3TQ7P

Eb1c/eb3c heterodimer in complex with the cap-gly domain of p150glued
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
LRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Interaction of mammalian end binding proteins with CAP-Gly domains of CLIP-170 and p150(glued).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 71
sequence length 71
chains with identical sequence Q
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 3tq7P00
2CP3A 2E4HA 1TOVA 2QK0A 1WHLA 1IXDA 2E3IA 2E3HA 2COZA 2HKQB 3TQ7P 2HQHA 2MPXC 1TXQA 2CP2A 2COWA 1WHGA 2M02A 2CP0A 2HL3A 1LPLA 1WHJA 3RDVA 1WHMA 2HKNA 4B6MA 2CP6A 2HL5C 3E2UA 1WHKA 2CP5A 2Z0WA 1WHHA 2COYA 2CP7A
chains in the Genus database with same CATH superfamily
2L5QA 3L2WA 3OQ5A 1VIFA 1TTHB 1VYVA 4C92A 3Q1JA 4X1VA 2KMTA 1AWJA 5IT9E 3DLMA 5AT1B 2DLPA 1UJ0A 3MJXA 3VUBA 2CP0A 1T0JA 4EDUA 4F17A 4ELYC 4Y28E 5HCKA 4C8QC 4N4GA 2BE7D 3ULRB 2HZYA 2COYA 1EIFA 4J7IA 1U8RA 4M77D 4J6WA 1U5SA 4RTYA 1TWBA 4C0DC 4JZ4A 3V8JA 2EKOA 5KYWA 2DJZA 2KNBB 3CPWP 1Q82R 2GTJA 1ZA1B 2HKQB 3OYDA 4M7AD 1I4K1 1D1BA 4M7DC 1R8OB 2YRVA 3OYAA 2GFUA 2QA4T 2K5LA 4MZMA 1WI7A 3QWYA 1SHGA 5FWBA 2CKKA 1OYXA 1ARKA 4EMKA 1VQ4T 5LJ3f 2IIMA 3SD4A 2NYSA 3RBBB 3REBB 2MIOA 3CPFA 2P0PA 4N0AA 3VS4A 1GCQA 1WFWA 3L42A 2ZCFB 5GAOl 2L8DA 5CQXA 3A98A 3TREA 1KQSA 1UGPB 2EQUA 2LQWA 3NFCA 1X01A 4AG1C 1BCMA 2LQ8A 3CBOA 3CC7Q 1D1AA 2FB7A 3CCUT 2EGAA 2R58A 3CCQQ 2CT3A 2EFIA 3CMAQ 2E70A 1DJ7B 3G71A 4OB3B 1D0XA 3VRZA 2DTIA 3X24B 1YJWT 4OB1B 4BI4A 3DB4A 4FYXB 4PJNA 1FMVA 1RI0A 2XI9A 1YI2A 4DOWA 2KDSA 1D1CA 3HRUA 2YXYA 2JT4A 1VQ7T 2YUOA 3NPFA 4J8OA 2DM1A 5IH2A 1ZUYA 1VQOT 4E7HA 3I9QA 3CCEA 2XDBA 4C0ZA 4YTLA 2RHYA 3L1AA 1VQPQ 3M58A 2RQWA 4M7DF 3TSWA 1JJ2S 4E7SA 2K2MA 3CMEQ 2L3RA 2MMPA 2DO3A 3MHXA 3M9QA 3PIPA 1SRLA 1M2VA 2JUFA 4HVVA 1NJIR 4PJOG 4Z89A 1YP5A 1I1JA 2HNIA 4C8QA 1K9MC 1I07A 3S3MA 3JCMP 2YT6A 2ZPFB 4XTVA 1BI1A 2EGCA 1GL5A 3A8GB 2EYQA 2J6OA 2V26A 2DERA 5DLQE 2L3QA 4N4HA 2DD4A 8ATCB 3MP6A 4M7DA 1M3AA 1A0NB 1W4SA 5GMKe 1B34B 3EG1A 5C6SA 3QKJA 3JCMW 5GMKl 4FU6A 1G8XA 2D8JA 1N6AA 2AT1B 3CCVQ 4F16A 1N8RC 1RL2A 2DAQA 4A4GA 4M77E 3LYIA 4LDXA 3OMGA 4KGZB 4AFSC 3JCMg 3BDUA 1YFNA 4J9HA 4M7AE 5L23A 1Q95G 5CKDA 1K9MU 1WHMA 3D7SB 4RTZA 1RAEB 3UT1A 4Y91A 1MNEA 3QWXX 3WXMB 5GMKj 1ZUKA 3EGXA 4UC4A 2EGEA 3OYIA 5DLOA 1Q7YR 2E10A 2GF7A 3CCMT 4OMFB 4BB7A 3NHNA 5CO7A 5FRNA 1OEBA 1ZX6A 3M54A 2KXDA 2RPNA 3HRTA 1LOJA 2FYKA 1S72T 2DIQA 2MCNA 1N8RU 3M57A 2YSQA 4C92E 1SF9A 2EBPA 5GANd 5I2SA 4PJOF 2D9TA 2F5TX 2DL3A 2CDTA 3I55Q 4JS4A 3RKWA 4DBFA 1GBQA 3EGDA 4IUQA 2Y4YA 5GAN3 1G3SA 1YITT 1ZA2B 1GBRA 4FL6A 3CPWS 1N27A 1QLYA 2AZSA 1P92A 3HHTB 4ZN3A 4KGXB 1MV3A 2CH4A 2FPEA 2RK1A 2KYBA 3CCRT 4Q5WA 4BUGA 2KEAA 4J9IA 3JB9F 3S3OA 1YJNT 2FEIA 3E19A 1T3SA 4LUEA 1VQ8A 2KQWA 4M75G 4LUDA 2RI5A 4EMGA 4PJOA 2O9VA 2E3IA 4HA8A 2LRQA 5IHKA 2DXUA 2DXTA 3EG2A 2YUNA 1K9AA 1QP2A 4E7ZA 2ESWA 2ROTA 1AWOA 2DJQA 1I81A 2FZCB 1KIKA 4J5YA 4J9GA 1CKAA 4PK4A 1UGRB 3J7AF 4C5IA 4VUBA 4BY6B 4E7KA 3AT1B 1IXDA 1RACB 1NPRA 1BCOA 2F5KA 2JZ2A 2DF6A 1YIJT 1H3ZA 3GLXA 4R0KA 1R0CB 2XDDA 5CKBA 2QQBA 5LJ3d 1M90C 2DYIA 1VUBA 3VS2A 3PGGA 3CC7A 1ZQ1A 1LJOA 3CCQA 4RCCA 2MWPA 3CMAA 3RUXA 3JCMc 4HCCA 2W10A 2DVEA 2MYSA 1G2BA 2E1HA 4E7IA 4EIKA 2HBPA 4ZNXA 3SWNC 2JN0A 1UGSB 2JM8A 4M75F 5GANe 1N9RA 3I5SA 4J7FA 3A5ZB 4QW2A 1ABOA 3U23A 1M8VA 2V1QA 1OV3A 4J6YA 2RD1A 1FYNA 1QVFP 2BKDN 3QXEB 3SEMA 1SRMA 3OS5A 1Q86C 3CMEA 1BI0A 2ENMA 1K9MR 2K9GA 4HVWA 4C8QE 5AYFA 4M78C 1X69A 2XD0A 2OTLQ 4A4HA 4Z88A 2LCSA 5GANj 1U06A 3OBYA 5FU7C 3C0CA 4LE9A 1K0XA 3O5ZA 2CSQA 1H8KA 4E47A 2LVMA 1C6VX 3KBGA 4ZTJA 3VS6A 3I5RA 1M1KU 3JCMQ 1KHCA 3GNFB 2E6ZA 1N8RR 2D1XA 2HQXA 3G71T 2OI3A 4JS5A 3CCVA 4PL6A 4KUIA 4CI0C 2EPDA 3E9FA 2CZ1B 1YI2T 2QTVA 1VQLQ 2KVQG 3FDRA 1NYGA 2CZ0B 2X51A 3LH5A 1XJWB 1X6GA 2J05A 4Z8AA 3CCET 2DA9A 2V8IA 1D3BA 2ZGWA 3LWIA 3VJPA 3CD6Q 1JRIA 4F7UE 4FM4B 5GAOm 5A2QE 3CCJA 5KCOA 3G1JA 1Y0MA 2V1RA 1Y57A 3JSCA 4M77C 1NM7A 3P8HA 1TS9A 2VKNA 3THKA 2HBWA 1UEBA 2KRSA 2DTHA 2PTKA 5LJ3j 2EJFA 4R56A 2AK5A 4M7AC 3C95A 3SWNA 4P5NA 4FCYA 3M56A 4M7AG 2JTFA 3HSBA 3GBQA 2LP5A 2I0NA 3O8VA 2BZXA 1AT1B 4FIBA 4XTZA 2M0OA 2DEQA 1K0SA 2VVKA 1Q82U 1KD1C 1OPLA 1WNLA 1RADB 2COWA 2OTJQ 5CKFA 2JXBA 1RAIB 4IUTA 3ASKA 4IURA 4OB0B 4OMMA 3HL8A 1Y71A 2LJ1A 2YUPA 2QQSA 3HFOA 4C92G 2K4YA 3RKYA 5GMKi 2P84A 2RB6A 1M1FA 3CXCP 3UATA 3CC2A 1GFCA 1PWTA 2RHXA 3LH0A 3V7CA 5GAOq 4BI8B 1VQ9Q 2JNGA 5A0GA 1VQ6A 2J7IA 3QO3A 5CAIA 1FXXA 3EGDB 4XTYA 2MF2A 5GAN7 2J6KA 2FO0A 1FMWA 4C0FA 3WVDB 3A8HB 3V7RA 3ZBDA 2JS0A 4OF1A 1JEGA 3QJYA 2YLCA 4M77F 1QKXA 3I56Q 3QG1A 1IHWA 2O4XA 3M4GA 2NUTA 3NGPA 3PIOA 4X9CA 2QG9B 3QDRB 5KYYB 1B07A 1I5OB 1BYMA 2AKKA 4RTVA 4C0GA 4M7AF 5HK0A 2RQTA 4PJOB 2ZZDA 2DL5A 1UE9A 1JBMA 2YLBA 3BFMA 2J06A 4BE1A 2DXBA 3MPUB 3CCLQ 1AD5A 1AOJA 3LGFA 4KT0E 1WYXA 4BACA 5HY6A 1QVFS 3P8DA 5GAMe 1VQ8T 4ORZA 3CEYA 1N9SA 2HEQA 2DXCA 2KK4A 4M77A 1NLPC 5CK9A 2E5KA 1QVGP 3MEUA 2JW4A 3OY9A 3CC4Q 4C92F 2CP5A 3EG9B 2QXFA 1NJIU 4B9XA 4M7AA 1YJ9Q 4M4ZA 4C5HA 4EPCA 4Y92A 5DM7R 1AZGB 4LDYA 2CUBA 1Q81U 2ZAEA 5GAMj 2OTLA 1SEMA 2X4JA 3EFSA 1X2KA 4PJJA 2ZPGB 1OPKA 2E6NA 3RIRA 2EQMA 4J9DA 2MAMA 2P4RA 3CC7T 1ZLMA 1JB0E 3CCQT 4HCBA 3CMAT 1SG5A 3QPHA 4X34A 4CC2A 5HKCA 4J9FA 1NYFA 3LX7A 1RUWA 4JRIA 2XK0A 1VQKT 3QYGB 3H41A 2LX9A 2DIGA 4C8QG 1VQLA 3VU3C 4Z02A 3HRSA 1Q7YU 2EW3A 3UA7A 1EFNA 2RJDA 1WPYA 3JCMX 2XKOC 4RG8A 1D0ZA 1WHGA 2PZ1A 4D6WA 1ZSZC 2PQWA 4GLMA 4JJBA 3OW2P 2FRWA 4JRQA 4M7DG 1WHJA 4KBMB 3M4YA 2AZVA 1D09B 2LQNA 1KJWA 4M75B 2HMAA 1Y07A 3CD6A 2CREA 1YBYA 4RCBA 2K6DA 3QZ5B 3VS3A 3MP1A 3SFMA 2Y4XA 1YNZA 2DK3A 3EH1A 2XHCA 3OYJA 2R57A 2P0QA 3SB2A 1M8MA 4RTXA 3X26B 5ECAA 2BUDA 3ER0A 2FPDA 2O31A 3X20B 2HL5C 5J39A 3OBWA 3UWNA 1ZBJA 1KC8C 2JMAA 2LNHB 3OYFA 2X4XA 1WXBA 2OAUA 1O75A 4OMOA 1W2BA 3L2ZA 5FWCA 2RHIA 1BI3A 1IB8A 1VQ5T 2EYYA 1KFZA 3CXCS 2BIVA 4M78E 4F7UG 3CCVT 1MMAA 4N4IA 3M0SA 3LLRA 2MWOA 2L89A 2QASA 4FYVB 4QQDA 3VYGA 4MMKA 4C8QF 2DFUA 4CC7A 2Z0WA 1O9SA 3G4SQ 3EFOA 1AHJB 3P8BB 1E6GA 1PSFA 1TSFA 3JCMh 1KC8U 3H6ZA 1VQ9A 2D6FA 4A54A 1UHFA 3CCJT 4BE0A 1QVPA 5LJ5h 4JUVA 4FT4A 5GJWB 2QA4Q 1SSHA 3MP8A 4XQ3A 5GAMh 3I56A 4AG2C 1OZ2A 1VQ4Q 3PE0A 1Q81R 3QZ9B 2QEXA 1VQMA 1WJSA 3EH2A 3VKIA 2PNIA 3MKDA 5M9OA 4DBQA 1TH7A 2LT1A 4ATOA 1ZSZA 3CCLA 2PVOB 1YHQT 1QVGS 3ZEHA 3JB9G 1UHCA 2WSFE 4J83A 3H0IA 4F7UF 3CCUQ 1KQ1A 2DBKA 4KGVB 5KYXA 4ZGDB 1VIEA 3CC4A 1WGSA 4RG2A 3EG3A 4DA4A 4DEXA 3JCMf 3CC2T 2OX7A 1NEBA 1Z9ZA 2W0ZA 2K3XA 1N5ZA 1G3TA 3OS1A 1YJ9A 3QJ6A 5LJ5g 1ABQA 1QVFA 2VASA 4K11A 4LDVA 2G3RA 2C0TA 2I2LA 1VQ7Q 3N5BB 5GAMg 3HTRA 4L59A 1BU1A 2M9UA 1VQOQ 1VQ6T 3G6EA 5FROA 1OI1A 5L8RE 3OYBA 2PUOB 3E1SA 4F7UA 1PNJA 3MEWA 1WHKA 3QUIA 3TVTA 2B86A 3KUFA 1U1TA 1QCOA 5CKHA 1GFDA 2K79A 2O01E 3E9GA 3OS0A 1NG2A 2QYZA 1KQSP 4MDWA 1IGUA 1B7TA 2KT8A 2EYZA 1SHFA 5KYUA 2JTMA 2DX1A 3BW1A 2EWNA 3OW2S 4OVAA 4NL3A 2A08A 4HXJA 1EZZB 4PJMA 1WJQA 1TXQA 2CP2A 4F14A 1UDLA 2CYZB 2IG0A 3GIBA 2ABLA 1M5Q1 1AZEA 2ED0A 4OMLA 1RAHB 4C92B 4CRIA 2F2VA 4F04B 4MZTA 1V29B 1JXMA 1H92A 1RAGB 2OTLT 5IHIA 4LDUA 1KC8R 5EC7A 1HSQA 1PM3A 2KROA 4LXCA 1K8AC 2LCCA 4PKCC 2CZ7B 4QVZA 2X3WD 3E2UA 5KYWB 5KE3A 1S72Q 3SDZA 2HSEB 1NLOC 5GAOn 5IN1A 1Z9QA 1M3BA 4II1A 1D0YA 3JV3A 4BDZA 3GF5A 2M51A 1VA7A 4J9BA 2JVVA 5FU6B 4JLIA 1IO6A 2BE9B 4EMKB 2NUZA 5D6XA 3G4SA 1MV0B 3V8LA 2H3JA 4ZGJB 2EYWA 4ELZC 1VQPA 1M90U 4FYYB 1OZ3A 3CXCA 1F1BB 4RTWA 3URGA 1G5VA 1GCPA 1QQJA 4PJOD 1NZ9A 2FZGB 2D0NA 3CD6T 1FX7A 4WF2A 1MMDA 4D8KA 1UFFA 5GMKh 4JLGA 4M78G 2QA4A 4JJNK 2GCXA 3PVQA 2LT4A 5D6WA 1Y96A 1WHLA 5J26A 3OSSC 4XTXA 3OYMA 1JJ2A 1I0CA 2NLUA 2CS7A 3UA6A 3NTKA 2M16A 3UPUA 2KSSA 2QQ9A 4KH0B 3RERA 2K57A 3TEEA 2A3LA 4OMQA 1WHHA 1Q86U 2YDLA 2CT4A 3H9NA 5CVIA 4FT2A 4R55A 3WVEB 1X27A 2OAWA 3CCUA 1MGQA 1Y7XA 1WXTA 2DTOA 3JB9H 4FSSA 2OJ2A 1PD1A 1BB9A 1XNIA 1M2VB 5LJ3e 4E7LA 2FRYA 5IXBA 1G3WA 2LC4A 2JJ9A 4J6XA 4C8QB 2ZPBB 2A0FB 2E4HA 4OGCA 2E41A 2M0YA 1VQ9T 4C0DB 2X35A 3FLGA 3JCMd 1ZUUA 4M7DB 2DL8A 3PFSA 4PJLA 2GGRA 4HT9A 3PVLA 4M77G 3S6WA 1UECA 4M78F 1KQSS 5I21A 4QQ6A 3CBPA 3I56T 2O88A 3I55A 1MMGA 3JCMb 2RK2A 1SSFA 4DBHA 3VV0A 2QEXT 1VQMT 5FW9A 2ZPEB 1W6XA 1PG5B 3PMTA 1BBZA 1PC0A 3J80E 4M75D 2HQHA 1M27C 4IUVA 1VQNQ 4IUPA 1IRXA 4A4FA 3CCLT 2LX7A 1YCSB 3T9NA 4RTUA 3EGXB 4B6MA 4L5GA 2DPPB 3EAEA 2E65A 2CP3A 4M78A 3LGLA 2X4YA 3CPWA 2RHUA 3CC4T 4F7UB 2GBQA 2EKHA 1M9SA 1OULA 1C0MA 4XAXB 2EYXA 2VGMA 2NUPA 1YJ9T 2GNCA 4AMCA 2R5AA 3FJ5A 1PSEA 1WQ7A 4PFZA 2O9SA 1KD1U 2VXEA 4BY6C 4OGEA 3G6ET 1B34A 1M90R 4NL2A 5C0MA 1X75C 1RLQC 1QW1A 3ME9A 5KYUB 4E7JA 3CCSQ 4B9WA 2KI7A 5GANh 3RKXA 5GMKm 3V7SA 1TUDA 1S72A 3VS7A 1U1SA 2BZYA 4XTWA 4FYWB 3IQLA 1PRLC 1HYOA 3H0FA 2LNVA 4L6V5 1TUGB 1IHVA 5FRMA 1FWZA 2H8HA 3DLLA 3L2VA 2RA2A 3VYHB 1HXDA 2XICA 2P0KA 3F70A 2RJFA 1Q86R 1RAFB 1GCQC 3PMIA 1GRIA 2RM4A 2DYBA 2JOYA 2DETA 3TSZA 5I11A 1G83A 5J3BA 1WX6A 1M1GA 3JAME 3NTHA 4LD9K 5GANg 2KAFA 4J9CA 2KXCA 4KUDK 2XMFA 3QDFA 2P4TA 3LW5E 1OU9A 4AT1B 2VWFA 1X2QA 4FW1A 3MEVA 3MCAB 2EQKA 3EGUA 3OYLA 5LJ3h 2L0AA 4M75E 2JM9A 2LMJA 4LDWA 4KH1B 3VS0A 1AEYA 1WXUA 2RMOA 2DL7A 4PLIA 1RABB 4NOYA 2FG0A 2H3EB 2RJCA 3BDLA 2A28A 5CCAA 4QQGA 3G4ST 2K3BA 4XTUA 1R77A 1Y96B 1VQPT 1PRMC 4QVCA 4AFQC 2KYMA 2HQEA 1VQ8Q 4HCZA 1X6OA 3CMET 3M55A 1OU8A 3A8MB 4X9DA 2V8JA 3NTIA 4ZTFA 5LJ3g 3HFNA 4PFOA 3L2UA 3BY7A 3CQTA 3VRYA 3M0PA 1KD1R 2A36A 1QP3A 2KT1A 4HVUA 1JXOA 3VS5A 2K7AA 3OYCA 3MEAA 5CR2A 2DVJA 1JU5C 1VQNA 1K1ZA 3UF4A 2D0QB 1D3BB 2F2XA 2OTJA 4C92D 1AWWA 2AKLA 2M02A 3DB3A 2RHZA 4QKUA 3A1PA 1IZ6A 1B3QA 3HKSA 4ESRA 2LCLA 2HD0A 1CSKA 2V8KA 4XU0A 4ZN1A 2Y90A 3J81E 5I2MA 1VQKQ 4RMOA 2CSIA 4E6RA 9ATCB 3M0QA 2M1HA 2K2VA 1KK7A 3SWNB 4DBRA 4BDYA 4WTOB 5GAN6 1UB4A 1M3CA 4LN2A 2KY9A 2B8AA 4JRPA 3FB9A 5GAN5 2F1LA 1ZSGA 1OQKA 1KHIA 1YWPA 3CCSA 3PNWC 4DOVA 3OYGA 3I55T 2E64A 3GNGA 4A63B 1R0BG 4M78B 1TUCA 4PJOC 4RUGA 3M0TA 2KRNA 5FU7B 1UG1A 2PVDB 4J9EA 4PNOA 2E3HA 1W70A 2DBMA 2FVUA 2NUPB 3JRZA 3NMZC 1S1NA 3OYYA 5D6YA 3KFVA 4AFUC 2IVWA 3RNJA 8AT1B 1OX9A 3M5AA 2ECZA 1H641 5FLXE 1VQ5Q 2HAXA 1YJWQ 2RN8A 1V76A 1K73C 2MOXA 1UTIA 2QK0A 2RQRA 2QTXA 5KCHA 1BI2A 4A53A 2O4XB 3A8LB 5IHNA 2DNUA 2DE0X 2NUTB 2SEMA 3TQ7P 4XK8E 2C0IA 2HSPA 2GQVA 3DKMA 5LJ5f 3L2RA 3M0RA 1LPLA 1MHNA 5GAMf 3RMSA 1WJRA 2GFAA 2X9HA 2EJ9A 4DEYA 2AHJB 4BE2A 2EQIA 3V8KA 3CCJQ 1QCFA 2XDPA 1VYUA 1K73U 4C8QD 4M77B 3X25B 4RKUE 3OS2A 4NS5A 5GAOr 2QAZA 1YN8A 7AT1B 4M7AB 5GAN4 3TCJA 2RH2A 2RQVA 2QQAA 4M7DD 1RI9A 1AWXA 1OOTA 4O5VA 1W2BP 2GTOA 2K5IA 3FIFA 3LWHA 1KQ2A 2FZKB 2MPXC 1HJDA 1YHQQ 2VXFA 2VGNA 4MMLA 1G3YA 2XU8A 1NEGA 4M75C 3QSUA 3I35A 1BIAA 2KE9A 2PVGB 5KYYA 1M2OA 2ED1A 2BZ8A 2JMCA 5IAYA 3S3NA 4TVRA 2A7YA 2HCKA 3CC2Q 2C06A 3X28B 3OYHA 3M59A 3QYHB 1J3TA 1MMNA 1RLPC 2DMOA 2EQJA 3RMQA 3FRNA 2QGGA 3CCMQ 2HKNA 2JS2A 4OB2B 2RI2A 4WCIA 3OYKA 4V2SA 1VQ6Q 2DL4A 1OX8A 5CQYA 1GXIE 4IIMA 3R6NA 3EG9A 3RESA 1PHTA 3H0HA 1TG0A 1TU0B 3EHRA 2KBTA 2QQRA 3AHUA 2YWWA 2VC8A 3HPWA 6AT1B 1FMKA 5A0DA 2A37A 3JCMJ 1VQLT 1KSWA 3QIIA 2LQKA 4OP0A 1YITQ 3GPLA 2ZPIB 2ATCB 3JCMV 1VYTA 4CC3A 1VQKA 1K8AU 4CC4B 4JDSA 3CCRQ 3TU4K 1YJNQ 2MI6A 1SKUB 2X3XD 2CUDA 3C12A 4HT8A 2C0OA 4AFZC 1UGQB 4JRKA 5I22A 1M1KC 3QBYA 4GBQA 4JJCA 3L2QA 2DRKA 2LDMA 5EG2A 1T3LA 3KXTA 2YRDA 2AIRB 4XU3A 1T0HA 3OMCA 4MDXA 2RQUA 4QVDA 1VQ4A 4BI3A 1X6BA 2YHTA 5CKEA 1C1AA 2LJ3A 3JB9I 3JB9D 2HL3A 5KH6A 3MO8A 1YCYA 2KGTA 3EFOB 1XTDA 4LNPA 1YIJQ 1VQNT 4DQ2A 1JQQA 2OTJT 4M75A 3G7ZA 1NE8A 1WA7A 4A4EA 4M7DE 3GOXA 1EX4A 4C5EA 3GP8A 5HK3A 1LCKA 2EIFA 1K73R 1MNDA 3VUZA 4HKEA 2KRMA 5A0LA 1VQ5A 4JJDA 1YJWA 1WIEA 1RAAB 4JZ3A 3META 1QCNA 2CP6A 3BE3A 2E5QA 3EFRA 1QVGA 1JO8A 4RTTA 3FC3A 2QGFB 1YWOA 4HCKA 2RO0A 2RJEA 4ZGEB 1PKTA 3FEOA 3M53A 2JTEA 2EJGA 1VQ7A 2DZCA 3ZFJA 4KRTA 1HD3A 1VQOA 2WACA 3C94A 1I8FA 2CH4W 5KYNA 2XIDA 1UUEA 4MZPA 2R5MA 1PKSA 1ZSZB 1WQWA 3VS1A 2EVRA 1Q82C 5IXFA 2L3PA 2RI3A 3CCST 4OMPA 2YUQA 4ME7A 1XOVA 4XU2A 2NWMA 2PU9B 2J6FA 2F2WA 2FL7A 5LJ5d 5KYXB 2LZ6B 2COZA 2VV5A 1W2BS 5GAMd 3UDCA 1QWEA 4EMHA 2QDLA 2VYTA 1HK9A 2E12A 2BTTA 2DZ9A 1VOMA 3R6OA 4KULA 1QKWA 1W1FA 2WSCE 4BD3A 3INZA 4JPBW 2DD5A 4FW2A 3OA6A 4C5GA 3C4SA 2LTOA 3PTAA 3HP9A 4IUUA 4XU1A 4GLKA 3G71Q 2ZPHB 1YHQA 2RNAA 1NPPA 4PLLA 2QI2A 3REAB 2LJ0A 4GY5A 4PJOE 3OW2A 1WLPB 1YI2Q 2CGHA 2VB6A 1BK2A 2DRMA 1E6HA 3M0UA 4C92C 1QWFA 5GAN8 1V1CA 3EG0A 1I5LA 3RR6A 4A4KA 1ZBXA 3CCEQ 1QMCA 1K8AR 2L3SA 1WDXA 3FJPA 4E2FB 3OYEA 2CZ6B 5GAN2 1K76A 2GQIA 1H3HA 2RF0A 3CCMA 3RDVA 4QT7A 2SRCA 3SHWA 3QHSA 1PD0A 5CIUA 5D7UA 2CP7A 1PCXA 2XG8D 2K3YA 2QDYB 1JJ2P 2IPOB 1LNXA 2HDAA 5GJVB 1IREB 1IGQA 1AVZC 3PT9A 5FU6C 4IIOA 3JCMe 2QEXQ 1VQMQ 1NJIC 4EMKC 4O6JA 1WZOA 2ROLA 3CBMA 3A8OB 1BKBA 1YITA 3EHQA 1Q81C 1SPKA 4N0AC 1M4ZA 5DY9A 2MK5A 4IKFA 3CCRA 5LJ5e 2X4WA 1NBEB 4M78D 1YJNA 1M1KR 1UGVA 2L2PA 1E7OA 2KR3A 1XQHA 5KE2A 1UJYA 2D8HA 2DKGA 2G6FX 3ZL7C 3H8ZA 3OSVA 1X43A 1ZHIA 1K4US 2O2OA 2DILA 1ACMB 1TOVA 4FSXA 5LL6S 5GANf 2FHDA 2K5FA 2VUBA 1MUZA 2PUKB 4LD6A 5LJ5j 3OB9A 2FPFA 1CKBA 4PFPA 3G6EQ 1BIBA 5GAOp 4D8DA 2EAYA 1Q7YC 1M30A 2YRCA 4ANJA 2DEUA 4OMNA 3JB9J 1YIJA 1KG1A 3OYNA 1LVKA 1U3OA 2WSEE 2F69A
chains in the Genus database with same CATH topology
2CP3A 2E4HA 1TOVA 2QK0A 1WHLA 1IXDA 2E3IA 2E3HA 2COZA 2HKQB 3TQ7P 2HQHA 2MPXC 1TXQA 2CP2A 2COWA 1WHGA 2M02A 2CP0A 2HL3A 1LPLA 1WHJA 3RDVA 1WHMA 2HKNA 4B6MA 2CP6A 2HL5C 3E2UA 1WHKA 2CP5A 2Z0WA 1WHHA 2COYA 2CP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP3 A;  2E4H A;  1TOV A;  2QK0 A;  1WHL A;  1IXD A;  2E3I A;  2E3H A;  2COZ A;  2HKQ B;  3TQ7 P;  2HQH A;  2MPX C;  1TXQ A;  2CP2 A;  2COW A;  1WHG A;  2M02 A;  2CP0 A;  2HL3 A;  1LPL A;  1WHJ A;  3RDV A;  1WHM A;  2HKN A;  4B6M A;  2CP6 A;  2HL5 C;  3E2U A;  1WHK A;  2CP5 A;  2Z0W A;  1WHH A;  2COY A;  2CP7 A; 
#chains in the Genus database with same CATH topology
 2L5Q A;  3L2W A;  3OQ5 A;  1VIF A;  1TTH B;  1VYV A;  4C92 A;  3Q1J A;  4X1V A;  2KMT A;  1AWJ A;  5IT9 E;  3DLM A;  5AT1 B;  2DLP A;  1UJ0 A;  3MJX A;  3VUB A;  2CP0 A;  1T0J A;  4EDU A;  4F17 A;  4ELY C;  4Y28 E;  5HCK A;  4C8Q C;  4N4G A;  2BE7 D;  3ULR B;  2HZY A;  2COY A;  1EIF A;  4J7I A;  1U8R A;  4M77 D;  4J6W A;  1U5S A;  4RTY A;  1TWB A;  4C0D C;  4JZ4 A;  3V8J A;  2EKO A;  5KYW A;  2DJZ A;  2KNB B;  3CPW P;  1Q82 R;  2GTJ A;  1ZA1 B;  2HKQ B;  3OYD A;  4M7A D;  1I4K 1;  1D1B A;  4M7D C;  1R8O B;  2YRV A;  3OYA A;  2GFU A;  2QA4 T;  2K5L A;  4MZM A;  1WI7 A;  3QWY A;  1SHG A;  5FWB A;  2CKK A;  1OYX A;  1ARK A;  4EMK A;  1VQ4 T;  5LJ3 f;  2IIM A;  3SD4 A;  2NYS A;  3RBB B;  3REB B;  2MIO A;  3CPF A;  2P0P A;  4N0A A;  3VS4 A;  1GCQ A;  1WFW A;  3L42 A;  2ZCF B;  5GAO l;  2L8D A;  5CQX A;  3A98 A;  3TRE A;  1KQS A;  1UGP B;  2EQU A;  2LQW A;  3NFC A;  1X01 A;  4AG1 C;  1BCM A;  2LQ8 A;  3CBO A;  3CC7 Q;  1D1A A;  2FB7 A;  3CCU T;  2EGA A;  2R58 A;  3CCQ Q;  2CT3 A;  2EFI A;  3CMA Q;  2E70 A;  1DJ7 B;  3G71 A;  4OB3 B;  1D0X A;  3VRZ A;  2DTI A;  3X24 B;  1YJW T;  4OB1 B;  4BI4 A;  3DB4 A;  4FYX B;  4PJN A;  1FMV A;  1RI0 A;  2XI9 A;  1YI2 A;  4DOW A;  2KDS A;  1D1C A;  3HRU A;  2YXY A;  2JT4 A;  1VQ7 T;  2YUO A;  3NPF A;  4J8O A;  2DM1 A;  5IH2 A;  1ZUY A;  1VQO T;  4E7H A;  3I9Q A;  3CCE A;  2XDB A;  4C0Z A;  4YTL A;  2RHY A;  3L1A A;  1VQP Q;  3M58 A;  2RQW A;  4M7D F;  3TSW A;  1JJ2 S;  4E7S A;  2K2M A;  3CME Q;  2L3R A;  2MMP A;  2DO3 A;  3MHX A;  3M9Q A;  3PIP A;  1SRL A;  1M2V A;  2JUF A;  4HVV A;  1NJI R;  4PJO G;  4Z89 A;  1YP5 A;  1I1J A;  2HNI A;  4C8Q A;  1K9M C;  1I07 A;  3S3M A;  3JCM P;  2YT6 A;  2ZPF B;  4XTV A;  1BI1 A;  2EGC A;  1GL5 A;  3A8G B;  2EYQ A;  2J6O A;  2V26 A;  2DER A;  5DLQ E;  2L3Q A;  4N4H A;  2DD4 A;  8ATC B;  3MP6 A;  4M7D A;  1M3A A;  1A0N B;  1W4S A;  5GMK e;  1B34 B;  3EG1 A;  5C6S A;  3QKJ A;  3JCM W;  5GMK l;  4FU6 A;  1G8X A;  2D8J A;  1N6A A;  2AT1 B;  3CCV Q;  4F16 A;  1N8R C;  1RL2 A;  2DAQ A;  4A4G A;  4M77 E;  3LYI A;  4LDX A;  3OMG A;  4KGZ B;  4AFS C;  3JCM g;  3BDU A;  1YFN A;  4J9H A;  4M7A E;  5L23 A;  1Q95 G;  5CKD A;  1K9M U;  1WHM A;  3D7S B;  4RTZ A;  1RAE B;  3UT1 A;  4Y91 A;  1MNE A;  3QWX X;  3WXM B;  5GMK j;  1ZUK A;  3EGX A;  4UC4 A;  2EGE A;  3OYI A;  5DLO A;  1Q7Y R;  2E10 A;  2GF7 A;  3CCM T;  4OMF B;  4BB7 A;  3NHN A;  5CO7 A;  5FRN A;  1OEB A;  1ZX6 A;  3M54 A;  2KXD A;  2RPN A;  3HRT A;  1LOJ A;  2FYK A;  1S72 T;  2DIQ A;  2MCN A;  1N8R U;  3M57 A;  2YSQ A;  4C92 E;  1SF9 A;  2EBP A;  5GAN d;  5I2S A;  4PJO F;  2D9T A;  2F5T X;  2DL3 A;  2CDT A;  3I55 Q;  4JS4 A;  3RKW A;  4DBF A;  1GBQ A;  3EGD A;  4IUQ A;  2Y4Y A;  5GAN 3;  1G3S A;  1YIT T;  1ZA2 B;  1GBR A;  4FL6 A;  3CPW S;  1N27 A;  1QLY A;  2AZS A;  1P92 A;  3HHT B;  4ZN3 A;  4KGX B;  1MV3 A;  2CH4 A;  2FPE A;  2RK1 A;  2KYB A;  3CCR T;  4Q5W A;  4BUG A;  2KEA A;  4J9I A;  3JB9 F;  3S3O A;  1YJN T;  2FEI A;  3E19 A;  1T3S A;  4LUE A;  1VQ8 A;  2KQW A;  4M75 G;  4LUD A;  2RI5 A;  4EMG A;  4PJO A;  2O9V A;  2E3I A;  4HA8 A;  2LRQ A;  5IHK A;  2DXU A;  2DXT A;  3EG2 A;  2YUN A;  1K9A A;  1QP2 A;  4E7Z A;  2ESW A;  2ROT A;  1AWO A;  2DJQ A;  1I81 A;  2FZC B;  1KIK A;  4J5Y A;  4J9G A;  1CKA A;  4PK4 A;  1UGR B;  3J7A F;  4C5I A;  4VUB A;  4BY6 B;  4E7K A;  3AT1 B;  1IXD A;  1RAC B;  1NPR A;  1BCO A;  2F5K A;  2JZ2 A;  2DF6 A;  1YIJ T;  1H3Z A;  3GLX A;  4R0K A;  1R0C B;  2XDD A;  5CKB A;  2QQB A;  5LJ3 d;  1M90 C;  2DYI A;  1VUB A;  3VS2 A;  3PGG A;  3CC7 A;  1ZQ1 A;  1LJO A;  3CCQ A;  4RCC A;  2MWP A;  3CMA A;  3RUX A;  3JCM c;  4HCC A;  2W10 A;  2DVE A;  2MYS A;  1G2B A;  2E1H A;  4E7I A;  4EIK A;  2HBP A;  4ZNX A;  3SWN C;  2JN0 A;  1UGS B;  2JM8 A;  4M75 F;  5GAN e;  1N9R A;  3I5S A;  4J7F A;  3A5Z B;  4QW2 A;  1ABO A;  3U23 A;  1M8V A;  2V1Q A;  1OV3 A;  4J6Y A;  2RD1 A;  1FYN A;  1QVF P;  2BKD N;  3QXE B;  3SEM A;  1SRM A;  3OS5 A;  1Q86 C;  3CME A;  1BI0 A;  2ENM A;  1K9M R;  2K9G A;  4HVW A;  4C8Q E;  5AYF A;  4M78 C;  1X69 A;  2XD0 A;  2OTL Q;  4A4H A;  4Z88 A;  2LCS A;  5GAN j;  1U06 A;  3OBY A;  5FU7 C;  3C0C A;  4LE9 A;  1K0X A;  3O5Z A;  2CSQ A;  1H8K A;  4E47 A;  2LVM A;  1C6V X;  3KBG A;  4ZTJ A;  3VS6 A;  3I5R A;  1M1K U;  3JCM Q;  1KHC A;  3GNF B;  2E6Z A;  1N8R R;  2D1X A;  2HQX A;  3G71 T;  2OI3 A;  4JS5 A;  3CCV A;  4PL6 A;  4KUI A;  4CI0 C;  2EPD A;  3E9F A;  2CZ1 B;  1YI2 T;  2QTV A;  1VQL Q;  2KVQ G;  3FDR A;  1NYG A;  2CZ0 B;  2X51 A;  3LH5 A;  1XJW B;  1X6G A;  2J05 A;  4Z8A A;  3CCE T;  2DA9 A;  2V8I A;  1D3B A;  2ZGW A;  3LWI A;  3VJP A;  3CD6 Q;  1JRI A;  4F7U E;  4FM4 B;  5GAO m;  5A2Q E;  3CCJ A;  5KCO A;  3G1J A;  1Y0M A;  2V1R A;  1Y57 A;  3JSC A;  4M77 C;  1NM7 A;  3P8H A;  1TS9 A;  2VKN A;  3THK A;  2HBW A;  1UEB A;  2KRS A;  2DTH A;  2PTK A;  5LJ3 j;  2EJF A;  4R56 A;  2AK5 A;  4M7A C;  3C95 A;  3SWN A;  4P5N A;  4FCY A;  3M56 A;  4M7A G;  2JTF A;  3HSB A;  3GBQ A;  2LP5 A;  2I0N A;  3O8V A;  2BZX A;  1AT1 B;  4FIB A;  4XTZ A;  2M0O A;  2DEQ A;  1K0S A;  2VVK A;  1Q82 U;  1KD1 C;  1OPL A;  1WNL A;  1RAD B;  2COW A;  2OTJ Q;  5CKF A;  2JXB A;  1RAI B;  4IUT A;  3ASK A;  4IUR A;  4OB0 B;  4OMM A;  3HL8 A;  1Y71 A;  2LJ1 A;  2YUP A;  2QQS A;  3HFO A;  4C92 G;  2K4Y A;  3RKY A;  5GMK i;  2P84 A;  2RB6 A;  1M1F A;  3CXC P;  3UAT A;  3CC2 A;  1GFC A;  1PWT A;  2RHX A;  3LH0 A;  3V7C A;  5GAO q;  4BI8 B;  1VQ9 Q;  2JNG A;  5A0G A;  1VQ6 A;  2J7I A;  3QO3 A;  5CAI A;  1FXX A;  3EGD B;  4XTY A;  2MF2 A;  5GAN 7;  2J6K A;  2FO0 A;  1FMW A;  4C0F A;  3WVD B;  3A8H B;  3V7R A;  3ZBD A;  2JS0 A;  4OF1 A;  1JEG A;  3QJY A;  2YLC A;  4M77 F;  1QKX A;  3I56 Q;  3QG1 A;  1IHW A;  2O4X A;  3M4G A;  2NUT A;  3NGP A;  3PIO A;  4X9C A;  2QG9 B;  3QDR B;  5KYY B;  1B07 A;  1I5O B;  1BYM A;  2AKK A;  4RTV A;  4C0G A;  4M7A F;  5HK0 A;  2RQT A;  4PJO B;  2ZZD A;  2DL5 A;  1UE9 A;  1JBM A;  2YLB A;  3BFM A;  2J06 A;  4BE1 A;  2DXB A;  3MPU B;  3CCL Q;  1AD5 A;  1AOJ A;  3LGF A;  4KT0 E;  1WYX A;  4BAC A;  5HY6 A;  1QVF S;  3P8D A;  5GAM e;  1VQ8 T;  4ORZ A;  3CEY A;  1N9S A;  2HEQ A;  2DXC A;  2KK4 A;  4M77 A;  1NLP C;  5CK9 A;  2E5K A;  1QVG P;  3MEU A;  2JW4 A;  3OY9 A;  3CC4 Q;  4C92 F;  2CP5 A;  3EG9 B;  2QXF A;  1NJI U;  4B9X A;  4M7A A;  1YJ9 Q;  4M4Z A;  4C5H A;  4EPC A;  4Y92 A;  5DM7 R;  1AZG B;  4LDY A;  2CUB A;  1Q81 U;  2ZAE A;  5GAM j;  2OTL A;  1SEM A;  2X4J A;  3EFS A;  1X2K A;  4PJJ A;  2ZPG B;  1OPK A;  2E6N A;  3RIR A;  2EQM A;  4J9D A;  2MAM A;  2P4R A;  3CC7 T;  1ZLM A;  1JB0 E;  3CCQ T;  4HCB A;  3CMA T;  1SG5 A;  3QPH A;  4X34 A;  4CC2 A;  5HKC A;  4J9F A;  1NYF A;  3LX7 A;  1RUW A;  4JRI A;  2XK0 A;  1VQK T;  3QYG B;  3H41 A;  2LX9 A;  2DIG A;  4C8Q G;  1VQL A;  3VU3 C;  4Z02 A;  3HRS A;  1Q7Y U;  2EW3 A;  3UA7 A;  1EFN A;  2RJD A;  1WPY A;  3JCM X;  2XKO C;  4RG8 A;  1D0Z A;  1WHG A;  2PZ1 A;  4D6W A;  1ZSZ C;  2PQW A;  4GLM A;  4JJB A;  3OW2 P;  2FRW A;  4JRQ A;  4M7D G;  1WHJ A;  4KBM B;  3M4Y A;  2AZV A;  1D09 B;  2LQN A;  1KJW A;  4M75 B;  2HMA A;  1Y07 A;  3CD6 A;  2CRE A;  1YBY A;  4RCB A;  2K6D A;  3QZ5 B;  3VS3 A;  3MP1 A;  3SFM A;  2Y4X A;  1YNZ A;  2DK3 A;  3EH1 A;  2XHC A;  3OYJ A;  2R57 A;  2P0Q A;  3SB2 A;  1M8M A;  4RTX A;  3X26 B;  5ECA A;  2BUD A;  3ER0 A;  2FPD A;  2O31 A;  3X20 B;  2HL5 C;  5J39 A;  3OBW A;  3UWN A;  1ZBJ A;  1KC8 C;  2JMA A;  2LNH B;  3OYF A;  2X4X A;  1WXB A;  2OAU A;  1O75 A;  4OMO A;  1W2B A;  3L2Z A;  5FWC A;  2RHI A;  1BI3 A;  1IB8 A;  1VQ5 T;  2EYY A;  1KFZ A;  3CXC S;  2BIV A;  4M78 E;  4F7U G;  3CCV T;  1MMA A;  4N4I A;  3M0S A;  3LLR A;  2MWO A;  2L89 A;  2QAS A;  4FYV B;  4QQD A;  3VYG A;  4MMK A;  4C8Q F;  2DFU A;  4CC7 A;  2Z0W A;  1O9S A;  3G4S Q;  3EFO A;  1AHJ B;  3P8B B;  1E6G A;  1PSF A;  1TSF A;  3JCM h;  1KC8 U;  3H6Z A;  1VQ9 A;  2D6F A;  4A54 A;  1UHF A;  3CCJ T;  4BE0 A;  1QVP A;  5LJ5 h;  4JUV A;  4FT4 A;  5GJW B;  2QA4 Q;  1SSH A;  3MP8 A;  4XQ3 A;  5GAM h;  3I56 A;  4AG2 C;  1OZ2 A;  1VQ4 Q;  3PE0 A;  1Q81 R;  3QZ9 B;  2QEX A;  1VQM A;  1WJS A;  3EH2 A;  3VKI A;  2PNI A;  3MKD A;  5M9O A;  4DBQ A;  1TH7 A;  2LT1 A;  4ATO A;  1ZSZ A;  3CCL A;  2PVO B;  1YHQ T;  1QVG S;  3ZEH A;  3JB9 G;  1UHC A;  2WSF E;  4J83 A;  3H0I A;  4F7U F;  3CCU Q;  1KQ1 A;  2DBK A;  4KGV B;  5KYX A;  4ZGD B;  1VIE A;  3CC4 A;  1WGS A;  4RG2 A;  3EG3 A;  4DA4 A;  4DEX A;  3JCM f;  3CC2 T;  2OX7 A;  1NEB A;  1Z9Z A;  2W0Z A;  2K3X A;  1N5Z A;  1G3T A;  3OS1 A;  1YJ9 A;  3QJ6 A;  5LJ5 g;  1ABQ A;  1QVF A;  2VAS A;  4K11 A;  4LDV A;  2G3R A;  2C0T A;  2I2L A;  1VQ7 Q;  3N5B B;  5GAM g;  3HTR A;  4L59 A;  1BU1 A;  2M9U A;  1VQO Q;  1VQ6 T;  3G6E A;  5FRO A;  1OI1 A;  5L8R E;  3OYB A;  2PUO B;  3E1S A;  4F7U A;  1PNJ A;  3MEW A;  1WHK A;  3QUI A;  3TVT A;  2B86 A;  3KUF A;  1U1T A;  1QCO A;  5CKH A;  1GFD A;  2K79 A;  2O01 E;  3E9G A;  3OS0 A;  1NG2 A;  2QYZ A;  1KQS P;  4MDW A;  1IGU A;  1B7T A;  2KT8 A;  2EYZ A;  1SHF A;  5KYU A;  2JTM A;  2DX1 A;  3BW1 A;  2EWN A;  3OW2 S;  4OVA A;  4NL3 A;  2A08 A;  4HXJ A;  1EZZ B;  4PJM A;  1WJQ A;  1TXQ A;  2CP2 A;  4F14 A;  1UDL A;  2CYZ B;  2IG0 A;  3GIB A;  2ABL A;  1M5Q 1;  1AZE A;  2ED0 A;  4OML A;  1RAH B;  4C92 B;  4CRI A;  2F2V A;  4F04 B;  4MZT A;  1V29 B;  1JXM A;  1H92 A;  1RAG B;  2OTL T;  5IHI A;  4LDU A;  1KC8 R;  5EC7 A;  1HSQ A;  1PM3 A;  2KRO A;  4LXC A;  1K8A C;  2LCC A;  4PKC C;  2CZ7 B;  4QVZ A;  2X3W D;  3E2U A;  5KYW B;  5KE3 A;  1S72 Q;  3SDZ A;  2HSE B;  1NLO C;  5GAO n;  5IN1 A;  1Z9Q A;  1M3B A;  4II1 A;  1D0Y A;  3JV3 A;  4BDZ A;  3GF5 A;  2M51 A;  1VA7 A;  4J9B A;  2JVV A;  5FU6 B;  4JLI A;  1IO6 A;  2BE9 B;  4EMK B;  2NUZ A;  5D6X A;  3G4S A;  1MV0 B;  3V8L A;  2H3J A;  4ZGJ B;  2EYW A;  4ELZ C;  1VQP A;  1M90 U;  4FYY B;  1OZ3 A;  3CXC A;  1F1B B;  4RTW A;  3URG A;  1G5V A;  1GCP A;  1QQJ A;  4PJO D;  1NZ9 A;  2FZG B;  2D0N A;  3CD6 T;  1FX7 A;  4WF2 A;  1MMD A;  4D8K A;  1UFF A;  5GMK h;  4JLG A;  4M78 G;  2QA4 A;  4JJN K;  2GCX A;  3PVQ A;  2LT4 A;  5D6W A;  1Y96 A;  1WHL A;  5J26 A;  3OSS C;  4XTX A;  3OYM A;  1JJ2 A;  1I0C A;  2NLU A;  2CS7 A;  3UA6 A;  3NTK A;  2M16 A;  3UPU A;  2KSS A;  2QQ9 A;  4KH0 B;  3RER A;  2K57 A;  3TEE A;  2A3L A;  4OMQ A;  1WHH A;  1Q86 U;  2YDL A;  2CT4 A;  3H9N A;  5CVI A;  4FT2 A;  4R55 A;  3WVE B;  1X27 A;  2OAW A;  3CCU A;  1MGQ A;  1Y7X A;  1WXT A;  2DTO A;  3JB9 H;  4FSS A;  2OJ2 A;  1PD1 A;  1BB9 A;  1XNI A;  1M2V B;  5LJ3 e;  4E7L A;  2FRY A;  5IXB A;  1G3W A;  2LC4 A;  2JJ9 A;  4J6X A;  4C8Q B;  2ZPB B;  2A0F B;  2E4H A;  4OGC A;  2E41 A;  2M0Y A;  1VQ9 T;  4C0D B;  2X35 A;  3FLG A;  3JCM d;  1ZUU A;  4M7D B;  2DL8 A;  3PFS A;  4PJL A;  2GGR A;  4HT9 A;  3PVL A;  4M77 G;  3S6W A;  1UEC A;  4M78 F;  1KQS S;  5I21 A;  4QQ6 A;  3CBP A;  3I56 T;  2O88 A;  3I55 A;  1MMG A;  3JCM b;  2RK2 A;  1SSF A;  4DBH A;  3VV0 A;  2QEX T;  1VQM T;  5FW9 A;  2ZPE B;  1W6X A;  1PG5 B;  3PMT A;  1BBZ A;  1PC0 A;  3J80 E;  4M75 D;  2HQH A;  1M27 C;  4IUV A;  1VQN Q;  4IUP A;  1IRX A;  4A4F A;  3CCL T;  2LX7 A;  1YCS B;  3T9N A;  4RTU A;  3EGX B;  4B6M A;  4L5G A;  2DPP B;  3EAE A;  2E65 A;  2CP3 A;  4M78 A;  3LGL A;  2X4Y A;  3CPW A;  2RHU A;  3CC4 T;  4F7U B;  2GBQ A;  2EKH A;  1M9S A;  1OUL A;  1C0M A;  4XAX B;  2EYX A;  2VGM A;  2NUP A;  1YJ9 T;  2GNC A;  4AMC A;  2R5A A;  3FJ5 A;  1PSE A;  1WQ7 A;  4PFZ A;  2O9S A;  1KD1 U;  2VXE A;  4BY6 C;  4OGE A;  3G6E T;  1B34 A;  1M90 R;  4NL2 A;  5C0M A;  1X75 C;  1RLQ C;  1QW1 A;  3ME9 A;  5KYU B;  4E7J A;  3CCS Q;  4B9W A;  2KI7 A;  5GAN h;  3RKX A;  5GMK m;  3V7S A;  1TUD A;  1S72 A;  3VS7 A;  1U1S A;  2BZY A;  4XTW A;  4FYW B;  3IQL A;  1PRL C;  1HYO A;  3H0F A;  2LNV A;  4L6V 5;  1TUG B;  1IHV A;  5FRM A;  1FWZ A;  2H8H A;  3DLL A;  3L2V A;  2RA2 A;  3VYH B;  1HXD A;  2XIC A;  2P0K A;  3F70 A;  2RJF A;  1Q86 R;  1RAF B;  1GCQ C;  3PMI A;  1GRI A;  2RM4 A;  2DYB A;  2JOY A;  2DET A;  3TSZ A;  5I11 A;  1G83 A;  5J3B A;  1WX6 A;  1M1G A;  3JAM E;  3NTH A;  4LD9 K;  5GAN g;  2KAF A;  4J9C A;  2KXC A;  4KUD K;  2XMF A;  3QDF A;  2P4T A;  3LW5 E;  1OU9 A;  4AT1 B;  2VWF A;  1X2Q A;  4FW1 A;  3MEV A;  3MCA B;  2EQK A;  3EGU A;  3OYL A;  5LJ3 h;  2L0A A;  4M75 E;  2JM9 A;  2LMJ A;  4LDW A;  4KH1 B;  3VS0 A;  1AEY A;  1WXU A;  2RMO A;  2DL7 A;  4PLI A;  1RAB B;  4NOY A;  2FG0 A;  2H3E B;  2RJC A;  3BDL A;  2A28 A;  5CCA A;  4QQG A;  3G4S T;  2K3B A;  4XTU A;  1R77 A;  1Y96 B;  1VQP T;  1PRM C;  4QVC A;  4AFQ C;  2KYM A;  2HQE A;  1VQ8 Q;  4HCZ A;  1X6O A;  3CME T;  3M55 A;  1OU8 A;  3A8M B;  4X9D A;  2V8J A;  3NTI A;  4ZTF A;  5LJ3 g;  3HFN A;  4PFO A;  3L2U A;  3BY7 A;  3CQT A;  3VRY A;  3M0P A;  1KD1 R;  2A36 A;  1QP3 A;  2KT1 A;  4HVU A;  1JXO A;  3VS5 A;  2K7A A;  3OYC A;  3MEA A;  5CR2 A;  2DVJ A;  1JU5 C;  1VQN A;  1K1Z A;  3UF4 A;  2D0Q B;  1D3B B;  2F2X A;  2OTJ A;  4C92 D;  1AWW A;  2AKL A;  2M02 A;  3DB3 A;  2RHZ A;  4QKU A;  3A1P A;  1IZ6 A;  1B3Q A;  3HKS A;  4ESR A;  2LCL A;  2HD0 A;  1CSK A;  2V8K A;  4XU0 A;  4ZN1 A;  2Y90 A;  3J81 E;  5I2M A;  1VQK Q;  4RMO A;  2CSI A;  4E6R A;  9ATC B;  3M0Q A;  2M1H A;  2K2V A;  1KK7 A;  3SWN B;  4DBR A;  4BDY A;  4WTO B;  5GAN 6;  1UB4 A;  1M3C A;  4LN2 A;  2KY9 A;  2B8A A;  4JRP A;  3FB9 A;  5GAN 5;  2F1L A;  1ZSG A;  1OQK A;  1KHI A;  1YWP A;  3CCS A;  3PNW C;  4DOV A;  3OYG A;  3I55 T;  2E64 A;  3GNG A;  4A63 B;  1R0B G;  4M78 B;  1TUC A;  4PJO C;  4RUG A;  3M0T A;  2KRN A;  5FU7 B;  1UG1 A;  2PVD B;  4J9E A;  4PNO A;  2E3H A;  1W70 A;  2DBM A;  2FVU A;  2NUP B;  3JRZ A;  3NMZ C;  1S1N A;  3OYY A;  5D6Y A;  3KFV A;  4AFU C;  2IVW A;  3RNJ A;  8AT1 B;  1OX9 A;  3M5A A;  2ECZ A;  1H64 1;  5FLX E;  1VQ5 Q;  2HAX A;  1YJW Q;  2RN8 A;  1V76 A;  1K73 C;  2MOX A;  1UTI A;  2QK0 A;  2RQR A;  2QTX A;  5KCH A;  1BI2 A;  4A53 A;  2O4X B;  3A8L B;  5IHN A;  2DNU A;  2DE0 X;  2NUT B;  2SEM A;  3TQ7 P;  4XK8 E;  2C0I A;  2HSP A;  2GQV A;  3DKM A;  5LJ5 f;  3L2R A;  3M0R A;  1LPL A;  1MHN A;  5GAM f;  3RMS A;  1WJR A;  2GFA A;  2X9H A;  2EJ9 A;  4DEY A;  2AHJ B;  4BE2 A;  2EQI A;  3V8K A;  3CCJ Q;  1QCF A;  2XDP A;  1VYU A;  1K73 U;  4C8Q D;  4M77 B;  3X25 B;  4RKU E;  3OS2 A;  4NS5 A;  5GAO r;  2QAZ A;  1YN8 A;  7AT1 B;  4M7A B;  5GAN 4;  3TCJ A;  2RH2 A;  2RQV A;  2QQA A;  4M7D D;  1RI9 A;  1AWX A;  1OOT A;  4O5V A;  1W2B P;  2GTO A;  2K5I A;  3FIF A;  3LWH A;  1KQ2 A;  2FZK B;  2MPX C;  1HJD A;  1YHQ Q;  2VXF A;  2VGN A;  4MML A;  1G3Y A;  2XU8 A;  1NEG A;  4M75 C;  3QSU A;  3I35 A;  1BIA A;  2KE9 A;  2PVG B;  5KYY A;  1M2O A;  2ED1 A;  2BZ8 A;  2JMC A;  5IAY A;  3S3N A;  4TVR A;  2A7Y A;  2HCK A;  3CC2 Q;  2C06 A;  3X28 B;  3OYH A;  3M59 A;  3QYH B;  1J3T A;  1MMN A;  1RLP C;  2DMO A;  2EQJ A;  3RMQ A;  3FRN A;  2QGG A;  3CCM Q;  2HKN A;  2JS2 A;  4OB2 B;  2RI2 A;  4WCI A;  3OYK A;  4V2S A;  1VQ6 Q;  2DL4 A;  1OX8 A;  5CQY A;  1GXI E;  4IIM A;  3R6N A;  3EG9 A;  3RES A;  1PHT A;  3H0H A;  1TG0 A;  1TU0 B;  3EHR A;  2KBT A;  2QQR A;  3AHU A;  2YWW A;  2VC8 A;  3HPW A;  6AT1 B;  1FMK A;  5A0D A;  2A37 A;  3JCM J;  1VQL T;  1KSW A;  3QII A;  2LQK A;  4OP0 A;  1YIT Q;  3GPL A;  2ZPI B;  2ATC B;  3JCM V;  1VYT A;  4CC3 A;  1VQK A;  1K8A U;  4CC4 B;  4JDS A;  3CCR Q;  3TU4 K;  1YJN Q;  2MI6 A;  1SKU B;  2X3X D;  2CUD A;  3C12 A;  4HT8 A;  2C0O A;  4AFZ C;  1UGQ B;  4JRK A;  5I22 A;  1M1K C;  3QBY A;  4GBQ A;  4JJC A;  3L2Q A;  2DRK A;  2LDM A;  5EG2 A;  1T3L A;  3KXT A;  2YRD A;  2AIR B;  4XU3 A;  1T0H A;  3OMC A;  4MDX A;  2RQU A;  4QVD A;  1VQ4 A;  4BI3 A;  1X6B A;  2YHT A;  5CKE A;  1C1A A;  2LJ3 A;  3JB9 I;  3JB9 D;  2HL3 A;  5KH6 A;  3MO8 A;  1YCY A;  2KGT A;  3EFO B;  1XTD A;  4LNP A;  1YIJ Q;  1VQN T;  4DQ2 A;  1JQQ A;  2OTJ T;  4M75 A;  3G7Z A;  1NE8 A;  1WA7 A;  4A4E A;  4M7D E;  3GOX A;  1EX4 A;  4C5E A;  3GP8 A;  5HK3 A;  1LCK A;  2EIF A;  1K73 R;  1MND A;  3VUZ A;  4HKE A;  2KRM A;  5A0L A;  1VQ5 A;  4JJD A;  1YJW A;  1WIE A;  1RAA B;  4JZ3 A;  3MET A;  1QCN A;  2CP6 A;  3BE3 A;  2E5Q A;  3EFR A;  1QVG A;  1JO8 A;  4RTT A;  3FC3 A;  2QGF B;  1YWO A;  4HCK A;  2RO0 A;  2RJE A;  4ZGE B;  1PKT A;  3FEO A;  3M53 A;  2JTE A;  2EJG A;  1VQ7 A;  2DZC A;  3ZFJ A;  4KRT A;  1HD3 A;  1VQO A;  2WAC A;  3C94 A;  1I8F A;  2CH4 W;  5KYN A;  2XID A;  1UUE A;  4MZP A;  2R5M A;  1PKS A;  1ZSZ B;  1WQW A;  3VS1 A;  2EVR A;  1Q82 C;  5IXF A;  2L3P A;  2RI3 A;  3CCS T;  4OMP A;  2YUQ A;  4ME7 A;  1XOV A;  4XU2 A;  2NWM A;  2PU9 B;  2J6F A;  2F2W A;  2FL7 A;  5LJ5 d;  5KYX B;  2LZ6 B;  2COZ A;  2VV5 A;  1W2B S;  5GAM d;  3UDC A;  1QWE A;  4EMH A;  2QDL A;  2VYT A;  1HK9 A;  2E12 A;  2BTT A;  2DZ9 A;  1VOM A;  3R6O A;  4KUL A;  1QKW A;  1W1F A;  2WSC E;  4BD3 A;  3INZ A;  4JPB W;  2DD5 A;  4FW2 A;  3OA6 A;  4C5G A;  3C4S A;  2LTO A;  3PTA A;  3HP9 A;  4IUU A;  4XU1 A;  4GLK A;  3G71 Q;  2ZPH B;  1YHQ A;  2RNA A;  1NPP A;  4PLL A;  2QI2 A;  3REA B;  2LJ0 A;  4GY5 A;  4PJO E;  3OW2 A;  1WLP B;  1YI2 Q;  2CGH A;  2VB6 A;  1BK2 A;  2DRM A;  1E6H A;  3M0U A;  4C92 C;  1QWF A;  5GAN 8;  1V1C A;  3EG0 A;  1I5L A;  3RR6 A;  4A4K A;  1ZBX A;  3CCE Q;  1QMC A;  1K8A R;  2L3S A;  1WDX A;  3FJP A;  4E2F B;  3OYE A;  2CZ6 B;  5GAN 2;  1K76 A;  2GQI A;  1H3H A;  2RF0 A;  3CCM A;  3RDV A;  4QT7 A;  2SRC A;  3SHW A;  3QHS A;  1PD0 A;  5CIU A;  5D7U A;  2CP7 A;  1PCX A;  2XG8 D;  2K3Y A;  2QDY B;  1JJ2 P;  2IPO B;  1LNX A;  2HDA A;  5GJV B;  1IRE B;  1IGQ A;  1AVZ C;  3PT9 A;  5FU6 C;  4IIO A;  3JCM e;  2QEX Q;  1VQM Q;  1NJI C;  4EMK C;  4O6J A;  1WZO A;  2ROL A;  3CBM A;  3A8O B;  1BKB A;  1YIT A;  3EHQ A;  1Q81 C;  1SPK A;  4N0A C;  1M4Z A;  5DY9 A;  2MK5 A;  4IKF A;  3CCR A;  5LJ5 e;  2X4W A;  1NBE B;  4M78 D;  1YJN A;  1M1K R;  1UGV A;  2L2P A;  1E7O A;  2KR3 A;  1XQH A;  5KE2 A;  1UJY A;  2D8H A;  2DKG A;  2G6F X;  3ZL7 C;  3H8Z A;  3OSV A;  1X43 A;  1ZHI A;  1K4U S;  2O2O A;  2DIL A;  1ACM B;  1TOV A;  4FSX A;  5LL6 S;  5GAN f;  2FHD A;  2K5F A;  2VUB A;  1MUZ A;  2PUK B;  4LD6 A;  5LJ5 j;  3OB9 A;  2FPF A;  1CKB A;  4PFP A;  3G6E Q;  1BIB A;  5GAO p;  4D8D A;  2EAY A;  1Q7Y C;  1M30 A;  2YRC A;  4ANJ A;  2DEU A;  4OMN A;  3JB9 J;  1YIJ A;  1KG1 A;  3OYN A;  1LVK A;  1U3O A;  2WSE E;  2F69 A; 
#chains in the Genus database with same CATH homology
 2CP3 A;  2E4H A;  1TOV A;  2QK0 A;  1WHL A;  1IXD A;  2E3I A;  2E3H A;  2COZ A;  2HKQ B;  3TQ7 P;  2HQH A;  2MPX C;  1TXQ A;  2CP2 A;  2COW A;  1WHG A;  2M02 A;  2CP0 A;  2HL3 A;  1LPL A;  1WHJ A;  3RDV A;  1WHM A;  2HKN A;  4B6M A;  2CP6 A;  2HL5 C;  3E2U A;  1WHK A;  2CP5 A;  2Z0W A;  1WHH A;  2COY A;  2CP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...