1UEBA

Crystal structure of translation elongation factor p from thermus thermophilus hb8
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elongation factor P
publication title Crystal structure of elongation factor P from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 40
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1uebA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA03
4JI3Q 5FJ8G 3FKIH 3OW2A 1I5FA 1N32L 4BBRH 1YNXA 4K0KQ 4NB3A 1TWFH 3ZJYC 5IYDG 4DV1Q 1N36L 4LFBQ 1VQ6T 1BVSA 2HIXA 3KBGA 2DGYA 1TXYA 4DUZL 2QEXT 4A4IA 3J80c 1PH7A 1DGSA 4JI2L 1QVGS 1G51A 2Y0SG 3EBEA 3BZCA 3G48A 1CKMA 3U4VA 2B3GA 2VQFL 1SMXA 5FLXc 4HJ9A 3I56T 1HZBA 3UDFA 3DB3A 1OXSC 1L0WA 5IYCH 1HNXL 1HR0W 1YI2T 1MIUA 1IYJB 1VQHA 4DV2L 4ALPA 3WWVA 4JI7L 4YY3L 1WJJA 5J26A 1LYLA 1PA6A 4HJAA 3DB4A 2A19A 1PH8A 3VDYA 2DUDA 2JEBI 4HIMA 3CCSA 1V1QA 4JI6Q 1E3PA 3PGZA 4A3JG 1EIFA 1Q81U 1NY4A 3S17H 1X3EA 2K4KA 4BY7H 4TQUS 4A3DH 3K7AH 5GAHC 3T1YL 2RF4A 3HKZG 5M3MG 4KI0A 3KDFB 3STBC 2B29A 4LFCQ 2UXBQ 3HOVH 4DNIA 4JI0Q 3S24A 2K52A 2H5XA 3PSIA 5FLMH 4GS3A 1EYGA 3GTGH 1E22A 1SN8A 3RN2A 5C44G 3JAMi 3CMET 3TRZA 2MFIA 1XNRL 5IAYA 3PO2H 3PO3H 2MWPA 5BR8L 4YCWA 4QL5A 3GTOH 4DR4Q 2LCLA 3FP9A 4A3EH 3CC2T 1SRUA 1NMFA 3S1MH 1NJIU 5C3EH 5IT9E 3CF5A 1L1OC 2UUCQ 4JBKA 5AJ3L 1JMCA 2JA6H 3K8AA 4L5QA 1NBWA 3I55T 3I56A 1Q82C 4LF5L 2HT1A 5LMUQ 4GNXC 1YI2A 3AYHB 4J15A 1BBWA 3CCQT 4B3SQ 4A3BG 4R4TA 4YCVA 1IZ6A 1Q46A 4JI3L 5IE8A 3RR5A 2E2JH 3LGJA 4OX9Q 1D7QA 2MWOA 1VQJA 2YTXA 1X3GA 1QVFS 3GTLH 4K0KL 2JE6I 1VQPT 4LFBL 4JI1Q 4DV1L 1TWAH 2Z6KA 4R1JA 4KHPL 1N8RC 1AE2A 3W5OA 4IOCA 1Z47A 2E2HH 3JAMc 3AFPA 1KQSA 4AIMA 1SE8A 4XIGS 1MJEA 2UXDQ 1YHQA 3AQQA 3K7UC 4RG1A 4Y7NH 1L1OB 1JJGA 4A3JH 1XPRA 5JJLA 1Y1VG 1YVCA 4RMFA 2XTIA 1FL0A 4IPDA 4GNXB 1PHJA 3M7NA 4A3CG 3ULPA 5M3MH 2CFMA 3CMEA 1KRSA 2ZTDA 2WAQG 3UDXA 3PUXA 2JNGA 1M1KU 3E0EA 5C4JH 1EIYB 1NZ9A 3CC2A 4YHHQ 4JI6L 3E9IA 2VS1A 1IBLQ 4HIKA 4LF7Q 4A3IH 1ASYA 1Y1WG 4A76A 2VW9A 2OTLT 2JEAI 3GTPH 4LFCL 1L2FA 2KVQG 3K81C 1X56A 3TS0A 1HZ9A 1X9NA 3KLWA 4DV7Q 4DV6L 4B3TQ 4JI4Q 2VUMG 4JI0L 2K75A 3S16H 4UP9A 3D31A 4NXNQ 3Q8DA 1G291 1WFQA 5IT9c 4WJ3M 3G71T 1K0RA 3EIVA 3RZOH 1JT8A 3HOWG 1HNWQ 2ATWA 3CCRA 4DR4L 1PYBA 4ZN1A 4DKAC 3HOUG 2JVVA 1I6HH 5H1SE 4YY3Q 1VQAA 1VQEA 1V43A 2QGQA 1K9MC 3CQZH 1PH2A 1MJCA 1T9HA 1YHAA 3CCJA 2ZTEA 2KCMA 1YIJT 5LMUL 4TVRA 4B3SL 1VQ9T 1NMGA 4IJHA 4PMWA 3U50C 4QQBX 1EFWA 4OX9L 4BBSG 4DAMA 1XTDA 5LL6S 1CKNB 3CCUT 3D0FA 4Y52H 4LUOA 4AQYQ 2I0QA 3I2ZA 4IFDI 1KD1C 1CSQA 4JI1L 5C4XH 2IX0A 3CCVT 2K5VA 2PQAB 5C0XJ 4YTLA 4DUYQ 2UXDL 4R4OA 3SGIA 1SFOH 2HHHQ 3M4OH 4BXXH 3I4NH 2RCNA 3RNUA 2OTLA 3PCOB 3CCST 1X55A 4JV5Q 2ID0A 3HOXH 3TQYA 1YITA 2R7ZG 3DLLA 4JYAQ 4FDBA 2ES2A 1A8VA 1VQFA 4DV5Q 2WB1G 3G71A 2JA8G 4ME3A 1EQRA 1U5KA 2KCTA 4DR3Q 3CXCA 5JJKA 4POGA 2CQOA 4YHHL 1IBLL 4LF7L 1E1TA 3L0OA 3NENA 1YJWT 3ULJA 4JI4L 3CPFA 3ERSX 4P71A 4DV7L 2ZM6Q 1M1GA 1YIJA 1VQ7A 3W1GA 4B3TL 3HOZG 1VQ9A 3CW2C 4NXNL 4L5RC 2JUFA 3MXNB 1J5EQ 4A3LH 2Q2IA 1JJCB 1KL9A 1PYSB 1VCIA 2AWOA 4A75A 1IBMQ 4LFAL 3LGFA 3CCUA 1VS0A 3CPWA 2RHQB 1XPUA 1KAWA 4OWWB 5IWAL 1UE1A 3CCVA 4DR2Q 4DPGA 1E7ZA 1EWIA 4JOIC 2OCEA 1M90C 1G6PA 3KOJA 1N34Q 1E24A 2NVTH 1W2BA 1B70B 2R92G 1JJ2A 3PIOA 4DV3Q 1LTLA 4JBMA 3GTMH 5IYBG 1S72A 4L5SA 2JA7G 1YHQT 1HR0Q 2KBNA 3BJUA 2N49A 2G3RA 4KHPQ 4A93G 4AQYL 4DV6Q 1KIXA 3PF4A 4BA2I 4DV0Q 3UE1A 1PH3A 4DUYL 3UE0A 2HHHL 4P72A 2UXCL 2N8NA 1XNIA 1Q82U 2YYZA 4DR5Q 5A2QE 1YJWA 3E9HA 4BY1H 3OYYA 1GVPA 1JE5A 4JV5L 4X6AH 2F3IA 3F8TA 5FJ8H 3A5UA 4XTCS 4IO9A 3KDFA 1IL2A 4JYAL 4JI5Q 3CCLA 4DV5L 5IYDH 1NPPA 2I5HA 2PI2E 3HOZH 1C9OA 2E70A 1VQ8A 2KHIA 3TREA 3KJOA 4DR3L 3I4MG 1UWVA 2NN6G 4GKJQ 3A5ZB 1CUKA 2A1AA 4HIDA 1GM5A 3CCRT 2MI6A 4GLVB 2MQHA 2Q2UA 3HOYG 1BKBA 3F2DA 2K50A 1WCMG 1QZHA 1Z9FA 2YTYA 1YJNT 1XNQQ 2ZM6L 4GN5A 4BA1I 4POFA 4R4CA 1CSPA 1YJ9T 4KHZA 1UE5A 1J5EL 4A3MG 3P8BB 1VQKT 4PG3A 3CCJT 1IBML 1GD7A 3LGLA 4R4QA 4KLKA 1FGUA 2HIVA 5M5YH 2F4VQ 2JA7H 2R93G 4DR2L 4C3JH 3M4PA 1K3RA 2PMZE 3F2BA 2JK8A 3PUYA 5ELOA 5JEAJ 5DLQE 4OO1G 2UXBL 5J3BA 4QY7A 1N34L 2HQLA 3W1BA 2IHFA 4UP7A 3J7AF 4HJ7A 3S1RH 1FJGL 2GVBA 3KF6B 5C44H 4DV3L 1TWHH 2AHOB 5M5WH 1PH9A 1L1OA 2NVQH 1HR0L 3A0JA 3GTJH 2EQSA 2JJQA 5DM7R 4GNXA 3HFZB 1HH2P 1YITT 1VQNT 1SR3A 3H15A 4DV0L 4OO1I 1A63A 2AWNA 3J81E 3CXCS 2Z0SA 2ZJPA 2LSSA 3M4QA 1N33Q 4PZ7A 4LFAQ 2E6ZA 3M85A 4DR5L 5ELNA 4GLXA 1PVOA 4JC0A 5IP7G 3OW2S 3ULLA 3I4MH 4A3BH 4LUZA 3JC66 1YJNA 5IWAQ 1MKHA 1OXTA 1OXVA 3GTQH 3HOYH 4JI5L 1YJ9A 2KHJA 1WCMH 2N3SA 1HNZQ 2LVMA 5GAEC 1VQ4A 1VQKA 1KD1U 1VQ7T 1SROA 2YV5A 2CCZA 4LF6Q 1HZAA 2ALYB 3RLOA 1K73U 2IHEA 4GOPC 2MNAA 4JBJA 1I3QH 3CPWS 3B6YA 1PH1A 1WYDA 4JI8Q 4A3GG 5GADC 4GKJL 3T1HL 1WOCA 1KXLA 1NPRA 1M1KC 4GN3B 1QUQA 2BH8A 1Y1VH 2K5NA 4QQDA 2LXKA 1Q7YC 3U58A 4R4IA 4LF9Q 1XNQL 3FKIG 1K8AC 4A3CH 2QA4A 4MZ9A 1VQLT 4X64L 2LQ8A 3RLNA 4BBRG 1TWGH 2UXCQ 1S40A 3CCMT 1KC8U 1VQBA 4O2DA 3S2DH 3CC7T 2R7DA 1QVFA 2E5LQ 1JB7A 3H0GG 4LF8L 1EQQA 5FLXE 3AFQA 3KYHC 1S72T 1VQNA 1CKNA 2JOYA 1Y1WH 2F4VL 4GOPB 3I7FA 3H3VI 2VUMH 4PZ8A 1Q86C 3TEHB 2PQAA 1R9TH 2NVXH 4GKKQ 5IP9G 2EIFA 1VQMT 1U0LA 1TWCH 1Q12A 3MEFA 3IRBA 1O7IA 4YWMA 5M3FG 3HOWH 1IXRA 4LF4Q 3S14H 2RHSB 3G6ET 4IJLA 5LMNW 2B63G 3HOUH 2LXJA 2VZAA 2K14A 4X65Q 2I5LX 1CKOA 4BY7G 4A3DG 3KFUA 2N78A 1PV4A 4QJFA 1Q1BA 2UU9Q 5K36G 3FHWA 2L3RA 3CCLT 1SSFA 3RLFA 1I94Q 1FVIA 1N33L 1Y14B 1UE6A 4AH6A 1VQ8T 3GTKH 5FLMG 1AE3A 1QZGA 4DR1Q 4BBSH 5JJIA 1XMOQ 2KDSA 1VQLA 1QVCA 1X54A 4DV4Q 2Y0SE 1B8AA 1HNZL 1W3SA 3CCMA 1KQSS 4A3EG 1BBUA 2PI2A 4EQ5A 3CC7A 1A62A 3H3VH 1FJGQ 2A8VA 4LF6L 2OTJT 3BZKA 5C3EG 4IFDJ 2JA6G 3RZDH 4JI8L 1PH6A 4JBWA 3F2CA 4NPSA 1VQGA 3H0GH 1H95A 3DM3A 1YZ6A 2R7ZH 1C0AA 4LF9L 1XPOA 1VQMA 3HKSA 5HGQA 3K0XA 2D0OA 5JEAG 2JA8H 2MO1A 3NBHB 1I50H 2NVYH 4HJ5A 1XMQQ 1LM0A 5IP9H 3HKZE 2PNHA 3JAME 3G6EA 4C3IH 4DAYB 2E5LL 1YHBA 3AEVA 4P74A 1PFSA 5M3FH 5GROA 5GAGC 3M3YH 1VQOA 1GO3E 2Q2HA 4IPCA 4UP8A 2Z6KC 2B63H 2WP8J 4HIOA 4NXML 1X3FA 1EOVA 3G4ST 2VL6A 4IPGA 4L5TA 3J81j 3RN5A 3EN2A 4GKKL 4YWLA 4B3ML 1N8RU 4B3RQ 3KF8B 4APVA 2E2IH 4JOIA 4DR7L 4X62Q 4ZN3A 3STBD 2YU9H 1SLJA 4DR6L 3T1HQ 2D0PA 3OTOL 4A3KG 4LF4L 4H02A 3U4ZA 2ZJQA 1Q81C 2CWAA 3CC4T 4X65L 2KENA 2IX1A 4A3IG 2OTJA 1YBYA 1J6QA 1Q8KA 4P73A 4X64Q 1GKHA 1D8LA 2UU9L 4MNOA 1RIPA 1OXUA 1I94L 1VQ4T 1VQ6A 2AKWB 2L15A 3F1ZA 1VQDA 2NN6I 4IPHA 2QEXA 2R92H 4LF8Q 2UUBQ 3CMAT 1IBKQ 5IYBH 1PH5A 4X34A 4DR1L 4LW1A 4QIWE 1XMOL 1QVGA 1UEBA 2VY3A 3A74A 5LMNL 1C7YA 4DV4L 4O0AA 2UUAQ 4A93H 3UDIA 4A3FG 4LNQA 1N9WA 4TVAB 5GQOA 2VQEQ 1P8LA 1S3OA 2R6GA 5C0XG 1HNWL 1NJIC 2QA4T 2C35B 2ZTCA 1PH4A 3GDEA 1NE3A 1LUZA 1WI5A 2ASBA 2CWPA 3UDGA 1VQ5T 3G4SA 1P16A 2K5HA 4DK6C 4YCUA 2WAQE 1VQIA 4OXPA 4IOAA 4DK3C 1K9MU 1AH9A 3NEMA 4CRIA 4LUVA 3L7ZC 5C0XI 2NZHA 2F52A 3S1QH 4GN4B 3CCET 2MO0A 3PF5A 1XMQL 4OWTB 3TS2A 5C4XG 2CKZB 3KF6A 4RG2A 4X66Q 3S2HH 4EX5A 1E1OA 3CC4A 1HZCA 4BXXG 3I4NG 2JA5G 4A3KH 3S15H 2JQOA 3HOXG 1KRTA 4JG2A 1Q7YU 2V1CC 5EAYA 4B3RL 3GD7A 1K8AU 4C2MH 1EUJA 1N32Q 2YTVA 3CMAA 4A3MH 3PUVA 1A0IA 1N36Q 3I55A 1K83H 4X62L 1V9PA 3J81i 4DUZQ 1XJVA 3CD6T 4JI2Q 3CCQA 1X65A 4QGUA 2VQFQ 2R93H 2FXQA 4JCVE 1W2BS 1HNXQ 4HJ8A 3PUZA 2GVAA 4UY8C 2XHCA 4DV2Q 1VQPA 1JJ2S 2DO3A 1NTGA 1QUQB 1Q86U 4A3FH 4JI7Q 2AMCB 3ER0A 3L2PA 3J80E 1VQ5A 3I4OA 2VNUD 2CKKA 4IFDG 4A3LG 2UUCL 1K8GA 4AYBE 4OONA 1IBKL 2UUBL 5IY0A 2IY5B 1YEZA 2EXDA 2E8GA 5IYCG 1Q1EA 2R7FA 1RL2A 2WFWA 3CAMA 2ZJRA 1ASZA 2UUAL 2Q2TA 2OQ0A 3CCEA 4PZ6A 4NXMQ 4GLAC 4B3MQ 4LWCA 3T1YQ 3J7ZC 2VQEL 2OQKA 1KHIA 5HY6A 3S1NH 3J81c 5E7NA 4DR7Q 5M5XH 4DR6Q 4AYBG 3OTOQ 3BU2A 4C3HH 5IP7H 2WB1E 1K73C 4UPAA 2IT1A 1X6OA 3J80i 1UE7A 3PUWA 3PV0A 4GOPA 1XNRQ 4WJ4A 2JA5H 5BR8Q 3KJPA 1VQOT 3LH0A 2D62A 2GN5A 1M90U 3NELA 2BA0A 2BH2A 3GO5A 3HOVG 4OWXB 1HJPA 3K80C 4YWKA 1OXXK 2IG0A 1VQCA 2JA9A 3CD6A 3CP0A 2NZOA 2BA1A 4MTNA 3M9BA 4P75A 2OWOA 4X66L 5AJ3Q 2XGTA 3J7A5 1OTCA 4A3GH 4LF5Q 1KC8C 1B7YB 3PO3G 4BY1G 5LMNQ 3ICEA 3PO2G 3PIPA 2I5MX
chains in the Genus database with same CATH superfamily
4JI3Q 4IZ8A 1BCOA 3NP8A 1TS9A 3NPFA 4KUDK 5KGUA 4K0KQ 3V8JA 4HT8A 1TWFH 1N36L 2LNHB 1VQ6T 2EY5A 2HIXA 5DLOA 4CGYB 2QEXT 1PH7A 2EYWA 1QVGS 2VQFL 3H0FA 2F0GA 1CKMA 4UHVA 4QVDA 3RUXA 1K83B 1GFCA 3UDFA 3DB3A 4DV2L 3PMFA 4II1A 3WWVA 4JI7L 5LJ5e 5AYFA 2GBQA 4J8OA 2XDBA 1C48A 5KIXA 1PD1A 1D5XC 2KSSA 2HQEA 1LPLA 1LT4D 4CHTB 1PH8A 4IUQA 1WIEA 1KD1R 4JI6Q 2VXFA 2HKNA 5CKHA 3PGZA 4PLIA 1Q81U 1NY4A 4TQUS 1F9SA 1MD2D 3K7AH 5HGTA 2RF4A 3HKZG 2FB7A 2K52A 3TEEA 2H5XA 1STBA 3PSIA 3LW5E 3S1NB 2KMTA 3GF5A 3CMET 1KABA 3M0UA 2MFIA 5M5XB 4M7AG 2MWPA 2ZPHB 3WXMB 3Q22A 1ZEQX 1SRUA 4JZ3A 2L89A 1NJIU 4UC4A 3KF8A 1NLPC 2UUCQ 1WTPA 1F2YA 1NBWA 3HFNA 2VVKA 4QKUA 4XU1A 4B3SQ 3SWNB 4YCVA 4PKCC 4O42A 1HTLD 2F1MA 2OXPA 4HMIA 4KJNA 4JI3L 2YT6A 5IE8A 4OX9Q 2VC8A 5GAMj 1G83A 2ZXOA 2C0TA 1VQJA 3WVEB 5JEAH 3GTLH 4K0KL 1H9SA 1QW1A 1VQPT 5GAOm 1FNUA 4JI1Q 3OBYA 1DZ1A 1N8RC 3W5OA 1M4ZA 4IOCA 3GBQA 3AFPA 3VRZA 4XIGS 1PRTD 4F7UA 2F0MA 3AQQA 3OQ5A 3C46A 4ORZA 4A3JH 5JJLA 4K6LA 5IHIA 2CZ7B 5CCAA 2XTIA 1FL0A 4GNXB 4C92B 1E2VA 4A3CG 1WFWA 4JS4A 2CFMA 4RKUE 1NUCA 2EGCA 3TQ7P 1CQVA 5KYYA 5CV5A 4ID6A 4I65A 2JNGA 4JI6L 1QVFP 1NZ9A 1SHGA 3CC2A 2XNAC 4XT1B 1VYUA 1XWEA 3G1JA 1ASYA 4XTYA 2B2WA 2E3HA 4LDUA 4PJOA 3M59A 4KHPL 1HZ9A 3A98A 4K2KA 3BYTB 1ZA1B 1D1BA 5DM63 2K75A 3S17B 2VYTA 1STYA 4A3DB 3D31A 5FU6C 2ENBA 2HL5C 1KG1A 2F5TX 1LTSD 2PZWA 1WGSA 4QCLA 3EIVA 1PG5B 5IT9L 3HOWG 1DM0B 3CCRA 2ATWA 4U673 3HOVB 5E4XA 4ZUIA 4ZN1A 4N9TA 4DKAC 2JVVA 1T0HA 1VQEA 3NE5B 3VS2A 1ILQA 5A0DA 1TT2A 1PH2A 4C0DC 2K04A 3GTOB 1I4HA 1YHAA 1X2QA 4M75B 4M78F 4XTWA 1SYBA 5F2DA 1N8RR 4B3SL 5C3EB 1I4QA 1UGSB 4PMWA 1PTOB 1EFWA 1K9AA 4OX9L 2RK2A 2JA6B 1XTDA 5GMKh 1YNZA 3OS2A 1LLRD 4AQYQ 4JI1L 2F2VA 5JVH3 2E2JB 2IX0A 3CCVT 2PQAB 1MMGA 5FK9C 1LT6D 4YTLA 1MBYA 3X20B 4C0GA 4JW0A 4DUYQ 3MTSA 3HTRA 3EFXD 1RAHB 5KYXB 5TSSA 5JPMC 1OX9A 3RNUA 2OTLA 1TWAB 1AZPA 2QG9B 3L2ZA 1X55A 5I6WA 2J6KA 4JRIA 5GAMh 2A68C 5C5MA 3UI2A 2R7ZG 3UPUA 5C4ZA 3OYJA 2ES2A 1ZUKA 4M7AD 2OJ2A 1VQFA 4B08A 4Y7NB 4DV5Q 4YIJA 4B9WA 1CQFA 3TCJA 3EFSA 2J6OA 2H4OA 1EQRA 3Q0AA 3VJPA 2EZVA 4POGA 4J6YA 1TS2A 1KJWA 3JB9F 5FO9B 3L2WA 3S3OA 1E1TA 3L0OA 1W70A 4KH0B 1YJWT 4Q0FA 1EZ6A 3TN2A 3H94A 5C4JB 2D1XA 4ILWA 3ERSX 2XK0A 4A3CH 1VQ7A 1YIJA 1O78A 2H8HA 1VQ9A 3MEHA 2H3EB 1QWFA 4M75E 5GAN3 2HEQA 3EQLC 4ULLA 1J5EQ 1JJCB 1PYSB 4WJWA 1VCIA 2DNCA 3BVMA 3FPUB 4MZMA 2O31A 3LGFA 1YWOA 2DZ9A 3JCMV 2QXFA 4DBRA 2IL8A 3S16B 1RTOA 4Z89A 1E7OA 4ZGDB 4KY5A 3HRUA 5CR2A 2DBKA 3MFYA 4BI3A 5C3XA 1VIEA 2OCEA 1PRMC 4QVCA 2V1QA 3SK6A 2EYLA 2K5WA 4DNRB 1W2BA 1Q7YR 2L9HA 3KXTA 4C1NI 3BW1A 3CQZB 2LQWA 1KLUD 2JA7G 2KBNA 3FEWX 4ME7A 2N49A 4ZTFA 4A93G 1B07A 1DOMA 2PMZB 4DV6Q 1BR9A 4AQYL 3PF4A 2CREA 1UHCA 4LNPA 2MHVA 3R2TA 4DUYL 2QGGA 3BVGA 2XVSA 4P72A 5A2QE 5C4XB 1Y07A 2OX7A 3OYYA 2DTIA 1JE5A 3CC7Q 3FPPA 1B7TA 1EY4A 2L3PA 3DEOA 3A5UA 4XTCS 1VIFA 1EEID 4IO9A 4BY6C 1S72Q 2KT8A 2ED1A 2ZAEA 1ESRA 4DV5L 1M1FA 4M7DC 3ME9A 2DY7A 1PKTA 3HOZH 2E70A 1LCKA 3QSUA 1IXDA 1JC7A 3TREA 2KHIA 1VQMQ 3ZBDA 4GKJQ 3A5ZB 4I7AA 3T56B 3UA7A 2B8FA 1X75C 2MQHA 3HOYG 1BKBA 3G6EQ 1GXIE 2E41A 5GANj 4XDXA 4R4CA 1J5EL 4ELYC 2CP0A 1VQKT 1WXUA 3CCJT 1IBML 3SWNA 3NHNA 3LGLA 3JCMg 2P0KA 2F3WA 3X28B 3MPUB 3JCMd 1FGUA 1Q8IA 1T3SA 4KLKA 2QQRA 3T13A 4L6V5 3EG0A 5CO7A 3M4PA 2PMZE 3F2BA 2JK8A 4OO1G 1RJTA 5T1IA 2WIIB 2IHFA 1EYCA 1ZA2B 4IN3A 1BCMA 4HJ7A 1FJGL 1M8AA 4LXCA 2RQRA 4HSPA 1TXQA 3KF6B 3PMTA 1DCZA 1TWHH 3QB3A 2NVQH 1EWHA 3OWFA 5EKLA 1HCZA 3DKMA 2O5JC 4KTAA 4XK8E 1ZSGA 4LN2A 4GNXA 4C92A 4OO1I 1BF4A 3JCMc 3QG1A 4Y91A 4CKCA 2VB2X 3J81E 2LSSA 2F0JA 1VA7A 4AG1C 5C6AA 1PVOA 1I1JA 5IP7G 2Z6BA 3H41A 3I4MH 1EIHA 2EFIA 2Q8IB 1EY7A 3OYCA 1OXTA 2FZCB 1OXVA 1VF7A 4NOYA 3GTQH 3BVZA 1YJ9A 2EGAA 4H13C 1E2WA 5GAEC 3PFSA 3NFCA 4E7JA 1GFDA 1R4QB 1SROA 1U9RA 3KUPA 4LF6Q 4X3TA 4EMKC 4GOPC 4XT3B 2MNAA 1KQ2A 2F0NA 2K03A 4A3GG 1HD3A 1K8MA 5GADC 4GKJL 1TS4A 1FNVA 4DGZA 1ONLA 1SRMA 2XWBB 3LX0A 2K5NA 3H0IA 5ECAA 2LXKA 2X6LA 4O5VA 3CC4Q 3FKIG 3M0TA 1K8AC 2F0WA 4GY5A 4MZ9A 4XXEA 3V96A 3RLNA 4M78G 4M75A 1TSFA 2UXCQ 1I4RA 3CCMT 1KDAA 1KC8U 1S40A 2DEQA 4C56C 1VQKQ 4KMUC 1Z6HA 2C9OA 2NB0A 1D0YA 3MVVA 5I11A 4RGTA 1BI0A 2JOYA 4OMQA 1EY9A 5GANh 5ELDA 3AT1B 1O80A 5CQYA 2L5QA 1QWYA 5GAMe 2PQAA 1J9OA 2JA7B 2KRSA 3OYAA 2EYHA 4F8MA 4C3JB 2YUPA 4C8QD 2EYYA 3MO8A 1HTPA 1O75A 5IGBA 5LJ3g 2EWNA 2X51A 5KYXA 5M3FG 3HOWH 4JDSA 3OIPA 3S1RB 2RHSB 4IJLA 2B63G 1LTRD 2VZAA 1UE9A 2FPDA 1PWTA 2HD0A 2IVWA 5CKFA 1CKOA 2XG8D 4QJFA 3K6OA 4E6IA 1HRJA 3FHWA 2L3RA 2L0CA 1C6VX 2BE5D 3GTJB 1UGVA 3OB9A 4FYDA 1VQ8T 3EHRA 1WDXA 3JB9G 3FDTA 2IIMA 8AT1B 1XMOQ 2L5TA 5C0MA 1X54A 4RTYA 4FYYB 1GUOA 1RUWA 2LT1A 1PD0A 1KQSS 4A3EG 1BBUA 3H3VH 4CC7A 1WA7A 1D2BA 4LF6L 2QYZA 2OTJT 1MSGA 4IFDJ 5CORA 3HOYB 4N8FA 2LFNA 1GL5A 1J3TA 2F0LA 3JB9I 5NUCA 4J5YA 1DXMA 2EQMA 2DETA 4NPSA 1VQGA 3H0GH 3F2CA 1H95A 1YZ6A 1UGQB 2R7ZH 5I21A 1I3QB 3A55A 2LX9A 4KUIA 2RCFA 1IL8A 5FLXL 2DFUA 2RF0A 2NVYH 1MUZA 3QIAA 2PNHA 1M4VA 1YHBA 4C0FA 5BN5A 1TWGB 1VMCA 4EGVA 5GROA 3HP9A 2BE7D 2HL3A 3P8DA 2PW7A 1GO3E 2DXTA 4FF4A 1HFNA 5GAOn 4NXML 3G4ST 1WQWA 3J81j 4HA8A 2D6FA 2JXMB 2IWHA 1ZX6A 2G9DA 4APVA 2KQWA 4JOIA 4DR7L 2HDMA 4ZYSA 2V8JA 4ZNXA 1EU4A 1SLJA 3STBD 3T1HQ 2CHBD 4DR6L 3TP7A 3OTOL 3M53A 3FMCA 3T4AC 3U4ZA 1X6GA 1MMNA 2JS0A 1STHA 3A7AB 2ATCB 4ZTJA 2IX1A 1V1PB 2HUGA 2O5IC 2AHJB 5L8RE 3U23A 1VQOQ 2EE1A 1VQ4T 4DQ2A 3OYDA 1VQ6A 2LY7A 2NN6I 4IPHA 2QEXA 1B34B 2DNEA 4H7BA 4LF8Q 2K57A 1G6ZA 3CMAT 1GOZA 3DM1A 1EYAA 2QW7A 4LW1A 1XMOL 1C7YA 2IPOB 2MK5A 2XICA 3INZA 3EG9B 2UUAQ 4A93H 2E76C 1JB0E 1RTNA 1Y57A 5GQOA 2A6HC 2LTOA 2KCNA 5EKIA 1S3OA 1WYXA 2R6GA 4A3GB 1XX8A 2QA4T 2C35B 4OVAA 2OTJQ 4HR7B 1PH4A 2WACA 2DPPB 3N52A 4R55A 2RSOA 2CWPA 3UDGA 1JB3A 2E64A 2COWA 1P16A 1X43A 1EZ8A 4M78B 2X4JA 5IH2A 4N9PA 1F9PA 1E6GA 1WHMA 2FZGB 3VYHB 1GUSA 3L7ZC 1OU9A 2NZHA 3X3NA 3S1QH 3MEUA 2CH4A 4GN4B 1CI3M 4OWTB 4DN4M 4C3HG 2EVRA 2B2UA 3KF6A 1A15A 3S2HH 4F04B 5IHNA 1D1IA 3A54A 3I4LA 3M58A 2MJ8A 2X6GA 2JQOA 1YCYA 3EGUA 3K0YA 2RPNA 4JRQA 2P0PA 5M3FB 1K8AU 4C2MH 1N32Q 5GJVB 2V1RA 2L12A 2YTVA 2B63B 3PUVA 4A63B 1A0IA 4M7DE 4DUZQ 1RDPD 2QTXA 2J0TD 3CD6T 2RJEA 3V7SA 2HSEB 1X65A 2PNIA 5DAUA 4BS9A 2CUDA 3R6OA 4JCVE 2DVEA 3MEAA 3IL8A 3SK5A 4CJ1B 4OGQC 1HNXQ 2EQKA 4IKFA 2XHCA 1Y8NB 1VQPA 1UNSA 1LT5D 2PTKA 1PRTF 3ER0A 1EYDA 1F9QA 3ZYYX 2VNUD 4IFDG 3VR5A 2DLPA 3OOCA 1QKWA 2K5LA 2AIRB 2ECZA 1PFBA 2E8GA 4A3EB 4C0ZA 1ASZA 3CAMA 1RL2A 2WFWA 2UUAL 2Q2TA 4FYXB 3CCQQ 4NW2A 2Q8RE 4LWCA 3Q6SA 3I70A 3WDNA 5GANe 5KYWB 3E19A 4AYBG 3AMUA 1L0XB 5IP7H 1K73C 4FXKC 1X6OA 2FZKB 3QYGB 1P92A 1UE7A 4R8IA 2JA5H 2BH2A 4HT9A 2KJXA 2BOSA 4G4KA 1SXTA 5I9OA 4O1NA 1OXXK 2IG0A 1VQCA 3QKJA 4QUFA 2EGEA 2DRKA 1JXOA 4OF1A 2DJQA 4KULA 2BA1A 2F4IA 3J7A5 4A3GH 4XQ3A 3OYMA 1B7YB 1F1BB 2F0KA 1Q90A 1ZSZC 2HCCA 1HHVA 2I0QA 2BCOA 3MHXA 2I5MX 5I9PA 2K5DA 2EYMA 3HHTB 4ZKBB 3FKIH 5CK9A 3OW2A 2RQXA 1I5FA 1N32L 2DIGA 4A3KB 4PJMA 2OTLQ 1AZGB 2CZ0B 4HXJA 1LACA 1XTCD 3ZJYC 3M4GA 4DV1Q 4LFBQ 1H9RA 4DUZL 4EMGA 1VUBA 4A4IA 4BB7A 3CRLC 2Y0SG 2M0YA 3G48A 3J80L 1RCVD 3H6ZA 1HNWL 2R57A 5FO8B 5IYCH 1HNXL 2DTHA 1YI2T 1MIUA 5EJWA 2CZ6B 2QQAA 5IGGA 4YY3L 1WJJA 1Y71A 2DAQA 1SEMA 5J26A 1LYLA 4FW2A 1PA6A 2RJCA 3DB4A 3EGXB 5COYA 2JYOA 4S3SA 3X24B 4N4HA 1YIJQ 1K73R 4M7AF 1E3PA 2F0EA 3VYTA 4A3JG 2LZ6B 1FYNA 3SR1A 1E0BA 2NWGA 1IW7D 3SWNC 2EJGC 4DNIA 1JORA 4JI0Q 3FLGA 4GS3A 1D09B 1SN8A 3RN2A 4FW1A 1G3TA 3MHBA 3M57A 1RF2D 1X3PA 2PW5A 4EIKA 2ZPIB 3PO2H 3DWPA 4NP5A 5IIFA 4YCWA 2K32A 4QL5A 4C3HB 4JJNK 3FP9A 3CCSQ 2KEEA 4A3EH 1NMFA 1M30A 2RQTA 2JN0A 1NEGA 3S1MH 3CF5A 3OYBA 2WV6D 3D4WA 3EROA 3I56A 3GOXA 5LMUQ 3AB9A 2YHTA 4GNXC 1M3BA 4C92C 1G2SA 1S5DD 1ZYRD 4PMBA 4ZRZA 4A3BG 1IZ6A 2RD1A 1Q46A 3LNNA 1V1PA 3LGJA 2MWOA 4G57A 2WSFE 5GAN4 1M8VA 4F17A 1QVFS 1W6XA 2E4HA 2DNUA 1X3GA 1BCPD 2JE6I 3N6RA 4LFBL 4HCSA 4DV1L 1B34A 1B4OA 4DBQA 1AE2A 4TKOB 2DVJA 3OA6A 3FB9A 3JAMc 4F88A 3D8GA 2RSNA 5FWCA 1TWFB 2C5CA 1GUTA 2YWWA 3EG9A 5BR8Q 1XPRA 2B8AA 1Y1VG 1YVCA 4PL6A 4IPDA 1PHJA 4XU0A 4IIMA 1MV3A 3ULPA 2J7ZA 2E5KA 1HXYD 2LJ0A 4CJ0B 5M3MH 1QNKA 4RTTA 2XDDA 4BE2A 4HN7A 5DNFA 3ZEHA 3ND9A 1JQQA 4K8JA 1UHFA 1U4MA 4KY6A 5CYUA 3PUXA 4XYQA 1M1KU 2D9TA 4M78A 3E0EA 1EIYB 2QTVA 2ZPBB 2VS1A 3V7RA 1PFNA 5ELBA 1IBLQ 4LF7Q 4M75C 1Y1WG 3TP5A 1YHQQ 3HEJA 2LKVA 3K81C 3H91A 3G7ZA 2VB3X 3KLWA 1B3QA 4PJNA 3T9NA 1PTOC 4JI0L 4UP9A 3K7AB 5I22A 3C2PA 4NXNQ 3D6CA 5C5LA 5IT9c 2ZPFB 2XIWA 2DN8A 1KQ1A 4LD6A 2F0OA 1CKAA 4FVMA 1AEXA 3TSWA 1IHWA 4DBHA 2VB6A 2NYZD 4FYVB 1V43A 1ABOA 1TWBA 1K9MC 2D0QB 4DU9A 4ELZC 2EKOA 1T9HA 1O9SA 1SSHA 1MSHA 1RACB 5GMKi 3CCJA 2KCMA 3KLSA 4FYWB 4J7FA 5LMUL 2PUKB 5A0LA 4IJHA 4PZ6A 4QQBX 3OSVA 3U50C 1JE4A 2JZ2A 2IJ0A 3MFGA 3VA7A 1SE3A 2EQUA 2F2XA 4XTVA 3RMSA 4PJLA 3D0FA 5IOCA 2OF1A 1FMWA 2DBMA 2Y0SB 3I2ZA 1KD1C 2DKGA 2K5VA 2RA2A 3NQIA 2KOLA 1E6HA 2M2LA 4FM4B 2V8KA 1KFZA 1SFOH 3GTLB 5IGCA 3M4OH 3JCMf 1YJ9Q 2V8IA 2RCNA 4PMCA 2ID0A 2F0SA 3CBPA 1EY5A 3TQYA 5KE3A 2FPFA 1A8VA 5KYWA 3G71A 2K2VA 4A3JB 1U5KA 2KCTA 4A4EA 3PT9A 4DR3Q 5GAN7 2EPBA 5JJKA 2DL5A 1UGRB 1AOJA 1HQRD 2CQOA 3A56A 3H0HA 1IBLL 1U4PA 4LF7L 4PNYA 5CV9A 2HAXA 1M9SA 2XIDA 1CFMA 1TY2A 3I73A 1SNQA 1GUGA 4RA8A 4JJBA 3HOZG 2NLUA 1K9MR 1YITQ 1SNOA 4NXNL 4IFDH 4IUTA 3VS1A 1KL9A 2JW4A 2MP1A 3CCUA 4LFAL 1VS0A 4FXGC 4ANJA 5IWAL 1ZSZB 3MXUA 3A8IE 4JOIC 1XJWB 1M90C 3LWUA 4X3KA 2AQ3B 3KOJA 1N34Q 1Y69U 2NVTH 3VU3C 2EDGA 1JOKA 2R92G 2CW0C 3RKYA 1JJ2A 2E1HA 2F69A 1FMVA 3MP6A 3QOLA 4CDDC 1U1TA 4DV3Q 1SF9A 4L5SA 2JT4A 4J9DA 4FL6A 3BJUA 4QIWB 2AQ1B 4EDUA 4LMQD 4KHPQ 4C8QF 1OYXA 1KIXA 4C1NK 4DV0Q 2F0HA 2PQWA 2KNBB 1PH3A 2QCPX 3EGXA 1JEGA 1OULA 1RI0A 4XU2A 4DR5Q 5FWBA 1WXTA 4P2CB 3PNWC 1AD5A 5GMKj 3QDFA 4A53A 2HDAA 1K8OA 5E1FA 4JI5Q 4AFSC 1PSFA 1V29B 1DYQA 4CDEC 2I5HA 1QCOA 1VQ8A 3EG3A 5LJ3f 2CYZB 4E47A 3L2VA 1AWJA 3KJOA 4DR3L 1Y1WB 5D3IB 3I4MG 2RBMA 2YDLA 1FXXA 1UJYA 3SXHA 4HIDA 3L1AA 2M9UA 3JV3A 4GLMA 1GM5A 3QIIA 4KN4C 3F2DA 2BZ8A 2L3SA 1Z9FA 4FSXA 2GTJA 2LP5A 4X9DA 1SYFA 2B2UC 1IYUA 3LWEA 4J83A 5JVG3 4EQPA 2M02A 4GN5A 4WF2A 3TSSA 2X3WD 4BA1I 5ISRA 4RWSC 4JZ4A 4KD4A 1M90R 1N9SA 2Y4YA 1A0NB 4A3MG 5I2SA 3CCLQ 4PG3A 1ZKOA 1GD7A 3P8HA 3S9WA 1QP2A 4RTXA 5LJ3j 3TSZA 3JCMh 5M5YH 3MXPA 1JXMA 1R0CB 2UXBL 1NSNS 3A7LA 2COYA 3M0RA 5DLQE 5J3BA 4QY7A 1N34L 2YRVA 2K6AA 3R93A 1U4LA 2GVBA 4DV3L 1MHWC 1PRTB 3D6WA 4OB2B 1LTBD 3QO2A 4OGEA 1KNEA 5A2QL 3REAB 2PVDB 2FPEA 1SYCA 1HH2P 4DV0L 1SR3A 3PIP3 1RAGB 1Z9QA 3ND8A 1BYMA 4LUDA 1OI1A 2AKKA 4HVUA 2ZT9C 4OEMB 2VGMA 3CU7A 2ZJPA 4GLXA 2E6ZA 1E2ZA 1C0MA 2CP5A 4DR5L 2W10A 1WD0A 4M77F 4A3BH 1OOTA 2EW3A 2CH4W 3QJ6A 4QW2A 1YJNA 2PZTA 2DTOA 5HK3A 4LUZA 3T16A 3OPOA 2XWJB 4JI5L 2KHJA 1WCMH 2RJDA 2N3SA 3X26B 1HNZQ 1SNDA 1VQ4A 1GHKA 1B3AA 1KD1U 4NKLA 2CCZA 3RLOA 2E12A 5CV4A 2QILA 4JI8Q 1M2VB 3HOZB 1SG5A 4GN3B 2P4RA 1Y1VH 4C92E 1Q7YC 1JQYD 1SNPA 4R4IA 1EQVA 1BI2A 1NCVA 2QA4A 2LQ8A 4KV6A 1DOLA 1HXDA 1RHPA 2ROLA 1D3BB 3S2DH 3CC7T 2KY9A 4FF3A 4HSVA 3H0GG 5IHKA 2AZVA 4E7LA 3AFQA 1GUNA 4E7ZA 3L2UA 1S72T 1VQNA 3GQBA 4RGMA 1Y1WH 2PVOB 2MIOA 4J9HA 4J9EA 5KH6A 4KK7A 4XYOA 4G7OC 1WLPB 2DYBA 3H3VI 3A8GB 3OYHA 2EIFA 2A0FB 1VQMT 3HKZB 3JCMP 5EC7A 2EYJA 3J81L 5LJ3h 2JMCA 3S14H 5LMNW 3G6ET 1T5EA 2FMMA 2LXJA 4BY7G 1F2MA 1OX8A 3M0SA 1CTMA 1TWHB 2N78A 3KFUA 2F0PA 1QLYA 2NVQB 4M7AB 2QF7A 5CKBA 4ZQ3A 4RTWA 2XRQD 2V26A 1UE6A 4LK1C 5FLMG 1IREB 1WZOA 2KCCA 1QZGA 3TDQA 5JJIA 2PPBC 2KECA 1C1AA 1VQLA 4DV4Q 1NNXA 1B8AA 4DOVA 1CZGA 1W3SA 1HNZL 3RKWA 1QCNA 3I4MB 1A62A 3CQTA 2IX3A 1FJGQ 4OIJA 3GTQB 2LS01 3DXJC 1TOVA 3RZDH 3ERQA 2XN9C 4JI8L 2ZZDA 3LLRA 4JBWA 4J1MA 1EY8A 3DM3A 1ZSZA 3UWNA 4JLGA 4Y28E 2MCNA 4Z9CB 3K0XA 2A6EC 4JRKA 3O13A 2KXDA 2KI7A 2EQJA 1SE2A 3HKZE 5CV8A 5IP9H 3JAME 4DAYB 3AEVA 3E9GA 1JCKB 3EG2A 2OEOA 3V8KA 5ELFA 2B86A 4C8QG 4IPCA 2Q2HA 2LQNA 1SJHD 4HIOA 1EOVA 3RDVA 3VUZA 4L5TA 5I4DA 2DMOA 4B3ML 3OS5A 1N8RU 4ZGEB 1YNJD 2A69C 1DOKA 4WFN3 2E2IH 5EKKA 5D7UA 5EGTA 3OMCA 2YU9H 4BE1A 4C5HA 2HQXA 2RHYA 2PZUA 5ELCA 4H02A 1IHVA 2ZJQA 2R58A 3CC4T 1RODA 2QASA 2B2YA 1RADB 1TR5A 1CM9A 2KYMA 4A3IG 3HOWB 1YBYA 5K5PA 3UT1A 4MNOA 4DEYA 3P7JA 4M78C 4TRDA 2R92H 2KR3A 1I07A 2EJGA 5IGDA 3VYUA 1AZQA 1CKBA 1IYVA 2UUBQ 1SMYD 5CIUA 3CRKC 1IBKQ 2K3YA 4CDCC 3TVTA 1HUMA 1S5BD 4JLIA 2VY3A 1W6JA 5LMNL 4DV4L 2HCIA 1N9WA 4TVAB 2FJ2A 2RA4A 1P8LA 1MV0B 3QDRB 3JCMe 3MWYW 2NUCA 5KYNA 4B6MA 5FRNA 1NE3A 3JSCA 2KAFA 3VS4A 2ASBA 4LE9A 2EYPA 4F14A 2D8JA 1VQ5T 3DMUA 3RMHA 3MJXA 3J7YW 2K5HA 4YCUA 4J9GA 1I4PA 1VQIA 1N6AA 2CSIA 4MMKA 4CKBA 4EVOA 1TS5A 3NEMA 2VUMB 3I56Q 3UDCA 1MNDA 1H9MA 3H0GB 3MKDA 2RJFA 3L9AX 2NTSA 3PF5A 4C5EA 3TS2A 1EZZB 2R7ZB 1R77A 2EJMA 4X66Q 2LT4A 1E1OA 1UECA 2NVYB 3I4NG 2JA5G 2SNMA 3S15H 1ET9A 2N55A 3QOJA 1AWWA 3HOXG 1KRTA 1Q7YU 3MXGA 3EGDB 1K76A 5EAYA 3GD7A 5HK0A 3AHUA 3VR6A 2FFKB 3VR3A 2ROTA 1CK1A 5CBAE 4A3MH 2SEBD 4M77G 1BU1A 1V9PA 3J81i 3IKJA 4J6XA 4JI2Q 4QGUA 1ESFA 1BCPF 1Q82R 2BTTA 2X9HA 2GVAA 5GMKe 4UY8C 2VUBA 3BYYB 4A3FH 1NTGA 1QUQB 2K5FA 3E9FA 2V4DA 3L2PA 3VS7A 1I5LA 4IUVA 1JU5C 2CKKA 3ITPA 4KBMB 4A3LG 2UUBL 1K8GA 2DX1A 1IBKL 1M2VA 2DJZA 3QZ9B 2RQVA 3U9SA 1LTGD 3I55Q 2L3QA 2KBTA 4HVWA 1Q1EA 5IYCG 2LC4A 3DEPA 4NXMQ 4KN7C 1HUNA 1G3YA 2DL4A 5IXBA 3CCEA 1ACMB 2RHXA 4PJOF 1FD7D 3TU4K 2EKHA 2Z1CA 3T1YQ 2KRMA 4DR7Q 4A93B 4DR6Q 1D3BA 5LJ3d 4KY7A 1W2BP 2DL3A 3C95A 3BU2A 2QI2A 3OTOQ 1HQMC 2IT1A 1VQ5Q 2NTTA 4KHVA 1OV3A 1YNNC 3PV0A 1XNRQ 4CC4B 1WHGA 2HMAA 1PRLC 1D5ZC 2SDFA 1VQOT 2NUTB 2D62A 4HCKA 1STNA 2GN5A 4DOWA 1TY0A 4CBVA 2CDTA 1RD9D 2P4TA 3K80C 4AG2C 1TKWB 2RHIA 3RKXA 3CP0A 3JCMb 4WJ3M 4C8QB 4TSSA 4X66L 2XGTA 1TS3A 3LWHA 4LF5Q 3S1QB 4BY1G 3ICEA 4XU3A 3PO2G 1QP3A 4LAAA 3H9NA 3ONAB 5GMKm 2EXZA 1XNQQ 3ZFJA 3S2HB 1ZBJA 4M7AA 4RCOA 2XSCA 1KSWA 2AKLA 1YNXA 5IYDG 1D0XA 2LJ1A 2B8GA 2GQIA 3KBGA 2YUOA 5FOBB 2CP3A 4OP0A 4KGZB 3J80c 1DGSA 4C2MB 4JI2L 4H44C 1RLPC 3U4VA 3META 3BZCA 4HJ9A 3TP6A 2RK1A 1AN8A 2LCCA 1O7ZA 1OXSC 1FWZA 2RI3A 3PTAA 1HR0W 5GAN5 1IYJB 3C3LA 2CSQA 3UA6A 1B2TA 1ARKA 3EA6A 1GRIA 1ZBXA 3CEYA 4HJAA 1U1SA 4B9XA 3JCMW 1V76A 2VWFA 2JEBI 4EQOA 1F2LA 4HIMA 4ZKCB 3M4YA 3M9QA 3VS5A 2H3JA 4BY7H 2K4KA 2I2LA 4A4HA 5GAHC 3T1YL 2O9VA 5M3MG 2D8HA 3KDFB 1F2ZA 2B29A 2MUYA 2JTEA 3CCUQ 2DM1A 2BZYA 2HBPA 2M0OA 3E6ZX 4PFZA 2TSSA 3S24A 1CHPD 5KCHA 4DAYA 5FLMH 1AWOA 1EYGA 3GTGH 1E22A 2KXCA 3JCMQ 1KTKA 2DJGC 5C44G 1GUWA 2O2OA 3PO3H 4M77D 2RN8A 1XNRL 4DR4Q 2YSQA 5BR8L 1LVKA 5C3WA 1QWEA 3CC2T 3P75A 3RUZA 3OMGA 1C8CA 3I4NB 2SEMA 2JA5B 1X2KA 4V190 4JBKA 1K0XA 3K8AA 3HOXB 2HT1A 4LF5L 3M56A 4M7DD 1FGBD 4J15A 3CCQT 3RR5A 1D7QA 4ZLTF 4D8KA 1I0CA 3L42A 5KYIA 1H641 2FYKA 4R1JA 1MMAA 4WORA 1LOJA 1Z47A 3FKIB 2E2HH 1KQSA 2UXDQ 3I90A 2X4YA 4LDXA 3K7UC 4RG1A 5I2MA 1L1OB 4LD9K 1V8QA 1RAFB 4HCZA 1JJGA 3PMIA 4G7ZC 1IB8A 4RMFA 3M7NA 1NYFA 2K33A 1WJSA 3I9QA 1I5OB 1IKLA 1OO9B 3O5ZA 5CR3A 1ENAA 3CMEA 1KRSA 4FP5D 1CSKA 2WAQG 2K4YA 1Y0MA 4YHHQ 1KHCA 2RH2A 3E9IA 1S1NA 4HIKA 5KE2A 4A3IH 1W6KA 4A76A 2E10A 2OTLT 3SHWA 2JEAI 3GTPH 1L2FA 2F0IA 1ET6A 3TS0A 1X9NA 4DV7Q 1OQKA 4OMFB 1YCSB 4KKSA 1LJOA 1K0RA 5KNDA 1FNWA 3RZOH 2E65A 1HNWQ 1U3OA 5AT1B 4DR4L 1W4SA 4OB3B 1PYBA 3PIO3 2QKIC 5GAN6 1I6HH 1ABQA 3EGDA 2QK0A 3HG9A 4M4ZA 2QQSA 1NYGA 1PCXA 3CC2Q 1BO0A 1ENFA 1VQAA 4YY3Q 5GMKl 1BI3A 2KVMA 2F03A 3PO2B 1NLOC 1UGPB 2DF6A 1WTVA 3P20A 4F7UG 1LABA 4PK4A 4LJZC 1YIJT 4M78E 4TVRA 1VQ9T 3S1MB 1NM7A 4XQQA 1HFGA 1QVPA 4BBSG 4DAMA 4JUVA 2CS7A 4CKEA 2EBPA 3CCRQ 3BDUA 1WI7A 4CC3A 4LUOA 4IFDI 1U06A 2EQIA 1LTAD 4GBQA 4A4GA 4Z88A 5D6YA 1YJNQ 5C0XJ 3M55A 2VV5A 4Q5VA 3LH5A 4ATOA 4I7ZC 3SGIA 2HHHQ 2UXDL 3M7GA 1QKXA 4L8JA 3I4NH 1S5CD 4PFOA 2YLBA 1GCQA 3CCST 4JV5Q 3MZ5A 4K14A 4PJOG 3HOXH 2ED0A 2O01E 3OSSC 4X3UA 4Q5WA 1D1CA 2WKDA 2NZ1D 4NL2A 2WB1G 2JA8G 1B44D 4ME3A 2DRMA 3CXCA 4C3IG 5JOBA 5M3MB 4OMMA 4YHHL 1MHNA 4V0BA 2NUTA 2DE0X 4DF7A 3ULJA 3GP7A 2JM8A 1BIAA 4MHEA 5C44B 4DV7L 2ZM6Q 1M1GA 3OWEB 2ZXRA 1GCPA 2J05A 4C8QA 4L5RC 1VQNQ 4DFAA 2JUFA 2OAWA 4L59A 4R56A 4A3LH 2Q2IA 5L23A 3I91A 2AWOA 5HCKA 4QQ6A 2F0TA 5FKAC 3SHLA 2EPDA 3OHXC 2XMFA 3CPWA 2DIQA 1KAWA 2N88A 4OWWB 4ZCKA 1AW7A 3CCVA 1E7ZA 1SAPA 2CUBA 1UTIA 3EG1A 2X4XA 4MDXA 1G6PA 2PYKA 1E24A 3SD4A 5M9OA 4CI0C 2NYSA 2B2YC 1VQ7Q 1FMKA 2HKQB 4HVVA 3PIOA 3A8JE 3GTMH 1VQ9Q 4LDYA 1S72A 1SEBD 1IGUA 1GHJA 1YHQT 1NAPA 4ABNA 4KT0E 2X69A 1EY0A 2AQ2B 1WHHA 1SYGA 3DLMA 2PNRC 2HZYA 1NE8A 1AFPA 1QJOA 4BDYA 5EG2A 3E5SA 2J7IA 1PZKD 3BDOA 2HBWA 1VQLQ 3K5MA 2HHHL 2F0FA 3QZ5B 2N8NA 1XNIA 1Q86R 2YYZA 3RESA 3OIQA 1YJWA 3HGBA 4IUNA 4BY1H 2O2LD 1RABB 4JV5L 3WOEA 3REBB 3I5SA 2F3IA 3F8TA 1SFOB 3M4OB 1BI1A 3PGGA 5CKEA 4BI8B 2WAQB 2J4XA 3KDFA 3SK8A 1I4K1 1TU2B 5IYDH 2PI2E 4ME5A 1WTOA 3KFVA 3W3AA 5CC4A 2A08A 1G3SA 4X1VA 4HMJA 4Y92A 1UWVA 5CMDA 4IUPA 4H0LC 1B1ZA 3T51B 1CUKA 1SJED 2A1AA 1HA6A 1YP5A 1HPCA 2MI6A 2Q2UA 1U8RA 1WCMG 2YTYA 2HD3A 8ATCB 1SSOA 1JWSD 2K3BA 3VYSA 1VOMA 1JOOA 1PRTC 1NBEB 2A3LA 2ZM6L 4NDXA 5HKCA 4HTHA 1II3A 1YJ9T 1RAIB 3FC3A 1GBQA 4KD3A 2BDOA 3FIFA 3D7SB 4K5XA 5GAN8 4R4QA 2A37A 2CT4A 4N0AC 2I46A 2HIVA 2F4VQ 2R93G 2NWMA 4PLLA 3EFRA 1O7LA 2P84A 3BFMA 1K3RA 4L5GA 3PUYA 4PJOD 2RM4A 1BCPB 2HQLA 4PQXA 4UP7A 2DL7A 3J7AF 5IXFA 5C44H 1LT3D 2AHOB 3HFOA 1L1OA 4AYBB 2NVTB 3A0JA 3VKIA 2FEIA 2O4XB 2VASA 1KNAA 3NPPA 2EQSA 5DM7R 4FU6A 1V1CA 1W1FA 1YITT 3HRTA 2AWNA 1G8ZD 5IODA 3LX7A 1O7YA 1Y96B 1N33Q 4AFQC 4LFAQ 4JK1C 4JC0A 2ZCFB 3I5RA 3ULLA 3E1SA 2BDNA 2WB1B 5IWAQ 3K58A 1MKHA 2HCKA 4QVZA 2AUKA 1WD1A 2MF2A 2KQ3A 1VQKA 3OYNA 1Q81R 2YRCA 3MP8A 5D6WA 4DAVA 2K6DA 1HZAA 1K73U 1JWMD 3I72A 4AFUC 3HL8A 1T0JA 4HCBA 2ABLA 2M16A 4KKUA 3B6YA 4WTOB 2R5MA 3SDZA 1WOCA 2F2WA 1AWXA 3NTIA 3X3MA 2DJFC 2C0IA 3CXCP 4QQDA 2K7VA 3U58A 4LF9Q 1XNQL 1UFFA 4X64L 3OW2P 4BBRG 3HSBA 1U5SA 1XOVA 1VQBA 1MNEA 1QVFA 5EBDA 1NJIR 1EQTA 5JJZA 4J6WA 3LWIA 4M7AC 2JM9A 3H09A 5D3DA 1B9MA 3KYHC 1EQQA 2F4VL 3WVDB 5J22A 3SK4A 4GZYC 2RDFA 4GKKQ 2CP2A 3CPWP 3TEHB 1R9TH 3QWXX 1WTQA 5IP9G 5M5YB 1U0LA 1ZUYA 1TWCH 1Q12A 1F9RA 3MEFA 1X01A 2MYSA 3GNGA 2CP6A 5KRUA 4OMPA 2G9HD 4OIKA 4A3DG 1J8IA 1HJDA 4DXGA 3SB2A 1Q1BA 3K57A 3O8VA 3QXEB 5K36G 3URYA 3CCLT 3TZUA 5GAOr 3NGPA 4J7IA 1NR2A 1N33L 3GTKH 3QHSA 3CCEQ 2RKSA 2E3IA 3IQLA 1AE3A 3BS1A 5CKDA 2GNCA 4QUCA 2Q8TA 4BBSH 1SHFA 4MZPA 3S3NA 2GCXA 2KDSA 3EAEA 3P1HA 1QVCA 2Y0SE 3TZDA 3QR8A 4A3BB 4M75G 3CCMA 3GNFB 4RCBA 2PI2A 4EQ5A 2KYBA 2XDPA 2E75C 3NTHA 3BZKA 1AHJB 5C3EG 1OPKA 1TG0A 2JA6G 1WCMB 2RVLA 2L0AA 3QO3A 3QWYA 5LJ5g 4R9WA 5D65A 1PH6A 5LJ5d 4K11A 1BIBA 1BBZA 1C0AA 1TUCA 5G3LD 2K01A 4UAIA 4LF9L 1M3CA 2FHDA 4CJ2C 2JA8H 4F7XA 3PE0A 3NBHB 4FO2A 1Y1VB 4ZGJB 2CGHA 5E4WC 1G5VA 2R93B 1ZQ1A 2NVXB 4C3IH 1AP0A 3OYEA 1PFSA 1SRLA 1CZWA 4A3KG 3M3YH 1VQOA 1SDFA 3S2DB 1Z9ZA 1Y8OB 1X3FA 4EPCA 1YNJC 2VL6A 4IPGA 3OY9A 3RN5A 4GKKL 1IBMQ 2PVGB 1TU0B 1A3UA 1Y7XA 4BE0A 1K28A 2K1BA 5I2YA 4AT1B 3VS6A 4FXDA 2QDYB 2D0PA 3FRPB 1KDBA 1TUDA 2RQWA 2Z9HA 5GAMf 4QB4A 2VXWA 2KENA 3EFOB 1RAAB 3SE0A 2QDLA 1NR4A 4AFZC 2OTJA 1Q8KA 1J6QA 4QF4A 3NSWA 4RCNA 1GKHA 1D8LA 2E74C 3H3VC 1RIPA 3S14B 1OXUA 2L15A 2EY1A 3F1ZA 1VQDA 1SMYC 1RAEB 5ELEA 2GA4B 3A8MB 3URGA 3TMEA 4X34A 1UEAB 3DWQA 5BN3A 1TIID 2C0OA 3M54A 4QIWE 1QOHA 5KNCA 1QVGA 1UEBA 4KGXB 4WRDA 4E7HA 1R8OB 3D4DA 1JO8A 3UDIA 4LDWA 4A3FG 1DD2A 4C92D 1AEYA 1S5ED 2VQEQ 4DNTB 4MZTA 3OS0A 1LUZA 1WI5A 4RHRA 2D2CC 1VQ6Q 2EAYA 3G4SA 2QEXQ 1PLFA 2AZSA 4BBRB 4DK6C 2ESWA 4IOAA 4OXPA 3JAML 1LTID 3HZXA 4DK3C 3RZDB 1K9MU 2FHTA 4BD3A 2W0ZA 4CRIA 1WTRA 4LUVA 3QYHB 1ZXTA 5JPNC 2DD5A 5C6SA 1S4ZA 3V05A 3MC0B 3L2RA 3Q24A 4OHJA 5C4XG 2LX7A 1EFNA 4EX5A 1HZCA 2CQAA 4ODGA 3KUFA 2VKNA 4BXXG 3BDLA 2OI3A 1VMPA 2O4XA 3RBBB 5KNBA 5FW9A 4JG2A 5GAN2 2V1CC 2OQ0A 3H6MA 1IGQA 4RCCA 4M7DF 3CMAA 1Y96A 4M75D 1K83H 1GCQC 4JVZA 3EVQA 4DXFA 2EJFA 1N9RA 3CCQA 3MEVA 3FVQA 1RLQC 4DAPA 1PTOD 2E2IB 4XQJA 2FMCA 2R93H 4BWGB 2SRCA 1W2BS 3RNJA 3UATA 3PUZA 3CMEQ 2YU9B 2LMCB 3OW7A 5HURA 4IUUA 1X69A 3V2TA 2QQBA 4XTZA 2A7YA 2GQVA 3FJ5A 5C0XH 3I4OA 1G91A 1G3WA 2XKOC 2HNIA 3KK7A 2UUCL 1XXGA 5GJWB 2IY5B 5IY0A 5FROA 2EXDA 2DD4A 1K1ZA 3KBXA 4X9CA 4BDZA 2R92B 3SEBA 4C8QC 3KLSX 5I2XA 4GLAC 4B3MQ 3J7ZC 2VQEL 4KH1B 2OQKA 1KHIA 5HY6A 1SNCA 2F0VA 2EYZA 5FU7B 5CV7A 3KLRA 5E7NA 3S1NH 5M5XH 1RI9A 1SYEA 4LDVA 1VQPQ 2ZPEB 4JPBW 1H9JA 2EY2A 4UPAA 1JJ2P 1LNXA 4PJJA 1SKUB 1BOSA 3AU7A 3OYGA 1X6BA 2MPXC 3EH1A 1UB4A 2RNAA 2BE5C 3PUWA 4M8AA 3KJPA 3BE3A 3LH0A 1M90U 2BA0A 3GO5A 4BUGA 2QQ9A 4OWXB 1HJPA 4OMLA 2KGTA 4RTUA 5GAOp 2JA9A 3E3XA 3CD6A 4RMOA 4P75A 5DM73 4MTNA 3M9BA 5CBEE 3R8BA 2OWOA 5AJ3Q 1JBMA 1D6EC 1UAPA 1WPYA 3DUZA 1OTCA 5CQXA 1KC8C 4FF2A 3HRSA 3PO3G 1QCFA 2L4NA 5LMNQ 1WVLA 2K9GA 3QBYA 3PIPA 2L1BA 2F0DA 3A8LB 5FJ8G 4RUGA 1EEFD 1ENCA 1HA5A 2JSOA 1UJ0A 4PFPA 4BBRH 3S15B 4NB3A 1EX4A 5J39A 1OU8A 2O9SA 2WSEE 1BVSA 5EPJA 2DGYA 1TXYA 3T53B 4XQNA 1LV9A 1TUGB 4VUBA 1G51A 2M51A 3EBEA 3G7LA 3NHHA 2B3GA 1SMXA 5FLXc 4A3MB 3I56T 1HZBA 3NTKA 1WNLA 1L0WA 2CZ1B 1EU3A 1V1OA 1VQHA 4ALPA 1DJRD 1UUPA 4MIUA 2DEUA 1Q95G 1PC0A 2ENMA 4A4FA 4GLKA 5IGFA 2A19A 1AVZC 3C12A 2JS2A 3JCMX 2DUDA 3VDYA 4A3FB 2SNSA 1H9KA 3CCSA 5GAOl 1V1QA 4DK1A 5LHY1 2AT1B 4IALA 4K2LA 1EIFA 2RB6A 3S17H 1X3EA 2CW0D 2DL8A 4A3DH 2KEAA 2GFAA 2CT3A 4M7AE 4C3JG 3HP3A 5K36H 4KI0A 3STBC 4LFCQ 4RTZA 1N27A 1QVGP 3NBHA 2UXBQ 4KRTA 1KAAA 4ZK9B 4OB1B 3HOVH 2PU9B 2FINB 3NWSA 2Z4IA 3MP1A 4NS5A 3A8KE 2BE9B 3CCVQ 4UDUC 4M77C 1I6VC 4E2FB 3MA2B 2B2VA 3JAMi 1KC8R 1S5FD 5CGKA 3TRZA 5IAYA 1A6XA 2RHZA 5GANf 3K59A 3GTOH 2LCLA 4BI4A 2QAZA 2X35A 4Z02A 2M00A 3L3OC 2ZGWA 5C3EH 1WHLA 5IT9E 3VR4A 1L1OC 3PVLA 1PTOH 2L11A 5AJ3L 2JJ9A 3U9OA 1JMCA 4L5QA 2FL7A 1HSQA 3I55T 1Q82C 2JA6H 2RDGA 1YI2A 3AYHB 1BBWA 1FX7A 3JB9J 4R4TA 1KIKA 1CT1D 3EFOA 2E2JH 1M5Q1 3FEOA 2YTXA 1YJWQ 4FIBA 1TWAH 2Z6KA 1EL0A 1BK2A 4DEXA 3RIRA 4AIMA 1MJEA 2K2MA 1SE8A 1G2BA 3ASKA 2DILA 1YHQA 4WCIA 2KUMA 4Y7NH 2P0QA 3R6NA 3L2QA 4EQNA 1MGQA 4D8DA 5EQ0A 2M1HA 1QCBD 2K3XA 5GAOq 2BKDN 2PZ1A 1DJ7B 3HS0C 2ZTDA 3UDXA 3EH2A 3JRZA 3IFDA 3NUCA 2NBFA 5C4JH 4JI7Q 1T5XD 3MCAB 4Z8AA 2DXCA 4EMHA 4N0AA 2VW9A 4LFCL 2KVQG 4ZAIA 1X56A 4JI4Q 4N4IA 4FSSA 1Z7TA 4B3TQ 3NK9A 4DV6L 2VUMG 3S16H 2Y4XA 4BY7B 4HAEA 4RGOS 4F7UF 2NUPB 3Q8DA 1M2OA 1G291 1WFQA 1DONA 3G71T 1JT8A 1EIGA 1EWCA 2XI9A 3JCMJ 3RD4A 2YLCA 3HOUG 4HCCA 4XAXB 2M9VA 3GTGB 5H1SE 4RGNA 1NEBA 1JR0D 1K3BC 4M7DG 2QGQA 3CQZH 3I35A 3RMQA 3PO3B 1MJCA 3GV3A 5L37A 1HK9A 2RI5A 3NMZC 1VDZA 1NMGA 1I4GA 5BN4A 3VRYA 3M5AA 9ATCB 5FU6B 5LL6S 1CKNB 4KKTA 3CCUT 4Y52H 4JJCA 2QDBA 1CSQA 5C4XH 5FRMA 2DERA 1D0ZA 2EVBA 1C4QA 4R4OA 1PMRA 1R4PB 4BXXH 5GAMg 4C0DB 2B2TA 5GAMd 3CCJQ 3BY7A 1XQHA 3PCOB 5EPKA 1AT1B 3EHQA 5LJ3e 4J8QA 2E2HB 1G2TA 4FT2A 1YITA 1SNMA 3DLLA 1STGA 4JYAQ 1H92A 1UG1A 2A68D 4FDBA 2ICEC 1STEA 3TBIB 2YUNA 1I81A 2Y90A 2DK3A 2R61A 1VYVA 3IAYA 2KA7A 2YRDA 4E7SA 1FR3A 1IRXA 2F1LA 2Z8LA 1IHZA 3NENA 2X4WA 2J6FA 3C0CA 1BB9A 4JI4L 3CPFA 2TMPA 1I8FA 3PQIA 4P71A 4B3TL 1KDCA 3W1GA 5M5WB 4A3IB 3CW2C 4K5WA 3GTPB 3MXNB 4IURA 3M0QA 1WTWA 4A75A 3G71Q 3QWNA 2A28A 2RHQB 1XPUA 1UE1A 4DR2Q 3RZOB 2F0UA 4DPGA 1EWIA 4RG8A 3CKIB 4KJOA 1ZLMA 1TQOA 1I6HB 5KYUB 4DA4A 1AZEA 4G7HC 2LJ3A 1B70B 5DEHA 1NG2A 5FO7B 4V2SA 1K8AR 2A74C 4ESRA 1LTLA 1JRIA 4JBMA 5IYBG 4JJDA 1IW7C 1HR0Q 2JXBA 3OS1A 2G3RA 3OBWA 2G5DA 4MMLA 2GFUA 2RO0A 4HCEA 4BA2I 3UE1A 4C8QE 5I6YA 4K6DA 4FCYA 5KEEA 1WTXA 2L8DA 3UE0A 2UXCL 1Q82U 4U68A 2A6ED 2LCSA 3CCMQ 2ZXPA 3E9HA 3RR6A 2FRWA 2YXYA 1HYOA 1GVPA 2D9UA 1I4XA 2B39A 4X6AH 1A2TA 5FJ8H 3BG3A 1PHTA 2F0QA 2A36A 2AUJD 1UUEA 4JYAL 1IL2A 4RTVA 3CCLA 1ZUUA 3OYFA 1NPPA 1ZYRC 4MTKA 1C9OA 1SPKA 2F5KA 1YWPA 3X25B 2LQKA 1MI2A 2NN6G 3IFTA 2XU8A 2Z4HA 2A69D 1T3LA 2G6FX 1BCPC 1WHJA 2EYXA 4M77B 3CCRT 1PZID 3BZDB 4GLVB 1QZHA 4OMNA 2K50A 3I3CA 1YJNT 2MAMA 1ICWA 2RHUA 4K8IA 4POFA 4OMOA 4QQGA 2L2PA 1CSPA 1UE5A 4J6HA 3P8BB 2I07B 4KHZA 4BY6B 3K5OA 3HOUB 3GIBA 4M7DB 5G3LF 3MAQA 1VQ8Q 4M78D 2B2WC 3A1PA 5C4HA 2PQEA 1BBXC 4DR2L 4PJOC 5D6XA 4C5IA 4C3JH 2JA7H 2PUOB 3VS0A 5ELOA 5JEAJ 2E6NA 2EJFC 3N5BB 3E0JA 3W1BA 3S1RH 1M8MA 2C06A 3R2IA 1R0BG 5LJ5f 3ULRB 3C4SA 5M5WH 1PH9A 1Y8PB 2EY6A 1HR0L 2SOBA 1D1AA 3GTJH 4C5GA 1PYWD 2JJQA 3GTMB 3HFZB 3H15A 1H3HA 1VQNT 1A63A 4BACA 1D1KA 5KYLA 4PV1C 1XYIA 3CXCS 2WSCE 2Z0SA 5E3FA 3M4QA 3FDRA 4PZ7A 3M85A 2COZA 3VR2A 5ELNA 1GJXA 1B53A 2RQUA 3OW2S 4E7IA 3JC66 1KK7A 3DHQA 4M77E 4O6JA 1I50B 1BXTA 2PCFB 5LJ5j 4M1UB 2D0NA 5JAVA 4BY1B 3HOYH 2LDMA 2LVMA 3JB9D 1OZ3A 4K5VA 2IPKD 3VA5A 3G4SQ 1EOTA 1VQ7T 3GV6A 4A4KA 2YV5A 1K4US 4J9FA 4QT7A 2NUPA 1RKNA 2ALYB 3D4RA 2IHEA 2FO0A 3G6JB 3TP8A 4JBJA 1I3QH 3CPWS 2IW3A 2R5AA 3OYKA 1WYDA 1PH1A 3R3OA 4HEDA 4C92F 3T1HL 1KXLA 1NPRA 1M1KC 2K7AA 1QUQA 1OEBA 1QILA 2BH8A 3S3MA 3C1FA 1H8KA 1VQLT 3NBIA 1YFNA 1MGSA 1QE6A 1TWGH 1WXBA 3C94A 3CHBD 4CC2A 4OO1H 2WINB 4O2DA 1PDQA 1FYCA 1VQ4Q 4F87A 1SE4A 1D5MC 4P5NA 2R7DA 5AFWA 1JB7A 2YUQA 2E5LQ 4LF8L 1WJRA 3M0PA 1BDOA 2EYFA 4FNFA 2ZPGB 2EYQA 5FLXE 5GANg 3CMAQ 1CKNA 2XRSD 5GANd 2DY8A 4EMKB 3GP8A 4GOPB 2KEDA 1M27C 3I7FA 2AK5A 2RDHA 3DWAA 2VUMH 3QUIA 1Q86C 4PZ8A 1ZHIA 2NVXH 1N5ZA 2HDLA 1GBRA 1YN8A 5DY9A 2QA4Q 3IRBA 1O7IA 3C1EA 4YWMA 1IXRA 2E5QA 2WKCA 4LF4Q 1UDLA 3HOUH 3V7CA 4D6WA 4X65Q 2A73B 1Q3LA 2I5LX 2K14A 1GXDC 4M75F 1A2UA 1PV4A 1A3TA 2UU9Q 3CBMA 2J06A 1WJQA 3RERA 1SSFA 1H3ZA 1YNND 4RHSA 3RLFA 1FVIA 3UF4A 4J9BA 1I94Q 1PTOF 1Y14B 5CV6A 4AH6A 4RKLA 2FG0A 1STAA 2MPMA 2KHSA 4QMGA 1WQ7A 3K5LA 2GGRA 4MDWA 4DR1Q 2FVUA 4IIOA 1EY6A 3GPLA 4KGVB 3VS3A 2A5HA 1M1KR 1IO6A 3CBOA 3OYLA 3SVMA 3CC7A 1BNZA 2I0NA 2A8VA 3MXNA 2B2VC 3THKA 5J1ZA 1CA5A 2K28A 5KCOA 4ZUJA 3FJPA 4OGCA 2FRYA 1JWUD 4MN3A 4XTXA 4E7KA 3CD6Q 5LJ5h 4F16A 3SEMA 1X32A 2HSPA 1WHKA 1PSEA 1ICFB 1VQMA 3HKSA 1K0SA 4RH6A 5HGQA 1XPOA 2D0OA 5JEAG 5KYUA 1LTTD 2Z0WA 1I50H 2MO1A 4DA2A 4HJ5A 1XMQQ 2JMAA 1LM0A 3G6EA 1ML0D 3QPHA 4CDFC 2E5LL 2JTMA 2KE9A 4P74A 5LL6X 4J9CA 1KQSP 3MEWA 5M3FH 2KT1A 5GAGC 1BUVT 3NWTA 4UP8A 2Z6KC 2B63H 2WP8J 3NXWA 4J9IA 5CAIA 5A0GA 3J7AV 4B3RQ 3EN2A 2KK4A 4YWLA 3K5NA 2LMJA 4A54A 2P5ZX 3EJIA 2PO4A 1PXUA 1QG7A 3SFMA 3KF8B 1B9NA 1PKSA 4X62Q 4ZN3A 1CA6A 1R9TB 1ILPA 4LF4L 3VYRA 3JB9H 2QEJC 3ZL7C 1TWCB 1Q81C 2CWAA 4X65L 1TH7A 2RMOA 4OB0B 4RAUC 4X64Q 4P73A 4RFBA 4RKBA 2UU9L 3I8ZA 5EPLA 2EJ9A 4PNOA 1H9SB 1I94L 3VYGA 2RI2A 2AKWB 4L6TB 1G8XA 2LRQA 5IYBH 1PH5A 4DR1L 3OYIA 4M77A 1B50A 4F7UB 2MMPA 1X3QA 2L55A 3A74A 3GTKB 4O0AA 4FT4A 4AMCA 4LNQA 1PNJA 2EYOA 4OELB 4BBSB 3D3RA 5C0XG 1QMCA 1NJIC 1OPLA 2VGNA 1PM3A 1TVXA 2A6HD 2ZTCA 3Q23A 3A8HB 2R3ZA 3F70A 3GDEA 5KYYB 2O88A 4M7DA 4NL3A 2EOTA 2HQHA 2X3XD 2BIVA 2WAQE 2K05A 3VUBA 1AH9A 2K5QA 3OSOA 1QB5D 5C0XI 3F2UA 1YI2Q 4PJOB 2F52A 3CCET 5EBCA 3QJYA 2H1EA 2DYIA 2BUDA 2MO0A 1XMQL 3FRNA 3V8LA 1KLGD 2CKZB 4RG2A 2NN6H 4HKEA 4JS5A 3CC4A 1WX6A 2DZCA 2ICIA 2JA8B 1M3AA 2GF7A 2K79A 2QGFB 2MGSA 4A3KH 3LYIA 1U4RA 4C3IB 4R8NA 5D14A 4B3RL 1SYDA 2NUZA 2F3VA 4N8X1 2DA9A 2LNVA 1EUJA 3M3YB 3VV0A 2B2TC 2JN4A 5T1GA 4JRPA 3I55A 1N36Q 4X62L 1SBBB 1PZJD 2JP1A 2DXBA 3GLXA 4DK0A 1L0YB 2VQFQ 3NQTA 5FU7C 4F7UE 2FXQA 3A8OB 1CHQD 1JOQA 4HJ8A 2K5IA 5IN1A 4DV2Q 3S6WA 1JJ2S 2DO3A 2OAUA 1JICA 1Q86U 1PFMA 2KROA 3PVQA 3Q1JA 1QNUA 4N4GA 1QQJA 3J80E 1EFID 2AMCB 1VQ5A 3BDCA 1F77A 2MOXA 4AYBE 4OONA 4C92G 1WTHA 1YEZA 4E6RA 1X27A 2R7FA 1BQQT 2ZJRA 1VYTA 3WOFA 5IGEA 1OZ2A 2KRNA 4XTUA 2E2DC 4X3SA 1TTHB 1IKMA 4PJOE 3J81c 1A3VA 2CVRA 7AT1B 2VXEA 4IQZA 2GTOA 3H8ZA 6AT1B 2WB1E 1VF5C 4C3HH 4R0KA 5A35A 4FF1A 3J80i 4EMKA 4WJ4A 3W2DA 4GOPA 2OT2A 2BZXA 3NELA 2XD0A 4LUEA 3HOVG 5CVIA 4L63B 3HRZC 4NMZA 4YWKA 1XJVA 3E2UA 2D5DA 2DXUA 4DBFA 2NZOA 2CP7A 3HPWA 4OL7A 1MMDA 1LO5D 2JTFA 2ZTEA
chains in the Genus database with same CATH topology
4JI3Q 4KUDK 4K0KQ 3V8JA 4HT8A 1TWFH 1N36L 1VQ6T 2HIXA 5DLOA 1PH7A 2QEXT 1QVGS 2VQFL 1CKMA 4QVDA 3RUXA 3UDFA 3DB3A 4DV2L 4II1A 3WWVA 4JI7L 5LJ5e 5AYFA 4J8OA 2XDBA 2KSSA 2HQEA 1PH8A 4IUQA 4JI6Q 2VXFA 5CKHA 3PGZA 4PLIA 1Q81U 1NY4A 4TQUS 3K7AH 2RF4A 3HKZG 2FB7A 2K52A 3TEEA 2H5XA 3PSIA 3LW5E 2KMTA 3GF5A 3CMET 2MFIA 4M7AG 2MWPA 2ZPHB 3WXMB 1SRUA 2L89A 1NJIU 4UC4A 2UUCQ 1NBWA 3HFNA 4XU1A 4B3SQ 3SWNB 4YCVA 4PKCC 4JI3L 5IE8A 4OX9Q 2VC8A 5GAMj 1VQJA 3WVEB 3GTLH 4K0KL 1QW1A 1VQPT 5GAOm 4JI1Q 3OBYA 1N8RC 3W5OA 1M4ZA 4IOCA 3AFPA 4XIGS 4F7UA 3AQQA 3OQ5A 4A3JH 5JJLA 5CCAA 2CZ7B 2XTIA 1FL0A 4GNXB 4C92B 4A3CG 4JS4A 2CFMA 4RKUE 2JNGA 4JI6L 1NZ9A 3CC2A 1ASYA 4XTYA 4LDUA 4PJOA 3M59A 4KHPL 1HZ9A 2K75A 2VYTA 3D31A 5FU6C 1KG1A 2F5TX 1WGSA 3EIVA 3HOWG 2ATWA 3CCRA 4ZN1A 4DKAC 2JVVA 1VQEA 5A0DA 1PH2A 4C0DC 1YHAA 4M75B 4M78F 4XTWA 4B3SL 1UGSB 4PMWA 1EFWA 4OX9L 2RK2A 1XTDA 5GMKh 3OS2A 4AQYQ 4JI1L 2IX0A 3CCVT 2PQAB 4YTLA 4DUYQ 3X20B 4C0GA 3RNUA 2OTLA 3L2ZA 1X55A 4JRIA 5GAMh 2R7ZG 3UPUA 3OYJA 2ES2A 4M7AD 1VQFA 4DV5Q 4B9WA 3TCJA 3EFSA 1EQRA 3VJPA 4POGA 4J6YA 3JB9F 3L2WA 3S3OA 1E1TA 3L0OA 1YJWT 3ERSX 2XK0A 1VQ7A 1YIJA 1VQ9A 4M75E 5GAN3 1J5EQ 1JJCB 1PYSB 1VCIA 1IBMQ 4MZMA 3LGFA 2DZ9A 3JCMV 2QXFA 4ZGDB 3HRUA 5CR2A 4BI3A 1VIEA 2OCEA 4QVCA 1W2BA 3KXTA 3BW1A 2JA7G 2KBNA 4ME7A 2N49A 4ZTFA 4A93G 4AQYL 4DV6Q 3PF4A 4DUYL 4P72A 5A2QE 1Y07A 3OYYA 2DTIA 1JE5A 3A5UA 4XTCS 1VIFA 4IO9A 4BY6C 4DV5L 1M1FA 4M7DC 3ME9A 3HOZH 2E70A 3QSUA 2KHIA 3TREA 3ZBDA 4GKJQ 3A5ZB 1X75C 2MQHA 3HOYG 1BKBA 1GXIE 2E41A 5GANj 4R4CA 1J5EL 4ELYC 1VQKT 3CCJT 1IBML 3SWNA 3LGLA 3JCMg 2P0KA 3X28B 3JCMd 4KLKA 1FGUA 2QQRA 4L6V5 5CO7A 3M4PA 2PMZE 3F2BA 2JK8A 4OO1G 2IHFA 4HJ7A 1FJGL 3KF6B 3PMTA 1TWHH 2NVQH 3DKMA 4XK8E 4GNXA 4C92A 4OO1I 3JCMc 3QG1A 4Y91A 3J81E 2LSSA 1PVOA 5IP7G 3I4MH 2EFIA 3OYCA 1OXTA 1OXVA 3GTQH 4NOYA 1YJ9A 5GAEC 3PFSA 3NFCA 4E7JA 1SROA 4LF6Q 4EMKC 4GOPC 2MNAA 1KQ2A 4A3GG 4GKJL 5GADC 2K5NA 2LXKA 4O5VA 4A3CH 3FKIG 1K8AC 4GY5A 4MZ9A 3RLNA 4M78G 4M75A 2UXCQ 1S40A 3CCMT 1KC8U 2DEQA 1BI0A 2JOYA 5GANh 5CQYA 2L5QA 2PQAA 5GAMe 3OYAA 4C8QD 3MO8A 1O75A 5LJ3g 2EWNA 5M3FG 3HOWH 4JDSA 2RHSB 4IJLA 2B63G 2VZAA 5CKFA 1CKOA 2HD0A 2IVWA 2XG8D 4QJFA 3FHWA 2L3RA 3OB9A 1VQ8T 3JB9G 1XMOQ 5C0MA 1X54A 2LT1A 1KQSS 4A3EG 1BBUA 3H3VH 4LF6L 2OTJT 4IFDJ 3JB9I 4J5YA 3F2CA 2EQMA 4NPSA 1VQGA 3H0GH 1H95A 1YZ6A 1UGQB 2R7ZH 5I21A 2LX9A 4KUIA 2NVYH 2PNHA 1YHBA 4C0FA 5GROA 3HP9A 3P8DA 1GO3E 2DXTA 5GAOn 4NXML 3G4ST 1WQWA 3J81j 4HA8A 2D6FA 4APVA 2KQWA 4JOIA 4DR7L 2V8JA 3STBD 1SLJA 4DR6L 3T1HQ 3OTOL 4A3KG 3M53A 3U4ZA 4ZTJA 2IX1A 2AHJB 5L8RE 1VQ4T 4DQ2A 3OYDA 1VQ6A 2NN6I 4IPHA 2QEXA 1B34B 4LF8Q 2K57A 3CMAT 4LW1A 1XMOL 1C7YA 3INZA 2XICA 4A93H 2UUAQ 1JB0E 5GQOA 2LTOA 1S3OA 2R6GA 2QA4T 2C35B 4OVAA 1PH4A 2WACA 2DPPB 4R55A 2CWPA 3UDGA 2E64A 1P16A 4M78B 2X4JA 3VYHB 3L7ZC 2NZHA 3S1QH 3MEUA 4GN4B 4OWTB 3KF6A 3S2HH 3M58A 2JQOA 1YCYA 4JRQA 2P0PA 1K8AU 4C2MH 1N32Q 2YTVA 3PUVA 1A0IA 4M7DE 4DUZQ 2QTXA 3CD6T 2RJEA 3V7SA 1X65A 3R6OA 4JCVE 2DVEA 3MEAA 1HNXQ 2EQKA 4IKFA 2XHCA 1VQPA 3ER0A 2VNUD 4IFDG 2K5LA 2E8GA 4C0ZA 1ASZA 3CAMA 1RL2A 2WFWA 2UUAL 2Q2TA 4LWCA 5GANe 3E19A 4AYBG 5IP7H 1K73C 1X6OA 3QYGB 1P92A 1UE7A 2JA5H 2BH2A 4HT9A 1VQCA 1OXXK 2IG0A 3QKJA 4OF1A 2BA1A 4KULA 3J7A5 4A3GH 4XQ3A 3OYMA 1B7YB 2I0QA 2I5MX 3MHXA 3HHTB 3FKIH 5CK9A 3OW2A 1I5FA 1N32L 2DIGA 2CZ0B 4LFBQ 3ZJYC 4DV1Q 3M4GA 4DUZL 4EMGA 1VUBA 4A4IA 4BB7A 2Y0SG 3G48A 3H6ZA 1HNWL 2R57A 5IYCH 1HNXL 2DTHA 1YI2T 1MIUA 2CZ6B 2QQAA 4YY3L 1WJJA 1Y71A 2DAQA 5J26A 1LYLA 1PA6A 2RJCA 3DB4A 3X24B 4N4HA 1E3PA 4A3JG 4M7AF 3SWNC 4DNIA 4JI0Q 3FLGA 4GS3A 1SN8A 3RN2A 1G3TA 3M57A 3PO2H 2ZPIB 4YCWA 4QL5A 4JJNK 3FP9A 4A3EH 1NMFA 2JN0A 3S1MH 3CF5A 3OYBA 3I56A 3GOXA 5LMUQ 2YHTA 4GNXC 4C92C 4A3BG 1IZ6A 2RD1A 1Q46A 3LGJA 2MWOA 2WSFE 5GAN4 1M8VA 1X3GA 1QVFS 2JE6I 4LFBL 4DV1L 1B34A 1AE2A 3OA6A 3FB9A 3JAMc 1XPRA 2B8AA 1Y1VG 1YVCA 4PL6A 4IPDA 1PHJA 4XU0A 3ULPA 5M3MH 2XDDA 4BE2A 3ZEHA 3PUXA 1M1KU 2D9TA 4M78A 3E0EA 1EIYB 2VS1A 2ZPBB 1IBLQ 3V7RA 4LF7Q 4M75C 1Y1WG 3K81C 3G7ZA 3KLWA 3T9NA 4JI0L 4UP9A 4NXNQ 5IT9c 2ZPFB 1KQ1A 4LD6A 1V43A 1K9MC 2D0QB 4ELZC 2EKOA 1T9HA 1O9SA 5GMKi 3CCJA 2KCMA 4J7FA 5LMUL 2PUKB 5A0LA 4IJHA 4QQBX 3OSVA 3U50C 2JZ2A 2EQUA 4XTVA 3RMSA 3D0FA 3I2ZA 1KD1C 2DKGA 2K5VA 2RA2A 4FM4B 2V8KA 1SFOH 3M4OH 3JCMf 2V8IA 2RCNA 2ID0A 3CBPA 3TQYA 5KE3A 1A8VA 3G71A 2K2VA 1U5KA 2KCTA 4A4EA 3PT9A 4DR3Q 5GAN7 5JJKA 2CQOA 1UGRB 1IBLL 4LF7L 2HAXA 1M9SA 2XIDA 3HOZG 2NLUA 4NXNL 4IUTA 1KL9A 4LFAL 3CCUA 1VS0A 5IWAL 4JOIC 1M90C 3KOJA 1N34Q 2NVTH 3VU3C 2R92G 3RKYA 1JJ2A 2E1HA 2F69A 3MP6A 4DV3Q 1U1TA 4L5SA 4FL6A 3BJUA 4KHPQ 4EDUA 4C8QF 1OYXA 1KIXA 4DV0Q 2PQWA 1PH3A 1RI0A 4XU2A 4DR5Q 3PNWC 5GMKj 4A53A 4JI5Q 1PSFA 1V29B 2I5HA 1VQ8A 5LJ3f 2CYZB 4E47A 3L2VA 3KJOA 4DR3L 3I4MG 1FXXA 4HIDA 3L1AA 2M9UA 1GM5A 3QIIA 3F2DA 1Z9FA 4FSXA 4X9DA 4J83A 4GN5A 4WF2A 4BA1I 1N9SA 2Y4YA 4A3MG 5I2SA 4PG3A 1GD7A 3P8HA 1QP2A 5LJ3j 5M5YH 3JCMh 5DLQE 5J3BA 4QY7A