1UEBA

Crystal structure of translation elongation factor p from thermus thermophilus hb8
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elongation factor P
publication title Crystal structure of elongation factor P from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 40
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1uebA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA03
4A3MH 2UXDL 4EQ5A 3H3VI 2N78A 3CC7T 1AE3A 2AHOB 4CRIA 1Q7YU 4C2MH 2Y0SE 5C44G 1QVFS 1WI5A 2JVVA 1X55A 2JEBI 1TXYA 2YTVA 3NENA 2XGTA 3S1NH 3FKIH 1HNZQ 2Q2UA 4PMWA 1AH9A 4P73A 3TREA 1E24A 3J81i 1TWAH 2VL6A 3S1QH 2GVAA 1EUJA 1JMCA 1CKNB 5AJ3Q 1G6PA 4DKAC 2VY3A 1YHQA 2Q2IA 1IXRA 1PH2A 5C4XH 1YITT 1X9NA 1EFWA 1CKNA 2E2IH 4IFDG 1X3EA 5IWAL 1KQSA 1HNWL 4KI0A 2ZJRA 3CC7A 1S72T 1YJWT 1TWHH 1P16A 3D0FA 1K8GA 1RL2A 2N8NA 5BR8Q 3HOVH 4OO1I 2KBNA 2ASBA 2JUFA 4B3SL 2VUMH 4HJ8A 3H0GH 2UU9Q 4DV0L 3S16H 4LFBL 3Q8DA 3BJUA 1VQFA 4JI0Q 5JEAG 3G71A 4NB3A 1Y1VG 4GNXB 3UDGA 2JA8G 1C0AA 2I5MX 1YZ6A 1J5EL 2UXCQ 2ATWA 4GLVB 3E9HA 1UE5A 4OWXB 4GNXA 3JC66 4HJ7A 4DUZQ 2LXJA 1XNIA 4OWTB 3CCVT 4LF4L 4RG2A 3GTJH 2IG0A 1VQ4T 2E5LL 3GTKH 2R93G 2ALYB 2VQEQ 1VQJA 4DR3Q 1C9OA 2QA4A 1U0LA 3CCEA 5DM7R 3CPWS 5LMNL 4OWWB 1VQ9A 3PIOA 3U50C 3CCUT 3PUXA 5IY0A 1IBKQ 3G48A 3PO3H 4B3RQ 4DV7Q 1M1KU 1HZ9A 2K75A 2L15A 1XMQQ 1IBML 2R92G 2NZOA 2OCEA 4HJ9A 4DR2Q 3HOYG 3CCMT 4DV1L 3CP0A 2RHSB 4JI5L 1I6HH 1A0IA 3RZDH 3PF4A 1B8AA 4BXXG 3S15H 2HHHQ 3TQYA 1IBLQ 2WFWA 2OTLA 2VZAA 1PH3A 1VQ4A 3W1BA 4A75A 3RNUA 1XNRL 1HNXL 1Q46A 4X62L 4DV4Q 4GOPB 1EYGA 1NZ9A 4LF6L 1P8LA 2R7DA 1Z9FA 4JYAQ 3ERSX 3MEFA 1IZ6A 3OW2S 4GLAC 4LFAQ 4GOPA 1XPOA 2VQFQ 1QUQB 1PYBA 1Q7YC 3HKZE 3PUWA 4DV5Q 4NXNQ 3AYHB 1VQLT 3M4PA 2PNHA 1VCIA 3L7ZC 3STBD 1QZGA 3HOWG 3NELA 1QUQA 3G4SA 2IHFA 4JBKA 2LSSA 1A8VA 4KHZA 4MTNA 2JJQA 5FLMH 1QZHA 3GTOH 1KRSA 3CPFA 1PFSA 2ZM6Q 4BY7G 1EQQA 3BZCA 1PHJA 4NXMQ 3BU2A 2NVTH 2Z0SA 1EIFA 3I4NH 4DAYB 4BA2I 4DR4L 2YU9H 2NN6G 4A3BG 2YTXA 3CCLT 4X65L 3I2ZA 4JI2L 5M5WH 3P8BB 4RMFA 4JI4Q 1YEZA 2XHCA 3S2HH 4GKJQ 1GVPA 1QVGS 5DLQE 1VQ5A 5C3EH 4A76A 4Y52H 4KHPQ 3DLLA 1XPUA 2PI2E 4APVA 4IJHA 2UXBQ 2CWPA 4HIDA 3F8TA 1VQLA 3CCQT 4X64L 1JJCB 4BBSG 2Z6KC 3U58A 2PMZE 1BBUA 3TEHB 5M3MH 1K73U 3ULLA 2F3IA 3PUZA 2F4VQ 2KDSA 2BA0A 3ICEA 1WJJA 3PUYA 1XMOQ 5LMNW 1WCMH 2AMCB 1PH5A 2WAQG 3PO2G 4IOAA 1L0WA 4JI3L 3AFPA 4Y7NH 1N33Q 2MO1A 4A3FH 1SN8A 1W2BS 5IYBH 1VQHA 3CF5A 4A3KG 4ZN3A 3K80C 4A3DG 1B70B 5M5YH 2I0QA 2JA7G 3OYYA 4R4IA 3RZOH 2R7ZG 2V1CC 1E1OA 2JA5G 5IP7G 1KL9A 1OTCA 1VQ7T 2CKZB 1M1KC 1CKOA 1UE6A 4YHHQ 2VW9A 4JI1L 1SROA 4B3TQ 4K0KL 1V1QA 2RCNA 1OXTA 3T1YQ 4GKKL 4A3CH 2WB1E 4WJ4A 4B3ML 4L5QA 1ASZA 1I94L 5C0XI 1BBWA 1N8RU 5FJ8H 3TS2A 1WYDA 2DGYA 2K14A 3J81j 2Q2TA 1VQMT 1UE7A 4IPCA 1N36Q 3UDIA 2KHIA 1S40A 2CFMA 1Q81U 1X56A 1GKHA 4LWCA 1IYJB 1YNXA 5IP9H 4BY1H 1VQ8A 5LMUQ 3OTOQ 5FLXE 3JAME 2OTJA 1LM0A 1YHBA 2YTYA 4AQYQ 3KF8B 3UE1A 3RN5A 1XMQL 1HR0L 3KDFB 3JAMc 4LF5L 3EBEA 3K81C 4LF9Q 4UP8A 1FVIA 4JBWA 3KDFA 2G3RA 3I55T 2HHHL 3CMAA 3PSIA 4JI6L 1VQAA 1CSQA 1K0RA 4C3JH 4BBRH 2KENA 1N32L 1Q1EA 2OQ0A 3S14H 4HIMA 2RF4A 5IYDH 2AWOA 2JNGA 1WOCA 4YY3L 1SRUA 4O2DA 2AKWB 4DV2L 3HOZG 4JC0A 4MNOA 1CSPA 4JOIA 3F1ZA 2N49A 3K7AH 4JI8L 4OO1G 3RLNA 4AH6A 4JV5Q 3G6ET 1K73C 2ES2A 3J7AF 3RN2A 4AYBE 3PF5A 2UUAQ 2BH2A 3I55A 1OXSC 2LCLA 1JJ2A 3I56T 4DR5L 2YYZA 4A3JG 5IE8A 2R6GA 3UE0A 3B6YA 3CCRT 1NMGA 4JI7L 4XIGS 3CD6T 1EQRA 1HZCA 4DR7Q 1N34Q 4AIMA 1QVFA 2HQLA 1YITA 3KYHC 1KD1U 1FJGQ 4MZ9A 3G6EA 3CMET 1YIJT 1YJWA 1S72A 1D8LA 4IPDA 4A93H 5GROA 3T1HL 4P75A 1SFOH 5IYCG 3KOJA 5IAYA 2ZTCA 4A3EH 4LF8L 4QL5A 4HIOA 1Q8KA 1J6QA 1N8RC 4RG1A 1N33L 3I4MH 3CCRA 5ELOA 4LFCQ 3KJPA 4A3LH 1HR0W 1HZBA 2UUCL 3HKZG 3A74A 2JA6G 1Q81C 5HY6A 1E7ZA 3U4VA 5HGQA 3CCVA 2PQAB 4DV3Q 3HOUG 4DV6L 4R1JA 4X66L 1R9TH 4DR6Q 4LF7Q 3F2CA 2PQAA 3UDXA 3EN2A 5M5XH 2KVQG 1VQDA 2JE6I 2EIFA 5C44H 1PVOA 3CCUA 4IOCA 2VS1A 4DNIA 4NPSA 4A4IA 1K8AU 1SSFA 1L1OB 4POFA 3CCMA 3JAMi 2E2JH 3E0EA 1JJGA 3W1GA 3PIPA 1AE2A 4LUVA 1L1OA 3CPWA 5GAGC 4LNQA 2IX1A 1X65A 2UXDQ 1X6OA 3GDEA 3CXCS 4XTCS 5E7NA 3M9BA 1XNQL 2K52A 4IJLA 4DR1Q 1CUKA 1TWFH 1PA6A 1NPRA 2I5HA 3K7UC 1Q12A 4FDBA 4GNXC 4A3IG 1Q82U 1M90U 5J26A 1TWGH 5GQOA 1VQPT 3GTGH 3KBGA 2LXKA 2E6ZA 1E1TA 1Y1VH 4P71A 5M3FG 1VQGA 1Z47A 3EIVA 4LUOA 1KIXA 2OWOA 2JA8H 3AQQA 2XTIA 5IWAQ 2MWOA 2MFIA 1NY4A 1HNWQ 3E9IA 5K36G 3PUVA 3OW2A 1EWIA 1NBWA 1FL0A 1HNZL 2B63G 2GVBA 4POGA 2IHEA 1KXLA 4DV0Q 2R93H 3CC2T 3CCLA 3UDFA 4C3HH 4A3MG 1VQNT 5AJ3L 1G51A 5JJKA 2KCTA 1KD1C 4PG3A 3AEVA 5IT9E 1YJNT 3CQZH 2MNAA 3HKSA 1J5EQ 2AWNA 3A5ZB 4JG2A 1MJCA 2H5XA 3CCQA 2R92H 4TVRA 3FKIG 4UPAA 5BR8L 3HOYH 2ZTDA 3F2BA 4HJAA 1PH7A 4IFDI 2L3RA 4LF4Q 2UU9L 4GOPC 2E5LQ 3CC4T 1QVGA 2ID0A 5C0XG 4OONA 4BXXH 1DGSA 2PI2A 4JI0L 3IRBA 2Q2HA 4X6AH 5LMNQ 2QEXT 3M4QA 5C4XG 1YI2T 4TVAB 5GAEC 2YV5A 2UXCL 3HFZB 3DB3A 5JJLA 4DUZL 3CCJT 1KAWA 1MIUA 1IBMQ 4OX9Q 1LYLA 4YCVA 2K4KA 4DUYQ 4ZN1A 2ZTEA 5A2QE 5IYDG 1JB7A 4DV1Q 3TRZA 2VUMG 5GADC 3H0GG 1KRTA 1BKBA 3S24A 2VQEL 4DR3L 3HOWH 4O0AA 2CCZA 2MO0A 2Y0SG 1VQ7A 1KHIA 1W2BA 4UP9A 5J3BA 2WP8J 1IBKL 1K8AC 4YWMA 1XNRQ 4B3RL 5JJIA 1HNXQ 3CCST 3FP9A 4X62Q 4DV7L 3VDYA 4LF6Q 4BY7H 4JBMA 1L2FA 1C7YA 1X3GA 1YI2A 5FLXc 4DR2L 3HOXG 4A3BH 2DO3A 1NJIC 4JCVE 2GN5A 3CCJA 1EIYB 4QQDA 1UEBA 1W3SA 2E2HH 1VQMA 1IBLL 1G291 1MJEA 4GLXA 1Q82C 3PO3G 1M90C 4DV4L 3CAMA 1PV4A 1KQSS 4BBSH 4BA1I 4DPGA 4JYAL 2HIVA 4LFAL 2N3SA 4DR4Q 3A0JA 2CWAA 2VQFL 4EX5A 1VQCA 4X65Q 3CW2C 1Q86U 4NXNL 4JI2Q 3F2DA 1V43A 4DV5L 3PO2H 4DR7L 1YHQT 1OXUA 1VQBA 4X34A 2JA9A 3LGJA 1PH8A 2NZHA 4LW1A 3GTMH 2ZM6L 4A3KH 3L0OA 4X64Q 3RR5A 4A3DH 1I50H 4NXML 3LH0A 4L5TA 1GD7A 4L5RC 4DR1L 2JA7H 1H95A 2ZJPA 3PV0A 2R7ZH 3D31A 4C3IH 4JI4L 1NPPA 2OQKA 5IP7H 2JQOA 3S1RH 1XPRA 2JA5H 4GKJL 3G71T 2HIXA 4PZ7A 4JI3Q 4KHPL 2UXBL 1YHAA 2I5LX 5FLMG 2UUBQ 4ME3A 1XTDA 4A3GG 3M3YH 1SMXA 1FGUA 1PH6A 1M1GA 1K9MU 2EQSA 4QY7A 4QJFA 4ALPA 3I4NG 3W5OA 1YBYA 2LVMA 2F4VL 1XMOL 2QA4T 3I56A 2FXQA 2KCMA 3ZJYC 3CCET 2R7FA 3FHWA 1X54A 3U4ZA 5C3EG 1IL2A 1VQ9T 4JI1Q 1VQOT 2MQHA 4K0KQ 4KLKA 2DUDA 3RLFA 2B3GA 3CD6A 4GKKQ 1V9PA 4A3GH 4DK6C 4B3MQ 1VQIA 3H3VH 2KHJA 2E70A 1I94Q 1PH1A 3K0XA 2IT1A 4QQBX 5M3MG 5H1SE 3J80E 4JBJA 3CMEA 1YIJA 1UWVA 1VS0A 2JK8A 3AFQA 3K8AA 3HOXH 1KC8U 1WCMG 2RHQB 1YJ9T 2OTLT 3KJOA 3I7FA 4YHHL 4B3TL 3J7A5 4JOIC 1ASYA 2HT1A 3J80c 4LUZA 3T1YL 4IO9A 4A3FG 5IYBG 5C4JH 4PZ8A 1RIPA 2A1AA 2Z6KA 4R4CA 5C0XJ 1VQOA 4IPGA 1Y14B 1LTLA 3NEMA 2EXDA 4DK3C 4OX9L 4DUYL 1HR0Q 1VQ6T 2D62A 3HOZH 3BZKA 4LF5Q 2K5NA 3G4ST 4YTLA 1NJIU 4P74A 1N36L 3S2DH 2IY5B 2BA1A 3NBHB 1I3QH 1MKHA 4QGUA 1TWCH 4A3CG 1YJ9A 5LMUL 1T9HA 3OTOL 4JI6Q 2QGQA 1Q86C 3STBC 4AQYL 1N32Q 5FJ8G 4YY3Q 1Y1WG 2K5HA 4DV2Q 4A3JH 1VQ5T 4LF9L 3KFUA 2A19A 4QIWE 3GTLH 1GM5A 3GTPH 1U5KA 1UE1A 4TQUS 4JI8Q 1VQ6A 3DB4A 4HIKA 1OXVA 4BY1G 2D0OA 5IP9G 5ELNA 4GN3B 1NE3A 3J81E 1O7IA 4YWKA 2LQ8A 1PYSB 4B3SQ 4HJ5A 1E22A 4LFBQ 2K50A 1VQKT 1E3PA 3J81c 4DR5Q 3TS0A 1QVCA 2CQOA 5IYCH 1EOVA 3LGLA 1S3OA 2WB1G 1VQPA 4JI7Q 3CXCA 1A62A 1K9MC 2JOYA 4IPHA 3KLWA 4JV5L 1GO3E 2NN6I 1NMFA 2UUAL 3GO5A 5IT9c 3J7ZC 4BBRG 4YWLA 1YVCA 3SGIA 5LL6S 1K83H 2B29A 3ULJA 3S17H 2D0PA 3RLOA 2JA6H 4H02A 1JT8A 3T1HQ 3ULPA 4DAMA 1B7YB 1SE8A 3HOUH 3DM3A 3MXNB 3CC2A 1WFQA 3S1MH 1VQKA 4LF8Q 1VQNA 2JEAI 1L1OC 1N34L 4YCWA 2F52A 2UUBL 1YJNA 1PH9A 1VQEA 3HOVG 3H15A 1KC8C 1HJPA 1FJGL 4JI5Q 2E8GA 2UUCQ 1HZAA 4GN5A 4R4TA 3ER0A 1NTGA 5GAHC 3L2PA 4DV6Q 4GS3A 4X66Q 3CC4A 3WWVA 2WAQE 1PH4A 2BH8A 2ZJQA 3J80i 2CKKA 3PCOB 4IFDJ 3GD7A 1JE5A 1VQ8T 1LUZA 3M7NA 3M85A 2OTJT 2QEXA 1HH2P 1SLJA 1XJVA 4LFCL 4P72A 3PGZA 4R4OA 1Q1BA 3A5UA 4A3IH 4A93G 2IX0A 1I5FA 1K3RA 5JEAJ 1BVSA 5EAYA 4DV3L 1Y1WH 1SR3A 4GN4B 4J15A 4PZ6A 2A8VA 2MWPA 4A3EG 4UP7A 3CMAT 1CKMA 4AYBG 5M3FH 4LF7L 4DR6L 1A63A 1D7QA 4OXPA 4UY8C 3GTQH 3I4MG 4WJ3M 1XNQQ 1X3FA 2C35B 4YCUA 3LGFA 3CCSA 3KF6B 2NVQH 4A3LG 4R4QA 1N9WA 3I4OA 2B63H 4L5SA 2VNUD 1JJ2S 2K5VA 3KF6A 1OXXK 3M4OH 2NVXH 2MI6A 2NVYH
chains in the Genus database with same CATH superfamily
1WDXA 1HTLD 2HCKA 3H3VI 4CRIA 2C0TA 2LCCA 4B3SL 5D6YA 1WJRA 1X55A 3S1NH 1M3BA 3FKIH 1WIEA 4EQNA 1Y0MA 3TP6A 1D09B 1K3BC 3X26B 4P73A 2QTXA 2GVAA 3X3NA 1G6PA 2Q2IA 1ZA2B 1IXRA 1T3LA 1G2TA 2E2IH 1FMKA 2O2OA 2ZJRA 3CC7A 2L55A 3WVEB 2OX7A 1P16A 2F5KA 3CBPA 3MCAB 4OO1I 5JVG3 4M78A 1M9SA 4BI3A 4HJ8A 3S16H 4LFBL 2L89A 3I4MB 3Q8DA 5GMKl 3BJUA 1VQFA 4JI0Q 1C0AA 1Y1VG 2JA8G 3ND8A 3BFMA 1A2TA 4RTVA 3E9HA 1UE5A 2ATWA 3BVZA 2DRKA 5KNCA 1WGSA 2DXUA 4AT1B 1ACMB 1KABA 3HRSA 3TP5A 2HUGA 4OWTB 2COYA 4LF4L 2B2WC 3GTJH 2EYYA 2E5LL 1H9SB 3K0YA 1IYUA 1STHA 1VQJA 4DR3Q 1F2ZA 2PVDB 2SDFA 2EJFC 2LZ6B 3CPWS 4OWWB 3N5BB 1RTNA 3PIOA 1Q90A 3PO3H 3G48A 1N5ZA 1M1KU 1HZ9A 2XD0A 1F2YA 1H9KA 2EZVA 4HCKA 1IBML 1MGQA 4C92G 3HOYG 2VXFA 2SNMA 4M75D 1VA7A 1I6HH 1JC7A 2QDLA 3S3NA 5C5MA 1A0IA 2QQBA 5I6YA 3RZDH 1V1OA 3S15H 3X25B 4BE2A 3OYEA 1SHFA 2J4XA 2OTLA 3R93A 1M5Q1 4Z89A 1SJED 4A75A 1G5VA 2NUPA 2KUMA 4RGTA 4DV4Q 3JCMP 2F4IA 1VQ4Q 2DBKA 1EYGA 4LF6L 2GGRA 1PD1A 1VYVA 2ZXPA 3ERSX 1IZ6A 2QDYB 2FJ2A 4LFAQ 2VQFQ 5FWCA 1JWUD 3HHTB 4J9EA 1Q7YC 3CCUQ 4DV5Q 3GTLB 4CKEA 3L2ZA 2CZ6B 5EG2A 3G4SA 2CP6A 1QUQA 4N4GA 5KCOA 3FEOA 4KHZA 2M51A 3GTOH 1KRSA 1X27A 2HD3A 2RCFA 4V2SA 1MNEA 2QAZA 1D5MC 1PHJA 4IFDH 3T56B 1EIFA 2RPNA 4E47A 1SDFA 2YU9H 2NN6G 3PQIA 3TP8A 4X65L 1IXDA 4JI2L 2O9VA 4GLKA 1RACB 4H13C 4F7UG 3JCMc 5CO7A 1QVGS 2OXPA 5C3EH 1SMYC 4Y52H 2V1RA 1HXDA 2EYLA 1KJWA 2CWPA 4J6WA 4HIDA 4C92B 2XRSD 3HOYB 4LNPA 4AFUC 1JEGA 1VQLQ 5CBEE 2X4WA 2EGEA 2PMZE 3TEHB 4C0DC 1OOTA 1XJWB 2LY7A 1B07A 2DERA 1VF5C 3HOUB 1BCPB 2C9OA 4JS5A 4B9WA 2BA0A 5EGTA 2BZ8A 5JJZA 1XMOQ 4M4ZA 1HXYD 2KJXA 1L0WA 5GAN3 4E7IA 4Y7NH 1LT4D 2HQHA 4OP0A 2Z6BA 5I9PA 4A3FH 1VQHA 1S4ZA 3CF5A 2YDLA 1YWOA 1TKWB 3CCLQ 5E1FA 4HN7A 5L8RE 5GJVB 3UWNA 4R4IA 3GF5A 3OYAA 1WHKA 3KFVA 2V1CC 2JA5G 3C46A 4JLGA 3JCMQ 4DGZA 4PJOC 3AU7A 1HSQA 2K79A 2ENMA 1V1QA 4KY5A 3T1YQ 4XAXB 1EY5A 4GKKL 1GFDA 4A3CH 4X3TA 3PE0A 4K5XA 4RGOS 1ASZA 2FO0A 4LJZC 5C0XI 4F7UB 2KAFA 1OPLA 4M78G 3A1PA 2RSOA 2DGYA 2K14A 1IYVA 2K32A 3J81j 1OX8A 4HT9A 4OMPA 2HDAA 2NBFA 5DAUA 3SEBA 1S40A 2CFMA 1Q81U 3EGXB 3DM1A 4LWCA 4ORZA 4K8JA 2A7YA 1M3AA 3HL8A 2OTJA 2YTYA 4ZGEB 1VQ7Q 1TSFA 2OI3A 1OYXA 2XICA 3INZA 1SSHA 2EY1A 2XDBA 1UE9A 3GTMB 1X75C 2WACA 3EBEA 3K81C 4Y28E 2K05A 4UP8A 1YWPA 1I50B 3RD4A 2G3RA 4C2MB 3CMAA 1JORA 3X3MA 4JI6L 1VQAA 3JCMf 5ELDA 1N32L 3ZL7C 2JA5B 2JJ9A 3S14H 2BZXA 2CVRA 3RBBB 4O2DA 2KBTA 3NTIA 4UC4A 4XT3B 2VKNA 4MNOA 1QLYA 1GBRA 1RF2D 1D1AA 2XG8D 3KUPA 5FO7B 2RB6A 3OS0A 3RLNA 2LS01 4AH6A 2L1BA 3V7CA 3MO8A 4M78B 3JCMJ 1KIKA 3OIPA 4JV5Q 5I11A 2DIQA 3I55A 2VUMB 2DKGA 2LCLA 2EWNA 5KYNA 1TS2A 2QYZA 3CPWP 4OIJA 5CGKA 1IHWA 1AWOA 2J7ZA 1PC0A 2R6GA 2RBMA 3C3LA 4DK0A 3UE0A 3B6YA 4JI7L 3LLRA 5FROA 4VUBA 1BBZA 1HZCA 1VOMA 4XTZA 1MGSA 4RUGA 1QVFA 4AIMA 4FSXA 2LTOA 3D6CA 1KD1U 2NUTB 3HOXB 3C94A 3G6EA 1YIJT 2NWMA 2CUBA 2M00A 4KN4C 3K58A 3QG1A 3GIBA 3VS3A 1SFOH 1HFNA 1YJWQ 5IYCG 1PTOB 1M27C 4PJJA 2FG0A 1Q8KA 2D8JA 2RJFA 2ZAEA 3I4MH 1N9RA 1N33L 2XDDA 1UHCA 4PLIA 1AWJA 4RTYA 2F0HA 1BDOA 1BU1A 2KEDA 4XQNA 1GXIE 1UEAB 1I4QA 3OW7A 4A3LH 1HR0W 2MPMA 1HZBA 1EEID 4PKCC 5ELCA 1DOLA 5CV5A 2JA6G 1E7ZA 1X2KA 3U4VA 2XSCA 4PJOE 2EYHA 3CXCP 1W6JA 1KQ2A 3M57A 1ZXTA 2PQAA 3UDXA 3EN2A 3HP3A 3OHXC 2FPEA 1VQDA 2JE6I 2EIFA 1WHGA 2ZPIB 4IOCA 2CZ7B 4R0KA 2DVEA 1CFMA 5IGBA 1D1CA 1SSFA 1UNSA 1L1OB 3DWPA 4IURA 3EH2A 1N27A 3SB2A 1WQWA 2PU9B 3CCMQ 1D0ZA 5J39A 1X65A 1X6OA 1WA7A 4PQXA 3Q1JA 1Y7XA 3M9BA 2JM8A 1TY2A 4DR1Q 1I4PA 1TWFH 1PA6A 5AT1B 4CKCA 1IHZA 3I8ZA 2I5HA 1E7OA 3H6ZA 1Q12A 4N9PA 1BYMA 5E4WC 2V8JA 1Q82U 1M90U 5A2QL 4C5IA 3H3VC 1ILQA 3MP6A 4XTYA 4KV6A 1M1KR 5CORA 3QWYA 5GQOA 2IX3A 5J22A 4FF1A 1XXGA 3QWXX 5GAMf 2E6ZA 5A0LA 1Y1VH 1KIXA 2JA8H 1VQGA 2CP7A 3FJPA 1K83B 3AQQA 2QQRA 1HNWQ 1SYFA 1SMYD 4ZQ3A 3E1SA 1HNZL 4ZKBB 1BF4A 5KYWA 1ESRA 3G7ZA 2IWHA 4DV0Q 1GHJA 4ULLA 2KQ3A 3UDFA 4RG8A 2EQIA 5AJ3L 1G51A 2K2MA 4DN4M 3CEYA 4DBHA 5GAMh 1SNPA 2N55A 1YJNT 4HCZA 2LC4A 3LW5E 1D3BB 4C8QB 2HSPA 4UPAA 5LJ5g 3HOYH 3QOJA 3SWNA 1F9PA 2L3RA 3A8GB 2F0WA 1WTRA 2K57A 1PD0A 2YSQA 2QGFB 2ID0A 4K5WA 1ABQA 3IAYA 3IL8A 3HZXA 3FRPB 3A8KE 2COZA 2QEXT 4FCYA 3M4QA 1YI2T 1UGSB 3ONAB 4OIKA 2E41A 2VYTA 3CCJT 3AHUA 4M7DF 3MXNA 2EYQA 2LRQA 2MUYA 4LUDA 1JB7A 3JRZA 4KD3A 4DV1Q 5FO9B 5M5YB 1KRTA 1AZPA 2FRWA 4PFOA 3JB9F 2EYPA 4KJOA 5CV4A 3M0UA 3PNWC 1B53A 3A98A 3E3XA 1AEYA 1HNXQ 3FP9A 4PJOF 2L3PA 2LQWA 1YNNC 4DR2L 1X69A 4C92C 2A68D 2NN6H 2DO3A 2GN5A 1CK1A 1EIYB 4QQGA 4QQDA 2LKVA 1MJEA 2DK3A 2EQKA 2QEJC 1U1SA 5EKLA 1U4PA 2F0PA 5IHKA 3TSZA 5GAN5 2SOBA 4ME7A 3CAMA 3GNFB 1S5ED 4L6V5 4BA1I 1NLPC 4GY5A 2HIVA 2AZVA 2CWAA 4S3SA 4KGXB 5FRMA 3FRNA 3N52A 5JOBA 2HZYA 1LTRD 3SVMA 3GV3A 4WORA 1Q8IA 1EZ6A 4X34A 2NZHA 3GTMH 2KOLA 4AFQC 1QWFA 1FYCA 3C4SA 1RJTA 1SE2A 4HEDA 2EJGA 1I50H 3RR5A 1F77A 4LXCA 4NXML 3LH0A 4ZGJB 1GD7A 2HCIA 5L23A 1Q81R 4QW2A 2ZJPA 4BXXH 5CQXA 1EU4A 1HK9A 4JI4L 4A53A 2JA5H 4GKJL 4X9DA 1V1CA 4N4HA 4OMLA 4QVCA 3G71T 4PZ7A 2KR3A 3M5AA 1HQRD 4XXEA 4JI3Q 2UXBL 1PDQA 3L2QA 2I5LX 4A3GG 4ME3A 3CKIB 3D8GA 3V05A 2WSCE 5LJ5d 1I4XA 4DBQA 3DWAA 3OWFA 1PH6A 2LQKA 4XU3A 4Z8AA 2RHXA 1R4QB 1RTOA 4QY7A 4ALPA 5LJ5j 4DXFA 2MF2A 1WJQA 2F4VL 2LVMA 2FXQA 4RKUE 4DA4A 4AYBB 3CCET 2R7FA 3GP8A 4R55A 2X4XA 3DHQA 1VQOT 3M56A 4K0KQ 2DUDA 2B3GA 2DNEA 3HSBA 3FEWX 2XMFA 1V9PA 2F0EA 1CQVA 2KHJA 1QILA 1I94Q 1Q86R 2LT4A 3HTRA 1H3HA 3K0XA 5M3MG 1TS3A 4M7AF 3VUZA 1YIJA 2JK8A 3K8AA 3HOXH 2RHQB 2BKDN 3CHBD 4PFPA 4IUTA 1F2LA 3H09A 2CDTA 1ASYA 4B3TL 3J80c 4UHVA 4IO9A 1BK2A 1RHPA 8AT1B 1RIPA 1PTOH 2B2UC 1OO9B 4R4CA 5BN3A 1EL0A 2DVJA 4M77B 5GAOm 4ZTFA 2ENBA 4PMBA 4FU6A 4M78C 2K03A 4OX9L 2CS7A 1WFWA 3M7GA 8ATCB 4DUYL 1HR0Q 4YTLA 2LMCB 3S2DH 2BA1A 2K5QA 1Q95G 3ME9A 1HD3A 3F70A 4QGUA 1QWYA 1M2VA 1M2OA 1YJ9A 1T9HA 3OTOL 2QGQA 3STBC 3S2HB 3NMZC 4C92E 3QSUA 1Y1WG 4AG1C 2K5HA 4PJOA 3ASKA 4KH0B 1VQ5T 1Y71A 5CKFA 1LOJA 3RKYA 4J1MA 4G7ZC 4JI8Q 4TQUS 5D7UA 4HXJA 1OXVA 2MGSA 1WD1A 4BY1G 5IP9G 3OB9A 3J81E 2X51A 1VQ6Q 1O7IA 1PTOC 1T5EA 1R0BG 2NWGA 3M58A 2KYBA 2KT1A 1PYSB 4XDXA 4DNRB 4IIMA 1PKSA 1QJOA 1E2ZA 4DR5Q 3AT1B 4XK8E 1KFZA 2IPKD 5IYCH 2K4YA 1WI7A 3CQZB 1MNDA 2JOYA 4IPHA 1TUDA 1GO3E 3PIO3 3E9GA 3P7JA 5IT9c 4JZ3A 2A74C 4BBRG 4YWLA 1ZLMA 1QG7A 1W6XA 2DL3A 1NJIR 1K83H 2D0PA 2VV5A 2JA6H 1IHVA 3T1HQ 1JWSD 4KTAA 4ZCKA 4HTHA 3MXNB 2ECZA 4F7UE 1C0MA 1Q82R 1L1OC 1FX7A 1N34L 4EDUA 2DL8A 1YJNA 1VQEA 1FYNA 3GPLA 3R3OA 2DZ9A 2DY7A 4JI5Q 4RTXA 1SJHD 2B8FA 2RMOA 2SEMA 3RMSA 1H92A 5HGTA 4JK1C 1ZSZB 4HVVA 4OB2B 4GN5A 2CSQA 1Y8OB 2XNAC 2L3SA 1EY7A 4X66Q 1EY6A 2BH8A 1AZQA 3GD7A 3D4DA 5LHY1 2QEXA 2E74C 4JVZA 1CQFA 4IUPA 1Q1BA 3HP9A 3VS6A 1EU3A 1TIID 2CQAA 4HCEA 1AD5A 4HKEA 5EQ0A 1SR3A 4GN4B 4L63B 2A8VA 1TU0B 2MWPA 2P0PA 3VR6A 4A3EG 2JMCA 1YNND 4BBRB 4DR6L 1WPYA 4C92D 4QQ6A 1I6VC 3QIAA 4WJ3M 2JZ2A 1X3FA 4YCUA 2KYMA 3M9QA 3NHNA 1A6XA 4M78E 3K7AB 1W4SA 1WTQA 5I4DA 1VQ8Q 1H8KA 1F9RA 2NVXH 1LPLA 2MI6A 3EIVA 2NVYH 5LJ3h 2YRDA 1X2QA 3CC7T 2AHOB 3UI2A 2KGTA 3M4YA 5I22A 4Z9CB 2JVVA 2JEBI 1WZOA 5HKCA 2XGTA 2RKSA 1NR2A 4MZPA 1K0SA 1BCPF 2JN4A 1HTPA 4PMWA 2Q2UA 3GBQA 4M7DG 3TREA 3LWHA 3J81i 1DD2A 3OYDA 3H9NA 1Z6HA 2F03A 1CKNB 5L37A 4DKAC 5HK0A 2GCXA 1YITT 4G4KA 4JW0A 4CDCC 1EFWA 4IFDG 1YHQQ 1U9RA 1Y57A 1S72T 1YJWT 1ZYRD 5KNBA 1J8IA 1JB0E 1MD2D 4PJOG 3JB9I 2O01E 4A3EB 2ASBA 1ZHIA 4DBRA 2WIIB 2KMTA 3GV6A 4DBFA 2D9TA 1SYGA 3G71A 2DEUA 3JCMV 1W6KA 4NB3A 4GNXB 4HVUA 2QXFA 2EJ9A 3LX0A 1J5EL 4OWXB 2MOXA 4OGCA 3OA6A 3JC66 1ILPA 3FPUB 3J7YW 3FLGA 1XNIA 3L42A 3NGPA 3QO3A 4RG2A 1D1BA 2CYZB 2IG0A 5M5XB 2R93G 4BI4A 2LJ3A 2CP0A 1QP2A 2EPBA 2VQEQ 2DX1A 3CCEA 3L2RA 5LMNL 4FYDA 2M02A 3CBMA 1H9SA 5IY0A 3U50C 4EIKA 2QA4Q 1IBKQ 4B3RQ 4XU0A 4M7DB 3K59A 2K75A 1XMQQ 2OCEA 4FT2A 4HJ9A 3CCMT 2YWWA 2P0KA 3A56A 3MFGA 3QR8A 5JVH3 5HCKA 4MHEA 4CC7A 2K3XA 3Q22A 3SEMA 3PF4A 1B8AA 2RO0A 4FNFA 4BXXG 2EKHA 1A3TA 5CKBA 3TQYA 4XYOA 4ATOA 2PW5A 2VZAA 1VQ4A 2JMAA 1BOSA 3W1BA 4M78D 1DONA 1KTKA 4BS9A 1R0CB 1Q46A 4X62L 4GOPB 1NZ9A 1P8LA 2F0NA 1LTTD 2A69C 3GLXA 1Z9FA 4JYAQ 4FXDA 2EPDA 2O5JC 1NNXA 4M1UB 1UHFA 1PYBA 3M4PA 3RIRA 2PNHA 3STBD 2FZGB 1XX8A 1OZ3A 4LDVA 2LSSA 4A3GH 2XIDA 3X28B 1PFSA 3S9WA 3K5LA 1WNLA 1SXTA 3QJ6A 2K33A 1EQQA 2R93B 2Z0SA 3TMEA 4JRQA 2RQRA 5GAN4 1QNKA 5E4XA 2JW4A 4E7KA 3MXPA 4A3BG 3I2ZA 3PVQA 3S2HH 4RMFA 2XHCA 4IALA 1PTOD 3A7LA 4F87A 4PJLA 1KQ1A 5DLQE 1VQ5A 2HSEB 4M7AG 4A76A 4WFN3 1XPUA 5DM73 4IJHA 1FWZA 2DBMA 4XU1A 2DXTA 2HD0A 1VQLA 3F8TA 4GZYC 5LJ5e 1E6HA 4NMZA 5G3LD 4C92A 3BE3A 3QXEB 4A63B 5M3MH 3ULLA 2WSEE 2F3IA 3ICEA 2F0GA 1EY8A 1PH5A 2WAQG 3M54A 1RABB 3AFPA 3BYTB 3EG2A 2MO1A 2M9UA 5IGEA 1ZUKA 4ZN3A 3K80C 4N8FA 1G8XA 2ESWA 1K76A 1B70B 1M4VA 3NP8A 2O4XB 4RHRA 3OYYA 5IOCA 4FVMA 1RAAB 5A35A 4U673 3JB9J 4MZMA 1SF9A 1OTCA 1SKUB 1G3SA 4DOWA 3CCQQ 1M1KC 1UE6A 4FSSA 5GANh 4YHHQ 2VW9A 4D8DA 1SROA 4RMOA 2RCNA 3M0TA 2RQWA 1TUCA 4BUGA 4WJ4A 2ROTA 4B3ML 3A8HB 4A3BB 2Z9HA 3SHLA 2V4DA 4M7AB 3TS2A 3UF4A 1C6VX 5J1ZA 3NUCA 1VQMT 1WHLA 2VASA 5E3FA 2DE0X 2K5IA 4QKUA 2OJ2A 2FPFA 2IVWA 1FR3A 1S1NA 1ICWA 2EFIA 1R77A 2BDNA 1X56A 2JXMB 4BY1H 5IP9H 2R61A 2Q8RE 3EA6A 3VYSA 4FF3A 2RDGA 3JCMX 3EGXA 4AQYQ 2VXWA 2WAQB 2D1XA 3SDZA 1H9JA 2JXBA 4A3MB 3KDFB 2PW7A 3JAMc 3D3RA 1J9OA 1B3QA 1JOKA 1O75A 3P8HA 2DTOA 2MK5A 3KBXA 1UGPB 1UJYA 3I55T 4J9FA 3F2UA 4E7HA 3PSIA 5LL6X 2QILA 5DLOA 4BBRH 2KENA 5GMKj 2EYOA 1WOCA 3S1QB 4YY3L 1M3CA 4QT7A 2RSNA 4DV2L 2AZSA 4KKSA 3BDUA 4JRPA 2AUJD 4XYQA 4H0LC 3K7AH 4OO1G 5C4XB 4XQQA 2D8HA 2DXBA 2B2UA 2RA4A 4C8QF 5HURA 1GHKA 1PG5B 5CVIA 3G6ET 1WTPA 2L0AA 3PF5A 4FW2A 4RKLA 3RMHA 4AYBE 2UUAQ 2DILA 5JPMC 2QG9B 3I9QA 1OXSC 2FRYA 3H0GB 1T3SA 2LJ0A 4NDXA 2K7VA 3R8BA 3I3CA 1PFNA 1STEA 2J6OA 3CD6T 1KLUD 1BUVT 2L5QA 5FU7B 1HFGA 2EXZA 2PZTA 3ERQA 2EKOA 2E1HA 1BQQT 3FIFA 1C4QA 1YITA 3KYHC 3URYA 1B1ZA 1K8OA 2EVRA 1FJGQ 3CMET 1YJWA 1S72A 4L59A 3PGGA 3MEAA 1LO5D 4IPDA 3HPWA 3MTSA 3NENA 2NUTA 4DU9A 4FYYB 3L1AA 1UGRB 2ZZDA 4A3EH 5C0MA 4LF8L 4QL5A 3SK8A 2M2LA 2EJGC 4LFCQ 3P75A 2DETA 1YP5A 1KDCA 3CCRQ 2GTOA 2L8DA 1IKLA 3J81L 1PZID 3HEJA 1Q81C 1I3QB 5HGQA 3HOUG 1OU8A 4BDYA 4DV6L 3JCMg 4BY6B 4BDZA 2H4OA 1YN8A 4R1JA 2O5IC 3VS2A 5M5XH 2KVQG 3OSVA 1I8FA 4FF2A 2VS1A 4EMKA 4IIOA 1A0NB 5CC4A 1GUWA 5CV6A 4OB3B 2RQUA 2JS2A 2NYZD 2EY5A 3CCMA 5EKKA 2E2JH 2OF1A 3E0EA 1BI3A 3PIPA 2P0QA 4LUVA 1L1OA 3CPWA 2A69D 3CXCS 2XI9A 5IH2A 1PM3A 2K2VA 3JB9H 2W0ZA 1OV3A 4PJMA 2NVTB 1D1KA 2JP1A 1GFCA 3I4NB 4ELYC 4GNXC 2CP5A 4ZRZA 2QW7A 1II3A 3E5SA 2B2VC 3EROA 3H91A 1RAFB 1RAGB 3REAB 1VQPT 3GTGH 2R5MA 4IUUA 3LH5A 4P71A 2F3VA 3KXTA 2XKOC 1ZX6A 2P4TA 2A36A 2D6FA 5GAOn 2F0IA 5IODA 1ZBJA 2J05A 1NY4A 3E9IA 1V76A 1WXTA 3PUVA 2F0SA 1XYIA 1EWIA 2CH4A 1SRMA 2IHEA 1AFPA 4M7DC 2R93H 3MKDA 2KNBB 5JJKA 1KD1C 1Y8PB 2AQ3B 4PG3A 1DOMA 5IT9E 4KJNA 3AEVA 1HHVA 2LNVA 2RJDA 1YCSB 2AWNA 3OBWA 2JSOA 2H5XA 3RZOB 4CHTB 4TVRA 5BR8L 4C8QA 1D3BA 2K3BA 2ZTDA 3NQIA 1PH7A 4LF4Q 2UU9L 4GOPC 2E5LQ 1U3OA 2ZPFB 2DMOA 4J9HA 3ZFJA 1QVGA 2W10A 4OONA 4X3SA 5C0XG 1DOKA 3LWUA 2HAXA 1QNUA 2GTJA 3UA7A 1IRXA 4J9DA 1PKTA 5M9OA 1F9SA 2UXCL 4M77F 3K5NA 5JJLA 3VUBA 4DUZL 3OY9A 4O1NA 1MIUA 1IBMQ 3A8OB 4BACA 1VQNQ 3DLMA 2Z0WA 4ZN1A 1LYLA 1STNA 2KHSA 2ZTEA 4YCVA 3JCMd 5EPLA 5IYDG 2DTIA 2Z8LA 2VUMG 2CT3A 2E3HA 1BKBA 3LX7A 3GTQB 4O0AA 1GUNA 4KHVA 4K11A 1KHIA 3VR3A 1BR9A 4FP5D 3SHWA 1GUSA 1RODA 5CIUA 4DV7L 4ESRA 2SNSA 4LF6Q 3D6WA 3CC4Q 2DZCA 5KYLA 1X3GA 2DL5A 5GAMg 1EIHA 3TP7A 3HOXG 1X32A 4PV1C 4A3BH 1NJIC 2YUNA 5IXBA 2WB1B 1I0CA 4RGNA 2I0NA 2E2HH 1WHHA 3META 3VRZA 1VQMA 1H9RA 3TDQA 1IBLL 1ONLA 3SD4A 1EFID 2MIOA 2QK0A 1Q82C 2K6DA 1M90C 2KA7A 1KQSS 1TWAB 3CQTA 2P84A 4DPGA 3AB9A 4JJCA 4CJ0B 4EX5A 1TH7A 4X65Q 4NXNL 1Q86U 2VGMA 2NB0A 4MN3A 3EHQA 5COYA 3CCSQ 4JI2Q 1YHQT 1OXUA 4BWGB 1M8AA 1ZA1B 1JE4A 2E75C 4KH1B 2DPPB 4LW1A 1TWHB 2ZM6L 3HOVB 5FRNA 3L0OA 1B3AA 1AVZC 4LDYA 5I2SA 1UGQB 5EBCA 4DR1L 4CGYB 5FW9A 5EC7A 1JBMA 4MMKA 5CK9A 1C1AA 5EPJA 1JOOA 4KRTA 1O7ZA 3FJ5A 2M1HA 4KKTA 3OPOA 4E7ZA 3MEUA 4M7AC 4KHPL 2UUBQ 1FNWA 4N4IA 1SMXA 1V29B 1P92A 3EG1A 3GTKB 4A93B 9ATCB 1M1GA 1K9MU 2CSIA 3RMQA 2EQSA 2F0UA 2F0VA 4ID6A 1EZ8A 1WTVA 3W5OA 2KEEA 4M7DE 1MBYA 4RTUA 2QA4T 2KCMA 3ZJYC 4OMQA 3FHWA 2VB3X 2DEQA 3QB3A 3I56Q 4ZYSA 3CD6A 4GKKQ 2CHBD 2RD1A 4HSVA 1WQ7A 4DK6C 3H3VH 5C4ZA 2ICIA 1CI3M 4ODGA 2F0OA 4ZLTF 4QQBX 5H1SE 1ZSGA 2Y90A 2A5HA 2D0NA 1PNJA 3CMEA 3TSSA 3AFQA 1BI0A 2A6EC 3M0SA 2ED0A 3NBIA 1WCMG 3OMCA 4EMKB 1YJ9T 1SYDA 3I7FA 4WF2A 4MTKA 4UAIA 2K5LA 1OEBA 4JOIC 5K5PA 4KY6A 5IYBG 2KY9A 5GAMd 5C0XJ 1WYXA 3VS4A 1AZGB 4C8QG 3T13A 2AHJB 3U23A 2DJGC 2RNAA 5GAMj 1I4GA 2E76C 1SE3A 3NEMA 4DK3C 4M77A 2F1MA 1RAIB 1NJIU 4P74A 2H1EA 1N36L 1IGQA 1SSOA 1Y69U 4OO1H 1L0XB 1NLOC 1I3QH 1MKHA 3V7SA 2CGHA 4WCIA 3VYHB 1SEBD 3C12A 2F5TX 4N0AA 5KYUA 5GMKe 1TS5A 4KMUC 4LMQD 4X3KA 5LMUL 4JI6Q 1N32Q 1OU9A 2OTLQ 5FU7C 1WX6A 2YRCA 2RM4A 4F7XA 1OX9A 5FJ8G 2K5WA 2E64A 2OAWA 2DXCA 5CKDA 4LF9L 3GTLH 2JN0A 1UE1A 3L2WA 2QDBA 2CW0C 1TOVA 1VQ6A 4HIKA 5I2MA 2KCCA 2D0OA 1V1PB 2LQ8A 3H0HA 3G4SQ 4B3SQ 1WCMB 3EGUA 3ZYYX 4DEXA 1QVCA 2HQEA 2J6FA 2BOSA 2H3JA 1TT2A 2PZWA 1EOVA 1AWWA 1VQPA 4JI7Q 1A62A 3QJYA 1NUCA 3VJPA 4RH6A 2K9GA 4QVZA 2R92B 4FM4B 4M7DD 4BY6C 4C3JG 2EGCA 4DOVA 2PQEA 4JJDA 3OIQA 3RLOA 1JT8A 1UDLA 3QWNA 3JB9D 3HOUH 3H0FA 3MAQA 3DM3A 2GFUA 4M7AE 3H6MA 3W2DA 2JEAI 3T51B 4JJBA 3CC2Q 4PJOD 2F52A 1VQKQ 4KULA 4ZNXA 1STAA 2KECA 3H15A 4QMGA 1SYCA 3VYRA 3OYGA 4B08A 1RKNA 5JPNC 3Q23A 4OL7A 2A28A 4EPCA 1HZAA 1GJXA 4R4TA 5GAHC 2P4RA 5IXFA 2F3WA 3CBOA 4OB0B 1ZSZA 2MP1A 1KQSP 3MP8A 2WAQE 3M0PA 1M4ZA 2GNCA 5IN1A 1HH2P 2EDGA 1SLJA 4R4OA 4AG2C 4L5GA 4AFSC 1I5FA 4C5HA 5GAOr 2RDFA 3KLSA 5EJWA 5JEAJ 4DV3L 2VB6A 4J15A 4K2LA 1BCPC 4D8KA 4ME5A 4UP7A 4AYBG 4C3JB 5ECAA 3BS1A 4IKFA 3EFXD 4LF7L 1A63A 4G57A 4OXPA 1SRLA 2CUDA 3DKMA 3P1HA 3GTQH 1PLFA 1VDZA 2C35B 1N6AA 1HPCA 1NEGA 2EYMA 3MC0B 4R4QA 3VA7A 1AOJA 1HCZA 2LNHB 1JJ2S 3PO2B 1EWCA 2M0YA 1LTBD 2MHVA 2AT1B 4CC4B 2OTJQ 1DM0B 2UXDL 2M16A 1EY0A 2KVMA 1QCFA 2EGAA 1GUOA 4D6WA 5KH6A 4C2MH 1EX4A 1K9AA 3RKWA 5GAN6 5C44G 3MEVA 1RD9D 4TSSA 3EFOB 4LUEA 3O8VA 1RAEB 3KLSX 4BB7A 1MHWC 4M77G 4A4HA 1HNZQ 3S1NB 2V8KA 4JDSA 1QVPA 1TWAH 2PPBC 5C0XH 4M75B 4Y91A 5GAOl 2ED1A 1EUJA 1F2MA 5AJ3Q 1JMCA 1SE4A 1YHQA 3M3YB 2Q8IB 1PH2A 1CKNA 2F0KA 5IWAL 1Z9ZA 3VS5A 3R2TA 4R8NA 1AT1B 2EQMA 2IL8A 1TWHH 4M7AD 4J6XA 3ITPA 3HOVH 5IYDH 2X9HA 2KBNA 1NYGA 3G6JB 3NWTA 2VUMH 2A73B 1CKAA 3T16A 2QGGA 1QCOA 1G6ZA 2LT1A 1SEMA 4NOYA 1FXXA 2JYOA 1HRJA 2I5MX 1YZ6A 1ESFA 4GLVB 2K28A 3Q6SA 4IUQA 4LDXA 4GNXA 1I5OB 2BDOA 1OULA 5GMKi 1F9QA 2DD5A 2B2VA 1R9TB 2LXJA 1EQTA 3JCMe 1SAPA 1VQ4T 3GTKH 1HYOA 2PVGB 4C3HG 2ALYB 2PNRC 5C44B 1C9OA 2QA4A 2DL4A 1U0LA 2CREA 2JM9A 3C2PA 1WHJA 3CCUT 4KBMB 1YNZA 2H8HA 2A6ED 5C6SA 5KYXB 1VQ9Q 3QDRB 2NZOA 4DR2Q 4M7DA 3CP0A 4JI5L 3NPFA 3O5ZA 5KYUB 2XU8A 1WHMA 4CI0C 1K9MR 4RTZA 2HHHQ 1PH3A 1PHTA 1XNRL 1SHGA 4RKBA 1G91A 4RA8A 4I65A 3HFNA 2R7DA 1MSHA 5EPKA 3OW2S 4GLAC 2JTEA 4GOPA 1XPOA 3MVVA 4J5YA 2B2YC 3PUWA 3WDNA 1VQLT 2AK5A 1ET9A 1VCIA 3L7ZC 5DM63 3NELA 2IHFA 2F0TA 1A8VA 1QZHA 1C48A 2PNIA 1L0YB 2HMAA 5LJ5h 4BY7G 5D6WA 4NXMQ 2PCFB 4A4KA 4CBVA 4C3HB 3MHBA 1NM7A 4BA2I 2CW0D 4DR4L 1G3YA 2KEAA 3RERA 1E6GA 1N9SA 2B8AA 5FU6B 3CCLT 1EY9A 2YTXA 4N9TA 3P8BB 4CJ1B 4JI4Q 1YEZA 3BDOA 4GKJQ 5A0GA 4OB1B 2EOTA 3CRLC 2PYKA 3DLLA 5F2DA 3BY7A 4APVA 2YUPA 3QO2A 1WJSA 2UXBQ 2RN8A 2E5QA 4X64L 4ZK9B 4EMKC 4RFBA 4BBSG 2Z6KC 1TUGB 2RJCA 4QIWB 5FO8B 1SNDA 1G83A 1K73U 4RCOA 2F4VQ 3PUZA 3OYKA 1WJJA 1ARKA 3S1MB 3TVTA 1WCMH 3BVGA 2F0DA 5LMNW 4XQJA 4IOAA 1E0BA 2DYBA 1SN8A 1W2BS 5IYBH 4G7HC 4JJNK 2GFAA 3DEPA 2I0QA 2EYWA 2KT8A 4JLIA 3RR6A 4LN2A 4N8X1 1WVLA 2R7ZG 2C06A 4LDWA 1MMGA 1E1OA 2O4XA 3G7LA 5D3DA 1I4HA 1VQ7T 2PUKB 3PIP3 4BY7B 4B3TQ 5CR2A 4JI1L 2CZ0B 1JRIA 1OXTA 1TXQA 5GJWB 2WB1E 1JJ2P 4L5QA 2FMMA 5GAMe 2COWA 2FL7A 2E6NA 3VYGA 1BBWA 1KG1A 4Q0FA 1N8RU 5FJ8H 5LJ3f 2ZPHB 3E9FA 4J7FA 1GUTA 1JCKB 4M7AA 5M3FB 4IPCA 1BI2A 2WINB 4BBSB 3BW1A 2J0TD 3V8LA 4LAAA 1VMCA 2RI5A 1AW7A 3OTOQ 1G8ZD 1GCQC 1PFMA 1TVXA 2K01A 3DEOA 1RLPC 1BCPD 3KF8B 3HRTA 2PTKA 4C8QC 2DN8A 2OT2A 1XMQL 2YHTA 1EZZB 4MDWA 1H9MA 3I72A 3M59A 4LF5L 3OSSC 4E7JA 2C5CA 2F0FA 3IFDA 1U4RA 1FVIA 3KDFA 4WTOB 3FPPA 3ULRB 2G9DA 2G6FX 1QB5D 2VWFA 2R7ZB 4OMFB 3VS0A 1CSQA 1RDPD 4C3JH 2I46A 1Q1EA 2RF0A 2OQ0A 1A15A 2RF4A 3S1RB 3MHXA 4JC0A 2BZYA 2NLUA 1CSPA 4JOIA 2N49A 3SR1A 2EJMA 4EGVA 3JB9G 2E2IB 4PNYA 1JQQA 2X6LA 3C95A 3PMIA 2ES2A 3J7AF 2VUBA 3VYUA 2DRMA 3PMFA 5C3WA 5C3XA 1WLPB 2BH2A 5CV7A 3TZDA 3I56T 2EY6A 4A3JG 2Y0SB 4DAPA 1TWBA 4J7IA 1K28A 4ZAIA 4ZTJA 4CJ2C 2JS0A 2JTMA 5DY9A 5NUCA 3J7AV 2XWJB 1N34Q 1MMNA 5GAOq 4FO2A 4FXGC 3SK4A 4OVAA 3R6OA 4HR7B 2G5DA 3P20A 4MZ9A 1D8LA 3GTJB 1UUEA 5GROA 4P75A 1VYTA 5AYFA 1I4RA 2ZTCA 1QCNA 2F2WA 3UATA 4CC2A 3OSOA 1PZJD 3TEEA 3FDTA 3PO3B 1KDAA 3RESA 3OW2P 4DEYA 1J6QA 4RG1A 4C0FA 1MUZA 2DYIA 3CCRA 5ELOA 5CAIA 5CCAA 2ZGWA 2QQ9A 1I6HB 2HL5C 2UUCL 3HKZG 3RZDB 3A74A 1PRLC 2A37A 5HY6A 5I2YA 2X35A 1TWCB 3QYGB 1R9TH 2QASA 5FOBB 3CCVQ 4DR6Q 1YIJQ 3C0CA 5C44H 1OZ2A 1K8MA 3CCUA 4KUDK 2MAMA 1B4OA 5CV9A 5FK9C 4A3JB 3DXJC 4NPSA 1LABA 4DNTB 1K8AU 3RUZA 3GTPB 1HQMC 4RWSC 4E7LA 1JJGA 3OYHA 3W1GA 4LNQA 1VIEA 5BN4A 2IX1A 3GDEA 3I5RA 3HRUA 4JRIA 4EMGA 5E7NA 1O78A 1XNQL 4TKOB 2K52A 2TMPA 4IJLA 5KRUA 4LD9K 1NPRA 3NWSA 3K7UC 4C8QE 4A3IG 2B39A 3L9AX 4ILWA 4RCBA 1W2BP 5C3EB 2LQNA 3LNNA 4V0BA 1KNAA 4AMCA 4CKBA 1U4MA 5T1GA 1CKBA 3KBGA 4FT4A 6AT1B 3EG0A 1E1TA 1D5XC 1E2WA 4J9BA 1Z47A 1YFNA 3BZDB 2GQIA 2DIGA 1JO8A 4LUOA 4II1A 3SK6A 2OWOA 2EE1A 3OYMA 3HKZB 5K36G 4X9CA 1AN8A 5I9OA 1GCPA 2ATCB 5DEHA 1NBWA 1FL0A 2B63G 1PZKD 3EJIA 4DF7A 4M77C 5GANf 2E2DC 3CC2T 3MXUA 3CCLA 4C3HH 4A3MG 3NHHA 2FVUA 4A3FB 5ELEA 2ZPEB 1UAPA 1Y96B 1U1TA 3CQZH 4N0AC 2MNAA 1J5EQ 4XQ3A 2Q8TA 2X4YA 1PRTF 4JG2A 1MJCA 1QQJA 1OPKA 1MHNA 2PUOB 3F2BA 1T0JA 4HJAA 3VV0A 3NTHA 3QKJA 2XK0A 2CP2A 2O9SA 3OQ5A 1FGBD 4JI0L 2Q2HA 5LMNQ 2E4HA 5C4XG 4TVAB 5GAEC 4A3IB 2YV5A 5IIFA 3HFZB 4LK1C 4KK7A 2LMJA 1KAWA 4HMJA 1H95A 3VS1A 3S3OA 1M8MA 3M55A 2B86A 5A2QE 4FYVB 3H0GG 1YJNQ 3L3OC 4QUCA 3S24A 1I07A 4DR3L 3TQ7P 2MO0A 2YLBA 4FF4A 1VQ7A 1D5ZC 1K73R 4F88A 2BUDA 1BI1A 5FU6C 5J3BA 2WP8J 1G3WA 4YWMA 2NVQB 2B63B 1UFFA 4EQPA 4J9CA 4X62Q 2KXDA 5TSSA 4BY7H 3M4OB 1B34B 1C7YA 5FLXc 2WKCA 4JCVE 1CSKA 2QEXQ 1BB9A 1YI2Q 1U5SA 4E6RA 1M30A 2HKQB 1W3SA 2L11A 3EFRA 2EYJA 3HG9A 3M53A 2AKKA 3CCJQ 4L8JA 4C8QD 5I6WA 4GLXA 1SNQA 2IPOB 4DV4L 3MA2B 1RI9A 2XWBB 1PV4A 3MEHA 4BBSH 2B2TA 1H641 4XTWA 3IFTA 1KAAA 1QMCA 2N3SA 1G3TA 4LFAL 3Q0AA 2VQFL 3QIIA 1VQCA 3VU3C 3CW2C 4DV5L 4OGQC 3F2DA 1V43A 1TU2B 2NZ1D 3VS7A 1ZSZC 1VQBA 1IREB 2NYSA 1N8RR 3EVQA 3LGJA 1PH8A 4LD6A 3H8ZA 2VGNA 2D2CC 4WRDA 3MFYA 4K14A 1MV3A 3OYLA 5FKAC 1HJDA 5KYYB 5JAVA 4L5RC 3T53B 2R7ZH 3PV0A 2KRNA 5IHNA 3M0QA 1NPPA 2L2PA 3S1RH 2BCOA 1VIFA 5GAN2 1YHAA 5FLMG 2DJQA 2F0QA 1XTDA 5LJ3e 4Q5VA 3IKJA 1MMAA 2K1BA 1IO6A 1X43A 1BNZA 4ELZC 3I4NG 5D65A 1STGA 2B2YA 2KE9A 4M77E 1SFOB 3H94A 3ND9A 4RTWA 1XMOL 3I56A 2DTHA 3A8MB 1X54A 1VQ9T 1LTID 3RLFA 3VYTA 4B3MQ 3L2VA 1B9MA 3A8JE 1PWTA 1PH1A 4EVOA 3G71Q 2IT1A 5IHIA 2QF7A 1ICFB 3J80E 1UWVA 1VS0A 1KC8U 4R56A 3KJOA 1ZUUA 2HT1A 1BCOA 4LUZA 1LV9A 1K4US 3LWEA 3T1YL 3R6NA 4CDEC 3MJXA 5GMKh 4PZ8A 4F16A 2A1AA 2Z6KA 1MV0B 2DL7A 3V2TA 3CCEQ 3M0RA 1S5BD 1Y14B 1VQOQ 3WOEA 2EXDA 3BVMA 1EOTA 1VQ6T 1S5DD 3BZKA 3VR5A 3EGDB 4KN7C 2IY5B 3NBHB 4HCSA 1B9NA 1TWCH 5I21A 1TWFB 4X1VA 3O13A 5KEEA 3TZUA 1LT6D 1KLGD 2LP5A 1Q86C 5M5WB 3TU4K 3UPUA 5GMKm 4YY3Q 4OMNA 2K3YA 3PMTA 4M75F 3S6WA 2MJ8A 4DV2Q 4A3JH 1MSGA 3KFUA 1LT5D 2A19A 1Y1VB 3CRKC 4QB4A 4QIWE 2JA8B 1GM5A 3GTPH 1U5KA 1AZEA 2E3IA 2LJ1A 3RNJA 3DB4A 1ENAA 1WXUA 5KE2A 4YWKA 2KRSA 4HJ5A 1V1PA 4LFBQ 2EQUA 1E3PA 1QWEA 3N6RA 4HA8A 2CP3A 3J81c 1CZWA 4KGVB 2FB7A 2CH4W 2AIRB 1S3OA 2WB1G 3CU7A 3CXCA 1K8AR 4XTXA 1ZQ1A 2X3WD 1K9MC 2LCSA 4DAYA 3LWIA 3FC3A 4M77D 1DYQA 4JV5L 1GCQA 5I2XA 2L5TA 1NMFA 1W70A 2NN6I 1C8CA 1IW7C 1FMVA 2K5FA 3WVDB 1VQ5Q 1FD7D 2KCNA 1MI2A 4KD4A 1YVCA 4FYXB 3T9NA 3ULJA 4HAEA 4F04B 4H02A 2EQJA 3ULPA 1B7YB 3EG9A 2V8IA 4MMLA 1G2SA 1SE8A 2IW3A 3CC2A 1WFQA 2XN9C 1VQKA 2N88A 4LF8Q 2GA4B 1O7YA 1ENFA 1M8VA 4IN3A 4YCWA 2RHYA 4ZGDB 1CT1D 1DZ1A 2UUBL 1NEBA 2X4JA 2EYFA 2AQ1B 3HOVG 1HJPA 4FW1A 2E8GA 3C1EA 2FHTA 2V26A 1W1FA 3L2PA 1ZUYA 1BO0A 1T5XD 2K04A 4DV6Q 4GS3A 3WWVA 2QTVA 1PH4A 3J80i 4KY7A 3PCOB 2L3QA 1VQ8T 3M7NA 1UJ0A 3V8JA 1QE6A 5CMDA 1XJVA 3VKIA 4JUVA 4NL3A 2A0FB 1Y8NB 2AQ2B 2RQXA 4P72A 3K5MA 3A5UA 4A3IH 2MMPA 4A93G 2IX0A 1K3RA 4JRKA 3MPUB 2Z1CA 3U9OA 1IKMA 4DA2A 1D7QA 5CYUA 3UDCA 2NTTA 3GNGA 5GANe 3MXGA 2F0LA 3X20B 5K36H 2A68C 2BE5C 3A8IE 2K7AA 3LGFA 3OMGA 3KF6B 1A3UA 2NVQH 3TCJA 2B63H 4L5SA 4PLLA 2J06A 4GBQA 1QOHA 2K5VA 2BTTA 1OXXK 3M4OH 1U06A 4A3MH 3QDFA 3M4GA 4EQ5A 4RGMA 4HCCA 3RDVA 2EYZA 3URGA 1CZGA 1AE3A 2MPXC 2N78A 2LX9A 2RA2A 1Q7YU 1IL8A 3L2UA 2Y0SE 1DJ7B 2A3LA 5CKHA 1QVFS 1RI0A 2FPDA 1UGVA 3WXMB 3P8DA 1TXYA 1WI5A 2EY2A 2XIWA 2YTVA 1PFBA 2H3EB 1Y07A 1AHJB 3THKA 1AH9A 5C6AA 3S1QH 3EFOA 1E24A 5GAN8 2VL6A 1GRIA 1XQHA 4YIJA 2VY3A 3D4WA 4M75A 5C4XH 1X9NA 4Z88A 1PCXA 1X3EA 1KQSA 3WOFA 1EQVA 4C0ZA 4KI0A 4WJWA 1HNWL 4K2KA 2EAYA 2DNCA 3D0FA 3NQTA 4NKLA 1RL2A 2N8NA 2KQWA 5BR8Q 4C1NK 3JCMh 3CC7Q 2JUFA 4IZ8A 1D0YA 4X3UA 3H0GH 3RKXA 4DV0L 2E12A 1ET6A 1LTAD 1SNOA 2UU9Q 2R5AA 1B50A 2PZUA 4NP5A 1O7LA 4OELB 3TBIB 5JEAG 4J83A 3H41A 4J8OA 3UDGA 1IB8A 2KXCA 4O42A 4ZUIA 1PRTB 2UXCQ 3KUFA 4HJ7A 2CT4A 4DUZQ 1KNEA 2LFNA 2AKLA 5IGGA 3CCVT 5KE3A 4QVDA 1YITQ 1UB4A 3GQBA 2O31A 4NS5A 5GAN7 2X3XD 1S72Q 3PFSA 5DM7R 5AFWA 2R58A 1VQ9A 3PUXA 2F2XA 4DV7Q 3AMUA 2ICEC 4U68A 1LTSD 2L15A 2R92G 1WTWA 1I1JA 4DV1L 3QZ9B 5KYXA 4GLMA 1NAPA 2RHSB 3A55A 1RUWA 1TTHB 3S2DB 2NUPB 1RLQC 3OYJA 1IBLQ 2WFWA 2LX7A 4HT8A 1G2BA 3RNUA 3TSWA 1YNJC 1HNXL 1JICA 1FMWA 4HVWA 1TWGB 3MEFA 4CDDC 1SNMA 1QUQB 1QVGP 3HKZE 4NXNQ 4DR7Q 3AYHB 1F1BB 3HOWG 2KSSA 1QZGA 4RTTA 4JBKA 5FLMH 1CHPD 1BIBA 2JJQA 3FMCA 1FNVA 4MTNA 5ELBA 3CPFA 4QUFA 2ZM6Q 1KC8R 3I4LA 2I2LA 3BZCA 1XTCD 1O80A 2RDHA 3BU2A 2NVTH 1LACA 3I4NH 4DAYB 1UTIA 3QZ5B 5CBAE 2EW3A 2R57A 5M5WH 3A54A 1VYUA 3EQLC 1RAHB 1GVPA 1LLRD 1I4K1 1EYDA 4KHPQ 5CKEA 1I5LA 2FINB 1EWHA 2PI2E 1HA5A 4TRDA 4J6YA 3CCQT 3EG9B 3QHSA 1JJCB 2RVLA 4FXKC 3SE0A 1WTHA 1D2BA 3U58A 2JA6B 1BBUA 1QCBD 1JR0D 3OYFA 1AP0A 2KDSA 1AEXA 2M9VA 3PUYA 4P5NA 4RAUC 1IW7D 2AMCB 3PO2G 4JI3L 1N33Q 4K6LA 1K1ZA 3X24B 2QKIC 5HK3A 3NSWA 4MDXA 2FZCB 4L6TB 5D6XA 4A3KG 4OF1A 3OOCA 4A3DG 3EG3A 4O5VA 1EYAA 5M5YH 2JA7G 3HOWB 4MIUA 3RZOH 3G1JA 3QUIA 4C3IG 2D9UA 5IP7G 1KL9A 2CKZB 1CKOA 5ELFA 3OS1A 4M75G 4K0KL 1KHCA 1JXMA 1X6GA 1EIGA 1CA6A 3K6OA 1I94L 4J9GA 4NW2A 2DJZA 1D6EC 4QF4A 3NPPA 1WYDA 1WTXA 3OWEB 5C4HA 2GQVA 2Q2TA 2DFUA 1UE7A 2ZXRA 1QVFP 4Z02A 1EFNA 1ZKOA 1N36Q 3TN2A 3UDIA 2KHIA 4O6JA 1GKHA 1TG0A 1IYJB 1YNXA 1S5CD 1VQ8A 3MWYW 5LMUQ 5FLXE 1UECA 3JAME 1YHBA 1LM0A 4CDFC 1WXBA 4AFZC 3UE1A 5KNDA 3S3MA 3RN5A 2NVXB 5GAOp 2NVYB 1HR0L 2DJFC 4FL6A 5IGDA 3KF8A 2PO4A 4NL2A 2BE5D 4A3KB 4LF9Q 4A3DB 4JBWA 4B6MA 5A0DA 3K57A 4C5EA 1NE8A 2HHHL 4HMIA 1TS9A 5KIXA 2O88A 1V8QA 1DXMA 3I73A 2JA7B 1K0RA 5KGUA 4H44C 1NYFA 3CMAQ 1VQMQ 2O2LD 4C3IB 2YXYA 4HIMA 3VR4A 1EY4A 2JNGA 2PVOB 2AWOA 2DM1A 1SRUA 1JQYD 2RI2A 2F1LA 4JZ4A 2AKWB 2B2WA 2SEBD 3HOZG 4IUVA 3F1ZA 2E10A 3E2UA 3J80L 4JI8L 2JT4A 2EJFA 2KI7A 1Q3LA 3HGBA 3IQLA 2EYXA 1K73C 1LCKA 1PYWD 2P5ZX 3RN2A 4J9IA 2XDPA 4V190 4OEMB 4OHJA 1JJ2A 1A3VA 4F8MA 2RHZA 3NTKA 3I55Q 2YYZA 4DR5L 4FYWB 5IE8A 1PRMC 1HA6A 3CCRT 4MZTA 2MYSA 1NMGA 3KK7A 1SG5A 4BI8B 1EQRA 4XIGS 4ANJA 1ZYRC 1JWMD 2ZXOA 5LJ3g 2HQLA 4DAVA 4KT0E 4DXGA 3V96A 1QW1A 1AWXA 1A2UA 1GUGA 2B2TC 3DMUA 1LTGD 4M8AA 2DY8A 1X01A 4A93H 1Q7YR 4A54A 4RCCA 3T1HL 3G6EQ 2V1QA 3H0IA 5C4JB 3KOJA 2RI3A 5IAYA 2RQVA 4RHSA 1LJOA 3EH1A 4HIOA 3LYIA 2NUCA 1XOVA 1N8RC 1QKXA 1X6BA 2HQXA 2HBPA 2KRMA 3HOZB 7AT1B 5FWBA 2KK4A 3KJPA 5KCHA 3K5OA 3CD6Q 1HUMA 2VVKA 4XT1B 3CCVA 3ZEHA 2PQAB 4DV3Q 2HDMA 3GP7A 4X66L 3OYCA 5LJ5f 1J3TA 2L9HA 1UUPA 3F2CA 4LF7Q 3CMEQ 1LVKA 5IT9L 2E5KA 1PVOA 1OQKA 1STYA 4K5VA 2Z4HA 2FHDA 4DNIA 2FEIA 4A4IA 2QQAA 1SNCA 4POFA 1X3PA 1YNJD 3EHRA 2WKDA 3HRZC 3JAMi 1CTMA 4XTUA 5BN5A 4QCLA 1AE2A 4JS4A 1E2VA 5GAGC 2ZCFB 2EVBA 4A3GB 2UXDQ 1PXUA 1NBEB 1KD1R 4XTCS 3W3AA 1B2TA 3DWQA 4G7OC 1CUKA 2IIMA 2QI2A 2ZT9C 1RADB 4FDBA 3OYNA 4J8QA 5EBDA 1O9SA 4IQZA 1PRTC 3MEWA 5J26A 3V7RA 1TWGH 1PSEA 2SRCA 2F2VA 2LXKA 4JPBW 5JEAH 5M3FG 4C0GA 2C0IA 1VMPA 2HBWA 3S17B 5EKIA 2XTIA 5IWAQ 2MWOA 2MFIA 1IGUA 1ABOA 4C1NI 5KYWB 2VC8A 1EYCA 1X3QA 5M3MB 4E2FB 3OW2A 3NK9A 1KSWA 5ISRA 1I81A 4I7AA 2GVBA 1KDBA 4POGA 2RHUA 3GOXA 3MP1A 3U9SA 3HFOA 3QYHB 2DD4A 3JCMb 1BXTA 1VF7A 4BE0A 5LJ3d 1VQNT 2GF7A 3RUXA 2KCTA 1B44D 3NFCA 1Z7TA 3R2IA 5LJ3j 3HKSA 1GXDC 3HS0C 4ZKCB 3SWNB 4B9XA 3A5ZB 2DF6A 1NR4A 1D0XA 5IGCA 2YUOA 3CCQA 1VQPQ 1Y96A 1ENCA 2A6HC 3FKIG 4P2CB 2R92H 4Q5WA 3OYIA 2HKNA 4HCBA 1U8RA 2YLCA 5DNFA 3CC4T 1SYEA 1DGSA 2PI2A 1H3ZA 3IRBA 4X6AH 1KXLA 5KYIA 2PMZB 4DQ2A 2FFKB 4IUNA 3DB3A 1M90R 5CR3A 2BE9B 4OX9Q 4Y92A 2K4KA 4DUYQ 1Y1WB 4LE9A 2HL3A 4PMCA 2PQWA 3TRZA 5GADC 3QOLA 4XU2A 1ZEQX 2VQEL 3HOWH 2CCZA 2FMCA 2Y0SG 2XVSA 3V8KA 1W2BA 4BY1B 1TS4A 4KGZB 4UP9A 4XTVA 1IBKL 1K8AC 5JJIA 1XNRQ 4B3RL 3FVQA 3CCST 2RK1A 3VDYA 1KK7A 4PFZA 2OAUA 5CQYA 4JBMA 1L2FA 1FNUA 2K5DA 1YI2A 3EFSA 3OBYA 2BE7D 2D0QB 1B34A 2HNIA 1PMRA 2IJ0A 1ML0D 3CCJA 2G9HD 4ABNA 2DA9A 1UEBA 1ZBXA 5D14A 1G291 3FKIB 3VA5A 5GANg 3PO3G 2QCPX 4DK1A 1EEFD 4JYAL 1BBXC 2I07B 4DR4Q 1WTOA 3I5SA 3A0JA 2ABLA 3PO2H 1K0XA 2RQTA 2JA9A 2M0OA 4HSPA 1QP3A 5IGFA 2NTSA 4A3KH 3E19A 4C92F 1NSNS 4X64Q 4A3DH 1T0HA 3S16B 3T4AC 4L5TA 2JA7H 4RCNA 4KUIA 1JU5C 3SK5A 3JV3A 3D31A 4C3IH 2OQKA 1DJRD 4E6IA 2JQOA 4PNOA 5KYYA 5IP7H 1XPRA 2HIXA 3JSCA 2J6KA 3EAEA 4OMMA 2Y4YA 2WSFE 4C56C 3Q24A 2EBPA 3M3YH 4C5GA 1FGUA 1Z9QA 3C1FA 1SBBB 3SFMA 3OYBA 1STBA 4QJFA 4FIBA 1YBYA 2R3ZA 4CC3A 3BYYB 4IFDI 3U4ZA 2XRQD 5C3EG 1IL2A 4JI1Q 2MQHA 1YCYA 4KLKA 3NE5B 1VQIA 2E70A 3PVLA 5C5LA 3E6ZX 5D3IB 3S15B 4F7UF 3DUZA 1HUNA 1MMDA 4JBJA 1VUBA 2X69A 2CZ1B 1B7TA 2F69A 2AUKA 2DAQA 5T1IA 3OS5A 2OTLT 2RK2A 4PL6A 4PJNA 3NXWA 4YHHL 2HDLA 3J7A5 2NUZA 2J7IA 4E7SA 2F0MA 4M75C 4C0DB 2LDMA 1TR5A 5C4JH 4A3FG 2RH2A 3FB9A 1XWEA 1VQOA 2PZ1A 1R8OB 2HCCA 4F17A 4IPGA 3UA6A 4R8IA 1LTLA 2E2JB 3HOZH 1JB3A 2D62A 2B8GA 4LF5Q 3GTOB 4J6HA 3ZBDA 3G4ST 2K5NA 2WV6D 2L0CA 1M2VB 2E65A 5GANd 3REBB 3KLRA 3A7AB 3E0JA 2RHIA 3A8LB 3EGDA 4R9WA 4A3CG 2YU9B 2ROLA 5GANj 1BCMA 2RJEA 1LT3D 3NBHA 1U4LA 3OS2A 4AQYL 4PJOB 4BD3A 1YJ9Q 2QQSA 1JXOA 3VRYA 3I35A 2HEQA 3GTGB 2GBQA 4PK4A 3D4RA 1SYBA 3QPHA 2YT6A 3BDCA 4ZUJA 1PRTD 5ELNA 4GN3B 4M78F 1NE3A 4I7ZC 1UG1A 3I70A 4DFAA 2Z4IA 1E22A 2K50A 4Y7NB 1VQKT 2VB2X 3TS0A 2YUQA 2CQOA 3LGLA 4A4GA 2ZPGB 3QBYA 4EQOA 3KLWA 3FDRA 2TSSA 2UUAL 3GO5A 1NCVA 3J7ZC 1CA5A 2L4NA 2OEOA 3D7SB 3SGIA 5LL6S 2B29A 3S17H 2KROA 5FLXL 3JCMW 3JAML 4OMOA 3SXHA 3I90A 4DAMA 1PSFA 2A6HD 2FZKB 1PTOF 1D1IA 3S1MH 2C0OA 1BIAA 2VXEA 1VQNA 1GL5A 1WD0A 1PH9A 4LDUA 1KC8C 1FJGL 5G3LF 4F14A 2JTFA 4DR7L 1NG2A 2A08A 2MCNA 2UUCQ 4A4EA 3ER0A 1NTGA 1LNXA 3BDLA 3CC4A 3PT9A 1GBQA 1CHQD 3PTAA 4K6DA 2ZJQA 2CKKA 4IFDJ 2F0JA 1RCVD 1JE5A 1LUZA 2K6AA 2L12A 3M85A 2OTJT 3VR2A 4LFCL 3PGZA 5CV8A 1QKWA 1R4PB 1DCZA 3BG3A 2FYKA 4UDUC 3UT1A 4H7BA 2YRVA 1M1FA 3I91A 2BIVA 4KKUA 1TY0A 1BVSA 2E2HB 5EAYA 1Y1WH 2D5DA 4PZ6A 1CM9A 1JOQA 2Y4XA 4F7UA 1OI1A 3CMAT 1CKMA 1GOZA 4M75E 5M3FH 3S14B 2X6GA 4UY8C 3I4MG 4BE1A 1SPKA 1TQOA 1XNQQ 2ZPBB 4OGEA 3CCSA 3MZ5A 2DLPA 4A3LG 4EMHA 4A4FA 1N9WA 3I4OA 2DNUA 1K8GA 4K8IA 2VNUD 3KF6A 1S5FD 3SWNC
chains in the Genus database with same CATH topology
3H3VI 4CRIA 2LCCA 5D6YA 1WJRA 1X55A 3FKIH 3X26B 4P73A 2QTXA 2GVAA 1G6PA 2Q2IA 1IXRA 2E2IH 2ZJRA 3CC7A 3WVEB 1P16A 2F5KA 3CBPA 3MCAB 4OO1I 4M78A 1M9SA 4BI3A 4HJ8A 3S16H 4LFBL 2L89A 3Q8DA 5GMKl 3BJUA 1VQFA 4JI0Q 1C0AA 1Y1VG 2JA8G 3BFMA 2ATWA 3E9HA 1UE5A 1WGSA 2DXUA 3HRSA 4OWTB 4LF4L 3GTJH 2E5LL 4DR3Q 1VQJA 2PVDB 4OWWB 3CPWS 3N5BB 3PIOA 3PO3H 3G48A 1M1KU 1HZ9A 2XD0A 1IBML 1MGQA 4C92G 3HOYG 2VXFA 4M75D 1I6HH 3S3NA 1A0IA 2QQBA 3RZDH 3S15H 3X25B 4BE2A 3OYEA 2OTLA 1M5Q1 4A75A 1G5VA 4DV4Q 3JCMP 1EYGA 4LF6L 3ERSX 1IZ6A 2QDYB 4LFAQ 2VQFQ 3HHTB 1Q7YC 4DV5Q 3L2ZA 2CZ6B 5EG2A 3G4SA 1QUQA 4N4GA 5KCOA 3FEOA 4KHZA 3GTOH 1KRSA 1PHJA 4V2SA 1EIFA 4E47A 2YU9H 2NN6G 4X65L 4JI2L 4GLKA 4F7UG 3JCMc 5CO7A 1QVGS 5C3EH 4Y52H 1HXDA 2CWPA 4J6WA 4HIDA 4C92B 2X4WA 2PMZE 3TEHB 4C0DC 4JS5A 4B9WA 2BA0A 1XMOQ 1L0WA 5GAN3 4E7IA 4Y7NH 4OP0A 4A3FH 1VQHA 3CF5A 5L8RE 4R4IA 3UWNA 3GF5A 3OYAA 2V1CC 2JA5G 4JLGA 3JCMQ 4PJOC 1V1QA 3T1YQ 4XAXB 4GKKL 4A3CH 1ASZA 5C0XI 4F7UB 2KAFA 4M78G 2DGYA 2K14A 3J81j 4HT9A 1S40A 2CFMA 1Q81U 4LWCA 2A7YA 3HL8A 2OTJA 2YTYA 4ZGEB 1OYXA 2XICA 3INZA 2XDBA 1X75C 2WACA 3EBEA 3K81C 4Y28E 4UP8A 2G3RA 3CMAA 4JI6L 1VQAA 3JCMf 1N32L 3S14H 4O2DA 3NTIA 4UC4A 4MNOA 2XG8D 2RB6A 3OS0A 3RLNA 4AH6A 3V7CA 3MO8A 4M78B 3JCMJ 4JV5Q 2DIQA 3I55A 2DKGA 2LCLA 2EWNA 2R6GA 3UE0A 3B6YA 4JI7L 3LLRA 5FROA 4VUBA 1HZCA 4XTZA 4AIMA 1QVFA 4FSXA 2LTOA 1KD1U 3C94A 3G6EA 1YIJT 3QG1A 3GIBA 1SFOH 5IYCG 1Q8KA 2RJFA 3I4MH 1N9RA 1N33L 2XDDA 4PLIA 1GXIE 4A3LH 1HR0W 1HZBA 4PKCC 2JA6G 1E7ZA 3U4VA 4PJOE 1KQ2A 3M57A 2PQAA 3UDXA 3EN2A 1VQDA 2JE6I 2EIFA 2ZPIB 4IOCA 2CZ7B 2DVEA 1SSFA 1L1OB 4IURA 1N27A 3SB2A 1WQWA 2PU9B 1X65A 5J39A 1X6OA 3Q1JA 1Y7XA 3M9BA 4DR1Q 1TWFH 1PA6A 2I5HA 3H6ZA 1Q12A 1BYMA 2V8JA 1Q82U 1M90U 4C5IA 3MP6A 4XTYA 5GQOA 5GAMf 2E6ZA 5A0LA 1Y1VH 1KIXA 2JA8H 1VQGA 3FJPA 3AQQA 2QQRA 1HNWQ 3E1SA 1HNZL 3G7ZA 4DV0Q 3UDFA 4RG8A 5AJ3L 1G51A 3CEYA 5GAMh 1YJNT 4HCZA 2LC4A 3LW5E 1D3BB 4C8QB 4UPAA 5LJ5g 3HOYH 3SWNA 2L3RA 3A8GB 2K57A 2ID0A 2QEXT 3M4QA 1YI2T 1UGSB 2E41A 2VYTA 3CCJT 3AHUA 4M7DF 2EYQA 2LRQA 1JB7A 3JRZA 4DV1Q 1KRTA 3JB9F 3PNWC 1HNXQ 3FP9A 4PJOF 4DR2L 4C92C 2DO3A 2GN5A 1EIYB 4QQGA 4QQDA 1MJEA 2DK3A 2EQKA 1U1SA 5GAN5 4ME7A 3CAMA 3GNFB 4L6V5 4BA1I 4GY5A 2HIVA 2CWAA 5FRMA 3FRNA 4X34A 2NZHA 3GTMH 3C4SA 3RR5A 2EJGA 1I50H 4NXML 3LH0A 4ZGJB 1GD7A 4QW2A 2ZJPA 5CQXA 1HK9A 4JI4L 4A53A 2JA5H 4GKJL 4X9DA 4N4HA 4QVCA 3G71T 4PZ7A 4JI3Q 3M5AA 2UXBL 4A3GG 3L2QA 2I5LX 4ME3A 2WSCE 5LJ5d 1PH6A 2LQKA 4XU3A 2RHXA 4QY7A 4ALPA 5LJ5j 2MF2A 1WJQA 2F4VL 2LVMA 2FXQA 4RKUE 4DA4A 3CCET 2R7FA 3GP8A 4R55A 2X4XA 1VQOT 3M56A 4K0KQ 2DUDA 2B3GA 3HSBA 1V9PA 2KHJA 1I94Q 2LT4A 3K0XA 5M3MG 4M7AF 3VUZA 1YIJA 2JK8A 3K8AA 3HOXH 2RHQB 2BKDN 4IUTA 4B3TL 1ASYA 3J80c 4IO9A 1RIPA 4R4CA 4M77B 5GAOm 4ZTFA 4FU6A 4M78C 4OX9L 2CS7A 4DUYL 1HR0Q 4YTLA 3S2DH 2BA1A 3ME9A 3F70A 4QGUA 1YJ9A 1T9HA 3OTOL 2QGQA 3STBC 4C92E 3QSUA 1Y1WG 2K5HA 4PJOA 3ASKA 1VQ5T 1Y71A 5CKFA 1LOJA 3RKYA 4JI8Q 4TQUS 1OXVA 4BY1G 5IP9G 3OB9A 3J81E 1O7IA 3M58A 1PYSB 4DR5Q 4XK8E 5IYCH 2K4YA 2JOYA 4IPHA 1GO3E 3E9GA 5IT9c 4BBRG 4YWLA 1K83H 2D0PA 2VV5A 2JA6H 3T1HQ 3MXNB 4F7UE 1L1OC 1FX7A 1N34L 4EDUA 1YJNA 1VQEA 3GPLA 2DZ9A 4JI5Q 3RMSA 4OB2B 4GN5A 4X66Q 2BH8A 3GD7A 2QEXA 4IUPA 1Q1BA 3HP9A 4HKEA 1SR3A 4GN4B 2A8VA 2P0PA 2MWPA 4A3EG 4DR6L 1WPYA 4C92D 4QQ6A 4WJ3M 2JZ2A 1X3FA 4YCUA 3M9QA 4M78E 1W4SA 2NVXH 2MI6A 3EIVA 2NVYH 5LJ3h 3CC7T 2AHOB 3M4YA 2JVVA 2JEBI 5HKCA 2XGTA 4MZPA 2Q2UA 4PMWA 4M7DG 3TREA 3LWHA 3J81i 3OYDA 1CKNB 4DKAC 5HK0A 2GCXA 1YITT 1EFWA 4IFDG 1S72T 1YJWT 1JB0E 4PJOG 3JB9I 2O01E 2ASBA 1ZHIA 2KMTA 2D9TA 3G71A 4NB3A 3JCMV 4GNXB 2QXFA 2EJ9A 1J5EL 4OWXB 4OGCA 3OA6A 3JC66 3FLGA 1XNIA 3L42A 3QO3A 4RG2A 2CYZB 2IG0A 2R93G 4BI4A 2VQEQ 1QP2A 3CCEA 3L2RA 5LMNL 3CBMA 5IY0A 3U50C 1IBKQ 4B3RQ 4XU0A 4M7DB 2K75A 1XMQQ 2OCEA 4FT2A 4HJ9A 3CCMT 2P0KA 2K3XA 3PF4A 1B8AA 2RO0A 4BXXG 3TQYA 5CKBA 4ATOA 2VZAA 1VQ4A 3W1BA 4M78D 1Q46A 4X62L 4GOPB 1NZ9A 1P8LA 3GLXA 1Z9FA 4JYAQ 1PYBA 3M4PA 3RIRA 2PNHA 3STBD 1OZ3A 4LDVA 2LSSA 4A3GH 2XIDA 3X28B 1PFSA 1WNLA 3QJ6A 1EQQA 2Z0SA 4JRQA 5GAN4 4E7KA 4A3BG 3I2ZA 3S2HH 4RMFA 2XHCA 4M7AG 1KQ1A 5DLQE 1VQ5A 4A76A 1XPUA 4IJHA 1FWZA 4XU1A 2DXTA 2HD0A 1VQLA 3F8TA 5LJ5e 4C92A 3QXEB 5M3MH 3ULLA 2WSEE 2F3IA 3ICEA 1PH5A 2WAQG 3M54A 3AFPA 2MO1A 2M9UA 4ZN3A 3K80C 1B70B 2O4XB 3OYYA 3JB9J 4MZMA 1OTCA 1G3SA 4DOWA 1M1KC 1UE6A 5GANh 4YHHQ 2VW9A 1SROA 4RMOA 2RCNA 4BUGA 4WJ4A 4B3ML 3A8HB 4M7AB 3TS2A 1VQMT 2K5IA 2IVWA 2EFIA 1X56A 4BY1H 5IP9H 3JCMX 4AQYQ 3SDZA 3KDFB 3JAMc 1O75A 3P8HA 2DTOA 1UGPB 3I55T 4E7HA 3PSIA 5DLOA 4BBRH 2KENA 5GMKj 1WOCA 4YY3L 4DV2L 3BDUA 4JRPA 3K7AH 4OO1G 2DXBA 4C8QF 5CVIA 3G6ET 3PF5A 2UUAQ 4AYBE 1OXSC 3CD6T 2L5QA 5FU7B 2EKOA 2E1HA 3FIFA 1YITA 3KYHC 1FJGQ 3CMET 1YJWA 1S72A 4L59A 3PGGA 3MEAA 4IPDA 3HPWA 3L1AA 1UGRB 2ZZDA 4A3EH 5C0MA 4LF8L 4QL5A 4LFCQ 2L8DA 1Q81C 5HGQA 3HOUG 4BDYA 4DV6L 3JCMg 4BY6B 4BDZA 4R1JA 5M5XH 2KVQG 3OSVA 1I8FA 2VS1A 4EMKA 4OB3B 3CCMA