A 4M7AF 4HCZA 5CKFA 1X75C 4C8QD 3MP1A 2V8KA 3OS2A 5CVIA 2GF7A 3OYBA 2KVQG 5KCHA 3CCJT 5GAOq 1VQPT 5GAN8 4JRQA 1ZQ1A 4HT8A 2QXFA 3HFOA 4J7IA 3FEOA 3UWNA 2MAMA 3QUIA 5GANg 3M9QA 1WNLA 1YHQA 4LDYA 5GAN2 5DLQE 3M4GA 4OP0A 2X35A 1WJSA 2ZCFB 3ZBDA 2FL7A 4M77C 4F7UF 2EAYA 5DM7R 3VYHB 2DK3A 2XU8A 2ZZDA 1YJ9T 1N8RC 4PJOA 5CO7A 3LWIA 3EFRA 3ASKA 4E7JA 3DB4A 4M7DA 2FYKA 4M78A 5D6YA 3WVDB 1Y07A 5GANe 3I56T 3FC3A 3OYNA 1QVFA 4IKFA 2XG8D 3JCMh 4C92E 2XDBA 2K5LA 2R5MA 2KY9A 4BI8B 3FIFA 2DAQA 4LD9K 2BIVA 2YLBA 4X34A 1M1GA 3JCMb 4EMKC 3H8ZA 4E7HA 3WXMB 2OAUA 2R5AA 4C92B 4N0AA 2XDDA 1ZBXA 3URGA 2AHJB 4ATOA 1KQSA 1EIFA 4QW2A 2K2VA 5LJ3e 5CR2A 2P0QA 1TH7A 4M75G 4OB3B 1UGSB 5HK0A 2HQXA 3G71T 3V7SA 5KH6A 2WACA 2V8JA 4MMKA 5CKHA 2ZPHB 4M7AD 2JUFA 1VQLA 4LDWA 2VXFA 2E65A 1PSEA 4D6WA 1KC8C 5J3BA 1N9RA 4ELZC 3KXTA 4KUIA 4MZPA 3SFMA 2VC8A 2LTOA 1MHNA 5DLOA 3E9GA 4A54A 3CCSA 4BY6B 1YITA 1UGRB 4XU2A 2MI6A 3V7RA 2E1HA 2ZPBB 3CD6A 2LQ8A 2VV5A 2XIDA 3ER0A 5LJ5d 2QDYB 2QA4T 4L6V5 3OMCA 3G6EA 4JDSA 3PIPA 2KQWA 1FWZA 4J6YA 1Q7YU 1G3TA 1AHJB 3LX7A 2OTLA 2EYQA 1Q81C 2P0KA 5J26A 1DJ7B 2X4YA 2EQJA 3EAEA 3HL8A 2K5IA 2YRVA 2ZPIB 1BI2A 3C94A 3PIOA 3OYLA 3UDCA 3A8LB 3G4ST 3UT1A 4Q5WA 1JRIA 1W2BA 1VQ8T 5IAYA 5HY6A 2E12A 3OYGA 2QTXA 1BIBA 3CPWS 5HK3A 4M75F 2JOYA 5FLXE 4LDXA 4FIBA 2RJEA 3P8HA 1NPPA 4OF1A 1WQWA 5CQXA 4C5GA 4CRIA 3CCUA 1VQMT 3JB9J 4E7LA 1X01A 3LH0A 2VUBA 3CXCS 4XTVA 4N4GA 2XICA 3M53A 3META 5M9OA 4C0DB 2DEQA 1VQ7T 3S3MA 5D6XA 3JCMg 4V2SA 4C92C 4X9CA 4QQDA 1YBYA 3VUZA 5GAN7 1K8AC 1YI2A 1M8VA 3GPLA 4HCBA 3QSUA 3MEWA 3SWNA 3VKIA 2ZPEB 3CCVA 4B9WA 4KUDK 3QYGB 4C0FA 3JCMW 2GQVA 4M77G 5CKEA 5CCAA 3JCMe 3A5ZB 3HFNA 3JAME 3RMSA 2G3RA 2PVDB 4XQ3A 4XTZA 2JZ2A 3BDLA 4A4HA 2LNVA 5DY9A 2R58A 3V8JA 1NZ9A 3FLGA 2RJCA 4IUQA 3JCMQ 4A4KA 1VQ5A 4JRKA 3DLMA 3MEAA 1VQKA 4PJOE 2ZGWA 5AYFA 3OY9A 3JCMc 5GANj 4EMGA 2PUOB 2RHXA 4M7DE 2L3RA 4M78E 1H3ZA 3OYYA 2M9UA 4JUVA 4LDVA 2DO3A 2QEXA 2EJFA 5GANf 3OW2S 4UC4A 5KE3A 3S3OA 1VQ5T 4R56A 4WF2A 2V8IA 1QP3A 2XHCA 4M75D 4C8QA 3L2QA 2JNGA 1M90C 4PJOB 2JTFA 2O4XA 4FM4B 5GAOp 1JJ2S 5GANd 1H641 3BFMA 4NOYA 2GFUA 2X4JA 5LJ3j 2ZPFB 3QJYA 2CZ1B 3TREA 2HQEA 2EQUA 3OYKA 3LWHA 3CCRT 2M1HA 2RA2A 3TCJA 4ZN3A 2L8DA 2K3YA 4JS4A 1Q82U 4BD3A 5LJ3f 4C5IA 3PT9A 4NS5A 4OB0B 1K73U 2L89A 4C0ZA 2K57A 4BE0A 4M77F 3QIIA 2VGNA 4IUVA 1K9MU 4B9XA 1I81A 2RO0A 3OS1A 1KD1U 3QZ9B 2WSCE 4C0DC 3PNWC 2OTJA 5GAOn 4ZGJB 1RL2A 1VQ8A 1VQOT 1KHIA 4JLIA 2D6FA 1O9SA 3LGLA 5GMKh 2QQRA 2VXEA 3CBPA 1RI0A 3CPFA 4MZMA 2A7YA 3HRUA 3OYFA 3TEEA 5D6WA 4HT9A 4XTXA 2L5QA 2LCCA 2LDMA 5A0LA 3QG1A 1M90U 3G7ZA 2DXBA 1OI1A 4JRIA 2YLCA 4P5NA 1UGQB 4M7AA 4J6XA 3P8BB 1Q86U 5GMKm 4PL6A 2GCXA 2WSFE 1VIEA 4IURA 4ZGEB 2PQWA 2LVMA 4NL2A 5LJ3g 3L2VA 2FHDA 1I4K1 5FU6C 3OS0A 1G3SA 3L2ZA 3A8GB 4II1A 3NTIA 3O8VA 2IVWA 2MWPA 3OB9A 3MO8A 4JJNK 4BDYA 3M59A 3CCMT 4C92G 4F7UA 2DXUA 1HXDA 2CGHA 1D3BB 4KBMB 4R55A 3CBOA 3FB9A 5I2MA 4PJOC 3CMAA 2RJDA 2FVUA 1I5LA 2RJFA 4M78C 4M7DC 4M7AC 5LJ5h 3PGGA 4M77D 3CCET 3ZEHA 2XKOC 4MDWA 1M1KU 3OYEA 2K5FA 3MP8A 1VQ6A 3OYMA 2RHUA 3E19A 2DD5A 4FSXA 3X24B 2GFAA 1KG1A 1G3WA 4RG8A 1O75A 5CK9A 1GXIE 4N0AC 5A0GA 2DIQA 4L59A 3JCMf 1NJIU 1QVGS 4MDXA 3JCMV 1BI0A 4A4GA 3RERA 5GAOl 3SWNB 4Y28E 2CZ7B 3M55A 2HNIA 3MEUA 4KT0E 3JCMd 5GAN3 1ZHIA 3SB2A 3CCQA 3CCLA 2NLUA 1IZ6A 3V7CA 5GAOr 1S72A 1W4SA 4PLLA 1B34A 4DQ2A 3QDRB 5KE2A 1VQNT 1OZ3A 3JCMJ 2MF2A 2DZCA 4O6JA 2HD0A 3Q1JA 3GNGA 1Y96A 2X4XA 4BUGA 4RKUE 4C8QE 1YIJT 4ELYC 5GAMh 1N27A 4C92F 3T9NA 3FJPA 3LW5E 1JJ2A 3OQ5A 1YCYA 3QPHA 1VQPA 2WSEE 2PU9B 2EWNA 5GMKl 1G3YA 3PFSA 4KULA 4NL3A 3I55T 3CCJA 2PUKB 3QHSA 4XTWA 4LDUA 1VQOA 5IN1A 1BYMA 4J7FA 1LNXA 4DOVA 3CC4T 1V29B 2O4XB 1FXXA 3C4SA 3QBYA 1P92A 4JLGA 3NTHA 3C95A 5GMKe 3HSBA 3TU4K 4YTLA 4BI4A 2CZ0B 2IG0A 2XK0A 4DOWA 3JB9H 1UGPB 5J39A 3JB9G 1YJ9A 4EPCA 1QVFS 1JBMA 4E7IA 2LT4A 3F70A 5EG2A 2HAXA 2EQMA 3QZ5B 4M75A 2RI3A 2CKKA 3I56A 1U8RA 3FDRA 3J81E 3OSSC 3OYIA 2RB6A 1Q7YC 4Z02A 1IREB 1WPYA 1YHQT 1VQ4T 4FT4A 4C0GA 3QXEB 1KQSS 1SSFA 5KCOA 4XTUA 3NFCA 3RKXA 3X28B 3CCMA 3AHUA 3PMTA 5FU6B 2H3JA 4XTYA 3M57A 2LC4A 4FL6A 4RCCA 3RIRA 3VJPA 4DA4A 3G71A 4M7AE 4OGCA 3MEVA 3HPWA 3EFSA 2KDSA 4M75C 3SWNC 4C92D 4X9DA 1QW1A 2EKOA 4HCCA 2M0OA 4HKEA 5LJ5e 4PLIA 4RMOA 3GIBA 4PJOG 1N6AA 4M7AB 4M7DB 4M78B 2EIFA 3DB3A 3RUXA 4M7DG 4M78G 5IT9E 1Y71A 4F7UE 5I2SA 3JB9F 3RKWA 3HRTA 1U1SA 2ZPGB 3PTAA 2XI9A 5FRNA 2EJ9A 2LCLA 2FB7A 1BKBA 2QA4A 2MMPA 3VUBA 1VQLT 2RHZA 2DXTA 3R6OA 4J6WA 2QQBA 5CKBA 2QI2A 3ME9A 2M16A 3MHXA 3LGFA 5LJ3d 4F7UB 2RHYA 4C8QC 2BKDN 5GAMg 1UEBA 3V8LA 2LT1A 3RKYA 3X25B 2DTHA 4ZTJA 1W2BS 3OSVA 1U1TA 2DTIA 1FX7A 5A0DA 5GAOm 2F5KA 3CCST 3G4SA 5FROA 3PMIA 1N8RU 3OMGA 4QVDA 2RK1A 2F69A 1BI1A 4Y91A 4EMHA 3CD6T 2MWOA 2Y4XA 3G6ET 3OBYA 4RG2A 3HRSA 5GAMe 3BY7A 2P4TA 3L2RA 3CMET 4A53A 1VQMA 4XAXB 2OTLT 2DZ9A 2RH2A 4M7DF 1M4ZA 2KAFA 2CYZB 3SDZA 2Y90A 3CBMA 4M77A 4PJOF 4A4EA 1WJQA 5GAN5 2RM4A 2LX9A 3MCAB 1VQ7A 2JTMA 5FU7C 1WJRA 2QQAA 2RK2A 3M5AA 4M78F 2QQ9A 3BW1A 3SD4A 4MZTA 3OA6A 1UB4A 2X4WA 3VYGA 3S6WA 4ZGDB 2E41A 3CPWA 3CCUT 1B34B 1YJWT 1K73C 3JB9D 4EMKA 4J5YA 1KC8U 1Y96B 3UPUA 2DPPB 5GMKj 2DXCA 3CXCA 1PSFA 2DKGA 1VQ4A 1K9MC 1KD1C 4OGEA 1KHCA 4N4IA 3H6ZA 2XD0A 5GAN4 3A8OB 3VV0A 3CEYA 2C06A 5L8RE 5CKDA 1YI2T 3CC2T 2DIGA 3CCVT 2E70A 3J7AF 3X26B 2B8AA 4M75E 2K4YA 4OB1B 1OZ2A 1I8FA 3QO3A 4QVCA 4L5GA 2A3LA 1Q81U 5CIUA 1M1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM c;  3V8K A;  4EMG A;  1LNX A;  4C8Q D;  4M7D E;  4M78 E;  4JUV A;  5GMK e;  3HSB A;  3L1A A;  3VU3 C;  2EJF A;  4M75 B;  5GAN f;  5GAN 8;  1M5Q 1;  5GAO q;  4HT8 A;  4WF2 A;  4M75 D;  4C8Q A;  3HFO A;  3JB9 H;  4PJO B;  3JB9 G;  5GMK i;  3QUI A;  1JBM A;  4PJO D;  5GAN g;  5GAO p;  4PNO A;  1WNL A;  5GAN d;  5GAN 2;  1H64 1;  4M75 A;  3BFM A;  4NOY A;  2DJZ A;  3M4G A;  4OP0 A;  5I21 A;  5LJ3 j;  4M78 D;  4F7U F;  4MML A;  4M77 C;  4M7D D;  2EAY A;  2E10 A;  5LJ5 j;  4PJO A;  2RB6 A;  2RA2 A;  1KQ1 A;  3EFR A;  5LJ3 f;  1WPY A;  2FYK A;  4M78 A;  4M7D A;  5GAN e;  5LJ5 f;  4XU1 A;  3JCM h;  4C92 E;  3BDU A;  4XTU A;  3FIF A;  3RKX A;  3AHU A;  2YLB A;  2K57 A;  4M77 F;  3JCM b;  4C8Q B;  4XTY A;  4RCC A;  1I81 A;  3RIR A;  4EMK C;  4C8Q G;  4M7A E;  4C92 B;  4N0A A;  5GAO n;  3EFS A;  4M75 C;  3SWN C;  4XU0 A;  4X9D A;  4C92 D;  5LJ3 e;  1TH7 A;  1N9S A;  4JLI A;  4M75 G;  5LJ5 e;  5GMK h;  2VXE A;  3GIB A;  4PJO G;  3V7S A;  4C92 A;  4M7A B;  4M7D B;  4M78 B;  4MMK A;  4XTX A;  3RUX A;  1KQ2 A;  4M7D G;  4M7A D;  4M78 G;  1D3B A;  1WQ7 A;  2VXF A;  2E65 A;  4F7U E;  5GAM j;  4JRI A;  1N9R A;  2YLC A;  3RKW A;  3JB9 F;  1U1S A;  2DTO A;  4M7A A;  2EJ9 A;  4J6X A;  2FB7 A;  1BIA A;  5GMK m;  2VC8 A;  2RD1 A;  5GAM f;  1LJO A;  2DXT A;  4J6W A;  4A54 A;  5LJ3 g;  4NL2 A;  5GAN h;  1I4K 1;  4XU2 A;  3V7R A;  2E1H A;  5LJ3 d;  4F7U B;  5LJ5 g;  3L2Z A;  4C8Q C;  5GAM g;  5LJ5 d;  3V8L A;  4M77 E;  3RKY A;  2DTH A;  5GAM d;  1U1T A;  2DTI A;  5GAO m;  4J6Y A;  4QVD A;  1LOJ A;  3RES A;  4C92 G;  4F7U A;  4Y91 A;  2DXU A;  1HXD A;  2CGH A;  1D3B B;  4EMH A;  4PJO C;  3FB9 A;  4XU3 A;  2DVE A;  5GAM e;  3INZ A;  4M77 B;  5LJ3 h;  4C8Q F;  1I5L A;  3BY7 A;  4M78 C;  4M7D C;  4M7A C;  3JB9 I;  1JRI A;  3PGG A;  4M77 D;  4A53 A;  5LJ5 h;  1MGQ A;  3JCM P;  4M7A G;  2DZ9 A;  2QTX A;  1BIB A;  4M75 F;  2Y90 A;  4M77 A;  4PJO F;  3JCM X;  5GAN 5;  1WQW A;  2RM4 A;  3JB9 J;  4HA8 A;  4M7D F;  1X01 A;  2JN0 A;  4M78 F;  4N0A C;  3BW1 A;  4XTV A;  4EMK B;  3JCM f;  2E41 A;  3JCM V;  2DEQ A;  2E64 A;  4F7U G;  3RER A;  1B34 B;  3SWN B;  5GAO l;  5GAN j;  3JCM g;  4V2S A;  4RCB A;  4C92 C;  4X9C A;  2HNI A;  3JB9 D;  4EMK A;  3JCM d;  4J5Y A;  5GAN 3;  3SB2 A;  1Y96 B;  5CAI A;  5GAN 7;  3V7C A;  5GMK j;  5GAO r;  1M8V A;  2DKG A;  3QSU A;  4DQ2 A;  1B34 A;  2EJG A;  2I2L A;  3SWN A;  3JCM J;  2DZC A;  3JCM W;  5GAN 4;  4M77 G;  3JCM e;  1Y96 A;  4C8Q E;  3HFN A;  5GAM h;  2YHT A;  4XQ3 A;  4C92 F;  5GAN 6;  4XTZ A;  3FJP A;  1HK9 A;  5DY9 A;  3JCM Q;  3V8J A;  4M75 E;  1YCY A;  4JRK A;  1I8F A;  3QO3 A;  5GMK l;  2EWN A;  4QVC A;  4PJO E;  4HT9 A;  4NL3 A;  3QHS A;  4XTW A;  2ZGW A;  4M7A F; 
#chains in the Genus database with same CATH topology
 1D0Z A;  1UDL A;  2E6Z A;  3M4Y A;  1I5O B;  4A4F A;  1D1A A;  1XNI A;  2EYX A;  4PJO D;  4PNO A;  5L23 A;  2VB6 A;  2YUO A;  5I21 A;  4MML A;  4FW2 A;  5LJ5 j;  4HXJ A;  1KQ1 A;  3UF4 A;  2BZ8 A;  2DYB A;  1KC8 R;  3CD6 Q;  3OYA A;  2BZY A;  5LJ5 f;  3REB B;  2W0Z A;  4LN2 A;  1YP5 A;  4LXC A;  2P0P A;  2K3X A;  4XU0 A;  1N9S A;  2X51 A;  3M56 A;  3HHT B;  1AOJ A;  2PTK A;  1QQJ A;  1HD3 A;  4C92 A;  2NYS A;  1WGS A;  4JRP A;  1KQ2 A;  4OB2 B;  5GAM j;  2J6K A;  2LQK A;  2A28 A;  4BE2 A;  2RD1 A;  5GAM f;  1YJW A;  5FU7 B;  2MCN A;  3CCE Q;  5CQY A;  2CRE A;  2DL8 A;  1Q95 G;  4M77 E;  3OYC A;  2MPX C;  2DBM A;  1X43 A;  3M58 A;  4PJM A;  3GOX A;  1OX8 A;  3RES A;  3E1S A;  4RTV A;  3GLX A;  1R8O B;  4XU3 A;  3RNJ A;  2EQK A;  1LVK A;  2HSE B;  1ZSZ B;  2GTJ A;  2OJ2 A;  4M7A G;  1JB0 E;  1PKS A;  1QCF A;  2DM1 A;  3JCM X;  2FZC B;  1QVP A;  5HKC A;  3DKM A;  4HA8 A;  2JN0 A;  1Y7X A;  1VQ6 T;  4J9D A;  5C0M A;  2JTE A;  2D0N A;  2M51 A;  4F7U G;  2DA9 A;  2DMO A;  2LRQ A;  4WCI A;  1PM3 A;  2RF0 A;  2LX7 A;  1AWJ A;  4TVR A;  2EJG A;  4KRT A;  3DLL A;  3J80 E;  1X6O A;  3I55 A;  2ROT A;  1G5V A;  4QQG A;  1WXT A;  1OU9 A;  4ZN1 A;  4PKC C;  2CP2 A;  8ATC B;  1G2B A;  4HCZ A;  1X75 C;  2V8K A;  5CVI A;  2GF7 A;  1OPK A;  2JW4 A;  1GFD A;  4HT8 A;  4J7I A;  2DEU A;  4PFZ A;  3M9Q A;  4LDY A;  3M4G A;  1WJS A;  5DM7 R;  3VYH B;  1N8R C;  5CO7 A;  5KYX A;  4DBQ A;  3EFR A;  5D6Y A;  1JQQ A;  2PZ1 A;  2V1Q A;  1SHG A;  2XDB A;  2KY9 A;  3FIF A;  1Q82 R;  1RAH B;  4X34 A;  1M1G A;  1NBE B;  4E7H A;  3WXM B;  2OAU A;  4ATO A;  1NLO C;  1K73 R;  1EIF A;  4QW2 A;  1TH7 A;  1RAA B;  1UGS B;  1VQ6 Q;  3V7S A;  4RTZ A;  5KH6 A;  2VXF A;  2E65 A;  1N9R A;  2XMF A;  4PFO A;  4KUI A;  2VC8 A;  1YIT A;  3CCS A;  4A54 A;  2C0T A;  2L0A A;  2MI6 A;  2OTL Q;  1RI9 A;  1M3B A;  1IRX A;  5LJ5 d;  2RQW A;  5IHN A;  2A08 A;  4J9F A;  3HL8 A;  2YRV A;  2ZPI B;  3C94 A;  3OYL A;  3UDC A;  4Q5W A;  5IAY A;  5HY6 A;  2E12 A;  3CPW S;  5FLX E;  4LDX A;  1NPP A;  5CQX A;  3JB9 J;  4E7L A;  1PRM C;  2JT4 A;  3CXC S;  2VUB A;  4XTV A;  4N4G A;  3NGP A;  5M9O A;  4C0D B;  2DEQ A;  3CCV Q;  1OOT A;  2LJ3 A;  1M2V A;  3JCM g;  1BCM A;  4X9C A;  3VUZ A;  5GAN 7;  1YI2 A;  1IGU A;  2ZPE B;  5CCA A;  3A5Z B;  3HFN A;  2PVD B;  4XQ3 A;  2JZ2 A;  5DY9 A;  1NZ9 A;  3MEA A;  1VQK A;  5AYF A;  4EMG A;  2HKQ B;  2RHX A;  2F2V A;  4M7D E;  1SPK A;  3OYY A;  4LDV A;  2DO3 A;  2QEX A;  3I35 A;  3S3O A;  1VQ5 T;  4R56 A;  4WF2 A;  2V8I A;  2XHC A;  4M75 D;  4C8Q A;  3M0Q A;  2O4X A;  1H64 1;  3BFM A;  4NOY A;  1K4U S;  2GFU A;  5LJ3 j;  3PE0 A;  4B6M A;  3TRE A;  5LJ3 f;  2MOX A;  2YXY A;  2O9S A;  2L89 A;  2C0I A;  4C0Z A;  3EGX B;  1K9M U;  1I81 A;  2RO0 A;  1O9S A;  3LGL A;  2QQR A;  2VXE A;  3CBP A;  3I9Q A;  5D6W A;  4XTX A;  3LH5 A;  1UGQ B;  2V26 A;  1UHC A;  1Q86 U;  2P84 A;  2GCX A;  1FMV A;  1VIE A;  3L2V A;  2PQW A;  2LVM A;  5IHK A;  1I4K 1;  3A8G B;  4CC7 A;  3NTI A;  2MWP A;  3U23 A;  3CMA Q;  4BDY A;  4C92 G;  1HXD A;  2CGH A;  1D3B B;  2JXB A;  3EGD A;  4R55 A;  4PJO C;  1Y57 A;  2KYM A;  2HZY A;  2FPE A;  5LJ5 h;  3PGG A;  4M77 D;  3ZEH A;  2SRC A;  3E19 A;  1R0C B;  1QCN A;  2EGC A;  1O75 A;  2F2X A;  5A0G A;  2BZX A;  3JCM f;  1NJI U;  3JCM V;  5HCK A;  2CZ7 B;  2ABL A;  3CCQ A;  5GAN 3;  1RAB B;  1RAD B;  3V7C A;  4AFZ C;  4PLL A;  3QDR B;  2MF2 A;  4JJC A;  2RQU A;  3GNG A;  2HKN A;  5GAM h;  3T9N A;  3LW5 E;  2FZG B;  1VQP A;  3I55 T;  2EWN A;  1YNZ A;  2E3I A;  3PFS A;  4NL3 A;  5IN1 A;  4J7F A;  1LNX A;  1AWW A;  3HSB A;  1K9A A;  3JB9 H;  3JB9 G;  1QVF S;  2NUT A;  1ZA1 B;  2EQM A;  2RI3 A;  4E6R A;  3J81 E;  2KI7 A;  4Z02 A;  1IRE B;  2YUP A;  3QXE B;  3G71 Q;  4XTU A;  4OMM A;  1M8M A;  1PG5 B;  2EPD A;  2X9H A;  1EFN A;  1JU5 C;  1VYT A;  2RPN A;  1QW1 A;  2EKO A;  5LJ5 e;  2QYZ A;  4RMO A;  1BBZ A;  2DL7 A;  1N6A A;  4M7A B;  4M7D B;  3DB3 A;  1TUD A;  1Y71 A;  5I2S A;  3HRT A;  2XI9 A;  2EJ9 A;  2FB7 A;  2OAW A;  4J6W A;  2QI2 A;  3VS6 A;  5LJ3 d;  4F7U B;  3VS0 A;  3X25 B;  4DEX A;  1W2B S;  4IIO A;  1OUL A;  3CCS T;  2F5K A;  3G4S A;  3I55 Q;  5IXF A;  1VQM Q;  4Y91 A;  2KBT A;  5GAM e;  1UTI A;  2P4T A;  3L2R A;  1QWF A;  4XAX B;  1VQ7 Q;  2DZ9 A;  2RQV A;  1M4Z A;  2AKK A;  2RM4 A;  2MIO A;  5FU7 C;  2QQA A;  4M78 F;  1Q82 C;  3VYG A;  3CPW A;  2DFU A;  1B34 B;  3EG9 B;  1K73 C;  3EG1 A;  5GMK j;  3CXC A;  1PSF A;  2DKG A;  1HYO A;  1KHC A;  3H6Z A;  3A8O B;  3VV0 A;  3CC2 T;  1YI2 T;  1M2O A;  2DNU A;  4PJN A;  2E70 A;  3J7A F;  1ZLM A;  2K4Y A;  3QO3 A;  4FSS A;  1M90 C;  1KSW A;  1Q81 U;  5CIU A;  1M1F A;  3M0U A;  3NMZ C;  3CCR Q;  1ACM B;  1BU1 A;  3L1A A;  3VU3 C;  2CT4 A;  3I5R A;  1VQK T;  1T0H A;  5GMK i;  3RDV A;  2KEA A;  2HMA A;  2QEX T;  2DJZ A;  4M7D D;  2NWM A;  1PKT A;  3A98 A;  1NLP C;  3WVE B;  1GBQ A;  2MYS A;  4LUD A;  1FYN A;  3P8D A;  2W10 A;  1K8A U;  2GBQ A;  1YFN A;  4C8Q G;  3L2W A;  1JEG A;  1WHG A;  3CME A;  4BE1 A;  1WHM A;  4EIK A;  3QWX X;  2KE9 A;  2PVG B;  2KRM A;  1FMW A;  1WFW A;  2CSQ A;  3D7S B;  2BUD A;  2DIL A;  1AT1 B;  4AG1 C;  3OYH A;  3CC2 Q;  5LJ5 g;  4RTW A;  2HBP A;  4BAC A;  1ZUU A;  2CP7 A;  1PCX A;  2J6O A;  4ZNX A;  1XOV A;  4M4Z A;  3H41 A;  3INZ A;  3OYD A;  5LJ3 h;  1MGQ A;  4J8O A;  1YJN A;  2O01 E;  4IUP A;  4BB7 A;  3JSC A;  4EMK B;  2G6F X;  4O5V A;  4J9H A;  2QQS A;  2EYY A;  1VQ9 A;  3MP6 A;  3RMQ A;  1VQN A;  1GL5 A;  3VRY A;  1YIJ A;  2I2L A;  1VYV A;  2EFI A;  3A8H B;  3CCQ T;  2FG0 A;  3CC7 A;  1WA7 A;  2YDL A;  3E9F A;  4QKU A;  5LL6 S;  1HK9 A;  1R77 A;  3CC4 A;  5A2Q E;  3A8M B;  3N5B B;  3ZFJ A;  3JB9 I;  3GP8 A;  2KK4 A;  4M7A F;  5CKF A;  3OS2 A;  1VQP T;  5KCH A;  5IH2 A;  1H3H A;  2QXF A;  1GCQ A;  1YHQ A;  3E2U A;  4OP0 A;  3ZBD A;  4Z8A A;  4F7U F;  1K0X A;  4M77 C;  4PJO A;  2EAY A;  2DK3 A;  1QVF A;  3OYN A;  3JCM h;  1GCP A;  2KNB B;  4BI8 B;  4HVV A;  2YLB A;  4ANJ A;  1EX4 A;  1H8K A;  2R5A A;  4C92 B;  1ZBX A;  1KK7 A;  2AHJ B;  2DJQ A;  2K2V A;  5LJ3 e;  2P0Q A;  2CP3 A;  1K9M R;  2O2O A;  2WAC A;  1WYX A;  2JUF A;  1VQL A;  3TSZ A;  1WXB A;  1T3S A;  1M27 C;  4MZP A;  1RAC B;  3SFM A;  4QT7 A;  1NEG A;  1UGR B;  4XU2 A;  2E1H A;  5IHI A;  2CDT A;  2XID A;  2QDY B;  3G6E A;  5FWB A;  2KQW A;  3LX7 A;  2EYQ A;  3EAE A;  2X4Y A;  2DL3 A;  2K9G A;  2DRK A;  3G4S T;  1JXM A;  1W2B A;  3OYG A;  1W6X A;  2A0F B;  2DE0 X;  3VS1 A;  1AVZ C;  4CRI A;  1WQW A;  4C5G A;  3CCU A;  3LH0 A;  4F04 B;  2XIC A;  2X3W D;  5AT1 B;  1B7T A;  4HCB A;  4D8K A;  3QSU A;  3MEW A;  1VYU A;  4IIM A;  3QYG B;  4C0F A;  2COZ A;  3JCM e;  5KYW A;  1SRL A;  2G3R A;  3BDL A;  3H9N A;  2R58 A;  2O88 A;  2COW A;  2RJC A;  3FJ5 A;  3HTR A;  4JRK A;  2QK0 A;  2ZGW A;  4LUE A;  1Z9Z A;  4M78 E;  2HDA A;  4JUV A;  1SG5 A;  2QDL A;  3L2Q A;  5KYX B;  4FM4 B;  1YWO A;  5KYU A;  5GAN d;  1ZUK A;  2RN8 A;  2EQU A;  2RA2 A;  2K3Y A;  1WLP B;  1ZX6 A;  3C0C A;  4NS5 A;  4OB0 B;  2E3H A;  3TSW A;  3OS1 A;  2ENM A;  3QZ9 B;  2J06 A;  2OTJ A;  3PNW C;  5GAO n;  1BK2 A;  1RL2 A;  1VQ8 A;  2QAS A;  1VQO T;  1KHI A;  4JLI A;  4KGX B;  5GMK h;  1RAG B;  1ZUY A;  3SEM A;  2YUQ A;  5A0L A;  1WHK A;  3CPW P;  5I11 A;  3G7Z A;  2K3B A;  2DXB A;  1OI1 A;  4JRI A;  2YLC A;  2KGT A;  5GMK m;  2HQH A;  3CXC P;  4ZGE B;  5LJ3 g;  4NL2 A;  3AT1 B;  4II1 A;  1M30 A;  3O8V A;  2AZS A;  1MNE A;  2RMO A;  1OPL A;  3CCM T;  4J9G A;  3FB9 A;  2KRN A;  2RJD A;  2FVU A;  4M7D C;  2YUN A;  4M7A C;  4MDW A;  3VS7 A;  1M1K U;  1QWE A;  3OYM A;  2HL5 C;  1KG1 A;  1M2V B;  1M90 R;  4N0A C;  1QVG S;  3R6N A;  1BI0 A;  2E5K A;  1IXD A;  1ZHI A;  1D1C A;  1IZ6 A;  1S72 A;  4DQ2 A;  1VQN T;  1OZ3 A;  3JCM J;  4O6J A;  4LD9 K;  4RKU E;  1ZBJ A;  1YIJ T;  1UJY A;  1VQO Q;  1N27 A;  3TQ7 P;  4C92 F;  1ABQ A;  2AT1 B;  1JJ2 A;  1PD0 A;  4E7I A;  1G3Y A;  3QHS A;  1BCO A;  4XTW A;  4X1V A;  1QMC A;  2DL5 A;  1BYM A;  1KJW A;  4DOV A;  3CC4 T;  4JPB W;  2O4X B;  1FXX A;  2ZAE A;  5GMK e;  4YTL A;  5J39 A;  4EPC A;  2LT4 A;  2A36 A;  3EFO A;  4M75 A;  2CKK A;  3VS3 A;  3I56 A;  3OYI A;  3CCM Q;  1WPY A;  1YHQ T;  1KQS S;  1UUE A;  3RKX A;  3X28 B;  2L2P A;  1YWP A;  3PMT A;  3M57 A;  4FL6 A;  3VJP A;  4M7A E;  2HL3 A;  2ECZ A;  2FZK B;  2KDS A;  3SWN C;  4X9D A;  1TS9 A;  3RR6 A;  4HKE A;  4PLI A;  4PJO G;  3O5Z A;  4M78 B;  2EIF A;  1M3A A;  1MMD A;  3TVT A;  4F7U E;  5GJV B;  3JB9 F;  1U1S A;  2ZPG B;  1ZSG A;  2QA4 A;  1BKB A;  4Y92 A;  1VQN Q;  2MMP A;  1VQL T;  2RHZ A;  2DXT A;  5CKB A;  2MK5 A;  3ME9 A;  2M16 A;  1YIJ Q;  1UEB A;  3V8L A;  4ZTJ A;  3ULR B;  3OSV A;  1U1T A;  2DTI A;  5A0D A;  5GAO m;  1UGV A;  1BI1 A;  4EMH A;  1MMN A;  3G6E T;  3CC4 Q;  2DYI A;  4CC2 A;  2RH2 A;  2KAF A;  3SDZ A;  4M77 A;  1SHF A;  1X27 A;  2RK2 A;  1V1C A;  3BW1 A;  4MZT A;  2LQW A;  2X4W A;  1NEB A;  4ZGD B;  2E41 A;  4F16 A;  1YHQ Q;  3CCU T;  3GBQ A;  1WHH A;  1YJW T;  1QVF P;  1X2K A;  1KC8 U;  3IQL A;  2B86 A;  1VQ4 A;  1K9M C;  1MND A;  5L8R E;  1VQ5 Q;  1LCK A;  1YCS B;  3EHR A;  3X26 B;  4OB1 B;  1FMK A;  1NM7 A;  4QVC A;  4F17 A;  4L5G A;  2FPD A;  2D0Q B;  1U3O A;  3QJ6 A;  2X3X D;  1Q86 C;  4VUB A;  2AKL A;  2LCS A;  1GFC A;  4J83 A;  4M78 D;  4LE9 A;  2E10 A;  1E6G A;  3MJX A;  3G6E Q;  4XU1 A;  3BE3 A;  3BDU A;  1C6V X;  1HSQ A;  3THK A;  3GNF B;  4E7K A;  1W2B P;  1Z9Q A;  3KBG A;  3LYI A;  1AWX A;  2EGA A;  2CZ6 B;  4ESR A;  3RBB B;  1NJI C;  7AT1 B;  2OTJ T;  1XTD A;  3C12 A;  1D3B A;  1YJW Q;  2VGM A;  5KYN A;  3H0H A;  4FU6 A;  2DD4 A;  3NTK A;  4JS5 A;  1LJO A;  2C0O A;  2PVO B;  4XK8 E;  1WI7 A;  2ESW A;  3M54 A;  3KUF A;  1RLP C;  2KT1 A;  4BI3 A;  1G83 A;  1I1J A;  1WDX A;  1D1B A;  2F5T X;  3CCE A;  4HCK A;  2EW3 A;  2GNC A;  2DVE A;  4OVA A;  4OMF B;  4C8Q F;  1MMA A;  2LZ6 B;  3JRZ A;  3JCM P;  2FEI A;  3OS5 A;  1QKW A;  2R57 A;  4BDZ A;  2YRC A;  1SSH A;  4FYW B;  5IXB A;  3M0P A;  4LD6 A;  1YIT T;  4RCB A;  2FO0 A;  1NG2 A;  3QWY A;  5CAI A;  2E5Q A;  1TTH B;  2RNA A;  2E6N A;  2Y4Y A;  1QVG A;  1M9S A;  3L2U A;  5C6S A;  1S72 T;  1QP2 A;  2OTJ Q;  1BB9 A;  1Y0M A;  4OMQ A;  8AT1 B;  4RTT A;  3EHQ A;  3MP1 A;  3OYB A;  2H8H A;  2KVQ G;  1RUW A;  5GAN 8;  2H3E B;  4OML A;  3HFO A;  2MAM A;  3QUI A;  5GAN g;  2D1X A;  1OQK A;  1WNL A;  5GAN 2;  2K7A A;  3JAM E;  2XU8 A;  1ZSZ C;  4HVW A;  3LWI A;  4E7J A;  3EG0 A;  4M7D A;  3I56 T;  3REA B;  3FC3 A;  4OMN A;  4IKF A;  4C92 E;  2DAQ A;  1OX9 A;  1MV0 B;  4N0A A;  1KQS A;  2DX1 A;  5CR2 A;  4M75 G;  4OB3 B;  5HK0 A;  2KXD A;  1X6G A;  2NUP A;  4MMK A;  4M7A D;  1YIT Q;  3CCS Q;  1IGQ A;  1SRM A;  4D6W A;  5J3B A;  4ELZ C;  2AIR B;  2LTO A;  1MHN A;  4BY6 B;  3V7R A;  2LQ8 A;  2VV5 A;  3ER0 A;  2QA4 T;  4L6V 5;  4JDS A;  2LJ0 A;  2JS0 A;  2YWW A;  2L3Q A;  4J6Y A;  1Q7Y U;  1G3T A;  1AHJ B;  4PJJ A;  1JJ2 P;  2OTL A;  1Q81 C;  2P0K A;  4D8D A;  1DJ7 B;  1E7O A;  3EG9 A;  1E6H A;  3A8L B;  4DBR A;  1JRI A;  4CC4 B;  3I5S A;  1S1N A;  1BIB A;  2QTX A;  1ABO A;  2DF6 A;  2JOY A;  4FIB A;  3P8H A;  4OF1 A;  1MV3 A;  1X01 A;  2HEQ A;  3M53 A;  1NYG A;  1YI2 Q;  2KYB A;  5D6X A;  4V2S A;  1YBY A;  1K8A C;  1IHV A;  1M8V A;  3GPL A;  3SWN A;  3CCV A;  1I0C A;  3JCM W;  4KUD K;  4M77 G;  1VA7 A;  1VQK Q;  2FPF A;  2ATC B;  2DBK A;  3VS4 A;  4XTZ A;  4A4H A;  1QLY A;  3V8J A;  4IUQ A;  4A4K A;  4FYY B;  2QEX Q;  2VKN A;  5ECA A;  3DLM A;  2D8H A;  5GAN j;  3JCM c;  2PUO B;  1H3Z A;  2V1R A;  2EJF A;  5GAN f;  4UC4 A;  5KE3 A;  4PJO B;  1UJ0 A;  2FRY A;  2JTF A;  1JJ2 S;  1QKX A;  2X4J A;  2ZPF B;  3QJY A;  2BE9 B;  2EVR A;  2HQE A;  3OW2 S;  3OYK A;  2M1H A;  4JS4 A;  4C5I A;  2LP5 A;  1RAI B;  3PT9 A;  2K57 A;  2DL4 A;  2D8J A;  4IUV A;  1AWO A;  3M0S A;  4JJD A;  1KD1 U;  1YN8 A;  4C0D C;  2RQT A;  2LNH B;  3VS2 A;  1WHJ A;  1OU8 A;  2D6F A;  4MZM A;  3OYF A;  2A7Y A;  2LMJ A;  3UAT A;  4K11 A;  2L5Q A;  2LDM A;  3QG1 A;  2FRW A;  2JMA A;  4JZ3 A;  4J6X A;  3P8B B;  4PL6 A;  2WSF E;  2FHD A;  4PFP A;  3L2Z A;  1LPL A;  2IVW A;  4JJN K;  1GBR A;  2J05 A;  3CMA A;  1I5L A;  4M78 C;  3CCE T;  1PRL C;  1KFZ A;  1SF9 A;  2K6D A;  1I07 A;  2RHU A;  3VRZ A;  4FSX A;  1G3W A;  4RG8 A;  5CK9 A;  1GXI E;  3CCQ Q;  4PJL A;  4L59 A;  2ED1 A;  3H0I A;  1WX6 A;  5GAO l;  4Y28 E;  1Q86 R;  3MEU A;  4KT0 E;  3CCL A;  3SB2 A;  5KYW B;  5GAO r;  1W4S A;  4KGV B;  5KE2 A;  1VQP Q;  3Q1J A;  1Y96 A;  2X4X A;  4C8Q E;  4ELY C;  3FJP A;  5KYY A;  3QPH A;  3CCJ A;  2DER A;  5FWC A;  1XJW B;  1C1A A;  2SEM A;  1V29 B;  3C4S A;  1P92 A;  3NTH A;  5KYU B;  1HJD A;  4BI4 A;  2IG0 A;  1W70 A;  1UGP B;  1TSF A;  1YJ9 A;  5EG2 A;  1NJI R;  1AZE A;  1CSK A;  2OI3 A;  4J9B A;  1U8R A;  3OSS C;  3EG3 A;  2RB6 A;  4C0G A;  1PC0 A;  1SSF A;  3ZL7 C;  2M0Y A;  2F2W A;  3NFC A;  3AHU A;  5FU6 B;  1AEY A;  9ATC B;  3G71 A;  4OGC A;  3HPW A;  4Z88 A;  4C92 D;  1H92 A;  4HCC A;  2M0O A;  3GIB A;  4WTO B;  1B3Q A;  3RUX A;  4M7D G;  2DLP A;  3RKW A;  2EKH A;  1F1B B;  2JJ9 A;  1K0S A;  3VUB A;  4RUG A;  3R6O A;  3G4S Q;  2COY A;  1QVG P;  3MHX A;  3LGF A;  4R0K A;  2BKD N;  2AZV A;  2CP6 A;  3RKY A;  2DTH A;  4GBQ A;  1FX7 A;  4GLM A;  5FRO A;  1N8R U;  4QVD A;  3EH1 A;  2RK1 A;  4PK4 A;  2Y4X A;  3OBY A;  3HRS A;  2OX7 A;  4A53 A;  3CME T;  1VQM A;  2OTL T;  1UFF A;  2Y90 A;  4PJO F;  1ZSZ A;  5GAN 5;  1VQ7 A;  3M5A A;  2QQ9 A;  1UB4 A;  3S6W A;  4ORZ A;  3PVQ A;  3NPF A;  3JB9 D;  2QAZ A;  3UPU A;  1T0J A;  2DPP B;  2CH4 W;  4N4I A;  2XD0 A;  5GAN 4;  3CEY A;  2KR3 A;  1ARK A;  4RTU A;  2DIG A;  1TOV A;  3CCV T;  1KQS P;  2B8A A;  2CP0 A;  1I8F A;  2L3S A;  2A3L A;  3V8K A;  3HKS A;  2XDP A;  1YJN T;  4FT2 A;  1C0M A;  3EFO B;  4M75 B;  1M5Q 1;  6AT1 B;  3CCR A;  2CP5 A;  3X20 B;  4JJB A;  3FRN A;  2K79 A;  4IUT A;  1VQ9 T;  4N4H A;  4CI0 C;  3OBW A;  1BI3 A;  5GJW B;  1RAE B;  3QYH B;  4Z89 A;  1NE8 A;  3L42 A;  1JXO A;  1X69 A;  2YSQ A;  3LLR A;  4ZTF A;  3CME Q;  4EDU A;  1M1K C;  3OW2 A;  3CC7 T;  4C8Q B;  4GLK A;  3MPU B;  4ME7 A;  1V76 A;  4AMC A;  1Q81 R;  2KSS A;  3GF5 A;  2VAS A;  1NPR A;  2VYT A;  1K1Z A;  1WQ7 A;  1XQH A;  5D7U A;  5FW9 A;  2DTO A;  4LNP A;  2RHI A;  4C5H A;  4RTX A;  1BIA A;  5I22 A;  3H0F A;  1VIF A;  5GAN h;  1SKU B;  2AK5 A;  2ROL A;  4AFS C;  5GAM d;  1LOJ A;  3CC2 A;  1K8A R;  4C5E A;  3OYJ A;  3S3N A;  2KMT A;  2O31 A;  4GY5 A;  4M77 B;  1YJN Q;  1Q7Y R;  1RLQ C;  1U06 A;  1KIK A;  2RI5 A;  3CMA T;  1VQ9 Q;  1OYX A;  1ZA2 B;  4E47 A;  2RI2 A;  1K76 A;  4BY6 C;  1SEM A;  4QVZ A;  2D9T A;  3EGD B;  2E64 A;  2DVJ A;  1VUB A;  2EGE A;  3HP9 A;  2JVV A;  2CS7 A;  5FRM A;  4QQ6 A;  1CKB A;  3CC7 Q;  2KRO A;  3QKJ A;  3CCL T;  2YHT A;  5GAN 6;  4IUU A;  2IPO B;  2RQR A;  2GQI A;  3UA7 A;  4C8Q D;  3CCJ T;  5GAO q;  1TWB A;  4JRQ A;  1ZQ1 A;  1GRI A;  2CSI A;  2JM8 A;  3FEO A;  3QDF A;  3UWN A;  5DLQ E;  2X35 A;  2ZCF B;  2FL7 A;  2VWF A;  3G1J A;  1YJ9 T;  2ZZD A;  3ASK A;  3DB4 A;  2FYK A;  4M78 A;  3WVD B;  1Y07 A;  5GAN e;  2XG8 D;  1RAF B;  2K5L A;  2R5M A;  4J9I A;  2BIV A;  3EGU A;  3JCM b;  1GCQ C;  4AFU C;  2CH4 A;  4EMK C;  1PNJ A;  3H8Z A;  2NUT B;  2XDD A;  3URG A;  3EGX A;  1VQL Q;  1OV3 A;  4KGZ B;  2HQX A;  3G71 T;  1KD1 R;  1T3L A;  2V8J A;  5CKH A;  1VOM A;  2ZPH B;  1PD1 A;  4LDW A;  1PSE A;  1KC8 C;  2HSP A;  2E4H A;  3KXT A;  5DLO A;  3E9G A;  1X2Q A;  3CCL Q;  1UEC A;  1QCO A;  2ZPB B;  3CD6 A;  3OMC A;  2EYW A;  3PIP A;  1FWZ A;  2J7I A;  5J26 A;  2EQJ A;  2EYZ A;  3M0T A;  2K5I A;  1BI2 A;  3PIO A;  3CCJ Q;  3UT1 A;  3CCU Q;  1VQ8 T;  2EQI A;  1G8X A;  5HK3 A;  4M75 F;  2M02 A;  2RJE A;  1VQM T;  2QGF B;  1YJ9 Q;  1OEB A;  3MET A;  3JV3 A;  3SHW A;  1VQ7 T;  3S3M A;  4C92 C;  2P4R A;  4QQD A;  2NUZ A;  3VKI A;  4KH1 B;  4B9W A;  1JO8 A;  2GQV A;  5CKE A;  3PVL A;  3RMS A;  2KT8 A;  4FYX B;  2LNV A;  3JCM Q;  1MMG A;  3FLG A;  1AD5 A;  4PJO E;  2BTT A;  3CQT A;  3OY9 A;  2L3R A;  2M9U A;  2ED0 A;  4E2F B;  2JMC A;  1QP3 A;  2JNG A;  4J9E A;  1D09 B;  1WHL A;  5GAO p;  2JS2 A;  2KRS A;  2K2M A;  2HBW A;  2JM9 A;  2CUB A;  4CC3 A;  2CZ1 B;  3LWH A;  1Q82 U;  3CCR T;  3TCJ A;  1WIE A;  4ZN3 A;  2L8D A;  2BE7 D;  4BD3 A;  2QGG A;  4OMO A;  1B07 A;  1K73 U;  1VQ8 Q;  4BE0 A;  4M77 F;  3QII A;  2VGN A;  4B9X A;  2WSC E;  2DET A;  4ZGJ B;  2NUP B;  4FYV B;  1EZZ B;  2HCK A;  4DBH A;  1RI0 A;  3CPF A;  3HRU A;  3TEE A;  1TUG B;  2LCC A;  1M90 U;  1WZO A;  4P5N A;  1W1F A;  4M7A A;  2I0N A;  3VS5 A;  4IUR A;  5FU6 C;  3OS0 A;  1G3S A;  3EH2 A;  3OB9 A;  3MO8 A;  2QTV A;  3M59 A;  4F7U A;  2DXU A;  4KBM B;  3CBO A;  5I2M A;  2RJF A;  1J3T A;  1N8R R;  2XKO C;  3OYE A;  2K5F A;  3MP8 A;  1VQ6 A;  2DD5 A;  2O9V A;  2YT6 A;  3X24 B;  2GFA A;  2DIQ A;  4MDX A;  4A4G A;  1S72 Q;  5EC7 A;  3RER A;  3SWN B;  4RTY A;  1D0Y A;  4AFQ C;  3M55 A;  2HNI A;  3JCM d;  2LJ1 A;  2NLU A;  4AT1 B;  1B34 A;  1D0X A;  1N5Z A;  1TU0 B;  3OW2 P;  2DZC A;  2HD0 A;  4BUG A;  1WXU A;  3EG2 A;  3OQ5 A;  1YCY A;  1IO6 A;  2WSE E;  2PU9 B;  5GMK l;  4KUL A;  4HT9 A;  1NYF A;  2PUK B;  1VQO A;  4LDU A;  1M1K R;  1IB8 A;  3QBY A;  4JLG A;  2QG9 B;  3C95 A;  3I56 Q;  3TU4 K;  2CZ0 B;  2XK0 A;  4DOW A;  4DBF A;  4DEY A;  3KFV A;  2F1L A;  1JBM A;  2HAX A;  3F70 A;  4AG2 C;  3QZ5 B;  3FDR A;  2PNI A;  4F14 A;  1Q7Y C;  1VQ4 T;  4FT4 A;  4E7Z A;  5KCO A;  3CCM A;  2H3J A;  4XTY A;  2LC4 A;  4RCC A;  3RIR A;  1UHF A;  1TUC A;  4DA4 A;  4JZ4 A;  1A0N B;  3MEV A;  3EFS A;  4M75 C;  4OMP A;  2GGR A;  4FCY A;  2EBP A;  3MKD A;  1M3C A;  1U5S A;  2QA4 Q;  1PHT A;  4M78 G;  5IT9 E;  1AZG B;  2GTO A;  5FRN A;  3PTA A;  2LCL A;  3NHN A;  3A1P A;  2QQB A;  3UA6 A;  4J9C A;  2Z0W A;  1TG0 A;  2RHY A;  4C8Q C;  1CKA A;  3M0R A;  5GAM g;  2LT1 A;  2DRM A;  1PWT A;  3PMI A;  3OMG A;  4KH0 B;  2F69 A;  3CD6 T;  1UG1 A;  1MUZ A;  2MWO A;  2IIM A;  4RG2 A;  4FW1 A;  2KXC A;  3BY7 A;  2CYZ B;  3CBM A;  4E7S A;  2J6F A;  4A4E A;  1X6B A;  1WJQ A;  4A63 B;  2LX9 A;  3MCA B;  2JTM A;  4M7D F;  1WJR A;  3SD4 A;  3OA6 A;  2L3P A;  1VQ4 Q;  2A37 A;  4EMK A;  4J5Y A;  1Y96 B;  2VVK A;  2DXC A;  4HVU A;  1R0B G;  2CUD A;  1TXQ A;  1KD1 C;  5KYY B;  4OGE A;  2CT3 A;  2C06 A;  5CKD A;  1IHW A;  2LQN A;  4M75 E;  1UE9 A;  1OZ2 A;  2YRD A;  1VQ5 A; 
#chains in the Genus database with same CATH homology
 2D0Q B;  2E6Z A;  3V8K A;  3HKS A;  3M4Y A;  2XDP A;  3QJ6 A;  1YJN T;  4FT2 A;  3L1A A;  3VU3 C;  4M75 B;  4A4F A;  4VUB A;  1Q86 C;  1M5Q 1;  1XNI A;  1VQK T;  5GMK i;  3CCR A;  3X20 B;  4PJO D;  4PNO A;  3FRN A;  4IUT A;  2QEX T;  1VQ9 T;  2DJZ A;  4J83 A;  5I21 A;  4M7D D;  4M78 D;  4MML A;  4N4H A;  2E10 A;  5LJ5 j;  4CI0 C;  1KQ1 A;  3OBW A;  1BI3 A;  3QYH B;  1NE8 A;  3L42 A;  3OYA A;  5LJ5 f;  3WVE B;  4XU1 A;  3BDU A;  3LLR A;  4ZTF A;  3P8D A;  4EDU A;  1M1K C;  1K8A U;  3GNF B;  3OW2 A;  3CC7 T;  2P0P A;  4C8Q B;  4E7K A;  4GLK A;  4C8Q G;  2K3X A;  3L2W A;  3KBG A;  3LYI A;  4ME7 A;  3CME A;  4BE1 A;  4XU0 A;  2CZ6 B;  1N9S A;  3M56 A;  3HHT B;  2KSS A;  1NJI C;  3GF5 A;  2OTJ T;  4C92 A;  1NPR A;  1XTD A;  1WGS A;  2VYT A;  4JRP A;  2PVG B;  3C12 A;  1KQ2 A;  1D3B A;  1WQ7 A;  1XQH A;  2VGM A;  4OB2 B;  5GAM j;  2LQK A;  2DTO A;  4BE2 A;  2RHI A;  4C5H A;  2BUD A;  4FU6 A;  1BIA A;  2DD4 A;  2RD1 A;  3NTK A;  4JS5 A;  5GAM f;  1LJO A;  2PVO B;  4XK8 E;  5FU7 B;  1YJW A;  1VIF A;  3OYH A;  5GAN h;  3M54 A;  3KUF A;  5LJ5 g;  5CQY A;  2HBP A;  4M77 E;  4BAC A;  5GAM d;  3OYC A;  3M58 A;  4BI3 A;  3GOX A;  1LOJ A;  2F5T X;  3RES A;  3CCE A;  3E1S A;  3CC2 A;  3GLX A;  4C5E A;  1R8O B;  1XOV A;  3OYJ A;  4XU3 A;  2DVE A;  2KMT A;  3S3N A;  4OVA A;  3INZ A;  2EQK A;  4GY5 A;  4M77 B;  4OMF B;  5LJ3 h;  3JRZ A;  4C8Q F;  3OYD A;  3JCM P;  1MGQ A;  4M7A G;  3OS5 A;  1JB0 E;  2RI5 A;  3CMA T;  2R57 A;  4J8O A;  3JCM X;  4BDZ A;  1QVP A;  1YJN A;  2O01 E;  4IUP A;  5HKC A;  1OYX A;  3DKM A;  4E47 A;  2RI2 A;  4HA8 A;  4BB7 A;  2JN0 A;  4BY6 C;  1Y7X A;  1VQ6 T;  4QVZ A;  3JSC A;  4EMK B;  4O5V A;  5C0M A;  2D9T A;  2QQS A;  2E64 A;  1VQ9 A;  4F7U G;  4LD6 A;  3MP6 A;  3RMQ A;  1VQN A;  1VUB A;  1YIT T;  2LRQ A;  2JVV A;  2CS7 A;  3HP9 A;  4RCB A;  1Q82 C;  5FRM A;  5CAI A;  2E5Q A;  4QQ6 A;  1YIJ A;  2I2L A;  2E6N A;  2EJG A;  2Y4Y A;  4TVR A;  1QVG A;  3DLL A;  2EFI A;  3A8H B;  3J80 E;  1X6O A;  3CCQ T;  1M9S A;  3QKJ A;  3L2U A;  3CCL T;  3I55 A;  1G5V A;  5C6S A;  4QQG A;  2YHT A;  3CC7 A;  1S72 T;  5GAN 6;  3E9F A;  4IUU A;  1QP2 A;  5LL6 S;  1HK9 A;  4ZN1 A;  3CC4 A;  4PKC C;  5A2Q E;  3A8M B;  3N5B B;  3ZFJ A;  3JB9 I;  3GP8 A;  2KK4 A;  4M7A F;  4HCZ A;  5CKF A;  1X75 C;  4C8Q D;  3MP1 A;  2V8K A;  3OS2 A;  5CVI A;  2GF7 A;  3OYB A;  2KVQ G;  5KCH A;  3CCJ T;  5GAO q;  1VQP T;  5GAN 8;  4JRQ A;  1ZQ1 A;  4HT8 A;  2QXF A;  3HFO A;  4J7I A;  3FEO A;  3UWN A;  2MAM A;  3QUI A;  5GAN g;  3M9Q A;  1WNL A;  1YHQ A;  4LDY A;  5GAN 2;  5DLQ E;  3M4G A;  4OP0 A;  2X35 A;  1WJS A;  2ZCF B;  3ZBD A;  2FL7 A;  4M77 C;  4F7U F;  2EAY A;  5DM7 R;  3VYH B;  2DK3 A;  2XU8 A;  2ZZD A;  1YJ9 T;  1N8R C;  4PJO A;  5CO7 A;  3LWI A;  3EFR A;  3ASK A;  4E7J A;  3DB4 A;  4M7D A;  2FYK A;  4M78 A;  5D6Y A;  3WVD B;  1Y07 A;  5GAN e;  3I56 T;  3FC3 A;  3OYN A;  1QVF A;  4IKF A;  2XG8 D;  3JCM h;  4C92 E;  2XDB A;  2K5L A;  2R5M A;  2KY9 A;  4BI8 B;  3FIF A;  2DAQ A;  4LD9 K;  2BIV A;  2YLB A;  4X34 A;  1M1G A;  3JCM b;  4EMK C;  3H8Z A;  4E7H A;  3WXM B;  2OAU A;  2R5A A;  4C92 B;  4N0A A;  2XDD A;  1ZBX A;  3URG A;  2AHJ B;  4ATO A;  1KQS A;  1EIF A;  4QW2 A;  2K2V A;  5LJ3 e;  5CR2 A;  2P0Q A;  1TH7 A;  4M75 G;  4OB3 B;  1UGS B;  5HK0 A;  2HQX A;  3G71 T;  3V7S A;  5KH6 A;  2WAC A;  2V8J A;  4MMK A;  5CKH A;  2ZPH B;  4M7A D;  2JUF A;  1VQL A;  4LDW A;  2VXF A;  2E65 A;  1PSE A;  4D6W A;  1KC8 C;  5J3B A;  1N9R A;  4ELZ C;  3KXT A;  4KUI A;  4MZP A;  3SFM A;  2VC8 A;  2LTO A;  1MHN A;  5DLO A;  3E9G A;  4A54 A;  3CCS A;  4BY6 B;  1YIT A;  1UGR B;  4XU2 A;  2MI6 A;  3V7R A;  2E1H A;  2ZPB B;  3CD6 A;  2LQ8 A;  2VV5 A;  2XID A;  3ER0 A;  5LJ5 d;  2QDY B;  2QA4 T;  4L6V 5;  3OMC A;  3G6E A;  4JDS A;  3PIP A;  2KQW A;  1FWZ A;  4J6Y A;  1Q7Y U;  1G3T A;  1AHJ B;  3LX7 A;  2OTL A;  2EYQ A;  1Q81 C;  2P0K A;  5J26 A;  1DJ7 B;  2X4Y A;  2EQJ A;  3EAE A;  3HL8 A;  2K5I A;  2YRV A;  2ZPI B;  1BI2 A;  3C94 A;  3PIO A;  3OYL A;  3UDC A;  3A8L B;  3G4S T;  3UT1 A;  4Q5W A;  1JRI A;  1W2B A;  1VQ8 T;  5IAY A;  5HY6 A;  2E12 A;  3OYG A;  2QTX A;  1BIB A;  3CPW S;  5HK3 A;  4M75 F;  2JOY A;  5FLX E;  4LDX A;  4FIB A;  2RJE A;  3P8H A;  1NPP A;  4OF1 A;  1WQW A;  5CQX A;  4C5G A;  4CRI A;  3CCU A;  1VQM T;  3JB9 J;  4E7L A;  1X01 A;  3LH0 A;  2VUB A;  3CXC S;  4XTV A;  4N4G A;  2XIC A;  3M53 A;  3MET A;  5M9O A;  4C0D B;  2DEQ A;  1VQ7 T;  3S3M A;  5D6X A;  3JCM g;  4V2S A;  4C92 C;  4X9C A;  4QQD A;  1YBY A;  3VUZ A;  5GAN 7;  1K8A C;  1YI2 A;  1M8V A;  3GPL A;  4HCB A;  3QSU A;  3MEW A;  3SWN A;  3VKI A;  2ZPE B;  3CCV A;  4B9W A;  4KUD K;  3QYG B;  4C0F A;  3JCM W;  2GQV A;  4M77 G;  5CKE A;  5CCA A;  3JCM e;  3A5Z B;  3HFN A;  3JAM E;  3RMS A;  2G3R A;  2PVD B;  4XQ3 A;  4XTZ A;  2JZ2 A;  3BDL A;  4A4H A;  2LNV A;  5DY9 A;  2R58 A;  3V8J A;  1NZ9 A;  3FLG A;  2RJC A;  4IUQ A;  3JCM Q;  4A4K A;  1VQ5 A;  4JRK A;  3DLM A;  3MEA A;  1VQK A;  4PJO E;  2ZGW A;  5AYF A;  3OY9 A;  3JCM c;  5GAN j;  4EMG A;  2PUO B;  2RHX A;  4M7D E;  2L3R A;  4M78 E;  1H3Z A;  3OYY A;  2M9U A;  4JUV A;  4LDV A;  2DO3 A;  2QEX A;  2EJF A;  5GAN f;  3OW2 S;  4UC4 A;  5KE3 A;  3S3O A;  1VQ5 T;  4R56 A;  4WF2 A;  2V8I A;  1QP3 A;  2XHC A;  4M75 D;  4C8Q A;  3L2Q A;  2JNG A;  1M90 C;  4PJO B;  2JTF A;  2O4X A;  4FM4 B;  5GAO p;  1JJ2 S;  5GAN d;  1H64 1;  3BFM A;  4NOY A;  2GFU A;  2X4J A;  5LJ3 j;  2ZPF B;  3QJY A;  2CZ1 B;  3TRE A;  2HQE A;  2EQU A;  3OYK A;  3LWH A;  3CCR T;  2M1H A;  2RA2 A;  3TCJ A;  4ZN3 A;  2L8D A;  2K3Y A;  4JS4 A;  1Q82 U;  4BD3 A;  5LJ3 f;  4C5I A;  3PT9 A;  4NS5 A;  4OB0 B;  1K73 U;  2L89 A;  4C0Z A;  2K57 A;  4BE0 A;  4M77 F;  3QII A;  2VGN A;  4IUV A;  1K9M U;  4B9X A;  1I81 A;  2RO0 A;  3OS1 A;  1KD1 U;  3QZ9 B;  2WSC E;  4C0D C;  3PNW C;  2OTJ A;  5GAO n;  4ZGJ B;  1RL2 A;  1VQ8 A;  1VQO T;  1KHI A;  4JLI A;  2D6F A;  1O9S A;  3LGL A;  5GMK h;  2QQR A;  2VXE A;  3CBP A;  1RI0 A;  3CPF A;  4MZM A;  2A7Y A;  3HRU A;  3OYF A;  3TEE A;  5D6W A;  4HT9 A;  4XTX A;  2L5Q A;  2LCC A;  2LDM A;  5A0L A;  3QG1 A;  1M90 U;  3G7Z A;  2DXB A;  1OI1 A;  4JRI A;  2YLC A;  4P5N A;  1UGQ B;  4M7A A;  4J6X A;  3P8B B;  1Q86 U;  5GMK m;  4PL6 A;  2GCX A;  2WSF E;  1VIE A;  4IUR A;  4ZGE B;  2PQW A;  2LVM A;  4NL2 A;  5LJ3 g;  3L2V A;  2FHD A;  1I4K 1;  5FU6 C;  3OS0 A;  1G3S A;  3L2Z A;  3A8G B;  4II1 A;  3NTI A;  3O8V A;  2IVW A;  2MWP A;  3OB9 A;  3MO8 A;  4JJN K;  4BDY A;  3M59 A;  3CCM T;  4C92 G;  4F7U A;  2DXU A;  1HXD A;  2CGH A;  1D3B B;  4KBM B;  4R55 A;  3CBO A;  3FB9 A;  5I2M A;  4PJO C;  3CMA A;  2RJD A;  2FVU A;  1I5L A;  2RJF A;  4M78 C;  4M7D C;  4M7A C;  5LJ5 h;  3PGG A;  4M77 D;  3CCE T;  3ZEH A;  2XKO C;  4MDW A;  1M1K U;  3OYE A;  2K5F A;  3MP8 A;  1VQ6 A;  3OYM A;  2RHU A;  3E19 A;  2DD5 A;  4FSX A;  3X24 B;  2GFA A;  1KG1 A;  1G3W A;  4RG8 A;  1O75 A;  5CK9 A;  1GXI E;  4N0A C;  5A0G A;  2DIQ A;  4L59 A;  3JCM f;  1NJI U;  1QVG S;  4MDX A;  3JCM V;  1BI0 A;  4A4G A;  3RER A;  5GAO l;  3SWN B;  4Y28 E;  2CZ7 B;  3M55 A;  2HNI A;  3MEU A;  4KT0 E;  3JCM d;  5GAN 3;  1ZHI A;  3SB2 A;  3CCQ A;  3CCL A;  2NLU A;  1IZ6 A;  3V7C A;  5GAO r;  1S72 A;  1W4S A;  4PLL A;  1B34 A;  4DQ2 A;  3QDR B;  5KE2 A;  1VQN T;  1OZ3 A;  3JCM J;  2MF2 A;  2DZC A;  4O6J A;  2HD0 A;  3Q1J A;  3GNG A;  1Y96 A;  2X4X A;  4BUG A;  4RKU E;  4C8Q E;  1YIJ T;  4ELY C;  5GAM h;  1N27 A;  4C92 F;  3T9N A;  3FJP A;  3LW5 E;  1JJ2 A;  3OQ5 A;  1YCY A;  3QPH A;  1VQP A;  2WSE E;  2PU9 B;  2EWN A;  5GMK l;  1G3Y A;  3PFS A;  4KUL A;  4NL3 A;  3I55 T;  3CCJ A;  2PUK B;  3QHS A;  4XTW A;  4LDU A;  1VQO A;  5IN1 A;  1BYM A;  4J7F A;  1LNX A;  4DOV A;  3CC4 T;  1V29 B;  2O4X B;  1FXX A;  3C4S A;  3QBY A;  1P92 A;  4JLG A;  3NTH A;  3C95 A;  5GMK e;  3HSB A;  3TU4 K;  4YTL A;  4BI4 A;  2CZ0 B;  2IG0 A;  2XK0 A;  4DOW A;  3JB9 H;  1UGP B;  5J39 A;  3JB9 G;  1YJ9 A;  4EPC A;  1QVF S;  1JBM A;  4E7I A;  2LT4 A;  3F70 A;  5EG2 A;  2HAX A;  2EQM A;  3QZ5 B;  4M75 A;  2RI3 A;  2CKK A;  3I56 A;  1U8R A;  3FDR A;  3J81 E;  3OSS C;  3OYI A;  2RB6 A;  1Q7Y C;  4Z02 A;  1IRE B;  1WPY A;  1YHQ T;  1VQ4 T;  4FT4 A;  4C0G A;  3QXE B;  1KQS S;  1SSF A;  5KCO A;  4XTU A;  3NFC A;  3RKX A;  3X28 B;  3CCM A;  3AHU A;  3PMT A;  5FU6 B;  2H3J A;  4XTY A;  3M57 A;  2LC4 A;  4FL6 A;  4RCC A;  3RIR A;  3VJP A;  4DA4 A;  3G71 A;  4M7A E;  4OGC A;  3MEV A;  3HPW A;  3EFS A;  2KDS A;  4M75 C;  3SWN C;  4C92 D;  4X9D A;  1QW1 A;  2EKO A;  4HCC A;  2M0O A;  4HKE A;  5LJ5 e;  4PLI A;  4RMO A;  3GIB A;  4PJO G;  1N6A A;  4M7A B;  4M7D B;  4M78 B;  2EIF A;  3DB3 A;  3RUX A;  4M7D G;  4M78 G;  5IT9 E;  1Y71 A;  4F7U E;  5I2S A;  3JB9 F;  3RKW A;  3HRT A;  1U1S A;  2ZPG B;  3PTA A;  2XI9 A;  5FRN A;  2EJ9 A;  2LCL A;  2FB7 A;  1BKB A;  2QA4 A;  2MMP A;  3VUB A;  1VQL T;  2RHZ A;  2DXT A;  3R6O A;  4J6W A;  2QQB A;  5CKB A;  2QI2 A;  3ME9 A;  2M16 A;  3MHX A;  3LGF A;  5LJ3 d;  4F7U B;  2RHY A;  4C8Q C;  2BKD N;  5GAM g;  1UEB A;  3V8L A;  2LT1 A;  3RKY A;  3X25 B;  2DTH A;  4ZTJ A;  1W2B S;  3OSV A;  1U1T A;  2DTI A;  1FX7 A;  5A0D A;  5GAO m;  2F5K A;  3CCS T;  3G4S A;  5FRO A;  3PMI A;  1N8R U;  3OMG A;  4QVD A;  2RK1 A;  2F69 A;  1BI1 A;  4Y91 A;  4EMH A;  3CD6 T;  2MWO A;  2Y4X A;  3G6E T;  3OBY A;  4RG2 A;  3HRS A;  5GAM e;  3BY7 A;  2P4T A;  3L2R A;  3CME T;  4A53 A;  1VQM A;  4XAX B;  2OTL T;  2DZ9 A;  2RH2 A;  4M7D F;  1M4Z A;  2KAF A;  2CYZ B;  3SDZ A;  2Y90 A;  3CBM A;  4M77 A;  4PJO F;  4A4E A;  1WJQ A;  5GAN 5;  2RM4 A;  2LX9 A;  3MCA B;  1VQ7 A;  2JTM A;  5FU7 C;  1WJR A;  2QQA A;  2RK2 A;  3M5A A;  4M78 F;  2QQ9 A;  3BW1 A;  3SD4 A;  4MZT A;  3OA6 A;  1UB4 A;  2X4W A;  3VYG A;  3S6W A;  4ZGD B;  2E41 A;  3CPW A;  3CCU T;  1B34 B;  1YJW T;  1K73 C;  3JB9 D;  4EMK A;  4J5Y A;  1KC8 U;  1Y96 B;  3UPU A;  2DPP B;  5GMK j;  2DXC A;  3CXC A;  1PSF A;  2DKG A;  1VQ4 A;  1K9M C;  1KD1 C;  4OGE A;  1KHC A;  4N4I A;  3H6Z A;  2XD0 A;  5GAN 4;  3A8O B;  3VV0 A;  3CEY A;  2C06 A;  5L8R E;  5CKD A;  1YI2 T;  3CC2 T;  2DIG A;  3CCV T;  2E70 A;  3J7A F;  3X26 B;  2B8A A;  4M75 E;  2K4Y A;  4OB1 B;  1OZ2 A;  1I8F A;  3QO3 A;  4QVC A;  4L5G A;  2A3L A;  1Q81 U;  5CIU A;  1M1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...