4M7DE

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
77
Chain Sequence
b'PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 77
sequence length 82
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dE00
4M77E 1WQ7A 4PJOG 5LJ3j 3HFNA 2E64A 4XTUA 4C8QC 2QTXA 4X9DA 5LJ3f 3RKXA 5GAOn 4M75E 3SB2A 3JCMf 5GANg 2DZ9A 5GAMd 4XTYA 4XQ3A 3RKYA 4C8QF 5LJ5e 5GAMh 3V7CA 4XTWA 4C8QE 4M77A 2HNIA 2JN0A 3INZA 2YLBA 3BW1A 1JBMA 2E65A 2EJGA 5GANj 1M8VA 2VXEA 2DVEA 4X9CA 2RA2A 4M7DF 4NL3A 5GANf 1KQ1A 1WQWA 5GAOl 1WNLA 4M7DD 4C8QA 3JCMb 3JCMW 4M7DC 3M4GA 5GAMe 4F7UG 4M7DB 4PJOD 4J5YA 2EJ9A 4PJOB 1BIAA 4M75F 4EMKB 5LJ5h 2DKGA 3V7SA 4WF2A 1LOJA 3JCMV 3JB9I 4M7DE 3SWNB 4M75C 5GMKe 3JCMQ 4MMLA 2DZCA 1HXDA 3JCMc 4C92G 2E41A 4M78G 5DY9A 2YHTA 3VU3C 3AHUA 3JB9H 1Y96A 3FJPA 1WPYA 4M7AG 2FYKA 3FB9A 3RKWA 5LJ3d 2EWNA 3JCMd 3JB9J 4QVCA 1U1SA 4F7UF 4RCBA 3JB9G 3BDUA 5GAN6 3BFMA 5GAN2 1I8FA 1KQ2A 4F7UB 1D3BB 3RERA 4M75A 4XTVA 5GAMg 1LNXA 5GMKh 1N9SA 1MGQA 2DTIA 1M5Q1 3QHSA 4J6XA 4NL2A 4XTZA 4PJOF 5GAN4 4HT8A 3EFSA 2DTOA 4F7UE 5GANd 4C92D 5CAIA 4M78D 5I21A 4J6WA 2E10A 4PJOC 3JCMe 3L1AA 4C92B 4M78B 4MMKA 3V8JA 4EMKC 5GAMj 4A53A 3JCMP 2ZGWA 3V8KA 2Y90A 4NOYA 2RD1A 4OP0A 4RCCA 4XTXA 3SWNC 3V7RA 3RUXA 3JCMX 4M7AD 4C92E 4M7AB 4PJOE 3JCMJ 2RB6A 1B34B 2YLCA 4HA8A 5LJ5g 4JLIA 3JB9D 3GIBA 2EAYA 1I5LA 2FB7A 4C8QG 5GMKm 4M7DA 2K57A 2DXUA 4PJOA 5LJ3h 3L2ZA 4EMKA 3JCMh 1I4K1 5LJ5j 1YCYA 2DJZA 5GAOp 3SWNA 1X01A 3BY7A 5LJ5f 5GAOr 1I81A 4M77D 5GMKl 5GAN5 2I2LA 4JRIA 4M77B 4M78F 4C92F 5GAN8 4HT9A 4EMHA 4XU3A 1U1TA 4V2SA 3HFOA 4C92C 4M78C 5LJ3e 1LJOA 5GANh 4M7AF 4DQ2A 4N0AC 5GAOq 2VC8A 4M77G 3RESA 4C8QD 5GAN7 5GAMf 4M7AC 1BIBA 2E1HA 4C8QB 4M78E 3JB9F 4F7UA 4M75G 1D3BA 4PNOA 2DXTA 1JRIA 5GMKj 5GAN3 2DEQA 5GAOm 4M7AE 5GANe 3EFRA 2RM4A 3RIRA 4QVDA 1H641 2DTHA 3FIFA 4JUVA 3V8LA 4A54A 4C92A 4M78A 4EMGA 4XU2A 1Y96B 1TH7A 4XU0A 4N0AA 3HSBA 4M77F 4JRKA 2VXFA 4M7AA 4XU1A 2CGHA 5GMKi 4M77C 1B34A 3QO3A 3JCMg 4Y91A 2EJFA 5LJ3g 5LJ5d 3QSUA 1N9RA 1HK9A 4M75D 3QUIA 3PGGA 4M7DG 4J6YA 4M75B
chains in the Genus database with same CATH superfamily
2K4YA 3SHWA 2EYZA 1VA7A 1OYXA 1SHFA 2KBTA 1VQKQ 4C8QE 2QGFB 4MZPA 2YLBA 5CKBA 2LJ0A 4OGEA 4PK4A 1M8VA 4CI0C 1EZZB 1X6BA 3GP8A 4M7DD 2EYXA 3E1SA 1K4US 3JCMW 5GAMe 1H92A 1YWPA 1BIAA 2D9TA 4AFUC 3CCUQ 2HDAA 1PRMC 1LPLA 6AT1B 3CC4T 2XDDA 2KI7A 3MP6A 1YJ9Q 1Q86U 1YITA 1T3LA 2XICA 4M75A 1LNXA 3CCVT 3CCMQ 2LQWA 3CBMA 3OYGA 2XDPA 2DRMA 2B8AA 5GJVB 3A1PA 2Y90A 2DX1A 4RCCA 1MMGA 3MKDA 3O5ZA 4PJOE 3CCSQ 2HL3A 2IVWA 3QYHB 1G3TA 4C8QG 2DO3A 4ZGJB 5LJ3h 2L3SA 2X4JA 1VQ8T 2LJ3A 1WXUA 4GLKA 2COYA 2K3XA 4C0FA 2RJEA 2M16A 4J9IA 1AZGB 2PUKB 1M27C 3JAME 5FLXE 1MMDA 2DXTA 2XG8D 2V1QA 4LD6A 4A4FA 4M7AE 1NYGA 2G3RA 1AWXA 3TVTA 2BKDN 4ME7A 1K9AA 1KQSP 4QT7A 2E12A 4M77F 2FZKB 1QVFA 5LJ5d 1QVPA 1YP5A 4AT1B 1UB4A 2DM1A 3EFOA 2DFUA 1VQ7Q 4J6YA 4M75B 4PJOG 5KYWA 4E7SA 3NTHA 1VQLQ 4X9DA 3RNJA 3EGUA 4LN2A 2PTKA 1GFCA 4PJNA 5FRNA 2PVGB 2NWMA 2EGEA 5D6XA 1QWFA 3OYHA 5EG2A 2EGCA 2DERA 3SEMA 3H6ZA 2DKGA 2RHXA 4OMMA 3TREA 4GBQA 2JNGA 5DY9A 2EYWA 1OX9A 2E4HA 1PHTA 1MMNA 3E9GA 2RJFA 3H8ZA 3L42A 3RKWA 3G71T 4M7AG 2KXCA 3ULRB 1FMWA 3NTKA 1VQ5A 1UHFA 1BCMA 4XTZA 4HT8A 1UUEA 4DOVA 2C0IA 5I21A 2PUOB 3CPWA 4EMKC 4Z88A 8AT1B 3RUXA 2YXYA 2YLCA 2YRDA 2KQWA 2AKKA 3EFOB 3C4SA 1PKSA 5KYWB 2JW4A 3SD4A 2QEXQ 1X01A 5GAOr 2DAQA 1W70A 3D7SB 5GANh 3VS0A 1WHMA 4DQ2A 2DE0X 4C8QD 2J06A 2QQBA 5GAMf 1X2QA 2P0PA 1JRIA 2HMAA 5FROA 2KR3A 1W2BA 2GF7A 5CVIA 4C92A 2RI5A 2DLPA 3CCJA 5GMKi 2A28A 2FHDA 1ZX6A 2A0FB 2K5LA 1GFDA 2RH2A 5CK9A 4E47A 2PNIA 3S3OA 3EG0A 2J7IA 3A8OB 4XK8E 1M3CA 4BI3A 2YUOA 2FRYA 1TG0A 1YIJT 3EG1A 2VVKA 5CKFA 1KD1U 2GFUA 2BTTA 2JMCA 2A36A 2FO0A 1YHQT 3BDLA 2KGTA 1ACMB 4PJOD 4FT4A 3KFVA 1NPRA 4ZN3A 1IXDA 4ESRA 2MYSA 2EQKA 1QQJA 4N4HA 1MV3A 4KH1B 2DZCA 1AD5A 1UG1A 3EAEA 1RI0A 2YHTA 3E2UA 1Q81R 2X4WA 2DXCA 1Y96A 3EG3A 2EW3A 1UGPB 2LTOA 1RAIB 1VQKT 3TSZA 2LVMA 3HRSA 1QKWA 2GQVA 1RLPC 1U3OA 2KRMA 2A7YA 5GAN6 3I55Q 3RERA 1TUCA 2E5KA 2K2MA 1M3AA 4F7UE 3CCUT 1NLPC 4C92B 3C0CA 3V7RA 4M7AD 2YDLA 3VS4A 1WIEA 2DNUA 4MZTA 1YJ9T 2R5AA 3MJXA 2AT1B 3ER0A 3PIOA 3L2ZA 1VQMA 3CCMT 1BYMA 4JJDA 2X4XA 1K9MC 1QVGP 1JJ2A 2ROLA 2F2XA 4V2SA 3ZL7C 3CCEA 4B9XA 3CCST 1W1FA 3OYMA 5D7UA 3VS6A 2BZXA 1WJSA 4FW1A 3GNFB 3EH2A 5I2MA 1GXIE 4MDXA 5I11A 2EKOA 1AWJA 1Y96B 3EG9A 4N0AA 3HSBA 4OB0B 2O2OA 3VS2A 3SFMA 2EJFA 3A98A 3OS1A 1YJWA 3WVDB 3QUIA 4C8QF 1VQ6A 1WQ7A 1XTDA 1C6VX 2E64A 4YTLA 3VS3A 1D09B 4DBQA 4XTWA 3OYLA 4P5NA 4M77A 3M0RA 2QAZA 3CEYA 4RUGA 2KY9A 2EYQA 1WNLA 2OI3A 5GAOl 2GFAA 1JEGA 2DJQA 3I35A 1VQ7T 1BBZA 2A08A 3JCMV 1D0XA 4BD3A 3JB9I 1VQLT 2XD0A 3MEUA 1M1KR 3EG2A 2JTEA 1WHGA 5LJ3d 1U1SA 3CBPA 2H3JA 1SKUB 3M54A 5GAN2 1VIEA 1SRLA 2XIDA 4PJOF 1K8AR 3CXCS 3CCRQ 4BE1A 3HHTB 2CH4A 5IHNA 3UATA 2ZGWA 3EG9B 3V8KA 1ZBXA 3URGA 3SWNC 3M4YA 4OP0A 2F5KA 1X2KA 2ROTA 1AOJA 3OSVA 2Z0WA 3GIBA 1I5LA 3HKSA 3NFCA 1KQSA 3OW2S 2QI2A 1NM7A 4M7DA 3OYIA 1QMCA 2EFIA 2HSPA 4JS4A 1UFFA 3PVLA 4HXJA 2KDSA 2JXBA 4M77B 4HT9A 3G6EQ 1VQ4A 2JM8A 1O9SA 1BU1A 1NEGA 4M7AF 3TQ7P 4M77G 1UGQB 4ATOA 1QCOA 3CCQQ 2RN8A 1T0HA 2QEXT 4RTWA 1UHCA 1Q82R 3QIIA 3UT1A 5DLOA 4AFZC 1N8RC 1MNDA 1TH7A 1B34A 1KC8R 2RJDA 2LP5A 3CMAQ 4XTUA 3SB2A 4FW2A 5GAMh 2VV5A 2OX7A 1C0MA 2JN0A 2ZPBB 2KYBA 2XU8A 4OMOA 3HPWA 3CD6A 2FPEA 1D1BA 2KRSA 2RMOA 4OVAA 4X9CA 1VQ9Q 5KE3A 3REAB 1B3QA 2DL3A 3M55A 1IO6A 2K79A 4M7DB 5A0DA 2FVUA 3I56Q 2E6ZA 2FL7A 3C12A 3VUZA 1KIKA 3WXMB 2G6FX 4CC2A 4A4KA 3A8LB 2MCNA 1IHVA 1S72Q 1VQ8A 3NMZC 3CC2Q 2D0NA 2DF6A 2EYYA 3BDUA 3H0HA 4RKUE 1R77A 5GAN4 1KHCA 1MHNA 2H8HA 4LXCA 5GANd 3FRNA 2FPDA 2QA4Q 2CH4W 1T3SA 3VS5A 3GPLA 2XI9A 4K11A 2ZAEA 1K9MR 2V8IA 5HKCA 2M0YA 1B34B 3M58A 1CKBA 4E7KA 7AT1B 3LWHA 2K57A 3I55T 2LRQA 1I4K1 1RABB 2DL7A 2L3QA 2KYMA 4FYYB 2CUBA 1M1GA 5A0GA 3NPFA 4M78C 4IIMA 2AZSA 2LX7A 4KGXB 2RI3A 3MEWA 2FRWA 3GBQA 4BY6B 1SF9A 3VRYA 1GRIA 4R0KA 3V8LA 4EMGA 3OS0A 1TOVA 2F2WA 1VQOA 2K3YA 2RPNA 3NGPA 2IG0A 3EGDA 1ABOA 4OB1B 2AHJB 1QCFA 3G71A 2KSSA 2DA9A 3OMGA 2ZZDA 3F70A 4XTYA 5LJ5e 1V1CA 1JBMA 2M02A 4ELZC 2RA2A 1N6AA 3CQTA 1RADB 2HEQA 3U23A 3H41A 4HVUA 1PG5B 1X6OA 4C8QA 1OOTA 2HD0A 8ATCB 1YITQ 4HVVA 4C0DC 4PFPA 3FLGA 3AHUA 3MEAA 1RAFB 1Q86C 2KEAA 4E7LA 1EIFA 1X75C 3FB9A 1QVGA 4F7UF 4RCBA 3JB9G 4MZMA 4XTVA 2HZYA 3UDCA 2CDTA 1MGQA 2DTIA 2ZPIB 4AFQC 4N4GA 1D1AA 4KULA 4PLIA 2DEUA 2ZPEB 2AK5A 2HKNA 5C6SA 5A0LA 1EX4A 3JSCA 1NPPA 1OI1A 2DD5A 2CS7A 3OS5A 1W6XA 2RK2A 3EGDB 2X51A 1RL2A 2MK5A 5I2SA 4PJOA 3OYJA 2MF2A 1ARKA 5GAOp 4IIOA 4DEYA 3CCRT 1Q81C 4EPCA 2CZ7B 4IUPA 4IUQA 1YFNA 2BIVA 5EC7A 1XQHA 3L2VA 2J6OA 1N8RR 2COWA 1K76A 2E1HA 4C8QB 4M78E 4EDUA 2EVRA 4L6V5 1VQNA 3N5BB 1YHQA 3TSWA 4JUVA 1BI2A 1QKXA 1VIFA 3RDVA 3G6ET 4M7AA 3H9NA 2NYSA 3TCJA 4KH0B 3J7AF 1HK9A 2HCKA 3CCQT 3X24B 3S3NA 4M75E 4LDXA 2JJ9A 4PLLA 5D6YA 4TVRA 4LDUA 4Y92A 5CQXA 3UWNA 4CC4B 4M4ZA 4PJLA 4FM4B 1JXMA 4PJOB 1VQ5Q 2QDYB 4IKFA 3CMAT 1MUZA 1UECA 1GCQC 4M78G 2DVJA 2V1RA 1SRMA 2LZ6B 2MIOA 3CCMA 4MDWA 1VQ9T 4VUBA 1YJNA 2JZ2A 4FYWB 1E6HA 3CCSA 3I56T 1CSKA 4JJNK 2JOYA 5FU7B 2OAUA 2JMAA 1OPLA 4M7AB 1S72T 1S1NA 1NG2A 1XOVA 4RMOA 5LJ5g 3JB9D 4ZTFA 3CC2T 3M9QA 3THKA 1TSFA 2IIMA 4ANJA 5LJ5j 3JCMh 2RQTA 3EGXA 5LJ5f 1Q7YU 4RTYA 1PSFA 2IPOB 2CP2A 1M1KC 2QA4T 2I2LA 3VKIA 1OU9A 3CCLA 4XAXB 3CCJQ 5KYXA 5J26A 4RG8A 4F04B 4KBMB 4AG2C 1K8AC 2VKNA 2WSCE 4IUUA 4QVDA 2CT3A 4A54A 2O9VA 1AEYA 2PVOB 2RJCA 1EFNA 2GGRA 4LDYA 2RQVA 2VXFA 2CP5A 2K5FA 3QWXX 2CGHA 1VQLA 2JS2A 1G3WA 4Z8AA 2DL4A 2CP7A 4OMFB 1M3BA 3LX7A 4WTOB 2R57A 1IB8A 1KD1C 5KCHA 1KQ2A 2NUZA 3LGFA 3LH0A 3OBWA 1YI2A 2MWPA 4RTTA 3MEVA 4J9FA 3J81E 4BE2A 3OYCA 2CZ0B 1TU0B 1Q86R 4J9DA 5D6WA 4J5YA 4J7FA 2M0OA 4L59A 2A37A 1Q82C 1SHGA 3EGXB 3P8DA 2YWWA 2W0ZA 2BZ8A 1HXDA 3OS2A 4HKEA 4J9BA 3JCMc 4R55A 3GLXA 3EH1A 1V29B 1SEMA 4LD9K 3JB9J 1PM3A 5KYXB 1WJRA 1KC8C 2K9GA 3VUBA 1WGSA 4A4GA 3MPUB 4C5GA 1OULA 5GMKh 1D0YA 1N9SA 1YITT 1ZUKA 1VQMQ 4M78D 4KT0E 3CXCP 1TUDA 2CSQA 2OTJA 1SSFA 2YSQA 4C92E 2QEXA 2RB6A 1PC0A 4IURA 1ABQA 2LQKA 2EAYA 3QJYA 2PU9B 1KQSS 3NHNA 4BE0A 3OW2P 4EMKA 2DRKA 2E5QA 2BE7D 3T9NA 2RQWA 1X6GA 1BK2A 1G2BA 4FYXB 1QLYA 4ORZA 2VC8A 3RESA 5GAN7 1E6GA 1UJ0A 3JB9F 3FJ5A 1O75A 1D3BA 4B6MA 1HD3A 1GBRA 3MO8A 2CP3A 1WYXA 4DOWA 2LQNA 4FU6A 3RIRA 4X1VA 1TTHB 5L23A 4LUDA 1PCXA 2VUBA 2JT4A 1QW1A 4PJMA 2LCSA 4RTZA 4FL6A 2XHCA 5CR2A 1QWEA 2L2PA 3OQ5A 4J8OA 1OV3A 2CUDA 3X25B 2QQSA 3M0UA 3OYKA 2D8JA 2JVVA 1FMVA 1W4SA 4C5IA 1ZUYA 2L5QA 4ZN1A 2JS0A 1ZUUA 2L3RA 1G83A 3QPHA 4NL3A 2GBQA 4M7DC 3FC3A 4F7UG 5GJWB 4RTXA 2DBMA 1PWTA 4EMKB 3OY9A 3I9QA 4A63B 4FCYA 4WCIA 3UF4A 2HQHA 1RUWA 4E7ZA 2XKOC 4GLMA 2E41A 2OAWA 3VU3C 1NYFA 4KUDK 2MWOA 5FWCA 2HBPA 1K0XA 4OB2B 2EWNA 2P84A 4D8KA 3G4SQ 4QQ6A 2BZYA 1K1ZA 1D3BB 1U5SA 3RMQA 1VQ5T 3G1JA 4HCZA 1M90U 3L2QA 2QQRA 1RAGB 1VQPA 2RQUA 1RAAB 4OMPA 1VQ4Q 2E3IA 4JLGA 1NJIU 1UE9A 3M57A 1K73U 2CSIA 3QXEB 3OYFA 3H0FA 1YCYA 1H3HA 1JQQA 3OSSC 3BY7A 4QVZA 5GAN5 1I07A 4M78F 2D8HA 5AT1B 2OTLA 1M30A 1SPKA 2ECZA 2J6KA 2ZCFB 1ZSZC 3RR6A 1PNJA 1Y71A 3QDRB 1UGVA 4IUTA 2JM9A 3KXTA 3ME9A 3CMEA 1WDXA 2QQAA 3FIFA 3OMCA 4FT2A 1KD1R 4JS5A 5LJ3g 2QYZA 3CCJT 3CD6Q 3META 3A8GB 4JJBA 5CIUA 1D1CA 5LJ3j 1I0CA 2RO0A 5GAOn 5LJ3f 5J39A 3RKYA 4BI4A 1WJQA 4OB3B 3O8VA 1R0CB 2E65A 1GL5A 2Y4YA 2SEMA 1F1BB 4DBRA 2DVEA 1D0ZA 4DBHA 4E7IA 4BACA 1KK7A 3L2UA 2AKLA 3M0SA 4HCCA 1A0NB 1WXTA 1NBEB 3CC4A 4M7DE 2EKHA 3JCMQ 4MMLA 1TXQA 4F16A 3JRZA 2NUPA 1OZ2A 3JV3A 1WPYA 2AZVA 1LCKA 2FPFA 3WVEB 3JCMd 1OEBA 3CCVA 3BFMA 3S3MA 4J6XA 1M5Q1 3PFSA 4J83A 3EFSA 3QZ5B 1M1FA 3L1AA 1E7OA 2RF0A 2I0NA 2WACA 2PVDB 3H0IA 1CKAA 2LNHB 2EGAA 1NZ9A 4ZTJA 1ZLMA 1BKBA 2DJZA 2L3PA 3SWNA 1I81A 2ZPFB 1VQMT 1FXXA 1QP2A 2WSFE 3CCQA 2KVQG 1X43A 2HKQB 2X9HA 4OMLA 1VQOQ 3L2RA 3CC7Q 3L2WA 2DEQA 2CYZB 1IREB 1AZEA 1RAHB 2XMFA 2R58A 2GCXA 2QGGA 5IHIA 3OYBA 4XU0A 2NUPB 4OF1A 1UJYA 4NS5A 1Z9ZA 2VB6A 4B9WA 1JO8A 4Y91A 3DKMA 1UTIA 5FU6B 1T0JA 1KG1A 3MP1A 2CREA 2D6FA 2KAFA 5J3BA 5GANg 2DZ9A 4R56A 4Q5WA 3V7CA 1B7TA 2HNIA 1WHKA 5GANj 2VXEA 5GANf 3CXCA 2DILA 1HYOA 3M53A 1WZOA 5IN1A 1QVFS 2EJ9A 1S72A 2J6FA 1YWOA 4LE9A 3SWNB 3GOXA 3P8HA 4M75C 1OQKA 1AHJB 3OW2A 1PD1A 2K2VA 4ZNXA 2QA4A 3VV0A 4FYVB 1FMKA 2NUTA 3OBYA 4PFZA 4NL2A 3QHSA 4C0ZA 1KJWA 1G5VA 2YUPA 2FEIA 1ZHIA 3V8JA 3DLLA 2COZA 4J9HA 2FZGB 3I5SA 2F5TX 3ZFJA 3PIPA 2P4TA 3G4ST 5AYFA 1ZSGA 4D6WA 1VQNQ 4OMQA 4KGZB 1IZ6A 4JRIA 4LUEA 5GAN8 5KCOA 3HL8A 4RTUA 2KXDA 1N5ZA 1R0BG 3CPWS 1VQ4T 2HQXA 2HQEA 2HAXA 2DIQA 2DMOA 5LL6S 2ED1A 4ZGEB 1KHIA 1G8XA 3EFRA 4F17A 2PZ1A 1YNZA 4M78A 5CO7A 2K6DA 4QW2A 2BE9B 3M0QA 2V8KA 2D1XA 2X3WD 2P0QA 4DA4A 2NUTB 2DD4A 2FG0A 4J9GA 1GCPA 2YUQA 1YIJA 3G7ZA 3QJ6A 2E6NA 4XQ3A 2LX9A 2O01E 1Y7XA 4PFOA 2MMPA 4LDVA 1W2BS 2X35A 3QDFA 3CD6T 2K3BA 3JCMb 1Y0MA 1Z9QA 3VJPA 1YJNQ 3R6NA 4WF2A 1U06A 2R5MA 1VQKA 1AT1B 3HRUA 3JB9H 3FEOA 3QYGB 4UC4A 4C0GA 2ED0A 3UA7A 5KYUA 1SSHA 3M0TA 4BDYA 1OX8A 4QVCA 1K0SA 3REBB 4KUIA 4JPBW 2EQIA 2CP0A 2CP6A 3QBYA 4JZ3A 2A3LA 5HCKA 3CCUA 1NE8A 3ASKA 2E10A 3QWYA 4D8DA 1Q81U 2WSEE 1M4ZA 4M78B 3LYIA 4A53A 2X3XD 4C5EA 1YJ9A 4JLIA 3RMSA 3CCLQ 2LDMA 5I22A 3C95A 1Q7YC 3PVQA 5CKEA 1WHHA 4CRIA 2KNBB 3I5RA 1TS9A 1MNEA 3LGLA 4BUGA 3PMTA 1UDLA 4QKUA 4C92C 1WHLA 5GAOq 1BIBA 2ABLA 2RHZA 9ATCB 4M75G 2P4RA 4J7IA 5GAOm 3QKJA 2DTHA 2QDLA 1Y07A 3R6OA 1YI2Q 2YRVA 5DM7R 3UPUA 2QXFA 2EQJA 5KYUB 4XU1A 2HSEB 1PRLC 1JJ2S 2VGNA 1VQOT 2KT1A 3VYGA 2GTJA 4C0DB 3CC7T 2VASA 2GNCA 3ZBDA 2QTXA 2CZ1B 5GAMd 1IHWA 4KGVB 4HCKA 4LDWA 2F69A 1JXOA 2J05A 3OYAA 4FIBA 1MMAA 4M7DF 1TUGB 2F2VA 5HK0A 1VQ7A 4X34A 1G3SA 4DBFA 2KROA 3M0PA 4A4HA 3VS7A 3DB3A 3LW5E 5FW9A 2KE9A 4RTVA 1KFZA 1HSQA 2FYKA 2OTJQ 2RI2A 1BI1A 4O5VA 3PMIA 2RHUA 2YUNA 5GAMg 1GCQA 2HBWA 2LMJA 3QZ9B 2DPPB 5CAIA 1M1KU 3BE3A 1NEBA 5A2QE 5GAMj 3JCMP 2RNAA 4PL6A 4AFSC 4CC3A 2DYBA 4NOYA 3JCMX 3JCMJ 2DL5A 3DLMA 5CKDA 4Y28E 1K8AU 2BUDA 1PKTA 1WLPB 2FZCB 3LLRA 2RHYA 1WA7A 4F14A 1BI3A 2ENMA 5CQYA 5LJ3e 1JU5C 4OGCA 4N0AC 4JZ4A 4Z89A 2XDBA 3PNWC 3HTRA 1XNIA 2DBKA 4F7UA 4PNOA 3FDRA 1WXBA 3CCEQ 1WFWA 4J9EA 3OA6A 1VYUA 3DB4A 2RM4A 3C94A 1H641 1X27A 1VQNT 5HK3A 2E70A 1ZQ1A 4QQDA 1G3YA 2VYTA 2JTMA 1KSWA 1B07A 4FSXA 4M77C 2QG9B 1WHJA 4M75D 3PT9A 1AWWA 3PGGA 2HL5C 1Q82U 4KRTA 5IH2A 2SRCA 1YJWQ 3PE0A 5HY6A 3TU4K 2KT8A 1VQ6Q 3EHRA 3EHQA 1FYNA 3BW1A 2EJGA 2MPXC 1KC8U 1QP3A 1KQ1A 1FX7A 3OYNA 2L0AA 2DYIA 1PSEA 2X4YA 5DLQE 1AVZC 2DIGA 2NLUA 4C92G 5ECAA 2EQUA 4BB7A 1AWOA 4EIKA 1VQPQ 1VYVA 3OYDA 2KK4A 3LH5A 2L8DA 2QASA 4F7UB 2LCLA 3KUFA 1M90C 1DJ7B 3HP9A 1YJNT 2C0TA 3S6WA 2DTOA 2JTFA 2D0QB 3JCMe 1Q7YR 1NJIC 3GF5A 1OZ3A 1V76A 3KBGA 2ZPGB 5KYNA 2OTLQ 2O4XA 1K73C 2CZ6B 2O31A 4HA8A 1P92A 5IXFA 3I55A 1WI7A 2FB7A 4BI8B 5GMKm 3OB9A 3HRTA 1Q95G 1H3ZA 1UEBA 1JB0E 1H8KA 1VOMA 2O9SA 3CMEQ 3VYHB 1BCOA 3J80E 1K9MU 2H3EB 4XU3A 4II1A 4BDZA 4QQGA 3CCLT 4ELYC 3OYYA 1R8OB 2YT6A 2LT4A 1YCSB 5GANe 1N27A 2LCCA 2VWFA 1TWBA 4JRKA 2B86A 5IT9E 2QK0A 2K7AA 4JDSA 5FU6C 4M77E 4FSSA 1U8RA 1M9SA 2YRCA 3CC4Q 4BY6C 2AIRB 1YI2T 2EIFA 2O4XB 4HCBA 1IGQA 1LVKA 2PQWA 3M4GA 1PD0A 3CCVQ 4M75F 4LNPA 5LJ5h 1QVFP 5GMKe 2P0KA 2W10A 1ZA1B 3IQLA 3FJPA 1XJWB 3NTIA 3G4SA 2KRNA 2Y4XA 4J9CA 2CT4A 1HJDA 1OPKA 1RACB 2ZPHB 1IRXA 1I8FA 4JRPA 1WX6A 1VQ8Q 2L89A 5KE2A 4C92D 1C1AA 4J6WA 3LWIA 4PJJA 4MMKA 2C06A 5IHKA 2MOXA 2DL8A 1FWZA 1VYTA 2OTJT 3P8BB 4AMCA 2F1LA 2XK0A 2DXUA 2MI6A 3CCRA 1QVGS 3M5AA 3A5ZB 3Q1JA 3MHXA 4AG1C 2K5IA 2GQIA 3VRZA 3HFOA 1M2OA 1MV0B 5CCAA 4ZGDB 3CPWP 2QQ9A 5FWBA 2VGMA 3X26B 4RG2A 3VS1A 1I1JA 2M1HA 2KMTA 1X69A 3G6EA 1OU8A 4DEXA 1ZSZA 3M59A 4GY5A 3ZEHA 1I5OB 1N8RU 3JCMg 1N9RA 1ZA2B 4M7DG 2RHIA 5KYYA 1M8MA 2ESWA 2DK3A 3HFNA 4C8QC 3CCET 3CBOA 3RKXA 2LQ8A 3JCMf 3E19A 1RAEB 3A8HB 3QG1A 3INZA 3G71Q 2RQRA 3RBBB 3TEEA 1Y57A 5M9OA 1M2VA 4JRQA 4E2FB 3A8MB 1W2BP 1WQWA 5L8RE 4Z02A 3CMAA 2O88A 2DETA 4JJCA 4IUVA 1IGUA 3V7SA 1LOJA 1QCNA 1YN8A 4A4EA 4O6JA 2JUFA 4OMNA 2LNVA 1YJWT 2QTVA 2M9UA 1M90R 4E6RA 1VQ6T 1VQ9A 2V26A 3UA6A 1BB9A 1NJIR 1GBQA 1YBYA 3E9FA 3GNGA 5FRMA 5CKHA 2LT1A 3PTAA 3I56A 1K73R 3SDZA 2DXBA 2ATCB 2MAMA 4PJOC 1ZSZB 2LC4A 4PKCC 4XTXA 2RD1A 2EBPA 5IXBA 2GTOA 4CC7A 2E3HA 3CC2A 1RI9A 1VQPT 3X20B 1RLQC 3X28B 3OYEA 5KYYB 3MCAB 1ZBJA 3M56A 4M77D 4C5HA 5KH6A 5GMKl 1UGRB 1J3TA 4C92F 2OJ2A 3CC7A 4E7HA 4EMHA 2LJ1A 1U1TA 3CPFA 1LJOA 1M2VB 5FU7C 2OTLT 2C0OA 4M7AC 2EQMA 3MP8A 4E7JA 2RK1A 5GMKj 5GAN3 5C0MA 2EPDA 1SG5A 3AT1B 1YIJQ 4XU2A 3CMET 2V8JA 4HVWA 1NLOC 2M51A 1YHQQ 3QSUA 3QO3A 4L5GA 2CKKA 1UGSB 1BI0A 1VUBA 5IAYA 4N4IA 1JJ2P
chains in the Genus database with same CATH topology
4C0DB 3CC7T 2K4YA 2RJDA 1YIJA 5CR2A 4XTUA 3ZBDA 2QTXA 3OQ5A 1OYXA 4J8OA 3SB2A 2CZ1B 5GAMd 3X25B 5GAMh 2VV5A 2QQSA 4C8QE 3OYKA 4LDWA 2JN0A 2JVVA 1W4SA 2F69A 2YLBA 2XU8A 2L5QA 2ZPBB 4MZPA 5CKBA 4C5IA 4ZN1A 3HPWA 4OGEA 3CD6A 2L3RA 3QPHA 3OYAA 4X9CA 1M8VA 4FIBA 4OVAA 4M7DF 4NL3A 5KE3A 5HK0A 1VQ7A 4CI0C 3GP8A 4M7DD 3M55A 3E1SA 4M7DC 4X34A 3JCMW 3FC3A 1G3SA 4F7UG 5GAMe 5A0DA 4M7DB 1BIAA 4EMKB 2FVUA 2D9TA 3OY9A 2E6ZA 2FL7A 3C12A 3VUZA 3WXMB 4A4HA 2XKOC 4A4KA 2E41A 3A8LB 3DB3A 3LW5E 3VU3C 3CC4T 4KUDK 2MWOA 2HBPA 2XDDA 2FYKA 4OB2B 1VQ8A 3MP6A 2EWNA 2RI2A 1BI1A 1Q86U 4O5VA 3BDUA 4RKUE 3PMIA 1YITA 4QQ6A 2RHUA 1D3BB 2XICA 4M75A 5GAMg 1LNXA 3RMQA 3CCVT 3CBMA 5GAN4 1VQ5T 1KHCA 1MHNA 3QZ9B 3OYGA 2XDPA 2DPPB 4HCZA 5CAIA 5GANd 1M1KU 5A2QE 2B8AA 3FRNA 1M90U 3L2QA 5GAMj 3JCMP 3GPLA 4PL6A 2Y90A 4NOYA 2QQRA 2XI9A 4RCCA 3JCMX 1VQPA 4PJOE 2V8IA 5HKCA 4JLGA 3JCMJ 1NJIU 2IVWA 1B34B 3QYHB 3M57A 3M58A 1G3TA 4C8QG 4E7KA 3DLMA 2DO3A 4ZGJB 3LWHA 5CKDA 2K57A 3I55T 1K73U 4Y28E 2LRQA 5LJ3h 1K8AU 3QXEB 1I4K1 2BUDA 1YCYA 2X4JA 3OYFA 1VQ8T 4GLKA 3OSSC 3BY7A 4QVZA 3LLRA 5GAN5 2RHYA 1M1GA 4M78F 2OTLA 1BI3A 5A0GA 5CQYA 5LJ3e 4M78C 2K3XA 4C0FA 2RJEA 2ZCFB 4OGCA 4N0AC 2M16A 2XDBA 3PNWC 1Y71A 2PUKB 1XNIA 3QDRB 3JAME 4IUTA 4PNOA 5FLXE 4F7UA 2DXTA 2RI3A 2XG8D 3MEWA 3FDRA 4BY6B 3KXTA 3ME9A 4LD6A 4A4FA 4M7AE 3OA6A 3DB4A 3CMEA 2RM4A 2QQAA 3C94A 1H641 3FIFA 3OMCA 2G3RA 3V8LA 2BKDN 4EMGA 4ME7A 1VQNT 5HK3A 2E70A 3OS0A 1ZQ1A 4FT2A 4QQDA 2E12A 4M77F 1G3YA 1QVFA 4JS5A 2VYTA 2JTMA 1VQOA 5LJ3g 5LJ5d 4FSXA 1QVPA 4M77C 2K3YA 3CCJT 3META 2IG0A 1UB4A 3A8GB 3PT9A 4M75D 3PGGA 4OB1B 2AHJB 4J6YA 4M75B 5CIUA 4PJOG 5LJ3j 3G71A 3NTHA 1Q82U 2KSSA 2RO0A 4X9DA 5GAOn 5LJ3f 5J39A 3OMGA 5HY6A 2ZZDA 3F70A 4XTYA 3RKYA 4BI4A 5LJ5e 3TU4K 5FRNA 2PVGB 1WJQA 4OB3B 3BW1A 1JBMA 3O8VA 2E65A 5D6XA 2EJGA 2Y4YA 4ELZC 3OYHA 5EG2A 2DVEA 2RA2A 1N6AA 1KC8U 1QP3A 1KQ1A 1FX7A 3OYNA 4E7IA 4BACA 3H6ZA 1X6OA 4C8QA 2HD0A 3L2UA 1PSEA 4HCCA 2DKGA 2X4YA 5DLQE 3CC4A 4M7DE 3JCMQ 4C0DC 4MMLA 2DIGA 2RHXA 3FLGA 3TREA 2NLUA 4C92G 2JNGA 3JRZA 3MEAA 5DY9A 3AHUA 1Q86C 1OZ2A 2EQUA 4E7LA 1EIFA 1X75C 4BB7A 1WPYA 3E9GA 3G71T 2RJFA 3FB9A 3H8ZA 3L42A 3RKWA 4M7AG 3WVEB 3JCMd 1QVGA 3OYDA 4F7UF 4RCBA 3NTKA 3CCVA 3JB9G 2KK4A 4MZMA 2L8DA 3BFMA 1VQ5A 1KQ2A 4F7UB 2LCLA 4XTVA 3KUFA 3UDCA 3S3MA 1M90C 1DJ7B 3HP9A 1MGQA 2DTIA 1M5Q1 2ZPIB 4J6XA 4XTZA 3PFSA 4DOVA 1YJNT 4HT8A 4J83A 3EFSA 2DTOA 4KULA 4N4GA 4PLIA 2ZPEB 3QZ5B 2PUOB 3S6WA 5I21A 3CPWA 1M1FA 2JTFA 2D0QB 3L1AA 4EMKC 5A0LA 3JSCA 5C6SA 1NPPA 3JCMe 1NJIC 1OI1A 2DD5A 3GF5A 1OZ3A 3KBGA 2CS7A 3RUXA 2ZPGB 3OS5A 2WACA 2O4XA 2PVDB 2YLCA 2CZ6B 4HA8A 2KQWA 3OYLA 1P92A 1K73C 3I55A 2RK2A 2FB7A 4BI8B 3C4SA 1RL2A 5GMKm 1NZ9A 5I2SA 3OB9A 4PJOA 3SD4A 3HRTA 3OYJA 4ZTJA 2MF2A 1BKBA 1H3ZA 2DJZA 5GAOp 1UEBA 1X01A 3SWNA 5GAOr 1JB0E 1I81A 2ZPFB 3CCRT 1VQMT 2DAQA 1Q81C 1FXXA 1QP2A 3VYHB 2WSFE 4EPCA 3J80E 3CCQA 2KVQG 4XU3A 1K9MU 2CZ7B 4II1A 4IUPA 4IUQA 5GANh 2BIVA 1XQHA 4DQ2A 3L2VA 4C8QD 4BDZA 2QQBA 4QQGA 5GAMf 2E1HA 4C8QB 3CCLT 4ELYC 4M78E 4EDUA 3OYYA 3L2RA 2P0PA 3L2WA 1JRIA 5FROA 2DEQA 4L6V5 1R8OB 2CYZB 2LT4A 1IREB 1VQNA 3N5BB 5GANe 1YHQA 1N27A 1W2BA 2GF7A 2R58A 4JUVA 1BI2A 5CVIA 2GCXA 4C92A 2LCCA 3OYBA 4XU0A 4OF1A 1VIFA 4NS5A 4B9WA 4JRKA 3G6ET 2RI5A 3CCJA 4M7AA 5IT9E 5GMKi 3TCJA 4Y91A 3DKMA 2FHDA 3J7AF 2K5LA 4JDSA 5FU6C 2RH2A 1HK9A 5CK9A 5FU6B 4E47A 1KG1A 3S3OA 4M77E 3MP1A 3CCQT 3A8OB 3X24B 1U8RA 1M9SA 2D6FA 3S3NA 4M75E 2KAFA 5J3BA 5GANg 4LDXA 2DZ9A 4XK8E 4BI3A 4BY6C 4PLLA 5D6YA 4TVRA 4R56A 4LDUA 5CQXA 1YIJT 4Q5WA 5CKFA 3UWNA 3V7CA 2GFUA 1KD1U 2HNIA 1YI2T 5GANj 2EIFA 2O4XB 2VXEA 1YHQT 4HCBA 5GANf 3BDLA 3CXCA 2PQWA 4FM4B 4PJOD 3M53A 3M4GA 4FT4A 5IN1A 1QVFS 1NPRA 4ZN3A 2EJ9A 4PJOB 4M75F 1S72A 5LJ5h 2QDYB 2EQKA 4N4HA 4IKFA 3CMAT 3SWNB 3GOXA 3P8HA 4M75C 5GMKe 2P0KA 2DZCA 3EAEA 1RI0A 4M78G 2YHTA 1AHJB 2X4WA 2DXCA 1Y96A 3FJPA 3NTIA 3G4SA 1UGPB 2Y4XA 2LTOA 3OW2A 1VQKT 2K2VA 4MDWA 2LVMA 3CCMA 3HRSA 2GQVA 1VQ9T 2A7YA 5GAN6 2ZPHB 4VUBA 5KCHA 2JZ2A 2QA4A 3VV0A 1YJNA 1I8FA 4JRPA 3RERA 3OBYA 2L89A 5KE2A 4NL2A 3QHSA 4F7UE 3CCSA 4C0ZA 4C92D 3I56T 3CCUT 1G5VA 4J6WA 3LWIA 4C92B 1ZHIA 4MMKA 3V8JA 4JJNK 2C06A 2JOYA 5FU7B 3V7RA 3DLLA 2OAUA 4M7AD 4M7AB 1S72T 1XOVA 1FWZA 4RMOA 5LJ5g 3JB9D 2OTJT 3P8BB 4MZTA 1YJ9T 2F5TX 3ZFJA 4ZTFA 3CC2T 3PIPA 2R5AA 3M9QA 2P4TA 2XK0A 3ER0A 3G4ST 2DXUA 5AYFA 3PIOA 2MI6A 3L2ZA 5LJ5j 3JCMh 3CCRA 3CCMT 1VQMA 4D6WA 1QVGS 1BYMA 2X4XA 3CCET 1K9MC 5LJ5f 1Q7YU 3M5AA 1PSFA 3A5ZB 1M1KC 1JJ2A 2QA4T 1IZ6A 2I2LA 4JRIA 3Q1JA 3MHXA 3VKIA 5KCOA 5GAN8 2K5IA 4V2SA 3HL8A 3HFOA 3CCEA 3CPWS 4XAXB 4B9XA 2HQXA 3CCST 1VQ4T 3CCLA 2HQEA 2HAXA 5J26A 3OYMA 4RG8A 5CCAA 4ZGDB 2DIQA 2QQ9A 2VGMA 1WJSA 4KBMB 4RG2A 3X26B 5LL6S 2M1HA 3GNFB 1K8AC 2KMTA 4ZGEB 5I2MA 1KHIA 3EFRA 4MDXA 1GXIE 2WSCE 4IUUA 4QVDA 2EKOA 4A54A 3G6EA 4M78A 1Y96B 5CO7A 4N0AA 3HSBA 2PVOB 4OB0B 2RJCA 4QW2A 2VXFA 4LDYA 3M59A 2V8KA 2K5FA 4GY5A 3ZEHA 2CGHA 3SFMA 1N8RU 3JCMg 1VQLA 1G3WA 2EJFA 3OS1A 1N9RA 1YJWA 3WVDB 2P0QA 4DA4A 4OMFB 3QUIA 4M7DG 2RHIA 3LX7A 4C8QF 1VQ6A 1WQ7A 1XTDA 2DD4A 2R57A 2DK3A 2E64A 3HFNA 4YTLA 3CBOA 3G7ZA 3QJ6A 3LGFA 3RKXA 4C8QC 2LQ8A 3LH0A 3JCMf 2E6NA 3E19A 3OBWA 1YI2A 4XQ3A 2MWPA 2LX9A 4XTWA 4M77A 3A8HB 3MEVA 3CEYA 2O01E 3INZA 3QG1A 1Y7XA 4P5NA 2MMPA 3TEEA 3J81E 4BE2A 4LDVA 1W2BS 3OYCA 2X35A 5M9OA 4JRQA 2CZ0B 3A8MB 1WQWA 2EYQA 1WNLA 2KY9A 5L8RE 5GAOl 2GFAA 3JCMb 3CD6T 4Z02A 5D6WA 4J5YA 3VJPA 3CMAA 1VQ7T 4J7FA 2M0OA 4L59A 4IUVA 3V7SA 4WF2A 1LOJA 1Q82C 4A4EA 3P8DA 4O6JA 3JCMV 4BD3A 3JB9I 2JUFA 1VQLT 2XD0A 2R5MA 2LNVA 1HXDA 3OS2A 4HKEA 3MEUA 3JCMc 4R55A 3HRUA 1YJWT 1VQKA 3FEOA 2M9UA 3QYGB 3JB9H 4UC4A 3GLXA 1V29B 1VQ6T 4C0GA 1VQ9A 4LD9K 5LJ3d 4BDYA 3JB9J 4QVCA 1U1SA 3CBPA 1WJRA 2H3JA 4KUIA 1KC8C 3M54A 3VUBA 1WGSA 1KD1C 4A4GA 1YBYA 3E9FA 3GNGA 5FRMA 4C5GA 5CKHA 2LT1A 3QBYA 5GAN2 3PTAA 1VIEA 2A3LA 3CCUA 5GMKh 3I56A 1NE8A 1N9SA 2XIDA 1YITT 4PJOF 3SDZA 3ASKA 3CXCS 2DXBA 4BE1A 3HHTB 4M78D 2E10A 2MAMA 1Q81U 4PJOC 2WSEE 1M4ZA 4KT0E 4M78B 3LYIA 4A53A 2ZGWA 2LC4A 3V8KA 4PKCC 1ZBXA 4XTXA 2RD1A 3M4YA 4OP0A 3SWNC 3URGA 4C5EA 2OTJA 1SSFA 2F5KA 1YJ9A 4C92E 2QEXA 3CC2A 2RB6A 4IURA 3OSVA 3GIBA 4JLIA 2LQKA 3RMSA 2EAYA 1VQPT 1I5LA 3X20B 3HKSA 3NFCA 2LDMA 1KQSA 3C95A 3OW2S 2QI2A 3QJYA 3X28B 2PU9B 1KQSS 3OYEA 1Q7YC 4M7DA 3MCAB 3OYIA 5CKEA 4BE0A 4CRIA 2EFIA 4EMKA 2E5QA 4JS4A 3T9NA 2KDSA 3M56A 4M77D 4C5HA 5KH6A 1UGRB 3LGLA 5GMKl 4M77B 4BUGA 4C92F 4HT9A 3CC7A 4E7HA 4EMHA 1VQ4A 1U1TA 3CPFA 3PMTA 4C92C 1O9SA 1LJOA 4M7AF 5GAOq 5FU7C 2OTLT 2VC8A 1UGQB 4M77G 3RESA 5GAN7 4ATOA 4M7AC 1BIBA 2RHZA 2EQMA 3JB9F 3MP8A 1O75A 1D3BA 2RK1A 4M75G 4E7JA 5GMKj 5GAN3 3MO8A 5C0MA 4DOWA 4J7IA 5GAOm 3QKJA 2QEXT 4FU6A 3QIIA 3RIRA 3UT1A 5DLOA 2DTHA 1Y07A 3R6OA 4XU2A 1N8RC 1TH7A 2YRVA 2V8JA 2VUBA 5DM7R 3CMET 3UPUA 2QXFA 2EQJA 1QW1A 4XU1A 1B34A 3QO3A 3QSUA 4L5GA 2CKKA 1JJ2S 2VGNA 1UGSB 1VQOT 1BI0A 1VUBA 3VYGA 5IAYA 4N4IA 4FL6A 2XHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 E;  1WQ7 A;  4PJO G;  5LJ3 j;  3HFN A;  2E64 A;  4XTU A;  4C8Q C;  2QTX A;  4X9D A;  5LJ3 f;  3RKX A;  5GAO n;  4M75 E;  3SB2 A;  3JCM f;  5GAN g;  2DZ9 A;  5GAM d;  4XTY A;  4XQ3 A;  3RKY A;  4C8Q F;  5LJ5 e;  5GAM h;  3V7C A;  4XTW A;  4C8Q E;  4M77 A;  2HNI A;  2JN0 A;  3INZ A;  2YLB A;  3BW1 A;  1JBM A;  2E65 A;  2EJG A;  5GAN j;  1M8V A;  2VXE A;  2DVE A;  4X9C A;  2RA2 A;  4M7D F;  4NL3 A;  5GAN f;  1KQ1 A;  1WQW A;  5GAO l;  1WNL A;  4M7D D;  4C8Q A;  3JCM b;  3JCM W;  4M7D C;  3M4G A;  5GAM e;  4F7U G;  4M7D B;  4PJO D;  4J5Y A;  2EJ9 A;  4PJO B;  1BIA A;  4M75 F;  4EMK B;  5LJ5 h;  2DKG A;  3V7S A;  4WF2 A;  1LOJ A;  3JCM V;  3JB9 I;  4M7D E;  3SWN B;  4M75 C;  5GMK e;  3JCM Q;  4MML A;  2DZC A;  1HXD A;  3JCM c;  4C92 G;  2E41 A;  4M78 G;  5DY9 A;  2YHT A;  3VU3 C;  3AHU A;  3JB9 H;  1Y96 A;  3FJP A;  1WPY A;  4M7A G;  2FYK A;  3FB9 A;  3RKW A;  5LJ3 d;  2EWN A;  3JCM d;  3JB9 J;  4QVC A;  1U1S A;  4F7U F;  4RCB A;  3JB9 G;  3BDU A;  5GAN 6;  3BFM A;  5GAN 2;  1I8F A;  1KQ2 A;  4F7U B;  1D3B B;  3RER A;  4M75 A;  4XTV A;  5GAM g;  1LNX A;  5GMK h;  1N9S A;  1MGQ A;  2DTI A;  1M5Q 1;  3QHS A;  4J6X A;  4NL2 A;  4XTZ A;  4PJO F;  5GAN 4;  4HT8 A;  3EFS A;  2DTO A;  4F7U E;  5GAN d;  4C92 D;  5CAI A;  4M78 D;  5I21 A;  4J6W A;  2E10 A;  4PJO C;  3JCM e;  3L1A A;  4C92 B;  4M78 B;  4MMK A;  3V8J A;  4EMK C;  5GAM j;  4A53 A;  3JCM P;  2ZGW A;  3V8K A;  2Y90 A;  4NOY A;  2RD1 A;  4OP0 A;  4RCC A;  4XTX A;  3SWN C;  3V7R A;  3RUX A;  3JCM X;  4M7A D;  4C92 E;  4M7A B;  4PJO E;  3JCM J;  2RB6 A;  1B34 B;  2YLC A;  4HA8 A;  5LJ5 g;  4JLI A;  3JB9 D;  3GIB A;  2EAY A;  1I5L A;  2FB7 A;  4C8Q G;  5GMK m;  4M7D A;  2K57 A;  2DXU A;  4PJO A;  5LJ3 h;  3L2Z A;  4EMK A;  3JCM h;  1I4K 1;  5LJ5 j;  1YCY A;  2DJZ A;  5GAO p;  3SWN A;  1X01 A;  3BY7 A;  5LJ5 f;  5GAO r;  1I81 A;  4M77 D;  5GMK l;  5GAN 5;  2I2L A;  4JRI A;  4M77 B;  4M78 F;  4C92 F;  5GAN 8;  4HT9 A;  4EMH A;  4XU3 A;  1U1T A;  4V2S A;  3HFO A;  4C92 C;  4M78 C;  5LJ3 e;  1LJO A;  5GAN h;  4M7A F;  4DQ2 A;  4N0A C;  5GAO q;  2VC8 A;  4M77 G;  3RES A;  4C8Q D;  5GAN 7;  5GAM f;  4M7A C;  1BIB A;  2E1H A;  4C8Q B;  4M78 E;  3JB9 F;  4F7U A;  4M75 G;  1D3B A;  4PNO A;  2DXT A;  1JRI A;  5GMK j;  5GAN 3;  2DEQ A;  5GAO m;  4M7A E;  5GAN e;  3EFR A;  2RM4 A;  3RIR A;  4QVD A;  1H64 1;  2DTH A;  3FIF A;  4JUV A;  3V8L A;  4A54 A;  4C92 A;  4M78 A;  4EMG A;  4XU2 A;  1Y96 B;  1TH7 A;  4XU0 A;  4N0A A;  3HSB A;  4M77 F;  4JRK A;  2VXF A;  4M7A A;  4XU1 A;  2CGH A;  5GMK i;  4M77 C;  1B34 A;  3QO3 A;  3JCM g;  4Y91 A;  2EJF A;  5LJ3 g;  5LJ5 d;  3QSU A;  1N9R A;  1HK9 A;  4M75 D;  3QUI A;  3PGG A;  4M7D G;  4J6Y A;  4M75 B; 
#chains in the Genus database with same CATH topology
 2K4Y A;  3SHW A;  2EYZ A;  1VA7 A;  1OYX A;  1SHF A;  2KBT A;  1VQK Q;  4C8Q E;  2QGF B;  4MZP A;  2YLB A;  5CKB A;  2LJ0 A;  4OGE A;  4PK4 A;  1M8V A;  4CI0 C;  1EZZ B;  1X6B A;  3GP8 A;  4M7D D;  2EYX A;  3E1S A;  1K4U S;  3JCM W;  5GAM e;  1H92 A;  1YWP A;  1BIA A;  2D9T A;  4AFU C;  3CCU Q;  2HDA A;  1PRM C;  1LPL A;  6AT1 B;  3CC4 T;  2XDD A;  2KI7 A;  3MP6 A;  1YJ9 Q;  1Q86 U;  1YIT A;  1T3L A;  2XIC A;  4M75 A;  1LNX A;  3CCV T;  3CCM Q;  2LQW A;  3CBM A;  3OYG A;  2XDP A;  2DRM A;  2B8A A;  5GJV B;  3A1P A;  2Y90 A;  2DX1 A;  4RCC A;  1MMG A;  3MKD A;  3O5Z A;  4PJO E;  3CCS Q;  2HL3 A;  2IVW A;  3QYH B;  1G3T A;  4C8Q G;  2DO3 A;  4ZGJ B;  5LJ3 h;  2L3S A;  2X4J A;  1VQ8 T;  2LJ3 A;  1WXU A;  4GLK A;  2COY A;  2K3X A;  4C0F A;  2RJE A;  2M16 A;  4J9I A;  1AZG B;  2PUK B;  1M27 C;  3JAM E;  5FLX E;  1MMD A;  2DXT A;  2XG8 D;  2V1Q A;  4LD6 A;  4A4F A;  4M7A E;  1NYG A;  2G3R A;  1AWX A;  3TVT A;  2BKD N;  4ME7 A;  1K9A A;  1KQS P;  4QT7 A;  2E12 A;  4M77 F;  2FZK B;  1QVF A;  5LJ5 d;  1QVP A;  1YP5 A;  4AT1 B;  1UB4 A;  2DM1 A;  3EFO A;  2DFU A;  1VQ7 Q;  4J6Y A;  4M75 B;  4PJO G;  5KYW A;  4E7S A;  3NTH A;  1VQL Q;  4X9D A;  3RNJ A;  3EGU A;  4LN2 A;  2PTK A;  1GFC A;  4PJN A;  5FRN A;  2PVG B;  2NWM A;  2EGE A;  5D6X A;  1QWF A;  3OYH A;  5EG2 A;  2EGC A;  2DER A;  3SEM A;  3H6Z A;  2DKG A;  2RHX A;  4OMM A;  3TRE A;  4GBQ A;  2JNG A;  5DY9 A;  2EYW A;  1OX9 A;  2E4H A;  1PHT A;  1MMN A;  3E9G A;  2RJF A;  3H8Z A;  3L42 A;  3RKW A;  3G71 T;  4M7A G;  2KXC A;  3ULR B;  1FMW A;  3NTK A;  1VQ5 A;  1UHF A;  1BCM A;  4XTZ A;  4HT8 A;  1UUE A;  4DOV A;  2C0I A;  5I21 A;  2PUO B;  3CPW A;  4EMK C;  4Z88 A;  8AT1 B;  3RUX A;  2YXY A;  2YLC A;  2YRD A;  2KQW A;  2AKK A;  3EFO B;  3C4S A;  1PKS A;  5KYW B;  2JW4 A;  3SD4 A;  2QEX Q;  1X01 A;  5GAO r;  2DAQ A;  1W70 A;  3D7S B;  5GAN h;  3VS0 A;  1WHM A;  4DQ2 A;  2DE0 X;  4C8Q D;  2J06 A;  2QQB A;  5GAM f;  1X2Q A;  2P0P A;  1JRI A;  2HMA A;  5FRO A;  2KR3 A;  1W2B A;  2GF7 A;  5CVI A;  4C92 A;  2RI5 A;  2DLP A;  3CCJ A;  5GMK i;  2A28 A;  2FHD A;  1ZX6 A;  2A0F B;  2K5L A;  1GFD A;  2RH2 A;  5CK9 A;  4E47 A;  2PNI A;  3S3O A;  3EG0 A;  2J7I A;  3A8O B;  4XK8 E;  1M3C A;  4BI3 A;  2YUO A;  2FRY A;  1TG0 A;  1YIJ T;  3EG1 A;  2VVK A;  5CKF A;  1KD1 U;  2GFU A;  2BTT A;  2JMC A;  2A36 A;  2FO0 A;  1YHQ T;  3BDL A;  2KGT A;  1ACM B;  4PJO D;  4FT4 A;  3KFV A;  1NPR A;  4ZN3 A;  1IXD A;  4ESR A;  2MYS A;  2EQK A;  1QQJ A;  4N4H A;  1MV3 A;  4KH1 B;  2DZC A;  1AD5 A;  1UG1 A;  3EAE A;  1RI0 A;  2YHT A;  3E2U A;  1Q81 R;  2X4W A;  2DXC A;  1Y96 A;  3EG3 A;  2EW3 A;  1UGP B;  2LTO A;  1RAI B;  1VQK T;  3TSZ A;  2LVM A;  3HRS A;  1QKW A;  2GQV A;  1RLP C;  1U3O A;  2KRM A;  2A7Y A;  5GAN 6;  3I55 Q;  3RER A;  1TUC A;  2E5K A;  2K2M A;  1M3A A;  4F7U E;  3CCU T;  1NLP C;  4C92 B;  3C0C A;  3V7R A;  4M7A D;  2YDL A;  3VS4 A;  1WIE A;  2DNU A;  4MZT A;  1YJ9 T;  2R5A A;  3MJX A;  2AT1 B;  3ER0 A;  3PIO A;  3L2Z A;  1VQM A;  3CCM T;  1BYM A;  4JJD A;  2X4X A;  1K9M C;  1QVG P;  1JJ2 A;  2ROL A;  2F2X A;  4V2S A;  3ZL7 C;  3CCE A;  4B9X A;  3CCS T;  1W1F A;  3OYM A;  5D7U A;  3VS6 A;  2BZX A;  1WJS A;  4FW1 A;  3GNF B;  3EH2 A;  5I2M A;  1GXI E;  4MDX A;  5I11 A;  2EKO A;  1AWJ A;  1Y96 B;  3EG9 A;  4N0A A;  3HSB A;  4OB0 B;  2O2O A;  3VS2 A;  3SFM A;  2EJF A;  3A98 A;  3OS1 A;  1YJW A;  3WVD B;  3QUI A;  4C8Q F;  1VQ6 A;  1WQ7 A;  1XTD A;  1C6V X;  2E64 A;  4YTL A;  3VS3 A;  1D09 B;  4DBQ A;  4XTW A;  3OYL A;  4P5N A;  4M77 A;  3M0R A;  2QAZ A;  3CEY A;  4RUG A;  2KY9 A;  2EYQ A;  1WNL A;  2OI3 A;  5GAO l;  2GFA A;  1JEG A;  2DJQ A;  3I35 A;  1VQ7 T;  1BBZ A;  2A08 A;  3JCM V;  1D0X A;  4BD3 A;  3JB9 I;  1VQL T;  2XD0 A;  3MEU A;  1M1K R;  3EG2 A;  2JTE A;  1WHG A;  5LJ3 d;  1U1S A;  3CBP A;  2H3J A;  1SKU B;  3M54 A;  5GAN 2;  1VIE A;  1SRL A;  2XID A;  4PJO F;  1K8A R;  3CXC S;  3CCR Q;  4BE1 A;  3HHT B;  2CH4 A;  5IHN A;  3UAT A;  2ZGW A;  3EG9 B;  3V8K A;  1ZBX A;  3URG A;  3SWN C;  3M4Y A;  4OP0 A;  2F5K A;  1X2K A;  2ROT A;  1AOJ A;  3OSV A;  2Z0W A;  3GIB A;  1I5L A;  3HKS A;  3NFC A;  1KQS A;  3OW2 S;  2QI2 A;  1NM7 A;  4M7D A;  3OYI A;  1QMC A;  2EFI A;  2HSP A;  4JS4 A;  1UFF A;  3PVL A;  4HXJ A;  2KDS A;  2JXB A;  4M77 B;  4HT9 A;  3G6E Q;  1VQ4 A;  2JM8 A;  1O9S A;  1BU1 A;  1NEG A;  4M7A F;  3TQ7 P;  4M77 G;  1UGQ B;  4ATO A;  1QCO A;  3CCQ Q;  2RN8 A;  1T0H A;  2QEX T;  4RTW A;  1UHC A;  1Q82 R;  3QII A;  3UT1 A;  5DLO A;  4AFZ C;  1N8R C;  1MND A;  1TH7 A;  1B34 A;  1KC8 R;  2RJD A;  2LP5 A;  3CMA Q;  4XTU A;  3SB2 A;  4FW2 A;  5GAM h;  2VV5 A;  2OX7 A;  1C0M A;  2JN0 A;  2ZPB B;  2KYB A;  2XU8 A;  4OMO A;  3HPW A;  3CD6 A;  2FPE A;  1D1B A;  2KRS A;  2RMO A;  4OVA A;  4X9C A;  1VQ9 Q;  5KE3 A;  3REA B;  1B3Q A;  2DL3 A;  3M55 A;  1IO6 A;  2K79 A;  4M7D B;  5A0D A;  2FVU A;  3I56 Q;  2E6Z A;  2FL7 A;  3C12 A;  3VUZ A;  1KIK A;  3WXM B;  2G6F X;  4CC2 A;  4A4K A;  3A8L B;  2MCN A;  1IHV A;  1S72 Q;  1VQ8 A;  3NMZ C;  3CC2 Q;  2D0N A;  2DF6 A;  2EYY A;  3BDU A;  3H0H A;  4RKU E;  1R77 A;  5GAN 4;  1KHC A;  1MHN A;  2H8H A;  4LXC A;  5GAN d;  3FRN A;  2FPD A;  2QA4 Q;  2CH4 W;  1T3S A;  3VS5 A;  3GPL A;  2XI9 A;  4K11 A;  2ZAE A;  1K9M R;  2V8I A;  5HKC A;  2M0Y A;  1B34 B;  3M58 A;  1CKB A;  4E7K A;  7AT1 B;  3LWH A;  2K57 A;  3I55 T;  2LRQ A;  1I4K 1;  1RAB B;  2DL7 A;  2L3Q A;  2KYM A;  4FYY B;  2CUB A;  1M1G A;  5A0G A;  3NPF A;  4M78 C;  4IIM A;  2AZS A;  2LX7 A;  4KGX B;  2RI3 A;  3MEW A;  2FRW A;  3GBQ A;  4BY6 B;  1SF9 A;  3VRY A;  1GRI A;  4R0K A;  3V8L A;  4EMG A;  3OS0 A;  1TOV A;  2F2W A;  1VQO A;  2K3Y A;  2RPN A;  3NGP A;  2IG0 A;  3EGD A;  1ABO A;  4OB1 B;  2AHJ B;  1QCF A;  3G71 A;  2KSS A;  2DA9 A;  3OMG A;  2ZZD A;  3F70 A;  4XTY A;  5LJ5 e;  1V1C A;  1JBM A;  2M02 A;  4ELZ C;  2RA2 A;  1N6A A;  3CQT A;  1RAD B;  2HEQ A;  3U23 A;  3H41 A;  4HVU A;  1PG5 B;  1X6O A;  4C8Q A;  1OOT A;  2HD0 A;  8ATC B;  1YIT Q;  4HVV A;  4C0D C;  4PFP A;  3FLG A;  3AHU A;  3MEA A;  1RAF B;  1Q86 C;  2KEA A;  4E7L A;  1EIF A;  1X75 C;  3FB9 A;  1QVG A;  4F7U F;  4RCB A;  3JB9 G;  4MZM A;  4XTV A;  2HZY A;  3UDC A;  2CDT A;  1MGQ A;  2DTI A;  2ZPI B;  4AFQ C;  4N4G A;  1D1A A;  4KUL A;  4PLI A;  2DEU A;  2ZPE B;  2AK5 A;  2HKN A;  5C6S A;  5A0L A;  1EX4 A;  3JSC A;  1NPP A;  1OI1 A;  2DD5 A;  2CS7 A;  3OS5 A;  1W6X A;  2RK2 A;  3EGD B;  2X51 A;  1RL2 A;  2MK5 A;  5I2S A;  4PJO A;  3OYJ A;  2MF2 A;  1ARK A;  5GAO p;  4IIO A;  4DEY A;  3CCR T;  1Q81 C;  4EPC A;  2CZ7 B;  4IUP A;  4IUQ A;  1YFN A;  2BIV A;  5EC7 A;  1XQH A;  3L2V A;  2J6O A;  1N8R R;  2COW A;  1K76 A;  2E1H A;  4C8Q B;  4M78 E;  4EDU A;  2EVR A;  4L6V 5;  1VQN A;  3N5B B;  1YHQ A;  3TSW A;  4JUV A;  1BI2 A;  1QKX A;  1VIF A;  3RDV A;  3G6E T;  4M7A A;  3H9N A;  2NYS A;  3TCJ A;  4KH0 B;  3J7A F;  1HK9 A;  2HCK A;  3CCQ T;  3X24 B;  3S3N A;  4M75 E;  4LDX A;  2JJ9 A;  4PLL A;  5D6Y A;  4TVR A;  4LDU A;  4Y92 A;  5CQX A;  3UWN A;  4CC4 B;  4M4Z A;  4PJL A;  4FM4 B;  1JXM A;  4PJO B;  1VQ5 Q;  2QDY B;  4IKF A;  3CMA T;  1MUZ A;  1UEC A;  1GCQ C;  4M78 G;  2DVJ A;  2V1R A;  1SRM A;  2LZ6 B;  2MIO A;  3CCM A;  4MDW A;  1VQ9 T;  4VUB A;  1YJN A;  2JZ2 A;  4FYW B;  1E6H A;  3CCS A;  3I56 T;  1CSK A;  4JJN K;  2JOY A;  5FU7 B;  2OAU A;  2JMA A;  1OPL A;  4M7A B;  1S72 T;  1S1N A;  1NG2 A;  1XOV A;  4RMO A;  5LJ5 g;  3JB9 D;  4ZTF A;  3CC2 T;  3M9Q A;  3THK A;  1TSF A;  2IIM A;  4ANJ A;  5LJ5 j;  3JCM h;  2RQT A;  3EGX A;  5LJ5 f;  1Q7Y U;  4RTY A;  1PSF A;  2IPO B;  2CP2 A;  1M1K C;  2QA4 T;  2I2L A;  3VKI A;  1OU9 A;  3CCL A;  4XAX B;  3CCJ Q;  5KYX A;  5J26 A;  4RG8 A;  4F04 B;  4KBM B;  4AG2 C;  1K8A C;  2VKN A;  2WSC E;  4IUU A;  4QVD A;  2CT3 A;  4A54 A;  2O9V A;  1AEY A;  2PVO B;  2RJC A;  1EFN A;  2GGR A;  4LDY A;  2RQV A;  2VXF A;  2CP5 A;  2K5F A;  3QWX X;  2CGH A;  1VQL A;  2JS2 A;  1G3W A;  4Z8A A;  2DL4 A;  2CP7 A;  4OMF B;  1M3B A;  3LX7 A;  4WTO B;  2R57 A;  1IB8 A;  1KD1 C;  5KCH A;  1KQ2 A;  2NUZ A;  3LGF A;  3LH0 A;  3OBW A;  1YI2 A;  2MWP A;  4RTT A;  3MEV A;  4J9F A;  3J81 E;  4BE2 A;  3OYC A;  2CZ0 B;  1TU0 B;  1Q86 R;  4J9D A;  5D6W A;  4J5Y A;  4J7F A;  2M0O A;  4L59 A;  2A37 A;  1Q82 C;  1SHG A;  3EGX B;  3P8D A;  2YWW A;  2W0Z A;  2BZ8 A;  1HXD A;  3OS2 A;  4HKE A;  4J9B A;  3JCM c;  4R55 A;  3GLX A;  3EH1 A;  1V29 B;  1SEM A;  4LD9 K;  3JB9 J;  1PM3 A;  5KYX B;  1WJR A;  1KC8 C;  2K9G A;  3VUB A;  1WGS A;  4A4G A;  3MPU B;  4C5G A;  1OUL A;  5GMK h;  1D0Y A;  1N9S A;  1YIT T;  1ZUK A;  1VQM Q;  4M78 D;  4KT0 E;  3CXC P;  1TUD A;  2CSQ A;  2OTJ A;  1SSF A;  2YSQ A;  4C92 E;  2QEX A;  2RB6 A;  1PC0 A;  4IUR A;  1ABQ A;  2LQK A;  2EAY A;  3QJY A;  2PU9 B;  1KQS S;  3NHN A;  4BE0 A;  3OW2 P;  4EMK A;  2DRK A;  2E5Q A;  2BE7 D;  3T9N A;  2RQW A;  1X6G A;  1BK2 A;  1G2B A;  4FYX B;  1QLY A;  4ORZ A;  2VC8 A;  3RES A;  5GAN 7;  1E6G A;  1UJ0 A;  3JB9 F;  3FJ5 A;  1O75 A;  1D3B A;  4B6M A;  1HD3 A;  1GBR A;  3MO8 A;  2CP3 A;  1WYX A;  4DOW A;  2LQN A;  4FU6 A;  3RIR A;  4X1V A;  1TTH B;  5L23 A;  4LUD A;  1PCX A;  2VUB A;  2JT4 A;  1QW1 A;  4PJM A;  2LCS A;  4RTZ A;  4FL6 A;  2XHC A;  5CR2 A;  1QWE A;  2L2P A;  3OQ5 A;  4J8O A;  1OV3 A;  2CUD A;  3X25 B;  2QQS A;  3M0U A;  3OYK A;  2D8J A;  2JVV A;  1FMV A;  1W4S A;  4C5I A;  1ZUY A;  2L5Q A;  4ZN1 A;  2JS0 A;  1ZUU A;  2L3R A;  1G83 A;  3QPH A;  4NL3 A;  2GBQ A;  4M7D C;  3FC3 A;  4F7U G;  5GJW B;  4RTX A;  2DBM A;  1PWT A;  4EMK B;  3OY9 A;  3I9Q A;  4A63 B;  4FCY A;  4WCI A;  3UF4 A;  2HQH A;  1RUW A;  4E7Z A;  2XKO C;  4GLM A;  2E41 A;  2OAW A;  3VU3 C;  1NYF A;  4KUD K;  2MWO A;  5FWC A;  2HBP A;  1K0X A;  4OB2 B;  2EWN A;  2P84 A;  4D8K A;  3G4S Q;  4QQ6 A;  2BZY A;  1K1Z A;  1D3B B;  1U5S A;  3RMQ A;  1VQ5 T;  3G1J A;  4HCZ A;  1M90 U;  3L2Q A;  2QQR A;  1RAG B;  1VQP A;  2RQU A;  1RAA B;  4OMP A;  1VQ4 Q;  2E3I A;  4JLG A;  1NJI U;  1UE9 A;  3M57 A;  1K73 U;  2CSI A;  3QXE B;  3OYF A;  3H0F A;  1YCY A;  1H3H A;  1JQQ A;  3OSS C;  3BY7 A;  4QVZ A;  5GAN 5;  1I07 A;  4M78 F;  2D8H A;  5AT1 B;  2OTL A;  1M30 A;  1SPK A;  2ECZ A;  2J6K A;  2ZCF B;  1ZSZ C;  3RR6 A;  1PNJ A;  1Y71 A;  3QDR B;  1UGV A;  4IUT A;  2JM9 A;  3KXT A;  3ME9 A;  3CME A;  1WDX A;  2QQA A;  3FIF A;  3OMC A;  4FT2 A;  1KD1 R;  4JS5 A;  5LJ3 g;  2QYZ A;  3CCJ T;  3CD6 Q;  3MET A;  3A8G B;  4JJB A;  5CIU A;  1D1C A;  5LJ3 j;  1I0C A;  2RO0 A;  5GAO n;  5LJ3 f;  5J39 A;  3RKY A;  4BI4 A;  1WJQ A;  4OB3 B;  3O8V A;  1R0C B;  2E65 A;  1GL5 A;  2Y4Y A;  2SEM A;  1F1B B;  4DBR A;  2DVE A;  1D0Z A;  4DBH A;  4E7I A;  4BAC A;  1KK7 A;  3L2U A;  2AKL A;  3M0S A;  4HCC A;  1A0N B;  1WXT A;  1NBE B;  3CC4 A;  4M7D E;  2EKH A;  3JCM Q;  4MML A;  1TXQ A;  4F16 A;  3JRZ A;  2NUP A;  1OZ2 A;  3JV3 A;  1WPY A;  2AZV A;  1LCK A;  2FPF A;  3WVE B;  3JCM d;  1OEB A;  3CCV A;  3BFM A;  3S3M A;  4J6X A;  1M5Q 1;  3PFS A;  4J83 A;  3EFS A;  3QZ5 B;  1M1F A;  3L1A A;  1E7O A;  2RF0 A;  2I0N A;  2WAC A;  2PVD B;  3H0I A;  1CKA A;  2LNH B;  2EGA A;  1NZ9 A;  4ZTJ A;  1ZLM A;  1BKB A;  2DJZ A;  2L3P A;  3SWN A;  1I81 A;  2ZPF B;  1VQM T;  1FXX A;  1QP2 A;  2WSF E;  3CCQ A;  2KVQ G;  1X43 A;  2HKQ B;  2X9H A;  4OML A;  1VQO Q;  3L2R A;  3CC7 Q;  3L2W A;  2DEQ A;  2CYZ B;  1IRE B;  1AZE A;  1RAH B;  2XMF A;  2R58 A;  2GCX A;  2QGG A;  5IHI A;  3OYB A;  4XU0 A;  2NUP B;  4OF1 A;  1UJY A;  4NS5 A;  1Z9Z A;  2VB6 A;  4B9W A;  1JO8 A;  4Y91 A;  3DKM A;  1UTI A;  5FU6 B;  1T0J A;  1KG1 A;  3MP1 A;  2CRE A;  2D6F A;  2KAF A;  5J3B A;  5GAN g;  2DZ9 A;  4R56 A;  4Q5W A;  3V7C A;  1B7T A;  2HNI A;  1WHK A;  5GAN j;  2VXE A;  5GAN f;  3CXC A;  2DIL A;  1HYO A;  3M53 A;  1WZO A;  5IN1 A;  1QVF S;  2EJ9 A;  1S72 A;  2J6F A;  1YWO A;  4LE9 A;  3SWN B;  3GOX A;  3P8H A;  4M75 C;  1OQK A;  1AHJ B;  3OW2 A;  1PD1 A;  2K2V A;  4ZNX A;  2QA4 A;  3VV0 A;  4FYV B;  1FMK A;  2NUT A;  3OBY A;  4PFZ A;  4NL2 A;  3QHS A;  4C0Z A;  1KJW A;  1G5V A;  2YUP A;  2FEI A;  1ZHI A;  3V8J A;  3DLL A;  2COZ A;  4J9H A;  2FZG B;  3I5S A;  2F5T X;  3ZFJ A;  3PIP A;  2P4T A;  3G4S T;  5AYF A;  1ZSG A;  4D6W A;  1VQN Q;  4OMQ A;  4KGZ B;  1IZ6 A;  4JRI A;  4LUE A;  5GAN 8;  5KCO A;  3HL8 A;  4RTU A;  2KXD A;  1N5Z A;  1R0B G;  3CPW S;  1VQ4 T;  2HQX A;  2HQE A;  2HAX A;  2DIQ A;  2DMO A;  5LL6 S;  2ED1 A;  4ZGE B;  1KHI A;  1G8X A;  3EFR A;  4F17 A;  2PZ1 A;  1YNZ A;  4M78 A;  5CO7 A;  2K6D A;  4QW2 A;  2BE9 B;  3M0Q A;  2V8K A;  2D1X A;  2X3W D;  2P0Q A;  4DA4 A;  2NUT B;  2DD4 A;  2FG0 A;  4J9G A;  1GCP A;  2YUQ A;  1YIJ A;  3G7Z A;  3QJ6 A;  2E6N A;  4XQ3 A;  2LX9 A;  2O01 E;  1Y7X A;  4PFO A;  2MMP A;  4LDV A;  1W2B S;  2X35 A;  3QDF A;  3CD6 T;  2K3B A;  3JCM b;  1Y0M A;  1Z9Q A;  3VJP A;  1YJN Q;  3R6N A;  4WF2 A;  1U06 A;  2R5M A;  1VQK A;  1AT1 B;  3HRU A;  3JB9 H;  3FEO A;  3QYG B;  4UC4 A;  4C0G A;  2ED0 A;  3UA7 A;  5KYU A;  1SSH A;  3M0T A;  4BDY A;  1OX8 A;  4QVC A;  1K0S A;  3REB B;  4KUI A;  4JPB W;  2EQI A;  2CP0 A;  2CP6 A;  3QBY A;  4JZ3 A;  2A3L A;  5HCK A;  3CCU A;  1NE8 A;  3ASK A;  2E10 A;  3QWY A;  4D8D A;  1Q81 U;  2WSE E;  1M4Z A;  4M78 B;  3LYI A;  4A53 A;  2X3X D;  4C5E A;  1YJ9 A;  4JLI A;  3RMS A;  3CCL Q;  2LDM A;  5I22 A;  3C95 A;  1Q7Y C;  3PVQ A;  5CKE A;  1WHH A;  4CRI A;  2KNB B;  3I5R A;  1TS9 A;  1MNE A;  3LGL A;  4BUG A;  3PMT A;  1UDL A;  4QKU A;  4C92 C;  1WHL A;  5GAO q;  1BIB A;  2ABL A;  2RHZ A;  9ATC B;  4M75 G;  2P4R A;  4J7I A;  5GAO m;  3QKJ A;  2DTH A;  2QDL A;  1Y07 A;  3R6O A;  1YI2 Q;  2YRV A;  5DM7 R;  3UPU A;  2QXF A;  2EQJ A;  5KYU B;  4XU1 A;  2HSE B;  1PRL C;  1JJ2 S;  2VGN A;  1VQO T;  2KT1 A;  3VYG A;  2GTJ A;  4C0D B;  3CC7 T;  2VAS A;  2GNC A;  3ZBD A;  2QTX A;  2CZ1 B;  5GAM d;  1IHW A;  4KGV B;  4HCK A;  4LDW A;  2F69 A;  1JXO A;  2J05 A;  3OYA A;  4FIB A;  1MMA A;  4M7D F;  1TUG B;  2F2V A;  5HK0 A;  1VQ7 A;  4X34 A;  1G3S A;  4DBF A;  2KRO A;  3M0P A;  4A4H A;  3VS7 A;  3DB3 A;  3LW5 E;  5FW9 A;  2KE9 A;  4RTV A;  1KFZ A;  1HSQ A;  2FYK A;  2OTJ Q;  2RI2 A;  1BI1 A;  4O5V A;  3PMI A;  2RHU A;  2YUN A;  5GAM g;  1GCQ A;  2HBW A;  2LMJ A;  3QZ9 B;  2DPP B;  5CAI A;  1M1K U;  3BE3 A;  1NEB A;  5A2Q E;  5GAM j;  3JCM P;  2RNA A;  4PL6 A;  4AFS C;  4CC3 A;  2DYB A;  4NOY A;  3JCM X;  3JCM J;  2DL5 A;  3DLM A;  5CKD A;  4Y28 E;  1K8A U;  2BUD A;  1PKT A;  1WLP B;  2FZC B;  3LLR A;  2RHY A;  1WA7 A;  4F14 A;  1BI3 A;  2ENM A;  5CQY A;  5LJ3 e;  1JU5 C;  4OGC A;  4N0A C;  4JZ4 A;  4Z89 A;  2XDB A;  3PNW C;  3HTR A;  1XNI A;  2DBK A;  4F7U A;  4PNO A;  3FDR A;  1WXB A;  3CCE Q;  1WFW A;  4J9E A;  3OA6 A;  1VYU A;  3DB4 A;  2RM4 A;  3C94 A;  1H64 1;  1X27 A;  1VQN T;  5HK3 A;  2E70 A;  1ZQ1 A;  4QQD A;  1G3Y A;  2VYT A;  2JTM A;  1KSW A;  1B07 A;  4FSX A;  4M77 C;  2QG9 B;  1WHJ A;  4M75 D;  3PT9 A;  1AWW A;  3PGG A;  2HL5 C;  1Q82 U;  4KRT A;  5IH2 A;  2SRC A;  1YJW Q;  3PE0 A;  5HY6 A;  3TU4 K;  2KT8 A;  1VQ6 Q;  3EHR A;  3EHQ A;  1FYN A;  3BW1 A;  2EJG A;  2MPX C;  1KC8 U;  1QP3 A;  1KQ1 A;  1FX7 A;  3OYN A;  2L0A A;  2DYI A;  1PSE A;  2X4Y A;  5DLQ E;  1AVZ C;  2DIG A;  2NLU A;  4C92 G;  5ECA A;  2EQU A;  4BB7 A;  1AWO A;  4EIK A;  1VQP Q;  1VYV A;  3OYD A;  2KK4 A;  3LH5 A;  2L8D A;  2QAS A;  4F7U B;  2LCL A;  3KUF A;  1M90 C;  1DJ7 B;  3HP9 A;  1YJN T;  2C0T A;  3S6W A;  2DTO A;  2JTF A;  2D0Q B;  3JCM e;  1Q7Y R;  1NJI C;  3GF5 A;  1OZ3 A;  1V76 A;  3KBG A;  2ZPG B;  5KYN A;  2OTL Q;  2O4X A;  1K73 C;  2CZ6 B;  2O31 A;  4HA8 A;  1P92 A;  5IXF A;  3I55 A;  1WI7 A;  2FB7 A;  4BI8 B;  5GMK m;  3OB9 A;  3HRT A;  1Q95 G;  1H3Z A;  1UEB A;  1JB0 E;  1H8K A;  1VOM A;  2O9S A;  3CME Q;  3VYH B;  1BCO A;  3J80 E;  1K9M U;  2H3E B;  4XU3 A;  4II1 A;  4BDZ A;  4QQG A;  3CCL T;  4ELY C;  3OYY A;  1R8O B;  2YT6 A;  2LT4 A;  1YCS B;  5GAN e;  1N27 A;  2LCC A;  2VWF A;  1TWB A;  4JRK A;  2B86 A;  5IT9 E;  2QK0 A;  2K7A A;  4JDS A;  5FU6 C;  4M77 E;  4FSS A;  1U8R A;  1M9S A;  2YRC A;  3CC4 Q;  4BY6 C;  2AIR B;  1YI2 T;  2EIF A;  2O4X B;  4HCB A;  1IGQ A;  1LVK A;  2PQW A;  3M4G A;  1PD0 A;  3CCV Q;  4M75 F;  4LNP A;  5LJ5 h;  1QVF P;  5GMK e;  2P0K A;  2W10 A;  1ZA1 B;  3IQL A;  3FJP A;  1XJW B;  3NTI A;  3G4S A;  2KRN A;  2Y4X A;  4J9C A;  2CT4 A;  1HJD A;  1OPK A;  1RAC B;  2ZPH B;  1IRX A;  1I8F A;  4JRP A;  1WX6 A;  1VQ8 Q;  2L89 A;  5KE2 A;  4C92 D;  1C1A A;  4J6W A;  3LWI A;  4PJJ A;  4MMK A;  2C06 A;  5IHK A;  2MOX A;  2DL8 A;  1FWZ A;  1VYT A;  2OTJ T;  3P8B B;  4AMC A;  2F1L A;  2XK0 A;  2DXU A;  2MI6 A;  3CCR A;  1QVG S;  3M5A A;  3A5Z B;  3Q1J A;  3MHX A;  4AG1 C;  2K5I A;  2GQI A;  3VRZ A;  3HFO A;  1M2O A;  1MV0 B;  5CCA A;  4ZGD B;  3CPW P;  2QQ9 A;  5FWB A;  2VGM A;  3X26 B;  4RG2 A;  3VS1 A;  1I1J A;  2M1H A;  2KMT A;  1X69 A;  3G6E A;  1OU8 A;  4DEX A;  1ZSZ A;  3M59 A;  4GY5 A;  3ZEH A;  1I5O B;  1N8R U;  3JCM g;  1N9R A;  1ZA2 B;  4M7D G;  2RHI A;  5KYY A;  1M8M A;  2ESW A;  2DK3 A;  3HFN A;  4C8Q C;  3CCE T;  3CBO A;  3RKX A;  2LQ8 A;  3JCM f;  3E19 A;  1RAE B;  3A8H B;  3QG1 A;  3INZ A;  3G71 Q;  2RQR A;  3RBB B;  3TEE A;  1Y57 A;  5M9O A;  1M2V A;  4JRQ A;  4E2F B;  3A8M B;  1W2B P;  1WQW A;  5L8R E;  4Z02 A;  3CMA A;  2O88 A;  2DET A;  4JJC A;  4IUV A;  1IGU A;  3V7S A;  1LOJ A;  1QCN A;  1YN8 A;  4A4E A;  4O6J A;  2JUF A;  4OMN A;  2LNV A;  1YJW T;  2QTV A;  2M9U A;  1M90 R;  4E6R A;  1VQ6 T;  1VQ9 A;  2V26 A;  3UA6 A;  1BB9 A;  1NJI R;  1GBQ A;  1YBY A;  3E9F A;  3GNG A;  5FRM A;  5CKH A;  2LT1 A;  3PTA A;  3I56 A;  1K73 R;  3SDZ A;  2DXB A;  2ATC B;  2MAM A;  4PJO C;  1ZSZ B;  2LC4 A;  4PKC C;  4XTX A;  2RD1 A;  2EBP A;  5IXB A;  2GTO A;  4CC7 A;  2E3H A;  3CC2 A;  1RI9 A;  1VQP T;  3X20 B;  1RLQ C;  3X28 B;  3OYE A;  5KYY B;  3MCA B;  1ZBJ A;  3M56 A;  4M77 D;  4C5H A;  5KH6 A;  5GMK l;  1UGR B;  1J3T A;  4C92 F;  2OJ2 A;  3CC7 A;  4E7H A;  4EMH A;  2LJ1 A;  1U1T A;  3CPF A;  1LJO A;  1M2V B;  5FU7 C;  2OTL T;  2C0O A;  4M7A C;  2EQM A;  3MP8 A;  4E7J A;  2RK1 A;  5GMK j;  5GAN 3;  5C0M A;  2EPD A;  1SG5 A;  3AT1 B;  1YIJ Q;  4XU2 A;  3CME T;  2V8J A;  4HVW A;  1NLO C;  2M51 A;  1YHQ Q;  3QSU A;  3QO3 A;  4L5G A;  2CKK A;  1UGS B;  1BI0 A;  1VUB A;  5IAY A;  4N4I A;  1JJ2 P; 
#chains in the Genus database with same CATH homology
 4C0D B;  3CC7 T;  2K4Y A;  2RJD A;  1YIJ A;  5CR2 A;  4XTU A;  3ZBD A;  2QTX A;  3OQ5 A;  1OYX A;  4J8O A;  3SB2 A;  2CZ1 B;  5GAM d;  3X25 B;  5GAM h;  2VV5 A;  2QQS A;  4C8Q E;  3OYK A;  4LDW A;  2JN0 A;  2JVV A;  1W4S A;  2F69 A;  2YLB A;  2XU8 A;  2L5Q A;  2ZPB B;  4MZP A;  5CKB A;  4C5I A;  4ZN1 A;  3HPW A;  4OGE A;  3CD6 A;  2L3R A;  3QPH A;  3OYA A;  4X9C A;  1M8V A;  4FIB A;  4OVA A;  4M7D F;  4NL3 A;  5KE3 A;  5HK0 A;  1VQ7 A;  4CI0 C;  3GP8 A;  4M7D D;  3M55 A;  3E1S A;  4M7D C;  4X34 A;  3JCM W;  3FC3 A;  1G3S A;  4F7U G;  5GAM e;  5A0D A;  4M7D B;  1BIA A;  4EMK B;  2FVU A;  2D9T A;  3OY9 A;  2E6Z A;  2FL7 A;  3C12 A;  3VUZ A;  3WXM B;  4A4H A;  2XKO C;  4A4K A;  2E41 A;  3A8L B;  3DB3 A;  3LW5 E;  3VU3 C;  3CC4 T;  4KUD K;  2MWO A;  2HBP A;  2XDD A;  2FYK A;  4OB2 B;  1VQ8 A;  3MP6 A;  2EWN A;  2RI2 A;  1BI1 A;  1Q86 U;  4O5V A;  3BDU A;  4RKU E;  3PMI A;  1YIT A;  4QQ6 A;  2RHU A;  1D3B B;  2XIC A;  4M75 A;  5GAM g;  1LNX A;  3RMQ A;  3CCV T;  3CBM A;  5GAN 4;  1VQ5 T;  1KHC A;  1MHN A;  3QZ9 B;  3OYG A;  2XDP A;  2DPP B;  4HCZ A;  5CAI A;  5GAN d;  1M1K U;  5A2Q E;  2B8A A;  3FRN A;  1M90 U;  3L2Q A;  5GAM j;  3JCM P;  3GPL A;  4PL6 A;  2Y90 A;  4NOY A;  2QQR A;  2XI9 A;  4RCC A;  3JCM X;  1VQP A;  4PJO E;  2V8I A;  5HKC A;  4JLG A;  3JCM J;  1NJI U;  2IVW A;  1B34 B;  3QYH B;  3M57 A;  3M58 A;  1G3T A;  4C8Q G;  4E7K A;  3DLM A;  2DO3 A;  4ZGJ B;  3LWH A;  5CKD A;  2K57 A;  3I55 T;  1K73 U;  4Y28 E;  2LRQ A;  5LJ3 h;  1K8A U;  3QXE B;  1I4K 1;  2BUD A;  1YCY A;  2X4J A;  3OYF A;  1VQ8 T;  4GLK A;  3OSS C;  3BY7 A;  4QVZ A;  3LLR A;  5GAN 5;  2RHY A;  1M1G A;  4M78 F;  2OTL A;  1BI3 A;  5A0G A;  5CQY A;  5LJ3 e;  4M78 C;  2K3X A;  4C0F A;  2RJE A;  2ZCF B;  4OGC A;  4N0A C;  2M16 A;  2XDB A;  3PNW C;  1Y71 A;  2PUK B;  1XNI A;  3QDR B;  3JAM E;  4IUT A;  4PNO A;  5FLX E;  4F7U A;  2DXT A;  2RI3 A;  2XG8 D;  3MEW A;  3FDR A;  4BY6 B;  3KXT A;  3ME9 A;  4LD6 A;  4A4F A;  4M7A E;  3OA6 A;  3DB4 A;  3CME A;  2RM4 A;  2QQA A;  3C94 A;  1H64 1;  3FIF A;  3OMC A;  2G3R A;  3V8L A;  2BKD N;  4EMG A;  4ME7 A;  1VQN T;  5HK3 A;  2E70 A;  3OS0 A;  1ZQ1 A;  4FT2 A;  4QQD A;  2E12 A;  4M77 F;  1G3Y A;  1QVF A;  4JS5 A;  2VYT A;  2JTM A;  1VQO A;  5LJ3 g;  5LJ5 d;  4FSX A;  1QVP A;  4M77 C;  2K3Y A;  3CCJ T;  3MET A;  2IG0 A;  1UB4 A;  3A8G B;  3PT9 A;  4M75 D;  3PGG A;  4OB1 B;  2AHJ B;  4J6Y A;  4M75 B;  5CIU A;  4PJO G;  5LJ3 j;  3G71 A;  3NTH A;  1Q82 U;  2KSS A;  2RO0 A;  4X9D A;  5GAO n;  5LJ3 f;  5J39 A;  3OMG A;  5HY6 A;  2ZZD A;  3F70 A;  4XTY A;  3RKY A;  4BI4 A;  5LJ5 e;  3TU4 K;  5FRN A;  2PVG B;  1WJQ A;  4OB3 B;  3BW1 A;  1JBM A;  3O8V A;  2E65 A;  5D6X A;  2EJG A;  2Y4Y A;  4ELZ C;  3OYH A;  5EG2 A;  2DVE A;  2RA2 A;  1N6A A;  1KC8 U;  1QP3 A;  1KQ1 A;  1FX7 A;  3OYN A;  4E7I A;  4BAC A;  3H6Z A;  1X6O A;  4C8Q A;  2HD0 A;  3L2U A;  1PSE A;  4HCC A;  2DKG A;  2X4Y A;  5DLQ E;  3CC4 A;  4M7D E;  3JCM Q;  4C0D C;  4MML A;  2DIG A;  2RHX A;  3FLG A;  3TRE A;  2NLU A;  4C92 G;  2JNG A;  3JRZ A;  3MEA A;  5DY9 A;  3AHU A;  1Q86 C;  1OZ2 A;  2EQU A;  4E7L A;  1EIF A;  1X75 C;  4BB7 A;  1WPY A;  3E9G A;  3G71 T;  2RJF A;  3FB9 A;  3H8Z A;  3L42 A;  3RKW A;  4M7A G;  3WVE B;  3JCM d;  1QVG A;  3OYD A;  4F7U F;  4RCB A;  3NTK A;  3CCV A;  3JB9 G;  2KK4 A;  4MZM A;  2L8D A;  3BFM A;  1VQ5 A;  1KQ2 A;  4F7U B;  2LCL A;  4XTV A;  3KUF A;  3UDC A;  3S3M A;  1M90 C;  1DJ7 B;  3HP9 A;  1MGQ A;  2DTI A;  1M5Q 1;  2ZPI B;  4J6X A;  4XTZ A;  3PFS A;  4DOV A;  1YJN T;  4HT8 A;  4J83 A;  3EFS A;  2DTO A;  4KUL A;  4N4G A;  4PLI A;  2ZPE B;  3QZ5 B;  2PUO B;  3S6W A;  5I21 A;  3CPW A;  1M1F A;  2JTF A;  2D0Q B;  3L1A A;  4EMK C;  5A0L A;  3JSC A;  5C6S A;  1NPP A;  3JCM e;  1NJI C;  1OI1 A;  2DD5 A;  3GF5 A;  1OZ3 A;  3KBG A;  2CS7 A;  3RUX A;  2ZPG B;  3OS5 A;  2WAC A;  2O4X A;  2PVD B;  2YLC A;  2CZ6 B;  4HA8 A;  2KQW A;  3OYL A;  1P92 A;  1K73 C;  3I55 A;  2RK2 A;  2FB7 A;  4BI8 B;  3C4S A;  1RL2 A;  5GMK m;  1NZ9 A;  5I2S A;  3OB9 A;  4PJO A;  3SD4 A;  3HRT A;  3OYJ A;  4ZTJ A;  2MF2 A;  1BKB A;  1H3Z A;  2DJZ A;  5GAO p;  1UEB A;  1X01 A;  3SWN A;  5GAO r;  1JB0 E;  1I81 A;  2ZPF B;  3CCR T;  1VQM T;  2DAQ A;  1Q81 C;  1FXX A;  1QP2 A;  3VYH B;  2WSF E;  4EPC A;  3J80 E;  3CCQ A;  2KVQ G;  4XU3 A;  1K9M U;  2CZ7 B;  4II1 A;  4IUP A;  4IUQ A;  5GAN h;  2BIV A;  1XQH A;  4DQ2 A;  3L2V A;  4C8Q D;  4BDZ A;  2QQB A;  4QQG A;  5GAM f;  2E1H A;  4C8Q B;  3CCL T;  4ELY C;  4M78 E;  4EDU A;  3OYY A;  3L2R A;  2P0P A;  3L2W A;  1JRI A;  5FRO A;  2DEQ A;  4L6V 5;  1R8O B;  2CYZ B;  2LT4 A;  1IRE B;  1VQN A;  3N5B B;  5GAN e;  1YHQ A;  1N27 A;  1W2B A;  2GF7 A;  2R58 A;  4JUV A;  1BI2 A;  5CVI A;  2GCX A;  4C92 A;  2LCC A;  3OYB A;  4XU0 A;  4OF1 A;  1VIF A;  4NS5 A;  4B9W A;  4JRK A;  3G6E T;  2RI5 A;  3CCJ A;  4M7A A;  5IT9 E;  5GMK i;  3TCJ A;  4Y91 A;  3DKM A;  2FHD A;  3J7A F;  2K5L A;  4JDS A;  5FU6 C;  2RH2 A;  1HK9 A;  5CK9 A;  5FU6 B;  4E47 A;  1KG1 A;  3S3O A;  4M77 E;  3MP1 A;  3CCQ T;  3A8O B;  3X24 B;  1U8R A;  1M9S A;  2D6F A;  3S3N A;  4M75 E;  2KAF A;  5J3B A;  5GAN g;  4LDX A;  2DZ9 A;  4XK8 E;  4BI3 A;  4BY6 C;  4PLL A;  5D6Y A;  4TVR A;  4R56 A;  4LDU A;  5CQX A;  1YIJ T;  4Q5W A;  5CKF A;  3UWN A;  3V7C A;  2GFU A;  1KD1 U;  2HNI A;  1YI2 T;  5GAN j;  2EIF A;  2O4X B;  2VXE A;  1YHQ T;  4HCB A;  5GAN f;  3BDL A;  3CXC A;  2PQW A;  4FM4 B;  4PJO D;  3M53 A;  3M4G A;  4FT4 A;  5IN1 A;  1QVF S;  1NPR A;  4ZN3 A;  2EJ9 A;  4PJO B;  4M75 F;  1S72 A;  5LJ5 h;  2QDY B;  2EQK A;  4N4H A;  4IKF A;  3CMA T;  3SWN B;  3GOX A;  3P8H A;  4M75 C;  5GMK e;  2P0K A;  2DZC A;  3EAE A;  1RI0 A;  4M78 G;  2YHT A;  1AHJ B;  2X4W A;  2DXC A;  1Y96 A;  3FJP A;  3NTI A;  3G4S A;  1UGP B;  2Y4X A;  2LTO A;  3OW2 A;  1VQK T;  2K2V A;  4MDW A;  2LVM A;  3CCM A;  3HRS A;  2GQV A;  1VQ9 T;  2A7Y A;  5GAN 6;  2ZPH B;  4VUB A;  5KCH A;  2JZ2 A;  2QA4 A;  3VV0 A;  1YJN A;  1I8F A;  4JRP A;  3RER A;  3OBY A;  2L89 A;  5KE2 A;  4NL2 A;  3QHS A;  4F7U E;  3CCS A;  4C0Z A;  4C92 D;  3I56 T;  3CCU T;  1G5V A;  4J6W A;  3LWI A;  4C92 B;  1ZHI A;  4MMK A;  3V8J A;  4JJN K;  2C06 A;  2JOY A;  5FU7 B;  3V7R A;  3DLL A;  2OAU A;  4M7A D;  4M7A B;  1S72 T;  1XOV A;  1FWZ A;  4RMO A;  5LJ5 g;  3JB9 D;  2OTJ T;  3P8B B;  4MZT A;  1YJ9 T;  2F5T X;  3ZFJ A;  4ZTF A;  3CC2 T;  3PIP A;  2R5A A;  3M9Q A;  2P4T A;  2XK0 A;  3ER0 A;  3G4S T;  2DXU A;  5AYF A;  3PIO A;  2MI6 A;  3L2Z A;  5LJ5 j;  3JCM h;  3CCR A;  3CCM T;  1VQM A;  4D6W A;  1QVG S;  1BYM A;  2X4X A;  3CCE T;  1K9M C;  5LJ5 f;  1Q7Y U;  3M5A A;  1PSF A;  3A5Z B;  1M1K C;  1JJ2 A;  2QA4 T;  1IZ6 A;  2I2L A;  4JRI A;  3Q1J A;  3MHX A;  3VKI A;  5KCO A;  5GAN 8;  2K5I A;  4V2S A;  3HL8 A;  3HFO A;  3CCE A;  3CPW S;  4XAX B;  4B9X A;  2HQX A;  3CCS T;  1VQ4 T;  3CCL A;  2HQE A;  2HAX A;  5J26 A;  3OYM A;  4RG8 A;  5CCA A;  4ZGD B;  2DIQ A;  2QQ9 A;  2VGM A;  1WJS A;  4KBM B;  4RG2 A;  3X26 B;  5LL6 S;  2M1H A;  3GNF B;  1K8A C;  2KMT A;  4ZGE B;  5I2M A;  1KHI A;  3EFR A;  4MDX A;  1GXI E;  2WSC E;  4IUU A;  4QVD A;  2EKO A;  4A54 A;  3G6E A;  4M78 A;  1Y96 B;  5CO7 A;  4N0A A;  3HSB A;  2PVO B;  4OB0 B;  2RJC A;  4QW2 A;  2VXF A;  4LDY A;  3M59 A;  2V8K A;  2K5F A;  4GY5 A;  3ZEH A;  2CGH A;  3SFM A;  1N8R U;  3JCM g;  1VQL A;  1G3W A;  2EJF A;  3OS1 A;  1N9R A;  1YJW A;  3WVD B;  2P0Q A;  4DA4 A;  4OMF B;  3QUI A;  4M7D G;  2RHI A;  3LX7 A;  4C8Q F;  1VQ6 A;  1WQ7 A;  1XTD A;  2DD4 A;  2R57 A;  2DK3 A;  2E64 A;  3HFN A;  4YTL A;  3CBO A;  3G7Z A;  3QJ6 A;  3LGF A;  3RKX A;  4C8Q C;  2LQ8 A;  3LH0 A;  3JCM f;  2E6N A;  3E19 A;  3OBW A;  1YI2 A;  4XQ3 A;  2MWP A;  2LX9 A;  4XTW A;  4M77 A;  3A8H B;  3MEV A;  3CEY A;  2O01 E;  3INZ A;  3QG1 A;  1Y7X A;  4P5N A;  2MMP A;  3TEE A;  3J81 E;  4BE2 A;  4LDV A;  1W2B S;  3OYC A;  2X35 A;  5M9O A;  4JRQ A;  2CZ0 B;  3A8M B;  1WQW A;  2EYQ A;  1WNL A;  2KY9 A;  5L8R E;  5GAO l;  2GFA A;  3JCM b;  3CD6 T;  4Z02 A;  5D6W A;  4J5Y A;  3VJP A;  3CMA A;  1VQ7 T;  4J7F A;  2M0O A;  4L59 A;  4IUV A;  3V7S A;  4WF2 A;  1LOJ A;  1Q82 C;  4A4E A;  3P8D A;  4O6J A;  3JCM V;  4BD3 A;  3JB9 I;  2JUF A;  1VQL T;  2XD0 A;  2R5M A;  2LNV A;  1HXD A;  3OS2 A;  4HKE A;  3MEU A;  3JCM c;  4R55 A;  3HRU A;  1YJW T;  1VQK A;  3FEO A;  2M9U A;  3QYG B;  3JB9 H;  4UC4 A;  3GLX A;  1V29 B;  1VQ6 T;  4C0G A;  1VQ9 A;  4LD9 K;  5LJ3 d;  4BDY A;  3JB9 J;  4QVC A;  1U1S A;  3CBP A;  1WJR A;  2H3J A;  4KUI A;  1KC8 C;  3M54 A;  3VUB A;  1WGS A;  1KD1 C;  4A4G A;  1YBY A;  3E9F A;  3GNG A;  5FRM A;  4C5G A;  5CKH A;  2LT1 A;  3QBY A;  5GAN 2;  3PTA A;  1VIE A;  2A3L A;  3CCU A;  5GMK h;  3I56 A;  1NE8 A;  1N9S A;  2XID A;  1YIT T;  4PJO F;  3SDZ A;  3ASK A;  3CXC S;  2DXB A;  4BE1 A;  3HHT B;  4M78 D;  2E10 A;  2MAM A;  1Q81 U;  4PJO C;  2WSE E;  1M4Z A;  4KT0 E;  4M78 B;  3LYI A;  4A53 A;  2ZGW A;  2LC4 A;  3V8K A;  4PKC C;  1ZBX A;  4XTX A;  2RD1 A;  3M4Y A;  4OP0 A;  3SWN C;  3URG A;  4C5E A;  2OTJ A;  1SSF A;  2F5K A;  1YJ9 A;  4C92 E;  2QEX A;  3CC2 A;  2RB6 A;  4IUR A;  3OSV A;  3GIB A;  4JLI A;  2LQK A;  3RMS A;  2EAY A;  1VQP T;  1I5L A;  3X20 B;  3HKS A;  3NFC A;  2LDM A;  1KQS A;  3C95 A;  3OW2 S;  2QI2 A;  3QJY A;  3X28 B;  2PU9 B;  1KQS S;  3OYE A;  1Q7Y C;  4M7D A;  3MCA B;  3OYI A;  5CKE A;  4BE0 A;  4CRI A;  2EFI A;  4EMK A;  2E5Q A;  4JS4 A;  3T9N A;  2KDS A;  3M56 A;  4M77 D;  4C5H A;  5KH6 A;  1UGR B;  3LGL A;  5GMK l;  4M77 B;  4BUG A;  4C92 F;  4HT9 A;  3CC7 A;  4E7H A;  4EMH A;  1VQ4 A;  1U1T A;  3CPF A;  3PMT A;  4C92 C;  1O9S A;  1LJO A;  4M7A F;  5GAO q;  5FU7 C;  2OTL T;  2VC8 A;  1UGQ B;  4M77 G;  3RES A;  5GAN 7;  4ATO A;  4M7A C;  1BIB A;  2RHZ A;  2EQM A;  3JB9 F;  3MP8 A;  1O75 A;  1D3B A;  2RK1 A;  4M75 G;  4E7J A;  5GMK j;  5GAN 3;  3MO8 A;  5C0M A;  4DOW A;  4J7I A;  5GAO m;  3QKJ A;  2QEX T;  4FU6 A;  3QII A;  3RIR A;  3UT1 A;  5DLO A;  2DTH A;  1Y07 A;  3R6O A;  4XU2 A;  1N8R C;  1TH7 A;  2YRV A;  2V8J A;  2VUB A;  5DM7 R;  3CME T;  3UPU A;  2QXF A;  2EQJ A;  1QW1 A;  4XU1 A;  1B34 A;  3QO3 A;  3QSU A;  4L5G A;  2CKK A;  1JJ2 S;  2VGN A;  1UGS B;  1VQO T;  1BI0 A;  1VUB A;  3VYG A;  5IAY A;  4N4I A;  4FL6 A;  2XHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...