4M7DE

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 77
sequence length 82
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dE00
4M77C 4EMHA 1H641 2EWNA 4JRKA 4M77A 4M78B 1X01A 3VU3C 5LJ3f 5GMKl 4M78A 5LJ5j 1WNLA 4M7DG 4RCCA 3V8JA 4M7DF 2E1HA 4M75B 4J5YA 3JB9F 4XTUA 3JCMc 4M7DD 4X9CA 4M7AE 3QHSA 4M7DE 3JB9D 4XU2A 1B34B 3JCMJ 2VXFA 3JCMX 5GANf 4N0AA 4M78F 4C8QC 4JRIA 4C8QA 4M75G 5GAN6 4NL3A 1BIAA 4M78D 4C92G 2DVEA 3JB9J 3HFNA 4M78E 5LJ5e 3BW1A 2RA2A 4EMKC 5GAMd 2YLBA 4XTYA 4XTZA 3AHUA 1N9RA 1I5LA 5GAMg 5GAN7 1I4K1 4M75E 3RKWA 4HT8A 4EMGA 4PJOA 2RB6A 4C92E 3RUXA 2DTIA 4M77B 3JCMf 2CGHA 5GAN3 5LJ5h 2I2LA 5CAIA 3JB9G 3RERA 3JCMV 3RIRA 3JCMP 2FB7A 5GAOr 5GAOm 1Y96A 2E41A 3BY7A 1YCYA 1U1TA 2E10A 4NL2A 3V7SA 5LJ3j 2JN0A 1U1SA 4XTXA 4M77G 3RKYA 3V7RA 4PJOF 3JB9H 4M78G 4HT9A 2E64A 4OP0A 4QVDA 5GAN2 4M7AC 4M77F 4PJOD 3EFSA 1N9SA 2YLCA 3BFMA 4JUVA 4C8QB 4F7UB 5GAOq 3QO3A 4J6XA 4M77D 1I81A 4F7UA 5GAN4 4M77E 5GMKj 1TH7A 3FIFA 5GANj 4EMKB 2EJFA 4EMKA 3JB9I 3FJPA 2RD1A 4XU0A 4PJOB 5GAN5 3JCMe 2DXTA 4C8QG 4J6YA 5LJ3e 1LOJA 4M75C 4C8QF 4F7UF 5LJ5d 2DXUA 2FYKA 4C92C 4WF2A 5GMKi 5LJ5g 2EAYA 3RKXA 1HK9A 4Y91A 5GAN8 2HNIA 4C8QD 1JBMA 4DQ2A 3JCMb 1Y96B 4C8QE 4F7UE 1WQ7A 3JCMh 4PNOA 4JLIA 4PJOG 2DZ9A 3SWNA 3JCMg 1MGQA 5GAOl 2EJGA 2RM4A 5LJ3h 3JCMW 5GMKe 5GAMf 5LJ3g 1WPYA 2DEQA 1D3BA 4QVCA 4M7AB 1KQ1A 3PGGA 5DY9A 5GANe 4M7AA 4HA8A 4NOYA 4M7DA 1HXDA 3L2ZA 4M7DC 2QTXA 4X9DA 4PJOE 5GAOn 5GAMj 2E65A 1BIBA 3V7CA 2Y90A 4XU1A 3V8LA 5GMKh 3EFRA 3RESA 2DTOA 3SWNC 2YHTA 5I21A 3GIBA 3L1AA 5GMKm 5GANh 2VC8A 3M4GA 5GANg 4MMLA 4M78C 2ZGWA 4A54A 4RCBA 4F7UG 4M7AF 3HSBA 1LNXA 1I8FA 2K57A 3JCMQ 1LJOA 4M75A 3SB2A 4C92B 4M7AD 4J6WA 4C92A 1KQ2A 4XTWA 1M8VA 3V8KA 3JCMd 4MMKA 2VXEA 4A53A 2EJ9A 1B34A 2DJZA 3BDUA 1WQWA 4N0AC 1JRIA 5LJ3d 5GAMe 1M5Q1 1D3BB 2DZCA 3INZA 4M7DB 4M7AG 4V2SA 3QSUA 4M75F 4XTVA 3QUIA 4XU3A 4C92F 5LJ5f 3HFOA 4M75D 3FB9A 4XQ3A 2DKGA 5GAMh 5GAOp 4C92D 4PJOC 3SWNB 5GANd 2DTHA
chains in the Genus database with same CATH superfamily
1H641 3GNFB 4FM4B 1N5ZA 4RCCA 1QVPA 1VIFA 1WHKA 2K5IA 1AWOA 2COYA 1RACB 1T3LA 2P0QA 4RTYA 3HFNA 4DBHA 1KSWA 1UGQB 2LNHB 2C0OA 4CC2A 5GAN7 4Z89A 2M02A 2RPNA 1R77A 1UB4A 2HD0A 1X6BA 3KUFA 4E7IA 3OYIA 1YCYA 1T0JA 1G83A 1U1TA 1OPLA 3OYCA 2XDDA 4VUBA 4PJOD 1M1GA 2L3PA 4JPBW 4QQDA 1MNEA 2JZ2A 1EX4A 4AFUC 2DA9A 1QWFA 4MZMA 1Q7YU 3E1SA 2KI7A 3R6NA 2V1RA 2M51A 2YRDA 1WHHA 4L6V5 3VS3A 5LJ3e 5LJ5g 3RKXA 1LPLA 3JCMh 1K4US 2K6DA 3E9GA 2RM4A 2D0NA 1ZSGA 1YITA 4M7AB 1VQ8Q 4HCCA 1WJSA 3M9QA 4LNPA 1GFDA 4XU1A 2A28A 2WSEE 4C0ZA 2ENMA 3EHRA 3M4GA 2B8AA 1QCNA 4D6WA 4OMQA 2RHZA 2CUBA 5EC7A 2XD0A 3VS2A 5HCKA 4N0AC 1ABQA 5C6SA 2GF7A 1M90U 2F5TX 4XU3A 3TEEA 4XQ3A 4PJOC 1OYXA 3SWNB 2JJ9A 5GANd 4LDYA 3LWIA 3PTAA 2DL7A 4L59A 2LT1A 2DETA 3M0SA 1NEGA 4QQ6A 1WHGA 2CT4A 2JVVA 4E2FB 2EPDA 3G7ZA 3JCMX 1RAHB 1O9SA 2DBKA 2E3HA 2M0OA 4YTLA 2O88A 2VVKA 5I2MA 1N9RA 3I56T 5GAMg 1AT1B 4KUIA 3NPFA 3OQ5A 4MZTA 1YJWT 3SD4A 4LN2A 2JMCA 2EBPA 1F1BB 3M56A 2LNVA 1N27A 3JB9H 4OP0A 1M3BA 3CXCA 4ORZA 1KQSP 2YLCA 4IUVA 3MP8A 5GMKj 5KYYA 3OYJA 4OGCA 4KGXB 2D9TA 1VQ6A 4PJOB 2KROA 3JCMe 5FRNA 1PD1A 3ME9A 3P8DA 2DL4A 2MAMA 5LJ5d 1W2BA 1M1FA 3TSWA 4FCYA 1K9MC 2J6FA 4F7UE 1WXBA 2KGTA 4Z02A 1M27C 2CREA 1Z9QA 1NYGA 2LC4A 3E19A 2QTXA 2BZYA 5I11A 2RHYA 4J9GA 1SF9A 3RESA 4DBQA 2SEMA 1VQ8A 1QCFA 4A54A 3EG0A 1Q7YR 1N8RR 2KYMA 3QYGB 1Q86U 2XI9A 1B7TA 1QWEA 2DNUA 4PLLA 3V8KA 3M53A 4E47A 3OW2S 2LZ6B 1KD1R 2MYSA 1G2BA 4EIKA 4V2SA 1GFCA 2A37A 5LJ5f 1X2QA 3X25B 2EWNA 1X01A 2BTTA 2W10A 1BI2A 2RHIA 2DERA 3PT9A 1M1KC 2DF6A 3OYKA 4KUDK 1VQ9T 1IRXA 2LMJA 1WFWA 3CMET 4OMLA 1PNJA 1TU0B 4A63B 4XTYA 5GAMd 2DD5A 3WXMB 3C95A 3RKWA 1N6AA 1Q81R 1PM3A 3JB9G 3OS2A 2P0KA 1BK2A 2E70A 3GLXA 3OYFA 2A3LA 3CC2Q 1NJIU 3ULRB 1SG5A 2JNGA 2KQWA 1Y57A 5IHKA 2AK5A 2LCLA 2VUBA 3T9NA 3D7SB 3S3NA 4J6XA 3M59A 2IPOB 1NPPA 2X51A 1NG2A 5GANj 1TUCA 1QLYA 4E7ZA 1D0ZA 2MK5A 4HXJA 2LQWA 4II1A 3EGUA 3DKMA 1I5OB 2KEAA 5GAMf 1WPYA 3QWXX 2LJ3A 5DY9A 1AZEA 2O4XB 4KH1B 3EAEA 2Y90A 1QKXA 2DTOA 2QQ9A 1IHWA 2QQSA 1BBZA 1ZHIA 4JJBA 2KYBA 3LLRA 2MWPA 1UDLA 4F7UG 4M7AF 3CPWA 4FSSA 4AFQC 2IG0A 2LX7A 5A2QE 1WLPB 2DJZA 1VA7A 1YIJT 1QVGP 3O5ZA 2FL7A 1PKTA 1WIEA 3VRYA 3VKIA 4F16A 2VWFA 4FU6A 1AVZC 2YT6A 4JJNK 4EMHA 3H8ZA 3E2UA 5LJ5j 4M78B 1WHMA 5D6YA 1R0BG 4OF1A 3KXTA 2E1HA 3J81E 1K73U 5CKBA 3RR6A 4CRIA 4WTOB 2QEXT 2KRSA 4QT7A 2X4JA 4M75G 4ELZC 1YJWQ 1TTHB 2YXYA 2YLBA 3VS4A 3EGDA 1KQSA 5D7UA 1M30A 1RLQC 3REBB 3RERA 3JCMV 2RHXA 1ZSZB 2FB7A 5GAOm 3DLMA 1SSHA 3C4SA 4B9XA 1H92A 2KXCA 3MCAB 2JN0A 1WXUA 2J6OA 2XG8D 1YFNA 3CC2A 4M77E 1D1AA 3M0TA 1YP5A 5KYUA 2RD1A 2EYWA 1D1BA 1UEBA 2DXTA 4E6RA 8ATCB 1RAEB 1LCKA 3FJ5A 3ZFJA 5C0MA 2Y4YA 1PRLC 4BE0A 2FZGB 1U8RA 2LQNA 4PNOA 5IXBA 3M54A 2DZ9A 1K0SA 5J39A 2YSQA 1XJWB 3G6EQ 5FU6C 1Q82U 2YUQA 1H3ZA 4M7AA 4M7DA 3A8GB 3M55A 5GAMj 5KYYB 2QGFB 5GMKh 1WI7A 3FEOA 3NTKA 4LDWA 3CD6Q 1ZUYA 2QQRA 3OYHA 1QVFP 2GNCA 2D1XA 1M8VA 2GQIA 4IIMA 3EH1A 2EJ9A 1W6XA 3UA6A 2J7IA 3BDUA 2F2XA 1VYVA 4P5NA 4WCIA 3CC4T 1K0XA 2DKGA 1W2BS 4KGVB 3SWNA 1ZA2B 1KJWA 1BI3A 2P0PA 3OA6A 1Y71A 2E4HA 3JCMc 1XTDA 4CC7A 2EVRA 3CMEQ 2PVGB 1I0CA 1D0YA 1NE8A 2JTFA 1YCSB 4C8QA 4BD3A 2K5LA 2DE0X 2DVEA 1G3YA 2XHCA 3QYHB 4XTZA 1FMKA 4E7HA 4EMGA 1K9MR 4J9EA 1TS9A 2ESWA 1YJWA 2E41A 1PCXA 2HSPA 4DOVA 2LT4A 1Q7YC 4X34A 1UHCA 4EDUA 3EFSA 2XKOC 2CH4A 3NFCA 5J3BA 2QYZA 3FIFA 4UC4A 1P92A 3EH2A 1K1ZA 1GL5A 2HNIA 2G3RA 1WQ7A 2J06A 1NBEB 5GMKe 2BKDN 1RL2A 2FEIA 1VYUA 1FMWA 3V7CA 3G6EA 4LDVA 2O9SA 3EFRA 5GMKm 5GANh 2GBQA 5KYNA 5ECAA 5IH2A 1QVGA 3VS1A 3MEWA 1UECA 4KH0B 1YIJQ 4M7AD 4J6WA 4XTWA 3CXCP 1M3AA 1D1CA 3CD6A 1NYFA 1Q81C 4ESRA 1JRIA 1OV3A 4GBQA 2QGGA 4QVZA 4DBFA 2DMOA 2QAZA 3OSVA 2KT8A 1YHQT 4LDUA 4B9WA 3HHTB 3G4ST 1YI2Q 2CDTA 2QEXQ 4FYXB 1VQOT 2LVMA 2HAXA 2CP3A 1E7OA 1TUGB 1KHIA 2CP0A 2OAWA 4XU2A 3I55T 1VQPQ 1W4SA 3PIOA 3UPUA 4M78F 3JV3A 1JU5C 2CP2A 2NUTB 4C92G 3CMEA 2O2OA 4XAXB 1B07A 1PC0A 3IQLA 2F2VA 5LJ5h 1WDXA 4BUGA 3OYLA 1X6GA 2RJCA 5CAIA 3L2QA 2EYXA 1WYXA 3A5ZB 3G71Q 3RKYA 4M7AC 1NLPC 2CSQA 1Y07A 3ZEHA 4BE2A 2RI5A 1JXMA 2MWOA 1TH7A 4C5IA 2DLPA 3EGDB 2HDAA 1S72Q 1YNZA 4KT0E 4IUTA 5GMKi 5GAN4 2BE9B 2WACA 3TCJA 1K8AR 1QVFA 1C1AA 3JRZA 5LJ3g 5GANe 1KQSS 2FPFA 1J3TA 1U3OA 2O4XA 5GAOn 1Q86C 4RUGA 3CC2T 3SWNC 4DEXA 1C6VX 3H41A 4JJCA 5KYUB 2VC8A 2QG9B 4AG2C 5KH6A 5L8RE 1NPRA 2YWWA 3CC4Q 1FMVA 4E7LA 1KQ2A 3MHXA 4MMKA 1RLPC 2VV5A 5I2SA 4K11A 1YIJA 4M7DB 5CK9A 4J9CA 3I35A 2FG0A 2RNAA 5GAMh 5GAOp 2G6FX 1KC8U 3CCET 4M78A 2EKOA 4ZTFA 2RQVA 3V8JA 3CBPA 4C0DB 1SRMA 5FU7B 3LYIA 3THKA 3H0IA 3C12A 2ECZA 2QEXA 3JCMJ 3MEUA 2R5AA 3L2WA 2CH4W 1BIAA 3I5RA 5LJ5e 3HRTA 2RF0A 2K2MA 1VQPA 3CPWP 1PSEA 2D0QB 1I5LA 1NZ9A 2HQHA 2CGHA 3PIPA 2MI6A 2XICA 1OU9A 3X24B 1V29B 2FZKB 1ZSZA 1VIEA 1A0NB 2CP6A 3QDRB 1U1SA 4ZN3A 2YUOA 3HKSA 4QVDA 1KK7A 3BFMA 4C8QB 1H3HA 2EQIA 3RDVA 3G71A 4OMFB 2A36A 4AFSC 1IZ6A 1QW1A 4OMMA 2H8HA 1GRIA 1MHNA 2RK2A 2X4WA 3A8LB 1S72A 4PJOG 3JCMg 1ZBJA 5GAOl 3EG1A 4BY6B 2K9GA 4F14A 1XNIA 3O8VA 2GFUA 4JRQA 1OX8A 3OS5A 2GQVA 2YRCA 1X6OA 1ZQ1A 1X43A 3L1AA 3NTIA 4A4GA 1TXQA 4RCBA 1I8FA 2ZPHB 2K57A 3JCMQ 1ZLMA 5FWCA 3N5BB 4J7IA 4LXCA 5GAMe 1M5Q1 1YHQQ 1ABOA 3X20B 3CC4A 3G4SQ 2V8JA 2L89A 3ER0A 3QJYA 5A0DA 1VQOQ 2D8JA 3G6ET 2O01E 1K73C 3UF4A 3OY9A 4JRKA 1FX7A 2LX9A 3I55Q 5LJ3f 1GBRA 1G3TA 3FDRA 2ZAEA 4XTUA 2LQKA 4ZNXA 2AHJB 3CEYA 3CD6T 3NGPA 4RTUA 3HRSA 3QZ9B 3MPUB 4C5HA 4M78D 1QVGS 2RMOA 5KYWB 1W1FA 4M75E 2DFUA 2RHUA 4J9BA 1IXDA 2ZPEB 2RI3A 1DJ7B 2JTEA 3QXEB 4HCZA 3RIRA 4LDXA 2PQWA 2QA4Q 1MNDA 3V7SA 1QP3A 2DIGA 1U5SA 2C0TA 1JO8A 2H3JA 2ROLA 2E5KA 3PVLA 2PU9B 1RI0A 4IIOA 3RMQA 1M90R 1Q82C 1LOJA 2JOYA 2ZPIB 1X69A 3X28B 2DILA 1MV0B 1YWPA 2KDSA 3META 2K4YA 2LTOA 3OYBA 2L3RA 1TG0A 1BI1A 2HKQB 4JLIA 3TU4K 2JM9A 1SSFA 2Y4XA 3CCMQ 5D6XA 1HXDA 2ABLA 2QASA 1ZUUA 3VUBA 1ZA1B 2HBWA 2K3BA 2RK1A 3DB3A 2DBMA 4AG1C 4M78C 3UDCA 1GBQA 1LNXA 1VUBA 3QG1A 2RQWA 1SKUB 3RMSA 2O9VA 1VQNT 1AWWA 3CCEQ 2DRMA 3QSUA 2ZPGB 3EG2A 1IGQA 1YHQA 3UATA 2CYZB 1QP2A 3G4SA 4M77A 3VU3C 5GMKl 1MMGA 5FROA 1VQOA 1HD3A 1QVFS 2BE7D 2K3XA 1ZSZC 4M7DF 3MP1A 3CCVQ 1UTIA 2E5QA 2ED1A 3EFOB 3I55A 1WX6A 1O75A 1E6HA 1WGSA 2YDLA 2VGNA 3CQTA 1IO6A 2NUTA 3CBOA 2HL3A 2LP5A 1K8AC 2KRMA 4Y28E 3L2VA 3CCRT 3BDLA 3M0PA 4CC4B 3VS0A 2NLUA 5A0GA 1UE9A 4GY5A 4O6JA 2R57A 2DXBA 1Z9ZA 2F5KA 3LX7A 2J05A 3CCJT 2HBPA 2EYZA 3EGXB 2DEUA 1Q86R 3QDFA 4MZPA 5AT1B 1YI2T 3H0HA 4F7UB 2M1HA 2QA4A 3S6WA 2AKLA 3HPWA 2RQTA 3JB9I 2DX1A 2B86A 2FPDA 4XU0A 1VQPT 2KAFA 2EW3A 3MKDA 4C8QF 4WF2A 4DQ2A 1JBMA 4BB7A 3JCMb 6AT1B 1UJYA 4ZGDB 1SPKA 1VQ5Q 1VQ7Q 1NEBA 4RKUE 4QVCA 1IREB 2DO3A 3HP9A 4D8DA 3AT1B 2RQUA 2E65A 2R58A 5CVIA 2ED0A 3G71T 1CKAA 3REAB 2WSCE 3CCMA 1WJQA 2PVDB 2ZGWA 1OEBA 4PJMA 4ZN1A 1MMAA 1S72T 1EFNA 3GPLA 3J80E 4FW1A 4F17A 5CKFA 4OMOA 3U23A 1V76A 1NJIR 1D09B 2MCNA 3HFOA 1M1KU 1VQLQ 2ATCB 2DTHA 3CCEA 5HKCA 4J9HA 3I5SA 5CIUA 4R0KA 1UHFA 4DEYA 4PJNA 2OTJQ 5LL6S 3CXCS 1M3CA 1UGSB 2NWMA 1C0MA 3JAME 3CCVA 5GAN6 3GF5A 2KK4A 3JB9J 2CP5A 4IUQA 1I4K1 3CMAT 3M0RA 3QJ6A 4J8OA 4C92E 2CZ7B 1S1NA 4Z8AA 2CKKA 4J9DA 4N4HA 3M4YA 1Y96A 1TSFA 4RG2A 4NL2A 3GOXA 4A4FA 3HL8A 2EFIA 2P4TA 1OI1A 2K5FA 2RJDA 4IUPA 2FZCB 1XQHA 4OB1B 1CKBA 2EGEA 2FRWA 3PMTA 4BE1A 1JEGA 4RTWA 2XK0A 1JJ2P 3CCQQ 3OB9A 2W0ZA 3OS0A 4HKEA 4Y91A 3KBGA 4PFZA 3CBMA 1EZZB 1WHLA 2DIQA 3VYHB 8AT1B 1GCPA 1UUEA 2JT4A 3JCMW 5KCHA 4LUDA 3L2ZA 1K73R 1IB8A 4C0GA 3GP8A 1VQ5A 1VQ7A 4LE9A 4MMLA 2YUNA 2RJFA 2JXBA 5FWBA 2F1LA 4PKCC 1VQNQ 3UWNA 2P84A 4N4GA 1CSKA 4C5GA 1OOTA 1QQJA 3OMGA 5KE2A 1KC8C 2MOXA 4ZGEB 3SDZA 2RJEA 3FRNA 3JSCA 1FYNA 2ZPBB 2K3YA 1D0XA 2QI2A 1VQLA 3H9NA 3JB9F 2A7YA 2X3WD 4M7DD 1M90C 4PJJA 3CCRQ 2H3EB 4EPCA 1R0CB 4MDXA 1BCMA 3TQ7P 2DYIA 3OW2A 1UGPB 5KYWA 1Q82R 2D6FA 3AHUA 2AZVA 2VGMA 2JS0A 3CCJQ 4HT8A 1QKWA 5CQXA 4M77B 2PZ1A 3QIIA 5IT9E 4ME7A 1SRLA 5CKDA 4XTXA 3V7RA 1VQ4T 3OS1A 1FXXA 2E64A 5GAN2 3CCST 1AEYA 2LJ1A 4OB0B 2DL5A 1PG5B 2EYYA 3A8MB 5FW9A 2OTLQ 2DXCA 2K79A 2QDLA 4EMKB 3J7AF 3CPWS 2EJFA 1RUWA 2KT1A 2HQEA 1BYMA 4J83A 4RTZA 4J6YA 4FT2A 2DAQA 2CT3A 4RTXA 1TOVA 4F7UF 5GAN8 4C8QD 2RQRA 2YUPA 1E6GA 3QKJA 1K9AA 2EIFA 3VJPA 2NUPA 2DEQA 1D3BA 1X2KA 3PGGA 4M7DC 2DJQA 1FWZA 2EQJA 4R56A 4X9DA 4PJOE 3OYGA 3VYGA 3TSZA 2QA4T 2KR3A 4TVRA 4HCKA 3S3OA 3CCLQ 2L3SA 5GANg 4FT4A 1OX9A 1HSQA 3OYAA 2LQ8A 1G3WA 1LJOA 4C0DC 4C92B 4DOWA 5KYXB 5FU7C 1OULA 4RTVA 4A53A 1B34A 1SHGA 5CCAA 5I22A 1YJNT 1WQWA 1VQNA 1T3SA 2VKNA 5CKHA 2DZCA 1H8KA 4M75F 3ASKA 3A98A 2YRVA 2A08A 4OVAA 2I0NA 2JUFA 3OMCA 4M7AG 2GCXA 4M7DG 3CCMT 3NMZC 2EQMA 3LH5A 3HRUA 1WZOA 2KE9A 4X9CA 1W70A 1K76A 3EFOA 2RI2A 4BI3A 3CMAQ 1VQ6Q 4C8QC 4JRIA 2QK0A 3VS5A 4MDWA 2D8HA 3CCRA 3M0UA 1U06A 2GTOA 1N8RU 2DPPB 3CCUT 3G1JA 3SHWA 1GCQA 5HK0A 4HVWA 1AD5A 3TREA 1MUZA 2CZ1B 2CZ6B 2DTIA 2O31A 1AHJB 2AIRB 5IN1A 3H6ZA 3GBQA 3P8BB 1KD1U 3JCMP 5GAOr 3CCJA 3BE3A 2LRQA 2X9HA 5IHNA 1JJ2A 4BY6C 3EGXA 1YI2A 1TWBA 4J7FA 2X4XA 3UA7A 5IAYA 3SFMA 4F7UA 3CCVT 2AKKA 4A4KA 1I07A 2FRYA 4C8QG 1NJIC 4HCBA 4OGEA 4JZ4A 2OTLA 2L8DA 2GTJA 2EAYA 1I1JA 4ATOA 1Y96B 5FRMA 5CKEA 2VB6A 5KCOA 1HYOA 2KXDA 1Q81U 2AZSA 1BIBA 3V8LA 3TVTA 2YHTA 5I21A 4PJLA 1G8XA 1ZUKA 1T0HA 2OJ2A 2ROTA 3LGFA 1JXOA 2PUOB 4ZTJA 3OYMA 2F2WA 4M75A 4M4ZA 1WHJA 3CCLA 2NUZA 3GNGA 5LJ3d 4O5VA 2LDMA 2OI3A 3SEMA 4XTVA 3MP6A 4KBMB 1RABB 2DVJA 1IHVA 1WJRA 4E7SA 3FLGA 1VQ5T 1VQ7T 2HZYA 4ANJA 1YJ9T 5A0LA 1GXIE 4J5YA 3QHSA 3JB9D 2JTMA 1VQMT 5GANf 4NS5A 4JS4A 4Y92A 1MMDA 1M2VB 3OYYA 2LCSA 3UT1A 7AT1B 2PNIA 4M78E 1VQKT 4FW2A 1ZX6A 4ZGJB 3CMAA 3HTRA 1YN8A 3EG9B 3L42A 2DD4A 3M58A 1VQ4Q 2DYBA 5GAN3 3CCSQ 3ZL7C 2WSFE 4BACA 1PHTA 1VQLT 2FVUA 4CC3A 2E10A 2BIVA 1VOMA 5CO7A 1Q95G 4IKFA 4M77F 1KFZA 3DLLA 4PK4A 4AFZC 3QO3A 1M8MA 1HJDA 5CQYA 3QZ5B 1UGVA 2OTJT 2X3XD 3KFVA 3FJPA 2V1QA 3R6OA 3VS7A 2C0IA 2M9UA 2EKHA 3ZBDA 1OZ3A 1NLOC 1KC8R 4FSXA 2XU8A 2VYTA 2AT1B 1EIFA 2DL8A 3CC7T 4DA4A 2KMTA 3A8HB 4HA8A 4NOYA 2JS2A 5FLXE 3L2UA 3M57A 4GLKA 2FO0A 2JMAA 4JS5A 2KY9A 5KE3A 1YJNQ 1PSFA 1KIKA 5HK3A 4JLGA 2EGAA 2F69A 3JCMd 2HL5C 4BDZA 5AYFA 2NUPB 1D3BB 3CCQT 2BZXA 2L0AA 2KRNA 4C92F 1GCQC 4M75D 1OZ2A 1AWXA 3M0QA 4KRTA 1WNLA 3NHNA 4GLMA 2NYSA 2X4YA 2KNBB 3P8HA 3C0CA 3CCUQ 1B34B 2E3IA 3X26B 2VXFA 2MMPA 1ACMB 1BI0A 3WVDB 1JQQA 3QBYA 4NL3A 2PTKA 2LCCA 2V8KA 2HMAA 3RNJA 1MV3A 1JB0E 2M16A 2K7AA 4E7JA 2Z0WA 3RUXA 3JCMf 2I2LA 4FL6A 4X1VA 2DK3A 5M9OA 4DBRA 1XOVA 5LJ3j 1VQ4A 3CCSA 2QDYB 2CSIA 4M78G 4HT9A 3OBYA 4E7KA 1N9SA 4JUVA 1I81A 4AT1B 2L5QA 1X27A 4HVUA 4EMKA 5GAN5 2EQUA 4M75C 2FYKA 1QCOA 3F70A 4IURA 3VS6A 2SRCA 2MF2A 4OB2B 3MEAA 2EJGA 3OW2P 4L5GA 1NM7A 2OAUA 1YITT 2CZ0B 2DRKA 4PFPA 1K9MU 4OMNA 2EGCA 2VASA 4RG8A 1AZGB 1ZBXA 3GIBA 2OX7A 4OMPA 4CI0C 4PLIA 3LGLA 2EYQA 1JJ2S 2EQKA 2QQBA 4BDYA 3PMIA 3DB4A 3SB2A 4C92A 2OTLT 5KYXA 2L3QA 3I9QA 5CR2A 1YJNA 4FYWB 3I56Q 2PUKB 1YBYA 1BU1A 1RAFB 2CUDA 1AWJA 4PL6A 1YJ9Q 3VV0A 4BI8B 1WXTA 2V8IA 3OBWA 3OYDA 1VQMQ 2LJ0A 4FYVB 1WA7A 4Z88A 4M75B 3QWYA 3CCLT 4PFOA 3PVQA 1VQKQ 5DM7R 4RTTA 2JM8A 4J9IA 5GJWB 1BCOA 1PRMC 3CCUA 3BW1A 2DL3A 4JJDA 4KGZB 1M2OA 2P4RA 4C0FA 2RO0A 1Y7XA 4QQGA 1RAGB 4KULA 4QW2A 4PJOF 2DM1A 3VRZA 1LVKA 4LD6A 5GAOq 4M77D 2ZPFB 4OB3B 1RI9A 3PFSA 3VUZA 2K2VA 2KVQG 1B3QA 1VQ6T 2QQAA 2ZZDA 9ATCB 2FHDA 4ELYC 3CC7Q 4C5EA 3Q1JA 2DXUA 1RAIB 2RN8A 1HK9A 3QPHA 4QKUA 4JDSA 2M0YA 2GGRA 4XK8E 1PKSA 1KQ1A 2BUDA 3URGA 4AMCA 1UJ0A 1M9SA 2E6NA 1IGUA 3NTHA 3OYEA 1VQ8T 1KG1A 5GJVB 2QTVA 2E6ZA 2RH2A 3HSBA 4J9FA 4LUEA 5D6WA 1MMNA 1VQ9Q 3A1PA 2R5MA 3A8OB 5DLQE 2V26A 5L23A 5FU6B 3L2RA 1TUDA 2MPXC 2MIOA 3QUIA 3OYNA 3I56A 3E9FA 5J26A 2CP7A 3FB9A 4C92D 3EG3A 1UGRB 1KHCA 4M77C 1BKBA 1YJ9A 1K8AU 1PWTA 4JRPA 3MJXA 2XIDA 3H0FA 4M7AE 4M7DE 1M4ZA 1N8RC 1VQMA 2KBTA 2COZA 1RAAB 4IUUA 4N0AA 1M2VA 2HQXA 1VQKA 2HEQA 3C94A 4FYYB 2RA2A 4EMKC 2FPEA 4A4HA 1KD1C 4D8KA 1G3SA 4PJOA 2COWA 2RB6A 2KSSA 1G5VA 3EG9A 1YWOA 5EG2A 2BZ8A 4B6MA 3LWHA 3S3MA 3CPFA 3BY7A 4RMOA 4M77G 1OQKA 2ZCFB 1UFFA 5HY6A 1ARKA 1PD0A 4N4IA 3LW5E 2HKNA 2OTJA 2HCKA 1Y0MA 3OSSC 2E12A 2J6KA 2JW4A 1RADB 4F04B 1OPKA 1X75C 1R8OB 4JZ3A 3EHQA 2XMFA 3RBBB 1YITQ 1M1KR 1AOJA 4C92C 4R55A 3PE0A 4A4EA 2HSEB 3WVEB 4C8QE 1QMCA 1MGQA 2XDPA 5LJ3h 3CC7A 4Q5WA 2A0FB 2IVWA 3M5AA 2XDBA 5DLOA 2GFAA 2C06A 3MO8A 2IIMA 1W2BP 4FIBA 5IHIA 1V1CA 1BB9A 1SHFA 2PVOB 4HVVA 5IXFA 1UG1A 3PNWC 4LD9K 1SEMA 4BI4A 3LH0A 2VXEA 2QXFA 3CCQA 1VQ9A 3INZA 2X35A 1OU8A 1VYTA 2L2PA 3MEVA 3FC3A 2CS7A
chains in the Genus database with same CATH topology
1VQ5T 1VQ7T 2CYZB 1QP2A 3G4SA 1H641 4M77A 3GNFB 3VU3C 5GMKl 4FM4B 5FROA 1YJ9T 4RCCA 1BI3A 1VQOA 1QVFS 2P0PA 4M7DF 2K3XA 5A0LA 3OA6A 1Y71A 3MP1A 1GXIE 4J5YA 3JCMc 2E5QA 1QVPA 1XTDA 1VIFA 3QHSA 3CC7T 3I55A 2PVGB 3JB9D 2JTMA 2K5IA 1VQMT 1NE8A 2JTFA 5GANf 4NS5A 4JS4A 1O75A 1WGSA 4C8QA 2VGNA 4BD3A 2P0QA 2K5LA 3OYYA 3UT1A 3CBOA 2DVEA 3HFNA 4M78E 1G3YA 1K8AC 1UGQB 2XHCA 4Y28E 1VQKT 3L2VA 3CCRT 4ZGJB 3QYHB 4XTZA 3CMAA 3BDLA 5GAN7 4E7HA 4EMGA 3L42A 2DD4A 2NLUA 3M58A 5A0GA 5GAN3 1YJWA 2WSFE 2HD0A 1UB4A 4GY5A 4O6JA 2R57A 2DXBA 2F5KA 3LX7A 4BACA 3KUFA 4E7IA 1VQLT 2E41A 2FVUA 3OYIA 1YCYA 3CCJT 1U1TA 2E10A 4DOVA 2LT4A 2HBPA 3OYCA 1Q7YC 4X34A 2BIVA 2XDDA 5CO7A 4EDUA 4MZPA 4IKFA 1YI2T 4M77F 4VUBA 4PJOD 3DLLA 3EFSA 4F7UB 1M1GA 2XKOC 4QQDA 2M1HA 3QO3A 3NFCA 2JZ2A 5CQYA 2QA4A 3QZ5B 3S6WA 5J3BA 2OTJT 4MZMA 1Q7YU 3HPWA 3FIFA 3E1SA 3JB9I 4UC4A 1P92A 3FJPA 4XU0A 1VQPT 3R6OA 2KAFA 2M9UA 4L6V5 5LJ3e 3ZBDA 4C8QF 1OZ3A 4WF2A 5LJ5g 3RKXA 2HNIA 4DQ2A 1JBMA 2G3RA 4BB7A 3JCMb 1WQ7A 3JCMh 4FSXA 2XU8A 3E9GA 2VYTA 4ZGDB 2RM4A 5GMKe 2BKDN 1RL2A 1EIFA 4RKUE 1YITA 4DA4A 4QVCA 4M7AB 1IREB 2KMTA 2DO3A 3A8HB 4HA8A 4NOYA 5FLXE 1WJSA 3L2UA 3M57A 3HP9A 4GLKA 4HCCA 3M9QA 2E65A 2R58A 5CVIA 3V7CA 3G6EA 4LDVA 4XU1A 3EFRA 3G71T 2WSEE 4C0ZA 5GMKm 4JS5A 5GANh 2WSCE 3M4GA 3CCMA 1QVGA 2KY9A 2B8AA 5KE3A 1WJQA 2PVDB 2ZGWA 3MEWA 4D6WA 1PSFA 2RHZA 5HK3A 4M7AD 4J6WA 2XD0A 4XTWA 4JLGA 2F69A 4ZN1A 3JCMd 3CD6A 1Q81C 1S72T 4N0AC 4BDZA 1JRIA 3GPLA 5AYFA 3J80E 1D3BB 3CCQT 5C6SA 4M7AG 2GF7A 5CKFA 1M90U 4QVZA 2F5TX 4XU3A 4C92F 1KD1U 3HFOA 3TEEA 4M75D 1M1KU 4XQ3A 4PJOC 3OSVA 1OYXA 3SWNB 5GANd 2DTHA 1YHQT 4LDYA 3CCEA 1OZ2A 5HKCA 4LDUA 4B9WA 3LWIA 3HHTB 3G4ST 3PTAA 5CIUA 1WNLA 4L59A 2LT1A 1VQOT 2X4YA 2LVMA 2HAXA 4QQ6A 2JVVA 5LL6S 3P8HA 3CXCS 1UGSB 1KHIA 4XU2A 3I55T 1B34B 3G7ZA 3X26B 2VXFA 1W4SA 2MMPA 1O9SA 3JCMX 1BI0A 3WVDB 2M0OA 4M78F 3JAME 3PIOA 4YTLA 3CCVA 3UPUA 3QBYA 5GAN6 4NL3A 3GF5A 4C92G 2LCCA 2V8KA 3CMEA 2KK4A 3JB9J 5I2MA 1JB0E 4XAXB 2M16A 1N9RA 3I56T 4E7JA 5GAMg 4IUQA 1I4K1 3CMAT 3QJ6A 4J8OA 3RUXA 3JCMf 4C92E 4KUIA 3OQ5A 2CZ7B 4MZTA 2CKKA 5LJ5h 2I2LA 4BUGA 3OYLA 4FL6A 1YJWT 2RJCA 3SD4A 5CAIA 4N4HA 3L2QA 3M4YA 3M56A 1Y96A 2DK3A 4RG2A 4NL2A 5M9OA 5LJ3j 1XOVA 3A5ZB 3GOXA 2LNVA 3RKYA 4A4FA 3HL8A 2EFIA 2P4TA 1N27A 2QDYB 3CCSA 1VQ4A 4M78G 3JB9H 4OP0A 3OBYA 1OI1A 4HT9A 4M7AC 1Y07A 3ZEHA 3CXCA 4BE2A 4E7KA 1N9SA 2K5FA 2RJDA 2YLCA 2RI5A 3MEVA 4IUPA 4JUVA 1XQHA 1I81A 4IUVA 3MP8A 2L5QA 5GMKj 2MWOA 4OB1B 1TH7A 4C5IA 3OYJA 4EMKA 4OGCA 3PMTA 2D9TA 1VQ6A 4BE1A 4PJOB 5GAN5 3JCMe 5FRNA 2EQUA 3ME9A 3P8DA 4KT0E 2XK0A 2MAMA 5LJ5d 4M75C 4IUTA 1W2BA 3OB9A 2FYKA 1M1FA 5GMKi 5GAN4 3OS0A 2WACA 4HKEA 4Y91A 3F70A 3KBGA 4IURA 1K9MC 3CBMA 2MF2A 3TCJA 4OB2B 4F7UE 2DIQA 3VYHB 3MEAA 3SWNA 4Z02A 1QVFA 2EJGA 3JCMW 3JRZA 4L5GA 5LJ3g 5KCHA 2OAUA 1YITT 2CZ0B 5GANe 2LC4A 1KQSS 3L2ZA 3E19A 1K9MU 2QTXA 2O4XA 5GAOn 4C0GA 1Q86C 4RG8A 2RHYA 3CC2T 3GP8A 3RESA 3SWNC 1VQ5A 1VQ7A 1ZBXA 3GIBA 2VC8A 1VQ8A 4MMLA 2RJFA 4CI0C 4A54A 4PLIA 3LGLA 5KH6A 2EYQA 1JJ2S 2EQKA 2QQBA 3QYGB 2XI9A 4PKCC 3PMIA 3DB4A 3UWNA 5L8RE 1NPRA 3SB2A 1Q86U 4N4GA 4C92A 4E7LA 4C5GA 2OTLT 1KQ2A 3MHXA 4PLLA 3V8KA 5CR2A 4MMKA 1YJNA 3OMGA 3M53A 4E47A 2VV5A 2PUKB 5KE2A 3OW2S 5I2SA 1YBYA 1YIJA 1KC8C 4ZGEB 4M7DB 4V2SA 3SDZA 5CK9A 4PL6A 2RJEA 3VV0A 5LJ5f 3FRNA 4BI8B 5GAMh 5GAOp 3JSCA 3X25B 2ZPBB 2K3YA 2V8IA 1KC8U 2EWNA 3CCET 1X01A 3OBWA 3OYDA 4M78A 2EKOA 4ZTFA 1BI2A 3V8JA 2QI2A 2RHIA 3CBPA 1VQLA 4M75B 4C0DB 3JB9F 2A7YA 4M7DD 5FU7B 3LYIA 1M90C 3CCLT 3C12A 3PT9A 2QEXA 3JCMJ 5DM7R 1M1KC 3S3NA 3MEUA 3OYKA 4EPCA 2R5AA 4KUDK 3L2WA 4MDXA 1VQ9T 1BIAA 3OW2A 1UGPB 5LJ5e 3CMET 3HRTA 3CCUA 3BW1A 2D6FA 5GAMd 4XTYA 1VQPA 2DD5A 2VGMA 3AHUA 1PSEA 2D0QB 3C95A 3WXMB 1I5LA 3RKWA 4HT8A 5CQXA 4M77B 1NZ9A 1N6AA 2CGHA 3PIPA 2MI6A 2XICA 3QIIA 5IT9E 3X24B 1V29B 3JB9G 3OS2A 4C0FA 4ME7A 2P0KA 1Y7XA 2RO0A 4QQGA 2E70A 3GLXA 3OYFA 1VIEA 4LDXA 2A3LA 3FLGA 3QDRB 5CKDA 1NJIU 1U1SA 4XTXA 4ZN3A 3V7RA 4KULA 4QW2A 4PJOF 1VQ4T 3HKSA 3OS1A 1FXXA 2E64A 2JNGA 2KQWA 4QVDA 5GAN2 3CCST 3BFMA 2VUBA 4LD6A 3T9NA 4OB0B 4C8QB 4J6XA 5GAOq 3M59A 4M77D 2ZPFB 3G71A 3A8MB 1NPPA 4OB3B 4OMFB 3PFSA 5GANj 3VUZA 2DXCA 3J7AF 4EMKB 2K2VA 3CPWS 2EJFA 2KVQG 1IZ6A 2HQEA 1QW1A 1BYMA 4J83A 2QQAA 2ZZDA 1VQ6T 2FHDA 4J6YA 4FT2A 4ELYC 2DAQA 3Q1JA 2DXUA 4C5EA 1MHNA 4F7UF 5GAN8 1HK9A 3QPHA 2RK2A 4C8QD 2X4WA 3A8LB 4II1A 1S72A 4JDSA 3QKJA 4PJOG 3JCMg 5GAOl 3DKMA 4XK8E 4BY6B 2EIFA 3VJPA 5GAMf 1WPYA 2DEQA 1D3BA 1XNIA 3O8VA 1KQ1A 3PGGA 5DY9A 2GFUA 4JRQA 4M7DC 1FWZA 2EQJA 2O4XB 2BUDA 3EAEA 4X9DA 4R56A 3OYGA 4PJOE 3VYGA 3OS5A 2GQVA 3URGA 2Y90A 1X6OA 2QA4T 1ZQ1A 1M9SA 2DTOA 4TVRA 2QQ9A 3S3OA 2E6NA 2QQSA 3L1AA 3NTIA 3NTHA 1ZHIA 4A4GA 4FT4A 3LLRA 5GANg 3OYEA 1VQ8T 1KG1A 2MWPA 4RCBA 4F7UG 4M7AF 2E6ZA 2RH2A 3CPWA 1I8FA 2ZPHB 2K57A 3JCMQ 3OYAA 3HSBA 2LQ8A 5D6WA 1G3WA 1LJOA 4C0DC 4C92B 4DOWA 5FU7C 2IG0A 3N5BB 4J7IA 2R5MA 3A8OB 5A2QE 4A53A 1B34A 5DLQE 5CCAA 2DJZA 1YJNT 1WQWA 5FU6B 5GAMe 1VQNA 1M5Q1 5CKHA 1YIJT 3X20B 3CC4A 2DZCA 3L2RA 4BDYA 2V8JA 2FL7A 3ASKA 4M75F 3QUIA 2L89A 2YRVA 3ER0A 3QJYA 5A0DA 3OYNA 3VKIA 3E9FA 5J26A 3FB9A 3I56A 4C92D 3G6ET 2O01E 4FU6A 1K73C 4OVAA 1UGRB 4JJNK 1KHCA 4M77C 3OY9A 4EMHA 2JUFA 1FX7A 3H8ZA 2LX9A 3OMCA 1BKBA 2GCXA 4JRKA 4M78B 5LJ3f 5LJ5j 3CCMT 1YJ9A 1K8AU 4M7DG 4JRPA 1G3TA 5D6YA 4OF1A 2EQMA 3FDRA 2E1HA 3KXTA 4XTUA 3HRUA 3J81E 2LQKA 2XIDA 4X9CA 1K73U 4M7AE 4M7DE 5CKBA 1M4ZA 1N8RC 1VQMA 2RI2A 2AHJB 3CEYA 4BI3A 3CD6T 3HRSA 4CRIA 2QEXT 4IUUA 4N0AA 4C8QC 3QZ9B 4JRIA 4C5HA 2X4JA 4M75G 4M78D 4MDWA 2HQXA 1QVGS 4ELZC 1VQKA 3CCRA 3C94A 1N8RU 2DPPB 2RA2A 4EMKC 4A4HA 5HK0A 2YLBA 3CCUT 1KD1C 1KQSA 3TREA 1G3SA 4M75E 4PJOA 2RHUA 2CZ1B 2RB6A 1G5VA 2CZ6B 2DTIA 2KSSA 5EG2A 2ZPEB 2RI3A 1DJ7B 1AHJB 3QXEB 4HCZA 3LWHA 3S3MA 3CPFA 5IN1A 3RERA 4ATOA 3H6ZA 3P8BB 2RHXA 3RIRA 3JCMV 3JCMP 2FB7A 2PQWA 5GAOm 3DLMA 4B9XA 2LRQA 3BY7A 3C4SA 3CCJA 4RMOA 3V7SA 3MCAB 2JN0A 1JJ2A 1QP3A 4M77G 4BY6C 2DIGA 1YI2A 4J7FA 2X4XA 2XG8D 2ZCFB 5HY6A 4N4IA 3SFMA 5IAYA 4F7UA 2H3JA 3LW5E 2OTJA 3CCVT 3CC2A 4M77E 2PU9B 3OSSC 1RI0A 4A4KA 5GAOr 2E12A 2RD1A 3RMQA 1UEBA 1X75C 2DXTA 1R8OB 4C8QG 1Q82C 1NJIC 4OGEA 4HCBA 1LOJA 2JOYA 2ZPIB 3X28B 3ZFJA 2OTLA 4C92C 2L8DA 2Y4YA 5C0MA 2EAYA 4BE0A 2KDSA 3META 2K4YA 2LTOA 4R55A 4A4EA 1U8RA 3WVEB 1Y96B 2L3RA 4C8QE 3OYBA 1BI1A 4PNOA 4JLIA 3M54A 2DZ9A 5CKEA 5FRMA 1MGQA 5J39A 3TU4K 2XDPA 5FU6C 1Q82U 5LJ3h 3CC7A 4Q5WA 2IVWA 5KCOA 1SSFA 3M5AA 1H3ZA 2Y4XA 2XDBA 5DLOA 4M7AA 5D6XA 4M7DA 1HXDA 2GFAA 2C06A 3A8GB 3MO8A 3M55A 5GAMj 1Q81U 1BIBA 3V8LA 3VUBA 5GMKh 2YHTA 5I21A 3FEOA 3NTKA 2RK1A 3DB3A 3LGFA 4FIBA 4LDWA 4M78C 3UDCA 2QQRA 2PUOB 1LNXA 2PVOB 3OYHA 1VUBA 3OYMA 4ZTJA 3QG1A 4M75A 3PNWC 3CCLA 4LD9K 1M8VA 3GNGA 4BI4A 3LH0A 3RMSA 2VXEA 2EJ9A 5LJ3d 3BDUA 4O5VA 2LDMA 2QXFA 3CCQA 1VQ9A 1VQNT 4P5NA 3INZA 2X35A 3CC4T 3QSUA 4XTVA 3MP6A 2ZPGB 4KBMB 2DKGA 1W2BS 1YHQA 2LCLA 1WJRA 3FC3A 2CS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 C;  4EMH A;  1H64 1;  2EWN A;  4JRK A;  4M77 A;  4M78 B;  1X01 A;  3VU3 C;  5LJ3 f;  5GMK l;  4M78 A;  5LJ5 j;  1WNL A;  4M7D G;  4RCC A;  3V8J A;  4M7D F;  2E1H A;  4M75 B;  4J5Y A;  3JB9 F;  4XTU A;  3JCM c;  4M7D D;  4X9C A;  4M7A E;  3QHS A;  4M7D E;  3JB9 D;  4XU2 A;  1B34 B;  3JCM J;  2VXF A;  3JCM X;  5GAN f;  4N0A A;  4M78 F;  4C8Q C;  4JRI A;  4C8Q A;  4M75 G;  5GAN 6;  4NL3 A;  1BIA A;  4M78 D;  4C92 G;  2DVE A;  3JB9 J;  3HFN A;  4M78 E;  5LJ5 e;  3BW1 A;  2RA2 A;  4EMK C;  5GAM d;  2YLB A;  4XTY A;  4XTZ A;  3AHU A;  1N9R A;  1I5L A;  5GAM g;  5GAN 7;  1I4K 1;  4M75 E;  3RKW A;  4HT8 A;  4EMG A;  4PJO A;  2RB6 A;  4C92 E;  3RUX A;  2DTI A;  4M77 B;  3JCM f;  2CGH A;  5GAN 3;  5LJ5 h;  2I2L A;  5CAI A;  3JB9 G;  3RER A;  3JCM V;  3RIR A;  3JCM P;  2FB7 A;  5GAO r;  5GAO m;  1Y96 A;  2E41 A;  3BY7 A;  1YCY A;  1U1T A;  2E10 A;  4NL2 A;  3V7S A;  5LJ3 j;  2JN0 A;  1U1S A;  4XTX A;  4M77 G;  3RKY A;  3V7R A;  4PJO F;  3JB9 H;  4M78 G;  4HT9 A;  2E64 A;  4OP0 A;  4QVD A;  5GAN 2;  4M7A C;  4M77 F;  4PJO D;  3EFS A;  1N9S A;  2YLC A;  3BFM A;  4JUV A;  4C8Q B;  4F7U B;  5GAO q;  3QO3 A;  4J6X A;  4M77 D;  1I81 A;  4F7U A;  5GAN 4;  4M77 E;  5GMK j;  1TH7 A;  3FIF A;  5GAN j;  4EMK B;  2EJF A;  4EMK A;  3JB9 I;  3FJP A;  2RD1 A;  4XU0 A;  4PJO B;  5GAN 5;  3JCM e;  2DXT A;  4C8Q G;  4J6Y A;  5LJ3 e;  1LOJ A;  4M75 C;  4C8Q F;  4F7U F;  5LJ5 d;  2DXU A;  2FYK A;  4C92 C;  4WF2 A;  5GMK i;  5LJ5 g;  2EAY A;  3RKX A;  1HK9 A;  4Y91 A;  5GAN 8;  2HNI A;  4C8Q D;  1JBM A;  4DQ2 A;  3JCM b;  1Y96 B;  4C8Q E;  4F7U E;  1WQ7 A;  3JCM h;  4PNO A;  4JLI A;  4PJO G;  2DZ9 A;  3SWN A;  3JCM g;  1MGQ A;  5GAO l;  2EJG A;  2RM4 A;  5LJ3 h;  3JCM W;  5GMK e;  5GAM f;  5LJ3 g;  1WPY A;  2DEQ A;  1D3B A;  4QVC A;  4M7A B;  1KQ1 A;  3PGG A;  5DY9 A;  5GAN e;  4M7A A;  4HA8 A;  4NOY A;  4M7D A;  1HXD A;  3L2Z A;  4M7D C;  2QTX A;  4X9D A;  4PJO E;  5GAO n;  5GAM j;  2E65 A;  1BIB A;  3V7C A;  2Y90 A;  4XU1 A;  3V8L A;  5GMK h;  3EFR A;  3RES A;  2DTO A;  3SWN C;  2YHT A;  5I21 A;  3GIB A;  3L1A A;  5GMK m;  5GAN h;  2VC8 A;  3M4G A;  5GAN g;  4MML A;  4M78 C;  2ZGW A;  4A54 A;  4RCB A;  4F7U G;  4M7A F;  3HSB A;  1LNX A;  1I8F A;  2K57 A;  3JCM Q;  1LJO A;  4M75 A;  3SB2 A;  4C92 B;  4M7A D;  4J6W A;  4C92 A;  1KQ2 A;  4XTW A;  1M8V A;  3V8K A;  3JCM d;  4MMK A;  2VXE A;  4A53 A;  2EJ9 A;  1B34 A;  2DJZ A;  3BDU A;  1WQW A;  4N0A C;  1JRI A;  5LJ3 d;  5GAM e;  1M5Q 1;  1D3B B;  2DZC A;  3INZ A;  4M7D B;  4M7A G;  4V2S A;  3QSU A;  4M75 F;  4XTV A;  3QUI A;  4XU3 A;  4C92 F;  5LJ5 f;  3HFO A;  4M75 D;  3FB9 A;  4XQ3 A;  2DKG A;  5GAM h;  5GAO p;  4C92 D;  4PJO C;  3SWN B;  5GAN d;  2DTH A; 
#chains in the Genus database with same CATH topology
 1H64 1;  3GNF B;  4FM4 B;  1N5Z A;  4RCC A;  1QVP A;  1VIF A;  1WHK A;  2K5I A;  1AWO A;  2COY A;  1RAC B;  1T3L A;  2P0Q A;  4RTY A;  3HFN A;  4DBH A;  1KSW A;  1UGQ B;  2LNH B;  2C0O A;  4CC2 A;  5GAN 7;  4Z89 A;  2M02 A;  2RPN A;  1R77 A;  1UB4 A;  2HD0 A;  1X6B A;  3KUF A;  4E7I A;  3OYI A;  1YCY A;  1T0J A;  1G83 A;  1U1T A;  1OPL A;  3OYC A;  2XDD A;  4VUB A;  4PJO D;  1M1G A;  2L3P A;  4JPB W;  4QQD A;  1MNE A;  2JZ2 A;  1EX4 A;  4AFU C;  2DA9 A;  1QWF A;  4MZM A;  1Q7Y U;  3E1S A;  2KI7 A;  3R6N A;  2V1R A;  2M51 A;  2YRD A;  1WHH A;  4L6V 5;  3VS3 A;  5LJ3 e;  5LJ5 g;  3RKX A;  1LPL A;  3JCM h;  1K4U S;  2K6D A;  3E9G A;  2RM4 A;  2D0N A;  1ZSG A;  1YIT A;  4M7A B;  1VQ8 Q;  4HCC A;  1WJS A;  3M9Q A;  4LNP A;  1GFD A;  4XU1 A;  2A28 A;  2WSE E;  4C0Z A;  2ENM A;  3EHR A;  3M4G A;  2B8A A;  1QCN A;  4D6W A;  4OMQ A;  2RHZ A;  2CUB A;  5EC7 A;  2XD0 A;  3VS2 A;  5HCK A;  4N0A C;  1ABQ A;  5C6S A;  2GF7 A;  1M90 U;  2F5T X;  4XU3 A;  3TEE A;  4XQ3 A;  4PJO C;  1OYX A;  3SWN B;  2JJ9 A;  5GAN d;  4LDY A;  3LWI A;  3PTA A;  2DL7 A;  4L59 A;  2LT1 A;  2DET A;  3M0S A;  1NEG A;  4QQ6 A;  1WHG A;  2CT4 A;  2JVV A;  4E2F B;  2EPD A;  3G7Z A;  3JCM X;  1RAH B;  1O9S A;  2DBK A;  2E3H A;  2M0O A;  4YTL A;  2O88 A;  2VVK A;  5I2M A;  1N9R A;  3I56 T;  5GAM g;  1AT1 B;  4KUI A;  3NPF A;  3OQ5 A;  4MZT A;  1YJW T;  3SD4 A;  4LN2 A;  2JMC A;  2EBP A;  1F1B B;  3M56 A;  2LNV A;  1N27 A;  3JB9 H;  4OP0 A;  1M3B A;  3CXC A;  4ORZ A;  1KQS P;  2YLC A;  4IUV A;  3MP8 A;  5GMK j;  5KYY A;  3OYJ A;  4OGC A;  4KGX B;  2D9T A;  1VQ6 A;  4PJO B;  2KRO A;  3JCM e;  5FRN A;  1PD1 A;  3ME9 A;  3P8D A;  2DL4 A;  2MAM A;  5LJ5 d;  1W2B A;  1M1F A;  3TSW A;  4FCY A;  1K9M C;  2J6F A;  4F7U E;  1WXB A;  2KGT A;  4Z02 A;  1M27 C;  2CRE A;  1Z9Q A;  1NYG A;  2LC4 A;  3E19 A;  2QTX A;  2BZY A;  5I11 A;  2RHY A;  4J9G A;  1SF9 A;  3RES A;  4DBQ A;  2SEM A;  1VQ8 A;  1QCF A;  4A54 A;  3EG0 A;  1Q7Y R;  1N8R R;  2KYM A;  3QYG B;  1Q86 U;  2XI9 A;  1B7T A;  1QWE A;  2DNU A;  4PLL A;  3V8K A;  3M53 A;  4E47 A;  3OW2 S;  2LZ6 B;  1KD1 R;  2MYS A;  1G2B A;  4EIK A;  4V2S A;  1GFC A;  2A37 A;  5LJ5 f;  1X2Q A;  3X25 B;  2EWN A;  1X01 A;  2BTT A;  2W10 A;  1BI2 A;  2RHI A;  2DER A;  3PT9 A;  1M1K C;  2DF6 A;  3OYK A;  4KUD K;  1VQ9 T;  1IRX A;  2LMJ A;  1WFW A;  3CME T;  4OML A;  1PNJ A;  1TU0 B;  4A63 B;  4XTY A;  5GAM d;  2DD5 A;  3WXM B;  3C95 A;  3RKW A;  1N6A A;  1Q81 R;  1PM3 A;  3JB9 G;  3OS2 A;  2P0K A;  1BK2 A;  2E70 A;  3GLX A;  3OYF A;  2A3L A;  3CC2 Q;  1NJI U;  3ULR B;  1SG5 A;  2JNG A;  2KQW A;  1Y57 A;  5IHK A;  2AK5 A;  2LCL A;  2VUB A;  3T9N A;  3D7S B;  3S3N A;  4J6X A;  3M59 A;  2IPO B;  1NPP A;  2X51 A;  1NG2 A;  5GAN j;  1TUC A;  1QLY A;  4E7Z A;  1D0Z A;  2MK5 A;  4HXJ A;  2LQW A;  4II1 A;  3EGU A;  3DKM A;  1I5O B;  2KEA A;  5GAM f;  1WPY A;  3QWX X;  2LJ3 A;  5DY9 A;  1AZE A;  2O4X B;  4KH1 B;  3EAE A;  2Y90 A;  1QKX A;  2DTO A;  2QQ9 A;  1IHW A;  2QQS A;  1BBZ A;  1ZHI A;  4JJB A;  2KYB A;  3LLR A;  2MWP A;  1UDL A;  4F7U G;  4M7A F;  3CPW A;  4FSS A;  4AFQ C;  2IG0 A;  2LX7 A;  5A2Q E;  1WLP B;  2DJZ A;  1VA7 A;  1YIJ T;  1QVG P;  3O5Z A;  2FL7 A;  1PKT A;  1WIE A;  3VRY A;  3VKI A;  4F16 A;  2VWF A;  4FU6 A;  1AVZ C;  2YT6 A;  4JJN K;  4EMH A;  3H8Z A;  3E2U A;  5LJ5 j;  4M78 B;  1WHM A;  5D6Y A;  1R0B G;  4OF1 A;  3KXT A;  2E1H A;  3J81 E;  1K73 U;  5CKB A;  3RR6 A;  4CRI A;  4WTO B;  2QEX T;  2KRS A;  4QT7 A;  2X4J A;  4M75 G;  4ELZ C;  1YJW Q;  1TTH B;  2YXY A;  2YLB A;  3VS4 A;  3EGD A;  1KQS A;  5D7U A;  1M30 A;  1RLQ C;  3REB B;  3RER A;  3JCM V;  2RHX A;  1ZSZ B;  2FB7 A;  5GAO m;  3DLM A;  1SSH A;  3C4S A;  4B9X A;  1H92 A;  2KXC A;  3MCA B;  2JN0 A;  1WXU A;  2J6O A;  2XG8 D;  1YFN A;  3CC2 A;  4M77 E;  1D1A A;  3M0T A;  1YP5 A;  5KYU A;  2RD1 A;  2EYW A;  1D1B A;  1UEB A;  2DXT A;  4E6R A;  8ATC B;  1RAE B;  1LCK A;  3FJ5 A;  3ZFJ A;  5C0M A;  2Y4Y A;  1PRL C;  4BE0 A;  2FZG B;  1U8R A;  2LQN A;  4PNO A;  5IXB A;  3M54 A;  2DZ9 A;  1K0S A;  5J39 A;  2YSQ A;  1XJW B;  3G6E Q;  5FU6 C;  1Q82 U;  2YUQ A;  1H3Z A;  4M7A A;  4M7D A;  3A8G B;  3M55 A;  5GAM j;  5KYY B;  2QGF B;  5GMK h;  1WI7 A;  3FEO A;  3NTK A;  4LDW A;  3CD6 Q;  1ZUY A;  2QQR A;  3OYH A;  1QVF P;  2GNC A;  2D1X A;  1M8V A;  2GQI A;  4IIM A;  3EH1 A;  2EJ9 A;  1W6X A;  3UA6 A;  2J7I A;  3BDU A;  2F2X A;  1VYV A;  4P5N A;  4WCI A;  3CC4 T;  1K0X A;  2DKG A;  1W2B S;  4KGV B;  3SWN A;  1ZA2 B;  1KJW A;  1BI3 A;  2P0P A;  3OA6 A;  1Y71 A;  2E4H A;  3JCM c;  1XTD A;  4CC7 A;  2EVR A;  3CME Q;  2PVG B;  1I0C A;  1D0Y A;  1NE8 A;  2JTF A;  1YCS B;  4C8Q A;  4BD3 A;  2K5L A;  2DE0 X;  2DVE A;  1G3Y A;  2XHC A;  3QYH B;  4XTZ A;  1FMK A;  4E7H A;  4EMG A;  1K9M R;  4J9E A;  1TS9 A;  2ESW A;  1YJW A;  2E41 A;  1PCX A;  2HSP A;  4DOV A;  2LT4 A;  1Q7Y C;  4X34 A;  1UHC A;  4EDU A;  3EFS A;  2XKO C;  2CH4 A;  3NFC A;  5J3B A;  2QYZ A;  3FIF A;  4UC4 A;  1P92 A;  3EH2 A;  1K1Z A;  1GL5 A;  2HNI A;  2G3R A;  1WQ7 A;  2J06 A;  1NBE B;  5GMK e;  2BKD N;  1RL2 A;  2FEI A;  1VYU A;  1FMW A;  3V7C A;  3G6E A;  4LDV A;  2O9S A;  3EFR A;  5GMK m;  5GAN h;  2GBQ A;  5KYN A;  5ECA A;  5IH2 A;  1QVG A;  3VS1 A;  3MEW A;  1UEC A;  4KH0 B;  1YIJ Q;  4M7A D;  4J6W A;  4XTW A;  3CXC P;  1M3A A;  1D1C A;  3CD6 A;  1NYF A;  1Q81 C;  4ESR A;  1JRI A;  1OV3 A;  4GBQ A;  2QGG A;  4QVZ A;  4DBF A;  2DMO A;  2QAZ A;  3OSV A;  2KT8 A;  1YHQ T;  4LDU A;  4B9W A;  3HHT B;  3G4S T;  1YI2 Q;  2CDT A;  2QEX Q;  4FYX B;  1VQO T;  2LVM A;  2HAX A;  2CP3 A;  1E7O A;  1TUG B;  1KHI A;  2CP0 A;  2OAW A;  4XU2 A;  3I55 T;  1VQP Q;  1W4S A;  3PIO A;  3UPU A;  4M78 F;  3JV3 A;  1JU5 C;  2CP2 A;  2NUT B;  4C92 G;  3CME A;  2O2O A;  4XAX B;  1B07 A;  1PC0 A;  3IQL A;  2F2V A;  5LJ5 h;  1WDX A;  4BUG A;  3OYL A;  1X6G A;  2RJC A;  5CAI A;  3L2Q A;  2EYX A;  1WYX A;  3A5Z B;  3G71 Q;  3RKY A;  4M7A C;  1NLP C;  2CSQ A;  1Y07 A;  3ZEH A;  4BE2 A;  2RI5 A;  1JXM A;  2MWO A;  1TH7 A;  4C5I A;  2DLP A;  3EGD B;  2HDA A;  1S72 Q;  1YNZ A;  4KT0 E;  4IUT A;  5GMK i;  5GAN 4;  2BE9 B;  2WAC A;  3TCJ A;  1K8A R;  1QVF A;  1C1A A;  3JRZ A;  5LJ3 g;  5GAN e;  1KQS S;  2FPF A;  1J3T A;  1U3O A;  2O4X A;  5GAO n;  1Q86 C;  4RUG A;  3CC2 T;  3SWN C;  4DEX A;  1C6V X;  3H41 A;  4JJC A;  5KYU B;  2VC8 A;  2QG9 B;  4AG2 C;  5KH6 A;  5L8R E;  1NPR A;  2YWW A;  3CC4 Q;  1FMV A;  4E7L A;  1KQ2 A;  3MHX A;  4MMK A;  1RLP C;  2VV5 A;  5I2S A;  4K11 A;  1YIJ A;  4M7D B;  5CK9 A;  4J9C A;  3I35 A;  2FG0 A;  2RNA A;  5GAM h;  5GAO p;  2G6F X;  1KC8 U;  3CCE T;  4M78 A;  2EKO A;  4ZTF A;  2RQV A;  3V8J A;  3CBP A;  4C0D B;  1SRM A;  5FU7 B;  3LYI A;  3THK A;  3H0I A;  3C12 A;  2ECZ A;  2QEX A;  3JCM J;  3MEU A;  2R5A A;  3L2W A;  2CH4 W;  1BIA A;  3I5R A;  5LJ5 e;  3HRT A;  2RF0 A;  2K2M A;  1VQP A;  3CPW P;  1PSE A;  2D0Q B;  1I5L A;  1NZ9 A;  2HQH A;  2CGH A;  3PIP A;  2MI6 A;  2XIC A;  1OU9 A;  3X24 B;  1V29 B;  2FZK B;  1ZSZ A;  1VIE A;  1A0N B;  2CP6 A;  3QDR B;  1U1S A;  4ZN3 A;  2YUO A;  3HKS A;  4QVD A;  1KK7 A;  3BFM A;  4C8Q B;  1H3H A;  2EQI A;  3RDV A;  3G71 A;  4OMF B;  2A36 A;  4AFS C;  1IZ6 A;  1QW1 A;  4OMM A;  2H8H A;  1GRI A;  1MHN A;  2RK2 A;  2X4W A;  3A8L B;  1S72 A;  4PJO G;  3JCM g;  1ZBJ A;  5GAO l;  3EG1 A;  4BY6 B;  2K9G A;  4F14 A;  1XNI A;  3O8V A;  2GFU A;  4JRQ A;  1OX8 A;  3OS5 A;  2GQV A;  2YRC A;  1X6O A;  1ZQ1 A;  1X43 A;  3L1A A;  3NTI A;  4A4G A;  1TXQ A;  4RCB A;  1I8F A;  2ZPH B;  2K57 A;  3JCM Q;  1ZLM A;  5FWC A;  3N5B B;  4J7I A;  4LXC A;  5GAM e;  1M5Q 1;  1YHQ Q;  1ABO A;  3X20 B;  3CC4 A;  3G4S Q;  2V8J A;  2L89 A;  3ER0 A;  3QJY A;  5A0D A;  1VQO Q;  2D8J A;  3G6E T;  2O01 E;  1K73 C;  3UF4 A;  3OY9 A;  4JRK A;  1FX7 A;  2LX9 A;  3I55 Q;  5LJ3 f;  1GBR A;  1G3T A;  3FDR A;  2ZAE A;  4XTU A;  2LQK A;  4ZNX A;  2AHJ B;  3CEY A;  3CD6 T;  3NGP A;  4RTU A;  3HRS A;  3QZ9 B;  3MPU B;  4C5H A;  4M78 D;  1QVG S;  2RMO A;  5KYW B;  1W1F A;  4M75 E;  2DFU A;  2RHU A;  4J9B A;  1IXD A;  2ZPE B;  2RI3 A;  1DJ7 B;  2JTE A;  3QXE B;  4HCZ A;  3RIR A;  4LDX A;  2PQW A;  2QA4 Q;  1MND A;  3V7S A;  1QP3 A;  2DIG A;  1U5S A;  2C0T A;  1JO8 A;  2H3J A;  2ROL A;  2E5K A;  3PVL A;  2PU9 B;  1RI0 A;  4IIO A;  3RMQ A;  1M90 R;  1Q82 C;  1LOJ A;  2JOY A;  2ZPI B;  1X69 A;  3X28 B;  2DIL A;  1MV0 B;  1YWP A;  2KDS A;  3MET A;  2K4Y A;  2LTO A;  3OYB A;  2L3R A;  1TG0 A;  1BI1 A;  2HKQ B;  4JLI A;  3TU4 K;  2JM9 A;  1SSF A;  2Y4X A;  3CCM Q;  5D6X A;  1HXD A;  2ABL A;  2QAS A;  1ZUU A;  3VUB A;  1ZA1 B;  2HBW A;  2K3B A;  2RK1 A;  3DB3 A;  2DBM A;  4AG1 C;  4M78 C;  3UDC A;  1GBQ A;  1LNX A;  1VUB A;  3QG1 A;  2RQW A;  1SKU B;  3RMS A;  2O9V A;  1VQN T;  1AWW A;  3CCE Q;  2DRM A;  3QSU A;  2ZPG B;  3EG2 A;  1IGQ A;  1YHQ A;  3UAT A;  2CYZ B;  1QP2 A;  3G4S A;  4M77 A;  3VU3 C;  5GMK l;  1MMG A;  5FRO A;  1VQO A;  1HD3 A;  1QVF S;  2BE7 D;  2K3X A;  1ZSZ C;  4M7D F;  3MP1 A;  3CCV Q;  1UTI A;  2E5Q A;  2ED1 A;  3EFO B;  3I55 A;  1WX6 A;  1O75 A;  1E6H A;  1WGS A;  2YDL A;  2VGN A;  3CQT A;  1IO6 A;  2NUT A;  3CBO A;  2HL3 A;  2LP5 A;  1K8A C;  2KRM A;  4Y28 E;  3L2V A;  3CCR T;  3BDL A;  3M0P A;  4CC4 B;  3VS0 A;  2NLU A;  5A0G A;  1UE9 A;  4GY5 A;  4O6J A;  2R57 A;  2DXB A;  1Z9Z A;  2F5K A;  3LX7 A;  2J05 A;  3CCJ T;  2HBP A;  2EYZ A;  3EGX B;  2DEU A;  1Q86 R;  3QDF A;  4MZP A;  5AT1 B;  1YI2 T;  3H0H A;  4F7U B;  2M1H A;  2QA4 A;  3S6W A;  2AKL A;  3HPW A;  2RQT A;  3JB9 I;  2DX1 A;  2B86 A;  2FPD A;  4XU0 A;  1VQP T;  2KAF A;  2EW3 A;  3MKD A;  4C8Q F;  4WF2 A;  4DQ2 A;  1JBM A;  4BB7 A;  3JCM b;  6AT1 B;  1UJY A;  4ZGD B;  1SPK A;  1VQ5 Q;  1VQ7 Q;  1NEB A;  4RKU E;  4QVC A;  1IRE B;  2DO3 A;  3HP9 A;  4D8D A;  3AT1 B;  2RQU A;  2E65 A;  2R58 A;  5CVI A;  2ED0 A;  3G71 T;  1CKA A;  3REA B;  2WSC E;  3CCM A;  1WJQ A;  2PVD B;  2ZGW A;  1OEB A;  4PJM A;  4ZN1 A;  1MMA A;  1S72 T;  1EFN A;  3GPL A;  3J80 E;  4FW1 A;  4F17 A;  5CKF A;  4OMO A;  3U23 A;  1V76 A;  1NJI R;  1D09 B;  2MCN A;  3HFO A;  1M1K U;  1VQL Q;  2ATC B;  2DTH A;  3CCE A;  5HKC A;  4J9H A;  3I5S A;  5CIU A;  4R0K A;  1UHF A;  4DEY A;  4PJN A;  2OTJ Q;  5LL6 S;  3CXC S;  1M3C A;  1UGS B;  2NWM A;  1C0M A;  3JAM E;  3CCV A;  5GAN 6;  3GF5 A;  2KK4 A;  3JB9 J;  2CP5 A;  4IUQ A;  1I4K 1;  3CMA T;  3M0R A;  3QJ6 A;  4J8O A;  4C92 E;  2CZ7 B;  1S1N A;  4Z8A A;  2CKK A;  4J9D A;  4N4H A;  3M4Y A;  1Y96 A;  1TSF A;  4RG2 A;  4NL2 A;  3GOX A;  4A4F A;  3HL8 A;  2EFI A;  2P4T A;  1OI1 A;  2K5F A;  2RJD A;  4IUP A;  2FZC B;  1XQH A;  4OB1 B;  1CKB A;  2EGE A;  2FRW A;  3PMT A;  4BE1 A;  1JEG A;  4RTW A;  2XK0 A;  1JJ2 P;  3CCQ Q;  3OB9 A;  2W0Z A;  3OS0 A;  4HKE A;  4Y91 A;  3KBG A;  4PFZ A;  3CBM A;  1EZZ B;  1WHL A;  2DIQ A;  3VYH B;  8AT1 B;  1GCP A;  1UUE A;  2JT4 A;  3JCM W;  5KCH A;  4LUD A;  3L2Z A;  1K73 R;  1IB8 A;  4C0G A;  3GP8 A;  1VQ5 A;  1VQ7 A;  4LE9 A;  4MML A;  2YUN A;  2RJF A;  2JXB A;  5FWB A;  2F1L A;  4PKC C;  1VQN Q;  3UWN A;  2P84 A;  4N4G A;  1CSK A;  4C5G A;  1OOT A;  1QQJ A;  3OMG A;  5KE2 A;  1KC8 C;  2MOX A;  4ZGE B;  3SDZ A;  2RJE A;  3FRN A;  3JSC A;  1FYN A;  2ZPB B;  2K3Y A;  1D0X A;  2QI2 A;  1VQL A;  3H9N A;  3JB9 F;  2A7Y A;  2X3W D;  4M7D D;  1M90 C;  4PJJ A;  3CCR Q;  2H3E B;  4EPC A;  1R0C B;  4MDX A;  1BCM A;  3TQ7 P;  2DYI A;  3OW2 A;  1UGP B;  5KYW A;  1Q82 R;  2D6F A;  3AHU A;  2AZV A;  2VGM A;  2JS0 A;  3CCJ Q;  4HT8 A;  1QKW A;  5CQX A;  4M77 B;  2PZ1 A;  3QII A;  5IT9 E;  4ME7 A;  1SRL A;  5CKD A;  4XTX A;  3V7R A;  1VQ4 T;  3OS1 A;  1FXX A;  2E64 A;  5GAN 2;  3CCS T;  1AEY A;  2LJ1 A;  4OB0 B;  2DL5 A;  1PG5 B;  2EYY A;  3A8M B;  5FW9 A;  2OTL Q;  2DXC A;  2K79 A;  2QDL A;  4EMK B;  3J7A F;  3CPW S;  2EJF A;  1RUW A;  2KT1 A;  2HQE A;  1BYM A;  4J83 A;  4RTZ A;  4J6Y A;  4FT2 A;  2DAQ A;  2CT3 A;  4RTX A;  1TOV A;  4F7U F;  5GAN 8;  4C8Q D;  2RQR A;  2YUP A;  1E6G A;  3QKJ A;  1K9A A;  2EIF A;  3VJP A;  2NUP A;  2DEQ A;  1D3B A;  1X2K A;  3PGG A;  4M7D C;  2DJQ A;  1FWZ A;  2EQJ A;  4R56 A;  4X9D A;  4PJO E;  3OYG A;  3VYG A;  3TSZ A;  2QA4 T;  2KR3 A;  4TVR A;  4HCK A;  3S3O A;  3CCL Q;  2L3S A;  5GAN g;  4FT4 A;  1OX9 A;  1HSQ A;  3OYA A;  2LQ8 A;  1G3W A;  1LJO A;  4C0D C;  4C92 B;  4DOW A;  5KYX B;  5FU7 C;  1OUL A;  4RTV A;  4A53 A;  1B34 A;  1SHG A;  5CCA A;  5I22 A;  1YJN T;  1WQW A;  1VQN A;  1T3S A;  2VKN A;  5CKH A;  2DZC A;  1H8K A;  4M75 F;  3ASK A;  3A98 A;  2YRV A;  2A08 A;  4OVA A;  2I0N A;  2JUF A;  3OMC A;  4M7A G;  2GCX A;  4M7D G;  3CCM T;  3NMZ C;  2EQM A;  3LH5 A;  3HRU A;  1WZO A;  2KE9 A;  4X9C A;  1W70 A;  1K76 A;  3EFO A;  2RI2 A;  4BI3 A;  3CMA Q;  1VQ6 Q;  4C8Q C;  4JRI A;  2QK0 A;  3VS5 A;  4MDW A;  2D8H A;  3CCR A;  3M0U A;  1U06 A;  2GTO A;  1N8R U;  2DPP B;  3CCU T;  3G1J A;  3SHW A;  1GCQ A;  5HK0 A;  4HVW A;  1AD5 A;  3TRE A;  1MUZ A;  2CZ1 B;  2CZ6 B;  2DTI A;  2O31 A;  1AHJ B;  2AIR B;  5IN1 A;  3H6Z A;  3GBQ A;  3P8B B;  1KD1 U;  3JCM P;  5GAO r;  3CCJ A;  3BE3 A;  2LRQ A;  2X9H A;  5IHN A;  1JJ2 A;  4BY6 C;  3EGX A;  1YI2 A;  1TWB A;  4J7F A;  2X4X A;  3UA7 A;  5IAY A;  3SFM A;  4F7U A;  3CCV T;  2AKK A;  4A4K A;  1I07 A;  2FRY A;  4C8Q G;  1NJI C;  4HCB A;  4OGE A;  4JZ4 A;  2OTL A;  2L8D A;  2GTJ A;  2EAY A;  1I1J A;  4ATO A;  1Y96 B;  5FRM A;  5CKE A;  2VB6 A;  5KCO A;  1HYO A;  2KXD A;  1Q81 U;  2AZS A;  1BIB A;  3V8L A;  3TVT A;  2YHT A;  5I21 A;  4PJL A;  1G8X A;  1ZUK A;  1T0H A;  2OJ2 A;  2ROT A;  3LGF A;  1JXO A;  2PUO B;  4ZTJ A;  3OYM A;  2F2W A;  4M75 A;  4M4Z A;  1WHJ A;  3CCL A;  2NUZ A;  3GNG A;  5LJ3 d;  4O5V A;  2LDM A;  2OI3 A;  3SEM A;  4XTV A;  3MP6 A;  4KBM B;  1RAB B;  2DVJ A;  1IHV A;  1WJR A;  4E7S A;  3FLG A;  1VQ5 T;  1VQ7 T;  2HZY A;  4ANJ A;  1YJ9 T;  5A0L A;  1GXI E;  4J5Y A;  3QHS A;  3JB9 D;  2JTM A;  1VQM T;  5GAN f;  4NS5 A;  4JS4 A;  4Y92 A;  1MMD A;  1M2V B;  3OYY A;  2LCS A;  3UT1 A;  7AT1 B;  2PNI A;  4M78 E;  1VQK T;  4FW2 A;  1ZX6 A;  4ZGJ B;  3CMA A;  3HTR A;  1YN8 A;  3EG9 B;  3L42 A;  2DD4 A;  3M58 A;  1VQ4 Q;  2DYB A;  5GAN 3;  3CCS Q;  3ZL7 C;  2WSF E;  4BAC A;  1PHT A;  1VQL T;  2FVU A;  4CC3 A;  2E10 A;  2BIV A;  1VOM A;  5CO7 A;  1Q95 G;  4IKF A;  4M77 F;  1KFZ A;  3DLL A;  4PK4 A;  4AFZ C;  3QO3 A;  1M8M A;  1HJD A;  5CQY A;  3QZ5 B;  1UGV A;  2OTJ T;  2X3X D;  3KFV A;  3FJP A;  2V1Q A;  3R6O A;  3VS7 A;  2C0I A;  2M9U A;  2EKH A;  3ZBD A;  1OZ3 A;  1NLO C;  1KC8 R;  4FSX A;  2XU8 A;  2VYT A;  2AT1 B;  1EIF A;  2DL8 A;  3CC7 T;  4DA4 A;  2KMT A;  3A8H B;  4HA8 A;  4NOY A;  2JS2 A;  5FLX E;  3L2U A;  3M57 A;  4GLK A;  2FO0 A;  2JMA A;  4JS5 A;  2KY9 A;  5KE3 A;  1YJN Q;  1PSF A;  1KIK A;  5HK3 A;  4JLG A;  2EGA A;  2F69 A;  3JCM d;  2HL5 C;  4BDZ A;  5AYF A;  2NUP B;  1D3B B;  3CCQ T;  2BZX A;  2L0A A;  2KRN A;  4C92 F;  1GCQ C;  4M75 D;  1OZ2 A;  1AWX A;  3M0Q A;  4KRT A;  1WNL A;  3NHN A;  4GLM A;  2NYS A;  2X4Y A;  2KNB B;  3P8H A;  3C0C A;  3CCU Q;  1B34 B;  2E3I A;  3X26 B;  2VXF A;  2MMP A;  1ACM B;  1BI0 A;  3WVD B;  1JQQ A;  3QBY A;  4NL3 A;  2PTK A;  2LCC A;  2V8K A;  2HMA A;  3RNJ A;  1MV3 A;  1JB0 E;  2M16 A;  2K7A A;  4E7J A;  2Z0W A;  3RUX A;  3JCM f;  2I2L A;  4FL6 A;  4X1V A;  2DK3 A;  5M9O A;  4DBR A;  1XOV A;  5LJ3 j;  1VQ4 A;  3CCS A;  2QDY B;  2CSI A;  4M78 G;  4HT9 A;  3OBY A;  4E7K A;  1N9S A;  4JUV A;  1I81 A;  4AT1 B;  2L5Q A;  1X27 A;  4HVU A;  4EMK A;  5GAN 5;  2EQU A;  4M75 C;  2FYK A;  1QCO A;  3F70 A;  4IUR A;  3VS6 A;  2SRC A;  2MF2 A;  4OB2 B;  3MEA A;  2EJG A;  3OW2 P;  4L5G A;  1NM7 A;  2OAU A;  1YIT T;  2CZ0 B;  2DRK A;  4PFP A;  1K9M U;  4OMN A;  2EGC A;  2VAS A;  4RG8 A;  1AZG B;  1ZBX A;  3GIB A;  2OX7 A;  4OMP A;  4CI0 C;  4PLI A;  3LGL A;  2EYQ A;  1JJ2 S;  2EQK A;  2QQB A;  4BDY A;  3PMI A;  3DB4 A;  3SB2 A;  4C92 A;  2OTL T;  5KYX A;  2L3Q A;  3I9Q A;  5CR2 A;  1YJN A;  4FYW B;  3I56 Q;  2PUK B;  1YBY A;  1BU1 A;  1RAF B;  2CUD A;  1AWJ A;  4PL6 A;  1YJ9 Q;  3VV0 A;  4BI8 B;  1WXT A;  2V8I A;  3OBW A;  3OYD A;  1VQM Q;  2LJ0 A;  4FYV B;  1WA7 A;  4Z88 A;  4M75 B;  3QWY A;  3CCL T;  4PFO A;  3PVQ A;  1VQK Q;  5DM7 R;  4RTT A;  2JM8 A;  4J9I A;  5GJW B;  1BCO A;  1PRM C;  3CCU A;  3BW1 A;  2DL3 A;  4JJD A;  4KGZ B;  1M2O A;  2P4R A;  4C0F A;  2RO0 A;  1Y7X A;  4QQG A;  1RAG B;  4KUL A;  4QW2 A;  4PJO F;  2DM1 A;  3VRZ A;  1LVK A;  4LD6 A;  5GAO q;  4M77 D;  2ZPF B;  4OB3 B;  1RI9 A;  3PFS A;  3VUZ A;  2K2V A;  2KVQ G;  1B3Q A;  1VQ6 T;  2QQA A;  2ZZD A;  9ATC B;  2FHD A;  4ELY C;  3CC7 Q;  4C5E A;  3Q1J A;  2DXU A;  1RAI B;  2RN8 A;  1HK9 A;  3QPH A;  4QKU A;  4JDS A;  2M0Y A;  2GGR A;  4XK8 E;  1PKS A;  1KQ1 A;  2BUD A;  3URG A;  4AMC A;  1UJ0 A;  1M9S A;  2E6N A;  1IGU A;  3NTH A;  3OYE A;  1VQ8 T;  1KG1 A;  5GJV B;  2QTV A;  2E6Z A;  2RH2 A;  3HSB A;  4J9F A;  4LUE A;  5D6W A;  1MMN A;  1VQ9 Q;  3A1P A;  2R5M A;  3A8O B;  5DLQ E;  2V26 A;  5L23 A;  5FU6 B;  3L2R A;  1TUD A;  2MPX C;  2MIO A;  3QUI A;  3OYN A;  3I56 A;  3E9F A;  5J26 A;  2CP7 A;  3FB9 A;  4C92 D;  3EG3 A;  1UGR B;  1KHC A;  4M77 C;  1BKB A;  1YJ9 A;  1K8A U;  1PWT A;  4JRP A;  3MJX A;  2XID A;  3H0F A;  4M7A E;  4M7D E;  1M4Z A;  1N8R C;  1VQM A;  2KBT A;  2COZ A;  1RAA B;  4IUU A;  4N0A A;  1M2V A;  2HQX A;  1VQK A;  2HEQ A;  3C94 A;  4FYY B;  2RA2 A;  4EMK C;  2FPE A;  4A4H A;  1KD1 C;  4D8K A;  1G3S A;  4PJO A;  2COW A;  2RB6 A;  2KSS A;  1G5V A;  3EG9 A;  1YWO A;  5EG2 A;  2BZ8 A;  4B6M A;  3LWH A;  3S3M A;  3CPF A;  3BY7 A;  4RMO A;  4M77 G;  1OQK A;  2ZCF B;  1UFF A;  5HY6 A;  1ARK A;  1PD0 A;  4N4I A;  3LW5 E;  2HKN A;  2OTJ A;  2HCK A;  1Y0M A;  3OSS C;  2E12 A;  2J6K A;  2JW4 A;  1RAD B;  4F04 B;  1OPK A;  1X75 C;  1R8O B;  4JZ3 A;  3EHQ A;  2XMF A;  3RBB B;  1YIT Q;  1M1K R;  1AOJ A;  4C92 C;  4R55 A;  3PE0 A;  4A4E A;  2HSE B;  3WVE B;  4C8Q E;  1QMC A;  1MGQ A;  2XDP A;  5LJ3 h;  3CC7 A;  4Q5W A;  2A0F B;  2IVW A;  3M5A A;  2XDB A;  5DLO A;  2GFA A;  2C06 A;  3MO8 A;  2IIM A;  1W2B P;  4FIB A;  5IHI A;  1V1C A;  1BB9 A;  1SHF A;  2PVO B;  4HVV A;  5IXF A;  1UG1 A;  3PNW C;  4LD9 K;  1SEM A;  4BI4 A;  3LH0 A;  2VXE A;  2QXF A;  3CCQ A;  1VQ9 A;  3INZ A;  2X35 A;  1OU8 A;  1VYT A;  2L2P A;  3MEV A;  3FC3 A;  2CS7 A; 
#chains in the Genus database with same CATH homology
 1VQ5 T;  1VQ7 T;  2CYZ B;  1QP2 A;  3G4S A;  1H64 1;  4M77 A;  3GNF B;  3VU3 C;  5GMK l;  4FM4 B;  5FRO A;  1YJ9 T;  4RCC A;  1BI3 A;  1VQO A;  1QVF S;  2P0P A;  4M7D F;  2K3X A;  5A0L A;  3OA6 A;  1Y71 A;  3MP1 A;  1GXI E;  4J5Y A;  3JCM c;  2E5Q A;  1QVP A;  1XTD A;  1VIF A;  3QHS A;  3CC7 T;  3I55 A;  2PVG B;  3JB9 D;  2JTM A;  2K5I A;  1VQM T;  1NE8 A;  2JTF A;  5GAN f;  4NS5 A;  4JS4 A;  1O75 A;  1WGS A;  4C8Q A;  2VGN A;  4BD3 A;  2P0Q A;  2K5L A;  3OYY A;  3UT1 A;  3CBO A;  2DVE A;  3HFN A;  4M78 E;  1G3Y A;  1K8A C;  1UGQ B;  2XHC A;  4Y28 E;  1VQK T;  3L2V A;  3CCR T;  4ZGJ B;  3QYH B;  4XTZ A;  3CMA A;  3BDL A;  5GAN 7;  4E7H A;  4EMG A;  3L42 A;  2DD4 A;  2NLU A;  3M58 A;  5A0G A;  5GAN 3;  1YJW A;  2WSF E;  2HD0 A;  1UB4 A;  4GY5 A;  4O6J A;  2R57 A;  2DXB A;  2F5K A;  3LX7 A;  4BAC A;  3KUF A;  4E7I A;  1VQL T;  2E41 A;  2FVU A;  3OYI A;  1YCY A;  3CCJ T;  1U1T A;  2E10 A;  4DOV A;  2LT4 A;  2HBP A;  3OYC A;  1Q7Y C;  4X34 A;  2BIV A;  2XDD A;  5CO7 A;  4EDU A;  4MZP A;  4IKF A;  1YI2 T;  4M77 F;  4VUB A;  4PJO D;  3DLL A;  3EFS A;  4F7U B;  1M1G A;  2XKO C;  4QQD A;  2M1H A;  3QO3 A;  3NFC A;  2JZ2 A;  5CQY A;  2QA4 A;  3QZ5 B;  3S6W A;  5J3B A;  2OTJ T;  4MZM A;  1Q7Y U;  3HPW A;  3FIF A;  3E1S A;  3JB9 I;  4UC4 A;  1P92 A;  3FJP A;  4XU0 A;  1VQP T;  3R6O A;  2KAF A;  2M9U A;  4L6V 5;  5LJ3 e;  3ZBD A;  4C8Q F;  1OZ3 A;  4WF2 A;  5LJ5 g;  3RKX A;  2HNI A;  4DQ2 A;  1JBM A;  2G3R A;  4BB7 A;  3JCM b;  1WQ7 A;  3JCM h;  4FSX A;  2XU8 A;  3E9G A;  2VYT A;  4ZGD B;  2RM4 A;  5GMK e;  2BKD N;  1RL2 A;  1EIF A;  4RKU E;  1YIT A;  4DA4 A;  4QVC A;  4M7A B;  1IRE B;  2KMT A;  2DO3 A;  3A8H B;  4HA8 A;  4NOY A;  5FLX E;  1WJS A;  3L2U A;  3M57 A;  3HP9 A;  4GLK A;  4HCC A;  3M9Q A;  2E65 A;  2R58 A;  5CVI A;  3V7C A;  3G6E A;  4LDV A;  4XU1 A;  3EFR A;  3G71 T;  2WSE E;  4C0Z A;  5GMK m;  4JS5 A;  5GAN h;  2WSC E;  3M4G A;  3CCM A;  1QVG A;  2KY9 A;  2B8A A;  5KE3 A;  1WJQ A;  2PVD B;  2ZGW A;  3MEW A;  4D6W A;  1PSF A;  2RHZ A;  5HK3 A;  4M7A D;  4J6W A;  2XD0 A;  4XTW A;  4JLG A;  2F69 A;  4ZN1 A;  3JCM d;  3CD6 A;  1Q81 C;  1S72 T;  4N0A C;  4BDZ A;  1JRI A;  3GPL A;  5AYF A;  3J80 E;  1D3B B;  3CCQ T;  5C6S A;  4M7A G;  2GF7 A;  5CKF A;  1M90 U;  4QVZ A;  2F5T X;  4XU3 A;  4C92 F;  1KD1 U;  3HFO A;  3TEE A;  4M75 D;  1M1K U;  4XQ3 A;  4PJO C;  3OSV A;  1OYX A;  3SWN B;  5GAN d;  2DTH A;  1YHQ T;  4LDY A;  3CCE A;  1OZ2 A;  5HKC A;  4LDU A;  4B9W A;  3LWI A;  3HHT B;  3G4S T;  3PTA A;  5CIU A;  1WNL A;  4L59 A;  2LT1 A;  1VQO T;  2X4Y A;  2LVM A;  2HAX A;  4QQ6 A;  2JVV A;  5LL6 S;  3P8H A;  3CXC S;  1UGS B;  1KHI A;  4XU2 A;  3I55 T;  1B34 B;  3G7Z A;  3X26 B;  2VXF A;  1W4S A;  2MMP A;  1O9S A;  3JCM X;  1BI0 A;  3WVD B;  2M0O A;  4M78 F;  3JAM E;  3PIO A;  4YTL A;  3CCV A;  3UPU A;  3QBY A;  5GAN 6;  4NL3 A;  3GF5 A;  4C92 G;  2LCC A;  2V8K A;  3CME A;  2KK4 A;  3JB9 J;  5I2M A;  1JB0 E;  4XAX B;  2M16 A;  1N9R A;  3I56 T;  4E7J A;  5GAM g;  4IUQ A;  1I4K 1;  3CMA T;  3QJ6 A;  4J8O A;  3RUX A;  3JCM f;  4C92 E;  4KUI A;  3OQ5 A;  2CZ7 B;  4MZT A;  2CKK A;  5LJ5 h;  2I2L A;  4BUG A;  3OYL A;  4FL6 A;  1YJW T;  2RJC A;  3SD4 A;  5CAI A;  4N4H A;  3L2Q A;  3M4Y A;  3M56 A;  1Y96 A;  2DK3 A;  4RG2 A;  4NL2 A;  5M9O A;  5LJ3 j;  1XOV A;  3A5Z B;  3GOX A;  2LNV A;  3RKY A;  4A4F A;  3HL8 A;  2EFI A;  2P4T A;  1N27 A;  2QDY B;  3CCS A;  1VQ4 A;  4M78 G;  3JB9 H;  4OP0 A;  3OBY A;  1OI1 A;  4HT9 A;  4M7A C;  1Y07 A;  3ZEH A;  3CXC A;  4BE2 A;  4E7K A;  1N9S A;  2K5F A;  2RJD A;  2YLC A;  2RI5 A;  3MEV A;  4IUP A;  4JUV A;  1XQH A;  1I81 A;  4IUV A;  3MP8 A;  2L5Q A;  5GMK j;  2MWO A;  4OB1 B;  1TH7 A;  4C5I A;  3OYJ A;  4EMK A;  4OGC A;  3PMT A;  2D9T A;  1VQ6 A;  4BE1 A;  4PJO B;  5GAN 5;  3JCM e;  5FRN A;  2EQU A;  3ME9 A;  3P8D A;  4KT0 E;  2XK0 A;  2MAM A;  5LJ5 d;  4M75 C;  4IUT A;  1W2B A;  3OB9 A;  2FYK A;  1M1F A;  5GMK i;  5GAN 4;  3OS0 A;  2WAC A;  4HKE A;  4Y91 A;  3F70 A;  3KBG A;  4IUR A;  1K9M C;  3CBM A;  2MF2 A;  3TCJ A;  4OB2 B;  4F7U E;  2DIQ A;  3VYH B;  3MEA A;  3SWN A;  4Z02 A;  1QVF A;  2EJG A;  3JCM W;  3JRZ A;  4L5G A;  5LJ3 g;  5KCH A;  2OAU A;  1YIT T;  2CZ0 B;  5GAN e;  2LC4 A;  1KQS S;  3L2Z A;  3E19 A;  1K9M U;  2QTX A;  2O4X A;  5GAO n;  4C0G A;  1Q86 C;  4RG8 A;  2RHY A;  3CC2 T;  3GP8 A;  3RES A;  3SWN C;  1VQ5 A;  1VQ7 A;  1ZBX A;  3GIB A;  2VC8 A;  1VQ8 A;  4MML A;  2RJF A;  4CI0 C;  4A54 A;  4PLI A;  3LGL A;  5KH6 A;  2EYQ A;  1JJ2 S;  2EQK A;  2QQB A;  3QYG B;  2XI9 A;  4PKC C;  3PMI A;  3DB4 A;  3UWN A;  5L8R E;  1NPR A;  3SB2 A;  1Q86 U;  4N4G A;  4C92 A;  4E7L A;  4C5G A;  2OTL T;  1KQ2 A;  3MHX A;  4PLL A;  3V8K A;  5CR2 A;  4MMK A;  1YJN A;  3OMG A;  3M53 A;  4E47 A;  2VV5 A;  2PUK B;  5KE2 A;  3OW2 S;  5I2S A;  1YBY A;  1YIJ A;  1KC8 C;  4ZGE B;  4M7D B;  4V2S A;  3SDZ A;  5CK9 A;  4PL6 A;  2RJE A;  3VV0 A;  5LJ5 f;  3FRN A;  4BI8 B;  5GAM h;  5GAO p;  3JSC A;  3X25 B;  2ZPB B;  2K3Y A;  2V8I A;  1KC8 U;  2EWN A;  3CCE T;  1X01 A;  3OBW A;  3OYD A;  4M78 A;  2EKO A;  4ZTF A;  1BI2 A;  3V8J A;  2QI2 A;  2RHI A;  3CBP A;  1VQL A;  4M75 B;  4C0D B;  3JB9 F;  2A7Y A;  4M7D D;  5FU7 B;  3LYI A;  1M90 C;  3CCL T;  3C12 A;  3PT9 A;  2QEX A;  3JCM J;  5DM7 R;  1M1K C;  3S3N A;  3MEU A;  3OYK A;  4EPC A;  2R5A A;  4KUD K;  3L2W A;  4MDX A;  1VQ9 T;  1BIA A;  3OW2 A;  1UGP B;  5LJ5 e;  3CME T;  3HRT A;  3CCU A;  3BW1 A;  2D6F A;  5GAM d;  4XTY A;  1VQP A;  2DD5 A;  2VGM A;  3AHU A;  1PSE A;  2D0Q B;  3C95 A;  3WXM B;  1I5L A;  3RKW A;  4HT8 A;  5CQX A;  4M77 B;  1NZ9 A;  1N6A A;  2CGH A;  3PIP A;  2MI6 A;  2XIC A;  3QII A;  5IT9 E;  3X24 B;  1V29 B;  3JB9 G;  3OS2 A;  4C0F A;  4ME7 A;  2P0K A;  1Y7X A;  2RO0 A;  4QQG A;  2E70 A;  3GLX A;  3OYF A;  1VIE A;  4LDX A;  2A3L A;  3FLG A;  3QDR B;  5CKD A;  1NJI U;  1U1S A;  4XTX A;  4ZN3 A;  3V7R A;  4KUL A;  4QW2 A;  4PJO F;  1VQ4 T;  3HKS A;  3OS1 A;  1FXX A;  2E64 A;  2JNG A;  2KQW A;  4QVD A;  5GAN 2;  3CCS T;  3BFM A;  2VUB A;  4LD6 A;  3T9N A;  4OB0 B;  4C8Q B;  4J6X A;  5GAO q;  3M59 A;  4M77 D;  2ZPF B;  3G71 A;  3A8M B;  1NPP A;  4OB3 B;  4OMF B;  3PFS A;  5GAN j;  3VUZ A;  2DXC A;  3J7A F;  4EMK B;  2K2V A;  3CPW S;  2EJF A;  2KVQ G;  1IZ6 A;  2HQE A;  1QW1 A;  1BYM A;  4J83 A;  2QQA A;  2ZZD A;  1VQ6 T;  2FHD A;  4J6Y A;  4FT2 A;  4ELY C;  2DAQ A;  3Q1J A;  2DXU A;  4C5E A;  1MHN A;  4F7U F;  5GAN 8;  1HK9 A;  3QPH A;  2RK2 A;  4C8Q D;  2X4W A;  3A8L B;  4II1 A;  1S72 A;  4JDS A;  3QKJ A;  4PJO G;  3JCM g;  5GAO l;  3DKM A;  4XK8 E;  4BY6 B;  2EIF A;  3VJP A;  5GAM f;  1WPY A;  2DEQ A;  1D3B A;  1XNI A;  3O8V A;  1KQ1 A;  3PGG A;  5DY9 A;  2GFU A;  4JRQ A;  4M7D C;  1FWZ A;  2EQJ A;  2O4X B;  2BUD A;  3EAE A;  4X9D A;  4R56 A;  3OYG A;  4PJO E;  3VYG A;  3OS5 A;  2GQV A;  3URG A;  2Y90 A;  1X6O A;  2QA4 T;  1ZQ1 A;  1M9S A;  2DTO A;  4TVR A;  2QQ9 A;  3S3O A;  2E6N A;  2QQS A;  3L1A A;  3NTI A;  3NTH A;  1ZHI A;  4A4G A;  4FT4 A;  3LLR A;  5GAN g;  3OYE A;  1VQ8 T;  1KG1 A;  2MWP A;  4RCB A;  4F7U G;  4M7A F;  2E6Z A;  2RH2 A;  3CPW A;  1I8F A;  2ZPH B;  2K57 A;  3JCM Q;  3OYA A;  3HSB A;  2LQ8 A;  5D6W A;  1G3W A;  1LJO A;  4C0D C;  4C92 B;  4DOW A;  5FU7 C;  2IG0 A;  3N5B B;  4J7I A;  2R5M A;  3A8O B;  5A2Q E;  4A53 A;  1B34 A;  5DLQ E;  5CCA A;  2DJZ A;  1YJN T;  1WQW A;  5FU6 B;  5GAM e;  1VQN A;  1M5Q 1;  5CKH A;  1YIJ T;  3X20 B;  3CC4 A;  2DZC A;  3L2R A;  4BDY A;  2V8J A;  2FL7 A;  3ASK A;  4M75 F;  3QUI A;  2L89 A;  2YRV A;  3ER0 A;  3QJY A;  5A0D A;  3OYN A;  3VKI A;  3E9F A;  5J26 A;  3FB9 A;  3I56 A;  4C92 D;  3G6E T;  2O01 E;  4FU6 A;  1K73 C;  4OVA A;  1UGR B;  4JJN K;  1KHC A;  4M77 C;  3OY9 A;  4EMH A;  2JUF A;  1FX7 A;  3H8Z A;  2LX9 A;  3OMC A;  1BKB A;  2GCX A;  4JRK A;  4M78 B;  5LJ3 f;  5LJ5 j;  3CCM T;  1YJ9 A;  1K8A U;  4M7D G;  4JRP A;  1G3T A;  5D6Y A;  4OF1 A;  2EQM A;  3FDR A;  2E1H A;  3KXT A;  4XTU A;  3HRU A;  3J81 E;  2LQK A;  2XID A;  4X9C A;  1K73 U;  4M7A E;  4M7D E;  5CKB A;  1M4Z A;  1N8R C;  1VQM A;  2RI2 A;  2AHJ B;  3CEY A;  4BI3 A;  3CD6 T;  3HRS A;  4CRI A;  2QEX T;  4IUU A;  4N0A A;  4C8Q C;  3QZ9 B;  4JRI A;  4C5H A;  2X4J A;  4M75 G;  4M78 D;  4MDW A;  2HQX A;  1QVG S;  4ELZ C;  1VQK A;  3CCR A;  3C94 A;  1N8R U;  2DPP B;  2RA2 A;  4EMK C;  4A4H A;  5HK0 A;  2YLB A;  3CCU T;  1KD1 C;  1KQS A;  3TRE A;  1G3S A;  4M75 E;  4PJO A;  2RHU A;  2CZ1 B;  2RB6 A;  1G5V A;  2CZ6 B;  2DTI A;  2KSS A;  5EG2 A;  2ZPE B;  2RI3 A;  1DJ7 B;  1AHJ B;  3QXE B;  4HCZ A;  3LWH A;  3S3M A;  3CPF A;  5IN1 A;  3RER A;  4ATO A;  3H6Z A;  3P8B B;  2RHX A;  3RIR A;  3JCM V;  3JCM P;  2FB7 A;  2PQW A;  5GAO m;  3DLM A;  4B9X A;  2LRQ A;  3BY7 A;  3C4S A;  3CCJ A;  4RMO A;  3V7S A;  3MCA B;  2JN0 A;  1JJ2 A;  1QP3 A;  4M77 G;  4BY6 C;  2DIG A;  1YI2 A;  4J7F A;  2X4X A;  2XG8 D;  2ZCF B;  5HY6 A;  4N4I A;  3SFM A;  5IAY A;  4F7U A;  2H3J A;  3LW5 E;  2OTJ A;  3CCV T;  3CC2 A;  4M77 E;  2PU9 B;  3OSS C;  1RI0 A;  4A4K A;  5GAO r;  2E12 A;  2RD1 A;  3RMQ A;  1UEB A;  1X75 C;  2DXT A;  1R8O B;  4C8Q G;  1Q82 C;  1NJI C;  4OGE A;  4HCB A;  1LOJ A;  2JOY A;  2ZPI B;  3X28 B;  3ZFJ A;  2OTL A;  4C92 C;  2L8D A;  2Y4Y A;  5C0M A;  2EAY A;  4BE0 A;  2KDS A;  3MET A;  2K4Y A;  2LTO A;  4R55 A;  4A4E A;  1U8R A;  3WVE B;  1Y96 B;  2L3R A;  4C8Q E;  3OYB A;  1BI1 A;  4PNO A;  4JLI A;  3M54 A;  2DZ9 A;  5CKE A;  5FRM A;  1MGQ A;  5J39 A;  3TU4 K;  2XDP A;  5FU6 C;  1Q82 U;  5LJ3 h;  3CC7 A;  4Q5W A;  2IVW A;  5KCO A;  1SSF A;  3M5A A;  1H3Z A;  2Y4X A;  2XDB A;  5DLO A;  4M7A A;  5D6X A;  4M7D A;  1HXD A;  2GFA A;  2C06 A;  3A8G B;  3MO8 A;  3M55 A;  5GAM j;  1Q81 U;  1BIB A;  3V8L A;  3VUB A;  5GMK h;  2YHT A;  5I21 A;  3FEO A;  3NTK A;  2RK1 A;  3DB3 A;  3LGF A;  4FIB A;  4LDW A;  4M78 C;  3UDC A;  2QQR A;  2PUO B;  1LNX A;  2PVO B;  3OYH A;  1VUB A;  3OYM A;  4ZTJ A;  3QG1 A;  4M75 A;  3PNW C;  3CCL A;  4LD9 K;  1M8V A;  3GNG A;  4BI4 A;  3LH0 A;  3RMS A;  2VXE A;  2EJ9 A;  5LJ3 d;  3BDU A;  4O5V A;  2LDM A;  2QXF A;  3CCQ A;  1VQ9 A;  1VQN T;  4P5N A;  3INZ A;  2X35 A;  3CC4 T;  3QSU A;  4XTV A;  3MP6 A;  2ZPG B;  4KBM B;  2DKG A;  1W2B S;  1YHQ A;  2LCL A;  1WJR A;  3FC3 A;  2CS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...