1UEBA

Crystal structure of translation elongation factor p from thermus thermophilus hb8
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of elongation factor P from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
molecule keywords elongation factor P
total genus 40
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1uebA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA03
3RLFA 4IOCA 5M5XH 3T1YQ 2R92H 1VQFA 3L7ZC 1K73U 3CCQA 1KC8U 4DR2L 2WP8J 1NY4A 3Q8DA 1HNXL 1RIPA 1MJCA 2NVXH 2K5HA 1SLJA 5C3EH 3ICEA 4LF6Q 3JC66 1VQNA 5IP7H 4K0KL 1VQCA 1UE1A 4K0KQ 1ASYA 4UPAA 3S16H 1Q82U 1YHAA 4HJ5A 1YI2A 1VQ7A 4MZ9A 3CAMA 3GTGH 1EYGA 3GD7A 1FVIA 2QA4A 3PF5A 2R93H 2ATWA 3PO3G 1QVFA 5FLMH 4YWLA 1Q86U 1GM5A 4YWMA 4P73A 3L0OA 5LMUQ 2LSSA 5IYBH 2ID0A 4ZN3A 4DAYB 4DKAC 4YY3L 1SR3A 4DV0Q 1XMOL 1JJGA 1MKHA 3HOWG 4LUZA 2IHEA 3MXNB 5IAYA 3CC2T 5GAHC 1VQ6A 2UU9L 4DK6C 2UXCL 3CCUT 1JE5A 4OWTB 1VQLA 4R1JA 1PYBA 5EAYA 5C4XG 4B3SQ 1VQ7T 4IFDI 1N32L 1KL9A 4FDBA 1U5KA 4O2DA 3UE0A 4DR7L 1NE3A 5LMUL 3K8AA 3TS0A 1VQBA 1N36L 3I55T 4AYBG 3I56T 4JYAL 2E5LQ 4AQYL 5JEAG 3H15A 4PMWA 5M3FG 1LUZA 1QVGS 2JVVA 1L1OC 3KJPA 4IJHA 3PO3H 4GKKL 4L5RC 3I4MH 2ZTCA 3CQZH 3W1BA 3J80c 1YHBA 2WAQG 3J81i 4GOPA 1V43A 1BBWA 1YJWT 1X65A 4DV4L 4ZN1A 2JJQA 2RCNA 4LF7Q 1HNXQ 3I4NG 5M5YH 3S17H 1KQSS 2QGQA 2R6GA 3CXCA 3I55A 4OONA 5C3EG 3T1YL 4X6AH 5BR8L 5ELNA 1YITA 4BY1G 2VW9A 2KHJA 4DR2Q 1XMOQ 5C0XJ 1E24A 4XIGS 3M9BA 4A3IH 1PFSA 2GN5A 1VQLT 1K0RA 2D62A 4DV2Q 2PNHA 1Y1VH 2VNUD 1NTGA 2DUDA 4GN5A 1VQHA 1VQ4A 4C3IH 5A2QE 3G4ST 2HT1A 4GKJL 1YJ9T 4B3RQ 3CMAA 1P8LA 5FLMG 4JI2Q 3PF4A 4BXXH 1PVOA 1FJGL 5C0XI 1Y1VG 4UY8C 1HZCA 2EXDA 3K81C 5M3MH 2ZTDA 1FL0A 2OTLT 1SRUA 3OTOL 3HOXH 5LMNW 4DV3L 2IX1A 5JJKA 1VQAA 4KLKA 2F4VQ 3GTQH 4DV1L 3TEHB 4JI2L 3GTJH 4EQ5A 2NN6G 4IFDG 2GVAA 4GKJQ 1QVGA 3GTKH 2UUCL 4X66L 4HIDA 5HY6A 5JJIA 5IWAL 1K8AC 2ZTEA 4BY7G 1V1QA 1KXLA 1UE7A 4JCVE 3AYHB 3KF6A 4JOIA 3HOUH 2UXBL 3D31A 4DR4Q 3T1HQ 4A3IG 2PMZE 2IX0A 1J5EQ 3CCJA 2JQOA 2K52A 1PHJA 3ERSX 1Q82C 3PSIA 3T1HL 3J81j 5BR8Q 3STBD 4JI8L 4QGUA 2OWOA 5IP7G 1EQQA 4LF8L 1IYJB 3PV0A 3PUZA 1ASZA 2ASBA 3GTMH 3D0FA 4C3JH 1D7QA 3K7UC 2JA5G 2IG0A 1QVFS 1HZBA 3HOYH 4LFAL 2C35B 2JA8G 3S1NH 1J6QA 3EIVA 3NEMA 1VQPA 2JEBI 4UP8A 3CD6T 1YJ9A 4A3EH 1EWIA 1Y1WH 2KCTA 5M3MG 3ULPA 2MWOA 3LGLA 1T9HA 4PZ6A 3W5OA 5FLXc 4A75A 2I5MX 4DR3Q 1JJ2A 2JEAI 3DB3A 3OW2A 1Q7YU 3U4ZA 1XNQQ 2YTXA 3CCQT 3BU2A 5IYBG 2R7FA 3TS2A 3KDFB 2E5LL 4A3EG 3AFPA 3CCEA 4OWXB 3HOWH 4A3DH 1CKMA 4Y7NH 1PA6A 1KHIA 3EBEA 2LXJA 3AFQA 2CQOA 4DR5L 2DO3A 4A3MH 4R4IA 4R4TA 3BZCA 1P16A 1X3GA 4IFDJ 4O0AA 1N8RU 4B3SL 1N32Q 4DV7Q 4KHPL 1NPPA 3K0XA 1VQMT 4JI3L 2L3RA 3EN2A 3G4SA 1WFQA 3KYHC 1LTLA 1XTDA 1HZ9A 5LL6S 1PH4A 1M1KU 3P8BB 1Z9FA 1KD1U 2LCLA 5C44G 1R9TH 4LF4Q 2YTVA 1VCIA 5IT9E 3U58A 4QL5A 2JA5H 4L5QA 4DR6Q 4X64L 3HOYG 1N33L 5C0XG 2IT1A 2Q2TA 2UUBQ 1VQ8T 4CRIA 4A4IA 4OWWB 3PUWA 1XPOA 4JC0A 4JI0L 1XNQL 1Q8KA 1M1KC 1A0IA 3G48A 5M3FH 2I0QA 4RMFA 3I4MG 2YV5A 1XMQL 2E2HH 2Z0SA 2LQ8A 3J81E 1VQPT 1Q86C 2WB1E 1EIYB 2CKKA 3GTLH 4BY7H 3CCLT 2EIFA 1KRSA 4JBJA 1VQ5A 2EQSA 4YHHQ 1PH7A 4B3ML 3M4PA 4LFCQ 3CCVT 1VQDA 5IYCH 4IPHA 1N33Q 4LF6L 1YJNT 1TXYA 2PI2E 2ZJRA 4R4QA 3JAMc 1IBMQ 1D8LA 3I56A 3WWVA 4LF4L 3KBGA 4HIOA 4DR7Q 1XNIA 4RG2A 4POGA 1NZ9A 4YCVA 2UUAQ 1NBWA 2D0PA 3E9IA 1K8GA 5C4JH 4GNXB 2K75A 3CCMA 4L5SA 2K5NA 2MO1A 4LF9Q 4P75A 1XPUA 2UUCQ 1KD1C 4A76A 2MWPA 2HQLA 4OXPA 1NJIU 4TVAB 4POFA 4ALPA 3HKSA 3CCLA 1EFWA 3A74A 4LF5Q 5JEAJ 4YY3Q 1N9WA 2Z6KC 4DV0L 2E2JH 4NXMQ 3S1RH 1XNRL 3ER0A 3FP9A 1LYLA 4DV3Q 3I7FA 3LH0A 1YJNA 1YNXA 1C7YA 1JT8A 3J7ZC 5J26A 4A3MG 3H0GH 1BBUA 1FJGQ 2G3RA 3E0EA 4BA1I 3UDFA 1AE3A 1A8VA 2NVQH 1YBYA 4IO9A 3CCST 2PI2A 1K9MC 4HJ7A 3NENA 5GAGC 2KBNA 4NXNQ 1G6PA 1Z47A 3KFUA 3M4OH 3KF8B 1VQ5T 4LF9L 4AH6A 5C44H 3PIPA 1E3PA 3CCVA 1TWCH 3U4VA 1Q12A 3A5UA 3VDYA 3PO2G 1EIFA 1PH6A 3G71A 2ALYB 3H3VH 1HNZQ 3KDFA 3BJUA 2YTYA 2Y0SE 4YWKA 4A3LG 5H1SE 4TVRA 5IYDH 2JE6I 1SE8A 3PGZA 2VQFQ 2OQ0A 2AWNA 4GLAC 3CC7A 1X56A 4GN3B 1X55A 2AHOB 4DV1Q 4IPCA 1SN8A 1Y1WG 2OTLA 3F2CA 1UEBA 2K14A 3AEVA 4NB3A 4C3HH 4JI1L 5DM7R 3CCJT 2MFIA 1XNRQ 1VQ4T 1QZGA 4JYAQ 3CCRT 2QEXA 3KOJA 1HR0L 4P74A 5M5WH 4HJAA 4LF5L 4GOPB 3HOZG 3S15H 1WI5A 3S14H 4GS3A 3RLOA 4JV5L 4X62L 4DUYQ 1X3FA 4MTNA 4GNXA 4A3CH 4QIWE 2UUAL 1KQSA 2R7ZG 2IHFA 3UDXA 1QZHA 1IBKL 2CWAA 1CKNB 4LUVA 2HIXA 2UU9Q 3CC2A 2WFWA 4JG2A 5LMNL 3HOVH 2Q2HA 4A3BH 2UXCQ 1H95A 2JNGA 1I3QH 1Q46A 2N3SA 1IBML 2OCEA 3HKZE 2VS1A 3HOUG 2E70A 3HFZB 3IRBA 1EUJA 4DR1Q 2F52A 4RG1A 4LFCL 3F2BA 4YHHL 1I94L 4JI6Q 5K36G 1Q81C 2LXKA 4P71A 1E7ZA 5FJ8H 1NMFA 1VQEA 4A3FG 3HOVG 3LGJA 1VS0A 2R93G 2KDSA 4QJFA 1BVSA 5IP9G 2CCZA 2BH8A 1XMQQ 3PIOA 2WAQE 1JJ2S 2ES2A 3HOXG 3W1GA 2VY3A 3S1QH 1X6OA 5FJ8G 2OQKA 2UUBL 1L1OB 3RZDH 2MNAA 1PV4A 4UP7A 1MJEA 1VQ6T 5AJ3L 2B29A 4R4OA 4A3KG 1KIXA 4LF8Q 3CCUA 2A8VA 3NELA 3CCRA 1NPRA 1OXUA 3CD6A 1WYDA 2GVBA 5LMNQ 5GQOA 3K7AH 1N36Q 3M3YH 1XPRA 5IYDG 1YJWA 1UE6A 2NZOA 1IBKQ 4DR4L 4DV7L 4IOAA 4KHPQ 4X34A 2KENA 2MO0A 5IWAQ 2YU9H 1YEZA 1PH8A 3CCET 1BKBA 4ME3A 3K80C 2A1AA 3CXCS 1NMGA 2RHSB 4DAMA 2BA0A 2A19A 5GROA 1GO3E 4JBMA 1A63A 4NPSA 1SMXA 1HH2P 1Q81U 2KVQG 3DB4A 3JAMi 1YVCA 3J7A5 1B70B 4AYBE 2MQHA 4JBWA 1G51A 1PH1A 2AKWB 3H0GG 4EX5A 3CMAT 4JI1Q 2XTIA 3FKIH 1L0WA 2YYZA 4BXXG 1V9PA 3PCOB 4GOPC 3RN2A 3LGFA 3NBHB 5IE8A 4A3JG 1X9NA 3JAME 1K9MU 2I5LX 4DV6L 4KI0A 4A3KH 4IPGA 3J81c 1VQKT 3TQYA 4GLXA 3A0JA 1YHQA 1HR0Q 1S40A 2L15A 4A3BG 4WJ3M 4QQBX 1Q1EA 3RZOH 1CSQA 1B7YB 4LUOA 4PG3A 4YCUA 3A5ZB 1OXSC 4YCWA 2ZM6Q 4A3FH 3H3VI 1CUKA 1IZ6A 1CKNA 4LF7L 2BH2A 3ZJYC 2RHQB 1OXXK 4A93H 4JI7Q 3PUYA 1KC8C 3STBC 2DGYA 1YIJA 2E8GA 4X65Q 4DV5Q 4B3TL 1IBLL 3GTPH 4JI4Q 4GNXC 1VQNT 4A3GH 3OTOQ 1YZ6A 2KCMA 3FKIG 1GKHA 4HIMA 2N78A 1W2BS 3M4QA 3G71T 2R7DA 2VL6A 4AQYQ 1B8AA 2VUMH 1GVPA 2VZAA 4BBSH 4HJ9A 3M7NA 2V1CC 5ELOA 4B3RL 3KLWA 1C0AA 2XHCA 1VQJA 5IY0A 1AE2A 3RLNA 3HOZH 4DV5L 4B3TQ 3ULLA 2JA9A 4DV2L 1YI2T 1E22A 4QY7A 5C4XH 2KHIA 4J15A 2VQEQ 2AWOA 2JA7G 1HNWQ 2LVMA 3RR5A 3SGIA 2OTJA 1C9OA 1QUQB 3AQQA 3CCSA 1X3EA 4C2MH 5IT9c 2R92G 3PO2H 1SROA 1QUQA 3CC7T 1VQMA 2N8NA 1YHQT 4DV4Q 1E1TA 4JOIC 1RL2A 2Y0SG 5AJ3Q 1M1GA 1VQ9T 3CC4T 1WOCA 4MNOA 3CPWA 1K8AU 1CKOA 1CSPA 1L2FA 3F1ZA 4HIKA 1N34Q 4B3MQ 4R4CA 1N8RC 4LFBQ 4DV6Q 1NJIC 4GKKQ 4JI5Q 3GTOH 1FGUA 1YIJT 3S2HH 3J7AF 1TWAH 3F2DA 2NN6I 3ULJA 1VQ8A 3U50C 1SFOH 4JI0Q 2D0OA 2CKZB 2VUMG 1WCMG 2K4KA 3I4NH 1M90U 2JK8A 4WJ4A 2CWPA 1U0LA 1JMCA 1W2BA 1VQIA 2HHHQ 4OO1G 4YTLA 1N34L 4DR6L 2OTJT 1PH5A 4QQDA 4LNQA 1S72T 1A62A 1I5FA 2H5XA 3KF6B 1I94Q 4JI6L 3G6ET 1L1OA 4DR1L 2E6ZA 1K73C 5J3BA 3MEFA 4X64Q 1XJVA 1M90C 4JI3Q 1S3OA 4DPGA 2B63G 1AH9A 5GAEC 1O7IA 2UXDL 1X54A 2Z6KA 2B3GA 2CFMA 1DGSA 3CMEA 4LW1A 1KRTA 1KAWA 1YITT 2VQEL 2QEXT 1TWHH 2UXDQ 5DLQE 3OYYA 4A3GG 1UE5A 4A3CG 2Q2UA 2NZHA 3E9HA 2B63H 1VQOA 2JOYA 1IXRA 4DR5Q 2I5HA 4UP9A 3S24A 1EOVA 1SSFA 4BBRG 2K50A 4BBSG 3UDIA 4DR3L 1WJJA 3BZKA 4TQUS 5E7NA 4HJ8A 2HHHL 4APVA 5HGQA 3CC4A 3G6EA 3CPWS 4XTCS 2JA6G 2N49A 3UE1A 2FXQA 4DNIA 4DUZQ 4A3JH 1PH2A 4PZ8A 1OTCA 4BBRH 3CPFA 1K83H 1TWFH 4GN4B 3J80i 3I2ZA 4JI5L 5IP9H 5IYCG 5GADC 2JA7H 4BA2I 4LFBL 4X65L 1MIUA 1Q1BA 2RF4A 3CF5A 3RN5A 1VQGA 2WB1G 2QA4T 2PQAB 4OX9Q 1VQ9A 2HIVA 4JI8Q 3UDGA 4LFAQ 4JI7L 1PH9A 4A3DG 1I6HH 2VQFL 2Q2IA 4H02A 4JBKA 2NVTH 3GDEA 3DLLA 1JJCB 1S72A 3J80E 3B6YA 3CCMT 1HZAA 1TWGH 2NVYH 2JUFA 2F3IA 3KJOA 1J5EL 1UWVA 2ZM6L 2UXBQ 4Y52H 3TRZA 1Q7YC 3L2PA 4BY1H 1HNZL 3DM3A 3S2DH 3PUVA 1PYSB 4P72A 4PZ7A 3M85A 2ZJQA 4X66Q 2ZJPA 4GLVB 1HJPA 1LM0A 3RNUA 1GD7A 2JA8H 5FLXE 4A93G 5JJLA 4X62Q 4DUYL 4OX9L 4JV5Q 2MI6A 3I4OA 1WCMH 2XGTA 1G291 4NXNL 1JB7A 1VQOT 3CP0A 3HKZG 4A3LH 1HNWL 3F8TA 2BA1A 4DUZL 4LWCA 2JA6H 3CW2C 1IL2A 2F4VL 3CMET 3S1MH 3PUXA 2AMCB 2K5VA 3TREA 4AIMA 2E2IH 1E1OA 1K3RA 1VQKA 1I50H 3GO5A 1W3SA 4IJLA 1OXVA 4JI4L 4OO1I 1IBLQ 4L5TA 2R7ZH 1OXTA 3OW2S 3FHWA 4IPDA 4NXML 2IY5B 4KHZA 1PH3A 1HR0W 1Y14B 4DK3C 1EQRA 2PQAA 1QVCA
chains in the Genus database with same CATH superfamily
3K5MA 1RDPD 1Y0MA 1VQFA 2CSQA 2KQWA 3CCQA 1K73U 1D0YA 3Q8DA 1RIPA 1UDLA 1SLJA 1TIID 4LF6Q 4AFUC 1BI1A 3CPWP 2NBFA 5IP7H 4K0KL 1VQCA 3QBYA 1ZUKA 3G4SQ 4HJ5A 2DKGA 1D0XA 1YI2A 2KSSA 5I4DA 4HMIA 3GD7A 4C56C 5IXBA 2IX3A 1EYGA 2Z8LA 1PZJD 3VS2A 5DAUA 1RHPA 1SRLA 4DK1A 2R93H 1QVFA 3H0FA 3VU3C 5FLMH 4YWLA 4EMKA 4YWMA 1TWBA 4AFSC 1SE2A 3L0OA 4P73A 5IYBH 1BQQT 1YCYA 4ZN3A 5CR2A 4DAYB 4DV0Q 1GUWA 2DX1A 1MKHA 5BN5A 1MNDA 1OPLA 1LLRD 4LUZA 1TS5A 3MXNB 1PKSA 4DK6C 3JCMf 1D1BA 5CCAA 1VQLA 1PYBA 3DXJC 2LFNA 1P92A 4B3SQ 3PTAA 2PZ1A 1L0YB 1EU4A 2L8DA 1U9RA 2E2JB 4G7OC 5IHKA 4M7DC 1NE3A 1LCKA 1XJWB 3DWQA 5LMUL 3TS0A 3CU7A 2B2YC 2JMCA 1VDZA 1STEA 3PMTA 4H7BA 4RWSC 2DVJA 1OO9B 1II3A 5E3FA 1STHA 3RD4A 4PJOD 3PO2B 2DXTA 4AQYL 1FXXA 2RHXA 3FRNA 2ENBA 3OOCA 4PMWA 1VQ4Q 2DIGA 2EDGA 5KNCA 3CD6Q 4M75A 1GFCA 3T16A 3H41A 2KHSA 3CQZH 4HCSA 3CBMA 5C44B 2F0VA 1UHFA 2CW0C 5LL6X 1F9QA 3X20B 1H641 3KBXA 1PRTB 3I4NG 4CC4B 1IW7C 1EY8A 3HS0C 3JB9J 2E2IB 3MEWA 1KQSS 2QGQA 2GFUA 1ZSZA 4M78E 4X6AH 4PJJA 4Q0FA 4ZAIA 3VS3A 1BIBA 4BY1G 4OGCA 2FVUA 2RN8A 3TBIB 1J9OA 4M7DD 2A68C 2XKOC 1K0RA 4DV2Q 5IHIA 1TS4A 3E0JA 1VQ4A 1FNVA 4R55A 3FLGA 4GKJL 1QJOA 4B3RQ 2C5CA 2J0TD 4V2SA 1P8LA 5FLMG 4JI2Q 1STBA 4K2KA 3P7JA 4PLIA 4FCYA 4UY8C 1U3OA 5GAMd 1HZCA 3QIAA 2ZTDA 3OTOL 1SRUA 3HP3A 4DV3L 4KGZB 2YLCA 2F4VQ 2MAMA 1HFNA 1C48A 4EQ5A 2NN6G 2W10A 5IGGA 1QVGA 3NP8A 3NBIA 2V1QA 3GTKH 4J9BA 1KXLA 3GNGA 1WQWA 2K7VA 5D7UA 1UE7A 2RKSA 5HK3A 3HOUH 2VYTA 4OMPA 4DR4Q 2IX0A 2B2VA 3PSIA 3J81j 1W70A 4LF8L 1K28A 4C3JH 4X3TA 1E0BA 2JA5G 1QVFS 1BR9A 1HZBA 2RD1A 3EHRA 2C35B 1D1KA 3NK9A 3FC3A 1OOTA 2DL3A 2RJFA 1QCNA 1CQVA 1SBBB 2JEBI 1TQOA 3CD6T 3EIVA 4UP8A 1EWIA 5TSSA 2VC8A 3H9NA 2E65A 3EVQA 2MWOA 1CZWA 5M3MG 1WI7A 5LJ5g 1D5XC 4DR3Q 3AT1B 4DBFA 3F2UA 4XYOA 4CC3A 2L12A 1JJ2A 1PTOF 1Q7YU 4ZRZA 3BU2A 2X69A 3TS2A 4KV6A 3IAYA 4A3EG 2RBMA 1K3BC 4OWXB 4A3DH 4Y7NH 4FF4A 1PA6A 4C92F 1KHIA 2ZPBB 3EBEA 4RG8A 3AFQA 3VS1A 2YU9B 2DO3A 4R4IA 1VQ5Q 4A53A 2QA4Q 2DNEA 3K5NA 3BZCA 4B3SL 4CDEC 5CR3A 4DV7Q 5KYIA 4VUBA 1VQMT 5J39A 2X6GA 4BD3A 5CV5A 3KYHC 3EN2A 3EG3A 1QMCA 3CHBD 4JI3L 1HZ9A 4KD3A 2R7ZH 5M5YB 1Z9FA 2LCLA 5C44G 2YTVA 1VCIA 5IT9E 4L5QA 1YJ9Q 2NYZD 3OYBA 2DL8A 2E4HA 2IT1A 2RCFA 1D3BA 2PTKA 4A4IA 2PZUA 5FU7B 1RAFB 1XPOA 4JI0L 1Q8KA 1M1KC 2DE0X 3H6MA 4RHSA 1M8AA 2I0QA 1SMYC 1OU9A 5IGFA 4M77E 4C3IB 3M0RA 3JCMX 2HQXA 3OS0A 2F3WA 2DZ9A 1PC0A 2EIFA 1AN8A 3V05A 4DAYA 1U4MA 5KCHA 1VQ5A 1LACA 3ZL7C 1SXTA 2KRMA 4FO2A 4MN3A 1PH7A 1LNXA 4ZGDB 3VYTA 4LF6L 3OHXC 4R4QA 1PTOD 3JAMc 2RJEA 5FU6B 1D0ZA 1D8LA 3WWVA 1U5SA 4HIOA 4BY6B 2I0NA 4IIOA 5AFWA 4DR7Q 3GTJB 4RG2A 4HR7B 1NZ9A 5HKCA 4LD9K 2UUAQ 3RBBB 3JCMe 3E9IA 4OELB 3UA7A 2MO1A 4LF9Q 8AT1B 4P75A 3UPUA 3R93A 2DNUA 1QP3A 2DYIA 4ALPA 1Q90A 3CCLA 2JXMB 1WTWA 4YY3Q 1N9WA 1TS9A 2MPXC 2MP1A 2Z6KC 3RMSA 2E2JH 2F0DA 2FEIA 2KQ3A 5FWBA 5GANj 1KDAA 4ZUJA 4C92G 4Z8AA 1PNJA 3NE5B 2JMAA 2XU8A 4R56A 3D3RA 4K5VA 1EY9A 2X4WA 3OSVA 2QCPX 2V4DA 1IHZA 4H44C 5ELDA 1C8CA 2HEQA 4E7SA 3G6EQ 1K9MR 3KXTA 2DJGC 2NVQH 1MNEA 4OGEA 3T53B 2LJ0A 2B8GA 3NENA 4NOYA 1ILPA 1ZQ1A 1ONLA 2A37A 4PK4A 2BDOA 4M75E 2E12A 2EJFC 1HQRD 1VQ5T 5GANd 5C44H 1ZXTA 2XWBB 1TWCH 5IN1A 2EYJA 3K5OA 4ABNA 3A5UA 3JCMP 1R0CB 3FJPA 3LYIA 4F7UA 2K79A 2ALYB 3HEJA 2O9SA 3OYLA 3QIIA 4M77C 3HG9A 3MFYA 4ZKBB 1UGQB 2N88A 1HNZQ 5LJ5e 7AT1B 1EQTA 5IGDA 1WGSA 4XTVA 1G3YA 4YWKA 1OX9A 1AZPA 3A55A 4C3JG 1EY5A 3RR6A 4IURA 1SE8A 1HQMC 2KECA 1D1CA 1ZHIA 4M7AE 1DYQA 5C4ZA 2PU9B 3SEMA 2AHOB 1Y57A 3JCMg 4IPCA 4J1MA 3EFXD 3CXCP 4AYBB 2X9HA 3EFRA 3AEVA 3J7AV 1J3TA 4JJDA 4JLIA 3ZEHA 1MMAA 3CCRT 2XIWA 4TSSA 2QEXA 1STGA 1E2ZA 1LO5D 4JYAQ 2F0EA 1H3ZA 3CCMQ 4PMCA 5M5WH 3MC0B 3Q23A 1W6XA 1MD2D 4LDYA 4KMUC 3S15H 3RLOA 3P8DA 2FJ2A 2R57A 2RQTA 2HCIA 4X62L 1X3FA 5IHNA 1NR4A 4M77D 2NZ1D 2IHFA 2DY8A 2BE9B 2CWAA 2V1RA 3MP6A 1HUMA 4XQJA 1SPKA 1STNA 2Q2HA 4A3BH 1VYUA 3RKXA 2AQ1B 3HFZB 3IRBA 4F8MA 4CDDC 3CMEQ 1QG7A 3PNWC 5A0GA 4IN3A 4P71A 3Q24A 2MUYA 3E6ZX 4CJ0B 5GAN8 4DAVA 1Q81R 2DFUA 4BBSB 1BVSA 1R4PB 4P2CB 2DXUA 2ES2A 5KYWA 5CVIA 2DZCA 4NXMQ 1JU5C 3R2TA 2FZCB 2AZSA 3EG9A 2KXCA 3OW7A 4L6V5 2OTLQ 2B29A 4R4OA 1QW1A 2A8VA 3CCRA 1N36Q 3NUCA 3X28B 5IXFA 2PMZB 2P5ZX 1Y96B 2E10A 1QCBD 1YJWA 1UE6A 3K0YA 2F0MA 4N0AC 1JICA 4DEXA 3H0HA 4DV7L 3NWTA 4Y7NB 3UI2A 3RNJA 3CRLC 5EC7A 1PH8A 1BKBA 3VYUA 2B8AA 2LP5A 3JB9F 3K80C 5JEAH 5KYUA 5D65A 5GROA 2E6NA 4PKCC 4NPSA 3OYHA 4GZYC 2KVQG 3J7A5 1LT5D 1RI0A 4QT7A 4ESRA 1NR2A 1NCVA 2GTJA 4JBWA 2K5QA 4I65A 2AKWB 4EX5A 4JI1Q 2XTIA 3FKIH 1U8RA 1SNOA 1HSQA 2EQKA 4GBQA 3VYRA 4F7XA 4GOPC 4PNYA 2KBTA 2HUGA 4A3JG 1ENCA 1F77A 4KI0A 4A3IB 3WVDB 4XDXA 4IPGA 3CC2Q 4OB2B 3IKJA 4GLXA 1KABA 4CJ1B 1LABA 2QI2A 2RNAA 1HR0Q 2CP5A 3GTLB 4WJ3M 3OYNA 1SYCA 3CCQQ 1Q1EA 3UF4A 1U1SA 1U4LA 3A5ZB 1M3BA 2A74C 3QOJA 4AG1C 1D1IA 4RTXA 4FXKC 4YCWA 1JOQA 1NG2A 2CZ7B 3E9FA 3X3MA 5LJ3d 1CUKA 5KYXA 1CKNA 1GXIE 2AK5A 3RMHA 1OXXK 2FPEA 2EGAA 5GAOr 4M7AG 1K1ZA 3A7AB 4DV5Q 2OF1A 4X65Q 3SHLA 1IBLL 5JPMC 3ZBDA 4GNXC 4M75B 1A0NB 1OX8A 1D1AA 2ZPGB 2XDPA 5CAIA 1FNWA 2KCMA 3VRYA 2RI5A 3M4QA 4RGTA 3BDUA 2BE5D 3G71T 4U68A 2J6FA 3M7NA 4J6HA 2D0NA 2HQHA 2RO0A 3A54A 3RLNA 3EGXA 5CV9A 1KIKA 3GP8A 2LCSA 1G83A 1AD5A 4EIKA 1UUEA 2LRQA 4QY7A 1KTKA 4G7HC 1AWXA 2QGGA 2XIDA 3JCMb 2K5DA 1Z9ZA 1TU0B 1ET9A 3AQQA 4RGNA 3PO3H 5IT9c 2P0QA 3PIP3 5A0DA 1EY7A 1IHWA 1QUQA 3CC7T 1EZZB 4D8KA 4CC7A 2F0HA 3E5SA 4MNOA 2ED0A 4C5IA 3VR5A 1HR0L 2WKCA 4ME5A 2EYZA 2HD3A 4R4CA 1VQOQ 4LFBQ 2RQVA 3GTOH 2KOLA 2QQSA 4FT4A 1F2ZA 4JI0Q 1SE4A 2VUMG 4FYVB 2EYFA 3UDCA 4JK1C 4WJ4A 2CWPA 1EWHA 4M8AA 1VQIA 1N34L 4CC2A 1BDOA 2KROA 1LTTD 1A62A 1G3TA 4RFBA 3Q0AA 1X43A 4IFDH 4HAEA 5CBEE 1I94Q 2E6ZA 5J3BA 1YNJC 1XJVA 4O42A 4XQQA 4JI3Q 3TP5A 3M57A 4OO1H 2COWA 1SJED 4DBRA 3TSWA 1X54A 2FHDA 3KK7A 3PQIA 5M5WB 4WORA 3CMEA 3OS5A 2A36A 1K8AR 4RKBA 3OYYA 4A3CG 3A1PA 3ASKA 4C8QA 2DXCA 2CQAA 4DN4M 4LE9A 4DR5Q 2I5HA 2QQ9A 3S3MA 4F04B 1EOVA 2RDGA 2ZGWA 4PJNA 2K50A 1RACB 2QQRA 2WACA 1TR5A 4RTVA 1YNZA 3UDIA 1DOMA 1PTOH 5E7NA 2WSEE 4C5EA 1LTGD 4HJ8A 4DR3L 5HGQA 4WCIA 2HHHL 4C92A 2A69C 2RM4A 3MP1A 4LDVA 2JA6G 2N49A 3UE1A 4DNIA 4A3JH 3EG9B 4C8QC 1HNWQ 2LX7A 5GAN3 4WRDA 1DOLA 3C3LA 3VKIA 3M53A 2HQEA 4X65L 1ZA2B 3T4AC 1UGVA 2QA4T 4JI7L 1IXDA 4A3DG 2LCCA 2Q2IA 2Z6BA 4H02A 3U9SA 1B50A 2VASA 3DLLA 1NEBA 1HZAA 2DL7A 1VIFA 2G6FX 3G7ZA 2IL8A 2UXBQ 1S5ED 2RDHA 1HRJA 4Y52H 4BY1H 2L9HA 1QWEA 2MCNA 1MUZA 1HNZL 1Y07A 2DYBA 3PUVA 3HOYB 1D09B 1VQ7Q 2F5TX 3RNUA 2RQWA 3HZXA 5FLXE 2SEMA 3C4SA 5I2MA 1QWFA 5CGKA 1FMKA 2FHTA 4X62Q 4OX9L 1AEXA 2MI6A 3I4OA 1BBZA 5I9PA 3HKZG 3KFVA 4KUIA 4A4FA 4M77G 2PNIA 1V76A 2QYZA 2X4YA 3META 1WVLA 2C9OA 3CW2C 5F2DA 2WV6D 1ZUUA 3PUXA 4C0FA 2E2IH 3I4LA 1WHLA 2SDFA 1M1KR 1Q86R 4HKEA 1VQKA 1K3RA 1I50H 1SDFA 1W3SA 4IJLA 3OS2A 3OYAA 3R2IA 4FF1A 3P8HA 5M9OA 1OXTA 3FHWA 3QJYA 2Z4IA 3CKIB 4B08A 1HXYD 4NXML 1TVXA 5K5PA 1Y14B 1I4QA 1QOHA 3V96A 4IOCA 1GXDC 2E74C 2NTTA 5M5XH 3T1YQ 4F14A 1DONA 3GV6A 4C8QG 1I4HA 3L7ZC 1UG1A 4PJOB 3SK5A 1M30A 3J7YW 4IKFA 1NY4A 2WP8J 4BB7A 2NVXH 1WLPB 1FMWA 5GMKm 1Z6HA 5IT9L 3TP7A 2RHZA 3JC66 4C92E 4HCEA 2LT1A 2XICA 1Q82U 2DETA 1YHAA 5FLXL 5E4WC 1BI3A 2EYWA 3VYSA 2E64A 3T56B 3PF5A 2KNBB 5EG2A 1STYA 1Q86U 3M9QA 5I9OA 4TRDA 4RH6A 5LMUQ 4I7AA 2ID0A 4DKAC 4YY3L 4ILWA 3S3OA 1OYXA 1ICFB 2JA7B 5IAYA 2D9TA 2X51A 1VQ6A 1JWMD 1VA7A 5FU7C 5LJ3g 1JE5A 1F9RA 1S5BD 4JZ4A 2ZXPA 5EAYA 4IFDI 1I6HB 2EPDA 2ZT9C 2WKDA 1AP0A 2A68D 3UE0A 2PQWA 4DR7L 1EYDA 3TP6A 1A6XA 1VQBA 2JTFA 1UNSA 1GCPA 3I55T 1RCVD 3I56T 4V190 5GMKi 4EMHA 2VB2X 1LUZA 3A7LA 1M2OA 4IJHA 4ID6A 1EYAA 1KJWA 1ZA1B 3QO3A 4NL3A 1GUSA 4LXCA 1PLFA 2ZTCA 3I4MH 1AW7A 2FZKB 3GTOB 1NYFA 3NHHA 1YJWT 1X65A 2D2CC 4DV4L 1O78A 4LF7Q 1PDQA 5GAOp 3SK6A 1AT1B 5JVH3 3S17H 4NW2A 5ELCA 1Y71A 2FPFA 2X4JA 1IYUA 3CXCA 2R6GA 3OSSC 3T1YL 1TKWB 1GUOA 1AWOA 4DR2Q 2D1XA 1ZUYA 3M9BA 1UB4A 1RODA 3EGDA 2GN5A 2VNUD 2K5LA 4C0GA 3PFSA 5AT1B 3ULRB 2DUDA 2CT4A 4GN5A 5EQ0A 2LC4A 3SFMA 1WD0A 2JYOA 1X2QA 4FYYB 2KYMA 3MKDA 4JVZA 5FOBB 3CMAA 3C95A 3S6WA 5GMKe 5ELEA 1XOVA 4BXXH 1G91A 2NYSA 2FL7A 4RTYA 5GAOm 1VQ9Q 2RI2A 1K4US 2EXDA 3E9GA 3I72A 1RLQC 3GOXA 4M7AC 1B44D 3GTQH 1BB9A 2WSCE 4A63B 4JI2L 1U4RA 1KHCA 1VF7A 1VMCA 1G8XA 1WNLA 4RTUA 4JLGA 2AUKA 1HTLD 3SEBA 4IFDG 4GKJQ 5FRNA 1TWFB 3BG3A 5IWAL 3GLXA 3H0IA 1I3QB 2ZTEA 4BY7G 2F0WA 4JCVE 3AYHB 5GAMe 2UXBL 4L63B 4KN4C 2NUPA 3QR8A 4FVMA 3T1HQ 3RKWA 2PMZE 4A3IG 1PHJA 4HSVA 2X3WD 3GIBA 2K03A 2L1BA 3T1HL 4XYQA 4IIMA 1ET6A 4M77A 4HA8A 1IYJB 3I56Q 3OMGA 2Y90A 4H13C 5JPNC 1ABOA 3I35A 2JA8G 3RERA 4QW2A 1PG5B 2OAUA 4JS4A 1J6QA 3QOLA 2NVQB 5GMKj 5J1ZA 4A4GA 1WJQA 1G3WA 3LGLA 2CZ1B 5FLXc 2B2WA 4A75A 2I5MX 1PRTC 1B53A 1KDBA 3O5ZA 4DQ2A 2JEAI 1I81A 1N6AA 3CCQT 3VR4A 3AFPA 3CCEA 1CKMA 3M54A 5GAN2 3CQZB 4B9WA 8ATCB 2CQOA 2ZPFB 1TXQA 4JJCA 1N32Q 1JEGA 3MXNA 2MJ8A 4AFZC 2DERA 1WFQA 4XT3B 2EQUA 1M1KU 1MMGA 1QP2A 3LNNA 4QMGA 1H3HA 4KN7C 1HD3A 4DR6Q 4KKTA 4X64L 3HOYG 1N33L 2KEAA 2RH2A 2RQRA 3FEWX 2Q2TA 4CRIA 3C46A 4JC0A 3E1SA 1HCZA 5M3FH 4EMGA 5C3EB 2EYMA 1SSHA 3VR6A 3I4MG 2O88A 1RKNA 2KJXA 2YV5A 4HMJA 1XMQL 2LQ8A 3J81E 2WB1E 3S15B 1HFGA 2LNVA 2CKKA 2CHBD 2JTEA 1KQ2A 2COZA 2UXCQ 4C1NI 3JAML 3FMCA 2Q8TA 1N33Q 1M8VA 4IPHA 2K3BA 4M75G 2PI2E 3SXHA 2ZJRA 4F87A 4A3FB 1S5DD 1IBMQ 4A3BB 2NUPB 1UEAB 3KBGA 3OB9A 1J8IA 1WHJA 3BW1A 4KT0E 3O13A 1D5MC 1I1JA 2QQAA 4KBMB 2EY1A 5COYA 1EY6A 4Y28E 3GTKB 1K8GA 1JORA 1RLPC 4LUEA 2K5NA 4N8FA 3CC4Q 2GF7A 1XPUA 2HQLA 3V7RA 4OXPA 3HOUB 3EGUA 1JB3A 3A74A 5JEAJ 3VS4A 1SNMA 4OB1B 2CT3A 3OBWA 3I5SA 3QYHB 4M78A 3VS7A 2DNCA 4ME7A 3S1RH 4DV3Q 4AG2C 4RGMA 4IUTA 1WTHA 4HVVA 2KT8A 1JR0D 4IUNA 3G1JA 3TSSA 1QCOA 3H0GH 4ELYC 3E0EA 1MI2A 1TU2B 3UDFA 2HBWA 2MIOA 3U23A 2EJ9A 5CIUA 3M7GA 4IO9A 2JSOA 2EVRA 2PVOB 2TMPA 4RAUC 4CGYB 2KBNA 4Z02A 3PO3B 1BCPD 1Z47A 3KF8B 1W4SA 2LQKA 3PIPA 1E3PA 2QEXQ 3MVVA 2L55A 1HYOA 1Q12A 1SYEA 2PZWA 2KY9A 5L23A 3RUXA 2EYQA 3C1EA 4MZTA 1KC8R 2YTYA 3ND8A 4KY5A 4CDFC 2L4NA 3K59A 2ENMA 3CRKC 3IFDA 4HCCA 4GY5A 3CC7A 1DCZA 1X56A 1X55A 1ILQA 5KYUB 4GLAC 2QK0A 1OEBA 5A2QL 1BI0A 2EJMA 1Y1WG 2FZGB 2QW7A 3OWEB 1UEBA 2K14A 4C3HH 2JW4A 2EQIA 1A2UA 4K5WA 2HNIA 1SRMA 2B2UA 2MFIA 4J9GA 4DGZA 3KOJA 1BU1A 2O01E 5LJ5h 4HJAA 4LF5L 1B07A 1X2KA 5DNFA 5JAVA 3X3NA 1HHVA 3JSCA 3INZA 2H8HA 4BY7B 1X6GA 4R0KA 5GMKh 4QIWE 3F70A 3I5RA 1A3VA 4OEMB 1QZHA 4LUVA 1AZEA 1HPCA 3CC2A 2QF7A 1QCFA 1EEFD 1I3QH 1Q46A 2N3SA 5JJKA 1KSWA 3HKZE 2VS1A 4BUGA 3MEAA 4PJOF 1M4VA 4LFCL 4DR1Q 4YHHL 5C0XH 2C0OA 1YP5A 1RUWA 2I2LA 4JPBW 2K04A 1E7ZA 1K83B 3UATA 1ZEQX 4FP5D 2R93G 4OGQC 5E1FA 4QJFA 5EJWA 1F2LA 5IP9G 3M4YA 2BCOA 3BYYB 4X9DA 2W0ZA 2N55A 4Q5VA 3S1QH 1EYCA 1X6OA 3EH1A 1WX6A 3EGXB 2UUBL 1T5XD 2JTMA 1L1OB 1TWGB 1TOVA 3NTKA 1BF4A 1MJEA 4ZNXA 4C0DB 1VQ6T 1KIXA 5GMKl 3PE0A 1K9AA 5KYYA 2GVBA 1NPRA 1OXUA 2EYYA 4KKUA 5LMNQ 2KCNA 1S4ZA 3M3YH 5I11A 4YIJA 4C8QE 1WHMA 1UAPA 3DWPA 1IW7D 3J80L 2JA8B 4KHPQ 2F0KA 3V2TA 4DBQA 3NQTA 2DL5A 2EPBA 2KENA 4M7DA 2IVWA 3SDZA 1E2WA 5E4XA 5FWCA 4QKUA 4ME3A 1DXMA 2A1AA 2A28A 1JQYD 1TWAB 4DAMA 1NSNS 2K1BA 1A63A 3H3VC 1UE9A 4BDYA 5C4HA 3DB4A 3QKJA 1I5OB 2F5KA 1M1FA 1G51A 3H0GG 3NQIA 3PCOB 3J81L 3RN2A 1X9NA 2RSNA 1CQFA 4C92C 2XDBA 2I5LX 4A3KH 2EZVA 3KLSX 3H94A 3A8MB 2K32A 1VQKT 2DD5A 3TQYA 3A0JA 2B2TA 5LJ3f 2L3QA 1YHQA 4E2FB 4BWGB 1LTRD 2D9UA 4A3BG 1TWHB 1W6KA 4NKLA 2V8JA 3L1AA 3HRZC 2PVGB 3FJ5A 4PG3A 2EQJA 2VGNA 5JOBA 2ZM6Q 2HZYA 3I55Q 3L42A 2XWJB 1IZ6A 2FO0A 3S3NA 3VA7A 4UC4A 1CFMA 2BH2A 3ZJYC 2YT6A 2RHQB 5C3WA 3V8JA 3OS1A 1D2BA 5GJVB 4JI7Q 5FKAC 3ME9A 1PZKD 3GTPH 5KE2A 4JI4Q 4C92B 1VQNT 4A3GH 2I46A 1H92A 1EQVA 1PZID 3T13A 1GKHA 2ROLA 4JRIA 1W2BS 4AFQC 1YJWQ 4PJOE 2R7DA 2VL6A 3S1RB 1LT6D 2NVTB 1PD1A 2VZAA 4BBSH 1EU3A 1ZYRC 4MZPA 2A6HD 2V1CC 1QKWA 2DL4A 3KLWA 2YRVA 2XHCA 1VQJA 1AE2A 3PMFA 2YUOA 2J06A 1QVGP 4DV5L 3H0GB 1LTAD 5C4XH 3WVEB 4F16A 1YNJD 4PNOA 1UECA 2VQEQ 3RZDB 2LVMA 3RR5A 3SGIA 1IYVA 1F9SA 3CCSA 2SNMA 1WFWA 4NL2A 3TSZA 1KD1R 2NUCA 3M5AA 2O5IC 5K36H 2K7AA 2E3HA 2H1EA 1RL2A 1IB8A 2JS0A 3FEOA 5AJ3Q 2ZPEB 1PYWD 1N34Q 3CPWA 1K8AU 1CSPA 4EVOA 3F1ZA 4HIKA 3FPUB 1B3AA 1O80A 2DM1A 4C0ZA 4JI5Q 2HD0A 1YIJT 2XN9C 4TKOB 3F2DA 2L2PA 1VQ8A 2A69D 2B2YA 3S9WA 2EVBA 1WCMG 4G4KA 1JJ2P 2K4KA 1M90U 2JK8A 3MPUB 2NB0A 3I4NH 1ZYRD 1W2BA 2DILA 5KH6A 1WXTA 3SR1A 5EBCA 1I5FA 1K73R 4C3HB 1YNND 2EGEA 1B3QA 3RKYA 3KF6B 4DEYA 3G6ET 4JI6L 1K73C 3MEFA 1M90C 1AH9A 2Z9HA 1C0MA 2IJ0A 1QVPA 2UXDL 4E7JA 3D4WA 2O4XA 1KAWA 2B2UC 2UXDQ 1F1BB 4A3GG 3BDOA 1TS3A 3OSOA 2MGSA 2CH4A 3KUPA 4L6TB 2JOYA 1CSKA 1W1FA 2HCKA 5M3MB 1SMYD 2VXWA 1RTNA 4BBSG 1R8OB 4J9IA 4BACA 2KVMA 3BZKA 4X3SA 1SF9A 2ZZDA 2JN4A 4V0BA 4APVA 1E2VA 3H91A 4R8IA 3G6EA 3CPWS 1GBQA 1OTCA 1SNCA 4EQPA 3EAEA 5CO7A 3J80i 4GN4B 4JI5L 3I2ZA 3EQLC 1JWSD 3KF8A 1PTOC 1VQGA 2WB1G 3QUIA 1GRIA 2PQAB 2F69A 1VQ9A 2HIVA 4JI8Q 1GUGA 1JOKA 4LFAQ 2AKLA 2VQFL 2VUMB 5CC4A 3KDFB 4OB3B 3J80E 1TWGH 4PJOA 3L2RA 2F3IA 3K5LA 1V1PB 3HOZB 5GAMj 4J8QA 4LAAA 3TRZA 3L2WA 4MIUA 2KEEA 3S2DH 1PYSB 2XG8D 3THKA 4BE0A 4PZ7A 2ZJQA 3K7AB 2ZJPA 4K6DA 1WJSA 1VQ8Q 1HJPA 1GD7A 1LM0A 4A93G 4J6YA 4DUYL 1AZGB 4RTTA 4JV5Q 1PMRA 3MP8A 1WCMH 1G291 4NXNL 4XQNA 3I4MB 3CP0A 2COYA 4C2MB 4A3LH 1WTOA 4PJOC 3F8TA 4OIKA 4HCKA 1B9NA 3DMUA 1MSHA 2D8JA 1OULA 3AHUA 4I7ZC 1IL2A 3CMET 5GAN5 4CI0C 1AFPA 4A3DB 2F3VA 5EKIA 4MMKA 5CQXA 5J22A 1E1OA 4JI4L 5CKBA 1IBLQ 2WAQB 3JB9H 4IPDA 2F0LA 5GJWB 3A8GB 2RHIA 3QPHA 3GPLA 1EWCA 2K6AA 4KHZA 5ISRA 2RA4A 1PH3A 5D6YA 1HR0W 3QZ5B 1DJRD 3E2UA 1Q82R 1QVCA 3RLFA 3PIO3 1CM9A 2KRNA 3QHSA 1BIAA 1LJOA 2R92H 2WB1B 1WZOA 2PCFB 1I6VC 1GBRA 3HFOA 2A7YA 1MV0B 1FX7A 4WTOB 1MJCA 2OX7A 2K5HA 3ICEA 1ESRA 1HUNA 2XI9A 1UTIA 1VQNA 1QNUA 1UE1A 3FB9A 1BCOA 4NS5A 4UPAA 3S16H 4LNPA 4MZ9A 1VQ7A 2DXBA 2M9UA 1KAAA 3BS1A 3Q6SA 4XXEA 2CUBA 2EYLA 2SEBD 5I6WA 1FVIA 1Y8NB 5KNDA 3QJ6A 2EBPA 2ATWA 2LY7A 3GTPB 1XWEA 3WOEA 4A3GB 5GAN4 1SYDA 1WQ7A 2JJ9A 2LSSA 1JJGA 2L11A 1QLYA 4A3JB 3HOWG 1QE6A 4RKUE 5I2SA 4XAXB 4ODGA 4ULLA 4QVZA 1LPLA 4FU6A 2F2WA 4J6WA 3CC2T 2FMCA 4R9WA 5GAHC 4PMBA 2LX9A 3EGDB 5L8RE 3CCUT 4OWTB 4R1JA 3QWYA 3V8LA 4FDBA 3GF5A 3PGGA 1U5KA 5I6YA 3S1NB 4O2DA 1NYGA 4BI3A 1E6HA 2Z4HA 2GQIA 2QXFA 5GAMh 2BZXA 4H0LC 4M77B 1RJTA 1SHGA 4JYAL 2E5LQ 2H3JA 1G6ZA 4X9CA 2YXYA 4MZMA 3JB9I 4QIWB 5M3FG 4ZGEB 3MJXA 1QVGS 1L1OC 2E5KA 3N5BB 4GKKL 4L5RC 3J80c 3W1BA 2CP2A 1YHBA 4M4ZA 3J81i 2M1HA 1ARKA 4KY6A 1FYNA 1BBWA 2CYZB 3G71Q 2OXPA 3NXWA 4ZN1A 2JJQA 1Q3LA 3I55A 4E7IA 5BR8L 2DF6A 5KYNA 5DM73 3CBOA 1S1NA 2X35A 2Y4YA 1EIHA 2RJDA 2P84A 3HRTA 1E24A 4A3IH 1CA6A 1TY0A 1AWJA 1ZBXA 2D62A 2PNHA 1Y1VH 4XU2A 2DTHA 2VKNA 5DY9A 3URGA 4ZTFA 1N8RR 3OYGA 4B6MA 1VQHA 1Q8IA 2AQ3B 2EJGC 4FF2A 4E7KA 5A2QE 3G4ST 1SEBD 3IQLA 1YJ9T 1Z7TA 2KRSA 3SVMA 2HT1A 3I8ZA 5CV6A 1FMVA 4EQNA 3TCJA 4AMCA 1PRTF 1FJGL 5C0XI 5KCOA 4ZUIA 1BOSA 1B2TA 2M00A 5M3MH 1FL0A 3HOXH 5LMNW 2C0TA 4K11A 4DOVA 1VQPQ 1AVZC 2RQUA 1PHTA 4FM4B 5GAOn 1ZSZC 3P75A 1DZ1A 1N9RA 4X66L 1G8ZD 3DEOA 1M2VA 1O7ZA 1PFBA 5C0MA 1V1QA 4JOIA 1OU8A 5CV4A 1BBXC 3D7SB 2EY5A 1J5EQ 1WHHA 3CCJA 3QXEB 2JQOA 1N5ZA 3QZ9B 3ERSX 1ZSZB 4OF1A 5EGTA 5BR8Q 2Z0WA 4MDXA 2RJCA 2OI3A 3TEEA 2X4XA 2VXFA 4MMLA 2OT2A 5EPJA 3STBD 4QGUA 2OWOA 3AMUA 3GBQA 3PV0A 3MAQA 3PUZA 1HXDA 3GTMH 3D0FA 1YITQ 2HKQB 1D7QA 3JCMV 3K7UC 1HJDA 4RA8A 2VV5A 4LFAL 1CHQD 3H8ZA 1SHFA 1H9SA 3NEMA 3HRSA 2QTXA 1YJ9A 4FYWB 1Y1WH 2MK5A 2KCTA 3ULPA 4NDXA 4HCBA 3W5OA 1EFNA 1IL8A 3M4OB 2PPBC 5IOCA 2ZPIB 3U4ZA 1XNQQ 1Y8PB 3HSBA 5IGBA 2R7FA 1NLPC 2D8HA 1LTBD 3MXGA 1JO8A 3HOWH 3CCSQ 3VS5A 2YRCA 2GNCA 4CKCA 2AKKA 3A8IE 3JCMW 1OZ3A 4R4TA 2F0NA 1P16A 1X3GA 4MHEA 1N8RU 3QDFA 3HGBA 1JC7A 2D0QB 3S17B 4J9FA 3EG2A 2MF2A 3P8BB 3VA5A 2YSQA 1K0XA 4Z9CB 1D3BB 2FFKB 3OIQA 2Q8RE 2R92B 3FKIB 2GQVA 2EXZA 2HAXA 1A3UA 3WOFA 4Q5WA 4OWWB 2HL3A 2RDFA 4JRQA 5CKEA 3H09A 2E2HH 4M78C 1VQPT 3GTLH 1EIYB 3NTHA 4BY7H 1R4QB 3H6ZA 1KRSA 2P0KA 3S16B 4HT9A 4M7AA 2CP0A 1RABB 4C8QD 2EQSA 5ELBA 4LFCQ 3M4PA 1H9MA 1VQDA 2JZ2A 5IYCH 2DJQA 3QDRB 4J9DA 2PVDB 1TXYA 3I3CA 1IKLA 3U9OA 2EY2A 2JXBA 4D6WA 1LV9A 2RHYA 4KY7A 2EJFA 5CBAE 4POGA 5DLOA 3C94A 1NBWA 2D0PA 2E3IA 2LQWA 3D4DA 1SE3A 3M4GA 2NWMA 4HCZA 5FW9A 4JW0A 4L5SA 1M4ZA 1WXUA 2UUCQ 4CJ2C 4A76A 2M16A 1EFWA 1YWOA 3NGPA 2J7IA 4M7DF 3G7LA 4C3IG 2BOSA 2M9VA 4DV0L 1RAGB 4XTWA 1XNRL 1AWWA 1LYLA 3V8KA 1GCQA 3TVTA 2O9VA 4M78B 3SHWA 1YNXA 2KUMA 4EDUA 1TY2A 1JT8A 3OYKA 3J7ZC 5ELOA 1S72Q 1PRLC 2LTOA 1BBUA 2G3RA 2EFIA 1AE3A 4C5HA 1D5ZC 3CCST 5LJ3e 2M0OA 1K9MC 3NPPA 4NXNQ 2Q8IB 2O31A 1W6JA 2C06A 3KFUA 4ZYSA 1TH7A 1IGQA 4AH6A 1GCQC 1G2BA 2D6FA 1XYIA 3CCVA 3U4VA 4G7ZC 3PO2G 2TSSA 4JRPA 1EIFA 1VQMQ 3S2HB 2HL5C 4OMOA 2DEQA 1B9MA 1PSEA 2RF0A 2PW5A 1RAIB 4A3LG 3QWNA 5H1SE 5LJ5f 2JE6I 2EYHA 3PGZA 2VQFQ 2O2OA 2OQ0A 3OYFA 4A4EA 2AWNA 1AHJB 1EEID 4GN3B 1T3LA 1H9RA 1R9TB 1RAAB 3EHQA 4A3KB 3QB3A 3EJIA 1WHGA 2OTLA 3F2CA 1TG0A 4N4GA 3MO8A 4RTWA 2KR3A 3LWHA 2VB6A 1RTOA 4JI1L 3JCMQ 1XNRQ 2EJGA 4DK0A 2LMCB 9ATCB 2LNHB 4P74A 4N0AA 1I4XA 3HOZG 3HOXB 3OYCA 3S14H 1CKAA 4GS3A 1EIGA 4ZK9B 1G2SA 4ZGJB 3EH2A 3TZDA 5I2YA 4MTNA 1I8FA 2ECZA 4J8OA 3GNFB 4A3CH 1KQSA 2GGRA 3UDXA 1IBKL 1X32A 2CH4W 1CKNB 4UHVA 2HIXA 4AT1B 2IIMA 2F1LA 1F9PA 3QYGB 3HOVH 1H95A 4XU0A 2JNGA 1B1ZA 1PTOB 2UUBQ 3HOUG 2OCEA 4K14A 2OJ2A 1TT2A 2E70A 3JCMJ 1K8OA 2YDLA 1EUJA 3DM1A 4RG1A 4E47A 1C4QA 3QO2A 2DJZA 3F2BA 4JI6Q 1JB0E 5K36G 4DF7A 2DTOA 2LXKA 2PZTA 4BBRB 1VQEA 2AUJD 3LGJA 1VS0A 4OHJA 2KDSA 4RGOS 4DA4A 2BH8A 2WAQE 4C3JB 4RHRA 3HOXG 1WTVA 3OMCA 3EFOB 3W1GA 5I21A 2L89A 4U673 4LN2A 3AB9A 4UAIA 2OQKA 2YRDA 2R5AA 4HT8A 4LDXA 5GAMg 1L0XB 1NLOC 4IZ8A 4UP7A 1JOOA 5DEHA 3RZDH 4LF8Q 4BY1B 3MXPA 4Z89A 1SYFA 4FXGC 4KK7A 3CD6A 1WYDA 3CBPA 3JV3A 1IBKQ 1A3TA 2DK3A 4XTUA 3OYEA 4DR4L 4N4IA 2LJ3A 1I07A 1IGUA 4IALA 5IWAQ 2EW3A 2YU9H 2LJ1A 1YEZA 2HDMA 1T3SA 3FPPA 4X1VA 4OMQA 4BI8B 1KNEA 3CXCS 2BA0A 2A19A 4JBMA 1HH2P 4K2LA 5IGEA 1YVCA 3KUFA 4ZTJA 4D8DA 1QB5D 2QDBA 2AT1B 3KLSA 4OVAA 3ND9A 1L0WA 2YYZA 2ABLA 2CDTA 2K3XA 4IQZA 1I4K1 2K2MA 3JAME 5C5MA 4ZKCB 4DV6L 1B7TA 2R58A 3HHTB 2B2VC 2FYKA 2CP3A 4KRTA 2L15A 3A56A 3GQBA 4QQBX 3SWNA 4PLLA 3L2UA 4ORZA 3T9NA 1IRXA 1UJ0A 2NLUA 5GAN6 2QQBA 2MYSA 1RADB 4XTZA 3G6JB 3L2ZA 3WDNA 3M55A 5C5LA 3SK4A 2YWWA 2RVLA 5ELFA 3BFMA 1FNUA 4LF7L 1S5FD 2OEOA 2NWGA 3PUYA 2CVRA 2IPOB 5C6SA 1YIJA 2DGYA 2F0GA 3ERQA 2K3YA 3N6RA 1YZ6A 3GTGB 1WDXA 3FKIG 1NM7A 2N78A 4ZQ3A 3EFSA 4N8X1 2ZPHB 2MMPA 3FDRA 4J7IA 1B8AA 2VUMH 1GVPA 3D4RA 2KE9A 2PNRC 1BCPC 2BIVA 1GOZA 4JS5A 3HOZH 2O2LD 1B34B 2LMJA 4B3TQ 5IH2A 1EFID 1TUGB 3ULLA 1YI2T 1GJXA 1E22A 4BE1A 1LTID 4KULA 1FYCA 2KCCA 4J15A 2M02A 2JA7G 5EKKA 1JXOA 1O7LA 4J9HA 4XTXA 3MWYW 1ABQA 3DHQA 1C9OA 4FT2A 1QUQB 3LWUA 1X3EA 3NWSA 5CKHA 4C2MH 4PFPA 2R92G 3ONAB 1DJ7B 3LWIA 2JA6B 2PUOB 2P4TA 2Y4XA 1VQMA 1MHNA 1YHQT 4DV4Q 3S1MB 4JOIC 3S2HH 2Y0SG 2LQNA 1M1GA 1WOCA 3CC4T 5I2XA 1CKOA 1DM0B 2A0FB 4GKKQ 3K57A 1JBMA 4K8JA 3J7AF 1TWAH 2K5IA 1NJIR 1G3SA 1PFMA 2D0OA 1KQSP 4K8IA 2XMFA 5EKLA 1JMCA 3IFTA 4E7HA 2HHHQ 3MFGA 2DRMA 4YTLA 4BDZA 3I90A 1PH5A 4LJZC 2NTSA 4OIJA 2R3ZA 4DOWA 3A8OB 1CI3M 1M90R 2JM9A 4X64Q 5HCKA 2JM8A 1PXUA 3OYMA 1S3OA 2JS2A 2PQEA 2XSCA 4PFOA 5KRUA 2EWNA 2C0IA 4Y91A 2CFMA 1RAEB 1D6EC 4LW1A 1YITT 2QEXT 1TWHH 5DLQE 3NSWA 2RPNA 3UA6A 1UE5A 2ESWA 2NZHA 3E9HA 2ZAEA 2F0JA 3A8JE 1TS2A 5KYXB 1IXRA 5BN4A 5I22A 5KEEA 3S24A 4BBRG 3X25B 2SNSA 1N9SA 3HOVB 2QEJC 4KD4A 4O5VA 1WIEA 3GTQB 2B8FA 5GAOl 3CC4A 2KXDA 4C8QF 4A93B 2VGMA 3CQTA 1PKTA 1PH2A 3OYDA 2LS01 5JJLA 3CEYA 4BBRH 3TU4K 2AZVA 1TWFH 5A35A 2JP1A 5IP9H 4BA2I 4LFBL 1MIUA 1Q1BA 2RF4A 1RF2D 1LVKA 4DNTB 4OX9Q 2F0OA 1YI2Q 3GP7A 3OIPA 5CQYA 2VB3X 4KTAA 2NVTH 3SD4A 1TUDA 3NMZC 1JJCB 3B6YA 4LK1C 1J5EL 2JUFA 4A4KA 4GLMA 1HA5A 1UWVA 4F7UF 2GBQA 1Q7YC 2DA9A 1M27C 3DUZA 2F2VA 4P72A 3SB2A 3M85A 3OBYA 4BY6C 2O4XB 3R6OA 1X27A 1SNPA 1MHWC 1WXBA 2XDDA 5GAN7 2RHUA 3VS0A 4C1NK 3MEVA 1VQOT 1OI1A 2EAYA 5EPLA 4E6IA 4PL6A 1HNWL 1AEYA 2BA1A 5HGTA 4LWCA 2X3XD 2CP7A 5KIXA 1R0BG 2GFAA 3V7CA 2K5VA 2K57A 4AIMA 2QTVA 4CHTB 5LJ3j 3GO5A 5EPKA 2MHVA 2FRYA 2CREA 2J6KA 4FW2A 2BTTA 3FIFA 3C0CA 2HDAA 3BZDB 4FSXA 2FPDA 3I4NB 4ATOA 1EQRA 2PQAA 4XTYA 4IUUA 2L3SA 3VJPA 4QCLA 1Y1VB 3FDTA 4QB4A 3I70A 1ZBJA 2B86A 2KK4A 3Q22A 3HKZB 1IO6A 3I73A 4FXDA 1SYGA 4DR2L 1KC8U 1T0HA 1HNXL 4JZ3A 1VMPA 4N9PA 2CS7A 5C3EH 1VQLQ 5D6XA 2PUKB 3E19A 1M5Q1 1PCXA 4O1NA 5D3IB 1TUCA 2XRSD 3NFCA 2Z1CA 1SSOA 3SE0A 2O5JC 3MA2B 1ASYA 4LD6A 1YN8A 3SK8A 3QSUA 1CK1A 3CAMA 2B63B 5FO9B 3REAB 1M3AA 2QG9B 3ZFJA 2QA4A 2KGTA 3A98A 1JE4A 3NTIA 5KYLA 2K5FA 3PO3G 3OY9A 5LJ5d 2EOTA 2K5WA 4P5NA 1GM5A 4QVCA 2VUBA 4E7LA 4BS9A 2P0PA 2RI3A 1SR3A 1XMOL 2F0FA 5C4JB 2L3PA 1NUCA 1LT4D 2IHEA 5KE3A 1GHKA 2UU9L 2UXCL 4IUVA 2QILA 4O6JA 1V8QA 1N32L 1VQ7T 3DEPA 2HSEB 5C4XG 1KL9A 2ZCFB 2E75C 2K2VA 2JN0A 4HSPA 3ITPA 1EY0A 1A2TA 3K8AA 1I4GA 1N36L 2K33A 4AYBG 3S2DB 2RB6A 2G9HD 4ZLTF 2KEDA 2LKVA 5JEAG 4F88A 3RUZA 4J83A 1EX4A 1OZ2A 1PSFA 3H15A 2E76C 2F03A 2DVEA 2VXEA 3CCRQ 2JVVA 3KJPA 2LZ6B 2GTOA 1OPKA 2VWFA 2A3LA 2WAQG 4GOPA 4QVDA 1V43A 1YNNC 1LT3D 1NEGA 2F0TA 1VUBA 4II1A 3FVQA 2RCNA 4C92D 2L0AA 1HNXQ 5M5YH 5CV8A 2R7ZB 4OMMA 3O8VA 4OONA 5C3EG 1UHCA 2M51A 2R5MA 4GLKA 1O9SA 4OB0B 1YITA 1ML0D 3C1FA 5ELNA 2VW9A 2KHJA 1K76A 3AU7A 2K01A 5C0XJ 4XIGS 2BZ8A 1PFSA 4DXFA 1VQLT 2BKDN 2CZ0B 1U06A 1C1AA 3BE3A 1NTGA 3TN2A 4JRKA 2ICEC 1M3CA 4C3IH 4KGXB 3VUBA 1S5CD 4KJOA 4M75C 3TMEA 1WPYA 1X69A 3MTSA 3PF4A 4RCNA 2FB7A 2NUTA 1EZ8A 3IL8A 4K6LA 5IGCA 4E6RA 1IREB 1Y1VG 4QUCA 2JT4A 1GL5A 2R61A 3DWAA 4CBVA 4XU3A 2EY6A 2FINB 3K81C 4F7UE 1EY4A 1AZQA 2OTLT 5D3DA 5CK9A 1CHPD 1JWUD 2BDNA 1VQAA 4KLKA 5NUCA 2IX1A 1SNQA 4DV1L 3TEHB 2CP6A 2FRWA 2DAQA 2KYBA 3GTJH 4M7AF 2GVAA 5AYFA 1BCPF 4XU1A 2GA4B 2UUCL 2A6HC 4HIDA 3BDLA 5HY6A 4ANJA 1XX8A 2OTJQ 1K8AC 4M7DE 4M78G 3VYGA 5GANg 4M7DB 3KF6A 3D31A 3OWFA 2K52A 1Q82C 1BXTA 2A6EC 2E2DC 4PQXA 1E7OA 2HBPA 2G9DA 4EMKC 3P1HA 1U4PA 3JCMh 4JI8L 4LUDA 5IP7G 1EQQA 2ASBA 3TP8A 1ASZA 5EBDA 3P20A 1LOJA 3DLMA 2IG0A 5FRMA 3HOYH 2EYPA 1SG5A 3S1NH 3MXUA 4EPCA 1X75C 2EQMA 2BE5C 1UGSB 1VQPA 4A3EH 4C0DC 4M75F 4J7FA 2HDLA 5FO8B 1T9HA 5KNBA 4PZ6A 4C3HG 5C3XA 3HL8A 1JQQA 4FL6A 3DB3A 3OW2A 1OV3A 1HA6A 3LW5E 3TQ7P 1TWCB 2YTXA 5IYBG 1YCSB 2E5LL 2MPMA 4KH0B 2PYKA 4EQOA 2E41A 1Y69U 2BE7D 2F0UA 2LXJA 2B39A 1I50B 1X6BA 4DR5L 4A3MH 5FO7B 1BO0A 3VUZA 2KT1A 4IFDJ 3ZYYX 4O0AA 1XNQL 4KHPL 4C5GA 1NPPA 1O7YA 2EE1A 3K0XA 1JRIA 2L3RA 4F17A 3G4SA 3URYA 1LTLA 1XTDA 1PH4A 1UGRB 5LL6S 4LF4Q 4HVWA 1KD1U 4FNFA 1R9TH 3U58A 4JDSA 2G5DA 4QL5A 1ZLMA 2JA5H 2DPPB 5C0XG 1ESFA 3Q1JA 5JJZA 3N52A 2I07B 1VQ8T 3X24B 1SYBA 1XTCD 3PUWA 5BN3A 2DRKA 1GUNA 4UDUC 3G48A 4DXGA 2VVKA 1A0IA 1MGQA 1H9KA 1BNZA 4RMFA 5GANe 3JCMc 3WXMB 2EYOA 2WIIB 3QG1A 4BE2A 1Q86C 2XK0A 3LLRA 3DKMA 2Z0SA 4M7AD 3CCLT 4DBHA 3RZOB 3PT9A 4JBJA 2HSPA 3CCJQ 2P4RA 1K8MA 4IUQA 4YHHQ 4B3ML 3CCVT 4QUFA 2DTIA 1YJNT 4OMFB 4F7UB 3R6NA 3VRZA 1O75A 1CTMA 4WFN3 3I56A 4LF4L 2J05A 1E6GA 1XNIA 4BI4A 4YCVA 2YUNA 3EG1A 2CUDA 3HFNA 3CC7Q 1WTRA 1YHQQ 4R8NA 3W3AA 5CKDA 5C4JH 2K75A 3CCMA 1EOTA 4GNXB 2Y0SB 2CGHA 1HTPA 1FD7D 2HCCA 3L2VA 2M2LA 1IHVA 3A8HB 3M59A 5LJ5j 1FR3A 5CV7A 1KD1C 4MTKA 2MWPA 4LF5Q 1NJIU 3LX0A 4TVAB 4POFA 3HKSA 4FYXB 3JRZA 1QQJA 2BZYA 2YLBA 3ER0A 4RTZA 1BCPB 3FP9A 3I7FA 4JJBA 3GV3A 3LH0A 1YJNA 4K5XA 3GTMB 2QASA 3UT1A 1C7YA 3LX7A 2E1HA 4KHVA 2J4XA 4F7UG 4DA2A 5J26A 4A3MG 1FJGQ 3R3OA 5D6WA 4BA1I 5C4XB 5ECAA 4KGVB 1A8VA 1YBYA 2EYXA 3QWXX 2NN6H 2ZXRA 5KGUA 2PI2A 4HJ7A 4KKSA 3BVMA 5GAGC 1V1CA 1X3QA 4QF4A 1RAHB 2L5QA 4Y92A 3M4OH 4LF9L 2A73B 4ELZC 1M8MA 3I9QA 4PJMA 1QNKA 1UJYA 3VDYA 3EROA 1PH6A 3G71A 3H3VH 3HOWB 1TSFA 3KDFA 1KNAA 1M2VB 3BJUA 4KJNA 2Y0SE 3BY7A 2IPKD 4M1UB 4N4HA 4TVRA 5IYDH 5A0LA 4J9CA 3MHXA 3NPFA 4M75D 3T51B 1SFOB 3C12A 5G3LF 1KQ1A 2YHTA 4DV1Q 5CMDA 3EFOA 3MEHA 2H3EB 1WHKA 1TTHB 1SN8A 1BK2A 2LDMA 3L2QA 3LWEA 2DEUA 3JCMd 1WTPA 4M78D 4NB3A 2EKOA 4EMKB 3CCLQ 3W2DA 3CMAQ 1SEMA 5DM7R 3VR2A 1ZX6A 3CCJT 1X3PA 1VQ4T 2IWHA 1QZGA 5KYYB 2QKIC 4DNRB 4J6XA 3CCVQ 4FW1A 1K0SA 1YJNQ 1PWTA 2E2HB 5GANf 1VQKQ 4GOPB 4MDWA 1WI5A 4JV5L 4M77F 4DUYQ 6AT1B 1B4OA 4GNXA 2K05A 1YFNA 2A6ED 1F2YA 2UUAL 2R7ZG 1PFNA 4FF3A 5L37A 1VOMA 4LDWA 4PJLA 5LJ3h 2WFWA 2AIRB 4JG2A 3M58A 5LMNL 2UU9Q 2DBMA 4G57A 2CZ6B 2X6LA 1IBML 2YUQA 1XMOQ 3GTGH 2B2WC 1FGBD 2F52A 2V8IA 1I94L 4C8QB 3BYTB 4CKEA 1Q81C 1I4RA 4L8JA 2KA7A 4RCBA 5FJ8H 1I0CA 3M0SA 4QQGA 5FROA 1NMFA 3E3XA 4A3FG 2DMOA 3HOVG 5KYWB 1C6VX 2CCZA 1VQNQ 1XMQQ 3NBHA 1H8KA 3PIOA 1Q95G 1JJ2S 2OAWA 2DJFC 4RCOA 5G3LD 3TZUA 2VY3A 3HPWA 5FJ8G 2ED1A 1MBYA 1B34A 4WF2A 3MCAB 2NVYB 3M0UA 4A3EB 1WTXA 2MNAA 1PV4A 1W2BP 2RK1A 3D6CA 5AJ3L 4A3KG 2ATCB 1Y96A 2QDYB 3MEUA 1WYXA 3CCUA 2L0CA 3NELA 2SOBA 1UUPA 1PVOA 1MMNA 3K7AH 5GQOA 1XPRA 4DFAA 5IYDG 2F1MA 2NZOA 1UGPB 1AOJA 1FWZA 4OP0A 4IOAA 1WJRA 4X34A 2RSOA 3OPOA 3OW2P 4EGVA 1WCMB 5C6AA 2MO0A 2XNAC 4HTHA 2QDLA 1ICWA 1BUVT 3A8KE 4A3MB 3CCET 3D8GA 1CA5A 4XQ3A 1NMGA 2RHSB 2K28A 2F2XA 2XD0A 1GO3E 1JXMA 2K4YA 1STAA 2ZXOA 2HMAA 2WSFE 5JVG3 1SMXA 5CYUA 3JAMi 1Q81U 4DAPA 1CZGA 3EA6A 2MOXA 1B70B 4AYBE 2MQHA 5GAOq 2JA5B 1PH1A 3UWNA 2XVSA 4PV1C 3CMAT 1YIJQ 4BXXG 4M7AB 4A4HA 2RA2A 2DIQA 1CKBA 1SJHD 1V9PA 3LGFA 3NBHB 5IE8A 3VR3A 5T1GA 2DD4A 2QAZA 1N27A 1K9MU 3K6OA 1WTQA 2K9GA 4FSSA 3J81c 1VYVA 1VIEA 2IW3A 5IODA 1S40A 4OMNA 3A8LB 5M3FB 3HRUA 2EKHA 3RZOH 5CKFA 4FYDA 1CSQA 1B7YB 4LUOA 2GCXA 4A54A 3RMQA 4YCUA 5DM63 2CSIA 1OXSC 2DLPA 4CKBA 4KH1B 2WINB 4A3FH 3S14B 3H3VI 3MZ5A 3JB9D 2AQ2B 4JUVA 1QVFP 4A93H 1KC8C 4NMZA 3STBC 2QGFB 1GUTA 2E8GA 4B3TL 1KLUD 2R93B 1MMDA 2F0QA 2PW7A 4JJNK 4DU9A 3OTOQ 3C2PA 4RKLA 2A08A 1RI9A 4HIMA 2A5HA 2NUTB 4RCCA 1VYTA 1IKMA 3L3OC 5FU6C 1T5EA 4AQYQ 2F0PA 2K6DA 4HJ9A 4B3RL 1VQ6Q 2L5TA 3R8BA 1C0AA 5IY0A 3HTRA 2KAFA 1VF5C 1Y7XA 4DV2L 2JA9A 2KHIA 4PFZA 3L9AX 2AWOA 4WJWA 2B2TC 3I91A 4S3SA 1G2TA 1BYMA 3KLRA 1EL0A 2OTJA 3CCEQ 3V7SA 1V1PA 1WD1A 3PO2H 1XQHA 3REBB 2ROTA 1SROA 4LDUA 2N8NA 1A15A 1E1TA 5LHY1 5JJIA 1VQ9T 3BDCA 5GANh 1L2FA 2V8KA 1PD0A 4B3MQ 3PMIA 1XXGA 1N8RC 4X3UA 4DV6Q 1NJIC 1G5VA 2DY7A 1FGUA 1EZ6A 3M0TA 4J5YA 2NN6I 2D5DA 3U50C 3ULJA 1H9SB 1SFOH 2CKZB 4Z88A 1SNDA 2H4OA 2EGCA 1U0LA 2J6OA 4OO1G 3PVQA 4DR6L 2OTJT 1V29B 1NNXA 3VS6A 3OA6A 1NAPA 4QQDA 5M5XB 4LNQA 1S72T 4M7DG 2CW0D 5T1IA 2H5XA 5FK9C 1KDCA 1L1OA 4DR1L 1G6PA 5D14A 1I4PA 4DPGA 1DOKA 1ENAA 4NP5A 2B63G 2NVXB 2LT4A 2SRCA 1F2MA 2M0YA 1O7IA 1ZKOA 2Z6KA 2B3GA 3BVGA 5GAEC 1DGSA 2DBKA 1KRTA 1KFZA 1Z9QA 1LTSD 2VQEL 2DN8A 4HXJA 1GFDA 1V1OA 2Q2UA 1QILA 1OQKA 1VQOA 4OMLA 2B63H 1MV3A 5HURA 4UP9A 1Y8OB 3SWNC 1KK7A 4E7ZA 1R77A 1SSFA 1T0JA 3OYJA 4KUDK 2F0IA 4LMQD 2V26A 4J9EA 1U1TA 4FIBA 2RMOA 4M78F 1WJJA 2HKNA 4HN7A 4TQUS 4XT1B 4CDCC 5IIFA 4L59A 2E5QA 4XTCS 2F4IA 1WA7A 2FXQA 4DUZQ 4PZ8A 1HK9A 3CPFA 1K83H 5IYCG 1ENFA 3D6WA 3K58A 4HVUA 2RQXA 1KG1A 5GADC 1NE8A 4RMOA 2JA7H 2FMMA 1QKXA 2KMTA 3CF5A 3RN5A 4K0KQ 1GHJA 3UDGA 2KI7A 4PJOG 3M0PA 3JB9G 1PH9A 1I6HH 3S1QB 3RIRA 4B9XA 4JBKA 4QQ6A 3GDEA 3LH5A 1S72A 1M9SA 3RESA 3OYIA 3CCMT 3HP9A 2NVYH 3KJOA 4OL7A 2ZM6L 2XRQD 2AHJB 3SWNB 4N9TA 3L2PA 1DD2A 3CCUQ 3DM3A 2BUDA 1MGSA 1PM3A 1BI2A 1Q7YR 4X66Q 3OQ5A 3M3YB 3TDQA 4RUGA 4IUPA 4GLVB 1JCKB 2JA8H 1SKUB 1Y1WB 4XK8E 4HEDA 1X01A 1BCMA 3M56A 1PRMC 1I5LA 2XGTA 1JB7A 3M0QA 5HK0A 3FRPB 4DUZL 2F0SA 2JA6H 3RDVA 1RD9D 2FG0A 3NHNA 2F4VL 3VV0A 3S1MH 1NBEB 1YWPA 1MSGA 2AMCB 3TREA 5GAMf 1ACMB 5CORA 1PRTD 4OO1I 1CT1D 1OXVA 3X26B 1ZSGA 3MHBA 4L5TA 3PVLA 1SAPA 3BVZA 3OW2S 2IY5B 2YUPA 3VYHB 4L5GA 1KLGD 1QWYA 2J7ZA 1UFFA 4ZCKA 4X3KA 2NUZA 1H9JA 2ICIA 4DK3C 2PO4A 2RK2A 3EG0A
chains in the Genus database with same CATH topology
1VQFA 2KQWA 3CCQA 1K73U 3Q8DA 1RIPA 1SLJA 4LF6Q 1BI1A 5IP7H 4K0KL 1VQCA 3QBYA 4HJ5A 2DKGA 1YI2A 2KSSA 1EYGA 3GD7A 2R93H 1QVFA 3VU3C 5FLMH 4YWLA 4EMKA 4YWMA 4P73A 3L0OA 5IYBH 1YCYA 4ZN3A 5CR2A 4DAYB 4DV0Q 1MKHA 4LUZA 3MXNB 4DK6C 3JCMf 5CCAA 1VQLA 1PYBA 1P92A 4B3SQ 3PTAA 2L8DA 4M7DC 1NE3A 5LMUL 3TS0A 3PMTA 4PJOD 2DXTA 4AQYL 1FXXA 2RHXA 3FRNA 4PMWA 2DIGA 4M75A 3CQZH 3CBMA 3X20B 1H641 3I4NG 3JB9J 3MEWA 1KQSS 2QGQA 2GFUA 4M78E 4X6AH 4BY1G 1BIBA 4OGCA 2FVUA 4M7DD 2XKOC 1K0RA 4DV2Q 1VQ4A 4R55A 3FLGA 4GKJL 4B3RQ 4V2SA 1P8LA 5FLMG 4JI2Q 4PLIA 4UY8C 5GAMd 1HZCA 2ZTDA 3OTOL 1SRUA 4DV3L 2YLCA 2F4VQ 2MAMA 4EQ5A 2NN6G 1QVGA 3GTKH 1KXLA 3GNGA 1WQWA 1UE7A 5HK3A 3HOUH 2VYTA 4DR4Q 2IX0A 3PSIA 3J81j 4LF8L 4C3JH 2JA5G 1QVFS 1HZBA 2RD1A 2C35B 3FC3A 2RJFA 3EIVA 2JEBI 4UP8A 3CD6T 1EWIA 2VC8A 2E65A 5M3MG 2MWOA 5LJ5g 4DR3Q 1JJ2A 1Q7YU 3BU2A 3TS2A 4A3EG 4OWXB 4A3DH 4Y7NH 1PA6A 4C92F 1KHIA 2ZPBB 3EBEA 4RG8A 3AFQA 2DO3A 4R4IA 4A53A 3BZCA 4B3SL 4DV7Q 4VUBA 1VQMT 5J39A 4BD3A 4JI3L 3KYHC 3EN2A 2R7ZH 1HZ9A 1Z9FA 2LCLA 5C44G 2YTVA 1VCIA 5IT9E 4L5QA 3OYBA 2IT1A 1D3BA 4A4IA 5FU7B 1XPOA 4JI0L 1Q8KA 1M1KC 2I0QA 4M77E 3JCMX 2HQXA 3OS0A 2DZ9A 2EIFA 5KCHA 1VQ5A 1PH7A 1LNXA 4ZGDB 4LF6L 4R4QA 3JAMc 2RJEA 5FU6B 1D8LA 3WWVA 4HIOA 4DR7Q 4BY6B 4RG2A 1NZ9A 5HKCA 4LD9K 2UUAQ 3JCMe 3E9IA 2MO1A 4LF9Q 4P75A 3UPUA 1QP3A 4ALPA 3CCLA 4YY3Q 1N9WA 2Z6KC 2E2JH 4NXMQ 3RMSA 5GANj 4C92G 2XU8A 4R56A 2X4WA 3OSVA 2NVQH 3KXTA 4OGEA 3NENA 4NOYA 1ZQ1A 4M75E 2E12A 1VQ5T 5GANd 5C44H 3A5UA 1TWCH 5IN1A 3JCMP 3FJPA 3LYIA 4F7UA 2ALYB 3OYLA 1HNZQ 3QIIA 4M77C 1UGQB 5LJ5e 1WGSA 4XTVA 1G3YA 4YWKA 4IURA 1SE8A 1ZHIA 4M7AE 2PU9B 2AHOB 3JCMg 4IPCA 3EFRA 3AEVA 4JLIA 3ZEHA 4JYAQ 3CCRT 2QEXA 1H3ZA 5M5WH 4LDYA 3S15H 3RLOA 3P8DA 4X62L 2R57A 1X3FA 4M77D 2IHFA 2CWAA 3MP6A 2Q2HA 4A3BH 3RKXA 3HFZB 3IRBA 3PNWC 5A0GA 4P71A 5GAN8 1BVSA 2DXUA 2ES2A 5CVIA 2DZCA 4L6V5 2B29A 4R4OA 1QW1A 2A8VA 3CCRA 1N36Q 3X28B 1Y96B 2E10A 1YJWA 1UE6A 4N0AC 4DV7L 1PH8A 1BKBA 2B8AA 3K80C 3JB9F 5GROA 2E6NA 4PKCC 4NPSA 3OYHA 2KVQG 3J7A5 1RI0A 4JBWA 2AKWB 4EX5A 4JI1Q 2XTIA 3FKIH 1U8RA 2EQKA 4GOPC 4A3JG 4KI0A 3WVDB 4IPGA 4OB2B 4GLXA 1HR0Q 2QI2A 4WJ3M 3OYNA 1Q1EA 1U1SA 3A5ZB 4YCWA 2CZ7B 3E9FA 5LJ3d 1CUKA 1CKNA 1GXIE 1OXXK 5GAOr 4M7AG 4DV5Q 4X65Q 1IBLL 3ZBDA 4GNXC 4M75B 2ZPGB 2XDPA 5CAIA 2KCMA 2RI5A 3M4QA 3BDUA 3G71T 3M7NA 2RO0A 3RLNA 3GP8A 2LRQA 4QY7A 2XIDA 3JCMb 3AQQA 5IT9c 2P0QA 5A0DA 1QUQA 3CC7T 4MNOA 4C5IA 1HR0L 4LFBQ 4R4CA 3GTOH 2QQSA 4FT4A 4JI0Q 2VUMG 3UDCA 4WJ4A 2CWPA 1VQIA 1N34L 1A62A 1G3TA 1I94Q 2E6ZA 5J3BA 1XJVA 4JI3Q 3M57A 1X54A 2FHDA 3CMEA 3OS5A 3OYYA 4A3CG 3ASKA 4C8QA 2DXCA 4DR5Q 2I5HA 2QQ9A 3S3MA 1EOVA 2ZGWA 2K50A 2QQRA 2WACA 3UDIA 4DR3L 4HJ8A 5E7NA 2HHHL 2WSEE 4C5EA 5HGQA 4C92A 2JA6G 2RM4A 3MP1A 4LDVA 2N49A 3UE1A 4DNIA 4A3JH 4C8QC 1HNWQ 5GAN3 3VKIA 3M53A 2HQEA 4X65L 2QA4T 4JI7L 4A3DG 2LCCA 2Q2IA 4H02A 3DLLA 1HZAA 1VIFA 3G7ZA 2UXBQ 4Y52H 4BY1H 1HNZL 1Y07A 3PUVA 2F5TX 3RNUA 5FLXE 3C4SA 5I2MA 4X62Q 4OX9L 2MI6A 3I4OA 3HKZG 4KUIA 4A4FA 4M77G 3META 2X4YA 3CW2C 3PUXA 4C0FA 2E2IH 1K3RA 4HKEA 1VQKA 1I50H 1W3SA 4IJLA 3OS2A 3OYAA 3P8HA 5M9OA 1OXTA 3FHWA 3QJYA 4NXML 1Y14B 4IOCA 5M5XH 3T1YQ 4C8QG 3L7ZC 4PJOB 4IKFA 1NY4A 2WP8J 4BB7A 2NVXH 5GMKm 2RHZA 3JC66 4C92E 2LT1A 2XICA 1Q82U 1YHAA 1BI3A 2E64A 3PF5A 5EG2A 1Q86U 3M9QA 5LMUQ 2ID0A 4DKAC 4YY3L 3S3OA 1OYXA 5IAYA 2D9TA 1VQ6A 5FU7C 5LJ3g 1JE5A 5EAYA 4IFDI 3UE0A 4DR7L 2PQWA 1VQBA 2JTFA 3I55T 3I56T 5GMKi 4EMHA 1LUZA 4IJHA 3PO3H 4NL3A 3QO3A 3I4MH 2ZTCA 1YJWT 1X65A 4DV4L 4LF7Q 5GAOp 3S17H 1Y71A 2X4JA 2R6GA 3CXCA 3OSSC 3T1YL 4DR2Q 3M9BA 1UB4A 2GN5A 2VNUD 2K5LA 4C0GA 3PFSA 2DUDA 4GN5A 2LC4A 3SFMA 3CMAA 3C95A 3S6WA 5GMKe 4BXXH 1XOVA 2FL7A 5GAOm 2RI2A 2EXDA 3E9GA 3GOXA 4M7AC 3GTQH 2WSCE 4JI2L 1KHCA 1WNLA 4IFDG 4JLGA 4GKJQ 5FRNA 5IWAL 3GLXA 2ZTEA 4BY7G 4JCVE 3AYHB 5GAMe 2UXBL 3T1HQ 4A3IG 3RKWA 2PMZE 1PHJA 3T1HL 3GIBA 4M77A 4HA8A 1IYJB 3OMGA 2Y90A 2JA8G 3RERA 1J6QA 4QW2A 4JS4A 2OAUA 5GMKj 4A4GA 1WJQA 1G3WA 3LGLA 2CZ1B 5FLXc 4A75A 2I5MX 4DQ2A 2JEAI 1I81A 1N6AA 3CCQT 3AFPA 3CCEA 1CKMA 3M54A 5GAN2 4B9WA 2CQOA 2ZPFB 1N32Q 1WFQA 2EQUA 1M1KU 1QP2A 4DR6Q 4X64L 3HOYG 1N33L 2RH2A 2Q2TA 4CRIA 4JC0A 3E1SA 5M3FH 4EMGA 3I4MG 2YV5A 1XMQL 2LQ8A 3J81E 2WB1E 2LNVA 2CKKA 1KQ2A 1N33Q 1M8VA 4IPHA 4M75G 2PI2E 2ZJRA 1IBMQ 3KBGA 3OB9A 3BW1A 4KT0E 2QQAA 4KBMB 4Y28E 1K8GA 2K5NA 2GF7A 1XPUA 2HQLA 3V7RA 4OXPA 3A74A 5JEAJ 4OB1B 3OBWA 3QYHB 4M78A 3S1RH 4ME7A 4DV3Q 4IUTA 3H0GH 4ELYC 3E0EA 3UDFA 2EJ9A 5CIUA 4IO9A 2PVOB 2KBNA 4Z02A 1Z47A 3KF8B 1W4SA 2LQKA 3PIPA 1E3PA 1Q12A 2KY9A 3RUXA 2EYQA 4MZTA 2YTYA 4HCCA 4GY5A 3CC7A 1X56A 4GLAC 1X55A 1BI0A 1Y1WG 1UEBA 2K14A 4C3HH 2HNIA 2MFIA 3KOJA 2O01E 5LJ5h 4HJAA 4LF5L 3JSCA 3INZA 5GMKh 4QIWE 3F70A 1QZHA 4LUVA 3CC2A 1Q46A 1I3QH 2N3SA 5JJKA 3HKZE 2VS1A 4BUGA 3MEAA 4PJOF 4LFCL 4DR1Q 4YHHL 2I2LA 1E7ZA 2R93G 4QJFA 5IP9G 3M4YA 4X9DA 3S1QH 1X6OA 2UUBL 2JTMA 1L1OB 3NTKA 1MJEA 4C0DB 1VQ6T 1KIXA 5GMKl 2GVBA 1NPRA 1OXUA 5LMNQ<