1OZ2A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
324
structure length
324
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 83
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A03
3F70A 4E7LA 3MP8A 3S3OA 2B8AA 2X4YA 3L2RA 5FRNA 4C5EA 5KE3A 3KUFA 1WJRA 2X4WA 3SD4A 1XNIA 3OYAA 3OYLA 3CEYA 3OYCA 4FU6A 3OQ5A 5KH6A 2RHXA 3LH0A 4ZTFA 2EKOA 4IUUA 5KCHA 5D6WA 2QQRA 3S3MA 3P8DA 2RO0A 2O4XB 4EDUA 3QJ6A 2M16A 3MP6A 5C0MA 5J26A 4QW2A 4Z02A 4FL6A 2E5QA 2K3YA 2RJCA 2RI2A 3C4SA 3OS0A 2L89A 3E9GA 3OYMA 3MEWA 1SSFA 2LRQA 3OS1A 4CRIA 2EFIA 2RHIA 3NTKA 3NTIA 3OYEA 4C5IA 1OI1A 5M9OA 5KE2A 4E7KA 5CIUA 5D6XA 4B9XA 2NLUA 4BE2A 3ME9A 4C5HA 2M0OA 2GF7A 2X35A 3QBYA 3LGLA 2DAQA 2RHUA 2XDPA 2L8DA 2QQSA 3DB3A 2GFUA 4IUTA 3LX7A 4IUVA 3ASKA 4N4HA 3P8HA 2LCCA 3M9QA 4QVZA 4IKFA 2RI5A 4BE0A 2MWPA 3MEVA 5J39A 3PMTA 4GY5A 2LTOA 2X4XA 3OMCA 2JZ2A 3FEOA 3BDLA 4C5GA 3OYIA 3MEAA 4A4FA 4BACA 4ZTJA 1WJSA 3QIIA 4NS5A 3QKJA 3UT1A 2LDMA 4N4GA 5KCOA 4IURA 5C6SA 2EQUA 1WGSA 3MEUA 3Q1JA 3PMIA 4A4GA 2M1HA 3ZEHA 3LGFA 3L2QA 4X34A 4BD3A 3OY9A 3OYFA 2BKDN 1N27A 4RG2A 4QQDA 2D9TA 5D6YA 4B9WA 3MP1A 2G3RA 2RJEA 1H3ZA 3S6WA 3OYDA 4Q5WA 4E7HA 2EQMA 2EQJA 2RJDA 4HCZA 2RI3A 4A4EA 4UC4A 5FROA 4QQGA 2R57A 4L59A 3FDRA 3FLGA 2WACA 3H6ZA 3PNWC 4N4IA 3EAEA 3OYKA 2JTFA 4II1A 2LVMA 5FRMA 1OZ2A 2DIQA 3META 3OMGA 5IAYA 3OA6A 2EQKA 1OYXA 2XK0A 3LLRA 3O8VA 3OYBA 2RHZA 2BIVA 2K3XA 3PFSA 2MWOA 3LYIA 3OYGA 1KHCA 3L2WA 3H8ZA 4PLIA 4QQ6A 4PL6A 3GOXA 2R58A 4E7JA 3UWNA 2P0KA 2VYTA 2HQEA 4LD6A 4A4HA 4BDYA 2FHDA 2R5AA 2PQWA 1OZ3A 1G5VA 2GFAA 2O4XA 1WJQA 2YRVA 3L42A 4IUQA 3MO8A 3DB4A 2L3RA 4BE1A 2IG0A 2R5MA 2CKKA 2RJFA 2F5KA 3DLMA 3OYNA 4PLLA 4BDZA 3S3NA 3OS2A 3OYHA 5IN1A 2RHYA 2HQXA 3E9FA 1MHNA 3NTHA 2BUDA 2DIGA 3OB9A 4OVAA 3L2VA 3FC3A 3OYJA 4IUPA 4E7IA 1RI0A 3L2UA 2E6NA
chains in the Genus database with same CATH superfamily
2FPEA 1H92A 1NBEB 2LQKA 3EH2A 5J3BA 4M7AD 2CP3A 4WTOB 4M7DA 3H0IA 3P8DA 3QJ6A 4OB0B 1RAFB 5A0GA 2YUPA 4GBQA 4M78C 2RQWA 3MEWA 2LRQA 3GNGA 2FRYA 2DILA 3LGLA 2GFUA 2L3QA 1YHQA 4FIBA 1UUEA 2YLCA 4DBFA 2V1QA 1M3CA 4C5GA 5I11A 4NL3A 2KYBA 3IQLA 3CBOA 3KFVA 5FU7B 4C92D 4D8DA 4RKUE 3LGFA 1M4ZA 3OY9A 3O5ZA 2DXBA 2V8IA 2HL3A 1J3TA 4VUBA 4C92F 4FYVB 2OTLA 3VRZA 3NHNA 2CREA 1TWBA 1JXOA 4YTLA 5GMKj 2R57A 3ER0A 4EMKC 2V8JA 4N4IA 4BI4A 5LJ5g 1IHWA 3OMGA 1MMNA 3P8BB 1AEYA 2NYSA 3MKDA 1E7OA 4F7UA 4EMKA 2EPDA 2L3PA 2LQ8A 3PFSA 3OYGA 2EYWA 4M7AE 4EMHA 1K76A 2FB7A 1M1KR 4JZ3A 1NJIR 1S1NA 3VS0A 1PC0A 1ZUUA 2QDYB 1Q7YR 1X75C 3CCUA 3PT9A 2O4XA 3L42A 2F5KA 4J6WA 4J7IA 5IHNA 4ESRA 1GL5A 1VQOQ 3M57A 4XTXA 4BB7A 4JJDA 4E7IA 1R77A 2E6NA 1Y71A 5GAN6 3CPFA 4M7AB 1VQMA 3G4SQ 3MJXA 2QQAA 3LH0A 4JS4A 4C8QG 1IXDA 2DX1A 2COZA 1RAEB 4EDUA 3EGDB 1O75A 5GAMe 3ULRB 4FM4B 3HP9A 5HKCA 2RI2A 3OS0A 3JAME 1HK9A 2CP7A 4CC3A 1JBMA 2DERA 2EFIA 1ZSZA 4CC2A 1D1BA 4OF1A 5LJ5e 3ME9A 3ZL7C 2X35A 2DXCA 4IUVA 2QQSA 1M1KC 1XQHA 4RG8A 4X9DA 1NJIC 4QVZA 2LNVA 1KQ1A 1Q7YC 4BE0A 1BI0A 5CCAA 4DQ2A 2JZ2A 3J7AF 5GAN4 3JB9G 1AWOA 1VQNA 2QEXT 3C95A 2D8HA 1MNEA 3X28B 3V8LA 3CCRQ 2P4TA 5HK0A 2D9TA 2G3RA 2XHCA 3A1PA 2PZ1A 2H8HA 1HXDA 1FWZA 2DEQA 3AT1B 1NE8A 3ZFJA 4FW2A 4EMGA 1RLQC 2DIQA 4N0AC 2EGAA 2XI9A 1UJYA 1ZX6A 1GBQA 2BTTA 5LL6S 4ANJA 2LC4A 1VQ5Q 2QTXA 1CKBA 4JDSA 1M2VB 2AKKA 1G5VA 1X43A 1WHHA 2IG0A 2NUZA 4JRIA 5KYWB 2CZ1B 2P4RA 3OB9A 3CMAQ 4RTWA 2YT6A 5LJ5h 4RMOA 3VS6A 4XTVA 2PVGB 2GQVA 1YJNQ 4J9IA 1WXBA 1YITA 2MIOA 4FU6A 5LJ3d 1K73U 3I35A 4KUIA 5KYXB 3EG1A 4MDWA 2RF0A 2A36A 2F1LA 2YUOA 1NEGA 3UDCA 3JB9I 5GAOq 1TOVA 2ATCB 1YJWQ 2VUBA 4E7KA 3REBB 5GAMj 2QA4Q 2M0OA 4XTWA 1X2QA 2P84A 2WSCE 3CCMA 2J6FA 2VC8A 5GAOl 2DZ9A 5GAOm 2VXEA 3M0SA 1PRLC 2HKNA 2DTOA 1U1SA 2VB6A 1QVFP 5KYYB 5GANj 3JCMc 1QVFS 5CAIA 3CCEA 1NZ9A 5IHIA 4X34A 1Y0MA 2ECZA 4V2SA 2Y4YA 1JU5C 4RG2A 4QQDA 2COWA 5KYUB 3V7SA 1H3ZA 3S6WA 3OYDA 1ZA1B 2CZ7B 2V1RA 3QDRB 2QDLA 3FLGA 2HD0A 2JTFA 5FRMA 4F17A 2W0ZA 1FMVA 2HMAA 2EWNA 4M7AC 1PRMC 4ELYC 4MDXA 2CP5A 3VRYA 4J7FA 5FU6B 1I5OB 1RACB 4M7AA 1G3TA 1GCQC 1YJ9T 2EYXA 1AVZC 4JRKA 3GBQA 1U1TA 1BU1A 4A4HA 1R0BG 4M77F 2FHDA 4XTUA 3CCQA 2QASA 3A8OB 2D1XA 3EGDA 2LJ3A 4BE1A 3RNJA 2KSSA 1SPKA 3GLXA 3NTHA 2JS0A 1PCXA 1SKUB 5A0DA 1D1AA 1UG1A 3EGXB 1RI0A 2EBPA 1QVGS 2KQWA 2C0IA 3OYCA 3JCMV 5GAN3 3QSUA 3HSBA 2QQRA 4C92C 4OB1B 5J26A 1VQ6T 1U8RA 1WXUA 2RJCA 4KBMB 4AFZC 1P92A 2L89A 2E10A 2E5KA 3PE0A 3I56T 1T0JA 4F14A 1C1AA 2D0NA 4RTYA 4HCKA 1C6VX 2JUFA 1TXQA 2A3LA 2CYZB 4XQ3A 1S72T 1LPLA 1RLPC 2LX9A 4DA4A 1PKTA 1WGSA 2JM9A 4M78E 3CD6T 1B34B 1KIKA 2ESWA 1M2VA 1VQ8T 1OU8A 3TCJA 2E41A 1TUGB 4R55A 4A4EA 2DA9A 4KGVB 5IHKA 2KRSA 3PNWC 3H6ZA 1K73C 5KYWA 3E1SA 5FWCA 5GANd 1K0SA 1KQSP 1M8VA 3QZ5B 4M75G 4PJOD 1KQSS 1KD1U 2K5FA 4FT4A 3M5AA 3G4SA 1X69A 4M78B 1R8OB 3A8LB 1QP2A 1U06A 2J6OA 2MYSA 4OMFB 1QCNA 4PJOF 3PVQA 2XICA 3MO8A 5KYXA 1PM3A 1YNZA 4PLLA 4LDUA 5GAN2 1ZBJA 3HRUA 2EQIA 1N9SA 1UE9A 2DBMA 3E9FA 2X51A 4KRTA 2OTJT 5I2MA 3OYJA 2JN0A 3MP8A 4LDVA 4FSXA 3EGUA 4M7DG 2Y90A 5GAN5 2EKOA 1WQWA 2PNIA 1X27A 2O9VA 1OU9A 4OMNA 5KYYA 2K3YA 3I55A 2RPNA 3TSWA 5IXBA 2GNCA 2VGNA 3CCRA 4C0GA 3NTIA 2KVQG 5M9OA 5KYUA 1AZGB 1LOJA 3CPWS 3CXCA 3A98A 1MMGA 2GF7A 1GXIE 2XDPA 2FRWA 3LX7A 2CP0A 2DYBA 1C0MA 4FYXB 1VQKA 2LT4A 3JCMW 4OMMA 1H8KA 3PMTA 4ME7A 3FEOA 2AK5A 2DE0X 3QIIA 4NS5A 3UT1A 2EJ9A 1M3BA 2EQUA 4RUGA 1I4K1 3OYFA 5GAOp 1N27A 1OQKA 2RJEA 2ED1A 2M0YA 2OJ2A 1M9SA 5CKDA 4JS5A 5FLXE 2EAYA 2MOXA 3EG0A 2KGTA 4LN2A 4F16A 4F7UG 2LVMA 2YRDA 5ECAA 3CMET 3EGXA 1YWPA 2SRCA 1KD1R 1YJNA 1V76A 1KHCA 5GMKe 2DTIA 2QEXQ 4M4ZA 1VQ9T 1VQ4A 4QVCA 2JJ9A 3UWNA 3JCMP 2VYTA 1ZHIA 1WZOA 2CP6A 3CCSA 2E64A 1UGVA 2FZGB 3EG9B 3NFCA 1AZEA 1IREB 3JCMQ 2PVOB 3EG3A 1JQQA 2DD5A 1YJWA 4OVAA 5LJ3e 2AKLA 1X01A 4R0KA 4JJNK 2QA4A 4E7LA 2X4YA 2RD1A 2KR3A 2DM1A 2QQ9A 3CEYA 2DEUA 3OQ5A 3EFOB 3HRTA 1X2KA 2JTMA 3PGGA 4C8QD 4A53A 2KDSA 5C0MA 1VIFA 2KXCA 1YI2T 2ZZDA 4LUDA 2DL5A 5GMKl 5GAN7 4C8QF 5GMKm 3RUXA 3WVDB 3GP8A 3J81E 4DBHA 4C0FA 1B34A 2DZCA 2KMTA 2GQIA 1OI1A 2DVJA 1QVFA 1KD1C 2L5QA 2OTLT 2DMOA 2HKQB 4KT0E 2DLPA 2DXTA 2C0TA 3MEVA 1PHTA 4DEYA 2JT4A 2BZ8A 1Q86U 2QAZA 1WJSA 1Y07A 4J6XA 3E2UA 4BY6B 1FXXA 1ZQ1A 3UPUA 5KCOA 2QTVA 3H0HA 2M51A 3JB9D 4M78A 2PU9B 4AMCA 2EGCA 2JMCA 4J6YA 3V8JA 3G71T 2YXYA 3CCUT 3JB9F 2RI3A 1WI7A 3M0RA 1GBRA 3VUZA 4Z88A 2COYA 4AFSC 3OYBA 1JJ2S 1TS9A 2JNGA 2HCKA 3N5BB 4ATOA 2R58A 5GAMg 3A5ZB 1YIJQ 2O9SA 2YRVA 2CT4A 2E70A 2DKGA 1D1CA 3G6ET 4K11A 3INZA 1KFZA 2K9GA 1TG0A 2RM4A 2QXFA 4OGEA 2LJ1A 1VA7A 3OYYA 5GANg 1PG5B 4J9CA 1TUDA 3FJ5A 5A2QE 2WSEE 3MPUB 3C12A 4FCYA 1XJWB 1XNIA 2DO3A 1KHIA 1YJ9Q 1SHGA 2P0QA 5LJ3j 2X9HA 4OP0A 3H9NA 3VS7A 1BBZA 1UHFA 1ABOA 1VUBA 2EW3A 1BYMA 2DXUA 2DAQA 2RHUA 1VQ7T 3P8HA 2LX7A 2KY9A 4TVRA 1FMKA 1AWJA 2XU8A 3JCMb 2DL4A 4GY5A 1W2BS 4PJOC 4C92E 5CO7A 2AHJB 1LJOA 3MHXA 3SHWA 3NGPA 3PIOA 1YCSB 1VQ6Q 2V8KA 3CBMA 4L5GA 1M27C 3BW1A 4PK4A 1VQPT 4B9WA 1KQSA 2LJ0A 2ROTA 3I56Q 3JCMJ 5I2SA 2EQJA 2LCSA 5GANe 2VV5A 3EG9A 1BIBA 4QQGA 5CQXA 1Z9ZA 2RQTA 1G3YA 1KSWA 2DETA 2EQKA 3HHTB 1OEBA 2JXBA 1UGRB 2JS2A 4C92B 3GPLA 1TSFA 1S72Q 4M7AG 1DJ7B 3CC2T 1O9SA 2DYIA 1QCOA 2BZXA 3EFOA 3CD6Q 4P5NA 2HAXA 1VQ8Q 2GFAA 2LNHB 2XDBA 3DB4A 2RJFA 2QK0A 1UGSB 3A8HB 3I5RA 1E6GA 4RCCA 3QPHA 3L2VA 3LH5A 2PTKA 3TQ7P 4B6MA 2XDDA 2GBQA 1WHLA 3S3OA 3L2RA 2JW4A 4N0AA 3RKWA 2DL3A 5KH6A 1WDXA 4DBRA 3PIPA 2RA2A 3CC7A 3CCMT 4RTZA 4LXCA 3X24B 4BY6C 1T0HA 5GAMh 1G3WA 3SB2A 3JCMg 2HZYA 3JB9J 4QW2A 3HTRA 1NG2A 1SSFA 2F69A 5FW9A 3OS1A 1M90U 2XG8D 2OTJQ 5KE2A 5CIUA 4C5HA 2PUKB 5GANh 2L8DA 3ASKA 1RAAB 1MV0B 4R56A 3M9QA 3UATA 1NM7A 3UF4A 5J39A 1WNLA 2O2OA 1X6OA 4MZTA 2K2MA 1WHMA 4XU3A 5AYFA 3SWNC 2EVRA 1PD1A 2VVKA 2QEXA 4PJLA 1Y57A 2B86A 5GJWB 5HK3A 4QKUA 2RQUA 2Y4XA 1K9AA 4WCIA 3RMSA 2O31A 3CCQT 4HCZA 2KBTA 2H3EB 2KE9A 2LZ6B 2XKOC 5FWBA 2A0FB 2E65A 1ZA2B 2LQNA 2CH4A 4DOVA 3FB9A 3VUBA 3DKMA 5DLQE 4OMOA 2W10A 2FEIA 5GAMf 1MNDA 1OOTA 4JLGA 3H0FA 4OMQA 4XK8E 3JCMe 4PL6A 3GOXA 4M75D 4C8QC 2PUOB 1UHCA 1BCOA 5LJ5f 5CKFA 2J05A 2KI7A 4E7SA 4M75F 2AZVA 1K9MU 4JJBA 1WLPB 1WHKA 1NPRA 2VASA 2E6ZA 3CMEQ 1NLOC 4C0DC 2ZPHB 4M77D 9ATCB 1AOJA 3SD4A 1SRMA 1SRLA 2JMAA 2M02A 3OYLA 5CQYA 1VQ9Q 2MK5A 4M7DD 4PKCC 3S3MA 1GCQA 1KC8U 1M2OA 1PWTA 1IHVA 4Z02A 1E6HA 4M7DF 3HL8A 3QYGB 1B7TA 4ZGDB 4WF2A 1SF9A 2EYQA 2ZPFB 4CRIA 2CGHA 2J7IA 3OYEA 1QVGP 3EFRA 2K79A 3QBYA 4N4HA 1D09B 4OB3B 1QKWA 2C0OA 1K73R 2RH2A 3SFMA 3GIBA 2LTOA 2X4XA 5IH2A 1RABB 4ZGJB 3NPFA 1W1FA 3EHQA 4ZTJA 4C92A 1YI2Q 2FG0A 3L1AA 3JCMh 3Q1JA 4KULA 2M1HA 3L2QA 2FL7A 3VJPA 1YIJA 4PJMA 1NPPA 1Q95G 2CT3A 4Z8AA 4D8KA 2YRCA 1Y7XA 4ZNXA 2QG9B 1OV3A 4UC4A 4BI3A 2LCLA 5CKBA 3DLLA 2M9UA 4AFUC 1OZ2A 3META 2E3IA 1HYOA 3M4GA 2RMOA 1QMCA 3HPWA 4PJJA 3LWHA 2DBKA 2MWOA 3LYIA 2DL7A 4M77E 3OW2P 3OW2S 1M90C 2EYYA 3TEEA 1OX9A 4F7UF 1GCPA 3RESA 1YJ9A 5DY9A 4E7JA 1RAIB 2RB6A 1XOVA 2DVEA 1UEBA 2FYKA 3G71Q 5AT1B 3OYNA 2QGGA 1VQOA 5IT9E 3I55T 2AIRB 4LDWA 4JRPA 2V26A 1YWOA 3CCRT 1EFNA 4KGZB 2PVDB 4NL2A 3L2UA 3JSCA 3JRZA 4M77B 8ATCB 3VU3C 2HSEB 1AWWA 1A0NB 1YBYA 1T3SA 1VQKT 1BI2A 4MZMA 4J9FA 1KC8R 2MI6A 1X6BA 5LJ5d 1D3BB 2XMFA 1FYNA 4RTTA 3CC4T 3CCLT 4FL6A 2E5QA 3G6EQ 3TU4K 3EH1A 2H3JA 1WHJA 3QDFA 4J9HA 4XTZA 4MMLA 3URGA 3I56A 4PFOA 2D0QB 3RERA 3T9NA 4IKFA 1RL2A 3D7SB 5L8RE 4Y92A 3BDLA 3OYIA 2DJZA 4XAXB 3CCVT 1S72A 3C0CA 4X1VA 1JO8A 4M78G 4A4GA 3CPWP 1VQ4T 3CD6A 1ARKA 2JM8A 2BKDN 4KGXB 4HKEA 2YDLA 4JUVA 4HT9A 1VQ8A 5GAOn 4Q5WA 5CVIA 2EQMA 1MMDA 2RJDA 3CCST 1VYVA 3M53A 4JLIA 5LJ3g 1VQ7Q 3X25B 3BE3A 3EAEA 1JRIA 1KC8C 2XK0A 1VQLT 1SHFA 4PJOE 1N8RU 4HXJA 1VQ5A 3OBWA 2MF2A 1VQPQ 3H41A 1QCFA 4X9CA 3M59A 4OMLA 3CCJT 1OX8A 4BDZA 1M30A 2ENMA 4O5VA 5CKEA 3CBPA 3CMAA 3FC3A 2OTJA 4PJOB 4C5EA 3KUFA 3CC2Q 1VYUA 4C0ZA 3VS1A 3NMZC 1GFCA 1F1BB 1Q82U 5D6WA 1TH7A 3RDVA 2DRMA 2JTEA 2FPDA 4NOYA 4IIOA 4DEXA 4ELZC 3OYMA 1I0CA 3QWYA 1AT1B 2X3XD 2NLUA 2VKNA 1PNJA 3DB3A 1ZUYA 1YHQT 3OS5A 4D6WA 4J9DA 1OPLA 3CCMQ 3VS2A 6AT1B 1FX7A 4M75C 2RN8A 2LDMA 3WXMB 4RTXA 5C6SA 1VIEA 3G1JA 4MZPA 4EPCA 4BD3A 1Q81U 1H3HA 4AG1C 5D7UA 5D6YA 2P0PA 4HT8A 1YN8A 4HVWA 2F5TX 5EG2A 3QG1A 4FT2A 4M77C 1OYXA 5GMKi 3CMEA 2XD0A 3R6OA 1N8RR 5GMKh 1TTHB 4HVVA 4M77A 1ZLMA 2GTOA 4M7DC 3GNFB 5CK9A 1VQ9A 2A08A 2HSPA 2HDAA 1WIEA 2R5AA 2PQWA 4IUQA 4M7AF 3CCQQ 1D3BA 4LUEA 3S3NA 2HEQA 2ZPEB 4AFQC 4ORZA 1JJ2P 3A8GB 5LJ3h 2BUDA 2CSIA 2CP2A 2DNUA 2OAWA 3SWNB 1VQMT 4ZN3A 4FSSA 1Q82R 3REAB 1N9RA 2ZAEA 1QVGA 3GF5A 4PFZA 4FW1A 4C8QE 5I22A 5GAOr 4J9EA 1M5Q1 2XIDA 3EFSA 3X26B 1HD3A 4A4KA 2JVVA 4BI8B 1YI2A 2QYZA 2J06A 3C4SA 4HCBA 2NWMA 1IGUA 1Y96B 1N8RC 4C5IA 4XTYA 4B9XA 2NUTB 1MUZA 4IUTA 3SDZA 2LCCA 3U23A 1B07A 2RI5A 4RCBA 4C8QB 4LDYA 4LDXA 2L2PA 2NUPB 2K6DA 3RKYA 1T3LA 2ED0A 3V7CA 1YCYA 1VQNT 3M58A 3PMIA 1V1CA 1Q81R 5LJ3f 1JXMA 3OW2A 3MP1A 1I81A 2FZKB 2RQRA 3G71A 2OAUA 4E7HA 3QO3A 1VOMA 4C0DB 5DLOA 3TVTA 1Q82C 1W2BP 2WACA 1AD5A 1Q86R 2DL8A 1OULA 1RAHB 3LLRA 3PVLA 1D0YA 2O88A 3J80E 1M3AA 4OB2B 5L23A 4PJOA 5IXFA 3H8ZA 3THKA 1M1GA 1QKXA 2P0KA 3JB9H 4LD6A 3CC7T 4F04B 1UTIA 1M8MA 2GCXA 2SEMA 3VS5A 2L0AA 3G6EA 1ZSZC 4PJNA 3FJPA 1UGQB 1G8XA 4JPBW 1LVKA 4L6V5 4PNOA 4LNPA 4A63B 1AWXA 3F70A 5FRNA 2MCNA 2X4WA 4O6JA 2LQWA 2QI2A 2ROLA 1YITT 1Q81C 2LP5A 4ZTFA 1KG1A 1SEMA 4AG2C 1NYFA 2RK2A 2QQBA 1I8FA 2VXFA 5I21A 4E7ZA 1RADB 4XU1A 2IPOB 3QYHB 3CXCP 1Q86C 5GAN8 3I55Q 3M0UA 3CXCS 2RHIA 3M0TA 4IIMA 2HBPA 3RR6A 4BE2A 4E2FB 2CS7A 3MCAB 1VQ7A 3V8KA 3CPWA 3HKSA 1VQKQ 2FPFA 2K2VA 2MWPA 3RKXA 4EIKA 1ZSGA 4C92G 1UDLA 4GLKA 4A4FA 4BACA 4Y28E 3QKJA 3CC4Q 5KYNA 3CCLQ 4N4GA 4IURA 5CR2A 3CCET 1K8AU 1TUCA 1VQPA 1ACMB 2GTJA 3PTAA 2EJFA 2YLBA 2HL5C 1MMAA 2F2VA 5DM7R 3EHRA 2HBWA 2IVWA 2X3WD 5IAYA 3QUIA 3CCVQ 5EC7A 3CC2A 3SWNA 4FYWB 7AT1B 2K57A 3TSZA 2ABLA 1VQ4Q 2G6FX 1OZ3A 5FU7C 2CZ0B 3QWXX 2E3HA 5HY6A 3CCSQ 5CKHA 1PKSA 3OS2A 5IN1A 2RHYA 2RQVA 1QWEA 1Y96A 1I5LA 1VQLQ 1EX4A 2EYZA 4OGCA 5KE3A 1UECA 1D0ZA 1WJRA 2RNAA 2NUTA 3OYAA 2I0NA 1BKBA 1GFDA 3HRSA 2DTHA 2DF6A 3I5SA 4IUUA 5KCHA 3A8MB 4AT1B 2F2XA 2MPXC 1JB0E 4C8QA 1YP5A 4QT7A 5GANf 2F2WA 5LJ5j 3CCJQ 2NUPA 2KRNA 1D0XA 2ZPGB 1QW1A 4LD9K 1QLYA 1K4US 1YIJT 1HSQA 2LT1A 1WA7A 3AHUA 2D6FA 1SSHA 3C94A 4KH1B 4DOWA 3QHSA 3RMQA 4HVUA 1PD0A 1NYGA 3OMCA 1BI3A 2HQHA 3MEAA 3X20B 1W4SA 1FMWA 1K8AR 1M90R 2A28A 3ZEHA 2DJQA 4M78D 3RIRA 2FZCB 2K5LA 2Z0WA 3BY7A 2KT8A 1UGPB 2YUQA 4M78F 2C06A 1W70A 1VQOT 1YHQQ 1IO6A 3OSSC 3FIFA 3OYKA 4JJCA 4ZGEB 2DRKA 2LMJA 3OA6A 3VYHB 2A37A 2ZPIB 2FO0A 2BIVA 2DPPB 3VYGA 4CI0C 1QQJA 1W6XA 3LWIA 4CC7A 1JJ2A 4M75E 3G4ST 4QQ6A 2X4JA 2RK1A 1N5ZA 2KYMA 3I9QA 1WFWA 2OTLQ 2DK3A 3M4YA 3CQTA 3KBGA 4HCCA 2YHTA 2KNBB 1H641 4J9BA 2MMPA 2CKKA 4OMPA 3QXEB 1BB9A 2DFUA 1WX6A 2HQXA 1HJDA 2DIGA 2HNIA 2VWFA 2EKHA 1I1JA 2EIFA 8AT1B 1PSFA 2JOYA 2KAFA 2B8AA 1K8AC 2E1HA 4DBQA 4M75B 2GGRA 2RHXA 4M7DE 1TU0B 2MAMA 2KT1A 4J5YA 3M54A 1QWFA 1PSEA 1BI1A 2KXDA 2RO0A 1K9MR 3CCUQ 1IZ6A 3MP6A 3QJYA 3WVEB 2KROA 4E6RA 1NLPC 3M56A 3HFOA 1ZBXA 1WPYA 2YUNA 1JEGA 5GAMd 5D6XA 3RBBB 3G7ZA 2DD4A 2E12A 1KJWA 3JCMf 1G3SA 1VQMQ 3UA6A 4M7DB 3L2ZA 1WXTA 3VS4A 3FRNA 2CUDA 1VQ6A 2ZCFB 1W2BA 3UA7A 2D8JA 1CKAA 1UFFA 2K3BA 3OSVA 1VQ5T 1NEBA 3M0QA 4LE9A 4KUDK 2KRMA 1K1ZA 4KH0B 4CC4B 5FROA 4J8OA 1QP3A 1OPKA 3FDRA 1B3QA 4Y91A 1Z9QA 1I07A 4II1A 2EGEA 4QVDA 2A7YA 1K9MC 1BIAA 4F7UE 3CMAT 4M77G 2CUBA 2RHZA 3TREA 2K3XA 5GJVB 2EJGA 1YJNT 1VQNQ 4XU2A 4PLIA 1M1FA 3LW5E 1UB4A 1X6GA 2L3SA 2CZ6B 2IIMA 2KEAA 1RI9A 2HQEA 1ZUKA 1R0CB 4RTUA 1IRXA 4MMKA 3VS3A 4PFPA 2BE7D 2FVUA 2K4YA 1WJQA 1ABQA 4XU0A 2L3RA 5HCKA 3OYHA 1YJWT 1LCKA 4F7UB 4EMKB 3BDUA 4J83A 2QA4T 1CSKA 3ZBDA 2J6KA 2ZPBB 4JZ4A 4GLMA 2OI3A 3CC7Q 4BUGA 2CH4W 2O4XB 5FU6C 2M16A 1KK7A 3M55A 3JV3A 3CC4A 3CCLA 2BE9B 1N6AA 3E9GA 4Z89A 1YFNA 1V29B 1IB8A 2ZGWA 3EG2A 1RAGB 3SEMA 4FYYB 3NTKA 4J9GA 1WYXA 5A0LA 4HA8A 1IGQA 1YITQ 1SG5A 1WHGA 2OX7A 4E47A 2YSQA 3VKIA 1EZZB 2O01E 2AT1B 3E19A 3CCVA 1G83A 3V7RA 4A54A 2E4HA 1LNXA 2AZSA 1KQ2A 3MEUA 3HFNA 1ZSZB 1U5SA 1GRIA 1RUWA 1MV3A 3M0PA 2CDTA 3JCMd 4L59A 3R6NA 1U3OA 1G2BA 1QVPA 2KK4A 3O8VA 3JCMX 1VQLA 4PJOG 2QGFB 1BK2A 3L2WA 3KXTA 2I2LA 4M75A 3CCEQ 2K5IA 1M1KU 1AHJB 1EIFA 2WSFE 1NJIU 4BDYA 1K0XA 2YWWA 1Q7YU 3CCJA 2R5MA 4JRQA 3DLMA 1BCMA 3OBYA 1VYTA 1XTDA 2CSQA 2K7AA 4RTVA 1WQ7A 3QZ9B 3VV0A 1MHNA 1MGQA 2BZYA 1UJ0A 4ZN1A 3BFMA 4IUPA 2VGMA
chains in the Genus database with same CATH topology
3F70A 4C0DC 3MP8A 4LDVA 2ZPHB 4M77D 5FRNA 2X4WA 2LQKA 4O6JA 5J3BA 4FSXA 3SD4A 2QI2A 1YITT 4M7AD 3OYLA 4M7DG 2Y90A 1Q81C 5CQYA 4ZTFA 5GAN5 2EKOA 1KG1A 4M7DA 4M7DD 4PKCC 3S3MA 2RK2A 1WQWA 3P8DA 2QQBA 1I8FA 2VXFA 5I21A 1KC8U 3QJ6A 4OB0B 5A0GA 4Z02A 4XU1A 3QYHB 3HL8A 4M78C 4M7DF 2K3YA 3QYGB 3I55A 4ZGDB 1Q86C 5GAN8 3MEWA 2LRQA 4WF2A 3CXCS 2EYQA 2ZPFB 4CRIA 2VGNA 3GNGA 3CCRA 4C0GA 2CGHA 2RHIA 3NTIA 3OYEA 2KVQG 3EFRA 5M9OA 1LOJA 2HBPA 3CPWS 4BE2A 3CXCA 3QBYA 2GF7A 1GXIE 2CS7A 3LGLA 3MCAB 2XDPA 2GFUA 4N4HA 3LX7A 1VQ7A 3V8KA 3CPWA 1VQKA 4OB3B 1YHQA 4FIBA 3HKSA 2LT4A 3JCMW 2RH2A 2MWPA 2K2VA 2YLCA 3PMTA 4ME7A 3RKXA 3SFMA 3GIBA 2LTOA 2X4XA 4C92G 3FEOA 4C5GA 4NL3A 4GLKA 3CBOA 4A4FA 4ZGJB 4Y28E 3QIIA 4BACA 4ZTJA 4NS5A 3QKJA 3UT1A 5FU7B 2EJ9A 4C92A 4C92D 4N4GA 4IURA 1QVFS 5CR2A 2EQUA 3L1AA 3JCMh 3CCET 3Q1JA 4KULA 1K8AU 2M1HA 4RKUE 2FL7A 3LGFA 3L2QA 1M4ZA 3VJPA 1I4K1 3OY9A 2DXBA 2V8IA 1NPPA 5GAOp 3OYFA 4VUBA 4C92F 1N27A 3PTAA 2EJFA 2YLBA 2RJEA 2OTLA 1Y7XA 1M9SA 5CKDA 4JS5A 4UC4A 5FLXE 2EAYA 5DM7R 4YTLA 4BI3A 5GMKj 2R57A 3ER0A 4EMKC 2LCLA 2V8JA 4N4IA 5CKBA 4BI4A 3DLLA 5LJ5g 2IVWA 4F7UG 2LVMA 2M9UA 1OZ2A 3META 3OMGA 5IAYA 3M4GA 3P8BB 3QUIA 3HPWA 4EMKA 4F7UA 3CMET 3LWHA 2LQ8A 3PFSA 2MWOA 3LYIA 4M77E 3OYGA 1YJNA 3CC2A 1KHCA 5GMKe 3OW2S 2DTIA 3SWNA 1M90C 4M7AE 4EMHA 2FB7A 3TEEA 2K57A 4F7UF 1VQ4A 3RESA 1VQ9T 4QVCA 5DY9A 4E7JA 1YJ9A 3UWNA 3JCMP 2RB6A 2VYTA 1XOVA 1ZHIA 2DVEA 2QDYB 1UEBA 1X75C 1OZ3A 2FYKA 5FU7C 3CCUA 2CZ0B 2O4XA 3PT9A 5HY6A 3CCSA 3L42A 2E64A 2F5KA 3NFCA 3OYNA 4J6WA 5CKHA 1VQOA 5IT9E 3OS2A 4J7IA 1IREB 3JCMQ 3I55T 5IN1A 2RHYA 2PVOB 4LDWA 2DD5A 3M57A 4JRPA 1YJWA 4OVAA 1Y96A 5LJ3e 1I5LA 3CCRT 4XTXA 4BB7A 1X01A 2PVDB 4E7IA 4NL2A 3L2UA 2E6NA 1Y71A 2QA4A 3JSCA 4JJNK 4E7LA 3JRZA 4M77B 2X4YA 4OGCA 3CPFA 3VU3C 5GAN6 1WJRA 5KE3A 2RD1A 4M7AB 3OYAA 1VQMA 2QQ9A 3CEYA 1YBYA 3OQ5A 1BKBA 2QQAA 1BI2A 1VQKT 3LH0A 3HRSA 2DTHA 4IUUA 4MZMA 3HRTA 4C8QG 3A8MB 5KCHA 4JS4A 2JTMA 1JB0E 4EDUA 2MI6A 4C8QA 3PGGA 4C8QD 5LJ5d 1D3BB 4A53A 1O75A 2KDSA 5GAMe 5C0MA 5LJ5j 5GANf 3CC4T 4FM4B 3CCLT 3HP9A 1VIFA 4FL6A 5HKCA 2E5QA 1YI2T 3TU4K 2RI2A 2ZPGB 2ZZDA 3OS0A 1QW1A 5GMKl 3JAME 1HK9A 2H3JA 4C8QF 5GMKm 5GAN7 4LD9K 3RUXA 3WVDB 3GP8A 4XTZA 3J81E 1JBMA 4C0FA 1B34A 1YIJT 2DZCA 2EFIA 4MMLA 2KMTA 4OF1A 3URGA 1OI1A 3I56A 2LT1A 1KD1C 1QVFA 3AHUA 5LJ5e 3ME9A 2L5QA 2OTLT 2D6FA 2X35A 2DXCA 3C94A 4IUVA 2QQSA 1M1KC 1XQHA 3QHSA 2D0QB 4RG8A 4X9DA 3RMQA 4KT0E 4DOWA 1NJIC 3RERA 4QVZA 3T9NA 2DXTA 2LNVA 4IKFA 1KQ1A 1RL2A 1Q7YC 4BE0A 3MEVA 5L8RE 1BI0A 5CCAA 3OMCA 4DQ2A 2JZ2A 3BDLA 3OYIA 2DJZA 1BI3A 3MEAA 1Q86U 3J7AF 4XAXB 1WJSA 1Y07A 4J6XA 1W4SA 3X20B 3CCVT 1S72A 5GAN4 4BY6B 1FXXA 1ZQ1A 3JB9G 3UPUA 5KCOA 1VQNA 4M78G 2QEXT 3C95A 4A4GA 3ZEHA 3JB9D 4M78A 3X28B 1VQ4T 2PU9B 4M78D 3CD6A 2BKDN 3V8LA 2P4TA 5HK0A 4HKEA 2D9TA 4J6YA 2G3RA 2K5LA 4JUVA 3RIRA 3V8JA 2XHCA 5GAOn 3G71T 3BY7A 4Q5WA 5CVIA 1VQ8A 4HT9A 2EQMA 2RJDA 3CCUT 3CCST 2RI3A 3JB9F 1HXDA 1UGPB 1FWZA 3M53A 4JLIA 2DEQA 4M78F 5LJ3g 1NE8A 2C06A 3X25B 3ZFJA 4EMGA 1VQOT 3OSSC 3FIFA 3OYKA 3VUZA 4ZGEB 3EAEA 1JRIA 1KC8C 2DIQA 3OA6A 2XK0A 4N0AC 1VQLT 3VYHB 3OYBA 2ZPIB 1JJ2S 2JNGA 2XI9A 2BIVA 2DPPB 3VYGA 4CI0C 4PJOE 1N8RU 5LL6S 3N5BB 3LWIA 1JJ2A 1VQ5A 3OBWA 2MF2A 2LC4A 4M75E 3G4ST 4QQ6A 4ATOA 2X4JA 2R58A 5GAMg 2QTXA 2RK1A 3A5ZB 4JDSA 4X9CA 3M59A 1G5VA 2YRVA 2DK3A 3M4YA 3KBGA 4HCCA 2YHTA 2E70A 2DKGA 3CCJT 1H641 2IG0A 2MMPA 2CKKA 3G6ET 4BDZA 3QXEB 4JRIA 3INZA 2CZ1B 2HQXA 2RM4A 2QXFA 2DIGA 4O5VA 4OGEA 5CKEA 2HNIA 3OB9A 3CBPA 3OYYA 3CMAA 1M1KU 5GANg 2EIFA 3FC3A 2OTJA 1PSFA 2JOYA 2KAFA 5LJ5h 4RMOA 5A2QE 2B8AA 4XTVA 2PVGB 2WSEE 4PJOB 4C5EA 1K8AC 3KUFA 2GQVA 2E1HA 3C12A 2DO3A 1XNIA 4M75B 1YITA 1KHIA 4C0ZA 4FU6A 2RHXA 4M7DE 5LJ3d 1Q82U 2MAMA 2P0QA 5D6WA 5LJ3j 4J5YA 3M54A 1TH7A 1K73U 1PSEA 1BI1A 2RO0A 4OP0A 1IZ6A 4KUIA 3MP6A 3QJYA 4MDWA 4NOYA 3WVEB 4ELZC 3UDCA 3JB9I 3OYMA 1VUBA 3M56A 5GAOq 3HFOA 1ZBXA 1WPYA 1BYMA 2VUBA 5GAMd 4E7KA 5D6XA 5GAMj 2NLUA 3G7ZA 2DXUA 2DD4A 2E12A 2M0OA 2DAQA 2RHUA 4XTWA 1VQ7T 3DB3A 3JCMf 3P8HA 1G3SA 1YHQT 2KY9A 3OS5A 4D6WA 4TVRA 2WSCE 3L2ZA 3CCMA 4M7DB 2VC8A 5GAOl 2XU8A 3JCMb 2DZ9A 5GAOm 2VXEA 4GY5A 1W2BS 2DTOA 4PJOC 3FRNA 1FX7A 4C92E 1U1SA 2AHJB 1LJOA 3MHXA 5CO7A 2ZCFB 4M75C 3PIOA 1VQ6A 1W2BA 2LDMA 5GANj 3WXMB 1VQPA 2V8KA 3CBMA 1VIEA 3OSVA 4L5GA 3JCMc 3BW1A 5C6SA 5CAIA 1NZ9A 4MZPA 4EPCA 3CCEA 1VQ5T 4KUDK 4X34A 4BD3A 1VQPT 4V2SA 2Y4YA 4RG2A 1Q81U 4QQDA 5D6YA 4B9WA 1KQSA 3V7SA 1H3ZA 3JCMJ 3S6WA 3OYDA 5I2SA 2EQJA 2CZ7B 5GANe 2VV5A 5FROA 2P0PA 4J8OA 3QDRB 1BIBA 4QQGA 5CQXA 4HT8A 1QP3A 5EG2A 2F5TX 3FDRA 4Y91A 3QG1A 3FLGA 2HD0A 2JTFA 4II1A 4FT2A 1G3YA 2A7YA 4M77C 4QVDA 1K9MC 1BIAA 5FRMA 2EQKA 1OYXA 3HHTB 4F7UE 5GMKi 3CMAT 4M77G 2RHZA 1UGRB 2EWNA 3TREA 3CMEA 2XD0A 3R6OA 4ELYC 2K3XA 4C92B 2EJGA 3GPLA 4M7AC 5GMKh 4MDXA 4J7FA 5FU6B 4M7AG 4M77A 1DJ7B 1YJNT 3CC2T 1O9SA 4XU2A 4PLIA 1M1FA 3LW5E 1UB4A 4M7DC 3GNFB 5CK9A 4M7AA 2CZ6B 1G3TA 1YJ9T 1VQ9A 4JRKA 1U1TA 2HQEA 4A4HA 4M77F 4XTUA 2FHDA 2R5AA 4P5NA 2PQWA 4MMKA 2HAXA 3CCQA 2K4YA 2FVUA 3A8OB 2GFAA 4IUQA 1WJQA 4M7AF 2XDBA 4XU0A 1D3BA 3DB4A 2L3RA 4BE1A 3S3NA 2RJFA 2ZPEB 2KSSA 1UGSB 3A8HB 3OYHA 3GLXA 4RCCA 3NTHA 3A8GB 5LJ3h 2BUDA 3QPHA 1YJWT 3L2VA 5A0DA 4F7UB 4EMKB 3BDUA 4J83A 1RI0A 2QA4T 3ZBDA 2XDDA 3S3OA 2ZPBB 3L2RA 3G4SA 4N0AA 3RKWA 3SWNB 1QVGS 2KQWA 3OYJA 1VQMT 4ZN3A 3OYCA 5KH6A 3JCMV 5GAN3 2RA2A 1N9RA 3PIPA 3CC7A 3QSUA 1QVGA 3HSBA 3CCMT 3GF5A 2QQRA 3X24B 4BY6C 4BUGA 4C92C 4C8QE 5GAMh 2O4XB 5FU6C 1M5Q1 2XIDA 1G3WA 3EFSA 5GAOr 3SB2A 2M16A 3JCMg 3X26B 3GOXA 4OB1B 4A4KA 3M55A 5J26A 2JVVA 3JB9J 3CC4A 4QW2A 3CCLA 4BI8B 1VQ6T 1U8RA 1N6AA 1YI2A 2RJCA 4KBMB 3C4SA 1P92A 2L89A 3E9GA 2F69A 1SSFA 2E10A 4HCBA 1V29B 3OS1A 1M90U 1Y96B 2ZGWA 2XG8D 3NTKA 1N8RC 3I56T 4C5IA 5A0LA 4XTYA 5KE2A 5CIUA 4B9XA 4HA8A 4C5HA 2PUKB 5GANh 4IUTA 2L8DA 3ASKA 3SDZA 2LCCA 4R56A 3M9QA 2JUFA 2RI5A 1YIJA 3KXTA 4E47A 5J39A 1WNLA 2A3LA 4RCBA 2CYZB 3VKIA 4C8QB 4LDYA 1X6OA 4MZTA 3SWNC 2O01E 4XU3A 5AYFA 4LDXA 4XQ3A 3E19A 3CCVA 3RKYA 1S72T 3V7CA 2LX9A 1YCYA 3V7RA 4A54A 1VQNT 4DA4A 1LNXA 3M58A 2QEXA 1KQ2A 1WGSA 3MEUA 3PMIA 4M78E 5HK3A 3CD6T 5LJ3f 1B34B 3HFNA 2Y4XA 3RMSA 3OW2A 3MP1A 1I81A 1VQ8T 3G71A 3CCQT 2OAUA 4E7HA 4HCZA 2E41A 3QO3A 3TCJA 4R55A 4A4EA 2XKOC 4C0DB 5DLOA 1Q82C 3JCMd 2E65A 4L59A 3PNWC 2WACA 3H6ZA 1K73C 4DOVA 3FB9A 3VUBA 1QVPA 3DKMA 5DLQE 2KK4A 3E1SA 3LLRA 3O8VA 3JCMX 1VQLA 4PJOG 3J80E 5GAMf 5GANd 4OB2B 1M8VA 3QZ5B 4PJOA 4M75G 4PJOD 4JLGA 1KQSS 1KD1U 3L2WA 3H8ZA 2K5FA 4XK8E 3JCMe 4FT4A 2I2LA 3M5AA 4M75A 2K5IA 4PL6A 1R8OB 4M75D 1M1GA 1QP2A 1AHJB 3A8LB 4M78B 1EIFA 2PUOB 2WSFE 4C8QC 2P0KA 1NJIU 3JB9H 4LD6A 3CC7T 4OMFB 4PJOF 4BDYA 2GCXA 5LJ5f 5CKFA 1Q7YU 4M75F 2XICA 3MO8A 3CCJA 2R5MA 4JRQA 3DLMA 1K9MU 4PLLA 3OBYA 3G6EA 1XTDA 4LDUA 5GAN2 3HRUA 1N9SA 1WQ7A 3QZ9B 3FJPA 3E9FA 1MHNA 1UGQB 1MGQA 3VV0A 1NPRA 4L6V5 4PNOA 3BFMA 4ZN1A 2OTJT 5I2MA 4IUPA 2E6ZA 2JN0A 2VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F70 A;  4E7L A;  3MP8 A;  3S3O A;  2B8A A;  2X4Y A;  3L2R A;  5FRN A;  4C5E A;  5KE3 A;  3KUF A;  1WJR A;  2X4W A;  3SD4 A;  1XNI A;  3OYA A;  3OYL A;  3CEY A;  3OYC A;  4FU6 A;  3OQ5 A;  5KH6 A;  2RHX A;  3LH0 A;  4ZTF A;  2EKO A;  4IUU A;  5KCH A;  5D6W A;  2QQR A;  3S3M A;  3P8D A;  2RO0 A;  2O4X B;  4EDU A;  3QJ6 A;  2M16 A;  3MP6 A;  5C0M A;  5J26 A;  4QW2 A;  4Z02 A;  4FL6 A;  2E5Q A;  2K3Y A;  2RJC A;  2RI2 A;  3C4S A;  3OS0 A;  2L89 A;  3E9G A;  3OYM A;  3MEW A;  1SSF A;  2LRQ A;  3OS1 A;  4CRI A;  2EFI A;  2RHI A;  3NTK A;  3NTI A;  3OYE A;  4C5I A;  1OI1 A;  5M9O A;  5KE2 A;  4E7K A;  5CIU A;  5D6X A;  4B9X A;  2NLU A;  4BE2 A;  3ME9 A;  4C5H A;  2M0O A;  2GF7 A;  2X35 A;  3QBY A;  3LGL A;  2DAQ A;  2RHU A;  2XDP A;  2L8D A;  2QQS A;  3DB3 A;  2GFU A;  4IUT A;  3LX7 A;  4IUV A;  3ASK A;  4N4H A;  3P8H A;  2LCC A;  3M9Q A;  4QVZ A;  4IKF A;  2RI5 A;  4BE0 A;  2MWP A;  3MEV A;  5J39 A;  3PMT A;  4GY5 A;  2LTO A;  2X4X A;  3OMC A;  2JZ2 A;  3FEO A;  3BDL A;  4C5G A;  3OYI A;  3MEA A;  4A4F A;  4BAC A;  4ZTJ A;  1WJS A;  3QII A;  4NS5 A;  3QKJ A;  3UT1 A;  2LDM A;  4N4G A;  5KCO A;  4IUR A;  5C6S A;  2EQU A;  1WGS A;  3MEU A;  3Q1J A;  3PMI A;  4A4G A;  2M1H A;  3ZEH A;  3LGF A;  3L2Q A;  4X34 A;  4BD3 A;  3OY9 A;  3OYF A;  2BKD N;  1N27 A;  4RG2 A;  4QQD A;  2D9T A;  5D6Y A;  4B9W A;  3MP1 A;  2G3R A;  2RJE A;  1H3Z A;  3S6W A;  3OYD A;  4Q5W A;  4E7H A;  2EQM A;  2EQJ A;  2RJD A;  4HCZ A;  2RI3 A;  4A4E A;  4UC4 A;  5FRO A;  4QQG A;  2R57 A;  4L59 A;  3FDR A;  3FLG A;  2WAC A;  3H6Z A;  3PNW C;  4N4I A;  3EAE A;  3OYK A;  2JTF A;  4II1 A;  2LVM A;  5FRM A;  1OZ2 A;  2DIQ A;  3MET A;  3OMG A;  5IAY A;  3OA6 A;  2EQK A;  1OYX A;  2XK0 A;  3LLR A;  3O8V A;  3OYB A;  2RHZ A;  2BIV A;  2K3X A;  3PFS A;  2MWO A;  3LYI A;  3OYG A;  1KHC A;  3L2W A;  3H8Z A;  4PLI A;  4QQ6 A;  4PL6 A;  3GOX A;  2R58 A;  4E7J A;  3UWN A;  2P0K A;  2VYT A;  2HQE A;  4LD6 A;  4A4H A;  4BDY A;  2FHD A;  2R5A A;  2PQW A;  1OZ3 A;  1G5V A;  2GFA A;  2O4X A;  1WJQ A;  2YRV A;  3L42 A;  4IUQ A;  3MO8 A;  3DB4 A;  2L3R A;  4BE1 A;  2IG0 A;  2R5M A;  2CKK A;  2RJF A;  2F5K A;  3DLM A;  3OYN A;  4PLL A;  4BDZ A;  3S3N A;  3OS2 A;  3OYH A;  5IN1 A;  2RHY A;  2HQX A;  3E9F A;  1MHN A;  3NTH A;  2BUD A;  2DIG A;  3OB9 A;  4OVA A;  3L2V A;  3FC3 A;  3OYJ A;  4IUP A;  4E7I A;  1RI0 A;  3L2U A;  2E6N A; 
#chains in the Genus database with same CATH topology
 2FPE A;  1H92 A;  1NBE B;  2LQK A;  3EH2 A;  5J3B A;  4M7A D;  2CP3 A;  4WTO B;  4M7D A;  3H0I A;  3P8D A;  3QJ6 A;  4OB0 B;  1RAF B;  5A0G A;  2YUP A;  4GBQ A;  4M78 C;  2RQW A;  3MEW A;  2LRQ A;  3GNG A;  2FRY A;  2DIL A;  3LGL A;  2GFU A;  2L3Q A;  1YHQ A;  4FIB A;  1UUE A;  2YLC A;  4DBF A;  2V1Q A;  1M3C A;  4C5G A;  5I11 A;  4NL3 A;  2KYB A;  3IQL A;  3CBO A;  3KFV A;  5FU7 B;  4C92 D;  4D8D A;  4RKU E;  3LGF A;  1M4Z A;  3OY9 A;  3O5Z A;  2DXB A;  2V8I A;  2HL3 A;  1J3T A;  4VUB A;  4C92 F;  4FYV B;  2OTL A;  3VRZ A;  3NHN A;  2CRE A;  1TWB A;  1JXO A;  4YTL A;  5GMK j;  2R57 A;  3ER0 A;  4EMK C;  2V8J A;  4N4I A;  4BI4 A;  5LJ5 g;  1IHW A;  3OMG A;  1MMN A;  3P8B B;  1AEY A;  2NYS A;  3MKD A;  1E7O A;  4F7U A;  4EMK A;  2EPD A;  2L3P A;  2LQ8 A;  3PFS A;  3OYG A;  2EYW A;  4M7A E;  4EMH A;  1K76 A;  2FB7 A;  1M1K R;  4JZ3 A;  1NJI R;  1S1N A;  3VS0 A;  1PC0 A;  1ZUU A;  2QDY B;  1Q7Y R;  1X75 C;  3CCU A;  3PT9 A;  2O4X A;  3L42 A;  2F5K A;  4J6W A;  4J7I A;  5IHN A;  4ESR A;  1GL5 A;  1VQO Q;  3M57 A;  4XTX A;  4BB7 A;  4JJD A;  4E7I A;  1R77 A;  2E6N A;  1Y71 A;  5GAN 6;  3CPF A;  4M7A B;  1VQM A;  3G4S Q;  3MJX A;  2QQA A;  3LH0 A;  4JS4 A;  4C8Q G;  1IXD A;  2DX1 A;  2COZ A;  1RAE B;  4EDU A;  3EGD B;  1O75 A;  5GAM e;  3ULR B;  4FM4 B;  3HP9 A;  5HKC A;  2RI2 A;  3OS0 A;  3JAM E;  1HK9 A;  2CP7 A;  4CC3 A;  1JBM A;  2DER A;  2EFI A;  1ZSZ A;  4CC2 A;  1D1B A;  4OF1 A;  5LJ5 e;  3ME9 A;  3ZL7 C;  2X35 A;  2DXC A;  4IUV A;  2QQS A;  1M1K C;  1XQH A;  4RG8 A;  4X9D A;  1NJI C;  4QVZ A;  2LNV A;  1KQ1 A;  1Q7Y C;  4BE0 A;  1BI0 A;  5CCA A;  4DQ2 A;  2JZ2 A;  3J7A F;  5GAN 4;  3JB9 G;  1AWO A;  1VQN A;  2QEX T;  3C95 A;  2D8H A;  1MNE A;  3X28 B;  3V8L A;  3CCR Q;  2P4T A;  5HK0 A;  2D9T A;  2G3R A;  2XHC A;  3A1P A;  2PZ1 A;  2H8H A;  1HXD A;  1FWZ A;  2DEQ A;  3AT1 B;  1NE8 A;  3ZFJ A;  4FW2 A;  4EMG A;  1RLQ C;  2DIQ A;  4N0A C;  2EGA A;  2XI9 A;  1UJY A;  1ZX6 A;  1GBQ A;  2BTT A;  5LL6 S;  4ANJ A;  2LC4 A;  1VQ5 Q;  2QTX A;  1CKB A;  4JDS A;  1M2V B;  2AKK A;  1G5V A;  1X43 A;  1WHH A;  2IG0 A;  2NUZ A;  4JRI A;  5KYW B;  2CZ1 B;  2P4R A;  3OB9 A;  3CMA Q;  4RTW A;  2YT6 A;  5LJ5 h;  4RMO A;  3VS6 A;  4XTV A;  2PVG B;  2GQV A;  1YJN Q;  4J9I A;  1WXB A;  1YIT A;  2MIO A;  4FU6 A;  5LJ3 d;  1K73 U;  3I35 A;  4KUI A;  5KYX B;  3EG1 A;  4MDW A;  2RF0 A;  2A36 A;  2F1L A;  2YUO A;  1NEG A;  3UDC A;  3JB9 I;  5GAO q;  1TOV A;  2ATC B;  1YJW Q;  2VUB A;  4E7K A;  3REB B;  5GAM j;  2QA4 Q;  2M0O A;  4XTW A;  1X2Q A;  2P84 A;  2WSC E;  3CCM A;  2J6F A;  2VC8 A;  5GAO l;  2DZ9 A;  5GAO m;  2VXE A;  3M0S A;  1PRL C;  2HKN A;  2DTO A;  1U1S A;  2VB6 A;  1QVF P;  5KYY B;  5GAN j;  3JCM c;  1QVF S;  5CAI A;  3CCE A;  1NZ9 A;  5IHI A;  4X34 A;  1Y0M A;  2ECZ A;  4V2S A;  2Y4Y A;  1JU5 C;  4RG2 A;  4QQD A;  2COW A;  5KYU B;  3V7S A;  1H3Z A;  3S6W A;  3OYD A;  1ZA1 B;  2CZ7 B;  2V1R A;  3QDR B;  2QDL A;  3FLG A;  2HD0 A;  2JTF A;  5FRM A;  4F17 A;  2W0Z A;  1FMV A;  2HMA A;  2EWN A;  4M7A C;  1PRM C;  4ELY C;  4MDX A;  2CP5 A;  3VRY A;  4J7F A;  5FU6 B;  1I5O B;  1RAC B;  4M7A A;  1G3T A;  1GCQ C;  1YJ9 T;  2EYX A;  1AVZ C;  4JRK A;  3GBQ A;  1U1T A;  1BU1 A;  4A4H A;  1R0B G;  4M77 F;  2FHD A;  4XTU A;  3CCQ A;  2QAS A;  3A8O B;  2D1X A;  3EGD A;  2LJ3 A;  4BE1 A;  3RNJ A;  2KSS A;  1SPK A;  3GLX A;  3NTH A;  2JS0 A;  1PCX A;  1SKU B;  5A0D A;  1D1A A;  1UG1 A;  3EGX B;  1RI0 A;  2EBP A;  1QVG S;  2KQW A;  2C0I A;  3OYC A;  3JCM V;  5GAN 3;  3QSU A;  3HSB A;  2QQR A;  4C92 C;  4OB1 B;  5J26 A;  1VQ6 T;  1U8R A;  1WXU A;  2RJC A;  4KBM B;  4AFZ C;  1P92 A;  2L89 A;  2E10 A;  2E5K A;  3PE0 A;  3I56 T;  1T0J A;  4F14 A;  1C1A A;  2D0N A;  4RTY A;  4HCK A;  1C6V X;  2JUF A;  1TXQ A;  2A3L A;  2CYZ B;  4XQ3 A;  1S72 T;  1LPL A;  1RLP C;  2LX9 A;  4DA4 A;  1PKT A;  1WGS A;  2JM9 A;  4M78 E;  3CD6 T;  1B34 B;  1KIK A;  2ESW A;  1M2V A;  1VQ8 T;  1OU8 A;  3TCJ A;  2E41 A;  1TUG B;  4R55 A;  4A4E A;  2DA9 A;  4KGV B;  5IHK A;  2KRS A;  3PNW C;  3H6Z A;  1K73 C;  5KYW A;  3E1S A;  5FWC A;  5GAN d;  1K0S A;  1KQS P;  1M8V A;  3QZ5 B;  4M75 G;  4PJO D;  1KQS S;  1KD1 U;  2K5F A;  4FT4 A;  3M5A A;  3G4S A;  1X69 A;  4M78 B;  1R8O B;  3A8L B;  1QP2 A;  1U06 A;  2J6O A;  2MYS A;  4OMF B;  1QCN A;  4PJO F;  3PVQ A;  2XIC A;  3MO8 A;  5KYX A;  1PM3 A;  1YNZ A;  4PLL A;  4LDU A;  5GAN 2;  1ZBJ A;  3HRU A;  2EQI A;  1N9S A;  1UE9 A;  2DBM A;  3E9F A;  2X51 A;  4KRT A;  2OTJ T;  5I2M A;  3OYJ A;  2JN0 A;  3MP8 A;  4LDV A;  4FSX A;  3EGU A;  4M7D G;  2Y90 A;  5GAN 5;  2EKO A;  1WQW A;  2PNI A;  1X27 A;  2O9V A;  1OU9 A;  4OMN A;  5KYY A;  2K3Y A;  3I55 A;  2RPN A;  3TSW A;  5IXB A;  2GNC A;  2VGN A;  3CCR A;  4C0G A;  3NTI A;  2KVQ G;  5M9O A;  5KYU A;  1AZG B;  1LOJ A;  3CPW S;  3CXC A;  3A98 A;  1MMG A;  2GF7 A;  1GXI E;  2XDP A;  2FRW A;  3LX7 A;  2CP0 A;  2DYB A;  1C0M A;  4FYX B;  1VQK A;  2LT4 A;  3JCM W;  4OMM A;  1H8K A;  3PMT A;  4ME7 A;  3FEO A;  2AK5 A;  2DE0 X;  3QII A;  4NS5 A;  3UT1 A;  2EJ9 A;  1M3B A;  2EQU A;  4RUG A;  1I4K 1;  3OYF A;  5GAO p;  1N27 A;  1OQK A;  2RJE A;  2ED1 A;  2M0Y A;  2OJ2 A;  1M9S A;  5CKD A;  4JS5 A;  5FLX E;  2EAY A;  2MOX A;  3EG0 A;  2KGT A;  4LN2 A;  4F16 A;  4F7U G;  2LVM A;  2YRD A;  5ECA A;  3CME T;  3EGX A;  1YWP A;  2SRC A;  1KD1 R;  1YJN A;  1V76 A;  1KHC A;  5GMK e;  2DTI A;  2QEX Q;  4M4Z A;  1VQ9 T;  1VQ4 A;  4QVC A;  2JJ9 A;  3UWN A;  3JCM P;  2VYT A;  1ZHI A;  1WZO A;  2CP6 A;  3CCS A;  2E64 A;  1UGV A;  2FZG B;  3EG9 B;  3NFC A;  1AZE A;  1IRE B;  3JCM Q;  2PVO B;  3EG3 A;  1JQQ A;  2DD5 A;  1YJW A;  4OVA A;  5LJ3 e;  2AKL A;  1X01 A;  4R0K A;  4JJN K;  2QA4 A;  4E7L A;  2X4Y A;  2RD1 A;  2KR3 A;  2DM1 A;  2QQ9 A;  3CEY A;  2DEU A;  3OQ5 A;  3EFO B;  3HRT A;  1X2K A;  2JTM A;  3PGG A;  4C8Q D;  4A53 A;  2KDS A;  5C0M A;  1VIF A;  2KXC A;  1YI2 T;  2ZZD A;  4LUD A;  2DL5 A;  5GMK l;  5GAN 7;  4C8Q F;  5GMK m;  3RUX A;  3WVD B;  3GP8 A;  3J81 E;  4DBH A;  4C0F A;  1B34 A;  2DZC A;  2KMT A;  2GQI A;  1OI1 A;  2DVJ A;  1QVF A;  1KD1 C;  2L5Q A;  2OTL T;  2DMO A;  2HKQ B;  4KT0 E;  2DLP A;  2DXT A;  2C0T A;  3MEV A;  1PHT A;  4DEY A;  2JT4 A;  2BZ8 A;  1Q86 U;  2QAZ A;  1WJS A;  1Y07 A;  4J6X A;  3E2U A;  4BY6 B;  1FXX A;  1ZQ1 A;  3UPU A;  5KCO A;  2QTV A;  3H0H A;  2M51 A;  3JB9 D;  4M78 A;  2PU9 B;  4AMC A;  2EGC A;  2JMC A;  4J6Y A;  3V8J A;  3G71 T;  2YXY A;  3CCU T;  3JB9 F;  2RI3 A;  1WI7 A;  3M0R A;  1GBR A;  3VUZ A;  4Z88 A;  2COY A;  4AFS C;  3OYB A;  1JJ2 S;  1TS9 A;  2JNG A;  2HCK A;  3N5B B;  4ATO A;  2R58 A;  5GAM g;  3A5Z B;  1YIJ Q;  2O9S A;  2YRV A;  2CT4 A;  2E70 A;  2DKG A;  1D1C A;  3G6E T;  4K11 A;  3INZ A;  1KFZ A;  2K9G A;  1TG0 A;  2RM4 A;  2QXF A;  4OGE A;  2LJ1 A;  1VA7 A;  3OYY A;  5GAN g;  1PG5 B;  4J9C A;  1TUD A;  3FJ5 A;  5A2Q E;  2WSE E;  3MPU B;  3C12 A;  4FCY A;  1XJW B;  1XNI A;  2DO3 A;  1KHI A;  1YJ9 Q;  1SHG A;  2P0Q A;  5LJ3 j;  2X9H A;  4OP0 A;  3H9N A;  3VS7 A;  1BBZ A;  1UHF A;  1ABO A;  1VUB A;  2EW3 A;  1BYM A;  2DXU A;  2DAQ A;  2RHU A;  1VQ7 T;  3P8H A;  2LX7 A;  2KY9 A;  4TVR A;  1FMK A;  1AWJ A;  2XU8 A;  3JCM b;  2DL4 A;  4GY5 A;  1W2B S;  4PJO C;  4C92 E;  5CO7 A;  2AHJ B;  1LJO A;  3MHX A;  3SHW A;  3NGP A;  3PIO A;  1YCS B;  1VQ6 Q;  2V8K A;  3CBM A;  4L5G A;  1M27 C;  3BW1 A;  4PK4 A;  1VQP T;  4B9W A;  1KQS A;  2LJ0 A;  2ROT A;  3I56 Q;  3JCM J;  5I2S A;  2EQJ A;  2LCS A;  5GAN e;  2VV5 A;  3EG9 A;  1BIB A;  4QQG A;  5CQX A;  1Z9Z A;  2RQT A;  1G3Y A;  1KSW A;  2DET A;  2EQK A;  3HHT B;  1OEB A;  2JXB A;  1UGR B;  2JS2 A;  4C92 B;  3GPL A;  1TSF A;  1S72 Q;  4M7A G;  1DJ7 B;  3CC2 T;  1O9S A;  2DYI A;  1QCO A;  2BZX A;  3EFO A;  3CD6 Q;  4P5N A;  2HAX A;  1VQ8 Q;  2GFA A;  2LNH B;  2XDB A;  3DB4 A;  2RJF A;  2QK0 A;  1UGS B;  3A8H B;  3I5R A;  1E6G A;  4RCC A;  3QPH A;  3L2V A;  3LH5 A;  2PTK A;  3TQ7 P;  4B6M A;  2XDD A;  2GBQ A;  1WHL A;  3S3O A;  3L2R A;  2JW4 A;  4N0A A;  3RKW A;  2DL3 A;  5KH6 A;  1WDX A;  4DBR A;  3PIP A;  2RA2 A;  3CC7 A;  3CCM T;  4RTZ A;  4LXC A;  3X24 B;  4BY6 C;  1T0H A;  5GAM h;  1G3W A;  3SB2 A;  3JCM g;  2HZY A;  3JB9 J;  4QW2 A;  3HTR A;  1NG2 A;  1SSF A;  2F69 A;  5FW9 A;  3OS1 A;  1M90 U;  2XG8 D;  2OTJ Q;  5KE2 A;  5CIU A;  4C5H A;  2PUK B;  5GAN h;  2L8D A;  3ASK A;  1RAA B;  1MV0 B;  4R56 A;  3M9Q A;  3UAT A;  1NM7 A;  3UF4 A;  5J39 A;  1WNL A;  2O2O A;  1X6O A;  4MZT A;  2K2M A;  1WHM A;  4XU3 A;  5AYF A;  3SWN C;  2EVR A;  1PD1 A;  2VVK A;  2QEX A;  4PJL A;  1Y57 A;  2B86 A;  5GJW B;  5HK3 A;  4QKU A;  2RQU A;  2Y4X A;  1K9A A;  4WCI A;  3RMS A;  2O31 A;  3CCQ T;  4HCZ A;  2KBT A;  2H3E B;  2KE9 A;  2LZ6 B;  2XKO C;  5FWB A;  2A0F B;  2E65 A;  1ZA2 B;  2LQN A;  2CH4 A;  4DOV A;  3FB9 A;  3VUB A;  3DKM A;  5DLQ E;  4OMO A;  2W10 A;  2FEI A;  5GAM f;  1MND A;  1OOT A;  4JLG A;  3H0F A;  4OMQ A;  4XK8 E;  3JCM e;  4PL6 A;  3GOX A;  4M75 D;  4C8Q C;  2PUO B;  1UHC A;  1BCO A;  5LJ5 f;  5CKF A;  2J05 A;  2KI7 A;  4E7S A;  4M75 F;  2AZV A;  1K9M U;  4JJB A;  1WLP B;  1WHK A;  1NPR A;  2VAS A;  2E6Z A;  3CME Q;  1NLO C;  4C0D C;  2ZPH B;  4M77 D;  9ATC B;  1AOJ A;  3SD4 A;  1SRM A;  1SRL A;  2JMA A;  2M02 A;  3OYL A;  5CQY A;  1VQ9 Q;  2MK5 A;  4M7D D;  4PKC C;  3S3M A;  1GCQ A;  1KC8 U;  1M2O A;  1PWT A;  1IHV A;  4Z02 A;  1E6H A;  4M7D F;  3HL8 A;  3QYG B;  1B7T A;  4ZGD B;  4WF2 A;  1SF9 A;  2EYQ A;  2ZPF B;  4CRI A;  2CGH A;  2J7I A;  3OYE A;  1QVG P;  3EFR A;  2K79 A;  3QBY A;  4N4H A;  1D09 B;  4OB3 B;  1QKW A;  2C0O A;  1K73 R;  2RH2 A;  3SFM A;  3GIB A;  2LTO A;  2X4X A;  5IH2 A;  1RAB B;  4ZGJ B;  3NPF A;  1W1F A;  3EHQ A;  4ZTJ A;  4C92 A;  1YI2 Q;  2FG0 A;  3L1A A;  3JCM h;  3Q1J A;  4KUL A;  2M1H A;  3L2Q A;  2FL7 A;  3VJP A;  1YIJ A;  4PJM A;  1NPP A;  1Q95 G;  2CT3 A;  4Z8A A;  4D8K A;  2YRC A;  1Y7X A;  4ZNX A;  2QG9 B;  1OV3 A;  4UC4 A;  4BI3 A;  2LCL A;  5CKB A;  3DLL A;  2M9U A;  4AFU C;  1OZ2 A;  3MET A;  2E3I A;  1HYO A;  3M4G A;  2RMO A;  1QMC A;  3HPW A;  4PJJ A;  3LWH A;  2DBK A;  2MWO A;  3LYI A;  2DL7 A;  4M77 E;  3OW2 P;  3OW2 S;  1M90 C;  2EYY A;  3TEE A;  1OX9 A;  4F7U F;  1GCP A;  3RES A;  1YJ9 A;  5DY9 A;  4E7J A;  1RAI B;  2RB6 A;  1XOV A;  2DVE A;  1UEB A;  2FYK A;  3G71 Q;  5AT1 B;  3OYN A;  2QGG A;  1VQO A;  5IT9 E;  3I55 T;  2AIR B;  4LDW A;  4JRP A;  2V26 A;  1YWO A;  3CCR T;  1EFN A;  4KGZ B;  2PVD B;  4NL2 A;  3L2U A;  3JSC A;  3JRZ A;  4M77 B;  8ATC B;  3VU3 C;  2HSE B;  1AWW A;  1A0N B;  1YBY A;  1T3S A;  1VQK T;  1BI2 A;  4MZM A;  4J9F A;  1KC8 R;  2MI6 A;  1X6B A;  5LJ5 d;  1D3B B;  2XMF A;  1FYN A;  4RTT A;  3CC4 T;  3CCL T;  4FL6 A;  2E5Q A;  3G6E Q;  3TU4 K;  3EH1 A;  2H3J A;  1WHJ A;  3QDF A;  4J9H A;  4XTZ A;  4MML A;  3URG A;  3I56 A;  4PFO A;  2D0Q B;  3RER A;  3T9N A;  4IKF A;  1RL2 A;  3D7S B;  5L8R E;  4Y92 A;  3BDL A;  3OYI A;  2DJZ A;  4XAX B;  3CCV T;  1S72 A;  3C0C A;  4X1V A;  1JO8 A;  4M78 G;  4A4G A;  3CPW P;  1VQ4 T;  3CD6 A;  1ARK A;  2JM8 A;  2BKD N;  4KGX B;  4HKE A;  2YDL A;  4JUV A;  4HT9 A;  1VQ8 A;  5GAO n;  4Q5W A;  5CVI A;  2EQM A;  1MMD A;  2RJD A;  3CCS T;  1VYV A;  3M53 A;  4JLI A;  5LJ3 g;  1VQ7 Q;  3X25 B;  3BE3 A;  3EAE A;  1JRI A;  1KC8 C;  2XK0 A;  1VQL T;  1SHF A;  4PJO E;  1N8R U;  4HXJ A;  1VQ5 A;  3OBW A;  2MF2 A;  1VQP Q;  3H41 A;  1QCF A;  4X9C A;  3M59 A;  4OML A;  3CCJ T;  1OX8 A;  4BDZ A;  1M30 A;  2ENM A;  4O5V A;  5CKE A;  3CBP A;  3CMA A;  3FC3 A;  2OTJ A;  4PJO B;  4C5E A;  3KUF A;  3CC2 Q;  1VYU A;  4C0Z A;  3VS1 A;  3NMZ C;  1GFC A;  1F1B B;  1Q82 U;  5D6W A;  1TH7 A;  3RDV A;  2DRM A;  2JTE A;  2FPD A;  4NOY A;  4IIO A;  4DEX A;  4ELZ C;  3OYM A;  1I0C A;  3QWY A;  1AT1 B;  2X3X D;  2NLU A;  2VKN A;  1PNJ A;  3DB3 A;  1ZUY A;  1YHQ T;  3OS5 A;  4D6W A;  4J9D A;  1OPL A;  3CCM Q;  3VS2 A;  6AT1 B;  1FX7 A;  4M75 C;  2RN8 A;  2LDM A;  3WXM B;  4RTX A;  5C6S A;  1VIE A;  3G1J A;  4MZP A;  4EPC A;  4BD3 A;  1Q81 U;  1H3H A;  4AG1 C;  5D7U A;  5D6Y A;  2P0P A;  4HT8 A;  1YN8 A;  4HVW A;  2F5T X;  5EG2 A;  3QG1 A;  4FT2 A;  4M77 C;  1OYX A;  5GMK i;  3CME A;  2XD0 A;  3R6O A;  1N8R R;  5GMK h;  1TTH B;  4HVV A;  4M77 A;  1ZLM A;  2GTO A;  4M7D C;  3GNF B;  5CK9 A;  1VQ9 A;  2A08 A;  2HSP A;  2HDA A;  1WIE A;  2R5A A;  2PQW A;  4IUQ A;  4M7A F;  3CCQ Q;  1D3B A;  4LUE A;  3S3N A;  2HEQ A;  2ZPE B;  4AFQ C;  4ORZ A;  1JJ2 P;  3A8G B;  5LJ3 h;  2BUD A;  2CSI A;  2CP2 A;  2DNU A;  2OAW A;  3SWN B;  1VQM T;  4ZN3 A;  4FSS A;  1Q82 R;  3REA B;  1N9R A;  2ZAE A;  1QVG A;  3GF5 A;  4PFZ A;  4FW1 A;  4C8Q E;  5I22 A;  5GAO r;  4J9E A;  1M5Q 1;  2XID A;  3EFS A;  3X26 B;  1HD3 A;  4A4K A;  2JVV A;  4BI8 B;  1YI2 A;  2QYZ A;  2J06 A;  3C4S A;  4HCB A;  2NWM A;  1IGU A;  1Y96 B;  1N8R C;  4C5I A;  4XTY A;  4B9X A;  2NUT B;  1MUZ A;  4IUT A;  3SDZ A;  2LCC A;  3U23 A;  1B07 A;  2RI5 A;  4RCB A;  4C8Q B;  4LDY A;  4LDX A;  2L2P A;  2NUP B;  2K6D A;  3RKY A;  1T3L A;  2ED0 A;  3V7C A;  1YCY A;  1VQN T;  3M58 A;  3PMI A;  1V1C A;  1Q81 R;  5LJ3 f;  1JXM A;  3OW2 A;  3MP1 A;  1I81 A;  2FZK B;  2RQR A;  3G71 A;  2OAU A;  4E7H A;  3QO3 A;  1VOM A;  4C0D B;  5DLO A;  3TVT A;  1Q82 C;  1W2B P;  2WAC A;  1AD5 A;  1Q86 R;  2DL8 A;  1OUL A;  1RAH B;  3LLR A;  3PVL A;  1D0Y A;  2O88 A;  3J80 E;  1M3A A;  4OB2 B;  5L23 A;  4PJO A;  5IXF A;  3H8Z A;  3THK A;  1M1G A;  1QKX A;  2P0K A;  3JB9 H;  4LD6 A;  3CC7 T;  4F04 B;  1UTI A;  1M8M A;  2GCX A;  2SEM A;  3VS5 A;  2L0A A;  3G6E A;  1ZSZ C;  4PJN A;  3FJP A;  1UGQ B;  1G8X A;  4JPB W;  1LVK A;  4L6V 5;  4PNO A;  4LNP A;  4A63 B;  1AWX A;  3F70 A;  5FRN A;  2MCN A;  2X4W A;  4O6J A;  2LQW A;  2QI2 A;  2ROL A;  1YIT T;  1Q81 C;  2LP5 A;  4ZTF A;  1KG1 A;  1SEM A;  4AG2 C;  1NYF A;  2RK2 A;  2QQB A;  1I8F A;  2VXF A;  5I21 A;  4E7Z A;  1RAD B;  4XU1 A;  2IPO B;  3QYH B;  3CXC P;  1Q86 C;  5GAN 8;  3I55 Q;  3M0U A;  3CXC S;  2RHI A;  3M0T A;  4IIM A;  2HBP A;  3RR6 A;  4BE2 A;  4E2F B;  2CS7 A;  3MCA B;  1VQ7 A;  3V8K A;  3CPW A;  3HKS A;  1VQK Q;  2FPF A;  2K2V A;  2MWP A;  3RKX A;  4EIK A;  1ZSG A;  4C92 G;  1UDL A;  4GLK A;  4A4F A;  4BAC A;  4Y28 E;  3QKJ A;  3CC4 Q;  5KYN A;  3CCL Q;  4N4G A;  4IUR A;  5CR2 A;  3CCE T;  1K8A U;  1TUC A;  1VQP A;  1ACM B;  2GTJ A;  3PTA A;  2EJF A;  2YLB A;  2HL5 C;  1MMA A;  2F2V A;  5DM7 R;  3EHR A;  2HBW A;  2IVW A;  2X3W D;  5IAY A;  3QUI A;  3CCV Q;  5EC7 A;  3CC2 A;  3SWN A;  4FYW B;  7AT1 B;  2K57 A;  3TSZ A;  2ABL A;  1VQ4 Q;  2G6F X;  1OZ3 A;  5FU7 C;  2CZ0 B;  3QWX X;  2E3H A;  5HY6 A;  3CCS Q;  5CKH A;  1PKS A;  3OS2 A;  5IN1 A;  2RHY A;  2RQV A;  1QWE A;  1Y96 A;  1I5L A;  1VQL Q;  1EX4 A;  2EYZ A;  4OGC A;  5KE3 A;  1UEC A;  1D0Z A;  1WJR A;  2RNA A;  2NUT A;  3OYA A;  2I0N A;  1BKB A;  1GFD A;  3HRS A;  2DTH A;  2DF6 A;  3I5S A;  4IUU A;  5KCH A;  3A8M B;  4AT1 B;  2F2X A;  2MPX C;  1JB0 E;  4C8Q A;  1YP5 A;  4QT7 A;  5GAN f;  2F2W A;  5LJ5 j;  3CCJ Q;  2NUP A;  2KRN A;  1D0X A;  2ZPG B;  1QW1 A;  4LD9 K;  1QLY A;  1K4U S;  1YIJ T;  1HSQ A;  2LT1 A;  1WA7 A;  3AHU A;  2D6F A;  1SSH A;  3C94 A;  4KH1 B;  4DOW A;  3QHS A;  3RMQ A;  4HVU A;  1PD0 A;  1NYG A;  3OMC A;  1BI3 A;  2HQH A;  3MEA A;  3X20 B;  1W4S A;  1FMW A;  1K8A R;  1M90 R;  2A28 A;  3ZEH A;  2DJQ A;  4M78 D;  3RIR A;  2FZC B;  2K5L A;  2Z0W A;  3BY7 A;  2KT8 A;  1UGP B;  2YUQ A;  4M78 F;  2C06 A;  1W70 A;  1VQO T;  1YHQ Q;  1IO6 A;  3OSS C;  3FIF A;  3OYK A;  4JJC A;  4ZGE B;  2DRK A;  2LMJ A;  3OA6 A;  3VYH B;  2A37 A;  2ZPI B;  2FO0 A;  2BIV A;  2DPP B;  3VYG A;  4CI0 C;  1QQJ A;  1W6X A;  3LWI A;  4CC7 A;  1JJ2 A;  4M75 E;  3G4S T;  4QQ6 A;  2X4J A;  2RK1 A;  1N5Z A;  2KYM A;  3I9Q A;  1WFW A;  2OTL Q;  2DK3 A;  3M4Y A;  3CQT A;  3KBG A;  4HCC A;  2YHT A;  2KNB B;  1H64 1;  4J9B A;  2MMP A;  2CKK A;  4OMP A;  3QXE B;  1BB9 A;  2DFU A;  1WX6 A;  2HQX A;  1HJD A;  2DIG A;  2HNI A;  2VWF A;  2EKH A;  1I1J A;  2EIF A;  8AT1 B;  1PSF A;  2JOY A;  2KAF A;  2B8A A;  1K8A C;  2E1H A;  4DBQ A;  4M75 B;  2GGR A;  2RHX A;  4M7D E;  1TU0 B;  2MAM A;  2KT1 A;  4J5Y A;  3M54 A;  1QWF A;  1PSE A;  1BI1 A;  2KXD A;  2RO0 A;  1K9M R;  3CCU Q;  1IZ6 A;  3MP6 A;  3QJY A;  3WVE B;  2KRO A;  4E6R A;  1NLP C;  3M56 A;  3HFO A;  1ZBX A;  1WPY A;  2YUN A;  1JEG A;  5GAM d;  5D6X A;  3RBB B;  3G7Z A;  2DD4 A;  2E12 A;  1KJW A;  3JCM f;  1G3S A;  1VQM Q;  3UA6 A;  4M7D B;  3L2Z A;  1WXT A;  3VS4 A;  3FRN A;  2CUD A;  1VQ6 A;  2ZCF B;  1W2B A;  3UA7 A;  2D8J A;  1CKA A;  1UFF A;  2K3B A;  3OSV A;  1VQ5 T;  1NEB A;  3M0Q A;  4LE9 A;  4KUD K;  2KRM A;  1K1Z A;  4KH0 B;  4CC4 B;  5FRO A;  4J8O A;  1QP3 A;  1OPK A;  3FDR A;  1B3Q A;  4Y91 A;  1Z9Q A;  1I07 A;  4II1 A;  2EGE A;  4QVD A;  2A7Y A;  1K9M C;  1BIA A;  4F7U E;  3CMA T;  4M77 G;  2CUB A;  2RHZ A;  3TRE A;  2K3X A;  5GJV B;  2EJG A;  1YJN T;  1VQN Q;  4XU2 A;  4PLI A;  1M1F A;  3LW5 E;  1UB4 A;  1X6G A;  2L3S A;  2CZ6 B;  2IIM A;  2KEA A;  1RI9 A;  2HQE A;  1ZUK A;  1R0C B;  4RTU A;  1IRX A;  4MMK A;  3VS3 A;  4PFP A;  2BE7 D;  2FVU A;  2K4Y A;  1WJQ A;  1ABQ A;  4XU0 A;  2L3R A;  5HCK A;  3OYH A;  1YJW T;  1LCK A;  4F7U B;  4EMK B;  3BDU A;  4J83 A;  2QA4 T;  1CSK A;  3ZBD A;  2J6K A;  2ZPB B;  4JZ4 A;  4GLM A;  2OI3 A;  3CC7 Q;  4BUG A;  2CH4 W;  2O4X B;  5FU6 C;  2M16 A;  1KK7 A;  3M55 A;  3JV3 A;  3CC4 A;  3CCL A;  2BE9 B;  1N6A A;  3E9G A;  4Z89 A;  1YFN A;  1V29 B;  1IB8 A;  2ZGW A;  3EG2 A;  1RAG B;  3SEM A;  4FYY B;  3NTK A;  4J9G A;  1WYX A;  5A0L A;  4HA8 A;  1IGQ A;  1YIT Q;  1SG5 A;  1WHG A;  2OX7 A;  4E47 A;  2YSQ A;  3VKI A;  1EZZ B;  2O01 E;  2AT1 B;  3E19 A;  3CCV A;  1G83 A;  3V7R A;  4A54 A;  2E4H A;  1LNX A;  2AZS A;  1KQ2 A;  3MEU A;  3HFN A;  1ZSZ B;  1U5S A;  1GRI A;  1RUW A;  1MV3 A;  3M0P A;  2CDT A;  3JCM d;  4L59 A;  3R6N A;  1U3O A;  1G2B A;  1QVP A;  2KK4 A;  3O8V A;  3JCM X;  1VQL A;  4PJO G;  2QGF B;  1BK2 A;  3L2W A;  3KXT A;  2I2L A;  4M75 A;  3CCE Q;  2K5I A;  1M1K U;  1AHJ B;  1EIF A;  2WSF E;  1NJI U;  4BDY A;  1K0X A;  2YWW A;  1Q7Y U;  3CCJ A;  2R5M A;  4JRQ A;  3DLM A;  1BCM A;  3OBY A;  1VYT A;  1XTD A;  2CSQ A;  2K7A A;  4RTV A;  1WQ7 A;  3QZ9 B;  3VV0 A;  1MHN A;  1MGQ A;  2BZY A;  1UJ0 A;  4ZN1 A;  3BFM A;  4IUP A;  2VGM A; 
#chains in the Genus database with same CATH homology
 3F70 A;  4C0D C;  3MP8 A;  4LDV A;  2ZPH B;  4M77 D;  5FRN A;  2X4W A;  2LQK A;  4O6J A;  5J3B A;  4FSX A;  3SD4 A;  2QI2 A;  1YIT T;  4M7A D;  3OYL A;  4M7D G;  2Y90 A;  1Q81 C;  5CQY A;  4ZTF A;  5GAN 5;  2EKO A;  1KG1 A;  4M7D A;  4M7D D;  4PKC C;  3S3M A;  2RK2 A;  1WQW A;  3P8D A;  2QQB A;  1I8F A;  2VXF A;  5I21 A;  1KC8 U;  3QJ6 A;  4OB0 B;  5A0G A;  4Z02 A;  4XU1 A;  3QYH B;  3HL8 A;  4M78 C;  4M7D F;  2K3Y A;  3QYG B;  3I55 A;  4ZGD B;  1Q86 C;  5GAN 8;  3MEW A;  2LRQ A;  4WF2 A;  3CXC S;  2EYQ A;  2ZPF B;  4CRI A;  2VGN A;  3GNG A;  3CCR A;  4C0G A;  2CGH A;  2RHI A;  3NTI A;  3OYE A;  2KVQ G;  3EFR A;  5M9O A;  1LOJ A;  2HBP A;  3CPW S;  4BE2 A;  3CXC A;  3QBY A;  2GF7 A;  1GXI E;  2CS7 A;  3LGL A;  3MCA B;  2XDP A;  2GFU A;  4N4H A;  3LX7 A;  1VQ7 A;  3V8K A;  3CPW A;  1VQK A;  4OB3 B;  1YHQ A;  4FIB A;  3HKS A;  2LT4 A;  3JCM W;  2RH2 A;  2MWP A;  2K2V A;  2YLC A;  3PMT A;  4ME7 A;  3RKX A;  3SFM A;  3GIB A;  2LTO A;  2X4X A;  4C92 G;  3FEO A;  4C5G A;  4NL3 A;  4GLK A;  3CBO A;  4A4F A;  4ZGJ B;  4Y28 E;  3QII A;  4BAC A;  4ZTJ A;  4NS5 A;  3QKJ A;  3UT1 A;  5FU7 B;  2EJ9 A;  4C92 A;  4C92 D;  4N4G A;  4IUR A;  1QVF S;  5CR2 A;  2EQU A;  3L1A A;  3JCM h;  3CCE T;  3Q1J A;  4KUL A;  1K8A U;  2M1H A;  4RKU E;  2FL7 A;  3LGF A;  3L2Q A;  1M4Z A;  3VJP A;  1I4K 1;  3OY9 A;  2DXB A;  2V8I A;  1NPP A;  5GAO p;  3OYF A;  4VUB A;  4C92 F;  1N27 A;  3PTA A;  2EJF A;  2YLB A;  2RJE A;  2OTL A;  1Y7X A;  1M9S A;  5CKD A;  4JS5 A;  4UC4 A;  5FLX E;  2EAY A;  5DM7 R;  4YTL A;  4BI3 A;  5GMK j;  2R57 A;  3ER0 A;  4EMK C;  2LCL A;  2V8J A;  4N4I A;  5CKB A;  4BI4 A;  3DLL A;  5LJ5 g;  2IVW A;  4F7U G;  2LVM A;  2M9U A;  1OZ2 A;  3MET A;  3OMG A;  5IAY A;  3M4G A;  3P8B B;  3QUI A;  3HPW A;  4EMK A;  4F7U A;  3CME T;  3LWH A;  2LQ8 A;  3PFS A;  2MWO A;  3LYI A;  4M77 E;  3OYG A;  1YJN A;  3CC2 A;  1KHC A;  5GMK e;  3OW2 S;  2DTI A;  3SWN A;  1M90 C;  4M7A E;  4EMH A;  2FB7 A;  3TEE A;  2K57 A;  4F7U F;  1VQ4 A;  3RES A;  1VQ9 T;  4QVC A;  5DY9 A;  4E7J A;  1YJ9 A;  3UWN A;  3JCM P;  2RB6 A;  2VYT A;  1XOV A;  1ZHI A;  2DVE A;  2QDY B;  1UEB A;  1X75 C;  1OZ3 A;  2FYK A;  5FU7 C;  3CCU A;  2CZ0 B;  2O4X A;  3PT9 A;  5HY6 A;  3CCS A;  3L42 A;  2E64 A;  2F5K A;  3NFC A;  3OYN A;  4J6W A;  5CKH A;  1VQO A;  5IT9 E;  3OS2 A;  4J7I A;  1IRE B;  3JCM Q;  3I55 T;  5IN1 A;  2RHY A;  2PVO B;  4LDW A;  2DD5 A;  3M57 A;  4JRP A;  1YJW A;  4OVA A;  1Y96 A;  5LJ3 e;  1I5L A;  3CCR T;  4XTX A;  4BB7 A;  1X01 A;  2PVD B;  4E7I A;  4NL2 A;  3L2U A;  2E6N A;  1Y71 A;  2QA4 A;  3JSC A;  4JJN K;  4E7L A;  3JRZ A;  4M77 B;  2X4Y A;  4OGC A;  3CPF A;  3VU3 C;  5GAN 6;  1WJR A;  5KE3 A;  2RD1 A;  4M7A B;  3OYA A;  1VQM A;  2QQ9 A;  3CEY A;  1YBY A;  3OQ5 A;  1BKB A;  2QQA A;  1BI2 A;  1VQK T;  3LH0 A;  3HRS A;  2DTH A;  4IUU A;  4MZM A;  3HRT A;  4C8Q G;  3A8M B;  5KCH A;  4JS4 A;  2JTM A;  1JB0 E;  4EDU A;  2MI6 A;  4C8Q A;  3PGG A;  4C8Q D;  5LJ5 d;  1D3B B;  4A53 A;  1O75 A;  2KDS A;  5GAM e;  5C0M A;  5LJ5 j;  5GAN f;  3CC4 T;  4FM4 B;  3CCL T;  3HP9 A;  1VIF A;  4FL6 A;  5HKC A;  2E5Q A;  1YI2 T;  3TU4 K;  2RI2 A;  2ZPG B;  2ZZD A;  3OS0 A;  1QW1 A;  5GMK l;  3JAM E;  1HK9 A;  2H3J A;  4C8Q F;  5GMK m;  5GAN 7;  4LD9 K;  3RUX A;  3WVD B;  3GP8 A;  4XTZ A;  3J81 E;  1JBM A;  4C0F A;  1B34 A;  1YIJ T;  2DZC A;  2EFI A;  4MML A;  2KMT A;  4OF1 A;  3URG A;  1OI1 A;  3I56 A;  2LT1 A;  1KD1 C;  1QVF A;  3AHU A;  5LJ5 e;  3ME9 A;  2L5Q A;  2OTL T;  2D6F A;  2X35 A;  2DXC A;  3C94 A;  4IUV A;  2QQS A;  1M1K C;  1XQH A;  3QHS A;  2D0Q B;  4RG8 A;  4X9D A;  3RMQ A;  4KT0 E;  4DOW A;  1NJI C;  3RER A;  4QVZ A;  3T9N A;  2DXT A;  2LNV A;  4IKF A;  1KQ1 A;  1RL2 A;  1Q7Y C;  4BE0 A;  3MEV A;  5L8R E;  1BI0 A;  5CCA A;  3OMC A;  4DQ2 A;  2JZ2 A;  3BDL A;  3OYI A;  2DJZ A;  1BI3 A;  3MEA A;  1Q86 U;  3J7A F;  4XAX B;  1WJS A;  1Y07 A;  4J6X A;  1W4S A;  3X20 B;  3CCV T;  1S72 A;  5GAN 4;  4BY6 B;  1FXX A;  1ZQ1 A;  3JB9 G;  3UPU A;  5KCO A;  1VQN A;  4M78 G;  2QEX T;  3C95 A;  4A4G A;  3ZEH A;  3JB9 D;  4M78 A;  3X28 B;  1VQ4 T;  2PU9 B;  4M78 D;  3CD6 A;  2BKD N;  3V8L A;  2P4T A;  5HK0 A;  4HKE A;  2D9T A;  4J6Y A;  2G3R A;  2K5L A;  4JUV A;  3RIR A;  3V8J A;  2XHC A;  5GAO n;  3G71 T;  3BY7 A;  4Q5W A;  5CVI A;  1VQ8 A;  4HT9 A;  2EQM A;  2RJD A;  3CCU T;  3CCS T;  2RI3 A;  3JB9 F;  1HXD A;  1UGP B;  1FWZ A;  3M53 A;  4JLI A;  2DEQ A;  4M78 F;  5LJ3 g;  1NE8 A;  2C06 A;  3X25 B;  3ZFJ A;  4EMG A;  1VQO T;  3OSS C;  3FIF A;  3OYK A;  3VUZ A;  4ZGE B;  3EAE A;  1JRI A;  1KC8 C;  2DIQ A;  3OA6 A;  2XK0 A;  4N0A C;  1VQL T;  3VYH B;  3OYB A;  2ZPI B;  1JJ2 S;  2JNG A;  2XI9 A;  2BIV A;  2DPP B;  3VYG A;  4CI0 C;  4PJO E;  1N8R U;  5LL6 S;  3N5B B;  3LWI A;  1JJ2 A;  1VQ5 A;  3OBW A;  2MF2 A;  2LC4 A;  4M75 E;  3G4S T;  4QQ6 A;  4ATO A;  2X4J A;  2R58 A;  5GAM g;  2QTX A;  2RK1 A;  3A5Z B;  4JDS A;  4X9C A;  3M59 A;  1G5V A;  2YRV A;  2DK3 A;  3M4Y A;  3KBG A;  4HCC A;  2YHT A;  2E70 A;  2DKG A;  3CCJ T;  1H64 1;  2IG0 A;  2MMP A;  2CKK A;  3G6E T;  4BDZ A;  3QXE B;  4JRI A;  3INZ A;  2CZ1 B;  2HQX A;  2RM4 A;  2QXF A;  2DIG A;  4O5V A;  4OGE A;  5CKE A;  2HNI A;  3OB9 A;  3CBP A;  3OYY A;  3CMA A;  1M1K U;  5GAN g;  2EIF A;  3FC3 A;  2OTJ A;  1PSF A;  2JOY A;  2KAF A;  5LJ5 h;  4RMO A;  5A2Q E;  2B8A A;  4XTV A;  2PVG B;  2WSE E;  4PJO B;  4C5E A;  1K8A C;  3KUF A;  2GQV A;  2E1H A;  3C12 A;  2DO3 A;  1XNI A;  4M75 B;  1YIT A;  1KHI A;  4C0Z A;  4FU6 A;  2RHX A;  4M7D E;  5LJ3 d;  1Q82 U;  2MAM A;  2P0Q A;  5D6W A;  5LJ3 j;  4J5Y A;  3M54 A;  1TH7 A;  1K73 U;  1PSE A;  1BI1 A;  2RO0 A;  4OP0 A;  1IZ6 A;  4KUI A;  3MP6 A;  3QJY A;  4MDW A;  4NOY A;  3WVE B;  4ELZ C;  3UDC A;  3JB9 I;  3OYM A;  1VUB A;  3M56 A;  5GAO q;  3HFO A;  1ZBX A;  1WPY A;  1BYM A;  2VUB A;  5GAM d;  4E7K A;  5D6X A;  5GAM j;  2NLU A;  3G7Z A;  2DXU A;  2DD4 A;  2E12 A;  2M0O A;  2DAQ A;  2RHU A;  4XTW A;  1VQ7 T;  3DB3 A;  3JCM f;  3P8H A;  1G3S A;  1YHQ T;  2KY9 A;  3OS5 A;  4D6W A;  4TVR A;  2WSC E;  3L2Z A;  3CCM A;  4M7D B;  2VC8 A;  5GAO l;  2XU8 A;  3JCM b;  2DZ9 A;  5GAO m;  2VXE A;  4GY5 A;  1W2B S;  2DTO A;  4PJO C;  3FRN A;  1FX7 A;  4C92 E;  1U1S A;  2AHJ B;  1LJO A;  3MHX A;  5CO7 A;  2ZCF B;  4M75 C;  3PIO A;  1VQ6 A;  1W2B A;  2LDM A;  5GAN j;  3WXM B;  1VQP A;  2V8K A;  3CBM A;  1VIE A;  3OSV A;  4L5G A;  3JCM c;  3BW1 A;  5C6S A;  5CAI A;  1NZ9 A;  4MZP A;  4EPC A;  3CCE A;  1VQ5 T;  4KUD K;  4X34 A;  4BD3 A;  1VQP T;  4V2S A;  2Y4Y A;  4RG2 A;  1Q81 U;  4QQD A;  5D6Y A;  4B9W A;  1KQS A;  3V7S A;  1H3Z A;  3JCM J;  3S6W A;  3OYD A;  5I2S A;  2EQJ A;  2CZ7 B;  5GAN e;  2VV5 A;  5FRO A;  2P0P A;  4J8O A;  3QDR B;  1BIB A;  4QQG A;  5CQX A;  4HT8 A;  1QP3 A;  5EG2 A;  2F5T X;  3FDR A;  4Y91 A;  3QG1 A;  3FLG A;  2HD0 A;  2JTF A;  4II1 A;  4FT2 A;  1G3Y A;  2A7Y A;  4M77 C;  4QVD A;  1K9M C;  1BIA A;  5FRM A;  2EQK A;  1OYX A;  3HHT B;  4F7U E;  5GMK i;  3CMA T;  4M77 G;  2RHZ A;  1UGR B;  2EWN A;  3TRE A;  3CME A;  2XD0 A;  3R6O A;  4ELY C;  2K3X A;  4C92 B;  2EJG A;  3GPL A;  4M7A C;  5GMK h;  4MDX A;  4J7F A;  5FU6 B;  4M7A G;  4M77 A;  1DJ7 B;  1YJN T;  3CC2 T;  1O9S A;  4XU2 A;  4PLI A;  1M1F A;  3LW5 E;  1UB4 A;  4M7D C;  3GNF B;  5CK9 A;  4M7A A;  2CZ6 B;  1G3T A;  1YJ9 T;  1VQ9 A;  4JRK A;  1U1T A;  2HQE A;  4A4H A;  4M77 F;  4XTU A;  2FHD A;  2R5A A;  4P5N A;  2PQW A;  4MMK A;  2HAX A;  3CCQ A;  2K4Y A;  2FVU A;  3A8O B;  2GFA A;  4IUQ A;  1WJQ A;  4M7A F;  2XDB A;  4XU0 A;  1D3B A;  3DB4 A;  2L3R A;  4BE1 A;  3S3N A;  2RJF A;  2ZPE B;  2KSS A;  1UGS B;  3A8H B;  3OYH A;  3GLX A;  4RCC A;  3NTH A;  3A8G B;  5LJ3 h;  2BUD A;  3QPH A;  1YJW T;  3L2V A;  5A0D A;  4F7U B;  4EMK B;  3BDU A;  4J83 A;  1RI0 A;  2QA4 T;  3ZBD A;  2XDD A;  3S3O A;  2ZPB B;  3L2R A;  3G4S A;  4N0A A;  3RKW A;  3SWN B;  1QVG S;  2KQW A;  3OYJ A;  1VQM T;  4ZN3 A;  3OYC A;  5KH6 A;  3JCM V;  5GAN 3;  2RA2 A;  1N9R A;  3PIP A;  3CC7 A;  3QSU A;  1QVG A;  3HSB A;  3CCM T;  3GF5 A;  2QQR A;  3X24 B;  4BY6 C;  4BUG A;  4C92 C;  4C8Q E;  5GAM h;  2O4X B;  5FU6 C;  1M5Q 1;  2XID A;  1G3W A;  3EFS A;  5GAO r;  3SB2 A;  2M16 A;  3JCM g;  3X26 B;  3GOX A;  4OB1 B;  4A4K A;  3M55 A;  5J26 A;  2JVV A;  3JB9 J;  3CC4 A;  4QW2 A;  3CCL A;  4BI8 B;  1VQ6 T;  1U8R A;  1N6A A;  1YI2 A;  2RJC A;  4KBM B;  3C4S A;  1P92 A;  2L89 A;  3E9G A;  2F69 A;  1SSF A;  2E10 A;  4HCB A;  1V29 B;  3OS1 A;  1M90 U;  1Y96 B;  2ZGW A;  2XG8 D;  3NTK A;  1N8R C;  3I56 T;  4C5I A;  5A0L A;  4XTY A;  5KE2 A;  5CIU A;  4B9X A;  4HA8 A;  4C5H A;  2PUK B;  5GAN h;  4IUT A;  2L8D A;  3ASK A;  3SDZ A;  2LCC A;  4R56 A;  3M9Q A;  2JUF A;  2RI5 A;  1YIJ A;  3KXT A;  4E47 A;  5J39 A;  1WNL A;  2A3L A;  4RCB A;  2CYZ B;  3VKI A;  4C8Q B;  4LDY A;  1X6O A;  4MZT A;  3SWN C;  2O01 E;  4XU3 A;  5AYF A;  4LDX A;  4XQ3 A;  3E19 A;  3CCV A;  3RKY A;  1S72 T;  3V7C A;  2LX9 A;  1YCY A;  3V7R A;  4A54 A;  1VQN T;  4DA4 A;  1LNX A;  3M58 A;  2QEX A;  1KQ2 A;  1WGS A;  3MEU A;  3PMI A;  4M78 E;  5HK3 A;  3CD6 T;  5LJ3 f;  1B34 B;  3HFN A;  2Y4X A;  3RMS A;  3OW2 A;  3MP1 A;  1I81 A;  1VQ8 T;  3G71 A;  3CCQ T;  2OAU A;  4E7H A;  4HCZ A;  2E41 A;  3QO3 A;  3TCJ A;  4R55 A;  4A4E A;  2XKO C;  4C0D B;  5DLO A;  1Q82 C;  3JCM d;  2E65 A;  4L59 A;  3PNW C;  2WAC A;  3H6Z A;  1K73 C;  4DOV A;  3FB9 A;  3VUB A;  1QVP A;  3DKM A;  5DLQ E;  2KK4 A;  3E1S A;  3LLR A;  3O8V A;  3JCM X;  1VQL A;  4PJO G;  3J80 E;  5GAM f;  5GAN d;  4OB2 B;  1M8V A;  3QZ5 B;  4PJO A;  4M75 G;  4PJO D;  4JLG A;  1KQS S;  1KD1 U;  3L2W A;  3H8Z A;  2K5F A;  4XK8 E;  3JCM e;  4FT4 A;  2I2L A;  3M5A A;  4M75 A;  2K5I A;  4PL6 A;  1R8O B;  4M75 D;  1M1G A;  1QP2 A;  1AHJ B;  3A8L B;  4M78 B;  1EIF A;  2PUO B;  2WSF E;  4C8Q C;  2P0K A;  1NJI U;  3JB9 H;  4LD6 A;  3CC7 T;  4OMF B;  4PJO F;  4BDY A;  2GCX A;  5LJ5 f;  5CKF A;  1Q7Y U;  4M75 F;  2XIC A;  3MO8 A;  3CCJ A;  2R5M A;  4JRQ A;  3DLM A;  1K9M U;  4PLL A;  3OBY A;  3G6E A;  1XTD A;  4LDU A;  5GAN 2;  3HRU A;  1N9S A;  1WQ7 A;  3QZ9 B;  3FJP A;  3E9F A;  1MHN A;  1UGQ B;  1MGQ A;  3VV0 A;  1NPR A;  4L6V 5;  4PNO A;  3BFM A;  4ZN1 A;  2OTJ T;  5I2M A;  4IUP A;  2E6Z A;  2JN0 A;  2VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...