5GANd

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 13
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gand00
2EJ9A 2DJZA 5GAN3 2DZ9A 5GAMd 3JB9H 4M77F 4PJOB 5GANg 2CGHA 4XU0A 4C8QB 4N0AC 3V7SA 5LJ5f 4M77E 2I2LA 3PGGA 1I8FA 3FJPA 2QTXA 3RESA 1D3BB 1LNXA 5GANe 3L1AA 3QHSA 4XTYA 4JLIA 4DQ2A 3FB9A 5GAN6 5GAOp 3JCMX 4M7DA 5GAOr 4M7DD 4EMKB 3V8KA 3JCMb 3HFNA 5LJ5j 4M7DC 2YHTA 4C92D 4WF2A 4F7UG 4F7UE 4X9CA 5GAOl 1U1TA 2DTOA 3M4GA 5GMKi 2RA2A 1N9RA 3L2ZA 4C92C 4OP0A 4EMGA 5GAMg 3JCMP 4MMKA 2EWNA 4PNOA 4M78B 4M7AD 1Y96A 4XU1A 1I81A 1WPYA 4J6XA 2EJFA 3BY7A 3JCMh 2DTIA 2FB7A 2JN0A 4M75B 4NL3A 4M7AC 4XQ3A 5GANj 2RB6A 5LJ3f 3JCMc 4PJOA 2FYKA 4M7DF 4C8QA 3JB9G 3RKYA 4PJOD 4C8QD 4M7DG 1U1SA 4NOYA 4M7DE 1D3BA 5GAMf 3V8JA 1LJOA 4C92F 3RERA 4PJOC 4HT8A 2YLCA 4EMKA 4M77B 4XTVA 4C92G 4C92E 3JCMW 5LJ3j 3JB9D 1KQ2A 5GAOm 4RCBA 5LJ3h 5GMKe 3SWNB 4F7UF 4M7AF 4EMKC 5GAMj 3RUXA 3JB9J 4M7AG 4M7AE 5DY9A 1WNLA 5LJ5h 4RCCA 5GAOq 3QSUA 5CAIA 3HSBA 2K57A 4M78A 5GANf 1M8VA 3JCMQ 3GIBA 1M5Q1 4M78D 1JBMA 2DXUA 4J6WA 3INZA 4J6YA 4PJOF 3BW1A 2VC8A 4M75A 2EAYA 3JCMV 4PJOG 4PJOE 4XTZA 4M75D 4C8QG 4C8QE 4JUVA 4M75C 4XU3A 5GANh 3JB9F 1BIAA 4HT9A 3QUIA 2E10A 2E65A 4M77A 4Y91A 4X9DA 2EJGA 3JCMd 4C8QC 3HFOA 4MMLA 1WQWA 2Y90A 2VXFA 3SWNA 2DVEA 4C92B 3RKWA 1WQ7A 1LOJA 1HXDA 4M78E 4M78G 4HA8A 1B34B 5GAMh 2E41A 4M75F 3V8LA 1I4K1 2DTHA 4M7AB 4F7UB 4M75G 4M75E 4QVDA 5LJ5e 5GAN7 5GAOn 3JB9I 3BDUA 5GMKl 1MGQA 4QVCA 4N0AA 2DZCA 1X01A 3FIFA 2RM4A 1YCYA 4M78C 3JCMg 4C8QF 1TH7A 3BFMA 4A54A 1HK9A 3RIRA 5GAN8 3V7CA 5GAN5 3JCMe 5LJ5d 3QO3A 4M77G 1H641 3RKXA 1BIBA 5GMKj 2RD1A 3SB2A 3VU3C 1I5LA 5GMKh 5GAN4 4M7DB 4XTUA 3JCMJ 4M77D 4C92A 4A53A 5I21A 3EFSA 3JCMf 4NL2A 5LJ3g 2VXEA 4V2SA 2DXTA 1JRIA 4M77C 4M78F 4JRIA 4EMHA 5GANd 1B34A 5LJ3e 2DEQA 2ZGWA 3EFRA 4F7UA 3V7RA 5GMKm 5LJ5g 4M7AA 3SWNC 2YLBA 1KQ1A 5GAMe 2HNIA 2DKGA 1N9SA 2E1HA 4XTXA 4XU2A 5GAN2 1Y96B 2E64A 3AHUA 5LJ3d 4JRKA 4XTWA 4J5YA
chains in the Genus database with same CATH superfamily
2OTLQ 3CC2Q 2OX7A 1Q82U 4N0AC 2A28A 3OY9A 1YHQQ 2BZXA 1VQPT 2QEXA 3CCET 2BIVA 5D6XA 4OMMA 1OZ2A 2VV5A 1KD1C 1M2VA 2EGEA 2LVMA 3FLGA 4ZGDB 1I81A 2EJFA 1ZUUA 1W4SA 4M7AC 1YWOA 4NL3A 3EFOB 2X4XA 3M0TA 3OYAA 3CCMT 1VQKA 2OTJT 1M27C 3TCJA 2AZSA 3RMQA 3URGA 2YLCA 4VUBA 4XTVA 6AT1B 2MYSA 1VQ6Q 4OMPA 1QVFA 4OMFB 2OI3A 5GANf 1M2OA 1WZOA 4E7KA 3VS2A 2DILA 2EAYA 2A08A 1YITT 5KE3A 1YI2A 1B07A 1G83A 3CBOA 1NPPA 4DEYA 3GOXA 1SHGA 5A0LA 1YWPA 1M30A 2O01E 2QASA 2KNBB 1TWBA 2DVEA 5IN1A 2PQWA 2GBQA 1FMKA 4MDXA 1LOJA 3EG0A 4E7LA 4ZTJA 5I22A 4J9DA 5GAN7 4FSXA 1SKUB 1OV3A 1WYXA 2A0FB 5EG2A 3VS1A 2P4TA 1RABB 1HK9A 3CCMQ 2DD5A 2OTJQ 2FZKB 2RQVA 2NUZA 2GGRA 4C92A 3PVQA 4OGEA 1RAEB 4IUPA 4M77C 4EMHA 3CC7A 2GFUA 2E70A 2K2MA 2DRKA 2XK0A 1RAHB 4HXJA 4JRKA 2EJ9A 2M0YA 2KK4A 3A5ZB 1QP3A 2I2LA 3TSWA 3RESA 1D3BB 1ZUKA 3VS4A 2WSEE 5KYUB 1JO8A 2ECZA 5GMKi 4FM4B 4BUGA 1B3QA 3LYIA 3EG3A 4IIMA 1K9MC 1X6BA 4M7AD 4XU1A 1ZSGA 1UE9A 1QVGA 1KD1U 3THKA 1XOVA 1MMGA 1MV0B 5KYYB 5CKBA 3VS7A 4PFPA 2MIOA 5KYXA 4DBRA 4M7AE 2DA9A 5LJ5h 1GL5A 2DBKA 3J7AF 1M8VA 4RMOA 2DRMA 3JCMV 2GTJA 2EW3A 3DB3A 3OYDA 4JUVA 3F70A 1VQ9T 2QQRA 3CCLA 2H3JA 2KXDA 3EG9B 3OS2A 1QMCA 2J06A 2HKNA 1ZBJA 2L3QA 2X9HA 2RI3A 4FIBA 3WVEB 4Z02A 3OYHA 5IH2A 2DL8A 3I5RA 5GAOn 4JPBW 2V8IA 3LX7A 1UTIA 3PNWC 4JJBA 4C8QF 3QIIA 1VQLA 2DL7A 5IT9E 2YRVA 3UA6A 4BE1A 4BY6B 5KE2A 2RNAA 3C0CA 2LJ3A 1VIEA 4M77D 2E3HA 1VQOA 5AYFA 4M78F 3EGXA 2ZGWA 3HTRA 5M9OA 5FRMA 1LVKA 2CYZB 1KFZA 3HHTB 3L2UA 2JOYA 1X43A 1XNIA 2YUPA 4J5YA 2LCCA 3O5ZA 1ZHIA 2G3RA 2FRYA 2K5IA 1PWTA 1R0CB 3JB9H 1VQKQ 4M77E 5FROA 1A0NB 2QGFB 3NFCA 3M57A 2QG9B 1BCMA 4C0DB 3ZBDA 3ER0A 1JXOA 2HL5C 2KXCA 1M9SA 2J6OA 5FU7C 5GAOl 3MEAA 2C0OA 2V8KA 2E3IA 4A4KA 3CC4A 1Y71A 2KE9A 2E6ZA 3OW2P 2LRQA 1AZEA 2KI7A 1UEBA 1KIKA 3M4YA 4JJDA 2AKLA 4CC3A 2FYKA 1ZSZA 5HK3A 4NOYA 1K9MU 3V8JA 1PG5B 1Z9QA 2JTMA 3HKSA 5LJ3j 3JB9D 3H0HA 2KEAA 3CBMA 1OPKA 5GAMj 5J39A 2CZ7B 2VVKA 3OYEA 4IUUA 2X35A 3Q1JA 1D09B 3JAME 1K73R 3GIBA 1JBMA 2SEMA 4ZGEB 4J9EA 2EQJA 4QKUA 2Y4XA 3EH1A 1PKSA 2D0NA 2G6FX 3OS5A 3VUBA 4FYYB 3HFOA 1Q86R 4MMLA 1WQWA 3MP6A 1RAAB 1WXBA 4IKFA 1I5OB 1QQJA 2EQKA 3H8ZA 3NTIA 1PSFA 4OMNA 3G71T 2A3LA 2ESWA 3BFMA 3RIRA 3JCMe 3H9NA 2EKOA 4KT0E 4C5HA 5GMKj 4KH0B 4PJLA 3GNFB 4XTUA 4M7DB 3CEYA 1WHKA 4WCIA 3CCJA 2L8DA 1VQ8T 1RI0A 2RQUA 5GMKm 2YUOA 3E9GA 1RL2A 3ME9A 2FZGB 4LNPA 2YLBA 4D8DA 2F2VA 4P5NA 3M9QA 2CP0A 1NPRA 3CCVA 1ZX6A 2EVRA 2QA4T 1I8FA 1LNXA 4TVRA 3I56T 3S3OA 3HFNA 2KDSA 3VS6A 4BI4A 3L2RA 3GPLA 3BE3A 2RA2A 1D0ZA 3VRZA 2JM9A 2PU9B 3CPFA 2Z0WA 3MEUA 3JCMc 1KJWA 2K2VA 3H41A 1WIEA 2FPFA 4M7DG 2I0NA 3M59A 1ZBXA 4C92G 1VQ5A 3QJYA 4RCBA 3CCSA 1D1CA 1G3YA 1VQ8Q 3RUXA 2ZCFB 1KC8C 4C0GA 1I1JA 4C0FA 3EFOA 3PFSA 1TU0B 4XTZA 2OTLA 3CBPA 5KYWB 3CC2A 1QVFS 1VQLQ 2CDTA 1IHWA 1YHQA 1YN8A 1MNEA 2ZPIB 1KC8R 4C8QC 4ZN3A 2YUQA 3C95A 1IGQA 2RJDA 3RKWA 4RG8A 1BB9A 2F5KA 2DMOA 3TREA 1RAIB 2B86A 2RI5A 4KULA 4E7HA 1I4K1 2YSQA 2WSCE 2RK2A 5LJ5e 1AT1B 1K8AR 3D7SB 3EH2A 2OAWA 3I9QA 4M78C 2KMTA 1BI0A 1B7TA 4IUTA 3VS5A 1Z9ZA 1BIBA 3M0RA 1VQ6A 2DJQA 4J9FA 1GFDA 1YJ9T 2JMCA 2O9SA 3L2WA 1R8OB 4JRIA 2RJCA 1C1AA 4R56A 3VYHB 2NUTB 4LDWA 3NTKA 1QKWA 1PRMC 2O4XB 1IHVA 3AHUA 3X24B 1K76A 3AT1B 1PKTA 3FJPA 3QHSA 4RUGA 5FW9A 4DQ2A 4RTZA 2K7AA 2YHTA 2EQIA 1Q81R 3ZEHA 3I55T 2DE0X 1WPYA 3LH5A 2JN0A 1ZUYA 4XQ3A 3CCMA 2OTJA 1JEGA 4BACA 3M0PA 3T9NA 1RLQC 1D3BA 1Q82R 3P8HA 1H3ZA 5KYUA 4JRQA 4ORZA 3A8MB 1YJ9Q 1QVGS 3VKIA 3VRYA 3SWNB 5IAYA 3TVTA 1AHJB 2RK1A 4RCCA 5GAOq 1M3CA 2P0KA 2CP5A 3J80E 2EQUA 2CUDA 1YITA 2OJ2A 4Y28E 1KC8U 2K5FA 2PUKB 5KYYA 2YXYA 1PSEA 3E19A 2KQWA 2KYMA 3QYGB 1QLYA 3KXTA 3P8DA 1QVFP 2A37A 4OB1B 3I55Q 2LDMA 1K8AU 1PRLC 3E9FA 3ASKA 1NEBA 3DB4A 1WJSA 2DL4A 4PLLA 1VQNT 2RHXA 4ANJA 3QO3A 3EG9A 1R77A 1PM3A 1H641 3A8LB 3M0SA 3MP1A 2HZYA 4L59A 3EFSA 3NMZC 2SRCA 4Z8AA 3C4SA 1U06A 4IUQA 2DF6A 4E47A 3PE0A 4NS5A 1YIJT 3FDRA 4AFUC 1N9SA 2XDBA 2E64A 1SSHA 2A36A 1ACMB 5CKHA 1AWOA 1KHIA 2VUBA 4PJOB 1NLPC 3S6WA 4EMKB 2HMAA 3V8KA 3MP8A 1VQ5Q 1R0BG 2H8HA 2RJFA 4EMGA 2M0OA 3CMAT 1SHFA 2L3SA 4FYXB 4DOVA 5GANj 3M0QA 2FEIA 4M7DF 2LNHB 4JZ3A 4KUDK 2DPPB 1KQSA 1LJOA 4C92F 2CSIA 2IPOB 1S1NA 3NGPA 3JSCA 2GF7A 4O6JA 3HRSA 3JCMQ 3UF4A 1EIFA 4O5VA 1TXQA 1CKBA 4JS4A 4PJOG 2K9GA 1QVGP 1CSKA 2ZPGB 1VQ9A 3MCAB 3MHXA 2YT6A 4OF1A 4PKCC 4E7JA 1KD1R 4X9DA 1VYVA 3UT1A 4A4GA 2DYIA 1SPKA 1TUCA 3FRNA 3LW5E 3ULRB 2E5QA 1FWZA 1WJQA 1OI1A 2L3PA 2VB6A 5J3BA 2QDYB 4F7UB 4QVDA 2BE7D 3FJ5A 4J9HA 3FC3A 2RPNA 2F2WA 1UECA 1K4US 2DEUA 1W2BS 5FU6C 3CPWA 1M90C 3N5BB 4RTVA 9ATCB 3PTAA 2JW4A 1MMDA 1VQPQ 3CCEQ 5LJ3g 2MWPA 1OX8A 1T0JA 4E7SA 1JU5C 4MZMA 1VQMT 4OVAA 2V1RA 4KGVB 2JNGA 2ENMA 2DJZA 1F1BB 2DZ9A 3LLRA 2DERA 2HBWA 3V7SA 2CH4W 2GFAA 3L1AA 4XTYA 4M7DA 2XG8D 5GAOr 4F7UG 3REAB 5IHKA 1TUGB 1N9RA 3L2ZA 4JDSA 5DM7R 2VGMA 8ATCB 2E4HA 3REBB 3BY7A 2FB7A 2YDLA 1YITQ 2ZZDA 1M3AA 1M8MA 4ZNXA 4QT7A 2HBPA 3RR6A 4PL6A 2ZPHB 1QKXA 3PVLA 1BU1A 1PCXA 4HVWA 2XDDA 1DJ7B 2PZ1A 1NJIC 1VQMQ 1OQKA 2M1HA 1BKBA 4AFSC 1Y0MA 1TS9A 3G1JA 1K9MR 1MHNA 2VXFA 4J83A 2CH4A 1AVZC 3LH0A 4HA8A 1VOMA 2RF0A 4M7AB 3JB9I 1GCPA 5KYWA 1QCFA 4A54A 3QG1A 5GAN8 2L89A 2O88A 3MJXA 4FU6A 1NG2A 5A0DA 2RD1A 4RTTA 2XD0A 1K0XA 3JCMf 4EPCA 2VXEA 1VQ8A 1M90U 4IUVA 2DETA 3EFRA 1O75A 2DNUA 3V7RA 4F14A 1ARKA 2F69A 2CP2A 2K3BA 5DLQE 1FXXA 1BBZA 1K1ZA 2LQNA 4OMOA 1NBEB 1E6GA 2QA4A 2MMPA 1WHLA 2F1LA 5GANe 5LL6S 3O8VA 1WI7A 1YFNA 1MMAA 2JMAA 2R58A 3M53A 3X20B 1VQ4T 2KT8A 5LJ5j 4M7DC 1WXTA 1XTDA 5I2SA 2FL7A 1IREB 4C92C 2NUTA 1YP5A 4MMKA 4LDVA 3J81E 2O4XA 4PJJA 1RUWA 3VJPA 3OB9A 2PNIA 4M75B 1JB0E 4FT2A 4XAXB 4E7IA 1VQ9Q 4F04B 1OEBA 3KFVA 3RKYA 1U1SA 4AMCA 3GBQA 5KH6A 3OYIA 4HT8A 1D0XA 4M77B 1NEGA 2COWA 3RMSA 5LJ3h 4BI3A 2BE9B 3ZL7C 4KH1B 3GF5A 1IZ6A 4PJOF 2HCKA 1N6AA 1D1BA 3OSSC 2J6KA 1NJIU 2M16A 4CC2A 1GCQA 1I0CA 4II1A 2D0QB 1VQ4Q 3SWNA 2JUFA 2QQAA 3CC7T 2BZ8A 2L3RA 5D7UA 4M75G 1OULA 2D9TA 3G7ZA 4GBQA 1Y57A 1YNZA 3QSUA 1TH7A 1JJ2A 1D1AA 2CKKA 2F5TX 4M77G 3R6NA 1TSFA 3DLMA 3MKDA 5GMKh 3IQLA 1N8RC 1YJ9A 1FX7A 4QQGA 1YJWT 1W2BA 1UHFA 4LDXA 2DM1A 2HNIA 2E1HA 2DYBA 2CREA 1WA7A 5FWBA 2JS0A 2AZVA 2Y4YA 2MK5A 3WVDB 2BTTA 1WFWA 2EKHA 2M02A 4JJCA 3NHNA 1NZ9A 1PC0A 2LNVA 3CXCA 2QTXA 1KSWA 3FB9A 4M7DD 2L5QA 2MWOA 2X3XD 2V26A 2GQVA 4C92D 2DBMA 1W70A 1U1TA 3X26B 2V1QA 2EWNA 3I55A 4KBMB 3SEMA 5I21A 2CUBA 5GJVB 4J9IA 5LJ3f 4FL6A 2E6NA 4PJOA 5CO7A 2FVUA 1VA7A 3JB9G 4M7DE 2J05A 5GAMf 4AFQC 1OX9A 4EMKA 4C92E 2HAXA 3JCMW 1O9SA 2AHJB 2K3YA 4PFOA 1YJWQ 2KROA 1LPLA 2K57A 4KRTA 2EYQA 1KQSS 1SSFA 1M5Q1 2DXUA 3G71Q 2IG0A 3UATA 1Q7YC 4E6RA 2EGCA 2LZ6B 1G2BA 2RHIA 5CKFA 5FU7B 2KT1A 1ZSZC 2DLPA 1FYNA 1M1KC 1IRXA 1AEYA 4C5IA 1UGVA 2DZCA 4BDYA 2LCLA 3TEEA 1AWJA 2M51A 3OYCA 3RKXA 2FPDA 2QA4Q 2K79A 2MAMA 1IXDA 1G3WA 1PNJA 3I56Q 1MV3A 4LDYA 2CZ1B 3CPWS 3GP8A 1SG5A 4RTUA 2ZPBB 4F7UA 1WHHA 5CIUA 7AT1B 4HCZA 2RHYA 1N8RU 4ESRA 4RTYA 4LD9K 2DXCA 2L2PA 1SRLA 4XTWA 2V8JA 5KCOA 2R5AA 3VYGA 1X75C 1M3BA 3PGGA 1ZLMA 4AG2C 4JLIA 1UJYA 2HQEA 2D6FA 1Q95G 4ELYC 4HCCA 4MZTA 4X9CA 3CMAA 3EGUA 4MZPA 2HQXA 3OYGA 2QQBA 4QQDA 4Z89A 3M55A 3H6ZA 3VUZA 4IIOA 2C0TA 1UJ0A 1TUDA 3QXEB 1VUBA 2P0PA 4Q5WA 4PJOC 3M58A 2ATCB 1T0HA 4JRPA 5GAOm 3CCEA 1VQPA 1H8KA 1QWEA 4EMKC 2DD4A 2RH2A 4YTLA 4J6YA 5ECAA 4B9WA 4OGCA 1P92A 4LUDA 2COYA 4R55A 2FPEA 2E65A 1G3TA 1KQSP 2DFUA 1X2QA 2DIQA 4HVUA 3JCMd 2J6FA 2RJEA 3FEOA 2K5LA 1Q7YU 2J7IA 3CCJT 1HXDA 2A7YA 1RLPC 1B34B 4M75F 3G4ST 1YJNT 4N0AA 3QYHB 2LQWA 3JCMg 3OBYA 1I07A 4QVZA 1VQ7T 2MI6A 3CCRT 1PD1A 1AWWA 2KR3A 3SB2A 3VU3C 1I5LA 4C5EA 3A1PA 1XQHA 1OYXA 2RMOA 2KSSA 4ZTFA 4E2FB 2C06A 1BI3A 2XMFA 4M7AA 2ROLA 4BI8B 1KQ1A 3GLXA 1VQMA 1G8XA 3EG2A 5GAN2 3SFMA 2E12A 3CPWP 2W0ZA 2GNCA 2CGHA 4C8QB 2LCSA 1VYUA 4OB3B 3JCMX 4J9BA 1T3LA 1GRIA 4JZ4A 4ME7A 3OYBA 3CCST 3UDCA 4X34A 2DX1A 2ZPFB 4M78B 3G4SQ 1YJNQ 3X28B 5HKCA 2EPDA 2OTLT 1VQ7Q 4LUEA 3CCRQ 4PJOD 2YUNA 4RG2A 4BE2A 1KQ2A 1FMWA 1KG1A 2MOXA 5CQYA 2FG0A 4E7ZA 3S3NA 3VV0A 1C0MA 2PTKA 4PK4A 3PMTA 3UPUA 1V76A 1TOVA 2FHDA 3PT9A 3UWNA 3BW1A 4M75A 3OBWA 4PJOE 3CD6T 3GNGA 3PIOA 4C8QG 1OOTA 1VQNQ 4XU3A 1AWXA 1WHGA 3QWXX 3KUFA 4M77A 4Y91A 2NWMA 4XK8E 2EJGA 2D8HA 1WJRA 1SRMA 2KRNA 3CCUT 1YBYA 4M78G 3CCQT 1MMNA 2BUDA 1YIJQ 1QWFA 3V7CA 1QW1A 1GBQA 5I11A 1EX4A 4FSSA 2X4YA 2LJ0A 2GTOA 2PVDB 1EFNA 1RI9A 4NL2A 4V2SA 1JJ2S 5CK9A 1Y07A 3I35A 2DEQA 4GLKA 3EGDB 1UB4A 3CMAQ 2KY9A 5DLOA 2QQ9A 4XU2A 4ELZC 3CD6Q 4J7FA 5LJ3d 2B8AA 2DXBA 3TU4K 3TQ7P 5GAMd 5HY6A 4ATOA 3HRUA 3QWYA 2P4RA 1VQ4A 3CCUQ 3NTHA 1QP2A 4F7UE 2CP6A 4RTWA 3CCQQ 2K6DA 3M4GA 2FZCB 2MPXC 2BKDN 2QGGA 5GAMg 3CXCS 1WHMA 1M90R 4J9GA 2AIRB 3JCMh 4HKEA 1U3OA 4OMLA 5I2MA 1AZGB 2HKQB 1NYGA 4B6MA 3JRZA 2DVJA 2CSQA 4EDUA 4BY6C 1U5SA 3EAEA 3QBYA 5A0GA 4DBHA 5CAIA 3HSBA 1T3SA 4J6WA 1ZQ1A 4Z88A 4FW1A 5L23A 2VYTA 4A63B 1QCNA 4M75C 2VWFA 1UGQB 4HT9A 3PMIA 2RO0A 2CP3A 5J26A 1TG0A 1WX6A 1ABOA 3G6ET 3C94A 1MUZA 2LP5A 4C0DC 1M1FA 3SDZA 2HEQA 5GJWB 1S72T 3M5AA 2H3EB 3HL8A 2QK0A 2LT1A 2DAQA 1BYMA 3BDUA 5GMKl 4X1VA 1X01A 2D1XA 2HQHA 4RKUE 3I5SA 4N4HA 2CZ6B 5A2QE 2KRMA 1U8RA 1NM7A 4D6WA 3OW2S 8AT1B 3EG1A 1NJIR 2XHCA 3E2UA 1YJWA 1JRIA 1JXMA 3QZ5B 2EYYA 3HRTA 4J8OA 4BDZA 1CKAA 3G71A 1Y96B 3CQTA 1IGUA 2JJ9A 2KBTA 3CMET 2P0QA 1RAGB 1JJ2P 3OMCA 4XU0A 3WXMB 4DA4A 3G6EQ 2EIFA 4PJMA 3JCMb 2QEXT 1S72Q 2DTOA 2EGAA 3QZ9B 1W2BP 2JM8A 1G5VA 4PNOA 4HCBA 5FU6B 4RTXA 4EIKA 4QQ6A 2RQRA 1RADB 1VQKT 3CXCP 3RERA 1WLPB 3I56A 3LGLA 2HSEB 2P84A 3LGFA 5IHIA 1OU9A 4M7AG 5DY9A 2NUPB 2PVGB 1SF9A 5C6SA 3CMEQ 4M75D 3META 4LE9A 2YRDA 4DEXA 1YI2T 3OYLA 5HK0A 2LTOA 2MCNA 1KK7A 3HP9A 2QEXQ 3A8HB 1WQ7A 1WHJA 5GAMh 1HD3A 2E41A 2LQKA 4A4FA 2DTHA 4PLIA 4M75E 1NLOC 3RNJA 2XU8A 1SEMA 2ZAEA 4QVCA 3A98A 2VGNA 3E1SA 2X3WD 2K3XA 2ABLA 2YWWA 3LWIA 5GAN4 3JCMJ 3X25B 2ED0A 2RN8A 2DXTA 1B34A 2YRCA 1M2VB 2QAZA 2DKGA 4K11A 4XTXA 2RI2A 2GCXA 1ZA2B 3ZFJA 4A53A 3OYMA 4KGZB 4BD3A 1YI2Q 2WACA 2X51A 1ZA1B 1K73C 5LJ5f 5FLXE 4FW2A 4HCKA 1M4ZA 1LCKA 2JTFA 5D6YA 4KUIA 4AT1B 4F16A 3JCMP 4J7IA 1Q86C 1GXIE 1XJWB 5D6WA 2DL5A 1YCSB 4AG1C 4J6XA 5KCHA 2R57A 2DTIA 5CKDA 1N8RR 2GQIA 4GY5A 2JZ2A 3L42A 2F2XA 4C8QA 4PFZA 3QKJA 1QVPA 3OA6A 1BCOA 2CZ0B 3OSVA 2AK5A 2O2OA 3OYNA 1RACB 4C5GA 2LMJA 2QDLA 3EHRA 1EZZB 1HSQA 2O31A 4F7UF 1UG1A 3CC7Q 3VS0A 2LX7A 4ZN1A 2KAFA 3MO8A 2DK3A 2CP7A 4M78A 4IURA 2EYWA 1GFCA 1JQQA 2DL3A 2ED1A 4QW2A 4BB7A 1J3TA 2VC8A 3L2QA 5IXBA 1AOJA 4CC7A 3CCLT 5CKEA 1UGSB 2E10A 3QJ6A 5C0MA 1BI1A 2EBPA 2LQ8A 2LJ1A 2Y90A 2AKKA 2QTVA 4C92B 3OS0A 3LWHA 3V8LA 5IHNA 2E5KA 3G4SA 1YJNA 4DBQA 4FCYA 3P8BB 3FIFA 2LC4A 2JS2A 2X4JA 1VQ7A 2IIMA 3CCRA 4LDUA 1VQLT 1WGSA 2CS7A 3OS1A 1E6HA 5KYNA 2XICA 5CCAA 2NYSA 1BK2A 5CR2A 1H3HA 1TTHB 5GANd 3H0FA 1GCQC 1VQOT 1Q7YR 2DO3A 2OAUA 3R6OA 1VYTA 3SWNC 3S3MA 2FRWA 3OW2A 2PVOB 1VQNA 2RHZA 4CI0C 5GAN3 4A4EA 3CCLQ 3QDFA 5GANg 1M1KR 2QYZA 4Y92A 5GAOp 3M0UA 2DIGA 4C0ZA 2X4WA 4FYVB 3MEVA 4R0KA 4WF2A 1K73U 2KGTA 3EGDA 5KYXB 2EYXA 2XKOC 4OP0A 4CC4B 3L2VA 1YIJA 3CC4T 4OB0B 2FO0A 3A8GB 2RB6A 5CVIA 3QPHA 4JS5A 2AT1B 3OYKA 1Q86U 4DOWA 1MNDA 1K8AC 3VS3A 1UHCA 2KYBA 2QQSA 2XDPA 3MPUB 4JLGA 1VQOQ 1HYOA 4M7AF 2VASA 2KRSA 2JXBA 1OPLA 4N4GA 3INZA 2RQWA 3CD6A 2HL3A 1X6GA 1NE8A 4HVVA 5FWCA 2PUOB 2EYZA 3QUIA 3RBBB 1V29B 4ZGJB 1N27A 1KHCA 1X6OA 1W6XA 3CCUA 3M56A 3CCQA 3DKMA 3EGXB 1V1CA 4MDWA 3CC4Q 5FRNA 2W10A 4LN2A 1MGQA 1AD5A 2M9UA 1YCYA 3RDVA 2JVVA 3OMGA 4KGXB 1Y7XA 1IO6A 4BE0A 3U23A 1Q81C 1W1FA 4M4ZA 1WDXA 1G3SA 1X27A 2D8JA 1VIFA 2EFIA 2C0IA 2O9VA 1GBRA 1H92A 1BI2A 5LJ3e 2LX9A 1Q82C 5HCKA 5GAMe 4D8KA 2HSPA 1PD0A 4JJNK 3JB9J 2CT4A 1M1KU 1IB8A 1QCOA 5CQXA 4M77F 4LXCA 4WTOB 3SHWA 1ZSZB 3UA7A 5L8RE 3CCVT 1PHTA 1OZ3A 5GAN6 1M1GA 1X2KA 3A8OB 4J9CA 5AT1B 1NYFA 4B9XA 4FT4A 2WSFE 2QXFA 1D0YA 4GLMA 1UGRB 2IVWA 1K0SA 1Y96A 2R5MA 3HPWA 2QI2A 4F17A 2K4YA 1UFFA 2ROTA 1ABQA 4C8QD 1N5ZA 2EQMA 3OYYA 4CRIA 4AFZC 5GMKe 1VQ5T 2XIDA 3OYFA 1FMVA 4PJNA 3CCJQ 1WNLA 3C12A 2HDAA 1C6VX 4M78D 3PIPA 1K9AA 2MF2A 4C8QE 4L6V5 4LD6A 5IXFA 3CC2T 3JB9F 5GANh 1BIAA 3CCVQ 3BDLA 2L0AA 3G6EA 1E7OA 3M54A 1YHQT 4OMQA 1S72A 2BZYA 3EHQA 4M78E 1UDLA 2NUPA 3MEWA 1WXUA 3OYJA 5EC7A 2NLUA 1HJDA 4OB2B 3QDRB 2CT3A 3JV3A 2RM4A 1RAFB 2XI9A 5GAN5 4FYWB 3NPFA 5LJ5d 4DBFA 4L5GA 3KBGA 3SD4A 1X69A 2HD0A 4UC4A 2JT4A 3OQ5A 1VQ6T 3CCSQ 3TSZA 2VKNA 1UUEA 1UGPB 2KVQG 4A4HA 1Q81U 1OU8A 2RQTA 5LJ5g 2ZPEB 3DLLA 2COZA 2RHUA 3CMEA 2LT4A 4N4IA 2JTEA 3H0IA
chains in the Genus database with same CATH topology
2Y4YA 3WVDB 3OMCA 1Q82U 4XU0A 3WXMB 1NZ9A 4N0AC 4DA4A 2LNVA 3CXCA 3FJPA 2QTXA 3OY9A 3QHSA 4DQ2A 3FB9A 4M7DD 2EIFA 2L5QA 2MWOA 2QEXA 1VQPT 3CCET 3JCMb 2GQVA 2BIVA 2QEXT 2YHTA 4C92D 5D6XA 1OZ2A 1U1TA 2DTOA 2VV5A 3QZ9B 3X26B 1KD1C 1G5VA 2LVMA 2EWNA 3FLGA 4PNOA 4ZGDB 4KBMB 3I55A 3ZEHA 4HCBA 3I55T 5FU6B 1I81A 1WPYA 5I21A 2EJFA 1W4SA 4M7AC 2JN0A 4NL3A 4XQ3A 3CCMA 2OTJA 2X4XA 5LJ3f 4FL6A 2E6NA 4QQ6A 5CO7A 2FVUA 3OYAA 3CCMT 4BACA 1VQKA 3JB9G 4PJOA 2OTJT 3TCJA 3T9NA 1VQKT 4M7DE 1D3BA 3RMQA 5GAMf 3RERA 3URGA 2YLCA 4EMKA 3P8HA 4VUBA 4XTVA 4C92E 3JCMW 2HAXA 1H3ZA 4JRQA 3I56A 3A8MB 3LGLA 1QVGS 1O9SA 2AHJB 2K3YA 3LGFA 3VKIA 3SWNB 1QVFA 4OMFB 5IAYA 4M7AG 1AHJB 5DY9A 2RK1A 4RCCA 5GAOq 2PVGB 2K57A 2EYQA 5GANf 2P0KA 1SSFA 1KQSS 1M5Q1 2DXUA 3J80E 2EQUA 4E7KA 1YITA 2IG0A 2EAYA 5C6SA 4M75D 1Q7YC 1YITT 3META 5KE3A 1YI2A 4Y28E 1YI2T 3CBOA 1NPPA 3OYLA 5HK0A 3X24B 3GOXA 1KC8U 5A0LA 2RHIA 2K5FA 2PUKB 2LTOA 1PSEA 2O01E 3E19A 5CKFA 2KQWA 5FU7B 3HP9A 3QYGB 3KXTA 2DVEA 3A8HB 5IN1A 1WQ7A 2PQWA 3P8DA 1M1KC 1LOJA 4MDXA 4C5IA 4E7LA 4OB1B 2E41A 2LQKA 4A4FA 5GAMh 4ZTJA 2DTHA 4PLIA 4M75E 5GAN7 2LDMA 1K8AU 4FSXA 2XU8A 4QVCA 2DZCA 3ASKA 3E9FA 5EG2A 3DB4A 4BDYA 2VGNA 1WJSA 2P4TA 4PLLA 1HK9A 1VQNT 2DD5A 2LCLA 2RHXA 3QO3A 3TEEA 3E1SA 3OYCA 1H641 3A8LB 3RKXA 2K3XA 3MP1A 3LWIA 5GAN4 2MAMA 3JCMJ 3X25B 4L59A 4C92A 1G3WA 3EFSA 4OGEA 4LDYA 2CZ1B 4IUPA 2DXTA 3C4SA 4M77C 4EMHA 4IUQA 4E47A 3CPWS 1B34A 3GP8A 2ZPBB 4F7UA 5CIUA 4NS5A 1YIJT 4HCZA 2GFUA 2RHYA 3FDRA 2DKGA 1N8RU 1N9SA 2RI2A 2E70A 4XTXA 2XDBA 2GCXA 2E64A 4LD9K 2DXCA 2XK0A 4JRKA 3ZFJA 4XTWA 5CKHA 4A53A 3OYMA 2EJ9A 2V8JA 4BD3A 1KHIA 2R5AA 2VUBA 1X75C 2WACA 2KK4A 3VYGA 5KCOA 1K73C 4PJOB 5LJ5f 3A5ZB 1QP3A 5FLXE 2I2LA 3PGGA 3RESA 1D3BB 1M4ZA 4JLIA 2WSEE 2HQEA 3S6WA 2D6FA 4EMKB 4ELYC 4HCCA 3V8KA 2JTFA 3MP8A 4MZTA 5D6YA 4KUIA 4X9CA 5GMKi 4FM4B 4BUGA 3LYIA 3CMAA 2RJFA 4EMGA 3JCMP 2M0OA 4MZPA 4J7IA 1Q86C 1K9MC 3CMAT 4M7AD 2HQXA 1GXIE 4XU1A 5D6WA 3OYGA 2QQBA 4QQDA 4J6XA 5KCHA 2R57A 2DTIA 3H6ZA 3M55A 5CKDA 1QVGA 4DOVA 5GANj 3VUZA 4GY5A 2JZ2A 3L42A 1KD1U 4M7DF 4C8QA 3QKJA 1QVPA 3QXEB 1XOVA 3OA6A 2DPPB 1VUBA 1KQSA 4KUDK 1LJOA 2CZ0B 2P0PA 3OSVA 4Q5WA 4C92F 4PJOC 3OYNA 3M58A 4C5GA 4JRPA 5GAOm 5CKBA 3CCEA 1VQPA 3JSCA 2GF7A 4F7UF 4E7JA 4EMKC 4O6JA 2DD4A 4M7AE 4ZN1A 5LJ5h 2KAFA 3HRSA 2DK3A 3MO8A 4M78A 3J7AF 1M8VA 2RH2A 4IURA 3JCMQ 1EIFA 4O5VA 4YTLA 4J6YA 4RMOA 4QW2A 4JS4A 4B9WA 4BB7A 4OGCA 2VC8A 3JCMV 3L2QA 4PJOG 1P92A 3DB3A 2ZPGB 3OYDA 1VQ9A 4JUVA 3MCAB 3F70A 3MHXA 1VQ9T 2QQRA 3CCLA 4R55A 4OF1A 2H3JA 4PKCC 5CKEA 1UGSB 2E10A 2E65A 3QJ6A 3OS2A 3CCLT 1G3TA 5C0MA 1BI1A 4X9DA 2DIQA 2LQ8A 3JCMd 2RJEA 3FEOA 2K5LA 2Y90A 1Q7YU 3UT1A 4A4GA 4C92B 2RI3A 4FIBA 3WVEB 3FRNA 3LW5E 4Z02A 3OYHA 3CCJT 3OS0A 2E5QA 1FWZA 1HXDA 2A7YA 1WJQA 1OI1A 3LWHA 1B34B 4M75F 3V8LA 5J3BA 2QDYB 4F7UB 4QVDA 5GAOn 3G4SA 1YJNA 2V8IA 3G4ST 3P8BB 3LX7A 1YJNT 4N0AA 3PNWC 3FIFA 3QYHB 3JCMg 2LC4A 4C8QF 3FC3A 3OBYA 2X4JA 3QIIA 1VQ7A 1VQLA 1W2BS 4QVZA 5FU6C 3CPWA 4LDUA 3CCRA 1WGSA 1M90C 1VQ7T 1VQLT 2MI6A 2CS7A 5IT9E 2YRVA 3CCRT 3N5BB 4BE1A 4BY6B 5KE2A 3OS1A 3SB2A 3VU3C 1I5LA 3PTAA 4C5EA 2XICA 1VIEA 5CCAA 4M77D 1XQHA 1OYXA 2KSSA 5LJ3g 5CR2A 1VQOA 2MWPA 5AYFA 4ZTFA 4M78F 5GANd 1VQOT 2C06A 2DO3A 2ZGWA 1BI3A 2OAUA 5M9OA 3R6OA 5FRMA 4M7AA 3SWNC 2CYZB 4BI8B 3S3MA 1KQ1A 3GLXA 3HHTB 3L2UA 2JOYA 1XNIA 1VQMA 3OW2A 4MZMA 5GAN2 1VQMT 4OVAA 3SFMA 2PVOB 4J5YA 2LCCA 2E12A 2JNGA 1VQNA 1ZHIA 2G3RA 2DJZA 2K5IA 2RHZA 4CI0C 5GAN3 2DZ9A 3LLRA 4A4EA 3JB9H 5GANg 2CGHA 4C8QB 3V7SA 4M77E 5FROA 3NFCA 3M57A 2GFAA 3L1AA 4XTYA 5GAOp 2XG8D 4C0DB 3ZBDA 4OB3B 4M7DA 3JCMX 3ER0A 2DIGA 4C0ZA 5GAOr 4ME7A 2X4WA 3OYBA 3CCST 3UDCA 1M9SA 4X34A 3MEVA 4WF2A 4F7UG 5FU7C 5GAOl 3MEAA 1K73U 2V8KA 1N9RA 2XKOC 3L2ZA 4JDSA 4OP0A 4A4KA 5DM7R 3L2VA 1YIJA 3CC4A 1Y71A 2ZPFB 2VGMA 4M78B 3CC4T 3X28B 2E6ZA 4OB0B 2LRQA 5HKCA 3BY7A 2FB7A 1UEBA 3A8GB 2ZZDA 2OTLT 2RB6A 3M4YA 5CVIA 2FYKA 4PJOD 5HK3A 3QPHA 4NOYA 2HBPA 4RG2A 4JS5A 3OYKA 1Q86U 4PL6A 3V8JA 4DOWA 1K9MU 4BE2A 1K8AC 1KQ2A 2JTMA 3HKSA 5LJ3j 3JB9D 2ZPHB 1KG1A 4M7DC 5CQYA 2QQSA 2XDPA 3S3NA 4M7AF 3CBMA 4JLGA 5GAMj 5J39A 2CZ7B 3VV0A 3OYEA 4IUUA 3UPUA 2X35A 3PMTA 3Q1JA 3JAME 3GIBA 4N4GA 2FHDA 1JBMA 4ZGEB 3PT9A 1DJ7B 3INZA 3UWNA 2XDDA 1NJIC 3CD6A 3BW1A 4M75A 3OBWA 2EQJA 3CD6T 3GNGA 3PIOA 4C8QG 4PJOE 1NE8A 2M1HA 1BKBA 2Y4XA 4XU3A 2PUOB 3KUFA 3QUIA 1V29B 4ZGJB 4M77A 4Y91A 3OS5A 1N27A 1KHCA 1X6OA 1WJRA 2EJGA 4XK8E 3VUBA 3HFOA 3CCUA 4MMLA 1MHNA 1WQWA 2VXFA 3MP6A 3M56A 4J83A 3CCUT 3CCQA 4IKFA 3DKMA 3LH0A 1YBYA 4M78G 3CCQT 2EQKA 3H8ZA 4HA8A 3NTIA 2BUDA 4MDWA 4M7AB 1PSFA 5FRNA 3JB9I 1MGQA 3G71T 2M9UA 2A3LA 1YCYA 2JVVA 3BFMA 3OMGA 1Y7XA 3QG1A 3RIRA 3V7CA 4A54A 3JCMe 2L89A 5GAN8 4BE0A 4FU6A 1QW1A 2EKOA 4KT0E 1Q81C 4C5HA 5A0DA 5GMKj 2RD1A 2X4YA 2XD0A 1G3SA 3GNFB 4XTUA 4M7DB 2EFIA 2PVDB 1VIFA 3CEYA 3JCMf 4EPCA 4NL2A 1BI2A 2VXEA 4V2SA 1JJ2S 1VQ8A 3CCJA 1M90U 2L8DA 1VQ8T 5LJ3e 1RI0A 1Y07A 5CK9A 2DEQA 4GLKA 4IUVA 1O75A 2LX9A 3EFRA 3V7RA 1UB4A 3E9GA 5GMKm 1RL2A 2F69A 3ME9A 1Q82C 2YLBA 5GAMe 3CC7A 5DLQE 2KY9A 1FXXA 5DLOA 2QQ9A 4XU2A 4ELZC 4P5NA 4J7FA 3M9QA 5LJ3d 4JJNK 3JB9J 2B8AA 2DXBA 3TU4K 1M1KU 5CQXA 5HY6A 1NPRA 4M77F 3HRUA 5GAMd 3CCVA 2QA4A 4ATOA 2MMPA 2QA4T 5L8RE 3CCVT 1I8FA 1OZ3A 5GANe 1LNXA 5LL6S 4TVRA 5GAN6 3O8VA 2R58A 1M1GA 3A8OB 1VQ4A 3M53A 3X20B 3I56T 4B9XA 3S3OA 1VQ4T 4FT4A 3HFNA 2KDSA 4BI4A 2WSFE 3NTHA 1QP2A 4F7UE 1XTDA 5I2SA 2FL7A 5LJ5j 3L2RA 3GPLA 3M4GA 2RA2A 1IREB 4C92C 2BKDN 5GAMg 2QXFA 4MMKA 3CXCS 4LDVA 3J81E 1UGRB 2IVWA 2O4XA 1Y96A 2PU9B 2R5MA 3HPWA 3JCMh 3VJPA 3OB9A 2QI2A 4M75B 3CPFA 1JB0E 4FT2A 3MEUA 4HKEA 4XAXB 4E7IA 3JCMc 5I2MA 2K2VA 3RKYA 2K4YA 4C8QD 4M7DG 1U1SA 3JRZA 5KH6A 3OYIA 2EQMA 3M59A 4HT8A 1ZBXA 4M77B 4C92G 3OYYA 4CRIA 4EDUA 1VQ5A 3QJYA 3RMSA 4RCBA 4BY6C 5LJ3h 5GMKe 2XIDA 3CCSA 3OYFA 1VQ5T 1G3YA 4BI3A 3EAEA 3RUXA 3QBYA 5A0GA 1WNLA 3C12A 5CAIA 3HSBA 2ZCFB 1KC8C 4M78D 3GF5A 4C0GA 4J6WA 1IZ6A 4C0FA 4PJOF 1N6AA 1ZQ1A 3PIPA 2MF2A 3PFSA 4XTZA 4C8QE 3CBPA 4L6V5 2OTLA 4LD6A 3CC2A 1QVFS 2VYTA 3CC2T 4M75C 5GANh 3JB9F 1BIAA 1UGQB 4HT9A 3OSSC 3PMIA 3BDLA 2RO0A 1NJIU 2M16A 5J26A 3G6EA 1YHQA 2ZPIB 3M54A 3G6ET 1YHQT 4II1A 3C94A 4C8QC 4ZN3A 3C95A 2D0QB 3SWNA 2JUFA 2RJDA 2QQAA 3RKWA 4C0DC 4RG8A 1S72A 3CC7T 1M1FA 4M78E 2F5KA 3SDZA 3TREA 3MEWA 1S72T 2RI5A 2L3RA 4KULA 3M5AA 4E7HA 3OYJA 1I4K1 3HL8A 2WSCE 2RK2A 4M75G 5LJ5e 2LT1A 2NLUA 2D9TA 2DAQA 4OB2B 3BDUA 5GMKl 1BYMA 3G7ZA 3QDRB 1X01A 3QSUA 2RM4A 4M78C 1TH7A 2XI9A 1JJ2A 4RKUE 2KMTA 1BI0A 5GAN5 5LJ5d 2CKKA 2F5TX 2CZ6B 4L5GA 3KBGA 4N4HA 5A2QE 4IUTA 4M77G 1U8RA 1BIBA 3DLMA 3SD4A 4D6WA 2HD0A 5GMKh 3OW2S 1N8RC 4UC4A 1YJ9A 1VQ6A 3OQ5A 2XHCA 1YJ9T 1VQ6T 1FX7A 1YJWA 1JRIA 3L2WA 1R8OB 1UGPB 2KVQG 4JRIA 4A4HA 4QQGA 2RJCA 1YJWT 1W2BA 1Q81U 5LJ5g 4LDXA 3QZ5B 4R56A 2ZPEB 3VYHB 3HRTA 4J8OA 2HNIA 4LDWA 4BDZA 3NTKA 2E1HA 3G71A 3DLLA 2RHUA 2O4XB 1Y96B 3CMEA 3AHUA 2LT4A 4N4IA 3CMET 2P0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ9 A;  2DJZ A;  5GAN 3;  2DZ9 A;  5GAM d;  3JB9 H;  4M77 F;  4PJO B;  5GAN g;  2CGH A;  4XU0 A;  4C8Q B;  4N0A C;  3V7S A;  5LJ5 f;  4M77 E;  2I2L A;  3PGG A;  1I8F A;  3FJP A;  2QTX A;  3RES A;  1D3B B;  1LNX A;  5GAN e;  3L1A A;  3QHS A;  4XTY A;  4JLI A;  4DQ2 A;  3FB9 A;  5GAN 6;  5GAO p;  3JCM X;  4M7D A;  5GAO r;  4M7D D;  4EMK B;  3V8K A;  3JCM b;  3HFN A;  5LJ5 j;  4M7D C;  2YHT A;  4C92 D;  4WF2 A;  4F7U G;  4F7U E;  4X9C A;  5GAO l;  1U1T A;  2DTO A;  3M4G A;  5GMK i;  2RA2 A;  1N9R A;  3L2Z A;  4C92 C;  4OP0 A;  4EMG A;  5GAM g;  3JCM P;  4MMK A;  2EWN A;  4PNO A;  4M78 B;  4M7A D;  1Y96 A;  4XU1 A;  1I81 A;  1WPY A;  4J6X A;  2EJF A;  3BY7 A;  3JCM h;  2DTI A;  2FB7 A;  2JN0 A;  4M75 B;  4NL3 A;  4M7A C;  4XQ3 A;  5GAN j;  2RB6 A;  5LJ3 f;  3JCM c;  4PJO A;  2FYK A;  4M7D F;  4C8Q A;  3JB9 G;  3RKY A;  4PJO D;  4C8Q D;  4M7D G;  1U1S A;  4NOY A;  4M7D E;  1D3B A;  5GAM f;  3V8J A;  1LJO A;  4C92 F;  3RER A;  4PJO C;  4HT8 A;  2YLC A;  4EMK A;  4M77 B;  4XTV A;  4C92 G;  4C92 E;  3JCM W;  5LJ3 j;  3JB9 D;  1KQ2 A;  5GAO m;  4RCB A;  5LJ3 h;  5GMK e;  3SWN B;  4F7U F;  4M7A F;  4EMK C;  5GAM j;  3RUX A;  3JB9 J;  4M7A G;  4M7A E;  5DY9 A;  1WNL A;  5LJ5 h;  4RCC A;  5GAO q;  3QSU A;  5CAI A;  3HSB A;  2K57 A;  4M78 A;  5GAN f;  1M8V A;  3JCM Q;  3GIB A;  1M5Q 1;  4M78 D;  1JBM A;  2DXU A;  4J6W A;  3INZ A;  4J6Y A;  4PJO F;  3BW1 A;  2VC8 A;  4M75 A;  2EAY A;  3JCM V;  4PJO G;  4PJO E;  4XTZ A;  4M75 D;  4C8Q G;  4C8Q E;  4JUV A;  4M75 C;  4XU3 A;  5GAN h;  3JB9 F;  1BIA A;  4HT9 A;  3QUI A;  2E10 A;  2E65 A;  4M77 A;  4Y91 A;  4X9D A;  2EJG A;  3JCM d;  4C8Q C;  3HFO A;  4MML A;  1WQW A;  2Y90 A;  2VXF A;  3SWN A;  2DVE A;  4C92 B;  3RKW A;  1WQ7 A;  1LOJ A;  1HXD A;  4M78 E;  4M78 G;  4HA8 A;  1B34 B;  5GAM h;  2E41 A;  4M75 F;  3V8L A;  1I4K 1;  2DTH A;  4M7A B;  4F7U B;  4M75 G;  4M75 E;  4QVD A;  5LJ5 e;  5GAN 7;  5GAO n;  3JB9 I;  3BDU A;  5GMK l;  1MGQ A;  4QVC A;  4N0A A;  2DZC A;  1X01 A;  3FIF A;  2RM4 A;  1YCY A;  4M78 C;  3JCM g;  4C8Q F;  1TH7 A;  3BFM A;  4A54 A;  1HK9 A;  3RIR A;  5GAN 8;  3V7C A;  5GAN 5;  3JCM e;  5LJ5 d;  3QO3 A;  4M77 G;  1H64 1;  3RKX A;  1BIB A;  5GMK j;  2RD1 A;  3SB2 A;  3VU3 C;  1I5L A;  5GMK h;  5GAN 4;  4M7D B;  4XTU A;  3JCM J;  4M77 D;  4C92 A;  4A53 A;  5I21 A;  3EFS A;  3JCM f;  4NL2 A;  5LJ3 g;  2VXE A;  4V2S A;  2DXT A;  1JRI A;  4M77 C;  4M78 F;  4JRI A;  4EMH A;  5GAN d;  1B34 A;  5LJ3 e;  2DEQ A;  2ZGW A;  3EFR A;  4F7U A;  3V7R A;  5GMK m;  5LJ5 g;  4M7A A;  3SWN C;  2YLB A;  1KQ1 A;  5GAM e;  2HNI A;  2DKG A;  1N9S A;  2E1H A;  4XTX A;  4XU2 A;  5GAN 2;  1Y96 B;  2E64 A;  3AHU A;  5LJ3 d;  4JRK A;  4XTW A;  4J5Y A; 
#chains in the Genus database with same CATH topology
 2OTL Q;  3CC2 Q;  2OX7 A;  1Q82 U;  4N0A C;  2A28 A;  3OY9 A;  1YHQ Q;  2BZX A;  1VQP T;  2QEX A;  3CCE T;  2BIV A;  5D6X A;  4OMM A;  1OZ2 A;  2VV5 A;  1KD1 C;  1M2V A;  2EGE A;  2LVM A;  3FLG A;  4ZGD B;  1I81 A;  2EJF A;  1ZUU A;  1W4S A;  4M7A C;  1YWO A;  4NL3 A;  3EFO B;  2X4X A;  3M0T A;  3OYA A;  3CCM T;  1VQK A;  2OTJ T;  1M27 C;  3TCJ A;  2AZS A;  3RMQ A;  3URG A;  2YLC A;  4VUB A;  4XTV A;  6AT1 B;  2MYS A;  1VQ6 Q;  4OMP A;  1QVF A;  4OMF B;  2OI3 A;  5GAN f;  1M2O A;  1WZO A;  4E7K A;  3VS2 A;  2DIL A;  2EAY A;  2A08 A;  1YIT T;  5KE3 A;  1YI2 A;  1B07 A;  1G83 A;  3CBO A;  1NPP A;  4DEY A;  3GOX A;  1SHG A;  5A0L A;  1YWP A;  1M30 A;  2O01 E;  2QAS A;  2KNB B;  1TWB A;  2DVE A;  5IN1 A;  2PQW A;  2GBQ A;  1FMK A;  4MDX A;  1LOJ A;  3EG0 A;  4E7L A;  4ZTJ A;  5I22 A;  4J9D A;  5GAN 7;  4FSX A;  1SKU B;  1OV3 A;  1WYX A;  2A0F B;  5EG2 A;  3VS1 A;  2P4T A;  1RAB B;  1HK9 A;  3CCM Q;  2DD5 A;  2OTJ Q;  2FZK B;  2RQV A;  2NUZ A;  2GGR A;  4C92 A;  3PVQ A;  4OGE A;  1RAE B;  4IUP A;  4M77 C;  4EMH A;  3CC7 A;  2GFU A;  2E70 A;  2K2M A;  2DRK A;  2XK0 A;  1RAH B;  4HXJ A;  4JRK A;  2EJ9 A;  2M0Y A;  2KK4 A;  3A5Z B;  1QP3 A;  2I2L A;  3TSW A;  3RES A;  1D3B B;  1ZUK A;  3VS4 A;  2WSE E;  5KYU B;  1JO8 A;  2ECZ A;  5GMK i;  4FM4 B;  4BUG A;  1B3Q A;  3LYI A;  3EG3 A;  4IIM A;  1K9M C;  1X6B A;  4M7A D;  4XU1 A;  1ZSG A;  1UE9 A;  1QVG A;  1KD1 U;  3THK A;  1XOV A;  1MMG A;  1MV0 B;  5KYY B;  5CKB A;  3VS7 A;  4PFP A;  2MIO A;  5KYX A;  4DBR A;  4M7A E;  2DA9 A;  5LJ5 h;  1GL5 A;  2DBK A;  3J7A F;  1M8V A;  4RMO A;  2DRM A;  3JCM V;  2GTJ A;  2EW3 A;  3DB3 A;  3OYD A;  4JUV A;  3F70 A;  1VQ9 T;  2QQR A;  3CCL A;  2H3J A;  2KXD A;  3EG9 B;  3OS2 A;  1QMC A;  2J06 A;  2HKN A;  1ZBJ A;  2L3Q A;  2X9H A;  2RI3 A;  4FIB A;  3WVE B;  4Z02 A;  3OYH A;  5IH2 A;  2DL8 A;  3I5R A;  5GAO n;  4JPB W;  2V8I A;  3LX7 A;  1UTI A;  3PNW C;  4JJB A;  4C8Q F;  3QII A;  1VQL A;  2DL7 A;  5IT9 E;  2YRV A;  3UA6 A;  4BE1 A;  4BY6 B;  5KE2 A;  2RNA A;  3C0C A;  2LJ3 A;  1VIE A;  4M77 D;  2E3H A;  1VQO A;  5AYF A;  4M78 F;  3EGX A;  2ZGW A;  3HTR A;  5M9O A;  5FRM A;  1LVK A;  2CYZ B;  1KFZ A;  3HHT B;  3L2U A;  2JOY A;  1X43 A;  1XNI A;  2YUP A;  4J5Y A;  2LCC A;  3O5Z A;  1ZHI A;  2G3R A;  2FRY A;  2K5I A;  1PWT A;  1R0C B;  3JB9 H;  1VQK Q;  4M77 E;  5FRO A;  1A0N B;  2QGF B;  3NFC A;  3M57 A;  2QG9 B;  1BCM A;  4C0D B;  3ZBD A;  3ER0 A;  1JXO A;  2HL5 C;  2KXC A;  1M9S A;  2J6O A;  5FU7 C;  5GAO l;  3MEA A;  2C0O A;  2V8K A;  2E3I A;  4A4K A;  3CC4 A;  1Y71 A;  2KE9 A;  2E6Z A;  3OW2 P;  2LRQ A;  1AZE A;  2KI7 A;  1UEB A;  1KIK A;  3M4Y A;  4JJD A;  2AKL A;  4CC3 A;  2FYK A;  1ZSZ A;  5HK3 A;  4NOY A;  1K9M U;  3V8J A;  1PG5 B;  1Z9Q A;  2JTM A;  3HKS A;  5LJ3 j;  3JB9 D;  3H0H A;  2KEA A;  3CBM A;  1OPK A;  5GAM j;  5J39 A;  2CZ7 B;  2VVK A;  3OYE A;  4IUU A;  2X35 A;  3Q1J A;  1D09 B;  3JAM E;  1K73 R;  3GIB A;  1JBM A;  2SEM A;  4ZGE B;  4J9E A;  2EQJ A;  4QKU A;  2Y4X A;  3EH1 A;  1PKS A;  2D0N A;  2G6F X;  3OS5 A;  3VUB A;  4FYY B;  3HFO A;  1Q86 R;  4MML A;  1WQW A;  3MP6 A;  1RAA B;  1WXB A;  4IKF A;  1I5O B;  1QQJ A;  2EQK A;  3H8Z A;  3NTI A;  1PSF A;  4OMN A;  3G71 T;  2A3L A;  2ESW A;  3BFM A;  3RIR A;  3JCM e;  3H9N A;  2EKO A;  4KT0 E;  4C5H A;  5GMK j;  4KH0 B;  4PJL A;  3GNF B;  4XTU A;  4M7D B;  3CEY A;  1WHK A;  4WCI A;  3CCJ A;  2L8D A;  1VQ8 T;  1RI0 A;  2RQU A;  5GMK m;  2YUO A;  3E9G A;  1RL2 A;  3ME9 A;  2FZG B;  4LNP A;  2YLB A;  4D8D A;  2F2V A;  4P5N A;  3M9Q A;  2CP0 A;  1NPR A;  3CCV A;  1ZX6 A;  2EVR A;  2QA4 T;  1I8F A;  1LNX A;  4TVR A;  3I56 T;  3S3O A;  3HFN A;  2KDS A;  3VS6 A;  4BI4 A;  3L2R A;  3GPL A;  3BE3 A;  2RA2 A;  1D0Z A;  3VRZ A;  2JM9 A;  2PU9 B;  3CPF A;  2Z0W A;  3MEU A;  3JCM c;  1KJW A;  2K2V A;  3H41 A;  1WIE A;  2FPF A;  4M7D G;  2I0N A;  3M59 A;  1ZBX A;  4C92 G;  1VQ5 A;  3QJY A;  4RCB A;  3CCS A;  1D1C A;  1G3Y A;  1VQ8 Q;  3RUX A;  2ZCF B;  1KC8 C;  4C0G A;  1I1J A;  4C0F A;  3EFO A;  3PFS A;  1TU0 B;  4XTZ A;  2OTL A;  3CBP A;  5KYW B;  3CC2 A;  1QVF S;  1VQL Q;  2CDT A;  1IHW A;  1YHQ A;  1YN8 A;  1MNE A;  2ZPI B;  1KC8 R;  4C8Q C;  4ZN3 A;  2YUQ A;  3C95 A;  1IGQ A;  2RJD A;  3RKW A;  4RG8 A;  1BB9 A;  2F5K A;  2DMO A;  3TRE A;  1RAI B;  2B86 A;  2RI5 A;  4KUL A;  4E7H A;  1I4K 1;  2YSQ A;  2WSC E;  2RK2 A;  5LJ5 e;  1AT1 B;  1K8A R;  3D7S B;  3EH2 A;  2OAW A;  3I9Q A;  4M78 C;  2KMT A;  1BI0 A;  1B7T A;  4IUT A;  3VS5 A;  1Z9Z A;  1BIB A;  3M0R A;  1VQ6 A;  2DJQ A;  4J9F A;  1GFD A;  1YJ9 T;  2JMC A;  2O9S A;  3L2W A;  1R8O B;  4JRI A;  2RJC A;  1C1A A;  4R56 A;  3VYH B;  2NUT B;  4LDW A;  3NTK A;  1QKW A;  1PRM C;  2O4X B;  1IHV A;  3AHU A;  3X24 B;  1K76 A;  3AT1 B;  1PKT A;  3FJP A;  3QHS A;  4RUG A;  5FW9 A;  4DQ2 A;  4RTZ A;  2K7A A;  2YHT A;  2EQI A;  1Q81 R;  3ZEH A;  3I55 T;  2DE0 X;  1WPY A;  3LH5 A;  2JN0 A;  1ZUY A;  4XQ3 A;  3CCM A;  2OTJ A;  1JEG A;  4BAC A;  3M0P A;  3T9N A;  1RLQ C;  1D3B A;  1Q82 R;  3P8H A;  1H3Z A;  5KYU A;  4JRQ A;  4ORZ A;  3A8M B;  1YJ9 Q;  1QVG S;  3VKI A;  3VRY A;  3SWN B;  5IAY A;  3TVT A;  1AHJ B;  2RK1 A;  4RCC A;  5GAO q;  1M3C A;  2P0K A;  2CP5 A;  3J80 E;  2EQU A;  2CUD A;  1YIT A;  2OJ2 A;  4Y28 E;  1KC8 U;  2K5F A;  2PUK B;  5KYY A;  2YXY A;  1PSE A;  3E19 A;  2KQW A;  2KYM A;  3QYG B;  1QLY A;  3KXT A;  3P8D A;  1QVF P;  2A37 A;  4OB1 B;  3I55 Q;  2LDM A;  1K8A U;  1PRL C;  3E9F A;  3ASK A;  1NEB A;  3DB4 A;  1WJS A;  2DL4 A;  4PLL A;  1VQN T;  2RHX A;  4ANJ A;  3QO3 A;  3EG9 A;  1R77 A;  1PM3 A;  1H64 1;  3A8L B;  3M0S A;  3MP1 A;  2HZY A;  4L59 A;  3EFS A;  3NMZ C;  2SRC A;  4Z8A A;  3C4S A;  1U06 A;  4IUQ A;  2DF6 A;  4E47 A;  3PE0 A;  4NS5 A;  1YIJ T;  3FDR A;  4AFU C;  1N9S A;  2XDB A;  2E64 A;  1SSH A;  2A36 A;  1ACM B;  5CKH A;  1AWO A;  1KHI A;  2VUB A;  4PJO B;  1NLP C;  3S6W A;  4EMK B;  2HMA A;  3V8K A;  3MP8 A;  1VQ5 Q;  1R0B G;  2H8H A;  2RJF A;  4EMG A;  2M0O A;  3CMA T;  1SHF A;  2L3S A;  4FYX B;  4DOV A;  5GAN j;  3M0Q A;  2FEI A;  4M7D F;  2LNH B;  4JZ3 A;  4KUD K;  2DPP B;  1KQS A;  1LJO A;  4C92 F;  2CSI A;  2IPO B;  1S1N A;  3NGP A;  3JSC A;  2GF7 A;  4O6J A;  3HRS A;  3JCM Q;  3UF4 A;  1EIF A;  4O5V A;  1TXQ A;  1CKB A;  4JS4 A;  4PJO G;  2K9G A;  1QVG P;  1CSK A;  2ZPG B;  1VQ9 A;  3MCA B;  3MHX A;  2YT6 A;  4OF1 A;  4PKC C;  4E7J A;  1KD1 R;  4X9D A;  1VYV A;  3UT1 A;  4A4G A;  2DYI A;  1SPK A;  1TUC A;  3FRN A;  3LW5 E;  3ULR B;  2E5Q A;  1FWZ A;  1WJQ A;  1OI1 A;  2L3P A;  2VB6 A;  5J3B A;  2QDY B;  4F7U B;  4QVD A;  2BE7 D;  3FJ5 A;  4J9H A;  3FC3 A;  2RPN A;  2F2W A;  1UEC A;  1K4U S;  2DEU A;  1W2B S;  5FU6 C;  3CPW A;  1M90 C;  3N5B B;  4RTV A;  9ATC B;  3PTA A;  2JW4 A;  1MMD A;  1VQP Q;  3CCE Q;  5LJ3 g;  2MWP A;  1OX8 A;  1T0J A;  4E7S A;  1JU5 C;  4MZM A;  1VQM T;  4OVA A;  2V1R A;  4KGV B;  2JNG A;  2ENM A;  2DJZ A;  1F1B B;  2DZ9 A;  3LLR A;  2DER A;  2HBW A;  3V7S A;  2CH4 W;  2GFA A;  3L1A A;  4XTY A;  4M7D A;  2XG8 D;  5GAO r;  4F7U G;  3REA B;  5IHK A;  1TUG B;  1N9R A;  3L2Z A;  4JDS A;  5DM7 R;  2VGM A;  8ATC B;  2E4H A;  3REB B;  3BY7 A;  2FB7 A;  2YDL A;  1YIT Q;  2ZZD A;  1M3A A;  1M8M A;  4ZNX A;  4QT7 A;  2HBP A;  3RR6 A;  4PL6 A;  2ZPH B;  1QKX A;  3PVL A;  1BU1 A;  1PCX A;  4HVW A;  2XDD A;  1DJ7 B;  2PZ1 A;  1NJI C;  1VQM Q;  1OQK A;  2M1H A;  1BKB A;  4AFS C;  1Y0M A;  1TS9 A;  3G1J A;  1K9M R;  1MHN A;  2VXF A;  4J83 A;  2CH4 A;  1AVZ C;  3LH0 A;  4HA8 A;  1VOM A;  2RF0 A;  4M7A B;  3JB9 I;  1GCP A;  5KYW A;  1QCF A;  4A54 A;  3QG1 A;  5GAN 8;  2L89 A;  2O88 A;  3MJX A;  4FU6 A;  1NG2 A;  5A0D A;  2RD1 A;  4RTT A;  2XD0 A;  1K0X A;  3JCM f;  4EPC A;  2VXE A;  1VQ8 A;  1M90 U;  4IUV A;  2DET A;  3EFR A;  1O75 A;  2DNU A;  3V7R A;  4F14 A;  1ARK A;  2F69 A;  2CP2 A;  2K3B A;  5DLQ E;  1FXX A;  1BBZ A;  1K1Z A;  2LQN A;  4OMO A;  1NBE B;  1E6G A;  2QA4 A;  2MMP A;  1WHL A;  2F1L A;  5GAN e;  5LL6 S;  3O8V A;  1WI7 A;  1YFN A;  1MMA A;  2JMA A;  2R58 A;  3M53 A;  3X20 B;  1VQ4 T;  2KT8 A;  5LJ5 j;  4M7D C;  1WXT A;  1XTD A;  5I2S A;  2FL7 A;  1IRE B;  4C92 C;  2NUT A;  1YP5 A;  4MMK A;  4LDV A;  3J81 E;  2O4X A;  4PJJ A;  1RUW A;  3VJP A;  3OB9 A;  2PNI A;  4M75 B;  1JB0 E;  4FT2 A;  4XAX B;  4E7I A;  1VQ9 Q;  4F04 B;  1OEB A;  3KFV A;  3RKY A;  1U1S A;  4AMC A;  3GBQ A;  5KH6 A;  3OYI A;  4HT8 A;  1D0X A;  4M77 B;  1NEG A;  2COW A;  3RMS A;  5LJ3 h;  4BI3 A;  2BE9 B;  3ZL7 C;  4KH1 B;  3GF5 A;  1IZ6 A;  4PJO F;  2HCK A;  1N6A A;  1D1B A;  3OSS C;  2J6K A;  1NJI U;  2M16 A;  4CC2 A;  1GCQ A;  1I0C A;  4II1 A;  2D0Q B;  1VQ4 Q;  3SWN A;  2JUF A;  2QQA A;  3CC7 T;  2BZ8 A;  2L3R A;  5D7U A;  4M75 G;  1OUL A;  2D9T A;  3G7Z A;  4GBQ A;  1Y57 A;  1YNZ A;  3QSU A;  1TH7 A;  1JJ2 A;  1D1A A;  2CKK A;  2F5T X;  4M77 G;  3R6N A;  1TSF A;  3DLM A;  3MKD A;  5GMK h;  3IQL A;  1N8R C;  1YJ9 A;  1FX7 A;  4QQG A;  1YJW T;  1W2B A;  1UHF A;  4LDX A;  2DM1 A;  2HNI A;  2E1H A;  2DYB A;  2CRE A;  1WA7 A;  5FWB A;  2JS0 A;  2AZV A;  2Y4Y A;  2MK5 A;  3WVD B;  2BTT A;  1WFW A;  2EKH A;  2M02 A;  4JJC A;  3NHN A;  1NZ9 A;  1PC0 A;  2LNV A;  3CXC A;  2QTX A;  1KSW A;  3FB9 A;  4M7D D;  2L5Q A;  2MWO A;  2X3X D;  2V26 A;  2GQV A;  4C92 D;  2DBM A;  1W70 A;  1U1T A;  3X26 B;  2V1Q A;  2EWN A;  3I55 A;  4KBM B;  3SEM A;  5I21 A;  2CUB A;  5GJV B;  4J9I A;  5LJ3 f;  4FL6 A;  2E6N A;  4PJO A;  5CO7 A;  2FVU A;  1VA7 A;  3JB9 G;  4M7D E;  2J05 A;  5GAM f;  4AFQ C;  1OX9 A;  4EMK A;  4C92 E;  2HAX A;  3JCM W;  1O9S A;  2AHJ B;  2K3Y A;  4PFO A;  1YJW Q;  2KRO A;  1LPL A;  2K57 A;  4KRT A;  2EYQ A;  1KQS S;  1SSF A;  1M5Q 1;  2DXU A;  3G71 Q;  2IG0 A;  3UAT A;  1Q7Y C;  4E6R A;  2EGC A;  2LZ6 B;  1G2B A;  2RHI A;  5CKF A;  5FU7 B;  2KT1 A;  1ZSZ C;  2DLP A;  1FYN A;  1M1K C;  1IRX A;  1AEY A;  4C5I A;  1UGV A;  2DZC A;  4BDY A;  2LCL A;  3TEE A;  1AWJ A;  2M51 A;  3OYC A;  3RKX A;  2FPD A;  2QA4 Q;  2K79 A;  2MAM A;  1IXD A;  1G3W A;  1PNJ A;  3I56 Q;  1MV3 A;  4LDY A;  2CZ1 B;  3CPW S;  3GP8 A;  1SG5 A;  4RTU A;  2ZPB B;  4F7U A;  1WHH A;  5CIU A;  7AT1 B;  4HCZ A;  2RHY A;  1N8R U;  4ESR A;  4RTY A;  4LD9 K;  2DXC A;  2L2P A;  1SRL A;  4XTW A;  2V8J A;  5KCO A;  2R5A A;  3VYG A;  1X75 C;  1M3B A;  3PGG A;  1ZLM A;  4AG2 C;  4JLI A;  1UJY A;  2HQE A;  2D6F A;  1Q95 G;  4ELY C;  4HCC A;  4MZT A;  4X9C A;  3CMA A;  3EGU A;  4MZP A;  2HQX A;  3OYG A;  2QQB A;  4QQD A;  4Z89 A;  3M55 A;  3H6Z A;  3VUZ A;  4IIO A;  2C0T A;  1UJ0 A;  1TUD A;  3QXE B;  1VUB A;  2P0P A;  4Q5W A;  4PJO C;  3M58 A;  2ATC B;  1T0H A;  4JRP A;  5GAO m;  3CCE A;  1VQP A;  1H8K A;  1QWE A;  4EMK C;  2DD4 A;  2RH2 A;  4YTL A;  4J6Y A;  5ECA A;  4B9W A;  4OGC A;  1P92 A;  4LUD A;  2COY A;  4R55 A;  2FPE A;  2E65 A;  1G3T A;  1KQS P;  2DFU A;  1X2Q A;  2DIQ A;  4HVU A;  3JCM d;  2J6F A;  2RJE A;  3FEO A;  2K5L A;  1Q7Y U;  2J7I A;  3CCJ T;  1HXD A;  2A7Y A;  1RLP C;  1B34 B;  4M75 F;  3G4S T;  1YJN T;  4N0A A;  3QYH B;  2LQW A;  3JCM g;  3OBY A;  1I07 A;  4QVZ A;  1VQ7 T;  2MI6 A;  3CCR T;  1PD1 A;  1AWW A;  2KR3 A;  3SB2 A;  3VU3 C;  1I5L A;  4C5E A;  3A1P A;  1XQH A;  1OYX A;  2RMO A;  2KSS A;  4ZTF A;  4E2F B;  2C06 A;  1BI3 A;  2XMF A;  4M7A A;  2ROL A;  4BI8 B;  1KQ1 A;  3GLX A;  1VQM A;  1G8X A;  3EG2 A;  5GAN 2;  3SFM A;  2E12 A;  3CPW P;  2W0Z A;  2GNC A;  2CGH A;  4C8Q B;  2LCS A;  1VYU A;  4OB3 B;  3JCM X;  4J9B A;  1T3L A;  1GRI A;  4JZ4 A;  4ME7 A;  3OYB A;  3CCS T;  3UDC A;  4X34 A;  2DX1 A;  2ZPF B;  4M78 B;  3G4S Q;  1YJN Q;  3X28 B;  5HKC A;  2EPD A;  2OTL T;  1VQ7 Q;  4LUE A;  3CCR Q;  4PJO D;  2YUN A;  4RG2 A;  4BE2 A;  1KQ2 A;  1FMW A;  1KG1 A;  2MOX A;  5CQY A;  2FG0 A;  4E7Z A;  3S3N A;  3VV0 A;  1C0M A;  2PTK A;  4PK4 A;  3PMT A;  3UPU A;  1V76 A;  1TOV A;  2FHD A;  3PT9 A;  3UWN A;  3BW1 A;  4M75 A;  3OBW A;  4PJO E;  3CD6 T;  3GNG A;  3PIO A;  4C8Q G;  1OOT A;  1VQN Q;  4XU3 A;  1AWX A;  1WHG A;  3QWX X;  3KUF A;  4M77 A;  4Y91 A;  2NWM A;  4XK8 E;  2EJG A;  2D8H A;  1WJR A;  1SRM A;  2KRN A;  3CCU T;  1YBY A;  4M78 G;  3CCQ T;  1MMN A;  2BUD A;  1YIJ Q;  1QWF A;  3V7C A;  1QW1 A;  1GBQ A;  5I11 A;  1EX4 A;  4FSS A;  2X4Y A;  2LJ0 A;  2GTO A;  2PVD B;  1EFN A;  1RI9 A;  4NL2 A;  4V2S A;  1JJ2 S;  5CK9 A;  1Y07 A;  3I35 A;  2DEQ A;  4GLK A;  3EGD B;  1UB4 A;  3CMA Q;  2KY9 A;  5DLO A;  2QQ9 A;  4XU2 A;  4ELZ C;  3CD6 Q;  4J7F A;  5LJ3 d;  2B8A A;  2DXB A;  3TU4 K;  3TQ7 P;  5GAM d;  5HY6 A;  4ATO A;  3HRU A;  3QWY A;  2P4R A;  1VQ4 A;  3CCU Q;  3NTH A;  1QP2 A;  4F7U E;  2CP6 A;  4RTW A;  3CCQ Q;  2K6D A;  3M4G A;  2FZC B;  2MPX C;  2BKD N;  2QGG A;  5GAM g;  3CXC S;  1WHM A;  1M90 R;  4J9G A;  2AIR B;  3JCM h;  4HKE A;  1U3O A;  4OML A;  5I2M A;  1AZG B;  2HKQ B;  1NYG A;  4B6M A;  3JRZ A;  2DVJ A;  2CSQ A;  4EDU A;  4BY6 C;  1U5S A;  3EAE A;  3QBY A;  5A0G A;  4DBH A;  5CAI A;  3HSB A;  1T3S A;  4J6W A;  1ZQ1 A;  4Z88 A;  4FW1 A;  5L23 A;  2VYT A;  4A63 B;  1QCN A;  4M75 C;  2VWF A;  1UGQ B;  4HT9 A;  3PMI A;  2RO0 A;  2CP3 A;  5J26 A;  1TG0 A;  1WX6 A;  1ABO A;  3G6E T;  3C94 A;  1MUZ A;  2LP5 A;  4C0D C;  1M1F A;  3SDZ A;  2HEQ A;  5GJW B;  1S72 T;  3M5A A;  2H3E B;  3HL8 A;  2QK0 A;  2LT1 A;  2DAQ A;  1BYM A;  3BDU A;  5GMK l;  4X1V A;  1X01 A;  2D1X A;  2HQH A;  4RKU E;  3I5S A;  4N4H A;  2CZ6 B;  5A2Q E;  2KRM A;  1U8R A;  1NM7 A;  4D6W A;  3OW2 S;  8AT1 B;  3EG1 A;  1NJI R;  2XHC A;  3E2U A;  1YJW A;  1JRI A;  1JXM A;  3QZ5 B;  2EYY A;  3HRT A;  4J8O A;  4BDZ A;  1CKA A;  3G71 A;  1Y96 B;  3CQT A;  1IGU A;  2JJ9 A;  2KBT A;  3CME T;  2P0Q A;  1RAG B;  1JJ2 P;  3OMC A;  4XU0 A;  3WXM B;  4DA4 A;  3G6E Q;  2EIF A;  4PJM A;  3JCM b;  2QEX T;  1S72 Q;  2DTO A;  2EGA A;  3QZ9 B;  1W2B P;  2JM8 A;  1G5V A;  4PNO A;  4HCB A;  5FU6 B;  4RTX A;  4EIK A;  4QQ6 A;  2RQR A;  1RAD B;  1VQK T;  3CXC P;  3RER A;  1WLP B;  3I56 A;  3LGL A;  2HSE B;  2P84 A;  3LGF A;  5IHI A;  1OU9 A;  4M7A G;  5DY9 A;  2NUP B;  2PVG B;  1SF9 A;  5C6S A;  3CME Q;  4M75 D;  3MET A;  4LE9 A;  2YRD A;  4DEX A;  1YI2 T;  3OYL A;  5HK0 A;  2LTO A;  2MCN A;  1KK7 A;  3HP9 A;  2QEX Q;  3A8H B;  1WQ7 A;  1WHJ A;  5GAM h;  1HD3 A;  2E41 A;  2LQK A;  4A4F A;  2DTH A;  4PLI A;  4M75 E;  1NLO C;  3RNJ A;  2XU8 A;  1SEM A;  2ZAE A;  4QVC A;  3A98 A;  2VGN A;  3E1S A;  2X3W D;  2K3X A;  2ABL A;  2YWW A;  3LWI A;  5GAN 4;  3JCM J;  3X25 B;  2ED0 A;  2RN8 A;  2DXT A;  1B34 A;  2YRC A;  1M2V B;  2QAZ A;  2DKG A;  4K11 A;  4XTX A;  2RI2 A;  2GCX A;  1ZA2 B;  3ZFJ A;  4A53 A;  3OYM A;  4KGZ B;  4BD3 A;  1YI2 Q;  2WAC A;  2X51 A;  1ZA1 B;  1K73 C;  5LJ5 f;  5FLX E;  4FW2 A;  4HCK A;  1M4Z A;  1LCK A;  2JTF A;  5D6Y A;  4KUI A;  4AT1 B;  4F16 A;  3JCM P;  4J7I A;  1Q86 C;  1GXI E;  1XJW B;  5D6W A;  2DL5 A;  1YCS B;  4AG1 C;  4J6X A;  5KCH A;  2R57 A;  2DTI A;  5CKD A;  1N8R R;  2GQI A;  4GY5 A;  2JZ2 A;  3L42 A;  2F2X A;  4C8Q A;  4PFZ A;  3QKJ A;  1QVP A;  3OA6 A;  1BCO A;  2CZ0 B;  3OSV A;  2AK5 A;  2O2O A;  3OYN A;  1RAC B;  4C5G A;  2LMJ A;  2QDL A;  3EHR A;  1EZZ B;  1HSQ A;  2O31 A;  4F7U F;  1UG1 A;  3CC7 Q;  3VS0 A;  2LX7 A;  4ZN1 A;  2KAF A;  3MO8 A;  2DK3 A;  2CP7 A;  4M78 A;  4IUR A;  2EYW A;  1GFC A;  1JQQ A;  2DL3 A;  2ED1 A;  4QW2 A;  4BB7 A;  1J3T A;  2VC8 A;  3L2Q A;  5IXB A;  1AOJ A;  4CC7 A;  3CCL T;  5CKE A;  1UGS B;  2E10 A;  3QJ6 A;  5C0M A;  1BI1 A;  2EBP A;  2LQ8 A;  2LJ1 A;  2Y90 A;  2AKK A;  2QTV A;  4C92 B;  3OS0 A;  3LWH A;  3V8L A;  5IHN A;  2E5K A;  3G4S A;  1YJN A;  4DBQ A;  4FCY A;  3P8B B;  3FIF A;  2LC4 A;  2JS2 A;  2X4J A;  1VQ7 A;  2IIM A;  3CCR A;  4LDU A;  1VQL T;  1WGS A;  2CS7 A;  3OS1 A;  1E6H A;  5KYN A;  2XIC A;  5CCA A;  2NYS A;  1BK2 A;  5CR2 A;  1H3H A;  1TTH B;  5GAN d;  3H0F A;  1GCQ C;  1VQO T;  1Q7Y R;  2DO3 A;  2OAU A;  3R6O A;  1VYT A;  3SWN C;  3S3M A;  2FRW A;  3OW2 A;  2PVO B;  1VQN A;  2RHZ A;  4CI0 C;  5GAN 3;  4A4E A;  3CCL Q;  3QDF A;  5GAN g;  1M1K R;  2QYZ A;  4Y92 A;  5GAO p;  3M0U A;  2DIG A;  4C0Z A;  2X4W A;  4FYV B;  3MEV A;  4R0K A;  4WF2 A;  1K73 U;  2KGT A;  3EGD A;  5KYX B;  2EYX A;  2XKO C;  4OP0 A;  4CC4 B;  3L2V A;  1YIJ A;  3CC4 T;  4OB0 B;  2FO0 A;  3A8G B;  2RB6 A;  5CVI A;  3QPH A;  4JS5 A;  2AT1 B;  3OYK A;  1Q86 U;  4DOW A;  1MND A;  1K8A C;  3VS3 A;  1UHC A;  2KYB A;  2QQS A;  2XDP A;  3MPU B;  4JLG A;  1VQO Q;  1HYO A;  4M7A F;  2VAS A;  2KRS A;  2JXB A;  1OPL A;  4N4G A;  3INZ A;  2RQW A;  3CD6 A;  2HL3 A;  1X6G A;  1NE8 A;  4HVV A;  5FWC A;  2PUO B;  2EYZ A;  3QUI A;  3RBB B;  1V29 B;  4ZGJ B;  1N27 A;  1KHC A;  1X6O A;  1W6X A;  3CCU A;  3M56 A;  3CCQ A;  3DKM A;  3EGX B;  1V1C A;  4MDW A;  3CC4 Q;  5FRN A;  2W10 A;  4LN2 A;  1MGQ A;  1AD5 A;  2M9U A;  1YCY A;  3RDV A;  2JVV A;  3OMG A;  4KGX B;  1Y7X A;  1IO6 A;  4BE0 A;  3U23 A;  1Q81 C;  1W1F A;  4M4Z A;  1WDX A;  1G3S A;  1X27 A;  2D8J A;  1VIF A;  2EFI A;  2C0I A;  2O9V A;  1GBR A;  1H92 A;  1BI2 A;  5LJ3 e;  2LX9 A;  1Q82 C;  5HCK A;  5GAM e;  4D8K A;  2HSP A;  1PD0 A;  4JJN K;  3JB9 J;  2CT4 A;  1M1K U;  1IB8 A;  1QCO A;  5CQX A;  4M77 F;  4LXC A;  4WTO B;  3SHW A;  1ZSZ B;  3UA7 A;  5L8R E;  3CCV T;  1PHT A;  1OZ3 A;  5GAN 6;  1M1G A;  1X2K A;  3A8O B;  4J9C A;  5AT1 B;  1NYF A;  4B9X A;  4FT4 A;  2WSF E;  2QXF A;  1D0Y A;  4GLM A;  1UGR B;  2IVW A;  1K0S A;  1Y96 A;  2R5M A;  3HPW A;  2QI2 A;  4F17 A;  2K4Y A;  1UFF A;  2ROT A;  1ABQ A;  4C8Q D;  1N5Z A;  2EQM A;  3OYY A;  4CRI A;  4AFZ C;  5GMK e;  1VQ5 T;  2XID A;  3OYF A;  1FMV A;  4PJN A;  3CCJ Q;  1WNL A;  3C12 A;  2HDA A;  1C6V X;  4M78 D;  3PIP A;  1K9A A;  2MF2 A;  4C8Q E;  4L6V 5;  4LD6 A;  5IXF A;  3CC2 T;  3JB9 F;  5GAN h;  1BIA A;  3CCV Q;  3BDL A;  2L0A A;  3G6E A;  1E7O A;  3M54 A;  1YHQ T;  4OMQ A;  1S72 A;  2BZY A;  3EHQ A;  4M78 E;  1UDL A;  2NUP A;  3MEW A;  1WXU A;  3OYJ A;  5EC7 A;  2NLU A;  1HJD A;  4OB2 B;  3QDR B;  2CT3 A;  3JV3 A;  2RM4 A;  1RAF B;  2XI9 A;  5GAN 5;  4FYW B;  3NPF A;  5LJ5 d;  4DBF A;  4L5G A;  3KBG A;  3SD4 A;  1X69 A;  2HD0 A;  4UC4 A;  2JT4 A;  3OQ5 A;  1VQ6 T;  3CCS Q;  3TSZ A;  2VKN A;  1UUE A;  1UGP B;  2KVQ G;  4A4H A;  1Q81 U;  1OU8 A;  2RQT A;  5LJ5 g;  2ZPE B;  3DLL A;  2COZ A;  2RHU A;  3CME A;  2LT4 A;  4N4I A;  2JTE A;  3H0I A; 
#chains in the Genus database with same CATH homology
 2Y4Y A;  3WVD B;  3OMC A;  1Q82 U;  4XU0 A;  3WXM B;  1NZ9 A;  4N0A C;  4DA4 A;  2LNV A;  3CXC A;  3FJP A;  2QTX A;  3OY9 A;  3QHS A;  4DQ2 A;  3FB9 A;  4M7D D;  2EIF A;  2L5Q A;  2MWO A;  2QEX A;  1VQP T;  3CCE T;  3JCM b;  2GQV A;  2BIV A;  2QEX T;  2YHT A;  4C92 D;  5D6X A;  1OZ2 A;  1U1T A;  2DTO A;  2VV5 A;  3QZ9 B;  3X26 B;  1KD1 C;  1G5V A;  2LVM A;  2EWN A;  3FLG A;  4PNO A;  4ZGD B;  4KBM B;  3I55 A;  3ZEH A;  4HCB A;  3I55 T;  5FU6 B;  1I81 A;  1WPY A;  5I21 A;  2EJF A;  1W4S A;  4M7A C;  2JN0 A;  4NL3 A;  4XQ3 A;  3CCM A;  2OTJ A;  2X4X A;  5LJ3 f;  4FL6 A;  2E6N A;  4QQ6 A;  5CO7 A;  2FVU A;  3OYA A;  3CCM T;  4BAC A;  1VQK A;  3JB9 G;  4PJO A;  2OTJ T;  3TCJ A;  3T9N A;  1VQK T;  4M7D E;  1D3B A;  3RMQ A;  5GAM f;  3RER A;  3URG A;  2YLC A;  4EMK A;  3P8H A;  4VUB A;  4XTV A;  4C92 E;  3JCM W;  2HAX A;  1H3Z A;  4JRQ A;  3I56 A;  3A8M B;  3LGL A;  1QVG S;  1O9S A;  2AHJ B;  2K3Y A;  3LGF A;  3VKI A;  3SWN B;  1QVF A;  4OMF B;  5IAY A;  4M7A G;  1AHJ B;  5DY9 A;  2RK1 A;  4RCC A;  5GAO q;  2PVG B;  2K57 A;  2EYQ A;  5GAN f;  2P0K A;  1SSF A;  1KQS S;  1M5Q 1;  2DXU A;  3J80 E;  2EQU A;  4E7K A;  1YIT A;  2IG0 A;  2EAY A;  5C6S A;  4M75 D;  1Q7Y C;  1YIT T;  3MET A;  5KE3 A;  1YI2 A;  4Y28 E;  1YI2 T;  3CBO A;  1NPP A;  3OYL A;  5HK0 A;  3X24 B;  3GOX A;  1KC8 U;  5A0L A;  2RHI A;  2K5F A;  2PUK B;  2LTO A;  1PSE A;  2O01 E;  3E19 A;  5CKF A;  2KQW A;  5FU7 B;  3HP9 A;  3QYG B;  3KXT A;  2DVE A;  3A8H B;  5IN1 A;  1WQ7 A;  2PQW A;  3P8D A;  1M1K C;  1LOJ A;  4MDX A;  4C5I A;  4E7L A;  4OB1 B;  2E41 A;  2LQK A;  4A4F A;  5GAM h;  4ZTJ A;  2DTH A;  4PLI A;  4M75 E;  5GAN 7;  2LDM A;  1K8A U;  4FSX A;  2XU8 A;  4QVC A;  2DZC A;  3ASK A;  3E9F A;  5EG2 A;  3DB4 A;  4BDY A;  2VGN A;  1WJS A;  2P4T A;  4PLL A;  1HK9 A;  1VQN T;  2DD5 A;  2LCL A;  2RHX A;  3QO3 A;  3TEE A;  3E1S A;  3OYC A;  1H64 1;  3A8L B;  3RKX A;  2K3X A;  3MP1 A;  3LWI A;  5GAN 4;  2MAM A;  3JCM J;  3X25 B;  4L59 A;  4C92 A;  1G3W A;  3EFS A;  4OGE A;  4LDY A;  2CZ1 B;  4IUP A;  2DXT A;  3C4S A;  4M77 C;  4EMH A;  4IUQ A;  4E47 A;  3CPW S;  1B34 A;  3GP8 A;  2ZPB B;  4F7U A;  5CIU A;  4NS5 A;  1YIJ T;  4HCZ A;  2GFU A;  2RHY A;  3FDR A;  2DKG A;  1N8R U;  1N9S A;  2RI2 A;  2E70 A;  4XTX A;  2XDB A;  2GCX A;  2E64 A;  4LD9 K;  2DXC A;  2XK0 A;  4JRK A;  3ZFJ A;  4XTW A;  5CKH A;  4A53 A;  3OYM A;  2EJ9 A;  2V8J A;  4BD3 A;  1KHI A;  2R5A A;  2VUB A;  1X75 C;  2WAC A;  2KK4 A;  3VYG A;  5KCO A;  1K73 C;  4PJO B;  5LJ5 f;  3A5Z B;  1QP3 A;  5FLX E;  2I2L A;  3PGG A;  3RES A;  1D3B B;  1M4Z A;  4JLI A;  2WSE E;  2HQE A;  3S6W A;  2D6F A;  4EMK B;  4ELY C;  4HCC A;  3V8K A;  2JTF A;  3MP8 A;  4MZT A;  5D6Y A;  4KUI A;  4X9C A;  5GMK i;  4FM4 B;  4BUG A;  3LYI A;  3CMA A;  2RJF A;  4EMG A;  3JCM P;  2M0O A;  4MZP A;  4J7I A;  1Q86 C;  1K9M C;  3CMA T;  4M7A D;  2HQX A;  1GXI E;  4XU1 A;  5D6W A;  3OYG A;  2QQB A;  4QQD A;  4J6X A;  5KCH A;  2R57 A;  2DTI A;  3H6Z A;  3M55 A;  5CKD A;  1QVG A;  4DOV A;  5GAN j;  3VUZ A;  4GY5 A;  2JZ2 A;  3L42 A;  1KD1 U;  4M7D F;  4C8Q A;  3QKJ A;  1QVP A;  3QXE B;  1XOV A;  3OA6 A;  2DPP B;  1VUB A;  1KQS A;  4KUD K;  1LJO A;  2CZ0 B;  2P0P A;  3OSV A;  4Q5W A;  4C92 F;  4PJO C;  3OYN A;  3M58 A;  4C5G A;  4JRP A;  5GAO m;  5CKB A;  3CCE A;  1VQP A;  3JSC A;  2GF7 A;  4F7U F;  4E7J A;  4EMK C;  4O6J A;  2DD4 A;  4M7A E;  4ZN1 A;  5LJ5 h;  2KAF A;  3HRS A;  2DK3 A;  3MO8 A;  4M78 A;  3J7A F;  1M8V A;  2RH2 A;  4IUR A;  3JCM Q;  1EIF A;  4O5V A;  4YTL A;  4J6Y A;  4RMO A;  4QW2 A;  4JS4 A;  4B9W A;  4BB7 A;  4OGC A;  2VC8 A;  3JCM V;  3L2Q A;  4PJO G;  1P92 A;  3DB3 A;  2ZPG B;  3OYD A;  1VQ9 A;  4JUV A;  3MCA B;  3F70 A;  3MHX A;  1VQ9 T;  2QQR A;  3CCL A;  4R55 A;  4OF1 A;  2H3J A;  4PKC C;  5CKE A;  1UGS B;  2E10 A;  2E65 A;  3QJ6 A;  3OS2 A;  3CCL T;  1G3T A;  5C0M A;  1BI1 A;  4X9D A;  2DIQ A;  2LQ8 A;  3JCM d;  2RJE A;  3FEO A;  2K5L A;  2Y90 A;  1Q7Y U;  3UT1 A;  4A4G A;  4C92 B;  2RI3 A;  4FIB A;  3WVE B;  3FRN A;  3LW5 E;  4Z02 A;  3OYH A;  3CCJ T;  3OS0 A;  2E5Q A;  1FWZ A;  1HXD A;  2A7Y A;  1WJQ A;  1OI1 A;  3LWH A;  1B34 B;  4M75 F;  3V8L A;  5J3B A;  2QDY B;  4F7U B;  4QVD A;  5GAO n;  3G4S A;  1YJN A;  2V8I A;  3G4S T;  3P8B B;  3LX7 A;  1YJN T;  4N0A A;  3PNW C;  3FIF A;  3QYH B;  3JCM g;  2LC4 A;  4C8Q F;  3FC3 A;  3OBY A;  2X4J A;  3QII A;  1VQ7 A;  1VQL A;  1W2B S;  4QVZ A;  5FU6 C;  3CPW A;  4LDU A;  3CCR A;  1WGS A;  1M90 C;  1VQ7 T;  1VQL T;  2MI6 A;  2CS7 A;  5IT9 E;  2YRV A;  3CCR T;  3N5B B;  4BE1 A;  4BY6 B;  5KE2 A;  3OS1 A;  3SB2 A;  3VU3 C;  1I5L A;  3PTA A;  4C5E A;  2XIC A;  1VIE A;  5CCA A;  4M77 D;  1XQH A;  1OYX A;  2KSS A;  5LJ3 g;  5CR2 A;  1VQO A;  2MWP A;  5AYF A;  4ZTF A;  4M78 F;  5GAN d;  1VQO T;  2C06 A;  2DO3 A;  2ZGW A;  1BI3 A;  2OAU A;  5M9O A;  3R6O A;  5FRM A;  4M7A A;  3SWN C;  2CYZ B;  4BI8 B;  3S3M A;  1KQ1 A;  3GLX A;  3HHT B;  3L2U A;  2JOY A;  1XNI A;  1VQM A;  3OW2 A;  4MZM A;  5GAN 2;  1VQM T;  4OVA A;  3SFM A;  2PVO B;  4J5Y A;  2LCC A;  2E12 A;  2JNG A;  1VQN A;  1ZHI A;  2G3R A;  2DJZ A;  2K5I A;  2RHZ A;  4CI0 C;  5GAN 3;  2DZ9 A;  3LLR A;  4A4E A;  3JB9 H;  5GAN g;  2CGH A;  4C8Q B;  3V7S A;  4M77 E;  5FRO A;  3NFC A;  3M57 A;  2GFA A;  3L1A A;  4XTY A;  5GAO p;  2XG8 D;  4C0D B;  3ZBD A;  4OB3 B;  4M7D A;  3JCM X;  3ER0 A;  2DIG A;  4C0Z A;  5GAO r;  4ME7 A;  2X4W A;  3OYB A;  3CCS T;  3UDC A;  1M9S A;  4X34 A;  3MEV A;  4WF2 A;  4F7U G;  5FU7 C;  5GAO l;  3MEA A;  1K73 U;  2V8K A;  1N9R A;  2XKO C;  3L2Z A;  4JDS A;  4OP0 A;  4A4K A;  5DM7 R;  3L2V A;  1YIJ A;  3CC4 A;  1Y71 A;  2ZPF B;  2VGM A;  4M78 B;  3CC4 T;  3X28 B;  2E6Z A;  4OB0 B;  2LRQ A;  5HKC A;  3BY7 A;  2FB7 A;  1UEB A;  3A8G B;  2ZZD A;  2OTL T;  2RB6 A;  3M4Y A;  5CVI A;  2FYK A;  4PJO D;  5HK3 A;  3QPH A;  4NOY A;  2HBP A;  4RG2 A;  4JS5 A;  3OYK A;  1Q86 U;  4PL6 A;  3V8J A;  4DOW A;  1K9M U;  4BE2 A;  1K8A C;  1KQ2 A;  2JTM A;  3HKS A;  5LJ3 j;  3JB9 D;  2ZPH B;  1KG1 A;  4M7D C;  5CQY A;  2QQS A;  2XDP A;  3S3N A;  4M7A F;  3CBM A;  4JLG A;  5GAM j;  5J39 A;  2CZ7 B;  3VV0 A;  3OYE A;  4IUU A;  3UPU A;  2X35 A;  3PMT A;  3Q1J A;  3JAM E;  3GIB A;  4N4G A;  2FHD A;  1JBM A;  4ZGE B;  3PT9 A;  1DJ7 B;  3INZ A;  3UWN A;  2XDD A;  1NJI C;  3CD6 A;  3BW1 A;  4M75 A;  3OBW A;  2EQJ A;  3CD6 T;  3GNG A;  3PIO A;  4C8Q G;  4PJO E;  1NE8 A;  2M1H A;  1BKB A;  2Y4X A;  4XU3 A;  2PUO B;  3KUF A;  3QUI A;  1V29 B;  4ZGJ B;  4M77 A;  4Y91 A;  3OS5 A;  1N27 A;  1KHC A;  1X6O A;  1WJR A;  2EJG A;  4XK8 E;  3VUB A;  3HFO A;  3CCU A;  4MML A;  1MHN A;  1WQW A;  2VXF A;  3MP6 A;  3M56 A;  4J83 A;  3CCU T;  3CCQ A;  4IKF A;  3DKM A;  3LH0 A;  1YBY A;  4M78 G;  3CCQ T;  2EQK A;  3H8Z A;  4HA8 A;  3NTI A;  2BUD A;  4MDW A;  4M7A B;  1PSF A;  5FRN A;  3JB9 I;  1MGQ A;  3G71 T;  2M9U A;  2A3L A;  1YCY A;  2JVV A;  3BFM A;  3OMG A;  1Y7X A;  3QG1 A;  3RIR A;  3V7C A;  4A54 A;  3JCM e;  2L89 A;  5GAN 8;  4BE0 A;  4FU6 A;  1QW1 A;  2EKO A;  4KT0 E;  1Q81 C;  4C5H A;  5A0D A;  5GMK j;  2RD1 A;  2X4Y A;  2XD0 A;  1G3S A;  3GNF B;  4XTU A;  4M7D B;  2EFI A;  2PVD B;  1VIF A;  3CEY A;  3JCM f;  4EPC A;  4NL2 A;  1BI2 A;  2VXE A;  4V2S A;  1JJ2 S;  1VQ8 A;  3CCJ A;  1M90 U;  2L8D A;  1VQ8 T;  5LJ3 e;  1RI0 A;  1Y07 A;  5CK9 A;  2DEQ A;  4GLK A;  4IUV A;  1O75 A;  2LX9 A;  3EFR A;  3V7R A;  1UB4 A;  3E9G A;  5GMK m;  1RL2 A;  2F69 A;  3ME9 A;  1Q82 C;  2YLB A;  5GAM e;  3CC7 A;  5DLQ E;  2KY9 A;  1FXX A;  5DLO A;  2QQ9 A;  4XU2 A;  4ELZ C;  4P5N A;  4J7F A;  3M9Q A;  5LJ3 d;  4JJN K;  3JB9 J;  2B8A A;  2DXB A;  3TU4 K;  1M1K U;  5CQX A;  5HY6 A;  1NPR A;  4M77 F;  3HRU A;  5GAM d;  3CCV A;  2QA4 A;  4ATO A;  2MMP A;  2QA4 T;  5L8R E;  3CCV T;  1I8F A;  1OZ3 A;  5GAN e;  1LNX A;  5LL6 S;  4TVR A;  5GAN 6;  3O8V A;  2R58 A;  1M1G A;  3A8O B;  1VQ4 A;  3M53 A;  3X20 B;  3I56 T;  4B9X A;  3S3O A;  1VQ4 T;  4FT4 A;  3HFN A;  2KDS A;  4BI4 A;  2WSF E;  3NTH A;  1QP2 A;  4F7U E;  1XTD A;  5I2S A;  2FL7 A;  5LJ5 j;  3L2R A;  3GPL A;  3M4G A;  2RA2 A;  1IRE B;  4C92 C;  2BKD N;  5GAM g;  2QXF A;  4MMK A;  3CXC S;  4LDV A;  3J81 E;  1UGR B;  2IVW A;  2O4X A;  1Y96 A;  2PU9 B;  2R5M A;  3HPW A;  3JCM h;  3VJP A;  3OB9 A;  2QI2 A;  4M75 B;  3CPF A;  1JB0 E;  4FT2 A;  3MEU A;  4HKE A;  4XAX B;  4E7I A;  3JCM c;  5I2M A;  2K2V A;  3RKY A;  2K4Y A;  4C8Q D;  4M7D G;  1U1S A;  3JRZ A;  5KH6 A;  3OYI A;  2EQM A;  3M59 A;  4HT8 A;  1ZBX A;  4M77 B;  4C92 G;  3OYY A;  4CRI A;  4EDU A;  1VQ5 A;  3QJY A;  3RMS A;  4RCB A;  4BY6 C;  5LJ3 h;  5GMK e;  2XID A;  3CCS A;  3OYF A;  1VQ5 T;  1G3Y A;  4BI3 A;  3EAE A;  3RUX A;  3QBY A;  5A0G A;  1WNL A;  3C12 A;  5CAI A;  3HSB A;  2ZCF B;  1KC8 C;  4M78 D;  3GF5 A;  4C0G A;  4J6W A;  1IZ6 A;  4C0F A;  4PJO F;  1N6A A;  1ZQ1 A;  3PIP A;  2MF2 A;  3PFS A;  4XTZ A;  4C8Q E;  3CBP A;  4L6V 5;  2OTL A;  4LD6 A;  3CC2 A;  1QVF S;  2VYT A;  3CC2 T;  4M75 C;  5GAN h;  3JB9 F;  1BIA A;  1UGQ B;  4HT9 A;  3OSS C;  3PMI A;  3BDL A;  2RO0 A;  1NJI U;  2M16 A;  5J26 A;  3G6E A;  1YHQ A;  2ZPI B;  3M54 A;  3G6E T;  1YHQ T;  4II1 A;  3C94 A;  4C8Q C;  4ZN3 A;  3C95 A;  2D0Q B;  3SWN A;  2JUF A;  2RJD A;  2QQA A;  3RKW A;  4C0D C;  4RG8 A;  1S72 A;  3CC7 T;  1M1F A;  4M78 E;  2F5K A;  3SDZ A;  3TRE A;  3MEW A;  1S72 T;  2RI5 A;  2L3R A;  4KUL A;  3M5A A;  4E7H A;  3OYJ A;  1I4K 1;  3HL8 A;  2WSC E;  2RK2 A;  4M75 G;  5LJ5 e;  2LT1 A;  2NLU A;  2D9T A;  2DAQ A;  4OB2 B;  3BDU A;  5GMK l;  1BYM A;  3G7Z A;  3QDR B;  1X01 A;  3QSU A;  2RM4 A;  4M78 C;  1TH7 A;  2XI9 A;  1JJ2 A;  4RKU E;  2KMT A;  1BI0 A;  5GAN 5;  5LJ5 d;  2CKK A;  2F5T X;  2CZ6 B;  4L5G A;  3KBG A;  4N4H A;  5A2Q E;  4IUT A;  4M77 G;  1U8R A;  1BIB A;  3DLM A;  3SD4 A;  4D6W A;  2HD0 A;  5GMK h;  3OW2 S;  1N8R C;  4UC4 A;  1YJ9 A;  1VQ6 A;  3OQ5 A;  2XHC A;  1YJ9 T;  1VQ6 T;  1FX7 A;  1YJW A;  1JRI A;  3L2W A;  1R8O B;  1UGP B;  2KVQ G;  4JRI A;  4A4H A;  4QQG A;  2RJC A;  1YJW T;  1W2B A;  1Q81 U;  5LJ5 g;  4LDX A;  3QZ5 B;  4R56 A;  2ZPE B;  3VYH B;  3HRT A;  4J8O A;  2HNI A;  4LDW A;  4BDZ A;  3NTK A;  2E1H A;  3G71 A;  3DLL A;  2RHU A;  2O4X B;  1Y96 B;  3CME A;  3AHU A;  2LT4 A;  4N4I A;  3CME T;  2P0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...