3SWNA

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
TILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 14
structure length 76
sequence length 76
chains with identical sequence D, P, S
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnA00
1KQ1A 4JLIA 5GMKm 4C8QF 4J6WA 5GAN8 2VXFA 5LJ5f 3QSUA 5GMKl 4M77B 1LNXA 1WQWA 4C8QC 3JCMh 4MMLA 3SWNB 4M77G 2RD1A 4V2SA 4HA8A 4JUVA 3QO3A 1U1SA 2DEQA 4M75C 3JCMQ 3L1AA 5GAN4 4M78A 1WQ7A 4XTYA 5GMKh 5GAOr 1WPYA 3FIFA 4MMKA 1HXDA 2DKGA 2VC8A 2RA2A 3BFMA 4N0AA 3RKXA 3RUXA 2HNIA 3VU3C 5LJ3j 5LJ5d 1I81A 4M75D 1M5Q1 2CGHA 2E64A 1N9SA 5DY9A 5LJ3g 3V7SA 4PNOA 5GAN7 1B34B 1HK9A 3INZA 2EJFA 4M78E 1JBMA 5LJ3f 2DXTA 3L2ZA 1N9RA 3QUIA 3JB9H 1D3BB 5I21A 5LJ5h 3FB9A 4HT9A 3HFNA 5GAOl 4M7DB 1H641 1LOJA 3PGGA 3HFOA 4XTUA 5GANg 4M7DD 2DZ9A 4M7DG 4C92F 5LJ3e 2Y90A 2DTHA 4M78F 3V8KA 4PJOA 2DTIA 3JCMP 4X9DA 2E10A 5LJ3d 5GAOq 4C92C 4C8QB 3FJPA 4M78C 3BDUA 3M4GA 3V8LA 4M7AA 4C92A 3JCMV 4C8QD 4C8QG 4NL3A 2YHTA 1Y96A 4EMGA 4QVCA 1YCYA 4N0AC 4WF2A 5GAMe 2JN0A 4M75B 2E65A 2YLBA 4DQ2A 4EMKC 4F7UE 5GAN3 4PJOE 5GANe 5LJ3h 3QHSA 1BIAA 4M75G 4M77F 4XU1A 4EMKA 5GANd 3JCMb 2DJZA 4M7AE 4A53A 4C92E 1X01A 4XTZA 4EMHA 5GAOn 1U1TA 2EWNA 4M77A 3V7RA 5GAMj 4F7UF 4PJOF 3GIBA 4Y91A 5GANj 5GAMg 2RB6A 4NOYA 2E41A 5GAN6 5GANh 3AHUA 4M7AF 4PJOC 5GAMf 4JRIA 4F7UA 1BIBA 3JB9F 5GANf 2K57A 4M77E 5GAN2 1WNLA 4M7AC 1JRIA 4J6XA 3JCMJ 3SB2A 2FYKA 4XU2A 3V7CA 4M78B 1I5LA 3RIRA 1I8FA 4C92D 3JCMe 1B34A 4M78D 5GAMd 4M78G 4HT8A 4X9CA 2DTOA 1D3BA 5GMKe 4M7DA 1MGQA 4M77C 2YLCA 2EJ9A 3EFRA 3V8JA 1M8VA 3BY7A 3SWNC 4J5YA 2DZCA 5GAMh 2I2LA 3SWNA 4M77D 4XTXA 4M75F 3JCMg 4XTVA 4XU3A 2QTXA 4A54A 4C8QA 5GAOp 2DVEA 4M7DE 4RCCA 4QVDA 3JCMf 5GMKj 4JRKA 1KQ2A 2FB7A 4F7UB 4PJOB 2RM4A 5LJ5e 4J6YA 4RCBA 4M75A 1I4K1 5GMKi 3RKYA 2EJGA 4F7UG 4NL2A 3BW1A 4PJOG 5GAN5 4PJOD 4M7AB 3HSBA 3JB9I 4C92B 2VXEA 4C8QE 2DXUA 4XTWA 1TH7A 1Y96B 4M7AD 1LJOA 4M7AG 4M7DF 4C92G 2ZGWA 4OP0A 3JB9J 3JCMX 3JB9D 2E1HA 3JB9G 2EAYA 3RKWA 3JCMd 4XU0A 3EFSA 4M75E 5LJ5j 4XQ3A 3JCMc 4M7DC 4EMKB 5GAOm 3JCMW 3RESA 3RERA 5LJ5g 5CAIA
chains in the Genus database with same CATH superfamily
4F14A 5GMKl 2RQUA 4MMLA 1VQ4T 5HK0A 2E12A 2VVKA 1UB4A 1WQ7A 3G4SQ 2LC4A 4HVVA 2RHUA 3RUXA 4DBRA 4IURA 2FL7A 4BE2A 1TS9A 1K0SA 3MEAA 2D1XA 1HK9A 3OQ5A 4R55A 3CMAA 3MP6A 1RI0A 3CMAQ 2LJ0A 2HQHA 1TUDA 3JCMP 1NLPC 4OMNA 1BI3A 1VYVA 3ME9A 3M5AA 3EG0A 1VQMT 2V8JA 3URGA 5CIUA 5GAN3 1XTDA 4O5VA 3P8BB 3CCLA 1VIFA 2YSQA 3DB4A 3LWIA 4DOWA 4PJOF 5J39A 5CKEA 3PVLA 5GAN6 1YI2A 2XG8D 4J9BA 1G2BA 3WVEB 4OMMA 5LL6S 1YIJA 2RK1A 4KBMB 3CCQA 3I35A 3L2VA 3CC2A 4D8DA 2O4XB 1X6GA 1GBQA 1X2KA 4M78D 2RMOA 5FWCA 4UC4A 3CCQQ 1D1CA 4RMOA 4GY5A 4J83A 2VGNA 5GJWB 2B8AA 2GBQA 5IH2A 2LJ1A 2ZPEB 4A54A 5GMKj 4NS5A 1QW1A 3UATA 4PJOG 3META 3OB9A 2LVMA 1K9AA 2A0FB 1BKBA 5CCAA 1N6AA 4IIOA 1OULA 2LP5A 4J6WA 4EPCA 2C06A 1WQWA 2V1QA 2GCXA 2RD1A 1RAFB 1NZ9A 2CKKA 3OYGA 3JCMQ 5GAOr 1YJWT 1HXDA 5LJ3j 2P84A 1WDXA 2DILA 2HNIA 1AZEA 1D1BA 5LJ3g 1BB9A 1Q82C 2D0QB 2X4XA 3TCJA 1YITT 2DXTA 2F1LA 1KQSS 5GAOl 2MK5A 1WYXA 1PRLC 3E1SA 4HKEA 4M78F 3UDCA 1T0HA 2V26A 4KGZB 2E6ZA 2IVWA 3FLGA 4LE9A 1ZHIA 2QA4Q 7AT1B 4M75G 3MEVA 5GANd 3MP1A 2P0QA 4F04B 1FWZA 3I55T 2O9VA 4MDWA 5D6YA 1AD5A 5GAMj 4E7JA 1VQ8A 2V8IA 5GAMg 3L2QA 1P92A 4PLLA 1UEBA 3X28B 4JRIA 1VQ8Q 5HKCA 5GAN2 4M7AC 2OTLA 4IUPA 1GBRA 1JO8A 1VQLT 3SB2A 3V7CA 1WGSA 3CCJQ 3EG3A 2YDLA 4P5NA 4J9FA 3JCMe 2OTLQ 2LT4A 4M78G 1T0JA 2BTTA 4A4EA 1VQOQ 1MGQA 2JS0A 4DOVA 3VUBA 1UGQB 3QZ9B 1JU5C 5KYWA 4TVRA 2DAQA 1GL5A 3J80E 3ZBDA 3E9GA 1K8AR 3BW1A 3H0FA 3VYHB 3CPWS 5DLQE 1QCOA 1UE9A 4C5HA 4B9WA 3OYDA 2DRKA 2EAYA 1H8KA 4OVAA 2M9UA 3EFOB 2HQXA 4JLIA 2EQJA 3EG9A 1PSEA 3BE3A 1NJIC 2JZ2A 2DRMA 3I56T 1VQKQ 3QO3A 4N4IA 2LZ6B 3R6NA 3L1AA 1KD1C 5KYYA 1J3TA 1AWOA 2XD0A 2A7YA 2M02A 1DJ7B 2RHXA 2OAWA 3OYNA 1JBMA 1E7OA 2RN8A 3CBPA 5I21A 2RJFA 4GLKA 2DBMA 2GF7A 4M7DD 3EG9B 2RH2A 1KC8R 3CCMQ 8AT1B 1LPLA 3CPWA 3DB3A 2OAUA 2YRCA 3V8LA 1M90U 2DL7A 4C8QD 1QWFA 3G1JA 5C0MA 2IPOB 1IREB 3ER0A 1C1AA 3OS5A 1UHFA 3QHSA 1Q86R 1IGUA 2R5MA 2NUPB 2EGEA 3SDZA 1KK7A 4F7UF 4RTZA 2FZGB 2QXFA 3BDLA 3QIIA 2JVVA 3JAME 1MV3A 2HBWA 5AT1B 1QVGS 2QQ9A 1YNZA 4Y28E 5IT9E 5KYUB 1X6BA 3CC7A 3GP8A 3EGXA 1S72T 1RL2A 2JTFA 4RG2A 5GMKe 2DLPA 2K4YA 1GXIE 4Z88A 5IHKA 4HVWA 1W2BP 3CD6Q 5DM7R 1K1ZA 1KQ2A 2OI3A 2COWA 3TQ7P 4BI4A 4J6YA 2MAMA 2KQWA 4F7UG 4M7AB 3C94A 3CC4A 4XTWA 4M7DF 3EGXB 4BE1A 1OU9A 2OTJA 3CCST 2LCCA 3CEYA 4C8QF 4BI3A 3G6ET 3VJPA 1I0CA 2QI2A 4MZMA 1K73R 5KYXB 3QXEB 3LGLA 4FW2A 3TU4K 3RKXA 1HYOA 2O2OA 5IXBA 1M2VA 1I1JA 1B34B 1UGVA 3I5RA 2JNGA 2WSFE 4M7DG 5M9OA 4PJOA 3NGPA 3O5ZA 3M4GA 3DLLA 4C8QG 4QVCA 2MIOA 5GAMe 3HRUA 4DQ2A 4EMKC 4PJOE 4K11A 2KROA 2GFAA 1R0BG 2BZ8A 2JTMA 1W2BA 1OX9A 4NOYA 3PFSA 1WNLA 2KSSA 3VKIA 1AZGB 3MPUB 2AT1B 1QWEA 1NYFA 1UHCA 4RTXA 4X9CA 2DTOA 4A4GA 2X35A 2KAFA 4X1VA 1MMAA 1R8OB 1BK2A 4M77C 2RI3A 1LCKA 1CKAA 4XU3A 3NPFA 2EQIA 4C0ZA 2PTKA 4M75A 1I4K1 2RJCA 1FXXA 2V8KA 4C92B 2R58A 1JEGA 2C0IA 3ULRB 2QDLA 3U23A 4M75E 2ZPFB 2HQEA 2ECZA 3M55A 4RKUE 3PMTA 3CCUA 4C5EA 1YJNT 3H0IA 2DE0X 5KCOA 1XNIA 2D0NA 2LQWA 2W10A 4FIBA 4M78A 4XTYA 2MWOA 4LDXA 4QQDA 4JJCA 2J7IA 2KNBB 5LJ5d 3CMET 4FYXB 1M5Q1 1VQPA 1Y07A 2Y4XA 3OYBA 1VQMQ 2EJFA 4M78E 3VS0A 3EAEA 1W4SA 4RG8A 2L3PA 2R5AA 1EIFA 3VS1A 2DYBA 2O31A 2FO0A 2CH4A 2KMTA 3CCEA 1VQ9A 4A63B 2VUBA 2RHZA 4OB2B 3QPHA 1FMKA 1K8AU 1WX6A 2KR3A 5IN1A 4EMKA 1VQ7T 1N8RC 4JRPA 2CUDA 3PNWC 5GANh 1Q7YC 1PWTA 1VQ5A 4FU6A 4E47A 2CUBA 2DPPB 1ZSZA 2L2PA 1WI7A 1D3BA 5KH6A 3UF4A 1YJ9A 2LQ8A 4IUQA 4IUUA 2X4YA 4OB0B 1YJ9Q 1M8MA 1GRIA 1PSFA 5FRMA 4LDYA 3CCRT 1KC8U 2FG0A 3TEEA 1SG5A 1YJWA 1PD0A 3C4SA 3M53A 1Q81C 2ZGWA 3JCMX 2KYBA 1YJWQ 3EH2A 2K5FA 1ZLMA 1ZSGA 4AFZC 3RERA 1Q86U 2CZ1B 4CC3A 1WXTA 5LJ5f 4M77B 4QKUA 1LNXA 4PKCC 1YITQ 1CSKA 3CXCS 1OQKA 1PNJA 3OYYA 1Y7XA 4JUVA 4JS5A 4C0FA 3QKJA 2O9SA 1RAAB 1U8RA 3FIFA 2RNAA 2CGHA 2P4RA 2LX7A 2KGTA 2KRMA 3M4YA 3FJ5A 1KHIA 3I55A 2DM1A 3I5SA 1QKWA 2KDSA 4ZTFA 1CKBA 4KULA 3I55Q 3MEWA 4CC4B 2M51A 3G4SA 4XK8E 4LD9K 1MUZA 2J6OA 2XDDA 3A8LB 4JJDA 1Y96A 1WXBA 4WTOB 3KXTA 2HMAA 2E65A 4F7UE 3FRNA 4XU1A 3JCMb 1G3TA 5ECAA 5I22A 5FU6C 4CC2A 2RI2A 2K3YA 1Q82R 2EGAA 1K73U 3JCMJ 1Z9QA 2NUZA 3MO8A 4XU2A 3PT9A 2M1HA 4C92D 2M16A 1OEBA 1NEGA 3NTHA 1SF9A 1MV0B 4M7DA 2EVRA 1SRLA 4PJNA 4QQ6A 4ANJA 1WA7A 3OSVA 1UGPB 3KUFA 2CREA 4ZN3A 4C8QA 2DK3A 2P0KA 4M7DE 2W0ZA 3NTIA 5GMKi 4PJLA 3PE0A 4C8QE 4E7IA 4ATOA 3VS7A 3QWXX 2PVDB 4XU0A 1WZOA 3TREA 1KQ1A 1H3HA 1KHCA 4E7HA 4BD3A 3WVDB 2ED1A 1H92A 1NYGA 1I07A 2HEQA 2ED0A 1PC0A 2V1RA 5GAN4 1MMGA 1YFNA 4L59A 2ZPHB 3SEMA 2DBKA 2JM8A 2PZ1A 5FU7B 5DY9A 2QGFB 1KQSP 3X20B 2JM9A 4MZTA 5C6SA 4BY6C 5A0GA 1WHMA 2CYZB 2GTJA 3HFOA 3HRSA 2K9GA 4WCIA 4C92F 2Y90A 2F2XA 2K3BA 5CQYA 4MDXA 4IIMA 5HCKA 2KE9A 2DJQA 2DXBA 2YT6A 1NJIR 1X01A 1VOMA 2DMOA 2XICA 1NPPA 4OF1A 1S72Q 2QEXA 2DA9A 3GIBA 1KD1R 4LDUA 4GBQA 4FSXA 2K5IA 2QEXQ 3CBMA 1JRIA 1YHQT 2QA4A 2KY9A 4RTTA 2JOYA 3FEOA 1Y57A 2CP3A 2XDPA 4DA4A 1NEBA 4AT1B 2VGMA 6AT1B 1U5SA 4ELZC 4JZ3A 3G7ZA 2EBPA 4LDVA 3CPFA 4M77D 5FU6B 2CS7A 3X24B 4QVDA 2MCNA 2RM4A 3CCJA 3OS0A 3CPWP 2X3WD 1RAIB 1KQSA 1QVPA 1VQOA 2E1HA 1X43A 3DLMA 2GGRA 4II1A 5GAOm 4CC7A 3QZ5B 3C0CA 4L5GA 5CK9A 1OX8A 2PVOB 4AFQC 4J9EA 4FL6A 2VASA 4DBFA 2QAZA 2HKQB 1UGSB 3BFMA 2PVGB 4JDSA 3CMAT 3V7SA 2FZKB 2PU9B 4AG1C 4BACA 1M1KC 5EG2A 5L23A 4HCZA 2LMJA 5LJ5h 4BDZA 5CKFA 1VQKA 4XTUA 5GANg 2AZSA 5KYWB 1BI1A 3OYCA 3JCMV 1IHWA 3Q1JA 2MMPA 3CCLT 1W1FA 1M3BA 2BUDA 2XDBA 4M77F 2DO3A 5A0LA 2LX9A 2JW4A 2FRYA 2DETA 2M0YA 2EWNA 2CT3A 3CCMA 4BDYA 1YI2T 1AEYA 3MKDA 2AHJB 2DF6A 2WACA 3AHUA 4L6V5 4PJOC 1YIJT 3CCQT 5GANf 1QVGP 3CC2T 2JUFA 4FT2A 5KYYB 1MMNA 2LQNA 2ROTA 2KK4A 5KYNA 2H3EB 3S3NA 4DEXA 4PJMA 5D7UA 3PTAA 4OMFB 3VS2A 1K9MC 3QG1A 3LX7A 5KCHA 1QMCA 3LH0A 2ESWA 1X27A 4J9IA 3GOXA 3M0TA 2HZYA 3L42A 2KRNA 2F2VA 1ACMB 4C0DC 1YJNQ 4D6WA 4LDWA 2X4WA 3JB9D 4CRIA 3CMEQ 2KEAA 3CD6A 3QSUA 1PD1A 1HD3A 3PIOA 2ZPBB 2DD5A 2L5QA 2RI5A 4ZGDB 3M0QA 1U1SA 2EIFA 5A0DA 1YCSB 1D09B 4M75C 2DVJA 2EFIA 1ABOA 1Q82U 4MMKA 2RF0A 1WIEA 2QG9B 1BYMA 1X75C 1UECA 1S1NA 1U06A 1C6VX 1WJRA 3QUIA 1VQ7A 3FB9A 4JLGA 4HT9A 1ZBJA 1VQ7Q 5LJ3e 1QVGA 5CKHA 3SD4A 4JS4A 2DEUA 2MI6A 3FJPA 4M78C 5IXFA 2AK5A 2YHTA 3OYMA 2VV5A 3VUZA 2QQRA 2WSCE 4ME7A 2DJZA 3REBB 3PMIA 3RDVA 1VQ8T 2MYSA 1RACB 2CP7A 1SHGA 4J9DA 2E41A 1B3QA 4ORZA 2KXDA 3JB9F 1TSFA 1ZBXA 5CO7A 2YUQA 3CCRQ 4PLIA 2EQUA 2ZZDA 1VQNT 1M2VB 2HSPA 2X9HA 1M8VA 1LVKA 2RQWA 3BY7A 5KE2A 2YRVA 4XTXA 3H6ZA 1O75A 1M9SA 2RJEA 5HK3A 5GAOp 4RCCA 2CSQA 3A8HB 4PJOB 2YRDA 2QQBA 4ZGJB 1ZSZC 4NL2A 4DBHA 2HL3A 1W6XA 2DXUA 1N8RR 3OMGA 3OYHA 3O8VA 3JB9G 1WHGA 3EFSA 3CCVA 1NJIU 1XOVA 1Q7YR 3CCVQ 2GTOA 2G3RA 4OMPA 1KD1U 4BE0A 3A8MB 1KSWA 3UT1A 1VQ4A 2YWWA 1T3SA 2F5KA 4ZNXA 3REAB 1WPYA 2FRWA 4N0AA 3C12A 1ZQ1A 1VQ4Q 1N9SA 1N27A 4C0DB 2EPDA 2KVQG 2AKLA 3HHTB 1QCFA 1BI2A 5KE3A 3EHRA 4FCYA 1IB8A 4LN2A 1Q81R 5CKBA 2D6FA 3CQTA 4J9GA 1VUBA 3PVQA 3QJ6A 1M1GA 5CQXA 3KBGA 1UUEA 1VIEA 4M75B 4OMQA 1VQMA 1RADB 2JTEA 4CI0C 4A53A 1F1BB 3LGFA 3OW2S 1V29B 3OYKA 2L0AA 1V1CA 2M0OA 3GNFB 1WJQA 4PFPA 2J6KA 2ZPGB 1RI9A 3CC7T 1NPRA 1UGRB 4M78B 1D1AA 3VRZA 3OYEA 2QGGA 4E7KA 2EGCA 4EDUA 2JT4A 1SEMA 3M0UA 2EYWA 2RJDA 2E3HA 4J5YA 2H3JA 2NLUA 2JS2A 2VWFA 4XTVA 5J3BA 2QTXA 3JRZA 3CC4T 1NBEB 1JB0E 2EQMA 2HAXA 1QCNA 1ZUUA 2IG0A 1TH7A 4M7AD 2OTJT 2LNHB 3WXMB 2QQAA 2RQRA 3JCMd 5LJ5j 3VS5A 4EMKB 4M7DC 3JCMW 5LJ5g 5CAIA 1QP3A 2Z0WA 3G71T 5GAN8 4FSSA 3MHXA 4ZN1A 1M3AA 1FYNA 3CXCP 4N4HA 4C8QC 1I5OB 1W70A 2X4JA 2HD0A 4BUGA 3RNJA 3VU3C 4V2SA 4HCCA 2E64A 1UFFA 1ZSZB 4LUEA 3VS6A 1WXUA 5I2MA 2E6NA 5GAN7 1QP2A 3X25B 1WFWA 1D3BB 4Q5WA 1Q95G 1YITA 1H641 1LOJA 1YWPA 2EYZA 1M2OA 2DZ9A 4PK4A 1BCMA 1UG1A 2FZCB 2E10A 2MPXC 1OPLA 1QVFP 3OSSC 1IRXA 2DXCA 1ABQA 1NE8A 4XTZA 4EMHA 2KYMA 1C0MA 2K3XA 1WHJA 4M7AF 4C5IA 3GBQA 3OBYA 4F7UA 1BU1A 4E6RA 3GLXA 4J6XA 2X51A 4KH1B 3GF5A 2DD4A 1QVFS 1VQLA 3OYLA 2E3IA 2GQIA 1VQLQ 4RUGA 3EFRA 3V8JA 1EFNA 1JXMA 3CXCA 4JPBW 2CSIA 4KT0E 5GJVB 5DLOA 1T3LA 1NG2A 4KRTA 3JCMf 1RAEB 2LCLA 2LDMA 4F7UB 1G3YA 1WHKA 1OPKA 4VUBA 5EC7A 1Y0MA 2LCSA 2H8HA 1M4ZA 1Y96B 1LJOA 4M7AG 2COZA 4OP0A 2KT8A 2A3LA 4HCKA 4N4GA 1BI0A 3E2UA 1SHFA 1QKXA 1AWJA 4J9CA 5GMKm 3CCUT 4C5GA 3VV0A 4HA8A 4O6JA 1QVFA 2DEQA 3I56A 1Z9ZA 2O4XA 1VQPT 2DKGA 2SRCA 2D8HA 4M75D 3I56Q 5FROA 1AHJB 4F17A 3H9NA 1FMVA 3F70A 1SRMA 5FLXE 2PUOB 3CCLQ 1N9RA 3OYJA 3DKMA 4M7DB 1TXQA 4OGEA 3CCET 1VQ9T 3LYIA 5D6WA 3V8KA 4QVZA 5LJ3d 4B6MA 2XMFA 3EGUA 4C8QB 2E5KA 1YI2Q 2K79A 3BDUA 4C0GA 3OA6A 3QDFA 4WF2A 1YIJQ 1B07A 1PG5B 1UJ0A 2XIDA 1M90C 1BIAA 3CC2Q 3CBOA 1N8RU 1TU0B 5GAOn 4LUDA 1JQQA 3S3OA 4E7ZA 2JMCA 4JZ4A 3QBYA 1Q7YU 3RBBB 1MMDA 1ZA2B 3M0PA 4FYYB 1VQ5T 2BE9B 3M59A 8ATCB 2E70A 3IQLA 1M1KR 2FPDA 1G83A 2OX7A 3RIRA 1RLPC 3QYGB 2QK0A 5GAMd 1YJ9T 1SSFA 2VYTA 1S72A 2DL8A 1B7TA 3QWYA 3SWNC 4M75F 2K5LA 1XQHA 1NLOC 1X2QA 4AFSC 3OY9A 4KH0B 1UTIA 3TVTA 4RTVA 5LJ5e 1X6OA 1Q81U 3EH1A 1JXOA 3M54A 5FW9A 2RO0A 1NM7A 1RABB 2B86A 2X3XD 3LLRA 4BB7A 4C92G 1R0CB 3JCMc 1OV3A 1OU8A 9ATCB 2JMAA 2F69A 1M30A 2C0OA 2HDAA 1HJDA 1WHLA 1BCOA 3CCSA 4KUDK 1GCQC 3OS2A 1EX4A 2ABLA 1X69A 4JJNK 5I11A 3G6EA 3CCSQ 3P8DA 4LD6A 1VQ6T 3G6EQ 2K2MA 2SEMA 2DIGA 1FMWA 1K9MR 4IUVA 2NYSA 4PNOA 1UDLA 2QQSA 5LJ3f 3A98A 4FW1A 4OGCA 3UPUA 2JJ9A 1ZA1B 5IHIA 2J6FA 3PGGA 2KI7A 4AMCA 3G4ST 3A8OB 2DTIA 2I0NA 3L2RA 1IHVA 4PJJA 5D6XA 2XU8A 2VKNA 3QJYA 2C0TA 2YLBA 3EFOA 4J9HA 1U3OA 1VQNA 1TG0A 2BKDN 4MZPA 3OBWA 2YUNA 2DL5A 1M27C 5GANj 4D8KA 1VQNQ 4XAXB 3NTKA 1G8XA 5GAMf 3P8HA 2PNIA 1VYTA 4RTYA 2WSEE 3EG1A 1YBYA 2ATCB 2YUPA 4PFZA 2FYKA 2EKHA 5IAYA 4A4FA 4DBQA 1N5ZA 4KGVB 4AFUC 2YXYA 4IKFA 4HT8A 4HCBA 1VA7A 2G6FX 4FT4A 2A37A 1D0XA 1PM3A 4J7IA 1K4US 1AWWA 3SWNA 4BY6B 2RQTA 4JRKA 2E5QA 2CDTA 2LJ3A 1G3WA 1OZ3A 1IXDA 3M0RA 4R0KA 1OZ2A 3JB9I 2QYZA 2NUPA 3HRTA 1RUWA 3H41A 4LNPA 4ZTJA 1E6HA 2CP5A 2DL3A 2XI9A 4FYVB 3J81E 3UWNA 1O9SA 3VS4A 3JCMh 3PIPA 3SWNB 2F2WA 4M77G 1GCQA 2CZ6B 1M3CA 1YJNA 5KYUA 4PL6A 1RAHB 1KIKA 2LNVA 1IGQA 2LTOA 2RA2A 3THKA 1D0ZA 4IUTA 2ZPIB 4B9XA 2CP6A 5CR2A 1FX7A 3CMEA 3J7AF 3A1PA 3L2WA 3GPLA 1ZUKA 2K7AA 4ELYC 3L2ZA 2DYIA 2KRSA 3JB9H 1MNEA 2KBTA 3UA6A 4Z89A 1HSQA 2CH4W 2FVUA 2VB6A 2EYXA 2K6DA 3S6WA 2EYQA 4ESRA 3EG2A 4X9DA 2XKOC 4C92C 2FHDA 4M7AA 2GNCA 4QW2A 1EZZB 4NL3A 4N0AC 2JN0A 2A36A 2RK2A 4DEYA 3ZEHA 3A5ZB 4YTLA 2MWPA 3CC7Q 4M7AE 4FYWB 4AG2C 3LWHA 2QEXT 1K8AC 2RQVA 2HSEB 1GFCA 4RTUA 3FC3A 2YUOA 1AT1B 2NUTA 5KYXA 2RB6A 3M56A 4A4HA 3MCAB 2CZ7B 2NWMA 1BIBA 2QA4T 2K57A 5J26A 3OYAA 2PUKB 5AYFA 2HKNA 2RHIA 1IZ6A 1UJYA 2QASA 4EIKA 2BZYA 1B34A 2J05A 3HPWA 5CVIA 3CC4Q 3S3MA 1TWBA 2OJ2A 1K0XA 1YWOA 2FEIA 2YLCA 4OB1B 2K2VA 2OTJQ 3NFCA 1KG1A 2IIMA 3G71A 2I2LA 2E4HA 2NUTB 3D7SB 1W2BS 2EKOA 2J06A 3RMQA 3CCJT 3G71Q 2FB7A 2OTLT 3LW5E 5CKDA 3CCRA 3SFMA 4Z02A 1VQOT 4PFOA 3HSBA 1KC8C 4Z8AA 2MF2A 3R6OA 1RAGB 1SSHA 3N5BB 2BIVA 4Y92A 2KT1A 1AOJA 1AWXA 3AT1B 5IHNA 4E7LA 2AZVA 2KXCA 3L2UA 1Q86C 4HVUA 5GMKh 1PKSA 2VC8A 1M1KU 1I81A 1YN8A 2R57A 1ZX6A 2ROLA 2CZ0B 3E19A 3UA7A 4F16A 3INZA 3OYIA 3RR6A 1VQKT 2HBPA 4LXCA 1TUGB 4J7FA 3GNGA 2HCKA 2DTHA 3H8ZA 2FPEA 5GAOq 3MJXA 2XHCA 2DERA 2AIRB 1YP5A 2RPNA 4C92A 5GANe 2A28A 3OW2P 5LJ3h 2ZCFB 2XK0A 3HL8A 4C92E 3X26B 1U1TA 4OMLA 3CCMT 3HTRA 2ZAEA 3V7RA 4E7SA 2QTVA 1A0NB 3OS1A 4Y91A 3I9QA 2RHYA 1IO6A 2D9TA 1E6GA 3H0HA 3JV3A 2BZXA 1M1FA 4KGXB 2EYYA 1OYXA 3EGDA 5L8RE 3RMSA 2FPFA 1KJWA 3QDRB 2D8JA 1I8FA 1K73C 3MEUA 3MP8A 2MOXA 1K9MU 1Y71A 2P4TA 1OOTA 2HL5C 1WHHA 2DFUA 4R56A 4FM4B 2DZCA 5GAMh 2COYA 3E9FA 2AKKA 4J8OA 2EQKA 1PCXA 3ASKA 1SKUB 3CCUQ 2Y4YA 4RCBA 4A4KA 3ZL7C 5FWBA 5A2QE 5GAN5 1OI1A 2PQWA 1PKTA 3LH5A 3OYFA 2F5TX 4BI8B 3EGDB 1I5LA 3M9QA 1BBZA 3SHWA 4QT7A 2L8DA 3FDRA 4XQ3A 1VQPQ 1MNDA 3TSWA 3CD6T 2P0PA 4M4ZA 3NHNA 2CP0A 2L89A 4X34A 1R77A 2VXFA 5I2SA 3VYGA 3VRYA 2CT4A 3C95A 1G5VA 1GCPA 3TSZA 2JXBA 1WJSA 1KFZA 2ENMA 1JJ2P 2DX1A 1TOVA 3CCEQ 1VQ9Q 3OW2A 3EHQA 1K76A 3M58A 2L3SA 1GFDA 4E2FB 2DNUA 3HFNA 3NMZC 4QQGA 1H3ZA 2EW3A 4GLMA 4RTWA 3VS3A 2LRQA 3QYHB 4JRQA 3KFVA 4EMGA 1G3SA 1YCYA 1JJ2S 1VQ5Q 2DL4A 3JSCA 1AVZC 4JJBA 2GQVA 2O01E 3M0SA 2CP2A 4M77A 1WLPB 1RLQC 2A08A 1PHTA 1QQJA 3ZFJA 1QLYA 5HY6A 4ZGEB 4HXJA 1TUCA 4M77E 2GFUA 3HKSA 5FU7C 1XJWB 2QDYB 1TTHB 1YHQA 4OMOA 1PRMC 3A8GB 2LQKA 1ZUYA 2DIQA 1YHQQ 2L3RA 2EJ9A 5FRNA 2LT1A 4KUIA 3JCMg 2DVEA 3HP9A 1JJ2A 1M90R 1V76A 2O88A 1VYUA 4OB3B 3RKYA 2EJGA 3M57A 4PJOD 2BE7D 1D0YA 1MHNA 2L3QA 2VXEA 1SPKA 1VQ6A 3T9NA 3CCVT 3JB9J 3RKWA 1VQ6Q 1ARKA 3RESA 3OMCA
chains in the Genus database with same CATH topology
2F69A 3M55A 4RKUE 3CD6A 3QSUA 5GMKl 3PIOA 2ZPBB 3PMTA 3CCSA 4KUDK 3CCUA 2DD5A 3OS2A 2L5QA 2RI5A 4MMLA 4ZGDB 5HK0A 2E12A 4C5EA 1VQ4T 4JJNK 1YJNT 5KCOA 1U1SA 2EIFA 1XNIA 1UB4A 3G6EA 5A0DA 4M75C 2EFIA 4FIBA 3P8DA 4M78A 1WQ7A 2MWOA 4XTYA 4LD6A 1Q82U 4QQDA 4LDXA 2LC4A 4MMKA 1VQ6T 2RHUA 3RUXA 5LJ5d 4IURA 3CMET 2FL7A 4BE2A 1M5Q1 2DIGA 1BYMA 1VQPA 1Y07A 4IUVA 1X75C 3MEAA 4PNOA 2Y4XA 3OYBA 2QQSA 1HK9A 5LJ3f 3OQ5A 2EJFA 4M78E 4R55A 3CMAA 3MP6A 1WJRA 3QUIA 1RI0A 4OGCA 3UPUA 1VQ7A 3EAEA 1W4SA 4RG8A 3FB9A 4JLGA 4HT9A 2R5AA 1EIFA 3PGGA 3G4ST 5LJ3e 1QVGA 3A8OB 2DTIA 5CKHA 3SD4A 3L2RA 3JCMP 4JS4A 1BI3A 2KMTA 2MI6A 3CCEA 1VQ9A 3FJPA 4M78C 3ME9A 5D6XA 3M5AA 1VQMT 2V8JA 3URGA 2VUBA 2YHTA 2RHZA 2XU8A 3QJYA 4OB2B 3OYMA 2VV5A 5CIUA 3QPHA 2YLBA 1K8AU 5GAN3 1XTDA 4O5VA 5IN1A 3P8BB 2QQRA 2WSCE 4ME7A 3VUZA 4EMKA 3CCLA 1VIFA 2DJZA 3PMIA 1VQ7T 1VQNA 2BKDN 3DB4A 1VQ8T 4MZPA 3LWIA 4DOWA 3OBWA 1N8RC 4PJOF 5J39A 5GANj 5CKEA 4JRPA 4XAXB 3NTKA 3PNWC 5GANh 2E41A 5GAN6 5GAMf 1YI2A 3P8HA 2XG8D 2WSEE 3WVEB 3JB9F 1Q7YC 5LL6S 1YIJA 2RK1A 1ZBXA 4KBMB 1VQ5A 5CO7A 1YBYA 4FU6A 3CCQA 4E47A 2DPPB 3L2VA 2FYKA 3CC2A 5IAYA 4PLIA 4A4FA 2O4XB 4M78D 2EQUA 4UC4A 2ZZDA 4IKFA 4HT8A 1VQNT 1D3BA 5KH6A 4HCBA 4FT4A 4RMOA 4GY5A 4J83A 2VGNA 1YJ9A 2LQ8A 2B8AA 4J7IA 1M8VA 3BY7A 5KE2A 2YRVA 4IUQA 4IUUA 2X4YA 4OB0B 3SWNA 4XTXA 1PSFA 3H6ZA 4BY6B 5FRMA 1O75A 4LDYA 2ZPEB 4A54A 3CCRT 1M9SA 2RJEA 5HK3A 5GAOp 4RCCA 5GMKj 4JRKA 3A8HB 4NS5A 1QW1A 1KC8U 2E5QA 4PJOB 2QQBA 1G3WA 1OZ3A 4ZGJB 3TEEA 4NL2A 4PJOG 1YJWA 3META 1OZ2A 3OB9A 3JB9I 2DXUA 2LVMA 3C4SA 3M53A 1Q81C 3OMGA 3OYHA 2ZGWA 3O8VA 3JCMX 3HRTA 3JB9G 3EFSA 1BKBA 2K5FA 3CCVA 5CCAA 1NJIU 1N6AA 4ZTJA 1XOVA 3RERA 1Q86U 2CZ1B 2XI9A 3J81E 4J6WA 4EPCA 5LJ5f 3UWNA 4M77B 2C06A 1O9SA 1LNXA 1WQWA 2G3RA 4PKCC 2GCXA 3JCMh 3PIPA 1KD1U 3SWNB 4M77G 2RD1A 3CXCS 2CZ6B 4JUVA 3OYYA 1Y7XA 4JS5A 3A8MB 1NZ9A 2CKKA 4C0FA 3OYGA 4BE0A 3QKJA 3UT1A 1VQ4A 3JCMQ 1YJNA 5GAOr 1YJWT 4PL6A 2F5KA 1U8RA 1WPYA 3FIFA 2LNVA 1HXDA 2LTOA 2RA2A 5LJ3j 4N0AA 4IUTA 2HNIA 2ZPIB 1ZQ1A 3C12A 2CGHA 4B9XA 1N9SA 5LJ3g 1N27A 5CR2A 1FX7A 3CMEA 4C0DB 2D0QB 1Q82C 3J7AF 2KVQG 3L2WA 3GPLA 2X4XA 3TCJA 1YITT 4ELYC 2DXTA 3HHTB 3L2ZA 3M4YA 1KQSS 3JB9H 1KHIA 3I55A 1BI2A 5GAOl 5KE3A 2KDSA 2FVUA 4ZTFA 4KULA 3S6WA 2EYQA 3E1SA 4HKEA 3MEWA 4M78F 4X9DA 3G4SA 4XK8E 5CKBA 4LD9K 2XKOC 4C92C 2D6FA 1VUBA 2FHDA 3UDCA 4M7AA 3QJ6A 4QW2A 2XDDA 3A8LB 1M1GA 4NL3A 5CQXA 1Y96A 2E6ZA 4N0AC 3KBGA 3KXTA 1VIEA 2IVWA 2JN0A 3FLGA 2E65A 4M75B 1ZHIA 4F7UE 3FRNA 1VQMA 2RK2A 4M75G 3ZEHA 3A5ZB 4YTLA 4XU1A 3MEVA 5GANd 3MP1A 2MWPA 4CI0C 3JCMb 4M7AE 4A53A 2P0QA 1FWZA 1G3TA 3LGFA 1V29B 3OW2S 1K8AC 2QEXT 3OYKA 3I55T 5D6YA 4MDWA 3LWHA 5GAMj 4E7JA 5FU6C 1VQ8A 2V8IA 3FC3A 2M0OA 2RI2A 5GAMg 3L2QA 2K3YA 3GNFB 1WJQA 2RB6A 3M56A 1P92A 4PLLA 4A4HA 3MCAB 2CZ7B 1UEBA 3X28B 4JRIA 1BIBA 5HKCA 2ZPGB 2QA4T 2K57A 5J26A 5GAN2 4M7AC 3OYAA 2PUKB 1K73U 3JCMJ 5AYFA 3CC7T 2OTLA 4IUPA 2RHIA 1VQLT 3MO8A 1NPRA 3SB2A 1UGRB 4XU2A 3V7CA 1WGSA 3PT9A 1IZ6A 4M78B 2M1HA 4P5NA 4C92D 3JCMe 1B34A 2LT4A 2M16A 4M78G 3HPWA 5CVIA 3OYEA 4E7KA 3S3MA 4EDUA 3NTHA 4A4EA 4M7DA 1MGQA 4OB1B 2YLCA 2K2VA 4QQ6A 4DOVA 3VUBA 2RJDA 1UGQB 3QZ9B 4J5YA 3NFCA 2H3JA 3OSVA 1UGPB 2NLUA 1KG1A 3G71A 2I2LA 3KUFA 4TVRA 4ZN3A 4XTVA 5J3BA 4C8QA 2DK3A 2P0KA 2QTXA 2EKOA 3RMQA 2DAQA 3CCJT 1W2BS 4M7DE 2FB7A 2OTLT 3LW5E 5CKDA 3NTIA 3JRZA 3J80E 3ZBDA 3SFMA 3CC4T 5GMKi 3CCRA 3E9GA 4Z02A 1JB0E 2EQMA 3BW1A 2HAXA 1VQOT 3HSBA 2IG0A 3VYHB 4C8QE 1KC8C 3CPWS 5DLQE 1TH7A 4E7IA 2MF2A 4M7AD 3R6OA 2OTJT 4ATOA 3WXMB 4C5HA 2QQAA 4B9WA 3OYDA 3N5BB 2EAYA 3JCMd 2PVDB 4XU0A 2BIVA 5LJ5j 4OVAA 4EMKB 4M7DC 2M9UA 3JCMW 3TREA 5LJ5g 5CAIA 2HQXA 1QP3A 1KQ1A 4JLIA 1KHCA 3G71T 5GAN8 2EQJA 4E7HA 4BD3A 3MHXA 3WVDB 4ZN1A 4E7LA 1PSEA 1NJIC 4N4HA 4C8QC 2JZ2A 2X4JA 3L2UA 1Q86C 3I56T 2HD0A 3QO3A 4N4IA 4BUGA 3L1AA 5GAN4 5GMKh 1KD1C 4L59A 2ZPHB 2VC8A 3VU3C 4V2SA 1M1KU 4HCCA 1I81A 2R57A 2E64A 5FU7B 2XD0A 2A7YA 5DY9A 2CZ0B 5I2MA 2E6NA 3E19A 5GAN7 1DJ7B 1QP2A 2RHXA 3INZA 3X20B 1JBMA 4MZTA 3X25B 5C6SA 3OYNA 3OYIA 3CBPA 4BY6C 1VQKT 1D3BB 2HBPA 2RJFA 5I21A 4GLKA 4Q5WA 5A0GA 1YITA 4J7FA 1H641 1LOJA 2CYZB 2GF7A 3HFOA 4M7DD 2DZ9A 3GNGA 3HRSA 4C92F 2RH2A 2Y90A 2DTHA 5CQYA 3H8ZA 2E10A 5GAOq 4MDXA 2XHCA 3CPWA 3DB3A 2OAUA 3V8LA 1M90U 4C92A 4C8QD 5C0MA 3OSSC 1IREB 3ER0A 3OS5A 2DXCA 5GANe 5LJ3h 2ZCFB 2DXBA 3QHSA 2XK0A 3HL8A 4C92E 1NE8A 1X01A 4XTZA 3X26B 4EMHA 1U1TA 2R5MA 3CCMT 2XICA 1NPPA 3V7RA 4OF1A 3SDZA 4F7UF 2QEXA 3GIBA 3OS1A 4Y91A 2K3XA 2RHYA 2QXFA 3BDLA 3QIIA 4LDUA 2JVVA 3JAME 2D9TA 4M7AF 4C5IA 4FSXA 2K5IA 3OBYA 4F7UA 1M1FA 3CBMA 3GLXA 1JRIA 4J6XA 1YHQT 1OYXA 2QA4A 1QVGS 2KY9A 3GF5A 2DD4A 5L8RE 2JOYA 2QQ9A 3RMSA 4Y28E 3FEOA 5IT9E 3QDRB 3CC7A 1I8FA 1QVFS 2XDPA 3MEUA 3GP8A 4DA4A 1K73C 1VQLA 1S72T 3MP8A 3OYLA 1RL2A 1K9MU 2VGMA 1Y71A 2P4TA 2JTFA 4RG2A 5GMKe 2K4YA 1GXIE 3EFRA 3V8JA 4ELZC 3G7ZA 3CXCA 4R56A 4FM4B 2DZCA 4KT0E 5GAMh 4LDVA 3E9FA 5DLOA 3CPFA 4M77D 4J8OA 2EQKA 5FU6B 5DM7R 3ASKA 2CS7A 3X24B 3JCMf 4QVDA 1KQ2A 2LCLA 2LDMA 4BI4A 2Y4YA 2RM4A 1G3YA 4F7UB 4J6YA 4RCBA 4A4KA 3OS0A 3CCJA 2MAMA 5A2QE 4VUBA 2KQWA 4F7UG 1OI1A 2PQWA 5GAN5 4M7AB 3OYFA 2F5TX 3C94A 4BI8B 3CC4A 4XTWA 1M4ZA 1Y96B 1KQSA 1LJOA 4M7AG 1QVPA 4M7DF 1VQOA 4OP0A 1I5LA 3M9QA 2E1HA 2A3LA 3DLMA 2L8DA 3FDRA 4N4GA 4BE1A 2OTJA 4XQ3A 1BI0A 4II1A 5GAOm 3CD6T 2P0PA 3CCST 5GMKm 3CCUT 2L89A 2LCCA 3CEYA 3QZ5B 4L5GA 4X34A 4C8QF 4C5GA 2VXFA 4BI3A 5CK9A 5I2SA 3VYGA 2PVOB 3G6ET 3C95A 3VJPA 4FL6A 2QI2A 4MZMA 3VV0A 4HA8A 1G5VA 4O6JA 1QVFA 1WJSA 2DEQA 3QXEB 3I56A 3LGLA 2O4XA 1UGSB 1VQPT 2DKGA 3BFMA 2PVGB 3TU4K 3RKXA 3OW2A 4M75D 4JDSA 5FROA 3CMAT 3M58A 3V7SA 1AHJB 1B34B 2PU9B 3F70A 5FLXE 2PUOB 1M1KC 4BACA 5EG2A 1N9RA 4HCZA 2JNGA 3OYJA 5LJ5h 3DKMA 4BDZA 5CKFA 3HFNA 4QQGA 4M7DB 1H3ZA 2WSFE 1VQKA 4OGEA 4XTUA 5GANg 4M7DG 5M9OA 3CCET 1VQ9T 3LYIA 5D6WA 3V8KA 4PJOA 4QVZA 5LJ3d 1BI1A 4C8QB 2LRQA 3BDUA 3M4GA 3DLLA 3QYHB 4C0GA 3OYCA 3OA6A 3JCMV 4JRQA 4C8QG 4EMGA 4QVCA 3Q1JA 1G3SA 1YCYA 2MMPA 4WF2A 5GAMe 3CCLT 3HRUA 1JJ2S 4DQ2A 2BUDA 4EMKC 2XDBA 2XIDA 4PJOE 1M90C 1BIAA 2DO3A 3CBOA 4M77F 2LX9A 5A0LA 2GFAA 1N8RU 3JSCA 5GAOn 2JTMA 3S3OA 2EWNA 2GQVA 2O01E 4M77A 1W2BA 3CCMA 4BDYA 1YI2T 3QBYA 1Q7YU 2AHJB 2WACA 4NOYA 3AHUA 4L6V5 4PJOC 1YIJT 3ZFJA 5HY6A 4ZGEB 1VQ5T 3PFSA 3CCQT 5GANf 4M77E 3M59A 1WNLA 2GFUA 2KSSA 2E70A 3HKSA 3VKIA 2JUFA 5FU7C 3CC2T 4FT2A 2QDYB 3RIRA 1YHQA 3QYGB 2KK4A 5GAMd 3A8GB 2LQKA 1YJ9T 4X9CA 2DTOA 3S3NA 1SSFA 4A4GA 2DIQA 2X35A 2KAFA 2VYTA 1S72A 1R8OB 2L3RA 4M77C 2EJ9A 2RI3A 5FRNA 3PTAA 3SWNC 4OMFB 1K9MC 3QG1A 2LT1A 3LX7A 5KCHA 4KUIA 3LH0A 4M75F 3JCMg 2K5LA 1XQHA 4XU3A 3GOXA 2DVEA 3HP9A 1JJ2A 3L42A 3OY9A 4C0ZA 5LJ5e 1Q81U 1X6OA 1I4K1 2RJCA 1FXXA 4M75A 4OB3B 2EJGA 3M57A 3RKYA 3M54A 4PJOD 2V8KA 2RO0A 4C0DC 4C92B 1MHNA 2R58A 2VXEA 1VQ6A 4D6WA 4LDWA 3T9NA 3LLRA 4BB7A 4C92G 3CCVT 3JB9J 2X4WA 3JB9D 3RKWA 4M75E 2ZPFB 3JCMc 4CRIA 3RESA 3OMCA 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ1 A;  4JLI A;  5GMK m;  4C8Q F;  4J6W A;  5GAN 8;  2VXF A;  5LJ5 f;  3QSU A;  5GMK l;  4M77 B;  1LNX A;  1WQW A;  4C8Q C;  3JCM h;  4MML A;  3SWN B;  4M77 G;  2RD1 A;  4V2S A;  4HA8 A;  4JUV A;  3QO3 A;  1U1S A;  2DEQ A;  4M75 C;  3JCM Q;  3L1A A;  5GAN 4;  4M78 A;  1WQ7 A;  4XTY A;  5GMK h;  5GAO r;  1WPY A;  3FIF A;  4MMK A;  1HXD A;  2DKG A;  2VC8 A;  2RA2 A;  3BFM A;  4N0A A;  3RKX A;  3RUX A;  2HNI A;  3VU3 C;  5LJ3 j;  5LJ5 d;  1I81 A;  4M75 D;  1M5Q 1;  2CGH A;  2E64 A;  1N9S A;  5DY9 A;  5LJ3 g;  3V7S A;  4PNO A;  5GAN 7;  1B34 B;  1HK9 A;  3INZ A;  2EJF A;  4M78 E;  1JBM A;  5LJ3 f;  2DXT A;  3L2Z A;  1N9R A;  3QUI A;  3JB9 H;  1D3B B;  5I21 A;  5LJ5 h;  3FB9 A;  4HT9 A;  3HFN A;  5GAO l;  4M7D B;  1H64 1;  1LOJ A;  3PGG A;  3HFO A;  4XTU A;  5GAN g;  4M7D D;  2DZ9 A;  4M7D G;  4C92 F;  5LJ3 e;  2Y90 A;  2DTH A;  4M78 F;  3V8K A;  4PJO A;  2DTI A;  3JCM P;  4X9D A;  2E10 A;  5LJ3 d;  5GAO q;  4C92 C;  4C8Q B;  3FJP A;  4M78 C;  3BDU A;  3M4G A;  3V8L A;  4M7A A;  4C92 A;  3JCM V;  4C8Q D;  4C8Q G;  4NL3 A;  2YHT A;  1Y96 A;  4EMG A;  4QVC A;  1YCY A;  4N0A C;  4WF2 A;  5GAM e;  2JN0 A;  4M75 B;  2E65 A;  2YLB A;  4DQ2 A;  4EMK C;  4F7U E;  5GAN 3;  4PJO E;  5GAN e;  5LJ3 h;  3QHS A;  1BIA A;  4M75 G;  4M77 F;  4XU1 A;  4EMK A;  5GAN d;  3JCM b;  2DJZ A;  4M7A E;  4A53 A;  4C92 E;  1X01 A;  4XTZ A;  4EMH A;  5GAO n;  1U1T A;  2EWN A;  4M77 A;  3V7R A;  5GAM j;  4F7U F;  4PJO F;  3GIB A;  4Y91 A;  5GAN j;  5GAM g;  2RB6 A;  4NOY A;  2E41 A;  5GAN 6;  5GAN h;  3AHU A;  4M7A F;  4PJO C;  5GAM f;  4JRI A;  4F7U A;  1BIB A;  3JB9 F;  5GAN f;  2K57 A;  4M77 E;  5GAN 2;  1WNL A;  4M7A C;  1JRI A;  4J6X A;  3JCM J;  3SB2 A;  2FYK A;  4XU2 A;  3V7C A;  4M78 B;  1I5L A;  3RIR A;  1I8F A;  4C92 D;  3JCM e;  1B34 A;  4M78 D;  5GAM d;  4M78 G;  4HT8 A;  4X9C A;  2DTO A;  1D3B A;  5GMK e;  4M7D A;  1MGQ A;  4M77 C;  2YLC A;  2EJ9 A;  3EFR A;  3V8J A;  1M8V A;  3BY7 A;  3SWN C;  4J5Y A;  2DZC A;  5GAM h;  2I2L A;  3SWN A;  4M77 D;  4XTX A;  4M75 F;  3JCM g;  4XTV A;  4XU3 A;  2QTX A;  4A54 A;  4C8Q A;  5GAO p;  2DVE A;  4M7D E;  4RCC A;  4QVD A;  3JCM f;  5GMK j;  4JRK A;  1KQ2 A;  2FB7 A;  4F7U B;  4PJO B;  2RM4 A;  5LJ5 e;  4J6Y A;  4RCB A;  4M75 A;  1I4K 1;  5GMK i;  3RKY A;  2EJG A;  4F7U G;  4NL2 A;  3BW1 A;  4PJO G;  5GAN 5;  4PJO D;  4M7A B;  3HSB A;  3JB9 I;  4C92 B;  2VXE A;  4C8Q E;  2DXU A;  4XTW A;  1TH7 A;  1Y96 B;  4M7A D;  1LJO A;  4M7A G;  4M7D F;  4C92 G;  2ZGW A;  4OP0 A;  3JB9 J;  3JCM X;  3JB9 D;  2E1H A;  3JB9 G;  2EAY A;  3RKW A;  3JCM d;  4XU0 A;  3EFS A;  4M75 E;  5LJ5 j;  4XQ3 A;  3JCM c;  4M7D C;  4EMK B;  5GAO m;  3JCM W;  3RES A;  3RER A;  5LJ5 g;  5CAI A; 
#chains in the Genus database with same CATH topology
 4F14 A;  5GMK l;  2RQU A;  4MML A;  1VQ4 T;  5HK0 A;  2E12 A;  2VVK A;  1UB4 A;  1WQ7 A;  3G4S Q;  2LC4 A;  4HVV A;  2RHU A;  3RUX A;  4DBR A;  4IUR A;  2FL7 A;  4BE2 A;  1TS9 A;  1K0S A;  3MEA A;  2D1X A;  1HK9 A;  3OQ5 A;  4R55 A;  3CMA A;  3MP6 A;  1RI0 A;  3CMA Q;  2LJ0 A;  2HQH A;  1TUD A;  3JCM P;  1NLP C;  4OMN A;  1BI3 A;  1VYV A;  3ME9 A;  3M5A A;  3EG0 A;  1VQM T;  2V8J A;  3URG A;  5CIU A;  5GAN 3;  1XTD A;  4O5V A;  3P8B B;  3CCL A;  1VIF A;  2YSQ A;  3DB4 A;  3LWI A;  4DOW A;  4PJO F;  5J39 A;  5CKE A;  3PVL A;  5GAN 6;  1YI2 A;  2XG8 D;  4J9B A;  1G2B A;  3WVE B;  4OMM A;  5LL6 S;  1YIJ A;  2RK1 A;  4KBM B;  3CCQ A;  3I35 A;  3L2V A;  3CC2 A;  4D8D A;  2O4X B;  1X6G A;  1GBQ A;  1X2K A;  4M78 D;  2RMO A;  5FWC A;  4UC4 A;  3CCQ Q;  1D1C A;  4RMO A;  4GY5 A;  4J83 A;  2VGN A;  5GJW B;  2B8A A;  2GBQ A;  5IH2 A;  2LJ1 A;  2ZPE B;  4A54 A;  5GMK j;  4NS5 A;  1QW1 A;  3UAT A;  4PJO G;  3MET A;  3OB9 A;  2LVM A;  1K9A A;  2A0F B;  1BKB A;  5CCA A;  1N6A A;  4IIO A;  1OUL A;  2LP5 A;  4J6W A;  4EPC A;  2C06 A;  1WQW A;  2V1Q A;  2GCX A;  2RD1 A;  1RAF B;  1NZ9 A;  2CKK A;  3OYG A;  3JCM Q;  5GAO r;  1YJW T;  1HXD A;  5LJ3 j;  2P84 A;  1WDX A;  2DIL A;  2HNI A;  1AZE A;  1D1B A;  5LJ3 g;  1BB9 A;  1Q82 C;  2D0Q B;  2X4X A;  3TCJ A;  1YIT T;  2DXT A;  2F1L A;  1KQS S;  5GAO l;  2MK5 A;  1WYX A;  1PRL C;  3E1S A;  4HKE A;  4M78 F;  3UDC A;  1T0H A;  2V26 A;  4KGZ B;  2E6Z A;  2IVW A;  3FLG A;  4LE9 A;  1ZHI A;  2QA4 Q;  7AT1 B;  4M75 G;  3MEV A;  5GAN d;  3MP1 A;  2P0Q A;  4F04 B;  1FWZ A;  3I55 T;  2O9V A;  4MDW A;  5D6Y A;  1AD5 A;  5GAM j;  4E7J A;  1VQ8 A;  2V8I A;  5GAM g;  3L2Q A;  1P92 A;  4PLL A;  1UEB A;  3X28 B;  4JRI A;  1VQ8 Q;  5HKC A;  5GAN 2;  4M7A C;  2OTL A;  4IUP A;  1GBR A;  1JO8 A;  1VQL T;  3SB2 A;  3V7C A;  1WGS A;  3CCJ Q;  3EG3 A;  2YDL A;  4P5N A;  4J9F A;  3JCM e;  2OTL Q;  2LT4 A;  4M78 G;  1T0J A;  2BTT A;  4A4E A;  1VQO Q;  1MGQ A;  2JS0 A;  4DOV A;  3VUB A;  1UGQ B;  3QZ9 B;  1JU5 C;  5KYW A;  4TVR A;  2DAQ A;  1GL5 A;  3J80 E;  3ZBD A;  3E9G A;  1K8A R;  3BW1 A;  3H0F A;  3VYH B;  3CPW S;  5DLQ E;  1QCO A;  1UE9 A;  4C5H A;  4B9W A;  3OYD A;  2DRK A;  2EAY A;  1H8K A;  4OVA A;  2M9U A;  3EFO B;  2HQX A;  4JLI A;  2EQJ A;  3EG9 A;  1PSE A;  3BE3 A;  1NJI C;  2JZ2 A;  2DRM A;  3I56 T;  1VQK Q;  3QO3 A;  4N4I A;  2LZ6 B;  3R6N A;  3L1A A;  1KD1 C;  5KYY A;  1J3T A;  1AWO A;  2XD0 A;  2A7Y A;  2M02 A;  1DJ7 B;  2RHX A;  2OAW A;  3OYN A;  1JBM A;  1E7O A;  2RN8 A;  3CBP A;  5I21 A;  2RJF A;  4GLK A;  2DBM A;  2GF7 A;  4M7D D;  3EG9 B;  2RH2 A;  1KC8 R;  3CCM Q;  8AT1 B;  1LPL A;  3CPW A;  3DB3 A;  2OAU A;  2YRC A;  3V8L A;  1M90 U;  2DL7 A;  4C8Q D;  1QWF A;  3G1J A;  5C0M A;  2IPO B;  1IRE B;  3ER0 A;  1C1A A;  3OS5 A;  1UHF A;  3QHS A;  1Q86 R;  1IGU A;  2R5M A;  2NUP B;  2EGE A;  3SDZ A;  1KK7 A;  4F7U F;  4RTZ A;  2FZG B;  2QXF A;  3BDL A;  3QII A;  2JVV A;  3JAM E;  1MV3 A;  2HBW A;  5AT1 B;  1QVG S;  2QQ9 A;  1YNZ A;  4Y28 E;  5IT9 E;  5KYU B;  1X6B A;  3CC7 A;  3GP8 A;  3EGX A;  1S72 T;  1RL2 A;  2JTF A;  4RG2 A;  5GMK e;  2DLP A;  2K4Y A;  1GXI E;  4Z88 A;  5IHK A;  4HVW A;  1W2B P;  3CD6 Q;  5DM7 R;  1K1Z A;  1KQ2 A;  2OI3 A;  2COW A;  3TQ7 P;  4BI4 A;  4J6Y A;  2MAM A;  2KQW A;  4F7U G;  4M7A B;  3C94 A;  3CC4 A;  4XTW A;  4M7D F;  3EGX B;  4BE1 A;  1OU9 A;  2OTJ A;  3CCS T;  2LCC A;  3CEY A;  4C8Q F;  4BI3 A;  3G6E T;  3VJP A;  1I0C A;  2QI2 A;  4MZM A;  1K73 R;  5KYX B;  3QXE B;  3LGL A;  4FW2 A;  3TU4 K;  3RKX A;  1HYO A;  2O2O A;  5IXB A;  1M2V A;  1I1J A;  1B34 B;  1UGV A;  3I5R A;  2JNG A;  2WSF E;  4M7D G;  5M9O A;  4PJO A;  3NGP A;  3O5Z A;  3M4G A;  3DLL A;  4C8Q G;  4QVC A;  2MIO A;  5GAM e;  3HRU A;  4DQ2 A;  4EMK C;  4PJO E;  4K11 A;  2KRO A;  2GFA A;  1R0B G;  2BZ8 A;  2JTM A;  1W2B A;  1OX9 A;  4NOY A;  3PFS A;  1WNL A;  2KSS A;  3VKI A;  1AZG B;  3MPU B;  2AT1 B;  1QWE A;  1NYF A;  1UHC A;  4RTX A;  4X9C A;  2DTO A;  4A4G A;  2X35 A;  2KAF A;  4X1V A;  1MMA A;  1R8O B;  1BK2 A;  4M77 C;  2RI3 A;  1LCK A;  1CKA A;  4XU3 A;  3NPF A;  2EQI A;  4C0Z A;  2PTK A;  4M75 A;  1I4K 1;  2RJC A;  1FXX A;  2V8K A;  4C92 B;  2R58 A;  1JEG A;  2C0I A;  3ULR B;  2QDL A;  3U23 A;  4M75 E;  2ZPF B;  2HQE A;  2ECZ A;  3M55 A;  4RKU E;  3PMT A;  3CCU A;  4C5E A;  1YJN T;  3H0I A;  2DE0 X;  5KCO A;  1XNI A;  2D0N A;  2LQW A;  2W10 A;  4FIB A;  4M78 A;  4XTY A;  2MWO A;  4LDX A;  4QQD A;  4JJC A;  2J7I A;  2KNB B;  5LJ5 d;  3CME T;  4FYX B;  1M5Q 1;  1VQP A;  1Y07 A;  2Y4X A;  3OYB A;  1VQM Q;  2EJF A;  4M78 E;  3VS0 A;  3EAE A;  1W4S A;  4RG8 A;  2L3P A;  2R5A A;  1EIF A;  3VS1 A;  2DYB A;  2O31 A;  2FO0 A;  2CH4 A;  2KMT A;  3CCE A;  1VQ9 A;  4A63 B;  2VUB A;  2RHZ A;  4OB2 B;  3QPH A;  1FMK A;  1K8A U;  1WX6 A;  2KR3 A;  5IN1 A;  4EMK A;  1VQ7 T;  1N8R C;  4JRP A;  2CUD A;  3PNW C;  5GAN h;  1Q7Y C;  1PWT A;  1VQ5 A;  4FU6 A;  4E47 A;  2CUB A;  2DPP B;  1ZSZ A;  2L2P A;  1WI7 A;  1D3B A;  5KH6 A;  3UF4 A;  1YJ9 A;  2LQ8 A;  4IUQ A;  4IUU A;  2X4Y A;  4OB0 B;  1YJ9 Q;  1M8M A;  1GRI A;  1PSF A;  5FRM A;  4LDY A;  3CCR T;  1KC8 U;  2FG0 A;  3TEE A;  1SG5 A;  1YJW A;  1PD0 A;  3C4S A;  3M53 A;  1Q81 C;  2ZGW A;  3JCM X;  2KYB A;  1YJW Q;  3EH2 A;  2K5F A;  1ZLM A;  1ZSG A;  4AFZ C;  3RER A;  1Q86 U;  2CZ1 B;  4CC3 A;  1WXT A;  5LJ5 f;  4M77 B;  4QKU A;  1LNX A;  4PKC C;  1YIT Q;  1CSK A;  3CXC S;  1OQK A;  1PNJ A;  3OYY A;  1Y7X A;  4JUV A;  4JS5 A;  4C0F A;  3QKJ A;  2O9S A;  1RAA B;  1U8R A;  3FIF A;  2RNA A;  2CGH A;  2P4R A;  2LX7 A;  2KGT A;  2KRM A;  3M4Y A;  3FJ5 A;  1KHI A;  3I55 A;  2DM1 A;  3I5S A;  1QKW A;  2KDS A;  4ZTF A;  1CKB A;  4KUL A;  3I55 Q;  3MEW A;  4CC4 B;  2M51 A;  3G4S A;  4XK8 E;  4LD9 K;  1MUZ A;  2J6O A;  2XDD A;  3A8L B;  4JJD A;  1Y96 A;  1WXB A;  4WTO B;  3KXT A;  2HMA A;  2E65 A;  4F7U E;  3FRN A;  4XU1 A;  3JCM b;  1G3T A;  5ECA A;  5I22 A;  5FU6 C;  4CC2 A;  2RI2 A;  2K3Y A;  1Q82 R;  2EGA A;  1K73 U;  3JCM J;  1Z9Q A;  2NUZ A;  3MO8 A;  4XU2 A;  3PT9 A;  2M1H A;  4C92 D;  2M16 A;  1OEB A;  1NEG A;  3NTH A;  1SF9 A;  1MV0 B;  4M7D A;  2EVR A;  1SRL A;  4PJN A;  4QQ6 A;  4ANJ A;  1WA7 A;  3OSV A;  1UGP B;  3KUF A;  2CRE A;  4ZN3 A;  4C8Q A;  2DK3 A;  2P0K A;  4M7D E;  2W0Z A;  3NTI A;  5GMK i;  4PJL A;  3PE0 A;  4C8Q E;  4E7I A;  4ATO A;  3VS7 A;  3QWX X;  2PVD B;  4XU0 A;  1WZO A;  3TRE A;  1KQ1 A;  1H3H A;  1KHC A;  4E7H A;  4BD3 A;  3WVD B;  2ED1 A;  1H92 A;  1NYG A;  1I07 A;  2HEQ A;  2ED0 A;  1PC0 A;  2V1R A;  5GAN 4;  1MMG A;  1YFN A;  4L59 A;  2ZPH B;  3SEM A;  2DBK A;  2JM8 A;  2PZ1 A;  5FU7 B;  5DY9 A;  2QGF B;  1KQS P;  3X20 B;  2JM9 A;  4MZT A;  5C6S A;  4BY6 C;  5A0G A;  1WHM A;  2CYZ B;  2GTJ A;  3HFO A;  3HRS A;  2K9G A;  4WCI A;  4C92 F;  2Y90 A;  2F2X A;  2K3B A;  5CQY A;  4MDX A;  4IIM A;  5HCK A;  2KE9 A;  2DJQ A;  2DXB A;  2YT6 A;  1NJI R;  1X01 A;  1VOM A;  2DMO A;  2XIC A;  1NPP A;  4OF1 A;  1S72 Q;  2QEX A;  2DA9 A;  3GIB A;  1KD1 R;  4LDU A;  4GBQ A;  4FSX A;  2K5I A;  2QEX Q;  3CBM A;  1JRI A;  1YHQ T;  2QA4 A;  2KY9 A;  4RTT A;  2JOY A;  3FEO A;  1Y57 A;  2CP3 A;  2XDP A;  4DA4 A;  1NEB A;  4AT1 B;  2VGM A;  6AT1 B;  1U5S A;  4ELZ C;  4JZ3 A;  3G7Z A;  2EBP A;  4LDV A;  3CPF A;  4M77 D;  5FU6 B;  2CS7 A;  3X24 B;  4QVD A;  2MCN A;  2RM4 A;  3CCJ A;  3OS0 A;  3CPW P;  2X3W D;  1RAI B;  1KQS A;  1QVP A;  1VQO A;  2E1H A;  1X43 A;  3DLM A;  2GGR A;  4II1 A;  5GAO m;  4CC7 A;  3QZ5 B;  3C0C A;  4L5G A;  5CK9 A;  1OX8 A;  2PVO B;  4AFQ C;  4J9E A;  4FL6 A;  2VAS A;  4DBF A;  2QAZ A;  2HKQ B;  1UGS B;  3BFM A;  2PVG B;  4JDS A;  3CMA T;  3V7S A;  2FZK B;  2PU9 B;  4AG1 C;  4BAC A;  1M1K C;  5EG2 A;  5L23 A;  4HCZ A;  2LMJ A;  5LJ5 h;  4BDZ A;  5CKF A;  1VQK A;  4XTU A;  5GAN g;  2AZS A;  5KYW B;  1BI1 A;  3OYC A;  3JCM V;  1IHW A;  3Q1J A;  2MMP A;  3CCL T;  1W1F A;  1M3B A;  2BUD A;  2XDB A;  4M77 F;  2DO3 A;  5A0L A;  2LX9 A;  2JW4 A;  2FRY A;  2DET A;  2M0Y A;  2EWN A;  2CT3 A;  3CCM A;  4BDY A;  1YI2 T;  1AEY A;  3MKD A;  2AHJ B;  2DF6 A;  2WAC A;  3AHU A;  4L6V 5;  4PJO C;  1YIJ T;  3CCQ T;  5GAN f;  1QVG P;  3CC2 T;  2JUF A;  4FT2 A;  5KYY B;  1MMN A;  2LQN A;  2ROT A;  2KK4 A;  5KYN A;  2H3E B;  3S3N A;  4DEX A;  4PJM A;  5D7U A;  3PTA A;  4OMF B;  3VS2 A;  1K9M C;  3QG1 A;  3LX7 A;  5KCH A;  1QMC A;  3LH0 A;  2ESW A;  1X27 A;  4J9I A;  3GOX A;  3M0T A;  2HZY A;  3L42 A;  2KRN A;  2F2V A;  1ACM B;  4C0D C;  1YJN Q;  4D6W A;  4LDW A;  2X4W A;  3JB9 D;  4CRI A;  3CME Q;  2KEA A;  3CD6 A;  3QSU A;  1PD1 A;  1HD3 A;  3PIO A;  2ZPB B;  2DD5 A;  2L5Q A;  2RI5 A;  4ZGD B;  3M0Q A;  1U1S A;  2EIF A;  5A0D A;  1YCS B;  1D09 B;  4M75 C;  2DVJ A;  2EFI A;  1ABO A;  1Q82 U;  4MMK A;  2RF0 A;  1WIE A;  2QG9 B;  1BYM A;  1X75 C;  1UEC A;  1S1N A;  1U06 A;  1C6V X;  1WJR A;  3QUI A;  1VQ7 A;  3FB9 A;  4JLG A;  4HT9 A;  1ZBJ A;  1VQ7 Q;  5LJ3 e;  1QVG A;  5CKH A;  3SD4 A;  4JS4 A;  2DEU A;  2MI6 A;  3FJP A;  4M78 C;  5IXF A;  2AK5 A;  2YHT A;  3OYM A;  2VV5 A;  3VUZ A;  2QQR A;  2WSC E;  4ME7 A;  2DJZ A;  3REB B;  3PMI A;  3RDV A;  1VQ8 T;  2MYS A;  1RAC B;  2CP7 A;  1SHG A;  4J9D A;  2E41 A;  1B3Q A;  4ORZ A;  2KXD A;  3JB9 F;  1TSF A;  1ZBX A;  5CO7 A;  2YUQ A;  3CCR Q;  4PLI A;  2EQU A;  2ZZD A;  1VQN T;  1M2V B;  2HSP A;  2X9H A;  1M8V A;  1LVK A;  2RQW A;  3BY7 A;  5KE2 A;  2YRV A;  4XTX A;  3H6Z A;  1O75 A;  1M9S A;  2RJE A;  5HK3 A;  5GAO p;  4RCC A;  2CSQ A;  3A8H B;  4PJO B;  2YRD A;  2QQB A;  4ZGJ B;  1ZSZ C;  4NL2 A;  4DBH A;  2HL3 A;  1W6X A;  2DXU A;  1N8R R;  3OMG A;  3OYH A;  3O8V A;  3JB9 G;  1WHG A;  3EFS A;  3CCV A;  1NJI U;  1XOV A;  1Q7Y R;  3CCV Q;  2GTO A;  2G3R A;  4OMP A;  1KD1 U;  4BE0 A;  3A8M B;  1KSW A;  3UT1 A;  1VQ4 A;  2YWW A;  1T3S A;  2F5K A;  4ZNX A;  3REA B;  1WPY A;  2FRW A;  4N0A A;  3C12 A;  1ZQ1 A;  1VQ4 Q;  1N9S A;  1N27 A;  4C0D B;  2EPD A;  2KVQ G;  2AKL A;  3HHT B;  1QCF A;  1BI2 A;  5KE3 A;  3EHR A;  4FCY A;  1IB8 A;  4LN2 A;  1Q81 R;  5CKB A;  2D6F A;  3CQT A;  4J9G A;  1VUB A;  3PVQ A;  3QJ6 A;  1M1G A;  5CQX A;  3KBG A;  1UUE A;  1VIE A;  4M75 B;  4OMQ A;  1VQM A;  1RAD B;  2JTE A;  4CI0 C;  4A53 A;  1F1B B;  3LGF A;  3OW2 S;  1V29 B;  3OYK A;  2L0A A;  1V1C A;  2M0O A;  3GNF B;  1WJQ A;  4PFP A;  2J6K A;  2ZPG B;  1RI9 A;  3CC7 T;  1NPR A;  1UGR B;  4M78 B;  1D1A A;  3VRZ A;  3OYE A;  2QGG A;  4E7K A;  2EGC A;  4EDU A;  2JT4 A;  1SEM A;  3M0U A;  2EYW A;  2RJD A;  2E3H A;  4J5Y A;  2H3J A;  2NLU A;  2JS2 A;  2VWF A;  4XTV A;  5J3B A;  2QTX A;  3JRZ A;  3CC4 T;  1NBE B;  1JB0 E;  2EQM A;  2HAX A;  1QCN A;  1ZUU A;  2IG0 A;  1TH7 A;  4M7A D;  2OTJ T;  2LNH B;  3WXM B;  2QQA A;  2RQR A;  3JCM d;  5LJ5 j;  3VS5 A;  4EMK B;  4M7D C;  3JCM W;  5LJ5 g;  5CAI A;  1QP3 A;  2Z0W A;  3G71 T;  5GAN 8;  4FSS A;  3MHX A;  4ZN1 A;  1M3A A;  1FYN A;  3CXC P;  4N4H A;  4C8Q C;  1I5O B;  1W70 A;  2X4J A;  2HD0 A;  4BUG A;  3RNJ A;  3VU3 C;  4V2S A;  4HCC A;  2E64 A;  1UFF A;  1ZSZ B;  4LUE A;  3VS6 A;  1WXU A;  5I2M A;  2E6N A;  5GAN 7;  1QP2 A;  3X25 B;  1WFW A;  1D3B B;  4Q5W A;  1Q95 G;  1YIT A;  1H64 1;  1LOJ A;  1YWP A;  2EYZ A;  1M2O A;  2DZ9 A;  4PK4 A;  1BCM A;  1UG1 A;  2FZC B;  2E10 A;  2MPX C;  1OPL A;  1QVF P;  3OSS C;  1IRX A;  2DXC A;  1ABQ A;  1NE8 A;  4XTZ A;  4EMH A;  2KYM A;  1C0M A;  2K3X A;  1WHJ A;  4M7A F;  4C5I A;  3GBQ A;  3OBY A;  4F7U A;  1BU1 A;  4E6R A;  3GLX A;  4J6X A;  2X51 A;  4KH1 B;  3GF5 A;  2DD4 A;  1QVF S;  1VQL A;  3OYL A;  2E3I A;  2GQI A;  1VQL Q;  4RUG A;  3EFR A;  3V8J A;  1EFN A;  1JXM A;  3CXC A;  4JPB W;  2CSI A;  4KT0 E;  5GJV B;  5DLO A;  1T3L A;  1NG2 A;  4KRT A;  3JCM f;  1RAE B;  2LCL A;  2LDM A;  4F7U B;  1G3Y A;  1WHK A;  1OPK A;  4VUB A;  5EC7 A;  1Y0M A;  2LCS A;  2H8H A;  1M4Z A;  1Y96 B;  1LJO A;  4M7A G;  2COZ A;  4OP0 A;  2KT8 A;  2A3L A;  4HCK A;  4N4G A;  1BI0 A;  3E2U A;  1SHF A;  1QKX A;  1AWJ A;  4J9C A;  5GMK m;  3CCU T;  4C5G A;  3VV0 A;  4HA8 A;  4O6J A;  1QVF A;  2DEQ A;  3I56 A;  1Z9Z A;  2O4X A;  1VQP T;  2DKG A;  2SRC A;  2D8H A;  4M75 D;  3I56 Q;  5FRO A;  1AHJ B;  4F17 A;  3H9N A;  1FMV A;  3F70 A;  1SRM A;  5FLX E;  2PUO B;  3CCL Q;  1N9R A;  3OYJ A;  3DKM A;  4M7D B;  1TXQ A;  4OGE A;  3CCE T;  1VQ9 T;  3LYI A;  5D6W A;  3V8K A;  4QVZ A;  5LJ3 d;  4B6M A;  2XMF A;  3EGU A;  4C8Q B;  2E5K A;  1YI2 Q;  2K79 A;  3BDU A;  4C0G A;  3OA6 A;  3QDF A;  4WF2 A;  1YIJ Q;  1B07 A;  1PG5 B;  1UJ0 A;  2XID A;  1M90 C;  1BIA A;  3CC2 Q;  3CBO A;  1N8R U;  1TU0 B;  5GAO n;  4LUD A;  1JQQ A;  3S3O A;  4E7Z A;  2JMC A;  4JZ4 A;  3QBY A;  1Q7Y U;  3RBB B;  1MMD A;  1ZA2 B;  3M0P A;  4FYY B;  1VQ5 T;  2BE9 B;  3M59 A;  8ATC B;  2E70 A;  3IQL A;  1M1K R;  2FPD A;  1G83 A;  2OX7 A;  3RIR A;  1RLP C;  3QYG B;  2QK0 A;  5GAM d;  1YJ9 T;  1SSF A;  2VYT A;  1S72 A;  2DL8 A;  1B7T A;  3QWY A;  3SWN C;  4M75 F;  2K5L A;  1XQH A;  1NLO C;  1X2Q A;  4AFS C;  3OY9 A;  4KH0 B;  1UTI A;  3TVT A;  4RTV A;  5LJ5 e;  1X6O A;  1Q81 U;  3EH1 A;  1JXO A;  3M54 A;  5FW9 A;  2RO0 A;  1NM7 A;  1RAB B;  2B86 A;  2X3X D;  3LLR A;  4BB7 A;  4C92 G;  1R0C B;  3JCM c;  1OV3 A;  1OU8 A;  9ATC B;  2JMA A;  2F69 A;  1M30 A;  2C0O A;  2HDA A;  1HJD A;  1WHL A;  1BCO A;  3CCS A;  4KUD K;  1GCQ C;  3OS2 A;  1EX4 A;  2ABL A;  1X69 A;  4JJN K;  5I11 A;  3G6E A;  3CCS Q;  3P8D A;  4LD6 A;  1VQ6 T;  3G6E Q;  2K2M A;  2SEM A;  2DIG A;  1FMW A;  1K9M R;  4IUV A;  2NYS A;  4PNO A;  1UDL A;  2QQS A;  5LJ3 f;  3A98 A;  4FW1 A;  4OGC A;  3UPU A;  2JJ9 A;  1ZA1 B;  5IHI A;  2J6F A;  3PGG A;  2KI7 A;  4AMC A;  3G4S T;  3A8O B;  2DTI A;  2I0N A;  3L2R A;  1IHV A;  4PJJ A;  5D6X A;  2XU8 A;  2VKN A;  3QJY A;  2C0T A;  2YLB A;  3EFO A;  4J9H A;  1U3O A;  1VQN A;  1TG0 A;  2BKD N;  4MZP A;  3OBW A;  2YUN A;  2DL5 A;  1M27 C;  5GAN j;  4D8K A;  1VQN Q;  4XAX B;  3NTK A;  1G8X A;  5GAM f;  3P8H A;  2PNI A;  1VYT A;  4RTY A;  2WSE E;  3EG1 A;  1YBY A;  2ATC B;  2YUP A;  4PFZ A;  2FYK A;  2EKH A;  5IAY A;  4A4F A;  4DBQ A;  1N5Z A;  4KGV B;  4AFU C;  2YXY A;  4IKF A;  4HT8 A;  4HCB A;  1VA7 A;  2G6F X;  4FT4 A;  2A37 A;  1D0X A;  1PM3 A;  4J7I A;  1K4U S;  1AWW A;  3SWN A;  4BY6 B;  2RQT A;  4JRK A;  2E5Q A;  2CDT A;  2LJ3 A;  1G3W A;  1OZ3 A;  1IXD A;  3M0R A;  4R0K A;  1OZ2 A;  3JB9 I;  2QYZ A;  2NUP A;  3HRT A;  1RUW A;  3H41 A;  4LNP A;  4ZTJ A;  1E6H A;  2CP5 A;  2DL3 A;  2XI9 A;  4FYV B;  3J81 E;  3UWN A;  1O9S A;  3VS4 A;  3JCM h;  3PIP A;  3SWN B;  2F2W A;  4M77 G;  1GCQ A;  2CZ6 B;  1M3C A;  1YJN A;  5KYU A;  4PL6 A;  1RAH B;  1KIK A;  2LNV A;  1IGQ A;  2LTO A;  2RA2 A;  3THK A;  1D0Z A;  4IUT A;  2ZPI B;  4B9X A;  2CP6 A;  5CR2 A;  1FX7 A;  3CME A;  3J7A F;  3A1P A;  3L2W A;  3GPL A;  1ZUK A;  2K7A A;  4ELY C;  3L2Z A;  2DYI A;  2KRS A;  3JB9 H;  1MNE A;  2KBT A;  3UA6 A;  4Z89 A;  1HSQ A;  2CH4 W;  2FVU A;  2VB6 A;  2EYX A;  2K6D A;  3S6W A;  2EYQ A;  4ESR A;  3EG2 A;  4X9D A;  2XKO C;  4C92 C;  2FHD A;  4M7A A;  2GNC A;  4QW2 A;  1EZZ B;  4NL3 A;  4N0A C;  2JN0 A;  2A36 A;  2RK2 A;  4DEY A;  3ZEH A;  3A5Z B;  4YTL A;  2MWP A;  3CC7 Q;  4M7A E;  4FYW B;  4AG2 C;  3LWH A;  2QEX T;  1K8A C;  2RQV A;  2HSE B;  1GFC A;  4RTU A;  3FC3 A;  2YUO A;  1AT1 B;  2NUT A;  5KYX A;  2RB6 A;  3M56 A;  4A4H A;  3MCA B;  2CZ7 B;  2NWM A;  1BIB A;  2QA4 T;  2K57 A;  5J26 A;  3OYA A;  2PUK B;  5AYF A;  2HKN A;  2RHI A;  1IZ6 A;  1UJY A;  2QAS A;  4EIK A;  2BZY A;  1B34 A;  2J05 A;  3HPW A;  5CVI A;  3CC4 Q;  3S3M A;  1TWB A;  2OJ2 A;  1K0X A;  1YWO A;  2FEI A;  2YLC A;  4OB1 B;  2K2V A;  2OTJ Q;  3NFC A;  1KG1 A;  2IIM A;  3G71 A;  2I2L A;  2E4H A;  2NUT B;  3D7S B;  1W2B S;  2EKO A;  2J06 A;  3RMQ A;  3CCJ T;  3G71 Q;  2FB7 A;  2OTL T;  3LW5 E;  5CKD A;  3CCR A;  3SFM A;  4Z02 A;  1VQO T;  4PFO A;  3HSB A;  1KC8 C;  4Z8A A;  2MF2 A;  3R6O A;  1RAG B;  1SSH A;  3N5B B;  2BIV A;  4Y92 A;  2KT1 A;  1AOJ A;  1AWX A;  3AT1 B;  5IHN A;  4E7L A;  2AZV A;  2KXC A;  3L2U A;  1Q86 C;  4HVU A;  5GMK h;  1PKS A;  2VC8 A;  1M1K U;  1I81 A;  1YN8 A;  2R57 A;  1ZX6 A;  2ROL A;  2CZ0 B;  3E19 A;  3UA7 A;  4F16 A;  3INZ A;  3OYI A;  3RR6 A;  1VQK T;  2HBP A;  4LXC A;  1TUG B;  4J7F A;  3GNG A;  2HCK A;  2DTH A;  3H8Z A;  2FPE A;  5GAO q;  3MJX A;  2XHC A;  2DER A;  2AIR B;  1YP5 A;  2RPN A;  4C92 A;  5GAN e;  2A28 A;  3OW2 P;  5LJ3 h;  2ZCF B;  2XK0 A;  3HL8 A;  4C92 E;  3X26 B;  1U1T A;  4OML A;  3CCM T;  3HTR A;  2ZAE A;  3V7R A;  4E7S A;  2QTV A;  1A0N B;  3OS1 A;  4Y91 A;  3I9Q A;  2RHY A;  1IO6 A;  2D9T A;  1E6G A;  3H0H A;  3JV3 A;  2BZX A;  1M1F A;  4KGX B;  2EYY A;  1OYX A;  3EGD A;  5L8R E;  3RMS A;  2FPF A;  1KJW A;  3QDR B;  2D8J A;  1I8F A;  1K73 C;  3MEU A;  3MP8 A;  2MOX A;  1K9M U;  1Y71 A;  2P4T A;  1OOT A;  2HL5 C;  1WHH A;  2DFU A;  4R56 A;  4FM4 B;  2DZC A;  5GAM h;  2COY A;  3E9F A;  2AKK A;  4J8O A;  2EQK A;  1PCX A;  3ASK A;  1SKU B;  3CCU Q;  2Y4Y A;  4RCB A;  4A4K A;  3ZL7 C;  5FWB A;  5A2Q E;  5GAN 5;  1OI1 A;  2PQW A;  1PKT A;  3LH5 A;  3OYF A;  2F5T X;  4BI8 B;  3EGD B;  1I5L A;  3M9Q A;  1BBZ A;  3SHW A;  4QT7 A;  2L8D A;  3FDR A;  4XQ3 A;  1VQP Q;  1MND A;  3TSW A;  3CD6 T;  2P0P A;  4M4Z A;  3NHN A;  2CP0 A;  2L89 A;  4X34 A;  1R77 A;  2VXF A;  5I2S A;  3VYG A;  3VRY A;  2CT4 A;  3C95 A;  1G5V A;  1GCP A;  3TSZ A;  2JXB A;  1WJS A;  1KFZ A;  2ENM A;  1JJ2 P;  2DX1 A;  1TOV A;  3CCE Q;  1VQ9 Q;  3OW2 A;  3EHQ A;  1K76 A;  3M58 A;  2L3S A;  1GFD A;  4E2F B;  2DNU A;  3HFN A;  3NMZ C;  4QQG A;  1H3Z A;  2EW3 A;  4GLM A;  4RTW A;  3VS3 A;  2LRQ A;  3QYH B;  4JRQ A;  3KFV A;  4EMG A;  1G3S A;  1YCY A;  1JJ2 S;  1VQ5 Q;  2DL4 A;  3JSC A;  1AVZ C;  4JJB A;  2GQV A;  2O01 E;  3M0S A;  2CP2 A;  4M77 A;  1WLP B;  1RLQ C;  2A08 A;  1PHT A;  1QQJ A;  3ZFJ A;  1QLY A;  5HY6 A;  4ZGE B;  4HXJ A;  1TUC A;  4M77 E;  2GFU A;  3HKS A;  5FU7 C;  1XJW B;  2QDY B;  1TTH B;  1YHQ A;  4OMO A;  1PRM C;  3A8G B;  2LQK A;  1ZUY A;  2DIQ A;  1YHQ Q;  2L3R A;  2EJ9 A;  5FRN A;  2LT1 A;  4KUI A;  3JCM g;  2DVE A;  3HP9 A;  1JJ2 A;  1M90 R;  1V76 A;  2O88 A;  1VYU A;  4OB3 B;  3RKY A;  2EJG A;  3M57 A;  4PJO D;  2BE7 D;  1D0Y A;  1MHN A;  2L3Q A;  2VXE A;  1SPK A;  1VQ6 A;  3T9N A;  3CCV T;  3JB9 J;  3RKW A;  1VQ6 Q;  1ARK A;  3RES A;  3OMC A; 
#chains in the Genus database with same CATH homology
 2F69 A;  3M55 A;  4RKU E;  3CD6 A;  3QSU A;  5GMK l;  3PIO A;  2ZPB B;  3PMT A;  3CCS A;  4KUD K;  3CCU A;  2DD5 A;  3OS2 A;  2L5Q A;  2RI5 A;  4MML A;  4ZGD B;  5HK0 A;  2E12 A;  4C5E A;  1VQ4 T;  4JJN K;  1YJN T;  5KCO A;  1U1S A;  2EIF A;  1XNI A;  1UB4 A;  3G6E A;  5A0D A;  4M75 C;  2EFI A;  4FIB A;  3P8D A;  4M78 A;  1WQ7 A;  2MWO A;  4XTY A;  4LD6 A;  1Q82 U;  4QQD A;  4LDX A;  2LC4 A;  4MMK A;  1VQ6 T;  2RHU A;  3RUX A;  5LJ5 d;  4IUR A;  3CME T;  2FL7 A;  4BE2 A;  1M5Q 1;  2DIG A;  1BYM A;  1VQP A;  1Y07 A;  4IUV A;  1X75 C;  3MEA A;  4PNO A;  2Y4X A;  3OYB A;  2QQS A;  1HK9 A;  5LJ3 f;  3OQ5 A;  2EJF A;  4M78 E;  4R55 A;  3CMA A;  3MP6 A;  1WJR A;  3QUI A;  1RI0 A;  4OGC A;  3UPU A;  1VQ7 A;  3EAE A;  1W4S A;  4RG8 A;  3FB9 A;  4JLG A;  4HT9 A;  2R5A A;  1EIF A;  3PGG A;  3G4S T;  5LJ3 e;  1QVG A;  3A8O B;  2DTI A;  5CKH A;  3SD4 A;  3L2R A;  3JCM P;  4JS4 A;  1BI3 A;  2KMT A;  2MI6 A;  3CCE A;  1VQ9 A;  3FJP A;  4M78 C;  3ME9 A;  5D6X A;  3M5A A;  1VQM T;  2V8J A;  3URG A;  2VUB A;  2YHT A;  2RHZ A;  2XU8 A;  3QJY A;  4OB2 B;  3OYM A;  2VV5 A;  5CIU A;  3QPH A;  2YLB A;  1K8A U;  5GAN 3;  1XTD A;  4O5V A;  5IN1 A;  3P8B B;  2QQR A;  2WSC E;  4ME7 A;  3VUZ A;  4EMK A;  3CCL A;  1VIF A;  2DJZ A;  3PMI A;  1VQ7 T;  1VQN A;  2BKD N;  3DB4 A;  1VQ8 T;  4MZP A;  3LWI A;  4DOW A;  3OBW A;  1N8R C;  4PJO F;  5J39 A;  5GAN j;  5CKE A;  4JRP A;  4XAX B;  3NTK A;  3PNW C;  5GAN h;  2E41 A;  5GAN 6;  5GAM f;  1YI2 A;  3P8H A;  2XG8 D;  2WSE E;  3WVE B;  3JB9 F;  1Q7Y C;  5LL6 S;  1YIJ A;  2RK1 A;  1ZBX A;  4KBM B;  1VQ5 A;  5CO7 A;  1YBY A;  4FU6 A;  3CCQ A;  4E47 A;  2DPP B;  3L2V A;  2FYK A;  3CC2 A;  5IAY A;  4PLI A;  4A4F A;  2O4X B;  4M78 D;  2EQU A;  4UC4 A;  2ZZD A;  4IKF A;  4HT8 A;  1VQN T;  1D3B A;  5KH6 A;  4HCB A;  4FT4 A;  4RMO A;  4GY5 A;  4J83 A;  2VGN A;  1YJ9 A;  2LQ8 A;  2B8A A;  4J7I A;  1M8V A;  3BY7 A;  5KE2 A;  2YRV A;  4IUQ A;  4IUU A;  2X4Y A;  4OB0 B;  3SWN A;  4XTX A;  1PSF A;  3H6Z A;  4BY6 B;  5FRM A;  1O75 A;  4LDY A;  2ZPE B;  4A54 A;  3CCR T;  1M9S A;  2RJE A;  5HK3 A;  5GAO p;  4RCC A;  5GMK j;  4JRK A;  3A8H B;  4NS5 A;  1QW1 A;  1KC8 U;  2E5Q A;  4PJO B;  2QQB A;  1G3W A;  1OZ3 A;  4ZGJ B;  3TEE A;  4NL2 A;  4PJO G;  1YJW A;  3MET A;  1OZ2 A;  3OB9 A;  3JB9 I;  2DXU A;  2LVM A;  3C4S A;  3M53 A;  1Q81 C;  3OMG A;  3OYH A;  2ZGW A;  3O8V A;  3JCM X;  3HRT A;  3JB9 G;  3EFS A;  1BKB A;  2K5F A;  3CCV A;  5CCA A;  1NJI U;  1N6A A;  4ZTJ A;  1XOV A;  3RER A;  1Q86 U;  2CZ1 B;  2XI9 A;  3J81 E;  4J6W A;  4EPC A;  5LJ5 f;  3UWN A;  4M77 B;  2C06 A;  1O9S A;  1LNX A;  1WQW A;  2G3R A;  4PKC C;  2GCX A;  3JCM h;  3PIP A;  1KD1 U;  3SWN B;  4M77 G;  2RD1 A;  3CXC S;  2CZ6 B;  4JUV A;  3OYY A;  1Y7X A;  4JS5 A;  3A8M B;  1NZ9 A;  2CKK A;  4C0F A;  3OYG A;  4BE0 A;  3QKJ A;  3UT1 A;  1VQ4 A;  3JCM Q;  1YJN A;  5GAO r;  1YJW T;  4PL6 A;  2F5K A;  1U8R A;  1WPY A;  3FIF A;  2LNV A;  1HXD A;  2LTO A;  2RA2 A;  5LJ3 j;  4N0A A;  4IUT A;  2HNI A;  2ZPI B;  1ZQ1 A;  3C12 A;  2CGH A;  4B9X A;  1N9S A;  5LJ3 g;  1N27 A;  5CR2 A;  1FX7 A;  3CME A;  4C0D B;  2D0Q B;  1Q82 C;  3J7A F;  2KVQ G;  3L2W A;  3GPL A;  2X4X A;  3TCJ A;  1YIT T;  4ELY C;  2DXT A;  3HHT B;  3L2Z A;  3M4Y A;  1KQS S;  3JB9 H;  1KHI A;  3I55 A;  1BI2 A;  5GAO l;  5KE3 A;  2KDS A;  2FVU A;  4ZTF A;  4KUL A;  3S6W A;  2EYQ A;  3E1S A;  4HKE A;  3MEW A;  4M78 F;  4X9D A;  3G4S A;  4XK8 E;  5CKB A;  4LD9 K;  2XKO C;  4C92 C;  2D6F A;  1VUB A;  2FHD A;  3UDC A;  4M7A A;  3QJ6 A;  4QW2 A;  2XDD A;  3A8L B;  1M1G A;  4NL3 A;  5CQX A;  1Y96 A;  2E6Z A;  4N0A C;  3KBG A;  3KXT A;  1VIE A;  2IVW A;  2JN0 A;  3FLG A;  2E65 A;  4M75 B;  1ZHI A;  4F7U E;  3FRN A;  1VQM A;  2RK2 A;  4M75 G;  3ZEH A;  3A5Z B;  4YTL A;  4XU1 A;  3MEV A;  5GAN d;  3MP1 A;  2MWP A;  4CI0 C;  3JCM b;  4M7A E;  4A53 A;  2P0Q A;  1FWZ A;  1G3T A;  3LGF A;  1V29 B;  3OW2 S;  1K8A C;  2QEX T;  3OYK A;  3I55 T;  5D6Y A;  4MDW A;  3LWH A;  5GAM j;  4E7J A;  5FU6 C;  1VQ8 A;  2V8I A;  3FC3 A;  2M0O A;  2RI2 A;  5GAM g;  3L2Q A;  2K3Y A;  3GNF B;  1WJQ A;  2RB6 A;  3M56 A;  1P92 A;  4PLL A;  4A4H A;  3MCA B;  2CZ7 B;  1UEB A;  3X28 B;  4JRI A;  1BIB A;  5HKC A;  2ZPG B;  2QA4 T;  2K57 A;  5J26 A;  5GAN 2;  4M7A C;  3OYA A;  2PUK B;  1K73 U;  3JCM J;  5AYF A;  3CC7 T;  2OTL A;  4IUP A;  2RHI A;  1VQL T;  3MO8 A;  1NPR A;  3SB2 A;  1UGR B;  4XU2 A;  3V7C A;  1WGS A;  3PT9 A;  1IZ6 A;  4M78 B;  2M1H A;  4P5N A;  4C92 D;  3JCM e;  1B34 A;  2LT4 A;  2M16 A;  4M78 G;  3HPW A;  5CVI A;  3OYE A;  4E7K A;  3S3M A;  4EDU A;  3NTH A;  4A4E A;  4M7D A;  1MGQ A;  4OB1 B;  2YLC A;  2K2V A;  4QQ6 A;  4DOV A;  3VUB A;  2RJD A;  1UGQ B;  3QZ9 B;  4J5Y A;  3NFC A;  2H3J A;  3OSV A;  1UGP B;  2NLU A;  1KG1 A;  3G71 A;  2I2L A;  3KUF A;  4TVR A;  4ZN3 A;  4XTV A;  5J3B A;  4C8Q A;  2DK3 A;  2P0K A;  2QTX A;  2EKO A;  3RMQ A;  2DAQ A;  3CCJ T;  1W2B S;  4M7D E;  2FB7 A;  2OTL T;  3LW5 E;  5CKD A;  3NTI A;  3JRZ A;  3J80 E;  3ZBD A;  3SFM A;  3CC4 T;  5GMK i;  3CCR A;  3E9G A;  4Z02 A;  1JB0 E;  2EQM A;  3BW1 A;  2HAX A;  1VQO T;  3HSB A;  2IG0 A;  3VYH B;  4C8Q E;  1KC8 C;  3CPW S;  5DLQ E;  1TH7 A;  4E7I A;  2MF2 A;  4M7A D;  3R6O A;  2OTJ T;  4ATO A;  3WXM B;  4C5H A;  2QQA A;  4B9W A;  3OYD A;  3N5B B;  2EAY A;  3JCM d;  2PVD B;  4XU0 A;  2BIV A;  5LJ5 j;  4OVA A;  4EMK B;  4M7D C;  2M9U A;  3JCM W;  3TRE A;  5LJ5 g;  5CAI A;  2HQX A;  1QP3 A;  1KQ1 A;  4JLI A;  1KHC A;  3G71 T;  5GAN 8;  2EQJ A;  4E7H A;  4BD3 A;  3MHX A;  3WVD B;  4ZN1 A;  4E7L A;  1PSE A;  1NJI C;  4N4H A;  4C8Q C;  2JZ2 A;  2X4J A;  3L2U A;  1Q86 C;  3I56 T;  2HD0 A;  3QO3 A;  4N4I A;  4BUG A;  3L1A A;  5GAN 4;  5GMK h;  1KD1 C;  4L59 A;  2ZPH B;  2VC8 A;  3VU3 C;  4V2S A;  1M1K U;  4HCC A;  1I81 A;  2R57 A;  2E64 A;  5FU7 B;  2XD0 A;  2A7Y A;  5DY9 A;  2CZ0 B;  5I2M A;  2E6N A;  3E19 A;  5GAN 7;  1DJ7 B;  1QP2 A;  2RHX A;  3INZ A;  3X20 B;  1JBM A;  4MZT A;  3X25 B;  5C6S A;  3OYN A;  3OYI A;  3CBP A;  4BY6 C;  1VQK T;  1D3B B;  2HBP A;  2RJF A;  5I21 A;  4GLK A;  4Q5W A;  5A0G A;  1YIT A;  4J7F A;  1H64 1;  1LOJ A;  2CYZ B;  2GF7 A;  3HFO A;  4M7D D;  2DZ9 A;  3GNG A;  3HRS A;  4C92 F;  2RH2 A;  2Y90 A;  2DTH A;  5CQY A;  3H8Z A;  2E10 A;  5GAO q;  4MDX A;  2XHC A;  3CPW A;  3DB3 A;  2OAU A;  3V8L A;  1M90 U;  4C92 A;  4C8Q D;  5C0M A;  3OSS C;  1IRE B;  3ER0 A;  3OS5 A;  2DXC A;  5GAN e;  5LJ3 h;  2ZCF B;  2DXB A;  3QHS A;  2XK0 A;  3HL8 A;  4C92 E;  1NE8 A;  1X01 A;  4XTZ A;  3X26 B;  4EMH A;  1U1T A;  2R5M A;  3CCM T;  2XIC A;  1NPP A;  3V7R A;  4OF1 A;  3SDZ A;  4F7U F;  2QEX A;  3GIB A;  3OS1 A;  4Y91 A;  2K3X A;  2RHY A;  2QXF A;  3BDL A;  3QII A;  4LDU A;  2JVV A;  3JAM E;  2D9T A;  4M7A F;  4C5I A;  4FSX A;  2K5I A;  3OBY A;  4F7U A;  1M1F A;  3CBM A;  3GLX A;  1JRI A;  4J6X A;  1YHQ T;  1OYX A;  2QA4 A;  1QVG S;  2KY9 A;  3GF5 A;  2DD4 A;  5L8R E;  2JOY A;  2QQ9 A;  3RMS A;  4Y28 E;  3FEO A;  5IT9 E;  3QDR B;  3CC7 A;  1I8F A;  1QVF S;  2XDP A;  3MEU A;  3GP8 A;  4DA4 A;  1K73 C;  1VQL A;  1S72 T;  3MP8 A;  3OYL A;  1RL2 A;  1K9M U;  2VGM A;  1Y71 A;  2P4T A;  2JTF A;  4RG2 A;  5GMK e;  2K4Y A;  1GXI E;  3EFR A;  3V8J A;  4ELZ C;  3G7Z A;  3CXC A;  4R56 A;  4FM4 B;  2DZC A;  4KT0 E;  5GAM h;  4LDV A;  3E9F A;  5DLO A;  3CPF A;  4M77 D;  4J8O A;  2EQK A;  5FU6 B;  5DM7 R;  3ASK A;  2CS7 A;  3X24 B;  3JCM f;  4QVD A;  1KQ2 A;  2LCL A;  2LDM A;  4BI4 A;  2Y4Y A;  2RM4 A;  1G3Y A;  4F7U B;  4J6Y A;  4RCB A;  4A4K A;  3OS0 A;  3CCJ A;  2MAM A;  5A2Q E;  4VUB A;  2KQW A;  4F7U G;  1OI1 A;  2PQW A;  5GAN 5;  4M7A B;  3OYF A;  2F5T X;  3C94 A;  4BI8 B;  3CC4 A;  4XTW A;  1M4Z A;  1Y96 B;  1KQS A;  1LJO A;  4M7A G;  1QVP A;  4M7D F;  1VQO A;  4OP0 A;  1I5L A;  3M9Q A;  2E1H A;  2A3L A;  3DLM A;  2L8D A;  3FDR A;  4N4G A;  4BE1 A;  2OTJ A;  4XQ3 A;  1BI0 A;  4II1 A;  5GAO m;  3CD6 T;  2P0P A;  3CCS T;  5GMK m;  3CCU T;  2L89 A;  2LCC A;  3CEY A;  3QZ5 B;  4L5G A;  4X34 A;  4C8Q F;  4C5G A;  2VXF A;  4BI3 A;  5CK9 A;  5I2S A;  3VYG A;  2PVO B;  3G6E T;  3C95 A;  3VJP A;  4FL6 A;  2QI2 A;  4MZM A;  3VV0 A;  4HA8 A;  1G5V A;  4O6J A;  1QVF A;  1WJS A;  2DEQ A;  3QXE B;  3I56 A;  3LGL A;  2O4X A;  1UGS B;  1VQP T;  2DKG A;  3BFM A;  2PVG B;  3TU4 K;  3RKX A;  3OW2 A;  4M75 D;  4JDS A;  5FRO A;  3CMA T;  3M58 A;  3V7S A;  1AHJ B;  1B34 B;  2PU9 B;  3F70 A;  5FLX E;  2PUO B;  1M1K C;  4BAC A;  5EG2 A;  1N9R A;  4HCZ A;  2JNG A;  3OYJ A;  5LJ5 h;  3DKM A;  4BDZ A;  5CKF A;  3HFN A;  4QQG A;  4M7D B;  1H3Z A;  2WSF E;  1VQK A;  4OGE A;  4XTU A;  5GAN g;  4M7D G;  5M9O A;  3CCE T;  1VQ9 T;  3LYI A;  5D6W A;  3V8K A;  4PJO A;  4QVZ A;  5LJ3 d;  1BI1 A;  4C8Q B;  2LRQ A;  3BDU A;  3M4G A;  3DLL A;  3QYH B;  4C0G A;  3OYC A;  3OA6 A;  3JCM V;  4JRQ A;  4C8Q G;  4EMG A;  4QVC A;  3Q1J A;  1G3S A;  1YCY A;  2MMP A;  4WF2 A;  5GAM e;  3CCL T;  3HRU A;  1JJ2 S;  4DQ2 A;  2BUD A;  4EMK C;  2XDB A;  2XID A;  4PJO E;  1M90 C;  1BIA A;  2DO3 A;  3CBO A;  4M77 F;  2LX9 A;  5A0L A;  2GFA A;  1N8R U;  3JSC A;  5GAO n;  2JTM A;  3S3O A;  2EWN A;  2GQV A;  2O01 E;  4M77 A;  1W2B A;  3CCM A;  4BDY A;  1YI2 T;  3QBY A;  1Q7Y U;  2AHJ B;  2WAC A;  4NOY A;  3AHU A;  4L6V 5;  4PJO C;  1YIJ T;  3ZFJ A;  5HY6 A;  4ZGE B;  1VQ5 T;  3PFS A;  3CCQ T;  5GAN f;  4M77 E;  3M59 A;  1WNL A;  2GFU A;  2KSS A;  2E70 A;  3HKS A;  3VKI A;  2JUF A;  5FU7 C;  3CC2 T;  4FT2 A;  2QDY B;  3RIR A;  1YHQ A;  3QYG B;  2KK4 A;  5GAM d;  3A8G B;  2LQK A;  1YJ9 T;  4X9C A;  2DTO A;  3S3N A;  1SSF A;  4A4G A;  2DIQ A;  2X35 A;  2KAF A;  2VYT A;  1S72 A;  1R8O B;  2L3R A;  4M77 C;  2EJ9 A;  2RI3 A;  5FRN A;  3PTA A;  3SWN C;  4OMF B;  1K9M C;  3QG1 A;  2LT1 A;  3LX7 A;  5KCH A;  4KUI A;  3LH0 A;  4M75 F;  3JCM g;  2K5L A;  1XQH A;  4XU3 A;  3GOX A;  2DVE A;  3HP9 A;  1JJ2 A;  3L42 A;  3OY9 A;  4C0Z A;  5LJ5 e;  1Q81 U;  1X6O A;  1I4K 1;  2RJC A;  1FXX A;  4M75 A;  4OB3 B;  2EJG A;  3M57 A;  3RKY A;  3M54 A;  4PJO D;  2V8K A;  2RO0 A;  4C0D C;  4C92 B;  1MHN A;  2R58 A;  2VXE A;  1VQ6 A;  4D6W A;  4LDW A;  3T9N A;  3LLR A;  4BB7 A;  4C92 G;  3CCV T;  3JB9 J;  2X4W A;  3JB9 D;  3RKW A;  4M75 E;  2ZPF B;  3JCM c;  4CRI A;  3RES A;  3OMC A;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...