4L6V5

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 9
structure length 68
sequence length 68
chains with identical sequence E, e
ec nomenclature
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l6v500
1UGSB 2DPPB 2WSCE 3VYGA 2PVGB 4OB1B 4Y28E 2QDYB 3A8OB 3X20B 1UGPB 2DXBA 2ZPEB 2AHJB 3QYHB 4OB2B 3QYGB 1QP3A 2CZ6B 1DJ7B 3HHTB 1UGRB 4ZGDB 2DD5A 2DD4A 2CYZB 2PUKB 3LW5E 2PU9B 2CZ0B 1PSFA 2PUOB 3X28B 2D0QB 2O01E 3A8MB 4XK8E 2DXCA 4OB0B 3VYHB 1PSEA 5L8RE 2PVOB 4KT0E 3X25B 4L6V5 3WVEB 4FM4B 3QZ9B 2ZPBB 4ZGEB 2CZ7B 4RKUE 1QP2A 4OB3B 2ZPHB 1GXIE 4ZGJB 1UGQB 2PVDB 2WSEE 2ZCFB 2ZPIB 2CZ1B 1V29B 3X26B 2WSFE 2ZPGB 2ZPFB 3A8GB 2ZZDA 3WVDB 3QXEB 3A8LB 1JB0E 3QZ5B 1IREB 1AHJB 3X24B 3A8HB
chains in the Genus database with same CATH superfamily
4B9WA 4LE9A 1MNDA 1UGSB 2A7YA 1S72Q 4Q5WA 1VQPQ 1YJNT 1QWEA 5GAOn 2DBKA 2JM9A 2K4YA 3JCMe 3JCMW 5IHKA 2NUPB 4RTTA 1VQ4Q 2KE9A 2RQWA 3OS1A 5HKCA 2JZ2A 4FT4A 4KGVB 4C92C 5GAOq 4M7DA 1M3BA 2J06A 2CP0A 1KQSS 1WXUA 5CVIA 5IT9E 3HSBA 1NG2A 5GAN2 1OYXA 2JW4A 1N27A 2HBWA 2PUOB 1Q86C 1RAHB 3ZL7C 2PQWA 4BACA 1YIJT 1VQ5T 1AOJA 1VQKQ 1G3YA 2KR3A 4A4EA 5GAN6 4HCZA 4EMHA 1TUGB 2DXCA 3HFNA 4J6YA 2AKLA 3CEYA 5L8RE 1QCFA 1WX6A 3X25B 2LNHB 4C92B 2XMFA 4FM4B 2LCSA 5GJVB 2J05A 2RQTA 5KCHA 1VYUA 1S1NA 2QA4T 2KSSA 1FWZA 2QTXA 2FEIA 3SEMA 3VV0A 2C0OA 1UGVA 3UA7A 5I2SA 2DYIA 3PGGA 3QWYA 2GQIA 4XTVA 1NJIR 1RLQC 5GAMj 2RI5A 3V8LA 2RJFA 2KK4A 4IURA 2LQWA 2DVJA 1Q81U 3JCMJ 2MK5A 2YRCA 3EFSA 5CKBA 3A8LB 1UHCA 3FLGA 2GFAA 3OYMA 3CCSA 3S3NA 3J7AF 1Q82R 1UE9A 1Q95G 2DK3A 3GNGA 4A4GA 2JNGA 1VQ7Q 1U8RA 2YRDA 2EGCA 2AIRB 2YHTA 1NZ9A 2MYSA 4C8QC 2YUNA 1KD1C 1NM7A 2QQRA 1B3QA 1BU1A 2H3JA 3M4YA 4KGXB 4R0KA 2E41A 4ME7A 2ROLA 2EFIA 4N4GA 3QYHB 1OX9A 2ROTA 2V8IA 2CZ6B 5FRNA 3HHTB 1RL2A 1ZA1B 4PNOA 3TQ7P 1F1BB 4M75B 3EH1A 1UG1A 2GGRA 3ME9A 1K4US 1QW1A 4RG8A 3VS0A 1J3TA 1MMGA 4FU6A 1I5LA 3CBOA 2P4TA 4C8QB 1RI9A 2D6FA 3EFOB 2FZKB 3OMGA 3VS6A 3VYHB 2KMTA 5KYYA 4XU0A 3NMZC 1VQLA 2O4XA 3QKJA 1IB8A 4XU2A 2YWWA 2GTJA 3QZ9B 2K3XA 2EBPA 1KIKA 4JLGA 3QIIA 3RKWA 2HQEA 1ZUYA 2RJEA 3VUZA 5HY6A 3I55Q 1BI1A 1QVGA 1VYVA 5AYFA 2W0ZA 1GBRA 2OTLT 5IHNA 2CSQA 1W1FA 2DAQA 5DLQE 1H3ZA 2ECZA 3GOXA 3CBPA 4MMKA 4F16A 4B6MA 2ZZDA 3CCUA 1I5OB 2LT4A 1KD1U 2QEXA 2BZYA 1N8RR 2OTJT 3BFMA 2F5KA 1OI1A 1PD0A 1JB0E 3CD6T 1IREB 4JRPA 1EZZB 1WQ7A 1QKWA 1D3BB 3OYKA 1K76A 3OBWA 1LJOA 4ANJA 1NEBA 4RG2A 3FIFA 5LJ3f 1EX4A 2M16A 3HL8A 3LH5A 2B8AA 5LJ5h 1BI2A 5GAN7 3OY9A 2DKGA 2FB7A 2DL4A 5CKHA 1UGPB 3G4ST 2DXBA 1OZ2A 4FYYB 3EG0A 1YJWQ 3OYFA 2KRSA 2RF0A 1R0BG 2O2OA 1M8VA 1WXBA 2LQKA 1NPPA 4A54A 2DFUA 2LJ0A 1I0CA 5CQXA 1W70A 3SB2A 2E70A 5GMKh 2LZ6B 4KGZB 2EWNA 1PSFA 3NTHA 2DZCA 3M54A 2X4JA 2CUBA 2EIFA 3LLRA 5J39A 2LJ1A 5LJ5d 4C5GA 4E7SA 2O01E 2EPDA 2HEQA 3C4SA 3N5BB 4E6RA 4DA4A 3CC7Q 2DTOA 1HSQA 1ZUUA 3CCRT 5LJ5j 2EAYA 2Y4XA 1M4ZA 3KUFA 5A2QE 3CC4A 2KT8A 2JN0A 2RHUA 5C6SA 4M77E 4JZ4A 1ZSZA 1C6VX 5GAMg 3RIRA 2JXBA 2RD1A 2YRVA 1ARKA 1QMCA 3O8VA 3CMEQ 4YTLA 1G8XA 4C0DC 4A63B 3FRNA 1QVGP 3HRUA 1S72A 4PJOG 1VQPA 2X4XA 1ZHIA 4M78A 2EKHA 4AT1B 3V8KA 3OW2A 4PL6A 1E7OA 4D8DA 1M2VB 4L5GA 3TCJA 2LRQA 3E19A 4FSXA 4OVAA 4HT8A 3REAB 3QXEB 3L2VA 3CMAT 1GRIA 1WFWA 3OMCA 5KYXA 5FU7C 2RMOA 1JQQA 4WCIA 2RH2A 1QVFS 1IGQA 3VS1A 5I11A 4M78G 2DLPA 1X01A 4J9EA 1SEMA 4C0DB 1EFNA 3VYGA 4Z8AA 4LDVA 4XAXB 1Q7YR 1VQKA 5FWBA 3UDCA 1YJNQ 2LJ3A 1WLPB 2JT4A 1BYMA 4E7ZA 1ACMB 4R55A 5GAOr 2NWMA 2VXEA 4QW2A 3I5RA 3MP8A 4DBHA 1ZBJA 1KJWA 5FU7B 5GANe 3GPLA 4TVRA 4N0AA 2XG8D 2KVQG 3A1PA 4FYXB 4F7UG 1IGUA 2EYZA 3JCMQ 3JCMV 1K9AA 1E6HA 2H8HA 3G71A 1YJ9T 4KUIA 2DZ9A 2J6KA 1VUBA 2AT1B 1JRIA 2O4XB 1I07A 2AZSA 4OGCA 3MCAB 1H3HA 2JJ9A 2KXCA 2BE9B 1FMKA 1P92A 2DEUA 1NEGA 2HMAA 3TSWA 1UDLA 3JCMb 2Y90A 3M0PA 3M0RA 1VIEA 5IH2A 2MWPA 1WJSA 3DKMA 2RK1A 3V7RA 3GF5A 3H0FA 2EQUA 2RNAA 1VQ7A 2GBQA 4E7LA 3JB9D 2ZPGB 5FW9A 1JU5C 1HXDA 1KQ1A 2P4RA 2HCKA 4GLMA 3OS2A 2KEAA 1R77A 3I9QA 2RQUA 1AWOA 1AZEA 2K5IA 2QQSA 2K9GA 3EG9B 3JSCA 2K79A 3JB9J 1YHQA 3A98A 1VQLQ 4MDWA 2DYBA 1BKBA 3C12A 2D9TA 4Y28E 2QDYB 1MNEA 1VA7A 3KFVA 2L8DA 1I8FA 1YN8A 2KQWA 3TEEA 5KYUB 1K9MR 4J8OA 4MZPA 4PJOC 4E7IA 2V26A 3TVTA 2LVMA 2E3HA 2HKQB 2C06A 2DL5A 2DRMA 2JOYA 2BKDN 2L3QA 2HSEB 3M0QA 2QEXQ 5LJ5g 4AG1C 5CKFA 2DXTA 5KYWA 3EGUA 4IUTA 3H41A 3BDUA 2LQ8A 1M1GA 1N5ZA 4LD6A 4PJOB 3OYHA 1NBEB 2CZ7B 4Y91A 6AT1B 3UATA 2MAMA 3CCJQ 2VXFA 2ZPHB 4PJJA 2KRMA 3H8ZA 2OI3A 1D1BA 1VQ9A 4M7AE 1X43A 3OS0A 2D8JA 3SWNC 4AMCA 1UTIA 2CZ1B 4JJDA 4A4FA 2F2XA 2E65A 1FMVA 3NFCA 4JUVA 2EW3A 1LNXA 1VQNT 2LX9A 1AVZC 2VGMA 3RUXA 3FJPA 4CC3A 1YJWA 5GAN4 4LD9K 1M5Q1 3Q1JA 2J6FA 2EQKA 1MV3A 1Y96A 5HCKA 4HCKA 5GAOp 3LWHA 3CC4Q 2EVRA 1I4K1 2XKOC 2HL3A 1VQ8T 3SWNB 3C0CA 1NYFA 1PWTA 2NLUA 3CC7A 1ABOA 4Z02A 1OPKA 5HK3A 2JM8A 2FRWA 1GCQA 3V8JA 1DJ7B 3VU3C 1O9SA 4F7UB 3MEWA 1Q81C 2LNVA 1RUWA 1W4SA 4LXCA 1TS9A 1BB9A 2E6ZA 2OAWA 4XTZA 2R5AA 1MMAA 3PNWC 1VQOT 3JCMc 4M77D 2EYXA 2A08A 3QBYA 1UJ0A 3OYGA 1WQWA 3CMEA 1AWXA 2LQNA 3CCQA 1YITQ 3S6WA 1KQSA 5CCAA 4CC4B 2IG0A 4KH0B 2LMJA 3CCMT 3CPWS 1WI7A 5A0LA 1FX7A 3META 5GAMh 2BE7D 3QHSA 4L59A 5I22A 4A4KA 1UEBA 1VQ6T 2FG0A 2X4WA 3RKYA 4IIOA 1WIEA 1O75A 3JB9F 4M7DG 3NGPA 1NE8A 1T3SA 4EIKA 4ATOA 4HA8A 3M58A 2KAFA 2LCLA 1WJRA 1VQMA 2OJ2A 5CQYA 4OMPA 3QSUA 1I1JA 3VKIA 2GFUA 2HBPA 1TUDA 1Y71A 1Y0MA 2LTOA 3CCST 2QK0A 1NYGA 1KG1A 3MEUA 2KGTA 3X26B 3TREA 1RLPC 2WSFE 3A8GB 5GAMd 4C5EA 2O9SA 1N9SA 3EG3A 1Q86R 1YJNA 4X9CA 1D1AA 4IUUA 3RR6A 5D6XA 4QKUA 2C0IA 2JTEA 3A8HB 5ECAA 1X69A 4F17A 2F1LA 3G71Q 3G1JA 2HDAA 4OMLA 3VS3A 3OSVA 3GIBA 3QJ6A 4WF2A 2DMOA 2K3BA 1WHHA 3CCLQ 4C92E 3QDRB 2GF7A 4KUDK 2V1QA 2E3IA 5CO7A 2HQHA 4M75C 1VQ5A 2CREA 4QT7A 1TOVA 3HTRA 4ZGDB 2DD5A 4FYVB 3REBB 2PUKB 5LJ3e 3VRZA 1K0SA 2CZ0B 2VYTA 5KE3A 3J81E 2MPXC 1KSWA 1MMDA 4OGEA 4DOWA 2CGHA 5CR2A 2O9VA 4Z88A 1SSHA 3MJXA 2HNIA 5CAIA 4J9GA 1PRMC 3CCVT 2XU8A 3M0SA 1KQSP 3CPWP 1YHQQ 5J26A 2L3SA 2RHZA 3EGDB 2G3RA 2RHYA 3CCET 4L6V5 2XDPA 4FL6A 2YDLA 3ZEHA 3I56T 4ORZA 2RQRA 3NPFA 3RMQA 2EYWA 2HL5C 2SEMA 2O31A 1KD1R 4HCCA 2DX1A 4J9FA 4NS5A 5IXFA 1UJYA 1G3SA 1PM3A 1NJIU 3JCMd 4ZGJB 1UGQB 1M2OA 1OOTA 1ABQA 3G6EQ 3OQ5A 3ULRB 2C0TA 4Z89A 3OBYA 3RBBB 1RACB 3AHUA 3ASKA 2CP7A 3V7CA 2COWA 3M55A 3P8BB 1Q82U 4J9IA 1SKUB 1SHGA 3EAEA 1PKTA 4M75E 4QVCA 3OYNA 4DEYA 2YUQA 2LT1A 2J6OA 2RM4A 1WYXA 1U1TA 1WZOA 3M0TA 5AT1B 2EGAA 3D7SB 1LOJA 1D1CA 4C8QE 2WSCE 3JRZA 2E4HA 2ENMA 3A8OB 4M7DC 5FU6C 3CC2T 5GAN8 3C94A 2CDTA 1QVPA 2IIMA 1D0YA 1X2KA 3BY7A 4M77F 1TU0B 3JCMP 1VQ9Q 4PKCC 2CYZB 2XICA 4LUEA 3L42A 4ZN3A 2JUFA 2DILA 4XTYA 4AFSC 2D0QB 2D8HA 3HRSA 3CCJA 2QXFA 3P8DA 1PSEA 1X6OA 1JJ2A 4DQ2A 5LL6S 4M7DB 1KFZA 5FU6B 1PHTA 5LJ5f 1JJ2S 4BE1A 4CRIA 1UECA 4M7AD 3QJYA 5IAYA 4FSSA 2FPDA 4QQDA 2OTLA 4DBQA 1S72T 3EHQA 3MP1A 4J9CA 2M1HA 2WSEE 2F2VA 2EYYA 2CP6A 2LDMA 4LUDA 4JLIA 2OTJA 1D09B 2MWOA 1VQ4T 3OA6A 4OMFB 4M7AA 4M7DE 1N8RU 2FHDA 3WVDB 2YSQA 3FEOA 1BCOA 1RAFB 2CP2A 3INZA 1AHJB 2I2LA 2YLBA 3VS2A 3CCQQ 1YP5A 1KQ2A 5DLOA 3G4SA 1D0ZA 2FZGB 4ZTFA 2RN8A 2QI2A 4E7KA 2QQBA 3QPHA 3FC3A 4KH1B 4UC4A 3NHNA 4R56A 3OYEA 1GBQA 1W2BS 1B34A 1WJQA 4HT9A 1QVFA 1ZA2B 1YITA 4IUVA 4E47A 1VQMQ 4XTUA 3EGXA 3OYLA 1ZX6A 4JJBA 1YFNA 2K7AA 2EQMA 1NLPC 4AFUC 3CCRA 1TG0A 2EGEA 5EG2A 1Z9QA 3NTIA 2E6NA 2X3XD 3CBMA 2IVWA 1SSFA 3OYJA 2PVOB 1JJ2P 4PLLA 1LCKA 1OU8A 2Y4YA 2MCNA 2DNUA 3CQTA 1OZ3A 2HSPA 3OYYA 2BZXA 2HKNA 1LVKA 1T0JA 1VQ7T 4EMKA 4OF1A 2X3WD 4E7JA 1OU9A 1N9RA 1YIJQ 1D0XA 2DXUA 3JCMg 1VQ5Q 3CMAA 4QVDA 1AEYA 2LX7A 2PZ1A 3PMTA 5KYYB 2NUPA 2DIQA 4LDUA 1T0HA 1YI2T 1G2BA 3CCLA 3SDZA 1TUCA 1YWPA 2DA9A 4C92D 3L1AA 2V8JA 4X1VA 1T3LA 3FJ5A 2QA4Q 1WDXA 3P8HA 2VVKA 2DPPB 4NL2A 2DE0X 3BDLA 5GMKl 2PVGB 2R58A 3FDRA 1GFCA 2CSIA 4EDUA 4E7HA 3HPWA 1X27A 2QQ9A 1OULA 4XTWA 3H9NA 4C92A 1QVFP 4M4ZA 1M1KC 3LW5E 5EC7A 3R6NA 2ED0A 2PU9B 2KNBB 3I55T 3VS5A 1JEGA 5KH6A 3JCMX 3X28B 4N4IA 3GBQA 1MUZA 4XQ3A 4M7AF 2L0AA 4MZMA 2EJ9A 4RTZA 1TWBA 2A36A 5L23A 4OB0B 5GMKi 1H92A 1WPYA 1IO6A 3G6EA 3DLLA 2KRNA 3EHRA 4V2SA 3L2UA 1ZSZC 1PCXA 4C5IA 2CT4A 3VS7A 3CCVQ 3L2WA 1IHWA 2ZPBB 4C5HA 5GANh 4RKUE 3CCEQ 2B86A 2L3PA 4LDYA 1BK2A 3I56Q 1GXIE 1WHGA 1OPLA 4M75D 4AG2C 4LNPA 4M78C 2VV5A 4JPBW 3QDFA 2O88A 3SD4A 1M30A 2CH4W 1UFFA 4EMGA 4C8QD 3M4GA 1GFDA 1ZSZB 1HYOA 5GANd 2P0KA 1B7TA 2L5QA 4ESRA 4HVWA 3LH0A 2M0YA 1M1KU 1NLOC 1K8AU 1BBZA 5GANj 4JS4A 2DETA 4C8QA 2COYA 1MGQA 4M78B 3EFOA 2OTLQ 1RAGB 1HJDA 2ZPEB 4D8KA 4PJLA 2DERA 1K9MU 2BTTA 4PJOE 3QYGB 4DOVA 2FPEA 2GNCA 3CC2Q 1EIFA 1H8KA 5KYXB 2OTJQ 1M1FA 3U23A 8AT1B 1IRXA 2VC8A 1SG5A 2K5FA 4II1A 3UA6A 2NYSA 3CD6Q 4N0AC 1XTDA 3OYIA 1X6GA 4KBMB 4LN2A 2KXDA 5I2MA 1PRLC 3OS5A 2AZVA 4JRQA 1X6BA 2KROA 4EPCA 2J7IA 4A53A 2OX7A 4M78E 5J3BA 1I81A 1C0MA 1WHMA 2FYKA 3G4SQ 1ZQ1A 3PTAA 1AD5A 1BIBA 2DVEA 1SHFA 4F04B 2M9UA 3UT1A 3RKXA 2JTFA 3OYCA 1KC8U 3GLXA 1GL5A 4O6JA 4ZGEB 3MHXA 3CXCA 2BIVA 1D3BA 1RAAB 1K73U 1QCOA 3CXCS 1XOVA 1M9SA 2H3EB 4ELZC 4J9HA 2PVDB 1VQNA 1ZBXA 4FT2A 3CPWA 3ZBDA 3H0HA 5CKDA 4C92F 2G6FX 1M90U 1OEBA 3H0IA 3SHWA 1Q81R 2ZPFB 3CCRQ 2JMCA 4BUGA 4F7UE 3QO3A 4M77A 1CKAA 2VWFA 4J6WA 5IN1A 4PK4A 1AWJA 1VQ8A 3S3MA 1PG5B 1WXTA 5GAMf 5CIUA 2YT6A 2PNIA 2E10A 7AT1B 3PFSA 2COZA 2JVVA 4FIBA 2A3LA 4OMNA 1Y07A 2JTMA 1JXMA 4M77G 1ZUKA 2XIDA 1W6XA 1QLYA 3QG1A 1NJIC 3JV3A 2YLCA 5GMKm 4D6WA 1WHLA 4J7IA 3OYDA 2XHCA 1VQOA 3M56A 2D1XA 3C95A 1MV0B 1RADB 3MEVA 3CMAQ 1R8OB 2DD4A 4RTUA 3T9NA 2K57A 2DL8A 3CCMA 1Q82C 1MHNA 4XK8E 1IHVA 2R5MA 4PFZA 1WGSA 4JS5A 3OYAA 1VQ6A 1YIJA 3CPFA 1WA7A 2M51A 1M2VA 2KI7A 1XNIA 2XI9A 3E1SA 2L3RA 4M75F 3E2UA 1FXXA 3EG1A 4AFQC 3RDVA 2RI2A 3SFMA 3PE0A 1VQLT 3EH2A 3RNJA 4C8QF 3JCMh 3CXCP 2QA4A 2CP5A 2QASA 4BY6C 2VKNA 3R6OA 5LJ5e 3QWXX 4LDWA 2FVUA 3VRYA 5KYWB 3M0UA 1FYNA 2KDSA 4HKEA 4J9BA 3JCMf 1Q86U 4IKFA 1YJ9Q 4B9XA 4JZ3A 1B07A 4FYWB 4J5YA 1YI2Q 4OMOA 2QG9B 4RCBA 5GANg 2DBMA 1X2QA 2IPOB 3OB9A 5GMKe 3CCUT 4E2FB 3UF4A 2QEXT 2VASA 3JAME 1YCYA 2AK5A 2FRYA 4IUPA 5DY9A 2ESWA 4BD3A 4BY6B 3DLMA 2RB6A 3THKA 1Y7XA 4ELYC 3V7SA 3MEAA 3LWIA 2MIOA 3ER0A 2HAXA 1GCQC 2BZ8A 1CKBA 4J83A 2HZYA 2DL7A 3FB9A 2X9HA 2WACA 4X9DA 1UGRB 5GAN3 2W10A 3OSSC 2E5QA 3LGFA 1Y57A 3CCJT 2V8KA 5KCOA 1Y96B 3CCVA 1G5VA 1N8RC 1NPRA 4PFOA 4XTXA 5GAOm 2K3YA 3CCEA 2JS0A 5KYNA 3E9FA 2CS7A 3I56A 3EG2A 2YUPA 4C0FA 3OYBA 4GY5A 3L2ZA 3J80E 2E64A 4M7DF 4BDZA 2X4YA 1QVGS 3PIOA 4KT0E 5A0GA 2QQAA 2YUOA 2CUDA 3AT1B 2NUZA 3HP9A 5GAN5 1SF9A 3URGA 4NL3A 4MDXA 2DM1A 5A0DA 4M77C 5LJ3h 1SRLA 2QGGA 2A37A 3L2RA 1OV3A 3EG9A 1QP2A 5M9OA 4KRTA 2CKKA 4OB3B 1RAEB 4QQ6A 3CC4T 4DBFA 2DRKA 5FWCA 2DL3A 4DEXA 2QGFB 2DJQA 1QWFA 1RI0A 4ZNXA 4IIMA 3S3OA 3PVLA 3LX7A 4PFPA 2DJZA 2DF6A 2DTIA 5KYUA 4PJNA 2QYZA 5LJ3d 2E5KA 2XD0A 5I21A 3RESA 1VQPT 1OX8A 3L2QA 4M77B 3M53A 5IHIA 3M59A 3PIPA 3CC2A 2X51A 4PJOD 1WNLA 4NOYA 3CD6A 5LJ3j 2X35A 1KHIA 1PNJA 1YITT 1ZLMA 4OB1B 4QQGA 1KHCA 2LP5A 2P0QA 4ZN1A 1G83A 1HK9A 1CSKA 2MOXA 1SRMA 4OP0A 4BI4A 1AWWA 1UUEA 1YBYA 3UWNA 4P5NA 4KULA 2EQJA 1TH7A 2EKOA 1U1SA 1VQNQ 2KYBA 4BI3A 2VB6A 1QP3A 2VGNA 4OMMA 1VQKT 2NUTA 1E6GA 4M78D 4M7AG 1V76A 4PJOA 2QDLA 1A0NB 3QUIA 1FMWA 2KBTA 3A5ZB 2K2VA 2XDBA 1PD1A 1TXQA 3LGLA 4BE0A 4MZTA 2L2PA 4JRKA 2ZGWA 2F2WA 3VJPA 4O5VA 3A8MB 1W2BA 1UB4A 1QCNA 2RQVA 4BDYA 2L89A 2KT1A 3DB4A 5GMKj 1VQ8Q 5C0MA 1H641 1M8MA 5FLXE 3M57A 1JO8A 3WVEB 4RMOA 3HRTA 4J6XA 2F69A 1Q7YC 2DTHA 4CI0C 1BIAA 3OW2S 1VQ4A 3E9GA 2ATCB 2HQXA 3G71T 1VYTA 4X34A 3GP8A 4JRIA 4RUGA 5KE2A 4CC2A 3F70A 2ZPIB 3UPUA 1VQOQ 1AT1B 3MPUB 4BB7A 3CCLT 2D0NA 4HVUA 1U5SA 1M3CA 1HD3A 1VIFA 3SWNA 1WHJA 4MMLA 2EJGA 3PMIA 4FW2A 3CCMQ 2A28A 4HXJA 3BE3A 2AKKA 2GQVA 1IZ6A 3M5AA 4RTXA 3X24B 4F7UA 3H6ZA 1VQ6Q 2MMPA 1Z9ZA 4OMQA 2EJFA 4JJNK 3I5SA 2EYQA 1R0CB 1AZGB 1JBMA 1UHFA 4C0ZA 4RCCA 2YXYA 3HFOA 4AFZC 4C0GA 1YHQT 3CCSQ 2RK2A 2Z0WA 4RTYA 4WTOB 2E12A 2LCCA 1N6AA 2MF2A 3VS4A 3MKDA 5CK9A 1K1ZA 3MP6A 3JB9I 1MMNA 2EQIA 1M3AA 2RI3A 5FRMA 2FO0A 3LYIA 3ZFJA 1TTHB 3PVQA 2K2MA 2M02A 2RPNA 1U3OA 3KBGA 3I35A 1Q7YU 4CC7A 2HD0A 2QAZA 3G6ET 2K6DA 4K11A 1KK7A 2DO3A 2XDDA 2GCXA 4FCYA 1W2BP 3TSZA 2FPFA 1XJWB 1K8AC 1M27C 1RABB 2I0NA 1PKSA 4RTWA 3DB3A 3OW2P 1XQHA 2RHXA 1YJ9A 4J9DA 3PT9A 4PLIA 4RTVA 5FROA 1K9MC 1JXOA 4C92G 1YI2A 2E1HA 2M0OA 4J7FA 2ZCFB 4XU1A 1OQKA 1ZSGA 1BI3A 4M7AC 1YWOA 4PJMA 2ZAEA 3TU4K 2R57A 4XU3A 5DM7R 1M1KR 2RHIA 2DEQA 1K8AR 3JB9G 2JS2A 5D7UA 2RJCA 1V1CA 1VOMA 1WHKA 1YNZA 4PJOF 4BE2A 4IUQA 1VQ9T 1QKXA 1RAIB 3QZ5B 5LJ3g 2JMAA 1BCMA 5HK0A 1SPKA 4QVZA 2ED1A 5GANf 1YJWT 1KC8C 2VUBA 2V1RA 5CKEA 4M78F 3CCUQ 4JDSA 4M7AB 3X20B 3EFRA 3I55A 1K73C 2P0PA 1LPLA 2AHJB 3BW1A 1QQJA 2PTKA 1TSFA 4OB2B 3EGDA 1YCSB 5GAMe 3HKSA 2RJDA 2KYMA 4F14A 4M75A 3O5ZA 4GBQA 1M90C 4Y92A 1BI0A 4DBRA 3G7ZA 2F5TX 2NUTB 4LDXA 3CC7T 4ZTJA 3VUBA 2CP3A 5D6YA 8ATCB 1KC8R 2ABLA 3GNFB 1IXDA 2K5LA 2MI6A 3MO8A 1K73R 2RA2A 1PC0A 1G3TA 4M75G 3RMSA 1K0XA 2FZCB 1B34B 3NTKA 4F7UF 5GAOl 2QTVA 4VUBA 1M90R 3EGXB 3CMET 4C8QG 1GCPA 1U06A 2CT3A 4EMKC 3CCQT 4N4HA 4FW1A 4JJCA 5D6WA 2SRCA 2A0FB 2DIGA 4HCBA 4BI8B 9ATCB 2GTOA 4A4HA 2XK0A 1G3WA 3JB9H 5IXBA 2OAUA 3WXMB 1V29B 2FL7A 4GLKA 2LC4A 4HVVA 1X75C 2BUDA 3M9QA 5GJWB 1C1AA 1VQMT 2P84A 2KY9A 4M7DD 2CH4A 3RERA 3IQLA 3KXTA 2RO0A 4EMKB
chains in the Genus database with same CATH topology
4B9WA 5DLOA 3G4SA 3CCUT 1UGSB 2A7YA 2QEXT 4Q5WA 3JAME 1YCYA 4ZTFA 1YJNT 4IUPA 2QI2A 5GAOn 4E7KA 4MDWA 2K4YA 5DY9A 1BKBA 2QQBA 3C12A 4BD3A 3JCMe 3JCMW 3QPHA 2D9TA 4BY6B 4Y28E 3DLMA 2QDYB 2RB6A 3FC3A 1Y7XA 4UC4A 4ELYC 3V7SA 3MEAA 4R56A 3LWIA 2L8DA 3OYEA 1I8FA 3ER0A 3OS1A 2KQWA 3TEEA 5HKCA 2HAXA 2JZ2A 4FT4A 4C92C 5GAOq 4M7DA 1W2BS 4J83A 1B34A 1WJQA 4HT9A 1QVFA 1YITA 4IUVA 3FB9A 4E47A 2WACA 3JCMd 4X9DA 4J8OA 4MZPA 4XTUA 1KQSS 1UGRB 5GAN3 3OYLA 4PJOC 4E7IA 3OSSC 5CVIA 5IT9E 2E5QA 3HSBA 2LVMA 3LGFA 3CCJT 2V8KA 1OYXA 2EQMA 5KCOA 1Y96B 5GAN2 3CCVA 1G5VA 1N27A 1N8RC 1NPRA 2PUOB 3CCRA 1Q86C 2C06A 2JOYA 2PQWA 4XTXA 2BKDN 4BACA 1YIJT 1VQ5T 5GAOm 2K3YA 1G3YA 5EG2A 4A4EA 5GAN6 5LJ5g 3CCEA 3E9FA 4HCZA 4EMHA 2DXCA 2CS7A 3HFNA 3NTIA 4J6YA 3I56A 2E6NA 5CKFA 4C0FA 3CBMA 2DXTA 4GY5A 3OYBA 3CEYA 3L2ZA 3J80E 2E64A 4M7DF 4BDZA 2X4YA 2IVWA 1SSFA 1QVGS 5L8RE 2PVOB 3OYJA 3PIOA 4KT0E 5A0GA 2QQAA 4IUTA 3X25B 3BDUA 4PLLA 2LQ8A 4C92B 1M1GA 3HP9A 2Y4YA 4FM4B 3URGA 5GAN5 4NL3A 4MDXA 5KCHA 2QA4T 1OZ3A 4LD6A 2KSSA 4M77C 5A0DA 1FWZA 2QTXA 3OYYA 5LJ3h 3OYHA 4PJOB 2CZ7B 4Y91A 3VV0A 1VQ7T 3L2RA 4EMKA 1QP2A 5M9OA 2CKKA 2MAMA 4OB3B 4OF1A 4QQ6A 2VXFA 3PGGA 5I2SA 2ZPHB 3CC4T 4E7JA 4XTVA 1N9RA 3H8ZA 5GAMj 2DXUA 1VQ9A 3JCMg 4M7AE 2RI5A 3V8LA 2RJFA 3OS0A 3SWNC 3CMAA 4QVDA 2KK4A 4IURA 2CZ1B 3PMTA 1RI0A 1Q81U 2DIQA 4A4FA 4LDUA 2E65A 3S3OA 3NFCA 4JUVA 3JCMJ 1YI2T 1LNXA 3LX7A 1VQNT 2DJZA 2DTIA 2LX9A 3EFSA 3CCLA 5CKBA 2VGMA 3SDZA 3A8LB 3FLGA 3OYMA 2GFAA 3CCSA 5LJ3d 3RUXA 2XD0A 3FJPA 3S3NA 3J7AF 5I21A 3RESA 1VQPT 1YJWA 5GAN4 3L2QA 4LD9K 1M5Q1 3Q1JA 4C92D 3L1AA 2V8JA 2EQKA 4M77B 2DK3A 3GNGA 3M53A 4A4GA 2JNGA 3M59A 3PIPA 3CC2A 1Y96A 1U8RA 3P8HA 4PJOD 2YHTA 1NZ9A 1WNLA 2DPPB 4NL2A 4NOYA 3BDLA 2X35A 5LJ3j 5GAOp 3LWHA 3CD6A 4C8QC 1KHIA 5GMKl 2PVGB 1YITT 1I4K1 2QQRA 2R58A 4OB1B 2XKOC 4QQGA 1KD1C 2H3JA 1VQ8T 1KHCA 3FDRA 3SWNB 3M4YA 2P0QA 4ZN1A 1HK9A 4OP0A 4BI4A 2E41A 4EDUA 4E7HA 1YBYA 2NLUA 3HPWA 4ME7A 4P5NA 3UWNA 3CC7A 4Z02A 2EFIA 2QQ9A 4N4GA 4XTWA 4KULA 3QYHB 2EQJA 1TH7A 2EKOA 4C92A 5HK3A 1U1SA 2V8IA 4BI3A 3V8JA 1QP3A 2CZ6B 2VGNA 1DJ7B 5FRNA 3VU3C 3HHTB 1M1KC 1O9SA 1VQKT 1RL2A 4F7UB 3MEWA 1Q81C 2LNVA 3LW5E 4M78D 4PNOA 4M7AG 2PU9B 4PJOA 1W4SA 3I55T 4M75B 3QUIA 3A5ZB 2E6ZA 2K2VA 2XDBA 3ME9A 5KH6A 3JCMX 3X28B 3LGLA 4BE0A 4MZTA 4N4IA 1QW1A 4JRKA 4RG8A 4XTZA 2R5AA 2ZGWA 3PNWC 1VQOT 4XQ3A 3JCMc 4M7AF 4M77D 3VJPA 4FU6A 1I5LA 4MZMA 4O5VA 3A8MB 2EJ9A 1W2BA 1UB4A 3CBOA 2P4TA 3QBYA 4C8QB 1WQWA 3OYGA 3CMEA 2D6FA 4BDYA 4OB0B 3OMGA 3CCQA 2L89A 3S6WA 3VYHB 5GMKi 1KQSA 3DB4A 1WPYA 2KMTA 5CCAA 4XU0A 5GMKj 3G6EA 2IG0A 5C0MA 2O4XA 3CCMT 1VQLA 1H641 3CPWS 3DLLA 5FLXE 3M57A 5A0LA 3L2UA 4V2SA 3QKJA 3WVEB 4RMOA 1FX7A 3HRTA 3META 4XU2A 4J6XA 2F69A 5GAMh 1Q7YC 3QHSA 4C5IA 4L59A 3QZ9B 2DTHA 4CI0C 3L2WA 2K3XA 2ZPBB 1VQ6T 4A4KA 1UEBA 1BIAA 4JLGA 3OW2S 2X4WA 1VQ4A 3QIIA 3RKYA 3E9GA 3RKWA 2HQXA 2HQEA 4C5HA 1O75A 5GANh 4RKUE 3JB9F 3G71T 4M7DG 4X34A 1NE8A 2RJEA 3VUZA 5HY6A 4ATOA 4HA8A 1BI1A 4JRIA 3M58A 4LDYA 2KAFA 3GP8A 5KE2A 2LCLA 1QVGA 1KQ2A 1WJRA 1GXIE 3F70A 1VQMA 2ZPIB 4M75D 5CQYA 3UPUA 5AYFA 3QSUA 3VKIA 2GFUA 2HBPA 1Y71A 4M78C 4BB7A 2VV5A 3CCLT 2OTLT 2LTOA 3CCST 3SD4A 2DAQA 1KG1A 1VIFA 5DLQE 3MEUA 3SWNA 3X26B 5GMKe 1H3ZA 3TREA 3GOXA 4MMLA 2WSFE 2EJGA 3A8GB 3CBPA 4MMKA 4EMGA 5GAMd 4C8QD 3PMIA 2ZZDA 3CCUA 4C5EA 2LT4A 3M4GA 1KD1U 2QEXA 1N9SA 2OTJT 3BFMA 2F5KA 1YJNA 1OI1A 1JB0E 4X9CA 5GANd 4IUUA 1IREB 4JRPA 3CD6T 2P0KA 5D6XA 2GQVA 1IZ6A 3M5AA 3X24B 1WQ7A 4F7UA 3A8HB 3H6ZA 1D3BB 2MMPA 3OYKA 2L5QA 3OBWA 2EJFA 1LJOA 4JJNK 3LH0A 2EYQA 4RG2A 1M1KU 1JBMA 3FIFA 5LJ3f 1K8AU 4C0ZA 2M16A 3HL8A 4RCCA 5GANj 5LJ5h 2B8AA 3OSVA 3GIBA 1BI2A 4JS4A 3HFOA 5GAN7 3OY9A 2DKGA 2FB7A 3QJ6A 4WF2A 4C8QA 5CKHA 1MGQA 4M78B 1UGPB 4C0GA 1YHQT 4C92E 3G4ST 3QDRB 2DXBA 2RK2A 1OZ2A 2ZPEB 2GF7A 4KUDK 2E12A 2LCCA 1N6AA 2MF2A 5CO7A 3OYFA 5CK9A 1K9MU 3MP6A 4M75C 3JB9I 1VQ5A 1M8VA 4PJOE 3QYGB 4DOVA 2LQKA 1EIFA 4ZGDB 1NPPA 2DD5A 2RI3A 4A54A 5FRMA 1M1FA 5CQXA 2PUKB 3LYIA 2VC8A 4II1A 2K5FA 3SB2A 3ZFJA 5LJ3e 2CZ0B 2E70A 2VYTA 4N0AC 5GMKh 1XTDA 2EWNA 1PSFA 3NTHA 3OYIA 2DZCA 3M54A 4KBMB 5KE3A 2X4JA 3KBGA 1Q7YU 2EIFA 3LLRA 5J39A 2HD0A 3J81E 5LJ5d 4C5GA 3G6ET 2O01E 2DO3A 4OGEA 2GCXA 2CGHA 5I2MA 4DOWA 2XDDA 3C4SA 3N5BB 5CR2A 3OS5A 4DA4A 2HNIA 5CAIA 4JRQA 2DTOA 4EPCA 4A53A 4M78E 2XU8A 3CCVT 5J3BA 1I81A 3CCRT 2FYKA 5LJ5j 5J26A 1ZQ1A 2EAYA 2RHZA 1K8AC 2G3RA 2RHYA 1BIBA 1M4ZA 2DVEA 2Y4XA 3KUFA 2XDPA 4FL6A 4L6V5 5A2QE 3CC4A 3CCET 2JN0A 2RHUA 2M9UA 5C6SA 3UT1A 4M77E 3RKXA 3ZEHA 3DB3A 3I56T 2JTFA 3OYCA 1KC8U 1XQHA 2RHXA 3GLXA 3RMQA 5GAMg 3RIRA 1YJ9A 4O6JA 2RD1A 2YRVA 3MHXA 4ZGEB 4HCCA 3CXCA 2BIVA 3O8VA 3PT9A 1D3BA 4PLIA 4NS5A 4YTLA 5FROA 1K73U 1K9MC 3CXCS 4C92G 1YI2A 1G3SA 1M9SA 1XOVA 2E1HA 2M0OA 1UGQB 2PVDB 4C0DC 4ELZC 1ZBXA 4FT2A 3FRNA 4J7FA 2ZCFB 1VQNA 4XU1A 3CPWA 4ZGJB 3HRUA 3OQ5A 3ZBDA 1BI3A 4M7AC 1S72A 3TU4K 4PJOG 2R57A 4C92F 2X4XA 4XU3A 5CKDA 1ZHIA 5DM7R 1VQPA 1M90U 2RHIA 3OBYA 2DEQA 4M78A 3V8KA 3JB9G 3OW2A 4PL6A 2ZPFB 3AHUA 2RJCA 3ASKA 4L5GA 3TCJA 2LRQA 3E19A 4FSXA 3V7CA 4PJOF 4BE2A 4OVAA 4IUQA 1VQ9T 4BUGA 4F7UE 3M55A 3QXEB 4HT8A 3P8BB 3L2VA 3QO3A 1Q82U 3CMAT 4M77A 3EAEA 3QZ5B 4M75E 4J6WA 5IN1A 4QVCA 3OYNA 3OMCA 5LJ3g 2LT1A 5FU7C 2RM4A 3S3MA 1U1TA 1VQ8A 2RH2A 5HK0A 1QVFS 5GAMf 5CIUA 4QVZA 1LOJA 2E10A 4M78G 3PFSA 3PTAA 2JVVA 4FIBA 4C8QE 1X01A 2A3LA 2WSCE 4C0DB 5GANf 1Y07A 1YJWT 2JTMA 2VUBA 3VYGA 1KC8C 3JRZA 4LDVA 4XAXB 5CKEA 4M78F 4JDSA 3A8OB 1VQKA 4M7AB 4M77G 3X20B 4M7DC 3EFRA 5FU6C 3UDCA 3CC2T 5GAN8 2XIDA 3I55A 1K73C 2P0PA 1BYMA 2AHJB 3C94A 3QG1A 1NJIC 2YLCA 3BW1A 4D6WA 5GMKm 4J7IA 3OYDA 1QVPA 2XHCA 3BY7A 4R55A 5GAOr 4M77F 4OB2B 1VQOA 3M56A 3C95A 5GAMe 3JCMP 3HKSA 2RJDA 2VXEA 4M75A 1M90C 3MEVA 1R8OB 2CYZB 2DD4A 4PKCC 1BI0A 4QW2A 3T9NA 3MP8A 2K57A 2XICA 5FU7B 3G7ZA 2F5TX 5GANe 3L42A 3GPLA 4LDXA 3CC7T 4ZN3A 2JUFA 4ZTJA 3VUBA 4TVRA 4XTYA 4N0AA 3CCMA 2D0QB 5D6YA 2XG8D 1Q82C 3GNFB 2KVQG 3HRSA 1MHNA 4XK8E 2K5LA 3CCJA 2QXFA 2R5MA 4F7UG 2MI6A 3MO8A 3P8DA 3JCMQ 1WGSA 3JCMV 3OYAA 4JS5A 1VQ6A 2RA2A 1G3TA 4M75G 1PSEA 1X6OA 3RMSA 1JJ2A 1YIJA 4DQ2A 5LL6S 3CPFA 4M7DB 5FU6B 5LJ5f 1B34B 3G71A 1YJ9T 4KUIA 3NTKA 1JJ2S 2DZ9A 4F7UF 4BE1A 4CRIA 5GAOl 4M7AD 1VUBA 1XNIA 2XI9A 1JRIA 2O4XB 3E1SA 2L3RA 4M75F 4OGCA 4VUBA 3MCAB 3CMET 3QJYA 5IAYA 4C8QG 1FXXA 3CCQT 4EMKC 1P92A 4N4HA 4QQDA 2OTLA 2RI2A 3SFMA 5D6WA 3JCMb 1VQLT 1S72T 4HCBA 2DIGA 2Y90A 4BI8B 1VIEA 3MP1A 4C8QF 3JCMh 2MWPA 2M1HA 4A4HA 2XK0A 1NJIU 2WSEE 1G3WA 1WJSA 2QA4A 2LDMA 3DKMA 4JLIA 3JB9H 2RK1A 3V7RA 2OTJA 3GF5A 4BY6C 3R6OA 2EQUA 5LJ5e 2MWOA 4LDWA 1VQ4T 2FVUA 1VQ7A 2OAUA 3WXMB 3OA6A 1V29B 2FL7A 4GLKA 4E7LA 4OMFB 2LC4A 4M7AA 3JB9D 1X75C 2BUDA 2KDSA 2ZPGB 4HKEA 4M7DE 3JCMf 1HXDA 3M9QA 1KQ1A 1N8RU 1Q86U 4IKFA 1VQMT 3OS2A 2FHDA 3WVDB 4B9XA 2KY9A 4M7DD 3FEOA 4J5YA 2K5IA 2QQSA 3RERA 3INZA 1AHJB 4RCBA 5GANg 2I2LA 2RO0A 2YLBA 3JSCA 4EMKB 3KXTA 3OB9A 3JB9J 1YHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGS B;  2DPP B;  2WSC E;  3VYG A;  2PVG B;  4OB1 B;  4Y28 E;  2QDY B;  3A8O B;  3X20 B;  1UGP B;  2DXB A;  2ZPE B;  2AHJ B;  3QYH B;  4OB2 B;  3QYG B;  1QP3 A;  2CZ6 B;  1DJ7 B;  3HHT B;  1UGR B;  4ZGD B;  2DD5 A;  2DD4 A;  2CYZ B;  2PUK B;  3LW5 E;  2PU9 B;  2CZ0 B;  1PSF A;  2PUO B;  3X28 B;  2D0Q B;  2O01 E;  3A8M B;  4XK8 E;  2DXC A;  4OB0 B;  3VYH B;  1PSE A;  5L8R E;  2PVO B;  4KT0 E;  3X25 B;  4L6V 5;  3WVE B;  4FM4 B;  3QZ9 B;  2ZPB B;  4ZGE B;  2CZ7 B;  4RKU E;  1QP2 A;  4OB3 B;  2ZPH B;  1GXI E;  4ZGJ B;  1UGQ B;  2PVD B;  2WSE E;  2ZCF B;  2ZPI B;  2CZ1 B;  1V29 B;  3X26 B;  2WSF E;  2ZPG B;  2ZPF B;  3A8G B;  2ZZD A;  3WVD B;  3QXE B;  3A8L B;  1JB0 E;  3QZ5 B;  1IRE B;  1AHJ B;  3X24 B;  3A8H B; 
#chains in the Genus database with same CATH topology
 4B9W A;  4LE9 A;  1MND A;  1UGS B;  2A7Y A;  1S72 Q;  4Q5W A;  1VQP Q;  1YJN T;  1QWE A;  5GAO n;  2DBK A;  2JM9 A;  2K4Y A;  3JCM e;  3JCM W;  5IHK A;  2NUP B;  4RTT A;  1VQ4 Q;  2KE9 A;  2RQW A;  3OS1 A;  5HKC A;  2JZ2 A;  4FT4 A;  4KGV B;  4C92 C;  5GAO q;  4M7D A;  1M3B A;  2J06 A;  2CP0 A;  1KQS S;  1WXU A;  5CVI A;  5IT9 E;  3HSB A;  1NG2 A;  5GAN 2;  1OYX A;  2JW4 A;  1N27 A;  2HBW A;  2PUO B;  1Q86 C;  1RAH B;  3ZL7 C;  2PQW A;  4BAC A;  1YIJ T;  1VQ5 T;  1AOJ A;  1VQK Q;  1G3Y A;  2KR3 A;  4A4E A;  5GAN 6;  4HCZ A;  4EMH A;  1TUG B;  2DXC A;  3HFN A;  4J6Y A;  2AKL A;  3CEY A;  5L8R E;  1QCF A;  1WX6 A;  3X25 B;  2LNH B;  4C92 B;  2XMF A;  4FM4 B;  2LCS A;  5GJV B;  2J05 A;  2RQT A;  5KCH A;  1VYU A;  1S1N A;  2QA4 T;  2KSS A;  1FWZ A;  2QTX A;  2FEI A;  3SEM A;  3VV0 A;  2C0O A;  1UGV A;  3UA7 A;  5I2S A;  2DYI A;  3PGG A;  3QWY A;  2GQI A;  4XTV A;  1NJI R;  1RLQ C;  5GAM j;  2RI5 A;  3V8L A;  2RJF A;  2KK4 A;  4IUR A;  2LQW A;  2DVJ A;  1Q81 U;  3JCM J;  2MK5 A;  2YRC A;  3EFS A;  5CKB A;  3A8L B;  1UHC A;  3FLG A;  2GFA A;  3OYM A;  3CCS A;  3S3N A;  3J7A F;  1Q82 R;  1UE9 A;  1Q95 G;  2DK3 A;  3GNG A;  4A4G A;  2JNG A;  1VQ7 Q;  1U8R A;  2YRD A;  2EGC A;  2AIR B;  2YHT A;  1NZ9 A;  2MYS A;  4C8Q C;  2YUN A;  1KD1 C;  1NM7 A;  2QQR A;  1B3Q A;  1BU1 A;  2H3J A;  3M4Y A;  4KGX B;  4R0K A;  2E41 A;  4ME7 A;  2ROL A;  2EFI A;  4N4G A;  3QYH B;  1OX9 A;  2ROT A;  2V8I A;  2CZ6 B;  5FRN A;  3HHT B;  1RL2 A;  1ZA1 B;  4PNO A;  3TQ7 P;  1F1B B;  4M75 B;  3EH1 A;  1UG1 A;  2GGR A;  3ME9 A;  1K4U S;  1QW1 A;  4RG8 A;  3VS0 A;  1J3T A;  1MMG A;  4FU6 A;  1I5L A;  3CBO A;  2P4T A;  4C8Q B;  1RI9 A;  2D6F A;  3EFO B;  2FZK B;  3OMG A;  3VS6 A;  3VYH B;  2KMT A;  5KYY A;  4XU0 A;  3NMZ C;  1VQL A;  2O4X A;  3QKJ A;  1IB8 A;  4XU2 A;  2YWW A;  2GTJ A;  3QZ9 B;  2K3X A;  2EBP A;  1KIK A;  4JLG A;  3QII A;  3RKW A;  2HQE A;  1ZUY A;  2RJE A;  3VUZ A;  5HY6 A;  3I55 Q;  1BI1 A;  1QVG A;  1VYV A;  5AYF A;  2W0Z A;  1GBR A;  2OTL T;  5IHN A;  2CSQ A;  1W1F A;  2DAQ A;  5DLQ E;  1H3Z A;  2ECZ A;  3GOX A;  3CBP A;  4MMK A;  4F16 A;  4B6M A;  2ZZD A;  3CCU A;  1I5O B;  2LT4 A;  1KD1 U;  2QEX A;  2BZY A;  1N8R R;  2OTJ T;  3BFM A;  2F5K A;  1OI1 A;  1PD0 A;  1JB0 E;  3CD6 T;  1IRE B;  4JRP A;  1EZZ B;  1WQ7 A;  1QKW A;  1D3B B;  3OYK A;  1K76 A;  3OBW A;  1LJO A;  4ANJ A;  1NEB A;  4RG2 A;  3FIF A;  5LJ3 f;  1EX4 A;  2M16 A;  3HL8 A;  3LH5 A;  2B8A A;  5LJ5 h;  1BI2 A;  5GAN 7;  3OY9 A;  2DKG A;  2FB7 A;  2DL4 A;  5CKH A;  1UGP B;  3G4S T;  2DXB A;  1OZ2 A;  4FYY B;  3EG0 A;  1YJW Q;  3OYF A;  2KRS A;  2RF0 A;  1R0B G;  2O2O A;  1M8V A;  1WXB A;  2LQK A;  1NPP A;  4A54 A;  2DFU A;  2LJ0 A;  1I0C A;  5CQX A;  1W70 A;  3SB2 A;  2E70 A;  5GMK h;  2LZ6 B;  4KGZ B;  2EWN A;  1PSF A;  3NTH A;  2DZC A;  3M54 A;  2X4J A;  2CUB A;  2EIF A;  3LLR A;  5J39 A;  2LJ1 A;  5LJ5 d;  4C5G A;  4E7S A;  2O01 E;  2EPD A;  2HEQ A;  3C4S A;  3N5B B;  4E6R A;  4DA4 A;  3CC7 Q;  2DTO A;  1HSQ A;  1ZUU A;  3CCR T;  5LJ5 j;  2EAY A;  2Y4X A;  1M4Z A;  3KUF A;  5A2Q E;  3CC4 A;  2KT8 A;  2JN0 A;  2RHU A;  5C6S A;  4M77 E;  4JZ4 A;  1ZSZ A;  1C6V X;  5GAM g;  3RIR A;  2JXB A;  2RD1 A;  2YRV A;  1ARK A;  1QMC A;  3O8V A;  3CME Q;  4YTL A;  1G8X A;  4C0D C;  4A63 B;  3FRN A;  1QVG P;  3HRU A;  1S72 A;  4PJO G;  1VQP A;  2X4X A;  1ZHI A;  4M78 A;  2EKH A;  4AT1 B;  3V8K A;  3OW2 A;  4PL6 A;  1E7O A;  4D8D A;  1M2V B;  4L5G A;  3TCJ A;  2LRQ A;  3E19 A;  4FSX A;  4OVA A;  4HT8 A;  3REA B;  3QXE B;  3L2V A;  3CMA T;  1GRI A;  1WFW A;  3OMC A;  5KYX A;  5FU7 C;  2RMO A;  1JQQ A;  4WCI A;  2RH2 A;  1QVF S;  1IGQ A;  3VS1 A;  5I11 A;  4M78 G;  2DLP A;  1X01 A;  4J9E A;  1SEM A;  4C0D B;  1EFN A;  3VYG A;  4Z8A A;  4LDV A;  4XAX B;  1Q7Y R;  1VQK A;  5FWB A;  3UDC A;  1YJN Q;  2LJ3 A;  1WLP B;  2JT4 A;  1BYM A;  4E7Z A;  1ACM B;  4R55 A;  5GAO r;  2NWM A;  2VXE A;  4QW2 A;  3I5R A;  3MP8 A;  4DBH A;  1ZBJ A;  1KJW A;  5FU7 B;  5GAN e;  3GPL A;  4TVR A;  4N0A A;  2XG8 D;  2KVQ G;  3A1P A;  4FYX B;  4F7U G;  1IGU A;  2EYZ A;  3JCM Q;  3JCM V;  1K9A A;  1E6H A;  2H8H A;  3G71 A;  1YJ9 T;  4KUI A;  2DZ9 A;  2J6K A;  1VUB A;  2AT1 B;  1JRI A;  2O4X B;  1I07 A;  2AZS A;  4OGC A;  3MCA B;  1H3H A;  2JJ9 A;  2KXC A;  2BE9 B;  1FMK A;  1P92 A;  2DEU A;  1NEG A;  2HMA A;  3TSW A;  1UDL A;  3JCM b;  2Y90 A;  3M0P A;  3M0R A;  1VIE A;  5IH2 A;  2MWP A;  1WJS A;  3DKM A;  2RK1 A;  3V7R A;  3GF5 A;  3H0F A;  2EQU A;  2RNA A;  1VQ7 A;  2GBQ A;  4E7L A;  3JB9 D;  2ZPG B;  5FW9 A;  1JU5 C;  1HXD A;  1KQ1 A;  2P4R A;  2HCK A;  4GLM A;  3OS2 A;  2KEA A;  1R77 A;  3I9Q A;  2RQU A;  1AWO A;  1AZE A;  2K5I A;  2QQS A;  2K9G A;  3EG9 B;  3JSC A;  2K79 A;  3JB9 J;  1YHQ A;  3A98 A;  1VQL Q;  4MDW A;  2DYB A;  1BKB A;  3C12 A;  2D9T A;  4Y28 E;  2QDY B;  1MNE A;  1VA7 A;  3KFV A;  2L8D A;  1I8F A;  1YN8 A;  2KQW A;  3TEE A;  5KYU B;  1K9M R;  4J8O A;  4MZP A;  4PJO C;  4E7I A;  2V26 A;  3TVT A;  2LVM A;  2E3H A;  2HKQ B;  2C06 A;  2DL5 A;  2DRM A;  2JOY A;  2BKD N;  2L3Q A;  2HSE B;  3M0Q A;  2QEX Q;  5LJ5 g;  4AG1 C;  5CKF A;  2DXT A;  5KYW A;  3EGU A;  4IUT A;  3H41 A;  3BDU A;  2LQ8 A;  1M1G A;  1N5Z A;  4LD6 A;  4PJO B;  3OYH A;  1NBE B;  2CZ7 B;  4Y91 A;  6AT1 B;  3UAT A;  2MAM A;  3CCJ Q;  2VXF A;  2ZPH B;  4PJJ A;  2KRM A;  3H8Z A;  2OI3 A;  1D1B A;  1VQ9 A;  4M7A E;  1X43 A;  3OS0 A;  2D8J A;  3SWN C;  4AMC A;  1UTI A;  2CZ1 B;  4JJD A;  4A4F A;  2F2X A;  2E65 A;  1FMV A;  3NFC A;  4JUV A;  2EW3 A;  1LNX A;  1VQN T;  2LX9 A;  1AVZ C;  2VGM A;  3RUX A;  3FJP A;  4CC3 A;  1YJW A;  5GAN 4;  4LD9 K;  1M5Q 1;  3Q1J A;  2J6F A;  2EQK A;  1MV3 A;  1Y96 A;  5HCK A;  4HCK A;  5GAO p;  3LWH A;  3CC4 Q;  2EVR A;  1I4K 1;  2XKO C;  2HL3 A;  1VQ8 T;  3SWN B;  3C0C A;  1NYF A;  1PWT A;  2NLU A;  3CC7 A;  1ABO A;  4Z02 A;  1OPK A;  5HK3 A;  2JM8 A;  2FRW A;  1GCQ A;  3V8J A;  1DJ7 B;  3VU3 C;  1O9S A;  4F7U B;  3MEW A;  1Q81 C;  2LNV A;  1RUW A;  1W4S A;  4LXC A;  1TS9 A;  1BB9 A;  2E6Z A;  2OAW A;  4XTZ A;  2R5A A;  1MMA A;  3PNW C;  1VQO T;  3JCM c;  4M77 D;  2EYX A;  2A08 A;  3QBY A;  1UJ0 A;  3OYG A;  1WQW A;  3CME A;  1AWX A;  2LQN A;  3CCQ A;  1YIT Q;  3S6W A;  1KQS A;  5CCA A;  4CC4 B;  2IG0 A;  4KH0 B;  2LMJ A;  3CCM T;  3CPW S;  1WI7 A;  5A0L A;  1FX7 A;  3MET A;  5GAM h;  2BE7 D;  3QHS A;  4L59 A;  5I22 A;  4A4K A;  1UEB A;  1VQ6 T;  2FG0 A;  2X4W A;  3RKY A;  4IIO A;  1WIE A;  1O75 A;  3JB9 F;  4M7D G;  3NGP A;  1NE8 A;  1T3S A;  4EIK A;  4ATO A;  4HA8 A;  3M58 A;  2KAF A;  2LCL A;  1WJR A;  1VQM A;  2OJ2 A;  5CQY A;  4OMP A;  3QSU A;  1I1J A;  3VKI A;  2GFU A;  2HBP A;  1TUD A;  1Y71 A;  1Y0M A;  2LTO A;  3CCS T;  2QK0 A;  1NYG A;  1KG1 A;  3MEU A;  2KGT A;  3X26 B;  3TRE A;  1RLP C;  2WSF E;  3A8G B;  5GAM d;  4C5E A;  2O9S A;  1N9S A;  3EG3 A;  1Q86 R;  1YJN A;  4X9C A;  1D1A A;  4IUU A;  3RR6 A;  5D6X A;  4QKU A;  2C0I A;  2JTE A;  3A8H B;  5ECA A;  1X69 A;  4F17 A;  2F1L A;  3G71 Q;  3G1J A;  2HDA A;  4OML A;  3VS3 A;  3OSV A;  3GIB A;  3QJ6 A;  4WF2 A;  2DMO A;  2K3B A;  1WHH A;  3CCL Q;  4C92 E;  3QDR B;  2GF7 A;  4KUD K;  2V1Q A;  2E3I A;  5CO7 A;  2HQH A;  4M75 C;  1VQ5 A;  2CRE A;  4QT7 A;  1TOV A;  3HTR A;  4ZGD B;  2DD5 A;  4FYV B;  3REB B;  2PUK B;  5LJ3 e;  3VRZ A;  1K0S A;  2CZ0 B;  2VYT A;  5KE3 A;  3J81 E;  2MPX C;  1KSW A;  1MMD A;  4OGE A;  4DOW A;  2CGH A;  5CR2 A;  2O9V A;  4Z88 A;  1SSH A;  3MJX A;  2HNI A;  5CAI A;  4J9G A;  1PRM C;  3CCV T;  2XU8 A;  3M0S A;  1KQS P;  3CPW P;  1YHQ Q;  5J26 A;  2L3S A;  2RHZ A;  3EGD B;  2G3R A;  2RHY A;  3CCE T;  4L6V 5;  2XDP A;  4FL6 A;  2YDL A;  3ZEH A;  3I56 T;  4ORZ A;  2RQR A;  3NPF A;  3RMQ A;  2EYW A;  2HL5 C;  2SEM A;  2O31 A;  1KD1 R;  4HCC A;  2DX1 A;  4J9F A;  4NS5 A;  5IXF A;  1UJY A;  1G3S A;  1PM3 A;  1NJI U;  3JCM d;  4ZGJ B;  1UGQ B;  1M2O A;  1OOT A;  1ABQ A;  3G6E Q;  3OQ5 A;  3ULR B;  2C0T A;  4Z89 A;  3OBY A;  3RBB B;  1RAC B;  3AHU A;  3ASK A;  2CP7 A;  3V7C A;  2COW A;  3M55 A;  3P8B B;  1Q82 U;  4J9I A;  1SKU B;  1SHG A;  3EAE A;  1PKT A;  4M75 E;  4QVC A;  3OYN A;  4DEY A;  2YUQ A;  2LT1 A;  2J6O A;  2RM4 A;  1WYX A;  1U1T A;  1WZO A;  3M0T A;  5AT1 B;  2EGA A;  3D7S B;  1LOJ A;  1D1C A;  4C8Q E;  2WSC E;  3JRZ A;  2E4H A;  2ENM A;  3A8O B;  4M7D C;  5FU6 C;  3CC2 T;  5GAN 8;  3C94 A;  2CDT A;  1QVP A;  2IIM A;  1D0Y A;  1X2K A;  3BY7 A;  4M77 F;  1TU0 B;  3JCM P;  1VQ9 Q;  4PKC C;  2CYZ B;  2XIC A;  4LUE A;  3L42 A;  4ZN3 A;  2JUF A;  2DIL A;  4XTY A;  4AFS C;  2D0Q B;  2D8H A;  3HRS A;  3CCJ A;  2QXF A;  3P8D A;  1PSE A;  1X6O A;  1JJ2 A;  4DQ2 A;  5LL6 S;  4M7D B;  1KFZ A;  5FU6 B;  1PHT A;  5LJ5 f;  1JJ2 S;  4BE1 A;  4CRI A;  1UEC A;  4M7A D;  3QJY A;  5IAY A;  4FSS A;  2FPD A;  4QQD A;  2OTL A;  4DBQ A;  1S72 T;  3EHQ A;  3MP1 A;  4J9C A;  2M1H A;  2WSE E;  2F2V A;  2EYY A;  2CP6 A;  2LDM A;  4LUD A;  4JLI A;  2OTJ A;  1D09 B;  2MWO A;  1VQ4 T;  3OA6 A;  4OMF B;  4M7A A;  4M7D E;  1N8R U;  2FHD A;  3WVD B;  2YSQ A;  3FEO A;  1BCO A;  1RAF B;  2CP2 A;  3INZ A;  1AHJ B;  2I2L A;  2YLB A;  3VS2 A;  3CCQ Q;  1YP5 A;  1KQ2 A;  5DLO A;  3G4S A;  1D0Z A;  2FZG B;  4ZTF A;  2RN8 A;  2QI2 A;  4E7K A;  2QQB A;  3QPH A;  3FC3 A;  4KH1 B;  4UC4 A;  3NHN A;  4R56 A;  3OYE A;  1GBQ A;  1W2B S;  1B34 A;  1WJQ A;  4HT9 A;  1QVF A;  1ZA2 B;  1YIT A;  4IUV A;  4E47 A;  1VQM Q;  4XTU A;  3EGX A;  3OYL A;  1ZX6 A;  4JJB A;  1YFN A;  2K7A A;  2EQM A;  1NLP C;  4AFU C;  3CCR A;  1TG0 A;  2EGE A;  5EG2 A;  1Z9Q A;  3NTI A;  2E6N A;  2X3X D;  3CBM A;  2IVW A;  1SSF A;  3OYJ A;  2PVO B;  1JJ2 P;  4PLL A;  1LCK A;  1OU8 A;  2Y4Y A;  2MCN A;  2DNU A;  3CQT A;  1OZ3 A;  2HSP A;  3OYY A;  2BZX A;  2HKN A;  1LVK A;  1T0J A;  1VQ7 T;  4EMK A;  4OF1 A;  2X3W D;  4E7J A;  1OU9 A;  1N9R A;  1YIJ Q;  1D0X A;  2DXU A;  3JCM g;  1VQ5 Q;  3CMA A;  4QVD A;  1AEY A;  2LX7 A;  2PZ1 A;  3PMT A;  5KYY B;  2NUP A;  2DIQ A;  4LDU A;  1T0H A;  1YI2 T;  1G2B A;  3CCL A;  3SDZ A;  1TUC A;  1YWP A;  2DA9 A;  4C92 D;  3L1A A;  2V8J A;  4X1V A;  1T3L A;  3FJ5 A;  2QA4 Q;  1WDX A;  3P8H A;  2VVK A;  2DPP B;  4NL2 A;  2DE0 X;  3BDL A;  5GMK l;  2PVG B;  2R58 A;  3FDR A;  1GFC A;  2CSI A;  4EDU A;  4E7H A;  3HPW A;  1X27 A;  2QQ9 A;  1OUL A;  4XTW A;  3H9N A;  4C92 A;  1QVF P;  4M4Z A;  1M1K C;  3LW5 E;  5EC7 A;  3R6N A;  2ED0 A;  2PU9 B;  2KNB B;  3I55 T;  3VS5 A;  1JEG A;  5KH6 A;  3JCM X;  3X28 B;  4N4I A;  3GBQ A;  1MUZ A;  4XQ3 A;  4M7A F;  2L0A A;  4MZM A;  2EJ9 A;  4RTZ A;  1TWB A;  2A36 A;  5L23 A;  4OB0 B;  5GMK i;  1H92 A;  1WPY A;  1IO6 A;  3G6E A;  3DLL A;  2KRN A;  3EHR A;  4V2S A;  3L2U A;  1ZSZ C;  1PCX A;  4C5I A;  2CT4 A;  3VS7 A;  3CCV Q;  3L2W A;  1IHW A;  2ZPB B;  4C5H A;  5GAN h;  4RKU E;  3CCE Q;  2B86 A;  2L3P A;  4LDY A;  1BK2 A;  3I56 Q;  1GXI E;  1WHG A;  1OPL A;  4M75 D;  4AG2 C;  4LNP A;  4M78 C;  2VV5 A;  4JPB W;  3QDF A;  2O88 A;  3SD4 A;  1M30 A;  2CH4 W;  1UFF A;  4EMG A;  4C8Q D;  3M4G A;  1GFD A;  1ZSZ B;  1HYO A;  5GAN d;  2P0K A;  1B7T A;  2L5Q A;  4ESR A;  4HVW A;  3LH0 A;  2M0Y A;  1M1K U;  1NLO C;  1K8A U;  1BBZ A;  5GAN j;  4JS4 A;  2DET A;  4C8Q A;  2COY A;  1MGQ A;  4M78 B;  3EFO A;  2OTL Q;  1RAG B;  1HJD A;  2ZPE B;  4D8K A;  4PJL A;  2DER A;  1K9M U;  2BTT A;  4PJO E;  3QYG B;  4DOV A;  2FPE A;  2GNC A;  3CC2 Q;  1EIF A;  1H8K A;  5KYX B;  2OTJ Q;  1M1F A;  3U23 A;  8AT1 B;  1IRX A;  2VC8 A;  1SG5 A;  2K5F A;  4II1 A;  3UA6 A;  2NYS A;  3CD6 Q;  4N0A C;  1XTD A;  3OYI A;  1X6G A;  4KBM B;  4LN2 A;  2KXD A;  5I2M A;  1PRL C;  3OS5 A;  2AZV A;  4JRQ A;  1X6B A;  2KRO A;  4EPC A;  2J7I A;  4A53 A;  2OX7 A;  4M78 E;  5J3B A;  1I81 A;  1C0M A;  1WHM A;  2FYK A;  3G4S Q;  1ZQ1 A;  3PTA A;  1AD5 A;  1BIB A;  2DVE A;  1SHF A;  4F04 B;  2M9U A;  3UT1 A;  3RKX A;  2JTF A;  3OYC A;  1KC8 U;  3GLX A;  1GL5 A;  4O6J A;  4ZGE B;  3MHX A;  3CXC A;  2BIV A;  1D3B A;  1RAA B;  1K73 U;  1QCO A;  3CXC S;  1XOV A;  1M9S A;  2H3E B;  4ELZ C;  4J9H A;  2PVD B;  1VQN A;  1ZBX A;  4FT2 A;  3CPW A;  3ZBD A;  3H0H A;  5CKD A;  4C92 F;  2G6F X;  1M90 U;  1OEB A;  3H0I A;  3SHW A;  1Q81 R;  2ZPF B;  3CCR Q;  2JMC A;  4BUG A;  4F7U E;  3QO3 A;  4M77 A;  1CKA A;  2VWF A;  4J6W A;  5IN1 A;  4PK4 A;  1AWJ A;  1VQ8 A;  3S3M A;  1PG5 B;  1WXT A;  5GAM f;  5CIU A;  2YT6 A;  2PNI A;  2E10 A;  7AT1 B;  3PFS A;  2COZ A;  2JVV A;  4FIB A;  2A3L A;  4OMN A;  1Y07 A;  2JTM A;  1JXM A;  4M77 G;  1ZUK A;  2XID A;  1W6X A;  1QLY A;  3QG1 A;  1NJI C;  3JV3 A;  2YLC A;  5GMK m;  4D6W A;  1WHL A;  4J7I A;  3OYD A;  2XHC A;  1VQO A;  3M56 A;  2D1X A;  3C95 A;  1MV0 B;  1RAD B;  3MEV A;  3CMA Q;  1R8O B;  2DD4 A;  4RTU A;  3T9N A;  2K57 A;  2DL8 A;  3CCM A;  1Q82 C;  1MHN A;  4XK8 E;  1IHV A;  2R5M A;  4PFZ A;  1WGS A;  4JS5 A;  3OYA A;  1VQ6 A;  1YIJ A;  3CPF A;  1WA7 A;  2M51 A;  1M2V A;  2KI7 A;  1XNI A;  2XI9 A;  3E1S A;  2L3R A;  4M75 F;  3E2U A;  1FXX A;  3EG1 A;  4AFQ C;  3RDV A;  2RI2 A;  3SFM A;  3PE0 A;  1VQL T;  3EH2 A;  3RNJ A;  4C8Q F;  3JCM h;  3CXC P;  2QA4 A;  2CP5 A;  2QAS A;  4BY6 C;  2VKN A;  3R6O A;  5LJ5 e;  3QWX X;  4LDW A;  2FVU A;  3VRY A;  5KYW B;  3M0U A;  1FYN A;  2KDS A;  4HKE A;  4J9B A;  3JCM f;  1Q86 U;  4IKF A;  1YJ9 Q;  4B9X A;  4JZ3 A;  1B07 A;  4FYW B;  4J5Y A;  1YI2 Q;  4OMO A;  2QG9 B;  4RCB A;  5GAN g;  2DBM A;  1X2Q A;  2IPO B;  3OB9 A;  5GMK e;  3CCU T;  4E2F B;  3UF4 A;  2QEX T;  2VAS A;  3JAM E;  1YCY A;  2AK5 A;  2FRY A;  4IUP A;  5DY9 A;  2ESW A;  4BD3 A;  4BY6 B;  3DLM A;  2RB6 A;  3THK A;  1Y7X A;  4ELY C;  3V7S A;  3MEA A;  3LWI A;  2MIO A;  3ER0 A;  2HAX A;  1GCQ C;  2BZ8 A;  1CKB A;  4J83 A;  2HZY A;  2DL7 A;  3FB9 A;  2X9H A;  2WAC A;  4X9D A;  1UGR B;  5GAN 3;  2W10 A;  3OSS C;  2E5Q A;  3LGF A;  1Y57 A;  3CCJ T;  2V8K A;  5KCO A;  1Y96 B;  3CCV A;  1G5V A;  1N8R C;  1NPR A;  4PFO A;  4XTX A;  5GAO m;  2K3Y A;  3CCE A;  2JS0 A;  5KYN A;  3E9F A;  2CS7 A;  3I56 A;  3EG2 A;  2YUP A;  4C0F A;  3OYB A;  4GY5 A;  3L2Z A;  3J80 E;  2E64 A;  4M7D F;  4BDZ A;  2X4Y A;  1QVG S;  3PIO A;  4KT0 E;  5A0G A;  2QQA A;  2YUO A;  2CUD A;  3AT1 B;  2NUZ A;  3HP9 A;  5GAN 5;  1SF9 A;  3URG A;  4NL3 A;  4MDX A;  2DM1 A;  5A0D A;  4M77 C;  5LJ3 h;  1SRL A;  2QGG A;  2A37 A;  3L2R A;  1OV3 A;  3EG9 A;  1QP2 A;  5M9O A;  4KRT A;  2CKK A;  4OB3 B;  1RAE B;  4QQ6 A;  3CC4 T;  4DBF A;  2DRK A;  5FWC A;  2DL3 A;  4DEX A;  2QGF B;  2DJQ A;  1QWF A;  1RI0 A;  4ZNX A;  4IIM A;  3S3O A;  3PVL A;  3LX7 A;  4PFP A;  2DJZ A;  2DF6 A;  2DTI A;  5KYU A;  4PJN A;  2QYZ A;  5LJ3 d;  2E5K A;  2XD0 A;  5I21 A;  3RES A;  1VQP T;  1OX8 A;  3L2Q A;  4M77 B;  3M53 A;  5IHI A;  3M59 A;  3PIP A;  3CC2 A;  2X51 A;  4PJO D;  1WNL A;  4NOY A;  3CD6 A;  5LJ3 j;  2X35 A;  1KHI A;  1PNJ A;  1YIT T;  1ZLM A;  4OB1 B;  4QQG A;  1KHC A;  2LP5 A;  2P0Q A;  4ZN1 A;  1G83 A;  1HK9 A;  1CSK A;  2MOX A;  1SRM A;  4OP0 A;  4BI4 A;  1AWW A;  1UUE A;  1YBY A;  3UWN A;  4P5N A;  4KUL A;  2EQJ A;  1TH7 A;  2EKO A;  1U1S A;  1VQN Q;  2KYB A;  4BI3 A;  2VB6 A;  1QP3 A;  2VGN A;  4OMM A;  1VQK T;  2NUT A;  1E6G A;  4M78 D;  4M7A G;  1V76 A;  4PJO A;  2QDL A;  1A0N B;  3QUI A;  1FMW A;  2KBT A;  3A5Z B;  2K2V A;  2XDB A;  1PD1 A;  1TXQ A;  3LGL A;  4BE0 A;  4MZT A;  2L2P A;  4JRK A;  2ZGW A;  2F2W A;  3VJP A;  4O5V A;  3A8M B;  1W2B A;  1UB4 A;  1QCN A;  2RQV A;  4BDY A;  2L89 A;  2KT1 A;  3DB4 A;  5GMK j;  1VQ8 Q;  5C0M A;  1H64 1;  1M8M A;  5FLX E;  3M57 A;  1JO8 A;  3WVE B;  4RMO A;  3HRT A;  4J6X A;  2F69 A;  1Q7Y C;  2DTH A;  4CI0 C;  1BIA A;  3OW2 S;  1VQ4 A;  3E9G A;  2ATC B;  2HQX A;  3G71 T;  1VYT A;  4X34 A;  3GP8 A;  4JRI A;  4RUG A;  5KE2 A;  4CC2 A;  3F70 A;  2ZPI B;  3UPU A;  1VQO Q;  1AT1 B;  3MPU B;  4BB7 A;  3CCL T;  2D0N A;  4HVU A;  1U5S A;  1M3C A;  1HD3 A;  1VIF A;  3SWN A;  1WHJ A;  4MML A;  2EJG A;  3PMI A;  4FW2 A;  3CCM Q;  2A28 A;  4HXJ A;  3BE3 A;  2AKK A;  2GQV A;  1IZ6 A;  3M5A A;  4RTX A;  3X24 B;  4F7U A;  3H6Z A;  1VQ6 Q;  2MMP A;  1Z9Z A;  4OMQ A;  2EJF A;  4JJN K;  3I5S A;  2EYQ A;  1R0C B;  1AZG B;  1JBM A;  1UHF A;  4C0Z A;  4RCC A;  2YXY A;  3HFO A;  4AFZ C;  4C0G A;  1YHQ T;  3CCS Q;  2RK2 A;  2Z0W A;  4RTY A;  4WTO B;  2E12 A;  2LCC A;  1N6A A;  2MF2 A;  3VS4 A;  3MKD A;  5CK9 A;  1K1Z A;  3MP6 A;  3JB9 I;  1MMN A;  2EQI A;  1M3A A;  2RI3 A;  5FRM A;  2FO0 A;  3LYI A;  3ZFJ A;  1TTH B;  3PVQ A;  2K2M A;  2M02 A;  2RPN A;  1U3O A;  3KBG A;  3I35 A;  1Q7Y U;  4CC7 A;  2HD0 A;  2QAZ A;  3G6E T;  2K6D A;  4K11 A;  1KK7 A;  2DO3 A;  2XDD A;  2GCX A;  4FCY A;  1W2B P;  3TSZ A;  2FPF A;  1XJW B;  1K8A C;  1M27 C;  1RAB B;  2I0N A;  1PKS A;  4RTW A;  3DB3 A;  3OW2 P;  1XQH A;  2RHX A;  1YJ9 A;  4J9D A;  3PT9 A;  4PLI A;  4RTV A;  5FRO A;  1K9M C;  1JXO A;  4C92 G;  1YI2 A;  2E1H A;  2M0O A;  4J7F A;  2ZCF B;  4XU1 A;  1OQK A;  1ZSG A;  1BI3 A;  4M7A C;  1YWO A;  4PJM A;  2ZAE A;  3TU4 K;  2R57 A;  4XU3 A;  5DM7 R;  1M1K R;  2RHI A;  2DEQ A;  1K8A R;  3JB9 G;  2JS2 A;  5D7U A;  2RJC A;  1V1C A;  1VOM A;  1WHK A;  1YNZ A;  4PJO F;  4BE2 A;  4IUQ A;  1VQ9 T;  1QKX A;  1RAI B;  3QZ5 B;  5LJ3 g;  2JMA A;  1BCM A;  5HK0 A;  1SPK A;  4QVZ A;  2ED1 A;  5GAN f;  1YJW T;  1KC8 C;  2VUB A;  2V1R A;  5CKE A;  4M78 F;  3CCU Q;  4JDS A;  4M7A B;  3X20 B;  3EFR A;  3I55 A;  1K73 C;  2P0P A;  1LPL A;  2AHJ B;  3BW1 A;  1QQJ A;  2PTK A;  1TSF A;  4OB2 B;  3EGD A;  1YCS B;  5GAM e;  3HKS A;  2RJD A;  2KYM A;  4F14 A;  4M75 A;  3O5Z A;  4GBQ A;  1M90 C;  4Y92 A;  1BI0 A;  4DBR A;  3G7Z A;  2F5T X;  2NUT B;  4LDX A;  3CC7 T;  4ZTJ A;  3VUB A;  2CP3 A;  5D6Y A;  8ATC B;  1KC8 R;  2ABL A;  3GNF B;  1IXD A;  2K5L A;  2MI6 A;  3MO8 A;  1K73 R;  2RA2 A;  1PC0 A;  1G3T A;  4M75 G;  3RMS A;  1K0X A;  2FZC B;  1B34 B;  3NTK A;  4F7U F;  5GAO l;  2QTV A;  4VUB A;  1M90 R;  3EGX B;  3CME T;  4C8Q G;  1GCP A;  1U06 A;  2CT3 A;  4EMK C;  3CCQ T;  4N4H A;  4FW1 A;  4JJC A;  5D6W A;  2SRC A;  2A0F B;  2DIG A;  4HCB A;  4BI8 B;  9ATC B;  2GTO A;  4A4H A;  2XK0 A;  1G3W A;  3JB9 H;  5IXB A;  2OAU A;  3WXM B;  1V29 B;  2FL7 A;  4GLK A;  2LC4 A;  4HVV A;  1X75 C;  2BUD A;  3M9Q A;  5GJW B;  1C1A A;  1VQM T;  2P84 A;  2KY9 A;  4M7D D;  2CH4 A;  3RER A;  3IQL A;  3KXT A;  2RO0 A;  4EMK B; 
#chains in the Genus database with same CATH homology
 4B9W A;  5DLO A;  3G4S A;  3CCU T;  1UGS B;  2A7Y A;  2QEX T;  4Q5W A;  3JAM E;  1YCY A;  4ZTF A;  1YJN T;  4IUP A;  2QI2 A;  5GAO n;  4E7K A;  4MDW A;  2K4Y A;  5DY9 A;  1BKB A;  2QQB A;  3C12 A;  4BD3 A;  3JCM e;  3JCM W;  3QPH A;  2D9T A;  4BY6 B;  4Y28 E;  3DLM A;  2QDY B;  2RB6 A;  3FC3 A;  1Y7X A;  4UC4 A;  4ELY C;  3V7S A;  3MEA A;  4R56 A;  3LWI A;  2L8D A;  3OYE A;  1I8F A;  3ER0 A;  3OS1 A;  2KQW A;  3TEE A;  5HKC A;  2HAX A;  2JZ2 A;  4FT4 A;  4C92 C;  5GAO q;  4M7D A;  1W2B S;  4J83 A;  1B34 A;  1WJQ A;  4HT9 A;  1QVF A;  1YIT A;  4IUV A;  3FB9 A;  4E47 A;  2WAC A;  3JCM d;  4X9D A;  4J8O A;  4MZP A;  4XTU A;  1KQS S;  1UGR B;  5GAN 3;  3OYL A;  4PJO C;  4E7I A;  3OSS C;  5CVI A;  5IT9 E;  2E5Q A;  3HSB A;  2LVM A;  3LGF A;  3CCJ T;  2V8K A;  1OYX A;  2EQM A;  5KCO A;  1Y96 B;  5GAN 2;  3CCV A;  1G5V A;  1N27 A;  1N8R C;  1NPR A;  2PUO B;  3CCR A;  1Q86 C;  2C06 A;  2JOY A;  2PQW A;  4XTX A;  2BKD N;  4BAC A;  1YIJ T;  1VQ5 T;  5GAO m;  2K3Y A;  1G3Y A;  5EG2 A;  4A4E A;  5GAN 6;  5LJ5 g;  3CCE A;  3E9F A;  4HCZ A;  4EMH A;  2DXC A;  2CS7 A;  3HFN A;  3NTI A;  4J6Y A;  3I56 A;  2E6N A;  5CKF A;  4C0F A;  3CBM A;  2DXT A;  4GY5 A;  3OYB A;  3CEY A;  3L2Z A;  3J80 E;  2E64 A;  4M7D F;  4BDZ A;  2X4Y A;  2IVW A;  1SSF A;  1QVG S;  5L8R E;  2PVO B;  3OYJ A;  3PIO A;  4KT0 E;  5A0G A;  2QQA A;  4IUT A;  3X25 B;  3BDU A;  4PLL A;  2LQ8 A;  4C92 B;  1M1G A;  3HP9 A;  2Y4Y A;  4FM4 B;  3URG A;  5GAN 5;  4NL3 A;  4MDX A;  5KCH A;  2QA4 T;  1OZ3 A;  4LD6 A;  2KSS A;  4M77 C;  5A0D A;  1FWZ A;  2QTX A;  3OYY A;  5LJ3 h;  3OYH A;  4PJO B;  2CZ7 B;  4Y91 A;  3VV0 A;  1VQ7 T;  3L2R A;  4EMK A;  1QP2 A;  5M9O A;  2CKK A;  2MAM A;  4OB3 B;  4OF1 A;  4QQ6 A;  2VXF A;  3PGG A;  5I2S A;  2ZPH B;  3CC4 T;  4E7J A;  4XTV A;  1N9R A;  3H8Z A;  5GAM j;  2DXU A;  1VQ9 A;  3JCM g;  4M7A E;  2RI5 A;  3V8L A;  2RJF A;  3OS0 A;  3SWN C;  3CMA A;  4QVD A;  2KK4 A;  4IUR A;  2CZ1 B;  3PMT A;  1RI0 A;  1Q81 U;  2DIQ A;  4A4F A;  4LDU A;  2E65 A;  3S3O A;  3NFC A;  4JUV A;  3JCM J;  1YI2 T;  1LNX A;  3LX7 A;  1VQN T;  2DJZ A;  2DTI A;  2LX9 A;  3EFS A;  3CCL A;  5CKB A;  2VGM A;  3SDZ A;  3A8L B;  3FLG A;  3OYM A;  2GFA A;  3CCS A;  5LJ3 d;  3RUX A;  2XD0 A;  3FJP A;  3S3N A;  3J7A F;  5I21 A;  3RES A;  1VQP T;  1YJW A;  5GAN 4;  3L2Q A;  4LD9 K;  1M5Q 1;  3Q1J A;  4C92 D;  3L1A A;  2V8J A;  2EQK A;  4M77 B;  2DK3 A;  3GNG A;  3M53 A;  4A4G A;  2JNG A;  3M59 A;  3PIP A;  3CC2 A;  1Y96 A;  1U8R A;  3P8H A;  4PJO D;  2YHT A;  1NZ9 A;  1WNL A;  2DPP B;  4NL2 A;  4NOY A;  3BDL A;  2X35 A;  5LJ3 j;  5GAO p;  3LWH A;  3CD6 A;  4C8Q C;  1KHI A;  5GMK l;  2PVG B;  1YIT T;  1I4K 1;  2QQR A;  2R58 A;  4OB1 B;  2XKO C;  4QQG A;  1KD1 C;  2H3J A;  1VQ8 T;  1KHC A;  3FDR A;  3SWN B;  3M4Y A;  2P0Q A;  4ZN1 A;  1HK9 A;  4OP0 A;  4BI4 A;  2E41 A;  4EDU A;  4E7H A;  1YBY A;  2NLU A;  3HPW A;  4ME7 A;  4P5N A;  3UWN A;  3CC7 A;  4Z02 A;  2EFI A;  2QQ9 A;  4N4G A;  4XTW A;  4KUL A;  3QYH B;  2EQJ A;  1TH7 A;  2EKO A;  4C92 A;  5HK3 A;  1U1S A;  2V8I A;  4BI3 A;  3V8J A;  1QP3 A;  2CZ6 B;  2VGN A;  1DJ7 B;  5FRN A;  3VU3 C;  3HHT B;  1M1K C;  1O9S A;  1VQK T;  1RL2 A;  4F7U B;  3MEW A;  1Q81 C;  2LNV A;  3LW5 E;  4M78 D;  4PNO A;  4M7A G;  2PU9 B;  4PJO A;  1W4S A;  3I55 T;  4M75 B;  3QUI A;  3A5Z B;  2E6Z A;  2K2V A;  2XDB A;  3ME9 A;  5KH6 A;  3JCM X;  3X28 B;  3LGL A;  4BE0 A;  4MZT A;  4N4I A;  1QW1 A;  4JRK A;  4RG8 A;  4XTZ A;  2R5A A;  2ZGW A;  3PNW C;  1VQO T;  4XQ3 A;  3JCM c;  4M7A F;  4M77 D;  3VJP A;  4FU6 A;  1I5L A;  4MZM A;  4O5V A;  3A8M B;  2EJ9 A;  1W2B A;  1UB4 A;  3CBO A;  2P4T A;  3QBY A;  4C8Q B;  1WQW A;  3OYG A;  3CME A;  2D6F A;  4BDY A;  4OB0 B;  3OMG A;  3CCQ A;  2L89 A;  3S6W A;  3VYH B;  5GMK i;  1KQS A;  3DB4 A;  1WPY A;  2KMT A;  5CCA A;  4XU0 A;  5GMK j;  3G6E A;  2IG0 A;  5C0M A;  2O4X A;  3CCM T;  1VQL A;  1H64 1;  3CPW S;  3DLL A;  5FLX E;  3M57 A;  5A0L A;  3L2U A;  4V2S A;  3QKJ A;  3WVE B;  4RMO A;  1FX7 A;  3HRT A;  3MET A;  4XU2 A;  4J6X A;  2F69 A;  5GAM h;  1Q7Y C;  3QHS A;  4C5I A;  4L59 A;  3QZ9 B;  2DTH A;  4CI0 C;  3L2W A;  2K3X A;  2ZPB B;  1VQ6 T;  4A4K A;  1UEB A;  1BIA A;  4JLG A;  3OW2 S;  2X4W A;  1VQ4 A;  3QII A;  3RKY A;  3E9G A;  3RKW A;  2HQX A;  2HQE A;  4C5H A;  1O75 A;  5GAN h;  4RKU E;  3JB9 F;  3G71 T;  4M7D G;  4X34 A;  1NE8 A;  2RJE A;  3VUZ A;  5HY6 A;  4ATO A;  4HA8 A;  1BI1 A;  4JRI A;  3M58 A;  4LDY A;  2KAF A;  3GP8 A;  5KE2 A;  2LCL A;  1QVG A;  1KQ2 A;  1WJR A;  1GXI E;  3F70 A;  1VQM A;  2ZPI B;  4M75 D;  5CQY A;  3UPU A;  5AYF A;  3QSU A;  3VKI A;  2GFU A;  2HBP A;  1Y71 A;  4M78 C;  4BB7 A;  2VV5 A;  3CCL T;  2OTL T;  2LTO A;  3CCS T;  3SD4 A;  2DAQ A;  1KG1 A;  1VIF A;  5DLQ E;  3MEU A;  3SWN A;  3X26 B;  5GMK e;  1H3Z A;  3TRE A;  3GOX A;  4MML A;  2WSF E;  2EJG A;  3A8G B;  3CBP A;  4MMK A;  4EMG A;  5GAM d;  4C8Q D;  3PMI A;  2ZZD A;  3CCU A;  4C5E A;  2LT4 A;  3M4G A;  1KD1 U;  2QEX A;  1N9S A;  2OTJ T;  3BFM A;  2F5K A;  1YJN A;  1OI1 A;  1JB0 E;  4X9C A;  5GAN d;  4IUU A;  1IRE B;  4JRP A;  3CD6 T;  2P0K A;  5D6X A;  2GQV A;  1IZ6 A;  3M5A A;  3X24 B;  1WQ7 A;  4F7U A;  3A8H B;  3H6Z A;  1D3B B;  2MMP A;  3OYK A;  2L5Q A;  3OBW A;  2EJF A;  1LJO A;  4JJN K;  3LH0 A;  2EYQ A;  4RG2 A;  1M1K U;  1JBM A;  3FIF A;  5LJ3 f;  1K8A U;  4C0Z A;  2M16 A;  3HL8 A;  4RCC A;  5GAN j;  5LJ5 h;  2B8A A;  3OSV A;  3GIB A;  1BI2 A;  4JS4 A;  3HFO A;  5GAN 7;  3OY9 A;  2DKG A;  2FB7 A;  3QJ6 A;  4WF2 A;  4C8Q A;  5CKH A;  1MGQ A;  4M78 B;  1UGP B;  4C0G A;  1YHQ T;  4C92 E;  3G4S T;  3QDR B;  2DXB A;  2RK2 A;  1OZ2 A;  2ZPE B;  2GF7 A;  4KUD K;  2E12 A;  2LCC A;  1N6A A;  2MF2 A;  5CO7 A;  3OYF A;  5CK9 A;  1K9M U;  3MP6 A;  4M75 C;  3JB9 I;  1VQ5 A;  1M8V A;  4PJO E;  3QYG B;  4DOV A;  2LQK A;  1EIF A;  4ZGD B;  1NPP A;  2DD5 A;  2RI3 A;  4A54 A;  5FRM A;  1M1F A;  5CQX A;  2PUK B;  3LYI A;  2VC8 A;  4II1 A;  2K5F A;  3SB2 A;  3ZFJ A;  5LJ3 e;  2CZ0 B;  2E70 A;  2VYT A;  4N0A C;  5GMK h;  1XTD A;  2EWN A;  1PSF A;  3NTH A;  3OYI A;  2DZC A;  3M54 A;  4KBM B;  5KE3 A;  2X4J A;  3KBG A;  1Q7Y U;  2EIF A;  3LLR A;  5J39 A;  2HD0 A;  3J81 E;  5LJ5 d;  4C5G A;  3G6E T;  2O01 E;  2DO3 A;  4OGE A;  2GCX A;  2CGH A;  5I2M A;  4DOW A;  2XDD A;  3C4S A;  3N5B B;  5CR2 A;  3OS5 A;  4DA4 A;  2HNI A;  5CAI A;  4JRQ A;  2DTO A;  4EPC A;  4A53 A;  4M78 E;  2XU8 A;  3CCV T;  5J3B A;  1I81 A;  3CCR T;  2FYK A;  5LJ5 j;  5J26 A;  1ZQ1 A;  2EAY A;  2RHZ A;  1K8A C;  2G3R A;  2RHY A;  1BIB A;  1M4Z A;  2DVE A;  2Y4X A;  3KUF A;  2XDP A;  4FL6 A;  4L6V 5;  5A2Q E;  3CC4 A;  3CCE T;  2JN0 A;  2RHU A;  2M9U A;  5C6S A;  3UT1 A;  4M77 E;  3RKX A;  3ZEH A;  3DB3 A;  3I56 T;  2JTF A;  3OYC A;  1KC8 U;  1XQH A;  2RHX A;  3GLX A;  3RMQ A;  5GAM g;  3RIR A;  1YJ9 A;  4O6J A;  2RD1 A;  2YRV A;  3MHX A;  4ZGE B;  4HCC A;  3CXC A;  2BIV A;  3O8V A;  3PT9 A;  1D3B A;  4PLI A;  4NS5 A;  4YTL A;  5FRO A;  1K73 U;  1K9M C;  3CXC S;  4C92 G;  1YI2 A;  1G3S A;  1M9S A;  1XOV A;  2E1H A;  2M0O A;  1UGQ B;  2PVD B;  4C0D C;  4ELZ C;  1ZBX A;  4FT2 A;  3FRN A;  4J7F A;  2ZCF B;  1VQN A;  4XU1 A;  3CPW A;  4ZGJ B;  3HRU A;  3OQ5 A;  3ZBD A;  1BI3 A;  4M7A C;  1S72 A;  3TU4 K;  4PJO G;  2R57 A;  4C92 F;  2X4X A;  4XU3 A;  5CKD A;  1ZHI A;  5DM7 R;  1VQP A;  1M90 U;  2RHI A;  3OBY A;  2DEQ A;  4M78 A;  3V8K A;  3JB9 G;  3OW2 A;  4PL6 A;  2ZPF B;  3AHU A;  2RJC A;  3ASK A;  4L5G A;  3TCJ A;  2LRQ A;  3E19 A;  4FSX A;  3V7C A;  4PJO F;  4BE2 A;  4OVA A;  4IUQ A;  1VQ9 T;  4BUG A;  4F7U E;  3M55 A;  3QXE B;  4HT8 A;  3P8B B;  3L2V A;  3QO3 A;  1Q82 U;  3CMA T;  4M77 A;  3EAE A;  3QZ5 B;  4M75 E;  4J6W A;  5IN1 A;  4QVC A;  3OYN A;  3OMC A;  5LJ3 g;  2LT1 A;  5FU7 C;  2RM4 A;  3S3M A;  1U1T A;  1VQ8 A;  2RH2 A;  5HK0 A;  1QVF S;  5GAM f;  5CIU A;  4QVZ A;  1LOJ A;  2E10 A;  4M78 G;  3PFS A;  3PTA A;  2JVV A;  4FIB A;  4C8Q E;  1X01 A;  2A3L A;  2WSC E;  4C0D B;  5GAN f;  1Y07 A;  1YJW T;  2JTM A;  2VUB A;  3VYG A;  1KC8 C;  3JRZ A;  4LDV A;  4XAX B;  5CKE A;  4M78 F;  4JDS A;  3A8O B;  1VQK A;  4M7A B;  4M77 G;  3X20 B;  4M7D C;  3EFR A;  5FU6 C;  3UDC A;  3CC2 T;  5GAN 8;  2XID A;  3I55 A;  1K73 C;  2P0P A;  1BYM A;  2AHJ B;  3C94 A;  3QG1 A;  1NJI C;  2YLC A;  3BW1 A;  4D6W A;  5GMK m;  4J7I A;  3OYD A;  1QVP A;  2XHC A;  3BY7 A;  4R55 A;  5GAO r;  4M77 F;  4OB2 B;  1VQO A;  3M56 A;  3C95 A;  5GAM e;  3JCM P;  3HKS A;  2RJD A;  2VXE A;  4M75 A;  1M90 C;  3MEV A;  1R8O B;  2CYZ B;  2DD4 A;  4PKC C;  1BI0 A;  4QW2 A;  3T9N A;  3MP8 A;  2K57 A;  2XIC A;  5FU7 B;  3G7Z A;  2F5T X;  5GAN e;  3L42 A;  3GPL A;  4LDX A;  3CC7 T;  4ZN3 A;  2JUF A;  4ZTJ A;  3VUB A;  4TVR A;  4XTY A;  4N0A A;  3CCM A;  2D0Q B;  5D6Y A;  2XG8 D;  1Q82 C;  3GNF B;  2KVQ G;  3HRS A;  1MHN A;  4XK8 E;  2K5L A;  3CCJ A;  2QXF A;  2R5M A;  4F7U G;  2MI6 A;  3MO8 A;  3P8D A;  3JCM Q;  1WGS A;  3JCM V;  3OYA A;  4JS5 A;  1VQ6 A;  2RA2 A;  1G3T A;  4M75 G;  1PSE A;  1X6O A;  3RMS A;  1JJ2 A;  1YIJ A;  4DQ2 A;  5LL6 S;  3CPF A;  4M7D B;  5FU6 B;  5LJ5 f;  1B34 B;  3G71 A;  1YJ9 T;  4KUI A;  3NTK A;  1JJ2 S;  2DZ9 A;  4F7U F;  4BE1 A;  4CRI A;  5GAO l;  4M7A D;  1VUB A;  1XNI A;  2XI9 A;  1JRI A;  2O4X B;  3E1S A;  2L3R A;  4M75 F;  4OGC A;  4VUB A;  3MCA B;  3CME T;  3QJY A;  5IAY A;  4C8Q G;  1FXX A;  3CCQ T;  4EMK C;  1P92 A;  4N4H A;  4QQD A;  2OTL A;  2RI2 A;  3SFM A;  5D6W A;  3JCM b;  1VQL T;  1S72 T;  4HCB A;  2DIG A;  2Y90 A;  4BI8 B;  1VIE A;  3MP1 A;  4C8Q F;  3JCM h;  2MWP A;  2M1H A;  4A4H A;  2XK0 A;  1NJI U;  2WSE E;  1G3W A;  1WJS A;  2QA4 A;  2LDM A;  3DKM A;  4JLI A;  3JB9 H;  2RK1 A;  3V7R A;  2OTJ A;  3GF5 A;  4BY6 C;  3R6O A;  2EQU A;  5LJ5 e;  2MWO A;  4LDW A;  1VQ4 T;  2FVU A;  1VQ7 A;  2OAU A;  3WXM B;  3OA6 A;  1V29 B;  2FL7 A;  4GLK A;  4E7L A;  4OMF B;  2LC4 A;  4M7A A;  3JB9 D;  1X75 C;  2BUD A;  2KDS A;  2ZPG B;  4HKE A;  4M7D E;  3JCM f;  1HXD A;  3M9Q A;  1KQ1 A;  1N8R U;  1Q86 U;  4IKF A;  1VQM T;  3OS2 A;  2FHD A;  3WVD B;  4B9X A;  2KY9 A;  4M7D D;  3FEO A;  4J5Y A;  2K5I A;  2QQS A;  3RER A;  3INZ A;  1AHJ B;  4RCB A;  5GAN g;  2I2L A;  2RO0 A;  2YLB A;  3JSC A;  4EMK B;  3KXT A;  3OB9 A;  3JB9 J;  1YHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...