1OZ2A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
324
structure length
324
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 83
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A03
4BACA 1XNIA 4Z02A 3BDLA 4Q5WA 2RJDA 4LD6A 4E7LA 2K3XA 3PNWC 2L3RA 2P0KA 3OS2A 4OVAA 1WJRA 2X4YA 3P8DA 3MEVA 5KCHA 3OYJA 3L2WA 3OYFA 4C5IA 5M9OA 2RHZA 4B9XA 3ZEHA 5KE2A 3OYNA 2X4XA 5CIUA 4IUUA 2R5MA 3OYIA 2R5AA 3MEAA 2DAQA 2R58A 3QJ6A 4B9WA 2EFIA 3E9GA 4CRIA 5FRMA 4UC4A 4BDYA 3S6WA 4PLIA 3OA6A 2L8DA 5D6YA 5C0MA 4QQDA 3Q1JA 4PL6A 2E6NA 4IUVA 5FROA 2MWPA 1OYXA 2D9TA 1RI0A 2K3YA 4QVZA 4A4GA 4N4HA 4ZTJA 1WGSA 2DIGA 4C5EA 2O4XA 2EQMA 2EQUA 2XDPA 2RHIA 2LCCA 2RI5A 2FHDA 2G3RA 2MWOA 4IUTA 2BUDA 2LTOA 2EQKA 3FC3A 1OZ2A 4NS5A 2M16A 2EQJA 2R57A 4E7HA 3KUFA 3QIIA 3L2QA 3GOXA 3OYGA 3LLRA 3QKJA 2F5KA 3DB3A 4BDZA 3OY9A 4E7IA 3OS1A 2HQEA 3LYIA 4C5HA 5IAYA 4A4HA 3OS0A 5FRNA 4BD3A 2JTFA 5J26A 5KE3A 3LX7A 5KCOA 4BE2A 2LDMA 2X35A 4ZTFA 3H6ZA 2O4XB 3FDRA 4E7KA 4PLLA 3PMIA 2X4WA 2L89A 3OQ5A 4FU6A 4GY5A 4IUQA 5D6WA 3UWNA 3L2VA 2B8AA 3F70A 3NTKA 3NTHA 4N4GA 4QQGA 3O8VA 3C4SA 4IUPA 2LRQA 4A4FA 3S3NA 4EDUA 2RI2A 3NTIA 5D6XA 4FL6A 2RO0A 3MEUA 5J39A 4QW2A 3L2RA 4II1A 4A4EA 2VYTA 3OYEA 3E9FA 2RJFA 2M0OA 3MO8A 3OYKA 1WJQA 3PMTA 1MHNA 4C5GA 4E7JA 3M9QA 3FLGA 2WACA 3MP8A 3MP6A 2DIQA 3OMCA 4IURA 3ASKA 2IG0A 1H3ZA 2BKDN 3OYMA 4HCZA 1SSFA 3H8ZA 3PFSA 2GF7A 4IKFA 1G5VA 2PQWA 3ME9A 3CEYA 5IN1A 2RJCA 2XK0A 2RHUA 3LH0A 2NLUA 4L59A 4RG2A 3OMGA 3P8HA 3OYAA 2E5QA 2LVMA 1WJSA 2QQSA 3MEWA 2GFAA 3UT1A 2CKKA 5KH6A 2RHXA 2HQXA 3DLMA 3L2UA 2GFUA 3OYLA 3LGFA 1OZ3A 2RHYA 4QQ6A 3META 3OB9A 4X34A 3OYHA 5C6SA 3EAEA 4BE1A 4BE0A 3SD4A 3OYDA 1KHCA 3LGLA 2JZ2A 2YRVA 3DB4A 3OYCA 3L42A 3OYBA 2QQRA 2EKOA 1OI1A 3FEOA 3QBYA 3S3OA 3S3MA 2M1HA 1N27A 2RJEA 2RI3A 3MP1A 2BIVA 4N4IA
chains in the Genus database with same CATH superfamily
2NUPA 5LJ5h 5IHKA 1OQKA 2FB7A 1WXUA 3G4SQ 3CCVQ 2OTLA 3G71Q 4O6JA 1YJWA 1TXQA 2CZ6B 4B9XA 5CR2A 2I0NA 4HVUA 1VQ7A 2R5AA 2DD4A 3E9GA 3G6ET 2KDSA 4OMOA 2DZ9A 1JBMA 1QWEA 3J81E 2KI7A 1ACMB 1G3YA 2KT1A 4FW1A 4Z88A 3RKWA 5GMKe 2YWWA 2YLBA 1JJ2P 3CBOA 4JRIA 3A8HB 2PZ1A 4HKEA 4AFUC 4BY6C 2C0OA 3M57A 2HKNA 1QVFS 4M75B 1OU9A 3CPWS 3D7SB 2KRNA 3RDVA 1NJIU 2PU9B 5J26A 2I2LA 2LDMA 4J9DA 1WPYA 2XKOC 1M5Q1 3JB9I 1BIAA 3OQ5A 4GY5A 2M0YA 2QASA 2XI9A 1X2QA 2DJQA 3CC2Q 3G6EQ 1G8XA 1OULA 4FL6A 2RD1A 2F1LA 1LNXA 2YUQA 4KGVB 2PNIA 2EIFA 3EG2A 1XTDA 2MAMA 4WCIA 2DIQA 3TREA 2LNVA 4DBFA 2E64A 1H3ZA 1E7OA 2VXFA 3RESA 1KQ2A 3VS1A 3SHWA 2KY9A 4IKFA 3BY7A 4AG2C 1IHWA 1UGVA 2A0FB 2K2MA 1XQHA 2LVMA 2QQSA 2GFAA 1IREB 2DA9A 1BBZA 1J3TA 3LWHA 2A3LA 1LOJA 1RADB 2CYZB 5HK0A 2KRMA 3KFVA 2ZPHB 2RI3A 3E1SA 3CCUT 2AKLA 3BDLA 3NFCA 5EC7A 3INZA 4E2FB 3PNWC 2ESWA 4M7DC 3A8MB 4JJNK 4M7AB 5KCHA 1Y07A 4M77B 1YJWQ 2MCNA 2QEXQ 4J9FA 1UFFA 3UA7A 4CRIA 1FWZA 4F14A 2E70A 1KQSP 2P84A 1IGQA 5FU7C 2W10A 3J7AF 4PL6A 3A8OB 2ENMA 3QYHB 1BB9A 3M59A 5GANf 2ROTA 3OBYA 9ATCB 1D1AA 1Y96A 1VQLT 4IUTA 4M7DE 2EQKA 1VQNT 1PWTA 2M51A 2C0IA 2M16A 2R57A 2O9VA 4BDZA 3QKJA 1VQKQ 4LDXA 5KYUB 3OS1A 3I9QA 4X9CA 2HQEA 5GJWB 4A4HA 5GAOm 2JTFA 5LJ3h 4F7UG 1X27A 5GAMh 2EJGA 3T9NA 1I07A 4EMGA 5GAMe 1OV3A 1UGQB 1QVFA 4DEYA 4XU1A 1B07A 4J9IA 3OYKA 2LT1A 4D8DA 3CCMQ 1BK2A 1K9MU 4C5GA 4LDYA 1BI0A 3EGUA 2FEIA 4HCZA 4LXCA 2KR3A 3FJPA 2FPDA 2RJCA 3EH2A 3EG3A 3RUXA 1NZ9A 3UT1A 2CP0A 2WSCE 4DEXA 2ZAEA 3JRZA 7AT1B 1SRLA 4IIOA 4QQ6A 4X34A 1UJ0A 1Q7YC 2EVRA 5GMKh 3CC7T 2L3PA 1VUBA 4PFZA 4N4IA 2J6FA 3OYYA 3JCMP 5FU6B 4RTWA 3UF4A 3H0FA 2BZYA 3CD6A 1UHCA 2ZZDA 3RR6A 1YI2A 2NYSA 3GNFB 3MPUB 2R5MA 3C94A 4B9WA 3CC7A 4EIKA 1X2KA 5A2QE 4BDYA 4C92F 5GAOr 4DQ2A 2L3SA 3A5ZB 4AT1B 1IO6A 1MNEA 2K3YA 4FCYA 4ZTJA 2DIGA 2EQUA 2RI5A 3JCMW 1M4ZA 1OZ2A 1Q81R 2LNHB 5DLQE 2DYIA 2CT4A 3OY9A 1KSWA 3G4ST 1UE9A 3OS0A 2QTVA 1AT1B 1VQLQ 3HHTB 4JS5A 4BUGA 3EHRA 2X35A 3H9NA 4J8OA 5LJ3e 4O5VA 1R77A 4FU6A 2ZPIB 1QWFA 2MOXA 2COWA 2RI2A 5D6XA 2DFUA 1Y0MA 2RJFA 1HSQA 3VUBA 3VJPA 1YN8A 1AWJA 3GNGA 1K0XA 3OYMA 3CEYA 1CKAA 2E5QA 1WA7A 4V2SA 5IHIA 1JJ2S 2DX1A 2FPEA 5A0GA 3DB4A 1QVFP 3L42A 2DVJA 3SEMA 4C8QG 1NEGA 1WLPB 1KJWA 2K4YA 5CQYA 1PNJA 1PD0A 2ED0A 3RNJA 3TSWA 2YLCA 3QO3A 3CC2A 1MMGA 2IPOB 1TUCA 1R0CB 2BE7D 2DJZA 3QG1A 1HJDA 2R58A 2KYMA 1OOTA 4XAXB 5ECAA 3M53A 1WZOA 4RUGA 4C8QD 1AWWA 4MMKA 1ZSZA 2F5TX 3EFSA 3Q1JA 3QUIA 2LCSA 3ER0A 2CP5A 3LW5E 1VQOT 1ZHIA 2H3EB 2VC8A 3CCMT 3VKIA 4N4HA 4JLGA 1WHLA 1TUGB 1N9SA 3E19A 1PCXA 4LNPA 2EQJA 2PVDB 1G83A 2K2VA 1JRIA 5CKBA 4J6YA 2ZPFB 2DERA 1VQ7T 5CKDA 2EGEA 4DBQA 3H6ZA 3CC2T 4OMNA 4Z89A 2CP3A 4E7KA 4M7DD 2PTKA 4A53A 1VQKT 3EG1A 2B8AA 3NTKA 2YHTA 2LQ8A 2RNAA 3G4SA 2RO0A 3L2ZA 5J39A 3HFOA 2ROLA 4FYXB 3SWNB 3OYEA 1QVGP 4OMFB 5KYWA 1MUZA 1FX7A 3M58A 1JXOA 4JZ3A 1KQSS 1KFZA 1QQJA 1BKBA 1AZEA 4RG2A 4L59A 2F2VA 5DM7R 3JB9J 2DTHA 3TU4K 3I5SA 3LGFA 2RHYA 4E6RA 4BE1A 1GBRA 1PHTA 3CD6T 1D0ZA 3JB9H 4L6V5 3CCQQ 2L2PA 3VRZA 3CCJA 3ULRB 3WXMB 2QQBA 1YITA 1EFNA 3TQ7P 2VV5A 1OU8A 4Z02A 2KAFA 2CP7A 2L3RA 1VIFA 2EPDA 4EMKA 4OVAA 3OYJA 2HAXA 1VQPA 2VVKA 2KMTA 4JJCA 3EG0A 2L0AA 5DLOA 1VQOQ 3SDZA 4AMCA 3SWNA 1Y57A 5I11A 1BCOA 3MKDA 2MF2A 1WYXA 2JT4A 4C92A 2QQAA 1UGSB 1WGSA 1GCQC 5AYFA 3QWYA 2KK4A 1N9RA 2LCCA 2VXEA 2JXBA 2W0ZA 5CKEA 2LTOA 3OSSC 2RQUA 1M2VA 5LJ3j 1VQ5Q 1OPLA 2O2OA 3L2QA 2F5KA 2K5IA 4E7IA 2COZA 2HDAA 3LYIA 1QP2A 2QI2A 1QVGA 2DZCA 4M77E 2EYZA 2YXYA 3M5AA 3N5BB 3PMIA 1NLOC 2F69A 2KQWA 3F70A 4XTWA 1PKTA 4MDWA 3DLLA 3PGGA 1VQ4Q 1WXBA 4J7FA 1PD1A 1CSKA 3CCJT 1VQNA 2C0TA 1RUWA 2CUDA 1QVGS 4Y92A 1RAEB 4C8QF 4LD9K 1UEBA 2QEXT 3OYFA 5GAMf 4FIBA 1AWOA 1U8RA 3MJXA 3RERA 2BTTA 2HQXA 1VQ5A 2VGMA 2GCXA 1QVPA 1QCNA 4M78A 4R56A 4PFPA 3HRUA 3A8LB 3LGLA 3JCMX 3V8LA 3CC4Q 1FMVA 1JU5C 5GANe 2XG8D 4LD6A 4ELZC 1WHKA 2P0KA 2JTMA 3RIRA 2X4YA 4LUEA 3H0IA 3MEVA 1M90R 3ZEHA 2CGHA 5CO7A 5CKHA 4IUUA 2SRCA 3MEAA 1IZ6A 2AKKA 2QA4T 2GQVA 2EQIA 3OA6A 3M55A 1M1GA 1NE8A 2K79A 3PIPA 2RF0A 2QDYB 1ZSGA 1K9MR 2LMJA 4QKUA 1U06A 1YFNA 1YIJA 3M0RA 3PVLA 3CCLA 2KXCA 4N0AC 2AZVA 1RLPC 3VS7A 4P5NA 4QVCA 2BZXA 4E7HA 1NJIR 5I22A 3VYGA 4GLMA 5CK9A 2HD0A 3V7CA 4C5HA 3V8KA 4IIMA 2JM9A 2NUTA 2LJ0A 3CXCS 4BI8B 5GMKj 2GNCA 3HPWA 1VQ6Q 1VQ8T 1RLQC 4KGZB 2DXUA 4JS4A 5FU7B 3SFMA 2DPPB 2X51A 3HRTA 5GAN2 4RKUE 4C8QC 3TEEA 2M0OA 1K73C 5FWBA 4PJOF 2BKDN 1G3WA 1SSFA 3VS4A 2RQRA 1ZLMA 1OPKA 2DD5A 1AEYA 1K8AC 2J7IA 1PSEA 4F7UA 1WX6A 2DL8A 4D6WA 4KUDK 3DLMA 2GFUA 2DMOA 2VB6A 3META 2QA4A 3UPUA 4BI4A 4F7UE 4BI3A 5GMKl 3OYBA 3CXCP 1WXTA 2JMCA 4BY6B 1VQMT 1SEMA 1N27A 3BE3A 2RJEA 4M75C 2DKGA 5I2MA 3UA6A 4CC3A 4XTUA 2VKNA 3P8DA 2CREA 1OX8A 2HEQA 4HT8A 2EFIA 5FRMA 1YITQ 1JB0E 2EGAA 2MYSA 4IUVA 3AHUA 2ATCB 4FT2A 2E5KA 1BI1A 4M77F 2KNBB 3VYHB 3E2UA 3GOXA 4M78G 4M75E 5HKCA 2KYBA 3RKXA 3X28B 1ZUKA 4AFQC 1W6XA 3QXEB 1Q86R 1WFWA 1Y96B 3FDRA 5KYXB 4X9DA 5D6WA 3UWNA 2D6FA 2JOYA 2P0PA 3QZ9B 1H641 2CDTA 2QEXA 2DF6A 1IXDA 4D8KA 1LPLA 4M77A 1PM3A 1YBYA 2EYYA 3OMCA 4M75G 3M0SA 3OS5A 4HXJA 2IG0A 3RBBB 4JRQA 1K73U 3EHQA 3EH1A 2PQWA 1V76A 1AWXA 1VYTA 3LH0A 3JSCA 3MEWA 1S72Q 3I56Q 2RM4A 2LQNA 4HVVA 1OZ3A 4OGEA 3A8GB 1YIJQ 4ZGDB 3VS6A 4OB2B 4HCBA 2OTJQ 5IH2A 1B7TA 2VUBA 4BACA 3X26B 2E6ZA 4RTXA 4A4KA 5IXBA 5CCAA 5KYXA 1VQPQ 1ZX6A 1SKUB 2Z0WA 1QKWA 4MZMA 2EJFA 4PFOA 4L5GA 3JCMh 1S72T 5GMKm 1HXDA 2D9TA 4FW2A 4RMOA 4ELYC 5GJVB 2CSQA 3CCQA 3JCMb 2MWOA 4LN2A 1M3AA 2KRSA 3CXCA 5KYNA 2RK1A 1TU0B 2YUNA 3OYGA 4GBQA 2L3QA 3CC4T 1UGPB 3ZFJA 2KROA 1Q7YR 1UUEA 1B34A 2YSQA 4BE2A 1YHQQ 1TH7A 4ZTFA 1Y71A 2AT1B 3I55Q 2YT6A 5LJ5j 1M1KU 2XDDA 2QYZA 4JRKA 3CCMA 1C0MA 3JB9F 3CBPA 2JS2A 2PUKB 3H0HA 3CC7Q 1AOJA 2KGTA 1V1CA 5GAN8 1RAHB 1BIBA 2CP2A 2V8IA 3QDFA 4NL3A 4ATOA 3G71A 1PRMC 2OTLQ 2OI3A 2EWNA 1NLPC 3PMTA 3J80E 1RAFB 3MP6A 1SSHA 1EX4A 1KD1R 3QWXX 2PVOB 4F7UB 1SHGA 2GF7A 1WHGA 4RG8A 5IXFA 2DEQA 3TCJA 1LJOA 4R55A 2CS7A 2RHXA 3O5ZA 1I4K1 2ZCFB 3P8BB 2A08A 4ZGEB 4NOYA 1TTHB 1NG2A 1GRIA 3VRYA 1RL2A 1E6HA 1D09B 2HNIA 2RK2A 4F17A 3M54A 1M27C 1S1NA 3KXTA 3MP1A 2JJ9A 1ZSZC 4KBMB 1VQ9Q 1YCSB 1JQQA 1X6GA 4E7LA 5CQXA 3ZL7C 5LL6S 4J83A 3CD6Q 3GP8A 3OSVA 1SPKA 2QG9B 4LDWA 2NUTB 5CIUA 2KBTA 4CC7A 3GPLA 2HQHA 1BI3A 1Y7XA 1NM7A 1TG0A 3M4GA 4PJOD 1OYXA 2FRYA 4C5EA 3EG9B 4ZGJB 2FZKB 2DETA 3R6OA 1W1FA 2FHDA 2HSEB 3FRNA 4C8QA 4HT9A 1YWPA 5HK3A 3KUFA 2WSFE 5GANj 3CCRA 1F1BB 1K8AU 1VQ4T 3M0UA 4M75D 4J6WA 2XMFA 3TSZA 5LJ3f 1VQ8Q 3L1AA 2DNUA 2V26A 1ARKA 1WHJA 2CT3A 4DBHA 5LJ5d 4EMHA 1AZGB 3CCLT 1XOVA 3L2VA 4RTVA 4RTYA 3EGXB 3C4SA 2DK3A 2JN0A 2RQTA 2YUOA 2OX7A 3S3NA 1T3SA 3PTAA 2EGCA 5GANh 2D0NA 4KT0E 2LP5A 2X3WD 5KYYB 4OMMA 1M1KC 5GAN6 1K4US 2ZGWA 5GAMd 3QJYA 1KC8C 2RN8A 2V8KA 1G3SA 3C0CA 1W70A 5IHNA 1G5VA 3NPFA 3GLXA 5GAOl 1KD1U 2EAYA 3FB9A 2MMPA 1UDLA 1WJSA 3PE0A 1X43A 1Q95G 1W2BS 2O31A 3CBMA 1X69A 1O9SA 4A63B 1OI1A 2OAUA 1NBEB 1BI2A 2LJ1A 3JAME 2DL4A 1WIEA 1YJNA 2V1RA 1UGRB 2VASA 2RPNA 5J3BA 2RHZA 1Q81C 1PKSA 1QLYA 3FIFA 5LJ5e 2DM1A 2Y90A 4QQDA 2E6NA 5FROA 1M2VB 2DXTA 3SWNC 1VQ8A 4C8QB 2DXBA 4M7AG 4ANJA 1YITT 2GGRA 1VYUA 2EQMA 3EG9A 2L5QA 2G3RA 1AD5A 3DKMA 2A7YA 4C92B 2MPXC 1IRXA 1T3LA 3CCEQ 1WQ7A 2EYWA 5FW9A 1JEGA 2YUPA 3M0PA 1SG5A 3QPHA 2D1XA 1CKBA 2E4HA 4YTLA 3CCVT 4M75F 3HTRA 2YRCA 3VS3A 1MV0B 2DEUA 3JCMJ 5D7UA 6AT1B 1VQOA 5GANd 5I2SA 3OBWA 1TUDA 4EDUA 1VQ7Q 4BB7A 4K11A 4A4EA 3ZBDA 1WJQA 2CZ0B 4RTUA 2GQIA 2IIMA 4CI0C 1GBQA 1YP5A 3ASKA 1FMKA 1VQLA 4FYYB 1ZQ1A 2G6FX 2HL3A 5CVIA 4C0DB 2DBKA 2X9HA 1H3HA 1D3BA 2LX9A 2O9SA 3OMGA 1VQKA 1K9AA 2P4RA 1UB4A 3CCST 4ZN3A 3CMEQ 3EFOB 1LVKA 4M78E 5LJ5f 2EJ9A 4PKCC 4BE0A 1KHCA 5KYWB 1VQ5T 2QQRA 2ZPGB 3A98A 3QBYA 4WF2A 1W2BP 3BW1A 1D3BB 3V7SA 4DOWA 2BIVA 2DRKA 1XNIA 4A54A 3QDRB 4RTZA 5A0DA 4MDXA 5FWCA 1ZUUA 4J9BA 5HY6A 1G3TA 1KK7A 4XTVA 1U5SA 3CCQT 4JRPA 2A37A 1N8RR 3HSBA 4ORZA 2J6OA 1D0YA 4M7AE 2FRWA 4CC2A 1B34B 3OW2A 1YJNQ 3CCSA 4ZN1A 1VQ6A 1VQPT 3I55A 1EIFA 5D6YA 1KC8R 1N5ZA 1EZZB 3BDUA 2HZYA 4E47A 2WSEE 1ZBXA 2V8JA 2H8HA 1AHJB 2KSSA 5GAOq 8ATCB 2FL7A 1M90C 2XICA 1NYGA 1TS9A 1ZSZB 3LLRA 1S72A 3JCMQ 2K6DA 3CMAQ 2DRMA 1Q82R 5KE3A 3LX7A 1QCFA 1Q86C 1I5OB 5FLXE 1YJNT 3MHXA 4C92D 2H3JA 4IUQA 2FZGB 1WI7A 1C1AA 4QQGA 4IUPA 1JJ2A 2DBMA 2MIOA 2K5FA 3JV3A 2PUOB 2DO3A 1MMDA 5GAMg 2DL5A 4II1A 1U1SA 1WDXA 2EYXA 3R6NA 2XIDA 1UG1A 1H8KA 4PJOC 4J9GA 4PJOA 4IURA 2J06A 4CC4B 3CMET 1MNDA 4C92G 3ME9A 4JPBW 4WTOB 1V29B 3GF5A 5EG2A 2LT4A 2E12A 2CKKA 4F7UF 2FO0A 3CPWA 3OB9A 1VA7A 1ZA2B 5IT9E 2QXFA 2EKOA 2F2WA 1YCYA 4M4ZA 2X4JA 5GAN3 1KIKA 2LZ6B 2SEMA 3C95A 4ESRA 4NL2A 4XK8E 4M7AD 2RJDA 1X75C 2KEAA 4J7IA 3M0TA 1PRLC 3L2WA 4Y28E 2DLPA 3NGPA 4C5IA 1VQ4A 3OYNA 4EMKC 3CCVA 5GAOp 4B6MA 1M30A 4M7DF 3I5RA 1X6OA 2QAZA 3NHNA 1VQ9A 1ZUYA 2GTJA 2QTXA 4DBRA 2JM8A 2MWPA 3EGXA 5I21A 1WHMA 1G2BA 3RMQA 1YJWT 2FVUA 2O4XA 1Q7YU 2XDPA 5L23A 1MMAA 2HMAA 4NS5A 3CPFA 4J9HA 4RTTA 3QIIA 3CCUQ 1RI9A 1HYOA 1M1KR 3MCAB 3RKYA 3VS2A 1KG1A 2ED1A 2QQ9A 3JCMg 4KH0B 4EPCA 1GL5A 4OB0B 3KBGA 4M77C 1I0CA 3CMAT 3CCSQ 2DVEA 4PLLA 3HKSA 2L89A 3CCET 3UATA 2LRQA 4PJLA 1NPRA 4A4FA 2HBPA 1VOMA 2KE9A 5GANg 2E1HA 3CCRT 4KUIA 1SHFA 4QW2A 1UHFA 5AT1B 1NEBA 2EBPA 1X01A 3MP8A 1R0BG 4F04B 1MV3A 2YDLA 1KD1C 3U23A 3CCRQ 4M7DG 2PVGB 2COYA 5IN1A 2MK5A 3P8HA 2JW4A 4E7SA 1JO8A 4F16A 3X24B 5L8RE 3L2UA 2KXDA 2QDLA 2K9GA 4FSSA 2P4TA 3THKA 5GAOn 4QT7A 1Q82U 3S3MA 1OX9A 1GCPA 4E7ZA 1GFDA 3C12A 3REBB 4C92E 4JZ4A 2K3XA 5GAN5 3OS2A 2P0QA 1T0HA 1N8RC 3LH5A 1KQSA 2C06A 4XTZA 5KE2A 3M4YA 2DAQA 2DXCA 4UC4A 3S6WA 2RA2A 3HFNA 2V1QA 5KYUA 1GFCA 3VU3C 4QVZA 1DJ7B 1K0SA 1UECA 3VUZA 5GAN7 2RHIA 3VS5A 1I81A 2NWMA 3CCUA 4HCKA 2FPFA 2LCLA 2K5LA 4OMLA 1BU1A 2HL5C 3DB3A 4ZNXA 4PJJA 1ABOA 3X25B 4OF1A 2O4XB 4M7AA 3QSUA 4KGXB 2FZCB 2X4WA 1KC8U 3I35A 3SB2A 3O8VA 1YIJT 2A36A 1TOVA 2QK0A 1M2OA 2FG0A 1TWBA 4M78D 1U1TA 2D8JA 3FLGA 1YHQA 4XU2A 4M78B 2AK5A 3CC4A 1QCOA 4JJDA 5CKFA 2E65A 4OB3B 1RAAB 2OTJT 1NYFA 2XK0A 2CH4A 2DILA 1SRMA 5A0LA 2FYKA 2AIRB 3CCLQ 3VV0A 1IB8A 2XHCA 8AT1B 1K73R 3EAEA 3HRSA 3PIOA 1VQ9T 4HCCA 3FEOA 3S3OA 4FSXA 2M1HA 2A28A 4C92C 1B3QA 3G7ZA 2NUZA 4J9CA 2IVWA 4PNOA 4PJOB 3G6EA 1WJRA 1K1ZA 5LJ3g 1GXIE 2OTJA 2LC4A 4M75A 3I56T 3CCJQ 3G1JA 1YI2T 2CH4W 2OTLT 1YJ9A 1HK9A 2JTEA 4OMPA 3I56A 2VGNA 1OEBA 4JJBA 1VQ6T 1H92A 4J5YA 1MMNA 2F2XA 3TVTA 2QGGA 5FRNA 4JDSA 2GTOA 4M7AC 1UTIA 1RACB 1VQNQ 4X1VA 3OW2S 3PT9A 1QMCA 4LDVA 2HBWA 1E6GA 4EMKB 2E3IA 4N4GA 1AVZC 2NUPB 5LJ3d 3NTIA 4OB1B 2AZSA 3L2RA 2ZPEB 1PG5B 1Q82C 4FM4B 1I5LA 1XJWB 1Q86U 2WACA 1R8OB 3GIBA 4C0FA 2ABLA 1PC0A 2QGFB 4FT4A 4J6XA 1N8RU 2HKQB 1M8VA 3WVEB 2NLUA 1MGQA 3M0QA 4XTYA 2OAWA 3CMEA 4QVDA 5GMKi 2BE9B 3H41A 3OYLA 1QKXA 1M90U 4N0AA 2LQWA 1YHQT 1RAIB 4FYVB 1QP3A 1KQ1A 3EFOA 3OYDA 2JZ2A 3OYCA 4KULA 4M77D 4RCCA 4RCBA 3OW2P 1P92A 1BCMA 3JCMV 2HCKA 2KVQG 1VYVA 4Q5WA 1VQMA 4AG1C 4LE9A 2CSIA 1YWOA 5LJ5g 2DL3A 5M9OA 4Y91A 1NJIC 1VQMQ 2X4XA 1QW1A 5GAN4 1W2BA 2M9UA 3BFMA 3JB9G 3GBQA 3QJ6A 4ME7A 4PLIA 1K76A 2L8DA 1N6AA 3QYGB 3QZ5B 5C0MA 2RH2A 1TSFA 2CZ1B 4R0KA 2QA4Q 4XTXA 3REAB 2JS0A 1M1FA 2BUDA 3FC3A 1Z9QA 3LWIA 2LX7A 1FXXA 2K7AA 4XQ3A 2D8HA 2JNGA 1UJYA 3JB9D 1D1CA 3I55T 1O75A 4FYWB 4JLIA 3WVDB 2XDBA 1A0NB 2Y4YA 2AHJB 1LCKA 2Y4XA 4MZTA 4C0GA 1K9MC 2ZPBB 4PJOG 2E3HA 2O01E 2HSPA 1JXMA 3NTHA 4JUVA 2XD0A 1K8AR 3M56A 4OMQA 1HD3A 4C0ZA 4LUDA 5DY9A 3MEUA 3EGDB 2RQVA 2K57A 4XU0A 2JUFA 2VYTA 3E9FA 1BYMA 4M7DB 4DA4A 1SF9A 1I1JA 3IQLA 2DTIA 3A1PA 2J6KA 1X6BA 3V7RA 3H8ZA 4PJNA 2LQKA 3JCMc 1IHVA 3UDCA 2DE0X 2RHUA 2D0QB 4M78F 1D0XA 4HVWA 3OYAA 3X20B 5KH6A 2MI6A 3EFRA 1WHHA 2RB6A 4LDUA 3OYHA 1YJ9Q 1T0JA 4M7DA 2YRVA 4HA8A 4MMLA 4DOVA 1U3OA 4AFZC 1WNLA 2KT8A 3EGDA 4GLKA 1KHIA 2X3XD 4OGCA 2EKHA 4Z8AA 4M7AF 2OJ2A 1RABB 3HL8A 1FMWA 2JMAA 1M3BA 3JCMf 2B86A 2E41A 2GBQA 4M78C 1YI2Q 1W4SA 1IGUA 2DL7A 2CP6A 2EYQA 3OYIA 2DTOA 1I8FA 5KYYA 3PVQA 1PSFA 1ABQA 2CUBA 2VWFA 5CAIA 1C6VX 3RMSA 1M9SA 1RI0A 4A4GA 1VIEA 2BZ8A 5HCKA 3FJ5A 3CMAA 3JCMe 4PJMA 2J05A 1M3CA 4C0DC 4OP0A 1RAGB 4AFSC 5IAYA 4BD3A 4J9EA 2JVVA 5KCOA 4KH1B 5GAMj 2E10A 2XU8A 3JCMd 3NMZC 3QHSA 1YNZA 4PJOE 1ZA1B 1WQWA 1FYNA 4TVRA 3CQTA 2EW3A 2M02A 5FU6C 3MO8A 2DYBA 1ZBJA 3AT1B 4KRTA 1MHNA 4E7JA 3M9QA 4M77G 2RMOA 4MZPA 2LJ3A 1GCQA 1Z9ZA 1Q81U 1M8MA 3PFSA 1NPPA 4VUBA 4C8QE 2RQWA 3CCEA 1D1BA 2O88A 3V8JA 3VS0A 2CZ7B 3URGA 5C6SA 4XU3A 3SD4A 2ECZA 3G71T 3HP9A 2YRDA 1YJ9T 3CPWP 4PK4A 2K3BA
chains in the Genus database with same CATH topology
4C92E 5LJ5h 4Z02A 2KAFA 4E7LA 5CQXA 2FB7A 2K3XA 5GAN5 2L3RA 5LL6S 3OS2A 2P0QA 4J83A 2OTLA 1VIFA 4EMKA 3GP8A 4OVAA 3OYJA 1N8RC 1KQSA 2HAXA 4O6JA 3OSVA 1YJWA 2C06A 4XTZA 2CZ6B 4B9XA 5KE2A 5CR2A 1VQPA 2KMTA 1VQ7A 3M4YA 4LDWA 5CIUA 5DLOA 2R5AA 3SDZA 3SWNA 2DAQA 2DD4A 3E9GA 3G6ET 2DXCA 2KDSA 4UC4A 3S6WA 2RA2A 3GPLA 3HFNA 1BI3A 2DZ9A 1Y7XA 1JBMA 3VU3C 3J81E 1G3YA 2MF2A 3M4GA 4PJOD 1OYXA 4C92A 2QQAA 1UGSB 4QVZA 3RKWA 5GMKe 1DJ7B 1WGSA 2YLBA 5AYFA 4C5EA 4ZGJB 3CBOA 4JRIA 3A8HB 3VUZA 2KK4A 3R6OA 5GAN7 2RHIA 2VXEA 1N9RA 2LCCA 1I81A 2FHDA 5CKEA 2LTOA 3OSSC 3FRNA 4HKEA 4C8QA 3CCUA 4BY6C 5LJ3j 3M57A 2LCLA 2K5LA 4HT9A 5HK3A 3KUFA 1QVFS 3L2QA 4M75B 2WSFE 2F5KA 3DB3A 5GANj 2K5IA 4E7IA 3CPWS 3CCRA 1NJIU 1K8AU 3LYIA 1QP2A 2PU9B 2QI2A 1VQ4T 1QVGA 5J26A 4M75D 4J6WA 2DZCA 4M77E 5LJ3f 2I2LA 3X25B 3L1AA 2LDMA 4OF1A 3M5AA 3N5BB 2O4XB 1WPYA 2XKOC 1M5Q1 4EMHA 5LJ5d 3QSUA 4M7AA 3PMIA 2X4WA 3JB9I 1XOVA 3CCLT 1BIAA 3OQ5A 4GY5A 1KC8U 2F69A 2KQWA 3F70A 4XTWA 3L2VA 3SB2A 3O8VA 4MDWA 3C4SA 2XI9A 2DK3A 2JN0A 1YIJT 3S3NA 3DLLA 3PGGA 3PTAA 5GANh 4FL6A 4KT0E 2RD1A 4J7FA 1M1KC 1LNXA 5GAN6 4M78D 2EIFA 3CCJT 2ZGWA 1XTDA 1U1TA 2MAMA 1VQNA 5GAMd 3QJYA 3FLGA 2DIQA 1YHQA 3TREA 2LNVA 1KC8C 4XU2A 1QVGS 2E64A 2V8KA 4M78B 4C8QF 3CC4A 1G3SA 2VXFA 3RESA 5CKFA 1KQ2A 1H3ZA 2KY9A 2E65A 4OB3B 4IKFA 4LD9K 3BY7A 1G5VA 1UEBA 3GLXA 5GAOl 1KD1U 2EAYA 3FB9A 2QEXT 2OTJT 2MMPA 3OYFA 2XK0A 5GAMf 4FIBA 1XQHA 5A0LA 1U8RA 2LVMA 1WJSA 2QQSA 3RERA 2GFAA 1IREB 2FYKA 2HQXA 3VV0A 1VQ5A 2VGMA 2XHCA 2GCXA 1QVPA 4M78A 4R56A 1W2BS 3EAEA 3HRSA 3LWHA 3HRUA 3PIOA 3A8LB 3LGLA 1VQ9T 4HCCA 2A3LA 1LOJA 3CBMA 3JCMX 1O9SA 1OI1A 3FEOA 3S3OA 2CYZB 2M1HA 4FSXA 3V8LA 5HK0A 4C92C 2ZPHB 3G7ZA 2RI3A 3E1SA 2OAUA 2IVWA 3CCUT 1BI2A 3BDLA 3NFCA 5GANe 2XG8D 3INZA 4LD6A 3JAME 4PNOA 3PNWC 4ELZC 4M7DC 2P0KA 1YJNA 1UGRB 1W2BA 4PJOB 2JTMA 3RIRA 3G6EA 1WJRA 2X4YA 3A8MB 3MEVA 4M7AB 5KCHA 4JJNK 1Y07A 4M77B 5J3BA 2RHZA 1Q81C 3ZEHA 2CGHA 5CO7A 5CKHA 4IUUA 3MEAA 1IZ6A 3FIFA 1FWZA 4CRIA 5LJ5e 5LJ3g 2Y90A 2QA4T 2E70A 2GQVA 1GXIE 3OA6A 2OTJA 3M55A 5FU7C 2LC4A 3J7AF 1M1GA 1NE8A 3A8OB 2E6NA 4M75A 4PL6A 4QQDA 2QDYB 5FROA 3PIPA 2DXTA 3SWNC 3I56T 1VQ8A 4C8QB 2DXBA 3QYHB 1YIJA 4M7AG 1YITT 1YI2T 2OTLT 1YJ9A 3M59A 5GANf 2EQMA 3OBYA 1Y96A 3CCLA 2L5QA 2G3RA 1HK9A 4IUTA 4N0AC 1VQLT 3I56A 2EQKA 2VGNA 3DKMA 1VQNT 2A7YA 4M7DE 2M16A 4C92B 4P5NA 2R57A 4QVCA 4E7HA 1VQ6T 4J5YA 4BDZA 1WQ7A 3QKJA 3VYGA 4LDXA 5CK9A 3OS1A 2HD0A 4X9CA 2HQEA 3V7CA 4C5HA 5FRNA 4A4HA 3V8KA 5GAOm 4JDSA 2JTFA 5LJ3h 4F7UG 3QPHA 4YTLA 5GAMh 3CCVT 4M75F 4M7AC 2EJGA 3T9NA 3CXCS 4BI8B 3JCMJ 3OW2S 3PT9A 4EMKB 4LDVA 4EMGA 5GMKj 3HPWA 1VQOA 5GAMe 5GANd 4N4GA 5I2SA 1VQ8T 3OBWA 1UGQB 2DXUA 5LJ3d 4EDUA 3NTIA 4JS4A 5FU7B 4BB7A 3SFMA 2DPPB 1QVFA 3HRTA 4OB1B 5GAN2 3L2RA 2ZPEB 4XU1A 4RKUE 4A4EA 3TEEA 2M0OA 4C8QC 1K73C 3ZBDA 3OYKA 1Q82C 1WJQA 2CZ0B 2LT1A 4FM4B 1I5LA 1K9MU 4C5GA 4LDYA 1Q86U 2WACA 1R8OB 4CI0C 3GIBA 4PJOF 1BI0A 3ASKA 4C0FA 2BKDN 1G3WA 4HCZA 1VQLA 1ZQ1A 1SSFA 3FJPA 4FT4A 4J6XA 5CVIA 4C0DB 1VQOT 1N8RU 1M8VA 1D3BA 2RJCA 2LX9A 3WVEB 2NLUA 1MGQA 2DD5A 3OMGA 1K8AC 3RUXA 1VQKA 1NZ9A 4XTYA 3UT1A 1PSEA 2WSCE 4F7UA 3JRZA 4D6WA 3CMEA 4KUDK 4QVDA 5GMKi 3DLMA 1UB4A 2GFUA 4ZN3A 3OYLA 3CCST 1M90U 5LJ5f 4M78E 4N0AA 3META 2EJ9A 4QQ6A 4X34A 2QA4A 1YHQT 3UPUA 4PKCC 4BI4A 4BE0A 4F7UE 1QP3A 1KQ1A 4BI3A 1KHCA 3OYDA 2JZ2A 5GMKl 3OYCA 1Q7YC 3OYBA 1VQ5T 2QQRA 2ZPGB 4KULA 4M77D 4RCBA 3QBYA 4RCCA 4WF2A 4BY6B 5GMKh 3BW1A 1P92A 3JCMV 1VQMT 1N27A 3CC7T 2RJEA 1D3BB 2KVQG 4M75C 2DKGA 3V7SA 4DOWA 1VUBA 2BIVA 4N4IA 1XNIA 5I2MA 3OYYA 3QDRB 4A54A 3JCMP 5A0DA 4MDXA 5FU6B 4Q5WA 1VQMA 5HY6A 1G3TA 4XTUA 3CCQT 4XTVA 4JRPA 3CD6A 3P8DA 5LJ5g 2ZZDA 3HSBA 1YI2A 5M9OA 4Y91A 1NJIC 3GNFB 4M7AE 2X4XA 1QW1A 2R5MA 5GAN4 3OW2A 1B34B 2M9UA 3BFMA 3C94A 4B9WA 3QJ6A 3JB9G 2EFIA 3CC7A 4HT8A 5A2QE 3CCSA 5FRMA 4ZN1A 4BDYA 4C92F 1VQ6A 5GAOr 4DQ2A 4ME7A 4PLIA 1JB0E 2L8DA 1VQPT 1N6AA 3I55A 1EIFA 3QYGB 3QZ5B 5D6YA 5C0MA 4IUVA 2RH2A 3A5ZB 2K3YA 3AHUA 2CZ1B 4FT2A 3BDUA 4ZTJA 1BI1A 2DIGA 4M77F 4E47A 2WSEE 4XTXA 1ZBXA 2EQUA 2V8JA 2RI5A 1AHJB 3JCMW 1M1FA 1M4ZA 2BUDA 3FC3A 2KSSA 1OZ2A 5GAOq 3LWIA 2FL7A 1M90C 5DLQE 1FXXA 3VYHB 2XICA 4XQ3A 3GOXA 3LLRA 2JNGA 1S72A 3JB9D 3OY9A 3G4ST 3JCMQ 4M78G 4M75E 3I55T 1O75A 5HKCA 3OS0A 4JLIA 3RKXA 3WVDB 3X28B 2XDBA 3HHTB 2Y4YA 2AHJB 4BUGA 4JS5A 5KE3A 3LX7A 3QXEB 2Y4XA 4MZTA 1Q86C 1Y96B 2X35A 4C0GA 5FLXE 1YJNT 2ZPBB 1K9MC 4PJOG 4J8OA 3MHXA 5LJ3e 4O5VA 3FDRA 4C92D 2O01E 4X9DA 2H3JA 4FU6A 4IUQA 5D6WA 3UWNA 2XD0A 3NTHA 4JUVA 4QQGA 2D6FA 2ZPIB 3M56A 2JOYA 2P0PA 4IUPA 1JJ2A 3QZ9B 2RI2A 2K5FA 1H641 2QEXA 5D6XA 4C0ZA 5DY9A 3MEUA 2PUOB 2DO3A 2K57A 4XU0A 5GAMg 4II1A 2JUFA 1U1SA 2VYTA 2RJFA 3E9FA 2XIDA 1BYMA 3VUBA 3VJPA 4M77A 4DA4A 4M7DB 1YBYA 3OMCA 4M75G 4PJOC 4PJOA 2DTIA 3OS5A 4IURA 3GNGA 2IG0A 3OYMA 4JRQA 3V7RA 3H8ZA 1K73U 3CMET 2LQKA 4C92G 2PQWA 3ME9A 3CEYA 3JCMc 3UDCA 3LH0A 1V29B 2RHUA 3GF5A 2D0QB 2LT4A 4M78F 5EG2A 2E12A 3OYAA 2E5QA 3JSCA 3MEWA 2MI6A 3X20B 5KH6A 4V2SA 2CKKA 2RM4A 1JJ2S 3EFRA 4F7UF 2RB6A 1OZ3A 4OGEA 3A8GB 3CPWA 4LDUA 3OB9A 3OYHA 5IT9E 5A0GA 4ZGDB 2YRVA 3DB4A 4HA8A 2QXFA 4MMLA 4DOVA 3L42A 4M7DA 4OB2B 4C8QG 4HCBA 2EKOA 1YCYA 1WNLA 2X4JA 5GAN3 2K4YA 5CQYA 3C95A 2VUBA 4GLKA 4BACA 1KHIA 4NL2A 4XK8E 3X26B 4M7AD 4OGCA 2E6ZA 2RJDA 4M7AF 1X75C 4A4KA 4J7IA 2YLCA 3HL8A 3QO3A 5CCAA 3CC2A 3L2WA 2E41A 4Y28E 3JCMf 4M78C 4C5IA 1W4SA 1VQ4A 3OYNA 2DJZA 2EYQA 3QG1A 4EMKC 3OYIA 3CCVA 2DTOA 2R58A 4MZMA 1I8FA 2EJFA 5GAOp 4L5GA 3JCMh 4XAXB 4M7DF 3M53A 1S72T 5GMKm 4C8QD 1PSFA 1X6OA 4MMKA 1HXDA 5CAIA 1VQ9A 2F5TX 3QUIA 2QTXA 3EFSA 3Q1JA 3RMSA 2MWPA 3ER0A 3LW5E 5I21A 2D9TA 1RI0A 1M9SA 1ZHIA 2VC8A 4RMOA 4A4GA 3VKIA 4N4HA 3CCMT 4JLGA 1VIEA 4ELYC 3RMQA 1YJWT 2FVUA 3CCQA 2O4XA 3CMAA 1Q7YU 2XDPA 1N9SA 3E19A 3JCMb 2MWOA 3JCMe 4NS5A 3CPFA 3CXCA 2EQJA 2RK1A 2PVDB 3QIIA 3OYGA 4C0DC 2K2VA 3MCAB 3RKYA 1JRIA 4OP0A 5CKBA 1KG1A 3CC4T 4J6YA 2ZPFB 1UGPB 5IAYA 2QQ9A 3ZFJA 1VQ7T 3JCMg 4BD3A 5CKDA 2JVVA 5KCOA 5GAMj 1B34A 2E10A 2XU8A 4EPCA 4BE2A 3JCMd 4OB0B 1TH7A 3KBGA 4ZTFA 4M77C 3H6ZA 1Y71A 3CMAT 3CC2T 2DVEA 4E7KA 4PLLA 4M7DD 3HKSA 5LJ5j 2L89A 3QHSA 1M1KU 4A53A 1VQKT 2XDDA 2B8AA 3NTKA 4JRKA 3CCMA 3CCET 3JB9F 3CBPA 4PJOE 2PUKB 2LRQA 2YHTA 1WQWA 1NPRA 4TVRA 2HBPA 4A4FA 5GANg 2LQ8A 3G4SA 5GAN8 1BIBA 2E1HA 2RO0A 2V8IA 3L2ZA 4NL3A 4KUIA 3CCRT 5J39A 3G71A 3HFOA 4QW2A 3SWNB 3OYEA 5FU6C 2EWNA 3MO8A 3PMTA 4OMFB 1MHNA 4E7JA 3J80E 1X01A 3M9QA 3MP8A 3MP6A 4ATOA 4M77G 1FX7A 4MZPA 3M58A 1Q81U 2PVOB 1KD1C 3PFSA 4F7UB 2GF7A 1KQSS 4RG8A 4M7DG 1NPPA 2DEQA 4VUBA 3TCJA 1BKBA 1LJOA 2PVGB 4C8QE 4R55A 5IN1A 4RG2A 4L59A 5DM7R 2CS7A 3P8HA 3JB9J 2DTHA 3TU4K 3CCEA 2RHXA 3X24B 1I4K1 2ZCFB 3P8BB 5L8RE 3V8JA 3L2UA 3LGFA 2RHYA 4ZGEB 2CZ7B 4NOYA 3URGA 5C6SA 4XU3A 4BE1A 3CD6T 3JB9H 3SD4A 1RL2A 2P4TA 4L6V5 3G71T 3HP9A 5GAOn 2HNIA 2RK2A 1Q82U 3CCJA 3WXMB 3M54A 3S3MA 1YJ9T 2QQBA 1YITA 3KXTA 3MP1A 2VV5A 3C12A 4KBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAC A;  1XNI A;  4Z02 A;  3BDL A;  4Q5W A;  2RJD A;  4LD6 A;  4E7L A;  2K3X A;  3PNW C;  2L3R A;  2P0K A;  3OS2 A;  4OVA A;  1WJR A;  2X4Y A;  3P8D A;  3MEV A;  5KCH A;  3OYJ A;  3L2W A;  3OYF A;  4C5I A;  5M9O A;  2RHZ A;  4B9X A;  3ZEH A;  5KE2 A;  3OYN A;  2X4X A;  5CIU A;  4IUU A;  2R5M A;  3OYI A;  2R5A A;  3MEA A;  2DAQ A;  2R58 A;  3QJ6 A;  4B9W A;  2EFI A;  3E9G A;  4CRI A;  5FRM A;  4UC4 A;  4BDY A;  3S6W A;  4PLI A;  3OA6 A;  2L8D A;  5D6Y A;  5C0M A;  4QQD A;  3Q1J A;  4PL6 A;  2E6N A;  4IUV A;  5FRO A;  2MWP A;  1OYX A;  2D9T A;  1RI0 A;  2K3Y A;  4QVZ A;  4A4G A;  4N4H A;  4ZTJ A;  1WGS A;  2DIG A;  4C5E A;  2O4X A;  2EQM A;  2EQU A;  2XDP A;  2RHI A;  2LCC A;  2RI5 A;  2FHD A;  2G3R A;  2MWO A;  4IUT A;  2BUD A;  2LTO A;  2EQK A;  3FC3 A;  1OZ2 A;  4NS5 A;  2M16 A;  2EQJ A;  2R57 A;  4E7H A;  3KUF A;  3QII A;  3L2Q A;  3GOX A;  3OYG A;  3LLR A;  3QKJ A;  2F5K A;  3DB3 A;  4BDZ A;  3OY9 A;  4E7I A;  3OS1 A;  2HQE A;  3LYI A;  4C5H A;  5IAY A;  4A4H A;  3OS0 A;  5FRN A;  4BD3 A;  2JTF A;  5J26 A;  5KE3 A;  3LX7 A;  5KCO A;  4BE2 A;  2LDM A;  2X35 A;  4ZTF A;  3H6Z A;  2O4X B;  3FDR A;  4E7K A;  4PLL A;  3PMI A;  2X4W A;  2L89 A;  3OQ5 A;  4FU6 A;  4GY5 A;  4IUQ A;  5D6W A;  3UWN A;  3L2V A;  2B8A A;  3F70 A;  3NTK A;  3NTH A;  4N4G A;  4QQG A;  3O8V A;  3C4S A;  4IUP A;  2LRQ A;  4A4F A;  3S3N A;  4EDU A;  2RI2 A;  3NTI A;  5D6X A;  4FL6 A;  2RO0 A;  3MEU A;  5J39 A;  4QW2 A;  3L2R A;  4II1 A;  4A4E A;  2VYT A;  3OYE A;  3E9F A;  2RJF A;  2M0O A;  3MO8 A;  3OYK A;  1WJQ A;  3PMT A;  1MHN A;  4C5G A;  4E7J A;  3M9Q A;  3FLG A;  2WAC A;  3MP8 A;  3MP6 A;  2DIQ A;  3OMC A;  4IUR A;  3ASK A;  2IG0 A;  1H3Z A;  2BKD N;  3OYM A;  4HCZ A;  1SSF A;  3H8Z A;  3PFS A;  2GF7 A;  4IKF A;  1G5V A;  2PQW A;  3ME9 A;  3CEY A;  5IN1 A;  2RJC A;  2XK0 A;  2RHU A;  3LH0 A;  2NLU A;  4L59 A;  4RG2 A;  3OMG A;  3P8H A;  3OYA A;  2E5Q A;  2LVM A;  1WJS A;  2QQS A;  3MEW A;  2GFA A;  3UT1 A;  2CKK A;  5KH6 A;  2RHX A;  2HQX A;  3DLM A;  3L2U A;  2GFU A;  3OYL A;  3LGF A;  1OZ3 A;  2RHY A;  4QQ6 A;  3MET A;  3OB9 A;  4X34 A;  3OYH A;  5C6S A;  3EAE A;  4BE1 A;  4BE0 A;  3SD4 A;  3OYD A;  1KHC A;  3LGL A;  2JZ2 A;  2YRV A;  3DB4 A;  3OYC A;  3L42 A;  3OYB A;  2QQR A;  2EKO A;  1OI1 A;  3FEO A;  3QBY A;  3S3O A;  3S3M A;  2M1H A;  1N27 A;  2RJE A;  2RI3 A;  3MP1 A;  2BIV A;  4N4I A; 
#chains in the Genus database with same CATH topology
 2NUP A;  5LJ5 h;  5IHK A;  1OQK A;  2FB7 A;  1WXU A;  3G4S Q;  3CCV Q;  2OTL A;  3G71 Q;  4O6J A;  1YJW A;  1TXQ A;  2CZ6 B;  4B9X A;  5CR2 A;  2I0N A;  4HVU A;  1VQ7 A;  2R5A A;  2DD4 A;  3E9G A;  3G6E T;  2KDS A;  4OMO A;  2DZ9 A;  1JBM A;  1QWE A;  3J81 E;  2KI7 A;  1ACM B;  1G3Y A;  2KT1 A;  4FW1 A;  4Z88 A;  3RKW A;  5GMK e;  2YWW A;  2YLB A;  1JJ2 P;  3CBO A;  4JRI A;  3A8H B;  2PZ1 A;  4HKE A;  4AFU C;  4BY6 C;  2C0O A;  3M57 A;  2HKN A;  1QVF S;  4M75 B;  1OU9 A;  3CPW S;  3D7S B;  2KRN A;  3RDV A;  1NJI U;  2PU9 B;  5J26 A;  2I2L A;  2LDM A;  4J9D A;  1WPY A;  2XKO C;  1M5Q 1;  3JB9 I;  1BIA A;  3OQ5 A;  4GY5 A;  2M0Y A;  2QAS A;  2XI9 A;  1X2Q A;  2DJQ A;  3CC2 Q;  3G6E Q;  1G8X A;  1OUL A;  4FL6 A;  2RD1 A;  2F1L A;  1LNX A;  2YUQ A;  4KGV B;  2PNI A;  2EIF A;  3EG2 A;  1XTD A;  2MAM A;  4WCI A;  2DIQ A;  3TRE A;  2LNV A;  4DBF A;  2E64 A;  1H3Z A;  1E7O A;  2VXF A;  3RES A;  1KQ2 A;  3VS1 A;  3SHW A;  2KY9 A;  4IKF A;  3BY7 A;  4AG2 C;  1IHW A;  1UGV A;  2A0F B;  2K2M A;  1XQH A;  2LVM A;  2QQS A;  2GFA A;  1IRE B;  2DA9 A;  1BBZ A;  1J3T A;  3LWH A;  2A3L A;  1LOJ A;  1RAD B;  2CYZ B;  5HK0 A;  2KRM A;  3KFV A;  2ZPH B;  2RI3 A;  3E1S A;  3CCU T;  2AKL A;  3BDL A;  3NFC A;  5EC7 A;  3INZ A;  4E2F B;  3PNW C;  2ESW A;  4M7D C;  3A8M B;  4JJN K;  4M7A B;  5KCH A;  1Y07 A;  4M77 B;  1YJW Q;  2MCN A;  2QEX Q;  4J9F A;  1UFF A;  3UA7 A;  4CRI A;  1FWZ A;  4F14 A;  2E70 A;  1KQS P;  2P84 A;  1IGQ A;  5FU7 C;  2W10 A;  3J7A F;  4PL6 A;  3A8O B;  2ENM A;  3QYH B;  1BB9 A;  3M59 A;  5GAN f;  2ROT A;  3OBY A;  9ATC B;  1D1A A;  1Y96 A;  1VQL T;  4IUT A;  4M7D E;  2EQK A;  1VQN T;  1PWT A;  2M51 A;  2C0I A;  2M16 A;  2R57 A;  2O9V A;  4BDZ A;  3QKJ A;  1VQK Q;  4LDX A;  5KYU B;  3OS1 A;  3I9Q A;  4X9C A;  2HQE A;  5GJW B;  4A4H A;  5GAO m;  2JTF A;  5LJ3 h;  4F7U G;  1X27 A;  5GAM h;  2EJG A;  3T9N A;  1I07 A;  4EMG A;  5GAM e;  1OV3 A;  1UGQ B;  1QVF A;  4DEY A;  4XU1 A;  1B07 A;  4J9I A;  3OYK A;  2LT1 A;  4D8D A;  3CCM Q;  1BK2 A;  1K9M U;  4C5G A;  4LDY A;  1BI0 A;  3EGU A;  2FEI A;  4HCZ A;  4LXC A;  2KR3 A;  3FJP A;  2FPD A;  2RJC A;  3EH2 A;  3EG3 A;  3RUX A;  1NZ9 A;  3UT1 A;  2CP0 A;  2WSC E;  4DEX A;  2ZAE A;  3JRZ A;  7AT1 B;  1SRL A;  4IIO A;  4QQ6 A;  4X34 A;  1UJ0 A;  1Q7Y C;  2EVR A;  5GMK h;  3CC7 T;  2L3P A;  1VUB A;  4PFZ A;  4N4I A;  2J6F A;  3OYY A;  3JCM P;  5FU6 B;  4RTW A;  3UF4 A;  3H0F A;  2BZY A;  3CD6 A;  1UHC A;  2ZZD A;  3RR6 A;  1YI2 A;  2NYS A;  3GNF B;  3MPU B;  2R5M A;  3C94 A;  4B9W A;  3CC7 A;  4EIK A;  1X2K A;  5A2Q E;  4BDY A;  4C92 F;  5GAO r;  4DQ2 A;  2L3S A;  3A5Z B;  4AT1 B;  1IO6 A;  1MNE A;  2K3Y A;  4FCY A;  4ZTJ A;  2DIG A;  2EQU A;  2RI5 A;  3JCM W;  1M4Z A;  1OZ2 A;  1Q81 R;  2LNH B;  5DLQ E;  2DYI A;  2CT4 A;  3OY9 A;  1KSW A;  3G4S T;  1UE9 A;  3OS0 A;  2QTV A;  1AT1 B;  1VQL Q;  3HHT B;  4JS5 A;  4BUG A;  3EHR A;  2X35 A;  3H9N A;  4J8O A;  5LJ3 e;  4O5V A;  1R77 A;  4FU6 A;  2ZPI B;  1QWF A;  2MOX A;  2COW A;  2RI2 A;  5D6X A;  2DFU A;  1Y0M A;  2RJF A;  1HSQ A;  3VUB A;  3VJP A;  1YN8 A;  1AWJ A;  3GNG A;  1K0X A;  3OYM A;  3CEY A;  1CKA A;  2E5Q A;  1WA7 A;  4V2S A;  5IHI A;  1JJ2 S;  2DX1 A;  2FPE A;  5A0G A;  3DB4 A;  1QVF P;  3L42 A;  2DVJ A;  3SEM A;  4C8Q G;  1NEG A;  1WLP B;  1KJW A;  2K4Y A;  5CQY A;  1PNJ A;  1PD0 A;  2ED0 A;  3RNJ A;  3TSW A;  2YLC A;  3QO3 A;  3CC2 A;  1MMG A;  2IPO B;  1TUC A;  1R0C B;  2BE7 D;  2DJZ A;  3QG1 A;  1HJD A;  2R58 A;  2KYM A;  1OOT A;  4XAX B;  5ECA A;  3M53 A;  1WZO A;  4RUG A;  4C8Q D;  1AWW A;  4MMK A;  1ZSZ A;  2F5T X;  3EFS A;  3Q1J A;  3QUI A;  2LCS A;  3ER0 A;  2CP5 A;  3LW5 E;  1VQO T;  1ZHI A;  2H3E B;  2VC8 A;  3CCM T;  3VKI A;  4N4H A;  4JLG A;  1WHL A;  1TUG B;  1N9S A;  3E19 A;  1PCX A;  4LNP A;  2EQJ A;  2PVD B;  1G83 A;  2K2V A;  1JRI A;  5CKB A;  4J6Y A;  2ZPF B;  2DER A;  1VQ7 T;  5CKD A;  2EGE A;  4DBQ A;  3H6Z A;  3CC2 T;  4OMN A;  4Z89 A;  2CP3 A;  4E7K A;  4M7D D;  2PTK A;  4A53 A;  1VQK T;  3EG1 A;  2B8A A;  3NTK A;  2YHT A;  2LQ8 A;  2RNA A;  3G4S A;  2RO0 A;  3L2Z A;  5J39 A;  3HFO A;  2ROL A;  4FYX B;  3SWN B;  3OYE A;  1QVG P;  4OMF B;  5KYW A;  1MUZ A;  1FX7 A;  3M58 A;  1JXO A;  4JZ3 A;  1KQS S;  1KFZ A;  1QQJ A;  1BKB A;  1AZE A;  4RG2 A;  4L59 A;  2F2V A;  5DM7 R;  3JB9 J;  2DTH A;  3TU4 K;  3I5S A;  3LGF A;  2RHY A;  4E6R A;  4BE1 A;  1GBR A;  1PHT A;  3CD6 T;  1D0Z A;  3JB9 H;  4L6V 5;  3CCQ Q;  2L2P A;  3VRZ A;  3CCJ A;  3ULR B;  3WXM B;  2QQB A;  1YIT A;  1EFN A;  3TQ7 P;  2VV5 A;  1OU8 A;  4Z02 A;  2KAF A;  2CP7 A;  2L3R A;  1VIF A;  2EPD A;  4EMK A;  4OVA A;  3OYJ A;  2HAX A;  1VQP A;  2VVK A;  2KMT A;  4JJC A;  3EG0 A;  2L0A A;  5DLO A;  1VQO Q;  3SDZ A;  4AMC A;  3SWN A;  1Y57 A;  5I11 A;  1BCO A;  3MKD A;  2MF2 A;  1WYX A;  2JT4 A;  4C92 A;  2QQA A;  1UGS B;  1WGS A;  1GCQ C;  5AYF A;  3QWY A;  2KK4 A;  1N9R A;  2LCC A;  2VXE A;  2JXB A;  2W0Z A;  5CKE A;  2LTO A;  3OSS C;  2RQU A;  1M2V A;  5LJ3 j;  1VQ5 Q;  1OPL A;  2O2O A;  3L2Q A;  2F5K A;  2K5I A;  4E7I A;  2COZ A;  2HDA A;  3LYI A;  1QP2 A;  2QI2 A;  1QVG A;  2DZC A;  4M77 E;  2EYZ A;  2YXY A;  3M5A A;  3N5B B;  3PMI A;  1NLO C;  2F69 A;  2KQW A;  3F70 A;  4XTW A;  1PKT A;  4MDW A;  3DLL A;  3PGG A;  1VQ4 Q;  1WXB A;  4J7F A;  1PD1 A;  1CSK A;  3CCJ T;  1VQN A;  2C0T A;  1RUW A;  2CUD A;  1QVG S;  4Y92 A;  1RAE B;  4C8Q F;  4LD9 K;  1UEB A;  2QEX T;  3OYF A;  5GAM f;  4FIB A;  1AWO A;  1U8R A;  3MJX A;  3RER A;  2BTT A;  2HQX A;  1VQ5 A;  2VGM A;  2GCX A;  1QVP A;  1QCN A;  4M78 A;  4R56 A;  4PFP A;  3HRU A;  3A8L B;  3LGL A;  3JCM X;  3V8L A;  3CC4 Q;  1FMV A;  1JU5 C;  5GAN e;  2XG8 D;  4LD6 A;  4ELZ C;  1WHK A;  2P0K A;  2JTM A;  3RIR A;  2X4Y A;  4LUE A;  3H0I A;  3MEV A;  1M90 R;  3ZEH A;  2CGH A;  5CO7 A;  5CKH A;  4IUU A;  2SRC A;  3MEA A;  1IZ6 A;  2AKK A;  2QA4 T;  2GQV A;  2EQI A;  3OA6 A;  3M55 A;  1M1G A;  1NE8 A;  2K79 A;  3PIP A;  2RF0 A;  2QDY B;  1ZSG A;  1K9M R;  2LMJ A;  4QKU A;  1U06 A;  1YFN A;  1YIJ A;  3M0R A;  3PVL A;  3CCL A;  2KXC A;  4N0A C;  2AZV A;  1RLP C;  3VS7 A;  4P5N A;  4QVC A;  2BZX A;  4E7H A;  1NJI R;  5I22 A;  3VYG A;  4GLM A;  5CK9 A;  2HD0 A;  3V7C A;  4C5H A;  3V8K A;  4IIM A;  2JM9 A;  2NUT A;  2LJ0 A;  3CXC S;  4BI8 B;  5GMK j;  2GNC A;  3HPW A;  1VQ6 Q;  1VQ8 T;  1RLQ C;  4KGZ B;  2DXU A;  4JS4 A;  5FU7 B;  3SFM A;  2DPP B;  2X51 A;  3HRT A;  5GAN 2;  4RKU E;  4C8Q C;  3TEE A;  2M0O A;  1K73 C;  5FWB A;  4PJO F;  2BKD N;  1G3W A;  1SSF A;  3VS4 A;  2RQR A;  1ZLM A;  1OPK A;  2DD5 A;  1AEY A;  1K8A C;  2J7I A;  1PSE A;  4F7U A;  1WX6 A;  2DL8 A;  4D6W A;  4KUD K;  3DLM A;  2GFU A;  2DMO A;  2VB6 A;  3MET A;  2QA4 A;  3UPU A;  4BI4 A;  4F7U E;  4BI3 A;  5GMK l;  3OYB A;  3CXC P;  1WXT A;  2JMC A;  4BY6 B;  1VQM T;  1SEM A;  1N27 A;  3BE3 A;  2RJE A;  4M75 C;  2DKG A;  5I2M A;  3UA6 A;  4CC3 A;  4XTU A;  2VKN A;  3P8D A;  2CRE A;  1OX8 A;  2HEQ A;  4HT8 A;  2EFI A;  5FRM A;  1YIT Q;  1JB0 E;  2EGA A;  2MYS A;  4IUV A;  3AHU A;  2ATC B;  4FT2 A;  2E5K A;  1BI1 A;  4M77 F;  2KNB B;  3VYH B;  3E2U A;  3GOX A;  4M78 G;  4M75 E;  5HKC A;  2KYB A;  3RKX A;  3X28 B;  1ZUK A;  4AFQ C;  1W6X A;  3QXE B;  1Q86 R;  1WFW A;  1Y96 B;  3FDR A;  5KYX B;  4X9D A;  5D6W A;  3UWN A;  2D6F A;  2JOY A;  2P0P A;  3QZ9 B;  1H64 1;  2CDT A;  2QEX A;  2DF6 A;  1IXD A;  4D8K A;  1LPL A;  4M77 A;  1PM3 A;  1YBY A;  2EYY A;  3OMC A;  4M75 G;  3M0S A;  3OS5 A;  4HXJ A;  2IG0 A;  3RBB B;  4JRQ A;  1K73 U;  3EHQ A;  3EH1 A;  2PQW A;  1V76 A;  1AWX A;  1VYT A;  3LH0 A;  3JSC A;  3MEW A;  1S72 Q;  3I56 Q;  2RM4 A;  2LQN A;  4HVV A;  1OZ3 A;  4OGE A;  3A8G B;  1YIJ Q;  4ZGD B;  3VS6 A;  4OB2 B;  4HCB A;  2OTJ Q;  5IH2 A;  1B7T A;  2VUB A;  4BAC A;  3X26 B;  2E6Z A;  4RTX A;  4A4K A;  5IXB A;  5CCA A;  5KYX A;  1VQP Q;  1ZX6 A;  1SKU B;  2Z0W A;  1QKW A;  4MZM A;  2EJF A;  4PFO A;  4L5G A;  3JCM h;  1S72 T;  5GMK m;  1HXD A;  2D9T A;  4FW2 A;  4RMO A;  4ELY C;  5GJV B;  2CSQ A;  3CCQ A;  3JCM b;  2MWO A;  4LN2 A;  1M3A A;  2KRS A;  3CXC A;  5KYN A;  2RK1 A;  1TU0 B;  2YUN A;  3OYG A;  4GBQ A;  2L3Q A;  3CC4 T;  1UGP B;  3ZFJ A;  2KRO A;  1Q7Y R;  1UUE A;  1B34 A;  2YSQ A;  4BE2 A;  1YHQ Q;  1TH7 A;  4ZTF A;  1Y71 A;  2AT1 B;  3I55 Q;  2YT6 A;  5LJ5 j;  1M1K U;  2XDD A;  2QYZ A;  4JRK A;  3CCM A;  1C0M A;  3JB9 F;  3CBP A;  2JS2 A;  2PUK B;  3H0H A;  3CC7 Q;  1AOJ A;  2KGT A;  1V1C A;  5GAN 8;  1RAH B;  1BIB A;  2CP2 A;  2V8I A;  3QDF A;  4NL3 A;  4ATO A;  3G71 A;  1PRM C;  2OTL Q;  2OI3 A;  2EWN A;  1NLP C;  3PMT A;  3J80 E;  1RAF B;  3MP6 A;  1SSH A;  1EX4 A;  1KD1 R;  3QWX X;  2PVO B;  4F7U B;  1SHG A;  2GF7 A;  1WHG A;  4RG8 A;  5IXF A;  2DEQ A;  3TCJ A;  1LJO A;  4R55 A;  2CS7 A;  2RHX A;  3O5Z A;  1I4K 1;  2ZCF B;  3P8B B;  2A08 A;  4ZGE B;  4NOY A;  1TTH B;  1NG2 A;  1GRI A;  3VRY A;  1RL2 A;  1E6H A;  1D09 B;  2HNI A;  2RK2 A;  4F17 A;  3M54 A;  1M27 C;  1S1N A;  3KXT A;  3MP1 A;  2JJ9 A;  1ZSZ C;  4KBM B;  1VQ9 Q;  1YCS B;  1JQQ A;  1X6G A;  4E7L A;  5CQX A;  3ZL7 C;  5LL6 S;  4J83 A;  3CD6 Q;  3GP8 A;  3OSV A;  1SPK A;  2QG9 B;  4LDW A;  2NUT B;  5CIU A;  2KBT A;  4CC7 A;  3GPL A;  2HQH A;  1BI3 A;  1Y7X A;  1NM7 A;  1TG0 A;  3M4G A;  4PJO D;  1OYX A;  2FRY A;  4C5E A;  3EG9 B;  4ZGJ B;  2FZK B;  2DET A;  3R6O A;  1W1F A;  2FHD A;  2HSE B;  3FRN A;  4C8Q A;  4HT9 A;  1YWP A;  5HK3 A;  3KUF A;  2WSF E;  5GAN j;  3CCR A;  1F1B B;  1K8A U;  1VQ4 T;  3M0U A;  4M75 D;  4J6W A;  2XMF A;  3TSZ A;  5LJ3 f;  1VQ8 Q;  3L1A A;  2DNU A;  2V26 A;  1ARK A;  1WHJ A;  2CT3 A;  4DBH A;  5LJ5 d;  4EMH A;  1AZG B;  3CCL T;  1XOV A;  3L2V A;  4RTV A;  4RTY A;  3EGX B;  3C4S A;  2DK3 A;  2JN0 A;  2RQT A;  2YUO A;  2OX7 A;  3S3N A;  1T3S A;  3PTA A;  2EGC A;  5GAN h;  2D0N A;  4KT0 E;  2LP5 A;  2X3W D;  5KYY B;  4OMM A;  1M1K C;  5GAN 6;  1K4U S;  2ZGW A;  5GAM d;  3QJY A;  1KC8 C;  2RN8 A;  2V8K A;  1G3S A;  3C0C A;  1W70 A;  5IHN A;  1G5V A;  3NPF A;  3GLX A;  5GAO l;  1KD1 U;  2EAY A;  3FB9 A;  2MMP A;  1UDL A;  1WJS A;  3PE0 A;  1X43 A;  1Q95 G;  1W2B S;  2O31 A;  3CBM A;  1X69 A;  1O9S A;  4A63 B;  1OI1 A;  2OAU A;  1NBE B;  1BI2 A;  2LJ1 A;  3JAM E;  2DL4 A;  1WIE A;  1YJN A;  2V1R A;  1UGR B;  2VAS A;  2RPN A;  5J3B A;  2RHZ A;  1Q81 C;  1PKS A;  1QLY A;  3FIF A;  5LJ5 e;  2DM1 A;  2Y90 A;  4QQD A;  2E6N A;  5FRO A;  1M2V B;  2DXT A;  3SWN C;  1VQ8 A;  4C8Q B;  2DXB A;  4M7A G;  4ANJ A;  1YIT T;  2GGR A;  1VYU A;  2EQM A;  3EG9 A;  2L5Q A;  2G3R A;  1AD5 A;  3DKM A;  2A7Y A;  4C92 B;  2MPX C;  1IRX A;  1T3L A;  3CCE Q;  1WQ7 A;  2EYW A;  5FW9 A;  1JEG A;  2YUP A;  3M0P A;  1SG5 A;  3QPH A;  2D1X A;  1CKB A;  2E4H A;  4YTL A;  3CCV T;  4M75 F;  3HTR A;  2YRC A;  3VS3 A;  1MV0 B;  2DEU A;  3JCM J;  5D7U A;  6AT1 B;  1VQO A;  5GAN d;  5I2S A;  3OBW A;  1TUD A;  4EDU A;  1VQ7 Q;  4BB7 A;  4K11 A;  4A4E A;  3ZBD A;  1WJQ A;  2CZ0 B;  4RTU A;  2GQI A;  2IIM A;  4CI0 C;  1GBQ A;  1YP5 A;  3ASK A;  1FMK A;  1VQL A;  4FYY B;  1ZQ1 A;  2G6F X;  2HL3 A;  5CVI A;  4C0D B;  2DBK A;  2X9H A;  1H3H A;  1D3B A;  2LX9 A;  2O9S A;  3OMG A;  1VQK A;  1K9A A;  2P4R A;  1UB4 A;  3CCS T;  4ZN3 A;  3CME Q;  3EFO B;  1LVK A;  4M78 E;  5LJ5 f;  2EJ9 A;  4PKC C;  4BE0 A;  1KHC A;  5KYW B;  1VQ5 T;  2QQR A;  2ZPG B;  3A98 A;  3QBY A;  4WF2 A;  1W2B P;  3BW1 A;  1D3B B;  3V7S A;  4DOW A;  2BIV A;  2DRK A;  1XNI A;  4A54 A;  3QDR B;  4RTZ A;  5A0D A;  4MDX A;  5FWC A;  1ZUU A;  4J9B A;  5HY6 A;  1G3T A;  1KK7 A;  4XTV A;  1U5S A;  3CCQ T;  4JRP A;  2A37 A;  1N8R R;  3HSB A;  4ORZ A;  2J6O A;  1D0Y A;  4M7A E;  2FRW A;  4CC2 A;  1B34 B;  3OW2 A;  1YJN Q;  3CCS A;  4ZN1 A;  1VQ6 A;  1VQP T;  3I55 A;  1EIF A;  5D6Y A;  1KC8 R;  1N5Z A;  1EZZ B;  3BDU A;  2HZY A;  4E47 A;  2WSE E;  1ZBX A;  2V8J A;  2H8H A;  1AHJ B;  2KSS A;  5GAO q;  8ATC B;  2FL7 A;  1M90 C;  2XIC A;  1NYG A;  1TS9 A;  1ZSZ B;  3LLR A;  1S72 A;  3JCM Q;  2K6D A;  3CMA Q;  2DRM A;  1Q82 R;  5KE3 A;  3LX7 A;  1QCF A;  1Q86 C;  1I5O B;  5FLX E;  1YJN T;  3MHX A;  4C92 D;  2H3J A;  4IUQ A;  2FZG B;  1WI7 A;  1C1A A;  4QQG A;  4IUP A;  1JJ2 A;  2DBM A;  2MIO A;  2K5F A;  3JV3 A;  2PUO B;  2DO3 A;  1MMD A;  5GAM g;  2DL5 A;  4II1 A;  1U1S A;  1WDX A;  2EYX A;  3R6N A;  2XID A;  1UG1 A;  1H8K A;  4PJO C;  4J9G A;  4PJO A;  4IUR A;  2J06 A;  4CC4 B;  3CME T;  1MND A;  4C92 G;  3ME9 A;  4JPB W;  4WTO B;  1V29 B;  3GF5 A;  5EG2 A;  2LT4 A;  2E12 A;  2CKK A;  4F7U F;  2FO0 A;  3CPW A;  3OB9 A;  1VA7 A;  1ZA2 B;  5IT9 E;  2QXF A;  2EKO A;  2F2W A;  1YCY A;  4M4Z A;  2X4J A;  5GAN 3;  1KIK A;  2LZ6 B;  2SEM A;  3C95 A;  4ESR A;  4NL2 A;  4XK8 E;  4M7A D;  2RJD A;  1X75 C;  2KEA A;  4J7I A;  3M0T A;  1PRL C;  3L2W A;  4Y28 E;  2DLP A;  3NGP A;  4C5I A;  1VQ4 A;  3OYN A;  4EMK C;  3CCV A;  5GAO p;  4B6M A;  1M30 A;  4M7D F;  3I5R A;  1X6O A;  2QAZ A;  3NHN A;  1VQ9 A;  1ZUY A;  2GTJ A;  2QTX A;  4DBR A;  2JM8 A;  2MWP A;  3EGX A;  5I21 A;  1WHM A;  1G2B A;  3RMQ A;  1YJW T;  2FVU A;  2O4X A;  1Q7Y U;  2XDP A;  5L23 A;  1MMA A;  2HMA A;  4NS5 A;  3CPF A;  4J9H A;  4RTT A;  3QII A;  3CCU Q;  1RI9 A;  1HYO A;  1M1K R;  3MCA B;  3RKY A;  3VS2 A;  1KG1 A;  2ED1 A;  2QQ9 A;  3JCM g;  4KH0 B;  4EPC A;  1GL5 A;  4OB0 B;  3KBG A;  4M77 C;  1I0C A;  3CMA T;  3CCS Q;  2DVE A;  4PLL A;  3HKS A;  2L89 A;  3CCE T;  3UAT A;  2LRQ A;  4PJL A;  1NPR A;  4A4F A;  2HBP A;  1VOM A;  2KE9 A;  5GAN g;  2E1H A;  3CCR T;  4KUI A;  1SHF A;  4QW2 A;  1UHF A;  5AT1 B;  1NEB A;  2EBP A;  1X01 A;  3MP8 A;  1R0B G;  4F04 B;  1MV3 A;  2YDL A;  1KD1 C;  3U23 A;  3CCR Q;  4M7D G;  2PVG B;  2COY A;  5IN1 A;  2MK5 A;  3P8H A;  2JW4 A;  4E7S A;  1JO8 A;  4F16 A;  3X24 B;  5L8R E;  3L2U A;  2KXD A;  2QDL A;  2K9G A;  4FSS A;  2P4T A;  3THK A;  5GAO n;  4QT7 A;  1Q82 U;  3S3M A;  1OX9 A;  1GCP A;  4E7Z A;  1GFD A;  3C12 A;  3REB B;  4C92 E;  4JZ4 A;  2K3X A;  5GAN 5;  3OS2 A;  2P0Q A;  1T0H A;  1N8R C;  3LH5 A;  1KQS A;  2C06 A;  4XTZ A;  5KE2 A;  3M4Y A;  2DAQ A;  2DXC A;  4UC4 A;  3S6W A;  2RA2 A;  3HFN A;  2V1Q A;  5KYU A;  1GFC A;  3VU3 C;  4QVZ A;  1DJ7 B;  1K0S A;  1UEC A;  3VUZ A;  5GAN 7;  2RHI A;  3VS5 A;  1I81 A;  2NWM A;  3CCU A;  4HCK A;  2FPF A;  2LCL A;  2K5L A;  4OML A;  1BU1 A;  2HL5 C;  3DB3 A;  4ZNX A;  4PJJ A;  1ABO A;  3X25 B;  4OF1 A;  2O4X B;  4M7A A;  3QSU A;  4KGX B;  2FZC B;  2X4W A;  1KC8 U;  3I35 A;  3SB2 A;  3O8V A;  1YIJ T;  2A36 A;  1TOV A;  2QK0 A;  1M2O A;  2FG0 A;  1TWB A;  4M78 D;  1U1T A;  2D8J A;  3FLG A;  1YHQ A;  4XU2 A;  4M78 B;  2AK5 A;  3CC4 A;  1QCO A;  4JJD A;  5CKF A;  2E65 A;  4OB3 B;  1RAA B;  2OTJ T;  1NYF A;  2XK0 A;  2CH4 A;  2DIL A;  1SRM A;  5A0L A;  2FYK A;  2AIR B;  3CCL Q;  3VV0 A;  1IB8 A;  2XHC A;  8AT1 B;  1K73 R;  3EAE A;  3HRS A;  3PIO A;  1VQ9 T;  4HCC A;  3FEO A;  3S3O A;  4FSX A;  2M1H A;  2A28 A;  4C92 C;  1B3Q A;  3G7Z A;  2NUZ A;  4J9C A;  2IVW A;  4PNO A;  4PJO B;  3G6E A;  1WJR A;  1K1Z A;  5LJ3 g;  1GXI E;  2OTJ A;  2LC4 A;  4M75 A;  3I56 T;  3CCJ Q;  3G1J A;  1YI2 T;  2CH4 W;  2OTL T;  1YJ9 A;  1HK9 A;  2JTE A;  4OMP A;  3I56 A;  2VGN A;  1OEB A;  4JJB A;  1VQ6 T;  1H92 A;  4J5Y A;  1MMN A;  2F2X A;  3TVT A;  2QGG A;  5FRN A;  4JDS A;  2GTO A;  4M7A C;  1UTI A;  1RAC B;  1VQN Q;  4X1V A;  3OW2 S;  3PT9 A;  1QMC A;  4LDV A;  2HBW A;  1E6G A;  4EMK B;  2E3I A;  4N4G A;  1AVZ C;  2NUP B;  5LJ3 d;  3NTI A;  4OB1 B;  2AZS A;  3L2R A;  2ZPE B;  1PG5 B;  1Q82 C;  4FM4 B;  1I5L A;  1XJW B;  1Q86 U;  2WAC A;  1R8O B;  3GIB A;  4C0F A;  2ABL A;  1PC0 A;  2QGF B;  4FT4 A;  4J6X A;  1N8R U;  2HKQ B;  1M8V A;  3WVE B;  2NLU A;  1MGQ A;  3M0Q A;  4XTY A;  2OAW A;  3CME A;  4QVD A;  5GMK i;  2BE9 B;  3H41 A;  3OYL A;  1QKX A;  1M90 U;  4N0A A;  2LQW A;  1YHQ T;  1RAI B;  4FYV B;  1QP3 A;  1KQ1 A;  3EFO A;  3OYD A;  2JZ2 A;  3OYC A;  4KUL A;  4M77 D;  4RCC A;  4RCB A;  3OW2 P;  1P92 A;  1BCM A;  3JCM V;  2HCK A;  2KVQ G;  1VYV A;  4Q5W A;  1VQM A;  4AG1 C;  4LE9 A;  2CSI A;  1YWO A;  5LJ5 g;  2DL3 A;  5M9O A;  4Y91 A;  1NJI C;  1VQM Q;  2X4X A;  1QW1 A;  5GAN 4;  1W2B A;  2M9U A;  3BFM A;  3JB9 G;  3GBQ A;  3QJ6 A;  4ME7 A;  4PLI A;  1K76 A;  2L8D A;  1N6A A;  3QYG B;  3QZ5 B;  5C0M A;  2RH2 A;  1TSF A;  2CZ1 B;  4R0K A;  2QA4 Q;  4XTX A;  3REA B;  2JS0 A;  1M1F A;  2BUD A;  3FC3 A;  1Z9Q A;  3LWI A;  2LX7 A;  1FXX A;  2K7A A;  4XQ3 A;  2D8H A;  2JNG A;  1UJY A;  3JB9 D;  1D1C A;  3I55 T;  1O75 A;  4FYW B;  4JLI A;  3WVD B;  2XDB A;  1A0N B;  2Y4Y A;  2AHJ B;  1LCK A;  2Y4X A;  4MZT A;  4C0G A;  1K9M C;  2ZPB B;  4PJO G;  2E3H A;  2O01 E;  2HSP A;  1JXM A;  3NTH A;  4JUV A;  2XD0 A;  1K8A R;  3M56 A;  4OMQ A;  1HD3 A;  4C0Z A;  4LUD A;  5DY9 A;  3MEU A;  3EGD B;  2RQV A;  2K57 A;  4XU0 A;  2JUF A;  2VYT A;  3E9F A;  1BYM A;  4M7D B;  4DA4 A;  1SF9 A;  1I1J A;  3IQL A;  2DTI A;  3A1P A;  2J6K A;  1X6B A;  3V7R A;  3H8Z A;  4PJN A;  2LQK A;  3JCM c;  1IHV A;  3UDC A;  2DE0 X;  2RHU A;  2D0Q B;  4M78 F;  1D0X A;  4HVW A;  3OYA A;  3X20 B;  5KH6 A;  2MI6 A;  3EFR A;  1WHH A;  2RB6 A;  4LDU A;  3OYH A;  1YJ9 Q;  1T0J A;  4M7D A;  2YRV A;  4HA8 A;  4MML A;  4DOV A;  1U3O A;  4AFZ C;  1WNL A;  2KT8 A;  3EGD A;  4GLK A;  1KHI A;  2X3X D;  4OGC A;  2EKH A;  4Z8A A;  4M7A F;  2OJ2 A;  1RAB B;  3HL8 A;  1FMW A;  2JMA A;  1M3B A;  3JCM f;  2B86 A;  2E41 A;  2GBQ A;  4M78 C;  1YI2 Q;  1W4S A;  1IGU A;  2DL7 A;  2CP6 A;  2EYQ A;  3OYI A;  2DTO A;  1I8F A;  5KYY A;  3PVQ A;  1PSF A;  1ABQ A;  2CUB A;  2VWF A;  5CAI A;  1C6V X;  3RMS A;  1M9S A;  1RI0 A;  4A4G A;  1VIE A;  2BZ8 A;  5HCK A;  3FJ5 A;  3CMA A;  3JCM e;  4PJM A;  2J05 A;  1M3C A;  4C0D C;  4OP0 A;  1RAG B;  4AFS C;  5IAY A;  4BD3 A;  4J9E A;  2JVV A;  5KCO A;  4KH1 B;  5GAM j;  2E10 A;  2XU8 A;  3JCM d;  3NMZ C;  3QHS A;  1YNZ A;  4PJO E;  1ZA1 B;  1WQW A;  1FYN A;  4TVR A;  3CQT A;  2EW3 A;  2M02 A;  5FU6 C;  3MO8 A;  2DYB A;  1ZBJ A;  3AT1 B;  4KRT A;  1MHN A;  4E7J A;  3M9Q A;  4M77 G;  2RMO A;  4MZP A;  2LJ3 A;  1GCQ A;  1Z9Z A;  1Q81 U;  1M8M A;  3PFS A;  1NPP A;  4VUB A;  4C8Q E;  2RQW A;  3CCE A;  1D1B A;  2O88 A;  3V8J A;  3VS0 A;  2CZ7 B;  3URG A;  5C6S A;  4XU3 A;  3SD4 A;  2ECZ A;  3G71 T;  3HP9 A;  2YRD A;  1YJ9 T;  3CPW P;  4PK4 A;  2K3B A; 
#chains in the Genus database with same CATH homology
 4C92 E;  5LJ5 h;  4Z02 A;  2KAF A;  4E7L A;  5CQX A;  2FB7 A;  2K3X A;  5GAN 5;  2L3R A;  5LL6 S;  3OS2 A;  2P0Q A;  4J83 A;  2OTL A;  1VIF A;  4EMK A;  3GP8 A;  4OVA A;  3OYJ A;  1N8R C;  1KQS A;  2HAX A;  4O6J A;  3OSV A;  1YJW A;  2C06 A;  4XTZ A;  2CZ6 B;  4B9X A;  5KE2 A;  5CR2 A;  1VQP A;  2KMT A;  1VQ7 A;  3M4Y A;  4LDW A;  5CIU A;  5DLO A;  2R5A A;  3SDZ A;  3SWN A;  2DAQ A;  2DD4 A;  3E9G A;  3G6E T;  2DXC A;  2KDS A;  4UC4 A;  3S6W A;  2RA2 A;  3GPL A;  3HFN A;  1BI3 A;  2DZ9 A;  1Y7X A;  1JBM A;  3VU3 C;  3J81 E;  1G3Y A;  2MF2 A;  3M4G A;  4PJO D;  1OYX A;  4C92 A;  2QQA A;  1UGS B;  4QVZ A;  3RKW A;  5GMK e;  1DJ7 B;  1WGS A;  2YLB A;  5AYF A;  4C5E A;  4ZGJ B;  3CBO A;  4JRI A;  3A8H B;  3VUZ A;  2KK4 A;  3R6O A;  5GAN 7;  2RHI A;  2VXE A;  1N9R A;  2LCC A;  1I81 A;  2FHD A;  5CKE A;  2LTO A;  3OSS C;  3FRN A;  4HKE A;  4C8Q A;  3CCU A;  4BY6 C;  5LJ3 j;  3M57 A;  2LCL A;  2K5L A;  4HT9 A;  5HK3 A;  3KUF A;  1QVF S;  3L2Q A;  4M75 B;  2WSF E;  2F5K A;  3DB3 A;  5GAN j;  2K5I A;  4E7I A;  3CPW S;  3CCR A;  1NJI U;  1K8A U;  3LYI A;  1QP2 A;  2PU9 B;  2QI2 A;  1VQ4 T;  1QVG A;  5J26 A;  4M75 D;  4J6W A;  2DZC A;  4M77 E;  5LJ3 f;  2I2L A;  3X25 B;  3L1A A;  2LDM A;  4OF1 A;  3M5A A;  3N5B B;  2O4X B;  1WPY A;  2XKO C;  1M5Q 1;  4EMH A;  5LJ5 d;  3QSU A;  4M7A A;  3PMI A;  2X4W A;  3JB9 I;  1XOV A;  3CCL T;  1BIA A;  3OQ5 A;  4GY5 A;  1KC8 U;  2F69 A;  2KQW A;  3F70 A;  4XTW A;  3L2V A;  3SB2 A;  3O8V A;  4MDW A;  3C4S A;  2XI9 A;  2DK3 A;  2JN0 A;  1YIJ T;  3S3N A;  3DLL A;  3PGG A;  3PTA A;  5GAN h;  4FL6 A;  4KT0 E;  2RD1 A;  4J7F A;  1M1K C;  1LNX A;  5GAN 6;  4M78 D;  2EIF A;  3CCJ T;  2ZGW A;  1XTD A;  1U1T A;  2MAM A;  1VQN A;  5GAM d;  3QJY A;  3FLG A;  2DIQ A;  1YHQ A;  3TRE A;  2LNV A;  1KC8 C;  4XU2 A;  1QVG S;  2E64 A;  2V8K A;  4M78 B;  4C8Q F;  3CC4 A;  1G3S A;  2VXF A;  3RES A;  5CKF A;  1KQ2 A;  1H3Z A;  2KY9 A;  2E65 A;  4OB3 B;  4IKF A;  4LD9 K;  3BY7 A;  1G5V A;  1UEB A;  3GLX A;  5GAO l;  1KD1 U;  2EAY A;  3FB9 A;  2QEX T;  2OTJ T;  2MMP A;  3OYF A;  2XK0 A;  5GAM f;  4FIB A;  1XQH A;  5A0L A;  1U8R A;  2LVM A;  1WJS A;  2QQS A;  3RER A;  2GFA A;  1IRE B;  2FYK A;  2HQX A;  3VV0 A;  1VQ5 A;  2VGM A;  2XHC A;  2GCX A;  1QVP A;  4M78 A;  4R56 A;  1W2B S;  3EAE A;  3HRS A;  3LWH A;  3HRU A;  3PIO A;  3A8L B;  3LGL A;  1VQ9 T;  4HCC A;  2A3L A;  1LOJ A;  3CBM A;  3JCM X;  1O9S A;  1OI1 A;  3FEO A;  3S3O A;  2CYZ B;  2M1H A;  4FSX A;  3V8L A;  5HK0 A;  4C92 C;  2ZPH B;  3G7Z A;  2RI3 A;  3E1S A;  2OAU A;  2IVW A;  3CCU T;  1BI2 A;  3BDL A;  3NFC A;  5GAN e;  2XG8 D;  3INZ A;  4LD6 A;  3JAM E;  4PNO A;  3PNW C;  4ELZ C;  4M7D C;  2P0K A;  1YJN A;  1UGR B;  1W2B A;  4PJO B;  2JTM A;  3RIR A;  3G6E A;  1WJR A;  2X4Y A;  3A8M B;  3MEV A;  4M7A B;  5KCH A;  4JJN K;  1Y07 A;  4M77 B;  5J3B A;  2RHZ A;  1Q81 C;  3ZEH A;  2CGH A;  5CO7 A;  5CKH A;  4IUU A;  3MEA A;  1IZ6 A;  3FIF A;  1FWZ A;  4CRI A;  5LJ5 e;  5LJ3 g;  2Y90 A;  2QA4 T;  2E70 A;  2GQV A;  1GXI E;  3OA6 A;  2OTJ A;  3M55 A;  5FU7 C;  2LC4 A;  3J7A F;  1M1G A;  1NE8 A;  3A8O B;  2E6N A;  4M75 A;  4PL6 A;  4QQD A;  2QDY B;  5FRO A;  3PIP A;  2DXT A;  3SWN C;  3I56 T;  1VQ8 A;  4C8Q B;  2DXB A;  3QYH B;  1YIJ A;  4M7A G;  1YIT T;  1YI2 T;  2OTL T;  1YJ9 A;  3M59 A;  5GAN f;  2EQM A;  3OBY A;  1Y96 A;  3CCL A;  2L5Q A;  2G3R A;  1HK9 A;  4IUT A;  4N0A C;  1VQL T;  3I56 A;  2EQK A;  2VGN A;  3DKM A;  1VQN T;  2A7Y A;  4M7D E;  2M16 A;  4C92 B;  4P5N A;  2R57 A;  4QVC A;  4E7H A;  1VQ6 T;  4J5Y A;  4BDZ A;  1WQ7 A;  3QKJ A;  3VYG A;  4LDX A;  5CK9 A;  3OS1 A;  2HD0 A;  4X9C A;  2HQE A;  3V7C A;  4C5H A;  5FRN A;  4A4H A;  3V8K A;  5GAO m;  4JDS A;  2JTF A;  5LJ3 h;  4F7U G;  3QPH A;  4YTL A;  5GAM h;  3CCV T;  4M75 F;  4M7A C;  2EJG A;  3T9N A;  3CXC S;  4BI8 B;  3JCM J;  3OW2 S;  3PT9 A;  4EMK B;  4LDV A;  4EMG A;  5GMK j;  3HPW A;  1VQO A;  5GAM e;  5GAN d;  4N4G A;  5I2S A;  1VQ8 T;  3OBW A;  1UGQ B;  2DXU A;  5LJ3 d;  4EDU A;  3NTI A;  4JS4 A;  5FU7 B;  4BB7 A;  3SFM A;  2DPP B;  1QVF A;  3HRT A;  4OB1 B;  5GAN 2;  3L2R A;  2ZPE B;  4XU1 A;  4RKU E;  4A4E A;  3TEE A;  2M0O A;  4C8Q C;  1K73 C;  3ZBD A;  3OYK A;  1Q82 C;  1WJQ A;  2CZ0 B;  2LT1 A;  4FM4 B;  1I5L A;  1K9M U;  4C5G A;  4LDY A;  1Q86 U;  2WAC A;  1R8O B;  4CI0 C;  3GIB A;  4PJO F;  1BI0 A;  3ASK A;  4C0F A;  2BKD N;  1G3W A;  4HCZ A;  1VQL A;  1ZQ1 A;  1SSF A;  3FJP A;  4FT4 A;  4J6X A;  5CVI A;  4C0D B;  1VQO T;  1N8R U;  1M8V A;  1D3B A;  2RJC A;  2LX9 A;  3WVE B;  2NLU A;  1MGQ A;  2DD5 A;  3OMG A;  1K8A C;  3RUX A;  1VQK A;  1NZ9 A;  4XTY A;  3UT1 A;  1PSE A;  2WSC E;  4F7U A;  3JRZ A;  4D6W A;  3CME A;  4KUD K;  4QVD A;  5GMK i;  3DLM A;  1UB4 A;  2GFU A;  4ZN3 A;  3OYL A;  3CCS T;  1M90 U;  5LJ5 f;  4M78 E;  4N0A A;  3MET A;  2EJ9 A;  4QQ6 A;  4X34 A;  2QA4 A;  1YHQ T;  3UPU A;  4PKC C;  4BI4 A;  4BE0 A;  4F7U E;  1QP3 A;  1KQ1 A;  4BI3 A;  1KHC A;  3OYD A;  2JZ2 A;  5GMK l;  3OYC A;  1Q7Y C;  3OYB A;  1VQ5 T;  2QQR A;  2ZPG B;  4KUL A;  4M77 D;  4RCB A;  3QBY A;  4RCC A;  4WF2 A;  4BY6 B;  5GMK h;  3BW1 A;  1P92 A;  3JCM V;  1VQM T;  1N27 A;  3CC7 T;  2RJE A;  1D3B B;  2KVQ G;  4M75 C;  2DKG A;  3V7S A;  4DOW A;  1VUB A;  2BIV A;  4N4I A;  1XNI A;  5I2M A;  3OYY A;  3QDR B;  4A54 A;  3JCM P;  5A0D A;  4MDX A;  5FU6 B;  4Q5W A;  1VQM A;  5HY6 A;  1G3T A;  4XTU A;  3CCQ T;  4XTV A;  4JRP A;  3CD6 A;  3P8D A;  5LJ5 g;  2ZZD A;  3HSB A;  1YI2 A;  5M9O A;  4Y91 A;  1NJI C;  3GNF B;  4M7A E;  2X4X A;  1QW1 A;  2R5M A;  5GAN 4;  3OW2 A;  1B34 B;  2M9U A;  3BFM A;  3C94 A;  4B9W A;  3QJ6 A;  3JB9 G;  2EFI A;  3CC7 A;  4HT8 A;  5A2Q E;  3CCS A;  5FRM A;  4ZN1 A;  4BDY A;  4C92 F;  1VQ6 A;  5GAO r;  4DQ2 A;  4ME7 A;  4PLI A;  1JB0 E;  2L8D A;  1VQP T;  1N6A A;  3I55 A;  1EIF A;  3QYG B;  3QZ5 B;  5D6Y A;  5C0M A;  4IUV A;  2RH2 A;  3A5Z B;  2K3Y A;  3AHU A;  2CZ1 B;  4FT2 A;  3BDU A;  4ZTJ A;  1BI1 A;  2DIG A;  4M77 F;  4E47 A;  2WSE E;  4XTX A;  1ZBX A;  2EQU A;  2V8J A;  2RI5 A;  1AHJ B;  3JCM W;  1M1F A;  1M4Z A;  2BUD A;  3FC3 A;  2KSS A;  1OZ2 A;  5GAO q;  3LWI A;  2FL7 A;  1M90 C;  5DLQ E;  1FXX A;  3VYH B;  2XIC A;  4XQ3 A;  3GOX A;  3LLR A;  2JNG A;  1S72 A;  3JB9 D;  3OY9 A;  3G4S T;  3JCM Q;  4M78 G;  4M75 E;  3I55 T;  1O75 A;  5HKC A;  3OS0 A;  4JLI A;  3RKX A;  3WVD B;  3X28 B;  2XDB A;  3HHT B;  2Y4Y A;  2AHJ B;  4BUG A;  4JS5 A;  5KE3 A;  3LX7 A;  3QXE B;  2Y4X A;  4MZT A;  1Q86 C;  1Y96 B;  2X35 A;  4C0G A;  5FLX E;  1YJN T;  2ZPB B;  1K9M C;  4PJO G;  4J8O A;  3MHX A;  5LJ3 e;  4O5V A;  3FDR A;  4C92 D;  2O01 E;  4X9D A;  2H3J A;  4FU6 A;  4IUQ A;  5D6W A;  3UWN A;  2XD0 A;  3NTH A;  4JUV A;  4QQG A;  2D6F A;  2ZPI B;  3M56 A;  2JOY A;  2P0P A;  4IUP A;  1JJ2 A;  3QZ9 B;  2RI2 A;  2K5F A;  1H64 1;  2QEX A;  5D6X A;  4C0Z A;  5DY9 A;  3MEU A;  2PUO B;  2DO3 A;  2K57 A;  4XU0 A;  5GAM g;  4II1 A;  2JUF A;  1U1S A;  2VYT A;  2RJF A;  3E9F A;  2XID A;  1BYM A;  3VUB A;  3VJP A;  4M77 A;  4DA4 A;  4M7D B;  1YBY A;  3OMC A;  4M75 G;  4PJO C;  4PJO A;  2DTI A;  3OS5 A;  4IUR A;  3GNG A;  2IG0 A;  3OYM A;  4JRQ A;  3V7R A;  3H8Z A;  1K73 U;  3CME T;  2LQK A;  4C92 G;  2PQW A;  3ME9 A;  3CEY A;  3JCM c;  3UDC A;  3LH0 A;  1V29 B;  2RHU A;  3GF5 A;  2D0Q B;  2LT4 A;  4M78 F;  5EG2 A;  2E12 A;  3OYA A;  2E5Q A;  3JSC A;  3MEW A;  2MI6 A;  3X20 B;  5KH6 A;  4V2S A;  2CKK A;  2RM4 A;  1JJ2 S;  3EFR A;  4F7U F;  2RB6 A;  1OZ3 A;  4OGE A;  3A8G B;  3CPW A;  4LDU A;  3OB9 A;  3OYH A;  5IT9 E;  5A0G A;  4ZGD B;  2YRV A;  3DB4 A;  4HA8 A;  2QXF A;  4MML A;  4DOV A;  3L42 A;  4M7D A;  4OB2 B;  4C8Q G;  4HCB A;  2EKO A;  1YCY A;  1WNL A;  2X4J A;  5GAN 3;  2K4Y A;  5CQY A;  3C95 A;  2VUB A;  4GLK A;  4BAC A;  1KHI A;  4NL2 A;  4XK8 E;  3X26 B;  4M7A D;  4OGC A;  2E6Z A;  2RJD A;  4M7A F;  1X75 C;  4A4K A;  4J7I A;  2YLC A;  3HL8 A;  3QO3 A;  5CCA A;  3CC2 A;  3L2W A;  2E41 A;  4Y28 E;  3JCM f;  4M78 C;  4C5I A;  1W4S A;  1VQ4 A;  3OYN A;  2DJZ A;  2EYQ A;  3QG1 A;  4EMK C;  3OYI A;  3CCV A;  2DTO A;  2R58 A;  4MZM A;  1I8F A;  2EJF A;  5GAO p;  4L5G A;  3JCM h;  4XAX B;  4M7D F;  3M53 A;  1S72 T;  5GMK m;  4C8Q D;  1PSF A;  1X6O A;  4MMK A;  1HXD A;  5CAI A;  1VQ9 A;  2F5T X;  3QUI A;  2QTX A;  3EFS A;  3Q1J A;  3RMS A;  2MWP A;  3ER0 A;  3LW5 E;  5I21 A;  2D9T A;  1RI0 A;  1M9S A;  1ZHI A;  2VC8 A;  4RMO A;  4A4G A;  3VKI A;  4N4H A;  3CCM T;  4JLG A;  1VIE A;  4ELY C;  3RMQ A;  1YJW T;  2FVU A;  3CCQ A;  2O4X A;  3CMA A;  1Q7Y U;  2XDP A;  1N9S A;  3E19 A;  3JCM b;  2MWO A;  3JCM e;  4NS5 A;  3CPF A;  3CXC A;  2EQJ A;  2RK1 A;  2PVD B;  3QII A;  3OYG A;  4C0D C;  2K2V A;  3MCA B;  3RKY A;  1JRI A;  4OP0 A;  5CKB A;  1KG1 A;  3CC4 T;  4J6Y A;  2ZPF B;  1UGP B;  5IAY A;  2QQ9 A;  3ZFJ A;  1VQ7 T;  3JCM g;  4BD3 A;  5CKD A;  2JVV A;  5KCO A;  5GAM j;  1B34 A;  2E10 A;  2XU8 A;  4EPC A;  4BE2 A;  3JCM d;  4OB0 B;  1TH7 A;  3KBG A;  4ZTF A;  4M77 C;  3H6Z A;  1Y71 A;  3CMA T;  3CC2 T;  2DVE A;  4E7K A;  4PLL A;  4M7D D;  3HKS A;  5LJ5 j;  2L89 A;  3QHS A;  1M1K U;  4A53 A;  1VQK T;  2XDD A;  2B8A A;  3NTK A;  4JRK A;  3CCM A;  3CCE T;  3JB9 F;  3CBP A;  4PJO E;  2PUK B;  2LRQ A;  2YHT A;  1WQW A;  1NPR A;  4TVR A;  2HBP A;  4A4F A;  5GAN g;  2LQ8 A;  3G4S A;  5GAN 8;  1BIB A;  2E1H A;  2RO0 A;  2V8I A;  3L2Z A;  4NL3 A;  4KUI A;  3CCR T;  5J39 A;  3G71 A;  3HFO A;  4QW2 A;  3SWN B;  3OYE A;  5FU6 C;  2EWN A;  3MO8 A;  3PMT A;  4OMF B;  1MHN A;  4E7J A;  3J80 E;  1X01 A;  3M9Q A;  3MP8 A;  3MP6 A;  4ATO A;  4M77 G;  1FX7 A;  4MZP A;  3M58 A;  1Q81 U;  2PVO B;  1KD1 C;  3PFS A;  4F7U B;  2GF7 A;  1KQS S;  4RG8 A;  4M7D G;  1NPP A;  2DEQ A;  4VUB A;  3TCJ A;  1BKB A;  1LJO A;  2PVG B;  4C8Q E;  4R55 A;  5IN1 A;  4RG2 A;  4L59 A;  5DM7 R;  2CS7 A;  3P8H A;  3JB9 J;  2DTH A;  3TU4 K;  3CCE A;  2RHX A;  3X24 B;  1I4K 1;  2ZCF B;  3P8B B;  5L8R E;  3V8J A;  3L2U A;  3LGF A;  2RHY A;  4ZGE B;  2CZ7 B;  4NOY A;  3URG A;  5C6S A;  4XU3 A;  4BE1 A;  3CD6 T;  3JB9 H;  3SD4 A;  1RL2 A;  2P4T A;  4L6V 5;  3G71 T;  3HP9 A;  5GAO n;  2HNI A;  2RK2 A;  1Q82 U;  3CCJ A;  3WXM B;  3M54 A;  3S3M A;  1YJ9 T;  2QQB A;  1YIT A;  3KXT A;  3MP1 A;  2VV5 A;  3C12 A;  4KBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...