1UEBA

Crystal structure of translation elongation factor p from thermus thermophilus hb8
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of elongation factor P from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
molecule keywords elongation factor P
total genus 40
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1uebA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1uebA03
3P8BB 1HZ9A 5J26A 1Q1EA 1UE7A 1IBKQ 4IFDI 1N36L 4GOPC 1PVOA 3HOWG 1AH9A 1OXVA 4A75A 4BBRH 1NBWA 4QQDA 3G4SA 3IRBA 2UUCL 2VNUD 2VY3A 2HHHL 3M7NA 1Q46A 1Q81C 1KC8U 1KL9A 2ID0A 4HIMA 2I5LX 4LF6Q 1NY4A 3G6ET 4YCUA 4PZ6A 4A3EH 2RF4A 3HOYH 4YTLA 1RL2A 3H0GG 1HR0W 3CCLT 1BVSA 3NBHB 2PQAB 2JA8G 4OO1G 1JE5A 4HIKA 2MO1A 5FLMG 1L2FA 2RCNA 4ME3A 3H3VI 1FGUA 3I7FA 1VQDA 4A3LG 4QIWE 1Q12A 4OWTB 4X62Q 1X55A 5LMNL 4JI1L 1D8LA 3TREA 4R4QA 5C4JH 1ASYA 2QA4T 2GVBA 2WB1G 3D31A 4LF5Q 3PF4A 2DO3A 4Y52H 4HJ8A 4JOIC 3H15A 2UUCQ 4NPSA 1PYBA 4LWCA 1WYDA 3A5UA 2R7ZG 4KHPQ 2IX0A 2AHOB 3CPWS 3CC7T 1PYSB 2D62A 3KF8B 5IYBG 4DR1Q 4LFAL 1G291 2JJQA 2CWPA 2R93H 1E3PA 2R92G 3PUZA 4DV7Q 2LXKA 1E24A 2NVTH 3PGZA 2E8GA 2L3RA 1SE8A 4MNOA 1JJGA 2Q2UA 1KQSS 3NENA 5ELNA 1KXLA 1X6OA 2E2HH 3LGFA 1FL0A 1YNXA 2JA9A 2KCTA 4BY7G 2G3RA 4GS3A 5GQOA 3RLNA 2HT1A 4QJFA 1K3RA 1YJ9A 4IJLA 1PH6A 1L0WA 3UE1A 1S40A 4JYAL 4MTNA 4PZ7A 5IYDG 4IJHA 3U50C 4IO9A 2Q2TA 1W2BS 1TWAH 3WWVA 1YITA 3RN5A 1LUZA 2NVYH 3M9BA 2VS1A 3RR5A 1NMFA 1Y14B 4JI7L 2E6ZA 3I55T 2R7DA 2HIVA 1VQOT 1G51A 3HOUG 1R9TH 2L15A 1HNWL 2B63H 1K0RA 3E9HA 1OTCA 1A63A 1KIXA 2R7FA 1YIJT 1K8GA 2JQOA 1VQIA 3LH0A 1E22A 1L1OC 1M1KU 1X65A 5HGQA 3F2DA 1EWIA 1I5FA 4C3IH 1QVCA 1BBWA 3TEHB 2YU9H 1C7YA 1VQHA 4JI5Q 2ZTCA 1XNRQ 1M1KC 2F52A 1Q7YC 3AYHB 2V1CC 2K5VA 1GKHA 2BA1A 2HHHQ 3PO3H 4R1JA 2LSSA 4DR5Q 4JI7Q 2K5NA 2PNHA 3TQYA 4ZN3A 3S16H 3CMAA 1SMXA 1VQ4A 1C9OA 2I0QA 4BY7H 1YHQA 1Q86U 1VQNA 4EQ5A 4GNXB 1YJNT 5C4XH 1VS0A 4A3IG 1Q82U 1YJWT 3ULLA 3DM3A 2HQLA 4JI0Q 2UXDQ 4QGUA 5DLQE 4A3FG 2K52A 4P72A 3S1QH 4DR2Q 1VQ7A 5LMNW 1Y1VG 5IYBH 5C4XG 1KAWA 1EIYB 2R93G 1TWFH 4JI8Q 5IAYA 1VQJA 1KD1U 1P8LA 4DKAC 3UE0A 3BZCA 4GN4B 4JI3L 3M4PA 3B6YA 2A19A 3J81i 4H02A 2IHFA 1I94L 2F4VL 3W1GA 3S1NH 3G71T 2YV5A 1PV4A 4XIGS 1N32L 4RG2A 3OYYA 5C3EG 4DR6Q 3PF5A 1NJIU 2QEXT 1QVFA 2KENA 3CCJT 1MIUA 4JG2A 4DV6L 3GTPH 2FXQA 2I5HA 2MI6A 2MWPA 2JA8H 3AFQA 4R4OA 2E5LQ 1SR3A 3CCQA 4P74A 3I56A 3CC4A 1AE3A 4LF6L 2UUBQ 2YYZA 4APVA 2WFWA 1EFWA 3STBD 1VQMT 4NXMQ 4A3BH 3RZDH 2JEBI 1E1OA 4A3CG 4OX9L 1OXSC 5C3EH 4GKKQ 3KF6B 2JA6H 3I4NH 2WP8J 3K81C 1QVFS 5AJ3L 2JA7H 4B3RL 2MNAA 4LNQA 3PCOB 3HOWH 4LF5L 1JMCA 3GD7A 1QVGA 2NVXH 1HNWQ 4BBRG 2JNGA 4DUZQ 1PA6A 1X3EA 1NTGA 2IT1A 4BY1H 1C0AA 3K0XA 2VQEL 1VQLA 2OWOA 2GVAA 4B3SL 2RHQB 5C44H 3Q8DA 5GAEC 1MKHA 1HZBA 4LF4L 2E70A 4DNIA 2E2IH 1B7YB 3T1HL 4OXPA 4FDBA 1HNXQ 2OTLT 1Q1BA 1PH8A 1OXTA 5BR8Q 4RG1A 2LXJA 3W5OA 1HR0Q 2WAQG 1CSQA 4IPHA 2ZM6Q 3DB3A 4NB3A 4DV1Q 1XMOQ 1HNXL 1XNQQ 2R7ZH 1QUQB 3S2HH 4O2DA 2ZM6L 1E7ZA 3CP0A 4LFBQ 3PO3G 4X66L 1J5EQ 4JV5L 2Y0SE 3DLLA 1M90C 3ULJA 5AJ3Q 2CWAA 1PH9A 1YEZA 4LFBL 3CCJA 4JI2L 4UP8A 2MFIA 5FJ8H 4A3MH 5M3FG 3HKSA 2JA7G 4JCVE 2R6GA 5A2QE 1IBMQ 3CCVT 3U4ZA 2VQEQ 4X34A 4YWMA 1XJVA 2IX1A 3HOUH 1LM0A 4O0AA 4UP7A 1FJGQ 1VQKT 4BY1G 4LUVA 2JUFA 3HFZB 1Z9FA 3I2ZA 4LFCL 3KDFB 3KLWA 2LVMA 1Q81U 5IP9H 1V1QA 1WFQA 3FHWA 5IYCH 1VQBA 4LF8L 4LFAQ 3M85A 2N49A 1N33Q 1MJEA 1AE2A 3F1ZA 2ZJPA 4X65Q 3AEVA 4AQYQ 5J3BA 1UE1A 2JK8A 4DK3C 1U0LA 2KDSA 3L7ZC 1NPPA 2UXBL 5IYDH 1YHQT 3L2PA 2VUMG 2EIFA 5IYCG 3CMAT 1YHBA 5LMNQ 1B8AA 1HR0L 3ZJYC 4NXML 3JAMi 1VQ5A 4WJ4A 1JT8A 1YI2A 1CKNB 3D0FA 1TWCH 1SSFA 1LYLA 4YWLA 1WI5A 2WB1E 3U4VA 1X54A 3HOXG 1E1TA 1X3GA 2H5XA 3CAMA 1HZAA 4HJ5A 3UDIA 1LTLA 4P75A 2D0PA 1Z47A 4KHZA 5FJ8G 2YTVA 1T9HA 5M5WH 4A3MG 3J81E 2DUDA 2F4VQ 1NPRA 1HH2P 2UUAL 4HIDA 3I4MG 4DV5Q 1X3FA 5LMUL 1VQMA 4JI8L 4BBSH 4JI6L 3JC66 4JBJA 4KI0A 4YY3L 4X6AH 4YCVA 3PIOA 1N33L 3CC4T 2Z6KA 3CCQT 1ASZA 1WJJA 4A3GH 3JAMc 4KHPL 1Y1WH 1JJCB 5LL6S 4YHHQ 4LF4Q 2ATWA 3CCUT 5FLMH 2YTXA 4JI5L 3CF5A 1NJIC 2VW9A 1VQ8A 4LUOA 5C44G 3PUWA 4B3MQ 3DB4A 1IZ6A 4JI4L 3J80c 4A3LH 4QY7A 1K9MU 4DR4Q 3G71A 2PI2A 3A0JA 1JJ2S 1M90U 1OXUA 3J81j 4DV0L 4DV6Q 2ES2A 4LW1A 4POGA 2NVQH 4DV2L 3SGIA 2VUMH 4IPDA 4JI2Q 3J7ZC 1Q8KA 4QL5A 3FKIG 1L1OB 4XTCS 4HIOA 4IOCA 4JBKA 1SRUA 5IP9G 3CCSA 3HOZG 4R4TA 4BXXH 2UXCQ 3GDEA 2UU9Q 4LF9L 2XGTA 1X56A 2AMCB 3EIVA 4GN5A 2BH8A 2PI2E 1YJNA 1MJCA 4PG3A 2UXCL 1N34Q 1UEBA 2K5HA 4IFDJ 1VQ4T 4C3HH 1N36Q 4AIMA 2QA4A 3AQQA 1X9NA 1TWGH 4X65L 1XMOL 3BJUA 4HJAA 4L5RC 5M3FH 4A4IA 1Y1WG 4C3JH 3J80i 3PUYA 2R92H 1JB7A 5JJLA 4TQUS 1YBYA 3UDXA 2QGQA 1J6QA 3PUXA 4DAYB 1UE5A 4DV2Q 2A8VA 4DR5L 4JI0L 2F3IA 4AQYL 3KJPA 1BBUA 4DV3L 3S14H 2PMZE 3UDGA 4A3KH 1HNZL 5JEAJ 3GTOH 5JJIA 3T1YQ 3G6EA 2K50A 3OW2A 2B3GA 4OWWB 2BH2A 3CCST 4GKJQ 2KBNA 3RLOA 1I50H 3I55A 1H95A 3ICEA 4A3FH 5ELOA 1I3QH 1FJGL 1IBLQ 1Y1VH 4JBWA 4PMWA 2IG0A 4YWKA 3H3VH 1NZ9A 3OTOQ 1KQSA 1IBLL 5M5YH 4AYBE 3CD6T 2GN5A 1PH2A 1EYGA 3MEFA 1IBML 1V9PA 4DR3L 4DR6L 4Y7NH 4DR7Q 3CMET 3NEMA 2KVQG 1XPOA 4UY8C 4AH6A 5C0XJ 3CD6A 2DGYA 2VQFL 5IWAL 4MZ9A 1QUQA 4ALPA 1EQQA 4POFA 1N9WA 1IXRA 2VL6A 1S72T 4YCWA 4R4IA 4GOPB 5IP7H 4K0KQ 2Y0SG 2BA0A 3CXCA 5GAHC 3CC7A 1KC8C 4JI4Q 4B3TL 1KHIA 2UXBQ 3E9IA 1Q86C 2JEAI 1EUJA 1WCMG 2OCEA 4JOIA 5K36G 3CW2C 4BXXG 3J81c 3HOZH 3K80C 2CKZB 1A8VA 2WAQE 1VQEA 2JE6I 5GAGC 4BA1I 1VQFA 1M1GA 5IP7G 5IT9c 3PO2G 3RLFA 2Q2HA 4LUZA 3HOVG 1TWHH 3GTJH 1N8RC 4A76A 1VQ9A 1YI2T 1A62A 2NZOA 1TXYA 1EQRA 3K7UC 4NXNQ 4B3RQ 2OQ0A 2HIXA 3MXNB 4OONA 5LMUQ 5IE8A 2N8NA 3KF6A 4TVAB 4A3DH 3E0EA 4DV5L 5GROA 3CCLA 4JC0A 1BKBA 4YY3Q 1XMQQ 3RNUA 1HJPA 3S1RH 2IHEA 4K0KL 1VQCA 1XPRA 3G4ST 1HNZQ 4DV4L 3M4OH 3HKZG 4GN3B 3F2CA 2N3SA 2KCMA 2KHIA 4A3DG 1KRTA 3CC2T 4DV1L 1S3OA 3F8TA 4L5QA 4A3IH 1XNQL 3TRZA 4BBSG 2ZJQA 2IY5B 4AYBG 2OTJA 3CCVA 3AFPA 3KDFA 5H1SE 4DUYQ 4LF7Q 2ZTEA 4X62L 1WOCA 3HOVH 3TS2A 3PO2H 3G48A 1VQ8T 4L5TA 1FVIA 3UDFA 4A3CH 3CCUA 3KJOA 1I94Q 4JI3Q 4A3BG 5DM7R 1VQ6A 1GD7A 4LFCQ 3BZKA 1L1OA 2AKWB 3HOXH 2VZAA 4GLVB 3KFUA 4WJ3M 4OWXB 4DAMA 3CPFA 1CUKA 2AWNA 4LF8Q 4EX5A 1KD1C 2CFMA 2NN6I 2OQKA 3CCEA 1UWVA 3H0GH 3I4OA 1P16A 3OTOL 3HOYG 4NXNL 1SLJA 3L0OA 3GTQH 3HKZE 4RMFA 5C0XG 4DR1L 3J7A5 3CCMA 1VQPT 4IPCA 5M3MH 4HJ9A 3CCRT 1PH7A 3K8AA 1PHJA 2OTLA 3GTLH 2E5LL 1CKNA 1PH1A 4GLXA 4C2MH 1IBKL 2JOYA 4CRIA 1VQGA 3KBGA 1YVCA 2N78A 4GOPA 1QZGA 1PH5A 4GNXA 4GKJL 4DR4L 1QVGS 5IY0A 4B3ML 4LF7L 1VQ5T 3CQZH 2ASBA 1IYJB 1Q7YU 4X64L 4X66Q 1J5EL 3M3YH 4DV3Q 3PSIA 1QZHA 1B70B 2B29A 4R4CA 4A3JH 4DK6C 4A93H 4L5SA 5HY6A 5JEAG 1PH3A 1K8AU 3PIPA 2CCZA 4OO1I 4DUYL 3CCRA 2Q2IA 1VQPA 2K75A 4JV5Q 4DR2L 1YZ6A 1W3SA 3PUVA 2JA5H 1PH4A 4IOAA 4LF9Q 1JJ2A 3PV0A 3TS0A 3I56T 3CCET 1CKOA 5IWAQ 4DR3Q 2E2JH 3GTGH 3GTMH 3S17H 4A3GG 3STBC 1PFSA 1U5KA 1VQKA 1OXXK 3NELA 1EIFA 5FLXc 2MO0A 1SFOH 1N34L 1GM5A 4B3SQ 1NE3A 4IFDG 2QEXA 3T1HQ 1W2BA 1K9MC 2LCLA 3I4MH 4TVRA 3S24A 3EBEA 5M5XH 2JA6G 1XNRL 4X64Q 2RHSB 1VQAA 2OTJT 2XTIA 5FLXE 3EN2A 3GO5A 3ULPA 1HZCA 3CC2A 1XPUA 2I5MX 3VDYA 1WCMH 5EAYA 4DV7L 3W1BA 3A74A 3BU2A 1GO3E 2C35B 2JVVA 1VQ7T 3CPWA 4J15A 4DV0Q 4B3TQ 3T1YL 3KOJA 3M4QA 4A3EG 3FKIH 1IL2A 3J80E 1YHAA 4PZ8A 2D0OA 3I4NG 1O7IA 2A1AA 1G6PA 1YJWA 5M3MG 2UUAQ 4BA2I 1VQNT 1K73C 4ZN1A 2ZTDA 2CQOA 4GKKL 1D7QA 2UUBL 4DPGA 2K4KA 1XNIA 2YTYA 4P73A 3OW2S 1VQLT 5E7NA 2UU9L 3GTKH 3S15H 1SN8A 1VQ9T 2XHCA 4GLAC 5C0XI 2LQ8A 4GNXC 2PQAA 4DR7L 1N32Q 4HJ7A 2VQFQ 4QQBX 1SROA 1GVPA 1XMQL 2KHJA 2NN6G 4IPGA 1YIJA 2K14A 1I6HH 4UPAA 3ER0A 3K7AH 2EQSA 3A5ZB 1VCIA 5IT9E 3FP9A 4A3KG 1KRSA 3LGJA 3RZOH 3CCMT 4KLKA 1K83H 1CSPA 2Z6KC 3KYHC 4JBMA 3F2BA 4DV4Q 1VQOA 4JYAQ 5BR8L 1K8AC 1A0IA 2JA5G 1S72A 5JJKA 1DGSA 1EOVA 3S1MH 2UXDL 4OX9Q 1UE6A 3J7AF 1CKMA 4P71A 1YITT 2Z0SA 2MQHA 2NZHA 1RIPA 3S2DH 2CKKA 2MWOA 2ALYB 1VQ6T 1Q82C 2EXDA 3ERSX 4UP9A 5GADC 4A3JG 1N8RU 1V43A 1XTDA 1YJ9T 4JI1Q 3LGLA 3CMEA 4DUZL 1NMGA 3JAME 3RN2A 3U58A 2B63G 2ZJRA 4YHHL 2AWOA 4JI6Q 4A93G 3CXCS 1K73U
chains in the Genus database with same CATH superfamily
2NWMA 3P8BB 1Q1EA 1UE7A 4IFDI 4K14A 1VQPQ 4QMGA 2F2XA 1OXVA 1TY2A 3HOWG 1SNMA 2COWA 4BBRH 1EEID 1F77A 2VNUD 2FZCB 4NP5A 3PGGA 1Q46A 1Q81C 1KC8U 1KL9A 3ZEHA 4BD3A 1BQQT 1SEBD 2ID0A 2KEDA 3HS0C 2O5IC 5GANf 4UAIA 1ZYRC 4YCUA 5KNBA 4A3EH 2RF4A 3M56A 4YTLA 1H8KA 5CK9A 1T5EA 1IXDA 1EFID 4ZUJA 2X6GA 4IURA 3BW1A 3SHLA 1HHVA 2EY6A 2RCNA 1MV3A 2M0YA 1FGUA 4M7DG 1PTOH 1VQDA 3H3VI 4HA8A 1X3QA 3NP8A 1ZEQX 1LLRD 5D6WA 2H8HA 1H9MA 4R4QA 2QXFA 3CBOA 4I65A 3D31A 3T9NA 3BVMA 3ITPA 1UGSB 4LWCA 3A5UA 3QO2A 2QDYB 2EZVA 2AHOB 4LFAL 2J0TD 3GTOB 1V29B 3I70A 3KF8B 2DTHA 2J4XA 2BIVA 3VUZA 1PRTB 3M0RA 4BBSB 1E3PA 2ZCFB 3PUZA 1I6VC 4HAEA 2ICIA 4DV7Q 1DJ7B 2P4TA 3C2PA 2NVTH 2QGFB 1JJGA 5CQXA 2LNHB 3M4GA 1KXLA 2EQJA 3SB2A 2C0TA 2K4YA 1YNXA 3TZDA 3S2HB 4GS3A 3RLNA 1Y96A 2HT1A 2DAQA 3X26B 2K2MA 5FOBB 1PH6A 2ZXRA 4JYAL 3I72A 2HMAA 4IO9A 1EWHA 2RPNA 5C4HA 2YUNA 2DIQA 3WWVA 2XWJB 2Q2TA 1LUZA 2MPXC 2GQIA 2NVYH 1MI2A 5CORA 1JXMA 2F4IA 5IT9L 4C3HH 2G6FX 1PD1A 4BACA 2E6ZA 5CKBA 3F70A 3I55T 4OGQC 4KMUC 1H9SA 4C1NK 2LTOA 5IODA 1R9TH 3WXMB 1GUGA 1BCPB 1GFCA 4ME7A 1Y96B 2B63H 5CO7A 2KA7A 1F2YA 2R7FA 4IUTA 4ANJA 1YIJT 4CC4B 1MUZA 2DL5A 2O2OA 2B2YC 2JQOA 2E65A 3OYCA 2E2JH 4XAXB 1NLPC 2AZSA 3S1QB 1PFNA 2F0IA 4CC7A 2O4XA 3TEHB 2YU9H 1K8MA 1MV0B 4BE2A 2ZTCA 1M1KC 4M1UB 2SRCA 1XNRQ 2V1CC 2ABLA 2B2TC 4OMNA 2BOSA 2LSSA 4PJOB 3EFRA 4XT3B 3TQYA 4OB2B 3CMAA 4XK8E 4FYWB 1YHQA 3N5BB 1ABOA 3L1AA 2XN9C 3FIFA 1EZZB 1UNSA 5C4XH 1HTLD 1G6ZA 4F7UB 4C0DC 3CRKC 5D7UA 1JQQA 3PVQA 4JI0Q 1RABB 2L2PA 2VWFA 1CA6A 4ZUIA 3VS7A 3JCMe 3OS2A 1IRXA 3SXHA 5LMNW 3QG1A 1GL5A 4DR2Q 2B2UA 1MMGA 1EIYB 2R93G 2E6NA 4HVVA 1VQJA 4M7AF 1KD1U 2PU9B 2EJMA 3EROA 3BZCA 4GN4B 2HBPA 2RK2A 4OMFB 3JB9G 1LT5D 4OHJA 4JI3L 1LTSD 1EIGA 3KLRA 3SK4A 3HRTA 3OBWA 2HNIA 2A3LA 5C3EG 3OYYA 2K1BA 4A3JB 1EL0A 2K33A 4PJOF 3D4DA 4I7AA 1X43A 3REBB 1MIUA 1VMCA 3QB3A 1A6XA 2ZXOA 1OPLA 2FXQA 4C3HG 1CZGA 2MWPA 1BCOA 2Z1CA 4N8X1 3AFQA 3DUZA 1GUNA 4K2LA 3CCQA 4E7ZA 4P74A 4RFBA 2JS0A 1HSQA 4C8QD 4E47A 1KABA 2EJGA 4APVA 1YJWQ 1SEMA 3STBD 2GFUA 4A3BH 3ASKA 2RM4A 2F2VA 2WV6D 4MZTA 4DQ2A 1E1OA 2M9VA 1AOJA 4NDXA 2ED0A 5C3EH 4OX9L 1BCMA 5D14A 2JA6H 3I4NH 4MMLA 1E2ZA 1UDLA 3QJYA 2YXYA 2V1QA 3T53B 2X3WD 1PA6A 2JA8B 5EKKA 2F0EA 5KYNA 2YUOA 3S1NB 2RHQB 4FSXA 5C44H 1B3AA 1MKHA 4G4KA 4J5YA 2YRCA 1B7YB 3T1HL 2WIIB 3OOCA 4OXPA 1I8FA 5A0GA 4BY6B 4IALA 1Q1BA 1OO9B 3REAB 1OXTA 3NBHA 1FGBD 4RG1A 4OMOA 3D3RA 1OQKA 1CSQA 1J3TA 4IPHA 4DV1Q 5GAN8 5LJ3h 2Q8IB 4GLKA 1HNXL 1IYUA 3S2HH 1A3TA 1JWMD 2Y0SE 3DLLA 1M90C 4HCEA 1HA6A 1OX8A 2CUBA 1YEZA 2HL3A 3CCJA 2XU8A 2F0NA 4JI2L 4FF1A 1T3LA 5M3FG 1CI3M 5E4XA 1UE9A 1V1PA 2R6GA 1QP2A 3QWYA 4FXDA 5GAN4 1X6BA 1Q81R 1LTID 3RIRA 4X34A 1XJVA 2IX1A 2KROA 2Y0SB 1WTPA 4KGZB 4BY1G 3ND8A 3OYLA 1TR5A 3HFZB 3I2ZA 4LFCL 3KDFB 2ZPEB 3QDRB 2CUDA 1Q81U 3P20A 1S1NA 4C8QE 3V2TA 3EG2A 1V1QA 1ABQA 3HG9A 1VQBA 1VF5C 2HDLA 5IYCH 3M85A 3BFMA 1YP5A 2ZJPA 2H4OA 2HQEA 3CCUQ 2FVUA 3NQTA 2JK8A 1U0LA 2KDSA 1ENFA 1NPPA 2J7IA 2M00A 2UXBL 5IYDH 5GANj 1KNEA 5T1GA 5IYCG 1LTTD 2FB7A 2HDMA 5CMDA 4C92F 3VRZA 2WB1B 3MXUA 1VQ5A 4GZYC 1IGUA 2KBTA 3WVDB 5GAMg 2BE5C 1JT8A 4MDWA 3MEAA 1LO5D 2QI2A 2FZGB 2DETA 4HJ7A 2H5XA 1EIHA 1HUNA 4L5GA 1T9HA 5G3LF 5M5WH 5GMKi 1T3SA 1YI2Q 1HH2P 2XDPA 5ELFA 4HIDA 1D3BA 5GAOp 1Y8NB 1K73R 1HCZA 4CDDC 1R77A 4X6AH 4HT9A 1VQ4Q 2Z6KA 5CV4A 4LDXA 1WJJA 2EY2A 4ZCKA 4KHPL 1Y1WH 5LL6S 3OYMA 4AT1B 1VIFA 2DRMA 2GCXA 1CZWA 3CCUT 1A15A 2AQ3B 3LH5A 2VVKA 4JI5L 4CJ2C 4B3MQ 4A3LH 5CV5A 1FWZA 4DR4Q 2RHIA 2ES2A 4Z9CB 1SYFA 1OXUA 2NVQH 1U1TA 1N27A 1EZ6A 3L2WA 3O8VA 2I2LA 4HCCA 4ZQ3A 3NTIA 1CK1A 4GLMA 2LCCA 2QW7A 4HIOA 4IOCA 4JBKA 4PNYA 2DJGC 5IP9G 3CCSA 2JW4A 3HOZG 4LF9L 2XIWA 2H3JA 2AMCB 4IIMA 2PI2E 3SK8A 1YJNA 3GBQA 2UXCL 3I3CA 4A4KA 1D0XA 1VQ4T 2RI3A 2PNRC 3EFOB 1RAHB 4HJAA 2QTVA 2NVQB 4A4IA 2A6EC 2K7VA 3J80i 5C3WA 4BI8B 3PUYA 2R92H 4CDEC 1JB7A 1R0BG 5JJLA 2QGQA 2P0KA 3R2TA 1UE5A 2KT8A 4DAYB 4QUCA 1MGSA 1STEA 1TWFB 2F3IA 1EEFD 3ERQA 4DV3L 4M7DD 3UDGA 3JCMf 1VIEA 5JEAJ 1C6VX 5HKCA 4OGCA 4LMQD 4KY6A 1W4SA 1IO6A 5GANh 3S14B 1I50H 1H95A 4ELYC 1IBLQ 4YWKA 2WKCA 3OTOQ 1KQSA 2JA6B 3LX0A 4JJCA 1Y69U 4KH0B 2EDGA 1PH2A 1EU4A 2EWNA 2FPDA 1GFDA 2NTTA 3MEFA 1WFWA 1WJSA 4HT8A 1PSFA 2LNVA 3IKJA 3PMFA 4KJOA 2KVQG 2OEOA 2DXUA 4RH6A 4C3HB 1XPOA 3HL8A 2X35A 3I5SA 2QG9B 1C48A 1FNUA 2QQSA 1PDQA 3VUBA 3W2DA 1BCPC 3GP7A 1Q82R 1TS3A 1W6XA 4MZ9A 1RODA 1PKSA 2DMOA 3M54A 4ALPA 2VL6A 4B9XA 1S72T 4DXFA 2LDMA 1WLPB 4M7DC 5I21A 4KHVA 5K36H 3NWTA 4K0KQ 3CXCA 2E3IA 5FU6B 1KAAA 2HCIA 2E12A 2BDOA 4JI4Q 1EUJA 4CI0C 2PMZB 2AKLA 4XXEA 1T0HA 1LPLA 3HOZH 2CKZB 2WAQE 5GAGC 1KQ1A 3PO2G 3K57A 3CXCP 2EYXA 1V1CA 4WTOB 1N8RC 3META 5GJWB 3EGDB 2B86A 1TS2A 2OQ0A 4B3RQ 5LMUQ 2IIMA 4HSPA 3JCMP 3QOJA 5GROA 2A6HC 1Q86R 5CC4A 1EY7A 2D9TA 3CCLA 4HVWA 1I4XA 3L9AX 3HOXB 1BKBA 1WIEA 3MEUA 4HKEA 3C1FA 1UJ0A 2HBWA 4JLIA 1B9MA 2Z0WA 2LX9A 1K9MR 2IHEA 4J83A 4JUVA 1G83A 4E7KA 3M4OH 1SJHD 3CU7A 2N3SA 2KCMA 2KHIA 3OWEB 2B63B 1QCFA 3MKDA 4F04B 4A93B 1KNAA 3TRZA 1VYTA 1BIAA 1LACA 2DL8A 2ZTEA 2XWBB 4O1NA 3HOVH 4ILWA 3UDFA 4C3JG 4HN7A 3HP9A 2NUPB 4JI3Q 5A0LA 5KYXB 1GD7A 1L1OA 3M3YB 2DIGA 4PNOA 2MIOA 2JTEA 2EGAA 4M77D 1VOMA 5IHIA 4GLVB 1N36Q 2MJ8A 1BBZA 2OQKA 3OTOL 3CHBD 2QYZA 1UWVA 3QDFA 3HOYG 4NXNL 1WHMA 2QK0A 5C0XG 4DR1L 2FYKA 2DX1A 3J7A5 3CCMA 4HJ9A 3K59A 1PH7A 4RKUE 4FF2A 2VUMB 2OTLA 4M7DB 4M75D 5AT1B 1CKNA 2M9UA 4GLXA 2YT6A 4X9DA 2EW3A 4MHEA 5M5XB 1AWOA 5FRMA 1PH5A 1I50B 3NGPA 4GNXA 1X2QA 4G57A 4GKJL 4DR4L 2CZ7B 4ZGJB 3MTSA 4DEXA 3CC2Q 1VQ5T 4HCBA 3CQZH 2ASBA 1LVKA 1Q7YU 1D1BA 1LV9A 4JZ3A 3V96A 4A3JH 3EGXA 1GCPA 2QDLA 4A93H 1PH3A 2XVSA 3V05A 4RTVA 3K58A 3EFXD 5FWCA 2HSPA 1Y8PB 3OMCA 2E64A 1G5VA 2K75A 3BZDB 4DR2L 3VR3A 2BTTA 1FYNA 5CV9A 1WNLA 4LF9Q 3G1JA 2FJ2A 3I56T 3AT1B 4DR3Q 5IWAQ 4B3SQ 3S15B 1EIFA 3KFVA 1MNEA 3EG3A 3Q1JA 3V8LA 2BUDA 1LABA 2DN8A 1NE3A 1WD0A 1Y1VB 3A8KE 1XWEA 3C95A 2DYBA 4ZGEB 2RI5A 2Z4IA 1QVGP 5M5XH 2XTIA 5A0DA 1FR3A 3ULPA 5M9OA 1ACMB 4DA4A 1HZCA 3OYEA 3OW2P 2ZGWA 3RZDB 3OYGA 3A74A 3BU2A 4KJNA 3WOFA 4DV0Q 4XTVA 5GAMf 2YU9B 2FL7A 1SRMA 1TUDA 3FKIH 3Q23A 1CTMA 2KVMA 3TP8A 3I4NG 2LRQA 2A1AA 2TSSA 4C1NI 1G6PA 1YJWA 5I6YA 1E2WA 1K73C 1D7QA 4RCNA 3NTHA 4HMJA 4DPGA 2RSNA 1XNIA 1JOOA 5CKEA 5E7NA 2UU9L 4JJBA 4LNPA 1ZKOA 2DJFC 4OB3B 4BB7A 2DK3A 3MZ5A 3K5OA 4DK1A 1GUWA 2K7AA 1M8MA 2CP6A 3HOVB 1JBMA 2BZ8A 2R58A 5D6XA 1BBXC 2NN6G 4RKLA 3FRPB 1O7YA 4UPAA 3HFNA 1EY4A 3A5ZB 4M7AB 4PFZA 1JWSD 5IT9E 3A8IE 3FP9A 5C5MA 3BS1A 2RDHA 4A3KG 4KLKA 3O5ZA 1ZYRD 1BU1A 4ZTFA 1X3PA 3KYHC 3J80L 2AQ2B 2RHUA 4FU6A 2KXDA 5C6AA 3VYRA 5KYWA 1S72A 2NVTB 1NEGA 3S1MH 1IHWA 1WHGA 2QF7A 1K76A 4M78F 5D3DA 5I9PA 2Z0SA 2JP1A 1BB9A 5FW9A 2CKKA 5JJZA 3ERSX 4UP9A 4A3JG 4K8JA 2J6FA 1YJ9T 4IIOA 3N6RA 4DUZL 1WTOA 2VGMA 2W0ZA 4WCIA 3JAME 2RMOA 4NOYA 1TT2A 1K83B 2F0PA 1N36L 4VUBA 2K6AA 2DBKA 3PFSA 4M78E 1JU5C 3MPUB 5IIFA 4GOPC 1PVOA 3IRBA 3G4SA 4JJNK 3LLRA 2A68C 2NBFA 2VY3A 1Y57A 1ZQ1A 8ATCB 5DEHA 3M7NA 1X01A 4LF6Q 5I2SA 3PE0A 3G6ET 3PO2B 5ELDA 1W70A 3TSWA 1V1OA 3HOYH 4K2KA 1KHCA 3NBHB 2JA8G 4LXCA 2MO1A 4XTXA 1JJ2P 3BVZA 3L2ZA 3KF8A 2EFIA 1N9RA 4ME5A 1HFNA 1VQMQ 1Z9QA 1D3BB 1X55A 4ZRZA 1ENCA 2FHDA 5CCAA 1WA7A 2PVDB 2A37A 5HK3A 1E7OA 2DERA 2AUJD 2FMCA 5C4JH 3PF4A 4Y52H 1TUCA 2JM9A 1UEAB 2UUCQ 1PYBA 1V1PB 2JJ9A 4RCCA 2PZ1A 4KHPQ 1PTOC 3G6JB 5IYBG 4DR1Q 1H3HA 2K3BA 3EG9B 1G291 2NVXB 1PYWD 2IL8A 2PCFB 1YCYA 1S5FD 1K9AA 2CH4A 2P4RA 4OGEA 4RMOA 2LXKA 5GMKm 1E24A 2PZUA 4QVDA 1GHJA 2XI9A 1G8XA 1SE8A 1PHTA 1TXQA 1KQSS 1SNDA 2C9OA 3HSBA 1M3AA 1D5XC 4OEMB 2KCTA 4F8MA 2E2HH 4BY7G 2COZA 5EG2A 1EU3A 2EQMA 2QKIC 4QJFA 1K3RA 1U5SA 2QAZA 3L2VA 5ELCA 3EG9A 1TWAH 3WVEB 1LTRD 2BE7D 5J1ZA 4V190 3TZUA 5GANe 1NMFA 3MFGA 4EMHA 1YFNA 1MBYA 2LT4A 1VQNQ 3OSOA 1BOSA 1GJXA 5A35A 4OVAA 4BE0A 2KAFA 3DKMA 3HOUG 1CHPD 1HNWL 2CDTA 4PL6A 1OTCA 5LJ5f 2LP5A 4H44C 2J05A 3U23A 2GA4B 3LH0A 1VQIA 3F2DA 1L1OC 5HGQA 4KUIA 1FYCA 3BDLA 1EWIA 2D8HA 4H0LC 3AB9A 1QVCA 5M3MB 1C7YA 1VQHA 1ZX6A 2NWGA 4IUNA 3PO3H 1Q7YC 3AYHB 2WACA 1TUGB 2K5VA 3I4MB 4DR5Q 3CCMQ 3MP1A 3NSWA 2K5NA 1XJWB 3S16H 4RG8A 5FU7B 2I0QA 2PNIA 1VQNA 4EQ5A 1SSOA 3GV3A 4A3IG 3VYGA 3D6WA 2LKVA 1BCPD 2F0DA 3ULLA 1AFPA 1DZ1A 1IW7C 2FRWA 4PJMA 1PD0A 2HEQA 5DLQE 1VQ6Q 1SYGA 4K8IA 1S5BD 4P72A 1STGA 1VQ7A 1Y1VG 3M9QA 1R8OB 2DILA 1JB3A 1F2ZA 1KFZA 2QILA 1JOQA 4EPCA 4JI8Q 4C0DB 2E2IB 3UE0A 5E1FA 1I94L 2JA5B 1PSEA 2ATCB 2I07B 4H02A 3MEVA 4J9DA 1FMKA 2B2WA 3W1GA 3S1NH 1WHLA 4E7LA 3G71T 2O01E 1D1IA 1PV4A 1O7LA 5FRNA 1HJDA 2MGSA 2QEXT 1NJIU 1QVFA 4K5WA 3CCJT 3QSUA 4MN3A 2I5HA 1TKWB 2MI6A 1RAGB 3F2UA 4PMCA 3I4NB 5L23A 2RNAA 3WOEA 2L5TA 2E5LQ 4F17A 1YNJD 3DEOA 4HMIA 1WPYA 1A3VA 2YYZA 1DYQA 4J8OA 1EFWA 4E7SA 4GKKQ 3M58A 2I0NA 3M0UA 3KF6B 4B08A 1QVFS 5AJ3L 5FU6C 4DU9A 1LCKA 3K5MA 3PCOB 1JMCA 5KYYA 1PXUA 2IPKD 5EKIA 1HNWQ 2JNGA 1WQWA 2IT1A 3T56B 1PFBA 1C0AA 3EH1A 2VQEL 1VQKQ 2O88A 1JRIA 5D65A 4A3KB 4NL3A 3FJ5A 1HQRD 3G71Q 1QNKA 5GAEC 4DNIA 1PC0A 1SE4A 1EYDA 2DA9A 2A69D 4K6DA 1HNXQ 1OU8A 3IQLA 1RKNA 4HSVA 2WAQG 3DB3A 1XNQQ 3GTMB 2DKGA 2JXBA 2RHZA 1NYGA 4O2DA 4RWSC 2X4YA 2ZM6L 1E7ZA 3CP0A 4PK4A 5IHNA 3AHUA 1JWUD 3Q0AA 4CGYB 1D09B 2E5QA 2JSOA 2ZPFB 4HCZA 4LFBL 1WJRA 3LW5E 3P8HA 5LL6X 1PZKD 4JCVE 3UF4A 3HEJA 4AYBB 2LQWA 3H0IA 3X24B 3CD6Q 3EAEA 1TWBA 3H6ZA 2ROTA 4JRQA 1LM0A 2QQRA 2HDAA 4LUVA 2JUFA 4FXKC 3TSSA 5D3IB 1G2TA 2DBMA 3QWXX 1BDOA 1QILA 2AQ1B 2B2TA 1WFQA 1N33Q 4F87A 3EG1A 2N49A 4ZAIA 3K5LA 5IXBA 3VKIA 1AE2A 1MJEA 4X65Q 4LAAA 5GMKj 5GMKl 3NUCA 4DK3C 1H9KA 1SE2A 3L2PA 2EIFA 3CMAT 2GF7A 5LMNQ 1B8AA 1TIID 1HR0L 3JAMi 4J9EA 4X3TA 3HHTB 2K79A 4WJ4A 2WSEE 3ZFJA 1GBRA 4TSSA 4G7ZC 4AFZC 1CKNB 1TWCH 1SSFA 4LN2A 1LYLA 4QIWB 2WB1E 4DAPA 1X54A 3HOXG 1E1TA 3CAMA 2UXDL 2R7ZB 1HZAA 2LY7A 2SNMA 1LTLA 2J06A 1DOKA 4KHZA 5I9OA 1JEGA 1RJTA 3OQ5A 1I4HA 3I90A 2E10A 5GAMh 4DV5Q 4BBSH 1VQMA 2IVWA 1ONLA 2F1MA 2Z8LA 3OPOA 4JI6L 3JC66 4JBJA 4YY3L 3RMQA 3MXPA 4YCVA 2YWWA 3Q22A 1N33L 1DONA 3TMEA 1WXTA 3INZA 3EQLC 2K2VA 4LK1C 1K8OA 3JAMc 5C3EB 4BY7B 3R6OA 2DTOA 1DXMA 1EQTA 3VYTA 5I22A 2E41A 2GGRA 4PLIA 2DZ9A 4A3GB 5FLMH 3OS0A 1CFMA 2VW9A 3OYAA 5C44G 3DB4A 1IZ6A 5A2QL 3G71A 4JI7L 2RI2A 2DTIA 1MMAA 1JJ2S 2JS2A 1KIKA 1PLFA 2VUMH 4DV2L 3FVQA 2GTJA 4OO1H 4PLLA 3J7ZC 1PCXA 1U4PA 3OSSC 3CCSQ 4N4IA 3HOUB 1NLOC 4PMBA 3PNWC 2E2DC 4V0BA 3JCMW 1G3SA 1SPKA 1M27C 4QL5A 5BN5A 4B9WA 3FKIG 3J7AV 1L1OB 2NUTA 4XTCS 2CP2A 2XG8D 3JSCA 1CSKA 2KECA 5BN3A 4C0ZA 1KJWA 2IX3A 3GDEA 2UU9Q 4BXXH 3SR1A 1RHPA 2EE1A 4Q5VA 1X56A 1QP3A 3AU7A 3GTPB 3SK5A 1OX9A 1BO0A 2ZZDA 3NK9A 3OYNA 1H9JA 1N34Q 3CC4Q 1HXYD 2NUZA 4RUGA 4QT7A 3EHQA 4Q5WA 2D9UA 3AQQA 4KTAA 4AIMA 1IYVA 5KYUB 4LJZC 4IUVA 2YDLA 3C12A 3URYA 4L5RC 3UDCA 4ELZC 3M4OB 1SYEA 4RTXA 4TQUS 3UDXA 3DXJC 1J6QA 2B2YA 3PUXA 4DV2Q 2A8VA 3A56A 5FO7B 4AQYL 2HD0A 5GAOl 3MWYW 3S14H 2RHXA 3GTOH 1E6HA 5JJIA 3G6EA 2LMJA 4A4GA 1MNDA 3GNGA 2LMCB 4C8QF 2KBNA 3RLOA 2MCNA 2ZPBB 3ICEA 5ELOA 2QTXA 2LC4A 8AT1B 3A7LA 4C2MB 5KNCA 1T0JA 2LJ1A 2M1HA 2DEUA 3SWNC 4IZ8A 1IBLL 3TU4K 2K05A 2KCNA 1I6HB 4B6MA 2LZ6B 1G3YA 3M0PA 3CCEQ 4PJJA 4RTZA 3JCMc 1ESRA 1SXTA 1IBML 1RLPC 2BZYA 4ATOA 3FPUB 3WDNA 4E7JA 3S3OA 2EYLA 3X3MA 4UY8C 3MFYA 3OS5A 1F2MA 4C5EA 3A8LB 2DGYA 4KD4A 4D8KA 1IXRA 2D8JA 1NJIR 4O5VA 5GAMd 4RCBA 1OU9A 4YCWA 3CQZB 3DM1A 4GOPB 2Y0SG 3T16A 3CC7A 2L8DA 1KHIA 1XQHA 1Q86C 2JEAI 1G2BA 1H92A 3ZYYX 1JOKA 2EKOA 1A8VA 4CC2A 5C0MA 1VQEA 4AG2C 3EGDA 1PRLC 1VQFA 2RN8A 1VQ8Q 3EVQA 4FVMA 3RLFA 2Q2HA 3HOVG 3QYHB 3FC3A 2HCCA 4M75A 3QWNA 3NMZC 1F2LA 1YI2T 2NZOA 5KCHA 5GANd 1EQRA 1TXYA 4XQQA 1KG1A 2X4WA 3K7UC 4NXNQ 4OONA 2HIXA 1ILPA 1FD7D 5ELEA 3VR5A 2E5KA 2DLPA 1VYVA 3OYFA 3EGUA 4TVAB 1SNOA 4DV5L 2AKKA 1N5ZA 3U9SA 4D6WA 3CCQQ 1XMQQ 4YY3Q 2ECZA 3H41A 3VA7A 3SVMA 1H641 2K3YA 4TRDA 3S1RH 2CGHA 3RBBB 2LCSA 3JCMQ 1VQCA 2DXTA 3BDUA 1XPRA 4DV4L 3FMCA 3DLMA 4DOVA 3HKZG 4GN3B 2ICEC 4N0AC 2MK5A 1I4K1 2P0PA 2V8KA 1X69A 3NHNA 3F2CA 4FYDA 3M59A 1S3OA 3RR6A 3EA6A 1C0MA 2CZ1B 3F8TA 4L5QA 4A3IH 2IY5B 5J22A 4IUPA 3CCVA 1Q3LA 4C5HA 1HK9A 1QJOA 4X62L 1YNNC 3TS2A 3EHRA 3RNJA 3PO2H 4L6V5 4L5TA 1FVIA 5I2YA 3CCUA 3LWUA 4C0GA 1LT6D 3QKJA 1STHA 4G7HC 2X3XD 4AFUC 4OB0B 5CR2A 2AKWB 2K28A 5IGGA 3KFUA 4HCKA 3CPFA 3I9QA 3ZBDA 2DM1A 1CUKA 2AWNA 2K5DA 4EX5A 1KQ2A 5IH2A 1EYAA 2CFMA 2NN6I 3TBIB 3I4OA 5JVG3 2FO0A 3L0OA 2Z4HA 2PPBC 3TVTA 3HKZE 2A7YA 4RMFA 5CKHA 4BDZA 3SFMA 3CCRT 3K8AA 4J8QA 1QCNA 1YCSB 2KY9A 4PJOA 2JMAA 4DAVA 4LDUA 4C2MH 1X75C 1IBKL 2IJ0A 3G7ZA 3H0FA 3KBGA 4GOPA 5GAOm 4J6WA 5AFWA 1B7TA 1P92A 3TCJA 2KJXA 3S1MB 4M75G 2ZPHB 1Z9ZA 4LF7L 3CCLQ 4FF4A 5KIXA 3M5AA 2C5CA 1IYJB 4M7AC 5EC7A 1QE6A 3PSIA 4J9FA 2B29A 2CHBD 4CHTB 4DK6C 2MYSA 4CJ0B 1Y1WB 3H09A 4OO1I 2KE9A 4PJOC 3NTKA 2K5QA 1F1BB 3GTKH 4F7UF 1BI0A 1YZ6A 1UHFA 4N9TA 2JA5H 1HA5A 2QGGA 4F7UG 1QB5D 3TS0A 3CCET 1CKOA 3STBC 4Z89A 1U5KA 1S5ED 1OXXK 1N34L 1AZGB 1EFNA 4BY6C 2MO0A 1GM5A 1D5ZC 1T5XD 3DHQA 1PFMA 2RQUA 2MF2A 5LJ5g 2R93B 2LCLA 4TVRA 2K5FA 2K04A 4X64Q 2DVEA 1SMYC 4M7DF 3O13A 1NE8A 5FLXE 3GO5A 4C5IA 4O42A 3FKIB 2PUKB 7AT1B 1XPUA 2I5MX 3FLGA 3PTAA 4RGMA 3M0SA 3E0JA 4F7XA 1VF7A 3VDYA 5EAYA 4DV7L 2VYTA 2E1HA 1GO3E 4J15A 1VQ7T 3CPWA 5KYUA 4MDXA 3KOJA 1NCVA 1ENAA 3SEBA 1YHAA 4PZ8A 2DXCA 1M30A 3QHSA 2Z6BA 3UWNA 1SJED 3K0YA 4DOWA 1M5Q1 1WHKA 1RUWA 4OIKA 2UUAQ 4BA2I 2JTFA 1VQNT 4Y92A 1TU2B 2B2WC 5TSSA 2CH4W 1YWOA 4ZN1A 2ZTDA 1DD2A 2XK0A 5D6YA 2LQKA 2F5TX 3A7AB 1D6EC 3KLSX 2UUBL 2YTYA 1SFOB 3OW2S 1K4US 2KI7A 4A3IB 1SN8A 1VYUA 2XHCA 1BYMA 5C0XI 2LQ8A 4GNXC 2E2HB 1B1ZA 4QQBX 1SROA 3VS2A 1S5CD 1I6HH 1ZXTA 2CSIA 4PV1C 4ZK9B 1PMRA 2HL5C 2L12A 3PT9A 3CCMT 3P8DA 2J7ZA 1R0CB 4DV4Q 3E1SA 1VQOA 2F0SA 5BR8L 1QVPA 1A0IA 3OW7A 4R8NA 1NR4A 5JJKA 1DGSA 1HUMA 5FO8B 3CBPA 4OX9Q 3NFCA 3J7AF 4P71A 4PQXA 4QQGA 1RIPA 2NZHA 2ALYB 4EQOA 1LTAD 1I1JA 2JZ2A 3A8MB 4JI1Q 4BI4A 1RCVD 4JI6Q 1SG5A 3TSZA 1S4ZA 1Y8OB 1NBEB 2ESWA 4RHSA 1WTXA 1IBKQ 2RHYA 4MZMA 4CDFC 4Z88A 4JI5Q 1AH9A 4KN7C 1OZ2A 1CM9A 3R93A 5GAN5 1B53A 2K9GA 3MVVA 2WINB 2UUCL 1G2SA 4QW2A 4A3BB 3TDQA 2AHJB 4J9GA 3I91A 5JVH3 4HIMA 2I5LX 3C46A 3KBXA 4ID6A 1LT3D 1NY4A 1A2UA 2X4JA 4M7AE 1LJOA 1KDAA 1EY9A 4JDSA 1TS4A 3H0GG 4FF3A 4OO1G 4DXGA 4HIKA 4FSSA 5GANg 3ZL7C 1D1AA 5L37A 3I7FA 1KK7A 4QIWE 1Q12A 4X62Q 5LMNL 3JB9F 2EPBA 3C1EA 4JI1L 1D8LA 3DWAA 1MSHA 1QKWA 2DD4A 4BUGA 2QA4T 1SE3A 2WB1G 4LF5Q 1O80A 1X6GA 2WAQB 2K6DA 1JE4A 2JN4A 4EGVA 1ML0D 2KK4A 3H15A 4DF7A 1WYDA 2OF1A 2IX0A 2XRSD 2CREA 3CC7T 4JRKA 1PYSB 2D62A 3G7LA 4J9HA 4KBMB 2CWPA 2R93H 3GF5A 2CSQA 3GNFB 1O78A 2A08A 2R92G 2OTLQ 3LWIA 3PGZA 2OTJQ 1XOVA 3ME9A 4NL2A 3G6EQ 1QWEA 2EVRA 3NENA 1X6OA 1TH7A 1WXUA 3LGFA 4DEYA 2CP3A 5FWBA 1B34A 1FL0A 1KC8R 1FMVA 1UUEA 2G3RA 2L9HA 2F0LA 1YJ9A 1L0WA 3UE1A 3FB9A 4JLGA 5LJ3f 2FMMA 3FPPA 4IJHA 4MTNA 3NHHA 4PZ7A 2PO4A 3U50C 2RDGA 5GMKe 1RAEB 3UA6A 1W2BS 2JN0A 1ZBXA 3M9BA 2XICA 2VS1A 4IUUA 5HK0A 3RR5A 2QA4Q 4C5GA 4V2SA 3QO3A 4M78A 2R7DA 2F0UA 1STBA 2HIVA 2HUGA 1VQOT 4YIJA 1QNUA 2L15A 3QZ9B 5E4WC 2Y90A 3TP5A 2FPEA 1A63A 1KIXA 3RKYA 4HCSA 2P5ZX 2EYHA 4FYYB 4RTYA 4IKFA 1HD3A 1Y71A 1BBWA 3CCJQ 1I5FA 1SNQA 2LS01 1PM3A 5L8RE 4FXGC 4PJNA 1RI9A 2LT1A 3H0HA 2OT2A 1AT1B 1SSHA 4BY7H 5HGTA 5KYIA 2C0IA 2GFAA 4LE9A 1C9OA 1Q86U 3DEPA 4FL6A 4CKCA 4GNXB 1YJNT 1VS0A 3LNNA 1YJWT 3QIIA 1OOTA 2HQLA 5JOBA 2D2CC 4QGUA 2A69C 3E6ZX 3HGBA 4K11A 1PRTF 3EG0A 4M7AG 2ENBA 5IYBH 3W3AA 5C4XG 5GMKh 1KAWA 3I55Q 4P5NA 4OMMA 2COYA 5IAYA 1Q95G 1P8LA 4DKAC 2J6KA 1I07A 3P7JA 4K5VA 3M4PA 2IHFA 2F4VL 2RJFA 2RDFA 1WXBA 2YLCA 3OHXC 2B8GA 2LX7A 3C4SA 2QASA 1CHQD 2YV5A 4M77A 4XIGS 5FROA 1N32L 4A4EA 2L3SA 4DR6Q 1TTHB 2AK5A 4JG2A 3NPPA 4C3IG 4DV6L 3GTPH 3VR4A 1E2VA 2A6HD 2PW5A 4R4OA 1PRMC 2DYIA 2JA8H 3I56A 3X20B 1AE3A 1GXDC 3TQ7P 4QVCA 5COYA 4XU3A 2SEMA 1VQMT 4NXMQ 4C92D 2JEBI 4QB4A 1OXSC 2EQIA 2KUMA 2WP8J 3K81C 2FFKB 1BF4A 4LNQA 2PQEA 5CIUA 1F9RA 2M51A 2DNEA 4C92A 4LF5L 2KEAA 1VA7A 3GD7A 2NVXH 2PVGB 4BBRG 1QKXA 1TSFA 4BY1H 1J8IA 3K0XA 2Y4XA 1VQLA 2O31A 4B3SL 3CC7Q 4XT1B 3VJPA 1K8AR 1ZSZA 1HZBA 3GTGB 2K5WA 4CKEA 2E2IH 3S17B 1U4MA 5CV6A 1NNXA 4FDBA 5C4JB 2IW3A 2OTLT 3K7AB 4J7FA 1Z7TA 5AYFA 5M5WB 1D0ZA 2R5AA 2FPFA 2L3PA 1HR0Q 2ZM6Q 1BI1A 3GP8A 5KE2A 4FT2A 5IHKA 5T1IA 4LFBQ 1U06A 4X66L 1J5EQ 2V1RA 1M3CA 3OIPA 3ULJA 3V7RA 1GUOA 1HRJA 3GQBA 3L2RA 3H91A 4A3MH 4R0KA 4TKOB 1LNXA 3HOWB 2JTMA 5A2QE 5EPJA 3CCVT 1W6KA 3U4ZA 4LUDA 4YWMA 5LJ3j 3X3NA 3CQTA 5DLOA 4UP7A 5FLXL 2F0FA 4KKSA 1VQKT 1D5MC 5E3FA 3RD4A 3EFSA 1R4QB 1M3BA 4JRIA 1Z9FA 1M90R 2LVMA 3KLWA 1I4RA 2EYYA 4PJOD 1DOMA 3OYBA 1NM7A 4CKBA 1QMCA 2WKDA 5JAVA 1AWXA 3UA7A 1BUVT 1YWPA 1YNZA 4Z02A 1M8VA 4F88A 5FK9C 4F7UE 3S2DB 5J3BA 3H8ZA 5I2MA 3L7ZC 3L2QA 3NBIA 1YHQT 1QCOA 2DVJA 1R9TB 2VUMG 2YUPA 1SHGA 3RMSA 1GHKA 1YHBA 2IWHA 1WTQA 3ZJYC 5GAOn 3JB9H 4NXML 1ZSGA 2DEQA 2DNUA 3I73A 5LJ3e 2DFUA 2EPDA 1YI2A 4X9CA 3RESA 1STYA 1WI5A 1W6JA 4DBRA 5CGKA 2EXZA 4X3KA 2L3QA 2UUBQ 1SAPA 1RAAB 1SMYD 4A63B 1Z47A 2D0PA 2SDFA 5EPLA 5K5PA 5FJ8G 2DUDA 4E7HA 1GUSA 1NPRA 2F4VQ 2UUAL 3I4MG 4RGOS 1J9OA 1X3FA 2RJEA 1K28A 2VXWA 1UFFA 1ICFB 1WX6A 5FKAC 5LMUL 2MMPA 3HKZB 2O9SA 5CQYA 1ZLMA 2RKSA 2DPPB 1U4LA 1ASZA 3MHBA 4A3GH 1JJCB 2RB6A 3JB9I 4RHRA 2P0QA 2KXCA 1A2TA 3T13A 1X27A 1GOZA 4OIJA 1CT1D 1I4QA 4PFOA 3TP7A 3CF5A 2YTXA 2A74C 1I81A 1A0NB 1VQ8A 3TP6A 3PUWA 4JI4L 4M78G 4M7AA 3SD4A 2PI2A 3A0JA 1SBBB 4DV6Q 4LW1A 1UUPA 4IPDA 2CP7A 1AN8A 3HRSA 4JI2Q 1XX8A 3DWQA 2HKNA 3GTJB 1Q8KA 3KUPA 3CKIB 2M0OA 2EJ9A 2KSSA 1TWCB 1BNZA 3IFDA 1N8RR 2K03A 2ZT9C 1EQVA 2H1EA 4KV6A 1M4VA 3E9FA 1L0XB 3A55A 1JICA 4FYXB 4Y28E 2XGTA 3EIVA 2OXPA 4GN5A 4PG3A 4A3EB 1MJCA 1UEBA 2LQNA 1UGRB 3V7SA 5KE3A 3TN2A 5GAOr 4IFDJ 2BE5D 4RGTA 1TWGH 3GV6A 2L11A 1UG1A 2GBQA 4OL7A 4C3JH 1Y1WG 2EQUA 4FNFA 1IGQA 1W2BP 4OELB 2HD3A 4DR5L 1U9RA 1H3ZA 2FHTA 4C0FA 1HNZL 4ZLTF 2KRMA 3RKWA 1Q90A 5C4XB 3T1YQ 2VXFA 1E6GA 2K01A 1IKMA 2B3GA 4ABNA 2BH2A 1U4RA 1NAPA 4GKJQ 3I55A 1Z6HA 4A3FH 2F0OA 4EMKB 4PMWA 4JBWA 2SEBD 1HQMC 1GXIE 1NZ9A 1OYXA 4KY5A 5JPMC 1KLGD 2D0NA 3H3VH 1U1SA 2FINB 5M5YH 2CZ6B 3CD6T 1JORA 1CKAA 1V9PA 4MIUA 4DR3L 1UAPA 3RKXA 4Y7NH 3PMTA 3QXEB 3CMET 2MP1A 2RQXA 1WVLA 2QQ9A 4EMKC 4AH6A 2E3HA 1NEBA 2B2VA 3BVGA 4EIKA 2WSFE 3SWNA 1WDXA 3MEHA 5C5LA 4MZPA 2VQFL 3GOXA 2RQRA 5I4DA 5IOCA 5IWAL 1QUQA 1EQQA 1GBQA 4POFA 4HTHA 1RADB 1FX7A 1N9WA 2JXMB 1PKTA 1NSNS 2OAWA 3C0CA 4RTUA 1Q7YR 1F9QA 4R4IA 4ZKCB 5IP7H 1ESFA 3CMAQ 2BA0A 3HPWA 2DL3A 5GAHC 3VS6A 1AEXA 1KC8C 4K5XA 1ZA1B 4B3TL 2UXBQ 2XSCA 3E9IA 5K36G 4JOIA 3CW2C 3K80C 3SK6A 1PTOF 3M55A 5IT9c 2D6FA 4LDWA 1KLUD 4OB1B 3V7CA 4B3RL 3D7SB 3GTJH 2EJFC 1TVXA 3VYSA 1VQ9A 4N4GA 3OYDA 4FM4B 5CBEE 3GTQB 2VV5A 2K5IA 5CVIA 4DNRB 3MXNB 1SHFA 2DRKA 3KF6A 2E76C 5LJ3g 2XDDA 1CQVA 2AT1B 4II1A 1F9PA 4S3SA 1UECA 3A8HB 4KKTA 4A3MB 2G9HD 5BN4A 4DBHA 1MD2D 4K0KL 4LD6A 4U673 5DAUA 1LT4D 2NUCA 3G4ST 1HNZQ 2CZ0B 4A3DG 3HZXA 1PTOB 3RUXA 1QVFP 3CC2T 2SNSA 1XNQL 2J6OA 1U3OA 5ECAA 2OTJA 2EBPA 3KDFA 4GBQA 4XQJA 4DUYQ 4IUQA 4E2FB 1VQ8T 2X6LA 4J6HA 3KJOA 4A3BG 1VQ6A 2DF6A 3A1PA 2NVYB 1M2VA 4RTTA 3MHXA 4C8QA 1NR2A 2VZAA 3BZKA 3GTKB 4WJ3M 2D0QB 4OWXB 4DAMA 5HURA 3M53A 4LF8Q 1ZUYA 1TQOA 1MHNA 1P16A 1PZID 4DK0A 1SLJA 4ZNXA 3KXTA 1FJGL 1VQPT 1QW1A 4IPCA 5M3MH 4BWGB 1WHJA 1PH1A 2X51A 2DY8A 3GPLA 1NYFA 2JOYA 4F16A 5ELBA 4F7UA 1YVCA 1QZGA 2VB2X 3NE5B 5IN1A 5GAMj 2F69A 5IY0A 2KYMA 1VUBA 3MP6A 1JCKB 2G5DA 2VKNA 2ZXPA 4RCOA 3ULRB 4X64L 1GCQC 1AW7A 4X1VA 4DV3Q 1QZHA 3IAYA 1B70B 4P2CB 4O6JA 1ICWA 4R4CA 3D4RA 5JEAG 1B07A 4L5SA 3PIPA 3PIP3 2EKHA 2MUYA 4MTKA 4Q0FA 3JCMb 4BS9A 1VQPA 4JV5Q 1XTCD 3IL8A 3MP8A 1W3SA 2LJ0A 2EYWA 4KT0E 5GJVB 1R4PB 1PH4A 2JM8A 2DNCA 3D6CA 3K5NA 2YRDA 1G3WA 2ED1A 3E5SA 1VQKA 3Q6SA 1SFOH 4M78B 2CP5A 1I5OB 2CW0C 2RBMA 3BDCA 4JW0A 5CV7A 4DFAA 5GAN2 2D1XA 2QEXA 3T1HQ 1N9SA 3L2UA 5EGTA 4MMKA 3A8JE 1HPCA 2EYOA 4JJDA 3EBEA 2Q8TA 5LJ3d 3HRUA 4JS5A 2OTJT 1LTGD 1VQAA 3EN2A 4R9WA 1SYCA 2E4HA 3P1HA 3CC2A 4RA8A 4U68A 2E74C 1SRLA 1E0BA 5CKFA 1AZPA 3M0TA 4KKUA 1VQ5Q 1YNJC 5EBCA 1D1KA 3MA2B 2C35B 1FXXA 2JT4A 4B3TQ 3VS4A 3NPFA 1PRTD 2NB0A 3M4QA 4A3EG 1YITQ 3J80E 2EJFA 1O7IA 5NUCA 3HFOA 4XU2A 2EY5A 5GAN3 1OEBA 1BK2A 1VQOQ 4LDYA 1Y0MA 4XYQA 3T51B 1B3QA 4PJOG 1FMWA 4KGXB 3JCMd 2CQAA 3VS0A 2K4KA 4K6LA 2ZAEA 4RGNA 3URGA 4KUDK 1VQ9T 1SKUB 3SHWA 3L42A 3VU3C 2EGCA 2PQAA 4ZYSA 4DR7L 1TS9A 2ENMA 2VQFQ 3JAML 1GVPA 3J81L 1RAFB 1AP0A 2B8AA 2K14A 1OI1A 4FP5D 3H6MA 1SF9A 1DJRD 2XD0A 3EFOA 4A54A 1B34B 1C1AA 1AWJA 3OY9A 2H3EB 4R56A 5CV8A 1QG7A 3M0QA 1K83H 1WD1A 4BDYA 2Z6KC 1GCQA 5CBAE 3OBYA 1STNA 1I0CA 1K8AC 1JR0D 4FT4A 1EOVA 2CS7A 1FNWA 2F0WA 1CKMA 3JCMJ 2MQHA 3QIAA 3OB9A 5C6SA 1WI7A 2R5MA 3S2DH 1Q82C 5GADC 4C56C 3V8KA 2A6ED 2HSEB 2YSQA 1N8RU 1V43A 1XTDA 3ONAB 3H3VC 2DJZA 2W10A 1NMGA 3RN2A 2ZJRA 2RVLA 3MJXA 1K73U 1HZ9A 5J26A 5ISRA 2JA7B 1RLQC 3CCRQ 4A75A 2KQ3A 1CKBA 4QQDA 1IREB 5LJ5e 1EY5A 1NBWA 3M7GA 4HEDA 2HHHL 4I7ZC 2F0JA 3LWHA 3EGXB 2HKQB 3UT1A 1RD9D 4PZ6A 2EVBA 4WFN3 1STAA 3CBMA 4J1MA 2RJDA 1RL2A 1EYCA 4BBRB 1HR0W 3CCLT 1BVSA 2PQAB 1JE5A 1BI3A 5FLMG 1L2FA 1FNVA 4ME3A 5DNFA 4Y7NB 4A3LG 4OWTB 1ZSZB 1ZUKA 3NQIA 5EPKA 3OIQA 5KCOA 2L1BA 4H13C 2CT3A 5M5YB 1EY0A 3TREA 4WJWA 1D1CA 1ASYA 2MOXA 2GVBA 3RDVA 2A5HA 2DO3A 4QVZA 2EYJA 3U9OA 4A4FA 4M75B 4DBQA 4HJ8A 4JOIC 4NPSA 2R7ZG 4QQ6A 4RAUC 3VR6A 2DD5A 3CPWS 2R61A 2PZTA 5EBDA 4A3DB 4M78C 3BG3A 4DBFA 2JJQA 3I5RA 2MPMA 2FRYA 1XXGA 3MCAB 4A53A 2KR3A 4ESRA 2E8GA 1MMDA 3NWSA 1WTHA 2L3RA 4MNOA 4C8QG 2MAMA 1AVZC 4XU1A 4C3JB 2Q2UA 5ELNA 1QWYA 3RMHA 1ZBJA 2JA9A 2FG0A 4DGZA 5GQOA 4ORZA 4IJLA 2DXBA 3M4YA 3VYHB 1S40A 1RDPD 1KQSP 2VB3X 6AT1B 3FRNA 5IYDG 5I2XA 3HOYB 1D0YA 1X2KA 1YITA 1OULA 1TWGB 3A8GB 2A68D 3RN5A 2K5LA 3H94A 4CC3A 1Y14B 3CCVQ 1I5LA 1TWAB 3THKA 2BCOA 1G51A 1AD5A 2R57A 5CYUA 1Q8IA 4NW2A 2K32A 4HVUA 1A3UA 4OMPA 2KOLA 4AFQC 4C92C 1K0RA 3LYIA 3E9HA 2F3WA 1K8GA 5JPNC 3RERA 1X65A 1E22A 1M1KU 4IN3A 5IGDA 3KLSA 4C3IH 2M02A 2QEXQ 3S6WA 4XTZA 1HXDA 2F0QA 2F03A 1K1ZA 1EZ8A 2DZCA 2QEJC 3JV3A 2KGTA 1TOVA 4AG1C 4EDUA 1GKHA 2BA1A 2F52A 2RQWA 4R1JA 2HHHQ 1RF2D 4JI7Q 2PNHA 4ZN3A 5LJ5d 1SMXA 2PQWA 2YLBA 2FEIA 1VQ4A 1TS5A 3R2IA 5J39A 2B2UC 1Q82U 1JO8A 3QZ5B 3MXGA 3GIBA 3DM3A 2UXDQ 4C92B 1G8ZD 3Q24A 3JRZA 4CBVA 5LHY1 3JB9D 2NN6H 2K52A 4EQPA 4A3FG 2EOTA 2KCCA 3S1QH 2VXEA 2MHVA 2PVOB 2YHTA 2EYMA 1O75A 1G91A 4NS5A 1DOLA 5LJ5h 4DN4M 1TWFH 2XMFA 3K7AH 4XTUA 2EYQA 1KD1R 1MHWC 1PG5B 3B6YA 2A19A 3J81i 3OA6A 1C8CA 1CA5A 4J7IA 5GAN6 1IL8A 5DM63 1M1FA 1YIJQ 4L59A 1RTNA 3C3LA 4RG2A 1JC7A 3PF5A 2BE9B 2KENA 2K3XA 2Z9HA 1AZEA 4M75F 2EAYA 3LWEA 2F2WA 2CT4A 2DE0X 3JB9J 1V76A 2F5KA 4WF2A 1AZQA 2O4XB 1SR3A 4UDUC 3CC4A 2NTSA 4LF6L 3R3OA 1M4ZA 2F0GA 2L0CA 3OYKA 3SWNB 4JK1C 1WTWA 2WFWA 2QQAA 2EQKA 4OP0A 3RZDH 4G7OC 3UI2A 4A3CG 4NMZA 2O2LD 4Z8AA 3OWFA 2ZPIB 4M75E 2XIDA 3FJPA 1ZHIA 2DJQA 4OF1A 2N55A 2PZWA 2R3ZA 2MNAA 3L3OC 2JA7H 3HOWH 3TEEA 2EJGC 1WCMB 1QVGA 3DMUA 2F0TA 3D4WA 3H0GB 4DUZQ 1X3EA 3I35A 1NTGA 1XYIA 2CVRA 5KYWB 4DA2A 2OWOA 1MMNA 2GVAA 4N0AA 3N52A 2KYBA 4ODGA 3Q8DA 4XQNA 4LF4L 2ROLA 5I11A 2E70A 1I4GA 2V4DA 3A98A 1WJQA 1IW7D 1PWTA 4GY5A 1LTBD 3E3XA 3ND9A 4N9PA 1PH8A 4QF4A 5BR8Q 4DNTB 2EY1A 2LXJA 2QCPX 3KK7A 3FDRA 4R55A 3VR2A 3W5OA 3I4LA 2CP0A 4NB3A 5KRUA 1XMOQ 2R7ZH 4H7BA 1QUQB 5IXFA 3JCMX 2LJ3A 1B2TA 3PO3G 4JV5L 4L8JA 1U8RA 5AJ3Q 1ARKA 1H9SB 2CWAA 1PH9A 3S1RB 2P84A 1SYBA 4UP8A 2MFIA 4E7IA 1BR9A 5FJ8H 3HKSA 4FCYA 2AZVA 1SNCA 2JA7G 1N6AA 1ET6A 2Y4YA 1IBMQ 1PNJA 2VQEQ 4EMKA 3HOUH 2JMCA 3VRYA 4O0AA 4WRDA 4M7AD 1QCBD 1FJGQ 1L0YB 2DL7A 1EWCA 1HTPA 2A28A 2A36A 1KDCA 2D5DA 5IP9H 4L63B 3FHWA 3OYIA 4LF8L 4LFAQ 4HXJA 4OMLA 2EYPA 1IKLA 5HCKA 3F1ZA 1BXTA 3QJ6A 3AEVA 4LUEA 3VS3A 4J9CA 4BI3A 4AQYQ 1UE1A 3BYYB 2L0AA 3S3NA 2F0KA 2HAXA 1II3A 4X3UA 1D2BA 2CW0D 3SEMA 1YJNQ 2KMTA 3D0FA 1BCPF 4YWLA 4M7DA 1HFGA 3HP3A 3U4VA 4PJLA 4EQNA 1X3GA 3HTRA 4HJ5A 2HQHA 3UDIA 4J6XA 4P75A 3R6NA 1RACB 4A3MG 2FZKB 2YTVA 3J81E 2VASA 4M7DE 2QQBA 1GUTA 2O5JC 4JI8L 3VYUA 4KI0A 3PIOA 1EY6A 3PIO3 4C8QB 4KRTA 4KULA 3CC4T 3CCQT 4M8AA 2O9VA 2NYSA 1WHHA 2DL4A 2KRNA 4YHHQ 4LF4Q 2KRSA 2ATWA 1NJIC 4LUOA 3G4SQ 3UPUA 1AEYA 1YHQQ 4QY7A 1K9MU 3J80c 1DCZA 3J81j 4JRPA 1M90U 4DV0L 4POGA 1K3BC 3SGIA 5GAN7 2EYFA 3FEOA 1WTVA 1TWHB 1PTOD 4QCLA 3BYTB 4J9IA 3BY7A 4JZ4A 3JCMh 2BDNA 3FDTA 1UGQB 1Y07A 1DM0B 1SRUA 3QBYA 4NKLA 1ZSZC 4R4TA 2UXCQ 2KEEA 4BE1A 5GAOq 2AUKA 3MXNA 1V8QA 2BH8A 5KH6A 3T4AC 2K5HA 2WSCE 2F3VA 3QUIA 2QA4A 3I8ZA 3S3MA 4XU0A 1X9NA 2HQXA 4X65L 4EMGA 1XMOL 4J6YA 4XYOA 4ZGDB 3BJUA 5M3FH 3M57A 4WORA 2OI3A 1QQJA 4KK7A 2A0FB 4A4HA 1YBYA 3VV0A 1QWFA 3CPWP 1S72Q 2V26A 4C92G 3K6OA 3PMIA 4A3FB 4JI0L 1X32A 3KJPA 1WZOA 2X9HA 4E6RA 1BBUA 2PMZE 4A3KH 2V8IA 2K50A 3P75A 3OYHA 3OW2A 1UGVA 4OWWB 3CCST 4PFPA 3S16B 1F9SA 4EVOA 1W1FA 2G9DA 4R8IA 1M2VB 1I3QH 4FW2A 3BE3A 1LOJA 1QLYA 3EH2A 1Y1VH 1JB0E 2IG0A 2DY7A 2C0OA 1B9NA 1NUCA 3GTLB 2X4XA 4AYBE 2GN5A 2PYKA 4CDCC 2PUOB 1EYGA 4X3SA 4QUFA 4DR6L 3MC0B 2SOBA 4DR7Q 3NEMA 4M77G 1MSGA 1JQYD 4XDXA 1ZA2B 2LFNA 5C0XJ 2EGEA 1NG2A 3CD6A 1YNND 4FO2A 5M3FB 1B44D 2F0VA 4KD3A 2RO0A 2IPOB 2NYZD 1OV3A 2VUBA 4FW1A 3MAQA 1RTOA 4JVZA 2B2VC 3E19A 3VA5A 1Y7XA 5IGFA 4BY1B 1M9SA 5CKDA 4Y91A 4DAYA 2RD1A 5IGCA 1WCMG 1H9RA 4M78D 2OCEA 5GAMe 4BXXG 3J81c 3MO8A 4RTWA 4ZKBB 1BI2A 2JE6I 3SE0A 1JXOA 1M1GA 4BA1I 5IP7G 1RI0A 2KNBB 2C06A 4PJOE 1TWHH 4LUZA 3HRZC 4A76A 3QOLA 1A62A 2AIRB 4KH1B 3OYJA 4IFDH 3UATA 5IE8A 2N8NA 4A3DH 3E0EA 3CMEQ 2RA2A 4F14A 2Q8RE 4JC0A 4C8QC 2KT1A 2M2LA 3RNUA 3PO3B 1HJPA 5CAIA 2ZPGB 5LJ5j 1M1KR 3A54A 1GRIA 1IHVA 4XTWA 1PZJD 3GLXA 3RZOB 1ILQA 2BKDN 2RQTA 1KRTA 2K57A 4DV1L 3OSVA 3QYGB 4BBSG 2ZJQA 1SDFA 2R92B 2XKOC 4AYBG 3AFPA 5F2DA 5KNDA 5H1SE 1AWWA 3NXWA 2NLUA 3J7YW 4LF7Q 1WOCA 2X69A 5KYLA 4HR7B 3G48A 5EQ0A 4A3CH 3DWPA 2XDBA 1I94Q 5DM7R 1O9SA 1WYXA 5EKLA 3S9WA 1TU0B 5C0XH 3HOXH 4LFCQ 4KGVB 4L6TB 5G3LD 3X28B 4D8DA 5I6WA 4M4ZA 1MGQA 2GTOA 1KD1C 3I56Q 1YN8A 3CCEA 3H0GH 1TY0A 3GTQH 4ZTJA 1IHZA 2PW7A 5DY9A 3EJIA 4C92E 3E9GA 1K0SA 1PHJA 3GTLH 3VS5A 4ULLA 2PTKA 3D8GA 2E5LL 3KUFA 1OPKA 1QOHA 2RJCA 2RF0A 4RKBA 3HOZB 4CRIA 1I3QB 1VQGA 2N78A 2F0MA 1QVGS 1M8AA 5KGUA 4B3ML 2EYZA 1WGSA 4E6IA 3OS1A 1WTRA 3LX7A 1VDZA 4KY7A 5C3XA 4X66Q 1J5EL 3M3YH 4IQZA 1O7ZA 2F0HA 2V8JA 3A8OB 2XNAC 2N88A 3OMGA 1WQ7A 1ZUUA 3VS1A 2RQVA 5HY6A 1BIBA 1K8AU 2CCZA 1TG0A 1PRTC 4DUYL 4M77C 3CCRA 5KYYB 2Q2IA 2VC8A 2RCFA 2KHSA 2HCKA 3PUVA 5KEEA 5JEAH 3AMUA 4IOAA 1JJ2A 3PV0A 3H9NA 5KYXA 4A3GG 3GTMH 3GTGH 3S17H 2NUPA 1PFSA 3QPHA 5C44B 1VQLQ 2BZXA 1B4OA 2E75C 3NELA 5EJWA 5FO9B 5FLXc 1KDBA 1VQ9Q 1VMPA 4IFDG 4FYVB 1W2BA 2CYZB 2GNCA 4PKCC 1K9MC 3V8JA 1HYOA 3I4MH 3S24A 4CJ1B 1B50A 2JA6G 1XNRL 4OMQA 2RHSB 2TMPA 3IFTA 1CQFA 3CEYA 1M2OA 4M77E 1KSWA 3X25B 1WCMH 3RUZA 3W1BA 3E2UA 2OX7A 4AFSC 1OZ3A 2JVVA 2RSOA 2L89A 4XTYA 4XQ3A 3JCMV 4C3IB 1UTIA 3T1YL 2RA4A 1IL2A 2I46A 2JYOA 4M75C 1S5DD 1EOTA 1IB8A 2D0OA 4N8FA 1UJYA 2L5QA 5M3MG 2RH2A 2VGNA 1YJ9Q 2A73B 4M77F 3PVLA 2L4NA 4GKKL 2CQOA 2RK1A 4FIBA 4AMCA 1UGPB 1EX4A 2NUTB 4JPBW 4P73A 2GQVA 3S15H 2F1LA 1VQLT 4LD9K 2QDBA 2NZ1D 4GLAC 4KN4C 1N32Q 3PQIA 1XMQL 2KHJA 5DM73 4IPGA 1YIJA 4UHVA 5IGEA 1AHJB 3ER0A 3JCMg 1EY8A 2EQSA 1K0XA 3CRLC 2M16A 1VCIA 2YRVA 4QKUA 4N4HA 5FU7C 2B8FA 2KQWA 1KRSA 3LGJA 5CR3A 3RZOH 1SNPA 1CSPA 2OAUA 9ATCB 1SYDA 3QR8A 1I4PA 3F2BA 4JBMA 4JS4A 4JYAQ 3C94A 2B39A 4UC4A 3BDOA 2JA5G 1KTKA 1RAIB 1VQ7Q 2HZYA 4J9BA 1C4QA 2YUQA 1UE6A 1YITT 5IGBA 4M77B 2MWOA 3SDZA 1ET9A 1VQ6T 2XRQD 2EXDA 3MEWA 3R8BA 5C4ZA 1UHCA 1UB4A 3FEWX 2L55A 3LGLA 3CMEA 2E2JB 2B63G 2VB6A 2OJ2A 3U58A 4A93G 4YHHL 2AWOA 4LDVA 1G3TA 3CXCS
chains in the Genus database with same CATH topology
3P8BB 1Q1EA 1UE7A 4IFDI 3HOWG 1OXVA 4BBRH 2VNUD 3PGGA 1Q46A 1Q81C 1KC8U 1KL9A 3ZEHA 4BD3A 2ID0A 5GANf 4YCUA 4A3EH 2RF4A 3M56A 4YTLA 5CK9A 4IURA 3BW1A 2RCNA 3H3VI 1FGUA 4M7DG 1VQDA 4HA8A 5D6WA 4R4QA 2QXFA 3CBOA 3D31A 3T9NA 4LWCA 1UGSB 3A5UA 2QDYB 2AHOB 4LFAL 1V29B 3KF8B 2DTHA 2BIVA 3VUZA 1E3PA 2ZCFB 3PUZA 4DV7Q 1DJ7B 2P4TA 2NVTH 1JJGA 5CQXA 3M4GA 1KXLA 2EQJA 3SB2A 2K4YA 1YNXA 4GS3A 3RLNA 1Y96A 2HT1A 2DAQA 3X26B 1PH6A 4JYAL 4IO9A 2Q2TA 2DIQA 3WWVA 1LUZA 2NVYH 4BACA 2E6ZA 5CKBA 3F70A 3I55T 2LTOA 1R9TH 3WXMB 4ME7A 1Y96B 2B63H 5CO7A 2R7FA 4IUTA 1YIJT 2JQOA 2E2JH 2E65A 3OYCA 4XAXB 3TEHB 2O4XA 2YU9H 4JI5Q 4BE2A 2ZTCA 1XNRQ 1M1KC 2V1CC 2LSSA 4PJOB 3EFRA 3TQYA 4OB2B 3CMAA 4XK8E 1YHQA 3N5BB 3L1AA 3FIFA 5C4XH 4F7UB 4C0DC 4JI0Q 3JCMe 3OS2A 4DR2Q 5LMNW 3QG1A 1EIYB 2R93G 2E6NA 1VQJA 4M7AF 1KD1U 2PU9B 3BZCA 4GN4B 2HBPA 2RK2A 4OMFB 3JB9G 4JI3L 3HRTA 3OBWA 2HNIA 2A3LA 5C3EG 3OYYA 4PJOF 1MIUA 2FXQA 2MWPA 3AFQA 3CCQA 4P74A 4C8QD 4E47A 2EJGA 4APVA 3STBD 2GFUA 4A3BH 3ASKA 2RM4A 4MZTA 4DQ2A 1E1OA 4OX9L 5C3EH 2JA6H 3I4NH 4MMLA 3QJYA 1PA6A 2RHQB 4FSXA 5C44H 1MKHA 4J5YA 1B7YB 3T1HL 4OXPA 1I8FA 5A0GA 4BY6B 1Q1BA 1OXTA 4RG1A 1CSQA 4IPHA 1HNXL 4DV1Q 5GAN8 5LJ3h 4GLKA 3S2HH 2Y0SE 3DLLA 1M90C 1YEZA 3CCJA 2XU8A 4JI2L 5M3FG 2R6GA 1QP2A 5GAN4 3RIRA 4X34A 1XJVA 2IX1A 4BY1G 3OYLA 3HFZB 3I2ZA 4LFCL 3KDFB 2ZPEB 3QDRB 1Q81U 4C8QE 1V1QA 5IYCH 1VQBA 3M85A 3BFMA 2ZJPA 2HQEA 2FVUA 2JK8A 1U0LA 2KDSA 2UXBL 1NPPA 5IYDH 5GANj 5IYCG 2FB7A 4C92F 1VQ5A 3WVDB 5GAMg 1JT8A 4MDWA 3MEAA 2QI2A 4HJ7A 2H5XA 4L5GA 1T9HA 5M5WH 5GMKi 1HH2P 2XDPA 4HIDA 1D3BA 5GAOp 4X6AH 4HT9A 2Z6KA 4LDXA 1WJJA 4KHPL 1Y1WH 5LL6S 3OYMA 1VIFA 2GCXA 3CCUT 4JI5L 4B3MQ 4A3LH 1FWZA 4DR4Q 2RHIA 2ES2A 2NVQH 1OXUA 1U1TA 1N27A 3L2WA 3O8VA 2I2LA 4HCCA 3NTIA 2LCCA 4HIOA 4IOCA 4JBKA 5IP9G 3CCSA 3HOZG 4LF9L 2H3JA 2AMCB 2PI2E 1YJNA 2UXCL 4A4KA 1VQ4T 2RI3A 4HJAA 4A4IA 3J80i 4BI8B 3PUYA 2R92H 1JB7A 5JJLA 2QGQA 2P0KA 4DAYB 1UE5A 2F3IA 4DV3L 4M7DD 3UDGA 3JCMf 1VIEA 5JEAJ 5HKCA 4OGCA 1W4SA 5GANh 1I50H 1H95A 4ELYC 1IBLQ 4YWKA 3OTOQ 1KQSA 1PH2A 2EWNA 3MEFA 1WJSA 4HT8A 1PSFA 2LNVA 2KVQG 1XPOA 2DXUA 3HL8A 2X35A 2QQSA 3VUBA 4MZ9A 4ALPA 3M54A 2VL6A 4B9XA 1S72T 2LDMA 4M7DC 5I21A 4K0KQ 3CXCA 5FU6B 2E12A 4JI4Q 1EUJA 4CI0C 3HOZH 2CKZB 2WAQE 5GAGC 1KQ1A 3PO2G 1N8RC 3META 4B3RQ 2OQ0A 5LMUQ 3JCMP 5GROA 2D9TA 3CCLA 1BKBA 3MEUA 4HKEA 4JLIA 2LX9A 2IHEA 4J83A 4JUVA 4E7KA 3M4OH 2N3SA 2KCMA 2KHIA 3TRZA 1BIAA 2ZTEA 3HOVH 3UDFA 3HP9A 4JI3Q 5A0LA 1GD7A 1L1OA 2DIGA 4PNOA 4GLVB 4M77D 2OQKA 3OTOL 1UWVA 3HOYG 4NXNL 5C0XG 4DR1L 2FYKA 3J7A5 3CCMA 4HJ9A 1PH7A 4RKUE 2OTLA 4M7DB 4M75D 1CKNA 2M9UA 4GLXA 4X9DA 5FRMA 1PH5A 4GNXA 4GKJL 4DR4L 2CZ7B 4ZGJB 1VQ5T 4HCBA 3CQZH 2ASBA 1Q7YU 4A3JH 4A93H 1PH3A 3OMCA 2E64A 1G5VA 2K75A 4DR2L 1WNLA 4LF9Q 3I56T 4DR3Q 5IWAQ 4B3SQ 1EIFA 3Q1JA 3V8LA 2BUDA 1NE3A 3C95A 4ZGEB 2RI5A 5M5XH 2XTIA 5A0DA 3ULPA 5M9OA 4DA4A 1HZCA 3OYEA 2ZGWA 3OYGA 3A74A 3BU2A 4DV0Q 4XTVA 5GAMf 2FL7A 3FKIH 3I4NG 2A1AA 2LRQA 1G6PA 1YJWA 1K73C 1D7QA 3NTHA 4DPGA 1XNIA 5E7NA 5CKEA 2UU9L 4OB3B 4BB7A 2DK3A 1JBMA 2R58A 5D6XA 2NN6G 4UPAA 3HFNA 3A5ZB 4M7AB 5IT9E 3FP9A 4A3KG 4KLKA 4ZTFA 3KYHC 2RHUA 4FU6A 1S72A 3S1MH 4M78F 2Z0SA 2CKKA 3ERSX 4UP9A 4A3JG 1YJ9T 4DUZL 2VGMA 3JAME 4NOYA 1N36L 4VUBA 3PFSA 4M78E 4GOPC 1PVOA 3IRBA 3G4SA 4JJNK 3LLRA 2VY3A 1ZQ1A 3M7NA 1X01A 4LF6Q 5I2SA 3G6ET 3HOYH 1KHCA 3NBHB 2JA8G 2MO1A 4XTXA 3L2ZA 2EFIA 1N9RA 1D3BB 1X55A 2FHDA 5CCAA 5C4JH 2PVDB 5HK3A 3PF4A 4Y52H 2UUCQ 1PYBA 4RCCA 4KHPQ 5IYBG 4DR1Q 1G291 1YCYA 4RMOA 4OGEA 2LXKA 5GMKm 1E24A 4QVDA 2XI9A 1SE8A 1KQSS 3HSBA 2E2HH 2KCTA 4BY7G 5EG2A 2EQMA 4QJFA 1K3RA 3L2VA 1TWAH 3WVEB 5GANe 1NMFA 4EMHA 2LT4A 4OVAA 4BE0A 2KAFA 3DKMA 3HOUG 1HNWL 4PL6A 1OTCA 5LJ5f 3LH0A 1VQIA 3F2DA 1L1OC 5HGQA 4KUIA 3BDLA 1EWIA 1QVCA 1C7YA 1VQHA 3PO3H 1Q7YC 3AYHB 2WACA 2K5VA 4DR5Q 3MP1A 2K5NA 3S16H 4RG8A 5FU7B 2I0QA 1VQNA 4EQ5A 4A3IG 3VYGA 3ULLA 5DLQE 4P72A 1VQ7A 1Y1VG 3M9QA 1R8OB 4EPCA 4JI8Q 4C0DB 3UE0A 1I94L 1PSEA 4H02A 3MEVA 3W1GA 3S1NH 4E7LA 3G71T 2O01E 1PV4A 5FRNA 2QEXT 1NJIU 1QVFA 3CCJT 3QSUA 2I5HA 2MI6A 2E5LQ 1WPYA 2YYZA 4J8OA 1EFWA 4GKKQ 3M58A 3KF6B 1QVFS 5AJ3L 5FU6C 3PCOB 1JMCA 1HNWQ 2JNGA 1WQWA 2IT1A 1C0AA 2VQEL 1JRIA 4NL3A 5GAEC 4DNIA 1HNXQ 2WAQG 3DB3A 1XNQQ 2DKGA 2RHZA 4O2DA 2X4YA 2ZM6L 1E7ZA 3CP0A 3AHUA 2E5QA 2ZPFB 4HCZA 4LFBL 1WJRA 3LW5E 3P8HA 4JCVE 3X24B 3EAEA 3H6ZA 4JRQA 1LM0A 2QQRA 4LUVA 2JUFA 1WFQA 1N33Q 2N49A 1MJEA 3VKIA 1AE2A 4X65Q 5GMKj 5GMKl 4DK3C 3L2PA 2EIFA 3CMAT 2GF7A 5LMNQ 1B8AA 1HR0L 3JAMi 3HHTB 4WJ4A 2WSEE 3ZFJA 1CKNB 1TWCH 1SSFA 1LYLA 3HOXG 2WB1E 1X54A 1E1TA 3CAMA 2UXDL 1HZAA 1LTLA 4KHZA 3OQ5A 4DV5Q 2E10A 5GAMh 4BBSH 1VQMA 2IVWA 4JI6L 3JC66 4JBJA 4YY3L 3RMQA 4YCVA 1N33L 3INZA 2K2VA 3JAMc 3R6OA 2DTOA 2E41A 4PLIA 2DZ9A 5FLMH 3OS0A 2VW9A 3OYAA 5C44G 3DB4A 1IZ6A 3G71A 4JI7L 2RI2A 2DTIA 1JJ2S 2VUMH 4DV2L 4PLLA 3J7ZC 3OSSC 4N4IA 3PNWC 3JCMW 1G3SA 4QL5A 4B9WA 3FKIG 1L1OB 4XTCS 3JSCA 2XG8D 4C0ZA 4BXXH 3GDEA 2UU9Q<