4M78D

Crystal structure of lsm2-8 complex, space group p21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 16
structure length 75
sequence length 75
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78D00
1H641 2DTIA 5GAMh 2I2LA 4OP0A 1N9RA 4F7UA 3RKXA 3HFNA 4F7UF 3AHUA 5LJ3j 4M78G 4F7UE 2EJFA 1I8FA 4J6WA 4EMGA 3JCMJ 4M7AB 2RB6A 2RM4A 4HT8A 2E65A 1LOJA 3V7CA 4M7DB 4M77G 4JLIA 3BW1A 4WF2A 3V7RA 4X9DA 2VC8A 2VXEA 4PNOA 3JB9H 3SWNC 4XU0A 5LJ3d 4C8QG 2YLBA 4M75E 5GMKi 4C92G 4PJOD 3FB9A 1N9SA 4EMKB 2E10A 5LJ5e 2QTXA 4XTXA 3JB9I 1JRIA 1WQWA 3JCMc 3VU3C 4M78B 5LJ3h 5LJ5h 5GAN3 5GAN4 2DZ9A 3HSBA 5GAMd 2E41A 2HNIA 2EWNA 4M77D 3FJPA 1JBMA 4M77B 3V8JA 1BIBA 4X9CA 1D3BA 4C8QD 4XQ3A 3JCMP 4C8QB 4A53A 1B34A 2VXFA 1Y96A 1KQ1A 4PJOG 4C92D 4C92B 3V8KA 5CAIA 1M8VA 5LJ5j 5GAN2 4HT9A 3BY7A 5GAN7 4HA8A 2DTHA 4J6XA 5GANf 2K57A 5GANg 4M7AA 3RKWA 2DZCA 4M75A 4M7AF 4J5YA 1WNLA 2DXUA 3JCMd 4M75F 5LJ5d 4DQ2A 4M7AE 1WQ7A 5DY9A 5GMKm 4M7DE 3JCMe 5I21A 2ZGWA 4PJOB 3BDUA 2Y90A 3JCMh 2FB7A 4MMLA 3HFOA 1HXDA 4M78A 3JB9F 3SWNB 3RERA 4J6YA 5GAOr 4M78F 1X01A 2EAYA 4M78E 2CGHA 4JRKA 1M5Q1 4XU2A 3QHSA 5GAN6 5GAMg 3JB9J 1YCYA 4JUVA 4M75C 2DTOA 4XU3A 3JCMV 3PGGA 4QVDA 5GMKl 5GAOp 3JCMW 1MGQA 1I81A 2DXTA 4NL3A 5GMKe 4JRIA 4XTYA 3JCMQ 4M78C 5GMKh 4C92E 5GAOq 4F7UG 4M7DD 3QSUA 4M7DA 1LJOA 4MMKA 1WPYA 2E64A 4XTWA 4M7DF 4XTZA 3FIFA 5LJ3f 1U1TA 1U1SA 4PJOA 4EMKA 5LJ3g 1I5LA 5GANj 3GIBA 4M75G 3L1AA 1HK9A 2DVEA 3RKYA 4PJOF 3RUXA 3V8LA 5GMKj 1D3BB 4PJOE 3JCMX 1B34B 4F7UB 1Y96B 5GAMf 2JN0A 2YHTA 3JB9G 2EJGA 5GAOm 4M7AC 2RA2A 4M77A 4M7DC 2E1HA 1LNXA 2EJ9A 3EFSA 4M77F 3M4GA 4C8QA 4EMHA 4XU1A 5GANd 1KQ2A 1TH7A 4M77E 3JCMb 4M7AD 4C92A 4C8QF 2FYKA 2DKGA 4XTVA 5GANe 4M75D 4N0AA 4EMKC 4M75B 4NL2A 4C8QE 4C92F 5GANh 5GAOn 4PJOC 5GAMj 3RIRA 3BFMA 2YLCA 4XTUA 3QO3A 5GAN5 2DEQA 5GAOl 3QUIA 3JB9D 4A54A 3V7SA 4Y91A 5LJ3e 4NOYA 4M78D 4M77C 3JCMf 4QVCA 4RCBA 5GAN8 5LJ5f 3JCMg 4C8QC 3INZA 4M7AG 3EFRA 5LJ5g 3L2ZA 4C92C 1I4K1 2DJZA 3RESA 4M7DG 4V2SA 4N0AC 2RD1A 3SB2A 4RCCA 1BIAA 5GAMe 3SWNA
chains in the Genus database with same CATH superfamily
2RQUA 5GAMh 1SKUB 4XK8E 3OS1A 2XK0A 4LUDA 3OYNA 5FLXE 3I5SA 2RHXA 2JMAA 2GQVA 3CC4Q 4E7ZA 2RHYA 2QGGA 2YLBA 2CZ6B 1N9SA 1G83A 2X35A 3JCMc 5LJ5h 1IHVA 1PD0A 2E41A 2BUDA 1C0MA 2VXFA 2LTOA 2RPNA 2YRVA 4N4IA 1IO6A 4AG2C 4HCCA 2YDLA 5GANf 1VQNQ 4ZN1A 1FXXA 2DIQA 2ZPIB 2GTJA 2G6FX 4DQ2A 3G4SQ 2JXBA 3RNJA 2RO0A 1UGQB 5KYNA 5KYWA 1NYFA 2EYYA 1OPLA 3TU4K 3JB9J 1VQ8T 1PCXA 2LX7A 2QI2A 1AHJB 4BD3A 2ZPEB 1I81A 2LQ8A 2GBQA 3CMAQ 3CMET 1YITA 3QJYA 2P0QA 3PNWC 3G71T 2QQRA 5HY6A 1LJOA 4F04B 3A8LB 3CCET 2X4WA 3ER0A 4PJOA 4EMKA 5LJ3g 4OMFB 1NJIC 1JXMA 2QGFB 2FRWA 3A98A 2DBMA 1RLQC 1QLYA 2EJGA 3VS4A 2AHJB 4M7DC 4OB3B 4OMQA 2IG0A 5FRMA 4A4HA 4C92A 3CCRA 4OB2B 2MCNA 5GAMj 3I55Q 1EX4A 3G7ZA 5IHIA 1VQ5A 5LL6S 2MAMA 4LUEA 5GJVB 1EFNA 5GAN5 4A54A 3M5AA 3V7SA 4Y91A 1KK7A 3ZL7C 4JS4A 3VRYA 5LJ5g 4Y28E 3CC7A 5FU6C 4N0AC 3S3MA 4E7JA 5IHKA 2W0ZA 4HCBA 1MMDA 3LGLA 1EIFA 4AFZC 2OTLQ 3H6ZA 1I5OB 3JCMJ 4KGZB 5I2MA 1ZHIA 1UHFA 2CDTA 3OMCA 4PFZA 4PNOA 4LD6A 3SWNC 1QVFS 5LJ3d 3FB9A 1X69A 2FVUA 1J3TA 1Q81U 5GAMd 4D8DA 1SPKA 1WZOA 2JUFA 1N8RR 4ELZC 1MMNA 1HD3A 3CMEQ 1PSEA 3JCMP 3G71Q 5GAN2 3CCEQ 2RK2A 4PLIA 1ACMB 4FM4B 4E7LA 4OMPA 5LJ5d 1SG5A 2PNIA 1T3LA 2DRKA 2JS2A 3EH2A 2KEAA 3DLMA 2QQAA 1UHCA 1OZ3A 4ANJA 3WXMB 2CP5A 4CRIA 4M75C 4ZN3A 3OB9A 3JCMW 2F1LA 3LWHA 1AWOA 4NL3A 2HMAA 1X75C 3UWNA 2DLPA 1K4US 2OTJQ 1G3TA 3H9NA 3MO8A 3LWIA 2KDSA 1V1CA 1ZSZA 4PJOF 1Q7YU 3JAME 1SSHA 4M7AC 1AOJA 2EGEA 1WI7A 1BI1A 2KT1A 2CSQA 1X6GA 3CCLT 2YWWA 1VQ6T 1WA7A 2NYSA 4ZGDB 1SEMA 4C8QE 4C92F 4LDXA 3RIRA 1UGPB 4XTUA 1WJRA 1PHTA 2FPEA 3CPFA 3QUIA 3JB9D 3CCST 2RJCA 1WJQA 3OSSC 2GQIA 4FW2A 3ZBDA 3A8HB 4L5GA 1JXOA 2JOYA 4ME7A 5I22A 2FO0A 2RH2A 3CCUT 1VQOT 3M55A 1GBQA 2LZ6B 2FEIA 2GFAA 3M0QA 3RDVA 3BW1A 1QVPA 2JT4A 2OAUA 1YJWA 3MEWA 4RTYA 2EQMA 2DNUA 1E6GA 3UF4A 3FLGA 1BIBA 2HD0A 3MP8A 2KROA 3HKSA 2X51A 2SEMA 2DA9A 1O75A 4BDYA 1S72T 1BKBA 2DK3A 4LN2A 2YSQA 4KH1B 4M7AA 4IUTA 2DZCA 1VQPT 4HKEA 1K9MU 3EFOB 2EPDA 1YI2A 2RF0A 4QW2A 3RBBB 2H8HA 1GRIA 1PKTA 4KH0B 2EAYA 2OJ2A 5CQXA 2CZ1B 3JCMV 4J9HA 4OMMA 2KRNA 1GXIE 1K0XA 1W70A 2EQKA 4C5IA 1GFDA 4F7UG 2ABLA 1Y7XA 4J9CA 1H92A 4K11A 2J06A 2K3BA 4PLLA 1OEBA 1YHQT 1VYUA 3GPLA 1D3BB 2FRYA 4KULA 4DBQA 3CXCA 5KYXA 1TSFA 4M77A 5D6WA 1M3AA 4J83A 2BIVA 2DF6A 5GANe 2C06A 5GAOn 3G6EA 1Y71A 1VQKA 2D6FA 1YJNA 3GNGA 5J39A 3R6NA 2DL8A 2CT4A 2D1XA 3CCMA 2RN8A 3A5ZB 1OYXA 3INZA 2E3HA 3QWXX 3HHTB 2BZYA 4F14A 2KXDA 2H3JA 1VQPQ 3CCVT 1VIFA 2M0OA 2ZPBB 4WF2A 5IT9E 3EG2A 4C8QG 2C0IA 5GMKi 3GBQA 4F17A 3OS0A 1NLPC 2HQEA 4LDYA 1ABQA 5CKHA 2L89A 1VQ4T 5A0LA 1JBMA 3CC4A 1I1JA 2VYTA 2KAFA 1QCOA 1RABB 2P84A 3P8BB 3SD4A 5DM7R 1K73R 2RQRA 3TVTA 1YHQQ 4J5YA 4M7AF 2OI3A 2NUPA 1M1KC 2WSCE 1JB0E 1S1NA 3JCMh 3HFOA 2NUTB 2YRDA 3LLRA 4II1A 4IURA 1VQNA 3VRZA 1M27C 4C0FA 2WACA 1VQ9T 3EGUA 4A4GA 4QQ6A 3OA6A 2QEXT 3FIFA 1RUWA 2ZAEA 1BK2A 3OYLA 4LD9K 1V29B 5FWCA 3GIBA 2DBKA 4IUVA 4PJOE 3CMAA 4F7UB 3CCVQ 1ZLMA 3SHWA 3E2UA 5HKCA 5GAOm 2M9UA 1WJSA 2MWOA 3EFSA 3P8DA 4M77F 4ZGEB 4XTVA 4M75D 2DIGA 3BFMA 3A1PA 2GCXA 1IREB 1VQ4Q 1KC8C 4IUPA 1WXUA 3EFRA 2NLUA 1GL5A 3M4YA 3T9NA 2DTIA 3E9GA 3I55A 3O5ZA 2AIRB 4M78G 2EJFA 2HDAA 1KQSA 1NJIU 1UTIA 3GOXA 3JB9H 2VXEA 4BI4A 3M0UA 6AT1B 3VU3C 2V26A 2ESWA 1K9AA 1NG2A 2HNIA 2OTLA 1PRMC 2EW3A 3MKDA 4C8QB 1K9MC 5CAIA 2FPDA 1M90R 2YUNA 3UT1A 4JJNK 4R56A 2JJ9A 3KUFA 2V1QA 3E19A 3OBYA 5IH2A 4M7DE 2YUQA 1TXQA 1Q7YR 3ASKA 2R58A 1QCFA 4PK4A 3CCEA 2HCKA 1M5Q1 2AK5A 2BE9B 5GAOp 3VS5A 4RKUE 3CCQT 4C0DB 4M78C 2MK5A 1KQSP 1WHGA 2FHDA 1R8OB 1FMVA 1WPYA 4XTWA 2L8DA 2QQSA 1D1BA 2VGMA 2LVMA 3OYJA 1LNXA 2OTJA 3M4GA 4EMHA 2MMPA 2JVVA 1TH7A 1NPRA 3S6WA 3CXCS 3GF5A 4Y92A 2F2WA 4C5HA 2B86A 2LDMA 2P0PA 1B7TA 3GP8A 2PUKB 4J9EA 3EGDB 4RCBA 2DXCA 4FU6A 1YIJQ 2BTTA 2ZZDA 3I56Q 4QKUA 2LC4A 2DL7A 4V2SA 1UEBA 2F5KA 2I2LA 4BDZA 3ZEHA 4BI3A 3M58A 3GLXA 4AFUC 2RB6A 4LDVA 1XNIA 3H0FA 2K5IA 1T3SA 1XOVA 4M75E 4C92G 4M78B 5LJ3h 3R6OA 4MZTA 3FJPA 1KD1R 3OQ5A 1IGQA 2AT1B 5L8RE 3REAB 3CCQQ 4XQ3A 1Y96A 2RMOA 2JTEA 1TUCA 1PKSA 2F5TX 4AMCA 2K4YA 1R77A 4CC7A 5KYUA 1AWWA 2HL5C 1U8RA 1GCQC 4M7AE 1QWFA 2Y90A 3L2RA 4MMLA 4GBQA 4KUIA 3RERA 1MMGA 4FIBA 3CD6Q 1FWZA 1X01A 1VQLQ 1AD5A 4QVDA 2CT3A 3MPUB 2QA4Q 5GMKe 5EG2A 4IKFA 3OYEA 5D7UA 5CQYA 4ATOA 2X3XD 3HRUA 4XTZA 2ROLA 3CC2T 1YBYA 1WLPB 1G3YA 5GMKj 1JEGA 2G3RA 1D1CA 4BE2A 2AKLA 3EHQA 2IIMA 2EJ9A 3M9QA 4M77E 1RAHB 1YWPA 1M3BA 1N8RC 2Y4YA 1X6BA 1LVKA 1RLPC 5GAOl 3DLLA 5LJ3e 4QVCA 5HK0A 1AVZC 5KYWB 2Y4XA 5KCHA 3L2ZA 3CBOA 3PVQA 2PVGB 4PFPA 5GAMe 1IGUA 4IUQA 3KXTA 1Q82R 5LJ3j 4IIOA 4J6WA 2XDBA 2CZ7B 2GTOA 4OMLA 1ABOA 4ESRA 2M02A 2VUBA 3MEAA 4EMKB 1KQSS 2QG9B 5LJ5e 4XTXA 2KQWA 4Z02A 1YJ9A 4MDWA 1VQPA 3LYIA 5FROA 1OPKA 3V8JA 4FYWB 2M16A 1B34A 4WCIA 1KQ1A 1M8VA 4C92B 2E6NA 5LJ5j 1VQMT 1AZEA 4N4GA 1Y07A 3SEMA 4J6XA 3NPFA 1ZBXA 5KH6A 4GLMA 4LNPA 4DOWA 2E5QA 2I0NA 2ATCB 3BDUA 3X25B 1WIEA 1VQ8Q 3JB9F 3VYHB 1HJDA 1KG1A 5GAN6 2DO3A 4EPCA 1YHQA 2KYBA 1OI1A 2K7AA 1VQ7T 2J7IA 4RMOA 3OYIA 1X27A 4M7DA 4MMKA 4HXJA 3OY9A 1K8AR 5CVIA 2CZ0B 5CKFA 1HK9A 2CSIA 2RQVA 2LJ0A 2MPXC 1OOTA 1W1FA 3D7SB 4AFQC 4MZMA 4BE1A 2DERA 3DKMA 1M1KU 5CO7A 2VV5A 3FRNA 4LDWA 1UECA 2DRMA 4N0AA 1NJIR 1RAGB 1TOVA 2HKNA 2XHCA 1I07A 4E47A 1G3WA 4M78D 3JCMf 1CKAA 1MV0B 5J26A 3VS7A 1X2QA 3JRZA 1OU9A 2DJZA 5M9OA 2OX7A 4RCCA 3NGPA 5EC7A 3SWNA 2JNGA 2O01E 2QQ9A 3WVDB 2A08A 2SRCA 3P8HA 3TEEA 1G3SA 3PFSA 2XIDA 2K2MA 2KSSA 4EMGA 4OGCA 1Y57A 3OYBA 1XTDA 4M77G 3V7RA 4KUDK 2E3IA 4XU0A 1OX9A 4J8OA 3PMIA 2FG0A 4CI0C 1WXBA 2DETA 3H0IA 3OYDA 4X9CA 2A3LA 4PJMA 2O2OA 1Q86U 2FPFA 3V8KA 3AT1B 3OMGA 4J7FA 1KC8U 2YUOA 2LQNA 4PL6A 2JTFA 5IHNA 2EFIA 4M75A 4XAXB 1WQ7A 4RTTA 2E70A 3J7AF 2ZPHB 1WHMA 4BY6C 4RTWA 2O88A 4OB1B 4BE0A 1YITT 3EGXA 1RI9A 4N4HA 2XKOC 3M0RA 3M53A 3MP1A 2QDYB 2ZCFB 5KYYB 3HPWA 1PC0A 5IXFA 4AT1B 4J9IA 1QCNA 3L2WA 3OSVA 2K2VA 3PTAA 4M7DF 1SHGA 4X34A 3HRTA 1UGRB 2EGAA 4EIKA 3ZFJA 3CCRT 3CCLQ 1V76A 1VQ6Q 4KBMB 2K3XA 1TWBA 2A0FB 3M0SA 1UDLA 1OU8A 3CCSQ 3CC7T 1W2BA 3M0TA 2LQKA 5I2SA 4NOYA 9ATCB 1NM7A 1SRLA 1UB4A 1K73C 4JLGA 1VQOQ 3CCUQ 1B07A 4TVRA 3REBB 1QKXA 4UC4A 2LJ1A 4E7IA 5A2QE 2DAQA 4BY6B 4NS5A 2ZPGB 3L2UA 1N5ZA 4HCKA 1IB8A 1H8KA 1LOJA 1N6AA 1YWOA 2E65A 2O9VA 1YIJA 1TTHB 3I56A 2XDPA 1PD1A 3BE3A 2P4RA 4VUBA 1AWXA 3MHXA 1WQWA 1PSFA 3L2QA 2B8AA 2EKOA 2IVWA 2JTMA 3C12A 4M77B 2HSPA 4P5NA 1S72Q 2QQBA 1HSQA 3BY7A 5GAN7 4LDUA 2DILA 2XDDA 2DYBA 5GANg 1X43A 1RAIB 5GJWB 1QVGA 1WNLA 4M75F 3X24B 1W2BP 3VS3A 1PG5B 2DL4A 4J9BA 5DY9A 3CCQA 2ZGWA 1F1BB 2CUDA 3EAEA 2XICA 5CR2A 2RQTA 3OYCA 1ZA1B 4PKCC 3TSZA 3QHSA 1QKWA 1CKBA 1WHKA 3BDLA 3CXCP 4WTOB 1Q95G 2K5FA 3UDCA 2M0YA 1OQKA 1ZSGA 4JRIA 3RR6A 2KXCA 2O31A 3CD6A 1VQLA 1BYMA 1KHCA 4FSSA 5LJ3f 4OVAA 4QVZA 1BU1A 4L59A 1M30A 4X1VA 2QA4A 2RJFA 3LH0A 1JJ2A 5GAMf 2MI6A 3NTKA 2PVDB 2QASA 1CSKA 2M1HA 5GANd 4A63B 4XU1A 4DEYA 1R0CB 3JCMb 1NLOC 2DKGA 2FZKB 3G4SA 8ATCB 2NUPB 1X6OA 1PNJA 1QVGP 4OMNA 3HL8A 1OV3A 5FW9A 2E4HA 5LJ5f 4DA4A 4C8QC 3CBPA 2L3PA 4JZ3A 2YUPA 1MNEA 1YCSB 3EG9A 3RESA 1MMAA 3C0CA 2IPOB 2LT1A 1BIAA 5CKDA 4O6JA 2P4TA 4DBRA 1MUZA 4OP0A 1U06A 4F7UA 1AWJA 1Y0MA 3DB3A 2KVQG 4HVUA 1YJWT 3V7CA 2R5AA 4J9DA 3H8ZA 2VC8A 3O8VA 3TSWA 2LJ3A 3S3OA 4ZTJA 1G5VA 1Q86C 1LCKA 2DZ9A 1Q81R 1ZUYA 4JJCA 3A8MB 3NTIA 2LMJA 1N8RU 1BCOA 2HEQA 4OB0B 1NZ9A 4C0DC 2PVOB 1JJ2P 3E9FA 1UG1A 2LRQA 1FMKA 1YI2T 2CH4W 2K57A 4DBHA 5CCAA 2QTVA 3H0HA 7AT1B 3GNFB 2E5KA 2VWFA 2C0OA 3JCMe 1ZUUA 3F70A 2O4XA 4J9FA 2PU9B 3X20B 2XI9A 4Z88A 2EKHA 4XU2A 1VQ9Q 3EG3A 4JUVA 2HBPA 1M1KR 3A8OB 4RUGA 2DXTA 2YT6A 2CP0A 1IZ6A 1TUGB 2QEXQ 5HK3A 1VQ8A 2LT4A 4RTXA 1RADB 3CMEA 4Q5WA 2X9HA 3PMTA 2KR3A 3G71A 1VQKT 3G6ET 1QQJA 2KGTA 1M2VB 1BBZA 2LNHB 1YJNT 2YHTA 3JB9G 2E1HA 2RI2A 3CCMT 4NL2A 4DEXA 3M59A 2YLCA 3QO3A 3QZ9B 1W6XA 1N27A 5GAN8 1MV3A 2L2PA 1PRLC 2HAXA 3NHNA 2ECZA 1W2BS 2RD1A 3IQLA 1N9RA 1OULA 1TG0A 3HFNA 4BI8B 4F7UF 3AHUA 2EIFA 2BZ8A 2GNCA 3E1SA 4JPBW 3WVEB 2RI5A 2EQIA 4X9DA 1ZA2B 4JRPA 3OYKA 3CC4T 2VKNA 2QTXA 5GAN3 1BI3A 2HQXA 3SFMA 4C0ZA 1Z9QA 3DB4A 2H3EB 3FC3A 3NTHA 2K5LA 3C94A 1XQHA 3RMSA 4PJOG 1NE8A 1D0ZA 2HL3A 2V1RA 3RKWA 5D6YA 3QXEB 3CPWA 3X26B 2KK4A 1K9MR 1VQNT 2LCLA 5GMKm 1GBRA 2COWA 1QVGS 4M78A 2X4XA 3Q1JA 4J6YA 2JS0A 2MYSA 1WYXA 2Z0WA 1I0CA 3PGGA 1RACB 2CP3A 3MJXA 4D8KA 2VVKA 1M1FA 2WSEE 4E2FB 3CMAT 1Q82C 3A8GB 1WX6A 3QG1A 1E6HA 1NBEB 1AEYA 2DL3A 3LX7A 2COZA 3RUXA 4RTZA 1Y96B 2JN0A 3L42A 5HCKA 3M56A 1WHLA 1TS9A 2MWPA 1JJ2S 2NUZA 2CKKA 3MCAB 4PJOC 4EMKC 5D6XA 5KYUB 5FRNA 2R57A 3NMZC 2DEQA 1JQQA 3CPWP 3CCLA 1VQ6A 4DOVA 2CS7A 5CKBA 3I55T 1K1ZA 2PUOB 3OYYA 4MDXA 4C92C 4M7DG 3SB2A 3VUZA 1UJYA 2F2XA 3CCSA 4B9XA 3UPUA 2BKDN 2X4JA 3PVLA 1K0SA 4A4FA 1VQOA 3CCUA 2OTLT 2E12A 1KSWA 2A7YA 1ZUKA 5CIUA 2RNAA 1R0BG 1BI2A 2BZXA 2EVRA 2PZ1A 1GCQA 2KMTA 4C8QD 1AZGB 1YFNA 5C6SA 1K8AC 3PT9A 5C0MA 4ZNXA 1K73U 2X3WD 4O5VA 4LE9A 2KNBB 4OF1A 4JS5A 2J05A 2YXYA 1IRXA 2K79A 1S72A 4PJOB 3N5BB 1K76A 3HP9A 3EG0A 3OW2A 2GF7A 1QP3A 4M78F 4RTUA 1BB9A 5I11A 4JRKA 2COYA 5GAMg 2LX9A 2MOXA 2L0AA 4ELYC 1A0NB 4B6MA 4XTYA 3CC2Q 1W4SA 4QQDA 2EBPA 4JJBA 1SRMA 3QDRB 3CEYA 4L6V5 1U1TA 2OTJT 4M75G 5KE2A 1VUBA 1FMWA 4CC3A 1B34B 1P92A 1WGSA 1D1AA 2DJQA 4C0GA 2DYIA 2VGNA 2JMCA 2RQWA 1ZSZC 1UFFA 2LCCA 2L3QA 2LQWA 2DFUA 3OYGA 3ULRB 2EYQA 1GFCA 4M7AG 2J6KA 1YP5A 2NWMA 3OW2P 2J6OA 1E7OA 4AG1C 3CCJT 2M51A 4IIMA 4F7UE 2P0KA 3FDRA 2K9GA 3QDFA 4R0KA 4M7DB 3EG1A 1VIEA 4OMOA 3J81E 3CCVA 1KIKA 1QP2A 1JRIA 2FZGB 3JSCA 2VASA 3X28B 2L5QA 2ROTA 4E7HA 1D0XA 1VQMQ 3JV3A 5A0GA 4A53A 1WDXA 5FU6B 2O9SA 1M90U 4JRQA 3QPHA 2J6FA 4ZGJB 1VYTA 2CUBA 1WXTA 1RAAB 1VQ4A 2D0QB 1FYNA 2HKQB 3PIPA 2CP2A 1G2BA 4LXCA 5I21A 3VS0A 3UA6A 1ZSZB 3CPWS 3SWNB 5J3BA 4DBFA 5GAOr 2A28A 2LNVA 2JZ2A 2CGHA 2D8JA 4FW1A 2DM1A 2WSFE 2HQHA 4FYXB 4Z8AA 1VQ7Q 5GMKl 2DVJA 4D6WA 2EQJA 2OAWA 1WFWA 2EGCA 1WHJA 1OX8A 4PFOA 3OYHA 3LGFA 3META 3OS2A 2VB6A 2V8IA 1VQ9A 1QW1A 3L2VA 3QKJA 1OZ2A 1SHFA 3CCJQ 2V8JA 2LCSA 1YN8A 3JCMX 2CP6A 8AT1B 3MP6A 2LP5A 5CK9A 2QEXA 3I5RA 4RTVA 3OYAA 1UJ0A 1H3ZA 1D0YA 2FYKA 4GLKA 4M75B 5A0DA 4JJDA 5GANh 3VUBA 5KYYA 4C5EA 2QYZA 2JM9A 4M77C 2DMOA 3EFOA 2RHZA 3EGXB 2PQWA 1H641 2KBTA 1XJWB 2PTKA 1VQ5T 3EHRA 1VOMA 1ARKA 1UUEA 3CQTA 4M7AB 2RM4A 1YJ9T 4JLIA 5AYFA 4FT2A 4ZTFA 2ZPFB 4JZ4A 4Z89A 4PJOD 5DLQE 2E10A 4J9GA 2E6ZA 5GAN4 2A37A 2C0TA 1DJ7B 1O9SA 2EWNA 1KD1U 1D3BA 2EQUA 1U5SA 4C92D 2F69A 4HA8A 1M2OA 3QBYA 2AKKA 3MEVA 2DXUA 2D8HA 1YITQ 5ECAA 2RI3A 3VS6A 3LW5E 1H3HA 5KYXB 1KFZA 4M78E 2DTOA 4A4KA 3OW2S 2QDLA 4HVWA 2D0NA 3I35A 3JCMQ 4PJJA 3VYGA 2ENMA 5GAOq 4B9WA 4FYVB 3QSUA 1VA7A 2D9TA 2KRMA 2E64A 3CCRQ 1NEBA 5KE3A 5L23A 5GANj 3LH5A 1VQ5Q 2DVEA 3V8LA 3M0PA 3QYGB 2K3YA 2MF2A 2XU8A 4BB7A 1YJ9Q 1RAFB 1KQ2A 2ED0A 2CH4A 3CC7Q 1Q81C 3OBWA 3S3NA 2A36A 1SSFA 4M7DD 4CC2A 3TCJA 3THKA 5KCOA 3U23A 2F2VA 3FJ5A 1LPLA 4KT0E 4IUUA 2CP7A 1RAEB 2DXBA 2QK0A 2NUTA 2KT8A 3PIOA 4KGVB 3RKXA 1Q82U 4E6RA 2KYMA 2XMFA 4OGEA 2CYZB 4MZPA 4EDUA 4HT8A 3VS1A 3KFVA 3M57A 2AZSA 5FU7C 1M4ZA 5AT1B 2K6DA 2YRCA 1BI0A 1KJWA 3JB9I 2GFUA 1M90C 2DL5A 1RI0A 1G8XA 3TREA 2FL7A 1YNZA 2EYZA 3MEUA 1TU0B 1UE9A 1X2KA 2XG8D 4QQGA 1M3CA 2FZCB 3OYMA 2DTHA 1Q7YC 1PM3A 3VS2A 1VYVA 2RHIA 2AZVA 2RJDA 2W10A 4ORZA 4C5GA 3QIIA 3VV0A 2L3SA 1UGSB 3EG9B 2FB7A 3NFCA 1HXDA 4KRTA 4PJNA 5CKEA 1BCMA 4FL6A 1YCYA 4FYYB 2HBWA 1M8MA 1MGQA 1GCPA 4C92E 2DE0X 1JO8A 4HVVA 3QWYA 1K8AU 2MIOA 1U1SA 1C6VX 1IXDA 1T0JA 2JM8A 3UA7A 2X4YA 2BE7D 3RKYA 5FU7B 3H41A 4FSXA 3RMQA 1WHHA 2RJEA 2RA2A 1M9SA 3SDZA 3CC2A 1RL2A 1T0HA 4C8QA 2KY9A 5DLOA 2R5MA 4F16A 4M7AD 3HRSA 4AFSC 3VJPA 2HSEB 2O4XB 1ZQ1A 2EYXA 3JCMg 2L3RA 3OYFA 1NYGA 1I4K1 1TUDA 3KBGA 1MHNA 3C4SA 1YIJT 1C1AA 1D09B 1M2VA 3I56T 1KHIA 3QYHB 5IN1A 4KGXB 2XD0A 1YJWQ 5IXBA 2HZYA 3I9QA 1QVFA 1I8FA 3FEOA 2DD5A 4RG8A 4PJLA 1KD1C 4GY5A 1AT1B 3OS5A 4BUGA 4J7IA 3HSBA 1IHWA 3G1JA 2V8KA 4M77D 4CC4B 3URGA 1FX7A 4FCYA 4YTLA 1YI2Q 1Q86R 1MNDA 3J80E 4HT9A 1KC8R 1B3QA 3M54A 1QMCA 2KRSA 3ME9A 4E7KA 3CBMA 4R55A 3JCMd 1VQMA 1ZX6A 2QXFA 1ZBJA 3EGDA 1JU5C 3TQ7P 1SF9A 3QZ5B 2QAZA 4XU3A 3CD6T 2DD4A 1VQLT 2DEUA 4QT7A 1QVFP 1QWEA 5GMKh 2QA4T 2CREA 4BACA 4HCZA 1NEGA 2KE9A 4RG2A 4A4EA 1VQ7A 1HYOA 1VQKQ 3G6EQ 1PWTA 2KI7A 1YJNQ 1I5LA 3VKIA 3L1AA 3PE0A 1M1GA 5FWBA 4FT4A 2ED1A 3G4ST 3UATA 3EH1A 4E7SA 3QJ6A 2GGRA 3CCMQ 2DX1A 2RHUA 2EYWA 2JW4A 1UGVA 4C8QF 1Z9ZA 1EZZB 3C95A 3CCJA 2DPPB 5IAYA 1NPPA 2RK1A 4JDSA 3HTRA 1U3OA 4M4ZA
chains in the Genus database with same CATH topology
2DTIA 5GAMh 4XK8E 3OS1A 3E9GA 4UC4A 3I55A 3CCJT 2XK0A 4E7IA 5A2QE 4M78G 2DAQA 4BY6B 4F7UE 2EJFA 2P0KA 5FLXE 3OYNA 3FDRA 4NS5A 2ZPGB 3L2UA 2RHXA 1KQSA 1N6AA 1LOJA 2E65A 3GOXA 2GQVA 1NJIU 4M7DB 1YIJA 3I56A 3JB9H 2VXEA 2XDPA 2RHYA 4VUBA 2YLBA 3CCRA 1VIEA 2CZ6B 1N9SA 2X35A 3MHXA 3J81E 4BI4A 3CCVA 1QP2A 1JRIA 1WQWA 3JCMc 1PSFA 3JSCA 3VU3C 5LJ5h 3L2QA 2B8AA 3X28B 2L5QA 2EKOA 2E41A 2OTLA 2HNIA 4E7HA 2IVWA 2JTMA 2BUDA 3C12A 4M77B 5A0GA 4P5NA 4C8QB 4A53A 2VXFA 1K9MC 2LTOA 2QQBA 5CAIA 5FU6B 2YRVA 1M90U 4JRQA 3BY7A 3QPHA 4N4IA 5GAN7 4LDUA 4ZGJB 4HCCA 3UT1A 4JJNK 4R56A 1VQ4A 5GANf 2D0QB 2XDDA 3KUFA 4ZN1A 5GANg 3PIPA 1FXXA 2DIQA 2ZPIB 1QVGA 3E19A 1WNLA 3OBYA 4M75F 4DQ2A 3X24B 1G5VA 5DY9A 4M7DE 5I21A 2ZGWA 3CCQA 2RO0A 1UGQB 3CPWS 3SWNB 5J3BA 1JJ2S 3ASKA 3EAEA 5GAOr 2R58A 2XICA 5CR2A 2LNVA 3CCEA 2JZ2A 3OYCA 3TU4K 2CGHA 4PKCC 1M5Q1 3JB9J 2WSFE 3QHSA 1VQ8T 1H3ZA 3BDLA 5GMKl 5GAOp 2K5FA 4D6WA 3UDCA 2EQJA 2QI2A 1AHJB 4BD3A 2ZPEB 1I81A 2LQ8A 4RKUE 3CCQT 4C0DB 4JRIA 3CMET 1YITA 4M78C 3QJYA 2P0QA 3PNWC 3OYHA 3G71T 2FHDA 3LGFA 1R8OB 2QQRA 3META 5HY6A 3OS2A 1LJOA 5FRMA 2V8IA 3A8LB 1WPYA 2X4WA 4XTWA 1VQLA 1VQ9A 1KHCA 1QW1A 3CCET 3L2VA 5LJ3f 3ER0A 2L8DA 3QKJA 1OZ2A 4OVAA 4PJOA 4QVZA 4EMKA 5LJ3g 4OMFB 4L59A 1NJIC 2V8JA 2QQSA 2QA4A 2RJFA 3JCMX 2VGMA 3LH0A 3MP6A 5CK9A 5GAMf 1JJ2A 1VQKA 2QEXA 2MI6A 2LVMA 2EJGA 2AHJB 3NTKA 2PVDB 3OYJA 4M7DC 4OB3B 1LNXA 2M1HA 5GANd 2OTJA 3M4GA 4EMHA 4XU1A 2MMPA 2IG0A 1TH7A 1NPRA 2JVVA 3S6WA 3GF5A 4A4HA 2FYKA 2DKGA 4C92A 4GLKA 3JCMb 3CXCS 3G4SA 4M75B 4OB2B 5A0DA 5GANh 3VUBA 5GAMj 4C5EA 4C5HA 3G7ZA 1VQ5A 5LL6S 2MAMA 1X6OA 2LDMA 2P0PA 5GAN5 3GP8A 2PUKB 4A54A 3M5AA 3V7SA 4Y91A 3HL8A 4M77C 4RCBA 2DXCA 2RHZA 4FU6A 5LJ5f 4DA4A 4C8QC 4JS4A 2ZZDA 3CBPA 5LJ5g 4Y28E 3CC7A 5FU6C 3RESA 2LC4A 4V2SA 4N0AC 3S3MA 2LT1A 1BIAA 5CKDA 2PQWA 1UEBA 4E7JA 1H641 4O6JA 2P4TA 2F5KA 2I2LA 4OP0A 4F7UA 4HCBA 1VQ5T 4BDZA 3LGLA 3ZEHA 1EIFA 4BI3A 3M58A 3GLXA 3H6ZA 3DB3A 2KVQG 4M7AB 2RB6A 2RM4A 5I2MA 3JCMJ 1ZHIA 1YJWT 1YJ9T 4LDVA 1XNIA 2R5AA 4JLIA 3V7CA 3OMCA 5AYFA 2K5IA 4FT2A 3H8ZA 2VC8A 3O8VA 4PNOA 4LD6A 3SWNC 3S3OA 5LJ3d 2ZPFB 4ZTFA 4ZTJA 1QVFS 1XOVA 4M75E 1Q86C 4C92G 4PJOD 3FB9A 5DLQE 2E10A 2E6ZA 2FVUA 4M78B 5LJ3h 5GAN4 2DZ9A 1Q81U 3R6OA 5GAMd 3A8MB 3NTIA 1N8RU 2JUFA 1DJ7B 1O9SA 4OB0B 2EWNA 4MZTA 4ELZC 3FJPA 1KD1U 3OQ5A 1D3BA 1NZ9A 2PVOB 5L8RE 4XQ3A 1PSEA 4C0DC 3JCMP 2EQUA 1Y96A 4C92D 3E9FA 2F69A 5GAN2 2LRQA 4HA8A 1YI2T 2F5TX 2RK2A 4PLIA 3QBYA 2K57A 2K4YA 5CCAA 3MEVA 4FM4B 2DXUA 4E7LA 1U8RA 5LJ5d 4M7AE 3GNFB 3JCMe 3F70A 2O4XA 2Y90A 3L2RA 4MMLA 3DLMA 2PU9B 3X20B 2QQAA 4KUIA 2RI3A 2XI9A 3RERA 1OZ3A 3LW5E 4FIBA 3WXMB 3OYAA 1FWZA 1X01A 4M78E 4XU2A 3CD6A 4CRIA 4M75C 4JUVA 2HBPA 2DTOA 4ZN3A 3A8OB 4QVDA 4A4KA 3OW2S 3OB9A 3JCMW 3LWHA 2DXTA 4NL3A 5GMKe 1X75C 3JCMQ 1IZ6A 5EG2A 3UWNA 3VYGA 4IKFA 5GAOq 5HK3A 3OYEA 1VQ8A 4EMGA 5CQYA 4B9WA 4ATOA 3QSUA 2D9TA 1G3TA 2E64A 3HRUA 2LT4A 3MO8A 4XTZA 5KE3A 3LWIA 3CC2T 1YBYA 2KDSA 3CMEA 4Q5WA 5GANj 1G3YA 2DVEA 3V8LA 4PJOF 3PMTA 5GMKj 1Q7YU 3G71A 3QYGB 1VQKT 3G6ET 2G3RA 2K3YA 3JAME 2MF2A 1YJNT 2YHTA 4M7AC 3JB9G 4BE2A 2XU8A 4BB7A 1BI1A 2E1HA 2EJ9A 3CCLT 1KQ2A 1VQ6T 2RI2A 3M9QA 4M77E 4ZGDB 1Q81C 3OBWA 3CCMT 3S3NA 1SSFA 4M7DD 1N8RC 4NL2A 4C8QE 4C92F 4LDXA 3M59A 3TCJA 3RIRA 2Y4YA 1UGPB 2YLCA 4XTUA 3QO3A 1WJRA 3CPFA 5KCOA 3QUIA 3QZ9B 5GAOl 3DLLA 1N27A 3JB9D 3CCST 2RJCA 1WJQA 5LJ3e 3OSSC 4QVCA 5HK0A 5GAN8 4KT0E 4IUUA 3ZBDA 2Y4XA 3A8HB 4L5GA 5KCHA 2HAXA 3L2ZA 2JOYA 3CBOA 4ME7A 1W2BS 2DXBA 2RD1A 2PVGB 5GAMe 4IUQA 3PIOA 1N9RA 2RH2A 3RKXA 3KXTA 3CCUT 1VQOT 3HFNA 3M55A 4BI8B 4F7UF 2EIFA 5LJ3j 1Q82U 3AHUA 2GFAA 4OGEA 2CYZB 4MZPA 4EDUA 4J6WA 3E1SA 3WVEB 4HT8A 2RI5A 2XDBA 2CZ7B 3BW1A 1QVPA 4X9DA 4JRPA 3M57A 5FU7C 1M4ZA 3OYKA 2VUBA 3MEAA 1BI0A 4EMKB 3CC4T 1KQSS 5LJ5e 2OAUA 2QTXA 4XTXA 3JB9I 2KQWA 2GFUA 5GAN3 1M90C 4Z02A 1BI3A 1YJWA 3MEWA 2HQXA 1YJ9A 3SFMA 2EQMA 4MDWA 4C0ZA 1VQPA 1RI0A 3LYIA 5FROA 3TREA 3DB4A 2FL7A 3FLGA 3V8JA 1BIBA 3FC3A 2HD0A 3MP8A 2K5LA 3C94A 1XQHA 3MEUA 3NTHA 2M16A 1B34A 3HKSA 3RMSA 1KQ1A 4PJOG 1M8VA 1NE8A 4C92B 2E6NA 5LJ5j 1VQMT 4QQGA 1O75A 2XG8D 4N4GA 4BDYA 1Y07A 1S72T 3OYMA 1BKBA 2DK3A 2DTHA 4J6XA 5KH6A 1ZBXA 1Q7YC 4M7AA 4IUTA 2DZCA 2RHIA 5D6YA 3RKWA 1VQPT 3QXEB 4HKEA 4DOWA 3CPWA 3X26B 2KK4A 1K9MU 2RJDA 1VQNT 2LCLA 2E5QA 4C5GA 5GMKm 3QIIA 3VV0A 3BDUA 1UGSB 3X25B 2FB7A 1YI2A 3NFCA 1HXDA 4M78A 2X4XA 4QW2A 1QVGS 3Q1JA 3JB9F 4J6YA 3VYHB 5CKEA 2EAYA 1KG1A 5GAN6 4FL6A 1YCYA 1BYMA 5CQXA 2CZ1B 2DO3A 3PGGA 3JCMV 4EPCA 1YHQA 1OI1A 1VQ7T 1MGQA 1GXIE 4RMOA 1M1FA 3T9NA 2EQKA 2WSEE 4C5IA 4C92E 4F7UG 1Y7XA 3OYIA 3CMAT 4M7DA 4MMKA 1Q82C 3A8GB 4PLLA 3QG1A 3OY9A 1K8AU 1U1SA 5CVIA 3LX7A 1YHQT 2CZ0B 5CKFA 1HK9A 2X4YA 3RKYA 3RUXA 5FU7B 3GPLA 1D3BB 4KULA 3CXCA 1Y96B 4FSXA 4MZMA 4BE1A 2JN0A 3RMQA 2RJEA 3DKMA 2RA2A 1M9SA 3L42A 4M77A 3SDZA 1M1KU 5CO7A 2VV5A 1RL2A 3CC2A 5D6WA 3FRNA 3M56A 4LDWA 4C8QA 2KY9A 5DLOA 2R5MA 4M7AD 2MWPA 2BIVA 3HRSA 2CKKA 3MCAB 4J83A 4N0AA 3VJPA 4EMKC 1Y71A 5D6XA 5GANe 5GAOn 3G6EA 2C06A 5FRNA 2D6FA 1YJNA 2XHCA 2R57A 3GNGA 4E47A 5J39A 2DEQA 2O4XB 1ZQ1A 3CCLA 1G3WA 1VQ6A 4M78D 2CS7A 5CKBA 3JCMf 4DOVA 3I55T 3CCMA 2PUOB 3JCMg 5J26A 3A5ZB 1OYXA 3INZA 3JRZA 3OYYA 2L3RA 3OYFA 3KBGA 1I4K1 2DJZA 4C92C 4M7DG 4MDXA 3SB2A 1MHNA 5M9OA 4RCCA 3VUZA 3SWNA 3HHTB 3C4SA 1YIJT 3I56T 3CCSA 2JNGA 2O01E 1KHIA 3QYHB 2QQ9A 5IN1A 3WVDB 4B9XA 2H3JA 2XD0A 3UPUA 2BKDN 3P8HA 3TEEA 1QVFA 1G3SA 3CCVT 1I8FA 2XIDA 1VIFA 2M0OA 2KSSA 2DD5A 2X4JA 3FEOA 3PFSA 2ZPBB 4OGCA 4RG8A 3OYBA 1XTDA 4M77G 4WF2A 3V7RA 1KD1C 5IT9E 4KUDK 4A4FA 1VQOA 3CCUA 2OTLT 4XU0A 4C8QG 2E12A 4GY5A 5GMKi 3OS5A 2A7YA 4BUGA 5CIUA 3OS0A 4J7IA 2HQEA 4LDYA 5CKHA 2L89A 4J8OA 3PMIA 3HSBA 1BI2A 1VQ4T 2V8KA 4CI0C 4M77D 5A0LA 1JBMA 3URGA 1FX7A 2KMTA 2A3LA 4X9CA 3OYDA 4C8QD 3CC4A 1Q86U 4YTLA 5C6SA 2VYTA 1K8AC 3V8KA 3PT9A 2KAFA 3J80E 4HT9A 3OMGA 3P8BB 4J7FA 3SD4A 5C0MA 5DM7R 1KC8U 1K73U 3M54A 4PL6A 4O5VA 2JTFA 2EFIA 3ME9A 4M75A 4E7KA 3CBMA 4OF1A 4J5YA 4XAXB 3JCMd 4R55A 4JS5A 4M7AF 1M1KC 1VQMA 1WQ7A 2WSCE 1JB0E 2E70A 2QXFA 1S72A 4PJOB 3N5BB 3JCMh 3HP9A 3J7AF 3HFOA 2ZPHB 3LLRA 2GF7A 4BY6C 3OW2A 4II1A 1QP3A 4M78F 4IURA 4OB1B 4BE0A 1YITT 3QZ5B 4JRKA 4N4HA 1VQNA 2XKOC 5GAMg 4XU3A 3M53A 4PJOC 4C0FA 2LX9A 3CD6T 2DD4A 2WACA 1VQLT 3MP1A 1VQ9T 2QDYB 2ZCFB 4ELYC 4A4GA 3HPWA 4XTYA 5GMKh 1W4SA 4QQDA 3L2WA 2QA4T 3OSVA 4BACA 4HCZA 4QQ6A 2K2VA 3OA6A 3QDRB 3PTAA 2QEXT 4M7DF 3CEYA 4RG2A 4A4EA 4L6V5 3FIFA 4X34A 3OYLA 3HRTA 1VQ7A 1U1TA 1UGRB 4LD9K 1V29B 2OTJT 1I5LA 3GIBA 4M75G 3VKIA 3L1AA 1M1GA 4FT4A 3ZFJA 3CCRT 5KE2A 4IUVA 1VUBA 3G4ST 4PJOE 3CMAA 1B34B 4F7UB 1P92A 1WGSA 4KBMB 3QJ6A 5HKCA 5GAOm 2M9UA 2K3XA 1WJSA 2MWOA 2RHUA 3EFSA 3P8DA 4M77F 4C0GA 4C8QF 2VGNA 4XTVA 4ZGEB 4M75D 2DIGA 3C95A 3CC7T 3BFMA 3CCJA 2LCCA 2DPPB 1W2BA 2GCXA 2LQKA 1IREB 5I2SA 5IAYA 1NPPA 4NOYA 3OYGA 1KC8C 2RK1A 2EYQA 1UB4A 4IUPA 1K73C 3EFRA 4JLGA 4M7AG 4JDSA 2NLUA 3M4YA 4TVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H64 1;  2DTI A;  5GAM h;  2I2L A;  4OP0 A;  1N9R A;  4F7U A;  3RKX A;  3HFN A;  4F7U F;  3AHU A;  5LJ3 j;  4M78 G;  4F7U E;  2EJF A;  1I8F A;  4J6W A;  4EMG A;  3JCM J;  4M7A B;  2RB6 A;  2RM4 A;  4HT8 A;  2E65 A;  1LOJ A;  3V7C A;  4M7D B;  4M77 G;  4JLI A;  3BW1 A;  4WF2 A;  3V7R A;  4X9D A;  2VC8 A;  2VXE A;  4PNO A;  3JB9 H;  3SWN C;  4XU0 A;  5LJ3 d;  4C8Q G;  2YLB A;  4M75 E;  5GMK i;  4C92 G;  4PJO D;  3FB9 A;  1N9S A;  4EMK B;  2E10 A;  5LJ5 e;  2QTX A;  4XTX A;  3JB9 I;  1JRI A;  1WQW A;  3JCM c;  3VU3 C;  4M78 B;  5LJ3 h;  5LJ5 h;  5GAN 3;  5GAN 4;  2DZ9 A;  3HSB A;  5GAM d;  2E41 A;  2HNI A;  2EWN A;  4M77 D;  3FJP A;  1JBM A;  4M77 B;  3V8J A;  1BIB A;  4X9C A;  1D3B A;  4C8Q D;  4XQ3 A;  3JCM P;  4C8Q B;  4A53 A;  1B34 A;  2VXF A;  1Y96 A;  1KQ1 A;  4PJO G;  4C92 D;  4C92 B;  3V8K A;  5CAI A;  1M8V A;  5LJ5 j;  5GAN 2;  4HT9 A;  3BY7 A;  5GAN 7;  4HA8 A;  2DTH A;  4J6X A;  5GAN f;  2K57 A;  5GAN g;  4M7A A;  3RKW A;  2DZC A;  4M75 A;  4M7A F;  4J5Y A;  1WNL A;  2DXU A;  3JCM d;  4M75 F;  5LJ5 d;  4DQ2 A;  4M7A E;  1WQ7 A;  5DY9 A;  5GMK m;  4M7D E;  3JCM e;  5I21 A;  2ZGW A;  4PJO B;  3BDU A;  2Y90 A;  3JCM h;  2FB7 A;  4MML A;  3HFO A;  1HXD A;  4M78 A;  3JB9 F;  3SWN B;  3RER A;  4J6Y A;  5GAO r;  4M78 F;  1X01 A;  2EAY A;  4M78 E;  2CGH A;  4JRK A;  1M5Q 1;  4XU2 A;  3QHS A;  5GAN 6;  5GAM g;  3JB9 J;  1YCY A;  4JUV A;  4M75 C;  2DTO A;  4XU3 A;  3JCM V;  3PGG A;  4QVD A;  5GMK l;  5GAO p;  3JCM W;  1MGQ A;  1I81 A;  2DXT A;  4NL3 A;  5GMK e;  4JRI A;  4XTY A;  3JCM Q;  4M78 C;  5GMK h;  4C92 E;  5GAO q;  4F7U G;  4M7D D;  3QSU A;  4M7D A;  1LJO A;  4MMK A;  1WPY A;  2E64 A;  4XTW A;  4M7D F;  4XTZ A;  3FIF A;  5LJ3 f;  1U1T A;  1U1S A;  4PJO A;  4EMK A;  5LJ3 g;  1I5L A;  5GAN j;  3GIB A;  4M75 G;  3L1A A;  1HK9 A;  2DVE A;  3RKY A;  4PJO F;  3RUX A;  3V8L A;  5GMK j;  1D3B B;  4PJO E;  3JCM X;  1B34 B;  4F7U B;  1Y96 B;  5GAM f;  2JN0 A;  2YHT A;  3JB9 G;  2EJG A;  5GAO m;  4M7A C;  2RA2 A;  4M77 A;  4M7D C;  2E1H A;  1LNX A;  2EJ9 A;  3EFS A;  4M77 F;  3M4G A;  4C8Q A;  4EMH A;  4XU1 A;  5GAN d;  1KQ2 A;  1TH7 A;  4M77 E;  3JCM b;  4M7A D;  4C92 A;  4C8Q F;  2FYK A;  2DKG A;  4XTV A;  5GAN e;  4M75 D;  4N0A A;  4EMK C;  4M75 B;  4NL2 A;  4C8Q E;  4C92 F;  5GAN h;  5GAO n;  4PJO C;  5GAM j;  3RIR A;  3BFM A;  2YLC A;  4XTU A;  3QO3 A;  5GAN 5;  2DEQ A;  5GAO l;  3QUI A;  3JB9 D;  4A54 A;  3V7S A;  4Y91 A;  5LJ3 e;  4NOY A;  4M78 D;  4M77 C;  3JCM f;  4QVC A;  4RCB A;  5GAN 8;  5LJ5 f;  3JCM g;  4C8Q C;  3INZ A;  4M7A G;  3EFR A;  5LJ5 g;  3L2Z A;  4C92 C;  1I4K 1;  2DJZ A;  3RES A;  4M7D G;  4V2S A;  4N0A C;  2RD1 A;  3SB2 A;  4RCC A;  1BIA A;  5GAM e;  3SWN A; 
#chains in the Genus database with same CATH topology
 2RQU A;  5GAM h;  1SKU B;  4XK8 E;  3OS1 A;  2XK0 A;  4LUD A;  3OYN A;  5FLX E;  3I5S A;  2RHX A;  2JMA A;  2GQV A;  3CC4 Q;  4E7Z A;  2RHY A;  2QGG A;  2YLB A;  2CZ6 B;  1N9S A;  1G83 A;  2X35 A;  3JCM c;  5LJ5 h;  1IHV A;  1PD0 A;  2E41 A;  2BUD A;  1C0M A;  2VXF A;  2LTO A;  2RPN A;  2YRV A;  4N4I A;  1IO6 A;  4AG2 C;  4HCC A;  2YDL A;  5GAN f;  1VQN Q;  4ZN1 A;  1FXX A;  2DIQ A;  2ZPI B;  2GTJ A;  2G6F X;  4DQ2 A;  3G4S Q;  2JXB A;  3RNJ A;  2RO0 A;  1UGQ B;  5KYN A;  5KYW A;  1NYF A;  2EYY A;  1OPL A;  3TU4 K;  3JB9 J;  1VQ8 T;  1PCX A;  2LX7 A;  2QI2 A;  1AHJ B;  4BD3 A;  2ZPE B;  1I81 A;  2LQ8 A;  2GBQ A;  3CMA Q;  3CME T;  1YIT A;  3QJY A;  2P0Q A;  3PNW C;  3G71 T;  2QQR A;  5HY6 A;  1LJO A;  4F04 B;  3A8L B;  3CCE T;  2X4W A;  3ER0 A;  4PJO A;  4EMK A;  5LJ3 g;  4OMF B;  1NJI C;  1JXM A;  2QGF B;  2FRW A;  3A98 A;  2DBM A;  1RLQ C;  1QLY A;  2EJG A;  3VS4 A;  2AHJ B;  4M7D C;  4OB3 B;  4OMQ A;  2IG0 A;  5FRM A;  4A4H A;  4C92 A;  3CCR A;  4OB2 B;  2MCN A;  5GAM j;  3I55 Q;  1EX4 A;  3G7Z A;  5IHI A;  1VQ5 A;  5LL6 S;  2MAM A;  4LUE A;  5GJV B;  1EFN A;  5GAN 5;  4A54 A;  3M5A A;  3V7S A;  4Y91 A;  1KK7 A;  3ZL7 C;  4JS4 A;  3VRY A;  5LJ5 g;  4Y28 E;  3CC7 A;  5FU6 C;  4N0A C;  3S3M A;  4E7J A;  5IHK A;  2W0Z A;  4HCB A;  1MMD A;  3LGL A;  1EIF A;  4AFZ C;  2OTL Q;  3H6Z A;  1I5O B;  3JCM J;  4KGZ B;  5I2M A;  1ZHI A;  1UHF A;  2CDT A;  3OMC A;  4PFZ A;  4PNO A;  4LD6 A;  3SWN C;  1QVF S;  5LJ3 d;  3FB9 A;  1X69 A;  2FVU A;  1J3T A;  1Q81 U;  5GAM d;  4D8D A;  1SPK A;  1WZO A;  2JUF A;  1N8R R;  4ELZ C;  1MMN A;  1HD3 A;  3CME Q;  1PSE A;  3JCM P;  3G71 Q;  5GAN 2;  3CCE Q;  2RK2 A;  4PLI A;  1ACM B;  4FM4 B;  4E7L A;  4OMP A;  5LJ5 d;  1SG5 A;  2PNI A;  1T3L A;  2DRK A;  2JS2 A;  3EH2 A;  2KEA A;  3DLM A;  2QQA A;  1UHC A;  1OZ3 A;  4ANJ A;  3WXM B;  2CP5 A;  4CRI A;  4M75 C;  4ZN3 A;  3OB9 A;  3JCM W;  2F1L A;  3LWH A;  1AWO A;  4NL3 A;  2HMA A;  1X75 C;  3UWN A;  2DLP A;  1K4U S;  2OTJ Q;  1G3T A;  3H9N A;  3MO8 A;  3LWI A;  2KDS A;  1V1C A;  1ZSZ A;  4PJO F;  1Q7Y U;  3JAM E;  1SSH A;  4M7A C;  1AOJ A;  2EGE A;  1WI7 A;  1BI1 A;  2KT1 A;  2CSQ A;  1X6G A;  3CCL T;  2YWW A;  1VQ6 T;  1WA7 A;  2NYS A;  4ZGD B;  1SEM A;  4C8Q E;  4C92 F;  4LDX A;  3RIR A;  1UGP B;  4XTU A;  1WJR A;  1PHT A;  2FPE A;  3CPF A;  3QUI A;  3JB9 D;  3CCS T;  2RJC A;  1WJQ A;  3OSS C;  2GQI A;  4FW2 A;  3ZBD A;  3A8H B;  4L5G A;  1JXO A;  2JOY A;  4ME7 A;  5I22 A;  2FO0 A;  2RH2 A;  3CCU T;  1VQO T;  3M55 A;  1GBQ A;  2LZ6 B;  2FEI A;  2GFA A;  3M0Q A;  3RDV A;  3BW1 A;  1QVP A;  2JT4 A;  2OAU A;  1YJW A;  3MEW A;  4RTY A;  2EQM A;  2DNU A;  1E6G A;  3UF4 A;  3FLG A;  1BIB A;  2HD0 A;  3MP8 A;  2KRO A;  3HKS A;  2X51 A;  2SEM A;  2DA9 A;  1O75 A;  4BDY A;  1S72 T;  1BKB A;  2DK3 A;  4LN2 A;  2YSQ A;  4KH1 B;  4M7A A;  4IUT A;  2DZC A;  1VQP T;  4HKE A;  1K9M U;  3EFO B;  2EPD A;  1YI2 A;  2RF0 A;  4QW2 A;  3RBB B;  2H8H A;  1GRI A;  1PKT A;  4KH0 B;  2EAY A;  2OJ2 A;  5CQX A;  2CZ1 B;  3JCM V;  4J9H A;  4OMM A;  2KRN A;  1GXI E;  1K0X A;  1W70 A;  2EQK A;  4C5I A;  1GFD A;  4F7U G;  2ABL A;  1Y7X A;  4J9C A;  1H92 A;  4K11 A;  2J06 A;  2K3B A;  4PLL A;  1OEB A;  1YHQ T;  1VYU A;  3GPL A;  1D3B B;  2FRY A;  4KUL A;  4DBQ A;  3CXC A;  5KYX A;  1TSF A;  4M77 A;  5D6W A;  1M3A A;  4J83 A;  2BIV A;  2DF6 A;  5GAN e;  2C06 A;  5GAO n;  3G6E A;  1Y71 A;  1VQK A;  2D6F A;  1YJN A;  3GNG A;  5J39 A;  3R6N A;  2DL8 A;  2CT4 A;  2D1X A;  3CCM A;  2RN8 A;  3A5Z B;  1OYX A;  3INZ A;  2E3H A;  3QWX X;  3HHT B;  2BZY A;  4F14 A;  2KXD A;  2H3J A;  1VQP Q;  3CCV T;  1VIF A;  2M0O A;  2ZPB B;  4WF2 A;  5IT9 E;  3EG2 A;  4C8Q G;  2C0I A;  5GMK i;  3GBQ A;  4F17 A;  3OS0 A;  1NLP C;  2HQE A;  4LDY A;  1ABQ A;  5CKH A;  2L89 A;  1VQ4 T;  5A0L A;  1JBM A;  3CC4 A;  1I1J A;  2VYT A;  2KAF A;  1QCO A;  1RAB B;  2P84 A;  3P8B B;  3SD4 A;  5DM7 R;  1K73 R;  2RQR A;  3TVT A;  1YHQ Q;  4J5Y A;  4M7A F;  2OI3 A;  2NUP A;  1M1K C;  2WSC E;  1JB0 E;  1S1N A;  3JCM h;  3HFO A;  2NUT B;  2YRD A;  3LLR A;  4II1 A;  4IUR A;  1VQN A;  3VRZ A;  1M27 C;  4C0F A;  2WAC A;  1VQ9 T;  3EGU A;  4A4G A;  4QQ6 A;  3OA6 A;  2QEX T;  3FIF A;  1RUW A;  2ZAE A;  1BK2 A;  3OYL A;  4LD9 K;  1V29 B;  5FWC A;  3GIB A;  2DBK A;  4IUV A;  4PJO E;  3CMA A;  4F7U B;  3CCV Q;  1ZLM A;  3SHW A;  3E2U A;  5HKC A;  5GAO m;  2M9U A;  1WJS A;  2MWO A;  3EFS A;  3P8D A;  4M77 F;  4ZGE B;  4XTV A;  4M75 D;  2DIG A;  3BFM A;  3A1P A;  2GCX A;  1IRE B;  1VQ4 Q;  1KC8 C;  4IUP A;  1WXU A;  3EFR A;  2NLU A;  1GL5 A;  3M4Y A;  3T9N A;  2DTI A;  3E9G A;  3I55 A;  3O5Z A;  2AIR B;  4M78 G;  2EJF A;  2HDA A;  1KQS A;  1NJI U;  1UTI A;  3GOX A;  3JB9 H;  2VXE A;  4BI4 A;  3M0U A;  6AT1 B;  3VU3 C;  2V26 A;  2ESW A;  1K9A A;  1NG2 A;  2HNI A;  2OTL A;  1PRM C;  2EW3 A;  3MKD A;  4C8Q B;  1K9M C;  5CAI A;  2FPD A;  1M90 R;  2YUN A;  3UT1 A;  4JJN K;  4R56 A;  2JJ9 A;  3KUF A;  2V1Q A;  3E19 A;  3OBY A;  5IH2 A;  4M7D E;  2YUQ A;  1TXQ A;  1Q7Y R;  3ASK A;  2R58 A;  1QCF A;  4PK4 A;  3CCE A;  2HCK A;  1M5Q 1;  2AK5 A;  2BE9 B;  5GAO p;  3VS5 A;  4RKU E;  3CCQ T;  4C0D B;  4M78 C;  2MK5 A;  1KQS P;  1WHG A;  2FHD A;  1R8O B;  1FMV A;  1WPY A;  4XTW A;  2L8D A;  2QQS A;  1D1B A;  2VGM A;  2LVM A;  3OYJ A;  1LNX A;  2OTJ A;  3M4G A;  4EMH A;  2MMP A;  2JVV A;  1TH7 A;  1NPR A;  3S6W A;  3CXC S;  3GF5 A;  4Y92 A;  2F2W A;  4C5H A;  2B86 A;  2LDM A;  2P0P A;  1B7T A;  3GP8 A;  2PUK B;  4J9E A;  3EGD B;  4RCB A;  2DXC A;  4FU6 A;  1YIJ Q;  2BTT A;  2ZZD A;  3I56 Q;  4QKU A;  2LC4 A;  2DL7 A;  4V2S A;  1UEB A;  2F5K A;  2I2L A;  4BDZ A;  3ZEH A;  4BI3 A;  3M58 A;  3GLX A;  4AFU C;  2RB6 A;  4LDV A;  1XNI A;  3H0F A;  2K5I A;  1T3S A;  1XOV A;  4M75 E;  4C92 G;  4M78 B;  5LJ3 h;  3R6O A;  4MZT A;  3FJP A;  1KD1 R;  3OQ5 A;  1IGQ A;  2AT1 B;  5L8R E;  3REA B;  3CCQ Q;  4XQ3 A;  1Y96 A;  2RMO A;  2JTE A;  1TUC A;  1PKS A;  2F5T X;  4AMC A;  2K4Y A;  1R77 A;  4CC7 A;  5KYU A;  1AWW A;  2HL5 C;  1U8R A;  1GCQ C;  4M7A E;  1QWF A;  2Y90 A;  3L2R A;  4MML A;  4GBQ A;  4KUI A;  3RER A;  1MMG A;  4FIB A;  3CD6 Q;  1FWZ A;  1X01 A;  1VQL Q;  1AD5 A;  4QVD A;  2CT3 A;  3MPU B;  2QA4 Q;  5GMK e;  5EG2 A;  4IKF A;  3OYE A;  5D7U A;  5CQY A;  4ATO A;  2X3X D;  3HRU A;  4XTZ A;  2ROL A;  3CC2 T;  1YBY A;  1WLP B;  1G3Y A;  5GMK j;  1JEG A;  2G3R A;  1D1C A;  4BE2 A;  2AKL A;  3EHQ A;  2IIM A;  2EJ9 A;  3M9Q A;  4M77 E;  1RAH B;  1YWP A;  1M3B A;  1N8R C;  2Y4Y A;  1X6B A;  1LVK A;  1RLP C;  5GAO l;  3DLL A;  5LJ3 e;  4QVC A;  5HK0 A;  1AVZ C;  5KYW B;  2Y4X A;  5KCH A;  3L2Z A;  3CBO A;  3PVQ A;  2PVG B;  4PFP A;  5GAM e;  1IGU A;  4IUQ A;  3KXT A;  1Q82 R;  5LJ3 j;  4IIO A;  4J6W A;  2XDB A;  2CZ7 B;  2GTO A;  4OML A;  1ABO A;  4ESR A;  2M02 A;  2VUB A;  3MEA A;  4EMK B;  1KQS S;  2QG9 B;  5LJ5 e;  4XTX A;  2KQW A;  4Z02 A;  1YJ9 A;  4MDW A;  1VQP A;  3LYI A;  5FRO A;  1OPK A;  3V8J A;  4FYW B;  2M16 A;  1B34 A;  4WCI A;  1KQ1 A;  1M8V A;  4C92 B;  2E6N A;  5LJ5 j;  1VQM T;  1AZE A;  4N4G A;  1Y07 A;  3SEM A;  4J6X A;  3NPF A;  1ZBX A;  5KH6 A;  4GLM A;  4LNP A;  4DOW A;  2E5Q A;  2I0N A;  2ATC B;  3BDU A;  3X25 B;  1WIE A;  1VQ8 Q;  3JB9 F;  3VYH B;  1HJD A;  1KG1 A;  5GAN 6;  2DO3 A;  4EPC A;  1YHQ A;  2KYB A;  1OI1 A;  2K7A A;  1VQ7 T;  2J7I A;  4RMO A;  3OYI A;  1X27 A;  4M7D A;  4MMK A;  4HXJ A;  3OY9 A;  1K8A R;  5CVI A;  2CZ0 B;  5CKF A;  1HK9 A;  2CSI A;  2RQV A;  2LJ0 A;  2MPX C;  1OOT A;  1W1F A;  3D7S B;  4AFQ C;  4MZM A;  4BE1 A;  2DER A;  3DKM A;  1M1K U;  5CO7 A;  2VV5 A;  3FRN A;  4LDW A;  1UEC A;  2DRM A;  4N0A A;  1NJI R;  1RAG B;  1TOV A;  2HKN A;  2XHC A;  1I07 A;  4E47 A;  1G3W A;  4M78 D;  3JCM f;  1CKA A;  1MV0 B;  5J26 A;  3VS7 A;  1X2Q A;  3JRZ A;  1OU9 A;  2DJZ A;  5M9O A;  2OX7 A;  4RCC A;  3NGP A;  5EC7 A;  3SWN A;  2JNG A;  2O01 E;  2QQ9 A;  3WVD B;  2A08 A;  2SRC A;  3P8H A;  3TEE A;  1G3S A;  3PFS A;  2XID A;  2K2M A;  2KSS A;  4EMG A;  4OGC A;  1Y57 A;  3OYB A;  1XTD A;  4M77 G;  3V7R A;  4KUD K;  2E3I A;  4XU0 A;  1OX9 A;  4J8O A;  3PMI A;  2FG0 A;  4CI0 C;  1WXB A;  2DET A;  3H0I A;  3OYD A;  4X9C A;  2A3L A;  4PJM A;  2O2O A;  1Q86 U;  2FPF A;  3V8K A;  3AT1 B;  3OMG A;  4J7F A;  1KC8 U;  2YUO A;  2LQN A;  4PL6 A;  2JTF A;  5IHN A;  2EFI A;  4M75 A;  4XAX B;  1WQ7 A;  4RTT A;  2E70 A;  3J7A F;  2ZPH B;  1WHM A;  4BY6 C;  4RTW A;  2O88 A;  4OB1 B;  4BE0 A;  1YIT T;  3EGX A;  1RI9 A;  4N4H A;  2XKO C;  3M0R A;  3M53 A;  3MP1 A;  2QDY B;  2ZCF B;  5KYY B;  3HPW A;  1PC0 A;  5IXF A;  4AT1 B;  4J9I A;  1QCN A;  3L2W A;  3OSV A;  2K2V A;  3PTA A;  4M7D F;  1SHG A;  4X34 A;  3HRT A;  1UGR B;  2EGA A;  4EIK A;  3ZFJ A;  3CCR T;  3CCL Q;  1V76 A;  1VQ6 Q;  4KBM B;  2K3X A;  1TWB A;  2A0F B;  3M0S A;  1UDL A;  1OU8 A;  3CCS Q;  3CC7 T;  1W2B A;  3M0T A;  2LQK A;  5I2S A;  4NOY A;  9ATC B;  1NM7 A;  1SRL A;  1UB4 A;  1K73 C;  4JLG A;  1VQO Q;  3CCU Q;  1B07 A;  4TVR A;  3REB B;  1QKX A;  4UC4 A;  2LJ1 A;  4E7I A;  5A2Q E;  2DAQ A;  4BY6 B;  4NS5 A;  2ZPG B;  3L2U A;  1N5Z A;  4HCK A;  1IB8 A;  1H8K A;  1LOJ A;  1N6A A;  1YWO A;  2E65 A;  2O9V A;  1YIJ A;  1TTH B;  3I56 A;  2XDP A;  1PD1 A;  3BE3 A;  2P4R A;  4VUB A;  1AWX A;  3MHX A;  1WQW A;  1PSF A;  3L2Q A;  2B8A A;  2EKO A;  2IVW A;  2JTM A;  3C12 A;  4M77 B;  2HSP A;  4P5N A;  1S72 Q;  2QQB A;  1HSQ A;  3BY7 A;  5GAN 7;  4LDU A;  2DIL A;  2XDD A;  2DYB A;  5GAN g;  1X43 A;  1RAI B;  5GJW B;  1QVG A;  1WNL A;  4M75 F;  3X24 B;  1W2B P;  3VS3 A;  1PG5 B;  2DL4 A;  4J9B A;  5DY9 A;  3CCQ A;  2ZGW A;  1F1B B;  2CUD A;  3EAE A;  2XIC A;  5CR2 A;  2RQT A;  3OYC A;  1ZA1 B;  4PKC C;  3TSZ A;  3QHS A;  1QKW A;  1CKB A;  1WHK A;  3BDL A;  3CXC P;  4WTO B;  1Q95 G;  2K5F A;  3UDC A;  2M0Y A;  1OQK A;  1ZSG A;  4JRI A;  3RR6 A;  2KXC A;  2O31 A;  3CD6 A;  1VQL A;  1BYM A;  1KHC A;  4FSS A;  5LJ3 f;  4OVA A;  4QVZ A;  1BU1 A;  4L59 A;  1M30 A;  4X1V A;  2QA4 A;  2RJF A;  3LH0 A;  1JJ2 A;  5GAM f;  2MI6 A;  3NTK A;  2PVD B;  2QAS A;  1CSK A;  2M1H A;  5GAN d;  4A63 B;  4XU1 A;  4DEY A;  1R0C B;  3JCM b;  1NLO C;  2DKG A;  2FZK B;  3G4S A;  8ATC B;  2NUP B;  1X6O A;  1PNJ A;  1QVG P;  4OMN A;  3HL8 A;  1OV3 A;  5FW9 A;  2E4H A;  5LJ5 f;  4DA4 A;  4C8Q C;  3CBP A;  2L3P A;  4JZ3 A;  2YUP A;  1MNE A;  1YCS B;  3EG9 A;  3RES A;  1MMA A;  3C0C A;  2IPO B;  2LT1 A;  1BIA A;  5CKD A;  4O6J A;  2P4T A;  4DBR A;  1MUZ A;  4OP0 A;  1U06 A;  4F7U A;  1AWJ A;  1Y0M A;  3DB3 A;  2KVQ G;  4HVU A;  1YJW T;  3V7C A;  2R5A A;  4J9D A;  3H8Z A;  2VC8 A;  3O8V A;  3TSW A;  2LJ3 A;  3S3O A;  4ZTJ A;  1G5V A;  1Q86 C;  1LCK A;  2DZ9 A;  1Q81 R;  1ZUY A;  4JJC A;  3A8M B;  3NTI A;  2LMJ A;  1N8R U;  1BCO A;  2HEQ A;  4OB0 B;  1NZ9 A;  4C0D C;  2PVO B;  1JJ2 P;  3E9F A;  1UG1 A;  2LRQ A;  1FMK A;  1YI2 T;  2CH4 W;  2K57 A;  4DBH A;  5CCA A;  2QTV A;  3H0H A;  7AT1 B;  3GNF B;  2E5K A;  2VWF A;  2C0O A;  3JCM e;  1ZUU A;  3F70 A;  2O4X A;  4J9F A;  2PU9 B;  3X20 B;  2XI9 A;  4Z88 A;  2EKH A;  4XU2 A;  1VQ9 Q;  3EG3 A;  4JUV A;  2HBP A;  1M1K R;  3A8O B;  4RUG A;  2DXT A;  2YT6 A;  2CP0 A;  1IZ6 A;  1TUG B;  2QEX Q;  5HK3 A;  1VQ8 A;  2LT4 A;  4RTX A;  1RAD B;  3CME A;  4Q5W A;  2X9H A;  3PMT A;  2KR3 A;  3G71 A;  1VQK T;  3G6E T;  1QQJ A;  2KGT A;  1M2V B;  1BBZ A;  2LNH B;  1YJN T;  2YHT A;  3JB9 G;  2E1H A;  2RI2 A;  3CCM T;  4NL2 A;  4DEX A;  3M59 A;  2YLC A;  3QO3 A;  3QZ9 B;  1W6X A;  1N27 A;  5GAN 8;  1MV3 A;  2L2P A;  1PRL C;  2HAX A;  3NHN A;  2ECZ A;  1W2B S;  2RD1 A;  3IQL A;  1N9R A;  1OUL A;  1TG0 A;  3HFN A;  4BI8 B;  4F7U F;  3AHU A;  2EIF A;  2BZ8 A;  2GNC A;  3E1S A;  4JPB W;  3WVE B;  2RI5 A;  2EQI A;  4X9D A;  1ZA2 B;  4JRP A;  3OYK A;  3CC4 T;  2VKN A;  2QTX A;  5GAN 3;  1BI3 A;  2HQX A;  3SFM A;  4C0Z A;  1Z9Q A;  3DB4 A;  2H3E B;  3FC3 A;  3NTH A;  2K5L A;  3C94 A;  1XQH A;  3RMS A;  4PJO G;  1NE8 A;  1D0Z A;  2HL3 A;  2V1R A;  3RKW A;  5D6Y A;  3QXE B;  3CPW A;  3X26 B;  2KK4 A;  1K9M R;  1VQN T;  2LCL A;  5GMK m;  1GBR A;  2COW A;  1QVG S;  4M78 A;  2X4X A;  3Q1J A;  4J6Y A;  2JS0 A;  2MYS A;  1WYX A;  2Z0W A;  1I0C A;  3PGG A;  1RAC B;  2CP3 A;  3MJX A;  4D8K A;  2VVK A;  1M1F A;  2WSE E;  4E2F B;  3CMA T;  1Q82 C;  3A8G B;  1WX6 A;  3QG1 A;  1E6H A;  1NBE B;  1AEY A;  2DL3 A;  3LX7 A;  2COZ A;  3RUX A;  4RTZ A;  1Y96 B;  2JN0 A;  3L42 A;  5HCK A;  3M56 A;  1WHL A;  1TS9 A;  2MWP A;  1JJ2 S;  2NUZ A;  2CKK A;  3MCA B;  4PJO C;  4EMK C;  5D6X A;  5KYU B;  5FRN A;  2R57 A;  3NMZ C;  2DEQ A;  1JQQ A;  3CPW P;  3CCL A;  1VQ6 A;  4DOV A;  2CS7 A;  5CKB A;  3I55 T;  1K1Z A;  2PUO B;  3OYY A;  4MDX A;  4C92 C;  4M7D G;  3SB2 A;  3VUZ A;  1UJY A;  2F2X A;  3CCS A;  4B9X A;  3UPU A;  2BKD N;  2X4J A;  3PVL A;  1K0S A;  4A4F A;  1VQO A;  3CCU A;  2OTL T;  2E12 A;  1KSW A;  2A7Y A;  1ZUK A;  5CIU A;  2RNA A;  1R0B G;  1BI2 A;  2BZX A;  2EVR A;  2PZ1 A;  1GCQ A;  2KMT A;  4C8Q D;  1AZG B;  1YFN A;  5C6S A;  1K8A C;  3PT9 A;  5C0M A;  4ZNX A;  1K73 U;  2X3W D;  4O5V A;  4LE9 A;  2KNB B;  4OF1 A;  4JS5 A;  2J05 A;  2YXY A;  1IRX A;  2K79 A;  1S72 A;  4PJO B;  3N5B B;  1K76 A;  3HP9 A;  3EG0 A;  3OW2 A;  2GF7 A;  1QP3 A;  4M78 F;  4RTU A;  1BB9 A;  5I11 A;  4JRK A;  2COY A;  5GAM g;  2LX9 A;  2MOX A;  2L0A A;  4ELY C;  1A0N B;  4B6M A;  4XTY A;  3CC2 Q;  1W4S A;  4QQD A;  2EBP A;  4JJB A;  1SRM A;  3QDR B;  3CEY A;  4L6V 5;  1U1T A;  2OTJ T;  4M75 G;  5KE2 A;  1VUB A;  1FMW A;  4CC3 A;  1B34 B;  1P92 A;  1WGS A;  1D1A A;  2DJQ A;  4C0G A;  2DYI A;  2VGN A;  2JMC A;  2RQW A;  1ZSZ C;  1UFF A;  2LCC A;  2L3Q A;  2LQW A;  2DFU A;  3OYG A;  3ULR B;  2EYQ A;  1GFC A;  4M7A G;  2J6K A;  1YP5 A;  2NWM A;  3OW2 P;  2J6O A;  1E7O A;  4AG1 C;  3CCJ T;  2M51 A;  4IIM A;  4F7U E;  2P0K A;  3FDR A;  2K9G A;  3QDF A;  4R0K A;  4M7D B;  3EG1 A;  1VIE A;  4OMO A;  3J81 E;  3CCV A;  1KIK A;  1QP2 A;  1JRI A;  2FZG B;  3JSC A;  2VAS A;  3X28 B;  2L5Q A;  2ROT A;  4E7H A;  1D0X A;  1VQM Q;  3JV3 A;  5A0G A;  4A53 A;  1WDX A;  5FU6 B;  2O9S A;  1M90 U;  4JRQ A;  3QPH A;  2J6F A;  4ZGJ B;  1VYT A;  2CUB A;  1WXT A;  1RAA B;  1VQ4 A;  2D0Q B;  1FYN A;  2HKQ B;  3PIP A;  2CP2 A;  1G2B A;  4LXC A;  5I21 A;  3VS0 A;  3UA6 A;  1ZSZ B;  3CPW S;  3SWN B;  5J3B A;  4DBF A;  5GAO r;  2A28 A;  2LNV A;  2JZ2 A;  2CGH A;  2D8J A;  4FW1 A;  2DM1 A;  2WSF E;  2HQH A;  4FYX B;  4Z8A A;  1VQ7 Q;  5GMK l;  2DVJ A;  4D6W A;  2EQJ A;  2OAW A;  1WFW A;  2EGC A;  1WHJ A;  1OX8 A;  4PFO A;  3OYH A;  3LGF A;  3MET A;  3OS2 A;  2VB6 A;  2V8I A;  1VQ9 A;  1QW1 A;  3L2V A;  3QKJ A;  1OZ2 A;  1SHF A;  3CCJ Q;  2V8J A;  2LCS A;  1YN8 A;  3JCM X;  2CP6 A;  8AT1 B;  3MP6 A;  2LP5 A;  5CK9 A;  2QEX A;  3I5R A;  4RTV A;  3OYA A;  1UJ0 A;  1H3Z A;  1D0Y A;  2FYK A;  4GLK A;  4M75 B;  5A0D A;  4JJD A;  5GAN h;  3VUB A;  5KYY A;  4C5E A;  2QYZ A;  2JM9 A;  4M77 C;  2DMO A;  3EFO A;  2RHZ A;  3EGX B;  2PQW A;  1H64 1;  2KBT A;  1XJW B;  2PTK A;  1VQ5 T;  3EHR A;  1VOM A;  1ARK A;  1UUE A;  3CQT A;  4M7A B;  2RM4 A;  1YJ9 T;  4JLI A;  5AYF A;  4FT2 A;  4ZTF A;  2ZPF B;  4JZ4 A;  4Z89 A;  4PJO D;  5DLQ E;  2E10 A;  4J9G A;  2E6Z A;  5GAN 4;  2A37 A;  2C0T A;  1DJ7 B;  1O9S A;  2EWN A;  1KD1 U;  1D3B A;  2EQU A;  1U5S A;  4C92 D;  2F69 A;  4HA8 A;  1M2O A;  3QBY A;  2AKK A;  3MEV A;  2DXU A;  2D8H A;  1YIT Q;  5ECA A;  2RI3 A;  3VS6 A;  3LW5 E;  1H3H A;  5KYX B;  1KFZ A;  4M78 E;  2DTO A;  4A4K A;  3OW2 S;  2QDL A;  4HVW A;  2D0N A;  3I35 A;  3JCM Q;  4PJJ A;  3VYG A;  2ENM A;  5GAO q;  4B9W A;  4FYV B;  3QSU A;  1VA7 A;  2D9T A;  2KRM A;  2E64 A;  3CCR Q;  1NEB A;  5KE3 A;  5L23 A;  5GAN j;  3LH5 A;  1VQ5 Q;  2DVE A;  3V8L A;  3M0P A;  3QYG B;  2K3Y A;  2MF2 A;  2XU8 A;  4BB7 A;  1YJ9 Q;  1RAF B;  1KQ2 A;  2ED0 A;  2CH4 A;  3CC7 Q;  1Q81 C;  3OBW A;  3S3N A;  2A36 A;  1SSF A;  4M7D D;  4CC2 A;  3TCJ A;  3THK A;  5KCO A;  3U23 A;  2F2V A;  3FJ5 A;  1LPL A;  4KT0 E;  4IUU A;  2CP7 A;  1RAE B;  2DXB A;  2QK0 A;  2NUT A;  2KT8 A;  3PIO A;  4KGV B;  3RKX A;  1Q82 U;  4E6R A;  2KYM A;  2XMF A;  4OGE A;  2CYZ B;  4MZP A;  4EDU A;  4HT8 A;  3VS1 A;  3KFV A;  3M57 A;  2AZS A;  5FU7 C;  1M4Z A;  5AT1 B;  2K6D A;  2YRC A;  1BI0 A;  1KJW A;  3JB9 I;  2GFU A;  1M90 C;  2DL5 A;  1RI0 A;  1G8X A;  3TRE A;  2FL7 A;  1YNZ A;  2EYZ A;  3MEU A;  1TU0 B;  1UE9 A;  1X2K A;  2XG8 D;  4QQG A;  1M3C A;  2FZC B;  3OYM A;  2DTH A;  1Q7Y C;  1PM3 A;  3VS2 A;  1VYV A;  2RHI A;  2AZV A;  2RJD A;  2W10 A;  4ORZ A;  4C5G A;  3QII A;  3VV0 A;  2L3S A;  1UGS B;  3EG9 B;  2FB7 A;  3NFC A;  1HXD A;  4KRT A;  4PJN A;  5CKE A;  1BCM A;  4FL6 A;  1YCY A;  4FYY B;  2HBW A;  1M8M A;  1MGQ A;  1GCP A;  4C92 E;  2DE0 X;  1JO8 A;  4HVV A;  3QWY A;  1K8A U;  2MIO A;  1U1S A;  1C6V X;  1IXD A;  1T0J A;  2JM8 A;  3UA7 A;  2X4Y A;  2BE7 D;  3RKY A;  5FU7 B;  3H41 A;  4FSX A;  3RMQ A;  1WHH A;  2RJE A;  2RA2 A;  1M9S A;  3SDZ A;  3CC2 A;  1RL2 A;  1T0H A;  4C8Q A;  2KY9 A;  5DLO A;  2R5M A;  4F16 A;  4M7A D;  3HRS A;  4AFS C;  3VJP A;  2HSE B;  2O4X B;  1ZQ1 A;  2EYX A;  3JCM g;  2L3R A;  3OYF A;  1NYG A;  1I4K 1;  1TUD A;  3KBG A;  1MHN A;  3C4S A;  1YIJ T;  1C1A A;  1D09 B;  1M2V A;  3I56 T;  1KHI A;  3QYH B;  5IN1 A;  4KGX B;  2XD0 A;  1YJW Q;  5IXB A;  2HZY A;  3I9Q A;  1QVF A;  1I8F A;  3FEO A;  2DD5 A;  4RG8 A;  4PJL A;  1KD1 C;  4GY5 A;  1AT1 B;  3OS5 A;  4BUG A;  4J7I A;  3HSB A;  1IHW A;  3G1J A;  2V8K A;  4M77 D;  4CC4 B;  3URG A;  1FX7 A;  4FCY A;  4YTL A;  1YI2 Q;  1Q86 R;  1MND A;  3J80 E;  4HT9 A;  1KC8 R;  1B3Q A;  3M54 A;  1QMC A;  2KRS A;  3ME9 A;  4E7K A;  3CBM A;  4R55 A;  3JCM d;  1VQM A;  1ZX6 A;  2QXF A;  1ZBJ A;  3EGD A;  1JU5 C;  3TQ7 P;  1SF9 A;  3QZ5 B;  2QAZ A;  4XU3 A;  3CD6 T;  2DD4 A;  1VQL T;  2DEU A;  4QT7 A;  1QVF P;  1QWE A;  5GMK h;  2QA4 T;  2CRE A;  4BAC A;  4HCZ A;  1NEG A;  2KE9 A;  4RG2 A;  4A4E A;  1VQ7 A;  1HYO A;  1VQK Q;  3G6E Q;  1PWT A;  2KI7 A;  1YJN Q;  1I5L A;  3VKI A;  3L1A A;  3PE0 A;  1M1G A;  5FWB A;  4FT4 A;  2ED1 A;  3G4S T;  3UAT A;  3EH1 A;  4E7S A;  3QJ6 A;  2GGR A;  3CCM Q;  2DX1 A;  2RHU A;  2EYW A;  2JW4 A;  1UGV A;  4C8Q F;  1Z9Z A;  1EZZ B;  3C95 A;  3CCJ A;  2DPP B;  5IAY A;  1NPP A;  2RK1 A;  4JDS A;  3HTR A;  1U3O A;  4M4Z A; 
#chains in the Genus database with same CATH homology
 2DTI A;  5GAM h;  4XK8 E;  3OS1 A;  3E9G A;  4UC4 A;  3I55 A;  3CCJ T;  2XK0 A;  4E7I A;  5A2Q E;  4M78 G;  2DAQ A;  4BY6 B;  4F7U E;  2EJF A;  2P0K A;  5FLX E;  3OYN A;  3FDR A;  4NS5 A;  2ZPG B;  3L2U A;  2RHX A;  1KQS A;  1N6A A;  1LOJ A;  2E65 A;  3GOX A;  2GQV A;  1NJI U;  4M7D B;  1YIJ A;  3I56 A;  3JB9 H;  2VXE A;  2XDP A;  2RHY A;  4VUB A;  2YLB A;  3CCR A;  1VIE A;  2CZ6 B;  1N9S A;  2X35 A;  3MHX A;  3J81 E;  4BI4 A;  3CCV A;  1QP2 A;  1JRI A;  1WQW A;  3JCM c;  1PSF A;  3JSC A;  3VU3 C;  5LJ5 h;  3L2Q A;  2B8A A;  3X28 B;  2L5Q A;  2EKO A;  2E41 A;  2OTL A;  2HNI A;  4E7H A;  2IVW A;  2JTM A;  2BUD A;  3C12 A;  4M77 B;  5A0G A;  4P5N A;  4C8Q B;  4A53 A;  2VXF A;  1K9M C;  2LTO A;  2QQB A;  5CAI A;  5FU6 B;  2YRV A;  1M90 U;  4JRQ A;  3BY7 A;  3QPH A;  4N4I A;  5GAN 7;  4LDU A;  4ZGJ B;  4HCC A;  3UT1 A;  4JJN K;  4R56 A;  1VQ4 A;  5GAN f;  2D0Q B;  2XDD A;  3KUF A;  4ZN1 A;  5GAN g;  3PIP A;  1FXX A;  2DIQ A;  2ZPI B;  1QVG A;  3E19 A;  1WNL A;  3OBY A;  4M75 F;  4DQ2 A;  3X24 B;  1G5V A;  5DY9 A;  4M7D E;  5I21 A;  2ZGW A;  3CCQ A;  2RO0 A;  1UGQ B;  3CPW S;  3SWN B;  5J3B A;  1JJ2 S;  3ASK A;  3EAE A;  5GAO r;  2R58 A;  2XIC A;  5CR2 A;  2LNV A;  3CCE A;  2JZ2 A;  3OYC A;  3TU4 K;  2CGH A;  4PKC C;  1M5Q 1;  3JB9 J;  2WSF E;  3QHS A;  1VQ8 T;  1H3Z A;  3BDL A;  5GMK l;  5GAO p;  2K5F A;  4D6W A;  3UDC A;  2EQJ A;  2QI2 A;  1AHJ B;  4BD3 A;  2ZPE B;  1I81 A;  2LQ8 A;  4RKU E;  3CCQ T;  4C0D B;  4JRI A;  3CME T;  1YIT A;  4M78 C;  3QJY A;  2P0Q A;  3PNW C;  3OYH A;  3G71 T;  2FHD A;  3LGF A;  1R8O B;  2QQR A;  3MET A;  5HY6 A;  3OS2 A;  1LJO A;  5FRM A;  2V8I A;  3A8L B;  1WPY A;  2X4W A;  4XTW A;  1VQL A;  1VQ9 A;  1KHC A;  1QW1 A;  3CCE T;  3L2V A;  5LJ3 f;  3ER0 A;  2L8D A;  3QKJ A;  1OZ2 A;  4OVA A;  4PJO A;  4QVZ A;  4EMK A;  5LJ3 g;  4OMF B;  4L59 A;  1NJI C;  2V8J A;  2QQS A;  2QA4 A;  2RJF A;  3JCM X;  2VGM A;  3LH0 A;  3MP6 A;  5CK9 A;  5GAM f;  1JJ2 A;  1VQK A;  2QEX A;  2MI6 A;  2LVM A;  2EJG A;  2AHJ B;  3NTK A;  2PVD B;  3OYJ A;  4M7D C;  4OB3 B;  1LNX A;  2M1H A;  5GAN d;  2OTJ A;  3M4G A;  4EMH A;  4XU1 A;  2MMP A;  2IG0 A;  1TH7 A;  1NPR A;  2JVV A;  3S6W A;  3GF5 A;  4A4H A;  2FYK A;  2DKG A;  4C92 A;  4GLK A;  3JCM b;  3CXC S;  3G4S A;  4M75 B;  4OB2 B;  5A0D A;  5GAN h;  3VUB A;  5GAM j;  4C5E A;  4C5H A;  3G7Z A;  1VQ5 A;  5LL6 S;  2MAM A;  1X6O A;  2LDM A;  2P0P A;  5GAN 5;  3GP8 A;  2PUK B;  4A54 A;  3M5A A;  3V7S A;  4Y91 A;  3HL8 A;  4M77 C;  4RCB A;  2DXC A;  2RHZ A;  4FU6 A;  5LJ5 f;  4DA4 A;  4C8Q C;  4JS4 A;  2ZZD A;  3CBP A;  5LJ5 g;  4Y28 E;  3CC7 A;  5FU6 C;  3RES A;  2LC4 A;  4V2S A;  4N0A C;  3S3M A;  2LT1 A;  1BIA A;  5CKD A;  2PQW A;  1UEB A;  4E7J A;  1H64 1;  4O6J A;  2P4T A;  2F5K A;  2I2L A;  4OP0 A;  4F7U A;  4HCB A;  1VQ5 T;  4BDZ A;  3LGL A;  3ZEH A;  1EIF A;  4BI3 A;  3M58 A;  3GLX A;  3H6Z A;  3DB3 A;  2KVQ G;  4M7A B;  2RB6 A;  2RM4 A;  5I2M A;  3JCM J;  1ZHI A;  1YJW T;  1YJ9 T;  4LDV A;  1XNI A;  2R5A A;  4JLI A;  3V7C A;  3OMC A;  5AYF A;  2K5I A;  4FT2 A;  3H8Z A;  2VC8 A;  3O8V A;  4PNO A;  4LD6 A;  3SWN C;  3S3O A;  5LJ3 d;  2ZPF B;  4ZTF A;  4ZTJ A;  1QVF S;  1XOV A;  4M75 E;  1Q86 C;  4C92 G;  4PJO D;  3FB9 A;  5DLQ E;  2E10 A;  2E6Z A;  2FVU A;  4M78 B;  5LJ3 h;  5GAN 4;  2DZ9 A;  1Q81 U;  3R6O A;  5GAM d;  3A8M B;  3NTI A;  1N8R U;  2JUF A;  1DJ7 B;  1O9S A;  4OB0 B;  2EWN A;  4MZT A;  4ELZ C;  3FJP A;  1KD1 U;  3OQ5 A;  1D3B A;  1NZ9 A;  2PVO B;  5L8R E;  4XQ3 A;  1PSE A;  4C0D C;  3JCM P;  2EQU A;  1Y96 A;  4C92 D;  3E9F A;  2F69 A;  5GAN 2;  2LRQ A;  4HA8 A;  1YI2 T;  2F5T X;  2RK2 A;  4PLI A;  3QBY A;  2K57 A;  2K4Y A;  5CCA A;  3MEV A;  4FM4 B;  2DXU A;  4E7L A;  1U8R A;  5LJ5 d;  4M7A E;  3GNF B;  3JCM e;  3F70 A;  2O4X A;  2Y90 A;  3L2R A;  4MML A;  3DLM A;  2PU9 B;  3X20 B;  2QQA A;  4KUI A;  2RI3 A;  2XI9 A;  3RER A;  1OZ3 A;  3LW5 E;  4FIB A;  3WXM B;  3OYA A;  1FWZ A;  1X01 A;  4M78 E;  4XU2 A;  3CD6 A;  4CRI A;  4M75 C;  4JUV A;  2HBP A;  2DTO A;  4ZN3 A;  3A8O B;  4QVD A;  4A4K A;  3OW2 S;  3OB9 A;  3JCM W;  3LWH A;  2DXT A;  4NL3 A;  5GMK e;  1X75 C;  3JCM Q;  1IZ6 A;  5EG2 A;  3UWN A;  3VYG A;  4IKF A;  5GAO q;  5HK3 A;  3OYE A;  1VQ8 A;  4EMG A;  5CQY A;  4B9W A;  4ATO A;  3QSU A;  2D9T A;  1G3T A;  2E64 A;  3HRU A;  2LT4 A;  3MO8 A;  4XTZ A;  5KE3 A;  3LWI A;  3CC2 T;  1YBY A;  2KDS A;  3CME A;  4Q5W A;  5GAN j;  1G3Y A;  2DVE A;  3V8L A;  4PJO F;  3PMT A;  5GMK j;  1Q7Y U;  3G71 A;  3QYG B;  1VQK T;  3G6E T;  2G3R A;  2K3Y A;  3JAM E;  2MF2 A;  1YJN T;  2YHT A;  4M7A C;  3JB9 G;  4BE2 A;  2XU8 A;  4BB7 A;  1BI1 A;  2E1H A;  2EJ9 A;  3CCL T;  1KQ2 A;  1VQ6 T;  2RI2 A;  3M9Q A;  4M77 E;  4ZGD B;  1Q81 C;  3OBW A;  3CCM T;  3S3N A;  1SSF A;  4M7D D;  1N8R C;  4NL2 A;  4C8Q E;  4C92 F;  4LDX A;  3M59 A;  3TCJ A;  3RIR A;  2Y4Y A;  1UGP B;  2YLC A;  4XTU A;  3QO3 A;  1WJR A;  3CPF A;  5KCO A;  3QUI A;  3QZ9 B;  5GAO l;  3DLL A;  1N27 A;  3JB9 D;  3CCS T;  2RJC A;  1WJQ A;  5LJ3 e;  3OSS C;  4QVC A;  5HK0 A;  5GAN 8;  4KT0 E;  4IUU A;  3ZBD A;  2Y4X A;  3A8H B;  4L5G A;  5KCH A;  2HAX A;  3L2Z A;  2JOY A;  3CBO A;  4ME7 A;  1W2B S;  2DXB A;  2RD1 A;  2PVG B;  5GAM e;  4IUQ A;  3PIO A;  1N9R A;  2RH2 A;  3RKX A;  3KXT A;  3CCU T;  1VQO T;  3HFN A;  3M55 A;  4BI8 B;  4F7U F;  2EIF A;  5LJ3 j;  1Q82 U;  3AHU A;  2GFA A;  4OGE A;  2CYZ B;  4MZP A;  4EDU A;  4J6W A;  3E1S A;  3WVE B;  4HT8 A;  2RI5 A;  2XDB A;  2CZ7 B;  3BW1 A;  1QVP A;  4X9D A;  4JRP A;  3M57 A;  5FU7 C;  1M4Z A;  3OYK A;  2VUB A;  3MEA A;  1BI0 A;  4EMK B;  3CC4 T;  1KQS S;  5LJ5 e;  2OAU A;  2QTX A;  4XTX A;  3JB9 I;  2KQW A;  2GFU A;  5GAN 3;  1M90 C;  4Z02 A;  1BI3 A;  1YJW A;  3MEW A;  2HQX A;  1YJ9 A;  3SFM A;  2EQM A;  4MDW A;  4C0Z A;  1VQP A;  1RI0 A;  3LYI A;  5FRO A;  3TRE A;  3DB4 A;  2FL7 A;  3FLG A;  3V8J A;  1BIB A;  3FC3 A;  2HD0 A;  3MP8 A;  2K5L A;  3C94 A;  1XQH A;  3MEU A;  3NTH A;  2M16 A;  1B34 A;  3HKS A;  3RMS A;  1KQ1 A;  4PJO G;  1M8V A;  1NE8 A;  4C92 B;  2E6N A;  5LJ5 j;  1VQM T;  4QQG A;  1O75 A;  2XG8 D;  4N4G A;  4BDY A;  1Y07 A;  1S72 T;  3OYM A;  1BKB A;  2DK3 A;  2DTH A;  4J6X A;  5KH6 A;  1ZBX A;  1Q7Y C;  4M7A A;  4IUT A;  2DZC A;  2RHI A;  5D6Y A;  3RKW A;  1VQP T;  3QXE B;  4HKE A;  4DOW A;  3CPW A;  3X26 B;  2KK4 A;  1K9M U;  2RJD A;  1VQN T;  2LCL A;  2E5Q A;  4C5G A;  5GMK m;  3QII A;  3VV0 A;  3BDU A;  1UGS B;  3X25 B;  2FB7 A;  1YI2 A;  3NFC A;  1HXD A;  4M78 A;  2X4X A;  4QW2 A;  1QVG S;  3Q1J A;  3JB9 F;  4J6Y A;  3VYH B;  5CKE A;  2EAY A;  1KG1 A;  5GAN 6;  4FL6 A;  1YCY A;  1BYM A;  5CQX A;  2CZ1 B;  2DO3 A;  3PGG A;  3JCM V;  4EPC A;  1YHQ A;  1OI1 A;  1VQ7 T;  1MGQ A;  1GXI E;  4RMO A;  1M1F A;  3T9N A;  2EQK A;  2WSE E;  4C5I A;  4C92 E;  4F7U G;  1Y7X A;  3OYI A;  3CMA T;  4M7D A;  4MMK A;  1Q82 C;  3A8G B;  4PLL A;  3QG1 A;  3OY9 A;  1K8A U;  1U1S A;  5CVI A;  3LX7 A;  1YHQ T;  2CZ0 B;  5CKF A;  1HK9 A;  2X4Y A;  3RKY A;  3RUX A;  5FU7 B;  3GPL A;  1D3B B;  4KUL A;  3CXC A;  1Y96 B;  4FSX A;  4MZM A;  4BE1 A;  2JN0 A;  3RMQ A;  2RJE A;  3DKM A;  2RA2 A;  1M9S A;  3L42 A;  4M77 A;  3SDZ A;  1M1K U;  5CO7 A;  2VV5 A;  1RL2 A;  3CC2 A;  5D6W A;  3FRN A;  3M56 A;  4LDW A;  4C8Q A;  2KY9 A;  5DLO A;  2R5M A;  4M7A D;  2MWP A;  2BIV A;  3HRS A;  2CKK A;  3MCA B;  4J83 A;  4N0A A;  3VJP A;  4EMK C;  1Y71 A;  5D6X A;  5GAN e;  5GAO n;  3G6E A;  2C06 A;  5FRN A;  2D6F A;  1YJN A;  2XHC A;  2R57 A;  3GNG A;  4E47 A;  5J39 A;  2DEQ A;  2O4X B;  1ZQ1 A;  3CCL A;  1G3W A;  1VQ6 A;  4M78 D;  2CS7 A;  5CKB A;  3JCM f;  4DOV A;  3I55 T;  3CCM A;  2PUO B;  3JCM g;  5J26 A;  3A5Z B;  1OYX A;  3INZ A;  3JRZ A;  3OYY A;  2L3R A;  3OYF A;  3KBG A;  1I4K 1;  2DJZ A;  4C92 C;  4M7D G;  4MDX A;  3SB2 A;  1MHN A;  5M9O A;  4RCC A;  3VUZ A;  3SWN A;  3HHT B;  3C4S A;  1YIJ T;  3I56 T;  3CCS A;  2JNG A;  2O01 E;  1KHI A;  3QYH B;  2QQ9 A;  5IN1 A;  3WVD B;  4B9X A;  2H3J A;  2XD0 A;  3UPU A;  2BKD N;  3P8H A;  3TEE A;  1QVF A;  1G3S A;  3CCV T;  1I8F A;  2XID A;  1VIF A;  2M0O A;  2KSS A;  2DD5 A;  2X4J A;  3FEO A;  3PFS A;  2ZPB B;  4OGC A;  4RG8 A;  3OYB A;  1XTD A;  4M77 G;  4WF2 A;  3V7R A;  1KD1 C;  5IT9 E;  4KUD K;  4A4F A;  1VQO A;  3CCU A;  2OTL T;  4XU0 A;  4C8Q G;  2E12 A;  4GY5 A;  5GMK i;  3OS5 A;  2A7Y A;  4BUG A;  5CIU A;  3OS0 A;  4J7I A;  2HQE A;  4LDY A;  5CKH A;  2L89 A;  4J8O A;  3PMI A;  3HSB A;  1BI2 A;  1VQ4 T;  2V8K A;  4CI0 C;  4M77 D;  5A0L A;  1JBM A;  3URG A;  1FX7 A;  2KMT A;  2A3L A;  4X9C A;  3OYD A;  4C8Q D;  3CC4 A;  1Q86 U;  4YTL A;  5C6S A;  2VYT A;  1K8A C;  3V8K A;  3PT9 A;  2KAF A;  3J80 E;  4HT9 A;  3OMG A;  3P8B B;  4J7F A;  3SD4 A;  5C0M A;  5DM7 R;  1KC8 U;  1K73 U;  3M54 A;  4PL6 A;  4O5V A;  2JTF A;  2EFI A;  3ME9 A;  4M75 A;  4E7K A;  3CBM A;  4OF1 A;  4J5Y A;  4XAX B;  3JCM d;  4R55 A;  4JS5 A;  4M7A F;  1M1K C;  1VQM A;  1WQ7 A;  2WSC E;  1JB0 E;  2E70 A;  2QXF A;  1S72 A;  4PJO B;  3N5B B;  3JCM h;  3HP9 A;  3J7A F;  3HFO A;  2ZPH B;  3LLR A;  2GF7 A;  4BY6 C;  3OW2 A;  4II1 A;  1QP3 A;  4M78 F;  4IUR A;  4OB1 B;  4BE0 A;  1YIT T;  3QZ5 B;  4JRK A;  4N4H A;  1VQN A;  2XKO C;  5GAM g;  4XU3 A;  3M53 A;  4PJO C;  4C0F A;  2LX9 A;  3CD6 T;  2DD4 A;  2WAC A;  1VQL T;  3MP1 A;  1VQ9 T;  2QDY B;  2ZCF B;  4ELY C;  4A4G A;  3HPW A;  4XTY A;  5GMK h;  1W4S A;  4QQD A;  3L2W A;  2QA4 T;  3OSV A;  4BAC A;  4HCZ A;  4QQ6 A;  2K2V A;  3OA6 A;  3QDR B;  3PTA A;  2QEX T;  4M7D F;  3CEY A;  4RG2 A;  4A4E A;  4L6V 5;  3FIF A;  4X34 A;  3OYL A;  3HRT A;  1VQ7 A;  1U1T A;  1UGR B;  4LD9 K;  1V29 B;  2OTJ T;  1I5L A;  3GIB A;  4M75 G;  3VKI A;  3L1A A;  1M1G A;  4FT4 A;  3ZFJ A;  3CCR T;  5KE2 A;  4IUV A;  1VUB A;  3G4S T;  4PJO E;  3CMA A;  1B34 B;  4F7U B;  1P92 A;  1WGS A;  4KBM B;  3QJ6 A;  5HKC A;  5GAO m;  2M9U A;  2K3X A;  1WJS A;  2MWO A;  2RHU A;  3EFS A;  3P8D A;  4M77 F;  4C0G A;  4C8Q F;  2VGN A;  4XTV A;  4ZGE B;  4M75 D;  2DIG A;  3C95 A;  3CC7 T;  3BFM A;  3CCJ A;  2LCC A;  2DPP B;  1W2B A;  2GCX A;  2LQK A;  1IRE B;  5I2S A;  5IAY A;  1NPP A;  4NOY A;  3OYG A;  1KC8 C;  2RK1 A;  2EYQ A;  1UB4 A;  4IUP A;  1K73 C;  3EFR A;  4JLG A;  4M7A G;  4JDS A;  2NLU A;  3M4Y A;  4TVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...