4M78D

Crystal structure of lsm2-8 complex, space group p21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 75
sequence length 75
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78D00
4C8QC 5GAMj 4X9CA 5GMKl 5GAMh 4M7DG 3AHUA 4C8QD 2DTIA 4C8QB 5LJ3f 5LJ3d 2DTOA 2EWNA 4M77E 4C92F 3BDUA 3RERA 2E41A 4RCBA 4XU2A 5GAN8 1I8FA 3HFNA 4M7DE 2EAYA 4J6WA 4HA8A 4XU3A 3FJPA 2YLCA 3INZA 3SB2A 2DEQA 1M5Q1 2DKGA 4M75F 4XTWA 4C92A 4J6YA 5GAOl 3JCMg 4M7AD 1U1SA 4JRIA 3HSBA 1HXDA 1KQ2A 5GAOn 2DZCA 4M77F 4XQ3A 4EMKA 4XTVA 2CGHA 2RB6A 3JCMW 1B34A 2E65A 5LJ5e 1I5LA 4M75A 3JCMf 3JCMd 3JB9D 4PJOE 1BIBA 4M7AA 5GAOq 3BY7A 5GAMe 4C92C 2QTXA 5LJ5d 4F7UA 4M78F 4XTXA 4XTYA 4C8QG 2EJFA 3RIRA 2DXTA 3JB9J 4C92D 4C92B 3JB9H 2JN0A 4EMKC 5GAMd 4MMLA 3RESA 2ZGWA 3L1AA 1WQWA 4J6XA 2DJZA 3JCMX 1Y96A 4M75C 4XU0A 4EMKB 3RUXA 1YCYA 5I21A 4M78A 5DY9A 5GMKm 5GAOr 5GANj 4PJOF 5GANh 4M7AC 1B34B 2K57A 4MMKA 1TH7A 3EFRA 3QUIA 4J5YA 4JLIA 4M75B 4M75D 5LJ5g 4M7AG 2RA2A 3V7RA 4M7AB 4EMHA 5GAN7 4XU1A 5GAN4 3QSUA 3M4GA 4F7UG 3JB9I 2FB7A 3BW1A 4M77D 1X01A 4NOYA 3FIFA 2I2LA 1N9RA 3RKXA 3SWNA 5LJ3h 4WF2A 1JBMA 5GMKj 4XTZA 3V7CA 4NL3A 5GMKh 3V8LA 4PJOA 3JB9G 1BIAA 1WPYA 2DTHA 4M78C 5GAMg 4M7DF 5GMKi 5GAOm 1LJOA 1Y96B 2YHTA 2E10A 2VXEA 5LJ5f 4M78D 4M78B 3JCMc 1H641 1MGQA 4M77A 3VU3C 5GAN3 4C92G 3V8KA 3SWNC 5GAMf 4RCCA 4M7DA 4PJOC 2E64A 2RD1A 3QHSA 1LNXA 4QVCA 3SWNB 4C8QE 3JB9F 5GANe 4PJOD 4PJOB 3GIBA 4PNOA 4M75G 1U1TA 1WNLA 3JCMh 4M77C 4N0AA 4V2SA 3JCMb 5GANd 4M77G 2HNIA 3L2ZA 5LJ3j 4M77B 5LJ3e 4X9DA 4DQ2A 3JCMJ 4A53A 4M7DC 4M75E 1M8VA 4JRKA 5GMKe 3PGGA 3FB9A 4QVDA 2E1HA 1D3BA 4M7AE 4M7DD 4M7DB 3QO3A 2VXFA 2YLBA 4EMGA 2EJGA 2VC8A 4C8QF 5GAN6 2Y90A 4Y91A 4F7UE 4HT9A 4M78G 3JCMV 3V8JA 3HFOA 5CAIA 5GAN5 4N0AC 2FYKA 1N9SA 3JCMP 2DVEA 1I4K1 1LOJA 4C8QA 4HT8A 5GANg 1HK9A 1KQ1A 2RM4A 4M78E 3RKYA 5GAOp 4OP0A 1WQ7A 4PJOG 4M7AF 4F7UB 5GAN2 4C92E 1D3BB 4NL2A 4A54A 3JCMe 4JUVA 4F7UF 1I81A 3JCMQ 5LJ5j 5LJ3g 5GANf 2DXUA 2EJ9A 3BFMA 3RKWA 2DZ9A 5LJ5h 1JRIA 3EFSA 3V7SA 4XTUA
chains in the Genus database with same CATH superfamily
1IHVA 4FT2A 4OVAA 1Q7YC 4XU2A 3GBQA 5GAN8 1TU0B 3N5BB 3MP6A 2HQXA 2DKGA 4C0DB 3X25B 5GAOl 3JCMg 3BDLA 3PNWC 1O9SA 1UJYA 3EG9A 2CGHA 1WZOA 2RNAA 1UGSB 1K73C 1WGSA 4E7ZA 4JJDA 1Q82U 3GP8A 3G4ST 2JZ2A 1G83A 4MMLA 3RESA 3CMAA 3GOXA 3RUXA 2HL5C 2X4JA 3CBMA 3UA6A 1TH7A 2SEMA 1XTDA 2YXYA 4RTXA 1IB8A 3NFCA 3V8LA 3TEEA 3WXMB 4OB2B 2CT3A 2F2XA 1Y96B 1M3BA 3OQ5A 3TCJA 4BI4A 3OS2A 3L2VA 3ER0A 3X26B 4CC2A 1M90U 1UJ0A 4RCCA 4M7DA 4HVUA 1RAEB 1WXTA 1KJWA 1K9MC 2BE7D 1KD1U 1RACB 1T3LA 1VA7A 2YUNA 4KUDK 2LQ8A 4OB0B 3JSCA 4OMQA 4M77G 2FPDA 1CKAA 4A4FA 1K0XA 3OW2P 4M7AE 3QZ5B 3CXCA 1AT1B 1MHNA 3OA6A 2EJGA 2PVOB 2CH4A 2V8IA 2JMCA 2MMPA 3V8JA 4MDWA 3URGA 1QVFA 2VKNA 1WHKA 1GFDA 1IHWA 1ZSZB 1VQ5A 2RHYA 1J3TA 2L3PA 4OP0A 4FL6A 5GAN2 4F7UF 1YI2A 2V1RA 2DXUA 4C8QC 4KBMB 3EFOB 2GCXA 2EQMA 2QEXA 1FWZA 1W2BS 2MCNA 4RCBA 4CC7A 1YHQQ 3HRUA 2EAYA 4QVZA 4HCCA 1YHQT 1WI7A 4R56A 2O4XB 4AT1B 2GBQA 2YRDA 3NPFA 5CKHA 2JM9A 2K7AA 1M30A 5KYYB 2OTJA 3ZL7C 3JCMd 2OJ2A 4KGVB 2HDAA 3NTHA 2R58A 3QBYA 4E2FB 1TOVA 3L1AA 4LXCA 4J6XA 4M75C 4PLIA 3OYFA 4MMKA 2K5LA 2CZ1B 3FJ5A 3GNFB 4N4IA 4XU1A 4ZN3A 2QA4A 1VQ7A 4CC3A 3JB9H 3EGDA 3RKXA 3CQTA 3VS1A 2RMOA 5GMKh 3C12A 1S72Q 2FG0A 5GAMg 2YHTA 2VXEA 1S72T 4M78D 1N8RC 4M77A 1AWJA 2EKHA 3KUFA 3PIOA 3CC4A 3J80E 5FLXE 3X28B 2E6NA 3MEUA 1FX7A 1WHGA 1U5SA 3CCSQ 4FU6A 1WYXA 3QXEB 4JZ4A 3CCST 4BI3A 1JJ2A 2VXFA 3UATA 1GBRA 1OPKA 3THKA 2A37A 4MZMA 5C6SA 3CXCP 3G6EQ 2JTFA 4KULA 2LTOA 3G6ET 2RJCA 2JMAA 1I81A 1QVFP 4KH1B 1VQPQ 4RMOA 3OSSC 2BKDN 1EIFA 3TREA 1VQPT 1MMAA 3VYGA 2PZ1A 1AHJB 4DA4A 2OTLQ 5CK9A 2CP6A 3G7ZA 2HAXA 1WX6A 2PVGB 5CR2A 1VQNA 1XNIA 4Z88A 2OTLT 4J6WA 8AT1B 1QKWA 2RQVA 3VRYA 2O31A 1X6BA 4BUGA 4FW1A 4Z8AA 2KXCA 2X35A 2HQEA 2X51A 3I56A 3TSZA 4M78F 1QP2A 5I2SA 1VQ6Q 5CQYA 3CCJT 4ATOA 2DPPB 2FL7A 1WFWA 1VQ6T 1VYUA 5D7UA 1M2OA 4M7AC 4MDXA 3RERA 2X4YA 4MZTA 2P84A 1T3SA 4M77D 5LJ5g 2ENMA 2V26A 1UB4A 2RO0A 4FW2A 4BDYA 1MV3A 5GAOm 4VUBA 1YJNQ 2CH4W 1NEBA 1AWXA 3RR6A 1BI3A 2Z0WA 1YJNT 2A08A 4QQGA 4O6JA 4BD3A 2NLUA 4LE9A 2GQVA 3A8MB 1NE8A 1K4US 3EG1A 3S3MA 2RJDA 1PSFA 3MO8A 2L3RA 1UE9A 4YTLA 1GBQA 3PGGA 4JJCA 1YJWA 4DOVA 2KYBA 2L3SA 2ZAEA 3CC7Q 2XI9A 2M0YA 3CC7T 2LMJA 2DF6A 3OBWA 1Y0MA 2RJFA 3EH1A 5GANf 1TUCA 1ZX6A 3L2QA 1OPLA 2DAQA 1UHFA 2IVWA 4J7IA 4GLMA 3OYLA 4N4HA 4ORZA 2LQKA 2F2WA 3E2UA 3DLLA 3SB2A 2DEQA 2JW4A 1VYTA 4J6YA 3NTKA 1U3OA 4HCZA 5A0GA 3CEYA 4M77F 3OYDA 3CBOA 3JCMW 3H0HA 3R6OA 5GJVB 2DERA 5GAOq 1TG0A 4C92C 3WVDB 1BI0A 2WSFE 1VQMQ 4AG1C 1KIKA 1ABOA 1M1KC 1RI0A 1VQMT 3M0TA 1TXQA 3H41A 1PHTA 5CIUA 2DE0X 4JLIA 2NUTB 4OMLA 6AT1B 1QVGS 1OQKA 3V7RA 2K3YA 5I11A 2GF7A 4DOWA 7AT1B 4F7UB 3L42A 2EQJA 4NL3A 2NUPB 2XICA 4L6V5 4PFZA 2F5TX 3CCUQ 3PE0A 3RDVA 3AT1B 4E7IA 4EIKA 5GANe 2EYQA 3MCAB 5M9OA 4DBRA 5GANd 5KYWA 3VRZA 4LD9K 3OW2S 3EHQA 5J26A 4EMGA 3G4SA 1AZEA 2DL3A 4HT9A 2VGMA 2LJ1A 4ANJA 1JEGA 4BY6C 2CP0A 1BU1A 1VOMA 5KYXB 1ARKA 8ATCB 4C8QA 2QQBA 1KQ1A 4RTVA 3L2RA 2DNUA 5GAOp 2K3XA 4PJJA 4Y28E 1ZLMA 2CP7A 3A8HB 2X3XD 2MIOA 2CP5A 3FC3A 1UGQB 1NYFA 2YSQA 2EGAA 4RTYA 1EX4A 2QYZA 2HD0A 2QASA 1WHJA 2DL5A 2QXFA 3CD6Q 3L2UA 4MZPA 2B8AA 3CD6T 1C0MA 1QVPA 2M0OA 1WHHA 4IKFA 4XTVA 2D1XA 4M75A 4KUIA 3PMIA 2KEAA 1D0XA 4EDUA 3VS6A 2LC4A 2EJFA 2RK2A 4C5HA 4HVVA 2DJZA 3EG9B 1Q82C 4J9DA 2GFAA 5KYNA 4M7AG 4J9HA 4A4KA 3DB3A 4J9CA 4J8OA 1YWOA 3P8DA 4IIMA 3UA7A 2D6FA 2CS7A 1GCQC 3SEMA 3HPWA 3EG2A 3SWNC 2RQWA 4LDVA 4IUPA 2LCLA 1YHQA 4FSXA 1AWWA 1FMVA 4C8QE 3GIBA 1M90C 4HVWA 1KD1C 1YBYA 2YT6A 2GTOA 4C0ZA 4M7DB 2RHUA 2E12A 5GAN5 1Q81R 5HK0A 4ZTJA 3CXCS 4HT8A 2IPOB 2J6KA 3EGUA 3OYJA 2MAMA 1QVFS 1X2QA 1M1GA 2D0NA 1YITQ 2JS0A 1Y71A 2E5QA 3KFVA 2HL3A 5KYUA 2XHCA 2JXBA 1S72A 1YITT 4M7DG 2NYSA 2DBMA 2J7IA 2AIRB 2FZCB 3VS0A 2V1QA 4KRTA 3A8LB 3PTAA 4CI0C 1LPLA 2DL8A 1ZUUA 2O88A 1U8RA 2CUDA 4A63B 3CCSA 2RQRA 1MMNA 3A98A 4M7AA 2RH2A 3VS7A 2AHJB 5CKEA 1VUBA 4EPCA 1NM7A 4FSSA 3M57A 2WACA 3QKJA 5FU6B 5KE3A 2ED1A 5GANh 2K4YA 2LT4A 3G6EA 2FEIA 4EMHA 4RG2A 3JB9I 3BW1A 4LD6A 1VQPA 1BIAA 3HKSA 3QPHA 4RTUA 4OB3B 2D8HA 1H641 1MGQA 1H3HA 2OTLA 2QQRA 3E9FA 1MMGA 2W10A 4PJOC 1X6OA 3G71Q 2YDLA 3HTRA 5IHNA 2EYYA 2A0FB 1JQQA 1AZGB 3CCQQ 3G71T 1OX9A 1W6XA 1G5VA 1QVGP 5IXFA 4IUUA 4FYWB 2FZGB 2CSQA 2QI2A 1RLPC 3MEVA 3JCMb 1K73R 3CCQT 3JCMJ 4M77B 1QCNA 2JTMA 1SRLA 2Y4YA 1UGVA 4DBFA 3PIPA 2L5QA 3CCLQ 2YLBA 5A0DA 3SD4A 3CCJA 2VYTA 3MEWA 3CCLT 1VQ6A 2BE9B 2DJQA 1P92A 1RAHB 1JJ2S 4LN2A 5J3BA 5L23A 1VIFA 1X6GA 2CT4A 1WJSA 2A28A 2OX7A 1FMKA 2LT1A 3BFMA 1B3QA 3EFSA 3NMZC 5GAMj 1N6AA 1AOJA 1Q81U 1RAAB 4FM4B 2DTOA 1YJNA 1HYOA 5FU7B 1I8FA 3MEAA 4HA8A 2COYA 3M9QA 4C92A 3C95A 3JRZA 4M7AD 4Q5WA 1HXDA 1PG5B 3CCRQ 1WXBA 2GFUA 3CPWA 2GGRA 3CCRT 2ZZDA 3ZBDA 1VIEA 4LDYA 1VQ9Q 2H8HA 3CC7A 3WVEB 4F17A 4ZTFA 1BYMA 5EC7A 2J6OA 1VQ9T 3VS3A 2DX1A 4OMMA 5GAOr 1Y7XA 3PMTA 1M3AA 1PD0A 4HCBA 1NJIR 2ROTA 4LUDA 2E3HA 2R5AA 4NOYA 1SF9A 4OGCA 2CKKA 2QK0A 5GMKi 3T9NA 2F2VA 1LJOA 1XOVA 2FVUA 2HZYA 3FEOA 5GAN3 2EKOA 2J6FA 1PNJA 3QWYA 2OAUA 1NPPA 5IHIA 4QVCA 4D8KA 2D8JA 1WIEA 2QGGA 2KRNA 1S1NA 3L2ZA 5LJ3j 1PM3A 4A4GA 2E4HA 4M7DD 4RTWA 4R55A 2EQKA 3VS4A 1VQMA 4QT7A 2DVEA 1D1CA 3QZ9B 1NBEB 1NEGA 4M78E 1WJQA 2KYMA 2L89A 2QQSA 2X4XA 3C94A 4M7AF 4C92E 3LX7A 1UGPB 5LJ5j 4E7SA 5A0LA 1JRIA 2KT8A 1RADB 4BI8B 3QJ6A 3QDFA 1OULA 4Z89A 3OYNA 3NGPA 3HRSA 1XQHA 4KGXB 3INZA 1SHFA 3FRNA 4Y92A 2KBTA 1I5LA 4JRQA 3CC2A 1W4SA 1PWTA 2WSEE 1QMCA 3OYIA 2RPNA 4FYYB 1WQWA 2DIGA 3CPWP 5GJWB 3PVLA 2COZA 1X2KA 2YUQA 1SEMA 2O2OA 2M16A 1GCQA 1IGQA 2XDDA 2DO3A 3M4GA 2FB7A 4IIOA 3SWNA 3LGFA 1WXUA 3LWHA 3LGLA 4A4HA 2DTHA 4M7DF 2KMTA 4K11A 1FXXA 1EFNA 3OSVA 4BDZA 3VU3C 4AG2C 1ZBJA 3CMAQ 3EFOA 1K76A 3CMAT 1OV3A 2EBPA 1OEBA 1NJIU 3HHTB 3DLMA 4BE0A 5KCHA 3P8HA 2LCCA 1I1JA 3OB9A 2XIDA 3OMGA 3CCMA 5AYFA 1WHLA 4QVDA 1PCXA 2XDBA 2BZXA 1X27A 1YJ9Q 1G3WA 4Y91A 1HSQA 1I0CA 5FWBA 4GY5A 3JCMV 2YWWA 3OYBA 1T0JA 4N0AC 1YJ9T 2OAWA 4ZGDB 3JCMP 2LX9A 4E7HA 1ZUYA 3ZFJA 5KYWB 2CP3A 2MWOA 1TUDA 2DM1A 5GANg 2C06A 2CUBA 1M27C 3L2WA 1RAIB 4A54A 4JUVA 1UGRB 4J9BA 1ZA1B 1TS9A 4RG8A 3V7SA 4C8QB 5LJ3f 2ZPBB 1G3YA 2ABLA 2E5KA 1KHIA 3JV3A 3G1JA 1M4ZA 1JJ2P 2PQWA 3OYAA 3M0UA 1KC8R 2DBKA 1W70A 2RI3A 1B34A 1G2BA 4OMFB 3GLXA 2KNBB 5CVIA 3EHRA 2MF2A 1NLOC 2XMFA 4DEXA 4XTYA 4C8QG 1GFCA 1V1CA 3RIRA 2HCKA 3H9NA 2JN0A 4EMKC 2CSIA 1GXIE 2A7YA 3HL8A 1IO6A 4M4ZA 2KSSA 2XD0A 4JLGA 1TWBA 5CKDA 1MNDA 2K57A 2O9SA 2EYWA 4M75B 4Z02A 3CMEA 3E9GA 2OTJQ 1N9RA 2J05A 2XKOC 5GMKj 1WDXA 4PJOA 4XTZA 3REAB 1AEYA 1D09B 5CO7A 2OTJT 4M78C 4JS5A 1OI1A 2QDYB 5EG2A 2VV5A 4LDWA 3X20B 1AD5A 2IIMA 3M59A 1H8KA 2DK3A 3ZEHA 2E64A 3LW5E 2RD1A 3QHSA 1LNXA 2R5MA 2HEQA 1VQ7Q 2L3QA 1TUGB 4M75G 2LQWA 2RF0A 2FPFA 1VQ8A 4V2SA 3NHNA 1KG1A 3QG1A 4LDUA 2K2MA 5LJ3e 3FB9A 2QAZA 1WHMA 4CC4B 2VC8A 1M1KR 1RUWA 4HCKA 1M3CA 2MWPA 1LVKA 3CBPA 1YIJQ 2FYKA 3CCUT 3CC4Q 3J7AF 1BB9A 1OOTA 3H0FA 3ASKA 1YIJT 2E3IA 1QWEA 3CC4T 2QQ9A 1OU9A 3EGXB 4BE2A 5GMKl 2FRWA 2QG9B 2DTIA 1PRLC 3E1SA 2R57A 4O5VA 2L8DA 1Z9ZA 2ZPFB 4C0DC 3O8VA 2YLCA 3G71A 4BB7A 3QWXX 5KYUB 1KFZA 2RQUA 3CCQA 1ZBXA 1JXMA 2G6FX 2HKNA 4ELZC 3QJYA 1R0BG 2E65A 4PJOE 3C4SA 1QCOA 2IG0A 3PFSA 2KAFA 3CCLA 1PD1A 1PC0A 2NWMA 3OYYA 1B7TA 2AZVA 1UUEA 1YCYA 2K79A 3MJXA 1Q86R 2COWA 3EFRA 4J5YA 1VQLQ 2JNGA 2RA2A 3DKMA 1KC8U 4M7AB 1JO8A 3I56Q 1VQLT 3H6ZA 1R0CB 3I56T 2PU9B 2XDPA 2KRSA 3FLGA 1KSWA 2EVRA 1RI9A 3V8KA 2EYXA 2ROLA 2JJ9A 2A36A 3M55A 3R6NA 2DLPA 2DEUA 4KGZB 2VVKA 4PKCC 3X24B 1UDLA 2PNIA 2E1HA 1D3BA 2E6ZA 4PL6A 3M0PA 1VQ9A 1Q82R 2DYIA 1ZSZC 1M8MA 2BZ8A 1I4K1 3KXTA 5FRMA 3OY9A 1ZQ1A 3EG3A 1HD3A 4NL2A 3VYHB 4QQ6A 2F1LA 3MP8A 4HKEA 2G3RA 2EFIA 4IUTA 4C8QD 3AHUA 2DRMA 3TQ7P 1YWPA 3HFNA 3JAME 1Q81C 2BZYA 3REBB 4ELYC 4KT0E 2KR3A 4NS5A 2ZPEB 5IAYA 3HSBA 3CCVQ 2DL4A 1SSFA 5GAOn 1K0SA 2AT1B 2X4WA 1OZ2A 3CCVT 2QDLA 3UPUA 5CKFA 2FO0A 3BY7A 1D0ZA 1QLYA 4RUGA 3A1PA 2DXBA 4C92B 1F1BB 1IGUA 1R77A 4LUEA 1UHCA 3CPWS 1RAFB 1V76A 5ECAA 1X69A 5I2MA 1QKXA 2M9UA 4M75D 4UC4A 2KE9A 1MNEA 5LJ3h 1UEBA 3V7CA 3S6WA 2HBPA 4IUVA 1K8AR 2EQIA 1G8XA 2E10A 2C0IA 3UWNA 3I55Q 3SDZA 4C92G 1YP5A 3VUBA 2RI5A 2J06A 3HP9A 1Q86U 3I55T 5KCOA 3RMSA 2P0QA 3EH2A 5IHKA 1RLQC 3OYCA 4N0AA 4II1A 2BIVA 1UTIA 2C0OA 1Q7YR 5GAN6 4C8QF 1VQKQ 4F7UE 4PJLA 2JVVA 1H3ZA 1VQKT 3I5SA 4BY6B 4L5GA 4AFQC 1YFNA 1JB0E 3M0QA 3EGDB 2ZPHB 1X43A 1KQSA 4J9IA 3S3NA 2DD5A 1A0NB 2EJ9A 1BI1A 1TSFA 1M2VA 4J7FA 3VS5A 3G4SQ 4F14A 4X9CA 5L8RE 4ESRA 2QTVA 1BKBA 2E41A 2WSCE 2CZ7B 1PSEA 3LH0A 2K5FA 2K6DA 2DXCA 3CCEQ 1VQOQ 3FJPA 4DBHA 5D6XA 3M53A 4M75F 3C0CA 2CYZB 3CCET 1VQOT 1KK7A 4EMKA 2LJ0A 4QW2A 2DFUA 1BK2A 2FHDA 3IQLA 4ZGJB 3JCMf 1AWOA 4B6MA 2CREA 1E7OA 1YJ9A 3SHWA 1UECA 1K9MR 1ZSGA 1U06A 4ZNXA 3RMQA 2LRQA 3J81E 2PUKB 3GPLA 3H8ZA 4M78A 5GMKm 3HRTA 2Y4XA 4J9FA 5FRNA 4WF2A 1JBMA 2C0TA 2CZ6B 1T0HA 3MPUB 2EGEA 3VJPA 4FT4A 3GNGA 2QQAA 1SPKA 3SWNB 4BE1A 1DJ7B 4PNOA 2LNVA 1MUZA 3A8OB 3GF5A 2LCSA 1NJIC 1K8AU 4DQ2A 3VUZA 2K3BA 2KT1A 4GBQA 4JJNK 1SRMA 1VQ4Q 1VQ4T 5FW9A 3LH5A 1FMWA 3MHXA 4E7KA 2DA9A 1I5OB 3JCMe 1K1ZA 2MI6A 2YUOA 1Q7YU 5IXBA 4OB1B 4OF1A 3JCMX 4XTUA 4GLKA 1SKUB 1KQSP 4QQDA 3LWIA 2D9TA 1UFFA 4C0FA 2GQIA 4M7DE 2V8KA 3DB4A 3MKDA 1M5Q1 4XTWA 1K73U 2SRCA 3M56A 1N8RR 3RBBB 3H0IA 2I0NA 3VV0A 3CCUA 4C92D 3JB9J 4ME7A 4IURA 1YIJA 1Y96A 5A2QE 2L2PA 4F16A 5GANj 2JTEA 1B34B 5DLOA 5GAN4 5CQXA 2AZSA 4AFZC 3M5AA 2PUOB 3FIFA 2I2LA 1SG5A 4JJBA 1MV0B 3JB9G 1WPYA 1K9MU 3OYGA 2LQNA 1UG1A 4E7LA 2KROA 5HK3A 5GAMf 2GNCA 4PK4A 4PJOB 4J9EA 3OBYA 1WNLA 1JXOA 4WTOB 2ECZA 1ZSZA 2RI2A 3EG0A 4X9DA 2E70A 1M8VA 3E19A 3LYIA 2EIFA 4PJMA 2AK5A 2P4TA 3M54A 3EAEA 2Y90A 1BI2A 3HFOA 5CCAA 2HQHA 4X1VA 2EQUA 2H3JA 2YRVA 3QYGB 2KVQG 4WCIA 3UDCA 3CD6A 1LOJA 1QW1A 1HK9A 1R8OB 3OS5A 4C5IA 4PJOG 3M0RA 1O75A 4X34A 1VQLA 1W2BA 4FCYA 5LJ3g 5J39A 2P0PA 2O4XA 2VUBA 2V8JA 2O9VA 4E7JA 3CCJQ 3TVTA 2CDTA 2EWNA 4M77E 4C92F 5KYYA 1RL2A 1YCSB 2VASA 2KDSA 5HY6A 4B9XA 1Y07A 1KQ2A 2EGCA 1BCOA 1BIBA 1C1AA 5GAMe 1FYNA 2L0AA 3PT9A 2ZPIB 3U23A 4XTXA 3RNJA 1IXDA 2LX7A 2DXTA 2P4RA 5GAMd 3UF4A 4BACA 3OMCA 1QQJA 3QIIA 1IRXA 1VQ5Q 3O5ZA 4XU0A 3M0SA 1N27A 2HSEB 1VQ5T 2K2VA 3A8GB 1YI2Q 1H92A 9ATCB 2O01E 5D6YA 4FIBA 2HBWA 2ZCFB 4LDXA 3OYMA 1YI2T 1N8RU 4J9GA 1KC8C 2OI3A 2M51A 3I5RA 1Q95G 2QEXQ 2K5IA 5LJ5f 3VS2A 2LDMA 5IH2A 2QEXT 2K9GA 3MP1A 3OS1A 2FPEA 1ZHIA 3M58A 4JDSA 5FROA 1ABQA 5KH6A 4P5NA 1M9SA 1ACMB 2LJ3A 3BE3A 5D6WA 2XK0A 4C0GA 1U1TA 3JCMh 2XU8A 2EW3A 2ED0A 3OYKA 3CCVA 4M7DC 2MYSA 1IREB 5KE2A 1YITA 3ME9A 3ULRB 1N5ZA 1G3SA 1BBZA 3QYHB 1PKTA 5DM7R 4QKUA 2JM8A 2RM4A 3RKYA 1ZA2B 4OGEA 1NZ9A 4E47A 2RK1A 2QA4Q 1D3BB 2RHZA 1TTHB 3JCMQ 5LL6S 1VQ7T 2QA4T 5CKBA 1D1BA 3RKWA 1E6GA 1WA7A 2BUDA 4AMCA 4PFOA 2P0KA 2X3WD 5LJ3d 1W2BP 2ZPGB 3BDUA 1W1FA 3F70A 3I55A 5C0MA 1ZUKA 4XU3A 2LP5A 3A5ZB 3CPFA 4JRIA 3UT1A 4OMPA 4E6RA 2AKLA 4OMNA 2MPXC 2DZCA 3NTIA 4TVRA 4B9WA 5LJ5e 3KBGA 3JB9D 2YUPA 4JRPA 3Q1JA 1GRIA 4JS4A 2M02A 3QDRB 5LJ5d 3S3OA 1X75C 4ZGEB 1VQKA 2EPDA 2FZKB 5FU6C 2RN8A 4N4GA 2ZGWA 2D0QB 4C5GA 2KY9A 1Y57A 2KXDA 5I21A 3QUIA 2RHIA 2GTJA 2LZ6B 4JPBW 2JT4A 1MMDA 4F7UG 1JU5C 3M4YA 3CC2Q 3OS0A 4HXJA 2DYBA 3CC2T 4OMOA 1VQNQ 2F5KA 1LCKA 2YRCA 1Z9QA 1VQNT 1C6VX 1B07A 1AVZC 3CCEA 1PRMC 1VQOA 4PJOD 2HMAA 4M77C 5DLQE 1Q86C 2JOYA 2DL7A 2RJEA 4JRKA 2HKQB 1NPRA 3TU4K 1RABB 3QO3A 4FYXB 1VYVA 1RAGB 5CAIA 1D0YA 2DMOA 2H3EB 2XG8D 2BTTA 2CZ0B 1IZ6A 4XAXB 1CSKA 2CP2A 1E6HA 4L59A 3CCMQ 5FWCA 2KGTA 4CRIA 1GCPA 1BCMA 2DZ9A 4J83A 3JB9F 3CCMT 3CCRA 2VB6A 4A4EA 2AKKA 5AT1B 2HSPA 4PLLA 1KQSS 5FU7C 5GAMh 2ATCB 4AFUC 2KI7A 1HJDA 3LLRA 2LNHB 1OU8A 2LVMA 5HKCA 1YNZA 1GL5A 2KK4A 3I9QA 2JS2A 1U1SA 2DIQA 1M2VB 3OYEA 1QWFA 4XQ3A 1OYXA 2RB6A 2PVDB 1V29B 1YJWQ 1WLPB 3D7SB 2NUTA 4LNPA 2DVJA 4D8DA 1M1KU 1PKSA 2F69A 4KH0B 1YJWT 2PTKA 2QTXA 3OYHA 4F7UA 1VQ4A 1SSHA 1QVGA 2NUPA 4FYVB 2DRKA 4RTZA 4EMKB 5IT9E 1M90R 5DY9A 4F04B 4PJOF 1SHGA 4AFSC 5I22A 1KD1R 5GAN7 2VGNA 1I07A 3QSUA 4DEYA 1X01A 3META 1NG2A 2X9HA 2A3LA 2NUZA 2DD4A 3FDRA 4XK8E 3JCMc 4M78B 5HCKA 1WJRA 3I35A 3EGXA 2M1HA 2MK5A 2ESWA 2MOXA 2RHXA 2RQTA 3TSWA 3VKIA 4ZN1A 3OW2A 3CMEQ 1QCFA 4RKUE 5KYXA 1KHCA 3CMET 2JUFA 2HNIA 2W0ZA 2EYZA 4A53A 4M75E 4PJNA 4D6WA 2KQWA 5GMKe 2QGFB 1QP3A 2DILA 1NLPC 2FRYA 3P8BB 2VWFA 1G3TA 1K8AC 4C5EA 4M78G 1D1AA 1YN8A 1N9SA 4JZ3A 3SFMA 4PFPA 4RTTA 1WQ7A 1VQ8Q 1NYGA 2KRMA 1CKBA 4IUQA 3PVQA 1M1FA 5IN1A 1EZZB 4R0KA 1VQ8T 1OX8A 1OZ3A 1K9AA 2DETA 1XJWB 5LJ5h 4DBQA 2B86A
chains in the Genus database with same CATH topology
4GLKA 4FT2A 2HD0A 4OVAA 2QXFA 4C8QB 5LJ3f 2ZPBB 4QQDA 1Q7YC 1G3YA 3LWIA 2D9TA 4XU2A 1KHIA 4C0FA 5GAN8 3L2UA 3N5BB 4M7DE 4MZPA 2B8AA 3MP6A 2V8KA 3CD6T 3DB4A 1M4ZA 1M5Q1 2DKGA 2HQXA 4XTWA 2PQWA 3X25B 4C0DB 3JCMg 5GAOl 1QVPA 2M0OA 3BDLA 3OYAA 3PNWC 1K73U 1O9SA 4IKFA 3M56A 4XTVA 2CGHA 2RI3A 1B34A 1UGSB 4M75A 1K73C 4KUIA 3PMIA 4OMFB 1WGSA 3GLXA 5CVIA 2MF2A 4EDUA 2LC4A 4XTYA 4C8QG 3GP8A 1Q82U 2EJFA 3RIRA 3VV0A 2RK2A 4C92D 3G4ST 4ME7A 3CCUA 3JB9J 4C5HA 2JN0A 2JZ2A 4EMKC 1GXIE 2A7YA 4MMLA 3HL8A 4IURA 3RESA 3CMAA 3JCMX 2DJZA 2KSSA 3GOXA 1Y96A 1YIJA 2XD0A 1Q82C 5A2QE 3RUXA 4JLGA 5GANj 2X4JA 5CKDA 2GFAA 1B34B 2K57A 3CBMA 1TH7A 4M75B 1XTDA 4Z02A 4M7AG 5DLOA 5GAN4 5CQXA 3CMEA 4A4KA 3E9GA 3M5AA 3DB3A 2PUOB 4J8OA 3FIFA 2I2LA 1N9RA 2XKOC 5GMKj 4PJOA 3NFCA 3P8DA 4XTZA 3V8LA 3TEEA 3JB9G 5CO7A 2OTJT 1WPYA 4M78C 4JS5A 1OI1A 3WXMB 4OB2B 2D6FA 2CS7A 1Y96B 2QDYB 5EG2A 2VV5A 1K9MU 3OQ5A 4LDWA 3TCJA 3HPWA 4BI4A 3OS2A 3X20B 3OYGA 3L2VA 3ER0A 3M59A 3X26B 4E7LA 2DK3A 5HK3A 1M90U 3SWNC 5GAMf 4RCCA 4M7DA 3ZEHA 4LDVA 2E64A 2LCLA 2RD1A 3LW5E 3QHSA 4FSXA 1LNXA 2R5MA 4IUPA 1YHQA 1KD1U 1K9MC 4C8QE 4PJOB 3GIBA 4KUDK 4M75G 1M90C 3OBYA 2LQ8A 1WNLA 4OB0B 1VQ8A 4V2SA 2RI2A 3JSCA 1KG1A 3QG1A 1KD1C 4M77G 4LDUA 5LJ3e 4X9DA 2E70A 4A4FA 1M8VA 1YBYA 3FB9A 3E19A 3LYIA 4C0ZA 4M7AE 3QZ5B 3CXCA 2EIFA 4M7DB 1MHNA 3M54A 2P4TA 2EJGA 2VC8A 3EAEA 2PVOB 3OA6A 2Y90A 1BI2A 2RHUA 2V8IA 2E12A 3V8JA 2MMPA 3HFOA 5CCAA 5GAN5 2MWPA 4MDWA 3CBPA 3URGA 2EQUA 2FYKA 2H3JA 2YRVA 3QYGB 1QVFA 3CCUT 2KVQG 3UDCA 5HK0A 3CD6A 3J7AF 4ZTJA 1LOJA 3CXCS 1QW1A 3ASKA 1HK9A 1R8OB 2RHYA 3OS5A 1YIJT 1VQ5A 4HT8A 4C5IA 4OP0A 3CC4T 4PJOG 4FL6A 5GAN2 3OYJA 2MAMA 1O75A 1QVFS 4F7UF 4X34A 2QQ9A 1VQLA 1W2BA 1YI2A 1M1GA 5LJ3g 2DXUA 5J39A 2P0PA 2O4XA 2VUBA 1Y71A 2E5QA 2V8JA 4C8QC 2XHCA 4BE2A 4E7JA 1S72A 4KBMB 5GMKl 1YITT 4M7DG 2GCXA 2EQMA 2QEXA 1FWZA 2DTIA 1W2BS 3E1SA 2EWNA 4M77E 2R57A 4C92F 4O5VA 4RCBA 2L8DA 2ZPFB 3HRUA 2EAYA 4C0DC 1RL2A 3A8LB 3O8VA 2YLCA 4QVZA 3PTAA 3G71A 4HCCA 4CI0C 1YHQT 4R56A 4BB7A 2O4XB 2KDSA 5HY6A 4B9XA 1Y07A 5CKHA 1KQ2A 3CCQA 1ZBXA 1U8RA 4ELZC 3CCSA 3QJYA 2E65A 2OTJA 3JCMd 4PJOE 1BIBA 4M7AA 3C4SA 2RH2A 2IG0A 2AHJB 3PFSA 2KAFA 5GAMe 3PT9A 2ZPIB 3NTHA 2R58A 3QBYA 4XTXA 5CKEA 3CCLA 1VUBA 4EPCA 2DXTA 3M57A 5GAMd 4BACA 2WACA 3OMCA 3QIIA 3OYYA 3L1AA 3QKJA 4J6XA 5FU6B 4M75C 5KE3A 4XU0A 1YCYA 1N27A 4PLIA 5GANh 2K4YA 3OYFA 4MMKA 3EFRA 2K5LA 2LT4A 4J5YA 3G6EA 2CZ1B 2K2VA 2JNGA 3A8GB 1VQ5T 2RA2A 3DKMA 1KC8U 4M7AB 4EMHA 3GNFB 4N4IA 4XU1A 4ZN3A 2O01E 2QA4A 4RG2A 5D6YA 1VQ7A 4FIBA 3JB9H 3JB9I 3BW1A 4LD6A 3RKXA 1VQLT 2ZCFB 3H6ZA 3OYMA 1YI2T 1N8RU 4LDXA 1VQPA 5GMKh 3C12A 1KC8C 1BIAA 3I56T 5GAMg 2K5IA 2YHTA 3HKSA 3QPHA 2PU9B 2VXEA 1S72T 5LJ5f 4M78D 2XDPA 2LDMA 1H641 1MGQA 4M77A 4OB3B 1N8RC 3FLGA 2QEXT 2OTLA 3KUFA 3MP1A 2QQRA 3OS1A 3E9FA 3V8KA 1ZHIA 3M58A 1X6OA 4JDSA 5FROA 4PJOC 5KH6A 4P5NA 3PIOA 1M9SA 3M55A 3J80E 5D6WA 3CC4A 5FLXE 2XK0A 4C0GA 3X28B 2E6NA 3G71T 1U1TA 3MEUA 3JCMh 2XU8A 1G5VA 1FX7A 4PKCC 4IUUA 3OYKA 3CCVA 2QI2A 3MEVA 4FU6A 3QXEB 3X24B 3JCMb 3CCQT 3JCMJ 4M77B 4M7DC 2JTMA 1IREB 5KE2A 3CCST 2Y4YA 2E1HA 1D3BA 4BI3A 3PIPA 1YITA 3ME9A 1JJ2A 2L5QA 2E6ZA 2VXFA 1G3SA 2YLBA 5A0DA 3SD4A 4PL6A 3CCJA 2VYTA 3QYHB 1VQ9A 3MEWA 3CCLT 4MZMA 5DM7R 5C6SA 1VQ6A 1P92A 1I4K1 1JJ2S 3KXTA 5FRMA 3OY9A 1ZQ1A 5J3BA 2RM4A 3RKYA 4OGEA 1NZ9A 4E47A 2RK1A 2JTFA 4KULA 1VIFA 1D3BB 2LTOA 4NL2A 3G6ET 2RHZA 2RJCA 1WJSA 3VYHB 4QQ6A 1I81A 3JCMQ 3MP8A 5LL6S 1VQ7T 2QA4T 5CKBA 2LT1A 3BFMA 3RKWA 4RMOA 3EFSA 3OSSC 2BUDA 4HKEA 2G3RA 2BKDN 5GAMj 1EIFA 1N6AA 3TREA 1VQPT 2P0KA 1Q81U 4FM4B 3VYGA 2EFIA 4IUTA 1AHJB 4C8QD 3AHUA 5LJ3d 2DTOA 4DA4A 1YJNA 2ZPGB 5CK9A 3BDUA 3G7ZA 5FU7B 2HAXA 1VQNA 2PVGB 1I8FA 3HFNA 5CR2A 3F70A 3JAME 1XNIA 5C0MA 3I55A 2OTLT 1Q81C 3MEAA 4J6WA 4HA8A 4XU3A 3M9QA 4KT0E 4NS5A 4ELYC 3A5ZB 4C92A 3CPFA 2ZPEB 3C95A 3JRZA 5IAYA 4M7AD 4Q5WA 4JRIA 3UT1A 3HSBA 1HXDA 1SSFA 5GAOn 3NTIA 2DZCA 4BUGA 2X35A 4TVRA 2X4WA 1OZ2A 2HQEA 4B9WA 5LJ5e 3CCVT 3KBGA 3UPUA 5CKFA 2GFUA 3I56A 3CPWA 3JB9D 4JRPA 3Q1JA 2ZZDA 3CCRT 3ZBDA 4JS4A 1VIEA 3BY7A 4LDYA 3QDRB 5LJ5d 3S3OA 4M78F 1X75C 1QP2A 3WVEB 4ZGEB 3CC7A 5I2SA 1VQKA 4ZTFA 2DXBA 5CQYA 5FU6C 4C92B 1BYMA 3CCJT 4ATOA 2DPPB 3CPWS 4N4GA 2ZGWA 2D0QB 4C5GA 1VQ9T 2FL7A 2KY9A 1VQ6T 5GAOr 5I21A 1Y7XA 3PMTA 5I2MA 4M7AC 4MDXA 3RERA 2M9UA 2X4YA 3QUIA 2RHIA 4M75D 4MZTA 4UC4A 4HCBA 4F7UG 4NOYA 2R5AA 4M77D 5LJ5g 3M4YA 5LJ3h 1UEBA 3V7CA 1UB4A 4OGCA 3S6WA 2RO0A 3OS0A 4BDYA 2CKKA 2HBPA 4IUVA 5GMKi 3T9NA 4VUBA 1LJOA 1XOVA 2FVUA 5GAOm 3CC2T 2E10A 3FEOA 5GAN3 2EKOA 2F5KA 3UWNA 1BI3A 3SDZA 4C92G 1YJNT 3VUBA 2RI5A 3HP9A 1VQNT 4QQGA 2OAUA 4O6JA 4BD3A 1Q86U 2NLUA 1NPPA 3I55T 5KCOA 4QVCA 2GQVA 3CCEA 1VQOA 3RMSA 3A8MB 4PJOD 2P0QA 4M77C 5DLQE 3OYCA 1Q86C 1NE8A 4N0AA 3S3MA 2JOYA 2RJDA 4II1A 1PSFA 3L2ZA 3MO8A 5LJ3j 2BIVA 2L3RA 4YTLA 2RJEA 4JRKA 4A4GA 3PGGA 1YJWA 4DOVA 1NPRA 3TU4K 4M7DD 3QO3A 2XI9A 5GAN6 4C8QF 4F7UE 4R55A 2EQKA 2JVVA 5CAIA 1H3ZA 1VQMA 3CC7T 1VQKT 2DVEA 4BY6B 4L5GA 2XG8D 3QZ9B 2CZ0B 1IZ6A 1JB0E 4XAXB 4M78E 1WJQA 2L89A 2X4XA 2QQSA 2ZPHB 3C94A 4M7AF 3OBWA 4C92E 3LX7A 1UGPB 4L59A 1KQSA 2RJFA 3S3NA 2DD5A 5LJ5j 4CRIA 5GANf 2EJ9A 3L2QA 2DZ9A 5A0LA 1JRIA 4J83A 3CCMT 2DAQA 1BI1A 4A4EA 3CCRA 3JB9F 4J7FA 4X9CA 1KQSS 4PLLA 4BI8B 3QJ6A 5FU7C 5GAMh 5L8RE 2IVWA 4J7IA 3OYNA 3OYLA 3HRSA 1BKBA 2E41A 2WSCE 2CZ7B 1PSEA 3LH0A 4N4HA 2LQKA 2K5FA 3LLRA 2DXCA 5HKCA 1XQHA 2LVMA 3DLLA 3FJPA 2KK4A 3INZA 5D6XA 3SB2A 2DEQA 3M53A 4M75F 4J6YA 1U1SA 2CYZB 2DIQA 3NTKA 1VQOT 3CCET 3FRNA 4HCZA 5A0GA 3CEYA 3OYEA 4M77F 4XQ3A 4EMKA 3OYDA 1OYXA 2RB6A 3CBOA 4QW2A 3JCMW 2PVDB 1V29B 2FHDA 1I5LA 4ZGJB 3R6OA 3JCMf 4JRQA 1M1KU 2F69A 5GAOq 3CC2A 1YJWT 4C92C 1W4SA 2QTXA 3OYHA 4F7UA 3WVDB 1VQ4A 1YJ9A 1BI0A 2WSFE 1QVGA 2WSEE 1M1KC 3OYIA 3RMQA 1RI0A 1WQWA 2DIGA 2LRQA 3J81E 1VQMT 2PUKB 3GPLA 4EMKB 5IT9E 3H8ZA 4M78A 5DY9A 5GMKm 4PJOF 5CIUA 2M16A 4JLIA 1QVGS 3V7RA 2K3YA 5GAN7 2VGNA 2Y4XA 3HRTA 2XDDA 3QSUA 2DO3A 2GF7A 3M4GA 4DOWA 5FRNA 2FB7A 4F7UB 1X01A 3L42A 3LGFA 3META 3SWNA 2EQJA 1JBMA 4WF2A 4NL3A 3LWHA 3LGLA 2A3LA 2CZ6B 2XICA 2DD4A 4A4HA 3FDRA 2DTHA 4L6V5 1K8AU 2KMTA 4M7DF 2F5TX 1FXXA 3OSVA 4BDZA 4XK8E 3JCMc 4M78B 3VU3C 1WJRA 3VJPA 2M1HA 4FT4A 3GNGA 2RHXA 2QQAA 3CMAT 4E7IA 3SWNB 3VKIA 1DJ7B 4ZN1A 4BE1A 5GANe 3OW2A 1NJIU 4PNOA 2EYQA 2LNVA 3DLMA 3HHTB 3MCAB 5KCHA 4BE0A 4RKUE 3P8HA 5M9OA 3A8OB 2LCCA 1KHCA 3GF5A 3CMET 5GANd 2JUFA 3OB9A 2HNIA 2XIDA 4LD9K 3OMGA 3CCMA 5AYFA 4DQ2A 1NJIC 4A53A 3VUZA 4M75E 4D6WA 5GMKe 2KQWA 3OW2S 4QVDA 2XDBA 1QP3A 4JJNK 5J26A 4EMGA 1G3WA 3P8BB 4Y91A 3G4SA 4HT9A 2VGMA 1G3TA 1K8AC 4C5EA 4M78G 4GY5A 3JCMV 4BY6C 3OYBA 4N0AC 1VQ4T 1YJ9T 4ZGDB 1N9SA 3JCMP 2LX9A 3SFMA 4E7HA 3MHXA 3ZFJA 4C8QA 2MWOA 2QQBA 1KQ1A 5GANg 3L2RA 4E7KA 2C06A 5GAOp 1WQ7A 2K3XA 3L2WA 3JCMe 4IUQA 4A54A 4Y28E 4JUVA 1M1FA 3A8HB 1UGRB 5IN1A 1VQ8T 1OZ3A 2MI6A 3FC3A 5LJ5h 1UGQB 1Q7YU 4RG8A 4OB1B 4OF1A 3V7SA 4XTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q C;  5GAM j;  4X9C A;  5GMK l;  5GAM h;  4M7D G;  3AHU A;  4C8Q D;  2DTI A;  4C8Q B;  5LJ3 f;  5LJ3 d;  2DTO A;  2EWN A;  4M77 E;  4C92 F;  3BDU A;  3RER A;  2E41 A;  4RCB A;  4XU2 A;  5GAN 8;  1I8F A;  3HFN A;  4M7D E;  2EAY A;  4J6W A;  4HA8 A;  4XU3 A;  3FJP A;  2YLC A;  3INZ A;  3SB2 A;  2DEQ A;  1M5Q 1;  2DKG A;  4M75 F;  4XTW A;  4C92 A;  4J6Y A;  5GAO l;  3JCM g;  4M7A D;  1U1S A;  4JRI A;  3HSB A;  1HXD A;  1KQ2 A;  5GAO n;  2DZC A;  4M77 F;  4XQ3 A;  4EMK A;  4XTV A;  2CGH A;  2RB6 A;  3JCM W;  1B34 A;  2E65 A;  5LJ5 e;  1I5L A;  4M75 A;  3JCM f;  3JCM d;  3JB9 D;  4PJO E;  1BIB A;  4M7A A;  5GAO q;  3BY7 A;  5GAM e;  4C92 C;  2QTX A;  5LJ5 d;  4F7U A;  4M78 F;  4XTX A;  4XTY A;  4C8Q G;  2EJF A;  3RIR A;  2DXT A;  3JB9 J;  4C92 D;  4C92 B;  3JB9 H;  2JN0 A;  4EMK C;  5GAM d;  4MML A;  3RES A;  2ZGW A;  3L1A A;  1WQW A;  4J6X A;  2DJZ A;  3JCM X;  1Y96 A;  4M75 C;  4XU0 A;  4EMK B;  3RUX A;  1YCY A;  5I21 A;  4M78 A;  5DY9 A;  5GMK m;  5GAO r;  5GAN j;  4PJO F;  5GAN h;  4M7A C;  1B34 B;  2K57 A;  4MMK A;  1TH7 A;  3EFR A;  3QUI A;  4J5Y A;  4JLI A;  4M75 B;  4M75 D;  5LJ5 g;  4M7A G;  2RA2 A;  3V7R A;  4M7A B;  4EMH A;  5GAN 7;  4XU1 A;  5GAN 4;  3QSU A;  3M4G A;  4F7U G;  3JB9 I;  2FB7 A;  3BW1 A;  4M77 D;  1X01 A;  4NOY A;  3FIF A;  2I2L A;  1N9R A;  3RKX A;  3SWN A;  5LJ3 h;  4WF2 A;  1JBM A;  5GMK j;  4XTZ A;  3V7C A;  4NL3 A;  5GMK h;  3V8L A;  4PJO A;  3JB9 G;  1BIA A;  1WPY A;  2DTH A;  4M78 C;  5GAM g;  4M7D F;  5GMK i;  5GAO m;  1LJO A;  1Y96 B;  2YHT A;  2E10 A;  2VXE A;  5LJ5 f;  4M78 D;  4M78 B;  3JCM c;  1H64 1;  1MGQ A;  4M77 A;  3VU3 C;  5GAN 3;  4C92 G;  3V8K A;  3SWN C;  5GAM f;  4RCC A;  4M7D A;  4PJO C;  2E64 A;  2RD1 A;  3QHS A;  1LNX A;  4QVC A;  3SWN B;  4C8Q E;  3JB9 F;  5GAN e;  4PJO D;  4PJO B;  3GIB A;  4PNO A;  4M75 G;  1U1T A;  1WNL A;  3JCM h;  4M77 C;  4N0A A;  4V2S A;  3JCM b;  5GAN d;  4M77 G;  2HNI A;  3L2Z A;  5LJ3 j;  4M77 B;  5LJ3 e;  4X9D A;  4DQ2 A;  3JCM J;  4A53 A;  4M7D C;  4M75 E;  1M8V A;  4JRK A;  5GMK e;  3PGG A;  3FB9 A;  4QVD A;  2E1H A;  1D3B A;  4M7A E;  4M7D D;  4M7D B;  3QO3 A;  2VXF A;  2YLB A;  4EMG A;  2EJG A;  2VC8 A;  4C8Q F;  5GAN 6;  2Y90 A;  4Y91 A;  4F7U E;  4HT9 A;  4M78 G;  3JCM V;  3V8J A;  3HFO A;  5CAI A;  5GAN 5;  4N0A C;  2FYK A;  1N9S A;  3JCM P;  2DVE A;  1I4K 1;  1LOJ A;  4C8Q A;  4HT8 A;  5GAN g;  1HK9 A;  1KQ1 A;  2RM4 A;  4M78 E;  3RKY A;  5GAO p;  4OP0 A;  1WQ7 A;  4PJO G;  4M7A F;  4F7U B;  5GAN 2;  4C92 E;  1D3B B;  4NL2 A;  4A54 A;  3JCM e;  4JUV A;  4F7U F;  1I81 A;  3JCM Q;  5LJ5 j;  5LJ3 g;  5GAN f;  2DXU A;  2EJ9 A;  3BFM A;  3RKW A;  2DZ9 A;  5LJ5 h;  1JRI A;  3EFS A;  3V7S A;  4XTU A; 
#chains in the Genus database with same CATH topology
 1IHV A;  4FT2 A;  4OVA A;  1Q7Y C;  4XU2 A;  3GBQ A;  5GAN 8;  1TU0 B;  3N5B B;  3MP6 A;  2HQX A;  2DKG A;  4C0D B;  3X25 B;  5GAO l;  3JCM g;  3BDL A;  3PNW C;  1O9S A;  1UJY A;  3EG9 A;  2CGH A;  1WZO A;  2RNA A;  1UGS B;  1K73 C;  1WGS A;  4E7Z A;  4JJD A;  1Q82 U;  3GP8 A;  3G4S T;  2JZ2 A;  1G83 A;  4MML A;  3RES A;  3CMA A;  3GOX A;  3RUX A;  2HL5 C;  2X4J A;  3CBM A;  3UA6 A;  1TH7 A;  2SEM A;  1XTD A;  2YXY A;  4RTX A;  1IB8 A;  3NFC A;  3V8L A;  3TEE A;  3WXM B;  4OB2 B;  2CT3 A;  2F2X A;  1Y96 B;  1M3B A;  3OQ5 A;  3TCJ A;  4BI4 A;  3OS2 A;  3L2V A;  3ER0 A;  3X26 B;  4CC2 A;  1M90 U;  1UJ0 A;  4RCC A;  4M7D A;  4HVU A;  1RAE B;  1WXT A;  1KJW A;  1K9M C;  2BE7 D;  1KD1 U;  1RAC B;  1T3L A;  1VA7 A;  2YUN A;  4KUD K;  2LQ8 A;  4OB0 B;  3JSC A;  4OMQ A;  4M77 G;  2FPD A;  1CKA A;  4A4F A;  1K0X A;  3OW2 P;  4M7A E;  3QZ5 B;  3CXC A;  1AT1 B;  1MHN A;  3OA6 A;  2EJG A;  2PVO B;  2CH4 A;  2V8I A;  2JMC A;  2MMP A;  3V8J A;  4MDW A;  3URG A;  1QVF A;  2VKN A;  1WHK A;  1GFD A;  1IHW A;  1ZSZ B;  1VQ5 A;  2RHY A;  1J3T A;  2L3P A;  4OP0 A;  4FL6 A;  5GAN 2;  4F7U F;  1YI2 A;  2V1R A;  2DXU A;  4C8Q C;  4KBM B;  3EFO B;  2GCX A;  2EQM A;  2QEX A;  1FWZ A;  1W2B S;  2MCN A;  4RCB A;  4CC7 A;  1YHQ Q;  3HRU A;  2EAY A;  4QVZ A;  4HCC A;  1YHQ T;  1WI7 A;  4R56 A;  2O4X B;  4AT1 B;  2GBQ A;  2YRD A;  3NPF A;  5CKH A;  2JM9 A;  2K7A A;  1M30 A;  5KYY B;  2OTJ A;  3ZL7 C;  3JCM d;  2OJ2 A;  4KGV B;  2HDA A;  3NTH A;  2R58 A;  3QBY A;  4E2F B;  1TOV A;  3L1A A;  4LXC A;  4J6X A;  4M75 C;  4PLI A;  3OYF A;  4MMK A;  2K5L A;  2CZ1 B;  3FJ5 A;  3GNF B;  4N4I A;  4XU1 A;  4ZN3 A;  2QA4 A;  1VQ7 A;  4CC3 A;  3JB9 H;  3EGD A;  3RKX A;  3CQT A;  3VS1 A;  2RMO A;  5GMK h;  3C12 A;  1S72 Q;  2FG0 A;  5GAM g;  2YHT A;  2VXE A;  1S72 T;  4M78 D;  1N8R C;  4M77 A;  1AWJ A;  2EKH A;  3KUF A;  3PIO A;  3CC4 A;  3J80 E;  5FLX E;  3X28 B;  2E6N A;  3MEU A;  1FX7 A;  1WHG A;  1U5S A;  3CCS Q;  4FU6 A;  1WYX A;  3QXE B;  4JZ4 A;  3CCS T;  4BI3 A;  1JJ2 A;  2VXF A;  3UAT A;  1GBR A;  1OPK A;  3THK A;  2A37 A;  4MZM A;  5C6S A;  3CXC P;  3G6E Q;  2JTF A;  4KUL A;  2LTO A;  3G6E T;  2RJC A;  2JMA A;  1I81 A;  1QVF P;  4KH1 B;  1VQP Q;  4RMO A;  3OSS C;  2BKD N;  1EIF A;  3TRE A;  1VQP T;  1MMA A;  3VYG A;  2PZ1 A;  1AHJ B;  4DA4 A;  2OTL Q;  5CK9 A;  2CP6 A;  3G7Z A;  2HAX A;  1WX6 A;  2PVG B;  5CR2 A;  1VQN A;  1XNI A;  4Z88 A;  2OTL T;  4J6W A;  8AT1 B;  1QKW A;  2RQV A;  3VRY A;  2O31 A;  1X6B A;  4BUG A;  4FW1 A;  4Z8A A;  2KXC A;  2X35 A;  2HQE A;  2X51 A;  3I56 A;  3TSZ A;  4M78 F;  1QP2 A;  5I2S A;  1VQ6 Q;  5CQY A;  3CCJ T;  4ATO A;  2DPP B;  2FL7 A;  1WFW A;  1VQ6 T;  1VYU A;  5D7U A;  1M2O A;  4M7A C;  4MDX A;  3RER A;  2X4Y A;  4MZT A;  2P84 A;  1T3S A;  4M77 D;  5LJ5 g;  2ENM A;  2V26 A;  1UB4 A;  2RO0 A;  4FW2 A;  4BDY A;  1MV3 A;  5GAO m;  4VUB A;  1YJN Q;  2CH4 W;  1NEB A;  1AWX A;  3RR6 A;  1BI3 A;  2Z0W A;  1YJN T;  2A08 A;  4QQG A;  4O6J A;  4BD3 A;  2NLU A;  4LE9 A;  2GQV A;  3A8M B;  1NE8 A;  1K4U S;  3EG1 A;  3S3M A;  2RJD A;  1PSF A;  3MO8 A;  2L3R A;  1UE9 A;  4YTL A;  1GBQ A;  3PGG A;  4JJC A;  1YJW A;  4DOV A;  2KYB A;  2L3S A;  2ZAE A;  3CC7 Q;  2XI9 A;  2M0Y A;  3CC7 T;  2LMJ A;  2DF6 A;  3OBW A;  1Y0M A;  2RJF A;  3EH1 A;  5GAN f;  1TUC A;  1ZX6 A;  3L2Q A;  1OPL A;  2DAQ A;  1UHF A;  2IVW A;  4J7I A;  4GLM A;  3OYL A;  4N4H A;  4ORZ A;  2LQK A;  2F2W A;  3E2U A;  3DLL A;  3SB2 A;  2DEQ A;  2JW4 A;  1VYT A;  4J6Y A;  3NTK A;  1U3O A;  4HCZ A;  5A0G A;  3CEY A;  4M77 F;  3OYD A;  3CBO A;  3JCM W;  3H0H A;  3R6O A;  5GJV B;  2DER A;  5GAO q;  1TG0 A;  4C92 C;  3WVD B;  1BI0 A;  2WSF E;  1VQM Q;  4AG1 C;  1KIK A;  1ABO A;  1M1K C;  1RI0 A;  1VQM T;  3M0T A;  1TXQ A;  3H41 A;  1PHT A;  5CIU A;  2DE0 X;  4JLI A;  2NUT B;  4OML A;  6AT1 B;  1QVG S;  1OQK A;  3V7R A;  2K3Y A;  5I11 A;  2GF7 A;  4DOW A;  7AT1 B;  4F7U B;  3L42 A;  2EQJ A;  4NL3 A;  2NUP B;  2XIC A;  4L6V 5;  4PFZ A;  2F5T X;  3CCU Q;  3PE0 A;  3RDV A;  3AT1 B;  4E7I A;  4EIK A;  5GAN e;  2EYQ A;  3MCA B;  5M9O A;  4DBR A;  5GAN d;  5KYW A;  3VRZ A;  4LD9 K;  3OW2 S;  3EHQ A;  5J26 A;  4EMG A;  3G4S A;  1AZE A;  2DL3 A;  4HT9 A;  2VGM A;  2LJ1 A;  4ANJ A;  1JEG A;  4BY6 C;  2CP0 A;  1BU1 A;  1VOM A;  5KYX B;  1ARK A;  8ATC B;  4C8Q A;  2QQB A;  1KQ1 A;  4RTV A;  3L2R A;  2DNU A;  5GAO p;  2K3X A;  4PJJ A;  4Y28 E;  1ZLM A;  2CP7 A;  3A8H B;  2X3X D;  2MIO A;  2CP5 A;  3FC3 A;  1UGQ B;  1NYF A;  2YSQ A;  2EGA A;  4RTY A;  1EX4 A;  2QYZ A;  2HD0 A;  2QAS A;  1WHJ A;  2DL5 A;  2QXF A;  3CD6 Q;  3L2U A;  4MZP A;  2B8A A;  3CD6 T;  1C0M A;  1QVP A;  2M0O A;  1WHH A;  4IKF A;  4XTV A;  2D1X A;  4M75 A;  4KUI A;  3PMI A;  2KEA A;  1D0X A;  4EDU A;  3VS6 A;  2LC4 A;  2EJF A;  2RK2 A;  4C5H A;  4HVV A;  2DJZ A;  3EG9 B;  1Q82 C;  4J9D A;  2GFA A;  5KYN A;  4M7A G;  4J9H A;  4A4K A;  3DB3 A;  4J9C A;  4J8O A;  1YWO A;  3P8D A;  4IIM A;  3UA7 A;  2D6F A;  2CS7 A;  1GCQ C;  3SEM A;  3HPW A;  3EG2 A;  3SWN C;  2RQW A;  4LDV A;  4IUP A;  2LCL A;  1YHQ A;  4FSX A;  1AWW A;  1FMV A;  4C8Q E;  3GIB A;  1M90 C;  4HVW A;  1KD1 C;  1YBY A;  2YT6 A;  2GTO A;  4C0Z A;  4M7D B;  2RHU A;  2E12 A;  5GAN 5;  1Q81 R;  5HK0 A;  4ZTJ A;  3CXC S;  4HT8 A;  2IPO B;  2J6K A;  3EGU A;  3OYJ A;  2MAM A;  1QVF S;  1X2Q A;  1M1G A;  2D0N A;  1YIT Q;  2JS0 A;  1Y71 A;  2E5Q A;  3KFV A;  2HL3 A;  5KYU A;  2XHC A;  2JXB A;  1S72 A;  1YIT T;  4M7D G;  2NYS A;  2DBM A;  2J7I A;  2AIR B;  2FZC B;  3VS0 A;  2V1Q A;  4KRT A;  3A8L B;  3PTA A;  4CI0 C;  1LPL A;  2DL8 A;  1ZUU A;  2O88 A;  1U8R A;  2CUD A;  4A63 B;  3CCS A;  2RQR A;  1MMN A;  3A98 A;  4M7A A;  2RH2 A;  3VS7 A;  2AHJ B;  5CKE A;  1VUB A;  4EPC A;  1NM7 A;  4FSS A;  3M57 A;  2WAC A;  3QKJ A;  5FU6 B;  5KE3 A;  2ED1 A;  5GAN h;  2K4Y A;  2LT4 A;  3G6E A;  2FEI A;  4EMH A;  4RG2 A;  3JB9 I;  3BW1 A;  4LD6 A;  1VQP A;  1BIA A;  3HKS A;  3QPH A;  4RTU A;  4OB3 B;  2D8H A;  1H64 1;  1MGQ A;  1H3H A;  2OTL A;  2QQR A;  3E9F A;  1MMG A;  2W10 A;  4PJO C;  1X6O A;  3G71 Q;  2YDL A;  3HTR A;  5IHN A;  2EYY A;  2A0F B;  1JQQ A;  1AZG B;  3CCQ Q;  3G71 T;  1OX9 A;  1W6X A;  1G5V A;  1QVG P;  5IXF A;  4IUU A;  4FYW B;  2FZG B;  2CSQ A;  2QI2 A;  1RLP C;  3MEV A;  3JCM b;  1K73 R;  3CCQ T;  3JCM J;  4M77 B;  1QCN A;  2JTM A;  1SRL A;  2Y4Y A;  1UGV A;  4DBF A;  3PIP A;  2L5Q A;  3CCL Q;  2YLB A;  5A0D A;  3SD4 A;  3CCJ A;  2VYT A;  3MEW A;  3CCL T;  1VQ6 A;  2BE9 B;  2DJQ A;  1P92 A;  1RAH B;  1JJ2 S;  4LN2 A;  5J3B A;  5L23 A;  1VIF A;  1X6G A;  2CT4 A;  1WJS A;  2A28 A;  2OX7 A;  1FMK A;  2LT1 A;  3BFM A;  1B3Q A;  3EFS A;  3NMZ C;  5GAM j;  1N6A A;  1AOJ A;  1Q81 U;  1RAA B;  4FM4 B;  2DTO A;  1YJN A;  1HYO A;  5FU7 B;  1I8F A;  3MEA A;  4HA8 A;  2COY A;  3M9Q A;  4C92 A;  3C95 A;  3JRZ A;  4M7A D;  4Q5W A;  1HXD A;  1PG5 B;  3CCR Q;  1WXB A;  2GFU A;  3CPW A;  2GGR A;  3CCR T;  2ZZD A;  3ZBD A;  1VIE A;  4LDY A;  1VQ9 Q;  2H8H A;  3CC7 A;  3WVE B;  4F17 A;  4ZTF A;  1BYM A;  5EC7 A;  2J6O A;  1VQ9 T;  3VS3 A;  2DX1 A;  4OMM A;  5GAO r;  1Y7X A;  3PMT A;  1M3A A;  1PD0 A;  4HCB A;  1NJI R;  2ROT A;  4LUD A;  2E3H A;  2R5A A;  4NOY A;  1SF9 A;  4OGC A;  2CKK A;  2QK0 A;  5GMK i;  3T9N A;  2F2V A;  1LJO A;  1XOV A;  2FVU A;  2HZY A;  3FEO A;  5GAN 3;  2EKO A;  2J6F A;  1PNJ A;  3QWY A;  2OAU A;  1NPP A;  5IHI A;  4QVC A;  4D8K A;  2D8J A;  1WIE A;  2QGG A;  2KRN A;  1S1N A;  3L2Z A;  5LJ3 j;  1PM3 A;  4A4G A;  2E4H A;  4M7D D;  4RTW A;  4R55 A;  2EQK A;  3VS4 A;  1VQM A;  4QT7 A;  2DVE A;  1D1C A;  3QZ9 B;  1NBE B;  1NEG A;  4M78 E;  1WJQ A;  2KYM A;  2L89 A;  2QQS A;  2X4X A;  3C94 A;  4M7A F;  4C92 E;  3LX7 A;  1UGP B;  5LJ5 j;  4E7S A;  5A0L A;  1JRI A;  2KT8 A;  1RAD B;  4BI8 B;  3QJ6 A;  3QDF A;  1OUL A;  4Z89 A;  3OYN A;  3NGP A;  3HRS A;  1XQH A;  4KGX B;  3INZ A;  1SHF A;  3FRN A;  4Y92 A;  2KBT A;  1I5L A;  4JRQ A;  3CC2 A;  1W4S A;  1PWT A;  2WSE E;  1QMC A;  3OYI A;  2RPN A;  4FYY B;  1WQW A;  2DIG A;  3CPW P;  5GJW B;  3PVL A;  2COZ A;  1X2K A;  2YUQ A;  1SEM A;  2O2O A;  2M16 A;  1GCQ A;  1IGQ A;  2XDD A;  2DO3 A;  3M4G A;  2FB7 A;  4IIO A;  3SWN A;  3LGF A;  1WXU A;  3LWH A;  3LGL A;  4A4H A;  2DTH A;  4M7D F;  2KMT A;  4K11 A;  1FXX A;  1EFN A;  3OSV A;  4BDZ A;  3VU3 C;  4AG2 C;  1ZBJ A;  3CMA Q;  3EFO A;  1K76 A;  3CMA T;  1OV3 A;  2EBP A;  1OEB A;  1NJI U;  3HHT B;  3DLM A;  4BE0 A;  5KCH A;  3P8H A;  2LCC A;  1I1J A;  3OB9 A;  2XID A;  3OMG A;  3CCM A;  5AYF A;  1WHL A;  4QVD A;  1PCX A;  2XDB A;  2BZX A;  1X27 A;  1YJ9 Q;  1G3W A;  4Y91 A;  1HSQ A;  1I0C A;  5FWB A;  4GY5 A;  3JCM V;  2YWW A;  3OYB A;  1T0J A;  4N0A C;  1YJ9 T;  2OAW A;  4ZGD B;  3JCM P;  2LX9 A;  4E7H A;  1ZUY A;  3ZFJ A;  5KYW B;  2CP3 A;  2MWO A;  1TUD A;  2DM1 A;  5GAN g;  2C06 A;  2CUB A;  1M27 C;  3L2W A;  1RAI B;  4A54 A;  4JUV A;  1UGR B;  4J9B A;  1ZA1 B;  1TS9 A;  4RG8 A;  3V7S A;  4C8Q B;  5LJ3 f;  2ZPB B;  1G3Y A;  2ABL A;  2E5K A;  1KHI A;  3JV3 A;  3G1J A;  1M4Z A;  1JJ2 P;  2PQW A;  3OYA A;  3M0U A;  1KC8 R;  2DBK A;  1W70 A;  2RI3 A;  1B34 A;  1G2B A;  4OMF B;  3GLX A;  2KNB B;  5CVI A;  3EHR A;  2MF2 A;  1NLO C;  2XMF A;  4DEX A;  4XTY A;  4C8Q G;  1GFC A;  1V1C A;  3RIR A;  2HCK A;  3H9N A;  2JN0 A;  4EMK C;  2CSI A;  1GXI E;  2A7Y A;  3HL8 A;  1IO6 A;  4M4Z A;  2KSS A;  2XD0 A;  4JLG A;  1TWB A;  5CKD A;  1MND A;  2K57 A;  2O9S A;  2EYW A;  4M75 B;  4Z02 A;  3CME A;  3E9G A;  2OTJ Q;  1N9R A;  2J05 A;  2XKO C;  5GMK j;  1WDX A;  4PJO A;  4XTZ A;  3REA B;  1AEY A;  1D09 B;  5CO7 A;  2OTJ T;  4M78 C;  4JS5 A;  1OI1 A;  2QDY B;  5EG2 A;  2VV5 A;  4LDW A;  3X20 B;  1AD5 A;  2IIM A;  3M59 A;  1H8K A;  2DK3 A;  3ZEH A;  2E64 A;  3LW5 E;  2RD1 A;  3QHS A;  1LNX A;  2R5M A;  2HEQ A;  1VQ7 Q;  2L3Q A;  1TUG B;  4M75 G;  2LQW A;  2RF0 A;  2FPF A;  1VQ8 A;  4V2S A;  3NHN A;  1KG1 A;  3QG1 A;  4LDU A;  2K2M A;  5LJ3 e;  3FB9 A;  2QAZ A;  1WHM A;  4CC4 B;  2VC8 A;  1M1K R;  1RUW A;  4HCK A;  1M3C A;  2MWP A;  1LVK A;  3CBP A;  1YIJ Q;  2FYK A;  3CCU T;  3CC4 Q;  3J7A F;  1BB9 A;  1OOT A;  3H0F A;  3ASK A;  1YIJ T;  2E3I A;  1QWE A;  3CC4 T;  2QQ9 A;  1OU9 A;  3EGX B;  4BE2 A;  5GMK l;  2FRW A;  2QG9 B;  2DTI A;  1PRL C;  3E1S A;  2R57 A;  4O5V A;  2L8D A;  1Z9Z A;  2ZPF B;  4C0D C;  3O8V A;  2YLC A;  3G71 A;  4BB7 A;  3QWX X;  5KYU B;  1KFZ A;  2RQU A;  3CCQ A;  1ZBX A;  1JXM A;  2G6F X;  2HKN A;  4ELZ C;  3QJY A;  1R0B G;  2E65 A;  4PJO E;  3C4S A;  1QCO A;  2IG0 A;  3PFS A;  2KAF A;  3CCL A;  1PD1 A;  1PC0 A;  2NWM A;  3OYY A;  1B7T A;  2AZV A;  1UUE A;  1YCY A;  2K79 A;  3MJX A;  1Q86 R;  2COW A;  3EFR A;  4J5Y A;  1VQL Q;  2JNG A;  2RA2 A;  3DKM A;  1KC8 U;  4M7A B;  1JO8 A;  3I56 Q;  1VQL T;  3H6Z A;  1R0C B;  3I56 T;  2PU9 B;  2XDP A;  2KRS A;  3FLG A;  1KSW A;  2EVR A;  1RI9 A;  3V8K A;  2EYX A;  2ROL A;  2JJ9 A;  2A36 A;  3M55 A;  3R6N A;  2DLP A;  2DEU A;  4KGZ B;  2VVK A;  4PKC C;  3X24 B;  1UDL A;  2PNI A;  2E1H A;  1D3B A;  2E6Z A;  4PL6 A;  3M0P A;  1VQ9 A;  1Q82 R;  2DYI A;  1ZSZ C;  1M8M A;  2BZ8 A;  1I4K 1;  3KXT A;  5FRM A;  3OY9 A;  1ZQ1 A;  3EG3 A;  1HD3 A;  4NL2 A;  3VYH B;  4QQ6 A;  2F1L A;  3MP8 A;  4HKE A;  2G3R A;  2EFI A;  4IUT A;  4C8Q D;  3AHU A;  2DRM A;  3TQ7 P;  1YWP A;  3HFN A;  3JAM E;  1Q81 C;  2BZY A;  3REB B;  4ELY C;  4KT0 E;  2KR3 A;  4NS5 A;  2ZPE B;  5IAY A;  3HSB A;  3CCV Q;  2DL4 A;  1SSF A;  5GAO n;  1K0S A;  2AT1 B;  2X4W A;  1OZ2 A;  3CCV T;  2QDL A;  3UPU A;  5CKF A;  2FO0 A;  3BY7 A;  1D0Z A;  1QLY A;  4RUG A;  3A1P A;  2DXB A;  4C92 B;  1F1B B;  1IGU A;  1R77 A;  4LUE A;  1UHC A;  3CPW S;  1RAF B;  1V76 A;  5ECA A;  1X69 A;  5I2M A;  1QKX A;  2M9U A;  4M75 D;  4UC4 A;  2KE9 A;  1MNE A;  5LJ3 h;  1UEB A;  3V7C A;  3S6W A;  2HBP A;  4IUV A;  1K8A R;  2EQI A;  1G8X A;  2E10 A;  2C0I A;  3UWN A;  3I55 Q;  3SDZ A;  4C92 G;  1YP5 A;  3VUB A;  2RI5 A;  2J06 A;  3HP9 A;  1Q86 U;  3I55 T;  5KCO A;  3RMS A;  2P0Q A;  3EH2 A;  5IHK A;  1RLQ C;  3OYC A;  4N0A A;  4II1 A;  2BIV A;  1UTI A;  2C0O A;  1Q7Y R;  5GAN 6;  4C8Q F;  1VQK Q;  4F7U E;  4PJL A;  2JVV A;  1H3Z A;  1VQK T;  3I5S A;  4BY6 B;  4L5G A;  4AFQ C;  1YFN A;  1JB0 E;  3M0Q A;  3EGD B;  2ZPH B;  1X43 A;  1KQS A;  4J9I A;  3S3N A;  2DD5 A;  1A0N B;  2EJ9 A;  1BI1 A;  1TSF A;  1M2V A;  4J7F A;  3VS5 A;  3G4S Q;  4F14 A;  4X9C A;  5L8R E;  4ESR A;  2QTV A;  1BKB A;  2E41 A;  2WSC E;  2CZ7 B;  1PSE A;  3LH0 A;  2K5F A;  2K6D A;  2DXC A;  3CCE Q;  1VQO Q;  3FJP A;  4DBH A;  5D6X A;  3M53 A;  4M75 F;  3C0C A;  2CYZ B;  3CCE T;  1VQO T;  1KK7 A;  4EMK A;  2LJ0 A;  4QW2 A;  2DFU A;  1BK2 A;  2FHD A;  3IQL A;  4ZGJ B;  3JCM f;  1AWO A;  4B6M A;  2CRE A;  1E7O A;  1YJ9 A;  3SHW A;  1UEC A;  1K9M R;  1ZSG A;  1U06 A;  4ZNX A;  3RMQ A;  2LRQ A;  3J81 E;  2PUK B;  3GPL A;  3H8Z A;  4M78 A;  5GMK m;  3HRT A;  2Y4X A;  4J9F A;  5FRN A;  4WF2 A;  1JBM A;  2C0T A;  2CZ6 B;  1T0H A;  3MPU B;  2EGE A;  3VJP A;  4FT4 A;  3GNG A;  2QQA A;  1SPK A;  3SWN B;  4BE1 A;  1DJ7 B;  4PNO A;  2LNV A;  1MUZ A;  3A8O B;  3GF5 A;  2LCS A;  1NJI C;  1K8A U;  4DQ2 A;  3VUZ A;  2K3B A;  2KT1 A;  4GBQ A;  4JJN K;  1SRM A;  1VQ4 Q;  1VQ4 T;  5FW9 A;  3LH5 A;  1FMW A;  3MHX A;  4E7K A;  2DA9 A;  1I5O B;  3JCM e;  1K1Z A;  2MI6 A;  2YUO A;  1Q7Y U;  5IXB A;  4OB1 B;  4OF1 A;  3JCM X;  4XTU A;  4GLK A;  1SKU B;  1KQS P;  4QQD A;  3LWI A;  2D9T A;  1UFF A;  4C0F A;  2GQI A;  4M7D E;  2V8K A;  3DB4 A;  3MKD A;  1M5Q 1;  4XTW A;  1K73 U;  2SRC A;  3M56 A;  1N8R R;  3RBB B;  3H0I A;  2I0N A;  3VV0 A;  3CCU A;  4C92 D;  3JB9 J;  4ME7 A;  4IUR A;  1YIJ A;  1Y96 A;  5A2Q E;  2L2P A;  4F16 A;  5GAN j;  2JTE A;  1B34 B;  5DLO A;  5GAN 4;  5CQX A;  2AZS A;  4AFZ C;  3M5A A;  2PUO B;  3FIF A;  2I2L A;  1SG5 A;  4JJB A;  1MV0 B;  3JB9 G;  1WPY A;  1K9M U;  3OYG A;  2LQN A;  1UG1 A;  4E7L A;  2KRO A;  5HK3 A;  5GAM f;  2GNC A;  4PK4 A;  4PJO B;  4J9E A;  3OBY A;  1WNL A;  1JXO A;  4WTO B;  2ECZ A;  1ZSZ A;  2RI2 A;  3EG0 A;  4X9D A;  2E70 A;  1M8V A;  3E19 A;  3LYI A;  2EIF A;  4PJM A;  2AK5 A;  2P4T A;  3M54 A;  3EAE A;  2Y90 A;  1BI2 A;  3HFO A;  5CCA A;  2HQH A;  4X1V A;  2EQU A;  2H3J A;  2YRV A;  3QYG B;  2KVQ G;  4WCI A;  3UDC A;  3CD6 A;  1LOJ A;  1QW1 A;  1HK9 A;  1R8O B;  3OS5 A;  4C5I A;  4PJO G;  3M0R A;  1O75 A;  4X34 A;  1VQL A;  1W2B A;  4FCY A;  5LJ3 g;  5J39 A;  2P0P A;  2O4X A;  2VUB A;  2V8J A;  2O9V A;  4E7J A;  3CCJ Q;  3TVT A;  2CDT A;  2EWN A;  4M77 E;  4C92 F;  5KYY A;  1RL2 A;  1YCS B;  2VAS A;  2KDS A;  5HY6 A;  4B9X A;  1Y07 A;  1KQ2 A;  2EGC A;  1BCO A;  1BIB A;  1C1A A;  5GAM e;  1FYN A;  2L0A A;  3PT9 A;  2ZPI B;  3U23 A;  4XTX A;  3RNJ A;  1IXD A;  2LX7 A;  2DXT A;  2P4R A;  5GAM d;  3UF4 A;  4BAC A;  3OMC A;  1QQJ A;  3QII A;  1IRX A;  1VQ5 Q;  3O5Z A;  4XU0 A;  3M0S A;  1N27 A;  2HSE B;  1VQ5 T;  2K2V A;  3A8G B;  1YI2 Q;  1H92 A;  9ATC B;  2O01 E;  5D6Y A;  4FIB A;  2HBW A;  2ZCF B;  4LDX A;  3OYM A;  1YI2 T;  1N8R U;  4J9G A;  1KC8 C;  2OI3 A;  2M51 A;  3I5R A;  1Q95 G;  2QEX Q;  2K5I A;  5LJ5 f;  3VS2 A;  2LDM A;  5IH2 A;  2QEX T;  2K9G A;  3MP1 A;  3OS1 A;  2FPE A;  1ZHI A;  3M58 A;  4JDS A;  5FRO A;  1ABQ A;  5KH6 A;  4P5N A;  1M9S A;  1ACM B;  2LJ3 A;  3BE3 A;  5D6W A;  2XK0 A;  4C0G A;  1U1T A;  3JCM h;  2XU8 A;  2EW3 A;  2ED0 A;  3OYK A;  3CCV A;  4M7D C;  2MYS A;  1IRE B;  5KE2 A;  1YIT A;  3ME9 A;  3ULR B;  1N5Z A;  1G3S A;  1BBZ A;  3QYH B;  1PKT A;  5DM7 R;  4QKU A;  2JM8 A;  2RM4 A;  3RKY A;  1ZA2 B;  4OGE A;  1NZ9 A;  4E47 A;  2RK1 A;  2QA4 Q;  1D3B B;  2RHZ A;  1TTH B;  3JCM Q;  5LL6 S;  1VQ7 T;  2QA4 T;  5CKB A;  1D1B A;  3RKW A;  1E6G A;  1WA7 A;  2BUD A;  4AMC A;  4PFO A;  2P0K A;  2X3W D;  5LJ3 d;  1W2B P;  2ZPG B;  3BDU A;  1W1F A;  3F70 A;  3I55 A;  5C0M A;  1ZUK A;  4XU3 A;  2LP5 A;  3A5Z B;  3CPF A;  4JRI A;  3UT1 A;  4OMP A;  4E6R A;  2AKL A;  4OMN A;  2MPX C;  2DZC A;  3NTI A;  4TVR A;  4B9W A;  5LJ5 e;  3KBG A;  3JB9 D;  2YUP A;  4JRP A;  3Q1J A;  1GRI A;  4JS4 A;  2M02 A;  3QDR B;  5LJ5 d;  3S3O A;  1X75 C;  4ZGE B;  1VQK A;  2EPD A;  2FZK B;  5FU6 C;  2RN8 A;  4N4G A;  2ZGW A;  2D0Q B;  4C5G A;  2KY9 A;  1Y57 A;  2KXD A;  5I21 A;  3QUI A;  2RHI A;  2GTJ A;  2LZ6 B;  4JPB W;  2JT4 A;  1MMD A;  4F7U G;  1JU5 C;  3M4Y A;  3CC2 Q;  3OS0 A;  4HXJ A;  2DYB A;  3CC2 T;  4OMO A;  1VQN Q;  2F5K A;  1LCK A;  2YRC A;  1Z9Q A;  1VQN T;  1C6V X;  1B07 A;  1AVZ C;  3CCE A;  1PRM C;  1VQO A;  4PJO D;  2HMA A;  4M77 C;  5DLQ E;  1Q86 C;  2JOY A;  2DL7 A;  2RJE A;  4JRK A;  2HKQ B;  1NPR A;  3TU4 K;  1RAB B;  3QO3 A;  4FYX B;  1VYV A;  1RAG B;  5CAI A;  1D0Y A;  2DMO A;  2H3E B;  2XG8 D;  2BTT A;  2CZ0 B;  1IZ6 A;  4XAX B;  1CSK A;  2CP2 A;  1E6H A;  4L59 A;  3CCM Q;  5FWC A;  2KGT A;  4CRI A;  1GCP A;  1BCM A;  2DZ9 A;  4J83 A;  3JB9 F;  3CCM T;  3CCR A;  2VB6 A;  4A4E A;  2AKK A;  5AT1 B;  2HSP A;  4PLL A;  1KQS S;  5FU7 C;  5GAM h;  2ATC B;  4AFU C;  2KI7 A;  1HJD A;  3LLR A;  2LNH B;  1OU8 A;  2LVM A;  5HKC A;  1YNZ A;  1GL5 A;  2KK4 A;  3I9Q A;  2JS2 A;  1U1S A;  2DIQ A;  1M2V B;  3OYE A;  1QWF A;  4XQ3 A;  1OYX A;  2RB6 A;  2PVD B;  1V29 B;  1YJW Q;  1WLP B;  3D7S B;  2NUT A;  4LNP A;  2DVJ A;  4D8D A;  1M1K U;  1PKS A;  2F69 A;  4KH0 B;  1YJW T;  2PTK A;  2QTX A;  3OYH A;  4F7U A;  1VQ4 A;  1SSH A;  1QVG A;  2NUP A;  4FYV B;  2DRK A;  4RTZ A;  4EMK B;  5IT9 E;  1M90 R;  5DY9 A;  4F04 B;  4PJO F;  1SHG A;  4AFS C;  5I22 A;  1KD1 R;  5GAN 7;  2VGN A;  1I07 A;  3QSU A;  4DEY A;  1X01 A;  3MET A;  1NG2 A;  2X9H A;  2A3L A;  2NUZ A;  2DD4 A;  3FDR A;  4XK8 E;  3JCM c;  4M78 B;  5HCK A;  1WJR A;  3I35 A;  3EGX A;  2M1H A;  2MK5 A;  2ESW A;  2MOX A;  2RHX A;  2RQT A;  3TSW A;  3VKI A;  4ZN1 A;  3OW2 A;  3CME Q;  1QCF A;  4RKU E;  5KYX A;  1KHC A;  3CME T;  2JUF A;  2HNI A;  2W0Z A;  2EYZ A;  4A53 A;  4M75 E;  4PJN A;  4D6W A;  2KQW A;  5GMK e;  2QGF B;  1QP3 A;  2DIL A;  1NLP C;  2FRY A;  3P8B B;  2VWF A;  1G3T A;  1K8A C;  4C5E A;  4M78 G;  1D1A A;  1YN8 A;  1N9S A;  4JZ3 A;  3SFM A;  4PFP A;  4RTT A;  1WQ7 A;  1VQ8 Q;  1NYG A;  2KRM A;  1CKB A;  4IUQ A;  3PVQ A;  1M1F A;  5IN1 A;  1EZZ B;  4R0K A;  1VQ8 T;  1OX8 A;  1OZ3 A;  1K9A A;  2DET A;  1XJW B;  5LJ5 h;  4DBQ A;  2B86 A; 
#chains in the Genus database with same CATH homology
 4GLK A;  4FT2 A;  2HD0 A;  4OVA A;  2QXF A;  4C8Q B;  5LJ3 f;  2ZPB B;  4QQD A;  1Q7Y C;  1G3Y A;  3LWI A;  2D9T A;  4XU2 A;  1KHI A;  4C0F A;  5GAN 8;  3L2U A;  3N5B B;  4M7D E;  4MZP A;  2B8A A;  3MP6 A;  2V8K A;  3CD6 T;  3DB4 A;  1M4Z A;  1M5Q 1;  2DKG A;  2HQX A;  4XTW A;  2PQW A;  3X25 B;  4C0D B;  3JCM g;  5GAO l;  1QVP A;  2M0O A;  3BDL A;  3OYA A;  3PNW C;  1K73 U;  1O9S A;  4IKF A;  3M56 A;  4XTV A;  2CGH A;  2RI3 A;  1B34 A;  1UGS B;  4M75 A;  1K73 C;  4KUI A;  3PMI A;  4OMF B;  1WGS A;  3GLX A;  5CVI A;  2MF2 A;  4EDU A;  2LC4 A;  4XTY A;  4C8Q G;  3GP8 A;  1Q82 U;  2EJF A;  3RIR A;  3VV0 A;  2RK2 A;  4C92 D;  3G4S T;  4ME7 A;  3CCU A;  3JB9 J;  4C5H A;  2JN0 A;  2JZ2 A;  4EMK C;  1GXI E;  2A7Y A;  4MML A;  3HL8 A;  4IUR A;  3RES A;  3CMA A;  3JCM X;  2DJZ A;  2KSS A;  3GOX A;  1Y96 A;  1YIJ A;  2XD0 A;  1Q82 C;  5A2Q E;  3RUX A;  4JLG A;  5GAN j;  2X4J A;  5CKD A;  2GFA A;  1B34 B;  2K57 A;  3CBM A;  1TH7 A;  4M75 B;  1XTD A;  4Z02 A;  4M7A G;  5DLO A;  5GAN 4;  5CQX A;  3CME A;  4A4K A;  3E9G A;  3M5A A;  3DB3 A;  2PUO B;  4J8O A;  3FIF A;  2I2L A;  1N9R A;  2XKO C;  5GMK j;  4PJO A;  3NFC A;  3P8D A;  4XTZ A;  3V8L A;  3TEE A;  3JB9 G;  5CO7 A;  2OTJ T;  1WPY A;  4M78 C;  4JS5 A;  1OI1 A;  3WXM B;  4OB2 B;  2D6F A;  2CS7 A;  1Y96 B;  2QDY B;  5EG2 A;  2VV5 A;  1K9M U;  3OQ5 A;  4LDW A;  3TCJ A;  3HPW A;  4BI4 A;  3OS2 A;  3X20 B;  3OYG A;  3L2V A;  3ER0 A;  3M59 A;  3X26 B;  4E7L A;  2DK3 A;  5HK3 A;  1M90 U;  3SWN C;  5GAM f;  4RCC A;  4M7D A;  3ZEH A;  4LDV A;  2E64 A;  2LCL A;  2RD1 A;  3LW5 E;  3QHS A;  4FSX A;  1LNX A;  2R5M A;  4IUP A;  1YHQ A;  1KD1 U;  1K9M C;  4C8Q E;  4PJO B;  3GIB A;  4KUD K;  4M75 G;  1M90 C;  3OBY A;  2LQ8 A;  1WNL A;  4OB0 B;  1VQ8 A;  4V2S A;  2RI2 A;  3JSC A;  1KG1 A;  3QG1 A;  1KD1 C;  4M77 G;  4LDU A;  5LJ3 e;  4X9D A;  2E70 A;  4A4F A;  1M8V A;  1YBY A;  3FB9 A;  3E19 A;  3LYI A;  4C0Z A;  4M7A E;  3QZ5 B;  3CXC A;  2EIF A;  4M7D B;  1MHN A;  3M54 A;  2P4T A;  2EJG A;  2VC8 A;  3EAE A;  2PVO B;  3OA6 A;  2Y90 A;  1BI2 A;  2RHU A;  2V8I A;  2E12 A;  3V8J A;  2MMP A;  3HFO A;  5CCA A;  5GAN 5;  2MWP A;  4MDW A;  3CBP A;  3URG A;  2EQU A;  2FYK A;  2H3J A;  2YRV A;  3QYG B;  1QVF A;  3CCU T;  2KVQ G;  3UDC A;  5HK0 A;  3CD6 A;  3J7A F;  4ZTJ A;  1LOJ A;  3CXC S;  1QW1 A;  3ASK A;  1HK9 A;  1R8O B;  2RHY A;  3OS5 A;  1YIJ T;  1VQ5 A;  4HT8 A;  4C5I A;  4OP0 A;  3CC4 T;  4PJO G;  4FL6 A;  5GAN 2;  3OYJ A;  2MAM A;  1O75 A;  1QVF S;  4F7U F;  4X34 A;  2QQ9 A;  1VQL A;  1W2B A;  1YI2 A;  1M1G A;  5LJ3 g;  2DXU A;  5J39 A;  2P0P A;  2O4X A;  2VUB A;  1Y71 A;  2E5Q A;  2V8J A;  4C8Q C;  2XHC A;  4BE2 A;  4E7J A;  1S72 A;  4KBM B;  5GMK l;  1YIT T;  4M7D G;  2GCX A;  2EQM A;  2QEX A;  1FWZ A;  2DTI A;  1W2B S;  3E1S A;  2EWN A;  4M77 E;  2R57 A;  4C92 F;  4O5V A;  4RCB A;  2L8D A;  2ZPF B;  3HRU A;  2EAY A;  4C0D C;  1RL2 A;  3A8L B;  3O8V A;  2YLC A;  4QVZ A;  3PTA A;  3G71 A;  4HCC A;  4CI0 C;  1YHQ T;  4R56 A;  4BB7 A;  2O4X B;  2KDS A;  5HY6 A;  4B9X A;  1Y07 A;  5CKH A;  1KQ2 A;  3CCQ A;  1ZBX A;  1U8R A;  4ELZ C;  3CCS A;  3QJY A;  2E65 A;  2OTJ A;  3JCM d;  4PJO E;  1BIB A;  4M7A A;  3C4S A;  2RH2 A;  2IG0 A;  2AHJ B;  3PFS A;  2KAF A;  5GAM e;  3PT9 A;  2ZPI B;  3NTH A;  2R58 A;  3QBY A;  4XTX A;  5CKE A;  3CCL A;  1VUB A;  4EPC A;  2DXT A;  3M57 A;  5GAM d;  4BAC A;  2WAC A;  3OMC A;  3QII A;  3OYY A;  3L1A A;  3QKJ A;  4J6X A;  5FU6 B;  4M75 C;  5KE3 A;  4XU0 A;  1YCY A;  1N27 A;  4PLI A;  5GAN h;  2K4Y A;  3OYF A;  4MMK A;  3EFR A;  2K5L A;  2LT4 A;  4J5Y A;  3G6E A;  2CZ1 B;  2K2V A;  2JNG A;  3A8G B;  1VQ5 T;  2RA2 A;  3DKM A;  1KC8 U;  4M7A B;  4EMH A;  3GNF B;  4N4I A;  4XU1 A;  4ZN3 A;  2O01 E;  2QA4 A;  4RG2 A;  5D6Y A;  1VQ7 A;  4FIB A;  3JB9 H;  3JB9 I;  3BW1 A;  4LD6 A;  3RKX A;  1VQL T;  2ZCF B;  3H6Z A;  3OYM A;  1YI2 T;  1N8R U;  4LDX A;  1VQP A;  5GMK h;  3C12 A;  1KC8 C;  1BIA A;  3I56 T;  5GAM g;  2K5I A;  2YHT A;  3HKS A;  3QPH A;  2PU9 B;  2VXE A;  1S72 T;  5LJ5 f;  4M78 D;  2XDP A;  2LDM A;  1H64 1;  1MGQ A;  4M77 A;  4OB3 B;  1N8R C;  3FLG A;  2QEX T;  2OTL A;  3KUF A;  3MP1 A;  2QQR A;  3OS1 A;  3E9F A;  3V8K A;  1ZHI A;  3M58 A;  1X6O A;  4JDS A;  5FRO A;  4PJO C;  5KH6 A;  4P5N A;  3PIO A;  1M9S A;  3M55 A;  3J80 E;  5D6W A;  3CC4 A;  5FLX E;  2XK0 A;  4C0G A;  3X28 B;  2E6N A;  3G71 T;  1U1T A;  3MEU A;  3JCM h;  2XU8 A;  1G5V A;  1FX7 A;  4PKC C;  4IUU A;  3OYK A;  3CCV A;  2QI2 A;  3MEV A;  4FU6 A;  3QXE B;  3X24 B;  3JCM b;  3CCQ T;  3JCM J;  4M77 B;  4M7D C;  2JTM A;  1IRE B;  5KE2 A;  3CCS T;  2Y4Y A;  2E1H A;  1D3B A;  4BI3 A;  3PIP A;  1YIT A;  3ME9 A;  1JJ2 A;  2L5Q A;  2E6Z A;  2VXF A;  1G3S A;  2YLB A;  5A0D A;  3SD4 A;  4PL6 A;  3CCJ A;  2VYT A;  3QYH B;  1VQ9 A;  3MEW A;  3CCL T;  4MZM A;  5DM7 R;  5C6S A;  1VQ6 A;  1P92 A;  1I4K 1;  1JJ2 S;  3KXT A;  5FRM A;  3OY9 A;  1ZQ1 A;  5J3B A;  2RM4 A;  3RKY A;  4OGE A;  1NZ9 A;  4E47 A;  2RK1 A;  2JTF A;  4KUL A;  1VIF A;  1D3B B;  2LTO A;  4NL2 A;  3G6E T;  2RHZ A;  2RJC A;  1WJS A;  3VYH B;  4QQ6 A;  1I81 A;  3JCM Q;  3MP8 A;  5LL6 S;  1VQ7 T;  2QA4 T;  5CKB A;  2LT1 A;  3BFM A;  3RKW A;  4RMO A;  3EFS A;  3OSS C;  2BUD A;  4HKE A;  2G3R A;  2BKD N;  5GAM j;  1EIF A;  1N6A A;  3TRE A;  1VQP T;  2P0K A;  1Q81 U;  4FM4 B;  3VYG A;  2EFI A;  4IUT A;  1AHJ B;  4C8Q D;  3AHU A;  5LJ3 d;  2DTO A;  4DA4 A;  1YJN A;  2ZPG B;  5CK9 A;  3BDU A;  3G7Z A;  5FU7 B;  2HAX A;  1VQN A;  2PVG B;  1I8F A;  3HFN A;  5CR2 A;  3F70 A;  3JAM E;  1XNI A;  5C0M A;  3I55 A;  2OTL T;  1Q81 C;  3MEA A;  4J6W A;  4HA8 A;  4XU3 A;  3M9Q A;  4KT0 E;  4NS5 A;  4ELY C;  3A5Z B;  4C92 A;  3CPF A;  2ZPE B;  3C95 A;  3JRZ A;  5IAY A;  4M7A D;  4Q5W A;  4JRI A;  3UT1 A;  3HSB A;  1HXD A;  1SSF A;  5GAO n;  3NTI A;  2DZC A;  4BUG A;  2X35 A;  4TVR A;  2X4W A;  1OZ2 A;  2HQE A;  4B9W A;  5LJ5 e;  3CCV T;  3KBG A;  3UPU A;  5CKF A;  2GFU A;  3I56 A;  3CPW A;  3JB9 D;  4JRP A;  3Q1J A;  2ZZD A;  3CCR T;  3ZBD A;  4JS4 A;  1VIE A;  3BY7 A;  4LDY A;  3QDR B;  5LJ5 d;  3S3O A;  4M78 F;  1X75 C;  1QP2 A;  3WVE B;  4ZGE B;  3CC7 A;  5I2S A;  1VQK A;  4ZTF A;  2DXB A;  5CQY A;  5FU6 C;  4C92 B;  1BYM A;  3CCJ T;  4ATO A;  2DPP B;  3CPW S;  4N4G A;  2ZGW A;  2D0Q B;  4C5G A;  1VQ9 T;  2FL7 A;  2KY9 A;  1VQ6 T;  5GAO r;  5I21 A;  1Y7X A;  3PMT A;  5I2M A;  4M7A C;  4MDX A;  3RER A;  2M9U A;  2X4Y A;  3QUI A;  2RHI A;  4M75 D;  4MZT A;  4UC4 A;  4HCB A;  4F7U G;  4NOY A;  2R5A A;  4M77 D;  5LJ5 g;  3M4Y A;  5LJ3 h;  1UEB A;  3V7C A;  1UB4 A;  4OGC A;  3S6W A;  2RO0 A;  3OS0 A;  4BDY A;  2CKK A;  2HBP A;  4IUV A;  5GMK i;  3T9N A;  4VUB A;  1LJO A;  1XOV A;  2FVU A;  5GAO m;  3CC2 T;  2E10 A;  3FEO A;  5GAN 3;  2EKO A;  2F5K A;  3UWN A;  1BI3 A;  3SDZ A;  4C92 G;  1YJN T;  3VUB A;  2RI5 A;  3HP9 A;  1VQN T;  4QQG A;  2OAU A;  4O6J A;  4BD3 A;  1Q86 U;  2NLU A;  1NPP A;  3I55 T;  5KCO A;  4QVC A;  2GQV A;  3CCE A;  1VQO A;  3RMS A;  3A8M B;  4PJO D;  2P0Q A;  4M77 C;  5DLQ E;  3OYC A;  1Q86 C;  1NE8 A;  4N0A A;  3S3M A;  2JOY A;  2RJD A;  4II1 A;  1PSF A;  3L2Z A;  3MO8 A;  5LJ3 j;  2BIV A;  2L3R A;  4YTL A;  2RJE A;  4JRK A;  4A4G A;  3PGG A;  1YJW A;  4DOV A;  1NPR A;  3TU4 K;  4M7D D;  3QO3 A;  2XI9 A;  5GAN 6;  4C8Q F;  4F7U E;  4R55 A;  2EQK A;  2JVV A;  5CAI A;  1H3Z A;  1VQM A;  3CC7 T;  1VQK T;  2DVE A;  4BY6 B;  4L5G A;  2XG8 D;  3QZ9 B;  2CZ0 B;  1IZ6 A;  1JB0 E;  4XAX B;  4M78 E;  1WJQ A;  2L89 A;  2X4X A;  2QQS A;  2ZPH B;  3C94 A;  4M7A F;  3OBW A;  4C92 E;  3LX7 A;  1UGP B;  4L59 A;  1KQS A;  2RJF A;  3S3N A;  2DD5 A;  5LJ5 j;  4CRI A;  5GAN f;  2EJ9 A;  3L2Q A;  2DZ9 A;  5A0L A;  1JRI A;  4J83 A;  3CCM T;  2DAQ A;  1BI1 A;  4A4E A;  3CCR A;  3JB9 F;  4J7F A;  4X9C A;  1KQS S;  4PLL A;  4BI8 B;  3QJ6 A;  5FU7 C;  5GAM h;  5L8R E;  2IVW A;  4J7I A;  3OYN A;  3OYL A;  3HRS A;  1BKB A;  2E41 A;  2WSC E;  2CZ7 B;  1PSE A;  3LH0 A;  4N4H A;  2LQK A;  2K5F A;  3LLR A;  2DXC A;  5HKC A;  1XQH A;  2LVM A;  3DLL A;  3FJP A;  2KK4 A;  3INZ A;  5D6X A;  3SB2 A;  2DEQ A;  3M53 A;  4M75 F;  4J6Y A;  1U1S A;  2CYZ B;  2DIQ A;  3NTK A;  1VQO T;  3CCE T;  3FRN A;  4HCZ A;  5A0G A;  3CEY A;  3OYE A;  4M77 F;  4XQ3 A;  4EMK A;  3OYD A;  1OYX A;  2RB6 A;  3CBO A;  4QW2 A;  3JCM W;  2PVD B;  1V29 B;  2FHD A;  1I5L A;  4ZGJ B;  3R6O A;  3JCM f;  4JRQ A;  1M1K U;  2F69 A;  5GAO q;  3CC2 A;  1YJW T;  4C92 C;  1W4S A;  2QTX A;  3OYH A;  4F7U A;  3WVD B;  1VQ4 A;  1YJ9 A;  1BI0 A;  2WSF E;  1QVG A;  2WSE E;  1M1K C;  3OYI A;  3RMQ A;  1RI0 A;  1WQW A;  2DIG A;  2LRQ A;  3J81 E;  1VQM T;  2PUK B;  3GPL A;  4EMK B;  5IT9 E;  3H8Z A;  4M78 A;  5DY9 A;  5GMK m;  4PJO F;  5CIU A;  2M16 A;  4JLI A;  1QVG S;  3V7R A;  2K3Y A;  5GAN 7;  2VGN A;  2Y4X A;  3HRT A;  2XDD A;  3QSU A;  2DO3 A;  2GF7 A;  3M4G A;  4DOW A;  5FRN A;  2FB7 A;  4F7U B;  1X01 A;  3L42 A;  3LGF A;  3MET A;  3SWN A;  2EQJ A;  1JBM A;  4WF2 A;  4NL3 A;  3LWH A;  3LGL A;  2A3L A;  2CZ6 B;  2XIC A;  2DD4 A;  4A4H A;  3FDR A;  2DTH A;  4L6V 5;  1K8A U;  2KMT A;  4M7D F;  2F5T X;  1FXX A;  3OSV A;  4BDZ A;  4XK8 E;  3JCM c;  4M78 B;  3VU3 C;  1WJR A;  3VJP A;  2M1H A;  4FT4 A;  3GNG A;  2RHX A;  2QQA A;  3CMA T;  4E7I A;  3SWN B;  3VKI A;  1DJ7 B;  4ZN1 A;  4BE1 A;  5GAN e;  3OW2 A;  1NJI U;  4PNO A;  2EYQ A;  2LNV A;  3DLM A;  3HHT B;  3MCA B;  5KCH A;  4BE0 A;  4RKU E;  3P8H A;  5M9O A;  3A8O B;  2LCC A;  1KHC A;  3GF5 A;  3CME T;  5GAN d;  2JUF A;  3OB9 A;  2HNI A;  2XID A;  4LD9 K;  3OMG A;  3CCM A;  5AYF A;  4DQ2 A;  1NJI C;  4A53 A;  3VUZ A;  4M75 E;  4D6W A;  5GMK e;  2KQW A;  3OW2 S;  4QVD A;  2XDB A;  1QP3 A;  4JJN K;  5J26 A;  4EMG A;  1G3W A;  3P8B B;  4Y91 A;  3G4S A;  4HT9 A;  2VGM A;  1G3T A;  1K8A C;  4C5E A;  4M78 G;  4GY5 A;  3JCM V;  4BY6 C;  3OYB A;  4N0A C;  1VQ4 T;  1YJ9 T;  4ZGD B;  1N9S A;  3JCM P;  2LX9 A;  3SFM A;  4E7H A;  3MHX A;  3ZFJ A;  4C8Q A;  2MWO A;  2QQB A;  1KQ1 A;  5GAN g;  3L2R A;  4E7K A;  2C06 A;  5GAO p;  1WQ7 A;  2K3X A;  3L2W A;  3JCM e;  4IUQ A;  4A54 A;  4Y28 E;  4JUV A;  1M1F A;  3A8H B;  1UGR B;  5IN1 A;  1VQ8 T;  1OZ3 A;  2MI6 A;  3FC3 A;  5LJ5 h;  1UGQ B;  1Q7Y U;  4RG8 A;  4OB1 B;  4OF1 A;  3V7S A;  4XTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...