3SWNA

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
TILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 14
structure length 76
sequence length 76
chains with identical sequence D, P, S
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnA00
1HK9A 4MMKA 2Y90A 2DKGA 4OP0A 3JB9H 2RA2A 3FB9A 4M75A 4XU2A 4X9DA 3V7CA 3V7SA 2YHTA 5GAMj 5GANj 3JB9J 4M7AF 4M77A 4C92A 3RIRA 4HT9A 1YCYA 2E41A 2YLCA 4EMKA 2DTOA 4PJOG 4C8QF 5GAMg 3QSUA 2VXFA 4M7AE 2QTXA 5LJ3d 3JCMh 4XU1A 1LOJA 4M77B 1B34A 4A54A 4C8QE 4EMKB 5CAIA 3JCMg 2YLBA 4HA8A 3JB9G 3V7RA 4J6YA 4M7AC 5GAMf 5GANf 4F7UA 3L2ZA 3JCMe 4M75G 4C8QC 4J6WA 4M78A 3RESA 4NL2A 4C92G 4XTXA 1I8FA 4M7DA 5GAN4 5GAN5 4PNOA 4XTYA 3JB9F 1D3BA 2DVEA 1U1TA 5GMKe 3GIBA 4M78B 4XU0A 4M75F 4J5YA 4XTWA 4M7DB 3JCMP 1M5Q1 1D3BB 4C92F 2DTIA 1KQ1A 4M7AD 3RUXA 4N0AC 3RKYA 1LJOA 4F7UG 5GAMd 5GANd 3BW1A 2E65A 4C8QD 3JCMb 4M78G 2DXTA 4M7DG 2DEQA 3SWNA 5DY9A 4M75C 2I2LA 3JCMQ 1I4K1 5LJ5h 4F7UF 2HNIA 4C92C 1BIBA 1N9SA 5GMKi 5GAOl 4JLIA 3QUIA 3SWNB 5GAN3 5LJ5g 4PJOF 5GAN6 5GMKh 4HT8A 2FYKA 3HFNA 5GMKj 5GAOp 1M8VA 2E1HA 4M77G 5LJ5e 4PJOE 1TH7A 3BFMA 2EAYA 4J6XA 4X9CA 3JCMf 2E64A 3EFRA 4WF2A 2EJGA 5GAN8 4XTVA 1WPYA 4M7AA 4PJOC 4QVDA 3JB9I 4M77F 5LJ3h 4M7DC 2EJFA 3SB2A 4M75E 3RERA 3INZA 4C8QA 1WQWA 3VU3C 5GAOn 3HSBA 2RM4A 1I81A 1JRIA 2CGHA 2ZGWA 2EJ9A 4RCBA 4M7AB 1BIAA 4C92E 5GMKl 5GAN7 5GAOm 3AHUA 3PGGA 1H641 4XU3A 3BDUA 4C8QB 5LJ3e 3JCMd 3QHSA 3RKWA 1I5LA 2RD1A 5GAN2 1KQ2A 2DZ9A 2VXEA 5GAOr 5LJ5j 3FIFA 4M77C 2JN0A 3JCMc 4EMHA 4EMKC 3M4GA 3JCMX 4PJOD 4NOYA 4RCCA 4M7AG 4N0AA 4M78F 4A53A 1LNXA 2DJZA 4F7UE 4M7DF 2VC8A 1WNLA 2DZCA 1U1SA 3HFOA 1X01A 4JRIA 3V8LA 4C8QG 4DQ2A 4M78E 4MMLA 3V8JA 2K57A 4QVCA 3JB9D 1JBMA 4M7DE 2DTHA 4XTUA 3QO3A 4XTZA 3RKXA 4Y91A 3L1AA 5GAMh 5GANh 2RB6A 4M75D 5LJ5f 4EMGA 1HXDA 5GMKm 5GANg 4M78C 4M77D 4C92D 4M75B 1MGQA 4V2SA 5LJ3j 1WQ7A 4NL3A 4C92B 5GAMe 5GANe 2FB7A 5LJ3g 3FJPA 4JUVA 5I21A 4M77E 4XQ3A 3JCMJ 1N9RA 1Y96A 1B34B 3JCMW 2E10A 3EFSA 2DXUA 4PJOA 5LJ5d 2EWNA 5LJ3f 3JCMV 1Y96B 4M78D 4F7UB 4JRKA 5GAOq 4M7DD 3BY7A 3V8KA 4PJOB 3SWNC
chains in the Genus database with same CATH superfamily
3H8ZA 2KXDA 2BZ8A 1UGQB 1M4ZA 3GLXA 1Y71A 3RIRA 2RHUA 1HYOA 5A0GA 4JJDA 1Q82C 1WJSA 3VS5A 3EHQA 2E5QA 2XKOC 4OB1B 4F7UA 3QIIA 4A4HA 4IIMA 3LLRA 1ZUYA 2RI2A 4LDUA 4M78B 3VS0A 2AZVA 3GNGA 3JCMP 1PHTA 2HDAA 1KQ1A 1NZ9A 4GLMA 3RUXA 1M3BA 1YI2T 4C8QD 1AZEA 4OMNA 1BI1A 3CD6A 3RMQA 2JM9A 3JCMQ 3FLGA 3M57A 5I2MA 1M1GA 3KUFA 3WVDB 4HT8A 2P0KA 4E7IA 3C95A 3VYGA 1WA7A 3M0UA 2AHJB 4BUGA 3TCJA 3A8MB 2NYSA 1WLPB 1JJ2A 3G71A 3FDRA 1WPYA 4QVDA 1UG1A 1OU9A 2LRQA 4J7FA 1UTIA 3OMCA 3OMGA 4JZ3A 2FO0A 1I5LA 3QHSA 2CUDA 2X4JA 2DZ9A 1WX6A 5CKEA 2FRYA 4LUDA 3H0FA 2J6KA 2QG9B 3L1AA 1XTDA 2IPOB 1PKTA 2RO0A 1BBZA 2AIRB 1S1NA 5IN1A 3CCVQ 2FB7A 3G6EA 4RG8A 5KCHA 2XDPA 2GFAA 1YHQA 1W2BS 1GFDA 5GJWB 3CD6Q 4IUTA 1JJ2P 1G83A 4GY5A 5CIUA 2OAWA 5FU6B 1M1KU 1MV3A 2KRSA 3UA7A 1YCYA 4EMKA 2QYZA 1UE9A 1JXOA 1D1BA 2J05A 3CCUA 2ED1A 1W70A 1JEGA 3JB9G 3JRZA 5A2QE 1RL2A 4A63B 4M7AC 5GAMf 4ZNXA 3CXCA 1KD1C 3I55T 4NL2A 3UA6A 4XTXA 3J81E 1I8FA 4XTYA 2HQXA 1Q86R 2NWMA 3N5BB 5FRMA 1N8RU 3VS4A 1UECA 3HL8A 2L3RA 2L0AA 3M0QA 4C5HA 4GLKA 4KRTA 4M7DG 1KFZA 1KQSS 8ATCB 4ELYC 3MO8A 1VQ4Q 2OTJA 3G6EQ 2OTLQ 1BIBA 3UWNA 3OYMA 3HKSA 3SWNB 2LJ1A 2GF7A 2CSIA 3CCMQ 1YHQQ 5KH6A 3KFVA 2QXFA 2JMCA 1VQKA 3QXEB 2GBQA 2IIMA 3SD4A 2IG0A 3VS7A 4Z88A 3HP9A 2HAXA 2E3HA 3LWHA 5LJ3h 3LH0A 4BE0A 5GAN7 1OU8A 3CXCP 3OYAA 4DEYA 1TS9A 1NJIR 4PFPA 1MMDA 1WHJA 2RNAA 2JN0A 3M4GA 3FEOA 4WTOB 4N0AA 1U5SA 1X43A 4KGZB 3HFOA 3SFMA 2MWPA 2OI3A 3LX7A 4F14A 4AFSC 4BACA 1Q81R 1R0CB 2LQWA 5CK9A 3CC7T 4M78C 3X20B 2O4XB 4FM4B 2LZ6B 2DYBA 4NS5A 4DBQA 1QCNA 2YSQA 2HQHA 3BDLA 1K8AC 2FZCB 2DXUA 4II1A 1MNDA 3JCMV 3CCRT 4JRKA 4BI4A 2JMAA 1WFWA 3CPWS 1J3TA 2Y90A 3L42A 4BB7A 1MUZA 4OP0A 2FZGB 3ME9A 1VQKQ 3V7SA 1GRIA 3SEMA 1ZQ1A 1B34A 4HA8A 2CH4W 3L2ZA 2K2VA 2HMAA 3NGPA 3S3OA 1M2VA 1AD5A 1UGSB 1EX4A 3M0TA 2DMOA 4C92F 2VGMA 2CUBA 3IQLA 4Z89A 3M5AA 2ED0A 3VKIA 1RABB 1NG2A 2EYYA 2JUFA 3QUIA 2LT4A 5LJ5g 1KIKA 5GAOp 3R6NA 1TH7A 3JCMf 2YXYA 1VQ8A 1VQOT 3BE3A 2GTJA 5GAN8 4XTVA 2LDMA 3OW2A 2K9GA 4M77F 2B8AA 1VQ7T 4HCBA 4M75E 3RERA 5FU6C 2EQJA 4FT2A 3KXTA 4ZTFA 8AT1B 2YRDA 3X26B 2HSEB 4C8QB 2F2VA 2O9VA 3L2VA 4RKUE 1QLYA 2D1XA 1MMAA 2DYIA 3CMAA 3META 2A37A 1V1CA 2FEIA 2LMJA 3ER0A 1G2BA 1JBMA 1ZSZA 2QEXT 1Q86U 2DTHA 2RHZA 3OYGA 5GAMh 1HXDA 3CCST 2BE7D 2W0ZA 4JDSA 2KDSA 2PQWA 5CO7A 5DM7R 2RQWA 3EGUA 4WCIA 1Y96A 1CKAA 3LW5E 5LL6S 2EWNA 4MZMA 2XI9A 3L2QA 1EFNA 1F1BB 1GBQA 3SWNC 2KRNA 4RTVA 4J9FA 4M75A 3CCEQ 2FHDA 2EYQA 3NFCA 5GANj 4M77A 4IUQA 4E47A 4FYWB 4LUEA 4IIOA 1R8OB 2HSPA 2LX7A 2XU8A 3CCQT 4JS4A 1NJIU 4RUGA 2ZPGB 2KK4A 4UC4A 3CMAQ 1D0XA 2KAFA 5FW9A 1TUCA 5GMKe 2FVUA 2ROLA 2FPFA 1X69A 3OYFA 2WSEE 5J39A 9ATCB 1D1CA 4Y28E 3C12A 1KG1A 2MOXA 2D0QB 1N9SA 3QJ6A 1G3YA 2QK0A 5D6WA 5GMKh 4OVAA 3HRSA 4QQGA 4OGCA 3M58A 2FZKB 3TQ7P 3QPHA 6AT1B 3EGXA 3A8LB 5KE3A 3MEUA 4M7DC 1T3LA 1VUBA 3HSBA 2XDDA 2PU9B 4J9DA 3VV0A 1CSKA 2M0OA 3BDUA 4MDXA 3SDZA 2AT1B 1BCMA 2KXCA 3I56Q 4L59A 1SSFA 5HY6A 4IUUA 1VQNA 4XTZA 1M1KC 1M30A 2DL7A 3MPUB 2YRCA 4Y92A 3TU4K 5KYUB 1MGQA 1JO8A 1XQHA 4J9IA 5FRNA 4ANJA 3QBYA 4XQ3A 4EDUA 3PIOA 3REAB 5DLOA 3VJPA 1M1FA 3EG1A 1WZOA 2OAUA 3EG9B 3V8KA 1C1AA 4ZN3A 2L3SA 2O9SA 2VKNA 2JZ2A 2RA2A 3OYKA 4KH0B 1MMGA 2M9UA 4LN2A 1W2BA 1LCKA 4PJOG 2K3XA 1HSQA 3H41A 3JCMh 5CAIA 3QZ9B 3CC2Q 3EH1A 4IURA 2QQAA 4C8QC 3L2RA 1K0XA 4FT4A 5GAN5 1NEBA 1VQ9T 2JNGA 2ROTA 2COWA 1Z9QA 1YJWA 4F7UG 3E9GA 1HD3A 3JV3A 1LVKA 3CCLA 2I2LA 5EG2A 4A4EA 3ZL7C 5CQXA 1Y0MA 4LD6A 1PCXA 2X3WD 5LJ5e 1W2BP 1YIJA 3EGDB 1KQSA 4Z8AA 2X4XA 3SB2A 4ZN1A 1YNZA 2RM4A 3S3MA 1DJ7B 4FCYA 3O8VA 2KROA 3RKWA 1YWPA 2VWFA 1UGVA 1X01A 2P0PA 1UJYA 2CP2A 3JB9D 1V29B 4FYXB 1PM3A 3NPFA 2VV5A 4MZPA 4C0FA 1YJWQ 2DIQA 2RI3A 3NTIA 2E4HA 3PE0A 1M27C 3EFSA 3CCLQ 1VQMA 1K0SA 2BKDN 3F70A 4F7UB 1KQSP 1KJWA 4M7DD 4KGXB 2F1LA 4PFOA 5IT9E 4MMKA 2L3QA 3A8HB 3QWXX 3JB9J 4HCZA 4M7AF 2RPNA 3NMZC 2E41A 2R57A 2K3BA 4M7AE 1AT1B 2QTXA 1YITQ 3CPWA 1RACB 4J6YA 1K73C 3JAME 2KI7A 3PVQA 3CC4Q 2MF2A 1K9AA 2O2OA 5KYXB 4OB0B 4BE2A 2DVEA 5KYYA 3LWIA 2KBTA 1O9SA 2KEAA 1D1AA 1FX7A 3M53A 2A7YA 1VQPQ 2Z0WA 4FU6A 1NPPA 1KC8R 1BCOA 1SHFA 3TSZA 3A8OB 2KYBA 3DKMA 4K11A 4FW2A 3OSSC 2E1HA 3CBMA 1VQMQ 3BFMA 3EFRA 1T0HA 4M7AA 3M56A 1I07A 3CPWP 4PLIA 1OQKA 4XU3A 4E7SA 2P84A 3I5RA 3NTKA 4ZGEB 1YI2A 1VQLT 1PG5B 2LP5A 2MPXC 1U06A 1NLPC 1ABQA 1CKBA 1GBRA 4M78F 4A53A 3CCVT 2ZPBB 3DB3A 4M78E 1JB0E 3MEWA 1QQJA 1Q7YC 1ARKA 3T9NA 4EMGA 3QWYA 3CD6T 5CQYA 4FYVB 5IAYA 1I0CA 4NL3A 1X2QA 3X28B 1O75A 3QKJA 5I21A 4JUVA 4MDWA 4QKUA 2AKKA 1VQ6A 1RLQC 1QP2A 3JCMW 3GOXA 1AHJB 4A4FA 4DBHA 2J7IA 4PK4A 1X2KA 1PSFA 2DKGA 2X4WA 5A0DA 2CZ6B 2J06A 2Y4XA 2DTOA 4KBMB 1OPLA 2MMPA 2LQNA 2PUOB 4VUBA 3V7RA 2JS2A 1K1ZA 4J9HA 3NTHA 1VYUA 3E1SA 1SKUB 2CT3A 1TUDA 3S6WA 4M78A 1PKSA 2LNHB 3PMIA 5GAN4 2JOYA 2JXBA 4QT7A 1VQ4T 1M5Q1 3G6ET 1D3BB 2OTLT 5IXFA 1PRLC 3A98A 2GFUA 1NBEB 5KYWB 5GANd 4OMOA 2LT1A 3BW1A 3CCMT 1YHQT 2CT4A 2H3EB 3G71Q 2NLUA 2V8KA 2O01E 3MCAB 2M1HA 1VQ6Q 2RHYA 2CSQA 2EFIA 4BI3A 2NUPB 3A5ZB 5GMKj 5I2SA 1VYVA 3I5SA 3I55A 2MAMA 3DLLA 2A28A 1UGRB 4BDYA 4EPCA 1NYFA 3JB9I 1Q82R 1QMCA 4J9EA 1WQWA 2CKKA 5LJ3e 2CZ0B 1UHFA 2J6OA 3H9NA 3CBOA 1EZZB 2EYWA 1YN8A 2CZ1B 2CDTA 4MMLA 2VB6A 3GBQA 2HBWA 1RAEB 5D6YA 3UF4A 4M4ZA 1KC8U 2EQIA 3CCUQ 1B34B 1VQKT 2DF6A 5KCOA 2ZZDA 1M2VB 1M8MA 3I9QA 2CYZB 3U23A 1C6VX 1YFNA 4LNPA 3S3NA 1IGQA 2LJ3A 4XU1A 2ECZA 3JCMg 1WXUA 2QASA 4M75G 3X24B 1TWBA 2OTJQ 2YUOA 2VUBA 3JB9F 2ENMA 3EFOA 4M7DB 1XJWB 2JS0A 1LJOA 2DXCA 5D7UA 3OYCA 3OS0A 3SWNA 2XG8D 3MP8A 5GAOl 3VRYA 2D6FA 5GAN6 2FYKA 2DBMA 4XK8E 4AFZC 3TSWA 2CP7A 2K5IA 1MV0B 1Y7XA 1PSEA 1SHGA 4J7IA 1MMNA 3OQ5A 3WVEB 4C92E 4FL6A 1TG0A 1AWXA 1NYGA 1X6GA 1KD1R 2RH2A 1YJ9A 2HD0A 2NUTB 2AKLA 2C0OA 5LJ5j 2FRWA 2QA4A 3C4SA 4PJOD 4QW2A 2VC8A 1M90C 2XHCA 4QVCA 1SSHA 5IHNA 1BI2A 2K5LA 2O4XA 3KBGA 2DETA 1ZBXA 4M75B 3TREA 4JRQA 1IHVA 1I1JA 1QVFS 1WQ7A 5GAMe 2QQRA 3OS2A 4M77E 1VQ7A 3JCMJ 2F5KA 3CCET 5CKFA 2R5AA 3R6OA 1HK9A 4FSSA 4C92A 1WXBA 3EAEA 4C8QF 4F17A 1Q82U 3CMAT 3CCSA 4C8QE 5IH2A 2XMFA 2Y4YA 1W4SA 4E7ZA 2ATCB 3MP1A 2X3XD 3RDVA 1JXMA 2BZYA 1YJ9Q 2QA4Q 1UDLA 4OMFB 2L3PA 2K3YA 4PNOA 1FYNA 4HVVA 3H0IA 2FPDA 3E19A 4E6RA 1WGSA 1VQ8Q 5FROA 5I22A 3TEEA 1YJNA 1GCQC 1WJQA 2SEMA 4FIBA 2DD5A 3M54A 1IREB 1NLOC 1VQ7Q 1KSWA 1RAGB 3M0RA 3UT1A 1I5OB 1RAFB 4ZGDB 3CCQA 4LDWA 3VUZA 4WF2A 3PTAA 2EJGA 4DOVA 3LGFA 1FWZA 2RN8A 3I56T 4C8QA 1Q81U 4C0GA 2YUNA 1OULA 4BE1A 2ZGWA 5GAOm 1RAAB 4R56A 2BIVA 4R0KA 1QVGS 2OX7A 3A8GB 3ULRB 2VXEA 2HCKA 4JLGA 4NOYA 4RCCA 4JRIA 5D6XA 1TUGB 1QKXA 3ASKA 2K6DA 2AZSA 3QDFA 2FPEA 1AEYA 4V2SA 1RAHB 3SHWA 2KRMA 3G4SA 1YJNQ 2H8HA 2DA9A 4RTXA 4HKEA 2K79A 4ELZC 4QVZA 1NM7A 4OB2B 4QQDA 2M16A 1TU0B 1XOVA 3OSVA 4J9CA 3E9FA 4FSXA 1AWOA 4AMCA 3CC2T 1WHGA 3CCJA 2QQBA 1S72A 5FU7B 3TVTA 1IZ6A 5GANf 2GQIA 3JCMe 1KD1U 2VVKA 2I0NA 2XICA 2LCSA 2DPPB 2QDLA 1YBYA 1N8RC 5C0MA 1QP3A 2DJQA 3OBYA 1YCSB 1WIEA 2CP6A 1G3WA 1WHHA 2V26A 1ZUUA 1X27A 2DXTA 3OYIA 1KHIA 2MYSA 4M75C 2ABLA 5CCAA 1ZLMA 4DEXA 1FMKA 2RQRA 3GF5A 3G4SQ 1UEBA 1PRMC 4F04B 3OYYA 4LE9A 2KGTA 2M51A 1OPKA 1W1FA 1YP5A 4HCKA 4A4GA 4PL6A 1VQNQ 2EJFA 1VQ9A 2PUKB 4J9GA 1JRIA 4RG2A 2JTEA 1BIAA 1H92A 3CCJQ 1S72Q 4XAXB 2KSSA 3JCMX 4M7AG 1YJWT 1LNXA 1VQ5T 5KYUA 5HK0A 1VYTA 2XIDA 2E6NA 3PMTA 4LD9K 3THKA 2VASA 3CCLT 1P92A 1AWJA 3RMSA 1VOMA 4LXCA 5LJ3j 1ZA2B 1QW1A 4KT0E 5LJ3g 3ZEHA 1TOVA 3EG9A 4LDVA 2ZPFB 2V8IA 2EQMA 3MKDA 4O6JA 2J6FA 4PJOB 3ZFJA 1YITT 3JSCA 1UJ0A 2DE0X 4OMLA 5KYYB 1TSFA 3FRNA 5AYFA 4E7HA 2HQEA 1GXIE 4HCCA 3CC4T 5L23A 2DEUA 4L5GA 4IUVA 4PKCC 1D09B 1BI3A 1VQPT 3QJYA 2O31A 1E7OA 1Q95G 5FLXE 3HRTA 5HK3A 3GIBA 3M9QA 3LYIA 4J5YA 2GNCA 3GNFB 2DO3A 3O5ZA 2HL5C 3VS6A 4N4IA 2E65A 1YIJQ 3CMEA 4M78G 1WHLA 1VQMT 2DEQA 3HTRA 1KK7A 4F7UF 2BUDA 4CC7A 3REBB 5GAN3 4ATOA 1GFCA 4MZTA 3FC3A 1TTHB 2L5QA 3EGDA 4OMQA 5ECAA 2YUPA 4HXJA 2P4RA 1MNEA 1WJRA 1U8RA 1W6XA 2E3IA 2HBPA 3VU3C 1I81A 2CGHA 3M0SA 3PGGA 1FMWA 1WXTA 5CKBA 2HKNA 2CP5A 1AZGB 2DLPA 1K9MR 3JCMc 5FU7C 1U3OA 2M02A 3UDCA 4E2FB 4D8DA 3PFSA 1U1SA 4DQ2A 3V8LA 1SF9A 1Q86C 1ZBJA 2KVQG 5GANh 2YT6A 4M75D 1KHCA 1UHCA 2DVJA 2C0TA 2FG0A 4M77D 1WDXA 4LDXA 2DRKA 1TXQA 2RMOA 3FJ5A 1QWFA 3CMEQ 4TVRA 4JRPA 4JJNK 2K7AA 5LJ5d 2DL8A 4YTLA 1VQLA 5GAOq 1QVFA 2XK0A 1PD0A 3Q1JA 3LH5A 4X9DA 3CCVA 5GAMj 5J3BA 3QSUA 5GAMg 1OEBA 1WI7A 2VXFA 3NHNA 4EMKB 2QQSA 2VGNA 4C0DC 1NJIC 5KYXA 3RESA 5L8RE 3GPLA 4RTTA 1BKBA 2DX1A 3G71T 1H8KA 3QYGB 4C0ZA 2LNVA 2NUZA 2LX9A 1VQ6T 1ZHIA 2DL5A 1WHMA 1AOJA 1Q81C 2CZ7B 2FL7A 1FMVA 1M3CA 4D6WA 1RI9A 2V8JA 1EIFA 1QVFP 2BZXA 1YWOA 3OA6A 1R0BG 3C94A 2DM1A 1YI2Q 1M8VA 2C06A 4X9CA 4J6XA 1VQLQ 3VYHB 1FXXA 1AVZC 1BYMA 1PNJA 2EBPA 4X34A 2YRVA 4PJOC 1T3SA 3URGA 4KH1B 3EG0A 2GQVA 2P0QA 1VQ4A 2OTLA 4RCBA 2EJ9A 1Y07A 2KT1A 3QDRB 1BU1A 3OS1A 4A4KA 5GJVB 4AT1B 3PNWC 2YDLA 2RD1A 2C0IA 3CCMA 1N6AA 1K73R 4OGEA 2D8HA 2MWOA 4EMHA 3QYHB 2V1RA 1GL5A 3QG1A 3HHTB 3DLMA 1SRMA 2LQKA 2F5TX 3V8JA 2JW4A 1GCPA 3OS5A 2RB6A 3EHRA 3CCUT 1QVGA 2ZPHB 2E70A 4CC2A 1IXDA 2G6FX 4RTUA 3CPFA 1OV3A 4AFQC 2GCXA 2RJEA 2P4TA 2RQVA 4ME7A 2D9TA 2F69A 2QAZA 4Q5WA 5M9OA 4QQ6A 3FB9A 1AWWA 2YHTA 3M0PA 3RBBB 3EFOB 2CH4A 2RQUA 3UATA 2OTJT 3EG3A 3OYHA 4KUIA 4DA4A 4FYYB 1K9MU 3HRUA 4C92G 2PZ1A 3MEVA 1QVGP 1QKWA 1D3BA 1Q7YR 2MK5A 4XU0A 5KYWA 2WSFE 3D7SB 3I55Q 3H6ZA 2CP0A 2NUPA 2XD0A 3CC7A 3C0CA 1I4K1 2HNIA 2KT8A 4PFZA 5GMKi 2ESWA 2LTOA 2KY9A 4M77G 4AFUC 1D0YA 1NE8A 2V1QA 2O88A 2E64A 2RK1A 1OX8A 4E7JA 1BI0A 3CCRA 2K4YA 2B86A 2QTVA 3INZA 3AHUA 1V76A 3L2UA 4BY6B 4X1VA 2E12A 5GAOr 2L89A 3FIFA 3MHXA 4EMKC 4HVUA 2D0NA 2DRMA 4M7DF 5EC7A 2PVGB 2HL3A 4C8QG 1SPKA 1GCQA 3M4YA 5CKDA 3MEAA 4M7DE 2RF0A 3RKXA 4JJCA 5A0LA 2DILA 2K5FA 2RJCA 1C0MA 1ZSZB 2D8JA 3OBWA 3G1JA 3VRZA 1G5VA 2L8DA 4C92B 3FJPA 1VIEA 1PD1A 1IB8A 4B9WA 3CC7Q 4JPBW 2EYXA 2MIOA 1OOTA 1Y96B 1RAIB 4BD3A 2DK3A 3I35A 2DFUA 1OZ3A 2LC4A 3V7CA 5J26A 2YLCA 3CCRQ 4Z02A 1VQOA 1YJ9T 1VIFA 2IVWA 2QA4T 3M59A 5LJ3d 5KYNA 3J80E 1LOJA 4M77B 1HJDA 1VA7A 1D0ZA 2CP3A 2LJ0A 1WYXA 1K73U 1VQ8T 2DAQA 4M7DA 4OMPA 1X6BA 3CCEA 3PIPA 1PC0A 1R77A 4PJMA 3QZ5B 4M75F 3OY9A 4ORZA 4ZGJB 4M7AD 2YUQA 4N0AC 3RKYA 2RJDA 2KE9A 2QEXA 3JCMb 5FWCA 1NEGA 1G8XA 3LGLA 2GTOA 1ZUKA 3A1PA 1JJ2S 2PVDB 2DERA 2DBKA 1Y57A 1UUEA 1IHWA 1RADB 2A0FB 4DBFA 4ESRA 4ZTJA 2QI2A 4RMOA 3OYLA 2QDYB 4CI0C 2JTFA 5CR2A 3EGXB 1UFFA 1G3SA 2PVOB 5GMKl 2VYTA 2NUTA 1VQOQ 2H3JA 1SEMA 3L2WA 5GAN2 1WHKA 2SRCA 4B9XA 1KQ2A 1K8AR 2QGFB 2ZCFB 1X6OA 2ZAEA 2PTKA 2F2WA 2EYZA 2RK2A 3CEYA 3P8BB 3OW2P 1WNLA 3OYJA 1H3ZA 4XTUA 1Q7YU 3QO3A 2COYA 3RNJA 1YJNT 5LJ5f 4L6V5 1LPLA 5GANg 3OYNA 2X9HA 5I11A 1M9SA 2HKQB 3H0HA 2QEXQ 4N4HA 2HEQA 3I56A 1OZ2A 5FWBA 1G3TA 2KYMA 3P8DA 3CCSQ 2EVRA 4M78D 4C5EA 5DLQE 3VS1A 5CVIA 1OYXA 4IKFA 3JB9H 3CXCS 1ZX6A 4OB3B 1K4US 1E6GA 3VS3A 1RLPC 5IHKA 2LCLA 3HPWA 1JQQA 4A54A 2OJ2A 4KULA 2DD4A 4BY6C 1M2OA 3WXMB 4RTWA 2X4YA 3EG2A 1M90R 4PJNA 3VUBA 2MI6A 1ACMB 3CCQQ 3PT9A 2EIFA 2K2MA 5GAMd 3G4ST 3CBPA 5IHIA 3P8HA 4B6MA 3CC2A 1ZSZC 5DY9A 1QCOA 1N27A 4C92C 2W10A 1UGPB 3ZBDA 1VQNT 3CQTA 3EH2A 2PNIA 2EAYA 2EW3A 2RHXA 5IXBA 3CCJT 2MCNA 1XNIA 1S72T 2ZPEB 1NPRA 1IO6A 4E7LA 4EIKA 4DBRA 4KUDK 1B07A 3DB4A 4LDYA 4PLLA 2DL3A 2EGEA 2KMTA 4O5VA 2X51A 4M77C 3RR6A 4E7KA 5CKHA 4FW1A 4CC3A 2JTMA 2DJZA 7AT1B 2WACA 4IUPA 2K57A 2QGGA 2X35A 2YWWA 4N4GA 4PJJA 5GMKm 2CS7A 2EPDA 3M55A 4AG2C 1H3HA 1ZSGA 2JVVA 1PWTA 1X75C 4C0DB 2WSCE 1KC8C 2HZYA 2RQTA 3PVLA 2LCCA 4KGVB 2COZA 1K9MC 5HCKA 5C6SA 1B3QA 2G3RA 2M0YA 1Z9ZA 3BY7A 4F16A 1UB4A 3AT1B 4JS5A 4OMMA 4XU2A 4C5GA 1QWEA 1VQ5A 2JM8A 2EQUA 4HT9A 1K76A 4OF1A 2EGCA 2DL4A 2RJFA 2EKOA 2A3LA 4CRIA 4GBQA 2YLBA 2RHIA 1MHNA 1N5ZA 4RTZA 1K8AU 1E6HA 4J6WA 4BI8B 1A0NB 1YIJT 2E5KA 5KE2A 1U1TA 4XTWA 3J7AF 1ABOA 3X25B 1BB9A 2DTIA 1YITA 2GGRA 4D8KA 2KNBB 4J9BA 2EQKA 4DOWA 1VQ9Q 1M3AA 1IRXA 2R5MA 5LJ5h 3OW2S 1IGUA 3CC4A 2E6ZA 3GP8A 4JLIA 4PJLA 4PJOF 2DXBA 3HFNA 3OYEA 4C5IA 5HKCA 1QCFA 3OYBA 4R55A 4PJOE 2JT4A 3UPUA 2ZPIB 1VQPA 2AK5A 1OI1A 1M1KR 4P5NA 2KR3A 4JZ4A 1JU5C 2F2XA 2A08A 2L2PA 4RTYA 2LQ8A 1BK2A 1B7TA 5GAOn 2KQWA 3VS2A 1VQ5Q 1RI0A 4M7AB 1H641 4AG1C 3JCMd 2JJ9A 2EGAA 5AT1B 1SRLA 4F7UE 1RUWA 2DZCA 1M90U 1OX9A 4HVWA 4BDZA 1N8RR 2LVMA 2DIGA 4Y91A 3CMET 2DNUA 2R58A 2A36A 2QQ9A 3OB9A 4C92D 3G7ZA 4CC4B 2XDBA 1SG5A 5GANe 2EKHA 2BE9B 1QVPA 2RI5A 3MJXA 2CREA 1N9RA 3MP6A 2E10A 4J83A 1ZA1B 4PJOA 5LJ3f 2BTTA 3E2UA 4J8OA 3OYDA 4JJBA 1T0JA
chains in the Genus database with same CATH topology
3H8ZA 4Q5WA 1HK9A 5M9OA 4QQ6A 2JZ2A 1UGQB 1M4ZA 2RA2A 3FB9A 3GLXA 3OYKA 2YHTA 2M9UA 1Y71A 3RIRA 2RHUA 4C92A 5A0GA 1W2BA 3EAEA 4PJOG 4C8QF 2OTJT 2K3XA 1Q82U 1Q82C 3JCMh 1WJSA 3OYHA 3CMAT 3CCSA 4KUIA 4C8QE 5CAIA 4DA4A 2E5QA 2Y4YA 1W4SA 3QZ9B 2XKOC 4OB1B 4F7UA 3MP1A 4IURA 3QIIA 2QQAA 4C8QC 3L2RA 4A4HA 1K9MU 3HRUA 4FT4A 4C92G 3LLRA 3MEVA 4OMFB 5GAN5 2K3YA 4PNOA 1D3BA 2RI2A 4LDUA 4M78B 2JNGA 4XU0A 1VQ9T 3GNGA 3JCMP 2WSFE 3E19A 1YJWA 1WGSA 1KQ1A 1NZ9A 3RUXA 5FROA 4F7UG 1YI2T 3H6ZA 4C8QD 3E9GA 3TEEA 1YJNA 1WJQA 1BI1A 4FIBA 3CCLA 2I2LA 3CD6A 2DD5A 3M54A 3RMQA 3JCMQ 3CC7A 3FLGA 1I4K1 1IREB 5EG2A 2XD0A 2HNIA 3M57A 5I2MA 5GMKi 4A4EA 5CQXA 1M1GA 3KUFA 2LTOA 3WVDB 4HT8A 4LD6A 2P0KA 4E7IA 3UT1A 3C95A 2KY9A 4M77G 5LJ5e 4ZGDB 3VYGA 3CCQA 1NE8A 2AHJB 4BUGA 4LDWA 2E64A 3A8MB 3TCJA 3VUZA 4WF2A 2RK1A 4E7JA 3PTAA 2EJGA 1YIJA 1BI0A 3CCRA 1KQSA 4DOVA 1JJ2A 3G71A 3FDRA 1WPYA 2K4YA 4QVDA 2X4XA 3LGFA 1FWZA 2LRQA 3SB2A 3I56T 3INZA 4C8QA 4ZN1A 4C0GA 1Q81U 4J7FA 3OMCA 2RM4A 4BE1A 2ZGWA 5GAOm 3L2UA 3S3MA 4BY6B 3AHUA 1DJ7B 3OMGA 4R56A 2BIVA 3O8VA 1I5LA 2E12A 3QHSA 3RKWA 1QVGS 3A8GB 2X4JA 2DZ9A 2VXEA 5GAOr 2L89A 3FIFA 3MHXA 4EMKC 4JLGA 4NOYA 4RCCA 5CKEA 4M7DF 2PVGB 4JRIA 5D6XA 1X01A 4C8QG 2P0PA 3JB9D 3M4YA 5CKDA 1V29B 3ASKA 3MEAA 4M7DE 3RKXA 3L1AA 1XTDA 2VV5A 5A0LA 2K5FA 2RJCA 2RO0A 4MZPA 4C0FA 3OBWA 4V2SA 2DIQA 2RI3A 1G5VA 3NTIA 5IN1A 2L8DA 4C92B 2FB7A 3FJPA 1VIEA 3G6EA 4RG8A 5KCHA 4B9WA 3G4SA 2XDPA 2GFAA 1YHQA 1W2BS 3EFSA 4IUTA 1VQMA 4HKEA 5GAOn 1Y96B 2BKDN 3F70A 4QVZA 4ELZC 4F7UB 4OB2B 4GY5A 4BD3A 4QQDA 4M7DD 2M16A 2DK3A 5CIUA 1XOVA 3OSVA 1OZ3A 5IT9E 4MMKA 2LC4A 3E9FA 5FU6B 3A8HB 4FSXA 3V7CA 3JB9J 1M1KU 4HCZA 3CC2T 5J26A 4M7AF 1YCYA 2E41A 2YLCA 4Z02A 4EMKA 1VQOA 1YJ9T 2R57A 3CCJA 1VIFA 2IVWA 2QA4T 4M7AE 3M59A 2QTXA 5LJ3d 2QQBA 3CCUA 1S72A 3J80E 1LOJA 4M77B 5FU7B 3CPWA 3JB9G 3JRZA 5A2QE 1RL2A 4J6YA 4M7AC 5GAMf 1IZ6A 5GANf 3JCMe 1K73U 1KD1U 3CXCA 1K73C 3JAME 3I55T 1KD1C 1VQ8T 2XICA 4NL2A 2DAQA 4XTXA 3J81E 1I8FA 4M7DA 2DPPB 2MF2A 3CCEA 4XTYA 2HQXA 3PIPA 4OB0B 4BE2A 1YBYA 2DVEA 3N5BB 5FRMA 3LWIA 3QZ5B 1N8RU 1N8RC 4M75F 5C0MA 1O9SA 3HL8A 3OY9A 1QP3A 3OBYA 4ZGJB 1FX7A 2L3RA 2A7YA 3M53A 4M7AD 4N0AC 3RKYA 2RJDA 4FU6A 1G3WA 2QEXA 3JCMb 1NPPA 2DXTA 4C5HA 4GLKA 4M7DG 3OYIA 1KHIA 3LGLA 4M75C 1KQSS 1JJ2S 3A8OB 4ELYC 3MO8A 2OTJA 5CCAA 2PVDB 1BIBA 3DKMA 3UWNA 3OYMA 3HKSA 3SWNB 3GF5A 2GF7A 3OSSC 1UEBA 3OYYA 2E1HA 3CBMA 5KH6A 2QXFA 3BFMA 1VQKA 3QXEB 3EFRA 3SD4A 2IG0A 4ZTJA 3HP9A 2QI2A 2HAXA 4RMOA 3OYLA 4M7AA 3M56A 2QDYB 4PL6A 4A4GA 4CI0C 2JTFA 5LJ3h 5CR2A 2EJFA 3LWHA 2PUKB 1VQ9A 4PLIA 3HSBA 1G3SA 1JRIA 3LH0A 2PVOB 4RG2A 5GAN7 4BE0A 1BIAA 5GMKl 3OYAA 2VYTA 2H3JA 4XU3A 3NTKA 3L2WA 4ZGEB 5GAN2 4B9XA 1YI2A 1VQLT 1KQ2A 2ZCFB 4XAXB 1X6OA 2JN0A 2KSSA 3M4GA 3JCMX 3FEOA 4M7AG 4N0AA 4M78F 1YJWT 4A53A 1LNXA 2RK2A 3CEYA 3P8BB 1WNLA 3HFOA 2ZPBB 3SFMA 3OYJA 2MWPA 3DB3A 3CCVT 1H3ZA 1VQ5T 4M78E 1JB0E 3MEWA 4XTUA 1Q7YU 3QO3A 5HK0A 2XIDA 1Q7YC 2E6NA 1YJNT 3LX7A 3T9NA 5LJ5f 3PMTA 4L6V5 4LD9K 4BACA 4EMGA 5CK9A 1P92A 3CCLT 3CD6T 5GANg 4M78C 3X20B 5CQYA 3RMSA 3OYNA 3CC7T 5IAYA 5LJ3j 2O4XB 1M9SA 4FM4B 4NL3A 3X28B 1O75A 1QW1A 3QKJA 4KT0E 4JUVA 4MDWA 4NS5A 3ZEHA 5I21A 5LJ3g 1VQ6A 4N4HA 3I56A 1OZ2A 3BDLA 1QP2A 1G3TA 3JCMW 1K8AC 3P8DA 4LDVA 2DXUA 2ZPFB 4II1A 2V8IA 3GOXA 2EQMA 3JCMV 1AHJB 4A4FA 4M78D 3CCRT 4JRKA 4O6JA 4BI4A 4C5EA 4PJOB 3ZFJA 5DLQE 3CPWS 3JSCA 5CVIA 1YITT 1PSFA 1OYXA 2Y90A 3L42A 2DKGA 2X4WA 4BB7A 4OP0A 4IKFA 3JB9H 3ME9A 3CXCS 3FRNA 5AYFA 3V7SA 5A0DA 2HQEA 4E7HA 2CZ6B 1GXIE 4OB3B 2Y4XA 1ZQ1A 2DTOA 4HCCA 3CC4T 2LCLA 1B34A 4L5GA 3HPWA 4KBMB 4A54A 4IUVA 2MMPA 2PUOB 4HA8A 4KULA 4VUBA 4PKCC 2DD4A 3V7RA 3NTHA 3L2ZA 1BI3A 4BY6C 2K2VA 3E1SA 3WXMB 1VQPT 3S3OA 3S6WA 4M78A 3QJYA 2X4YA 3PMIA 5GAN4 3VUBA 5FLXE 3HRTA 5HK3A 1UGSB 2MI6A 3GIBA 2JOYA 3LYIA 3M9QA 4J5YA 3PT9A 1M5Q1 3G6ET 1D3BB 1VQ4T 2EIFA 3GNFB 2OTLT 2DO3A 2VGMA 4C92F 2GFUA 5GAMd 5GANd 3G4ST 3CBPA 2LT1A 3BW1A 2E65A 3M5AA 4N4IA 3P8HA 3CMEA 3CCMT 1YHQT 4M78G 3CC2A 1VQMT 2NLUA 2DEQA 5DY9A 2V8KA 2O01E 3VKIA 3MCAB 1N27A 2M1HA 4F7UF 2BUDA 4C92C 2RHYA 1UGPB 2JUFA 3QUIA 2EFIA 2LT4A 3ZBDA 4BI3A 5LJ5g 5GAN3 4ATOA 1VQNT 3A5ZB 5GMKj 4MZTA 5GAOp 5I2SA 3FC3A 2L5QA 1TH7A 3JCMf 2EAYA 1VQ8A 3I55A 2RHXA 2MAMA 3DLLA 1VQOT 1UGRB 3CCJT 4BDYA 1WJRA 1XNIA 5GAN8 1U8RA 4EPCA 1S72T 2ZPEB 4XTVA 2LDMA 3OW2A 3JB9I 4M77F 2B8AA 1VQ7T 4HCBA 4M75E 2HBPA 3RERA 5FU6C 1NPRA 1WQWA 2EQJA 4FT2A 3VU3C 1I81A 2CGHA 4E7LA 4KUDK 3KXTA 2CKKA 3DB4A 4ZTFA 3PGGA 4LDYA 4PLLA 4C8QB 3X26B 5LJ3e 5CKBA 2CZ0B 2KMTA 3L2VA 4RKUE 4O5VA 3CBOA 4M77C 3JCMc 4E7KA 5CKHA 5FU7C 3META 3CMAA 2JTMA 3UDCA 2DJZA 3PFSA 1U1SA 2WACA 3ER0A 3V8LA 4DQ2A 2CZ1B 4IUPA 4MMLA 2K57A 1JBMA 2QEXT 1Q86C 1Q86U 2DTHA 2RHZA 3OYGA 2X35A 4N4GA 5GAMh 2KVQG 5GANh 4M75D 1HXDA 1KHCA 3CCST 5D6YA 5GMKm 4M77D 2CS7A 3M55A 4LDXA 2JVVA 4JDSA 2KDSA 1X75C 2PQWA 5CO7A 4C0DB 5DM7R 2WSCE 1KC8U 1KC8C 1VQ4A 1Y96A 4TVRA 1B34B 4JRPA 1VQKT 2LCCA 3LW5E 4JJNK 1K9MC 5C6SA 5LL6S 5LJ5d 2EWNA 4MZMA 2XI9A 4YTLA 2G3RA 3L2QA 1VQLA 5GAOq 5KCOA 3BY7A 1QVFA 1UB4A 3SWNC 2ZZDA 2XK0A 4JS5A 2CYZB 3Q1JA 4M75A 4XU2A 2FHDA 4X9DA 4C5GA 3CCVA 5GAMj 2EYQA 3NFCA 5GANj 3CC4A 1VQ5A 4M77A 5J3BA 2EQUA 4HT9A 3S3NA 3QSUA 5GAMg 4OF1A 2RJFA 2VXFA 4IUQA 4E47A 2EKOA 2A3LA 4XU1A 4CRIA 4EMKB 1R8OB 3JCMg 2YLBA 2RHIA 1MHNA 2QQSA 2VGNA 2XU8A 4C0DC 3CCQT 4JS4A 1NJIU 1NJIC 1K8AU 4M75G 3X24B 2ZPGB 2KK4A 4J6WA 3RESA 4BI8B 4UC4A 5L8RE 3GPLA 1YIJT 1BKBA 3G71T 2VUBA 3JB9F 5KE2A 2KAFA 1U1TA 3QYGB 4C0ZA 2FVUA 5GMKe 2LNVA 4M7DB 4XTWA 3J7AF 2LX9A 3OYFA 1VQ6T 3X25B 1ZHIA 2DTIA 1YITA 1LJOA 2WSEE 5J39A 1Q81C 2DXCA 2CZ7B 2FL7A 2EQKA 4Y28E 4DOWA 4D6WA 3OYCA 3OS0A 3SWNA 3C12A 2V8JA 2XG8D 2R5MA 1KG1A 5LJ5h 1EIFA 3OW2S 2D0QB 1N9SA 2E6ZA 3MP8A 3QJ6A 5GAOl 4JLIA 1G3YA 3GP8A 2D6FA 5D6WA 4PJOF 2DXBA 5GAN6 5GMKh 2FYKA 3C94A 3HFNA 3OYEA 4OVAA 4C5IA 5HKCA 3OA6A 1M8VA 3OYBA 4R55A 3HRSA 4XK8E 4PJOE 3UPUA 2C06A 4X9CA 4J6XA 4QQGA 4OGCA 2ZPIB 1VQPA 3M58A 3VYHB 1OI1A 2K5IA 3QPHA 1FXXA 4P5NA 1BYMA 4X34A 4PJOC 1Y7XA 1PSEA 2LQ8A 2YRVA 3A8LB 3MEUA 5KE3A 3URGA 4M7DC 4J7IA 1VUBA 2GQVA 2P0QA 2KQWA 3OQ5A 3WVEB 1RI0A 4M7AB 4RCBA 2EJ9A 4C92E 4FL6A 1Y07A 2XDDA 3QDRB 2OTLA 2PU9B 3OS1A 4A4KA 1H641 3VV0A 2M0OA 3BDUA 3JCMd 3PNWC 2RD1A 3CCMA 1N6AA 2RH2A 4OGEA 1YJ9A 3SDZA 4MDXA 2HD0A 5LJ5j 2QA4A 2MWOA 4EMHA 3C4SA 4PJOD 3QYHB 4L59A 4QW2A 1SSFA 3QG1A 5HY6A 4F7UE 2VC8A 2DZCA 3HHTB 1M90U 3DLMA 4BDZA 2LQKA 4IUUA 1M90C 2F5TX 2LVMA 2XHCA 3V8JA 4QVCA 1VQNA 2DIGA 4XTZA 4Y91A 3CMET 1M1KC 1BI2A 2K5LA 2O4XA 3KBGA 2R58A 2RB6A 3OS5A 3CCUT 1QVGA 2ZPHB 2E70A 3TU4K 2QQ9A 3OB9A 1ZBXA 4C92D 4M75B 3TREA 4JRQA 1MGQA 1QVFS 3G7ZA 1WQ7A 2XDBA 5GAMe 2QQRA 5GANe 1XQHA 3CPFA 3OS2A 1QVPA 4M77E 5FRNA 3QBYA 4XQ3A 3JCMJ 2RI5A 2GCXA 2RJEA 4EDUA 3PIOA 1VQ7A 1N9RA 2F5KA 3CCET 3MP6A 2P4TA 5DLOA 2E10A 4J83A 3VJPA 4PJOA 5CKFA 1M1FA 5LJ3f 2R5AA 3R6OA 2D9TA 2OAUA 4ME7A 2F69A 3V8KA 4J8OA 3OYDA 4ZN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  4MMK A;  2Y90 A;  2DKG A;  4OP0 A;  3JB9 H;  2RA2 A;  3FB9 A;  4M75 A;  4XU2 A;  4X9D A;  3V7C A;  3V7S A;  2YHT A;  5GAM j;  5GAN j;  3JB9 J;  4M7A F;  4M77 A;  4C92 A;  3RIR A;  4HT9 A;  1YCY A;  2E41 A;  2YLC A;  4EMK A;  2DTO A;  4PJO G;  4C8Q F;  5GAM g;  3QSU A;  2VXF A;  4M7A E;  2QTX A;  5LJ3 d;  3JCM h;  4XU1 A;  1LOJ A;  4M77 B;  1B34 A;  4A54 A;  4C8Q E;  4EMK B;  5CAI A;  3JCM g;  2YLB A;  4HA8 A;  3JB9 G;  3V7R A;  4J6Y A;  4M7A C;  5GAM f;  5GAN f;  4F7U A;  3L2Z A;  3JCM e;  4M75 G;  4C8Q C;  4J6W A;  4M78 A;  3RES A;  4NL2 A;  4C92 G;  4XTX A;  1I8F A;  4M7D A;  5GAN 4;  5GAN 5;  4PNO A;  4XTY A;  3JB9 F;  1D3B A;  2DVE A;  1U1T A;  5GMK e;  3GIB A;  4M78 B;  4XU0 A;  4M75 F;  4J5Y A;  4XTW A;  4M7D B;  3JCM P;  1M5Q 1;  1D3B B;  4C92 F;  2DTI A;  1KQ1 A;  4M7A D;  3RUX A;  4N0A C;  3RKY A;  1LJO A;  4F7U G;  5GAM d;  5GAN d;  3BW1 A;  2E65 A;  4C8Q D;  3JCM b;  4M78 G;  2DXT A;  4M7D G;  2DEQ A;  3SWN A;  5DY9 A;  4M75 C;  2I2L A;  3JCM Q;  1I4K 1;  5LJ5 h;  4F7U F;  2HNI A;  4C92 C;  1BIB A;  1N9S A;  5GMK i;  5GAO l;  4JLI A;  3QUI A;  3SWN B;  5GAN 3;  5LJ5 g;  4PJO F;  5GAN 6;  5GMK h;  4HT8 A;  2FYK A;  3HFN A;  5GMK j;  5GAO p;  1M8V A;  2E1H A;  4M77 G;  5LJ5 e;  4PJO E;  1TH7 A;  3BFM A;  2EAY A;  4J6X A;  4X9C A;  3JCM f;  2E64 A;  3EFR A;  4WF2 A;  2EJG A;  5GAN 8;  4XTV A;  1WPY A;  4M7A A;  4PJO C;  4QVD A;  3JB9 I;  4M77 F;  5LJ3 h;  4M7D C;  2EJF A;  3SB2 A;  4M75 E;  3RER A;  3INZ A;  4C8Q A;  1WQW A;  3VU3 C;  5GAO n;  3HSB A;  2RM4 A;  1I81 A;  1JRI A;  2CGH A;  2ZGW A;  2EJ9 A;  4RCB A;  4M7A B;  1BIA A;  4C92 E;  5GMK l;  5GAN 7;  5GAO m;  3AHU A;  3PGG A;  1H64 1;  4XU3 A;  3BDU A;  4C8Q B;  5LJ3 e;  3JCM d;  3QHS A;  3RKW A;  1I5L A;  2RD1 A;  5GAN 2;  1KQ2 A;  2DZ9 A;  2VXE A;  5GAO r;  5LJ5 j;  3FIF A;  4M77 C;  2JN0 A;  3JCM c;  4EMH A;  4EMK C;  3M4G A;  3JCM X;  4PJO D;  4NOY A;  4RCC A;  4M7A G;  4N0A A;  4M78 F;  4A53 A;  1LNX A;  2DJZ A;  4F7U E;  4M7D F;  2VC8 A;  1WNL A;  2DZC A;  1U1S A;  3HFO A;  1X01 A;  4JRI A;  3V8L A;  4C8Q G;  4DQ2 A;  4M78 E;  4MML A;  3V8J A;  2K57 A;  4QVC A;  3JB9 D;  1JBM A;  4M7D E;  2DTH A;  4XTU A;  3QO3 A;  4XTZ A;  3RKX A;  4Y91 A;  3L1A A;  5GAM h;  5GAN h;  2RB6 A;  4M75 D;  5LJ5 f;  4EMG A;  1HXD A;  5GMK m;  5GAN g;  4M78 C;  4M77 D;  4C92 D;  4M75 B;  1MGQ A;  4V2S A;  5LJ3 j;  1WQ7 A;  4NL3 A;  4C92 B;  5GAM e;  5GAN e;  2FB7 A;  5LJ3 g;  3FJP A;  4JUV A;  5I21 A;  4M77 E;  4XQ3 A;  3JCM J;  1N9R A;  1Y96 A;  1B34 B;  3JCM W;  2E10 A;  3EFS A;  2DXU A;  4PJO A;  5LJ5 d;  2EWN A;  5LJ3 f;  3JCM V;  1Y96 B;  4M78 D;  4F7U B;  4JRK A;  5GAO q;  4M7D D;  3BY7 A;  3V8K A;  4PJO B;  3SWN C; 
#chains in the Genus database with same CATH topology
 3H8Z A;  2KXD A;  2BZ8 A;  1UGQ B;  1M4Z A;  3GLX A;  1Y71 A;  3RIR A;  2RHU A;  1HYO A;  5A0G A;  4JJD A;  1Q82 C;  1WJS A;  3VS5 A;  3EHQ A;  2E5Q A;  2XKO C;  4OB1 B;  4F7U A;  3QII A;  4A4H A;  4IIM A;  3LLR A;  1ZUY A;  2RI2 A;  4LDU A;  4M78 B;  3VS0 A;  2AZV A;  3GNG A;  3JCM P;  1PHT A;  2HDA A;  1KQ1 A;  1NZ9 A;  4GLM A;  3RUX A;  1M3B A;  1YI2 T;  4C8Q D;  1AZE A;  4OMN A;  1BI1 A;  3CD6 A;  3RMQ A;  2JM9 A;  3JCM Q;  3FLG A;  3M57 A;  5I2M A;  1M1G A;  3KUF A;  3WVD B;  4HT8 A;  2P0K A;  4E7I A;  3C95 A;  3VYG A;  1WA7 A;  3M0U A;  2AHJ B;  4BUG A;  3TCJ A;  3A8M B;  2NYS A;  1WLP B;  1JJ2 A;  3G71 A;  3FDR A;  1WPY A;  4QVD A;  1UG1 A;  1OU9 A;  2LRQ A;  4J7F A;  1UTI A;  3OMC A;  3OMG A;  4JZ3 A;  2FO0 A;  1I5L A;  3QHS A;  2CUD A;  2X4J A;  2DZ9 A;  1WX6 A;  5CKE A;  2FRY A;  4LUD A;  3H0F A;  2J6K A;  2QG9 B;  3L1A A;  1XTD A;  2IPO B;  1PKT A;  2RO0 A;  1BBZ A;  2AIR B;  1S1N A;  5IN1 A;  3CCV Q;  2FB7 A;  3G6E A;  4RG8 A;  5KCH A;  2XDP A;  2GFA A;  1YHQ A;  1W2B S;  1GFD A;  5GJW B;  3CD6 Q;  4IUT A;  1JJ2 P;  1G83 A;  4GY5 A;  5CIU A;  2OAW A;  5FU6 B;  1M1K U;  1MV3 A;  2KRS A;  3UA7 A;  1YCY A;  4EMK A;  2QYZ A;  1UE9 A;  1JXO A;  1D1B A;  2J05 A;  3CCU A;  2ED1 A;  1W70 A;  1JEG A;  3JB9 G;  3JRZ A;  5A2Q E;  1RL2 A;  4A63 B;  4M7A C;  5GAM f;  4ZNX A;  3CXC A;  1KD1 C;  3I55 T;  4NL2 A;  3UA6 A;  4XTX A;  3J81 E;  1I8F A;  4XTY A;  2HQX A;  1Q86 R;  2NWM A;  3N5B B;  5FRM A;  1N8R U;  3VS4 A;  1UEC A;  3HL8 A;  2L3R A;  2L0A A;  3M0Q A;  4C5H A;  4GLK A;  4KRT A;  4M7D G;  1KFZ A;  1KQS S;  8ATC B;  4ELY C;  3MO8 A;  1VQ4 Q;  2OTJ A;  3G6E Q;  2OTL Q;  1BIB A;  3UWN A;  3OYM A;  3HKS A;  3SWN B;  2LJ1 A;  2GF7 A;  2CSI A;  3CCM Q;  1YHQ Q;  5KH6 A;  3KFV A;  2QXF A;  2JMC A;  1VQK A;  3QXE B;  2GBQ A;  2IIM A;  3SD4 A;  2IG0 A;  3VS7 A;  4Z88 A;  3HP9 A;  2HAX A;  2E3H A;  3LWH A;  5LJ3 h;  3LH0 A;  4BE0 A;  5GAN 7;  1OU8 A;  3CXC P;  3OYA A;  4DEY A;  1TS9 A;  1NJI R;  4PFP A;  1MMD A;  1WHJ A;  2RNA A;  2JN0 A;  3M4G A;  3FEO A;  4WTO B;  4N0A A;  1U5S A;  1X43 A;  4KGZ B;  3HFO A;  3SFM A;  2MWP A;  2OI3 A;  3LX7 A;  4F14 A;  4AFS C;  4BAC A;  1Q81 R;  1R0C B;  2LQW A;  5CK9 A;  3CC7 T;  4M78 C;  3X20 B;  2O4X B;  4FM4 B;  2LZ6 B;  2DYB A;  4NS5 A;  4DBQ A;  1QCN A;  2YSQ A;  2HQH A;  3BDL A;  1K8A C;  2FZC B;  2DXU A;  4II1 A;  1MND A;  3JCM V;  3CCR T;  4JRK A;  4BI4 A;  2JMA A;  1WFW A;  3CPW S;  1J3T A;  2Y90 A;  3L42 A;  4BB7 A;  1MUZ A;  4OP0 A;  2FZG B;  3ME9 A;  1VQK Q;  3V7S A;  1GRI A;  3SEM A;  1ZQ1 A;  1B34 A;  4HA8 A;  2CH4 W;  3L2Z A;  2K2V A;  2HMA A;  3NGP A;  3S3O A;  1M2V A;  1AD5 A;  1UGS B;  1EX4 A;  3M0T A;  2DMO A;  4C92 F;  2VGM A;  2CUB A;  3IQL A;  4Z89 A;  3M5A A;  2ED0 A;  3VKI A;  1RAB B;  1NG2 A;  2EYY A;  2JUF A;  3QUI A;  2LT4 A;  5LJ5 g;  1KIK A;  5GAO p;  3R6N A;  1TH7 A;  3JCM f;  2YXY A;  1VQ8 A;  1VQO T;  3BE3 A;  2GTJ A;  5GAN 8;  4XTV A;  2LDM A;  3OW2 A;  2K9G A;  4M77 F;  2B8A A;  1VQ7 T;  4HCB A;  4M75 E;  3RER A;  5FU6 C;  2EQJ A;  4FT2 A;  3KXT A;  4ZTF A;  8AT1 B;  2YRD A;  3X26 B;  2HSE B;  4C8Q B;  2F2V A;  2O9V A;  3L2V A;  4RKU E;  1QLY A;  2D1X A;  1MMA A;  2DYI A;  3CMA A;  3MET A;  2A37 A;  1V1C A;  2FEI A;  2LMJ A;  3ER0 A;  1G2B A;  1JBM A;  1ZSZ A;  2QEX T;  1Q86 U;  2DTH A;  2RHZ A;  3OYG A;  5GAM h;  1HXD A;  3CCS T;  2BE7 D;  2W0Z A;  4JDS A;  2KDS A;  2PQW A;  5CO7 A;  5DM7 R;  2RQW A;  3EGU A;  4WCI A;  1Y96 A;  1CKA A;  3LW5 E;  5LL6 S;  2EWN A;  4MZM A;  2XI9 A;  3L2Q A;  1EFN A;  1F1B B;  1GBQ A;  3SWN C;  2KRN A;  4RTV A;  4J9F A;  4M75 A;  3CCE Q;  2FHD A;  2EYQ A;  3NFC A;  5GAN j;  4M77 A;  4IUQ A;  4E47 A;  4FYW B;  4LUE A;  4IIO A;  1R8O B;  2HSP A;  2LX7 A;  2XU8 A;  3CCQ T;  4JS4 A;  1NJI U;  4RUG A;  2ZPG B;  2KK4 A;  4UC4 A;  3CMA Q;  1D0X A;  2KAF A;  5FW9 A;  1TUC A;  5GMK e;  2FVU A;  2ROL A;  2FPF A;  1X69 A;  3OYF A;  2WSE E;  5J39 A;  9ATC B;  1D1C A;  4Y28 E;  3C12 A;  1KG1 A;  2MOX A;  2D0Q B;  1N9S A;  3QJ6 A;  1G3Y A;  2QK0 A;  5D6W A;  5GMK h;  4OVA A;  3HRS A;  4QQG A;  4OGC A;  3M58 A;  2FZK B;  3TQ7 P;  3QPH A;  6AT1 B;  3EGX A;  3A8L B;  5KE3 A;  3MEU A;  4M7D C;  1T3L A;  1VUB A;  3HSB A;  2XDD A;  2PU9 B;  4J9D A;  3VV0 A;  1CSK A;  2M0O A;  3BDU A;  4MDX A;  3SDZ A;  2AT1 B;  1BCM A;  2KXC A;  3I56 Q;  4L59 A;  1SSF A;  5HY6 A;  4IUU A;  1VQN A;  4XTZ A;  1M1K C;  1M30 A;  2DL7 A;  3MPU B;  2YRC A;  4Y92 A;  3TU4 K;  5KYU B;  1MGQ A;  1JO8 A;  1XQH A;  4J9I A;  5FRN A;  4ANJ A;  3QBY A;  4XQ3 A;  4EDU A;  3PIO A;  3REA B;  5DLO A;  3VJP A;  1M1F A;  3EG1 A;  1WZO A;  2OAU A;  3EG9 B;  3V8K A;  1C1A A;  4ZN3 A;  2L3S A;  2O9S A;  2VKN A;  2JZ2 A;  2RA2 A;  3OYK A;  4KH0 B;  1MMG A;  2M9U A;  4LN2 A;  1W2B A;  1LCK A;  4PJO G;  2K3X A;  1HSQ A;  3H41 A;  3JCM h;  5CAI A;  3QZ9 B;  3CC2 Q;  3EH1 A;  4IUR A;  2QQA A;  4C8Q C;  3L2R A;  1K0X A;  4FT4 A;  5GAN 5;  1NEB A;  1VQ9 T;  2JNG A;  2ROT A;  2COW A;  1Z9Q A;  1YJW A;  4F7U G;  3E9G A;  1HD3 A;  3JV3 A;  1LVK A;  3CCL A;  2I2L A;  5EG2 A;  4A4E A;  3ZL7 C;  5CQX A;  1Y0M A;  4LD6 A;  1PCX A;  2X3W D;  5LJ5 e;  1W2B P;  1YIJ A;  3EGD B;  1KQS A;  4Z8A A;  2X4X A;  3SB2 A;  4ZN1 A;  1YNZ A;  2RM4 A;  3S3M A;  1DJ7 B;  4FCY A;  3O8V A;  2KRO A;  3RKW A;  1YWP A;  2VWF A;  1UGV A;  1X01 A;  2P0P A;  1UJY A;  2CP2 A;  3JB9 D;  1V29 B;  4FYX B;  1PM3 A;  3NPF A;  2VV5 A;  4MZP A;  4C0F A;  1YJW Q;  2DIQ A;  2RI3 A;  3NTI A;  2E4H A;  3PE0 A;  1M27 C;  3EFS A;  3CCL Q;  1VQM A;  1K0S A;  2BKD N;  3F70 A;  4F7U B;  1KQS P;  1KJW A;  4M7D D;  4KGX B;  2F1L A;  4PFO A;  5IT9 E;  4MMK A;  2L3Q A;  3A8H B;  3QWX X;  3JB9 J;  4HCZ A;  4M7A F;  2RPN A;  3NMZ C;  2E41 A;  2R57 A;  2K3B A;  4M7A E;  1AT1 B;  2QTX A;  1YIT Q;  3CPW A;  1RAC B;  4J6Y A;  1K73 C;  3JAM E;  2KI7 A;  3PVQ A;  3CC4 Q;  2MF2 A;  1K9A A;  2O2O A;  5KYX B;  4OB0 B;  4BE2 A;  2DVE A;  5KYY A;  3LWI A;  2KBT A;  1O9S A;  2KEA A;  1D1A A;  1FX7 A;  3M53 A;  2A7Y A;  1VQP Q;  2Z0W A;  4FU6 A;  1NPP A;  1KC8 R;  1BCO A;  1SHF A;  3TSZ A;  3A8O B;  2KYB A;  3DKM A;  4K11 A;  4FW2 A;  3OSS C;  2E1H A;  3CBM A;  1VQM Q;  3BFM A;  3EFR A;  1T0H A;  4M7A A;  3M56 A;  1I07 A;  3CPW P;  4PLI A;  1OQK A;  4XU3 A;  4E7S A;  2P84 A;  3I5R A;  3NTK A;  4ZGE B;  1YI2 A;  1VQL T;  1PG5 B;  2LP5 A;  2MPX C;  1U06 A;  1NLP C;  1ABQ A;  1CKB A;  1GBR A;  4M78 F;  4A53 A;  3CCV T;  2ZPB B;  3DB3 A;  4M78 E;  1JB0 E;  3MEW A;  1QQJ A;  1Q7Y C;  1ARK A;  3T9N A;  4EMG A;  3QWY A;  3CD6 T;  5CQY A;  4FYV B;  5IAY A;  1I0C A;  4NL3 A;  1X2Q A;  3X28 B;  1O75 A;  3QKJ A;  5I21 A;  4JUV A;  4MDW A;  4QKU A;  2AKK A;  1VQ6 A;  1RLQ C;  1QP2 A;  3JCM W;  3GOX A;  1AHJ B;  4A4F A;  4DBH A;  2J7I A;  4PK4 A;  1X2K A;  1PSF A;  2DKG A;  2X4W A;  5A0D A;  2CZ6 B;  2J06 A;  2Y4X A;  2DTO A;  4KBM B;  1OPL A;  2MMP A;  2LQN A;  2PUO B;  4VUB A;  3V7R A;  2JS2 A;  1K1Z A;  4J9H A;  3NTH A;  1VYU A;  3E1S A;  1SKU B;  2CT3 A;  1TUD A;  3S6W A;  4M78 A;  1PKS A;  2LNH B;  3PMI A;  5GAN 4;  2JOY A;  2JXB A;  4QT7 A;  1VQ4 T;  1M5Q 1;  3G6E T;  1D3B B;  2OTL T;  5IXF A;  1PRL C;  3A98 A;  2GFU A;  1NBE B;  5KYW B;  5GAN d;  4OMO A;  2LT1 A;  3BW1 A;  3CCM T;  1YHQ T;  2CT4 A;  2H3E B;  3G71 Q;  2NLU A;  2V8K A;  2O01 E;  3MCA B;  2M1H A;  1VQ6 Q;  2RHY A;  2CSQ A;  2EFI A;  4BI3 A;  2NUP B;  3A5Z B;  5GMK j;  5I2S A;  1VYV A;  3I5S A;  3I55 A;  2MAM A;  3DLL A;  2A28 A;  1UGR B;  4BDY A;  4EPC A;  1NYF A;  3JB9 I;  1Q82 R;  1QMC A;  4J9E A;  1WQW A;  2CKK A;  5LJ3 e;  2CZ0 B;  1UHF A;  2J6O A;  3H9N A;  3CBO A;  1EZZ B;  2EYW A;  1YN8 A;  2CZ1 B;  2CDT A;  4MML A;  2VB6 A;  3GBQ A;  2HBW A;  1RAE B;  5D6Y A;  3UF4 A;  4M4Z A;  1KC8 U;  2EQI A;  3CCU Q;  1B34 B;  1VQK T;  2DF6 A;  5KCO A;  2ZZD A;  1M2V B;  1M8M A;  3I9Q A;  2CYZ B;  3U23 A;  1C6V X;  1YFN A;  4LNP A;  3S3N A;  1IGQ A;  2LJ3 A;  4XU1 A;  2ECZ A;  3JCM g;  1WXU A;  2QAS A;  4M75 G;  3X24 B;  1TWB A;  2OTJ Q;  2YUO A;  2VUB A;  3JB9 F;  2ENM A;  3EFO A;  4M7D B;  1XJW B;  2JS0 A;  1LJO A;  2DXC A;  5D7U A;  3OYC A;  3OS0 A;  3SWN A;  2XG8 D;  3MP8 A;  5GAO l;  3VRY A;  2D6F A;  5GAN 6;  2FYK A;  2DBM A;  4XK8 E;  4AFZ C;  3TSW A;  2CP7 A;  2K5I A;  1MV0 B;  1Y7X A;  1PSE A;  1SHG A;  4J7I A;  1MMN A;  3OQ5 A;  3WVE B;  4C92 E;  4FL6 A;  1TG0 A;  1AWX A;  1NYG A;  1X6G A;  1KD1 R;  2RH2 A;  1YJ9 A;  2HD0 A;  2NUT B;  2AKL A;  2C0O A;  5LJ5 j;  2FRW A;  2QA4 A;  3C4S A;  4PJO D;  4QW2 A;  2VC8 A;  1M90 C;  2XHC A;  4QVC A;  1SSH A;  5IHN A;  1BI2 A;  2K5L A;  2O4X A;  3KBG A;  2DET A;  1ZBX A;  4M75 B;  3TRE A;  4JRQ A;  1IHV A;  1I1J A;  1QVF S;  1WQ7 A;  5GAM e;  2QQR A;  3OS2 A;  4M77 E;  1VQ7 A;  3JCM J;  2F5K A;  3CCE T;  5CKF A;  2R5A A;  3R6O A;  1HK9 A;  4FSS A;  4C92 A;  1WXB A;  3EAE A;  4C8Q F;  4F17 A;  1Q82 U;  3CMA T;  3CCS A;  4C8Q E;  5IH2 A;  2XMF A;  2Y4Y A;  1W4S A;  4E7Z A;  2ATC B;  3MP1 A;  2X3X D;  3RDV A;  1JXM A;  2BZY A;  1YJ9 Q;  2QA4 Q;  1UDL A;  4OMF B;  2L3P A;  2K3Y A;  4PNO A;  1FYN A;  4HVV A;  3H0I A;  2FPD A;  3E19 A;  4E6R A;  1WGS A;  1VQ8 Q;  5FRO A;  5I22 A;  3TEE A;  1YJN A;  1GCQ C;  1WJQ A;  2SEM A;  4FIB A;  2DD5 A;  3M54 A;  1IRE B;  1NLO C;  1VQ7 Q;  1KSW A;  1RAG B;  3M0R A;  3UT1 A;  1I5O B;  1RAF B;  4ZGD B;  3CCQ A;  4LDW A;  3VUZ A;  4WF2 A;  3PTA A;  2EJG A;  4DOV A;  3LGF A;  1FWZ A;  2RN8 A;  3I56 T;  4C8Q A;  1Q81 U;  4C0G A;  2YUN A;  1OUL A;  4BE1 A;  2ZGW A;  5GAO m;  1RAA B;  4R56 A;  2BIV A;  4R0K A;  1QVG S;  2OX7 A;  3A8G B;  3ULR B;  2VXE A;  2HCK A;  4JLG A;  4NOY A;  4RCC A;  4JRI A;  5D6X A;  1TUG B;  1QKX A;  3ASK A;  2K6D A;  2AZS A;  3QDF A;  2FPE A;  1AEY A;  4V2S A;  1RAH B;  3SHW A;  2KRM A;  3G4S A;  1YJN Q;  2H8H A;  2DA9 A;  4RTX A;  4HKE A;  2K79 A;  4ELZ C;  4QVZ A;  1NM7 A;  4OB2 B;  4QQD A;  2M16 A;  1TU0 B;  1XOV A;  3OSV A;  4J9C A;  3E9F A;  4FSX A;  1AWO A;  4AMC A;  3CC2 T;  1WHG A;  3CCJ A;  2QQB A;  1S72 A;  5FU7 B;  3TVT A;  1IZ6 A;  5GAN f;  2GQI A;  3JCM e;  1KD1 U;  2VVK A;  2I0N A;  2XIC A;  2LCS A;  2DPP B;  2QDL A;  1YBY A;  1N8R C;  5C0M A;  1QP3 A;  2DJQ A;  3OBY A;  1YCS B;  1WIE A;  2CP6 A;  1G3W A;  1WHH A;  2V26 A;  1ZUU A;  1X27 A;  2DXT A;  3OYI A;  1KHI A;  2MYS A;  4M75 C;  2ABL A;  5CCA A;  1ZLM A;  4DEX A;  1FMK A;  2RQR A;  3GF5 A;  3G4S Q;  1UEB A;  1PRM C;  4F04 B;  3OYY A;  4LE9 A;  2KGT A;  2M51 A;  1OPK A;  1W1F A;  1YP5 A;  4HCK A;  4A4G A;  4PL6 A;  1VQN Q;  2EJF A;  1VQ9 A;  2PUK B;  4J9G A;  1JRI A;  4RG2 A;  2JTE A;  1BIA A;  1H92 A;  3CCJ Q;  1S72 Q;  4XAX B;  2KSS A;  3JCM X;  4M7A G;  1YJW T;  1LNX A;  1VQ5 T;  5KYU A;  5HK0 A;  1VYT A;  2XID A;  2E6N A;  3PMT A;  4LD9 K;  3THK A;  2VAS A;  3CCL T;  1P92 A;  1AWJ A;  3RMS A;  1VOM A;  4LXC A;  5LJ3 j;  1ZA2 B;  1QW1 A;  4KT0 E;  5LJ3 g;  3ZEH A;  1TOV A;  3EG9 A;  4LDV A;  2ZPF B;  2V8I A;  2EQM A;  3MKD A;  4O6J A;  2J6F A;  4PJO B;  3ZFJ A;  1YIT T;  3JSC A;  1UJ0 A;  2DE0 X;  4OML A;  5KYY B;  1TSF A;  3FRN A;  5AYF A;  4E7H A;  2HQE A;  1GXI E;  4HCC A;  3CC4 T;  5L23 A;  2DEU A;  4L5G A;  4IUV A;  4PKC C;  1D09 B;  1BI3 A;  1VQP T;  3QJY A;  2O31 A;  1E7O A;  1Q95 G;  5FLX E;  3HRT A;  5HK3 A;  3GIB A;  3M9Q A;  3LYI A;  4J5Y A;  2GNC A;  3GNF B;  2DO3 A;  3O5Z A;  2HL5 C;  3VS6 A;  4N4I A;  2E65 A;  1YIJ Q;  3CME A;  4M78 G;  1WHL A;  1VQM T;  2DEQ A;  3HTR A;  1KK7 A;  4F7U F;  2BUD A;  4CC7 A;  3REB B;  5GAN 3;  4ATO A;  1GFC A;  4MZT A;  3FC3 A;  1TTH B;  2L5Q A;  3EGD A;  4OMQ A;  5ECA A;  2YUP A;  4HXJ A;  2P4R A;  1MNE A;  1WJR A;  1U8R A;  1W6X A;  2E3I A;  2HBP A;  3VU3 C;  1I81 A;  2CGH A;  3M0S A;  3PGG A;  1FMW A;  1WXT A;  5CKB A;  2HKN A;  2CP5 A;  1AZG B;  2DLP A;  1K9M R;  3JCM c;  5FU7 C;  1U3O A;  2M02 A;  3UDC A;  4E2F B;  4D8D A;  3PFS A;  1U1S A;  4DQ2 A;  3V8L A;  1SF9 A;  1Q86 C;  1ZBJ A;  2KVQ G;  5GAN h;  2YT6 A;  4M75 D;  1KHC A;  1UHC A;  2DVJ A;  2C0T A;  2FG0 A;  4M77 D;  1WDX A;  4LDX A;  2DRK A;  1TXQ A;  2RMO A;  3FJ5 A;  1QWF A;  3CME Q;  4TVR A;  4JRP A;  4JJN K;  2K7A A;  5LJ5 d;  2DL8 A;  4YTL A;  1VQL A;  5GAO q;  1QVF A;  2XK0 A;  1PD0 A;  3Q1J A;  3LH5 A;  4X9D A;  3CCV A;  5GAM j;  5J3B A;  3QSU A;  5GAM g;  1OEB A;  1WI7 A;  2VXF A;  3NHN A;  4EMK B;  2QQS A;  2VGN A;  4C0D C;  1NJI C;  5KYX A;  3RES A;  5L8R E;  3GPL A;  4RTT A;  1BKB A;  2DX1 A;  3G71 T;  1H8K A;  3QYG B;  4C0Z A;  2LNV A;  2NUZ A;  2LX9 A;  1VQ6 T;  1ZHI A;  2DL5 A;  1WHM A;  1AOJ A;  1Q81 C;  2CZ7 B;  2FL7 A;  1FMV A;  1M3C A;  4D6W A;  1RI9 A;  2V8J A;  1EIF A;  1QVF P;  2BZX A;  1YWO A;  3OA6 A;  1R0B G;  3C94 A;  2DM1 A;  1YI2 Q;  1M8V A;  2C06 A;  4X9C A;  4J6X A;  1VQL Q;  3VYH B;  1FXX A;  1AVZ C;  1BYM A;  1PNJ A;  2EBP A;  4X34 A;  2YRV A;  4PJO C;  1T3S A;  3URG A;  4KH1 B;  3EG0 A;  2GQV A;  2P0Q A;  1VQ4 A;  2OTL A;  4RCB A;  2EJ9 A;  1Y07 A;  2KT1 A;  3QDR B;  1BU1 A;  3OS1 A;  4A4K A;  5GJV B;  4AT1 B;  3PNW C;  2YDL A;  2RD1 A;  2C0I A;  3CCM A;  1N6A A;  1K73 R;  4OGE A;  2D8H A;  2MWO A;  4EMH A;  3QYH B;  2V1R A;  1GL5 A;  3QG1 A;  3HHT B;  3DLM A;  1SRM A;  2LQK A;  2F5T X;  3V8J A;  2JW4 A;  1GCP A;  3OS5 A;  2RB6 A;  3EHR A;  3CCU T;  1QVG A;  2ZPH B;  2E70 A;  4CC2 A;  1IXD A;  2G6F X;  4RTU A;  3CPF A;  1OV3 A;  4AFQ C;  2GCX A;  2RJE A;  2P4T A;  2RQV A;  4ME7 A;  2D9T A;  2F69 A;  2QAZ A;  4Q5W A;  5M9O A;  4QQ6 A;  3FB9 A;  1AWW A;  2YHT A;  3M0P A;  3RBB B;  3EFO B;  2CH4 A;  2RQU A;  3UAT A;  2OTJ T;  3EG3 A;  3OYH A;  4KUI A;  4DA4 A;  4FYY B;  1K9M U;  3HRU A;  4C92 G;  2PZ1 A;  3MEV A;  1QVG P;  1QKW A;  1D3B A;  1Q7Y R;  2MK5 A;  4XU0 A;  5KYW A;  2WSF E;  3D7S B;  3I55 Q;  3H6Z A;  2CP0 A;  2NUP A;  2XD0 A;  3CC7 A;  3C0C A;  1I4K 1;  2HNI A;  2KT8 A;  4PFZ A;  5GMK i;  2ESW A;  2LTO A;  2KY9 A;  4M77 G;  4AFU C;  1D0Y A;  1NE8 A;  2V1Q A;  2O88 A;  2E64 A;  2RK1 A;  1OX8 A;  4E7J A;  1BI0 A;  3CCR A;  2K4Y A;  2B86 A;  2QTV A;  3INZ A;  3AHU A;  1V76 A;  3L2U A;  4BY6 B;  4X1V A;  2E12 A;  5GAO r;  2L89 A;  3FIF A;  3MHX A;  4EMK C;  4HVU A;  2D0N A;  2DRM A;  4M7D F;  5EC7 A;  2PVG B;  2HL3 A;  4C8Q G;  1SPK A;  1GCQ A;  3M4Y A;  5CKD A;  3MEA A;  4M7D E;  2RF0 A;  3RKX A;  4JJC A;  5A0L A;  2DIL A;  2K5F A;  2RJC A;  1C0M A;  1ZSZ B;  2D8J A;  3OBW A;  3G1J A;  3VRZ A;  1G5V A;  2L8D A;  4C92 B;  3FJP A;  1VIE A;  1PD1 A;  1IB8 A;  4B9W A;  3CC7 Q;  4JPB W;  2EYX A;  2MIO A;  1OOT A;  1Y96 B;  1RAI B;  4BD3 A;  2DK3 A;  3I35 A;  2DFU A;  1OZ3 A;  2LC4 A;  3V7C A;  5J26 A;  2YLC A;  3CCR Q;  4Z02 A;  1VQO A;  1YJ9 T;  1VIF A;  2IVW A;  2QA4 T;  3M59 A;  5LJ3 d;  5KYN A;  3J80 E;  1LOJ A;  4M77 B;  1HJD A;  1VA7 A;  1D0Z A;  2CP3 A;  2LJ0 A;  1WYX A;  1K73 U;  1VQ8 T;  2DAQ A;  4M7D A;  4OMP A;  1X6B A;  3CCE A;  3PIP A;  1PC0 A;  1R77 A;  4PJM A;  3QZ5 B;  4M75 F;  3OY9 A;  4ORZ A;  4ZGJ B;  4M7A D;  2YUQ A;  4N0A C;  3RKY A;  2RJD A;  2KE9 A;  2QEX A;  3JCM b;  5FWC A;  1NEG A;  1G8X A;  3LGL A;  2GTO A;  1ZUK A;  3A1P A;  1JJ2 S;  2PVD B;  2DER A;  2DBK A;  1Y57 A;  1UUE A;  1IHW A;  1RAD B;  2A0F B;  4DBF A;  4ESR A;  4ZTJ A;  2QI2 A;  4RMO A;  3OYL A;  2QDY B;  4CI0 C;  2JTF A;  5CR2 A;  3EGX B;  1UFF A;  1G3S A;  2PVO B;  5GMK l;  2VYT A;  2NUT A;  1VQO Q;  2H3J A;  1SEM A;  3L2W A;  5GAN 2;  1WHK A;  2SRC A;  4B9X A;  1KQ2 A;  1K8A R;  2QGF B;  2ZCF B;  1X6O A;  2ZAE A;  2PTK A;  2F2W A;  2EYZ A;  2RK2 A;  3CEY A;  3P8B B;  3OW2 P;  1WNL A;  3OYJ A;  1H3Z A;  4XTU A;  1Q7Y U;  3QO3 A;  2COY A;  3RNJ A;  1YJN T;  5LJ5 f;  4L6V 5;  1LPL A;  5GAN g;  3OYN A;  2X9H A;  5I11 A;  1M9S A;  2HKQ B;  3H0H A;  2QEX Q;  4N4H A;  2HEQ A;  3I56 A;  1OZ2 A;  5FWB A;  1G3T A;  2KYM A;  3P8D A;  3CCS Q;  2EVR A;  4M78 D;  4C5E A;  5DLQ E;  3VS1 A;  5CVI A;  1OYX A;  4IKF A;  3JB9 H;  3CXC S;  1ZX6 A;  4OB3 B;  1K4U S;  1E6G A;  3VS3 A;  1RLP C;  5IHK A;  2LCL A;  3HPW A;  1JQQ A;  4A54 A;  2OJ2 A;  4KUL A;  2DD4 A;  4BY6 C;  1M2O A;  3WXM B;  4RTW A;  2X4Y A;  3EG2 A;  1M90 R;  4PJN A;  3VUB A;  2MI6 A;  1ACM B;  3CCQ Q;  3PT9 A;  2EIF A;  2K2M A;  5GAM d;  3G4S T;  3CBP A;  5IHI A;  3P8H A;  4B6M A;  3CC2 A;  1ZSZ C;  5DY9 A;  1QCO A;  1N27 A;  4C92 C;  2W10 A;  1UGP B;  3ZBD A;  1VQN T;  3CQT A;  3EH2 A;  2PNI A;  2EAY A;  2EW3 A;  2RHX A;  5IXB A;  3CCJ T;  2MCN A;  1XNI A;  1S72 T;  2ZPE B;  1NPR A;  1IO6 A;  4E7L A;  4EIK A;  4DBR A;  4KUD K;  1B07 A;  3DB4 A;  4LDY A;  4PLL A;  2DL3 A;  2EGE A;  2KMT A;  4O5V A;  2X51 A;  4M77 C;  3RR6 A;  4E7K A;  5CKH A;  4FW1 A;  4CC3 A;  2JTM A;  2DJZ A;  7AT1 B;  2WAC A;  4IUP A;  2K57 A;  2QGG A;  2X35 A;  2YWW A;  4N4G A;  4PJJ A;  5GMK m;  2CS7 A;  2EPD A;  3M55 A;  4AG2 C;  1H3H A;  1ZSG A;  2JVV A;  1PWT A;  1X75 C;  4C0D B;  2WSC E;  1KC8 C;  2HZY A;  2RQT A;  3PVL A;  2LCC A;  4KGV B;  2COZ A;  1K9M C;  5HCK A;  5C6S A;  1B3Q A;  2G3R A;  2M0Y A;  1Z9Z A;  3BY7 A;  4F16 A;  1UB4 A;  3AT1 B;  4JS5 A;  4OMM A;  4XU2 A;  4C5G A;  1QWE A;  1VQ5 A;  2JM8 A;  2EQU A;  4HT9 A;  1K76 A;  4OF1 A;  2EGC A;  2DL4 A;  2RJF A;  2EKO A;  2A3L A;  4CRI A;  4GBQ A;  2YLB A;  2RHI A;  1MHN A;  1N5Z A;  4RTZ A;  1K8A U;  1E6H A;  4J6W A;  4BI8 B;  1A0N B;  1YIJ T;  2E5K A;  5KE2 A;  1U1T A;  4XTW A;  3J7A F;  1ABO A;  3X25 B;  1BB9 A;  2DTI A;  1YIT A;  2GGR A;  4D8K A;  2KNB B;  4J9B A;  2EQK A;  4DOW A;  1VQ9 Q;  1M3A A;  1IRX A;  2R5M A;  5LJ5 h;  3OW2 S;  1IGU A;  3CC4 A;  2E6Z A;  3GP8 A;  4JLI A;  4PJL A;  4PJO F;  2DXB A;  3HFN A;  3OYE A;  4C5I A;  5HKC A;  1QCF A;  3OYB A;  4R55 A;  4PJO E;  2JT4 A;  3UPU A;  2ZPI B;  1VQP A;  2AK5 A;  1OI1 A;  1M1K R;  4P5N A;  2KR3 A;  4JZ4 A;  1JU5 C;  2F2X A;  2A08 A;  2L2P A;  4RTY A;  2LQ8 A;  1BK2 A;  1B7T A;  5GAO n;  2KQW A;  3VS2 A;  1VQ5 Q;  1RI0 A;  4M7A B;  1H64 1;  4AG1 C;  3JCM d;  2JJ9 A;  2EGA A;  5AT1 B;  1SRL A;  4F7U E;  1RUW A;  2DZC A;  1M90 U;  1OX9 A;  4HVW A;  4BDZ A;  1N8R R;  2LVM A;  2DIG A;  4Y91 A;  3CME T;  2DNU A;  2R58 A;  2A36 A;  2QQ9 A;  3OB9 A;  4C92 D;  3G7Z A;  4CC4 B;  2XDB A;  1SG5 A;  5GAN e;  2EKH A;  2BE9 B;  1QVP A;  2RI5 A;  3MJX A;  2CRE A;  1N9R A;  3MP6 A;  2E10 A;  4J83 A;  1ZA1 B;  4PJO A;  5LJ3 f;  2BTT A;  3E2U A;  4J8O A;  3OYD A;  4JJB A;  1T0J A; 
#chains in the Genus database with same CATH homology
 3H8Z A;  4Q5W A;  1HK9 A;  5M9O A;  4QQ6 A;  2JZ2 A;  1UGQ B;  1M4Z A;  2RA2 A;  3FB9 A;  3GLX A;  3OYK A;  2YHT A;  2M9U A;  1Y71 A;  3RIR A;  2RHU A;  4C92 A;  5A0G A;  1W2B A;  3EAE A;  4PJO G;  4C8Q F;  2OTJ T;  2K3X A;  1Q82 U;  1Q82 C;  3JCM h;  1WJS A;  3OYH A;  3CMA T;  3CCS A;  4KUI A;  4C8Q E;  5CAI A;  4DA4 A;  2E5Q A;  2Y4Y A;  1W4S A;  3QZ9 B;  2XKO C;  4OB1 B;  4F7U A;  3MP1 A;  4IUR A;  3QII A;  2QQA A;  4C8Q C;  3L2R A;  4A4H A;  1K9M U;  3HRU A;  4FT4 A;  4C92 G;  3LLR A;  3MEV A;  4OMF B;  5GAN 5;  2K3Y A;  4PNO A;  1D3B A;  2RI2 A;  4LDU A;  4M78 B;  2JNG A;  4XU0 A;  1VQ9 T;  3GNG A;  3JCM P;  2WSF E;  3E19 A;  1YJW A;  1WGS A;  1KQ1 A;  1NZ9 A;  3RUX A;  5FRO A;  4F7U G;  1YI2 T;  3H6Z A;  4C8Q D;  3E9G A;  3TEE A;  1YJN A;  1WJQ A;  1BI1 A;  4FIB A;  3CCL A;  2I2L A;  3CD6 A;  2DD5 A;  3M54 A;  3RMQ A;  3JCM Q;  3CC7 A;  3FLG A;  1I4K 1;  1IRE B;  5EG2 A;  2XD0 A;  2HNI A;  3M57 A;  5I2M A;  5GMK i;  4A4E A;  5CQX A;  1M1G A;  3KUF A;  2LTO A;  3WVD B;  4HT8 A;  4LD6 A;  2P0K A;  4E7I A;  3UT1 A;  3C95 A;  2KY9 A;  4M77 G;  5LJ5 e;  4ZGD B;  3VYG A;  3CCQ A;  1NE8 A;  2AHJ B;  4BUG A;  4LDW A;  2E64 A;  3A8M B;  3TCJ A;  3VUZ A;  4WF2 A;  2RK1 A;  4E7J A;  3PTA A;  2EJG A;  1YIJ A;  1BI0 A;  3CCR A;  1KQS A;  4DOV A;  1JJ2 A;  3G71 A;  3FDR A;  1WPY A;  2K4Y A;  4QVD A;  2X4X A;  3LGF A;  1FWZ A;  2LRQ A;  3SB2 A;  3I56 T;  3INZ A;  4C8Q A;  4ZN1 A;  4C0G A;  1Q81 U;  4J7F A;  3OMC A;  2RM4 A;  4BE1 A;  2ZGW A;  5GAO m;  3L2U A;  3S3M A;  4BY6 B;  3AHU A;  1DJ7 B;  3OMG A;  4R56 A;  2BIV A;  3O8V A;  1I5L A;  2E12 A;  3QHS A;  3RKW A;  1QVG S;  3A8G B;  2X4J A;  2DZ9 A;  2VXE A;  5GAO r;  2L89 A;  3FIF A;  3MHX A;  4EMK C;  4JLG A;  4NOY A;  4RCC A;  5CKE A;  4M7D F;  2PVG B;  4JRI A;  5D6X A;  1X01 A;  4C8Q G;  2P0P A;  3JB9 D;  3M4Y A;  5CKD A;  1V29 B;  3ASK A;  3MEA A;  4M7D E;  3RKX A;  3L1A A;  1XTD A;  2VV5 A;  5A0L A;  2K5F A;  2RJC A;  2RO0 A;  4MZP A;  4C0F A;  3OBW A;  4V2S A;  2DIQ A;  2RI3 A;  1G5V A;  3NTI A;  5IN1 A;  2L8D A;  4C92 B;  2FB7 A;  3FJP A;  1VIE A;  3G6E A;  4RG8 A;  5KCH A;  4B9W A;  3G4S A;  2XDP A;  2GFA A;  1YHQ A;  1W2B S;  3EFS A;  4IUT A;  1VQM A;  4HKE A;  5GAO n;  1Y96 B;  2BKD N;  3F70 A;  4QVZ A;  4ELZ C;  4F7U B;  4OB2 B;  4GY5 A;  4BD3 A;  4QQD A;  4M7D D;  2M16 A;  2DK3 A;  5CIU A;  1XOV A;  3OSV A;  1OZ3 A;  5IT9 E;  4MMK A;  2LC4 A;  3E9F A;  5FU6 B;  3A8H B;  4FSX A;  3V7C A;  3JB9 J;  1M1K U;  4HCZ A;  3CC2 T;  5J26 A;  4M7A F;  1YCY A;  2E41 A;  2YLC A;  4Z02 A;  4EMK A;  1VQO A;  1YJ9 T;  2R57 A;  3CCJ A;  1VIF A;  2IVW A;  2QA4 T;  4M7A E;  3M59 A;  2QTX A;  5LJ3 d;  2QQB A;  3CCU A;  1S72 A;  3J80 E;  1LOJ A;  4M77 B;  5FU7 B;  3CPW A;  3JB9 G;  3JRZ A;  5A2Q E;  1RL2 A;  4J6Y A;  4M7A C;  5GAM f;  1IZ6 A;  5GAN f;  3JCM e;  1K73 U;  1KD1 U;  3CXC A;  1K73 C;  3JAM E;  3I55 T;  1KD1 C;  1VQ8 T;  2XIC A;  4NL2 A;  2DAQ A;  4XTX A;  3J81 E;  1I8F A;  4M7D A;  2DPP B;  2MF2 A;  3CCE A;  4XTY A;  2HQX A;  3PIP A;  4OB0 B;  4BE2 A;  1YBY A;  2DVE A;  3N5B B;  5FRM A;  3LWI A;  3QZ5 B;  1N8R U;  1N8R C;  4M75 F;  5C0M A;  1O9S A;  3HL8 A;  3OY9 A;  1QP3 A;  3OBY A;  4ZGJ B;  1FX7 A;  2L3R A;  2A7Y A;  3M53 A;  4M7A D;  4N0A C;  3RKY A;  2RJD A;  4FU6 A;  1G3W A;  2QEX A;  3JCM b;  1NPP A;  2DXT A;  4C5H A;  4GLK A;  4M7D G;  3OYI A;  1KHI A;  3LGL A;  4M75 C;  1KQS S;  1JJ2 S;  3A8O B;  4ELY C;  3MO8 A;  2OTJ A;  5CCA A;  2PVD B;  1BIB A;  3DKM A;  3UWN A;  3OYM A;  3HKS A;  3SWN B;  3GF5 A;  2GF7 A;  3OSS C;  1UEB A;  3OYY A;  2E1H A;  3CBM A;  5KH6 A;  2QXF A;  3BFM A;  1VQK A;  3QXE B;  3EFR A;  3SD4 A;  2IG0 A;  4ZTJ A;  3HP9 A;  2QI2 A;  2HAX A;  4RMO A;  3OYL A;  4M7A A;  3M56 A;  2QDY B;  4PL6 A;  4A4G A;  4CI0 C;  2JTF A;  5LJ3 h;  5CR2 A;  2EJF A;  3LWH A;  2PUK B;  1VQ9 A;  4PLI A;  3HSB A;  1G3S A;  1JRI A;  3LH0 A;  2PVO B;  4RG2 A;  5GAN 7;  4BE0 A;  1BIA A;  5GMK l;  3OYA A;  2VYT A;  2H3J A;  4XU3 A;  3NTK A;  3L2W A;  4ZGE B;  5GAN 2;  4B9X A;  1YI2 A;  1VQL T;  1KQ2 A;  2ZCF B;  4XAX B;  1X6O A;  2JN0 A;  2KSS A;  3M4G A;  3JCM X;  3FEO A;  4M7A G;  4N0A A;  4M78 F;  1YJW T;  4A53 A;  1LNX A;  2RK2 A;  3CEY A;  3P8B B;  1WNL A;  3HFO A;  2ZPB B;  3SFM A;  3OYJ A;  2MWP A;  3DB3 A;  3CCV T;  1H3Z A;  1VQ5 T;  4M78 E;  1JB0 E;  3MEW A;  4XTU A;  1Q7Y U;  3QO3 A;  5HK0 A;  2XID A;  1Q7Y C;  2E6N A;  1YJN T;  3LX7 A;  3T9N A;  5LJ5 f;  3PMT A;  4L6V 5;  4LD9 K;  4BAC A;  4EMG A;  5CK9 A;  1P92 A;  3CCL T;  3CD6 T;  5GAN g;  4M78 C;  3X20 B;  5CQY A;  3RMS A;  3OYN A;  3CC7 T;  5IAY A;  5LJ3 j;  2O4X B;  1M9S A;  4FM4 B;  4NL3 A;  3X28 B;  1O75 A;  1QW1 A;  3QKJ A;  4KT0 E;  4JUV A;  4MDW A;  4NS5 A;  3ZEH A;  5I21 A;  5LJ3 g;  1VQ6 A;  4N4H A;  3I56 A;  1OZ2 A;  3BDL A;  1QP2 A;  1G3T A;  3JCM W;  1K8A C;  3P8D A;  4LDV A;  2DXU A;  2ZPF B;  4II1 A;  2V8I A;  3GOX A;  2EQM A;  3JCM V;  1AHJ B;  4A4F A;  4M78 D;  3CCR T;  4JRK A;  4O6J A;  4BI4 A;  4C5E A;  4PJO B;  3ZFJ A;  5DLQ E;  3CPW S;  3JSC A;  5CVI A;  1YIT T;  1PSF A;  1OYX A;  2Y90 A;  3L42 A;  2DKG A;  2X4W A;  4BB7 A;  4OP0 A;  4IKF A;  3JB9 H;  3ME9 A;  3CXC S;  3FRN A;  5AYF A;  3V7S A;  5A0D A;  2HQE A;  4E7H A;  2CZ6 B;  1GXI E;  4OB3 B;  2Y4X A;  1ZQ1 A;  2DTO A;  4HCC A;  3CC4 T;  2LCL A;  1B34 A;  4L5G A;  3HPW A;  4KBM B;  4A54 A;  4IUV A;  2MMP A;  2PUO B;  4HA8 A;  4KUL A;  4VUB A;  4PKC C;  2DD4 A;  3V7R A;  3NTH A;  3L2Z A;  1BI3 A;  4BY6 C;  2K2V A;  3E1S A;  3WXM B;  1VQP T;  3S3O A;  3S6W A;  4M78 A;  3QJY A;  2X4Y A;  3PMI A;  5GAN 4;  3VUB A;  5FLX E;  3HRT A;  5HK3 A;  1UGS B;  2MI6 A;  3GIB A;  2JOY A;  3LYI A;  3M9Q A;  4J5Y A;  3PT9 A;  1M5Q 1;  3G6E T;  1D3B B;  1VQ4 T;  2EIF A;  3GNF B;  2OTL T;  2DO3 A;  2VGM A;  4C92 F;  2GFU A;  5GAM d;  5GAN d;  3G4S T;  3CBP A;  2LT1 A;  3BW1 A;  2E65 A;  3M5A A;  4N4I A;  3P8H A;  3CME A;  3CCM T;  1YHQ T;  4M78 G;  3CC2 A;  1VQM T;  2NLU A;  2DEQ A;  5DY9 A;  2V8K A;  2O01 E;  3VKI A;  3MCA B;  1N27 A;  2M1H A;  4F7U F;  2BUD A;  4C92 C;  2RHY A;  1UGP B;  2JUF A;  3QUI A;  2EFI A;  2LT4 A;  3ZBD A;  4BI3 A;  5LJ5 g;  5GAN 3;  4ATO A;  1VQN T;  3A5Z B;  5GMK j;  4MZT A;  5GAO p;  5I2S A;  3FC3 A;  2L5Q A;  1TH7 A;  3JCM f;  2EAY A;  1VQ8 A;  3I55 A;  2RHX A;  2MAM A;  3DLL A;  1VQO T;  1UGR B;  3CCJ T;  4BDY A;  1WJR A;  1XNI A;  5GAN 8;  1U8R A;  4EPC A;  1S72 T;  2ZPE B;  4XTV A;  2LDM A;  3OW2 A;  3JB9 I;  4M77 F;  2B8A A;  1VQ7 T;  4HCB A;  4M75 E;  2HBP A;  3RER A;  5FU6 C;  1NPR A;  1WQW A;  2EQJ A;  4FT2 A;  3VU3 C;  1I81 A;  2CGH A;  4E7L A;  4KUD K;  3KXT A;  2CKK A;  3DB4 A;  4ZTF A;  3PGG A;  4LDY A;  4PLL A;  4C8Q B;  3X26 B;  5LJ3 e;  5CKB A;  2CZ0 B;  2KMT A;  3L2V A;  4RKU E;  4O5V A;  3CBO A;  4M77 C;  3JCM c;  4E7K A;  5CKH A;  5FU7 C;  3MET A;  3CMA A;  2JTM A;  3UDC A;  2DJZ A;  3PFS A;  1U1S A;  2WAC A;  3ER0 A;  3V8L A;  4DQ2 A;  2CZ1 B;  4IUP A;  4MML A;  2K57 A;  1JBM A;  2QEX T;  1Q86 C;  1Q86 U;  2DTH A;  2RHZ A;  3OYG A;  2X35 A;  4N4G A;  5GAM h;  2KVQ G;  5GAN h;  4M75 D;  1HXD A;  1KHC A;  3CCS T;  5D6Y A;  5GMK m;  4M77 D;  2CS7 A;  3M55 A;  4LDX A;  2JVV A;  4JDS A;  2KDS A;  1X75 C;  2PQW A;  5CO7 A;  4C0D B;  5DM7 R;  2WSC E;  1KC8 U;  1KC8 C;  1VQ4 A;  1Y96 A;  4TVR A;  1B34 B;  4JRP A;  1VQK T;  2LCC A;  3LW5 E;  4JJN K;  1K9M C;  5C6S A;  5LL6 S;  5LJ5 d;  2EWN A;  4MZM A;  2XI9 A;  4YTL A;  2G3R A;  3L2Q A;  1VQL A;  5GAO q;  5KCO A;  3BY7 A;  1QVF A;  1UB4 A;  3SWN C;  2ZZD A;  2XK0 A;  4JS5 A;  2CYZ B;  3Q1J A;  4M75 A;  4XU2 A;  2FHD A;  4X9D A;  4C5G A;  3CCV A;  5GAM j;  2EYQ A;  3NFC A;  5GAN j;  3CC4 A;  1VQ5 A;  4M77 A;  5J3B A;  2EQU A;  4HT9 A;  3S3N A;  3QSU A;  5GAM g;  4OF1 A;  2RJF A;  2VXF A;  4IUQ A;  4E47 A;  2EKO A;  2A3L A;  4XU1 A;  4CRI A;  4EMK B;  1R8O B;  3JCM g;  2YLB A;  2RHI A;  1MHN A;  2QQS A;  2VGN A;  2XU8 A;  4C0D C;  3CCQ T;  4JS4 A;  1NJI U;  1NJI C;  1K8A U;  4M75 G;  3X24 B;  2ZPG B;  2KK4 A;  4J6W A;  3RES A;  4BI8 B;  4UC4 A;  5L8R E;  3GPL A;  1YIJ T;  1BKB A;  3G71 T;  2VUB A;  3JB9 F;  5KE2 A;  2KAF A;  1U1T A;  3QYG B;  4C0Z A;  2FVU A;  5GMK e;  2LNV A;  4M7D B;  4XTW A;  3J7A F;  2LX9 A;  3OYF A;  1VQ6 T;  3X25 B;  1ZHI A;  2DTI A;  1YIT A;  1LJO A;  2WSE E;  5J39 A;  1Q81 C;  2DXC A;  2CZ7 B;  2FL7 A;  2EQK A;  4Y28 E;  4DOW A;  4D6W A;  3OYC A;  3OS0 A;  3SWN A;  3C12 A;  2V8J A;  2XG8 D;  2R5M A;  1KG1 A;  5LJ5 h;  1EIF A;  3OW2 S;  2D0Q B;  1N9S A;  2E6Z A;  3MP8 A;  3QJ6 A;  5GAO l;  4JLI A;  1G3Y A;  3GP8 A;  2D6F A;  5D6W A;  4PJO F;  2DXB A;  5GAN 6;  5GMK h;  2FYK A;  3C94 A;  3HFN A;  3OYE A;  4OVA A;  4C5I A;  5HKC A;  3OA6 A;  1M8V A;  3OYB A;  4R55 A;  3HRS A;  4XK8 E;  4PJO E;  3UPU A;  2C06 A;  4X9C A;  4J6X A;  4QQG A;  4OGC A;  2ZPI B;  1VQP A;  3M58 A;  3VYH B;  1OI1 A;  2K5I A;  3QPH A;  1FXX A;  4P5N A;  1BYM A;  4X34 A;  4PJO C;  1Y7X A;  1PSE A;  2LQ8 A;  2YRV A;  3A8L B;  3MEU A;  5KE3 A;  3URG A;  4M7D C;  4J7I A;  1VUB A;  2GQV A;  2P0Q A;  2KQW A;  3OQ5 A;  3WVE B;  1RI0 A;  4M7A B;  4RCB A;  2EJ9 A;  4C92 E;  4FL6 A;  1Y07 A;  2XDD A;  3QDR B;  2OTL A;  2PU9 B;  3OS1 A;  4A4K A;  1H64 1;  3VV0 A;  2M0O A;  3BDU A;  3JCM d;  3PNW C;  2RD1 A;  3CCM A;  1N6A A;  2RH2 A;  4OGE A;  1YJ9 A;  3SDZ A;  4MDX A;  2HD0 A;  5LJ5 j;  2QA4 A;  2MWO A;  4EMH A;  3C4S A;  4PJO D;  3QYH B;  4L59 A;  4QW2 A;  1SSF A;  3QG1 A;  5HY6 A;  4F7U E;  2VC8 A;  2DZC A;  3HHT B;  1M90 U;  3DLM A;  4BDZ A;  2LQK A;  4IUU A;  1M90 C;  2F5T X;  2LVM A;  2XHC A;  3V8J A;  4QVC A;  1VQN A;  2DIG A;  4XTZ A;  4Y91 A;  3CME T;  1M1K C;  1BI2 A;  2K5L A;  2O4X A;  3KBG A;  2R58 A;  2RB6 A;  3OS5 A;  3CCU T;  1QVG A;  2ZPH B;  2E70 A;  3TU4 K;  2QQ9 A;  3OB9 A;  1ZBX A;  4C92 D;  4M75 B;  3TRE A;  4JRQ A;  1MGQ A;  1QVF S;  3G7Z A;  1WQ7 A;  2XDB A;  5GAM e;  2QQR A;  5GAN e;  1XQH A;  3CPF A;  3OS2 A;  1QVP A;  4M77 E;  5FRN A;  3QBY A;  4XQ3 A;  3JCM J;  2RI5 A;  2GCX A;  2RJE A;  4EDU A;  3PIO A;  1VQ7 A;  1N9R A;  2F5K A;  3CCE T;  3MP6 A;  2P4T A;  5DLO A;  2E10 A;  4J83 A;  3VJP A;  4PJO A;  5CKF A;  1M1F A;  5LJ3 f;  2R5A A;  3R6O A;  2D9T A;  2OAU A;  4ME7 A;  2F69 A;  3V8K A;  4J8O A;  3OYD A;  4ZN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...