4M7DE

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 13
structure length 77
sequence length 82
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dE00
1WNLA 4MMKA 5DY9A 4EMKA 4C92C 5GAN5 4A54A 5GAMe 4XTWA 3RKWA 2VXFA 5GMKi 4M7DE 2E64A 4PJOF 4MMLA 4M75E 4XTZA 4HA8A 4N0AC 5GMKl 4QVCA 1WQWA 2YLBA 4J6WA 5LJ5g 1KQ1A 5GAOl 2DTIA 1H641 4M75F 4C8QD 2DTHA 4XTVA 3HFOA 4M77C 5GMKm 2FB7A 5GAMf 3QHSA 4PJOG 3JCMe 4M77D 4C92G 5GAOm 1HK9A 3FJPA 4M78C 4C8QF 2DZ9A 4HT9A 3JB9H 5GANg 4XU2A 5GANd 1YCYA 2YLCA 4XQ3A 4EMKB 3JCMc 3L2ZA 3JCMW 4M78D 1BIAA 2DJZA 4M77E 2CGHA 3JCMX 5GAN4 5GANj 4M7AE 2QTXA 5LJ5e 3HSBA 4M78E 3FB9A 4X9DA 4M7AF 3EFRA 4DQ2A 4NL3A 3QUIA 1D3BA 4EMHA 4XTUA 3JCMh 3V8LA 4J6XA 1LJOA 4NOYA 1D3BB 5LJ3f 4F7UB 5GAOn 4F7UF 4M77B 3BDUA 3EFSA 4OP0A 3JCMV 4M7DD 1U1TA 3JCMg 2EJFA 2DXUA 5GAN8 5I21A 4JRKA 4RCBA 1BIBA 4M78B 3JB9F 4M75A 1KQ2A 3V8KA 4F7UG 4EMKC 1JBMA 4M7DA 4C92F 1HXDA 1Y96A 4RCCA 3RIRA 4M78G 3V7CA 5LJ3j 4PJOB 3JB9D 3JB9G 5GMKe 2ZGWA 4EMGA 1TH7A 4C8QA 5GAOq 2FYKA 5GANh 4C92E 4M77G 4C92D 5GAOp 2E41A 1MGQA 1X01A 4C8QE 3JCMQ 4M7DC 4XU0A 2YHTA 4M75B 4JUVA 3L1AA 4M75C 5LJ3d 3JCMb 4M7DB 4V2SA 3M4GA 1LNXA 2EJ9A 2JN0A 2DZCA 4M75D 3BFMA 1WPYA 5GANf 5GAN7 4M7AA 4C8QG 5GAN6 4C8QC 5CAIA 3JCMd 2E65A 2RD1A 3V7RA 5LJ5h 2EJGA 1I5LA 4NL2A 4F7UA 5GAMd 2E1HA 2RA2A 2DEQA 5GANe 2I2LA 4QVDA 4PJOC 4M75G 3HFNA 4WF2A 3SWNA 1N9SA 2E10A 4M7AB 1WQ7A 1B34A 5LJ5f 5LJ5d 2Y90A 3RESA 4XTYA 2VXEA 5GMKh 5GAMh 3BW1A 4XU3A 1M8VA 3RKYA 1N9RA 3JB9I 2DXTA 5LJ5j 2K57A 4PJOE 4M77F 1B34B 4M78A 3QO3A 3JCMJ 3RKXA 5GAN3 5GAN2 3SB2A 4XTXA 4M78F 1I81A 3JCMf 5GAOr 4PJOA 3RERA 4M77A 3SWNC 3JCMP 3FIFA 4A53A 5GAMj 3BY7A 5LJ3h 3JB9J 4C92B 2DTOA 2HNIA 4XU1A 4M7AD 2DKGA 4HT8A 2VC8A 1M5Q1 5LJ3e 4F7UE 3V7SA 4M7DG 4N0AA 3PGGA 4J5YA 4X9CA 4J6YA 1I8FA 3V8JA 4M7AG 4M7AC 2EWNA 5LJ3g 1I4K1 4Y91A 4JRIA 2RM4A 1LOJA 2EAYA 4JLIA 4M7DF 4C92A 4PNOA 5GMKj 2RB6A 3AHUA 3VU3C 4C8QB 3GIBA 1JRIA 3INZA 2DVEA 3RUXA 3QSUA 1U1SA 1Y96B 5GAMg 4PJOD 3SWNB
chains in the Genus database with same CATH superfamily
1B3QA 2CH4W 3M0TA 1EIFA 3GOXA 3CCVA 1G3TA 1R0BG 2CUDA 2F2VA 4CC4B 4QVCA 1JXMA 1IREB 3FRNA 2L89A 2Y4YA 1Z9ZA 1QCFA 4MDXA 2M51A 3JCMe 4PJLA 1D0XA 3FJPA 1I07A 5GANg 1W1FA 4XU2A 3X28B 4A63B 4RMOA 4FM4B 4HVWA 2GFAA 3HSBA 1W70A 3EFRA 1PKSA 2HKNA 2P0KA 1YIJA 3C94A 3QDFA 4M7DD 1N8RC 4QQ6A 2HL3A 3E2UA 4DA4A 4J83A 2QXFA 4O5VA 2RH2A 3OYGA 3CCJT 1RAEB 2ZCFB 2J6FA 2HSEB 1M4ZA 2IIMA 4ZTJA 1ZBJA 3L1AA 2LQ8A 2R5AA 2RO0A 2LJ0A 3NFCA 3URGA 4RUGA 1FWZA 1FMVA 2Z0WA 3X26B 4OVAA 2L3QA 3CCRT 4FYYB 3HFNA 1Q81R 2DPPB 3CBOA 1WQ7A 4XTYA 3JSCA 4ZN1A 3VS5A 2MI6A 1PD1A 4M78A 2ZZDA 3KUFA 4BE1A 3NHNA 5CKBA 1WHJA 5GAN2 3P8HA 3T9NA 3CCQQ 1PWTA 3EGXA 4RTTA 3QZ9B 2RJCA 2K2VA 1XQHA 2ZPEB 1UE9A 3CPWP 3BDLA 5IAYA 1VIFA 4JJCA 1AZGB 2CZ0B 2EAYA 3LWHA 4LE9A 1X6OA 3INZA 3RUXA 1U1SA 1Y96B 1HJDA 3OYMA 1Q7YC 2CP3A 3IQLA 3CCEA 2VXFA 1BCOA 2RHUA 2FPFA 1NZ9A 3RDVA 4PFOA 3G6EQ 1KQ1A 4M75F 3ZEHA 1Q7YU 4C8QF 4DBQA 3LGLA 3L2ZA 2D6FA 2DL7A 4E7IA 2V8JA 3P8DA 2LT1A 4JLGA 1OU9A 3UT1A 2GNCA 1QMCA 3M0UA 1SG5A 3S3MA 2CT4A 3FEOA 3CMEQ 1V76A 3U23A 4FW2A 1SHGA 3OYHA 3MO8A 3QYHB 1X01A 1VQ4T 4C8QE 2E6ZA 4AT1B 2KRSA 3R6NA 4V2SA 1VOMA 3UATA 3EAEA 2DZCA 3HL8A 1OX8A 3OYBA 1OQKA 4UC4A 4C8QG 4DBFA 2RD1A 5A0DA 4C0DB 4A4FA 2X3XD 3L2RA 2EQJA 1SKUB 2H3EB 3REBB 1OYXA 4M7AB 2QAZA 2KT1A 4XK8E 3A5ZB 4C5HA 4OB2B 4O6JA 2BZ8A 3RERA 5GJVB 3CPFA 3KXTA 2VC8A 3CMAA 3G71T 4J6YA 2MMPA 1LVKA 3UWNA 4E2FB 1JJ2A 1H3HA 2CT3A 1MNEA 5GMKj 1SHFA 4CI0C 2HBPA 5AYFA 1UEBA 4OMLA 4PJOD 4FL6A 3L2UA 5KE3A 1MMGA 3R6OA 3CCQT 1LPLA 2NUTB 3BE3A 1WYXA 3OBWA 3O5ZA 5C0MA 3CD6T 2D1XA 1YP5A 2DRMA 2KEAA 4PJMA 1CSKA 2YLCA 3OMCA 4OMOA 4XQ3A 4F17A 2DJZA 1ZA2B 2XU8A 2YUOA 3RMSA 5KYWA 5LJ5e 3CC7T 2PU9B 3M56A 2DXCA 1UUEA 3I55A 3OSSC 2EBPA 2DLPA 3GBQA 5CKDA 4OP0A 2NLUA 3LYIA 3QWXX 2DXUA 3M4YA 5I22A 5C6SA 1QVPA 2LP5A 1Y96A 4PJOB 5CK9A 4C8QA 2PVDB 3VS3A 5GAOp 3JRZA 4R56A 1WLPB 4XU0A 2YHTA 1UHCA 2RHXA 1GL5A 1D0ZA 4BI3A 1G2BA 2JS0A 2X4YA 3TVTA 1I5LA 1BCMA 2DJQA 1I0CA 3CBMA 1RAGB 1UGSB 2HKQB 1K9MC 2LT4A 3UA6A 1LCKA 2Y90A 2VXEA 3I56A 2P0QA 2DXTA 1MMNA 2NUZA 3D7SB 3RKXA 3G4SA 2QQRA 5IHKA 4C92B 2DIGA 3OSVA 1VQ6T 3A1PA 2GBQA 1NBEB 5IT9E 1I4K1 2NUPA 1BB9A 1M1GA 3MP6A 4IIOA 1W2BA 4PNOA 1X43A 4XAXB 1IO6A 5FU6C 2NUTA 2BUDA 3OS0A 2KQWA 5FRNA 2NWMA 5FU7B 2ZAEA 2MWOA 1VQLQ 3HFOA 1YNZA 2ZPGB 2YUPA 4FCYA 4M77D 2KYBA 1RAHB 4ZNXA 3VV0A 4EMKB 2DNUA 2QTVA 2COWA 3OBYA 3OW2S 3EGDA 3PVLA 1BBZA 2XDDA 2OTJQ 2DL3A 3H9NA 3CC4Q 1D3BA 3A8MB 1JXOA 3FDRA 4HVVA 1ARKA 1LJOA 3UF4A 5LJ3f 1AWJA 2FPEA 3O8VA 1U5SA 2O31A 4CRIA 1JJ2S 1KD1C 4IKFA 3WVDB 2EIFA 1TUDA 2ZGWA 2FYKA 2DILA 1RABB 4ELYC 3LX7A 3ME9A 5LJ3d 1Q82C 4J7FA 1BI3A 1FXXA 1J3TA 4C8QC 3SEMA 3JCMd 2ROLA 3A98A 5I2MA 1FMWA 4J9EA 1NPRA 4M75G 4C0FA 1QLYA 5GAMh 2AKLA 3L2VA 4LDUA 3TQ7P 2LDMA 1MV3A 4M78F 1SEMA 1OI1A 4EPCA 1Q82R 3PNWC 2DKGA 1QP3A 1K9MU 2AK5A 3TSWA 4OGCA 2BE7D 2YRVA 4Y91A 2FPDA 4JS4A 1VQ7Q 2M0YA 3I9QA 1VQOQ 2E12A 3X25B 1C1AA 1Y71A 2LCLA 3G1JA 2E6NA 3HPWA 1WNLA 4ZGEB 1QVGS 3MKDA 4EMKA 1BYMA 2E64A 1QVFS 2DETA 1Q86C 3UDCA 1TUCA 2DTIA 2JM8A 1AOJA 4BUGA 1VQ8Q 3H0IA 2JJ9A 2RI3A 3QHSA 1MMDA 2P84A 1SRLA 2YSQA 5I11A 2ZPBB 4GBQA 5GAN4 2ZPHB 4JPBW 2QTXA 1M30A 2GQVA 2VVKA 1WJSA 3C4SA 4MDWA 2GGRA 4NL3A 1UJYA 1Y07A 1I5OB 3QXEB 1ZUYA 1KQSA 4NOYA 2QEXQ 2NUPB 3OS5A 3CCUA 1K73C 2F2WA 2OTJT 4F7UG 1JBMA 4PK4A 3PFSA 3V7CA 1G83A 2PVGB 4Z89A 1NYGA 4ELZC 2VV5A 4RTZA 2JVVA 3JCMQ 4JUVA 4X1VA 3QIIA 1IGUA 3PT9A 4QKUA 1YJWT 4CC3A 3KFVA 2RMOA 2QYZA 5HKCA 2EJGA 2Y4XA 2RQVA 1K0SA 2QQBA 4VUBA 4E7LA 5GANe 5DLOA 5CKHA 3H0HA 1KC8R 1V1CA 2LQWA 3EGDB 5CCAA 2RPNA 4ZGJB 3QKJA 1QVFP 4PFPA 3CCJQ 4M4ZA 4QVZA 4BI4A 1YHQT 1QVGP 2GF7A 3JB9J 2EQMA 1KHIA 2DM1A 3G4ST 1OX9A 2QA4T 4IURA 2K5FA 1OU8A 2D8JA 2KI7A 2EYYA 4M7DF 2M0OA 5IXFA 1KK7A 3AHUA 2E4HA 3GIBA 1RL2A 2CP6A 2K9GA 2LJ3A 4L6V5 1EFNA 5DY9A 1YI2Q 3RKWA 1VA7A 5GMKi 2C06A 2ZPIB 3OS1A 1YBYA 2NYSA 2AKKA 4XTVA 2HEQA 1YWOA 3E9FA 4M77C 5HK0A 1VQ6Q 4ME7A 1FYNA 1HK9A 3QJYA 1QKWA 4C0DC 1GRIA 3HRTA 2JXBA 4M78D 2EYQA 1YHQA 1XJWB 5FLXE 1IB8A 3FB9A 4M78E 2ZPFB 2DRKA 3QUIA 2J6KA 4E7SA 3V8LA 2VGNA 4FT4A 2MOXA 5GAN8 4JRKA 1B7TA 1WJQA 2AZVA 5L23A 2LRQA 1M1KR 1Q86R 2FG0A 1K73U 2LVMA 4C92E 1YJ9Q 3X24B 2E5QA 4M7DC 3VS4A 1GCQA 5D6XA 3H6ZA 1SSFA 4M7AA 1NLPC 3HP9A 5GANf 3LH0A 1KQSS 2RQTA 1S72Q 5HY6A 3LGFA 1WXTA 1M1FA 5FU6B 1CKAA 1VQ4A 2E10A 4A4HA 5LJ5f 1VYTA 1BI1A 1NLOC 3RKYA 5KCOA 1JU5C 1N6AA 1YCSB 4Z88A 4OMPA 2DX1A 2ESWA 3VRYA 1ABOA 4RTYA 2OAUA 2RJFA 1A0NB 4J9IA 4PJJA 5D6YA 2DBMA 4E6RA 4P5NA 3EGXB 1UHFA 1PRLC 1SSHA 3QBYA 4Z02A 5KYUB 4N0AA 1P92A 3PGGA 5KCHA 2EWNA 3PMIA 4JRIA 1X27A 2FRWA 4C92A 1M2VB 1ZSZA 1YITA 2HCKA 1M3CA 4CC7A 2QA4A 1KG1A 2RI2A 1VQ9A 4D8KA 2RQUA 3LW5E 5FWCA 2AZSA 2QG9B 2XICA 1ZX6A 3I5SA 1H641 1RLPC 2LJ1A 4HVUA 1JQQA 4E47A 2BZYA 2KR3A 4M78C 2DO3A 4OGEA 2C0IA 4J7IA 3EG9A 2DXBA 3CMEA 2R58A 1BU1A 4GLKA 2V8IA 1QW1A 1T3SA 4EMHA 1KC8C 4BE2A 2CREA 1MHNA 2AHJB 1BIBA 1U06A 4OMFB 3S6WA 2OTJA 2CH4A 2F69A 4M75B 3DB4A 5CQYA 3JCMb 4M7DB 3PIPA 3GF5A 4M75D 2KK4A 2XDBA 3PVQA 1H3ZA 3L2QA 4PL6A 2P0PA 1FMKA 3I35A 3OS2A 2DL5A 4WF2A 3MEWA 1PKTA 2KRMA 3GPLA 3M0QA 4XU3A 1N9RA 2XD0A 1VQ7A 1VQOA 1NEGA 4XTXA 3REAB 3J7AF 3EH2A 2COZA 4LDYA 1YI2A 2XKOC 2VGMA 2K3YA 2XMFA 3CC2Q 4OB3B 1MMAA 1ZSGA 1Q81U 1VQ6A 4OMQA 2DVEA 4LUEA 2HBWA 3SWNB 3PMTA 1KQSP 4A4KA 3CCSQ 5HCKA 5GAN5 2JOYA 4M7DE 2RJEA 1AZEA 3VRZA 2YLBA 3QPHA 3CC2A 3CBPA 1VQ5Q 2E70A 4C8QD 3CXCS 5CIUA 1MNDA 3S3NA 3RMQA 2RHYA 1ZBXA 4RTXA 5GAMf 4NS5A 2O01E 3TCJA 2XIDA 2BE9B 2VYTA 3JV3A 2HDAA 2L3SA 4Q5WA 5GANj 2KE9A 4M77E 1OZ3A 1WXUA 3TREA 1NYFA 3M9QA 2O9VA 1HYOA 4DQ2A 4XTUA 3M58A 3C95A 4J6XA 5FW9A 8AT1B 4OMMA 1AVZC 3ZBDA 4PLLA 1QCNA 1WHLA 2ED0A 4KUIA 1VYUA 2LX9A 2YWWA 2JMAA 3RR6A 2FRYA 2XI9A 1RADB 5CVIA 4M78G 2QEXT 1GXIE 1UGPB 1ZLMA 1IGQA 5GMKe 3QWYA 2LNHB 2O4XA 1M2VA 1ZSZB 2QI2A 2H8HA 1JO8A 4J8OA 2QDYB 1WFWA 2RF0A 4B6MA 2EJ9A 2JN0A 3FJ5A 1UB4A 4KGXB 1ABQA 1ZQ1A 2RQRA 2VB6A 2QASA 1K9MR 1KD1U 3OYJA 3MCAB 3QG1A 2COYA 4J9FA 2EW3A 3TSZA 2GTJA 4JJBA 1GFCA 1XNIA 2F5TX 2JUFA 2PZ1A 2RK2A 2O88A 1WHKA 4J5YA 1G3YA 4LDXA 2RM4A 4JZ4A 1WXBA 2YDLA 3VU3C 2PQWA 5FRMA 2L2PA 1JRIA 2KT8A 1PNJA 3OQ5A 1Q82U 3CPWA 3UA7A 2M1HA 1WI7A 4J9CA 4J9GA 3OYDA 5LJ5g 3M0PA 4FW1A 1K73R 4LD6A 3MP8A 4JJNK 1VQKT 3ZL7C 4FSXA 3EG2A 3JB9H 2EGEA 1IHVA 2JM9A 2B8AA 2RNAA 4J9HA 1KFZA 1GBQA 1OULA 1K76A 3EH1A 4F7UB 3S3OA 1VQNT 4A4EA 4HXJA 3JCMg 1D1AA 4LN2A 3G6ET 1ACMB 1OEBA 3OB9A 1KQ2A 1M3BA 4LDWA 3CXCP 1YITT 2PNIA 1V29B 3E19A 4KGZB 2JW4A 1KC8U 1TUGB 3HKSA 1WHHA 3M5AA 4M75C 4WCIA 2ATCB 4KULA 1WX6A 3BFMA 1E6GA 1M1KC 1M2OA 2V1QA 3HRUA 3CCMT 5HK3A 4F16A 2G3RA 5A0LA 4DOWA 2RI5A 1QWEA 1S72T 4ANJA 3BW1A 4EDUA 4PLIA 4OB1B 1Y0MA 5DLQE 3JB9I 4ZGDB 1JEGA 3H0FA 4AG2C 4DBHA 2QDLA 1B34B 1Q95G 2SRCA 3JCMJ 4JZ3A 1AEYA 2MWPA 1IZ6A 3FLGA 1VQOT 2QGFB 1M5Q1 5LJ3e 1UFFA 4F7UE 2A08A 1I8FA 4M7AC 3M53A 4ORZA 1AWXA 3X20B 3G6EA 4JLIA 3CMET 5KYXA 2O4XB 1YJNQ 2LTOA 2AIRB 4MZPA 1OZ2A 3VYHB 4AFUC 3TEEA 3I55T 1BI2A 2ED1A 2X4XA 1KHCA 3RBBB 4XTWA 2ABLA 1AD5A 1D1BA 2HD0A 3PTAA 2FZGB 2M16A 4XTZA 2FHDA 1W6XA 2KROA 2DTHA 3CMAT 4PJOG 2DZ9A 4FT2A 4Y28E 2QK0A 3LLRA 2HAXA 1BIAA 3EG0A 2VUBA 2FO0A 3JCMh 2WSCE 3OW2P 1VQ8A 3M59A 1BK2A 2KMTA 1GCPA 1TS9A 1X6GA 2QQAA 2O2OA 1UGRB 1Z9QA 3ER0A 4B9WA 3LH5A 4C92F 1HXDA 4RCCA 5LJ3j 2DMOA 4ATOA 3OYAA 1PSFA 5IHIA 8ATCB 2JNGA 4M77G 1ZSZC 1UDLA 4F14A 2IPOB 2EKHA 4E7HA 4C0GA 2E65A 4NL2A 4F7UA 3NTIA 1W2BP 3WVEB 4OB0B 2K3XA 3WXMB 3HTRA 1OPKA 4X34A 5GMKh 2HQHA 2B86A 2K5IA 2ROTA 5LJ5j 2A37A 4PJOE 4MZTA 2V26A 4N4GA 2CZ7B 1VIEA 3VS0A 3JCMf 4RG8A 4M7AE 1RI0A 1VQ8T 2KYMA 2LNVA 2DYIA 4M7AD 5KYYB 4M7DG 1X2KA 4LDVA 2K2MA 3EG3A 3L42A 2DEUA 2CSIA 3A8LB 4C92C 4PJOF 1O75A 4J9BA 4N4IA 2P4RA 4JS5A 9ATCB 4HA8A 4N0AC 3H8ZA 1U3OA 1VQPA 3I55Q 3H41A 1E7OA 1YIJQ 5CKFA 2M9UA 5GAOm 2OAWA 2EYXA 4L5GA 7AT1B 3CCSA 3JCMX 1YJNT 2FZCB 1OPLA 3DLMA 2L3PA 1IHWA 4C5GA 2E3IA 5A0GA 4F7UF 2RK1A 1NE8A 3SDZA 5KYUA 1G5VA 3A8HB 3JB9F 4KH0B 4AMCA 3EGUA 5CR2A 4EMKC 3SFMA 1YHQQ 2EYWA 1Y7XA 5KYXB 2E41A 3OYIA 2A0FB 2OTLA 2J05A 5EC7A 3G71Q 1MUZA 5CAIA 2MAMA 4FIBA 4D8DA 1KD1R 2E1HA 2QGGA 1JB0E 2F1LA 4PJOC 1N8RR 4A4GA 1YIJT 1M3AA 4HCBA 1B34A 2GCXA 3QZ5B 1VQKQ 1YJ9A 1D1CA 3P8BB 4C0ZA 2XK0A 3MEVA 1M90C 1TWBA 1YJNA 1O9SA 2LQKA 5GAN3 1VQMQ 5LL6S 4Y92A 2HNIA 5J26A 3CCEQ 3DLLA 2L8DA 1ZUKA 4DEYA 1FX7A 2PTKA 1Q7YR 2K4YA 2YRDA 2D9TA 2EQKA 5GJWB 1RAIB 3CQTA 1TXQA 2EPDA 1WHGA 4OF1A 2JTEA 2CYZB 4AFQC 2YRCA 4BD3A 1X6BA 1VQMA 4IUTA 1IXDA 1NM7A 1ZHIA 2YXYA 2GTOA 2X9HA 4OMNA 1DJ7B 2A7YA 1QVFA 4LNPA 5CQXA 2KXCA 2K3BA 2DIQA 4ESRA 5GAOl 2CUBA 2JTFA 1H92A 2LX7A 2QQ9A 4C5EA 2XHCA 2CDTA 1VQ9Q 2HZYA 4HT9A 5CO7A 4LUDA 1VQPT 3OYNA 2VASA 4BE0A 2LZ6B 3E9GA 3JCMc 2XDPA 2M02A 2EGAA 3CD6Q 1VYVA 4GLMA 1M8MA 1ZA1B 3ZFJA 4X9DA 4M7AF 3TU4K 5KYYA 2D8HA 2W10A 1VQLA 3CCET 2FVUA 3PE0A 2J6OA 3J80E 3M55A 2FZKB 4M75A 1YFNA 2MPXC 4M7DA 1VQ5T 3VS6A 1UJ0A 2CS7A 3DKMA 3CD6A 1YJWQ 3CEYA 4KRTA 5GANh 2CP2A 2DBKA 3CC4A 1NPPA 3DB3A 1VQMT 2AT1B 1PRMC 3NMZC 4WTOB 1K8AC 1N27A 5LJ5h 4HCKA 1NG2A 2L0AA 3CCLA 5FROA 1XTDA 3CMAQ 1RAAB 3VJPA 5J3BA 3QJ6A 2LCSA 2EVRA 1OV3A 2EQUA 1F1BB 2FEIA 3CPWS 2K57A 2KBTA 4YTLA 3MHXA 3QO3A 2HMAA 1U8RA 3FIFA 4A53A 4F04B 1QQJA 1VQLT 1VQ4Q 3OMGA 4C5IA 4PFZA 4BB7A 1NJIU 4X9CA 5IH2A 5IHNA 3MEAA 1VQPQ 2LMJA 4FSSA 1RI9A 1M90U 1VQ5A 1RAFB 2E3HA 4FYXB 5ECAA 1TTHB 1IRXA 2F5KA 5D7UA 4BDYA 2VKNA 4MMKA 3A8GB 2OJ2A 1HSQA 1X2QA 2JMCA 4QT7A 2I0NA 2RJDA 5AT1B 2WACA 5DM7R 4LXCA 4FU6A 1AT1B 1YITQ 3CCLT 2FB7A 1KJWA 2PUOB 1W2BS 1JJ2P 2KVQG 1YCYA 2EGCA 1VQ9T 3LWIA 1NJIC 1T3LA 1K4US 1D3BB 3VS1A 2V8KA 4BY6C 2VWFA 4KH1B 4M77B 3BDUA 5GAOn 1WZOA 4HKEA 2L3RA 4BACA 2X35A 4QW2A 4E7JA 1WJRA 5D6WA 3V8KA 1UGQB 4KBMB 4EMGA 1MGQA 4ZTFA 2KSSA 3I56Q 4RTVA 2K79A 4II1A 5CKEA 2DF6A 4IUQA 1WA7A 3NPFA 3EHRA 2DL8A 3CC4T 3CC7A 3VYGA 4LD9K 2OTLT 2RA2A 1BKBA 2DEQA 1M90R 1N9SA 1G8XA 2GFUA 2LCCA 1M8VA 4MZMA 1VUBA 4HCCA 3CCMA 1HD3A 2A3LA 4QQGA 5GAOr 3HRSA 1I81A 3NTHA 3CC7Q 5LJ3h 2CP0A 5KH6A 1C0MA 5A2QE 3NGPA 2CSQA 4IUVA 5I2SA 1X69A 5LJ3g 4N4HA 4JDSA 2RHIA 4AFZC 4E7ZA 3QYGB 3CCMQ 3OY9A 3VUZA 2JZ2A 1UTIA 2D0QB 3QSUA 4Z8AA 1UG1A 1B07A 4DBRA 1SPKA 5GAMe 3I56T 1VQ7T 5EG2A 4M75E 1WQWA 2OI3A 2YT6A 2BIVA 2QQSA 3CCRA 2A28A 3THKA 2KGTA 1TOVA 3EHQA 4DOVA 2RHZA 4DEXA 2EKOA 3EG9B 1ZUUA 2KY9A 4HCZA 3CCUT 3CCVQ 5M9OA 4BI8B 3MEUA 1M9SA 1AWOA 5FWBA 5IN1A 3G7ZA 1PM3A 3EFSA 4KGVB 3E1SA 2LQNA 3VS7A 3OYFA 2DA9A 2JT4A 2D0NA 1QP2A 4M78B 4RCBA 2J7IA 2RN8A 2A36A 3CCLQ 3EG1A 4PJNA 4JRQA 2BKDN 1K0XA 2CZ6B 3UPUA 4C92D 1PD0A 3JAME 1H8KA 1LNXA 2R57A 5GAN7 2MCNA 2CP5A 3KBGA 4HT8A 1PHTA 3V7RA 3PIOA 2YUNA 2I2LA 3GP8A 4QVDA 1R8OB 2DVJA 1NEBA 1KSWA 2OX7A 1PC0A 1S1NA 2EQIA 2OTLQ 2PVOB 2X3WD 4M77F 2JTMA 2XG8D 2K5LA 3M57A 3G71A 4RTWA 3SB2A 2ENMA 4PJOA 3CC2T 3JCMP 3BY7A 1PCXA 2DTOA 2DL4A 1VQNQ 5J39A 1R0CB 2EFIA 3V7SA 3VUBA 2DE0X 1VQKA 4KT0E 3OYYA 1SF9A 2PUKB 1YN8A 2H3JA 2KRNA 2GQIA 2P4TA 4C8QB 1AWWA 2J06A 2C0OA 5KYWB 5GAMg 3VS2A 1K9AA 2KAFA 3CCQA 2DK3A 1R77A 2KDSA 1K8AU 1VQNA 1D0YA 3VKIA 2HSPA 3OYLA 1AHJB 4MMLA 1E6HA 2KXDA 5GMKl 2V1RA 4RKUE 4IIMA 4IUPA 1RUWA 2QEXA 2QA4Q 1M1KU 1UGVA 4GY5A 1YJ9T 3L2WA 5GANd 3JB9G 1OOTA 3GNGA 2CGHA 3OA6A 3AT1B 3I5RA 2DERA 1YJWA 3M54A 5IXBA 3CCST 3OYCA 2CKKA 1QKXA 3M0SA 3NTKA 2EJFA 2C0TA 3META 1W4SA 2IVWA 3OW2A 1Y57A 3RIRA 2O9SA 1T0HA 2G6FX 2K7AA 2YUQA 3JB9D 1TH7A 1EX4A 2L5QA 1K1ZA 4IUUA 2BZXA 2MYSA 3M4GA 1QWFA 3EFOB 2SEMA 3MP1A 4QQDA 1XOVA 2EYZA 1TSFA 2DD5A 2IG0A 2X4WA 2CP7A 1WGSA 1NJIR 1K8AR 2MF2A 1PSEA 4M77A 3SWNC 5GAMj 1D09B 2X51A 4KUDK 4M7AG 3C12A 4FYVB 1LOJA 3SD4A 4AFSC 4BY6B 3QDRB 4RG2A 1MV0B 1TG0A 3RNJA 4D6WA 1WHMA 2F2XA 4A54A 1C6VX 4J6WA 2DYBA 1I1JA 2ECZA 3CXCA 5GMKm 1Q86U 3SHWA 3FC3A 4C92G 3A8OB 1UECA 3JCMW 2DFUA 2W0ZA 1SRMA 3OYEA 4RTUA 3HHTB 3J81E 1WIEA 2MIOA 3C0CA 4FYWB 4PKCC 1WDXA 3M0RA 1RACB 3ASKA 1X75C 3JCMV 4TVRA 1U1TA 2HL5C 2HQXA 5L8RE 5I21A 1S72A 1BI0A 3F70A 2BTTA 4JRPA 3ULRB 1T0JA 5GAOq 2DAQA 5FU7C 4B9XA 3OYKA 4JJDA 1GBRA 1GFDA 1YI2T 2RQWA 3CCUQ 3CCVT 1TU0B 1WPYA 2LC4A 4AG1C 4L59A 3EFOA 5GAN6 2FL7A 2WSFE 4EIKA 4K11A 5GAMd 3SWNA 1EZZB 5LJ5d 1RLQC 3RESA 3GLXA 2DD4A 1QVGA 2X4JA 1QCOA 1PG5B 5KE2A 4R0KA 2R5MA 5KYNA 4J9DA 4R55A 1YWPA 1N8RU 4E7KA 1CKBA 2MK5A 6AT1B 2E5KA 1Q81C 4XU1A 1G3WA 2KNBB 1N5ZA 2K6DA 3N5BB 2WSEE 4ZN3A 3Q1JA 3V8JA 1M27C 3GNFB 1GCQC 3CCRQ 1KIKA 4BDZA 2RB6A 1G3SA 3CCJA 2JS2A 2CZ1B 3MPUB 3G4SQ 4CC2A 3MJXA 2HQEA
chains in the Genus database with same CATH topology
1WNLA 4MMKA 2M1HA 4ZGEB 1EIFA 3GOXA 3A8GB 4EMKA 1QVGS 1BYMA 3CCVA 3OYDA 1G3TA 2E64A 2RJDA 1QVFS 1Q86C 3UDCA 4QVCA 5LJ5g 2WACA 5DM7R 4FU6A 2DTIA 1IREB 3FRNA 2L89A 2Y4YA 4LD6A 4BUGA 4MDXA 3MP8A 3CCLT 4JJNK 2FB7A 1VQKT 2RI3A 3QHSA 3JCMe 2PUOB 1W2BS 3FJPA 4FSXA 2KVQG 3JB9H 5GANg 4XU2A 2ZPBB 1YCYA 3X28B 5GAN4 2ZPHB 4RMOA 2QTXA 2GQVA 4FM4B 1WJSA 2B8AA 2GFAA 1VQ9T 3HSBA 3LWIA 1NJIC 3C4SA 3EFRA 4MDWA 4NL3A 1Y07A 2P0KA 3QXEB 1KQSA 4NOYA 1YIJA 1D3BB 3C94A 2V8KA 4BY6C 4F7UB 5GAOn 4M77B 3BDUA 3OS5A 4A4EA 3S3OA 3CCUA 1VQNT 4M7DD 4HKEA 2L3RA 4QQ6A 3JCMg 1N8RC 4BACA 4DA4A 1K73C 3G6ET 2X35A 2QXFA 4J83A 4QW2A 2OTJT 3OB9A 1WJRA 4O5VA 5D6WA 3V8KA 4F7UG 4E7JA 2RH2A 1JBMA 3OYGA 3CCJT 4LDWA 1KQ2A 3V7CA 3PFSA 2ZCFB 1YITT 1UGQB 4KBMB 4EMGA 2PVGB 1V29B 4ELZC 3E19A 2VV5A 1M4ZA 1MGQA 4ZTJA 2JVVA 1KC8U 3JCMQ 3HKSA 4ZTFA 2KSSA 3M5AA 4JUVA 3L1AA 4M75C 2LQ8A 3QIIA 4II1A 3PT9A 4KULA 2R5AA 2RO0A 3BFMA 5CKEA 1YJWT 4IUQA 3NFCA 3URGA 1M1KC 3CC4T 5HKCA 3HRUA 1FWZA 2EJGA 2Y4XA 3VYGA 3CC7A 5HK3A 3CCMT 2OTLT 4LD9K 3X26B 2RA2A 1BKBA 2DEQA 2QQBA 4OVAA 4VUBA 5CKHA 5GANe 5DLOA 3CCRT 4E7LA 3HFNA 1N9SA 2DPPB 3CBOA 2G3RA 1WQ7A 2GFUA 5A0LA 4DOWA 2RI5A 2LCCA 1S72T 4XTYA 3BW1A 4EDUA 5CCAA 1M8VA 4MZMA 4OB1B 3JSCA 4PLIA 1VUBA 5DLQE 4ZGDB 4ZN1A 3JB9I 4HCCA 4ZGJB 3CCMA 2MI6A 1B34B 3QKJA 4M78A 3JCMJ 2ZZDA 3KUFA 4BE1A 2A3LA 4QVZA 5CKBA 4BI4A 4QQGA 5GAN2 5GAOr 3HRSA 1I81A 3NTHA 1YHQT 2GF7A 3JB9J 3P8HA 3T9NA 5LJ3h 2EQMA 2MWPA 3QZ9B 2RJCA 1IZ6A 2K2VA 3FLGA 1KHIA 5KH6A 5A2QE 1VQOT 1XQHA 2ZPEB 3BDLA 1M5Q1 4IUVA 4F7UE 5IAYA 5LJ3e 3G4ST 2QA4T 5I2SA 1VIFA 1I8FA 4M7AC 5LJ3g 3M53A 4IURA 4N4HA 2K5FA 2CZ0B 4JDSA 3X20B 2EAYA 4JLIA 3G6EA 2RHIA 3CMET 4M7DF 2M0OA 3LWHA 3QYGB 2O4XB 3AHUA 3OY9A 3VUZA 3GIBA 2JZ2A 1RL2A 1X6OA 2D0QB 3INZA 3RUXA 2LTOA 1U1SA 1Y96B 4L6V5 1OZ2A 4MZPA 3OYMA 1Q7YC 3QSUA 3VYHB 3TEEA 5DY9A 3I55T 1BI2A 3CCEA 3I56T 2X4XA 1KHCA 4XTWA 2VXFA 3RKWA 5GAMe 5GMKi 1VQ7T 2RHUA 2HD0A 5EG2A 1NZ9A 3PTAA 2M16A 4M75E 4XTZA 2C06A 2FHDA 1WQWA 2ZPIB 2BIVA 1KQ1A 2QQSA 3OS1A 3CCRA 1YBYA 4M75F 3ZEHA 2DTHA 4XTVA 5HK0A 3E9FA 4M77C 4DOVA 3CMAT 1Q7YU 4ME7A 2RHZA 4PJOG 1HK9A 3QJYA 3LGLA 4C0DC 2DZ9A 2EKOA 4FT2A 4Y28E 4C8QF 2KY9A 3HRTA 4HCZA 3L2ZA 3LLRA 4M78D 1BIAA 2EYQA 5M9OA 3CCUT 2HAXA 2D6FA 4E7IA 1YHQA 5FLXE 4BI8B 3MEUA 3FB9A 4M78E 2V8JA 2ZPFB 1M9SA 2VUBA 3QUIA 3P8DA 3JCMh 3V8LA 2LT1A 2WSCE 4JLGA 5IN1A 1VQ8A 3M59A 3G7ZA 2KMTA 2VGNA 3EFSA 4FT4A 3E1SA 3UT1A 3OYFA 5GAN8 2QQAA 3S3MA 4JRKA 1QP2A 4M78B 4RCBA 1UGRB 3FEOA 1WJQA 3ER0A 2LRQA 4B9WA 4C92F 1HXDA 4RCCA 5LJ3j 4ATOA 3OYAA 1PSFA 4JRQA 1K73U 2LVMA 2BKDN 3OYHA 2CZ6B 4C92E 2JNGA 3MO8A 3QYHB 4M77G 1X01A 3X24B 4C92D 3UPUA 4C8QE 2E5QA 1VQ4T 4M7DC 3JAME 2E6ZA 5D6XA 4V2SA 3H6ZA 1LNXA 1SSFA 3EAEA 2R57A 2DZCA 3HL8A 5GAN7 3OYBA 3HP9A 5GANf 4E7HA 3LH0A 3KBGA 1KQSS 4UC4A 4M7AA 4C8QG 5HY6A 4C0GA 4HT8A 2E65A 2RD1A 3V7RA 4C0DB 5A0DA 3LGFA 4NL2A 3PIOA 1M1FA 3NTIA 5FU6B 4F7UA 4A4FA 3L2RA 2EQJA 2I2LA 3WVEB 4QVDA 3GP8A 1VQ4A 1R8OB 4OB0B 2E10A 1OYXA 4M7AB 2K3XA 3WXMB 4A4HA 4X34A 5LJ5f 1BI1A 5GMKh 3RKYA 2K5IA 4XK8E 2PVOB 5LJ5j 4PJOE 4M77F 5KCOA 4MZTA 1N6AA 2JTMA 2XG8D 2CZ7B 1VIEA 3A5ZB 2K5LA 3M57A 4N4GA 4C5HA 3G71A 4OB2B 3SB2A 3JCMf 4O6JA 4RG8A 4PJOA 3RERA 1RI0A 3CC2T 3JCMP 4M7AE 2OAUA 3BY7A 2RJFA 1VQ8T 5D6YA 2DTOA 2LNVA 3CPFA 4P5NA 5J39A 4M7AD 3KXTA 2VC8A 2EFIA 3QBYA 4Z02A 3CMAA 4M7DG 3V7SA 3VUBA 4N0AA 3G71T 1P92A 3PGGA 4J6YA 2MMPA 3UWNA 1VQKA 5KCHA 2EWNA 4KT0E 3PMIA 3OYYA 4JRIA 1JJ2A 4LDVA 4C92A 2PUKB 5GMKj 2H3JA 1YITA 2P4TA 4C8QB 4CI0C 2HBPA 5AYFA 3L42A 2QA4A 1KG1A 2RI2A 1VQ9A 1UEBA 5GAMg 3CCQA 4FL6A 2KAFA 3L2UA 4PJOD 2DK3A 3A8LB 3LW5E 4C92C 2KDSA 1K8AU 1VQNA 5KE3A 4PJOF 1O75A 3VKIA 3OYLA 4N4IA 4JS5A 1AHJB 4MMLA 4HA8A 4N0AC 2XICA 3R6OA 5GMKl 3H8ZA 3CCQT 1VQPA 4RKUE 1H641 4IUPA 3OBWA 5C0MA 2QEXA 3CD6T 5CKFA 4E47A 1M1KU 2M9UA 5GAOm 4M78C 2DO3A 4L5GA 4GY5A 1YJ9T 3L2WA 4OGEA 5GANd 2YLCA 3OMCA 4XQ3A 3GNGA 4J7IA 3CCSA 3JB9G 2DJZA 2DXBA 2CGHA 3JCMX 2R58A 3CMEA 3OA6A 1YJNT 2XU8A 4GLKA 3RMSA 3DLMA 5LJ5e 1YJWA 3M54A 2V8IA 1QW1A 3CC7T 2PU9B 3M56A 2DXCA 4EMHA 3I55A 3OSSC 3CCST 3OYCA 4C5GA 2CKKA 5A0GA 4F7UF 5CKDA 4OP0A 4BE2A 2RK1A 3NTKA 1KC8C 1MHNA 1NE8A 2NLUA 2AHJB 2EJFA 3LYIA 2DXUA 3META 3M4YA 3SDZA 1G5VA 3A8HB 1BIBA 1W4SA 3JB9F 2IVWA 5C6SA 1QVPA 5CR2A 4EMKC 3OW2A 3RIRA 1Y96A 4OMFB 3SFMA 4PJOB 3S6WA 5CK9A 3JB9D 1TH7A 4C8QA 2PVDB 5GAOp 2OTJA 1Y7XA 3JRZA 2E41A 2L5QA 4R56A 3OYIA 2F69A 4XU0A 2YHTA 4M75B 4IUUA 3DB4A 5CQYA 2OTLA 3JCMb 4M7DB 3PIPA 3M4GA 3GF5A 3MP1A 4M75D 4QQDA 2RHXA 2KK4A 4BI3A 2XDBA 2X4YA 5CAIA 1H3ZA 1I5LA 2MAMA 4FIBA 3L2QA 1XOVA 4PL6A 2E1HA 2P0PA 1JB0E 3CBMA 3OS2A 4PJOC 1UGSB 4WF2A 4A4GA 3MEWA 1YIJT 1K9MC 4HCBA 2LT4A 1B34A 2GCXA 3QZ5B 3GPLA 1YJ9A 2Y90A 3P8BB 2DD5A 2IG0A 2VXEA 2X4WA 4C0ZA 4XU3A 3I56A 2XK0A 1N9RA 2P0QA 2DXTA 3MEVA 1M90C 1WGSA 2XD0A 1VQ7A 1VQOA 1YJNA 1O9SA 3RKXA 2LQKA 5GAN3 3G4SA 2MF2A 4XTXA 2QQRA 1PSEA 3J7AF 4M77A 3SWNC 5GAMj 5LL6S 4C92B 2DIGA 2HNIA 3OSVA 5J26A 1VQ6T 4LDYA 1YI2A 3DLLA 4KUDK 2L8DA 2XKOC 1FX7A 5IT9E 2VGMA 4M7AG 2K3YA 3C12A 2K4YA 1I4K1 1LOJA 1M1GA 2D9TA 4OB3B 2EQKA 3MP6A 1W2BA 4PNOA 3SD4A 4BY6B 3QDRB 4RG2A 1Q81U 4XAXB 1VQ6A 2DVEA 4OF1A 2CYZB 4BD3A 1VQMA 4D6WA 3SWNB 4IUTA 3PMTA 1ZHIA 5FU6C 4A4KA 5GAN5 4A54A 1DJ7B 2A7YA 2JOYA 2BUDA 1QVFA 4M7DE 2RJEA 3OS0A 2KQWA 5CQXA 5FRNA 2YLBA 3QPHA 4J6WA 5FU7B 3CC2A 3CBPA 2MWOA 2DIQA 5GAOl 2E70A 2JTFA 4C8QD 2QQ9A 5CIUA 3CXCS 3HFOA 2RHYA 2XHCA 2ZPGB 3RMQA 4C5EA 3CXCA 1ZBXA 5GMKm 1Q86U 5GAMf 4NS5A 3FC3A 2O01E 3TCJA 2XIDA 4M77D 2VYTA 4C92G 3A8OB 4HT9A 5CO7A 1VQPT 4Q5WA 3OYNA 5GANj 3VV0A 4EMKB 4BE0A 3E9GA 3JCMc 3JCMW 4M77E 2XDPA 1OZ3A 3OYEA 3OBYA 3OW2S 3TREA 3HHTB 2XDDA 3ZFJA 3J81E 3M9QA 4X9DA 4M7AF 3TU4K 4DQ2A 4PKCC 1D3BA 1VQLA 3A8MB 3M58A 3FDRA 4XTUA 3C95A 4J6XA 1LJOA 3ASKA 1X75C 5LJ3f 3CCET 3JCMV 4TVRA 2FVUA 1U1TA 4PLLA 3O8VA 3ZBDA 4KUIA 2HQXA 4CRIA 1JJ2S 5L8RE 5I21A 1S72A 2LX9A 3M55A 3J80E 1KD1C 4IKFA 4M75A 3WVDB 1BI0A 3F70A 4JRPA 2EIFA 4M7DA 2XI9A 1VQ5T 5CVIA 4M78G 2QEXT 2CS7A 3DKMA 3CD6A 1GXIE 1UGPB 5GMKe 2ZGWA 5GAOq 3CEYA 2FYKA 2O4XA 5GANh 3CC4A 1NPPA 2DAQA 2QI2A 5FU7C 3DB3A 4B9XA 1VQMT 4ELYC 3OYKA 3LX7A 3ME9A 5LJ3d 4J8OA 2QDYB 1Q82C 1YI2T 4J7FA 2EJ9A 2JN0A 3CCVT 1BI3A 1UB4A 1WPYA 2LC4A 1FXXA 4L59A 5GAN6 1N27A 4C8QC 3JCMd 1K8AC 2FL7A 2WSFE 5LJ5h 5GAMd 5I2MA 3CCLA 1NPRA 4M75G 3SWNA 5FROA 1XTDA 1ZQ1A 4C0FA 5LJ5d 3GLXA 3RESA 3VJPA 5J3BA 2DD4A 3QJ6A 5GAMh 2X4JA 1QVGA 2EQUA 3L2VA 4LDUA 3CPWS 5KE2A 2K57A 1KD1U 3OYJA 2R5MA 3MHXA 3MCAB 3QG1A 3QO3A 4YTLA 4R55A 1N8RU 1U8RA 4E7KA 2LDMA 4M78F 1OI1A 3FIFA 4A53A 4EPCA 1Q81C 1VQLT 4XU1A 1XNIA 3PNWC 1G3WA 2DKGA 2F5TX 2JUFA 2RK2A 1QP3A 3OMGA 4C5IA 4BB7A 1NJIU 1K9MU 3N5BB 2WSEE 4ZN3A 4J5YA 1G3YA 3Q1JA 4OGCA 4X9CA 3V8JA 3S3NA 2YRVA 4Y91A 4LDXA 3GNFB 3MEAA 2RM4A 1M90U 1VQ5A 4JS4A 4BDZA 2RB6A 3VU3C 1G3SA 2PQWA 5FRMA 2E12A 3CCJA 2CZ1B 1JRIA 3X25B 1Y71A 2LCLA 2F5KA 3OQ5A 1Q82U 3CPWA 4BDYA 2HQEA 2E6NA 3HPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNL A;  4MMK A;  5DY9 A;  4EMK A;  4C92 C;  5GAN 5;  4A54 A;  5GAM e;  4XTW A;  3RKW A;  2VXF A;  5GMK i;  4M7D E;  2E64 A;  4PJO F;  4MML A;  4M75 E;  4XTZ A;  4HA8 A;  4N0A C;  5GMK l;  4QVC A;  1WQW A;  2YLB A;  4J6W A;  5LJ5 g;  1KQ1 A;  5GAO l;  2DTI A;  1H64 1;  4M75 F;  4C8Q D;  2DTH A;  4XTV A;  3HFO A;  4M77 C;  5GMK m;  2FB7 A;  5GAM f;  3QHS A;  4PJO G;  3JCM e;  4M77 D;  4C92 G;  5GAO m;  1HK9 A;  3FJP A;  4M78 C;  4C8Q F;  2DZ9 A;  4HT9 A;  3JB9 H;  5GAN g;  4XU2 A;  5GAN d;  1YCY A;  2YLC A;  4XQ3 A;  4EMK B;  3JCM c;  3L2Z A;  3JCM W;  4M78 D;  1BIA A;  2DJZ A;  4M77 E;  2CGH A;  3JCM X;  5GAN 4;  5GAN j;  4M7A E;  2QTX A;  5LJ5 e;  3HSB A;  4M78 E;  3FB9 A;  4X9D A;  4M7A F;  3EFR A;  4DQ2 A;  4NL3 A;  3QUI A;  1D3B A;  4EMH A;  4XTU A;  3JCM h;  3V8L A;  4J6X A;  1LJO A;  4NOY A;  1D3B B;  5LJ3 f;  4F7U B;  5GAO n;  4F7U F;  4M77 B;  3BDU A;  3EFS A;  4OP0 A;  3JCM V;  4M7D D;  1U1T A;  3JCM g;  2EJF A;  2DXU A;  5GAN 8;  5I21 A;  4JRK A;  4RCB A;  1BIB A;  4M78 B;  3JB9 F;  4M75 A;  1KQ2 A;  3V8K A;  4F7U G;  4EMK C;  1JBM A;  4M7D A;  4C92 F;  1HXD A;  1Y96 A;  4RCC A;  3RIR A;  4M78 G;  3V7C A;  5LJ3 j;  4PJO B;  3JB9 D;  3JB9 G;  5GMK e;  2ZGW A;  4EMG A;  1TH7 A;  4C8Q A;  5GAO q;  2FYK A;  5GAN h;  4C92 E;  4M77 G;  4C92 D;  5GAO p;  2E41 A;  1MGQ A;  1X01 A;  4C8Q E;  3JCM Q;  4M7D C;  4XU0 A;  2YHT A;  4M75 B;  4JUV A;  3L1A A;  4M75 C;  5LJ3 d;  3JCM b;  4M7D B;  4V2S A;  3M4G A;  1LNX A;  2EJ9 A;  2JN0 A;  2DZC A;  4M75 D;  3BFM A;  1WPY A;  5GAN f;  5GAN 7;  4M7A A;  4C8Q G;  5GAN 6;  4C8Q C;  5CAI A;  3JCM d;  2E65 A;  2RD1 A;  3V7R A;  5LJ5 h;  2EJG A;  1I5L A;  4NL2 A;  4F7U A;  5GAM d;  2E1H A;  2RA2 A;  2DEQ A;  5GAN e;  2I2L A;  4QVD A;  4PJO C;  4M75 G;  3HFN A;  4WF2 A;  3SWN A;  1N9S A;  2E10 A;  4M7A B;  1WQ7 A;  1B34 A;  5LJ5 f;  5LJ5 d;  2Y90 A;  3RES A;  4XTY A;  2VXE A;  5GMK h;  5GAM h;  3BW1 A;  4XU3 A;  1M8V A;  3RKY A;  1N9R A;  3JB9 I;  2DXT A;  5LJ5 j;  2K57 A;  4PJO E;  4M77 F;  1B34 B;  4M78 A;  3QO3 A;  3JCM J;  3RKX A;  5GAN 3;  5GAN 2;  3SB2 A;  4XTX A;  4M78 F;  1I81 A;  3JCM f;  5GAO r;  4PJO A;  3RER A;  4M77 A;  3SWN C;  3JCM P;  3FIF A;  4A53 A;  5GAM j;  3BY7 A;  5LJ3 h;  3JB9 J;  4C92 B;  2DTO A;  2HNI A;  4XU1 A;  4M7A D;  2DKG A;  4HT8 A;  2VC8 A;  1M5Q 1;  5LJ3 e;  4F7U E;  3V7S A;  4M7D G;  4N0A A;  3PGG A;  4J5Y A;  4X9C A;  4J6Y A;  1I8F A;  3V8J A;  4M7A G;  4M7A C;  2EWN A;  5LJ3 g;  1I4K 1;  4Y91 A;  4JRI A;  2RM4 A;  1LOJ A;  2EAY A;  4JLI A;  4M7D F;  4C92 A;  4PNO A;  5GMK j;  2RB6 A;  3AHU A;  3VU3 C;  4C8Q B;  3GIB A;  1JRI A;  3INZ A;  2DVE A;  3RUX A;  3QSU A;  1U1S A;  1Y96 B;  5GAM g;  4PJO D;  3SWN B; 
#chains in the Genus database with same CATH topology
 1B3Q A;  2CH4 W;  3M0T A;  1EIF A;  3GOX A;  3CCV A;  1G3T A;  1R0B G;  2CUD A;  2F2V A;  4CC4 B;  4QVC A;  1JXM A;  1IRE B;  3FRN A;  2L89 A;  2Y4Y A;  1Z9Z A;  1QCF A;  4MDX A;  2M51 A;  3JCM e;  4PJL A;  1D0X A;  3FJP A;  1I07 A;  5GAN g;  1W1F A;  4XU2 A;  3X28 B;  4A63 B;  4RMO A;  4FM4 B;  4HVW A;  2GFA A;  3HSB A;  1W70 A;  3EFR A;  1PKS A;  2HKN A;  2P0K A;  1YIJ A;  3C94 A;  3QDF A;  4M7D D;  1N8R C;  4QQ6 A;  2HL3 A;  3E2U A;  4DA4 A;  4J83 A;  2QXF A;  4O5V A;  2RH2 A;  3OYG A;  3CCJ T;  1RAE B;  2ZCF B;  2J6F A;  2HSE B;  1M4Z A;  2IIM A;  4ZTJ A;  1ZBJ A;  3L1A A;  2LQ8 A;  2R5A A;  2RO0 A;  2LJ0 A;  3NFC A;  3URG A;  4RUG A;  1FWZ A;  1FMV A;  2Z0W A;  3X26 B;  4OVA A;  2L3Q A;  3CCR T;  4FYY B;  3HFN A;  1Q81 R;  2DPP B;  3CBO A;  1WQ7 A;  4XTY A;  3JSC A;  4ZN1 A;  3VS5 A;  2MI6 A;  1PD1 A;  4M78 A;  2ZZD A;  3KUF A;  4BE1 A;  3NHN A;  5CKB A;  1WHJ A;  5GAN 2;  3P8H A;  3T9N A;  3CCQ Q;  1PWT A;  3EGX A;  4RTT A;  3QZ9 B;  2RJC A;  2K2V A;  1XQH A;  2ZPE B;  1UE9 A;  3CPW P;  3BDL A;  5IAY A;  1VIF A;  4JJC A;  1AZG B;  2CZ0 B;  2EAY A;  3LWH A;  4LE9 A;  1X6O A;  3INZ A;  3RUX A;  1U1S A;  1Y96 B;  1HJD A;  3OYM A;  1Q7Y C;  2CP3 A;  3IQL A;  3CCE A;  2VXF A;  1BCO A;  2RHU A;  2FPF A;  1NZ9 A;  3RDV A;  4PFO A;  3G6E Q;  1KQ1 A;  4M75 F;  3ZEH A;  1Q7Y U;  4C8Q F;  4DBQ A;  3LGL A;  3L2Z A;  2D6F A;  2DL7 A;  4E7I A;  2V8J A;  3P8D A;  2LT1 A;  4JLG A;  1OU9 A;  3UT1 A;  2GNC A;  1QMC A;  3M0U A;  1SG5 A;  3S3M A;  2CT4 A;  3FEO A;  3CME Q;  1V76 A;  3U23 A;  4FW2 A;  1SHG A;  3OYH A;  3MO8 A;  3QYH B;  1X01 A;  1VQ4 T;  4C8Q E;  2E6Z A;  4AT1 B;  2KRS A;  3R6N A;  4V2S A;  1VOM A;  3UAT A;  3EAE A;  2DZC A;  3HL8 A;  1OX8 A;  3OYB A;  1OQK A;  4UC4 A;  4C8Q G;  4DBF A;  2RD1 A;  5A0D A;  4C0D B;  4A4F A;  2X3X D;  3L2R A;  2EQJ A;  1SKU B;  2H3E B;  3REB B;  1OYX A;  4M7A B;  2QAZ A;  2KT1 A;  4XK8 E;  3A5Z B;  4C5H A;  4OB2 B;  4O6J A;  2BZ8 A;  3RER A;  5GJV B;  3CPF A;  3KXT A;  2VC8 A;  3CMA A;  3G71 T;  4J6Y A;  2MMP A;  1LVK A;  3UWN A;  4E2F B;  1JJ2 A;  1H3H A;  2CT3 A;  1MNE A;  5GMK j;  1SHF A;  4CI0 C;  2HBP A;  5AYF A;  1UEB A;  4OML A;  4PJO D;  4FL6 A;  3L2U A;  5KE3 A;  1MMG A;  3R6O A;  3CCQ T;  1LPL A;  2NUT B;  3BE3 A;  1WYX A;  3OBW A;  3O5Z A;  5C0M A;  3CD6 T;  2D1X A;  1YP5 A;  2DRM A;  2KEA A;  4PJM A;  1CSK A;  2YLC A;  3OMC A;  4OMO A;  4XQ3 A;  4F17 A;  2DJZ A;  1ZA2 B;  2XU8 A;  2YUO A;  3RMS A;  5KYW A;  5LJ5 e;  3CC7 T;  2PU9 B;  3M56 A;  2DXC A;  1UUE A;  3I55 A;  3OSS C;  2EBP A;  2DLP A;  3GBQ A;  5CKD A;  4OP0 A;  2NLU A;  3LYI A;  3QWX X;  2DXU A;  3M4Y A;  5I22 A;  5C6S A;  1QVP A;  2LP5 A;  1Y96 A;  4PJO B;  5CK9 A;  4C8Q A;  2PVD B;  3VS3 A;  5GAO p;  3JRZ A;  4R56 A;  1WLP B;  4XU0 A;  2YHT A;  1UHC A;  2RHX A;  1GL5 A;  1D0Z A;  4BI3 A;  1G2B A;  2JS0 A;  2X4Y A;  3TVT A;  1I5L A;  1BCM A;  2DJQ A;  1I0C A;  3CBM A;  1RAG B;  1UGS B;  2HKQ B;  1K9M C;  2LT4 A;  3UA6 A;  1LCK A;  2Y90 A;  2VXE A;  3I56 A;  2P0Q A;  2DXT A;  1MMN A;  2NUZ A;  3D7S B;  3RKX A;  3G4S A;  2QQR A;  5IHK A;  4C92 B;  2DIG A;  3OSV A;  1VQ6 T;  3A1P A;  2GBQ A;  1NBE B;  5IT9 E;  1I4K 1;  2NUP A;  1BB9 A;  1M1G A;  3MP6 A;  4IIO A;  1W2B A;  4PNO A;  1X43 A;  4XAX B;  1IO6 A;  5FU6 C;  2NUT A;  2BUD A;  3OS0 A;  2KQW A;  5FRN A;  2NWM A;  5FU7 B;  2ZAE A;  2MWO A;  1VQL Q;  3HFO A;  1YNZ A;  2ZPG B;  2YUP A;  4FCY A;  4M77 D;  2KYB A;  1RAH B;  4ZNX A;  3VV0 A;  4EMK B;  2DNU A;  2QTV A;  2COW A;  3OBY A;  3OW2 S;  3EGD A;  3PVL A;  1BBZ A;  2XDD A;  2OTJ Q;  2DL3 A;  3H9N A;  3CC4 Q;  1D3B A;  3A8M B;  1JXO A;  3FDR A;  4HVV A;  1ARK A;  1LJO A;  3UF4 A;  5LJ3 f;  1AWJ A;  2FPE A;  3O8V A;  1U5S A;  2O31 A;  4CRI A;  1JJ2 S;  1KD1 C;  4IKF A;  3WVD B;  2EIF A;  1TUD A;  2ZGW A;  2FYK A;  2DIL A;  1RAB B;  4ELY C;  3LX7 A;  3ME9 A;  5LJ3 d;  1Q82 C;  4J7F A;  1BI3 A;  1FXX A;  1J3T A;  4C8Q C;  3SEM A;  3JCM d;  2ROL A;  3A98 A;  5I2M A;  1FMW A;  4J9E A;  1NPR A;  4M75 G;  4C0F A;  1QLY A;  5GAM h;  2AKL A;  3L2V A;  4LDU A;  3TQ7 P;  2LDM A;  1MV3 A;  4M78 F;  1SEM A;  1OI1 A;  4EPC A;  1Q82 R;  3PNW C;  2DKG A;  1QP3 A;  1K9M U;  2AK5 A;  3TSW A;  4OGC A;  2BE7 D;  2YRV A;  4Y91 A;  2FPD A;  4JS4 A;  1VQ7 Q;  2M0Y A;  3I9Q A;  1VQO Q;  2E12 A;  3X25 B;  1C1A A;  1Y71 A;  2LCL A;  3G1J A;  2E6N A;  3HPW A;  1WNL A;  4ZGE B;  1QVG S;  3MKD A;  4EMK A;  1BYM A;  2E64 A;  1QVF S;  2DET A;  1Q86 C;  3UDC A;  1TUC A;  2DTI A;  2JM8 A;  1AOJ A;  4BUG A;  1VQ8 Q;  3H0I A;  2JJ9 A;  2RI3 A;  3QHS A;  1MMD A;  2P84 A;  1SRL A;  2YSQ A;  5I11 A;  2ZPB B;  4GBQ A;  5GAN 4;  2ZPH B;  4JPB W;  2QTX A;  1M30 A;  2GQV A;  2VVK A;  1WJS A;  3C4S A;  4MDW A;  2GGR A;  4NL3 A;  1UJY A;  1Y07 A;  1I5O B;  3QXE B;  1ZUY A;  1KQS A;  4NOY A;  2QEX Q;  2NUP B;  3OS5 A;  3CCU A;  1K73 C;  2F2W A;  2OTJ T;  4F7U G;  1JBM A;  4PK4 A;  3PFS A;  3V7C A;  1G83 A;  2PVG B;  4Z89 A;  1NYG A;  4ELZ C;  2VV5 A;  4RTZ A;  2JVV A;  3JCM Q;  4JUV A;  4X1V A;  3QII A;  1IGU A;  3PT9 A;  4QKU A;  1YJW T;  4CC3 A;  3KFV A;  2RMO A;  2QYZ A;  5HKC A;  2EJG A;  2Y4X A;  2RQV A;  1K0S A;  2QQB A;  4VUB A;  4E7L A;  5GAN e;  5DLO A;  5CKH A;  3H0H A;  1KC8 R;  1V1C A;  2LQW A;  3EGD B;  5CCA A;  2RPN A;  4ZGJ B;  3QKJ A;  1QVF P;  4PFP A;  3CCJ Q;  4M4Z A;  4QVZ A;  4BI4 A;  1YHQ T;  1QVG P;  2GF7 A;  3JB9 J;  2EQM A;  1KHI A;  2DM1 A;  3G4S T;  1OX9 A;  2QA4 T;  4IUR A;  2K5F A;  1OU8 A;  2D8J A;  2KI7 A;  2EYY A;  4M7D F;  2M0O A;  5IXF A;  1KK7 A;  3AHU A;  2E4H A;  3GIB A;  1RL2 A;  2CP6 A;  2K9G A;  2LJ3 A;  4L6V 5;  1EFN A;  5DY9 A;  1YI2 Q;  3RKW A;  1VA7 A;  5GMK i;  2C06 A;  2ZPI B;  3OS1 A;  1YBY A;  2NYS A;  2AKK A;  4XTV A;  2HEQ A;  1YWO A;  3E9F A;  4M77 C;  5HK0 A;  1VQ6 Q;  4ME7 A;  1FYN A;  1HK9 A;  3QJY A;  1QKW A;  4C0D C;  1GRI A;  3HRT A;  2JXB A;  4M78 D;  2EYQ A;  1YHQ A;  1XJW B;  5FLX E;  1IB8 A;  3FB9 A;  4M78 E;  2ZPF B;  2DRK A;  3QUI A;  2J6K A;  4E7S A;  3V8L A;  2VGN A;  4FT4 A;  2MOX A;  5GAN 8;  4JRK A;  1B7T A;  1WJQ A;  2AZV A;  5L23 A;  2LRQ A;  1M1K R;  1Q86 R;  2FG0 A;  1K73 U;  2LVM A;  4C92 E;  1YJ9 Q;  3X24 B;  2E5Q A;  4M7D C;  3VS4 A;  1GCQ A;  5D6X A;  3H6Z A;  1SSF A;  4M7A A;  1NLP C;  3HP9 A;  5GAN f;  3LH0 A;  1KQS S;  2RQT A;  1S72 Q;  5HY6 A;  3LGF A;  1WXT A;  1M1F A;  5FU6 B;  1CKA A;  1VQ4 A;  2E10 A;  4A4H A;  5LJ5 f;  1VYT A;  1BI1 A;  1NLO C;  3RKY A;  5KCO A;  1JU5 C;  1N6A A;  1YCS B;  4Z88 A;  4OMP A;  2DX1 A;  2ESW A;  3VRY A;  1ABO A;  4RTY A;  2OAU A;  2RJF A;  1A0N B;  4J9I A;  4PJJ A;  5D6Y A;  2DBM A;  4E6R A;  4P5N A;  3EGX B;  1UHF A;  1PRL C;  1SSH A;  3QBY A;  4Z02 A;  5KYU B;  4N0A A;  1P92 A;  3PGG A;  5KCH A;  2EWN A;  3PMI A;  4JRI A;  1X27 A;  2FRW A;  4C92 A;  1M2V B;  1ZSZ A;  1YIT A;  2HCK A;  1M3C A;  4CC7 A;  2QA4 A;  1KG1 A;  2RI2 A;  1VQ9 A;  4D8K A;  2RQU A;  3LW5 E;  5FWC A;  2AZS A;  2QG9 B;  2XIC A;  1ZX6 A;  3I5S A;  1H64 1;  1RLP C;  2LJ1 A;  4HVU A;  1JQQ A;  4E47 A;  2BZY A;  2KR3 A;  4M78 C;  2DO3 A;  4OGE A;  2C0I A;  4J7I A;  3EG9 A;  2DXB A;  3CME A;  2R58 A;  1BU1 A;  4GLK A;  2V8I A;  1QW1 A;  1T3S A;  4EMH A;  1KC8 C;  4BE2 A;  2CRE A;  1MHN A;  2AHJ B;  1BIB A;  1U06 A;  4OMF B;  3S6W A;  2OTJ A;  2CH4 A;  2F69 A;  4M75 B;  3DB4 A;  5CQY A;  3JCM b;  4M7D B;  3PIP A;  3GF5 A;  4M75 D;  2KK4 A;  2XDB A;  3PVQ A;  1H3Z A;  3L2Q A;  4PL6 A;  2P0P A;  1FMK A;  3I35 A;  3OS2 A;  2DL5 A;  4WF2 A;  3MEW A;  1PKT A;  2KRM A;  3GPL A;  3M0Q A;  4XU3 A;  1N9R A;  2XD0 A;  1VQ7 A;  1VQO A;  1NEG A;  4XTX A;  3REA B;  3J7A F;  3EH2 A;  2COZ A;  4LDY A;  1YI2 A;  2XKO C;  2VGM A;  2K3Y A;  2XMF A;  3CC2 Q;  4OB3 B;  1MMA A;  1ZSG A;  1Q81 U;  1VQ6 A;  4OMQ A;  2DVE A;  4LUE A;  2HBW A;  3SWN B;  3PMT A;  1KQS P;  4A4K A;  3CCS Q;  5HCK A;  5GAN 5;  2JOY A;  4M7D E;  2RJE A;  1AZE A;  3VRZ A;  2YLB A;  3QPH A;  3CC2 A;  3CBP A;  1VQ5 Q;  2E70 A;  4C8Q D;  3CXC S;  5CIU A;  1MND A;  3S3N A;  3RMQ A;  2RHY A;  1ZBX A;  4RTX A;  5GAM f;  4NS5 A;  2O01 E;  3TCJ A;  2XID A;  2BE9 B;  2VYT A;  3JV3 A;  2HDA A;  2L3S A;  4Q5W A;  5GAN j;  2KE9 A;  4M77 E;  1OZ3 A;  1WXU A;  3TRE A;  1NYF A;  3M9Q A;  2O9V A;  1HYO A;  4DQ2 A;  4XTU A;  3M58 A;  3C95 A;  4J6X A;  5FW9 A;  8AT1 B;  4OMM A;  1AVZ C;  3ZBD A;  4PLL A;  1QCN A;  1WHL A;  2ED0 A;  4KUI A;  1VYU A;  2LX9 A;  2YWW A;  2JMA A;  3RR6 A;  2FRY A;  2XI9 A;  1RAD B;  5CVI A;  4M78 G;  2QEX T;  1GXI E;  1UGP B;  1ZLM A;  1IGQ A;  5GMK e;  3QWY A;  2LNH B;  2O4X A;  1M2V A;  1ZSZ B;  2QI2 A;  2H8H A;  1JO8 A;  4J8O A;  2QDY B;  1WFW A;  2RF0 A;  4B6M A;  2EJ9 A;  2JN0 A;  3FJ5 A;  1UB4 A;  4KGX B;  1ABQ A;  1ZQ1 A;  2RQR A;  2VB6 A;  2QAS A;  1K9M R;  1KD1 U;  3OYJ A;  3MCA B;  3QG1 A;  2COY A;  4J9F A;  2EW3 A;  3TSZ A;  2GTJ A;  4JJB A;  1GFC A;  1XNI A;  2F5T X;  2JUF A;  2PZ1 A;  2RK2 A;  2O88 A;  1WHK A;  4J5Y A;  1G3Y A;  4LDX A;  2RM4 A;  4JZ4 A;  1WXB A;  2YDL A;  3VU3 C;  2PQW A;  5FRM A;  2L2P A;  1JRI A;  2KT8 A;  1PNJ A;  3OQ5 A;  1Q82 U;  3CPW A;  3UA7 A;  2M1H A;  1WI7 A;  4J9C A;  4J9G A;  3OYD A;  5LJ5 g;  3M0P A;  4FW1 A;  1K73 R;  4LD6 A;  3MP8 A;  4JJN K;  1VQK T;  3ZL7 C;  4FSX A;  3EG2 A;  3JB9 H;  2EGE A;  1IHV A;  2JM9 A;  2B8A A;  2RNA A;  4J9H A;  1KFZ A;  1GBQ A;  1OUL A;  1K76 A;  3EH1 A;  4F7U B;  3S3O A;  1VQN T;  4A4E A;  4HXJ A;  3JCM g;  1D1A A;  4LN2 A;  3G6E T;  1ACM B;  1OEB A;  3OB9 A;  1KQ2 A;  1M3B A;  4LDW A;  3CXC P;  1YIT T;  2PNI A;  1V29 B;  3E19 A;  4KGZ B;  2JW4 A;  1KC8 U;  1TUG B;  3HKS A;  1WHH A;  3M5A A;  4M75 C;  4WCI A;  2ATC B;  4KUL A;  1WX6 A;  3BFM A;  1E6G A;  1M1K C;  1M2O A;  2V1Q A;  3HRU A;  3CCM T;  5HK3 A;  4F16 A;  2G3R A;  5A0L A;  4DOW A;  2RI5 A;  1QWE A;  1S72 T;  4ANJ A;  3BW1 A;  4EDU A;  4PLI A;  4OB1 B;  1Y0M A;  5DLQ E;  3JB9 I;  4ZGD B;  1JEG A;  3H0F A;  4AG2 C;  4DBH A;  2QDL A;  1B34 B;  1Q95 G;  2SRC A;  3JCM J;  4JZ3 A;  1AEY A;  2MWP A;  1IZ6 A;  3FLG A;  1VQO T;  2QGF B;  1M5Q 1;  5LJ3 e;  1UFF A;  4F7U E;  2A08 A;  1I8F A;  4M7A C;  3M53 A;  4ORZ A;  1AWX A;  3X20 B;  3G6E A;  4JLI A;  3CME T;  5KYX A;  2O4X B;  1YJN Q;  2LTO A;  2AIR B;  4MZP A;  1OZ2 A;  3VYH B;  4AFU C;  3TEE A;  3I55 T;  1BI2 A;  2ED1 A;  2X4X A;  1KHC A;  3RBB B;  4XTW A;  2ABL A;  1AD5 A;  1D1B A;  2HD0 A;  3PTA A;  2FZG B;  2M16 A;  4XTZ A;  2FHD A;  1W6X A;  2KRO A;  2DTH A;  3CMA T;  4PJO G;  2DZ9 A;  4FT2 A;  4Y28 E;  2QK0 A;  3LLR A;  2HAX A;  1BIA A;  3EG0 A;  2VUB A;  2FO0 A;  3JCM h;  2WSC E;  3OW2 P;  1VQ8 A;  3M59 A;  1BK2 A;  2KMT A;  1GCP A;  1TS9 A;  1X6G A;  2QQA A;  2O2O A;  1UGR B;  1Z9Q A;  3ER0 A;  4B9W A;  3LH5 A;  4C92 F;  1HXD A;  4RCC A;  5LJ3 j;  2DMO A;  4ATO A;  3OYA A;  1PSF A;  5IHI A;  8ATC B;  2JNG A;  4M77 G;  1ZSZ C;  1UDL A;  4F14 A;  2IPO B;  2EKH A;  4E7H A;  4C0G A;  2E65 A;  4NL2 A;  4F7U A;  3NTI A;  1W2B P;  3WVE B;  4OB0 B;  2K3X A;  3WXM B;  3HTR A;  1OPK A;  4X34 A;  5GMK h;  2HQH A;  2B86 A;  2K5I A;  2ROT A;  5LJ5 j;  2A37 A;  4PJO E;  4MZT A;  2V26 A;  4N4G A;  2CZ7 B;  1VIE A;  3VS0 A;  3JCM f;  4RG8 A;  4M7A E;  1RI0 A;  1VQ8 T;  2KYM A;  2LNV A;  2DYI A;  4M7A D;  5KYY B;  4M7D G;  1X2K A;  4LDV A;  2K2M A;  3EG3 A;  3L42 A;  2DEU A;  2CSI A;  3A8L B;  4C92 C;  4PJO F;  1O75 A;  4J9B A;  4N4I A;  2P4R A;  4JS5 A;  9ATC B;  4HA8 A;  4N0A C;  3H8Z A;  1U3O A;  1VQP A;  3I55 Q;  3H41 A;  1E7O A;  1YIJ Q;  5CKF A;  2M9U A;  5GAO m;  2OAW A;  2EYX A;  4L5G A;  7AT1 B;  3CCS A;  3JCM X;  1YJN T;  2FZC B;  1OPL A;  3DLM A;  2L3P A;  1IHW A;  4C5G A;  2E3I A;  5A0G A;  4F7U F;  2RK1 A;  1NE8 A;  3SDZ A;  5KYU A;  1G5V A;  3A8H B;  3JB9 F;  4KH0 B;  4AMC A;  3EGU A;  5CR2 A;  4EMK C;  3SFM A;  1YHQ Q;  2EYW A;  1Y7X A;  5KYX B;  2E41 A;  3OYI A;  2A0F B;  2OTL A;  2J05 A;  5EC7 A;  3G71 Q;  1MUZ A;  5CAI A;  2MAM A;  4FIB A;  4D8D A;  1KD1 R;  2E1H A;  2QGG A;  1JB0 E;  2F1L A;  4PJO C;  1N8R R;  4A4G A;  1YIJ T;  1M3A A;  4HCB A;  1B34 A;  2GCX A;  3QZ5 B;  1VQK Q;  1YJ9 A;  1D1C A;  3P8B B;  4C0Z A;  2XK0 A;  3MEV A;  1M90 C;  1TWB A;  1YJN A;  1O9S A;  2LQK A;  5GAN 3;  1VQM Q;  5LL6 S;  4Y92 A;  2HNI A;  5J26 A;  3CCE Q;  3DLL A;  2L8D A;  1ZUK A;  4DEY A;  1FX7 A;  2PTK A;  1Q7Y R;  2K4Y A;  2YRD A;  2D9T A;  2EQK A;  5GJW B;  1RAI B;  3CQT A;  1TXQ A;  2EPD A;  1WHG A;  4OF1 A;  2JTE A;  2CYZ B;  4AFQ C;  2YRC A;  4BD3 A;  1X6B A;  1VQM A;  4IUT A;  1IXD A;  1NM7 A;  1ZHI A;  2YXY A;  2GTO A;  2X9H A;  4OMN A;  1DJ7 B;  2A7Y A;  1QVF A;  4LNP A;  5CQX A;  2KXC A;  2K3B A;  2DIQ A;  4ESR A;  5GAO l;  2CUB A;  2JTF A;  1H92 A;  2LX7 A;  2QQ9 A;  4C5E A;  2XHC A;  2CDT A;  1VQ9 Q;  2HZY A;  4HT9 A;  5CO7 A;  4LUD A;  1VQP T;  3OYN A;  2VAS A;  4BE0 A;  2LZ6 B;  3E9G A;  3JCM c;  2XDP A;  2M02 A;  2EGA A;  3CD6 Q;  1VYV A;  4GLM A;  1M8M A;  1ZA1 B;  3ZFJ A;  4X9D A;  4M7A F;  3TU4 K;  5KYY A;  2D8H A;  2W10 A;  1VQL A;  3CCE T;  2FVU A;  3PE0 A;  2J6O A;  3J80 E;  3M55 A;  2FZK B;  4M75 A;  1YFN A;  2MPX C;  4M7D A;  1VQ5 T;  3VS6 A;  1UJ0 A;  2CS7 A;  3DKM A;  3CD6 A;  1YJW Q;  3CEY A;  4KRT A;  5GAN h;  2CP2 A;  2DBK A;  3CC4 A;  1NPP A;  3DB3 A;  1VQM T;  2AT1 B;  1PRM C;  3NMZ C;  4WTO B;  1K8A C;  1N27 A;  5LJ5 h;  4HCK A;  1NG2 A;  2L0A A;  3CCL A;  5FRO A;  1XTD A;  3CMA Q;  1RAA B;  3VJP A;  5J3B A;  3QJ6 A;  2LCS A;  2EVR A;  1OV3 A;  2EQU A;  1F1B B;  2FEI A;  3CPW S;  2K57 A;  2KBT A;  4YTL A;  3MHX A;  3QO3 A;  2HMA A;  1U8R A;  3FIF A;  4A53 A;  4F04 B;  1QQJ A;  1VQL T;  1VQ4 Q;  3OMG A;  4C5I A;  4PFZ A;  4BB7 A;  1NJI U;  4X9C A;  5IH2 A;  5IHN A;  3MEA A;  1VQP Q;  2LMJ A;  4FSS A;  1RI9 A;  1M90 U;  1VQ5 A;  1RAF B;  2E3H A;  4FYX B;  5ECA A;  1TTH B;  1IRX A;  2F5K A;  5D7U A;  4BDY A;  2VKN A;  4MMK A;  3A8G B;  2OJ2 A;  1HSQ A;  1X2Q A;  2JMC A;  4QT7 A;  2I0N A;  2RJD A;  5AT1 B;  2WAC A;  5DM7 R;  4LXC A;  4FU6 A;  1AT1 B;  1YIT Q;  3CCL T;  2FB7 A;  1KJW A;  2PUO B;  1W2B S;  1JJ2 P;  2KVQ G;  1YCY A;  2EGC A;  1VQ9 T;  3LWI A;  1NJI C;  1T3L A;  1K4U S;  1D3B B;  3VS1 A;  2V8K A;  4BY6 C;  2VWF A;  4KH1 B;  4M77 B;  3BDU A;  5GAO n;  1WZO A;  4HKE A;  2L3R A;  4BAC A;  2X35 A;  4QW2 A;  4E7J A;  1WJR A;  5D6W A;  3V8K A;  1UGQ B;  4KBM B;  4EMG A;  1MGQ A;  4ZTF A;  2KSS A;  3I56 Q;  4RTV A;  2K79 A;  4II1 A;  5CKE A;  2DF6 A;  4IUQ A;  1WA7 A;  3NPF A;  3EHR A;  2DL8 A;  3CC4 T;  3CC7 A;  3VYG A;  4LD9 K;  2OTL T;  2RA2 A;  1BKB A;  2DEQ A;  1M90 R;  1N9S A;  1G8X A;  2GFU A;  2LCC A;  1M8V A;  4MZM A;  1VUB A;  4HCC A;  3CCM A;  1HD3 A;  2A3L A;  4QQG A;  5GAO r;  3HRS A;  1I81 A;  3NTH A;  3CC7 Q;  5LJ3 h;  2CP0 A;  5KH6 A;  1C0M A;  5A2Q E;  3NGP A;  2CSQ A;  4IUV A;  5I2S A;  1X69 A;  5LJ3 g;  4N4H A;  4JDS A;  2RHI A;  4AFZ C;  4E7Z A;  3QYG B;  3CCM Q;  3OY9 A;  3VUZ A;  2JZ2 A;  1UTI A;  2D0Q B;  3QSU A;  4Z8A A;  1UG1 A;  1B07 A;  4DBR A;  1SPK A;  5GAM e;  3I56 T;  1VQ7 T;  5EG2 A;  4M75 E;  1WQW A;  2OI3 A;  2YT6 A;  2BIV A;  2QQS A;  3CCR A;  2A28 A;  3THK A;  2KGT A;  1TOV A;  3EHQ A;  4DOV A;  2RHZ A;  4DEX A;  2EKO A;  3EG9 B;  1ZUU A;  2KY9 A;  4HCZ A;  3CCU T;  3CCV Q;  5M9O A;  4BI8 B;  3MEU A;  1M9S A;  1AWO A;  5FWB A;  5IN1 A;  3G7Z A;  1PM3 A;  3EFS A;  4KGV B;  3E1S A;  2LQN A;  3VS7 A;  3OYF A;  2DA9 A;  2JT4 A;  2D0N A;  1QP2 A;  4M78 B;  4RCB A;  2J7I A;  2RN8 A;  2A36 A;  3CCL Q;  3EG1 A;  4PJN A;  4JRQ A;  2BKD N;  1K0X A;  2CZ6 B;  3UPU A;  4C92 D;  1PD0 A;  3JAM E;  1H8K A;  1LNX A;  2R57 A;  5GAN 7;  2MCN A;  2CP5 A;  3KBG A;  4HT8 A;  1PHT A;  3V7R A;  3PIO A;  2YUN A;  2I2L A;  3GP8 A;  4QVD A;  1R8O B;  2DVJ A;  1NEB A;  1KSW A;  2OX7 A;  1PC0 A;  1S1N A;  2EQI A;  2OTL Q;  2PVO B;  2X3W D;  4M77 F;  2JTM A;  2XG8 D;  2K5L A;  3M57 A;  3G71 A;  4RTW A;  3SB2 A;  2ENM A;  4PJO A;  3CC2 T;  3JCM P;  3BY7 A;  1PCX A;  2DTO A;  2DL4 A;  1VQN Q;  5J39 A;  1R0C B;  2EFI A;  3V7S A;  3VUB A;  2DE0 X;  1VQK A;  4KT0 E;  3OYY A;  1SF9 A;  2PUK B;  1YN8 A;  2H3J A;  2KRN A;  2GQI A;  2P4T A;  4C8Q B;  1AWW A;  2J06 A;  2C0O A;  5KYW B;  5GAM g;  3VS2 A;  1K9A A;  2KAF A;  3CCQ A;  2DK3 A;  1R77 A;  2KDS A;  1K8A U;  1VQN A;  1D0Y A;  3VKI A;  2HSP A;  3OYL A;  1AHJ B;  4MML A;  1E6H A;  2KXD A;  5GMK l;  2V1R A;  4RKU E;  4IIM A;  4IUP A;  1RUW A;  2QEX A;  2QA4 Q;  1M1K U;  1UGV A;  4GY5 A;  1YJ9 T;  3L2W A;  5GAN d;  3JB9 G;  1OOT A;  3GNG A;  2CGH A;  3OA6 A;  3AT1 B;  3I5R A;  2DER A;  1YJW A;  3M54 A;  5IXB A;  3CCS T;  3OYC A;  2CKK A;  1QKX A;  3M0S A;  3NTK A;  2EJF A;  2C0T A;  3MET A;  1W4S A;  2IVW A;  3OW2 A;  1Y57 A;  3RIR A;  2O9S A;  1T0H A;  2G6F X;  2K7A A;  2YUQ A;  3JB9 D;  1TH7 A;  1EX4 A;  2L5Q A;  1K1Z A;  4IUU A;  2BZX A;  2MYS A;  3M4G A;  1QWF A;  3EFO B;  2SEM A;  3MP1 A;  4QQD A;  1XOV A;  2EYZ A;  1TSF A;  2DD5 A;  2IG0 A;  2X4W A;  2CP7 A;  1WGS A;  1NJI R;  1K8A R;  2MF2 A;  1PSE A;  4M77 A;  3SWN C;  5GAM j;  1D09 B;  2X51 A;  4KUD K;  4M7A G;  3C12 A;  4FYV B;  1LOJ A;  3SD4 A;  4AFS C;  4BY6 B;  3QDR B;  4RG2 A;  1MV0 B;  1TG0 A;  3RNJ A;  4D6W A;  1WHM A;  2F2X A;  4A54 A;  1C6V X;  4J6W A;  2DYB A;  1I1J A;  2ECZ A;  3CXC A;  5GMK m;  1Q86 U;  3SHW A;  3FC3 A;  4C92 G;  3A8O B;  1UEC A;  3JCM W;  2DFU A;  2W0Z A;  1SRM A;  3OYE A;  4RTU A;  3HHT B;  3J81 E;  1WIE A;  2MIO A;  3C0C A;  4FYW B;  4PKC C;  1WDX A;  3M0R A;  1RAC B;  3ASK A;  1X75 C;  3JCM V;  4TVR A;  1U1T A;  2HL5 C;  2HQX A;  5L8R E;  5I21 A;  1S72 A;  1BI0 A;  3F70 A;  2BTT A;  4JRP A;  3ULR B;  1T0J A;  5GAO q;  2DAQ A;  5FU7 C;  4B9X A;  3OYK A;  4JJD A;  1GBR A;  1GFD A;  1YI2 T;  2RQW A;  3CCU Q;  3CCV T;  1TU0 B;  1WPY A;  2LC4 A;  4AG1 C;  4L59 A;  3EFO A;  5GAN 6;  2FL7 A;  2WSF E;  4EIK A;  4K11 A;  5GAM d;  3SWN A;  1EZZ B;  5LJ5 d;  1RLQ C;  3RES A;  3GLX A;  2DD4 A;  1QVG A;  2X4J A;  1QCO A;  1PG5 B;  5KE2 A;  4R0K A;  2R5M A;  5KYN A;  4J9D A;  4R55 A;  1YWP A;  1N8R U;  4E7K A;  1CKB A;  2MK5 A;  6AT1 B;  2E5K A;  1Q81 C;  4XU1 A;  1G3W A;  2KNB B;  1N5Z A;  2K6D A;  3N5B B;  2WSE E;  4ZN3 A;  3Q1J A;  3V8J A;  1M27 C;  3GNF B;  1GCQ C;  3CCR Q;  1KIK A;  4BDZ A;  2RB6 A;  1G3S A;  3CCJ A;  2JS2 A;  2CZ1 B;  3MPU B;  3G4S Q;  4CC2 A;  3MJX A;  2HQE A; 
#chains in the Genus database with same CATH homology
 1WNL A;  4MMK A;  2M1H A;  4ZGE B;  1EIF A;  3GOX A;  3A8G B;  4EMK A;  1QVG S;  1BYM A;  3CCV A;  3OYD A;  1G3T A;  2E64 A;  2RJD A;  1QVF S;  1Q86 C;  3UDC A;  4QVC A;  5LJ5 g;  2WAC A;  5DM7 R;  4FU6 A;  2DTI A;  1IRE B;  3FRN A;  2L89 A;  2Y4Y A;  4LD6 A;  4BUG A;  4MDX A;  3MP8 A;  3CCL T;  4JJN K;  2FB7 A;  1VQK T;  2RI3 A;  3QHS A;  3JCM e;  2PUO B;  1W2B S;  3FJP A;  4FSX A;  2KVQ G;  3JB9 H;  5GAN g;  4XU2 A;  2ZPB B;  1YCY A;  3X28 B;  5GAN 4;  2ZPH B;  4RMO A;  2QTX A;  2GQV A;  4FM4 B;  1WJS A;  2B8A A;  2GFA A;  1VQ9 T;  3HSB A;  3LWI A;  1NJI C;  3C4S A;  3EFR A;  4MDW A;  4NL3 A;  1Y07 A;  2P0K A;  3QXE B;  1KQS A;  4NOY A;  1YIJ A;  1D3B B;  3C94 A;  2V8K A;  4BY6 C;  4F7U B;  5GAO n;  4M77 B;  3BDU A;  3OS5 A;  4A4E A;  3S3O A;  3CCU A;  1VQN T;  4M7D D;  4HKE A;  2L3R A;  4QQ6 A;  3JCM g;  1N8R C;  4BAC A;  4DA4 A;  1K73 C;  3G6E T;  2X35 A;  2QXF A;  4J83 A;  4QW2 A;  2OTJ T;  3OB9 A;  1WJR A;  4O5V A;  5D6W A;  3V8K A;  4F7U G;  4E7J A;  2RH2 A;  1JBM A;  3OYG A;  3CCJ T;  4LDW A;  1KQ2 A;  3V7C A;  3PFS A;  2ZCF B;  1YIT T;  1UGQ B;  4KBM B;  4EMG A;  2PVG B;  1V29 B;  4ELZ C;  3E19 A;  2VV5 A;  1M4Z A;  1MGQ A;  4ZTJ A;  2JVV A;  1KC8 U;  3JCM Q;  3HKS A;  4ZTF A;  2KSS A;  3M5A A;  4JUV A;  3L1A A;  4M75 C;  2LQ8 A;  3QII A;  4II1 A;  3PT9 A;  4KUL A;  2R5A A;  2RO0 A;  3BFM A;  5CKE A;  1YJW T;  4IUQ A;  3NFC A;  3URG A;  1M1K C;  3CC4 T;  5HKC A;  3HRU A;  1FWZ A;  2EJG A;  2Y4X A;  3VYG A;  3CC7 A;  5HK3 A;  3CCM T;  2OTL T;  4LD9 K;  3X26 B;  2RA2 A;  1BKB A;  2DEQ A;  2QQB A;  4OVA A;  4VUB A;  5CKH A;  5GAN e;  5DLO A;  3CCR T;  4E7L A;  3HFN A;  1N9S A;  2DPP B;  3CBO A;  2G3R A;  1WQ7 A;  2GFU A;  5A0L A;  4DOW A;  2RI5 A;  2LCC A;  1S72 T;  4XTY A;  3BW1 A;  4EDU A;  5CCA A;  1M8V A;  4MZM A;  4OB1 B;  3JSC A;  4PLI A;  1VUB A;  5DLQ E;  4ZGD B;  4ZN1 A;  3JB9 I;  4HCC A;  4ZGJ B;  3CCM A;  2MI6 A;  1B34 B;  3QKJ A;  4M78 A;  3JCM J;  2ZZD A;  3KUF A;  4BE1 A;  2A3L A;  4QVZ A;  5CKB A;  4BI4 A;  4QQG A;  5GAN 2;  5GAO r;  3HRS A;  1I81 A;  3NTH A;  1YHQ T;  2GF7 A;  3JB9 J;  3P8H A;  3T9N A;  5LJ3 h;  2EQM A;  2MWP A;  3QZ9 B;  2RJC A;  1IZ6 A;  2K2V A;  3FLG A;  1KHI A;  5KH6 A;  5A2Q E;  1VQO T;  1XQH A;  2ZPE B;  3BDL A;  1M5Q 1;  4IUV A;  4F7U E;  5IAY A;  5LJ3 e;  3G4S T;  2QA4 T;  5I2S A;  1VIF A;  1I8F A;  4M7A C;  5LJ3 g;  3M53 A;  4IUR A;  4N4H A;  2K5F A;  2CZ0 B;  4JDS A;  3X20 B;  2EAY A;  4JLI A;  3G6E A;  2RHI A;  3CME T;  4M7D F;  2M0O A;  3LWH A;  3QYG B;  2O4X B;  3AHU A;  3OY9 A;  3VUZ A;  3GIB A;  2JZ2 A;  1RL2 A;  1X6O A;  2D0Q B;  3INZ A;  3RUX A;  2LTO A;  1U1S A;  1Y96 B;  4L6V 5;  1OZ2 A;  4MZP A;  3OYM A;  1Q7Y C;  3QSU A;  3VYH B;  3TEE A;  5DY9 A;  3I55 T;  1BI2 A;  3CCE A;  3I56 T;  2X4X A;  1KHC A;  4XTW A;  2VXF A;  3RKW A;  5GAM e;  5GMK i;  1VQ7 T;  2RHU A;  2HD0 A;  5EG2 A;  1NZ9 A;  3PTA A;  2M16 A;  4M75 E;  4XTZ A;  2C06 A;  2FHD A;  1WQW A;  2ZPI B;  2BIV A;  1KQ1 A;  2QQS A;  3OS1 A;  3CCR A;  1YBY A;  4M75 F;  3ZEH A;  2DTH A;  4XTV A;  5HK0 A;  3E9F A;  4M77 C;  4DOV A;  3CMA T;  1Q7Y U;  4ME7 A;  2RHZ A;  4PJO G;  1HK9 A;  3QJY A;  3LGL A;  4C0D C;  2DZ9 A;  2EKO A;  4FT2 A;  4Y28 E;  4C8Q F;  2KY9 A;  3HRT A;  4HCZ A;  3L2Z A;  3LLR A;  4M78 D;  1BIA A;  2EYQ A;  5M9O A;  3CCU T;  2HAX A;  2D6F A;  4E7I A;  1YHQ A;  5FLX E;  4BI8 B;  3MEU A;  3FB9 A;  4M78 E;  2V8J A;  2ZPF B;  1M9S A;  2VUB A;  3QUI A;  3P8D A;  3JCM h;  3V8L A;  2LT1 A;  2WSC E;  4JLG A;  5IN1 A;  1VQ8 A;  3M59 A;  3G7Z A;  2KMT A;  2VGN A;  3EFS A;  4FT4 A;  3E1S A;  3UT1 A;  3OYF A;  5GAN 8;  2QQA A;  3S3M A;  4JRK A;  1QP2 A;  4M78 B;  4RCB A;  1UGR B;  3FEO A;  1WJQ A;  3ER0 A;  2LRQ A;  4B9W A;  4C92 F;  1HXD A;  4RCC A;  5LJ3 j;  4ATO A;  3OYA A;  1PSF A;  4JRQ A;  1K73 U;  2LVM A;  2BKD N;  3OYH A;  2CZ6 B;  4C92 E;  2JNG A;  3MO8 A;  3QYH B;  4M77 G;  1X01 A;  3X24 B;  4C92 D;  3UPU A;  4C8Q E;  2E5Q A;  1VQ4 T;  4M7D C;  3JAM E;  2E6Z A;  5D6X A;  4V2S A;  3H6Z A;  1LNX A;  1SSF A;  3EAE A;  2R57 A;  2DZC A;  3HL8 A;  5GAN 7;  3OYB A;  3HP9 A;  5GAN f;  4E7H A;  3LH0 A;  3KBG A;  1KQS S;  4UC4 A;  4M7A A;  4C8Q G;  5HY6 A;  4C0G A;  4HT8 A;  2E65 A;  2RD1 A;  3V7R A;  4C0D B;  5A0D A;  3LGF A;  4NL2 A;  3PIO A;  1M1F A;  3NTI A;  5FU6 B;  4F7U A;  4A4F A;  3L2R A;  2EQJ A;  2I2L A;  3WVE B;  4QVD A;  3GP8 A;  1VQ4 A;  1R8O B;  4OB0 B;  2E10 A;  1OYX A;  4M7A B;  2K3X A;  3WXM B;  4A4H A;  4X34 A;  5LJ5 f;  1BI1 A;  5GMK h;  3RKY A;  2K5I A;  4XK8 E;  2PVO B;  5LJ5 j;  4PJO E;  4M77 F;  5KCO A;  4MZT A;  1N6A A;  2JTM A;  2XG8 D;  2CZ7 B;  1VIE A;  3A5Z B;  2K5L A;  3M57 A;  4N4G A;  4C5H A;  3G71 A;  4OB2 B;  3SB2 A;  3JCM f;  4O6J A;  4RG8 A;  4PJO A;  3RER A;  1RI0 A;  3CC2 T;  3JCM P;  4M7A E;  2OAU A;  3BY7 A;  2RJF A;  1VQ8 T;  5D6Y A;  2DTO A;  2LNV A;  3CPF A;  4P5N A;  5J39 A;  4M7A D;  3KXT A;  2VC8 A;  2EFI A;  3QBY A;  4Z02 A;  3CMA A;  4M7D G;  3V7S A;  3VUB A;  4N0A A;  3G71 T;  1P92 A;  3PGG A;  4J6Y A;  2MMP A;  3UWN A;  1VQK A;  5KCH A;  2EWN A;  4KT0 E;  3PMI A;  3OYY A;  4JRI A;  1JJ2 A;  4LDV A;  4C92 A;  2PUK B;  5GMK j;  2H3J A;  1YIT A;  2P4T A;  4C8Q B;  4CI0 C;  2HBP A;  5AYF A;  3L42 A;  2QA4 A;  1KG1 A;  2RI2 A;  1VQ9 A;  1UEB A;  5GAM g;  3CCQ A;  4FL6 A;  2KAF A;  3L2U A;  4PJO D;  2DK3 A;  3A8L B;  3LW5 E;  4C92 C;  2KDS A;  1K8A U;  1VQN A;  5KE3 A;  4PJO F;  1O75 A;  3VKI A;  3OYL A;  4N4I A;  4JS5 A;  1AHJ B;  4MML A;  4HA8 A;  4N0A C;  2XIC A;  3R6O A;  5GMK l;  3H8Z A;  3CCQ T;  1VQP A;  4RKU E;  1H64 1;  4IUP A;  3OBW A;  5C0M A;  2QEX A;  3CD6 T;  5CKF A;  4E47 A;  1M1K U;  2M9U A;  5GAO m;  4M78 C;  2DO3 A;  4L5G A;  4GY5 A;  1YJ9 T;  3L2W A;  4OGE A;  5GAN d;  2YLC A;  3OMC A;  4XQ3 A;  3GNG A;  4J7I A;  3CCS A;  3JB9 G;  2DJZ A;  2DXB A;  2CGH A;  3JCM X;  2R58 A;  3CME A;  3OA6 A;  1YJN T;  2XU8 A;  4GLK A;  3RMS A;  3DLM A;  5LJ5 e;  1YJW A;  3M54 A;  2V8I A;  1QW1 A;  3CC7 T;  2PU9 B;  3M56 A;  2DXC A;  4EMH A;  3I55 A;  3OSS C;  3CCS T;  3OYC A;  4C5G A;  2CKK A;  5A0G A;  4F7U F;  5CKD A;  4OP0 A;  4BE2 A;  2RK1 A;  3NTK A;  1KC8 C;  1MHN A;  1NE8 A;  2NLU A;  2AHJ B;  2EJF A;  3LYI A;  2DXU A;  3MET A;  3M4Y A;  3SDZ A;  1G5V A;  3A8H B;  1BIB A;  1W4S A;  3JB9 F;  2IVW A;  5C6S A;  1QVP A;  5CR2 A;  4EMK C;  3OW2 A;  3RIR A;  1Y96 A;  4OMF B;  3SFM A;  4PJO B;  3S6W A;  5CK9 A;  3JB9 D;  1TH7 A;  4C8Q A;  2PVD B;  5GAO p;  2OTJ A;  1Y7X A;  3JRZ A;  2E41 A;  2L5Q A;  4R56 A;  3OYI A;  2F69 A;  4XU0 A;  2YHT A;  4M75 B;  4IUU A;  3DB4 A;  5CQY A;  2OTL A;  3JCM b;  4M7D B;  3PIP A;  3M4G A;  3GF5 A;  3MP1 A;  4M75 D;  4QQD A;  2RHX A;  2KK4 A;  4BI3 A;  2XDB A;  2X4Y A;  5CAI A;  1H3Z A;  1I5L A;  2MAM A;  4FIB A;  3L2Q A;  1XOV A;  4PL6 A;  2E1H A;  2P0P A;  1JB0 E;  3CBM A;  3OS2 A;  4PJO C;  1UGS B;  4WF2 A;  4A4G A;  3MEW A;  1YIJ T;  1K9M C;  4HCB A;  2LT4 A;  1B34 A;  2GCX A;  3QZ5 B;  3GPL A;  1YJ9 A;  2Y90 A;  3P8B B;  2DD5 A;  2IG0 A;  2VXE A;  2X4W A;  4C0Z A;  4XU3 A;  3I56 A;  2XK0 A;  1N9R A;  2P0Q A;  2DXT A;  3MEV A;  1M90 C;  1WGS A;  2XD0 A;  1VQ7 A;  1VQO A;  1YJN A;  1O9S A;  3RKX A;  2LQK A;  5GAN 3;  3G4S A;  2MF2 A;  4XTX A;  2QQR A;  1PSE A;  3J7A F;  4M77 A;  3SWN C;  5GAM j;  5LL6 S;  4C92 B;  2DIG A;  2HNI A;  3OSV A;  5J26 A;  1VQ6 T;  4LDY A;  1YI2 A;  3DLL A;  4KUD K;  2L8D A;  2XKO C;  1FX7 A;  5IT9 E;  2VGM A;  4M7A G;  2K3Y A;  3C12 A;  2K4Y A;  1I4K 1;  1LOJ A;  1M1G A;  2D9T A;  4OB3 B;  2EQK A;  3MP6 A;  1W2B A;  4PNO A;  3SD4 A;  4BY6 B;  3QDR B;  4RG2 A;  1Q81 U;  4XAX B;  1VQ6 A;  2DVE A;  4OF1 A;  2CYZ B;  4BD3 A;  1VQM A;  4D6W A;  3SWN B;  4IUT A;  3PMT A;  1ZHI A;  5FU6 C;  4A4K A;  5GAN 5;  4A54 A;  1DJ7 B;  2A7Y A;  2JOY A;  2BUD A;  1QVF A;  4M7D E;  2RJE A;  3OS0 A;  2KQW A;  5CQX A;  5FRN A;  2YLB A;  3QPH A;  4J6W A;  5FU7 B;  3CC2 A;  3CBP A;  2MWO A;  2DIQ A;  5GAO l;  2E70 A;  2JTF A;  4C8Q D;  2QQ9 A;  5CIU A;  3CXC S;  3HFO A;  2RHY A;  2XHC A;  2ZPG B;  3RMQ A;  4C5E A;  3CXC A;  1ZBX A;  5GMK m;  1Q86 U;  5GAM f;  4NS5 A;  3FC3 A;  2O01 E;  3TCJ A;  2XID A;  4M77 D;  2VYT A;  4C92 G;  3A8O B;  4HT9 A;  5CO7 A;  1VQP T;  4Q5W A;  3OYN A;  5GAN j;  3VV0 A;  4EMK B;  4BE0 A;  3E9G A;  3JCM c;  3JCM W;  4M77 E;  2XDP A;  1OZ3 A;  3OYE A;  3OBY A;  3OW2 S;  3TRE A;  3HHT B;  2XDD A;  3ZFJ A;  3J81 E;  3M9Q A;  4X9D A;  4M7A F;  3TU4 K;  4DQ2 A;  4PKC C;  1D3B A;  1VQL A;  3A8M B;  3M58 A;  3FDR A;  4XTU A;  3C95 A;  4J6X A;  1LJO A;  3ASK A;  1X75 C;  5LJ3 f;  3CCE T;  3JCM V;  4TVR A;  2FVU A;  1U1T A;  4PLL A;  3O8V A;  3ZBD A;  4KUI A;  2HQX A;  4CRI A;  1JJ2 S;  5L8R E;  5I21 A;  1S72 A;  2LX9 A;  3M55 A;  3J80 E;  1KD1 C;  4IKF A;  4M75 A;  3WVD B;  1BI0 A;  3F70 A;  4JRP A;  2EIF A;  4M7D A;  2XI9 A;  1VQ5 T;  5CVI A;  4M78 G;  2QEX T;  2CS7 A;  3DKM A;  3CD6 A;  1GXI E;  1UGP B;  5GMK e;  2ZGW A;  5GAO q;  3CEY A;  2FYK A;  2O4X A;  5GAN h;  3CC4 A;  1NPP A;  2DAQ A;  2QI2 A;  5FU7 C;  3DB3 A;  4B9X A;  1VQM T;  4ELY C;  3OYK A;  3LX7 A;  3ME9 A;  5LJ3 d;  4J8O A;  2QDY B;  1Q82 C;  1YI2 T;  4J7F A;  2EJ9 A;  2JN0 A;  3CCV T;  1BI3 A;  1UB4 A;  1WPY A;  2LC4 A;  1FXX A;  4L59 A;  5GAN 6;  1N27 A;  4C8Q C;  3JCM d;  1K8A C;  2FL7 A;  2WSF E;  5LJ5 h;  5GAM d;  5I2M A;  3CCL A;  1NPR A;  4M75 G;  3SWN A;  5FRO A;  1XTD A;  1ZQ1 A;  4C0F A;  5LJ5 d;  3GLX A;  3RES A;  3VJP A;  5J3B A;  2DD4 A;  3QJ6 A;  5GAM h;  2X4J A;  1QVG A;  2EQU A;  3L2V A;  4LDU A;  3CPW S;  5KE2 A;  2K57 A;  1KD1 U;  3OYJ A;  2R5M A;  3MHX A;  3MCA B;  3QG1 A;  3QO3 A;  4YTL A;  4R55 A;  1N8R U;  1U8R A;  4E7K A;  2LDM A;  4M78 F;  1OI1 A;  3FIF A;  4A53 A;  4EPC A;  1Q81 C;  1VQL T;  4XU1 A;  1XNI A;  3PNW C;  1G3W A;  2DKG A;  2F5T X;  2JUF A;  2RK2 A;  1QP3 A;  3OMG A;  4C5I A;  4BB7 A;  1NJI U;  1K9M U;  3N5B B;  2WSE E;  4ZN3 A;  4J5Y A;  1G3Y A;  3Q1J A;  4OGC A;  4X9C A;  3V8J A;  3S3N A;  2YRV A;  4Y91 A;  4LDX A;  3GNF B;  3MEA A;  2RM4 A;  1M90 U;  1VQ5 A;  4JS4 A;  4BDZ A;  2RB6 A;  3VU3 C;  1G3S A;  2PQW A;  5FRM A;  2E12 A;  3CCJ A;  2CZ1 B;  1JRI A;  3X25 B;  1Y71 A;  2LCL A;  2F5K A;  3OQ5 A;  1Q82 U;  3CPW A;  4BDY A;  2HQE A;  2E6N A;  3HPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...