1OZ2A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
324
structure length
324
Chain Sequence
b'ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
molecule tags Transcription
source organism Homo sapiens
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
total genus 83
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A03
2EKOA 3L2QA 4BACA 4FL6A 2CKKA 2X4XA 4C5IA 2DAQA 4UC4A 4BE2A 2R57A 4C5GA 3OS0A 4N4HA 2WACA 3UT1A 1XNIA 2LRQA 2B8AA 4QW2A 4Z02A 4BE0A 4E7KA 3S3NA 2LCCA 2RHIA 2EQMA 2XK0A 3OYJA 2RO0A 2IG0A 4A4FA 3LH0A 3LGFA 5D6WA 3FC3A 3DB4A 5FRNA 4HCZA 2XDPA 1OZ3A 3PFSA 3MEUA 4A4HA 3OYCA 4B9XA 3L2WA 4PLLA 3FEOA 4IKFA 2F5KA 2GF7A 5KH6A 4A4GA 2R58A 2RHUA 3OYIA 3OMGA 4RG2A 3L2RA 2D9TA 3MP6A 4N4IA 2VYTA 3PMIA 3DB3A 3OY9A 4CRIA 3OA6A 4QQGA 3ZEHA 3OYMA 4QVZA 2FHDA 2L8DA 3CEYA 4N4GA 2RHZA 3OYBA 3OMCA 3PMTA 3S6WA 5FRMA 4E7HA 4BD3A 3LX7A 4IUQA 5KE2A 1MHNA 3L2UA 3L2VA 2QQRA 3KUFA 2O4XA 4BE1A 4II1A 2RI5A 2RHXA 3QKJA 2BUDA 4GY5A 5KCOA 2RI2A 3OYEA 4LD6A 2LTOA 3MEVA 2X35A 2G3RA 2X4YA 2EQJA 3LLRA 5J26A 4L59A 1N27A 3OYFA 2K3YA 4ZTJA 3SD4A 2PQWA 3BDLA 2DIQA 3META 2GFUA 2K3XA 5FROA 2EQUA 4A4EA 2RJFA 4BDYA 2M16A 4IUUA 5CIUA 1KHCA 4IUTA 2HQXA 3MEWA 2RJDA 1RI0A 3ASKA 3OS2A 1WJQA 2E5QA 4OVAA 1WJSA 3L42A 4PLIA 4QQ6A 3LGLA 4B9WA 2JTFA 3P8DA 4E7LA 5IAYA 3S3OA 3H6ZA 3FLGA 4Q5WA 3OB9A 3PNWC 2LVMA 2M1HA 3QIIA 2P0KA 4E7IA 2BKDN 3F70A 2QQSA 1OYXA 3C4SA 3E9GA 2EQKA 3OQ5A 4IUPA 4FU6A 3H8ZA 3P8HA 2MWOA 3QJ6A 2RHYA 2BIVA 4EDUA 3GOXA 2NLUA 1SSFA 2M0OA 4ZTFA 3OS1A 3NTIA 4IUVA 3EAEA 4QQDA 1OI1A 3NTKA 5D6YA 4BDZA 5D6XA 2HQEA 2L3RA 5IN1A 5KCHA 4X34A 2R5AA 4IURA 2JZ2A 1G5VA 1WGSA 4C5HA 3MEAA 3MP8A 2X4WA 3M9QA 3LYIA 3UWNA 2RJEA 2O4XB 2LDMA 3NTHA 5KE3A 2MWPA 3OYAA 2R5MA 3OYLA 3MP1A 2DIGA 2E6NA 3FDRA 1OZ2A 3ME9A 3MO8A 1H3ZA 2YRVA 3OYKA 3DLMA 2L89A 2EFIA 3O8VA 3OYNA 3OYHA 5J39A 3OYGA 3S3MA 5C6SA 4E7JA 2RI3A 4NS5A 3QBYA 3OYDA 2RJCA 4C5EA 5M9OA 3Q1JA 4PL6A 5C0MA 2GFAA 1WJRA 3E9FA
chains in the Genus database with same CATH superfamily
1E6GA 1IGUA 4JRIA 4C5IA 1ZSGA 3QZ5B 2DYBA 4C92G 2MIOA 3NGPA 3JCMX 3J81E 4WF2A 3RBBB 1WXUA 2E65A 1E7OA 5AYFA 2EYXA 4J6WA 1D0YA 3G4SA 2RPNA 2DEQA 1QVFP 1M90U 4HVWA 4MMLA 2GF7A 2R58A 2D9TA 2E41A 3OYMA 2ZPIB 1MV0B 4N4GA 2DVEA 3OYBA 2JTEA 2DTHA 3LX7A 2DFUA 3G6ET 3M59A 1JQQA 3CPWP 3MEVA 4RMOA 1N27A 3JCMJ 1UGSB 2YWWA 1A0NB 4M78A 2F2XA 1N6AA 1O75A 2W10A 2YLCA 4MDXA 3RKWA 2OTJT 1EIFA 3CCRA 1KQSS 3EG9B 3EGUA 3QYHB 3SDZA 1YHQA 5FU7B 1QP3A 4E7IA 1EZZB 4C0FA 2YDLA 2X3XD 2RQUA 3QJ6A 4L5GA 1VQ7A 4IUVA 1OI1A 3FJPA 3NTKA 5D6XA 1AT1B 3OBYA 2RQWA 3PVLA 4D8DA 3PVQA 4M7DD 2NYSA 1NYFA 2RQVA 2AZSA 1N9SA 2HMAA 2LQNA 4LDWA 2CT3A 1QQJA 3QG1A 3JB9D 4FSSA 3UDCA 1D1AA 1YBYA 4PL6A 1K9MC 4PNOA 1W2BA 4HKEA 1Q81C 4ORZA 2VV5A 2BZXA 5I2MA 1UGRB 3I5SA 1B34B 2XDDA 2FZKB 4HXJA 1VQ5A 1OV3A 2COWA 4BE0A 4YTLA 1ABQA 1ZUUA 3CC4T 1OPLA 2JMCA 4LDXA 2EGAA 5KYNA 1V29B 1G3WA 1QVGA 2RQRA 2RD1A 3BDUA 4IKFA 3OS5A 2EJ9A 2L2PA 4CC3A 3OMGA 3MKDA 2DZCA 1GFDA 1M3AA 5CKFA 1YJWT 3CCQA 1BI3A 3OMCA 3CXCA 1QKXA 3C12A 1M30A 1NEGA 2DETA 1VQKA 3V8LA 4F04B 2DBKA 1WXTA 1DJ7B 2PVDB 8AT1B 1YJWA 3CCQT 4JLIA 3OYFA 2NUPA 4VUBA 2JOYA 1PM3A 1AZGB 1VQNT 2M16A 1Y07A 4JJDA 3ASKA 2D1XA 2E1HA 2AT1B 4M75G 4M77E 2JTFA 4JZ3A 1S72A 3FLGA 1TXQA 3I5RA 3VS7A 1M27C 3CPFA 4FSXA 4HT9A 4DBHA 4M7DB 2X3WD 4Y28E 3E9GA 3C4SA 2YRCA 4M7AE 2MWOA 2COYA 2EJGA 2QEXT 1ZX6A 2LJ3A 4PFOA 4OMQA 2VGNA 2YRDA 1MUZA 2K5LA 4HVUA 2HAXA 1M1KR 2DJZA 3LYIA 2LDMA 3ZBDA 3RUXA 4ZGEB 3EFOB 1W2BS 4RTUA 3DLMA 3G4ST 4WTOB 1Y96B 5C6SA 3S3MA 1PSFA 1RL2A 4K11A 3QXEB 1OPKA 3A8LB 2QASA 1NZ9A 2FG0A 1WYXA 1Y0MA 1B3QA 2G6FX 3SWNB 3QZ9B 4OGEA 3OS0A 4OGCA 2EVRA 2ED0A 1YWOA 4QW2A 4RTZA 2V8KA 4QT7A 4EMKC 4RKUE 1YJNT 1ZBXA 5D6WA 2IVWA 2QQBA 3DB4A 5FRNA 2XDPA 2CP2A 3PFSA 2X9HA 4X9DA 4A4HA 1NBEB 1N5ZA 5A0GA 4A4GA 3V8KA 2EJFA 4DA4A 1VQ6A 3VKIA 3PMIA 3CC2T 1SHFA 4C8QC 4Z89A 1VQKT 1M2OA 2HL5C 1UG1A 4RTYA 4LDVA 2A3LA 3EGXB 3CC7A 3JB9F 5GAMj 3CCLA 2X35A 2QXFA 1QWEA 3V7CA 5D7UA 1Y96A 1I81A 4AMCA 3UA6A 4A4EA 5CIUA 3HL8A 3CCEQ 2E5QA 2F69A 2HBPA 4B9WA 1LVKA 2QG9B 1ZSZA 2NUTB 4OB0B 1X6BA 1UHCA 3QIIA 4N0AC 2CYZB 4A63B 3JCMb 4ESRA 4KBMB 4D8KA 1X75C 3VYGA 3I56A 4FT2A 1I0CA 4J9DA 3JCMe 3TSWA 2RHYA 2BIVA 2LZ6B 2V8IA 2DK3A 3HFOA 4Z88A 4XTZA 3I56Q 1AEYA 1QW1A 3URGA 4E47A 1UJ0A 1JJ2S 4J9BA 1UGPB 2O4XB 2EKHA 2EFIA 5LJ3g 2O9VA 3UF4A 2YUPA 3ER0A 5LJ5h 4LNPA 1PD1A 4M4ZA 5M9OA 5GANh 1K0XA 1F1BB 2GFAA 1WJRA 3EG1A 2LX7A 2JXBA 3PGGA 4FL6A 2CKKA 2L0AA 2E4HA 1Q82C 1XTDA 1KC8R 2K2MA 4RG8A 3VS4A 1UB4A 4XTWA 2DERA 1T0HA 4C8QD 5GAMg 3CC4A 2IIMA 5KYYA 1SEMA 3WVEB 1Q95G 4ANJA 2QA4Q 1VIEA 4OMMA 4Y91A 1CKBA 2DTOA 3JCMc 3ZL7C 1NLPC 2HDAA 1WQWA 1PCXA 5A0LA 2OAWA 1MMNA 2VYTA 2JTMA 2XHCA 2PTKA 3CCMQ 1UDLA 1K8AC 1X2KA 2OTLA 3KFVA 2O4XA 2M51A 2E64A 4LD6A 2K7AA 5GJWB 1WDXA 2G3RA 1Y57A 3GNFB 2H8HA 2FRWA 3BDLA 3CXCS 1KQSA 5LJ3d 2E70A 4KGZB 1BIBA 5DLQE 2HQXA 2RJDA 3BW1A 3RKYA 1QVGP 5FWCA 1TG0A 1SHGA 1NJIR 3CC7Q 4C8QB 2M1HA 2FL7A 2O31A 3QUIA 1SRLA 2E3HA 3CCQQ 1OYXA 3JB9I 5FW9A 3CXCP 2QDYB 2EW3A 1QCNA 2Y4XA 4QQDA 4BI3A 1M1KC 2EYQA 4JLGA 5IN1A 5LJ5g 4X34A 4J9FA 4N0AA 1H641 2X4WA 3VJPA 4J9CA 1M2VB 3UWNA 3M54A 2I2LA 3MP1A 2DL7A 2C0OA 2DIGA 5CAIA 1VQ9A 1VQMA 3SB2A 2E6NA 3V7SA 2VB6A 2K4YA 1D1BA 2MI6A 2YRVA 3OYKA 2XU8A 3OBWA 1YITQ 2EQIA 2DF6A 2LX9A 3E9FA 1YIJA 2CZ1B 2AZVA 1EX4A 2R57A 2XKOC 3TSZA 4EMHA 1WIEA 9ATCB 4C8QA 4ME7A 4A4FA 1VQLA 3M55A 2O9SA 3FC3A 3EH1A 1KD1U 3QDRB 4ZN3A 1AWOA 2O2OA 4KT0E 1GCPA 4C92B 3OYIA 3FJ5A 1H3HA 4XU3A 2DL3A 4M78E 2OTJA 3C95A 2RHZA 3PIOA 4BD3A 2AKKA 2CP6A 3L2VA 4XTUA 4II1A 2KR3A 3I9QA 4FCYA 1WQ7A 2LT1A 3CCVQ 2K3YA 1VQOQ 3META 2DXCA 4OB3B 3M4GA 2J6KA 4NOYA 3CMET 1Q86C 4M77B 1RAEB 5I2SA 1VQOA 3L42A 2HKQB 3CC2Q 4E7LA 4R56A 4JPBW 4M75C 1K9MR 1VQPA 3H0FA 2OTLT 3QWXX 1CSKA 3M0PA 4JJCA 2BKDN 4O5VA 1ZBJA 2QQSA 1Q82U 1X01A 3JB9H 2FPFA 4OMOA 4J8OA 3HTRA 4M78B 5D6YA 2A08A 4JDSA 5KCHA 1D3BB 2V26A 4GLKA 1Q86U 1D0XA 5GANd 4A4KA 1U1SA 1UGQB 5GAOl 2GNCA 2EYWA 4RTTA 3JCMf 2EWNA 3SEMA 3EH2A 1U1TA 2QQ9A 1OX9A 1R8OB 2YHTA 3M0UA 5GAN4 1NJIC 1YITA 2KVQG 2YLBA 4M7DG 1WHMA 2KGTA 4HCKA 2YUQA 1KQ1A 3S3NA 2RHIA 1BI0A 2A28A 1VQ4Q 1G2BA 3CD6T 2DD5A 1W6XA 1AOJA 1W70A 4M77D 3R6OA 2KI7A 2CH4W 2RHUA 3VYHB 4RG2A 1W2BP 1NPRA 1K8AR 2H3JA 1U5SA 4ELYC 5GAMe 2CREA 3CEYA 5GANe 3PMTA 4CI0C 3HPWA 5I21A 1YHQQ 1QP2A 3QDFA 3KUFA 1LJOA 3M58A 2RHXA 4JRQA 3X20B 1NE8A 2OJ2A 5GMKh 3A98A 4IUUA 4D6WA 2CDTA 1KC8C 1ZSZB 1XJWB 1WJSA 2FYKA 2NUTA 2K6DA 2X4JA 3X25B 2KXDA 4CC7A 2NWMA 4F17A 4F7UA 3M56A 1Z9QA 1VQMT 3A8OB 1PC0A 1Q7YR 2RA2A 3CD6Q 1RACB 1N8RU 5GAOp 1P92A 1PD0A 1M8VA 1RUWA 4FU6A 1ZQ1A 3HRSA 1N8RC 3NTIA 1QVFA 4OB2B 1U8RA 4M7DE 1WGSA 3E1SA 5CO7A 3CD6A 2RJEA 3NPFA 1VQPQ 4ZGJB 4J5YA 2RM4A 3FDRA 3MO8A 5J39A 1C0MA 4BI8B 3CCET 1VA7A 2RJCA 4C5EA 2GTOA 5C0MA 4J9HA 3T9NA 2X4XA 3X26B 3TVTA 4CC4B 5CK9A 5GMKl 1C6VX 5A2QE 1ZA1B 2EQMA 2XK0A 3CCLT 2LQWA 2IG0A 3M0TA 5FLXE 4KH0B 2FZCB 1OZ3A 4XTXA 1WNLA 1YI2T 5GANg 1VQ6Q 3EG3A 3OYCA 1HXDA 2K5FA 5GMKe 3G71Q 2MMPA 1VQ7Q 4B6MA 1VQ8A 2XMFA 4C8QG 1VQLT 5LJ3h 4QVZA 2XI9A 4WCIA 2HBWA 2RF0A 2GQIA 4GBQA 2QI2A 3OYYA 2IPOB 3CC7T 5GAN2 1BU1A 2DJQA 2DRMA 4P5NA 3CCRT 2K3XA 1G8XA 3LH5A 2LQ8A 3D7SB 5J3BA 2KSSA 3VV0A 1IXDA 2KY9A 3OS2A 1M90R 3CQTA 4MMKA 1C1AA 2JT4A 2MYSA 4E2FB 3PNWC 1WXBA 1ZLMA 1SRMA 4M7AD 2D8HA 2V1RA 3V7RA 2DL8A 2NLUA 2FZGB 1K76A 3DKMA 1LNXA 3CBMA 2YUOA 3L2ZA 4LXCA 2ZAEA 2PUOB 5KE3A 2R5MA 3RMQA 2FPDA 3QSUA 1VQ5Q 4M7DF 6AT1B 1JO8A 2NUZA 3OSVA 1BIAA 5GAN8 2Y90A 3OYGA 4ZNXA 3CCEA 3OYDA 2RK2A 3CMAQ 1XQHA 3HSBA 3HRTA 3G71T 3GIBA 2HZYA 2FRYA 2MOXA 4M75F 4NL2A 1PHTA 2PZ1A 1XNIA 2DX1A 2MAMA 2B8AA 4RUGA 2DXBA 1N8RR 3LH0A 3CCMA 3PIPA 1OX8A 1W4SA 3P8BB 4FYWB 1Q7YC 4LDUA 5LJ5d 2H3EB 8ATCB 2ZPGB 2GGRA 2L3QA 4PJNA 5GAMd 1UE9A 3RIRA 2L8DA 3AT1B 3C0CA 4E7HA 4KGVB 5KE2A 1WZOA 2V8JA 2GTJA 5CKDA 2CP3A 2K2VA 2YT6A 5KYWB 3E2UA 5HK3A 1WX6A 4L59A 4C92D 3RNJA 5GMKj 2P0QA 2RJFA 1IGQA 3VS6A 3RDVA 1RI0A 3M0RA 1D1CA 5CQYA 1Q7YU 4DOWA 4LDYA 1OEBA 4ATOA 3CCSQ 3JCMQ 3CCUQ 1SG5A 4XTVA 5HCKA 3SFMA 3X24B 2F5TX 2YXYA 5GAMh 4OMNA 1BYMA 2QGFB 3HFNA 3TCJA 2J7IA 3QHSA 1D0ZA 1K9AA 4A54A 1VQ5T 1PRMC 5LJ5e 1SSFA 4DQ2A 1YN8A 3VUBA 3FIFA 3G4SQ 2ROLA 2PVOB 1AVZC 2KE9A 4M7DC 4PJLA 3MCAB 3EG9A 4GLMA 2CUDA 2BZ8A 2LMJA 2DMOA 1X2QA 3A1PA 1YIJQ 2XIDA 1QCFA 2KROA 4E7ZA 4HVVA 1J3TA 1LOJA 1FXXA 3ULRB 2PNIA 2V1QA 2I0NA 1RI9A 2LRQA 1VQ9Q 4NL3A 4LD9K 5GAN7 2WSFE 5CCAA 1TS9A 2NUPB 3HRUA 3VRYA 3EHRA 2O88A 4B9XA 1YI2A 4DOVA 3SWNC 5A0DA 2QQAA 3HHTB 2K3BA 4JS4A 3RERA 3QO3A 3OY9A 2PUKB 5IHNA 1MHNA 3L2UA 1Q86R 4IIOA 4HCBA 1B34A 4JRKA 2CSIA 2RI5A 2DA9A 3QKJA 3CCUA 1N9RA 2L3PA 2XD0A 1WI7A 5AT1B 2LTOA 3VS5A 3M4YA 2FPEA 4FW2A 2DL5A 4BDYA 2HNIA 3CCVA 5EC7A 4F7UB 3LGLA 4AT1B 3S3OA 1RLPC 4JUVA 5LJ3e 1VQNA 1X69A 1ZSZC 2HKNA 3EFOA 2OTLQ 1HYOA 1RABB 1U3OA 4BY6C 2RMOA 1T0JA 1YJNQ 3P8HA 2ZPEB 3GOXA 2DO3A 4J6XA 5GJVB 5EG2A 2LNVA 3OW2S 2MPXC 1JXOA 1I8FA 4Y92A 2CS7A 1AZEA 4KUIA 1SSHA 1JB0E 5KYXB 2E5KA 3IQLA 1KK7A 1V76A 1YCYA 2KRSA 3CCJA 2RI3A 4OP0A 3G1JA 3SHWA 4JJNK 2FB7A 1G83A 1YITT 4ZTFA 1KJWA 3GF5A 4BACA 3JCMh 2E10A 3E19A 3UT1A 1ZUYA 1YWPA 1PKSA 4XU2A 5IH2A 2CP0A 3EFRA 2HL3A 2QGGA 4PLLA 1UEBA 3J7AF 4M7AG 2EPDA 5KH6A 1W1FA 4OB1B 3G7ZA 4EMGA 1AD5A 1PKTA 3ZEHA 2L5QA 4XTYA 4C8QF 3OSSC 3VUZA 5FRMA 2FVUA 4KUDK 5CKEA 5I22A 1M90C 2CP5A 3OW2A 3G6EQ 1VQ4A 4RTWA 2BUDA 4PJOE 5KCOA 4EPCA 2J05A 2X4YA 3VS2A 1R0BG 3SD4A 2PQWA 1GXIE 5HKCA 4IUTA 1UTIA 1PRLC 3GNGA 1KD1C 4PLIA 2JUFA 3CPWA 3P8DA 4BUGA 4Q5WA 1FMVA 1RAAB 1YCSB 1KG1A 4AFQC 4JS5A 1M1FA 1WPYA 4C0GA 3CCUT 5CKHA 2A0FB 2EQKA 2Z0WA 4OMPA 3I55T 1RLQC 4KULA 2GQVA 3BE3A 2KYBA 1NG2A 4BDZA 2VXEA 2R5AA 1ZUKA 4J7IA 4C5HA 4EMKB 2XDBA 4M7AF 3KXTA 2KBTA 2QK0A 3NTHA 4J7FA 1MV3A 4C0DB 3PE0A 2D6FA 3CCRQ 4M78G 1IO6A 1H3ZA 1VIFA 3UATA 2DEUA 3OYHA 3GP8A 1H92A 2LP5A 3M0SA 1KC8U 2QEXQ 3Q1JA 1AWJA 4E6RA 1R77A 2DAQA 1TTHB 1ZHIA 2HSPA 2VASA 2WACA 1LPLA 1OULA 1YP5A 2QAZA 1AWWA 3TQ7P 1VYVA 4M77G 4X1VA 1IHVA 4HCZA 2WSCE 4ZN1A 3CCVT 1K4US 3RKXA 1JEGA 1ABOA 4RTXA 1H8KA 4BY6B 3MP6A 3VU3C 1VQ8T 1FMKA 1SKUB 1BI2A 3S6WA 4EMKA 1VQ4T 2LJ1A 1U06A 3JAME 1K8AU 4L6V5 2HEQA 1KQ2A 2K9GA 3CCSA 1T3SA 4PJOB 2ECZA 4LUDA 5FWBA 1RAHB 5KYYB 5CR2A 2YUNA 1KHIA 4JZ4A 4KRTA 5FROA 4O6JA 2CZ0B 3REBB 1VQPT 4PK4A 4PJOF 2J6FA 2LNHB 4C0ZA 4OMFB 2ROTA 4QQ6A 1UECA 2RH2A 2KNBB 5GAN6 2JM8A 3OW2P 3QWYA 4FW1A 4ZGDB 1KFZA 1MMGA 1D09B 3OQ5A 2KQWA 2DNUA 1UHFA 4M78C 2DE0X 1MNDA 3LWHA 1PNJA 3G71A 3DLLA 1X27A 1YJ9A 1E6HA 1YI2Q 3SWNA 1YJNA 1TSFA 2HQEA 4XU0A 3NFCA 1VQLQ 1JRIA 3M9QA 1VQ7T 2F2VA 1M3BA 2KRMA 2KT8A 3TU4K 4PJOA 2OI3A 3CC2A 5DLOA 1S72T 3EHQA 1JBMA 3AHUA 2QDLA 4V2SA 4J9EA 4PFZA 3JB9J 2JVVA 4M7AA 1NEBA 4C5GA 1BCMA 4N4HA 1TH7A 2DVJA 4M7AB 1RAGB 3EGXA 3CMEQ 2CH4A 2J06A 1GRIA 1FMWA 2HSEB 2O01E 2KDSA 4C92E 4QVDA 3R6NA 1GL5A 3MPUB 2D0NA 2AHJB 2FEIA 3EFSA 3L2RA 1BBZA 2A37A 4J9IA 3QPHA 2DXTA 1HD3A 2RQTA 1Z9ZA 4XU1A 1S1NA 3KBGA 3REAB 7AT1B 3JCMW 4M7AC 2EAYA 5KYXA 2EYYA 2KK4A 2EQJA 2QA4T 2QTVA 2WSEE 5IXFA 2DIQA 1JJ2P 2QEXA 4HCCA 4XK8E 5LJ3j 1KHCA 1UJYA 3LWIA 1TUGB 1WJQA 3GPLA 1WHJA 4DBQA 5CKBA 4IIMA 3JV3A 1K1ZA 4JRPA 5IAYA 2LCLA 2BTTA 3BY7A 4F7UF 3CBPA 4AG2C 2EGCA 5LJ5f 1I4K1 3H8ZA 5GANf 2K5IA 1KIKA 5GAMf 1YJ9Q 4EDUA 5IHIA 5LL6S 3OS1A 1BCOA 1WHKA 1GBRA 1MGQA 2KYMA 2DRKA 5L23A 2L3RA 3VRZA 3EGDB 4E7SA 3JCMd 5FU6B 2VUBA 1ZA2B 4F16A 3QJYA 2MWPA 1UFFA 1XOVA 2DZ9A 1EFNA 1S72Q 5I11A 1QKWA 1YHQT 3ME9A 2JM9A 1QVGS 3HP9A 1QCOA 1WHHA 3O8VA 3HKSA 3MJXA 1Y7XA 4JJBA 4M77C 5HY6A 3V8JA 3WXMB 2GBQA 2A36A 3L2QA 2C06A 2HD0A 2L3SA 3M57A 4UC4A 1KD1R 1G3YA 1WLPB 4E7KA 2LCCA 4DBRA 1BB9A 2RO0A 3CBOA 1BKBA 4FT4A 2DBMA 1Y71A 2ZCFB 2LT4A 2EGEA 1CKAA 3L2WA 2CT4A 3N5BB 4N4IA 3CCMT 4EIKA 3I55Q 2FHDA 1O9SA 1I07A 2E3IA 3UA7A 4R55A 1ARKA 1QMCA 3EGDA 4BB7A 2M9UA 4OMLA 4PJOG 3CMEA 5GMKm 2JJ9A 5L8RE 1BK2A 5GAN5 3LLRA 2C0TA 2JNGA 2GFUA 2LC4A 2DYIA 2JS2A 2RN8A 4FYVB 4FYYB 3CMAA 2D8JA 2EBPA 2PU9B 1SPKA 2ENMA 2ZZDA 1IHWA 1M2VA 2GCXA 3H6ZA 2BZYA 3OB9A 2P4RA 2SRCA 3FRNA 2KXCA 1VQOT 3F70A 4ELZC 4RCBA 2KMTA 1MNEA 5GAOq 4J6YA 1GFCA 3RMSA 3WVDB 4F7UE 1M1KU 1MMDA 3O5ZA 1WHGA 2LCSA 2C0IA 4QKUA 2QA4A 1Q82R 4IURA 3TREA 2ESWA 4XAXB 3MEAA 2DKGA 4QVCA 1TWBA 1QLYA 1M1GA 4J83A 3JB9G 2VC8A 3CCJT 1NPPA 4NS5A 1RADB 4PJJA 1B7TA 4KGXB 1AWXA 5GMKi 2QTXA 2EKOA 2K79A 2B86A 4C92F 2EYZA 1YNZA 3PT9A 1PG5B 3QYGB 4Z02A 4MZTA 1VOMA 5FU6C 1VQKQ 3PTAA 3OYJA 2ZPBB 1JXMA 4RCCA 5KYUA 2YSQA 3JSCA 3LGFA 2QYZA 3H41A 5KYUB 3EG0A 2ABLA 4BI4A 3FEOA 4M77A 2F5KA 3GLXA 3DB3A 4CRIA 5CQXA 2EIFA 1IB8A 4QQGA 3VS1A 4M7DA 1M5Q1 2QQRA 3TEEA 3CMAT 2FO0A 4GY5A 1UUEA 3OYEA 1FWZA 4MZPA 5J26A 5ECAA 1VYTA 1BI1A 2LJ0A 3M5AA 4F7UG 2EQUA 3L1AA 2VXFA 1TU0B 1D3BA 5HK0A 2VWFA 4OVAA 5LJ3f 1OU9A 3I56T 4MZMA 1G3TA 5GAN3 2DD4A 1K0SA 3M0QA 1GCQA 2P0KA 2J6OA 5KYWA 1X6OA 3I55A 1K9MU 2E6ZA 3UPUA 5GAOr 1HJDA 3H9NA 5LJ5j 2DL4A 1YIJT 1QVPA 3A8MB 2VGMA 5GANj 2CGHA 2JZ2A 1MMAA 4AFSC 1UGVA 2RB6A 4F14A 1K73R 4FYXB 3U23A 4M75A 3OYLA 2DPPB 3A8HB 3THKA 4M75B 1VQ9T 1OZ2A 3EG2A 3QBYA 4M78D 4C92A 1VQ6T 2RI2A 1LCKA 1VUBA 4RTVA 1I5LA 1NLOC 3CCST 3A8GB 3NHNA 4A53A 2X51A 4C8QE 3H0IA 1FYNA 1VQ8Q 2M0YA 1M3CA 1IZ6A 1OOTA 4AG1C 2CSQA 4C92C 2AIRB 3OA6A 4DBFA 3CC4Q 2JN0A 1AHJB 1I1JA 5IXBA 3LW5E 4BE1A 5DY9A 4FIBA 2AKLA 3RR6A 2JW4A 3JRZA 2SEMA 2RNAA 5GAOm 2OX7A 1YFNA 3MEWA 3CCJQ 4CC2A 3J80E 3FB9A 1M8MA 2XICA 2RK1A 1FX7A 1VQMQ 1QWFA 1SF9A 3JCMV 3X28B 4PFPA 3G6EA 2Y4YA 3JCMP 2PVGB 1PSEA 2DLPA 5GAOn 3VS0A 3I35A 1Q81U 2A7YA 2COZA 5IT9E 2M0OA 1VYUA 2BE7D 1GCQC 3RESA 1Q81R 4HT8A 4TVRA 1V1CA 5FU7C 2MCNA 4DEYA 5CVIA 1HK9A 1VQNQ 2E12A 4HA8A 3H0HA 1GBQA 4M75E 1KSWA 2ZGWA 4MDWA 1K73U 1RAIB 1R0CB 2CZ7B 4J9GA 1HSQA 3C94A 4LN2A 4LE9A 2KT1A 2L89A 1K73C 4AFZC 1M4ZA 4BE2A 1YJWQ 1OQKA 2P0PA 2MK5A 1WA7A 2AK5A 1TUDA 1NJIU 1YJ9T 2CUBA 2BE9B 2W0ZA 2VVKA 4KH1B 2OTJQ 3MEUA 2KEAA 3M53A 3JCMg 1KQSP 1RAFB 1QVFS 2F1LA 1WHLA 4DEXA 2HQHA 2K57A 4X9CA 2F2WA 4PJOC 1PWTA 3INZA 4FM4B 4IUQA 2P4TA 1JU5C 4M78F 3CPWS 3GBQA 2DILA 2XG8D 4R0KA 1B07A 2JMAA 1NYGA 4LUEA 2P84A 3CCLQ 3ZFJA 3MHXA 2MF2A 2ZPHB 2LVMA 4M77F 1IREB 4XQ3A 1T3LA 4IUPA 2D0QB 4AFUC 4PJOD 1JJ2A 1ACMB 2CZ6B 2DTIA 1WFWA 3A5ZB 2OAUA 1NM7A 2ATCB 3EAEA 4PKCC 2KRNA 1TOVA 2JS0A 2DM1A 1M9SA 2DXUA 2KAFA 3VS3A 1X43A 1G5VA 4Z8AA 3MP8A 4C0DC 2ZPFB 4M75D 3OYAA 1TUCA 5DM7R 4PJMA 1G3SA 1X6GA 2LQKA 1I5OB 2ED1A 2CP7A 3OYNA 4OF1A 4E7JA 5IHKA 2VKNA 3BFMA 1OU8A 2M02A 2HCKA 1IRXA 3NMZC 4ZTJA
chains in the Genus database with same CATH topology
1LOJA 1FXXA 2CZ1B 4JRIA 3L2QA 2C06A 2HD0A 4C5IA 3M57A 4UC4A 3QZ5B 2R57A 2XKOC 4EMHA 4C92G 2LRQA 3JCMX 3J81E 1G3YA 4WF2A 4E7KA 2LCCA 2E65A 4NL3A 4C8QA 4LD9K 5GAN7 2RO0A 3CBOA 4ME7A 2WSFE 1BKBA 4FT4A 5AYFA 3M55A 1Y71A 4J6WA 2ZCFB 4A4FA 5CCAA 2LT4A 3FC3A 1KD1U 3HRUA 3QDRB 4ZN3A 3G4SA 4KT0E 4B9XA 3L2WA 1YI2A 2DEQA 4DOVA 3SWNC 5A0DA 4C92B 2QQAA 2GF7A 4MMLA 3OYIA 2R58A 3HHTB 1M90U 3N5BB 2D9TA 4JS4A 4N4IA 4XU3A 3CCMT 3RERA 2E41A 3QO3A 4M78E 3OY9A 3OYMA 2OTJA 2ZPIB 2FHDA 4N4GA 1O9SA 2DVEA 2RHZA 3C95A 4R55A 3OYBA 2PUKB 3PIOA 2DTHA 3LX7A 4BD3A 1MHNA 4BB7A 3L2UA 3L2VA 4HCBA 1B34A 2M9UA 4XTUA 4JRKA 3G6ET 4PJOG 4II1A 2RI5A 3CMEA 3QKJA 3CCUA 3M59A 1N9RA 5GMKm 2XD0A 5L8RE 2LTOA 1WQ7A 2LT1A 3M4YA 3MEVA 5GAN5 4RMOA 3LLRA 1N27A 2K3YA 3JCMJ 1UGSB 2JNGA 2GFUA 2LC4A 3META 2DXCA 4OB3B 3M4GA 4M78A 1N6AA 4NOYA 3CMET 1O75A 3CMAA 4BDYA 2YLCA 1Q86C 4M77B 2PU9B 5I2SA 1VQOA 3RKWA 4MDXA 3L42A 2HNIA 2ZZDA 3CCVA 4F7UB 3LGLA 4E7LA 2OTJT 4R56A 1EIFA 3S3OA 3CCRA 1KQSS 2GCXA 3H6ZA 4JUVA 5LJ3e 4M75C 3OB9A 1VQNA 1VQPA 3QYHB 2OTLT 3SDZA 3FRNA 1YHQA 5FU7B 1QP3A 1VQOT 4E7IA 2BKDN 3F70A 4O5VA 4C0FA 4ELZC 4BY6C 2QQSA 4RCBA 1Q82U 1X01A 2KMTA 5GAOq 3JB9H 3P8HA 4J6YA 3QJ6A 4L5GA 3RMSA 3WVDB 4F7UE 2ZPEB 3GOXA 1M1KU 1VQ7A 4J8OA 2DO3A 4J6XA 4IUVA 4M78B 1VQLA 1OI1A 3FJPA 3NTKA 5D6YA 4JDSA 5D6XA 5KCHA 2QA4A 3OBYA 5EG2A 4IURA 3TREA 1D3BB 4XAXB 4GLKA 1Q86U 3MEAA 2LNVA 5GANd 2DKGA 3OW2S 4QVCA 4A4KA 1U1SA 4M7DD 1I8FA 1UGQB 4J83A 1M1GA 5GAOl 1N9SA 2CS7A 4KUIA 3JB9G 2VC8A 1JB0E 3CCJT 4LDWA 3JCMf 1NPPA 1YCYA 2EWNA 3QG1A 2RI3A 4NS5A 4OP0A 3CCJA 3JB9D 3CCQA 1U1TA 3UDCA 2QQ9A 1R8OB 1YBYA 2YHTA 4JJNK 4PL6A 1K9MC 2FB7A 5GAN4 1YITT 4ZTFA 3GF5A 4PNOA 5GMKi 1W2BA 1NJIC 2QTXA 2EKOA 4HKEA 2KVQG 2YLBA 4BACA 3JCMh 1YITA 1Q81C 4M7DG 2VV5A 4C92F 2E10A 5I2MA 1UGRB 2XDDA 1B34B 3E19A 3UT1A 3PT9A 1VQ5A 1KQ1A 3QYGB 4Z02A 4YTLA 4MZTA 4BE0A 5FU6C 2RHIA 3S3NA 1BI0A 3CC4T 3PTAA 4LDXA 3OYJA 2ZPBB 4RCCA 4XU2A 3LGFA 3JSCA 1V29B 1G3WA 1QVGA 2RD1A 3EFRA 3CD6T 2DD5A 4BI4A 4PLLA 4M77D 3BDUA 3FEOA 1UEBA 4M77A 4IKFA 3J7AF 4M7AG 2F5KA 3GLXA 2EJ9A 3OS5A 2RHUA 3R6OA 5KH6A 3OMGA 4OB1B 4RG2A 3VYHB 1NPRA 3G7ZA 4EMGA 2H3JA 2DZCA 3DB3A 4CRIA 5CQXA 2EIFA 4QQGA 5CKFA 2L5QA 4XTYA 3ZEHA 3OSSC 3CEYA 3VUZA 4C8QF 4ELYC 5GAMe 2FVUA 1BI3A 3OMCA 3PMTA 5CKEA 5GANe 4CI0C 3HPWA 3CXCA 1M90C 4KUDK 3C12A 5I21A 3OW2A 1QP2A 1VQ4A 1VQKA 3V8LA 1M5Q1 2QQRA 3KUFA 4M7DA 3TEEA 1LJOA 3M58A 2RHXA 3CMAT 4JRQA 1DJ7B 2BUDA 4GY5A 5KCOA 4PJOE 4EPCA 3OYEA 2PVDB 1FWZA 4MZPA 3X20B 1YJWA 2X4YA 4JLIA 3CCQT 5J26A 1NE8A 3OYFA 1BI1A 3SD4A 2PQWA 3M5AA 5GMKh 1YJWT 4VUBA 2JOYA 4F7UG 2EQUA 1VQNT 3L1AA 1GXIE 5HKCA 2M16A 4IUUA 1Y07A 2VXFA 3GNGA 4IUTA 4D6WA 1D3BA 3ASKA 5HK0A 1KC8C 1KD1C 2E1HA 4M75G 2JUFA 1WJSA 2FYKA 4M77E 4OVAA 4PLIA 3CPWA 5LJ3f 2JTFA 3P8DA 4BUGA 3I56T 2X4JA 3X25B 1S72A 3FLGA 4MZMA 1G3TA 4Q5WA 4F7UA 1KG1A 3M56A 5GAN3 1VQMT 4JS5A 2DD4A 3A8OB 1M1FA 2RA2A 3CPFA 4FSXA 4HT9A 1N8RU 2P0KA 5GAOp 1P92A 1WPYA 4C0GA 3CCUT 4M7DB 5CKHA 4Y28E 1X6OA 3E9GA 3C4SA 3I55A 1M8VA 2EQKA 2E6ZA 1K9MU 3I55T 3UPUA 4FU6A 5GAOr 4M7AE 2MWOA 2EJGA 1ZQ1A 3HRSA 1N8RC 4KULA 5LJ5j 3NTIA 1YIJT 2QEXT 1QVFA 1QVPA 3A8MB 2GQVA 4OB2B 2VGMA 1U8RA 2VGNA 4BDZA 5GANj 4M7DE 2VXEA 2CGHA 2K5LA 2R5AA 2JZ2A 4J7IA 2HAXA 1WGSA 4C5HA 4EMKB 2XDBA 3E1SA 4M7AF 3KXTA 2RB6A 2DJZA 3LYIA 5CO7A 3CD6A 2RJEA 4M75A 2LDMA 3NTHA 3RUXA 3ZBDA 3OYLA 4J7FA 2DPPB 4C0DB 4J5YA 3A8HB 4ZGJB 4ZGEB 2RM4A 4M75B 3FDRA 1VQ9T 1W2BS 2D6FA 1OZ2A 3MO8A 4M78G 1H3ZA 3DLMA 1VIFA 3OYHA 3G4ST 5J39A 3GP8A 1Y96B 5C6SA 3S3MA 1PSFA 4BI8B 3QBYA 3CCET 1RL2A 4M78D 2RJCA 4C5EA 3QXEB 4C92A 1KC8U 3Q1JA 1VQ6T 3A8LB 5C0MA 2RI2A 1NZ9A 1VUBA 3T9NA 2X4XA 2DAQA 3SWNB 3X26B 5CK9A 1I5LA 1ZHIA 3QZ9B 4OGEA 3OS0A 5GMKl 2WACA 4OGCA 4QW2A 2V8KA 4EMKC 5A2QE 1YIJA 2EQMA 2XK0A 4RKUE 3CCLT 2IG0A 3CCST 5FLXE 1YJNT 3A8GB 4A53A 1ZBXA 5D6WA 4M77G 2IVWA 2QQBA 3DB4A 5FRNA 4HCZA 2WSCE 2XDPA 1OZ3A 4ZN1A 3CCVT 4XTXA 1WNLA 3PFSA 3RKXA 4C8QE 1YI2T 4X9DA 4A4HA 5GANg 3OYCA 1HXDA 2K5FA 5GMKe 2MMPA 5A0GA 4A4GA 3V8KA 2EJFA 1VQ8A 4BY6B 4C8QG 1IZ6A 3MP6A 3VU3C 4DA4A 5LJ3h 3VKIA 1VQLT 3PMIA 4C92C 1VQ8T 1VQ6A 3OA6A 3CC2T 4QVZA 1BI2A 3S6WA 4C8QC 4EMKA 1VQ4T 1VQKT 2JN0A 1AHJB 2XI9A 3LW5E 4LDVA 2A3LA 4BE1A 3JAME 1K8AU 5DY9A 4FIBA 4L6V5 3CC7A 1KQ2A 2QI2A 5GAMj 3CCSA 3CCLA 3JB9F 3OYYA 2X35A 3CC7T 4PJOB 5GAN2 2QXFA 4P5NA 3JRZA 3V7CA 5CR2A 1Y96A 1KHIA 1I81A 3CCRT 2K3XA 5FROA 2LQ8A 4O6JA 2CZ0B 5J3BA 4A4EA 1VQPT 2KSSA 5GAOm 4PJOF 5CIUA 3VV0A 3HL8A 3MEWA 2KY9A 4C0ZA 3OS2A 4OMFB 2E5QA 3J80E 4QQ6A 2F69A 2HBPA 3FB9A 2XICA 4MMKA 4B9WA 2RK1A 2RH2A 5GAN6 1FX7A 3PNWC 4OB0B 3JCMV 4ZGDB 3X28B 3G6EA 3QIIA 2Y4YA 3JCMP 4N0AC 2CYZB 3JCMb 4M7AD 2PVGB 4KBMB 1PSEA 1X75C 3OQ5A 2KQWA 3VYGA 5GAOn 4FT2A 3V7RA 3I56A 3JCMe 1Q81U 4M78C 2RHYA 2BIVA 2V8IA 2A7YA 2DK3A 2NLUA 3HFOA 2M0OA 3LWHA 5IT9E 3G71A 3DLLA 1YJ9A 3DKMA 1LNXA 4XTZA 3SWNA 1YJNA 3CBMA 3L2ZA 2HQEA 1QW1A 4XU0A 3RESA 3URGA 4E47A 4HT8A 3NFCA 4TVRA 1JRIA 1UGPB 3M9QA 5FU7C 1JJ2S 1VQ7T 2O4XB 2PUOB 5KE3A 5CVIA 2R5MA 1HK9A 3RMQA 2E12A 4HA8A 3QSUA 4M7DF 4M75E 2ZGWA 3OSVA 1BIAA 4MDWA 2EFIA 5LJ3g 5GAN8 2Y90A 3TU4K 1K73U 3OYGA 3CC2A 3CCEA 5DLOA 1S72T 3ER0A 5LJ5h 2CZ7B 3OYDA 1JBMA 3C94A 2RK2A 1XQHA 5M9OA 3AHUA 5GANh 3HSBA 2L89A 2GFAA 1WJRA 3HRTA 3G71T 1K73C 3GIBA 4V2SA 4M75F 3JB9J 3PGGA 4FL6A 2CKKA 2JVVA 4NL2A 4M7AA 1M4ZA 4BE2A 1Q82C 1XTDA 4C5GA 4RG8A 4N4HA 1TH7A 2P0PA 1UB4A 4M7AB 1XNIA 2MAMA 2B8AA 4XTWA 2DXBA 1NJIU 1YJ9T 4C8QD 5GAMg 3LH0A 3CC4A 2O01E 3CCMA 2KDSA 4C92E 4QVDA 3WVEB 3PIPA 1W4SA 1VIEA 3P8BB 4Y91A 2AHJB 3EFSA 3MEUA 2DTOA 3M53A 3JCMg 3JCMc 1Q7YC 4LDUA 5LJ5d 1WQWA 3L2RA 5A0LA 1QVFS 5FRMA 2K57A 2VYTA 3QPHA 2ZPGB 2JTMA 4X9CA 2XHCA 5GAMd 2DXTA 2L8DA 3RIRA 4E7HA 1K8AC 4PJOC 3INZA 4FM4B 4IUQA 5KE2A 2OTLA 2V8JA 5CKDA 2O4XA 4XU1A 4PJOA 2K2VA 3KBGA 2E64A 2P4TA 3JCMW 4M7AC 4LD6A 2EAYA 4M78F 3CPWS 5HK3A 2G3RA 2KK4A 2EQJA 2QA4T 2XG8D 3GNFB 4L59A 2WSEE 3BDLA 3CXCS 2DIQA 1KQSA 2QEXA 4C92D 5GMKj 4HCCA 2E70A 2P0QA 2RJFA 4XK8E 5LJ3d 5LJ3j 1BIBA 5DLQE 1KHCA 3LWIA 2HQXA 1RI0A 2RJDA 3BW1A 5CQYA 1WJQA 3RKYA 3GPLA 1Q7YU 4DOWA 4LDYA 5CKBA 4ATOA 4JRPA 3ZFJA 5IAYA 3MHXA 3JCMQ 2MF2A 2LCLA 4XTVA 2ZPHB 3SFMA 3BY7A 3X24B 4C8QB 2F5TX 2LVMA 3CBPA 2M1HA 2FL7A 4F7UF 5GAMh 1BYMA 4M77F 3QUIA 3HFNA 3TCJA 5LJ5f 1IREB 1OYXA 4XQ3A 1I4K1 3JB9I 4IUPA 3QHSA 2D0QB 3H8ZA 4PJOD 5GANf 1JJ2A 2CZ6B 2DTIA 2K5IA 4A54A 1VQ5T 5GAMf 3A5ZB 2QDYB 4EDUA 5LJ5e 1SSFA 5LL6S 2OAUA 4DQ2A 2Y4XA 3OS1A 3EAEA 4PKCC 4QQDA 3FIFA 3VUBA 1M9SA 4BI3A 1MGQA 2DXUA 2EYQA 2KAFA 2PVOB 1M1KC 4JLGA 2L3RA 5IN1A 5LJ5g 4X34A 4N0AA 1H641 1G5VA 3JCMd 5FU6B 3MP8A 2VUBA 2X4WA 3VJPA 4C0DC 2ZPFB 4M7DC 3UWNA 4M75D 3QJYA 3M54A 3MCAB 2MWPA 2I2LA 3OYAA 5DM7R 3MP1A 2DIGA 1VQ9A 1G3SA 5CAIA 1XOVA 2DZ9A 1VQMA 2E6NA 2LQKA 3SB2A 3V7SA 2K4YA 1YHQT 3ME9A 2MI6A 1QVGS 2YRVA 3HP9A 3OYKA 3OYNA 4OF1A 3O8VA 3HKSA 2XU8A 3OBWA 4E7JA 1Y7XA 4M77C 5HY6A 2XIDA 3BFMA 2LX9A 3V8JA 4ZTJA 3WXMB 3E9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKO A;  3L2Q A;  4BAC A;  4FL6 A;  2CKK A;  2X4X A;  4C5I A;  2DAQ A;  4UC4 A;  4BE2 A;  2R57 A;  4C5G A;  3OS0 A;  4N4H A;  2WAC A;  3UT1 A;  1XNI A;  2LRQ A;  2B8A A;  4QW2 A;  4Z02 A;  4BE0 A;  4E7K A;  3S3N A;  2LCC A;  2RHI A;  2EQM A;  2XK0 A;  3OYJ A;  2RO0 A;  2IG0 A;  4A4F A;  3LH0 A;  3LGF A;  5D6W A;  3FC3 A;  3DB4 A;  5FRN A;  4HCZ A;  2XDP A;  1OZ3 A;  3PFS A;  3MEU A;  4A4H A;  3OYC A;  4B9X A;  3L2W A;  4PLL A;  3FEO A;  4IKF A;  2F5K A;  2GF7 A;  5KH6 A;  4A4G A;  2R58 A;  2RHU A;  3OYI A;  3OMG A;  4RG2 A;  3L2R A;  2D9T A;  3MP6 A;  4N4I A;  2VYT A;  3PMI A;  3DB3 A;  3OY9 A;  4CRI A;  3OA6 A;  4QQG A;  3ZEH A;  3OYM A;  4QVZ A;  2FHD A;  2L8D A;  3CEY A;  4N4G A;  2RHZ A;  3OYB A;  3OMC A;  3PMT A;  3S6W A;  5FRM A;  4E7H A;  4BD3 A;  3LX7 A;  4IUQ A;  5KE2 A;  1MHN A;  3L2U A;  3L2V A;  2QQR A;  3KUF A;  2O4X A;  4BE1 A;  4II1 A;  2RI5 A;  2RHX A;  3QKJ A;  2BUD A;  4GY5 A;  5KCO A;  2RI2 A;  3OYE A;  4LD6 A;  2LTO A;  3MEV A;  2X35 A;  2G3R A;  2X4Y A;  2EQJ A;  3LLR A;  5J26 A;  4L59 A;  1N27 A;  3OYF A;  2K3Y A;  4ZTJ A;  3SD4 A;  2PQW A;  3BDL A;  2DIQ A;  3MET A;  2GFU A;  2K3X A;  5FRO A;  2EQU A;  4A4E A;  2RJF A;  4BDY A;  2M16 A;  4IUU A;  5CIU A;  1KHC A;  4IUT A;  2HQX A;  3MEW A;  2RJD A;  1RI0 A;  3ASK A;  3OS2 A;  1WJQ A;  2E5Q A;  4OVA A;  1WJS A;  3L42 A;  4PLI A;  4QQ6 A;  3LGL A;  4B9W A;  2JTF A;  3P8D A;  4E7L A;  5IAY A;  3S3O A;  3H6Z A;  3FLG A;  4Q5W A;  3OB9 A;  3PNW C;  2LVM A;  2M1H A;  3QII A;  2P0K A;  4E7I A;  2BKD N;  3F70 A;  2QQS A;  1OYX A;  3C4S A;  3E9G A;  2EQK A;  3OQ5 A;  4IUP A;  4FU6 A;  3H8Z A;  3P8H A;  2MWO A;  3QJ6 A;  2RHY A;  2BIV A;  4EDU A;  3GOX A;  2NLU A;  1SSF A;  2M0O A;  4ZTF A;  3OS1 A;  3NTI A;  4IUV A;  3EAE A;  4QQD A;  1OI1 A;  3NTK A;  5D6Y A;  4BDZ A;  5D6X A;  2HQE A;  2L3R A;  5IN1 A;  5KCH A;  4X34 A;  2R5A A;  4IUR A;  2JZ2 A;  1G5V A;  1WGS A;  4C5H A;  3MEA A;  3MP8 A;  2X4W A;  3M9Q A;  3LYI A;  3UWN A;  2RJE A;  2O4X B;  2LDM A;  3NTH A;  5KE3 A;  2MWP A;  3OYA A;  2R5M A;  3OYL A;  3MP1 A;  2DIG A;  2E6N A;  3FDR A;  1OZ2 A;  3ME9 A;  3MO8 A;  1H3Z A;  2YRV A;  3OYK A;  3DLM A;  2L89 A;  2EFI A;  3O8V A;  3OYN A;  3OYH A;  5J39 A;  3OYG A;  3S3M A;  5C6S A;  4E7J A;  2RI3 A;  4NS5 A;  3QBY A;  3OYD A;  2RJC A;  4C5E A;  5M9O A;  3Q1J A;  4PL6 A;  5C0M A;  2GFA A;  1WJR A;  3E9F A; 
#chains in the Genus database with same CATH topology
 1E6G A;  1IGU A;  4JRI A;  4C5I A;  1ZSG A;  3QZ5 B;  2DYB A;  4C92 G;  2MIO A;  3NGP A;  3JCM X;  3J81 E;  4WF2 A;  3RBB B;  1WXU A;  2E65 A;  1E7O A;  5AYF A;  2EYX A;  4J6W A;  1D0Y A;  3G4S A;  2RPN A;  2DEQ A;  1QVF P;  1M90 U;  4HVW A;  4MML A;  2GF7 A;  2R58 A;  2D9T A;  2E41 A;  3OYM A;  2ZPI B;  1MV0 B;  4N4G A;  2DVE A;  3OYB A;  2JTE A;  2DTH A;  3LX7 A;  2DFU A;  3G6E T;  3M59 A;  1JQQ A;  3CPW P;  3MEV A;  4RMO A;  1N27 A;  3JCM J;  1UGS B;  2YWW A;  1A0N B;  4M78 A;  2F2X A;  1N6A A;  1O75 A;  2W10 A;  2YLC A;  4MDX A;  3RKW A;  2OTJ T;  1EIF A;  3CCR A;  1KQS S;  3EG9 B;  3EGU A;  3QYH B;  3SDZ A;  1YHQ A;  5FU7 B;  1QP3 A;  4E7I A;  1EZZ B;  4C0F A;  2YDL A;  2X3X D;  2RQU A;  3QJ6 A;  4L5G A;  1VQ7 A;  4IUV A;  1OI1 A;  3FJP A;  3NTK A;  5D6X A;  1AT1 B;  3OBY A;  2RQW A;  3PVL A;  4D8D A;  3PVQ A;  4M7D D;  2NYS A;  1NYF A;  2RQV A;  2AZS A;  1N9S A;  2HMA A;  2LQN A;  4LDW A;  2CT3 A;  1QQJ A;  3QG1 A;  3JB9 D;  4FSS A;  3UDC A;  1D1A A;  1YBY A;  4PL6 A;  1K9M C;  4PNO A;  1W2B A;  4HKE A;  1Q81 C;  4ORZ A;  2VV5 A;  2BZX A;  5I2M A;  1UGR B;  3I5S A;  1B34 B;  2XDD A;  2FZK B;  4HXJ A;  1VQ5 A;  1OV3 A;  2COW A;  4BE0 A;  4YTL A;  1ABQ A;  1ZUU A;  3CC4 T;  1OPL A;  2JMC A;  4LDX A;  2EGA A;  5KYN A;  1V29 B;  1G3W A;  1QVG A;  2RQR A;  2RD1 A;  3BDU A;  4IKF A;  3OS5 A;  2EJ9 A;  2L2P A;  4CC3 A;  3OMG A;  3MKD A;  2DZC A;  1GFD A;  1M3A A;  5CKF A;  1YJW T;  3CCQ A;  1BI3 A;  3OMC A;  3CXC A;  1QKX A;  3C12 A;  1M30 A;  1NEG A;  2DET A;  1VQK A;  3V8L A;  4F04 B;  2DBK A;  1WXT A;  1DJ7 B;  2PVD B;  8AT1 B;  1YJW A;  3CCQ T;  4JLI A;  3OYF A;  2NUP A;  4VUB A;  2JOY A;  1PM3 A;  1AZG B;  1VQN T;  2M16 A;  1Y07 A;  4JJD A;  3ASK A;  2D1X A;  2E1H A;  2AT1 B;  4M75 G;  4M77 E;  2JTF A;  4JZ3 A;  1S72 A;  3FLG A;  1TXQ A;  3I5R A;  3VS7 A;  1M27 C;  3CPF A;  4FSX A;  4HT9 A;  4DBH A;  4M7D B;  2X3W D;  4Y28 E;  3E9G A;  3C4S A;  2YRC A;  4M7A E;  2MWO A;  2COY A;  2EJG A;  2QEX T;  1ZX6 A;  2LJ3 A;  4PFO A;  4OMQ A;  2VGN A;  2YRD A;  1MUZ A;  2K5L A;  4HVU A;  2HAX A;  1M1K R;  2DJZ A;  3LYI A;  2LDM A;  3ZBD A;  3RUX A;  4ZGE B;  3EFO B;  1W2B S;  4RTU A;  3DLM A;  3G4S T;  4WTO B;  1Y96 B;  5C6S A;  3S3M A;  1PSF A;  1RL2 A;  4K11 A;  3QXE B;  1OPK A;  3A8L B;  2QAS A;  1NZ9 A;  2FG0 A;  1WYX A;  1Y0M A;  1B3Q A;  2G6F X;  3SWN B;  3QZ9 B;  4OGE A;  3OS0 A;  4OGC A;  2EVR A;  2ED0 A;  1YWO A;  4QW2 A;  4RTZ A;  2V8K A;  4QT7 A;  4EMK C;  4RKU E;  1YJN T;  1ZBX A;  5D6W A;  2IVW A;  2QQB A;  3DB4 A;  5FRN A;  2XDP A;  2CP2 A;  3PFS A;  2X9H A;  4X9D A;  4A4H A;  1NBE B;  1N5Z A;  5A0G A;  4A4G A;  3V8K A;  2EJF A;  4DA4 A;  1VQ6 A;  3VKI A;  3PMI A;  3CC2 T;  1SHF A;  4C8Q C;  4Z89 A;  1VQK T;  1M2O A;  2HL5 C;  1UG1 A;  4RTY A;  4LDV A;  2A3L A;  3EGX B;  3CC7 A;  3JB9 F;  5GAM j;  3CCL A;  2X35 A;  2QXF A;  1QWE A;  3V7C A;  5D7U A;  1Y96 A;  1I81 A;  4AMC A;  3UA6 A;  4A4E A;  5CIU A;  3HL8 A;  3CCE Q;  2E5Q A;  2F69 A;  2HBP A;  4B9W A;  1LVK A;  2QG9 B;  1ZSZ A;  2NUT B;  4OB0 B;  1X6B A;  1UHC A;  3QII A;  4N0A C;  2CYZ B;  4A63 B;  3JCM b;  4ESR A;  4KBM B;  4D8K A;  1X75 C;  3VYG A;  3I56 A;  4FT2 A;  1I0C A;  4J9D A;  3JCM e;  3TSW A;  2RHY A;  2BIV A;  2LZ6 B;  2V8I A;  2DK3 A;  3HFO A;  4Z88 A;  4XTZ A;  3I56 Q;  1AEY A;  1QW1 A;  3URG A;  4E47 A;  1UJ0 A;  1JJ2 S;  4J9B A;  1UGP B;  2O4X B;  2EKH A;  2EFI A;  5LJ3 g;  2O9V A;  3UF4 A;  2YUP A;  3ER0 A;  5LJ5 h;  4LNP A;  1PD1 A;  4M4Z A;  5M9O A;  5GAN h;  1K0X A;  1F1B B;  2GFA A;  1WJR A;  3EG1 A;  2LX7 A;  2JXB A;  3PGG A;  4FL6 A;  2CKK A;  2L0A A;  2E4H A;  1Q82 C;  1XTD A;  1KC8 R;  2K2M A;  4RG8 A;  3VS4 A;  1UB4 A;  4XTW A;  2DER A;  1T0H A;  4C8Q D;  5GAM g;  3CC4 A;  2IIM A;  5KYY A;  1SEM A;  3WVE B;  1Q95 G;  4ANJ A;  2QA4 Q;  1VIE A;  4OMM A;  4Y91 A;  1CKB A;  2DTO A;  3JCM c;  3ZL7 C;  1NLP C;  2HDA A;  1WQW A;  1PCX A;  5A0L A;  2OAW A;  1MMN A;  2VYT A;  2JTM A;  2XHC A;  2PTK A;  3CCM Q;  1UDL A;  1K8A C;  1X2K A;  2OTL A;  3KFV A;  2O4X A;  2M51 A;  2E64 A;  4LD6 A;  2K7A A;  5GJW B;  1WDX A;  2G3R A;  1Y57 A;  3GNF B;  2H8H A;  2FRW A;  3BDL A;  3CXC S;  1KQS A;  5LJ3 d;  2E70 A;  4KGZ B;  1BIB A;  5DLQ E;  2HQX A;  2RJD A;  3BW1 A;  3RKY A;  1QVG P;  5FWC A;  1TG0 A;  1SHG A;  1NJI R;  3CC7 Q;  4C8Q B;  2M1H A;  2FL7 A;  2O31 A;  3QUI A;  1SRL A;  2E3H A;  3CCQ Q;  1OYX A;  3JB9 I;  5FW9 A;  3CXC P;  2QDY B;  2EW3 A;  1QCN A;  2Y4X A;  4QQD A;  4BI3 A;  1M1K C;  2EYQ A;  4JLG A;  5IN1 A;  5LJ5 g;  4X34 A;  4J9F A;  4N0A A;  1H64 1;  2X4W A;  3VJP A;  4J9C A;  1M2V B;  3UWN A;  3M54 A;  2I2L A;  3MP1 A;  2DL7 A;  2C0O A;  2DIG A;  5CAI A;  1VQ9 A;  1VQM A;  3SB2 A;  2E6N A;  3V7S A;  2VB6 A;  2K4Y A;  1D1B A;  2MI6 A;  2YRV A;  3OYK A;  2XU8 A;  3OBW A;  1YIT Q;  2EQI A;  2DF6 A;  2LX9 A;  3E9F A;  1YIJ A;  2CZ1 B;  2AZV A;  1EX4 A;  2R57 A;  2XKO C;  3TSZ A;  4EMH A;  1WIE A;  9ATC B;  4C8Q A;  4ME7 A;  4A4F A;  1VQL A;  3M55 A;  2O9S A;  3FC3 A;  3EH1 A;  1KD1 U;  3QDR B;  4ZN3 A;  1AWO A;  2O2O A;  4KT0 E;  1GCP A;  4C92 B;  3OYI A;  3FJ5 A;  1H3H A;  4XU3 A;  2DL3 A;  4M78 E;  2OTJ A;  3C95 A;  2RHZ A;  3PIO A;  4BD3 A;  2AKK A;  2CP6 A;  3L2V A;  4XTU A;  4II1 A;  2KR3 A;  3I9Q A;  4FCY A;  1WQ7 A;  2LT1 A;  3CCV Q;  2K3Y A;  1VQO Q;  3MET A;  2DXC A;  4OB3 B;  3M4G A;  2J6K A;  4NOY A;  3CME T;  1Q86 C;  4M77 B;  1RAE B;  5I2S A;  1VQO A;  3L42 A;  2HKQ B;  3CC2 Q;  4E7L A;  4R56 A;  4JPB W;  4M75 C;  1K9M R;  1VQP A;  3H0F A;  2OTL T;  3QWX X;  1CSK A;  3M0P A;  4JJC A;  2BKD N;  4O5V A;  1ZBJ A;  2QQS A;  1Q82 U;  1X01 A;  3JB9 H;  2FPF A;  4OMO A;  4J8O A;  3HTR A;  4M78 B;  5D6Y A;  2A08 A;  4JDS A;  5KCH A;  1D3B B;  2V26 A;  4GLK A;  1Q86 U;  1D0X A;  5GAN d;  4A4K A;  1U1S A;  1UGQ B;  5GAO l;  2GNC A;  2EYW A;  4RTT A;  3JCM f;  2EWN A;  3SEM A;  3EH2 A;  1U1T A;  2QQ9 A;  1OX9 A;  1R8O B;  2YHT A;  3M0U A;  5GAN 4;  1NJI C;  1YIT A;  2KVQ G;  2YLB A;  4M7D G;  1WHM A;  2KGT A;  4HCK A;  2YUQ A;  1KQ1 A;  3S3N A;  2RHI A;  1BI0 A;  2A28 A;  1VQ4 Q;  1G2B A;  3CD6 T;  2DD5 A;  1W6X A;  1AOJ A;  1W70 A;  4M77 D;  3R6O A;  2KI7 A;  2CH4 W;  2RHU A;  3VYH B;  4RG2 A;  1W2B P;  1NPR A;  1K8A R;  2H3J A;  1U5S A;  4ELY C;  5GAM e;  2CRE A;  3CEY A;  5GAN e;  3PMT A;  4CI0 C;  3HPW A;  5I21 A;  1YHQ Q;  1QP2 A;  3QDF A;  3KUF A;  1LJO A;  3M58 A;  2RHX A;  4JRQ A;  3X20 B;  1NE8 A;  2OJ2 A;  5GMK h;  3A98 A;  4IUU A;  4D6W A;  2CDT A;  1KC8 C;  1ZSZ B;  1XJW B;  1WJS A;  2FYK A;  2NUT A;  2K6D A;  2X4J A;  3X25 B;  2KXD A;  4CC7 A;  2NWM A;  4F17 A;  4F7U A;  3M56 A;  1Z9Q A;  1VQM T;  3A8O B;  1PC0 A;  1Q7Y R;  2RA2 A;  3CD6 Q;  1RAC B;  1N8R U;  5GAO p;  1P92 A;  1PD0 A;  1M8V A;  1RUW A;  4FU6 A;  1ZQ1 A;  3HRS A;  1N8R C;  3NTI A;  1QVF A;  4OB2 B;  1U8R A;  4M7D E;  1WGS A;  3E1S A;  5CO7 A;  3CD6 A;  2RJE A;  3NPF A;  1VQP Q;  4ZGJ B;  4J5Y A;  2RM4 A;  3FDR A;  3MO8 A;  5J39 A;  1C0M A;  4BI8 B;  3CCE T;  1VA7 A;  2RJC A;  4C5E A;  2GTO A;  5C0M A;  4J9H A;  3T9N A;  2X4X A;  3X26 B;  3TVT A;  4CC4 B;  5CK9 A;  5GMK l;  1C6V X;  5A2Q E;  1ZA1 B;  2EQM A;  2XK0 A;  3CCL T;  2LQW A;  2IG0 A;  3M0T A;  5FLX E;  4KH0 B;  2FZC B;  1OZ3 A;  4XTX A;  1WNL A;  1YI2 T;  5GAN g;  1VQ6 Q;  3EG3 A;  3OYC A;  1HXD A;  2K5F A;  5GMK e;  3G71 Q;  2MMP A;  1VQ7 Q;  4B6M A;  1VQ8 A;  2XMF A;  4C8Q G;  1VQL T;  5LJ3 h;  4QVZ A;  2XI9 A;  4WCI A;  2HBW A;  2RF0 A;  2GQI A;  4GBQ A;  2QI2 A;  3OYY A;  2IPO B;  3CC7 T;  5GAN 2;  1BU1 A;  2DJQ A;  2DRM A;  4P5N A;  3CCR T;  2K3X A;  1G8X A;  3LH5 A;  2LQ8 A;  3D7S B;  5J3B A;  2KSS A;  3VV0 A;  1IXD A;  2KY9 A;  3OS2 A;  1M90 R;  3CQT A;  4MMK A;  1C1A A;  2JT4 A;  2MYS A;  4E2F B;  3PNW C;  1WXB A;  1ZLM A;  1SRM A;  4M7A D;  2D8H A;  2V1R A;  3V7R A;  2DL8 A;  2NLU A;  2FZG B;  1K76 A;  3DKM A;  1LNX A;  3CBM A;  2YUO A;  3L2Z A;  4LXC A;  2ZAE A;  2PUO B;  5KE3 A;  2R5M A;  3RMQ A;  2FPD A;  3QSU A;  1VQ5 Q;  4M7D F;  6AT1 B;  1JO8 A;  2NUZ A;  3OSV A;  1BIA A;  5GAN 8;  2Y90 A;  3OYG A;  4ZNX A;  3CCE A;  3OYD A;  2RK2 A;  3CMA Q;  1XQH A;  3HSB A;  3HRT A;  3G71 T;  3GIB A;  2HZY A;  2FRY A;  2MOX A;  4M75 F;  4NL2 A;  1PHT A;  2PZ1 A;  1XNI A;  2DX1 A;  2MAM A;  2B8A A;  4RUG A;  2DXB A;  1N8R R;  3LH0 A;  3CCM A;  3PIP A;  1OX8 A;  1W4S A;  3P8B B;  4FYW B;  1Q7Y C;  4LDU A;  5LJ5 d;  2H3E B;  8ATC B;  2ZPG B;  2GGR A;  2L3Q A;  4PJN A;  5GAM d;  1UE9 A;  3RIR A;  2L8D A;  3AT1 B;  3C0C A;  4E7H A;  4KGV B;  5KE2 A;  1WZO A;  2V8J A;  2GTJ A;  5CKD A;  2CP3 A;  2K2V A;  2YT6 A;  5KYW B;  3E2U A;  5HK3 A;  1WX6 A;  4L59 A;  4C92 D;  3RNJ A;  5GMK j;  2P0Q A;  2RJF A;  1IGQ A;  3VS6 A;  3RDV A;  1RI0 A;  3M0R A;  1D1C A;  5CQY A;  1Q7Y U;  4DOW A;  4LDY A;  1OEB A;  4ATO A;  3CCS Q;  3JCM Q;  3CCU Q;  1SG5 A;  4XTV A;  5HCK A;  3SFM A;  3X24 B;  2F5T X;  2YXY A;  5GAM h;  4OMN A;  1BYM A;  2QGF B;  3HFN A;  3TCJ A;  2J7I A;  3QHS A;  1D0Z A;  1K9A A;  4A54 A;  1VQ5 T;  1PRM C;  5LJ5 e;  1SSF A;  4DQ2 A;  1YN8 A;  3VUB A;  3FIF A;  3G4S Q;  2ROL A;  2PVO B;  1AVZ C;  2KE9 A;  4M7D C;  4PJL A;  3MCA B;  3EG9 A;  4GLM A;  2CUD A;  2BZ8 A;  2LMJ A;  2DMO A;  1X2Q A;  3A1P A;  1YIJ Q;  2XID A;  1QCF A;  2KRO A;  4E7Z A;  4HVV A;  1J3T A;  1LOJ A;  1FXX A;  3ULR B;  2PNI A;  2V1Q A;  2I0N A;  1RI9 A;  2LRQ A;  1VQ9 Q;  4NL3 A;  4LD9 K;  5GAN 7;  2WSF E;  5CCA A;  1TS9 A;  2NUP B;  3HRU A;  3VRY A;  3EHR A;  2O88 A;  4B9X A;  1YI2 A;  4DOV A;  3SWN C;  5A0D A;  2QQA A;  3HHT B;  2K3B A;  4JS4 A;  3RER A;  3QO3 A;  3OY9 A;  2PUK B;  5IHN A;  1MHN A;  3L2U A;  1Q86 R;  4IIO A;  4HCB A;  1B34 A;  4JRK A;  2CSI A;  2RI5 A;  2DA9 A;  3QKJ A;  3CCU A;  1N9R A;  2L3P A;  2XD0 A;  1WI7 A;  5AT1 B;  2LTO A;  3VS5 A;  3M4Y A;  2FPE A;  4FW2 A;  2DL5 A;  4BDY A;  2HNI A;  3CCV A;  5EC7 A;  4F7U B;  3LGL A;  4AT1 B;  3S3O A;  1RLP C;  4JUV A;  5LJ3 e;  1VQN A;  1X69 A;  1ZSZ C;  2HKN A;  3EFO A;  2OTL Q;  1HYO A;  1RAB B;  1U3O A;  4BY6 C;  2RMO A;  1T0J A;  1YJN Q;  3P8H A;  2ZPE B;  3GOX A;  2DO3 A;  4J6X A;  5GJV B;  5EG2 A;  2LNV A;  3OW2 S;  2MPX C;  1JXO A;  1I8F A;  4Y92 A;  2CS7 A;  1AZE A;  4KUI A;  1SSH A;  1JB0 E;  5KYX B;  2E5K A;  3IQL A;  1KK7 A;  1V76 A;  1YCY A;  2KRS A;  3CCJ A;  2RI3 A;  4OP0 A;  3G1J A;  3SHW A;  4JJN K;  2FB7 A;  1G83 A;  1YIT T;  4ZTF A;  1KJW A;  3GF5 A;  4BAC A;  3JCM h;  2E10 A;  3E19 A;  3UT1 A;  1ZUY A;  1YWP A;  1PKS A;  4XU2 A;  5IH2 A;  2CP0 A;  3EFR A;  2HL3 A;  2QGG A;  4PLL A;  1UEB A;  3J7A F;  4M7A G;  2EPD A;  5KH6 A;  1W1F A;  4OB1 B;  3G7Z A;  4EMG A;  1AD5 A;  1PKT A;  3ZEH A;  2L5Q A;  4XTY A;  4C8Q F;  3OSS C;  3VUZ A;  5FRM A;  2FVU A;  4KUD K;  5CKE A;  5I22 A;  1M90 C;  2CP5 A;  3OW2 A;  3G6E Q;  1VQ4 A;  4RTW A;  2BUD A;  4PJO E;  5KCO A;  4EPC A;  2J05 A;  2X4Y A;  3VS2 A;  1R0B G;  3SD4 A;  2PQW A;  1GXI E;  5HKC A;  4IUT A;  1UTI A;  1PRL C;  3GNG A;  1KD1 C;  4PLI A;  2JUF A;  3CPW A;  3P8D A;  4BUG A;  4Q5W A;  1FMV A;  1RAA B;  1YCS B;  1KG1 A;  4AFQ C;  4JS5 A;  1M1F A;  1WPY A;  4C0G A;  3CCU T;  5CKH A;  2A0F B;  2EQK A;  2Z0W A;  4OMP A;  3I55 T;  1RLQ C;  4KUL A;  2GQV A;  3BE3 A;  2KYB A;  1NG2 A;  4BDZ A;  2VXE A;  2R5A A;  1ZUK A;  4J7I A;  4C5H A;  4EMK B;  2XDB A;  4M7A F;  3KXT A;  2KBT A;  2QK0 A;  3NTH A;  4J7F A;  1MV3 A;  4C0D B;  3PE0 A;  2D6F A;  3CCR Q;  4M78 G;  1IO6 A;  1H3Z A;  1VIF A;  3UAT A;  2DEU A;  3OYH A;  3GP8 A;  1H92 A;  2LP5 A;  3M0S A;  1KC8 U;  2QEX Q;  3Q1J A;  1AWJ A;  4E6R A;  1R77 A;  2DAQ A;  1TTH B;  1ZHI A;  2HSP A;  2VAS A;  2WAC A;  1LPL A;  1OUL A;  1YP5 A;  2QAZ A;  1AWW A;  3TQ7 P;  1VYV A;  4M77 G;  4X1V A;  1IHV A;  4HCZ A;  2WSC E;  4ZN1 A;  3CCV T;  1K4U S;  3RKX A;  1JEG A;  1ABO A;  4RTX A;  1H8K A;  4BY6 B;  3MP6 A;  3VU3 C;  1VQ8 T;  1FMK A;  1SKU B;  1BI2 A;  3S6W A;  4EMK A;  1VQ4 T;  2LJ1 A;  1U06 A;  3JAM E;  1K8A U;  4L6V 5;  2HEQ A;  1KQ2 A;  2K9G A;  3CCS A;  1T3S A;  4PJO B;  2ECZ A;  4LUD A;  5FWB A;  1RAH B;  5KYY B;  5CR2 A;  2YUN A;  1KHI A;  4JZ4 A;  4KRT A;  5FRO A;  4O6J A;  2CZ0 B;  3REB B;  1VQP T;  4PK4 A;  4PJO F;  2J6F A;  2LNH B;  4C0Z A;  4OMF B;  2ROT A;  4QQ6 A;  1UEC A;  2RH2 A;  2KNB B;  5GAN 6;  2JM8 A;  3OW2 P;  3QWY A;  4FW1 A;  4ZGD B;  1KFZ A;  1MMG A;  1D09 B;  3OQ5 A;  2KQW A;  2DNU A;  1UHF A;  4M78 C;  2DE0 X;  1MND A;  3LWH A;  1PNJ A;  3G71 A;  3DLL A;  1X27 A;  1YJ9 A;  1E6H A;  1YI2 Q;  3SWN A;  1YJN A;  1TSF A;  2HQE A;  4XU0 A;  3NFC A;  1VQL Q;  1JRI A;  3M9Q A;  1VQ7 T;  2F2V A;  1M3B A;  2KRM A;  2KT8 A;  3TU4 K;  4PJO A;  2OI3 A;  3CC2 A;  5DLO A;  1S72 T;  3EHQ A;  1JBM A;  3AHU A;  2QDL A;  4V2S A;  4J9E A;  4PFZ A;  3JB9 J;  2JVV A;  4M7A A;  1NEB A;  4C5G A;  1BCM A;  4N4H A;  1TH7 A;  2DVJ A;  4M7A B;  1RAG B;  3EGX A;  3CME Q;  2CH4 A;  2J06 A;  1GRI A;  1FMW A;  2HSE B;  2O01 E;  2KDS A;  4C92 E;  4QVD A;  3R6N A;  1GL5 A;  3MPU B;  2D0N A;  2AHJ B;  2FEI A;  3EFS A;  3L2R A;  1BBZ A;  2A37 A;  4J9I A;  3QPH A;  2DXT A;  1HD3 A;  2RQT A;  1Z9Z A;  4XU1 A;  1S1N A;  3KBG A;  3REA B;  7AT1 B;  3JCM W;  4M7A C;  2EAY A;  5KYX A;  2EYY A;  2KK4 A;  2EQJ A;  2QA4 T;  2QTV A;  2WSE E;  5IXF A;  2DIQ A;  1JJ2 P;  2QEX A;  4HCC A;  4XK8 E;  5LJ3 j;  1KHC A;  1UJY A;  3LWI A;  1TUG B;  1WJQ A;  3GPL A;  1WHJ A;  4DBQ A;  5CKB A;  4IIM A;  3JV3 A;  1K1Z A;  4JRP A;  5IAY A;  2LCL A;  2BTT A;  3BY7 A;  4F7U F;  3CBP A;  4AG2 C;  2EGC A;  5LJ5 f;  1I4K 1;  3H8Z A;  5GAN f;  2K5I A;  1KIK A;  5GAM f;  1YJ9 Q;  4EDU A;  5IHI A;  5LL6 S;  3OS1 A;  1BCO A;  1WHK A;  1GBR A;  1MGQ A;  2KYM A;  2DRK A;  5L23 A;  2L3R A;  3VRZ A;  3EGD B;  4E7S A;  3JCM d;  5FU6 B;  2VUB A;  1ZA2 B;  4F16 A;  3QJY A;  2MWP A;  1UFF A;  1XOV A;  2DZ9 A;  1EFN A;  1S72 Q;  5I11 A;  1QKW A;  1YHQ T;  3ME9 A;  2JM9 A;  1QVG S;  3HP9 A;  1QCO A;  1WHH A;  3O8V A;  3HKS A;  3MJX A;  1Y7X A;  4JJB A;  4M77 C;  5HY6 A;  3V8J A;  3WXM B;  2GBQ A;  2A36 A;  3L2Q A;  2C06 A;  2HD0 A;  2L3S A;  3M57 A;  4UC4 A;  1KD1 R;  1G3Y A;  1WLP B;  4E7K A;  2LCC A;  4DBR A;  1BB9 A;  2RO0 A;  3CBO A;  1BKB A;  4FT4 A;  2DBM A;  1Y71 A;  2ZCF B;  2LT4 A;  2EGE A;  1CKA A;  3L2W A;  2CT4 A;  3N5B B;  4N4I A;  3CCM T;  4EIK A;  3I55 Q;  2FHD A;  1O9S A;  1I07 A;  2E3I A;  3UA7 A;  4R55 A;  1ARK A;  1QMC A;  3EGD A;  4BB7 A;  2M9U A;  4OML A;  4PJO G;  3CME A;  5GMK m;  2JJ9 A;  5L8R E;  1BK2 A;  5GAN 5;  3LLR A;  2C0T A;  2JNG A;  2GFU A;  2LC4 A;  2DYI A;  2JS2 A;  2RN8 A;  4FYV B;  4FYY B;  3CMA A;  2D8J A;  2EBP A;  2PU9 B;  1SPK A;  2ENM A;  2ZZD A;  1IHW A;  1M2V A;  2GCX A;  3H6Z A;  2BZY A;  3OB9 A;  2P4R A;  2SRC A;  3FRN A;  2KXC A;  1VQO T;  3F70 A;  4ELZ C;  4RCB A;  2KMT A;  1MNE A;  5GAO q;  4J6Y A;  1GFC A;  3RMS A;  3WVD B;  4F7U E;  1M1K U;  1MMD A;  3O5Z A;  1WHG A;  2LCS A;  2C0I A;  4QKU A;  2QA4 A;  1Q82 R;  4IUR A;  3TRE A;  2ESW A;  4XAX B;  3MEA A;  2DKG A;  4QVC A;  1TWB A;  1QLY A;  1M1G A;  4J83 A;  3JB9 G;  2VC8 A;  3CCJ T;  1NPP A;  4NS5 A;  1RAD B;  4PJJ A;  1B7T A;  4KGX B;  1AWX A;  5GMK i;  2QTX A;  2EKO A;  2K79 A;  2B86 A;  4C92 F;  2EYZ A;  1YNZ A;  3PT9 A;  1PG5 B;  3QYG B;  4Z02 A;  4MZT A;  1VOM A;  5FU6 C;  1VQK Q;  3PTA A;  3OYJ A;  2ZPB B;  1JXM A;  4RCC A;  5KYU A;  2YSQ A;  3JSC A;  3LGF A;  2QYZ A;  3H41 A;  5KYU B;  3EG0 A;  2ABL A;  4BI4 A;  3FEO A;  4M77 A;  2F5K A;  3GLX A;  3DB3 A;  4CRI A;  5CQX A;  2EIF A;  1IB8 A;  4QQG A;  3VS1 A;  4M7D A;  1M5Q 1;  2QQR A;  3TEE A;  3CMA T;  2FO0 A;  4GY5 A;  1UUE A;  3OYE A;  1FWZ A;  4MZP A;  5J26 A;  5ECA A;  1VYT A;  1BI1 A;  2LJ0 A;  3M5A A;  4F7U G;  2EQU A;  3L1A A;  2VXF A;  1TU0 B;  1D3B A;  5HK0 A;  2VWF A;  4OVA A;  5LJ3 f;  1OU9 A;  3I56 T;  4MZM A;  1G3T A;  5GAN 3;  2DD4 A;  1K0S A;  3M0Q A;  1GCQ A;  2P0K A;  2J6O A;  5KYW A;  1X6O A;  3I55 A;  1K9M U;  2E6Z A;  3UPU A;  5GAO r;  1HJD A;  3H9N A;  5LJ5 j;  2DL4 A;  1YIJ T;  1QVP A;  3A8M B;  2VGM A;  5GAN j;  2CGH A;  2JZ2 A;  1MMA A;  4AFS C;  1UGV A;  2RB6 A;  4F14 A;  1K73 R;  4FYX B;  3U23 A;  4M75 A;  3OYL A;  2DPP B;  3A8H B;  3THK A;  4M75 B;  1VQ9 T;  1OZ2 A;  3EG2 A;  3QBY A;  4M78 D;  4C92 A;  1VQ6 T;  2RI2 A;  1LCK A;  1VUB A;  4RTV A;  1I5L A;  1NLO C;  3CCS T;  3A8G B;  3NHN A;  4A53 A;  2X51 A;  4C8Q E;  3H0I A;  1FYN A;  1VQ8 Q;  2M0Y A;  1M3C A;  1IZ6 A;  1OOT A;  4AG1 C;  2CSQ A;  4C92 C;  2AIR B;  3OA6 A;  4DBF A;  3CC4 Q;  2JN0 A;  1AHJ B;  1I1J A;  5IXB A;  3LW5 E;  4BE1 A;  5DY9 A;  4FIB A;  2AKL A;  3RR6 A;  2JW4 A;  3JRZ A;  2SEM A;  2RNA A;  5GAO m;  2OX7 A;  1YFN A;  3MEW A;  3CCJ Q;  4CC2 A;  3J80 E;  3FB9 A;  1M8M A;  2XIC A;  2RK1 A;  1FX7 A;  1VQM Q;  1QWF A;  1SF9 A;  3JCM V;  3X28 B;  4PFP A;  3G6E A;  2Y4Y A;  3JCM P;  2PVG B;  1PSE A;  2DLP A;  5GAO n;  3VS0 A;  3I35 A;  1Q81 U;  2A7Y A;  2COZ A;  5IT9 E;  2M0O A;  1VYU A;  2BE7 D;  1GCQ C;  3RES A;  1Q81 R;  4HT8 A;  4TVR A;  1V1C A;  5FU7 C;  2MCN A;  4DEY A;  5CVI A;  1HK9 A;  1VQN Q;  2E12 A;  4HA8 A;  3H0H A;  1GBQ A;  4M75 E;  1KSW A;  2ZGW A;  4MDW A;  1K73 U;  1RAI B;  1R0C B;  2CZ7 B;  4J9G A;  1HSQ A;  3C94 A;  4LN2 A;  4LE9 A;  2KT1 A;  2L89 A;  1K73 C;  4AFZ C;  1M4Z A;  4BE2 A;  1YJW Q;  1OQK A;  2P0P A;  2MK5 A;  1WA7 A;  2AK5 A;  1TUD A;  1NJI U;  1YJ9 T;  2CUB A;  2BE9 B;  2W0Z A;  2VVK A;  4KH1 B;  2OTJ Q;  3MEU A;  2KEA A;  3M53 A;  3JCM g;  1KQS P;  1RAF B;  1QVF S;  2F1L A;  1WHL A;  4DEX A;  2HQH A;  2K57 A;  4X9C A;  2F2W A;  4PJO C;  1PWT A;  3INZ A;  4FM4 B;  4IUQ A;  2P4T A;  1JU5 C;  4M78 F;  3CPW S;  3GBQ A;  2DIL A;  2XG8 D;  4R0K A;  1B07 A;  2JMA A;  1NYG A;  4LUE A;  2P84 A;  3CCL Q;  3ZFJ A;  3MHX A;  2MF2 A;  2ZPH B;  2LVM A;  4M77 F;  1IRE B;  4XQ3 A;  1T3L A;  4IUP A;  2D0Q B;  4AFU C;  4PJO D;  1JJ2 A;  1ACM B;  2CZ6 B;  2DTI A;  1WFW A;  3A5Z B;  2OAU A;  1NM7 A;  2ATC B;  3EAE A;  4PKC C;  2KRN A;  1TOV A;  2JS0 A;  2DM1 A;  1M9S A;  2DXU A;  2KAF A;  3VS3 A;  1X43 A;  1G5V A;  4Z8A A;  3MP8 A;  4C0D C;  2ZPF B;  4M75 D;  3OYA A;  1TUC A;  5DM7 R;  4PJM A;  1G3S A;  1X6G A;  2LQK A;  1I5O B;  2ED1 A;  2CP7 A;  3OYN A;  4OF1 A;  4E7J A;  5IHK A;  2VKN A;  3BFM A;  1OU8 A;  2M02 A;  2HCK A;  1IRX A;  3NMZ C;  4ZTJ A; 
#chains in the Genus database with same CATH homology
 1LOJ A;  1FXX A;  2CZ1 B;  4JRI A;  3L2Q A;  2C06 A;  2HD0 A;  4C5I A;  3M57 A;  4UC4 A;  3QZ5 B;  2R57 A;  2XKO C;  4EMH A;  4C92 G;  2LRQ A;  3JCM X;  3J81 E;  1G3Y A;  4WF2 A;  4E7K A;  2LCC A;  2E65 A;  4NL3 A;  4C8Q A;  4LD9 K;  5GAN 7;  2RO0 A;  3CBO A;  4ME7 A;  2WSF E;  1BKB A;  4FT4 A;  5AYF A;  3M55 A;  1Y71 A;  4J6W A;  2ZCF B;  4A4F A;  5CCA A;  2LT4 A;  3FC3 A;  1KD1 U;  3HRU A;  3QDR B;  4ZN3 A;  3G4S A;  4KT0 E;  4B9X A;  3L2W A;  1YI2 A;  2DEQ A;  4DOV A;  3SWN C;  5A0D A;  4C92 B;  2QQA A;  2GF7 A;  4MML A;  3OYI A;  2R58 A;  3HHT B;  1M90 U;  3N5B B;  2D9T A;  4JS4 A;  4N4I A;  4XU3 A;  3CCM T;  3RER A;  2E41 A;  3QO3 A;  4M78 E;  3OY9 A;  3OYM A;  2OTJ A;  2ZPI B;  2FHD A;  4N4G A;  1O9S A;  2DVE A;  2RHZ A;  3C95 A;  4R55 A;  3OYB A;  2PUK B;  3PIO A;  2DTH A;  3LX7 A;  4BD3 A;  1MHN A;  4BB7 A;  3L2U A;  3L2V A;  4HCB A;  1B34 A;  2M9U A;  4XTU A;  4JRK A;  3G6E T;  4PJO G;  4II1 A;  2RI5 A;  3CME A;  3QKJ A;  3CCU A;  3M59 A;  1N9R A;  5GMK m;  2XD0 A;  5L8R E;  2LTO A;  1WQ7 A;  2LT1 A;  3M4Y A;  3MEV A;  5GAN 5;  4RMO A;  3LLR A;  1N27 A;  2K3Y A;  3JCM J;  1UGS B;  2JNG A;  2GFU A;  2LC4 A;  3MET A;  2DXC A;  4OB3 B;  3M4G A;  4M78 A;  1N6A A;  4NOY A;  3CME T;  1O75 A;  3CMA A;  4BDY A;  2YLC A;  1Q86 C;  4M77 B;  2PU9 B;  5I2S A;  1VQO A;  3RKW A;  4MDX A;  3L42 A;  2HNI A;  2ZZD A;  3CCV A;  4F7U B;  3LGL A;  4E7L A;  2OTJ T;  4R56 A;  1EIF A;  3S3O A;  3CCR A;  1KQS S;  2GCX A;  3H6Z A;  4JUV A;  5LJ3 e;  4M75 C;  3OB9 A;  1VQN A;  1VQP A;  3QYH B;  2OTL T;  3SDZ A;  3FRN A;  1YHQ A;  5FU7 B;  1QP3 A;  1VQO T;  4E7I A;  2BKD N;  3F70 A;  4O5V A;  4C0F A;  4ELZ C;  4BY6 C;  2QQS A;  4RCB A;  1Q82 U;  1X01 A;  2KMT A;  5GAO q;  3JB9 H;  3P8H A;  4J6Y A;  3QJ6 A;  4L5G A;  3RMS A;  3WVD B;  4F7U E;  2ZPE B;  3GOX A;  1M1K U;  1VQ7 A;  4J8O A;  2DO3 A;  4J6X A;  4IUV A;  4M78 B;  1VQL A;  1OI1 A;  3FJP A;  3NTK A;  5D6Y A;  4JDS A;  5D6X A;  5KCH A;  2QA4 A;  3OBY A;  5EG2 A;  4IUR A;  3TRE A;  1D3B B;  4XAX B;  4GLK A;  1Q86 U;  3MEA A;  2LNV A;  5GAN d;  2DKG A;  3OW2 S;  4QVC A;  4A4K A;  1U1S A;  4M7D D;  1I8F A;  1UGQ B;  4J83 A;  1M1G A;  5GAO l;  1N9S A;  2CS7 A;  4KUI A;  3JB9 G;  2VC8 A;  1JB0 E;  3CCJ T;  4LDW A;  3JCM f;  1NPP A;  1YCY A;  2EWN A;  3QG1 A;  2RI3 A;  4NS5 A;  4OP0 A;  3CCJ A;  3JB9 D;  3CCQ A;  1U1T A;  3UDC A;  2QQ9 A;  1R8O B;  1YBY A;  2YHT A;  4JJN K;  4PL6 A;  1K9M C;  2FB7 A;  5GAN 4;  1YIT T;  4ZTF A;  3GF5 A;  4PNO A;  5GMK i;  1W2B A;  1NJI C;  2QTX A;  2EKO A;  4HKE A;  2KVQ G;  2YLB A;  4BAC A;  3JCM h;  1YIT A;  1Q81 C;  4M7D G;  2VV5 A;  4C92 F;  2E10 A;  5I2M A;  1UGR B;  2XDD A;  1B34 B;  3E19 A;  3UT1 A;  3PT9 A;  1VQ5 A;  1KQ1 A;  3QYG B;  4Z02 A;  4YTL A;  4MZT A;  4BE0 A;  5FU6 C;  2RHI A;  3S3N A;  1BI0 A;  3CC4 T;  3PTA A;  4LDX A;  3OYJ A;  2ZPB B;  4RCC A;  4XU2 A;  3LGF A;  3JSC A;  1V29 B;  1G3W A;  1QVG A;  2RD1 A;  3EFR A;  3CD6 T;  2DD5 A;  4BI4 A;  4PLL A;  4M77 D;  3BDU A;  3FEO A;  1UEB A;  4M77 A;  4IKF A;  3J7A F;  4M7A G;  2F5K A;  3GLX A;  2EJ9 A;  3OS5 A;  2RHU A;  3R6O A;  5KH6 A;  3OMG A;  4OB1 B;  4RG2 A;  3VYH B;  1NPR A;  3G7Z A;  4EMG A;  2H3J A;  2DZC A;  3DB3 A;  4CRI A;  5CQX A;  2EIF A;  4QQG A;  5CKF A;  2L5Q A;  4XTY A;  3ZEH A;  3OSS C;  3CEY A;  3VUZ A;  4C8Q F;  4ELY C;  5GAM e;  2FVU A;  1BI3 A;  3OMC A;  3PMT A;  5CKE A;  5GAN e;  4CI0 C;  3HPW A;  3CXC A;  1M90 C;  4KUD K;  3C12 A;  5I21 A;  3OW2 A;  1QP2 A;  1VQ4 A;  1VQK A;  3V8L A;  1M5Q 1;  2QQR A;  3KUF A;  4M7D A;  3TEE A;  1LJO A;  3M58 A;  2RHX A;  3CMA T;  4JRQ A;  1DJ7 B;  2BUD A;  4GY5 A;  5KCO A;  4PJO E;  4EPC A;  3OYE A;  2PVD B;  1FWZ A;  4MZP A;  3X20 B;  1YJW A;  2X4Y A;  4JLI A;  3CCQ T;  5J26 A;  1NE8 A;  3OYF A;  1BI1 A;  3SD4 A;  2PQW A;  3M5A A;  5GMK h;  1YJW T;  4VUB A;  2JOY A;  4F7U G;  2EQU A;  1VQN T;  3L1A A;  1GXI E;  5HKC A;  2M16 A;  4IUU A;  1Y07 A;  2VXF A;  3GNG A;  4IUT A;  4D6W A;  1D3B A;  3ASK A;  5HK0 A;  1KC8 C;  1KD1 C;  2E1H A;  4M75 G;  2JUF A;  1WJS A;  2FYK A;  4M77 E;  4OVA A;  4PLI A;  3CPW A;  5LJ3 f;  2JTF A;  3P8D A;  4BUG A;  3I56 T;  2X4J A;  3X25 B;  1S72 A;  3FLG A;  4MZM A;  1G3T A;  4Q5W A;  4F7U A;  1KG1 A;  3M56 A;  5GAN 3;  1VQM T;  4JS5 A;  2DD4 A;  3A8O B;  1M1F A;  2RA2 A;  3CPF A;  4FSX A;  4HT9 A;  1N8R U;  2P0K A;  5GAO p;  1P92 A;  1WPY A;  4C0G A;  3CCU T;  4M7D B;  5CKH A;  4Y28 E;  1X6O A;  3E9G A;  3C4S A;  3I55 A;  1M8V A;  2EQK A;  2E6Z A;  1K9M U;  3I55 T;  3UPU A;  4FU6 A;  5GAO r;  4M7A E;  2MWO A;  2EJG A;  1ZQ1 A;  3HRS A;  1N8R C;  4KUL A;  5LJ5 j;  3NTI A;  1YIJ T;  2QEX T;  1QVF A;  1QVP A;  3A8M B;  2GQV A;  4OB2 B;  2VGM A;  1U8R A;  2VGN A;  4BDZ A;  5GAN j;  4M7D E;  2VXE A;  2CGH A;  2K5L A;  2R5A A;  2JZ2 A;  4J7I A;  2HAX A;  1WGS A;  4C5H A;  4EMK B;  2XDB A;  3E1S A;  4M7A F;  3KXT A;  2RB6 A;  2DJZ A;  3LYI A;  5CO7 A;  3CD6 A;  2RJE A;  4M75 A;  2LDM A;  3NTH A;  3RUX A;  3ZBD A;  3OYL A;  4J7F A;  2DPP B;  4C0D B;  4J5Y A;  3A8H B;  4ZGJ B;  4ZGE B;  2RM4 A;  4M75 B;  3FDR A;  1VQ9 T;  1W2B S;  2D6F A;  1OZ2 A;  3MO8 A;  4M78 G;  1H3Z A;  3DLM A;  1VIF A;  3OYH A;  3G4S T;  5J39 A;  3GP8 A;  1Y96 B;  5C6S A;  3S3M A;  1PSF A;  4BI8 B;  3QBY A;  3CCE T;  1RL2 A;  4M78 D;  2RJC A;  4C5E A;  3QXE B;  4C92 A;  1KC8 U;  3Q1J A;  1VQ6 T;  3A8L B;  5C0M A;  2RI2 A;  1NZ9 A;  1VUB A;  3T9N A;  2X4X A;  2DAQ A;  3SWN B;  3X26 B;  5CK9 A;  1I5L A;  1ZHI A;  3QZ9 B;  4OGE A;  3OS0 A;  5GMK l;  2WAC A;  4OGC A;  4QW2 A;  2V8K A;  4EMK C;  5A2Q E;  1YIJ A;  2EQM A;  2XK0 A;  4RKU E;  3CCL T;  2IG0 A;  3CCS T;  5FLX E;  1YJN T;  3A8G B;  4A53 A;  1ZBX A;  5D6W A;  4M77 G;  2IVW A;  2QQB A;  3DB4 A;  5FRN A;  4HCZ A;  2WSC E;  2XDP A;  1OZ3 A;  4ZN1 A;  3CCV T;  4XTX A;  1WNL A;  3PFS A;  3RKX A;  4C8Q E;  1YI2 T;  4X9D A;  4A4H A;  5GAN g;  3OYC A;  1HXD A;  2K5F A;  5GMK e;  2MMP A;  5A0G A;  4A4G A;  3V8K A;  2EJF A;  1VQ8 A;  4BY6 B;  4C8Q G;  1IZ6 A;  3MP6 A;  3VU3 C;  4DA4 A;  5LJ3 h;  3VKI A;  1VQL T;  3PMI A;  4C92 C;  1VQ8 T;  1VQ6 A;  3OA6 A;  3CC2 T;  4QVZ A;  1BI2 A;  3S6W A;  4C8Q C;  4EMK A;  1VQ4 T;  1VQK T;  2JN0 A;  1AHJ B;  2XI9 A;  3LW5 E;  4LDV A;  2A3L A;  4BE1 A;  3JAM E;  1K8A U;  5DY9 A;  4FIB A;  4L6V 5;  3CC7 A;  1KQ2 A;  2QI2 A;  5GAM j;  3CCS A;  3CCL A;  3JB9 F;  3OYY A;  2X35 A;  3CC7 T;  4PJO B;  5GAN 2;  2QXF A;  4P5N A;  3JRZ A;  3V7C A;  5CR2 A;  1Y96 A;  1KHI A;  1I81 A;  3CCR T;  2K3X A;  5FRO A;  2LQ8 A;  4O6J A;  2CZ0 B;  5J3B A;  4A4E A;  1VQP T;  2KSS A;  5GAO m;  4PJO F;  5CIU A;  3VV0 A;  3HL8 A;  3MEW A;  2KY9 A;  4C0Z A;  3OS2 A;  4OMF B;  2E5Q A;  3J80 E;  4QQ6 A;  2F69 A;  2HBP A;  3FB9 A;  2XIC A;  4MMK A;  4B9W A;  2RK1 A;  2RH2 A;  5GAN 6;  1FX7 A;  3PNW C;  4OB0 B;  3JCM V;  4ZGD B;  3X28 B;  3G6E A;  3QII A;  2Y4Y A;  3JCM P;  4N0A C;  2CYZ B;  3JCM b;  4M7A D;  2PVG B;  4KBM B;  1PSE A;  1X75 C;  3OQ5 A;  2KQW A;  3VYG A;  5GAO n;  4FT2 A;  3V7R A;  3I56 A;  3JCM e;  1Q81 U;  4M78 C;  2RHY A;  2BIV A;  2V8I A;  2A7Y A;  2DK3 A;  2NLU A;  3HFO A;  2M0O A;  3LWH A;  5IT9 E;  3G71 A;  3DLL A;  1YJ9 A;  3DKM A;  1LNX A;  4XTZ A;  3SWN A;  1YJN A;  3CBM A;  3L2Z A;  2HQE A;  1QW1 A;  4XU0 A;  3RES A;  3URG A;  4E47 A;  4HT8 A;  3NFC A;  4TVR A;  1JRI A;  1UGP B;  3M9Q A;  5FU7 C;  1JJ2 S;  1VQ7 T;  2O4X B;  2PUO B;  5KE3 A;  5CVI A;  2R5M A;  1HK9 A;  3RMQ A;  2E12 A;  4HA8 A;  3QSU A;  4M7D F;  4M75 E;  2ZGW A;  3OSV A;  1BIA A;  4MDW A;  2EFI A;  5LJ3 g;  5GAN 8;  2Y90 A;  3TU4 K;  1K73 U;  3OYG A;  3CC2 A;  3CCE A;  5DLO A;  1S72 T;  3ER0 A;  5LJ5 h;  2CZ7 B;  3OYD A;  1JBM A;  3C94 A;  2RK2 A;  1XQH A;  5M9O A;  3AHU A;  5GAN h;  3HSB A;  2L89 A;  2GFA A;  1WJR A;  3HRT A;  3G71 T;  1K73 C;  3GIB A;  4V2S A;  4M75 F;  3JB9 J;  3PGG A;  4FL6 A;  2CKK A;  2JVV A;  4NL2 A;  4M7A A;  1M4Z A;  4BE2 A;  1Q82 C;  1XTD A;  4C5G A;  4RG8 A;  4N4H A;  1TH7 A;  2P0P A;  1UB4 A;  4M7A B;  1XNI A;  2MAM A;  2B8A A;  4XTW A;  2DXB A;  1NJI U;  1YJ9 T;  4C8Q D;  5GAM g;  3LH0 A;  3CC4 A;  2O01 E;  3CCM A;  2KDS A;  4C92 E;  4QVD A;  3WVE B;  3PIP A;  1W4S A;  1VIE A;  3P8B B;  4Y91 A;  2AHJ B;  3EFS A;  3MEU A;  2DTO A;  3M53 A;  3JCM g;  3JCM c;  1Q7Y C;  4LDU A;  5LJ5 d;  1WQW A;  3L2R A;  5A0L A;  1QVF S;  5FRM A;  2K57 A;  2VYT A;  3QPH A;  2ZPG B;  2JTM A;  4X9C A;  2XHC A;  5GAM d;  2DXT A;  2L8D A;  3RIR A;  4E7H A;  1K8A C;  4PJO C;  3INZ A;  4FM4 B;  4IUQ A;  5KE2 A;  2OTL A;  2V8J A;  5CKD A;  2O4X A;  4XU1 A;  4PJO A;  2K2V A;  3KBG A;  2E64 A;  2P4T A;  3JCM W;  4M7A C;  4LD6 A;  2EAY A;  4M78 F;  3CPW S;  5HK3 A;  2G3R A;  2KK4 A;  2EQJ A;  2QA4 T;  2XG8 D;  3GNF B;  4L59 A;  2WSE E;  3BDL A;  3CXC S;  2DIQ A;  1KQS A;  2QEX A;  4C92 D;  5GMK j;  4HCC A;  2E70 A;  2P0Q A;  2RJF A;  4XK8 E;  5LJ3 d;  5LJ3 j;  1BIB A;  5DLQ E;  1KHC A;  3LWI A;  2HQX A;  1RI0 A;  2RJD A;  3BW1 A;  5CQY A;  1WJQ A;  3RKY A;  3GPL A;  1Q7Y U;  4DOW A;  4LDY A;  5CKB A;  4ATO A;  4JRP A;  3ZFJ A;  5IAY A;  3MHX A;  3JCM Q;  2MF2 A;  2LCL A;  4XTV A;  2ZPH B;  3SFM A;  3BY7 A;  3X24 B;  4C8Q B;  2F5T X;  2LVM A;  3CBP A;  2M1H A;  2FL7 A;  4F7U F;  5GAM h;  1BYM A;  4M77 F;  3QUI A;  3HFN A;  3TCJ A;  5LJ5 f;  1IRE B;  1OYX A;  4XQ3 A;  1I4K 1;  3JB9 I;  4IUP A;  3QHS A;  2D0Q B;  3H8Z A;  4PJO D;  5GAN f;  1JJ2 A;  2CZ6 B;  2DTI A;  2K5I A;  4A54 A;  1VQ5 T;  5GAM f;  3A5Z B;  2QDY B;  4EDU A;  5LJ5 e;  1SSF A;  5LL6 S;  2OAU A;  4DQ2 A;  2Y4X A;  3OS1 A;  3EAE A;  4PKC C;  4QQD A;  3FIF A;  3VUB A;  1M9S A;  4BI3 A;  1MGQ A;  2DXU A;  2EYQ A;  2KAF A;  2PVO B;  1M1K C;  4JLG A;  2L3R A;  5IN1 A;  5LJ5 g;  4X34 A;  4N0A A;  1H64 1;  1G5V A;  3JCM d;  5FU6 B;  3MP8 A;  2VUB A;  2X4W A;  3VJP A;  4C0D C;  2ZPF B;  4M7D C;  3UWN A;  4M75 D;  3QJY A;  3M54 A;  3MCA B;  2MWP A;  2I2L A;  3OYA A;  5DM7 R;  3MP1 A;  2DIG A;  1VQ9 A;  1G3S A;  5CAI A;  1XOV A;  2DZ9 A;  1VQM A;  2E6N A;  2LQK A;  3SB2 A;  3V7S A;  2K4Y A;  1YHQ T;  3ME9 A;  2MI6 A;  1QVG S;  2YRV A;  3HP9 A;  3OYK A;  3OYN A;  4OF1 A;  3O8V A;  3HKS A;  2XU8 A;  3OBW A;  4E7J A;  1Y7X A;  4M77 C;  5HY6 A;  2XID A;  3BFM A;  2LX9 A;  3V8J A;  4ZTJ A;  3WXM B;  3E9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...