4L6V5

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 9
structure length 68
sequence length 68
chains with identical sequence E, e
ec nomenclature
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l6v500
3QZ9B 1UGQB 2DD5A 1UGRB 1UGPB 1PSEA 2PVDB 3QYGB 2CZ6B 1JB0E 1QP3A 2O01E 2ZPFB 1IREB 2QDYB 2ZPBB 3HHTB 2PU9B 3A8LB 3X26B 4XK8E 3X24B 3VYGA 4RKUE 2PUKB 2CZ0B 3A8OB 4OB3B 1V29B 2DD4A 2WSCE 4L6V5 2CZ1B 2CZ7B 2ZPHB 2WSFE 2DPPB 2ZPIB 3QZ5B 3QXEB 4Y28E 3WVEB 2ZCFB 3A8GB 3VYHB 3QYHB 4OB1B 3X20B 2D0QB 1PSFA 3A8HB 4FM4B 4ZGJB 1DJ7B 3WVDB 1QP2A 2CYZB 3X28B 1GXIE 2ZPGB 2PVGB 2ZPEB 2AHJB 4OB0B 4OB2B 3X25B 2WSEE 2DXCA 5L8RE 4ZGDB 2DXBA 2PVOB 4ZGEB 2PUOB 2ZZDA 4KT0E 1AHJB 3LW5E 3A8MB 1UGSB
chains in the Genus database with same CATH superfamily
2D8JA 1UFFA 3CBPA 4J9CA 3M53A 2P4RA 4LXCA 2GCXA 1C0MA 2V8JA 2QI2A 4ORZA 1D09B 4A63B 2LQ8A 3EH2A 4A4KA 2FPFA 2O01E 4XTVA 1VUBA 2QEXT 3CCST 3OYAA 3UA6A 3PMTA 3MPUB 3QKJA 3EG1A 2JNGA 2K6DA 2QK0A 3X26B 1T0JA 1PC0A 5IHIA 4PJMA 1NLPC 1FYNA 1VQ8T 1WQ7A 3ZBDA 3VU3C 1KQSS 5GAOr 4KGVB 2QA4T 2CP0A 2M9UA 1YI2A 1NJIC 3CCQT 4C8QA 2O4XB 4E7IA 4M75C 2FZGB 3IQLA 2WSFE 3S3OA 5KYYA 2DYIA 2A36A 2CSIA 3ZFJA 1VQPQ 1KK7A 5FRNA 3M55A 1N5ZA 2A28A 2LQWA 2NUZA 4IUTA 2M0OA 1EZZB 2LNVA 4ME7A 4M78D 2JW4A 2HD0A 3OYCA 3S3MA 4BDZA 2RQTA 1Q7YC 5FU7C 4MDXA 3NTHA 3VS1A 3OY9A 3AHUA 3PFSA 1D3BB 4WF2A 2LJ0A 4XU1A 5AYFA 1W2BP 4E7SA 4DBQA 2P0PA 3JB9D 2ZPGB 1JBMA 5GAOl 1V76A 4PJOF 1D1CA 4C0DB 1OZ3A 3LH0A 2DEQA 3JCMQ 2DM1A 2MAMA 1U06A 1VQ5T 2ESWA 1TU0B 4C5GA 1YJWQ 3M0PA 3OMGA 4LN2A 4XTZA 3CC7A 1AHJB 3A8MB 2M51A 5FWBA 3OYFA 4BE0A 3I55T 4JLGA 1IRXA 3QWXX 4ZN1A 3TU4K 2A0FB 1HYOA 2JVVA 2KR3A 2BZ8A 1KQ2A 1AWOA 2EWNA 4HVVA 1QCFA 1H3ZA 2KSSA 2KYBA 3FDRA 3HHTB 3J80E 1O9SA 2EQJA 1NBEB 3H41A 3P8HA 1PD0A 5LL6S 4Y91A 1UJYA 3CPWS 3M0QA 1NYGA 4BY6B 5LJ3e 3EGXA 2YSQA 1I8FA 2KAFA 4KH0B 1YJWT 4JS4A 1PWTA 9ATCB 1JJ2P 1MV0B 3VS3A 2W0ZA 4UC4A 1M1FA 1R0CB 2KGTA 3DB3A 3REAB 2QTXA 1WNLA 2OJ2A 1N8RR 2M1HA 1E6GA 3QZ5B 4M78G 4PJOB 3VRYA 4M7DA 4J9BA 2OTJA 3MP6A 3TEEA 1D0XA 1WIEA 2E3HA 2EYQA 4CRIA 4C92G 3BW1A 2YWWA 3RKWA 2VVKA 2DA9A 2J7IA 1X2KA 4BI8B 1NJIU 4II1A 2HSEB 5LJ5j 2RI5A 3MEWA 2CP6A 4JRKA 3EGDA 3X28B 1Y96B 2CP2A 2O88A 1UGVA 2VASA 3OW2A 4C8QE 3RIRA 2KRMA 1WHMA 2CS7A 2YRCA 5GAMd 4R56A 3F70A 1H641 1PKTA 4M78F 3OSSC 1WI7A 4RUGA 5KCHA 2GQVA 1OI1A 3E9GA 5GAMf 2CUBA 1N9SA 1YJNQ 4C92F 2GNCA 1KSWA 2EGAA 4C5HA 3JCMg 2EJ9A 3J7AF 3A1PA 4BI3A 3FEOA 3JV3A 1YNZA 3EAEA 3G4SQ 1QVFP 1BI0A 4AFQC 1UGQB 3NHNA 1KQSA 3JB9F 3V8JA 2K4YA 5FWCA 3OYBA 4CC2A 1VQ7Q 1X2QA 2I0NA 1VYVA 3C95A 1FX7A 3HFNA 1D0ZA 4F17A 1WHGA 2QEXA 5IAYA 2LC4A 4PKCC 1K4US 1UG1A 1QWFA 2DFUA 2GTJA 2OAWA 5I11A 2QTVA 5GANg 5CIUA 1QW1A 1V1CA 4L5GA 2CSQA 5IHKA 4M77E 2KNBB 2I2LA 2VB6A 3JCMb 2RQUA 2F2XA 4XU0A 2QA4A 2D1XA 3CCQA 2AIRB 1K8AC 3V7CA 2ZPHB 2A7YA 3VS0A 2DZCA 2FRWA 5GAMh 3G71Q 2GFAA 1SSFA 3FLGA 3SWNC 3M4YA 2QYZA 1M3CA 2NWMA 2FPEA 2XD0A 2E12A 1KHCA 4M78B 1JRIA 1TSFA 3OYDA 3CCLT 4FM4B 3REBB 4C92B 1U5SA 1NLOC 3M0SA 2CREA 1XQHA 3CC2T 3ME9A 1FMVA 2FPDA 2P0QA 1QP2A 1Y57A 4DOVA 2E5KA 5FLXE 4LDWA 2JXBA 3OA6A 1GXIE 4PLIA 2LNHB 8AT1B 3FJ5A 2CP3A 1KD1R 3CCJQ 3EFSA 3QPHA 1M1GA 2PNIA 3CCVQ 2FHDA 1HJDA 1VQ5A 5GAN3 3CPWA 4M7DE 2DBKA 1ZUYA 4E7JA 2RI2A 2KDSA 3I35A 2X4XA 2P84A 3I55A 2DJZA 2J06A 2FG0A 4C8QC 2GFUA 1OZ2A 1G3WA 2V1RA 1ZSGA 1W1FA 1QCNA 2LT1A 2X3XD 2F1LA 2FL7A 2X3WD 1RI0A 4PNOA 3EHRA 1VQLQ 4J7IA 3EH1A 4MMKA 2KBTA 5GMKl 3SHWA 1BI1A 4KULA 2RPNA 5I22A 1YJNT 5HKCA 3RESA 1YJWA 1ZQ1A 2LX7A 3KBGA 1CKAA 1PKSA 3G4ST 1SRLA 1U8RA 1ZHIA 2CZ7B 2K3BA 1VIEA 2RHXA 1P92A 4QVZA 2H3EB 4OVAA 2MWOA 3MP1A 1XOVA 1ZSZC 4Y28E 3I9QA 2BKDN 3H9NA 2V26A 4M77C 2JM8A 1IO6A 1N6AA 2DVJA 2QG9B 3HP9A 1G3YA 1C1AA 1OYXA 3BDUA 2O4XA 1N27A 2KE9A 2SRCA 4F7UA 1RAIB 4ZGJB 2HDAA 2E3IA 2KRSA 4E7ZA 3BDLA 1K8AU 1YCSB 1VOMA 3HRSA 1B07A 1KD1U 2EQMA 1AWWA 1TOVA 2PZ1A 3JCMc 2EW3A 2JT4A 3J81E 1VQPA 4JJNK 1LCKA 3DB4A 1GBQA 1ARKA 3VS4A 1G5VA 1TTHB 2QQSA 2AKLA 4J5YA 3JSCA 3TVTA 1D3BA 2RHZA 1YIJQ 3CMAT 2HZYA 3A98A 4OF1A 1F1BB 3QJ6A 3U23A 4J9HA 1VIFA 2L2PA 3QSUA 1K9MR 4RTZA 2QASA 1PSEA 5IXFA 1TXQA 4JZ4A 1JB0E 3HRUA 3MEAA 3LGLA 1IGQA 4M7DC 3FB9A 1RAAB 1VYUA 3QBYA 4OMFB 5CKBA 2K79A 3SD4A 3EG2A 4M75G 4BE2A 1SSHA 3CCVT 3JCMd 2RHYA 2W10A 3CPFA 2FZKB 3QDFA 2KI7A 3OYGA 4RG8A 3JCMf 4LDYA 1YHQQ 4L59A 3CCUQ 4FIBA 2DPPB 3I5RA 1RACB 1WQWA 2EGCA 4O5VA 4QT7A 4IUUA 4A54A 3QG1A 2ZCFB 2O9VA 2DTIA 4PFOA 4LD6A 3VYHB 2C06A 2YUOA 2GF7A 3C4SA 1VQLT 4ZTJA 3MP8A 3GLXA 2F69A 5GANd 2DJQA 3M58A 3Q1JA 7AT1B 2RNAA 3OS2A 3CC2A 2QGFB 1VQ9T 1TUDA 4NOYA 3LX7A 5KH6A 1VQOQ 5CR2A 4PJOA 3O5ZA 4QQ6A 2LCSA 1SF9A 2Z0WA 2KQWA 2EFIA 3L2RA 3HKSA 5CKHA 2YLCA 2RD1A 3V7SA 5J3BA 1BKBA 3TREA 2X4WA 4WCIA 3JCMh 5I2SA 1Y71A 2EYXA 4QW2A 1VQ4Q 3LGFA 1UGSB 2KK4A 3META 4F7UF 2QGGA 3VRZA 1Y96A 3OYEA 4AFZC 1R8OB 5GJWB 4HCKA 2Y90A 1PCXA 1UUEA 5CKDA 1BIBA 3SFMA 2ZPFB 5FU6B 2SEMA 2V8IA 3G6EQ 1I1JA 1PG5B 5GANh 3CXCP 3OYNA 2HKQB 1M1KR 1SPKA 1YJNA 4HCZA 2HAXA 2OAUA 2E65A 5KCOA 1YIJT 3G4SA 3OW2S 1WXBA 2AZSA 5KYNA 4A4EA 2XDBA 3UA7A 2B86A 4KUIA 4N4HA 1OPKA 1OX8A 4QKUA 1VQ7A 1Q95G 4Z8AA 2KT8A 3EFOB 1QQJA 2DL5A 2K5LA 1WJQA 2GGRA 1UHFA 2MWPA 3A8GB 2BZXA 1SRMA 4XU3A 4E7LA 1Y07A 4LDUA 2MMPA 1VQ6Q 4KGXB 3PE0A 1SHGA 2EYYA 4F7UB 1W4SA 2O9SA 4E6RA 2YT6A 1YHQT 4GY5A 2VGNA 5C6SA 5FROA 2C0IA 4PK4A 4M78A 5GAMj 2D8HA 3L2WA 2JOYA 2YDLA 2WSEE 3BFMA 3QO3A 3RMQA 4ZTFA 3VS6A 3G71A 2YUPA 2DNUA 5L8RE 4C92A 2EAYA 1T0HA 1QMCA 4FU6A 2PVOB 1UECA 2E64A 4C92D 4J6WA 2DX1A 3RKYA 1NE8A 1BIAA 2K3YA 3OBYA 3CMAA 4JDSA 3UF4A 1WDXA 2DL4A 3EGUA 1G8XA 1JO8A 3L2ZA 3G7ZA 3JRZA 4PJJA 1IB8A 4J6YA 2J05A 4OMPA 1VQOT 2XI9A 4PJLA 1YITQ 4C0ZA 4DBHA 5KE3A 5D6YA 4PJOE 1HXDA 1X01A 2LQNA 1ABOA 4RTUA 1WJSA 2E10A 2LX9A 3OQ5A 1M1KU 3M54A 3CCJA 1RLQC 2OTLQ 2L89A 2P4TA 1MNDA 3CCVA 4OMMA 2XIDA 3VS7A 4J8OA 4LUDA 5GANe 4XQ3A 4J9EA 1IHWA 2EYWA 2COWA 2RK2A 1N8RC 1MMNA 2BTTA 4AT1B 3UWNA 1RAFB 2B8AA 4M77D 3VUZA 5CQYA 1IXDA 4N0AC 1Q86R 1MMAA 2K9GA 4FSSA 3DLLA 1BCMA 5DLOA 4IUVA 2YUNA 5KYWB 3WXMB 2RJEA 3CC4Q 1TWBA 1VQLA 2KEAA 3QYHB 3G6ET 4ESRA 4ZNXA 2CGHA 2R5MA 2H3JA 5CCAA 1KJWA 3CBMA 4FT4A 1S1NA 2LJ3A 1AZEA 1VQ9A 1SHFA 3E1SA 4JJCA 3ASKA 4HA8A 3PGGA 4BACA 3NTIA 2L5QA 2RJFA 1QVGA 2NUPA 1HK9A 4A4GA 1PM3A 2QAZA 5GJVB 3E9FA 2JZ2A 2DKGA 2JJ9A 1CSKA 2LJ1A 4DEXA 2J6FA 3KUFA 2JMAA 2VYTA 5A0LA 4EMKC 2X9HA 2XDPA 1VQ6T 2KT1A 4J9DA 2RH2A 4M7AD 4KH1B 3TCJA 4TVRA 2QXFA 2K57A 4DQ2A 2XDDA 1Q81R 3VV0A 1B3QA 1ZLMA 2PVDB 2E6ZA 3OYKA 1X27A 3M57A 4X9DA 1VQPT 3VJPA 4NL2A 2ZPBB 4C5EA 4BY6C 2PU9B 4M78E 4A4HA 1WA7A 5GAN5 2YXYA 2HQEA 4AFSC 1AWJA 1W2BS 2EJGA 2VUBA 4OP0A 1LOJA 1QVPA 4V2SA 3H0HA 1D1AA 2VKNA 1O75A 2FO0A 3OYIA 1YIJA 1NEGA 4M77G 4J7FA 4PJOC 2HQXA 2QDLA 1TUCA 3EHQA 3SWNB 1WHLA 4DOWA 4QQGA 3QJYA 4IIMA 4J9IA 2BE9B 2DIGA 1MMGA 2L3SA 2JTFA 4PFZA 5GAN4 1G2BA 2KY9A 2HKNA 3VS2A 1HSQA 1ZBXA 2OTLT 4Y92A 3VKIA 3TSZA 2O31A 3QDRB 2F2VA 2F5KA 1N8RU 3BY7A 3O8VA 5HY6A 3JCMV 2CP5A 4M77F 3HSBA 4HCCA 1KD1C 1U1TA 2EVRA 3URGA 1YHQA 1H8KA 3OYLA 4AMCA 3CCUA 4HT9A 1VQNQ 1GCQA 1AT1B 4J6XA 3THKA 3CD6Q 3JB9I 4CI0C 2LVMA 4PJNA 1JJ2S 5GAN6 4XTWA 2CP7A 4KBMB 4NS5A 5J39A 3CC4T 3CMEQ 4K11A 2Y4YA 4M7AG 4OGEA 2DRMA 2NUTB 4F04B 1Q81U 4IUQA 5L23A 1ZBJA 2KROA 4F14A 4EPCA 3CCMQ 5LJ3g 2EGEA 2K5FA 4C0FA 2E1HA 4ATOA 3OYMA 1VQOA 2HMAA 2RK1A 4FYYB 3I56Q 3MHXA 4HXJA 1X6BA 1I81A 3GPLA 2HCKA 2VV5A 2GQIA 3MEVA 3MO8A 4M7AF 4ANJA 1OPLA 1XTDA 2AT1B 4MMLA 1VQ4A 4Q5WA 6AT1B 1ZSZB 3KFVA 3P8BB 1M3BA 1WHHA 2DAQA 2RQRA 2YLBA 4M77B 2E41A 4M78C 4BB7A 3FC3A 1FMWA 1I07A 2DEUA 2MF2A 5GAOm 3VUBA 4M75A 1U3OA 5LJ5f 5GAOn 4AG2C 3G6EA 5GANj 1RUWA 1WHKA 4M75D 2X35A 1RLPC 3S3NA 2QQ9A 1DJ7B 5HCKA 2JS2A 1M5Q1 3EFOA 1VQ7T 2XKOC 5GAMe 4OB2B 2FYKA 1ACMB 3EG9B 2NUPB 5KYXB 2COYA 1FMKA 3GIBA 4DBFA 4BD3A 3SEMA 1S72Q 2IPOB 4HKEA 1W2BA 1N9RA 1K9MC 1VQ6A 4M7AB 1M90R 4JRIA 2K2MA 1KC8R 5EC7A 2Y4XA 1G3SA 1MNEA 4LDVA 4E2FB 4GBQA 2DILA 2DL8A 1WXTA 3M0RA 3L1AA 5GMKh 1LJOA 4RCCA 2IVWA 3M9QA 2X4YA 4ELZC 1AWXA 3G71T 2VXFA 1VQNT 1OV3A 4BI4A 1BB9A 3CD6T 4JUVA 3GNGA 5HK3A 2XMFA 2LP5A 1UJ0A 3GP8A 1AZGB 2J6KA 1BI2A 1OQKA 1WFWA 2ENMA 3NPFA 1AEYA 4GLKA 1MGQA 3MEUA 4ELYC 3ULRB 1UTIA 3GBQA 2C0OA 1SKUB 1MMDA 3CCJT 1VQKQ 2EQIA 1YITA 2OX7A 1RAHB 3CCSQ 5D6WA 1EX4A 3MJXA 2CUDA 4MDWA 4QVCA 5CKFA 1JJ2A 5C0MA 2BUDA 1RADB 2OTLA 2HL5C 3RERA 4EMHA 4KGZB 2IG0A 4BE1A 1Q82R 2IIMA 1VQ8Q 5A2QE 2LDMA 3S6WA 5J26A 3WVDB 1QKXA 2CYZB 4D8DA 2ED0A 1M30A 5KYWA 3LYIA 2E6NA 2RHUA 1Z9ZA 4EDUA 2A37A 2DVEA 2ZPEB 5A0DA 4OMQA 2V8KA 4M75F 1GFCA 2RO0A 3LH5A 3M0TA 4ZGDB 1KQSP 3CC4A 1H3HA 3H6ZA 3T9NA 3PIPA 1M90U 2LTOA 1KC8U 2ZZDA 1MV3A 1OU8A 1E7OA 2G6FX 2EKOA 1QWEA 2R58A 1ZA2B 1OULA 4AG1C 2PQWA 3KXTA 2WACA 1W70A 2DTHA 1QVFA 1M1KC 1M8MA 2CDTA 3OYJA 4XK8E 3X24B 4Z88A 5IT9E 1K9MU 2LCLA 3RR6A 1PHTA 1S72T 1JEGA 2FZCB 1K1ZA 4F7UE 5LJ3d 1QVGS 4MZPA 5I2MA 1BCOA 1TS9A 5IH2A 2CZ1B 2K2VA 5LJ3f 2EKHA 2F5TX 2XK0A 2CT4A 2M0YA 2E4HA 1TUGB 4IKFA 4ZN3A 1E6HA 2K3XA 3CCRQ 1Q82U 4M75B 2RN8A 5KE2A 1YJ9Q 4J83A 2CH4A 5ECAA 3SWNA 3RDVA 1OX9A 1RL2A 4PL6A 3H0IA 2D0NA 4JRQA 1K76A 1YWPA 2EQKA 1D1BA 3A5ZB 2CKKA 5A0GA 1WJRA 1FWZA 3CPWP 2FB7A 4HT8A 4LUEA 5FU7B 4OB0B 2DO3A 2L3PA 5D7UA 2DMOA 1VQKT 3V8LA 2XICA 1NZ9A 3TQ7P 1NPPA 4ZGEB 2YUQA 3UPUA 5GMKm 4XTYA 1AD5A 1OU9A 1QKWA 4AFUC 5LJ3h 2KXCA 1A0NB 4FYVB 2RJDA 4FYWB 1J3TA 2DF6A 5FU6C 3LWIA 3CCUT 2DL3A 3FJPA 1BBZA 1G83A 1KIKA 3M59A 3GF5A 1BI3A 2VXEA 1VQNA 2PTKA 2NUTA 1K73C 2L8DA 4C8QD 4Z89A 3CD6A 4PJOG 2O2OA 4D8KA 2DXTA 4M4ZA 2MPXC 3JCMe 3CMEA 2K5IA 3D7SB 2RM4A 3R6NA 2NYSA 3A8OB 1KHIA 1Q86C 1M2VA 4OB3B 3QHSA 2MI6A 2DZ9A 3CCMA 1NG2A 5LJ5g 2JN0A 3CCEQ 5IN1A 4DA4A 2M02A 1NJIR 3ER0A 3I56A 4RTTA 3HTRA 1T3SA 2DXUA 2HEQA 2EPDA 1K73R 3HPWA 1ZA1B 1VQ4T 4B9XA 4N4IA 1AOJA 2CH4W 4CC3A 1ZSZA 4RMOA 5CVIA 3FRNA 2HNIA 3A8HB 2G3RA 4M77A 3PNWC 3OYHA 5KYUB 1X6GA 3CXCS 3L42A 3JCMJ 1W6XA 1Q7YR 4RTVA 2COZA 4RCBA 3UT1A 3N5BB 2LT4A 4EMKB 4EMGA 5IXBA 1UB4A 2KYMA 1PD1A 1WGSA 2KVQG 2A3LA 4YTLA 4X34A 3CCRT 1GBRA 1Q81C 5AT1B 4C0DC 1VQMQ 4RG2A 4QQDA 1YJ9T 3P8DA 1X69A 1MUZA 3CCLQ 3AT1B 3QZ9B 1MHNA 1ZUKA 1ABQA 3SB2A 1JXOA 2ROTA 5HK0A 2HQHA 3CC2Q 1VA7A 1H92A 3EG9A 3JCMP 1PRMC 5KYXA 1X75C 4FYXB 1NEBA 4IURA 4LD9K 3OBWA 3QYGB 4C8QG 2RB6A 1TG0A 4MZTA 4JJBA 1K0SA 3OSVA 4KRTA 4OGCA 4EIKA 1B34B 4JLIA 1I4K1 3QUIA 4M7AA 1WYXA 3A8LB 1HD3A 1XNIA 1Y0MA 1GL5A 2M16A 3VYGA 1S72A 2ROLA 2ATCB 2MYSA 4J9FA 5D6XA 1JQQA 1FXXA 4FW1A 1K0XA 2GBQA 2EIFA 1U1SA 4M7DD 2LMJA 2CT3A 2R57A 4LDXA 2RA2A 4A4FA 3UDCA 5DLQE 5EG2A 3FIFA 5GMKj 5CK9A 3JB9G 1QLYA 4C8QF 1K73U 8ATCB 2ZPIB 3HRTA 3QXEB 1UE9A 3JCMX 2E70A 4C92E 4OB1B 3X20B 4O6JA 1M2OA 2DBMA 1Q86U 5DM7R 3PVQA 4FT2A 5I21A 4RTXA 1Q7YU 2ECZA 1JU5C 1SEMA 2NLUA 2E5QA 3PT9A 5CO7A 2FVUA 1EFNA 4J9GA 2L3RA 1B7TA 2D9TA 3ZL7C 1YITT 4E7HA 3CCET 2QQBA 4PLLA 4OMNA 1NPRA 4C0GA 3I5SA 1VQKA 2EQUA 3C12A 2DXCA 3UATA 2DXBA 3CCSA 4F16A 2LRQA 5CKEA 1IHVA 2HBWA 3QWYA 5DY9A 1G3TA 2KXDA 2MK5A 4XU2A 4N4GA 3LLRA 4GLMA 4JPBW 4CC4B 3JAME 1TH7A 1YI2Q 1VQ8A 2GTOA 1RI9A 2YRDA 3MCAB 2JS0A 3EG0A 5GAN7 1QP3A 3RKXA 2A08A 2QDYB 4C8QB 2ED1A 3PTAA 2J6OA 2ZGWA 3VS5A 1CKBA 5KYYB 2JMCA 4M7DG 2PUKB 3R6OA 4FSXA 4P5NA 5FW9A 1WLPB 1LPLA 1VQMT 4Z02A 3QIIA 3CMAQ 3GOXA 4B6MA 4A53A 1M2VB 2DD4A 2WSCE 1YBYA 3CXCA 2MCNA 2V1QA 1BU1A 4JS5A 2DK3A 1K9AA 3L2QA 1M8VA 3V8KA 2QQAA 1OEBA 1JXMA 1BYMA 3JB9J 1WX6A 3RNJA 4IUPA 1K8AR 1IGUA 4PFPA 5CQXA 3CC7Q 4M7DF 4CC7A 4DEYA 4M7AE 4FCYA 4HVWA 2VC8A 2KMTA 2RMOA 2KRNA 4R55A 1KFZA 3OB9A 1UDLA 5LJ5d 1QVFS 2OI3A 1M4ZA 3EFRA 2DTOA 4C92C 2RQVA 4HVUA 3RBBB 2PVGB 2DERA 3G1JA 2R5AA 2JM9A 1EIFA 1YN8A 3NGPA 1RAGB 1M90C 2EYZA 2MOXA 1KC8C 3CCRA 2PUOB 1PRLC 2DETA 3M0UA 4KT0E 1YJ9A 3C94A 4XTUA 2RQWA 2K7AA 4X9CA 1NYFA 4C5IA 1WZOA 2C0TA 1VQ9Q 2VGMA 1UGPB 4WTOB 3PIOA 3OS5A 3TSWA 4BUGA 3EGXB 4FL6A 1X6OA 3INZA 2FEIA 1IREB 2X51A 2F2WA 2OTJQ 4B9WA 4D6WA 5GAOq 3RUXA 1YCYA 1RAEB 4M7DB 1GRIA 5LJ3j 2X4JA 4NL3A 4LNPA 5LJ5h 3OYYA 2P0KA 3LWHA 1YI2T 3GNFB 2XHCA 4L6V5 1M27C 2H8HA 1AVZC 4RTYA 1UHCA 4JRPA 4E47A 1WHJA 2QQRA 3SDZA 3M5AA 3WVEB 2BIVA 1Q82C 4RTWA 3CMET 3EGDB 4N0AA 2D0QB 1X43A 1PSFA 2FRYA 3PVLA 3M56A 1QVGP 3OMCA 2ZAEA 3JB9H 3H8ZA 3CCMT 1VYTA 1Z9QA 2DYBA 3BE3A 3OS0A 1NM7A 2BZYA 1D0YA 1C6VX 3NMZC 4MZMA 4BDYA 1M9SA 1KQ1A 1RABB 1UEBA 3I56T 2QEXQ 3CCEA 4KUDK 2RJCA 2AHJB 2MIOA 5GMKi 1LVKA 4M7AC 2JUFA 3HFOA 4JZ3A 3RMSA 3CBOA 1M3AA 5FRMA 2RHIA 5IHNA 2AK5A 2VWFA 3NTKA 3OW2P 5KYUA 4LE9A 1QCOA 4IIOA 2RF0A 2XG8D 2DRKA 3CC7T 5M9OA 1I5LA 3CEYA 4XTXA 2QA4Q 2YRVA 1WPYA 3CCQQ 1IZ6A 1R77A 1ZUUA 1T3LA 2DD5A 2HSPA 1UGRB 3PMIA 3M4GA 1KG1A 4EMKA 2HL3A 4HCBA 1BK2A 2EBPA 1LNXA 3MKDA 4E7KA 4VUBA 2CZ6B 2JTMA 5GAOp 1XJWB 3CQTA 4M75E 1R0BG 2LQKA 2AKKA 4QVDA 3HL8A 2LZ6B 4RKUE 2HBPA 2CZ0B 2BE7D 3L2VA 2D6FA 1VQMA 2DLPA 2EJFA 3CCLA 2DIQA 1YFNA 3E19A 1V29B 4F7UG 2JTEA 5GANf 1B34A 3DLMA 5GMKe 4JJDA 3V7RA 5LJ5e 1YP5A 4R0KA 4FW2A 1SG5A 1OOTA 1PNJA 1YWOA 3NFCA 5GAMg 3OS1A 1I5OB 4PJOD 1WXUA 1GFDA 1VQ5Q 2OTJT 2L3QA 2YHTA 2AZVA 1GCPA 2LCCA 2RI3A 3C0CA 3H0FA 3I55Q 3L2UA 3DKMA 5GAN2 1GCQC 5CAIA 4X1VA 2XU8A 2DL7A 4OMOA 1ZX6A 4XAXB 3X25B 5GAN8 4OMLA 1Y7XA 3ZEHA 3E2UA 1I0CA 4DBRA 2ABLA 3JCMW 3EG3A 3LW5E 2DE0X 2L0AA
chains in the Genus database with same CATH topology
4OF1A 3QJ6A 3QZ9B 1MHNA 1VIFA 3SB2A 4EPCA 3CBPA 5HK0A 5LJ3g 3M53A 3QSUA 1YHQT 2GCXA 3JCMP 1X75C 2V8JA 2QI2A 2K5FA 4C0FA 2E1HA 1PSEA 2LQ8A 4IURA 4LD9K 4ATOA 3OYMA 3OBWA 3QYGB 1VQOA 4C8QG 2RB6A 4A4KA 1JB0E 3HRUA 2RK1A 3LGLA 3MEAA 4MZTA 2O01E 4XTVA 1VUBA 2QEXT 3CCST 3MHXA 3OSVA 4M7DC 3OYAA 4OGCA 3GPLA 1I81A 3FB9A 1B34B 2VV5A 1I4K1 3PMTA 4JLIA 3QKJA 3QUIA 3QBYA 2JNGA 4OMFB 1VQ5T 4M7AA 5CKBA 3A8LB 1XNIA 3X26B 2M16A 3MEVA 3SD4A 3VYGA 4M75G 4BE2A 3MO8A 1S72A 3CCVT 4M7AF 5D6XA 3JCMd 1FXXA 2RHYA 1VQ8T 1XTDA 2EIFA 1WQ7A 1U1SA 4MMLA 1VQ4A 3CPFA 4M7DD 3ZBDA 4Q5WA 3VU3C 2R57A 4RG8A 3JCMf 3OYGA 4LDYA 1KQSS 5GAOr 2QA4T 2M9UA 1YI2A 3P8BB 4LDXA 2RA2A 4A4FA 3UDCA 4C8QA 4L59A 5DLQE 5EG2A 2DAQA 2O4XB 2YLBA 3FIFA 3CCQT 4M77B 4E7IA 2E41A 4M75C 5GMKj 4FIBA 5CK9A 4M78C 4BB7A 3FC3A 3JB9G 2WSFE 3S3OA 4C8QF 1K73U 2DPPB 2ZPIB 1WQWA 3HRTA 3QXEB 4O5VA 3ZFJA 4IUUA 2MF2A 3JCMX 5GAOm 4A54A 5FRNA 3M55A 3QG1A 2ZCFB 4M75A 3VUBA 2E70A 2DTIA 5LJ5f 4LD6A 3VYHB 4C92E 5GAOn 3C4SA 2GF7A 2M0OA 4IUTA 3G6EA 2C06A 5GANj 4ZTJA 1VQLT 2LNVA 4OB1B 3MP8A 3X20B 4M75D 4ME7A 4M78D 3GLXA 2F69A 4O6JA 5GANd 3M58A 3Q1JA 2X35A 2HD0A 3OYCA 1Q86U 3S3MA 5DM7R 4BDZA 3S3NA 1Q7YC 4FT2A 5FU7C 3OS2A 4MDXA 5I21A 3CC2A 2QQ9A 3NTHA 1DJ7B 1VQ9T 1Q7YU 4NOYA 1M5Q1 2NLUA 2E5QA 3PT9A 3OY9A 3LX7A 5CO7A 3AHUA 5KH6A 2FVUA 3PFSA 1VQ7T 1D3BB 5CR2A 4WF2A 4PJOA 4XU1A 2L3RA 4QQ6A 5AYFA 2D9TA 2XKOC 1YITT 2P0PA 3JB9D 4E7HA 2ZPGB 1JBMA 5GAOl 3CCET 5GAMe 4OB2B 2FYKA 2QQBA 2KQWA 4PJOF 4PLLA 4C0DB 1OZ3A 2EFIA 3L2RA 3LH0A 3GIBA 2DEQA 1NPRA 4C0GA 3JCMQ 3HKSA 5CKHA 2EQUA 3C12A 2YLCA 2DXCA 4BD3A 2MAMA 2RD1A 1VQKA 2DXBA 3CCSA 3V7SA 5J3BA 1BKBA 2LRQA 5CKEA 3TREA 2X4WA 4HKEA 1W2BA 5DY9A 1G3TA 1N9RA 3JCMh 4C5GA 4XU2A 3OMGA 1Y71A 4N4GA 5I2SA 4QW2A 1K9MC 4XTZA 3CC7A 1AHJB 3LLRA 3A8MB 3LGFA 1VQ6A 1UGSB 4M7AB 3OYFA 2KK4A 3META 4F7UF 3I55T 4BE0A 4JRIA 1Y96A 3OYEA 4JLGA 3JAME 1TH7A 2Y4XA 1G3SA 1R8OB 1VQ8A 4ZN1A 4LDVA 3TU4K 2JVVA 2Y90A 3L1AA 1KQ2A 5GMKh 1LJOA 3MCAB 4RCCA 2EWNA 5CKDA 2IVWA 3M9QA 2X4YA 1BIBA 4ELZC 5GAN7 1QP3A 3G71T 3SFMA 2VXFA 3RKXA 2ZPFB 1VQNT 2QDYB 4C8QB 1H3ZA 5FU6B 2KSSA 3FDRA 2V8IA 3HHTB 3J80E 4BI4A 3PTAA 3CD6T 2ZGWA 1O9SA 2EQJA 4JUVA 3GNGA 3P8HA 5HK3A 5GANh 5LL6S 4Y91A 3CPWS 3GP8A 4M7DG 2PUKB 3R6OA 3OYNA 1BI2A 4FSXA 4P5NA 1YJNA 4HCZA 2HAXA 4BY6B 5LJ3e 1VQMT 4Z02A 1I8FA 2OAUA 2E65A 2KAFA 3QIIA 1YJWT 3GOXA 5KCOA 1YIJT 4A53A 4JS4A 3G4SA 4GLKA 2DD4A 1MGQA 2WSCE 3MEUA 3OW2S 1YBYA 4A4EA 3CXCA 4UC4A 2XDBA 1M1FA 4ELYC 4JS5A 2DK3A 3L2QA 4KUIA 1M8VA 4N4HA 3DB3A 3V8KA 2QQAA 1VQ7A 2QTXA 1WNLA 3CCJT 2M1HA 3QZ5B 1BYMA 3JB9J 1KC8C 1YITA 2K5LA 4M78G 1WJQA 4IUPA 4PJOB 2MWPA 5D6WA 4M7DA 1NJIC 3A8GB 4MDWA 4QVCA 5CKFA 1JJ2A 2OTJA 3MP6A 3TEEA 5CQXA 4XU3A 2BUDA 5C0MA 2EYQA 4CRIA 4E7LA 1Y07A 4LDUA 4C92G 2OTLA 2MMPA 3BW1A 4M7DF 3RERA 4EMHA 4M7AE 2IG0A 4BE1A 3RKWA 2VC8A 2KMTA 4R55A 5A2QE 2LDMA 4BI8B 1NJIU 4F7UB 1W4SA 4II1A 3S6WA 5LJ5j 5J26A 2RI5A 3WVDB 3OB9A 2CYZB 5LJ5d 3MEWA 1QVFS 3LYIA 4JRKA 2E6NA 1M4ZA 2RHUA 3EFRA 2VGNA 2DTOA 4GY5A 4C92C 3X28B 1Y96B 4EDUA 5C6SA 2DVEA 5FROA 2PVGB 2ZPEB 4M78A 3OW2A 4C8QE 5GAMj 2R5AA 3RIRA 5A0DA 3L2WA 1EIFA 2JOYA 2CS7A 5GAMd 2V8KA 2WSEE 3BFMA 3QO3A 3RMQA 3F70A 4M75F 4R56A 1H641 4ZTFA 4M78F 3G71A 3OSSC 2RO0A 5L8RE 4C92A 4ZGDB 2EAYA 1M90C 3CC4A 3H6ZA 4FU6A 2PVOB 2GQVA 1OI1A 3T9NA 5KCHA 3E9GA 5GAMf 3PIPA 2PUOB 3CCRA 1M90U 2E64A 1N9SA 2LTOA 2ZZDA 4J6WA 4C92D 4C92F 3RKYA 1KC8U 1NE8A 4KT0E 1BIAA 1YJ9A 4C5HA 3JCMg 2EJ9A 2K3YA 3OBYA 3CMAA 3C94A 4JDSA 3J7AF 4XTUA 3FEOA 3EAEA 4BI3A 2EKOA 2R58A 1BI0A 4X9CA 1UGQB 4C5IA 1KQSA 3JB9F 3V8JA 2PQWA 1UGPB 2K4YA 2VGMA 3L2ZA 3G7ZA 3KXTA 3JRZA 3PIOA 3OYBA 3OS5A 4BUGA 2WACA 4J6YA 4FL6A 1VQOT 2XI9A 1X6OA 3C95A 3HFNA 1FX7A 3INZA 4C0ZA 5KE3A 2QEXA 5D6YA 4PJOE 2DTHA 1IREB 1HXDA 1X01A 5IAYA 2LC4A 1M1KC 1QVFA 4PKCC 1WJSA 2E10A 2LX9A 3OQ5A 3OYJA 1M1KU 3M54A 4B9WA 3CCJA 4D6WA 4XK8E 3X24B 5IT9E 2L89A 2P4TA 1K9MU 2LCLA 5GAOq 3RUXA 1YCYA 3CCVA 1S72T 2XIDA 4J8OA 5GANg 5CIUA 1QW1A 5GANe 4L5GA 4XQ3A 4M7DB 4M77E 2I2LA 5LJ3j 2X4JA 4F7UE 3JCMb 4NL3A 5LJ3d 1QVGS 4MZPA 4XU0A 2RK2A 3OYYA 5LJ5h 5I2MA 2P0KA 3LWHA 2QA4A 1N8RC 3CCQA 3GNFB 2XHCA 4L6V5 1YI2T 2CZ1B 3UWNA 1K8AC 2K2VA 5LJ3f 2B8AA 3V7CA 2ZPHB 4M77D 5CQYA 3VUZA 4JRPA 4E47A 2A7YA 2F5TX 4N0AC 2DZCA 2XK0A 2QQRA 3SDZA 5GAMh 3M5AA 3DLLA 5DLOA 2GFAA 4IUVA 1SSFA 3WXMB 2RJEA 2BIVA 3WVEB 3FLGA 3SWNC 3M4YA 2K3XA 4ZN3A 1Q82C 4IKFA 3CMET 2XD0A 1VQLA 2E12A 1KHCA 3QYHB 4N0AA 4M75B 3G6ET 1Q82U 4M78B 2D0QB 1JRIA 2CGHA 5KE2A 1PSFA 2R5MA 2H3JA 3OYDA 4J83A 3M56A 3CCLT 5CCAA 3OMCA 3SWNA 3CBMA 1RL2A 4PL6A 3JB9H 4FM4B 4FT4A 3H8ZA 4C92B 4JRQA 4IUQA 3CCMT 1XQHA 1VQ9A 3CC2T 3E1SA 3ME9A 2EQKA 3ASKA 4HA8A 3OS0A 2P0QA 1QP2A 3PGGA 4DOVA 4BACA 3NTIA 3A5ZB 2CKKA 5A0GA 1WJRA 5FLXE 4LDWA 2L5QA 1FWZA 2RJFA 4MZMA 3OA6A 4BDYA 1QVGA 1M9SA 1KQ1A 1UEBA 4PLIA 3I56T 2FB7A 4HT8A 1HK9A 3CCEA 4KUDK 2RJCA 2AHJB 4OB0B 5FU7B 2DO3A 5GMKi 4A4GA 4M7AC 2JUFA 3HFOA 3RMSA 3EFSA 3CBOA 3QPHA 1VQKT 3V8LA 2XICA 3E9FA 5FRMA 2RHIA 1M1GA 2JZ2A 1NZ9A 2DKGA 2FHDA 3NTKA 1NPPA 4ZGEB 1VQ5A 5GAN3 3CPWA 3UPUA 5GMKm 3KUFA 4M7DE 2XG8D 2RI2A 4XTYA 4E7JA 2KDSA 2VYTA 5A0LA 3CC7T 4EMKC 5M9OA 2X4XA 2XDPA 1VQ6T 1I5LA 3I55A 3CEYA 4XTXA 2RH2A 5LJ3h 4M7AD 3TCJA 2YRVA 2DJZA 1WPYA 2RJDA 4TVRA 1IZ6A 2QXFA 2K57A 4C8QC 2DD5A 4DQ2A 2GFUA 5FU6C 2XDDA 1OZ2A 3LWIA 1UGRB 3PMIA 3CCUT 3VV0A 1G3WA 3FJPA 3M4GA 1KG1A 4EMKA 4HCBA 2PVDB 3M59A 3GF5A 1LNXA 2E6ZA 1BI3A 2VXEA 2LT1A 3OYKA 4VUBA 2CZ6B 4E7KA 2JTMA 3M57A 5GAOp 4X9DA 1VQPT 2FL7A 1RI0A 1VQNA 3VJPA 4NL2A 2ZPBB 4PNOA 4C5EA 4BY6C 1K73C 2L8DA 4C8QD 4J7IA 3CD6A 4M75E 2PU9B 4MMKA 4M78E 2LQKA 4PJOG 4A4HA 5GAN5 4QVDA 5GMKl 2DXTA 2HQEA 3HL8A 1W2BS 1BI1A 3JCMe 2EJGA 2VUBA 4KULA 4RKUE 2HBPA 3CMEA 2K5IA 4OP0A 2CZ0B 1LOJA 1QVPA 3P8DA 2RM4A 4V2SA 3L2VA 1YJNT 5HKCA 2D6FA 1VQMA 3RESA 1O75A 2EJFA 3A8OB 1KHIA 3OYIA 3CCLA 1YJWA 1Q86C 1YIJA 1ZQ1A 2DIQA 4M77G 3KBGA 3E19A 4OB3B 3QHSA 3G4ST 1V29B 4J7FA 4F7UG 4PJOC 2HQXA 2MI6A 3SWNB 2DZ9A 3CCMA 5GANf 4DOWA 4QQGA 1B34A 3DLMA 5LJ5g 5GMKe 1ZHIA 2CZ7B 1U8RA 2JN0A 3QJYA 3V7RA 1VIEA 2RHXA 5LJ5e 1P92A 5IN1A 4QVZA 4OVAA 2MWOA 3MP1A 1XOVA 2DIGA 4DA4A 4Y28E 3ER0A 3I56A 3NFCA 5GAMg 3OS1A 2BKDN 2JTFA 5GAN4 4M77C 4PJOD 2DXUA 2OTJT 2KY9A 1N6AA 2YHTA 3HPWA 3HP9A 1VQ4T 4B9XA 1ZBXA 4N4IA 2OTLT 3VKIA 2LCCA 1G3YA 2RI3A 4RMOA 1GXIE 5CVIA 3FRNA 1OYXA 3L2UA 3BDUA 2O4XA 1N27A 2HNIA 3A8HB 2G3RA 3DKMA 3QDRB 4M77A 2F5KA 3PNWC 4F7UA 4ZGJB 3OYHA 3BY7A 1N8RU 3O8VA 5GAN2 5HY6A 3JCMV 3BDLA 5CAIA 4M77F 1K8AU 3HSBA 3CXCS 4HCCA 3L42A 1KD1C 3HRSA 3JCMJ 1U1TA 2XU8A 3URGA 1YHQA 2EQMA 1KD1U 3OYLA 4RCBA 3CCUA 4HT9A 4XAXB 3JCMc 3X25B 3UT1A 4J6XA 5GAN8 3N5BB 2LT4A 3JB9I 4EMKB 4CI0C 2LVMA 1Y7XA 3J81E 3ZEHA 4EMGA 1UB4A 1VQPA 1JJ2S 5GAN6 4XTWA 4JJNK 1WGSA 4KBMB 4NS5A 2KVQG 3DB4A 5J39A 2A3LA 4YTLA 3CC4T 2Y4YA 4X34A 3CCRT 4M7AG 1G5VA 4OGEA 3JCMW 1Q81C 2QQSA 4C0DC 4RG2A 4J5YA 3LW5E 4QQDA 1YJ9T 3JSCA 1Q81U 1D3BA 2RHZA 3CMAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ9 B;  1UGQ B;  2DD5 A;  1UGR B;  1UGP B;  1PSE A;  2PVD B;  3QYG B;  2CZ6 B;  1JB0 E;  1QP3 A;  2O01 E;  2ZPF B;  1IRE B;  2QDY B;  2ZPB B;  3HHT B;  2PU9 B;  3A8L B;  3X26 B;  4XK8 E;  3X24 B;  3VYG A;  4RKU E;  2PUK B;  2CZ0 B;  3A8O B;  4OB3 B;  1V29 B;  2DD4 A;  2WSC E;  4L6V 5;  2CZ1 B;  2CZ7 B;  2ZPH B;  2WSF E;  2DPP B;  2ZPI B;  3QZ5 B;  3QXE B;  4Y28 E;  3WVE B;  2ZCF B;  3A8G B;  3VYH B;  3QYH B;  4OB1 B;  3X20 B;  2D0Q B;  1PSF A;  3A8H B;  4FM4 B;  4ZGJ B;  1DJ7 B;  3WVD B;  1QP2 A;  2CYZ B;  3X28 B;  1GXI E;  2ZPG B;  2PVG B;  2ZPE B;  2AHJ B;  4OB0 B;  4OB2 B;  3X25 B;  2WSE E;  2DXC A;  5L8R E;  4ZGD B;  2DXB A;  2PVO B;  4ZGE B;  2PUO B;  2ZZD A;  4KT0 E;  1AHJ B;  3LW5 E;  3A8M B;  1UGS B; 
#chains in the Genus database with same CATH topology
 2D8J A;  1UFF A;  3CBP A;  4J9C A;  3M53 A;  2P4R A;  4LXC A;  2GCX A;  1C0M A;  2V8J A;  2QI2 A;  4ORZ A;  1D09 B;  4A63 B;  2LQ8 A;  3EH2 A;  4A4K A;  2FPF A;  2O01 E;  4XTV A;  1VUB A;  2QEX T;  3CCS T;  3OYA A;  3UA6 A;  3PMT A;  3MPU B;  3QKJ A;  3EG1 A;  2JNG A;  2K6D A;  2QK0 A;  3X26 B;  1T0J A;  1PC0 A;  5IHI A;  4PJM A;  1NLP C;  1FYN A;  1VQ8 T;  1WQ7 A;  3ZBD A;  3VU3 C;  1KQS S;  5GAO r;  4KGV B;  2QA4 T;  2CP0 A;  2M9U A;  1YI2 A;  1NJI C;  3CCQ T;  4C8Q A;  2O4X B;  4E7I A;  4M75 C;  2FZG B;  3IQL A;  2WSF E;  3S3O A;  5KYY A;  2DYI A;  2A36 A;  2CSI A;  3ZFJ A;  1VQP Q;  1KK7 A;  5FRN A;  3M55 A;  1N5Z A;  2A28 A;  2LQW A;  2NUZ A;  4IUT A;  2M0O A;  1EZZ B;  2LNV A;  4ME7 A;  4M78 D;  2JW4 A;  2HD0 A;  3OYC A;  3S3M A;  4BDZ A;  2RQT A;  1Q7Y C;  5FU7 C;  4MDX A;  3NTH A;  3VS1 A;  3OY9 A;  3AHU A;  3PFS A;  1D3B B;  4WF2 A;  2LJ0 A;  4XU1 A;  5AYF A;  1W2B P;  4E7S A;  4DBQ A;  2P0P A;  3JB9 D;  2ZPG B;  1JBM A;  5GAO l;  1V76 A;  4PJO F;  1D1C A;  4C0D B;  1OZ3 A;  3LH0 A;  2DEQ A;  3JCM Q;  2DM1 A;  2MAM A;  1U06 A;  1VQ5 T;  2ESW A;  1TU0 B;  4C5G A;  1YJW Q;  3M0P A;  3OMG A;  4LN2 A;  4XTZ A;  3CC7 A;  1AHJ B;  3A8M B;  2M51 A;  5FWB A;  3OYF A;  4BE0 A;  3I55 T;  4JLG A;  1IRX A;  3QWX X;  4ZN1 A;  3TU4 K;  2A0F B;  1HYO A;  2JVV A;  2KR3 A;  2BZ8 A;  1KQ2 A;  1AWO A;  2EWN A;  4HVV A;  1QCF A;  1H3Z A;  2KSS A;  2KYB A;  3FDR A;  3HHT B;  3J80 E;  1O9S A;  2EQJ A;  1NBE B;  3H41 A;  3P8H A;  1PD0 A;  5LL6 S;  4Y91 A;  1UJY A;  3CPW S;  3M0Q A;  1NYG A;  4BY6 B;  5LJ3 e;  3EGX A;  2YSQ A;  1I8F A;  2KAF A;  4KH0 B;  1YJW T;  4JS4 A;  1PWT A;  9ATC B;  1JJ2 P;  1MV0 B;  3VS3 A;  2W0Z A;  4UC4 A;  1M1F A;  1R0C B;  2KGT A;  3DB3 A;  3REA B;  2QTX A;  1WNL A;  2OJ2 A;  1N8R R;  2M1H A;  1E6G A;  3QZ5 B;  4M78 G;  4PJO B;  3VRY A;  4M7D A;  4J9B A;  2OTJ A;  3MP6 A;  3TEE A;  1D0X A;  1WIE A;  2E3H A;  2EYQ A;  4CRI A;  4C92 G;  3BW1 A;  2YWW A;  3RKW A;  2VVK A;  2DA9 A;  2J7I A;  1X2K A;  4BI8 B;  1NJI U;  4II1 A;  2HSE B;  5LJ5 j;  2RI5 A;  3MEW A;  2CP6 A;  4JRK A;  3EGD A;  3X28 B;  1Y96 B;  2CP2 A;  2O88 A;  1UGV A;  2VAS A;  3OW2 A;  4C8Q E;  3RIR A;  2KRM A;  1WHM A;  2CS7 A;  2YRC A;  5GAM d;  4R56 A;  3F70 A;  1H64 1;  1PKT A;  4M78 F;  3OSS C;  1WI7 A;  4RUG A;  5KCH A;  2GQV A;  1OI1 A;  3E9G A;  5GAM f;  2CUB A;  1N9S A;  1YJN Q;  4C92 F;  2GNC A;  1KSW A;  2EGA A;  4C5H A;  3JCM g;  2EJ9 A;  3J7A F;  3A1P A;  4BI3 A;  3FEO A;  3JV3 A;  1YNZ A;  3EAE A;  3G4S Q;  1QVF P;  1BI0 A;  4AFQ C;  1UGQ B;  3NHN A;  1KQS A;  3JB9 F;  3V8J A;  2K4Y A;  5FWC A;  3OYB A;  4CC2 A;  1VQ7 Q;  1X2Q A;  2I0N A;  1VYV A;  3C95 A;  1FX7 A;  3HFN A;  1D0Z A;  4F17 A;  1WHG A;  2QEX A;  5IAY A;  2LC4 A;  4PKC C;  1K4U S;  1UG1 A;  1QWF A;  2DFU A;  2GTJ A;  2OAW A;  5I11 A;  2QTV A;  5GAN g;  5CIU A;  1QW1 A;  1V1C A;  4L5G A;  2CSQ A;  5IHK A;  4M77 E;  2KNB B;  2I2L A;  2VB6 A;  3JCM b;  2RQU A;  2F2X A;  4XU0 A;  2QA4 A;  2D1X A;  3CCQ A;  2AIR B;  1K8A C;  3V7C A;  2ZPH B;  2A7Y A;  3VS0 A;  2DZC A;  2FRW A;  5GAM h;  3G71 Q;  2GFA A;  1SSF A;  3FLG A;  3SWN C;  3M4Y A;  2QYZ A;  1M3C A;  2NWM A;  2FPE A;  2XD0 A;  2E12 A;  1KHC A;  4M78 B;  1JRI A;  1TSF A;  3OYD A;  3CCL T;  4FM4 B;  3REB B;  4C92 B;  1U5S A;  1NLO C;  3M0S A;  2CRE A;  1XQH A;  3CC2 T;  3ME9 A;  1FMV A;  2FPD A;  2P0Q A;  1QP2 A;  1Y57 A;  4DOV A;  2E5K A;  5FLX E;  4LDW A;  2JXB A;  3OA6 A;  1GXI E;  4PLI A;  2LNH B;  8AT1 B;  3FJ5 A;  2CP3 A;  1KD1 R;  3CCJ Q;  3EFS A;  3QPH A;  1M1G A;  2PNI A;  3CCV Q;  2FHD A;  1HJD A;  1VQ5 A;  5GAN 3;  3CPW A;  4M7D E;  2DBK A;  1ZUY A;  4E7J A;  2RI2 A;  2KDS A;  3I35 A;  2X4X A;  2P84 A;  3I55 A;  2DJZ A;  2J06 A;  2FG0 A;  4C8Q C;  2GFU A;  1OZ2 A;  1G3W A;  2V1R A;  1ZSG A;  1W1F A;  1QCN A;  2LT1 A;  2X3X D;  2F1L A;  2FL7 A;  2X3W D;  1RI0 A;  4PNO A;  3EHR A;  1VQL Q;  4J7I A;  3EH1 A;  4MMK A;  2KBT A;  5GMK l;  3SHW A;  1BI1 A;  4KUL A;  2RPN A;  5I22 A;  1YJN T;  5HKC A;  3RES A;  1YJW A;  1ZQ1 A;  2LX7 A;  3KBG A;  1CKA A;  1PKS A;  3G4S T;  1SRL A;  1U8R A;  1ZHI A;  2CZ7 B;  2K3B A;  1VIE A;  2RHX A;  1P92 A;  4QVZ A;  2H3E B;  4OVA A;  2MWO A;  3MP1 A;  1XOV A;  1ZSZ C;  4Y28 E;  3I9Q A;  2BKD N;  3H9N A;  2V26 A;  4M77 C;  2JM8 A;  1IO6 A;  1N6A A;  2DVJ A;  2QG9 B;  3HP9 A;  1G3Y A;  1C1A A;  1OYX A;  3BDU A;  2O4X A;  1N27 A;  2KE9 A;  2SRC A;  4F7U A;  1RAI B;  4ZGJ B;  2HDA A;  2E3I A;  2KRS A;  4E7Z A;  3BDL A;  1K8A U;  1YCS B;  1VOM A;  3HRS A;  1B07 A;  1KD1 U;  2EQM A;  1AWW A;  1TOV A;  2PZ1 A;  3JCM c;  2EW3 A;  2JT4 A;  3J81 E;  1VQP A;  4JJN K;  1LCK A;  3DB4 A;  1GBQ A;  1ARK A;  3VS4 A;  1G5V A;  1TTH B;  2QQS A;  2AKL A;  4J5Y A;  3JSC A;  3TVT A;  1D3B A;  2RHZ A;  1YIJ Q;  3CMA T;  2HZY A;  3A98 A;  4OF1 A;  1F1B B;  3QJ6 A;  3U23 A;  4J9H A;  1VIF A;  2L2P A;  3QSU A;  1K9M R;  4RTZ A;  2QAS A;  1PSE A;  5IXF A;  1TXQ A;  4JZ4 A;  1JB0 E;  3HRU A;  3MEA A;  3LGL A;  1IGQ A;  4M7D C;  3FB9 A;  1RAA B;  1VYU A;  3QBY A;  4OMF B;  5CKB A;  2K79 A;  3SD4 A;  3EG2 A;  4M75 G;  4BE2 A;  1SSH A;  3CCV T;  3JCM d;  2RHY A;  2W10 A;  3CPF A;  2FZK B;  3QDF A;  2KI7 A;  3OYG A;  4RG8 A;  3JCM f;  4LDY A;  1YHQ Q;  4L59 A;  3CCU Q;  4FIB A;  2DPP B;  3I5R A;  1RAC B;  1WQW A;  2EGC A;  4O5V A;  4QT7 A;  4IUU A;  4A54 A;  3QG1 A;  2ZCF B;  2O9V A;  2DTI A;  4PFO A;  4LD6 A;  3VYH B;  2C06 A;  2YUO A;  2GF7 A;  3C4S A;  1VQL T;  4ZTJ A;  3MP8 A;  3GLX A;  2F69 A;  5GAN d;  2DJQ A;  3M58 A;  3Q1J A;  7AT1 B;  2RNA A;  3OS2 A;  3CC2 A;  2QGF B;  1VQ9 T;  1TUD A;  4NOY A;  3LX7 A;  5KH6 A;  1VQO Q;  5CR2 A;  4PJO A;  3O5Z A;  4QQ6 A;  2LCS A;  1SF9 A;  2Z0W A;  2KQW A;  2EFI A;  3L2R A;  3HKS A;  5CKH A;  2YLC A;  2RD1 A;  3V7S A;  5J3B A;  1BKB A;  3TRE A;  2X4W A;  4WCI A;  3JCM h;  5I2S A;  1Y71 A;  2EYX A;  4QW2 A;  1VQ4 Q;  3LGF A;  1UGS B;  2KK4 A;  3MET A;  4F7U F;  2QGG A;  3VRZ A;  1Y96 A;  3OYE A;  4AFZ C;  1R8O B;  5GJW B;  4HCK A;  2Y90 A;  1PCX A;  1UUE A;  5CKD A;  1BIB A;  3SFM A;  2ZPF B;  5FU6 B;  2SEM A;  2V8I A;  3G6E Q;  1I1J A;  1PG5 B;  5GAN h;  3CXC P;  3OYN A;  2HKQ B;  1M1K R;  1SPK A;  1YJN A;  4HCZ A;  2HAX A;  2OAU A;  2E65 A;  5KCO A;  1YIJ T;  3G4S A;  3OW2 S;  1WXB A;  2AZS A;  5KYN A;  4A4E A;  2XDB A;  3UA7 A;  2B86 A;  4KUI A;  4N4H A;  1OPK A;  1OX8 A;  4QKU A;  1VQ7 A;  1Q95 G;  4Z8A A;  2KT8 A;  3EFO B;  1QQJ A;  2DL5 A;  2K5L A;  1WJQ A;  2GGR A;  1UHF A;  2MWP A;  3A8G B;  2BZX A;  1SRM A;  4XU3 A;  4E7L A;  1Y07 A;  4LDU A;  2MMP A;  1VQ6 Q;  4KGX B;  3PE0 A;  1SHG A;  2EYY A;  4F7U B;  1W4S A;  2O9S A;  4E6R A;  2YT6 A;  1YHQ T;  4GY5 A;  2VGN A;  5C6S A;  5FRO A;  2C0I A;  4PK4 A;  4M78 A;  5GAM j;  2D8H A;  3L2W A;  2JOY A;  2YDL A;  2WSE E;  3BFM A;  3QO3 A;  3RMQ A;  4ZTF A;  3VS6 A;  3G71 A;  2YUP A;  2DNU A;  5L8R E;  4C92 A;  2EAY A;  1T0H A;  1QMC A;  4FU6 A;  2PVO B;  1UEC A;  2E64 A;  4C92 D;  4J6W A;  2DX1 A;  3RKY A;  1NE8 A;  1BIA A;  2K3Y A;  3OBY A;  3CMA A;  4JDS A;  3UF4 A;  1WDX A;  2DL4 A;  3EGU A;  1G8X A;  1JO8 A;  3L2Z A;  3G7Z A;  3JRZ A;  4PJJ A;  1IB8 A;  4J6Y A;  2J05 A;  4OMP A;  1VQO T;  2XI9 A;  4PJL A;  1YIT Q;  4C0Z A;  4DBH A;  5KE3 A;  5D6Y A;  4PJO E;  1HXD A;  1X01 A;  2LQN A;  1ABO A;  4RTU A;  1WJS A;  2E10 A;  2LX9 A;  3OQ5 A;  1M1K U;  3M54 A;  3CCJ A;  1RLQ C;  2OTL Q;  2L89 A;  2P4T A;  1MND A;  3CCV A;  4OMM A;  2XID A;  3VS7 A;  4J8O A;  4LUD A;  5GAN e;  4XQ3 A;  4J9E A;  1IHW A;  2EYW A;  2COW A;  2RK2 A;  1N8R C;  1MMN A;  2BTT A;  4AT1 B;  3UWN A;  1RAF B;  2B8A A;  4M77 D;  3VUZ A;  5CQY A;  1IXD A;  4N0A C;  1Q86 R;  1MMA A;  2K9G A;  4FSS A;  3DLL A;  1BCM A;  5DLO A;  4IUV A;  2YUN A;  5KYW B;  3WXM B;  2RJE A;  3CC4 Q;  1TWB A;  1VQL A;  2KEA A;  3QYH B;  3G6E T;  4ESR A;  4ZNX A;  2CGH A;  2R5M A;  2H3J A;  5CCA A;  1KJW A;  3CBM A;  4FT4 A;  1S1N A;  2LJ3 A;  1AZE A;  1VQ9 A;  1SHF A;  3E1S A;  4JJC A;  3ASK A;  4HA8 A;  3PGG A;  4BAC A;  3NTI A;  2L5Q A;  2RJF A;  1QVG A;  2NUP A;  1HK9 A;  4A4G A;  1PM3 A;  2QAZ A;  5GJV B;  3E9F A;  2JZ2 A;  2DKG A;  2JJ9 A;  1CSK A;  2LJ1 A;  4DEX A;  2J6F A;  3KUF A;  2JMA A;  2VYT A;  5A0L A;  4EMK C;  2X9H A;  2XDP A;  1VQ6 T;  2KT1 A;  4J9D A;  2RH2 A;  4M7A D;  4KH1 B;  3TCJ A;  4TVR A;  2QXF A;  2K57 A;  4DQ2 A;  2XDD A;  1Q81 R;  3VV0 A;  1B3Q A;  1ZLM A;  2PVD B;  2E6Z A;  3OYK A;  1X27 A;  3M57 A;  4X9D A;  1VQP T;  3VJP A;  4NL2 A;  2ZPB B;  4C5E A;  4BY6 C;  2PU9 B;  4M78 E;  4A4H A;  1WA7 A;  5GAN 5;  2YXY A;  2HQE A;  4AFS C;  1AWJ A;  1W2B S;  2EJG A;  2VUB A;  4OP0 A;  1LOJ A;  1QVP A;  4V2S A;  3H0H A;  1D1A A;  2VKN A;  1O75 A;  2FO0 A;  3OYI A;  1YIJ A;  1NEG A;  4M77 G;  4J7F A;  4PJO C;  2HQX A;  2QDL A;  1TUC A;  3EHQ A;  3SWN B;  1WHL A;  4DOW A;  4QQG A;  3QJY A;  4IIM A;  4J9I A;  2BE9 B;  2DIG A;  1MMG A;  2L3S A;  2JTF A;  4PFZ A;  5GAN 4;  1G2B A;  2KY9 A;  2HKN A;  3VS2 A;  1HSQ A;  1ZBX A;  2OTL T;  4Y92 A;  3VKI A;  3TSZ A;  2O31 A;  3QDR B;  2F2V A;  2F5K A;  1N8R U;  3BY7 A;  3O8V A;  5HY6 A;  3JCM V;  2CP5 A;  4M77 F;  3HSB A;  4HCC A;  1KD1 C;  1U1T A;  2EVR A;  3URG A;  1YHQ A;  1H8K A;  3OYL A;  4AMC A;  3CCU A;  4HT9 A;  1VQN Q;  1GCQ A;  1AT1 B;  4J6X A;  3THK A;  3CD6 Q;  3JB9 I;  4CI0 C;  2LVM A;  4PJN A;  1JJ2 S;  5GAN 6;  4XTW A;  2CP7 A;  4KBM B;  4NS5 A;  5J39 A;  3CC4 T;  3CME Q;  4K11 A;  2Y4Y A;  4M7A G;  4OGE A;  2DRM A;  2NUT B;  4F04 B;  1Q81 U;  4IUQ A;  5L23 A;  1ZBJ A;  2KRO A;  4F14 A;  4EPC A;  3CCM Q;  5LJ3 g;  2EGE A;  2K5F A;  4C0F A;  2E1H A;  4ATO A;  3OYM A;  1VQO A;  2HMA A;  2RK1 A;  4FYY B;  3I56 Q;  3MHX A;  4HXJ A;  1X6B A;  1I81 A;  3GPL A;  2HCK A;  2VV5 A;  2GQI A;  3MEV A;  3MO8 A;  4M7A F;  4ANJ A;  1OPL A;  1XTD A;  2AT1 B;  4MML A;  1VQ4 A;  4Q5W A;  6AT1 B;  1ZSZ B;  3KFV A;  3P8B B;  1M3B A;  1WHH A;  2DAQ A;  2RQR A;  2YLB A;  4M77 B;  2E41 A;  4M78 C;  4BB7 A;  3FC3 A;  1FMW A;  1I07 A;  2DEU A;  2MF2 A;  5GAO m;  3VUB A;  4M75 A;  1U3O A;  5LJ5 f;  5GAO n;  4AG2 C;  3G6E A;  5GAN j;  1RUW A;  1WHK A;  4M75 D;  2X35 A;  1RLP C;  3S3N A;  2QQ9 A;  1DJ7 B;  5HCK A;  2JS2 A;  1M5Q 1;  3EFO A;  1VQ7 T;  2XKO C;  5GAM e;  4OB2 B;  2FYK A;  1ACM B;  3EG9 B;  2NUP B;  5KYX B;  2COY A;  1FMK A;  3GIB A;  4DBF A;  4BD3 A;  3SEM A;  1S72 Q;  2IPO B;  4HKE A;  1W2B A;  1N9R A;  1K9M C;  1VQ6 A;  4M7A B;  1M90 R;  4JRI A;  2K2M A;  1KC8 R;  5EC7 A;  2Y4X A;  1G3S A;  1MNE A;  4LDV A;  4E2F B;  4GBQ A;  2DIL A;  2DL8 A;  1WXT A;  3M0R A;  3L1A A;  5GMK h;  1LJO A;  4RCC A;  2IVW A;  3M9Q A;  2X4Y A;  4ELZ C;  1AWX A;  3G71 T;  2VXF A;  1VQN T;  1OV3 A;  4BI4 A;  1BB9 A;  3CD6 T;  4JUV A;  3GNG A;  5HK3 A;  2XMF A;  2LP5 A;  1UJ0 A;  3GP8 A;  1AZG B;  2J6K A;  1BI2 A;  1OQK A;  1WFW A;  2ENM A;  3NPF A;  1AEY A;  4GLK A;  1MGQ A;  3MEU A;  4ELY C;  3ULR B;  1UTI A;  3GBQ A;  2C0O A;  1SKU B;  1MMD A;  3CCJ T;  1VQK Q;  2EQI A;  1YIT A;  2OX7 A;  1RAH B;  3CCS Q;  5D6W A;  1EX4 A;  3MJX A;  2CUD A;  4MDW A;  4QVC A;  5CKF A;  1JJ2 A;  5C0M A;  2BUD A;  1RAD B;  2OTL A;  2HL5 C;  3RER A;  4EMH A;  4KGZ B;  2IG0 A;  4BE1 A;  1Q82 R;  2IIM A;  1VQ8 Q;  5A2Q E;  2LDM A;  3S6W A;  5J26 A;  3WVD B;  1QKX A;  2CYZ B;  4D8D A;  2ED0 A;  1M30 A;  5KYW A;  3LYI A;  2E6N A;  2RHU A;  1Z9Z A;  4EDU A;  2A37 A;  2DVE A;  2ZPE B;  5A0D A;  4OMQ A;  2V8K A;  4M75 F;  1GFC A;  2RO0 A;  3LH5 A;  3M0T A;  4ZGD B;  1KQS P;  3CC4 A;  1H3H A;  3H6Z A;  3T9N A;  3PIP A;  1M90 U;  2LTO A;  1KC8 U;  2ZZD A;  1MV3 A;  1OU8 A;  1E7O A;  2G6F X;  2EKO A;  1QWE A;  2R58 A;  1ZA2 B;  1OUL A;  4AG1 C;  2PQW A;  3KXT A;  2WAC A;  1W70 A;  2DTH A;  1QVF A;  1M1K C;  1M8M A;  2CDT A;  3OYJ A;  4XK8 E;  3X24 B;  4Z88 A;  5IT9 E;  1K9M U;  2LCL A;  3RR6 A;  1PHT A;  1S72 T;  1JEG A;  2FZC B;  1K1Z A;  4F7U E;  5LJ3 d;  1QVG S;  4MZP A;  5I2M A;  1BCO A;  1TS9 A;  5IH2 A;  2CZ1 B;  2K2V A;  5LJ3 f;  2EKH A;  2F5T X;  2XK0 A;  2CT4 A;  2M0Y A;  2E4H A;  1TUG B;  4IKF A;  4ZN3 A;  1E6H A;  2K3X A;  3CCR Q;  1Q82 U;  4M75 B;  2RN8 A;  5KE2 A;  1YJ9 Q;  4J83 A;  2CH4 A;  5ECA A;  3SWN A;  3RDV A;  1OX9 A;  1RL2 A;  4PL6 A;  3H0I A;  2D0N A;  4JRQ A;  1K76 A;  1YWP A;  2EQK A;  1D1B A;  3A5Z B;  2CKK A;  5A0G A;  1WJR A;  1FWZ A;  3CPW P;  2FB7 A;  4HT8 A;  4LUE A;  5FU7 B;  4OB0 B;  2DO3 A;  2L3P A;  5D7U A;  2DMO A;  1VQK T;  3V8L A;  2XIC A;  1NZ9 A;  3TQ7 P;  1NPP A;  4ZGE B;  2YUQ A;  3UPU A;  5GMK m;  4XTY A;  1AD5 A;  1OU9 A;  1QKW A;  4AFU C;  5LJ3 h;  2KXC A;  1A0N B;  4FYV B;  2RJD A;  4FYW B;  1J3T A;  2DF6 A;  5FU6 C;  3LWI A;  3CCU T;  2DL3 A;  3FJP A;  1BBZ A;  1G83 A;  1KIK A;  3M59 A;  3GF5 A;  1BI3 A;  2VXE A;  1VQN A;  2PTK A;  2NUT A;  1K73 C;  2L8D A;  4C8Q D;  4Z89 A;  3CD6 A;  4PJO G;  2O2O A;  4D8K A;  2DXT A;  4M4Z A;  2MPX C;  3JCM e;  3CME A;  2K5I A;  3D7S B;  2RM4 A;  3R6N A;  2NYS A;  3A8O B;  1KHI A;  1Q86 C;  1M2V A;  4OB3 B;  3QHS A;  2MI6 A;  2DZ9 A;  3CCM A;  1NG2 A;  5LJ5 g;  2JN0 A;  3CCE Q;  5IN1 A;  4DA4 A;  2M02 A;  1NJI R;  3ER0 A;  3I56 A;  4RTT A;  3HTR A;  1T3S A;  2DXU A;  2HEQ A;  2EPD A;  1K73 R;  3HPW A;  1ZA1 B;  1VQ4 T;  4B9X A;  4N4I A;  1AOJ A;  2CH4 W;  4CC3 A;  1ZSZ A;  4RMO A;  5CVI A;  3FRN A;  2HNI A;  3A8H B;  2G3R A;  4M77 A;  3PNW C;  3OYH A;  5KYU B;  1X6G A;  3CXC S;  3L42 A;  3JCM J;  1W6X A;  1Q7Y R;  4RTV A;  2COZ A;  4RCB A;  3UT1 A;  3N5B B;  2LT4 A;  4EMK B;  4EMG A;  5IXB A;  1UB4 A;  2KYM A;  1PD1 A;  1WGS A;  2KVQ G;  2A3L A;  4YTL A;  4X34 A;  3CCR T;  1GBR A;  1Q81 C;  5AT1 B;  4C0D C;  1VQM Q;  4RG2 A;  4QQD A;  1YJ9 T;  3P8D A;  1X69 A;  1MUZ A;  3CCL Q;  3AT1 B;  3QZ9 B;  1MHN A;  1ZUK A;  1ABQ A;  3SB2 A;  1JXO A;  2ROT A;  5HK0 A;  2HQH A;  3CC2 Q;  1VA7 A;  1H92 A;  3EG9 A;  3JCM P;  1PRM C;  5KYX A;  1X75 C;  4FYX B;  1NEB A;  4IUR A;  4LD9 K;  3OBW A;  3QYG B;  4C8Q G;  2RB6 A;  1TG0 A;  4MZT A;  4JJB A;  1K0S A;  3OSV A;  4KRT A;  4OGC A;  4EIK A;  1B34 B;  4JLI A;  1I4K 1;  3QUI A;  4M7A A;  1WYX A;  3A8L B;  1HD3 A;  1XNI A;  1Y0M A;  1GL5 A;  2M16 A;  3VYG A;  1S72 A;  2ROL A;  2ATC B;  2MYS A;  4J9F A;  5D6X A;  1JQQ A;  1FXX A;  4FW1 A;  1K0X A;  2GBQ A;  2EIF A;  1U1S A;  4M7D D;  2LMJ A;  2CT3 A;  2R57 A;  4LDX A;  2RA2 A;  4A4F A;  3UDC A;  5DLQ E;  5EG2 A;  3FIF A;  5GMK j;  5CK9 A;  3JB9 G;  1QLY A;  4C8Q F;  1K73 U;  8ATC B;  2ZPI B;  3HRT A;  3QXE B;  1UE9 A;  3JCM X;  2E70 A;  4C92 E;  4OB1 B;  3X20 B;  4O6J A;  1M2O A;  2DBM A;  1Q86 U;  5DM7 R;  3PVQ A;  4FT2 A;  5I21 A;  4RTX A;  1Q7Y U;  2ECZ A;  1JU5 C;  1SEM A;  2NLU A;  2E5Q A;  3PT9 A;  5CO7 A;  2FVU A;  1EFN A;  4J9G A;  2L3R A;  1B7T A;  2D9T A;  3ZL7 C;  1YIT T;  4E7H A;  3CCE T;  2QQB A;  4PLL A;  4OMN A;  1NPR A;  4C0G A;  3I5S A;  1VQK A;  2EQU A;  3C12 A;  2DXC A;  3UAT A;  2DXB A;  3CCS A;  4F16 A;  2LRQ A;  5CKE A;  1IHV A;  2HBW A;  3QWY A;  5DY9 A;  1G3T A;  2KXD A;  2MK5 A;  4XU2 A;  4N4G A;  3LLR A;  4GLM A;  4JPB W;  4CC4 B;  3JAM E;  1TH7 A;  1YI2 Q;  1VQ8 A;  2GTO A;  1RI9 A;  2YRD A;  3MCA B;  2JS0 A;  3EG0 A;  5GAN 7;  1QP3 A;  3RKX A;  2A08 A;  2QDY B;  4C8Q B;  2ED1 A;  3PTA A;  2J6O A;  2ZGW A;  3VS5 A;  1CKB A;  5KYY B;  2JMC A;  4M7D G;  2PUK B;  3R6O A;  4FSX A;  4P5N A;  5FW9 A;  1WLP B;  1LPL A;  1VQM T;  4Z02 A;  3QII A;  3CMA Q;  3GOX A;  4B6M A;  4A53 A;  1M2V B;  2DD4 A;  2WSC E;  1YBY A;  3CXC A;  2MCN A;  2V1Q A;  1BU1 A;  4JS5 A;  2DK3 A;  1K9A A;  3L2Q A;  1M8V A;  3V8K A;  2QQA A;  1OEB A;  1JXM A;  1BYM A;  3JB9 J;  1WX6 A;  3RNJ A;  4IUP A;  1K8A R;  1IGU A;  4PFP A;  5CQX A;  3CC7 Q;  4M7D F;  4CC7 A;  4DEY A;  4M7A E;  4FCY A;  4HVW A;  2VC8 A;  2KMT A;  2RMO A;  2KRN A;  4R55 A;  1KFZ A;  3OB9 A;  1UDL A;  5LJ5 d;  1QVF S;  2OI3 A;  1M4Z A;  3EFR A;  2DTO A;  4C92 C;  2RQV A;  4HVU A;  3RBB B;  2PVG B;  2DER A;  3G1J A;  2R5A A;  2JM9 A;  1EIF A;  1YN8 A;  3NGP A;  1RAG B;  1M90 C;  2EYZ A;  2MOX A;  1KC8 C;  3CCR A;  2PUO B;  1PRL C;  2DET A;  3M0U A;  4KT0 E;  1YJ9 A;  3C94 A;  4XTU A;  2RQW A;  2K7A A;  4X9C A;  1NYF A;  4C5I A;  1WZO A;  2C0T A;  1VQ9 Q;  2VGM A;  1UGP B;  4WTO B;  3PIO A;  3OS5 A;  3TSW A;  4BUG A;  3EGX B;  4FL6 A;  1X6O A;  3INZ A;  2FEI A;  1IRE B;  2X51 A;  2F2W A;  2OTJ Q;  4B9W A;  4D6W A;  5GAO q;  3RUX A;  1YCY A;  1RAE B;  4M7D B;  1GRI A;  5LJ3 j;  2X4J A;  4NL3 A;  4LNP A;  5LJ5 h;  3OYY A;  2P0K A;  3LWH A;  1YI2 T;  3GNF B;  2XHC A;  4L6V 5;  1M27 C;  2H8H A;  1AVZ C;  4RTY A;  1UHC A;  4JRP A;  4E47 A;  1WHJ A;  2QQR A;  3SDZ A;  3M5A A;  3WVE B;  2BIV A;  1Q82 C;  4RTW A;  3CME T;  3EGD B;  4N0A A;  2D0Q B;  1X43 A;  1PSF A;  2FRY A;  3PVL A;  3M56 A;  1QVG P;  3OMC A;  2ZAE A;  3JB9 H;  3H8Z A;  3CCM T;  1VYT A;  1Z9Q A;  2DYB A;  3BE3 A;  3OS0 A;  1NM7 A;  2BZY A;  1D0Y A;  1C6V X;  3NMZ C;  4MZM A;  4BDY A;  1M9S A;  1KQ1 A;  1RAB B;  1UEB A;  3I56 T;  2QEX Q;  3CCE A;  4KUD K;  2RJC A;  2AHJ B;  2MIO A;  5GMK i;  1LVK A;  4M7A C;  2JUF A;  3HFO A;  4JZ3 A;  3RMS A;  3CBO A;  1M3A A;  5FRM A;  2RHI A;  5IHN A;  2AK5 A;  2VWF A;  3NTK A;  3OW2 P;  5KYU A;  4LE9 A;  1QCO A;  4IIO A;  2RF0 A;  2XG8 D;  2DRK A;  3CC7 T;  5M9O A;  1I5L A;  3CEY A;  4XTX A;  2QA4 Q;  2YRV A;  1WPY A;  3CCQ Q;  1IZ6 A;  1R77 A;  1ZUU A;  1T3L A;  2DD5 A;  2HSP A;  1UGR B;  3PMI A;  3M4G A;  1KG1 A;  4EMK A;  2HL3 A;  4HCB A;  1BK2 A;  2EBP A;  1LNX A;  3MKD A;  4E7K A;  4VUB A;  2CZ6 B;  2JTM A;  5GAO p;  1XJW B;  3CQT A;  4M75 E;  1R0B G;  2LQK A;  2AKK A;  4QVD A;  3HL8 A;  2LZ6 B;  4RKU E;  2HBP A;  2CZ0 B;  2BE7 D;  3L2V A;  2D6F A;  1VQM A;  2DLP A;  2EJF A;  3CCL A;  2DIQ A;  1YFN A;  3E19 A;  1V29 B;  4F7U G;  2JTE A;  5GAN f;  1B34 A;  3DLM A;  5GMK e;  4JJD A;  3V7R A;  5LJ5 e;  1YP5 A;  4R0K A;  4FW2 A;  1SG5 A;  1OOT A;  1PNJ A;  1YWO A;  3NFC A;  5GAM g;  3OS1 A;  1I5O B;  4PJO D;  1WXU A;  1GFD A;  1VQ5 Q;  2OTJ T;  2L3Q A;  2YHT A;  2AZV A;  1GCP A;  2LCC A;  2RI3 A;  3C0C A;  3H0F A;  3I55 Q;  3L2U A;  3DKM A;  5GAN 2;  1GCQ C;  5CAI A;  4X1V A;  2XU8 A;  2DL7 A;  4OMO A;  1ZX6 A;  4XAX B;  3X25 B;  5GAN 8;  4OML A;  1Y7X A;  3ZEH A;  3E2U A;  1I0C A;  4DBR A;  2ABL A;  3JCM W;  3EG3 A;  3LW5 E;  2DE0 X;  2L0A A; 
#chains in the Genus database with same CATH homology
 4OF1 A;  3QJ6 A;  3QZ9 B;  1MHN A;  1VIF A;  3SB2 A;  4EPC A;  3CBP A;  5HK0 A;  5LJ3 g;  3M53 A;  3QSU A;  1YHQ T;  2GCX A;  3JCM P;  1X75 C;  2V8J A;  2QI2 A;  2K5F A;  4C0F A;  2E1H A;  1PSE A;  2LQ8 A;  4IUR A;  4LD9 K;  4ATO A;  3OYM A;  3OBW A;  3QYG B;  1VQO A;  4C8Q G;  2RB6 A;  4A4K A;  1JB0 E;  3HRU A;  2RK1 A;  3LGL A;  3MEA A;  4MZT A;  2O01 E;  4XTV A;  1VUB A;  2QEX T;  3CCS T;  3MHX A;  3OSV A;  4M7D C;  3OYA A;  4OGC A;  3GPL A;  1I81 A;  3FB9 A;  1B34 B;  2VV5 A;  1I4K 1;  3PMT A;  4JLI A;  3QKJ A;  3QUI A;  3QBY A;  2JNG A;  4OMF B;  1VQ5 T;  4M7A A;  5CKB A;  3A8L B;  1XNI A;  3X26 B;  2M16 A;  3MEV A;  3SD4 A;  3VYG A;  4M75 G;  4BE2 A;  3MO8 A;  1S72 A;  3CCV T;  4M7A F;  5D6X A;  3JCM d;  1FXX A;  2RHY A;  1VQ8 T;  1XTD A;  2EIF A;  1WQ7 A;  1U1S A;  4MML A;  1VQ4 A;  3CPF A;  4M7D D;  3ZBD A;  4Q5W A;  3VU3 C;  2R57 A;  4RG8 A;  3JCM f;  3OYG A;  4LDY A;  1KQS S;  5GAO r;  2QA4 T;  2M9U A;  1YI2 A;  3P8B B;  4LDX A;  2RA2 A;  4A4F A;  3UDC A;  4C8Q A;  4L59 A;  5DLQ E;  5EG2 A;  2DAQ A;  2O4X B;  2YLB A;  3FIF A;  3CCQ T;  4M77 B;  4E7I A;  2E41 A;  4M75 C;  5GMK j;  4FIB A;  5CK9 A;  4M78 C;  4BB7 A;  3FC3 A;  3JB9 G;  2WSF E;  3S3O A;  4C8Q F;  1K73 U;  2DPP B;  2ZPI B;  1WQW A;  3HRT A;  3QXE B;  4O5V A;  3ZFJ A;  4IUU A;  2MF2 A;  3JCM X;  5GAO m;  4A54 A;  5FRN A;  3M55 A;  3QG1 A;  2ZCF B;  4M75 A;  3VUB A;  2E70 A;  2DTI A;  5LJ5 f;  4LD6 A;  3VYH B;  4C92 E;  5GAO n;  3C4S A;  2GF7 A;  2M0O A;  4IUT A;  3G6E A;  2C06 A;  5GAN j;  4ZTJ A;  1VQL T;  2LNV A;  4OB1 B;  3MP8 A;  3X20 B;  4M75 D;  4ME7 A;  4M78 D;  3GLX A;  2F69 A;  4O6J A;  5GAN d;  3M58 A;  3Q1J A;  2X35 A;  2HD0 A;  3OYC A;  1Q86 U;  3S3M A;  5DM7 R;  4BDZ A;  3S3N A;  1Q7Y C;  4FT2 A;  5FU7 C;  3OS2 A;  4MDX A;  5I21 A;  3CC2 A;  2QQ9 A;  3NTH A;  1DJ7 B;  1VQ9 T;  1Q7Y U;  4NOY A;  1M5Q 1;  2NLU A;  2E5Q A;  3PT9 A;  3OY9 A;  3LX7 A;  5CO7 A;  3AHU A;  5KH6 A;  2FVU A;  3PFS A;  1VQ7 T;  1D3B B;  5CR2 A;  4WF2 A;  4PJO A;  4XU1 A;  2L3R A;  4QQ6 A;  5AYF A;  2D9T A;  2XKO C;  1YIT T;  2P0P A;  3JB9 D;  4E7H A;  2ZPG B;  1JBM A;  5GAO l;  3CCE T;  5GAM e;  4OB2 B;  2FYK A;  2QQB A;  2KQW A;  4PJO F;  4PLL A;  4C0D B;  1OZ3 A;  2EFI A;  3L2R A;  3LH0 A;  3GIB A;  2DEQ A;  1NPR A;  4C0G A;  3JCM Q;  3HKS A;  5CKH A;  2EQU A;  3C12 A;  2YLC A;  2DXC A;  4BD3 A;  2MAM A;  2RD1 A;  1VQK A;  2DXB A;  3CCS A;  3V7S A;  5J3B A;  1BKB A;  2LRQ A;  5CKE A;  3TRE A;  2X4W A;  4HKE A;  1W2B A;  5DY9 A;  1G3T A;  1N9R A;  3JCM h;  4C5G A;  4XU2 A;  3OMG A;  1Y71 A;  4N4G A;  5I2S A;  4QW2 A;  1K9M C;  4XTZ A;  3CC7 A;  1AHJ B;  3LLR A;  3A8M B;  3LGF A;  1VQ6 A;  1UGS B;  4M7A B;  3OYF A;  2KK4 A;  3MET A;  4F7U F;  3I55 T;  4BE0 A;  4JRI A;  1Y96 A;  3OYE A;  4JLG A;  3JAM E;  1TH7 A;  2Y4X A;  1G3S A;  1R8O B;  1VQ8 A;  4ZN1 A;  4LDV A;  3TU4 K;  2JVV A;  2Y90 A;  3L1A A;  1KQ2 A;  5GMK h;  1LJO A;  3MCA B;  4RCC A;  2EWN A;  5CKD A;  2IVW A;  3M9Q A;  2X4Y A;  1BIB A;  4ELZ C;  5GAN 7;  1QP3 A;  3G71 T;  3SFM A;  2VXF A;  3RKX A;  2ZPF B;  1VQN T;  2QDY B;  4C8Q B;  1H3Z A;  5FU6 B;  2KSS A;  3FDR A;  2V8I A;  3HHT B;  3J80 E;  4BI4 A;  3PTA A;  3CD6 T;  2ZGW A;  1O9S A;  2EQJ A;  4JUV A;  3GNG A;  3P8H A;  5HK3 A;  5GAN h;  5LL6 S;  4Y91 A;  3CPW S;  3GP8 A;  4M7D G;  2PUK B;  3R6O A;  3OYN A;  1BI2 A;  4FSX A;  4P5N A;  1YJN A;  4HCZ A;  2HAX A;  4BY6 B;  5LJ3 e;  1VQM T;  4Z02 A;  1I8F A;  2OAU A;  2E65 A;  2KAF A;  3QII A;  1YJW T;  3GOX A;  5KCO A;  1YIJ T;  4A53 A;  4JS4 A;  3G4S A;  4GLK A;  2DD4 A;  1MGQ A;  2WSC E;  3MEU A;  3OW2 S;  1YBY A;  4A4E A;  3CXC A;  4UC4 A;  2XDB A;  1M1F A;  4ELY C;  4JS5 A;  2DK3 A;  3L2Q A;  4KUI A;  1M8V A;  4N4H A;  3DB3 A;  3V8K A;  2QQA A;  1VQ7 A;  2QTX A;  1WNL A;  3CCJ T;  2M1H A;  3QZ5 B;  1BYM A;  3JB9 J;  1KC8 C;  1YIT A;  2K5L A;  4M78 G;  1WJQ A;  4IUP A;  4PJO B;  2MWP A;  5D6W A;  4M7D A;  1NJI C;  3A8G B;  4MDW A;  4QVC A;  5CKF A;  1JJ2 A;  2OTJ A;  3MP6 A;  3TEE A;  5CQX A;  4XU3 A;  2BUD A;  5C0M A;  2EYQ A;  4CRI A;  4E7L A;  1Y07 A;  4LDU A;  4C92 G;  2OTL A;  2MMP A;  3BW1 A;  4M7D F;  3RER A;  4EMH A;  4M7A E;  2IG0 A;  4BE1 A;  3RKW A;  2VC8 A;  2KMT A;  4R55 A;  5A2Q E;  2LDM A;  4BI8 B;  1NJI U;  4F7U B;  1W4S A;  4II1 A;  3S6W A;  5LJ5 j;  5J26 A;  2RI5 A;  3WVD B;  3OB9 A;  2CYZ B;  5LJ5 d;  3MEW A;  1QVF S;  3LYI A;  4JRK A;  2E6N A;  1M4Z A;  2RHU A;  3EFR A;  2VGN A;  2DTO A;  4GY5 A;  4C92 C;  3X28 B;  1Y96 B;  4EDU A;  5C6S A;  2DVE A;  5FRO A;  2PVG B;  2ZPE B;  4M78 A;  3OW2 A;  4C8Q E;  5GAM j;  2R5A A;  3RIR A;  5A0D A;  3L2W A;  1EIF A;  2JOY A;  2CS7 A;  5GAM d;  2V8K A;  2WSE E;  3BFM A;  3QO3 A;  3RMQ A;  3F70 A;  4M75 F;  4R56 A;  1H64 1;  4ZTF A;  4M78 F;  3G71 A;  3OSS C;  2RO0 A;  5L8R E;  4C92 A;  4ZGD B;  2EAY A;  1M90 C;  3CC4 A;  3H6Z A;  4FU6 A;  2PVO B;  2GQV A;  1OI1 A;  3T9N A;  5KCH A;  3E9G A;  5GAM f;  3PIP A;  2PUO B;  3CCR A;  1M90 U;  2E64 A;  1N9S A;  2LTO A;  2ZZD A;  4J6W A;  4C92 D;  4C92 F;  3RKY A;  1KC8 U;  1NE8 A;  4KT0 E;  1BIA A;  1YJ9 A;  4C5H A;  3JCM g;  2EJ9 A;  2K3Y A;  3OBY A;  3CMA A;  3C94 A;  4JDS A;  3J7A F;  4XTU A;  3FEO A;  3EAE A;  4BI3 A;  2EKO A;  2R58 A;  1BI0 A;  4X9C A;  1UGQ B;  4C5I A;  1KQS A;  3JB9 F;  3V8J A;  2PQW A;  1UGP B;  2K4Y A;  2VGM A;  3L2Z A;  3G7Z A;  3KXT A;  3JRZ A;  3PIO A;  3OYB A;  3OS5 A;  4BUG A;  2WAC A;  4J6Y A;  4FL6 A;  1VQO T;  2XI9 A;  1X6O A;  3C95 A;  3HFN A;  1FX7 A;  3INZ A;  4C0Z A;  5KE3 A;  2QEX A;  5D6Y A;  4PJO E;  2DTH A;  1IRE B;  1HXD A;  1X01 A;  5IAY A;  2LC4 A;  1M1K C;  1QVF A;  4PKC C;  1WJS A;  2E10 A;  2LX9 A;  3OQ5 A;  3OYJ A;  1M1K U;  3M54 A;  4B9W A;  3CCJ A;  4D6W A;  4XK8 E;  3X24 B;  5IT9 E;  2L89 A;  2P4T A;  1K9M U;  2LCL A;  5GAO q;  3RUX A;  1YCY A;  3CCV A;  1S72 T;  2XID A;  4J8O A;  5GAN g;  5CIU A;  1QW1 A;  5GAN e;  4L5G A;  4XQ3 A;  4M7D B;  4M77 E;  2I2L A;  5LJ3 j;  2X4J A;  4F7U E;  3JCM b;  4NL3 A;  5LJ3 d;  1QVG S;  4MZP A;  4XU0 A;  2RK2 A;  3OYY A;  5LJ5 h;  5I2M A;  2P0K A;  3LWH A;  2QA4 A;  1N8R C;  3CCQ A;  3GNF B;  2XHC A;  4L6V 5;  1YI2 T;  2CZ1 B;  3UWN A;  1K8A C;  2K2V A;  5LJ3 f;  2B8A A;  3V7C A;  2ZPH B;  4M77 D;  5CQY A;  3VUZ A;  4JRP A;  4E47 A;  2A7Y A;  2F5T X;  4N0A C;  2DZC A;  2XK0 A;  2QQR A;  3SDZ A;  5GAM h;  3M5A A;  3DLL A;  5DLO A;  2GFA A;  4IUV A;  1SSF A;  3WXM B;  2RJE A;  2BIV A;  3WVE B;  3FLG A;  3SWN C;  3M4Y A;  2K3X A;  4ZN3 A;  1Q82 C;  4IKF A;  3CME T;  2XD0 A;  1VQL A;  2E12 A;  1KHC A;  3QYH B;  4N0A A;  4M75 B;  3G6E T;  1Q82 U;  4M78 B;  2D0Q B;  1JRI A;  2CGH A;  5KE2 A;  1PSF A;  2R5M A;  2H3J A;  3OYD A;  4J83 A;  3M56 A;  3CCL T;  5CCA A;  3OMC A;  3SWN A;  3CBM A;  1RL2 A;  4PL6 A;  3JB9 H;  4FM4 B;  4FT4 A;  3H8Z A;  4C92 B;  4JRQ A;  4IUQ A;  3CCM T;  1XQH A;  1VQ9 A;  3CC2 T;  3E1S A;  3ME9 A;  2EQK A;  3ASK A;  4HA8 A;  3OS0 A;  2P0Q A;  1QP2 A;  3PGG A;  4DOV A;  4BAC A;  3NTI A;  3A5Z B;  2CKK A;  5A0G A;  1WJR A;  5FLX E;  4LDW A;  2L5Q A;  1FWZ A;  2RJF A;  4MZM A;  3OA6 A;  4BDY A;  1QVG A;  1M9S A;  1KQ1 A;  1UEB A;  4PLI A;  3I56 T;  2FB7 A;  4HT8 A;  1HK9 A;  3CCE A;  4KUD K;  2RJC A;  2AHJ B;  4OB0 B;  5FU7 B;  2DO3 A;  5GMK i;  4A4G A;  4M7A C;  2JUF A;  3HFO A;  3RMS A;  3EFS A;  3CBO A;  3QPH A;  1VQK T;  3V8L A;  2XIC A;  3E9F A;  5FRM A;  2RHI A;  1M1G A;  2JZ2 A;  1NZ9 A;  2DKG A;  2FHD A;  3NTK A;  1NPP A;  4ZGE B;  1VQ5 A;  5GAN 3;  3CPW A;  3UPU A;  5GMK m;  3KUF A;  4M7D E;  2XG8 D;  2RI2 A;  4XTY A;  4E7J A;  2KDS A;  2VYT A;  5A0L A;  3CC7 T;  4EMK C;  5M9O A;  2X4X A;  2XDP A;  1VQ6 T;  1I5L A;  3I55 A;  3CEY A;  4XTX A;  2RH2 A;  5LJ3 h;  4M7A D;  3TCJ A;  2YRV A;  2DJZ A;  1WPY A;  2RJD A;  4TVR A;  1IZ6 A;  2QXF A;  2K57 A;  4C8Q C;  2DD5 A;  4DQ2 A;  2GFU A;  5FU6 C;  2XDD A;  1OZ2 A;  3LWI A;  1UGR B;  3PMI A;  3CCU T;  3VV0 A;  1G3W A;  3FJP A;  3M4G A;  1KG1 A;  4EMK A;  4HCB A;  2PVD B;  3M59 A;  3GF5 A;  1LNX A;  2E6Z A;  1BI3 A;  2VXE A;  2LT1 A;  3OYK A;  4VUB A;  2CZ6 B;  4E7K A;  2JTM A;  3M57 A;  5GAO p;  4X9D A;  1VQP T;  2FL7 A;  1RI0 A;  1VQN A;  3VJP A;  4NL2 A;  2ZPB B;  4PNO A;  4C5E A;  4BY6 C;  1K73 C;  2L8D A;  4C8Q D;  4J7I A;  3CD6 A;  4M75 E;  2PU9 B;  4MMK A;  4M78 E;  2LQK A;  4PJO G;  4A4H A;  5GAN 5;  4QVD A;  5GMK l;  2DXT A;  2HQE A;  3HL8 A;  1W2B S;  1BI1 A;  3JCM e;  2EJG A;  2VUB A;  4KUL A;  4RKU E;  2HBP A;  3CME A;  2K5I A;  4OP0 A;  2CZ0 B;  1LOJ A;  1QVP A;  3P8D A;  2RM4 A;  4V2S A;  3L2V A;  1YJN T;  5HKC A;  2D6F A;  1VQM A;  3RES A;  1O75 A;  2EJF A;  3A8O B;  1KHI A;  3OYI A;  3CCL A;  1YJW A;  1Q86 C;  1YIJ A;  1ZQ1 A;  2DIQ A;  4M77 G;  3KBG A;  3E19 A;  4OB3 B;  3QHS A;  3G4S T;  1V29 B;  4J7F A;  4F7U G;  4PJO C;  2HQX A;  2MI6 A;  3SWN B;  2DZ9 A;  3CCM A;  5GAN f;  4DOW A;  4QQG A;  1B34 A;  3DLM A;  5LJ5 g;  5GMK e;  1ZHI A;  2CZ7 B;  1U8R A;  2JN0 A;  3QJY A;  3V7R A;  1VIE A;  2RHX A;  5LJ5 e;  1P92 A;  5IN1 A;  4QVZ A;  4OVA A;  2MWO A;  3MP1 A;  1XOV A;  2DIG A;  4DA4 A;  4Y28 E;  3ER0 A;  3I56 A;  3NFC A;  5GAM g;  3OS1 A;  2BKD N;  2JTF A;  5GAN 4;  4M77 C;  4PJO D;  2DXU A;  2OTJ T;  2KY9 A;  1N6A A;  2YHT A;  3HPW A;  3HP9 A;  1VQ4 T;  4B9X A;  1ZBX A;  4N4I A;  2OTL T;  3VKI A;  2LCC A;  1G3Y A;  2RI3 A;  4RMO A;  1GXI E;  5CVI A;  3FRN A;  1OYX A;  3L2U A;  3BDU A;  2O4X A;  1N27 A;  2HNI A;  3A8H B;  2G3R A;  3DKM A;  3QDR B;  4M77 A;  2F5K A;  3PNW C;  4F7U A;  4ZGJ B;  3OYH A;  3BY7 A;  1N8R U;  3O8V A;  5GAN 2;  5HY6 A;  3JCM V;  3BDL A;  5CAI A;  4M77 F;  1K8A U;  3HSB A;  3CXC S;  4HCC A;  3L42 A;  1KD1 C;  3HRS A;  3JCM J;  1U1T A;  2XU8 A;  3URG A;  1YHQ A;  2EQM A;  1KD1 U;  3OYL A;  4RCB A;  3CCU A;  4HT9 A;  4XAX B;  3JCM c;  3X25 B;  3UT1 A;  4J6X A;  5GAN 8;  3N5B B;  2LT4 A;  3JB9 I;  4EMK B;  4CI0 C;  2LVM A;  1Y7X A;  3J81 E;  3ZEH A;  4EMG A;  1UB4 A;  1VQP A;  1JJ2 S;  5GAN 6;  4XTW A;  4JJN K;  1WGS A;  4KBM B;  4NS5 A;  2KVQ G;  3DB4 A;  5J39 A;  2A3L A;  4YTL A;  3CC4 T;  2Y4Y A;  4X34 A;  3CCR T;  4M7A G;  1G5V A;  4OGE A;  3JCM W;  1Q81 C;  2QQS A;  4C0D C;  4RG2 A;  4J5Y A;  3LW5 E;  4QQD A;  1YJ9 T;  3JSC A;  1Q81 U;  1D3B A;  2RHZ A;  3CMA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...