4L6V5

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
b'ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 9
structure length 68
sequence length 68
chains with identical sequence E, e
ec nomenclature
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l6v500
1DJ7B 4ZGJB 1JB0E 2PVDB 3X28B 1UGRB 2QDYB 4OB0B 2ZZDA 1UGQB 1UGPB 2ZPHB 2WSEE 2ZPBB 3VYHB 3A8MB 3A8LB 2ZCFB 2WSCE 4OB2B 2ZPGB 3QYHB 4RKUE 1IREB 1PSEA 4OB3B 2ZPFB 1PSFA 1UGSB 3X20B 2AHJB 3QZ5B 2D0QB 2PUKB 1V29B 2CZ1B 5L8RE 1QP2A 3WVDB 2CZ0B 3QXEB 4ZGDB 3VYGA 4ZGEB 2PUOB 4KT0E 3X25B 4FM4B 1GXIE 3A8OB 2DXBA 2PVGB 2PVOB 4L6V5 3LW5E 2PU9B 3HHTB 3A8GB 4OB1B 2CYZB 3WVEB 2O01E 2CZ6B 2WSFE 2ZPEB 2DD5A 2ZPIB 1QP3A 2CZ7B 2DD4A 1AHJB 3X24B 4XK8E 3A8HB 4Y28E 3QYGB 2DPPB 3X26B 3QZ9B 2DXCA
chains in the Genus database with same CATH superfamily
2DYIA 2PQWA 1VQKT 1H8KA 4OB0B 2D0NA 3VS3A 3JV3A 4XU2A 2DK3A 4M75C 5LJ3f 2F2VA 1QWEA 5FU7B 1MMDA 4R0KA 2ZPHB 1W2BP 1K1ZA 3OYAA 1K8AR 3CD6A 4E47A 2FO0A 2EQUA 2YUOA 4JLGA 4LD9K 1IZ6A 1CKAA 2WSCE 1VQ7A 4J5YA 1MNDA 5IXFA 4D6WA 1VQ5A 4MDWA 2P0PA 2E3HA 2HDAA 2E10A 5GJVB 3OYIA 1VQ8T 1NLOC 2AIRB 1OZ2A 4RTTA 2VWFA 2OTJT 3P8DA 1E7OA 4O6JA 2F5TX 3CCST 5GAN2 2KNBB 3P8BB 1Y96B 4EMKC 1GL5A 3QO3A 4ZGDB 2FVUA 3SDZA 1M8MA 2E4HA 1NYGA 1NPRA 2DMOA 4J9GA 4Z89A 1QVPA 1G3YA 1Y96A 1QKXA 2KBTA 2R5AA 1VQMA 3LLRA 4M78F 4A4EA 3JSCA 4E7HA 1M4ZA 1KQSS 1ZLMA 2QEXA 1K0SA 2QXFA 3OYYA 2V26A 4V2SA 1X69A 1WZOA 5FU6B 3VUZA 2DD5A 1YHQQ 4J7FA 4FL6A 2DD4A 1VQPQ 3THKA 2FRWA 4C92E 2DZ9A 3M4GA 2O9VA 4LN2A 3PGGA 1PG5B 4IKFA 2DPPB 2FZKB 4R55A 2X51A 3ER0A 4A4FA 3NTHA 4J8OA 4QVCA 1VQ7T 5DLQE 3EFSA 1IGQA 3EFOB 2QDLA 2HKQB 3X28B 4TVRA 1G83A 3RR6A 1NJIR 3G6EQ 1R0CB 3FJPA 4CC4B 4E7JA 3EFOA 4EDUA 2ZPBB 2X9HA 1OI1A 2QI2A 1Y71A 1M1FA 1U1TA 4GLMA 1K8AC 2KY9A 1G3TA 3A98A 4MZMA 3MEVA 4C0ZA 3SB2A 1TUGB 3L2QA 1PKTA 2VGMA 1VQ4T 2EAYA 3QZ5B 3OYFA 5GANj 1GRIA 1MV0B 1BK2A 3CEYA 1ACMB 1IGUA 1QCFA 3CPWA 3QKJA 1YI2A 1LCKA 1NM7A 1D09B 2AKLA 4PJOC 4X1VA 4FM4B 3JCMb 4RG8A 3RIRA 1SKUB 5LJ3e 1N9RA 1WLPB 1W2BS 2RQTA 1Y07A 3OYEA 1BCOA 4JUVA 4C8QC 1N8RU 5EC7A 4QW2A 3PIPA 3JB9J 1OZ3A 2JNGA 1WHJA 1BKBA 1NYFA 2K3YA 3CCVQ 1WJQA 2JS0A 4B6MA 3JCMg 3GP8A 5GANh 1UUEA 1KK7A 2EBPA 3DLLA 2LCCA 2RK1A 3A8HB 2YLBA 1M3CA 1UEBA 4FT2A 3G4ST 3QYGB 4XTVA 1M1KU 5DM7R 3CC4Q 1N9SA 2QTXA 3HKSA 4M78B 4OF1A 2RQVA 3G7ZA 3VS5A 4ZGJB 1I8FA 1MGQA 4FYYB 3CCLA 4RUGA 2E5KA 2A7YA 3R6OA 1K4US 2LMJA 2J6OA 4M78A 4JLIA 1OX8A 2XI9A 1TOVA 4PJOD 1OQKA 4N4IA 4AG1C 3TCJA 3M9QA 2E6NA 3GPLA 4M7AC 2KK4A 2F2XA 2XIDA 1G5VA 3SWNB 1Q82R 3MJXA 4M75F 1TH7A 5KCHA 3E19A 3MEWA 2L3SA 2FYKA 4F7UG 4YTLA 4OB3B 3SWNA 3JCMP 4NL3A 2HEQA 3X20B 2YSQA 3REAB 4MMKA 2EQIA 2KVQG 4C8QD 4RTXA 4E7SA 1X6BA 3VS1A 3TEEA 3RKWA 3H0HA 4PJOE 4FCYA 1V76A 4F17A 1PKSA 1G3WA 1WI7A 1ZSGA 4VUBA 4DBRA 1WIEA 2HQEA 2YDLA 1M1KC 4BACA 2QQAA 3EGUA 2E70A 2I0NA 4CI0C 1O9SA 4QKUA 3RMQA 4J9BA 1VQOQ 2HAXA 3HTRA 4C8QE 5LJ5j 3GLXA 3OYLA 1VQNA 3GNFB 2COWA 1TG0A 2JMAA 4RG2A 2NYSA 1M90U 1RAFB 4DBFA 2A3LA 5GAMf 4RCCA 3KBGA 1WXBA 4BE1A 3H0FA 4J6XA 3CC2A 3I55Q 5FROA 3UPUA 2X4YA 4M7AD 2X3XD 1VQLQ 3ME9A 3FB9A 3M54A 4HKEA 4FW2A 5FWCA 5GAN4 1MMNA 4KBMB 4OMMA 1VQKQ 2MK5A 1BYMA 5GANe 2VKNA 2DERA 1JB0E 1YJNQ 1K9AA 1SRLA 2QQBA 1Q81R 1WNLA 5LJ5h 1YHQT 4M7AE 4QQ6A 3D7SB 2LQKA 2K6DA 2YRVA 5KYYB 1PNJA 3VU3C 1B07A 4GY5A 2OTLA 1VQ8Q 1B34B 5KYYA 4BDYA 2OTJQ 3CC7Q 2XDPA 4AMCA 2O4XB 3CCSQ 2M1HA 1RI0A 5HKCA 1B34A 2QASA 4LNPA 3V7CA 4AFZC 2DLPA 5KE2A 1JXMA 1W6XA 2E3IA 3DLMA 2O4XA 1UDLA 2V8KA 5GMKj 2CP3A 3VYGA 1BI1A 1HK9A 3X25B 3G71Q 5GMKm 3LX7A 1Q7YR 1G3SA 2P84A 2EKHA 4IUVA 4PJOF 2ZGWA 1GBQA 2OX7A 5DY9A 4PFZA 2LJ3A 3UWNA 5L23A 3L42A 3RUXA 1VYVA 1MV3A 4JRKA 4XU1A 3E9FA 3PNWC 3BW1A 2F2WA 4C8QF 2RJDA 1OV3A 3LWIA 1U06A 2DL5A 1JJ2A 2RO0A 5KYWB 3LGFA 5GAMd 1P92A 2OI3A 4Y28E 1VQ7Q 2LRQA 1AD5A 5J26A 3I5SA 3QWYA 4EIKA 4EMKB 4OMFB 1LOJA 4ELZC 5GMKh 2DXCA 4QT7A 1VQ5Q 5KYWA 1BI2A 3CCQA 2X4XA 2XD0A 2OTLT 4LE9A 4EMKA 2EJ9A 1M9SA 2MAMA 1H641 2RHYA 5GANg 2RD1A 2O88A 1GCPA 5GAOl 2DRMA 3QG1A 1Q81C 2OJ2A 1QVFP 4ZTFA 1GCQA 5CVIA 3URGA 3A8LB 2FL7A 2DBKA 1VIFA 4OB2B 1UFFA 2RA2A 3PIOA 3V8LA 4MZPA 3ZEHA 1R0BG 2YUNA 2J6FA 1IREB 2XDBA 3CC4T 3GIBA 4PJMA 1VQMQ 3L2RA 1ZA2B 2RJEA 4M7AF 2L5QA 4JRPA 2NUPB 2D0QB 2PUKB 3VV0A 3HSBA 1NG2A 1XNIA 2B86A 1JXOA 2QEXQ 4F16A 3WVDB 4O5VA 2HSPA 4QQDA 2ROTA 2NUPA 2GNCA 2RH2A 4JDSA 1TXQA 4KT0E 1Q86R 2LZ6B 3FRNA 4F7UF 3DKMA 2EYZA 3ZBDA 4PJJA 3CCMA 3JCMV 4LDVA 3HRSA 2R57A 1UHFA 3EFRA 3JCMc 3S3OA 3JCMf 2L3QA 2BZ8A 1N5ZA 1U5SA 2HL5C 4A4KA 4JJDA 1NBEB 3PTAA 4KH0B 3UF4A 2K3BA 3Q1JA 1OOTA 3SHWA 1QVGA 4NOYA 1PRLC 2RHIA 3TSZA 1KC8C 1IB8A 1I5OB 3RBBB 1NLPC 3CCRA 2JMCA 2DX1A 3QBYA 4PJOB 4E6RA 5M9OA 4QQGA 2H8HA 4M7DG 2QA4A 2CKKA 2MWPA 2ZZDA 2LNHB 1ZUKA 4PJOA 3EGDB 3M0QA 1AWWA 5GMKe 3EG3A 4M7DC 3OQ5A 5FLXE 2VXFA 3ZL7C 1AWOA 2XICA 5D6XA 4C8QB 1MMGA 5LJ3j 3A8MB 3EGDA 4LDYA 3CCJA 1PRMC 2ZPGB 3PFSA 2HBPA 3OYNA 1PSEA 4F04B 3BDUA 4M77C 4C8QA 4DBQA 3JB9G 2HCKA 1C6VX 1WJRA 3T9NA 3V8KA 2KGTA 3LH5A 1F1BB 2AHJB 5IAYA 1YJNT 3P8HA 5LJ5g 2QQRA 3CCMT 2EIFA 3OSVA 3OY9A 4KH1B 1YP5A 1RI9A 3FLGA 2LX9A 4CC7A 4MZTA 3QWXX 4ZNXA 1UE9A 2KMTA 2PTKA 4OMPA 4OMNA 1PD0A 2YRCA 3C12A 3TU4K 2GCXA 1WJSA 3E9GA 3VS0A 1SEMA 1Q86C 5A0GA 2PVGB 1QVFS 1OX9A 5GAN8 1KQ2A 3MKDA 4NL2A 4OP0A 2EQKA 1FMWA 3EG0A 2DEUA 3CC7T 3UDCA 2RI5A 4M7AB 5LJ3h 4KGXB 1AWJA 1MHNA 2VASA 3CCLQ 2DXTA 4M7AA 1NEGA 2FEIA 4LXCA 4AFUC 4PLIA 4XQ3A 2LC4A 2CP0A 3G71T 5KCOA 2QYZA 3JCMd 4Y91A 3OA6A 2K5IA 1K8AU 3C94A 4XAXB 4F7UB 2DXUA 5HK3A 3VS2A 1Z9ZA 3QZ9B 2X3WD 3HRTA 4M77D 1U3OA 2LNVA 3OW2P 2QTVA 4KRTA 1YIJA 2RB6A 2RNAA 4F7UA 4M75D 4Z88A 1M2OA 4RMOA 1UGQB 4JS5A 1YITA 1S72A 2LTOA 4AFQC 1G2BA 4ZN1A 4ZTJA 1HJDA 1JQQA 1OYXA 1PM3A 1MUZA 3HL8A 2CP6A 1RUWA 4E7LA 2M0OA 1WX6A 2RHUA 2CGHA 3CD6T 2H3JA 1UECA 3L1AA 4C0FA 2LX7A 4GBQA 4M77E 2EGAA 1AZGB 4N0AC 4ANJA 3VUBA 1KQSA 4M75E 1VQ5T 1AVZC 7AT1B 3CMEA 3CXCP 1VQNQ 2AK5A 3TREA 2RK2A 1YN8A 3FC3A 4Z8AA 1OU8A 2K2MA 3LYIA 4ESRA 4GLKA 1IHVA 4DEYA 1KD1R 3CC2Q 3OYMA 4PFPA 3E2UA 4J9IA 1VQMT 1X6GA 3L2ZA 2EJFA 3VS4A 2ENMA 2HBWA 5IN1A 1UJYA 3PE0A 5LL6S 3BE3A 1YIJT 3OYDA 1X01A 2QEXT 1LPLA 1C1AA 5HY6A 1RAIB 2L8DA 4WF2A 1RABB 1IHWA 3TVTA 3GOXA 2EGCA 2SRCA 4KUIA 1SSFA 1XOVA 3H6ZA 3V7RA 5HCKA 1QW1A 2X4JA 3I5RA 2OTLQ 3MPUB 2DVJA 1I1JA 3LH0A 4EPCA 4Q5WA 1XJWB 2EJGA 4DOVA 2NWMA 2GTJA 2VGNA 1LVKA 2J06A 2DKGA 4B9XA 4EMHA 2WSEE 4CRIA 4HVWA 4KGZB 4EMGA 1SHGA 2JXBA 1W2BA 4BB7A 3PMIA 1X43A 1YJ9A 4BE0A 3A5ZB 4RKUE 5DLOA 2OAWA 4M7DF 2QG9B 4LDUA 2HD0A 5C6SA 1YNZA 1RAGB 5IHKA 2DAQA 2LCSA 3PVLA 5C0MA 3GNGA 1NJIC 1SHFA 1W4SA 3OBYA 1VQ9A 1WXTA 1FXXA 3OW2S 3EG9B 4FYXB 4M77F 4BDZA 3VRYA 3QUIA 1J3TA 1YI2T 2X35A 5CR2A 3EHRA 1Y57A 1EX4A 2CP5A 4A53A 1VQ6A 2EGEA 3EG9A 2L89A 3I56A 3RNJA 2PZ1A 2KXDA 1KD1C 2E41A 2A08A 2JM8A 1D0YA 2PU9B 3WXMB 4HXJA 3U23A 3ASKA 1RLQC 4OGEA 3ZFJA 4M4ZA 2EFIA 1BB9A 1M90R 2E65A 4LDXA 5GAN5 2O01E 2HNIA 4PJNA 4OMQA 2M9UA 3CXCS 3CBPA 4ATOA 2VYTA 2ZPIB 2EW3A 3MP1A 4OMOA 4HA8A 1YBYA 3S3MA 2CS7A 2DYBA 3EAEA 5GAOq 5GAMj 2LQ8A 4D8DA 2YHTA 1K73R 1IXDA 5LJ3g 3V8JA 2AZVA 3QPHA 2GGRA 2KROA 1VOMA 4HCKA 1YJWA 3J80E 3OYJA 4J7IA 2ECZA 3M0UA 2YWWA 3O8VA 2DJQA 4R56A 3CCLT 3G6EA 3C0CA 3CXCA 5GANd 3CPFA 2LT4A 2Y90A 4HVVA 2L3PA 5CKEA 1S1NA 3QDRB 2VXEA 1HSQA 3OS2A 2NLUA 3JB9H 1JU5C 5LJ5f 2DETA 2LDMA 3I56T 2R58A 2CP2A 3L2VA 5CAIA 3CCMQ 4JJBA 1ZSZC 3GBQA 1WFWA 1N27A 3DB4A 3BY7A 3OS0A 1XQHA 2RQWA 1D0XA 2BIVA 1LNXA 5KE3A 1WHLA 1BI0A 1BCMA 1FYNA 3H8ZA 1OU9A 3QXEB 2FPEA 2GQVA 4B9WA 1O75A 1SPKA 4LDWA 1BIBA 2PUOB 1BIAA 3CMAA 1NEBA 1UG1A 2DIGA 2RI2A 3OYGA 1Q82C 2C06A 1FMVA 1WQWA 5CQXA 1OPLA 2CDTA 2XU8A 2YUQA 4PJLA 2DXBA 5IHIA 2E12A 3VKIA 4E7KA 2DL4A 2MOXA 3E1SA 2KXCA 1AEYA 5KH6A 4F7UE 2JTFA 3HHTB 5CKDA 5FRMA 1VQNT 1JEGA 4E7IA 1GFDA 2QA4Q 2DTHA 1YJWT 1K9MR 4D8KA 2ZPEB 1AOJA 4M77B 1QP3A 3HP9A 2ED1A 3MHXA 3CCVA 4M75B 1Q81U 2L3RA 3CC2T 1WHKA 4BI8B 2LQWA 5D6WA 4M77A 1E6GA 3QIIA 5I11A 3CCUA 3CCJQ 4X9DA 4CC2A 1K73C 4M75A 5D7UA 2LJ0A 3RERA 4ZN3A 1PC0A 4JS4A 1PCXA 1B3QA 2X4WA 1RACB 1KG1A 2E6ZA 1TTHB 4J6YA 1ZBXA 3CD6Q 1QCOA 4DBHA 1UGVA 2QK0A 1WGSA 5FRNA 5IH2A 1I07A 3LGLA 4AT1B 4HCCA 2DL7A 2OAUA 2GFAA 3UA7A 3CMAT 2A36A 2ZPFB 4CC3A 3V7SA 2E64A 3I9QA 5LJ5d 2QQ9A 1FMKA 3UT1A 2CZ1B 3RDVA 1TSFA 4JZ4A 2YRDA 1QP2A 5I2MA 2IVWA 3KXTA 1Q95G 1TUDA 4N4HA 1PD1A 2O31A 4BY6C 1R77A 5GAMe 4J9FA 3S3NA 2H3EB 3JRZA 2KI7A 1GXIE 3M55A 4XTZA 3RMSA 1RL2A 4OGCA 2MIOA 4IIOA 1KC8U 4C5IA 1TUCA 3CCUT 2YUPA 1YIJQ 1BU1A 2K2VA 4BI4A 2KYBA 2L2PA 1KFZA 3A1PA 4HCZA 2JTEA 4KULA 2BE7D 1I81A 3OSSC 1YITQ 1K9MC 3CBOA 1S72Q 4BE2A 2JUFA 2MPXC 2YXYA 1Q7YC 2DZCA 2COYA 4N0AA 5I22A 4IUUA 4FYWB 2M02A 1KQ1A 4Z02A 4PNOA 1M2VB 3HRUA 1WHHA 3CCQT 3M57A 1RAEB 2QGGA 2FZCB 3QDFA 1UGPB 1M2VA 2D6FA 2DTIA 1PHTA 1X27A 3INZA 5GJWB 4J9EA 3M0TA 2CSQA 2NUTB 1B7TA 1A0NB 3QYHB 1M30A 1Q86U 3SEMA 2L0AA 4BI3A 2NUTA 4MDXA 4OVAA 3M56A 1IO6A 1QWFA 2OTJA 4MMLA 3CPWP 1WDXA 2LJ1A 3TSWA 1YI2Q 1X2QA 2GBQA 2K7AA 1VYUA 2CH4A 3EHQA 5I21A 2DO3A 4C92G 1N6AA 3OYBA 4C0DC 1R8OB 3FJ5A 1Z9QA 2PVOB 2LQNA 1H3ZA 4XTUA 5ECAA 4L6V5 2EPDA 3M58A 1H3HA 2YLCA 2P4RA 1NZ9A 1ZX6A 2QGFB 4C92C 2MWOA 3UA6A 3EH1A 1SRMA 4ELYC 2EYYA 4JPBW 2CH4W 4JJCA 2EYXA 4L59A 3QJ6A 2KR3A 1FWZA 2CT3A 4XTWA 1GBRA 1WXUA 2IG0A 1M3AA 2DF6A 2JVVA 4QVZA 4FU6A 2RN8A 2CP7A 3H0IA 3VJPA 5IHNA 1YJ9Q 3NMZC 2DL8A 2KE9A 3M59A 3CCRT 2D8JA 2QA4T 5IXBA 1UGRB 5GAN6 1JO8A 4M7DD 1ZA1B 4J9DA 5CKFA 1KHCA 1VQ9Q 1G8XA 1VUBA 3EG2A 3OBWA 3CCEA 4FW1A 2RI3A 5CK9A 3OMGA 2K5LA 2EVRA 5GMKl 1QVFA 1VQ6Q 2G3RA 1VIEA 4FYVB 3NPFA 3JB9I 2DVEA 3I56Q 3CCJT 3QHSA 2A37A 4NS5A 2RJCA 3QJYA 1VQ4A 2Y4YA 3LWHA 2VV5A 4XTXA 3G1JA 1GCQC 2Y4XA 5D6YA 3EG1A 4C92D 4M7DE 3BFMA 1D0ZA 3JB9D 2ATCB 3M0SA 2O9SA 4II1A 4XU3A 2VC8A 4JJNK 2CZ0B 2XHCA 1X6OA 3JCMe 1OULA 2MF2A 4C0GA 2V1QA 1WHMA 2XMFA 2DILA 2JT4A 1W70A 2JN0A 3GF5A 2DA9A 3UATA 4A4GA 1WPYA 2A28A 3LW5E 2D9TA 1AWXA 3H9NA 1ABQA 1YJWQ 2LP5A 4X34A 3OYHA 1RAAB 4F14A 3CQTA 1X2KA 4KGVB 5AYFA 2XG8D 3CPWS 4JRQA 1ZSZB 1U1SA 2ZAEA 3PT9A 1AHJB 4WTOB 2D8HA 1EZZB 2EQJA 4A4HA 2DFUA 3G4SA 3VS6A 3CCET 1YWPA 1ZSZA 2A0FB 1N8RR 5LJ3d 2NUZA 3C4SA 2M51A 8AT1B 3F70A 9ATCB 1QKWA 4FIBA 1K76A 1CSKA 2PVDB 2DBMA 5EG2A 2FG0A 2HZYA 1NJIU 4FSSA 3L2UA 4PJOG 1YITT 2DTOA 1S72T 2RQUA 2HMAA 2RJFA 2O2OA 2RM4A 3MEUA 1M1KR 5A2QE 1TS9A 4DQ2A 3CMAQ 2P0QA 4ME7A 8ATCB 1KD1U 5GANf 1SSHA 1OEBA 3NHNA 4C8QG 3RKXA 1QQJA 4DOWA 2MI6A 1YCSB 1PSFA 1MMAA 4DEXA 2BTTA 2EQMA 3N5BB 1X75C 3CMET 2V8JA 4WCIA 3MCAB 2JTMA 2VVKA 5L8RE 2KEAA 2DRKA 4AFSC 2KQWA 2KT8A 2GF7A 5GAOm 1UJ0A 1U8RA 3JAME 1UHCA 3J7AF 3A8OB 2MCNA 1RAHB 5FU7C 1KHIA 1WA7A 3CCUQ 2VB6A 3KUFA 3A8GB 1HD3A 1T3LA 4ORZA 1H92A 3M5AA 3RESA 1KIKA 2RMOA 1UTIA 2K79A 3M0RA 2RHZA 1PWTA 4OB1B 1VYTA 2KT1A 2F1LA 4HT8A 3META 2CZ6B 2WSFE 2JJ9A 2M0YA 3S6WA 3JCMJ 2G6FX 4C92F 2DNUA 4M7AG 1BI3A 3EGXB 2CZ7B 1M5Q1 1HXDA 4PK4A 3DB3A 1QLYA 3NFCA 3JB9F 3OMCA 1JJ2P 2K3XA 2HKNA 2K4YA 4IURA 1MNEA 4C5HA 2KYMA 4PFOA 3OS1A 1YFNA 4L5GA 3EGXA 2IIMA 2F5KA 3JCMX 3X26B 2MMPA 1HYOA 1M27C 1N8RC 3CCQQ 4IUQA 4BY6B 3OW2A 3PVQA 4X9CA 3OYCA 2RF0A 4XTYA 2COZA 1W1FA 1V1CA 2DL3A 3JCMQ 5CKBA 5A0LA 3SD4A 2R5MA 5AT1B 1YHQA 3R6NA 1VQPA 2EWNA 2C0OA 2I2LA 1ZBJA 1Q82U 2FRYA 1YJ9T 4RTZA 5FU6C 3MP8A 2DJZA 2JW4A 4PKCC 4E7ZA 4HCBA 1D1AA 3HPWA 1V29B 5HK0A 1VQ9T 2FB7A 1NE8A 1KSWA 3SFMA 4E2FB 3M0PA 4ZGEB 4OMLA 1K0XA 1VQ6T 2C0TA 1D1CA 3O5ZA 5FWBA 2HSEB 2E5QA 1IRXA 2BUDA 1WQ7A 3J81E 2F69A 3CBMA 4QVDA 1YWOA 1LJOA 3OS5A 2HQXA 3MEAA 1I5LA 1UB4A 2M16A 5GAMh 1K73U 2FPFA 5KYXB 2P4TA 3PMTA 2CT4A 2CSIA 1RADB 3NTKA 2XKOC 1D1BA 2GFUA 2C0IA 5KYXA 2KDSA 2CREA 2CUBA 4KUDK 2VUBA 1E6HA 4PLLA 4RTUA 3QSUA 1Y0MA 1Y7XA 1D3BB 5CQYA 2EYWA 2SEMA 1QVGP 2DIQA 2RQRA 4XK8E 4M7DB 1VQPT 3MP6A 1TWBA 3TQ7P 3CCRQ 2BZYA 1D3BA 4FSXA 2BZXA 4M7DA 1DJ7B 1KJWA 1RLPC 1M90C 2DM1A 2QDYB 1ZHIA 4C0DB 1T3SA 2FZGB 1C0MA 3HFOA 3G6ET 2J05A 1ZUYA 4C92B 5CO7A 2EYQA 2W0ZA 2V1RA 4Y92A 4HT9A 3CC4A 4C92A 2J6KA 1JJ2S 4K11A 2WACA 3EH2A 1AZEA 1M3BA 1XTDA 2BE9B 2IPOB 2J7IA 2RPNA 4M78G 2JM9A 1I4K1 1T0JA 3KFVA 3HFNA 2E1HA 4J83A 2MYSA 4M78C 2EKOA 1K9MU 2AKKA 6AT1B 2BKDN 1BBZA 5GAN3 1Q7YU 3ULRB 2JOYA 4N4GA 5CCAA 1WHGA 4BUGA 1KC8R 3C95A 4UC4A 4P5NA 5I2SA 2KRMA 4FT4A 3OYKA 2DE0X 4J9HA 1FX7A 1NPPA 1WYXA 3SWNC 2AZSA 2JZ2A 5IT9E 3IQLA 5FW9A 2CUDA 5CIUA 1SF9A 1QMCA 2ESWA 3JCMW 3X24B 3CCVT 2V8IA 5GAOp 3CCEQ 2RHXA 1VQOA 2QQSA 2KSSA 1JRIA 5GAN7 1ARKA 4IUPA 5CKHA 2DEQA 1VQ4Q 3AT1B 5LJ5e 2D1XA 2ABLA 3NGPA 2JS2A 1EFNA 4IIMA 1JBMA 2HQHA 1VA7A 2HL3A 4IUTA 4LUDA 2ED0A 5KYUB 5GAOr 1TU0B 1CKBA 3BDLA 3I55A 2K5FA 3VYHB 1VQLA 4M78D 1YCYA 4DA4A 5KYUA 3FDRA 1ZQ1A 2ZCFB 3FIFA 5J3BA 2LT1A 2LCLA 1KQSP 1EIFA 1VQKA 4C5GA 4PL6A 1AT1B 1QVGS 3I35A 2YT6A 3CMEQ 1YJNA 2FHDA 1UGSB 4J6WA 1ZUUA 4LD6A 3FEOA 1M1GA 2GTOA 4RTVA 3MO8A 2K57A 1M8VA 2ROLA 2W10A 3M4YA 2XDDA 4RTYA 4BD3A 4M78E 1I0CA 2QAZA 1SG5A 3OB9A 2LVMA 3AHUA 4JRIA 1ABOA 4JZ3A 4C5EA 5GAOn 1OPKA 2XK0A 4J9CA 1T0HA 1VQ8A 3G4SQ 3JCMh 3CC7A 2K9GA 5KYNA 3M53A 3CCSA 1VQOT 2B8AA 3VRZA 2GQIA 2CYZB 4HVUA 2AT1B 3WVEB 4A63B 4AG2C 1QCNA 5GMKi 3RKYA 3NTIA 2KRNA 3VS7A 1GFCA 4LUEA 2Z0WA 2FPDA 3G71A 4RTWA 4RCBA 3L2WA 5GAMg 4M77G 3I55T 2P0KA 5A0DA 5J39A 2PNIA 1VQLT 4XU0A 2KAFA 3REBB 4A54A 4M75G 2KRSA 3H41A
chains in the Genus database with same CATH topology
1BI2A 2PQWA 4FIBA 3CCQA 2PVDB 2X4XA 5EG2A 2XD0A 1VQKT 2OTLT 4J7IA 4EMKA 2EJ9A 4OB0B 3O8VA 1NJIU 4R56A 1M9SA 2MAMA 4XU2A 2DK3A 4M75C 3CCLT 1H641 5LJ3f 2RHYA 5FU7B 5GANg 2RD1A 4PJOG 3L2UA 3G6EA 2DTOA 1YITT 1S72T 2ZPHB 3CXCA 5GANd 3CPFA 2LT4A 5GAOl 3QG1A 1Q81C 3OYAA 2Y90A 5CKEA 2RJFA 3CD6A 4E47A 4ZTFA 2EQUA 2RM4A 3QDRB 3MEUA 5CVIA 2VXEA 3A8LB 4JLGA 3URGA 2FL7A 5A2QE 1IZ6A 1VIFA 2WSCE 4OB2B 3PIOA 2NLUA 2RA2A 3V8LA 4DQ2A 4J5YA 4MZPA 1VQ7A 2P0QA 3ZEHA 3JB9H 4ME7A 1KD1U 5GANf 1IREB 5LJ5f 4D6WA 1VQ5A 3CC4T 2XDBA 4MDWA 3OS2A 3GIBA 2LDMA 2P0PA 3RKXA 2R58A 4C8QG 3I56T 3L2RA 4DOWA 3L2VA 2MI6A 2E10A 2RJEA 5CAIA 1PSFA 3OYIA 4M7AF 1VQ8T 1N27A 3DB4A 3BY7A 2EQMA 3OS0A 3N5BB 1X75C 1OZ2A 2L5QA 1XQHA 3CMET 2V8JA 4JRPA 2D0QB 2PUKB 3VV0A 2OTJT 3MCAB 3P8DA 2BIVA 1LNXA 2JTMA 3HSBA 4O6JA 1XNIA 2F5TX 5L8RE 5KE3A 3CCST 1BI0A 3WVDB 5GAN2 4EMKC 3P8BB 1Y96B 2KQWA 3H8ZA 4O5VA 4QQDA 3QXEB 1G5VA 2GQVA 3QO3A 4B9WA 1O75A 2FVUA 2GF7A 3SDZA 2RH2A 4JDSA 1BIBA 4LDWA 4ZGDB 5GAOm 1U8RA 2PUOB 1BIAA 3CMAA 2DIGA 2RI2A 1Q82C 3OYGA 4KT0E 4LD9K 3JAME 2C06A 1NPRA 1WQWA 5CQXA 1QVPA 3J7AF 1G3YA 2XU8A 3FRNA 1Y96A 4F7UF 3A8OB 3DKMA 2DXBA 2E12A 3VKIA 4E7KA 2R5AA 5FU7C 1KHIA 1VQMA 3E1SA 3ZBDA 3CCMA 5KH6A 3JCMV 3LLRA 4F7UE 4M78F 2JTFA 3KUFA 4A4EA 3HHTB 3A8GB 4LDVA 3HRSA 3JSCA 5CKDA 2R57A 3M5AA 5FRMA 1VQNT 3RESA 4E7HA 3EFRA 1M4ZA 3JCMc 1KQSS 2RHZA 4E7IA 4OB1B 2QEXA 4HT8A 2DTHA 3S3OA 1YJWT 3META 3JCMf 2CZ6B 2QXFA 2WSFE 3OYYA 3JCMJ 3S6WA 2ZPEB 4V2SA 4A4KA 4M77B 5FU6B 3VUZA 4C92F 4M7AG 1BI3A 2DD5A 1QP3A 2CZ7B 1M5Q1 3HP9A 1HXDA 3MHXA 4J7FA 3DB3A 3NFCA 4FL6A 3JB9F 3OMCA 3CCVA 2DD4A 2K3XA 4M75B 2L3RA 1Q81U 2K4YA 3CC2T 4IURA 3Q1JA 4C5HA 4C92E 2DZ9A 3M4GA 4BI8B 5D6WA 4M77A 3OS1A 3QIIA 4L5GA 1QVGA 3PGGA 4NOYA 3CCUA 2RHIA 2F5KA 4X9DA 2DPPB 3JCMX 4R55A 1KC8C 4IKFA 1K73C 3X26B 4M75A 3ER0A 4M7AC 2MMPA 3RERA 4A4FA 3NTHA 4J8OA 1N8RC 4ZN3A 4QVCA 3CCRA 1VQ7T 4PJOB 3QBYA 5DLQE 5M9OA 4IUQA 4QQGA 3EFSA 4BY6B 3OW2A 4X9CA 4JS4A 4M7DG 2QA4A 2CKKA 3OYCA 4XTYA 3X28B 2MWPA 4TVRA 2X4WA 3JCMQ 5CKBA 1KG1A 5A0LA 3SD4A 2ZZDA 3FJPA 2E6ZA 2R5MA 4PJOA 1YHQA 5GMKe 4E7JA 4J6YA 1ZBXA 4M7DC 4EDUA 2ZPBB 3OQ5A 5FLXE 1VQPA 2EWNA 2VXFA 1OI1A 2QI2A 2XICA 1Y71A 5D6XA 1M1FA 1WGSA 1U1TA 4C8QB 2I2LA 5LJ3j 1K8AC 2KY9A 1G3TA 3A8MB 3PTAA 5FRNA 4MZMA 4LDYA 1Q82U 3LGLA 3MEVA 3CCJA 4C0ZA 3SB2A 2ZPGB 3PFSA 2HBPA 4HCCA 1YJ9T 3OYNA 2OAUA 1PSEA 2GFAA 3CMAT 3L2QA 3BDUA 4M77C 5FU6C 4C8QA 2VGMA 1VQ4T 3MP8A 2ZPFB 3JB9G 2EAYA 1WJRA 2DJZA 3T9NA 3V7SA 3V8KA 2AHJB 5IAYA 4PKCC 2E64A 1YJNT 3P8HA 3QZ5B 3OYFA 5GANj 5LJ5g 2QQRA 3CEYA 3CCMT 4HCBA 2EIFA 3OSVA 3OY9A 5LJ5d 3QKJA 3HPWA 3CPWA 1V29B 2QQ9A 3UT1A 5HK0A 2CZ1B 1VQ9T 1YI2A 2FB7A 3FLGA 2LX9A 1NE8A 1QP2A 5I2MA 2IVWA 4MZTA 3SFMA 3KXTA 4PJOC 4N4HA 2KMTA 4BY6C 4ZGEB 3C12A 5GAMe 3TU4K 2GCXA 4FM4B 1VQ6T 3JCMb 1WJSA 3E9GA 4RG8A 3RIRA 3S3NA 3JRZA 5LJ3e 1GXIE 1Q86C 3M55A 2E5QA 4XTZA 2BUDA 1N9RA 1WQ7A 2PVGB 3RMSA 5A0GA 3J81E 1W2BS 1RL2A 2F69A 4OGCA 1Y07A 3CBMA 4QVDA 1QVFS 5GAN8 3OYEA 1KQ2A 1LJOA 3OS5A 2HQXA 4JUVA 3MEAA 1I5LA 1UB4A 4NL2A 2M16A 5GAMh 1K73U 4C5IA 1KC8U 4OP0A 2EQKA 3CC7T 3UDCA 2RI5A 4C8QC 3CCUT 1N8RU 4M7AB 5LJ3h 2K2VA 2P4TA 4BI4A 3PMTA 4QW2A 3PIPA 1MHNA 3JB9J 1OZ3A 2JNGA 3NTKA 2XKOC 1BKBA 2GFUA 4HCZA 4KULA 1I81A 2DXTA 3OSSC 1K9MC 4M7AA 3CBOA 4BE2A 2JUFA 2KDSA 4PLIA 4KUDK 2K3YA 4XQ3A 2VUBA 1WJQA 4PLLA 2LC4A 3QSUA 3JCMg 1Y7XA 1D3BB 5CQYA 5GANh 3G71T 3GP8A 5KCOA 1Q7YC 2DZCA 3DLLA 3JCMd 4N0AA 4Y91A 2LCCA 2RK1A 2DIQA 2K5IA 4IUUA 3A8HB 3C94A 4XK8E 2YLBA 3OA6A 1K8AU 1VQPT 3MP6A 4XAXB 1UEBA 2DXUA 4F7UB 1KQ1A 4Z02A 4FT2A 3G4ST 3QYGB 4XTVA 5HK3A 1M1KU 5DM7R 1N9SA 1D3BA 3QZ9B 2QTXA 3HKSA 3HRTA 2LNVA 4M77D 4PNOA 1YIJA 4M78B 4FSXA 2RB6A 4M7DA 4OF1A 1DJ7B 3G7ZA 4F7UA 4ZGJB 3HRUA 1M90C 4M75D 1I8FA 1MGQA 3CCQT 3M57A 3CCLA 2QDYB 1ZHIA 2A7YA 4C0DB 3R6OA 4RMOA 1UGQB 4JS5A 1YITA 1S72A 4M78A 2LTOA 4JLIA 3HFOA 1UGPB 4ZN1A 4ZTJA 2D6FA 1OYXA 2DTIA 3G6ET 3INZA 3HL8A 2XI9A 4C92B 4PJOD 4N4IA 4E7LA 2M0OA 3TCJA 3M9QA 2E6NA 3GPLA 2RHUA 2KK4A 2CGHA 2XIDA 5CO7A 3CD6T 2EYQA 2H3JA 3SWNB 3JB9D 4M75F 1TH7A 3L1AA 4C0FA 3QYHB 4M77E 5KCHA 3E19A 4HT9A 3MEWA 3CC4A 4C92A 2FYKA 1Q86U 4N0AC 1JJ2S 2WACA 4F7UG 3VUBA 1KQSA 4M75E 4OB3B 4YTLA 4BI3A 1VQ5T 3SWNA 4MDXA 3JCMP 4NL3A 1XTDA 4OVAA 3X20B 3M56A 3CMEA 4MMKA 2OTJA 4MMLA 2KVQG 4C8QD 4M78G 3TREA 2RK2A 1I4K1 3TEEA 3RKWA 3FC3A 4PJOE 3HFNA 2E1HA 1G3WA 4J83A 3LYIA 4GLKA 4VUBA 4M78C 2HQEA 2EKOA 1K9MU 1M1KC 4BACA 5I21A 2QQAA 2BKDN 2DO3A 5GAN3 4C92G 3OYMA 2E70A 1N6AA 4CI0C 3OYBA 4C0DC 1R8OB 1Q7YU 2PVOB 2JOYA 1H3ZA 4N4GA 1O9SA 4XTUA 3RMQA 5CCAA 4L6V5 1VQMT 3M58A 2HAXA 4BUGA 4C8QE 5LJ5j 2YLCA 3L2ZA 3C95A 1NZ9A 2EJFA 3GLXA 3GNFB 4UC4A 4C92C 2MWOA 4P5NA 5I2SA 3OYLA 1VQNA 4FT4A 3OYKA 1FX7A 1NPPA 4ELYC 3SWNC 2JZ2A 4RG2A 5IN1A 5IT9E 5LL6S 1M90U 1YIJT 3OYDA 4L59A 1X01A 2QEXT 3QJ6A 2A3LA 5GAMf 5HY6A 4RCCA 5CIUA 3KBGA 2L8DA 4BE1A 1FWZA 4J6XA 4WF2A 4XTWA 3CC2A 3JCMW 5FROA 3UPUA 2X4YA 2IG0A 3X24B 2V8IA 5GAOp 3CCVT 4M7AD 2JVVA 2RHXA 3ME9A 3GOXA 3FB9A 3M54A 4HKEA 4QVZA 1VQOA 4FU6A 2QQSA 4KUIA 2KSSA 5GAN4 1JRIA 3VJPA 5GAN7 1SSFA 1XOVA 4IUPA 5CKHA 2DEQA 4KBMB 3H6ZA 3V7RA 1QW1A 2X4JA 1BYMA 5GANe 5LJ5e 3M59A 3CCRT 4EPCA 3LH0A 1JB0E 1JBMA 4Q5WA 2QA4T 1UGRB 4IUTA 2EJGA 4DOVA 5GAN6 4M7DD 5GAOr 5CKFA 1KHCA 2VGNA 2QQBA 2DKGA 4B9XA 4EMHA 1WNLA 1VUBA 2WSEE 3BDLA 4CRIA 5LJ5h 1YHQT 4M7AE 3I55A 4QQ6A 2LQKA 2K5FA 3VYHB 3OBWA 4EMGA 3CCEA 2RI3A 1VQLA 4M78D 1YCYA 4DA4A 5CK9A 1W2BA 2YRVA 2K5LA 3FDRA 3OMGA 1ZQ1A 4BB7A 5GMKl 2ZCFB 1QVFA 3FIFA 3PMIA 5J3BA 2G3RA 2LT1A 1VIEA 3VU3C 4BE0A 1YJ9A 3JB9I 2DVEA 2LCLA 3A5ZB 3QHSA 4RKUE 5DLOA 3CCJT 4NS5A 2RJCA 3QJYA 1VQ4A 2Y4YA 4GY5A 1EIFA 1VQKA 2OTLA 4M7DF 4C5GA 4LDUA 1B34B 2HD0A 4PL6A 3LWHA 2VV5A 4XTXA 4BDYA 2Y4XA 5D6YA 5C6SA 1QVGS 1YJNA 2DAQA 2FHDA 1UGSB 4C92D 2XDPA 4M7DE 4J6WA 3BFMA 5C0MA 3GNGA 2O4XB 1NJIC 1W4SA 3OBYA 3FEOA 4LD6A 1M1GA 1RI0A 2M1HA 5HKCA 4II1A 1B34A 1VQ9A 4XU3A 1FXXA 3V7CA 3MO8A 2K57A 3OW2S 1M8VA 4M77F 5KE2A 3M4YA 2VC8A 4BD3A 2XDDA 4M78E 4JJNK 4BDZA 3QUIA 2CZ0B 2X35A 2XHCA 5CR2A 1YI2T 3DLMA 2O4XA 1X6OA 2V8KA 3OB9A 5GMKj 3JCMe 3VYGA 2LVMA 4A53A 3AHUA 2MF2A 4JRIA 1VQ6A 4C0GA 1BI1A 1HK9A 2L89A 3X25B 4C5EA 5GAOn 3I56A 2JN0A 2XK0A 5GMKm 3LX7A 1KD1C 3GF5A 2E41A 1G3SA 1VQ8A 4IUVA 1WPYA 3JCMh 4A4GA 3LW5E 2PU9B 4PJOF 3CC7A 3WXMB 2D9TA 3ASKA 3M53A 2ZGWA 4OGEA 3CCSA 2B8AA 3ZFJA 1VQOT 5DY9A 2EFIA 4X34A 3OYHA 2CYZB 2E65A 4LDXA 3WVEB 3UWNA 5GAN5 2O01E 2HNIA 3L42A 5AYFA 3RUXA 2XG8D 2M9UA 3CXCS 5GMKi 3CBPA 3RKYA 4JRKA 3NTIA 4XU1A 3CPWS 4ATOA 2VYTA 3E9FA 2ZPIB 3BW1A 3PNWC 3MP1A 4C8QF 4JRQA 4HA8A 1YBYA 3G71A 3S3MA 1U1SA 2CS7A 2RJDA 3LWIA 3PT9A 1AHJB 4RCBA 3L2WA 1JJ2A 3EAEA 5GAMg 2RO0A 5GAMj 5GAOq 2EQJA 2LQ8A 4A4HA 3G4SA 4M77G 3I55T 4M7DB 3LGFA 2YHTA 5GAMd 1P92A 2P0KA 5A0DA 5J39A 5LJ3g 4Y28E 3CCET 2LRQA 3V8JA 5J26A 1VQLT 4XU0A 2KAFA 5LJ3d 4A54A 3C4SA 3QPHA 4EMKB 4M75G 4OMFB 1LOJA 4ELZC 5GMKh 2DXCA 1YJWA 3J80E 3F70A 3OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJ7 B;  4ZGJ B;  1JB0 E;  2PVD B;  3X28 B;  1UGR B;  2QDY B;  4OB0 B;  2ZZD A;  1UGQ B;  1UGP B;  2ZPH B;  2WSE E;  2ZPB B;  3VYH B;  3A8M B;  3A8L B;  2ZCF B;  2WSC E;  4OB2 B;  2ZPG B;  3QYH B;  4RKU E;  1IRE B;  1PSE A;  4OB3 B;  2ZPF B;  1PSF A;  1UGS B;  3X20 B;  2AHJ B;  3QZ5 B;  2D0Q B;  2PUK B;  1V29 B;  2CZ1 B;  5L8R E;  1QP2 A;  3WVD B;  2CZ0 B;  3QXE B;  4ZGD B;  3VYG A;  4ZGE B;  2PUO B;  4KT0 E;  3X25 B;  4FM4 B;  1GXI E;  3A8O B;  2DXB A;  2PVG B;  2PVO B;  4L6V 5;  3LW5 E;  2PU9 B;  3HHT B;  3A8G B;  4OB1 B;  2CYZ B;  3WVE B;  2O01 E;  2CZ6 B;  2WSF E;  2ZPE B;  2DD5 A;  2ZPI B;  1QP3 A;  2CZ7 B;  2DD4 A;  1AHJ B;  3X24 B;  4XK8 E;  3A8H B;  4Y28 E;  3QYG B;  2DPP B;  3X26 B;  3QZ9 B;  2DXC A; 
#chains in the Genus database with same CATH topology
 2DYI A;  2PQW A;  1VQK T;  1H8K A;  4OB0 B;  2D0N A;  3VS3 A;  3JV3 A;  4XU2 A;  2DK3 A;  4M75 C;  5LJ3 f;  2F2V A;  1QWE A;  5FU7 B;  1MMD A;  4R0K A;  2ZPH B;  1W2B P;  1K1Z A;  3OYA A;  1K8A R;  3CD6 A;  4E47 A;  2FO0 A;  2EQU A;  2YUO A;  4JLG A;  4LD9 K;  1IZ6 A;  1CKA A;  2WSC E;  1VQ7 A;  4J5Y A;  1MND A;  5IXF A;  4D6W A;  1VQ5 A;  4MDW A;  2P0P A;  2E3H A;  2HDA A;  2E10 A;  5GJV B;  3OYI A;  1VQ8 T;  1NLO C;  2AIR B;  1OZ2 A;  4RTT A;  2VWF A;  2OTJ T;  3P8D A;  1E7O A;  4O6J A;  2F5T X;  3CCS T;  5GAN 2;  2KNB B;  3P8B B;  1Y96 B;  4EMK C;  1GL5 A;  3QO3 A;  4ZGD B;  2FVU A;  3SDZ A;  1M8M A;  2E4H A;  1NYG A;  1NPR A;  2DMO A;  4J9G A;  4Z89 A;  1QVP A;  1G3Y A;  1Y96 A;  1QKX A;  2KBT A;  2R5A A;  1VQM A;  3LLR A;  4M78 F;  4A4E A;  3JSC A;  4E7H A;  1M4Z A;  1KQS S;  1ZLM A;  2QEX A;  1K0S A;  2QXF A;  3OYY A;  2V26 A;  4V2S A;  1X69 A;  1WZO A;  5FU6 B;  3VUZ A;  2DD5 A;  1YHQ Q;  4J7F A;  4FL6 A;  2DD4 A;  1VQP Q;  3THK A;  2FRW A;  4C92 E;  2DZ9 A;  3M4G A;  2O9V A;  4LN2 A;  3PGG A;  1PG5 B;  4IKF A;  2DPP B;  2FZK B;  4R55 A;  2X51 A;  3ER0 A;  4A4F A;  3NTH A;  4J8O A;  4QVC A;  1VQ7 T;  5DLQ E;  3EFS A;  1IGQ A;  3EFO B;  2QDL A;  2HKQ B;  3X28 B;  4TVR A;  1G83 A;  3RR6 A;  1NJI R;  3G6E Q;  1R0C B;  3FJP A;  4CC4 B;  4E7J A;  3EFO A;  4EDU A;  2ZPB B;  2X9H A;  1OI1 A;  2QI2 A;  1Y71 A;  1M1F A;  1U1T A;  4GLM A;  1K8A C;  2KY9 A;  1G3T A;  3A98 A;  4MZM A;  3MEV A;  4C0Z A;  3SB2 A;  1TUG B;  3L2Q A;  1PKT A;  2VGM A;  1VQ4 T;  2EAY A;  3QZ5 B;  3OYF A;  5GAN j;  1GRI A;  1MV0 B;  1BK2 A;  3CEY A;  1ACM B;  1IGU A;  1QCF A;  3CPW A;  3QKJ A;  1YI2 A;  1LCK A;  1NM7 A;  1D09 B;  2AKL A;  4PJO C;  4X1V A;  4FM4 B;  3JCM b;  4RG8 A;  3RIR A;  1SKU B;  5LJ3 e;  1N9R A;  1WLP B;  1W2B S;  2RQT A;  1Y07 A;  3OYE A;  1BCO A;  4JUV A;  4C8Q C;  1N8R U;  5EC7 A;  4QW2 A;  3PIP A;  3JB9 J;  1OZ3 A;  2JNG A;  1WHJ A;  1BKB A;  1NYF A;  2K3Y A;  3CCV Q;  1WJQ A;  2JS0 A;  4B6M A;  3JCM g;  3GP8 A;  5GAN h;  1UUE A;  1KK7 A;  2EBP A;  3DLL A;  2LCC A;  2RK1 A;  3A8H B;  2YLB A;  1M3C A;  1UEB A;  4FT2 A;  3G4S T;  3QYG B;  4XTV A;  1M1K U;  5DM7 R;  3CC4 Q;  1N9S A;  2QTX A;  3HKS A;  4M78 B;  4OF1 A;  2RQV A;  3G7Z A;  3VS5 A;  4ZGJ B;  1I8F A;  1MGQ A;  4FYY B;  3CCL A;  4RUG A;  2E5K A;  2A7Y A;  3R6O A;  1K4U S;  2LMJ A;  2J6O A;  4M78 A;  4JLI A;  1OX8 A;  2XI9 A;  1TOV A;  4PJO D;  1OQK A;  4N4I A;  4AG1 C;  3TCJ A;  3M9Q A;  2E6N A;  3GPL A;  4M7A C;  2KK4 A;  2F2X A;  2XID A;  1G5V A;  3SWN B;  1Q82 R;  3MJX A;  4M75 F;  1TH7 A;  5KCH A;  3E19 A;  3MEW A;  2L3S A;  2FYK A;  4F7U G;  4YTL A;  4OB3 B;  3SWN A;  3JCM P;  4NL3 A;  2HEQ A;  3X20 B;  2YSQ A;  3REA B;  4MMK A;  2EQI A;  2KVQ G;  4C8Q D;  4RTX A;  4E7S A;  1X6B A;  3VS1 A;  3TEE A;  3RKW A;  3H0H A;  4PJO E;  4FCY A;  1V76 A;  4F17 A;  1PKS A;  1G3W A;  1WI7 A;  1ZSG A;  4VUB A;  4DBR A;  1WIE A;  2HQE A;  2YDL A;  1M1K C;  4BAC A;  2QQA A;  3EGU A;  2E70 A;  2I0N A;  4CI0 C;  1O9S A;  4QKU A;  3RMQ A;  4J9B A;  1VQO Q;  2HAX A;  3HTR A;  4C8Q E;  5LJ5 j;  3GLX A;  3OYL A;  1VQN A;  3GNF B;  2COW A;  1TG0 A;  2JMA A;  4RG2 A;  2NYS A;  1M90 U;  1RAF B;  4DBF A;  2A3L A;  5GAM f;  4RCC A;  3KBG A;  1WXB A;  4BE1 A;  3H0F A;  4J6X A;  3CC2 A;  3I55 Q;  5FRO A;  3UPU A;  2X4Y A;  4M7A D;  2X3X D;  1VQL Q;  3ME9 A;  3FB9 A;  3M54 A;  4HKE A;  4FW2 A;  5FWC A;  5GAN 4;  1MMN A;  4KBM B;  4OMM A;  1VQK Q;  2MK5 A;  1BYM A;  5GAN e;  2VKN A;  2DER A;  1JB0 E;  1YJN Q;  1K9A A;  1SRL A;  2QQB A;  1Q81 R;  1WNL A;  5LJ5 h;  1YHQ T;  4M7A E;  4QQ6 A;  3D7S B;  2LQK A;  2K6D A;  2YRV A;  5KYY B;  1PNJ A;  3VU3 C;  1B07 A;  4GY5 A;  2OTL A;  1VQ8 Q;  1B34 B;  5KYY A;  4BDY A;  2OTJ Q;  3CC7 Q;  2XDP A;  4AMC A;  2O4X B;  3CCS Q;  2M1H A;  1RI0 A;  5HKC A;  1B34 A;  2QAS A;  4LNP A;  3V7C A;  4AFZ C;  2DLP A;  5KE2 A;  1JXM A;  1W6X A;  2E3I A;  3DLM A;  2O4X A;  1UDL A;  2V8K A;  5GMK j;  2CP3 A;  3VYG A;  1BI1 A;  1HK9 A;  3X25 B;  3G71 Q;  5GMK m;  3LX7 A;  1Q7Y R;  1G3S A;  2P84 A;  2EKH A;  4IUV A;  4PJO F;  2ZGW A;  1GBQ A;  2OX7 A;  5DY9 A;  4PFZ A;  2LJ3 A;  3UWN A;  5L23 A;  3L42 A;  3RUX A;  1VYV A;  1MV3 A;  4JRK A;  4XU1 A;  3E9F A;  3PNW C;  3BW1 A;  2F2W A;  4C8Q F;  2RJD A;  1OV3 A;  3LWI A;  1U06 A;  2DL5 A;  1JJ2 A;  2RO0 A;  5KYW B;  3LGF A;  5GAM d;  1P92 A;  2OI3 A;  4Y28 E;  1VQ7 Q;  2LRQ A;  1AD5 A;  5J26 A;  3I5S A;  3QWY A;  4EIK A;  4EMK B;  4OMF B;  1LOJ A;  4ELZ C;  5GMK h;  2DXC A;  4QT7 A;  1VQ5 Q;  5KYW A;  1BI2 A;  3CCQ A;  2X4X A;  2XD0 A;  2OTL T;  4LE9 A;  4EMK A;  2EJ9 A;  1M9S A;  2MAM A;  1H64 1;  2RHY A;  5GAN g;  2RD1 A;  2O88 A;  1GCP A;  5GAO l;  2DRM A;  3QG1 A;  1Q81 C;  2OJ2 A;  1QVF P;  4ZTF A;  1GCQ A;  5CVI A;  3URG A;  3A8L B;  2FL7 A;  2DBK A;  1VIF A;  4OB2 B;  1UFF A;  2RA2 A;  3PIO A;  3V8L A;  4MZP A;  3ZEH A;  1R0B G;  2YUN A;  2J6F A;  1IRE B;  2XDB A;  3CC4 T;  3GIB A;  4PJM A;  1VQM Q;  3L2R A;  1ZA2 B;  2RJE A;  4M7A F;  2L5Q A;  4JRP A;  2NUP B;  2D0Q B;  2PUK B;  3VV0 A;  3HSB A;  1NG2 A;  1XNI A;  2B86 A;  1JXO A;  2QEX Q;  4F16 A;  3WVD B;  4O5V A;  2HSP A;  4QQD A;  2ROT A;  2NUP A;  2GNC A;  2RH2 A;  4JDS A;  1TXQ A;  4KT0 E;  1Q86 R;  2LZ6 B;  3FRN A;  4F7U F;  3DKM A;  2EYZ A;  3ZBD A;  4PJJ A;  3CCM A;  3JCM V;  4LDV A;  3HRS A;  2R57 A;  1UHF A;  3EFR A;  3JCM c;  3S3O A;  3JCM f;  2L3Q A;  2BZ8 A;  1N5Z A;  1U5S A;  2HL5 C;  4A4K A;  4JJD A;  1NBE B;  3PTA A;  4KH0 B;  3UF4 A;  2K3B A;  3Q1J A;  1OOT A;  3SHW A;  1QVG A;  4NOY A;  1PRL C;  2RHI A;  3TSZ A;  1KC8 C;  1IB8 A;  1I5O B;  3RBB B;  1NLP C;  3CCR A;  2JMC A;  2DX1 A;  3QBY A;  4PJO B;  4E6R A;  5M9O A;  4QQG A;  2H8H A;  4M7D G;  2QA4 A;  2CKK A;  2MWP A;  2ZZD A;  2LNH B;  1ZUK A;  4PJO A;  3EGD B;  3M0Q A;  1AWW A;  5GMK e;  3EG3 A;  4M7D C;  3OQ5 A;  5FLX E;  2VXF A;  3ZL7 C;  1AWO A;  2XIC A;  5D6X A;  4C8Q B;  1MMG A;  5LJ3 j;  3A8M B;  3EGD A;  4LDY A;  3CCJ A;  1PRM C;  2ZPG B;  3PFS A;  2HBP A;  3OYN A;  1PSE A;  4F04 B;  3BDU A;  4M77 C;  4C8Q A;  4DBQ A;  3JB9 G;  2HCK A;  1C6V X;  1WJR A;  3T9N A;  3V8K A;  2KGT A;  3LH5 A;  1F1B B;  2AHJ B;  5IAY A;  1YJN T;  3P8H A;  5LJ5 g;  2QQR A;  3CCM T;  2EIF A;  3OSV A;  3OY9 A;  4KH1 B;  1YP5 A;  1RI9 A;  3FLG A;  2LX9 A;  4CC7 A;  4MZT A;  3QWX X;  4ZNX A;  1UE9 A;  2KMT A;  2PTK A;  4OMP A;  4OMN A;  1PD0 A;  2YRC A;  3C12 A;  3TU4 K;  2GCX A;  1WJS A;  3E9G A;  3VS0 A;  1SEM A;  1Q86 C;  5A0G A;  2PVG B;  1QVF S;  1OX9 A;  5GAN 8;  1KQ2 A;  3MKD A;  4NL2 A;  4OP0 A;  2EQK A;  1FMW A;  3EG0 A;  2DEU A;  3CC7 T;  3UDC A;  2RI5 A;  4M7A B;  5LJ3 h;  4KGX B;  1AWJ A;  1MHN A;  2VAS A;  3CCL Q;  2DXT A;  4M7A A;  1NEG A;  2FEI A;  4LXC A;  4AFU C;  4PLI A;  4XQ3 A;  2LC4 A;  2CP0 A;  3G71 T;  5KCO A;  2QYZ A;  3JCM d;  4Y91 A;  3OA6 A;  2K5I A;  1K8A U;  3C94 A;  4XAX B;  4F7U B;  2DXU A;  5HK3 A;  3VS2 A;  1Z9Z A;  3QZ9 B;  2X3W D;  3HRT A;  4M77 D;  1U3O A;  2LNV A;  3OW2 P;  2QTV A;  4KRT A;  1YIJ A;  2RB6 A;  2RNA A;  4F7U A;  4M75 D;  4Z88 A;  1M2O A;  4RMO A;  1UGQ B;  4JS5 A;  1YIT A;  1S72 A;  2LTO A;  4AFQ C;  1G2B A;  4ZN1 A;  4ZTJ A;  1HJD A;  1JQQ A;  1OYX A;  1PM3 A;  1MUZ A;  3HL8 A;  2CP6 A;  1RUW A;  4E7L A;  2M0O A;  1WX6 A;  2RHU A;  2CGH A;  3CD6 T;  2H3J A;  1UEC A;  3L1A A;  4C0F A;  2LX7 A;  4GBQ A;  4M77 E;  2EGA A;  1AZG B;  4N0A C;  4ANJ A;  3VUB A;  1KQS A;  4M75 E;  1VQ5 T;  1AVZ C;  7AT1 B;  3CME A;  3CXC P;  1VQN Q;  2AK5 A;  3TRE A;  2RK2 A;  1YN8 A;  3FC3 A;  4Z8A A;  1OU8 A;  2K2M A;  3LYI A;  4ESR A;  4GLK A;  1IHV A;  4DEY A;  1KD1 R;  3CC2 Q;  3OYM A;  4PFP A;  3E2U A;  4J9I A;  1VQM T;  1X6G A;  3L2Z A;  2EJF A;  3VS4 A;  2ENM A;  2HBW A;  5IN1 A;  1UJY A;  3PE0 A;  5LL6 S;  3BE3 A;  1YIJ T;  3OYD A;  1X01 A;  2QEX T;  1LPL A;  1C1A A;  5HY6 A;  1RAI B;  2L8D A;  4WF2 A;  1RAB B;  1IHW A;  3TVT A;  3GOX A;  2EGC A;  2SRC A;  4KUI A;  1SSF A;  1XOV A;  3H6Z A;  3V7R A;  5HCK A;  1QW1 A;  2X4J A;  3I5R A;  2OTL Q;  3MPU B;  2DVJ A;  1I1J A;  3LH0 A;  4EPC A;  4Q5W A;  1XJW B;  2EJG A;  4DOV A;  2NWM A;  2GTJ A;  2VGN A;  1LVK A;  2J06 A;  2DKG A;  4B9X A;  4EMH A;  2WSE E;  4CRI A;  4HVW A;  4KGZ B;  4EMG A;  1SHG A;  2JXB A;  1W2B A;  4BB7 A;  3PMI A;  1X43 A;  1YJ9 A;  4BE0 A;  3A5Z B;  4RKU E;  5DLO A;  2OAW A;  4M7D F;  2QG9 B;  4LDU A;  2HD0 A;  5C6S A;  1YNZ A;  1RAG B;  5IHK A;  2DAQ A;  2LCS A;  3PVL A;  5C0M A;  3GNG A;  1NJI C;  1SHF A;  1W4S A;  3OBY A;  1VQ9 A;  1WXT A;  1FXX A;  3OW2 S;  3EG9 B;  4FYX B;  4M77 F;  4BDZ A;  3VRY A;  3QUI A;  1J3T A;  1YI2 T;  2X35 A;  5CR2 A;  3EHR A;  1Y57 A;  1EX4 A;  2CP5 A;  4A53 A;  1VQ6 A;  2EGE A;  3EG9 A;  2L89 A;  3I56 A;  3RNJ A;  2PZ1 A;  2KXD A;  1KD1 C;  2E41 A;  2A08 A;  2JM8 A;  1D0Y A;  2PU9 B;  3WXM B;  4HXJ A;  3U23 A;  3ASK A;  1RLQ C;  4OGE A;  3ZFJ A;  4M4Z A;  2EFI A;  1BB9 A;  1M90 R;  2E65 A;  4LDX A;  5GAN 5;  2O01 E;  2HNI A;  4PJN A;  4OMQ A;  2M9U A;  3CXC S;  3CBP A;  4ATO A;  2VYT A;  2ZPI B;  2EW3 A;  3MP1 A;  4OMO A;  4HA8 A;  1YBY A;  3S3M A;  2CS7 A;  2DYB A;  3EAE A;  5GAO q;  5GAM j;  2LQ8 A;  4D8D A;  2YHT A;  1K73 R;  1IXD A;  5LJ3 g;  3V8J A;  2AZV A;  3QPH A;  2GGR A;  2KRO A;  1VOM A;  4HCK A;  1YJW A;  3J80 E;  3OYJ A;  4J7I A;  2ECZ A;  3M0U A;  2YWW A;  3O8V A;  2DJQ A;  4R56 A;  3CCL T;  3G6E A;  3C0C A;  3CXC A;  5GAN d;  3CPF A;  2LT4 A;  2Y90 A;  4HVV A;  2L3P A;  5CKE A;  1S1N A;  3QDR B;  2VXE A;  1HSQ A;  3OS2 A;  2NLU A;  3JB9 H;  1JU5 C;  5LJ5 f;  2DET A;  2LDM A;  3I56 T;  2R58 A;  2CP2 A;  3L2V A;  5CAI A;  3CCM Q;  4JJB A;  1ZSZ C;  3GBQ A;  1WFW A;  1N27 A;  3DB4 A;  3BY7 A;  3OS0 A;  1XQH A;  2RQW A;  1D0X A;  2BIV A;  1LNX A;  5KE3 A;  1WHL A;  1BI0 A;  1BCM A;  1FYN A;  3H8Z A;  1OU9 A;  3QXE B;  2FPE A;  2GQV A;  4B9W A;  1O75 A;  1SPK A;  4LDW A;  1BIB A;  2PUO B;  1BIA A;  3CMA A;  1NEB A;  1UG1 A;  2DIG A;  2RI2 A;  3OYG A;  1Q82 C;  2C06 A;  1FMV A;  1WQW A;  5CQX A;  1OPL A;  2CDT A;  2XU8 A;  2YUQ A;  4PJL A;  2DXB A;  5IHI A;  2E12 A;  3VKI A;  4E7K A;  2DL4 A;  2MOX A;  3E1S A;  2KXC A;  1AEY A;  5KH6 A;  4F7U E;  2JTF A;  3HHT B;  5CKD A;  5FRM A;  1VQN T;  1JEG A;  4E7I A;  1GFD A;  2QA4 Q;  2DTH A;  1YJW T;  1K9M R;  4D8K A;  2ZPE B;  1AOJ A;  4M77 B;  1QP3 A;  3HP9 A;  2ED1 A;  3MHX A;  3CCV A;  4M75 B;  1Q81 U;  2L3R A;  3CC2 T;  1WHK A;  4BI8 B;  2LQW A;  5D6W A;  4M77 A;  1E6G A;  3QII A;  5I11 A;  3CCU A;  3CCJ Q;  4X9D A;  4CC2 A;  1K73 C;  4M75 A;  5D7U A;  2LJ0 A;  3RER A;  4ZN3 A;  1PC0 A;  4JS4 A;  1PCX A;  1B3Q A;  2X4W A;  1RAC B;  1KG1 A;  2E6Z A;  1TTH B;  4J6Y A;  1ZBX A;  3CD6 Q;  1QCO A;  4DBH A;  1UGV A;  2QK0 A;  1WGS A;  5FRN A;  5IH2 A;  1I07 A;  3LGL A;  4AT1 B;  4HCC A;  2DL7 A;  2OAU A;  2GFA A;  3UA7 A;  3CMA T;  2A36 A;  2ZPF B;  4CC3 A;  3V7S A;  2E64 A;  3I9Q A;  5LJ5 d;  2QQ9 A;  1FMK A;  3UT1 A;  2CZ1 B;  3RDV A;  1TSF A;  4JZ4 A;  2YRD A;  1QP2 A;  5I2M A;  2IVW A;  3KXT A;  1Q95 G;  1TUD A;  4N4H A;  1PD1 A;  2O31 A;  4BY6 C;  1R77 A;  5GAM e;  4J9F A;  3S3N A;  2H3E B;  3JRZ A;  2KI7 A;  1GXI E;  3M55 A;  4XTZ A;  3RMS A;  1RL2 A;  4OGC A;  2MIO A;  4IIO A;  1KC8 U;  4C5I A;  1TUC A;  3CCU T;  2YUP A;  1YIJ Q;  1BU1 A;  2K2V A;  4BI4 A;  2KYB A;  2L2P A;  1KFZ A;  3A1P A;  4HCZ A;  2JTE A;  4KUL A;  2BE7 D;  1I81 A;  3OSS C;  1YIT Q;  1K9M C;  3CBO A;  1S72 Q;  4BE2 A;  2JUF A;  2MPX C;  2YXY A;  1Q7Y C;  2DZC A;  2COY A;  4N0A A;  5I22 A;  4IUU A;  4FYW B;  2M02 A;  1KQ1 A;  4Z02 A;  4PNO A;  1M2V B;  3HRU A;  1WHH A;  3CCQ T;  3M57 A;  1RAE B;  2QGG A;  2FZC B;  3QDF A;  1UGP B;  1M2V A;  2D6F A;  2DTI A;  1PHT A;  1X27 A;  3INZ A;  5GJW B;  4J9E A;  3M0T A;  2CSQ A;  2NUT B;  1B7T A;  1A0N B;  3QYH B;  1M30 A;  1Q86 U;  3SEM A;  2L0A A;  4BI3 A;  2NUT A;  4MDX A;  4OVA A;  3M56 A;  1IO6 A;  1QWF A;  2OTJ A;  4MML A;  3CPW P;  1WDX A;  2LJ1 A;  3TSW A;  1YI2 Q;  1X2Q A;  2GBQ A;  2K7A A;  1VYU A;  2CH4 A;  3EHQ A;  5I21 A;  2DO3 A;  4C92 G;  1N6A A;  3OYB A;  4C0D C;  1R8O B;  3FJ5 A;  1Z9Q A;  2PVO B;  2LQN A;  1H3Z A;  4XTU A;  5ECA A;  4L6V 5;  2EPD A;  3M58 A;  1H3H A;  2YLC A;  2P4R A;  1NZ9 A;  1ZX6 A;  2QGF B;  4C92 C;  2MWO A;  3UA6 A;  3EH1 A;  1SRM A;  4ELY C;  2EYY A;  4JPB W;  2CH4 W;  4JJC A;  2EYX A;  4L59 A;  3QJ6 A;  2KR3 A;  1FWZ A;  2CT3 A;  4XTW A;  1GBR A;  1WXU A;  2IG0 A;  1M3A A;  2DF6 A;  2JVV A;  4QVZ A;  4FU6 A;  2RN8 A;  2CP7 A;  3H0I A;  3VJP A;  5IHN A;  1YJ9 Q;  3NMZ C;  2DL8 A;  2KE9 A;  3M59 A;  3CCR T;  2D8J A;  2QA4 T;  5IXB A;  1UGR B;  5GAN 6;  1JO8 A;  4M7D D;  1ZA1 B;  4J9D A;  5CKF A;  1KHC A;  1VQ9 Q;  1G8X A;  1VUB A;  3EG2 A;  3OBW A;  3CCE A;  4FW1 A;  2RI3 A;  5CK9 A;  3OMG A;  2K5L A;  2EVR A;  5GMK l;  1QVF A;  1VQ6 Q;  2G3R A;  1VIE A;  4FYV B;  3NPF A;  3JB9 I;  2DVE A;  3I56 Q;  3CCJ T;  3QHS A;  2A37 A;  4NS5 A;  2RJC A;  3QJY A;  1VQ4 A;  2Y4Y A;  3LWH A;  2VV5 A;  4XTX A;  3G1J A;  1GCQ C;  2Y4X A;  5D6Y A;  3EG1 A;  4C92 D;  4M7D E;  3BFM A;  1D0Z A;  3JB9 D;  2ATC B;  3M0S A;  2O9S A;  4II1 A;  4XU3 A;  2VC8 A;  4JJN K;  2CZ0 B;  2XHC A;  1X6O A;  3JCM e;  1OUL A;  2MF2 A;  4C0G A;  2V1Q A;  1WHM A;  2XMF A;  2DIL A;  2JT4 A;  1W70 A;  2JN0 A;  3GF5 A;  2DA9 A;  3UAT A;  4A4G A;  1WPY A;  2A28 A;  3LW5 E;  2D9T A;  1AWX A;  3H9N A;  1ABQ A;  1YJW Q;  2LP5 A;  4X34 A;  3OYH A;  1RAA B;  4F14 A;  3CQT A;  1X2K A;  4KGV B;  5AYF A;  2XG8 D;  3CPW S;  4JRQ A;  1ZSZ B;  1U1S A;  2ZAE A;  3PT9 A;  1AHJ B;  4WTO B;  2D8H A;  1EZZ B;  2EQJ A;  4A4H A;  2DFU A;  3G4S A;  3VS6 A;  3CCE T;  1YWP A;  1ZSZ A;  2A0F B;  1N8R R;  5LJ3 d;  2NUZ A;  3C4S A;  2M51 A;  8AT1 B;  3F70 A;  9ATC B;  1QKW A;  4FIB A;  1K76 A;  1CSK A;  2PVD B;  2DBM A;  5EG2 A;  2FG0 A;  2HZY A;  1NJI U;  4FSS A;  3L2U A;  4PJO G;  1YIT T;  2DTO A;  1S72 T;  2RQU A;  2HMA A;  2RJF A;  2O2O A;  2RM4 A;  3MEU A;  1M1K R;  5A2Q E;  1TS9 A;  4DQ2 A;  3CMA Q;  2P0Q A;  4ME7 A;  8ATC B;  1KD1 U;  5GAN f;  1SSH A;  1OEB A;  3NHN A;  4C8Q G;  3RKX A;  1QQJ A;  4DOW A;  2MI6 A;  1YCS B;  1PSF A;  1MMA A;  4DEX A;  2BTT A;  2EQM A;  3N5B B;  1X75 C;  3CME T;  2V8J A;  4WCI A;  3MCA B;  2JTM A;  2VVK A;  5L8R E;  2KEA A;  2DRK A;  4AFS C;  2KQW A;  2KT8 A;  2GF7 A;  5GAO m;  1UJ0 A;  1U8R A;  3JAM E;  1UHC A;  3J7A F;  3A8O B;  2MCN A;  1RAH B;  5FU7 C;  1KHI A;  1WA7 A;  3CCU Q;  2VB6 A;  3KUF A;  3A8G B;  1HD3 A;  1T3L A;  4ORZ A;  1H92 A;  3M5A A;  3RES A;  1KIK A;  2RMO A;  1UTI A;  2K79 A;  3M0R A;  2RHZ A;  1PWT A;  4OB1 B;  1VYT A;  2KT1 A;  2F1L A;  4HT8 A;  3MET A;  2CZ6 B;  2WSF E;  2JJ9 A;  2M0Y A;  3S6W A;  3JCM J;  2G6F X;  4C92 F;  2DNU A;  4M7A G;  1BI3 A;  3EGX B;  2CZ7 B;  1M5Q 1;  1HXD A;  4PK4 A;  3DB3 A;  1QLY A;  3NFC A;  3JB9 F;  3OMC A;  1JJ2 P;  2K3X A;  2HKN A;  2K4Y A;  4IUR A;  1MNE A;  4C5H A;  2KYM A;  4PFO A;  3OS1 A;  1YFN A;  4L5G A;  3EGX A;  2IIM A;  2F5K A;  3JCM X;  3X26 B;  2MMP A;  1HYO A;  1M27 C;  1N8R C;  3CCQ Q;  4IUQ A;  4BY6 B;  3OW2 A;  3PVQ A;  4X9C A;  3OYC A;  2RF0 A;  4XTY A;  2COZ A;  1W1F A;  1V1C A;  2DL3 A;  3JCM Q;  5CKB A;  5A0L A;  3SD4 A;  2R5M A;  5AT1 B;  1YHQ A;  3R6N A;  1VQP A;  2EWN A;  2C0O A;  2I2L A;  1ZBJ A;  1Q82 U;  2FRY A;  1YJ9 T;  4RTZ A;  5FU6 C;  3MP8 A;  2DJZ A;  2JW4 A;  4PKC C;  4E7Z A;  4HCB A;  1D1A A;  3HPW A;  1V29 B;  5HK0 A;  1VQ9 T;  2FB7 A;  1NE8 A;  1KSW A;  3SFM A;  4E2F B;  3M0P A;  4ZGE B;  4OML A;  1K0X A;  1VQ6 T;  2C0T A;  1D1C A;  3O5Z A;  5FWB A;  2HSE B;  2E5Q A;  1IRX A;  2BUD A;  1WQ7 A;  3J81 E;  2F69 A;  3CBM A;  4QVD A;  1YWO A;  1LJO A;  3OS5 A;  2HQX A;  3MEA A;  1I5L A;  1UB4 A;  2M16 A;  5GAM h;  1K73 U;  2FPF A;  5KYX B;  2P4T A;  3PMT A;  2CT4 A;  2CSI A;  1RAD B;  3NTK A;  2XKO C;  1D1B A;  2GFU A;  2C0I A;  5KYX A;  2KDS A;  2CRE A;  2CUB A;  4KUD K;  2VUB A;  1E6H A;  4PLL A;  4RTU A;  3QSU A;  1Y0M A;  1Y7X A;  1D3B B;  5CQY A;  2EYW A;  2SEM A;  1QVG P;  2DIQ A;  2RQR A;  4XK8 E;  4M7D B;  1VQP T;  3MP6 A;  1TWB A;  3TQ7 P;  3CCR Q;  2BZY A;  1D3B A;  4FSX A;  2BZX A;  4M7D A;  1DJ7 B;  1KJW A;  1RLP C;  1M90 C;  2DM1 A;  2QDY B;  1ZHI A;  4C0D B;  1T3S A;  2FZG B;  1C0M A;  3HFO A;  3G6E T;  2J05 A;  1ZUY A;  4C92 B;  5CO7 A;  2EYQ A;  2W0Z A;  2V1R A;  4Y92 A;  4HT9 A;  3CC4 A;  4C92 A;  2J6K A;  1JJ2 S;  4K11 A;  2WAC A;  3EH2 A;  1AZE A;  1M3B A;  1XTD A;  2BE9 B;  2IPO B;  2J7I A;  2RPN A;  4M78 G;  2JM9 A;  1I4K 1;  1T0J A;  3KFV A;  3HFN A;  2E1H A;  4J83 A;  2MYS A;  4M78 C;  2EKO A;  1K9M U;  2AKK A;  6AT1 B;  2BKD N;  1BBZ A;  5GAN 3;  1Q7Y U;  3ULR B;  2JOY A;  4N4G A;  5CCA A;  1WHG A;  4BUG A;  1KC8 R;  3C95 A;  4UC4 A;  4P5N A;  5I2S A;  2KRM A;  4FT4 A;  3OYK A;  2DE0 X;  4J9H A;  1FX7 A;  1NPP A;  1WYX A;  3SWN C;  2AZS A;  2JZ2 A;  5IT9 E;  3IQL A;  5FW9 A;  2CUD A;  5CIU A;  1SF9 A;  1QMC A;  2ESW A;  3JCM W;  3X24 B;  3CCV T;  2V8I A;  5GAO p;  3CCE Q;  2RHX A;  1VQO A;  2QQS A;  2KSS A;  1JRI A;  5GAN 7;  1ARK A;  4IUP A;  5CKH A;  2DEQ A;  1VQ4 Q;  3AT1 B;  5LJ5 e;  2D1X A;  2ABL A;  3NGP A;  2JS2 A;  1EFN A;  4IIM A;  1JBM A;  2HQH A;  1VA7 A;  2HL3 A;  4IUT A;  4LUD A;  2ED0 A;  5KYU B;  5GAO r;  1TU0 B;  1CKB A;  3BDL A;  3I55 A;  2K5F A;  3VYH B;  1VQL A;  4M78 D;  1YCY A;  4DA4 A;  5KYU A;  3FDR A;  1ZQ1 A;  2ZCF B;  3FIF A;  5J3B A;  2LT1 A;  2LCL A;  1KQS P;  1EIF A;  1VQK A;  4C5G A;  4PL6 A;  1AT1 B;  1QVG S;  3I35 A;  2YT6 A;  3CME Q;  1YJN A;  2FHD A;  1UGS B;  4J6W A;  1ZUU A;  4LD6 A;  3FEO A;  1M1G A;  2GTO A;  4RTV A;  3MO8 A;  2K57 A;  1M8V A;  2ROL A;  2W10 A;  3M4Y A;  2XDD A;  4RTY A;  4BD3 A;  4M78 E;  1I0C A;  2QAZ A;  1SG5 A;  3OB9 A;  2LVM A;  3AHU A;  4JRI A;  1ABO A;  4JZ3 A;  4C5E A;  5GAO n;  1OPK A;  2XK0 A;  4J9C A;  1T0H A;  1VQ8 A;  3G4S Q;  3JCM h;  3CC7 A;  2K9G A;  5KYN A;  3M53 A;  3CCS A;  1VQO T;  2B8A A;  3VRZ A;  2GQI A;  2CYZ B;  4HVU A;  2AT1 B;  3WVE B;  4A63 B;  4AG2 C;  1QCN A;  5GMK i;  3RKY A;  3NTI A;  2KRN A;  3VS7 A;  1GFC A;  4LUE A;  2Z0W A;  2FPD A;  3G71 A;  4RTW A;  4RCB A;  3L2W A;  5GAM g;  4M77 G;  3I55 T;  2P0K A;  5A0D A;  5J39 A;  2PNI A;  1VQL T;  4XU0 A;  2KAF A;  3REB B;  4A54 A;  4M75 G;  2KRS A;  3H41 A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  2PQW A;  4FIB A;  3CCQ A;  2PVD B;  2X4X A;  5EG2 A;  2XD0 A;  1VQK T;  2OTL T;  4J7I A;  4EMK A;  2EJ9 A;  4OB0 B;  3O8V A;  1NJI U;  4R56 A;  1M9S A;  2MAM A;  4XU2 A;  2DK3 A;  4M75 C;  3CCL T;  1H64 1;  5LJ3 f;  2RHY A;  5FU7 B;  5GAN g;  2RD1 A;  4PJO G;  3L2U A;  3G6E A;  2DTO A;  1YIT T;  1S72 T;  2ZPH B;  3CXC A;  5GAN d;  3CPF A;  2LT4 A;  5GAO l;  3QG1 A;  1Q81 C;  3OYA A;  2Y90 A;  5CKE A;  2RJF A;  3CD6 A;  4E47 A;  4ZTF A;  2EQU A;  2RM4 A;  3QDR B;  3MEU A;  5CVI A;  2VXE A;  3A8L B;  4JLG A;  3URG A;  2FL7 A;  5A2Q E;  1IZ6 A;  1VIF A;  2WSC E;  4OB2 B;  3PIO A;  2NLU A;  2RA2 A;  3V8L A;  4DQ2 A;  4J5Y A;  4MZP A;  1VQ7 A;  2P0Q A;  3ZEH A;  3JB9 H;  4ME7 A;  1KD1 U;  5GAN f;  1IRE B;  5LJ5 f;  4D6W A;  1VQ5 A;  3CC4 T;  2XDB A;  4MDW A;  3OS2 A;  3GIB A;  2LDM A;  2P0P A;  3RKX A;  2R58 A;  4C8Q G;  3I56 T;  3L2R A;  4DOW A;  3L2V A;  2MI6 A;  2E10 A;  2RJE A;  5CAI A;  1PSF A;  3OYI A;  4M7A F;  1VQ8 T;  1N27 A;  3DB4 A;  3BY7 A;  2EQM A;  3OS0 A;  3N5B B;  1X75 C;  1OZ2 A;  2L5Q A;  1XQH A;  3CME T;  2V8J A;  4JRP A;  2D0Q B;  2PUK B;  3VV0 A;  2OTJ T;  3MCA B;  3P8D A;  2BIV A;  1LNX A;  2JTM A;  3HSB A;  4O6J A;  1XNI A;  2F5T X;  5L8R E;  5KE3 A;  3CCS T;  1BI0 A;  3WVD B;  5GAN 2;  4EMK C;  3P8B B;  1Y96 B;  2KQW A;  3H8Z A;  4O5V A;  4QQD A;  3QXE B;  1G5V A;  2GQV A;  3QO3 A;  4B9W A;  1O75 A;  2FVU A;  2GF7 A;  3SDZ A;  2RH2 A;  4JDS A;  1BIB A;  4LDW A;  4ZGD B;  5GAO m;  1U8R A;  2PUO B;  1BIA A;  3CMA A;  2DIG A;  2RI2 A;  1Q82 C;  3OYG A;  4KT0 E;  4LD9 K;  3JAM E;  2C06 A;  1NPR A;  1WQW A;  5CQX A;  1QVP A;  3J7A F;  1G3Y A;  2XU8 A;  3FRN A;  1Y96 A;  4F7U F;  3A8O B;  3DKM A;  2DXB A;  2E12 A;  3VKI A;  4E7K A;  2R5A A;  5FU7 C;  1KHI A;  1VQM A;  3E1S A;  3ZBD A;  3CCM A;  5KH6 A;  3JCM V;  3LLR A;  4F7U E;  4M78 F;  2JTF A;  3KUF A;  4A4E A;  3HHT B;  3A8G B;  4LDV A;  3HRS A;  3JSC A;  5CKD A;  2R57 A;  3M5A A;  5FRM A;  1VQN T;  3RES A;  4E7H A;  3EFR A;  1M4Z A;  3JCM c;  1KQS S;  2RHZ A;  4E7I A;  4OB1 B;  2QEX A;  4HT8 A;  2DTH A;  3S3O A;  1YJW T;  3MET A;  3JCM f;  2CZ6 B;  2QXF A;  2WSF E;  3OYY A;  3JCM J;  3S6W A;  2ZPE B;  4V2S A;  4A4K A;  4M77 B;  5FU6 B;  3VUZ A;  4C92 F;  4M7A G;  1BI3 A;  2DD5 A;  1QP3 A;  2CZ7 B;  1M5Q 1;  3HP9 A;  1HXD A;  3MHX A;  4J7F A;  3DB3 A;  3NFC A;  4FL6 A;  3JB9 F;  3OMC A;  3CCV A;  2DD4 A;  2K3X A;  4M75 B;  2L3R A;  1Q81 U;  2K4Y A;  3CC2 T;  4IUR A;  3Q1J A;  4C5H A;  4C92 E;  2DZ9 A;  3M4G A;  4BI8 B;  5D6W A;  4M77 A;  3OS1 A;  3QII A;  4L5G A;  1QVG A;  3PGG A;  4NOY A;  3CCU A;  2RHI A;  2F5K A;  4X9D A;  2DPP B;  3JCM X;  4R55 A;  1KC8 C;  4IKF A;  1K73 C;  3X26 B;  4M75 A;  3ER0 A;  4M7A C;  2MMP A;  3RER A;  4A4F A;  3NTH A;  4J8O A;  1N8R C;  4ZN3 A;  4QVC A;  3CCR A;  1VQ7 T;  4PJO B;  3QBY A;  5DLQ E;  5M9O A;  4IUQ A;  4QQG A;  3EFS A;  4BY6 B;  3OW2 A;  4X9C A;  4JS4 A;  4M7D G;  2QA4 A;  2CKK A;  3OYC A;  4XTY A;  3X28 B;  2MWP A;  4TVR A;  2X4W A;  3JCM Q;  5CKB A;  1KG1 A;  5A0L A;  3SD4 A;  2ZZD A;  3FJP A;  2E6Z A;  2R5M A;  4PJO A;  1YHQ A;  5GMK e;  4E7J A;  4J6Y A;  1ZBX A;  4M7D C;  4EDU A;  2ZPB B;  3OQ5 A;  5FLX E;  1VQP A;  2EWN A;  2VXF A;  1OI1 A;  2QI2 A;  2XIC A;  1Y71 A;  5D6X A;  1M1F A;  1WGS A;  1U1T A;  4C8Q B;  2I2L A;  5LJ3 j;  1K8A C;  2KY9 A;  1G3T A;  3A8M B;  3PTA A;  5FRN A;  4MZM A;  4LDY A;  1Q82 U;  3LGL A;  3MEV A;  3CCJ A;  4C0Z A;  3SB2 A;  2ZPG B;  3PFS A;  2HBP A;  4HCC A;  1YJ9 T;  3OYN A;  2OAU A;  1PSE A;  2GFA A;  3CMA T;  3L2Q A;  3BDU A;  4M77 C;  5FU6 C;  4C8Q A;  2VGM A;  1VQ4 T;  3MP8 A;  2ZPF B;  3JB9 G;  2EAY A;  1WJR A;  2DJZ A;  3T9N A;  3V7S A;  3V8K A;  2AHJ B;  5IAY A;  4PKC C;  2E64 A;  1YJN T;  3P8H A;  3QZ5 B;  3OYF A;  5GAN j;  5LJ5 g;  2QQR A;  3CEY A;  3CCM T;  4HCB A;  2EIF A;  3OSV A;  3OY9 A;  5LJ5 d;  3QKJ A;  3HPW A;  3CPW A;  1V29 B;  2QQ9 A;  3UT1 A;  5HK0 A;  2CZ1 B;  1VQ9 T;  1YI2 A;  2FB7 A;  3FLG A;  2LX9 A;  1NE8 A;  1QP2 A;  5I2M A;  2IVW A;  4MZT A;  3SFM A;  3KXT A;  4PJO C;  4N4H A;  2KMT A;  4BY6 C;  4ZGE B;  3C12 A;  5GAM e;  3TU4 K;  2GCX A;  4FM4 B;  1VQ6 T;  3JCM b;  1WJS A;  3E9G A;  4RG8 A;  3RIR A;  3S3N A;  3JRZ A;  5LJ3 e;  1GXI E;  1Q86 C;  3M55 A;  2E5Q A;  4XTZ A;  2BUD A;  1N9R A;  1WQ7 A;  2PVG B;  3RMS A;  5A0G A;  3J81 E;  1W2B S;  1RL2 A;  2F69 A;  4OGC A;  1Y07 A;  3CBM A;  4QVD A;  1QVF S;  5GAN 8;  3OYE A;  1KQ2 A;  1LJO A;  3OS5 A;  2HQX A;  4JUV A;  3MEA A;  1I5L A;  1UB4 A;  4NL2 A;  2M16 A;  5GAM h;  1K73 U;  4C5I A;  1KC8 U;  4OP0 A;  2EQK A;  3CC7 T;  3UDC A;  2RI5 A;  4C8Q C;  3CCU T;  1N8R U;  4M7A B;  5LJ3 h;  2K2V A;  2P4T A;  4BI4 A;  3PMT A;  4QW2 A;  3PIP A;  1MHN A;  3JB9 J;  1OZ3 A;  2JNG A;  3NTK A;  2XKO C;  1BKB A;  2GFU A;  4HCZ A;  4KUL A;  1I81 A;  2DXT A;  3OSS C;  1K9M C;  4M7A A;  3CBO A;  4BE2 A;  2JUF A;  2KDS A;  4PLI A;  4KUD K;  2K3Y A;  4XQ3 A;  2VUB A;  1WJQ A;  4PLL A;  2LC4 A;  3QSU A;  3JCM g;  1Y7X A;  1D3B B;  5CQY A;  5GAN h;  3G71 T;  3GP8 A;  5KCO A;  1Q7Y C;  2DZC A;  3DLL A;  3JCM d;  4N0A A;  4Y91 A;  2LCC A;  2RK1 A;  2DIQ A;  2K5I A;  4IUU A;  3A8H B;  3C94 A;  4XK8 E;  2YLB A;  3OA6 A;  1K8A U;  1VQP T;  3MP6 A;  4XAX B;  1UEB A;  2DXU A;  4F7U B;  1KQ1 A;  4Z02 A;  4FT2 A;  3G4S T;  3QYG B;  4XTV A;  5HK3 A;  1M1K U;  5DM7 R;  1N9S A;  1D3B A;  3QZ9 B;  2QTX A;  3HKS A;  3HRT A;  2LNV A;  4M77 D;  4PNO A;  1YIJ A;  4M78 B;  4FSX A;  2RB6 A;  4M7D A;  4OF1 A;  1DJ7 B;  3G7Z A;  4F7U A;  4ZGJ B;  3HRU A;  1M90 C;  4M75 D;  1I8F A;  1MGQ A;  3CCQ T;  3M57 A;  3CCL A;  2QDY B;  1ZHI A;  2A7Y A;  4C0D B;  3R6O A;  4RMO A;  1UGQ B;  4JS5 A;  1YIT A;  1S72 A;  4M78 A;  2LTO A;  4JLI A;  3HFO A;  1UGP B;  4ZN1 A;  4ZTJ A;  2D6F A;  1OYX A;  2DTI A;  3G6E T;  3INZ A;  3HL8 A;  2XI9 A;  4C92 B;  4PJO D;  4N4I A;  4E7L A;  2M0O A;  3TCJ A;  3M9Q A;  2E6N A;  3GPL A;  2RHU A;  2KK4 A;  2CGH A;  2XID A;  5CO7 A;  3CD6 T;  2EYQ A;  2H3J A;  3SWN B;  3JB9 D;  4M75 F;  1TH7 A;  3L1A A;  4C0F A;  3QYH B;  4M77 E;  5KCH A;  3E19 A;  4HT9 A;  3MEW A;  3CC4 A;  4C92 A;  2FYK A;  1Q86 U;  4N0A C;  1JJ2 S;  2WAC A;  4F7U G;  3VUB A;  1KQS A;  4M75 E;  4OB3 B;  4YTL A;  4BI3 A;  1VQ5 T;  3SWN A;  4MDX A;  3JCM P;  4NL3 A;  1XTD A;  4OVA A;  3X20 B;  3M56 A;  3CME A;  4MMK A;  2OTJ A;  4MML A;  2KVQ G;  4C8Q D;  4M78 G;  3TRE A;  2RK2 A;  1I4K 1;  3TEE A;  3RKW A;  3FC3 A;  4PJO E;  3HFN A;  2E1H A;  1G3W A;  4J83 A;  3LYI A;  4GLK A;  4VUB A;  4M78 C;  2HQE A;  2EKO A;  1K9M U;  1M1K C;  4BAC A;  5I21 A;  2QQA A;  2BKD N;  2DO3 A;  5GAN 3;  4C92 G;  3OYM A;  2E70 A;  1N6A A;  4CI0 C;  3OYB A;  4C0D C;  1R8O B;  1Q7Y U;  2PVO B;  2JOY A;  1H3Z A;  4N4G A;  1O9S A;  4XTU A;  3RMQ A;  5CCA A;  4L6V 5;  1VQM T;  3M58 A;  2HAX A;  4BUG A;  4C8Q E;  5LJ5 j;  2YLC A;  3L2Z A;  3C95 A;  1NZ9 A;  2EJF A;  3GLX A;  3GNF B;  4UC4 A;  4C92 C;  2MWO A;  4P5N A;  5I2S A;  3OYL A;  1VQN A;  4FT4 A;  3OYK A;  1FX7 A;  1NPP A;  4ELY C;  3SWN C;  2JZ2 A;  4RG2 A;  5IN1 A;  5IT9 E;  5LL6 S;  1M90 U;  1YIJ T;  3OYD A;  4L59 A;  1X01 A;  2QEX T;  3QJ6 A;  2A3L A;  5GAM f;  5HY6 A;  4RCC A;  5CIU A;  3KBG A;  2L8D A;  4BE1 A;  1FWZ A;  4J6X A;  4WF2 A;  4XTW A;  3CC2 A;  3JCM W;  5FRO A;  3UPU A;  2X4Y A;  2IG0 A;  3X24 B;  2V8I A;  5GAO p;  3CCV T;  4M7A D;  2JVV A;  2RHX A;  3ME9 A;  3GOX A;  3FB9 A;  3M54 A;  4HKE A;  4QVZ A;  1VQO A;  4FU6 A;  2QQS A;  4KUI A;  2KSS A;  5GAN 4;  1JRI A;  3VJP A;  5GAN 7;  1SSF A;  1XOV A;  4IUP A;  5CKH A;  2DEQ A;  4KBM B;  3H6Z A;  3V7R A;  1QW1 A;  2X4J A;  1BYM A;  5GAN e;  5LJ5 e;  3M59 A;  3CCR T;  4EPC A;  3LH0 A;  1JB0 E;  1JBM A;  4Q5W A;  2QA4 T;  1UGR B;  4IUT A;  2EJG A;  4DOV A;  5GAN 6;  4M7D D;  5GAO r;  5CKF A;  1KHC A;  2VGN A;  2QQB A;  2DKG A;  4B9X A;  4EMH A;  1WNL A;  1VUB A;  2WSE E;  3BDL A;  4CRI A;  5LJ5 h;  1YHQ T;  4M7A E;  3I55 A;  4QQ6 A;  2LQK A;  2K5F A;  3VYH B;  3OBW A;  4EMG A;  3CCE A;  2RI3 A;  1VQL A;  4M78 D;  1YCY A;  4DA4 A;  5CK9 A;  1W2B A;  2YRV A;  2K5L A;  3FDR A;  3OMG A;  1ZQ1 A;  4BB7 A;  5GMK l;  2ZCF B;  1QVF A;  3FIF A;  3PMI A;  5J3B A;  2G3R A;  2LT1 A;  1VIE A;  3VU3 C;  4BE0 A;  1YJ9 A;  3JB9 I;  2DVE A;  2LCL A;  3A5Z B;  3QHS A;  4RKU E;  5DLO A;  3CCJ T;  4NS5 A;  2RJC A;  3QJY A;  1VQ4 A;  2Y4Y A;  4GY5 A;  1EIF A;  1VQK A;  2OTL A;  4M7D F;  4C5G A;  4LDU A;  1B34 B;  2HD0 A;  4PL6 A;  3LWH A;  2VV5 A;  4XTX A;  4BDY A;  2Y4X A;  5D6Y A;  5C6S A;  1QVG S;  1YJN A;  2DAQ A;  2FHD A;  1UGS B;  4C92 D;  2XDP A;  4M7D E;  4J6W A;  3BFM A;  5C0M A;  3GNG A;  2O4X B;  1NJI C;  1W4S A;  3OBY A;  3FEO A;  4LD6 A;  1M1G A;  1RI0 A;  2M1H A;  5HKC A;  4II1 A;  1B34 A;  1VQ9 A;  4XU3 A;  1FXX A;  3V7C A;  3MO8 A;  2K57 A;  3OW2 S;  1M8V A;  4M77 F;  5KE2 A;  3M4Y A;  2VC8 A;  4BD3 A;  2XDD A;  4M78 E;  4JJN K;  4BDZ A;  3QUI A;  2CZ0 B;  2X35 A;  2XHC A;  5CR2 A;  1YI2 T;  3DLM A;  2O4X A;  1X6O A;  2V8K A;  3OB9 A;  5GMK j;  3JCM e;  3VYG A;  2LVM A;  4A53 A;  3AHU A;  2MF2 A;  4JRI A;  1VQ6 A;  4C0G A;  1BI1 A;  1HK9 A;  2L89 A;  3X25 B;  4C5E A;  5GAO n;  3I56 A;  2JN0 A;  2XK0 A;  5GMK m;  3LX7 A;  1KD1 C;  3GF5 A;  2E41 A;  1G3S A;  1VQ8 A;  4IUV A;  1WPY A;  3JCM h;  4A4G A;  3LW5 E;  2PU9 B;  4PJO F;  3CC7 A;  3WXM B;  2D9T A;  3ASK A;  3M53 A;  2ZGW A;  4OGE A;  3CCS A;  2B8A A;  3ZFJ A;  1VQO T;  5DY9 A;  2EFI A;  4X34 A;  3OYH A;  2CYZ B;  2E65 A;  4LDX A;  3WVE B;  3UWN A;  5GAN 5;  2O01 E;  2HNI A;  3L42 A;  5AYF A;  3RUX A;  2XG8 D;  2M9U A;  3CXC S;  5GMK i;  3CBP A;  3RKY A;  4JRK A;  3NTI A;  4XU1 A;  3CPW S;  4ATO A;  2VYT A;  3E9F A;  2ZPI B;  3BW1 A;  3PNW C;  3MP1 A;  4C8Q F;  4JRQ A;  4HA8 A;  1YBY A;  3G71 A;  3S3M A;  1U1S A;  2CS7 A;  2RJD A;  3LWI A;  3PT9 A;  1AHJ B;  4RCB A;  3L2W A;  1JJ2 A;  3EAE A;  5GAM g;  2RO0 A;  5GAM j;  5GAO q;  2EQJ A;  2LQ8 A;  4A4H A;  3G4S A;  4M77 G;  3I55 T;  4M7D B;  3LGF A;  2YHT A;  5GAM d;  1P92 A;  2P0K A;  5A0D A;  5J39 A;  5LJ3 g;  4Y28 E;  3CCE T;  2LRQ A;  3V8J A;  5J26 A;  1VQL T;  4XU0 A;  2KAF A;  5LJ3 d;  4A54 A;  3C4S A;  3QPH A;  4EMK B;  4M75 G;  4OMF B;  1LOJ A;  4ELZ C;  5GMK h;  2DXC A;  1YJW A;  3J80 E;  3F70 A;  3OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...