3SWNA

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
TILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm7
total genus 14
structure length 76
sequence length 76
chains with identical sequence D, P, S
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnA00
5GAN2 4F7UF 1B34A 1U1SA 3FJPA 3L2ZA 3BY7A 3PGGA 4N0AC 3EFSA 3JCMQ 2FB7A 3JCMc 4F7UG 1X01A 3JB9D 4JRIA 4C92D 3JCMb 5LJ3j 4M77A 3V7CA 4XTYA 1WPYA 1D3BB 4NOYA 3SWNB 1LOJA 4C92E 4EMHA 4EMKA 1I81A 4M78A 5GAMh 4XU1A 5LJ3e 4V2SA 4WF2A 4J6WA 5LJ3f 1WQWA 2EJGA 3JCMP 5GAMj 5GAOm 4DQ2A 4PJOB 2DJZA 4M78G 4XTZA 2YHTA 4HT8A 2FYKA 4M7DG 2YLBA 4M7AB 2RB6A 5GAOq 4M7DC 3L1AA 3HFOA 1I5LA 4XTUA 3V8LA 2RA2A 4N0AA 5GAN4 2E65A 4EMKB 5CAIA 2VC8A 3EFRA 3FIFA 4M7AG 4PNOA 4M78D 4C8QB 2E64A 5GAN8 4NL2A 3JCMd 3INZA 4QVDA 3JB9H 4M75B 1Y96A 3JB9F 2DVEA 4C8QC 1YCYA 1LJOA 1H641 4M75G 3V8JA 4PJOF 5GAMg 5GAOp 1N9SA 4XTVA 4C8QA 2DTOA 5GANg 5GAOr 3QUIA 3M4GA 3RKYA 2CGHA 5GAOn 5GAN3 4XQ3A 2DZCA 3JCMg 3JCMJ 4M7DB 3JCMV 1JBMA 4M78B 2DZ9A 5GMKh 1BIAA 4M77B 2HNIA 1JRIA 5GMKl 2E10A 5LJ3d 4PJOD 4M7AD 1LNXA 1HK9A 4PJOG 3SB2A 2I2LA 3V8KA 4C8QF 4J6XA 1TH7A 4JLIA 2YLCA 4XU0A 2E1HA 1KQ1A 3RIRA 4M7DD 2DXUA 4M7DF 4M75C 2RM4A 4M78F 3JCMW 4JUVA 4RCCA 4C8QD 5GMKm 5GANj 5GMKi 4M7AF 3QO3A 4J5YA 2ZGWA 4OP0A 3JCMf 4F7UE 3BFMA 3JCMe 2K57A 3JCMX 5GANf 3V7RA 3JB9I 5GANe 2DKGA 3QHSA 5GAMf 3RKXA 4M77C 4C92G 5GAMe 5GAN6 3RUXA 1N9RA 4PJOC 2VXFA 5LJ5d 4HA8A 2Y90A 4M75E 4F7UA 3VU3C 1U1TA 3QSUA 1BIBA 5GAN5 2DTIA 4C92F 4XTWA 4C92A 5GANh 5GAMd 3GIBA 3V7SA 4M77F 5LJ5g 2RD1A 3JCMh 5LJ5e 4A53A 3HFNA 4A54A 4C8QG 5LJ5f 2JN0A 5I21A 1D3BA 4MMKA 3SWNA 1B34B 4M7AE 1WQ7A 2E41A 1I8FA 3BDUA 4C8QE 4PJOE 4EMKC 5LJ5j 5LJ3g 4J6YA 4HT9A 4M75D 1Y96B 2DEQA 5GMKj 5LJ5h 5GAN7 5GAOl 1MGQA 4C92B 4M7AA 4M7AC 4XTXA 4PJOA 4X9CA 4XU2A 4F7UB 3AHUA 1M8VA 3JB9G 5GANd 2EJFA 5GMKe 4NL3A 2EAYA 3HSBA 3RERA 4M7DA 2QTXA 4M77D 2DXTA 3SWNC 4M77E 3RKWA 4JRKA 4QVCA 4Y91A 3FB9A 4M78E 4XU3A 4M7DE 4M78C 4M75F 2EJ9A 1M5Q1 2DTHA 2EWNA 4M75A 4M77G 1WNLA 1HXDA 4X9DA 5DY9A 4C92C 2VXEA 4MMLA 4EMGA 3JB9J 1I4K1 3BW1A 5LJ3h 3RESA 1KQ2A 4RCBA
chains in the Genus database with same CATH superfamily
1O9SA 3CCSA 3FJPA 3VS7A 1N8RU 3E9GA 2D1XA 2X4XA 4F7UG 4OMQA 1QVFP 1V1CA 4BE0A 1QVGA 1WFWA 2XDPA 3CCLA 2JNGA 1T0JA 4PJOB 4OMLA 1PD0A 4LE9A 4E7ZA 2F2XA 3G7ZA 1VQ4A 5CAIA 3QDFA 5IXFA 1JJ2S 1FX7A 4B6MA 2DBKA 4M75B 1YCYA 4PJNA 2J06A 1D0ZA 2W10A 1YFNA 5GANg 1K0XA 1RL2A 2CH4A 1X75C 1GFDA 2XK0A 3I55T 3VS6A 2BIVA 3VRZA 3DLLA 1LNXA 4E7SA 3EAEA 4ZGEB 1OOTA 4M78F 1KD1U 4AMCA 3EGXB 1YITT 2O9SA 3EHRA 3MEVA 2A28A 1UG1A 2YSQA 5GAMe 4F14A 1W4SA 1SSFA 4BDYA 2HCKA 4BE2A 2BZYA 1WXBA 3QSUA 2EKHA 3CCUT 1UB4A 1YNZA 2DA9A 2EQJA 1ZA2B 1ABQA 4DOVA 3SWNA 4OB3B 2QA4T 2OX7A 2CP7A 2RK1A 2V8KA 3TCJA 2HD0A 2MMPA 4JLGA 2D6FA 3HSBA 3LH0A 2V8IA 4F04B 3EH2A 3RKWA 4JRKA 2K4YA 1KD1C 5KYYA 4OMMA 1VQLA 4M7DE 1M5Q1 4J9CA 2V1QA 1UTIA 2LMJA 3EGDA 5LJ3h 1M2VA 4PLIA 2VUBA 4AFZC 4AT1B 2E5KA 3H0FA 9ATCB 3M0QA 2E6NA 1X01A 3MEAA 1UHFA 2F2VA 3CEYA 5CQXA 3CCQQ 2PVOB 3L2RA 1I0CA 3JCMP 3CCLT 4N4HA 1UGRB 3I56T 4M7DC 3QZ9B 1YJ9T 3OYHA 2DE0X 2F5KA 3QKJA 2MCNA 2IIMA 5D7UA 4KH0B 1IZ6A 2E64A 2QI2A 1Z9ZA 2RHXA 3GNGA 2EQIA 4MZPA 1I07A 1QQJA 3X28B 3OYLA 1MNEA 2JTEA 1N9SA 1YJ9A 4FT4A 4C0DB 1QWEA 3JCMg 2CZ0B 2C0IA 2I0NA 3L2VA 5GMKl 1OEBA 3NTHA 2QK0A 4PFOA 3D7SB 3V8KA 4UC4A 1BYMA 3EH1A 2R57A 3NGPA 1QVFS 1OU9A 2YUQA 4J5YA 3QXEB 2JTFA 3FDRA 3JSCA 4F7UE 2EQKA 1R77A 2MF2A 3V7RA 3TVTA 2FZKB 3M56A 3OY9A 2YUOA 1H8KA 2K79A 2RNAA 2GTOA 4C0GA 2QAZA 3NMZC 5GAMd 3GIBA 1NJIC 2YT6A 3HFNA 4E7JA 3FLGA 4MMKA 1D09B 1NZ9A 3BDUA 1SG5A 1R0CB 5KYUB 2NUPB 3KFVA 2ABLA 1MGQA 2M9UA 1SF9A 3JB9G 2YUNA 1VQOT 3MO8A 1M3CA 2V8JA 5C0MA 1ZBJA 1JXOA 2LP5A 4M77E 1OZ3A 1I1JA 4Y91A 1YJWQ 5FU6C 3META 3M57A 2YDLA 5CKFA 1ZLMA 1KK7A 4JJDA 2DF6A 3N5BB 4PLLA 5KYXA 3CPWP 1FMKA 1RABB 3IQLA 4JRIA 1G5VA 1JJ2P 4J9IA 1VQMT 3I56Q 1Y57A 1K73R 2XKOC 4V2SA 3CCUA 3X26B 2QASA 1VQOA 4RTVA 3I5RA 3FC3A 1TUGB 4DOWA 1YHQT 3V8LA 2VVKA 4KT0E 1N27A 1PD1A 3LYIA 5CQYA 5IH2A 4D6WA 1YITA 3RMQA 3L2QA 1YJNA 4Y28E 4FT2A 1K9MU 2RF0A 1FMWA 1FMVA 3QUIA 1BBZA 2JMCA 4PKCC 2DL5A 2DAQA 4CC4B 2ZPGB 5FLXE 2RQVA 1XTDA 3I55A 2COZA 3QZ5B 5DLOA 1TH7A 3EGUA 4NS5A 4N4GA 1ZSZB 1B3QA 3EG9A 4IIMA 2DL4A 3CCST 1O75A 1VQ5Q 3CD6A 4CC2A 2RI5A 2ROLA 5A0GA 2YRCA 4HCZA 1UGSB 3OA6A 1G3SA 3A8LB 1NJIR 3ZEHA 1YCSB 1FYNA 1M8MA 2RHYA 4OGEA 2YRVA 2XI9A 3MHXA 1VQ4Q 4GLKA 4C8QE 1VQKT 2GF7A 1U5SA 1QVGS 1ZSZA 5FWCA 2DX1A 4AG2C 3HHTB 1K73U 2HEQA 1VQNT 1QW1A 4MZMA 3QJ6A 2OI3A 4FCYA 1KQ2A 2LCLA 3M9QA 1ZUUA 3SHWA 4A4EA 2FRWA 1OV3A 2CSIA 4QQDA 2FB7A 2KYMA 2X51A 2XMFA 2EGAA 4PK4A 3SWNB 3M4YA 1VQNQ 1WXUA 2JZ2A 4M78G 2FYKA 2L5QA 3CC7A 2E65A 1U3OA 3FIFA 3KUFA 4QKUA 2FZGB 5I11A 1VQ6Q 1EX4A 3MP6A 3VS1A 3NPFA 3JB9H 3CXCA 3JB9F 4FYXB 4ZTFA 5CR2A 1PRMC 2A08A 3PMTA 3M4GA 1X6GA 2VGNA 2DZCA 4KUDK 1WHKA 1CKBA 1WJRA 2FPDA 4FU6A 2WACA 3LGLA 4LD9K 3PMIA 2H3EB 2KRNA 1KD1R 4JLIA 2OTLT 2DXUA 3A8HB 2F5TX 4C8QD 2ATCB 2LCCA 4GLMA 5KYUA 5AT1B 3RKXA 1MNDA 5GAN6 2ESWA 2E4HA 1Q82C 1VQOQ 2E70A 2P4TA 2KY9A 2KE9A 1X27A 2ZPHB 2HSEB 4KUIA 1BI3A 2P0KA 4EMKC 3A98A 2JM9A 1JB0E 2QDLA 5CO7A 4YTLA 2MWPA 2AKLA 4OMNA 5HCKA 2FEIA 3VS2A 1WA7A 2M51A 5KYNA 3UATA 3FEOA 3THKA 1C6VX 2LRQA 2K2VA 1YIJQ 2EWNA 2SRCA 4LDXA 1X2KA 2LNVA 1ARKA 3HKSA 1PSEA 2CDTA 3CCJQ 8ATCB 3L42A 3H41A 2SEMA 8AT1B 2EJGA 3UT1A 1Y7XA 4GBQA 2BE7D 1YWPA 5GAOq 3HFOA 2RI2A 3GLXA 4N0AA 2RK2A 1H3HA 4J9HA 1KQSP 5AYFA 3INZA 5GJVB 1E7OA 3OSSC 4LN2A 2WSFE 2JOYA 3EGDB 3EFOB 3JCMJ 4A63B 4BDZA 5KYYB 5A2QE 1NJIU 2LT4A 2IG0A 4IUQA 5FU7C 4J6XA 4M7DD 5CK9A 1KHCA 2DYBA 3SDZA 3RDVA 4A4HA 1JU5C 4C0ZA 3JCMX 1S1NA 2V26A 4C92G 1WHHA 3RUXA 3CC2A 1UUEA 1NEBA 2PVDB 1U1TA 4JS4A 2OAUA 4JZ3A 2RD1A 4OB0B 2P4RA 5IN1A 2NLUA 1YBYA 4M7AE 1QVGP 3CCVT 3MPUB 5LJ5h 5GAN7 2O9VA 4OMPA 1KC8U 3CC4T 2PZ1A 2QGFB 3CCLQ 4JJCA 2DXTA 3CMET 1G3TA 4M78C 3UPUA 3MEUA 4C5GA 4ME7A 3HRSA 3CCMA 3VJPA 5D6XA 2FG0A 5CKDA 4F16A 5C6SA 4BI3A 3JCMQ 1VQ9T 3CCET 3QIIA 1VQ7T 2K5FA 1KIKA 3PTAA 2X3WD 2IVWA 4J6WA 2AZSA 2D8HA 3PIPA 1Y0MA 1YJWA 4ZGJB 4C8QB 3G4SA 2MPXC 5I2MA 1IGQA 3VUZA 3CCRT 2EIFA 3CMAA 5CCAA 3NTKA 2HL5C 4M75G 3H0IA 5GAOr 5GAOn 2LJ3A 3WVDB 5FU6B 1E6GA 4M78B 2YRDA 2B8AA 4RTYA 1HJDA 1QMCA 4EDUA 3SB2A 2KEAA 1U06A 2I2LA 3HRUA 3CCSQ 1J3TA 1VQ7Q 1VQ9A 1ZBXA 4RTWA 4E7KA 2M0OA 3C4SA 2QEXQ 2KRSA 3X25B 1RI0A 3CCJA 2QQ9A 1W70A 2P0PA 3G4ST 4RUGA 5GJWB 2HL3A 1K8AC 1QVFA 2HBWA 3M0RA 1T3SA 2VXFA 3GPLA 4M75E 4BY6B 2D0NA 2DTIA 3M55A 4M77F 2KROA 3PVQA 2K7AA 4CRIA 2CUDA 1I8FA 4QQ6A 4R0KA 1XNIA 3HPWA 4M75D 3G6EQ 3GBQA 1M90R 2VB6A 3OBWA 1OZ2A 5FU7B 5GMKe 3CD6Q 3EFOA 2DBMA 1X43A 3OMGA 2X9HA 5HK3A 2CT4A 2EQMA 4Y92A 3RR6A 3PT9A 2LT1A 4M78E 3TEEA 5I2SA 1HYOA 4C92C 1Q7YU 3PFSA 4C0DC 1I4K1 4F7UA 3OYDA 3L2ZA 2AKKA 3MJXA 2GFAA 2LCSA 1D1AA 4JRQA 2KDSA 1N8RC 1M3BA 3SFMA 3CC7T 4EMHA 4NOYA 1RAIB 1I81A 5GAMh 4R55A 4KGXB 3VYHB 2F69A 4M7DG 3ER0A 2RO0A 4BUGA 1YWOA 1B7TA 3M58A 3EG9B 1QP3A 2D0QB 2YXYA 5GAN8 3L2UA 1JQQA 2LNHB 4J7FA 5KE3A 2DYIA 3RNJA 3TSWA 3BE3A 3M0UA 3M5AA 1N8RR 3V8JA 1F1BB 2CP5A 1AOJA 2DL7A 1SPKA 1YI2T 2KT8A 4PL6A 3MKDA 3TU4K 5GMKh 2X4YA 5A0DA 1VQNA 2RH2A 3JRZA 2KSSA 2YUPA 2KAFA 4J9GA 4M7AD 5D6WA 1HSQA 2E5QA 4MDXA 2BUDA 2HZYA 2QGGA 1Q86R 2QQBA 1PC0A 1VA7A 2RJEA 2DEUA 2A0FB 3TREA 2MYSA 4LDVA 2L3RA 2K57A 3C12A 3A5ZB 4ZGDB 1Q81C 2L3SA 4Q5WA 2DD4A 1CSKA 2CZ1B 4PJJA 5KCHA 3VU3C 3CPWA 1D1BA 5GAN5 2P0QA 3NTIA 2JUFA 4OVAA 3V7SA 2BE9B 1BCMA 1N5ZA 3GF5A 3CMAT 1EFNA 1WX6A 2DXCA 2DIGA 1PRLC 2GQIA 1IB8A 1LCKA 1R8OB 1X69A 1YJ9Q 3URGA 4C92B 1C1AA 4EIKA 2AK5A 4WTOB 2EJFA 2NUTB 2EAYA 4NL3A 4OMFB 2J7IA 2QQAA 1VQ7A 4HCKA 1GCQC 5DY9A 4DEXA 1TUCA 2M0YA 3CCEA 1OPKA 1Q81R 4MDWA 1YJNT 4F7UF 3JAME 1W2BA 2LDMA 2CYZB 2B86A 4LUEA 4N0AC 2HKQB 4ELZC 4R56A 3JCMb 5LJ3j 2HKNA 3G71Q 3V7CA 3JV3A 1D3BB 1T0HA 2Y4YA 5LJ3e 3S6WA 2BZ8A 3CQTA 2JS2A 5GAMj 4A4FA 5HK0A 4BI4A 3CC4A 1B07A 1D1CA 2BKDN 2LZ6B 4PNOA 1ZUYA 4A4KA 1Q86U 3T9NA 3JCMd 1M9SA 2CKKA 1C0MA 2DJQA 4C8QA 2ROTA 2EBPA 2VGMA 4M4ZA 2QQSA 2DZ9A 1SRLA 3HL8A 2E3IA 4QVZA 2COYA 2EFIA 3CCVQ 1MV3A 1PKTA 2L8DA 2FRYA 1TS9A 4OP0A 3DKMA 3BFMA 3CPWS 1WJQA 3OYAA 3QHSA 2EGEA 5LJ5d 1VQ8A 2P84A 4QQGA 1BI1A 2OJ2A 3GOXA 4A53A 5HY6A 5FRMA 3OS0A 1YJNQ 5EG2A 4J6YA 2YWWA 2L2PA 5J3BA 3ULRB 3OYIA 4M7AA 4XTXA 2XDDA 1VQPQ 1S72A 1PCXA 1ZSGA 5FRNA 3CD6T 4XU3A 2KXDA 2RQRA 1BI2A 2VV5A 2PNIA 1IHVA 2HMAA 2ENMA 2HAXA 2VXEA 4IURA 1GL5A 1U1SA 3G6ET 2KRMA 3DB3A 2PU9B 1WXTA 2O88A 3QPHA 4PFPA 4LXCA 1YP5A 4M77A 1WPYA 1LOJA 1X2QA 4LD6A 5CVIA 4A4GA 1IREB 3QG1A 1WQWA 1UGPB 2JVVA 2DJZA 2Z0WA 2XD0A 4M7AB 4XTUA 3E2UA 1AZGB 2MOXA 2ZCFB 4M78D 2ZPIB 1NEGA 3BDLA 4RTXA 3X24B 1YHQA 3PE0A 1E6HA 5GAOp 4BY6C 3VYGA 1BIAA 5LJ3d 2CH4W 1VQMQ 2OAWA 4ZN1A 1Q95G 2DMOA 1PWTA 1IHWA 4M7AF 4KULA 1MMGA 2OTLA 1IO6A 2QA4A 2GNCA 3OYFA 3G71A 3JCMe 3ASKA 2EYXA 1FWZA 3QJYA 4HA8A 2DO3A 3OYGA 4C5EA 4X34A 4AFSC 4XTWA 1AWJA 4BACA 1D0YA 3UF4A 1K0SA 2CP6A 5I21A 3MP1A 5LJ3g 3VS3A 2QXFA 4BD3A 3VUBA 4ELYC 3OMCA 3EG2A 1M8VA 1QCNA 1NPRA 2KNBB 4II1A 4L6V5 2KT1A 1OX9A 4QVCA 3M59A 3H8ZA 3J7AF 4M75F 3PIOA 1YI2Q 3WXMB 5KH6A 1WHLA 3OS1A 3BW1A 2QYZA 1OQKA 1TOVA 1IXDA 1WZOA 2PQWA 3I35A 1OPLA 4HCBA 1GFCA 3E9FA 2M02A 4C92D 1VQ4T 2MI6A 5KYXB 4KRTA 4AG1C 1GXIE 2MIOA 4WF2A 2ECZA 5I22A 4E7LA 4DQ2A 1RUWA 1JJ2A 4IIOA 3L1AA 4JDSA 1WJSA 1QCOA 4LDUA 2DFUA 2R5MA 1VQKA 2J6OA 1AEYA 2OTLQ 4K11A 2NUPA 5IHNA 2DLPA 4BB7A 3KXTA 5GAMg 1S72Q 4KGZB 1RAFB 4ZTJA 2CGHA 2HBPA 1ZQ1A 2ED1A 1K76A 2F1LA 3L2WA 4M77B 1Y07A 3CCUQ 4ZN3A 1HK9A 2FHDA 3J81E 1OI1A 3SD4A 2E1HA 1SEMA 2RM4A 1UE9A 2A37A 3J80E 1QVPA 2LQ8A 1K1ZA 3GNFB 3KBGA 5EC7A 5CKBA 1QCFA 5GANe 2JTMA 2XDBA 2Y90A 6AT1B 1BIBA 4C92F 3SEMA 5DLQE 4J9BA 3I55Q 3LGFA 4LDYA 4E7IA 2A7YA 5L23A 1B34B 4DBHA 4LNPA 4JJBA 1KFZA 3REAB 5HKCA 4HT9A 2DEQA 5GAOl 2XIDA 3C0CA 3R6NA 4HXJA 1VQ5A 1M1KR 2JXBA 4D8KA 2C0OA 2L3QA 4P5NA 5IT9E 2J05A 1VQMA 1PSFA 4Z89A 2XG8D 2DL3A 4M75A 2W0ZA 4OMOA 3OYEA 3VS4A 1IGUA 2K5LA 2K9GA 2X3XD 2CUBA 3H0HA 3LWIA 1P92A 1M4ZA 4GY5A 1M2VB 2LJ1A 2VYTA 4XU1A 5CKEA 1AD5A 2KR3A 4E2FB 4RTZA 1VQ5T 2RB6A 1MMNA 2K3XA 3OYCA 1I5LA 4TVRA 1VQ9Q 2L0AA 3CBMA 3R6OA 1SSHA 4EMKB 2CP2A 3G71T 5KYWB 2K2MA 5CIUA 5ECAA 4PJOF 2LJ0A 3QYGB 4CC3A 3VS0A 2H3JA 4XQ3A 4IUTA 3ME9A 4M7DB 1WGSA 2QG9B 1TTHB 4WCIA 2HNIA 1UGQB 2E10A 2L89A 2KI7A 3CCMQ 4D8DA 2X35A 2EPDA 2JW4A 4RTUA 1I5OB 3S3NA 4RCCA 3G6EA 3EG3A 1PKSA 2M16A 3NFCA 1H92A 3E1SA 3EGXA 3G1JA 5GAMf 3CBPA 2VASA 4J8OA 2NUTA 3ZBDA 1WYXA 4FSXA 3P8DA 5CKHA 2DK3A 4C92A 5GANh 3OYKA 3PNWC 3HP9A 3F70A 3H6ZA 2E41A 2LQWA 1RACB 1D0XA 2NUZA 2M1HA 2VWFA 4M7AC 3CBOA 3I56A 2AHJB 2X4WA 4XU2A 4ANJA 1MUZA 5GANd 2EVRA 2RHUA 2RHZA 1AVZC 2QTVA 4E6RA 1Q86C 2NYSA 1VUBA 1RAGB 2EJ9A 1K8AR 1SKUB 4EMGA 1IRXA 3O8VA 4FYVB 4J9DA 1NYFA 5FW9A 2G3RA 5GAN2 4RKUE 3PVLA 1W6XA 2FPEA 4X1VA 3QDRB 4FL6A 2DM1A 1VQLT 2ZPEB 4EMKA 4C92E 2R58A 1VQPA 1VIFA 5LJ3f 1VIEA 2E3HA 2QDYB 2YLBA 2DIQA 1EIFA 4OB2B 1UECA 4RMOA 5GAN4 5IHIA 2D8JA 2IPOB 2ZZDA 1V29B 4NL2A 2O31A 1NBEB 4C8QC 1H641 2DTOA 2LX9A 3RKYA 5GAN3 2E6ZA 4J9EA 1HD3A 1Q7YR 5IHKA 3EG1A 1JRIA 1K9MR 3VRYA 2RQTA 4C8QF 1VQLQ 2YLCA 3AT1B 1KSWA 3JCMW 3LX7A 2O4XB 5GANj 1VYUA 1X6BA 1AZEA 4BE1A 1BK2A 4F17A 2QQRA 2RPNA 5LJ5g 1BU1A 3JCMh 2JN0A 2K6DA 1GCQA 1ZUKA 2C0TA 2O2OA 1MMDA 3CCJT 2A36A 3MCAB 3G4SQ 1Y96B 4X9CA 3AHUA 1R0BG 2ED0A 2WSEE 1YIJT 3CC2Q 3CC4Q 1JO8A 4OGCA 4PJMA 4DEYA 4FYWB 3OYYA 1GBQA 2FVUA 2L3PA 2DXBA 1WNLA 1HXDA 5M9OA 3JB9J 3RESA 3S3OA 1RADB 2DILA 2PUOB 4DBQA 1G3YA 1WHGA 3M54A 3A1PA 3ZFJA 3CCRQ 3UDCA 1NYGA 4E47A 3A8GB 4XTYA 3REBB 2EKOA 2AT1B 3CPFA 4M78A 1Q82R 2E12A 1S72T 3OYJA 1QKXA 3FJ5A 4C0FA 5FWBA 3CCQT 4LDWA 5A0LA 2RI3A 3Q1JA 2QEXT 1GBRA 1TWBA 3A8OB 2AIRB 1G2BA 4N4IA 1M30A 1JBMA 1VQ8T 1PM3A 1VOMA 1M27C 2ZPFB 1V76A 1RAAB 1UJ0A 2VKNA 2RMOA 2CT3A 1T3LA 4JS5A 4KBMB 3HTRA 4M75C 1ACMB 4FM4B 1TU0B 1NE8A 2HQEA 4Z02A 5GMKi 3O5ZA 2KK4A 3JCMf 1PHTA 2OTJA 1RI9A 4LUDA 3CMAQ 4FSSA 3OS2A 1VQ6T 4DBFA 4M77C 1NLOC 3RMSA 4PJOC 1K8AU 3OW2A 3OW2P 2JMAA 3CC2T 3OB9A 4ESRA 1VQ6A 1D3BA 1ZX6A 2HQXA 1UGVA 5LJ5j 2LC4A 2MWOA 4QT7A 2KGTA 4C5HA 4FW2A 2RQWA 1EZZB 3QWXX 2JS0A 2R5AA 3RERA 3FB9A 3M53A 4FYYB 3OW2S 3I9QA 3NHNA 5KE2A 2K3BA 4X9DA 1FXXA 4MMLA 3EFSA 3JB9D 1SRMA 3S3MA 1K4US 3QWYA 3E19A 2GFUA 4KH1B 1KJWA 4O6JA 4XTZA 4AFUC 4HT8A 1M1KC 1JEGA 3OYMA 3C94A 4BI8B 2CP0A 2DVJA 1WIEA 1QKWA 3I5SA 3WVEB 3OS5A 1Q7YC 2KXCA 1KC8C 2OTJQ 1OULA 1GCPA 4CC7A 1LJOA 2PUKB 1AWWA 4XTVA 3OYBA 2KVQG 3VS5A 5LL6S 4HKEA 7AT1B 3OYNA 3P8BB 5IAYA 2RJFA 4C5IA 1YIJA 4JJNK 5DM7R 1TXQA 2BTTA 4XU0A 4M7DF 3RIRA 1M2OA 2Y4XA 3CCRA 1OU8A 3QO3A 1UFFA 2X4JA 2ZGWA 3VV0A 1CKAA 5GANf 2DKGA 1SHFA 4XK8E 3CMEA 1Q81U 2EYYA 1N9RA 1KHIA 3LW5E 3OSVA 5J26A 4L5GA 2LX7A 2HSPA 4O5VA 1YI2A 2K5IA 2G6FX 1M1KU 1WQ7A 3CXCP 1K9AA 1KQSA 2J6KA 4DA4A 1Q82U 5D6YA 4B9WA 3VKIA 2F2WA 1M90C 4F7UB 2XU8A 2PVGB 1QP2A 3TQ7P 4FIBA 1WI7A 1ZHIA 1VQKQ 4M77G 1UJYA 1UHCA 1WDXA 2DRMA 2OTJT 1UEBA 2HDAA 3CCVA 3PGGA 2O01E 3DLMA 1PNJA 2EW3A 4HVUA 1M1FA 2FZCB 3DB4A 2GQVA 3MEWA 1W2BS 2XHCA 1KQSS 2XICA 1NPPA 1Z9QA 2WSCE 1JXMA 4QW2A 3M0PA 3LH5A 2YHTA 1VQ8Q 2DETA 1VQPT 3A8MB 4B9XA 2RN8A 1NM7A 4L59A 2QEXA 4M7AG 1G8XA 2DRKA 3CCEQ 1K9MC 1KG1A 2EGCA 3M0SA 3UWNA 2DVEA 1OX8A 2GGRA 1A0NB 4J7IA 3JCMV 1M3AA 2C06A 1X6OA 1NG2A 1W1FA 4PJOD 4EPCA 1RAEB 3P8HA 4JRPA 2KYBA 1GRIA 3CC7Q 2CP3A 4JUVA 2FL7A 4J9FA 2EYQA 5GMKm 1UDLA 1AWXA 3LLRA 3CCQA 1M90U 1BB9A 3JB9I 2KQWA 1TUDA 1XQHA 3EG0A 1OYXA 2EYZA 2LTOA 2RJCA 1XJWB 2RJDA 1DJ7B 1RLPC 2JM8A 4ZNXA 1G3WA 2V1RA 4Z8AA 2CSQA 4ATOA 5LJ5e 2DNUA 4C8QG 4A54A 5LJ5f 3UA7A 4JPBW 4RTTA 1U8RA 2CZ6B 1XOVA 1QWFA 1YN8A 1LPLA 1YJWT 4JZ4A 1K73C 4KGVB 1TG0A 2CS7A 3UA6A 4RG2A 2J6FA 1MMAA 1G83A 2H8HA 2FO0A 2MK5A 2DERA 2DL8A 1B34A 1MHNA 1ZA1B 1ABOA 4HVVA 3BY7A 2GTJA 1BCOA 2MAMA 3CCMT 3JCMc 4XAXB 3CMEQ 2QA4Q 4PJLA 5KCOA 2ZPBB 4FW1A 2ZAEA 1H3ZA 3LWHA 4J83A 1AT1B 3QBYA 1AWOA 1RLQC 2K3YA 4ORZA 1KC8R 2HQHA 5GAOm 3X20B 4VUBA 1M1GA 1QLYA 3CXCS 2RA2A 3GP8A 3MP8A 4OF1A 4AFQC 2VC8A 3EFRA 1PG5B 1WLPB 2RQUA 2NWMA 2DD5A 4QVDA 3OBYA 1Y96A 1MV0B 1WHMA 1BI0A 4IKFA 1Y71A 2GBQA 4MZTA 4OB1B 1VYTA 3EHQA 2FPFA 2RHIA 4IUUA 4IUVA 3H9NA 4HVWA 4PJOG 4IUPA 5FROA 5J39A 1KQ1A 4E7HA 2COWA 2KMTA 1TSFA 5L8RE 2CZ7B 2A3LA 1NLPC 2LQKA 2O4XA 1RAHB 2JT4A 2LQNA 1YHQQ 2BZXA 2EQUA 2JJ9A 2AZVA 4HCCA 1W2BP 2EYWA 2GCXA 3FRNA 3RBBB 1VYVA 4PFZA 2KBTA 3M0TA 5IXBA 2DPPB 1WHJA 1YITQ 4Z88A 4PJOE 1AHJB 2PTKA 3ZL7C 4CI0C 5GMKj 1ZSZC 2CREA 3QYHB 4PJOA 4DBRA 2LVMA 1BKBA 4M7DA 3OQ5A 1N6AA 2QTXA 4M77D 3SWNC 1SHGA 3TSZA 3HRTA 3C95A 2D9TA 2DTHA 1LVKA 4RG8A 3U23A 5KYWA 4RCBA
chains in the Genus database with same CATH topology
1O9SA 3CCSA 3S3OA 1U1SA 2PUOB 3FJPA 3G6ET 2LNVA 3DB3A 1N8RU 2PU9B 3HKSA 1PSEA 1G3YA 3E9GA 3M54A 3QPHA 3ZFJA 2X4XA 4F7UG 3UDCA 3L42A 4E47A 3A8GB 4M77A 4XTYA 1WPYA 2EKOA 4BE0A 1LOJA 3CPFA 4LD6A 4M78A 1QVGA 5CVIA 4A4GA 1IREB 2XDPA 3QG1A 3CCLA 1WQWA 2EJGA 3UT1A 1UGPB 2JNGA 2JVVA 4PJOB 1Y7XA 2DJZA 2E12A 1S72T 3OYJA 4M7AB 2XD0A 5GAOq 3HFOA 2RI2A 3GLXA 3G7ZA 4XTUA 4C0FA 4N0AA 1VQ4A 5CAIA 3CCQT 2ZCFB 2RK2A 4M78D 1JJ2S 2ZPIB 4LDWA 5AYFA 5A0LA 1FX7A 3INZA 4M75B 2RI3A 3Q1JA 2QEXT 3BDLA 3OSSC 1YCYA 3A8OB 3X24B 4N4IA 2WSFE 1YHQA 5GAOp 5GANg 1RL2A 2JOYA 4BY6C 3JCMJ 1JBMA 1X75C 4BDZA 2XK0A 3VYGA 3I55T 2BIVA 1VQ8T 1BIAA 5A2QE 1NJIU 5LJ3d 2LT4A 2ZPFB 3DLLA 1LNXA 2IG0A 4IUQA 5FU7C 4J6XA 3EAEA 4ZN1A 4JS5A 4M7DD 4KBMB 4ZGEB 4M75C 4M78F 5CK9A 1KD1U 1KHCA 4FM4B 1NE8A 2HQEA 4Z02A 1YITT 5GMKi 4M7AF 4KULA 3SDZA 2OTLA 2KK4A 2QA4A 3MEVA 3JCMf 2OTJA 4A4HA 3OYFA 3G71A 4C0ZA 3JCMe 3ASKA 3JCMX 3OS2A 1VQ6T 1FWZA 4M77C 4C92G 5GAMe 3RUXA 3RMSA 1W4SA 1SSFA 3QJYA 4BDYA 3CC2A 4HA8A 1K8AU 2DO3A 4BE2A 3OW2A 3QSUA 2PVDB 3OYGA 1U1TA 3CCUT 4JS4A 1UB4A 2OAUA 4C5EA 4X34A 4XTWA 3CC2T 4BACA 3OB9A 2EQJA 2RD1A 4OB0B 4DOVA 1VQ6A 5IN1A 2NLUA 5I21A 1D3BA 1YBYA 3SWNA 4M7AE 4OB3B 2QA4T 2HQXA 3MP1A 5LJ3g 2LC4A 5LJ5j 3CCVT 2RK1A 2QXFA 2MWOA 5LJ5h 2V8KA 4BD3A 5GAN7 3TCJA 2HD0A 3VUBA 4ELYC 4C5HA 3CC4T 2MMPA 1KC8U 4JLGA 3OMCA 1M8VA 2D6FA 3HSBA 1NPRA 2R5AA 3LH0A 3RERA 2V8IA 4II1A 2DXTA 4L6V5 3RKWA 4JRKA 3CMET 2K4YA 3M59A 1G3TA 4QVCA 3FB9A 3H8ZA 3M53A 3OW2S 1KD1C 3J7AF 1VQLA 4M7DE 4M78C 4M75F 5KE2A 1M5Q1 3UPUA 4X9DA 3PIOA 3WXMB 3MEUA 4C5GA 4ME7A 5KH6A 1FXXA 3HRSA 4MMLA 3OS1A 3CCMA 3BW1A 5LJ3h 3VJPA 5D6XA 4PLIA 2VUBA 5CKDA 5C6SA 2PQWA 4BI3A 4HCBA 3EFSA 3JCMQ 1VQ9T 3CCET 3E9FA 3QIIA 2E6NA 1X01A 3MEAA 5CQXA 3CEYA 4C92D 3JB9D 1VQ4T 2MI6A 1VQ7T 2K5FA 3S3MA 2PVOB 3PTAA 3E19A 2IVWA 2GFUA 3L2RA 1GXIE 4WF2A 4J6WA 4E7LA 3JCMP 4DQ2A 4O6JA 4XTZA 4HT8A 3CCLT 1JJ2A 4N4HA 1M1KC 1UGRB 3I56T 4M7DC 3L1AA 3QZ9B 4JDSA 3PIPA 1WJSA 3C94A 2F5KA 4BI8B 3OYMA 3QKJA 3OYHA 1YJ9T 4LDUA 2R5MA 3WVEB 1YJWA 1VQKA 3OS5A 1IZ6A 4ZGJB 4C8QB 3G4SA 1Q7YC 2E64A 2QI2A 2RHXA 3GNGA 5I2MA 1KC8C 3VUZA 3CCRT 4MZPA 2EIFA 3CMAA 1LJOA 5CCAA 3X28B 3NTKA 2PUKB 4BB7A 4M75G 3OYLA 5GAMg 3KXTA 1N9SA 4XTVA 1YJ9A 3OYBA 5GAOr 4FT4A 4C0DB 2KVQG 2CGHA 2HBPA 5GAOn 4ZTJA 5LL6S 3WVDB 3JCMg 2CZ0B 4HKEA 1ZQ1A 5FU6B 4M78B 3OYNA 3L2VA 3P8BB 3L2WA 5IAYA 4M77B 2RJFA 4C5IA 5GMKl 1Y07A 1YIJA 2B8AA 4JJNK 5DM7R 4ZN3A 4EDUA 1HK9A 3NTHA 2FHDA 3SB2A 2I2LA 3V8KA 3HRUA 3J81E 4UC4A 1OI1A 3SD4A 4XU0A 2E1HA 1ZBXA 3RIRA 1VQ9A 4M7DF 1BYMA 2RM4A 4E7KA 2M0OA 2R57A 3C4SA 4PJOC 2Y4XA 3J80E 3CCRA 1QVFS 1QVPA 1RI0A 3X25B 3CCJA 2QQ9A 2X4JA 3QO3A 2ZGWA 4J5YA 2P0PA 2JTFA 2LQ8A 3FDRA 3QXEB 3JSCA 3VV0A 3GNFB 4F7UE 3G4ST 2EQKA 3KBGA 2MF2A 3V7RA 5CKBA 5GANf 5GANe 2DKGA 1K8AC 2JTMA 4XK8E 1QVFA 3M56A 3OY9A 3CMEA 1Q81U 1N9RA 2XDBA 1KHIA 3LW5E 2VXFA 3OSVA 5J26A 3GPLA 2Y90A 4M75E 4L5GA 1BIBA 4BY6B 4C0GA 2DTIA 4O5VA 4C92F 5DLQE 1YI2A 5GAMd 3GIBA 2K5IA 3M55A 4M77F 1NJIC 3LGFA 3HFNA 4LDYA 4E7JA 4E7IA 2A7YA 3FLGA 1M1KU 4MMKA 4CRIA 1NZ9A 1B34B 1WQ7A 1I8FA 3BDUA 4QQ6A 1XNIA 1KQSA 5HKCA 3HPWA 4M75D 4HT9A 4DA4A 2DEQA 1Q82U 3OBWA 5D6YA 5GAOl 1MGQA 2XIDA 4B9WA 3VKIA 1OZ2A 2M9UA 1M90C 4F7UB 1VQ5A 3JB9G 1VQOT 2XU8A 5FU7B 5GMKe 3MO8A 2PVGB 2V8JA 1QP2A 3OMGA 4FIBA 4P5NA 5IT9E 5C0MA 4M77E 1VQMA 5HK3A 1OZ3A 1PSFA 2EQMA 4Y91A 3PT9A 2LT1A 2XG8D 4M78E 3TEEA 1ZHIA 5I2SA 5FU6C 4M75A 4M77G 4C92C 3META 1Q7YU 3M57A 3PFSA 2OTJT 4C0DC 1I4K1 3OYEA 1UEBA 5CKFA 4F7UA 4PLLA 3N5BB 2K5LA 3OYDA 3L2ZA 3PGGA 2O01E 3CCVA 3DLMA 2GFAA 3LWIA 1M1FA 4JRQA 3DB4A 1P92A 2GQVA 3MEWA 4JRIA 2XHCA 1W2BS 1M4ZA 2KDSA 1N8RC 1G5VA 4GY5A 3SFMA 2XICA 1KQSS 1NPPA 4EMHA 3CC7T 4NOYA 2VYTA 1I81A 5GAMh 4R55A 1VQMT 4XU1A 5CKEA 3VYHB 4V2SA 2F69A 2XKOC 3CCUA 3X26B 2WSCE 4QW2A 1VQOA 2YHTA 3FC3A 1VQPT 4M7DG 1VQ5T 3A8MB 4B9XA 2RB6A 2K3XA 3OYCA 1I5LA 4TVRA 3ER0A 2RO0A 4BUGA 4DOWA 3V8LA 4L59A 1YHQT 3M58A 3CBMA 3R6OA 4KT0E 1N27A 4EMKB 2QEXA 4M7AG 1QP3A 3LYIA 3G71T 5CQYA 2D0QB 5GAN8 3L2UA 4D6WA 5CIUA 4J7FA 1YITA 3RMQA 5KE3A 3L2QA 1K9MC 1KG1A 3UWNA 2DVEA 1YJNA 3M5AA 4Y28E 4J7IA 4PJOF 3V8JA 4FT2A 1K9MU 3QYGB 3QUIA 1YI2T 2H3JA 4PL6A 4IUTA 3ME9A 4XQ3A 3TU4K 1WGSA 4PKCC 3JCMV 4M7DB 2DAQA 2C06A 1X6OA 5GMKh 2ZPGB 2X4YA 5FLXE 2HNIA 1UGQB 1XTDA 5A0DA 2E10A 1VQNA 2L89A 4PJOD 2RH2A 3JRZA 3I55A 2KSSA 4M7AD 2KAFA 3QZ5B 5DLOA 4EPCA 3P8HA 5D6WA 2E5QA 2X35A 4JRPA 4MDXA 1TH7A 2BUDA 4NS5A 3S3NA 2QQBA 4JUVA 4N4GA 4RCCA 2RJEA 2FL7A 3NFCA 2M16A 2EYQA 5GMKm 3G6EA 3CCST 3TREA 4LDVA 1O75A 3E1SA 3LLRA 2L3RA 3CCQA 1M90U 2K57A 3C12A 3A5ZB 4ZGDB 1Q81C 3JB9I 2KQWA 1XQHA 5GAMf 4Q5WA 3CD6A 3CBPA 1OYXA 2LTOA 2DD4A 2RJCA 4J8OA 2RI5A 2CZ1B 3ZBDA 5A0GA 2RJDA 5KCHA 3VU3C 3CPWA 4FSXA 4HCZA 1DJ7B 3P8DA 5GAN5 2P0QA 1UGSB 1G3WA 2DK3A 5CKHA 4C92A 5GANh 3OA6A 3NTIA 1G3SA 2JUFA 3A8LB 4OVAA 3V7SA 3ZEHA 3OYKA 4ATOA 5LJ5e 3PNWC 4C8QG 3HP9A 4A54A 3F70A 5LJ5f 2RHYA 3GF5A 3CMAT 4OGEA 2YRVA 3H6ZA 2XI9A 3MHXA 2DXCA 2DIGA 2CZ6B 2E41A 4GLKA 4C8QE 1U8RA 1XOVA 1R8OB 2GF7A 1YJWT 1VQKT 3URGA 1K73C 2M1HA 4C92B 1QVGS 4M7AC 3CBOA 3I56A 2AHJB 2CS7A 2X4WA 4XU2A 4RG2A 3HHTB 5GANd 2EJFA 1K73U 4NL3A 2EAYA 2RHUA 2RHZA 1VQNT 4OMFB 1Q86C 1QW1A 2QQAA 1VUBA 4MZMA 1VQ7A 2EJ9A 3QJ6A 5DY9A 4EMGA 1KQ2A 3O8VA 2LCLA 3M9QA 3CCEA 4MDWA 2G3RA 4F7UF 4RKUE 1B34A 1MHNA 5GAN2 2LDMA 3JAME 1YJNT 1W2BA 2CYZB 3BY7A 4N0AC 4A4EA 2MAMA 3QDRB 4ELZC 3CCMT 4FL6A 4QQDA 2FB7A 4XAXB 3JCMc 4R56A 3JCMb 5LJ3j 5KCOA 1VQLT 2ZPBB 3V7CA 1D3BB 3SWNB 2ZPEB 4EMKA 4C92E 4J83A 3LWHA 1H3ZA 3QBYA 3M4YA 2K3YA 2Y4YA 2R58A 5LJ3e 1VQPA 1VIFA 5LJ3f 3S6WA 5GAMj 5GAOm 2JZ2A 4A4FA 4M78G 3X20B 1VIEA 2FYKA 2L5QA 2QDYB 2YLBA 4VUBA 4BI4A 5HK0A 3CC4A 2DIQA 1EIFA 4OB2B 3CC7A 1M1GA 2BKDN 3CXCS 2RA2A 5GAN4 3MP8A 2E65A 4OF1A 4RMOA 3GP8A 2VC8A 3EFRA 3FIFA 3KUFA 4PNOA 4A4KA 1Q86U 3MP6A 2ZZDA 1V29B 4NL2A 2DD5A 3T9NA 4QVDA 3JCMd 3JB9H 1M9SA 3OBYA 1Y96A 3CXCA 3JB9F 4C8QC 4ZTFA 1H641 2CKKA 5CR2A 3PMTA 4C8QA 2DTOA 2LX9A 3RKYA 3M4GA 2VGMA 5GAN3 1BI0A 2E6ZA 2DZCA 2VGNA 4IKFA 4KUDK 1Y71A 4MZTA 1WJRA 2QQSA 4FU6A 2DZ9A 4OB1B 2WACA 3LGLA 1JRIA 2RHIA 4IUUA 4IUVA 3HL8A 4LD9K 3PMIA 4QVZA 4PJOG 4C8QF 2EFIA 4IUPA 5FROA 5J39A 4JLIA 2YLCA 1KQ1A 2OTLT 2DXUA 4E7HA 3A8HB 3JCMW 3LX7A 2F5TX 4C8QD 2O4XB 2KMTA 2LCCA 2L8DA 5L8RE 5GANj 2CZ7B 4OP0A 2A3LA 3DKMA 3BFMA 2LQKA 3CPWS 1WJQA 2O4XA 3OYAA 3QHSA 3RKXA 5GAN6 1Q82C 2EQUA 5LJ5d 4BE1A 1VQ8A 2QQRA 2E70A 4HCCA 4QQGA 2P4TA 2KY9A 1BI1A 2GCXA 3FRNA 5LJ5g 3GOXA 3JCMh 4A53A 2JN0A 2ZPHB 2DPPB 4KUIA 1BI3A 2P0KA 5HY6A 5FRMA 3OS0A 3CCJT 4PJOE 4EMKC 1AHJB 5EG2A 3MCAB 4J6YA 4CI0C 1Y96B 5GMKj 5J3BA 3OYIA 4M7AA 1JB0E 3QYHB 4XTXA 5CO7A 4X9CA 2XDDA 4PJOA 4YTLA 2LVMA 1BKBA 3AHUA 1S72A 2MWPA 4M7DA 3OQ5A 2WSEE 1N6AA 1YIJT 2QTXA 4M77D 3SWNC 4OGCA 3FEOA 2LRQA 5FRNA 2K2VA 3CD6T 3HRTA 3OYYA 4XU3A 1BI2A 2FVUA 2VV5A 2DXBA 2D9TA 2DTHA 2EWNA 3C95A 1WNLA 1HXDA 4RG8A 2HAXA 5M9OA 2VXEA 3JB9J 4IURA 4LDXA 3RESA 4RCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 2;  4F7U F;  1B34 A;  1U1S A;  3FJP A;  3L2Z A;  3BY7 A;  3PGG A;  4N0A C;  3EFS A;  3JCM Q;  2FB7 A;  3JCM c;  4F7U G;  1X01 A;  3JB9 D;  4JRI A;  4C92 D;  3JCM b;  5LJ3 j;  4M77 A;  3V7C A;  4XTY A;  1WPY A;  1D3B B;  4NOY A;  3SWN B;  1LOJ A;  4C92 E;  4EMH A;  4EMK A;  1I81 A;  4M78 A;  5GAM h;  4XU1 A;  5LJ3 e;  4V2S A;  4WF2 A;  4J6W A;  5LJ3 f;  1WQW A;  2EJG A;  3JCM P;  5GAM j;  5GAO m;  4DQ2 A;  4PJO B;  2DJZ A;  4M78 G;  4XTZ A;  2YHT A;  4HT8 A;  2FYK A;  4M7D G;  2YLB A;  4M7A B;  2RB6 A;  5GAO q;  4M7D C;  3L1A A;  3HFO A;  1I5L A;  4XTU A;  3V8L A;  2RA2 A;  4N0A A;  5GAN 4;  2E65 A;  4EMK B;  5CAI A;  2VC8 A;  3EFR A;  3FIF A;  4M7A G;  4PNO A;  4M78 D;  4C8Q B;  2E64 A;  5GAN 8;  4NL2 A;  3JCM d;  3INZ A;  4QVD A;  3JB9 H;  4M75 B;  1Y96 A;  3JB9 F;  2DVE A;  4C8Q C;  1YCY A;  1LJO A;  1H64 1;  4M75 G;  3V8J A;  4PJO F;  5GAM g;  5GAO p;  1N9S A;  4XTV A;  4C8Q A;  2DTO A;  5GAN g;  5GAO r;  3QUI A;  3M4G A;  3RKY A;  2CGH A;  5GAO n;  5GAN 3;  4XQ3 A;  2DZC A;  3JCM g;  3JCM J;  4M7D B;  3JCM V;  1JBM A;  4M78 B;  2DZ9 A;  5GMK h;  1BIA A;  4M77 B;  2HNI A;  1JRI A;  5GMK l;  2E10 A;  5LJ3 d;  4PJO D;  4M7A D;  1LNX A;  1HK9 A;  4PJO G;  3SB2 A;  2I2L A;  3V8K A;  4C8Q F;  4J6X A;  1TH7 A;  4JLI A;  2YLC A;  4XU0 A;  2E1H A;  1KQ1 A;  3RIR A;  4M7D D;  2DXU A;  4M7D F;  4M75 C;  2RM4 A;  4M78 F;  3JCM W;  4JUV A;  4RCC A;  4C8Q D;  5GMK m;  5GAN j;  5GMK i;  4M7A F;  3QO3 A;  4J5Y A;  2ZGW A;  4OP0 A;  3JCM f;  4F7U E;  3BFM A;  3JCM e;  2K57 A;  3JCM X;  5GAN f;  3V7R A;  3JB9 I;  5GAN e;  2DKG A;  3QHS A;  5GAM f;  3RKX A;  4M77 C;  4C92 G;  5GAM e;  5GAN 6;  3RUX A;  1N9R A;  4PJO C;  2VXF A;  5LJ5 d;  4HA8 A;  2Y90 A;  4M75 E;  4F7U A;  3VU3 C;  1U1T A;  3QSU A;  1BIB A;  5GAN 5;  2DTI A;  4C92 F;  4XTW A;  4C92 A;  5GAN h;  5GAM d;  3GIB A;  3V7S A;  4M77 F;  5LJ5 g;  2RD1 A;  3JCM h;  5LJ5 e;  4A53 A;  3HFN A;  4A54 A;  4C8Q G;  5LJ5 f;  2JN0 A;  5I21 A;  1D3B A;  4MMK A;  3SWN A;  1B34 B;  4M7A E;  1WQ7 A;  2E41 A;  1I8F A;  3BDU A;  4C8Q E;  4PJO E;  4EMK C;  5LJ5 j;  5LJ3 g;  4J6Y A;  4HT9 A;  4M75 D;  1Y96 B;  2DEQ A;  5GMK j;  5LJ5 h;  5GAN 7;  5GAO l;  1MGQ A;  4C92 B;  4M7A A;  4M7A C;  4XTX A;  4PJO A;  4X9C A;  4XU2 A;  4F7U B;  3AHU A;  1M8V A;  3JB9 G;  5GAN d;  2EJF A;  5GMK e;  4NL3 A;  2EAY A;  3HSB A;  3RER A;  4M7D A;  2QTX A;  4M77 D;  2DXT A;  3SWN C;  4M77 E;  3RKW A;  4JRK A;  4QVC A;  4Y91 A;  3FB9 A;  4M78 E;  4XU3 A;  4M7D E;  4M78 C;  4M75 F;  2EJ9 A;  1M5Q 1;  2DTH A;  2EWN A;  4M75 A;  4M77 G;  1WNL A;  1HXD A;  4X9D A;  5DY9 A;  4C92 C;  2VXE A;  4MML A;  4EMG A;  3JB9 J;  1I4K 1;  3BW1 A;  5LJ3 h;  3RES A;  1KQ2 A;  4RCB A; 
#chains in the Genus database with same CATH topology
 1O9S A;  3CCS A;  3FJP A;  3VS7 A;  1N8R U;  3E9G A;  2D1X A;  2X4X A;  4F7U G;  4OMQ A;  1QVF P;  1V1C A;  4BE0 A;  1QVG A;  1WFW A;  2XDP A;  3CCL A;  2JNG A;  1T0J A;  4PJO B;  4OML A;  1PD0 A;  4LE9 A;  4E7Z A;  2F2X A;  3G7Z A;  1VQ4 A;  5CAI A;  3QDF A;  5IXF A;  1JJ2 S;  1FX7 A;  4B6M A;  2DBK A;  4M75 B;  1YCY A;  4PJN A;  2J06 A;  1D0Z A;  2W10 A;  1YFN A;  5GAN g;  1K0X A;  1RL2 A;  2CH4 A;  1X75 C;  1GFD A;  2XK0 A;  3I55 T;  3VS6 A;  2BIV A;  3VRZ A;  3DLL A;  1LNX A;  4E7S A;  3EAE A;  4ZGE B;  1OOT A;  4M78 F;  1KD1 U;  4AMC A;  3EGX B;  1YIT T;  2O9S A;  3EHR A;  3MEV A;  2A28 A;  1UG1 A;  2YSQ A;  5GAM e;  4F14 A;  1W4S A;  1SSF A;  4BDY A;  2HCK A;  4BE2 A;  2BZY A;  1WXB A;  3QSU A;  2EKH A;  3CCU T;  1UB4 A;  1YNZ A;  2DA9 A;  2EQJ A;  1ZA2 B;  1ABQ A;  4DOV A;  3SWN A;  4OB3 B;  2QA4 T;  2OX7 A;  2CP7 A;  2RK1 A;  2V8K A;  3TCJ A;  2HD0 A;  2MMP A;  4JLG A;  2D6F A;  3HSB A;  3LH0 A;  2V8I A;  4F04 B;  3EH2 A;  3RKW A;  4JRK A;  2K4Y A;  1KD1 C;  5KYY A;  4OMM A;  1VQL A;  4M7D E;  1M5Q 1;  4J9C A;  2V1Q A;  1UTI A;  2LMJ A;  3EGD A;  5LJ3 h;  1M2V A;  4PLI A;  2VUB A;  4AFZ C;  4AT1 B;  2E5K A;  3H0F A;  9ATC B;  3M0Q A;  2E6N A;  1X01 A;  3MEA A;  1UHF A;  2F2V A;  3CEY A;  5CQX A;  3CCQ Q;  2PVO B;  3L2R A;  1I0C A;  3JCM P;  3CCL T;  4N4H A;  1UGR B;  3I56 T;  4M7D C;  3QZ9 B;  1YJ9 T;  3OYH A;  2DE0 X;  2F5K A;  3QKJ A;  2MCN A;  2IIM A;  5D7U A;  4KH0 B;  1IZ6 A;  2E64 A;  2QI2 A;  1Z9Z A;  2RHX A;  3GNG A;  2EQI A;  4MZP A;  1I07 A;  1QQJ A;  3X28 B;  3OYL A;  1MNE A;  2JTE A;  1N9S A;  1YJ9 A;  4FT4 A;  4C0D B;  1QWE A;  3JCM g;  2CZ0 B;  2C0I A;  2I0N A;  3L2V A;  5GMK l;  1OEB A;  3NTH A;  2QK0 A;  4PFO A;  3D7S B;  3V8K A;  4UC4 A;  1BYM A;  3EH1 A;  2R57 A;  3NGP A;  1QVF S;  1OU9 A;  2YUQ A;  4J5Y A;  3QXE B;  2JTF A;  3FDR A;  3JSC A;  4F7U E;  2EQK A;  1R77 A;  2MF2 A;  3V7R A;  3TVT A;  2FZK B;  3M56 A;  3OY9 A;  2YUO A;  1H8K A;  2K79 A;  2RNA A;  2GTO A;  4C0G A;  2QAZ A;  3NMZ C;  5GAM d;  3GIB A;  1NJI C;  2YT6 A;  3HFN A;  4E7J A;  3FLG A;  4MMK A;  1D09 B;  1NZ9 A;  3BDU A;  1SG5 A;  1R0C B;  5KYU B;  2NUP B;  3KFV A;  2ABL A;  1MGQ A;  2M9U A;  1SF9 A;  3JB9 G;  2YUN A;  1VQO T;  3MO8 A;  1M3C A;  2V8J A;  5C0M A;  1ZBJ A;  1JXO A;  2LP5 A;  4M77 E;  1OZ3 A;  1I1J A;  4Y91 A;  1YJW Q;  5FU6 C;  3MET A;  3M57 A;  2YDL A;  5CKF A;  1ZLM A;  1KK7 A;  4JJD A;  2DF6 A;  3N5B B;  4PLL A;  5KYX A;  3CPW P;  1FMK A;  1RAB B;  3IQL A;  4JRI A;  1G5V A;  1JJ2 P;  4J9I A;  1VQM T;  3I56 Q;  1Y57 A;  1K73 R;  2XKO C;  4V2S A;  3CCU A;  3X26 B;  2QAS A;  1VQO A;  4RTV A;  3I5R A;  3FC3 A;  1TUG B;  4DOW A;  1YHQ T;  3V8L A;  2VVK A;  4KT0 E;  1N27 A;  1PD1 A;  3LYI A;  5CQY A;  5IH2 A;  4D6W A;  1YIT A;  3RMQ A;  3L2Q A;  1YJN A;  4Y28 E;  4FT2 A;  1K9M U;  2RF0 A;  1FMW A;  1FMV A;  3QUI A;  1BBZ A;  2JMC A;  4PKC C;  2DL5 A;  2DAQ A;  4CC4 B;  2ZPG B;  5FLX E;  2RQV A;  1XTD A;  3I55 A;  2COZ A;  3QZ5 B;  5DLO A;  1TH7 A;  3EGU A;  4NS5 A;  4N4G A;  1ZSZ B;  1B3Q A;  3EG9 A;  4IIM A;  2DL4 A;  3CCS T;  1O75 A;  1VQ5 Q;  3CD6 A;  4CC2 A;  2RI5 A;  2ROL A;  5A0G A;  2YRC A;  4HCZ A;  1UGS B;  3OA6 A;  1G3S A;  3A8L B;  1NJI R;  3ZEH A;  1YCS B;  1FYN A;  1M8M A;  2RHY A;  4OGE A;  2YRV A;  2XI9 A;  3MHX A;  1VQ4 Q;  4GLK A;  4C8Q E;  1VQK T;  2GF7 A;  1U5S A;  1QVG S;  1ZSZ A;  5FWC A;  2DX1 A;  4AG2 C;  3HHT B;  1K73 U;  2HEQ A;  1VQN T;  1QW1 A;  4MZM A;  3QJ6 A;  2OI3 A;  4FCY A;  1KQ2 A;  2LCL A;  3M9Q A;  1ZUU A;  3SHW A;  4A4E A;  2FRW A;  1OV3 A;  2CSI A;  4QQD A;  2FB7 A;  2KYM A;  2X51 A;  2XMF A;  2EGA A;  4PK4 A;  3SWN B;  3M4Y A;  1VQN Q;  1WXU A;  2JZ2 A;  4M78 G;  2FYK A;  2L5Q A;  3CC7 A;  2E65 A;  1U3O A;  3FIF A;  3KUF A;  4QKU A;  2FZG B;  5I11 A;  1VQ6 Q;  1EX4 A;  3MP6 A;  3VS1 A;  3NPF A;  3JB9 H;  3CXC A;  3JB9 F;  4FYX B;  4ZTF A;  5CR2 A;  1PRM C;  2A08 A;  3PMT A;  3M4G A;  1X6G A;  2VGN A;  2DZC A;  4KUD K;  1WHK A;  1CKB A;  1WJR A;  2FPD A;  4FU6 A;  2WAC A;  3LGL A;  4LD9 K;  3PMI A;  2H3E B;  2KRN A;  1KD1 R;  4JLI A;  2OTL T;  2DXU A;  3A8H B;  2F5T X;  4C8Q D;  2ATC B;  2LCC A;  4GLM A;  5KYU A;  5AT1 B;  3RKX A;  1MND A;  5GAN 6;  2ESW A;  2E4H A;  1Q82 C;  1VQO Q;  2E70 A;  2P4T A;  2KY9 A;  2KE9 A;  1X27 A;  2ZPH B;  2HSE B;  4KUI A;  1BI3 A;  2P0K A;  4EMK C;  3A98 A;  2JM9 A;  1JB0 E;  2QDL A;  5CO7 A;  4YTL A;  2MWP A;  2AKL A;  4OMN A;  5HCK A;  2FEI A;  3VS2 A;  1WA7 A;  2M51 A;  5KYN A;  3UAT A;  3FEO A;  3THK A;  1C6V X;  2LRQ A;  2K2V A;  1YIJ Q;  2EWN A;  2SRC A;  4LDX A;  1X2K A;  2LNV A;  1ARK A;  3HKS A;  1PSE A;  2CDT A;  3CCJ Q;  8ATC B;  3L42 A;  3H41 A;  2SEM A;  8AT1 B;  2EJG A;  3UT1 A;  1Y7X A;  4GBQ A;  2BE7 D;  1YWP A;  5GAO q;  3HFO A;  2RI2 A;  3GLX A;  4N0A A;  2RK2 A;  1H3H A;  4J9H A;  1KQS P;  5AYF A;  3INZ A;  5GJV B;  1E7O A;  3OSS C;  4LN2 A;  2WSF E;  2JOY A;  3EGD B;  3EFO B;  3JCM J;  4A63 B;  4BDZ A;  5KYY B;  5A2Q E;  1NJI U;  2LT4 A;  2IG0 A;  4IUQ A;  5FU7 C;  4J6X A;  4M7D D;  5CK9 A;  1KHC A;  2DYB A;  3SDZ A;  3RDV A;  4A4H A;  1JU5 C;  4C0Z A;  3JCM X;  1S1N A;  2V26 A;  4C92 G;  1WHH A;  3RUX A;  3CC2 A;  1UUE A;  1NEB A;  2PVD B;  1U1T A;  4JS4 A;  2OAU A;  4JZ3 A;  2RD1 A;  4OB0 B;  2P4R A;  5IN1 A;  2NLU A;  1YBY A;  4M7A E;  1QVG P;  3CCV T;  3MPU B;  5LJ5 h;  5GAN 7;  2O9V A;  4OMP A;  1KC8 U;  3CC4 T;  2PZ1 A;  2QGF B;  3CCL Q;  4JJC A;  2DXT A;  3CME T;  1G3T A;  4M78 C;  3UPU A;  3MEU A;  4C5G A;  4ME7 A;  3HRS A;  3CCM A;  3VJP A;  5D6X A;  2FG0 A;  5CKD A;  4F16 A;  5C6S A;  4BI3 A;  3JCM Q;  1VQ9 T;  3CCE T;  3QII A;  1VQ7 T;  2K5F A;  1KIK A;  3PTA A;  2X3W D;  2IVW A;  4J6W A;  2AZS A;  2D8H A;  3PIP A;  1Y0M A;  1YJW A;  4ZGJ B;  4C8Q B;  3G4S A;  2MPX C;  5I2M A;  1IGQ A;  3VUZ A;  3CCR T;  2EIF A;  3CMA A;  5CCA A;  3NTK A;  2HL5 C;  4M75 G;  3H0I A;  5GAO r;  5GAO n;  2LJ3 A;  3WVD B;  5FU6 B;  1E6G A;  4M78 B;  2YRD A;  2B8A A;  4RTY A;  1HJD A;  1QMC A;  4EDU A;  3SB2 A;  2KEA A;  1U06 A;  2I2L A;  3HRU A;  3CCS Q;  1J3T A;  1VQ7 Q;  1VQ9 A;  1ZBX A;  4RTW A;  4E7K A;  2M0O A;  3C4S A;  2QEX Q;  2KRS A;  3X25 B;  1RI0 A;  3CCJ A;  2QQ9 A;  1W70 A;  2P0P A;  3G4S T;  4RUG A;  5GJW B;  2HL3 A;  1K8A C;  1QVF A;  2HBW A;  3M0R A;  1T3S A;  2VXF A;  3GPL A;  4M75 E;  4BY6 B;  2D0N A;  2DTI A;  3M55 A;  4M77 F;  2KRO A;  3PVQ A;  2K7A A;  4CRI A;  2CUD A;  1I8F A;  4QQ6 A;  4R0K A;  1XNI A;  3HPW A;  4M75 D;  3G6E Q;  3GBQ A;  1M90 R;  2VB6 A;  3OBW A;  1OZ2 A;  5FU7 B;  5GMK e;  3CD6 Q;  3EFO A;  2DBM A;  1X43 A;  3OMG A;  2X9H A;  5HK3 A;  2CT4 A;  2EQM A;  4Y92 A;  3RR6 A;  3PT9 A;  2LT1 A;  4M78 E;  3TEE A;  5I2S A;  1HYO A;  4C92 C;  1Q7Y U;  3PFS A;  4C0D C;  1I4K 1;  4F7U A;  3OYD A;  3L2Z A;  2AKK A;  3MJX A;  2GFA A;  2LCS A;  1D1A A;  4JRQ A;  2KDS A;  1N8R C;  1M3B A;  3SFM A;  3CC7 T;  4EMH A;  4NOY A;  1RAI B;  1I81 A;  5GAM h;  4R55 A;  4KGX B;  3VYH B;  2F69 A;  4M7D G;  3ER0 A;  2RO0 A;  4BUG A;  1YWO A;  1B7T A;  3M58 A;  3EG9 B;  1QP3 A;  2D0Q B;  2YXY A;  5GAN 8;  3L2U A;  1JQQ A;  2LNH B;  4J7F A;  5KE3 A;  2DYI A;  3RNJ A;  3TSW A;  3BE3 A;  3M0U A;  3M5A A;  1N8R R;  3V8J A;  1F1B B;  2CP5 A;  1AOJ A;  2DL7 A;  1SPK A;  1YI2 T;  2KT8 A;  4PL6 A;  3MKD A;  3TU4 K;  5GMK h;  2X4Y A;  5A0D A;  1VQN A;  2RH2 A;  3JRZ A;  2KSS A;  2YUP A;  2KAF A;  4J9G A;  4M7A D;  5D6W A;  1HSQ A;  2E5Q A;  4MDX A;  2BUD A;  2HZY A;  2QGG A;  1Q86 R;  2QQB A;  1PC0 A;  1VA7 A;  2RJE A;  2DEU A;  2A0F B;  3TRE A;  2MYS A;  4LDV A;  2L3R A;  2K57 A;  3C12 A;  3A5Z B;  4ZGD B;  1Q81 C;  2L3S A;  4Q5W A;  2DD4 A;  1CSK A;  2CZ1 B;  4PJJ A;  5KCH A;  3VU3 C;  3CPW A;  1D1B A;  5GAN 5;  2P0Q A;  3NTI A;  2JUF A;  4OVA A;  3V7S A;  2BE9 B;  1BCM A;  1N5Z A;  3GF5 A;  3CMA T;  1EFN A;  1WX6 A;  2DXC A;  2DIG A;  1PRL C;  2GQI A;  1IB8 A;  1LCK A;  1R8O B;  1X69 A;  1YJ9 Q;  3URG A;  4C92 B;  1C1A A;  4EIK A;  2AK5 A;  4WTO B;  2EJF A;  2NUT B;  2EAY A;  4NL3 A;  4OMF B;  2J7I A;  2QQA A;  1VQ7 A;  4HCK A;  1GCQ C;  5DY9 A;  4DEX A;  1TUC A;  2M0Y A;  3CCE A;  1OPK A;  1Q81 R;  4MDW A;  1YJN T;  4F7U F;  3JAM E;  1W2B A;  2LDM A;  2CYZ B;  2B86 A;  4LUE A;  4N0A C;  2HKQ B;  4ELZ C;  4R56 A;  3JCM b;  5LJ3 j;  2HKN A;  3G71 Q;  3V7C A;  3JV3 A;  1D3B B;  1T0H A;  2Y4Y A;  5LJ3 e;  3S6W A;  2BZ8 A;  3CQT A;  2JS2 A;  5GAM j;  4A4F A;  5HK0 A;  4BI4 A;  3CC4 A;  1B07 A;  1D1C A;  2BKD N;  2LZ6 B;  4PNO A;  1ZUY A;  4A4K A;  1Q86 U;  3T9N A;  3JCM d;  1M9S A;  2CKK A;  1C0M A;  2DJQ A;  4C8Q A;  2ROT A;  2EBP A;  2VGM A;  4M4Z A;  2QQS A;  2DZ9 A;  1SRL A;  3HL8 A;  2E3I A;  4QVZ A;  2COY A;  2EFI A;  3CCV Q;  1MV3 A;  1PKT A;  2L8D A;  2FRY A;  1TS9 A;  4OP0 A;  3DKM A;  3BFM A;  3CPW S;  1WJQ A;  3OYA A;  3QHS A;  2EGE A;  5LJ5 d;  1VQ8 A;  2P84 A;  4QQG A;  1BI1 A;  2OJ2 A;  3GOX A;  4A53 A;  5HY6 A;  5FRM A;  3OS0 A;  1YJN Q;  5EG2 A;  4J6Y A;  2YWW A;  2L2P A;  5J3B A;  3ULR B;  3OYI A;  4M7A A;  4XTX A;  2XDD A;  1VQP Q;  1S72 A;  1PCX A;  1ZSG A;  5FRN A;  3CD6 T;  4XU3 A;  2KXD A;  2RQR A;  1BI2 A;  2VV5 A;  2PNI A;  1IHV A;  2HMA A;  2ENM A;  2HAX A;  2VXE A;  4IUR A;  1GL5 A;  1U1S A;  3G6E T;  2KRM A;  3DB3 A;  2PU9 B;  1WXT A;  2O88 A;  3QPH A;  4PFP A;  4LXC A;  1YP5 A;  4M77 A;  1WPY A;  1LOJ A;  1X2Q A;  4LD6 A;  5CVI A;  4A4G A;  1IRE B;  3QG1 A;  1WQW A;  1UGP B;  2JVV A;  2DJZ A;  2Z0W A;  2XD0 A;  4M7A B;  4XTU A;  3E2U A;  1AZG B;  2MOX A;  2ZCF B;  4M78 D;  2ZPI B;  1NEG A;  3BDL A;  4RTX A;  3X24 B;  1YHQ A;  3PE0 A;  1E6H A;  5GAO p;  4BY6 C;  3VYG A;  1BIA A;  5LJ3 d;  2CH4 W;  1VQM Q;  2OAW A;  4ZN1 A;  1Q95 G;  2DMO A;  1PWT A;  1IHW A;  4M7A F;  4KUL A;  1MMG A;  2OTL A;  1IO6 A;  2QA4 A;  2GNC A;  3OYF A;  3G71 A;  3JCM e;  3ASK A;  2EYX A;  1FWZ A;  3QJY A;  4HA8 A;  2DO3 A;  3OYG A;  4C5E A;  4X34 A;  4AFS C;  4XTW A;  1AWJ A;  4BAC A;  1D0Y A;  3UF4 A;  1K0S A;  2CP6 A;  5I21 A;  3MP1 A;  5LJ3 g;  3VS3 A;  2QXF A;  4BD3 A;  3VUB A;  4ELY C;  3OMC A;  3EG2 A;  1M8V A;  1QCN A;  1NPR A;  2KNB B;  4II1 A;  4L6V 5;  2KT1 A;  1OX9 A;  4QVC A;  3M59 A;  3H8Z A;  3J7A F;  4M75 F;  3PIO A;  1YI2 Q;  3WXM B;  5KH6 A;  1WHL A;  3OS1 A;  3BW1 A;  2QYZ A;  1OQK A;  1TOV A;  1IXD A;  1WZO A;  2PQW A;  3I35 A;  1OPL A;  4HCB A;  1GFC A;  3E9F A;  2M02 A;  4C92 D;  1VQ4 T;  2MI6 A;  5KYX B;  4KRT A;  4AG1 C;  1GXI E;  2MIO A;  4WF2 A;  2ECZ A;  5I22 A;  4E7L A;  4DQ2 A;  1RUW A;  1JJ2 A;  4IIO A;  3L1A A;  4JDS A;  1WJS A;  1QCO A;  4LDU A;  2DFU A;  2R5M A;  1VQK A;  2J6O A;  1AEY A;  2OTL Q;  4K11 A;  2NUP A;  5IHN A;  2DLP A;  4BB7 A;  3KXT A;  5GAM g;  1S72 Q;  4KGZ B;  1RAF B;  4ZTJ A;  2CGH A;  2HBP A;  1ZQ1 A;  2ED1 A;  1K76 A;  2F1L A;  3L2W A;  4M77 B;  1Y07 A;  3CCU Q;  4ZN3 A;  1HK9 A;  2FHD A;  3J81 E;  1OI1 A;  3SD4 A;  2E1H A;  1SEM A;  2RM4 A;  1UE9 A;  2A37 A;  3J80 E;  1QVP A;  2LQ8 A;  1K1Z A;  3GNF B;  3KBG A;  5EC7 A;  5CKB A;  1QCF A;  5GAN e;  2JTM A;  2XDB A;  2Y90 A;  6AT1 B;  1BIB A;  4C92 F;  3SEM A;  5DLQ E;  4J9B A;  3I55 Q;  3LGF A;  4LDY A;  4E7I A;  2A7Y A;  5L23 A;  1B34 B;  4DBH A;  4LNP A;  4JJB A;  1KFZ A;  3REA B;  5HKC A;  4HT9 A;  2DEQ A;  5GAO l;  2XID A;  3C0C A;  3R6N A;  4HXJ A;  1VQ5 A;  1M1K R;  2JXB A;  4D8K A;  2C0O A;  2L3Q A;  4P5N A;  5IT9 E;  2J05 A;  1VQM A;  1PSF A;  4Z89 A;  2XG8 D;  2DL3 A;  4M75 A;  2W0Z A;  4OMO A;  3OYE A;  3VS4 A;  1IGU A;  2K5L A;  2K9G A;  2X3X D;  2CUB A;  3H0H A;  3LWI A;  1P92 A;  1M4Z A;  4GY5 A;  1M2V B;  2LJ1 A;  2VYT A;  4XU1 A;  5CKE A;  1AD5 A;  2KR3 A;  4E2F B;  4RTZ A;  1VQ5 T;  2RB6 A;  1MMN A;  2K3X A;  3OYC A;  1I5L A;  4TVR A;  1VQ9 Q;  2L0A A;  3CBM A;  3R6O A;  1SSH A;  4EMK B;  2CP2 A;  3G71 T;  5KYW B;  2K2M A;  5CIU A;  5ECA A;  4PJO F;  2LJ0 A;  3QYG B;  4CC3 A;  3VS0 A;  2H3J A;  4XQ3 A;  4IUT A;  3ME9 A;  4M7D B;  1WGS A;  2QG9 B;  1TTH B;  4WCI A;  2HNI A;  1UGQ B;  2E10 A;  2L89 A;  2KI7 A;  3CCM Q;  4D8D A;  2X35 A;  2EPD A;  2JW4 A;  4RTU A;  1I5O B;  3S3N A;  4RCC A;  3G6E A;  3EG3 A;  1PKS A;  2M16 A;  3NFC A;  1H92 A;  3E1S A;  3EGX A;  3G1J A;  5GAM f;  3CBP A;  2VAS A;  4J8O A;  2NUT A;  3ZBD A;  1WYX A;  4FSX A;  3P8D A;  5CKH A;  2DK3 A;  4C92 A;  5GAN h;  3OYK A;  3PNW C;  3HP9 A;  3F70 A;  3H6Z A;  2E41 A;  2LQW A;  1RAC B;  1D0X A;  2NUZ A;  2M1H A;  2VWF A;  4M7A C;  3CBO A;  3I56 A;  2AHJ B;  2X4W A;  4XU2 A;  4ANJ A;  1MUZ A;  5GAN d;  2EVR A;  2RHU A;  2RHZ A;  1AVZ C;  2QTV A;  4E6R A;  1Q86 C;  2NYS A;  1VUB A;  1RAG B;  2EJ9 A;  1K8A R;  1SKU B;  4EMG A;  1IRX A;  3O8V A;  4FYV B;  4J9D A;  1NYF A;  5FW9 A;  2G3R A;  5GAN 2;  4RKU E;  3PVL A;  1W6X A;  2FPE A;  4X1V A;  3QDR B;  4FL6 A;  2DM1 A;  1VQL T;  2ZPE B;  4EMK A;  4C92 E;  2R58 A;  1VQP A;  1VIF A;  5LJ3 f;  1VIE A;  2E3H A;  2QDY B;  2YLB A;  2DIQ A;  1EIF A;  4OB2 B;  1UEC A;  4RMO A;  5GAN 4;  5IHI A;  2D8J A;  2IPO B;  2ZZD A;  1V29 B;  4NL2 A;  2O31 A;  1NBE B;  4C8Q C;  1H64 1;  2DTO A;  2LX9 A;  3RKY A;  5GAN 3;  2E6Z A;  4J9E A;  1HD3 A;  1Q7Y R;  5IHK A;  3EG1 A;  1JRI A;  1K9M R;  3VRY A;  2RQT A;  4C8Q F;  1VQL Q;  2YLC A;  3AT1 B;  1KSW A;  3JCM W;  3LX7 A;  2O4X B;  5GAN j;  1VYU A;  1X6B A;  1AZE A;  4BE1 A;  1BK2 A;  4F17 A;  2QQR A;  2RPN A;  5LJ5 g;  1BU1 A;  3JCM h;  2JN0 A;  2K6D A;  1GCQ A;  1ZUK A;  2C0T A;  2O2O A;  1MMD A;  3CCJ T;  2A36 A;  3MCA B;  3G4S Q;  1Y96 B;  4X9C A;  3AHU A;  1R0B G;  2ED0 A;  2WSE E;  1YIJ T;  3CC2 Q;  3CC4 Q;  1JO8 A;  4OGC A;  4PJM A;  4DEY A;  4FYW B;  3OYY A;  1GBQ A;  2FVU A;  2L3P A;  2DXB A;  1WNL A;  1HXD A;  5M9O A;  3JB9 J;  3RES A;  3S3O A;  1RAD B;  2DIL A;  2PUO B;  4DBQ A;  1G3Y A;  1WHG A;  3M54 A;  3A1P A;  3ZFJ A;  3CCR Q;  3UDC A;  1NYG A;  4E47 A;  3A8G B;  4XTY A;  3REB B;  2EKO A;  2AT1 B;  3CPF A;  4M78 A;  1Q82 R;  2E12 A;  1S72 T;  3OYJ A;  1QKX A;  3FJ5 A;  4C0F A;  5FWB A;  3CCQ T;  4LDW A;  5A0L A;  2RI3 A;  3Q1J A;  2QEX T;  1GBR A;  1TWB A;  3A8O B;  2AIR B;  1G2B A;  4N4I A;  1M30 A;  1JBM A;  1VQ8 T;  1PM3 A;  1VOM A;  1M27 C;  2ZPF B;  1V76 A;  1RAA B;  1UJ0 A;  2VKN A;  2RMO A;  2CT3 A;  1T3L A;  4JS5 A;  4KBM B;  3HTR A;  4M75 C;  1ACM B;  4FM4 B;  1TU0 B;  1NE8 A;  2HQE A;  4Z02 A;  5GMK i;  3O5Z A;  2KK4 A;  3JCM f;  1PHT A;  2OTJ A;  1RI9 A;  4LUD A;  3CMA Q;  4FSS A;  3OS2 A;  1VQ6 T;  4DBF A;  4M77 C;  1NLO C;  3RMS A;  4PJO C;  1K8A U;  3OW2 A;  3OW2 P;  2JMA A;  3CC2 T;  3OB9 A;  4ESR A;  1VQ6 A;  1D3B A;  1ZX6 A;  2HQX A;  1UGV A;  5LJ5 j;  2LC4 A;  2MWO A;  4QT7 A;  2KGT A;  4C5H A;  4FW2 A;  2RQW A;  1EZZ B;  3QWX X;  2JS0 A;  2R5A A;  3RER A;  3FB9 A;  3M53 A;  4FYY B;  3OW2 S;  3I9Q A;  3NHN A;  5KE2 A;  2K3B A;  4X9D A;  1FXX A;  4MML A;  3EFS A;  3JB9 D;  1SRM A;  3S3M A;  1K4U S;  3QWY A;  3E19 A;  2GFU A;  4KH1 B;  1KJW A;  4O6J A;  4XTZ A;  4AFU C;  4HT8 A;  1M1K C;  1JEG A;  3OYM A;  3C94 A;  4BI8 B;  2CP0 A;  2DVJ A;  1WIE A;  1QKW A;  3I5S A;  3WVE B;  3OS5 A;  1Q7Y C;  2KXC A;  1KC8 C;  2OTJ Q;  1OUL A;  1GCP A;  4CC7 A;  1LJO A;  2PUK B;  1AWW A;  4XTV A;  3OYB A;  2KVQ G;  3VS5 A;  5LL6 S;  4HKE A;  7AT1 B;  3OYN A;  3P8B B;  5IAY A;  2RJF A;  4C5I A;  1YIJ A;  4JJN K;  5DM7 R;  1TXQ A;  2BTT A;  4XU0 A;  4M7D F;  3RIR A;  1M2O A;  2Y4X A;  3CCR A;  1OU8 A;  3QO3 A;  1UFF A;  2X4J A;  2ZGW A;  3VV0 A;  1CKA A;  5GAN f;  2DKG A;  1SHF A;  4XK8 E;  3CME A;  1Q81 U;  2EYY A;  1N9R A;  1KHI A;  3LW5 E;  3OSV A;  5J26 A;  4L5G A;  2LX7 A;  2HSP A;  4O5V A;  1YI2 A;  2K5I A;  2G6F X;  1M1K U;  1WQ7 A;  3CXC P;  1K9A A;  1KQS A;  2J6K A;  4DA4 A;  1Q82 U;  5D6Y A;  4B9W A;  3VKI A;  2F2W A;  1M90 C;  4F7U B;  2XU8 A;  2PVG B;  1QP2 A;  3TQ7 P;  4FIB A;  1WI7 A;  1ZHI A;  1VQK Q;  4M77 G;  1UJY A;  1UHC A;  1WDX A;  2DRM A;  2OTJ T;  1UEB A;  2HDA A;  3CCV A;  3PGG A;  2O01 E;  3DLM A;  1PNJ A;  2EW3 A;  4HVU A;  1M1F A;  2FZC B;  3DB4 A;  2GQV A;  3MEW A;  1W2B S;  2XHC A;  1KQS S;  2XIC A;  1NPP A;  1Z9Q A;  2WSC E;  1JXM A;  4QW2 A;  3M0P A;  3LH5 A;  2YHT A;  1VQ8 Q;  2DET A;  1VQP T;  3A8M B;  4B9X A;  2RN8 A;  1NM7 A;  4L59 A;  2QEX A;  4M7A G;  1G8X A;  2DRK A;  3CCE Q;  1K9M C;  1KG1 A;  2EGC A;  3M0S A;  3UWN A;  2DVE A;  1OX8 A;  2GGR A;  1A0N B;  4J7I A;  3JCM V;  1M3A A;  2C06 A;  1X6O A;  1NG2 A;  1W1F A;  4PJO D;  4EPC A;  1RAE B;  3P8H A;  4JRP A;  2KYB A;  1GRI A;  3CC7 Q;  2CP3 A;  4JUV A;  2FL7 A;  4J9F A;  2EYQ A;  5GMK m;  1UDL A;  1AWX A;  3LLR A;  3CCQ A;  1M90 U;  1BB9 A;  3JB9 I;  2KQW A;  1TUD A;  1XQH A;  3EG0 A;  1OYX A;  2EYZ A;  2LTO A;  2RJC A;  1XJW B;  2RJD A;  1DJ7 B;  1RLP C;  2JM8 A;  4ZNX A;  1G3W A;  2V1R A;  4Z8A A;  2CSQ A;  4ATO A;  5LJ5 e;  2DNU A;  4C8Q G;  4A54 A;  5LJ5 f;  3UA7 A;  4JPB W;  4RTT A;  1U8R A;  2CZ6 B;  1XOV A;  1QWF A;  1YN8 A;  1LPL A;  1YJW T;  4JZ4 A;  1K73 C;  4KGV B;  1TG0 A;  2CS7 A;  3UA6 A;  4RG2 A;  2J6F A;  1MMA A;  1G83 A;  2H8H A;  2FO0 A;  2MK5 A;  2DER A;  2DL8 A;  1B34 A;  1MHN A;  1ZA1 B;  1ABO A;  4HVV A;  3BY7 A;  2GTJ A;  1BCO A;  2MAM A;  3CCM T;  3JCM c;  4XAX B;  3CME Q;  2QA4 Q;  4PJL A;  5KCO A;  2ZPB B;  4FW1 A;  2ZAE A;  1H3Z A;  3LWH A;  4J83 A;  1AT1 B;  3QBY A;  1AWO A;  1RLQ C;  2K3Y A;  4ORZ A;  1KC8 R;  2HQH A;  5GAO m;  3X20 B;  4VUB A;  1M1G A;  1QLY A;  3CXC S;  2RA2 A;  3GP8 A;  3MP8 A;  4OF1 A;  4AFQ C;  2VC8 A;  3EFR A;  1PG5 B;  1WLP B;  2RQU A;  2NWM A;  2DD5 A;  4QVD A;  3OBY A;  1Y96 A;  1MV0 B;  1WHM A;  1BI0 A;  4IKF A;  1Y71 A;  2GBQ A;  4MZT A;  4OB1 B;  1VYT A;  3EHQ A;  2FPF A;  2RHI A;  4IUU A;  4IUV A;  3H9N A;  4HVW A;  4PJO G;  4IUP A;  5FRO A;  5J39 A;  1KQ1 A;  4E7H A;  2COW A;  2KMT A;  1TSF A;  5L8R E;  2CZ7 B;  2A3L A;  1NLP C;  2LQK A;  2O4X A;  1RAH B;  2JT4 A;  2LQN A;  1YHQ Q;  2BZX A;  2EQU A;  2JJ9 A;  2AZV A;  4HCC A;  1W2B P;  2EYW A;  2GCX A;  3FRN A;  3RBB B;  1VYV A;  4PFZ A;  2KBT A;  3M0T A;  5IXB A;  2DPP B;  1WHJ A;  1YIT Q;  4Z88 A;  4PJO E;  1AHJ B;  2PTK A;  3ZL7 C;  4CI0 C;  5GMK j;  1ZSZ C;  2CRE A;  3QYH B;  4PJO A;  4DBR A;  2LVM A;  1BKB A;  4M7D A;  3OQ5 A;  1N6A A;  2QTX A;  4M77 D;  3SWN C;  1SHG A;  3TSZ A;  3HRT A;  3C95 A;  2D9T A;  2DTH A;  1LVK A;  4RG8 A;  3U23 A;  5KYW A;  4RCB A; 
#chains in the Genus database with same CATH homology
 1O9S A;  3CCS A;  3S3O A;  1U1S A;  2PUO B;  3FJP A;  3G6E T;  2LNV A;  3DB3 A;  1N8R U;  2PU9 B;  3HKS A;  1PSE A;  1G3Y A;  3E9G A;  3M54 A;  3QPH A;  3ZFJ A;  2X4X A;  4F7U G;  3UDC A;  3L42 A;  4E47 A;  3A8G B;  4M77 A;  4XTY A;  1WPY A;  2EKO A;  4BE0 A;  1LOJ A;  3CPF A;  4LD6 A;  4M78 A;  1QVG A;  5CVI A;  4A4G A;  1IRE B;  2XDP A;  3QG1 A;  3CCL A;  1WQW A;  2EJG A;  3UT1 A;  1UGP B;  2JNG A;  2JVV A;  4PJO B;  1Y7X A;  2DJZ A;  2E12 A;  1S72 T;  3OYJ A;  4M7A B;  2XD0 A;  5GAO q;  3HFO A;  2RI2 A;  3GLX A;  3G7Z A;  4XTU A;  4C0F A;  4N0A A;  1VQ4 A;  5CAI A;  3CCQ T;  2ZCF B;  2RK2 A;  4M78 D;  1JJ2 S;  2ZPI B;  4LDW A;  5AYF A;  5A0L A;  1FX7 A;  3INZ A;  4M75 B;  2RI3 A;  3Q1J A;  2QEX T;  3BDL A;  3OSS C;  1YCY A;  3A8O B;  3X24 B;  4N4I A;  2WSF E;  1YHQ A;  5GAO p;  5GAN g;  1RL2 A;  2JOY A;  4BY6 C;  3JCM J;  1JBM A;  1X75 C;  4BDZ A;  2XK0 A;  3VYG A;  3I55 T;  2BIV A;  1VQ8 T;  1BIA A;  5A2Q E;  1NJI U;  5LJ3 d;  2LT4 A;  2ZPF B;  3DLL A;  1LNX A;  2IG0 A;  4IUQ A;  5FU7 C;  4J6X A;  3EAE A;  4ZN1 A;  4JS5 A;  4M7D D;  4KBM B;  4ZGE B;  4M75 C;  4M78 F;  5CK9 A;  1KD1 U;  1KHC A;  4FM4 B;  1NE8 A;  2HQE A;  4Z02 A;  1YIT T;  5GMK i;  4M7A F;  4KUL A;  3SDZ A;  2OTL A;  2KK4 A;  2QA4 A;  3MEV A;  3JCM f;  2OTJ A;  4A4H A;  3OYF A;  3G71 A;  4C0Z A;  3JCM e;  3ASK A;  3JCM X;  3OS2 A;  1VQ6 T;  1FWZ A;  4M77 C;  4C92 G;  5GAM e;  3RUX A;  3RMS A;  1W4S A;  1SSF A;  3QJY A;  4BDY A;  3CC2 A;  4HA8 A;  1K8A U;  2DO3 A;  4BE2 A;  3OW2 A;  3QSU A;  2PVD B;  3OYG A;  1U1T A;  3CCU T;  4JS4 A;  1UB4 A;  2OAU A;  4C5E A;  4X34 A;  4XTW A;  3CC2 T;  4BAC A;  3OB9 A;  2EQJ A;  2RD1 A;  4OB0 B;  4DOV A;  1VQ6 A;  5IN1 A;  2NLU A;  5I21 A;  1D3B A;  1YBY A;  3SWN A;  4M7A E;  4OB3 B;  2QA4 T;  2HQX A;  3MP1 A;  5LJ3 g;  2LC4 A;  5LJ5 j;  3CCV T;  2RK1 A;  2QXF A;  2MWO A;  5LJ5 h;  2V8K A;  4BD3 A;  5GAN 7;  3TCJ A;  2HD0 A;  3VUB A;  4ELY C;  4C5H A;  3CC4 T;  2MMP A;  1KC8 U;  4JLG A;  3OMC A;  1M8V A;  2D6F A;  3HSB A;  1NPR A;  2R5A A;  3LH0 A;  3RER A;  2V8I A;  4II1 A;  2DXT A;  4L6V 5;  3RKW A;  4JRK A;  3CME T;  2K4Y A;  3M59 A;  1G3T A;  4QVC A;  3FB9 A;  3H8Z A;  3M53 A;  3OW2 S;  1KD1 C;  3J7A F;  1VQL A;  4M7D E;  4M78 C;  4M75 F;  5KE2 A;  1M5Q 1;  3UPU A;  4X9D A;  3PIO A;  3WXM B;  3MEU A;  4C5G A;  4ME7 A;  5KH6 A;  1FXX A;  3HRS A;  4MML A;  3OS1 A;  3CCM A;  3BW1 A;  5LJ3 h;  3VJP A;  5D6X A;  4PLI A;  2VUB A;  5CKD A;  5C6S A;  2PQW A;  4BI3 A;  4HCB A;  3EFS A;  3JCM Q;  1VQ9 T;  3CCE T;  3E9F A;  3QII A;  2E6N A;  1X01 A;  3MEA A;  5CQX A;  3CEY A;  4C92 D;  3JB9 D;  1VQ4 T;  2MI6 A;  1VQ7 T;  2K5F A;  3S3M A;  2PVO B;  3PTA A;  3E19 A;  2IVW A;  2GFU A;  3L2R A;  1GXI E;  4WF2 A;  4J6W A;  4E7L A;  3JCM P;  4DQ2 A;  4O6J A;  4XTZ A;  4HT8 A;  3CCL T;  1JJ2 A;  4N4H A;  1M1K C;  1UGR B;  3I56 T;  4M7D C;  3L1A A;  3QZ9 B;  4JDS A;  3PIP A;  1WJS A;  3C94 A;  2F5K A;  4BI8 B;  3OYM A;  3QKJ A;  3OYH A;  1YJ9 T;  4LDU A;  2R5M A;  3WVE B;  1YJW A;  1VQK A;  3OS5 A;  1IZ6 A;  4ZGJ B;  4C8Q B;  3G4S A;  1Q7Y C;  2E64 A;  2QI2 A;  2RHX A;  3GNG A;  5I2M A;  1KC8 C;  3VUZ A;  3CCR T;  4MZP A;  2EIF A;  3CMA A;  1LJO A;  5CCA A;  3X28 B;  3NTK A;  2PUK B;  4BB7 A;  4M75 G;  3OYL A;  5GAM g;  3KXT A;  1N9S A;  4XTV A;  1YJ9 A;  3OYB A;  5GAO r;  4FT4 A;  4C0D B;  2KVQ G;  2CGH A;  2HBP A;  5GAO n;  4ZTJ A;  5LL6 S;  3WVD B;  3JCM g;  2CZ0 B;  4HKE A;  1ZQ1 A;  5FU6 B;  4M78 B;  3OYN A;  3L2V A;  3P8B B;  3L2W A;  5IAY A;  4M77 B;  2RJF A;  4C5I A;  5GMK l;  1Y07 A;  1YIJ A;  2B8A A;  4JJN K;  5DM7 R;  4ZN3 A;  4EDU A;  1HK9 A;  3NTH A;  2FHD A;  3SB2 A;  2I2L A;  3V8K A;  3HRU A;  3J81 E;  4UC4 A;  1OI1 A;  3SD4 A;  4XU0 A;  2E1H A;  1ZBX A;  3RIR A;  1VQ9 A;  4M7D F;  1BYM A;  2RM4 A;  4E7K A;  2M0O A;  2R57 A;  3C4S A;  4PJO C;  2Y4X A;  3J80 E;  3CCR A;  1QVF S;  1QVP A;  1RI0 A;  3X25 B;  3CCJ A;  2QQ9 A;  2X4J A;  3QO3 A;  2ZGW A;  4J5Y A;  2P0P A;  2JTF A;  2LQ8 A;  3FDR A;  3QXE B;  3JSC A;  3VV0 A;  3GNF B;  4F7U E;  3G4S T;  2EQK A;  3KBG A;  2MF2 A;  3V7R A;  5CKB A;  5GAN f;  5GAN e;  2DKG A;  1K8A C;  2JTM A;  4XK8 E;  1QVF A;  3M56 A;  3OY9 A;  3CME A;  1Q81 U;  1N9R A;  2XDB A;  1KHI A;  3LW5 E;  2VXF A;  3OSV A;  5J26 A;  3GPL A;  2Y90 A;  4M75 E;  4L5G A;  1BIB A;  4BY6 B;  4C0G A;  2DTI A;  4O5V A;  4C92 F;  5DLQ E;  1YI2 A;  5GAM d;  3GIB A;  2K5I A;  3M55 A;  4M77 F;  1NJI C;  3LGF A;  3HFN A;  4LDY A;  4E7J A;  4E7I A;  2A7Y A;  3FLG A;  1M1K U;  4MMK A;  4CRI A;  1NZ9 A;  1B34 B;  1WQ7 A;  1I8F A;  3BDU A;  4QQ6 A;  1XNI A;  1KQS A;  5HKC A;  3HPW A;  4M75 D;  4HT9 A;  4DA4 A;  2DEQ A;  1Q82 U;  3OBW A;  5D6Y A;  5GAO l;  1MGQ A;  2XID A;  4B9W A;  3VKI A;  1OZ2 A;  2M9U A;  1M90 C;  4F7U B;  1VQ5 A;  3JB9 G;  1VQO T;  2XU8 A;  5FU7 B;  5GMK e;  3MO8 A;  2PVG B;  2V8J A;  1QP2 A;  3OMG A;  4FIB A;  4P5N A;  5IT9 E;  5C0M A;  4M77 E;  1VQM A;  5HK3 A;  1OZ3 A;  1PSF A;  2EQM A;  4Y91 A;  3PT9 A;  2LT1 A;  2XG8 D;  4M78 E;  3TEE A;  1ZHI A;  5I2S A;  5FU6 C;  4M75 A;  4M77 G;  4C92 C;  3MET A;  1Q7Y U;  3M57 A;  3PFS A;  2OTJ T;  4C0D C;  1I4K 1;  3OYE A;  1UEB A;  5CKF A;  4F7U A;  4PLL A;  3N5B B;  2K5L A;  3OYD A;  3L2Z A;  3PGG A;  2O01 E;  3CCV A;  3DLM A;  2GFA A;  3LWI A;  1M1F A;  4JRQ A;  3DB4 A;  1P92 A;  2GQV A;  3MEW A;  4JRI A;  2XHC A;  1W2B S;  1M4Z A;  2KDS A;  1N8R C;  1G5V A;  4GY5 A;  3SFM A;  2XIC A;  1KQS S;  1NPP A;  4EMH A;  3CC7 T;  4NOY A;  2VYT A;  1I81 A;  5GAM h;  4R55 A;  1VQM T;  4XU1 A;  5CKE A;  3VYH B;  4V2S A;  2F69 A;  2XKO C;  3CCU A;  3X26 B;  2WSC E;  4QW2 A;  1VQO A;  2YHT A;  3FC3 A;  1VQP T;  4M7D G;  1VQ5 T;  3A8M B;  4B9X A;  2RB6 A;  2K3X A;  3OYC A;  1I5L A;  4TVR A;  3ER0 A;  2RO0 A;  4BUG A;  4DOW A;  3V8L A;  4L59 A;  1YHQ T;  3M58 A;  3CBM A;  3R6O A;  4KT0 E;  1N27 A;  4EMK B;  2QEX A;  4M7A G;  1QP3 A;  3LYI A;  3G71 T;  5CQY A;  2D0Q B;  5GAN 8;  3L2U A;  4D6W A;  5CIU A;  4J7F A;  1YIT A;  3RMQ A;  5KE3 A;  3L2Q A;  1K9M C;  1KG1 A;  3UWN A;  2DVE A;  1YJN A;  3M5A A;  4Y28 E;  4J7I A;  4PJO F;  3V8J A;  4FT2 A;  1K9M U;  3QYG B;  3QUI A;  1YI2 T;  2H3J A;  4PL6 A;  4IUT A;  3ME9 A;  4XQ3 A;  3TU4 K;  1WGS A;  4PKC C;  3JCM V;  4M7D B;  2DAQ A;  2C06 A;  1X6O A;  5GMK h;  2ZPG B;  2X4Y A;  5FLX E;  2HNI A;  1UGQ B;  1XTD A;  5A0D A;  2E10 A;  1VQN A;  2L89 A;  4PJO D;  2RH2 A;  3JRZ A;  3I55 A;  2KSS A;  4M7A D;  2KAF A;  3QZ5 B;  5DLO A;  4EPC A;  3P8H A;  5D6W A;  2E5Q A;  2X35 A;  4JRP A;  4MDX A;  1TH7 A;  2BUD A;  4NS5 A;  3S3N A;  2QQB A;  4JUV A;  4N4G A;  4RCC A;  2RJE A;  2FL7 A;  3NFC A;  2M16 A;  2EYQ A;  5GMK m;  3G6E A;  3CCS T;  3TRE A;  4LDV A;  1O75 A;  3E1S A;  3LLR A;  2L3R A;  3CCQ A;  1M90 U;  2K57 A;  3C12 A;  3A5Z B;  4ZGD B;  1Q81 C;  3JB9 I;  2KQW A;  1XQH A;  5GAM f;  4Q5W A;  3CD6 A;  3CBP A;  1OYX A;  2LTO A;  2DD4 A;  2RJC A;  4J8O A;  2RI5 A;  2CZ1 B;  3ZBD A;  5A0G A;  2RJD A;  5KCH A;  3VU3 C;  3CPW A;  4FSX A;  4HCZ A;  1DJ7 B;  3P8D A;  5GAN 5;  2P0Q A;  1UGS B;  1G3W A;  2DK3 A;  5CKH A;  4C92 A;  5GAN h;  3OA6 A;  3NTI A;  1G3S A;  2JUF A;  3A8L B;  4OVA A;  3V7S A;  3ZEH A;  3OYK A;  4ATO A;  5LJ5 e;  3PNW C;  4C8Q G;  3HP9 A;  4A54 A;  3F70 A;  5LJ5 f;  2RHY A;  3GF5 A;  3CMA T;  4OGE A;  2YRV A;  3H6Z A;  2XI9 A;  3MHX A;  2DXC A;  2DIG A;  2CZ6 B;  2E41 A;  4GLK A;  4C8Q E;  1U8R A;  1XOV A;  1R8O B;  2GF7 A;  1YJW T;  1VQK T;  3URG A;  1K73 C;  2M1H A;  4C92 B;  1QVG S;  4M7A C;  3CBO A;  3I56 A;  2AHJ B;  2CS7 A;  2X4W A;  4XU2 A;  4RG2 A;  3HHT B;  5GAN d;  2EJF A;  1K73 U;  4NL3 A;  2EAY A;  2RHU A;  2RHZ A;  1VQN T;  4OMF B;  1Q86 C;  1QW1 A;  2QQA A;  1VUB A;  4MZM A;  1VQ7 A;  2EJ9 A;  3QJ6 A;  5DY9 A;  4EMG A;  1KQ2 A;  3O8V A;  2LCL A;  3M9Q A;  3CCE A;  4MDW A;  2G3R A;  4F7U F;  4RKU E;  1B34 A;  1MHN A;  5GAN 2;  2LDM A;  3JAM E;  1YJN T;  1W2B A;  2CYZ B;  3BY7 A;  4N0A C;  4A4E A;  2MAM A;  3QDR B;  4ELZ C;  3CCM T;  4FL6 A;  4QQD A;  2FB7 A;  4XAX B;  3JCM c;  4R56 A;  3JCM b;  5LJ3 j;  5KCO A;  1VQL T;  2ZPB B;  3V7C A;  1D3B B;  3SWN B;  2ZPE B;  4EMK A;  4C92 E;  4J83 A;  3LWH A;  1H3Z A;  3QBY A;  3M4Y A;  2K3Y A;  2Y4Y A;  2R58 A;  5LJ3 e;  1VQP A;  1VIF A;  5LJ3 f;  3S6W A;  5GAM j;  5GAO m;  2JZ2 A;  4A4F A;  4M78 G;  3X20 B;  1VIE A;  2FYK A;  2L5Q A;  2QDY B;  2YLB A;  4VUB A;  4BI4 A;  5HK0 A;  3CC4 A;  2DIQ A;  1EIF A;  4OB2 B;  3CC7 A;  1M1G A;  2BKD N;  3CXC S;  2RA2 A;  5GAN 4;  3MP8 A;  2E65 A;  4OF1 A;  4RMO A;  3GP8 A;  2VC8 A;  3EFR A;  3FIF A;  3KUF A;  4PNO A;  4A4K A;  1Q86 U;  3MP6 A;  2ZZD A;  1V29 B;  4NL2 A;  2DD5 A;  3T9N A;  4QVD A;  3JCM d;  3JB9 H;  1M9S A;  3OBY A;  1Y96 A;  3CXC A;  3JB9 F;  4C8Q C;  4ZTF A;  1H64 1;  2CKK A;  5CR2 A;  3PMT A;  4C8Q A;  2DTO A;  2LX9 A;  3RKY A;  3M4G A;  2VGM A;  5GAN 3;  1BI0 A;  2E6Z A;  2DZC A;  2VGN A;  4IKF A;  4KUD K;  1Y71 A;  4MZT A;  1WJR A;  2QQS A;  4FU6 A;  2DZ9 A;  4OB1 B;  2WAC A;  3LGL A;  1JRI A;  2RHI A;  4IUU A;  4IUV A;  3HL8 A;  4LD9 K;  3PMI A;  4QVZ A;  4PJO G;  4C8Q F;  2EFI A;  4IUP A;  5FRO A;  5J39 A;  4JLI A;  2YLC A;  1KQ1 A;  2OTL T;  2DXU A;  4E7H A;  3A8H B;  3JCM W;  3LX7 A;  2F5T X;  4C8Q D;  2O4X B;  2KMT A;  2LCC A;  2L8D A;  5L8R E;  5GAN j;  2CZ7 B;  4OP0 A;  2A3L A;  3DKM A;  3BFM A;  2LQK A;  3CPW S;  1WJQ A;  2O4X A;  3OYA A;  3QHS A;  3RKX A;  5GAN 6;  1Q82 C;  2EQU A;  5LJ5 d;  4BE1 A;  1VQ8 A;  2QQR A;  2E70 A;  4HCC A;  4QQG A;  2P4T A;  2KY9 A;  1BI1 A;  2GCX A;  3FRN A;  5LJ5 g;  3GOX A;  3JCM h;  4A53 A;  2JN0 A;  2ZPH B;  2DPP B;  4KUI A;  1BI3 A;  2P0K A;  5HY6 A;  5FRM A;  3OS0 A;  3CCJ T;  4PJO E;  4EMK C;  1AHJ B;  5EG2 A;  3MCA B;  4J6Y A;  4CI0 C;  1Y96 B;  5GMK j;  5J3B A;  3OYI A;  4M7A A;  1JB0 E;  3QYH B;  4XTX A;  5CO7 A;  4X9C A;  2XDD A;  4PJO A;  4YTL A;  2LVM A;  1BKB A;  3AHU A;  1S72 A;  2MWP A;  4M7D A;  3OQ5 A;  2WSE E;  1N6A A;  1YIJ T;  2QTX A;  4M77 D;  3SWN C;  4OGC A;  3FEO A;  2LRQ A;  5FRN A;  2K2V A;  3CD6 T;  3HRT A;  3OYY A;  4XU3 A;  1BI2 A;  2FVU A;  2VV5 A;  2DXB A;  2D9T A;  2DTH A;  2EWN A;  3C95 A;  1WNL A;  1HXD A;  4RG8 A;  2HAX A;  5M9O A;  2VXE A;  3JB9 J;  4IUR A;  4LDX A;  3RES A;  4RCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...