3SWNA

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
TILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm7
total genus 14
structure length 76
sequence length 76
chains with identical sequence D, P, S
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnA00
3FB9A 3BFMA 1N9SA 4M7AB 4C8QA 4M7DG 4PJOE 2EJFA 2RB6A 5GAN3 1U1SA 4V2SA 1I8FA 5GAOp 3JCMV 3AHUA 4PNOA 3RKYA 4PJOG 5GAMd 3JCMe 4M7AE 4M7DE 2E64A 5LJ3d 2YHTA 3QO3A 4N0AC 4OP0A 5LJ5f 5GANf 3SWNB 4M7AG 1TH7A 5LJ3j 4A54A 4XTYA 2I2LA 3RKWA 3QUIA 4WF2A 4XQ3A 1D3BB 1LJOA 3V8LA 4M7DC 2QTXA 1U1TA 1LOJA 2DEQA 1BIBA 4PJOA 3FJPA 1I4K1 4PJOC 4RCCA 5GAN4 4M77E 4C8QF 4M7AD 4HT8A 4M77A 4C92G 1MGQA 1N9RA 3L1AA 1BIAA 5LJ5g 5GANg 2DTHA 5GAN5 5GAOn 3JCMJ 4HA8A 4M7DA 4J6WA 1HXDA 4M77G 3VU3C 3EFRA 4C92C 4C92A 1YCYA 4EMKB 4C92E 3PGGA 4XTVA 2DJZA 5I21A 3RERA 2FB7A 5GAN2 5LJ3e 3V7SA 4M7AC 4EMHA 4M75F 5GAN6 2DZCA 5GAOq 3V7CA 2RD1A 4JUVA 2DZ9A 3JCMQ 3FIFA 4C92D 4NL3A 4DQ2A 4HT9A 3RESA 2ZGWA 4M78A 2HNIA 3RIRA 2E65A 3JB9D 4JRKA 3SWNC 3JB9G 3QSUA 2VXFA 1JRIA 2EJGA 4JRIA 1WQWA 3RKXA 4JLIA 3V8JA 4F7UF 4J6XA 5CAIA 3V7RA 4C8QB 1B34A 2E10A 4N0AA 5GAMg 3HSBA 4M7AA 5DY9A 2K57A 3JCMg 3JCMX 2YLBA 1Y96B 4M75D 4M75G 4M77C 1JBMA 2DXUA 4F7UB 2EWNA 4QVCA 3JCMb 3HFOA 5GAOm 2DKGA 4M75A 4M78C 4XU3A 5GAOr 5GANe 4XU0A 5LJ5e 3EFSA 2YLCA 4M75E 4MMKA 1KQ1A 3JCMc 4C8QG 4F7UE 5GAMh 2EJ9A 2E1HA 3JCMP 1WQ7A 4QVDA 3HFNA 3JCMW 4XU1A 4M77F 4C8QE 3M4GA 4F7UG 3JB9J 1D3BA 4A53A 4J5YA 5GAMf 3JB9F 3BDUA 4X9DA 2DVEA 3BY7A 5LJ3h 3L2ZA 4NOYA 3SWNA 5LJ5d 5GANd 5GMKe 5GMKh 2RM4A 1WPYA 1KQ2A 3JB9H 2DTOA 2FYKA 4M78F 4M7DB 5GAOl 1X01A 4C92B 2RA2A 5LJ3g 4XTZA 4Y91A 1WNLA 5GMKl 4PJOB 3JCMh 4C8QC 3JB9I 4C8QD 4M7AF 1H641 4M77B 2EAYA 2Y90A 4M78D 1HK9A 4XTWA 3SB2A 2VXEA 3QHSA 4EMKA 3V8KA 4NL2A 4XTUA 2CGHA 4M78B 5GMKi 4EMGA 4M7DF 5GAMj 5GMKm 1I5LA 1M8VA 5LJ5j 5GANj 5GAMe 3JCMf 4PJOF 5LJ3f 3INZA 4M77D 4M75C 1B34B 4RCBA 4J6YA 4X9CA 4XU2A 1I81A 2DTIA 4M78G 5GAN7 4PJOD 1LNXA 3JCMd 1Y96A 2DXTA 1M5Q1 2E41A 4XTXA 5GMKj 4C92F 4EMKC 4F7UA 5LJ5h 2VC8A 3BW1A 5GANh 4M75B 4M78E 3RUXA 5GAN8 4M7DD 4MMLA 3GIBA 2JN0A
chains in the Genus database with same CATH superfamily
2PQWA 4M7AB 4AFUC 3RMQA 1PSFA 3SD4A 1I8FA 2CKKA 5KYWB 2GGRA 4J7FA 1Q82R 4C5IA 3VS4A 2C06A 3MJXA 1N6AA 3TQ7P 3V8LA 4EDUA 2DEQA 1NYGA 3OQ5A 3FJPA 1K8AU 1N27A 1TS9A 3UA7A 3UWNA 5DLOA 2HSPA 3CC2A 3EFRA 3VUZA 1X27A 3PGGA 1PC0A 2JUFA 3HTRA 4M75F 2DA9A 2HCKA 2LJ0A 4EPCA 2DNUA 1UTIA 2NYSA 1IB8A 3T9NA 2NUPA 1WXTA 3OYYA 2KE9A 1RAAB 1SKUB 2FPEA 1YJ9Q 2AKLA 5CAIA 3M0UA 4KRTA 3JCMg 3F70A 1SSFA 4M75D 2DXUA 2PZ1A 1I0CA 5LJ5e 2YLCA 3G71Q 3PT9A 2BTTA 5KYWA 3JCMW 3EH2A 2XIDA 1D3BA 3CEYA 4ZGEB 3BY7A 5HCKA 2LTOA 1K73U 4Z89A 1X75C 1D0XA 4AG1C 2KAFA 4IUUA 3CCQA 1QW1A 4K11A 2LZ6B 3FJ5A 3KUFA 2BIVA 5IHKA 2RQWA 2X35A 2VUBA 2IIMA 3X25B 3JB9I 4BE2A 4RG8A 1ZSGA 3ZL7C 3H6ZA 4MDWA 2K5IA 3CCUT 2DMOA 2RQUA 3ULRB 5FU7C 4BB7A 3HHTB 1N8RR 1B34B 3M0QA 4M78G 1OEBA 5CKDA 6AT1B 4PJOD 2L3RA 3CC7T 4L6V5 4AG2C 4M78E 2J05A 2BKDN 2KT8A 5A0LA 1Q7YR 1VQ6T 1AWJA 1E7OA 2EQMA 4OF1A 1YI2T 2YHTA 3EFOB 3I35A 2OAWA 2WSEE 4E7KA 8ATCB 4PFOA 4ELZC 4LDUA 3ASKA 2D8JA 5AT1B 2F1LA 2RK1A 2JTMA 1VQOA 4F7UF 1Y7XA 3CMEA 3CCSA 2DJZA 1SRLA 2FPFA 2LQWA 2XDPA 3REBB 3CCLA 3GF5A 4PL6A 2HBWA 5L23A 1AWWA 2QDLA 1M90R 2JW4A 2HL5C 3VUBA 2KI7A 4J6XA 1B34A 3TCJA 3M53A 1QMCA 2EWNA 3A1PA 1XJWB 1BU1A 1UGQB 3VKIA 1GCPA 2R5MA 1KD1U 2YUQA 2XICA 1OV3A 3EFOA 2EFIA 5LJ5d 3M5AA 3R6NA 5GMKe 4AFQC 4WTOB 3A8OB 1BK2A 4XTZA 2DL5A 2JJ9A 2ENMA 3CXCP 2QQ9A 1NPRA 2VXEA 3CCMA 4ZTFA 4RTYA 4M78B 5CKHA 2KT1A 2R58A 3P8HA 4E7HA 3G4SA 2J6KA 4HVUA 3URGA 3ZFJA 2EGEA 2F5TX 1S1NA 4F16A 2HQXA 1Q81R 2AZSA 3FB9A 2LCLA 4E7IA 1SEMA 1M9SA 3GBQA 2ZPFB 5FWCA 1UFFA 3A8LB 3I56T 1Z9QA 2SEMA 1AD5A 3A8MB 2JZ2A 1KQSP 4JZ4A 1YNZA 1WHLA 2L5QA 2OTJT 5IT9E 2DPPB 1UDLA 1N9RA 3CCVA 1VQ8Q 4AFZC 3JCMJ 1M3BA 4ZN1A 3OS1A 4J6WA 1HXDA 4LDVA 3CXCA 3OYDA 2E3IA 1YCYA 2LDMA 3OW2S 5FU6B 3V7CA 1PSEA 2RJFA 2RNAA 1T0HA 1VYTA 4M78A 3UPUA 1YIJT 2P84A 1JRIA 1IO6A 1C1AA 2XI9A 3NGPA 4HCZA 4ELYC 2IG0A 4IIOA 1VQLQ 1IHWA 3G1JA 5D7UA 3TSZA 3VS3A 2QA4A 5FU7B 2RJEA 3QPHA 1VQMA 3QJYA 4F7UG 5KE3A 1NPPA 3OYKA 3CD6A 2VB6A 2EYYA 1NG2A 5FU6C 3NMZC 1KIKA 2JM8A 3E9GA 1ZSZB 2HBPA 3SFMA 1ACMB 3O8VA 4B9WA 3MPUB 3CPWP 2XK0A 5KH6A 3M0TA 1W6XA 1WNLA 3ZBDA 2PVOB 4C8QD 2EAYA 3CBMA 2Y90A 1X69A 3QHSA 1MHNA 4IUQA 2LCSA 4OB1B 2Y4XA 1YI2A 5GMKm 2L3SA 2YUOA 3CMET 4J83A 2P4RA 1VQ6Q 4X9CA 4FYYB 1LNXA 1VQ4Q 1HYOA 1NM7A 1OU9A 3CCEQ 1BBZA 2RF0A 4ORZA 4JJDA 3GIBA 1UG1A 2LQ8A 2RJDA 4PJOE 1NZ9A 2JXBA 3JCMV 3RKYA 1KFZA 4PJOG 4M7AE 3JCMe 7AT1B 3CCRT 5LJ3d 3QO3A 4OP0A 4KBMB 3HRTA 1K76A 3E1SA 5IN1A 4ME7A 2QTXA 4PJJA 2RI2A 4M4ZA 3EH1A 1GFDA 2QQBA 1ZSZA 3CCQT 4PJOC 3QJ6A 2C0IA 2QQRA 3NTKA 1Y0MA 3PVQA 3VYGA 4BDZA 4KGVB 2DXBA 4CC7A 1RAEB 1RAIB 2RD1A 3FIFA 3QDFA 4JS5A 4FW1A 2XDDA 2AZVA 1YHQA 1AT1B 2MPXC 2ROLA 4CC3A 1BKBA 1UUEA 4BACA 1OX8A 1WHKA 4FSXA 4M75G 2ZCFB 4XU3A 1K1ZA 1R0CB 4XU0A 4A4EA 4BY6C 3VS2A 2K2VA 5GAMf 2DVEA 2RMOA 2L3PA 2HL3A 2P0QA 3M59A 3M54A 3JB9H 5J26A 1QVGA 3P8BB 2OTLA 1N8RU 2YUPA 1YITQ 1WLPB 4MZMA 4LN2A 3LWHA 2ZAEA 5D6XA 3CBPA 2LT1A 2EGAA 3CC4Q 1IREB 1QVPA 4RMOA 2WSFE 1MNDA 1M1KU 1VQKQ 4PJOF 4ZN3A 5FWBA 1JO8A 3ER0A 1X6GA 1W4SA 2FVUA 4C0FA 2DXTA 2KYMA 4J9GA 4KH0B 4M75B 4PJNA 4RTTA 4RTZA 4OMOA 3EG3A 3A8GB 1M3CA 5GAN3 4RKUE 1YJ9T 4MZTA 1VQ4T 2YUNA 3SHWA 3VS7A 2O01E 3CCJA 1VQ8A 1ZUKA 3OY9A 1XQHA 1R77A 2DERA 3CCMQ 1RADB 4J8OA 2LX9A 4Y92A 4J9HA 1G83A 2CDTA 3H41A 1QKXA 1K73C 2IVWA 4C8QF 3X20B 4C92G 1E6HA 2J6FA 1SHFA 1I07A 4C92A 1AOJA 2JVVA 2FZKB 3BE3A 1H8KA 1D1CA 4M7AC 2OX7A 1QP3A 4F17A 4QKUA 1VQ7A 2FRYA 2OTJA 1RI0A 2YXYA 1RLPC 1WHHA 4HT9A 1OPLA 2CYZB 4ANJA 1QCNA 1BCOA 2WSCE 3E9FA 3KFVA 4D6WA 1YI2Q 1QKWA 3CCLT 3THKA 3G4SQ 2LVMA 4D8KA 1YHQQ 3MO8A 2XU8A 3AT1B 4M75A 4C0GA 4DEXA 1Q82U 2CZ0B 5GANe 4BD3A 1FX7A 1PCXA 1M1GA 1BI3A 3JCMc 4F7UE 1Q82C 1AWOA 2MK5A 4ESRA 1RL2A 2L0AA 4OMLA 1M1FA 4C8QE 3M4GA 3G6EQ 1Q86U 4X9DA 2QQAA 3SWNA 2M0YA 5IHNA 3RDVA 4E6RA 3CMEQ 3GPLA 1BB9A 2QEXA 2FYKA 4M78F 3H0FA 2V1RA 1OZ2A 4EIKA 1N8RC 3META 3EG9B 3CPWS 1VIEA 5I2MA 3HRSA 1S72Q 2CGHA 5GMKi 2GTJA 4JRQA 1VQ9Q 5CCAA 4Q5WA 3FC3A 3J80E 3OMGA 3MEWA 4B9XA 3LH0A 1KC8C 4RCBA 1I81A 3H9NA 2ZPIB 2HEQA 2MI6A 5GMKj 2D8HA 4PFZA 3OS0A 2DO3A 4OGCA 1UJ0A 1U1SA 2FZCB 2JT4A 2F5KA 5IXBA 2R57A 2CP7A 5LJ5f 4J9FA 4JZ3A 2YSQA 4AT1B 4HKEA 4F14A 1H3ZA 3RKWA 5IXFA 2J06A 4GBQA 1WXUA 4Z8AA 1M90C 2X3WD 2GCXA 4HA8A 3VU3C 1S72T 2CUBA 4LDXA 4EMHA 3CCVQ 2DZ9A 1IZ6A 1KG1A 1NEBA 2RHZA 3JB9D 1WJSA 1M30A 3CCSQ 3V8JA 3G71A 5KYYB 4N0AA 4E47A 2LNHB 5DY9A 3QIIA 2MWPA 1VQ5A 2DXCA 4F7UB 1PNJA 3G6ET 2KBTA 1WA7A 3E2UA 2K6DA 5KCHA 1G3YA 1KQ1A 2O9SA 1MMAA 2HMAA 3JB9J 5J3BA 3QWYA 2DILA 2LRQA 3CCLQ 1QP2A 3I56A 1MMDA 5M9OA 3L2QA 1RAHB 4Y91A 1XNIA 1GBQA 1W2BS 2VV5A 4M7AF 2RHYA 1WZOA 4QQ6A 1JQQA 1JXOA 2RQRA 4OMPA 1X43A 1VQ4A 5D6YA 2MF2A 2OI3A 4C5HA 1QCFA 1OPKA 3C94A 1FMWA 4PK4A 4BDYA 2EKOA 4PLIA 1QWFA 3NFCA 3EG0A 5GANh 3BW1A 2IPOB 5GJWB 1GCQA 4OMQA 4MMLA 2LJ1A 2BZ8A 1JJ2S 2JNGA 2FPDA 1ARKA 3CQTA 3PE0A 4CC4B 4LUDA 1PRMC 1U06A 1YN8A 5GAMd 3OYJA 2C0OA 2LP5A 1FMKA 3UATA 1NE8A 4XTYA 2X51A 9ATCB 4M7DC 5GJVB 2DD4A 1BIBA 4PFPA 2ED0A 2LQKA 4PJOA 2OTLT 1YBYA 1VQKT 2H8HA 5GAOn 2CSIA 4LUEA 3A5ZB 3PIOA 1VYUA 1VQOT 4D8DA 1SG5A 1K9MU 2CP2A 5GAOq 1KC8U 1VQLA 3EGDA 2DRMA 3RIRA 4IIMA 2XHCA 3MP1A 3R6OA 1ZUUA 3I55Q 2G6FX 2QG9B 3MP8A 4L5GA 5GAMg 2EQIA 4ZGJB 1LVKA 1M8MA 1FXXA 1U3OA 1RAFB 2BE7D 4C8QG 2HZYA 2ROTA 2DIQA 2DLPA 2QA4T 4IURA 4E2FB 2EPDA 4A4GA 1MNEA 3L2ZA 4DOVA 1B7TA 5GMKh 1VQ5T 1G5VA 2HKNA 4FYVB 2KY9A 1RACB 2P4TA 2JTFA 2YRCA 2D0QB 2DE0X 5CQYA 1VQ9T 1KD1R 4PJOB 2GQIA 1JB0E 1WJQA 1X6OA 4HCKA 1I5LA 1TTHB 5LJ3f 3WVDB 2MMPA 2BZXA 1ZHIA 3EGDB 2RK2A 2DTIA 2COWA 1WPYA 5C0MA 2DL3A 5CKFA 3TREA 1VQ9A 2RPNA 1I1JA 5GAOp 3AHUA 1OI1A 4JJBA 1Q81C 2EBPA 1M27C 2EQJA 3M0RA 1PKSA 1MMNA 3FEOA 1DJ7B 3M55A 2ZPEB 1I5OB 1OYXA 3GOXA 2COZA 4J7IA 4Z02A 2QI2A 2RO0A 1PD0A 4C92C 2FRWA 2D9TA 4C92E 5LJ3e 2RHXA 2RQTA 1KJWA 1RUWA 3M0SA 2WACA 1ZA2B 1UGPB 1KK7A 3LGFA 4QT7A 2CH4W 1LCKA 2H3JA 4JRIA 2ZZDA 1NLPC 2KROA 5FW9A 2YLBA 5GAN4 5GAOm 5GAOr 1VQ6A 1SHGA 2BZYA 2CS7A 4OMMA 2O4XA 2RH2A 5GAMh 2OTLQ 2I0NA 4QVDA 5FRMA 1K0SA 4J5YA 3CCRQ 3M56A 4RTUA 2GFAA 2A36A 1EZZB 2LCCA 2YRVA 2E6NA 3UA6A 2XD0A 4OVAA 3JAME 5CQXA 3OYCA 4N4GA 3JCMh 4KT0E 5I22A 2CUDA 4XTWA 5KE2A 3EHRA 1WX6A 4JJNK 1VQ7T 2Y4YA 1M90U 1K9MR 4J9CA 3C95A 2PUOB 2DAQA 1MV3A 2EYZA 4DOWA 4LDYA 2BE9B 3A98A 3VYHB 2LJ3A 2VVKA 2CT4A 2J6OA 3BFMA 3IQLA 3CD6Q 2RB6A 5HK0A 3OYFA 5HKCA 2M16A 3TSWA 1UB4A 1TXQA 4M7AG 2O4XB 4J9DA 4QVZA 1RI9A 4KGXB 5CKBA 3VV0A 1EX4A 1WJRA 4LNPA 4IUPA 2A08A 3CCUQ 4B6MA 1KQSS 4M77A 1BYMA 3OYHA 1LPLA 4M77G 3O5ZA 3G6EA 2A28A 2E5KA 5LL6S 1OQKA 1FYNA 2GQVA 2K3YA 2KRSA 3SWNC 4LXCA 3OYMA 3X28B 3OW2A 2DJQA 3QZ9B 3HSBA 2GBQA 4OB3B 2K2MA 4QVCA 2KXDA 2OTJQ 3EFSA 3EGUA 4M75E 2E3HA 2C0TA 2JM9A 1H92A 1VQ5Q 2E1HA 3QZ5B 4A4KA 3I56Q 2KEAA 2LNVA 1AZEA 2B86A 3CXCS 3M9QA 5EC7A 2KDSA 2QA4Q 3OYGA 1D09B 2AT1B 2KMTA 3H0HA 3C4SA 4C0DB 2L8DA 2YWWA 4ZNXA 2FG0A 4M77B 2E5QA 4BE0A 1UE9A 4IUTA 2MWOA 2XKOC 4F04B 4EMGA 2JS0A 1M8VA 4JS4A 5GANj 2MIOA 1G2BA 2K9GA 1V76A 2EW3A 3VS5A 2B8AA 3S3OA 3CC7A 2O9VA 3OB9A 2VC8A 3RUXA 1D1BA 4C8QA 1V29B 3REAB 2O31A 1HSQA 4PNOA 2AIRB 2VASA 1J3TA 1K9AA 1OOTA 4GLKA 2QDYB 5GANf 4XK8E 1H3HA 4PLLA 2QAZA 1GCQC 1D0ZA 3OYBA 4CRIA 5IHIA 2I2LA 4PJMA 3VS1A 4XQ3A 2PU9B 2F2WA 1LOJA 2CSQA 1YWOA 5DM7R 4KUIA 4M7AD 1Q95G 3L2VA 1PD1A 3L1AA 4JDSA 2DTHA 2RJCA 2NUTA 4BI4A 4BE1A 1GBRA 3G4ST 2MYSA 3M0PA 4JLGA 5GAN2 2M02A 2Z0WA 2W10A 3V7SA 2DZCA 1IGQA 3Q1JA 3WXMB 1HJDA 1UGSB 4FIBA 4NL3A 2DBKA 3RNJA 5EG2A 1VQNA 4KULA 1XOVA 2RN8A 4AMCA 3I5RA 1U5SA 4CC2A 2E10A 1VQPQ 2DYBA 3CMAT 2V8JA 4M78C 4O6JA 3PFSA 1ABQA 1VQKA 2EIFA 5KYXB 2QGGA 2KNBB 3CPWA 4XU1A 3NTIA 3JV3A 3DKMA 1VIFA 1VQOQ 5LJ3h 4E7JA 1D0YA 1JJ2P 3N5BB 3CBOA 4N4HA 1KQ2A 3CCJT 3P8DA 4C92B 1SF9A 4O5VA 3QBYA 2QK0A 1NBEB 1WXBA 1JU5C 3OSSC 1PWTA 3OYNA 1IXDA 2H3EB 3CCST 3GLXA 3DB4A 3INZA 2V8KA 1XTDA 3CC4T 5HK3A 2YT6A 2QYZA 1VUBA 2CP6A 2E41A 5LJ5h 1MUZA 3MKDA 1GFCA 1VYVA 2EJFA 2DEUA 2X9HA 4V2SA 3MP6A 1YP5A 2EQUA 2CH4A 3MEUA 2RI5A 3SWNB 5KYXA 2LX7A 2DRKA 4FSSA 4R55A 3VRYA 1SRMA 4ZTJA 4KUDK 3S3MA 4FW2A 2EKHA 2CZ1B 1CSKA 1LJOA 2M9UA 1YJWQ 4R56A 3EG9A 1I4K1 2G3RA 1HD3A 4RCCA 3EHQA 3CC4A 3CCJQ 2M0OA 5GANg 2DL7A 3OSVA 1T0JA 1KD1C 3JRZA 4XTVA 5I21A 4II1A 5A0GA 5FROA 5J39A 1BI2A 2HNIA 2E65A 1YIJA 3PIPA 2M1HA 5CR2A 1FWZA 2EJGA 1WQWA 4FYWB 1IHVA 3GNGA 4LE9A 3OBYA 3HL8A 5A0DA 1A0NB 1S72A 2QGFB 1G8XA 4BUGA 2KXCA 1Q7YU 2EGCA 3EGXB 3CCQQ 2F69A 2EJ9A 3ZEHA 1UEBA 3JCMP 5A2QE 3HFNA 2HD0A 2W0ZA 1YITA 4IUVA 3QWXX 4GY5A 4NOYA 4E7ZA 1YJNA 1WI7A 1M3AA 1UJYA 1KHIA 3CCRA 5GAOl 2A37A 2YRDA 2SRCA 4C8QC 4LD6A 1GXIE 3VS0A 3ME9A 1TUDA 2K5FA 2CP0A 4JJCA 4KGZB 1Y71A 3NTHA 2K4YA 2RHIA 2QEXT 3L2WA 2PNIA 3JCMf 1PM3A 3X26B 1OZ3A 5D6WA 4M75C 5KYYA 2M51A 1M2OA 2FL7A 1Y96A 1M5Q1 4XTXA 1VQMT 2NLUA 4EMKC 4F7UA 2FZGB 4L59A 3I55T 4HVWA 3OYIA 1N9SA 4M7DG 3VS6A 4FU6A 2QASA 4FCYA 3J81E 1Y07A 4M7DE 1QVGS 2EVRA 1GL5A 3S3NA 2E64A 1GRIA 1G3SA 3EGXA 2P0KA 2OJ2A 2DD5A 2DFUA 4MZPA 3MEAA 1OULA 4WF2A 1D3BB 2L3QA 3S6WA 1ZQ1A 4IKFA 4M77E 2X4XA 1U8RA 4EMKB 4YTLA 4P5NA 3OYAA 3CCUA 3CC7Q 1ABOA 5KYUB 3EG1A 3JCMQ 2KVQG 3DB3A 4JRKA 1YHQT 1B3QA 4JPBW 2KK4A 3VJPA 1AHJB 2CZ6B 2RHUA 2K57A 2NWMA 1Y96B 4ATOA 1YJ9A 4A4FA 3JCMb 1KC8R 4DBRA 3OS5A 3RBBB 1UHFA 2F2VA 2J7IA 1BI1A 1YFNA 5CKEA 2JTEA 1BCMA 2JMCA 4Z88A 5I11A 2KR3A 2RM4A 4M7DB 3CCMT 4OMFB 5GMKl 2KRMA 1KHCA 1QWEA 2YDLA 2COYA 3M58A 3QYHB 1R8OB 4M78D 1HK9A 1Q86R 3LW5E 4EMKA 2VGMA 3V8KA 2P0PA 1RAGB 2BUDA 5GAMj 4BY6B 5KYUA 1YJNT 2V26A 3QXEB 1WFWA 1YCSB 1IRXA 3CMAQ 2VYTA 3DLMA 4FYXB 2PVGB 3D7SB 3PVLA 3TEEA 2DL4A 5L8RE 4J9BA 1MMGA 1WHGA 1P92A 1VQNT 2HQEA 4FT2A 1WIEA 1YITT 4A4HA 4Y28E 1Q86C 4FL6A 1MGQA 4M7DA 4J9EA 1O9SA 3HP9A 5AYFA 3RERA 1IGUA 2EYXA 2DF6A 3C12A 2EYWA 1NEGA 4C92D 1Z9ZA 1M1KC 2ZGWA 3QSUA 1D1AA 1PRLC 2JMAA 4E7LA 2DIGA 2ABLA 4QQGA 3L2RA 3E19A 1ZBXA 4M77C 2DETA 5FLXE 5C6SA 2DKGA 3C0CA 5CVIA 3L2UA 4HCCA 3PMIA 4WCIA 3CCEA 5ECAA 2CT3A 3I55A 3HPWA 3H8ZA 2KYBA 1AWXA 2QXFA 3CC2Q 3BDUA 3MCAB 1KSWA 1SSHA 1RABB 2LT4A 3I5SA 5IAYA 1VQ7Q 1JEGA 1KQSA 2RA2A 4QQDA 2A3LA 1WGSA 4A63B 3QKJA 4AFSC 4C0ZA 1QVFP 2VKNA 3LH5A 1VQLT 2XMFA 3TVTA 3CCET 5LJ5j 2L2PA 1AZGB 4RTWA 2X3XD 2DM1A 2HDAA 3RR6A 2CREA 5KCOA 3JCMd 4FT4A 4DBHA 2D0NA 5GAN8 4RUGA 2E70A 4RG2A 1VQ8T 2DVJA 4DBFA 4DBQA 1JXMA 3U23A 1PHTA 4ZGDB 1EIFA 2FHDA 4OGEA 2ATCB 3RMSA 3OW2P 4HT8A 4GLMA 1NJIR 4OMNA 5GAN5 2AKKA 4HXJA 1EFNA 1W70A 2EYQA 3NPFA 1QVFA 3LGLA 2FB7A 4N4IA 5GAN6 2LC4A 3VRZA 3A8HB 2F2XA 1CKBA 3G7ZA 1K8AR 2V8IA 3RKXA 1M1KR 1UHCA 1UGVA 1X2KA 4FM4B 2DX1A 2RI3A 2QTVA 1JBMA 1YIJQ 3CC2T 2DBMA 4MMKA 3GP8A 2ESWA 2CP3A 1M2VB 5HY6A 4QW2A 1VQNQ 1PG5B 2CZ7B 4M77F 4A53A 3JB9F 2PUKB 4CI0C 4TVRA 5GANd 4RTVA 1NJIC 4PKCC 2ED1A 4C0DC 1QVGP 5LJ3g 5DLQE 1AVZC 1Y57A 2VGNA 2NUZA 2XDBA 3EAEA 1UECA 4LD9K 5I2SA 1H641 3LWIA 2ZPBB 1VQPA 2E12A 3H0IA 1K8AC 5CIUA 2KSSA 1UGRB 3OYEA 3M57A 2JS2A 2DL8A 1VOMA 1E6GA 1ZBJA 4C92F 3X24B 4M7DD 3QDRB 2KGTA 1B07A 2MOXA 4JRPA 3HKSA 2K3BA 1TWBA 3L42A 1ZA1B 1WYXA 2DYIA 3OMCA 4R0KA 1M2VA 1VQPT 4PJLA 3PMTA 1T3SA 2E6ZA 3DLLA 1U1TA 3UF4A 1O75A 2ZPHB 3OYLA 3UT1A 2MAMA 4KH1B 1V1CA 3PTAA 3OS2A 1YJNQ 4HVVA 5LJ5g 2GTOA 1T3LA 2QEXQ 4C5GA 2FEIA 3M4YA 2D6FA 1Q7YC 2HSEB 2AHJB 1TSFA 1ZSZC 3FDRA 3OA6A 1QQJA 1W1FA 2A0FB 4DQ2A 1K4US 3UDCA 1Q81U 3JB9G 2VXFA 1FMVA 1YWPA 2KQWA 2E4HA 2JOYA 5FRNA 3LLRA 4JLIA 4HCBA 1OX9A 3V7RA 4C8QB 1TG0A 1ZUYA 2QQSA 5IH2A 3JCMX 1CKAA 3OBWA 3TU4K 3HRUA 1TOVA 2LQNA 4BI3A 4UC4A 4LDWA 1M4ZA 3BDLA 3JSCA 1C6VX 1ZX6A 4X34A 2PTKA 2X4JA 3LX7A 3J7AF 2NUTB 1VA7A 4VUBA 1SPKA 1RLQC 1JJ2A 3FRNA 1VQMQ 1QLYA 2CP5A 1G3TA 1K9MC 1X6BA 1NJIU 1WDXA 2MCNA 4XTUA 2ZPGB 4M7DF 1K0XA 1W2BP 5KYNA 4M77D 2R5AA 4J6YA 1G3WA 3EG2A 5GAN7 2RQVA 2VWFA 2K79A 2HKQB 1TUGB 3PNWC 1W2BA 1WHMA 1AEYA 2K7AA 3CMAA 2DK3A 1F1BB 2A7YA 1R0BG 2O88A 4N0AC 1K73R 1MV0B 1TH7A 2D1XA 1QCOA 5LJ3j 4A54A 2LMJA 3QUIA 3CCVT 3SDZA 4MDXA 5CO7A 2HAXA 1BIAA 1YJWA 5GAMe 4BI8B 2AK5A 2O2OA 4JUVA 3G71T 3I9QA 3RESA 3FLGA 3MHXA 2K5LA 3SEMA 2L89A 4OB0B 3WVEB 1X2QA 1QVFS 4M7AA 4DEYA 3QG1A 1PKTA 2X4WA 1TU0B 2XG8D 1OU8A 1TUCA 3CPFA 2X4YA 4X1VA 3HFOA 1YJWT 5CK9A 3KXTA 3KBGA 4OB2B 3CD6T 4RTXA 3NHNA 2ECZA 1N5ZA 1WQ7A 2OAUA 4J9IA 1C0MA 8AT1B 3GNFB 1ZLMA 2GF7A 2KRNA 2HQHA 2EQKA 1NLOC 1BI0A 2GNCA 2PVDB 3QYGB 2DTOA 4C5EA 1X01A 4NS5A 4XAXB 3SB2A 4E7SA 3LYIA 2NUPB 4NL2A 3MEVA 1WHJA 2GFUA 1NYFA 4XU2A 2K3XA 2V1QA 4DA4A 2JN0A 2FO0A
chains in the Genus database with same CATH topology
3A8GB 3BFMA 2PQWA 4M7AB 3RMQA 2RB6A 3TEEA 5GAN3 1PSFA 3SD4A 4RKUE 5L8RE 1I8FA 2CKKA 5HK0A 3OYFA 1YJ9T 4MZTA 1VQ4T 5HKCA 4J7FA 2M16A 2O01E 1UB4A 3CCJA 4C5IA 4M7AG 2O4XB 4QVZA 1VQ8A 2C06A 3OY9A 1P92A 5CKBA 1XQHA 3VV0A 1VQNT 1WJRA 2HQEA 1N6AA 4FT2A 3V8LA 1YITT 4EDUA 4IUPA 4J8OA 4A4HA 2LX9A 2DEQA 4Y28E 1K73C 3OQ5A 3FJPA 2IVWA 1KQSS 4C8QF 1K8AU 1Q86C 3X20B 4FL6A 1N27A 1MGQA 4M77A 3UWNA 4C92G 5DLOA 4M7DA 1BYMA 3OYHA 4M77G 4C92A 1O9SA 3EFRA 3HP9A 3VUZA 3G6EA 3CC2A 2JVVA 3PGGA 5AYFA 3RERA 2JUFA 5LL6S 4M7AC 4M75F 1QP3A 3C12A 4EPCA 1VQ7A 2OTJA 4C92D 3T9NA 1RI0A 1M1KC 4HT9A 3OYYA 2ZGWA 2GQVA 2K3YA 2CYZB 3SWNC 3QSUA 3OYMA 2WSCE 3X28B 3E9FA 4D6WA 3OW2A 4E7LA 2DIGA 3QZ9B 5CAIA 4QQGA 3CCLT 3L2RA 3HSBA 3E19A 1ZBXA 4OB3B 3JCMg 3F70A 1SSFA 2LVMA 4M75D 2DXUA 4M77C 4QVCA 3MO8A 2XU8A 5FLXE 5C6SA 2DKGA 4M75A 4C0GA 5CVIA 3L2UA 1Q82U 2CZ0B 5GANe 3PMIA 3EFSA 1FX7A 2YLCA 4BD3A 4M75E 5LJ5e 3CCEA 1M1GA 1BI3A 3PT9A 3JCMc 4F7UE 1Q82C 3I55A 3HPWA 2E1HA 3QZ5B 3H8ZA 1RL2A 3JCMW 1M1FA 4C8QE 2QXFA 3M4GA 2XIDA 1D3BA 4A4KA 1Q86U 3CEYA 3BDUA 4X9DA 4ZGEB 3BY7A 2QQAA 3MCAB 2LNVA 2LTOA 3SWNA 1K73U 1X75C 2KAFA 2LT4A 3CXCS 3GPLA 4IUUA 3M9QA 5IAYA 2QEXA 2KDSA 2FYKA 4M78F 3OYGA 3CCQA 1QW1A 2KMTA 1KQSA 1OZ2A 2RA2A 3C4SA 2A3LA 2BIVA 1WGSA 3KUFA 4QQDA 1N8RC 2X35A 3META 3QKJA 4C0DB 2L8DA 2VUBA 3X25B 4C0ZA 3JB9I 4BE2A 4RG8A 4M77B 3CPWS 1VIEA 5I2MA 2E5QA 4BE0A 3H6ZA 4IUTA 4MDWA 2XKOC 2MWOA 3HRSA 1YIJA 2CGHA 5GMKi 1VQLT 4EMGA 2K5IA 4JRQA 3CCUT 1M8VA 4JS4A 5CCAA 3CCET 5LJ5j 4Q5WA 3FC3A 5GANj 3J80E 3OMGA 3MEWA 5FU7C 4B9XA 3LH0A 4BB7A 3HHTB 1KC8C 1B34B 4RCBA 1I81A 4M78G 5CKDA 5KCOA 3JCMd 4FT4A 2ZPIB 2L3RA 2B8AA 3S3OA 4PJOD 2MI6A 5GMKj 3CC7A 3OB9A 4L6V5 2VC8A 5GAN8 3CC7T 3RUXA 4M78E 2BKDN 5A0LA 3OS0A 2DO3A 4OGCA 4C8QA 1V29B 2E70A 1VQ6T 1U1SA 4PNOA 4RG2A 1VQ8T 2F5KA 2EQMA 2R57A 4GLKA 4OF1A 1YI2T 2QDYB 2YHTA 5LJ5f 5GANf 2WSEE 4XK8E 4E7KA 4PLLA 4ELZC 3CD6A 4LDUA 3OYBA 4HKEA 4CRIA 2I2LA 1EIFA 3RKWA 4ZGDB 1H3ZA 4XQ3A 2PU9B 2FHDA 3ASKA 4OGEA 1LOJA 3RMSA 5DM7R 4KUIA 4M7AD 4HT8A 3L2VA 1M90C 3L1AA 2RK1A 2GCXA 4JDSA 5GAN5 2DTHA 2RJCA 2JTMA 4HA8A 4BI4A 4BE1A 4F7UF 3VU3C 1Y7XA 1VQOA 1S72T 3CMEA 3G4ST 3CCSA 2DJZA 2EYQA 1QVFA 3LGLA 2FB7A 4JLGA 2XDPA 5GAN2 3V7SA 4N4IA 3CCLA 3GF5A 4PL6A 4EMHA 2DZCA 2LC4A 5GAN6 3Q1JA 3A8HB 3WXMB 1UGSB 4FIBA 2DZ9A 4NL3A 1IZ6A 1KG1A 3G7ZA 2RHZA 3JB9D 5EG2A 1VQNA 1WJSA 1XOVA 4KULA 2V8IA 3VUBA 3RKXA 3V8JA 3G71A 4J6XA 1B34A 2E10A 4N0AA 4E47A 5DY9A 3TCJA 2MWPA 3M53A 3QIIA 4FM4B 2RI3A 1VQ5A 3CMAT 1JBMA 2DXCA 2V8JA 2EWNA 4F7UB 3G6ET 3CC2T 4M78C 4O6JA 5KCHA 3PFSA 4MMKA 1G3YA 1KQ1A 1UGQB 3GP8A 2EIFA 1VQKA 3VKIA 5HY6A 4QW2A 2R5MA 1KD1U 3CPWA 2CZ7B 4XU1A 4M77F 3NTIA 3JB9J 2XICA 4A53A 2PUKB 3DKMA 1VIFA 4TVRA 5J3BA 4CI0C 3JB9F 5LJ3h 4E7JA 2EFIA 2LRQA 3CBOA 3N5BB 3M5AA 5LJ5d 5GMKe 5GANd 1NJIC 4N4HA 4PKCC 1KQ2A 3CCJT 4C0DC 1QP2A 3A8OB 3P8DA 3I56A 5M9OA 3L2QA 4C92B 5LJ3g 4XTZA 5DLQE 4Y91A 1XNIA 2VGNA 2XDBA 3EAEA 3QBYA 4O5VA 2VV5A 1W2BS 5I2SA 4LD9K 4M7AF 2RHYA 1H641 4LDXA 3LWIA 2QQ9A 2ZPBB 1NPRA 1VQPA 2E12A 2VXEA 3CCMA 4ZTFA 4QQ6A 3OSSC 4M78B 5CKHA 1K8AC 2R58A 5CIUA 3P8HA 3OYNA 1VQ4A 5D6YA 4E7HA 3G4SA 2MF2A 3GLXA 3CCST 2KSSA 1UGRB 3DB4A 3INZA 4C5HA 3OYEA 3URGA 3M57A 2V8KA 1XTDA 3C94A 5HK3A 3CC4T 4BDYA 2EKOA 3ZFJA 4PLIA 2F5TX 1VUBA 2E41A 3NFCA 2HQXA 4C92F 5LJ5h 3BW1A 3X24B 5GANh 4M7DD 4MMLA 3QDRB 3FB9A 1JJ2S 2LCLA 2JNGA 4E7IA 2EJFA 4JRPA 1M9SA 3HKSA 4V2SA 2ZPFB 3MP6A 3OYJA 2EQUA 5GAMd 4HCCA 3MEUA 2RI5A 3A8LB 3L42A 3I56T 3SWNB 3OMCA 1NE8A 1VQPT 3A8MB 2JZ2A 4R55A 4XTYA 3PMTA 4ZTJA 4KUDK 2E6ZA 3S3MA 3DLLA 2CZ1B 1LJOA 2L5QA 2M9UA 4M7DC 2OTJT 1U1TA 2DD4A 1O75A 5IT9E 1BIBA 2ZPHB 2DPPB 2LQKA 4R56A 3UT1A 3OYLA 2OTLT 1I4K1 2G3RA 1YBYA 2MAMA 4RCCA 3PTAA 4PJOA 3OS2A 1VQKT 3CC4A 5GAOn 1N9RA 2M0OA 5LJ5g 5GANg 3A5ZB 3PIOA 3CCVA 3JCMJ 3OSVA 4ZN1A 3OS1A 4J6WA 1HXDA 4LDVA 3CXCA 1VQOT 3OYDA 1YCYA 1KD1C 3JRZA 4XTVA 1K9MU 4C5GA 5I21A 3M4YA 2D6FA 1Q7YC 2LDMA 4II1A 5A0GA 2AHJB 3OW2S 5FU6B 5FROA 5GAOq 3V7CA 1KC8U 1VQLA 1PSEA 3FDRA 3OA6A 2RJFA 5J39A 4DQ2A 1BI2A 4M78A 2HNIA 3RIRA 2E65A 3UDCA 3UPUA 3JB9G 3PIPA 1YIJT 2VXFA 2XHCA 3MP1A 1JRIA 3R6OA 2M1HA 2KQWA 2JOYA 5FRNA 2XI9A 5CR2A 3LLRA 1FWZA 2EJGA 1WQWA 4JLIA 4HCZA 4HCBA 3GNGA 3V7RA 3MP8A 4L5GA 4C8QB 4ELYC 5GAMg 3OBYA 2QQSA 2IG0A 3HL8A 4ZGJB 3JCMX 5A0DA 3OBWA 1S72A 3TU4K 3HRUA 4BUGA 1FXXA 1Q7YU 4C8QG 2QA4A 2F69A 5FU7B 2RJEA 2DIQA 2EJ9A 3QPHA 3ZEHA 1UEBA 3JCMP 5A2QE 1VQMA 3HFNA 3QJYA 4UC4A 4BI3A 4F7UG 5KE3A 1NPPA 2HD0A 4IURA 4LDWA 3OYKA 1M4ZA 3BDLA 4A4GA 5FU6C 1YITA 3JSCA 4IUVA 3L2ZA 4DOVA 3E9GA 4GY5A 4NOYA 1YJNA 2HBPA 5GMKh 1VQ5T 1G5VA 3SFMA 4M7DF 3O8VA 4B9WA 1KHIA 4X34A 2XK0A 2X4JA 2KY9A 3LX7A 3CCRA 5KH6A 5GAOl 3J7AF 2P4TA 2JTFA 4VUBA 1WNLA 3ZBDA 1JJ2A 2D0QB 3FRNA 5CQYA 1VQ9T 2PVOB 4PJOB 4C8QC 4C8QD 1G3TA 1JB0E 4LD6A 1K9MC 2EAYA 3CBMA 2Y90A 1GXIE 1NJIU 3ME9A 1WJQA 2K5FA 3QHSA 1MHNA 4IUQA 1Y71A 3NTHA 2K4YA 1X6OA 2RHIA 2ZPGB 2Y4XA 4OB1B 4XTUA 5GMKm 2QEXT 3L2WA 1YI2A 1I5LA 3JCMf 3CMET 3X26B 5LJ3f 1OZ3A 3WVDB 2MMPA 4J83A 1ZHIA 4M77D 4M75C 5D6WA 2R5AA 4J6YA 4X9CA 2RK2A 1G3WA 2DTIA 2FL7A 5GAN7 1LNXA 1Y96A 1M5Q1 4XTXA 1VQMT 2NLUA 4EMKC 4F7UA 4L59A 3I55T 3GIBA 1WPYA 3PNWC 1W2BA 2LQ8A 2RJDA 5C0MA 3OYIA 1N9SA 5CKFA 3TREA 4M7DG 4PJOE 1VQ9A 1NZ9A 4FU6A 3J81E 5GAOp 3CMAA 3JCMV 3AHUA 1Y07A 2DK3A 2A7YA 3RKYA 4PJOG 4M7AE 3JCMe 1QVGS 4M7DE 3S3NA 1OI1A 2E64A 3CCRT 1Q81C 5LJ3d 4N0AC 3QO3A 4OP0A 4KBMB 1G3SA 2EQJA 3HRTA 2P0KA 1TH7A 3E1SA 2DD5A 5IN1A 5LJ3j 4A54A 4MZPA 3MEAA 3QUIA 4WF2A 3FEOA 1D3BB 3CCVT 4ME7A 2QTXA 1DJ7B 2RI2A 3M55A 3SDZA 2ZPEB 4MDXA 3S6WA 1OYXA 1ZQ1A 3GOXA 2QQBA 4IKFA 3CCQT 4PJOC 3QJ6A 4M77E 5CO7A 4J7IA 4Z02A 2QI2A 2QQRA 2RO0A 2HAXA 1BIAA 2X4XA 3NTKA 2QA4T 1U8RA 1YJWA 4C92C 5GAMe 4EMKB 4YTLA 4P5NA 2D9TA 3VYGA 4BI8B 4C92E 3OYAA 4BDZA 3CCUA 5LJ3e 2DXBA 2RHXA 2RD1A 4JUVA 3G71T 3JCMQ 3FIFA 2WACA 3LGFA 1UGPB 3FLGA 2K5LA 3MHXA 3RESA 2XDDA 4JS5A 2KVQG 3DB3A 4JRKA 1YHQT 1YHQA 2KK4A 3VJPA 1AHJB 2CZ6B 2H3JA 4JRIA 1BKBA 2L89A 2ZZDA 4OB0B 3WVEB 4BACA 1QVFS 2RHUA 4M7AA 4FSXA 3QG1A 2X4WA 2XG8D 2K57A 2YLBA 1Y96B 5GAN4 4M75G 3CPFA 2X4YA 1YJ9A 4ATOA 4A4FA 3JCMb 3HFOA 5GAOm 5GAOr 2ZCFB 4XU3A 1VQ6A 4XU0A 1YJWT 4A4EA 5CK9A 3KXTA 3KBGA 2CS7A 3OS5A 4OB2B 3CD6T 2O4XA 2RH2A 4BY6C 5GAMh 1BI1A 2K2VA 1WQ7A 5CKEA 2OAUA 4QVDA 5FRMA 3GNFB 4J5YA 2GF7A 5GAMf 2DVEA 3M56A 2EQKA 1BI0A 2GFAA 2RM4A 2P0QA 2PVDB 3M59A 3M54A 3JB9H 3QYGB 5J26A 1QVGA 2DTOA 3P8BB 2OTLA 4M7DB 4C5EA 1X01A 2LCCA 2YRVA 3CCMT 2E6NA 4MZMA 3LWHA 1N8RU 4OMFB 5GMKl 4NS5A 4OVAA 5D6XA 5CQXA 3JAME 3OYCA 2XD0A 4N4GA 1KHCA 3M58A 3QYHB 4KT0E 3JCMh 3CBPA 1R8OB 2LT1A 4XAXB 4M78D 1HK9A 4XTWA 3SB2A 5KE2A 4JJNK 1VQ7T 3LYIA 3LW5E 4EMKA 2VGMA 3V8KA 1IREB 2P0PA 1QVPA 4NL2A 2Y4YA 4RMOA 1M90U 2BUDA 5GAMj 2WSFE 4BY6B 3MEVA 1M1KU 3C95A 1YJNT 2PUOB 4PJOF 4ZN3A 2DAQA 4DOWA 3QXEB 4LDYA 2GFUA 4XU2A 3ER0A 2K3XA 3VYHB 1W4SA 2VYTA 2FVUA 3DLMA 4C0FA 2DXTA 1Q81U 4DA4A 2PVGB 4M75B 2JN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB9 A;  3BFM A;  1N9S A;  4M7A B;  4C8Q A;  4M7D G;  4PJO E;  2EJF A;  2RB6 A;  5GAN 3;  1U1S A;  4V2S A;  1I8F A;  5GAO p;  3JCM V;  3AHU A;  4PNO A;  3RKY A;  4PJO G;  5GAM d;  3JCM e;  4M7A E;  4M7D E;  2E64 A;  5LJ3 d;  2YHT A;  3QO3 A;  4N0A C;  4OP0 A;  5LJ5 f;  5GAN f;  3SWN B;  4M7A G;  1TH7 A;  5LJ3 j;  4A54 A;  4XTY A;  2I2L A;  3RKW A;  3QUI A;  4WF2 A;  4XQ3 A;  1D3B B;  1LJO A;  3V8L A;  4M7D C;  2QTX A;  1U1T A;  1LOJ A;  2DEQ A;  1BIB A;  4PJO A;  3FJP A;  1I4K 1;  4PJO C;  4RCC A;  5GAN 4;  4M77 E;  4C8Q F;  4M7A D;  4HT8 A;  4M77 A;  4C92 G;  1MGQ A;  1N9R A;  3L1A A;  1BIA A;  5LJ5 g;  5GAN g;  2DTH A;  5GAN 5;  5GAO n;  3JCM J;  4HA8 A;  4M7D A;  4J6W A;  1HXD A;  4M77 G;  3VU3 C;  3EFR A;  4C92 C;  4C92 A;  1YCY A;  4EMK B;  4C92 E;  3PGG A;  4XTV A;  2DJZ A;  5I21 A;  3RER A;  2FB7 A;  5GAN 2;  5LJ3 e;  3V7S A;  4M7A C;  4EMH A;  4M75 F;  5GAN 6;  2DZC A;  5GAO q;  3V7C A;  2RD1 A;  4JUV A;  2DZ9 A;  3JCM Q;  3FIF A;  4C92 D;  4NL3 A;  4DQ2 A;  4HT9 A;  3RES A;  2ZGW A;  4M78 A;  2HNI A;  3RIR A;  2E65 A;  3JB9 D;  4JRK A;  3SWN C;  3JB9 G;  3QSU A;  2VXF A;  1JRI A;  2EJG A;  4JRI A;  1WQW A;  3RKX A;  4JLI A;  3V8J A;  4F7U F;  4J6X A;  5CAI A;  3V7R A;  4C8Q B;  1B34 A;  2E10 A;  4N0A A;  5GAM g;  3HSB A;  4M7A A;  5DY9 A;  2K57 A;  3JCM g;  3JCM X;  2YLB A;  1Y96 B;  4M75 D;  4M75 G;  4M77 C;  1JBM A;  2DXU A;  4F7U B;  2EWN A;  4QVC A;  3JCM b;  3HFO A;  5GAO m;  2DKG A;  4M75 A;  4M78 C;  4XU3 A;  5GAO r;  5GAN e;  4XU0 A;  5LJ5 e;  3EFS A;  2YLC A;  4M75 E;  4MMK A;  1KQ1 A;  3JCM c;  4C8Q G;  4F7U E;  5GAM h;  2EJ9 A;  2E1H A;  3JCM P;  1WQ7 A;  4QVD A;  3HFN A;  3JCM W;  4XU1 A;  4M77 F;  4C8Q E;  3M4G A;  4F7U G;  3JB9 J;  1D3B A;  4A53 A;  4J5Y A;  5GAM f;  3JB9 F;  3BDU A;  4X9D A;  2DVE A;  3BY7 A;  5LJ3 h;  3L2Z A;  4NOY A;  3SWN A;  5LJ5 d;  5GAN d;  5GMK e;  5GMK h;  2RM4 A;  1WPY A;  1KQ2 A;  3JB9 H;  2DTO A;  2FYK A;  4M78 F;  4M7D B;  5GAO l;  1X01 A;  4C92 B;  2RA2 A;  5LJ3 g;  4XTZ A;  4Y91 A;  1WNL A;  5GMK l;  4PJO B;  3JCM h;  4C8Q C;  3JB9 I;  4C8Q D;  4M7A F;  1H64 1;  4M77 B;  2EAY A;  2Y90 A;  4M78 D;  1HK9 A;  4XTW A;  3SB2 A;  2VXE A;  3QHS A;  4EMK A;  3V8K A;  4NL2 A;  4XTU A;  2CGH A;  4M78 B;  5GMK i;  4EMG A;  4M7D F;  5GAM j;  5GMK m;  1I5L A;  1M8V A;  5LJ5 j;  5GAN j;  5GAM e;  3JCM f;  4PJO F;  5LJ3 f;  3INZ A;  4M77 D;  4M75 C;  1B34 B;  4RCB A;  4J6Y A;  4X9C A;  4XU2 A;  1I81 A;  2DTI A;  4M78 G;  5GAN 7;  4PJO D;  1LNX A;  3JCM d;  1Y96 A;  2DXT A;  1M5Q 1;  2E41 A;  4XTX A;  5GMK j;  4C92 F;  4EMK C;  4F7U A;  5LJ5 h;  2VC8 A;  3BW1 A;  5GAN h;  4M75 B;  4M78 E;  3RUX A;  5GAN 8;  4M7D D;  4MML A;  3GIB A;  2JN0 A; 
#chains in the Genus database with same CATH topology
 2PQW A;  4M7A B;  4AFU C;  3RMQ A;  1PSF A;  3SD4 A;  1I8F A;  2CKK A;  5KYW B;  2GGR A;  4J7F A;  1Q82 R;  4C5I A;  3VS4 A;  2C06 A;  3MJX A;  1N6A A;  3TQ7 P;  3V8L A;  4EDU A;  2DEQ A;  1NYG A;  3OQ5 A;  3FJP A;  1K8A U;  1N27 A;  1TS9 A;  3UA7 A;  3UWN A;  5DLO A;  2HSP A;  3CC2 A;  3EFR A;  3VUZ A;  1X27 A;  3PGG A;  1PC0 A;  2JUF A;  3HTR A;  4M75 F;  2DA9 A;  2HCK A;  2LJ0 A;  4EPC A;  2DNU A;  1UTI A;  2NYS A;  1IB8 A;  3T9N A;  2NUP A;  1WXT A;  3OYY A;  2KE9 A;  1RAA B;  1SKU B;  2FPE A;  1YJ9 Q;  2AKL A;  5CAI A;  3M0U A;  4KRT A;  3JCM g;  3F70 A;  1SSF A;  4M75 D;  2DXU A;  2PZ1 A;  1I0C A;  5LJ5 e;  2YLC A;  3G71 Q;  3PT9 A;  2BTT A;  5KYW A;  3JCM W;  3EH2 A;  2XID A;  1D3B A;  3CEY A;  4ZGE B;  3BY7 A;  5HCK A;  2LTO A;  1K73 U;  4Z89 A;  1X75 C;  1D0X A;  4AG1 C;  2KAF A;  4IUU A;  3CCQ A;  1QW1 A;  4K11 A;  2LZ6 B;  3FJ5 A;  3KUF A;  2BIV A;  5IHK A;  2RQW A;  2X35 A;  2VUB A;  2IIM A;  3X25 B;  3JB9 I;  4BE2 A;  4RG8 A;  1ZSG A;  3ZL7 C;  3H6Z A;  4MDW A;  2K5I A;  3CCU T;  2DMO A;  2RQU A;  3ULR B;  5FU7 C;  4BB7 A;  3HHT B;  1N8R R;  1B34 B;  3M0Q A;  4M78 G;  1OEB A;  5CKD A;  6AT1 B;  4PJO D;  2L3R A;  3CC7 T;  4L6V 5;  4AG2 C;  4M78 E;  2J05 A;  2BKD N;  2KT8 A;  5A0L A;  1Q7Y R;  1VQ6 T;  1AWJ A;  1E7O A;  2EQM A;  4OF1 A;  1YI2 T;  2YHT A;  3EFO B;  3I35 A;  2OAW A;  2WSE E;  4E7K A;  8ATC B;  4PFO A;  4ELZ C;  4LDU A;  3ASK A;  2D8J A;  5AT1 B;  2F1L A;  2RK1 A;  2JTM A;  1VQO A;  4F7U F;  1Y7X A;  3CME A;  3CCS A;  2DJZ A;  1SRL A;  2FPF A;  2LQW A;  2XDP A;  3REB B;  3CCL A;  3GF5 A;  4PL6 A;  2HBW A;  5L23 A;  1AWW A;  2QDL A;  1M90 R;  2JW4 A;  2HL5 C;  3VUB A;  2KI7 A;  4J6X A;  1B34 A;  3TCJ A;  3M53 A;  1QMC A;  2EWN A;  3A1P A;  1XJW B;  1BU1 A;  1UGQ B;  3VKI A;  1GCP A;  2R5M A;  1KD1 U;  2YUQ A;  2XIC A;  1OV3 A;  3EFO A;  2EFI A;  5LJ5 d;  3M5A A;  3R6N A;  5GMK e;  4AFQ C;  4WTO B;  3A8O B;  1BK2 A;  4XTZ A;  2DL5 A;  2JJ9 A;  2ENM A;  3CXC P;  2QQ9 A;  1NPR A;  2VXE A;  3CCM A;  4ZTF A;  4RTY A;  4M78 B;  5CKH A;  2KT1 A;  2R58 A;  3P8H A;  4E7H A;  3G4S A;  2J6K A;  4HVU A;  3URG A;  3ZFJ A;  2EGE A;  2F5T X;  1S1N A;  4F16 A;  2HQX A;  1Q81 R;  2AZS A;  3FB9 A;  2LCL A;  4E7I A;  1SEM A;  1M9S A;  3GBQ A;  2ZPF B;  5FWC A;  1UFF A;  3A8L B;  3I56 T;  1Z9Q A;  2SEM A;  1AD5 A;  3A8M B;  2JZ2 A;  1KQS P;  4JZ4 A;  1YNZ A;  1WHL A;  2L5Q A;  2OTJ T;  5IT9 E;  2DPP B;  1UDL A;  1N9R A;  3CCV A;  1VQ8 Q;  4AFZ C;  3JCM J;  1M3B A;  4ZN1 A;  3OS1 A;  4J6W A;  1HXD A;  4LDV A;  3CXC A;  3OYD A;  2E3I A;  1YCY A;  2LDM A;  3OW2 S;  5FU6 B;  3V7C A;  1PSE A;  2RJF A;  2RNA A;  1T0H A;  1VYT A;  4M78 A;  3UPU A;  1YIJ T;  2P84 A;  1JRI A;  1IO6 A;  1C1A A;  2XI9 A;  3NGP A;  4HCZ A;  4ELY C;  2IG0 A;  4IIO A;  1VQL Q;  1IHW A;  3G1J A;  5D7U A;  3TSZ A;  3VS3 A;  2QA4 A;  5FU7 B;  2RJE A;  3QPH A;  1VQM A;  3QJY A;  4F7U G;  5KE3 A;  1NPP A;  3OYK A;  3CD6 A;  2VB6 A;  2EYY A;  1NG2 A;  5FU6 C;  3NMZ C;  1KIK A;  2JM8 A;  3E9G A;  1ZSZ B;  2HBP A;  3SFM A;  1ACM B;  3O8V A;  4B9W A;  3MPU B;  3CPW P;  2XK0 A;  5KH6 A;  3M0T A;  1W6X A;  1WNL A;  3ZBD A;  2PVO B;  4C8Q D;  2EAY A;  3CBM A;  2Y90 A;  1X69 A;  3QHS A;  1MHN A;  4IUQ A;  2LCS A;  4OB1 B;  2Y4X A;  1YI2 A;  5GMK m;  2L3S A;  2YUO A;  3CME T;  4J83 A;  2P4R A;  1VQ6 Q;  4X9C A;  4FYY B;  1LNX A;  1VQ4 Q;  1HYO A;  1NM7 A;  1OU9 A;  3CCE Q;  1BBZ A;  2RF0 A;  4ORZ A;  4JJD A;  3GIB A;  1UG1 A;  2LQ8 A;  2RJD A;  4PJO E;  1NZ9 A;  2JXB A;  3JCM V;  3RKY A;  1KFZ A;  4PJO G;  4M7A E;  3JCM e;  7AT1 B;  3CCR T;  5LJ3 d;  3QO3 A;  4OP0 A;  4KBM B;  3HRT A;  1K76 A;  3E1S A;  5IN1 A;  4ME7 A;  2QTX A;  4PJJ A;  2RI2 A;  4M4Z A;  3EH1 A;  1GFD A;  2QQB A;  1ZSZ A;  3CCQ T;  4PJO C;  3QJ6 A;  2C0I A;  2QQR A;  3NTK A;  1Y0M A;  3PVQ A;  3VYG A;  4BDZ A;  4KGV B;  2DXB A;  4CC7 A;  1RAE B;  1RAI B;  2RD1 A;  3FIF A;  3QDF A;  4JS5 A;  4FW1 A;  2XDD A;  2AZV A;  1YHQ A;  1AT1 B;  2MPX C;  2ROL A;  4CC3 A;  1BKB A;  1UUE A;  4BAC A;  1OX8 A;  1WHK A;  4FSX A;  4M75 G;  2ZCF B;  4XU3 A;  1K1Z A;  1R0C B;  4XU0 A;  4A4E A;  4BY6 C;  3VS2 A;  2K2V A;  5GAM f;  2DVE A;  2RMO A;  2L3P A;  2HL3 A;  2P0Q A;  3M59 A;  3M54 A;  3JB9 H;  5J26 A;  1QVG A;  3P8B B;  2OTL A;  1N8R U;  2YUP A;  1YIT Q;  1WLP B;  4MZM A;  4LN2 A;  3LWH A;  2ZAE A;  5D6X A;  3CBP A;  2LT1 A;  2EGA A;  3CC4 Q;  1IRE B;  1QVP A;  4RMO A;  2WSF E;  1MND A;  1M1K U;  1VQK Q;  4PJO F;  4ZN3 A;  5FWB A;  1JO8 A;  3ER0 A;  1X6G A;  1W4S A;  2FVU A;  4C0F A;  2DXT A;  2KYM A;  4J9G A;  4KH0 B;  4M75 B;  4PJN A;  4RTT A;  4RTZ A;  4OMO A;  3EG3 A;  3A8G B;  1M3C A;  5GAN 3;  4RKU E;  1YJ9 T;  4MZT A;  1VQ4 T;  2YUN A;  3SHW A;  3VS7 A;  2O01 E;  3CCJ A;  1VQ8 A;  1ZUK A;  3OY9 A;  1XQH A;  1R77 A;  2DER A;  3CCM Q;  1RAD B;  4J8O A;  2LX9 A;  4Y92 A;  4J9H A;  1G83 A;  2CDT A;  3H41 A;  1QKX A;  1K73 C;  2IVW A;  4C8Q F;  3X20 B;  4C92 G;  1E6H A;  2J6F A;  1SHF A;  1I07 A;  4C92 A;  1AOJ A;  2JVV A;  2FZK B;  3BE3 A;  1H8K A;  1D1C A;  4M7A C;  2OX7 A;  1QP3 A;  4F17 A;  4QKU A;  1VQ7 A;  2FRY A;  2OTJ A;  1RI0 A;  2YXY A;  1RLP C;  1WHH A;  4HT9 A;  1OPL A;  2CYZ B;  4ANJ A;  1QCN A;  1BCO A;  2WSC E;  3E9F A;  3KFV A;  4D6W A;  1YI2 Q;  1QKW A;  3CCL T;  3THK A;  3G4S Q;  2LVM A;  4D8K A;  1YHQ Q;  3MO8 A;  2XU8 A;  3AT1 B;  4M75 A;  4C0G A;  4DEX A;  1Q82 U;  2CZ0 B;  5GAN e;  4BD3 A;  1FX7 A;  1PCX A;  1M1G A;  1BI3 A;  3JCM c;  4F7U E;  1Q82 C;  1AWO A;  2MK5 A;  4ESR A;  1RL2 A;  2L0A A;  4OML A;  1M1F A;  4C8Q E;  3M4G A;  3G6E Q;  1Q86 U;  4X9D A;  2QQA A;  3SWN A;  2M0Y A;  5IHN A;  3RDV A;  4E6R A;  3CME Q;  3GPL A;  1BB9 A;  2QEX A;  2FYK A;  4M78 F;  3H0F A;  2V1R A;  1OZ2 A;  4EIK A;  1N8R C;  3MET A;  3EG9 B;  3CPW S;  1VIE A;  5I2M A;  3HRS A;  1S72 Q;  2CGH A;  5GMK i;  2GTJ A;  4JRQ A;  1VQ9 Q;  5CCA A;  4Q5W A;  3FC3 A;  3J80 E;  3OMG A;  3MEW A;  4B9X A;  3LH0 A;  1KC8 C;  4RCB A;  1I81 A;  3H9N A;  2ZPI B;  2HEQ A;  2MI6 A;  5GMK j;  2D8H A;  4PFZ A;  3OS0 A;  2DO3 A;  4OGC A;  1UJ0 A;  1U1S A;  2FZC B;  2JT4 A;  2F5K A;  5IXB A;  2R57 A;  2CP7 A;  5LJ5 f;  4J9F A;  4JZ3 A;  2YSQ A;  4AT1 B;  4HKE A;  4F14 A;  1H3Z A;  3RKW A;  5IXF A;  2J06 A;  4GBQ A;  1WXU A;  4Z8A A;  1M90 C;  2X3W D;  2GCX A;  4HA8 A;  3VU3 C;  1S72 T;  2CUB A;  4LDX A;  4EMH A;  3CCV Q;  2DZ9 A;  1IZ6 A;  1KG1 A;  1NEB A;  2RHZ A;  3JB9 D;  1WJS A;  1M30 A;  3CCS Q;  3V8J A;  3G71 A;  5KYY B;  4N0A A;  4E47 A;  2LNH B;  5DY9 A;  3QII A;  2MWP A;  1VQ5 A;  2DXC A;  4F7U B;  1PNJ A;  3G6E T;  2KBT A;  1WA7 A;  3E2U A;  2K6D A;  5KCH A;  1G3Y A;  1KQ1 A;  2O9S A;  1MMA A;  2HMA A;  3JB9 J;  5J3B A;  3QWY A;  2DIL A;  2LRQ A;  3CCL Q;  1QP2 A;  3I56 A;  1MMD A;  5M9O A;  3L2Q A;  1RAH B;  4Y91 A;  1XNI A;  1GBQ A;  1W2B S;  2VV5 A;  4M7A F;  2RHY A;  1WZO A;  4QQ6 A;  1JQQ A;  1JXO A;  2RQR A;  4OMP A;  1X43 A;  1VQ4 A;  5D6Y A;  2MF2 A;  2OI3 A;  4C5H A;  1QCF A;  1OPK A;  3C94 A;  1FMW A;  4PK4 A;  4BDY A;  2EKO A;  4PLI A;  1QWF A;  3NFC A;  3EG0 A;  5GAN h;  3BW1 A;  2IPO B;  5GJW B;  1GCQ A;  4OMQ A;  4MML A;  2LJ1 A;  2BZ8 A;  1JJ2 S;  2JNG A;  2FPD A;  1ARK A;  3CQT A;  3PE0 A;  4CC4 B;  4LUD A;  1PRM C;  1U06 A;  1YN8 A;  5GAM d;  3OYJ A;  2C0O A;  2LP5 A;  1FMK A;  3UAT A;  1NE8 A;  4XTY A;  2X51 A;  9ATC B;  4M7D C;  5GJV B;  2DD4 A;  1BIB A;  4PFP A;  2ED0 A;  2LQK A;  4PJO A;  2OTL T;  1YBY A;  1VQK T;  2H8H A;  5GAO n;  2CSI A;  4LUE A;  3A5Z B;  3PIO A;  1VYU A;  1VQO T;  4D8D A;  1SG5 A;  1K9M U;  2CP2 A;  5GAO q;  1KC8 U;  1VQL A;  3EGD A;  2DRM A;  3RIR A;  4IIM A;  2XHC A;  3MP1 A;  3R6O A;  1ZUU A;  3I55 Q;  2G6F X;  2QG9 B;  3MP8 A;  4L5G A;  5GAM g;  2EQI A;  4ZGJ B;  1LVK A;  1M8M A;  1FXX A;  1U3O A;  1RAF B;  2BE7 D;  4C8Q G;  2HZY A;  2ROT A;  2DIQ A;  2DLP A;  2QA4 T;  4IUR A;  4E2F B;  2EPD A;  4A4G A;  1MNE A;  3L2Z A;  4DOV A;  1B7T A;  5GMK h;  1VQ5 T;  1G5V A;  2HKN A;  4FYV B;  2KY9 A;  1RAC B;  2P4T A;  2JTF A;  2YRC A;  2D0Q B;  2DE0 X;  5CQY A;  1VQ9 T;  1KD1 R;  4PJO B;  2GQI A;  1JB0 E;  1WJQ A;  1X6O A;  4HCK A;  1I5L A;  1TTH B;  5LJ3 f;  3WVD B;  2MMP A;  2BZX A;  1ZHI A;  3EGD B;  2RK2 A;  2DTI A;  2COW A;  1WPY A;  5C0M A;  2DL3 A;  5CKF A;  3TRE A;  1VQ9 A;  2RPN A;  1I1J A;  5GAO p;  3AHU A;  1OI1 A;  4JJB A;  1Q81 C;  2EBP A;  1M27 C;  2EQJ A;  3M0R A;  1PKS A;  1MMN A;  3FEO A;  1DJ7 B;  3M55 A;  2ZPE B;  1I5O B;  1OYX A;  3GOX A;  2COZ A;  4J7I A;  4Z02 A;  2QI2 A;  2RO0 A;  1PD0 A;  4C92 C;  2FRW A;  2D9T A;  4C92 E;  5LJ3 e;  2RHX A;  2RQT A;  1KJW A;  1RUW A;  3M0S A;  2WAC A;  1ZA2 B;  1UGP B;  1KK7 A;  3LGF A;  4QT7 A;  2CH4 W;  1LCK A;  2H3J A;  4JRI A;  2ZZD A;  1NLP C;  2KRO A;  5FW9 A;  2YLB A;  5GAN 4;  5GAO m;  5GAO r;  1VQ6 A;  1SHG A;  2BZY A;  2CS7 A;  4OMM A;  2O4X A;  2RH2 A;  5GAM h;  2OTL Q;  2I0N A;  4QVD A;  5FRM A;  1K0S A;  4J5Y A;  3CCR Q;  3M56 A;  4RTU A;  2GFA A;  2A36 A;  1EZZ B;  2LCC A;  2YRV A;  2E6N A;  3UA6 A;  2XD0 A;  4OVA A;  3JAM E;  5CQX A;  3OYC A;  4N4G A;  3JCM h;  4KT0 E;  5I22 A;  2CUD A;  4XTW A;  5KE2 A;  3EHR A;  1WX6 A;  4JJN K;  1VQ7 T;  2Y4Y A;  1M90 U;  1K9M R;  4J9C A;  3C95 A;  2PUO B;  2DAQ A;  1MV3 A;  2EYZ A;  4DOW A;  4LDY A;  2BE9 B;  3A98 A;  3VYH B;  2LJ3 A;  2VVK A;  2CT4 A;  2J6O A;  3BFM A;  3IQL A;  3CD6 Q;  2RB6 A;  5HK0 A;  3OYF A;  5HKC A;  2M16 A;  3TSW A;  1UB4 A;  1TXQ A;  4M7A G;  2O4X B;  4J9D A;  4QVZ A;  1RI9 A;  4KGX B;  5CKB A;  3VV0 A;  1EX4 A;  1WJR A;  4LNP A;  4IUP A;  2A08 A;  3CCU Q;  4B6M A;  1KQS S;  4M77 A;  1BYM A;  3OYH A;  1LPL A;  4M77 G;  3O5Z A;  3G6E A;  2A28 A;  2E5K A;  5LL6 S;  1OQK A;  1FYN A;  2GQV A;  2K3Y A;  2KRS A;  3SWN C;  4LXC A;  3OYM A;  3X28 B;  3OW2 A;  2DJQ A;  3QZ9 B;  3HSB A;  2GBQ A;  4OB3 B;  2K2M A;  4QVC A;  2KXD A;  2OTJ Q;  3EFS A;  3EGU A;  4M75 E;  2E3H A;  2C0T A;  2JM9 A;  1H92 A;  1VQ5 Q;  2E1H A;  3QZ5 B;  4A4K A;  3I56 Q;  2KEA A;  2LNV A;  1AZE A;  2B86 A;  3CXC S;  3M9Q A;  5EC7 A;  2KDS A;  2QA4 Q;  3OYG A;  1D09 B;  2AT1 B;  2KMT A;  3H0H A;  3C4S A;  4C0D B;  2L8D A;  2YWW A;  4ZNX A;  2FG0 A;  4M77 B;  2E5Q A;  4BE0 A;  1UE9 A;  4IUT A;  2MWO A;  2XKO C;  4F04 B;  4EMG A;  2JS0 A;  1M8V A;  4JS4 A;  5GAN j;  2MIO A;  1G2B A;  2K9G A;  1V76 A;  2EW3 A;  3VS5 A;  2B8A A;  3S3O A;  3CC7 A;  2O9V A;  3OB9 A;  2VC8 A;  3RUX A;  1D1B A;  4C8Q A;  1V29 B;  3REA B;  2O31 A;  1HSQ A;  4PNO A;  2AIR B;  2VAS A;  1J3T A;  1K9A A;  1OOT A;  4GLK A;  2QDY B;  5GAN f;  4XK8 E;  1H3H A;  4PLL A;  2QAZ A;  1GCQ C;  1D0Z A;  3OYB A;  4CRI A;  5IHI A;  2I2L A;  4PJM A;  3VS1 A;  4XQ3 A;  2PU9 B;  2F2W A;  1LOJ A;  2CSQ A;  1YWO A;  5DM7 R;  4KUI A;  4M7A D;  1Q95 G;  3L2V A;  1PD1 A;  3L1A A;  4JDS A;  2DTH A;  2RJC A;  2NUT A;  4BI4 A;  4BE1 A;  1GBR A;  3G4S T;  2MYS A;  3M0P A;  4JLG A;  5GAN 2;  2M02 A;  2Z0W A;  2W10 A;  3V7S A;  2DZC A;  1IGQ A;  3Q1J A;  3WXM B;  1HJD A;  1UGS B;  4FIB A;  4NL3 A;  2DBK A;  3RNJ A;  5EG2 A;  1VQN A;  4KUL A;  1XOV A;  2RN8 A;  4AMC A;  3I5R A;  1U5S A;  4CC2 A;  2E10 A;  1VQP Q;  2DYB A;  3CMA T;  2V8J A;  4M78 C;  4O6J A;  3PFS A;  1ABQ A;  1VQK A;  2EIF A;  5KYX B;  2QGG A;  2KNB B;  3CPW A;  4XU1 A;  3NTI A;  3JV3 A;  3DKM A;  1VIF A;  1VQO Q;  5LJ3 h;  4E7J A;  1D0Y A;  1JJ2 P;  3N5B B;  3CBO A;  4N4H A;  1KQ2 A;  3CCJ T;  3P8D A;  4C92 B;  1SF9 A;  4O5V A;  3QBY A;  2QK0 A;  1NBE B;  1WXB A;  1JU5 C;  3OSS C;  1PWT A;  3OYN A;  1IXD A;  2H3E B;  3CCS T;  3GLX A;  3DB4 A;  3INZ A;  2V8K A;  1XTD A;  3CC4 T;  5HK3 A;  2YT6 A;  2QYZ A;  1VUB A;  2CP6 A;  2E41 A;  5LJ5 h;  1MUZ A;  3MKD A;  1GFC A;  1VYV A;  2EJF A;  2DEU A;  2X9H A;  4V2S A;  3MP6 A;  1YP5 A;  2EQU A;  2CH4 A;  3MEU A;  2RI5 A;  3SWN B;  5KYX A;  2LX7 A;  2DRK A;  4FSS A;  4R55 A;  3VRY A;  1SRM A;  4ZTJ A;  4KUD K;  3S3M A;  4FW2 A;  2EKH A;  2CZ1 B;  1CSK A;  1LJO A;  2M9U A;  1YJW Q;  4R56 A;  3EG9 A;  1I4K 1;  2G3R A;  1HD3 A;  4RCC A;  3EHQ A;  3CC4 A;  3CCJ Q;  2M0O A;  5GAN g;  2DL7 A;  3OSV A;  1T0J A;  1KD1 C;  3JRZ A;  4XTV A;  5I21 A;  4II1 A;  5A0G A;  5FRO A;  5J39 A;  1BI2 A;  2HNI A;  2E65 A;  1YIJ A;  3PIP A;  2M1H A;  5CR2 A;  1FWZ A;  2EJG A;  1WQW A;  4FYW B;  1IHV A;  3GNG A;  4LE9 A;  3OBY A;  3HL8 A;  5A0D A;  1A0N B;  1S72 A;  2QGF B;  1G8X A;  4BUG A;  2KXC A;  1Q7Y U;  2EGC A;  3EGX B;  3CCQ Q;  2F69 A;  2EJ9 A;  3ZEH A;  1UEB A;  3JCM P;  5A2Q E;  3HFN A;  2HD0 A;  2W0Z A;  1YIT A;  4IUV A;  3QWX X;  4GY5 A;  4NOY A;  4E7Z A;  1YJN A;  1WI7 A;  1M3A A;  1UJY A;  1KHI A;  3CCR A;  5GAO l;  2A37 A;  2YRD A;  2SRC A;  4C8Q C;  4LD6 A;  1GXI E;  3VS0 A;  3ME9 A;  1TUD A;  2K5F A;  2CP0 A;  4JJC A;  4KGZ B;  1Y71 A;  3NTH A;  2K4Y A;  2RHI A;  2QEX T;  3L2W A;  2PNI A;  3JCM f;  1PM3 A;  3X26 B;  1OZ3 A;  5D6W A;  4M75 C;  5KYY A;  2M51 A;  1M2O A;  2FL7 A;  1Y96 A;  1M5Q 1;  4XTX A;  1VQM T;  2NLU A;  4EMK C;  4F7U A;  2FZG B;  4L59 A;  3I55 T;  4HVW A;  3OYI A;  1N9S A;  4M7D G;  3VS6 A;  4FU6 A;  2QAS A;  4FCY A;  3J81 E;  1Y07 A;  4M7D E;  1QVG S;  2EVR A;  1GL5 A;  3S3N A;  2E64 A;  1GRI A;  1G3S A;  3EGX A;  2P0K A;  2OJ2 A;  2DD5 A;  2DFU A;  4MZP A;  3MEA A;  1OUL A;  4WF2 A;  1D3B B;  2L3Q A;  3S6W A;  1ZQ1 A;  4IKF A;  4M77 E;  2X4X A;  1U8R A;  4EMK B;  4YTL A;  4P5N A;  3OYA A;  3CCU A;  3CC7 Q;  1ABO A;  5KYU B;  3EG1 A;  3JCM Q;  2KVQ G;  3DB3 A;  4JRK A;  1YHQ T;  1B3Q A;  4JPB W;  2KK4 A;  3VJP A;  1AHJ B;  2CZ6 B;  2RHU A;  2K57 A;  2NWM A;  1Y96 B;  4ATO A;  1YJ9 A;  4A4F A;  3JCM b;  1KC8 R;  4DBR A;  3OS5 A;  3RBB B;  1UHF A;  2F2V A;  2J7I A;  1BI1 A;  1YFN A;  5CKE A;  2JTE A;  1BCM A;  2JMC A;  4Z88 A;  5I11 A;  2KR3 A;  2RM4 A;  4M7D B;  3CCM T;  4OMF B;  5GMK l;  2KRM A;  1KHC A;  1QWE A;  2YDL A;  2COY A;  3M58 A;  3QYH B;  1R8O B;  4M78 D;  1HK9 A;  1Q86 R;  3LW5 E;  4EMK A;  2VGM A;  3V8K A;  2P0P A;  1RAG B;  2BUD A;  5GAM j;  4BY6 B;  5KYU A;  1YJN T;  2V26 A;  3QXE B;  1WFW A;  1YCS B;  1IRX A;  3CMA Q;  2VYT A;  3DLM A;  4FYX B;  2PVG B;  3D7S B;  3PVL A;  3TEE A;  2DL4 A;  5L8R E;  4J9B A;  1MMG A;  1WHG A;  1P92 A;  1VQN T;  2HQE A;  4FT2 A;  1WIE A;  1YIT T;  4A4H A;  4Y28 E;  1Q86 C;  4FL6 A;  1MGQ A;  4M7D A;  4J9E A;  1O9S A;  3HP9 A;  5AYF A;  3RER A;  1IGU A;  2EYX A;  2DF6 A;  3C12 A;  2EYW A;  1NEG A;  4C92 D;  1Z9Z A;  1M1K C;  2ZGW A;  3QSU A;  1D1A A;  1PRL C;  2JMA A;  4E7L A;  2DIG A;  2ABL A;  4QQG A;  3L2R A;  3E19 A;  1ZBX A;  4M77 C;  2DET A;  5FLX E;  5C6S A;  2DKG A;  3C0C A;  5CVI A;  3L2U A;  4HCC A;  3PMI A;  4WCI A;  3CCE A;  5ECA A;  2CT3 A;  3I55 A;  3HPW A;  3H8Z A;  2KYB A;  1AWX A;  2QXF A;  3CC2 Q;  3BDU A;  3MCA B;  1KSW A;  1SSH A;  1RAB B;  2LT4 A;  3I5S A;  5IAY A;  1VQ7 Q;  1JEG A;  1KQS A;  2RA2 A;  4QQD A;  2A3L A;  1WGS A;  4A63 B;  3QKJ A;  4AFS C;  4C0Z A;  1QVF P;  2VKN A;  3LH5 A;  1VQL T;  2XMF A;  3TVT A;  3CCE T;  5LJ5 j;  2L2P A;  1AZG B;  4RTW A;  2X3X D;  2DM1 A;  2HDA A;  3RR6 A;  2CRE A;  5KCO A;  3JCM d;  4FT4 A;  4DBH A;  2D0N A;  5GAN 8;  4RUG A;  2E70 A;  4RG2 A;  1VQ8 T;  2DVJ A;  4DBF A;  4DBQ A;  1JXM A;  3U23 A;  1PHT A;  4ZGD B;  1EIF A;  2FHD A;  4OGE A;  2ATC B;  3RMS A;  3OW2 P;  4HT8 A;  4GLM A;  1NJI R;  4OMN A;  5GAN 5;  2AKK A;  4HXJ A;  1EFN A;  1W70 A;  2EYQ A;  3NPF A;  1QVF A;  3LGL A;  2FB7 A;  4N4I A;  5GAN 6;  2LC4 A;  3VRZ A;  3A8H B;  2F2X A;  1CKB A;  3G7Z A;  1K8A R;  2V8I A;  3RKX A;  1M1K R;  1UHC A;  1UGV A;  1X2K A;  4FM4 B;  2DX1 A;  2RI3 A;  2QTV A;  1JBM A;  1YIJ Q;  3CC2 T;  2DBM A;  4MMK A;  3GP8 A;  2ESW A;  2CP3 A;  1M2V B;  5HY6 A;  4QW2 A;  1VQN Q;  1PG5 B;  2CZ7 B;  4M77 F;  4A53 A;  3JB9 F;  2PUK B;  4CI0 C;  4TVR A;  5GAN d;  4RTV A;  1NJI C;  4PKC C;  2ED1 A;  4C0D C;  1QVG P;  5LJ3 g;  5DLQ E;  1AVZ C;  1Y57 A;  2VGN A;  2NUZ A;  2XDB A;  3EAE A;  1UEC A;  4LD9 K;  5I2S A;  1H64 1;  3LWI A;  2ZPB B;  1VQP A;  2E12 A;  3H0I A;  1K8A C;  5CIU A;  2KSS A;  1UGR B;  3OYE A;  3M57 A;  2JS2 A;  2DL8 A;  1VOM A;  1E6G A;  1ZBJ A;  4C92 F;  3X24 B;  4M7D D;  3QDR B;  2KGT A;  1B07 A;  2MOX A;  4JRP A;  3HKS A;  2K3B A;  1TWB A;  3L42 A;  1ZA1 B;  1WYX A;  2DYI A;  3OMC A;  4R0K A;  1M2V A;  1VQP T;  4PJL A;  3PMT A;  1T3S A;  2E6Z A;  3DLL A;  1U1T A;  3UF4 A;  1O75 A;  2ZPH B;  3OYL A;  3UT1 A;  2MAM A;  4KH1 B;  1V1C A;  3PTA A;  3OS2 A;  1YJN Q;  4HVV A;  5LJ5 g;  2GTO A;  1T3L A;  2QEX Q;  4C5G A;  2FEI A;  3M4Y A;  2D6F A;  1Q7Y C;  2HSE B;  2AHJ B;  1TSF A;  1ZSZ C;  3FDR A;  3OA6 A;  1QQJ A;  1W1F A;  2A0F B;  4DQ2 A;  1K4U S;  3UDC A;  1Q81 U;  3JB9 G;  2VXF A;  1FMV A;  1YWP A;  2KQW A;  2E4H A;  2JOY A;  5FRN A;  3LLR A;  4JLI A;  4HCB A;  1OX9 A;  3V7R A;  4C8Q B;  1TG0 A;  1ZUY A;  2QQS A;  5IH2 A;  3JCM X;  1CKA A;  3OBW A;  3TU4 K;  3HRU A;  1TOV A;  2LQN A;  4BI3 A;  4UC4 A;  4LDW A;  1M4Z A;  3BDL A;  3JSC A;  1C6V X;  1ZX6 A;  4X34 A;  2PTK A;  2X4J A;  3LX7 A;  3J7A F;  2NUT B;  1VA7 A;  4VUB A;  1SPK A;  1RLQ C;  1JJ2 A;  3FRN A;  1VQM Q;  1QLY A;  2CP5 A;  1G3T A;  1K9M C;  1X6B A;  1NJI U;  1WDX A;  2MCN A;  4XTU A;  2ZPG B;  4M7D F;  1K0X A;  1W2B P;  5KYN A;  4M77 D;  2R5A A;  4J6Y A;  1G3W A;  3EG2 A;  5GAN 7;  2RQV A;  2VWF A;  2K79 A;  2HKQ B;  1TUG B;  3PNW C;  1W2B A;  1WHM A;  1AEY A;  2K7A A;  3CMA A;  2DK3 A;  1F1B B;  2A7Y A;  1R0B G;  2O88 A;  4N0A C;  1K73 R;  1MV0 B;  1TH7 A;  2D1X A;  1QCO A;  5LJ3 j;  4A54 A;  2LMJ A;  3QUI A;  3CCV T;  3SDZ A;  4MDX A;  5CO7 A;  2HAX A;  1BIA A;  1YJW A;  5GAM e;  4BI8 B;  2AK5 A;  2O2O A;  4JUV A;  3G71 T;  3I9Q A;  3RES A;  3FLG A;  3MHX A;  2K5L A;  3SEM A;  2L89 A;  4OB0 B;  3WVE B;  1X2Q A;  1QVF S;  4M7A A;  4DEY A;  3QG1 A;  1PKT A;  2X4W A;  1TU0 B;  2XG8 D;  1OU8 A;  1TUC A;  3CPF A;  2X4Y A;  4X1V A;  3HFO A;  1YJW T;  5CK9 A;  3KXT A;  3KBG A;  4OB2 B;  3CD6 T;  4RTX A;  3NHN A;  2ECZ A;  1N5Z A;  1WQ7 A;  2OAU A;  4J9I A;  1C0M A;  8AT1 B;  3GNF B;  1ZLM A;  2GF7 A;  2KRN A;  2HQH A;  2EQK A;  1NLO C;  1BI0 A;  2GNC A;  2PVD B;  3QYG B;  2DTO A;  4C5E A;  1X01 A;  4NS5 A;  4XAX B;  3SB2 A;  4E7S A;  3LYI A;  2NUP B;  4NL2 A;  3MEV A;  1WHJ A;  2GFU A;  1NYF A;  4XU2 A;  2K3X A;  2V1Q A;  4DA4 A;  2JN0 A;  2FO0 A; 
#chains in the Genus database with same CATH homology
 3A8G B;  3BFM A;  2PQW A;  4M7A B;  3RMQ A;  2RB6 A;  3TEE A;  5GAN 3;  1PSF A;  3SD4 A;  4RKU E;  5L8R E;  1I8F A;  2CKK A;  5HK0 A;  3OYF A;  1YJ9 T;  4MZT A;  1VQ4 T;  5HKC A;  4J7F A;  2M16 A;  2O01 E;  1UB4 A;  3CCJ A;  4C5I A;  4M7A G;  2O4X B;  4QVZ A;  1VQ8 A;  2C06 A;  3OY9 A;  1P92 A;  5CKB A;  1XQH A;  3VV0 A;  1VQN T;  1WJR A;  2HQE A;  1N6A A;  4FT2 A;  3V8L A;  1YIT T;  4EDU A;  4IUP A;  4J8O A;  4A4H A;  2LX9 A;  2DEQ A;  4Y28 E;  1K73 C;  3OQ5 A;  3FJP A;  2IVW A;  1KQS S;  4C8Q F;  1K8A U;  1Q86 C;  3X20 B;  4FL6 A;  1N27 A;  1MGQ A;  4M77 A;  3UWN A;  4C92 G;  5DLO A;  4M7D A;  1BYM A;  3OYH A;  4M77 G;  4C92 A;  1O9S A;  3EFR A;  3HP9 A;  3VUZ A;  3G6E A;  3CC2 A;  2JVV A;  3PGG A;  5AYF A;  3RER A;  2JUF A;  5LL6 S;  4M7A C;  4M75 F;  1QP3 A;  3C12 A;  4EPC A;  1VQ7 A;  2OTJ A;  4C92 D;  3T9N A;  1RI0 A;  1M1K C;  4HT9 A;  3OYY A;  2ZGW A;  2GQV A;  2K3Y A;  2CYZ B;  3SWN C;  3QSU A;  3OYM A;  2WSC E;  3X28 B;  3E9F A;  4D6W A;  3OW2 A;  4E7L A;  2DIG A;  3QZ9 B;  5CAI A;  4QQG A;  3CCL T;  3L2R A;  3HSB A;  3E19 A;  1ZBX A;  4OB3 B;  3JCM g;  3F70 A;  1SSF A;  2LVM A;  4M75 D;  2DXU A;  4M77 C;  4QVC A;  3MO8 A;  2XU8 A;  5FLX E;  5C6S A;  2DKG A;  4M75 A;  4C0G A;  5CVI A;  3L2U A;  1Q82 U;  2CZ0 B;  5GAN e;  3PMI A;  3EFS A;  1FX7 A;  2YLC A;  4BD3 A;  4M75 E;  5LJ5 e;  3CCE A;  1M1G A;  1BI3 A;  3PT9 A;  3JCM c;  4F7U E;  1Q82 C;  3I55 A;  3HPW A;  2E1H A;  3QZ5 B;  3H8Z A;  1RL2 A;  3JCM W;  1M1F A;  4C8Q E;  2QXF A;  3M4G A;  2XID A;  1D3B A;  4A4K A;  1Q86 U;  3CEY A;  3BDU A;  4X9D A;  4ZGE B;  3BY7 A;  2QQA A;  3MCA B;  2LNV A;  2LTO A;  3SWN A;  1K73 U;  1X75 C;  2KAF A;  2LT4 A;  3CXC S;  3GPL A;  4IUU A;  3M9Q A;  5IAY A;  2QEX A;  2KDS A;  2FYK A;  4M78 F;  3OYG A;  3CCQ A;  1QW1 A;  2KMT A;  1KQS A;  1OZ2 A;  2RA2 A;  3C4S A;  2A3L A;  2BIV A;  1WGS A;  3KUF A;  4QQD A;  1N8R C;  2X35 A;  3MET A;  3QKJ A;  4C0D B;  2L8D A;  2VUB A;  3X25 B;  4C0Z A;  3JB9 I;  4BE2 A;  4RG8 A;  4M77 B;  3CPW S;  1VIE A;  5I2M A;  2E5Q A;  4BE0 A;  3H6Z A;  4IUT A;  4MDW A;  2XKO C;  2MWO A;  3HRS A;  1YIJ A;  2CGH A;  5GMK i;  1VQL T;  4EMG A;  2K5I A;  4JRQ A;  3CCU T;  1M8V A;  4JS4 A;  5CCA A;  3CCE T;  5LJ5 j;  4Q5W A;  3FC3 A;  5GAN j;  3J80 E;  3OMG A;  3MEW A;  5FU7 C;  4B9X A;  3LH0 A;  4BB7 A;  3HHT B;  1KC8 C;  1B34 B;  4RCB A;  1I81 A;  4M78 G;  5CKD A;  5KCO A;  3JCM d;  4FT4 A;  2ZPI B;  2L3R A;  2B8A A;  3S3O A;  4PJO D;  2MI6 A;  5GMK j;  3CC7 A;  3OB9 A;  4L6V 5;  2VC8 A;  5GAN 8;  3CC7 T;  3RUX A;  4M78 E;  2BKD N;  5A0L A;  3OS0 A;  2DO3 A;  4OGC A;  4C8Q A;  1V29 B;  2E70 A;  1VQ6 T;  1U1S A;  4PNO A;  4RG2 A;  1VQ8 T;  2F5K A;  2EQM A;  2R57 A;  4GLK A;  4OF1 A;  1YI2 T;  2QDY B;  2YHT A;  5LJ5 f;  5GAN f;  2WSE E;  4XK8 E;  4E7K A;  4PLL A;  4ELZ C;  3CD6 A;  4LDU A;  3OYB A;  4HKE A;  4CRI A;  2I2L A;  1EIF A;  3RKW A;  4ZGD B;  1H3Z A;  4XQ3 A;  2PU9 B;  2FHD A;  3ASK A;  4OGE A;  1LOJ A;  3RMS A;  5DM7 R;  4KUI A;  4M7A D;  4HT8 A;  3L2V A;  1M90 C;  3L1A A;  2RK1 A;  2GCX A;  4JDS A;  5GAN 5;  2DTH A;  2RJC A;  2JTM A;  4HA8 A;  4BI4 A;  4BE1 A;  4F7U F;  3VU3 C;  1Y7X A;  1VQO A;  1S72 T;  3CME A;  3G4S T;  3CCS A;  2DJZ A;  2EYQ A;  1QVF A;  3LGL A;  2FB7 A;  4JLG A;  2XDP A;  5GAN 2;  3V7S A;  4N4I A;  3CCL A;  3GF5 A;  4PL6 A;  4EMH A;  2DZC A;  2LC4 A;  5GAN 6;  3Q1J A;  3A8H B;  3WXM B;  1UGS B;  4FIB A;  2DZ9 A;  4NL3 A;  1IZ6 A;  1KG1 A;  3G7Z A;  2RHZ A;  3JB9 D;  5EG2 A;  1VQN A;  1WJS A;  1XOV A;  4KUL A;  2V8I A;  3VUB A;  3RKX A;  3V8J A;  3G71 A;  4J6X A;  1B34 A;  2E10 A;  4N0A A;  4E47 A;  5DY9 A;  3TCJ A;  2MWP A;  3M53 A;  3QII A;  4FM4 B;  2RI3 A;  1VQ5 A;  3CMA T;  1JBM A;  2DXC A;  2V8J A;  2EWN A;  4F7U B;  3G6E T;  3CC2 T;  4M78 C;  4O6J A;  5KCH A;  3PFS A;  4MMK A;  1G3Y A;  1KQ1 A;  1UGQ B;  3GP8 A;  2EIF A;  1VQK A;  3VKI A;  5HY6 A;  4QW2 A;  2R5M A;  1KD1 U;  3CPW A;  2CZ7 B;  4XU1 A;  4M77 F;  3NTI A;  3JB9 J;  2XIC A;  4A53 A;  2PUK B;  3DKM A;  1VIF A;  4TVR A;  5J3B A;  4CI0 C;  3JB9 F;  5LJ3 h;  4E7J A;  2EFI A;  2LRQ A;  3CBO A;  3N5B B;  3M5A A;  5LJ5 d;  5GMK e;  5GAN d;  1NJI C;  4N4H A;  4PKC C;  1KQ2 A;  3CCJ T;  4C0D C;  1QP2 A;  3A8O B;  3P8D A;  3I56 A;  5M9O A;  3L2Q A;  4C92 B;  5LJ3 g;  4XTZ A;  5DLQ E;  4Y91 A;  1XNI A;  2VGN A;  2XDB A;  3EAE A;  3QBY A;  4O5V A;  2VV5 A;  1W2B S;  5I2S A;  4LD9 K;  4M7A F;  2RHY A;  1H64 1;  4LDX A;  3LWI A;  2QQ9 A;  2ZPB B;  1NPR A;  1VQP A;  2E12 A;  2VXE A;  3CCM A;  4ZTF A;  4QQ6 A;  3OSS C;  4M78 B;  5CKH A;  1K8A C;  2R58 A;  5CIU A;  3P8H A;  3OYN A;  1VQ4 A;  5D6Y A;  4E7H A;  3G4S A;  2MF2 A;  3GLX A;  3CCS T;  2KSS A;  1UGR B;  3DB4 A;  3INZ A;  4C5H A;  3OYE A;  3URG A;  3M57 A;  2V8K A;  1XTD A;  3C94 A;  5HK3 A;  3CC4 T;  4BDY A;  2EKO A;  3ZFJ A;  4PLI A;  2F5T X;  1VUB A;  2E41 A;  3NFC A;  2HQX A;  4C92 F;  5LJ5 h;  3BW1 A;  3X24 B;  5GAN h;  4M7D D;  4MML A;  3QDR B;  3FB9 A;  1JJ2 S;  2LCL A;  2JNG A;  4E7I A;  2EJF A;  4JRP A;  1M9S A;  3HKS A;  4V2S A;  2ZPF B;  3MP6 A;  3OYJ A;  2EQU A;  5GAM d;  4HCC A;  3MEU A;  2RI5 A;  3A8L B;  3L42 A;  3I56 T;  3SWN B;  3OMC A;  1NE8 A;  1VQP T;  3A8M B;  2JZ2 A;  4R55 A;  4XTY A;  3PMT A;  4ZTJ A;  4KUD K;  2E6Z A;  3S3M A;  3DLL A;  2CZ1 B;  1LJO A;  2L5Q A;  2M9U A;  4M7D C;  2OTJ T;  1U1T A;  2DD4 A;  1O75 A;  5IT9 E;  1BIB A;  2ZPH B;  2DPP B;  2LQK A;  4R56 A;  3UT1 A;  3OYL A;  2OTL T;  1I4K 1;  2G3R A;  1YBY A;  2MAM A;  4RCC A;  3PTA A;  4PJO A;  3OS2 A;  1VQK T;  3CC4 A;  5GAO n;  1N9R A;  2M0O A;  5LJ5 g;  5GAN g;  3A5Z B;  3PIO A;  3CCV A;  3JCM J;  3OSV A;  4ZN1 A;  3OS1 A;  4J6W A;  1HXD A;  4LDV A;  3CXC A;  1VQO T;  3OYD A;  1YCY A;  1KD1 C;  3JRZ A;  4XTV A;  1K9M U;  4C5G A;  5I21 A;  3M4Y A;  2D6F A;  1Q7Y C;  2LDM A;  4II1 A;  5A0G A;  2AHJ B;  3OW2 S;  5FU6 B;  5FRO A;  5GAO q;  3V7C A;  1KC8 U;  1VQL A;  1PSE A;  3FDR A;  3OA6 A;  2RJF A;  5J39 A;  4DQ2 A;  1BI2 A;  4M78 A;  2HNI A;  3RIR A;  2E65 A;  3UDC A;  3UPU A;  3JB9 G;  3PIP A;  1YIJ T;  2VXF A;  2XHC A;  3MP1 A;  1JRI A;  3R6O A;  2M1H A;  2KQW A;  2JOY A;  5FRN A;  2XI9 A;  5CR2 A;  3LLR A;  1FWZ A;  2EJG A;  1WQW A;  4JLI A;  4HCZ A;  4HCB A;  3GNG A;  3V7R A;  3MP8 A;  4L5G A;  4C8Q B;  4ELY C;  5GAM g;  3OBY A;  2QQS A;  2IG0 A;  3HL8 A;  4ZGJ B;  3JCM X;  5A0D A;  3OBW A;  1S72 A;  3TU4 K;  3HRU A;  4BUG A;  1FXX A;  1Q7Y U;  4C8Q G;  2QA4 A;  2F69 A;  5FU7 B;  2RJE A;  2DIQ A;  2EJ9 A;  3QPH A;  3ZEH A;  1UEB A;  3JCM P;  5A2Q E;  1VQM A;  3HFN A;  3QJY A;  4UC4 A;  4BI3 A;  4F7U G;  5KE3 A;  1NPP A;  2HD0 A;  4IUR A;  4LDW A;  3OYK A;  1M4Z A;  3BDL A;  4A4G A;  5FU6 C;  1YIT A;  3JSC A;  4IUV A;  3L2Z A;  4DOV A;  3E9G A;  4GY5 A;  4NOY A;  1YJN A;  2HBP A;  5GMK h;  1VQ5 T;  1G5V A;  3SFM A;  4M7D F;  3O8V A;  4B9W A;  1KHI A;  4X34 A;  2XK0 A;  2X4J A;  2KY9 A;  3LX7 A;  3CCR A;  5KH6 A;  5GAO l;  3J7A F;  2P4T A;  2JTF A;  4VUB A;  1WNL A;  3ZBD A;  1JJ2 A;  2D0Q B;  3FRN A;  5CQY A;  1VQ9 T;  2PVO B;  4PJO B;  4C8Q C;  4C8Q D;  1G3T A;  1JB0 E;  4LD6 A;  1K9M C;  2EAY A;  3CBM A;  2Y90 A;  1GXI E;  1NJI U;  3ME9 A;  1WJQ A;  2K5F A;  3QHS A;  1MHN A;  4IUQ A;  1Y71 A;  3NTH A;  2K4Y A;  1X6O A;  2RHI A;  2ZPG B;  2Y4X A;  4OB1 B;  4XTU A;  5GMK m;  2QEX T;  3L2W A;  1YI2 A;  1I5L A;  3JCM f;  3CME T;  3X26 B;  5LJ3 f;  1OZ3 A;  3WVD B;  2MMP A;  4J83 A;  1ZHI A;  4M77 D;  4M75 C;  5D6W A;  2R5A A;  4J6Y A;  4X9C A;  2RK2 A;  1G3W A;  2DTI A;  2FL7 A;  5GAN 7;  1LNX A;  1Y96 A;  1M5Q 1;  4XTX A;  1VQM T;  2NLU A;  4EMK C;  4F7U A;  4L59 A;  3I55 T;  3GIB A;  1WPY A;  3PNW C;  1W2B A;  2LQ8 A;  2RJD A;  5C0M A;  3OYI A;  1N9S A;  5CKF A;  3TRE A;  4M7D G;  4PJO E;  1VQ9 A;  1NZ9 A;  4FU6 A;  3J81 E;  5GAO p;  3CMA A;  3JCM V;  3AHU A;  1Y07 A;  2DK3 A;  2A7Y A;  3RKY A;  4PJO G;  4M7A E;  3JCM e;  1QVG S;  4M7D E;  3S3N A;  1OI1 A;  2E64 A;  3CCR T;  1Q81 C;  5LJ3 d;  4N0A C;  3QO3 A;  4OP0 A;  4KBM B;  1G3S A;  2EQJ A;  3HRT A;  2P0K A;  1TH7 A;  3E1S A;  2DD5 A;  5IN1 A;  5LJ3 j;  4A54 A;  4MZP A;  3MEA A;  3QUI A;  4WF2 A;  3FEO A;  1D3B B;  3CCV T;  4ME7 A;  2QTX A;  1DJ7 B;  2RI2 A;  3M55 A;  3SDZ A;  2ZPE B;  4MDX A;  3S6W A;  1OYX A;  1ZQ1 A;  3GOX A;  2QQB A;  4IKF A;  3CCQ T;  4PJO C;  3QJ6 A;  4M77 E;  5CO7 A;  4J7I A;  4Z02 A;  2QI2 A;  2QQR A;  2RO0 A;  2HAX A;  1BIA A;  2X4X A;  3NTK A;  2QA4 T;  1U8R A;  1YJW A;  4C92 C;  5GAM e;  4EMK B;  4YTL A;  4P5N A;  2D9T A;  3VYG A;  4BI8 B;  4C92 E;  3OYA A;  4BDZ A;  3CCU A;  5LJ3 e;  2DXB A;  2RHX A;  2RD1 A;  4JUV A;  3G71 T;  3JCM Q;  3FIF A;  2WAC A;  3LGF A;  1UGP B;  3FLG A;  2K5L A;  3MHX A;  3RES A;  2XDD A;  4JS5 A;  2KVQ G;  3DB3 A;  4JRK A;  1YHQ T;  1YHQ A;  2KK4 A;  3VJP A;  1AHJ B;  2CZ6 B;  2H3J A;  4JRI A;  1BKB A;  2L89 A;  2ZZD A;  4OB0 B;  3WVE B;  4BAC A;  1QVF S;  2RHU A;  4M7A A;  4FSX A;  3QG1 A;  2X4W A;  2XG8 D;  2K57 A;  2YLB A;  1Y96 B;  5GAN 4;  4M75 G;  3CPF A;  2X4Y A;  1YJ9 A;  4ATO A;  4A4F A;  3JCM b;  3HFO A;  5GAO m;  5GAO r;  2ZCF B;  4XU3 A;  1VQ6 A;  4XU0 A;  1YJW T;  4A4E A;  5CK9 A;  3KXT A;  3KBG A;  2CS7 A;  3OS5 A;  4OB2 B;  3CD6 T;  2O4X A;  2RH2 A;  4BY6 C;  5GAM h;  1BI1 A;  2K2V A;  1WQ7 A;  5CKE A;  2OAU A;  4QVD A;  5FRM A;  3GNF B;  4J5Y A;  2GF7 A;  5GAM f;  2DVE A;  3M56 A;  2EQK A;  1BI0 A;  2GFA A;  2RM4 A;  2P0Q A;  2PVD B;  3M59 A;  3M54 A;  3JB9 H;  3QYG B;  5J26 A;  1QVG A;  2DTO A;  3P8B B;  2OTL A;  4M7D B;  4C5E A;  1X01 A;  2LCC A;  2YRV A;  3CCM T;  2E6N A;  4MZM A;  3LWH A;  1N8R U;  4OMF B;  5GMK l;  4NS5 A;  4OVA A;  5D6X A;  5CQX A;  3JAM E;  3OYC A;  2XD0 A;  4N4G A;  1KHC A;  3M58 A;  3QYH B;  4KT0 E;  3JCM h;  3CBP A;  1R8O B;  2LT1 A;  4XAX B;  4M78 D;  1HK9 A;  4XTW A;  3SB2 A;  5KE2 A;  4JJN K;  1VQ7 T;  3LYI A;  3LW5 E;  4EMK A;  2VGM A;  3V8K A;  1IRE B;  2P0P A;  1QVP A;  4NL2 A;  2Y4Y A;  4RMO A;  1M90 U;  2BUD A;  5GAM j;  2WSF E;  4BY6 B;  3MEV A;  1M1K U;  3C95 A;  1YJN T;  2PUO B;  4PJO F;  4ZN3 A;  2DAQ A;  4DOW A;  3QXE B;  4LDY A;  2GFU A;  4XU2 A;  3ER0 A;  2K3X A;  3VYH B;  1W4S A;  2VYT A;  2FVU A;  3DLM A;  4C0F A;  2DXT A;  1Q81 U;  4DA4 A;  2PVG B;  4M75 B;  2JN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...