3SWNA

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
b'TILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 14
structure length 76
sequence length 76
chains with identical sequence D, P, S
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnA00
1WQ7A 5GAMh 4EMKC 3V7CA 2DXTA 5GAMe 4M78G 4F7UG 2HNIA 2YLBA 4XTYA 1M8VA 1U1SA 4J6XA 5GAN4 4XTZA 2RB6A 2EJFA 4XU3A 1MGQA 5GAOq 3BY7A 4M75G 3RKXA 5LJ3j 4XU0A 3SWNA 4C8QB 5LJ5f 4M7DG 3RUXA 5GANf 5GAMd 3JCMc 5GMKj 1BIBA 4M78C 4XU2A 3JCMV 3BFMA 4EMHA 5CAIA 1Y96B 4HT8A 4MMLA 5GAOr 3JB9F 5I21A 3FIFA 2RM4A 3V8LA 2DXUA 1B34B 2YHTA 1BIAA 4M78E 5GAN8 3JCMW 5LJ5h 4M75C 4C8QG 4EMGA 5LJ5e 2CGHA 4M7DC 5GANe 3HFOA 2E1HA 4HA8A 5GAMg 4EMKA 5GMKm 4C92F 3JB9I 2DTHA 4M7DE 1D3BA 4QVCA 3GIBA 4M7DF 3JB9D 1JBMA 1YCYA 2EJ9A 2YLCA 2JN0A 4M7AB 2DVEA 4M77B 4C8QC 2VC8A 4JLIA 5LJ5d 3RERA 1I4K1 3JB9J 5GANd 2EWNA 3FJPA 3SWNB 4NOYA 3INZA 4V2SA 2DKGA 4XTXA 4HT9A 4J6YA 3JCMf 4C92D 4M7AE 4A54A 2DTIA 2EAYA 4C92A 4M7AG 4RCCA 4M77G 3V8JA 1H641 5LJ5g 4M7DD 3EFRA 4F7UE 3RKWA 4N0AC 4A53A 1WPYA 5GANg 4M7DA 4M78F 3BW1A 4OP0A 1LOJA 4NL2A 1WQWA 4XTVA 4XTUA 4F7UF 3JCMb 5LJ3f 4J6WA 5GAMj 5GANh 3QO3A 5GAN2 1X01A 4PJOB 1I5LA 2E10A 4M75E 4X9CA 4XQ3A 2VXFA 4M75F 1D3BB 3QHSA 2DZ9A 3JCMQ 2RA2A 3SB2A 3JCMX 4M77C 1KQ2A 2ZGWA 4M7AC 2RD1A 3HFNA 3L1AA 5GAN7 2K57A 3EFSA 4JRIA 3SWNC 5GMKl 3M4GA 4PJOG 4J5YA 1HK9A 2DTOA 4M77E 1KQ1A 5DY9A 5LJ3e 5GAOm 1TH7A 4M78D 4XTWA 5GAMf 4M7AF 4M77F 1LJOA 3PGGA 3JCMd 2EJGA 3JCMP 4MMKA 4M78A 4C8QE 4F7UA 4Y91A 4C8QF 2DJZA 3HSBA 2I2LA 1U1TA 5GAN5 4C92B 4M75D 5LJ5j 3JB9G 3JB9H 4N0AA 3V7SA 3RESA 3RKYA 2DZCA 4M75A 5GAOn 2FYKA 4NL3A 5GANj 5LJ3d 3V7RA 5GAOp 4PJOC 2E65A 2Y90A 3JCMg 5GAN3 3RIRA 3FB9A 3JCMh 4EMKB 4M7AD 4M77D 3JCMe 1WNLA 4PJOE 4PNOA 4C92G 4DQ2A 4M7AA 4PJOF 4M77A 1HXDA 4C8QD 5GMKi 2E64A 4XU1A 4C8QA 4JRKA 3QUIA 2VXEA 5LJ3g 3V8KA 4QVDA 4JUVA 5LJ3h 2E41A 4WF2A 4X9DA 3VU3C 3JCMJ 3AHUA 4RCBA 1Y96A 4M78B 4F7UB 1LNXA 5GMKh 5GMKe 2DEQA 1B34A 4C92C 3QSUA 3L2ZA 1JRIA 5GAN6 2FB7A 1M5Q1 1N9SA 4PJOD 2QTXA 3BDUA 5GAOl 1N9RA 4M75B 4C92E 4PJOA 1I8FA 1I81A 4M7DB
chains in the Genus database with same CATH superfamily
1WQ7A 2DXTA 2YUPA 3HTRA 2HNIA 4XTZA 2COZA 2EJFA 1NEGA 3M0PA 2KRSA 3OYKA 2OAWA 1Y96B 2DXUA 5FW9A 4F04B 2JMCA 2A37A 1RI0A 2KE9A 2NUTA 2QTVA 2DNUA 1M90U 3CBMA 3QJ6A 1UHCA 1ZSZB 4N4IA 1M1KC 4CC7A 5LJ5d 2GBQA 4CRIA 3CCST 3S3OA 3INZA 2HKNA 3CCSA 2LJ3A 2EYYA 5FRMA 2AIRB 3URGA 1KD1U 4FT4A 2RMOA 4BE0A 5D6WA 2FZGB 1SRLA 2LCSA 4M7AC 1PRLC 1WHLA 1NJIC 2OTJQ 3HFNA 1UGPB 5GMKl 4KBMB 3LX7A 2F5TX 5GAOm 4M77F 3E2UA 4MMKA 2J6FA 2I2LA 5IHKA 5GAN5 1UGVA 3OYNA 3JB9H 3V7SA 2DZCA 3PE0A 2QQBA 1M1KU 2H3JA 3CCUQ 2GCXA 1K8AR 1GXIE 2DL4A 4PJOE 1K4US 1K0XA 4J9FA 1SEMA 2LQKA 3QPHA 1B07A 1C1AA 2VXEA 3V8KA 4C5HA 4QVDA 3H9NA 2EQIA 1X2KA 4FU6A 2DEQA 4C92C 3GPLA 3OYHA 2FL7A 2AT1B 1VIEA 2GF7A 3M56A 1F1BB 1MHNA 1M3BA 3EGXB 4OMQA 4LDVA 3E1SA 4OMMA 1MGQA 1KQSP 1TUDA 2RQUA 3I5SA 3VS4A 3NHNA 5M9OA 1JJ2P 3QKJA 2CT4A 2DILA 5KYUB 2MOXA 4QVZA 1UGQB 4DOWA 2DVJA 4J9GA 1K0SA 1NE8A 4IUQA 4HA8A 5FWCA 3P8BB 4BE1A 3META 4M7DF 3CD6T 2DVEA 1OX8A 2K2VA 2RQTA 3OBWA 3H0HA 2CP6A 4OB0B 2COWA 2HZYA 1A0NB 1XQHA 3CPWA 2RHXA 3EG2A 3EH1A 5DLQE 2DERA 3CBPA 3J80E 1LCKA 1VYVA 2R5AA 3EAEA 4BACA 2RHYA 4ZN1A 3FLGA 1OPLA 4JRQA 2NUZA 4C0GA 2XD0A 4Y28E 1R77A 4M75A 1QCOA 5FROA 1WGSA 2HQXA 2CZ0B 1WNLA 4PLIA 4PNOA 4BY6C 5LJ3g 4ZTJA 1SHFA 4KRTA 1D0XA 4PFZA 3TU4K 4FYXB 3EFOA 1B34A 2GGRA 2EQMA 3L2ZA 2E12A 1U5SA 1M4ZA 3MEVA 1T3LA 3FEOA 3Q1JA 5GAMh 2CDTA 2YLBA 5GJVB 1FMVA 2LJ0A 4JZ4A 4LDYA 1YIJT 1Q82U 4EPCA 4XU0A 1YIJA 2OTLA 5D6XA 1PKSA 3GNFB 4RMOA 4BI8B 3V8LA 2P4TA 3TEEA 1QMCA 4DEYA 5IXFA 1D09B 3D7SB 5GMKm 5CR2A 2O4XB 3J7AF 1MMGA 2DTHA 2DIQA 4QVCA 3QYGB 3JB9D 3CCEQ 1WXUA 2EJ9A 3CMET 1KC8R 3CMEA 2EWNA 4O6JA 5CO7A 3KUFA 2JUFA 4J9IA 2W10A 2DPPB 1Q81C 3JCMf 4A63B 1MMNA 5LJ5g 1WPYA 3A8GB 4NS5A 2E5KA 3G1JA 3MO8A 4FW2A 3OYGA 3QO3A 2P0QA 1TWBA 2D1XA 3DB3A 4X9CA 5KYWB 2HD0A 5LL6S 2KI7A 2RQVA 5A0GA 5KYXB 2JZ2A 1KQSS 3M55A 3OYFA 1KIKA 2RJEA 3TVTA 3SFMA 3CC4Q 5A0DA 2X4XA 4IUTA 1AWOA 1FMKA 1JJ2S 4M7AF 2EJGA 4A4EA 4F7UA 1NG2A 2ED1A 2G3RA 2JT4A 1QWEA 3JB9G 3THKA 1J3TA 2CUBA 4CC3A 2KK4A 4FYYB 4E47A 4AFSC 1VQMQ 3FB9A 1M1FA 1K9AA 1Q81U 4C8QD 4ORZA 2OX7A 4L59A 1WHHA 2KBTA 3MJXA 3UPUA 1JQQA 2DK3A 2C0TA 1G2BA 2O9SA 4C0DC 3OS1A 1IHVA 3C0CA 1XOVA 5CKBA 2LRQA 3EHRA 3RNJA 3BDUA 1N9RA 1UFFA 2DLPA 1OX9A 4JDSA 2M16A 2DMOA 3E9GA 2K5FA 1P92A 4XU3A 2QASA 2HQHA 2K3XA 1RAFB 4E7LA 1TXQA 2DXBA 2F2VA 1EZZB 3QYHB 1BIBA 2AKLA 3OS0A 5CAIA 1G83A 1TOVA 4C8QG 1O9SA 3F70A 5GANe 3CCVQ 1X6BA 2ZCFB 3EG9B 1JBMA 1GBQA 1FXXA 3L2RA 7AT1B 4L6V5 1W4SA 1VQKQ 3HL8A 3SWNB 4BDYA 1UHFA 1VQPT 4RTXA 4XTXA 1X27A 1VQPA 1X43A 2YRDA 2IIMA 2DTIA 1WX6A 4A4HA 1IHWA 4ESRA 4RKUE 2JXBA 1BCOA 1AVZC 3JCMb 2XDPA 5FU7B 2BZ8A 3CPWP 2ZPHB 4CC2A 2PZ1A 2NLUA 2LVMA 1N5ZA 1H3ZA 3A8MB 2EKHA 4KH1B 2EPDA 2DAQA 4DOVA 4HT8A 5DY9A 2K7AA 2JTEA 3HKSA 2VKNA 3OYEA 4M78A 2I0NA 4D8DA 2DJZA 4KH0B 1Q86C 1HJDA 5GANj 2BZYA 4ZGDB 2X3WD 2E65A 2F5KA 3CMAT 2YRCA 4DA4A 3CMAA 1X6GA 3A8LB 1W70A 1GCQC 2PVGB 2QQAA 3PMIA 4IUUA 3CCMQ 4PFOA 1K76A 2CYZB 3RBBB 1LPLA 1WLPB 5GMKe 1C6VX 1WI7A 4E2FB 5GAN6 4J83A 4ELYC 2EBPA 1MNDA 4KGVB 2CS7A 2RH2A 1AD5A 5FU6B 3QWYA 5EC7A 4LNPA 3OA6A 1I1JA 1YFNA 4BB7A 2K5IA 1YN8A 4UC4A 3MEWA 5GANf 1K73R 5KCHA 3P8DA 2NYSA 2ZPFB 1E6HA 4EMGA 2NUPB 1CSKA 2CZ1B 4JJCA 4C0ZA 1R0BG 1UTIA 2XU8A 3G71T 1UB4A 1NZ9A 2KAFA 2XI9A 3CCJQ 3C12A 2NWMA 3G71A 1H8KA 1H3HA 4C8QC 3I56T 2O31A 2Y4YA 2KT8A 2LT4A 3I56A 1AWXA 4A4GA 1BCMA 3HRTA 3VYGA 4PK4A 1KC8U 4A53A 2O2OA 1VQNQ 4OGEA 2NUTB 1HD3A 1NYGA 2E10A 4II1A 2HKQB 1RL2A 1KJWA 2V1RA 1AZGB 2PQWA 4M75F 3JCMX 3LYIA 3MP6A 2D8HA 8ATCB 2VUBA 3CC7Q 4PJLA 3L1AA 4K11A 4PJOG 1ZA1B 3LH5A 1AZEA 2RHUA 1O75A 4C8QE 1Y71A 2EW3A 2DBMA 3G7ZA 4Z89A 2M0YA 3OYJA 5GAOn 2LZ6B 3OY9A 2IPOB 4QKUA 2Y90A 4MDXA 4DBQA 5I2SA 4RTYA 5L8RE 1GRIA 2GTJA 2RPNA 1PC0A 2R58A 1YCSB 1AWWA 3UT1A 3PIOA 4IIOA 4C0FA 1W2BA 4PJOA 2BZXA 2RNAA 1MV3A 3CPWS 1S72Q 2VWFA 4JLGA 3M58A 2RB6A 3SD4A 4JJBA 2EGEA 3RUXA 1UECA 2QXFA 4EMHA 3BFMA 3ER0A 4DBHA 1YJWQ 4MMLA 2RM4A 4C5EA 5GAN8 1OULA 2XMFA 1ACMB 3HFOA 2E1HA 4DBRA 2JS0A 3J81E 3WVDB 4RG8A 1YI2Q 2QAZA 1G3YA 1M2OA 1ZQ1A 2CZ7B 4FYVB 1KD1C 3DLLA 2MCNA 4NOYA 3G6ET 3QIIA 4OMOA 3LGLA 3G6EA 3L42A 1X69A 1VQLT 4J9EA 4C92A 2L8DA 2LCCA 3UATA 1SRMA 1VQLA 3RKWA 1Y57A 4KGZB 3R6OA 1G3TA 4OP0A 4F7UF 1YJ9T 1NPPA 3A8OB 1YJ9A 3PVQA 3PT9A 1WFWA 2DRMA 1Q95G 3SB2A 1V29B 4IUVA 3E19A 2E3HA 4M4ZA 2K57A 1RAHB 3M53A 2DBKA 2JS2A 1FYNA 5LJ3e 4LD9K 1PHTA 1QP3A 2ABLA 2PUOB 3PGGA 2ATCB 3ZL7C 2DETA 1QP2A 4OMFB 1U1TA 1M2VA 3RMQA 4B6MA 4LDXA 4E7SA 3RKYA 1AOJA 3I5RA 4PJOC 3CBOA 2PU9B 3H0FA 2XHCA 1VQ4Q 1QKWA 4EMKB 2QEXT 2E70A 1E7OA 3CCET 2QEXA 3L2QA 1Y7XA 2O88A 2KT1A 3M0UA 3KFVA 4X9DA 3CQTA 2A0FB 4E7KA 4BUGA 2RHIA 1WJSA 2J06A 2K5LA 3JV3A 3UA7A 2RJDA 4M75B 3S3MA 3CCRT 1I81A 1QVFP 2L3QA 3CCRA 2EGCA 3QDFA 2D8JA 4AMCA 5LJ3j 2C0IA 4R0KA 3I35A 3ZEHA 3EHQA 3M59A 2ROTA 4E7JA 1K9MC 2BE7D 1YWOA 1B34B 3EFOB 3AT1B 4XK8E 3JCMW 5LJ5e 3G4SQ 2QA4T 3VS5A 3CCQT 4JJNK 2QA4A 1ARKA 1VQMT 1SG5A 2V8JA 2WSCE 3CCQA 3OSSC 2KGTA 4EDUA 2YLCA 4HCKA 1VQ5T 1JB0E 1FX7A 2VC8A 4RTVA 1VQ7T 2DYIA 1VQ5A 3VS3A 3LWHA 2QQSA 1VQ7A 4V2SA 1ZX6A 2EFIA 1PWTA 2HL5C 3DB4A 3C94A 4R56A 2P0PA 2JM8A 1QLYA 2WSFE 4M78F 2X4JA 1N8RC 5LJ3f 3EG1A 1KHCA 1UJ0A 4D6WA 1VQ9Q 3I55Q 3ASKA 1K9MU 4IURA 2JOYA 2GTOA 3CD6A 4XAXB 1BK2A 5EG2A 4Y91A 1WHMA 1JEGA 5LJ5j 3M54A 3CXCA 1QVGP 1Q7YU 4GY5A 4LDWA 2C0OA 5CCAA 1MV0B 2DA9A 3JCMe 3BE3A 1ZSZA 2FO0A 3GOXA 4J9BA 1HXDA 2QDYB 1M30A 1IRXA 2A08A 2DJQA 4WF2A 1KK7A 3VV0A 2MWOA 2DL8A 2LQNA 4F7UB 1N8RU 1BI3A 4E7ZA 1Q82C 4AFQC 3BDLA 3REBB 3CCLQ 2IVWA 3OW2P 3EGUA 2DF6A 1N6AA 4XTYA 1VQOT 1YBYA 3OYAA 2MI6A 1RI9A 2VVKA 1VQOA 2SEMA 2CZ6B 5LJ5f 3T9NA 3JCMV 5CVIA 4HCBA 2G6FX 2M9UA 1NLOC 2X9HA 4AFZC 1WXBA 3UWNA 3OYIA 2GQVA 4WCIA 4HKEA 1S1NA 1XJWB 1D3BA 1X2QA 3M0SA 3LLRA 5J39A 3CCMT 1YITT 4M77B 3LW5E 1YITA 1AEYA 2H8HA 1W6XA 1QKXA 3GLXA 5D6YA 1SKUB 4JS4A 2KDSA 1LOJA 4NL2A 2R5MA 2RI5A 3GNGA 4A4FA 2PUKB 3ZFJA 4XQ3A 1QVFS 3FJ5A 2V1QA 2DD5A 2KEAA 1ZSZC 1KQ2A 2DL3A 1WDXA 1ZUKA 3CCSQ 1HK9A 4KGXB 2KRNA 1EIFA 3I9QA 2DL7A 1ZUUA 4NL3A 2KYMA 4WTOB 1K8AC 4KUDK 3CCJT 1VQ8T 4M77D 2XK0A 3REAB 3SDZA 4PJOF 1SF9A 1VQ8A 1JO8A 2PVDB 1TUGB 1U8RA 3QXEB 2CUDA 3CC2T 2F1LA 1X6OA 3CC2A 4M78B 5GMKh 1M3CA 5IXBA 4FSSA 1LVKA 2FB7A 4BI4A 1VQNT 3M57A 1VYUA 4M7DB 3MHXA 4FT2A 1BI0A 2SRCA 1M8VA 1ZA2B 1WHJA 4ZN3A 5GAOq 3BY7A 1BKBA 2KNBB 1IGUA 5GAMd 2RO0A 5A0LA 1K8AU 3X25B 1D1CA 3L2WA 4L5GA 5CIUA 2EYQA 1BIAA 1WHKA 1IZ6A 2DXCA 1QVGS 1WA7A 4OGCA 1PG5B 4E7HA 5IAYA 4C92F 4MDWA 2LQWA 3GIBA 1GCQA 1KSWA 2AHJB 2A7YA 5FWBA 4OMNA 1C0MA 4JZ3A 4C5IA 4J6YA 3VUZA 1E6GA 1OZ3A 1GFDA 2ED0A 2XKOC 3JRZA 4RCCA 4M7DD 2QK0A 3HHTB 3BW1A 4FM4B 1VQ6T 3OW2S 4ZTFA 1VQ6A 1JXMA 1YHQT 3QHSA 3TSWA 3OYYA 1YHQA 2RD1A 1UE9A 1UJYA 4HVUA 1TH7A 1YJWT 2BTTA 1YJNT 2RHZA 2GQIA 1YJNA 2LP5A 5J3BA 2HEQA 2O4XA 2ROLA 3L2VA 1NPRA 4FL6A 3VUBA 3PTAA 5GMKi 2PNIA 3HP9A 4C8QA 3PIPA 2HMAA 3NGPA 2KROA 3FDRA 2CH4A 1M90R 4RTZA 3NTIA 2CSIA 3LGFA 2OI3A 3EH2A 3ZBDA 2V8IA 4AG2C 1FWZA 3H41A 3JAME 1D0ZA 3GBQA 2MYSA 1KD1R 2LTOA 4GLMA 2HBWA 5ECAA 5L23A 2W0ZA 2HL3A 2XIDA 3FIFA 1BI2A 2D6FA 1RACB 2AZSA 4ELZC 3PVLA 1B7TA 2CGHA 4MZTA 1VQ4T 3QBYA 1OYXA 3JB9I 1KC8C 2ZPBB 5C6SA 1YIJQ 2OTLQ 4M7AB 2OTJT 2O9VA 2YUNA 1I4K1 2OTJA 2QYZA 1M1KR 1RLPC 1ZHIA 1ZLMA 4A54A 1ZSGA 3NTHA 4Q5WA 3VS1A 1T3SA 1WQWA 3DLMA 3CCUT 5KYYA 4JRPA 1OPKA 1OI1A 3CCUA 3JCMQ 2LDMA 2ZGWA 3CMEQ 3EFSA 2JVVA 2EGAA 3WXMB 3M4GA 4J9HA 4M77E 1KQ1A 1NJIR 5GAMf 4RTWA 3JCMP 3A98A 2YWWA 4C92B 2RQRA 4F14A 2DIGA 2CSQA 1OZ2A 4OF1A 1M27C 3RIRA 1KQSA 4M7AD 1I07A 3QUIA 3IQLA 4KUIA 5KH6A 3VU3C 2MMPA 2DD4A 5I22A 2MAMA 4OB3B 1YWPA 2YUOA 5CKEA 1OOTA 1M2VB 1OV3A 5HY6A 1UEBA 2FZKB 2LNVA 1BYMA 4RTTA 2FPFA 2KY9A 3V7CA 4D8KA 4A4KA 5KCOA 4HCCA 1QCNA 2VB6A 1ZUYA 3OS2A 4DEXA 4IIMA 2FPEA 4QT7A 3X28B 1ABOA 4X1VA 2DX1A 5I21A 4OB1B 2RK1A 2PVOB 1RADB 3P8HA 4M78E 5LJ5h 2JW4A 1PNJA 3VS6A 5GAMg 1WJRA 2LX9A 2FEIA 4M7DE 3MPUB 3MEAA 5GJWB 4F17A 4PJJA 2VGMA 1KG1A 1SHGA 2QGGA 2CP3A 2DM1A 2B86A 2B8AA 4BDZA 3M9QA 5A2QE 2DO3A 3OS5A 3CCLT 4TVRA 1MMAA 4J6WA 2YXYA 4AFUC 2RI2A 2RJFA 1BU1A 2HCKA 3A1PA 5I2MA 4MZMA 3SWNC 1WZOA 4BY6B 3NMZC 3JCMJ 1VQPQ 2KYBA 2KRMA 3X20B 3HSBA 5IH2A 4N0AA 1VIFA 1WYXA 5FU7C 2A28A 1VYTA 2JNGA 2EQJA 4RTUA 2YUQA 4ANJA 3JCMh 3OYDA 1TG0A 1G3WA 3MEUA 3OB9A 2J6OA 2QQ9A 3OBYA 2QDLA 1BI1A 1PRMC 2P4RA 4QW2A 4Z8AA 4BE2A 2PTKA 3VS2A 2L3RA 1N9SA 1OQKA 2VASA 3CMAQ 2M1HA 4X34A 2ECZA 3A8HB 5CQYA 5GAN4 3DKMA 2HSEB 3GP8A 2D0QB 3CCEA 2BE9B 1K73C 2HAXA 2LCLA 3JB9F 2RQWA 4YTLA 4BI3A 5J26A 2D0NA 2OJ2A 3VKIA 2DFUA 2E3IA 2P84A 1Y0MA 1I5OB 2FPDA 5FU6C 1XTDA 1JU5C 2EQKA 2QI2A 1WJQA 2HBPA 2ZAEA 2JMAA 5CKDA 5CKFA 2FVUA 3RERA 2FG0A 4JLIA 3JB9J 4R55A 2JTMA 2AK5A 3FJPA 3CC4T 3OYLA 4HT9A 3TCJA 3CC4A 4FW1A 1ZBJA 2EAYA 1U06A 1Q81R 1M3AA 1H641 2AZVA 1IO6A 4N0AC 1GFCA 3EGDA 3M5AA 1TTHB 4JS5A 5GAN2 3UDCA 3G71Q 1PD1A 1UGRB 1K73U 1D3BB 3QDRB 1RAEB 1VQMA 1Q7YC 2K2MA 2MIOA 3TREA 3I56Q 2JM9A 1PM3A 4J5YA 4M7AE 2DTOA 4LUEA 3O5ZA 2CREA 2QGFB 3UF4A 4B9WA 3JCMd 1VOMA 3PMTA 3HRUA 4C0DB 4C8QF 4BD3A 1I0CA 4M75D 1BB9A 1NJIU 1T0HA 2FHDA 3V7RA 3OMCA 3VRZA 2BIVA 2CKKA 1X75C 2E6ZA 2RJCA 2L0AA 3A5ZB 2CP7A 2JJ9A 3HPWA 2K6DA 2L89A 2LJ1A 3S3NA 3AHUA 4RCBA 1Y96A 1LNXA 8AT1B 2LNHB 3QSUA 3H6ZA 3OYMA 1M5Q1 3X24B 1GCPA 4C92E 2FRWA 2ZPIB 3CCVT 2QG9B 2DYBA 2EKOA 3CCVA 4OMPA 4E7IA 4M75G 5CK9A 2ZPGB 4OVAA 1VQKT 2COYA 1CKBA 1VQKA 4LUDA 3H8ZA 5FLXE 1AHJB 2YHTA 1NLPC 3OYBA 4HVWA 2X51A 1QVPA 2MK5A 2VV5A 5HK0A 4EMKA 1W2BP 1PD0A 1IGQA 3M0RA 3M0TA 1YCYA 2J6KA 5IT9E 5CQXA 5IN1A 2DKGA 2EQUA 1AWJA 2EYZA 4IUPA 4J9CA 1IREB 2XDDA 2XDBA 3MP1A 2GFAA 4N4GA 3EFRA 3WVEB 1R0CB 3MKDA 5GANh 1WXTA 2L5QA 1MNEA 1X01A 2F69A 5DM7R 2VXFA 2RI3A 2KQWA 4J7IA 2GFUA 2L2PA 2BKDN 3MCAB 1B3QA 4P5NA 4ATOA 3CCMA 1EFNA 3G6EQ 3CEYA 4LDUA 4Z02A 4LN2A 2FRYA 3OSVA 2KSSA 1VQLQ 4GLKA 3U23A 2Z0WA 1Z9ZA 1R8OB 1K1ZA 1YJ9Q 1SPKA 3EGXA 3QJYA 1Q86R 2HQEA 2C06A 5IHIA 2CH4W 2CP2A 4JJDA 1H92A 4PL6A 2OTLT 2RF0A 3C4SA 2E64A 1V76A 4XU1A 4OMLA 4JUVA 2E41A 5KYUA 2ZPEB 1G8XA 3M4YA 1JXOA 2OAUA 1JRIA 5D7UA 5CKHA 2EVRA 2KR3A 2LX7A 4EIKA 1OU9A 4EMKC 4F7UG 2QEXQ 5DLOA 2J7IA 1KHIA 1U1SA 2K9GA 3CCJA 4GBQA 2K3YA 4C8QB 1TUCA 1G3SA 2ZZDA 1D0YA 4XU2A 2DL5A 2HDAA 3RR6A 4M75C 4FIBA 3OQ5A 1Z9QA 4PJMA 3CCRQ 1VQNA 5AT1B 1YNZA 4HVVA 2EYWA 2CT3A 1UGSB 2M0OA 2X4WA 3CC7T 2IG0A 2MWPA 5GANd 3CC7A 2KMTA 4OB2B 4MZPA 1OU8A 3RMSA 4J8OA 2R57A 4M77G 1NM7A 1MMDA 4KULA 4DBFA 1NBEB 2QA4Q 1GBRA 3CCQQ 4PJNA 4M75E 3RDVA 4PKCC 2RA2A 4Z88A 3S6WA 1VQ5Q 4RG2A 4FCYA 5HKCA 4JRIA 1VQ7Q 2LQ8A 3CPFA 2WSEE 2HSPA 4M78D 1WIEA 4PLLA 1RUWA 3OYCA 2LMJA 4QQGA 4HXJA 3RESA 3O8VA 2CP5A 3VS7A 3JCMg 5KYYB 2J05A 1S72T 1W2BS 1BBZA 4DQ2A 2EIFA 1S72A 4M77A 5HK3A 3CD6Q 3OMGA 4C5GA 2L3PA 3TQ7P 2E6NA 1VUBA 2DRKA 3H0IA 1DJ7B 3MP8A 1YJWA 3LWIA 3QG1A 3NTKA 9ATCB 2YT6A 1SSFA 3KBGA 3GF5A 2DE0X 2JTFA 3CXCP 2K4YA 1UUEA 5GAMe 3SEMA 4M78G 1YI2T 2KVQG 6AT1B 5KE3A 1YI2A 4J6XA 1UG1A 3NPFA 2V26A 2BUDA 3UA6A 4M7DG 1CKAA 3L2UA 2V8KA 2F2WA 1GL5A 1HSQA 1PCXA 3E9FA 5C0MA 2Y4XA 1ABQA 2EYXA 1AT1B 1QQJA 4QQDA 1RAIB 4LXCA 1PSEA 2X3XD 2LC4A 5KYWA 4ZNXA 4FSXA 1VQOQ 4HCZA 1W1FA 4IKFA 5KYXA 1PKTA 3VS0A 2P0KA 4AG1C 4ZGJB 3ULRB 2ESWA 2YSQA 3PFSA 2H3EB 3V8JA 2F2XA 2KXCA 4F7UE 4J7FA 5HCKA 4M7DA 2K3BA 3FC3A 4XTVA 5GAMj 5AYFA 3EG0A 2D9TA 4PJOB 1I5LA 1TSFA 1OEBA 2LT1A 1VQ4A 1NYFA 1YITQ 4M77C 4N4HA 4LD6A 2YRVA 2WACA 1IB8A 2MPXC 4KT0E 4RUGA 1LJOA 2VYTA 2XG8D 1TS9A 2O01E 1G5VA 4LE9A 1QVFA 3M0QA 1HYOA 2FYKA 3TSZA 5GAN3 3EG3A 1RLQC 3NFCA 4ME7A 4CC4B 4O5VA 1WHGA 4ZGEB 3QWXX 2X35A 1RABB 1SSHA 4JRKA 1Q86U 5LJ3h 5I11A 4AT1B 4JPBW 1M1GA 3QZ9B 4Y92A 2A3LA 3SHWA 2A36A 4PJOD 5GAOl 2K79A 3G4ST 1I8FA 1M9SA 1RAAB 3G4SA 3EG9A 5KE2A 1VQ8Q 3LH0A 3QZ5B 2MF2A 1JJ2A 3RKXA 3SWNA 3HRSA 2RK2A 1NEBA 3CC2Q 3JCMc 5GMKj 4M78C 5GAOr 1TU0B 1D1AA 2QQRA 1V1CA 1K9MR 2ENMA 3PNWC 4VUBA 4CI0C 2YDLA 4M7DC 2VGNA 4FYWB 4E6RA 1PSFA 1IXDA 1VQ9T 3KXTA 3I55T 1VQ9A 3R6NA 2JN0A 2XICA 3I55A 1Q7YR 3C95A 2L3SA 2AKKA 1QVGA 1ZBXA 4C92D 2DEUA 2E4HA 4M7AG 5GANg 1RAGB 4F16A 1Y07A 4XTUA 5IHNA 1VA7A 3CXCS 4B9XA 5KYNA 1D1BA 1MUZA 2RN8A 1U3OA 2GNCA 3VYHB 1N8RR 2DZ9A 2X4YA 5GAN7 2E5QA 3ME9A 4XTWA 3VRYA 3FRNA 3OW2A 1EX4A 3EGDB 5LJ3d 5GAOp 5FRNA 1VQ6Q 1N27A 1XNIA 3CCLA 3VJPA 4QQ6A 1T0JA 1YHQQ 3JSCA 4C92G 4M7AA 1QCFA 4J9DA 1QW1A 1YP5A 1KFZA 1UDLA 3N5BB 1M90C 2CP0A 4PFPA 2M02A 1M8MA 1YJNQ 2FZCB 2KXDA 1FMWA 2NUPA 2QTXA 1Q82R 3X26B 2M51A 1QWFA
chains in the Genus database with same CATH topology
1WQ7A 4FT2A 2DXTA 3CCVA 1BI0A 2CS7A 2HNIA 2RH2A 5FU6B 1M8VA 4XTZA 3OA6A 4BB7A 4ZN3A 4E7IA 2EJFA 5GAOq 2K5IA 3BY7A 4M75G 5CK9A 2ZPGB 4OVAA 1VQKT 1BKBA 4UC4A 3MEWA 5GANf 5GAMd 2RO0A 5A0LA 1VQKA 1K8AU 3OYKA 3X25B 3L2WA 4L5GA 1Y96B 3H8ZA 2DXUA 5CIUA 5FLXE 1AHJB 2YHTA 5KCHA 2EYQA 3P8DA 1BIAA 1IZ6A 2DXCA 2ZPFB 3OYBA 4EMGA 1QVGS 4OGCA 2CZ1B 1RI0A 1QVPA 4C0ZA 2VV5A 5HK0A 4E7HA 5IAYA 4EMKA 4C92F 2XU8A 3G71T 1UB4A 1NZ9A 2KAFA 4MDWA 2XI9A 3C12A 1M90U 3G71A 3CBMA 3GIBA 3QJ6A 1YCYA 2AHJB 4N4IA 5IT9E 1M1KC 5LJ5d 4C8QC 3I56T 4CRIA 2A7YA 2Y4YA 2LT4A 3CCST 3I56A 3INZA 5CQXA 5IN1A 3S3OA 4A4GA 2DKGA 2EQUA 4C5IA 3CCSA 4IUPA 4J6YA 1IREB 3HRTA 3VYGA 3VUZA 1OZ3A 1KC8U 2XDDA 2XKOC 2XDBA 3JRZA 3MP1A 2GFAA 4N4GA 4RCCA 5FRMA 4M7DD 3EFRA 3WVEB 4A53A 3URGA 1KD1U 3HHTB 4FT4A 3BW1A 4FM4B 4OGEA 5GANh 1VQ6T 3OW2S 2L5QA 4ZTFA 1X01A 2F69A 4BE0A 2E10A 4II1A 5D6WA 5DM7R 1VQ6A 2VXFA 1RL2A 2KQWA 2RI3A 4J7IA 2GFUA 2PQWA 3QHSA 4M75F 1YHQT 3MCAB 2BKDN 3OYYA 3LYIA 3MP6A 3JCMX 1YHQA 4M7AC 2VUBA 1NJIC 2RD1A 3HFNA 3L1AA 4P5NA 1UGPB 4ATOA 5GMKl 3CCMA 4PJOG 4KBMB 3LX7A 2F5TX 1TH7A 3CEYA 5GAOm 2RHUA 4M77F 1YJWT 4LDUA 1O75A 4MMKA 4Z02A 4C8QE 1Y71A 3OSVA 2KSSA 1YJNT 2I2LA 3G7ZA 4GLKA 2RHZA 5GAN5 3OYNA 3OYJA 1YJNA 3JB9H 5GAOn 3V7SA 3OY9A 2DZCA 1R8OB 5J3BA 2QQBA 2O4XA 3L2VA 2H3JA 2Y90A 1NPRA 2HQEA 3QJYA 1M1KU 2C06A 4MDXA 2GCXA 5I2SA 1GXIE 4PJOE 5L8RE 4FL6A 3VUBA 3PTAA 4PL6A 2LQKA 3QPHA 2OTLT 3C4SA 2E64A 5GMKi 3HP9A 4XU1A 4C8QA 2R58A 2VXEA 3PIPA 3V8KA 4C5HA 4QVDA 4JUVA 2E41A 3FDRA 2ZPEB 3UT1A 4FU6A 2DEQA 3M4YA 3NTIA 4C92C 2OAUA 3PIOA 3GPLA 1JRIA 3OYHA 2FL7A 3LGFA 5CKHA 3ZBDA 1VIEA 2GF7A 3M56A 4C0FA 1W2BA 2V8IA 4PJOA 1FWZA 1MHNA 4EMKC 4F7UG 3CPWS 5DLOA 1KHIA 1U1SA 4JLGA 3M58A 3CCJA 4LDVA 2RB6A 3E1SA 3JAME 1MGQA 3SD4A 2K3YA 4C8QB 1G3SA 2ZZDA 3RUXA 2LTOA 5M9OA 3QKJA 2XIDA 2QXFA 4XU2A 4EMHA 3BFMA 3ER0A 4QVZA 4MMLA 1UGQB 3FIFA 2RM4A 1BI2A 2D6FA 4DOWA 4C5EA 5GAN8 4ELZC 4M75C 1NE8A 2CGHA 4IUQA 4FIBA 4MZTA 3HFOA 2E1HA 3OQ5A 4HA8A 3J81E 1VQ4T 3WVDB 3QBYA 1OYXA 4RG8A 1VQNA 3JB9I 1KC8C 2ZPBB 3P8BB 1G3YA 4BE1A 3META 4M7DF 2CZ7B 1ZQ1A 1KD1C 1UGSB 2M0OA 5C6SA 2X4WA 3CC7T 4M7AB 2DVEA 3CD6T 3DLLA 2IG0A 2OTJT 1I4K1 2MWPA 5GANd 3CC7A 2KMTA 2OTJA 2K2VA 4NOYA 4MZPA 3QIIA 4OB2B 3OBWA 3G6ET 3RMSA 3LGLA 3G6EA 3L42A 1ZHIA 4OB0B 4A54A 1VQLT 4J8OA 4C92A 2R57A 2L8DA 4M77G 2LCCA 3NTHA 4Q5WA 4KULA 1VQLA 3RKWA 1XQHA 3CPWA 4OP0A 3R6OA 1G3TA 4F7UF 1WQWA 2RHXA 3DLMA 1YJ9T 5DLQE 1NPPA 3A8OB 3CCUT 4JRPA 1YJ9A 3PT9A 3CBPA 4M75E 1OI1A 3J80E 3CCUA 4PKCC 3JCMQ 2RA2A 2LDMA 1V29B 4IUVA 3SB2A 2R5AA 2ZGWA 3E19A 3S6WA 4RG2A 2K57A 3EAEA 3EFSA 2JVVA 2LQ8A 3M53A 4JRIA 5HKCA 2RHYA 2WSEE 3CPFA 3M4GA 3WXMB 3FLGA 4ZN1A 4M77E 1KQ1A 5LJ3e 4LD9K 4M78D 5GAMf 1QP3A 2PUOB 3JCMP 3PGGA 4PLLA 4JRQA 1QP2A 4OMFB 1U1TA 3OYCA 3RMQA 4C0GA 4C92B 2XD0A 4LDXA 4QQGA 2DIGA 4Y28E 3RESA 3RKYA 3O8VA 4M75A 5FROA 4PJOC 3CBOA 2PU9B 1OZ2A 2XHCA 1WGSA 4OF1A 3JCMg 2HQXA 3RIRA 1S72T 4EMKB 2QEXT 1W2BS 1KQSA 2CZ0B 4M7AD 1WNLA 2E70A 4PLIA 4PNOA 4DQ2A 2EIFA 3CCET 1S72A 2QEXA 4M77A 3L2QA 5HK3A 1Y7XA 3OMGA 4C5GA 4BY6C 5LJ3g 3QUIA 2E6NA 1VUBA 4KUIA 4ZTJA 4X9DA 3VU3C 5KH6A 2MMPA 2DD4A 2MAMA 4OB3B 1DJ7B 4E7KA 4BUGA 2RHIA 1WJSA 3TU4K 1B34A 2K5LA 3MP8A 2EQMA 5CKEA 1YJWA 3L2ZA 3QG1A 3LWIA 5HY6A 2E12A 2RJDA 3NTKA 1M4ZA 1UEBA 1SSFA 3KBGA 3MEVA 4M75B 3GF5A 3S3MA 3CCRT 1I81A 2LNVA 3FEOA 2JTFA 3Q1JA 5GAMh 1BYMA 2K4YA 2KY9A 3V7CA 5GAMe 4M78G 3CCRA 1YI2T 2KVQG 2YLBA 4A4KA 5KCOA 5KE3A 1YI2A 4HCCA 4J6XA 4LDYA 1YIJT 1Q82U 3OS2A 4EPCA 2BUDA 5LJ3j 4XU0A 1YIJA 3X28B 2OTLA 4M7DG 3ZEHA 3L2UA 2V8KA 5D6XA 3M59A 4E7JA 3GNFB 4RMOA 4BI8B 5I21A 3V8LA 2RK1A 2PVOB 2P4TA 4OB1B 3TEEA 1K9MC 3P8HA 1B34B 4M78E 4XK8E 3E9FA 3JCMW 5LJ5h 5C0MA 2Y4XA 5LJ5e 2QA4T 4QQDA 3CCQT 5GAMg 2QA4A 4JJNK 1WJRA 5GMKm 5CR2A 1VQMT 2O4XB 1PSEA 3J7AF 2WSCE 2LC4A 2V8JA 3OSSC 2DTHA 2LX9A 4FSXA 3CCQA 2DIQA 4M7DE 4QVCA 3QYGB 3JB9D 4HCZA 4EDUA 2EJ9A 2YLCA 3MEAA 3CMET 1VQ5T 4IKFA 1JB0E 1FX7A 2VC8A 1VQ7T 2VGMA 3CMEA 2EWNA 4O6JA 2P0KA 5CO7A 2QQSA 3LWHA 1VQ5A 1VQ7A 3KUFA 2JUFA 4ZGJB 4V2SA 1KG1A 2DPPB 2EFIA 1Q81C 3JCMf 3DB4A 2B8AA 3C94A 4BDZA 4R56A 2P0PA 3PFSA 3V8JA 3M9QA 5A2QE 5LJ5g 2DO3A 3OS5A 3CCLT 4F7UE 4J7FA 1WPYA 3A8GB 4M7DA 4NS5A 2WSFE 4M78F 4TVRA 2X4JA 3MO8A 4XTVA 5GAMj 3OYGA 5AYFA 3FC3A 5LJ3f 2D9TA 4J6WA 1N8RC 3QO3A 4PJOB 1KHCA 1I5LA 2P0QA 3DB3A 2LT1A 4X9CA 4D6WA 2RI2A 2RJFA 1VQ4A 4BACA 5I2MA 2HD0A 4M77C 5LL6S 3ASKA 4N4HA 4LD6A 4MZMA 2YRVA 2WACA 3SWNC 5A0GA 1KQSS 2JZ2A 4IURA 2JOYA 3M55A 3OYFA 1K9MU 2RJEA 4BY6B 3SFMA 3JCMJ 3CD6A 5A0DA 2X4XA 4IUTA 4XAXB 1JJ2S 4M7AF 4KT0E 1LJOA 5EG2A 2EJGA 4A4EA 4F7UA 2VYTA 4Y91A 2G3RA 3X20B 3HSBA 2XG8D 1G5VA 2O01E 3JB9G 5LJ5j 3M54A 3CXCA 4N0AA 1QVFA 1Q7YU 2FYKA 1VIFA 2KK4A 4GY5A 4LDWA 5FU7C 2JNGA 4E47A 5CCAA 2EQJA 5GAN3 3NFCA 3FB9A 4ME7A 3JCMh 3OYDA 4O5VA 1M1FA 3JCMe 1G3WA 3MEUA 1Q81U 4ZGEB 3GOXA 1HXDA 3OB9A 4C8QD 2X35A 2QDYB 2QQ9A 3OBYA 4L59A 4JRKA 1Q86U 5LJ3h 1BI1A 3UPUA 4WF2A 2DK3A 4QW2A 2MWOA 3VV0A 4C0DC 1M1GA 3QZ9B 4F7UB 1N8RU 2A3LA 1BI3A 3OS1A 4BE2A 1Q82C 1XOVA 5CKBA 3BDLA 2LRQA 2L3RA 1N9SA 4PJOD 5GAOl 3BDUA 1N9RA 3G4ST 2IVWA 1I8FA 1M9SA 4JDSA 3G4SA 2M1HA 1N6AA 4X34A 4XTYA 5KE2A 2M16A 3A8HB 3E9GA 5CQYA 1VQOT 2K5FA 1YBYA 3LH0A 3DKMA 3QZ5B 2MI6A 2MF2A 5GAN4 3OYAA 1VQOA 1P92A 4XU3A 1JJ2A 3RKXA 3GP8A 2D0QB 2K3XA 3CCEA 2CZ6B 3SWNA 3T9NA 3HRSA 5LJ5f 2RK2A 4E7LA 2DXBA 1K73C 3QYHB 3JCMc 1BIBA 5GMKj 2HAXA 4M78C 2LCLA 3JCMV 3OS0A 5CAIA 3JB9F 5GAOr 5CVIA 4HCBA 4YTLA 4BI3A 2M9UA 5J26A 2QQRA 3VKIA 4C8QG 1O9SA 3F70A 3PNWC 4VUBA 4CI0C 4M7DC 5GANe 3UWNA 3OYIA 2GQVA 2VGNA 4HKEA 5FU6C 1PSFA 1XTDA 2ZCFB 1VQ9T 1D3BA 2EQKA 2QI2A 3KXTA 1WJQA 2HBPA 3LLRA 1JBMA 5J39A 1FXXA 3I55T 5CKDA 3L2RA 3CCMT 1YITT 5CKFA 2JN0A 1VQ9A 2FVUA 4L6V5 2XICA 4M77B 3RERA 3LW5E 4JLIA 3I55A 3JB9J 1W4SA 1YITA 4R55A 3C95A 2JTMA 3FJPA 3HL8A 3SWNB 4BDYA 3GLXA 3CC4T 3OYLA 1VQPT 5D6YA 4XTXA 4HT9A 3TCJA 1QVGA 3CC4A 1VQPA 1ZBXA 4C92D 2DTIA 2EAYA 4M7AG 4A4HA 1H641 4RKUE 4N0AC 5GANg 3M5AA 4JS4A 1Y07A 2KDSA 1LOJA 4NL2A 4XTUA 2XDPA 3JCMb 4JS5A 2R5MA 2RI5A 3GNGA 5FU7B 4A4FA 3UDCA 5GAN2 3CXCS 2PUKB 3ZFJA 4B9XA 1UGRB 2ZPHB 4XQ3A 1K73U 1QVFS 3VYHB 1D3BB 2DD5A 2NLUA 2DZ9A 3QDRB 2LVMA 1VQMA 1Q7YC 1KQ2A 1H3ZA 3A8MB 3TREA 2X4YA 5GAN7 2DAQA 2E5QA 4DOVA 4J5YA 1HK9A 2DTOA 3HKSA 5DY9A 4HT8A 4M7AE 3ME9A 4XTWA 3JCMd 4B9WA 3OYEA 3FRNA 4M78A 3PMTA 3HRUA 4C0DB 4C8QF 2DJZA 1EIFA 4BD3A 3OW2A 4M75D 1Q86C 4NL3A 4ZGDB 5GANj 1NJIU 1K8AC 5LJ3d 2FHDA 3V7RA 3OMCA 2E65A 2BIVA 5GAOp 5FRNA 1N27A 1XNIA 2CKKA 2F5KA 3CCLA 3CMAT 4KUDK 3CCJT 3VJPA 4DA4A 3CMAA 3A8LB 4QQ6A 4M77D 2XK0A 3JSCA 1VQ8T 3SDZA 4C92G 1X75C 2PVGB 2QQAA 3PMIA 4PJOF 2E6ZA 2RJCA 4IUUA 1VQ8A 4M7AA 3A5ZB 2PVDB 1QW1A 3HPWA 2L89A 1U8RA 2CYZB 3N5BB 3QXEB 1M90C 3CC2T 3S3NA 3AHUA 4RCBA 1Y96A 1X6OA 3CC2A 4M78B 5GMKh 1LNXA 5GMKe 3QSUA 3H6ZA 5GAN6 4J83A 2FB7A 3OYMA 1M5Q1 3X24B 4ELYC 2QTXA 4BI4A 1VQNT 3M57A 4C92E 3X26B 2ZPIB 3CCVT 4M7DB 3MHXA 2EKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQ7 A;  5GAM h;  4EMK C;  3V7C A;  2DXT A;  5GAM e;  4M78 G;  4F7U G;  2HNI A;  2YLB A;  4XTY A;  1M8V A;  1U1S A;  4J6X A;  5GAN 4;  4XTZ A;  2RB6 A;  2EJF A;  4XU3 A;  1MGQ A;  5GAO q;  3BY7 A;  4M75 G;  3RKX A;  5LJ3 j;  4XU0 A;  3SWN A;  4C8Q B;  5LJ5 f;  4M7D G;  3RUX A;  5GAN f;  5GAM d;  3JCM c;  5GMK j;  1BIB A;  4M78 C;  4XU2 A;  3JCM V;  3BFM A;  4EMH A;  5CAI A;  1Y96 B;  4HT8 A;  4MML A;  5GAO r;  3JB9 F;  5I21 A;  3FIF A;  2RM4 A;  3V8L A;  2DXU A;  1B34 B;  2YHT A;  1BIA A;  4M78 E;  5GAN 8;  3JCM W;  5LJ5 h;  4M75 C;  4C8Q G;  4EMG A;  5LJ5 e;  2CGH A;  4M7D C;  5GAN e;  3HFO A;  2E1H A;  4HA8 A;  5GAM g;  4EMK A;  5GMK m;  4C92 F;  3JB9 I;  2DTH A;  4M7D E;  1D3B A;  4QVC A;  3GIB A;  4M7D F;  3JB9 D;  1JBM A;  1YCY A;  2EJ9 A;  2YLC A;  2JN0 A;  4M7A B;  2DVE A;  4M77 B;  4C8Q C;  2VC8 A;  4JLI A;  5LJ5 d;  3RER A;  1I4K 1;  3JB9 J;  5GAN d;  2EWN A;  3FJP A;  3SWN B;  4NOY A;  3INZ A;  4V2S A;  2DKG A;  4XTX A;  4HT9 A;  4J6Y A;  3JCM f;  4C92 D;  4M7A E;  4A54 A;  2DTI A;  2EAY A;  4C92 A;  4M7A G;  4RCC A;  4M77 G;  3V8J A;  1H64 1;  5LJ5 g;  4M7D D;  3EFR A;  4F7U E;  3RKW A;  4N0A C;  4A53 A;  1WPY A;  5GAN g;  4M7D A;  4M78 F;  3BW1 A;  4OP0 A;  1LOJ A;  4NL2 A;  1WQW A;  4XTV A;  4XTU A;  4F7U F;  3JCM b;  5LJ3 f;  4J6W A;  5GAM j;  5GAN h;  3QO3 A;  5GAN 2;  1X01 A;  4PJO B;  1I5L A;  2E10 A;  4M75 E;  4X9C A;  4XQ3 A;  2VXF A;  4M75 F;  1D3B B;  3QHS A;  2DZ9 A;  3JCM Q;  2RA2 A;  3SB2 A;  3JCM X;  4M77 C;  1KQ2 A;  2ZGW A;  4M7A C;  2RD1 A;  3HFN A;  3L1A A;  5GAN 7;  2K57 A;  3EFS A;  4JRI A;  3SWN C;  5GMK l;  3M4G A;  4PJO G;  4J5Y A;  1HK9 A;  2DTO A;  4M77 E;  1KQ1 A;  5DY9 A;  5LJ3 e;  5GAO m;  1TH7 A;  4M78 D;  4XTW A;  5GAM f;  4M7A F;  4M77 F;  1LJO A;  3PGG A;  3JCM d;  2EJG A;  3JCM P;  4MMK A;  4M78 A;  4C8Q E;  4F7U A;  4Y91 A;  4C8Q F;  2DJZ A;  3HSB A;  2I2L A;  1U1T A;  5GAN 5;  4C92 B;  4M75 D;  5LJ5 j;  3JB9 G;  3JB9 H;  4N0A A;  3V7S A;  3RES A;  3RKY A;  2DZC A;  4M75 A;  5GAO n;  2FYK A;  4NL3 A;  5GAN j;  5LJ3 d;  3V7R A;  5GAO p;  4PJO C;  2E65 A;  2Y90 A;  3JCM g;  5GAN 3;  3RIR A;  3FB9 A;  3JCM h;  4EMK B;  4M7A D;  4M77 D;  3JCM e;  1WNL A;  4PJO E;  4PNO A;  4C92 G;  4DQ2 A;  4M7A A;  4PJO F;  4M77 A;  1HXD A;  4C8Q D;  5GMK i;  2E64 A;  4XU1 A;  4C8Q A;  4JRK A;  3QUI A;  2VXE A;  5LJ3 g;  3V8K A;  4QVD A;  4JUV A;  5LJ3 h;  2E41 A;  4WF2 A;  4X9D A;  3VU3 C;  3JCM J;  3AHU A;  4RCB A;  1Y96 A;  4M78 B;  4F7U B;  1LNX A;  5GMK h;  5GMK e;  2DEQ A;  1B34 A;  4C92 C;  3QSU A;  3L2Z A;  1JRI A;  5GAN 6;  2FB7 A;  1M5Q 1;  1N9S A;  4PJO D;  2QTX A;  3BDU A;  5GAO l;  1N9R A;  4M75 B;  4C92 E;  4PJO A;  1I8F A;  1I81 A;  4M7D B; 
#chains in the Genus database with same CATH topology
 1WQ7 A;  2DXT A;  2YUP A;  3HTR A;  2HNI A;  4XTZ A;  2COZ A;  2EJF A;  1NEG A;  3M0P A;  2KRS A;  3OYK A;  2OAW A;  1Y96 B;  2DXU A;  5FW9 A;  4F04 B;  2JMC A;  2A37 A;  1RI0 A;  2KE9 A;  2NUT A;  2QTV A;  2DNU A;  1M90 U;  3CBM A;  3QJ6 A;  1UHC A;  1ZSZ B;  4N4I A;  1M1K C;  4CC7 A;  5LJ5 d;  2GBQ A;  4CRI A;  3CCS T;  3S3O A;  3INZ A;  2HKN A;  3CCS A;  2LJ3 A;  2EYY A;  5FRM A;  2AIR B;  3URG A;  1KD1 U;  4FT4 A;  2RMO A;  4BE0 A;  5D6W A;  2FZG B;  1SRL A;  2LCS A;  4M7A C;  1PRL C;  1WHL A;  1NJI C;  2OTJ Q;  3HFN A;  1UGP B;  5GMK l;  4KBM B;  3LX7 A;  2F5T X;  5GAO m;  4M77 F;  3E2U A;  4MMK A;  2J6F A;  2I2L A;  5IHK A;  5GAN 5;  1UGV A;  3OYN A;  3JB9 H;  3V7S A;  2DZC A;  3PE0 A;  2QQB A;  1M1K U;  2H3J A;  3CCU Q;  2GCX A;  1K8A R;  1GXI E;  2DL4 A;  4PJO E;  1K4U S;  1K0X A;  4J9F A;  1SEM A;  2LQK A;  3QPH A;  1B07 A;  1C1A A;  2VXE A;  3V8K A;  4C5H A;  4QVD A;  3H9N A;  2EQI A;  1X2K A;  4FU6 A;  2DEQ A;  4C92 C;  3GPL A;  3OYH A;  2FL7 A;  2AT1 B;  1VIE A;  2GF7 A;  3M56 A;  1F1B B;  1MHN A;  1M3B A;  3EGX B;  4OMQ A;  4LDV A;  3E1S A;  4OMM A;  1MGQ A;  1KQS P;  1TUD A;  2RQU A;  3I5S A;  3VS4 A;  3NHN A;  5M9O A;  1JJ2 P;  3QKJ A;  2CT4 A;  2DIL A;  5KYU B;  2MOX A;  4QVZ A;  1UGQ B;  4DOW A;  2DVJ A;  4J9G A;  1K0S A;  1NE8 A;  4IUQ A;  4HA8 A;  5FWC A;  3P8B B;  4BE1 A;  3MET A;  4M7D F;  3CD6 T;  2DVE A;  1OX8 A;  2K2V A;  2RQT A;  3OBW A;  3H0H A;  2CP6 A;  4OB0 B;  2COW A;  2HZY A;  1A0N B;  1XQH A;  3CPW A;  2RHX A;  3EG2 A;  3EH1 A;  5DLQ E;  2DER A;  3CBP A;  3J80 E;  1LCK A;  1VYV A;  2R5A A;  3EAE A;  4BAC A;  2RHY A;  4ZN1 A;  3FLG A;  1OPL A;  4JRQ A;  2NUZ A;  4C0G A;  2XD0 A;  4Y28 E;  1R77 A;  4M75 A;  1QCO A;  5FRO A;  1WGS A;  2HQX A;  2CZ0 B;  1WNL A;  4PLI A;  4PNO A;  4BY6 C;  5LJ3 g;  4ZTJ A;  1SHF A;  4KRT A;  1D0X A;  4PFZ A;  3TU4 K;  4FYX B;  3EFO A;  1B34 A;  2GGR A;  2EQM A;  3L2Z A;  2E12 A;  1U5S A;  1M4Z A;  3MEV A;  1T3L A;  3FEO A;  3Q1J A;  5GAM h;  2CDT A;  2YLB A;  5GJV B;  1FMV A;  2LJ0 A;  4JZ4 A;  4LDY A;  1YIJ T;  1Q82 U;  4EPC A;  4XU0 A;  1YIJ A;  2OTL A;  5D6X A;  1PKS A;  3GNF B;  4RMO A;  4BI8 B;  3V8L A;  2P4T A;  3TEE A;  1QMC A;  4DEY A;  5IXF A;  1D09 B;  3D7S B;  5GMK m;  5CR2 A;  2O4X B;  3J7A F;  1MMG A;  2DTH A;  2DIQ A;  4QVC A;  3QYG B;  3JB9 D;  3CCE Q;  1WXU A;  2EJ9 A;  3CME T;  1KC8 R;  3CME A;  2EWN A;  4O6J A;  5CO7 A;  3KUF A;  2JUF A;  4J9I A;  2W10 A;  2DPP B;  1Q81 C;  3JCM f;  4A63 B;  1MMN A;  5LJ5 g;  1WPY A;  3A8G B;  4NS5 A;  2E5K A;  3G1J A;  3MO8 A;  4FW2 A;  3OYG A;  3QO3 A;  2P0Q A;  1TWB A;  2D1X A;  3DB3 A;  4X9C A;  5KYW B;  2HD0 A;  5LL6 S;  2KI7 A;  2RQV A;  5A0G A;  5KYX B;  2JZ2 A;  1KQS S;  3M55 A;  3OYF A;  1KIK A;  2RJE A;  3TVT A;  3SFM A;  3CC4 Q;  5A0D A;  2X4X A;  4IUT A;  1AWO A;  1FMK A;  1JJ2 S;  4M7A F;  2EJG A;  4A4E A;  4F7U A;  1NG2 A;  2ED1 A;  2G3R A;  2JT4 A;  1QWE A;  3JB9 G;  3THK A;  1J3T A;  2CUB A;  4CC3 A;  2KK4 A;  4FYY B;  4E47 A;  4AFS C;  1VQM Q;  3FB9 A;  1M1F A;  1K9A A;  1Q81 U;  4C8Q D;  4ORZ A;  2OX7 A;  4L59 A;  1WHH A;  2KBT A;  3MJX A;  3UPU A;  1JQQ A;  2DK3 A;  2C0T A;  1G2B A;  2O9S A;  4C0D C;  3OS1 A;  1IHV A;  3C0C A;  1XOV A;  5CKB A;  2LRQ A;  3EHR A;  3RNJ A;  3BDU A;  1N9R A;  1UFF A;  2DLP A;  1OX9 A;  4JDS A;  2M16 A;  2DMO A;  3E9G A;  2K5F A;  1P92 A;  4XU3 A;  2QAS A;  2HQH A;  2K3X A;  1RAF B;  4E7L A;  1TXQ A;  2DXB A;  2F2V A;  1EZZ B;  3QYH B;  1BIB A;  2AKL A;  3OS0 A;  5CAI A;  1G83 A;  1TOV A;  4C8Q G;  1O9S A;  3F70 A;  5GAN e;  3CCV Q;  1X6B A;  2ZCF B;  3EG9 B;  1JBM A;  1GBQ A;  1FXX A;  3L2R A;  7AT1 B;  4L6V 5;  1W4S A;  1VQK Q;  3HL8 A;  3SWN B;  4BDY A;  1UHF A;  1VQP T;  4RTX A;  4XTX A;  1X27 A;  1VQP A;  1X43 A;  2YRD A;  2IIM A;  2DTI A;  1WX6 A;  4A4H A;  1IHW A;  4ESR A;  4RKU E;  2JXB A;  1BCO A;  1AVZ C;  3JCM b;  2XDP A;  5FU7 B;  2BZ8 A;  3CPW P;  2ZPH B;  4CC2 A;  2PZ1 A;  2NLU A;  2LVM A;  1N5Z A;  1H3Z A;  3A8M B;  2EKH A;  4KH1 B;  2EPD A;  2DAQ A;  4DOV A;  4HT8 A;  5DY9 A;  2K7A A;  2JTE A;  3HKS A;  2VKN A;  3OYE A;  4M78 A;  2I0N A;  4D8D A;  2DJZ A;  4KH0 B;  1Q86 C;  1HJD A;  5GAN j;  2BZY A;  4ZGD B;  2X3W D;  2E65 A;  2F5K A;  3CMA T;  2YRC A;  4DA4 A;  3CMA A;  1X6G A;  3A8L B;  1W70 A;  1GCQ C;  2PVG B;  2QQA A;  3PMI A;  4IUU A;  3CCM Q;  4PFO A;  1K76 A;  2CYZ B;  3RBB B;  1LPL A;  1WLP B;  5GMK e;  1C6V X;  1WI7 A;  4E2F B;  5GAN 6;  4J83 A;  4ELY C;  2EBP A;  1MND A;  4KGV B;  2CS7 A;  2RH2 A;  1AD5 A;  5FU6 B;  3QWY A;  5EC7 A;  4LNP A;  3OA6 A;  1I1J A;  1YFN A;  4BB7 A;  2K5I A;  1YN8 A;  4UC4 A;  3MEW A;  5GAN f;  1K73 R;  5KCH A;  3P8D A;  2NYS A;  2ZPF B;  1E6H A;  4EMG A;  2NUP B;  1CSK A;  2CZ1 B;  4JJC A;  4C0Z A;  1R0B G;  1UTI A;  2XU8 A;  3G71 T;  1UB4 A;  1NZ9 A;  2KAF A;  2XI9 A;  3CCJ Q;  3C12 A;  2NWM A;  3G71 A;  1H8K A;  1H3H A;  4C8Q C;  3I56 T;  2O31 A;  2Y4Y A;  2KT8 A;  2LT4 A;  3I56 A;  1AWX A;  4A4G A;  1BCM A;  3HRT A;  3VYG A;  4PK4 A;  1KC8 U;  4A53 A;  2O2O A;  1VQN Q;  4OGE A;  2NUT B;  1HD3 A;  1NYG A;  2E10 A;  4II1 A;  2HKQ B;  1RL2 A;  1KJW A;  2V1R A;  1AZG B;  2PQW A;  4M75 F;  3JCM X;  3LYI A;  3MP6 A;  2D8H A;  8ATC B;  2VUB A;  3CC7 Q;  4PJL A;  3L1A A;  4K11 A;  4PJO G;  1ZA1 B;  3LH5 A;  1AZE A;  2RHU A;  1O75 A;  4C8Q E;  1Y71 A;  2EW3 A;  2DBM A;  3G7Z A;  4Z89 A;  2M0Y A;  3OYJ A;  5GAO n;  2LZ6 B;  3OY9 A;  2IPO B;  4QKU A;  2Y90 A;  4MDX A;  4DBQ A;  5I2S A;  4RTY A;  5L8R E;  1GRI A;  2GTJ A;  2RPN A;  1PC0 A;  2R58 A;  1YCS B;  1AWW A;  3UT1 A;  3PIO A;  4IIO A;  4C0F A;  1W2B A;  4PJO A;  2BZX A;  2RNA A;  1MV3 A;  3CPW S;  1S72 Q;  2VWF A;  4JLG A;  3M58 A;  2RB6 A;  3SD4 A;  4JJB A;  2EGE A;  3RUX A;  1UEC A;  2QXF A;  4EMH A;  3BFM A;  3ER0 A;  4DBH A;  1YJW Q;  4MML A;  2RM4 A;  4C5E A;  5GAN 8;  1OUL A;  2XMF A;  1ACM B;  3HFO A;  2E1H A;  4DBR A;  2JS0 A;  3J81 E;  3WVD B;  4RG8 A;  1YI2 Q;  2QAZ A;  1G3Y A;  1M2O A;  1ZQ1 A;  2CZ7 B;  4FYV B;  1KD1 C;  3DLL A;  2MCN A;  4NOY A;  3G6E T;  3QII A;  4OMO A;  3LGL A;  3G6E A;  3L42 A;  1X69 A;  1VQL T;  4J9E A;  4C92 A;  2L8D A;  2LCC A;  3UAT A;  1SRM A;  1VQL A;  3RKW A;  1Y57 A;  4KGZ B;  3R6O A;  1G3T A;  4OP0 A;  4F7U F;  1YJ9 T;  1NPP A;  3A8O B;  1YJ9 A;  3PVQ A;  3PT9 A;  1WFW A;  2DRM A;  1Q95 G;  3SB2 A;  1V29 B;  4IUV A;  3E19 A;  2E3H A;  4M4Z A;  2K57 A;  1RAH B;  3M53 A;  2DBK A;  2JS2 A;  1FYN A;  5LJ3 e;  4LD9 K;  1PHT A;  1QP3 A;  2ABL A;  2PUO B;  3PGG A;  2ATC B;  3ZL7 C;  2DET A;  1QP2 A;  4OMF B;  1U1T A;  1M2V A;  3RMQ A;  4B6M A;  4LDX A;  4E7S A;  3RKY A;  1AOJ A;  3I5R A;  4PJO C;  3CBO A;  2PU9 B;  3H0F A;  2XHC A;  1VQ4 Q;  1QKW A;  4EMK B;  2QEX T;  2E70 A;  1E7O A;  3CCE T;  2QEX A;  3L2Q A;  1Y7X A;  2O88 A;  2KT1 A;  3M0U A;  3KFV A;  4X9D A;  3CQT A;  2A0F B;  4E7K A;  4BUG A;  2RHI A;  1WJS A;  2J06 A;  2K5L A;  3JV3 A;  3UA7 A;  2RJD A;  4M75 B;  3S3M A;  3CCR T;  1I81 A;  1QVF P;  2L3Q A;  3CCR A;  2EGC A;  3QDF A;  2D8J A;  4AMC A;  5LJ3 j;  2C0I A;  4R0K A;  3I35 A;  3ZEH A;  3EHQ A;  3M59 A;  2ROT A;  4E7J A;  1K9M C;  2BE7 D;  1YWO A;  1B34 B;  3EFO B;  3AT1 B;  4XK8 E;  3JCM W;  5LJ5 e;  3G4S Q;  2QA4 T;  3VS5 A;  3CCQ T;  4JJN K;  2QA4 A;  1ARK A;  1VQM T;  1SG5 A;  2V8J A;  2WSC E;  3CCQ A;  3OSS C;  2KGT A;  4EDU A;  2YLC A;  4HCK A;  1VQ5 T;  1JB0 E;  1FX7 A;  2VC8 A;  4RTV A;  1VQ7 T;  2DYI A;  1VQ5 A;  3VS3 A;  3LWH A;  2QQS A;  1VQ7 A;  4V2S A;  1ZX6 A;  2EFI A;  1PWT A;  2HL5 C;  3DB4 A;  3C94 A;  4R56 A;  2P0P A;  2JM8 A;  1QLY A;  2WSF E;  4M78 F;  2X4J A;  1N8R C;  5LJ3 f;  3EG1 A;  1KHC A;  1UJ0 A;  4D6W A;  1VQ9 Q;  3I55 Q;  3ASK A;  1K9M U;  4IUR A;  2JOY A;  2GTO A;  3CD6 A;  4XAX B;  1BK2 A;  5EG2 A;  4Y91 A;  1WHM A;  1JEG A;  5LJ5 j;  3M54 A;  3CXC A;  1QVG P;  1Q7Y U;  4GY5 A;  4LDW A;  2C0O A;  5CCA A;  1MV0 B;  2DA9 A;  3JCM e;  3BE3 A;  1ZSZ A;  2FO0 A;  3GOX A;  4J9B A;  1HXD A;  2QDY B;  1M30 A;  1IRX A;  2A08 A;  2DJQ A;  4WF2 A;  1KK7 A;  3VV0 A;  2MWO A;  2DL8 A;  2LQN A;  4F7U B;  1N8R U;  1BI3 A;  4E7Z A;  1Q82 C;  4AFQ C;  3BDL A;  3REB B;  3CCL Q;  2IVW A;  3OW2 P;  3EGU A;  2DF6 A;  1N6A A;  4XTY A;  1VQO T;  1YBY A;  3OYA A;  2MI6 A;  1RI9 A;  2VVK A;  1VQO A;  2SEM A;  2CZ6 B;  5LJ5 f;  3T9N A;  3JCM V;  5CVI A;  4HCB A;  2G6F X;  2M9U A;  1NLO C;  2X9H A;  4AFZ C;  1WXB A;  3UWN A;  3OYI A;  2GQV A;  4WCI A;  4HKE A;  1S1N A;  1XJW B;  1D3B A;  1X2Q A;  3M0S A;  3LLR A;  5J39 A;  3CCM T;  1YIT T;  4M77 B;  3LW5 E;  1YIT A;  1AEY A;  2H8H A;  1W6X A;  1QKX A;  3GLX A;  5D6Y A;  1SKU B;  4JS4 A;  2KDS A;  1LOJ A;  4NL2 A;  2R5M A;  2RI5 A;  3GNG A;  4A4F A;  2PUK B;  3ZFJ A;  4XQ3 A;  1QVF S;  3FJ5 A;  2V1Q A;  2DD5 A;  2KEA A;  1ZSZ C;  1KQ2 A;  2DL3 A;  1WDX A;  1ZUK A;  3CCS Q;  1HK9 A;  4KGX B;  2KRN A;  1EIF A;  3I9Q A;  2DL7 A;  1ZUU A;  4NL3 A;  2KYM A;  4WTO B;  1K8A C;  4KUD K;  3CCJ T;  1VQ8 T;  4M77 D;  2XK0 A;  3REA B;  3SDZ A;  4PJO F;  1SF9 A;  1VQ8 A;  1JO8 A;  2PVD B;  1TUG B;  1U8R A;  3QXE B;  2CUD A;  3CC2 T;  2F1L A;  1X6O A;  3CC2 A;  4M78 B;  5GMK h;  1M3C A;  5IXB A;  4FSS A;  1LVK A;  2FB7 A;  4BI4 A;  1VQN T;  3M57 A;  1VYU A;  4M7D B;  3MHX A;  4FT2 A;  1BI0 A;  2SRC A;  1M8V A;  1ZA2 B;  1WHJ A;  4ZN3 A;  5GAO q;  3BY7 A;  1BKB A;  2KNB B;  1IGU A;  5GAM d;  2RO0 A;  5A0L A;  1K8A U;  3X25 B;  1D1C A;  3L2W A;  4L5G A;  5CIU A;  2EYQ A;  1BIA A;  1WHK A;  1IZ6 A;  2DXC A;  1QVG S;  1WA7 A;  4OGC A;  1PG5 B;  4E7H A;  5IAY A;  4C92 F;  4MDW A;  2LQW A;  3GIB A;  1GCQ A;  1KSW A;  2AHJ B;  2A7Y A;  5FWB A;  4OMN A;  1C0M A;  4JZ3 A;  4C5I A;  4J6Y A;  3VUZ A;  1E6G A;  1OZ3 A;  1GFD A;  2ED0 A;  2XKO C;  3JRZ A;  4RCC A;  4M7D D;  2QK0 A;  3HHT B;  3BW1 A;  4FM4 B;  1VQ6 T;  3OW2 S;  4ZTF A;  1VQ6 A;  1JXM A;  1YHQ T;  3QHS A;  3TSW A;  3OYY A;  1YHQ A;  2RD1 A;  1UE9 A;  1UJY A;  4HVU A;  1TH7 A;  1YJW T;  2BTT A;  1YJN T;  2RHZ A;  2GQI A;  1YJN A;  2LP5 A;  5J3B A;  2HEQ A;  2O4X A;  2ROL A;  3L2V A;  1NPR A;  4FL6 A;  3VUB A;  3PTA A;  5GMK i;  2PNI A;  3HP9 A;  4C8Q A;  3PIP A;  2HMA A;  3NGP A;  2KRO A;  3FDR A;  2CH4 A;  1M90 R;  4RTZ A;  3NTI A;  2CSI A;  3LGF A;  2OI3 A;  3EH2 A;  3ZBD A;  2V8I A;  4AG2 C;  1FWZ A;  3H41 A;  3JAM E;  1D0Z A;  3GBQ A;  2MYS A;  1KD1 R;  2LTO A;  4GLM A;  2HBW A;  5ECA A;  5L23 A;  2W0Z A;  2HL3 A;  2XID A;  3FIF A;  1BI2 A;  2D6F A;  1RAC B;  2AZS A;  4ELZ C;  3PVL A;  1B7T A;  2CGH A;  4MZT A;  1VQ4 T;  3QBY A;  1OYX A;  3JB9 I;  1KC8 C;  2ZPB B;  5C6S A;  1YIJ Q;  2OTL Q;  4M7A B;  2OTJ T;  2O9V A;  2YUN A;  1I4K 1;  2OTJ A;  2QYZ A;  1M1K R;  1RLP C;  1ZHI A;  1ZLM A;  4A54 A;  1ZSG A;  3NTH A;  4Q5W A;  3VS1 A;  1T3S A;  1WQW A;  3DLM A;  3CCU T;  5KYY A;  4JRP A;  1OPK A;  1OI1 A;  3CCU A;  3JCM Q;  2LDM A;  2ZGW A;  3CME Q;  3EFS A;  2JVV A;  2EGA A;  3WXM B;  3M4G A;  4J9H A;  4M77 E;  1KQ1 A;  1NJI R;  5GAM f;  4RTW A;  3JCM P;  3A98 A;  2YWW A;  4C92 B;  2RQR A;  4F14 A;  2DIG A;  2CSQ A;  1OZ2 A;  4OF1 A;  1M27 C;  3RIR A;  1KQS A;  4M7A D;  1I07 A;  3QUI A;  3IQL A;  4KUI A;  5KH6 A;  3VU3 C;  2MMP A;  2DD4 A;  5I22 A;  2MAM A;  4OB3 B;  1YWP A;  2YUO A;  5CKE A;  1OOT A;  1M2V B;  1OV3 A;  5HY6 A;  1UEB A;  2FZK B;  2LNV A;  1BYM A;  4RTT A;  2FPF A;  2KY9 A;  3V7C A;  4D8K A;  4A4K A;  5KCO A;  4HCC A;  1QCN A;  2VB6 A;  1ZUY A;  3OS2 A;  4DEX A;  4IIM A;  2FPE A;  4QT7 A;  3X28 B;  1ABO A;  4X1V A;  2DX1 A;  5I21 A;  4OB1 B;  2RK1 A;  2PVO B;  1RAD B;  3P8H A;  4M78 E;  5LJ5 h;  2JW4 A;  1PNJ A;  3VS6 A;  5GAM g;  1WJR A;  2LX9 A;  2FEI A;  4M7D E;  3MPU B;  3MEA A;  5GJW B;  4F17 A;  4PJJ A;  2VGM A;  1KG1 A;  1SHG A;  2QGG A;  2CP3 A;  2DM1 A;  2B86 A;  2B8A A;  4BDZ A;  3M9Q A;  5A2Q E;  2DO3 A;  3OS5 A;  3CCL T;  4TVR A;  1MMA A;  4J6W A;  2YXY A;  4AFU C;  2RI2 A;  2RJF A;  1BU1 A;  2HCK A;  3A1P A;  5I2M A;  4MZM A;  3SWN C;  1WZO A;  4BY6 B;  3NMZ C;  3JCM J;  1VQP Q;  2KYB A;  2KRM A;  3X20 B;  3HSB A;  5IH2 A;  4N0A A;  1VIF A;  1WYX A;  5FU7 C;  2A28 A;  1VYT A;  2JNG A;  2EQJ A;  4RTU A;  2YUQ A;  4ANJ A;  3JCM h;  3OYD A;  1TG0 A;  1G3W A;  3MEU A;  3OB9 A;  2J6O A;  2QQ9 A;  3OBY A;  2QDL A;  1BI1 A;  1PRM C;  2P4R A;  4QW2 A;  4Z8A A;  4BE2 A;  2PTK A;  3VS2 A;  2L3R A;  1N9S A;  1OQK A;  2VAS A;  3CMA Q;  2M1H A;  4X34 A;  2ECZ A;  3A8H B;  5CQY A;  5GAN 4;  3DKM A;  2HSE B;  3GP8 A;  2D0Q B;  3CCE A;  2BE9 B;  1K73 C;  2HAX A;  2LCL A;  3JB9 F;  2RQW A;  4YTL A;  4BI3 A;  5J26 A;  2D0N A;  2OJ2 A;  3VKI A;  2DFU A;  2E3I A;  2P84 A;  1Y0M A;  1I5O B;  2FPD A;  5FU6 C;  1XTD A;  1JU5 C;  2EQK A;  2QI2 A;  1WJQ A;  2HBP A;  2ZAE A;  2JMA A;  5CKD A;  5CKF A;  2FVU A;  3RER A;  2FG0 A;  4JLI A;  3JB9 J;  4R55 A;  2JTM A;  2AK5 A;  3FJP A;  3CC4 T;  3OYL A;  4HT9 A;  3TCJ A;  3CC4 A;  4FW1 A;  1ZBJ A;  2EAY A;  1U06 A;  1Q81 R;  1M3A A;  1H64 1;  2AZV A;  1IO6 A;  4N0A C;  1GFC A;  3EGD A;  3M5A A;  1TTH B;  4JS5 A;  5GAN 2;  3UDC A;  3G71 Q;  1PD1 A;  1UGR B;  1K73 U;  1D3B B;  3QDR B;  1RAE B;  1VQM A;  1Q7Y C;  2K2M A;  2MIO A;  3TRE A;  3I56 Q;  2JM9 A;  1PM3 A;  4J5Y A;  4M7A E;  2DTO A;  4LUE A;  3O5Z A;  2CRE A;  2QGF B;  3UF4 A;  4B9W A;  3JCM d;  1VOM A;  3PMT A;  3HRU A;  4C0D B;  4C8Q F;  4BD3 A;  1I0C A;  4M75 D;  1BB9 A;  1NJI U;  1T0H A;  2FHD A;  3V7R A;  3OMC A;  3VRZ A;  2BIV A;  2CKK A;  1X75 C;  2E6Z A;  2RJC A;  2L0A A;  3A5Z B;  2CP7 A;  2JJ9 A;  3HPW A;  2K6D A;  2L89 A;  2LJ1 A;  3S3N A;  3AHU A;  4RCB A;  1Y96 A;  1LNX A;  8AT1 B;  2LNH B;  3QSU A;  3H6Z A;  3OYM A;  1M5Q 1;  3X24 B;  1GCP A;  4C92 E;  2FRW A;  2ZPI B;  3CCV T;  2QG9 B;  2DYB A;  2EKO A;  3CCV A;  4OMP A;  4E7I A;  4M75 G;  5CK9 A;  2ZPG B;  4OVA A;  1VQK T;  2COY A;  1CKB A;  1VQK A;  4LUD A;  3H8Z A;  5FLX E;  1AHJ B;  2YHT A;  1NLP C;  3OYB A;  4HVW A;  2X51 A;  1QVP A;  2MK5 A;  2VV5 A;  5HK0 A;  4EMK A;  1W2B P;  1PD0 A;  1IGQ A;  3M0R A;  3M0T A;  1YCY A;  2J6K A;  5IT9 E;  5CQX A;  5IN1 A;  2DKG A;  2EQU A;  1AWJ A;  2EYZ A;  4IUP A;  4J9C A;  1IRE B;  2XDD A;  2XDB A;  3MP1 A;  2GFA A;  4N4G A;  3EFR A;  3WVE B;  1R0C B;  3MKD A;  5GAN h;  1WXT A;  2L5Q A;  1MNE A;  1X01 A;  2F69 A;  5DM7 R;  2VXF A;  2RI3 A;  2KQW A;  4J7I A;  2GFU A;  2L2P A;  2BKD N;  3MCA B;  1B3Q A;  4P5N A;  4ATO A;  3CCM A;  1EFN A;  3G6E Q;  3CEY A;  4LDU A;  4Z02 A;  4LN2 A;  2FRY A;  3OSV A;  2KSS A;  1VQL Q;  4GLK A;  3U23 A;  2Z0W A;  1Z9Z A;  1R8O B;  1K1Z A;  1YJ9 Q;  1SPK A;  3EGX A;  3QJY A;  1Q86 R;  2HQE A;  2C06 A;  5IHI A;  2CH4 W;  2CP2 A;  4JJD A;  1H92 A;  4PL6 A;  2OTL T;  2RF0 A;  3C4S A;  2E64 A;  1V76 A;  4XU1 A;  4OML A;  4JUV A;  2E41 A;  5KYU A;  2ZPE B;  1G8X A;  3M4Y A;  1JXO A;  2OAU A;  1JRI A;  5D7U A;  5CKH A;  2EVR A;  2KR3 A;  2LX7 A;  4EIK A;  1OU9 A;  4EMK C;  4F7U G;  2QEX Q;  5DLO A;  2J7I A;  1KHI A;  1U1S A;  2K9G A;  3CCJ A;  4GBQ A;  2K3Y A;  4C8Q B;  1TUC A;  1G3S A;  2ZZD A;  1D0Y A;  4XU2 A;  2DL5 A;  2HDA A;  3RR6 A;  4M75 C;  4FIB A;  3OQ5 A;  1Z9Q A;  4PJM A;  3CCR Q;  1VQN A;  5AT1 B;  1YNZ A;  4HVV A;  2EYW A;  2CT3 A;  1UGS B;  2M0O A;  2X4W A;  3CC7 T;  2IG0 A;  2MWP A;  5GAN d;  3CC7 A;  2KMT A;  4OB2 B;  4MZP A;  1OU8 A;  3RMS A;  4J8O A;  2R57 A;  4M77 G;  1NM7 A;  1MMD A;  4KUL A;  4DBF A;  1NBE B;  2QA4 Q;  1GBR A;  3CCQ Q;  4PJN A;  4M75 E;  3RDV A;  4PKC C;  2RA2 A;  4Z88 A;  3S6W A;  1VQ5 Q;  4RG2 A;  4FCY A;  5HKC A;  4JRI A;  1VQ7 Q;  2LQ8 A;  3CPF A;  2WSE E;  2HSP A;  4M78 D;  1WIE A;  4PLL A;  1RUW A;  3OYC A;  2LMJ A;  4QQG A;  4HXJ A;  3RES A;  3O8V A;  2CP5 A;  3VS7 A;  3JCM g;  5KYY B;  2J05 A;  1S72 T;  1W2B S;  1BBZ A;  4DQ2 A;  2EIF A;  1S72 A;  4M77 A;  5HK3 A;  3CD6 Q;  3OMG A;  4C5G A;  2L3P A;  3TQ7 P;  2E6N A;  1VUB A;  2DRK A;  3H0I A;  1DJ7 B;  3MP8 A;  1YJW A;  3LWI A;  3QG1 A;  3NTK A;  9ATC B;  2YT6 A;  1SSF A;  3KBG A;  3GF5 A;  2DE0 X;  2JTF A;  3CXC P;  2K4Y A;  1UUE A;  5GAM e;  3SEM A;  4M78 G;  1YI2 T;  2KVQ G;  6AT1 B;  5KE3 A;  1YI2 A;  4J6X A;  1UG1 A;  3NPF A;  2V26 A;  2BUD A;  3UA6 A;  4M7D G;  1CKA A;  3L2U A;  2V8K A;  2F2W A;  1GL5 A;  1HSQ A;  1PCX A;  3E9F A;  5C0M A;  2Y4X A;  1ABQ A;  2EYX A;  1AT1 B;  1QQJ A;  4QQD A;  1RAI B;  4LXC A;  1PSE A;  2X3X D;  2LC4 A;  5KYW A;  4ZNX A;  4FSX A;  1VQO Q;  4HCZ A;  1W1F A;  4IKF A;  5KYX A;  1PKT A;  3VS0 A;  2P0K A;  4AG1 C;  4ZGJ B;  3ULR B;  2ESW A;  2YSQ A;  3PFS A;  2H3E B;  3V8J A;  2F2X A;  2KXC A;  4F7U E;  4J7F A;  5HCK A;  4M7D A;  2K3B A;  3FC3 A;  4XTV A;  5GAM j;  5AYF A;  3EG0 A;  2D9T A;  4PJO B;  1I5L A;  1TSF A;  1OEB A;  2LT1 A;  1VQ4 A;  1NYF A;  1YIT Q;  4M77 C;  4N4H A;  4LD6 A;  2YRV A;  2WAC A;  1IB8 A;  2MPX C;  4KT0 E;  4RUG A;  1LJO A;  2VYT A;  2XG8 D;  1TS9 A;  2O01 E;  1G5V A;  4LE9 A;  1QVF A;  3M0Q A;  1HYO A;  2FYK A;  3TSZ A;  5GAN 3;  3EG3 A;  1RLQ C;  3NFC A;  4ME7 A;  4CC4 B;  4O5V A;  1WHG A;  4ZGE B;  3QWX X;  2X35 A;  1RAB B;  1SSH A;  4JRK A;  1Q86 U;  5LJ3 h;  5I11 A;  4AT1 B;  4JPB W;  1M1G A;  3QZ9 B;  4Y92 A;  2A3L A;  3SHW A;  2A36 A;  4PJO D;  5GAO l;  2K79 A;  3G4S T;  1I8F A;  1M9S A;  1RAA B;  3G4S A;  3EG9 A;  5KE2 A;  1VQ8 Q;  3LH0 A;  3QZ5 B;  2MF2 A;  1JJ2 A;  3RKX A;  3SWN A;  3HRS A;  2RK2 A;  1NEB A;  3CC2 Q;  3JCM c;  5GMK j;  4M78 C;  5GAO r;  1TU0 B;  1D1A A;  2QQR A;  1V1C A;  1K9M R;  2ENM A;  3PNW C;  4VUB A;  4CI0 C;  2YDL A;  4M7D C;  2VGN A;  4FYW B;  4E6R A;  1PSF A;  1IXD A;  1VQ9 T;  3KXT A;  3I55 T;  1VQ9 A;  3R6N A;  2JN0 A;  2XIC A;  3I55 A;  1Q7Y R;  3C95 A;  2L3S A;  2AKK A;  1QVG A;  1ZBX A;  4C92 D;  2DEU A;  2E4H A;  4M7A G;  5GAN g;  1RAG B;  4F16 A;  1Y07 A;  4XTU A;  5IHN A;  1VA7 A;  3CXC S;  4B9X A;  5KYN A;  1D1B A;  1MUZ A;  2RN8 A;  1U3O A;  2GNC A;  3VYH B;  1N8R R;  2DZ9 A;  2X4Y A;  5GAN 7;  2E5Q A;  3ME9 A;  4XTW A;  3VRY A;  3FRN A;  3OW2 A;  1EX4 A;  3EGD B;  5LJ3 d;  5GAO p;  5FRN A;  1VQ6 Q;  1N27 A;  1XNI A;  3CCL A;  3VJP A;  4QQ6 A;  1T0J A;  1YHQ Q;  3JSC A;  4C92 G;  4M7A A;  1QCF A;  4J9D A;  1QW1 A;  1YP5 A;  1KFZ A;  1UDL A;  3N5B B;  1M90 C;  2CP0 A;  4PFP A;  2M02 A;  1M8M A;  1YJN Q;  2FZC B;  2KXD A;  1FMW A;  2NUP A;  2QTX A;  1Q82 R;  3X26 B;  2M51 A;  1QWF A; 
#chains in the Genus database with same CATH homology
 1WQ7 A;  4FT2 A;  2DXT A;  3CCV A;  1BI0 A;  2CS7 A;  2HNI A;  2RH2 A;  5FU6 B;  1M8V A;  4XTZ A;  3OA6 A;  4BB7 A;  4ZN3 A;  4E7I A;  2EJF A;  5GAO q;  2K5I A;  3BY7 A;  4M75 G;  5CK9 A;  2ZPG B;  4OVA A;  1VQK T;  1BKB A;  4UC4 A;  3MEW A;  5GAN f;  5GAM d;  2RO0 A;  5A0L A;  1VQK A;  1K8A U;  3OYK A;  3X25 B;  3L2W A;  4L5G A;  1Y96 B;  3H8Z A;  2DXU A;  5CIU A;  5FLX E;  1AHJ B;  2YHT A;  5KCH A;  2EYQ A;  3P8D A;  1BIA A;  1IZ6 A;  2DXC A;  2ZPF B;  3OYB A;  4EMG A;  1QVG S;  4OGC A;  2CZ1 B;  1RI0 A;  1QVP A;  4C0Z A;  2VV5 A;  5HK0 A;  4E7H A;  5IAY A;  4EMK A;  4C92 F;  2XU8 A;  3G71 T;  1UB4 A;  1NZ9 A;  2KAF A;  4MDW A;  2XI9 A;  3C12 A;  1M90 U;  3G71 A;  3CBM A;  3GIB A;  3QJ6 A;  1YCY A;  2AHJ B;  4N4I A;  5IT9 E;  1M1K C;  5LJ5 d;  4C8Q C;  3I56 T;  4CRI A;  2A7Y A;  2Y4Y A;  2LT4 A;  3CCS T;  3I56 A;  3INZ A;  5CQX A;  5IN1 A;  3S3O A;  4A4G A;  2DKG A;  2EQU A;  4C5I A;  3CCS A;  4IUP A;  4J6Y A;  1IRE B;  3HRT A;  3VYG A;  3VUZ A;  1OZ3 A;  1KC8 U;  2XDD A;  2XKO C;  2XDB A;  3JRZ A;  3MP1 A;  2GFA A;  4N4G A;  4RCC A;  5FRM A;  4M7D D;  3EFR A;  3WVE B;  4A53 A;  3URG A;  1KD1 U;  3HHT B;  4FT4 A;  3BW1 A;  4FM4 B;  4OGE A;  5GAN h;  1VQ6 T;  3OW2 S;  2L5Q A;  4ZTF A;  1X01 A;  2F69 A;  4BE0 A;  2E10 A;  4II1 A;  5D6W A;  5DM7 R;  1VQ6 A;  2VXF A;  1RL2 A;  2KQW A;  2RI3 A;  4J7I A;  2GFU A;  2PQW A;  3QHS A;  4M75 F;  1YHQ T;  3MCA B;  2BKD N;  3OYY A;  3LYI A;  3MP6 A;  3JCM X;  1YHQ A;  4M7A C;  2VUB A;  1NJI C;  2RD1 A;  3HFN A;  3L1A A;  4P5N A;  1UGP B;  4ATO A;  5GMK l;  3CCM A;  4PJO G;  4KBM B;  3LX7 A;  2F5T X;  1TH7 A;  3CEY A;  5GAO m;  2RHU A;  4M77 F;  1YJW T;  4LDU A;  1O75 A;  4MMK A;  4Z02 A;  4C8Q E;  1Y71 A;  3OSV A;  2KSS A;  1YJN T;  2I2L A;  3G7Z A;  4GLK A;  2RHZ A;  5GAN 5;  3OYN A;  3OYJ A;  1YJN A;  3JB9 H;  5GAO n;  3V7S A;  3OY9 A;  2DZC A;  1R8O B;  5J3B A;  2QQB A;  2O4X A;  3L2V A;  2H3J A;  2Y90 A;  1NPR A;  2HQE A;  3QJY A;  1M1K U;  2C06 A;  4MDX A;  2GCX A;  5I2S A;  1GXI E;  4PJO E;  5L8R E;  4FL6 A;  3VUB A;  3PTA A;  4PL6 A;  2LQK A;  3QPH A;  2OTL T;  3C4S A;  2E64 A;  5GMK i;  3HP9 A;  4XU1 A;  4C8Q A;  2R58 A;  2VXE A;  3PIP A;  3V8K A;  4C5H A;  4QVD A;  4JUV A;  2E41 A;  3FDR A;  2ZPE B;  3UT1 A;  4FU6 A;  2DEQ A;  3M4Y A;  3NTI A;  4C92 C;  2OAU A;  3PIO A;  3GPL A;  1JRI A;  3OYH A;  2FL7 A;  3LGF A;  5CKH A;  3ZBD A;  1VIE A;  2GF7 A;  3M56 A;  4C0F A;  1W2B A;  2V8I A;  4PJO A;  1FWZ A;  1MHN A;  4EMK C;  4F7U G;  3CPW S;  5DLO A;  1KHI A;  1U1S A;  4JLG A;  3M58 A;  3CCJ A;  4LDV A;  2RB6 A;  3E1S A;  3JAM E;  1MGQ A;  3SD4 A;  2K3Y A;  4C8Q B;  1G3S A;  2ZZD A;  3RUX A;  2LTO A;  5M9O A;  3QKJ A;  2XID A;  2QXF A;  4XU2 A;  4EMH A;  3BFM A;  3ER0 A;  4QVZ A;  4MML A;  1UGQ B;  3FIF A;  2RM4 A;  1BI2 A;  2D6F A;  4DOW A;  4C5E A;  5GAN 8;  4ELZ C;  4M75 C;  1NE8 A;  2CGH A;  4IUQ A;  4FIB A;  4MZT A;  3HFO A;  2E1H A;  3OQ5 A;  4HA8 A;  3J81 E;  1VQ4 T;  3WVD B;  3QBY A;  1OYX A;  4RG8 A;  1VQN A;  3JB9 I;  1KC8 C;  2ZPB B;  3P8B B;  1G3Y A;  4BE1 A;  3MET A;  4M7D F;  2CZ7 B;  1ZQ1 A;  1KD1 C;  1UGS B;  2M0O A;  5C6S A;  2X4W A;  3CC7 T;  4M7A B;  2DVE A;  3CD6 T;  3DLL A;  2IG0 A;  2OTJ T;  1I4K 1;  2MWP A;  5GAN d;  3CC7 A;  2KMT A;  2OTJ A;  2K2V A;  4NOY A;  4MZP A;  3QII A;  4OB2 B;  3OBW A;  3G6E T;  3RMS A;  3LGL A;  3G6E A;  3L42 A;  1ZHI A;  4OB0 B;  4A54 A;  1VQL T;  4J8O A;  4C92 A;  2R57 A;  2L8D A;  4M77 G;  2LCC A;  3NTH A;  4Q5W A;  4KUL A;  1VQL A;  3RKW A;  1XQH A;  3CPW A;  4OP0 A;  3R6O A;  1G3T A;  4F7U F;  1WQW A;  2RHX A;  3DLM A;  1YJ9 T;  5DLQ E;  1NPP A;  3A8O B;  3CCU T;  4JRP A;  1YJ9 A;  3PT9 A;  3CBP A;  4M75 E;  1OI1 A;  3J80 E;  3CCU A;  4PKC C;  3JCM Q;  2RA2 A;  2LDM A;  1V29 B;  4IUV A;  3SB2 A;  2R5A A;  2ZGW A;  3E19 A;  3S6W A;  4RG2 A;  2K57 A;  3EAE A;  3EFS A;  2JVV A;  2LQ8 A;  3M53 A;  4JRI A;  5HKC A;  2RHY A;  2WSE E;  3CPF A;  3M4G A;  3WXM B;  3FLG A;  4ZN1 A;  4M77 E;  1KQ1 A;  5LJ3 e;  4LD9 K;  4M78 D;  5GAM f;  1QP3 A;  2PUO B;  3JCM P;  3PGG A;  4PLL A;  4JRQ A;  1QP2 A;  4OMF B;  1U1T A;  3OYC A;  3RMQ A;  4C0G A;  4C92 B;  2XD0 A;  4LDX A;  4QQG A;  2DIG A;  4Y28 E;  3RES A;  3RKY A;  3O8V A;  4M75 A;  5FRO A;  4PJO C;  3CBO A;  2PU9 B;  1OZ2 A;  2XHC A;  1WGS A;  4OF1 A;  3JCM g;  2HQX A;  3RIR A;  1S72 T;  4EMK B;  2QEX T;  1W2B S;  1KQS A;  2CZ0 B;  4M7A D;  1WNL A;  2E70 A;  4PLI A;  4PNO A;  4DQ2 A;  2EIF A;  3CCE T;  1S72 A;  2QEX A;  4M77 A;  3L2Q A;  5HK3 A;  1Y7X A;  3OMG A;  4C5G A;  4BY6 C;  5LJ3 g;  3QUI A;  2E6N A;  1VUB A;  4KUI A;  4ZTJ A;  4X9D A;  3VU3 C;  5KH6 A;  2MMP A;  2DD4 A;  2MAM A;  4OB3 B;  1DJ7 B;  4E7K A;  4BUG A;  2RHI A;  1WJS A;  3TU4 K;  1B34 A;  2K5L A;  3MP8 A;  2EQM A;  5CKE A;  1YJW A;  3L2Z A;  3QG1 A;  3LWI A;  5HY6 A;  2E12 A;  2RJD A;  3NTK A;  1M4Z A;  1UEB A;  1SSF A;  3KBG A;  3MEV A;  4M75 B;  3GF5 A;  3S3M A;  3CCR T;  1I81 A;  2LNV A;  3FEO A;  2JTF A;  3Q1J A;  5GAM h;  1BYM A;  2K4Y A;  2KY9 A;  3V7C A;  5GAM e;  4M78 G;  3CCR A;  1YI2 T;  2KVQ G;  2YLB A;  4A4K A;  5KCO A;  5KE3 A;  1YI2 A;  4HCC A;  4J6X A;  4LDY A;  1YIJ T;  1Q82 U;  3OS2 A;  4EPC A;  2BUD A;  5LJ3 j;  4XU0 A;  1YIJ A;  3X28 B;  2OTL A;  4M7D G;  3ZEH A;  3L2U A;  2V8K A;  5D6X A;  3M59 A;  4E7J A;  3GNF B;  4RMO A;  4BI8 B;  5I21 A;  3V8L A;  2RK1 A;  2PVO B;  2P4T A;  4OB1 B;  3TEE A;  1K9M C;  3P8H A;  1B34 B;  4M78 E;  4XK8 E;  3E9F A;  3JCM W;  5LJ5 h;  5C0M A;  2Y4X A;  5LJ5 e;  2QA4 T;  4QQD A;  3CCQ T;  5GAM g;  2QA4 A;  4JJN K;  1WJR A;  5GMK m;  5CR2 A;  1VQM T;  2O4X B;  1PSE A;  3J7A F;  2WSC E;  2LC4 A;  2V8J A;  3OSS C;  2DTH A;  2LX9 A;  4FSX A;  3CCQ A;  2DIQ A;  4M7D E;  4QVC A;  3QYG B;  3JB9 D;  4HCZ A;  4EDU A;  2EJ9 A;  2YLC A;  3MEA A;  3CME T;  1VQ5 T;  4IKF A;  1JB0 E;  1FX7 A;  2VC8 A;  1VQ7 T;  2VGM A;  3CME A;  2EWN A;  4O6J A;  2P0K A;  5CO7 A;  2QQS A;  3LWH A;  1VQ5 A;  1VQ7 A;  3KUF A;  2JUF A;  4ZGJ B;  4V2S A;  1KG1 A;  2DPP B;  2EFI A;  1Q81 C;  3JCM f;  3DB4 A;  2B8A A;  3C94 A;  4BDZ A;  4R56 A;  2P0P A;  3PFS A;  3V8J A;  3M9Q A;  5A2Q E;  5LJ5 g;  2DO3 A;  3OS5 A;  3CCL T;  4F7U E;  4J7F A;  1WPY A;  3A8G B;  4M7D A;  4NS5 A;  2WSF E;  4M78 F;  4TVR A;  2X4J A;  3MO8 A;  4XTV A;  5GAM j;  3OYG A;  5AYF A;  3FC3 A;  5LJ3 f;  2D9T A;  4J6W A;  1N8R C;  3QO3 A;  4PJO B;  1KHC A;  1I5L A;  2P0Q A;  3DB3 A;  2LT1 A;  4X9C A;  4D6W A;  2RI2 A;  2RJF A;  1VQ4 A;  4BAC A;  5I2M A;  2HD0 A;  4M77 C;  5LL6 S;  3ASK A;  4N4H A;  4LD6 A;  4MZM A;  2YRV A;  2WAC A;  3SWN C;  5A0G A;  1KQS S;  2JZ2 A;  4IUR A;  2JOY A;  3M55 A;  3OYF A;  1K9M U;  2RJE A;  4BY6 B;  3SFM A;  3JCM J;  3CD6 A;  5A0D A;  2X4X A;  4IUT A;  4XAX B;  1JJ2 S;  4M7A F;  4KT0 E;  1LJO A;  5EG2 A;  2EJG A;  4A4E A;  4F7U A;  2VYT A;  4Y91 A;  2G3R A;  3X20 B;  3HSB A;  2XG8 D;  1G5V A;  2O01 E;  3JB9 G;  5LJ5 j;  3M54 A;  3CXC A;  4N0A A;  1QVF A;  1Q7Y U;  2FYK A;  1VIF A;  2KK4 A;  4GY5 A;  4LDW A;  5FU7 C;  2JNG A;  4E47 A;  5CCA A;  2EQJ A;  5GAN 3;  3NFC A;  3FB9 A;  4ME7 A;  3JCM h;  3OYD A;  4O5V A;  1M1F A;  3JCM e;  1G3W A;  3MEU A;  1Q81 U;  4ZGE B;  3GOX A;  1HXD A;  3OB9 A;  4C8Q D;  2X35 A;  2QDY B;  2QQ9 A;  3OBY A;  4L59 A;  4JRK A;  1Q86 U;  5LJ3 h;  1BI1 A;  3UPU A;  4WF2 A;  2DK3 A;  4QW2 A;  2MWO A;  3VV0 A;  4C0D C;  1M1G A;  3QZ9 B;  4F7U B;  1N8R U;  2A3L A;  1BI3 A;  3OS1 A;  4BE2 A;  1Q82 C;  1XOV A;  5CKB A;  3BDL A;  2LRQ A;  2L3R A;  1N9S A;  4PJO D;  5GAO l;  3BDU A;  1N9R A;  3G4S T;  2IVW A;  1I8F A;  1M9S A;  4JDS A;  3G4S A;  2M1H A;  1N6A A;  4X34 A;  4XTY A;  5KE2 A;  2M16 A;  3A8H B;  3E9G A;  5CQY A;  1VQO T;  2K5F A;  1YBY A;  3LH0 A;  3DKM A;  3QZ5 B;  2MI6 A;  2MF2 A;  5GAN 4;  3OYA A;  1VQO A;  1P92 A;  4XU3 A;  1JJ2 A;  3RKX A;  3GP8 A;  2D0Q B;  2K3X A;  3CCE A;  2CZ6 B;  3SWN A;  3T9N A;  3HRS A;  5LJ5 f;  2RK2 A;  4E7L A;  2DXB A;  1K73 C;  3QYH B;  3JCM c;  1BIB A;  5GMK j;  2HAX A;  4M78 C;  2LCL A;  3JCM V;  3OS0 A;  5CAI A;  3JB9 F;  5GAO r;  5CVI A;  4HCB A;  4YTL A;  4BI3 A;  2M9U A;  5J26 A;  2QQR A;  3VKI A;  4C8Q G;  1O9S A;  3F70 A;  3PNW C;  4VUB A;  4CI0 C;  4M7D C;  5GAN e;  3UWN A;  3OYI A;  2GQV A;  2VGN A;  4HKE A;  5FU6 C;  1PSF A;  1XTD A;  2ZCF B;  1VQ9 T;  1D3B A;  2EQK A;  2QI2 A;  3KXT A;  1WJQ A;  2HBP A;  3LLR A;  1JBM A;  5J39 A;  1FXX A;  3I55 T;  5CKD A;  3L2R A;  3CCM T;  1YIT T;  5CKF A;  2JN0 A;  1VQ9 A;  2FVU A;  4L6V 5;  2XIC A;  4M77 B;  3RER A;  3LW5 E;  4JLI A;  3I55 A;  3JB9 J;  1W4S A;  1YIT A;  4R55 A;  3C95 A;  2JTM A;  3FJP A;  3HL8 A;  3SWN B;  4BDY A;  3GLX A;  3CC4 T;  3OYL A;  1VQP T;  5D6Y A;  4XTX A;  4HT9 A;  3TCJ A;  1QVG A;  3CC4 A;  1VQP A;  1ZBX A;  4C92 D;  2DTI A;  2EAY A;  4M7A G;  4A4H A;  1H64 1;  4RKU E;  4N0A C;  5GAN g;  3M5A A;  4JS4 A;  1Y07 A;  2KDS A;  1LOJ A;  4NL2 A;  4XTU A;  2XDP A;  3JCM b;  4JS5 A;  2R5M A;  2RI5 A;  3GNG A;  5FU7 B;  4A4F A;  3UDC A;  5GAN 2;  3CXC S;  2PUK B;  3ZFJ A;  4B9X A;  1UGR B;  2ZPH B;  4XQ3 A;  1K73 U;  1QVF S;  3VYH B;  1D3B B;  2DD5 A;  2NLU A;  2DZ9 A;  3QDR B;  2LVM A;  1VQM A;  1Q7Y C;  1KQ2 A;  1H3Z A;  3A8M B;  3TRE A;  2X4Y A;  5GAN 7;  2DAQ A;  2E5Q A;  4DOV A;  4J5Y A;  1HK9 A;  2DTO A;  3HKS A;  5DY9 A;  4HT8 A;  4M7A E;  3ME9 A;  4XTW A;  3JCM d;  4B9W A;  3OYE A;  3FRN A;  4M78 A;  3PMT A;  3HRU A;  4C0D B;  4C8Q F;  2DJZ A;  1EIF A;  4BD3 A;  3OW2 A;  4M75 D;  1Q86 C;  4NL3 A;  4ZGD B;  5GAN j;  1NJI U;  1K8A C;  5LJ3 d;  2FHD A;  3V7R A;  3OMC A;  2E65 A;  2BIV A;  5GAO p;  5FRN A;  1N27 A;  1XNI A;  2CKK A;  2F5K A;  3CCL A;  3CMA T;  4KUD K;  3CCJ T;  3VJP A;  4DA4 A;  3CMA A;  3A8L B;  4QQ6 A;  4M77 D;  2XK0 A;  3JSC A;  1VQ8 T;  3SDZ A;  4C92 G;  1X75 C;  2PVG B;  2QQA A;  3PMI A;  4PJO F;  2E6Z A;  2RJC A;  4IUU A;  1VQ8 A;  4M7A A;  3A5Z B;  2PVD B;  1QW1 A;  3HPW A;  2L89 A;  1U8R A;  2CYZ B;  3N5B B;  3QXE B;  1M90 C;  3CC2 T;  3S3N A;  3AHU A;  4RCB A;  1Y96 A;  1X6O A;  3CC2 A;  4M78 B;  5GMK h;  1LNX A;  5GMK e;  3QSU A;  3H6Z A;  5GAN 6;  4J83 A;  2FB7 A;  3OYM A;  1M5Q 1;  3X24 B;  4ELY C;  2QTX A;  4BI4 A;  1VQN T;  3M57 A;  4C92 E;  3X26 B;  2ZPI B;  3CCV T;  4M7D B;  3MHX A;  2EKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...