1UEBA

Crystal structure of translation elongation factor p from thermus thermophilus hb8
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
b'MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elongation factor P
publication title Crystal structure of elongation factor P from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 40
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1uebA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA03
4X62L 4EQ5A 3UDGA 3F8TA 2UUAQ 4JOIC 1PH5A 1C9OA 2ZTEA 1K8AU 4MNOA 1GO3E 2FXQA 3UDFA 1VQ6T 1VQBA 4R4OA 3CMEA 4B3MQ 3J80c 5IWAQ 4C2MH 1I3QH 3W1GA 4JI0Q 1K83H 4TVRA 3G4SA 1YJ9T 1S72T 5JEAJ 3UE1A 4X66Q 1TWHH 1QZHA 2JA7G 4DR2L 1E3PA 4BXXH 3KJPA 4DR5Q 1V43A 1B7YB 3CCSA 2PNHA 4YWMA 1JJ2S 4L5SA 3E0EA 2JJQA 4LUZA 2E5LQ 3CCMT 4A3EG 4NXML 2ASBA 1A62A 1VQFA 5C44G 1AE2A 1UE7A 4GN5A 1CKOA 3F1ZA 3CCET 3K7AH 4DUZL 4DV1Q 3UDIA 4HJ8A 4A93H 3I56A 2JA5G 3RLNA 4A3MG 1EOVA 2EQSA 3KDFB 5FLXE 1L1OA 2N3SA 4IPDA 1Y1WH 1Q86U 4DR3Q 4LFAL 3ICEA 1FGUA 4CRIA 3TS2A 1QVFA 1UE6A 5LMNQ 1E1OA 5C0XG 1T9HA 2WAQG 1N34Q 3S1NH 4QJFA 2VUMG 1J5EQ 3CPWS 3L2PA 2R6GA 4JI2Q 4JI3Q 1TWFH 4QGUA 4DR6L 1Q1EA 3RNUA 1M1KC 1NMGA 1IBMQ 1PVOA 3D0FA 2GVAA 4DV3L 2EIFA 3CMAT 1MJCA 2OTLA 1VQMT 3HKZG 4JI5Q 4OX9Q 5IP7H 4RMFA 4UP9A 1XNQL 1YHQA 2D62A 1GD7A 3CCQT 1YITT 3CC2T 3H3VI 4A3BG 2RHQB 3GDEA 3TEHB 3I2ZA 4YCWA 4LF4L 1OXVA 2LSSA 1XNRL 4DR4Q 4DKAC 4QL5A 5C0XI 3F2CA 2JA6H 2R7ZH 2PI2A 1SRUA 1YHBA 1K8AC 2ZM6L 1C0AA 2R93H 4J15A 5IYCH 2LQ8A 3GTJH 3FP9A 2UUAL 5C4JH 2PI2E 4LFCL 2MNAA 4IOCA 1XPOA 2KENA 2ZJQA 2B3GA 1G291 4YCVA 2HT1A 2DO3A 3CC4T 3AFQA 4X6AH 2QA4A 2Y0SE 2CKKA 2ZJRA 4K0KL 2VQFL 3G71T 4JV5Q 1GKHA 3I55A 5A2QE 1YJWA 5BR8Q 1AE3A 3A74A 1VQOA 3J81i 1M90C 2N49A 4X62Q 4DNIA 2F52A 1WCMH 2B29A 4A93G 2JVVA 5C3EH 2I5LX 4KHZA 1VQGA 1LM0A 1Y1WG 3I4MH 5M5XH 2HQLA 2UXDL 3CCUT 2QEXT 1HH2P 2I5MX 3NELA 3CCJT 3AQQA 3DLLA 2Z0SA 4UP8A 4DR2Q 4GKJL 4DR3L 2VNUD 4JI6L 1VQ6A 3JC66 4NXMQ 1K3RA 3ERSX 4IJLA 1YHAA 3K8AA 1K0RA 2BA0A 2Q2TA 1PYSB 1YJ9A 4DUZQ 1Q81C 1N8RC 4JI4L 1EUJA 4LFAQ 4C3HH 3T1HL 4LF6Q 1VQAA 4APVA 2OCEA 3L0OA 2NVQH 3J81E 1E7ZA 4R4CA 2E2JH 1Q12A 3ULPA 3RZDH 2JA5H 3HOXH 3CD6A 4A3MH 4DAMA 1VQKA 1IBLL 1KHIA 4GLVB 5AJ3L 2OWOA 2R7ZG 4A3KG 3GTOH 1XMOL 3TREA 5M5WH 3FKIH 3VDYA 2R93G 1VQ9A 2Q2IA 3UDXA 3GTGH 4TVAB 3NENA 1VQ5T 4H02A 1R9TH 1OTCA 1LYLA 2ZTDA 1EWIA 3KOJA 5IAYA 2VUMH 4DV3Q 1PH9A 2NN6G 1H95A 4XIGS 3L7ZC 1VQ7T 2PQAA 3CCVA 5FJ8H 3G6ET 1GM5A 1XNQQ 3S15H 4YWKA 1AH9A 3U50C 5JJKA 1V9PA 3TQYA 2E70A 4A3JH 1PYBA 1A0IA 4P75A 3STBC 2E8GA 1QZGA 1U5KA 1XNRQ 3CXCA 3CMAA 1OXTA 1WCMG 3PUWA 4JBWA 1K73U 5C3EG 4JV5L 1D7QA 1N32L 4BY1G 4EX5A 1GVPA 4LF5Q 1NBWA 3CCQA 1OXSC 5J3BA 2AHOB 4JOIA 4GOPA 1YITA 1I50H 1X55A 4LFCQ 3I4MG 1BVSA 4ZN1A 3CCLA 2R7FA 2VY3A 1NTGA 1WJJA 1L1OB 2MO1A 2NN6I 3LGJA 4JI1L 1PH8A 4K0KQ 1X9NA 1QVFS 2VQFQ 4IFDG 3RLOA 4LNQA 1L2FA 4JYAL 1WYDA 3STBD 4OWTB 4A3CH 4P74A 3OTOL 1YNXA 2I0QA 4JBMA 2NZOA 4GN4B 2R7DA 2XTIA 3SGIA 1VQ4T 2WP8J 2HHHL 4LF8L 1YI2T 3HOWH 4A3BH 5JJLA 5IT9E 2K4KA 2JEAI 4GN3B 2RF4A 4A3LH 1M90U 4KI0A 4AQYL 1PA6A 2E6ZA 2LXJA 2WB1E 3F2BA 4A3GH 3CC7A 1VQJA 1KC8C 1N36L 4HIDA 3HOVG 2UXDQ 3D31A 3J80i 3OW2S 3HOXG 4A76A 5M3FH 3K0XA 4RG2A 1BKBA 1YJNT 3M4QA 1HNXL 4LF6L 4GKJQ 1YBYA 4JI6Q 4DV2L 1I5FA 2H5XA 2KHJA 3FKIG 2JA8H 2DUDA 3JAMc 4IFDI 4A75A 4WJ4A 1D8LA 1SROA 2ID0A 4YWLA 4AH6A 4DR1L 4A3FH 3CCUA 2JQOA 4R4TA 4NPSA 1BBWA 1MJEA 3CCRT 2K75A 5ELNA 4IO9A 1VQNA 2Q2UA 2KCMA 5FJ8G 1HZBA 4GNXB 4JI4Q 1JT8A 3T1HQ 2UXBL 3U4VA 1IL2A 3EIVA 4A3JG 1Q81U 1N8RU 2ATWA 3GTPH 3S16H 5EAYA 1CSPA 4LUOA 2KDSA 3PIPA 4IJHA 4DV0L 2YU9H 1IBLQ 4LF9L 2D0OA 4JI8L 3P8BB 5LL6S 1L1OC 2C35B 5AJ3Q 2I5HA 1K73C 3S1RH 1XMOQ 1FVIA 1NJIU 4KLKA 1OXXK 3J80E 3UE0A 1EFWA 2MQHA 1TWGH 4DV6L 4O2DA 4C3JH 4A3KH 3E9IA 2BH8A 2K52A 4LF5L 3S2HH 1JJCB 3EBEA 5C0XJ 2YTXA 4FDBA 1YEZA 3RR5A 1HZ9A 4B3RQ 2GVBA 4JCVE 1PV4A 2Y0SG 3TRZA 1VQ5A 1JJ2A 1Q8KA 4BA2I 4A3CG 1KXLA 4P72A 3KBGA 4IPGA 1IZ6A 1WI5A 4JG2A 1FJGQ 5M5YH 3HOWG 2NVYH 1K9MC 4ALPA 3J7AF 3PIOA 2UU9L 3K7UC 2JEBI 4A3LG 3G6EA 1N32Q 4HIKA 4L5TA 2BH2A 2JUFA 3KYHC 3H15A 4A3GG 5K36G 3PGZA 4GS3A 2UXCL 1B8AA 2B63H 1CKNA 2Z6KA 3J7ZC 1VQ8T 5M3FG 1W3SA 1N9WA 4GLXA 4BY1H 1HJPA 2YYZA 5H1SE 3PO3G 2IHEA 3G4ST 3KLWA 1TWAH 3F2DA 1Z47A 2JNGA 2JA8G 4PZ8A 4JYAQ 1PH3A 4GNXC 3KF6A 2CCZA 1X65A 3ZJYC 4IPHA 1G51A 3OTOQ 2HHHQ 4A3DG 1Y1VG 4A3FG 4LF8Q 2F4VL 2JE6I 4HJ5A 1SE8A 1Z9FA 3PF5A 2IT1A 2VS1A 1HNZL 4DAYB 3PF4A 2AMCB 4AIMA 3GTQH 1Q7YC 1XNIA 4AQYQ 1ASYA 3BU2A 3I56T 3EN2A 3PUYA 1N36Q 1K8GA 5E7NA 4A4IA 3DB4A 1S72A 2DGYA 4DK6C 2N8NA 4YY3L 4HIMA 1I94L 4BBSG 2PQAB 5M3MG 1VQ4A 2NVTH 5GADC 4DV5L 1PH4A 1KC8U 1FL0A 1G6PA 1HNXQ 3HOVH 1XPUA 2IG0A 3CXCS 1IXRA 3ULJA 3CCMA 4DV2Q 1Q82C 1N33L 3BJUA 2G3RA 4X34A 4DPGA 4LUVA 4LF7L 1NJIC 2F3IA 1YVCA 3S24A 3CCEA 1QVGA 2A8VA 4DR1Q 2RCNA 4L5QA 5J26A 4AYBE 4B3TL 4Y52H 2MFIA 4R1JA 1YJNA 4GOPB 3HKSA 4OX9L 2OTJT 4L5RC 4POGA 3HOZH 1NY4A 3GO5A 2OTLT 3G48A 2UXBQ 3CQZH 1HZAA 1XMQL 1JMCA 5ELOA 3PCOB 1Q1BA 2NZHA 2MI6A 4DV0Q 3U4ZA 1KL9A 4LF9Q 3AFPA 4JI8Q 2IX1A 4LFBL 3CCRA 2CWAA 1P16A 2GN5A 3FHWA 1FJGL 5IP9G 1HR0L 2A1AA 2K5HA 2AWOA 1PH1A 2B63G 3I4NH 4PMWA 1VQMA 4DV6Q 3IRBA 1VQPT 4ME3A 2LXKA 2KCTA 1RIPA 1UWVA 2K5VA 4OXPA 3AEVA 5DLQE 3T1YL 5FLXc 4UPAA 3CC2A 3TS0A 4C3IH 1HR0W 1WOCA 1CSQA 1J6QA 1QUQA 3AYHB 1Y14B 1S40A 3KFUA 3NEMA 4TQUS 3LH0A 2LVMA 2OQKA 4HJ9A 2CKZB 2KVQG 4MZ9A 5GQOA 4O0AA 4JC0A 1W2BA 5JEAG 4KHPL 1HNWL 4P71A 5HY6A 3GTMH 1NMFA 4DK3C 1KRSA 1O7IA 1JB7A 2UU9Q 1KD1C 3PUVA 5GAHC 3CAMA 3M9BA 1K9MU 1X54A 2UXCQ 3CC4A 1EYGA 2E2HH 2VL6A 4DV4Q 4GKKL 5JJIA 2WB1G 1X6OA 3G71A 4IOAA 4NXNL 1KQSA 1NE3A 3OYYA 4UP7A 4DV7L 4GOPC 1X3EA 3PUZA 2UUBL 3W5OA 4X64L 4DUYL 4JI7L 3S1QH 3PO3H 3DM3A 4DR7L 2F4VQ 3W1BA 2PMZE 2QGQA 4BA1I 4YHHL 3WWVA 1VQ8A 1HNZQ 1YIJT 3H0GH 2R92H 3M7NA 1V1QA 2L15A 1ASZA 3HOZG 4A3DH 1Y1VH 2N78A 3MEFA 2YV5A 4JBJA 4IFDJ 2QEXA 2VW9A 1SLJA 4YY3Q 4HJ7A 3CCJA 1EIYB 1I94Q 4HIOA 5C4XH 4IPCA 4HJAA 3HOUG 1Q7YU 5FLMH 4OWWB 2AKWB 3S2DH 2JOYA 4X65Q 4DV5Q 5LMUL 4YTLA 4B3RL 2IHFA 2ALYB 3CD6T 1N33Q 1KRTA 3PUXA 4BBSH 1VQKT 5M3MH 4LF7Q 2L3RA 3JAMi 3LGLA 1VQ9T 3I4NG 1Q82U 2JK8A 4BBRH 4B3SL 4QQBX 4B3TQ 2K14A 2KHIA 3KF8B 1VQLT 4LWCA 1PFSA 3BZCA 1CUKA 3I4OA 1CKNB 3CP0A 2UUCL 1IBKQ 3CCVT 2CWPA 5IE8A 1XMQQ 2WAQE 4UY8C 1SR3A 2KBNA 2MWOA 1YZ6A 3HFZB 1VQCA 4OONA 2WFWA 3M85A 1SFOH 3HOYH 4LFBQ 3KF6B 2EXDA 1NPRA 1P8LA 2OTJA 1VQDA 5IY0A 4ZN3A 3RN2A 5GAEC 1HR0Q 3HKZE 3NBHB 3M3YH 3B6YA 2CQOA 3KDFA 5IYDH 1I6HH 1VQ7A 1KAWA 2XGTA 1PHJA 3OW2A 1IYJB 1PH6A 3S1MH 4POFA 5IP9H 3CCLT 3T1YQ 2ES2A 3A5ZB 3CPFA 2LCLA 1XPRA 2VZAA 2VQEQ 2IX0A 3CMET 4QQDA 1M1GA 3JAME 3A0JA 4P73A 4DV4L 1EQQA 3J81c 4WJ3M 3E9HA 1QVGS 4BY7H 1HNWQ 4KHPQ 1XTDA 1VQPA 2NVXH 1JJGA 4GNXA 3S14H 1SSFA 3ULLA 3CPWA 1X56A 3H0GG 4PZ7A 2R92G 3M4OH 4YCUA 3LGFA 3CCST 3RLFA 4A3IH 2E2IH 1UEBA 3BZKA 4B3ML 4BXXG 5IWAL 2JA9A 2IY5B 3PO2H 5C4XG 1KD1U 1VQIA 4GKKQ 4JI0L 3CC7T 5FLMG 1VQEA 4X66L 4LW1A 1E24A 3PV0A 3K81C 1A8VA 4MTNA 4NXNQ 3GTLH 4JI1Q 4DR5L 5IYBH 4NB3A 4DV7Q 1C7YA 2MO0A 2UUBQ 1X3FA 4X64Q 1YI2A 4DUYQ 2E5LL 1X3GA 5GAGC 4R4IA 2Z6KC 3I7FA 4X65L 4JI7Q 4DR7Q 1A63A 4PG3A 2BA1A 2YTVA 3J7A5 4BBRG 1Q86C 3K80C 4YHHQ 2Q2HA 3J81j 4DV1L 1VQHA 1S3OA 1LUZA 1VQNT 4AYBG 2A19A 4QY7A 3DB3A 1RL2A 1Q46A 4JBKA 5HGQA 2JA7H 2XHCA 3GTKH 5DM7R 3HOYG 1CKMA 1W2BS 5GROA 5LMNL 1YIJA 1MKHA 1OXUA 1QUQB 1DGSA 2YTYA 3A5UA 1YHQT 1N34L 1J5EL 1VS0A 1IBKL 4JI2L 3RN5A 4JI3L 3HOUH 3RZOH 3GD7A 1HZCA 3U58A 5IP7G 4A3EH 2AWNA 1XJVA 2CFMA 5C44H 1PH7A 4XTCS 4OO1G 5LMNW 5IYDG 1IBML 5IT9c 4B3SQ 1LTLA 4JI5L 2OQ0A 1VCIA 1TWCH 1KQSS 4GLAC 1TXYA 1L0WA 3MXNB 2UUCQ 2JA6G 3H3VH 2V1CC 1QVCA 4RG1A 5IYCG 4BY7G 1B70B 1WFQA 2QA4T 3Q8DA 1MIUA 2VQEL 4DR6Q 4DR4L 2HIVA 3CF5A 4Y7NH 1VQLA 5LMUQ 2RHSB 1BBUA 1UE5A 4A3IG 3S17H 3I55T 2ZTCA 1EQRA 3KJOA 1YJWT 4OO1I 2D0PA 1M1KU 1U0LA 3PSIA 1VQOT 1SN8A 4OWXB 3PO2G 3M4PA 2HIXA 1E1TA 2ZJPA 1JE5A 5IYBG 1KIXA 4LF4Q 2K50A 4QIWE 1PH2A 4R4QA 1UE1A 1SMXA 1NPPA 2MWPA 1E22A 2K5NA 1EIFA 5BR8L 4PZ6A 3CW2C 3ER0A 2ZM6Q 1NZ9A
chains in the Genus database with same CATH superfamily
5CR3A 4I7ZC 2F69A 2K05A 1C9OA 1ZA1B 1E7OA 1MHNA 3R6NA 5E1FA 4ORZA 1VQBA 3R2TA 5EKKA 4B3MQ 5IWAQ 2KK4A 4K11A 2ZGWA 3CCJQ 4PV1C 1B9NA 2DXTA 1GBQA 3PT9A 8AT1B 1YJ9T 3PMIA 2CUDA 3UE1A 1QZHA 2JA7G 4N0AA 1E3PA 1LPLA 5LJ3f 4J1MA 3KJPA 4RTUA 1OU9A 5I2SA 1SYDA 3X28B 1B7YB 1JJ2S 5CIUA 4C92A 5KYYA 5KH6A 4A3EG 1D1KA 1F9RA 1R4PB 4GN5A 4Q0FA 1TIID 4C3HG 3F1ZA 3J81L 3RR6A 4QQGA 3OIQA 3AHUA 4KUIA 4HN7A 4M77B 4OMLA 2RCFA 3K6OA 1BBXC 5EBCA 2FPEA 1BBZA 4KV6A 1Q86U 4C0DC 2Z8LA 4JJDA 1X3QA 2XNAC 1J8IA 1IKMA 1CQVA 1CKBA 1GUTA 2EYJA 2QGGA 5LMNQ 2P0PA 2CP0A 1N34Q 3S1NH 2WAQG 2LS01 1J5EQ 4F7UE 2R6GA 4JI0Q 4JI3Q 4FNFA 3E5SA 1CHPD 5D65A 3M0RA 2DJFC 3TSWA 2RDGA 1X6GA 3E2UA 4HXJA 3HOWB 4QUFA 2OTLA 2JMCA 5IP7H 1XNQL 2CP7A 1YHQA 3BZDB 3Q22A 1AW7A 2CP3A 2AZSA 2RD1A 2X4JA 4F7XA 1EU4A 5KE3A 4A3BG 3NGPA 3TEHB 1AZGB 1XNRL 4ESRA 1WTPA 1Y1WB 3QR8A 2JZ2A 3NHHA 1SRUA 5G3LD 3FJPA 3H09A 2R93H 5IYCH 4D6WA 3GTJH 1BU1A 4F7UF 1CK1A 1EZZB 2UUAL 2NUCA 2PI2E 2MNAA 1XPOA 4G7ZC 2F0PA 4X6AH 2CKKA 2W10A 4O42A 2ZJRA 1STGA 3G71T 4L5GA 2RDHA 3I55A 1PSFA 1YJWA 1Y8OB 4M7DB 1KQ1A 4AFZC 5LJ5f 1VQOA 3HGBA 3MPUB 4E6RA 2IJ0A 2YU9B 2JVVA 2DBMA 3S1RB 1ZSZC 3VS4A 2EXZA 5M5XH 2UXDL 1PYWD 1WVLA 3NELA 2F4VL 3IAYA 4A3KB 3CQTA 2Z0SA 1SRMA 4OMPA 2E10A 2M0OA 2RSOA 1TT2A 4A3MG 2R5AA 2XDDA 4IFDH 1IXDA 5CV4A 3FJ5A 3JC66 3VR6A 3K8AA 4C56C 5DLOA 2RQVA 2Q2TA 2WSFE 1A3TA 3OYMA 1YJ9A 1JR0D 4C5GA 1NEBA 4M78G 4KD4A 4LF6Q 5FU7C 2Q8RE 3DXJC 1WXUA 3IFTA 4QB4A 1H9SB 1XMOL 1V76A 2E2JH 2JA5H 1SF9A 3L2WA 2NWGA 1VQ9Q 5C3EB 3EHQA 4DAMA 1IBLL 1A15A 3GTOH 2O9VA 1QG7A 1K9MR 1W6JA 1VQ9A 2R93G 4ILWA 4OMMA 3U23A 3NENA 4GZYC 1VQ5T 2ROLA 2XN9C 4X3TA 1EY6A 2KQ3A 1LYLA 2VB3X 2LNVA 5IAYA 3TDQA 1IKLA 2EJGA 3OY9A 2YLBA 3OYAA 2L0CA 3TBIB 1H95A 3D4RA 2E64A 2OAWA 3EGDB 5ELBA 5FJ8H 1GM5A 4DU9A 2K9GA 2J7ZA 5KYWA 5AFWA 3UPUA 1W1FA 2DYBA 5CORA 3TQYA 4PJLA 4J83A 1H9MA 3D6CA 1G2TA 2E8GA 5KYUA 3PUWA 1UAPA 1SNPA 2K79A 2ZT9C 1JOQA 2DLPA 1GVPA 2PZWA 1I5OB 4JJCA 1OXSC 1UGSB 4G4KA 3HOXB 4LFCQ 1D0YA 3R2IA 1BB9A 2Q8IB 5FU6C 3OWEB 3SHWA 3CCLA 2R7FA 2NLUA 4PQXA 3RLNA 2EQJA 2ZXOA 4LJZC 3WOEA 2CZ0B 1PH8A 1X9NA 2OX7A 3IFDA 4IFDG 4H44C 3RLOA 1L2FA 1WYDA 4OWTB 4F7UB 3CCSQ 1C4QA 2YWWA 4GN4B 3HOWH 5HK3A 1RJTA 2JEAI 5JJLA 4L6V5 3QWNA 4X3UA 3I56Q 5LJ3g 4A3JB 3NBIA 2E6ZA 2WB1E 2BE9B 1V1PB 1DXMA 4C92E 4FIBA 1GRIA 3HPWA 2NTSA 1BKBA 1YJNT 1HNXL 1B3QA 2F2XA 4KKSA 4JI6Q 2DUDA 5HURA 2LC4A 2BDOA 3JAMc 4NDXA 2ID0A 1I07A 4XYOA 4DR1L 1PXUA 1RF2D 2R5MA 1SAPA 2LFNA 4A3FH 4FW2A 4R4TA 4NPSA 1I4QA 2DPPB 3CBMA 4Z88A 4HVVA 1TS2A 2KCMA 1HZBA 3V7SA 5FJ8G 4JI4Q 3T1HQ 1GUSA 2PUOB 1RODA 3EIVA 3BDOA 2JW4A 5FWCA 4MMLA 1PWTA 1CSPA 4LUOA 4C92F 1OX8A 1CA6A 3PIPA 3W2DA 2YU9H 4O5VA 3A8KE 2DNCA 3S1RH 5AJ3Q 1BCPC 2GFUA 4A3GB 2I5HA 4J9EA 1WZOA 4KLKA 4KY7A 4R0KA 2ZPEB 2WSCE 1OV3A 1JO8A 4A3KH 1QWYA 1HJDA 1XJWB 1YNNC 4O2DA 4RAUC 1NSNS 4C8QG 1WHHA 2QA4Q 5KNCA 1S5CD 5JJZA 5HK0A 1YEZA 1B9MA 4HAEA 1SYEA 2G5DA 1PV4A 2WKDA 3A8LB 1VQ5A 2P4TA 2NN6H 1LT3D 4P72A 2HBWA 4DBRA 1IZ6A 4FF1A 3HOWG 3NMZC 3JSCA 2D6FA 4ALPA 4RTTA 1JE4A 1X2KA 4RUGA 4HA8A 4LE9A 3GTPB 1N32Q 2V4DA 4ZKCB 3KYHC 2L8DA 1VIEA 5GMKj 2PYKA 3H15A 3OYIA 4HCBA 1BI0A 1AZQA 2B63H 1CKNA 2LQNA 4DFAA 1PRMC 3VRYA 2Z6KA 1WJQA 3WDNA 1ZQ1A 3RKYA 3VA5A 2NBFA 2ZZDA 2A28A 4DEYA 1HJPA 4OELB 5I6YA 5E3FA 3VV0A 1Z47A 1Z9QA 2F03A 4GNXC 2DM1A 1TY2A 2KJXA 2HD3A 4IQZA 1B2TA 4A3FG 1AP0A 1UHFA 1ZXTA 2WACA 3MKDA 2VXWA 1GFCA 1XNIA 4OGCA 3MXPA 1WQ7A 4ZCKA 3BU2A 4AQYQ 1K8GA 1N36Q 2K33A 1S5FD 5E7NA 3DB4A 4Y28E 2DGYA 4DK6C 2N8NA 5CC4A 2RI3A 3H94A 5M3MG 2RK1A 1I6HB 1UHCA 2QTXA 3CD6Q 1L0YB 5I9PA 4DV5L 1PH4A 1RABB 2GGRA 2RJFA 3VS3A 4K6LA 3ULJA 3CCMA 5KNDA 1N33L 2L0AA 1XPUA 5KCHA 4DPGA 2AT1B 1M1KR 2E76C 2F3IA 1I4GA 4LF7L 3CCEA 1QVGA 3REAB 1QB5D 2I0NA 2BUDA 3QZ9B 1D3BB 4WTOB 3PTAA 5GANj 1K28A 1TWAB 4B3TL 1MNDA 4R1JA 4NOYA 1YJNA 4GOPB 5IHNA 4POGA 3LWIA 4CKBA 2SEMA 3CCVQ 3GO5A 2JTMA 4O6JA 1PKSA 5ELOA 3MFGA 4ZRZA 1Q1BA 2VXFA 2OEOA 4DV0Q 3PNWC 4ZNXA 4K5WA 4EQPA 3AFPA 2ZCFB 4PFOA 2F0SA 2KHSA 1F9QA 2SEBD 2QI2A 1P16A 3VUZA 3FHWA 5IP9G 2WB1B 4OMQA 2B63G 4PMWA 1YITQ 1VQMA 4C92B 4J8OA 3JCMQ 2WKCA 4CDCC 1RIPA 3A7AB 2F0OA 3X3MA 4OB0B 2KT8A 1QVGP 1C0MA 4NP5A 1CKAA 3PVQA 1WOCA 2DL5A 1CSQA 4C5IA 4X1VA 4A53A 4K5VA 4BWGB 2D9UA 3OPOA 1K76A 4HJ9A 1IRXA 2KVQG 4RWSC 2NUZA 1OPLA 2GTJA 1W2BA 2FINB 3N6RA 4JC0A 4ZYSA 3RIRA 1KTKA 3HFOA 3L2VA 4QVCA 2XD0A 1NMFA 2K28A 1IREB 3CQZB 1OX9A 1IO6A 1KIKA 3E3XA 4CJ1B 2X4XA 2XICA 1X01A 5FROA 1AFPA 1EU3A 1SNCA 1EYGA 2XDBA 4WRDA 1RKNA 5C44B 2E2HH 4GKKL 3QKJA 1X6OA 4NXNL 1STHA 3MFYA 3TSSA 4UP7A 2ZPIB 5GAOl 1TWCB 3QWYA 5DNFA 3W5OA 4JI7L 3SR1A 5IXFA 1KDAA 3VR4A 2HQXA 1Q81R 2WINB 3VR5A 3W1BA 3CCUQ 3JCMP 4BA1I 3SVMA 1SDFA 4ZTFA 4AG1C 1T5EA 3H0GH 1Y96B 6AT1B 2O5JC 4Y7NB 3M7NA 1ABQA 2N78A 5KYXA 2YV5A 1W2BP 3MEFA 2E65A 2QEXA 3TP5A 3PIP3 1FMWA 1STNA 3HOUG 2DXCA 4N9PA 2QCPX 5FLMH 1BCOA 2DIGA 2DXBA 1ZBJA 1ABOA 1WHMA 3UATA 3V8KA 2MPMA 4B08A 2VYTA 2HDAA 4OMOA 1G3YA 3HKZB 1RTNA 1YP5A 3I4LA 3PUXA 4A63B 2XI9A 3V8LA 4QUCA 2X3XD 3JAMi 2KY9A 2RJEA 4OHJA 2CH4A 3GTQB 4LD9K 2R57A 4BBRH 4LDWA 1BUVT 1EEID 3HTRA 2AQ1B 2KHIA 2MJ8A 3KF8B 1VQLT 3TZUA 1LCKA 2J6FA 2FG0A 4U68A 4A4EA 1STEA 5D6YA 3L2QA 3CP0A 4JS5A 1OULA 1SYFA 2K57A 4R8NA 2WAQE 3AU7A 1I3QB 2EYMA 1LV9A 2SOBA 2YUPA 3VS1A 3RMHA 1NPRA 1VQDA 1OQKA 2E3IA 5GMKi 5EGTA 5IY0A 5G3LF 2Q8TA 5GAEC 1IHWA 2K32A 3B6YA 3M3YH 1SYCA 3ZYYX 4K2LA 4KHVA 1I6HH 2C0TA 1JU5C 4E47A 2XGTA 1PHJA 2GCXA 4ZGDB 1IYJB 1S5DD 3MO8A 3E19A 3T1YQ 2KEAA 1XPRA 1IL8A 5CO7A 1F2YA 1LLRD 3CMET 3HSBA 2IX0A 3JAME 4C1NK 1MNEA 1EQVA 1AWOA 4BY6C 3E9HA 1I4PA 1PSEA 1QVGS 4BY7H 4J5YA 1M3AA 3QDFA 3H0GG 1BNZA 1VYTA 1XTCD 4YCUA 5IHIA 3CEYA 3LGFA 1VMPA 4B3ML 2EW3A 5IWAL 2RF0A 2K1BA 2LDMA 3JCMV 5GMKm 1VQIA 3PO2H 2W0ZA 3V7CA 5FLMG 1VQ4Q 4LW1A 1QWEA 3OYDA 4S3SA 1LNXA 2F3WA 1CI3M 5JVH3 4DV7Q 1C7YA 2MO0A 3MWYW 1X3FA 1YI2A 3S3MA 3NWSA 3MEVA 5GAGC 2Z6KC 1EY8A 1KJWA 4K5XA 2KROA 1QWFA 5KYWB 3KUPA 1TVXA 1LO5D 2BA1A 4PG3A 3J7A5 4BBRG 3K80C 4IUQA 4YHHQ 3WXMB 2Q2HA 1QCOA 1EY0A 4CBVA 3M56A 4X9DA 1G8ZD 2R7ZB 1LUZA 1GOZA 5GAN2 1VQNT 4AYBG 4FXDA 1VYUA 2ZXRA 4QVZA 1Q46A 3S14B 4DBFA 3GTKH 1KHCA 4JJBA 1W2BS 4M7DA 1MKHA 1SE2A 5LMNL 1N34L 1IBKL 5GMKe 5GAN3 2YXYA 3CCRQ 1VS0A 2K3XA 3EG2A 4JI3L 1J5EL 1HZCA 4BDYA 5K36G 5C44H 2SNMA 4M78E 1U4RA 2A74C 2DXUA 2DILA 4NS5A 1VCIA 4ANJA 1SKUB 1TWCH 1OOTA 5GAMh 4GLAC 3CC2Q 1TXYA 1L0WA 2DYIA 2JA6G 4LNPA 1GXIE 3HEJA 3SK6A 5KEEA 4BY7G 2B86A 2ZPFB 4Q5WA 1WFQA 2VQEL 3CF5A 4Y7NH 5IN1A 1VQLA 3HP3A 1BBUA 4PJJA 1UE5A 2DL3A 2GQIA 2K3BA 2D8JA 4A4GA 3KLSX 5KCOA 1U0LA 4DA2A 1AD5A 5CCAA 4J7FA 1SN8A 4WORA 3PO2G 2JM9A 1AOJA 4JRIA 1SBBB 1Y8NB 4M78F 2A6ED 1H9SA 3RZOB 5C3XA 4Z02A 1ICWA 1BIAA 4UHVA 2HNIA 1IYUA 4LF4Q 1PH2A 1M30A 4C3HB 3S6WA 1OEBA 1UE1A 1SMXA 1NPPA 2P84A 1E22A 2XG8D 2EYOA 2K5NA 4TQUS 3CW2C 5DM63 2ZM6Q 3GTQH 1CQFA 4J9BA 1H3HA 3F8TA 5JVG3 3RZDB 1PM3A 1S1NA 4JOIC 4DF7A 1VQ8Q 1K8AU 3GF5A 1S5BD 1GO3E 2FXQA 3JCMe 1VQ6T 3UDFA 2ZPBB 3CMEA 1D09B 3EGDA 2FRYA 1I3QH 2DN8A 2G9DA 3W1GA 1R9TB 1PZKD 3ZBDA 5JEAJ 1S72T 3JCMX 3PMTA 1QP2A 2EYPA 1Q82R 2F0LA 2CP2A 3A56A 5C0XJ 2PNHA 4LUZA 1JBMA 1AEXA 2DNUA 5C44G 2PNIA 1AE2A 2M9VA 2WIIB 3K7AH 4HJ8A 4DV1Q 1CTMA 3R8BA 2VGNA 2JMAA 2V26A 3H8ZA 4IUTA 2QDBA 4ZGJB 3BYYB 2PU9B 1F77A 3K0YA 3KDFB 1RACB 2N3SA 4IPDA 1EOTA 3SK8A 2J06A 1GFDA 1JICA 1I50B 5GANd 1GUWA 2RQTA 4KULA 5LJ3h 1QVFA 1QKWA 3KUFA 1E1OA 2O9SA 1LTSD 1T9HA 4NW2A 2H3EB 4QJFA 5C0XG 5DAUA 2OTJQ 3JRZA 1MHWC 2L5QA 2HSEB 1DOMA 4ATOA 2KYBA 2Z9HA 4XQNA 4DR6L 5FO9B 1YCYA 1M1KC 1NMGA 3RNUA 1PVOA 1V1PA 3D0FA 3M58A 4LDUA 3WVDB 1VQ7Q 1PMRA 3D6WA 4FVMA 4OX9Q 3HKZG 2ED0A 4RMFA 4UP9A 2KQWA 5I2MA 4JRQA 1SSHA 1GD7A 1T5XD 3C0CA 2D62A 2LJ0A 4JVZA 3H3VC 4G7OC 3H3VI 1E6GA 4I7AA 3HRSA 1OXVA 3U9OA 1SRLA 1VQPQ 5JPMC 1CSKA 1NE8A 2Y4XA 2EJMA 3F2CA 1ONLA 4JRPA 2EWNA 2PI2A 2R7ZH 1C0AA 4R9WA 4J15A 2KUMA 4C8QE 1QVFP 3QOJA 4LFCL 2KENA 3NUCA 3F2UA 2B3GA 2MIOA 3S1NB 4M7AE 4DNRB 3CC4T 3FEOA 4IUPA 2HT1A 2FZKB 1JOOA 4OP0A 1II3A 3S15B 4M77C 4JV5Q 2EYYA 2V1RA 3TQ7P 1EEFD 1EQTA 3TP7A 3SHLA 3C2PA 3S16B 2EZVA 2N49A 4X62Q 2DTOA 4DNIA 4M78B 1R8OB 5FLXL 2COZA 2I5LX 1G6ZA 1I0CA 3QSUA 2BE5D 2TSSA 4EDUA 1SEBD 4C8QF 1STBA 2I5MX 3CCJT 3AQQA 4UP8A 4AFSC 4DR2Q 3OYHA 3EH1A 1WXBA 2NZ1D 4DR3L 4PJOG 4M7AF 3QXEB 1GCQA 1YIJQ 3GTJB 2HKQB 4JI6L 3VS7A 1VQ6A 4OGQC 3QUIA 4JS4A 1YHAA 1LOJA 5LJ5h 1KFZA 3C46A 1QOHA 3ASKA 3OMCA 4DUZQ 5M5YB 2PVOB 1Q81C 1N8RC 2LZ6B 4JI4L 2A36A 4LFAQ 4C3HH 3T1HL 2K03A 4APVA 1I1JA 3J80L 3ULPA 4EGVA 3RZDH 4IUUA 3RNJA 2OWOA 4LDVA 1ZSGA 1KHIA 5AJ3L 1P92A 3UF4A 1I4XA 4J7IA 2HCCA 2R7ZG 1IGQA 4HSPA 2J6OA 4M8AA 3UDXA 2F2VA 3GNGA 4XK8E 3G7LA 5BN5A 1R9TH 1OTCA 2AKLA 2EGAA 4MHEA 1EWIA 4M7DC 3T16A 1ARKA 3H6MA 1N5ZA 1QNKA 3G6ET 4YWKA 3A98A 3DM1A 2M0YA 2DD5A 4AMCA 2JTEA 2ESWA 1HA5A 1V9PA 3DHQA 1PYBA 4O1NA 1TG0A 4KH0B 2X4WA 4PJOD 1A0IA 1KNAA 2F1MA 3C3LA 3STBC 4V190 2J0TD 4RKBA 1AEYA 3L9AX 1U5KA 1QZGA 1OXTA 1H9RA 1D7QA 3OYGA 1N32L 4DOVA 2IW3A 4LF5Q 1DYQA 4GOPA 5J3BA 1I50H 1X55A 2EE1A 4ZN1A 5EPKA 2EKOA 3SEMA 3SD4A 1G3SA 3A1PA 1NTGA 1WJJA 2ENBA 2F0DA 3GTOB 2NN6I 3LGJA 3SK4A 4K0KQ 1ZLMA 2VXEA 1QVFS 1X27A 3JCMJ 4QW2A 1TS9A 2L3QA 5CKHA 4OEMB 1YWOA 2FMMA 4A3CH 4P74A 1GJXA 4JBMA 4HT9A 2ZAEA 2B2UA 1TXQA 4HMIA 4GN3B 1IGUA 4ZQ3A 4A3LH 3RD4A 4AQYL 1I6VC 2FJ2A 2LXJA 1PA6A 1LTID 2A7YA 3CC7A 1ENCA 1N36L 4HIDA 3HOVG 4PJMA 3D31A 1H3ZA 1QW1A 2K2MA 3OW2S 4MIUA 2OF1A 4A76A 2B39A 2QQ9A 2K6AA 2F0UA 3K0XA 4GKJQ 2RO0A 3EG0A 2RQXA 3AB9A 2JA8H 1I5FA 2H5XA 2KHJA 4KY5A 2IIMA 4KMUC 4WJ4A 3HRZC 1SROA 4J6YA 3EFXD 4YWLA 2LRQA 4C8QB 1WJRA 3QYGB 1O7LA 2M02A 4C0ZA 5I2YA 4FF2A 2E75C 1HXDA 1YWPA 4XTWA 1BBWA 2HDLA 4M7AB 5CK9A 4CC3A 5ELNA 1MJEA 2OTLQ 2Q2UA 1JT8A 1IYVA 1YHQQ 3NWTA 1O75A 3U4VA 4DXFA 5CKDA 1Q81U 1N8RU 3JB9G 3S16H 5EAYA 2RN8A 2DD4A 3X24B 4R8IA 4DV0L 2CZ6B 2LT4A 1TKWB 4ULLA 3P8BB 5LL6S 2KEDA 1D5XC 2C35B 3GQBA 3L3OC 4YIJA 1W6XA 1XMOQ 2XIDA 1FVIA 1WHGA 4M75G 1NJIU 3I5SA 2R93B 2FO0A 1Y96A 2AHJB 2PW5A 4C3IG 1NBEB 2MQHA 1TWGH 4ZGEB 1M4VA 1TSFA 4ABNA 4C3JH 5CMDA 2BH8A 3FB9A 2EPBA 2DRMA 4RGMA 1HQRD 2RM4A 2EJ9A 1JQYD 4V0BA 3RR5A 4A3FB 2Y0SG 4A3CG 1RLPC 3I55Q 1E2VA 4RTVA 1YJWQ 5IT9L 1PFNA 4RMOA 1FJGQ 1VQOQ 4JG2A 5M5YH 1X6BA 1UB4A 4JRKA 3OW7A 2LMJA 3CRLC 4A3LG 3G6EA 4HIKA 2KT1A 1F9SA 3KF8A 2JUFA 2V1QA 5M3MB 4GS3A 2K2VA 1TWBA 1JC7A 2R3ZA 4PL6A 4DBHA 3UDCA 2DJQA 2AZVA 2DZCA 3OS2A 5ELFA 3PO3G 3UA7A 3G4ST 1U3OA 4E7HA 2DY7A 3F2DA 3R6OA 2JA8G 4PZ8A 2NUPA 2GA4B 1PH3A 1A2UA 4N8X1 4IPHA 1G51A 3OTOQ 1WTRA 4A3DG 1UGVA 2L5TA 2JE6I 4M75D 2VS1A 1YJ9Q 4DAYB 1BF4A 3GLXA 2AMCB 4BB7A 4RH6A 3I56T 3M59A 2LT1A 3P8DA 1Y1WH 2L55A 3OYLA 1F2ZA 4V2SA 1RTOA 4BBSG 4NMZA 1TU2B 1ZYRD 4MDXA 1C48A 4BACA 1IXRA 4J6HA 3MCAB 1Q82C 5GAMj 4DV2Q 1FMVA 3BJUA 1H92A 2B63B 3SK5A 4MTKA 4PJOA 3S24A 4Z8AA 3SWNA 1V1OA 3FMCA 1DZ1A 2D1XA 2VASA 5TSSA 2QAZA 4RHSA 1KABA 4C3JG 1AT1B 2RCNA 1B1ZA 4L5QA 4AYBE 2MFIA 3QG1A 4F8MA 3HKSA 4BS9A 1QMCA 4KN7C 3HOZH 1RAHB 4RCCA 3M4OB 1DD2A 1YNJC 2UXBQ 1YFNA 1B44D 4KKUA 2Z6BA 3A8MB 4PFPA 4K8IA 1ACMB 4ELZC 2NZHA 2EGEA 1LTBD 1K8AR 1TR5A 4LF9Q 4JI8Q 2IX1A 3C95A 3JCMf 3P75A 3BDLA 2PW7A 2HEQA 2GN5A 3A8GB 2KXDA 3FLGA 4HCSA 2AWOA 3I4NH 4IALA 3FRNA 3ZFJA 4DV6Q 2LXKA 3CCLQ 1WHJA 2F0HA 4OXPA 4WFN3 2HL5C 3AEVA 3T1YL 5FLXc 3MP1A 3TS0A 1RD9D 1PRTD 1DONA 3OSOA 4M78D 5IGEA 1J6QA 3AYHB 1M90R 1MGSA 3KFUA 3NEMA 2DY8A 2CKZB 4DNTB 5GQOA 3K58A 4BUGA 1K8MA 2BCOA 2CP5A 2CW0D 3LYIA 4CJ2C 2COWA 1QE6A 5IGDA 1O7IA 2UU9Q 2E2DC 3M0TA 3HOUB 1PFBA 5IGCA 1VDZA 2DA9A 2VL6A 4DV4Q 2G9HD 5JJIA 5CQYA 3G71A 1RAIB 3GOXA 2QF7A 4F04B 2ZXPA 4IOAA 4L63B 1X75C 3I72A 5CBEE 5GAOr 4DV7L 4GOPC 2XMFA 1GXDC 1X3EA 2MUYA 1W70A 3BDCA 2BIVA 3DM3A 4DR7L 2VNUD 3DKMA 2F4VQ 1VYVA 5LJ3j 4YHHL 3WWVA 1D1AA 1HNZQ 1K3BC 2RHYA 1V1QA 3HOZG 1ASZA 4C0GA 2B2YA 3EG9B 3S17B 2VW9A 4N0AC 1SLJA 4HJ7A 4ID6A 4MZTA 5ECAA 2B2UC 1I94Q 2DL8A 1R4QB 2RHIA 3L2UA 2AKWB 1HTPA 1F9PA 4X65Q 4C92C 2J7IA 1LTTD 1UGPB 4YTLA 2JTFA 1PDQA 1EL0A 3CD6T 2FPDA 3TU4K 2EY5A 5FK9C 1VQKT 3Q0AA 2E2HB 5M3MH 2O4XA 1W6KA 1WNLA 1OYXA 2RQUA 2JT4A 2L3RA 4XTUA 2XRSD 3LGLA 2ICIA 3DEPA 3I4NG 1Q82U 2DAQA 1UGRB 3OWFA 4FW1A 1O7ZA 2E1HA 3CHBD 4LWCA 1T0HA 3GTMB 2FMCA 3BZCA 4GLKA 4FYXB 2LQWA 3I4OA 1ILQA 2X35A 3CCVT 2DRKA 1XMQQ 5IE8A 3M54A 1XWEA 1WIEA 1VQ5Q 1QVPA 2VKNA 2DNEA 3EFRA 2MHVA 1K83B 3H0GB 1YZ6A 3HFZB 2BZYA 1VQCA 2WFWA 4OONA 4M7AG 1TWHB 3BY7A 3JCMW 2EXDA 4B3SL 1UDLA 2F5KA 1FX7A 2D9TA 4XQJA 2F1LA 3H6ZA 4OIKA 3RN2A 3TP6A 1KG1A 3OS5A 3HKZE 3NBHB 1EX4A 2RJCA 3KDFA 3NXWA 1WD0A 4CDEC 2RHUA 2DE0X 4M75A 1TU0B 2QEJC 3S1MH 1R0BG 2B8AA 1WGSA 3L1AA 1GBRA 4KRTA 2QTVA 1QCFA 4POFA 5IP9H 3MEUA 1NYFA 1C1AA 2QG9B 4CJ0B 1EQQA 4LF4L 1M1GA 3MXUA 2B2VA 3J81c 2BE7D 4BBRB 2RHXA 4HVWA 4FO2A 4LDYA 3PVLA 1HNWQ 5C4ZA 3RESA 3OYNA 2ENMA 3ULLA 1X56A 2CSIA 3M4OH 1LT5D 4AYBB 3A8OB 2Y90A 1SG5A 2E2IH 3NTKA 3BZKA 4BXXG 2IY5B 5LJ5j 3FPUB 1HD3A 3VYTA 2H8HA 1U9RA 1DOKA 5C4HA 3RERA 1VQEA 3NE5B 3PV0A 3TMEA 4FF4A 2JN4A 2F0NA 4JI1Q 4C8QD 1ESFA 5IYBH 3CCMQ 3M3YB 1I8FA 1RHPA 4X64Q 4DUYQ 2NUTB 4M7AD 1X3GA 4XAXB 3CCEQ 1F2LA 2F0IA 3CBOA 2M2LA 3J81j 1JRIA 4K14A 4DV1L 2JP1A 1MMAA 5IGGA 2A37A 1YJNQ 2JA6B 2XKOC 3PFSA 1AWJA 2CS7A 3RDVA 1SMYC 4BY7B 3QHSA 1X3PA 1EZ8A 4MZPA 4FM4B 4IIOA 4PJOE 1QLYA 1BDOA 1UGQB 2AQ3B 5HGQA 2HUGA 3MHBA 1WPYA 1YN8A 5DM7R 5GROA 5LMUQ 2D0NA 4B3RQ 5M9OA 1OXUA 2YTYA 4OWWB 4KTAA 1TY0A 4CC2A 4M78A 3HOUH 2RH2A 3PO2B 2M51A 2TMPA 1WHLA 2FHTA 3P20A 4RGOS 1KLUD 4N9TA 3G1JA 4OO1G 3DWQA 2OXPA 1NAPA 1HCZA 2ECZA 1VQMQ 2A6HC 3BVMA 1J9OA 3C1FA 5IT9c 1K9AA 1SYBA 4IN3A 1WTOA 4C0FA 2RK2A 3JCMg 4FCYA 3VYGA 2F0WA 3MXNB 2UUCQ 1EY7A 3I4MB 1ICFB 2V1CC 1MSGA 2A69C 4PJOF 1EY4A 3WVEB 3M4YA 2N88A 2LNHB 1O9SA 2HIVA 1TQOA 2RHSB 2BZXA 2KVMA 5CV7A 3S17H 1PNJA 2EJGC 1B53A 2EYHA 5GAOp 2D0PA 1E6HA 4OWXB 3GTKB 2QILA 2BZ8A 3I3CA 3HHTB 5GAMe 2HIXA 3M9QA 2WV6D 5EJWA 3S9WA 1HUNA 3O8VA 5IYBG 2EQMA 4QIWE 3EG1A 2LY7A 3L2ZA 4R4QA 1ZHIA 2MWPA 3OS1A 3M9BA 1EIFA 1BCMA 4PZ6A 3ER0A 1CM9A 2F0QA 5KYIA 4X62L 4EQ5A 3UDGA 2ES2A 4A3MB 3ZL7C 1Q7YR 2FB7A 2UUAQ 2ZTEA 2L3SA 2HDMA 4EQOA 1Y7XA 3GP8A 2H4OA 5M5WB 2CYZB 3X3NA 5C0MA 1N8RR 2GBQA 2QEXQ 1EIHA 4C2MH 4K8JA 1TH7A 2M9UA 1TS4A 1K83H 1G3TA 1TWHH 3ME9A 4DR2L 1NJIR 4K2KA 2B8GA 1G8XA 2CUBA 4YWMA 1FD7D 1A2TA 4L5SA 3E0EA 2MPXC 2F0MA 2CZ7B 2ASBA 4XU2A 2L3PA 3FC3A 1NR2A 1DM0B 1G91A 1CKOA 4CKCA 5KNBA 2B2TA 2RJDA 4ZUIA 4DUZL 2DVEA 7AT1B 3UDIA 4X3KA 4A93H 3DLMA 3E9GA 5GAMd 2EYQA 4K6DA 2EQSA 2RPNA 5FLXE 3ICEA 1K1ZA 4LFAL 1FGUA 4Q5VA 3I90A 4CRIA 3CU7A 3TS2A 1HFGA 1U8RA 4KK7A 4KGVB 1M8MA 4II1A 1PKTA 5JPNC 2B2YC 5L8RE 2VUMG 2HCKA 2X51A 1MUZA 4XQ3A 4JI2Q 2EVBA 4BD3A 2BDNA 1TWFH 5FOBB 3NTHA 5K5PA 1R77A 2PUKB 2A5HA 4QGUA 2NUPB 1VA7A 1Q1EA 4DOWA 1B4OA 1IBMQ 5T1IA 2EIFA 3CMAT 5E4XA 5EPJA 2RI2A 1D5MC 5K36H 2AQ2B 1WI7A 1VOMA 1YNZA 1VF5C 1A6XA 3BG3A 3CCQT 5BN3A 2DTIA 3CC2T 4FP5D 5LJ3e 1AZEA 3K7AB 3MP8A 3GDEA 5I4DA 1PD1A 4M75E 1WTXA 2LSSA 2EGCA 5GJVB 4DEXA 5M3FB 1O7YA 4QL5A 4C8QA 4DKAC 2JA6H 5EBDA 1YHBA 1K8AC 1F2MA 1FMKA 1SNDA 4M7AA 5C4JH 3OMGA 3I5RA 2RA4A 2HQEA 2MMPA 4PJOB 5KYNA 4YCVA 3SWNB 2ZJQA 3BS1A 4XU1A 2Y0SE 5F2DA 4PK4A 3T9NA 2G6FX 2I2LA 1NNXA 4K0KL 1UTIA 4E7SA 3A8JE 1U06A 3JB9F 5BR8Q 1AE3A 1YI2Q 2EY1A 4EMKB 3J81i 1M90C 1NG2A 3LX0A 1ZUYA 2MCNA 2ATCB 1WCMH 4F14A 2B29A 4I65A 4A93G 4M75F 2F3VA 4FL6A 4KHZA 4XDXA 1VQGA 1F1BB 3T13A 1W4SA 2E6NA 3I4MH 2ZPGB 1QCNA 4UAIA 3CRKC 5LJ3d 4LD6A 4E7ZA 3HRTA 2DJZA 3JV3A 4GKJL 4AFUC 4RA8A 1RCVD 3J7YW 3H9NA 1N6AA 3VS5A 1K3RA 4NXMQ 3L42A 1HYOA 4E7IA 1K0RA 2A73B 2BA0A 2VB2X 1PYSB 1BI2A 1X69A 4CGYB 1BQQT 2FRWA 5FRMA 3FRPB 3RMQA 1EUJA 3T53B 2E3HA 3NHNA 1PZID 2EYFA 1VQAA 3EH2A 1H641 3L0OA 4QIWB 2NVQH 3J81E 4PLLA 4R4CA 1I4RA 5C5LA 5EPLA 4A3MH 2KOLA 2AK5A 3DEOA 5IOCA 2F4IA 1UECA 4XTVA 2BOSA 3TREA 1VQLQ 5LJ5e 3FKIH 1U1SA 3ND9A 2Q2IA 2V8JA 1XOVA 4KKTA 2L12A 1SHFA 1A63A 4DAYA 1BR9A 2KXCA 1WYXA 5GAN4 5GAOq 5C0XH 4QKUA 1Y07A 4DV3Q 3LNNA 5D7UA 1PH9A 4BI3A 2XSCA 4M78C 1VQ7T 3L7ZC 2F0GA 1H8KA 3DWPA 5A2QL 4EVOA 3D7SB 4HVUA 4OB2B 1DJRD 5JJKA 1PRTF 2K04A 1EYAA 4RG8A 3CBPA 2EFIA 1HUMA 2NVTB 1WDXA 3CMAA 1WCMG 1K73U 1E2WA 3V7RA 1FNVA 4BE1A 3HOVB 5GANe 5IGFA 4FSXA 4BY1G 1NR4A 4H0LC 3CCQA 3PGGA 4RTXA 1NBWA 2AHOB 2L4NA 3CMEQ 3I4MG 2O4XB 2K5LA 3JCMb 1BVSA 4KBMB 2LJ1A 1L1OB 3KLRA 2MO1A 2VQFQ 5IIFA 4WJWA 1UJ0A 5LJ5d 1SE4A 1STAA 1E2ZA 2KCCA 3OTOL 3X25B 4CC4B 2I0QA 2NZOA 2XTIA 4DBQA 3SGIA 3GP7A 4DK0A 2ABLA 2K5QA 5IT9E 2K4KA 3G7ZA 5DM73 5I6WA 2QGFB 3M4GA 3VRZA 1M90U 4LK1C 2EYXA 3NK9A 3F2BA 1VQJA 2EQUA 1KC8C 2L1BA 1EZ6A 1WTWA 1B3AA 1UUPA 3A55A 5M3FH 4CDDC 5CBAE 4RG2A 2DL4A 4M75B 4LF6L 1HRJA 1VMCA 2PVDB 4DV2L 4DR7Q 3FKIG 4IFDI 4C3IB 4A75A 2CZ1B 3I70A 1BYMA 2YSQA 1VQNQ 1H9KA 5GAN5 4KT0E 3EHRA 4NL3A 3OSSC 4ODGA 1VQNA 2MF2A 4HTHA 2AUJD 4IUVA 2Y0SB 1D0XA 3OSVA 2SDFA 1HHVA 4LUEA 2UXBL 1JWSD 4KY6A 2LTOA 5FRNA 3UI2A 1V29B 2LCCA 2KDSA 4RHRA 4LF9L 4N4IA 1KDCA 3DMUA 1T3LA 2P0QA 3MEHA 4L8JA 5CV5A 4JI8L 3MVVA 3K57A 3MEAA 3SXHA 5C5MA 1WX6A 1S5ED 3S1QB 5AYFA 1OXXK 2DL7A 2C5CA 1EFWA 3EG9A 4DV6L 3PO3B 1R0CB 3K5OA 1QP3A 3E9IA 2JA8B 1PG5B 3S2HH 1JJCB 3BFMA 5CV9A 4VUBA 1UEAB 3OBWA 2YTXA 4FDBA 4BE2A 4RTZA 4A3DB 2RSNA 3QZ5B 4XTZA 2GVBA 3LLRA 1TTHB 1JJ2A 1Q8KA 2K6DA 1BCPD 3KBGA 4FXKC 1Z9ZA 4IPGA 4Z89A 2EJFA 2XWBB 2IPKD 2HBPA 2UU9L 4KUDK 2JEBI 1FXXA 4BBSB 4L5TA 2BH2A 1PRTB 5GAN6 4J9CA 3VS6A 1YNND 3VS0A 5FW9A 2E74C 3PGZA 1T3SA 3J7ZC 4C8QC 3M5AA 1KDBA 1W3SA 5I21A 1EIGA 5M3FG 2YYZA 4GLXA 3INZA 2IHEA 4M7AC 4JYAQ 4LXCA 3Q6SA 1KK7A 1VQ6Q 1MMGA 1TWGB 3ZJYC 4C3JB 1XYIA 2CCZA 2HHHQ 3OYKA 4IIMA 2RMOA 1D5ZC 1Y1VG 2P5ZX 3DUZA 3R93A 1YCSB 4HJ5A 4LF8Q 3LWUA 1Z9FA 3PF5A 5FO8B 3NBHA 1HNZL 1BIBA 1S72Q 3PF4A 4DA4A 1JJ2P 2FYKA 1Q7YC 4PMBA 1ASYA 3MA2B 3A8HB 3EN2A 2CVRA 4A4IA 3LX7A 1Y57A 1S72A 1I94L 5L37A 2MP1A 1MBYA 2A68D 2PQAB 2HQHA 5GADC 1KSWA 2NVTH 1KC8U 1FL0A 1SYGA 1G6PA 3HOVH 3OS0A 2G3RA 3H0IA 2XIWA 4LUVA 5LHY1 1NJIC 1UUEA 2LQKA 1YVCA 3NPPA 4H13C 2JJ9A 4LMQD 3FDRA 1LJOA 1IHZA 4LN2A 3THKA 5J26A 3E6ZX 2NVXB 4JW0A 1DCZA 4L5RC 5I22A 3RUZA 5CQXA 3TVTA 2OTLT 3G48A 1HZAA 1XMQL 1LT6D 3QWXX 4QMGA 1ILPA 3PCOB 1M3CA 5GAOn 1VUBA 2MYSA 3D3RA 3QDRB 2NUTA 1PTOB 3QIAA 1JB0E 2RNAA 3GTLB 2X6LA 3JB9H 2EOTA 4J9GA 1NCVA 5IH2A 2VV5A 3OQ5A 4KGXB 1EWCA 5C3WA 2K5HA 1PH1A 1KNEA 5CV6A 5ISRA 4E7JA 2X3WD 2JXBA 3EGXB 4ME3A 2KCTA 1K8OA 2KRSA 2RI5A 1AZPA 4F88A 1HR0W 4UPAA 1GUOA 4C3IH 2XU8A 2D8HA 1S40A 5A0DA 1Y14B 1QJOA 5GAOm 3LH0A 2X9HA 3EVQA 2K7VA 5JEAG 4CDFC 4O0AA 3K5NA 1HNWL 4P71A 4TRDA 3JCMh 3HOZB 1JB7A 1KRSA 2O2OA 3PUVA 2Y4YA 1QQJA 2KYMA 3OB9A 5KIXA 2KECA 2UXCQ 3CC4A 3CC7Q 2EY2A 2DK3A 4X3SA 5HKCA 3OIPA 3MXNA 4XQQA 1KQSA 1PLFA 3OYYA 1MV3A 3VJPA 3I4NB 3S1QH 4X64L 4DUYL 4JZ3A 3PO3H 4HR7B 2E5QA 2QGQA 2K4YA 2D5DA 2OT2A 2R92H 4E2FB 4JLIA 4A3DH 3RMSA 1M8VA 4IFDJ 1ET6A 4YY3Q 3CCJA 3QJYA 5DY9A 1JXOA 2MOXA 1Q7YU 1JB3A 2A0FB 2CP6A 1GHJA 2KEEA 5C4XG 5A0GA 3LH5A 2EPDA 4PFZA 2RHZA 2H1EA 2IHFA 4TKOB 5LMUL 4B3RL 2C0IA 4F17A 1SNOA 4BBSH 2YLCA 4FXGC 3H0HA 1D1CA 1D0ZA 4HCKA 1VQ9T 1XXGA 1KQSP 2JK8A 3K5MA 2EDGA 3E1SA 1RDPD 4IZ8A 5D3DA 1PFSA 4OL7A 1CUKA 2OAUA 2GFAA 2UUCL 1IBKQ 1WFWA 4UY8C 1SR3A 3GPLA 2KBNA 2MWOA 3QJ6A 1SFOH 1OZ2A 2DF6A 4LFBQ 3KF6B 2DKGA 1JEGA 1P8LA 2Z4IA 3GIBA 2K3YA 2V8IA 4XTYA 3G6EQ 4ZN3A 2DERA 2O88A 1HR0Q 4Y92A 2I07B 1UFFA 4ZKBB 4KH1B 5IYDH 3A8IE 1RAGB 1WTHA 1OO9B 3BW1A 5CGKA 1PH6A 4ME7A 3CCLT 4XTXA 3TCJA 3A5ZB 2QKIC 2VZAA 2VQEQ 4JPBW 2FFKB 4P73A 3VYRA 4WJ3M 2DETA 3JB9D 4KHPQ 1XTDA 2NVXH 3H0FA 2F0TA 4GNXA 1SSFA 3CPWA 2R92G 5FKAC 3DWAA 1MMNA 3CCST 1UEBA 2JA9A 4HCCA 3QBYA 1JXMA 2EJFC 4A4KA 1CHQD 1PTOH 2SNSA 2L2PA 3BVGA 3OYJA 3K81C 3GTLH 3ITPA 1U1TA 2DBKA 1M2VB 3IQLA 1EYCA 2UUBQ 2Z4HA 4OMNA 3UA6A 3O5ZA 2QDLA 2B2WA 3I7FA 5CR2A 2NYZD 1Y69U 3S1MB 4PMCA 1JWUD 2YTVA 2IPOB 1M27C 3IKJA 5ELEA 4IKFA 1TUCA 2LX9A 4HT8A 1VQHA 4BI4A 4EIKA 1O80A 5LL6X 1S3OA 5GMKl 3PE0A 2A19A 4QY7A 2LCSA 3A7LA 5D3IB 1GCQC 2J05A 3DB3A 3X26B 3CPWP 4ZLTF 4JBKA 1K73R 5GAMg 2E2IB 5GANf 1QUQB 3EGUA 4EMKA 3A5UA 1DGSA 4HSVA 4DAVA 2K5DA 5I2XA 4JI2L 1XX8A 3GD7A 4C2MB 4GLMA 4OF1A 5COYA 5IP7G 3U58A 2AWNA 4DGZA 1PH7A 1AHJB 4EMGA 5IYDG 4HEDA 1LTAD 1IBML 2K5FA 5GAN7 2MK5A 4MMKA 2OQ0A 4RKUE 4FT2A 2A6EC 1KQSS 3AMUA 2ICEC 4GY5A 2PO4A 3H3VH 5D14A 4EQNA 3U9SA 4QT7A 1SJHD 4OIJA 5IYCG 1B70B 2QA4T 3Q8DA 1MIUA 4DR6Q 1ZBXA 4XT3B 4E6IA 5BN4A 4KJNA 3M0PA 4AFQC 2GF7A 1XQHA 4C0DB 1HPCA 1EQRA 2ZTCA 2PPBC 1IHVA 4PJNA 1B34B 4PNYA 1GCPA 3D4DA 3EFOB 4R56A 2QXFA 2VC8A 5CVIA 3M4PA 3QIIA 3UWNA 3ZEHA 1GHKA 2ZJPA 3G71Q 3RKXA 1UJYA 2M1HA 4IURA 5FWBA 5DEHA 3EFSA 2RBMA 4OB3B 5BR8L 4FYYB 1Z6HA 3Q23A 4TSSA 4N4GA 3C4SA 4JI1L 4BDZA 4X9CA 5D6WA 4XU3A 5L23A 4WF2A 1PH5A 1PC0A 2K5WA 1HXYD 2JS0A 4J9FA 4C5EA 2XK0A 2CDTA 1ENAA 3G4SQ 4MNOA 1G83A 4R4OA 3J80c 4CI0C 3GTGB 3UT1A 2EYZA 1K4US 2KA7A 3C1EA 4TVRA 5EKIA 3G4SA 3FIFA 4B9WA 3FEWX 4X66Q 1X32A 3GNFB 3NPFA 2VUMB 3H91A 4BXXH 4DR5Q 2Z0WA 1V43A 8ATCB 1MI2A 1BI3A 2EQKA 1BO0A 1HQMC 3CCSA 3T56B 3RBBB 1G5VA 1X2QA 2IVWA 2JJQA 2DFUA 3MC0B 3CCMT 2E5LQ 1ZKOA 4NXML 1A62A 1VQFA 1BI1A 1UE7A 3SB2A 3CKIB 1K0XA 2DMOA 4LUDA 2LMCB 2M00A 3CCET 2I46A 3I56A 2JA5G 3P8HA 1TS3A 4RTYA 2RB6A 1EOVA 2C0OA 2EYWA 2VWFA 1L1OA 2A3LA 4D8KA 2B8FA 1PTOD 1PRLC 3ERQA 4ZAIA 2IWHA 5A35A 2YUQA 4DR3Q 3OHXC 3TP8A 2E5KA 4F16A 2PZUA 1UE6A 3I9QA 1UG1A 2C9OA 4L6TB 1ZSZB 2DIQA 2R58A 3CPWS 1N9RA 3L2PA 4P5NA 3KFVA 1B07A 5CV8A 2IL8A 1IW7D 3HZXA 2Z1CA 5A0LA 2GVAA 3IL8A 1QILA 2WSEE 4DV3L 1MJCA 1VQMT 4JI5Q 4OO1H 3P1HA 4DK1A 4XT1B 4M77G 2PZ1A 2HSPA 1YITT 2BKDN 3AT1B 4OMFB 2RHQB 4JLGA 4A93B 1Z7TA 3I2ZA 4YCWA 1KD1R 2CHBD 1K0SA 1BCPF 4DR4Q 1RLQC 3OYBA 5C0XI 3RUXA 4J6XA 5FU7B 4LDXA 1PZJD 2ZM6L 2PTKA 1FNWA 2LQ8A 3FP9A 1LT4D 1QKXA 2NWMA 1VIFA 4IOCA 3TEEA 2LKVA 2MGSA 2BE5C 2YHTA 1G291 1KC8R 2DO3A 3AFQA 2QA4A 1ET9A 2KRNA 1TWFB 2VQFL 1M5Q1 1MSHA 1ZUKA 4CC7A 1KQ2A 1GKHA 3HG9A 3I91A 1OZ3A 5A2QE 3KBXA 2VGMA 2FPFA 1X43A 3A74A 3T51B 1AVZC 1GL5A 2EYLA 2AKKA 2F52A 1Q8IA 5CYUA 5C3EH 1SEMA 3MEWA 4J9IA 5LJ5g 2YRCA 1LM0A 1EFID 2F0KA 1Y1WG 2A68C 2HQLA 3LW5E 3C94A 2DVJA 3LWEA 3CCUT 4ZUJA 2QEXT 1HH2P 3T4AC 4M77D 3DLLA 4IUNA 2CH4W 1G3WA 2L11A 1D6EC 5C4JB 3MZ5A 3V8JA 3D8GA 3ERSX 3QB3A 4IJLA 2RQRA 4QQ6A 5FU6B 3JCMc 4HCEA 2ZPHB 1FYCA 1QCBD 2QQAA 1WLPB 2C06A 2X69A 4M7DG 1ZEQX 3M0UA 5D6XA 3VYSA 2NVYB 2PVGB 3EA6A 3FVQA 5GANg 4KGZB 1DJ7B 1NLPC 2QQBA 5CAIA 2B2WC 2KNBB 1VQKQ 3OYFA 2GNCA 2OCEA 1FYNA 2QW7A 1E7ZA 5M5WH 1WCMB 1Q12A 3VA7A 4CHTB 4OX9L 3HOXH 3CD6A 4PLIA 1RAEB 1VQKA 4PJOC 3SWNC 4GLVB 4BY1B 2LJ3A 2NYSA 4A3KG 4P2CB 1HA6A 2FL7A 4A54A 3D4WA 3KLSA 2V8KA 3MAQA 3GTGH 4WCIA 1M4ZA 4TVAB 4G57A 5KRUA 4FYDA 3W3AA 4H02A 5FO7B 2O01E 1EY9A 2ZTDA 3KOJA 4HMJA 2VUMH 4EMKC 2EVRA 2CT4A 3M55A 2NN6G 4XIGS 3Q1JA 2PQAA 3CCVA 1JQQA 2HKNA 3R3OA 1XNQQ 3S15H 4C5HA 1AH9A 3U50C 1CT1D 2E70A 3LWHA 4A3JH 3I73A 4UDUC 3NTIA 1OU8A 4P75A 2HZYA 2JXMB 3OBYA 5J22A 1XNRQ 4JV5L 3KXTA 3CXCA 4JBWA 4FYVB 1I5LA 5C3EG 5KYYB 1TUDA 3J7AV 2NVQB 2NTTA 3VS2A 4EX5A 1G2BA 4M7DD 5IHKA 4RKLA 5J39A 4H7BA 4JOIA 2KGTA 4FU6A 1YITA 2JSOA 2HL3A 4U673 2VY3A 1BCPB 4RFBA 2PCFB 3FKIB 5EG2A 3MP6A 4MDWA 3OYEA 1FNUA 3TN2A 1U4MA 2E4HA 1GUGA 4LNQA 4JYAL 3STBD 3RKWA 1WTVA 3GBQA 3MJXA 3NQIA 2OJ2A 1YNXA 1Q86R 4N8FA 5ELDA 2R7DA 2J6KA 2HHHL 1VQ4T 2WP8J 4LF8L 1YI2T 2F2WA 1B50A 2M16A 3NP8A 1MD2D 2RF4A 4KI0A 3EGXA 5EKLA 3URYA 2KE9A 4A3GH 3EJIA 3CXCP 2MAMA 2FEIA 1BXTA 2UXDQ 3J80i 2VB6A 2DTHA 2XDPA 2PQEA 1NUCA 3HOXG 3M4QA 1YBYA 4BI8B 3EROA 3OYCA 1JOKA 3M7GA 1D8LA 1M9SA 4AH6A 3CCUA 2JQOA 4F7UG 1KAAA 1Y8PB 2HAXA 4JZ4A 3CCRT 1SHGA 2K75A 4IO9A 2J4XA 4GNXB 5I11A 4CKEA 1IL2A 4A3JG 2ATWA 3GTPH 5T1GA 2YRDA 3MHXA 4N4HA 1Y71A 3HL8A 5EC7A 5AT1B 1PCXA 4IJHA 2BTTA 1IBLQ 2D0OA 1L1OC 1OPKA 1K73C 1SNQA 1HFNA 4FF3A 4J9HA 3J80E 3UE0A 1J3TA 3L2RA 3S3NA 3N52A 1FGBD 3QYHB 1HSQA 3N5BB 2K52A 4LF5L 2HD0A 4M4ZA 1FWZA 3EBEA 1Q95G 2E41A 4OVAA 1LTGD 1UE9A 1LACA 1HZ9A 3G6JB 1Y1VB 4M1UB 4JCVE 4BA2I 3TRZA 1NM7A 1C8CA 3JB9I 4AG2C 2GQVA 1KXLA 5C4XB 3C12A 1M8AA 1WI5A 4M77A 2CREA 2E12A 2NVYH 1K9MC 3S2DB 4EPCA 3J7AF 1AWXA 3PIOA 5JOBA 4J6WA 3K7UC 1A3UA 4M75C 5J1ZA 2DX1A 1E0BA 1ESRA 4A3GG 1KLGD 1RAFB 2KRMA 3MTSA 3K5LA 2UXCL 4KD3A 1B8AA 3P7JA 3VDYA 1RI9A 4HCZA 4OGEA 4OB1B 1VQ8T 2B2VC 1N9WA 2ED1A 4BY1H 5H1SE 2X6GA 2IX3A 3KLWA 2KR3A 4BE0A 1TWAH 1RAAB 2EAYA 2JNGA 2PZTA 1ZYRC 2DJGC 3KF6A 1X65A 2DEUA 1B7TA 1M1FA 1MMDA 2YT6A 1WXTA 1EYDA 3S2HB 2CQAA 1SE8A 2F5TX 3TSZA 4PNOA 1D1IA 1SJED 2IT1A 3HOYB 2R61A 4ZTJA 4AIMA 4KN4C 2EQIA 1LVKA 1PHTA 3PUYA 3ULRB 4C1NI 4YY3L 4HIMA 4B9XA 3A54A 1VQ4A 5CKEA 3I8ZA 1HNXQ 2IG0A 3CXCS 2D2CC 1SPKA 1NLOC 4X34A 3ONAB 3VYUA 5KYUB 1I81A 1N9SA 2JM8A 1JWMD 4RGTA 2A8VA 4DR1Q 2KMTA 3NSWA 2FZGB 2QQRA 4Y52H 2YUOA 1VF7A 2O31A 4R55A 2OTJT 1I4HA 1NY4A 4AT1B 1BK2A 3EAEA 3CQZH 4A3IB 3F70A 5GAN8 1JMCA 2FVUA 1PRTC 1M2VA 1D2BA 1IB8A 1MGQA 1S4ZA 2MI6A 3U4ZA 1RUWA 1KL9A 1G2SA 4LFBL 3CMAQ 1D1BA 3CCRA 2CWAA 2CW0C 5I9OA 3GV3A 2DZ9A 1FJGL 1I4K1 5CKBA 4ELYC 3CCQQ 2A1AA 2NB0A 3HFNA 1HR0L 2K01A 3PMFA 2SRCA 4XU0A 1VQPT 3IRBA 1YNJD 1UWVA 2K5VA 5DLQE 5C6SA 3BE3A 3CC2A 2F0EA 1QUQA 1WHKA 1SSOA 2LVMA 2OQKA 2K7AA 3HP9A 2RKSA 4MZ9A 4KHPL 5HY6A 3GTMH 3V05A 3VYHB 2JA7B 1WA7A 4DK3C 1ZX6A 1KD1C 2L89A 3GV6A 5GAHC 3CAMA 1K9MU 2F0FA 2K5IA 1X54A 2YDLA 4A3EB 3VUBA 3QOLA 1TS5A 2RDFA 3WOFA 2EY6A 5IODA 1M2OA 2WB1G 4QVDA 4RCNA 4C92G 1AWWA 3FDTA 2FHDA 1NE3A 4EMHA 4FYWB 3PUZA 4J8QA 2UUBL 2O5IC 1O78A 2CSQA 2QYZA 1SXTA 4A4FA 4JUVA 3TZDA 4KJOA 2FZCB 2PMZE 1RADB 3M0QA 4JDSA 4DXGA 2PQWA 1VQ8A 3QO3A 1B34A 1YIJT 1QNUA 2KI7A 4QCLA 3EFOA 1FR3A 1PTOC 2WAQB 1JORA 1TOVA 2L15A 2H3JA 1Y1VH 4JBJA 4BY6B 1DOLA 3META 1EIYB 4RCOA 1GUNA 4HIOA 1PTOF 4IPCA 5C4XH 1C6VX 4HJAA 3S3OA 4DN4M 1TUGB 2JOYA 2HMAA 4DV5Q 1STYA 3S2DH 2ALYB 1U5SA 1N33Q 4Z9CB 1KRTA 1U4LA 2B2TC 2RVLA 2XWJB 1H9JA 4LF7Q 1OI1A 1IW7C 3M53A 2D0QB 3X20B 2DEQA 1CZWA 1EY5A 5NUCA 4A3BB 3ND8A 2P4RA 4E7LA 4QQBX 4B3TQ 2K14A 4JK1C 2RA2A 2CGHA 1T0JA 5HGTA 1HK9A 2ROTA 4F7UA 5E4WC 5CKFA 1CKNB 3NFCA 3URGA 2CWPA 1RI0A 4C92D 3OA6A 3PIO3 2JN0A 3JCMd 2R92B 2JS2A 2N55A 1PD0A 3M85A 3HOYH 2KAFA 2OTJA 2EBPA 9ATCB 3E9FA 3I35A 4HKEA 4L59A 2F0JA 3EQLC 2CQOA 3M0SA 3JB9J 1VQ7A 1KAWA 3MXGA 4M77E 1U4PA 1SNMA 3OW2A 5EQ0A 3M57A 4B6MA 4GBQA 2LCLA 3CPFA 4DV4L 2QQSA 4QQDA 3SFMA 3A0JA 5C6AA 3K59A 1ZSZA 2KBTA 2VVKA 3VKIA 5IXBA 1CFMA 4MN3A 3VR2A 2XVSA 1ENFA 2L9HA 4FSSA 4FT4A 1VQPA 1M3BA 1JJGA 1Y0MA 4G7HC 3S14H 3PQIA 4PZ7A 4PKCC 1ML0D 3HRUA 4A4HA 3RLFA 5JEAH 4A3IH 2JYOA 1WTQA 1N27A 3V96A 4NL2A 1SFOB 1A3VA 1KD1U 1WJSA 1SE3A 2HCIA 1V1CA 3QPHA 3CC7T 1LTRD 4JI0L 4GKKQ 3NQTA 2LP5A 1UNSA 4X66L 1E24A 3H41A 1A8VA 4MTNA 3SE0A 4NXNQ 4M77F 5KE2A 2QDYB 4DR5L 4NB3A 1V8QA 2YRVA 2E5LL 3OW2P 4JI7Q 5GMKh 4X65L 1NYGA 4R4IA 3Q24A 1NEGA 1ZA2B 4D8DA 2F0VA 1Q86C 2QASA 3EG3A 1A0NB 3FPPA 2AUKA 5JAVA 2AIRB 3BDUA 3SDZA 2PNRC 4E7KA 1Q90A 5GAMf 1LABA 1RL2A 1ZUUA 1WQWA 2JA7H 2XHCA 2OI3A 3HOYG 2COYA 1CKMA 4XYQA 5KYLA 1YIJA 1EWHA 4ME5A 1YHQT 3RZOH 4RTWA 3RN5A 1MV0B 4M7DE 5IGBA 4QF4A 3OOCA 1XJVA 4A3EH 2EKHA 2CFMA 1Q3LA 3BYTB 3HS0C 1HTLD 4XTCS 4JJNK 2GTOA 1AN8A 5LMNW 4B3SQ 2X4YA 4MZMA 4F87A 5KGUA 1LTLA 1SMYD 4JI5L 1WD1A 2KSSA 3JAML 2QK0A 3VR3A 1CZGA 2LX7A 4DAPA 3REBB 2CT3A 3O13A 5ELCA 5HCKA 2O2LD 5M5XB 1EFNA 2VUBA 5GJWB 1QVCA 4RG1A 1PFMA 4NKLA 4RCBA 5GANh 4UC4A 4DR4L 2PMZB 2RQWA 4LAAA 2YUNA 3SEBA 3KK7A 4A3IG 3I55T 3KJOA 1YJWT 2A6HD 4OO1I 2P0KA 1L0XB 1M1KU 4M7DF 1VQOT 3CC4Q 4DQ2A 3PSIA 1BOSA 3BVZA 3E0JA 2KCNA 5KYXB 1E1TA 2A08A 1JE5A 4ZK9B 4J9DA 1KIXA 4RGNA 2XRQD 1JCKB 2A69D 2K50A 3V2TA 3VU3C 4Y91A 1CA5A 1D3BA 4A3BH 4XXEA 2E2JB 3QO2A 2JA5B 1NZ9A
chains in the Genus database with same CATH topology
2F69A 1C9OA 1MHNA 1VQBA 4B3MQ 5IWAQ 2KK4A 2ZGWA 2DXTA 3PT9A 1YJ9T 3UE1A 2JA7G 3PMIA 1QZHA 4N0AA 1E3PA 5LJ3f 3KJPA 5I2SA 3X28B 1B7YB 1JJ2S 5CIUA 4C92A 5KH6A 4A3EG 4GN5A 3F1ZA 4QQGA 3AHUA 4KUIA 4M77B 1Q86U 4C0DC 5LMNQ 2P0PA 1N34Q 3S1NH 2WAQG 1J5EQ 4F7UE 2R6GA 4JI3Q 2OTLA 5IP7H 1XNQL 1YHQA 2RD1A 2X4JA 5KE3A 4A3BG 3TEHB 1XNRL 2JZ2A 1SRUA 3FJPA 2R93H 5IYCH 4D6WA 3GTJH 4F7UF 2UUAL 2PI2E 2MNAA 1XPOA 4X6AH 2CKKA 2ZJRA 3G71T 4L5GA 3I55A 1PSFA 1YJWA 4M7DB 1KQ1A 5LJ5f 1VQOA 2JVVA 5M5XH 2UXDL 3NELA 2Z0SA 2E10A 2M0OA 2R5AA 2XDDA 3JC66 3K8AA 5DLOA 2Q2TA 2WSFE 3OYMA 1YJ9A 4C5GA 4M78G 4LF6Q 5FU7C 2E2JH 2JA5H 3L2WA 4DAMA 1IBLL 3GTOH 2R93G 1VQ9A 3NENA 1VQ5T 1LYLA 2LNVA 5IAYA 2EJGA 3OY9A 2YLBA 3OYAA 1H95A 2E64A 5FJ8H 1GM5A 3TQYA 3UPUA 4J83A 2E8GA 3PUWA 1GVPA 1OXSC 1UGSB 4LFCQ 5FU6C 3CCLA 2R7FA 2NLUA 2EQJA 2CZ0B 1PH8A 1X9NA 4IFDG 3RLOA 1L2FA 1WYDA 4OWTB 4F7UB 4GN4B 3HOWH 5HK3A 2JEAI 5JJLA 4L6V5 5LJ3g 2E6ZA 2WB1E 4C92E 4FIBA 3HPWA 1BKBA 1YJNT 1HNXL 4JI6Q 2DUDA 3JAMc 2LC4A 2ID0A 4DR1L 4A3FH 2R5MA 4R4TA 4NPSA 2DPPB 3CBMA 2KCMA 5FJ8G 1HZBA 3V7SA 4JI4Q 3T1HQ 2PUOB 3EIVA 1CSPA 4MMLA 4LUOA 4C92F 3PIPA 2YU9H 4O5VA 3S1RH 5AJ3Q 2GFUA 2I5HA 4KLKA 2ZPEB 2WSCE 4A3KH 4O2DA 4C8QG 5HK0A 1YEZA 1PV4A 3A8LB 1VQ5A 2P4TA 4P72A 1IZ6A 3HOWG 3JSCA 2D6FA 4ALPA 4HA8A 1N32Q 3KYHC 2L8DA 1VIEA 5GMKj 3H15A 3OYIA 4HCBA 1BI0A 2B63H 1CKNA 2Z6KA 1WJQA 1ZQ1A 3RKYA 2ZZDA 1HJPA 3VV0A 1Z47A 4GNXC 4A3FG 2WACA 1XNIA 4OGCA 4AQYQ 1WQ7A 3BU2A 1K8GA 1N36Q 5E7NA 3DB4A 4Y28E 2DGYA 4DK6C 2N8NA 2RI3A 5M3MG 2RK1A 4DV5L 2QTXA 1PH4A 1XPUA 2RJFA 3ULJA 1N33L 3CCMA 5KCHA 4DPGA 4LF7L 2F3IA 3CCEA 1QVGA 2BUDA 3QZ9B 1D3BB 3PTAA 5GANj 4B3TL 4R1JA 4NOYA 1YJNA 4GOPB 4POGA 3LWIA 3GO5A 2JTMA 4O6JA 5ELOA 1Q1BA 2VXFA 4DV0Q 3PNWC 3AFPA 2ZCFB 2QI2A 1P16A 3VUZA 3FHWA 5IP9G 2B63G 4PMWA 1VQMA 4C92B 4J8OA 3JCMQ 1RIPA 4OB0B 1WOCA 1CSQA 4C5IA 4A53A 4HJ9A 2KVQG 4JC0A 1W2BA 3RIRA 3HFOA 3L2VA 4QVCA 2XD0A 1NMFA 1IREB 2X4XA 2XICA 1X01A 5FROA 1EYGA 2XDBA 2E2HH 4GKKL 3QKJA 1X6OA 4NXNL 4UP7A 2ZPIB 5GAOl 3W5OA 4JI7L 2HQXA 3W1BA 4BA1I 3JCMP 4ZTFA 3H0GH 1Y96B 3M7NA 2N78A 3MEFA 2YV5A 2E65A 2QEXA 3HOUG 2DXCA 5FLMH 2DIGA 2DXBA 3V8KA 2VYTA 1G3YA 3PUXA 2XI9A 3V8LA 3JAMi 2KY9A 2RJEA 4LD9K 2R57A 4BBRH 4LDWA 4B3SL 3KF8B 2KHIA 1VQLT 4A4EA 5D6YA 3L2QA 3CP0A 4JS5A 2K57A 2WAQE 1NPRA 1VQDA 5GMKi 5IY0A 5GAEC 3M3YH 3B6YA 1I6HH 2XGTA 4E47A 1PHJA 2GCXA 4ZGDB 1IYJB 3MO8A 3E19A 3T1YQ 1XPRA 5CO7A 2IX0A 3CMET 3HSBA 3JAME 4BY6C 3E9HA 1PSEA 1QVGS 4BY7H 4J5YA 3H0GG 4YCUA 3CEYA 3LGFA 4B3ML 5IWAL 3PO2H 2LDMA 3JCMV 5GMKm 1VQIA 3V7CA 5FLMG 4LW1A 3OYDA 1LNXA 4DV7Q 1C7YA 2MO0A 1X3FA 1YI2A 3S3MA 3MEVA 5GAGC 2Z6KC 4DR7Q 1A63A 4PG3A 2BA1A 3J7A5 4BBRG 3K80C 4IUQA 4YHHQ 3WXMB 2Q2HA 3M56A 4X9DA 1LUZA 5GAN2 1VQNT 4AYBG 4QVZA 1Q46A 3GTKH 1KHCA 1W2BS 4M7DA 5LMNL 1MKHA 1N34L 1IBKL 5GMKe 5GAN3 1VS0A 1J5EL 2K3XA 4JI3L 1HZCA 4BDYA 5K36G 5C44H 4M78E 2DXUA 4NS5A 1VCIA 1TWCH 5GAMh 4GLAC 1L0WA 1TXYA 2JA6G 1GXIE 4BY7G 2ZPFB 4Q5WA 1WFQA 2VQEL 3CF5A 4Y7NH 5IN1A 1VQLA 1BBUA 1UE5A 4A4GA 5KCOA 1U0LA 3PO2G 1SN8A 5CCAA 4J7FA 4JRIA 4M78F 4Z02A 1BIAA 2HNIA 4LF4Q 1PH2A 3S6WA 1UE1A 1SMXA 1NPPA 1E22A 2ZM6Q 2XG8D 2K5NA 4TQUS 3CW2C 3GTQH 3F8TA 4JOIC 1K8AU 3GF5A 1GO3E 2FXQA 3JCMe 1VQ6T 3UDFA 2ZPBB 3CMEA 1I3QH 3W1GA 3ZBDA 5JEAJ 1S72T 3JCMX 3PMTA 1QP2A 2PNHA 4LUZA 1JBMA 5C44G 1AE2A 3K7AH 4HJ8A 4DV1Q 2VGNA 3H8ZA 4IUTA 3RLNA 4ZGJB 4A3MG 2PU9B 3KDFB 2N3SA 4IPDA 5GANd 4KULA 5LJ3h 1QVFA 3KUFA 1E1OA 5C0XG 1T9HA 4QJFA 3JRZA 2L5QA 4ATOA 4DR6L 3RNUA 1YCYA 1M1KC 1NMGA 1PVOA 3D0FA 3M58A 4LDUA 3WVDB 4OX9Q 3HKZG 4RMFA 4UP9A 2KQWA 5I2MA 4JRQA 2D62A 1GD7A 3H3VI 3HRSA 1OXVA 3F2CA 2Y4XA 1NE8A 2R7ZH 4JRPA 2EWNA 2PI2A 1C0AA 4J15A 4C8QE 4LFCL 2KENA 2B3GA 4M7AE 2HT1A 3CC4T 3FEOA 4IUPA 4OP0A 4M77C 4JV5Q 2N49A 4X62Q 2DTOA 4DNIA 4M78B 1R8OB 2I5LX 3QSUA 4EDUA 4C8QF 2I5MX 3CCJT 3AQQA 4UP8A 4DR2Q 3OYHA 4DR3L 2VNUD 4PJOG 4M7AF 3QXEB 4JI6L 1VQ6A 3QUIA 4JS4A 1YHAA 1LOJA 5LJ5h 3ASKA 3OMCA 4DUZQ 2PVOB 1Q81C 1N8RC 4JI4L 4LFAQ 4C3HH 3T1HL 4APVA 3ULPA 3RZDH 4IUUA 2OWOA 4LDVA 1KHIA 5AJ3L 1P92A 2R7ZG 4J7IA 3UDXA 3GNGA 4XK8E 1R9TH 1OTCA 1EWIA 4M7DC 3G6ET 4YWKA 1V9PA 2DD5A 1PYBA 4PJOD 2X4WA 1A0IA 3STBC 1QZGA 1U5KA 1OXTA 1D7QA 3OYGA 1N32L 4DOVA 4LF5Q 4GOPA 5J3BA 1I50H 1X55A 4ZN1A 2EKOA 3SD4A 1G3SA 1NTGA 1WJJA 2NN6I 3LGJA 4K0KQ 2VXEA 1QVFS 3JCMJ 4QW2A 5CKHA 4A3CH 4P74A 4JBMA 4HT9A 4GN3B 4A3LH 4AQYL 1PA6A 2LXJA 2A7YA 3CC7A 1N36L 3HOVG 4HIDA 3D31A 1H3ZA 1QW1A 3OW2S 4A76A 2QQ9A 3K0XA 4GKJQ 2RO0A 2JA8H 1I5FA 2H5XA 2KHJA 4WJ4A 1SROA 4J6YA 4YWLA 2LRQA 4C8QB 1WJRA 3QYGB 4C0ZA 1HXDA 4XTWA 1BBWA 1MJEA 4M7AB 5CK9A 5ELNA 2Q2UA 1JT8A 1O75A 3U4VA 5CKDA 1Q81U 1N8RU 3JB9G 3S16H 5EAYA 2DD4A 3X24B 4DV0L 2CZ6B 2LT4A 3P8BB 5LL6S 2C35B 1XMOQ 2XIDA 1FVIA 4M75G 1NJIU 1Y96A 2AHJB 2MQHA 1TWGH 4ZGEB 4C3JH 2BH8A 3FB9A 2RM4A 2EJ9A 3RR5A 2Y0SG 4A3CG 4RMOA 1FJGQ 4JG2A 5M5YH 4JRKA 1UB4A 4A3LG 3G6EA 4HIKA 2JUFA 4GS3A 2K2VA 4PL6A 3UDCA 2DZCA 3OS2A 3PO3G 3F2DA 3G4ST 4E7HA 3R6OA