5GANd

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gand00
1I8FA 4N0AA 3INZA 5GAOq 5GMKm 4PJOC 3FB9A 2RB6A 4A54A 2I2LA 4RCBA 4M7DG 4N0AC 3JCMW 4PJOD 3PGGA 5GMKe 5LJ3e 1LOJA 2DTOA 5GANd 2DZCA 3V8LA 3V8JA 3L2ZA 3V7CA 1N9RA 4J5YA 5GANh 2E64A 3QO3A 1YCYA 4C8QE 2EJFA 2EAYA 2K57A 4F7UF 4C8QF 1WNLA 3EFRA 4M7AB 2EJGA 5GAMd 3JCMh 4OP0A 5GAOn 1U1TA 4MMLA 3JCMQ 2YHTA 4DQ2A 4M7AG 2QTXA 3L1AA 3JB9J 3HSBA 5GAMf 3RKWA 3VU3C 4HT8A 4M75B 1D3BB 1KQ1A 4XTXA 4PJOF 5GANg 5GMKl 4M7DA 4M7DE 2CGHA 4M75G 4C92B 4C92A 3JCMJ 4NL2A 4M7DC 1TH7A 2RD1A 3JCMV 2YLCA 2RA2A 4C92G 4M7DD 4C92C 3RKXA 3JCMb 3QUIA 2DZ9A 5GAMg 5GAN4 1MGQA 3FIFA 4M78B 4QVCA 2E65A 5LJ5h 2FYKA 4Y91A 4X9CA 4JLIA 4XU3A 1WQ7A 3SB2A 5GANj 2HNIA 4M77B 2DTHA 1B34B 5GANe 1JRIA 1B34A 3JCMd 3BDUA 5GANf 2Y90A 4XTZA 3BFMA 5GAN6 2E1HA 4M77G 2E10A 2DXUA 4M7AA 4M7AE 1M8VA 5GAOm 2JN0A 3JCMf 5GAMj 3RESA 5GAMe 4XU0A 4M7AC 5GAOr 3FJPA 4X9DA 5LJ3d 4JUVA 2FB7A 4V2SA 3V8KA 4M7AD 2E41A 4J6XA 4M75A 4M75E 1BIBA 1D3BA 4JRKA 4XTVA 5GMKh 5LJ3h 3RUXA 4M7DF 4M75C 1H641 3RIRA 4C92E 1HXDA 3JCMg 4M75D 5LJ5d 4JRIA 4XTWA 4F7UB 4J6WA 3JCMX 1Y96B 1Y96A 1JBMA 2DKGA 4M78A 5DY9A 3V7RA 1BIAA 4C92D 4F7UG 3V7SA 1HK9A 5LJ5f 5GAN2 3JCMP 1KQ2A 2VC8A 4M78G 4M77A 4HT9A 4M77E 4M78C 2VXFA 2YLBA 3RKYA 1I81A 5LJ3g 3JB9G 4M78D 5GAOl 4PJOB 4M77C 3JCMe 1U1SA 1X01A 2DTIA 4M7AF 3JB9D 3QHSA 4M77D 3JB9H 1I4K1 4PJOG 2DJZA 5GAN3 5LJ5g 3RERA 4WF2A 5I21A 3GIBA 3EFSA 4A53A 4HA8A 4NOYA 4EMKB 4EMGA 5CAIA 1LJOA 4EMKA 5GMKi 4M75F 5GMKj 5LJ3j 1WQWA 2RM4A 5LJ3f 2EJ9A 5GAN5 3BW1A 3HFNA 4EMKC 1M5Q1 4XTYA 3JCMc 4C92F 5GAOp 3HFOA 4RCCA 4XQ3A 1WPYA 4J6YA 4C8QB 4C8QA 4F7UA 4F7UE 5GAN8 4NL3A 4XU2A 5LJ5j 4M78E 5LJ5e 2DVEA 3JB9I 4C8QG 1I5LA 1LNXA 3M4GA 4C8QC 3QSUA 4M78F 4XTUA 3BY7A 2ZGWA 4XU1A 3SWNB 5GAN7 3AHUA 3SWNA 1N9SA 4C8QD 5GAMh 3JB9F 4M77F 2DXTA 4QVDA 4EMHA 2EWNA 3SWNC 2VXEA 4PNOA 2DEQA 4PJOA 4MMKA 4PJOE 4M7DB
chains in the Genus database with same CATH superfamily
4EDUA 3S3MA 5GAOq 2K79A 1C0MA 3ZEHA 4Z8AA 2BZXA 2DM1A 3QIIA 2JUFA 2F5KA 3E9GA 2PVOB 1IRXA 1AWWA 2GBQA 2ECZA 2CP2A 3VJPA 2O88A 3M0TA 1BI3A 1LCKA 2M16A 2KRMA 4PJOF 4XTXA 5GMKl 2ATCB 5DLQE 2HKNA 1UUEA 3QYHB 3WVEB 3MHXA 1K4US 3OYHA 4CC7A 4M7DD 1MNEA 5GAN4 2KROA 3CC2A 2EYZA 2OAWA 1B34B 5FWBA 3QWYA 3VS0A 2JN0A 2X4XA 4JUVA 4M7AD 1NM7A 4XTVA 2GTJA 3UATA 3CC2Q 4M75C 1H641 5A0LA 2X3WD 1K8AC 3CC7Q 3X28B 1D1CA 4AMCA 3WXMB 3JCMX 1K8AR 1Y96B 2CUBA 1GCQA 3NGPA 2VC8A 2DK3A 2EYYA 2LQNA 1U1SA 2HBWA 1QLYA 1PD0A 2JVVA 2GFAA 1D0XA 5GAN3 3RERA 5IXBA 2KDSA 1QVGP 1LJOA 4E6RA 1ZBXA 2JM9A 1Y57A 3CC2T 4C8QB 5IHIA 4J6YA 1LPLA 1U8RA 3CC7T 4XU2A 4K11A 3QSUA 5GJVB 2A08A 1TUDA 5GAN7 1SSHA 3SWNB 3CXCA 4JS5A 1O9SA 1N9SA 5IXFA 5CVIA 4FL6A 3H0FA 3OS0A 4RKUE 4HCZA 4RCBA 1M1FA 4RTTA 5D6XA 1NPRA 5IH2A 5KYWA 3CCLA 2EAYA 2EQIA 3EFRA 1S72T 5KYUB 5CKBA 4MMLA 4E7SA 3GPLA 1OQKA 4BE2A 2ZAEA 1R77A 2KR3A 1C6VX 4GY5A 3S3NA 2OI3A 2VKNA 1KHIA 3CCLQ 3QUIA 1K73U 4BI4A 1BI2A 5KYXB 4IUUA 5GAN6 2FL7A 4M77G 5CKDA 2QASA 4HKEA 2Z0WA 4M75A 2D8JA 5LJ3h 5I2MA 1K9AA 2AHJB 1M8MA 4PLLA 4JJCA 4AFUC 4C0DB 2K2VA 3LLRA 4J6WA 4OB1B 3CCLT 2NYSA 4B9XA 1RACB 5CKHA 4M77E 3PNWC 2LJ3A 2GTOA 2K5IA 2CP0A 4PJOB 3DB4A 1K0XA 2ZPIB 3J7AF 3JB9D 1X6BA 3QHSA 1WHKA 3SDZA 3CPFA 3VRYA 1MMDA 1OV3A 1BK2A 4A53A 1HD3A 4EMGA 1I0CA 2EJ9A 3IQLA 4J9DA 3PVQA 5CR2A 3X24B 1Y7XA 2ZGWA 2QGGA 3CMEQ 1N8RC 1WGSA 4M77F 1RI0A 2HKQB 2HD0A 2P0PA 4FU6A 4IUTA 2A28A 1N8RR 1UFFA 3INZA 4BUGA 1JEGA 4ZN3A 4N0AC 5LJ3e 1E6GA 1IGQA 1T3LA 1BYMA 1V29B 4OGEA 5EC7A 3TVTA 1ZQ1A 1RLQC 2K5FA 3CCEA 3OW2S 2MK5A 2M1HA 3HSBA 4AG2C 4HT8A 4JJDA 3CMET 4DBHA 1EZZB 2CGHA 2DXBA 3N5BB 4KRTA 2YLCA 4BI3A 5A0DA 2D9TA 2KY9A 2DZ9A 1MGQA 2F1LA 2E65A 3CCEQ 2Y4YA 3EFOA 2AZVA 2XU8A 2FPDA 2E1HA 2J05A 1ABOA 5GAOm 3D7SB 1AVZC 2M02A 2DD4A 4LDYA 1V1CA 4OB3B 2O4XA 1OI1A 4A4KA 1GBQA 3G71A 3HRTA 1Q82U 4B6MA 4LDXA 1HXDA 4CC2A 1QVFA 2K4YA 2LTOA 4P5NA 1LVKA 1AWOA 3V7RA 2DKGA 4JJNK 1HK9A 1KQ2A 2P4RA 1SRMA 3CCET 1QCFA 2JMAA 3CCMA 2HAXA 2DFUA 3A8HB 4R0KA 1IO6A 2O9VA 4J9CA 3MCAB 2LNVA 3G7ZA 4LE9A 1W2BA 2X3XD 1OX8A 2MIOA 4LXCA 2QA4A 1B3QA 2BIVA 2COYA 1WXTA 4EMKC 3MO8A 1FX7A 2PTKA 4XQ3A 1X6OA 4IKFA 3HL8A 1KG1A 3DKMA 4OMPA 3VS7A 1WZOA 3RR6A 1UGSB 3OMCA 2X51A 2VGMA 2DRKA 1OULA 2L8DA 1G3SA 3I9QA 1RAEB 5CIUA 3V8KA 4BB7A 1PSEA 2RQVA 3WVDB 2OTJQ 4N0AA 3QZ5B 4TVRA 8AT1B 1JJ2P 2EQUA 1NEBA 2EGCA 5CKEA 4AFSC 2MPXC 2R58A 5GANh 3OA6A 1M90C 2XKOC 1Q7YC 4OP0A 2G3RA 2LNHB 1Q86C 5KCOA 1M90R 3LYIA 2YHTA 1Q7YR 5GAMf 2M0OA 1VQOA 1Q86R 3VV0A 2FZCB 3FEOA 4PJNA 2X4YA 2OTJT 1YJNA 1AZEA 4CRIA 1D0ZA 3JAME 3RKXA 3QDFA 5GAMg 2DL7A 4DBRA 1OU8A 4M77B 2GCXA 2E4HA 1VQOQ 3VUZA 3CCQA 3JCMf 4LDUA 1KQSA 1YJNQ 2KK4A 2E41A 1GL5A 3VS3A 5GMKh 4OB2B 2EVRA 4J7IA 1Q81U 4CC3A 3JCMg 5KYYA 2IVWA 1WIEA 3PT9A 5CK9A 1HYOA 1XQHA 1JBMA 2FG0A 3CCQQ 5LJ5f 2LC4A 2DEUA 4HCKA 4GLKA 1WHMA 1X01A 2OX7A 1VQOT 3MEWA 3OS2A 5LJ5g 5I21A 3EFSA 3OYYA 4NOYA 3ZBDA 4E7IA 4EMKA 1YJNT 2E5QA 3MPUB 1JQQA 3JCMc 3PTAA 4RTZA 1WLPB 4JLGA 4KH0B 4XU1A 5HY6A 1X43A 4C8QD 3L2UA 2EW3A 4Y92A 2FPEA 1AEYA 4PNOA 4EIKA 4PJOC 4LUDA 3C95A 3AT1B 2VB6A 1FMKA 5GMKe 3H8ZA 2DNUA 3PIOA 1N9RA 3M0UA 2QK0A 3QO3A 1BCOA 3H6ZA 4F04B 1M1KC 1KD1U 3OYMA 3JCMQ 3BDLA 3P8BB 1M1KR 4HCCA 2RJDA 4DA4A 3S6WA 2CUDA 3OQ5A 4J9GA 1I5OB 1G2BA 2FPFA 1WXBA 1X75C 4C92C 3GOXA 3RNJA 2YXYA 3EFOB 4JLIA 2O01E 1ZBJA 1U3OA 1UECA 1SRLA 5KYUA 4FYVB 1KC8U 3H41A 3RESA 2HCKA 5GAOr 1OPLA 2LDMA 3M56A 2OJ2A 4LNPA 2LQKA 2R57A 3LWIA 1QVPA 1SSFA 2YT6A 2EYWA 2SEMA 3RIRA 1YNZA 2ED0A 2HBPA 2J06A 3TU4K 3PE0A 4PJJA 3SEMA 3TSWA 2EIFA 3ZFJA 3LGFA 3RKYA 2QI2A 3L2VA 2M0YA 5KYXA 1FYNA 1H3HA 4OF1A 2BZ8A 4Z89A 1VQMA 5FRNA 3GIBA 4HA8A 1YP5A 2HZYA 4ZGEB 1T0JA 3UF4A 2MAMA 3TCJA 1WHLA 2K2MA 2JNGA 3DLLA 1VUBA 2KYBA 2RI2A 1NYFA 3FJ5A 6AT1B 1VQMQ 4PJOA 2DL5A 1TU0B 4R56A 4N4HA 4OGCA 1ARKA 2K9GA 1UDLA 2CYZB 3V7CA 1K8AU 2E70A 1M27C 2DILA 3M9QA 2RHXA 1NG2A 1GRIA 4RG8A 2CH4W 3CMAA 4A4EA 1K0SA 1U1TA 2FZGB 3JB9J 1VYTA 1QWFA 3L2QA 2HDAA 2DL4A 1PD1A 2KYMA 1VQMT 2DE0X 2L5QA 4LN2A 4RTXA 2I0NA 4C92A 1OZ3A 2K3BA 2NUZA 5IT9E 4HXJA 4C92G 3OYFA 1UHFA 2QDLA 3VS2A 1PC0A 5D6WA 3CMAQ 3SB2A 3VYGA 2CKKA 1SF9A 2ROLA 1R0CB 2D1XA 4FYWB 4FYYB 2GGRA 2CZ0B 1X27A 2O2OA 3FJPA 2DJQA 1M30A 2RF0A 1YJWA 4E7JA 3CXCS 1BIBA 3FDRA 3OYNA 3OW2P 2V1QA 4C92E 3OYBA 3REBB 3EHQA 5KYYB 1PM3A 2BE7D 3I56A 2XDBA 5ECAA 1U06A 1RUWA 1VOMA 1OPKA 2M51A 2KSSA 3CMAT 5LJ3g 2DXCA 4M77C 1IB8A 4QVZA 2HMAA 2EQMA 2W10A 1I4K1 1RAAB 2KXDA 5J3BA 4ELYC 2QQBA 4L59A 4EMKB 1D0YA 3I56Q 4RTYA 3OYJA 5GAN5 3HFNA 4C92F 3HFOA 4RCCA 4KGXB 1YJ9A 1M9SA 2G6FX 1W6XA 4NL3A 5KE3A 4JJBA 3MJXA 2JT4A 4ZTFA 1BKBA 4M78F 2NLUA 3MP1A 5IHNA 4WTOB 3I5RA 1NLPC 2LX9A 4AFQC 4MZTA 1OU9A 1U5SA 3CCUA 5CKFA 4DEXA 2BKDN 3FRNA 3FB9A 4M7DG 3PGGA 1YJ9Q 4HVVA 2QYZA 3L2ZA 3I56T 1SPKA 2E64A 2DYBA 1WJRA 5C6SA 4Q5WA 3DB3A 3CCUQ 5GAMd 3EH2A 4J9HA 4QQGA 1M3AA 1X2KA 3P8DA 4IURA 2CSQA 4M7AG 2QTXA 4C0ZA 2KT1A 4C5HA 4KUIA 2EGAA 5L8RE 2YRCA 4ATOA 3H0HA 2C06A 4M7DE 2YWWA 3RDVA 3X25B 2RJCA 3KUFA 2KE9A 2RHYA 4IUPA 2MCNA 2QAZA 3JCMd 4BI8B 4M7AE 2KRNA 2LT1A 2YUOA 3CCUT 4BACA 1MV0B 2ZPHB 3A98A 4JRKA 4ZGJB 3H0IA 1B07A 2EQKA 4M7DF 3MEVA 3OYKA 4M75D 5LJ5d 4JRIA 1CKAA 2CP6A 2LQWA 1WDXA 1VQ9A 3JCMP 4M77A 4DBFA 2YLBA 1I81A 1VQ6A 2DTIA 4M7AF 1K1ZA 2CP3A 3NHNA 3JB9H 2QEXA 3UT1A 4QW2A 2DL8A 1FMWA 1G3TA 3LGLA 4OMLA 3BW1A 3FLGA 4FSXA 4C5IA 1ZSZC 1VQ6Q 1N5ZA 4ZNXA 1H92A 3EG9B 3QDRB 1SEMA 2QEXQ 4EMHA 2EWNA 2PVDB 3A8MB 2LQ8A 4RTUA 5L23A 3NTIA 1XOVA 2JJ9A 3R6NA 3M59A 1PNJA 2DTOA 2AKKA 4ANJA 1QWEA 2E3HA 2EQJA 4LD6A 2DF6A 3C4SA 1VIEA 1QVFS 1VQ6T 1PKSA 4JRQA 2L3SA 3PVLA 1RAFB 2QEXT 1D3BB 2ZPBB 5GANg 5LL6S 4BDZA 2KNBB 4C92B 3JCMJ 2C0OA 4BE0A 3VS4A 3HPWA 2WSEE 2DX1A 4Y28E 3GNGA 4M78B 1HSQA 1W2BS 2V8IA 4X9CA 2VUBA 4FCYA 1V76A 1JRIA 2PUKB 1SKUB 3REAB 1UTIA 1M3BA 2O31A 3QWXX 4AFZC 1VQKA 2FB7A 2YDLA 3NPFA 3VUBA 4ZGDB 3G4SA 2DIQA 4C0GA 4FW2A 1M3CA 1UGQB 4OMNA 4JZ4A 1IHVA 4F7UG 5EG2A 2P84A 2VXFA 1VQKQ 3NFCA 3JRZA 2J7IA 5J26A 5GAOl 2RHZA 1Q7YU 1Q86U 3G4SQ 1KFZA 1YWPA 1GXIE 3KBGA 1ZSZA 4ELZC 3CPWA 2EYXA 5CCAA 1YIJA 1VQLA 4F7UE 5GAN8 2DVEA 3GBQA 1AWJA 3JB9F 4C5EA 2VYTA 5AT1B 3G71Q 2DEQA 2AZSA 5J39A 1VQKT 4M7DB 1VIFA 1YIJQ 1VQLQ 3GF5A 3QXEB 1KQSS 3G4ST 2DMOA 1JU5C 2FRWA 2DZCA 3V8LA 3E19A 1RABB 2NWMA 4D6WA 2KI7A 3MKDA 2LZ6B 1NLOC 4F7UF 2LCLA 1W70A 4M7AB 3CCMQ 1VYVA 3TSZA 1NE8A 3L1AA 1OZ2A 2P0QA 1K9MC 3VU3C 3CBMA 3CD6A 1UJYA 1RL2A 5CQYA 2ESWA 2CT4A 2LCCA 4C5GA 2QA4Q 1K9MR 3G71T 2HL3A 2IG0A 2OAUA 4BE1A 1PG5B 2CS7A 2QQSA 4DEYA 4F14A 1YIJT 1VQLT 4D8KA 2F5TX 2EKOA 1TUGB 4QKUA 4A4GA 4J7FA 3UA7A 1YWOA 5FU6C 1K76A 2ROTA 1SG5A 3C0CA 3C94A 3CCMT 3CCSA 3C12A 5LJ3d 1FXXA 1PRLC 2JTMA 4A4HA 4DBQA 1G83A 1D1BA 4KT0E 2QA4T 1M2VB 1BIAA 1QQJA 5GAN2 1VQ4A 3SD4A 3CCSQ 3CCVA 2RO0A 3PFSA 1Q82C 2GF7A 1WJQA 2X4WA 3I35A 1ZUKA 2XIDA 1Q82R 2K7AA 2WACA 2RM4A 1CSKA 1WX6A 1YBYA 2O9SA 1VYUA 3CXCP 1VQ4Q 3CCVQ 2CH4A 2J6KA 1QVGA 1UGRB 2L2PA 2L3RA 4F16A 2A3LA 2KQWA 3M5AA 1VA7A 2RHIA 3CCST 3EGDB 4LUEA 5I22A 1YN8A 2JXBA 4A54A 2WSCE 4DOVA 1B7TA 3P8HA 3V8JA 2PZ1A 3QZ9B 2SRCA 1KSWA 4KGZB 1WNLA 4F17A 1VQ4T 3CCVT 1TS9A 1UGPB 2OTLA 3RBBB 3CCQT 2DA9A 3META 4D8DA 3BE3A 2KEAA 1SHFA 1UB4A 1PSFA 2RD1A 2K5LA 1NEGA 2RJFA 4R55A 4OMMA 2KAFA 4XK8E 1GBRA 4N4GA 1WI7A 1XJWB 2JTEA 2X4JA 2Y90A 2RI3A 3NTHA 2H3EB 4RTVA 9ATCB 2MYSA 2VVKA 2YRVA 4X9DA 1VQ8A 1MMGA 2V8JA 2K3YA 2VGNA 3EHRA 3ER0A 1F1BB 2ZPEB 4F7UB 2LT4A 2HSPA 1VQ5A 1I1JA 4M78C 3VS1A 4II1A 2NUPA 4MZPA 1GFDA 1VQ8Q 4J83A 1ZHIA 3PIPA 4ZTJA 5FWCA 5FLXE 2KVQG 4X34A 5CAIA 3HRSA 3QJYA 5C0MA 1QCOA 2E12A 1ZSZB 1VQ5Q 3VYHB 2JS2A 1UG1A 4EPCA 2A37A 5HK3A 1XNIA 2KT8A 2ZPGB 2WSFE 5GAMh 2X9HA 2YUQA 4NS5A 1W4SA 2MWOA 1NJIC 4VUBA 2VXEA 1D1AA 2JMCA 2AT1B 1NJIR 1VQ8T 1M2OA 1UHCA 1E7OA 4PJOD 4LD9K 3LH0A 1AOJA 1MMAA 2RH2A 5GANd 4PK4A 4ORZA 1GCPA 2K57A 4C8QF 3JCMh 2JM8A 3EAEA 3EG9A 2B8AA 2RQTA 5FROA 3X26B 1VQNA 4IIMA 4M7DC 2MMPA 3JCMb 1JB0E 3FIFA 5LJ5h 1BI1A 2DRMA 2LMJA 4XU3A 3MEAA 3A8GB 2DTHA 4Z02A 3BDUA 4XTZA 3BFMA 3OYAA 4OB0B 3OSVA 1VQNQ 1JXMA 1R8OB 3OBWA 5GAMe 4M7AC 4E7HA 2DIGA 1UEBA 1QVFP 1D3BA 1KIKA 1CKBA 1Z9QA 2A36A 5HKCA 4FT4A 1R0BG 2VASA 2QQ9A 3FC3A 2IPOB 1TWBA 4M78A 4MDWA 3OMGA 2RQRA 3CCRA 5DLOA 4M78G 4HT9A 4L5GA 2XDDA 4IUQA 2EYQA 2XI9A 1Z9ZA 1W2BP 1G3WA 3JCMe 1X69A 3HRUA 4JPBW 2K3XA 1VQNT 4WF2A 4JS4A 2HSEB 2FHDA 3EGXB 3OYIA 1W1FA 1WQWA 1NBEB 2DERA 1AWXA 5LJ3f 3LWHA 3CCRQ 2Y4XA 2PVGB 1OYXA 3M54A 2M9UA 4M78E 5LJ5e 3M4GA 1IXDA 3EGUA 1IZ6A 3BY7A 2RK2A 3EG0A 1IGUA 3NTKA 1YJWQ 2FO0A 1P92A 4QVDA 4GBQA 3Q1JA 1N6AA 2PQWA 2GQIA 3URGA 5GMKm 2V1RA 2RMOA 3JCMW 2LCSA 2RI5A 4PJMA 3OS1A 3CC7A 3SHWA 1YCYA 5IHKA 2DAQA 1JJ2A 3CCRT 1ZA2B 4OVAA 3ZL7C 2RHUA 3MP6A 4CC4B 2D0NA 1T0HA 3KFVA 1YJWT 4M7DA 1NPPA 2HQEA 2ZPFB 4FM4B 3OBYA 2PNIA 5DM7R 2RA2A 2JW4A 2DPPB 5FU6B 1I07A 2LRQA 3F70A 4QVCA 1OX9A 2FYKA 2NUTA 2FEIA 1KQSP 2HNIA 1XTDA 2CDTA 1S72A 4JDSA 4M7AA 3ULRB 3OSSC 2CT3A 5CQXA 2KBTA 4BD3A 3RMSA 3O5ZA 5GAMj 3L2WA 1J3TA 2EGEA 2QG9B 1E6HA 3CCJA 4FW1A 4ESRA 5I11A 5FU7B 2RN8A 1X2QA 4XTWA 1S72Q 3QYGB 1YJ9T 2COWA 4HVUA 4J9EA 3I55A 2HQHA 3M0SA 5KE2A 2NUPB 1QKWA 1PHTA 4M77D 3LH5A 3CEYA 2XMFA 3CCJQ 1ABQA 1N8RU 2YUPA 2KGTA 3M58A 3KXTA 5GMKi 3I55Q 2PUOB 3A1PA 4XTYA 1H8KA 2MI6A 2CREA 2F2WA 1OOTA 4BY6B 2MOXA 5LJ5j 1M2VA 1WHHA 1LNXA 3QBYA 2QQAA 4OMFB 2ENMA 1WXUA 3GLXA 1X6GA 2CP5A 3M0PA 1WYXA 4FT2A 2R5MA 3CCJT 2XHCA 4KBMB 1VQ9Q 3L2RA 3OS5A 2C0IA 4IIOA 3I55T 3OYDA 2EPDA 4KH1B 1BU1A 5GAOn 2W0ZA 3PMTA 1ZX6A 1YITA 2YSQA 3LX7A 2A7YA 3EGDA 2B86A 1M4ZA 3VS5A 1TXQA 4M75G 3QG1A 2CZ6B 1AT1B 3TREA 1ZSGA 5AYFA 1BCMA 2FZKB 4OMOA 1BB9A 4IUVA 4PFOA 1A0NB 2KMTA 1VQ9T 2QXFA 5GANf 3U23A 3CPWS 1GFCA 1YITQ 1RLPC 2E10A 1JO8A 1N27A 4J8OA 4XU0A 3CMEA 4LDWA 1JXOA 4M75E 1WA7A 3A8LB 3RUXA 2IIMA 4YTLA 4KUDK 2RJEA 4KGVB 1TTHB 1ZUYA 8ATCB 3CBOA 3GNFB 3M57A 1EFNA 2VV5A 1MMNA 1BI0A 2E6ZA 3RMQA 3JB9G 4O6JA 3G6EA 3M4YA 1YITT 4FSSA 3UA6A 4RUGA 1K9MU 2EBPA 2L0AA 1PWTA 4M75F 1RADB 4XAXB 1K73C 2H3JA 1TSFA 1QP3A 5GAOp 7AT1B 1K73R 4F7UA 4PKCC 1NYGA 1OEBA 2PU9B 4E2FB 1S1NA 2DBKA 1Q95G 3G6EQ 4L6V5 4XTUA 2LJ1A 2LX7A 3CC4A 2DXTA 1G3YA 1M90U 2RQWA 2GFUA 5D7UA 1PCXA 4RTWA 1KK7A 1LOJA 1YHQA 1EIFA 2D0QB 1WHGA 1QP2A 3H9NA 3CC4Q 4J5YA 3JSCA 1MUZA 1T3SA 2JZ2A 4DQ2A 3G6ET 4X1VA 2DYIA 1KQ1A 1YHQQ 3QJ6A 4NL2A 1UE9A 4M4ZA 3OYGA 2NUTB 4Z88A 4Y91A 2BE9B 3X20B 1WQ7A 4B9WA 1Y71A 4A4FA 2DD5A 2CSIA 5I2SA 2KRSA 3CC4T 3HTRA 5IAYA 2DXUA 3TEEA 3LW5E 1QVGS 3J81E 1AHJB 4V2SA 2DETA 3HKSA 4C0FA 2XD0A 2OTJA 2LVMA 4E7LA 1IHWA 1YHQT 1FMVA 3OYCA 3OW2A 5DY9A 3V7SA 2J6FA 3QPHA 3CD6Q 1SHGA 2CZ1B 2AKLA 2COZA 3OYLA 3EG3A 2DLPA 2H8HA 1UGVA 1BBZA 5LJ3j 2RK1A 3HHTB 1M5Q1 2DVJA 1AD5A 4FYXB 5KYWB 3M0QA 4PFPA 4JRPA 3OY9A 1NZ9A 2VWFA 5FU7C 2L89A 4C8QC 2BTTA 4KULA 3O8VA 3E1SA 3UDCA 4E7KA 2E3IA 3SWNC 1M1KU 4MMKA 1I8FA 3CD6T 4QQ6A 1YFNA 2I2LA 2DBMA 3EGXA 4UC4A 3VS6A 4J9BA 4JZ3A 1RI9A 1KHCA 3G1JA 2EJFA 3DLMA 2YUNA 3OYEA 4BY6C 5A0GA 4HVWA 5M9OA 3MP8A 2EFIA 4M75B 3R6OA 3L42A 5HK0A 4CI0C 1TOVA 2C0TA 2DL3A 4MZMA 3VRZA 2BUDA 1VQPA 2CP7A 2JTFA 1TH7A 4PFZA 5GJWB 3SFMA 1YCSB 1KJWA 3PMIA 1C1AA 3A8OB 5GANe 2J6OA 4J9IA 4OMQA 1B34A 3E2UA 1UJ0A 5KYNA 2HQXA 1M8VA 1WFWA 5HCKA 4WCIA 1H3ZA 3J80E 1VQPQ 3M55A 2QGFB 3ASKA 1NJIU 1QMCA 2GQVA 3ME9A 1YI2A 4LDVA 4FIBA 2ABLA 4E47A 1AZGB 1Y96A 2KXCA 4C0DC 2OTLQ 1EX4A 1HJDA 3QKJA 4N4IA 1ACMB 3T9NA 2FVUA 4AT1B 1YI2Q 5A2QE 2AIRB 2V8KA 1DJ7B 1VQPT 2X35A 3M0RA 3EG2A 1RAHB 1G5VA 1M1GA 1WJSA 2R5AA 2E6NA 4DOWA 2ED1A 4C8QA 2ZCFB 2QQRA 2D8HA 3JB9I 4C8QG 3SWNA 2OTLT 5CO7A 2E5KA 1WHJA 4HCBA 1VQ7A 2K6DA 2P4TA 1Q81C 4QQDA 4O5VA 2RB6A 4AG1C 1Q81R 3NMZC 1YI2T 2D6FA 1PRMC 1MV3A 4ZN1A 2AK5A 2FRYA 3E9FA 2XG8D 3S3OA 4C8QE 1ZUUA 5KCHA 1QW1A 3EH1A 1VQ7Q 3TQ7P 2EJGA 3EG1A 3M53A 3JV3A 4MDXA 3CBPA 1PKTA 2LJ0A 1O75A 1RAIB 3RKWA 2XK0A 3UPUA 2DO3A 2O4XB 2RPNA 1MNDA 4PLIA 4A63B 2LP5A 3JCMV 2GNCA 3OB9A 1FWZA 2V26A 5GANj 1VQ5T 2EKHA 2RQUA 1D09B 2JOYA 2MF2A 4GLMA 2CZ7B 1VQ7T 2BZYA 2QDYB 1MHNA 2F2VA 1ZLMA 2RNAA 4J6XA 3A5ZB 1G8XA 1Y0MA 3CQTA 2XDPA 3THKA 5IN1A 1TG0A 2L3QA 5D6YA 4C92D 1KD1C 4E7ZA 2A0FB 2HEQA 4RG2A 1KD1R 1GCQC 4M78D 5KH6A 1JJ2S 2F69A 2YRDA 3GP8A 2P0KA 4PJOG 1RAGB 3CPWP 2DJZA 2MWPA 2QTVA 1QCNA 3MEUA 3VKIA 5GMKj 1QKXA 4PL6A 4PJLA 1TUCA 5FW9A 4J9FA 2ZZDA 1IREB 1WPYA 4BDYA 2L3PA 2JS0A 2XICA 3UWNA 1I5LA 4RMOA 3HP9A 4ME7A 1KC8C 1Y07A 3I5SA 3AHUA 4QT7A 2F2XA 1KC8R 4PJOE 2HL5C 1ZA1B 5FRMA
chains in the Genus database with same CATH topology
4EDUA 3S3MA 5GAOq 4PJOC 1VIFA 3C95A 4FT2A 3GF5A 3QXEB 2R5MA 3G4ST 2XHCA 5GMKe 4KBMB 3CCJT 1KQSS 3H8ZA 2DZCA 3V8LA 3PIOA 3ZEHA 3E19A 1N9RA 3L2RA 4D6WA 3OS5A 3QO3A 3I55T 3QIIA 3H6ZA 2JUFA 3OYDA 2F5KA 4F7UF 2LCLA 1M1KC 4M7AB 3E9GA 2PVOB 5GAOn 1KD1U 3OYMA 3JCMQ 3BDLA 1NE8A 3P8BB 3L1AA 4HCCA 1OZ2A 3PMTA 3VJPA 2P0QA 1K9MC 3VU3C 1YITA 3CBMA 3CD6A 2RJDA 3LX7A 1BI3A 2A7YA 2M16A 3S6WA 4DA4A 1RL2A 4XTXA 5CQYA 4PJOF 1M4ZA 5GMKl 4C5GA 2LCCA 5DLQE 3OQ5A 3QG1A 2CZ6B 3QYHB 2OAUA 2IG0A 3MHXA 4M75G 3WVEB 3G71T 4BE1A 3TREA 2CS7A 3OYHA 2QQSA 1X75C 4M7DD 5AYFA 4C92C 3GOXA 5GAN4 1YIJT 1VQLT 2F5TX 2EKOA 3CC2A 4IUVA 4A4GA 4J7FA 4JLIA 5FU6C 2KMTA 1B34B 1VQ9T 2QXFA 5GANf 3CPWS 2O01E 2E10A 3C94A 1N27A 2JN0A 4J8OA 1KC8U 3RESA 3CCMT 4XU0A 3CCSA 5GAOr 2X4XA 3C12A 4LDWA 1FXXA 4JUVA 5LJ3d 3CMEA 4M7AD 2LDMA 3M56A 4M75E 4XTVA 2JTMA 2LQKA 2R57A 3LWIA 1QVPA 3A8LB 3RUXA 4A4HA 1SSFA 4YTLA 4M75C 1H641 3RIRA 5A0LA 4KT0E 4KUDK 1K8AC 2RJEA 2HBPA 2QA4T 3X28B 3WXMB 3TU4K 3JCMX 1Y96B 3CBOA 1BIAA 5GAN2 2EIFA 3GNFB 2VC8A 3LGFA 2VV5A 3M57A 3ZFJA 1VQ4A 3SD4A 3RKYA 2QI2A 2RO0A 3CCVA 1BI0A 2DK3A 3PFSA 3L2VA 2E6ZA 3RMQA 3JB9G 4O6JA 1U1SA 3G6EA 3M4YA 1YITT 1Q82C 4OF1A 2GF7A 2JVVA 1WJQA 2GFAA 2X4WA 5GAN3 3RERA 1VQMA 5FRNA 2XIDA 1K9MU 3GIBA 4HA8A 2KDSA 1LJOA 4M75F 4ZGEB 4XAXB 2WACA 1K73C 2RM4A 1ZBXA 2H3JA 1YBYA 2MAMA 1QP3A 3TCJA 5GAOp 3CC2T 2JNGA 4C8QB 4F7UA 3DLLA 4J6YA 4PKCC 1U8RA 1QVGA 1VUBA 2RI2A 1UGRB 2PU9B 4XU2A 3CC7T 2L3RA 4L6V5 3QSUA 4XTUA 5GAN7 3SWNB 4JS5A 3CXCA 2A3LA 3CC4A 1O9SA 1N9SA 2KQWA 3M5AA 2DXTA 1G3YA 1M90U 5CVIA 4FL6A 3OS0A 4PJOA 4RKUE 2RHIA 3CCST 4R56A 2GFUA 4HCZA 4N4HA 4OGCA 4A54A 4RCBA 2WSCE 4DOVA 3P8HA 1M1FA 2CYZB 1LOJA 5D6XA 1YHQA 1EIFA 2D0QB 3V8JA 1NPRA 3QZ9B 3V7CA 1QP2A 1K8AU 4J5YA 2E70A 3M9QA 3CCLA 2RHXA 2EAYA 1WNLA 3EFRA 1VQ4T 4RG8A 3CMAA 3CCVT 1S72T 4A4EA 1U1TA 1UGPB 3JSCA 4MMLA 5CKBA 2JZ2A 3GPLA 2OTLA 4DQ2A 3G6ET 4BE2A 3CCQT 3JB9J 3L2QA 3META 1KQ1A 1VQMT 4GY5A 2L5QA 3QJ6A 3S3NA 4C92A 1OZ3A 4NL2A 5IT9E 1UB4A 1PSFA 1KHIA 2RD1A 2K5LA 4C92G 3OYFA 2RJFA 3QUIA 3OYGA 5D6WA 1K73U 4BI4A 4Y91A 4R55A 1BI2A 2KAFA 4XK8E 1WQ7A 3SB2A 4N4GA 1Y71A 3VYGA 3X20B 4B9WA 4A4FA 2DD5A 5I2SA 2CKKA 2X4JA 2RI3A 2Y90A 4IUUA 3CC4T 5GAN6 2FL7A 4M77G 2DXUA 5CKDA 5IAYA 3NTHA 3TEEA 3LW5E 1QVGS 3J81E 2CZ0B 4HKEA 1AHJB 3FJPA 2YRVA 4X9DA 3HKSA 1YJWA 4V2SA 4E7JA 4M75A 3CXCS 1BIBA 3FDRA 4C0FA 1VQ8A 5LJ3h 3OYNA 2V8JA 2VGNA 2K3YA 2XD0A 5I2MA 2OTJA 2AHJB 4C92E 3OYBA 4PLLA 2LVMA 4E7LA 1YHQT 3ER0A 4C0DB 2K2VA 3LLRA 4F7UB 2ZPEB 4J6WA 3I56A 2XDBA 3OYCA 4OB1B 2LT4A 5DY9A 3CCLT 3OW2A 4B9XA 1VQ5A 3V7SA 2KSSA 5CKHA 3QPHA 4M78C 4M77E 3PNWC 5LJ3g 3CMAT 2K5IA 4II1A 4MZPA 4PJOB 2DXCA 4M77C 3DB4A 2CZ1B 4J83A 2ZPIB 1ZHIA 3J7AF 3JB9D 4QVZA 3QHSA 2EQMA 3PIPA 4ZTJA 1I4K1 3SDZA 3CPFA 3OYLA 5J3BA 5FLXE 4ELYC 2QQBA 4L59A 2KVQG 4A53A 4X34A 4EMKB 4EMGA 5CAIA 3HRSA 5LJ3j 2RK1A 3QJYA 5C0MA 3HHTB 3OYJA 2EJ9A 2E12A 5GAN5 3HFNA 1M5Q1 3VYHB 4C92F 3HFOA 5CR2A 4JRPA 4RCCA 1YJ9A 1M9SA 4EPCA 3OY9A 1NZ9A 3X24B 5KE3A 4NL3A 5FU7C 1Y7XA 2L89A 4C8QC 4ZTFA 1BKBA 4M78F 5HK3A 2NLUA 1XNIA 2ZGWA 3MP1A 3O8VA 4KULA 2ZPGB 2WSFE 3E1SA 5GAMh 3UDCA 1N8RC 1WGSA 4M77F 2LX9A 4E7KA 4NS5A 1RI0A 1W4SA 2MWOA 4MZTA 4VUBA 3CCUA 3SWNC 2VXEA 1NJIC 2HD0A 2P0PA 4FU6A 4IUTA 4MMKA 5CKFA 1M1KU 1I8FA 3CD6T 3INZA 4QQ6A 1VQ8T 2BKDN 3FRNA 3FB9A 4BUGA 2I2LA 4M7DG 4ZN3A 4N0AC 4LD9K 4PJOD 3PGGA 3LH0A 5LJ3e 4UC4A 2RH2A 5GANd 3L2ZA 3I56T 1BYMA 1V29B 2E64A 1KHCA 4OGEA 1WJRA 1ZQ1A 2EJFA 3DLMA 4Q5WA 2K57A 2K5FA 3DB3A 4C8QF 5C6SA 5GAMd 4QQGA 3OYEA 3JCMh 3CCEA 4BY6C 5A0GA 3EAEA 3P8DA 4IURA 5M9OA 4M7AG 3MP8A 2B8AA 2QTXA 3OW2S 4C0ZA 4C5HA 2M1HA 4KUIA 3HSBA 2EFIA 5L8RE 4M75B 4HT8A 3R6OA 5FROA 3L42A 5HK0A 4CI0C 3CMET 3X26B 4ATOA 2C06A 1VQNA 4M7DE 2CGHA 2DXBA 3N5BB 4MZMA 2BUDA 3X25B 2JTFA 1VQPA 1TH7A 4M7DC 2YLCA 2RJCA 3KUFA 4BI3A 2MMPA 5A0DA 2D9TA 3SFMA 2KY9A 3JCMb 2DZ9A 1JB0E 2RHYA 1MGQA 3FIFA 5LJ5h 2E65A 1BI1A 4IUPA 2Y4YA 3PMIA 4XU3A 3MEAA 3A8OB 3A8GB 2XU8A 2DTHA 4BI8B 5GANe 4Z02A 1B34A 3JCMd 3BDUA 4XTZA 3BFMA 2E1HA 2HQXA 4M7AE 3OYAA 1M8VA 4OB0B 3OSVA 5GAOm 3CCUT 1R8OB 2LT1A 3OBWA 4BACA 5GAMe 4M7AC 1H3ZA 2DD4A 3J80E 4E7HA 3M55A 3ASKA 2DIGA 4LDYA 1UEBA 2ZPHB 4OB3B 4JRKA 1D3BA 2O4XA 4ZGJB 2GQVA 1NJIU 1OI1A 4A4KA 3G71A 2EQKA 3HRTA 1Q82U 4M7DF 5HKCA 3ME9A 3MEVA 3OYKA 4LDXA 1HXDA 4FT4A 1YI2A 4M75D 4LDVA 4FIBA 5LJ5d 4JRIA 4E47A 1QVFA 2K4YA 2LTOA 2QQ9A 4P5NA 3FC3A 1Y96A 4M78A 2DKGA 4MDWA 3OMGA 3V7RA 4C0DC 4JJNK 1VQ9A 1HK9A 3QKJA 3CCRA 3JCMP 4N4IA 5DLOA 4M78G 4M77A 1KQ2A 4L5GA 5J39A 3CCET 2YLBA 4HT9A 1I81A 2XDDA 1VQ6A 4IUQA 2EYQA 3T9NA 2XI9A 1G3WA 3JCMe 2DTIA 3HRUA 3CCMA 2FVUA 4M7AF 2HAXA 3A8HB 3JB9H 2K3XA 2QEXA 1VQNT 3MCAB 4WF2A 3UT1A 5A2QE 4JS4A 2LNVA 3G7ZA 2FHDA 4QW2A 2V8KA 1W2BA 1DJ7B 3OYIA 2X35A 1VQPT 1G3TA 1WQWA 3LGLA 1G5VA 1M1GA 1WJSA 5LJ3f 3LWHA 2QA4A 2BIVA 3BW1A 3FLGA 4FSXA 2R5AA 2E6NA 4C5IA 3MO8A 4EMKC 4DOWA 1FX7A 2Y4XA 2PVGB 4XQ3A 1X6OA 4C8QA 3HL8A 4IKFA 1OYXA 2ZCFB 1KG1A 2QQRA 2M9UA 3M54A 4M78E 5LJ5e 3JB9I 4C8QG 3DKMA 3M4GA 1IZ6A 3BY7A 3QDRB 2RK2A 3SWNA 1UGSB 3NTKA 3OMCA 2OTLT 2VGMA 2L8DA 5CO7A 1P92A 1G3SA 4QVDA 4EMHA 2EWNA 2PVDB 5CIUA 3V8KA 4BB7A 1VQ7A 4HCBA 1PSEA 2P4TA 3WVDB 3Q1JA 1Q81C 1N6AA 4N0AA 3A8MB 2LQ8A 3QZ5B 2PQWA 4QQDA 3URGA 5GMKm 4O5VA 2RB6A 4TVRA 3NTIA 3JCMW 2EQUA 1XOVA 3M59A 1YI2T 2D6FA 5CKEA 2DTOA 2RI5A 4ZN1A 2R58A 3OS1A 3E9FA 2XG8D 2EQJA 5GANh 4LD6A 3CC7A 3S3OA 1YCYA 4C8QE 2DAQA 3OA6A 1JJ2A 3CCRT 1M90C 2XKOC 5KCHA 3C4SA 1QW1A 4OVAA 2EJGA 1VIEA 1Q7YC 3M53A 4OP0A 1QVFS 2G3RA 1VQ6T 1Q86C 5KCOA 4MDXA 3CBPA 3LYIA 4JRQA 2YHTA 2RHUA 3MP6A 1O75A 5GAMf 2M0OA 3RKWA 1VQOA 2XK0A 3UPUA 2DO3A 3VV0A 2QEXT 1D3BB 2O4XB 1YJWT 2ZPBB 5GANg 3FEOA 5LL6S 4M7DA 1NPPA 4BDZA 2HQEA 2ZPFB 4FM4B 3OBYA 4C92B 3JCMJ 2X4YA 4PLIA 2OTJT 1YJNA 5DM7R 3JCMV 4BE0A 3HPWA 4CRIA 2RA2A 2WSEE 3OB9A 3JAME 2DPPB 3RKXA 5FU6B 1FWZA 5GAMg 2LRQA 3F70A 4Y28E 3GNGA 4M78B 4QVCA 1W2BS 2FYKA 2V8IA 4X9CA 5GANj 2VUBA 2HNIA 4M77B 2GCXA 1VQ5T 1JRIA 1XTDA 1S72A 2PUKB 4JDSA 2JOYA 4M7AA 2MF2A 3OSSC 5CQXA 3VUZA 2CZ7B 4BD3A 3JCMf 3CCQA 4LDUA 3RMSA 5GAMj 1VQ7T 1KQSA 3L2WA 2QDYB 1MHNA 1VQKA 2FB7A 2KK4A 2E41A 4J6XA 3VUBA 5GMKh 4OB2B 3A5ZB 4ZGDB 4J7IA 1Q81U 3CCJA 3G4SA 2XDPA 2DIQA 4C0GA 3JCMg 2IVWA 1UGQB 5FU7B 4XTWA 3PT9A 5IN1A 5CK9A 3QYGB 1XQHA 1YJ9T 1JBMA 5D6YA 4C92D 1KD1C 4F7UG 3I55A 5EG2A 5LJ5f 5KE2A 4RG2A 2VXFA 3NFCA 3JRZA 5J26A 4M78D 2LC4A 5GAOl 5KH6A 4GLKA 1X01A 1JJ2S 2RHZA 2F69A 1Q7YU 1VQOT 3GP8A 3MEWA 4M77D 1Q86U 3CEYA 2P0KA 4PJOG 3OS2A 2DJZA 5LJ5g 2MWPA 1N8RU 5I21A 3M58A 3MEUA 3EFSA 3OYYA 4NOYA 3VKIA 3ZBDA 5GMKi 5GMKj 4EMKA 3KXTA 4E7IA 1YJNT 2E5QA 4PL6A 1GXIE 3KBGA 2PUOB 4ELZC 3CPWA 2ZZDA 4XTYA 3JCMc 1IREB 5CCAA 3PTAA 1YIJA 2MI6A 1VQLA 1WPYA 4F7UE 4BY6B 4BDYA 5GAN8 5LJ5j 2XICA 3UWNA 4JLGA 4RMOA 2DVEA 1I5LA 3HP9A 4ME7A 1LNXA 1KC8C 1Y07A 4XU1A 3QBYA 5HY6A 3AHUA 2QQAA 4C8QD 3L2UA 3JB9F 4C5EA 4OMFB 2VYTA 4PJOE 4PNOA 2DEQA 3GLXA 1VQKT 5FRMA 4M7DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8F A;  4N0A A;  3INZ A;  5GAO q;  5GMK m;  4PJO C;  3FB9 A;  2RB6 A;  4A54 A;  2I2L A;  4RCB A;  4M7D G;  4N0A C;  3JCM W;  4PJO D;  3PGG A;  5GMK e;  5LJ3 e;  1LOJ A;  2DTO A;  5GAN d;  2DZC A;  3V8L A;  3V8J A;  3L2Z A;  3V7C A;  1N9R A;  4J5Y A;  5GAN h;  2E64 A;  3QO3 A;  1YCY A;  4C8Q E;  2EJF A;  2EAY A;  2K57 A;  4F7U F;  4C8Q F;  1WNL A;  3EFR A;  4M7A B;  2EJG A;  5GAM d;  3JCM h;  4OP0 A;  5GAO n;  1U1T A;  4MML A;  3JCM Q;  2YHT A;  4DQ2 A;  4M7A G;  2QTX A;  3L1A A;  3JB9 J;  3HSB A;  5GAM f;  3RKW A;  3VU3 C;  4HT8 A;  4M75 B;  1D3B B;  1KQ1 A;  4XTX A;  4PJO F;  5GAN g;  5GMK l;  4M7D A;  4M7D E;  2CGH A;  4M75 G;  4C92 B;  4C92 A;  3JCM J;  4NL2 A;  4M7D C;  1TH7 A;  2RD1 A;  3JCM V;  2YLC A;  2RA2 A;  4C92 G;  4M7D D;  4C92 C;  3RKX A;  3JCM b;  3QUI A;  2DZ9 A;  5GAM g;  5GAN 4;  1MGQ A;  3FIF A;  4M78 B;  4QVC A;  2E65 A;  5LJ5 h;  2FYK A;  4Y91 A;  4X9C A;  4JLI A;  4XU3 A;  1WQ7 A;  3SB2 A;  5GAN j;  2HNI A;  4M77 B;  2DTH A;  1B34 B;  5GAN e;  1JRI A;  1B34 A;  3JCM d;  3BDU A;  5GAN f;  2Y90 A;  4XTZ A;  3BFM A;  5GAN 6;  2E1H A;  4M77 G;  2E10 A;  2DXU A;  4M7A A;  4M7A E;  1M8V A;  5GAO m;  2JN0 A;  3JCM f;  5GAM j;  3RES A;  5GAM e;  4XU0 A;  4M7A C;  5GAO r;  3FJP A;  4X9D A;  5LJ3 d;  4JUV A;  2FB7 A;  4V2S A;  3V8K A;  4M7A D;  2E41 A;  4J6X A;  4M75 A;  4M75 E;  1BIB A;  1D3B A;  4JRK A;  4XTV A;  5GMK h;  5LJ3 h;  3RUX A;  4M7D F;  4M75 C;  1H64 1;  3RIR A;  4C92 E;  1HXD A;  3JCM g;  4M75 D;  5LJ5 d;  4JRI A;  4XTW A;  4F7U B;  4J6W A;  3JCM X;  1Y96 B;  1Y96 A;  1JBM A;  2DKG A;  4M78 A;  5DY9 A;  3V7R A;  1BIA A;  4C92 D;  4F7U G;  3V7S A;  1HK9 A;  5LJ5 f;  5GAN 2;  3JCM P;  1KQ2 A;  2VC8 A;  4M78 G;  4M77 A;  4HT9 A;  4M77 E;  4M78 C;  2VXF A;  2YLB A;  3RKY A;  1I81 A;  5LJ3 g;  3JB9 G;  4M78 D;  5GAO l;  4PJO B;  4M77 C;  3JCM e;  1U1S A;  1X01 A;  2DTI A;  4M7A F;  3JB9 D;  3QHS A;  4M77 D;  3JB9 H;  1I4K 1;  4PJO G;  2DJZ A;  5GAN 3;  5LJ5 g;  3RER A;  4WF2 A;  5I21 A;  3GIB A;  3EFS A;  4A53 A;  4HA8 A;  4NOY A;  4EMK B;  4EMG A;  5CAI A;  1LJO A;  4EMK A;  5GMK i;  4M75 F;  5GMK j;  5LJ3 j;  1WQW A;  2RM4 A;  5LJ3 f;  2EJ9 A;  5GAN 5;  3BW1 A;  3HFN A;  4EMK C;  1M5Q 1;  4XTY A;  3JCM c;  4C92 F;  5GAO p;  3HFO A;  4RCC A;  4XQ3 A;  1WPY A;  4J6Y A;  4C8Q B;  4C8Q A;  4F7U A;  4F7U E;  5GAN 8;  4NL3 A;  4XU2 A;  5LJ5 j;  4M78 E;  5LJ5 e;  2DVE A;  3JB9 I;  4C8Q G;  1I5L A;  1LNX A;  3M4G A;  4C8Q C;  3QSU A;  4M78 F;  4XTU A;  3BY7 A;  2ZGW A;  4XU1 A;  3SWN B;  5GAN 7;  3AHU A;  3SWN A;  1N9S A;  4C8Q D;  5GAM h;  3JB9 F;  4M77 F;  2DXT A;  4QVD A;  4EMH A;  2EWN A;  3SWN C;  2VXE A;  4PNO A;  2DEQ A;  4PJO A;  4MMK A;  4PJO E;  4M7D B; 
#chains in the Genus database with same CATH topology
 4EDU A;  3S3M A;  5GAO q;  2K79 A;  1C0M A;  3ZEH A;  4Z8A A;  2BZX A;  2DM1 A;  3QII A;  2JUF A;  2F5K A;  3E9G A;  2PVO B;  1IRX A;  1AWW A;  2GBQ A;  2ECZ A;  2CP2 A;  3VJP A;  2O88 A;  3M0T A;  1BI3 A;  1LCK A;  2M16 A;  2KRM A;  4PJO F;  4XTX A;  5GMK l;  2ATC B;  5DLQ E;  2HKN A;  1UUE A;  3QYH B;  3WVE B;  3MHX A;  1K4U S;  3OYH A;  4CC7 A;  4M7D D;  1MNE A;  5GAN 4;  2KRO A;  3CC2 A;  2EYZ A;  2OAW A;  1B34 B;  5FWB A;  3QWY A;  3VS0 A;  2JN0 A;  2X4X A;  4JUV A;  4M7A D;  1NM7 A;  4XTV A;  2GTJ A;  3UAT A;  3CC2 Q;  4M75 C;  1H64 1;  5A0L A;  2X3W D;  1K8A C;  3CC7 Q;  3X28 B;  1D1C A;  4AMC A;  3WXM B;  3JCM X;  1K8A R;  1Y96 B;  2CUB A;  1GCQ A;  3NGP A;  2VC8 A;  2DK3 A;  2EYY A;  2LQN A;  1U1S A;  2HBW A;  1QLY A;  1PD0 A;  2JVV A;  2GFA A;  1D0X A;  5GAN 3;  3RER A;  5IXB A;  2KDS A;  1QVG P;  1LJO A;  4E6R A;  1ZBX A;  2JM9 A;  1Y57 A;  3CC2 T;  4C8Q B;  5IHI A;  4J6Y A;  1LPL A;  1U8R A;  3CC7 T;  4XU2 A;  4K11 A;  3QSU A;  5GJV B;  2A08 A;  1TUD A;  5GAN 7;  1SSH A;  3SWN B;  3CXC A;  4JS5 A;  1O9S A;  1N9S A;  5IXF A;  5CVI A;  4FL6 A;  3H0F A;  3OS0 A;  4RKU E;  4HCZ A;  4RCB A;  1M1F A;  4RTT A;  5D6X A;  1NPR A;  5IH2 A;  5KYW A;  3CCL A;  2EAY A;  2EQI A;  3EFR A;  1S72 T;  5KYU B;  5CKB A;  4MML A;  4E7S A;  3GPL A;  1OQK A;  4BE2 A;  2ZAE A;  1R77 A;  2KR3 A;  1C6V X;  4GY5 A;  3S3N A;  2OI3 A;  2VKN A;  1KHI A;  3CCL Q;  3QUI A;  1K73 U;  4BI4 A;  1BI2 A;  5KYX B;  4IUU A;  5GAN 6;  2FL7 A;  4M77 G;  5CKD A;  2QAS A;  4HKE A;  2Z0W A;  4M75 A;  2D8J A;  5LJ3 h;  5I2M A;  1K9A A;  2AHJ B;  1M8M A;  4PLL A;  4JJC A;  4AFU C;  4C0D B;  2K2V A;  3LLR A;  4J6W A;  4OB1 B;  3CCL T;  2NYS A;  4B9X A;  1RAC B;  5CKH A;  4M77 E;  3PNW C;  2LJ3 A;  2GTO A;  2K5I A;  2CP0 A;  4PJO B;  3DB4 A;  1K0X A;  2ZPI B;  3J7A F;  3JB9 D;  1X6B A;  3QHS A;  1WHK A;  3SDZ A;  3CPF A;  3VRY A;  1MMD A;  1OV3 A;  1BK2 A;  4A53 A;  1HD3 A;  4EMG A;  1I0C A;  2EJ9 A;  3IQL A;  4J9D A;  3PVQ A;  5CR2 A;  3X24 B;  1Y7X A;  2ZGW A;  2QGG A;  3CME Q;  1N8R C;  1WGS A;  4M77 F;  1RI0 A;  2HKQ B;  2HD0 A;  2P0P A;  4FU6 A;  4IUT A;  2A28 A;  1N8R R;  1UFF A;  3INZ A;  4BUG A;  1JEG A;  4ZN3 A;  4N0A C;  5LJ3 e;  1E6G A;  1IGQ A;  1T3L A;  1BYM A;  1V29 B;  4OGE A;  5EC7 A;  3TVT A;  1ZQ1 A;  1RLQ C;  2K5F A;  3CCE A;  3OW2 S;  2MK5 A;  2M1H A;  3HSB A;  4AG2 C;  4HT8 A;  4JJD A;  3CME T;  4DBH A;  1EZZ B;  2CGH A;  2DXB A;  3N5B B;  4KRT A;  2YLC A;  4BI3 A;  5A0D A;  2D9T A;  2KY9 A;  2DZ9 A;  1MGQ A;  2F1L A;  2E65 A;  3CCE Q;  2Y4Y A;  3EFO A;  2AZV A;  2XU8 A;  2FPD A;  2E1H A;  2J05 A;  1ABO A;  5GAO m;  3D7S B;  1AVZ C;  2M02 A;  2DD4 A;  4LDY A;  1V1C A;  4OB3 B;  2O4X A;  1OI1 A;  4A4K A;  1GBQ A;  3G71 A;  3HRT A;  1Q82 U;  4B6M A;  4LDX A;  1HXD A;  4CC2 A;  1QVF A;  2K4Y A;  2LTO A;  4P5N A;  1LVK A;  1AWO A;  3V7R A;  2DKG A;  4JJN K;  1HK9 A;  1KQ2 A;  2P4R A;  1SRM A;  3CCE T;  1QCF A;  2JMA A;  3CCM A;  2HAX A;  2DFU A;  3A8H B;  4R0K A;  1IO6 A;  2O9V A;  4J9C A;  3MCA B;  2LNV A;  3G7Z A;  4LE9 A;  1W2B A;  2X3X D;  1OX8 A;  2MIO A;  4LXC A;  2QA4 A;  1B3Q A;  2BIV A;  2COY A;  1WXT A;  4EMK C;  3MO8 A;  1FX7 A;  2PTK A;  4XQ3 A;  1X6O A;  4IKF A;  3HL8 A;  1KG1 A;  3DKM A;  4OMP A;  3VS7 A;  1WZO A;  3RR6 A;  1UGS B;  3OMC A;  2X51 A;  2VGM A;  2DRK A;  1OUL A;  2L8D A;  1G3S A;  3I9Q A;  1RAE B;  5CIU A;  3V8K A;  4BB7 A;  1PSE A;  2RQV A;  3WVD B;  2OTJ Q;  4N0A A;  3QZ5 B;  4TVR A;  8AT1 B;  1JJ2 P;  2EQU A;  1NEB A;  2EGC A;  5CKE A;  4AFS C;  2MPX C;  2R58 A;  5GAN h;  3OA6 A;  1M90 C;  2XKO C;  1Q7Y C;  4OP0 A;  2G3R A;  2LNH B;  1Q86 C;  5KCO A;  1M90 R;  3LYI A;  2YHT A;  1Q7Y R;  5GAM f;  2M0O A;  1VQO A;  1Q86 R;  3VV0 A;  2FZC B;  3FEO A;  4PJN A;  2X4Y A;  2OTJ T;  1YJN A;  1AZE A;  4CRI A;  1D0Z A;  3JAM E;  3RKX A;  3QDF A;  5GAM g;  2DL7 A;  4DBR A;  1OU8 A;  4M77 B;  2GCX A;  2E4H A;  1VQO Q;  3VUZ A;  3CCQ A;  3JCM f;  4LDU A;  1KQS A;  1YJN Q;  2KK4 A;  2E41 A;  1GL5 A;  3VS3 A;  5GMK h;  4OB2 B;  2EVR A;  4J7I A;  1Q81 U;  4CC3 A;  3JCM g;  5KYY A;  2IVW A;  1WIE A;  3PT9 A;  5CK9 A;  1HYO A;  1XQH A;  1JBM A;  2FG0 A;  3CCQ Q;  5LJ5 f;  2LC4 A;  2DEU A;  4HCK A;  4GLK A;  1WHM A;  1X01 A;  2OX7 A;  1VQO T;  3MEW A;  3OS2 A;  5LJ5 g;  5I21 A;  3EFS A;  3OYY A;  4NOY A;  3ZBD A;  4E7I A;  4EMK A;  1YJN T;  2E5Q A;  3MPU B;  1JQQ A;  3JCM c;  3PTA A;  4RTZ A;  1WLP B;  4JLG A;  4KH0 B;  4XU1 A;  5HY6 A;  1X43 A;  4C8Q D;  3L2U A;  2EW3 A;  4Y92 A;  2FPE A;  1AEY A;  4PNO A;  4EIK A;  4PJO C;  4LUD A;  3C95 A;  3AT1 B;  2VB6 A;  1FMK A;  5GMK e;  3H8Z A;  2DNU A;  3PIO A;  1N9R A;  3M0U A;  2QK0 A;  3QO3 A;  1BCO A;  3H6Z A;  4F04 B;  1M1K C;  1KD1 U;  3OYM A;  3JCM Q;  3BDL A;  3P8B B;  1M1K R;  4HCC A;  2RJD A;  4DA4 A;  3S6W A;  2CUD A;  3OQ5 A;  4J9G A;  1I5O B;  1G2B A;  2FPF A;  1WXB A;  1X75 C;  4C92 C;  3GOX A;  3RNJ A;  2YXY A;  3EFO B;  4JLI A;  2O01 E;  1ZBJ A;  1U3O A;  1UEC A;  1SRL A;  5KYU A;  4FYV B;  1KC8 U;  3H41 A;  3RES A;  2HCK A;  5GAO r;  1OPL A;  2LDM A;  3M56 A;  2OJ2 A;  4LNP A;  2LQK A;  2R57 A;  3LWI A;  1QVP A;  1SSF A;  2YT6 A;  2EYW A;  2SEM A;  3RIR A;  1YNZ A;  2ED0 A;  2HBP A;  2J06 A;  3TU4 K;  3PE0 A;  4PJJ A;  3SEM A;  3TSW A;  2EIF A;  3ZFJ A;  3LGF A;  3RKY A;  2QI2 A;  3L2V A;  2M0Y A;  5KYX A;  1FYN A;  1H3H A;  4OF1 A;  2BZ8 A;  4Z89 A;  1VQM A;  5FRN A;  3GIB A;  4HA8 A;  1YP5 A;  2HZY A;  4ZGE B;  1T0J A;  3UF4 A;  2MAM A;  3TCJ A;  1WHL A;  2K2M A;  2JNG A;  3DLL A;  1VUB A;  2KYB A;  2RI2 A;  1NYF A;  3FJ5 A;  6AT1 B;  1VQM Q;  4PJO A;  2DL5 A;  1TU0 B;  4R56 A;  4N4H A;  4OGC A;  1ARK A;  2K9G A;  1UDL A;  2CYZ B;  3V7C A;  1K8A U;  2E70 A;  1M27 C;  2DIL A;  3M9Q A;  2RHX A;  1NG2 A;  1GRI A;  4RG8 A;  2CH4 W;  3CMA A;  4A4E A;  1K0S A;  1U1T A;  2FZG B;  3JB9 J;  1VYT A;  1QWF A;  3L2Q A;  2HDA A;  2DL4 A;  1PD1 A;  2KYM A;  1VQM T;  2DE0 X;  2L5Q A;  4LN2 A;  4RTX A;  2I0N A;  4C92 A;  1OZ3 A;  2K3B A;  2NUZ A;  5IT9 E;  4HXJ A;  4C92 G;  3OYF A;  1UHF A;  2QDL A;  3VS2 A;  1PC0 A;  5D6W A;  3CMA Q;  3SB2 A;  3VYG A;  2CKK A;  1SF9 A;  2ROL A;  1R0C B;  2D1X A;  4FYW B;  4FYY B;  2GGR A;  2CZ0 B;  1X27 A;  2O2O A;  3FJP A;  2DJQ A;  1M30 A;  2RF0 A;  1YJW A;  4E7J A;  3CXC S;  1BIB A;  3FDR A;  3OYN A;  3OW2 P;  2V1Q A;  4C92 E;  3OYB A;  3REB B;  3EHQ A;  5KYY B;  1PM3 A;  2BE7 D;  3I56 A;  2XDB A;  5ECA A;  1U06 A;  1RUW A;  1VOM A;  1OPK A;  2M51 A;  2KSS A;  3CMA T;  5LJ3 g;  2DXC A;  4M77 C;  1IB8 A;  4QVZ A;  2HMA A;  2EQM A;  2W10 A;  1I4K 1;  1RAA B;  2KXD A;  5J3B A;  4ELY C;  2QQB A;  4L59 A;  4EMK B;  1D0Y A;  3I56 Q;  4RTY A;  3OYJ A;  5GAN 5;  3HFN A;  4C92 F;  3HFO A;  4RCC A;  4KGX B;  1YJ9 A;  1M9S A;  2G6F X;  1W6X A;  4NL3 A;  5KE3 A;  4JJB A;  3MJX A;  2JT4 A;  4ZTF A;  1BKB A;  4M78 F;  2NLU A;  3MP1 A;  5IHN A;  4WTO B;  3I5R A;  1NLP C;  2LX9 A;  4AFQ C;  4MZT A;  1OU9 A;  1U5S A;  3CCU A;  5CKF A;  4DEX A;  2BKD N;  3FRN A;  3FB9 A;  4M7D G;  3PGG A;  1YJ9 Q;  4HVV A;  2QYZ A;  3L2Z A;  3I56 T;  1SPK A;  2E64 A;  2DYB A;  1WJR A;  5C6S A;  4Q5W A;  3DB3 A;  3CCU Q;  5GAM d;  3EH2 A;  4J9H A;  4QQG A;  1M3A A;  1X2K A;  3P8D A;  4IUR A;  2CSQ A;  4M7A G;  2QTX A;  4C0Z A;  2KT1 A;  4C5H A;  4KUI A;  2EGA A;  5L8R E;  2YRC A;  4ATO A;  3H0H A;  2C06 A;  4M7D E;  2YWW A;  3RDV A;  3X25 B;  2RJC A;  3KUF A;  2KE9 A;  2RHY A;  4IUP A;  2MCN A;  2QAZ A;  3JCM d;  4BI8 B;  4M7A E;  2KRN A;  2LT1 A;  2YUO A;  3CCU T;  4BAC A;  1MV0 B;  2ZPH B;  3A98 A;  4JRK A;  4ZGJ B;  3H0I A;  1B07 A;  2EQK A;  4M7D F;  3MEV A;  3OYK A;  4M75 D;  5LJ5 d;  4JRI A;  1CKA A;  2CP6 A;  2LQW A;  1WDX A;  1VQ9 A;  3JCM P;  4M77 A;  4DBF A;  2YLB A;  1I81 A;  1VQ6 A;  2DTI A;  4M7A F;  1K1Z A;  2CP3 A;  3NHN A;  3JB9 H;  2QEX A;  3UT1 A;  4QW2 A;  2DL8 A;  1FMW A;  1G3T A;  3LGL A;  4OML A;  3BW1 A;  3FLG A;  4FSX A;  4C5I A;  1ZSZ C;  1VQ6 Q;  1N5Z A;  4ZNX A;  1H92 A;  3EG9 B;  3QDR B;  1SEM A;  2QEX Q;  4EMH A;  2EWN A;  2PVD B;  3A8M B;  2LQ8 A;  4RTU A;  5L23 A;  3NTI A;  1XOV A;  2JJ9 A;  3R6N A;  3M59 A;  1PNJ A;  2DTO A;  2AKK A;  4ANJ A;  1QWE A;  2E3H A;  2EQJ A;  4LD6 A;  2DF6 A;  3C4S A;  1VIE A;  1QVF S;  1VQ6 T;  1PKS A;  4JRQ A;  2L3S A;  3PVL A;  1RAF B;  2QEX T;  1D3B B;  2ZPB B;  5GAN g;  5LL6 S;  4BDZ A;  2KNB B;  4C92 B;  3JCM J;  2C0O A;  4BE0 A;  3VS4 A;  3HPW A;  2WSE E;  2DX1 A;  4Y28 E;  3GNG A;  4M78 B;  1HSQ A;  1W2B S;  2V8I A;  4X9C A;  2VUB A;  4FCY A;  1V76 A;  1JRI A;  2PUK B;  1SKU B;  3REA B;  1UTI A;  1M3B A;  2O31 A;  3QWX X;  4AFZ C;  1VQK A;  2FB7 A;  2YDL A;  3NPF A;  3VUB A;  4ZGD B;  3G4S A;  2DIQ A;  4C0G A;  4FW2 A;  1M3C A;  1UGQ B;  4OMN A;  4JZ4 A;  1IHV A;  4F7U G;  5EG2 A;  2P84 A;  2VXF A;  1VQK Q;  3NFC A;  3JRZ A;  2J7I A;  5J26 A;  5GAO l;  2RHZ A;  1Q7Y U;  1Q86 U;  3G4S Q;  1KFZ A;  1YWP A;  1GXI E;  3KBG A;  1ZSZ A;  4ELZ C;  3CPW A;  2EYX A;  5CCA A;  1YIJ A;  1VQL A;  4F7U E;  5GAN 8;  2DVE A;  3GBQ A;  1AWJ A;  3JB9 F;  4C5E A;  2VYT A;  5AT1 B;  3G71 Q;  2DEQ A;  2AZS A;  5J39 A;  1VQK T;  4M7D B;  1VIF A;  1YIJ Q;  1VQL Q;  3GF5 A;  3QXE B;  1KQS S;  3G4S T;  2DMO A;  1JU5 C;  2FRW A;  2DZC A;  3V8L A;  3E19 A;  1RAB B;  2NWM A;  4D6W A;  2KI7 A;  3MKD A;  2LZ6 B;  1NLO C;  4F7U F;  2LCL A;  1W70 A;  4M7A B;  3CCM Q;  1VYV A;  3TSZ A;  1NE8 A;  3L1A A;  1OZ2 A;  2P0Q A;  1K9M C;  3VU3 C;  3CBM A;  3CD6 A;  1UJY A;  1RL2 A;  5CQY A;  2ESW A;  2CT4 A;  2LCC A;  4C5G A;  2QA4 Q;  1K9M R;  3G71 T;  2HL3 A;  2IG0 A;  2OAU A;  4BE1 A;  1PG5 B;  2CS7 A;  2QQS A;  4DEY A;  4F14 A;  1YIJ T;  1VQL T;  4D8K A;  2F5T X;  2EKO A;  1TUG B;  4QKU A;  4A4G A;  4J7F A;  3UA7 A;  1YWO A;  5FU6 C;  1K76 A;  2ROT A;  1SG5 A;  3C0C A;  3C94 A;  3CCM T;  3CCS A;  3C12 A;  5LJ3 d;  1FXX A;  1PRL C;  2JTM A;  4A4H A;  4DBQ A;  1G83 A;  1D1B A;  4KT0 E;  2QA4 T;  1M2V B;  1BIA A;  1QQJ A;  5GAN 2;  1VQ4 A;  3SD4 A;  3CCS Q;  3CCV A;  2RO0 A;  3PFS A;  1Q82 C;  2GF7 A;  1WJQ A;  2X4W A;  3I35 A;  1ZUK A;  2XID A;  1Q82 R;  2K7A A;  2WAC A;  2RM4 A;  1CSK A;  1WX6 A;  1YBY A;  2O9S A;  1VYU A;  3CXC P;  1VQ4 Q;  3CCV Q;  2CH4 A;  2J6K A;  1QVG A;  1UGR B;  2L2P A;  2L3R A;  4F16 A;  2A3L A;  2KQW A;  3M5A A;  1VA7 A;  2RHI A;  3CCS T;  3EGD B;  4LUE A;  5I22 A;  1YN8 A;  2JXB A;  4A54 A;  2WSC E;  4DOV A;  1B7T A;  3P8H A;  3V8J A;  2PZ1 A;  3QZ9 B;  2SRC A;  1KSW A;  4KGZ B;  1WNL A;  4F17 A;  1VQ4 T;  3CCV T;  1TS9 A;  1UGP B;  2OTL A;  3RBB B;  3CCQ T;  2DA9 A;  3MET A;  4D8D A;  3BE3 A;  2KEA A;  1SHF A;  1UB4 A;  1PSF A;  2RD1 A;  2K5L A;  1NEG A;  2RJF A;  4R55 A;  4OMM A;  2KAF A;  4XK8 E;  1GBR A;  4N4G A;  1WI7 A;  1XJW B;  2JTE A;  2X4J A;  2Y90 A;  2RI3 A;  3NTH A;  2H3E B;  4RTV A;  9ATC B;  2MYS A;  2VVK A;  2YRV A;  4X9D A;  1VQ8 A;  1MMG A;  2V8J A;  2K3Y A;  2VGN A;  3EHR A;  3ER0 A;  1F1B B;  2ZPE B;  4F7U B;  2LT4 A;  2HSP A;  1VQ5 A;  1I1J A;  4M78 C;  3VS1 A;  4II1 A;  2NUP A;  4MZP A;  1GFD A;  1VQ8 Q;  4J83 A;  1ZHI A;  3PIP A;  4ZTJ A;  5FWC A;  5FLX E;  2KVQ G;  4X34 A;  5CAI A;  3HRS A;  3QJY A;  5C0M A;  1QCO A;  2E12 A;  1ZSZ B;  1VQ5 Q;  3VYH B;  2JS2 A;  1UG1 A;  4EPC A;  2A37 A;  5HK3 A;  1XNI A;  2KT8 A;  2ZPG B;  2WSF E;  5GAM h;  2X9H A;  2YUQ A;  4NS5 A;  1W4S A;  2MWO A;  1NJI C;  4VUB A;  2VXE A;  1D1A A;  2JMC A;  2AT1 B;  1NJI R;  1VQ8 T;  1M2O A;  1UHC A;  1E7O A;  4PJO D;  4LD9 K;  3LH0 A;  1AOJ A;  1MMA A;  2RH2 A;  5GAN d;  4PK4 A;  4ORZ A;  1GCP A;  2K57 A;  4C8Q F;  3JCM h;  2JM8 A;  3EAE A;  3EG9 A;  2B8A A;  2RQT A;  5FRO A;  3X26 B;  1VQN A;  4IIM A;  4M7D C;  2MMP A;  3JCM b;  1JB0 E;  3FIF A;  5LJ5 h;  1BI1 A;  2DRM A;  2LMJ A;  4XU3 A;  3MEA A;  3A8G B;  2DTH A;  4Z02 A;  3BDU A;  4XTZ A;  3BFM A;  3OYA A;  4OB0 B;  3OSV A;  1VQN Q;  1JXM A;  1R8O B;  3OBW A;  5GAM e;  4M7A C;  4E7H A;  2DIG A;  1UEB A;  1QVF P;  1D3B A;  1KIK A;  1CKB A;  1Z9Q A;  2A36 A;  5HKC A;  4FT4 A;  1R0B G;  2VAS A;  2QQ9 A;  3FC3 A;  2IPO B;  1TWB A;  4M78 A;  4MDW A;  3OMG A;  2RQR A;  3CCR A;  5DLO A;  4M78 G;  4HT9 A;  4L5G A;  2XDD A;  4IUQ A;  2EYQ A;  2XI9 A;  1Z9Z A;  1W2B P;  1G3W A;  3JCM e;  1X69 A;  3HRU A;  4JPB W;  2K3X A;  1VQN T;  4WF2 A;  4JS4 A;  2HSE B;  2FHD A;  3EGX B;  3OYI A;  1W1F A;  1WQW A;  1NBE B;  2DER A;  1AWX A;  5LJ3 f;  3LWH A;  3CCR Q;  2Y4X A;  2PVG B;  1OYX A;  3M54 A;  2M9U A;  4M78 E;  5LJ5 e;  3M4G A;  1IXD A;  3EGU A;  1IZ6 A;  3BY7 A;  2RK2 A;  3EG0 A;  1IGU A;  3NTK A;  1YJW Q;  2FO0 A;  1P92 A;  4QVD A;  4GBQ A;  3Q1J A;  1N6A A;  2PQW A;  2GQI A;  3URG A;  5GMK m;  2V1R A;  2RMO A;  3JCM W;  2LCS A;  2RI5 A;  4PJM A;  3OS1 A;  3CC7 A;  3SHW A;  1YCY A;  5IHK A;  2DAQ A;  1JJ2 A;  3CCR T;  1ZA2 B;  4OVA A;  3ZL7 C;  2RHU A;  3MP6 A;  4CC4 B;  2D0N A;  1T0H A;  3KFV A;  1YJW T;  4M7D A;  1NPP A;  2HQE A;  2ZPF B;  4FM4 B;  3OBY A;  2PNI A;  5DM7 R;  2RA2 A;  2JW4 A;  2DPP B;  5FU6 B;  1I07 A;  2LRQ A;  3F70 A;  4QVC A;  1OX9 A;  2FYK A;  2NUT A;  2FEI A;  1KQS P;  2HNI A;  1XTD A;  2CDT A;  1S72 A;  4JDS A;  4M7A A;  3ULR B;  3OSS C;  2CT3 A;  5CQX A;  2KBT A;  4BD3 A;  3RMS A;  3O5Z A;  5GAM j;  3L2W A;  1J3T A;  2EGE A;  2QG9 B;  1E6H A;  3CCJ A;  4FW1 A;  4ESR A;  5I11 A;  5FU7 B;  2RN8 A;  1X2Q A;  4XTW A;  1S72 Q;  3QYG B;  1YJ9 T;  2COW A;  4HVU A;  4J9E A;  3I55 A;  2HQH A;  3M0S A;  5KE2 A;  2NUP B;  1QKW A;  1PHT A;  4M77 D;  3LH5 A;  3CEY A;  2XMF A;  3CCJ Q;  1ABQ A;  1N8R U;  2YUP A;  2KGT A;  3M58 A;  3KXT A;  5GMK i;  3I55 Q;  2PUO B;  3A1P A;  4XTY A;  1H8K A;  2MI6 A;  2CRE A;  2F2W A;  1OOT A;  4BY6 B;  2MOX A;  5LJ5 j;  1M2V A;  1WHH A;  1LNX A;  3QBY A;  2QQA A;  4OMF B;  2ENM A;  1WXU A;  3GLX A;  1X6G A;  2CP5 A;  3M0P A;  1WYX A;  4FT2 A;  2R5M A;  3CCJ T;  2XHC A;  4KBM B;  1VQ9 Q;  3L2R A;  3OS5 A;  2C0I A;  4IIO A;  3I55 T;  3OYD A;  2EPD A;  4KH1 B;  1BU1 A;  5GAO n;  2W0Z A;  3PMT A;  1ZX6 A;  1YIT A;  2YSQ A;  3LX7 A;  2A7Y A;  3EGD A;  2B86 A;  1M4Z A;  3VS5 A;  1TXQ A;  4M75 G;  3QG1 A;  2CZ6 B;  1AT1 B;  3TRE A;  1ZSG A;  5AYF A;  1BCM A;  2FZK B;  4OMO A;  1BB9 A;  4IUV A;  4PFO A;  1A0N B;  2KMT A;  1VQ9 T;  2QXF A;  5GAN f;  3U23 A;  3CPW S;  1GFC A;  1YIT Q;  1RLP C;  2E10 A;  1JO8 A;  1N27 A;  4J8O A;  4XU0 A;  3CME A;  4LDW A;  1JXO A;  4M75 E;  1WA7 A;  3A8L B;  3RUX A;  2IIM A;  4YTL A;  4KUD K;  2RJE A;  4KGV B;  1TTH B;  1ZUY A;  8ATC B;  3CBO A;  3GNF B;  3M57 A;  1EFN A;  2VV5 A;  1MMN A;  1BI0 A;  2E6Z A;  3RMQ A;  3JB9 G;  4O6J A;  3G6E A;  3M4Y A;  1YIT T;  4FSS A;  3UA6 A;  4RUG A;  1K9M U;  2EBP A;  2L0A A;  1PWT A;  4M75 F;  1RAD B;  4XAX B;  1K73 C;  2H3J A;  1TSF A;  1QP3 A;  5GAO p;  7AT1 B;  1K73 R;  4F7U A;  4PKC C;  1NYG A;  1OEB A;  2PU9 B;  4E2F B;  1S1N A;  2DBK A;  1Q95 G;  3G6E Q;  4L6V 5;  4XTU A;  2LJ1 A;  2LX7 A;  3CC4 A;  2DXT A;  1G3Y A;  1M90 U;  2RQW A;  2GFU A;  5D7U A;  1PCX A;  4RTW A;  1KK7 A;  1LOJ A;  1YHQ A;  1EIF A;  2D0Q B;  1WHG A;  1QP2 A;  3H9N A;  3CC4 Q;  4J5Y A;  3JSC A;  1MUZ A;  1T3S A;  2JZ2 A;  4DQ2 A;  3G6E T;  4X1V A;  2DYI A;  1KQ1 A;  1YHQ Q;  3QJ6 A;  4NL2 A;  1UE9 A;  4M4Z A;  3OYG A;  2NUT B;  4Z88 A;  4Y91 A;  2BE9 B;  3X20 B;  1WQ7 A;  4B9W A;  1Y71 A;  4A4F A;  2DD5 A;  2CSI A;  5I2S A;  2KRS A;  3CC4 T;  3HTR A;  5IAY A;  2DXU A;  3TEE A;  3LW5 E;  1QVG S;  3J81 E;  1AHJ B;  4V2S A;  2DET A;  3HKS A;  4C0F A;  2XD0 A;  2OTJ A;  2LVM A;  4E7L A;  1IHW A;  1YHQ T;  1FMV A;  3OYC A;  3OW2 A;  5DY9 A;  3V7S A;  2J6F A;  3QPH A;  3CD6 Q;  1SHG A;  2CZ1 B;  2AKL A;  2COZ A;  3OYL A;  3EG3 A;  2DLP A;  2H8H A;  1UGV A;  1BBZ A;  5LJ3 j;  2RK1 A;  3HHT B;  1M5Q 1;  2DVJ A;  1AD5 A;  4FYX B;  5KYW B;  3M0Q A;  4PFP A;  4JRP A;  3OY9 A;  1NZ9 A;  2VWF A;  5FU7 C;  2L89 A;  4C8Q C;  2BTT A;  4KUL A;  3O8V A;  3E1S A;  3UDC A;  4E7K A;  2E3I A;  3SWN C;  1M1K U;  4MMK A;  1I8F A;  3CD6 T;  4QQ6 A;  1YFN A;  2I2L A;  2DBM A;  3EGX A;  4UC4 A;  3VS6 A;  4J9B A;  4JZ3 A;  1RI9 A;  1KHC A;  3G1J A;  2EJF A;  3DLM A;  2YUN A;  3OYE A;  4BY6 C;  5A0G A;  4HVW A;  5M9O A;  3MP8 A;  2EFI A;  4M75 B;  3R6O A;  3L42 A;  5HK0 A;  4CI0 C;  1TOV A;  2C0T A;  2DL3 A;  4MZM A;  3VRZ A;  2BUD A;  1VQP A;  2CP7 A;  2JTF A;  1TH7 A;  4PFZ A;  5GJW B;  3SFM A;  1YCS B;  1KJW A;  3PMI A;  1C1A A;  3A8O B;  5GAN e;  2J6O A;  4J9I A;  4OMQ A;  1B34 A;  3E2U A;  1UJ0 A;  5KYN A;  2HQX A;  1M8V A;  1WFW A;  5HCK A;  4WCI A;  1H3Z A;  3J80 E;  1VQP Q;  3M55 A;  2QGF B;  3ASK A;  1NJI U;  1QMC A;  2GQV A;  3ME9 A;  1YI2 A;  4LDV A;  4FIB A;  2ABL A;  4E47 A;  1AZG B;  1Y96 A;  2KXC A;  4C0D C;  2OTL Q;  1EX4 A;  1HJD A;  3QKJ A;  4N4I A;  1ACM B;  3T9N A;  2FVU A;  4AT1 B;  1YI2 Q;  5A2Q E;  2AIR B;  2V8K A;  1DJ7 B;  1VQP T;  2X35 A;  3M0R A;  3EG2 A;  1RAH B;  1G5V A;  1M1G A;  1WJS A;  2R5A A;  2E6N A;  4DOW A;  2ED1 A;  4C8Q A;  2ZCF B;  2QQR A;  2D8H A;  3JB9 I;  4C8Q G;  3SWN A;  2OTL T;  5CO7 A;  2E5K A;  1WHJ A;  4HCB A;  1VQ7 A;  2K6D A;  2P4T A;  1Q81 C;  4QQD A;  4O5V A;  2RB6 A;  4AG1 C;  1Q81 R;  3NMZ C;  1YI2 T;  2D6F A;  1PRM C;  1MV3 A;  4ZN1 A;  2AK5 A;  2FRY A;  3E9F A;  2XG8 D;  3S3O A;  4C8Q E;  1ZUU A;  5KCH A;  1QW1 A;  3EH1 A;  1VQ7 Q;  3TQ7 P;  2EJG A;  3EG1 A;  3M53 A;  3JV3 A;  4MDX A;  3CBP A;  1PKT A;  2LJ0 A;  1O75 A;  1RAI B;  3RKW A;  2XK0 A;  3UPU A;  2DO3 A;  2O4X B;  2RPN A;  1MND A;  4PLI A;  4A63 B;  2LP5 A;  3JCM V;  2GNC A;  3OB9 A;  1FWZ A;  2V26 A;  5GAN j;  1VQ5 T;  2EKH A;  2RQU A;  1D09 B;  2JOY A;  2MF2 A;  4GLM A;  2CZ7 B;  1VQ7 T;  2BZY A;  2QDY B;  1MHN A;  2F2V A;  1ZLM A;  2RNA A;  4J6X A;  3A5Z B;  1G8X A;  1Y0M A;  3CQT A;  2XDP A;  3THK A;  5IN1 A;  1TG0 A;  2L3Q A;  5D6Y A;  4C92 D;  1KD1 C;  4E7Z A;  2A0F B;  2HEQ A;  4RG2 A;  1KD1 R;  1GCQ C;  4M78 D;  5KH6 A;  1JJ2 S;  2F69 A;  2YRD A;  3GP8 A;  2P0K A;  4PJO G;  1RAG B;  3CPW P;  2DJZ A;  2MWP A;  2QTV A;  1QCN A;  3MEU A;  3VKI A;  5GMK j;  1QKX A;  4PL6 A;  4PJL A;  1TUC A;  5FW9 A;  4J9F A;  2ZZD A;  1IRE B;  1WPY A;  4BDY A;  2L3P A;  2JS0 A;  2XIC A;  3UWN A;  1I5L A;  4RMO A;  3HP9 A;  4ME7 A;  1KC8 C;  1Y07 A;  3I5S A;  3AHU A;  4QT7 A;  2F2X A;  1KC8 R;  4PJO E;  2HL5 C;  1ZA1 B;  5FRM A; 
#chains in the Genus database with same CATH homology
 4EDU A;  3S3M A;  5GAO q;  4PJO C;  1VIF A;  3C95 A;  4FT2 A;  3GF5 A;  3QXE B;  2R5M A;  3G4S T;  2XHC A;  5GMK e;  4KBM B;  3CCJ T;  1KQS S;  3H8Z A;  2DZC A;  3V8L A;  3PIO A;  3ZEH A;  3E19 A;  1N9R A;  3L2R A;  4D6W A;  3OS5 A;  3QO3 A;  3I55 T;  3QII A;  3H6Z A;  2JUF A;  3OYD A;  2F5K A;  4F7U F;  2LCL A;  1M1K C;  4M7A B;  3E9G A;  2PVO B;  5GAO n;  1KD1 U;  3OYM A;  3JCM Q;  3BDL A;  1NE8 A;  3P8B B;  3L1A A;  4HCC A;  1OZ2 A;  3PMT A;  3VJP A;  2P0Q A;  1K9M C;  3VU3 C;  1YIT A;  3CBM A;  3CD6 A;  2RJD A;  3LX7 A;  1BI3 A;  2A7Y A;  2M16 A;  3S6W A;  4DA4 A;  1RL2 A;  4XTX A;  5CQY A;  4PJO F;  1M4Z A;  5GMK l;  4C5G A;  2LCC A;  5DLQ E;  3OQ5 A;  3QG1 A;  2CZ6 B;  3QYH B;  2OAU A;  2IG0 A;  3MHX A;  4M75 G;  3WVE B;  3G71 T;  4BE1 A;  3TRE A;  2CS7 A;  3OYH A;  2QQS A;  1X75 C;  4M7D D;  5AYF A;  4C92 C;  3GOX A;  5GAN 4;  1YIJ T;  1VQL T;  2F5T X;  2EKO A;  3CC2 A;  4IUV A;  4A4G A;  4J7F A;  4JLI A;  5FU6 C;  2KMT A;  1B34 B;  1VQ9 T;  2QXF A;  5GAN f;  3CPW S;  2O01 E;  2E10 A;  3C94 A;  1N27 A;  2JN0 A;  4J8O A;  1KC8 U;  3RES A;  3CCM T;  4XU0 A;  3CCS A;  5GAO r;  2X4X A;  3C12 A;  4LDW A;  1FXX A;  4JUV A;  5LJ3 d;  3CME A;  4M7A D;  2LDM A;  3M56 A;  4M75 E;  4XTV A;  2JTM A;  2LQK A;  2R57 A;  3LWI A;  1QVP A;  3A8L B;  3RUX A;  4A4H A;  1SSF A;  4YTL A;  4M75 C;  1H64 1;  3RIR A;  5A0L A;  4KT0 E;  4KUD K;  1K8A C;  2RJE A;  2HBP A;  2QA4 T;  3X28 B;  3WXM B;  3TU4 K;  3JCM X;  1Y96 B;  3CBO A;  1BIA A;  5GAN 2;  2EIF A;  3GNF B;  2VC8 A;  3LGF A;  2VV5 A;  3M57 A;  3ZFJ A;  1VQ4 A;  3SD4 A;  3RKY A;  2QI2 A;  2RO0 A;  3CCV A;  1BI0 A;  2DK3 A;  3PFS A;  3L2V A;  2E6Z A;  3RMQ A;  3JB9 G;  4O6J A;  1U1S A;  3G6E A;  3M4Y A;  1YIT T;  1Q82 C;  4OF1 A;  2GF7 A;  2JVV A;  1WJQ A;  2GFA A;  2X4W A;  5GAN 3;  3RER A;  1VQM A;  5FRN A;  2XID A;  1K9M U;  3GIB A;  4HA8 A;  2KDS A;  1LJO A;  4M75 F;  4ZGE B;  4XAX B;  2WAC A;  1K73 C;  2RM4 A;  1ZBX A;  2H3J A;  1YBY A;  2MAM A;  1QP3 A;  3TCJ A;  5GAO p;  3CC2 T;  2JNG A;  4C8Q B;  4F7U A;  3DLL A;  4J6Y A;  4PKC C;  1U8R A;  1QVG A;  1VUB A;  2RI2 A;  1UGR B;  2PU9 B;  4XU2 A;  3CC7 T;  2L3R A;  4L6V 5;  3QSU A;  4XTU A;  5GAN 7;  3SWN B;  4JS5 A;  3CXC A;  2A3L A;  3CC4 A;  1O9S A;  1N9S A;  2KQW A;  3M5A A;  2DXT A;  1G3Y A;  1M90 U;  5CVI A;  4FL6 A;  3OS0 A;  4PJO A;  4RKU E;  2RHI A;  3CCS T;  4R56 A;  2GFU A;  4HCZ A;  4N4H A;  4OGC A;  4A54 A;  4RCB A;  2WSC E;  4DOV A;  3P8H A;  1M1F A;  2CYZ B;  1LOJ A;  5D6X A;  1YHQ A;  1EIF A;  2D0Q B;  3V8J A;  1NPR A;  3QZ9 B;  3V7C A;  1QP2 A;  1K8A U;  4J5Y A;  2E70 A;  3M9Q A;  3CCL A;  2RHX A;  2EAY A;  1WNL A;  3EFR A;  1VQ4 T;  4RG8 A;  3CMA A;  3CCV T;  1S72 T;  4A4E A;  1U1T A;  1UGP B;  3JSC A;  4MML A;  5CKB A;  2JZ2 A;  3GPL A;  2OTL A;  4DQ2 A;  3G6E T;  4BE2 A;  3CCQ T;  3JB9 J;  3L2Q A;  3MET A;  1KQ1 A;  1VQM T;  4GY5 A;  2L5Q A;  3QJ6 A;  3S3N A;  4C92 A;  1OZ3 A;  4NL2 A;  5IT9 E;  1UB4 A;  1PSF A;  1KHI A;  2RD1 A;  2K5L A;  4C92 G;  3OYF A;  2RJF A;  3QUI A;  3OYG A;  5D6W A;  1K73 U;  4BI4 A;  4Y91 A;  4R55 A;  1BI2 A;  2KAF A;  4XK8 E;  1WQ7 A;  3SB2 A;  4N4G A;  1Y71 A;  3VYG A;  3X20 B;  4B9W A;  4A4F A;  2DD5 A;  5I2S A;  2CKK A;  2X4J A;  2RI3 A;  2Y90 A;  4IUU A;  3CC4 T;  5GAN 6;  2FL7 A;  4M77 G;  2DXU A;  5CKD A;  5IAY A;  3NTH A;  3TEE A;  3LW5 E;  1QVG S;  3J81 E;  2CZ0 B;  4HKE A;  1AHJ B;  3FJP A;  2YRV A;  4X9D A;  3HKS A;  1YJW A;  4V2S A;  4E7J A;  4M75 A;  3CXC S;  1BIB A;  3FDR A;  4C0F A;  1VQ8 A;  5LJ3 h;  3OYN A;  2V8J A;  2VGN A;  2K3Y A;  2XD0 A;  5I2M A;  2OTJ A;  2AHJ B;  4C92 E;  3OYB A;  4PLL A;  2LVM A;  4E7L A;  1YHQ T;  3ER0 A;  4C0D B;  2K2V A;  3LLR A;  4F7U B;  2ZPE B;  4J6W A;  3I56 A;  2XDB A;  3OYC A;  4OB1 B;  2LT4 A;  5DY9 A;  3CCL T;  3OW2 A;  4B9X A;  1VQ5 A;  3V7S A;  2KSS A;  5CKH A;  3QPH A;  4M78 C;  4M77 E;  3PNW C;  5LJ3 g;  3CMA T;  2K5I A;  4II1 A;  4MZP A;  4PJO B;  2DXC A;  4M77 C;  3DB4 A;  2CZ1 B;  4J83 A;  2ZPI B;  1ZHI A;  3J7A F;  3JB9 D;  4QVZ A;  3QHS A;  2EQM A;  3PIP A;  4ZTJ A;  1I4K 1;  3SDZ A;  3CPF A;  3OYL A;  5J3B A;  5FLX E;  4ELY C;  2QQB A;  4L59 A;  2KVQ G;  4A53 A;  4X34 A;  4EMK B;  4EMG A;  5CAI A;  3HRS A;  5LJ3 j;  2RK1 A;  3QJY A;  5C0M A;  3HHT B;  3OYJ A;  2EJ9 A;  2E12 A;  5GAN 5;  3HFN A;  1M5Q 1;  3VYH B;  4C92 F;  3HFO A;  5CR2 A;  4JRP A;  4RCC A;  1YJ9 A;  1M9S A;  4EPC A;  3OY9 A;  1NZ9 A;  3X24 B;  5KE3 A;  4NL3 A;  5FU7 C;  1Y7X A;  2L89 A;  4C8Q C;  4ZTF A;  1BKB A;  4M78 F;  5HK3 A;  2NLU A;  1XNI A;  2ZGW A;  3MP1 A;  3O8V A;  4KUL A;  2ZPG B;  2WSF E;  3E1S A;  5GAM h;  3UDC A;  1N8R C;  1WGS A;  4M77 F;  2LX9 A;  4E7K A;  4NS5 A;  1RI0 A;  1W4S A;  2MWO A;  4MZT A;  4VUB A;  3CCU A;  3SWN C;  2VXE A;  1NJI C;  2HD0 A;  2P0P A;  4FU6 A;  4IUT A;  4MMK A;  5CKF A;  1M1K U;  1I8F A;  3CD6 T;  3INZ A;  4QQ6 A;  1VQ8 T;  2BKD N;  3FRN A;  3FB9 A;  4BUG A;  2I2L A;  4M7D G;  4ZN3 A;  4N0A C;  4LD9 K;  4PJO D;  3PGG A;  3LH0 A;  5LJ3 e;  4UC4 A;  2RH2 A;  5GAN d;  3L2Z A;  3I56 T;  1BYM A;  1V29 B;  2E64 A;  1KHC A;  4OGE A;  1WJR A;  1ZQ1 A;  2EJF A;  3DLM A;  4Q5W A;  2K57 A;  2K5F A;  3DB3 A;  4C8Q F;  5C6S A;  5GAM d;  4QQG A;  3OYE A;  3JCM h;  3CCE A;  4BY6 C;  5A0G A;  3EAE A;  3P8D A;  4IUR A;  5M9O A;  4M7A G;  3MP8 A;  2B8A A;  2QTX A;  3OW2 S;  4C0Z A;  4C5H A;  2M1H A;  4KUI A;  3HSB A;  2EFI A;  5L8R E;  4M75 B;  4HT8 A;  3R6O A;  5FRO A;  3L42 A;  5HK0 A;  4CI0 C;  3CME T;  3X26 B;  4ATO A;  2C06 A;  1VQN A;  4M7D E;  2CGH A;  2DXB A;  3N5B B;  4MZM A;  2BUD A;  3X25 B;  2JTF A;  1VQP A;  1TH7 A;  4M7D C;  2YLC A;  2RJC A;  3KUF A;  4BI3 A;  2MMP A;  5A0D A;  2D9T A;  3SFM A;  2KY9 A;  3JCM b;  2DZ9 A;  1JB0 E;  2RHY A;  1MGQ A;  3FIF A;  5LJ5 h;  2E65 A;  1BI1 A;  4IUP A;  2Y4Y A;  3PMI A;  4XU3 A;  3MEA A;  3A8O B;  3A8G B;  2XU8 A;  2DTH A;  4BI8 B;  5GAN e;  4Z02 A;  1B34 A;  3JCM d;  3BDU A;  4XTZ A;  3BFM A;  2E1H A;  2HQX A;  4M7A E;  3OYA A;  1M8V A;  4OB0 B;  3OSV A;  5GAO m;  3CCU T;  1R8O B;  2LT1 A;  3OBW A;  4BAC A;  5GAM e;  4M7A C;  1H3Z A;  2DD4 A;  3J80 E;  4E7H A;  3M55 A;  3ASK A;  2DIG A;  4LDY A;  1UEB A;  2ZPH B;  4OB3 B;  4JRK A;  1D3B A;  2O4X A;  4ZGJ B;  2GQV A;  1NJI U;  1OI1 A;  4A4K A;  3G71 A;  2EQK A;  3HRT A;  1Q82 U;  4M7D F;  5HKC A;  3ME9 A;  3MEV A;  3OYK A;  4LDX A;  1HXD A;  4FT4 A;  1YI2 A;  4M75 D;  4LDV A;  4FIB A;  5LJ5 d;  4JRI A;  4E47 A;  1QVF A;  2K4Y A;  2LTO A;  2QQ9 A;  4P5N A;  3FC3 A;  1Y96 A;  4M78 A;  2DKG A;  4MDW A;  3OMG A;  3V7R A;  4C0D C;  4JJN K;  1VQ9 A;  1HK9 A;  3QKJ A;  3CCR A;  3JCM P;  4N4I A;  5DLO A;  4M78 G;  4M77 A;  1KQ2 A;  4L5G A;  5J39 A;  3CCE T;  2YLB A;  4HT9 A;  1I81 A;  2XDD A;  1VQ6 A;  4IUQ A;  2EYQ A;  3T9N A;  2XI9 A;  1G3W A;  3JCM e;  2DTI A;  3HRU A;  3CCM A;  2FVU A;  4M7A F;  2HAX A;  3A8H B;  3JB9 H;  2K3X A;  2QEX A;  1VQN T;  3MCA B;  4WF2 A;  3UT1 A;  5A2Q E;  4JS4 A;  2LNV A;  3G7Z A;  2FHD A;  4QW2 A;  2V8K A;  1W2B A;  1DJ7 B;  3OYI A;  2X35 A;  1VQP T;  1G3T A;  1WQW A;  3LGL A;  1G5V A;  1M1G A;  1WJS A;  5LJ3 f;  3LWH A;  2QA4 A;  2BIV A;  3BW1 A;  3FLG A;  4FSX A;  2R5A A;  2E6N A;  4C5I A;  3MO8 A;  4EMK C;  4DOW A;  1FX7 A;  2Y4X A;  2PVG B;  4XQ3 A;  1X6O A;  4C8Q A;  3HL8 A;  4IKF A;  1OYX A;  2ZCF B;  1KG1 A;  2QQR A;  2M9U A;  3M54 A;  4M78 E;  5LJ5 e;  3JB9 I;  4C8Q G;  3DKM A;  3M4G A;  1IZ6 A;  3BY7 A;  3QDR B;  2RK2 A;  3SWN A;  1UGS B;  3NTK A;  3OMC A;  2OTL T;  2VGM A;  2L8D A;  5CO7 A;  1P92 A;  1G3S A;  4QVD A;  4EMH A;  2EWN A;  2PVD B;  5CIU A;  3V8K A;  4BB7 A;  1VQ7 A;  4HCB A;  1PSE A;  2P4T A;  3WVD B;  3Q1J A;  1Q81 C;  1N6A A;  4N0A A;  3A8M B;  2LQ8 A;  3QZ5 B;  2PQW A;  4QQD A;  3URG A;  5GMK m;  4O5V A;  2RB6 A;  4TVR A;  3NTI A;  3JCM W;  2EQU A;  1XOV A;  3M59 A;  1YI2 T;  2D6F A;  5CKE A;  2DTO A;  2RI5 A;  4ZN1 A;  2R58 A;  3OS1 A;  3E9F A;  2XG8 D;  2EQJ A;  5GAN h;  4LD6 A;  3CC7 A;  3S3O A;  1YCY A;  4C8Q E;  2DAQ A;  3OA6 A;  1JJ2 A;  3CCR T;  1M90 C;  2XKO C;  5KCH A;  3C4S A;  1QW1 A;  4OVA A;  2EJG A;  1VIE A;  1Q7Y C;  3M53 A;  4OP0 A;  1QVF S;  2G3R A;  1VQ6 T;  1Q86 C;  5KCO A;  4MDX A;  3CBP A;  3LYI A;  4JRQ A;  2YHT A;  2RHU A;  3MP6 A;  1O75 A;  5GAM f;  2M0O A;  3RKW A;  1VQO A;  2XK0 A;  3UPU A;  2DO3 A;  3VV0 A;  2QEX T;  1D3B B;  2O4X B;  1YJW T;  2ZPB B;  5GAN g;  3FEO A;  5LL6 S;  4M7D A;  1NPP A;  4BDZ A;  2HQE A;  2ZPF B;  4FM4 B;  3OBY A;  4C92 B;  3JCM J;  2X4Y A;  4PLI A;  2OTJ T;  1YJN A;  5DM7 R;  3JCM V;  4BE0 A;  3HPW A;  4CRI A;  2RA2 A;  2WSE E;  3OB9 A;  3JAM E;  2DPP B;  3RKX A;  5FU6 B;  1FWZ A;  5GAM g;  2LRQ A;  3F70 A;  4Y28 E;  3GNG A;  4M78 B;  4QVC A;  1W2B S;  2FYK A;  2V8I A;  4X9C A;  5GAN j;  2VUB A;  2HNI A;  4M77 B;  2GCX A;  1VQ5 T;  1JRI A;  1XTD A;  1S72 A;  2PUK B;  4JDS A;  2JOY A;  4M7A A;  2MF2 A;  3OSS C;  5CQX A;  3VUZ A;  2CZ7 B;  4BD3 A;  3JCM f;  3CCQ A;  4LDU A;  3RMS A;  5GAM j;  1VQ7 T;  1KQS A;  3L2W A;  2QDY B;  1MHN A;  1VQK A;  2FB7 A;  2KK4 A;  2E41 A;  4J6X A;  3VUB A;  5GMK h;  4OB2 B;  3A5Z B;  4ZGD B;  4J7I A;  1Q81 U;  3CCJ A;  3G4S A;  2XDP A;  2DIQ A;  4C0G A;  3JCM g;  2IVW A;  1UGQ B;  5FU7 B;  4XTW A;  3PT9 A;  5IN1 A;  5CK9 A;  3QYG B;  1XQH A;  1YJ9 T;  1JBM A;  5D6Y A;  4C92 D;  1KD1 C;  4F7U G;  3I55 A;  5EG2 A;  5LJ5 f;  5KE2 A;  4RG2 A;  2VXF A;  3NFC A;  3JRZ A;  5J26 A;  4M78 D;  2LC4 A;  5GAO l;  5KH6 A;  4GLK A;  1X01 A;  1JJ2 S;  2RHZ A;  2F69 A;  1Q7Y U;  1VQO T;  3GP8 A;  3MEW A;  4M77 D;  1Q86 U;  3CEY A;  2P0K A;  4PJO G;  3OS2 A;  2DJZ A;  5LJ5 g;  2MWP A;  1N8R U;  5I21 A;  3M58 A;  3MEU A;  3EFS A;  3OYY A;  4NOY A;  3VKI A;  3ZBD A;  5GMK i;  5GMK j;  4EMK A;  3KXT A;  4E7I A;  1YJN T;  2E5Q A;  4PL6 A;  1GXI E;  3KBG A;  2PUO B;  4ELZ C;  3CPW A;  2ZZD A;  4XTY A;  3JCM c;  1IRE B;  5CCA A;  3PTA A;  1YIJ A;  2MI6 A;  1VQL A;  1WPY A;  4F7U E;  4BY6 B;  4BDY A;  5GAN 8;  5LJ5 j;  2XIC A;  3UWN A;  4JLG A;  4RMO A;  2DVE A;  1I5L A;  3HP9 A;  4ME7 A;  1LNX A;  1KC8 C;  1Y07 A;  4XU1 A;  3QBY A;  5HY6 A;  3AHU A;  2QQA A;  4C8Q D;  3L2U A;  3JB9 F;  4C5E A;  4OMF B;  2VYT A;  4PJO E;  4PNO A;  2DEQ A;  3GLX A;  1VQK T;  5FRM A;  4M7D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...