1UEBA

Crystal structure of translation elongation factor p from thermus thermophilus hb8
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords elongation factor P
publication title Crystal structure of elongation factor P from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 40
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1uebA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA03
4Y52H 2UU9Q 5LMUQ 1CKMA 3K7AH 4GNXB 3CC2T 3U4VA 3K7UC 5GAEC 4HIDA 5JEAJ 1JT8A 4JYAL 1X3FA 1YVCA 1Q86C 4DUZL 4NPSA 1KC8C 3KF6A 3M9BA 1N34Q 4JV5L 5JJIA 2Q2UA 4X62L 4HIKA 2LQ8A 2PMZE 1S40A 3G4SA 1K83H 3HOXH 5LMUL 1IBKL 1W2BA 2UU9L 2ZJQA 3GTLH 5IT9E 4DV7Q 3S16H 1SR3A 3Q8DA 4YCVA 3CCRA 4MTNA 4GKKQ 2D0OA 2OTLA 2KDSA 5IWAQ 1EIYB 3CCUT 2R7FA 5K36G 1UE7A 5C3EH 4LNQA 4K0KQ 4ZN3A 4X64L 1CUKA 1QVGA 2PNHA 3RN5A 4LFCQ 3F1ZA 4A3MG 4BBRH 5IP7H 4DV7L 4GLXA 4A3EH 4GKJQ 3S15H 4QY7A 4YCWA 5JEAG 3J81i 4OO1G 2VNUD 4A3KG 3CMEA 1XTDA 3RNUA 4R4QA 3D0FA 1UWVA 1UE6A 2I5LX 3BZKA 5M5XH 4JI4Q 3PF5A 5M3FG 2ALYB 2R93H 3HOVH 2OTLT 4GLAC 3HOYG 2ASBA 3HOUH 3ULPA 2MWPA 5M3MH 1Q7YU 3NELA 1ASYA 3S2HH 1Y1VH 3S1MH 1N36Q 1YJ9A 3GD7A 3NENA 1O7IA 2PQAB 3KJOA 1EWIA 2JE6I 3KF8B 4JI4L 2JK8A 1PFSA 1GKHA 3I56A 2K75A 4BA1I 2KHJA 5IP9H 3CXCS 4L5QA 1QZGA 5J3BA 1AE3A 4DV1Q 4JI8L 1U5KA 4LF6L 2Q2HA 2QGQA 4UP9A 4B3ML 1NJIU 1PVOA 1VQ6A 1IXRA 3PUZA 4XIGS 1N36L 1HZ9A 4R4OA 4X6AH 2OQKA 3CCLA 1FVIA 3A0JA 3KLWA 3PCOB 4QGUA 1YJ9T 2NZOA 4A3GH 1N9WA 4C3HH 2F52A 4JBKA 5FLMG 1FGUA 2EQSA 2JA5H 3I56T 2A8VA 1D8LA 4DV5L 1GO3E 1Z47A 1SE8A 2GN5A 4DR5L 3HOXG 1PH3A 2R7ZG 4B3SQ 4LF8L 4O2DA 2H5XA 2N3SA 4B3TQ 4HJ7A 2JA8H 1VQ6T 3A5ZB 1Q81U 4BXXH 4DR2Q 2KVQG 2Q2TA 1M1GA 3CPWS 3CCLT 4JI1Q 1XMOL 3H0GH 5C3EG 4AQYQ 1JMCA 2MWOA 3RR5A 1CKNA 2CCZA 4DUYQ 4A3EG 1HZCA 4HJAA 4B3TL 3TREA 2N49A 1MIUA 1GD7A 2MQHA 1B70B 2LXJA 4ZN1A 5LMNQ 1K9MU 3K80C 1NE3A 3UDXA 4X34A 2UUAQ 2E6ZA 2JUFA 1WI5A 3HOVG 4IJLA 2JA7G 4DUYL 4X65Q 1YITA 4MZ9A 1L1OC 1XJVA 3KBGA 2ID0A 2VQFL 2R6GA 2IX1A 2HIVA 1X3GA 3SGIA 3OTOQ 4XTCS 1N33Q 5GQOA 2ZM6Q 4P75A 2UXDL 3NEMA 4R4CA 4FDBA 2UUAL 5IP9G 1FJGQ 2G3RA 2MO0A 1BBUA 1EQQA 4DAYB 4X65L 4WJ3M 1BBWA 1SMXA 1BVSA 4PZ7A 1CKOA 1Q8KA 4A3MH 2UXBQ 1A0IA 1HR0W 3OTOL 5IAYA 3CD6A 2AWNA 2UUBQ 4TQUS 3PO2H 4DR4L 1XPUA 1JJ2S 4A3KH 2GVBA 3AYHB 1PV4A 3S1QH 3DB3A 3CCMA 1SN8A 4L5SA 3F2CA 4DR5Q 3ULJA 5C44G 1YHQT 1A62A 3J80i 5BR8L 1VQMA 4IO9A 2DUDA 4LF4Q 3CMAA 1TWGH 4OWWB 4DV0Q 4CRIA 2Q2IA 4JI0Q 3HOYH 3J81c 2K5NA 4Y7NH 3G71T 2ZJPA 2UUBL 3G6EA 1JE5A 3RN2A 2JA8G 1NY4A 3I4OA 1HR0L 1YJNT 3F8TA 2CFMA 3W5OA 3CD6T 4APVA 1E3PA 4IJHA 1KD1U 4JOIC 1VQPA 4H02A 4JBWA 3TEHB 4BY1G 4R1JA 3CCJT 4LF4L 4QQBX 5JJLA 2LCLA 4DKAC 2E5LL 2GVAA 3CCMT 4GOPA 2LSSA 2XHCA 4A3BG 1VQMT 3OW2S 3CMAT 3J7A5 4NXML 2BA0A 5C0XI 1A63A 3CP0A 4LUOA 3S24A 4QL5A 3H3VI 1N8RC 2F4VQ 3G6ET 4GNXA 3PUXA 2HHHQ 3CCET 1OXSC 4DV6Q 2NN6G 4UPAA 1NMFA 5FLMH 1VQ4T 2VL6A 3PUWA 3M4OH 4JBMA 2MNAA 1P8LA 3RZDH 4LF5Q 1K8AC 1VQKA 1WYDA 4JI2Q 2Z6KA 4X66Q 3M4QA 1WFQA 1PYSB 4GN5A 4JC0A 1WJJA 4L5TA 4GS3A 1PH2A 3F2BA 1VQNA 2C35B 4YHHQ 1VQ8A 3RLFA 2OWOA 1NPPA 1PH4A 3HOZG 2HHHL 1N34L 1YIJA 1V43A 3TQYA 4DV6L 4ALPA 1PH9A 3CPFA 1HNXQ 4IOCA 4LF5L 3J81E 1FL0A 1HZAA 4JI2L 2IT1A 2RHSB 2ZJRA 2RHQB 5GROA 3S1RH 1IBLQ 4LFBQ 4O0AA 1XPRA 4QIWE 3PO2G 3G4ST 1VQKT 4R4IA 4GKKL 2Y0SE 1VQGA 3UDGA 3GTPH 5IWAL 2QEXA 1IYJB 1VQNT 2OCEA 3A5UA 1VQ8T 3CCRT 3K8AA 3LH0A 4K0KL 4JI7Q 2DO3A 3HKSA 2B3GA 4LFCL 1YIJT 3ZJYC 1L0WA 5IYDG 3T1HQ 2JA7H 1VQIA 3GDEA 1IBLL 4GKJL 4BY7H 1KAWA 4A3LH 2IY5B 5EAYA 4IFDI 2NVQH 2WB1E 3L7ZC 1VQAA 4EX5A 3OYYA 3PUYA 3BZCA 4DV3Q 4YTLA 2PQAA 1YJWA 4JI7L 1XNRQ 1M90C 3CMET 4GN3B 4YWMA 2QEXT 1Q82C 3PV0A 2JA9A 2JVVA 5DM7R 1Q1EA 2JOYA 2WP8J 1A8VA 2VW9A 5ELOA 1X54A 2Z0SA 2K52A 4RMFA 3OW2A 4JBJA 1SFOH 1ASZA 4YCUA 2MFIA 5C4JH 1K73C 2K4KA 2B63G 1BKBA 2I5HA 4UP7A 4DV1L 2RF4A 4OWXB 1GM5A 5C44H 4QJFA 5A2QE 3ERSX 4P71A 1YJWT 5IY0A 4A76A 2CKZB 1YHAA 1S3OA 2K5VA 1YI2A 1KRSA 2CKKA 2AHOB 3KDFB 4OONA 1Q86U 3GO5A 4QQDA 4WJ4A 1KC8U 1N32Q 3J80c 3UE1A 4DK6C 1VQOA 1NBWA 1Q46A 1VQJA 3G48A 3S17H 1X56A 2YTYA 4BY1H 2CWPA 4MNOA 2AKWB 4HIMA 1QZHA 1Y1WH 1RL2A 3U58A 4B3SL 4YWKA 1QVFS 5HGQA 5LMNW 4A3BH 4IPHA 1N32L 4AIMA 4DAMA 3IRBA 3RLOA 5IYBG 2EXDA 4DR2L 3GTGH 3PIOA 1E22A 3H15A 1YI2T 4AYBE 4JI1L 1AH9A 1K3RA 4HJ8A 2DGYA 3L0OA 4AYBG 3GTJH 1LTLA 1OTCA 1K0RA 1IBMQ 4AQYL 4UY8C 1X55A 2E70A 1VQOT 1KQSS 2FXQA 2NVYH 3E9HA 2WAQE 1M1KC 1EIFA 1NMGA 2WAQG 3UDIA 3KYHC 4BY7G 3A74A 4C2MH 4A3LG 1L1OB 4IPGA 4JI3Q 1HNZQ 1TWHH 5LMNL 1I50H 3HOZH 4DR3Q 3M4PA 5GAHC 5C4XG 1JJCB 3H3VH 4B3RQ 2R7DA 3CXCA 4DR1Q 2E2IH 3NBHB 2OTJA 1KRTA 2D0PA 4AH6A 3RLNA 2ZM6L 4PZ6A 4JI3L 4POGA 1YITT 1N33L 3PF4A 3J80E 3PO3G 4IFDG 4HJ9A 2AMCB 4PZ8A 1TXYA 3FKIG 4LW1A 1FJGL 3KOJA 5AJ3Q 1G51A 3T1YQ 2YV5A 1PHJA 4DR1L 1QUQB 1K8GA 1VQ9A 1YHBA 2UXBL 5IYDH 2E2HH 1QVCA 5FLXc 3ER0A 3GTQH 2JJQA 3E0EA 3CCQA 4LUZA 1X6OA 2MI6A 1K73U 1Q1BA 1VQ7A 4UP8A 2OTJT 4A3DH 4A3JG 3HOWG 1E24A 5AJ3L 1S72A 3FHWA 3T1YL 3I7FA 2YTVA 1SROA 4A75A 1CSQA 3CPWA 2QA4A 1AE2A 2ZTEA 3I2ZA 4DV0L 4JI0L 2JEBI 1Y1WG 1PH6A 2HQLA 1VQHA 1YEZA 2IG0A 1SSFA 1Q7YC 2K14A 4P74A 3B6YA 4A3IG 1VQ5A 3JAMi 1KIXA 1VQ9T 3J81j 2VZAA 1WCMG 2A1AA 4DPGA 5M5WH 1I94Q 3CCQT 3K81C 1NTGA 2KCMA 5GAGC 2B63H 1NPRA 4BBSH 3AQQA 2NVXH 3HFZB 1TWFH 1V9PA 1OXUA 2WFWA 4R4TA 2CWAA 1S72T 1NJIC 1VQPT 2VQEQ 3ICEA 1PA6A 3HKZE 3S2DH 4LWCA 4GOPC 1PH1A 3E9IA 3UE0A 2A19A 4YY3Q 2I5MX 2MO1A 1XNQQ 2XTIA 1HJPA 2YYZA 2V1CC 4KHZA 4GOPB 2F4VL 1VQ5T 2LVMA 3AFPA 1U0LA 1E7ZA 4KLKA 5C0XG 1I5FA 4JV5Q 1J6QA 4GNXC 1UEBA 4IOAA 4A4IA 3CC7A 2VQEL 1HH2P 1IBKQ 5FLXE 2R7ZH 1YBYA 4J15A 4POFA 4X66L 3CCUA 3KF6B 4YY3L 1XNQL 5IYCG 1C0AA 3LGFA 2Z6KC 4DNIA 4YHHL 3I55A 2B29A 5IYBH 1Q81C 3LGJA 4A93H 4LFAQ 3VDYA 1XMQQ 1OXXK 2AWOA 2Y0SG 3PSIA 1JJ2A 1MJEA 4A3FH 1HNXL 2PI2E 4X64Q 4IFDJ 4DV4Q 4ME3A 4OO1I 4JI6Q 2OQ0A 3AEVA 3GTKH 1C9OA 1D7QA 2NZHA 1EOVA 3LGLA 1B8AA 3CC7T 4LFBL 1LUZA 3I4MH 4A3DG 3W1GA 3CC4A 5FJ8H 5H1SE 1XMQL 3M85A 4LFAL 2WB1G 2VS1A 1K9MC 1G291 1VQBA 3I55T 4DV4L 4JI6L 3I4NH 5C4XH 4L5RC 3T1HL 3MXNB 4OWTB 5LL6S 3DM3A 1W3SA 1LM0A 3CQZH 1E1TA 1J5EQ 2VUMH 1TWAH 2VY3A 2IX0A 3PO3H 3CCSA 3WWVA 3L2PA 4DR7Q 4GLVB 4EQ5A 2E2JH 4DV3L 3S14H 1B7YB 3FKIH 4BBSG 1XNRL 5J26A 4JI8Q 3CC4T 1E1OA 3AFQA 4LF6Q 4B3MQ 2R92G 1EUJA 1YZ6A 3U4ZA 4DV2Q 2I0QA 4JI5Q 1J5EL 2JA6G 1N8RU 4DR7L 2KENA 1VQEA 5IE8A 3K0XA 3J7AF 1L2FA 1GVPA 5M5YH 1R9TH 1IZ6A 3KDFA 2ZTCA 4A3JH 3HOWH 4A3CG 3ULLA 3DLLA 3TS2A 3CCST 3PIPA 2YTXA 4DV5Q 2PI2A 1MJCA 1K8AU 1OXTA 1VQFA 2EIFA 1CSPA 2RCNA 3P8BB 1T9HA 4JI5L 4DV2L 1JB7A 4LF8Q 3GTOH 3EN2A 1TWCH 4NB3A 3TS0A 1Y14B 4A3IH 4TVAB 4GN4B 4A93G 1EFWA 1KHIA 1P16A 4TVRA 3S1NH 1WCMH 4LF7Q 4NXNQ 2JEAI 1XMOQ 1KD1C 2K50A 4A3FG 3FP9A 1XNIA 1KL9A 2BH2A 1I6HH 3JAMc 2HT1A 4KI0A 4OX9Q 1EYGA 2ES2A 1C7YA 2KHIA 1Q12A 2BA1A 3PUVA 1EQRA 3I4MG 3DB4A 1H95A 1PH7A 3KJPA 2LXKA 4NXNL 1HZBA 4LF7L 5FJ8G 3UDFA 3BU2A 2ZTDA 1CKNB 1G6PA 2F3IA 2ATWA 1JJGA 2N8NA 1XPOA 3CCVA 4KHPQ 1L1OA 1IBML 3CW2C 4IPDA 3I4NG 4P73A 3W1BA 1PH5A 4BBRG 5IP7G 4OX9L 2VQFQ 2K5HA 2E8GA 1PH8A 3JC66 3CF5A 2KBNA 2N78A 3MEFA 2UUCQ 4P72A 1V1QA 2VUMG 5IYCH 4LUVA 2L15A 2UXDQ 1HNZL 5GADC 4PMWA 4JCVE 2NVTH 3U50C 4DR3L 3RZOH 5E7NA 4KHPL 4RG2A 1M90U 3EBEA 4IPCA 4OXPA 2R93G 4PG3A 1W2BS 4B3RL 3HOUG 1Q82U 2JNGA 5M3MG 1VCIA 5JJKA 3CCVT 1Y1VG 2UUCL 5DLQE 2CQOA 3STBD 1QUQA 4LF9Q 1X9NA 1VQLA 3CAMA 1YHQA 1WOCA 3D31A 4DR4Q 1I3QH 2XGTA 3J7ZC 4DR6Q 1QVGS 3G71A 4HIOA 1VQDA 4YWLA 5BR8Q 1HNWQ 2YU9H 3JAME 5C0XJ 1NZ9A 1PYBA 1YJNA 4C3IH 2IHEA 2JQOA 4LF9L 5IT9c 2UXCQ 1IL2A 3CCJA 1SRUA 5HY6A 4JOIA 1HR0Q 1RIPA 1QVFA 3BJUA 1MKHA 1SLJA 1VS0A 1DGSA 4DK3C 3GTMH 4A3GG 1VQLT 4DR6L 1KXLA 2JA5G 1VQCA 2D62A 5ELNA 5M3FH 3TRZA 1HNWL 1VQ7T 1LYLA 1UE1A 1X65A 3CC2A 2HIXA 2E5LQ 2R92H 1YNXA 2UXCL 3STBC 3KFUA 2BH8A 1KQSA 3CCEA 4NXMQ 4BXXG 2QA4T 3HKZG 2NN6I 2IHFA 1VQ4A 4RG1A 4HJ5A 1I94L 3PGZA 4DUZQ 2JA6H 4JYAQ 2L3RA 3H0GG 1Z9FA 3M7NA 1UE5A 3M3YH 3F2DA 4C3JH 3EIVA 1X3EA 2KCTA 4JG2A 4X62Q 4A3CH 1OXVA 1M1KU 4BA2I
chains in the Genus database with same CATH superfamily
1UNSA 1TIID 4Y52H 3E3XA 4NOYA 2ZT9C 3U4VA 3I4NB 5C4XB 2ENMA 2L11A 5JEAJ 4JYAL 1X3FA 4NPSA 3VUBA 3OYAA 3PQIA 5A0LA 1UE9A 3KF6A 3CQZB 2VUMB 3F2UA 3FDRA 1TWAB 3LYIA 2RKSA 4K5XA 2UU9L 2EQUA 1TWBA 5IT9E 1AWWA 1G8ZD 3S16H 2HCCA 4BY6B 3CCRA 1N6AA 1W6XA 4M78C 5GAMf 1EIYB 3CCUT 5K36G 1X32A 4LNQA 2FG0A 1O75A 1UECA 1IW7C 1CUKA 1QVGA 3RN5A 4PMBA 3F1ZA 3CC4Q 4A3MG 5GANg 3DEOA 4BBRH 2B2WC 1R9TB 1DOKA 4C3IG 3X20B 4M1UB 4YCWA 3S15H 1PRMC 3JSCA 5A35A 2QK0A 4A3KG 3QOJA 3RR6A 3WVDB 4JI4Q 4J9HA 3OA6A 3BZKA 4A3IB 1TWCB 3PF5A 2RHIA 5M3FG 4K5VA 2IPOB 5I22A 1OU8A 1WCMB 2O01E 5E4XA 3JCMW 3S2HH 2A36A 3I70A 2MK5A 4MZPA 1O7IA 4ATOA 2PQAB 1EWIA 2JE6I 3KF8B 3TSSA 2JK8A 5FO8B 3CXCS 2WSEE 2DEUA 1U5KA 4C3JG 2QGQA 3D6CA 3QSUA 1NR2A 4UP9A 1IXRA 2FPDA 4C0DB 1RODA 1HZ9A 1OO9B 4X6AH 3QKJA 2OQKA 3VYSA 1R4PB 2F3WA 3SWNC 3KLWA 3RKYA 3J81L 4WFN3 2NZOA 2OXPA 1D5XC 1N9WA 2E10A 4JBKA 1JJ2P 2QQ9A 1FGUA 2EOTA 1I4HA 3BY7A 4DV5L 1PH3A 2XICA 2GN5A 4B3SQ 2CH4W 3H0HA 4J1MA 1RCVD 4KK7A 4HVVA 3NQIA 3VS0A 1J9OA 1GBRA 3V96A 3HHTB 2QDYB 4DR2Q 4MTKA 1SYDA 5GAOq 2PQWA 3H0GH 4M77D 1JMCA 1SYGA 4PL6A 3RR5A 3SB2A 4ZLTF 1VF5C 1QWFA 2EE1A 2LT1A 3TREA 5CV6A 2N49A 1P92A 4RGMA 2YU9B 4ZN1A 3ZL7C 2EYXA 4EMKB 4C3IB 5LMNQ 2QF7A 2JUFA 3HOVG 3M4GA 2A69C 1B3AA 4DAPA 5I2SA 4DUYL 2JA7G 1YITA 1L1OC 4KH1B 2XU8A 2IX1A 5M3FB 3OTOQ 1LOJA 4IIOA 1KABA 5GQOA 2FZKB 2UXDL 2EYJA 1R8OB 2R92B 3NEMA 4FYVB 3MP8A 4XQ3A 4FO2A 2UUAL 5IP9G 3AMUA 2G3RA 2MIOA 2RK2A 4MDXA 1BBUA 1U3OA 4J7IA 3EA6A 4K6LA 2EVRA 2KRNA 1PFNA 1SMXA 3BVZA 3JB9I 1M1KR 2J4XA 2LCCA 3M3YB 4C3JB 2RHUA 4ZUIA 2CP7A 2NUZA 3O5ZA 4HKEA 2UUBQ 4DR4L 1STBA 2EYHA 3SXHA 1XYIA 1TOVA 2FB7A 2KYBA 4A4FA 2B2UC 4NS5A 1MNDA 4JJNK 3CCMA 4KY7A 5CKEA 3F2CA 2B2VC 5C44G 3J80i 4OMPA 5ECAA 2O5JC 1VQMA 5C6SA 5LL6X 4F7UE 5E3FA 3G71T 2A3LA 1CFMA 1GL5A 4DOWA 4X3UA 2P4RA 1D0XA 1ET6A 1K83B 3MTSA 1E2ZA 2CFMA 3MC0B 1H95A 4IJHA 4K2LA 2DY7A 4JOIC 5KIXA 1FMVA 2BZ8A 4R1JA 4JK1C 5JJLA 1JU5C 4KKTA 3EGDA 2GVAA 3CCMT 4G7OC 1LT6D 1VQMT 1LT3D 1S5ED 4RHSA 2EGAA 2NWMA 3J7A5 1B34A 5HURA 2BE5C 5LJ5h 1A63A 3EG1A 3L2ZA 3S24A 4E2FB 4QL5A 4B9XA 1N8RC 1F9SA 2PW7A 2KR3A 1M30A 1PCXA 1F2YA 3PUXA 5CYUA 3J7YW 2HHHQ 3JCMV 1W4SA 2QTXA 4UPAA 5IODA 1MUZA 1EYCA 2VL6A 3PUWA 4JBMA 1RUWA 2ZXPA 3RZDH 2RN8A 3IQLA 1Q7YR 3M4QA 4GN5A 1PYSB 4FF3A 3HOVB 1E6HA 4HMJA 4YHHQ 4V2SA 3HOZG 1YWOA 4QVDA 1YIJA 2BKDN 5CKHA 1N34L 3S1MB 1PH9A 2KRMA 2VB2X 2KRSA 2RDFA 1YCSB 1QKXA 1OEBA 2OTLQ 1FL0A 3H9NA 1EY6A 5CBAE 1QCOA 1UGSB 4C92E 5JPMC 2K05A 2JXMB 1ZKOA 1RI0A 3ND9A 2YT6A 5DM63 3T9NA 3X25B 2K3XA 3UDGA 1WI7A 2QEXA 2OCEA 3A5UA 2EY2A 2DO3A 3M59A 1JCKB 2JXBA 1YIJT 2R61A 1L0WA 4G57A 1PG5B 2FRYA 1ZSZA 4C3HB 2HBPA 2SDFA 1IBLL 5EG2A 1KLGD 4DK0A 2JA5B 3Q6SA 1EYDA 4X3KA 5EAYA 2AHJB 2HBWA 1Q81R 1OTCA 3WVEB 2DN8A 1VQAA 1U06A 4JRIA 3OYYA 4F16A 2JTMA 1NYGA 1YJ9Q 3I3CA 4JI7L 5KCOA 1M90C 1HTPA 4RCNA 2QEXT 1Q82C 1SBBB 3TP7A 1VIFA 5CR2A 1IB8A 2WP8J 4R0KA 2DNEA 3FB9A 4JBJA 2M00A 2QKIC 3S3MA 1SFOH 1K9MR 2NBFA 2NTSA 1K73C 3CHBD 1UGVA 1BKBA 5CIUA 1B07A 4FM4B 4C56C 3MXGA 5JOBA 4QJFA 1FYNA 1HRJA 1PZKD 2CT3A 3GBQA 1YHAA 3OIQA 4A76A 1KFZA 3GF5A 1YNNC 1STGA 4QQDA 2DETA 5LJ3g 1STNA 2PMZB 1VQJA 1Q46A 1RAFB 1YFNA 1H9SA 2AKLA 2VXEA 1LNXA 2DE0X 2AKWB 4Z8AA 2PVDB 2RQXA 1PHTA 1EYAA 1V1PA 1KQ2A 2E3HA 1QVFS 2X35A 2HD3A 1CSKA 2AT1B 4YWKA 1DYQA 4IPHA 4AIMA 3VS5A 1N32L 8ATCB 3IRBA 3RLOA 4DAMA 2EXDA 3GTGH 1E22A 1EQTA 1GOZA 4X9DA 2AQ1B 4AYBE 1N9RA 1AH9A 4HSPA 1SEMA 1B9MA 4P5NA 1T5EA 2NN6H 1X55A 2E2DC 1HQMC 4KHVA 2WAQE 2RPNA 1EIFA 4PNYA 3UDIA 4J9FA 3R2IA 4C2MH 1WVLA 1L1OB 1H9KA 3HOYB 1M8VA 2D8JA 2C06A 1TWHH 3EH1A 4IUTA 4DR3Q 1M4ZA 5GAHC 4CC2A 5KYUB 2ED1A 3OYDA 3ITPA 3H3VH 1FNWA 4M75F 1YHQQ 2EJFC 2L3SA 2RI3A 2OTJA 1UAPA 4DEYA 5LJ5j 1TTHB 4DAYA 1N33L 4PZ6A 5GMKe 3PO3G 2EFIA 2K01A 1M3CA 2QXFA 4XTUA 2AMCB 4DU9A 3FKIG 1FJGL 3CD6Q 3KOJA 2YRVA 3GNFB 2WKDA 1ET9A 1G51A 1BK2A 5GMKl 1TXQA 1YHBA 1R0CB 4L5GA 2K32A 4XT3B 3M53A 4E7ZA 4PFPA 4FSXA 1BCPB 2OTJT 4B08A 1IHVA 2BZYA 2XDPA 1HJDA 3PFSA 3FHWA 4J6HA 3THKA 2NB0A 1WIEA 4RKLA 2CW0D 3CCEQ 1CSQA 1Z9ZA 1AE2A 4CKEA 3C0CA 1Y1WG 1PH6A 1YEZA 5KYXA 2IG0A 1SSFA 1VIEA 3B6YA 1VQ5A 1WX6A 1KIXA 1X69A 2H8HA 2VZAA 4J9EA 2A1AA 3FC3A 5AYFA 1ZUYA 2J05A 1T3LA 4EMHA 2KCMA 4OB3B 2RI2A 5GAN5 2QG9B 1N27A 3C1FA 1GUWA 3HFZB 4LK1C 3DMUA 3EG0A 2L55A 1RADB 3UA7A 1ILPA 2CWAA 1NJIC 2HNIA 1VQPT 1WQ7A 1SE4A 3W2DA 1V1OA 2GQVA 1QOHA 3UE0A 4M78D 4YY3Q 1SKUB 1HJPA 4QB4A 2V1CC 4KHZA 2F4VL 1VQ5T 1EFID 1E7ZA 1HK9A 2PPBC 2EYYA 1J6QA 1IW7D 4ME5A 4IOAA 1VQNQ 1DCZA 1A3UA 5GANf 2JM8A 3CCRQ 1EOTA 3TN2A 4A4IA 2VQEL 1EQVA 1JR0D 2AQ2B 3QDFA 1XNQL 2YXYA 3K5OA 2DZCA 1C0AA 1DOMA 2B29A 1K9AA 2HKQB 4RTZA 4LFAQ 5GMKh 2Y0SG 3PSIA 4Z9CB 2LJ1A 1MJEA 4KD3A 1G83A 1HNXL 4IFDJ 4R56A 5CMDA 5CR3A 3SK8A 3GTKH 2F0JA 1G91A 3L42A 4HN7A 1SJHD 1Z6HA 1UEAB 1UHCA 3M0RA 3P1HA 1LUZA 4A3DG 3W1GA 3CC4A 3MCAB 1F77A 2E5QA 2CUBA 2RJDA 3W3AA 2JTFA 4BACA 4DV4L 2IVWA 3I4NH 1TUDA 2OJ2A 2RMOA 2L0CA 1LCKA 1NG2A 1XWEA 5C4XH 3IKJA 5LJ5d 4OWTB 1HA6A 2K7AA 5LL6S 1WXUA 1W3SA 2RI5A 1YJWQ 3GPLA 3CQZH 1E1TA 4BY1B 2VUMH 1KNAA 3C95A 2COWA 1PLFA 1ESRA 1FYCA 1TWAH 1Y1WB 4Y92A 3VR4A 3L2PA 3P7JA 4EQ5A 2CSQA 1ZBXA 1I6VC 1GRIA 4XYOA 1B7YB 3Q22A 1TSFA 4A3BB 4JI8Q 3QIIA 3CC4T 1RKNA 3C3LA 1FXXA 1JBMA 1AW7A 3NWTA 2HSPA 4DAVA 1VA7A 1L0XB 3U4ZA 1NM7A 4OEMB 2ZXOA 3GTJB 1J5EL 3INZA 4II1A 2AUJD 2H1EA 2EYFA 2IW3A 1X3PA 2YDLA 1SNOA 5CBEE 1N8RU 1VQEA 1BU1A 1R9TH 1QMCA 5KCHA 5GAMh 2C9OA 5IT9L 1X43A 2BDNA 2YTXA 4M77F 1IHZA 1MJCA 1I50B 2PI2A 5EBCA 2RDGA 5C5MA 4JI5L 2A68C 4IUVA 3KUFA 1GCPA 3HRTA 2RQWA 1TWCH 2K5QA 3EN2A 4JUVA 4NB3A 3TS0A 3K5NA 1TS9A 3VS6A 4TVAB 3ZFJA 3FLGA 3BDLA 1AEXA 3QWYA 1WCMH 2KA7A 1BIBA 4LDVA 4HSVA 2RO0A 2L2PA 1KD1C 2A69D 2KQWA 5E4WC 2E41A 3TEEA 3FP9A 5CAIA 5I9OA 4RCCA 1TS5A 2K7VA 2VB6A 3NSWA 4KI0A 2Q8IB 2I0NA 4C8QA 1TY2A 1C7YA 2ES2A 4OX9Q 3PUVA 1H9SB 3I4MG 3RKXA 1O80A 1HZBA 4LF7L 2V8IA 1YITQ 4BDZA 3BU2A 2W10A 1U9RA 2F3IA 3JB9J 4PJOA 2N8NA 4QUCA 1XPOA 3GTQB 2R58A 1ENAA 5C0XH 2DBMA 4IPDA 3M57A 1RTOA 4A3DB 4P73A 4J9IA 4K8IA 1J8IA 4DNTB 3JC66 2KBNA 2N78A 3R93A 5HKCA 2ZCFB 1V1QA 1BNZA 1FWZA 2M16A 4M77A 2EPDA 2KBTA 5DAUA 2LFNA 2R93G 2ROLA 4OMFB 1M90U 3EBEA 3X28B 4PG3A 4B3RL 1YWPA 1Q82U 5M3MG 1S5CD 1WQWA 4I7AA 1MMGA 1Y1VG 2B63B 5IHIA 4ABNA 3STBD 1QUQA 2A8VA 3D31A 4KN7C 2J7ZA 1DJ7B 4KUIA 2XGTA 5NUCA 3J7ZC 1DXMA 1DJRD 3C1EA 2DRMA 4YWLA 5BR8Q 1UJYA 1IXDA 1NLPC 4OELB 3JCMe 4ZGEB 4JZ3A 4HVUA 1PYBA 2YU9H 2DL5A 1YJNA 2LQNA 4C3IH 4C1NK 3NBIA 4LF9L 1EFNA 1WTQA 2BE5D 4HEDA 1SRUA 2DK3A 1WHMA 2LX9A 2K6AA 2QGFB 1HR0Q 4A3GG 3H91A 1DGSA 2VUBA 1SNQA 3JCMb 5M3FH 1HNWL 2DF6A 3TRZA 1GXIE 1X6BA 4IFDH 3LWIA 1LYLA 2E5LQ 3CC2A 2VYTA 3V7CA 1ICWA 2R92H 3TCJA 1YNXA 2UXCL 1WHKA 3KFUA 2BH8A 1KQSA 4JW0A 3FJ5A 4NXMQ 4BXXG 3HKZG 1YP5A 2NN6I 3NPFA 4RG1A 1I94L 1NEGA 2L0AA 4GBQA 3M7NA 1UE5A 3M3YH 1HFGA 1NUCA 3F2DA 3MKDA 4C3JH 3I4MB 1A3VA 1X3EA 2KCTA 4A3CH 4BUGA 1EZ8A 2RHZA 4RGNA 2CGHA 4LDWA 5AT1B 1QQJA 2YRDA 4OP0A 1CKMA 3HTRA 2DXCA 3CC2T 4HIDA 2YLBA 3CU7A 5GAEC 1NAPA 4A4GA 4DUZL 2DL3A 4KKSA 4JV5L 1V1CA 2Q2UA 3H09A 2RCFA 3MEAA 2LQ8A 3M0QA 1LT5D 1K83H 4BY6C 2PMZE 2V4DA 2I07B 1S40A 1IBKL 2E2JB 1AN8A 4DV7Q 4EVOA 2QASA 1GCQA 2QEXQ 1SR3A 3Q8DA 3PO2B 3UI2A 3EHQA 2OTLA 1M1FA 1NE8A 4RTYA 2KDSA 4DN4M 5IWAQ 5GAMj 1BCMA 2P0KA 4KRTA 1S5DD 2DM1A 3E9FA 4FYDA 1QW1A 2BZXA 4ZN3A 3FEWX 3CPWP 4LFCQ 2KNBB 3NP8A 2RHYA 3RKWA 1K8AR 2PCFB 3A7AB 5IP7H 4GKJQ 2OT2A 4OMOA 4C8QG 3LWHA 2EYZA 1VYVA 1AT1B 4JRQA 3J81i 2AK5A 2A28A 3CMEA 2X4JA 4ID6A 4R4QA 1TR5A 1UWVA 1BI2A 1DOLA 1KQ1A 4PJOG 2ALYB 3HOVH 2OTLT 4GLAC 1WTOA 3R6NA 4A63B 2Q8RE 1BI1A 1S4ZA 2F3VA 3ULPA 3NELA 1ASYA 4WORA 1CKAA 3S1MH 4AT1B 3ERQA 1N36Q 1YJ9A 1PTOB 3GD7A 3NENA 1H3ZA 2A6HC 4D6WA 2EYMA 4JI4L 1IKLA 2VGMA 2P5ZX 5IP9H 1F9QA 4L5QA 4ELZC 3HKZB 4UDUC 4LF6L 4B3ML 1VYUA 1NJIU 1BI3A 4XIGS 3P75A 4PNOA 3OWFA 2F5TX 4LN2A 2A0FB 4H0LC 5IGDA 4FW2A 1Z7TA 3EAEA 2P0QA 1MV0B 1YJ9T 3DLMA 1SNCA 1TUCA 4C3HH 3KUPA 4C5EA 2PTKA 3OYHA 2EQSA 2JA5H 3OPOA 1QVPA 2GQIA 1LPLA 1OZ3A 6AT1B 1D8LA 3TP6A 1GO3E 1Z47A 4F88A 2HL5C 3MAQA 3HOXG 4DR5L 1M8MA 2FJ2A 3DEPA 4B3TQ 2X6GA 2PUKB 3A5ZB 3N5BB 2NZ1D 1D3BB 2KVQG 2Q2TA 1M1GA 3I9QA 1AD5A 1TKWB 4JI1Q 1XMOL 5A0GA 2KXCA 1TU2B 2O4XA 5C3EG 2XDBA 3MFYA 3ULRB 4HT8A 4LAAA 5IGEA 1I3QB 3OBWA 1CKNA 2CCZA 2WV6D 4A3EG 5EKKA 1HZCA 4HJAA 4M7AA 2O5IC 1AZGB 5CV4A 1GD7A 2MQHA 2LXJA 3A8JE 3GV3A 2AKKA 1A15A 1KDAA 2F1MA 3K80C 1NE3A 1M8AA 3BW1A 2OTJQ 4N9TA 4K11A 1LACA 2QCPX 2CH4A 2PZ1A 5KYYA 3GTMB 4ELYC 4MZ9A 3QJYA 2AQ3B 3NUCA 4QVZA 2VQFL 1Y71A 1XJVA 2NUTA 2R6GA 4PJOB 4M7DA 4XTCS 5GAMd 1X2KA 2RSNA 1LTRD 1QKWA 3MHBA 3NK9A 2IL8A 1VQLQ 2WKCA 1BBWA 3BFMA 2M2LA 2XI9A 3T56B 1K3BC 4PZ7A 1CKOA 2UXBQ 3MP6A 2X69A 3OTOL 3CD6A 2F2XA 5CGKA 1MSHA 3K59A 4KJNA 3R6OA 1D1IA 2XWJB 1JJ2S 2DYIA 4BI8B 1WJSA 3TDQA 3VYHB 4LUEA 1SN8A 3EGXB 3H6MA 3FIFA 1T0JA 1UUEA 1YHQT 1A62A 4IO9A 2DXBA 2ZGWA 4LF4Q 4DEXA 4E7SA 3HOYH 5EPJA 4FF1A 1O7ZA 2ZPFB 2J06A 2UUBL 2V8KA 2JA8G 2EAYA 3CBPA 3NFCA 3HOXB 1WHLA 1X27A 4M78F 3CD6T 1KD1U 1U1SA 4H02A 4JBWA 2GFAA 2MMPA 1JORA 3M0PA 4GOPA 2LSSA 5C3EB 2DX1A 4RTUA 1ZUUA 2BA0A 3VJPA 2KHSA 2QEJC 5C0XI 2OX7A 4A3EB 2CZ6B 2WSFE 1JOOA 4GNXA 1MGSA 3CCET 4KT0E 2ATCB 3SVMA 2JJ9A 5FLMH 4O42A 1U4RA 3GTPB 1CT1D 2B8GA 2CP6A 2VWFA 2QQBA 4X3TA 5M5XB 4JI2Q 2EJMA 3ASKA 1WFQA 2DZ9A 5FU6C 1GUGA 1MD2D 3SR1A 1VQNA 2CQAA 3A8IE 3F2BA 4PFZA 3HOUB 1NPPA 1F2LA 2F0VA 2EW3A 2HHHL 2Q8TA 1V43A 1K1ZA 4HCEA 4DNRB 1WTHA 3AHUA 3QBYA 1QP3A 3CKIB 3FRPB 3VA5A 4FF4A 3EG9B 4LFBQ 1D1CA 3HRZC 3OYFA 5GAOm 3PO2G 4GKKL 4R4IA 2Y0SE 2DERA 2YWWA 1B53A 4GY5A 1J3TA 2Z9HA 1VQNT 3FDTA 3RUZA 3CCRT 3LH0A 4K0KL 3ZJYC 4J6YA 5IYDG 3D4WA 2DTIA 3GDEA 2YUPA 3PNWC 4FIBA 5KYWA 4M7AG 4IFDI 3M0TA 2SRCA 4K8JA 2KAFA 3PUYA 1U1TA 2B39A 2JA8B 1YJWA 1XNRQ 3E19A 4GN3B 4YWMA 3I56Q 2JA9A 2A68D 2JVVA 5L37A 5DM7R 1Q1EA 2B8AA 2VVKA 5GANh 2K5WA 3TMEA 3RIRA 4XU3A 4C92D 4M7DG 2Z0SA 1AWXA 4RMFA 4N8X1 3JV3A 1RACB 4RCBA 3D6WA 2MFIA 4YCUA 2K4KA 3NHNA 5DY9A 1PSFA 4C0ZA 2RF4A 1PMRA 3SHLA 4DV1L 1GM5A 1XOVA 3REAB 1FMWA 5A2QE 2D9UA 1YJWT 3K5LA 1B4OA 2F2WA 2VXFA 3L2RA 2GBQA 2K5VA 1YI2A 1EY4A 2CKKA 3KDFB 4HR7B 4OONA 1IRXA 1JOKA 1IKMA 4DK6C 4HCZA 3G48A 2FYKA 1STAA 4CHTB 4L59A 3O13A 4BY1H 3PGGA 1QVGP 2X51A 1QCNA 1Y1WH 5KNBA 3EFOA 1XX8A 4A3BH 4DF7A 1TT2A 2D8HA 2DLPA 3UWNA 3X3MA 1SSHA 4A3MB 2YSQA 3PIOA 3H15A 1YI2T 2ED0A 2X3XD 2KT1A 2DGYA 3GTJH 4Z88A 2BE7D 2CP2A 2RJCA 4EPCA 3JRZA 1EZ6A 2R3ZA 4NL2A 1H8KA 2M9UA 2FXQA 4AQYL 4A3KB 2VASA 3VS7A 2DA9A 1M1KC 1HXYD 4BY7G 2O4XB 3CBOA 2F0TA 1LVKA 3S1NB 2K2VA 4KULA 1PFMA 4DFAA 4IPGA 4JI3Q 1HNZQ 4XTVA 1I50H 2NLUA 1SE3A 4M7AB 2F0EA 3RD4A 2NUPA 2FHTA 3A8GB 2R7DA 3CXCA 1A3TA 1NYFA 1DZ1A 3TU4K 4AH6A 2ZM6L 1KTKA 2LX7A 1YITT 3E9GA 4DXGA 3QPHA 5IH2A 1X6GA 3ZBDA 5FW9A 4XU2A 1YJNQ 2PZTA 4LW1A 3H3VC 4DBFA 1V76A 4M7DB 2YV5A 2LS01 1K8GA 1TVXA 2EQKA 2SEBD 4KUDK 3EJIA 1BCPC 5FLXc 4L6V5 2GCXA 2A74C 3GTQH 3FJPA 3T13A 1EY7A 3KLRA 4IZ8A 3JB9G 3M4OB 1VQ7A 1Q1BA 4A3DH 3CC2Q 5CV9A 4A3JG 3HOWG 4RTTA 1JQYD 4OMMA 3VKIA 1PD0A 1UGPB 4LD9K 2YTVA 1YNZA 4DV0L 4JI0L 2QDBA 4HXJA 3JCMf 1VQHA 1Q7YC 2F0KA 1G8XA 9ATCB 4RWSC 4J83A 3TP5A 2YUQA 3UATA 2QTVA 4BS9A 2ZPEB 1G3YA 5D3DA 1CA5A 1QP2A 2L8DA 3NTKA 3OYEA 1NTGA 4DGZA 2TMPA 2B63H 2EYQA 2JP1A 3AQQA 4C5GA 3VR5A 1Y8NB 2MJ8A 3R2TA 4TRDA 1OXUA 4R4TA 4XAXB 3QOLA 1PZID 2PNRC 1WYXA 1C48A 3BYYB 3EVQA 3HKZE 3MVVA 2A19A 2I5MX 2JA7B 4CC4B 2YYZA 3KBXA 4GOPB 1VQKQ 4BY7B 3M4YA 4KLKA 2AIRB 5FU6B 3URGA 1NNXA 4K5WA 5C6AA 1TY0A 3EH2A 1NBEB 4Z02A 4FYWB 2DRKA 4RUGA 1C6VX 1VQ8Q 2K3YA 5FLXE 1YBYA 4KGZB 5GANj 2FINB 3AT1B 1TQOA 2FMMA 3K0YA 2LCSA 4X66L 5BN5A 1OOTA 3KF6B 4XQQA 1ZBJA 4YY3L 3EFRA 1ESFA 5IYCG 2LP5A 3LGFA 4DNIA 1GJXA 5IYBH 1Q81C 3VRYA 3LGJA 4ULLA 1XMQQ 1K4US 1OXXK 4J5YA 2AWOA 2PQEA 2PI2E 4OO1I 3AEVA 2DKGA 4FSSA 3CMEQ 4QKUA 3QR8A 3NHHA 1JE4A 4KY5A 2NZHA 1D7QA 5C44B 2A6HD 4JJDA 5LJ3e 3I4MH 1Q86R 1KC8R 4R9WA 4NL3A 4LFAL 1TU0B 5CCAA 2WB1G 2XRQD 1K9MC 2F69A 4IIMA 1ENCA 1G291 1LTGD 4JDSA 5JAVA 4DA2A 2NYSA 4OB2B 4BE2A 2C5CA 4H13C 3J7AV 4C8QE 3T1HL 3S17B 2JW4A 5JJZA 3E0JA 4ZYSA 4A3IH 1EIHA 3DM3A 1A6XA 1TG0A 2ZPGB 1ZSZC 1VYTA 2F1LA 4PJOE 4DR7Q 2X4XA 3MEVA 3WWVA 2PVOB 2COZA 3TSWA 3KLSX 4GLVB 4DV3L 2E2JH 5J26A 1E1OA 1ONLA 1PRTF 1ZA2B 1LJOA 4WTOB 2V8JA 2KVMA 2X3WD 4EMGA 2CT4A 3QG1A 1ZYRC 5IGFA 3CRKC 2JA6G 2QW7A 1WFWA 2CS7A 2O9SA 4OMQA 1L2FA 1GVPA 3C94A 4CC3A 2ZTCA 1RAIB 3DLLA 4RG8A 2G9DA 2E75C 3PIPA 4U673 4MZMA 4DV5Q 1OXTA 1VQFA 3HOZB 1JB7A 1F9RA 3P8BB 2RHXA 1T9HA 1ZXTA 2LQWA 3E6ZX 1PXUA 5D7UA 1BI0A 2E2IB 4AFZC 2CYZB 4XQJA 1D1KA 4TVRA 1P16A 3OYKA 2O88A 1BDOA 1JICA 4NXML 2F0HA 3T16A 2A6ED 1PTOH 1XNIA 1KL9A 1W6JA 1RLQC 2EKOA 2K57A 5CO7A 2L12A 3FVQA 5C4ZA 3JAMc 1EYGA 2BH2A 2HT1A 2ZAEA 2BA1A 3AU7A 1TS2A 3OQ5A 3DB4A 1BQQT 3LX7A 1I4RA 3KJPA 2LXKA 3JCMX 5FJ8G 1SRMA 3HFNA 1Q8IA 1JJGA 1KK7A 4EQPA 1B9NA 3EFSA 2RF0A 5GANd 3LLRA 4BBRG 1I0CA 4OX9L 1PSEA 2WB1B 3EHRA 3CF5A 3L2UA 2UUCQ 3QUIA 3OYNA 1EWHA 1KNEA 1G2SA 1FD7D 2CVRA 2RK1A 5GAOr 4LUVA 2UXDQ 1C8CA 3NBHA 4PMWA 3MEWA 5E7NA 4OXPA 4FU6A 1LTID 2F0WA 2QILA 1SAPA 4L8JA 2EQJA 1W2BS 5M5WB 1E6GA 1VCIA 4MHEA 1ZHIA 4OGEA 4PQXA 5EQ0A 4JRKA 2LTOA 3IFTA 1Y7XA 4DBQA 2NUPB 1TWFB 1VQLA 1BCOA 1HCZA 4ZTFA 1WOCA 3CAMA 4DR4Q 1I3QH 4F7XA 1U4PA 3Q23A 2XG8D 3N52A 4KMUC 3DKMA 1EY9A 2RVLA 3JAME 5C0XJ 1VDZA 2J6OA 1KDBA 3MEHA 2IHEA 3NXWA 1S72Q 2FRWA 3JCMJ 3S3NA 3CCJA 3OYLA 5HY6A 4HCSA 1QVFA 2K5DA 1GHJA 1UHFA 1SLJA 1VS0A 2LZ6B 3M54A 4DK3C 1VQLT 3VA7A 4M75A 5EPLA 1KXLA 3I72A 2SEMA 3R3OA 5ELNA 4ZKCB 4JVZA 3P8HA 2Z0WA 2QI2A 1CZWA 1IL8A 2KEAA 4F7UF 2K04A 4CJ0B 2IHFA 4F04B 1VQ4A 3FPUB 3EGDB 4FF2A 1IGUA 3V8KA 5L23A 1Z9FA 4N4IA 1SHGA 2CUDA 2EY1A 2I2LA 4RKUE 3N6RA 4XYQA 1B34B 4X62Q 1OXVA 1M1KU 4BA2I 2LDMA 2QGGA 4EGVA 5FWCA 4R8IA 5LMUQ 3I35A 1UG1A 5FWBA 1D5ZC 1YVCA 1N34Q 5JJIA 5KGUA 3VUZA 1D2BA 4LMQD 4HIKA 5FOBB 1BB9A 3PO3B 1PZJD 3G4SA 3HOXH 4XU0A 1W2BA 2HAXA 3FKIB 4QQGA 4WRDA 5IIFA 3OMGA 1CK1A 2I46A 2Z4IA 4E7HA 4YCVA 2WIIB 1B50A 5DM73 5A0DA 2D0OA 2JMCA 3SD4A 4FCYA 2R7FA 3S1RB 3OS5A 5C3EH 1BBXC 2IWHA 2PO4A 2F2VA 4X64L 2WSCE 4F7UA 2JYOA 2RQUA 5M5YB 2DNCA 4DV7L 4GLXA 2J6KA 4A3EH 2RA2A 4QY7A 5JEAG 3D8GA 1SYBA 3MXNA 4C92F 3RNUA 1HA5A 2I5LX 3GTOB 2DY8A 5M5XH 1ZSZB 2PUOB 4IURA 2AZVA 2M0YA 5CV8A 2L3QA 1PTOC 2L5QA 2ASBA 3HOUH 4M7AE 1Q7YU 3IFDA 3FEOA 2KK4A 5IGGA 3PE0A 5GAMg 4BA1I 1PFSA 1GKHA 3I56A 2VGNA 1AEYA 2K75A 4LD6A 3HRUA 1U4LA 2GNCA 2A5HA 1QZGA 4LJZC 3OMCA 1HUNA 5AFWA 1YI2Q 2Q2HA 1TUGB 4H7BA 1LTTD 2A08A 3H0GB 4M7DE 1N36L 1S5FD 1CHPD 4ZRZA 1K8OA 2KEDA 1FVIA 1I5OB 3A0JA 1B3QA 1WNLA 1PFBA 3PCOB 4QGUA 1JXMA 2F52A 3I56T 2E1HA 3CBMA 3RZOB 3NQTA 2JMAA 4LF8L 3OSVA 2H5XA 1O7YA 2N3SA 2Y0SB 3TZDA 4HJ7A 2JA8H 3L2VA 1Q81U 1QILA 3QB3A 1GUOA 4ZKBB 1IBMQ 1WTPA 3CPWS 4AFSC 2KE9A 1SXTA 4M75G 1V1PB 1PWTA 2IIMA 3AB9A 3PIO3 4ZGJB 2MGSA 4B3TL 1NR4A 3CCVQ 3MHXA 2CZ7B 4C8QC 1M2VA 5T1GA 4LDUA 1K9MU 3VS2A 3UDXA 4X34A 5DLOA 2E6ZA 1PC0A 1WI5A 1IYVA 4PJOC 1G3TA 3LWEA 4X65Q 1BCPD 3KBGA 2KGTA 3CQTA 2DJQA 2EGEA 4O5VA 1II3A 4J9DA 1FR3A 2ZPHB 2HIVA 3M9QA 1RDPD 3A7LA 2ESWA 2FL7A 4K2KA 3SGIA 1N33Q 2M9VA 1D5MC 4R4CA 2ICEC 4FDBA 1B2TA 5A2QL 2LNVA 1OYXA 1FJGQ 2MO0A 4M77C 1EQQA 1OU9A 4DAYB 4WJ3M 3NMZC 5K36H 2XIWA 1WTVA 1AOJA 4JS5A 1VQ7Q 2LC4A 2G9HD 4A3MH 5IAYA 3H8ZA 2HDLA 2AWNA 3FPPA 1UGRB 4E7KA 3V2TA 5I21A 4TQUS 3PO2H 1XPUA 4HCCA 4A4HA 1O7LA 4FL6A 2EY5A 2GVBA 5D65A 4A3KH 3AYHB 4LNPA 1PV4A 3K7AB 3DB3A 5GMKj 4L5SA 2MYSA 1UB4A 4IUNA 3S1NH 2DUDA 4OWWB 1ZUKA 2Q2IA 2EPBA 5HK0A 3NGPA 2K5NA 1H9JA 3RN2A 1NY4A 3RUXA 3I4OA 1EEID 1YJNT 3F8TA 3G6JB 3W5OA 4APVA 2ZZDA 1E3PA 3GTLB 2K5FA 2DL7A 1C4QA 5I4DA 5I6YA 3TEHB 1UGQB 4LF4L 1WJRA 5KYXB 1M9SA 2LCLA 3I5RA 4QQ6A 1AZEA 1RAAB 2FO0A 3BVGA 1UFFA 5ISRA 3OY9A 2SOBA 1D6EC 1QWEA 4WJWA 3OW2S 4Y91A 2QQSA 1RABB 2HUGA 3CP0A 4LUOA 2J6FA 5KE2A 1I4PA 2BUDA 5EGTA 3KFVA 5EPKA 3U9SA 4A53A 2K79A 2EYWA 2VC8A 1W70A 3UT1A 1HPCA 5FO9B 2F4VQ 3QYGB 3E1SA 1WHJA 5IGBA 2NN6G 5F2DA 4DV6Q 1NMFA 2LQKA 1G5VA 1GUSA 3M4OH 2MUYA 2MNAA 1P8LA 4LF5Q 1WD1A 3A8MB 1K8AC 1VQKA 4BWGB 2Z6KA 2R93B 4F8MA 4L5TA 4KGXB 4OB0B 2PU9B 4GS3A 1PH2A 4DQ2A 2C35B 3IL8A 1VQ8A 5M3MB 1SE2A 1EL0A 1Y1VB 2DJFC 2EJGA 3A98A 3NWSA 2FZCB 3TQYA 1Q3LA 4ALPA 3CPFA 1HNXQ 4XTZA 5CKDA 3A8OB 2RSOA 4QCLA 1G6ZA 4JI2L 2F0GA 2RHSB 3H0GG 1GUTA 3KLSA 2RHQB 5GROA 2ZJRA 1PKTA 4O0AA 3JCMh 2X4WA 3H0FA 4QIWE 5I2YA 1VQKT 5I9PA 1GCQC 1AZPA 4ME7A 2K5LA 1IYJB 1CQVA 1VQ8T 3HKSA 2B3GA 4OMLA 2JA7H 3QYHB 4A3GB 4QMGA 4J9CA 1WA7A 4BY7H 3HS0C 1KQSP 5FO7B 2X4YA 1YNND 1WLPB 2WB1E 3M58A 3L7ZC 5LJ3f 4C5HA 4EX5A 1PRLC 1F2MA 1HYOA 3A56A 2F5KA 2PQAA 4M77G 1H641 3MZ5A 3CMET 2J7IA 2LT4A 3OHXC 1D0ZA 3PV0A 2M02A 4O1NA 4D8KA 3P8DA 2JOYA 2SNSA 3EGUA 3I5SA 3META 2KQ3A 1X54A 2K52A 1OI1A 4X1VA 3OW2A 1KIKA 2XIDA 1VQ6Q 1ASZA 3U9OA 1KSWA 4NKLA 4CGYB 3GTMH 2MOXA 5FLXL 1PNJA 2I5HA 1K0XA 3X24B 3CCLQ 3ZEHA 4LDXA 2OEOA 5C44H 2UXBL 5IN1A 1BR9A 1M2OA 3NPPA 3SHWA 4P71A 5C4HA 2CKZB 1S3OA 3NE5B 2NTTA 2EDGA 4NP5A 3GO5A 4WJ4A 2W0ZA 2XD0A 1RAGB 3J80c 1G3WA 2DXTA 3UE1A 3S17H 4OF1A 1RTNA 3LX0A 5M9OA 1STEA 4RTVA 4DK1A 1QZHA 3RERA 4IQZA 4R8NA 4B3SL 5HGQA 5LMNW 2M51A 1IHWA 4DR2L 1ZEQX 3QZ9B 4N0AA 1F2ZA 1K3RA 3L0OA 4AYBG 4C8QB 4UY8C 1K0RA 4G7ZC 4EMKA 3VU3C 2DBKA 3E9HA 4MN3A 3S1QB 2F0UA 2WAQG 4XK8E 2B2YA 3KYHC 2HD0A 5D6YA 1E2VA 2O2OA 2PNIA 3M5AA 4FXGC 1TWGB 3GNGA 4M7AC 3WOFA 4F17A 4A3LG 4OHJA 3BE3A 4Y7NB 5LMNL 3HOZH 4CJ2C 3M4PA 3M7GA 4JLGA 5FRNA 2BIVA 1M5Q1 2FEIA 3SEMA 1JJCB 4B3RQ 5C4XG 5EBDA 1WTWA 2L89A 5IHNA 1M2VB 4DR1Q 2E2IH 2Y4YA 4KV6A 4M77B 1KRTA 2ZPBB 2D0PA 5C3WA 2CREA 4JI3L 1K8MA 2K3BA 3J80E 1RLPC 4M7DC 3OWEB 5JPNC 1TXYA 5GAOp 4C0FA 4DOVA 5JVG3 5AJ3Q 5C5LA 3S9WA 3T1YQ 1SEBD 1QUQB 3CCJQ 2KCNA 2O2LD 4CDFC 4BI4A 1VQ9A 1HTLD 1ZA1B 1DD2A 8AT1B 1RI9A 2DJGC 1ACMB 5CKFA 2JJQA 2DVEA 3CCQA 4JRPA 2B2TA 2KUMA 3BDUA 1X6OA 3CMAQ 4HAEA 1E24A 1CI3M 2F4IA 1S72A 1U8RA 3MPUB 2RB6A 3D7SB 3V8JA 1SROA 1XXGA 4A75A 2LNHB 2QA4A 1VQ4Q 4XU1A 2C0IA 2E64A 3A1PA 1ICFB 2K14A 1Q95G 3DHQA 4P74A 4JJCA 2E6NA 4PKCC 1DM0B 4A3IG 1VQ9T 3J81j 1OPLA 3QJ6A 3L2QA 1WCMG 3CEYA 5M5WH 1I94Q 5DNFA 3CCQT 5HGTA 1MGQA 2XMFA 4AFQC 2E74C 3K81C 2A73B 3VR6A 5GAGC 1NPRA 1B44D 3OBYA 4ZUJA 1ABQA 1TWFH 2WFWA 1S72T 5KNDA 4A54A 2HL3A 4KGVB 3T4AC 2L5TA 3OIPA 4GOPC 1AZQA 1SPKA 3L1AA 2MO1A 2XTIA 1I4GA 3D4RA 3G4SQ 2LVMA 1A2TA 1U0LA 4G7HC 4JV5Q 1JB0E 5C0XG 4XT1B 2NVQB 4GNXC 1VMPA 2HQHA 3CC7A 1IBKQ 1HXDA 2BE9B 4J15A 4Z89A 1I8FA 3VYUA 2B8FA 2DD5A 3GLXA 4M78A 3CCUA 1EY8A 1KLUD 2K33A 3QXEB 4ESRA 1Y07A 4YHHL 3PMIA 3JAML 1AVZC 3VDYA 3L9AX 2GA4B 1MHNA 4ORZA 1JJ2A 4PMCA 5D6WA 2HCKA 2B2WA 1PTOD 2F0OA 4KN4C 4ME3A 4JI6Q 1JWUD 5C4JB 1C9OA 5J39A 4Q5VA 1EOVA 3LGLA 1B8AA 3CC7T 1L0YB 2R5AA 1ZX6A 4V0BA 5FKAC 5FJ8H 2BTTA 2OI3A 1XMQL 3M85A 3VS3A 1XJWB 2L3PA 3A8LB 4FXDA 2EQMA 1MMAA 4DBHA 1VQBA 2Z1CA 5EKIA 4F87A 2YUOA 2BDOA 3OOCA 4RFBA 2E65A 4J6WA 4I7ZC 1SJED 1RAHB 5COYA 3VYRA 3MO8A 1SYFA 1K28A 1STHA 1D1BA 1LM0A 5CKBA 1EU3A 4IUQA 2VY3A 2IX0A 3PO3H 3CCSA 5IXBA 1R4QB 3FKIH 4PJMA 4BBSG 4IFDG 3E5SA 4LF6Q 4B3MQ 3X26B 2R92G 1EUJA 1ABOA 4DV2Q 3SWNA 1LLRD 2I0QA 5FU7C 2NVYB 4DR7L 3V8LA 2KENA 5BN4A 3V7SA 5I2MA 5M5YH 1HFNA 3HP3A 3HPWA 4FYYB 1JRIA 3HZXA 4A3CG 1OULA 2NUCA 3ULLA 3CCST 4K14A 4FYXB 1K8AU 4DR5Q 2RCNA 2EIFA 3JCMd 1CSPA 1VQOQ 1D0YA 4S3SA 5EKLA 4PJNA 2HQXA 2BCOA 5C3XA 4C8QD 3UPUA 3GTOH 1HHVA 1Y14B 4QUFA 3QHSA 3FRNA 1SMYC 2EY6A 4A93G 4NXNQ 4E6RA 2JEAI 2RJEA 2DIQA 1XMOQ 2F0PA 2RQRA 4PJOD 2G5DA 4HTHA 3OYGA 5D14A 4ZQ3A 1VF7A 5GAN6 4A3FG 5GAN2 2E5KA 4FXKC 2VB3X 2JM9A 1BCPF 1IYUA 5I6WA 1A0NB 3OW7A 1PH7A 3GIBA 2E2HB 1RHPA 4M75E 1CKNB 2ZTDA 2ATWA 4IKFA 1F9PA 3CCVA 3UDCA 4KHPQ 3EG2A 1L1OA 2PW5A 3QO2A 5LJ5e 4OMNA 1EZZB 2XWBB 2JN0A 4N4HA 3W1BA 5IP7G 2VQFQ 2XN9C 2K5HA 2E8GA 1PH8A 5CQXA 3MEFA 5KYUA 1WXBA 4P72A 3C46A 1JXOA 2VV5A 2D5DA 4BE0A 3HFOA 5KYYB 3MXPA 5GADC 3RZOH 3U50C 1ARKA 4DR3L 4WCIA 1I4QA 2NUTB 1LO5D 2RDHA 4IPCA 4N9PA 4YIJA 1JB3A 3HL8A 3CCVT 4A4EA 3RMSA 2UUCL 4BBSB 5DLQE 1ZQ1A 2NVXB 1JWSD 1X9NA 2K9GA 1JQQA 3E2UA 4M78G 2B2UA 2OAUA 2ZXRA 5KNCA 3S2DB 2B2VA 3X3NA 4DR6Q 2V1RA 2K5IA 3G71A 1EX4A 3OYIA 1NZ9A 3VYTA 5K5PA 2EQIA 2GTOA 5GAN4 4HCBA 2ICIA 5LJ5g 5JEAH 2X6LA 1XTCD 4HVWA 1KJWA 1Y8OB 1IL2A 3K57A 4JOIA 1PM3A 2R7ZB 2Z8LA 4HT9A 3BJUA 3ONAB 4C3HG 1CTMA 1YN8A 2RJFA 2GGRA 4GLMA 1VQCA 4X3SA 2JA5G 3GP8A 1VQ7T 4A93B 1X65A 5GAOl 2KOLA 2DD4A 3A8HB 3STBC 3TP8A 4A3FB 4UC4A 5IHKA 3MP1A 1HD3A 1KAAA 4HMIA 2NYZD 1NEBA 5GJVB 4JYAQ 2L3RA 5ELDA 3LWUA 2EBPA 2ROTA 1SF9A 3EIVA 2XVSA 4JG2A 3VYGA 4OGQC 3PVLA 3CXCP 3D4DA 5T1IA 3ZYYX 4CKBA 2UU9Q 2DTOA 3K7AH 4GNXB 1AWJA 5GMKm 3K7UC 2MP1A 1JT8A 3SFMA 1Q86C 2F0QA 1KC8C 5JVH3 1I5LA 3M9BA 4RCOA 1ZLMA 4X62L 2KEEA 5EC7A 3I55Q 3QDRB 2ZJQA 5LMUL 3GTLH 2CP3A 3UF4A 2FVUA 4J8QA 3S14B 4MTNA 1G2TA 4N8FA 4GKKQ 1N8RR 2D2CC 3QO3A 2EYPA 4CJ1B 2EWNA 4XTYA 4GZYC 4N4GA 1W1FA 1Y0MA 1UE7A 4M78B 5E1FA 4CDDC 4K0KQ 1G2BA 1RD9D 2K28A 5CK9A 2PNHA 4A3JB 3HOWB 2DAQA 1OPKA 5I2XA 4OO1G 2VNUD 2JSOA 1MV3A 3MXUA 1XTDA 2EVBA 3D0FA 5G3LD 2HQEA 1UE6A 2KJXA 3I90A 1SNPA 1D09B 2R93H 4AG1C 2A37A 1WHHA 5KYWB 3HOYG 2JZ2A 1UJ0A 2MWPA 2WINB 1W6KA 3A8KE 3DWPA 5M3MH 5FROA 2LKVA 1Y1VH 3CRLC 3EROA 1YNJC 3QIAA 2F0LA 4RAUC 2F03A 3KJOA 5ELCA 1QCBD 1I6HB 1JWMD 3JCMQ 4M77E 4D8DA 4QVCA 2KHJA 5J3BA 1AE3A 1QJOA 5FU7B 4JI8L 4DV1Q 1IGQA 1M3BA 4B9WA 1PVOA 1G3SA 2MCNA 2CP0A 1VQ6A 3PUZA 1E0BA 1I4XA 1B1ZA 2YHTA 2PZWA 5IGCA 2D1XA 3VRZA 4R4OA 3QZ5B 3M56A 4EDUA 3CCLA 4I65A 4ZK9B 2R57A 2DJZA 3OS1A 4OIJA 5GAN7 4A3GH 2F0MA 1MSGA 3DM1A 2QQAA 3SWNB 1M90R 5FLMG 4OL7A 1WTXA 4AFUC 1Q82R 3TQ7P 1SE8A 2R7ZG 2NVTB 3G7ZA 4QIWB 4O2DA 3RMQA 4TKOB 1Z9QA 4M7AD 1U5SA 1VQ6T 4LE9A 2KT8A 4BXXH 1NLOC 1JO8A 3HSBA 4RGOS 1K73R 5BN3A 3CCLT 3OSSC 3L3OC 3SK5A 3EFOB 2KMTA 5LJ3h 1JOQA 2RH2A 4AQYQ 1IO6A 1AWOA 2MWOA 4E7IA 2R5MA 2LMJA 4MMKA 3OYMA 3TSZA 3SK4A 4XQNA 4DUYQ 3IAYA 1I4K1 2F0NA 1KG1A 1QB5D 1QWYA 5CV5A 1MMDA 4O6JA 1CZGA 1MIUA 3VR2A 5GAOn 4M7DD 1B70B 2GF7A 4J9BA 5CORA 2DEQA 5DEHA 4TSSA 2DILA 3H3VI 1RJTA 4NW2A 1OZ2A 1PRTC 3OSOA 2UUAQ 2EJFA 4QW2A 2PZUA 4IJLA 5KEEA 2KSSA 4KY6A 1NCVA 3K58A 3NTHA 4EIKA 2F0FA 2ID0A 1X01A 2J0TD 2RQVA 2XSCA 1K76A 3OB9A 4WF2A 1X3GA 3EQLC 3MA2B 2ZM6Q 5IOCA 3EFXD 4P75A 2O31A 1EU4A 4HA8A 1VQ9Q 1I81A 1VUBA 1QG7A 1BIAA 1Y96A 3GP7A 4X65L 1QCFA 1O9SA 3CCQQ 1BVSA 2JA6B 1Q8KA 3FMCA 3H41A 1A0IA 1HR0W 1T5XD 3M55A 3G1JA 4JPBW 1OV3A 2RD1A 2C0OA 4NDXA 2JS2A 2QA4Q 2F0IA 4RKBA 1GFDA 4CKCA 2ECZA 3S1QH 3ULJA 5BR8L 2CP5A 1CQFA 4FVMA 3JCMc 3CMAA 1TWGH 4DV0Q 4CRIA 4JI0Q 4PV1C 1N5ZA 1S5BD 1Y8PB 4IN3A 2K03A 3G7LA 3SE0A 4Y7NH 3J81c 1LTAD 2HKNA 2F0DA 5CV7A 2ZJPA 1TS3A 3G6EA 1JE5A 5ELFA 1EY5A 3WOEA 4UAIA 4EQOA 1HR0L 5I11A 2M1HA 3BDOA 3I73A 3S16B 1VQPA 1H9RA 2E12A 4U68A 4QQBX 4BY1G 2QYZA 3CCJT 3BDCA 3T51B 4M75C 3H94A 1QLYA 1FGBD 4IALA 3TZUA 1RAEB 4DKAC 2E5LL 2DYBA 2XHCA 4A3BG 1WXTA 3U23A 3CMAT 4ZAIA 2YUNA 3KXTA 3TVTA 2MPMA 2JT4A 1Y57A 3EG3A 1FX7A 4FW1A 4IUUA 4FT2A 4DA4A 1LABA 3RNJA 4BBRB 3CC7Q 3S15B 3G6ET 1N9SA 4CC7A 4E6IA 1OXSC 3CCUQ 1F1BB 1VQ4T 5FRMA 2EJ9A 3J80L 1PTOF 4FT4A 1WYDA 4X66Q 4PFOA 3DWAA 4RTWA 4JC0A 2D9TA 1WJJA 4KTAA 5GAMe 3PMTA 1SG5A 3JB9D 1BXTA 4FNFA 3RLFA 2OWOA 1PH4A 1WHGA 3S2HB 2QQRA 1E2WA 2RBMA 4DV6L 5GAN8 4IOCA 3UA6A 4BB7A 1NJIR 3J81E 1HZAA 4LF5L 1SRLA 1U4MA 2IT1A 2HDAA 2VXWA 3VV0A 5KH6A 4E7JA 3S1RH 1IBLQ 1T0HA 3DWQA 1XPRA 3DUZA 3REBB 2V1QA 3G4ST 2D0NA 1QVFP 5CVIA 5D6XA 4B6MA 5GMKi 5HCKA 3VS1A 1VQGA 5IWAL 3GTPH 3K8AA 2EYOA 4P2CB 4JI7Q 1FMKA 4LFCL 1CM9A 3T1HQ 1VQIA 4GKJL 3CCSQ 1BYMA 3PTAA 1R0BG 1KAWA 4A3LH 2IY5B 1HSQA 2NVQH 2LJ0A 3ME9A 4RH6A 5LJ3j 2P0PA 3BZCA 4DV3Q 1I1JA 4YTLA 4H44C 2XRSD 4Q5WA 1O78A 4J8OA 4FP5D 1D1AA 3C12A 1AHJB 2CDTA 1A8VA 2VW9A 5ELOA 3T53B 5KE3A 1SMYD 2P4TA 4C8QF 3GQBA 2Z4HA 3QWXX 5KYNA 3BG3A 1S1NA 4OIKA 1TS4A 2N88A 4UHVA 5C4JH 4AG2C 4C1NI 2L9HA 4CDEC 2B63G 4UP7A 1G6PA 1B7TA 1UUPA 1VOMA 4OWXB 4PJOF 1EIGA 2YRCA 4VUBA 3ERSX 1W2BP 1K0SA 5IY0A 5ELBA 1OQKA 4C92A 1LTBD 1KRSA 2AHOB 1MMNA 1WGSA 2P84A 1Q86U 1KC8U 3BZDB 1N32Q 4E47A 5C0MA 3OYCA 4DXFA 1VQOA 1NBWA 1PD1A 2L4NA 1X56A 3QWNA 4L6TB 2RNAA 1D3BA 2DXUA 1V8QA 1SYCA 2CWPA 2XKOC 2ENBA 2YTYA 2MF2A 1ENFA 4MNOA 5KYLA 1YCYA 4HIMA 4XXEA 1RL2A 3U58A 2NWGA 1C0MA 3O8VA 4C92C 2MAMA 5GAN3 1M4VA 2Y4XA 2BOSA 1KDCA 5IYBG 2DNUA 2DVJA 2RA4A 1Y69U 3F70A 4JI1L 4HJ8A 2VKNA 4CBVA 4M8AA 2MPXC 1LTLA 2FZGB 2E70A 1VQOT 1KQSS 2NVYH 4CI0C 3R8BA 3RMHA 4LDYA 1BO0A 1NMGA 3H6ZA 1PRTB 2H3EB 3A74A 3BS1A 3OS0A 3I91A 4M4ZA 2H3JA 1KD1R 5TSSA 4C0GA 2DL4A 4Q0FA 4CDCC 2DPPB 3M0SA 1GUNA 5LJ5f 2AUKA 3NBHB 3RLNA 4POGA 3G71Q 1ILQA 3PF4A 2SNMA 1RF2D 4HJ9A 4PZ8A 4ANJA 4KJOA 4X9CA 3BVMA 3HRSA 1PHJA 1T3SA 4LUDA 2HDMA 4DR1L 2Y90A 1SYEA 1LV9A 2HZYA 4OB1B 2PVGB 3EGXA 2FHDA 2KY9A 4M78E 4F7UG 3CCMQ 1JEGA 3ER0A 1FNVA 1QVCA 1STYA 1X75C 1Y96B 1WJQA 3SDZA 1BOSA 1VQMQ 2KECA 2CSIA 3E0EA 4LUZA 2MI6A 1K73U 2DIGA 3PT9A 5LJ3d 4DBRA 2KI7A 3VS4A 4NMZA 4UP8A 4MZTA 3RZDB 5AJ3L 5GJWB 4J6XA 3RBBB 3T1YL 3I7FA 3CPWA 2ZTEA 1SNDA 3I2ZA 3M0UA 3Q1JA 2JEBI 2OAWA 2HQLA 2JN4A 2D6FA 1TH7A 4PLIA 4JZ4A 4M75B 2C0TA 2CHBD 3JAMi 2EGCA 1WD0A 3SK6A 4DPGA 1DONA 3URYA 1SDFA 2KYMA 4XDXA 2E3IA 4BBSH 2NVXH 2IPKD 2RM4A 2XDDA 1Q90A 1V9PA 2FMCA 3TBIB 7AT1B 2FPEA 3C2PA 1X2QA 2VQEQ 1PA6A 3ICEA 5D3IB 3MJXA 3S2DH 4HCKA 4LWCA 1PH1A 2EKHA 3E9IA 1AP0A 2L1BA 1XNQQ 2K6DA 3S6WA 1OX8A 3RDVA 1BBZA 2QAZA 3AFPA 2MHVA 4J7FA 5HK3A 1I5FA 2HSEB 4JLIA 1UEBA 3SEBA 4Y28E 3LH5A 1HH2P 1C1AA 2R7ZH 3JCMg 4POFA 1EEFD 1YIJQ 3OS2A 4ODGA 1JC7A 2HCIA 3L2WA 4C92G 1NSNS 2Z6KC 4IUPA 4A93H 3I55A 2M0OA 3HGBA 1H92A 2FPFA 3EG9A 2F0SA 2LY7A 2H4OA 5G3LF 4A3FH 4LXCA 1EWCA 2EJGC 1CHQD 2LRQA 4X64Q 4DV4Q 2IX3A 1GXDC 1SFOB 2OQ0A 1YNJD 5EJWA 1LT4D 4LFBL 1ZYRD 2K2MA 2XK0A 1QNUA 4QT7A 3MEUA 4OVAA 3I4LA 5H1SE 1AFPA 4F7UB 4RA8A 2HMAA 4ZNXA 4C5IA 2LMCB 2VS1A 5J22A 3GV6A 1M3AA 3I55T 1MNEA 3Q24A 5CC4A 4JI6L 3KF8A 4L5RC 3MXNB 4RHRA 2RQTA 2TSSA 2EZVA 1PDQA 2E76C 3HG9A 4F14A 1J5EQ 1E7OA 1VMCA 4XTWA 2KCCA 1GFCA 3H0IA 2JTEA 4QF4A 3S14H 3HEJA 3Q0AA 1XNRL 3AFQA 1WTRA 3GTGB 2V26A 2KROA 2GFUA 2WACA 2HEQA 5CQYA 2CZ1B 2X9HA 1YZ6A 5FK9C 2ZPIB 1WDXA 4JI5Q 4V190 2D0QB 2K4YA 2GTJA 1BF4A 3MWYW 3LNNA 4M7AF 3D3RA 3JB9H 4PLLA 5IE8A 3PIP3 3K0XA 3J7AF 1IZ6A 4ZGDB 3KDFA 4C0DC 4A3JH 4C2MB 3HOWH 5ELEA 5LHY1 4PJLA 1QE6A 3DXJC 1ML0D 1CA6A 3TS2A 1GBQA 4JS4A 1R77A 1TWHB 4DV2L 3I8ZA 3K6OA 3OYJA 2COYA 3VR3A 4BE1A 1ZSGA 4JJBA 4LF8Q 4MDWA 1H9MA 1MHWC 1X3QA 2G6FX 3P20A 1UTIA 1WPYA 4GN4B 4EQNA 1EFWA 1KHIA 2CZ0B 4M7DF 1A2UA 4LF7Q 1PRTD 3ND8A 4C92B 5L8RE 2K50A 3K5MA 1HQRD 3WDNA 2XNAC 1I6HH 3WXMB 3A55A 4RGTA 1CKBA 4KH0B 2KHIA 1Q12A 2Z6BA 4MMLA 1EQRA 3MFGA 2DFUA 4A4KA 1BUVT 4NXNL 3UDFA 4BD3A 4N0AC 1IBML 1XQHA 3CW2C 2PYKA 3I4NG 1PH5A 1PKSA 4PJJA 2ABLA 2OF1A 2EXZA 4G4KA 4EMKC 1OX9A 1GHKA 4GLKA 1IREB 2A7YA 2VUMG 5IYCH 3OW2P 2B2YC 2L15A 2EYLA 1HNZL 1SNMA 2KXDA 4JCVE 2NVTH 4MIUA 4ZCKA 4KHPL 1M27C 4RG2A 2LJ3A 1PYWD 2A6EC 5KRUA 3HOUG 2JNGA 3GOXA 3JCMP 4RTXA 5JJKA 4J9GA 2CQOA 4ZTJA 2N55A 1SHFA 4ILWA 4KD4A 4LF9Q 1YHQA 4RMOA 3V7RA 4AMCA 3KK7A 4PK4A 1QVGS 2E4HA 2YLCA 2O9VA 4HIOA 4M75D 1VQDA 1HNWQ 3G6EQ 1MI2A 4BDYA 3RESA 3HP9A 2IJ0A 2JQOA 1KHCA 5IT9c 1VQPQ 2UXCQ 1EY0A 4OO1H 5KYIA 1RIPA 2B2TC 4BI3A 2B86A 1MKHA 4E7LA 4DR6L 4KKUA 1UDLA 2DL8A 1LTSD 3PMFA 2D62A 2FFKB 2DMOA 4XTXA 1VQ5Q 1QNKA 1SSOA 4K6DA 5IXFA 5IYDH 3NTIA 1UE1A 2HIXA 3V05A 3S3OA 2QDLA 2E2HH 4R55A 1WZOA 3PVQA 4AYBB 3C4SA 3CCEA 3A54A 1HUMA 2QA4T 4OGCA 1FNUA 1V29B 4L63B 1I07A 3GTKB 4HJ5A 1MBYA 1H3HA 2K1BA 3JB9F 3PGZA 5J1ZA 4DUZQ 3BYTB 2JA6H 3LW5E 2WAQB 2AZSA 2JS0A 2DTHA 4KBMB 5GANe 3OYBA 2CW0C
chains in the Genus database with same CATH topology
4Y52H 4NOYA 3U4VA 5JEAJ 4JYAL 1X3FA 4NPSA 3VUBA 3OYAA 5A0LA 3KF6A 3FDRA 3LYIA 2UU9L 2EQUA 5IT9E 3S16H 4BY6B 3CCRA 1N6AA 4M78C 5GAMf 1EIYB 3CCUT 5K36G 4LNQA 1O75A 3RN5A 1CUKA 1QVGA 3F1ZA 4A3MG 5GANg 4BBRH 3X20B 3S15H 4YCWA 3JSCA 4A3KG 3WVDB 4JI4Q 3OA6A 3BZKA 3PF5A 2RHIA 5M3FG 2O01E 3JCMW 3S2HH 4MZPA 1O7IA 4ATOA 2PQAB 1EWIA 2JE6I 3KF8B 2JK8A 3CXCS 2WSEE 1U5KA 2QGQA 4UP9A 3QSUA 1IXRA 4C0DB 1HZ9A 4X6AH 3QKJA 2OQKA 3SWNC 3KLWA 3RKYA 2NZOA 1N9WA 2E10A 4JBKA 2QQ9A 1FGUA 3BY7A 4DV5L 1PH3A 2XICA 2GN5A 4B3SQ 3HHTB 2QDYB 4DR2Q 5GAOq 2PQWA 3H0GH 4M77D 1JMCA 4PL6A 3RR5A 3SB2A 2LT1A 3TREA 2N49A 1P92A 4ZN1A 4EMKB 5LMNQ 2JUFA 3HOVG 3M4GA 2JA7G 5I2SA 4DUYL 1YITA 1L1OC 2XU8A 2IX1A 3OTOQ 1LOJA 5GQOA 2UXDL 1R8OB 3NEMA 3MP8A 4XQ3A 2UUAL 5IP9G 2G3RA 2RK2A 4MDXA 1BBUA 4J7IA 1SMXA 3JB9I 2LCCA 2RHUA 2UUBQ 4HKEA 4DR4L 2FB7A 4A4FA 4NS5A 4JJNK 3CCMA 5CKEA 3F2CA 5C44G 3J80i 1VQMA 5C6SA 4F7UE 3G71T 2A3LA 4DOWA 1H95A 2CFMA 4IJHA 4JOIC 4R1JA 5JJLA 2GVAA 3CCMT 1VQMT 3J7A5 1B34A 5LJ5h 1A63A 3L2ZA 3S24A 4QL5A 4B9XA 1N8RC 3PUXA 2HHHQ 3JCMV 1W4SA 2QTXA 4UPAA 3PUWA 2VL6A 4JBMA 3RZDH 3M4QA 4GN5A 1PYSB 4YHHQ 4V2SA 3HOZG 4QVDA 1YIJA 2BKDN 5CKHA 1N34L 1PH9A 1FL0A 1UGSB 4C92E 1RI0A 3T9NA 3X25B 2K3XA 3UDGA 2QEXA 2OCEA 3A5UA 2DO3A 3M59A 1YIJT 1L0WA 2HBPA 1IBLL 5EG2A 5EAYA 2AHJB 3WVEB 1VQAA 4JRIA 3OYYA 2JTMA 4JI7L 5KCOA 1M90C 2QEXT 1Q82C 1VIFA 5CR2A 2WP8J 3FB9A 4JBJA 1SFOH 3S3MA 1K73C 1BKBA 5CIUA 4FM4B 4QJFA 4A76A 1YHAA 3GF5A 4QQDA 5LJ3g 1VQJA 1Q46A 2VXEA 1LNXA 2AKWB 2PVDB 4YWKA 1KQ2A 1QVFS 2X35A 4IPHA 1N32L 4AIMA 4DAMA 3IRBA 3RLOA 2EXDA 3GTGH 1E22A 4X9DA 4AYBE 1AH9A 1N9RA 4P5NA 1X55A 2WAQE 1EIFA 3UDIA 4C2MH 1L1OB 1M8VA 2C06A 1TWHH 4IUTA 4DR3Q 1M4ZA 5GAHC 3H3VH 3OYDA 4M75F 2RI3A 2OTJA 5LJ5j 1N33L 4PZ6A 5GMKe 3PO3G 2EFIA 2QXFA 4XTUA 2AMCB 3FKIG 1FJGL 3KOJA 2YRVA 3GNFB 1G51A 5GMKl 1YHBA 4L5GA 3M53A 4FSXA 2OTJT 2XDPA 3PFSA 3FHWA 1CSQA 1AE2A 1Y1WG 1PH6A 1YEZA 2IG0A 1SSFA 1VIEA 3B6YA 1VQ5A 1KIXA 2VZAA 2A1AA 3FC3A 5AYFA 4EMHA 2KCMA 4OB3B 2RI2A 5GAN5 1N27A 3HFZB 2CWAA 1NJIC 2HNIA 1VQPT 1WQ7A 2GQVA 3UE0A 4M78D 4YY3Q 1HJPA 2V1CC 4KHZA 2F4VL 1VQ5T 1E7ZA 1HK9A 1J6QA 4IOAA 5GANf 4A4IA 2VQEL 1XNQL 2DZCA 1C0AA 2B29A 4LFAQ 5GMKh 2Y0SG 3PSIA 1MJEA 1HNXL 4IFDJ 4R56A 3GTKH 3L42A 1LUZA 4A3DG 3W1GA 3CC4A 3MCAB 2E5QA 2RJDA 2JTFA 4BACA 4DV4L 2IVWA 3I4NH 5C4XH 5LJ5d 4OWTB 5LL6S 1W3SA 2RI5A 3GPLA 3CQZH 1E1TA 2VUMH 3C95A 1TWAH 3L2PA 4EQ5A 1ZBXA 1B7YB 4JI8Q 3QIIA 3CC4T 1FXXA 1JBMA 3U4ZA 1J5EL 3INZA 4II1A 1N8RU 1VQEA 1R9TH 5KCHA 5GAMh 2YTXA 4M77F 2PI2A 1MJCA 4JI5L 4IUVA 3KUFA 3HRTA 3EN2A 1TWCH 4NB3A 3TS0A 4JUVA 4A3IH 4TVAB 3ZFJA 3FLGA 3BDLA 1WCMH 1BIBA 4LDVA 2RO0A 1KD1C 2KQWA 2E41A 3TEEA 3FP9A 5CAIA 4RCCA 4KI0A 4OX9Q 4C8QA 2ES2A 1C7YA 3PUVA 3I4MG 3RKXA 1HZBA 4LF7L 2V8IA 4BDZA 3BU2A 1G6PA 2F3IA 3JB9J 4PJOA 2N8NA 1XPOA 2R58A 4IPDA 3M57A 4P73A 3JC66 2KBNA 2N78A 5HKCA 2ZCFB 1V1QA 1FWZA 2M16A 4M77A 2R93G 4OMFB 1M90U 3EBEA 3X28B 4PG3A 4B3RL 1Q82U 5M3MG 1WQWA 1Y1VG 3STBD 1QUQA 3D31A 1DJ7B 4KUIA 2XGTA 3J7ZC 4YWLA 5BR8Q 2YU9H 3JCMe 4ZGEB 1PYBA 1YJNA 4C3IH 4LF9L 1SRUA 2DK3A 2LX9A 1HR0Q 4A3GG 1DGSA 2VUBA 3JCMb 5M3FH 1HNWL 3TRZA 1GXIE 3LWIA 1LYLA 2E5LQ 3CC2A 2VYTA 3V7CA 2R92H 3TCJA 1YNXA 2UXCL 3KFUA 2BH8A 1KQSA 4NXMQ 4BXXG 3HKZG 2NN6I 4RG1A 1I94L 3M7NA 1UE5A 3M3YH 3F2DA 4C3JH 4A3CH 1X3EA 2KCTA 4BUGA 2RHZA 2CGHA 4LDWA 4OP0A 1CKMA 2DXCA 3CC2T 4HIDA 2YLBA 5GAEC 4A4GA 4DUZL 4JV5L 2Q2UA 3MEAA 2LQ8A 2PMZE 1S40A 1K83H 4BY6C 1IBKL 4QQBX 4DV7Q 1SR3A 3Q8DA 2OTLA 1M1FA 1NE8A 2KDSA 5IWAQ 5GAMj 2P0KA 3E9FA 1QW1A 4ZN3A 4LFCQ 2RHYA 3RKWA 5IP7H 4GKJQ 4C8QG 3LWHA 3J81i 4JRQA 3CMEA 2X4JA 4R4QA 1UWVA 1BI2A 1KQ1A 4PJOG 2ALYB 3HOVH 2OTLT 4GLAC 1BI1A 3ULPA 3NELA 1ASYA 3S1MH 1N36Q 1YJ9A 3GD7A 3NENA 1H3ZA 4D6WA 4JI4L 2VGMA 5IP9H 4L5QA 4ELZC 4LF6L 4B3ML 1NJIU 1BI3A 4XIGS 4PNOA 2F5TX 3EAEA 2P0QA 1YJ9T 3DLMA 4C3HH 4C5EA 2EQSA 3OYHA 2JA5H 2A8VA 1QVPA 1OZ3A 1D8LA 1GO3E 1Z47A 4DR5L 3HOXG 4B3TQ 2PUKB 3A5ZB 3N5BB 1D3BB 2KVQG 2Q2TA 1M1GA 4JI1Q 1XMOL 5A0GA 2O4XA 5C3EG 2XDBA 4HT8A 3OBWA 1CKNA 2CCZA 4A3EG 1HZCA 4HJAA 4M7AA 1GD7A 2MQHA 2LXJA 3K80C 1NE3A 3BW1A 4ELYC 4MZ9A 3QJYA 1XJVA 2VQFL 4QVZA 1Y71A 2R6GA 4PJOB 4M7DA 4XTCS 5GAMd 1BBWA 3BFMA 2XI9A 4PZ7A 1CKOA 2UXBQ 3MP6A 3OTOL 3CD6A 3R6OA 1JJ2S 4BI8B 1WJSA 3VYHB 1SN8A 3FIFA 1YHQT 1A62A 4IO9A 2DXBA 2ZGWA 4LF4Q 3HOYH 2ZPFB 2UUBL 2V8KA 2JA8G 2EAYA 3CBPA 3NFCA 3CD6T 4M78F 1KD1U 1U1SA 4H02A 4JBWA 2GFAA 2MMPA 4GOPA 2LSSA 2BA0A 5C0XI 3VJPA 2CZ6B 2WSFE 4GNXA 3CCET 4KT0E 5FLMH 2QQBA 4JI2Q 3ASKA 1WFQA 2DZ9A 5FU6C 3F2BA 1VQNA 1NPPA 2HHHL 1V43A 3AHUA 3QBYA 1QP3A 4LFBQ 3OYFA 5GAOm 3PO2G 4GKKL 4R4IA 2Y0SE 4GY5A 1VQNT 3CCRT 3LH0A 4K0KL 3ZJYC 4J6YA 5IYDG 2DTIA 3GDEA 4FIBA 3PNWC 4M7AG 4IFDI 2KAFA 3PUYA 1U1TA 1YJWA 1XNRQ 3E19A 4GN3B 4YWMA 2JA9A 2JVVA 1Q1EA 5DM7R 2B8AA 5GANh 3RIRA 4XU3A 4C92D 4M7DG 2Z0SA 4RMFA 4RCBA 4YCUA 2MFIA 2K4KA 5DY9A 1PSFA 4C0ZA 2RF4A 4DV1L 1GM5A 1XOVA 5A2QE 1YJWT 3L2RA 2VXFA 2K5VA 1YI2A 2CKKA 3KDFB 4OONA