1OZ2A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
324
structure length
324
Chain Sequence
b'ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 83
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A03
3LLRA 3MEAA 3PMTA 4QW2A 3FEOA 1OZ2A 4PLLA 2LDMA 2QQRA 2M0OA 4BACA 3QJ6A 2BUDA 4N4HA 3LGLA 4E7IA 5KH6A 4A4HA 1N27A 5C0MA 3OYEA 3MP1A 2G3RA 1OI1A 2RJDA 3OY9A 2L3RA 3KUFA 4UC4A 4ZTFA 4II1A 2RHYA 3OYLA 2MWPA 2RI3A 3NTHA 2RHIA 2L89A 3L42A 3OMCA 1WJSA 3H8ZA 3MEVA 2QQSA 3EAEA 2F5KA 3QBYA 4ZTJA 4E7JA 2JTFA 2CKKA 2GFUA 3MP8A 1G5VA 2D9TA 2LRQA 2R58A 1XNIA 2RJEA 4N4IA 3OYBA 2E6NA 2M16A 3DB3A 4A4FA 2RJCA 4A4GA 1SSFA 2DAQA 5D6YA 2EQUA 3LH0A 3LX7A 3OS1A 3MEUA 2DIQA 2RHXA 4BD3A 2EQJA 2O4XA 2RO0A 4QQDA 2EQKA 4PL6A 3PMIA 3OQ5A 3OYIA 3L2VA 4IUVA 2GFAA 4BDYA 2R5MA 2WACA 3OA6A 2X4YA 3NTIA 2E5QA 3PFSA 2RHZA 5M9OA 4E7LA 2XK0A 2MWOA 3GOXA 3M9QA 4BE0A 3SD4A 4Q5WA 3ASKA 5C6SA 3OYNA 3S6WA 1WJQA 4FU6A 5CIUA 2DIGA 4E7KA 4EDUA 2LCCA 2O4XB 3QIIA 2L8DA 5J39A 4LD6A 3C4SA 3O8VA 2K3YA 3FLGA 3FDRA 3ME9A 2PQWA 4C5HA 3LYIA 4Z02A 3E9FA 2HQXA 4HCZA 3MO8A 4L59A 3OYKA 4BDZA 2M1HA 5FRMA 3L2UA 2EFIA 1RI0A 3Q1JA 5J26A 2GF7A 3L2WA 2RI5A 4E7HA 4NS5A 4QVZA 4B9WA 2LVMA 2R57A 3H6ZA 3P8DA 2IG0A 2RHUA 2XDPA 4OVAA 3UT1A 4C5GA 3LGFA 4CRIA 3OYJA 2NLUA 4IUUA 2VYTA 4QQGA 1OYXA 2BIVA 2LTOA 2X4WA 3FC3A 1KHCA 2X35A 3NTKA 4BE1A 2P0KA 3BDLA 4PLIA 4BE2A 3OYGA 2HQEA 2EKOA 3L2RA 5FRNA 4X34A 2RJFA 5KCOA 2R5AA 3S3MA 3MP6A 5KE3A 3OYFA 2B8AA 2YRVA 3S3OA 4IUTA 5D6WA 3L2QA 4FL6A 3UWNA 4C5EA 5IAYA 4GY5A 5KCHA 3OS2A 3OYDA 3DB4A 5KE2A 2JZ2A 1WGSA 4IURA 3CEYA 3F70A 4IUPA 3OYCA 4C5IA 4IUQA 3PNWC 2BKDN 4B9XA 2K3XA 2X4XA 2EQMA 5D6XA 3OYMA 4N4GA 3MEWA 4RG2A 3OS0A 3DLMA 4IKFA 3OYHA 3S3NA 4QQ6A 2RI2A 3E9GA 1H3ZA 5IN1A 1OZ3A 3ZEHA 3OMGA 3QKJA 5FROA 4A4EA 1WJRA 3OYAA 2FHDA 3OB9A 3P8HA 3META 1MHNA
chains in the Genus database with same CATH superfamily
3LLRA 1SRMA 3OSVA 4KGVB 1WHHA 1VQ7A 3CQTA 4ELZC 2RI3A 4FT2A 4OB0B 1ABQA 1PKSA 4D8DA 3HSBA 3V8KA 5DY9A 1SHGA 4PJOB 2LNVA 1VQKA 2M02A 4AFZC 2E6NA 2E5KA 1K1ZA 4JJCA 4M78D 5IHIA 2QA4Q 1WFWA 3CPWA 4CC3A 1RABB 4MDXA 4J7FA 2LCSA 5GAMf 4JJDA 4AG1C 1NBEB 2E5QA 1K8AR 4ATOA 4E47A 2LX9A 2DMOA 4BE0A 2KDSA 1QVFS 4XU0A 2K79A 2V8IA 1QMCA 3RKYA 1TOVA 4CI0C 1AEYA 3KFVA 5LJ3f 4C92F 1BYMA 3FLGA 1QCFA 2YWWA 5LJ5e 3VU3C 4C8QF 1RLQC 2FZGB 4QVZA 2CP5A 4X9DA 4E7ZA 5KYUB 4F17A 3FIFA 3JCMV 4M77E 3M0TA 2ESWA 2PVDB 2COYA 2YLCA 4QQGA 5A0DA 1VQPT 2JS0A 4C92B 4FW2A 1U5SA 3MKDA 1QVGA 2LC4A 5GAN8 4HVWA 3CCRA 4FL6A 4R56A 4PFPA 4C8QB 4XTYA 1WGSA 3PNWC 1NE8A 2VASA 2VB6A 2OTLQ 3AHUA 3QHSA 3C94A 1BBZA 4M4ZA 4QQ6A 3RDVA 3HL8A 3OMGA 3OYAA 1NG2A 5KYYB 2VC8A 4ZN3A 4QW2A 4OGCA 4M7DC 1FMKA 1OZ2A 2A37A 5GAMh 1BIAA 3CCUT 4GBQA 1AT1B 1WQ7A 1NJIR 1SSHA 2C0TA 2ZPGB 2DJQA 1WDXA 1Q81U 1M30A 3JB9H 3EAEA 1UGQB 4XK8E 1ACMB 1K73U 5LJ3h 1XNIA 2JJ9A 1I5OB 1YI2T 3M55A 4HCCA 2RHXA 1HD3A 3JCMf 2HSEB 1WYXA 3I56Q 2E1HA 2KRSA 2MI6A 2LJ3A 2CDTA 1M2VA 3PFSA 2L0AA 1Z9ZA 3THKA 3EG9B 3JB9D 2I2LA 5GANh 3H0IA 1JXOA 4X1VA 2KRNA 1VQPA 3J81E 1X75C 3A8LB 2DE0X 3LYIA 4EMKB 2FL7A 2KROA 4FW1A 3M4YA 4WTOB 1G2BA 1W2BP 1QW1A 2EGEA 2A0FB 3CCVT 2EW3A 2LVMA 4DBRA 3EH1A 5HK0A 1AD5A 2XG8D 1D09B 1JEGA 3BY7A 3H0HA 2V8KA 2LTOA 2O88A 5GMKm 4XU2A 4DOVA 4BB7A 1RAFB 3DKMA 4KBMB 3SB2A 1D0ZA 3L2QA 1TS9A 3D7SB 1BI3A 4BI3A 1VYVA 1VQOT 3A1PA 4M7AF 1X6GA 2VXEA 1IRXA 4P5NA 1TWBA 3EFRA 1WIEA 3OYYA 3CXCS 4AT1B 3C0CA 1PD0A 1W4SA 2LQWA 4D6WA 4PJLA 3E9GA 2QTVA 1BIBA 4OMMA 5FROA 2C0IA 5GMKh 5GAOr 5GMKl 2LNHB 2YRCA 4IIOA 2K5FA 3JCMh 1H92A 1YJWQ 1YI2A 4M77C 4KH0B 5GAMj 4M7AB 1KFZA 3OYLA 4RTUA 4BY6B 1KHIA 3V8LA 1OPKA 3KBGA 1U1SA 1JJ2P 3EGXA 1GXIE 1SHFA 1TU0B 3JV3A 3OYBA 1QKXA 1M3CA 2M16A 5LJ3j 1ZUUA 2DIQA 3CC7T 3CBPA 2NUTA 1Q81C 3VS4A 1MNEA 2K7AA 1G83A 2JS2A 3CMAQ 2R5MA 3E19A 3RR6A 1KIKA 3REAB 2J6KA 1Q82R 3CCVA 1GFCA 5CIUA 5FLXE 1M90R 2IVWA 4C0DC 3UATA 2L8DA 5J39A 3TQ7P 3O8VA 2EAYA 2HQXA 5GAN6 3JCMQ 3OYKA 1BB9A 2XD0A 1MUZA 2DL5A 5IHNA 5FRMA 3L2UA 1KK7A 1NLPC 2VV5A 3UA6A 2ZPEB 3L2WA 1VQOA 2IG0A 2NLUA 2XHCA 2VYTA 2J6OA 2JT4A 1UTIA 2DM1A 1KHCA 3SHWA 2KAFA 5KCOA 3S3MA 4F04B 1D0XA 5KE3A 3CBMA 2BE7D 4MZMA 2YUNA 1ABOA 3VRYA 5KE2A 2L5QA 4C5IA 2P84A 1HYOA 1WHMA 1J3TA 4RTTA 3VS2A 1WXBA 3M5AA 2ABLA 3AT1B 2FRWA 5FU6C 2DNUA 4ZN1A 3PMTA 4ZNXA 4C0GA 1X69A 2M0OA 1UB4A 5HKCA 5LJ5f 3I55T 2HL3A 3VS6A 5C0MA 4PJNA 2RJDA 4QVCA 3CC7A 5FWBA 2FPFA 4NL3A 5L8RE 4L5GA 2HAXA 2IPOB 2F5KA 2L3SA 1YCSB 2DTOA 3OW2S 1I5LA 3HKSA 2P0QA 1RAHB 2DAQA 3LH0A 1VA7A 3RERA 1FWZA 1X27A 2JTMA 3G1JA 2KEAA 2QGFB 1IO6A 2CZ1B 2PNIA 3FJ5A 3KXTA 2O2OA 4DBHA 1U06A 1PSFA 1QP2A 4CC2A 2DX1A 1D0YA 2NUPA 2OTLT 1WNLA 2QG9B 1M2VB 3UDCA 4HCZA 3MO8A 3N5BB 4BDZA 4C0FA 2DETA 2Y90A 2KBTA 1Z9QA 2GF7A 3CMET 4KGZB 2ZPHB 4LDXA 2KMTA 2DRMA 3LGFA 5GANe 2HL5C 1ZX6A 3OW2A 3JB9J 1QWFA 1GCQA 4F7UA 1YITQ 1KQ2A 4JZ4A 3A8GB 3QDFA 4Y28E 1EZZB 1M1GA 2EPDA 2J06A 3G4SQ 3S3OA 4IUTA 4E7SA 1YIJQ 5IAYA 1SRLA 4M75G 3JCMb 5CAIA 3I55A 3VYHB 2D0QB 3JCMc 4J6XA 3I56T 3TU4K 4HT9A 2F5TX 1H3ZA 1Q82C 4C92E 1M90C 2QYZA 1XQHA 4HVVA 4RUGA 5CKBA 2JVVA 2LJ0A 2OTJQ 3EFSA 4QT7A 1QKWA 2RHYA 2CUBA 5LJ5g 4R55A 1OQKA 4JRQA 3H8ZA 3MEVA 3EHRA 2A08A 2KT1A 2XU8A 4OF1A 4RG8A 5GMKe 1ZLMA 4N4IA 2CSQA 2Z0WA 3I5RA 1SSFA 1K76A 4PFOA 3QO3A 3CD6Q 3VUBA 2RM4A 2OTLA 2EQKA 3PMIA 1RAEB 2K4YA 2YLBA 3SDZA 3EGXB 3NTIA 4F16A 4JS4A 2D8JA 2HZYA 1U3OA 4E7LA 1TSFA 3CCJT 1K9MR 2E70A 1N8RR 3CMEA 1M4ZA 4J9CA 1O9SA 4E7KA 1VQ9T 1K0SA 2CZ0B 5AYFA 4R0KA 2NUTB 1YWOA 2XDBA 3TSZA 2X51A 4C5HA 5I22A 2B86A 2NYSA 1H641 3GPLA 5LJ5d 3PE0A 3GNFB 4MMKA 2KYBA 3G71Q 4M7DD 1RADB 1U8RA 2RK1A 3PVLA 1VQLT 3UPUA 2DTHA 2OI3A 3VV0A 3I56A 2MF2A 3NHNA 3QXEB 5AT1B 2R5AA 1ARKA 3QJYA 3MJXA 2A28A 2PTKA 3OYCA 1ZBXA 1M8MA 3G7ZA 2M9UA 5GJWB 1UFFA 3CMAT 3DLMA 4IKFA 4RMOA 1UGPB 2ZGWA 4M7DA 3VS5A 2FRYA 2EJ9A 1PNJA 1MMNA 2RA2A 4E7IA 4A4HA 1OI1A 2DEUA 2DKGA 2CP2A 2MWPA 2PUKB 4JS5A 1H8KA 1WA7A 1DJ7B 1S72T 2L89A 3UA7A 2P4RA 2RQRA 2JTFA 5CCAA 1W1FA 2ZAEA 3MP8A 1ZBJA 2R58A 2DJZA 4BUGA 2HMAA 4J6YA 3VRZA 2DVEA 1VQ9A 2OX7A 5I21A 1QCOA 1IGQA 1VQNQ 3ZFJA 1UGVA 3OQ5A 1EIFA 2CYZB 2EYWA 3CCST 1OU8A 2LJ1A 4C92C 1BK2A 1ZUKA 5GAN4 1B3QA 2KQWA 1ZUYA 1PHTA 1AVZC 1VQLA 3V7CA 2E65A 3H9NA 2RNAA 4IIMA 8ATCB 1V1CA 1IREB 4E7HA 4B9WA 4F7UF 4LD9K 3QG1A 4M77D 2NUPB 4RCBA 4IUUA 1Q7YR 2EIFA 1X2QA 1M9SA 2X4WA 3OBYA 3CMAA 3BDLA 1VQ5Q 4BE2A 3H0FA 4AG2C 1X6BA 4AFSC 4RTVA 2F69A 2K2MA 3EFOA 3X28B 3OYFA 4C5EA 3J80E 3GLXA 4VUBA 2EWNA 1YHQT 2GQIA 4M78A 2CGHA 2HQHA 1Y71A 1M1KR 4F7UB 1S72A 1HK9A 1K9MC 1N8RC 4A4EA 1JXMA 2FHDA 4M77A 3V7SA 2DXTA 4XTVA 2RK2A 4ORZA 4PLLA 1N5ZA 3QJ6A 2BUDA 2HKNA 2KNBB 1TUDA 3OY9A 1SEMA 5IT9E 1D1CA 1D3BA 1SKUB 3CCMT 3L42A 3CCSA 2QQSA 1RI9A 3E1SA 1QVFA 1XOVA 2DVJA 4PJOG 2DXBA 2HBPA 5FU7C 3M56A 4DBFA 4RTYA 1NLOC 5CKHA 3JRZA 4LDYA 4M75E 1GBRA 2HSPA 4HXJA 4O6JA 2EYYA 4HA8A 2EGAA 1E6GA 1AZEA 4ELYC 1E7OA 3X20B 2DLPA 2DXUA 3OBWA 2MYSA 4FU6A 3QYGB 1BI2A 4KH1B 1M8VA 3E2UA 1G3TA 1BCMA 2A3LA 1XTDA 2H3EB 2K3YA 2XKOC 3E9FA 2YSQA 1S1NA 1W6XA 4K11A 3Q1JA 1TH7A 2JMAA 5A2QE 2YUPA 1IGUA 4OVAA 1YHQA 4V2SA 1QQJA 2K2VA 2KE9A 5GAOp 4PJMA 3RMSA 3FC3A 2QQBA 2CP6A 3RMQA 1VQ6T 7AT1B 4PLIA 1NJIU 4C92G 1ZSZA 5D6WA 2L3PA 3P8BB 2RPNA 1YJ9Q 3G6EQ 2JZ2A 4C8QG 1I1JA 1W70A 3CD6T 1OULA 4DEXA 4M7DF 4HVUA 5GAOq 1X43A 3OYMA 4N4GA 3GNGA 3CCMA 4XQ3A 2GBQA 5KYWA 2K9GA 5CR2A 3NGPA 2FZCB 3VS3A 2O9SA 2VUBA 3CCEQ 2DZ9A 1WQWA 3LGLA 4J5YA 2G3RA 2WSFE 1SG5A 5ECAA 4E6RA 3INZA 1KQSS 2LQ8A 4M7DB 1ZA1B 4E7JA 1K8AC 1VQ8Q 1HXDA 1Y0MA 2GFUA 2D9TA 3HHTB 4TVRA 1M27C 3G71T 1UJYA 1Y7XA 3GBQA 1Q7YC 4KUIA 3URGA 3VS1A 3LWIA 3LX7A 5GANg 2PUOB 1K0XA 1M3BA 3VYGA 1PCXA 3VKIA 5GAN5 2DO3A 2AKKA 3M0QA 1VQ7Q 4A54A 2X9HA 2ZPFB 2D6FA 3HFOA 1V76A 2BZ8A 4Y92A 1M1KC 3X25B 2OTJA 4FYWB 4HCKA 3X24B 1VQ6A 2L2PA 2YUQA 1VQMQ 3A98A 3QZ5B 2EKHA 4AMCA 4OP0A 5LL6S 2P4TA 2R57A 4C5GA 4ZGEB 1MMAA 4JDSA 3CD6A 3CXCA 1WX6A 4M75C 4ME7A 1HJDA 4FIBA 2RMOA 2QGGA 4JRKA 3PTAA 3CCQT 4M78F 4L6V5 3CC2T 4ZGDB 1KD1R 2BKDN 1RL2A 2JM9A 3JCMJ 2K3XA 1VQNT 4M77F 1NJIC 2VGNA 3SWNC 3OS0A 2KYMA 2ZPIB 1WXTA 4KULA 3EFOB 1BKBA 1UE9A 3EG1A 1PM3A 1X2KA 3X26B 2ROTA 3G71A 1LNXA 3LWHA 1QWEA 2XDDA 4M78B 5GMKi 2JUFA 3HTRA 1YWPA 3OYEA 1Q82U 4UC4A 1M90U 4M7AG 2C0OA 5GAOm 3CPWP 3QWYA 2QAZA 3CCRQ 2QA4T 3OMCA 4M77B 4KT0E 1FX7A 2X4JA 2QK0A 2H3JA 3OS1A 3M0PA 3LH5A 2O4XA 1D3BB 3TVTA 2KVQG 1H3HA 1VQ5T 2SRCA 1I0CA 2WSEE 1CKAA 2CSIA 5GAOl 3ASKA 1UHCA 1KC8R 3VJPA 4Z89A 4RKUE 1MV0B 2EVRA 1WPYA 4LD6A 3M4GA 1R0CB 1NPPA 4ANJA 2FPDA 5GAMe 3ZBDA 4RTWA 1TXQA 4DQ2A 4J9GA 2KXCA 1JRIA 4LNPA 3CCQA 1VYTA 3MCAB 1QVGP 1Q86R 3CC2A 5FW9A 2GTJA 4Y91A 1WI7A 4EPCA 5LJ3e 1VQNA 4PJOE 4JJNK 4J8OA 2ED1A 1VYUA 1QVFP 3OYGA 3L2RA 5FRNA 1PC0A 3A5ZB 1V29B 2B8AA 2VVKA 5L23A 2P0PA 4GY5A 4C0ZA 2RN8A 1VQPQ 3EGDA 4IUPA 1OX8A 2FYKA 4YTLA 4DEYA 1G8XA 2CS7A 4A63B 3BW1A 4RCCA 2VXFA 3MEWA 2QA4A 3JB9F 1MGQA 2RI2A 3JSCA 1ZSZB 1OZ3A 2QDLA 3P8HA 3C12A 2EGCA 1D1BA 3FEOA 5LJ5h 2QQRA 3RBBB 1R0BG 3MP1A 5GAN2 2KXDA 2QEXQ 4ZTFA 5FU6B 1R8OB 1TUCA 2YT6A 1VIFA 1VQ5A 5KYWB 4WF2A 3CCUQ 2LRQA 2FG0A 2RH2A 2HKQB 3DB3A 4N0AC 2RJCA 2EYXA 3T9NA 3JAME 3A8HB 1W2BS 3FRNA 2COWA 3NMZC 4C8QE 1NEGA 1KSWA 2HCKA 2GFAA 2WACA 1PRLC 1KD1C 2XK0A 3GOXA 1YI2Q 4HCBA 2QTXA 4Q5WA 5C6SA 2LQNA 2FO0A 2CH4W 2FPEA 4PNOA 4XU1A 4LDUA 2FVUA 3JCMe 1PD1A 3FDRA 1VQ4Q 2COZA 1LPLA 1LOJA 2G6FX 2OAUA 3VS7A 3RIRA 2J05A 1MMGA 3PT9A 5GAN3 3PIPA 2CREA 2LT4A 3OYJA 1JB0E 1OYXA 5HY6A 1K9AA 3TREA 2RQUA 2KRMA 1WXUA 4MZTA 2HQEA 2E64A 1UG1A 2FZKB 1E6HA 2QI2A 2YRDA 4CC7A 4A4KA 4IURA 1JJ2S 1EX4A 1M2OA 2ATCB 4JZ3A 1YJWT 1BU1A 4GLKA 3I35A 3M0UA 4OMFB 5KYXA 1GFDA 2KR3A 5CKDA 1Y96A 2QQ9A 1KC8C 3V8JA 3UF4A 3FB9A 2JW4A 2O9VA 1K9MU 5LJ5j 5KH6A 1N8RU 4PJOC 5CO7A 3M59A 3JCMX 3M54A 3FJPA 2NWMA 1VQMT 1WJSA 2CZ6B 4J9EA 5FWCA 3G6EA 4OB2B 3CXCP 4ZGJB 5GAOn 4OGEA 4Z8AA 2KY9A 4LUEA 1OOTA 4QQDA 1C1AA 3OS5A 2QXFA 1OPLA 3OYIA 2JMCA 1JJ2A 1FMVA 1NM7A 3GP8A 2E3IA 2K5IA 1SF9A 4FSSA 1WJQA 1YNZA 1GRIA 2DPPB 2O4XB 1NEBA 2LQKA 1PWTA 1YN8A 3NFCA 2PQWA 2HBWA 1GCQC 2KT8A 2IIMA 2RF0A 4DA4A 1MNDA 2D0NA 4AFUC 4M7AE 4EMGA 1VIEA 1RACB 2CZ7B 2F2VA 3CPFA 4QKUA 1YJWA 4C8QC 2C06A 4JLIA 2X35A 2E3HA 2LT1A 4BE1A 2V8JA 1QLYA 2DD5A 2RJFA 2QASA 3ER0A 2M0YA 2LZ6B 3EH2A 2CP0A 3F70A 3CC4Q 2JTEA 1PSEA 5GAN7 1AWJA 2KGTA 4B9XA 1UDLA 3M53A 1A0NB 1VQMA 3ZEHA 3QKJA 1WJRA 1QVGS 3EGDB 4BDYA 5J3BA 2GTOA 4FCYA 2GCXA 3QYHB 2RQVA 2L3RA 1IHVA 2DXCA 2O31A 4DBQA 1OEBA 1IHWA 3NTHA 3WVDB 3QPHA 4Z88A 2RD1A 2EYQA 3I55Q 4NOYA 4RTZA 2O01E 2MCNA 2QDYB 1Q95G 4DOWA 1MMDA 4PFZA 1AWXA 3SFMA 4J9FA 3BDUA 4M78E 1FYNA 1PG5B 4M75D 1K8AU 1M3AA 1Q7YU 2AZSA 2JXBA 1OV3A 3OA6A 1VOMA 3M9QA 4BI8B 4OMQA 2WSCE 2V26A 1WHLA 4EMKC 1IXDA 1OX9A 4PKCC 4XAXB 1YCYA 3QIIA 5GANf 3C95A 1QCNA 3R6NA 1Q81R 1WHKA 2DF6A 3RKWA 1NZ9A 3PIOA 3OW2P 2DEQA 3CCLQ 1K73R 4FM4B 3EHQA 2DL3A 3M57A 1M1KU 2EFIA 1YITT 3QWXX 3U23A 1GCPA 4KUDK 1I8FA 1Y57A 2K57A 2CP3A 4M75A 3TCJA 2XDPA 3G4ST 1YIJT 1UHFA 2BZXA 2OJ2A 2QEXT 4O5VA 2GGRA 5EG2A 5HK3A 2ZZDA 2NUZA 3CMEQ 5DM7R 1WHGA 1VUBA 4KGXB 2XICA 1AWOA 4JLGA 2K6DA 5KYNA 3CEYA 4IUQA 3SWNA 4J9IA 2LMJA 2X4XA 2Y4XA 3M58A 4F7UG 4LXCA 2OTJT 3S3NA 2DBKA 5IN1A 1I81A 4M7AC 1O75A 3BFMA 4FSXA 2JN0A 4BY6C 1MHNA 2KSSA 1PKTA 4N4HA 4PJJA 2AHJB 8AT1B 4II1A 1IB8A 5KYXB 1VQ4T 5GAMg 1UUEA 1Y96B 4JPBW 1I07A 2CKKA 2MIOA 2RJEA 2AZVA 5D6YA 4OMOA 1GBQA 4FYVB 2H8HA 2MK5A 5A0LA 5LJ3g 3HPWA 3EGUA 2W10A 5FU7B 2XMFA 4RTXA 1I4K1 2ECZA 2RHZA 5M9OA 1M1FA 3VUZA 1EFNA 1YITA 3SD4A 1B34A 3S6WA 3MHXA 4E2FB 3G4SA 1YIJA 3TSWA 2QEXA 1PRMC 1YJNQ 2DL7A 3ME9A 1GL5A 2I0NA 4LUDA 4Z02A 3CCJQ 4L59A 4OMNA 1QVPA 2PU9B 1NYGA 5GAMd 1VQ9Q 4LN2A 1UGRB 1LCKA 3CCUA 2V1QA 3OSSC 1N9SA 2L3QA 4FYXB 4J83A 2RHUA 4X9CA 3UT1A 5EC7A 3HFNA 4M78C 1OU9A 1MV3A 1N6AA 3GIBA 5LJ3d 2ZCFB 4JRPA 4JJBA 2J6FA 2X3WD 2YRVA 3EG2A 2DERA 3OS2A 1VQKQ 4OB1B 2Y4YA 1VQLQ 1T3SA 1UGSB 1KQSA 2CT4A 1VQ4A 5GJVB 3M0RA 2AK5A 1M5Q1 4CC4B 2E6ZA 1WLPB 5GANd 2VWFA 1YP5A 2EBPA 2KK4A 3MEAA 1G3YA 5IHKA 1ZSGA 2E10A 2EJFA 4BACA 2BE9B 1N27A 1TG0A 2X3XD 3JCMg 1K73C 1P92A 1AHJB 2YXYA 4ESRA 2RHIA 4XTUA 4M7DG 4N0AA 4ZTJA 1K4US 3A8OB 5GANj 1RAAB 4A4FA 4WCIA 5IXFA 1KG1A 1S72Q 2RQTA 2V1RA 1BCOA 2DD4A 2YHTA 1RAGB 3HRSA 2XIDA 3RKXA 2YDLA 4IUVA 2X4YA 4JRIA 2RQWA 4J7IA 1KQ1A 3BE3A 2ZPBB 3CBOA 4XTZA 2OAWA 2GNCA 1FMWA 3CC4T 5IXBA 4D8KA 4LDVA 2HEQA 3CCSQ 1KD1U 3O5ZA 1TUGB 1D1AA 4FT4A 3A8MB 4M75F 3JCMd 3DLLA 2M1HA 2DILA 2W0ZA 5CKFA 1ZSZC 2DZCA 2ENMA 3RUXA 2DL8A 2HNIA 4NS5A 4GLMA 4EIKA 4CRIA 2A7YA 4PJOD 3NTKA 2SEMA 5GMKj 3JCMP 4XTWA 4X34A 4AFQC 4B6MA 1X6OA 4PK4A 4M75B 2D8HA 4C0DB 2EQIA 2MAMA 2DRKA 1N9RA 3ZL7C 1ZA2B 2AKLA 3I5SA 1T0JA 1LJOA 2JOYA 3L1AA 1YBYA 1YHQQ 3QDRB 1NPRA 4PJOA 2DL4A 2M51A 1TTHB 3PVQA 3SWNB 4XU3A 4A53A 3V7RA 4M78G 4LE9A 3RNJA 4EMHA 2F1LA 1KC8U 3ULRB 3CCLT 2PZ1A 4HKEA 6AT1B 3QBYA 1QP3A 3M0SA 4M77G 2A36A 5D7UA 1R77A 4A4GA 1UJ0A 4C92D 1C6VX 3CC4A 4JUVA 1Q86U 2VKNA 3CCMQ 2RO0A 3HP9A 4C8QD 3LW5E 1JBMA 1C0MA 2CUDA 2KI7A 3I9QA 2D1XA 4F7UE 3OYNA 1Y07A 1YFNA 2DIGA 4EDUA 5I11A 1G3WA 5KYUA 2LCLA 4J6WA 5CQXA 1FXXA 2FEIA 1BI0A 3QUIA 1AOJA 2QQAA 1ZHIA 3R6OA 4C92A 5J26A 1RI0A 4MDWA 1B34B 2RI5A 2ED0A 1U1TA 4C8QA 3H6ZA 3P8DA 1BI1A 1YJ9T 3QSUA 2PVGB 1HSQA 3EG3A 3G6ET 2DA9A 3PGGA 2P0KA 2DYIA 2LP5A 3NPFA 3UWNA 5KCHA 2RB6A 3EG0A 1LVKA 1XJWB 5KYYA 4OB3B 2DFUA 5DLQE 1T0HA 2BZYA 1VQ6Q 3VS0A 3CCET 5D6XA 3HRUA 4OMPA 4QVDA 3CCLA 3OYHA 3REBB 3H41A 1IZ6A 1ZQ1A 5CQYA 3OB9A 4F14A 2F2XA 3META 2YUOA 3CCVQ 1W2BA 2LDMA 4OMLA 1RUWA 4FYYB 1VQ8T 3HRTA 3TEEA 3KUFA 5CKEA 3JB9I 1YJNT 2E4HA 1X01A 2DTIA 4HT8A 2EJGA 4J9HA 1SPKA 4MZPA 2DK3A 1G5VA 1VQOQ 2VGMA 3JB9G 3EG9A 1JQQA 2EQUA 1JU5C 5HCKA 1WZOA 1JO8A 3MEUA 1VQ7T 2JNGA 4BD3A 5DLOA 2EQJA 3MPUB 2E41A 4PL6A 1CKBA 3L2VA 2MPXC 4EMKA 5A0GA 2BTTA 2MWOA 1VQKT 1KJWA 5CK9A 1RAIB 4NL2A 5CVIA 1Q86C 3WXMB 3SEMA 1CSKA 3J7AF 1B7TA 2LCCA 1KQSP 2DYBA 2PVOB 3WVEB 1YJ9A 2K5LA 3C4SA 4BI4A 3GF5A 1UEBA 3L2ZA 2FB7A 2MMPA 2ROLA 2HDAA 3JCMW 4M7AD 2AIRB 3IQLA 2LX7A 2CT3A 2E12A 1G3SA 3QZ9B 4M7DE 1B07A 5I2MA 4XTXA 2J7IA 4J9DA 4MMLA 3CCEA 2BIVA 3CC7Q 2F2WA 2MOXA 2HD0A 5IH2A 1AWWA 1AZGB 2AT1B 2EKOA 2XI9A 3CPWS 3MP6A 4KRTA 1RLPC 1T3LA 2EYZA 2DBMA 4J9BA 3OYDA 1NYFA 1F1BB 2CH4A 3DB4A 9ATCB 1UECA 1VQ8A 3RESA 2EQMA 1YJNA 3CCQQ 4M7AA 4PJOF 4RG2A 3CCJA 1WHJA 3CC2Q 2CP7A 2K3BA 4LDWA 2JM8A 2GQVA 3CCRT 5I2SA
chains in the Genus database with same CATH topology
1XQHA 3LLRA 3G71A 1LNXA 2KSSA 3LWHA 2XDDA 3OSVA 4M78B 4N4HA 5CKBA 5GMKi 2JUFA 2AHJB 1VQ7A 2JVVA 3OYEA 3EFSA 4ELZC 1Q82U 4UC4A 4II1A 2RHYA 1M90U 4M7AG 5GAOm 2RI3A 4FT2A 5LJ5g 1VQ4T 4OB0B 5GAMg 4M7DC 4R55A 2QA4T 3OMCA 4JRQA 3HSBA 3H8ZA 3MEVA 1Y96B 3V8KA 5DY9A 4M77B 2XU8A 4OF1A 4KT0E 4RG8A 4PJOB 2CKKA 2LNVA 5GMKe 1FX7A 2X4JA 4N4IA 1VQKA 2RJEA 2H3JA 2E6NA 1SSFA 5D6YA 1VQ7T 3QO3A 3OS1A 4M78D 5A0LA 5LJ3g 3VUBA 2O4XA 2RM4A 3CPWA 2OTLA 2EQKA 1D3BB 3HPWA 3PMIA 4MDXA 4J7FA 5GAMf 2KVQG 2K4YA 5FU7B 2YLBA 3SDZA 1VQ5T 4JS4A 3NTIA 1I4K1 2E5QA 2WSEE 2RHZA 4E47A 5M9OA 1M1FA 4E7LA 3VUZA 4ATOA 2LX9A 5GAOl 3CCJT 4BE0A 1YITA 2E70A 2KDSA 3SD4A 3ASKA 1B34A 1QVFS 4XU0A 3CMEA 1M4ZA 3S6WA 1O9SA 3MHXA 2V8IA 4E7KA 3RKYA 3VJPA 3G4SA 4RKUE 4CI0C 1VQ9T 1YIJA 2CZ0B 5AYFA 5LJ3f 2QEXA 1WPYA 4LD6A 4C92F 3M4GA 2XDBA 1BYMA 1NPPA 3FLGA 3ME9A 5LJ5e 4C5HA 5GAMe 4Z02A 3ZBDA 3VU3C 4L59A 1H641 4C8QF 4DQ2A 1QVPA 3GPLA 1JRIA 2PU9B 5LJ5d 3CCQA 5GAMd 1UGRB 3MCAB 3CCUA 3GNFB 4MMKA 3CC2A 3OSSC 1N9SA 4QVZA 4M7DD 4X9DA 4J83A 2RHUA 4X9CA 3UT1A 1U8RA 2RK1A 4Y91A 3HFNA 3FIFA 4EPCA 3JCMV 4M78C 4M77E 5LJ3e 3UPUA 2DTHA 2PVDB 2YLCA 4QQGA 5A0DA 1VQPT 1VQLT 1VQNA 3VV0A 4PJOE 3I56A 4JJNK 1N6AA 2MF2A 3GIBA 4J8OA 5LJ3d 3QXEB 4C92B 3OYGA 3L2RA 5FRNA 2ZCFB 2R5AA 3A5ZB 1QVGA 4JRPA 1V29B 2B8AA 2YRVA 2LC4A 5GAN8 3CCRA 4FL6A 2P0PA 4R56A 3OS2A 3QJYA 4GY5A 2Y4YA 4OB1B 4C0ZA 4C8QB 4XTYA 1WGSA 4IUPA 3OYCA 2FYKA 4YTLA 1ZBXA 3G7ZA 3PNWC 2CS7A 1NE8A 1UGSB 3BW1A 4RCCA 1KQSA 2VXFA 2M9UA 1VQ4A 3AHUA 3MEWA 3QHSA 3C94A 3CMAT 3DLMA 4IKFA 4RMOA 2QA4A 3JB9F 1M5Q1 4QQ6A 1MGQA 1UGPB 2RI2A 2ZGWA 2E6ZA 3JSCA 4M7DA 1OZ3A 3HL8A 3OMGA 3OYAA 5GANd 3P8HA 3C12A 3MEAA 2KK4A 2VC8A 4ZN3A 4QW2A 1G3YA 2EJ9A 3FEOA 1OZ2A 4OGCA 2E10A 5LJ5h 2EJFA 2QQRA 4BACA 5GAMh 1M90C 1BIAA 2RA2A 3CCUT 4E7IA 4A4HA 1N27A 3MP1A 5GAN2 1OI1A 4ZTFA 3JCMg 1WQ7A 2DKGA 1K73C 1P92A 2MWPA 2PUKB 1AHJB 1R8OB 5FU6B 4JS5A 1DJ7B 2RHIA 1S72T 2L89A 2ZPGB 4XTUA 1VQ5A 1VIFA 1Q81U 3JB9H 4M7DG 3EAEA 1UGQB 4N0AA 4ZTJA 4WF2A 4XK8E 2JTFA 5CCAA 3A8OB 3MP8A 1K73U 2R58A 2DJZA 1XNIA 2LRQA 5LJ3h 4BUGA 2RH2A 5GANj 4J6YA 3DB3A 4N0AC 2RJCA 4A4FA 3T9NA 1YI2T 3JAME 2DVEA 1VQ9A 1KG1A 3A8HB 3M55A 3FRNA 1W2BS 4HCCA 5I21A 2RHXA 2DD4A 2YHTA 3JCMf 3ZFJA 3HRSA 2E1HA 3OQ5A 4C8QE 2XIDA 3RKXA 2MI6A 1EIFA 2CYZB 2GFAA 4IUVA 3CCST 2WACA 2X4YA 3PFSA 4JRIA 4C92C 1KD1C 2XK0A 3GOXA 4J7IA 1KQ1A 2ZPBB 5GAN4 2QTXA 4HCBA 2KQWA 3CBOA 4Q5WA 4XTZA 5C6SA 3JB9D 2I2LA 3CC4T 5GANh 4PNOA 4XU1A 5I2SA 4LDUA 4LDVA 1VQLA 1VQPA 2FVUA 3V7CA 3J81E 3JCMe 1X75C 1KD1U 2E65A 3A8LB 3FDRA 4FT4A 3LYIA 3A8MB 4EMKB 4M75F 2FL7A 3JCMd 3DLLA 1LOJA 2M1HA 2OAUA 1IREB 3RIRA 3M4YA 5CKFA 2DZCA 3RUXA 1QW1A 4E7HA 3PT9A 2HNIA 4NS5A 4B9WA 3CCVT 2LVMA 4F7UF 5GAN3 3PIPA 5HK0A 4LD9K 4CRIA 2XG8D 2LT4A 3QG1A 4M77D 3OYJA 1JB0E 2A7YA 3BY7A 4IUUA 4RCBA 4PJOD 2EIFA 1OYXA 5HY6A 2V8KA 2LTOA 5GMKm 2X4WA 1M9SA 3OBYA 4XU2A 3TREA 4DOVA 3NTKA 4BB7A 3CMAA 3BDLA 5GMKj 4MZTA 4BE2A 4XTWA 3JCMP 2HQEA 3DKMA 4KBMB 2E64A 4X34A 3SB2A 2F69A 2QI2A 1X6OA 3X28B 3OYFA 3L2QA 4C5EA 1VQOT 4M75B 1BI3A 4BI3A 3J80E 3GLXA 4VUBA 4A4KA 2EWNA 4M7AF 2VXEA 4IURA 1JJ2S 4C0DB 2MAMA 1N9RA 1YHQT 4P5NA 4M78A 3EFRA 3OYYA 2CGHA 1Y71A 3CXCS 1YJWT 4GLKA 4F7UB 1S72A 1W4SA 4OMFB 1G5VA 1HK9A 4D6WA 1K9MC 3E9GA 1LJOA 1N8RC 1BIBA 5CKDA 2JOYA 1Y96A 3L1AA 4A4EA 5FROA 5GMKh 1YBYA 2QQ9A 5GMKl 5GAOr 2FHDA 3QDRB 1NPRA 4M77A 3V7SA 1KC8C 3V8JA 4PJOA 2K5FA 2DXTA 4XTVA 2RK2A 3JCMh 3FB9A 3SWNB 4PLLA 1YI2A 3QJ6A 2BUDA 4XU3A 4A53A 1K9MU 3V7RA 4M78G 4M77C 5KH6A 5LJ5j 5GAMj 1N8RU 4PJOC 3OY9A 5CO7A 4M7AB 4EMHA 3M59A 3JCMX 3OYLA 1KC8U 5IT9E 3M54A 3FJPA 4BY6B 1D3BA 1KHIA 3V8LA 3CCLT 3L42A 3CCMT 4HKEA 1WJSA 3KBGA 3CCSA 1VQMT 2QQSA 3QBYA 1U1SA 1QP3A 2CZ6B 3E1SA 1QVFA 4M77G 1GXIE 1XOVA 4PJOG 3OYBA 2DXBA 3G6EA 2HBPA 2M16A 4OB2B 5FU7C 4A4GA 4C92D 3M56A 5LJ3j 3CC4A 4ZGJB 5GAOn 4JUVA 5CKHA 1Q86U 4OGEA 2DIQA 2KY9A 2RO0A 4QQDA 3CC7T 3HP9A 3JRZA 3CBPA 4LDYA 3OS5A 4C8QD 4M75E 1Q81C 2QXFA 3OYIA 3LW5E 4O6JA 1JBMA 2R5MA 4HA8A 1JJ2A 4ELYC 3E19A 3X20B 3GP8A 2K5IA 2DXUA 3OBWA 4F7UE 3OYNA 1WJQA 3CCVA 1Y07A 4FU6A 5CIUA 3QYGB 5FLXE 2DIGA 1BI2A 2IVWA 2DPPB 4EDUA 1M8VA 2O4XB 4C0DC 1G3TA 1G3WA 2L8DA 2LQKA 2LCLA 2A3LA 5J39A 1XTDA 3O8VA 2K3YA 4J6WA 3NFCA 2EAYA 1FXXA 2XKOC 5CQXA 2PQWA 1BI0A 3E9FA 2HQXA 5GAN6 3JCMQ 4DA4A 3QUIA 3OYKA 2XD0A 2QQAA 1ZHIA 5FRMA 3R6OA 4C92A 5J26A 1RI0A 3Q1JA 4MDWA 3L2UA 1B34B 1TH7A 4M7AE 2VV5A 2ZPEB 2RI5A 3L2WA 1VQOA 5A2QE 1U1TA 4C8QA 3H6ZA 3P8DA 2IG0A 1BI1A 4OVAA 4EMGA 1VIEA 1YHQA 4V2SA 1YJ9T 3QSUA 2CZ7B 2NLUA 2XHCA 2VYTA 2PVGB 2K2VA 5GAOp 3G6ET 3CPFA 3RMSA 1YJWA 4C8QC 2C06A 3FC3A 4JLIA 1KHCA 2QQBA 2X35A 3PGGA 2LT1A 3RMQA 1VQ6T 4BE1A 2P0KA 2V8JA 4PLIA 2KAFA 2DD5A 1NJIU 4C92G 2RJFA 5KCOA 3S3MA 5KE3A 3ER0A 5D6WA 3P8BB 3CBMA 3UWNA 5KCHA 4MZMA 5KE2A 2RB6A 2JZ2A 4C8QG 2L5QA 3F70A 4OB3B 4C5IA 5DLQE 1PSEA 5GAN7 3CD6T 4M7DF 4B9XA 5GAOq 3CCET 3M53A 5D6XA 3OYMA 4N4GA 3HRUA 3GNGA 4QVDA 3CCMA 3OYHA 3CCLA 4XQ3A 1VQMA 3M5AA 3ZEHA 1IZ6A 3QKJA 1ZQ1A 1WJRA 5CQYA 1QVGS 5CR2A 5FU6C 3OB9A 4ZN1A 3META 4BDYA 3PMTA 2VUBA 5J3BA 4C0GA 1W2BA 2DZ9A 2LDMA 2M0OA 1UB4A 1WQWA 2GCXA 3QYHB 5HKCA 3LGLA 5LJ5f 3I55T 1VQ8T 3HRTA 3TEEA 4J5YA 5C0MA 2G3RA 2RJDA 4QVCA 2L3RA 3KUFA 2DXCA 5CKEA 3JB9I 3CC7A 2WSFE 1YJNT 3INZA 3NTHA 1X01A 3WVDB 2LQ8A 2DTIA 1KQSS 4NL3A 3QPHA 5L8RE 4M7DB 4L5GA 2HAXA 4HT8A 2EJGA 2F5KA 2DTOA 2EYQA 2RD1A 4E7JA 3OW2S 1K8AC 1I5LA 2DK3A 1HXDA 2GFUA 3HKSA 2D9TA 3HHTB 4MZPA 2VGMA 2O01E 4NOYA 4TVRA 1Y7XA 3G71T 3JB9G 1Q7YC 2QDYB 4KUIA 2P0QA 2DAQA 3URGA 2EQUA 4DOWA 3LH0A 3LX7A 3SFMA 3MEUA 5GANg 2JNGA 3BDUA 4BD3A 3LWIA 2PUOB 5DLOA 1FWZA 2EQJA 4M78E 4M75D 3RERA 1K8AU 2E41A 2JTMA 4PL6A 3VYGA 3VKIA 3L2VA 1Q7YU 2CZ1B 4EMKA 3OA6A 5A0GA 5GAN5 2MWOA 3M9QA 2DO3A 1VQKT 4BI8B 5CK9A 4NL2A 2WSCE 5CVIA 4A54A 3KXTA 3WXMB 2ZPFB 4EMKC 1Q86C 2D6FA 1PSFA 4PKCC 3J7AF 3HFOA 2LCCA 1QP2A 4XAXB 1M1KC 1YJ9A 1YCYA 2PVOB 3QIIA 3WVEB 3C95A 3X25B 5GANf 2OTJA 2K5LA 3C4SA 4BI4A 2OTLT 1WNLA 3GF5A 1UEBA 3RKWA 1NZ9A 3L2ZA 3UDCA 2FB7A 4HCZA 2DEQA 3MO8A 3X24B 2MMPA 3PIOA 1VQ6A 3N5BB 4FM4B 4BDZA 3JCMW 3QZ5B 3M57A 4C0FA 1M1KU 2Y90A 4M7AD 2EFIA 4OP0A 5LL6S 2GF7A 1YITT 2P4TA 2E12A 1G3SA 3CMET 4KUDK 3QZ9B 1I8FA 2K57A 2ZPHB 4M75A 3TCJA 2R57A 4C5GA 2KMTA 4LDXA 2XDPA 4ZGEB 3G4ST 1YIJT 4M7DE 3LGFA 5I2MA 4XTXA 4JDSA 5GANe 3CD6A 3CXCA 2QEXT 4MMLA 4O5VA 3CCEA 2BIVA 4M75C 4ME7A 3OW2A 3JB9J 2HD0A 5EG2A 4FIBA 2ZZDA 4F7UA 5HK3A 2EKOA 4JRKA 5DM7R 1KQ2A 4Y28E 2XI9A 3A8GB 3CPWS 3PTAA 3MP6A 1VUBA 3CCQT 4M78F 1M1GA 3S3OA 2XICA 4IUTA 4L6V5 5IAYA 3OYDA 3CC2T 3DB4A 4M75G 4ZGDB 4JLGA 3CEYA 3JCMb 4IUQA 5CAIA 3I55A 3VYHB 1VQ8A 3SWNA 3RESA 2BKDN 1RL2A 3JCMJ 2D0QB 2K3XA 3JCMc 2X4XA 1VQNT 4J6XA 2EQMA 3I56T 1YJNA 4M77F 3TU4K 1NJIC 2Y4XA 4M7AA 2VGNA 4HT9A 3M58A 3SWNC 4PJOF 2F5TX 4RG2A 4F7UG 3OS0A 3CCJA 2OTJT 3S3NA 2ZPIB 4KULA 1BKBA 1H3ZA 5IN1A 1I81A 4M7AC 1O75A 1Q82C 3BFMA 4LDWA 4FSXA 2GQVA 4C92E 3CCRT 2JN0A 3X26B 4BY6C 1MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLR A;  3MEA A;  3PMT A;  4QW2 A;  3FEO A;  1OZ2 A;  4PLL A;  2LDM A;  2QQR A;  2M0O A;  4BAC A;  3QJ6 A;  2BUD A;  4N4H A;  3LGL A;  4E7I A;  5KH6 A;  4A4H A;  1N27 A;  5C0M A;  3OYE A;  3MP1 A;  2G3R A;  1OI1 A;  2RJD A;  3OY9 A;  2L3R A;  3KUF A;  4UC4 A;  4ZTF A;  4II1 A;  2RHY A;  3OYL A;  2MWP A;  2RI3 A;  3NTH A;  2RHI A;  2L89 A;  3L42 A;  3OMC A;  1WJS A;  3H8Z A;  3MEV A;  2QQS A;  3EAE A;  2F5K A;  3QBY A;  4ZTJ A;  4E7J A;  2JTF A;  2CKK A;  2GFU A;  3MP8 A;  1G5V A;  2D9T A;  2LRQ A;  2R58 A;  1XNI A;  2RJE A;  4N4I A;  3OYB A;  2E6N A;  2M16 A;  3DB3 A;  4A4F A;  2RJC A;  4A4G A;  1SSF A;  2DAQ A;  5D6Y A;  2EQU A;  3LH0 A;  3LX7 A;  3OS1 A;  3MEU A;  2DIQ A;  2RHX A;  4BD3 A;  2EQJ A;  2O4X A;  2RO0 A;  4QQD A;  2EQK A;  4PL6 A;  3PMI A;  3OQ5 A;  3OYI A;  3L2V A;  4IUV A;  2GFA A;  4BDY A;  2R5M A;  2WAC A;  3OA6 A;  2X4Y A;  3NTI A;  2E5Q A;  3PFS A;  2RHZ A;  5M9O A;  4E7L A;  2XK0 A;  2MWO A;  3GOX A;  3M9Q A;  4BE0 A;  3SD4 A;  4Q5W A;  3ASK A;  5C6S A;  3OYN A;  3S6W A;  1WJQ A;  4FU6 A;  5CIU A;  2DIG A;  4E7K A;  4EDU A;  2LCC A;  2O4X B;  3QII A;  2L8D A;  5J39 A;  4LD6 A;  3C4S A;  3O8V A;  2K3Y A;  3FLG A;  3FDR A;  3ME9 A;  2PQW A;  4C5H A;  3LYI A;  4Z02 A;  3E9F A;  2HQX A;  4HCZ A;  3MO8 A;  4L59 A;  3OYK A;  4BDZ A;  2M1H A;  5FRM A;  3L2U A;  2EFI A;  1RI0 A;  3Q1J A;  5J26 A;  2GF7 A;  3L2W A;  2RI5 A;  4E7H A;  4NS5 A;  4QVZ A;  4B9W A;  2LVM A;  2R57 A;  3H6Z A;  3P8D A;  2IG0 A;  2RHU A;  2XDP A;  4OVA A;  3UT1 A;  4C5G A;  3LGF A;  4CRI A;  3OYJ A;  2NLU A;  4IUU A;  2VYT A;  4QQG A;  1OYX A;  2BIV A;  2LTO A;  2X4W A;  3FC3 A;  1KHC A;  2X35 A;  3NTK A;  4BE1 A;  2P0K A;  3BDL A;  4PLI A;  4BE2 A;  3OYG A;  2HQE A;  2EKO A;  3L2R A;  5FRN A;  4X34 A;  2RJF A;  5KCO A;  2R5A A;  3S3M A;  3MP6 A;  5KE3 A;  3OYF A;  2B8A A;  2YRV A;  3S3O A;  4IUT A;  5D6W A;  3L2Q A;  4FL6 A;  3UWN A;  4C5E A;  5IAY A;  4GY5 A;  5KCH A;  3OS2 A;  3OYD A;  3DB4 A;  5KE2 A;  2JZ2 A;  1WGS A;  4IUR A;  3CEY A;  3F70 A;  4IUP A;  3OYC A;  4C5I A;  4IUQ A;  3PNW C;  2BKD N;  4B9X A;  2K3X A;  2X4X A;  2EQM A;  5D6X A;  3OYM A;  4N4G A;  3MEW A;  4RG2 A;  3OS0 A;  3DLM A;  4IKF A;  3OYH A;  3S3N A;  4QQ6 A;  2RI2 A;  3E9G A;  1H3Z A;  5IN1 A;  1OZ3 A;  3ZEH A;  3OMG A;  3QKJ A;  5FRO A;  4A4E A;  1WJR A;  3OYA A;  2FHD A;  3OB9 A;  3P8H A;  3MET A;  1MHN A; 
#chains in the Genus database with same CATH topology
 3LLR A;  1SRM A;  3OSV A;  4KGV B;  1WHH A;  1VQ7 A;  3CQT A;  4ELZ C;  2RI3 A;  4FT2 A;  4OB0 B;  1ABQ A;  1PKS A;  4D8D A;  3HSB A;  3V8K A;  5DY9 A;  1SHG A;  4PJO B;  2LNV A;  1VQK A;  2M02 A;  4AFZ C;  2E6N A;  2E5K A;  1K1Z A;  4JJC A;  4M78 D;  5IHI A;  2QA4 Q;  1WFW A;  3CPW A;  4CC3 A;  1RAB B;  4MDX A;  4J7F A;  2LCS A;  5GAM f;  4JJD A;  4AG1 C;  1NBE B;  2E5Q A;  1K8A R;  4ATO A;  4E47 A;  2LX9 A;  2DMO A;  4BE0 A;  2KDS A;  1QVF S;  4XU0 A;  2K79 A;  2V8I A;  1QMC A;  3RKY A;  1TOV A;  4CI0 C;  1AEY A;  3KFV A;  5LJ3 f;  4C92 F;  1BYM A;  3FLG A;  1QCF A;  2YWW A;  5LJ5 e;  3VU3 C;  4C8Q F;  1RLQ C;  2FZG B;  4QVZ A;  2CP5 A;  4X9D A;  4E7Z A;  5KYU B;  4F17 A;  3FIF A;  3JCM V;  4M77 E;  3M0T A;  2ESW A;  2PVD B;  2COY A;  2YLC A;  4QQG A;  5A0D A;  1VQP T;  2JS0 A;  4C92 B;  4FW2 A;  1U5S A;  3MKD A;  1QVG A;  2LC4 A;  5GAN 8;  4HVW A;  3CCR A;  4FL6 A;  4R56 A;  4PFP A;  4C8Q B;  4XTY A;  1WGS A;  3PNW C;  1NE8 A;  2VAS A;  2VB6 A;  2OTL Q;  3AHU A;  3QHS A;  3C94 A;  1BBZ A;  4M4Z A;  4QQ6 A;  3RDV A;  3HL8 A;  3OMG A;  3OYA A;  1NG2 A;  5KYY B;  2VC8 A;  4ZN3 A;  4QW2 A;  4OGC A;  4M7D C;  1FMK A;  1OZ2 A;  2A37 A;  5GAM h;  1BIA A;  3CCU T;  4GBQ A;  1AT1 B;  1WQ7 A;  1NJI R;  1SSH A;  2C0T A;  2ZPG B;  2DJQ A;  1WDX A;  1Q81 U;  1M30 A;  3JB9 H;  3EAE A;  1UGQ B;  4XK8 E;  1ACM B;  1K73 U;  5LJ3 h;  1XNI A;  2JJ9 A;  1I5O B;  1YI2 T;  3M55 A;  4HCC A;  2RHX A;  1HD3 A;  3JCM f;  2HSE B;  1WYX A;  3I56 Q;  2E1H A;  2KRS A;  2MI6 A;  2LJ3 A;  2CDT A;  1M2V A;  3PFS A;  2L0A A;  1Z9Z A;  3THK A;  3EG9 B;  3JB9 D;  2I2L A;  5GAN h;  3H0I A;  1JXO A;  4X1V A;  2KRN A;  1VQP A;  3J81 E;  1X75 C;  3A8L B;  2DE0 X;  3LYI A;  4EMK B;  2FL7 A;  2KRO A;  4FW1 A;  3M4Y A;  4WTO B;  1G2B A;  1W2B P;  1QW1 A;  2EGE A;  2A0F B;  3CCV T;  2EW3 A;  2LVM A;  4DBR A;  3EH1 A;  5HK0 A;  1AD5 A;  2XG8 D;  1D09 B;  1JEG A;  3BY7 A;  3H0H A;  2V8K A;  2LTO A;  2O88 A;  5GMK m;  4XU2 A;  4DOV A;  4BB7 A;  1RAF B;  3DKM A;  4KBM B;  3SB2 A;  1D0Z A;  3L2Q A;  1TS9 A;  3D7S B;  1BI3 A;  4BI3 A;  1VYV A;  1VQO T;  3A1P A;  4M7A F;  1X6G A;  2VXE A;  1IRX A;  4P5N A;  1TWB A;  3EFR A;  1WIE A;  3OYY A;  3CXC S;  4AT1 B;  3C0C A;  1PD0 A;  1W4S A;  2LQW A;  4D6W A;  4PJL A;  3E9G A;  2QTV A;  1BIB A;  4OMM A;  5FRO A;  2C0I A;  5GMK h;  5GAO r;  5GMK l;  2LNH B;  2YRC A;  4IIO A;  2K5F A;  3JCM h;  1H92 A;  1YJW Q;  1YI2 A;  4M77 C;  4KH0 B;  5GAM j;  4M7A B;  1KFZ A;  3OYL A;  4RTU A;  4BY6 B;  1KHI A;  3V8L A;  1OPK A;  3KBG A;  1U1S A;  1JJ2 P;  3EGX A;  1GXI E;  1SHF A;  1TU0 B;  3JV3 A;  3OYB A;  1QKX A;  1M3C A;  2M16 A;  5LJ3 j;  1ZUU A;  2DIQ A;  3CC7 T;  3CBP A;  2NUT A;  1Q81 C;  3VS4 A;  1MNE A;  2K7A A;  1G83 A;  2JS2 A;  3CMA Q;  2R5M A;  3E19 A;  3RR6 A;  1KIK A;  3REA B;  2J6K A;  1Q82 R;  3CCV A;  1GFC A;  5CIU A;  5FLX E;  1M90 R;  2IVW A;  4C0D C;  3UAT A;  2L8D A;  5J39 A;  3TQ7 P;  3O8V A;  2EAY A;  2HQX A;  5GAN 6;  3JCM Q;  3OYK A;  1BB9 A;  2XD0 A;  1MUZ A;  2DL5 A;  5IHN A;  5FRM A;  3L2U A;  1KK7 A;  1NLP C;  2VV5 A;  3UA6 A;  2ZPE B;  3L2W A;  1VQO A;  2IG0 A;  2NLU A;  2XHC A;  2VYT A;  2J6O A;  2JT4 A;  1UTI A;  2DM1 A;  1KHC A;  3SHW A;  2KAF A;  5KCO A;  3S3M A;  4F04 B;  1D0X A;  5KE3 A;  3CBM A;  2BE7 D;  4MZM A;  2YUN A;  1ABO A;  3VRY A;  5KE2 A;  2L5Q A;  4C5I A;  2P84 A;  1HYO A;  1WHM A;  1J3T A;  4RTT A;  3VS2 A;  1WXB A;  3M5A A;  2ABL A;  3AT1 B;  2FRW A;  5FU6 C;  2DNU A;  4ZN1 A;  3PMT A;  4ZNX A;  4C0G A;  1X69 A;  2M0O A;  1UB4 A;  5HKC A;  5LJ5 f;  3I55 T;  2HL3 A;  3VS6 A;  5C0M A;  4PJN A;  2RJD A;  4QVC A;  3CC7 A;  5FWB A;  2FPF A;  4NL3 A;  5L8R E;  4L5G A;  2HAX A;  2IPO B;  2F5K A;  2L3S A;  1YCS B;  2DTO A;  3OW2 S;  1I5L A;  3HKS A;  2P0Q A;  1RAH B;  2DAQ A;  3LH0 A;  1VA7 A;  3RER A;  1FWZ A;  1X27 A;  2JTM A;  3G1J A;  2KEA A;  2QGF B;  1IO6 A;  2CZ1 B;  2PNI A;  3FJ5 A;  3KXT A;  2O2O A;  4DBH A;  1U06 A;  1PSF A;  1QP2 A;  4CC2 A;  2DX1 A;  1D0Y A;  2NUP A;  2OTL T;  1WNL A;  2QG9 B;  1M2V B;  3UDC A;  4HCZ A;  3MO8 A;  3N5B B;  4BDZ A;  4C0F A;  2DET A;  2Y90 A;  2KBT A;  1Z9Q A;  2GF7 A;  3CME T;  4KGZ B;  2ZPH B;  4LDX A;  2KMT A;  2DRM A;  3LGF A;  5GAN e;  2HL5 C;  1ZX6 A;  3OW2 A;  3JB9 J;  1QWF A;  1GCQ A;  4F7U A;  1YIT Q;  1KQ2 A;  4JZ4 A;  3A8G B;  3QDF A;  4Y28 E;  1EZZ B;  1M1G A;  2EPD A;  2J06 A;  3G4S Q;  3S3O A;  4IUT A;  4E7S A;  1YIJ Q;  5IAY A;  1SRL A;  4M75 G;  3JCM b;  5CAI A;  3I55 A;  3VYH B;  2D0Q B;  3JCM c;  4J6X A;  3I56 T;  3TU4 K;  4HT9 A;  2F5T X;  1H3Z A;  1Q82 C;  4C92 E;  1M90 C;  2QYZ A;  1XQH A;  4HVV A;  4RUG A;  5CKB A;  2JVV A;  2LJ0 A;  2OTJ Q;  3EFS A;  4QT7 A;  1QKW A;  2RHY A;  2CUB A;  5LJ5 g;  4R55 A;  1OQK A;  4JRQ A;  3H8Z A;  3MEV A;  3EHR A;  2A08 A;  2KT1 A;  2XU8 A;  4OF1 A;  4RG8 A;  5GMK e;  1ZLM A;  4N4I A;  2CSQ A;  2Z0W A;  3I5R A;  1SSF A;  1K76 A;  4PFO A;  3QO3 A;  3CD6 Q;  3VUB A;  2RM4 A;  2OTL A;  2EQK A;  3PMI A;  1RAE B;  2K4Y A;  2YLB A;  3SDZ A;  3EGX B;  3NTI A;  4F16 A;  4JS4 A;  2D8J A;  2HZY A;  1U3O A;  4E7L A;  1TSF A;  3CCJ T;  1K9M R;  2E70 A;  1N8R R;  3CME A;  1M4Z A;  4J9C A;  1O9S A;  4E7K A;  1VQ9 T;  1K0S A;  2CZ0 B;  5AYF A;  4R0K A;  2NUT B;  1YWO A;  2XDB A;  3TSZ A;  2X51 A;  4C5H A;  5I22 A;  2B86 A;  2NYS A;  1H64 1;  3GPL A;  5LJ5 d;  3PE0 A;  3GNF B;  4MMK A;  2KYB A;  3G71 Q;  4M7D D;  1RAD B;  1U8R A;  2RK1 A;  3PVL A;  1VQL T;  3UPU A;  2DTH A;  2OI3 A;  3VV0 A;  3I56 A;  2MF2 A;  3NHN A;  3QXE B;  5AT1 B;  2R5A A;  1ARK A;  3QJY A;  3MJX A;  2A28 A;  2PTK A;  3OYC A;  1ZBX A;  1M8M A;  3G7Z A;  2M9U A;  5GJW B;  1UFF A;  3CMA T;  3DLM A;  4IKF A;  4RMO A;  1UGP B;  2ZGW A;  4M7D A;  3VS5 A;  2FRY A;  2EJ9 A;  1PNJ A;  1MMN A;  2RA2 A;  4E7I A;  4A4H A;  1OI1 A;  2DEU A;  2DKG A;  2CP2 A;  2MWP A;  2PUK B;  4JS5 A;  1H8K A;  1WA7 A;  1DJ7 B;  1S72 T;  2L89 A;  3UA7 A;  2P4R A;  2RQR A;  2JTF A;  5CCA A;  1W1F A;  2ZAE A;  3MP8 A;  1ZBJ A;  2R58 A;  2DJZ A;  4BUG A;  2HMA A;  4J6Y A;  3VRZ A;  2DVE A;  1VQ9 A;  2OX7 A;  5I21 A;  1QCO A;  1IGQ A;  1VQN Q;  3ZFJ A;  1UGV A;  3OQ5 A;  1EIF A;  2CYZ B;  2EYW A;  3CCS T;  1OU8 A;  2LJ1 A;  4C92 C;  1BK2 A;  1ZUK A;  5GAN 4;  1B3Q A;  2KQW A;  1ZUY A;  1PHT A;  1AVZ C;  1VQL A;  3V7C A;  2E65 A;  3H9N A;  2RNA A;  4IIM A;  8ATC B;  1V1C A;  1IRE B;  4E7H A;  4B9W A;  4F7U F;  4LD9 K;  3QG1 A;  4M77 D;  2NUP B;  4RCB A;  4IUU A;  1Q7Y R;  2EIF A;  1X2Q A;  1M9S A;  2X4W A;  3OBY A;  3CMA A;  3BDL A;  1VQ5 Q;  4BE2 A;  3H0F A;  4AG2 C;  1X6B A;  4AFS C;  4RTV A;  2F69 A;  2K2M A;  3EFO A;  3X28 B;  3OYF A;  4C5E A;  3J80 E;  3GLX A;  4VUB A;  2EWN A;  1YHQ T;  2GQI A;  4M78 A;  2CGH A;  2HQH A;  1Y71 A;  1M1K R;  4F7U B;  1S72 A;  1HK9 A;  1K9M C;  1N8R C;  4A4E A;  1JXM A;  2FHD A;  4M77 A;  3V7S A;  2DXT A;  4XTV A;  2RK2 A;  4ORZ A;  4PLL A;  1N5Z A;  3QJ6 A;  2BUD A;  2HKN A;  2KNB B;  1TUD A;  3OY9 A;  1SEM A;  5IT9 E;  1D1C A;  1D3B A;  1SKU B;  3CCM T;  3L42 A;  3CCS A;  2QQS A;  1RI9 A;  3E1S A;  1QVF A;  1XOV A;  2DVJ A;  4PJO G;  2DXB A;  2HBP A;  5FU7 C;  3M56 A;  4DBF A;  4RTY A;  1NLO C;  5CKH A;  3JRZ A;  4LDY A;  4M75 E;  1GBR A;  2HSP A;  4HXJ A;  4O6J A;  2EYY A;  4HA8 A;  2EGA A;  1E6G A;  1AZE A;  4ELY C;  1E7O A;  3X20 B;  2DLP A;  2DXU A;  3OBW A;  2MYS A;  4FU6 A;  3QYG B;  1BI2 A;  4KH1 B;  1M8V A;  3E2U A;  1G3T A;  1BCM A;  2A3L A;  1XTD A;  2H3E B;  2K3Y A;  2XKO C;  3E9F A;  2YSQ A;  1S1N A;  1W6X A;  4K11 A;  3Q1J A;  1TH7 A;  2JMA A;  5A2Q E;  2YUP A;  1IGU A;  4OVA A;  1YHQ A;  4V2S A;  1QQJ A;  2K2V A;  2KE9 A;  5GAO p;  4PJM A;  3RMS A;  3FC3 A;  2QQB A;  2CP6 A;  3RMQ A;  1VQ6 T;  7AT1 B;  4PLI A;  1NJI U;  4C92 G;  1ZSZ A;  5D6W A;  2L3P A;  3P8B B;  2RPN A;  1YJ9 Q;  3G6E Q;  2JZ2 A;  4C8Q G;  1I1J A;  1W70 A;  3CD6 T;  1OUL A;  4DEX A;  4M7D F;  4HVU A;  5GAO q;  1X43 A;  3OYM A;  4N4G A;  3GNG A;  3CCM A;  4XQ3 A;  2GBQ A;  5KYW A;  2K9G A;  5CR2 A;  3NGP A;  2FZC B;  3VS3 A;  2O9S A;  2VUB A;  3CCE Q;  2DZ9 A;  1WQW A;  3LGL A;  4J5Y A;  2G3R A;  2WSF E;  1SG5 A;  5ECA A;  4E6R A;  3INZ A;  1KQS S;  2LQ8 A;  4M7D B;  1ZA1 B;  4E7J A;  1K8A C;  1VQ8 Q;  1HXD A;  1Y0M A;  2GFU A;  2D9T A;  3HHT B;  4TVR A;  1M27 C;  3G71 T;  1UJY A;  1Y7X A;  3GBQ A;  1Q7Y C;  4KUI A;  3URG A;  3VS1 A;  3LWI A;  3LX7 A;  5GAN g;  2PUO B;  1K0X A;  1M3B A;  3VYG A;  1PCX A;  3VKI A;  5GAN 5;  2DO3 A;  2AKK A;  3M0Q A;  1VQ7 Q;  4A54 A;  2X9H A;  2ZPF B;  2D6F A;  3HFO A;  1V76 A;  2BZ8 A;  4Y92 A;  1M1K C;  3X25 B;  2OTJ A;  4FYW B;  4HCK A;  3X24 B;  1VQ6 A;  2L2P A;  2YUQ A;  1VQM Q;  3A98 A;  3QZ5 B;  2EKH A;  4AMC A;  4OP0 A;  5LL6 S;  2P4T A;  2R57 A;  4C5G A;  4ZGE B;  1MMA A;  4JDS A;  3CD6 A;  3CXC A;  1WX6 A;  4M75 C;  4ME7 A;  1HJD A;  4FIB A;  2RMO A;  2QGG A;  4JRK A;  3PTA A;  3CCQ T;  4M78 F;  4L6V 5;  3CC2 T;  4ZGD B;  1KD1 R;  2BKD N;  1RL2 A;  2JM9 A;  3JCM J;  2K3X A;  1VQN T;  4M77 F;  1NJI C;  2VGN A;  3SWN C;  3OS0 A;  2KYM A;  2ZPI B;  1WXT A;  4KUL A;  3EFO B;  1BKB A;  1UE9 A;  3EG1 A;  1PM3 A;  1X2K A;  3X26 B;  2ROT A;  3G71 A;  1LNX A;  3LWH A;  1QWE A;  2XDD A;  4M78 B;  5GMK i;  2JUF A;  3HTR A;  1YWP A;  3OYE A;  1Q82 U;  4UC4 A;  1M90 U;  4M7A G;  2C0O A;  5GAO m;  3CPW P;  3QWY A;  2QAZ A;  3CCR Q;  2QA4 T;  3OMC A;  4M77 B;  4KT0 E;  1FX7 A;  2X4J A;  2QK0 A;  2H3J A;  3OS1 A;  3M0P A;  3LH5 A;  2O4X A;  1D3B B;  3TVT A;  2KVQ G;  1H3H A;  1VQ5 T;  2SRC A;  1I0C A;  2WSE E;  1CKA A;  2CSI A;  5GAO l;  3ASK A;  1UHC A;  1KC8 R;  3VJP A;  4Z89 A;  4RKU E;  1MV0 B;  2EVR A;  1WPY A;  4LD6 A;  3M4G A;  1R0C B;  1NPP A;  4ANJ A;  2FPD A;  5GAM e;  3ZBD A;  4RTW A;  1TXQ A;  4DQ2 A;  4J9G A;  2KXC A;  1JRI A;  4LNP A;  3CCQ A;  1VYT A;  3MCA B;  1QVG P;  1Q86 R;  3CC2 A;  5FW9 A;  2GTJ A;  4Y91 A;  1WI7 A;  4EPC A;  5LJ3 e;  1VQN A;  4PJO E;  4JJN K;  4J8O A;  2ED1 A;  1VYU A;  1QVF P;  3OYG A;  3L2R A;  5FRN A;  1PC0 A;  3A5Z B;  1V29 B;  2B8A A;  2VVK A;  5L23 A;  2P0P A;  4GY5 A;  4C0Z A;  2RN8 A;  1VQP Q;  3EGD A;  4IUP A;  1OX8 A;  2FYK A;  4YTL A;  4DEY A;  1G8X A;  2CS7 A;  4A63 B;  3BW1 A;  4RCC A;  2VXF A;  3MEW A;  2QA4 A;  3JB9 F;  1MGQ A;  2RI2 A;  3JSC A;  1ZSZ B;  1OZ3 A;  2QDL A;  3P8H A;  3C12 A;  2EGC A;  1D1B A;  3FEO A;  5LJ5 h;  2QQR A;  3RBB B;  1R0B G;  3MP1 A;  5GAN 2;  2KXD A;  2QEX Q;  4ZTF A;  5FU6 B;  1R8O B;  1TUC A;  2YT6 A;  1VIF A;  1VQ5 A;  5KYW B;  4WF2 A;  3CCU Q;  2LRQ A;  2FG0 A;  2RH2 A;  2HKQ B;  3DB3 A;  4N0A C;  2RJC A;  2EYX A;  3T9N A;  3JAM E;  3A8H B;  1W2B S;  3FRN A;  2COW A;  3NMZ C;  4C8Q E;  1NEG A;  1KSW A;  2HCK A;  2GFA A;  2WAC A;  1PRL C;  1KD1 C;  2XK0 A;  3GOX A;  1YI2 Q;  4HCB A;  2QTX A;  4Q5W A;  5C6S A;  2LQN A;  2FO0 A;  2CH4 W;  2FPE A;  4PNO A;  4XU1 A;  4LDU A;  2FVU A;  3JCM e;  1PD1 A;  3FDR A;  1VQ4 Q;  2COZ A;  1LPL A;  1LOJ A;  2G6F X;  2OAU A;  3VS7 A;  3RIR A;  2J05 A;  1MMG A;  3PT9 A;  5GAN 3;  3PIP A;  2CRE A;  2LT4 A;  3OYJ A;  1JB0 E;  1OYX A;  5HY6 A;  1K9A A;  3TRE A;  2RQU A;  2KRM A;  1WXU A;  4MZT A;  2HQE A;  2E64 A;  1UG1 A;  2FZK B;  1E6H A;  2QI2 A;  2YRD A;  4CC7 A;  4A4K A;  4IUR A;  1JJ2 S;  1EX4 A;  1M2O A;  2ATC B;  4JZ3 A;  1YJW T;  1BU1 A;  4GLK A;  3I35 A;  3M0U A;  4OMF B;  5KYX A;  1GFD A;  2KR3 A;  5CKD A;  1Y96 A;  2QQ9 A;  1KC8 C;  3V8J A;  3UF4 A;  3FB9 A;  2JW4 A;  2O9V A;  1K9M U;  5LJ5 j;  5KH6 A;  1N8R U;  4PJO C;  5CO7 A;  3M59 A;  3JCM X;  3M54 A;  3FJP A;  2NWM A;  1VQM T;  1WJS A;  2CZ6 B;  4J9E A;  5FWC A;  3G6E A;  4OB2 B;  3CXC P;  4ZGJ B;  5GAO n;  4OGE A;  4Z8A A;  2KY9 A;  4LUE A;  1OOT A;  4QQD A;  1C1A A;  3OS5 A;  2QXF A;  1OPL A;  3OYI A;  2JMC A;  1JJ2 A;  1FMV A;  1NM7 A;  3GP8 A;  2E3I A;  2K5I A;  1SF9 A;  4FSS A;  1WJQ A;  1YNZ A;  1GRI A;  2DPP B;  2O4X B;  1NEB A;  2LQK A;  1PWT A;  1YN8 A;  3NFC A;  2PQW A;  2HBW A;  1GCQ C;  2KT8 A;  2IIM A;  2RF0 A;  4DA4 A;  1MND A;  2D0N A;  4AFU C;  4M7A E;  4EMG A;  1VIE A;  1RAC B;  2CZ7 B;  2F2V A;  3CPF A;  4QKU A;  1YJW A;  4C8Q C;  2C06 A;  4JLI A;  2X35 A;  2E3H A;  2LT1 A;  4BE1 A;  2V8J A;  1QLY A;  2DD5 A;  2RJF A;  2QAS A;  3ER0 A;  2M0Y A;  2LZ6 B;  3EH2 A;  2CP0 A;  3F70 A;  3CC4 Q;  2JTE A;  1PSE A;  5GAN 7;  1AWJ A;  2KGT A;  4B9X A;  1UDL A;  3M53 A;  1A0N B;  1VQM A;  3ZEH A;  3QKJ A;  1WJR A;  1QVG S;  3EGD B;  4BDY A;  5J3B A;  2GTO A;  4FCY A;  2GCX A;  3QYH B;  2RQV A;  2L3R A;  1IHV A;  2DXC A;  2O31 A;  4DBQ A;  1OEB A;  1IHW A;  3NTH A;  3WVD B;  3QPH A;  4Z88 A;  2RD1 A;  2EYQ A;  3I55 Q;  4NOY A;  4RTZ A;  2O01 E;  2MCN A;  2QDY B;  1Q95 G;  4DOW A;  1MMD A;  4PFZ A;  1AWX A;  3SFM A;  4J9F A;  3BDU A;  4M78 E;  1FYN A;  1PG5 B;  4M75 D;  1K8A U;  1M3A A;  1Q7Y U;  2AZS A;  2JXB A;  1OV3 A;  3OA6 A;  1VOM A;  3M9Q A;  4BI8 B;  4OMQ A;  2WSC E;  2V26 A;  1WHL A;  4EMK C;  1IXD A;  1OX9 A;  4PKC C;  4XAX B;  1YCY A;  3QII A;  5GAN f;  3C95 A;  1QCN A;  3R6N A;  1Q81 R;  1WHK A;  2DF6 A;  3RKW A;  1NZ9 A;  3PIO A;  3OW2 P;  2DEQ A;  3CCL Q;  1K73 R;  4FM4 B;  3EHQ A;  2DL3 A;  3M57 A;  1M1K U;  2EFI A;  1YIT T;  3QWX X;  3U23 A;  1GCP A;  4KUD K;  1I8F A;  1Y57 A;  2K57 A;  2CP3 A;  4M75 A;  3TCJ A;  2XDP A;  3G4S T;  1YIJ T;  1UHF A;  2BZX A;  2OJ2 A;  2QEX T;  4O5V A;  2GGR A;  5EG2 A;  5HK3 A;  2ZZD A;  2NUZ A;  3CME Q;  5DM7 R;  1WHG A;  1VUB A;  4KGX B;  2XIC A;  1AWO A;  4JLG A;  2K6D A;  5KYN A;  3CEY A;  4IUQ A;  3SWN A;  4J9I A;  2LMJ A;  2X4X A;  2Y4X A;  3M58 A;  4F7U G;  4LXC A;  2OTJ T;  3S3N A;  2DBK A;  5IN1 A;  1I81 A;  4M7A C;  1O75 A;  3BFM A;  4FSX A;  2JN0 A;  4BY6 C;  1MHN A;  2KSS A;  1PKT A;  4N4H A;  4PJJ A;  2AHJ B;  8AT1 B;  4II1 A;  1IB8 A;  5KYX B;  1VQ4 T;  5GAM g;  1UUE A;  1Y96 B;  4JPB W;  1I07 A;  2CKK A;  2MIO A;  2RJE A;  2AZV A;  5D6Y A;  4OMO A;  1GBQ A;  4FYV B;  2H8H A;  2MK5 A;  5A0L A;  5LJ3 g;  3HPW A;  3EGU A;  2W10 A;  5FU7 B;  2XMF A;  4RTX A;  1I4K 1;  2ECZ A;  2RHZ A;  5M9O A;  1M1F A;  3VUZ A;  1EFN A;  1YIT A;  3SD4 A;  1B34 A;  3S6W A;  3MHX A;  4E2F B;  3G4S A;  1YIJ A;  3TSW A;  2QEX A;  1PRM C;  1YJN Q;  2DL7 A;  3ME9 A;  1GL5 A;  2I0N A;  4LUD A;  4Z02 A;  3CCJ Q;  4L59 A;  4OMN A;  1QVP A;  2PU9 B;  1NYG A;  5GAM d;  1VQ9 Q;  4LN2 A;  1UGR B;  1LCK A;  3CCU A;  2V1Q A;  3OSS C;  1N9S A;  2L3Q A;  4FYX B;  4J83 A;  2RHU A;  4X9C A;  3UT1 A;  5EC7 A;  3HFN A;  4M78 C;  1OU9 A;  1MV3 A;  1N6A A;  3GIB A;  5LJ3 d;  2ZCF B;  4JRP A;  4JJB A;  2J6F A;  2X3W D;  2YRV A;  3EG2 A;  2DER A;  3OS2 A;  1VQK Q;  4OB1 B;  2Y4Y A;  1VQL Q;  1T3S A;  1UGS B;  1KQS A;  2CT4 A;  1VQ4 A;  5GJV B;  3M0R A;  2AK5 A;  1M5Q 1;  4CC4 B;  2E6Z A;  1WLP B;  5GAN d;  2VWF A;  1YP5 A;  2EBP A;  2KK4 A;  3MEA A;  1G3Y A;  5IHK A;  1ZSG A;  2E10 A;  2EJF A;  4BAC A;  2BE9 B;  1N27 A;  1TG0 A;  2X3X D;  3JCM g;  1K73 C;  1P92 A;  1AHJ B;  2YXY A;  4ESR A;  2RHI A;  4XTU A;  4M7D G;  4N0A A;  4ZTJ A;  1K4U S;  3A8O B;  5GAN j;  1RAA B;  4A4F A;  4WCI A;  5IXF A;  1KG1 A;  1S72 Q;  2RQT A;  2V1R A;  1BCO A;  2DD4 A;  2YHT A;  1RAG B;  3HRS A;  2XID A;  3RKX A;  2YDL A;  4IUV A;  2X4Y A;  4JRI A;  2RQW A;  4J7I A;  1KQ1 A;  3BE3 A;  2ZPB B;  3CBO A;  4XTZ A;  2OAW A;  2GNC A;  1FMW A;  3CC4 T;  5IXB A;  4D8K A;  4LDV A;  2HEQ A;  3CCS Q;  1KD1 U;  3O5Z A;  1TUG B;  1D1A A;  4FT4 A;  3A8M B;  4M75 F;  3JCM d;  3DLL A;  2M1H A;  2DIL A;  2W0Z A;  5CKF A;  1ZSZ C;  2DZC A;  2ENM A;  3RUX A;  2DL8 A;  2HNI A;  4NS5 A;  4GLM A;  4EIK A;  4CRI A;  2A7Y A;  4PJO D;  3NTK A;  2SEM A;  5GMK j;  3JCM P;  4XTW A;  4X34 A;  4AFQ C;  4B6M A;  1X6O A;  4PK4 A;  4M75 B;  2D8H A;  4C0D B;  2EQI A;  2MAM A;  2DRK A;  1N9R A;  3ZL7 C;  1ZA2 B;  2AKL A;  3I5S A;  1T0J A;  1LJO A;  2JOY A;  3L1A A;  1YBY A;  1YHQ Q;  3QDR B;  1NPR A;  4PJO A;  2DL4 A;  2M51 A;  1TTH B;  3PVQ A;  3SWN B;  4XU3 A;  4A53 A;  3V7R A;  4M78 G;  4LE9 A;  3RNJ A;  4EMH A;  2F1L A;  1KC8 U;  3ULR B;  3CCL T;  2PZ1 A;  4HKE A;  6AT1 B;  3QBY A;  1QP3 A;  3M0S A;  4M77 G;  2A36 A;  5D7U A;  1R77 A;  4A4G A;  1UJ0 A;  4C92 D;  1C6V X;  3CC4 A;  4JUV A;  1Q86 U;  2VKN A;  3CCM Q;  2RO0 A;  3HP9 A;  4C8Q D;  3LW5 E;  1JBM A;  1C0M A;  2CUD A;  2KI7 A;  3I9Q A;  2D1X A;  4F7U E;  3OYN A;  1Y07 A;  1YFN A;  2DIG A;  4EDU A;  5I11 A;  1G3W A;  5KYU A;  2LCL A;  4J6W A;  5CQX A;  1FXX A;  2FEI A;  1BI0 A;  3QUI A;  1AOJ A;  2QQA A;  1ZHI A;  3R6O A;  4C92 A;  5J26 A;  1RI0 A;  4MDW A;  1B34 B;  2RI5 A;  2ED0 A;  1U1T A;  4C8Q A;  3H6Z A;  3P8D A;  1BI1 A;  1YJ9 T;  3QSU A;  2PVG B;  1HSQ A;  3EG3 A;  3G6E T;  2DA9 A;  3PGG A;  2P0K A;  2DYI A;  2LP5 A;  3NPF A;  3UWN A;  5KCH A;  2RB6 A;  3EG0 A;  1LVK A;  1XJW B;  5KYY A;  4OB3 B;  2DFU A;  5DLQ E;  1T0H A;  2BZY A;  1VQ6 Q;  3VS0 A;  3CCE T;  5D6X A;  3HRU A;  4OMP A;  4QVD A;  3CCL A;  3OYH A;  3REB B;  3H41 A;  1IZ6 A;  1ZQ1 A;  5CQY A;  3OB9 A;  4F14 A;  2F2X A;  3MET A;  2YUO A;  3CCV Q;  1W2B A;  2LDM A;  4OML A;  1RUW A;  4FYY B;  1VQ8 T;  3HRT A;  3TEE A;  3KUF A;  5CKE A;  3JB9 I;  1YJN T;  2E4H A;  1X01 A;  2DTI A;  4HT8 A;  2EJG A;  4J9H A;  1SPK A;  4MZP A;  2DK3 A;  1G5V A;  1VQO Q;  2VGM A;  3JB9 G;  3EG9 A;  1JQQ A;  2EQU A;  1JU5 C;  5HCK A;  1WZO A;  1JO8 A;  3MEU A;  1VQ7 T;  2JNG A;  4BD3 A;  5DLO A;  2EQJ A;  3MPU B;  2E41 A;  4PL6 A;  1CKB A;  3L2V A;  2MPX C;  4EMK A;  5A0G A;  2BTT A;  2MWO A;  1VQK T;  1KJW A;  5CK9 A;  1RAI B;  4NL2 A;  5CVI A;  1Q86 C;  3WXM B;  3SEM A;  1CSK A;  3J7A F;  1B7T A;  2LCC A;  1KQS P;  2DYB A;  2PVO B;  3WVE B;  1YJ9 A;  2K5L A;  3C4S A;  4BI4 A;  3GF5 A;  1UEB A;  3L2Z A;  2FB7 A;  2MMP A;  2ROL A;  2HDA A;  3JCM W;  4M7A D;  2AIR B;  3IQL A;  2LX7 A;  2CT3 A;  2E12 A;  1G3S A;  3QZ9 B;  4M7D E;  1B07 A;  5I2M A;  4XTX A;  2J7I A;  4J9D A;  4MML A;  3CCE A;  2BIV A;  3CC7 Q;  2F2W A;  2MOX A;  2HD0 A;  5IH2 A;  1AWW A;  1AZG B;  2AT1 B;  2EKO A;  2XI9 A;  3CPW S;  3MP6 A;  4KRT A;  1RLP C;  1T3L A;  2EYZ A;  2DBM A;  4J9B A;  3OYD A;  1NYF A;  1F1B B;  2CH4 A;  3DB4 A;  9ATC B;  1UEC A;  1VQ8 A;  3RES A;  2EQM A;  1YJN A;  3CCQ Q;  4M7A A;  4PJO F;  4RG2 A;  3CCJ A;  1WHJ A;  3CC2 Q;  2CP7 A;  2K3B A;  4LDW A;  2JM8 A;  2GQV A;  3CCR T;  5I2S A; 
#chains in the Genus database with same CATH homology
 1XQH A;  3LLR A;  3G71 A;  1LNX A;  2KSS A;  3LWH A;  2XDD A;  3OSV A;  4M78 B;  4N4H A;  5CKB A;  5GMK i;  2JUF A;  2AHJ B;  1VQ7 A;  2JVV A;  3OYE A;  3EFS A;  4ELZ C;  1Q82 U;  4UC4 A;  4II1 A;  2RHY A;  1M90 U;  4M7A G;  5GAO m;  2RI3 A;  4FT2 A;  5LJ5 g;  1VQ4 T;  4OB0 B;  5GAM g;  4M7D C;  4R55 A;  2QA4 T;  3OMC A;  4JRQ A;  3HSB A;  3H8Z A;  3MEV A;  1Y96 B;  3V8K A;  5DY9 A;  4M77 B;  2XU8 A;  4OF1 A;  4KT0 E;  4RG8 A;  4PJO B;  2CKK A;  2LNV A;  5GMK e;  1FX7 A;  2X4J A;  4N4I A;  1VQK A;  2RJE A;  2H3J A;  2E6N A;  1SSF A;  5D6Y A;  1VQ7 T;  3QO3 A;  3OS1 A;  4M78 D;  5A0L A;  5LJ3 g;  3VUB A;  2O4X A;  2RM4 A;  3CPW A;  2OTL A;  2EQK A;  1D3B B;  3HPW A;  3PMI A;  4MDX A;  4J7F A;  5GAM f;  2KVQ G;  2K4Y A;  5FU7 B;  2YLB A;  3SDZ A;  1VQ5 T;  4JS4 A;  3NTI A;  1I4K 1;  2E5Q A;  2WSE E;  2RHZ A;  4E47 A;  5M9O A;  1M1F A;  4E7L A;  3VUZ A;  4ATO A;  2LX9 A;  5GAO l;  3CCJ T;  4BE0 A;  1YIT A;  2E70 A;  2KDS A;  3SD4 A;  3ASK A;  1B34 A;  1QVF S;  4XU0 A;  3CME A;  1M4Z A;  3S6W A;  1O9S A;  3MHX A;  2V8I A;  4E7K A;  3RKY A;  3VJP A;  3G4S A;  4RKU E;  4CI0 C;  1VQ9 T;  1YIJ A;  2CZ0 B;  5AYF A;  5LJ3 f;  2QEX A;  1WPY A;  4LD6 A;  4C92 F;  3M4G A;  2XDB A;  1BYM A;  1NPP A;  3FLG A;  3ME9 A;  5LJ5 e;  4C5H A;  5GAM e;  4Z02 A;  3ZBD A;  3VU3 C;  4L59 A;  1H64 1;  4C8Q F;  4DQ2 A;  1QVP A;  3GPL A;  1JRI A;  2PU9 B;  5LJ5 d;  3CCQ A;  5GAM d;  1UGR B;  3MCA B;  3CCU A;  3GNF B;  4MMK A;  3CC2 A;  3OSS C;  1N9S A;  4QVZ A;  4M7D D;  4X9D A;  4J83 A;  2RHU A;  4X9C A;  3UT1 A;  1U8R A;  2RK1 A;  4Y91 A;  3HFN A;  3FIF A;  4EPC A;  3JCM V;  4M78 C;  4M77 E;  5LJ3 e;  3UPU A;  2DTH A;  2PVD B;  2YLC A;  4QQG A;  5A0D A;  1VQP T;  1VQL T;  1VQN A;  3VV0 A;  4PJO E;  3I56 A;  4JJN K;  1N6A A;  2MF2 A;  3GIB A;  4J8O A;  5LJ3 d;  3QXE B;  4C92 B;  3OYG A;  3L2R A;  5FRN A;  2ZCF B;  2R5A A;  3A5Z B;  1QVG A;  4JRP A;  1V29 B;  2B8A A;  2YRV A;  2LC4 A;  5GAN 8;  3CCR A;  4FL6 A;  2P0P A;  4R56 A;  3OS2 A;  3QJY A;  4GY5 A;  2Y4Y A;  4OB1 B;  4C0Z A;  4C8Q B;  4XTY A;  1WGS A;  4IUP A;  3OYC A;  2FYK A;  4YTL A;  1ZBX A;  3G7Z A;  3PNW C;  2CS7 A;  1NE8 A;  1UGS B;  3BW1 A;  4RCC A;  1KQS A;  2VXF A;  2M9U A;  1VQ4 A;  3AHU A;  3MEW A;  3QHS A;  3C94 A;  3CMA T;  3DLM A;  4IKF A;  4RMO A;  2QA4 A;  3JB9 F;  1M5Q 1;  4QQ6 A;  1MGQ A;  1UGP B;  2RI2 A;  2ZGW A;  2E6Z A;  3JSC A;  4M7D A;  1OZ3 A;  3HL8 A;  3OMG A;  3OYA A;  5GAN d;  3P8H A;  3C12 A;  3MEA A;  2KK4 A;  2VC8 A;  4ZN3 A;  4QW2 A;  1G3Y A;  2EJ9 A;  3FEO A;  1OZ2 A;  4OGC A;  2E10 A;  5LJ5 h;  2EJF A;  2QQR A;  4BAC A;  5GAM h;  1M90 C;  1BIA A;  2RA2 A;  3CCU T;  4E7I A;  4A4H A;  1N27 A;  3MP1 A;  5GAN 2;  1OI1 A;  4ZTF A;  3JCM g;  1WQ7 A;  2DKG A;  1K73 C;  1P92 A;  2MWP A;  2PUK B;  1AHJ B;  1R8O B;  5FU6 B;  4JS5 A;  1DJ7 B;  2RHI A;  1S72 T;  2L89 A;  2ZPG B;  4XTU A;  1VQ5 A;  1VIF A;  1Q81 U;  3JB9 H;  4M7D G;  3EAE A;  1UGQ B;  4N0A A;  4ZTJ A;  4WF2 A;  4XK8 E;  2JTF A;  5CCA A;  3A8O B;  3MP8 A;  1K73 U;  2R58 A;  2DJZ A;  1XNI A;  2LRQ A;  5LJ3 h;  4BUG A;  2RH2 A;  5GAN j;  4J6Y A;  3DB3 A;  4N0A C;  2RJC A;  4A4F A;  3T9N A;  1YI2 T;  3JAM E;  2DVE A;  1VQ9 A;  1KG1 A;  3A8H B;  3M55 A;  3FRN A;  1W2B S;  4HCC A;  5I21 A;  2RHX A;  2DD4 A;  2YHT A;  3JCM f;  3ZFJ A;  3HRS A;  2E1H A;  3OQ5 A;  4C8Q E;  2XID A;  3RKX A;  2MI6 A;  1EIF A;  2CYZ B;  2GFA A;  4IUV A;  3CCS T;  2WAC A;  2X4Y A;  3PFS A;  4JRI A;  4C92 C;  1KD1 C;  2XK0 A;  3GOX A;  4J7I A;  1KQ1 A;  2ZPB B;  5GAN 4;  2QTX A;  4HCB A;  2KQW A;  3CBO A;  4Q5W A;  4XTZ A;  5C6S A;  3JB9 D;  2I2L A;  3CC4 T;  5GAN h;  4PNO A;  4XU1 A;  5I2S A;  4LDU A;  4LDV A;  1VQL A;  1VQP A;  2FVU A;  3V7C A;  3J81 E;  3JCM e;  1X75 C;  1KD1 U;  2E65 A;  3A8L B;  3FDR A;  4FT4 A;  3LYI A;  3A8M B;  4EMK B;  4M75 F;  2FL7 A;  3JCM d;  3DLL A;  1LOJ A;  2M1H A;  2OAU A;  1IRE B;  3RIR A;  3M4Y A;  5CKF A;  2DZC A;  3RUX A;  1QW1 A;  4E7H A;  3PT9 A;  2HNI A;  4NS5 A;  4B9W A;  3CCV T;  2LVM A;  4F7U F;  5GAN 3;  3PIP A;  5HK0 A;  4LD9 K;  4CRI A;  2XG8 D;  2LT4 A;  3QG1 A;  4M77 D;  3OYJ A;  1JB0 E;  2A7Y A;  3BY7 A;  4IUU A;  4RCB A;  4PJO D;  2EIF A;  1OYX A;  5HY6 A;  2V8K A;  2LTO A;  5GMK m;  2X4W A;  1M9S A;  3OBY A;  4XU2 A;  3TRE A;  4DOV A;  3NTK A;  4BB7 A;  3CMA A;  3BDL A;  5GMK j;  4MZT A;  4BE2 A;  4XTW A;  3JCM P;  2HQE A;  3DKM A;  4KBM B;  2E64 A;  4X34 A;  3SB2 A;  2F69 A;  2QI2 A;  1X6O A;  3X28 B;  3OYF A;  3L2Q A;  4C5E A;  1VQO T;  4M75 B;  1BI3 A;  4BI3 A;  3J80 E;  3GLX A;  4VUB A;  4A4K A;  2EWN A;  4M7A F;  2VXE A;  4IUR A;  1JJ2 S;  4C0D B;  2MAM A;  1N9R A;  1YHQ T;  4P5N A;  4M78 A;  3EFR A;  3OYY A;  2CGH A;  1Y71 A;  3CXC S;  1YJW T;  4GLK A;  4F7U B;  1S72 A;  1W4S A;  4OMF B;  1G5V A;  1HK9 A;  4D6W A;  1K9M C;  3E9G A;  1LJO A;  1N8R C;  1BIB A;  5CKD A;  2JOY A;  1Y96 A;  3L1A A;  4A4E A;  5FRO A;  5GMK h;  1YBY A;  2QQ9 A;  5GMK l;  5GAO r;  2FHD A;  3QDR B;  1NPR A;  4M77 A;  3V7S A;  1KC8 C;  3V8J A;  4PJO A;  2K5F A;  2DXT A;  4XTV A;  2RK2 A;  3JCM h;  3FB9 A;  3SWN B;  4PLL A;  1YI2 A;  3QJ6 A;  2BUD A;  4XU3 A;  4A53 A;  1K9M U;  3V7R A;  4M78 G;  4M77 C;  5KH6 A;  5LJ5 j;  5GAM j;  1N8R U;  4PJO C;  3OY9 A;  5CO7 A;  4M7A B;  4EMH A;  3M59 A;  3JCM X;  3OYL A;  1KC8 U;  5IT9 E;  3M54 A;  3FJP A;  4BY6 B;  1D3B A;  1KHI A;  3V8L A;  3CCL T;  3L42 A;  3CCM T;  4HKE A;  1WJS A;  3KBG A;  3CCS A;  1VQM T;  2QQS A;  3QBY A;  1U1S A;  1QP3 A;  2CZ6 B;  3E1S A;  1QVF A;  4M77 G;  1GXI E;  1XOV A;  4PJO G;  3OYB A;  2DXB A;  3G6E A;  2HBP A;  2M16 A;  4OB2 B;  5FU7 C;  4A4G A;  4C92 D;  3M56 A;  5LJ3 j;  3CC4 A;  4ZGJ B;  5GAO n;  4JUV A;  5CKH A;  1Q86 U;  4OGE A;  2DIQ A;  2KY9 A;  2RO0 A;  4QQD A;  3CC7 T;  3HP9 A;  3JRZ A;  3CBP A;  4LDY A;  3OS5 A;  4C8Q D;  4M75 E;  1Q81 C;  2QXF A;  3OYI A;  3LW5 E;  4O6J A;  1JBM A;  2R5M A;  4HA8 A;  1JJ2 A;  4ELY C;  3E19 A;  3X20 B;  3GP8 A;  2K5I A;  2DXU A;  3OBW A;  4F7U E;  3OYN A;  1WJQ A;  3CCV A;  1Y07 A;  4FU6 A;  5CIU A;  3QYG B;  5FLX E;  2DIG A;  1BI2 A;  2IVW A;  2DPP B;  4EDU A;  1M8V A;  2O4X B;  4C0D C;  1G3T A;  1G3W A;  2L8D A;  2LQK A;  2LCL A;  2A3L A;  5J39 A;  1XTD A;  3O8V A;  2K3Y A;  4J6W A;  3NFC A;  2EAY A;  1FXX A;  2XKO C;  5CQX A;  2PQW A;  1BI0 A;  3E9F A;  2HQX A;  5GAN 6;  3JCM Q;  4DA4 A;  3QUI A;  3OYK A;  2XD0 A;  2QQA A;  1ZHI A;  5FRM A;  3R6O A;  4C92 A;  5J26 A;  1RI0 A;  3Q1J A;  4MDW A;  3L2U A;  1B34 B;  1TH7 A;  4M7A E;  2VV5 A;  2ZPE B;  2RI5 A;  3L2W A;  1VQO A;  5A2Q E;  1U1T A;  4C8Q A;  3H6Z A;  3P8D A;  2IG0 A;  1BI1 A;  4OVA A;  4EMG A;  1VIE A;  1YHQ A;  4V2S A;  1YJ9 T;  3QSU A;  2CZ7 B;  2NLU A;  2XHC A;  2VYT A;  2PVG B;  2K2V A;  5GAO p;  3G6E T;  3CPF A;  3RMS A;  1YJW A;  4C8Q C;  2C06 A;  3FC3 A;  4JLI A;  1KHC A;  2QQB A;  2X35 A;  3PGG A;  2LT1 A;  3RMQ A;  1VQ6 T;  4BE1 A;  2P0K A;  2V8J A;  4PLI A;  2KAF A;  2DD5 A;  1NJI U;  4C92 G;  2RJF A;  5KCO A;  3S3M A;  5KE3 A;  3ER0 A;  5D6W A;  3P8B B;  3CBM A;  3UWN A;  5KCH A;  4MZM A;  5KE2 A;  2RB6 A;  2JZ2 A;  4C8Q G;  2L5Q A;  3F70 A;  4OB3 B;  4C5I A;  5DLQ E;  1PSE A;  5GAN 7;  3CD6 T;  4M7D F;  4B9X A;  5GAO q;  3CCE T;  3M53 A;  5D6X A;  3OYM A;  4N4G A;  3HRU A;  3GNG A;  4QVD A;  3CCM A;  3OYH A;  3CCL A;  4XQ3 A;  1VQM A;  3M5A A;  3ZEH A;  1IZ6 A;  3QKJ A;  1ZQ1 A;  1WJR A;  5CQY A;  1QVG S;  5CR2 A;  5FU6 C;  3OB9 A;  4ZN1 A;  3MET A;  4BDY A;  3PMT A;  2VUB A;  5J3B A;  4C0G A;  1W2B A;  2DZ9 A;  2LDM A;  2M0O A;  1UB4 A;  1WQW A;  2GCX A;  3QYH B;  5HKC A;  3LGL A;  5LJ5 f;  3I55 T;  1VQ8 T;  3HRT A;  3TEE A;  4J5Y A;  5C0M A;  2G3R A;  2RJD A;  4QVC A;  2L3R A;  3KUF A;  2DXC A;  5CKE A;  3JB9 I;  3CC7 A;  2WSF E;  1YJN T;  3INZ A;  3NTH A;  1X01 A;  3WVD B;  2LQ8 A;  2DTI A;  1KQS S;  4NL3 A;  3QPH A;  5L8R E;  4M7D B;  4L5G A;  2HAX A;  4HT8 A;  2EJG A;  2F5K A;  2DTO A;  2EYQ A;  2RD1 A;  4E7J A;  3OW2 S;  1K8A C;  1I5L A;  2DK3 A;  1HXD A;  2GFU A;  3HKS A;  2D9T A;  3HHT B;  4MZP A;  2VGM A;  2O01 E;  4NOY A;  4TVR A;  1Y7X A;  3G71 T;  3JB9 G;  1Q7Y C;  2QDY B;  4KUI A;  2P0Q A;  2DAQ A;  3URG A;  2EQU A;  4DOW A;  3LH0 A;  3LX7 A;  3SFM A;  3MEU A;  5GAN g;  2JNG A;  3BDU A;  4BD3 A;  3LWI A;  2PUO B;  5DLO A;  1FWZ A;  2EQJ A;  4M78 E;  4M75 D;  3RER A;  1K8A U;  2E41 A;  2JTM A;  4PL6 A;  3VYG A;  3VKI A;  3L2V A;  1Q7Y U;  2CZ1 B;  4EMK A;  3OA6 A;  5A0G A;  5GAN 5;  2MWO A;  3M9Q A;  2DO3 A;  1VQK T;  4BI8 B;  5CK9 A;  4NL2 A;  2WSC E;  5CVI A;  4A54 A;  3KXT A;  3WXM B;  2ZPF B;  4EMK C;  1Q86 C;  2D6F A;  1PSF A;  4PKC C;  3J7A F;  3HFO A;  2LCC A;  1QP2 A;  4XAX B;  1M1K C;  1YJ9 A;  1YCY A;  2PVO B;  3QII A;  3WVE B;  3C95 A;  3X25 B;  5GAN f;  2OTJ A;  2K5L A;  3C4S A;  4BI4 A;  2OTL T;  1WNL A;  3GF5 A;  1UEB A;  3RKW A;  1NZ9 A;  3L2Z A;  3UDC A;  2FB7 A;  4HCZ A;  2DEQ A;  3MO8 A;  3X24 B;  2MMP A;  3PIO A;  1VQ6 A;  3N5B B;  4FM4 B;  4BDZ A;  3JCM W;  3QZ5 B;  3M57 A;  4C0F A;  1M1K U;  2Y90 A;  4M7A D;  2EFI A;  4OP0 A;  5LL6 S;  2GF7 A;  1YIT T;  2P4T A;  2E12 A;  1G3S A;  3CME T;  4KUD K;  3QZ9 B;  1I8F A;  2K57 A;  2ZPH B;  4M75 A;  3TCJ A;  2R57 A;  4C5G A;  2KMT A;  4LDX A;  2XDP A;  4ZGE B;  3G4S T;  1YIJ T;  4M7D E;  3LGF A;  5I2M A;  4XTX A;  4JDS A;  5GAN e;  3CD6 A;  3CXC A;  2QEX T;  4MML A;  4O5V A;  3CCE A;  2BIV A;  4M75 C;  4ME7 A;  3OW2 A;  3JB9 J;  2HD0 A;  5EG2 A;  4FIB A;  2ZZD A;  4F7U A;  5HK3 A;  2EKO A;  4JRK A;  5DM7 R;  1KQ2 A;  4Y28 E;  2XI9 A;  3A8G B;  3CPW S;  3PTA A;  3MP6 A;  1VUB A;  3CCQ T;  4M78 F;  1M1G A;  3S3O A;  2XIC A;  4IUT A;  4L6V 5;  5IAY A;  3OYD A;  3CC2 T;  3DB4 A;  4M75 G;  4ZGD B;  4JLG A;  3CEY A;  3JCM b;  4IUQ A;  5CAI A;  3I55 A;  3VYH B;  1VQ8 A;  3SWN A;  3RES A;  2BKD N;  1RL2 A;  3JCM J;  2D0Q B;  2K3X A;  3JCM c;  2X4X A;  1VQN T;  4J6X A;  2EQM A;  3I56 T;  1YJN A;  4M77 F;  3TU4 K;  1NJI C;  2Y4X A;  4M7A A;  2VGN A;  4HT9 A;  3M58 A;  3SWN C;  4PJO F;  2F5T X;  4RG2 A;  4F7U G;  3OS0 A;  3CCJ A;  2OTJ T;  3S3N A;  2ZPI B;  4KUL A;  1BKB A;  1H3Z A;  5IN1 A;  1I81 A;  4M7A C;  1O75 A;  1Q82 C;  3BFM A;  4LDW A;  4FSX A;  2GQV A;  4C92 E;  3CCR T;  2JN0 A;  3X26 B;  4BY6 C;  1MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...