5GANd

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gand00
4A53A 2E41A 4M7AD 3V8LA 4F7UA 4J6WA 4M77A 3RKYA 4M7DG 1BIAA 2VC8A 4C92F 4C8QA 4N0AC 1WNLA 4M75A 2EJ9A 2E10A 4M7AG 4C92E 2DJZA 4M78B 1JBMA 1YCYA 2FB7A 5LJ3d 4A54A 4M7DC 4PJOD 3SB2A 1H641 4XU2A 4M75C 4NOYA 3BW1A 4EMHA 4M7AC 3QSUA 5GANg 1X01A 5GAN3 5LJ5e 4M78D 3SWNA 4PJOG 3V8JA 3JCMQ 1M8VA 1KQ2A 3V7RA 2DEQA 3EFRA 4XTUA 2DXTA 3JCMh 3V7CA 4EMKC 1LNXA 3JB9I 3QUIA 4XU0A 1I5LA 3BDUA 5GAMh 3BY7A 4M7AB 3JCMV 4PJOC 1MGQA 2EJFA 2E64A 1TH7A 3M4GA 1WQ7A 1Y96A 2RA2A 4M77D 4MMLA 4C8QD 4M7DD 1WPYA 5GANd 5LJ3e 5GMKm 1JRIA 2VXFA 4EMKB 3V8KA 3JCMd 4M75D 4M77G 5GAMd 2YHTA 4C8QG 4PJOB 3RKXA 2CGHA 2YLCA 5GAN5 4J6YA 4M75G 5LJ3f 5GMKj 1M5Q1 4JUVA 4M77C 4M7AF 1B34B 4XQ3A 5GAN6 2E65A 3JB9D 4C8QC 3HFNA 3JCMJ 3PGGA 2DXUA 4JLIA 4M7AE 3GIBA 4XTVA 3BFMA 1HK9A 3RIRA 3FIFA 4NL3A 2Y90A 5GANe 5GMKi 3JB9G 3JCMg 4M77B 4PJOF 4MMKA 1HXDA 4M7DB 5GAMg 4C8QB 5GAMe 4EMGA 4PJOE 4M75B 4RCBA 4WF2A 3SWNC 3JCMb 4M78F 5GANf 4PNOA 3JCMf 3V7SA 5GAN7 1BIBA 2YLBA 1N9RA 1KQ1A 3QHSA 4M78E 2JN0A 4C92A 5GAMf 1D3BA 2DTIA 4J5YA 4QVCA 4JRIA 5I21A 5GAOn 4F7UG 1I4K1 1LOJA 4X9DA 4V2SA 3SWNB 1N9SA 4J6XA 4M77F 4M7DF 2EJGA 2RM4A 4C8QF 3HFOA 3JCMX 5GAOm 3QO3A 4M77E 5DY9A 4M75F 5LJ5j 5GAOp 3JB9J 4M78C 4C8QE 4M7DE 2EWNA 2RB6A 4DQ2A 2E1HA 4M75E 5GMKh 1Y96B 5LJ5h 4OP0A 4XTXA 2DZ9A 5GAOq 4XU1A 5GMKl 2DKGA 3JCMc 4M78A 4F7UB 3JCMe 1WQWA 4XTWA 3JB9F 2QTXA 3FB9A 4HT9A 4JRKA 3VU3C 5LJ3j 4C92D 5LJ5d 4N0AA 4HT8A 3RKWA 1U1SA 3L1AA 5LJ3h 4C92G 5GAOr 3AHUA 1I81A 2FYKA 3JCMW 4M7DA 1LJOA 4XU3A 3INZA 2I2LA 5CAIA 5GAN8 3HSBA 4XTZA 4M7AA 4F7UF 4HA8A 2DVEA 2HNIA 4C92C 3JCMP 2ZGWA 4F7UE 1U1TA 4NL2A 3JB9H 4EMKA 5GANj 4XTYA 3RERA 2DTOA 5GMKe 5LJ5g 3L2ZA 2VXEA 4QVDA 3RESA 5GAMj 5GANh 2RD1A 1I8FA 2K57A 4C92B 4PJOA 1D3BB 2DTHA 4M78G 3RUXA 1B34A 3EFSA 5LJ5f 3FJPA 4Y91A 4RCCA 2EAYA 5GAN2 5GAN4 5LJ3g 5GAOl 2DZCA 4X9CA
chains in the Genus database with same CATH superfamily
3V8LA 4Q5WA 1YJ9T 2MMPA 1TUGB 4XU2A 3A5ZB 1R8OB 5GAN3 3S3MA 1M8VA 1U3OA 4B9WA 1LNXA 1Y0MA 3M0RA 3BDUA 1X75C 4X34A 1WJSA 1F1BB 1VIEA 3DLLA 1YWOA 3E9FA 1SSHA 4JRPA 2EIFA 2YLCA 1OPKA 3CXCS 4E7LA 4JUVA 1UUEA 2EYQA 2P4TA 3GLXA 4C8QC 1NEBA 3J81E 5CO7A 1YJNQ 2DRKA 1D0YA 5GANe 5HKCA 1AD5A 2YRDA 5M9OA 1QP3A 1VQNA 4E2FB 4M7DB 2FRYA 1Q86U 3DB3A 3CMAQ 4WF2A 1NG2A 3H0HA 2ZPIB 1KHIA 2OX7A 4J5YA 1Z9QA 1OZ3A 1N9SA 3LGFA 1NZ9A 5GAOm 5HCKA 3G1JA 4M77E 3LGLA 4M75F 1VQOA 1RAHB 5LJ5h 2DZ9A 1I0CA 2RMOA 4XU1A 4OVAA 4E7JA 2F2VA 3JCMe 1PCXA 3FB9A 1ZSZB 5LJ3j 2DLPA 5AT1B 1FMKA 4FM4B 1G2BA 1VQPA 2FYKA 2KK4A 1KQSP 1NLOC 3A8GB 1YITT 3JB9H 1IHWA 1OPLA 4N4GA 4ELYC 3UA6A 3OW2A 2LCSA 3UPUA 1PWTA 5C0MA 2EQUA 5CK9A 4AFQC 2MPXC 3NTKA 2XI9A 5GAN2 5GAN4 2QQRA 1UEBA 3EH1A 1K8AR 1VQKA 2K7AA 2FEIA 4QQ6A 1YJ9A 3CBPA 2CH4A 1PNJA 1MV0B 4JRQA 1NYGA 2RHIA 4RTTA 5FRMA 3OY9A 1JU5C 2A08A 2M0YA 4IKFA 1QKWA 2M1HA 3EFRA 2HMAA 1K73C 1VQMT 1IGUA 2D0QB 2RQUA 1YI2A 2M51A 4DQ2A 4C8QD 3ZBDA 5LJ3e 2D0NA 2XKOC 2M9UA 3EFOB 1VQ8A 1LVKA 3CBMA 1N8RU 5GAN6 2C0IA 3PNWC 4IIMA 3R6OA 4ESRA 5HY6A 1HYOA 4C0DB 3JB9G 4CI0C 3RDVA 2NUPB 5GAMg 2AT1B 3CCQQ 2L3RA 3SWNC 2K3XA 2CYZB 2KROA 3I5SA 1N9RA 5FROA 5I11A 1O75A 2ATCB 5KYWA 2KAFA 1R0BG 4J9HA 2O4XB 3I56Q 2W0ZA 2GGRA 2OI3A 1Y7XA 2HCKA 2H3EB 1M8MA 4LDXA 2OAWA 5FU7B 3CCLQ 3PE0A 3JCMc 5KCHA 1BKBA 5I2MA 4MZMA 2DX1A 4FW1A 1VQLQ 2P0KA 1OQKA 3AHUA 1G3YA 2HSPA 2RHZA 2ZPHB 1YITA 2QA4A 1BU1A 1PHTA 2KYBA 3QG1A 2X4XA 3M0UA 3LWHA 1M1GA 1UDLA 2KDSA 3M4YA 1QVGS 1M30A 3PMIA 1RLQC 2X4JA 3JSCA 1PC0A 2ED1A 4A4FA 5FRNA 3CC7T 3HP9A 1WI7A 5IHNA 2YUQA 4LUDA 4C92F 4HCKA 1K9MU 2DXBA 4JJDA 1ZX6A 3CCMQ 1VQ4T 2AIRB 4M78B 3OS1A 3PIPA 2O2OA 2PU9B 2PUKB 3H0IA 2K2MA 1VQ9Q 1JXMA 2VGNA 5GANg 3V8JA 3E19A 3CD6T 3OYNA 3V7RA 3CC2A 1VYUA 2VB6A 4CC2A 1KD1C 2E64A 3OS2A 1WX6A 2OTLA 2DD4A 2L89A 4OMPA 4OMOA 1B7TA 2A37A 2OTJT 1G3TA 5GAMd 4J7IA 1M5Q1 1ACMB 3MP1A 2E65A 3VS7A 1K76A 4AFUC 1GCQC 2CZ1B 3X24B 4M7AE 4VUBA 3JCMg 2B86A 2GNCA 3EG9B 4PNOA 1QKXA 4ANJA 2EYYA 2MCNA 2MWOA 1LCKA 2EJGA 2QQSA 2VYTA 5DY9A 3H6ZA 1ABOA 1KC8C 3G4SA 1WHHA 4PLLA 5KYNA 5GMKl 1NPPA 2DD5A 3VU3C 5CKHA 4C0FA 2DK3A 2K2VA 2XD0A 1MMDA 2I0NA 2ZPBB 3CCST 1ZUUA 4NL2A 4EMKA 5KYXA 3Q1JA 3FLGA 4PJOA 1BB9A 3QDRB 2EKHA 4RG2A 2DF6A 2V1QA 2E6NA 4DBRA 3CC7A 3RNJA 2DL3A 5LJ3g 2DIGA 2F2XA 4AG1C 2RJDA 2QDYB 4C0ZA 1WDXA 1O9SA 4N0AC 1KG1A 1Q95G 1MMGA 1M1KR 1K1ZA 1KQSA 1YJNA 1ZBXA 1PD0A 4PJOG 2LQ8A 3CMEQ 2BZXA 4XU0A 3J80E 2K6DA 3CMAA 4M7DD 3C94A 1JJ2S 1WPYA 5L8RE 1W70A 1RAIB 3JCMd 5D6XA 2RI3A 5CKBA 2CKKA 4GLMA 4J9EA 5IXBA 5GAN5 5EG2A 4C0DC 1SG5A 2XDPA 1WYXA 3NFCA 3HFNA 1N5ZA 2DXUA 4JLIA 5KYUA 4BE0A 2LNVA 4OGCA 2KBTA 1Y07A 2PZ1A 4J9FA 2G3RA 3CCVA 4PJMA 2GBQA 3MEWA 1Z9ZA 3JCMb 3QHSA 3CCEA 4BE2A 2LJ1A 5GAOn 4C8QF 1P92A 3JB9J 2NWMA 2DYBA 4M75E 1VQ5T 2B8AA 4OB0B 4A4HA 2QEXQ 2ENMA 4XTWA 2PVOB 2WSCE 2SRCA 1Q86R 1WHMA 3M53A 4A4KA 2P0QA 3OA6A 1YWPA 2JOYA 3SDZA 1SEMA 3G6EQ 1AWXA 2R58A 4HA8A 3REBB 3QJYA 3QPHA 2COWA 1WXUA 2Y4XA 3OQ5A 3OS0A 2GTOA 4LN2A 3A98A 4ME7A 3OYIA 1OX8A 3OMGA 1M2VA 2MWPA 1XQHA 3TEEA 4JZ3A 2CP5A 4M78C 1B3QA 2V8JA 1K0SA 1JQQA 2YUNA 2LCLA 2RJFA 4NOYA 4EMHA 2XK0A 4BDZA 3U23A 2GFAA 2VASA 1WXBA 1SRLA 2MF2A 1YIJT 1G3WA 2W10A 1VQ6T 2KRNA 1JB0E 3LYIA 2BZYA 4KH0B 1JRIA 1AWWA 4KUIA 1K8AC 3CC4T 1PSEA 1QCNA 3OSVA 4E7KA 4J6YA 3I56A 2PVDB 2VVKA 3JCMJ 2VV5A 4PL6A 1GL5A 2LJ0A 4L5GA 4BUGA 3META 3M0QA 2LT1A 2V8KA 3PTAA 3P8HA 3D7SB 1X69A 3G7ZA 2PNIA 3LWIA 2EYZA 2X4WA 1N8RR 4GLKA 2KY9A 4LXCA 3QKJA 2AZSA 3T9NA 3QZ5B 3EH2A 1WQWA 2H8HA 3I55Q 5CQYA 3CCUQ 3ULRB 1IB8A 1AWJA 3X28B 1VQNT 3GPLA 3VUBA 4XU3A 1VIFA 2RJEA 4F7UF 4CC7A 1T3LA 3JCMP 1S72A 3EG1A 1U8RA 4J8OA 1VQOT 3HKSA 1B34A 3QBYA 4J9DA 4NS5A 2FVUA 2BIVA 4DBQA 4M77A 3RMSA 4EPCA 1BIAA 4BI8B 2Y4YA 1RABB 2E10A 4C92E 2DJZA 3N5BB 1KHCA 3C12A 1VQ7Q 2EYXA 3BW1A 1Q81C 7AT1B 4DOWA 2RK2A 1WIEA 1U5SA 2DXTA 2QQBA 3ZFJA 5KCOA 2P84A 1Y96A 4E7ZA 1X27A 5KE3A 3CCJQ 4M77G 1K9MR 4JZ4A 2CREA 1VQKT 4OGEA 4KGZB 1AVZC 2AK5A 4C5GA 2PUOB 4FIBA 1NJIU 2DPPB 1IREB 1MMAA 4NL3A 2HKQB 2Y90A 1UGQB 2LVMA 3CQTA 3X26B 4IURA 2EQMA 3CCRA 5CKDA 4QQGA 1YI2T 2DTIA 2K4YA 1GCPA 4EIKA 1WXTA 4M7DF 2RQVA 1HJDA 4LUEA 2E1HA 1VQ8T 2FZKB 5GMKh 5J39A 3OYCA 2ZPGB 2QQ9A 4JLGA 1OZ2A 1Q7YC 2ECZA 1UHCA 1VQ4Q 1NBEB 5CKEA 5KE2A 3OYAA 4XTZA 2EGAA 1TU0B 2FHDA 2RPNA 2ZGWA 3EAEA 3H41A 1M2OA 4B9XA 1RAAB 4E7SA 1AHJB 1BCMA 2XIDA 2DXCA 3OBWA 1OU9A 2OTJQ 4MDWA 4R55A 3CMEA 1YNZA 1SRMA 1UGPB 2LP5A 4KBMB 4AG2C 1WHGA 4J6WA 1IGQA 2DL7A 1RL2A 2EW3A 2O9SA 1QVFP 4BI3A 2F69A 3GF5A 2LQKA 2EYWA 2QA4T 3OW2S 2JTFA 5A0DA 2K5FA 1FYNA 1KQ2A 1W4SA 1N27A 3OYHA 1MGQA 3VRYA 1PG5B 2QI2A 3M4GA 2CT4A 4F17A 4EMKB 5KH6A 2R57A 5ECAA 4PJOB 4MZTA 2HD0A 2CP3A 1X2KA 4FW2A 1EZZB 3CPWS 2HSEB 1D1BA 1RI0A 1SSFA 3FIFA 1QQJA 1KD1U 2EQJA 1ZSGA 2QEXA 1ZUYA 3J7AF 3MEAA 4BACA 3CCSQ 1BI2A 2CP7A 2KE9A 3CC2T 1QCOA 2J6OA 3RBBB 1KQ1A 3C0CA 4UC4A 4JRIA 3L42A 3M0TA 1H3HA 1YHQQ 2OTLT 3SHWA 2LJ3A 1M3BA 3G6EA 4F14A 1YP5A 2V26A 2RHYA 1Q82C 4C8QE 2RB6A 2LTOA 2E12A 4OMNA 3OYMA 2ROLA 2A3LA 4IUVA 1WA7A 5GAOr 5KYUB 2ZPEB 3VS6A 4M7AA 1UB4A 1RAEB 1KFZA 2EGCA 3RERA 4XK8E 5A0GA 2QG9B 2F5KA 4J9IA 2VXEA 4QVDA 2QDLA 1JXOA 2J06A 3AT1B 5DM7R 3TQ7P 4FU6A 3G4ST 1MNDA 3ZL7C 3OYEA 2LDMA 4X9CA 2FPDA 4F7UA 2EGEA 3MHXA 2EJ9A 4M7AG 1MV3A 1BI1A 2KXCA 1RI9A 2QASA 2RH2A 4FSXA 1UGRB 2WSFE 1H641 5GJWB 5IN1A 4Z89A 2COZA 3UDCA 4ORZA 1D0XA 3CBOA 4PJJA 3MJXA 3G71Q 2JXBA 1I5LA 4FSSA 4KH1B 1TH7A 3EHQA 2A7YA 2E3IA 2JS2A 3R6NA 4R0KA 1VQ5Q 3PMTA 1QP2A 5GMKj 2YXYA 2QGFB 3JB9D 1M2VB 2KR3A 4AMCA 4XTVA 8AT1B 2MK5A 4IIOA 1QVGA 2HDAA 3BE3A 1WHKA 3SFMA 1YJNT 3I55A 3S3OA 3CCUA 4HVWA 3UWNA 1OYXA 2JN0A 5GAMf 1K0XA 4N4HA 3OYGA 3M56A 4PFOA 2ZAEA 3I35A 3CMAT 3PVLA 2V8IA 5FU6B 3HFOA 3JCMX 3QO3A 5LJ5j 3E1SA 2E6ZA 3M9QA 2MI6A 1WGSA 1YCSB 2NUZA 4OP0A 4FYWB 2L8DA 1I07A 3EGDB 3MKDA 4JRKA 2BE9B 3CCVT 3L1AA 2XHCA 3M0SA 2JMCA 4R56A 3C4SA 1I81A 4M7DA 3OYKA 1T0HA 4LDUA 2XU8A 3CCET 3HTRA 4F7UE 1C1AA 2K5IA 3PVQA 2FZCB 1N8RC 5GMKe 1OEBA 2NYSA 1IO6A 3S3NA 3QJ6A 1OX9A 1UJ0A 3VYHB 2C06A 2FRWA 2EAYA 3M59A 4ZGEB 4BY6B 1MHNA 2K3YA 1PKSA 4A53A 1NE8A 3QXEB 4M7DG 3CCJA 1ZSZA 2D8JA 1WNLA 4M75A 1YJWQ 1ZLMA 3JV3A 2FB7A 2JTMA 4B6MA 2LQWA 8ATCB 3L2WA 4M75C 3QSUA 5LJ5e 3TCJA 4RTZA 1RAGB 3DLMA 1XJWB 2QYZA 4EMKC 5GAMh 4PJOC 4OMLA 5CQXA 1GFDA 2XICA 1W2BP 5GANd 5GMKm 1T3SA 4QVZA 3QWYA 1E6HA 4M75G 4FL6A 1KQSS 1B34B 4KRTA 4RKUE 4O5VA 1PM3A 3RIRA 1VQNQ 1FWZA 4M77B 1QVFA 4BDYA 1HXDA 4QW2A 1B07A 3OYJA 5IH2A 3TVTA 3JCMf 3FRNA 4QVCA 3X25B 3PT9A 3CCQT 3P8DA 3LX7A 4JJBA 2KMTA 2RM4A 4FYXB 5GAOp 4M7DE 4JPBW 5FLXE 4QQDA 1NJIR 5FWCA 1Y96B 3I56T 2YRVA 4DEXA 2JMAA 3X20B 3OMCA 2LMJA 2D9TA 2DM1A 5I2SA 3MP8A 3GOXA 1VQPQ 4Z02A 1KK7A 1JJ2A 2JVVA 5IXFA 3CXCP 1VOMA 4IUUA 3INZA 3OB9A 3THKA 1G5VA 1VQLT 4F04B 5IAYA 2X35A 4RTYA 2DTOA 3L2ZA 4RTVA 5GANh 2K57A 2CP0A 1ZUKA 1X43A 3EFSA 3HRUA 3RR6A 4E6RA 2RNAA 1MUZA 1PD1A 1ZQ1A 1YJ9Q 2CS7A 4Z88A 6AT1B 3RKYA 1UTIA 2KSSA 1CKAA 4Y28E 5LJ3d 4PJOD 2KRMA 2O9VA 1WJRA 4IUTA 1SHGA 1XTDA 2DVJA 2M16A 2HL5C 1S72T 1H8KA 1TUDA 4IUQA 3JCMh 4AFZC 4CC4B 1DJ7B 2KI7A 4OB2B 5CCAA 2V1RA 4ZTFA 1VQ8Q 3QZ9B 2YHTA 1NM7A 3RKXA 1YHQA 3ME9A 1Q81U 2E70A 2GFUA 3PGGA 1M90U 3BDLA 3I5RA 2J05A 3HRTA 1BI3A 2KRSA 3BFMA 1HK9A 3NTIA 1UGVA 2F5TX 2KGTA 3EG3A 4DA4A 2E5KA 2DL5A 3VS2A 4L59A 2DL4A 4BB7A 3CCQA 1M4ZA 3V7SA 3OYDA 5GAN7 5FU6C 4C92A 4P5NA 1TS9A 4QT7A 4X9DA 5KYYA 3DKMA 4PJNA 3L2VA 3FJ5A 1A0NB 1Y57A 5IHIA 5LL6S 1KD1R 2MOXA 1TG0A 2XG8D 1SKUB 2QTXA 3CCLA 3JB9F 1AWOA 1R77A 3KBGA 4KT0E 2IVWA 4QKUA 3RKWA 5LJ3h 1YITQ 4C92G 1VQLA 1G3SA 2QA4Q 3EG9A 2L3PA 3EGUA 3CCRT 5GAN8 4RUGA 2DVEA 2YSQA 2YDLA 1ZA2B 4XTYA 1SHFA 5LJ5g 2O31A 5GAMj 4BY6C 2X9HA 5IT9E 4WTOB 1Q7YU 1RLPC 2YRCA 2DIQA 3FJPA 1TWBA 2QGGA 1W1FA 2KQWA 4AFSC 3JRZA 4LDWA 1NPRA 3S6WA 1X6OA 4FYYB 1GBRA 2H3JA 2ZZDA 1VQMQ 2BTTA 3CCMA 4II1A 1ABQA 1E6GA 3P8BB 4M78D 1GFCA 1VQ9A 4JS4A 3PFSA 3FC3A 5KYWB 2EKOA 4M7AB 5J3BA 1WFWA 2DETA 4ZN3A 3CMET 3VKIA 1UFFA 2K79A 2C0OA 2A36A 4M77C 1QVGP 1V29B 2KYMA 3WVDB 5I22A 3MO8A 2M0OA 4PJLA 5GAMe 3EG2A 4LD6A 5HK0A 2IPOB 4V2SA 2JS0A 1I4K1 2LZ6B 3E9GA 1K4US 4HCZA 4J6XA 2JNGA 4C5IA 4LDVA 1W2BA 2ESWA 2GCXA 3KXTA 2EWNA 1QMCA 1K73U 4WCIA 3VS0A 2KXDA 3WVEB 3F70A 2EBPA 5LJ5d 1BI0A 1X6GA 2QEXT 4FYVB 4PFZA 3VRZA 1BK2A 3ER0A 1Q82U 1OI1A 1YJWA 4E7HA 3REAB 3QYGB 1I1JA 1U1TA 1VYVA 2PTKA 3G6ET 1D1CA 3M0PA 3VYGA 1E7OA 2GQVA 2L3SA 3CC7Q 1ZBJA 2CSQA 4ZN1A 5DLQE 1Y71A 1TOVA 5GAOl 1M27C 2HBPA 4OMFB 4J9GA 4JDSA 5D6YA 4C8QA 4OB3B 2LCCA 4C5EA 4MZPA 2L0AA 3CD6Q 4ZTJA 1JBMA 3SB2A 3MEVA 3CXCA 1PRLC 1X01A 2COYA 2LNHB 3MCAB 2DEQA 1VA7A 3LW5E 3V7CA 2E5QA 2HAXA 3QUIA 2RQRA 2J6KA 3VUZA 3A8HB 1J3TA 2EJFA 4M77D 1UHFA 4AT1B 2HBWA 2VGMA 4C8QG 4EDUA 4M4ZA 4KULA 3A8MB 3EGXA 4HCBA 1AEYA 3GIBA 3CCVQ 1D09B 2RI2A 4RMOA 5J26A 2DILA 4PJOF 1IZ6A 2CT3A 4E7IA 1QCFA 4M75B 4RCBA 2VUBA 3CCEQ 3SEMA 2NUTA 2RHXA 2WSEE 5KYXB 1PKTA 3I9QA 1SPKA 2L5QA 2A28A 4J83A 2KVQG 1HSQA 1M1KC 3RMQA 2JM8A 2ED0A 2OAUA 1JJ2P 4HT9A 2K9GA 2DERA 4PK4A 4X1VA 4CC3A 3URGA 1VUBA 3L2QA 3OYBA 2QAZA 3FDRA 1TUCA 3I55T 1LJOA 1S1NA 2I2LA 3CCUT 4PFPA 3HSBA 2EPDA 3CEYA 2AHJB 2RN8A 1M3AA 4RG8A 1ARKA 3OYLA 3CPWA 2DMOA 4C5HA 2CP2A 3JAME 2QXFA 1NJIC 3VS5A 3RUXA 1VYTA 4ATOA 1KIKA 1GXIE 1UECA 5GJVB 3VS4A 2FZGB 3GNGA 2HKNA 2O88A 1BYMA 4A54A 1T0JA 3KFVA 1KC8U 1EX4A 4HVUA 4OB1B 2YT6A 2XMFA 4M7AC 3HRSA 5IHKA 3SWNA 2C0TA 2EQIA 4XTUA 4ZNXA 1EFNA 2DE0X 1VQ7T 3BY7A 1Q86C 2LT4A 5FW9A 3V8KA 1H3ZA 4OMMA 1FXXA 2D8HA 3CCJT 1IRXA 2DJQA 2E3HA 2MIOA 2F1LA 5GMKi 1IHVA 2ZCFB 3GNFB 2X4YA 4MMKA 3H0FA 2K3BA 4LE9A 1CKBA 3OS5A 3OYYA 2GQIA 4M78F 2RF0A 2BE7D 2ZPFB 1D3BA 5I21A 4F7UG 1LOJA 4LNPA 1OU8A 4XAXB 2KEAA 3QDFA 1QW1A 1Q81R 3NGPA 1M90R 1OOTA 1QWFA 4OF1A 2P0PA 2D1XA 5A0LA 2OJ2A 3SD4A 2DEUA 3ZEHA 1IXDA 4J9CA 1M3CA 1U1SA 1W6XA 2NLUA 2YWWA 5CVIA 2FPFA 3OYFA 1S72Q 2HNIA 3NMZC 5CR2A 4HKEA 2M02A 1VQMA 2HEQA 2RJCA 1GRIA 4C92B 2QK0A 2CH4W 2KNBB 2X3XD 1X2QA 5KYYB 4LD9K 4KGVB 3L2UA 1HD3A 3QYHB 4M7AD 1QLYA 1GCQA 2P4RA 2RQWA 2DNUA 1YIJQ 4M7DC 3C95A 4GBQA 1VQ6Q 5DLOA 2RHUA 4ZGJB 1VQ7A 2IIMA 2YUOA 1WHLA 2MAMA 1Q7YR 3JB9I 2HQEA 2ROTA 4TVRA 3CC4Q 4DBFA 3JCMV 1WLPB 2JTEA 2L2PA 4ELZC 2DRMA 4HXJA 3TREA 4KUDK 2DBKA 4D8DA 1ZSZC 3TSWA 3KUFA 1RACB 1KJWA 4BD3A 1TSFA 2F2WA 3CCRQ 3HPWA 5GANf 1K9AA 3NTHA 4J9BA 1BIBA 2YLBA 2GF7A 1EIFA 2VWFA 2LRQA 1YBYA 2DO3A 2PQWA 2KT1A 4M77F 4YTLA 3EHRA 1BBZA 3OSSC 1V76A 4IUPA 1YHQT 2WACA 1QVFS 1SF9A 4JJNK 1FMVA 2PVGB 3HL8A 4N0AA 1YN8A 1K8AU 1VQ4A 4K11A 2DFUA 2LX7A 3JCMW 2EFIA 1KSWA 2EQKA 2AKKA 3MPUB 4BI4A 1VQOQ 1FX7A 3CD6A 1K9MC 3M58A 1YFNA 4GY5A 1K73R 3EFOA 3RESA 2CUBA 1MMNA 2QTVA 3A8LB 2FL7A 5CIUA 4Y91A 2OTJA 4RTXA 2VKNA 1WHJA 1UGSB 3VS3A 3GP8A 3CCLT 1UE9A 5D6WA 2L3QA 3A1PA 2NUPA 2JW4A 1C0MA 3WXMB 4ZGDB 2JM9A 1H92A 1OULA 3FEOA 4F16A 9ATCB 1Q82R 2E4HA 2BZ8A 5D7UA 1BCOA 1N6AA 1G83A 2O4XA 2A0FB 2QQAA 3IQLA 2KT8A 3GBQA 4A63B 1D1AA 1U06A 4Z8AA 2DYIA 3QWXX 1WQ7A 1VQKQ 2VXFA 2CZ6B 3E2UA 5AYFA 4M75D 3G71T 5FU7C 1M9SA 4L6V5 2CGHA 2FO0A 5LJ3f 1PSFA 2YUPA 3UATA 4XQ3A 4KGXB 4Y92A 2BKDN 4O6JA 1C6VX 3CCMT 1YI2Q 4C8QB 2CP6A 2LQNA 4PJOE 2HQHA 1VQ9T 1AT1B 3EG0A 2JUFA 1AZEA 3CCSA 2R5AA 2HL3A 1QWEA 3UA7A 1JEGA 2ABLA 3LH5A 3OW2P 4DBHA 2HZYA 1UG1A 2IG0A 2O01E 4LDYA 3MEUA 4FT2A 4DEYA 4A4EA 3NHNA 4XTXA 5GAOq 1NEGA 3HHTB 4M78A 4FCYA 2J7IA 4N4IA 5EC7A 4HT8A 3EGXB 2X51A 3ASKA 1RADB 2XDDA 3H8ZA 2JT4A 3A8OB 3CPWP 2J6FA 4C92C 3VS1A 3NPFA 1CSKA 1R0CB 5A2QE 2NUTB 2GTJA 1X6BA 1RUWA 2DTHA 4M78G 4RCCA 2FPEA 3OBYA 5C6SA 2LX9A 4BE1A 4EMGA 2E41A 1M1FA 5L23A 3EGDA 1AOJA 1QVPA 2VC8A 3DB4A 4HCCA 1MNEA 1ZHIA 1YCYA 2CUDA 1PRMC 1RAFB 2DBMA 2X3WD 3M54A 1YJWT 4A4GA 3JCMQ 4DOVA 4MDXA 2CZ0B 3M55A 2XDBA 2CSIA 3CPFA 4C0GA 2AKLA 3G71A 1WJQA 4MMLA 2RA2A 2CZ7B 4HVVA 1UJYA 3MP6A 3O5ZA 3PIOA 1GBQA 2RI5A 3TU4K 1ZA1B 5HK3A 1VQ5A 3TSZA 4M7AF 4JJCA 3UT1A 3VJPA 2RO0A 1KC8R 1V1CA 2LC4A 2BUDA 2K5LA 4JS5A 1LPLA 3CC2Q 1AZGB 2JJ9A 4J7FA 2G6FX 1WZOA 2OTLQ 1G8XA 4M78E 5CKFA 3SWNB 1TXQA 2D6FA 4CRIA 2Z0WA 4RTWA 2CDTA 1FMWA 1TTHB 2RK1A 2MYSA 2DKGA 5FWBA 4F7UB 4C92D 3UF4A 4E47A 2DL8A 3M5AA 4PLIA 3VV0A 3LH0A 1XOVA 2HQXA 2DA9A 3LLRA 3L2RA 2SEMA 1NLPC 2DAQA 4FT4A 5CAIA 1W2BS 2R5MA 1VQPT 2AZVA 1M1KU 4D8KA 5GANj 1YIJA 3O8VA 2JZ2A 4PKCC 1VQ6A 4OMQA 3G4SQ 1M90C 3M57A 2RD1A 1I8FA 1I5OB 2EVRA 1D3BB 1XNIA 1NYFA 1JO8A 4RTUA 5LJ5f 1OV3A 3H9NA 2FG0A 3CC4A 3QIIA 1D0ZA 4D6WA 2DZCA 2RQTA
chains in the Genus database with same CATH topology
4A53A 4M7AC 3V8LA 1NE8A 2V8JA 3QXEB 4M7DG 3CCJA 3GNGA 4Q5WA 1WNLA 4M75A 2LCLA 1YJ9T 2FB7A 1BYMA 4A54A 1KC8U 2JTMA 2MMPA 4XU2A 3L2WA 2RJFA 4M75C 4NOYA 4OB1B 2XK0A 3A5ZB 1R8OB 3HRSA 4EMHA 5GAN3 5LJ5e 3TCJA 2GFAA 3SWNA 4BDZA 3S3MA 1M8VA 2MF2A 4XTUA 4B9WA 1YIJT 3DLMA 1G3WA 4EMKC 1LNXA 1VQ6T 3BDUA 5GAMh 3BY7A 1X75C 1VQ7T 1JB0E 4PJOC 4X34A 1WJSA 5CQXA 2XICA 3LYIA 5GANd 1VIEA 2LT4A 3DLLA 5GMKm 1JRIA 1Q86C 3V8KA 4KUIA 1H3ZA 3E9FA 4QVZA 1K8AC 3CC4T 1PSEA 1FXXA 3OSVA 4JRPA 2EIFA 2YLCA 4E7KA 4J6YA 4M75G 2PVDB 3I56A 4FL6A 3CXCS 4E7LA 4JUVA 1KQSS 1B34B 2EYQA 3CCJT 2P4TA 3GLXA 4RKUE 4C8QC 3J81E 3JCMJ 5CO7A 2VV5A 4O5VA 4PL6A 4L5GA 3RIRA 1FWZA 5GANe 5GMKi 5HKCA 4BUGA 2ZCFB 3GNFB 5M9OA 3META 4M77B 2X4YA 1QP3A 4MMKA 1HXDA 4BDYA 1QVFA 2LT1A 4QW2A 2V8KA 3OYJA 1VQNA 4M7DB 1M90C 3PTAA 3DB3A 1Q86U 4WF2A 3OS5A 3OYYA 4M78F 2ZPIB 3JCMf 3P8HA 1KHIA 2ZPFB 3FRNA 3G7ZA 1D3BA 4J5YA 4QVCA 5I21A 3X25B 1OZ3A 3PT9A 4F7UG 3CCQT 1LOJA 3P8DA 3LX7A 1N9SA 3LGFA 4XAXB 3LWIA 4M7DA 1NZ9A 2KMTA 2RM4A 5GAOm 2X4WA 4M77E 3LGLA 1QW1A 4M75F 4GLKA 5GAOp 1VQOA 5FLXE 4M7DE 2KY9A 4QQDA 3I56T 1Y96B 5LJ5h 2YRVA 2DZ9A 4OF1A 3QKJA 2P0PA 4XU1A 3X20B 3T9NA 3QZ5B 4OVAA 4E7JA 5A0LA 3JCMe 3SD4A 1WQWA 3OMCA 3FB9A 2D9TA 5CQYA 3ZEHA 5I2SA 3MP8A 5LJ3j 3GOXA 3X28B 1VQNT 1U1SA 4Z02A 4FM4B 2NLUA 1JJ2A 2JVVA 2FYKA 3GPLA 1VQPA 4IUUA 2KK4A 4XU3A 3INZA 5CVIA 3VUBA 3OB9A 1VIFA 2RJEA 3CD6T 1G5VA 3OYFA 1VQLT 4F7UF 5IAYA 2HNIA 2X35A 3A8GB 5CR2A 3JCMP 1YITT 1S72A 4HKEA 3JB9H 1VQMA 4N4GA 2DTOA 1U8RA 3L2ZA 4J8OA 2RJCA 4ELYC 5GANh 2K57A 4C92B 3OW2A 3UPUA 1VQOT 5C0MA 3HKSA 2EQUA 1B34A 3EFSA 3HRUA 3QBYA 5CK9A 3NTKA 2XI9A 5GAN2 5GAN4 4LD9K 2QQRA 4NS5A 3L2UA 2FVUA 1UEBA 1VQKA 1ZQ1A 2BIVA 3QYHB 4M7AD 2CS7A 4M77A 3RMSA 4EPCA 4QQ6A 3RKYA 1BIAA 4BI8B 1YJ9A 3CBPA 2Y4YA 2KSSA 2E10A 4C92E 4Y28E 2DJZA 3N5BB 5LJ3d 4JRQA 4M7DC 4PJOD 2RHIA 1KHCA 3C12A 3C95A 5FRMA 1WJRA 2RHUA 5DLOA 4IUTA 3OY9A 3BW1A 1Q81C 4IKFA 1XTDA 4ZGJB 2M16A 4DOWA 1VQ7A 1S72T 2RK2A 2M1HA 2MAMA 3EFRA 1K73C 2DXTA 2QQBA 4IUQA 3JCMh 3ZFJA 5KCOA 1VQMT 2D0QB 3JB9I 2HQEA 4TVRA 1YI2A 1DJ7B 3JCMV 4OB2B 5CCAA 4DQ2A 1Y96A 4C8QD 3ZBDA 4ELZC 4ZTFA 5LJ3e 5KE3A 2XKOC 2M9UA 4M77G 3QZ9B 2YHTA 3TREA 3RKXA 1VQ8A 1VQKT 1YHQA 4OGEA 4KUDK 3ME9A 3CBMA 1N8RU 1Q81U 2E70A 4C5GA 5GAN6 2PUOB 2GFUA 3PNWC 3PGGA 1M90U 3KUFA 3R6OA 4FIBA 3BDLA 2DPPB 1NJIU 3HRTA 1BI3A 1IREB 3BFMA 1HK9A 3NTIA 5HY6A 2Y90A 4C0DB 4NL3A 1UGQB 3JB9G 2F5TX 4BD3A 4CI0C 4DA4A 2LVMA 5GAMg 4L59A 3X26B 4IURA 2L3RA 2EQMA 3HPWA 3SWNC 2K3XA 4BB7A 5GANf 3CCRA 3CCQA 1M4ZA 5CKDA 3V7SA 3OYDA 3NTHA 5FU6C 5GAN7 2CYZB 1BIBA 2YLBA 1N9RA 2GF7A 5FROA 1O75A 4P5NA 4QQGA 4C92A 1EIFA 1YI2T 2DTIA 2KAFA 2K4YA 2LRQA 1YBYA 2DO3A 4X9DA 2O4XB 2PQWA 4M77F 4YTLA 3DKMA 4M7DF 1Y7XA 4HCCA 3OSSC 4IUPA 3L2VA 2E1HA 1VQ8T 5GMKh 1YHQT 2WACA 4LDXA 1QVFS 5FU7B 5J39A 5LL6S 3OYCA 2ZPGB 2QQ9A 4JJNK 3JCMc 5KCHA 3CCLA 2XG8D 4JLGA 2QTXA 3JB9F 2PVGB 1OZ2A 1BKBA 3HL8A 5I2MA 1Q7YC 4N0AA 4MZMA 3KBGA 4KT0E 2IVWA 3RKWA 2P0KA 5LJ3h 1K8AU 5CKEA 4C92G 1G3YA 1G3SA 1VQ4A 1VQLA 5KE2A 2RHZA 2ZPHB 3JCMW 3AHUA 2EFIA 1YITA 3CCRT 5GAN8 2QA4A 2EQKA 3OYAA 4XTZA 2DVEA 2FHDA 2X4XA 3QG1A 4BI4A 1FX7A 2ZGWA 3EAEA 3CD6A 3LWHA 1K9MC 1M1GA 3M58A 4B9XA 4XTYA 1AHJB 5LJ5g 2KDSA 2XIDA 2DXCA 3OBWA 4GY5A 3M4YA 3RESA 4BY6C 5GAMj 1QVGS 3PMIA 5IT9E 1Q7YU 3A8LB 2X4JA 2FL7A 4MDWA 5CIUA 4R55A 3CMEA 3JSCA 2DIQA 3FJPA 4Y91A 4A4FA 2OTJA 1UGPB 4KBMB 1UGSB 2KQWA 5FRNA 3GP8A 3CCLT 3JRZA 5D6WA 4LDWA 3CC7T 3HP9A 4J6WA 1RL2A 4C92F 3WXMB 1NPRA 3S6WA 4ZGDB 1X6OA 3FEOA 1K9MU 2DXBA 1VQ4T 4BI3A 2H3JA 2ZZDA 4M78B 3OS1A 3PIPA 2PU9B 2F69A 2PUKB 3GF5A 3CCMA 2LQKA 2QA4T 1N6AA 4II1A 3OW2S 2JTFA 2VGNA 5GANg 3P8BB 2O4XA 4M78D 2K5FA 3E19A 2QQAA 3V8JA 5A0DA 3OYNA 1VQ9A 3V7RA 1W4SA 4JS4A 3CC2A 3PFSA 1KQ2A 3FC3A 1N27A 3QSUA 1KD1C 2EKOA 4M7AB 3OYHA 5J3BA 1MGQA 2E64A 2QI2A 3M4GA 1WQ7A 3OS2A 2OTLA 2DD4A 2L89A 4ZN3A 3CMET 2VXFA 2CZ6B 5AYFA 3VKIA 4M75D 4EMKB 5KH6A 3G71T 2OTJT 1G3TA 2R57A 5GAMd 4PJOB 4J7IA 1M9SA 5FU7C 4L6V5 4MZTA 2CGHA 2HD0A 5LJ3f 1PSFA 1M5Q1 3MP1A 4M77C 4XQ3A 2E65A 1V29B 2CZ1B 3CPWS 3X24B 4M7AE 4VUBA 1RI0A 2BKDN 3WVDB 1SSFA 3FIFA 3MO8A 4O6JA 1KD1U 3JCMg 2EQJA 2M0OA 3CCMT 2QEXA 4C8QB 5GAMe 3J7AF 3MEAA 4LD6A 4PJOE 4BACA 1VQ9T 5HK0A 1BI2A 3CC2T 4PNOA 2JUFA 1KQ1A 3CCSA 4UC4A 2R5AA 4JRIA 4V2SA 3L42A 1I4K1 3E9GA 4HCZA 4J6XA 2OTLT 2MWOA 2EJGA 2QQSA 2JNGA 2VYTA 4C5IA 3G6EA 2IG0A 2O01E 4LDVA 1W2BA 2RHYA 4LDYA 3MEUA 5DY9A 1Q82C 2GCXA 4M78C 4C8QE 3H6ZA 2EWNA 4FT2A 3KXTA 2RB6A 1KC8C 4A4EA 1K73U 4XTXA 5GAOq 2LTOA 3G4SA 4PLLA 5GMKl 3HHTB 4M78A 3WVEB 1NPPA 3F70A 2DD5A 2E12A 3VU3C 5CKHA 3OYMA 4C0FA 5LJ5d 2DK3A 4N4IA 1BI0A 2K2VA 4HT8A 2QEXT 2A3LA 4IUVA 2XD0A 5GAOr 2ZPBB 3ASKA 2XDDA 3H8ZA 3ER0A 3A8OB 2ZPEB 4M7AA 1Q82U 3CCST 1OI1A 1UB4A 4C92C 1YJWA 4E7HA 3QYGB 1U1TA 4NL2A 4EMKA 3RERA 4XK8E 5A0GA 3Q1JA 2F5KA 3FLGA 3G6ET 2VXEA 4QVDA 5A2QE 4PJOA 3QDRB 3VYGA 4RG2A 2DTHA 2GQVA 4M78G 5DM7R 4ZN1A 5DLQE 1Y71A 4FU6A 4RCCA 2E6NA 3CC7A 3G4ST 3OBYA 5LJ3g 5GAOl 2HBPA 2LX9A 2DIGA 5C6SA 3OYEA 4BE1A 2LDMA 4X9CA 4EMGA 2E41A 1M1FA 4OMFB 4F7UA 2RJDA 2QDYB 4JDSA 4C0ZA 1QVPA 2VC8A 3DB4A 5D6YA 1O9SA 4OB3B 4C8QA 2LCCA 1ZHIA 4N0AC 3MHXA 4C5EA 1KG1A 2EJ9A 4MZPA 4M7AG 1BI1A 4ZTJA 1JBMA 1YCYA 2RH2A 4FSXA 1UGRB 2WSFE 1H641 3MEVA 5IN1A 3SB2A 3CXCA 1KQSA 3M54A 1X01A 1YJNA 1ZBXA 1YJWT 4PJOG 4A4GA 3JCMQ 3UDCA 4DOVA 3MCAB 4MDXA 2DEQA 2LQ8A 3LW5E 3V7CA 2CZ0B 2E5QA 3CBOA 3M55A 2HAXA 3QUIA 4XU0A 2XDBA 4C0GA 3CPFA 3J80E 3VUZA 1I5LA 3A8HB 3G71A 2EJFA 4M77D 1WJQA 1TH7A 3CMAA 4MMLA 2RA2A 4M7DD 3C94A 1JJ2S 1WPYA 5L8RE 2CZ7B 2A7YA 5D6XA 2RI3A 3JCMd 5CKBA 3MP6A 3PIOA 2CKKA 2VGMA 4C8QG 2RI5A 4EDUA 3TU4K 3PMTA 5GAN5 5HK3A 5EG2A 1QP2A 1VQ5A 5GMKj 4C0DC 2XDPA 4M7AF 3UT1A 3VJPA 2RO0A 3NFCA 4KULA 3JB9D 3HFNA 3A8MB 2LC4A 4HCBA 2DXUA 4JLIA 4BE0A 3GIBA 2BUDA 2K5LA 2LNVA 4XTVA 4OGCA 4JS5A 2RI2A 4RMOA 5J26A 1Y07A 3CCVA 2G3RA 4PJOF 1QVGA 4J7FA 1IZ6A 3SFMA 3MEWA 1YJNT 4E7IA 3I55A 3S3OA 4M75B 4RCBA 3JCMb 3CCUA 2VUBA 3UWNA 3QHSA 1OYXA 4M78E 2JN0A 2RHXA 5GAMf 2WSEE 4N4HA 3OYGA 3CCEA 3M56A 4BE2A 5CKFA 5GAOn 3CMAT 3SWNB 2V8IA 2L5QA 4C8QF 5FU6B 3HFOA 3JCMX 2D6FA 3QO3A 1P92A 5LJ5j 3JB9J 4CRIA 4J83A 2KVQG 2E6ZA 3E1SA 3M9QA 2MI6A 1M1KC 4M75E 3RMQA 2B8AA 4OB0B 1WGSA 4OP0A 1VQ5T 4A4HA 2RK1A 2OAUA 2L8DA 2DKGA 4F7UB 4HT9A 4XTWA 2PVOB 4JRKA 4C92D 2WSCE 3URGA 4E47A 3M53A 3CCVT 1VUBA 4A4KA 3M5AA 4PLIA 3L1AA 2P0QA 2XHCA 3L2QA 3OYBA 3VV0A 3OA6A 4R56A 3LH0A 3C4SA 1XOVA 1I81A 2HQXA 2JOYA 3FDRA 3LLRA 3I55T 1LJOA 3L2RA 3SDZA 2DAQA 4FT4A 2I2LA 5CAIA 3CCUT 3HSBA 1W2BS 3OYKA 2R58A 2R5MA 4HA8A 4LDUA 1VQPT 2XU8A 3CEYA 1M1KU 2AHJB 3CCET 4F7UE 3QJYA 3QPHA 5GANj 1YIJA 2K5IA 3O8VA 2JZ2A 1N8RC 4PKCC 5GMKe 1VQ6A 4RG8A 3OS0A 2Y4XA 3OQ5A 3OYLA 3CPWA 3M57A 2RD1A 1I8FA 4C5HA 3JAME 2QXFA 3S3NA 3QJ6A 1NJIC 1D3BB 4ME7A 3OYIA 1XNIA 3RUXA 3VYHB 2C06A 5LJ5f 4ATOA 3OMGA 2EAYA 2MWPA 3M59A 4ZGEB 4BY6B 1XQHA 3CC4A 1GXIE 3QIIA 3TEEA 1MHNA 4D6WA 2K3YA 2DZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A53 A;  2E41 A;  4M7A D;  3V8L A;  4F7U A;  4J6W A;  4M77 A;  3RKY A;  4M7D G;  1BIA A;  2VC8 A;  4C92 F;  4C8Q A;  4N0A C;  1WNL A;  4M75 A;  2EJ9 A;  2E10 A;  4M7A G;  4C92 E;  2DJZ A;  4M78 B;  1JBM A;  1YCY A;  2FB7 A;  5LJ3 d;  4A54 A;  4M7D C;  4PJO D;  3SB2 A;  1H64 1;  4XU2 A;  4M75 C;  4NOY A;  3BW1 A;  4EMH A;  4M7A C;  3QSU A;  5GAN g;  1X01 A;  5GAN 3;  5LJ5 e;  4M78 D;  3SWN A;  4PJO G;  3V8J A;  3JCM Q;  1M8V A;  1KQ2 A;  3V7R A;  2DEQ A;  3EFR A;  4XTU A;  2DXT A;  3JCM h;  3V7C A;  4EMK C;  1LNX A;  3JB9 I;  3QUI A;  4XU0 A;  1I5L A;  3BDU A;  5GAM h;  3BY7 A;  4M7A B;  3JCM V;  4PJO C;  1MGQ A;  2EJF A;  2E64 A;  1TH7 A;  3M4G A;  1WQ7 A;  1Y96 A;  2RA2 A;  4M77 D;  4MML A;  4C8Q D;  4M7D D;  1WPY A;  5GAN d;  5LJ3 e;  5GMK m;  1JRI A;  2VXF A;  4EMK B;  3V8K A;  3JCM d;  4M75 D;  4M77 G;  5GAM d;  2YHT A;  4C8Q G;  4PJO B;  3RKX A;  2CGH A;  2YLC A;  5GAN 5;  4J6Y A;  4M75 G;  5LJ3 f;  5GMK j;  1M5Q 1;  4JUV A;  4M77 C;  4M7A F;  1B34 B;  4XQ3 A;  5GAN 6;  2E65 A;  3JB9 D;  4C8Q C;  3HFN A;  3JCM J;  3PGG A;  2DXU A;  4JLI A;  4M7A E;  3GIB A;  4XTV A;  3BFM A;  1HK9 A;  3RIR A;  3FIF A;  4NL3 A;  2Y90 A;  5GAN e;  5GMK i;  3JB9 G;  3JCM g;  4M77 B;  4PJO F;  4MMK A;  1HXD A;  4M7D B;  5GAM g;  4C8Q B;  5GAM e;  4EMG A;  4PJO E;  4M75 B;  4RCB A;  4WF2 A;  3SWN C;  3JCM b;  4M78 F;  5GAN f;  4PNO A;  3JCM f;  3V7S A;  5GAN 7;  1BIB A;  2YLB A;  1N9R A;  1KQ1 A;  3QHS A;  4M78 E;  2JN0 A;  4C92 A;  5GAM f;  1D3B A;  2DTI A;  4J5Y A;  4QVC A;  4JRI A;  5I21 A;  5GAO n;  4F7U G;  1I4K 1;  1LOJ A;  4X9D A;  4V2S A;  3SWN B;  1N9S A;  4J6X A;  4M77 F;  4M7D F;  2EJG A;  2RM4 A;  4C8Q F;  3HFO A;  3JCM X;  5GAO m;  3QO3 A;  4M77 E;  5DY9 A;  4M75 F;  5LJ5 j;  5GAO p;  3JB9 J;  4M78 C;  4C8Q E;  4M7D E;  2EWN A;  2RB6 A;  4DQ2 A;  2E1H A;  4M75 E;  5GMK h;  1Y96 B;  5LJ5 h;  4OP0 A;  4XTX A;  2DZ9 A;  5GAO q;  4XU1 A;  5GMK l;  2DKG A;  3JCM c;  4M78 A;  4F7U B;  3JCM e;  1WQW A;  4XTW A;  3JB9 F;  2QTX A;  3FB9 A;  4HT9 A;  4JRK A;  3VU3 C;  5LJ3 j;  4C92 D;  5LJ5 d;  4N0A A;  4HT8 A;  3RKW A;  1U1S A;  3L1A A;  5LJ3 h;  4C92 G;  5GAO r;  3AHU A;  1I81 A;  2FYK A;  3JCM W;  4M7D A;  1LJO A;  4XU3 A;  3INZ A;  2I2L A;  5CAI A;  5GAN 8;  3HSB A;  4XTZ A;  4M7A A;  4F7U F;  4HA8 A;  2DVE A;  2HNI A;  4C92 C;  3JCM P;  2ZGW A;  4F7U E;  1U1T A;  4NL2 A;  3JB9 H;  4EMK A;  5GAN j;  4XTY A;  3RER A;  2DTO A;  5GMK e;  5LJ5 g;  3L2Z A;  2VXE A;  4QVD A;  3RES A;  5GAM j;  5GAN h;  2RD1 A;  1I8F A;  2K57 A;  4C92 B;  4PJO A;  1D3B B;  2DTH A;  4M78 G;  3RUX A;  1B34 A;  3EFS A;  5LJ5 f;  3FJP A;  4Y91 A;  4RCC A;  2EAY A;  5GAN 2;  5GAN 4;  5LJ3 g;  5GAO l;  2DZC A;  4X9C A; 
#chains in the Genus database with same CATH topology
 3V8L A;  4Q5W A;  1YJ9 T;  2MMP A;  1TUG B;  4XU2 A;  3A5Z B;  1R8O B;  5GAN 3;  3S3M A;  1M8V A;  1U3O A;  4B9W A;  1LNX A;  1Y0M A;  3M0R A;  3BDU A;  1X75 C;  4X34 A;  1WJS A;  1F1B B;  1VIE A;  3DLL A;  1YWO A;  3E9F A;  1SSH A;  4JRP A;  2EIF A;  2YLC A;  1OPK A;  3CXC S;  4E7L A;  4JUV A;  1UUE A;  2EYQ A;  2P4T A;  3GLX A;  4C8Q C;  1NEB A;  3J81 E;  5CO7 A;  1YJN Q;  2DRK A;  1D0Y A;  5GAN e;  5HKC A;  1AD5 A;  2YRD A;  5M9O A;  1QP3 A;  1VQN A;  4E2F B;  4M7D B;  2FRY A;  1Q86 U;  3DB3 A;  3CMA Q;  4WF2 A;  1NG2 A;  3H0H A;  2ZPI B;  1KHI A;  2OX7 A;  4J5Y A;  1Z9Q A;  1OZ3 A;  1N9S A;  3LGF A;  1NZ9 A;  5GAO m;  5HCK A;  3G1J A;  4M77 E;  3LGL A;  4M75 F;  1VQO A;  1RAH B;  5LJ5 h;  2DZ9 A;  1I0C A;  2RMO A;  4XU1 A;  4OVA A;  4E7J A;  2F2V A;  3JCM e;  1PCX A;  3FB9 A;  1ZSZ B;  5LJ3 j;  2DLP A;  5AT1 B;  1FMK A;  4FM4 B;  1G2B A;  1VQP A;  2FYK A;  2KK4 A;  1KQS P;  1NLO C;  3A8G B;  1YIT T;  3JB9 H;  1IHW A;  1OPL A;  4N4G A;  4ELY C;  3UA6 A;  3OW2 A;  2LCS A;  3UPU A;  1PWT A;  5C0M A;  2EQU A;  5CK9 A;  4AFQ C;  2MPX C;  3NTK A;  2XI9 A;  5GAN 2;  5GAN 4;  2QQR A;  1UEB A;  3EH1 A;  1K8A R;  1VQK A;  2K7A A;  2FEI A;  4QQ6 A;  1YJ9 A;  3CBP A;  2CH4 A;  1PNJ A;  1MV0 B;  4JRQ A;  1NYG A;  2RHI A;  4RTT A;  5FRM A;  3OY9 A;  1JU5 C;  2A08 A;  2M0Y A;  4IKF A;  1QKW A;  2M1H A;  3EFR A;  2HMA A;  1K73 C;  1VQM T;  1IGU A;  2D0Q B;  2RQU A;  1YI2 A;  2M51 A;  4DQ2 A;  4C8Q D;  3ZBD A;  5LJ3 e;  2D0N A;  2XKO C;  2M9U A;  3EFO B;  1VQ8 A;  1LVK A;  3CBM A;  1N8R U;  5GAN 6;  2C0I A;  3PNW C;  4IIM A;  3R6O A;  4ESR A;  5HY6 A;  1HYO A;  4C0D B;  3JB9 G;  4CI0 C;  3RDV A;  2NUP B;  5GAM g;  2AT1 B;  3CCQ Q;  2L3R A;  3SWN C;  2K3X A;  2CYZ B;  2KRO A;  3I5S A;  1N9R A;  5FRO A;  5I11 A;  1O75 A;  2ATC B;  5KYW A;  2KAF A;  1R0B G;  4J9H A;  2O4X B;  3I56 Q;  2W0Z A;  2GGR A;  2OI3 A;  1Y7X A;  2HCK A;  2H3E B;  1M8M A;  4LDX A;  2OAW A;  5FU7 B;  3CCL Q;  3PE0 A;  3JCM c;  5KCH A;  1BKB A;  5I2M A;  4MZM A;  2DX1 A;  4FW1 A;  1VQL Q;  2P0K A;  1OQK A;  3AHU A;  1G3Y A;  2HSP A;  2RHZ A;  2ZPH B;  1YIT A;  2QA4 A;  1BU1 A;  1PHT A;  2KYB A;  3QG1 A;  2X4X A;  3M0U A;  3LWH A;  1M1G A;  1UDL A;  2KDS A;  3M4Y A;  1QVG S;  1M30 A;  3PMI A;  1RLQ C;  2X4J A;  3JSC A;  1PC0 A;  2ED1 A;  4A4F A;  5FRN A;  3CC7 T;  3HP9 A;  1WI7 A;  5IHN A;  2YUQ A;  4LUD A;  4C92 F;  4HCK A;  1K9M U;  2DXB A;  4JJD A;  1ZX6 A;  3CCM Q;  1VQ4 T;  2AIR B;  4M78 B;  3OS1 A;  3PIP A;  2O2O A;  2PU9 B;  2PUK B;  3H0I A;  2K2M A;  1VQ9 Q;  1JXM A;  2VGN A;  5GAN g;  3V8J A;  3E19 A;  3CD6 T;  3OYN A;  3V7R A;  3CC2 A;  1VYU A;  2VB6 A;  4CC2 A;  1KD1 C;  2E64 A;  3OS2 A;  1WX6 A;  2OTL A;  2DD4 A;  2L89 A;  4OMP A;  4OMO A;  1B7T A;  2A37 A;  2OTJ T;  1G3T A;  5GAM d;  4J7I A;  1M5Q 1;  1ACM B;  3MP1 A;  2E65 A;  3VS7 A;  1K76 A;  4AFU C;  1GCQ C;  2CZ1 B;  3X24 B;  4M7A E;  4VUB A;  3JCM g;  2B86 A;  2GNC A;  3EG9 B;  4PNO A;  1QKX A;  4ANJ A;  2EYY A;  2MCN A;  2MWO A;  1LCK A;  2EJG A;  2QQS A;  2VYT A;  5DY9 A;  3H6Z A;  1ABO A;  1KC8 C;  3G4S A;  1WHH A;  4PLL A;  5KYN A;  5GMK l;  1NPP A;  2DD5 A;  3VU3 C;  5CKH A;  4C0F A;  2DK3 A;  2K2V A;  2XD0 A;  1MMD A;  2I0N A;  2ZPB B;  3CCS T;  1ZUU A;  4NL2 A;  4EMK A;  5KYX A;  3Q1J A;  3FLG A;  4PJO A;  1BB9 A;  3QDR B;  2EKH A;  4RG2 A;  2DF6 A;  2V1Q A;  2E6N A;  4DBR A;  3CC7 A;  3RNJ A;  2DL3 A;  5LJ3 g;  2DIG A;  2F2X A;  4AG1 C;  2RJD A;  2QDY B;  4C0Z A;  1WDX A;  1O9S A;  4N0A C;  1KG1 A;  1Q95 G;  1MMG A;  1M1K R;  1K1Z A;  1KQS A;  1YJN A;  1ZBX A;  1PD0 A;  4PJO G;  2LQ8 A;  3CME Q;  2BZX A;  4XU0 A;  3J80 E;  2K6D A;  3CMA A;  4M7D D;  3C94 A;  1JJ2 S;  1WPY A;  5L8R E;  1W70 A;  1RAI B;  3JCM d;  5D6X A;  2RI3 A;  5CKB A;  2CKK A;  4GLM A;  4J9E A;  5IXB A;  5GAN 5;  5EG2 A;  4C0D C;  1SG5 A;  2XDP A;  1WYX A;  3NFC A;  3HFN A;  1N5Z A;  2DXU A;  4JLI A;  5KYU A;  4BE0 A;  2LNV A;  4OGC A;  2KBT A;  1Y07 A;  2PZ1 A;  4J9F A;  2G3R A;  3CCV A;  4PJM A;  2GBQ A;  3MEW A;  1Z9Z A;  3JCM b;  3QHS A;  3CCE A;  4BE2 A;  2LJ1 A;  5GAO n;  4C8Q F;  1P92 A;  3JB9 J;  2NWM A;  2DYB A;  4M75 E;  1VQ5 T;  2B8A A;  4OB0 B;  4A4H A;  2QEX Q;  2ENM A;  4XTW A;  2PVO B;  2WSC E;  2SRC A;  1Q86 R;  1WHM A;  3M53 A;  4A4K A;  2P0Q A;  3OA6 A;  1YWP A;  2JOY A;  3SDZ A;  1SEM A;  3G6E Q;  1AWX A;  2R58 A;  4HA8 A;  3REB B;  3QJY A;  3QPH A;  2COW A;  1WXU A;  2Y4X A;  3OQ5 A;  3OS0 A;  2GTO A;  4LN2 A;  3A98 A;  4ME7 A;  3OYI A;  1OX8 A;  3OMG A;  1M2V A;  2MWP A;  1XQH A;  3TEE A;  4JZ3 A;  2CP5 A;  4M78 C;  1B3Q A;  2V8J A;  1K0S A;  1JQQ A;  2YUN A;  2LCL A;  2RJF A;  4NOY A;  4EMH A;  2XK0 A;  4BDZ A;  3U23 A;  2GFA A;  2VAS A;  1WXB A;  1SRL A;  2MF2 A;  1YIJ T;  1G3W A;  2W10 A;  1VQ6 T;  2KRN A;  1JB0 E;  3LYI A;  2BZY A;  4KH0 B;  1JRI A;  1AWW A;  4KUI A;  1K8A C;  3CC4 T;  1PSE A;  1QCN A;  3OSV A;  4E7K A;  4J6Y A;  3I56 A;  2PVD B;  2VVK A;  3JCM J;  2VV5 A;  4PL6 A;  1GL5 A;  2LJ0 A;  4L5G A;  4BUG A;  3MET A;  3M0Q A;  2LT1 A;  2V8K A;  3PTA A;  3P8H A;  3D7S B;  1X69 A;  3G7Z A;  2PNI A;  3LWI A;  2EYZ A;  2X4W A;  1N8R R;  4GLK A;  2KY9 A;  4LXC A;  3QKJ A;  2AZS A;  3T9N A;  3QZ5 B;  3EH2 A;  1WQW A;  2H8H A;  3I55 Q;  5CQY A;  3CCU Q;  3ULR B;  1IB8 A;  1AWJ A;  3X28 B;  1VQN T;  3GPL A;  3VUB A;  4XU3 A;  1VIF A;  2RJE A;  4F7U F;  4CC7 A;  1T3L A;  3JCM P;  1S72 A;  3EG1 A;  1U8R A;  4J8O A;  1VQO T;  3HKS A;  1B34 A;  3QBY A;  4J9D A;  4NS5 A;  2FVU A;  2BIV A;  4DBQ A;  4M77 A;  3RMS A;  4EPC A;  1BIA A;  4BI8 B;  2Y4Y A;  1RAB B;  2E10 A;  4C92 E;  2DJZ A;  3N5B B;  1KHC A;  3C12 A;  1VQ7 Q;  2EYX A;  3BW1 A;  1Q81 C;  7AT1 B;  4DOW A;  2RK2 A;  1WIE A;  1U5S A;  2DXT A;  2QQB A;  3ZFJ A;  5KCO A;  2P84 A;  1Y96 A;  4E7Z A;  1X27 A;  5KE3 A;  3CCJ Q;  4M77 G;  1K9M R;  4JZ4 A;  2CRE A;  1VQK T;  4OGE A;  4KGZ B;  1AVZ C;  2AK5 A;  4C5G A;  2PUO B;  4FIB A;  1NJI U;  2DPP B;  1IRE B;  1MMA A;  4NL3 A;  2HKQ B;  2Y90 A;  1UGQ B;  2LVM A;  3CQT A;  3X26 B;  4IUR A;  2EQM A;  3CCR A;  5CKD A;  4QQG A;  1YI2 T;  2DTI A;  2K4Y A;  1GCP A;  4EIK A;  1WXT A;  4M7D F;  2RQV A;  1HJD A;  4LUE A;  2E1H A;  1VQ8 T;  2FZK B;  5GMK h;  5J39 A;  3OYC A;  2ZPG B;  2QQ9 A;  4JLG A;  1OZ2 A;  1Q7Y C;  2ECZ A;  1UHC A;  1VQ4 Q;  1NBE B;  5CKE A;  5KE2 A;  3OYA A;  4XTZ A;  2EGA A;  1TU0 B;  2FHD A;  2RPN A;  2ZGW A;  3EAE A;  3H41 A;  1M2O A;  4B9X A;  1RAA B;  4E7S A;  1AHJ B;  1BCM A;  2XID A;  2DXC A;  3OBW A;  1OU9 A;  2OTJ Q;  4MDW A;  4R55 A;  3CME A;  1YNZ A;  1SRM A;  1UGP B;  2LP5 A;  4KBM B;  4AG2 C;  1WHG A;  4J6W A;  1IGQ A;  2DL7 A;  1RL2 A;  2EW3 A;  2O9S A;  1QVF P;  4BI3 A;  2F69 A;  3GF5 A;  2LQK A;  2EYW A;  2QA4 T;  3OW2 S;  2JTF A;  5A0D A;  2K5F A;  1FYN A;  1KQ2 A;  1W4S A;  1N27 A;  3OYH A;  1MGQ A;  3VRY A;  1PG5 B;  2QI2 A;  3M4G A;  2CT4 A;  4F17 A;  4EMK B;  5KH6 A;  2R57 A;  5ECA A;  4PJO B;  4MZT A;  2HD0 A;  2CP3 A;  1X2K A;  4FW2 A;  1EZZ B;  3CPW S;  2HSE B;  1D1B A;  1RI0 A;  1SSF A;  3FIF A;  1QQJ A;  1KD1 U;  2EQJ A;  1ZSG A;  2QEX A;  1ZUY A;  3J7A F;  3MEA A;  4BAC A;  3CCS Q;  1BI2 A;  2CP7 A;  2KE9 A;  3CC2 T;  1QCO A;  2J6O A;  3RBB B;  1KQ1 A;  3C0C A;  4UC4 A;  4JRI A;  3L42 A;  3M0T A;  1H3H A;  1YHQ Q;  2OTL T;  3SHW A;  2LJ3 A;  1M3B A;  3G6E A;  4F14 A;  1YP5 A;  2V26 A;  2RHY A;  1Q82 C;  4C8Q E;  2RB6 A;  2LTO A;  2E12 A;  4OMN A;  3OYM A;  2ROL A;  2A3L A;  4IUV A;  1WA7 A;  5GAO r;  5KYU B;  2ZPE B;  3VS6 A;  4M7A A;  1UB4 A;  1RAE B;  1KFZ A;  2EGC A;  3RER A;  4XK8 E;  5A0G A;  2QG9 B;  2F5K A;  4J9I A;  2VXE A;  4QVD A;  2QDL A;  1JXO A;  2J06 A;  3AT1 B;  5DM7 R;  3TQ7 P;  4FU6 A;  3G4S T;  1MND A;  3ZL7 C;  3OYE A;  2LDM A;  4X9C A;  2FPD A;  4F7U A;  2EGE A;  3MHX A;  2EJ9 A;  4M7A G;  1MV3 A;  1BI1 A;  2KXC A;  1RI9 A;  2QAS A;  2RH2 A;  4FSX A;  1UGR B;  2WSF E;  1H64 1;  5GJW B;  5IN1 A;  4Z89 A;  2COZ A;  3UDC A;  4ORZ A;  1D0X A;  3CBO A;  4PJJ A;  3MJX A;  3G71 Q;  2JXB A;  1I5L A;  4FSS A;  4KH1 B;  1TH7 A;  3EHQ A;  2A7Y A;  2E3I A;  2JS2 A;  3R6N A;  4R0K A;  1VQ5 Q;  3PMT A;  1QP2 A;  5GMK j;  2YXY A;  2QGF B;  3JB9 D;  1M2V B;  2KR3 A;  4AMC A;  4XTV A;  8AT1 B;  2MK5 A;  4IIO A;  1QVG A;  2HDA A;  3BE3 A;  1WHK A;  3SFM A;  1YJN T;  3I55 A;  3S3O A;  3CCU A;  4HVW A;  3UWN A;  1OYX A;  2JN0 A;  5GAM f;  1K0X A;  4N4H A;  3OYG A;  3M56 A;  4PFO A;  2ZAE A;  3I35 A;  3CMA T;  3PVL A;  2V8I A;  5FU6 B;  3HFO A;  3JCM X;  3QO3 A;  5LJ5 j;  3E1S A;  2E6Z A;  3M9Q A;  2MI6 A;  1WGS A;  1YCS B;  2NUZ A;  4OP0 A;  4FYW B;  2L8D A;  1I07 A;  3EGD B;  3MKD A;  4JRK A;  2BE9 B;  3CCV T;  3L1A A;  2XHC A;  3M0S A;  2JMC A;  4R56 A;  3C4S A;  1I81 A;  4M7D A;  3OYK A;  1T0H A;  4LDU A;  2XU8 A;  3CCE T;  3HTR A;  4F7U E;  1C1A A;  2K5I A;  3PVQ A;  2FZC B;  1N8R C;  5GMK e;  1OEB A;  2NYS A;  1IO6 A;  3S3N A;  3QJ6 A;  1OX9 A;  1UJ0 A;  3VYH B;  2C06 A;  2FRW A;  2EAY A;  3M59 A;  4ZGE B;  4BY6 B;  1MHN A;  2K3Y A;  1PKS A;  4A53 A;  1NE8 A;  3QXE B;  4M7D G;  3CCJ A;  1ZSZ A;  2D8J A;  1WNL A;  4M75 A;  1YJW Q;  1ZLM A;  3JV3 A;  2FB7 A;  2JTM A;  4B6M A;  2LQW A;  8ATC B;  3L2W A;  4M75 C;  3QSU A;  5LJ5 e;  3TCJ A;  4RTZ A;  1RAG B;  3DLM A;  1XJW B;  2QYZ A;  4EMK C;  5GAM h;  4PJO C;  4OML A;  5CQX A;  1GFD A;  2XIC A;  1W2B P;  5GAN d;  5GMK m;  1T3S A;  4QVZ A;  3QWY A;  1E6H A;  4M75 G;  4FL6 A;  1KQS S;  1B34 B;  4KRT A;  4RKU E;  4O5V A;  1PM3 A;  3RIR A;  1VQN Q;  1FWZ A;  4M77 B;  1QVF A;  4BDY A;  1HXD A;  4QW2 A;  1B07 A;  3OYJ A;  5IH2 A;  3TVT A;  3JCM f;  3FRN A;  4QVC A;  3X25 B;  3PT9 A;  3CCQ T;  3P8D A;  3LX7 A;  4JJB A;  2KMT A;  2RM4 A;  4FYX B;  5GAO p;  4M7D E;  4JPB W;  5FLX E;  4QQD A;  1NJI R;  5FWC A;  1Y96 B;  3I56 T;  2YRV A;  4DEX A;  2JMA A;  3X20 B;  3OMC A;  2LMJ A;  2D9T A;  2DM1 A;  5I2S A;  3MP8 A;  3GOX A;  1VQP Q;  4Z02 A;  1KK7 A;  1JJ2 A;  2JVV A;  5IXF A;  3CXC P;  1VOM A;  4IUU A;  3INZ A;  3OB9 A;  3THK A;  1G5V A;  1VQL T;  4F04 B;  5IAY A;  2X35 A;  4RTY A;  2DTO A;  3L2Z A;  4RTV A;  5GAN h;  2K57 A;  2CP0 A;  1ZUK A;  1X43 A;  3EFS A;  3HRU A;  3RR6 A;  4E6R A;  2RNA A;  1MUZ A;  1PD1 A;  1ZQ1 A;  1YJ9 Q;  2CS7 A;  4Z88 A;  6AT1 B;  3RKY A;  1UTI A;  2KSS A;  1CKA A;  4Y28 E;  5LJ3 d;  4PJO D;  2KRM A;  2O9V A;  1WJR A;  4IUT A;  1SHG A;  1XTD A;  2DVJ A;  2M16 A;  2HL5 C;  1S72 T;  1H8K A;  1TUD A;  4IUQ A;  3JCM h;  4AFZ C;  4CC4 B;  1DJ7 B;  2KI7 A;  4OB2 B;  5CCA A;  2V1R A;  4ZTF A;  1VQ8 Q;  3QZ9 B;  2YHT A;  1NM7 A;  3RKX A;  1YHQ A;  3ME9 A;  1Q81 U;  2E70 A;  2GFU A;  3PGG A;  1M90 U;  3BDL A;  3I5R A;  2J05 A;  3HRT A;  1BI3 A;  2KRS A;  3BFM A;  1HK9 A;  3NTI A;  1UGV A;  2F5T X;  2KGT A;  3EG3 A;  4DA4 A;  2E5K A;  2DL5 A;  3VS2 A;  4L59 A;  2DL4 A;  4BB7 A;  3CCQ A;  1M4Z A;  3V7S A;  3OYD A;  5GAN 7;  5FU6 C;  4C92 A;  4P5N A;  1TS9 A;  4QT7 A;  4X9D A;  5KYY A;  3DKM A;  4PJN A;  3L2V A;  3FJ5 A;  1A0N B;  1Y57 A;  5IHI A;  5LL6 S;  1KD1 R;  2MOX A;  1TG0 A;  2XG8 D;  1SKU B;  2QTX A;  3CCL A;  3JB9 F;  1AWO A;  1R77 A;  3KBG A;  4KT0 E;  2IVW A;  4QKU A;  3RKW A;  5LJ3 h;  1YIT Q;  4C92 G;  1VQL A;  1G3S A;  2QA4 Q;  3EG9 A;  2L3P A;  3EGU A;  3CCR T;  5GAN 8;  4RUG A;  2DVE A;  2YSQ A;  2YDL A;  1ZA2 B;  4XTY A;  1SHF A;  5LJ5 g;  2O31 A;  5GAM j;  4BY6 C;  2X9H A;  5IT9 E;  4WTO B;  1Q7Y U;  1RLP C;  2YRC A;  2DIQ A;  3FJP A;  1TWB A;  2QGG A;  1W1F A;  2KQW A;  4AFS C;  3JRZ A;  4LDW A;  1NPR A;  3S6W A;  1X6O A;  4FYY B;  1GBR A;  2H3J A;  2ZZD A;  1VQM Q;  2BTT A;  3CCM A;  4II1 A;  1ABQ A;  1E6G A;  3P8B B;  4M78 D;  1GFC A;  1VQ9 A;  4JS4 A;  3PFS A;  3FC3 A;  5KYW B;  2EKO A;  4M7A B;  5J3B A;  1WFW A;  2DET A;  4ZN3 A;  3CME T;  3VKI A;  1UFF A;  2K79 A;  2C0O A;  2A36 A;  4M77 C;  1QVG P;  1V29 B;  2KYM A;  3WVD B;  5I22 A;  3MO8 A;  2M0O A;  4PJL A;  5GAM e;  3EG2 A;  4LD6 A;  5HK0 A;  2IPO B;  4V2S A;  2JS0 A;  1I4K 1;  2LZ6 B;  3E9G A;  1K4U S;  4HCZ A;  4J6X A;  2JNG A;  4C5I A;  4LDV A;  1W2B A;  2ESW A;  2GCX A;  3KXT A;  2EWN A;  1QMC A;  1K73 U;  4WCI A;  3VS0 A;  2KXD A;  3WVE B;  3F70 A;  2EBP A;  5LJ5 d;  1BI0 A;  1X6G A;  2QEX T;  4FYV B;  4PFZ A;  3VRZ A;  1BK2 A;  3ER0 A;  1Q82 U;  1OI1 A;  1YJW A;  4E7H A;  3REA B;  3QYG B;  1I1J A;  1U1T A;  1VYV A;  2PTK A;  3G6E T;  1D1C A;  3M0P A;  3VYG A;  1E7O A;  2GQV A;  2L3S A;  3CC7 Q;  1ZBJ A;  2CSQ A;  4ZN1 A;  5DLQ E;  1Y71 A;  1TOV A;  5GAO l;  1M27 C;  2HBP A;  4OMF B;  4J9G A;  4JDS A;  5D6Y A;  4C8Q A;  4OB3 B;  2LCC A;  4C5E A;  4MZP A;  2L0A A;  3CD6 Q;  4ZTJ A;  1JBM A;  3SB2 A;  3MEV A;  3CXC A;  1PRL C;  1X01 A;  2COY A;  2LNH B;  3MCA B;  2DEQ A;  1VA7 A;  3LW5 E;  3V7C A;  2E5Q A;  2HAX A;  3QUI A;  2RQR A;  2J6K A;  3VUZ A;  3A8H B;  1J3T A;  2EJF A;  4M77 D;  1UHF A;  4AT1 B;  2HBW A;  2VGM A;  4C8Q G;  4EDU A;  4M4Z A;  4KUL A;  3A8M B;  3EGX A;  4HCB A;  1AEY A;  3GIB A;  3CCV Q;  1D09 B;  2RI2 A;  4RMO A;  5J26 A;  2DIL A;  4PJO F;  1IZ6 A;  2CT3 A;  4E7I A;  1QCF A;  4M75 B;  4RCB A;  2VUB A;  3CCE Q;  3SEM A;  2NUT A;  2RHX A;  2WSE E;  5KYX B;  1PKT A;  3I9Q A;  1SPK A;  2L5Q A;  2A28 A;  4J83 A;  2KVQ G;  1HSQ A;  1M1K C;  3RMQ A;  2JM8 A;  2ED0 A;  2OAU A;  1JJ2 P;  4HT9 A;  2K9G A;  2DER A;  4PK4 A;  4X1V A;  4CC3 A;  3URG A;  1VUB A;  3L2Q A;  3OYB A;  2QAZ A;  3FDR A;  1TUC A;  3I55 T;  1LJO A;  1S1N A;  2I2L A;  3CCU T;  4PFP A;  3HSB A;  2EPD A;  3CEY A;  2AHJ B;  2RN8 A;  1M3A A;  4RG8 A;  1ARK A;  3OYL A;  3CPW A;  2DMO A;  4C5H A;  2CP2 A;  3JAM E;  2QXF A;  1NJI C;  3VS5 A;  3RUX A;  1VYT A;  4ATO A;  1KIK A;  1GXI E;  1UEC A;  5GJV B;  3VS4 A;  2FZG B;  3GNG A;  2HKN A;  2O88 A;  1BYM A;  4A54 A;  1T0J A;  3KFV A;  1KC8 U;  1EX4 A;  4HVU A;  4OB1 B;  2YT6 A;  2XMF A;  4M7A C;  3HRS A;  5IHK A;  3SWN A;  2C0T A;  2EQI A;  4XTU A;  4ZNX A;  1EFN A;  2DE0 X;  1VQ7 T;  3BY7 A;  1Q86 C;  2LT4 A;  5FW9 A;  3V8K A;  1H3Z A;  4OMM A;  1FXX A;  2D8H A;  3CCJ T;  1IRX A;  2DJQ A;  2E3H A;  2MIO A;  2F1L A;  5GMK i;  1IHV A;  2ZCF B;  3GNF B;  2X4Y A;  4MMK A;  3H0F A;  2K3B A;  4LE9 A;  1CKB A;  3OS5 A;  3OYY A;  2GQI A;  4M78 F;  2RF0 A;  2BE7 D;  2ZPF B;  1D3B A;  5I21 A;  4F7U G;  1LOJ A;  4LNP A;  1OU8 A;  4XAX B;  2KEA A;  3QDF A;  1QW1 A;  1Q81 R;  3NGP A;  1M90 R;  1OOT A;  1QWF A;  4OF1 A;  2P0P A;  2D1X A;  5A0L A;  2OJ2 A;  3SD4 A;  2DEU A;  3ZEH A;  1IXD A;  4J9C A;  1M3C A;  1U1S A;  1W6X A;  2NLU A;  2YWW A;  5CVI A;  2FPF A;  3OYF A;  1S72 Q;  2HNI A;  3NMZ C;  5CR2 A;  4HKE A;  2M02 A;  1VQM A;  2HEQ A;  2RJC A;  1GRI A;  4C92 B;  2QK0 A;  2CH4 W;  2KNB B;  2X3X D;  1X2Q A;  5KYY B;  4LD9 K;  4KGV B;  3L2U A;  1HD3 A;  3QYH B;  4M7A D;  1QLY A;  1GCQ A;  2P4R A;  2RQW A;  2DNU A;  1YIJ Q;  4M7D C;  3C95 A;  4GBQ A;  1VQ6 Q;  5DLO A;  2RHU A;  4ZGJ B;  1VQ7 A;  2IIM A;  2YUO A;  1WHL A;  2MAM A;  1Q7Y R;  3JB9 I;  2HQE A;  2ROT A;  4TVR A;  3CC4 Q;  4DBF A;  3JCM V;  1WLP B;  2JTE A;  2L2P A;  4ELZ C;  2DRM A;  4HXJ A;  3TRE A;  4KUD K;  2DBK A;  4D8D A;  1ZSZ C;  3TSW A;  3KUF A;  1RAC B;  1KJW A;  4BD3 A;  1TSF A;  2F2W A;  3CCR Q;  3HPW A;  5GAN f;  1K9A A;  3NTH A;  4J9B A;  1BIB A;  2YLB A;  2GF7 A;  1EIF A;  2VWF A;  2LRQ A;  1YBY A;  2DO3 A;  2PQW A;  2KT1 A;  4M77 F;  4YTL A;  3EHR A;  1BBZ A;  3OSS C;  1V76 A;  4IUP A;  1YHQ T;  2WAC A;  1QVF S;  1SF9 A;  4JJN K;  1FMV A;  2PVG B;  3HL8 A;  4N0A A;  1YN8 A;  1K8A U;  1VQ4 A;  4K11 A;  2DFU A;  2LX7 A;  3JCM W;  2EFI A;  1KSW A;  2EQK A;  2AKK A;  3MPU B;  4BI4 A;  1VQO Q;  1FX7 A;  3CD6 A;  1K9M C;  3M58 A;  1YFN A;  4GY5 A;  1K73 R;  3EFO A;  3RES A;  2CUB A;  1MMN A;  2QTV A;  3A8L B;  2FL7 A;  5CIU A;  4Y91 A;  2OTJ A;  4RTX A;  2VKN A;  1WHJ A;  1UGS B;  3VS3 A;  3GP8 A;  3CCL T;  1UE9 A;  5D6W A;  2L3Q A;  3A1P A;  2NUP A;  2JW4 A;  1C0M A;  3WXM B;  4ZGD B;  2JM9 A;  1H92 A;  1OUL A;  3FEO A;  4F16 A;  9ATC B;  1Q82 R;  2E4H A;  2BZ8 A;  5D7U A;  1BCO A;  1N6A A;  1G83 A;  2O4X A;  2A0F B;  2QQA A;  3IQL A;  2KT8 A;  3GBQ A;  4A63 B;  1D1A A;  1U06 A;  4Z8A A;  2DYI A;  3QWX X;  1WQ7 A;  1VQK Q;  2VXF A;  2CZ6 B;  3E2U A;  5AYF A;  4M75 D;  3G71 T;  5FU7 C;  1M9S A;  4L6V 5;  2CGH A;  2FO0 A;  5LJ3 f;  1PSF A;  2YUP A;  3UAT A;  4XQ3 A;  4KGX B;  4Y92 A;  2BKD N;  4O6J A;  1C6V X;  3CCM T;  1YI2 Q;  4C8Q B;  2CP6 A;  2LQN A;  4PJO E;  2HQH A;  1VQ9 T;  1AT1 B;  3EG0 A;  2JUF A;  1AZE A;  3CCS A;  2R5A A;  2HL3 A;  1QWE A;  3UA7 A;  1JEG A;  2ABL A;  3LH5 A;  3OW2 P;  4DBH A;  2HZY A;  1UG1 A;  2IG0 A;  2O01 E;  4LDY A;  3MEU A;  4FT2 A;  4DEY A;  4A4E A;  3NHN A;  4XTX A;  5GAO q;  1NEG A;  3HHT B;  4M78 A;  4FCY A;  2J7I A;  4N4I A;  5EC7 A;  4HT8 A;  3EGX B;  2X51 A;  3ASK A;  1RAD B;  2XDD A;  3H8Z A;  2JT4 A;  3A8O B;  3CPW P;  2J6F A;  4C92 C;  3VS1 A;  3NPF A;  1CSK A;  1R0C B;  5A2Q E;  2NUT B;  2GTJ A;  1X6B A;  1RUW A;  2DTH A;  4M78 G;  4RCC A;  2FPE A;  3OBY A;  5C6S A;  2LX9 A;  4BE1 A;  4EMG A;  2E41 A;  1M1F A;  5L23 A;  3EGD A;  1AOJ A;  1QVP A;  2VC8 A;  3DB4 A;  4HCC A;  1MNE A;  1ZHI A;  1YCY A;  2CUD A;  1PRM C;  1RAF B;  2DBM A;  2X3W D;  3M54 A;  1YJW T;  4A4G A;  3JCM Q;  4DOV A;  4MDX A;  2CZ0 B;  3M55 A;  2XDB A;  2CSI A;  3CPF A;  4C0G A;  2AKL A;  3G71 A;  1WJQ A;  4MML A;  2RA2 A;  2CZ7 B;  4HVV A;  1UJY A;  3MP6 A;  3O5Z A;  3PIO A;  1GBQ A;  2RI5 A;  3TU4 K;  1ZA1 B;  5HK3 A;  1VQ5 A;  3TSZ A;  4M7A F;  4JJC A;  3UT1 A;  3VJP A;  2RO0 A;  1KC8 R;  1V1C A;  2LC4 A;  2BUD A;  2K5L A;  4JS5 A;  1LPL A;  3CC2 Q;  1AZG B;  2JJ9 A;  4J7F A;  2G6F X;  1WZO A;  2OTL Q;  1G8X A;  4M78 E;  5CKF A;  3SWN B;  1TXQ A;  2D6F A;  4CRI A;  2Z0W A;  4RTW A;  2CDT A;  1FMW A;  1TTH B;  2RK1 A;  2MYS A;  2DKG A;  5FWB A;  4F7U B;  4C92 D;  3UF4 A;  4E47 A;  2DL8 A;  3M5A A;  4PLI A;  3VV0 A;  3LH0 A;  1XOV A;  2HQX A;  2DA9 A;  3LLR A;  3L2R A;  2SEM A;  1NLP C;  2DAQ A;  4FT4 A;  5CAI A;  1W2B S;  2R5M A;  1VQP T;  2AZV A;  1M1K U;  4D8K A;  5GAN j;  1YIJ A;  3O8V A;  2JZ2 A;  4PKC C;  1VQ6 A;  4OMQ A;  3G4S Q;  1M90 C;  3M57 A;  2RD1 A;  1I8F A;  1I5O B;  2EVR A;  1D3B B;  1XNI A;  1NYF A;  1JO8 A;  4RTU A;  5LJ5 f;  1OV3 A;  3H9N A;  2FG0 A;  3CC4 A;  3QII A;  1D0Z A;  4D6W A;  2DZC A;  2RQT A; 
#chains in the Genus database with same CATH homology
 4A53 A;  4M7A C;  3V8L A;  1NE8 A;  2V8J A;  3QXE B;  4M7D G;  3CCJ A;  3GNG A;  4Q5W A;  1WNL A;  4M75 A;  2LCL A;  1YJ9 T;  2FB7 A;  1BYM A;  4A54 A;  1KC8 U;  2JTM A;  2MMP A;  4XU2 A;  3L2W A;  2RJF A;  4M75 C;  4NOY A;  4OB1 B;  2XK0 A;  3A5Z B;  1R8O B;  3HRS A;  4EMH A;  5GAN 3;  5LJ5 e;  3TCJ A;  2GFA A;  3SWN A;  4BDZ A;  3S3M A;  1M8V A;  2MF2 A;  4XTU A;  4B9W A;  1YIJ T;  3DLM A;  1G3W A;  4EMK C;  1LNX A;  1VQ6 T;  3BDU A;  5GAM h;  3BY7 A;  1X75 C;  1VQ7 T;  1JB0 E;  4PJO C;  4X34 A;  1WJS A;  5CQX A;  2XIC A;  3LYI A;  5GAN d;  1VIE A;  2LT4 A;  3DLL A;  5GMK m;  1JRI A;  1Q86 C;  3V8K A;  4KUI A;  1H3Z A;  3E9F A;  4QVZ A;  1K8A C;  3CC4 T;  1PSE A;  1FXX A;  3OSV A;  4JRP A;  2EIF A;  2YLC A;  4E7K A;  4J6Y A;  4M75 G;  2PVD B;  3I56 A;  4FL6 A;  3CXC S;  4E7L A;  4JUV A;  1KQS S;  1B34 B;  2EYQ A;  3CCJ T;  2P4T A;  3GLX A;  4RKU E;  4C8Q C;  3J81 E;  3JCM J;  5CO7 A;  2VV5 A;  4O5V A;  4PL6 A;  4L5G A;  3RIR A;  1FWZ A;  5GAN e;  5GMK i;  5HKC A;  4BUG A;  2ZCF B;  3GNF B;  5M9O A;  3MET A;  4M77 B;  2X4Y A;  1QP3 A;  4MMK A;  1HXD A;  4BDY A;  1QVF A;  2LT1 A;  4QW2 A;  2V8K A;  3OYJ A;  1VQN A;  4M7D B;  1M90 C;  3PTA A;  3DB3 A;  1Q86 U;  4WF2 A;  3OS5 A;  3OYY A;  4M78 F;  2ZPI B;  3JCM f;  3P8H A;  1KHI A;  2ZPF B;  3FRN A;  3G7Z A;  1D3B A;  4J5Y A;  4QVC A;  5I21 A;  3X25 B;  1OZ3 A;  3PT9 A;  4F7U G;  3CCQ T;  1LOJ A;  3P8D A;  3LX7 A;  1N9S A;  3LGF A;  4XAX B;  3LWI A;  4M7D A;  1NZ9 A;  2KMT A;  2RM4 A;  5GAO m;  2X4W A;  4M77 E;  3LGL A;  1QW1 A;  4M75 F;  4GLK A;  5GAO p;  1VQO A;  5FLX E;  4M7D E;  2KY9 A;  4QQD A;  3I56 T;  1Y96 B;  5LJ5 h;  2YRV A;  2DZ9 A;  4OF1 A;  3QKJ A;  2P0P A;  4XU1 A;  3X20 B;  3T9N A;  3QZ5 B;  4OVA A;  4E7J A;  5A0L A;  3JCM e;  3SD4 A;  1WQW A;  3OMC A;  3FB9 A;  2D9T A;  5CQY A;  3ZEH A;  5I2S A;  3MP8 A;  5LJ3 j;  3GOX A;  3X28 B;  1VQN T;  1U1S A;  4Z02 A;  4FM4 B;  2NLU A;  1JJ2 A;  2JVV A;  2FYK A;  3GPL A;  1VQP A;  4IUU A;  2KK4 A;  4XU3 A;  3INZ A;  5CVI A;  3VUB A;  3OB9 A;  1VIF A;  2RJE A;  3CD6 T;  1G5V A;  3OYF A;  1VQL T;  4F7U F;  5IAY A;  2HNI A;  2X35 A;  3A8G B;  5CR2 A;  3JCM P;  1YIT T;  1S72 A;  4HKE A;  3JB9 H;  1VQM A;  4N4G A;  2DTO A;  1U8R A;  3L2Z A;  4J8O A;  2RJC A;  4ELY C;  5GAN h;  2K57 A;  4C92 B;  3OW2 A;  3UPU A;  1VQO T;  5C0M A;  3HKS A;  2EQU A;  1B34 A;  3EFS A;  3HRU A;  3QBY A;  5CK9 A;  3NTK A;  2XI9 A;  5GAN 2;  5GAN 4;  4LD9 K;  2QQR A;  4NS5 A;  3L2U A;  2FVU A;  1UEB A;  1VQK A;  1ZQ1 A;  2BIV A;  3QYH B;  4M7A D;  2CS7 A;  4M77 A;  3RMS A;  4EPC A;  4QQ6 A;  3RKY A;  1BIA A;  4BI8 B;  1YJ9 A;  3CBP A;  2Y4Y A;  2KSS A;  2E10 A;  4C92 E;  4Y28 E;  2DJZ A;  3N5B B;  5LJ3 d;  4JRQ A;  4M7D C;  4PJO D;  2RHI A;  1KHC A;  3C12 A;  3C95 A;  5FRM A;  1WJR A;  2RHU A;  5DLO A;  4IUT A;  3OY9 A;  3BW1 A;  1Q81 C;  4IKF A;  1XTD A;  4ZGJ B;  2M16 A;  4DOW A;  1VQ7 A;  1S72 T;  2RK2 A;  2M1H A;  2MAM A;  3EFR A;  1K73 C;  2DXT A;  2QQB A;  4IUQ A;  3JCM h;  3ZFJ A;  5KCO A;  1VQM T;  2D0Q B;  3JB9 I;  2HQE A;  4TVR A;  1YI2 A;  1DJ7 B;  3JCM V;  4OB2 B;  5CCA A;  4DQ2 A;  1Y96 A;  4C8Q D;  3ZBD A;  4ELZ C;  4ZTF A;  5LJ3 e;  5KE3 A;  2XKO C;  2M9U A;  4M77 G;  3QZ9 B;  2YHT A;  3TRE A;  3RKX A;  1VQ8 A;  1VQK T;  1YHQ A;  4OGE A;  4KUD K;  3ME9 A;  3CBM A;  1N8R U;  1Q81 U;  2E70 A;  4C5G A;  5GAN 6;  2PUO B;  2GFU A;  3PNW C;  3PGG A;  1M90 U;  3KUF A;  3R6O A;  4FIB A;  3BDL A;  2DPP B;  1NJI U;  3HRT A;  1BI3 A;  1IRE B;  3BFM A;  1HK9 A;  3NTI A;  5HY6 A;  2Y90 A;  4C0D B;  4NL3 A;  1UGQ B;  3JB9 G;  2F5T X;  4BD3 A;  4CI0 C;  4DA4 A;  2LVM A;  5GAM g;  4L59 A;  3X26 B;  4IUR A;  2L3R A;  2EQM A;  3HPW A;  3SWN C;  2K3X A;  4BB7 A;  5GAN f;  3CCR A;  3CCQ A;  1M4Z A;  5CKD A;  3V7S A;  3OYD A;  3NTH A;  5FU6 C;  5GAN 7;  2CYZ B;  1BIB A;  2YLB A;  1N9R A;  2GF7 A;  5FRO A;  1O75 A;  4P5N A;  4QQG A;  4C92 A;  1EIF A;  1YI2 T;  2DTI A;  2KAF A;  2K4Y A;  2LRQ A;  1YBY A;  2DO3 A;  4X9D A;  2O4X B;  2PQW A;  4M77 F;  4YTL A;  3DKM A;  4M7D F;  1Y7X A;  4HCC A;  3OSS C;  4IUP A;  3L2V A;  2E1H A;  1VQ8 T;  5GMK h;  1YHQ T;  2WAC A;  4LDX A;  1QVF S;  5FU7 B;  5J39 A;  5LL6 S;  3OYC A;  2ZPG B;  2QQ9 A;  4JJN K;  3JCM c;  5KCH A;  3CCL A;  2XG8 D;  4JLG A;  2QTX A;  3JB9 F;  2PVG B;  1OZ2 A;  1BKB A;  3HL8 A;  5I2M A;  1Q7Y C;  4N0A A;  4MZM A;  3KBG A;  4KT0 E;  2IVW A;  3RKW A;  2P0K A;  5LJ3 h;  1K8A U;  5CKE A;  4C92 G;  1G3Y A;  1G3S A;  1VQ4 A;  1VQL A;  5KE2 A;  2RHZ A;  2ZPH B;  3JCM W;  3AHU A;  2EFI A;  1YIT A;  3CCR T;  5GAN 8;  2QA4 A;  2EQK A;  3OYA A;  4XTZ A;  2DVE A;  2FHD A;  2X4X A;  3QG1 A;  4BI4 A;  1FX7 A;  2ZGW A;  3EAE A;  3CD6 A;  3LWH A;  1K9M C;  1M1G A;  3M58 A;  4B9X A;  4XTY A;  1AHJ B;  5LJ5 g;  2KDS A;  2XID A;  2DXC A;  3OBW A;  4GY5 A;  3M4Y A;  3RES A;  4BY6 C;  5GAM j;  1QVG S;  3PMI A;  5IT9 E;  1Q7Y U;  3A8L B;  2X4J A;  2FL7 A;  4MDW A;  5CIU A;  4R55 A;  3CME A;  3JSC A;  2DIQ A;  3FJP A;  4Y91 A;  4A4F A;  2OTJ A;  1UGP B;  4KBM B;  1UGS B;  2KQW A;  5FRN A;  3GP8 A;  3CCL T;  3JRZ A;  5D6W A;  4LDW A;  3CC7 T;  3HP9 A;  4J6W A;  1RL2 A;  4C92 F;  3WXM B;  1NPR A;  3S6W A;  4ZGD B;  1X6O A;  3FEO A;  1K9M U;  2DXB A;  1VQ4 T;  4BI3 A;  2H3J A;  2ZZD A;  4M78 B;  3OS1 A;  3PIP A;  2PU9 B;  2F69 A;  2PUK B;  3GF5 A;  3CCM A;  2LQK A;  2QA4 T;  1N6A A;  4II1 A;  3OW2 S;  2JTF A;  2VGN A;  5GAN g;  3P8B B;  2O4X A;  4M78 D;  2K5F A;  3E19 A;  2QQA A;  3V8J A;  5A0D A;  3OYN A;  1VQ9 A;  3V7R A;  1W4S A;  4JS4 A;  3CC2 A;  3PFS A;  1KQ2 A;  3FC3 A;  1N27 A;  3QSU A;  1KD1 C;  2EKO A;  4M7A B;  3OYH A;  5J3B A;  1MGQ A;  2E64 A;  2QI2 A;  3M4G A;  1WQ7 A;  3OS2 A;  2OTL A;  2DD4 A;  2L89 A;  4ZN3 A;  3CME T;  2VXF A;  2CZ6 B;  5AYF A;  3VKI A;  4M75 D;  4EMK B;  5KH6 A;  3G71 T;  2OTJ T;  1G3T A;  2R57 A;  5GAM d;  4PJO B;  4J7I A;  1M9S A;  5FU7 C;  4L6V 5;  4MZT A;  2CGH A;  2HD0 A;  5LJ3 f;  1PSF A;  1M5Q 1;  3MP1 A;  4M77 C;  4XQ3 A;  2E65 A;  1V29 B;  2CZ1 B;  3CPW S;  3X24 B;  4M7A E;  4VUB A;  1RI0 A;  2BKD N;  3WVD B;  1SSF A;  3FIF A;  3MO8 A;  4O6J A;  1KD1 U;  3JCM g;  2EQJ A;  2M0O A;  3CCM T;  2QEX A;  4C8Q B;  5GAM e;  3J7A F;  3MEA A;  4LD6 A;  4PJO E;  4BAC A;  1VQ9 T;  5HK0 A;  1BI2 A;  3CC2 T;  4PNO A;  2JUF A;  1KQ1 A;  3CCS A;  4UC4 A;  2R5A A;  4JRI A;  4V2S A;  3L42 A;  1I4K 1;  3E9G A;  4HCZ A;  4J6X A;  2OTL T;  2MWO A;  2EJG A;  2QQS A;  2JNG A;  2VYT A;  4C5I A;  3G6E A;  2IG0 A;  2O01 E;  4LDV A;  1W2B A;  2RHY A;  4LDY A;  3MEU A;  5DY9 A;  1Q82 C;  2GCX A;  4M78 C;  4C8Q E;  3H6Z A;  2EWN A;  4FT2 A;  3KXT A;  2RB6 A;  1KC8 C;  4A4E A;  1K73 U;  4XTX A;  5GAO q;  2LTO A;  3G4S A;  4PLL A;  5GMK l;  3HHT B;  4M78 A;  3WVE B;  1NPP A;  3F70 A;  2DD5 A;  2E12 A;  3VU3 C;  5CKH A;  3OYM A;  4C0F A;  5LJ5 d;  2DK3 A;  4N4I A;  1BI0 A;  2K2V A;  4HT8 A;  2QEX T;  2A3L A;  4IUV A;  2XD0 A;  5GAO r;  2ZPB B;  3ASK A;  2XDD A;  3H8Z A;  3ER0 A;  3A8O B;  2ZPE B;  4M7A A;  1Q82 U;  3CCS T;  1OI1 A;  1UB4 A;  4C92 C;  1YJW A;  4E7H A;  3QYG B;  1U1T A;  4NL2 A;  4EMK A;  3RER A;  4XK8 E;  5A0G A;  3Q1J A;  2F5K A;  3FLG A;  3G6E T;  2VXE A;  4QVD A;  5A2Q E;  4PJO A;  3QDR B;  3VYG A;  4RG2 A;  2DTH A;  2GQV A;  4M78 G;  5DM7 R;  4ZN1 A;  5DLQ E;  1Y71 A;  4FU6 A;  4RCC A;  2E6N A;  3CC7 A;  3G4S T;  3OBY A;  5LJ3 g;  5GAO l;  2HBP A;  2LX9 A;  2DIG A;  5C6S A;  3OYE A;  4BE1 A;  2LDM A;  4X9C A;  4EMG A;  2E41 A;  1M1F A;  4OMF B;  4F7U A;  2RJD A;  2QDY B;  4JDS A;  4C0Z A;  1QVP A;  2VC8 A;  3DB4 A;  5D6Y A;  1O9S A;  4OB3 B;  4C8Q A;  2LCC A;  1ZHI A;  4N0A C;  3MHX A;  4C5E A;  1KG1 A;  2EJ9 A;  4MZP A;  4M7A G;  1BI1 A;  4ZTJ A;  1JBM A;  1YCY A;  2RH2 A;  4FSX A;  1UGR B;  2WSF E;  1H64 1;  3MEV A;  5IN1 A;  3SB2 A;  3CXC A;  1KQS A;  3M54 A;  1X01 A;  1YJN A;  1ZBX A;  1YJW T;  4PJO G;  4A4G A;  3JCM Q;  3UDC A;  4DOV A;  3MCA B;  4MDX A;  2DEQ A;  2LQ8 A;  3LW5 E;  3V7C A;  2CZ0 B;  2E5Q A;  3CBO A;  3M55 A;  2HAX A;  3QUI A;  4XU0 A;  2XDB A;  4C0G A;  3CPF A;  3J80 E;  3VUZ A;  1I5L A;  3A8H B;  3G71 A;  2EJF A;  4M77 D;  1WJQ A;  1TH7 A;  3CMA A;  4MML A;  2RA2 A;  4M7D D;  3C94 A;  1JJ2 S;  1WPY A;  5L8R E;  2CZ7 B;  2A7Y A;  5D6X A;  2RI3 A;  3JCM d;  5CKB A;  3MP6 A;  3PIO A;  2CKK A;  2VGM A;  4C8Q G;  2RI5 A;  4EDU A;  3TU4 K;  3PMT A;  5GAN 5;  5HK3 A;  5EG2 A;  1QP2 A;  1VQ5 A;  5GMK j;  4C0D C;  2XDP A;  4M7A F;  3UT1 A;  3VJP A;  2RO0 A;  3NFC A;  4KUL A;  3JB9 D;  3HFN A;  3A8M B;  2LC4 A;  4HCB A;  2DXU A;  4JLI A;  4BE0 A;  3GIB A;  2BUD A;  2K5L A;  2LNV A;  4XTV A;  4OGC A;  4JS5 A;  2RI2 A;  4RMO A;  5J26 A;  1Y07 A;  3CCV A;  2G3R A;  4PJO F;  1QVG A;  4J7F A;  1IZ6 A;  3SFM A;  3MEW A;  1YJN T;  4E7I A;  3I55 A;  3S3O A;  4M75 B;  4RCB A;  3JCM b;  3CCU A;  2VUB A;  3UWN A;  3QHS A;  1OYX A;  4M78 E;  2JN0 A;  2RHX A;  5GAM f;  2WSE E;  4N4H A;  3OYG A;  3CCE A;  3M56 A;  4BE2 A;  5CKF A;  5GAO n;  3CMA T;  3SWN B;  2V8I A;  2L5Q A;  4C8Q F;  5FU6 B;  3HFO A;  3JCM X;  2D6F A;  3QO3 A;  1P92 A;  5LJ5 j;  3JB9 J;  4CRI A;  4J83 A;  2KVQ G;  2E6Z A;  3E1S A;  3M9Q A;  2MI6 A;  1M1K C;  4M75 E;  3RMQ A;  2B8A A;  4OB0 B;  1WGS A;  4OP0 A;  1VQ5 T;  4A4H A;  2RK1 A;  2OAU A;  2L8D A;  2DKG A;  4F7U B;  4HT9 A;  4XTW A;  2PVO B;  4JRK A;  4C92 D;  2WSC E;  3URG A;  4E47 A;  3M53 A;  3CCV T;  1VUB A;  4A4K A;  3M5A A;  4PLI A;  3L1A A;  2P0Q A;  2XHC A;  3L2Q A;  3OYB A;  3VV0 A;  3OA6 A;  4R56 A;  3LH0 A;  3C4S A;  1XOV A;  1I81 A;  2HQX A;  2JOY A;  3FDR A;  3LLR A;  3I55 T;  1LJO A;  3L2R A;  3SDZ A;  2DAQ A;  4FT4 A;  2I2L A;  5CAI A;  3CCU T;  3HSB A;  1W2B S;  3OYK A;  2R58 A;  2R5M A;  4HA8 A;  4LDU A;  1VQP T;  2XU8 A;  3CEY A;  1M1K U;  2AHJ B;  3CCE T;  4F7U E;  3QJY A;  3QPH A;  5GAN j;  1YIJ A;  2K5I A;  3O8V A;  2JZ2 A;  1N8R C;  4PKC C;  5GMK e;  1VQ6 A;  4RG8 A;  3OS0 A;  2Y4X A;  3OQ5 A;  3OYL A;  3CPW A;  3M57 A;  2RD1 A;  1I8F A;  4C5H A;  3JAM E;  2QXF A;  3S3N A;  3QJ6 A;  1NJI C;  1D3B B;  4ME7 A;  3OYI A;  1XNI A;  3RUX A;  3VYH B;  2C06 A;  5LJ5 f;  4ATO A;  3OMG A;  2EAY A;  2MWP A;  3M59 A;  4ZGE B;  4BY6 B;  1XQH A;  3CC4 A;  1GXI E;  3QII A;  3TEE A;  1MHN A;  4D6W A;  2K3Y A;  2DZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...