1OZ2A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
324
structure length
324
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 83
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz2A03
3L2WA 2F5KA 2O4XA 2NLUA 3NTIA 5M9OA 2B8AA 1OZ3A 3DB3A 4QVZA 3OY9A 3OYGA 2GFAA 2M0OA 2XK0A 4E7HA 5KH6A 5KCHA 1G5VA 2RHXA 3H8ZA 3MP1A 2D9TA 1OZ2A 3MP8A 3P8DA 4HCZA 1KHCA 3OYDA 4E7KA 3LH0A 4IUPA 4PL6A 5KE3A 3LGLA 4BDZA 2M1HA 4NS5A 3OYNA 2HQXA 3OMCA 4QQ6A 3L2UA 3C4SA 4E7IA 3QIIA 1WJQA 3LYIA 5CIUA 4IUQA 4B9XA 3FC3A 2MWOA 3EAEA 3OYBA 2LTOA 1N27A 2RJCA 3ASKA 2X35A 3OYLA 2RHUA 3CEYA 4L59A 1OI1A 2PQWA 4C5EA 4N4GA 3OS0A 5FRNA 5FRMA 3OYHA 4N4IA 2O4XB 3ZEHA 1H3ZA 3PMTA 2BUDA 3MP6A 4A4EA 4A4FA 4X34A 3L2VA 3E9FA 5D6XA 4QQGA 3MO8A 4E7LA 2L8DA 5FROA 3PMIA 1WGSA 2RI3A 3OYJA 4LD6A 5C0MA 4ZTJA 4IURA 5J39A 2RI5A 2DAQA 4OVAA 2P0KA 3META 4C5IA 2EFIA 3OYAA 3O8VA 1MHNA 2RI2A 4PLIA 4Z02A 4E7JA 1WJRA 3NTKA 3QBYA 3L42A 4BE1A 2G3RA 1OYXA 2XDPA 3MEWA 2EQUA 4C5GA 3OQ5A 3MEAA 3FDRA 2JZ2A 2RHIA 2RJFA 4FU6A 3OS2A 2R57A 5J26A 4N4HA 3NTHA 3OYMA 4BE2A 4BDYA 5D6YA 2X4XA 3OA6A 3S3MA 5IN1A 3M9QA 4A4GA 2GF7A 2R5AA 3DB4A 4PLLA 3LGFA 1XNIA 2LCCA 2QQSA 2K3XA 2YRVA 5KE2A 3OYKA 2GFUA 4A4HA 3OS1A 3OYIA 3P8HA 3OMGA 2X4YA 2L89A 3LLRA 4Q5WA 4ZTFA 2RO0A 4IUTA 2VYTA 3MEUA 3OB9A 5KCOA 2FHDA 2EQKA 2EQJA 3FLGA 2IG0A 2HQEA 2E6NA 4C5HA 3F70A 1WJSA 1RI0A 2R58A 4BACA 2DIQA 3Q1JA 2LVMA 3BDLA 4BE0A 3OYFA 2X4WA 2R5MA 3PNWC 3SD4A 3E9GA 4IUUA 1SSFA 3OYEA 4UC4A 3ME9A 2QQRA 2BIVA 3UT1A 3H6ZA 2MWPA 4EDUA 3S6WA 3L2QA 2WACA 2RJEA 3S3NA 2CKKA 2LDMA 2RJDA 4QW2A 3FEOA 4CRIA 3UWNA 5IAYA 2L3RA 2E5QA 2RHYA 4RG2A 5D6WA 4B9WA 2DIGA 2JTFA 3KUFA 4FL6A 4GY5A 2M16A 4QQDA 4II1A 2EKOA 3QKJA 3GOXA 4IKFA 2K3YA 3QJ6A 4IUVA 3MEVA 3L2RA 3S3OA 3LX7A 2LRQA 3DLMA 3PFSA 2BKDN 3OYCA 2RHZA 4BD3A 2EQMA 5C6SA
chains in the Genus database with same CATH superfamily
2EJGA 4DEXA 1YBYA 3JV3A 4A54A 4CC4B 2EJFA 1GCPA 5I11A 3V7RA 3C0CA 2JNGA 2JTEA 5CKBA 1G8XA 2CT3A 5DLQE 2X9HA 5A0DA 4C8QB 4FSXA 1SHGA 3MKDA 4JRIA 4XU3A 2FZCB 1V76A 4JJNK 5CKDA 3CMAQ 4R56A 1X2KA 1I5OB 3ASKA 3INZA 3REBB 2LQNA 1QVGA 1JB0E 4J8OA 4ZNXA 4N0AA 1QQJA 2WSFE 3ZEHA 1KQSP 3MP6A 1ZUKA 2B86A 2DPPB 3EG2A 1VQ5T 5CCAA 4EMKC 1WA7A 3JCMX 2K79A 2RI3A 1VQ7A 3I55T 3J80E 4D8DA 1RI9A 4C5IA 1FX7A 4V2SA 4BI4A 2RI2A 4JRPA 1D1BA 1UGQB 3CMAA 1JU5C 2CS7A 2YRDA 1GCQA 2DILA 1YWPA 3CC2A 4ATOA 1BCOA 1G2BA 2PUKB 5GAN3 3OYIA 3C95A 1VQ9Q 3P8HA 2E64A 4IUTA 4FW1A 4XTUA 2EYXA 4DBHA 3I55Q 4C8QF 1RI0A 1QW1A 4BE0A 1H641 1K1ZA 3RMSA 2DKGA 2WACA 4QW2A 2DL7A 5AYFA 1X27A 1OPLA 4GY5A 3HRTA 1FXXA 5HY6A 1JEGA 4FCYA 1HXDA 3S3OA 3LX7A 3QXEB 2HNIA 5C6SA 4PJLA 2CZ6B 3GBQA 4BI3A 3MCAB 4JS4A 1UGPB 2XK0A 5KCHA 2DXBA 1R0BG 4WTOB 4E7KA 2VKNA 4EMKA 1M2OA 2CH4A 1LPLA 5KE3A 5CAIA 1M3AA 2XHCA 2HQXA 2K4YA 2QXFA 2DTOA 2A36A 2DL3A 4E7IA 1YI2A 1E6GA 5CIUA 4IUQA 1ZHIA 2A3LA 3CCVT 3C12A 3TREA 1KK7A 4M77A 4A63B 2GCXA 3TCJA 3CXCP 2GTJA 3CMET 2KE9A 3CXCS 5GAOn 2JMCA 3M53A 5GJVB 3OYYA 1W2BS 1M2VB 2E3IA 1QVFS 1WJRA 3RMQA 1OYXA 3OQ5A 4AT1B 2DZCA 4D8KA 3OYMA 5LJ3j 3A5ZB 1QP3A 1WXUA 3TVTA 5J3BA 2K2MA 2CZ1B 1QCNA 1M1KU 2CP5A 3V7SA 2YLBA 2L89A 2E70A 1ZSGA 3NMZC 2HAXA 2E6NA 1JJ2P 3WXMB 1A0NB 6AT1B 2JUFA 3G7ZA 1B7TA 3QO3A 4OB0B 4LXCA 3RIRA 4M75G 1G3YA 1Q82C 3CCEQ 1TUCA 2JM8A 1U06A 2EKOA 2D8HA 2CP3A 2Y90A 5GMKm 4DA4A 2ZAEA 2DERA 2XD0A 1KQSA 3EGXB 2K9GA 1ZBJA 3JCMe 5KYXA 2M0OA 2EYYA 2MMPA 3MHXA 3JCMQ 2M51A 4KRTA 3ER0A 2BZXA 4OMPA 2LCSA 2NYSA 4C92A 4NS5A 1BYMA 4HA8A 3M56A 4ORZA 3CCEA 4J6WA 1IREB 1KQ1A 4Y91A 3CC4A 1WJQA 5IHIA 2QASA 1I1JA 4M7AA 1UUEA 1TWBA 1ZSZA 3HFNA 3EH2A 3TEEA 4E2FB 3CCVQ 4F7UG 4X34A 3L2VA 2DEQA 3E9FA 1KQSS 4NL2A 2VB6A 4L6V5 1M1KR 2DYIA 2FZKB 5KYYA 1IXDA 1Z9ZA 3OW2S 1WHHA 4L5GA 3CCJQ 4C92F 2LNVA 1NBEB 2JN0A 2YSQA 3PIPA 5GAN7 4RTXA 2DBKA 2RA2A 2XMFA 2ROTA 3MEAA 2CT4A 4FYXB 1YJNA 2LNHB 1N8RU 4CC3A 1SRMA 3SWNC 1UTIA 1OOTA 2DXTA 4XTXA 1UJ0A 4KGZB 3X25B 2ZZDA 3G71T 2QQSA 1Q86U 3H41A 1H3HA 1K8AU 3OS1A 4HVVA 3OMGA 2DLPA 1TTHB 1VQ5Q 4XAXB 2M9UA 2QI2A 2IPOB 3HFOA 3M54A 1WJSA 1WIEA 4KBMB 2DIQA 3C94A 3PNWC 1VQLQ 2NUTA 4M75D 3M0QA 4LD9K 4EDUA 2CP0A 2RJDA 4F14A 4ZGDB 3CBOA 1BI0A 3GLXA 1ZSZC 2MYSA 1BIBA 1BB9A 4JJBA 3MEVA 5GAN5 2HSEB 2RQTA 4C8QG 2A08A 3V8LA 5L8RE 1VQ5A 2DEUA 1N5ZA 1T0HA 5CKFA 2EGAA 5GAN6 3TQ7P 1NZ9A 5M9OA 1S72T 3OY9A 3EFRA 1FYNA 1KC8U 1VQLA 1QWEA 3EG9B 2M1HA 1UE9A 1H8KA 2P0PA 5LJ5h 3NGPA 1WI7A 4C0FA 3RESA 1AT1B 3M0PA 1C0MA 2O4XB 2MCNA 2ESWA 3CCQA 1Q86R 1N9RA 2ATCB 4M78B 2HBPA 3A8MB 1C6VX 2Y4YA 5IH2A 2COYA 5FWCA 2KYBA 5ECAA 2C0TA 2F2VA 4BI8B 2FO0A 1NLOC 1SRLA 1OX8A 1IHWA 3CD6T 1WPYA 2C0OA 1WQWA 1BKBA 3VRYA 2J05A 4AG1C 1HJDA 2EW3A 4C92E 2X4XA 4M77B 5IN1A 2GF7A 2R5AA 2AIRB 1M1FA 3PGGA 3TSWA 1UECA 2LCCA 1BI3A 1TG0A 3CCMT 1WQ7A 5DY9A 4RG8A 4F7UE 1GL5A 3LLRA 1VQNA 2E4HA 2ZPIB 1X6OA 4FYWB 1QKWA 2ZPEB 2NWMA 2X51A 1AD5A 1IRXA 1W1FA 4BACA 2PVGB 2ZPFB 1Q95G 2IIMA 3OYFA 3CPWP 2CREA 4C8QE 1RAGB 3VU3C 4M77C 3TU4K 1M90C 3H6ZA 4J6YA 4EMGA 1PRMC 1UFFA 2KNBB 5GAOp 2BE9B 3FJPA 1SG5A 2FG0A 2KYMA 4E7ZA 3JCMd 2D6FA 2QQ9A 2FPFA 4OGEA 1YCSB 2EQMA 1VQNQ 3OBWA 2D8JA 3G71A 4EIKA 2HCKA 2HL5C 2EIFA 4R55A 3OYGA 1G5VA 5GAMh 3P8DA 4OMMA 2QEXT 5A2QE 4M7AG 4D6WA 2KEAA 4QQ6A 3C4SA 1WDXA 4EPCA 1TXQA 1W4SA 2DF6A 4J7IA 2EQIA 1K9AA 1O75A 3IQLA 4RTYA 4N4IA 3CCRA 1T3LA 2E5KA 1GBRA 1Q82U 2RPNA 1N6AA 1NM7A 4XTVA 3KBGA 3EH1A 2RMOA 4LD6A 5GANe 2QQAA 3GNGA 3META 4DOWA 3G6ET 2KVQG 1MNDA 2DBMA 3M58A 4B6MA 3OS2A 1Q7YU 1CKAA 2EYQA 2KMTA 2YXYA 3NTHA 3VS3A 3OA6A 1PC0A 8AT1B 3NPFA 5GAOl 5KYNA 3CCRQ 4Z89A 2BTTA 5L23A 2VGNA 4BUGA 3EHRA 2L5QA 2LMJA 2YUPA 1QVFP 4E6RA 4ZTFA 4GBQA 5KCOA 1VQ7Q 1I8FA 5I22A 2VXFA 2HQEA 4JUVA 2MPXC 3CCJT 1UGVA 5GMKj 4M7DG 4M75F 4RUGA 4J9GA 2QAZA 2YWWA 2MWPA 3L2QA 4CRIA 1UG1A 2RF0A 2L3RA 2RK1A 2RN8A 5LJ5f 4RTZA 3CC2Q 3CPFA 4IKFA 1NLPC 4M7AB 1TUDA 5IHNA 2LRQA 3L1AA 4C0DB 1VQ9A 4LDVA 3HKSA 1VQMT 3L2WA 3UATA 2E41A 3I55A 1XOVA 1NJIU 1Y71A 1LCKA 1Q7YC 2D9TA 3EG3A 1RLQC 1AVZC 4BY6C 1MMAA 1N8RR 3M55A 3GIBA 1V29B 1HYOA 3QIIA 3EGDA 1X69A 4B9XA 2KQWA 1OPKA 2OI3A 4C0GA 2RJCA 3J7AF 1PWTA 3CEYA 5IHKA 1OI1A 2PQWA 1M90U 2COZA 7AT1B 2DO3A 1X2QA 2QG9B 2AZSA 2SRCA 4ANJA 4J9IA 1KIKA 4OMNA 5D6XA 2DYBA 1NE8A 3MO8A 3JSCA 5FROA 2K3BA 4M7DC 2DNUA 2JS2A 1B3QA 2EVRA 3SEMA 2ZGWA 1PRLC 4C0DC 5KYUA 3QDRB 4M7AE 3LWIA 2P84A 1YI2Q 4BE1A 1FMWA 2A0FB 1VQKQ 4FU6A 1R8OB 4N4HA 3G6EQ 2JTMA 1D3BB 2E6ZA 5KYWA 1VQ9T 1KC8C 3PVLA 3M4YA 1UDLA 3RUXA 2A37A 2X3XD 2LQWA 4M78G 1VIEA 2VYTA 3CXCA 2EQKA 3L2ZA 3M0SA 9ATCB 2GBQA 3JB9D 2KXDA 4ELZC 1JJ2S 2HQHA 1YI2T 4BY6B 1VQKA 3CMAT 2VGMA 5D6WA 3G6EA 3KUFA 1ARKA 1GXIE 3CC7A 1OX9A 4PJMA 4OF1A 2RHZA 4TVRA 1YHQA 1NPRA 4LDYA 4M7AC 2O4XA 2YHTA 2RQWA 1M90R 4KULA 3ULRB 1OZ2A 1VOMA 2VV5A 2YDLA 3G1JA 1SPKA 2F1LA 4XU2A 1JXMA 1X43A 2PVDB 1JJ2A 3L2UA 2OTLA 5CR2A 5GJWB 1X6BA 3QUIA 5GAN4 1WHGA 1KG1A 3CC7Q 4ZGJB 2OAUA 2QYZA 1AOJA 1QCOA 3E19A 1D1AA 2L0AA 3EHQA 3SDZA 1IB8A 1Y96A 1QVFA 5EG2A 4LE9A 4JZ4A 5C0MA 5GMKe 2F2WA 5J39A 1K8AC 2EFIA 2OTLQ 1AZEA 3CPWS 1Q81U 4ZN1A 3CC4Q 3JCMb 3CC7T 3D7SB 3HTRA 5LJ5j 3M9QA 4J9CA 4FT2A 2V8JA 3CCVA 3RR6A 1RAAB 2DD4A 4ZN3A 3HPWA 1RL2A 4FSSA 1R77A 1K0XA 2O9SA 1VA7A 1YJWT 5GAMj 4HCKA 4XU0A 1QVGP 4F7UB 1M5Q1 5LJ3g 2R58A 1T3SA 3A8LB 5GANd 3CCSA 3M5AA 5GANj 4FT4A 1B34B 4IUUA 1SSFA 3VS1A 2BIVA 1QP2A 4J6XA 1N9SA 4X1VA 2QQBA 3SWNA 1YJNQ 5LJ5g 1W70A 2IVWA 2DIGA 2E10A 1FMVA 1VYVA 4FYYB 2K6DA 3FB9A 1VQ8T 2F5TX 2BKDN 4A4HA 1M4ZA 2PVOB 3A8OB 4EMKB 2EYZA 4DBQA 2AKLA 3DB3A 3QHSA 1K73U 1WXBA 1N8RC 3H8ZA 5DLOA 4M78F 4PJOD 1YIJT 1YJ9A 1Q7YR 3BFMA 3V8KA 2QEXQ 2ED0A 1NEGA 4XTZA 3CC2T 4N0AC 3OYBA 3V7CA 1G3SA 1I5LA 3MPUB 1K76A 3QDFA 1IZ6A 2KI7A 3G4SA 1AHJB 3RKYA 5KYXB 5IXFA 2VWFA 2P4RA 2FL7A 1AZGB 1AEYA 1XQHA 2NUPB 2HEQA 1CKBA 4ZGEB 3QG1A 4LDWA 1RUWA 5LJ3e 3QBYA 1MGQA 2XKOC 4AFSC 1UHCA 2EQUA 3FDRA 2FPEA 3M59A 1ACMB 1YNZA 1MMDA 4PJOB 4A4GA 1PKTA 4RCBA 5LJ5e 3A98A 1IHVA 1QKXA 1CSKA 1TH7A 3VS6A 2Z0WA 4Y92A 4F7UA 4PJOG 1QCFA 2KT8A 5GAMd 3MEUA 3M0UA 4J7FA 1VIFA 2BZ8A 2NUPA 2MK5A 4X9CA 1VQ7T 2X4WA 3JCMc 2CKKA 3I56Q 4MDWA 2MOXA 4QQDA 4NL3A 1BU1A 2GTOA 3L2RA 1Z9QA 4AFZC 2CUDA 4ME7A 1M1KC 2E65A 2CGHA 2L3PA 2KRMA 1VQMQ 2CP6A 1X01A 3JAME 3OYDA 3M0TA 3WVEB 1D0XA 2KSSA 2LZ6B 8ATCB 3I56A 3LWHA 2DL8A 2FB7A 3SHWA 2DJQA 2J6OA 1ZQ1A 1YIJQ 2CDTA 3PTAA 4JJDA 3EAEA 1ZX6A 5A0LA 1N27A 3HSBA 4PJOC 4P5NA 3CCMA 1J3TA 1VQ4T 2Y4XA 4RTUA 4LDXA 3G71Q 2JJ9A 1PD1A 3PMTA 4MZMA 2HL3A 4OGCA 4MMKA 1KSWA 2KK4A 2PU9B 1WGSA 2KY9A 3KXTA 1VYUA 2J06A 1RAHB 5GANf 3O8VA 1MHNA 4Y28E 1YIJA 2NUZA 2RJFA 1D09B 3CCMQ 1NJIR 1U3OA 1KC8R 1VQ4Q 1NG2A 2K3XA 2GFUA 1VQPT 2O9VA 4M78A 5D7UA 2RO0A 2K5IA 5A0GA 3BE3A 3HRUA 1I0CA 4LDUA 4DQ2A 3BW1A 2OTLT 1AWJA 4C92D 2QQRA 4J9EA 3OSSC 3S3NA 3QZ5B 3JCMP 1PG5B 2QA4A 4IIOA 3FEOA 3JCMf 3UWNA 4M7DE 3QJYA 2QGGA 4MDXA 4RG2A 1B34A 2KBTA 2JTFA 4RKUE 4II1A 2H8HA 4PKCC 1SEMA 5HK3A 2HKNA 4XQ3A 1GCQC 5AT1B 4RMOA 4HVWA 4AMCA 2ZPGB 3VS2A 4PFPA 5GMKi 2DL4A 2O2OA 2RHXA 3QPHA 2MAMA 2EPDA 1JRIA 2QA4Q 4LUDA 2FYKA 3I5RA 3VYGA 1GBQA 3OYLA 2DVJA 4M77D 1G3TA 1OQKA 2HKQB 1ZLMA 3JB9I 3EG1A 1EX4A 1RADB 2QDYB 1M3BA 2JM9A 5GAOq 1S1NA 4E7LA 2L8DA 2CZ7B 3QZ9B 3JB9G 5GMKh 4DBRA 2COWA 4RTVA 4MZPA 2MIOA 4M7DF 5KYYB 1RACB 2QA4T 4E7JA 4AFUC 4M75A 2KRNA 3L42A 2ABLA 4FYVB 4J9HA 2G6FX 1RLPC 2R57A 4J5YA 4BE2A 4JLGA 2CH4W 1NPPA 1ZBXA 2DFUA 2RK2A 1KD1U 3CCUT 1NJIC 3CMEQ 2FRYA 5CVIA 5HK0A 1E6HA 4KH1B 3OB9A 2FHDA 3CBPA 4C8QC 1VQLT 2DJZA 1YJWQ 1Y57A 4C0ZA 3BDLA 3WVDB 1WHLA 2R5MA 3E9GA 5GAOm 1OV3A 3OYEA 4A53A 1BCMA 3OBYA 2LX7A 4C92B 4J83A 5HCKA 3RERA 3GPLA 2M16A 5LJ3f 3GOXA 1KJWA 1OEBA 2K3YA 2VVKA 1XTDA 1VQ6T 2CSQA 2K5LA 2FZGB 3PFSA 3JB9H 3X20B 1ZUUA 2OTJT 2XIDA 2CUBA 3SB2A 3A8HB 2NLUA 2L3QA 5IXBA 1YJWA 4KT0E 1LNXA 2AZVA 2J7IA 3EG0A 3LGLA 4HXJA 4MZTA 3CD6A 1K9MR 2DA9A 2VUBA 2EBPA 3UPUA 2O88A 2HDAA 2RH2A 2MWOA 2YUNA 3ZBDA 3CCUA 2OJ2A 1R0CB 2X35A 1VQ6Q 2EYWA 4PJJA 4N4GA 1YHQQ 2VC8A 2YUQA 1PKSA 2GNCA 5GMKl 3JCMJ 3RKXA 3HP9A 3EFOA 1TUGB 3R6OA 2DE0X 1KD1R 1SF9A 3PT9A 1Y96B 4J9DA 3CQTA 4WF2A 3BY7A 3GF5A 3CD6Q 2LT1A 5CQXA 3OYAA 1V1CA 5HKCA 2DX1A 4M75E 1MV0B 3VKIA 4C5GA 2RHIA 2LP5A 4JRKA 2EGEA 4GLMA 1RAFB 4GLKA 4JRQA 2OTJA 1YHQT 4DOVA 1W2BP 3OSVA 5CQYA 3OYKA 2OX7A 2D1XA 5FU7C 1D1CA 3NFCA 5FW9A 4HT9A 2EQJA 4X9DA 2EAYA 3EGUA 1WHKA 1M8VA 2VASA 1KHIA 3CCLA 5IAYA 3CPWA 4M7DD 5EC7A 1WZOA 1D3BA 1O9SA 1PCXA 4FL6A 3VJPA 1SSHA 3EGXA 4RTTA 1NEBA 4KUDK 2DTIA 2O01E 3TSZA 4BD3A 2DXCA 2DZ9A 1BI2A 3VUZA 1EFNA 1VQOA 4QVZA 2LX9A 2V8KA 5KH6A 4RTWA 4HCZA 1ZUYA 4CI0C 3CCSQ 2FPDA 3CCLQ 3HRSA 3EFSA 1I4K1 2RQRA 1AWOA 2DTHA 1SKUB 1I81A 2BZYA 2F2XA 4C5EA 1RABB 5KYWB 2P0QA 1K9MC 4JJCA 2DVEA 2MI6A 1MNEA 1K9MU 3H0IA 1JXOA 3REAB 1VQOQ 1Y7XA 2X4JA 5GANh 1TSFA 2V8IA 2AK5A 2RI5A 2DAQA 1YJ9Q 2P0KA 2YUOA 2W10A 4PLIA 2QEXA 3BDUA 1LOJA 2JZ2A 2L3SA 2LJ1A 4KGVB 4BDYA 3S3MA 2PZ1A 3X24B 2C0IA 1XNIA 3G4SQ 1Y0MA 4PFOA 2M02A 4C92C 2DM1A 2A7YA 2KT1A 1OULA 1WFWA 1WHMA 4LN2A 3MJXA 1ABOA 2LVMA 5I2SA 3JCMh 4UC4A 1MV3A 1D0YA 2PNIA 3JCMg 4QVCA 2RJEA 2F69A 1G3WA 1QMCA 3QKJA 3V8JA 1GFCA 3PIOA 1QVGS 4M7AD 3DLLA 1U1SA 2RNAA 4M78E 3G4ST 2RM4A 5CKEA 2E1HA 5CK9A 2XDDA 1RAEB 2CYZB 2F5KA 3N5BB 4A4KA 1TOVA 3OW2A 1OZ3A 3EG9A 2GFAA 4E7HA 1PSFA 2ZPHB 2P4TA 3MP8A 2EWNA 3LH0A 1FMKA 3FRNA 2YLCA 2WSCE 4AG2C 2K5FA 3CCLT 4QT7A 2DRMA 2RD1A 4KH0B 5GAN8 2VXEA 4C92G 3OS5A 1PD0A 4Z88A 3PE0A 4JDSA 2QDLA 4F16A 1SHFA 1FWZA 1H3ZA 4A4EA 1HD3A 3VV0A 4PJOE 3X28B 1VQMA 4QQGA 4J9BA 3PMIA 1M27C 3VS4A 3KFVA 3OYJA 1UHFA 1YFNA 4ZTJA 5I21A 3QYHB 1IO6A 4OVAA 5LL6S 3M57A 2MF2A 2D0QB 2DK3A 4M78C 2XG8D 5GAOr 4Z02A 2JT4A 4OB1B 1TU0B 3THKA 2JMAA 3P8BB 1YJ9T 3GP8A 2G3RA 3MEWA 1IGUA 4KUIA 1HSQA 2ROLA 1G83A 5D6YA 1W2BA 2WSEE 5CO7A 2H3JA 1MMGA 2KDSA 2ED1A 4PLLA 5FLXE 4JS5A 2LQ8A 2HMAA 2K7AA 1K8AR 2ENMA 3RBBB 1YITA 2AKKA 2CP7A 2DXUA 3OW2P 4PNOA 1KQ2A 2KROA 1PM3A 4AFQC 5GAN2 3LW5E 1YWOA 2J6KA 1I07A 3UT1A 2E3HA 5FU6B 1H92A 2NUTB 3A1PA 2AHJB 1WXTA 1VQ4A 3QJ6A 4PFZA 1YCYA 1ZSZB 1P92A 5IT9E 3OYCA 4CC7A 1BK2A 4F04B 1M1GA 1UB4A 1Q86C 1NYFA 2H3EB 1YITQ 4VUBA 2B8AA 2A28A 2EJ9A 3MP1A 2QGFB 2LT4A 1JQQA 1LJOA 2J6FA 1LVKA 2KR3A 4JPBW 2EKHA 3OMCA 1QLYA 3ZFJA 1K73C 3UF4A 1VQKT 1UGSB 3LYIA 2ZPBB 3FC3A 5GAMe 3LH5A 5GAMg 2LC4A 3QYGB 2RHUA 1T0JA 4FW2A 1VQPA 1OU8A 5FRNA 1U1TA 3OYHA 3T9NA 1YITT 2K2VA 4R0KA 1WLPB 2FEIA 1KFZA 4OMFB 4HKEA 1UGRB 3CCST 4M75B 4XU1A 3H9NA 2RQVA 4RCCA 2FVUA 3GNFB 1AWWA 4M78D 4PJOF 4M7DB 1BBZA 2DD5A 1BIAA 2QK0A 3RKWA 2O31A 3QWXX 1QWFA 2XDPA 1YN8A 2DMOA 1M30A 1ZA2B 5J26A 4M7AF 4XK8E 5LJ3d 1Q81C 1VQPQ 1VQ8A 1W6XA 4YTLA 2X3WD 2LJ0A 1IGQA 1JO8A 2L2PA 1WX6A 1WHJA 2IG0A 5KYUB 3F70A 3ZL7C 3H0HA 2DRKA 3Q1JA 2GQVA 4PJNA 3S6WA 4OP0A 3I9QA 1U5SA 2LJ3A 4OB3B 3URGA 1VQ8Q 2JVVA 1Y07A 2JW4A 4OMQA 3O5ZA 3CMEA 3U23A 2KRSA 1QVPA 1EZZB 1E7OA 2HSPA 1PHTA 2EGCA 1PNJA 2CZ0B 2XICA 1K4US 2GGRA 3DKMA 4M77F 4MMLA 2HZYA 1HK9A 1KHCA 1D0ZA 3AT1B 4IUPA 5FU6C 4PL6A 1S72Q 2I2LA 3EGDB 2XDBA 2JS0A 3FJ5A 3CCJA 3RDVA 2ECZA 3OYNA 2E12A 4BB7A 3J81E 1XJWB 5LJ3h 2LQKA 1WNLA 3VS0A 3JB9J 3HHTB 4K11A 2LTOA 3AHUA 2DETA 2HBWA 4L59A 3VUBA 1K73R 4FIBA 5FRMA 2BUDA 4A4FA 4HT8A 2BE7D 1M3CA 4XTWA 4XTYA 1GRIA 3UA6A 4QKUA 1VQOT 1S72A 4LUEA 1ZA1B 2KXCA 4O6JA 2LCLA 2C06A 2OAWA 1EIFA 3E2UA 2M0YA 1DJ7B 1K0SA 2XI9A 2SEMA 4M7DA 3CCUQ 3VYHB 4HVUA 1VQ6A 3M4GA 5DM7R 2GQIA 1MMNA 1X6GA 3DB4A 3LGFA 1VYTA 2YRVA 1Q81R 4CC2A 5KE2A 1RAIB 2CSIA 2X4YA 5GANg 1JBMA 4QVDA 4O5VA 3A8GB 4DBFA 2JOYA 3CCQT 3FLGA 3QSUA 4C5HA 4KGXB 3M0RA 3I56T 1U8RA 3SD4A 5GAMf 1NYGA 4DEYA 3I5SA 1M8MA 5I2MA 4B9WA 4LNPA 1F1BB 1M9SA 2OTJQ 4FM4B 1YP5A 2KGTA 3DLMA 4WCIA 2HD0A 5LJ5d 2K57A 1WYXA 3H0FA 3CBMA 4OB2B 2AT1B 1UJYA 3CCQQ 3NTIA 2PTKA 3EFOB 1VQNT 2QTXA 4C8QA 2PUOB 2CP2A 4E47A 3I35A 3X26B 2KAFA 2QTVA 2XU8A 1UEBA 4BDZA 4J9FA 4M4ZA 4Z8AA 1M2VA 1YJNT 3JB9F 4ESRA 1Q82R 4JZ3A 4PJOA 3OS0A 3HL8A 4JLIA 3JCMW 4NOYA 4C8QD 3JRZA 4HCBA 4F17A 1X75C 3FIFA 3NHNA 2YT6A 4F7UF 1C1AA 1VUBA 4IURA 2FRWA 3UDCA 3R6NA 1KD1C 4M77G 3NTKA 3JCMV 1PSEA 3VS5A 2RQUA 2RB6A 1B07A 3UA7A 2DL5A 3CCET 3VS7A 1MUZA 3CC4T 3PVQA 2V26A 1ABQA 2V1RA 4HCCA 1GFDA 4IIMA 4PK4A 1TS9A 3QWYA 4Q5WA 3CCRT 2I0NA 3E1SA 3SFMA 4ELYC 5FU7B 4M77E 5CKHA 1BI1A 3VRZA 1AWXA 3ME9A 4E7SA 4OMLA 2LDMA 2ZCFB 2E5QA 2RHYA 3RNJA 2D0NA 2JXBA 4EMHA 2V1QA 3SWNB 4IUVA 2W0ZA 4OMOA 1OU9A 4M75C 5FWBA 2YRCA
chains in the Genus database with same CATH topology
2EJGA 2E65A 2F5KA 3G71A 1YBYA 3N5BB 4A4KA 2CGHA 4A54A 3OW2A 2EJFA 1OZ3A 1X01A 2EIFA 4R55A 3OYGA 2GFAA 4E7HA 3JAME 3V7RA 1PSFA 2ZPHB 2P4TA 1G5VA 5GAMh 2JNGA 3MP8A 3P8DA 3OYDA 5CKBA 2EWNA 3LH0A 3FRNA 5DLQE 2QEXT 5A0DA 3WVEB 2YLCA 4FSXA 4C8QB 5A2QE 4M7AG 4JRIA 2KSSA 4XU3A 4D6WA 3I56A 3LWHA 4QQ6A 2WSCE 4JJNK 5CKDA 2FB7A 3C4SA 4R56A 1ZQ1A 2K5FA 3CCLT 3PTAA 2RD1A 4EPCA 5GAN8 3EAEA 5A0LA 2VXEA 1N27A 1W4SA 3OS5A 4C92G 3HSBA 3ASKA 3INZA 4J7IA 4PJOC 4P5NA 3CCMA 1O75A 1QVGA 1JB0E 4J8OA 1VQ4T 4JDSA 2Y4XA 4N4IA 4LDXA 1FWZA 4N0AA 2WSFE 3ZEHA 3CCRA 3PMTA 1H3ZA 3MP6A 4A4EA 4MZMA 3VV0A 4PJOE 2DPPB 3X28B 1VQMA 4QQGA 4OGCA 1VQ5T 5CCAA 4MMKA 4EMKC 3PMIA 2PU9B 2KK4A 1Q82U 1N6AA 4XTVA 3JCMX 3KBGA 1WGSA 2RI3A 3OYJA 3I55T 4LD6A 1VQ7A 3J80E 4ZTJA 5GANe 5I21A 2KY9A 3QYHB 3KXTA 2QQAA 4OVAA 5LL6S 3GNGA 2MF2A 3M57A 2D0QB 2DK3A 3META 1FX7A 4M78C 2XG8D 4C5IA 4DOWA 3O8VA 1MHNA 2RI2A 4BI4A 4Z02A 5GANf 4JRPA 1UGQB 4OB1B 4Y28E 3CMAA 1YIJA 3G6ET 3P8BB 2CS7A 1YJ9T 2KVQG 3GP8A 2G3RA 3MEWA 4KUIA 2RJFA 3M58A 3OS2A 1Q7YU 2EYQA 2KMTA 3NTHA 5D6YA 3OA6A 1W2BA 2WSEE 3CC2A 5CO7A 2H3JA 4ATOA 2KDSA 4PLLA 2PUKB 5FLXE 5GAOl 2LQ8A 4JS5A 2K3XA 5GAN3 3OYIA 2GFUA 2VGNA 3C95A 4BUGA 1VQPT 4HT8A 3P8HA 2E64A 2L5QA 4M78A 4ZTFA 2RO0A 4IUTA 4XTUA 2K5IA 5KCOA 5GAOr 1YITA 1I8FA 2VXFA 4C8QF 2HQEA 5A0GA 2DXUA 4JUVA 4PNOA 1RI0A 1KQ2A 3CCJT 1QW1A 3HRUA 4LDUA 4DQ2A 5GAN2 4BE0A 1H641 3LW5E 5GMKj 4M7DG 4M75F 3BW1A 3RMSA 2OTLT 2DKGA 4C92D 2QQRA 3UT1A 3OSSC 2MWPA 5FU6B 3L2QA 3QZ5B 2WACA 3S3NA 3JCMP 4QW2A 4CRIA 2QA4A 3FEOA 3JCMf 3UWNA 4M7DE 2L3RA 2RK1A 3QJYA 5AYFA 4RG2A 4MDXA 1B34A 4RKUE 2JTFA 4GY5A 5LJ5f 2AHJB 4II1A 3CPFA 4PKCC 4IKFA 3HRTA 5HK3A 1VQ4A 1FXXA 3QJ6A 4M7AB 4XQ3A 5HY6A 1YCYA 1P92A 1HXDA 3S3OA 3LX7A 2LRQA 3L1AA 4C0DB 4RMOA 3OYCA 4LDVA 5IT9E 1VQ9A 3HKSA 1VQMT 3QXEB 1M1GA 2HNIA 1UB4A 5C6SA 2CZ6B 2ZPGB 3L2WA 1Q86C 2E41A 3I55A 4BI3A 3MCAB 4VUBA 5GMKi 2B8AA 4JS4A 1UGPB 1XOVA 2EJ9A 1NJIU 1Y71A 2XK0A 5KCHA 2DXBA 2RHXA 3MP1A 4E7KA 2D9TA 2LT4A 1Q7YC 1LJOA 4EMKA 3QPHA 2MAMA 4BY6C 5KE3A 5CAIA 2XHCA 1JRIA 2HQXA 3M55A 3OMCA 2K4YA 3GIBA 2QXFA 2DTOA 3ZFJA 1V29B 1K73C 4E7IA 1YI2A 3QIIA 1VQKT 1UGSB 3LYIA 2ZPBB 5CIUA 2FYKA 4IUQA 1M1KC 4B9XA 3FC3A 3VYGA 1ZHIA 2A3LA 2KQWA 5GAMe 4C0GA 2RJCA 2LC4A 3QYGB 5GAMg 3CCVT 3OYLA 3J7AF 2RHUA 3C12A 3CEYA 1OI1A 2PQWA 3TREA 1M90U 4M77A 1VQPA 4M77D 5FRNA 1G3TA 1U1TA 2GCXA 3TCJA 2DO3A 3OYHA 3T9NA 3JB9I 3CMET 1YITT 2K2VA 2QDYB 5D6XA 5GAOq 3CXCS 1NE8A 3MO8A 4E7LA 2L8DA 3JSCA 5FROA 4M7DC 2CZ7B 3QZ9B 5GAOn 3JB9G 3M53A 4HKEA 1UGRB 4OMFB 5GMKh 3CCST 2ZGWA 4M75B 4XU1A 4C0DC 4RCCA 2FVUA 4MZPA 3GNFB 3QDRB 3OYYA 1W2BS 4M7DF 4M78D 4PJOF 4M7DB 2DD5A 2QA4T 4M7AE 3LWIA 1QVFS 4E7JA 1WJRA 1BIAA 4M75A 3L42A 3RKWA 3RMQA 4BE1A 2XDPA 1OYXA 3OQ5A 4FU6A 2R57A 1R8OB 5J26A 4M7AF 4N4HA 2DZCA 4J5YA 2JTMA 4XK8E 3OYMA 5LJ3j 4BE2A 4JLGA 1D3BB 2E6ZA 3A5ZB 5LJ3d 1QP3A 1VQ9T 1Q81C 1VQ8A 1NPPA 1ZBXA 1KC8C 2RK2A 1KD1U 3CCUT 5J3BA 3M4YA 4YTLA 2CZ1B 1M1KU 3RUXA 1NJIC 5CVIA 3V7SA 5HK0A 2YLBA 2L89A 2E70A 4M78G 1VIEA 2VYTA 3OB9A 2FHDA 3CBPA 2EQKA 4C8QC 3CXCA 2IG0A 3L2ZA 1VQLT 2HAXA 2E6NA 3F70A 3WXMB 2DJZA 3Q1JA 4C0ZA 3BDLA 3WVDB 2GQVA 2R5MA 2JUFA 3JB9D 3E9GA 3G7ZA 4ELZC 5GAOm 3QO3A 4OB0B 4A53A 3OYEA 1JJ2S 1YI2T 3RIRA 3OBYA 4BY6B 1VQKA 4C92B 3S6WA 4M75G 4J83A 1G3YA 4OP0A 3CMAT 3RERA 2VGMA 5D6WA 1Q82C 3G6EA 3GPLA 3KUFA 2M16A 4OB3B 3URGA 2EKOA 5LJ3f 3GOXA 2JVVA 2K3YA 1GXIE 1XTDA 1Y07A 2Y90A 1VQ6T 2K5LA 3CMEA 3CC7A 5GMKm 3PFSA 4DA4A 4OF1A 2RHZA 4TVRA 3X20B 3JB9H 2OTJT 2XIDA 1YHQA 1NPRA 1KQSA 1QVPA 2XD0A 4LDYA 4M7AC 2O4XA 3SB2A 3JCMe 3A8HB 2CZ0B 2NLUA 2XICA 2YHTA 4OGEA 2M0OA 2MMPA 3DKMA 3MHXA 4M77F 3JCMQ 4KT0E 1LNXA 4KULA 1HK9A 1OZ2A 3ER0A 4MMLA 1YJWA 1KHCA 4IUPA 5FU6C 4PL6A 2VV5A 2I2LA 3LGLA 2XDBA 4C92A 4NS5A 1BYMA 3CCJA 4MZTA 4HA8A 3CD6A 3OYNA 2E12A 4XU2A 4BB7A 3M56A 2VUBA 2PVDB 1JJ2A 3J81E 3L2UA 3CCEA 4J6WA 5CR2A 2OTLA 1IREB 1KQ1A 4Y91A 3UPUA 3CC4A 1WJQA 5LJ3h 2LQKA 1WNLA 3QUIA 2RH2A 5GAN4 2MWOA 3JB9J 3HHTB 3ZBDA 4M7AA 3CCUA 2LTOA 3HFNA 1KG1A 3AHUA 2X35A 4L59A 3VUBA 4ZGJB 2OAUA 3E19A 4N4GA 4FIBA 2VC8A 5FRMA 3TEEA 5GMKl 2BUDA 3SDZA 4A4FA 4F7UG 3JCMJ 4X34A 1Y96A 3RKXA 2DEQA 3E9FA 3HP9A 5EG2A 3L2VA 4NL2A 1KQSS 1QVFA 4L6V5 4XTWA 4XTYA 3R6OA 5C0MA 3OW2S 5GMKe 3PT9A 1Y96B 4WF2A 1VQOT 5J39A 1S72A 3BY7A 4L5GA 1K8AC 4O6JA 3GF5A 4C92F 2LCLA 2EFIA 2LT1A 5CQXA 2LNVA 3OYAA 2C06A 2JN0A 1EIFA 5HKCA 3PIPA 5GAN7 4ZN1A 3CPWS 1DJ7B 4M75E 2XI9A 2RA2A 3VKIA 1Q81U 4C5GA 3MEAA 2RHIA 4M7DA 3VYHB 1YJNA 1N8RU 4JRKA 1VQ6A 3SWNC 3JCMb 3M4GA 5DM7R 3CC7T 5LJ5j 2DXTA 3M9QA 4GLKA 4XTXA 4JRQA 2OTJA 4FT2A 3DB4A 2V8JA 3LGFA 3X25B 4DOVA 1YHQT 2ZZDA 3G71T 2QQSA 2YRVA 3OSVA 5CQYA 3CCVA 1Q86U 2DD4A 5KE2A 4ZN3A 3OYKA 3HPWA 3OS1A 1RL2A 1K8AU 3OMGA 5FU7C 2X4YA 5GANg 1JBMA 4QVDA 4O5VA 3A8GB 4XAXB 1YJWT 5GAMj 3NFCA 4HT9A 2JOYA 3CCQT 2EQJA 2M9UA 3FLGA 4X9DA 2EAYA 3QSUA 2QI2A 4XU0A 4C5HA 1M8VA 4F7UB 1M5Q1 3HFOA 3M54A 1WJSA 5LJ3g 2R58A 4KBMB 2DIQA 3A8LB 3I56T 3C94A 5GANd 3M5AA 3CCSA 3PNWC 3SD4A 5GAMf 4FT4A 5GANj 1B34B 4IUUA 1SSFA 1KHIA 4M75D 3CCLA 2BIVA 4LD9K 1QP2A 4EDUA 4J6XA 1N9SA 2QQBA 2RJDA 3SWNA 4ZGDB 5IAYA 3CPWA 4M7DD 5LJ5g 3CBOA 5I2MA 4B9WA 1BI0A 2DIGA 2IVWA 1D3BA 3GLXA 1O9SA 2E10A 4FL6A 3VJPA 1BIBA 1M9SA 4FM4B 3FB9A 4KUDK 3MEVA 2DTIA 5GAN5 4C8QG 3DLMA 3V8LA 2F5TX 2BKDN 1VQ8T 2HD0A 5L8RE 2O01E 5LJ5d 2K57A 4BD3A 2DZ9A 2DXCA 4A4HA 1M4ZA 2PVOB 1VQ5A 1BI2A 3CBMA 4OB2B 5CKFA 3VUZA 3A8OB 5GAN6 4EMKB 1NZ9A 3NTIA 5M9OA 1VQOA 1VQNT 1S72T 2QTXA 3DB3A 4QVZA 2LX9A 3QHSA 2PUOB 4C8QA 3OY9A 2V8KA 5KH6A 1K73U 4E47A 3H8ZA 1N8RC 3EFRA 4HCZA 5DLOA 3X26B 2KAFA 4CI0C 1KC8U 4M78F 1VQLA 4PJOD 2XU8A 1YIJT 1UEBA 4BDZA 1YJ9A 2M1HA 3HRSA 3EFSA 1I4K1 2P0PA 3BFMA 3V8KA 1YJNT 3JB9F 4XTZA 2DTHA 5LJ5h 3CC2T 4N0AC 3OYBA 1I81A 4C0FA 3V7CA 1G3SA 1I5LA 4C5EA 4PJOA 2P0QA 3RESA 3OS0A 1K9MC 1IZ6A 3HL8A 4JLIA 2DVEA 2MI6A 2O4XB 3JCMW 3G4SA 4NOYA 1AHJB 3RKYA 3JRZA 4C8QD 4HCBA 3CCQA 1X75C 1K9MU 3FIFA 1Y7XA 4F7UF 1N9RA 2X4JA 4M78B 1VUBA 1U8RA 2FL7A 2HBPA 3A8MB 5GANh 4IURA 1XQHA 2V8IA 2RI5A 2Y4YA 2DAQA 2P0KA 4PLIA 3UDCA 4ZGEB 1KD1C 4BI8B 3QG1A 4LDWA 4M77G 3NTKA 3JCMV 3QBYA 3BDUA 5LJ3e 2QEXA 1MGQA 1LOJA 2XKOC 1PSEA 3CD6T 1WPYA 2EQUA 1WQWA 1BKBA 2JZ2A 3FDRA 2RB6A 3CCET 3M59A 3CC4T 4C92E 4BDYA 2X4XA 4M77B 3S3MA 3X24B 5IN1A 4A4GA 4PJOB 4RCBA 2GF7A 2R5AA 5LJ5e 1M1FA 3PGGA 1XNIA 2LCCA 1TH7A 1BI3A 3CCMT 4HCCA 1WQ7A 5DY9A 4RG8A 4C92C 4F7UE 4F7UA 3LLRA 2A7YA 4PJOG 1VQNA 2ZPIB 4Q5WA 3CCRT 1X6OA 5GAMd 3MEUA 4J7FA 3E1SA 3SFMA 4ELYC 5FU7B 1VIFA 4M77E 5CKHA 2ZPEB 4BACA 2PVGB 2LVMA 2ZPFB 4X9CA 5I2SA 2X4WA 3OYFA 1VQ7T 1BI1A 3JCMh 4C8QE 3VU3C 4UC4A 3ME9A 4M77C 3JCMc 3TU4K 4V2SA 1M90C 3H6ZA 3JCMg 4QVCA 2RJEA 4J6YA 2CKKA 2LDMA 4EMGA 4MDWA 2ZCFB 2F69A 2E5QA 2RHYA 1G3WA 4QQDA 5GAOp 4NL3A 3QKJA 3V8JA 4EMHA 3PIOA 3SWNB 1QVGS 3FJPA 3DLLA 1U1SA 4IUVA 4M78E 3L2RA 4M7AD 3JCMd 2D6FA 3G4ST 2RM4A 5CKEA 2E1HA 2QQ9A 5CK9A 4M75C 2XDDA 2CYZB 4ME7A 2EQMA 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2W A;  2F5K A;  2O4X A;  2NLU A;  3NTI A;  5M9O A;  2B8A A;  1OZ3 A;  3DB3 A;  4QVZ A;  3OY9 A;  3OYG A;  2GFA A;  2M0O A;  2XK0 A;  4E7H A;  5KH6 A;  5KCH A;  1G5V A;  2RHX A;  3H8Z A;  3MP1 A;  2D9T A;  1OZ2 A;  3MP8 A;  3P8D A;  4HCZ A;  1KHC A;  3OYD A;  4E7K A;  3LH0 A;  4IUP A;  4PL6 A;  5KE3 A;  3LGL A;  4BDZ A;  2M1H A;  4NS5 A;  3OYN A;  2HQX A;  3OMC A;  4QQ6 A;  3L2U A;  3C4S A;  4E7I A;  3QII A;  1WJQ A;  3LYI A;  5CIU A;  4IUQ A;  4B9X A;  3FC3 A;  2MWO A;  3EAE A;  3OYB A;  2LTO A;  1N27 A;  2RJC A;  3ASK A;  2X35 A;  3OYL A;  2RHU A;  3CEY A;  4L59 A;  1OI1 A;  2PQW A;  4C5E A;  4N4G A;  3OS0 A;  5FRN A;  5FRM A;  3OYH A;  4N4I A;  2O4X B;  3ZEH A;  1H3Z A;  3PMT A;  2BUD A;  3MP6 A;  4A4E A;  4A4F A;  4X34 A;  3L2V A;  3E9F A;  5D6X A;  4QQG A;  3MO8 A;  4E7L A;  2L8D A;  5FRO A;  3PMI A;  1WGS A;  2RI3 A;  3OYJ A;  4LD6 A;  5C0M A;  4ZTJ A;  4IUR A;  5J39 A;  2RI5 A;  2DAQ A;  4OVA A;  2P0K A;  3MET A;  4C5I A;  2EFI A;  3OYA A;  3O8V A;  1MHN A;  2RI2 A;  4PLI A;  4Z02 A;  4E7J A;  1WJR A;  3NTK A;  3QBY A;  3L42 A;  4BE1 A;  2G3R A;  1OYX A;  2XDP A;  3MEW A;  2EQU A;  4C5G A;  3OQ5 A;  3MEA A;  3FDR A;  2JZ2 A;  2RHI A;  2RJF A;  4FU6 A;  3OS2 A;  2R57 A;  5J26 A;  4N4H A;  3NTH A;  3OYM A;  4BE2 A;  4BDY A;  5D6Y A;  2X4X A;  3OA6 A;  3S3M A;  5IN1 A;  3M9Q A;  4A4G A;  2GF7 A;  2R5A A;  3DB4 A;  4PLL A;  3LGF A;  1XNI A;  2LCC A;  2QQS A;  2K3X A;  2YRV A;  5KE2 A;  3OYK A;  2GFU A;  4A4H A;  3OS1 A;  3OYI A;  3P8H A;  3OMG A;  2X4Y A;  2L89 A;  3LLR A;  4Q5W A;  4ZTF A;  2RO0 A;  4IUT A;  2VYT A;  3MEU A;  3OB9 A;  5KCO A;  2FHD A;  2EQK A;  2EQJ A;  3FLG A;  2IG0 A;  2HQE A;  2E6N A;  4C5H A;  3F70 A;  1WJS A;  1RI0 A;  2R58 A;  4BAC A;  2DIQ A;  3Q1J A;  2LVM A;  3BDL A;  4BE0 A;  3OYF A;  2X4W A;  2R5M A;  3PNW C;  3SD4 A;  3E9G A;  4IUU A;  1SSF A;  3OYE A;  4UC4 A;  3ME9 A;  2QQR A;  2BIV A;  3UT1 A;  3H6Z A;  2MWP A;  4EDU A;  3S6W A;  3L2Q A;  2WAC A;  2RJE A;  3S3N A;  2CKK A;  2LDM A;  2RJD A;  4QW2 A;  3FEO A;  4CRI A;  3UWN A;  5IAY A;  2L3R A;  2E5Q A;  2RHY A;  4RG2 A;  5D6W A;  4B9W A;  2DIG A;  2JTF A;  3KUF A;  4FL6 A;  4GY5 A;  2M16 A;  4QQD A;  4II1 A;  2EKO A;  3QKJ A;  3GOX A;  4IKF A;  2K3Y A;  3QJ6 A;  4IUV A;  3MEV A;  3L2R A;  3S3O A;  3LX7 A;  2LRQ A;  3DLM A;  3PFS A;  2BKD N;  3OYC A;  2RHZ A;  4BD3 A;  2EQM A;  5C6S A; 
#chains in the Genus database with same CATH topology
 2EJG A;  4DEX A;  1YBY A;  3JV3 A;  4A54 A;  4CC4 B;  2EJF A;  1GCP A;  5I11 A;  3V7R A;  3C0C A;  2JNG A;  2JTE A;  5CKB A;  1G8X A;  2CT3 A;  5DLQ E;  2X9H A;  5A0D A;  4C8Q B;  4FSX A;  1SHG A;  3MKD A;  4JRI A;  4XU3 A;  2FZC B;  1V76 A;  4JJN K;  5CKD A;  3CMA Q;  4R56 A;  1X2K A;  1I5O B;  3ASK A;  3INZ A;  3REB B;  2LQN A;  1QVG A;  1JB0 E;  4J8O A;  4ZNX A;  4N0A A;  1QQJ A;  2WSF E;  3ZEH A;  1KQS P;  3MP6 A;  1ZUK A;  2B86 A;  2DPP B;  3EG2 A;  1VQ5 T;  5CCA A;  4EMK C;  1WA7 A;  3JCM X;  2K79 A;  2RI3 A;  1VQ7 A;  3I55 T;  3J80 E;  4D8D A;  1RI9 A;  4C5I A;  1FX7 A;  4V2S A;  4BI4 A;  2RI2 A;  4JRP A;  1D1B A;  1UGQ B;  3CMA A;  1JU5 C;  2CS7 A;  2YRD A;  1GCQ A;  2DIL A;  1YWP A;  3CC2 A;  4ATO A;  1BCO A;  1G2B A;  2PUK B;  5GAN 3;  3OYI A;  3C95 A;  1VQ9 Q;  3P8H A;  2E64 A;  4IUT A;  4FW1 A;  4XTU A;  2EYX A;  4DBH A;  3I55 Q;  4C8Q F;  1RI0 A;  1QW1 A;  4BE0 A;  1H64 1;  1K1Z A;  3RMS A;  2DKG A;  2WAC A;  4QW2 A;  2DL7 A;  5AYF A;  1X27 A;  1OPL A;  4GY5 A;  3HRT A;  1FXX A;  5HY6 A;  1JEG A;  4FCY A;  1HXD A;  3S3O A;  3LX7 A;  3QXE B;  2HNI A;  5C6S A;  4PJL A;  2CZ6 B;  3GBQ A;  4BI3 A;  3MCA B;  4JS4 A;  1UGP B;  2XK0 A;  5KCH A;  2DXB A;  1R0B G;  4WTO B;  4E7K A;  2VKN A;  4EMK A;  1M2O A;  2CH4 A;  1LPL A;  5KE3 A;  5CAI A;  1M3A A;  2XHC A;  2HQX A;  2K4Y A;  2QXF A;  2DTO A;  2A36 A;  2DL3 A;  4E7I A;  1YI2 A;  1E6G A;  5CIU A;  4IUQ A;  1ZHI A;  2A3L A;  3CCV T;  3C12 A;  3TRE A;  1KK7 A;  4M77 A;  4A63 B;  2GCX A;  3TCJ A;  3CXC P;  2GTJ A;  3CME T;  2KE9 A;  3CXC S;  5GAO n;  2JMC A;  3M53 A;  5GJV B;  3OYY A;  1W2B S;  1M2V B;  2E3I A;  1QVF S;  1WJR A;  3RMQ A;  1OYX A;  3OQ5 A;  4AT1 B;  2DZC A;  4D8K A;  3OYM A;  5LJ3 j;  3A5Z B;  1QP3 A;  1WXU A;  3TVT A;  5J3B A;  2K2M A;  2CZ1 B;  1QCN A;  1M1K U;  2CP5 A;  3V7S A;  2YLB A;  2L89 A;  2E70 A;  1ZSG A;  3NMZ C;  2HAX A;  2E6N A;  1JJ2 P;  3WXM B;  1A0N B;  6AT1 B;  2JUF A;  3G7Z A;  1B7T A;  3QO3 A;  4OB0 B;  4LXC A;  3RIR A;  4M75 G;  1G3Y A;  1Q82 C;  3CCE Q;  1TUC A;  2JM8 A;  1U06 A;  2EKO A;  2D8H A;  2CP3 A;  2Y90 A;  5GMK m;  4DA4 A;  2ZAE A;  2DER A;  2XD0 A;  1KQS A;  3EGX B;  2K9G A;  1ZBJ A;  3JCM e;  5KYX A;  2M0O A;  2EYY A;  2MMP A;  3MHX A;  3JCM Q;  2M51 A;  4KRT A;  3ER0 A;  2BZX A;  4OMP A;  2LCS A;  2NYS A;  4C92 A;  4NS5 A;  1BYM A;  4HA8 A;  3M56 A;  4ORZ A;  3CCE A;  4J6W A;  1IRE B;  1KQ1 A;  4Y91 A;  3CC4 A;  1WJQ A;  5IHI A;  2QAS A;  1I1J A;  4M7A A;  1UUE A;  1TWB A;  1ZSZ A;  3HFN A;  3EH2 A;  3TEE A;  4E2F B;  3CCV Q;  4F7U G;  4X34 A;  3L2V A;  2DEQ A;  3E9F A;  1KQS S;  4NL2 A;  2VB6 A;  4L6V 5;  1M1K R;  2DYI A;  2FZK B;  5KYY A;  1IXD A;  1Z9Z A;  3OW2 S;  1WHH A;  4L5G A;  3CCJ Q;  4C92 F;  2LNV A;  1NBE B;  2JN0 A;  2YSQ A;  3PIP A;  5GAN 7;  4RTX A;  2DBK A;  2RA2 A;  2XMF A;  2ROT A;  3MEA A;  2CT4 A;  4FYX B;  1YJN A;  2LNH B;  1N8R U;  4CC3 A;  1SRM A;  3SWN C;  1UTI A;  1OOT A;  2DXT A;  4XTX A;  1UJ0 A;  4KGZ B;  3X25 B;  2ZZD A;  3G71 T;  2QQS A;  1Q86 U;  3H41 A;  1H3H A;  1K8A U;  3OS1 A;  4HVV A;  3OMG A;  2DLP A;  1TTH B;  1VQ5 Q;  4XAX B;  2M9U A;  2QI2 A;  2IPO B;  3HFO A;  3M54 A;  1WJS A;  1WIE A;  4KBM B;  2DIQ A;  3C94 A;  3PNW C;  1VQL Q;  2NUT A;  4M75 D;  3M0Q A;  4LD9 K;  4EDU A;  2CP0 A;  2RJD A;  4F14 A;  4ZGD B;  3CBO A;  1BI0 A;  3GLX A;  1ZSZ C;  2MYS A;  1BIB A;  1BB9 A;  4JJB A;  3MEV A;  5GAN 5;  2HSE B;  2RQT A;  4C8Q G;  2A08 A;  3V8L A;  5L8R E;  1VQ5 A;  2DEU A;  1N5Z A;  1T0H A;  5CKF A;  2EGA A;  5GAN 6;  3TQ7 P;  1NZ9 A;  5M9O A;  1S72 T;  3OY9 A;  3EFR A;  1FYN A;  1KC8 U;  1VQL A;  1QWE A;  3EG9 B;  2M1H A;  1UE9 A;  1H8K A;  2P0P A;  5LJ5 h;  3NGP A;  1WI7 A;  4C0F A;  3RES A;  1AT1 B;  3M0P A;  1C0M A;  2O4X B;  2MCN A;  2ESW A;  3CCQ A;  1Q86 R;  1N9R A;  2ATC B;  4M78 B;  2HBP A;  3A8M B;  1C6V X;  2Y4Y A;  5IH2 A;  2COY A;  5FWC A;  2KYB A;  5ECA A;  2C0T A;  2F2V A;  4BI8 B;  2FO0 A;  1NLO C;  1SRL A;  1OX8 A;  1IHW A;  3CD6 T;  1WPY A;  2C0O A;  1WQW A;  1BKB A;  3VRY A;  2J05 A;  4AG1 C;  1HJD A;  2EW3 A;  4C92 E;  2X4X A;  4M77 B;  5IN1 A;  2GF7 A;  2R5A A;  2AIR B;  1M1F A;  3PGG A;  3TSW A;  1UEC A;  2LCC A;  1BI3 A;  1TG0 A;  3CCM T;  1WQ7 A;  5DY9 A;  4RG8 A;  4F7U E;  1GL5 A;  3LLR A;  1VQN A;  2E4H A;  2ZPI B;  1X6O A;  4FYW B;  1QKW A;  2ZPE B;  2NWM A;  2X51 A;  1AD5 A;  1IRX A;  1W1F A;  4BAC A;  2PVG B;  2ZPF B;  1Q95 G;  2IIM A;  3OYF A;  3CPW P;  2CRE A;  4C8Q E;  1RAG B;  3VU3 C;  4M77 C;  3TU4 K;  1M90 C;  3H6Z A;  4J6Y A;  4EMG A;  1PRM C;  1UFF A;  2KNB B;  5GAO p;  2BE9 B;  3FJP A;  1SG5 A;  2FG0 A;  2KYM A;  4E7Z A;  3JCM d;  2D6F A;  2QQ9 A;  2FPF A;  4OGE A;  1YCS B;  2EQM A;  1VQN Q;  3OBW A;  2D8J A;  3G71 A;  4EIK A;  2HCK A;  2HL5 C;  2EIF A;  4R55 A;  3OYG A;  1G5V A;  5GAM h;  3P8D A;  4OMM A;  2QEX T;  5A2Q E;  4M7A G;  4D6W A;  2KEA A;  4QQ6 A;  3C4S A;  1WDX A;  4EPC A;  1TXQ A;  1W4S A;  2DF6 A;  4J7I A;  2EQI A;  1K9A A;  1O75 A;  3IQL A;  4RTY A;  4N4I A;  3CCR A;  1T3L A;  2E5K A;  1GBR A;  1Q82 U;  2RPN A;  1N6A A;  1NM7 A;  4XTV A;  3KBG A;  3EH1 A;  2RMO A;  4LD6 A;  5GAN e;  2QQA A;  3GNG A;  3MET A;  4DOW A;  3G6E T;  2KVQ G;  1MND A;  2DBM A;  3M58 A;  4B6M A;  3OS2 A;  1Q7Y U;  1CKA A;  2EYQ A;  2KMT A;  2YXY A;  3NTH A;  3VS3 A;  3OA6 A;  1PC0 A;  8AT1 B;  3NPF A;  5GAO l;  5KYN A;  3CCR Q;  4Z89 A;  2BTT A;  5L23 A;  2VGN A;  4BUG A;  3EHR A;  2L5Q A;  2LMJ A;  2YUP A;  1QVF P;  4E6R A;  4ZTF A;  4GBQ A;  5KCO A;  1VQ7 Q;  1I8F A;  5I22 A;  2VXF A;  2HQE A;  4JUV A;  2MPX C;  3CCJ T;  1UGV A;  5GMK j;  4M7D G;  4M75 F;  4RUG A;  4J9G A;  2QAZ A;  2YWW A;  2MWP A;  3L2Q A;  4CRI A;  1UG1 A;  2RF0 A;  2L3R A;  2RK1 A;  2RN8 A;  5LJ5 f;  4RTZ A;  3CC2 Q;  3CPF A;  4IKF A;  1NLP C;  4M7A B;  1TUD A;  5IHN A;  2LRQ A;  3L1A A;  4C0D B;  1VQ9 A;  4LDV A;  3HKS A;  1VQM T;  3L2W A;  3UAT A;  2E41 A;  3I55 A;  1XOV A;  1NJI U;  1Y71 A;  1LCK A;  1Q7Y C;  2D9T A;  3EG3 A;  1RLQ C;  1AVZ C;  4BY6 C;  1MMA A;  1N8R R;  3M55 A;  3GIB A;  1V29 B;  1HYO A;  3QII A;  3EGD A;  1X69 A;  4B9X A;  2KQW A;  1OPK A;  2OI3 A;  4C0G A;  2RJC A;  3J7A F;  1PWT A;  3CEY A;  5IHK A;  1OI1 A;  2PQW A;  1M90 U;  2COZ A;  7AT1 B;  2DO3 A;  1X2Q A;  2QG9 B;  2AZS A;  2SRC A;  4ANJ A;  4J9I A;  1KIK A;  4OMN A;  5D6X A;  2DYB A;  1NE8 A;  3MO8 A;  3JSC A;  5FRO A;  2K3B A;  4M7D C;  2DNU A;  2JS2 A;  1B3Q A;  2EVR A;  3SEM A;  2ZGW A;  1PRL C;  4C0D C;  5KYU A;  3QDR B;  4M7A E;  3LWI A;  2P84 A;  1YI2 Q;  4BE1 A;  1FMW A;  2A0F B;  1VQK Q;  4FU6 A;  1R8O B;  4N4H A;  3G6E Q;  2JTM A;  1D3B B;  2E6Z A;  5KYW A;  1VQ9 T;  1KC8 C;  3PVL A;  3M4Y A;  1UDL A;  3RUX A;  2A37 A;  2X3X D;  2LQW A;  4M78 G;  1VIE A;  2VYT A;  3CXC A;  2EQK A;  3L2Z A;  3M0S A;  9ATC B;  2GBQ A;  3JB9 D;  2KXD A;  4ELZ C;  1JJ2 S;  2HQH A;  1YI2 T;  4BY6 B;  1VQK A;  3CMA T;  2VGM A;  5D6W A;  3G6E A;  3KUF A;  1ARK A;  1GXI E;  3CC7 A;  1OX9 A;  4PJM A;  4OF1 A;  2RHZ A;  4TVR A;  1YHQ A;  1NPR A;  4LDY A;  4M7A C;  2O4X A;  2YHT A;  2RQW A;  1M90 R;  4KUL A;  3ULR B;  1OZ2 A;  1VOM A;  2VV5 A;  2YDL A;  3G1J A;  1SPK A;  2F1L A;  4XU2 A;  1JXM A;  1X43 A;  2PVD B;  1JJ2 A;  3L2U A;  2OTL A;  5CR2 A;  5GJW B;  1X6B A;  3QUI A;  5GAN 4;  1WHG A;  1KG1 A;  3CC7 Q;  4ZGJ B;  2OAU A;  2QYZ A;  1AOJ A;  1QCO A;  3E19 A;  1D1A A;  2L0A A;  3EHQ A;  3SDZ A;  1IB8 A;  1Y96 A;  1QVF A;  5EG2 A;  4LE9 A;  4JZ4 A;  5C0M A;  5GMK e;  2F2W A;  5J39 A;  1K8A C;  2EFI A;  2OTL Q;  1AZE A;  3CPW S;  1Q81 U;  4ZN1 A;  3CC4 Q;  3JCM b;  3CC7 T;  3D7S B;  3HTR A;  5LJ5 j;  3M9Q A;  4J9C A;  4FT2 A;  2V8J A;  3CCV A;  3RR6 A;  1RAA B;  2DD4 A;  4ZN3 A;  3HPW A;  1RL2 A;  4FSS A;  1R77 A;  1K0X A;  2O9S A;  1VA7 A;  1YJW T;  5GAM j;  4HCK A;  4XU0 A;  1QVG P;  4F7U B;  1M5Q 1;  5LJ3 g;  2R58 A;  1T3S A;  3A8L B;  5GAN d;  3CCS A;  3M5A A;  5GAN j;  4FT4 A;  1B34 B;  4IUU A;  1SSF A;  3VS1 A;  2BIV A;  1QP2 A;  4J6X A;  1N9S A;  4X1V A;  2QQB A;  3SWN A;  1YJN Q;  5LJ5 g;  1W70 A;  2IVW A;  2DIG A;  2E10 A;  1FMV A;  1VYV A;  4FYY B;  2K6D A;  3FB9 A;  1VQ8 T;  2F5T X;  2BKD N;  4A4H A;  1M4Z A;  2PVO B;  3A8O B;  4EMK B;  2EYZ A;  4DBQ A;  2AKL A;  3DB3 A;  3QHS A;  1K73 U;  1WXB A;  1N8R C;  3H8Z A;  5DLO A;  4M78 F;  4PJO D;  1YIJ T;  1YJ9 A;  1Q7Y R;  3BFM A;  3V8K A;  2QEX Q;  2ED0 A;  1NEG A;  4XTZ A;  3CC2 T;  4N0A C;  3OYB A;  3V7C A;  1G3S A;  1I5L A;  3MPU B;  1K76 A;  3QDF A;  1IZ6 A;  2KI7 A;  3G4S A;  1AHJ B;  3RKY A;  5KYX B;  5IXF A;  2VWF A;  2P4R A;  2FL7 A;  1AZG B;  1AEY A;  1XQH A;  2NUP B;  2HEQ A;  1CKB A;  4ZGE B;  3QG1 A;  4LDW A;  1RUW A;  5LJ3 e;  3QBY A;  1MGQ A;  2XKO C;  4AFS C;  1UHC A;  2EQU A;  3FDR A;  2FPE A;  3M59 A;  1ACM B;  1YNZ A;  1MMD A;  4PJO B;  4A4G A;  1PKT A;  4RCB A;  5LJ5 e;  3A98 A;  1IHV A;  1QKX A;  1CSK A;  1TH7 A;  3VS6 A;  2Z0W A;  4Y92 A;  4F7U A;  4PJO G;  1QCF A;  2KT8 A;  5GAM d;  3MEU A;  3M0U A;  4J7F A;  1VIF A;  2BZ8 A;  2NUP A;  2MK5 A;  4X9C A;  1VQ7 T;  2X4W A;  3JCM c;  2CKK A;  3I56 Q;  4MDW A;  2MOX A;  4QQD A;  4NL3 A;  1BU1 A;  2GTO A;  3L2R A;  1Z9Q A;  4AFZ C;  2CUD A;  4ME7 A;  1M1K C;  2E65 A;  2CGH A;  2L3P A;  2KRM A;  1VQM Q;  2CP6 A;  1X01 A;  3JAM E;  3OYD A;  3M0T A;  3WVE B;  1D0X A;  2KSS A;  2LZ6 B;  8ATC B;  3I56 A;  3LWH A;  2DL8 A;  2FB7 A;  3SHW A;  2DJQ A;  2J6O A;  1ZQ1 A;  1YIJ Q;  2CDT A;  3PTA A;  4JJD A;  3EAE A;  1ZX6 A;  5A0L A;  1N27 A;  3HSB A;  4PJO C;  4P5N A;  3CCM A;  1J3T A;  1VQ4 T;  2Y4X A;  4RTU A;  4LDX A;  3G71 Q;  2JJ9 A;  1PD1 A;  3PMT A;  4MZM A;  2HL3 A;  4OGC A;  4MMK A;  1KSW A;  2KK4 A;  2PU9 B;  1WGS A;  2KY9 A;  3KXT A;  1VYU A;  2J06 A;  1RAH B;  5GAN f;  3O8V A;  1MHN A;  4Y28 E;  1YIJ A;  2NUZ A;  2RJF A;  1D09 B;  3CCM Q;  1NJI R;  1U3O A;  1KC8 R;  1VQ4 Q;  1NG2 A;  2K3X A;  2GFU A;  1VQP T;  2O9V A;  4M78 A;  5D7U A;  2RO0 A;  2K5I A;  5A0G A;  3BE3 A;  3HRU A;  1I0C A;  4LDU A;  4DQ2 A;  3BW1 A;  2OTL T;  1AWJ A;  4C92 D;  2QQR A;  4J9E A;  3OSS C;  3S3N A;  3QZ5 B;  3JCM P;  1PG5 B;  2QA4 A;  4IIO A;  3FEO A;  3JCM f;  3UWN A;  4M7D E;  3QJY A;  2QGG A;  4MDX A;  4RG2 A;  1B34 A;  2KBT A;  2JTF A;  4RKU E;  4II1 A;  2H8H A;  4PKC C;  1SEM A;  5HK3 A;  2HKN A;  4XQ3 A;  1GCQ C;  5AT1 B;  4RMO A;  4HVW A;  4AMC A;  2ZPG B;  3VS2 A;  4PFP A;  5GMK i;  2DL4 A;  2O2O A;  2RHX A;  3QPH A;  2MAM A;  2EPD A;  1JRI A;  2QA4 Q;  4LUD A;  2FYK A;  3I5R A;  3VYG A;  1GBQ A;  3OYL A;  2DVJ A;  4M77 D;  1G3T A;  1OQK A;  2HKQ B;  1ZLM A;  3JB9 I;  3EG1 A;  1EX4 A;  1RAD B;  2QDY B;  1M3B A;  2JM9 A;  5GAO q;  1S1N A;  4E7L A;  2L8D A;  2CZ7 B;  3QZ9 B;  3JB9 G;  5GMK h;  4DBR A;  2COW A;  4RTV A;  4MZP A;  2MIO A;  4M7D F;  5KYY B;  1RAC B;  2QA4 T;  4E7J A;  4AFU C;  4M75 A;  2KRN A;  3L42 A;  2ABL A;  4FYV B;  4J9H A;  2G6F X;  1RLP C;  2R57 A;  4J5Y A;  4BE2 A;  4JLG A;  2CH4 W;  1NPP A;  1ZBX A;  2DFU A;  2RK2 A;  1KD1 U;  3CCU T;  1NJI C;  3CME Q;  2FRY A;  5CVI A;  5HK0 A;  1E6H A;  4KH1 B;  3OB9 A;  2FHD A;  3CBP A;  4C8Q C;  1VQL T;  2DJZ A;  1YJW Q;  1Y57 A;  4C0Z A;  3BDL A;  3WVD B;  1WHL A;  2R5M A;  3E9G A;  5GAO m;  1OV3 A;  3OYE A;  4A53 A;  1BCM A;  3OBY A;  2LX7 A;  4C92 B;  4J83 A;  5HCK A;  3RER A;  3GPL A;  2M16 A;  5LJ3 f;  3GOX A;  1KJW A;  1OEB A;  2K3Y A;  2VVK A;  1XTD A;  1VQ6 T;  2CSQ A;  2K5L A;  2FZG B;  3PFS A;  3JB9 H;  3X20 B;  1ZUU A;  2OTJ T;  2XID A;  2CUB A;  3SB2 A;  3A8H B;  2NLU A;  2L3Q A;  5IXB A;  1YJW A;  4KT0 E;  1LNX A;  2AZV A;  2J7I A;  3EG0 A;  3LGL A;  4HXJ A;  4MZT A;  3CD6 A;  1K9M R;  2DA9 A;  2VUB A;  2EBP A;  3UPU A;  2O88 A;  2HDA A;  2RH2 A;  2MWO A;  2YUN A;  3ZBD A;  3CCU A;  2OJ2 A;  1R0C B;  2X35 A;  1VQ6 Q;  2EYW A;  4PJJ A;  4N4G A;  1YHQ Q;  2VC8 A;  2YUQ A;  1PKS A;  2GNC A;  5GMK l;  3JCM J;  3RKX A;  3HP9 A;  3EFO A;  1TUG B;  3R6O A;  2DE0 X;  1KD1 R;  1SF9 A;  3PT9 A;  1Y96 B;  4J9D A;  3CQT A;  4WF2 A;  3BY7 A;  3GF5 A;  3CD6 Q;  2LT1 A;  5CQX A;  3OYA A;  1V1C A;  5HKC A;  2DX1 A;  4M75 E;  1MV0 B;  3VKI A;  4C5G A;  2RHI A;  2LP5 A;  4JRK A;  2EGE A;  4GLM A;  1RAF B;  4GLK A;  4JRQ A;  2OTJ A;  1YHQ T;  4DOV A;  1W2B P;  3OSV A;  5CQY A;  3OYK A;  2OX7 A;  2D1X A;  5FU7 C;  1D1C A;  3NFC A;  5FW9 A;  4HT9 A;  2EQJ A;  4X9D A;  2EAY A;  3EGU A;  1WHK A;  1M8V A;  2VAS A;  1KHI A;  3CCL A;  5IAY A;  3CPW A;  4M7D D;  5EC7 A;  1WZO A;  1D3B A;  1O9S A;  1PCX A;  4FL6 A;  3VJP A;  1SSH A;  3EGX A;  4RTT A;  1NEB A;  4KUD K;  2DTI A;  2O01 E;  3TSZ A;  4BD3 A;  2DXC A;  2DZ9 A;  1BI2 A;  3VUZ A;  1EFN A;  1VQO A;  4QVZ A;  2LX9 A;  2V8K A;  5KH6 A;  4RTW A;  4HCZ A;  1ZUY A;  4CI0 C;  3CCS Q;  2FPD A;  3CCL Q;  3HRS A;  3EFS A;  1I4K 1;  2RQR A;  1AWO A;  2DTH A;  1SKU B;  1I81 A;  2BZY A;  2F2X A;  4C5E A;  1RAB B;  5KYW B;  2P0Q A;  1K9M C;  4JJC A;  2DVE A;  2MI6 A;  1MNE A;  1K9M U;  3H0I A;  1JXO A;  3REA B;  1VQO Q;  1Y7X A;  2X4J A;  5GAN h;  1TSF A;  2V8I A;  2AK5 A;  2RI5 A;  2DAQ A;  1YJ9 Q;  2P0K A;  2YUO A;  2W10 A;  4PLI A;  2QEX A;  3BDU A;  1LOJ A;  2JZ2 A;  2L3S A;  2LJ1 A;  4KGV B;  4BDY A;  3S3M A;  2PZ1 A;  3X24 B;  2C0I A;  1XNI A;  3G4S Q;  1Y0M A;  4PFO A;  2M02 A;  4C92 C;  2DM1 A;  2A7Y A;  2KT1 A;  1OUL A;  1WFW A;  1WHM A;  4LN2 A;  3MJX A;  1ABO A;  2LVM A;  5I2S A;  3JCM h;  4UC4 A;  1MV3 A;  1D0Y A;  2PNI A;  3JCM g;  4QVC A;  2RJE A;  2F69 A;  1G3W A;  1QMC A;  3QKJ A;  3V8J A;  1GFC A;  3PIO A;  1QVG S;  4M7A D;  3DLL A;  1U1S A;  2RNA A;  4M78 E;  3G4S T;  2RM4 A;  5CKE A;  2E1H A;  5CK9 A;  2XDD A;  1RAE B;  2CYZ B;  2F5K A;  3N5B B;  4A4K A;  1TOV A;  3OW2 A;  1OZ3 A;  3EG9 A;  2GFA A;  4E7H A;  1PSF A;  2ZPH B;  2P4T A;  3MP8 A;  2EWN A;  3LH0 A;  1FMK A;  3FRN A;  2YLC A;  2WSC E;  4AG2 C;  2K5F A;  3CCL T;  4QT7 A;  2DRM A;  2RD1 A;  4KH0 B;  5GAN 8;  2VXE A;  4C92 G;  3OS5 A;  1PD0 A;  4Z88 A;  3PE0 A;  4JDS A;  2QDL A;  4F16 A;  1SHF A;  1FWZ A;  1H3Z A;  4A4E A;  1HD3 A;  3VV0 A;  4PJO E;  3X28 B;  1VQM A;  4QQG A;  4J9B A;  3PMI A;  1M27 C;  3VS4 A;  3KFV A;  3OYJ A;  1UHF A;  1YFN A;  4ZTJ A;  5I21 A;  3QYH B;  1IO6 A;  4OVA A;  5LL6 S;  3M57 A;  2MF2 A;  2D0Q B;  2DK3 A;  4M78 C;  2XG8 D;  5GAO r;  4Z02 A;  2JT4 A;  4OB1 B;  1TU0 B;  3THK A;  2JMA A;  3P8B B;  1YJ9 T;  3GP8 A;  2G3R A;  3MEW A;  1IGU A;  4KUI A;  1HSQ A;  2ROL A;  1G83 A;  5D6Y A;  1W2B A;  2WSE E;  5CO7 A;  2H3J A;  1MMG A;  2KDS A;  2ED1 A;  4PLL A;  5FLX E;  4JS5 A;  2LQ8 A;  2HMA A;  2K7A A;  1K8A R;  2ENM A;  3RBB B;  1YIT A;  2AKK A;  2CP7 A;  2DXU A;  3OW2 P;  4PNO A;  1KQ2 A;  2KRO A;  1PM3 A;  4AFQ C;  5GAN 2;  3LW5 E;  1YWO A;  2J6K A;  1I07 A;  3UT1 A;  2E3H A;  5FU6 B;  1H92 A;  2NUT B;  3A1P A;  2AHJ B;  1WXT A;  1VQ4 A;  3QJ6 A;  4PFZ A;  1YCY A;  1ZSZ B;  1P92 A;  5IT9 E;  3OYC A;  4CC7 A;  1BK2 A;  4F04 B;  1M1G A;  1UB4 A;  1Q86 C;  1NYF A;  2H3E B;  1YIT Q;  4VUB A;  2B8A A;  2A28 A;  2EJ9 A;  3MP1 A;  2QGF B;  2LT4 A;  1JQQ A;  1LJO A;  2J6F A;  1LVK A;  2KR3 A;  4JPB W;  2EKH A;  3OMC A;  1QLY A;  3ZFJ A;  1K73 C;  3UF4 A;  1VQK T;  1UGS B;  3LYI A;  2ZPB B;  3FC3 A;  5GAM e;  3LH5 A;  5GAM g;  2LC4 A;  3QYG B;  2RHU A;  1T0J A;  4FW2 A;  1VQP A;  1OU8 A;  5FRN A;  1U1T A;  3OYH A;  3T9N A;  1YIT T;  2K2V A;  4R0K A;  1WLP B;  2FEI A;  1KFZ A;  4OMF B;  4HKE A;  1UGR B;  3CCS T;  4M75 B;  4XU1 A;  3H9N A;  2RQV A;  4RCC A;  2FVU A;  3GNF B;  1AWW A;  4M78 D;  4PJO F;  4M7D B;  1BBZ A;  2DD5 A;  1BIA A;  2QK0 A;  3RKW A;  2O31 A;  3QWX X;  1QWF A;  2XDP A;  1YN8 A;  2DMO A;  1M30 A;  1ZA2 B;  5J26 A;  4M7A F;  4XK8 E;  5LJ3 d;  1Q81 C;  1VQP Q;  1VQ8 A;  1W6X A;  4YTL A;  2X3W D;  2LJ0 A;  1IGQ A;  1JO8 A;  2L2P A;  1WX6 A;  1WHJ A;  2IG0 A;  5KYU B;  3F70 A;  3ZL7 C;  3H0H A;  2DRK A;  3Q1J A;  2GQV A;  4PJN A;  3S6W A;  4OP0 A;  3I9Q A;  1U5S A;  2LJ3 A;  4OB3 B;  3URG A;  1VQ8 Q;  2JVV A;  1Y07 A;  2JW4 A;  4OMQ A;  3O5Z A;  3CME A;  3U23 A;  2KRS A;  1QVP A;  1EZZ B;  1E7O A;  2HSP A;  1PHT A;  2EGC A;  1PNJ A;  2CZ0 B;  2XIC A;  1K4U S;  2GGR A;  3DKM A;  4M77 F;  4MML A;  2HZY A;  1HK9 A;  1KHC A;  1D0Z A;  3AT1 B;  4IUP A;  5FU6 C;  4PL6 A;  1S72 Q;  2I2L A;  3EGD B;  2XDB A;  2JS0 A;  3FJ5 A;  3CCJ A;  3RDV A;  2ECZ A;  3OYN A;  2E12 A;  4BB7 A;  3J81 E;  1XJW B;  5LJ3 h;  2LQK A;  1WNL A;  3VS0 A;  3JB9 J;  3HHT B;  4K11 A;  2LTO A;  3AHU A;  2DET A;  2HBW A;  4L59 A;  3VUB A;  1K73 R;  4FIB A;  5FRM A;  2BUD A;  4A4F A;  4HT8 A;  2BE7 D;  1M3C A;  4XTW A;  4XTY A;  1GRI A;  3UA6 A;  4QKU A;  1VQO T;  1S72 A;  4LUE A;  1ZA1 B;  2KXC A;  4O6J A;  2LCL A;  2C06 A;  2OAW A;  1EIF A;  3E2U A;  2M0Y A;  1DJ7 B;  1K0S A;  2XI9 A;  2SEM A;  4M7D A;  3CCU Q;  3VYH B;  4HVU A;  1VQ6 A;  3M4G A;  5DM7 R;  2GQI A;  1MMN A;  1X6G A;  3DB4 A;  3LGF A;  1VYT A;  2YRV A;  1Q81 R;  4CC2 A;  5KE2 A;  1RAI B;  2CSI A;  2X4Y A;  5GAN g;  1JBM A;  4QVD A;  4O5V A;  3A8G B;  4DBF A;  2JOY A;  3CCQ T;  3FLG A;  3QSU A;  4C5H A;  4KGX B;  3M0R A;  3I56 T;  1U8R A;  3SD4 A;  5GAM f;  1NYG A;  4DEY A;  3I5S A;  1M8M A;  5I2M A;  4B9W A;  4LNP A;  1F1B B;  1M9S A;  2OTJ Q;  4FM4 B;  1YP5 A;  2KGT A;  3DLM A;  4WCI A;  2HD0 A;  5LJ5 d;  2K57 A;  1WYX A;  3H0F A;  3CBM A;  4OB2 B;  2AT1 B;  1UJY A;  3CCQ Q;  3NTI A;  2PTK A;  3EFO B;  1VQN T;  2QTX A;  4C8Q A;  2PUO B;  2CP2 A;  4E47 A;  3I35 A;  3X26 B;  2KAF A;  2QTV A;  2XU8 A;  1UEB A;  4BDZ A;  4J9F A;  4M4Z A;  4Z8A A;  1M2V A;  1YJN T;  3JB9 F;  4ESR A;  1Q82 R;  4JZ3 A;  4PJO A;  3OS0 A;  3HL8 A;  4JLI A;  3JCM W;  4NOY A;  4C8Q D;  3JRZ A;  4HCB A;  4F17 A;  1X75 C;  3FIF A;  3NHN A;  2YT6 A;  4F7U F;  1C1A A;  1VUB A;  4IUR A;  2FRW A;  3UDC A;  3R6N A;  1KD1 C;  4M77 G;  3NTK A;  3JCM V;  1PSE A;  3VS5 A;  2RQU A;  2RB6 A;  1B07 A;  3UA7 A;  2DL5 A;  3CCE T;  3VS7 A;  1MUZ A;  3CC4 T;  3PVQ A;  2V26 A;  1ABQ A;  2V1R A;  4HCC A;  1GFD A;  4IIM A;  4PK4 A;  1TS9 A;  3QWY A;  4Q5W A;  3CCR T;  2I0N A;  3E1S A;  3SFM A;  4ELY C;  5FU7 B;  4M77 E;  5CKH A;  1BI1 A;  3VRZ A;  1AWX A;  3ME9 A;  4E7S A;  4OML A;  2LDM A;  2ZCF B;  2E5Q A;  2RHY A;  3RNJ A;  2D0N A;  2JXB A;  4EMH A;  2V1Q A;  3SWN B;  4IUV A;  2W0Z A;  4OMO A;  1OU9 A;  4M75 C;  5FWB A;  2YRC A; 
#chains in the Genus database with same CATH homology
 2EJG A;  2E65 A;  2F5K A;  3G71 A;  1YBY A;  3N5B B;  4A4K A;  2CGH A;  4A54 A;  3OW2 A;  2EJF A;  1OZ3 A;  1X01 A;  2EIF A;  4R55 A;  3OYG A;  2GFA A;  4E7H A;  3JAM E;  3V7R A;  1PSF A;  2ZPH B;  2P4T A;  1G5V A;  5GAM h;  2JNG A;  3MP8 A;  3P8D A;  3OYD A;  5CKB A;  2EWN A;  3LH0 A;  3FRN A;  5DLQ E;  2QEX T;  5A0D A;  3WVE B;  2YLC A;  4FSX A;  4C8Q B;  5A2Q E;  4M7A G;  4JRI A;  2KSS A;  4XU3 A;  4D6W A;  3I56 A;  3LWH A;  4QQ6 A;  2WSC E;  4JJN K;  5CKD A;  2FB7 A;  3C4S A;  4R56 A;  1ZQ1 A;  2K5F A;  3CCL T;  3PTA A;  2RD1 A;  4EPC A;  5GAN 8;  3EAE A;  5A0L A;  2VXE A;  1N27 A;  1W4S A;  3OS5 A;  4C92 G;  3HSB A;  3ASK A;  3INZ A;  4J7I A;  4PJO C;  4P5N A;  3CCM A;  1O75 A;  1QVG A;  1JB0 E;  4J8O A;  1VQ4 T;  4JDS A;  2Y4X A;  4N4I A;  4LDX A;  1FWZ A;  4N0A A;  2WSF E;  3ZEH A;  3CCR A;  3PMT A;  1H3Z A;  3MP6 A;  4A4E A;  4MZM A;  3VV0 A;  4PJO E;  2DPP B;  3X28 B;  1VQM A;  4QQG A;  4OGC A;  1VQ5 T;  5CCA A;  4MMK A;  4EMK C;  3PMI A;  2PU9 B;  2KK4 A;  1Q82 U;  1N6A A;  4XTV A;  3JCM X;  3KBG A;  1WGS A;  2RI3 A;  3OYJ A;  3I55 T;  4LD6 A;  1VQ7 A;  3J80 E;  4ZTJ A;  5GAN e;  5I21 A;  2KY9 A;  3QYH B;  3KXT A;  2QQA A;  4OVA A;  5LL6 S;  3GNG A;  2MF2 A;  3M57 A;  2D0Q B;  2DK3 A;  3MET A;  1FX7 A;  4M78 C;  2XG8 D;  4C5I A;  4DOW A;  3O8V A;  1MHN A;  2RI2 A;  4BI4 A;  4Z02 A;  5GAN f;  4JRP A;  1UGQ B;  4OB1 B;  4Y28 E;  3CMA A;  1YIJ A;  3G6E T;  3P8B B;  2CS7 A;  1YJ9 T;  2KVQ G;  3GP8 A;  2G3R A;  3MEW A;  4KUI A;  2RJF A;  3M58 A;  3OS2 A;  1Q7Y U;  2EYQ A;  2KMT A;  3NTH A;  5D6Y A;  3OA6 A;  1W2B A;  2WSE E;  3CC2 A;  5CO7 A;  2H3J A;  4ATO A;  2KDS A;  4PLL A;  2PUK B;  5FLX E;  5GAO l;  2LQ8 A;  4JS5 A;  2K3X A;  5GAN 3;  3OYI A;  2GFU A;  2VGN A;  3C95 A;  4BUG A;  1VQP T;  4HT8 A;  3P8H A;  2E64 A;  2L5Q A;  4M78 A;  4ZTF A;  2RO0 A;  4IUT A;  4XTU A;  2K5I A;  5KCO A;  5GAO r;  1YIT A;  1I8F A;  2VXF A;  4C8Q F;  2HQE A;  5A0G A;  2DXU A;  4JUV A;  4PNO A;  1RI0 A;  1KQ2 A;  3CCJ T;  1QW1 A;  3HRU A;  4LDU A;  4DQ2 A;  5GAN 2;  4BE0 A;  1H64 1;  3LW5 E;  5GMK j;  4M7D G;  4M75 F;  3BW1 A;  3RMS A;  2OTL T;  2DKG A;  4C92 D;  2QQR A;  3UT1 A;  3OSS C;  2MWP A;  5FU6 B;  3L2Q A;  3QZ5 B;  2WAC A;  3S3N A;  3JCM P;  4QW2 A;  4CRI A;  2QA4 A;  3FEO A;  3JCM f;  3UWN A;  4M7D E;  2L3R A;  2RK1 A;  3QJY A;  5AYF A;  4RG2 A;  4MDX A;  1B34 A;  4RKU E;  2JTF A;  4GY5 A;  5LJ5 f;  2AHJ B;  4II1 A;  3CPF A;  4PKC C;  4IKF A;  3HRT A;  5HK3 A;  1VQ4 A;  1FXX A;  3QJ6 A;  4M7A B;  4XQ3 A;  5HY6 A;  1YCY A;  1P92 A;  1HXD A;  3S3O A;  3LX7 A;  2LRQ A;  3L1A A;  4C0D B;  4RMO A;  3OYC A;  4LDV A;  5IT9 E;  1VQ9 A;  3HKS A;  1VQM T;  3QXE B;  1M1G A;  2HNI A;  1UB4 A;  5C6S A;  2CZ6 B;  2ZPG B;  3L2W A;  1Q86 C;  2E41 A;  3I55 A;  4BI3 A;  3MCA B;  4VUB A;  5GMK i;  2B8A A;  4JS4 A;  1UGP B;  1XOV A;  2EJ9 A;  1NJI U;  1Y71 A;  2XK0 A;  5KCH A;  2DXB A;  2RHX A;  3MP1 A;  4E7K A;  2D9T A;  2LT4 A;  1Q7Y C;  1LJO A;  4EMK A;  3QPH A;  2MAM A;  4BY6 C;  5KE3 A;  5CAI A;  2XHC A;  1JRI A;  2HQX A;  3M55 A;  3OMC A;  2K4Y A;  3GIB A;  2QXF A;  2DTO A;  3ZFJ A;  1V29 B;  1K73 C;  4E7I A;  1YI2 A;  3QII A;  1VQK T;  1UGS B;  3LYI A;  2ZPB B;  5CIU A;  2FYK A;  4IUQ A;  1M1K C;  4B9X A;  3FC3 A;  3VYG A;  1ZHI A;  2A3L A;  2KQW A;  5GAM e;  4C0G A;  2RJC A;  2LC4 A;  3QYG B;  5GAM g;  3CCV T;  3OYL A;  3J7A F;  2RHU A;  3C12 A;  3CEY A;  1OI1 A;  2PQW A;  3TRE A;  1M90 U;  4M77 A;  1VQP A;  4M77 D;  5FRN A;  1G3T A;  1U1T A;  2GCX A;  3TCJ A;  2DO3 A;  3OYH A;  3T9N A;  3JB9 I;  3CME T;  1YIT T;  2K2V A;  2QDY B;  5D6X A;  5GAO q;  3CXC S;  1NE8 A;  3MO8 A;  4E7L A;  2L8D A;  3JSC A;  5FRO A;  4M7D C;  2CZ7 B;  3QZ9 B;  5GAO n;  3JB9 G;  3M53 A;  4HKE A;  1UGR B;  4OMF B;  5GMK h;  3CCS T;  2ZGW A;  4M75 B;  4XU1 A;  4C0D C;  4RCC A;  2FVU A;  4MZP A;  3GNF B;  3QDR B;  3OYY A;  1W2B S;  4M7D F;  4M78 D;  4PJO F;  4M7D B;  2DD5 A;  2QA4 T;  4M7A E;  3LWI A;  1QVF S;  4E7J A;  1WJR A;  1BIA A;  4M75 A;  3L42 A;  3RKW A;  3RMQ A;  4BE1 A;  2XDP A;  1OYX A;  3OQ5 A;  4FU6 A;  2R57 A;  1R8O B;  5J26 A;  4M7A F;  4N4H A;  2DZC A;  4J5Y A;  2JTM A;  4XK8 E;  3OYM A;  5LJ3 j;  4BE2 A;  4JLG A;  1D3B B;  2E6Z A;  3A5Z B;  5LJ3 d;  1QP3 A;  1VQ9 T;  1Q81 C;  1VQ8 A;  1NPP A;  1ZBX A;  1KC8 C;  2RK2 A;  1KD1 U;  3CCU T;  5J3B A;  3M4Y A;  4YTL A;  2CZ1 B;  1M1K U;  3RUX A;  1NJI C;  5CVI A;  3V7S A;  5HK0 A;  2YLB A;  2L89 A;  2E70 A;  4M78 G;  1VIE A;  2VYT A;  3OB9 A;  2FHD A;  3CBP A;  2EQK A;  4C8Q C;  3CXC A;  2IG0 A;  3L2Z A;  1VQL T;  2HAX A;  2E6N A;  3F70 A;  3WXM B;  2DJZ A;  3Q1J A;  4C0Z A;  3BDL A;  3WVD B;  2GQV A;  2R5M A;  2JUF A;  3JB9 D;  3E9G A;  3G7Z A;  4ELZ C;  5GAO m;  3QO3 A;  4OB0 B;  4A53 A;  3OYE A;  1JJ2 S;  1YI2 T;  3RIR A;  3OBY A;  4BY6 B;  1VQK A;  4C92 B;  3S6W A;  4M75 G;  4J83 A;  1G3Y A;  4OP0 A;  3CMA T;  3RER A;  2VGM A;  5D6W A;  1Q82 C;  3G6E A;  3GPL A;  3KUF A;  2M16 A;  4OB3 B;  3URG A;  2EKO A;  5LJ3 f;  3GOX A;  2JVV A;  2K3Y A;  1GXI E;  1XTD A;  1Y07 A;  2Y90 A;  1VQ6 T;  2K5L A;  3CME A;  3CC7 A;  5GMK m;  3PFS A;  4DA4 A;  4OF1 A;  2RHZ A;  4TVR A;  3X20 B;  3JB9 H;  2OTJ T;  2XID A;  1YHQ A;  1NPR A;  1KQS A;  1QVP A;  2XD0 A;  4LDY A;  4M7A C;  2O4X A;  3SB2 A;  3JCM e;  3A8H B;  2CZ0 B;  2NLU A;  2XIC A;  2YHT A;  4OGE A;  2M0O A;  2MMP A;  3DKM A;  3MHX A;  4M77 F;  3JCM Q;  4KT0 E;  1LNX A;  4KUL A;  1HK9 A;  1OZ2 A;  3ER0 A;  4MML A;  1YJW A;  1KHC A;  4IUP A;  5FU6 C;  4PL6 A;  2VV5 A;  2I2L A;  3LGL A;  2XDB A;  4C92 A;  4NS5 A;  1BYM A;  3CCJ A;  4MZT A;  4HA8 A;  3CD6 A;  3OYN A;  2E12 A;  4XU2 A;  4BB7 A;  3M56 A;  2VUB A;  2PVD B;  1JJ2 A;  3J81 E;  3L2U A;  3CCE A;  4J6W A;  5CR2 A;  2OTL A;  1IRE B;  1KQ1 A;  4Y91 A;  3UPU A;  3CC4 A;  1WJQ A;  5LJ3 h;  2LQK A;  1WNL A;  3QUI A;  2RH2 A;  5GAN 4;  2MWO A;  3JB9 J;  3HHT B;  3ZBD A;  4M7A A;  3CCU A;  2LTO A;  3HFN A;  1KG1 A;  3AHU A;  2X35 A;  4L59 A;  3VUB A;  4ZGJ B;  2OAU A;  3E19 A;  4N4G A;  4FIB A;  2VC8 A;  5FRM A;  3TEE A;  5GMK l;  2BUD A;  3SDZ A;  4A4F A;  4F7U G;  3JCM J;  4X34 A;  1Y96 A;  3RKX A;  2DEQ A;  3E9F A;  3HP9 A;  5EG2 A;  3L2V A;  4NL2 A;  1KQS S;  1QVF A;  4L6V 5;  4XTW A;  4XTY A;  3R6O A;  5C0M A;  3OW2 S;  5GMK e;  3PT9 A;  1Y96 B;  4WF2 A;  1VQO T;  5J39 A;  1S72 A;  3BY7 A;  4L5G A;  1K8A C;  4O6J A;  3GF5 A;  4C92 F;  2LCL A;  2EFI A;  2LT1 A;  5CQX A;  2LNV A;  3OYA A;  2C06 A;  2JN0 A;  1EIF A;  5HKC A;  3PIP A;  5GAN 7;  4ZN1 A;  3CPW S;  1DJ7 B;  4M75 E;  2XI9 A;  2RA2 A;  3VKI A;  1Q81 U;  4C5G A;  3MEA A;  2RHI A;  4M7D A;  3VYH B;  1YJN A;  1N8R U;  4JRK A;  1VQ6 A;  3SWN C;  3JCM b;  3M4G A;  5DM7 R;  3CC7 T;  5LJ5 j;  2DXT A;  3M9Q A;  4GLK A;  4XTX A;  4JRQ A;  2OTJ A;  4FT2 A;  3DB4 A;  2V8J A;  3LGF A;  3X25 B;  4DOV A;  1YHQ T;  2ZZD A;  3G71 T;  2QQS A;  2YRV A;  3OSV A;  5CQY A;  3CCV A;  1Q86 U;  2DD4 A;  5KE2 A;  4ZN3 A;  3OYK A;  3HPW A;  3OS1 A;  1RL2 A;  1K8A U;  3OMG A;  5FU7 C;  2X4Y A;  5GAN g;  1JBM A;  4QVD A;  4O5V A;  3A8G B;  4XAX B;  1YJW T;  5GAM j;  3NFC A;  4HT9 A;  2JOY A;  3CCQ T;  2EQJ A;  2M9U A;  3FLG A;  4X9D A;  2EAY A;  3QSU A;  2QI2 A;  4XU0 A;  4C5H A;  1M8V A;  4F7U B;  1M5Q 1;  3HFO A;  3M54 A;  1WJS A;  5LJ3 g;  2R58 A;  4KBM B;  2DIQ A;  3A8L B;  3I56 T;  3C94 A;  5GAN d;  3M5A A;  3CCS A;  3PNW C;  3SD4 A;  5GAM f;  4FT4 A;  5GAN j;  1B34 B;  4IUU A;  1SSF A;  1KHI A;  4M75 D;  3CCL A;  2BIV A;  4LD9 K;  1QP2 A;  4EDU A;  4J6X A;  1N9S A;  2QQB A;  2RJD A;  3SWN A;  4ZGD B;  5IAY A;  3CPW A;  4M7D D;  5LJ5 g;  3CBO A;  5I2M A;  4B9W A;  1BI0 A;  2DIG A;  2IVW A;  1D3B A;  3GLX A;  1O9S A;  2E10 A;  4FL6 A;  3VJP A;  1BIB A;  1M9S A;  4FM4 B;  3FB9 A;  4KUD K;  3MEV A;  2DTI A;  5GAN 5;  4C8Q G;  3DLM A;  3V8L A;  2F5T X;  2BKD N;  1VQ8 T;  2HD0 A;  5L8R E;  2O01 E;  5LJ5 d;  2K57 A;  4BD3 A;  2DZ9 A;  2DXC A;  4A4H A;  1M4Z A;  2PVO B;  1VQ5 A;  1BI2 A;  3CBM A;  4OB2 B;  5CKF A;  3VUZ A;  3A8O B;  5GAN 6;  4EMK B;  1NZ9 A;  3NTI A;  5M9O A;  1VQO A;  1VQN T;  1S72 T;  2QTX A;  3DB3 A;  4QVZ A;  2LX9 A;  3QHS A;  2PUO B;  4C8Q A;  3OY9 A;  2V8K A;  5KH6 A;  1K73 U;  4E47 A;  3H8Z A;  1N8R C;  3EFR A;  4HCZ A;  5DLO A;  3X26 B;  2KAF A;  4CI0 C;  1KC8 U;  4M78 F;  1VQL A;  4PJO D;  2XU8 A;  1YIJ T;  1UEB A;  4BDZ A;  1YJ9 A;  2M1H A;  3HRS A;  3EFS A;  1I4K 1;  2P0P A;  3BFM A;  3V8K A;  1YJN T;  3JB9 F;  4XTZ A;  2DTH A;  5LJ5 h;  3CC2 T;  4N0A C;  3OYB A;  1I81 A;  4C0F A;  3V7C A;  1G3S A;  1I5L A;  4C5E A;  4PJO A;  2P0Q A;  3RES A;  3OS0 A;  1K9M C;  1IZ6 A;  3HL8 A;  4JLI A;  2DVE A;  2MI6 A;  2O4X B;  3JCM W;  3G4S A;  4NOY A;  1AHJ B;  3RKY A;  3JRZ A;  4C8Q D;  4HCB A;  3CCQ A;  1X75 C;  1K9M U;  3FIF A;  1Y7X A;  4F7U F;  1N9R A;  2X4J A;  4M78 B;  1VUB A;  1U8R A;  2FL7 A;  2HBP A;  3A8M B;  5GAN h;  4IUR A;  1XQH A;  2V8I A;  2RI5 A;  2Y4Y A;  2DAQ A;  2P0K A;  4PLI A;  3UDC A;  4ZGE B;  1KD1 C;  4BI8 B;  3QG1 A;  4LDW A;  4M77 G;  3NTK A;  3JCM V;  3QBY A;  3BDU A;  5LJ3 e;  2QEX A;  1MGQ A;  1LOJ A;  2XKO C;  1PSE A;  3CD6 T;  1WPY A;  2EQU A;  1WQW A;  1BKB A;  2JZ2 A;  3FDR A;  2RB6 A;  3CCE T;  3M59 A;  3CC4 T;  4C92 E;  4BDY A;  2X4X A;  4M77 B;  3S3M A;  3X24 B;  5IN1 A;  4A4G A;  4PJO B;  4RCB A;  2GF7 A;  2R5A A;  5LJ5 e;  1M1F A;  3PGG A;  1XNI A;  2LCC A;  1TH7 A;  1BI3 A;  3CCM T;  4HCC A;  1WQ7 A;  5DY9 A;  4RG8 A;  4C92 C;  4F7U E;  4F7U A;  3LLR A;  2A7Y A;  4PJO G;  1VQN A;  2ZPI B;  4Q5W A;  3CCR T;  1X6O A;  5GAM d;  3MEU A;  4J7F A;  3E1S A;  3SFM A;  4ELY C;  5FU7 B;  1VIF A;  4M77 E;  5CKH A;  2ZPE B;  4BAC A;  2PVG B;  2LVM A;  2ZPF B;  4X9C A;  5I2S A;  2X4W A;  3OYF A;  1VQ7 T;  1BI1 A;  3JCM h;  4C8Q E;  3VU3 C;  4UC4 A;  3ME9 A;  4M77 C;  3JCM c;  3TU4 K;  4V2S A;  1M90 C;  3H6Z A;  3JCM g;  4QVC A;  2RJE A;  4J6Y A;  2CKK A;  2LDM A;  4EMG A;  4MDW A;  2ZCF B;  2F69 A;  2E5Q A;  2RHY A;  1G3W A;  4QQD A;  5GAO p;  4NL3 A;  3QKJ A;  3V8J A;  4EMH A;  3PIO A;  3SWN B;  1QVG S;  3FJP A;  3DLL A;  1U1S A;  4IUV A;  4M78 E;  3L2R A;  4M7A D;  3JCM d;  2D6F A;  3G4S T;  2RM4 A;  5CKE A;  2E1H A;  2QQ9 A;  5CK9 A;  4M75 C;  2XDD A;  2CYZ B;  4ME7 A;  2EQM A;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...