1OZ2A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
324
structure length
324
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A03
2K3YA 4E7JA 2E6NA 3OYEA 4HCZA 3FEOA 2B8AA 1SSFA 2QQSA 3UT1A 5C6SA 2R58A 2RO0A 3NTHA 5IN1A 3ZEHA 3EAEA 2DIQA 1OI1A 3QIIA 2O4XA 5FRMA 3FDRA 3NTKA 2G3RA 1XNIA 4ZTJA 4N4HA 2L8DA 2MWOA 1OYXA 2RJCA 3E9GA 1KHCA 2M1HA 5KE2A 2L89A 3OYHA 3P8HA 4ZTFA 3SD4A 4CRIA 4GY5A 2RHZA 2X4XA 2RHYA 3MEAA 5J39A 4C5GA 3OYKA 3L2QA 2EFIA 2M0OA 5D6XA 4E7KA 3CEYA 1MHNA 3LX7A 4BACA 3OS2A 2PQWA 4N4IA 2IG0A 2GFUA 3LGLA 4B9XA 5J26A 2LTOA 4PLIA 3PMTA 3L2RA 2WACA 2RJEA 3O8VA 1N27A 4NS5A 3MEUA 4BE2A 4LD6A 2HQEA 4A4EA 3META 4X34A 3LGFA 3QBYA 3FLGA 4BDYA 2NLUA 2EKOA 2P0KA 4PL6A 5KCHA 2BIVA 2FHDA 3PNWC 4B9WA 4EDUA 3OYDA 4QVZA 2CKKA 4FL6A 3MO8A 1WJQA 4QQGA 4QW2A 2RHIA 4Z02A 2MWPA 2F5KA 4OVAA 3OYJA 4E7LA 1G5VA 4E7HA 3H8ZA 4IUTA 2LRQA 2K3XA 2X4WA 3OS1A 2GF7A 3OMCA 3OYBA 2X35A 3GOXA 2BKDN 5IAYA 3OY9A 4RG2A 3OYFA 2L3RA 2XK0A 3OYLA 1WJSA 4IUPA 4C5HA 4QQDA 3S3OA 3P8DA 2EQUA 4PLLA 4BE0A 5C0MA 3MEVA 4II1A 2E5QA 4L59A 3Q1JA 2DIGA 3OYGA 4IKFA 3S6WA 3LLRA 4IUVA 5KE3A 4UC4A 3S3MA 3L2WA 2D9TA 3OB9A 3MP6A 2R5MA 5D6YA 3OYMA 2EQKA 2RI3A 2R57A 3MEWA 2RI5A 4A4HA 4BE1A 5CIUA 3L2UA 3ME9A 3C4SA 2EQJA 2HQXA 3H6ZA 3OQ5A 3UWNA 3QKJA 4A4FA 2JZ2A 2QQRA 2R5AA 3F70A 2GFAA 5KH6A 4FU6A 3OA6A 4BDZA 3L2VA 1WJRA 4IUUA 3MP1A 3BDLA 3MP8A 3NTIA 3OYAA 2BUDA 5FRNA 2LVMA 3L42A 3OYNA 5FROA 3DB4A 3DB3A 5M9OA 3M9QA 3QJ6A 3OYIA 3S3NA 1OZ2A 3ASKA 3FC3A 1OZ3A 3OMGA 2JTFA 5D6WA 3OS0A 3LH0A 4A4GA 2RHUA 4N4GA 3E9FA 2RI2A 1H3ZA 2M16A 4C5EA 3PMIA 3LYIA 1WGSA 4IURA 2RJDA 4IUQA 2XDPA 5KCOA 3OYCA 2RJFA 4E7IA 3DLMA 4C5IA 1RI0A 2EQMA 4Q5WA 2LCCA 2O4XB 2DAQA 2VYTA 2X4YA 2YRVA 3KUFA 2RHXA 3PFSA 4QQ6A 4BD3A 2LDMA
chains in the Genus database with same CATH superfamily
5A0LA 3CCRT 3PE0A 2LT1A 2DJZA 3M57A 4M77B 2ESWA 1YJNT 2O4XA 1UECA 3JB9H 1QLYA 1AVZC 5KE2A 2L89A 2MAMA 2ZPHB 3EG9B 3TVTA 4M78C 1FWZA 2M02A 5KYYA 2COZA 4JS5A 5D7UA 1ZUKA 1NZ9A 3EG0A 2PQWA 4B9XA 2I0NA 4M7AB 2RQRA 4NS5A 3META 3HP9A 5I22A 5CAIA 5I2SA 1QKXA 1W4SA 4PJOC 3SWNC 2P4RA 5GMKj 3GP8A 4LXCA 1I5OB 4FL6A 2HAXA 2MWPA 3MKDA 4OVAA 3RUXA 1UFFA 2X4WA 2KXDA 2GF7A 3OY9A 2BTTA 4X9CA 4FYWB 4BE0A 5DLOA 2V26A 2E5QA 4BY6C 1AZEA 2QA4A 1BI1A 1M8VA 2O88A 2QTXA 5CIUA 3HFNA 2ZZDA 1Q86U 3BY7A 4FU6A 2V1RA 4J9BA 5FRNA 1AT1B 5GAMe 1VQ4Q 5L8RE 2GTOA 4AFQC 2DD4A 1Y96B 1AWJA 3ASKA 4XU3A 2RHUA 1M1KR 2M16A 4RTZA 3BW1A 2P84A 4E7IA 4MMLA 1PM3A 2C0OA 3OYEA 1VQ4T 1PKTA 2XIDA 5IN1A 2KBTA 2FRWA 3CCQA 1I07A 4XU1A 1H92A 2KDSA 2MF2A 3OYHA 2E41A 3SD4A 4B6MA 2RHZA 3EFSA 4D8KA 2M9UA 1QWFA 2KT8A 5LJ5h 3TCJA 1UE9A 3M4GA 2M0YA 5GAOm 4MZMA 5CKEA 1I4K1 2J05A 1OPKA 2BZXA 1VQ6A 2KGTA 1N5ZA 3TQ7P 1JB0E 4OMNA 2EGEA 2J7IA 4B9WA 5KYWB 1Q82R 1MNEA 2NWMA 1K8AR 4FM4B 1MMDA 3G4SA 5GAN7 1YJNA 5KYWA 1VQ8A 2LMJA 3TREA 2L3RA 4DOWA 3CMAQ 3H41A 2JNGA 4PLLA 2EWNA 2EGAA 4OB2B 4JJCA 2FZCB 3MCAB 2NUTA 2XD0A 4Y91A 1RAGB 2RH2A 2RI5A 2KROA 3L2UA 2K5LA 5HCKA 2D8HA 5GAOn 1M1KU 2J6FA 1X43A 3CMAT 1V1CA 3MP1A 5J3BA 2PUOB 2PVDB 3NTIA 1UGPB 3QDFA 2JVVA 1UGRB 4XTZA 1M90C 2FPFA 2XU8A 3AT1B 4C8QB 1Y71A 2X9HA 5IXBA 5GANh 2A36A 2IVWA 4RMOA 4R56A 4R55A 3I35A 2KT1A 2LQ8A 2QGGA 3VS7A 5LJ3h 4WF2A 4XTXA 2ZPIB 3UPUA 3JCMf 2AK5A 5LJ5g 3JCMW 2KEAA 1QVPA 4RTYA 2G3RA 4DBFA 3V8JA 1Y0MA 1YN8A 4LDYA 5CKHA 5HK0A 3THKA 4N4IA 4VUBA 3VUZA 3CCJQ 2VC8A 1Q82U 1WHMA 4DOVA 2AKKA 3CPWS 1UG1A 4OF1A 4E7SA 1K8AU 1MV0B 4M75B 2HKNA 1XQHA 3GBQA 2O9SA 1UGQB 3CCJT 2ECZA 2HBPA 3OW2S 1B07A 2KYMA 2DXTA 1RACB 1VQ5A 1UJYA 4JRIA 3JCMX 2OX7A 4IIOA 3CC2Q 2XK0A 4C8QF 4C92C 4FYYB 1YIJA 1YCSB 4II1A 4ORZA 4GBQA 5KE3A 3I55T 1X27A 1X69A 2JS0A 2Y90A 3CC2T 3I5RA 4E2FB 3G6ET 2C0TA 1BU1A 5GANg 4BDZA 2QEXQ 3M0SA 2JXBA 1WHKA 4IUUA 1S72T 4M7DB 1VIEA 3L42A 5LJ3g 1P92A 1CKBA 2RD1A 2CT4A 2AHJB 3N5BB 3OMGA 1M2VB 1VYTA 4M77C 3JB9I 3OYCA 1TH7A 4RTTA 3PIOA 1R0BG 2QEXT 1WDXA 5I2MA 4M75D 2EJ9A 1T3SA 3I56A 1NBEB 2ROLA 1RUWA 1VYVA 1LCKA 4DQ2A 3TU4K 2HMAA 3CBOA 3UDCA 3CC4A 1ZSZA 1BCOA 3V7SA 5C6SA 4E6RA 2DK3A 3ZEHA 4M7AC 3EFOA 2L8DA 3WVEB 3P8HA 4KT0E 1M8MA 1NYGA 1J3TA 2CUBA 1LVKA 4J7IA 5D6XA 4HA8A 1DJ7B 2LX9A 2QDLA 2WACA 4M78D 3HSBA 1UDLA 4X34A 1KG1A 3LGFA 1B34A 2MK5A 3JB9D 2A0FB 4A4KA 1W2BA 1I5LA 4PL6A 3RERA 4AFUC 4JZ3A 4HCKA 4D8DA 4Y28E 1QCNA 3OYJA 1YJ9T 3OSVA 4PJOD 1YCYA 1VQ9A 4JDSA 1X75C 2BZ8A 2VB6A 2CZ6B 1WQ7A 4O6JA 3VYGA 1Q7YC 1VQMA 1WPYA 2EQUA 1KC8C 1RAFB 3X25B 3GLXA 4FYXB 2K4YA 4IKFA 1XTDA 4UC4A 5D6YA 1HD3A 3RBBB 3C94A 2FO0A 3C95A 3X26B 1X6OA 1Q81C 1RLQC 5KH6A 1WXBA 3VS5A 2COYA 3H0IA 2KRSA 2DJQA 1YWOA 2DA9A 3EFRA 4IURA 1VA7A 1WGSA 2HCKA 4JJNK 2KRMA 4Q5WA 4BUGA 2RHXA 4PJMA 2EYQA 5GAOl 4JPBW 4E7JA 2RK1A 3UT1A 4RTXA 1D1AA 2K57A 3QZ9B 3I55A 1OI1A 1AWXA 2LNHB 3NMZC 2DEQA 2BE7D 3G6EA 1AWWA 1SRLA 1JJ2S 1S72A 4PJNA 5CKFA 1OX8A 1PWTA 2QA4Q 1UB4A 3RR6A 4F7UE 1QCOA 2FL7A 4OGEA 4HT9A 1HYOA 1K1ZA 2VASA 2K79A 4JRPA 3FRNA 1WQWA 4NL3A 5KCHA 3A98A 2XG8D 2CKKA 2ZCFB 2GTJA 2F5KA 1TUDA 2GGRA 1M27C 2Y4XA 1G5VA 4FW1A 2VKNA 4AFSC 2JM8A 1OU9A 2EPDA 4BI3A 2F5TX 3JCMc 5GAN6 2FPEA 2CH4A 3PGGA 3REBB 1VIFA 4J9GA 5GMKh 2DBMA 1ZSGA 3UF4A 1WFWA 2D9TA 1QVFA 2L2PA 4LDWA 4N0AC 1SSHA 3CCQQ 4L6V5 3ME9A 3CCMT 1Q86C 1LNXA 3A8MB 4RCBA 1KIKA 1TG0A 4C8QC 2VGMA 1KD1U 1K9MC 4E47A 2E3IA 3LWHA 1QMCA 4KBMB 4HKEA 3V8KA 1R77A 4CC4B 1LJOA 2K2VA 2CP2A 1OZ3A 1AD5A 1YJ9A 1GCPA 1SHFA 3E9FA 4ELZC 5KYXA 3CCQT 3C0CA 4LDXA 3OYYA 3HRUA 1W1FA 1VQ6Q 2LCCA 2DAQA 2ZPFB 1QP3A 4CC7A 2GCXA 4IUVA 1KSWA 3EH1A 4EMKB 2B8AA 2J6KA 1FMKA 1TTHB 3EAEA 3QIIA 1ZX6A 4N4HA 3JCMb 1U1SA 3G4SQ 1C0MA 2O01E 1OYXA 4J9IA 2DD5A 4M75C 1YJNQ 1VQ8Q 1VQLT 2I2LA 2OTJT 1VQ6T 4RG8A 2KNBB 4BI4A 2YRCA 3L1AA 1X2KA 1PC0A 1I8FA 3PMTA 4FCYA 1UGVA 3L2ZA 2GQVA 1EFNA 2DL3A 4A4EA 3G4ST 4JUVA 1GCQA 3CCVA 4OMOA 1BK2A 5KYYB 1KQSA 3KFVA 3LWIA 5IT9E 1VQ8T 2OI3A 2K2MA 1UGSB 2ROTA 1K9MR 2PZ1A 1OX9A 5A0GA 1GFCA 3MJXA 3CCLT 2YUNA 1ZHIA 1W2BP 2QXFA 4A63B 3JCMV 3IQLA 4ZNXA 4Z89A 5DY9A 2GBQA 2VUBA 3OYGA 1OU8A 2E12A 4M7DC 2JM9A 3SHWA 4C92D 2YSQA 2ZPBB 4OMFB 1Y7XA 1VUBA 2JJ9A 3RMSA 1X2QA 2VV5A 3RDVA 4XTUA 2DF6A 2JTEA 1EIFA 3MHXA 2HZYA 3M9QA 5GAMf 5GAMj 3PVQA 3A8GB 1ZUUA 1MMNA 1BIAA 2DEUA 4M78G 3H0FA 5EC7A 2FPDA 2DERA 2IPOB 2DPPB 4C5IA 1N8RC 2CSIA 3JB9G 3SB2A 2DKGA 1PG5B 2LDMA 3BFMA 1PD1A 4M77D 2QQSA 2YT6A 1VQPT 2VGNA 1WHLA 2RO0A 4CI0C 1YHQT 2H8HA 3CPFA 4PJOG 3J81E 1VQ5Q 3CMET 3CCST 2F2XA 1IHWA 3E9GA 1KHCA 2M1HA 3A5ZB 2F2VA 3CCMA 1VQOA 5FU7B 1BI0A 2RHYA 3JRZA 2DLPA 4M7AD 4E7KA 2LC4A 1YIJQ 4BACA 3QYGB 3OS2A 3JCMh 3JAME 1K4US 4DEXA 1N6AA 2YXYA 2EYYA 1N27A 2MOXA 1VQ5T 3QDRB 4IIMA 3H0HA 1OULA 2ZPGB 4ANJA 1A0NB 2E70A 2AZSA 1YIJT 4QVZA 2F69A 1F1BB 1D3BB 4AG1C 4XAXB 2WSCE 2QDYB 4F7UG 5LJ5d 4KULA 1H3HA 2HSPA 3OYFA 2WSFE 1D3BA 2D0NA 1FMWA 4OP0A 4IUPA 1WNLA 1VQLA 2OTJA 2DL4A 1KHIA 1N8RR 3Q1JA 5GAN5 3I56Q 3RKWA 2VWFA 4PFZA 3OB9A 3CC4Q 4KRTA 3EHRA 3CCEA 1UHCA 2LP5A 1M3CA 3UWNA 4V2SA 3X28B 1YI2T 2ZPEB 3I9QA 1QWEA 3OYAA 3OYNA 2NUTB 1JQQA 1QVFP 4ME7A 3I56T 3RKYA 3JCMP 3OYIA 2CP3A 4C0GA 3CC4T 3TSWA 3WXMB 1C1AA 3CCLA 2DTOA 3PMIA 4MDXA 2QG9B 4JJBA 4ZN3A 1AWOA 4Z8AA 4KH0B 4QVDA 1K73C 2XICA 2NUZA 1SSFA 1G3WA 4KGXB 4P5NA 2EGCA 3JCMg 2KY9A 2R58A 4AFZC 5CR2A 1AZGB 2DBKA 1XNIA 4A53A 5KYUA 2F2WA 1VQ9Q 1MMGA 3V8LA 3HFOA 1SF9A 4CRIA 3WVDB 1M4ZA 2CH4W 5GANd 1VQMQ 5FW9A 4ZGDB 4LNPA 2AT1B 2LNVA 3JCMJ 3LGLA 1FXXA 1PCXA 5LJ3d 1AEYA 3M5AA 2XDDA 3VUBA 1VQ9T 5IXFA 1G3YA 4F17A 1U8RA 1NJIC 4GLMA 2H3EB 4J6WA 1VQMT 1JXOA 3UA6A 5HY6A 5A2QE 2JW4A 1VQPA 2SEMA 2HL3A 3VYHB 2K3BA 1YHQA 1KQSP 1X6GA 2RMOA 3GOXA 2PVOB 2HD0A 4AG2C 3CMEA 3CCSA 1JEGA 2IIMA 1E7OA 1I0CA 2RQWA 1IREB 4C5HA 3S3OA 3P8DA 1PSFA 1NYFA 1R0CB 2O9VA 3QXEB 3OYMA 2C0IA 4ZGEB 4QVCA 3I55Q 1D0XA 3OQ5A 1TUCA 4EMHA 2OAWA 2QQRA 3F70A 5LL6S 3HTRA 1TSFA 2KQWA 4RKUE 3BDLA 3G6EQ 2RB6A 1M90R 3M56A 2VXEA 4F14A 2QAZA 1ZQ1A 1S72Q 1T0JA 5GMKm 1OZ2A 1HXDA 4EMKC 4C8QD 3PIPA 2JTFA 4HCBA 1N9SA 2YLBA 3QG1A 3REAB 5KCOA 2CP5A 5CVIA 4J9CA 5DLQE 5I21A 5LJ5e 1EX4A 1NJIR 2E3HA 2DZCA 2XKOC 3G1JA 3CXCS 2RQVA 3TEEA 2OAUA 3VRYA 3NTKA 4DBQA 3VV0A 2EJFA 1JRIA 2HEQA 2CGHA 3VKIA 1YITT 4M78A 4C5GA 2D6FA 3L2QA 1YI2A 2M0OA 4OMPA 1ZSZB 3LX7A 2G6FX 2P0PA 3CC7T 2KRNA 3EFOB 2JOYA 2LTOA 1MV3A 3X24B 3O8VA 4C92G 4JRQA 3JCMQ 4YTLA 1U3OA 2GQIA 1RADB 4JZ4A 1JU5C 4BDYA 2JMAA 1OPLA 4PJOA 3SWNA 2BIVA 3PNWC 4LUDA 5AT1B 1KQ1A 2W0ZA 1IB8A 5GJVB 4QQGA 4TVRA 2FG0A 3GPLA 4ZN1A 1U5SA 3FIFA 2LCLA 3OS1A 2CDTA 4MZTA 1B34B 4E7ZA 1YJ9Q 1QVGA 2AIRB 1GBRA 4M4ZA 2DETA 3G71T 4R0KA 1GBQA 4M77G 4F7UB 1BKBA 4M75E 3MP6A 1NEGA 2LQKA 4M78F 5GANe 3R6OA 1PHTA 3A1PA 4M7DD 1UUEA 5LJ3e 1G3SA 1KD1C 4HVWA 1WJRA 4A54A 4F7UA 2YRDA 1XJWB 5CK9A 4M7AG 2DM1A 2VVKA 3M54A 3QWYA 3OS0A 1W2BS 2QGFB 4PJOF 4N4GA 3E1SA 2RQTA 3M0QA 2RJFA 1VQNA 5FWCA 3OBYA 4M78E 3CCVQ 3KUFA 3PFSA 4QQ6A 5FU7C 2KXCA 2X4JA 4J9DA 1MMAA 2DIQA 2EQIA 1ABOA 1D1BA 2EVRA 2DTIA 2QQBA 5FU6B 4PJOE 2D8JA 4J9FA 3CCVT 1QCFA 4KGZB 1G2BA 2D0QB 2IG0A 1GXIE 3QO3A 4F7UF 2FYKA 2ENMA 2QQAA 2K5FA 2NUPB 3HPWA 4O5VA 3LW5E 1R8OB 2FHDA 2NUPA 1JJ2A 3UA7A 4FW2A 2LRQA 3VS2A 1QW1A 1Q7YR 4CC2A 1KC8R 4EIKA 2X35A 1MGQA 2BKDN 1RAIB 1E6HA 3EGXA 8ATCB 2HNIA 1WJSA 1W70A 3DKMA 3CCUA 2W10A 1YITA 3D7SB 1SG5A 1XOVA 3JV3A 2HDAA 5IHNA 3CC7A 4J7FA 4Z88A 3SFMA 1Q81R 2KK4A 1ZLMA 2DZ9A 4OMQA 4BE1A 2E65A 2HBWA 4A4FA 1KQ2A 2R5AA 3OA6A 3L2VA 1Y57A 3CCMQ 1VQOQ 3BE3A 2DNUA 2DVEA 2LVMA 1NM7A 1IZ6A 2DRKA 5GAOq 4OB0B 2DX1A 3EG2A 1BBZA 1FYNA 1QKWA 2K5IA 2YWWA 4HT8A 1B3QA 1H3ZA 3A8LB 2QYZA 3LYIA 4Y92A 4RTVA 4IUQA 1V29B 2RF0A 1YJWT 2CZ1B 2RK2A 9ATCB 4KUDK 2E5KA 1VQOT 3ER0A 4BD3A 1Y07A 4C0ZA 3FEOA 3G71A 3QWXX 1TS9A 3A8OB 4NL2A 5GAMh 3NTHA 1IGQA 2EKHA 5KYXB 3FDRA 4ZTJA 1KFZA 1TUGB 1WHHA 4ZTFA 4XQ3A 3RESA 1QVFS 1D0ZA 2KMTA 5J39A 3ZBDA 4PFPA 3U23A 1VQLQ 2OTJQ 4J6YA 2GNCA 2KI7A 4PLIA 1WXTA 2M51A 1WHGA 4J5YA 3CCEQ 3VS4A 1RI9A 4BB7A 3QSUA 1O75A 2NLUA 2P0KA 1WYXA 3M0RA 8AT1B 4PKCC 5GAOp 3OYDA 4Z02A 1T3LA 1WJQA 3MO8A 4QW2A 2BE9B 2MCNA 2L3QA 3OSSC 2CP6A 3CD6A 4C8QG 2L0AA 2OTLA 5CO7A 5IAYA 3CCET 3TSZA 2ABLA 1IHVA 3CCLQ 1NEBA 5GMKl 4C92A 4ATOA 2JN0A 2JS2A 4J6XA 3S6WA 1Q86R 3C12A 1B7TA 1QVGP 2LJ1A 2XI9A 3QUIA 2DL7A 2CT3A 2EQJA 1ZA2B 2LCSA 1YFNA 3JB9J 2XMFA 5HK3A 2DXBA 4WTOB 4PJJA 1FX7A 2YHTA 5M9OA 3S3NA 3QJ6A 1KQSS 1H8KA 4M75G 5GAMg 4A4GA 1ARKA 5DM7R 2BZYA 1BCMA 4M77A 4MDWA 1WXUA 3T9NA 2X3XD 1RI0A 2EQMA 4HVVA 2VYTA 1Z9ZA 1KK7A 2LQWA 1M1KC 3EG9A 4HCZA 1ZSZC 2J6OA 4LD9K 4EMGA 1ZBJA 2RM4A 1YWPA 1VQPQ 4C92F 4OMLA 4M7AA 1YHQQ 4XU2A 1BB9A 3EG1A 3RKXA 1UEBA 1V76A 3CMEQ 3CCSQ 2HQHA 1NLOC 4DBHA 3BDUA 2Y4YA 3ZL7C 1MHNA 5GMKi 1PRMC 4RCCA 2PUKB 4OMMA 5J26A 1VQKA 1U06A 2CUDA 3MEUA 4HCCA 2Z0WA 3GF5A 4RUGA 1AHJB 3M53A 1D1CA 2RQUA 3QBYA 4MMKA 5GMKe 1PNJA 4C92E 1YJWA 4M7DG 1CSKA 5CCAA 2A08A 4BI8B 2ED0A 4EDUA 2O31A 1WIEA 1HK9A 2YUQA 2MI6A 4M77F 1E6GA 1GRIA 2QI2A 2A28A 4PK4A 3JCMd 4ELYC 1Q82C 1K9MU 2ATCB 1D0YA 1YNZA 1K8AC 2A7YA 1JJ2P 1PD0A 1TWBA 3VS3A 4M7AF 2H3JA 3NFCA 1TOVA 5FWBA 2LJ3A 3QJYA 2KR3A 3CBMA 3MEWA 1Y96A 4A4HA 4M77E 1PSEA 2CYZB 2CP0A 4PJLA 1VQ7A 2DL5A 1M1FA 1PKSA 3QKJA 4C0DB 5HKCA 1OV3A 1UTIA 2MIOA 3MP8A 3VJPA 1YI2Q 3NGPA 3A8HB 2DRMA 2DO3A 4M7AE 2YDLA 1QP2A 3KBGA 4K11A 1W6XA 2QQ9A 3P8BB 2EYWA 4C5EA 3OS5A 1YP5A 5FU6C 2CSQA 2YRVA 1FMVA 2K3YA 4AT1B 2E6NA 5IHKA 3X20B 2B86A 2P4TA 3J80E 2RNAA 5GAN3 2O2OA 2MWOA 2RJCA 1NPPA 1WX6A 1M3AA 2X3WD 1RLPC 2X4XA 1RL2A 3FJPA 3OYKA 3CCRA 2KE9A 4ZGJB 2EW3A 1K0SA 1WA7A 1PRLC 2RA2A 1WZOA 5KYUB 4BE2A 1D09B 3ZFJA 1IRXA 2K7AA 1ABQA 3FLGA 3R6NA 1MUZA 1G3TA 2MPXC 1G8XA 3GNFB 5KYNA 5L23A 4X1VA 2RHIA 1WLPB 2PNIA 5CQYA 3OYBA 3GIBA 5GAN4 2KAFA 4LE9A 1C6VX 1EZZB 4F16A 1VQNQ 4XK8E 2DXUA 1M30A 1NG2A 2HL5C 1TU0B 3L2WA 2E64A 1N8RU 4N0AA 4OGCA 3OBWA 2JZ2A 3CPWA 5GAN2 4C8QA 1VQNT 7AT1B 2C06A 4KGVB 2JTMA 2MYSA 3DB4A 3VS6A 3RNJA 4MZPA 1X01A 1K73R 3LH0A 1IO6A 4JRKA 5IHIA 1ACMB 1M2OA 3G7ZA 3OW2A 3DLMA 3E2UA 4J9HA 2X4YA 2FB7A 3JCMe 4LUEA 4LDUA 5LJ5f 5LJ5j 3PT9A 4QT7A 1TXQA 3CBPA 3NHNA 2LT4A 3FJ5A 3GNGA 2P0QA 1JO8A 4M75A 1YBYA 1ZUYA 1JBMA 1IGUA 5EG2A 1VQ4A 3CEYA 3CCUQ 1YITQ 1I1JA 1M1GA 1NPRA 2GFUA 2V8JA 3CXCA 3CC7Q 2RJEA 1BI3A 2JT4A 1GCQC 1U1TA 3E19A 4M78B 3PVLA 3M58A 3DLLA 2LJ0A 5ECAA 3URGA 4FT2A 6AT1B 4DBRA 2PVGB 3M4YA 3QYHB 3CCUT 2E6ZA 2AKLA 4E7HA 1M3BA 3H8ZA 4IUTA 3RMQA 1SEMA 1ZA1B 1SPKA 2EAYA 3OMCA 3HL8A 2L5QA 4PJOB 3SWNB 4JLGA 1JXMA 3EH2A 1CKAA 3O5ZA 4C8QE 2PTKA 3EGUA 1IXDA 4KH1B 4L59A 5GAN8 3LLRA 4LDVA 3QZ5B 4M7DA 3G71Q 3S3MA 4M75F 2R5MA 1MNDA 2E10A 2V1QA 1K73U 2HQXA 3H6ZA 5GANf 5GANj 1M2VA 4ESRA 2GFAA 1LOJA 5AYFA 1M5Q1 5LJ3f 5LJ3j 4BY6B 1OOTA 2ED1A 3QHSA 2QK0A 2DVJA 2V8IA 3VRZA 3FC3A 3M55A 5D6WA 2V8KA 1M90U 3M0PA 3M0TA 3UATA 2EJGA 5GJWB 1SRMA 3CMAA 3QPHA 3H9NA 4PFOA 1QVGS 2XDBA 3JB9F 4F04B 3M0UA 2KYBA 2JMCA 1RAHB 1NJIU 1SHGA 1ZBXA 3CD6Q 2OTLQ 2J06A 2EIFA 3J7AF 4M7DF 1K0XA 1OQKA 3EHQA 2KSSA 2EFIA 3JSCA 2A3LA 1VOMA 2FVUA 2EYXA 1OEBA 2CP7A 1HJDA 3CD6T 1BYMA 2FZKB 2RPNA 2OTLT 2FRYA 4EPCA 2EKOA 2DFUA 4XTWA 2KVQG 1BIBA 4M7DE 1VYUA 4QKUA 3ULRB 2F1LA 4KUIA 4J9EA 4FSXA 2E1HA 2K6DA 4L5GA 2E4HA 1G83A 1M9SA 1GL5A 4RG2A 2FZGB 5GAOr 2AZVA 4GLKA 4C0DC 4LN2A 4J83A 2K9GA 2CREA 2LX7A 3MEVA 5C0MA 1T0HA 3CCJA 2DIGA 1RABB 1AOJA 2D1XA 2DTHA 1UHFA 1QQJA 4OB1B 3M59A 5CKBA 3HRTA 4C0FA 1KD1R 2EQKA 3VU3C 3EGXB 3SDZA 3C4SA 1BI2A 1H641 1S1NA 2WSEE 3NPFA 2CZ0B 1K76A 4PNOA 2BUDA 4WCIA 4RTUA 4X9DA 4JLIA 1N9RA 1WI7A 3DB3A 3VS0A 4FYVB 3EG3A 2XHCA 2EBPA 5CKDA 4CC3A 1VQKQ 2RN8A 3CC2A 3CPWP 3RIRA 1GFDA 2RI2A 3HKSA 2XDPA 5I11A 1KJWA 1YJWQ 5CQXA 2YLCA 5IH2A 1LPLA 5FRMA 1VQKT 3OW2P 4D6WA 2A37A 2QEXA 1UJ0A 3INZA 3I5SA 5FLXE 4GY5A 1WHJA 3MEAA 4HVUA 3FB9A 2QA4T 2YUOA 3EGDB 1RAEB 2HSEB 3L2RA 1K9AA 1X6BA 5A0DA 1NLPC 3HRSA 4XU0A 4LD6A 3SEMA 2HQEA 2CS7A 5GAMd 2QASA 3HHTB 3EGDA 1VQ7Q 2DE0X 2SRCA 1Q95G 3CXCP 2CZ7B 2ZGWA 1I81A 3LH5A 2NYSA 1O9SA 2MMPA 4E7LA 2FEIA 2OJ2A 4FIBA 2K3XA 2L3SA 3PTAA 2COWA 2DL8A 2JUFA 2PU9B 3OYLA 1VQ7T 4XTYA 2DXCA 4QQDA 1Q7YU 4XTVA 1KC8U 2DYIA 4J8OA 3KXTA 2HKQB 2L3PA 2VXFA 1NE8A 4OB3B 4DEYA 2EYZA 2DYBA 2R57A 2RI3A 2QTVA 2YUPA 3MPUB 4C92B 4JS4A 1Q81U 4NOYA 3AHUA 3V7RA 2ZAEA 4HXJA 2X51A 4JJDA 5FROA 3CQTA 3CCRQ 4FSSA 2LZ6B 3V7CA 4FT4A 1HSQA 4AMCA 3VS1A 4EMKA 1Z9QA 1SKUB 4DA4A 2RJDA 4RTWA 2LQNA 2O4XB 2DMOA 1RAAB 2DILA
chains in the Genus database with same CATH topology
2K3YA 5A0LA 4E7JA 2DZCA 2E6NA 2XKOC 3CXCS 3CCRT 2RK1A 2LT1A 3UT1A 3X20B 2DJZA 3M57A 2P4TA 3J80E 2K57A 3TEEA 3QZ9B 4M77B 2OAUA 1OI1A 5GAN3 2O4XA 3I55A 3NTKA 1YJNT 3VV0A 3JB9H 2MWOA 2RJCA 1NPPA 2EJFA 1JRIA 5KE2A 2L89A 2MAMA 2ZPHB 2DEQA 2CGHA 2X4XA 1RL2A 4M78C 1FWZA 3VKIA 3G6EA 1YITT 3FJPA 4M78A 3OYKA 4C5GA 2D6FA 3L2QA 1YI2A 2M0OA 3CCRA 4JS5A 1JJ2S 3LX7A 1NZ9A 4ZGJB 2P0PA 1S72A 3CC7T 2PQWA 5CKFA 4B9XA 2JOYA 2LTOA 2RA2A 4M7AB 1UB4A 3X24B 4F7UE 3O8VA 2FL7A 4NS5A 4OGEA 4C92G 4BE2A 4JRQA 4HT9A 3ZFJA 3META 3HP9A 3JCMQ 4YTLA 4JRPA 3FLGA 3FRNA 5CAIA 5I2SA 1WQWA 1W4SA 4NL3A 4BDYA 4PJOC 3SWNC 4PJOA 3SWNA 5KCHA 1G3TA 2BIVA 3PNWC 5GMKj 3GP8A 2XG8D 1KQ1A 2CKKA 3GNFB 4FL6A 4QQGA 2ZCFB 4TVRA 2RHIA 2HAXA 2MWPA 2F5KA 4OVAA 3GPLA 2Y4XA 4ZN1A 1G5VA 3FIFA 3RUXA 2LCLA 2X4WA 3OS1A 2GF7A 5CQYA 4MZTA 1B34B 3OYBA 3GIBA 3OY9A 1QVGA 4BI3A 5GAN4 2F5TX 3JCMc 5GAN6 2KAFA 4X9CA 3PGGA 4XK8E 1VIFA 4BE0A 5GMKh 2DXUA 5DLOA 3G71T 2E5QA 4BY6C 4M77G 2QA4A 1BI1A 4F7UB 1BKBA 2D9TA 2E64A 3MP6A 4M75E 3L2WA 1QVFA 1M8VA 2QTXA 4LDWA 2LQKA 4M78F 4N0AC 5GANe 1N8RU 4N0AA 4L6V5 5CIUA 3ME9A 4OGCA 3R6OA 3HFNA 2ZZDA 3CCMT 1Q86C 1Q86U 1LNXA 3A8MB 4RCBA 3OBWA 4M7DD 2JZ2A 3BY7A 3CPWA 4C8QC 5LJ3e 5GAN2 2VGMA 1G3SA 4FU6A 1KD1U 4A54A 1WJRA 4C8QA 4F7UA 1KD1C 4E47A 5CK9A 1K9MC 1VQNT 2C06A 3LWHA 5FRNA 5GAMe 4M7AG 2JTMA 3DB4A 5L8RE 4KBMB 4HKEA 3V8KA 2DD4A 1Y96B 3ASKA 4MZPA 3M54A 1LJOA 2K2VA 1OZ3A 3OS0A 1W2BS 1X01A 4XU3A 3LH0A 4PJOF 1YJ9A 2RHUA 4JRKA 4N4GA 3E9FA 3E1SA 4ELZC 3CCQT 4LDXA 2M16A 3G7ZA 3BW1A 3OYYA 2RJFA 4E7IA 1VQNA 3OW2A 3DLMA 3HRUA 3OBYA 4M78E 4MMLA 2LCCA 2DAQA 2X4YA 1QP3A 2ZPFB 3KUFA 2GCXA 3PFSA 2FB7A 4QQ6A 5FU7C 3JCMe 4IUVA 4LDUA 5LJ5f 5LJ5j 3OYEA 1VQ4T 4EMKB 2B8AA 2X4JA 3PT9A 2XIDA 3CBPA 5IN1A 3EAEA 2DIQA 3CCQA 3QIIA 2LT4A 4N4HA 3JCMb 1U1SA 2DTIA 4XU1A 2O01E 3GNGA 1OYXA 2KDSA 2MF2A 2P0QA 2QQBA 2DD5A 4M75C 5FU6B 3OYHA 2E41A 4M75A 3SD4A 1YBYA 4PJOE 2RHZA 1VQLT 2I2LA 1JBMA 3EFSA 3CCVT 2M9UA 5EG2A 1VQ6T 2OTJT 4RG8A 1VQ4A 4BI4A 3L1AA 3CEYA 2D0QB 5LJ5h 3TCJA 1M1GA 2V8JA 1NPRA 2GFUA 2IG0A 3M4GA 1GXIE 1I8FA 3CXCA 3PMTA 3QO3A 5GAOm 2RJEA 4F7UF 2FYKA 2GQVA 2QQAA 3L2ZA 2K5FA 4MZMA 5CKEA 1BI3A 1I4K1 3HPWA 1U1TA 3E19A 4O5VA 4A4EA 4JUVA 3G4ST 4M78B 3CCVA 1VQ6A 3LW5E 3M58A 1KQSA 3LWIA 1R8OB 5IT9E 1VQ8T 3DLLA 1JB0E 1UGSB 2FHDA 4B9WA 3URGA 4FT2A 1JJ2A 2PVGB 3M4YA 3QYHB 3CCUT 2E6ZA 4E7HA 4FM4B 5A0GA 3H8ZA 4IUTA 2LRQA 3RMQA 1Q7YC 3G4SA 1QW1A 3CCLT 2EAYA 3OMCA 2X35A 1MGQA 5GAN7 1YJNA 1ZHIA 2BKDN 2L5QA 3HL8A 1VQ8A 4PJOB 3SWNB 4JLGA 3TREA 2L3RA 2QXFA 4C8QE 2HNIA 3JCMV 1WJSA 4DOWA 5DY9A 2JNGA 4PLLA 3DKMA 3CCUA 1YITA 2EWNA 2VUBA 4L59A 3OYGA 5GAN8 2E12A 1XOVA 4OB2B 3LLRA 4LDVA 4M7DC 3QZ5B 4M7DA 3CC7A 4J7FA 3S3MA 3MCAB 4M75F 3SFMA 2XD0A 2R5MA 4Y91A 2KK4A 4C92D 2RH2A 2DZ9A 2RI5A 4BE1A 2ZPBB 2E10A 2E65A 2K5LA 2HQXA 3H6ZA 3L2UA 1K73U 5GAOn 5GANf 4OMFB 5GANj 4A4FA 1M1KU 1KQ2A 2R5AA 3OA6A 1Y7XA 1VUBA 2GFAA 3RMSA 1LOJA 5AYFA 3L2VA 1M5Q1 3CMAT 3MP1A 2VV5A 5J3BA 4XTUA 2DVEA 2PUOB 2PVDB 5LJ3f 4BY6B 3NTIA 5LJ3j 1EIFA 1UGPB 1IZ6A 2LVMA 3MHXA 3QHSA 5GAOq 4OB0B 2JVVA 3M9QA 5GAMf 1UGRB 5GAMj 2V8IA 4XTZA 3FC3A 3M55A 2K5IA 3A8GB 5D6WA 2V8KA 1BIAA 1M90U 1M90C 4M78G 2XU8A 4HT8A 1H3ZA 3A8LB 4C8QB 3LYIA 1Y71A 2EJGA 4IUQA 1V29B 5GANh 1YJWT 2CZ1B 3CMAA 2IVWA 2RK2A 4RMOA 2DPPB 4R56A 4R55A 4C5IA 3QPHA 1N8RC 4KUDK 2LQ8A 3JB9G 3SB2A 2DKGA 1VQOT 3ER0A 5LJ3h 4BD3A 2LDMA 4WF2A 1Y07A 3BFMA 4XTXA 4C0ZA 2ZPIB 4M77D 3UPUA 3FEOA 3JCMf 3G71A 1QVGS 2XDBA 2QQSA 1VQPT 5LJ5g 2VGNA 3JB9F 3A8OB 4NL2A 5GAMh 3NTHA 2RO0A 4CI0C 3JCMW 1YHQT 1QVPA 3CPFA 1NJIU 3FDRA 4PJOG 2G3RA 4ZTJA 3J81E 1ZBXA 3CMET 3CCST 3E9GA 3V8JA 1KHCA 2EIFA 2M1HA 3A5ZB 3J7AF 3CCMA 4XQ3A 4ZTFA 1VQOA 4M7DF 5FU7B 1BI0A 3RESA 2RHYA 1QVFS 2KMTA 3JRZA 5J39A 2KSSA 3ZBDA 2EFIA 4M7AD 4LDYA 5CKHA 2LC4A 5HK0A 4E7KA 4BACA 3QYGB 3OS2A 4J6YA 4N4IA 3JSCA 4VUBA 2A3LA 2VC8A 3JCMh 3VUZA 1Q82U 3JAME 3CPWS 4PLIA 2FVUA 4DOVA 1N6AA 4OF1A 1N27A 1K8AU 4M75B 4J5YA 1VQ5T 3CD6T 3QDRB 1BYMA 2OTLT 4BB7A 1XQHA 3QSUA 1O75A 2NLUA 4EPCA 2EKOA 2P0KA 1UGQB 5GAOp 2ZPGB 4PKCC 4XTWA 3OYDA 2E70A 2KVQG 1YIJT 1BIBA 4M7DE 4QVZA 4Z02A 2F69A 3MO8A 1WJQA 4QW2A 1D3BB 4KUIA 4XAXB 2HBPA 2WSCE 3OSSC 4FSXA 3CCJT 3OW2S 2E1HA 2DXTA 2QDYB 4F7UG 4L5GA 4JRIA 4C8QG 5LJ5d 3JCMX 1VQ5A 4KULA 3CD6A 2OTLA 5CO7A 1M9SA 5IAYA 3CCET 4RG2A 3OYFA 5GAOr 2XK0A 4C8QF 2WSFE 1D3BA 4OP0A 4GLKA 4IUPA 1WNLA 4C92C 4C0DC 5GMKl 1YIJA 4C92A 4J83A 4ATOA 1VQLA 2OTJA 2JN0A 5C0MA 1KHIA 3MEVA 4II1A 3CCJA 3Q1JA 2DIGA 5GAN5 3RKWA 4J6XA 3S6WA 2DTHA 5KE3A 3I55T 3C12A 4OB1B 3OB9A 3M59A 5CKBA 3HRTA 4C0FA 2EQKA 2XI9A 3VU3C 3CCEA 3QUIA 3SDZA 3C4SA 2EQJA 2Y90A 3UWNA 1BI2A 1H641 3CC2T 3G6ET 4V2SA 2WSEE 3X28B 5GANg 4BDZA 1YI2T 2CZ0B 2ZPEB 4IUUA 3JB9J 4PNOA 1S72T 4M7DB 3OYAA 2BUDA 1VIEA 3L42A 5LJ3g 5HK3A 1P92A 2DXBA 3OYNA 4ME7A 4X9DA 4JLIA 1N9RA 1FX7A 3DB3A 3RKYA 3I56T 2YHTA 5M9OA 3JCMP 2RD1A 3QJ6A 3OYIA 3S3NA 1KQSS 2AHJB 3N5BB 4M75G 2XHCA 5GAMg 5CKDA 4C0GA 3OMGA 3CC4T 3WXMB 4A4GA 3CC2A 4M77C 3RIRA 2RI2A 3HKSA 5DM7R 3JB9I 3CCLA 2DTOA 3PMIA 4M77A 3OYCA 4MDWA 4MDXA 2XDPA 1TH7A 3T9NA 4ZN3A 1RI0A 2EQMA 3PIOA 2QEXT 2VYTA 4QVDA 1K73C 5I2MA 4M75D 2EJ9A 2XICA 3I56A 1M1KC 5CQXA 4HCZA 2YLCA 4DQ2A 3TU4K 1SSFA 1G3WA 3CBOA 4P5NA 4LD9K 3UDCA 3CC4A 3JCMg 2KY9A 3V7SA 2R58A 5C6SA 2DK3A 3ZEHA 4EMGA 5CR2A 4M7AC 2RM4A 5FRMA 1VQKT 4C92F 1XNIA 4A53A 4M7AA 4D6WA 3V8LA 2L8DA 4XU2A 3WVEB 2QEXA 3INZA 3HFOA 5FLXE 3RKXA 3P8HA 4KT0E 3WVDB 4GY5A 1UEBA 4CRIA 3MEAA 1M4ZA 3BDUA 4J7IA 2Y4YA 4HA8A 5D6XA 1MHNA 5GANd 5GMKi 3FB9A 2QA4T 4ZGDB 3JCMJ 2LNVA 4RCCA 2PUKB 3LGLA 1DJ7B 2LX9A 5J26A 1FXXA 1VQKA 5LJ3d 3L2RA 2WACA 4M78D 5A0DA 3M5AA 3MEUA 3GF5A 3HRSA 4XU0A 4LD6A 2XDDA 3VUBA 4HCCA 2HQEA 1AHJB 2CS7A 4X34A 5GAMd 3M53A 1VQ9T 1G3YA 3LGFA 3QBYA 3HSBA 3HHTB 1KG1A 1U8RA 1B34A 3JB9D 4MMKA 5GMKe 4C92E 1NJIC 4A4KA 1YJWA 4M7DG 1W2BA 1I5LA 5CCAA 4PL6A 3RERA 4BI8B 4EDUA 2CZ7B 2ZGWA 1HK9A 4J6WA 1VQMT 2MI6A 1I81A 4M77F 5HY6A 5A2QE 1O9SA 2MMPA 4Y28E 3OYJA 4E7LA 1YJ9T 1VQPA 3OSVA 4FIBA 4PJOD 2QI2A 2K3XA 1YCYA 3VYHB 1VQ9A 1YHQA 4JDSA 3JCMd 4ELYC 3PTAA 1Q82C 3GOXA 1K9MU 2PVOB 1X75C 2HD0A 2JUFA 2PU9B 3CMEA 3CCSA 3OYLA 1K8AC 2A7YA 1VQ7T 4XTYA 2DXCA 1IREB 2CZ6B 1WQ7A 4O6JA 4QQDA 3VYGA 4C5HA 3S3OA 3P8DA 1WPYA 2EQUA 4J8OA 1PSFA 4XTVA 1VQMA 1KC8C 1KC8U 3X25B 3GLXA 4M7AF 2K4YA 3KXTA 4IKFA 2H3JA 3NFCA 2VXFA 1NE8A 1XTDA 4OB3B 3QJYA 4UC4A 3QXEB 5D6YA 3OYMA 3CBMA 2RI3A 2R57A 3MEWA 4ZGEB 1Y96A 4A4HA 4M77E 4QVCA 1PSEA 2CYZB 3C94A 3OQ5A 1VQ7A 3C95A 3X26B 1M1FA 4C92B 3QKJA 1X6OA 4EMHA 4C0DB 4JS4A 5HKCA 1Q81C 2QQRA 3F70A 4NOYA 5LL6S 5KH6A 1Q81U 3AHUA 3V7RA 2KQWA 4RKUE 3BDLA 2RB6A 3MP8A 3VJPA 3M56A 2VXEA 5FROA 3V7CA 4FT4A 1ZQ1A 3A8HB 5GMKm 1OZ2A 1HXDA 4EMKC 1Q7YU 4C8QD 2DO3A 4M7AE 4EMKA 3PIPA 2JTFA 4HCBA 1QP2A 1N9SA 3KBGA 2QQ9A 2YLBA 3EFRA 3QG1A 3P8BB 4C5EA 4IURA 1WGSA 5KCOA 2RJDA 4DA4A 3OS5A 4JJNK 5CVIA 5FU6C 5DLQE 4Q5WA 5I21A 2YRVA 2O4XB 4BUGA 5LJ5e 2RHXA 5GAOl 2EYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Y A;  4E7J A;  2E6N A;  3OYE A;  4HCZ A;  3FEO A;  2B8A A;  1SSF A;  2QQS A;  3UT1 A;  5C6S A;  2R58 A;  2RO0 A;  3NTH A;  5IN1 A;  3ZEH A;  3EAE A;  2DIQ A;  1OI1 A;  3QII A;  2O4X A;  5FRM A;  3FDR A;  3NTK A;  2G3R A;  1XNI A;  4ZTJ A;  4N4H A;  2L8D A;  2MWO A;  1OYX A;  2RJC A;  3E9G A;  1KHC A;  2M1H A;  5KE2 A;  2L89 A;  3OYH A;  3P8H A;  4ZTF A;  3SD4 A;  4CRI A;  4GY5 A;  2RHZ A;  2X4X A;  2RHY A;  3MEA A;  5J39 A;  4C5G A;  3OYK A;  3L2Q A;  2EFI A;  2M0O A;  5D6X A;  4E7K A;  3CEY A;  1MHN A;  3LX7 A;  4BAC A;  3OS2 A;  2PQW A;  4N4I A;  2IG0 A;  2GFU A;  3LGL A;  4B9X A;  5J26 A;  2LTO A;  4PLI A;  3PMT A;  3L2R A;  2WAC A;  2RJE A;  3O8V A;  1N27 A;  4NS5 A;  3MEU A;  4BE2 A;  4LD6 A;  2HQE A;  4A4E A;  3MET A;  4X34 A;  3LGF A;  3QBY A;  3FLG A;  4BDY A;  2NLU A;  2EKO A;  2P0K A;  4PL6 A;  5KCH A;  2BIV A;  2FHD A;  3PNW C;  4B9W A;  4EDU A;  3OYD A;  4QVZ A;  2CKK A;  4FL6 A;  3MO8 A;  1WJQ A;  4QQG A;  4QW2 A;  2RHI A;  4Z02 A;  2MWP A;  2F5K A;  4OVA A;  3OYJ A;  4E7L A;  1G5V A;  4E7H A;  3H8Z A;  4IUT A;  2LRQ A;  2K3X A;  2X4W A;  3OS1 A;  2GF7 A;  3OMC A;  3OYB A;  2X35 A;  3GOX A;  2BKD N;  5IAY A;  3OY9 A;  4RG2 A;  3OYF A;  2L3R A;  2XK0 A;  3OYL A;  1WJS A;  4IUP A;  4C5H A;  4QQD A;  3S3O A;  3P8D A;  2EQU A;  4PLL A;  4BE0 A;  5C0M A;  3MEV A;  4II1 A;  2E5Q A;  4L59 A;  3Q1J A;  2DIG A;  3OYG A;  4IKF A;  3S6W A;  3LLR A;  4IUV A;  5KE3 A;  4UC4 A;  3S3M A;  3L2W A;  2D9T A;  3OB9 A;  3MP6 A;  2R5M A;  5D6Y A;  3OYM A;  2EQK A;  2RI3 A;  2R57 A;  3MEW A;  2RI5 A;  4A4H A;  4BE1 A;  5CIU A;  3L2U A;  3ME9 A;  3C4S A;  2EQJ A;  2HQX A;  3H6Z A;  3OQ5 A;  3UWN A;  3QKJ A;  4A4F A;  2JZ2 A;  2QQR A;  2R5A A;  3F70 A;  2GFA A;  5KH6 A;  4FU6 A;  3OA6 A;  4BDZ A;  3L2V A;  1WJR A;  4IUU A;  3MP1 A;  3BDL A;  3MP8 A;  3NTI A;  3OYA A;  2BUD A;  5FRN A;  2LVM A;  3L42 A;  3OYN A;  5FRO A;  3DB4 A;  3DB3 A;  5M9O A;  3M9Q A;  3QJ6 A;  3OYI A;  3S3N A;  1OZ2 A;  3ASK A;  3FC3 A;  1OZ3 A;  3OMG A;  2JTF A;  5D6W A;  3OS0 A;  3LH0 A;  4A4G A;  2RHU A;  4N4G A;  3E9F A;  2RI2 A;  1H3Z A;  2M16 A;  4C5E A;  3PMI A;  3LYI A;  1WGS A;  4IUR A;  2RJD A;  4IUQ A;  2XDP A;  5KCO A;  3OYC A;  2RJF A;  4E7I A;  3DLM A;  4C5I A;  1RI0 A;  2EQM A;  4Q5W A;  2LCC A;  2O4X B;  2DAQ A;  2VYT A;  2X4Y A;  2YRV A;  3KUF A;  2RHX A;  3PFS A;  4QQ6 A;  4BD3 A;  2LDM A; 
#chains in the Genus database with same CATH topology
 5A0L A;  3CCR T;  3PE0 A;  2LT1 A;  2DJZ A;  3M57 A;  4M77 B;  2ESW A;  1YJN T;  2O4X A;  1UEC A;  3JB9 H;  1QLY A;  1AVZ C;  5KE2 A;  2L89 A;  2MAM A;  2ZPH B;  3EG9 B;  3TVT A;  4M78 C;  1FWZ A;  2M02 A;  5KYY A;  2COZ A;  4JS5 A;  5D7U A;  1ZUK A;  1NZ9 A;  3EG0 A;  2PQW A;  4B9X A;  2I0N A;  4M7A B;  2RQR A;  4NS5 A;  3MET A;  3HP9 A;  5I22 A;  5CAI A;  5I2S A;  1QKX A;  1W4S A;  4PJO C;  3SWN C;  2P4R A;  5GMK j;  3GP8 A;  4LXC A;  1I5O B;  4FL6 A;  2HAX A;  2MWP A;  3MKD A;  4OVA A;  3RUX A;  1UFF A;  2X4W A;  2KXD A;  2GF7 A;  3OY9 A;  2BTT A;  4X9C A;  4FYW B;  4BE0 A;  5DLO A;  2V26 A;  2E5Q A;  4BY6 C;  1AZE A;  2QA4 A;  1BI1 A;  1M8V A;  2O88 A;  2QTX A;  5CIU A;  3HFN A;  2ZZD A;  1Q86 U;  3BY7 A;  4FU6 A;  2V1R A;  4J9B A;  5FRN A;  1AT1 B;  5GAM e;  1VQ4 Q;  5L8R E;  2GTO A;  4AFQ C;  2DD4 A;  1Y96 B;  1AWJ A;  3ASK A;  4XU3 A;  2RHU A;  1M1K R;  2M16 A;  4RTZ A;  3BW1 A;  2P84 A;  4E7I A;  4MML A;  1PM3 A;  2C0O A;  3OYE A;  1VQ4 T;  1PKT A;  2XID A;  5IN1 A;  2KBT A;  2FRW A;  3CCQ A;  1I07 A;  4XU1 A;  1H92 A;  2KDS A;  2MF2 A;  3OYH A;  2E41 A;  3SD4 A;  4B6M A;  2RHZ A;  3EFS A;  4D8K A;  2M9U A;  1QWF A;  2KT8 A;  5LJ5 h;  3TCJ A;  1UE9 A;  3M4G A;  2M0Y A;  5GAO m;  4MZM A;  5CKE A;  1I4K 1;  2J05 A;  1OPK A;  2BZX A;  1VQ6 A;  2KGT A;  1N5Z A;  3TQ7 P;  1JB0 E;  4OMN A;  2EGE A;  2J7I A;  4B9W A;  5KYW B;  1Q82 R;  1MNE A;  2NWM A;  1K8A R;  4FM4 B;  1MMD A;  3G4S A;  5GAN 7;  1YJN A;  5KYW A;  1VQ8 A;  2LMJ A;  3TRE A;  2L3R A;  4DOW A;  3CMA Q;  3H41 A;  2JNG A;  4PLL A;  2EWN A;  2EGA A;  4OB2 B;  4JJC A;  2FZC B;  3MCA B;  2NUT A;  2XD0 A;  4Y91 A;  1RAG B;  2RH2 A;  2RI5 A;  2KRO A;  3L2U A;  2K5L A;  5HCK A;  2D8H A;  5GAO n;  1M1K U;  2J6F A;  1X43 A;  3CMA T;  1V1C A;  3MP1 A;  5J3B A;  2PUO B;  2PVD B;  3NTI A;  1UGP B;  3QDF A;  2JVV A;  1UGR B;  4XTZ A;  1M90 C;  2FPF A;  2XU8 A;  3AT1 B;  4C8Q B;  1Y71 A;  2X9H A;  5IXB A;  5GAN h;  2A36 A;  2IVW A;  4RMO A;  4R56 A;  4R55 A;  3I35 A;  2KT1 A;  2LQ8 A;  2QGG A;  3VS7 A;  5LJ3 h;  4WF2 A;  4XTX A;  2ZPI B;  3UPU A;  3JCM f;  2AK5 A;  5LJ5 g;  3JCM W;  2KEA A;  1QVP A;  4RTY A;  2G3R A;  4DBF A;  3V8J A;  1Y0M A;  1YN8 A;  4LDY A;  5CKH A;  5HK0 A;  3THK A;  4N4I A;  4VUB A;  3VUZ A;  3CCJ Q;  2VC8 A;  1Q82 U;  1WHM A;  4DOV A;  2AKK A;  3CPW S;  1UG1 A;  4OF1 A;  4E7S A;  1K8A U;  1MV0 B;  4M75 B;  2HKN A;  1XQH A;  3GBQ A;  2O9S A;  1UGQ B;  3CCJ T;  2ECZ A;  2HBP A;  3OW2 S;  1B07 A;  2KYM A;  2DXT A;  1RAC B;  1VQ5 A;  1UJY A;  4JRI A;  3JCM X;  2OX7 A;  4IIO A;  3CC2 Q;  2XK0 A;  4C8Q F;  4C92 C;  4FYY B;  1YIJ A;  1YCS B;  4II1 A;  4ORZ A;  4GBQ A;  5KE3 A;  3I55 T;  1X27 A;  1X69 A;  2JS0 A;  2Y90 A;  3CC2 T;  3I5R A;  4E2F B;  3G6E T;  2C0T A;  1BU1 A;  5GAN g;  4BDZ A;  2QEX Q;  3M0S A;  2JXB A;  1WHK A;  4IUU A;  1S72 T;  4M7D B;  1VIE A;  3L42 A;  5LJ3 g;  1P92 A;  1CKB A;  2RD1 A;  2CT4 A;  2AHJ B;  3N5B B;  3OMG A;  1M2V B;  1VYT A;  4M77 C;  3JB9 I;  3OYC A;  1TH7 A;  4RTT A;  3PIO A;  1R0B G;  2QEX T;  1WDX A;  5I2M A;  4M75 D;  2EJ9 A;  1T3S A;  3I56 A;  1NBE B;  2ROL A;  1RUW A;  1VYV A;  1LCK A;  4DQ2 A;  3TU4 K;  2HMA A;  3CBO A;  3UDC A;  3CC4 A;  1ZSZ A;  1BCO A;  3V7S A;  5C6S A;  4E6R A;  2DK3 A;  3ZEH A;  4M7A C;  3EFO A;  2L8D A;  3WVE B;  3P8H A;  4KT0 E;  1M8M A;  1NYG A;  1J3T A;  2CUB A;  1LVK A;  4J7I A;  5D6X A;  4HA8 A;  1DJ7 B;  2LX9 A;  2QDL A;  2WAC A;  4M78 D;  3HSB A;  1UDL A;  4X34 A;  1KG1 A;  3LGF A;  1B34 A;  2MK5 A;  3JB9 D;  2A0F B;  4A4K A;  1W2B A;  1I5L A;  4PL6 A;  3RER A;  4AFU C;  4JZ3 A;  4HCK A;  4D8D A;  4Y28 E;  1QCN A;  3OYJ A;  1YJ9 T;  3OSV A;  4PJO D;  1YCY A;  1VQ9 A;  4JDS A;  1X75 C;  2BZ8 A;  2VB6 A;  2CZ6 B;  1WQ7 A;  4O6J A;  3VYG A;  1Q7Y C;  1VQM A;  1WPY A;  2EQU A;  1KC8 C;  1RAF B;  3X25 B;  3GLX A;  4FYX B;  2K4Y A;  4IKF A;  1XTD A;  4UC4 A;  5D6Y A;  1HD3 A;  3RBB B;  3C94 A;  2FO0 A;  3C95 A;  3X26 B;  1X6O A;  1Q81 C;  1RLQ C;  5KH6 A;  1WXB A;  3VS5 A;  2COY A;  3H0I A;  2KRS A;  2DJQ A;  1YWO A;  2DA9 A;  3EFR A;  4IUR A;  1VA7 A;  1WGS A;  2HCK A;  4JJN K;  2KRM A;  4Q5W A;  4BUG A;  2RHX A;  4PJM A;  2EYQ A;  5GAO l;  4JPB W;  4E7J A;  2RK1 A;  3UT1 A;  4RTX A;  1D1A A;  2K57 A;  3QZ9 B;  3I55 A;  1OI1 A;  1AWX A;  2LNH B;  3NMZ C;  2DEQ A;  2BE7 D;  3G6E A;  1AWW A;  1SRL A;  1JJ2 S;  1S72 A;  4PJN A;  5CKF A;  1OX8 A;  1PWT A;  2QA4 Q;  1UB4 A;  3RR6 A;  4F7U E;  1QCO A;  2FL7 A;  4OGE A;  4HT9 A;  1HYO A;  1K1Z A;  2VAS A;  2K79 A;  4JRP A;  3FRN A;  1WQW A;  4NL3 A;  5KCH A;  3A98 A;  2XG8 D;  2CKK A;  2ZCF B;  2GTJ A;  2F5K A;  1TUD A;  2GGR A;  1M27 C;  2Y4X A;  1G5V A;  4FW1 A;  2VKN A;  4AFS C;  2JM8 A;  1OU9 A;  2EPD A;  4BI3 A;  2F5T X;  3JCM c;  5GAN 6;  2FPE A;  2CH4 A;  3PGG A;  3REB B;  1VIF A;  4J9G A;  5GMK h;  2DBM A;  1ZSG A;  3UF4 A;  1WFW A;  2D9T A;  1QVF A;  2L2P A;  4LDW A;  4N0A C;  1SSH A;  3CCQ Q;  4L6V 5;  3ME9 A;  3CCM T;  1Q86 C;  1LNX A;  3A8M B;  4RCB A;  1KIK A;  1TG0 A;  4C8Q C;  2VGM A;  1KD1 U;  1K9M C;  4E47 A;  2E3I A;  3LWH A;  1QMC A;  4KBM B;  4HKE A;  3V8K A;  1R77 A;  4CC4 B;  1LJO A;  2K2V A;  2CP2 A;  1OZ3 A;  1AD5 A;  1YJ9 A;  1GCP A;  1SHF A;  3E9F A;  4ELZ C;  5KYX A;  3CCQ T;  3C0C A;  4LDX A;  3OYY A;  3HRU A;  1W1F A;  1VQ6 Q;  2LCC A;  2DAQ A;  2ZPF B;  1QP3 A;  4CC7 A;  2GCX A;  4IUV A;  1KSW A;  3EH1 A;  4EMK B;  2B8A A;  2J6K A;  1FMK A;  1TTH B;  3EAE A;  3QII A;  1ZX6 A;  4N4H A;  3JCM b;  1U1S A;  3G4S Q;  1C0M A;  2O01 E;  1OYX A;  4J9I A;  2DD5 A;  4M75 C;  1YJN Q;  1VQ8 Q;  1VQL T;  2I2L A;  2OTJ T;  1VQ6 T;  4RG8 A;  2KNB B;  4BI4 A;  2YRC A;  3L1A A;  1X2K A;  1PC0 A;  1I8F A;  3PMT A;  4FCY A;  1UGV A;  3L2Z A;  2GQV A;  1EFN A;  2DL3 A;  4A4E A;  3G4S T;  4JUV A;  1GCQ A;  3CCV A;  4OMO A;  1BK2 A;  5KYY B;  1KQS A;  3KFV A;  3LWI A;  5IT9 E;  1VQ8 T;  2OI3 A;  2K2M A;  1UGS B;  2ROT A;  1K9M R;  2PZ1 A;  1OX9 A;  5A0G A;  1GFC A;  3MJX A;  3CCL T;  2YUN A;  1ZHI A;  1W2B P;  2QXF A;  4A63 B;  3JCM V;  3IQL A;  4ZNX A;  4Z89 A;  5DY9 A;  2GBQ A;  2VUB A;  3OYG A;  1OU8 A;  2E12 A;  4M7D C;  2JM9 A;  3SHW A;  4C92 D;  2YSQ A;  2ZPB B;  4OMF B;  1Y7X A;  1VUB A;  2JJ9 A;  3RMS A;  1X2Q A;  2VV5 A;  3RDV A;  4XTU A;  2DF6 A;  2JTE A;  1EIF A;  3MHX A;  2HZY A;  3M9Q A;  5GAM f;  5GAM j;  3PVQ A;  3A8G B;  1ZUU A;  1MMN A;  1BIA A;  2DEU A;  4M78 G;  3H0F A;  5EC7 A;  2FPD A;  2DER A;  2IPO B;  2DPP B;  4C5I A;  1N8R C;  2CSI A;  3JB9 G;  3SB2 A;  2DKG A;  1PG5 B;  2LDM A;  3BFM A;  1PD1 A;  4M77 D;  2QQS A;  2YT6 A;  1VQP T;  2VGN A;  1WHL A;  2RO0 A;  4CI0 C;  1YHQ T;  2H8H A;  3CPF A;  4PJO G;  3J81 E;  1VQ5 Q;  3CME T;  3CCS T;  2F2X A;  1IHW A;  3E9G A;  1KHC A;  2M1H A;  3A5Z B;  2F2V A;  3CCM A;  1VQO A;  5FU7 B;  1BI0 A;  2RHY A;  3JRZ A;  2DLP A;  4M7A D;  4E7K A;  2LC4 A;  1YIJ Q;  4BAC A;  3QYG B;  3OS2 A;  3JCM h;  3JAM E;  1K4U S;  4DEX A;  1N6A A;  2YXY A;  2EYY A;  1N27 A;  2MOX A;  1VQ5 T;  3QDR B;  4IIM A;  3H0H A;  1OUL A;  2ZPG B;  4ANJ A;  1A0N B;  2E70 A;  2AZS A;  1YIJ T;  4QVZ A;  2F69 A;  1F1B B;  1D3B B;  4AG1 C;  4XAX B;  2WSC E;  2QDY B;  4F7U G;  5LJ5 d;  4KUL A;  1H3H A;  2HSP A;  3OYF A;  2WSF E;  1D3B A;  2D0N A;  1FMW A;  4OP0 A;  4IUP A;  1WNL A;  1VQL A;  2OTJ A;  2DL4 A;  1KHI A;  1N8R R;  3Q1J A;  5GAN 5;  3I56 Q;  3RKW A;  2VWF A;  4PFZ A;  3OB9 A;  3CC4 Q;  4KRT A;  3EHR A;  3CCE A;  1UHC A;  2LP5 A;  1M3C A;  3UWN A;  4V2S A;  3X28 B;  1YI2 T;  2ZPE B;  3I9Q A;  1QWE A;  3OYA A;  3OYN A;  2NUT B;  1JQQ A;  1QVF P;  4ME7 A;  3I56 T;  3RKY A;  3JCM P;  3OYI A;  2CP3 A;  4C0G A;  3CC4 T;  3TSW A;  3WXM B;  1C1A A;  3CCL A;  2DTO A;  3PMI A;  4MDX A;  2QG9 B;  4JJB A;  4ZN3 A;  1AWO A;  4Z8A A;  4KH0 B;  4QVD A;  1K73 C;  2XIC A;  2NUZ A;  1SSF A;  1G3W A;  4KGX B;  4P5N A;  2EGC A;  3JCM g;  2KY9 A;  2R58 A;  4AFZ C;  5CR2 A;  1AZG B;  2DBK A;  1XNI A;  4A53 A;  5KYU A;  2F2W A;  1VQ9 Q;  1MMG A;  3V8L A;  3HFO A;  1SF9 A;  4CRI A;  3WVD B;  1M4Z A;  2CH4 W;  5GAN d;  1VQM Q;  5FW9 A;  4ZGD B;  4LNP A;  2AT1 B;  2LNV A;  3JCM J;  3LGL A;  1FXX A;  1PCX A;  5LJ3 d;  1AEY A;  3M5A A;  2XDD A;  3VUB A;  1VQ9 T;  5IXF A;  1G3Y A;  4F17 A;  1U8R A;  1NJI C;  4GLM A;  2H3E B;  4J6W A;  1VQM T;  1JXO A;  3UA6 A;  5HY6 A;  5A2Q E;  2JW4 A;  1VQP A;  2SEM A;  2HL3 A;  3VYH B;  2K3B A;  1YHQ A;  1KQS P;  1X6G A;  2RMO A;  3GOX A;  2PVO B;  2HD0 A;  4AG2 C;  3CME A;  3CCS A;  1JEG A;  2IIM A;  1E7O A;  1I0C A;  2RQW A;  1IRE B;  4C5H A;  3S3O A;  3P8D A;  1PSF A;  1NYF A;  1R0C B;  2O9V A;  3QXE B;  3OYM A;  2C0I A;  4ZGE B;  4QVC A;  3I55 Q;  1D0X A;  3OQ5 A;  1TUC A;  4EMH A;  2OAW A;  2QQR A;  3F70 A;  5LL6 S;  3HTR A;  1TSF A;  2KQW A;  4RKU E;  3BDL A;  3G6E Q;  2RB6 A;  1M90 R;  3M56 A;  2VXE A;  4F14 A;  2QAZ A;  1ZQ1 A;  1S72 Q;  1T0J A;  5GMK m;  1OZ2 A;  1HXD A;  4EMK C;  4C8Q D;  3PIP A;  2JTF A;  4HCB A;  1N9S A;  2YLB A;  3QG1 A;  3REA B;  5KCO A;  2CP5 A;  5CVI A;  4J9C A;  5DLQ E;  5I21 A;  5LJ5 e;  1EX4 A;  1NJI R;  2E3H A;  2DZC A;  2XKO C;  3G1J A;  3CXC S;  2RQV A;  3TEE A;  2OAU A;  3VRY A;  3NTK A;  4DBQ A;  3VV0 A;  2EJF A;  1JRI A;  2HEQ A;  2CGH A;  3VKI A;  1YIT T;  4M78 A;  4C5G A;  2D6F A;  3L2Q A;  1YI2 A;  2M0O A;  4OMP A;  1ZSZ B;  3LX7 A;  2G6F X;  2P0P A;  3CC7 T;  2KRN A;  3EFO B;  2JOY A;  2LTO A;  1MV3 A;  3X24 B;  3O8V A;  4C92 G;  4JRQ A;  3JCM Q;  4YTL A;  1U3O A;  2GQI A;  1RAD B;  4JZ4 A;  1JU5 C;  4BDY A;  2JMA A;  1OPL A;  4PJO A;  3SWN A;  2BIV A;  3PNW C;  4LUD A;  5AT1 B;  1KQ1 A;  2W0Z A;  1IB8 A;  5GJV B;  4QQG A;  4TVR A;  2FG0 A;  3GPL A;  4ZN1 A;  1U5S A;  3FIF A;  2LCL A;  3OS1 A;  2CDT A;  4MZT A;  1B34 B;  4E7Z A;  1YJ9 Q;  1QVG A;  2AIR B;  1GBR A;  4M4Z A;  2DET A;  3G71 T;  4R0K A;  1GBQ A;  4M77 G;  4F7U B;  1BKB A;  4M75 E;  3MP6 A;  1NEG A;  2LQK A;  4M78 F;  5GAN e;  3R6O A;  1PHT A;  3A1P A;  4M7D D;  1UUE A;  5LJ3 e;  1G3S A;  1KD1 C;  4HVW A;  1WJR A;  4A54 A;  4F7U A;  2YRD A;  1XJW B;  5CK9 A;  4M7A G;  2DM1 A;  2VVK A;  3M54 A;  3QWY A;  3OS0 A;  1W2B S;  2QGF B;  4PJO F;  4N4G A;  3E1S A;  2RQT A;  3M0Q A;  2RJF A;  1VQN A;  5FWC A;  3OBY A;  4M78 E;  3CCV Q;  3KUF A;  3PFS A;  4QQ6 A;  5FU7 C;  2KXC A;  2X4J A;  4J9D A;  1MMA A;  2DIQ A;  2EQI A;  1ABO A;  1D1B A;  2EVR A;  2DTI A;  2QQB A;  5FU6 B;  4PJO E;  2D8J A;  4J9F A;  3CCV T;  1QCF A;  4KGZ B;  1G2B A;  2D0Q B;  2IG0 A;  1GXI E;  3QO3 A;  4F7U F;  2FYK A;  2ENM A;  2QQA A;  2K5F A;  2NUP B;  3HPW A;  4O5V A;  3LW5 E;  1R8O B;  2FHD A;  2NUP A;  1JJ2 A;  3UA7 A;  4FW2 A;  2LRQ A;  3VS2 A;  1QW1 A;  1Q7Y R;  4CC2 A;  1KC8 R;  4EIK A;  2X35 A;  1MGQ A;  2BKD N;  1RAI B;  1E6H A;  3EGX A;  8ATC B;  2HNI A;  1WJS A;  1W70 A;  3DKM A;  3CCU A;  2W10 A;  1YIT A;  3D7S B;  1SG5 A;  1XOV A;  3JV3 A;  2HDA A;  5IHN A;  3CC7 A;  4J7F A;  4Z88 A;  3SFM A;  1Q81 R;  2KK4 A;  1ZLM A;  2DZ9 A;  4OMQ A;  4BE1 A;  2E65 A;  2HBW A;  4A4F A;  1KQ2 A;  2R5A A;  3OA6 A;  3L2V A;  1Y57 A;  3CCM Q;  1VQO Q;  3BE3 A;  2DNU A;  2DVE A;  2LVM A;  1NM7 A;  1IZ6 A;  2DRK A;  5GAO q;  4OB0 B;  2DX1 A;  3EG2 A;  1BBZ A;  1FYN A;  1QKW A;  2K5I A;  2YWW A;  4HT8 A;  1B3Q A;  1H3Z A;  3A8L B;  2QYZ A;  3LYI A;  4Y92 A;  4RTV A;  4IUQ A;  1V29 B;  2RF0 A;  1YJW T;  2CZ1 B;  2RK2 A;  9ATC B;  4KUD K;  2E5K A;  1VQO T;  3ER0 A;  4BD3 A;  1Y07 A;  4C0Z A;  3FEO A;  3G71 A;  3QWX X;  1TS9 A;  3A8O B;  4NL2 A;  5GAM h;  3NTH A;  1IGQ A;  2EKH A;  5KYX B;  3FDR A;  4ZTJ A;  1KFZ A;  1TUG B;  1WHH A;  4ZTF A;  4XQ3 A;  3RES A;  1QVF S;  1D0Z A;  2KMT A;  5J39 A;  3ZBD A;  4PFP A;  3U23 A;  1VQL Q;  2OTJ Q;  4J6Y A;  2GNC A;  2KI7 A;  4PLI A;  1WXT A;  2M51 A;  1WHG A;  4J5Y A;  3CCE Q;  3VS4 A;  1RI9 A;  4BB7 A;  3QSU A;  1O75 A;  2NLU A;  2P0K A;  1WYX A;  3M0R A;  8AT1 B;  4PKC C;  5GAO p;  3OYD A;  4Z02 A;  1T3L A;  1WJQ A;  3MO8 A;  4QW2 A;  2BE9 B;  2MCN A;  2L3Q A;  3OSS C;  2CP6 A;  3CD6 A;  4C8Q G;  2L0A A;  2OTL A;  5CO7 A;  5IAY A;  3CCE T;  3TSZ A;  2ABL A;  1IHV A;  3CCL Q;  1NEB A;  5GMK l;  4C92 A;  4ATO A;  2JN0 A;  2JS2 A;  4J6X A;  3S6W A;  1Q86 R;  3C12 A;  1B7T A;  1QVG P;  2LJ1 A;  2XI9 A;  3QUI A;  2DL7 A;  2CT3 A;  2EQJ A;  1ZA2 B;  2LCS A;  1YFN A;  3JB9 J;  2XMF A;  5HK3 A;  2DXB A;  4WTO B;  4PJJ A;  1FX7 A;  2YHT A;  5M9O A;  3S3N A;  3QJ6 A;  1KQS S;  1H8K A;  4M75 G;  5GAM g;  4A4G A;  1ARK A;  5DM7 R;  2BZY A;  1BCM A;  4M77 A;  4MDW A;  1WXU A;  3T9N A;  2X3X D;  1RI0 A;  2EQM A;  4HVV A;  2VYT A;  1Z9Z A;  1KK7 A;  2LQW A;  1M1K C;  3EG9 A;  4HCZ A;  1ZSZ C;  2J6O A;  4LD9 K;  4EMG A;  1ZBJ A;  2RM4 A;  1YWP A;  1VQP Q;  4C92 F;  4OML A;  4M7A A;  1YHQ Q;  4XU2 A;  1BB9 A;  3EG1 A;  3RKX A;  1UEB A;  1V76 A;  3CME Q;  3CCS Q;  2HQH A;  1NLO C;  4DBH A;  3BDU A;  2Y4Y A;  3ZL7 C;  1MHN A;  5GMK i;  1PRM C;  4RCC A;  2PUK B;  4OMM A;  5J26 A;  1VQK A;  1U06 A;  2CUD A;  3MEU A;  4HCC A;  2Z0W A;  3GF5 A;  4RUG A;  1AHJ B;  3M53 A;  1D1C A;  2RQU A;  3QBY A;  4MMK A;  5GMK e;  1PNJ A;  4C92 E;  1YJW A;  4M7D G;  1CSK A;  5CCA A;  2A08 A;  4BI8 B;  2ED0 A;  4EDU A;  2O31 A;  1WIE A;  1HK9 A;  2YUQ A;  2MI6 A;  4M77 F;  1E6G A;  1GRI A;  2QI2 A;  2A28 A;  4PK4 A;  3JCM d;  4ELY C;  1Q82 C;  1K9M U;  2ATC B;  1D0Y A;  1YNZ A;  1K8A C;  2A7Y A;  1JJ2 P;  1PD0 A;  1TWB A;  3VS3 A;  4M7A F;  2H3J A;  3NFC A;  1TOV A;  5FWB A;  2LJ3 A;  3QJY A;  2KR3 A;  3CBM A;  3MEW A;  1Y96 A;  4A4H A;  4M77 E;  1PSE A;  2CYZ B;  2CP0 A;  4PJL A;  1VQ7 A;  2DL5 A;  1M1F A;  1PKS A;  3QKJ A;  4C0D B;  5HKC A;  1OV3 A;  1UTI A;  2MIO A;  3MP8 A;  3VJP A;  1YI2 Q;  3NGP A;  3A8H B;  2DRM A;  2DO3 A;  4M7A E;  2YDL A;  1QP2 A;  3KBG A;  4K11 A;  1W6X A;  2QQ9 A;  3P8B B;  2EYW A;  4C5E A;  3OS5 A;  1YP5 A;  5FU6 C;  2CSQ A;  2YRV A;  1FMV A;  2K3Y A;  4AT1 B;  2E6N A;  5IHK A;  3X20 B;  2B86 A;  2P4T A;  3J80 E;  2RNA A;  5GAN 3;  2O2O A;  2MWO A;  2RJC A;  1NPP A;  1WX6 A;  1M3A A;  2X3W D;  1RLP C;  2X4X A;  1RL2 A;  3FJP A;  3OYK A;  3CCR A;  2KE9 A;  4ZGJ B;  2EW3 A;  1K0S A;  1WA7 A;  1PRL C;  2RA2 A;  1WZO A;  5KYU B;  4BE2 A;  1D09 B;  3ZFJ A;  1IRX A;  2K7A A;  1ABQ A;  3FLG A;  3R6N A;  1MUZ A;  1G3T A;  2MPX C;  1G8X A;  3GNF B;  5KYN A;  5L23 A;  4X1V A;  2RHI A;  1WLP B;  2PNI A;  5CQY A;  3OYB A;  3GIB A;  5GAN 4;  2KAF A;  4LE9 A;  1C6V X;  1EZZ B;  4F16 A;  1VQN Q;  4XK8 E;  2DXU A;  1M30 A;  1NG2 A;  2HL5 C;  1TU0 B;  3L2W A;  2E64 A;  1N8R U;  4N0A A;  4OGC A;  3OBW A;  2JZ2 A;  3CPW A;  5GAN 2;  4C8Q A;  1VQN T;  7AT1 B;  2C06 A;  4KGV B;  2JTM A;  2MYS A;  3DB4 A;  3VS6 A;  3RNJ A;  4MZP A;  1X01 A;  1K73 R;  3LH0 A;  1IO6 A;  4JRK A;  5IHI A;  1ACM B;  1M2O A;  3G7Z A;  3OW2 A;  3DLM A;  3E2U A;  4J9H A;  2X4Y A;  2FB7 A;  3JCM e;  4LUE A;  4LDU A;  5LJ5 f;  5LJ5 j;  3PT9 A;  4QT7 A;  1TXQ A;  3CBP A;  3NHN A;  2LT4 A;  3FJ5 A;  3GNG A;  2P0Q A;  1JO8 A;  4M75 A;  1YBY A;  1ZUY A;  1JBM A;  1IGU A;  5EG2 A;  1VQ4 A;  3CEY A;  3CCU Q;  1YIT Q;  1I1J A;  1M1G A;  1NPR A;  2GFU A;  2V8J A;  3CXC A;  3CC7 Q;  2RJE A;  1BI3 A;  2JT4 A;  1GCQ C;  1U1T A;  3E19 A;  4M78 B;  3PVL A;  3M58 A;  3DLL A;  2LJ0 A;  5ECA A;  3URG A;  4FT2 A;  6AT1 B;  4DBR A;  2PVG B;  3M4Y A;  3QYH B;  3CCU T;  2E6Z A;  2AKL A;  4E7H A;  1M3B A;  3H8Z A;  4IUT A;  3RMQ A;  1SEM A;  1ZA1 B;  1SPK A;  2EAY A;  3OMC A;  3HL8 A;  2L5Q A;  4PJO B;  3SWN B;  4JLG A;  1JXM A;  3EH2 A;  1CKA A;  3O5Z A;  4C8Q E;  2PTK A;  3EGU A;  1IXD A;  4KH1 B;  4L59 A;  5GAN 8;  3LLR A;  4LDV A;  3QZ5 B;  4M7D A;  3G71 Q;  3S3M A;  4M75 F;  2R5M A;  1MND A;  2E10 A;  2V1Q A;  1K73 U;  2HQX A;  3H6Z A;  5GAN f;  5GAN j;  1M2V A;  4ESR A;  2GFA A;  1LOJ A;  5AYF A;  1M5Q 1;  5LJ3 f;  5LJ3 j;  4BY6 B;  1OOT A;  2ED1 A;  3QHS A;  2QK0 A;  2DVJ A;  2V8I A;  3VRZ A;  3FC3 A;  3M55 A;  5D6W A;  2V8K A;  1M90 U;  3M0P A;  3M0T A;  3UAT A;  2EJG A;  5GJW B;  1SRM A;  3CMA A;  3QPH A;  3H9N A;  4PFO A;  1QVG S;  2XDB A;  3JB9 F;  4F04 B;  3M0U A;  2KYB A;  2JMC A;  1RAH B;  1NJI U;  1SHG A;  1ZBX A;  3CD6 Q;  2OTL Q;  2J06 A;  2EIF A;  3J7A F;  4M7D F;  1K0X A;  1OQK A;  3EHQ A;  2KSS A;  2EFI A;  3JSC A;  2A3L A;  1VOM A;  2FVU A;  2EYX A;  1OEB A;  2CP7 A;  1HJD A;  3CD6 T;  1BYM A;  2FZK B;  2RPN A;  2OTL T;  2FRY A;  4EPC A;  2EKO A;  2DFU A;  4XTW A;  2KVQ G;  1BIB A;  4M7D E;  1VYU A;  4QKU A;  3ULR B;  2F1L A;  4KUI A;  4J9E A;  4FSX A;  2E1H A;  2K6D A;  4L5G A;  2E4H A;  1G83 A;  1M9S A;  1GL5 A;  4RG2 A;  2FZG B;  5GAO r;  2AZV A;  4GLK A;  4C0D C;  4LN2 A;  4J83 A;  2K9G A;  2CRE A;  2LX7 A;  3MEV A;  5C0M A;  1T0H A;  3CCJ A;  2DIG A;  1RAB B;  1AOJ A;  2D1X A;  2DTH A;  1UHF A;  1QQJ A;  4OB1 B;  3M59 A;  5CKB A;  3HRT A;  4C0F A;  1KD1 R;  2EQK A;  3VU3 C;  3EGX B;  3SDZ A;  3C4S A;  1BI2 A;  1H64 1;  1S1N A;  2WSE E;  3NPF A;  2CZ0 B;  1K76 A;  4PNO A;  2BUD A;  4WCI A;  4RTU A;  4X9D A;  4JLI A;  1N9R A;  1WI7 A;  3DB3 A;  3VS0 A;  4FYV B;  3EG3 A;  2XHC A;  2EBP A;  5CKD A;  4CC3 A;  1VQK Q;  2RN8 A;  3CC2 A;  3CPW P;  3RIR A;  1GFD A;  2RI2 A;  3HKS A;  2XDP A;  5I11 A;  1KJW A;  1YJW Q;  5CQX A;  2YLC A;  5IH2 A;  1LPL A;  5FRM A;  1VQK T;  3OW2 P;  4D6W A;  2A37 A;  2QEX A;  1UJ0 A;  3INZ A;  3I5S A;  5FLX E;  4GY5 A;  1WHJ A;  3MEA A;  4HVU A;  3FB9 A;  2QA4 T;  2YUO A;  3EGD B;  1RAE B;  2HSE B;  3L2R A;  1K9A A;  1X6B A;  5A0D A;  1NLP C;  3HRS A;  4XU0 A;  4LD6 A;  3SEM A;  2HQE A;  2CS7 A;  5GAM d;  2QAS A;  3HHT B;  3EGD A;  1VQ7 Q;  2DE0 X;  2SRC A;  1Q95 G;  3CXC P;  2CZ7 B;  2ZGW A;  1I81 A;  3LH5 A;  2NYS A;  1O9S A;  2MMP A;  4E7L A;  2FEI A;  2OJ2 A;  4FIB A;  2K3X A;  2L3S A;  3PTA A;  2COW A;  2DL8 A;  2JUF A;  2PU9 B;  3OYL A;  1VQ7 T;  4XTY A;  2DXC A;  4QQD A;  1Q7Y U;  4XTV A;  1KC8 U;  2DYI A;  4J8O A;  3KXT A;  2HKQ B;  2L3P A;  2VXF A;  1NE8 A;  4OB3 B;  4DEY A;  2EYZ A;  2DYB A;  2R57 A;  2RI3 A;  2QTV A;  2YUP A;  3MPU B;  4C92 B;  4JS4 A;  1Q81 U;  4NOY A;  3AHU A;  3V7R A;  2ZAE A;  4HXJ A;  2X51 A;  4JJD A;  5FRO A;  3CQT A;  3CCR Q;  4FSS A;  2LZ6 B;  3V7C A;  4FT4 A;  1HSQ A;  4AMC A;  3VS1 A;  4EMK A;  1Z9Q A;  1SKU B;  4DA4 A;  2RJD A;  4RTW A;  2LQN A;  2O4X B;  2DMO A;  1RAA B;  2DIL A; 
#chains in the Genus database with same CATH homology
 2K3Y A;  5A0L A;  4E7J A;  2DZC A;  2E6N A;  2XKO C;  3CXC S;  3CCR T;  2RK1 A;  2LT1 A;  3UT1 A;  3X20 B;  2DJZ A;  3M57 A;  2P4T A;  3J80 E;  2K57 A;  3TEE A;  3QZ9 B;  4M77 B;  2OAU A;  1OI1 A;  5GAN 3;  2O4X A;  3I55 A;  3NTK A;  1YJN T;  3VV0 A;  3JB9 H;  2MWO A;  2RJC A;  1NPP A;  2EJF A;  1JRI A;  5KE2 A;  2L89 A;  2MAM A;  2ZPH B;  2DEQ A;  2CGH A;  2X4X A;  1RL2 A;  4M78 C;  1FWZ A;  3VKI A;  3G6E A;  1YIT T;  3FJP A;  4M78 A;  3OYK A;  4C5G A;  2D6F A;  3L2Q A;  1YI2 A;  2M0O A;  3CCR A;  4JS5 A;  1JJ2 S;  3LX7 A;  1NZ9 A;  4ZGJ B;  2P0P A;  1S72 A;  3CC7 T;  2PQW A;  5CKF A;  4B9X A;  2JOY A;  2LTO A;  2RA2 A;  4M7A B;  1UB4 A;  3X24 B;  4F7U E;  3O8V A;  2FL7 A;  4NS5 A;  4OGE A;  4C92 G;  4BE2 A;  4JRQ A;  4HT9 A;  3ZFJ A;  3MET A;  3HP9 A;  3JCM Q;  4YTL A;  4JRP A;  3FLG A;  3FRN A;  5CAI A;  5I2S A;  1WQW A;  1W4S A;  4NL3 A;  4BDY A;  4PJO C;  3SWN C;  4PJO A;  3SWN A;  5KCH A;  1G3T A;  2BIV A;  3PNW C;  5GMK j;  3GP8 A;  2XG8 D;  1KQ1 A;  2CKK A;  3GNF B;  4FL6 A;  4QQG A;  2ZCF B;  4TVR A;  2RHI A;  2HAX A;  2MWP A;  2F5K A;  4OVA A;  3GPL A;  2Y4X A;  4ZN1 A;  1G5V A;  3FIF A;  3RUX A;  2LCL A;  2X4W A;  3OS1 A;  2GF7 A;  5CQY A;  4MZT A;  1B34 B;  3OYB A;  3GIB A;  3OY9 A;  1QVG A;  4BI3 A;  5GAN 4;  2F5T X;  3JCM c;  5GAN 6;  2KAF A;  4X9C A;  3PGG A;  4XK8 E;  1VIF A;  4BE0 A;  5GMK h;  2DXU A;  5DLO A;  3G71 T;  2E5Q A;  4BY6 C;  4M77 G;  2QA4 A;  1BI1 A;  4F7U B;  1BKB A;  2D9T A;  2E64 A;  3MP6 A;  4M75 E;  3L2W A;  1QVF A;  1M8V A;  2QTX A;  4LDW A;  2LQK A;  4M78 F;  4N0A C;  5GAN e;  1N8R U;  4N0A A;  4L6V 5;  5CIU A;  3ME9 A;  4OGC A;  3R6O A;  3HFN A;  2ZZD A;  3CCM T;  1Q86 C;  1Q86 U;  1LNX A;  3A8M B;  4RCB A;  3OBW A;  4M7D D;  2JZ2 A;  3BY7 A;  3CPW A;  4C8Q C;  5LJ3 e;  5GAN 2;  2VGM A;  1G3S A;  4FU6 A;  1KD1 U;  4A54 A;  1WJR A;  4C8Q A;  4F7U A;  1KD1 C;  4E47 A;  5CK9 A;  1K9M C;  1VQN T;  2C06 A;  3LWH A;  5FRN A;  5GAM e;  4M7A G;  2JTM A;  3DB4 A;  5L8R E;  4KBM B;  4HKE A;  3V8K A;  2DD4 A;  1Y96 B;  3ASK A;  4MZP A;  3M54 A;  1LJO A;  2K2V A;  1OZ3 A;  3OS0 A;  1W2B S;  1X01 A;  4XU3 A;  3LH0 A;  4PJO F;  1YJ9 A;  2RHU A;  4JRK A;  4N4G A;  3E9F A;  3E1S A;  4ELZ C;  3CCQ T;  4LDX A;  2M16 A;  3G7Z A;  3BW1 A;  3OYY A;  2RJF A;  4E7I A;  1VQN A;  3OW2 A;  3DLM A;  3HRU A;  3OBY A;  4M78 E;  4MML A;  2LCC A;  2DAQ A;  2X4Y A;  1QP3 A;  2ZPF B;  3KUF A;  2GCX A;  3PFS A;  2FB7 A;  4QQ6 A;  5FU7 C;  3JCM e;  4IUV A;  4LDU A;  5LJ5 f;  5LJ5 j;  3OYE A;  1VQ4 T;  4EMK B;  2B8A A;  2X4J A;  3PT9 A;  2XID A;  3CBP A;  5IN1 A;  3EAE A;  2DIQ A;  3CCQ A;  3QII A;  2LT4 A;  4N4H A;  3JCM b;  1U1S A;  2DTI A;  4XU1 A;  2O01 E;  3GNG A;  1OYX A;  2KDS A;  2MF2 A;  2P0Q A;  2QQB A;  2DD5 A;  4M75 C;  5FU6 B;  3OYH A;  2E41 A;  4M75 A;  3SD4 A;  1YBY A;  4PJO E;  2RHZ A;  1VQL T;  2I2L A;  1JBM A;  3EFS A;  3CCV T;  2M9U A;  5EG2 A;  1VQ6 T;  2OTJ T;  4RG8 A;  1VQ4 A;  4BI4 A;  3L1A A;  3CEY A;  2D0Q B;  5LJ5 h;  3TCJ A;  1M1G A;  2V8J A;  1NPR A;  2GFU A;  2IG0 A;  3M4G A;  1GXI E;  1I8F A;  3CXC A;  3PMT A;  3QO3 A;  5GAO m;  2RJE A;  4F7U F;  2FYK A;  2GQV A;  2QQA A;  3L2Z A;  2K5F A;  4MZM A;  5CKE A;  1BI3 A;  1I4K 1;  3HPW A;  1U1T A;  3E19 A;  4O5V A;  4A4E A;  4JUV A;  3G4S T;  4M78 B;  3CCV A;  1VQ6 A;  3LW5 E;  3M58 A;  1KQS A;  3LWI A;  1R8O B;  5IT9 E;  1VQ8 T;  3DLL A;  1JB0 E;  1UGS B;  2FHD A;  4B9W A;  3URG A;  4FT2 A;  1JJ2 A;  2PVG B;  3M4Y A;  3QYH B;  3CCU T;  2E6Z A;  4E7H A;  4FM4 B;  5A0G A;  3H8Z A;  4IUT A;  2LRQ A;  3RMQ A;  1Q7Y C;  3G4S A;  1QW1 A;  3CCL T;  2EAY A;  3OMC A;  2X35 A;  1MGQ A;  5GAN 7;  1YJN A;  1ZHI A;  2BKD N;  2L5Q A;  3HL8 A;  1VQ8 A;  4PJO B;  3SWN B;  4JLG A;  3TRE A;  2L3R A;  2QXF A;  4C8Q E;  2HNI A;  3JCM V;  1WJS A;  4DOW A;  5DY9 A;  2JNG A;  4PLL A;  3DKM A;  3CCU A;  1YIT A;  2EWN A;  2VUB A;  4L59 A;  3OYG A;  5GAN 8;  2E12 A;  1XOV A;  4OB2 B;  3LLR A;  4LDV A;  4M7D C;  3QZ5 B;  4M7D A;  3CC7 A;  4J7F A;  3S3M A;  3MCA B;  4M75 F;  3SFM A;  2XD0 A;  2R5M A;  4Y91 A;  2KK4 A;  4C92 D;  2RH2 A;  2DZ9 A;  2RI5 A;  4BE1 A;  2ZPB B;  2E10 A;  2E65 A;  2K5L A;  2HQX A;  3H6Z A;  3L2U A;  1K73 U;  5GAO n;  5GAN f;  4OMF B;  5GAN j;  4A4F A;  1M1K U;  1KQ2 A;  2R5A A;  3OA6 A;  1Y7X A;  1VUB A;  2GFA A;  3RMS A;  1LOJ A;  5AYF A;  3L2V A;  1M5Q 1;  3CMA T;  3MP1 A;  2VV5 A;  5J3B A;  4XTU A;  2DVE A;  2PUO B;  2PVD B;  5LJ3 f;  4BY6 B;  3NTI A;  5LJ3 j;  1EIF A;  1UGP B;  1IZ6 A;  2LVM A;  3MHX A;  3QHS A;  5GAO q;  4OB0 B;  2JVV A;  3M9Q A;  5GAM f;  1UGR B;  5GAM j;  2V8I A;  4XTZ A;  3FC3 A;  3M55 A;  2K5I A;  3A8G B;  5D6W A;  2V8K A;  1BIA A;  1M90 U;  1M90 C;  4M78 G;  2XU8 A;  4HT8 A;  1H3Z A;  3A8L B;  4C8Q B;  3LYI A;  1Y71 A;  2EJG A;  4IUQ A;  1V29 B;  5GAN h;  1YJW T;  2CZ1 B;  3CMA A;  2IVW A;  2RK2 A;  4RMO A;  2DPP B;  4R56 A;  4R55 A;  4C5I A;  3QPH A;  1N8R C;  4KUD K;  2LQ8 A;  3JB9 G;  3SB2 A;  2DKG A;  1VQO T;  3ER0 A;  5LJ3 h;  4BD3 A;  2LDM A;  4WF2 A;  1Y07 A;  3BFM A;  4XTX A;  4C0Z A;  2ZPI B;  4M77 D;  3UPU A;  3FEO A;  3JCM f;  3G71 A;  1QVG S;  2XDB A;  2QQS A;  1VQP T;  5LJ5 g;  2VGN A;  3JB9 F;  3A8O B;  4NL2 A;  5GAM h;  3NTH A;  2RO0 A;  4CI0 C;  3JCM W;  1YHQ T;  1QVP A;  3CPF A;  1NJI U;  3FDR A;  4PJO G;  2G3R A;  4ZTJ A;  3J81 E;  1ZBX A;  3CME T;  3CCS T;  3E9G A;  3V8J A;  1KHC A;  2EIF A;  2M1H A;  3A5Z B;  3J7A F;  3CCM A;  4XQ3 A;  4ZTF A;  1VQO A;  4M7D F;  5FU7 B;  1BI0 A;  3RES A;  2RHY A;  1QVF S;  2KMT A;  3JRZ A;  5J39 A;  2KSS A;  3ZBD A;  2EFI A;  4M7A D;  4LDY A;  5CKH A;  2LC4 A;  5HK0 A;  4E7K A;  4BAC A;  3QYG B;  3OS2 A;  4J6Y A;  4N4I A;  3JSC A;  4VUB A;  2A3L A;  2VC8 A;  3JCM h;  3VUZ A;  1Q82 U;  3JAM E;  3CPW S;  4PLI A;  2FVU A;  4DOV A;  1N6A A;  4OF1 A;  1N27 A;  1K8A U;  4M75 B;  4J5Y A;  1VQ5 T;  3CD6 T;  3QDR B;  1BYM A;  2OTL T;  4BB7 A;  1XQH A;  3QSU A;  1O75 A;  2NLU A;  4EPC A;  2EKO A;  2P0K A;  1UGQ B;  5GAO p;  2ZPG B;  4PKC C;  4XTW A;  3OYD A;  2E70 A;  2KVQ G;  1YIJ T;  1BIB A;  4M7D E;  4QVZ A;  4Z02 A;  2F69 A;  3MO8 A;  1WJQ A;  4QW2 A;  1D3B B;  4KUI A;  4XAX B;  2HBP A;  2WSC E;  3OSS C;  4FSX A;  3CCJ T;  3OW2 S;  2E1H A;  2DXT A;  2QDY B;  4F7U G;  4L5G A;  4JRI A;  4C8Q G;  5LJ5 d;  3JCM X;  1VQ5 A;  4KUL A;  3CD6 A;  2OTL A;  5CO7 A;  1M9S A;  5IAY A;  3CCE T;  4RG2 A;  3OYF A;  5GAO r;  2XK0 A;  4C8Q F;  2WSF E;  1D3B A;  4OP0 A;  4GLK A;  4IUP A;  1WNL A;  4C92 C;  4C0D C;  5GMK l;  1YIJ A;  4C92 A;  4J83 A;  4ATO A;  1VQL A;  2OTJ A;  2JN0 A;  5C0M A;  1KHI A;  3MEV A;  4II1 A;  3CCJ A;  3Q1J A;  2DIG A;  5GAN 5;  3RKW A;  4J6X A;  3S6W A;  2DTH A;  5KE3 A;  3I55 T;  3C12 A;  4OB1 B;  3OB9 A;  3M59 A;  5CKB A;  3HRT A;  4C0F A;  2EQK A;  2XI9 A;  3VU3 C;  3CCE A;  3QUI A;  3SDZ A;  3C4S A;  2EQJ A;  2Y90 A;  3UWN A;  1BI2 A;  1H64 1;  3CC2 T;  3G6E T;  4V2S A;  2WSE E;  3X28 B;  5GAN g;  4BDZ A;  1YI2 T;  2CZ0 B;  2ZPE B;  4IUU A;  3JB9 J;  4PNO A;  1S72 T;  4M7D B;  3OYA A;  2BUD A;  1VIE A;  3L42 A;  5LJ3 g;  5HK3 A;  1P92 A;  2DXB A;  3OYN A;  4ME7 A;  4X9D A;  4JLI A;  1N9R A;  1FX7 A;  3DB3 A;  3RKY A;  3I56 T;  2YHT A;  5M9O A;  3JCM P;  2RD1 A;  3QJ6 A;  3OYI A;  3S3N A;  1KQS S;  2AHJ B;  3N5B B;  4M75 G;  2XHC A;  5GAM g;  5CKD A;  4C0G A;  3OMG A;  3CC4 T;  3WXM B;  4A4G A;  3CC2 A;  4M77 C;  3RIR A;  2RI2 A;  3HKS A;  5DM7 R;  3JB9 I;  3CCL A;  2DTO A;  3PMI A;  4M77 A;  3OYC A;  4MDW A;  4MDX A;  2XDP A;  1TH7 A;  3T9N A;  4ZN3 A;  1RI0 A;  2EQM A;  3PIO A;  2QEX T;  2VYT A;  4QVD A;  1K73 C;  5I2M A;  4M75 D;  2EJ9 A;  2XIC A;  3I56 A;  1M1K C;  5CQX A;  4HCZ A;  2YLC A;  4DQ2 A;  3TU4 K;  1SSF A;  1G3W A;  3CBO A;  4P5N A;  4LD9 K;  3UDC A;  3CC4 A;  3JCM g;  2KY9 A;  3V7S A;  2R58 A;  5C6S A;  2DK3 A;  3ZEH A;  4EMG A;  5CR2 A;  4M7A C;  2RM4 A;  5FRM A;  1VQK T;  4C92 F;  1XNI A;  4A53 A;  4M7A A;  4D6W A;  3V8L A;  2L8D A;  4XU2 A;  3WVE B;  2QEX A;  3INZ A;  3HFO A;  5FLX E;  3RKX A;  3P8H A;  4KT0 E;  3WVD B;  4GY5 A;  1UEB A;  4CRI A;  3MEA A;  1M4Z A;  3BDU A;  4J7I A;  2Y4Y A;  4HA8 A;  5D6X A;  1MHN A;  5GAN d;  5GMK i;  3FB9 A;  2QA4 T;  4ZGD B;  3JCM J;  2LNV A;  4RCC A;  2PUK B;  3LGL A;  1DJ7 B;  2LX9 A;  5J26 A;  1FXX A;  1VQK A;  5LJ3 d;  3L2R A;  2WAC A;  4M78 D;  5A0D A;  3M5A A;  3MEU A;  3GF5 A;  3HRS A;  4XU0 A;  4LD6 A;  2XDD A;  3VUB A;  4HCC A;  2HQE A;  1AHJ B;  2CS7 A;  4X34 A;  5GAM d;  3M53 A;  1VQ9 T;  1G3Y A;  3LGF A;  3QBY A;  3HSB A;  3HHT B;  1KG1 A;  1U8R A;  1B34 A;  3JB9 D;  4MMK A;  5GMK e;  4C92 E;  1NJI C;  4A4K A;  1YJW A;  4M7D G;  1W2B A;  1I5L A;  5CCA A;  4PL6 A;  3RER A;  4BI8 B;  4EDU A;  2CZ7 B;  2ZGW A;  1HK9 A;  4J6W A;  1VQM T;  2MI6 A;  1I81 A;  4M77 F;  5HY6 A;  5A2Q E;  1O9S A;  2MMP A;  4Y28 E;  3OYJ A;  4E7L A;  1YJ9 T;  1VQP A;  3OSV A;  4FIB A;  4PJO D;  2QI2 A;  2K3X A;  1YCY A;  3VYH B;  1VQ9 A;  1YHQ A;  4JDS A;  3JCM d;  4ELY C;  3PTA A;  1Q82 C;  3GOX A;  1K9M U;  2PVO B;  1X75 C;  2HD0 A;  2JUF A;  2PU9 B;  3CME A;  3CCS A;  3OYL A;  1K8A C;  2A7Y A;  1VQ7 T;  4XTY A;  2DXC A;  1IRE B;  2CZ6 B;  1WQ7 A;  4O6J A;  4QQD A;  3VYG A;  4C5H A;  3S3O A;  3P8D A;  1WPY A;  2EQU A;  4J8O A;  1PSF A;  4XTV A;  1VQM A;  1KC8 C;  1KC8 U;  3X25 B;  3GLX A;  4M7A F;  2K4Y A;  3KXT A;  4IKF A;  2H3J A;  3NFC A;  2VXF A;  1NE8 A;  1XTD A;  4OB3 B;  3QJY A;  4UC4 A;  3QXE B;  5D6Y A;  3OYM A;  3CBM A;  2RI3 A;  2R57 A;  3MEW A;  4ZGE B;  1Y96 A;  4A4H A;  4M77 E;  4QVC A;  1PSE A;  2CYZ B;  3C94 A;  3OQ5 A;  1VQ7 A;  3C95 A;  3X26 B;  1M1F A;  4C92 B;  3QKJ A;  1X6O A;  4EMH A;  4C0D B;  4JS4 A;  5HKC A;  1Q81 C;  2QQR A;  3F70 A;  4NOY A;  5LL6 S;  5KH6 A;  1Q81 U;  3AHU A;  3V7R A;  2KQW A;  4RKU E;  3BDL A;  2RB6 A;  3MP8 A;  3VJP A;  3M56 A;  2VXE A;  5FRO A;  3V7C A;  4FT4 A;  1ZQ1 A;  3A8H B;  5GMK m;  1OZ2 A;  1HXD A;  4EMK C;  1Q7Y U;  4C8Q D;  2DO3 A;  4M7A E;  4EMK A;  3PIP A;  2JTF A;  4HCB A;  1QP2 A;  1N9S A;  3KBG A;  2QQ9 A;  2YLB A;  3EFR A;  3QG1 A;  3P8B B;  4C5E A;  4IUR A;  1WGS A;  5KCO A;  2RJD A;  4DA4 A;  3OS5 A;  4JJN K;  5CVI A;  5FU6 C;  5DLQ E;  4Q5W A;  5I21 A;  2YRV A;  2O4X B;  4BUG A;  5LJ5 e;  2RHX A;  5GAO l;  2EYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...