3TQ7P

Eb1c/eb3c heterodimer in complex with the cap-gly domain of p150glued
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'LRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 1
molecule tags Protein binding
source organism Homo sapiens
publication title Interaction of mammalian end binding proteins with CAP-Gly domains of CLIP-170 and p150(glued).
pubmed doi rcsb
total genus 14
structure length 71
sequence length 71
chains with identical sequence Q
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 3tq7P00
3E2UA 1WHGA 2E3IA 2COZA 2E4HA 1LPLA 2CP7A 1WHJA 4B6MA 1WHMA 1WHKA 2CP2A 2CP6A 1TOVA 2COWA 2HQHA 2E3HA 2CP5A 2M02A 2COYA 2CP0A 2HL5C 1WHLA 3TQ7P 2CP3A 1IXDA 2Z0WA 2MPXC 1WHHA 2HKQB 2HL3A 2QK0A 3RDVA 2HKNA 1TXQA
chains in the Genus database with same CATH superfamily
1SSFA 1W4SA 2OX7A 4PJOB 1OEBA 4VUBA 2X3XD 1OU9A 2KMTA 2D6FA 2MAMA 1YN8A 4ELZC 2M0OA 4DBRA 5I2SA 4N0AA 4BI4A 1OULA 2RK1A 3CC7A 4LE9A 4BD3A 2PU9B 5DLQE 4MZTA 4XU0A 4M7DD 3TU4K 2EJFA 3OBWA 1KG1A 4PL6A 1BIAA 3E2UA 1Q81R 2XKOC 2JTEA 3QJYA 4C5HA 1E7OA 2X9HA 3RKWA 5FLXE 1K0XA 4JRKA 4E7ZA 4EMKA 1QWEA 2B86A 2JZ2A 3I5RA 4EIKA 5GMKh 3HRTA 3GNGA 2Y4XA 3M57A 3CC2A 3EGDA 2XIDA 4QW2A 4M77F 3ZFJA 3EG2A 1M1GA 1QVFS 4ZGEB 4J7FA 5L23A 1T0HA 2FRWA 2FPEA 1AZEA 2A37A 2V26A 4J9GA 4IUTA 3M5AA 2RQRA 5IT9E 1PSFA 2E5QA 1ABQA 4NL2A 4RTYA 2RI5A 4D8DA 1YIJQ 4M75F 3T9NA 3PIOA 3CCJT 3ME9A 2NUZA 3J7AF 1VQ4A 3UDCA 1MMAA 2YWWA 4KT0E 1K8AR 2DM1A 2P84A 2RQWA 2QTXA 3CCVA 2RN8A 5GAN4 1YITQ 2YRDA 1B7TA 5HKCA 1CKBA 4C8QB 1Z9QA 3VRZA 5GANh 4O6JA 4FSSA 2EJ9A 1BB9A 2ZPHB 3M0QA 3MCAB 1R0BG 2SRCA 2V1RA 1QQJA 2KT1A 3QYGB 4J9CA 4M7DE 5J26A 4F7UA 2KDSA 3OYHA 1AWJA 3CCVQ 3CCUA 1WHLA 2Z0WA 1M1FA 2IPOB 2AT1B 4D8KA 4A4KA 3LLRA 2AKLA 4HVUA 4PJOE 5LJ5j 4Y91A 1VQNT 4IURA 1M8VA 1QVPA 3CPWA 1YJNT 2DVJA 3CQTA 2IG0A 5CVIA 4C8QC 2DIGA 4PFPA 3JB9I 2VV5A 3EG1A 1WNLA 3PTAA 2DK3A 1VQMA 1H3ZA 3L2VA 3HTRA 1SHFA 3M9QA 1G3TA 5GMKe 2YUNA 1YJ9Q 2DXUA 4K11A 2L3QA 2QG9B 2DYBA 2DYIA 1SG5A 2JUFA 5FROA 3M53A 2OTJQ 1OPKA 2FHDA 2WSFE 2K3YA 3DLMA 4DQ2A 4CC4B 1KSWA 4RTVA 5KH6A 4OVAA 2DVEA 2DZCA 2X35A 4AFSC 2L0AA 4M75G 1X75C 5CKBA 3M55A 3VRYA 4KRTA 2D8HA 1R0CB 4E7HA 1WPYA 4X9CA 1X6BA 3HRSA 3RBBB 3META 2V8JA 3JB9F 3UF4A 1K9AA 1K9MR 1WHGA 2CGHA 1KC8C 4ZNXA 4C0DC 1KK7A 2CZ7B 3E1SA 3VUZA 1BIBA 2VWFA 4ZN3A 3V7RA 3FIFA 4NS5A 1Q82U 1T3LA 3LYIA 2ZGWA 3CC2Q 1VQOT 1AWWA 4DBQA 3NTHA 2DILA 3H9NA 5CQYA 4PFOA 4M78D 4M77B 2KNBB 1YI2T 1MUZA 1XOVA 1UDLA 2DAQA 4D6WA 1RAFB 1YFNA 4B9WA 1AEYA 1JO8A 1VQ9A 2CP0A 1NYGA 1PRLC 1W2BS 2IVWA 5LJ5e 3VYGA 4J6XA 4AG2C 1JU5C 1NEGA 5FWCA 2FZGB 1YWPA 2DTIA 5LJ5d 5GAMg 4ORZA 5L8RE 5LJ5f 3TSZA 1UTIA 4Y92A 3TEEA 2EKHA 4V2SA 3M4GA 5GAOl 3H0HA 1BCOA 3OMGA 1AZGB 1E6GA 1VYTA 1TUCA 1PM3A 3C0CA 2OTJT 3JB9H 4C5GA 2CP2A 4DA4A 3EGUA 1GBQA 5KCHA 2DL4A 1Q86R 1BBZA 4JS5A 2P0KA 3OW2P 2QI2A 1M90C 4R56A 1X2KA 3RKYA 5GJVB 3OYDA 4HCBA 2YUOA 2DL5A 1RL2A 3GLXA 4LD9K 2DO3A 3SDZA 4BUGA 4ZN1A 4M7AA 1AWXA 2FL7A 2KXCA 2COWA 1SPKA 2O9SA 4M75E 2A7YA 4AFUC 4F7UG 2KRSA 5IHIA 2PNIA 2EVRA 2P0QA 1X27A 3NTIA 2BZXA 3SHWA 1YJWT 1E6HA 1JJ2S 1MNEA 2PQWA 4HXJA 2M9UA 1VQ7Q 4E47A 1QVGS 4FW2A 2EQMA 4M7DB 1VIFA 1OPLA 3LX7A 1IHVA 3JB9J 3VJPA 3REBB 5CCAA 5KYYB 2OTLQ 2QYZA 2CH4W 4MZMA 4EMHA 3EGXA 4M7DG 5KYWB 1NE8A 2JXBA 3CCRQ 2ENMA 4GLMA 3KBGA 4YTLA 3D7SB 3PMIA 1G5VA 1ZHIA 4OB1B 1MGQA 2XU8A 3QIIA 1M3CA 2F2VA 1YIJT 2RK2A 1G8XA 4J9BA 3CXCP 4C8QE 5GMKl 1Y0MA 2A08A 5KCOA 4DOWA 2PUOB 2K5FA 4E6RA 4KGXB 3PE0A 5A0GA 3RESA 1MMGA 2F5KA 1SRLA 1D3BA 1D0ZA 3JCMW 3E9GA 1IB8A 4PJJA 3DB3A 2G3RA 1Y96A 2HD0A 1C6VX 2FYKA 2P4RA 2LJ0A 3L2ZA 2OTJA 3OYMA 2ROTA 4EMGA 2O9VA 1RAAB 2VUBA 4AFZC 1K0SA 1OYXA 4Q5WA 1WI7A 1OU8A 3CC7Q 4MDWA 3U23A 4OMFB 1NM7A 4OGEA 4JUVA 3CCQA 1V29B 2J06A 1RAGB 1ARKA 2JS0A 1ZA1B 2BUDA 3BY7A 2J6KA 2YUPA 3PIPA 4M7AB 2FPDA 1UB4A 3JCMQ 3KUFA 3GPLA 4HCCA 4J9FA 1WQ7A 4BE2A 3EG3A 2KSSA 2K5LA 4M77D 4M78B 4C92B 2FEIA 5CKEA 4BACA 3CC4Q 3RDVA 2EYWA 2BZ8A 2GFAA 3HPWA 3MEVA 3DLLA 1AHJB 2E3IA 4A53A 5FU6C 2E6ZA 3SD4A 4LUEA 2LNHB 5C0MA 2P4TA 3OYEA 2D1XA 2JTFA 1UECA 2YLBA 2RHYA 1QVFA 4RCBA 1JEGA 2HQXA 3I55Q 5CKDA 2VKNA 4XTWA 2FRYA 2DTHA 3CCMT 1XQHA 2GFUA 4CRIA 2M1HA 1SEMA 3R6NA 2RHIA 4N4HA 1M4ZA 4KGZB 2NLUA 4CC3A 4BY6B 1VQLA 5FW9A 1GCQC 1WLPB 1QKXA 3H41A 3A8MB 2DBKA 2I0NA 1RAIB 2KBTA 5FU7B 1VQ6A 3LWHA 4FW1A 1VQOQ 1XJWB 2DZ9A 4AMCA 2DTOA 1VYVA 1C0MA 2D9TA 2KYBA 3VS3A 4C92F 5CR2A 3NMZC 5KYWA 4PKCC 5J39A 3RKXA 1VQ5Q 2RNAA 2ZPBB 3QHSA 4XTUA 4MMLA 2QGGA 5KE3A 2E1HA 4M75C 2VYTA 4M7AG 2NUTA 2AZVA 2YRCA 5LJ3g 4HCKA 3LWIA 2G6FX 5HK3A 3CMEQ 3UA7A 1HD3A 1I1JA 2RI2A 4C0FA 5DLOA 4GY5A 4CI0C 1A0NB 4ESRA 3OS5A 3G71A 2K57A 1VQMT 4FT2A 1YJWA 1Y96B 5D6YA 1VQKA 3I56A 1N8RC 2CP5A 3O5ZA 1YJNA 2EWNA 4EMKB 2DA9A 4EPCA 3S3MA 2QEXA 1YJ9T 2J6OA 1B34A 3H0FA 2FVUA 2GQVA 3OYYA 3MPUB 2DIQA 2EYQA 1VQKQ 1VQ7A 2KR3A 5GAN6 5KYYA 3GNFB 2FPFA 2M02A 2COYA 4A4HA 1U3OA 3QDRB 3OSSC 3JCMX 3BFMA 1UGQB 3MP6A 1UEBA 4M4ZA 3G6EA 2MPXC 3F70A 3QPHA 1JRIA 1IZ6A 2EGCA 1PHTA 4LN2A 1N8RR 3CCQT 1TXQA 2XI9A 3MO8A 4F7UB 3S3OA 3JV3A 1N9SA 2XMFA 4CC2A 4OB3B 3LGLA 3SFMA 4J83A 1X01A 2ZPFB 1VQ4T 2EKOA 1YCSB 3EG9A 3KXTA 4IUVA 2DRMA 4OP0A 3G6ET 2ZPGB 1KQ1A 3WVEB 3UATA 2X4WA 4AT1B 2M0YA 4HCZA 1I5OB 3PVQA 4JRPA 5GAMe 4RG2A 3CCMQ 5IHKA 2COZA 2EGEA 4IUQA 1ZUKA 2K2VA 2RJFA 2V8KA 2D0QB 2RO0A 2DXBA 1VQ8A 1AWOA 4PFZA 1CSKA 5GAMd 2K4YA 4J6YA 4FYWB 2K3XA 1N8RU 3FJ5A 3X25B 4M77G 3VS4A 4PLLA 2LQWA 3CC2T 2QAZA 2YSQA 1MV0B 3N5BB 4M7AE 4M7AC 2CT3A 1VQ8Q 1VQPQ 1TOVA 1D1BA 1I07A 3FEOA 2YXYA 2E10A 5CIUA 1M1KR 4QT7A 1K73C 1RLQC 2HL5C 1D3BB 4PJOG 1EIFA 3A98A 1EFNA 3PMTA 3RIRA 3GF5A 1Q81U 2KI7A 2C0IA 3H0IA 2QA4A 2LVMA 5LJ3j 1ZLMA 3EHRA 4HVVA 1Q7YR 4Z02A 2HQEA 1ZSZB 4QQDA 4NL3A 1QW1A 2VC8A 1BCMA 2L3RA 1IHWA 3CXCS 2E65A 5GMKj 4IUPA 2AK5A 4XK8E 1C1AA 1H8KA 1NPRA 2QA4T 4RTUA 1QVGP 4E7SA 3V8LA 4J7IA 3A8HB 1XTDA 4HVWA 4M77C 3OYCA 1G2BA 4QKUA 3JCMg 4JDSA 3JAME 1U8RA 5LJ5g 4DOVA 3TREA 1WQWA 3JRZA 3LH5A 1RADB 1PD1A 2CP6A 2M51A 3OYLA 3INZA 5KE2A 2HBWA 5CQXA 1JXMA 3I55T 1Y71A 2NYSA 2D8JA 3PGGA 5GANd 2QQ9A 2NUPB 3MP1A 3L2QA 3MEWA 4N4GA 2YT6A 3CCLQ 2AKKA 2L89A 1IGUA 4KH0B 3RMSA 2RD1A 1VQLQ 1HJDA 3M0UA 3CC4A 1JQQA 2ZPIB 3ER0A 1KC8U 1QVFP 2JMAA 3CCUT 1J3TA 1M1KU 2H3JA 4OMOA 4RTTA 2L3SA 3J81E 1WJSA 2VGMA 3JCMV 1M27C 2A0FB 4RTWA 1X6OA 1NG2A 5GANf 3CCLA 1Q7YC 3L2UA 4LDWA 2AZSA 1AD5A 2GCXA 2XDPA 4II1A 3VS2A 3SWNB 1QCFA 4FM4B 1ZBJA 3P8BB 5GAN3 2JOYA 2R58A 1ZBXA 3MHXA 1VA7A 4ELYC 4HT9A 4C92D 2ESWA 3G7ZA 1QVGA 1VQ7T 4C8QG 3CC4T 5M9OA 2I2LA 1KQSS 3CXCA 4PJOA 9ATCB 4IIMA 3M59A 3OYNA 2CUDA 1K76A 1S72Q 3CD6T 2JNGA 1GBRA 2RF0A 1VQPT 3CCJA 4BE0A 4PJOF 1IGQA 2LX9A 2KVQG 3VYHB 2X3WD 1VUBA 2QQRA 3BDUA 3RR6A 2RQVA 2OJ2A 4KUDK 2HCKA 4BDYA 1RAEB 4L5GA 1WYXA 5LJ3e 3V8JA 2JS2A 3VKIA 2VASA 3P8HA 2CT4A 2DETA 1DJ7B 5IHNA 4M78C 1HYOA 2QA4Q 5LJ3f 4IIOA 1YP5A 3CCRA 3X28B 4F14A 3M0SA 5KYXB 3CEYA 1NYFA 4J8OA 4RTZA 2RJDA 2XK0A 1SSHA 2EQIA 5IXBA 1T3SA 4XU2A 3WXMB 4HT8A 1ZSZC 1I0CA 2BKDN 2XDDA 1YIJA 1WZOA 3PVLA 1B07A 4FIBA 3QYHB 3S3NA 3KFVA 4J9DA 1EX4A 1LPLA 1B34B 1WDXA 1UGPB 2JJ9A 2MYSA 5EG2A 2E3HA 2QTVA 2LDMA 3M58A 1NJIR 4A63B 2ZCFB 1N9RA 2O31A 2K2MA 2LCLA 3QBYA 2CSQA 3BDLA 1IREB 1YITA 1JJ2P 4A4FA 5HY6A 4XAXB 1VQ8T 5GANe 1OX9A 3S6WA 3OYJA 2WSEE 4B6MA 1K8AC 4C8QA 1VQ6T 4M75B 3JB9D 3CPWS 2HBPA 4RG8A 2NUPA 2DXCA 2YDLA 2CH4A 4PJOC 1WJQA 2MMPA 1NPPA 4PJOD 2XD0A 2KRNA 4DBFA 4M77A 2MWPA 2BIVA 2RA2A 2HL3A 2K3BA 3EG9B 3RUXA 3A1PA 3UWNA 4ZGJB 5GANg 1S72T 1BYMA 3REAB 1T0JA 4AG1C 4M78E 1I5LA 1UHFA 1UJYA 2EYXA 3FLGA 1MMNA 1N6AA 3MKDA 4DBHA 2DJQA 4BY6C 1ZSZA 2CREA 3JCMd 2DL8A 2LP5A 3OW2S 3EH2A 5FU6B 2O2OA 3NFCA 2QQAA 5GAMh 3MEAA 1PNJA 2EQKA 4F7UF 4WF2A 2KE9A 5KYXA 1FMVA 2RM4A 4E7JA 2QXFA 2F2XA 4OMNA 4XU3A 3DKMA 3JCMP 2X4YA 4M77E 3O8VA 2ZPEB 2HZYA 3JCMb 1RACB 5LJ5h 3G4ST 2EQUA 2YRVA 1KJWA 2FZCB 4DEXA 5D7UA 1HXDA 5FRMA 3HKSA 4PNOA 1EZZB 2WACA 2CYZB 1GL5A 3VU3C 2R57A 5AT1B 4AFQC 4N0AC 1XNIA 3QO3A 1FYNA 3R6OA 3QDFA 4R0KA 2O4XA 1VQ9T 1YJ9A 4ZGDB 1KFZA 2XHCA 2HNIA 1O75A 4LDVA 1WJRA 1ZUUA 3MP8A 1OZ3A 2J6FA 2QASA 1RUWA 3OYIA 1R77A 4BE1A 3C12A 1KHIA 3CD6Q 1HSQA 2DF6A 3M0RA 4JLIA 1SRMA 3G71T 2L3PA 2CSIA 1D1AA 1X2QA 1I8FA 2HSEB 3OSVA 2GTOA 3OBYA 3CMEA 4P5NA 4OMMA 2F69A 1GCQA 1WXBA 1UJ0A 1LOJA 1FMKA 1YWOA 2H8HA 4PJNA 4MDXA 3CBMA 1MHNA 1PSEA 1NEBA 1UUEA 2HKQB 2LNVA 5CK9A 3E19A 3HP9A 2GGRA 1RABB 4JRQA 2E12A 4PJLA 4J9IA 3SWNA 1OX8A 1YHQA 2M16A 2KAFA 1M90R 4Y28E 1Q81C 1ZA2B 2DBMA 4RMOA 1IXDA 3HFNA 2ABLA 2VB6A 2YLCA 2DX1A 2NWMA 1Q86U 2VVKA 2ZZDA 1FXXA 2CS7A 3EHQA 2EFIA 5I21A 1YJNQ 2J7IA 1Y57A 1FMWA 2A3LA 2XG8D 3V7SA 1I81A 2CP3A 1MMDA 1Q82C 2B8AA 1BU1A 1ZUYA 1WHHA 3OB9A 4XQ3A 3CPWP 3TSWA 4M78G 1D0XA 1YCYA 3G4SA 1AVZC 3CCRT 3SEMA 4JJNK 3I9QA 5I11A 1FWZA 1TUDA 1PWTA 1UGSB 5LJ3d 2D0NA 1Q86C 1ACMB 1ZSGA 4M7AD 4IUUA 4C0ZA 2KQWA 4QVCA 3MEUA 1W1FA 3ULRB 1TWBA 4LNPA 3EH1A 1QCNA 4KH1B 1TSFA 1ZX6A 1K8AU 3BE3A 4HA8A 2LTOA 2X51A 4FYXB 4XTZA 2KK4A 4RTXA 3G71Q 4X1VA 4FT4A 4C92G 3JCMh 3OS0A 1MV3A 2HDAA 5IH2A 2OTLA 1VQPA 3CCLT 3EG0A 2RMOA 4QVDA 1W6XA 2YHTA 3QJ6A 1M2VB 4NOYA 3A5ZB 2RPNA 5CO7A 3QZ5B 2ROLA 2E6NA 5GAOn 2HAXA 4FYYB 2QGFB 1QCOA 1WXUA 3GP8A 4HKEA 3HFOA 2XDBA 3E9FA 2K79A 3JCMf 1YI2A 1NBEB 3H8ZA 4C8QD 3OQ5A 2JMCA 1OV3A 2RH2A 1UE9A 2GBQA 2QQSA 4WTOB 3CMAT 4FSXA 1D0YA 1VQOA 5GAN7 2C0OA 4C0DB 5GAMj 2K5IA 2OAUA 1H92A 3DB4A 2LQKA 3RNJA 2X4XA 4GLKA 1BI2A 3J80E 2DE0X 3VUBA 1G3WA 4OGCA 5KYNA 2MI6A 3EAEA 1VQ9Q 1GCPA 1YBYA 2K7AA 2DL7A 2DERA 3JCMJ 4BB7A 5GAN5 2RJCA 1M8MA 1GFCA 4M78F 5FWBA 5D6XA 4FCYA 4KGVB 4J9EA 3OYGA 2BTTA 1H3HA 4JZ4A 2W10A 4WCIA 1K9MU 4FL6A 3QZ9B 3EGDB 2O4XB 1R8OB 2DFUA 3G6EQ 1QWFA 1QLYA 1VQ4Q 4E7IA 2V8IA 2JVVA 3VS7A 4C92A 2GQIA 5A2QE 3I35A 2LMJA 3OYBA 4EDUA 3OA6A 1KQSA 2ED1A 2KT8A 1AT1B 1N5ZA 1TTHB 3EFOB 3VS6A 4A4EA 1PKTA 1BI1A 4CC7A 1TU0B 1PC0A 5FRNA 1LCKA 3RERA 2KROA 3CMAA 3CBPA 4MMKA 2YUQA 4XU1A 1GXIE 1M3BA 1LJOA 3X24B 2LCSA 1VQNA 2K6DA 4C92E 4ANJA 1Z9ZA 3A8GB 1V1CA 5GANj 2CUBA 3M56A 3HHTB 5GAOr 3CCET 3C95A 5GAOp 1IRXA 1TS9A 1JBMA 2AHJB 2RHXA 2JM9A 2LZ6B 1KQ2A 2R5AA 4JPBW 2DL3A 4QQGA 1QKWA 4XTXA 3I5SA 3M54A 3PT9A 1QMCA 4A54A 5ECAA 1NJIC 4E2FB 1OQKA 4J9HA 2RB6A 1VQMQ 5GMKi 3EGXB 5C6SA 2VXFA 4ATOA 3LW5E 4RUGA 3X26B 1UGVA 4OMPA 5CAIA 2QDLA 3JCMe 1KD1C 1WX6A 2L2PA 2E41A 3GOXA 1M2OA 1ZQ1A 3L2WA 1UHCA 3VS0A 3LGFA 2RI3A 2KGTA 3JB9G 3CCEA 2EJGA 2PVGB 2QEXT 3JSCA 2OTLT 2KXDA 1P92A 1RI0A 2EW3A 2LJ1A 3I56T 3URGA 4PLIA 1YNZA 1Q82R 4PJMA 1M9SA 2PUKB 3NHNA 3V7CA 2IIMA 4X34A 4EMKC 1VIEA 1X43A 4LD6A 2DJZA 1YHQQ 4QVZA 1I4K1 5DM7R 3EFRA 4J5YA 3QG1A 2HMAA 2O88A 2CKKA 1UFFA 5IN1A 2RJEA 3VV0A 1RLPC 4UC4A 1JB0E 3ASKA 4OMLA 2KRMA 1PD0A 4F7UE 3RMQA 1OZ2A 3OMCA 2FB7A 2ATCB 4LDYA 4TVRA 4DEYA 1U1SA 2GTJA 2DEQA 2V1QA 5GAOm 2MK5A 4OB2B 3CC7T 1TG0A 1B3QA 4PK4A 2PVOB 3G1JA 2E4HA 4C8QF 4LDUA 2BE9B 4KBMB 2X4JA 3SWNC 3EFSA 5GAN2 1HK9A 3M4YA 1VQ6Q 3AHUA 2BE7D 1WIEA 2A36A 1Q7YU 1SF9A 1YI2Q 2GNCA 1G3YA 1YHQT 1SKUB 4JJCA 2H3EB 1M30A 3OS2A 5FU7C 2L5QA 5J3BA 4F16A 6AT1B 4C0GA 2EQJA 1N27A 2EGAA 3CCSQ 1M1KC 3CCMA 3L42A 1S1NA 1F1BB 2DNUA 2HEQA 5IAYA 5CKHA 1NLPC 5A0LA 4LXCA 1K1ZA 4LUDA 2DPPB 3TQ7P 4BDZA 2C06A 4KUIA 2DRKA 3CMAQ 1TUGB 3HSBA 2MWOA 3CCVT 4OB0B 2CDTA 3HL8A 2LT4A 2HKNA 2XICA 4L6V5 5I2MA 2ECZA 3OYKA 3TVTA 4JZ3A 2DLPA 3QKJA 3X20B 4OF1A 2MCNA 1H641 1YJWQ 3FB9A 1QP3A 3C4SA 3QWXX 4O5VA 2GF7A 5LJ3h 1U5SA 1WA7A 4JLGA 3QSUA 2Y90A 4OMQA 3V8KA 5CKFA 4JRIA 2FG0A 3NPFA 3UA6A 1FX7A 1D09B 1GRIA 2NUTB 5KYUB 2K9GA 1M5Q1 1Q95G 2F1LA 2LQNA 3MJXA 4C92C 4M7DF 4JS4A 3C94A 2EYZA 2FO0A 1AOJA 1CKAA 2EBPA 3EFOA 3VS5A 3WVDB 2LJ3A 2LX7A 2RQTA 1K73U 2JTMA 2PTKA 2DXTA 2W0ZA 2RHUA 1W70A 2VGNA 3LH0A 2BZYA 1IO6A 1WGSA 4E7KA 4LDXA 4M78A 4Z8AA 8AT1B 3NTKA 5GAOq 5A0DA 3ZL7C 4JJBA 3M0TA 1WHMA 1WHKA 2EPDA 3IQLA 5GMKm 2R5MA 1X6GA 3THKA 3FC3A 1VQNQ 1NLOC 5HCKA 2C0TA 1OOTA 2MOXA 4RKUE 2F2WA 1VYUA 3ZEHA 3L2RA 1MNDA 3CCQQ 2QEXQ 1VQKT 2WSCE 2CZ1B 4M7DA 4FU6A 1KHCA 4B9XA 1PRMC 5D6WA 3CCUQ 1KD1U 5AYFA 3CCST 2KYMA 1BKBA 2QDYB 2OAWA 3PFSA 4JJDA 4N4IA 2LCCA 4GBQA 2LT1A 4F17A 2ED0A 1YITT 2EIFA 2QK0A 2HSPA 1NJIU 3CCSA 2SEMA 2EYYA 2JW4A 4Z89A 3G4SQ 3OYAA 2CZ0B 3AT1B 3PNWC 1VQLT 2L8DA 1SHGA 4M75D 1LNXA 5HK0A 3OYFA 2Y4YA 5GAMf 3GBQA 4XTYA 4ZTFA 4A4GA 1ABOA 4M7DC 1KQSP 3OY9A 2DD5A 1VQ5A 2DMOA 2LQ8A 1BI3A 3Q1JA 1QP2A 2CP7A 3CMET 3FDRA 5KYUA 2KY9A 3JCMc 4ME7A 2PZ1A 4FYVB 1O9SA 5IXFA 3M0PA 5EC7A 2F5TX 1K73R 4XTVA 1PKSA 2DKGA 3L1AA 1BK2A 2O01E 3SB2A 4C5EA 2OI3A 1PG5B 4KULA 1KIKA 1W2BP 2DD4A 2RQUA 1KD1R 3BW1A 2JN0A 2ZAEA 2KEAA 1K4US 1TH7A 3I56Q 3HRUA 1JJ2A 2RHZA 4J6WA 2CZ6B 1WFWA 3CCJQ 1K9MC 2E70A 2EAYA 1U06A 3QWYA 4RCCA 1RAHB 2QQBA 3H6ZA 4BI3A 4QQ6A 3GIBA 1G3SA 3VS1A 1RI9A 1M2VA 3UT1A 2AIRB 4Z88A 3CBOA 3FRNA 3NGPA 2JT4A 1WXTA 1UGRB 2PVDB 4C5IA 3OW2A 4M7AF 4BI8B 5GJWB 1UG1A 2A28A 2MIOA 7AT1B 3FJPA 3OS1A 3CCEQ 1GFDA 1WHJA 1Y7XA 2LC4A 1OI1A 2JM8A 1BI0A 3CD6A 1M3AA 2DEUA 2HQHA 1NZ9A 2E5KA 5LL6S 1U1TA 1W2BA 5I22A 1Y07A 2P0PA 1VQ5T 1JXOA 4M75A 5DY9A 1KC8R 3A8LB 4ZTJA 3CPFA 1S72A 3TCJA 4X9DA 2J05A 1X69A 3P8DA 4F04B 2MF2A 3UPUA 4IKFA 1LVKA 3QUIA 3QXEB 3I55A 8ATCB 2E64A 1G83A 2FZKB 3ZBDA 1M90U 1PCXA 5GAN8 1D1CA 2VXEA 4L59A 1V76A 3A8OB 4MZPA 2LRQA 1VOMA 4E7LA 4R55A
chains in the Genus database with same CATH topology
3E2UA 1WHGA 2E3IA 2COZA 2E4HA 1LPLA 2CP7A 1WHJA 4B6MA 1WHMA 1WHKA 2CP2A 2CP6A 1TOVA 2COWA 2HQHA 2E3HA 2CP5A 2M02A 2COYA 2CP0A 2HL5C 1WHLA 3TQ7P 2CP3A 1IXDA 2Z0WA 2MPXC 1WHHA 2HKQB 2HL3A 2QK0A 3RDVA 2HKNA 1TXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2U A;  1WHG A;  2E3I A;  2COZ A;  2E4H A;  1LPL A;  2CP7 A;  1WHJ A;  4B6M A;  1WHM A;  1WHK A;  2CP2 A;  2CP6 A;  1TOV A;  2COW A;  2HQH A;  2E3H A;  2CP5 A;  2M02 A;  2COY A;  2CP0 A;  2HL5 C;  1WHL A;  3TQ7 P;  2CP3 A;  1IXD A;  2Z0W A;  2MPX C;  1WHH A;  2HKQ B;  2HL3 A;  2QK0 A;  3RDV A;  2HKN A;  1TXQ A; 
#chains in the Genus database with same CATH topology
 1SSF A;  1W4S A;  2OX7 A;  4PJO B;  1OEB A;  4VUB A;  2X3X D;  1OU9 A;  2KMT A;  2D6F A;  2MAM A;  1YN8 A;  4ELZ C;  2M0O A;  4DBR A;  5I2S A;  4N0A A;  4BI4 A;  1OUL A;  2RK1 A;  3CC7 A;  4LE9 A;  4BD3 A;  2PU9 B;  5DLQ E;  4MZT A;  4XU0 A;  4M7D D;  3TU4 K;  2EJF A;  3OBW A;  1KG1 A;  4PL6 A;  1BIA A;  3E2U A;  1Q81 R;  2XKO C;  2JTE A;  3QJY A;  4C5H A;  1E7O A;  2X9H A;  3RKW A;  5FLX E;  1K0X A;  4JRK A;  4E7Z A;  4EMK A;  1QWE A;  2B86 A;  2JZ2 A;  3I5R A;  4EIK A;  5GMK h;  3HRT A;  3GNG A;  2Y4X A;  3M57 A;  3CC2 A;  3EGD A;  2XID A;  4QW2 A;  4M77 F;  3ZFJ A;  3EG2 A;  1M1G A;  1QVF S;  4ZGE B;  4J7F A;  5L23 A;  1T0H A;  2FRW A;  2FPE A;  1AZE A;  2A37 A;  2V26 A;  4J9G A;  4IUT A;  3M5A A;  2RQR A;  5IT9 E;  1PSF A;  2E5Q A;  1ABQ A;  4NL2 A;  4RTY A;  2RI5 A;  4D8D A;  1YIJ Q;  4M75 F;  3T9N A;  3PIO A;  3CCJ T;  3ME9 A;  2NUZ A;  3J7A F;  1VQ4 A;  3UDC A;  1MMA A;  2YWW A;  4KT0 E;  1K8A R;  2DM1 A;  2P84 A;  2RQW A;  2QTX A;  3CCV A;  2RN8 A;  5GAN 4;  1YIT Q;  2YRD A;  1B7T A;  5HKC A;  1CKB A;  4C8Q B;  1Z9Q A;  3VRZ A;  5GAN h;  4O6J A;  4FSS A;  2EJ9 A;  1BB9 A;  2ZPH B;  3M0Q A;  3MCA B;  1R0B G;  2SRC A;  2V1R A;  1QQJ A;  2KT1 A;  3QYG B;  4J9C A;  4M7D E;  5J26 A;  4F7U A;  2KDS A;  3OYH A;  1AWJ A;  3CCV Q;  3CCU A;  1WHL A;  2Z0W A;  1M1F A;  2IPO B;  2AT1 B;  4D8K A;  4A4K A;  3LLR A;  2AKL A;  4HVU A;  4PJO E;  5LJ5 j;  4Y91 A;  1VQN T;  4IUR A;  1M8V A;  1QVP A;  3CPW A;  1YJN T;  2DVJ A;  3CQT A;  2IG0 A;  5CVI A;  4C8Q C;  2DIG A;  4PFP A;  3JB9 I;  2VV5 A;  3EG1 A;  1WNL A;  3PTA A;  2DK3 A;  1VQM A;  1H3Z A;  3L2V A;  3HTR A;  1SHF A;  3M9Q A;  1G3T A;  5GMK e;  2YUN A;  1YJ9 Q;  2DXU A;  4K11 A;  2L3Q A;  2QG9 B;  2DYB A;  2DYI A;  1SG5 A;  2JUF A;  5FRO A;  3M53 A;  2OTJ Q;  1OPK A;  2FHD A;  2WSF E;  2K3Y A;  3DLM A;  4DQ2 A;  4CC4 B;  1KSW A;  4RTV A;  5KH6 A;  4OVA A;  2DVE A;  2DZC A;  2X35 A;  4AFS C;  2L0A A;  4M75 G;  1X75 C;  5CKB A;  3M55 A;  3VRY A;  4KRT A;  2D8H A;  1R0C B;  4E7H A;  1WPY A;  4X9C A;  1X6B A;  3HRS A;  3RBB B;  3MET A;  2V8J A;  3JB9 F;  3UF4 A;  1K9A A;  1K9M R;  1WHG A;  2CGH A;  1KC8 C;  4ZNX A;  4C0D C;  1KK7 A;  2CZ7 B;  3E1S A;  3VUZ A;  1BIB A;  2VWF A;  4ZN3 A;  3V7R A;  3FIF A;  4NS5 A;  1Q82 U;  1T3L A;  3LYI A;  2ZGW A;  3CC2 Q;  1VQO T;  1AWW A;  4DBQ A;  3NTH A;  2DIL A;  3H9N A;  5CQY A;  4PFO A;  4M78 D;  4M77 B;  2KNB B;  1YI2 T;  1MUZ A;  1XOV A;  1UDL A;  2DAQ A;  4D6W A;  1RAF B;  1YFN A;  4B9W A;  1AEY A;  1JO8 A;  1VQ9 A;  2CP0 A;  1NYG A;  1PRL C;  1W2B S;  2IVW A;  5LJ5 e;  3VYG A;  4J6X A;  4AG2 C;  1JU5 C;  1NEG A;  5FWC A;  2FZG B;  1YWP A;  2DTI A;  5LJ5 d;  5GAM g;  4ORZ A;  5L8R E;  5LJ5 f;  3TSZ A;  1UTI A;  4Y92 A;  3TEE A;  2EKH A;  4V2S A;  3M4G A;  5GAO l;  3H0H A;  1BCO A;  3OMG A;  1AZG B;  1E6G A;  1VYT A;  1TUC A;  1PM3 A;  3C0C A;  2OTJ T;  3JB9 H;  4C5G A;  2CP2 A;  4DA4 A;  3EGU A;  1GBQ A;  5KCH A;  2DL4 A;  1Q86 R;  1BBZ A;  4JS5 A;  2P0K A;  3OW2 P;  2QI2 A;  1M90 C;  4R56 A;  1X2K A;  3RKY A;  5GJV B;  3OYD A;  4HCB A;  2YUO A;  2DL5 A;  1RL2 A;  3GLX A;  4LD9 K;  2DO3 A;  3SDZ A;  4BUG A;  4ZN1 A;  4M7A A;  1AWX A;  2FL7 A;  2KXC A;  2COW A;  1SPK A;  2O9S A;  4M75 E;  2A7Y A;  4AFU C;  4F7U G;  2KRS A;  5IHI A;  2PNI A;  2EVR A;  2P0Q A;  1X27 A;  3NTI A;  2BZX A;  3SHW A;  1YJW T;  1E6H A;  1JJ2 S;  1MNE A;  2PQW A;  4HXJ A;  2M9U A;  1VQ7 Q;  4E47 A;  1QVG S;  4FW2 A;  2EQM A;  4M7D B;  1VIF A;  1OPL A;  3LX7 A;  1IHV A;  3JB9 J;  3VJP A;  3REB B;  5CCA A;  5KYY B;  2OTL Q;  2QYZ A;  2CH4 W;  4MZM A;  4EMH A;  3EGX A;  4M7D G;  5KYW B;  1NE8 A;  2JXB A;  3CCR Q;  2ENM A;  4GLM A;  3KBG A;  4YTL A;  3D7S B;  3PMI A;  1G5V A;  1ZHI A;  4OB1 B;  1MGQ A;  2XU8 A;  3QII A;  1M3C A;  2F2V A;  1YIJ T;  2RK2 A;  1G8X A;  4J9B A;  3CXC P;  4C8Q E;  5GMK l;  1Y0M A;  2A08 A;  5KCO A;  4DOW A;  2PUO B;  2K5F A;  4E6R A;  4KGX B;  3PE0 A;  5A0G A;  3RES A;  1MMG A;  2F5K A;  1SRL A;  1D3B A;  1D0Z A;  3JCM W;  3E9G A;  1IB8 A;  4PJJ A;  3DB3 A;  2G3R A;  1Y96 A;  2HD0 A;  1C6V X;  2FYK A;  2P4R A;  2LJ0 A;  3L2Z A;  2OTJ A;  3OYM A;  2ROT A;  4EMG A;  2O9V A;  1RAA B;  2VUB A;  4AFZ C;  1K0S A;  1OYX A;  4Q5W A;  1WI7 A;  1OU8 A;  3CC7 Q;  4MDW A;  3U23 A;  4OMF B;  1NM7 A;  4OGE A;  4JUV A;  3CCQ A;  1V29 B;  2J06 A;  1RAG B;  1ARK A;  2JS0 A;  1ZA1 B;  2BUD A;  3BY7 A;  2J6K A;  2YUP A;  3PIP A;  4M7A B;  2FPD A;  1UB4 A;  3JCM Q;  3KUF A;  3GPL A;  4HCC A;  4J9F A;  1WQ7 A;  4BE2 A;  3EG3 A;  2KSS A;  2K5L A;  4M77 D;  4M78 B;  4C92 B;  2FEI A;  5CKE A;  4BAC A;  3CC4 Q;  3RDV A;  2EYW A;  2BZ8 A;  2GFA A;  3HPW A;  3MEV A;  3DLL A;  1AHJ B;  2E3I A;  4A53 A;  5FU6 C;  2E6Z A;  3SD4 A;  4LUE A;  2LNH B;  5C0M A;  2P4T A;  3OYE A;  2D1X A;  2JTF A;  1UEC A;  2YLB A;  2RHY A;  1QVF A;  4RCB A;  1JEG A;  2HQX A;  3I55 Q;  5CKD A;  2VKN A;  4XTW A;  2FRY A;  2DTH A;  3CCM T;  1XQH A;  2GFU A;  4CRI A;  2M1H A;  1SEM A;  3R6N A;  2RHI A;  4N4H A;  1M4Z A;  4KGZ B;  2NLU A;  4CC3 A;  4BY6 B;  1VQL A;  5FW9 A;  1GCQ C;  1WLP B;  1QKX A;  3H41 A;  3A8M B;  2DBK A;  2I0N A;  1RAI B;  2KBT A;  5FU7 B;  1VQ6 A;  3LWH A;  4FW1 A;  1VQO Q;  1XJW B;  2DZ9 A;  4AMC A;  2DTO A;  1VYV A;  1C0M A;  2D9T A;  2KYB A;  3VS3 A;  4C92 F;  5CR2 A;  3NMZ C;  5KYW A;  4PKC C;  5J39 A;  3RKX A;  1VQ5 Q;  2RNA A;  2ZPB B;  3QHS A;  4XTU A;  4MML A;  2QGG A;  5KE3 A;  2E1H A;  4M75 C;  2VYT A;  4M7A G;  2NUT A;  2AZV A;  2YRC A;  5LJ3 g;  4HCK A;  3LWI A;  2G6F X;  5HK3 A;  3CME Q;  3UA7 A;  1HD3 A;  1I1J A;  2RI2 A;  4C0F A;  5DLO A;  4GY5 A;  4CI0 C;  1A0N B;  4ESR A;  3OS5 A;  3G71 A;  2K57 A;  1VQM T;  4FT2 A;  1YJW A;  1Y96 B;  5D6Y A;  1VQK A;  3I56 A;  1N8R C;  2CP5 A;  3O5Z A;  1YJN A;  2EWN A;  4EMK B;  2DA9 A;  4EPC A;  3S3M A;  2QEX A;  1YJ9 T;  2J6O A;  1B34 A;  3H0F A;  2FVU A;  2GQV A;  3OYY A;  3MPU B;  2DIQ A;  2EYQ A;  1VQK Q;  1VQ7 A;  2KR3 A;  5GAN 6;  5KYY A;  3GNF B;  2FPF A;  2M02 A;  2COY A;  4A4H A;  1U3O A;  3QDR B;  3OSS C;  3JCM X;  3BFM A;  1UGQ B;  3MP6 A;  1UEB A;  4M4Z A;  3G6E A;  2MPX C;  3F70 A;  3QPH A;  1JRI A;  1IZ6 A;  2EGC A;  1PHT A;  4LN2 A;  1N8R R;  3CCQ T;  1TXQ A;  2XI9 A;  3MO8 A;  4F7U B;  3S3O A;  3JV3 A;  1N9S A;  2XMF A;  4CC2 A;  4OB3 B;  3LGL A;  3SFM A;  4J83 A;  1X01 A;  2ZPF B;  1VQ4 T;  2EKO A;  1YCS B;  3EG9 A;  3KXT A;  4IUV A;  2DRM A;  4OP0 A;  3G6E T;  2ZPG B;  1KQ1 A;  3WVE B;  3UAT A;  2X4W A;  4AT1 B;  2M0Y A;  4HCZ A;  1I5O B;  3PVQ A;  4JRP A;  5GAM e;  4RG2 A;  3CCM Q;  5IHK A;  2COZ A;  2EGE A;  4IUQ A;  1ZUK A;  2K2V A;  2RJF A;  2V8K A;  2D0Q B;  2RO0 A;  2DXB A;  1VQ8 A;  1AWO A;  4PFZ A;  1CSK A;  5GAM d;  2K4Y A;  4J6Y A;  4FYW B;  2K3X A;  1N8R U;  3FJ5 A;  3X25 B;  4M77 G;  3VS4 A;  4PLL A;  2LQW A;  3CC2 T;  2QAZ A;  2YSQ A;  1MV0 B;  3N5B B;  4M7A E;  4M7A C;  2CT3 A;  1VQ8 Q;  1VQP Q;  1TOV A;  1D1B A;  1I07 A;  3FEO A;  2YXY A;  2E10 A;  5CIU A;  1M1K R;  4QT7 A;  1K73 C;  1RLQ C;  2HL5 C;  1D3B B;  4PJO G;  1EIF A;  3A98 A;  1EFN A;  3PMT A;  3RIR A;  3GF5 A;  1Q81 U;  2KI7 A;  2C0I A;  3H0I A;  2QA4 A;  2LVM A;  5LJ3 j;  1ZLM A;  3EHR A;  4HVV A;  1Q7Y R;  4Z02 A;  2HQE A;  1ZSZ B;  4QQD A;  4NL3 A;  1QW1 A;  2VC8 A;  1BCM A;  2L3R A;  1IHW A;  3CXC S;  2E65 A;  5GMK j;  4IUP A;  2AK5 A;  4XK8 E;  1C1A A;  1H8K A;  1NPR A;  2QA4 T;  4RTU A;  1QVG P;  4E7S A;  3V8L A;  4J7I A;  3A8H B;  1XTD A;  4HVW A;  4M77 C;  3OYC A;  1G2B A;  4QKU A;  3JCM g;  4JDS A;  3JAM E;  1U8R A;  5LJ5 g;  4DOV A;  3TRE A;  1WQW A;  3JRZ A;  3LH5 A;  1RAD B;  1PD1 A;  2CP6 A;  2M51 A;  3OYL A;  3INZ A;  5KE2 A;  2HBW A;  5CQX A;  1JXM A;  3I55 T;  1Y71 A;  2NYS A;  2D8J A;  3PGG A;  5GAN d;  2QQ9 A;  2NUP B;  3MP1 A;  3L2Q A;  3MEW A;  4N4G A;  2YT6 A;  3CCL Q;  2AKK A;  2L89 A;  1IGU A;  4KH0 B;  3RMS A;  2RD1 A;  1VQL Q;  1HJD A;  3M0U A;  3CC4 A;  1JQQ A;  2ZPI B;  3ER0 A;  1KC8 U;  1QVF P;  2JMA A;  3CCU T;  1J3T A;  1M1K U;  2H3J A;  4OMO A;  4RTT A;  2L3S A;  3J81 E;  1WJS A;  2VGM A;  3JCM V;  1M27 C;  2A0F B;  4RTW A;  1X6O A;  1NG2 A;  5GAN f;  3CCL A;  1Q7Y C;  3L2U A;  4LDW A;  2AZS A;  1AD5 A;  2GCX A;  2XDP A;  4II1 A;  3VS2 A;  3SWN B;  1QCF A;  4FM4 B;  1ZBJ A;  3P8B B;  5GAN 3;  2JOY A;  2R58 A;  1ZBX A;  3MHX A;  1VA7 A;  4ELY C;  4HT9 A;  4C92 D;  2ESW A;  3G7Z A;  1QVG A;  1VQ7 T;  4C8Q G;  3CC4 T;  5M9O A;  2I2L A;  1KQS S;  3CXC A;  4PJO A;  9ATC B;  4IIM A;  3M59 A;  3OYN A;  2CUD A;  1K76 A;  1S72 Q;  3CD6 T;  2JNG A;  1GBR A;  2RF0 A;  1VQP T;  3CCJ A;  4BE0 A;  4PJO F;  1IGQ A;  2LX9 A;  2KVQ G;  3VYH B;  2X3W D;  1VUB A;  2QQR A;  3BDU A;  3RR6 A;  2RQV A;  2OJ2 A;  4KUD K;  2HCK A;  4BDY A;  1RAE B;  4L5G A;  1WYX A;  5LJ3 e;  3V8J A;  2JS2 A;  3VKI A;  2VAS A;  3P8H A;  2CT4 A;  2DET A;  1DJ7 B;  5IHN A;  4M78 C;  1HYO A;  2QA4 Q;  5LJ3 f;  4IIO A;  1YP5 A;  3CCR A;  3X28 B;  4F14 A;  3M0S A;  5KYX B;  3CEY A;  1NYF A;  4J8O A;  4RTZ A;  2RJD A;  2XK0 A;  1SSH A;  2EQI A;  5IXB A;  1T3S A;  4XU2 A;  3WXM B;  4HT8 A;  1ZSZ C;  1I0C A;  2BKD N;  2XDD A;  1YIJ A;  1WZO A;  3PVL A;  1B07 A;  4FIB A;  3QYH B;  3S3N A;  3KFV A;  4J9D A;  1EX4 A;  1LPL A;  1B34 B;  1WDX A;  1UGP B;  2JJ9 A;  2MYS A;  5EG2 A;  2E3H A;  2QTV A;  2LDM A;  3M58 A;  1NJI R;  4A63 B;  2ZCF B;  1N9R A;  2O31 A;  2K2M A;  2LCL A;  3QBY A;  2CSQ A;  3BDL A;  1IRE B;  1YIT A;  1JJ2 P;  4A4F A;  5HY6 A;  4XAX B;  1VQ8 T;  5GAN e;  1OX9 A;  3S6W A;  3OYJ A;  2WSE E;  4B6M A;  1K8A C;  4C8Q A;  1VQ6 T;  4M75 B;  3JB9 D;  3CPW S;  2HBP A;  4RG8 A;  2NUP A;  2DXC A;  2YDL A;  2CH4 A;  4PJO C;  1WJQ A;  2MMP A;  1NPP A;  4PJO D;  2XD0 A;  2KRN A;  4DBF A;  4M77 A;  2MWP A;  2BIV A;  2RA2 A;  2HL3 A;  2K3B A;  3EG9 B;  3RUX A;  3A1P A;  3UWN A;  4ZGJ B;  5GAN g;  1S72 T;  1BYM A;  3REA B;  1T0J A;  4AG1 C;  4M78 E;  1I5L A;  1UHF A;  1UJY A;  2EYX A;  3FLG A;  1MMN A;  1N6A A;  3MKD A;  4DBH A;  2DJQ A;  4BY6 C;  1ZSZ A;  2CRE A;  3JCM d;  2DL8 A;  2LP5 A;  3OW2 S;  3EH2 A;  5FU6 B;  2O2O A;  3NFC A;  2QQA A;  5GAM h;  3MEA A;  1PNJ A;  2EQK A;  4F7U F;  4WF2 A;  2KE9 A;  5KYX A;  1FMV A;  2RM4 A;  4E7J A;  2QXF A;  2F2X A;  4OMN A;  4XU3 A;  3DKM A;  3JCM P;  2X4Y A;  4M77 E;  3O8V A;  2ZPE B;  2HZY A;  3JCM b;  1RAC B;  5LJ5 h;  3G4S T;  2EQU A;  2YRV A;  1KJW A;  2FZC B;  4DEX A;  5D7U A;  1HXD A;  5FRM A;  3HKS A;  4PNO A;  1EZZ B;  2WAC A;  2CYZ B;  1GL5 A;  3VU3 C;  2R57 A;  5AT1 B;  4AFQ C;  4N0A C;  1XNI A;  3QO3 A;  1FYN A;  3R6O A;  3QDF A;  4R0K A;  2O4X A;  1VQ9 T;  1YJ9 A;  4ZGD B;  1KFZ A;  2XHC A;  2HNI A;  1O75 A;  4LDV A;  1WJR A;  1ZUU A;  3MP8 A;  1OZ3 A;  2J6F A;  2QAS A;  1RUW A;  3OYI A;  1R77 A;  4BE1 A;  3C12 A;  1KHI A;  3CD6 Q;  1HSQ A;  2DF6 A;  3M0R A;  4JLI A;  1SRM A;  3G71 T;  2L3P A;  2CSI A;  1D1A A;  1X2Q A;  1I8F A;  2HSE B;  3OSV A;  2GTO A;  3OBY A;  3CME A;  4P5N A;  4OMM A;  2F69 A;  1GCQ A;  1WXB A;  1UJ0 A;  1LOJ A;  1FMK A;  1YWO A;  2H8H A;  4PJN A;  4MDX A;  3CBM A;  1MHN A;  1PSE A;  1NEB A;  1UUE A;  2HKQ B;  2LNV A;  5CK9 A;  3E19 A;  3HP9 A;  2GGR A;  1RAB B;  4JRQ A;  2E12 A;  4PJL A;  4J9I A;  3SWN A;  1OX8 A;  1YHQ A;  2M16 A;  2KAF A;  1M90 R;  4Y28 E;  1Q81 C;  1ZA2 B;  2DBM A;  4RMO A;  1IXD A;  3HFN A;  2ABL A;  2VB6 A;  2YLC A;  2DX1 A;  2NWM A;  1Q86 U;  2VVK A;  2ZZD A;  1FXX A;  2CS7 A;  3EHQ A;  2EFI A;  5I21 A;  1YJN Q;  2J7I A;  1Y57 A;  1FMW A;  2A3L A;  2XG8 D;  3V7S A;  1I81 A;  2CP3 A;  1MMD A;  1Q82 C;  2B8A A;  1BU1 A;  1ZUY A;  1WHH A;  3OB9 A;  4XQ3 A;  3CPW P;  3TSW A;  4M78 G;  1D0X A;  1YCY A;  3G4S A;  1AVZ C;  3CCR T;  3SEM A;  4JJN K;  3I9Q A;  5I11 A;  1FWZ A;  1TUD A;  1PWT A;  1UGS B;  5LJ3 d;  2D0N A;  1Q86 C;  1ACM B;  1ZSG A;  4M7A D;  4IUU A;  4C0Z A;  2KQW A;  4QVC A;  3MEU A;  1W1F A;  3ULR B;  1TWB A;  4LNP A;  3EH1 A;  1QCN A;  4KH1 B;  1TSF A;  1ZX6 A;  1K8A U;  3BE3 A;  4HA8 A;  2LTO A;  2X51 A;  4FYX B;  4XTZ A;  2KK4 A;  4RTX A;  3G71 Q;  4X1V A;  4FT4 A;  4C92 G;  3JCM h;  3OS0 A;  1MV3 A;  2HDA A;  5IH2 A;  2OTL A;  1VQP A;  3CCL T;  3EG0 A;  2RMO A;  4QVD A;  1W6X A;  2YHT A;  3QJ6 A;  1M2V B;  4NOY A;  3A5Z B;  2RPN A;  5CO7 A;  3QZ5 B;  2ROL A;  2E6N A;  5GAO n;  2HAX A;  4FYY B;  2QGF B;  1QCO A;  1WXU A;  3GP8 A;  4HKE A;  3HFO A;  2XDB A;  3E9F A;  2K79 A;  3JCM f;  1YI2 A;  1NBE B;  3H8Z A;  4C8Q D;  3OQ5 A;  2JMC A;  1OV3 A;  2RH2 A;  1UE9 A;  2GBQ A;  2QQS A;  4WTO B;  3CMA T;  4FSX A;  1D0Y A;  1VQO A;  5GAN 7;  2C0O A;  4C0D B;  5GAM j;  2K5I A;  2OAU A;  1H92 A;  3DB4 A;  2LQK A;  3RNJ A;  2X4X A;  4GLK A;  1BI2 A;  3J80 E;  2DE0 X;  3VUB A;  1G3W A;  4OGC A;  5KYN A;  2MI6 A;  3EAE A;  1VQ9 Q;  1GCP A;  1YBY A;  2K7A A;  2DL7 A;  2DER A;  3JCM J;  4BB7 A;  5GAN 5;  2RJC A;  1M8M A;  1GFC A;  4M78 F;  5FWB A;  5D6X A;  4FCY A;  4KGV B;  4J9E A;  3OYG A;  2BTT A;  1H3H A;  4JZ4 A;  2W10 A;  4WCI A;  1K9M U;  4FL6 A;  3QZ9 B;  3EGD B;  2O4X B;  1R8O B;  2DFU A;  3G6E Q;  1QWF A;  1QLY A;  1VQ4 Q;  4E7I A;  2V8I A;  2JVV A;  3VS7 A;  4C92 A;  2GQI A;  5A2Q E;  3I35 A;  2LMJ A;  3OYB A;  4EDU A;  3OA6 A;  1KQS A;  2ED1 A;  2KT8 A;  1AT1 B;  1N5Z A;  1TTH B;  3EFO B;  3VS6 A;  4A4E A;  1PKT A;  1BI1 A;  4CC7 A;  1TU0 B;  1PC0 A;  5FRN A;  1LCK A;  3RER A;  2KRO A;  3CMA A;  3CBP A;  4MMK A;  2YUQ A;  4XU1 A;  1GXI E;  1M3B A;  1LJO A;  3X24 B;  2LCS A;  1VQN A;  2K6D A;  4C92 E;  4ANJ A;  1Z9Z A;  3A8G B;  1V1C A;  5GAN j;  2CUB A;  3M56 A;  3HHT B;  5GAO r;  3CCE T;  3C95 A;  5GAO p;  1IRX A;  1TS9 A;  1JBM A;  2AHJ B;  2RHX A;  2JM9 A;  2LZ6 B;  1KQ2 A;  2R5A A;  4JPB W;  2DL3 A;  4QQG A;  1QKW A;  4XTX A;  3I5S A;  3M54 A;  3PT9 A;  1QMC A;  4A54 A;  5ECA A;  1NJI C;  4E2F B;  1OQK A;  4J9H A;  2RB6 A;  1VQM Q;  5GMK i;  3EGX B;  5C6S A;  2VXF A;  4ATO A;  3LW5 E;  4RUG A;  3X26 B;  1UGV A;  4OMP A;  5CAI A;  2QDL A;  3JCM e;  1KD1 C;  1WX6 A;  2L2P A;  2E41 A;  3GOX A;  1M2O A;  1ZQ1 A;  3L2W A;  1UHC A;  3VS0 A;  3LGF A;  2RI3 A;  2KGT A;  3JB9 G;  3CCE A;  2EJG A;  2PVG B;  2QEX T;  3JSC A;  2OTL T;  2KXD A;  1P92 A;  1RI0 A;  2EW3 A;  2LJ1 A;  3I56 T;  3URG A;  4PLI A;  1YNZ A;  1Q82 R;  4PJM A;  1M9S A;  2PUK B;  3NHN A;  3V7C A;  2IIM A;  4X34 A;  4EMK C;  1VIE A;  1X43 A;  4LD6 A;  2DJZ A;  1YHQ Q;  4QVZ A;  1I4K 1;  5DM7 R;  3EFR A;  4J5Y A;  3QG1 A;  2HMA A;  2O88 A;  2CKK A;  1UFF A;  5IN1 A;  2RJE A;  3VV0 A;  1RLP C;  4UC4 A;  1JB0 E;  3ASK A;  4OML A;  2KRM A;  1PD0 A;  4F7U E;  3RMQ A;  1OZ2 A;  3OMC A;  2FB7 A;  2ATC B;  4LDY A;  4TVR A;  4DEY A;  1U1S A;  2GTJ A;  2DEQ A;  2V1Q A;  5GAO m;  2MK5 A;  4OB2 B;  3CC7 T;  1TG0 A;  1B3Q A;  4PK4 A;  2PVO B;  3G1J A;  2E4H A;  4C8Q F;  4LDU A;  2BE9 B;  4KBM B;  2X4J A;  3SWN C;  3EFS A;  5GAN 2;  1HK9 A;  3M4Y A;  1VQ6 Q;  3AHU A;  2BE7 D;  1WIE A;  2A36 A;  1Q7Y U;  1SF9 A;  1YI2 Q;  2GNC A;  1G3Y A;  1YHQ T;  1SKU B;  4JJC A;  2H3E B;  1M30 A;  3OS2 A;  5FU7 C;  2L5Q A;  5J3B A;  4F16 A;  6AT1 B;  4C0G A;  2EQJ A;  1N27 A;  2EGA A;  3CCS Q;  1M1K C;  3CCM A;  3L42 A;  1S1N A;  1F1B B;  2DNU A;  2HEQ A;  5IAY A;  5CKH A;  1NLP C;  5A0L A;  4LXC A;  1K1Z A;  4LUD A;  2DPP B;  3TQ7 P;  4BDZ A;  2C06 A;  4KUI A;  2DRK A;  3CMA Q;  1TUG B;  3HSB A;  2MWO A;  3CCV T;  4OB0 B;  2CDT A;  3HL8 A;  2LT4 A;  2HKN A;  2XIC A;  4L6V 5;  5I2M A;  2ECZ A;  3OYK A;  3TVT A;  4JZ3 A;  2DLP A;  3QKJ A;  3X20 B;  4OF1 A;  2MCN A;  1H64 1;  1YJW Q;  3FB9 A;  1QP3 A;  3C4S A;  3QWX X;  4O5V A;  2GF7 A;  5LJ3 h;  1U5S A;  1WA7 A;  4JLG A;  3QSU A;  2Y90 A;  4OMQ A;  3V8K A;  5CKF A;  4JRI A;  2FG0 A;  3NPF A;  3UA6 A;  1FX7 A;  1D09 B;  1GRI A;  2NUT B;  5KYU B;  2K9G A;  1M5Q 1;  1Q95 G;  2F1L A;  2LQN A;  3MJX A;  4C92 C;  4M7D F;  4JS4 A;  3C94 A;  2EYZ A;  2FO0 A;  1AOJ A;  1CKA A;  2EBP A;  3EFO A;  3VS5 A;  3WVD B;  2LJ3 A;  2LX7 A;  2RQT A;  1K73 U;  2JTM A;  2PTK A;  2DXT A;  2W0Z A;  2RHU A;  1W70 A;  2VGN A;  3LH0 A;  2BZY A;  1IO6 A;  1WGS A;  4E7K A;  4LDX A;  4M78 A;  4Z8A A;  8AT1 B;  3NTK A;  5GAO q;  5A0D A;  3ZL7 C;  4JJB A;  3M0T A;  1WHM A;  1WHK A;  2EPD A;  3IQL A;  5GMK m;  2R5M A;  1X6G A;  3THK A;  3FC3 A;  1VQN Q;  1NLO C;  5HCK A;  2C0T A;  1OOT A;  2MOX A;  4RKU E;  2F2W A;  1VYU A;  3ZEH A;  3L2R A;  1MND A;  3CCQ Q;  2QEX Q;  1VQK T;  2WSC E;  2CZ1 B;  4M7D A;  4FU6 A;  1KHC A;  4B9X A;  1PRM C;  5D6W A;  3CCU Q;  1KD1 U;  5AYF A;  3CCS T;  2KYM A;  1BKB A;  2QDY B;  2OAW A;  3PFS A;  4JJD A;  4N4I A;  2LCC A;  4GBQ A;  2LT1 A;  4F17 A;  2ED0 A;  1YIT T;  2EIF A;  2QK0 A;  2HSP A;  1NJI U;  3CCS A;  2SEM A;  2EYY A;  2JW4 A;  4Z89 A;  3G4S Q;  3OYA A;  2CZ0 B;  3AT1 B;  3PNW C;  1VQL T;  2L8D A;  1SHG A;  4M75 D;  1LNX A;  5HK0 A;  3OYF A;  2Y4Y A;  5GAM f;  3GBQ A;  4XTY A;  4ZTF A;  4A4G A;  1ABO A;  4M7D C;  1KQS P;  3OY9 A;  2DD5 A;  1VQ5 A;  2DMO A;  2LQ8 A;  1BI3 A;  3Q1J A;  1QP2 A;  2CP7 A;  3CME T;  3FDR A;  5KYU A;  2KY9 A;  3JCM c;  4ME7 A;  2PZ1 A;  4FYV B;  1O9S A;  5IXF A;  3M0P A;  5EC7 A;  2F5T X;  1K73 R;  4XTV A;  1PKS A;  2DKG A;  3L1A A;  1BK2 A;  2O01 E;  3SB2 A;  4C5E A;  2OI3 A;  1PG5 B;  4KUL A;  1KIK A;  1W2B P;  2DD4 A;  2RQU A;  1KD1 R;  3BW1 A;  2JN0 A;  2ZAE A;  2KEA A;  1K4U S;  1TH7 A;  3I56 Q;  3HRU A;  1JJ2 A;  2RHZ A;  4J6W A;  2CZ6 B;  1WFW A;  3CCJ Q;  1K9M C;  2E70 A;  2EAY A;  1U06 A;  3QWY A;  4RCC A;  1RAH B;  2QQB A;  3H6Z A;  4BI3 A;  4QQ6 A;  3GIB A;  1G3S A;  3VS1 A;  1RI9 A;  1M2V A;  3UT1 A;  2AIR B;  4Z88 A;  3CBO A;  3FRN A;  3NGP A;  2JT4 A;  1WXT A;  1UGR B;  2PVD B;  4C5I A;  3OW2 A;  4M7A F;  4BI8 B;  5GJW B;  1UG1 A;  2A28 A;  2MIO A;  7AT1 B;  3FJP A;  3OS1 A;  3CCE Q;  1GFD A;  1WHJ A;  1Y7X A;  2LC4 A;  1OI1 A;  2JM8 A;  1BI0 A;  3CD6 A;  1M3A A;  2DEU A;  2HQH A;  1NZ9 A;  2E5K A;  5LL6 S;  1U1T A;  1W2B A;  5I22 A;  1Y07 A;  2P0P A;  1VQ5 T;  1JXO A;  4M75 A;  5DY9 A;  1KC8 R;  3A8L B;  4ZTJ A;  3CPF A;  1S72 A;  3TCJ A;  4X9D A;  2J05 A;  1X69 A;  3P8D A;  4F04 B;  2MF2 A;  3UPU A;  4IKF A;  1LVK A;  3QUI A;  3QXE B;  3I55 A;  8ATC B;  2E64 A;  1G83 A;  2FZK B;  3ZBD A;  1M90 U;  1PCX A;  5GAN 8;  1D1C A;  2VXE A;  4L59 A;  1V76 A;  3A8O B;  4MZP A;  2LRQ A;  1VOM A;  4E7L A;  4R55 A; 
#chains in the Genus database with same CATH homology
 3E2U A;  1WHG A;  2E3I A;  2COZ A;  2E4H A;  1LPL A;  2CP7 A;  1WHJ A;  4B6M A;  1WHM A;  1WHK A;  2CP2 A;  2CP6 A;  1TOV A;  2COW A;  2HQH A;  2E3H A;  2CP5 A;  2M02 A;  2COY A;  2CP0 A;  2HL5 C;  1WHL A;  3TQ7 P;  2CP3 A;  1IXD A;  2Z0W A;  2MPX C;  1WHH A;  2HKQ B;  2HL3 A;  2QK0 A;  3RDV A;  2HKN A;  1TXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...