4M7DE

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 77
sequence length 82
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dE00
2CGHA 4OP0A 3HFOA 4M77G 4C8QB 4M77C 5GAOm 1KQ1A 4MMKA 4A53A 4M78A 3V7SA 4F7UE 5GAMg 1KQ2A 2DEQA 1U1SA 3BY7A 4M7DD 1I8FA 5GMKh 5LJ3g 1BIAA 5GANd 5DY9A 4EMHA 1N9SA 2ZGWA 5GANh 4MMLA 4F7UA 2QTXA 4M7AC 4M7DB 4NL2A 3JCMd 3SWNB 4PJOE 4C8QG 3SB2A 3JCMh 2DXTA 5GAN2 1B34A 4M7AE 4JRKA 4XU3A 3EFRA 3BDUA 1WQ7A 4HT9A 4C92E 4RCCA 4DQ2A 3JB9I 5GAMh 1JRIA 4PJOA 3JCMQ 4J5YA 1H641 4EMKB 5GANg 2RB6A 2E41A 3HSBA 2K57A 5LJ3h 4C92A 4JUVA 2RA2A 4M75A 2VXEA 3RKXA 4XTUA 4C8QC 1I4K1 3JCMP 2DZCA 4XTYA 4M7DF 3VU3C 2RD1A 4WF2A 5GMKe 4C8QE 3V8JA 4PNOA 1HK9A 3JCMg 4M7DG 1Y96B 4M7DC 4M77E 4M75D 1D3BA 4N0AC 5LJ5j 3SWNC 3JCMe 4C8QA 4XTZA 4QVDA 1WNLA 4X9CA 2EJ9A 2DZ9A 4M77A 3RKYA 4M78D 5GAMe 4RCBA 4F7UF 4J6WA 4XTWA 3QSUA 1X01A 2VXFA 3JCMV 2DVEA 4XU1A 5GMKj 1LNXA 1WPYA 3JCMc 4EMKC 1JBMA 1N9RA 2JN0A 5GMKi 3INZA 5LJ3e 3SWNA 3EFSA 5GANj 4M7AA 2I2LA 5LJ5e 4HT8A 5GAN3 5GAMf 5GMKm 1TH7A 1LOJA 5GAN7 3V7CA 4F7UB 3V8KA 1HXDA 3M4GA 5GAOl 4NOYA 5LJ3f 3V7RA 4Y91A 5GAMj 4PJOD 1BIBA 4C92F 4EMGA 5LJ5f 4M75F 3PGGA 2RM4A 1MGQA 2YLBA 5GAN6 2DJZA 5GAN4 4M7AD 3JB9H 4XU0A 2E65A 5GANe 5LJ3j 4PJOB 2E1HA 4C92D 2YHTA 5GAOn 3BFMA 3L1AA 3QO3A 4JRIA 4M78F 5GAN8 2FB7A 5GAOr 2EWNA 4XTVA 4C92B 2EJFA 4M7DE 4M75B 3RUXA 4M78G 3QUIA 5GANf 4XTXA 4XQ3A 1M5Q1 1I5LA 1I81A 3JCMf 3JCMJ 4M78B 3JB9D 4M7DA 4N0AA 4F7UG 4NL3A 2VC8A 3RIRA 4C8QD 4A54A 3RKWA 1D3BB 2DTHA 2HNIA 4PJOF 4M77D 3V8LA 5GAOq 1U1TA 2EJGA 5GAOp 1WQWA 4HA8A 4M7AF 3BW1A 3QHSA 4M77B 4PJOG 2FYKA 1B34B 5CAIA 4EMKA 3FIFA 3RESA 4PJOC 4M7AG 2DKGA 2E10A 2YLCA 5LJ5g 4V2SA 4C92G 3RERA 4J6XA 4M75G 4M7AB 4C92C 3JCMX 1M8VA 4XU2A 4M75C 5I21A 3GIBA 3JCMW 3FB9A 2DTIA 2EAYA 4JLIA 5GAMd 3JB9J 3JB9F 4M75E 3AHUA 1Y96A 2E64A 3FJPA 4M78C 4C8QF 2Y90A 1LJOA 5LJ3d 3JCMb 3L2ZA 3HFNA 3JB9G 5GMKl 2DTOA 1YCYA 4M77F 5LJ5d 2DXUA 4QVCA 4M78E 4X9DA 4J6YA 5GAN5 5LJ5h
chains in the Genus database with same CATH superfamily
2CUDA 3G6ET 3QBYA 4Q5WA 3EG3A 1WJSA 2RHIA 1GRIA 2A7YA 2HMAA 1M3CA 4OMQA 5LJ3g 2J6FA 2F5KA 3VKIA 7AT1B 2D6FA 4EPCA 1ZA1B 2LX7A 3VS2A 5IHNA 3UF4A 2PUOB 3LH0A 4E7ZA 1UG1A 2D8HA 2LP5A 3G4SA 1KQSP 1Q81R 1K9MU 1JJ2A 1HD3A 2FHDA 3V8JA 3CCRQ 4OF1A 3MP1A 2DK3A 3MO8A 2ROTA 2XHCA 4C8QA 2M16A 2QGFB 2O4XB 1YI2A 3FLGA 2M1HA 1VQMT 2O2OA 3HRTA 1ZUYA 4QKUA 2HDAA 2SRCA 2DETA 4DBFA 2CP3A 4PL6A 1SRLA 3OB9A 4IURA 4A4FA 2HBWA 4XAXB 2RM4A 3JB9H 2DLPA 4MDWA 3TQ7P 2RHUA 2B8AA 1I1JA 3CMEA 1X69A 4F14A 4FW1A 3QZ9B 4DOWA 4II1A 1YJWT 2M02A 3WVEB 4M7AF 2FPDA 1JQQA 3FIFA 3RESA 5CQXA 2DKGA 3BDLA 3RDVA 5LJ5g 1W1FA 3GP8A 2XDDA 2G3RA 3AHUA 3PIPA 2QQBA 2XG8D 2E5QA 1OPKA 2DL8A 3ZBDA 4B6MA 1YHQT 4OP0A 1TUGB 1KQ1A 2CH4A 1K0SA 1M2VA 1BIAA 4KH0B 2ZGWA 4F7UA 4JZ3A 3A8LB 5KYWA 5CKEA 1M30A 5GAN2 2FG0A 4PJJA 2DIGA 3OYDA 5GAMh 4J9HA 3OYNA 1Q86C 3N5BB 1NLOC 1JJ2S 4J8OA 1BKBA 5FWBA 1WHGA 4BB7A 4LE9A 2HL3A 4AG2C 1AWJA 3M9QA 1ZHIA 3CC7Q 5HK0A 1QW1A 2VKNA 4RKUE 1KC8R 4XU1A 3I9QA 3JCMc 2L3PA 2AIRB 3SHWA 2W0ZA 3OYCA 1WHLA 5GMKm 2JW4A 3G6EA 3CCRA 1WXBA 3NTHA 1YJNQ 4M75F 5GAN4 1Z9ZA 2RHYA 2E1HA 1K0XA 2DYBA 4JRIA 2EWNA 1BI2A 2EKHA 2KYMA 2NUZA 2FEIA 4XK8E 1JEGA 5FU7C 4Z88A 4L5GA 4N0AA 1RAGB 2RQUA 2D0QB 2P0KA 3FEOA 5D6WA 3G71T 1T0JA 2DO3A 2KR3A 1B7TA 3JAME 3VS0A 4A4GA 3TVTA 3OYMA 2LMJA 2WACA 3RERA 2KEAA 1AWXA 5CKDA 1BU1A 1IGUA 2KROA 4KBMB 2FRYA 3FB9A 3JCMW 2EAYA 5GAMd 1VQMA 1K76A 4WCIA 2GQIA 1Y96A 1RAAB 1M3AA 4JRPA 3CXCA 1D1AA 3A98A 2V8IA 1EZZB 3OW2S 4D6WA 1RI9A 4J9GA 1X6GA 3S3OA 1N9SA 4QVZA 5KE3A 2KXCA 2C0IA 4FL6A 4MZMA 4OMLA 5IXFA 2YRDA 3NFCA 3A8OB 1ZBXA 3TSWA 1TUDA 1NLPC 3GPLA 2X4YA 1Q81U 2BE9B 1VA7A 3CCUQ 1GFCA 3UWNA 2F2WA 4KUDK 2DZ9A 3QSUA 1NPRA 1FXXA 3DLLA 2K3YA 2YSQA 1WPYA 2QDYB 5FU7B 1PRLC 1VQ6Q 3MCAB 2F5TX 2LQWA 4AT1B 1YHQA 3V7CA 2EQMA 2GF7A 2BUDA 1K8AR 1WX6A 4RMOA 1MNEA 2XMFA 4A4KA 2YWWA 3CC7A 5IHKA 4CRIA 2YUQA 4LNPA 2K79A 3CCJT 5GAN8 4JS5A 2RHXA 3QYHB 4XTVA 2EJFA 1QVPA 3RUXA 1HJDA 3OMGA 4C0GA 4BUGA 4A54A 4F04B 4E7LA 2BZ8A 3R6NA 1WDXA 2PVGB 3CPFA 1PCXA 4LDYA 3S3NA 3ER0A 2JJ9A 2LDMA 3QWXX 4RG8A 2XKOC 1PD0A 1VIFA 3CXCS 2AKLA 5LJ5d 1F1BB 2AK5A 1IHWA 2VASA 1LCKA 1SSHA 4RTVA 1Q82R 5KYYB 4BI3A 1QWFA 1KQ2A 2MF2A 2DEQA 3EGDA 1K9MC 1YIJQ 2OAUA 5GANh 2MMPA 1N8RU 4FCYA 4IIOA 2ZPIB 4M7AE 3CD6T 1M2OA 4JRKA 2EPDA 2C0TA 3CBMA 1Q7YU 2KRNA 2V26A 2COZA 4C92A 2E70A 3JSCA 5CVIA 1BI0A 3G1JA 4CC7A 3G71A 4WF2A 3OY9A 3CC2A 3HRUA 1HSQA 1YITA 1TWBA 3O8VA 2CP6A 1VUBA 4M78D 5EC7A 3J81E 4F7UF 2OTJQ 4F17A 2KI7A 1UUEA 1KC8U 2E3IA 4HT8A 1D0YA 4ELYC 2QI2A 4MZPA 4PFOA 4MZTA 1MGQA 1G3WA 2Y4YA 3OS2A 3LWHA 1UB4A 1KG1A 4N4HA 2J05A 1IB8A 1MNDA 2H3JA 3RR6A 4A4EA 1OPLA 4M78G 5GANf 2CT4A 1M1KU 1VQ6A 1XOVA 3H6ZA 1BK2A 3PFSA 1TSFA 3CPWA 3FC3A 4M77D 1WQWA 1PD1A 3QHSA 1MUZA 2M0OA 4EMKA 1NEBA 4Z8AA 2YLCA 4V2SA 2D9TA 1G83A 3CCQT 3M58A 1TOVA 2L0AA 2RQRA 2JS0A 1C0MA 3CCLQ 1GCPA 4M75E 4C0DC 1VQ8Q 5CO7A 2DXCA 2DMOA 4X9DA 4N4GA 3CMAQ 4TVRA 2IG0A 4M77G 2X4XA 3VS7A 4MMKA 5IN1A 2KNBB 1PRMC 1RAHB 5J39A 2XI9A 1V29B 2MI6A 3CCJA 1NE8A 2RJDA 2K9GA 1D1CA 4BE1A 4LD6A 4KRTA 4HT9A 4DQ2A 2MYSA 2EFIA 1O9SA 2J06A 4OMPA 1VQLT 4RTZA 2XDBA 2K4YA 1YIJA 2GTJA 2HEQA 2KXDA 2M9UA 3X25B 3OS1A 2V1QA 2D0NA 1X27A 3JCMe 2QXFA 1VYUA 1BCOA 2BZXA 3MPUB 1N9RA 2EQKA 3LH5A 5A0GA 1YI2Q 1XNIA 1AEYA 1BCMA 3UDCA 1AHJB 3LLRA 4M4ZA 5GAOl 4R56A 1KJWA 1WIEA 1SF9A 3EG9B 5GANe 1EIFA 2NUPA 4LDVA 3T9NA 4KGZB 2OTJA 5GAOr 2HCKA 3CPWP 3MP6A 1NPPA 1VQ9T 1M1FA 4DOVA 3QUIA 2CT3A 1RAFB 2LJ0A 1VQPT 2OTLT 1OV3A 2JM9A 4OB1B 4C0DB 3KXTA 3JB9D 4QT7A 1K73C 4BY6C 1W2BS 2VVKA 1UGQB 2DBKA 4C5GA 5CAIA 4OVAA 3I56T 1C6VX 4DEXA 3H9NA 4M75G 4R55A 1D0ZA 1A0NB 1YNZA 2EYZA 1KD1C 2QASA 5AYFA 1LPLA 3OSVA 3JB9G 1J3TA 1AVZC 2DTOA 2RQVA 4RTUA 2ABLA 3PNWC 4M77C 4A4HA 3U23A 5GAMg 4A53A 2CZ0B 3X28B 4M7DD 2M0YA 1I8FA 5DY9A 2EYYA 4M7AC 1BI3A 2L5QA 3CCLA 2LJ1A 4NL2A 1WHKA 2R5MA 1RAEB 2C0OA 2A36A 3I5RA 2OJ2A 4CI0C 1U3OA 3A8GB 4PJOA 3CMAA 3GNFB 3JCMQ 3O5ZA 1V1CA 1JXMA 2EVRA 3CCET 5J3BA 1H8KA 4E7HA 1RUWA 3H0FA 2W10A 3VU3C 1BYMA 2B86A 2ATCB 2DA9A 2MWPA 4M7DG 4BE0A 1D3BA 3BE3A 4N4IA 3SWNC 2FPFA 3PMIA 2KYBA 2KDSA 4PFZA 1X2QA 3OMCA 4E7JA 1M90R 4JPBW 3CCMQ 2I2LA 1ZSZC 3F70A 1GCQA 1O75A 3V8KA 3REBB 2FZKB 4BY6B 4O5VA 3UA7A 4C92F 5I2MA 5CCAA 4BDZA 3G6EQ 4BD3A 3ZFJA 2DILA 3CC4T 3EHQA 2DX1A 3QO3A 4M78F 3MEVA 3SDZA 4AG1C 2FZCB 1FMWA 5KYXB 3CCST 3MEAA 4FT2A 2VC8A 3C0CA 4C8QD 1YWOA 1VQ4T 1NYFA 2GGRA 2DAQA 5FRNA 4BI8B 2QEXT 2MCNA 2KAFA 5I2SA 3CEYA 4M77B 2O01E 2FYKA 4QQGA 1SG5A 2RF0A 1OU8A 3EH2A 2EGEA 1S72T 3M0TA 4M7AB 4BACA 4M75C 2E4HA 2DE0X 2Y90A 3S6WA 2KRMA 4FYVB 3VS3A 1X2KA 4M77F 1VQMQ 1ZQ1A 1Q7YC 4C8QG 5GAN5 5L8RE 1TUCA 2KK4A 4LUEA 4CC4B 2K5IA 3RBBB 3V7SA 3VS4A 1T3SA 2QQRA 1Z9QA 2XU8A 3EG2A 3SWNB 3SB2A 1QP2A 1UECA 1PKTA 1VQ9A 2WSCE 1NZ9A 3BDUA 1M1GA 2BZYA 4DEYA 1I07A 3JRZA 3CCVT 2GQVA 2COWA 1ZSZB 2QG9B 2VXEA 3RKXA 2LQNA 4XTYA 4P5NA 2DL5A 1YJWQ 2QGGA 3OW2A 4OMMA 3M0UA 1G3TA 2QDLA 4M7DC 4PJLA 1N6AA 1RLQC 5KYYA 2R58A 1UDLA 4R0KA 2RHZA 3TREA 1JJ2P 2L2PA 2DVEA 3QJYA 5DM7R 2CZ1B 2JN0A 3J80E 5ECAA 2KQWA 2V8JA 1VQ5T 2BTTA 4HVVA 1TH7A 2WSEE 3CBPA 3NGPA 1TU0B 4FM4B 3A1PA 3OS0A 4O6JA 1YHQQ 3OA6A 5LJ3j 5FWCA 5KCHA 4PKCC 4ZN1A 2JXBA 5D6YA 4M75B 2F2XA 3HHTB 2NUTA 3CCMA 1YJ9T 2P84A 3WVDB 3PIOA 1NJIC 1JO8A 3VRZA 4F7UG 3RIRA 1IXDA 2MPXC 2O9VA 1RADB 2QAZA 5GAOp 2J6OA 4FIBA 2L8DA 1QCNA 2JM8A 3BW1A 1UHCA 2JOYA 1B34B 1UTIA 4IUUA 3L2UA 1G3SA 4ZGEB 3LWIA 5DLQE 2ESWA 4XU2A 2LNHB 3L2RA 3TCJA 3JB9F 5HKCA 4IUTA 4RTXA 2DNUA 2KSSA 2G6FX 3OBWA 3X24B 2VB6A 5GAOm 2NYSA 3REAB 2JTMA 5CKBA 4M7DB 4IUPA 5A0DA 2YRVA 2PTKA 3GBQA 3EFRA 3P8HA 5A0LA 1Q86R 8ATCB 2FVUA 4DBHA 1H641 1OOTA 1GL5A 4F16A 2RB6A 2RMOA 2QEXA 3JCMP 1VQOT 4M7DF 2A28A 3G71Q 5LJ5j 1KHIA 3H0HA 4ME7A 4JS4A 1WNLA 1NJIR 1UFFA 3CC2Q 1X43A 1YITQ 2KY9A 1TTHB 2EGCA 4HVWA 3NTKA 3EFSA 1QVFA 9ATCB 1G8XA 1M90U 2YRCA 4DBRA 1YJWA 3VYGA 1YN8A 3NTIA 2IVWA 1TXQA 4FYXB 5LJ3f 2DJZA 2KMTA 2PU9B 2FB7A 2KT1A 1MHNA 1IRXA 2VGNA 3ZL7C 2HZYA 1OYXA 2DVJA 2EBPA 4XTXA 2EYQA 3OYGA 1RL2A 1WZOA 1Y7XA 2PNIA 2PVOB 4PLIA 1UGPB 4J83A 2R5AA 6AT1B 1M4ZA 1PSEA 2DL7A 2DD5A 1CKBA 2K3BA 1D1BA 2YDLA 5D6XA 4ESRA 8AT1B 4JLIA 1QP3A 1SKUB 4KULA 3GOXA 3LYIA 2MWOA 4C8QF 2JT4A 5HK3A 4PJMA 4M78E 2QYZA 1K9AA 2CGHA 1N5ZA 3HP9A 3VS6A 1E7OA 3PMTA 3VUZA 3P8BB 1VQKT 3CXCP 3UATA 1VQ7T 4KGXB 2K7AA 4J9IA 1EX4A 4X1VA 3JCMh 5I22A 3I55T 2HKQB 2YXYA 2H3EB 2CYZB 2PUKB 4RCCA 3CCJQ 1YJ9A 2WSFE 2E41A 2VYTA 3VUBA 2LNVA 3H41A 2JTFA 2JTEA 2RPNA 4PNOA 1PC0A 5FROA 4M77E 4N0AC 1OU9A 1GXIE 4QVDA 2RN8A 3OS5A 1ZUKA 3EH1A 5LJ3e 1QVFS 4QW2A 1M2VB 4GY5A 4F7UB 5KYWB 3PT9A 4NOYA 1HYOA 1OZ2A 3KBGA 3DLMA 1IGQA 1Y07A 5GAN6 1WYXA 4AFUC 4C92D 3BFMA 4RTWA 1KFZA 2PZ1A 2ENMA 1ZX6A 2P4RA 5HCKA 2EYWA 4XQ3A 1I81A 3JCMf 1Q95G 4AFQC 2K5LA 1QLYA 2GCXA 2E12A 2L89A 3TEEA 3M53A 2EJGA 1VQOA 5GJVB 4LDUA 5CIUA 2DM1A 2ROLA 2X35A 1QCFA 3OYLA 4C92G 4J6XA 1AT1B 4OB0B 1VYVA 4J9CA 3OBYA 2MOXA 1JXOA 4LN2A 2QA4T 2A08A 3L2WA 2X3XD 1R0CB 1K9MR 2O4XA 2AZVA 3FJ5A 1W2BA 3LW5E 3BY7A 1H3HA 1ABOA 5GANd 5CQYA 4E7SA 1RABB 4MDXA 1MV3A 4UC4A 1QWEA 3E1SA 1VQNT 2YUNA 2P0PA 3H0IA 1Q86U 3HPWA 4J5YA 3ZEHA 2K57A 2LRQA 1XQHA 1YFNA 4XTUA 2FL7A 1VOMA 2GNCA 2RNAA 5I11A 1E6GA 1NYGA 4WTOB 3OYEA 2RO0A 1Y96B 2EIFA 1ZA2B 1P92A 1AWOA 3EGXB 2Z0WA 5KCOA 2QTVA 1S1NA 2HSEB 5J26A 4E47A 1X01A 5IT9E 3CCQQ 5GMKj 1RACB 1WJQA 1UHFA 5GMKi 3SWNA 4J9BA 4L6V5 3G4ST 3M4GA 1Y0MA 4JJBA 1UGSB 2VUBA 4DA4A 1WGSA 2CP5A 1BIBA 3IQLA 1QVGA 4BE2A 2CZ7B 1WXUA 2DL3A 2XICA 1ZSZA 4GLMA 3CBOA 4X34A 3SD4A 1N27A 5CR2A 4M7DE 1IHVA 3EFOB 2L3QA 1I5LA 2JS2A 1UGRB 1R0BG 3JV3A 4HVUA 1W70A 2HQXA 4YTLA 2HQEA 2LZ6B 1VQLQ 2HAXA 3DB3A 2JVVA 1K8AU 5CKHA 3M4YA 3EAEA 1ZLMA 1C1AA 4C92C 3CMET 5IHIA 3VS5A 4EIKA 1AD5A 1OQKA 1PWTA 3CD6A 4M78C 1YWPA 3A8MB 2CUBA 4RG2A 4OMOA 3MEUA 4JJNK 2RJFA 4IUQA 3HKSA 4LUDA 4ZGJB 1UGVA 4D8KA 1KK7A 2EKOA 5FLXE 3EG1A 3M59A 1ZBJA 3THKA 3OYBA 2EQIA 2J7IA 3EG0A 1KQSA 2DXTA 2AHJB 1B34A 2E5KA 3R6OA 2LVMA 2PVDB 5FRMA 1VQ9Q 2DIQA 1VQPQ 2OTLQ 1OX9A 2FZGB 2ED1A 4EDUA 1NM7A 2P4TA 4C8QE 5CKFA 1Q82U 1Q81C 1WJRA 1B3QA 1TS9A 4XTZA 2HQHA 4QQ6A 2EJ9A 3I56Q 2DRKA 2VXFA 3JCMV 4JJDA 2OX7A 4EMKC 3GLXA 2GFAA 3LX7A 2EYXA 3INZA 4LXCA 3AT1B 3M54A 2JZ2A 1HXDA 2JUFA 3KFVA 2DEUA 2QQSA 4PJOD 3P8DA 1QVGS 2LQKA 2YLBA 4XU0A 2HSPA 1SHFA 1X6BA 1NBEB 3CCQA 4KUIA 4C92B 3OYFA 1K73R 2RQWA 4RUGA 3E9GA 2XD0A 1WLPB 1BB9A 3I35A 1MMGA 5KYUB 2DPPB 4M78B 2O9SA 3CCRT 3M0SA 2HNIA 3C95A 1XJWB 4D8DA 4OGEA 4PJOG 3CCEQ 4PLLA 4CC2A 4FU6A 2E10A 3A5ZB 3OYJA 1KD1R 4BI4A 1AWWA 3GIBA 1FMVA 2X3WD 2DTIA 3EGUA 1K4US 2YUPA 4GLKA 4J9DA 2E64A 1M3BA 1LJOA 3JCMb 2CDTA 2DXUA 1VQLA 5C0MA 2I0NA 1UJYA 4F7UE 4CC3A 3NMZC 3E2UA 2DL4A 2BE7D 3M57A 3L2QA 1VIEA 4ANJA 3CQTA 3MHXA 2DF6A 3Q1JA 4B9WA 1KQSS 3CC4Q 1SEMA 5FU6C 1N8RC 2SEMA 3JB9I 1QKXA 2V1RA 4PJNA 4EMKB 3VS1A 5KYNA 3GNGA 1WA7A 3WXMB 2JNGA 2VWFA 3CCSQ 4JLGA 1AZGB 2CSQA 5GMKe 1TG0A 1VQ4Q 1WHHA 2QEXQ 3LGFA 3A8HB 4RCBA 1S72Q 4XTWA 4Y92A 2NLUA 2KGTA 1VQPA 2OTLA 1RLPC 2F2VA 1KC8C 2AT1B 3L2VA 2ZZDA 3C4SA 3HL8A 3PVQA 2RI2A 4C5HA 5GAMj 2QQAA 3OYHA 4E7KA 4C5EA 3DB4A 3I56A 1AZEA 2LTOA 3H8ZA 2LX9A 4IIMA 2XDPA 1LVKA 1V76A 3QYGB 4OB2B 1M1KC 4NL3A 3META 2DD4A 2KRSA 5GAOq 1WI7A 4LD9K 2DERA 1JU5C 3CCVQ 1I0CA 4PJOC 1FWZA 1N8RR 3CC7T 3QPHA 1WXTA 1M8VA 3UT1A 4KH1B 3M0QA 2XIDA 3M0RA 1Q7YR 5FU6B 3JB9J 2X9HA 1ARKA 1PSFA 2K5FA 5HY6A 2FRWA 2NUPB 3JCMg 1YJNT 3RMQA 4IKFA 3CCEA 1XTDA 3HFOA 1MV0B 2ZCFB 1VQ5Q 2MAMA 4VUBA 2HD0A 2ED0A 4EMHA 2LCSA 1GCQC 1VYTA 2F69A 3C12A 1D09B 3MEWA 2LT4A 2X4WA 5GANg 5FW9A 5LJ3h 1CSKA 2RA2A 1YJ9Q 4C8QC 4AFZC 2KVQG 1HK9A 3HTRA 4J9FA 3CC4A 5KH6A 2RK2A 4ZN3A 3SEMA 1M1KR 1G3YA 4DBQA 3OW2P 2ZPEB 1SHGA 3CCSA 5GAMf 4C0ZA 4JJCA 1VQ4A 3QWYA 2CSIA 1YCSB 2CH4W 4EMGA 3CC2T 1M27C 4PJOB 4ORZA 1YITT 4HXJA 2RH2A 1S72A 5GAOn 1K8AC 1K1ZA 1W4SA 3OYKA 1K73U 3TSZA 4GBQA 2LCLA 3EGXA 4BDYA 3RKWA 4E6RA 2GFUA 1D3BB 4AFSC 4PJOF 3V8LA 4HCKA 5EG2A 1R8OB 2CP2A 1KSWA 2O31A 3CCUT 2LT1A 1VQOQ 2KT8A 4ATOA 1ACMB 4ZTJA 3TU4K 2V8KA 1KD1U 5LL6S 2D8JA 1PKSA 3ULRB 1VQ6T 1SSFA 1SPKA 5GJWB 2DFUA 2AZSA 3FJPA 5LJ3d 2YUOA 1FYNA 2DJQA 3PTAA 3EFOA 5LJ5h 1GFDA 3ASKA 3CCVA 4C8QB 1OULA 2ZPBB 1U1SA 2ZPGB 1D0XA 2BKDN 2OI3A 3S3MA 1Q82C 1AOJA 2K6DA 4ZGDB 4XU3A 1WQ7A 2K3XA 1X75C 3EG9A 4C92E 2D1XA 1WHJA 2FO0A 5IAYA 3I5SA 1PM3A 1VQ5A 4JUVA 2RD1A 2LQ8A 4NS5A 1U8RA 4Y28E 3ME9A 1QQJA 4HCCA 1JB0E 1NG2A 2K2MA 1B07A 5L23A 4OMNA 5GAMe 4J6WA 1KHCA 1ZUUA 3FDRA 5GANj 1UJ0A 5AT1B 3E9FA 2EQJA 4HKEA 5GAN3 1YJNA 2QK0A 1YIJT 3V7RA 4LDWA 2CS7A 4B9XA 5LJ5f 2VV5A 3PGGA 1M9SA 3M55A 4FW2A 2RI5A 1UEBA 1IZ6A 4KT0E 2YHTA 1QVFP 1W6XA 1VQKQ 1MMDA 1MMNA 1VQ7Q 3OYAA 1YP5A 1M5Q1 2X51A 3JCMJ 3I55Q 1H92A 4JDSA 3QDRB 2LJ3A 4FYWB 2C06A 4E2FB 2DTHA 2PQWA 2GTOA 3QKJA 4HA8A 5D7UA 2OTJT 3X26B 3RMSA 4RTYA 4HCZA 2FPEA 2MK5A 1QMCA 1UE9A 3QJ6A 2HBPA 4FT4A 2OAWA 2RQTA 3UA6A 3CD6Q 2QQ9A 3KUFA 2A0FB 5KYUA 2ECZA 4M78A 1FX7A 2AKKA 2LCCA 2NUTB 1G2BA 2E3HA 3UPUA 2X4JA 2QTXA 3JCMd 2E6NA 1PNJA 5IH2A 1QKWA 4OGCA 1DJ7B 2HKNA 2KBTA 2ZPHB 5M9OA 4ELZC 5CK9A 3D7SB 2DZCA 2CREA 2A37A 4K11A 3CCUA 1EFNA 3X20B 1BBZA 3E19A 5KYXA 2EW3A 1FMKA 3CCLT 2CZ6B 1VQ8T 3EHRA 4J7IA 4HCBA 1BI1A 3DKMA 4M77A 3RKYA 2M51A 3VYHB 2A3LA 3CMAT 1H3ZA 1T3LA 3G7ZA 2IPOB 2RI3A 4J9EA 5IXBA 1U5SA 1G5VA 4KGVB 4M7AA 5LJ5e 2RK1A 4OB3B 1LOJA 3NHNA 5DLOA 5A2QE 1OZ3A 2QA4Q 3FRNA 4Y91A 1OEBA 4M7AD 4ZNXA 1ZSGA 2E65A 4FSXA 2IIMA 2RJEA 2DBMA 1NJIU 4C0FA 1VQNQ 1PG5B 1E6HA 2BIVA 3M0PA 3MJXA 3OYIA 4QQDA 4OMFB 1Y71A 1IREB 2H8HA 4M7AG 1VQKA 1ABQA 1VQ7A 3JCMX 1QCOA 1YI2T 3I55A 3OSSC 4J7FA 4E7IA 2ZAEA 3L2ZA 5GMKl 4FSSA 2HL5C 4QVCA 1GBRA 3QZ5B 3OQ5A 3HRSA 4IUVA 3PE0A 1X6OA 2YT6A 3G4SQ 5GMKh 2JMCA 2O88A 4FYYB 4MMLA 1I5OB 3QDFA 1OI1A 2GBQA 4PJOE 2CP7A 1Y57A 1IO6A 4AMCA 3OYYA 2L3SA 1JRIA 1W2BP 2JMAA 3VRYA 2XK0A 3HSBA 4Z02A 3LGLA 2DYIA 4M75A 5C6SA 2EQUA 1I4K1 4PK4A 4JRQA 3GF5A 3MKDA 3C94A 4M75D 1RI0A 1GBQA 3SFMA 4RTTA 2L3RA 3M56A 3QG1A 1KIKA 2K2VA 3J7AF 1NEGA 4X9CA 2VGMA 1WHMA 2MIOA 3QXEB 1LNXA 1RAIB 1JBMA 4L59A 1R77A 3CMEQ 1SRMA 2R57A 3CPWS 5GAN7 1M90C 4JZ4A 1CKAA 2DXBA 2J6KA 2NWMA 2RJCA 1MMAA 4A63B 3PVLA 4ZTFA 3URGA 3L1AA 1M8MA 2ZPFB 1U06A 5KE2A 1YBYA 1QVGP 4PFPA 4M7DA 3L42A 2QA4A 3EGDB 3NPFA 4LDXA 1PHTA 2F1LA 2COYA 1T0HA 4Z89A 1U1TA 2CP0A 2P0QA 1WFWA 2KE9A 1OX8A 4C5IA 2DRMA 2EGAA 2Y4XA 3VJPA 1VQ8A 3M5AA 2LC4A 5I21A 3CCMT 3QIIA 3RNJA 1VQNA 2CKKA 3MP8A 3HFNA 2E6ZA 1YCYA 3VV0A 4J6YA
chains in the Genus database with same CATH topology
3RMQA 3G6ET 4IKFA 4TVRA 3CCEA 3QBYA 2CGHA 2IG0A 4Q5WA 1XTDA 3HFOA 3HP9A 4M77G 2X4XA 1WJSA 2ZCFB 2RHIA 3PMTA 4MMKA 5IN1A 2A7YA 3VUZA 2MAMA 4VUBA 2HD0A 5J39A 5LJ3g 2XI9A 3P8BB 1VQKT 4EMHA 1V29B 1VQ7T 2F5KA 2MI6A 3CCJA 1NE8A 3VKIA 2D6FA 2RJDA 2F69A 3JCMh 4EPCA 3I55T 3C12A 4BE1A 4LD6A 3MEWA 2LT4A 4HT9A 2PUKB 2CYZB 4RCCA 4DQ2A 1YJ9A 2WSFE 2X4WA 2EFIA 1O9SA 5GANg 2PUOB 2E41A 2VYTA 5LJ3h 3LH0A 3VUBA 2LNVA 1VQLT 2XDBA 2RA2A 2K4YA 2JTFA 4C8QC 3G4SA 1YIJA 1K9MU 2KVQG 2M9UA 1JJ2A 3X25B 3OS1A 2FHDA 3V8JA 4PNOA 1HK9A 3JCMg 4OF1A 3MP1A 2RK2A 4M77E 5FROA 4ZN3A 5KH6A 2DK3A 3MO8A 4N0AC 3JCMe 2XHCA 2QXFA 1GXIE 4C8QA 2M16A 1G3YA 4QVDA 2O4XB 1YI2A 3FLGA 2M1HA 1VQMT 3OS5A 3HRTA 5LJ3e 1N9RA 2ZPEB 1QVFS 4QW2A 2EQKA 5A0GA 3CCSA 1XNIA 5GAMf 3UDCA 4C0ZA 1VQ4A 4GY5A 4F7UB 1AHJB 3LLRA 4PL6A 5GAOl 3PT9A 4NOYA 4R56A 3OB9A 4IURA 4A4FA 1OZ2A 3KBGA 3DLMA 4XAXB 4EMGA 3CC2T 1Y07A 2RM4A 5GAN6 3JB9H 4MDWA 5GANe 1EIFA 4PJOB 1YITT 2RHUA 2RH2A 4LDVA 3T9NA 4C92D 2B8AA 1S72A 5GAOn 3BFMA 2OTJA 5GAOr 1K8AC 3MP6A 1NPPA 1VQ9T 3CMEA 1M1FA 4DOVA 3QUIA 1W4SA 3OYKA 1K73U 1VQPT 2OTLT 4XQ3A 4OB1B 4C0DB 1I81A 3JCMf 3KXTA 3JB9D 2K5LA 3QZ9B 2LCLA 4DOWA 2GCXA 2E12A 4BDYA 4II1A 1YJWT 1K73C 3RKWA 2L89A 3TEEA 2GFUA 1D3BB 4BY6C 4PJOF 3M53A 3V8LA 2EJGA 3WVEB 1VQOA 1W2BS 4M7AF 5EG2A 1R8OB 4LDUA 3CCUT 1UGQB 5CIUA 4C5GA 5CAIA 3FIFA 3RESA 2LT1A 2X35A 5CQXA 2DKGA 3BDLA 4OVAA 3I56T 5LJ5g 3OYLA 4ATOA 4ZTJA 4C92G 4J6XA 4M75G 3TU4K 2V8KA 3GP8A 1KD1U 5LL6S 4R55A 2XDDA 1VQ6T 1SSFA 4OB0B 2G3RA 3OBYA 3AHUA 3PIPA 5DM7R 3FJPA 1KD1C 5LJ3d 5AYFA 2QA4T 3OSVA 3JB9G 2DTOA 2QQBA 3L2WA 3PTAA 5LJ5h 2XG8D 2E5QA 2O4XA 3ZBDA 3ASKA 3CCVA 1YHQT 4OP0A 3PNWC 4C8QB 4M77C 4A4HA 1KQ1A 5GAMg 4A53A 1W2BA 3LW5E 2ZPBB 1U1SA 2CZ0B 2ZPGB 3BY7A 3X28B 1I8FA 4M7DD 5GANd 1BIAA 2BKDN 3S3MA 5DY9A 2ZGWA 4M7AC 1BI3A 2L5QA 4F7UA 1Q82C 3CCLA 3A8LB 5CKEA 4NL2A 5CQYA 5GAN2 1QVGA 4MDXA 2R5MA 4UC4A 4ZGDB 2DIGA 3E1SA 4XU3A 1VQNT 1WQ7A 2K3XA 2P0PA 4CI0C 1X75C 3A8GB 4C92E 3OYDA 3GNFB 5GAMh 3CMAA 1Q86U 3JCMQ 3HPWA 4J5YA 4PJOA 3ZEHA 5IAYA 2K57A 2LRQA 3OYNA 1XQHA 1VQ5A 4JUVA 1Q86C 5J3BA 3CCET 4E7HA 3N5BB 4XTUA 2FL7A 1JJ2S 3VU3C 1BYMA 2RD1A 1BKBA 2LQ8A 4J8OA 4BB7A 2MWPA 4NS5A 3OYEA 1U8RA 2RO0A 4Y28E 4M7DG 1Y96B 2EIFA 3ME9A 1P92A 4BE0A 1D3BA 4N4IA 4HCCA 1JB0E 3M9QA 3SWNC 1ZHIA 3PMIA 5KCOA 5HK0A 5GAMe 5J26A 4J6WA 4E47A 1X01A 2KDSA 1KHCA 1QW1A 4RKUE 5IT9E 4XU1A 5GMKj 3JCMc 1WJQA 3FDRA 3OMCA 4E7JA 5GANj 5GMKi 3E9FA 2EQJA 3SWNA 4HKEA 2I2LA 3OYCA 5GAN3 5GMKm 1YJNA 3F70A 1O75A 4L6V5 3G6EA 3V8KA 3G4ST 3CCRA 3M4GA 1YIJT 4BY6B 3NTHA 1UGSB 2VUBA 2CS7A 4LDWA 3V7RA 4B9XA 4DA4A 1WGSA 4O5VA 1BIBA 5I2MA 4C92F 5CCAA 5LJ5f 4M75F 2VV5A 3PGGA 5GAN4 4BDZA 4BD3A 2CZ7B 1M9SA 3M55A 3ZFJA 3CC4T 2RI5A 4BE2A 2RHYA 3QSUA 1UEBA 1IZ6A 2E1HA 2XICA 4KT0E 3CBOA 2YHTA 4X34A 3SD4A 3QO3A 4JRIA 4M78F 1N27A 2EWNA 1BI2A 3MEVA 5CR2A 4M7DE 3SDZA 3OYAA 4XK8E 1I5LA 1M5Q1 5FU7C 1UGRB 3JCMJ 4JDSA 3QDRB 4L5GA 3MEAA 4N0AA 4FT2A 2VC8A 4C8QD 3CCST 2D0QB 1VQ4T 2C06A 2DAQA 5FRNA 2P0KA 3FEOA 2DTHA 5D6WA 4BI8B 2PQWA 2QEXT 2HQXA 3QKJA 3G71T 4HA8A 2KAFA 2DO3A 3CEYA 4YTLA 2HQEA 5I2SA 4M77B 2O01E 2FYKA 4QQGA 2HAXA 3DB3A 3JAME 4A4GA 2JVVA 1K8AU 5CKHA 3OYMA 3M4YA 3EAEA 1S72T 2OTJT 2WACA 3RERA 4M7AB 3X26B 4C92C 4BACA 4M75C 3RMSA 5CKDA 3CMET 3JCMW 4KBMB 3FB9A 4HCZA 2EAYA 5GAMd 1VQMA 3CD6A 3QJ6A 1Y96A 4M78C 2HBPA 2Y90A 3S6WA 4JRPA 3CXCA 4FT4A 3A8MB 4M77F 1ZQ1A 1Q7YC 4C8QG 2V8IA 5GAN5 5L8RE 2QQ9A 2KK4A 3OW2S 3KUFA 4RG2A 2K5IA 3MEUA 4JJNK 4M78A 3V7SA 1FX7A 4D6WA 2LCCA 2RJFA 4IUQA 2QQRA 3HKSA 4ZGJB 3S3OA 2EKOA 1N9SA 5FLXE 4QVZA 3M59A 2X4JA 2QTXA 5KE3A 3UPUA 2XU8A 3OYBA 3JCMd 3SWNB 4FL6A 4MZMA 3SB2A 1KQSA 1QP2A 2AHJB 2DXTA 2E6NA 1B34A 1VQ9A 2WSCE 1NZ9A 3R6OA 1DJ7B 3BDUA 4OGCA 2LVMA 2PVDB 1M1GA 5FRMA 3JRZA 3NFCA 2ZPHB 2DIQA 3CCVT 3A8OB 5M9OA 4ELZC 2GQVA 1ZBXA 2VXEA 3RKXA 5CK9A 3GPLA 2DZCA 2X4YA 4XTYA 4P5NA 4EDUA 3CCUA 1Q81U 3OW2A 2P4TA 3X20B 3E19A 1G3TA 4C8QE 5CKFA 1Q82U 4M7DC 3CCLT 1N6AA 2CZ6B 1WJRA 1Q81C 1VQ8T 4HCBA 4J7IA 4XTZA 1BI1A 2R58A 3UWNA 4QQ6A 4KUDK 2EJ9A 2DZ9A 3DKMA 1NPRA 4M77A 3RKYA 1FXXA 2RHZA 3TREA 3VYHB 3DLLA 2A3LA 2VXFA 3JCMV 3CMAT 2DVEA 2K3YA 1H3ZA 3G7ZA 4EMKC 1WPYA 2GFAA 2CZ1B 2JN0A 2QDYB 2RI3A 3GLXA 3INZA 3LX7A 2KQWA 2V8JA 5FU7B 3J80E 1G5VA 4M7AA 5LJ5e 2RK1A 2F5TX 3MCAB 1VQ5T 3M54A 4OB3B 1TH7A 1LOJA 2JZ2A 1YHQA 2WSEE 3V7CA 1HXDA 3CBPA 5DLOA 5A2QE 1OZ3A 4FM4B 2EQMA 2JUFA 2GF7A 2QQSA 3FRNA 4Y91A 2BUDA 3P8DA 3OS0A 4PJOD 4O6JA 1QVGS 2LQKA 2YLBA 4RMOA 4M7AD 3CC4A 4XU0A 2E65A 4A4KA 5LJ3j 4FSXA 3OA6A 5KCHA 3CC7A 4PKCC 4CRIA 2RJEA 3CCJT 5GAN8 3CCQA 4KUIA 4JS5A 4ZN1A 2RHXA 3QYHB 4XTVA 4C92B 2EJFA 5D6YA 4M75B 3OYFA 1QVPA 3HHTB 3CCMA 3RUXA 3E9GA 1NJIU 2XD0A 1YJ9T 2DPPB 3OMGA 4M78B 3WVDB 4C0GA 3PIOA 1NJIC 4F7UG 4BUGA 3RIRA 4C0FA 4A54A 3CCRT 2BIVA 2HNIA 3OYIA 3C95A 5GAOp 4FIBA 2L8DA 4QQDA 3BW1A 2JOYA 4OMFB 4OGEA 1Y71A 1B34B 4PJOG 4E7LA 4PLLA 1IREB 4IUUA 4M7AG 3L2UA 4FU6A 2PVGB 1G3SA 2E10A 3CPFA 4LDYA 4ZGEB 3LWIA 1VQKA 3A5ZB 3OYJA 3S3NA 5DLQE 4BI4A 3ER0A 1VQ7A 3JCMX 4XU2A 3GIBA 3L2RA 2LDMA 1YI2T 2DTIA 3I55A 3OSSC 4J7FA 4RG8A 3TCJA 2XKOC 3JB9F 4E7IA 4GLKA 5HKCA 2E64A 1VIFA 4IUTA 3CXCS 1LJOA 3JCMb 3L2ZA 2KSSA 5GMKl 3OBWA 3X24B 2DXUA 4QVCA 5LJ5d 1VQLA 3QZ5B 5C0MA 3OQ5A 3HRSA 5GAOm 4BI3A 4F7UE 4IUVA 1KQ2A 2MF2A 2DEQA 1X6OA 1K9MC 2JTMA 3M57A 1VIEA 5CKBA 2OAUA 5GMKh 3L2QA 5GANh 2MMPA 4MMLA 1N8RU 4M7DB 3MHXA 1OI1A 4IUPA 3Q1JA 4B9WA 5A0DA 2ZPIB 1KQSS 4PJOE 2YRVA 4M7AE 5FU6C 1N8RC 3CD6T 3OYYA 4JRKA 3EFRA 3P8HA 5A0LA 3JB9I 3CBMA 1JRIA 1Q7YU 2FVUA 1H641 4EMKB 2XK0A 2RB6A 3HSBA 4Z02A 3GNGA 3LGLA 4C92A 2E70A 3JSCA 5CVIA 3WXMB 4M75A 5C6SA 1BI0A 2EQUA 1I4K1 2JNGA 2QEXA 3JCMP 1VQOT 3G71A 4M7DF 4JLGA 4WF2A 4JRQA 5GMKe 3OY9A 3GF5A 3CC2A 3LGFA 3C94A 3HRUA 4M75D 1RI0A 3SFMA 5LJ5j 1YITA 1KHIA 3O8VA 2L3RA 3M56A 1VUBA 3QG1A 4ME7A 2K2VA 3A8HB 1WNLA 4JS4A 3J7AF 4X9CA 2VGMA 4M78D 4RCBA 4F7UF 4XTWA 3J81E 2KY9A 3QJYA 2NLUA 3QXEB 1VQPA 2OTLA 1LNXA 1KC8U 1JBMA 4L59A 3NTKA 3EFSA 1QVFA 1M90U 2R57A 3CPWS 4HT8A 1YJWA 3VYGA 5GAN7 1KC8C 3NTIA 2IVWA 2ZZDA 3L2VA 4ELYC 5LJ3f 1M90C 2QI2A 4MZPA 3C4SA 3HL8A 4C5HA 2RI2A 5GAMj 2DXBA 2QQAA 4MZTA 3OYHA 1MGQA 1G3WA 2DJZA 4N4GA 2Y4YA 3OS2A 3LWHA 4C5EA 4E7KA 2RJCA 3DB4A 1UB4A 3I56A 1KG1A 2LTOA 4ZTFA 2KMTA 3L1AA 3URGA 2PU9B 2FB7A 4N4HA 3H8ZA 2LX9A 1MHNA 2VGNA 2H3JA 2XDPA 2ZPFB 4A4EA 4M78G 5GANf 1OYXA 1M1KU 1VQ6A 4XTXA 2EYQA 3OYGA 1RL2A 3QYGB 1XOVA 5KE2A 1YBYA 4M7DA 1Y7XA 3H6ZA 3L42A 4OB2B 2QA4A 1M1KC 4NL3A 3PFSA 2PVOB 4LDXA 3META 4PLIA 1UGPB 4J83A 2R5AA 3CPWA 3FC3A 2DD4A 4M77D 5GAOq 1U1TA 2P0QA 4LD9K 1WQWA 3QHSA 1M4ZA 1PSEA 2M0OA 4EMKA 4PJOC 1FWZA 3CC7T 2DD5A 3QPHA 2YLCA 4C5IA 4V2SA 2D9TA 2Y4XA 3VJPA 3CCQT 1VQ8A 3M58A 3M5AA 1M8VA 2LC4A 5D6XA 3UT1A 5I21A 2XIDA 3CCMT 4JLIA 1QP3A 3QIIA 4KULA 3GOXA 5FU6B 3JB9J 3LYIA 1VQNA 4M75E 4C0DC 2MWOA 2CKKA 5CO7A 4C8QF 5HK3A 1PSFA 3MP8A 2K5FA 3HFNA 2E6ZA 1YCYA 2DXCA 5HY6A 3VV0A 4M78E 4X9DA 4J6YA 1YJNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGH A;  4OP0 A;  3HFO A;  4M77 G;  4C8Q B;  4M77 C;  5GAO m;  1KQ1 A;  4MMK A;  4A53 A;  4M78 A;  3V7S A;  4F7U E;  5GAM g;  1KQ2 A;  2DEQ A;  1U1S A;  3BY7 A;  4M7D D;  1I8F A;  5GMK h;  5LJ3 g;  1BIA A;  5GAN d;  5DY9 A;  4EMH A;  1N9S A;  2ZGW A;  5GAN h;  4MML A;  4F7U A;  2QTX A;  4M7A C;  4M7D B;  4NL2 A;  3JCM d;  3SWN B;  4PJO E;  4C8Q G;  3SB2 A;  3JCM h;  2DXT A;  5GAN 2;  1B34 A;  4M7A E;  4JRK A;  4XU3 A;  3EFR A;  3BDU A;  1WQ7 A;  4HT9 A;  4C92 E;  4RCC A;  4DQ2 A;  3JB9 I;  5GAM h;  1JRI A;  4PJO A;  3JCM Q;  4J5Y A;  1H64 1;  4EMK B;  5GAN g;  2RB6 A;  2E41 A;  3HSB A;  2K57 A;  5LJ3 h;  4C92 A;  4JUV A;  2RA2 A;  4M75 A;  2VXE A;  3RKX A;  4XTU A;  4C8Q C;  1I4K 1;  3JCM P;  2DZC A;  4XTY A;  4M7D F;  3VU3 C;  2RD1 A;  4WF2 A;  5GMK e;  4C8Q E;  3V8J A;  4PNO A;  1HK9 A;  3JCM g;  4M7D G;  1Y96 B;  4M7D C;  4M77 E;  4M75 D;  1D3B A;  4N0A C;  5LJ5 j;  3SWN C;  3JCM e;  4C8Q A;  4XTZ A;  4QVD A;  1WNL A;  4X9C A;  2EJ9 A;  2DZ9 A;  4M77 A;  3RKY A;  4M78 D;  5GAM e;  4RCB A;  4F7U F;  4J6W A;  4XTW A;  3QSU A;  1X01 A;  2VXF A;  3JCM V;  2DVE A;  4XU1 A;  5GMK j;  1LNX A;  1WPY A;  3JCM c;  4EMK C;  1JBM A;  1N9R A;  2JN0 A;  5GMK i;  3INZ A;  5LJ3 e;  3SWN A;  3EFS A;  5GAN j;  4M7A A;  2I2L A;  5LJ5 e;  4HT8 A;  5GAN 3;  5GAM f;  5GMK m;  1TH7 A;  1LOJ A;  5GAN 7;  3V7C A;  4F7U B;  3V8K A;  1HXD A;  3M4G A;  5GAO l;  4NOY A;  5LJ3 f;  3V7R A;  4Y91 A;  5GAM j;  4PJO D;  1BIB A;  4C92 F;  4EMG A;  5LJ5 f;  4M75 F;  3PGG A;  2RM4 A;  1MGQ A;  2YLB A;  5GAN 6;  2DJZ A;  5GAN 4;  4M7A D;  3JB9 H;  4XU0 A;  2E65 A;  5GAN e;  5LJ3 j;  4PJO B;  2E1H A;  4C92 D;  2YHT A;  5GAO n;  3BFM A;  3L1A A;  3QO3 A;  4JRI A;  4M78 F;  5GAN 8;  2FB7 A;  5GAO r;  2EWN A;  4XTV A;  4C92 B;  2EJF A;  4M7D E;  4M75 B;  3RUX A;  4M78 G;  3QUI A;  5GAN f;  4XTX A;  4XQ3 A;  1M5Q 1;  1I5L A;  1I81 A;  3JCM f;  3JCM J;  4M78 B;  3JB9 D;  4M7D A;  4N0A A;  4F7U G;  4NL3 A;  2VC8 A;  3RIR A;  4C8Q D;  4A54 A;  3RKW A;  1D3B B;  2DTH A;  2HNI A;  4PJO F;  4M77 D;  3V8L A;  5GAO q;  1U1T A;  2EJG A;  5GAO p;  1WQW A;  4HA8 A;  4M7A F;  3BW1 A;  3QHS A;  4M77 B;  4PJO G;  2FYK A;  1B34 B;  5CAI A;  4EMK A;  3FIF A;  3RES A;  4PJO C;  4M7A G;  2DKG A;  2E10 A;  2YLC A;  5LJ5 g;  4V2S A;  4C92 G;  3RER A;  4J6X A;  4M75 G;  4M7A B;  4C92 C;  3JCM X;  1M8V A;  4XU2 A;  4M75 C;  5I21 A;  3GIB A;  3JCM W;  3FB9 A;  2DTI A;  2EAY A;  4JLI A;  5GAM d;  3JB9 J;  3JB9 F;  4M75 E;  3AHU A;  1Y96 A;  2E64 A;  3FJP A;  4M78 C;  4C8Q F;  2Y90 A;  1LJO A;  5LJ3 d;  3JCM b;  3L2Z A;  3HFN A;  3JB9 G;  5GMK l;  2DTO A;  1YCY A;  4M77 F;  5LJ5 d;  2DXU A;  4QVC A;  4M78 E;  4X9D A;  4J6Y A;  5GAN 5;  5LJ5 h; 
#chains in the Genus database with same CATH topology
 2CUD A;  3G6E T;  3QBY A;  4Q5W A;  3EG3 A;  1WJS A;  2RHI A;  1GRI A;  2A7Y A;  2HMA A;  1M3C A;  4OMQ A;  5LJ3 g;  2J6F A;  2F5K A;  3VKI A;  7AT1 B;  2D6F A;  4EPC A;  1ZA1 B;  2LX7 A;  3VS2 A;  5IHN A;  3UF4 A;  2PUO B;  3LH0 A;  4E7Z A;  1UG1 A;  2D8H A;  2LP5 A;  3G4S A;  1KQS P;  1Q81 R;  1K9M U;  1JJ2 A;  1HD3 A;  2FHD A;  3V8J A;  3CCR Q;  4OF1 A;  3MP1 A;  2DK3 A;  3MO8 A;  2ROT A;  2XHC A;  4C8Q A;  2M16 A;  2QGF B;  2O4X B;  1YI2 A;  3FLG A;  2M1H A;  1VQM T;  2O2O A;  3HRT A;  1ZUY A;  4QKU A;  2HDA A;  2SRC A;  2DET A;  4DBF A;  2CP3 A;  4PL6 A;  1SRL A;  3OB9 A;  4IUR A;  4A4F A;  2HBW A;  4XAX B;  2RM4 A;  3JB9 H;  2DLP A;  4MDW A;  3TQ7 P;  2RHU A;  2B8A A;  1I1J A;  3CME A;  1X69 A;  4F14 A;  4FW1 A;  3QZ9 B;  4DOW A;  4II1 A;  1YJW T;  2M02 A;  3WVE B;  4M7A F;  2FPD A;  1JQQ A;  3FIF A;  3RES A;  5CQX A;  2DKG A;  3BDL A;  3RDV A;  5LJ5 g;  1W1F A;  3GP8 A;  2XDD A;  2G3R A;  3AHU A;  3PIP A;  2QQB A;  2XG8 D;  2E5Q A;  1OPK A;  2DL8 A;  3ZBD A;  4B6M A;  1YHQ T;  4OP0 A;  1TUG B;  1KQ1 A;  2CH4 A;  1K0S A;  1M2V A;  1BIA A;  4KH0 B;  2ZGW A;  4F7U A;  4JZ3 A;  3A8L B;  5KYW A;  5CKE A;  1M30 A;  5GAN 2;  2FG0 A;  4PJJ A;  2DIG A;  3OYD A;  5GAM h;  4J9H A;  3OYN A;  1Q86 C;  3N5B B;  1NLO C;  1JJ2 S;  4J8O A;  1BKB A;  5FWB A;  1WHG A;  4BB7 A;  4LE9 A;  2HL3 A;  4AG2 C;  1AWJ A;  3M9Q A;  1ZHI A;  3CC7 Q;  5HK0 A;  1QW1 A;  2VKN A;  4RKU E;  1KC8 R;  4XU1 A;  3I9Q A;  3JCM c;  2L3P A;  2AIR B;  3SHW A;  2W0Z A;  3OYC A;  1WHL A;  5GMK m;  2JW4 A;  3G6E A;  3CCR A;  1WXB A;  3NTH A;  1YJN Q;  4M75 F;  5GAN 4;  1Z9Z A;  2RHY A;  2E1H A;  1K0X A;  2DYB A;  4JRI A;  2EWN A;  1BI2 A;  2EKH A;  2KYM A;  2NUZ A;  2FEI A;  4XK8 E;  1JEG A;  5FU7 C;  4Z88 A;  4L5G A;  4N0A A;  1RAG B;  2RQU A;  2D0Q B;  2P0K A;  3FEO A;  5D6W A;  3G71 T;  1T0J A;  2DO3 A;  2KR3 A;  1B7T A;  3JAM E;  3VS0 A;  4A4G A;  3TVT A;  3OYM A;  2LMJ A;  2WAC A;  3RER A;  2KEA A;  1AWX A;  5CKD A;  1BU1 A;  1IGU A;  2KRO A;  4KBM B;  2FRY A;  3FB9 A;  3JCM W;  2EAY A;  5GAM d;  1VQM A;  1K76 A;  4WCI A;  2GQI A;  1Y96 A;  1RAA B;  1M3A A;  4JRP A;  3CXC A;  1D1A A;  3A98 A;  2V8I A;  1EZZ B;  3OW2 S;  4D6W A;  1RI9 A;  4J9G A;  1X6G A;  3S3O A;  1N9S A;  4QVZ A;  5KE3 A;  2KXC A;  2C0I A;  4FL6 A;  4MZM A;  4OML A;  5IXF A;  2YRD A;  3NFC A;  3A8O B;  1ZBX A;  3TSW A;  1TUD A;  1NLP C;  3GPL A;  2X4Y A;  1Q81 U;  2BE9 B;  1VA7 A;  3CCU Q;  1GFC A;  3UWN A;  2F2W A;  4KUD K;  2DZ9 A;  3QSU A;  1NPR A;  1FXX A;  3DLL A;  2K3Y A;  2YSQ A;  1WPY A;  2QDY B;  5FU7 B;  1PRL C;  1VQ6 Q;  3MCA B;  2F5T X;  2LQW A;  4AT1 B;  1YHQ A;  3V7C A;  2EQM A;  2GF7 A;  2BUD A;  1K8A R;  1WX6 A;  4RMO A;  1MNE A;  2XMF A;  4A4K A;  2YWW A;  3CC7 A;  5IHK A;  4CRI A;  2YUQ A;  4LNP A;  2K79 A;  3CCJ T;  5GAN 8;  4JS5 A;  2RHX A;  3QYH B;  4XTV A;  2EJF A;  1QVP A;  3RUX A;  1HJD A;  3OMG A;  4C0G A;  4BUG A;  4A54 A;  4F04 B;  4E7L A;  2BZ8 A;  3R6N A;  1WDX A;  2PVG B;  3CPF A;  1PCX A;  4LDY A;  3S3N A;  3ER0 A;  2JJ9 A;  2LDM A;  3QWX X;  4RG8 A;  2XKO C;  1PD0 A;  1VIF A;  3CXC S;  2AKL A;  5LJ5 d;  1F1B B;  2AK5 A;  1IHW A;  2VAS A;  1LCK A;  1SSH A;  4RTV A;  1Q82 R;  5KYY B;  4BI3 A;  1QWF A;  1KQ2 A;  2MF2 A;  2DEQ A;  3EGD A;  1K9M C;  1YIJ Q;  2OAU A;  5GAN h;  2MMP A;  1N8R U;  4FCY A;  4IIO A;  2ZPI B;  4M7A E;  3CD6 T;  1M2O A;  4JRK A;  2EPD A;  2C0T A;  3CBM A;  1Q7Y U;  2KRN A;  2V26 A;  2COZ A;  4C92 A;  2E70 A;  3JSC A;  5CVI A;  1BI0 A;  3G1J A;  4CC7 A;  3G71 A;  4WF2 A;  3OY9 A;  3CC2 A;  3HRU A;  1HSQ A;  1YIT A;  1TWB A;  3O8V A;  2CP6 A;  1VUB A;  4M78 D;  5EC7 A;  3J81 E;  4F7U F;  2OTJ Q;  4F17 A;  2KI7 A;  1UUE A;  1KC8 U;  2E3I A;  4HT8 A;  1D0Y A;  4ELY C;  2QI2 A;  4MZP A;  4PFO A;  4MZT A;  1MGQ A;  1G3W A;  2Y4Y A;  3OS2 A;  3LWH A;  1UB4 A;  1KG1 A;  4N4H A;  2J05 A;  1IB8 A;  1MND A;  2H3J A;  3RR6 A;  4A4E A;  1OPL A;  4M78 G;  5GAN f;  2CT4 A;  1M1K U;  1VQ6 A;  1XOV A;  3H6Z A;  1BK2 A;  3PFS A;  1TSF A;  3CPW A;  3FC3 A;  4M77 D;  1WQW A;  1PD1 A;  3QHS A;  1MUZ A;  2M0O A;  4EMK A;  1NEB A;  4Z8A A;  2YLC A;  4V2S A;  2D9T A;  1G83 A;  3CCQ T;  3M58 A;  1TOV A;  2L0A A;  2RQR A;  2JS0 A;  1C0M A;  3CCL Q;  1GCP A;  4M75 E;  4C0D C;  1VQ8 Q;  5CO7 A;  2DXC A;  2DMO A;  4X9D A;  4N4G A;  3CMA Q;  4TVR A;  2IG0 A;  4M77 G;  2X4X A;  3VS7 A;  4MMK A;  5IN1 A;  2KNB B;  1PRM C;  1RAH B;  5J39 A;  2XI9 A;  1V29 B;  2MI6 A;  3CCJ A;  1NE8 A;  2RJD A;  2K9G A;  1D1C A;  4BE1 A;  4LD6 A;  4KRT A;  4HT9 A;  4DQ2 A;  2MYS A;  2EFI A;  1O9S A;  2J06 A;  4OMP A;  1VQL T;  4RTZ A;  2XDB A;  2K4Y A;  1YIJ A;  2GTJ A;  2HEQ A;  2KXD A;  2M9U A;  3X25 B;  3OS1 A;  2V1Q A;  2D0N A;  1X27 A;  3JCM e;  2QXF A;  1VYU A;  1BCO A;  2BZX A;  3MPU B;  1N9R A;  2EQK A;  3LH5 A;  5A0G A;  1YI2 Q;  1XNI A;  1AEY A;  1BCM A;  3UDC A;  1AHJ B;  3LLR A;  4M4Z A;  5GAO l;  4R56 A;  1KJW A;  1WIE A;  1SF9 A;  3EG9 B;  5GAN e;  1EIF A;  2NUP A;  4LDV A;  3T9N A;  4KGZ B;  2OTJ A;  5GAO r;  2HCK A;  3CPW P;  3MP6 A;  1NPP A;  1VQ9 T;  1M1F A;  4DOV A;  3QUI A;  2CT3 A;  1RAF B;  2LJ0 A;  1VQP T;  2OTL T;  1OV3 A;  2JM9 A;  4OB1 B;  4C0D B;  3KXT A;  3JB9 D;  4QT7 A;  1K73 C;  4BY6 C;  1W2B S;  2VVK A;  1UGQ B;  2DBK A;  4C5G A;  5CAI A;  4OVA A;  3I56 T;  1C6V X;  4DEX A;  3H9N A;  4M75 G;  4R55 A;  1D0Z A;  1A0N B;  1YNZ A;  2EYZ A;  1KD1 C;  2QAS A;  5AYF A;  1LPL A;  3OSV A;  3JB9 G;  1J3T A;  1AVZ C;  2DTO A;  2RQV A;  4RTU A;  2ABL A;  3PNW C;  4M77 C;  4A4H A;  3U23 A;  5GAM g;  4A53 A;  2CZ0 B;  3X28 B;  4M7D D;  2M0Y A;  1I8F A;  5DY9 A;  2EYY A;  4M7A C;  1BI3 A;  2L5Q A;  3CCL A;  2LJ1 A;  4NL2 A;  1WHK A;  2R5M A;  1RAE B;  2C0O A;  2A36 A;  3I5R A;  2OJ2 A;  4CI0 C;  1U3O A;  3A8G B;  4PJO A;  3CMA A;  3GNF B;  3JCM Q;  3O5Z A;  1V1C A;  1JXM A;  2EVR A;  3CCE T;  5J3B A;  1H8K A;  4E7H A;  1RUW A;  3H0F A;  2W10 A;  3VU3 C;  1BYM A;  2B86 A;  2ATC B;  2DA9 A;  2MWP A;  4M7D G;  4BE0 A;  1D3B A;  3BE3 A;  4N4I A;  3SWN C;  2FPF A;  3PMI A;  2KYB A;  2KDS A;  4PFZ A;  1X2Q A;  3OMC A;  4E7J A;  1M90 R;  4JPB W;  3CCM Q;  2I2L A;  1ZSZ C;  3F70 A;  1GCQ A;  1O75 A;  3V8K A;  3REB B;  2FZK B;  4BY6 B;  4O5V A;  3UA7 A;  4C92 F;  5I2M A;  5CCA A;  4BDZ A;  3G6E Q;  4BD3 A;  3ZFJ A;  2DIL A;  3CC4 T;  3EHQ A;  2DX1 A;  3QO3 A;  4M78 F;  3MEV A;  3SDZ A;  4AG1 C;  2FZC B;  1FMW A;  5KYX B;  3CCS T;  3MEA A;  4FT2 A;  2VC8 A;  3C0C A;  4C8Q D;  1YWO A;  1VQ4 T;  1NYF A;  2GGR A;  2DAQ A;  5FRN A;  4BI8 B;  2QEX T;  2MCN A;  2KAF A;  5I2S A;  3CEY A;  4M77 B;  2O01 E;  2FYK A;  4QQG A;  1SG5 A;  2RF0 A;  1OU8 A;  3EH2 A;  2EGE A;  1S72 T;  3M0T A;  4M7A B;  4BAC A;  4M75 C;  2E4H A;  2DE0 X;  2Y90 A;  3S6W A;  2KRM A;  4FYV B;  3VS3 A;  1X2K A;  4M77 F;  1VQM Q;  1ZQ1 A;  1Q7Y C;  4C8Q G;  5GAN 5;  5L8R E;  1TUC A;  2KK4 A;  4LUE A;  4CC4 B;  2K5I A;  3RBB B;  3V7S A;  3VS4 A;  1T3S A;  2QQR A;  1Z9Q A;  2XU8 A;  3EG2 A;  3SWN B;  3SB2 A;  1QP2 A;  1UEC A;  1PKT A;  1VQ9 A;  2WSC E;  1NZ9 A;  3BDU A;  1M1G A;  2BZY A;  4DEY A;  1I07 A;  3JRZ A;  3CCV T;  2GQV A;  2COW A;  1ZSZ B;  2QG9 B;  2VXE A;  3RKX A;  2LQN A;  4XTY A;  4P5N A;  2DL5 A;  1YJW Q;  2QGG A;  3OW2 A;  4OMM A;  3M0U A;  1G3T A;  2QDL A;  4M7D C;  4PJL A;  1N6A A;  1RLQ C;  5KYY A;  2R58 A;  1UDL A;  4R0K A;  2RHZ A;  3TRE A;  1JJ2 P;  2L2P A;  2DVE A;  3QJY A;  5DM7 R;  2CZ1 B;  2JN0 A;  3J80 E;  5ECA A;  2KQW A;  2V8J A;  1VQ5 T;  2BTT A;  4HVV A;  1TH7 A;  2WSE E;  3CBP A;  3NGP A;  1TU0 B;  4FM4 B;  3A1P A;  3OS0 A;  4O6J A;  1YHQ Q;  3OA6 A;  5LJ3 j;  5FWC A;  5KCH A;  4PKC C;  4ZN1 A;  2JXB A;  5D6Y A;  4M75 B;  2F2X A;  3HHT B;  2NUT A;  3CCM A;  1YJ9 T;  2P84 A;  3WVD B;  3PIO A;  1NJI C;  1JO8 A;  3VRZ A;  4F7U G;  3RIR A;  1IXD A;  2MPX C;  2O9V A;  1RAD B;  2QAZ A;  5GAO p;  2J6O A;  4FIB A;  2L8D A;  1QCN A;  2JM8 A;  3BW1 A;  1UHC A;  2JOY A;  1B34 B;  1UTI A;  4IUU A;  3L2U A;  1G3S A;  4ZGE B;  3LWI A;  5DLQ E;  2ESW A;  4XU2 A;  2LNH B;  3L2R A;  3TCJ A;  3JB9 F;  5HKC A;  4IUT A;  4RTX A;  2DNU A;  2KSS A;  2G6F X;  3OBW A;  3X24 B;  2VB6 A;  5GAO m;  2NYS A;  3REA B;  2JTM A;  5CKB A;  4M7D B;  4IUP A;  5A0D A;  2YRV A;  2PTK A;  3GBQ A;  3EFR A;  3P8H A;  5A0L A;  1Q86 R;  8ATC B;  2FVU A;  4DBH A;  1H64 1;  1OOT A;  1GL5 A;  4F16 A;  2RB6 A;  2RMO A;  2QEX A;  3JCM P;  1VQO T;  4M7D F;  2A28 A;  3G71 Q;  5LJ5 j;  1KHI A;  3H0H A;  4ME7 A;  4JS4 A;  1WNL A;  1NJI R;  1UFF A;  3CC2 Q;  1X43 A;  1YIT Q;  2KY9 A;  1TTH B;  2EGC A;  4HVW A;  3NTK A;  3EFS A;  1QVF A;  9ATC B;  1G8X A;  1M90 U;  2YRC A;  4DBR A;  1YJW A;  3VYG A;  1YN8 A;  3NTI A;  2IVW A;  1TXQ A;  4FYX B;  5LJ3 f;  2DJZ A;  2KMT A;  2PU9 B;  2FB7 A;  2KT1 A;  1MHN A;  1IRX A;  2VGN A;  3ZL7 C;  2HZY A;  1OYX A;  2DVJ A;  2EBP A;  4XTX A;  2EYQ A;  3OYG A;  1RL2 A;  1WZO A;  1Y7X A;  2PNI A;  2PVO B;  4PLI A;  1UGP B;  4J83 A;  2R5A A;  6AT1 B;  1M4Z A;  1PSE A;  2DL7 A;  2DD5 A;  1CKB A;  2K3B A;  1D1B A;  2YDL A;  5D6X A;  4ESR A;  8AT1 B;  4JLI A;  1QP3 A;  1SKU B;  4KUL A;  3GOX A;  3LYI A;  2MWO A;  4C8Q F;  2JT4 A;  5HK3 A;  4PJM A;  4M78 E;  2QYZ A;  1K9A A;  2CGH A;  1N5Z A;  3HP9 A;  3VS6 A;  1E7O A;  3PMT A;  3VUZ A;  3P8B B;  1VQK T;  3CXC P;  3UAT A;  1VQ7 T;  4KGX B;  2K7A A;  4J9I A;  1EX4 A;  4X1V A;  3JCM h;  5I22 A;  3I55 T;  2HKQ B;  2YXY A;  2H3E B;  2CYZ B;  2PUK B;  4RCC A;  3CCJ Q;  1YJ9 A;  2WSF E;  2E41 A;  2VYT A;  3VUB A;  2LNV A;  3H41 A;  2JTF A;  2JTE A;  2RPN A;  4PNO A;  1PC0 A;  5FRO A;  4M77 E;  4N0A C;  1OU9 A;  1GXI E;  4QVD A;  2RN8 A;  3OS5 A;  1ZUK A;  3EH1 A;  5LJ3 e;  1QVF S;  4QW2 A;  1M2V B;  4GY5 A;  4F7U B;  5KYW B;  3PT9 A;  4NOY A;  1HYO A;  1OZ2 A;  3KBG A;  3DLM A;  1IGQ A;  1Y07 A;  5GAN 6;  1WYX A;  4AFU C;  4C92 D;  3BFM A;  4RTW A;  1KFZ A;  2PZ1 A;  2ENM A;  1ZX6 A;  2P4R A;  5HCK A;  2EYW A;  4XQ3 A;  1I81 A;  3JCM f;  1Q95 G;  4AFQ C;  2K5L A;  1QLY A;  2GCX A;  2E12 A;  2L89 A;  3TEE A;  3M53 A;  2EJG A;  1VQO A;  5GJV B;  4LDU A;  5CIU A;  2DM1 A;  2ROL A;  2X35 A;  1QCF A;  3OYL A;  4C92 G;  4J6X A;  1AT1 B;  4OB0 B;  1VYV A;  4J9C A;  3OBY A;  2MOX A;  1JXO A;  4LN2 A;  2QA4 T;  2A08 A;  3L2W A;  2X3X D;  1R0C B;  1K9M R;  2O4X A;  2AZV A;  3FJ5 A;  1W2B A;  3LW5 E;  3BY7 A;  1H3H A;  1ABO A;  5GAN d;  5CQY A;  4E7S A;  1RAB B;  4MDX A;  1MV3 A;  4UC4 A;  1QWE A;  3E1S A;  1VQN T;  2YUN A;  2P0P A;  3H0I A;  1Q86 U;  3HPW A;  4J5Y A;  3ZEH A;  2K57 A;  2LRQ A;  1XQH A;  1YFN A;  4XTU A;  2FL7 A;  1VOM A;  2GNC A;  2RNA A;  5I11 A;  1E6G A;  1NYG A;  4WTO B;  3OYE A;  2RO0 A;  1Y96 B;  2EIF A;  1ZA2 B;  1P92 A;  1AWO A;  3EGX B;  2Z0W A;  5KCO A;  2QTV A;  1S1N A;  2HSE B;  5J26 A;  4E47 A;  1X01 A;  5IT9 E;  3CCQ Q;  5GMK j;  1RAC B;  1WJQ A;  1UHF A;  5GMK i;  3SWN A;  4J9B A;  4L6V 5;  3G4S T;  3M4G A;  1Y0M A;  4JJB A;  1UGS B;  2VUB A;  4DA4 A;  1WGS A;  2CP5 A;  1BIB A;  3IQL A;  1QVG A;  4BE2 A;  2CZ7 B;  1WXU A;  2DL3 A;  2XIC A;  1ZSZ A;  4GLM A;  3CBO A;  4X34 A;  3SD4 A;  1N27 A;  5CR2 A;  4M7D E;  1IHV A;  3EFO B;  2L3Q A;  1I5L A;  2JS2 A;  1UGR B;  1R0B G;  3JV3 A;  4HVU A;  1W70 A;  2HQX A;  4YTL A;  2HQE A;  2LZ6 B;  1VQL Q;  2HAX A;  3DB3 A;  2JVV A;  1K8A U;  5CKH A;  3M4Y A;  3EAE A;  1ZLM A;  1C1A A;  4C92 C;  3CME T;  5IHI A;  3VS5 A;  4EIK A;  1AD5 A;  1OQK A;  1PWT A;  3CD6 A;  4M78 C;  1YWP A;  3A8M B;  2CUB A;  4RG2 A;  4OMO A;  3MEU A;  4JJN K;  2RJF A;  4IUQ A;  3HKS A;  4LUD A;  4ZGJ B;  1UGV A;  4D8K A;  1KK7 A;  2EKO A;  5FLX E;  3EG1 A;  3M59 A;  1ZBJ A;  3THK A;  3OYB A;  2EQI A;  2J7I A;  3EG0 A;  1KQS A;  2DXT A;  2AHJ B;  1B34 A;  2E5K A;  3R6O A;  2LVM A;  2PVD B;  5FRM A;  1VQ9 Q;  2DIQ A;  1VQP Q;  2OTL Q;  1OX9 A;  2FZG B;  2ED1 A;  4EDU A;  1NM7 A;  2P4T A;  4C8Q E;  5CKF A;  1Q82 U;  1Q81 C;  1WJR A;  1B3Q A;  1TS9 A;  4XTZ A;  2HQH A;  4QQ6 A;  2EJ9 A;  3I56 Q;  2DRK A;  2VXF A;  3JCM V;  4JJD A;  2OX7 A;  4EMK C;  3GLX A;  2GFA A;  3LX7 A;  2EYX A;  3INZ A;  4LXC A;  3AT1 B;  3M54 A;  2JZ2 A;  1HXD A;  2JUF A;  3KFV A;  2DEU A;  2QQS A;  4PJO D;  3P8D A;  1QVG S;  2LQK A;  2YLB A;  4XU0 A;  2HSP A;  1SHF A;  1X6B A;  1NBE B;  3CCQ A;  4KUI A;  4C92 B;  3OYF A;  1K73 R;  2RQW A;  4RUG A;  3E9G A;  2XD0 A;  1WLP B;  1BB9 A;  3I35 A;  1MMG A;  5KYU B;  2DPP B;  4M78 B;  2O9S A;  3CCR T;  3M0S A;  2HNI A;  3C95 A;  1XJW B;  4D8D A;  4OGE A;  4PJO G;  3CCE Q;  4PLL A;  4CC2 A;  4FU6 A;  2E10 A;  3A5Z B;  3OYJ A;  1KD1 R;  4BI4 A;  1AWW A;  3GIB A;  1FMV A;  2X3W D;  2DTI A;  3EGU A;  1K4U S;  2YUP A;  4GLK A;  4J9D A;  2E64 A;  1M3B A;  1LJO A;  3JCM b;  2CDT A;  2DXU A;  1VQL A;  5C0M A;  2I0N A;  1UJY A;  4F7U E;  4CC3 A;  3NMZ C;  3E2U A;  2DL4 A;  2BE7 D;  3M57 A;  3L2Q A;  1VIE A;  4ANJ A;  3CQT A;  3MHX A;  2DF6 A;  3Q1J A;  4B9W A;  1KQS S;  3CC4 Q;  1SEM A;  5FU6 C;  1N8R C;  2SEM A;  3JB9 I;  1QKX A;  2V1R A;  4PJN A;  4EMK B;  3VS1 A;  5KYN A;  3GNG A;  1WA7 A;  3WXM B;  2JNG A;  2VWF A;  3CCS Q;  4JLG A;  1AZG B;  2CSQ A;  5GMK e;  1TG0 A;  1VQ4 Q;  1WHH A;  2QEX Q;  3LGF A;  3A8H B;  4RCB A;  1S72 Q;  4XTW A;  4Y92 A;  2NLU A;  2KGT A;  1VQP A;  2OTL A;  1RLP C;  2F2V A;  1KC8 C;  2AT1 B;  3L2V A;  2ZZD A;  3C4S A;  3HL8 A;  3PVQ A;  2RI2 A;  4C5H A;  5GAM j;  2QQA A;  3OYH A;  4E7K A;  4C5E A;  3DB4 A;  3I56 A;  1AZE A;  2LTO A;  3H8Z A;  2LX9 A;  4IIM A;  2XDP A;  1LVK A;  1V76 A;  3QYG B;  4OB2 B;  1M1K C;  4NL3 A;  3MET A;  2DD4 A;  2KRS A;  5GAO q;  1WI7 A;  4LD9 K;  2DER A;  1JU5 C;  3CCV Q;  1I0C A;  4PJO C;  1FWZ A;  1N8R R;  3CC7 T;  3QPH A;  1WXT A;  1M8V A;  3UT1 A;  4KH1 B;  3M0Q A;  2XID A;  3M0R A;  1Q7Y R;  5FU6 B;  3JB9 J;  2X9H A;  1ARK A;  1PSF A;  2K5F A;  5HY6 A;  2FRW A;  2NUP B;  3JCM g;  1YJN T;  3RMQ A;  4IKF A;  3CCE A;  1XTD A;  3HFO A;  1MV0 B;  2ZCF B;  1VQ5 Q;  2MAM A;  4VUB A;  2HD0 A;  2ED0 A;  4EMH A;  2LCS A;  1GCQ C;  1VYT A;  2F69 A;  3C12 A;  1D09 B;  3MEW A;  2LT4 A;  2X4W A;  5GAN g;  5FW9 A;  5LJ3 h;  1CSK A;  2RA2 A;  1YJ9 Q;  4C8Q C;  4AFZ C;  2KVQ G;  1HK9 A;  3HTR A;  4J9F A;  3CC4 A;  5KH6 A;  2RK2 A;  4ZN3 A;  3SEM A;  1M1K R;  1G3Y A;  4DBQ A;  3OW2 P;  2ZPE B;  1SHG A;  3CCS A;  5GAM f;  4C0Z A;  4JJC A;  1VQ4 A;  3QWY A;  2CSI A;  1YCS B;  2CH4 W;  4EMG A;  3CC2 T;  1M27 C;  4PJO B;  4ORZ A;  1YIT T;  4HXJ A;  2RH2 A;  1S72 A;  5GAO n;  1K8A C;  1K1Z A;  1W4S A;  3OYK A;  1K73 U;  3TSZ A;  4GBQ A;  2LCL A;  3EGX A;  4BDY A;  3RKW A;  4E6R A;  2GFU A;  1D3B B;  4AFS C;  4PJO F;  3V8L A;  4HCK A;  5EG2 A;  1R8O B;  2CP2 A;  1KSW A;  2O31 A;  3CCU T;  2LT1 A;  1VQO Q;  2KT8 A;  4ATO A;  1ACM B;  4ZTJ A;  3TU4 K;  2V8K A;  1KD1 U;  5LL6 S;  2D8J A;  1PKS A;  3ULR B;  1VQ6 T;  1SSF A;  1SPK A;  5GJW B;  2DFU A;  2AZS A;  3FJP A;  5LJ3 d;  2YUO A;  1FYN A;  2DJQ A;  3PTA A;  3EFO A;  5LJ5 h;  1GFD A;  3ASK A;  3CCV A;  4C8Q B;  1OUL A;  2ZPB B;  1U1S A;  2ZPG B;  1D0X A;  2BKD N;  2OI3 A;  3S3M A;  1Q82 C;  1AOJ A;  2K6D A;  4ZGD B;  4XU3 A;  1WQ7 A;  2K3X A;  1X75 C;  3EG9 A;  4C92 E;  2D1X A;  1WHJ A;  2FO0 A;  5IAY A;  3I5S A;  1PM3 A;  1VQ5 A;  4JUV A;  2RD1 A;  2LQ8 A;  4NS5 A;  1U8R A;  4Y28 E;  3ME9 A;  1QQJ A;  4HCC A;  1JB0 E;  1NG2 A;  2K2M A;  1B07 A;  5L23 A;  4OMN A;  5GAM e;  4J6W A;  1KHC A;  1ZUU A;  3FDR A;  5GAN j;  1UJ0 A;  5AT1 B;  3E9F A;  2EQJ A;  4HKE A;  5GAN 3;  1YJN A;  2QK0 A;  1YIJ T;  3V7R A;  4LDW A;  2CS7 A;  4B9X A;  5LJ5 f;  2VV5 A;  3PGG A;  1M9S A;  3M55 A;  4FW2 A;  2RI5 A;  1UEB A;  1IZ6 A;  4KT0 E;  2YHT A;  1QVF P;  1W6X A;  1VQK Q;  1MMD A;  1MMN A;  1VQ7 Q;  3OYA A;  1YP5 A;  1M5Q 1;  2X51 A;  3JCM J;  3I55 Q;  1H92 A;  4JDS A;  3QDR B;  2LJ3 A;  4FYW B;  2C06 A;  4E2F B;  2DTH A;  2PQW A;  2GTO A;  3QKJ A;  4HA8 A;  5D7U A;  2OTJ T;  3X26 B;  3RMS A;  4RTY A;  4HCZ A;  2FPE A;  2MK5 A;  1QMC A;  1UE9 A;  3QJ6 A;  2HBP A;  4FT4 A;  2OAW A;  2RQT A;  3UA6 A;  3CD6 Q;  2QQ9 A;  3KUF A;  2A0F B;  5KYU A;  2ECZ A;  4M78 A;  1FX7 A;  2AKK A;  2LCC A;  2NUT B;  1G2B A;  2E3H A;  3UPU A;  2X4J A;  2QTX A;  3JCM d;  2E6N A;  1PNJ A;  5IH2 A;  1QKW A;  4OGC A;  1DJ7 B;  2HKN A;  2KBT A;  2ZPH B;  5M9O A;  4ELZ C;  5CK9 A;  3D7S B;  2DZC A;  2CRE A;  2A37 A;  4K11 A;  3CCU A;  1EFN A;  3X20 B;  1BBZ A;  3E19 A;  5KYX A;  2EW3 A;  1FMK A;  3CCL T;  2CZ6 B;  1VQ8 T;  3EHR A;  4J7I A;  4HCB A;  1BI1 A;  3DKM A;  4M77 A;  3RKY A;  2M51 A;  3VYH B;  2A3L A;  3CMA T;  1H3Z A;  1T3L A;  3G7Z A;  2IPO B;  2RI3 A;  4J9E A;  5IXB A;  1U5S A;  1G5V A;  4KGV B;  4M7A A;  5LJ5 e;  2RK1 A;  4OB3 B;  1LOJ A;  3NHN A;  5DLO A;  5A2Q E;  1OZ3 A;  2QA4 Q;  3FRN A;  4Y91 A;  1OEB A;  4M7A D;  4ZNX A;  1ZSG A;  2E65 A;  4FSX A;  2IIM A;  2RJE A;  2DBM A;  1NJI U;  4C0F A;  1VQN Q;  1PG5 B;  1E6H A;  2BIV A;  3M0P A;  3MJX A;  3OYI A;  4QQD A;  4OMF B;  1Y71 A;  1IRE B;  2H8H A;  4M7A G;  1VQK A;  1ABQ A;  1VQ7 A;  3JCM X;  1QCO A;  1YI2 T;  3I55 A;  3OSS C;  4J7F A;  4E7I A;  2ZAE A;  3L2Z A;  5GMK l;  4FSS A;  2HL5 C;  4QVC A;  1GBR A;  3QZ5 B;  3OQ5 A;  3HRS A;  4IUV A;  3PE0 A;  1X6O A;  2YT6 A;  3G4S Q;  5GMK h;  2JMC A;  2O88 A;  4FYY B;  4MML A;  1I5O B;  3QDF A;  1OI1 A;  2GBQ A;  4PJO E;  2CP7 A;  1Y57 A;  1IO6 A;  4AMC A;  3OYY A;  2L3S A;  1JRI A;  1W2B P;  2JMA A;  3VRY A;  2XK0 A;  3HSB A;  4Z02 A;  3LGL A;  2DYI A;  4M75 A;  5C6S A;  2EQU A;  1I4K 1;  4PK4 A;  4JRQ A;  3GF5 A;  3MKD A;  3C94 A;  4M75 D;  1RI0 A;  1GBQ A;  3SFM A;  4RTT A;  2L3R A;  3M56 A;  3QG1 A;  1KIK A;  2K2V A;  3J7A F;  1NEG A;  4X9C A;  2VGM A;  1WHM A;  2MIO A;  3QXE B;  1LNX A;  1RAI B;  1JBM A;  4L59 A;  1R77 A;  3CME Q;  1SRM A;  2R57 A;  3CPW S;  5GAN 7;  1M90 C;  4JZ4 A;  1CKA A;  2DXB A;  2J6K A;  2NWM A;  2RJC A;  1MMA A;  4A63 B;  3PVL A;  4ZTF A;  3URG A;  3L1A A;  1M8M A;  2ZPF B;  1U06 A;  5KE2 A;  1YBY A;  1QVG P;  4PFP A;  4M7D A;  3L42 A;  2QA4 A;  3EGD B;  3NPF A;  4LDX A;  1PHT A;  2F1L A;  2COY A;  1T0H A;  4Z89 A;  1U1T A;  2CP0 A;  2P0Q A;  1WFW A;  2KE9 A;  1OX8 A;  4C5I A;  2DRM A;  2EGA A;  2Y4X A;  3VJP A;  1VQ8 A;  3M5A A;  2LC4 A;  5I21 A;  3CCM T;  3QII A;  3RNJ A;  1VQN A;  2CKK A;  3MP8 A;  3HFN A;  2E6Z A;  1YCY A;  3VV0 A;  4J6Y A; 
#chains in the Genus database with same CATH homology
 3RMQ A;  3G6E T;  4IKF A;  4TVR A;  3CCE A;  3QBY A;  2CGH A;  2IG0 A;  4Q5W A;  1XTD A;  3HFO A;  3HP9 A;  4M77 G;  2X4X A;  1WJS A;  2ZCF B;  2RHI A;  3PMT A;  4MMK A;  5IN1 A;  2A7Y A;  3VUZ A;  2MAM A;  4VUB A;  2HD0 A;  5J39 A;  5LJ3 g;  2XI9 A;  3P8B B;  1VQK T;  4EMH A;  1V29 B;  1VQ7 T;  2F5K A;  2MI6 A;  3CCJ A;  1NE8 A;  3VKI A;  2D6F A;  2RJD A;  2F69 A;  3JCM h;  4EPC A;  3I55 T;  3C12 A;  4BE1 A;  4LD6 A;  3MEW A;  2LT4 A;  4HT9 A;  2PUK B;  2CYZ B;  4RCC A;  4DQ2 A;  1YJ9 A;  2WSF E;  2X4W A;  2EFI A;  1O9S A;  5GAN g;  2PUO B;  2E41 A;  2VYT A;  5LJ3 h;  3LH0 A;  3VUB A;  2LNV A;  1VQL T;  2XDB A;  2RA2 A;  2K4Y A;  2JTF A;  4C8Q C;  3G4S A;  1YIJ A;  1K9M U;  2KVQ G;  2M9U A;  1JJ2 A;  3X25 B;  3OS1 A;  2FHD A;  3V8J A;  4PNO A;  1HK9 A;  3JCM g;  4OF1 A;  3MP1 A;  2RK2 A;  4M77 E;  5FRO A;  4ZN3 A;  5KH6 A;  2DK3 A;  3MO8 A;  4N0A C;  3JCM e;  2XHC A;  2QXF A;  1GXI E;  4C8Q A;  2M16 A;  1G3Y A;  4QVD A;  2O4X B;  1YI2 A;  3FLG A;  2M1H A;  1VQM T;  3OS5 A;  3HRT A;  5LJ3 e;  1N9R A;  2ZPE B;  1QVF S;  4QW2 A;  2EQK A;  5A0G A;  3CCS A;  1XNI A;  5GAM f;  3UDC A;  4C0Z A;  1VQ4 A;  4GY5 A;  4F7U B;  1AHJ B;  3LLR A;  4PL6 A;  5GAO l;  3PT9 A;  4NOY A;  4R56 A;  3OB9 A;  4IUR A;  4A4F A;  1OZ2 A;  3KBG A;  3DLM A;  4XAX B;  4EMG A;  3CC2 T;  1Y07 A;  2RM4 A;  5GAN 6;  3JB9 H;  4MDW A;  5GAN e;  1EIF A;  4PJO B;  1YIT T;  2RHU A;  2RH2 A;  4LDV A;  3T9N A;  4C92 D;  2B8A A;  1S72 A;  5GAO n;  3BFM A;  2OTJ A;  5GAO r;  1K8A C;  3MP6 A;  1NPP A;  1VQ9 T;  3CME A;  1M1F A;  4DOV A;  3QUI A;  1W4S A;  3OYK A;  1K73 U;  1VQP T;  2OTL T;  4XQ3 A;  4OB1 B;  4C0D B;  1I81 A;  3JCM f;  3KXT A;  3JB9 D;  2K5L A;  3QZ9 B;  2LCL A;  4DOW A;  2GCX A;  2E12 A;  4BDY A;  4II1 A;  1YJW T;  1K73 C;  3RKW A;  2L89 A;  3TEE A;  2GFU A;  1D3B B;  4BY6 C;  4PJO F;  3M53 A;  3V8L A;  2EJG A;  3WVE B;  1VQO A;  1W2B S;  4M7A F;  5EG2 A;  1R8O B;  4LDU A;  3CCU T;  1UGQ B;  5CIU A;  4C5G A;  5CAI A;  3FIF A;  3RES A;  2LT1 A;  2X35 A;  5CQX A;  2DKG A;  3BDL A;  4OVA A;  3I56 T;  5LJ5 g;  3OYL A;  4ATO A;  4ZTJ A;  4C92 G;  4J6X A;  4M75 G;  3TU4 K;  2V8K A;  3GP8 A;  1KD1 U;  5LL6 S;  4R55 A;  2XDD A;  1VQ6 T;  1SSF A;  4OB0 B;  2G3R A;  3OBY A;  3AHU A;  3PIP A;  5DM7 R;  3FJP A;  1KD1 C;  5LJ3 d;  5AYF A;  2QA4 T;  3OSV A;  3JB9 G;  2DTO A;  2QQB A;  3L2W A;  3PTA A;  5LJ5 h;  2XG8 D;  2E5Q A;  2O4X A;  3ZBD A;  3ASK A;  3CCV A;  1YHQ T;  4OP0 A;  3PNW C;  4C8Q B;  4M77 C;  4A4H A;  1KQ1 A;  5GAM g;  4A53 A;  1W2B A;  3LW5 E;  2ZPB B;  1U1S A;  2CZ0 B;  2ZPG B;  3BY7 A;  3X28 B;  1I8F A;  4M7D D;  5GAN d;  1BIA A;  2BKD N;  3S3M A;  5DY9 A;  2ZGW A;  4M7A C;  1BI3 A;  2L5Q A;  4F7U A;  1Q82 C;  3CCL A;  3A8L B;  5CKE A;  4NL2 A;  5CQY A;  5GAN 2;  1QVG A;  4MDX A;  2R5M A;  4UC4 A;  4ZGD B;  2DIG A;  3E1S A;  4XU3 A;  1VQN T;  1WQ7 A;  2K3X A;  2P0P A;  4CI0 C;  1X75 C;  3A8G B;  4C92 E;  3OYD A;  3GNF B;  5GAM h;  3CMA A;  1Q86 U;  3JCM Q;  3HPW A;  4J5Y A;  4PJO A;  3ZEH A;  5IAY A;  2K57 A;  2LRQ A;  3OYN A;  1XQH A;  1VQ5 A;  4JUV A;  1Q86 C;  5J3B A;  3CCE T;  4E7H A;  3N5B B;  4XTU A;  2FL7 A;  1JJ2 S;  3VU3 C;  1BYM A;  2RD1 A;  1BKB A;  2LQ8 A;  4J8O A;  4BB7 A;  2MWP A;  4NS5 A;  3OYE A;  1U8R A;  2RO0 A;  4Y28 E;  4M7D G;  1Y96 B;  2EIF A;  3ME9 A;  1P92 A;  4BE0 A;  1D3B A;  4N4I A;  4HCC A;  1JB0 E;  3M9Q A;  3SWN C;  1ZHI A;  3PMI A;  5KCO A;  5HK0 A;  5GAM e;  5J26 A;  4J6W A;  4E47 A;  1X01 A;  2KDS A;  1KHC A;  1QW1 A;  4RKU E;  5IT9 E;  4XU1 A;  5GMK j;  3JCM c;  1WJQ A;  3FDR A;  3OMC A;  4E7J A;  5GAN j;  5GMK i;  3E9F A;  2EQJ A;  3SWN A;  4HKE A;  2I2L A;  3OYC A;  5GAN 3;  5GMK m;  1YJN A;  3F70 A;  1O75 A;  4L6V 5;  3G6E A;  3V8K A;  3G4S T;  3CCR A;  3M4G A;  1YIJ T;  4BY6 B;  3NTH A;  1UGS B;  2VUB A;  2CS7 A;  4LDW A;  3V7R A;  4B9X A;  4DA4 A;  1WGS A;  4O5V A;  1BIB A;  5I2M A;  4C92 F;  5CCA A;  5LJ5 f;  4M75 F;  2VV5 A;  3PGG A;  5GAN 4;  4BDZ A;  4BD3 A;  2CZ7 B;  1M9S A;  3M55 A;  3ZFJ A;  3CC4 T;  2RI5 A;  4BE2 A;  2RHY A;  3QSU A;  1UEB A;  1IZ6 A;  2E1H A;  2XIC A;  4KT0 E;  3CBO A;  2YHT A;  4X34 A;  3SD4 A;  3QO3 A;  4JRI A;  4M78 F;  1N27 A;  2EWN A;  1BI2 A;  3MEV A;  5CR2 A;  4M7D E;  3SDZ A;  3OYA A;  4XK8 E;  1I5L A;  1M5Q 1;  5FU7 C;  1UGR B;  3JCM J;  4JDS A;  3QDR B;  4L5G A;  3MEA A;  4N0A A;  4FT2 A;  2VC8 A;  4C8Q D;  3CCS T;  2D0Q B;  1VQ4 T;  2C06 A;  2DAQ A;  5FRN A;  2P0K A;  3FEO A;  2DTH A;  5D6W A;  4BI8 B;  2PQW A;  2QEX T;  2HQX A;  3QKJ A;  3G71 T;  4HA8 A;  2KAF A;  2DO3 A;  3CEY A;  4YTL A;  2HQE A;  5I2S A;  4M77 B;  2O01 E;  2FYK A;  4QQG A;  2HAX A;  3DB3 A;  3JAM E;  4A4G A;  2JVV A;  1K8A U;  5CKH A;  3OYM A;  3M4Y A;  3EAE A;  1S72 T;  2OTJ T;  2WAC A;  3RER A;  4M7A B;  3X26 B;  4C92 C;  4BAC A;  4M75 C;  3RMS A;  5CKD A;  3CME T;  3JCM W;  4KBM B;  3FB9 A;  4HCZ A;  2EAY A;  5GAM d;  1VQM A;  3CD6 A;  3QJ6 A;  1Y96 A;  4M78 C;  2HBP A;  2Y90 A;  3S6W A;  4JRP A;  3CXC A;  4FT4 A;  3A8M B;  4M77 F;  1ZQ1 A;  1Q7Y C;  4C8Q G;  2V8I A;  5GAN 5;  5L8R E;  2QQ9 A;  2KK4 A;  3OW2 S;  3KUF A;  4RG2 A;  2K5I A;  3MEU A;  4JJN K;  4M78 A;  3V7S A;  1FX7 A;  4D6W A;  2LCC A;  2RJF A;  4IUQ A;  2QQR A;  3HKS A;  4ZGJ B;  3S3O A;  2EKO A;  1N9S A;  5FLX E;  4QVZ A;  3M59 A;  2X4J A;  2QTX A;  5KE3 A;  3UPU A;  2XU8 A;  3OYB A;  3JCM d;  3SWN B;  4FL6 A;  4MZM A;  3SB2 A;  1KQS A;  1QP2 A;  2AHJ B;  2DXT A;  2E6N A;  1B34 A;  1VQ9 A;  2WSC E;  1NZ9 A;  3R6O A;  1DJ7 B;  3BDU A;  4OGC A;  2LVM A;  2PVD B;  1M1G A;  5FRM A;  3JRZ A;  3NFC A;  2ZPH B;  2DIQ A;  3CCV T;  3A8O B;  5M9O A;  4ELZ C;  2GQV A;  1ZBX A;  2VXE A;  3RKX A;  5CK9 A;  3GPL A;  2DZC A;  2X4Y A;  4XTY A;  4P5N A;  4EDU A;  3CCU A;  1Q81 U;  3OW2 A;  2P4T A;  3X20 B;  3E19 A;  1G3T A;  4C8Q E;  5CKF A;  1Q82 U;  4M7D C;  3CCL T;  1N6A A;  2CZ6 B;  1WJR A;  1Q81 C;  1VQ8 T;  4HCB A;  4J7I A;  4XTZ A;  1BI1 A;  2R58 A;  3UWN A;  4QQ6 A;  4KUD K;  2EJ9 A;  2DZ9 A;  3DKM A;  1NPR A;  4M77 A;  3RKY A;  1FXX A;  2RHZ A;  3TRE A;  3VYH B;  3DLL A;  2A3L A;  2VXF A;  3JCM V;  3CMA T;  2DVE A;  2K3Y A;  1H3Z A;  3G7Z A;  4EMK C;  1WPY A;  2GFA A;  2CZ1 B;  2JN0 A;  2QDY B;  2RI3 A;  3GLX A;  3INZ A;  3LX7 A;  2KQW A;  2V8J A;  5FU7 B;  3J80 E;  1G5V A;  4M7A A;  5LJ5 e;  2RK1 A;  2F5T X;  3MCA B;  1VQ5 T;  3M54 A;  4OB3 B;  1TH7 A;  1LOJ A;  2JZ2 A;  1YHQ A;  2WSE E;  3V7C A;  1HXD A;  3CBP A;  5DLO A;  5A2Q E;  1OZ3 A;  4FM4 B;  2EQM A;  2JUF A;  2GF7 A;  2QQS A;  3FRN A;  4Y91 A;  2BUD A;  3P8D A;  3OS0 A;  4PJO D;  4O6J A;  1QVG S;  2LQK A;  2YLB A;  4RMO A;  4M7A D;  3CC4 A;  4XU0 A;  2E65 A;  4A4K A;  5LJ3 j;  4FSX A;  3OA6 A;  5KCH A;  3CC7 A;  4PKC C;  4CRI A;  2RJE A;  3CCJ T;  5GAN 8;  3CCQ A;  4KUI A;  4JS5 A;  4ZN1 A;  2RHX A;  3QYH B;  4XTV A;  4C92 B;  2EJF A;  5D6Y A;  4M75 B;  3OYF A;  1QVP A;  3HHT B;  3CCM A;  3RUX A;  3E9G A;  1NJI U;  2XD0 A;  1YJ9 T;  2DPP B;  3OMG A;  4M78 B;  3WVD B;  4C0G A;  3PIO A;  1NJI C;  4F7U G;  4BUG A;  3RIR A;  4C0F A;  4A54 A;  3CCR T;  2BIV A;  2HNI A;  3OYI A;  3C95 A;  5GAO p;  4FIB A;  2L8D A;  4QQD A;  3BW1 A;  2JOY A;  4OMF B;  4OGE A;  1Y71 A;  1B34 B;  4PJO G;  4E7L A;  4PLL A;  1IRE B;  4IUU A;  4M7A G;  3L2U A;  4FU6 A;  2PVG B;  1G3S A;  2E10 A;  3CPF A;  4LDY A;  4ZGE B;  3LWI A;  1VQK A;  3A5Z B;  3OYJ A;  3S3N A;  5DLQ E;  4BI4 A;  3ER0 A;  1VQ7 A;  3JCM X;  4XU2 A;  3GIB A;  3L2R A;  2LDM A;  1YI2 T;  2DTI A;  3I55 A;  3OSS C;  4J7F A;  4RG8 A;  3TCJ A;  2XKO C;  3JB9 F;  4E7I A;  4GLK A;  5HKC A;  2E64 A;  1VIF A;  4IUT A;  3CXC S;  1LJO A;  3JCM b;  3L2Z A;  2KSS A;  5GMK l;  3OBW A;  3X24 B;  2DXU A;  4QVC A;  5LJ5 d;  1VQL A;  3QZ5 B;  5C0M A;  3OQ5 A;  3HRS A;  5GAO m;  4BI3 A;  4F7U E;  4IUV A;  1KQ2 A;  2MF2 A;  2DEQ A;  1X6O A;  1K9M C;  2JTM A;  3M57 A;  1VIE A;  5CKB A;  2OAU A;  5GMK h;  3L2Q A;  5GAN h;  2MMP A;  4MML A;  1N8R U;  4M7D B;  3MHX A;  1OI1 A;  4IUP A;  3Q1J A;  4B9W A;  5A0D A;  2ZPI B;  1KQS S;  4PJO E;  2YRV A;  4M7A E;  5FU6 C;  1N8R C;  3CD6 T;  3OYY A;  4JRK A;  3EFR A;  3P8H A;  5A0L A;  3JB9 I;  3CBM A;  1JRI A;  1Q7Y U;  2FVU A;  1H64 1;  4EMK B;  2XK0 A;  2RB6 A;  3HSB A;  4Z02 A;  3GNG A;  3LGL A;  4C92 A;  2E70 A;  3JSC A;  5CVI A;  3WXM B;  4M75 A;  5C6S A;  1BI0 A;  2EQU A;  1I4K 1;  2JNG A;  2QEX A;  3JCM P;  1VQO T;  3G71 A;  4M7D F;  4JLG A;  4WF2 A;  4JRQ A;  5GMK e;  3OY9 A;  3GF5 A;  3CC2 A;  3LGF A;  3C94 A;  3HRU A;  4M75 D;  1RI0 A;  3SFM A;  5LJ5 j;  1YIT A;  1KHI A;  3O8V A;  2L3R A;  3M56 A;  1VUB A;  3QG1 A;  4ME7 A;  2K2V A;  3A8H B;  1WNL A;  4JS4 A;  3J7A F;  4X9C A;  2VGM A;  4M78 D;  4RCB A;  4F7U F;  4XTW A;  3J81 E;  2KY9 A;  3QJY A;  2NLU A;  3QXE B;  1VQP A;  2OTL A;  1LNX A;  1KC8 U;  1JBM A;  4L59 A;  3NTK A;  3EFS A;  1QVF A;  1M90 U;  2R57 A;  3CPW S;  4HT8 A;  1YJW A;  3VYG A;  5GAN 7;  1KC8 C;  3NTI A;  2IVW A;  2ZZD A;  3L2V A;  4ELY C;  5LJ3 f;  1M90 C;  2QI2 A;  4MZP A;  3C4S A;  3HL8 A;  4C5H A;  2RI2 A;  5GAM j;  2DXB A;  2QQA A;  4MZT A;  3OYH A;  1MGQ A;  1G3W A;  2DJZ A;  4N4G A;  2Y4Y A;  3OS2 A;  3LWH A;  4C5E A;  4E7K A;  2RJC A;  3DB4 A;  1UB4 A;  3I56 A;  1KG1 A;  2LTO A;  4ZTF A;  2KMT A;  3L1A A;  3URG A;  2PU9 B;  2FB7 A;  4N4H A;  3H8Z A;  2LX9 A;  1MHN A;  2VGN A;  2H3J A;  2XDP A;  2ZPF B;  4A4E A;  4M78 G;  5GAN f;  1OYX A;  1M1K U;  1VQ6 A;  4XTX A;  2EYQ A;  3OYG A;  1RL2 A;  3QYG B;  1XOV A;  5KE2 A;  1YBY A;  4M7D A;  1Y7X A;  3H6Z A;  3L42 A;  4OB2 B;  2QA4 A;  1M1K C;  4NL3 A;  3PFS A;  2PVO B;  4LDX A;  3MET A;  4PLI A;  1UGP B;  4J83 A;  2R5A A;  3CPW A;  3FC3 A;  2DD4 A;  4M77 D;  5GAO q;  1U1T A;  2P0Q A;  4LD9 K;  1WQW A;  3QHS A;  1M4Z A;  1PSE A;  2M0O A;  4EMK A;  4PJO C;  1FWZ A;  3CC7 T;  2DD5 A;  3QPH A;  2YLC A;  4C5I A;  4V2S A;  2D9T A;  2Y4X A;  3VJP A;  3CCQ T;  1VQ8 A;  3M58 A;  3M5A A;  1M8V A;  2LC4 A;  5D6X A;  3UT1 A;  5I21 A;  2XID A;  3CCM T;  4JLI A;  1QP3 A;  3QII A;  4KUL A;  3GOX A;  5FU6 B;  3JB9 J;  3LYI A;  1VQN A;  4M75 E;  4C0D C;  2MWO A;  2CKK A;  5CO7 A;  4C8Q F;  5HK3 A;  1PSF A;  3MP8 A;  2K5F A;  3HFN A;  2E6Z A;  1YCY A;  2DXC A;  5HY6 A;  3VV0 A;  4M78 E;  4X9D A;  4J6Y A;  1YJN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...