2JTEA

Third sh3 domain of cd2ap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title The high resolution NMR structure of the third SH3 domain of CD2AP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jteA00
1HD3A 1EFNA 2KR3A 2E5KA 3PVQA 1UGVA 3EG2A 2EVRA 3I5SA 3U23A 1OOTA 1K76A 2KT1A 2K6DA 1QLYA 2F2VA 2HSPA 1RUWA 4JJBA 2C0TA 1K0XA 2DL4A 2KROA 4ORZA 1UE9A 4DEYA 1T0JA 1LCKA 4CC7A 2EGAA 1AVZC 2JMCA 3M0RA 3TSWA 3VS0A 2RQUA 4J9HA 2CSQA 2KYMA 4J9FA 1G83A 1W6XA 4RTZA 2L2PA 2CT3A 4DEXA 4Y92A 1I1JA 1AWJA 2CH4W 2LP5A 1K4US 1SHFA 2ESWA 4ESRA 2EYWA 2DILA 1VA7A 2AZSA 3EHQA 1ABQA 1X2QA 2FPDA 3THKA 4J9IA 2VVKA 4HCKA 2A36A 1PRMC 1WA7A 4RTYA 1ZUKA 2G6FX 3EGUA 1SSHA 4HVWA 4WCIA 4QT7A 3VS5A 2IIMA 2L3QA 1ABOA 2DL3A 1QWFA 5IHIA 3VS7A 2RPNA 2EGCA 1YP5A 1TG0A 1OEBA 5HCKA 1H92A 1NEBA 1WXTA 1X6GA 4JPBW 1G2BA 4AFQC 2DRMA 2FEIA 1W70A 4IIOA 2HCKA 2CH4A 4HVVA 1M3CA 3NHNA 1RLPC 3ULRB 2ENMA 4F14A 2AK5A 1PKSA 1RI9A 1WYXA 2J05A 5IHNA 1QWEA 3NPFA 3M0UA 1B07A 2BZYA 4JJDA 4AFZC 3I9QA 4OMQA 1XOVA 1GL5A 3REBB 2B86A 1PRLC 1GFCA 1Y0MA 1UJ0A 2YUOA 1M8MA 4LN2A 1AZEA 2FRWA 2AKLA 1SRLA 4F17A 4RTWA 2CDTA 1MV0B 1UECA 1ZBJA 1PHTA 1UDLA 2A08A 1GCPA 4RTTA 1PKTA 4Z88A 2LQNA 2KT8A 4EIKA 3UA6A 2XMFA 5I11A 4J9DA 1ZX6A 1JXOA 3A98A 3EG0A 1BU1A 1AZGB 4OMPA 2ABLA 1A0NB 1YWPA 1QKWA 2RNAA 2RQRA 4K11A 1T3LA 3SHWA 4RTVA 1UHFA 1RLQC 1Y57A 2FRYA 3PE0A 4AG2C 3H0FA 2GGRA 1K9AA 2BZ8A 1JO8A 1VYVA 1NLOC 3H0IA 2DE0X 1ZSGA 1W1FA 2JMAA 1UFFA 3O5ZA 1X69A 2KEAA 1QKXA 2D1XA 2DM1A 1M3BA 4GBQA 2DJQA 2DX1A 4RTXA 4F16A 1Z9ZA 2A37A 2JS0A 1JQQA 2D0NA 2J6KA 1YNZA 1NYFA 1WFWA 4X1VA 2YUPA 4J9BA 1M27C 2RF0A 3SEMA 1I07A 2KRMA 2L3SA 1AOJA 2DL7A 2JW4A 4Z8AA 2EYZA 2YSQA 1AEYA 4JJCA 1IO6A 4RTUA 1OV3A 4CC2A 1VYUA 2DVJA 2EGEA 2BZXA 1K0SA 1UG1A 1FYNA 1M3AA 4HVUA 2LJ1A 5I22A 2K9GA 2LX7A 1JEGA 3VS3A 1VYTA 2V1QA 5GJVB 4KRTA 3UATA 3NGPA 1OPLA 3VRYA 1UUEA 4LUEA 2VWFA 1E7OA 4ZNXA 3M0TA 4LNPA 1GFDA 1QCFA 2K7AA 5FWCA 1WX6A 3R6NA 1NYGA 1TUCA 2DA9A 2FG0A 2JS2A 2KXCA 4CC4B 2NUZA 2PTKA 3GBQA 5L23A 4E6RA 2JT4A 1KFZA 2HEQA 1U06A 5IXFA 1GRIA 1N5ZA 2MCNA 1ZLMA 2CT4A 4J9CA 1AWOA 2YDLA 1U3OA 2EYXA 2OI3A 2JXBA 1ZUYA 1NEGA 2JTEA 2LNHB 2RQVA 1UJYA 2FPEA 1NM7A 4JZ3A 2MIOA 2RMOA 5ECAA 3EHRA 1ARKA 2AZVA 1TUDA 2J06A 3EG3A 1CKBA 1GCQA 2SEMA 2O9SA 2K79A 2KYBA 5IXBA 3LH5A 1WLPB 1S1NA 1BBZA 4JZ4A 3VS1A 1UHCA 3I5RA 4GLMA 3TSZA 2J7IA 2JM8A 1H8KA 4A63B 1WI7A 2OJ2A 1SRMA 3IQLA 2D8JA 2L3PA 1B3QA 1E6GA 1JXMA 3VS6A 2KE9A 1FMKA 2LMJA 2DBKA 2DMOA 2MOXA 4M4ZA 2DRKA 1PWTA 2EBPA 3QWYA 2GBQA 1BK2A 2X3WD 2C0OA 2J6FA 4AFUC 2YT6A 2DLPA 3KFVA 2LQWA 2K2MA 2NWMA 4OMOA 1AWXA 2DNUA 2FO0A 1NG2A 1GBRA 2KNBB 1YCSB 2YUQA 2JM9A 3PVLA 1YN8A 4AG1C 2H8HA 1ZUUA 2EPDA 1SEMA 2F2WA 1AWWA 2CREA 2FPFA 4RUGA 4J9GA 3CQTA 5IH2A 1I0CA 2CUDA 2K3BA 3H41A 1X43A 2X3XD 2DBMA 1MV3A 1OPKA 2C0IA 4LE9A 1Z9QA 2KXDA 3M0PA 2BTTA 2O2OA 3UF4A 2PNIA 3UA7A 2LCSA 2LZ6B 4Z89A 1E6HA 1BB9A 3VRZA 1T0HA 2V1RA 2DYBA 1U5SA 3TVTA 2DL8A 1H3HA 3H0HA 2RQWA 1MUZA 4J9EA 3RBBB 2DF6A 2F2XA 3VS4A 1WDXA 2W10A 1KSWA 1V1CA 2J6OA 2ED0A 1SHGA 2I0NA 5FW9A 2EYYA 2M51A 2LJ0A 1JU5C 1T3SA 3NMZC 2SRCA 3EG1A 2ROLA 1WXUA 4D8KA 2AKKA 3REAB 2VKNA 2O9VA 1UTIA 4FSSA 4IIMA 2EQIA 2O88A 2PZ1A 2ROTA 3RNJA 3M0QA 2RQTA 4AFSC 2A28A 2CSIA 2EKHA 2OAWA 2ECZA 1CKAA 5IHKA 2RN8A 1HSQA 2W0ZA 2LJ3A 1X6BA 1KIKA 2GTOA 4OMMA 4HXJA 3FJ5A 2KRSA 1NLPC 1CSKA 1AD5A 1GBQA 1X27A 4CC3A 3QWXX 2QDLA 2D8HA 3I35A 4OMLA 1GCQC 3JV3A 1J3TA 2DL5A 4LUDA 3M0SA 2EW3A 2L0AA 2CUBA 1YWOA 1SPKA 1X2KA 2M0YA 2GTJA 1KJWA 4D8DA 2HBWA 1HJDA 2GNCA 3ZL7C 1K1ZA 1PNJA 5GJWB 2O31A 4OMNA 2HDAA 2ED1A 5FWBA 3C0CA 1M30A 2KGTA 2KBTA 2YUNA 2P4RA 1WXBA 4R0KA 1WIEA 3VS2A 2GQIA 2KRNA 5EC7A
chains in the Genus database with same CATH superfamily
2AIRB 1IGUA 2KR3A 2QDYB 2EAYA 3PMIA 3PVQA 4M75C 3EG2A 2EVRA 1Y96A 2DVEA 1YCYA 2A7YA 3JB9D 3JRZA 3CMAT 1QCNA 4FW2A 2HSPA 4JJBA 2DL4A 4ORZA 4LD9K 1T0JA 1VQ8A 3VJPA 2GFAA 4CC7A 3MEUA 3CCQA 2EGAA 4XAXB 2R58A 3JCMf 1WHKA 4X34A 2P4TA 4J9HA 2KYMA 3HP9A 3CCSQ 4RTZA 1PC0A 4C8QA 2L2PA 2CT3A 4DEXA 1S72T 1KC8R 1I1JA 1AWJA 2R5MA 1OULA 4WTOB 1K4US 5LL6S 2EYWA 3UPUA 2VYTA 2AZSA 5GANh 3EHQA 3DB3A 4M77E 2FPDA 3QKJA 5C6SA 5C0MA 3CPWA 3G4ST 4HCKA 2A36A 5GANe 4KH1B 1WA7A 2RK2A 2G6FX 1U1SA 3EGUA 3UWNA 1NJIR 1SSHA 4HVWA 3CMEQ 3VS5A 2IIMA 1PCXA 1QWFA 1TWBA 5HCKA 5KYYB 3EAEA 1H92A 3LW5E 4IUPA 4JPBW 3L1AA 2DRMA 1Q81C 4IIOA 2HCKA 2OTJA 3CD6A 2X4JA 2L3RA 1WZOA 3PMTA 4NS5A 1RLPC 2LCCA 2ENMA 3G6ET 1IB8A 3OYYA 4L5GA 1Y7XA 2DZ9A 1QVPA 4FU6A 1KHCA 5IHNA 1W2BA 1QVFP 2A3LA 3NTHA 3NPFA 4AFZC 4C92F 3C95A 3I9QA 4OMQA 1XOVA 1YITT 1K8AC 5GAOl 1ZBXA 1X6OA 1KC8U 2E12A 4M7DB 1KC8C 5KYWB 2AKLA 4C0DC 3M55A 4JS4A 1JJ2A 1UECA 1ZA1B 2X4WA 1ZBJA 4XQ3A 1UDLA 1VQ6Q 1GCPA 2MPXC 2LQNA 1BI3A 2I2LA 2F69A 1JXOA 3EG0A 3L42A 3M4YA 3OYGA 1VQ4T 1YWPA 2LVMA 4N0AA 1NJIU 1T3LA 2FZKB 4PJOG 1UHFA 1NJIC 1RLQC 4AG2C 3QJ6A 1M1FA 4Y91A 2BE9B 5FU6C 4RKUE 3EH2A 3UT1A 2BZ8A 1YIJT 1JO8A 1D3BA 3H0IA 3DB4A 1IGQA 4M7AG 1UFFA 3SB2A 2E1HA 2ZPBB 1QKXA 3CCRT 2HNIA 5FRMA 2DM1A 1M3BA 4GBQA 4PJMA 3C94A 1HK9A 2PQWA 3GP8A 2O4XA 1NYFA 4J8OA 4M77B 4X1VA 1HXDA 2YUPA 1SSFA 2RF0A 1N8RR 1I07A 2L3SA 1AOJA 5GMKe 3VUBA 3R6OA 2MK5A 4FM4B 1VYUA 4J6WA 9ATCB 3BE3A 4JRQA 1WHMA 5A0DA 2PU9B 3QBYA 3TU4K 1M3AA 3RESA 2RI5A 4HVUA 1Q82C 2ZAEA 3FJPA 4ELZC 1WHJA 1JEGA 3M57A 2V1QA 3OBWA 4FYVB 1R0CB 3EGDB 1YJ9A 3SWNB 1LOJA 3I56T 4LUEA 1VQ5T 5GAN3 2IPOB 1WGSA 2VWFA 1QCFA 2K7AA 2PUOB 5KYYA 1W4SA 3JB9I 1PD0A 2HQXA 2JS2A 2ZPFB 4Y28E 2PTKA 3GBQA 4F7UA 1R77A 1WJSA 2JT4A 4C0ZA 3OYCA 5L8RE 1UGRB 3CCEA 5IXFA 3X28B 3M54A 4PJOA 1JB0E 3JCMW 3OQ5A 4QKUA 4XTWA 4J9CA 2YDLA 4M78F 1AT1B 4QVCA 2F5KA 2LNHB 4JRKA 4M7AA 1NM7A 2RMOA 3QPHA 3CBOA 3P8DA 2DAQA 1P92A 2SEMA 3L2ZA 2K79A 2YLCA 2KYBA 3LH5A 4OB2B 4EDUA 3L2QA 1N8RU 4JZ4A 2CP6A 3OYFA 1KK7A 3NTKA 1RAEB 4A63B 3P8BB 2Y4XA 4GY5A 1VQLT 3CC2A 4J6YA 4N0AC 3BDLA 1SRMA 1VUBA 2EFIA 2OTLQ 1FMKA 2LMJA 3OB9A 2DBKA 3LYIA 4M4ZA 4PLIA 2DK3A 4MDXA 3DLMA 4PFOA 1BK2A 3CCVA 2MAMA 4NL3A 2C0OA 2QQAA 1SF9A 3KFVA 1MMAA 2ATCB 2DNUA 2GQVA 5KH6A 5KYNA 1VQ8Q 1NG2A 3CCQQ 1K73C 3PVLA 2PVGB 3OS1A 3X20B 2MYSA 5GAMe 4BUGA 4J7FA 2F2WA 1AWWA 2CREA 1D1AA 4J9GA 4C5EA 2NYSA 2JVVA 4VUBA 4C8QE 3V8JA 2QQRA 1Z9QA 2BTTA 2DTIA 3UF4A 2K5IA 1WJRA 3UA7A 2DEQA 3PFSA 2LZ6B 3V7RA 1IREB 1BB9A 1M2VB 4P5NA 2DYBA 2DIGA 3RKXA 3CPWS 3CCLT 2B8AA 2JN0A 1H3HA 5KCHA 2VASA 4J9EA 1VQPT 4A4HA 5CKHA 2DF6A 2CZ0B 3VS4A 5GAMg 2E10A 1WDXA 3Q1JA 2HAXA 3MJXA 4XTYA 2ED0A 1SHGA 1LJOA 1UB4A 2M51A 5FW9A 2VV5A 3CCJT 1JU5C 3EGXA 3EG1A 4D8KA 3REAB 2YRVA 2VGNA 1M1GA 4C92E 4IIMA 3JCMP 4DBHA 2XIDA 2PZ1A 2RJFA 3P8HA 3M0QA 3RERA 1FX7A 2DTOA 2A28A 1XTDA 4WF2A 2OTJQ 1WHLA 7AT1B 2EQMA 1HSQA 3CD6Q 1VQOT 2GTOA 2KSSA 4OVAA 3VKIA 1AD5A 1GBQA 2K5LA 1Q7YR 2QDLA 1W2BS 5CVIA 4OMLA 2CZ7B 3CCUA 1UGSB 1SPKA 1X2KA 1VQNT 2GTJA 1KJWA 4ZGJB 1TOVA 2HBWA 4EMKA 3OBYA 3ZL7C 4C0DB 1PNJA 4BACA 5GJWB 2O31A 2V8KA 3TCJA 3JCMb 4R55A 2HDAA 2HQHA 4KBMB 2G3RA 2KBTA 1EIFA 2EQUA 4O6JA 1M2OA 4ZN1A 1VIEA 3VS2A 2NUPA 1QP3A 1HD3A 2EWNA 4PLLA 1YFNA 1Y96B 1I5OB 5CR2A 1OOTA 2RK1A 2K4YA 1K76A 1VIFA 2KT1A 2C0TA 1K0XA 3A8LB 2JZ2A 5CAIA 1LCKA 1AVZC 2XHCA 1G3YA 2JMCA 2DERA 4M77C 4BI4A 1M9SA 4C8QB 2RQUA 3JCMV 2CSQA 2QGFB 1QW1A 2QK0A 1OI1A 3OY9A 2ZPHB 3OW2P 1Q7YU 4M7DD 3EG9A 5DLQE 4HCCA 2ESWA 2LT4A 2DILA 1VA7A 2VXFA 1QVGA 2A0FB 4ATOA 3EFRA 4PNOA 5CIUA 3JCMe 2VVKA 4FYWB 1PRMC 1D0ZA 1XNIA 1V76A 3OYMA 4C92B 2LQKA 2QI2A 5LJ3f 1QP2A 1YJ9Q 5IAYA 1N27A 1NEBA 4N4IA 5FLXE 4BDYA 2FEIA 1BIBA 2EQJA 1YJNQ 2CH4A 4HVVA 2DKGA 2KK4A 2L5QA 1I81A 3JCMg 2QEXA 3KBGA 2AK5A 2CP5A 4M77D 3X26B 2RM4A 3CCEQ 2BE7D 3UDCA 3RR6A 4PJOE 1QWEA 4JRPA 2NUTA 3M0UA 2BZYA 4JJDA 4XTUA 1QMCA 3QUIA 4EMKC 4PL6A 1Y0MA 1KQ1A 3ZEHA 4EPCA 1UJ0A 2YUOA 1M8MA 1VQKT 1MMDA 2M1HA 4DQ2A 3HRUA 2FRWA 4F17A 4RTWA 2CDTA 4XU2A 1VQ7T 1MV0B 2RHXA 1D09B 3HFNA 1M90C 3OMGA 1PHTA 4RTTA 1PKTA 5GMKj 1QQJA 2KT8A 4EIKA 2PVOB 2XMFA 3BY7A 3MPUB 4JUVA 4E7ZA 5I11A 1ZX6A 3V8KA 1BU1A 3CC2Q 1AZGB 4OMPA 2ABLA 2RNAA 4D6WA 3CMAA 1KQSA 3L2VA 1TSFA 3V8LA 2FRYA 4MMLA 1D3BB 2E4HA 1BKBA 2F1LA 3H0FA 3EFSA 1YBYA 3CCVQ 1ZSGA 2JTMA 1I5LA 2KEAA 1RABB 4KT0E 5A2QE 2DJQA 2O4XB 1S72A 2KDSA 4RTXA 4F16A 1Z9ZA 1D0YA 3QHSA 3SD4A 1YHQT 2A37A 1N9RA 1JBMA 2WSCE 3AHUA 3HKSA 2K2VA 2KRMA 2DL7A 4Z8AA 4Z02A 2YSQA 5GAN8 3I55T 2P0PA 2EJFA 3G4SA 2DVJA 2JUFA 3TREA 3OS0A 1K9MR 2BZXA 1K0SA 1UG1A 2ZGWA 1VQMQ 3QIIA 3GLXA 1U8RA 2LX7A 1LVKA 3VS3A 5GJVB 3ME9A 4M75D 4BB7A 3QO3A 4C92A 2QA4Q 3VRYA 1UUEA 1TUGB 3M9QA 1YI2T 3M0TA 1DJ7B 1GFDA 2XD0A 4F7UB 2DA9A 2HL3A 2FG0A 2LC4A 2Z0WA 2DEUA 3G6EA 4QVZA 2V8JA 2LDMA 3FB9A 3FLGA 4PJOB 1KFZA 1Y07A 2HEQA 4N4GA 4IUVA 2FVUA 5LJ5f 2V8IA 1D0XA 3BW1A 1ZLMA 1YITA 2EYXA 2OI3A 1PG5B 1ZUYA 3MO8A 4M7AB 4KUDK 5EG2A 4DBQA 3E19A 3NFCA 1D1BA 3M59A 2AZVA 2PVDB 3CCUQ 4M78G 2KY9A 1LNXA 2O9SA 3CCMT 1RAFB 5IXBA 1S1NA 3JCMJ 3ASKA 5GAMj 1H8KA 5GAN4 4OGCA 5GAOp 1K9MU 2AHJB 2QQ9A 1VQ4A 2MMPA 2OJ2A 5CQXA 4KUIA 1B3QA 3RMQA 2R57A 3GF5A 3GNFB 5CO7A 4KGXB 1YIJA 2DRKA 2EQKA 3OYBA 4OP0A 3QWYA 3CCRA 2GBQA 3CC4T 4AFUC 3OYHA 2K2MA 3CC7T 4C8QC 4OMOA 3M56A 2HBPA 2HMAA 2MWOA 4C5GA 5GMKh 2DJZA 2F5TX 5D6XA 4QQGA 1OX9A 1YCSB 1SKUB 2JM9A 4ANJA 1ZUUA 2EPDA 2H8HA 2XU8A 1SEMA 3RDVA 3X25B 4LDWA 1YJWT 3H41A 1X43A 2DBMA 1OPKA 1MMGA 4PJJA 1UEBA 2K5FA 4XTXA 3RKYA 2O2OA 1QVGS 3CPFA 4RMOA 4HT9A 1E6HA 3VRZA 1T0HA 5GAMd 5GAN7 2LCLA 1U5SA 3TEEA 4C92C 2DL8A 3QYGB 2E3HA 3H0HA 2RQWA 3I56A 4NOYA 1VQ5A 3C4SA 4M78A 3LGLA 4C5IA 1FMWA 3RBBB 4KULA 3CBPA 3OA6A 1WQWA 4CI0C 3KXTA 3EGXB 3JSCA 2QYZA 2JNGA 2RH2A 2W10A 2J6OA 2EJGA 2I0NA 1VQ9T 2LJ0A 3G71T 8AT1B 2JJ9A 2O9VA 3E1SA 2EQIA 3VUZA 2O88A 3HL8A 4HCBA 4C8QD 4AFSC 2EKHA 4BD3A 2QAZA 4JDSA 2RN8A 5GMKi 2W0ZA 1KIKA 1XJWB 1ACMB 2QEXQ 4HXJA 3NTIA 1X27A 4CC3A 2FZCB 1YJNT 3CXCS 4IUTA 3RMSA 4A54A 3I35A 2P0QA 5AYFA 3G1JA 4FW1A 2XICA 4EMKB 4II1A 3HRTA 1N8RC 3L2WA 3OMCA 1LPLA 2GNCA 2CP2A 4XU1A 4E2FB 1VQLA 3META 1OU9A 2NUPB 5FWBA 2KGTA 2P4RA 1WIEA 2IVWA 4HCZA 1EFNA 2DTHA 4FT2A 2E5KA 4RG2A 3OS2A 1KQSS 1OYXA 3JB9G 4LDYA 1H641 3CEYA 3CMAQ 2FB7A 1V29B 2DXCA 3QZ5B 1QLYA 4ELYC 5GAMh 5FU7C 4N4HA 2KROA 1H3ZA 1UE9A 4DEYA 2IG0A 2X51A 4L6V5 4M7DF 3TSWA 3J81E 3VS0A 1QVFA 1S72Q 3V7CA 1G83A 1W6XA 1QCOA 2WSEE 3EG9B 2XDBA 4Y92A 5GAOm 5A0GA 3CCST 1MNEA 1X01A 4JRIA 1SHFA 3CCLA 3J7AF 2Y90A 2FHDA 1G3SA 4OMFB 3G4SQ 3A8OB 1VQPA 2EYQA 3THKA 4J9IA 2RD1A 1ZUKA 3OYNA 1VQMT 3N5BB 3CCJA 4M75G 5GAOn 2BIVA 3HRSA 3CMET 3LLRA 1ABOA 4OF1A 2DL3A 2ZZDA 3VS7A 3E9FA 2RPNA 2EGCA 1YP5A 1TG0A 1OEBA 3MP8A 3OS5A 3JCMd 1WXTA 1B34A 1X6GA 2QA4T 2C06A 4PJOC 1G2BA 4PK4A 4AFQC 4JLIA 5J39A 1VQOA 1W70A 2KI7A 3E9GA 4A4GA 3G6EQ 2VGMA 2FYKA 2VUBA 4HKEA 3NHNA 4M7AC 4DOVA 3ULRB 4C0GA 1NZ9A 1RI9A 2BKDN 1TTHB 4BY6C 5DLOA 1U1TA 2NUTB 1Q95G 1GXIE 2J05A 5LJ3e 4XTVA 1YITQ 1VQNA 3GIBA 3WVDB 3KUFA 3REBB 2B86A 2XI9A 4LN2A 3OYKA 1AZEA 2DPPB 3JAME 1SRLA 3EFOA 2M9UA 4B9WA 2RHIA 2A08A 4Z88A 3JB9F 5GAN2 3C12A 3CPWP 1M1KR 2JOYA 1JRIA 2FL7A 1BCOA 1VQ6T 2QTVA 3A98A 1VQ4Q 2R5AA 4OB3B 4EMHA 1G8XA 5LJ3g 4HT8A 1A0NB 3TQ7P 2RQRA 4K11A 1Y57A 3PE0A 1YIJQ 4PJOD 4BI8B 1WJQA 1VYVA 1NLOC 3CCRQ 2DE0X 1WNLA 5GAOq 5GMKl 2RJCA 5HK3A 4M7AD 2BUDA 3OYJA 4E7SA 3FDRA 2DX1A 2EJ9A 5CKEA 2XG8D 4JJNK 2JS0A 2J6KA 4E7KA 3INZA 1Q7YC 3JCMh 1W2BP 1M27C 1PD1A 1WHGA 5DY9A 2EYZA 4RG8A 2DXTA 4IURA 3FRNA 1AEYA 4JJCA 1IO6A 1OV3A 1X75C 4CC2A 4RCCA 4FT4A 2RHZA 4M75F 4F04B 4EMGA 1FYNA 4BE0A 1IZ6A 3HSBA 4YTLA 4LDXA 4JLGA 2LJ1A 3JB9J 3QG1A 1JJ2P 1VYTA 1WHHA 1VQ5Q 4J7IA 3MEWA 1C1AA 1OPLA 1M1KU 2QXFA 4M78E 3JCMc 1E7OA 2RHUA 1Q86R 1RAAB 2LT1A 5FWCA 1WX6A 2DD5A 4IKFA 3JCMX 1TUCA 2KXCA 4CC4B 1TXQA 5L23A 2RI2A 4E6RA 4JS5A 3CXCA 1U06A 1GRIA 4ZTFA 1AWOA 1NEGA 4MZMA 2QQBA 4PFPA 5GAOr 3S6WA 1ZA2B 1UJYA 1MNDA 1VQKA 4A4KA 3EHRA 5I21A 1TUDA 3EG3A 5FRNA 4QQ6A 1CKBA 1GCQA 3DLLA 4XK8E 1VQ7A 3SDZA 2QASA 1UHCA 3I5RA 5D7UA 4GLMA 3TSZA 4PJLA 3RIRA 5LJ5e 3QXEB 2RJDA 6AT1B 3IQLA 1M8VA 4M7DE 5DM7R 3BFMA 3VS6A 2KE9A 2DMOA 4BDZA 1Q81R 2COYA 2MOXA 2M02A 2OTLT 1R8OB 3LWIA 5KYXA 1Q86U 2ZPEB 5FU7B 3PTAA 1Q86C 4MMKA 2GCXA 2LQWA 2H3EB 3CBMA 1AWXA 1YHQA 1SG5A 5LJ5g 3MHXA 4ZGEB 5KYUB 4R56A 3PT9A 2KNBB 4B6MA 3LH0A 2CKKA 2YUQA 4RCBA 1QVFS 1YN8A 2K3XA 1VQ8T 3CCQT 2LRQA 4X9CA 3OYDA 2FPFA 3I55A 4RUGA 1K8AR 1G3TA 1NPRA 1RL2A 3BDUA 2K3BA 2X3XD 4ZTJA 3M0PA 1IXDA 2E64A 2PNIA 3ZFJA 4DBFA 3CCLQ 2K3YA 1O9SA 4M78B 2VXEA 5HKCA 2X4XA 1VQPQ 3QSUA 1MGQA 2HQEA 1ZSZA 1YI2A 3QDFA 2KMTA 2CS7A 4PFZA 3CCJQ 1UGQB 2K57A 4C8QF 5IN1A 1T3SA 3NMZC 2SRCA 1WXUA 2X35A 2AKKA 3M53A 1UTIA 4ZGDB 2DYIA 4C0FA 3HHTB 1Q81U 2ROTA 3H8ZA 4KGZB 3OSVA 2RQTA 1VQOQ 5GMKm 1IRXA 4DA4A 5IHKA 1X6BA 2OTJT 4BY6B 2AT1B 4OMMA 3PIPA 2V26A 3FJ5A 2KRSA 1NLPC 1Y71A 3CD6T 5GAN5 1EX4A 2QGGA 2CGHA 5GANg 4BE1A 2HZYA 4UC4A 3OW2A 2D8HA 1GCQC 3CCMA 1BIAA 1VQNQ 4CRIA 2DL5A 3M58A 4LUDA 2CUBA 2L0AA 1KD1R 4FIBA 2HKNA 2M0YA 4FYXB 1K8AU 1HJDA 2DIQA 3MEVA 1KHIA 3EH1A 1K1ZA 4Q5WA 1Q82R 5I2MA 1K9MC 2P84A 4J6XA 4OMNA 2ED1A 4FCYA 3C0CA 3L2RA 3VYHB 1WXBA 4R0KA 2GQIA 5M9OA 5EC7A 4OGEA 2HD0A 4F7UG 1UGVA 3CC4A 2MWPA 2E6NA 3VYGA 3I5SA 3U23A 4IUQA 3CC7A 2OAUA 2COWA 3OYLA 2K6DA 2F2VA 1RUWA 2O01E 2VC8A 1PSEA 3SFMA 4LDVA 5HK0A 4E47A 3M0RA 5KYUA 4MZPA 4M75E 3QYHB 4LXCA 1YJWA 1O75A 5GANf 4J9FA 3MEAA 4M7DG 2E65A 2CH4W 4E7JA 5CKDA 3JB9H 2LP5A 4XU3A 4ESRA 3G7ZA 3QZ9B 1OU8A 2GF7A 1ABQA 1X2QA 2Y4YA 5LJ3j 3S3OA 1KD1U 1ZSZC 1KD1C 4E7HA 1HYOA 4RTYA 2HL5C 3MCAB 5CKBA 2MI6A 1Q82U 3O8VA 1VQ9A 4WCIA 3G71A 4LD6A 4QT7A 2L3QA 5D6YA 2E6ZA 4J83A 5IHIA 1B34B 4AMCA 4PKCC 4OB0B 1YJ9T 5IT9E 1I8FA 1M3CA 4M77G 1YJNA 1K73R 1BCMA 4F14A 2DXBA 4NL2A 1PKSA 1G3WA 2RA2A 4GLKA 1ZQ1A 2YXYA 5CK9A 1WYXA 3M5AA 1VOMA 3CCET 2QG9B 1B07A 1NE8A 1GL5A 2P0KA 1VQKQ 1PRLC 1GFCA 2PUKB 3EFOB 1OQKA 2D9TA 1VQ7Q 3H9NA 4C92D 4IUUA 1QVGP 3S3NA 2E5QA 3OYAA 4M7DA 5LJ3d 4BI3A 4F7UF 5KYWA 4V2SA 3UA6A 5CQYA 4J9DA 2L89A 4ZN3A 3FIFA 4PJOF 1TH7A 3VV0A 1QKWA 3AT1B 3CC2T 2YWWA 3SHWA 4RTVA 3PIOA 1UGPB 4M7AF 3GPLA 1N6AA 4M75B 1AHJB 3JCMQ 5KCOA 2GGRA 1K9AA 4OB1B 3LWHA 3HPWA 4C5HA 1W1FA 2JMAA 3V7SA 3O5ZA 1X69A 2MF2A 2D1XA 3CCVT 1OZ2A 1YHQQ 4PJNA 1MMNA 3CCSA 1KQ2A 4A4FA 2DFUA 5AT1B 1JQQA 4O5VA 2D0NA 3RUXA 3A8HB 1YNZA 1K73U 1WFWA 1FXXA 3A8MB 3E2UA 3CXCP 1ZHIA 4J9BA 1B7TA 3I55Q 3SEMA 4M77A 2CP0A 2JW4A 5KE2A 4A53A 1PM3A 2KAFA 1BYMA 4RTUA 2CP3A 3A5ZB 4M78C 2EGEA 2COZA 1VQMA 2NLUA 2DXUA 3WXMB 1MHNA 2WACA 2HSEB 2K9GA 3PGGA 5I22A 2ZPGB 3CMEA 5CCAA 4KRTA 1YI2Q 1PSFA 3UATA 3NGPA 1KG1A 5A0LA 1OX8A 2QA4A 4ZNXA 4E7LA 4LNPA 4M77F 3EGDA 1WQ7A 5LJ5j 2OX7A 2M0OA 3R6NA 3SWNA 2EIFA 3OYIA 2CZ6B 1KQSP 1NYGA 1G5VA 2NUZA 5LJ3h 4TVRA 2CZ1B 2YRDA 5D6WA 3WVEB 1N5ZA 2MCNA 2DETA 1I4K1 2CT4A 1U3OA 2RI3A 2JXBA 3MKDA 2JTEA 2D0QB 2E41A 5KE3A 3OW2S 2RQVA 1IHVA 3A8GB 3H6ZA 2H3JA 2FPEA 4JZ3A 1OZ3A 2MIOA 5ECAA 3S3MA 1ARKA 3CCMQ 2J06A 5HY6A 2CP7A 3OSSC 2ZPIB 4KH0B 2E70A 3CCUT 4M7DC 2KQWA 4M78D 3GNGA 1WLPB 4L59A 1BBZA 2RO0A 3VS1A 3MP6A 2J7IA 2JM8A 1VQ6A 3D7SB 3LGFA 3LX7A 3VU3C 3HTRA 2X4YA 1JJ2S 1WI7A 4E7IA 4AT1B 1RI0A 4MZTA 3FEOA 2ZCFB 2D8JA 3HFOA 2L3PA 5GAMf 1E6GA 1JXMA 2LQ8A 1RACB 3PNWC 4FL6A 3URGA 3MP1A 5KYXB 3CC4Q 1PWTA 5I2SA 2XK0A 4M75A 5LJ5d 2XDPA 2EBPA 3ER0A 3CC7Q 2X3WD 5GANj 2J6FA 2YT6A 2DLPA 1NPPA 2NWMA 1RADB 5FU6B 2YHTA 1F1BB 1IHWA 1BI0A 1WPYA 2FO0A 1GBRA 1BI1A 4QQDA 4AG1C 1YJWQ 3OYEA 4XTZA 2D6FA 3CQTA 2JTFA 2HKQB 2LX9A 1I0CA 3F70A 5IH2A 3J80E 2CUDA 4A4EA 1M4ZA 1MV3A 1N9SA 2RB6A 2C0IA 4LE9A 2KXDA 2X9HA 3A1PA 1TS9A 2LCSA 3FC3A 1M90R 4Z89A 1FWZA 2L8DA 2LNVA 2V1RA 1ZSZB 2EKOA 3I56Q 2QTXA 3TVTA 1M2VA 5J3BA 3T9NA 2DD4A 4XU0A 4DOWA 3M4GA 1R0BG 2DO3A 1MUZA 5CKFA 2CYZB 1M1KC 2F2XA 2WSFE 3SWNC 1RAGB 3ZBDA 1VQ9Q 3G71Q 8ATCB 1KSWA 1V1CA 5GAN6 1TU0B 3GOXA 2EYYA 4BE2A 4MDWA 2YRCA 1RAIB 1M5Q1 1NBEB 2ROLA 2VKNA 1FMVA 4FSSA 4X9DA 5J26A 2DZCA 4FSXA 4C8QG 1XQHA 1C6VX 3RNJA 1BI2A 3QDRB 5GANd 2CSIA 2OAWA 2ECZA 4QVDA 1CKAA 2QQSA 2LJ3A 3RKWA 1RAHB 1C0MA 2M16A 4KGVB 2KVQG 1CSKA 4F7UE 3L2UA 2QEXT 3QWXX 3JV3A 3X24B 5LJ5h 1J3TA 4QW2A 2XDDA 3M0SA 2EW3A 2RJEA 1YWOA 2E3IA 4HA8A 4B9XA 2LTOA 2GFUA 4DBRA 3DKMA 2YLBA 4D8DA 1VQLQ 1EZZB 2VB6A 5FROA 4M7AE 2FZGB 4C92G 4J5YA 1M30A 2YUNA 4ME7A 1M90U 4LDUA 2XKOC 4FYYB 1D1CA 2RHYA 3QJYA 2KRNA 2OTLA
chains in the Genus database with same CATH topology
1HD3A 1EFNA 2KR3A 2E5KA 3PVQA 1UGVA 3EG2A 2EVRA 3I5SA 3U23A 1OOTA 1K76A 2KT1A 2K6DA 1QLYA 2F2VA 2HSPA 1RUWA 4JJBA 2C0TA 1K0XA 2DL4A 2KROA 4ORZA 1UE9A 4DEYA 1T0JA 1LCKA 4CC7A 2EGAA 1AVZC 2JMCA 3M0RA 3TSWA 3VS0A 2RQUA 4J9HA 2CSQA 2KYMA 4J9FA 1G83A 1W6XA 4RTZA 2L2PA 2CT3A 4DEXA 4Y92A 1I1JA 1AWJA 2CH4W 2LP5A 1K4US 1SHFA 2ESWA 4ESRA 2EYWA 2DILA 1VA7A 2AZSA 3EHQA 1ABQA 1X2QA 2FPDA 3THKA 4J9IA 2VVKA 4HCKA 2A36A 1PRMC 1WA7A 4RTYA 1ZUKA 2G6FX 3EGUA 1SSHA 4HVWA 4WCIA 4QT7A 3VS5A 2IIMA 2L3QA 1ABOA 2DL3A 1QWFA 5IHIA 3VS7A 2RPNA 2EGCA 1YP5A 1TG0A 1OEBA 5HCKA 1H92A 1NEBA 1WXTA 1X6GA 4JPBW 1G2BA 4AFQC 2DRMA 2FEIA 1W70A 4IIOA 2HCKA 2CH4A 4HVVA 1M3CA 3NHNA 1RLPC 3ULRB 2ENMA 4F14A 2AK5A 1PKSA 1RI9A 1WYXA 2J05A 5IHNA 1QWEA 3NPFA 3M0UA 1B07A 2BZYA 4JJDA 4AFZC 3I9QA 4OMQA 1XOVA 1GL5A 3REBB 2B86A 1PRLC 1GFCA 1Y0MA 1UJ0A 2YUOA 1M8MA 4LN2A 1AZEA 2FRWA 2AKLA 1SRLA 4F17A 4RTWA 2CDTA 1MV0B 1UECA 1ZBJA 1PHTA 1UDLA 2A08A 1GCPA 4RTTA 1PKTA 4Z88A 2LQNA 2KT8A 4EIKA 3UA6A 2XMFA 5I11A 4J9DA 1ZX6A 1JXOA 3A98A 3EG0A 1BU1A 1AZGB 4OMPA 2ABLA 1A0NB 1YWPA 1QKWA 2RNAA 2RQRA 4K11A 1T3LA 3SHWA 4RTVA 1UHFA 1RLQC 1Y57A 2FRYA 3PE0A 4AG2C 3H0FA 2GGRA 1K9AA 2BZ8A 1JO8A 1VYVA 1NLOC 3H0IA 2DE0X 1ZSGA 1W1FA 2JMAA 1UFFA 3O5ZA 1X69A 2KEAA 1QKXA 2D1XA 2DM1A 1M3BA 4GBQA 2DJQA 2DX1A 4RTXA 4F16A 1Z9ZA 2A37A 2JS0A 1JQQA 2D0NA 2J6KA 1YNZA 1NYFA 1WFWA 4X1VA 2YUPA 4J9BA 1M27C 2RF0A 3SEMA 1I07A 2KRMA 2L3SA 1AOJA 2DL7A 2JW4A 4Z8AA 2EYZA 2YSQA 1AEYA 4JJCA 1IO6A 4RTUA 1OV3A 4CC2A 1VYUA 2DVJA 2EGEA 2BZXA 1K0SA 1UG1A 1FYNA 1M3AA 4HVUA 2LJ1A 5I22A 2K9GA 2LX7A 1JEGA 3VS3A 1VYTA 2V1QA 5GJVB 4KRTA 3UATA 3NGPA 1OPLA 3VRYA 1UUEA 4LUEA 2VWFA 1E7OA 4ZNXA 3M0TA 4LNPA 1GFDA 1QCFA 2K7AA 5FWCA 1WX6A 3R6NA 1NYGA 1TUCA 2DA9A 2FG0A 2JS2A 2KXCA 4CC4B 2NUZA 2PTKA 3GBQA 5L23A 4E6RA 2JT4A 1KFZA 2HEQA 1U06A 5IXFA 1GRIA 1N5ZA 2MCNA 1ZLMA 2CT4A 4J9CA 1AWOA 2YDLA 1U3OA 2EYXA 2OI3A 2JXBA 1ZUYA 1NEGA 2JTEA 2LNHB 2RQVA 1UJYA 2FPEA 1NM7A 4JZ3A 2MIOA 2RMOA 5ECAA 3EHRA 1ARKA 2AZVA 1TUDA 2J06A 3EG3A 1CKBA 1GCQA 2SEMA 2O9SA 2K79A 2KYBA 5IXBA 3LH5A 1WLPB 1S1NA 1BBZA 4JZ4A 3VS1A 1UHCA 3I5RA 4GLMA 3TSZA 2J7IA 2JM8A 1H8KA 4A63B 1WI7A 2OJ2A 1SRMA 3IQLA 2D8JA 2L3PA 1B3QA 1E6GA 1JXMA 3VS6A 2KE9A 1FMKA 2LMJA 2DBKA 2DMOA 2MOXA 4M4ZA 2DRKA 1PWTA 2EBPA 3QWYA 2GBQA 1BK2A 2X3WD 2C0OA 2J6FA 4AFUC 2YT6A 2DLPA 3KFVA 2LQWA 2K2MA 2NWMA 4OMOA 1AWXA 2DNUA 2FO0A 1NG2A 1GBRA 2KNBB 1YCSB 2YUQA 2JM9A 3PVLA 1YN8A 4AG1C 2H8HA 1ZUUA 2EPDA 1SEMA 2F2WA 1AWWA 2CREA 2FPFA 4RUGA 4J9GA 3CQTA 5IH2A 1I0CA 2CUDA 2K3BA 3H41A 1X43A 2X3XD 2DBMA 1MV3A 1OPKA 2C0IA 4LE9A 1Z9QA 2KXDA 3M0PA 2BTTA 2O2OA 3UF4A 2PNIA 3UA7A 2LCSA 2LZ6B 4Z89A 1E6HA 1BB9A 3VRZA 1T0HA 2V1RA 2DYBA 1U5SA 3TVTA 2DL8A 1H3HA 3H0HA 2RQWA 1MUZA 4J9EA 3RBBB 2DF6A 2F2XA 3VS4A 1WDXA 2W10A 1KSWA 1V1CA 2J6OA 2ED0A 1SHGA 2I0NA 5FW9A 2EYYA 2M51A 2LJ0A 1JU5C 1T3SA 3NMZC 2SRCA 3EG1A 2ROLA 1WXUA 4D8KA 2AKKA 3REAB 2VKNA 2O9VA 1UTIA 4FSSA 4IIMA 2EQIA 2O88A 2PZ1A 2ROTA 3RNJA 3M0QA 2RQTA 4AFSC 2A28A 2CSIA 2EKHA 2OAWA 2ECZA 1CKAA 5IHKA 2RN8A 1HSQA 2W0ZA 2LJ3A 1X6BA 1KIKA 2GTOA 4OMMA 4HXJA 3FJ5A 2KRSA 1NLPC 1CSKA 1AD5A 1GBQA 1X27A 4CC3A 3QWXX 2QDLA 2D8HA 3I35A 4OMLA 1GCQC 3JV3A 1J3TA 2DL5A 4LUDA 3M0SA 2EW3A 2L0AA 2CUBA 1YWOA 1SPKA 1X2KA 2M0YA 2GTJA 1KJWA 4D8DA 2HBWA 1HJDA 2GNCA 3ZL7C 1K1ZA 1PNJA 5GJWB 2O31A 4OMNA 2HDAA 2ED1A 5FWBA 3C0CA 1M30A 2KGTA 2KBTA 2YUNA 2P4RA 1WXBA 4R0KA 1WIEA 3VS2A 2GQIA 2KRNA 5EC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD3 A;  1EFN A;  2KR3 A;  2E5K A;  3PVQ A;  1UGV A;  3EG2 A;  2EVR A;  3I5S A;  3U23 A;  1OOT A;  1K76 A;  2KT1 A;  2K6D A;  1QLY A;  2F2V A;  2HSP A;  1RUW A;  4JJB A;  2C0T A;  1K0X A;  2DL4 A;  2KRO A;  4ORZ A;  1UE9 A;  4DEY A;  1T0J A;  1LCK A;  4CC7 A;  2EGA A;  1AVZ C;  2JMC A;  3M0R A;  3TSW A;  3VS0 A;  2RQU A;  4J9H A;  2CSQ A;  2KYM A;  4J9F A;  1G83 A;  1W6X A;  4RTZ A;  2L2P A;  2CT3 A;  4DEX A;  4Y92 A;  1I1J A;  1AWJ A;  2CH4 W;  2LP5 A;  1K4U S;  1SHF A;  2ESW A;  4ESR A;  2EYW A;  2DIL A;  1VA7 A;  2AZS A;  3EHQ A;  1ABQ A;  1X2Q A;  2FPD A;  3THK A;  4J9I A;  2VVK A;  4HCK A;  2A36 A;  1PRM C;  1WA7 A;  4RTY A;  1ZUK A;  2G6F X;  3EGU A;  1SSH A;  4HVW A;  4WCI A;  4QT7 A;  3VS5 A;  2IIM A;  2L3Q A;  1ABO A;  2DL3 A;  1QWF A;  5IHI A;  3VS7 A;  2RPN A;  2EGC A;  1YP5 A;  1TG0 A;  1OEB A;  5HCK A;  1H92 A;  1NEB A;  1WXT A;  1X6G A;  4JPB W;  1G2B A;  4AFQ C;  2DRM A;  2FEI A;  1W70 A;  4IIO A;  2HCK A;  2CH4 A;  4HVV A;  1M3C A;  3NHN A;  1RLP C;  3ULR B;  2ENM A;  4F14 A;  2AK5 A;  1PKS A;  1RI9 A;  1WYX A;  2J05 A;  5IHN A;  1QWE A;  3NPF A;  3M0U A;  1B07 A;  2BZY A;  4JJD A;  4AFZ C;  3I9Q A;  4OMQ A;  1XOV A;  1GL5 A;  3REB B;  2B86 A;  1PRL C;  1GFC A;  1Y0M A;  1UJ0 A;  2YUO A;  1M8M A;  4LN2 A;  1AZE A;  2FRW A;  2AKL A;  1SRL A;  4F17 A;  4RTW A;  2CDT A;  1MV0 B;  1UEC A;  1ZBJ A;  1PHT A;  1UDL A;  2A08 A;  1GCP A;  4RTT A;  1PKT A;  4Z88 A;  2LQN A;  2KT8 A;  4EIK A;  3UA6 A;  2XMF A;  5I11 A;  4J9D A;  1ZX6 A;  1JXO A;  3A98 A;  3EG0 A;  1BU1 A;  1AZG B;  4OMP A;  2ABL A;  1A0N B;  1YWP A;  1QKW A;  2RNA A;  2RQR A;  4K11 A;  1T3L A;  3SHW A;  4RTV A;  1UHF A;  1RLQ C;  1Y57 A;  2FRY A;  3PE0 A;  4AG2 C;  3H0F A;  2GGR A;  1K9A A;  2BZ8 A;  1JO8 A;  1VYV A;  1NLO C;  3H0I A;  2DE0 X;  1ZSG A;  1W1F A;  2JMA A;  1UFF A;  3O5Z A;  1X69 A;  2KEA A;  1QKX A;  2D1X A;  2DM1 A;  1M3B A;  4GBQ A;  2DJQ A;  2DX1 A;  4RTX A;  4F16 A;  1Z9Z A;  2A37 A;  2JS0 A;  1JQQ A;  2D0N A;  2J6K A;  1YNZ A;  1NYF A;  1WFW A;  4X1V A;  2YUP A;  4J9B A;  1M27 C;  2RF0 A;  3SEM A;  1I07 A;  2KRM A;  2L3S A;  1AOJ A;  2DL7 A;  2JW4 A;  4Z8A A;  2EYZ A;  2YSQ A;  1AEY A;  4JJC A;  1IO6 A;  4RTU A;  1OV3 A;  4CC2 A;  1VYU A;  2DVJ A;  2EGE A;  2BZX A;  1K0S A;  1UG1 A;  1FYN A;  1M3A A;  4HVU A;  2LJ1 A;  5I22 A;  2K9G A;  2LX7 A;  1JEG A;  3VS3 A;  1VYT A;  2V1Q A;  5GJV B;  4KRT A;  3UAT A;  3NGP A;  1OPL A;  3VRY A;  1UUE A;  4LUE A;  2VWF A;  1E7O A;  4ZNX A;  3M0T A;  4LNP A;  1GFD A;  1QCF A;  2K7A A;  5FWC A;  1WX6 A;  3R6N A;  1NYG A;  1TUC A;  2DA9 A;  2FG0 A;  2JS2 A;  2KXC A;  4CC4 B;  2NUZ A;  2PTK A;  3GBQ A;  5L23 A;  4E6R A;  2JT4 A;  1KFZ A;  2HEQ A;  1U06 A;  5IXF A;  1GRI A;  1N5Z A;  2MCN A;  1ZLM A;  2CT4 A;  4J9C A;  1AWO A;  2YDL A;  1U3O A;  2EYX A;  2OI3 A;  2JXB A;  1ZUY A;  1NEG A;  2JTE A;  2LNH B;  2RQV A;  1UJY A;  2FPE A;  1NM7 A;  4JZ3 A;  2MIO A;  2RMO A;  5ECA A;  3EHR A;  1ARK A;  2AZV A;  1TUD A;  2J06 A;  3EG3 A;  1CKB A;  1GCQ A;  2SEM A;  2O9S A;  2K79 A;  2KYB A;  5IXB A;  3LH5 A;  1WLP B;  1S1N A;  1BBZ A;  4JZ4 A;  3VS1 A;  1UHC A;  3I5R A;  4GLM A;  3TSZ A;  2J7I A;  2JM8 A;  1H8K A;  4A63 B;  1WI7 A;  2OJ2 A;  1SRM A;  3IQL A;  2D8J A;  2L3P A;  1B3Q A;  1E6G A;  1JXM A;  3VS6 A;  2KE9 A;  1FMK A;  2LMJ A;  2DBK A;  2DMO A;  2MOX A;  4M4Z A;  2DRK A;  1PWT A;  2EBP A;  3QWY A;  2GBQ A;  1BK2 A;  2X3W D;  2C0O A;  2J6F A;  4AFU C;  2YT6 A;  2DLP A;  3KFV A;  2LQW A;  2K2M A;  2NWM A;  4OMO A;  1AWX A;  2DNU A;  2FO0 A;  1NG2 A;  1GBR A;  2KNB B;  1YCS B;  2YUQ A;  2JM9 A;  3PVL A;  1YN8 A;  4AG1 C;  2H8H A;  1ZUU A;  2EPD A;  1SEM A;  2F2W A;  1AWW A;  2CRE A;  2FPF A;  4RUG A;  4J9G A;  3CQT A;  5IH2 A;  1I0C A;  2CUD A;  2K3B A;  3H41 A;  1X43 A;  2X3X D;  2DBM A;  1MV3 A;  1OPK A;  2C0I A;  4LE9 A;  1Z9Q A;  2KXD A;  3M0P A;  2BTT A;  2O2O A;  3UF4 A;  2PNI A;  3UA7 A;  2LCS A;  2LZ6 B;  4Z89 A;  1E6H A;  1BB9 A;  3VRZ A;  1T0H A;  2V1R A;  2DYB A;  1U5S A;  3TVT A;  2DL8 A;  1H3H A;  3H0H A;  2RQW A;  1MUZ A;  4J9E A;  3RBB B;  2DF6 A;  2F2X A;  3VS4 A;  1WDX A;  2W10 A;  1KSW A;  1V1C A;  2J6O A;  2ED0 A;  1SHG A;  2I0N A;  5FW9 A;  2EYY A;  2M51 A;  2LJ0 A;  1JU5 C;  1T3S A;  3NMZ C;  2SRC A;  3EG1 A;  2ROL A;  1WXU A;  4D8K A;  2AKK A;  3REA B;  2VKN A;  2O9V A;  1UTI A;  4FSS A;  4IIM A;  2EQI A;  2O88 A;  2PZ1 A;  2ROT A;  3RNJ A;  3M0Q A;  2RQT A;  4AFS C;  2A28 A;  2CSI A;  2EKH A;  2OAW A;  2ECZ A;  1CKA A;  5IHK A;  2RN8 A;  1HSQ A;  2W0Z A;  2LJ3 A;  1X6B A;  1KIK A;  2GTO A;  4OMM A;  4HXJ A;  3FJ5 A;  2KRS A;  1NLP C;  1CSK A;  1AD5 A;  1GBQ A;  1X27 A;  4CC3 A;  3QWX X;  2QDL A;  2D8H A;  3I35 A;  4OML A;  1GCQ C;  3JV3 A;  1J3T A;  2DL5 A;  4LUD A;  3M0S A;  2EW3 A;  2L0A A;  2CUB A;  1YWO A;  1SPK A;  1X2K A;  2M0Y A;  2GTJ A;  1KJW A;  4D8D A;  2HBW A;  1HJD A;  2GNC A;  3ZL7 C;  1K1Z A;  1PNJ A;  5GJW B;  2O31 A;  4OMN A;  2HDA A;  2ED1 A;  5FWB A;  3C0C A;  1M30 A;  2KGT A;  2KBT A;  2YUN A;  2P4R A;  1WXB A;  4R0K A;  1WIE A;  3VS2 A;  2GQI A;  2KRN A;  5EC7 A; 
#chains in the Genus database with same CATH topology
 2AIR B;  1IGU A;  2KR3 A;  2QDY B;  2EAY A;  3PMI A;  3PVQ A;  4M75 C;  3EG2 A;  2EVR A;  1Y96 A;  2DVE A;  1YCY A;  2A7Y A;  3JB9 D;  3JRZ A;  3CMA T;  1QCN A;  4FW2 A;  2HSP A;  4JJB A;  2DL4 A;  4ORZ A;  4LD9 K;  1T0J A;  1VQ8 A;  3VJP A;  2GFA A;  4CC7 A;  3MEU A;  3CCQ A;  2EGA A;  4XAX B;  2R58 A;  3JCM f;  1WHK A;  4X34 A;  2P4T A;  4J9H A;  2KYM A;  3HP9 A;  3CCS Q;  4RTZ A;  1PC0 A;  4C8Q A;  2L2P A;  2CT3 A;  4DEX A;  1S72 T;  1KC8 R;  1I1J A;  1AWJ A;  2R5M A;  1OUL A;  4WTO B;  1K4U S;  5LL6 S;  2EYW A;  3UPU A;  2VYT A;  2AZS A;  5GAN h;  3EHQ A;  3DB3 A;  4M77 E;  2FPD A;  3QKJ A;  5C6S A;  5C0M A;  3CPW A;  3G4S T;  4HCK A;  2A36 A;  5GAN e;  4KH1 B;  1WA7 A;  2RK2 A;  2G6F X;  1U1S A;  3EGU A;  3UWN A;  1NJI R;  1SSH A;  4HVW A;  3CME Q;  3VS5 A;  2IIM A;  1PCX A;  1QWF A;  1TWB A;  5HCK A;  5KYY B;  3EAE A;  1H92 A;  3LW5 E;  4IUP A;  4JPB W;  3L1A A;  2DRM A;  1Q81 C;  4IIO A;  2HCK A;  2OTJ A;  3CD6 A;  2X4J A;  2L3R A;  1WZO A;  3PMT A;  4NS5 A;  1RLP C;  2LCC A;  2ENM A;  3G6E T;  1IB8 A;  3OYY A;  4L5G A;  1Y7X A;  2DZ9 A;  1QVP A;  4FU6 A;  1KHC A;  5IHN A;  1W2B A;  1QVF P;  2A3L A;  3NTH A;  3NPF A;  4AFZ C;  4C92 F;  3C95 A;  3I9Q A;  4OMQ A;  1XOV A;  1YIT T;  1K8A C;  5GAO l;  1ZBX A;  1X6O A;  1KC8 U;  2E12 A;  4M7D B;  1KC8 C;  5KYW B;  2AKL A;  4C0D C;  3M55 A;  4JS4 A;  1JJ2 A;  1UEC A;  1ZA1 B;  2X4W A;  1ZBJ A;  4XQ3 A;  1UDL A;  1VQ6 Q;  1GCP A;  2MPX C;  2LQN A;  1BI3 A;  2I2L A;  2F69 A;  1JXO A;  3EG0 A;  3L42 A;  3M4Y A;  3OYG A;  1VQ4 T;  1YWP A;  2LVM A;  4N0A A;  1NJI U;  1T3L A;  2FZK B;  4PJO G;  1UHF A;  1NJI C;  1RLQ C;  4AG2 C;  3QJ6 A;  1M1F A;  4Y91 A;  2BE9 B;  5FU6 C;  4RKU E;  3EH2 A;  3UT1 A;  2BZ8 A;  1YIJ T;  1JO8 A;  1D3B A;  3H0I A;  3DB4 A;  1IGQ A;  4M7A G;  1UFF A;  3SB2 A;  2E1H A;  2ZPB B;  1QKX A;  3CCR T;  2HNI A;  5FRM A;  2DM1 A;  1M3B A;  4GBQ A;  4PJM A;  3C94 A;  1HK9 A;  2PQW A;  3GP8 A;  2O4X A;  1NYF A;  4J8O A;  4M77 B;  4X1V A;  1HXD A;  2YUP A;  1SSF A;  2RF0 A;  1N8R R;  1I07 A;  2L3S A;  1AOJ A;  5GMK e;  3VUB A;  3R6O A;  2MK5 A;  4FM4 B;  1VYU A;  4J6W A;  9ATC B;  3BE3 A;  4JRQ A;  1WHM A;  5A0D A;  2PU9 B;  3QBY A;  3TU4 K;  1M3A A;  3RES A;  2RI5 A;  4HVU A;  1Q82 C;  2ZAE A;  3FJP A;  4ELZ C;  1WHJ A;  1JEG A;  3M57 A;  2V1Q A;  3OBW A;  4FYV B;  1R0C B;  3EGD B;  1YJ9 A;  3SWN B;  1LOJ A;  3I56 T;  4LUE A;  1VQ5 T;  5GAN 3;  2IPO B;  1WGS A;  2VWF A;  1QCF A;  2K7A A;  2PUO B;  5KYY A;  1W4S A;  3JB9 I;  1PD0 A;  2HQX A;  2JS2 A;  2ZPF B;  4Y28 E;  2PTK A;  3GBQ A;  4F7U A;  1R77 A;  1WJS A;  2JT4 A;  4C0Z A;  3OYC A;  5L8R E;  1UGR B;  3CCE A;  5IXF A;  3X28 B;  3M54 A;  4PJO A;  1JB0 E;  3JCM W;  3OQ5 A;  4QKU A;  4XTW A;  4J9C A;  2YDL A;  4M78 F;  1AT1 B;  4QVC A;  2F5K A;  2LNH B;  4JRK A;  4M7A A;  1NM7 A;  2RMO A;  3QPH A;  3CBO A;  3P8D A;  2DAQ A;  1P92 A;  2SEM A;  3L2Z A;  2K79 A;  2YLC A;  2KYB A;  3LH5 A;  4OB2 B;  4EDU A;  3L2Q A;  1N8R U;  4JZ4 A;  2CP6 A;  3OYF A;  1KK7 A;  3NTK A;  1RAE B;  4A63 B;  3P8B B;  2Y4X A;  4GY5 A;  1VQL T;  3CC2 A;  4J6Y A;  4N0A C;  3BDL A;  1SRM A;  1VUB A;  2EFI A;  2OTL Q;  1FMK A;  2LMJ A;  3OB9 A;  2DBK A;  3LYI A;  4M4Z A;  4PLI A;  2DK3 A;  4MDX A;  3DLM A;  4PFO A;  1BK2 A;  3CCV A;  2MAM A;  4NL3 A;  2C0O A;  2QQA A;  1SF9 A;  3KFV A;  1MMA A;  2ATC B;  2DNU A;  2GQV A;  5KH6 A;  5KYN A;  1VQ8 Q;  1NG2 A;  3CCQ Q;  1K73 C;  3PVL A;  2PVG B;  3OS1 A;  3X20 B;  2MYS A;  5GAM e;  4BUG A;  4J7F A;  2F2W A;  1AWW A;  2CRE A;  1D1A A;  4J9G A;  4C5E A;  2NYS A;  2JVV A;  4VUB A;  4C8Q E;  3V8J A;  2QQR A;  1Z9Q A;  2BTT A;  2DTI A;  3UF4 A;  2K5I A;  1WJR A;  3UA7 A;  2DEQ A;  3PFS A;  2LZ6 B;  3V7R A;  1IRE B;  1BB9 A;  1M2V B;  4P5N A;  2DYB A;  2DIG A;  3RKX A;  3CPW S;  3CCL T;  2B8A A;  2JN0 A;  1H3H A;  5KCH A;  2VAS A;  4J9E A;  1VQP T;  4A4H A;  5CKH A;  2DF6 A;  2CZ0 B;  3VS4 A;  5GAM g;  2E10 A;  1WDX A;  3Q1J A;  2HAX A;  3MJX A;  4XTY A;  2ED0 A;  1SHG A;  1LJO A;  1UB4 A;  2M51 A;  5FW9 A;  2VV5 A;  3CCJ T;  1JU5 C;  3EGX A;  3EG1 A;  4D8K A;  3REA B;  2YRV A;  2VGN A;  1M1G A;  4C92 E;  4IIM A;  3JCM P;  4DBH A;  2XID A;  2PZ1 A;  2RJF A;  3P8H A;  3M0Q A;  3RER A;  1FX7 A;  2DTO A;  2A28 A;  1XTD A;  4WF2 A;  2OTJ Q;  1WHL A;  7AT1 B;  2EQM A;  1HSQ A;  3CD6 Q;  1VQO T;  2GTO A;  2KSS A;  4OVA A;  3VKI A;  1AD5 A;  1GBQ A;  2K5L A;  1Q7Y R;  2QDL A;  1W2B S;  5CVI A;  4OML A;  2CZ7 B;  3CCU A;  1UGS B;  1SPK A;  1X2K A;  1VQN T;  2GTJ A;  1KJW A;  4ZGJ B;  1TOV A;  2HBW A;  4EMK A;  3OBY A;  3ZL7 C;  4C0D B;  1PNJ A;  4BAC A;  5GJW B;  2O31 A;  2V8K A;  3TCJ A;  3JCM b;  4R55 A;  2HDA A;  2HQH A;  4KBM B;  2G3R A;  2KBT A;  1EIF A;  2EQU A;  4O6J A;  1M2O A;  4ZN1 A;  1VIE A;  3VS2 A;  2NUP A;  1QP3 A;  1HD3 A;  2EWN A;  4PLL A;  1YFN A;  1Y96 B;  1I5O B;  5CR2 A;  1OOT A;  2RK1 A;  2K4Y A;  1K76 A;  1VIF A;  2KT1 A;  2C0T A;  1K0X A;  3A8L B;  2JZ2 A;  5CAI A;  1LCK A;  1AVZ C;  2XHC A;  1G3Y A;  2JMC A;  2DER A;  4M77 C;  4BI4 A;  1M9S A;  4C8Q B;  2RQU A;  3JCM V;  2CSQ A;  2QGF B;  1QW1 A;  2QK0 A;  1OI1 A;  3OY9 A;  2ZPH B;  3OW2 P;  1Q7Y U;  4M7D D;  3EG9 A;  5DLQ E;  4HCC A;  2ESW A;  2LT4 A;  2DIL A;  1VA7 A;  2VXF A;  1QVG A;  2A0F B;  4ATO A;  3EFR A;  4PNO A;  5CIU A;  3JCM e;  2VVK A;  4FYW B;  1PRM C;  1D0Z A;  1XNI A;  1V76 A;  3OYM A;  4C92 B;  2LQK A;  2QI2 A;  5LJ3 f;  1QP2 A;  1YJ9 Q;  5IAY A;  1N27 A;  1NEB A;  4N4I A;  5FLX E;  4BDY A;  2FEI A;  1BIB A;  2EQJ A;  1YJN Q;  2CH4 A;  4HVV A;  2DKG A;  2KK4 A;  2L5Q A;  1I81 A;  3JCM g;  2QEX A;  3KBG A;  2AK5 A;  2CP5 A;  4M77 D;  3X26 B;  2RM4 A;  3CCE Q;  2BE7 D;  3UDC A;  3RR6 A;  4PJO E;  1QWE A;  4JRP A;  2NUT A;  3M0U A;  2BZY A;  4JJD A;  4XTU A;  1QMC A;  3QUI A;  4EMK C;  4PL6 A;  1Y0M A;  1KQ1 A;  3ZEH A;  4EPC A;  1UJ0 A;  2YUO A;  1M8M A;  1VQK T;  1MMD A;  2M1H A;  4DQ2 A;  3HRU A;  2FRW A;  4F17 A;  4RTW A;  2CDT A;  4XU2 A;  1VQ7 T;  1MV0 B;  2RHX A;  1D09 B;  3HFN A;  1M90 C;  3OMG A;  1PHT A;  4RTT A;  1PKT A;  5GMK j;  1QQJ A;  2KT8 A;  4EIK A;  2PVO B;  2XMF A;  3BY7 A;  3MPU B;  4JUV A;  4E7Z A;  5I11 A;  1ZX6 A;  3V8K A;  1BU1 A;  3CC2 Q;  1AZG B;  4OMP A;  2ABL A;  2RNA A;  4D6W A;  3CMA A;  1KQS A;  3L2V A;  1TSF A;  3V8L A;  2FRY A;  4MML A;  1D3B B;  2E4H A;  1BKB A;  2F1L A;  3H0F A;  3EFS A;  1YBY A;  3CCV Q;  1ZSG A;  2JTM A;  1I5L A;  2KEA A;  1RAB B;  4KT0 E;  5A2Q E;  2DJQ A;  2O4X B;  1S72 A;  2KDS A;  4RTX A;  4F16 A;  1Z9Z A;  1D0Y A;  3QHS A;  3SD4 A;  1YHQ T;  2A37 A;  1N9R A;  1JBM A;  2WSC E;  3AHU A;  3HKS A;  2K2V A;  2KRM A;  2DL7 A;  4Z8A A;  4Z02 A;  2YSQ A;  5GAN 8;  3I55 T;  2P0P A;  2EJF A;  3G4S A;  2DVJ A;  2JUF A;  3TRE A;  3OS0 A;  1K9M R;  2BZX A;  1K0S A;  1UG1 A;  2ZGW A;  1VQM Q;  3QII A;  3GLX A;  1U8R A;  2LX7 A;  1LVK A;  3VS3 A;  5GJV B;  3ME9 A;  4M75 D;  4BB7 A;  3QO3 A;  4C92 A;  2QA4 Q;  3VRY A;  1UUE A;  1TUG B;  3M9Q A;  1YI2 T;  3M0T A;  1DJ7 B;  1GFD A;  2XD0 A;  4F7U B;  2DA9 A;  2HL3 A;  2FG0 A;  2LC4 A;  2Z0W A;  2DEU A;  3G6E A;  4QVZ A;  2V8J A;  2LDM A;  3FB9 A;  3FLG A;  4PJO B;  1KFZ A;  1Y07 A;  2HEQ A;  4N4G A;  4IUV A;  2FVU A;  5LJ5 f;  2V8I A;  1D0X A;  3BW1 A;  1ZLM A;  1YIT A;  2EYX A;  2OI3 A;  1PG5 B;  1ZUY A;  3MO8 A;  4M7A B;  4KUD K;  5EG2 A;  4DBQ A;  3E19 A;  3NFC A;  1D1B A;  3M59 A;  2AZV A;  2PVD B;  3CCU Q;  4M78 G;  2KY9 A;  1LNX A;  2O9S A;  3CCM T;  1RAF B;  5IXB A;  1S1N A;  3JCM J;  3ASK A;  5GAM j;  1H8K A;  5GAN 4;  4OGC A;  5GAO p;  1K9M U;  2AHJ B;  2QQ9 A;  1VQ4 A;  2MMP A;  2OJ2 A;  5CQX A;  4KUI A;  1B3Q A;  3RMQ A;  2R57 A;  3GF5 A;  3GNF B;  5CO7 A;  4KGX B;  1YIJ A;  2DRK A;  2EQK A;  3OYB A;  4OP0 A;  3QWY A;  3CCR A;  2GBQ A;  3CC4 T;  4AFU C;  3OYH A;  2K2M A;  3CC7 T;  4C8Q C;  4OMO A;  3M56 A;  2HBP A;  2HMA A;  2MWO A;  4C5G A;  5GMK h;  2DJZ A;  2F5T X;  5D6X A;  4QQG A;  1OX9 A;  1YCS B;  1SKU B;  2JM9 A;  4ANJ A;  1ZUU A;  2EPD A;  2H8H A;  2XU8 A;  1SEM A;  3RDV A;  3X25 B;  4LDW A;  1YJW T;  3H41 A;  1X43 A;  2DBM A;  1OPK A;  1MMG A;  4PJJ A;  1UEB A;  2K5F A;  4XTX A;  3RKY A;  2O2O A;  1QVG S;  3CPF A;  4RMO A;  4HT9 A;  1E6H A;  3VRZ A;  1T0H A;  5GAM d;  5GAN 7;  2LCL A;  1U5S A;  3TEE A;  4C92 C;  2DL8 A;  3QYG B;  2E3H A;  3H0H A;  2RQW A;  3I56 A;  4NOY A;  1VQ5 A;  3C4S A;  4M78 A;  3LGL A;  4C5I A;  1FMW A;  3RBB B;  4KUL A;  3CBP A;  3OA6 A;  1WQW A;  4CI0 C;  3KXT A;  3EGX B;  3JSC A;  2QYZ A;  2JNG A;  2RH2 A;  2W10 A;  2J6O A;  2EJG A;  2I0N A;  1VQ9 T;  2LJ0 A;  3G71 T;  8AT1 B;  2JJ9 A;  2O9V A;  3E1S A;  2EQI A;  3VUZ A;  2O88 A;  3HL8 A;  4HCB A;  4C8Q D;  4AFS C;  2EKH A;  4BD3 A;  2QAZ A;  4JDS A;  2RN8 A;  5GMK i;  2W0Z A;  1KIK A;  1XJW B;  1ACM B;  2QEX Q;  4HXJ A;  3NTI A;  1X27 A;  4CC3 A;  2FZC B;  1YJN T;  3CXC S;  4IUT A;  3RMS A;  4A54 A;  3I35 A;  2P0Q A;  5AYF A;  3G1J A;  4FW1 A;  2XIC A;  4EMK B;  4II1 A;  3HRT A;  1N8R C;  3L2W A;  3OMC A;  1LPL A;  2GNC A;  2CP2 A;  4XU1 A;  4E2F B;  1VQL A;  3MET A;  1OU9 A;  2NUP B;  5FWB A;  2KGT A;  2P4R A;  1WIE A;  2IVW A;  4HCZ A;  1EFN A;  2DTH A;  4FT2 A;  2E5K A;  4RG2 A;  3OS2 A;  1KQS S;  1OYX A;  3JB9 G;  4LDY A;  1H64 1;  3CEY A;  3CMA Q;  2FB7 A;  1V29 B;  2DXC A;  3QZ5 B;  1QLY A;  4ELY C;  5GAM h;  5FU7 C;  4N4H A;  2KRO A;  1H3Z A;  1UE9 A;  4DEY A;  2IG0 A;  2X51 A;  4L6V 5;  4M7D F;  3TSW A;  3J81 E;  3VS0 A;  1QVF A;  1S72 Q;  3V7C A;  1G83 A;  1W6X A;  1QCO A;  2WSE E;  3EG9 B;  2XDB A;  4Y92 A;  5GAO m;  5A0G A;  3CCS T;  1MNE A;  1X01 A;  4JRI A;  1SHF A;  3CCL A;  3J7A F;  2Y90 A;  2FHD A;  1G3S A;  4OMF B;  3G4S Q;  3A8O B;  1VQP A;  2EYQ A;  3THK A;  4J9I A;  2RD1 A;  1ZUK A;  3OYN A;  1VQM T;  3N5B B;  3CCJ A;  4M75 G;  5GAO n;  2BIV A;  3HRS A;  3CME T;  3LLR A;  1ABO A;  4OF1 A;  2DL3 A;  2ZZD A;  3VS7 A;  3E9F A;  2RPN A;  2EGC A;  1YP5 A;  1TG0 A;  1OEB A;  3MP8 A;  3OS5 A;  3JCM d;  1WXT A;  1B34 A;  1X6G A;  2QA4 T;  2C06 A;  4PJO C;  1G2B A;  4PK4 A;  4AFQ C;  4JLI A;  5J39 A;  1VQO A;  1W70 A;  2KI7 A;  3E9G A;  4A4G A;  3G6E Q;  2VGM A;  2FYK A;  2VUB A;  4HKE A;  3NHN A;  4M7A C;  4DOV A;  3ULR B;  4C0G A;  1NZ9 A;  1RI9 A;  2BKD N;  1TTH B;  4BY6 C;  5DLO A;  1U1T A;  2NUT B;  1Q95 G;  1GXI E;  2J05 A;  5LJ3 e;  4XTV A;  1YIT Q;  1VQN A;  3GIB A;  3WVD B;  3KUF A;  3REB B;  2B86 A;  2XI9 A;  4LN2 A;  3OYK A;  1AZE A;  2DPP B;  3JAM E;  1SRL A;  3EFO A;  2M9U A;  4B9W A;  2RHI A;  2A08 A;  4Z88 A;  3JB9 F;  5GAN 2;  3C12 A;  3CPW P;  1M1K R;  2JOY A;  1JRI A;  2FL7 A;  1BCO A;  1VQ6 T;  2QTV A;  3A98 A;  1VQ4 Q;  2R5A A;  4OB3 B;  4EMH A;  1G8X A;  5LJ3 g;  4HT8 A;  1A0N B;  3TQ7 P;  2RQR A;  4K11 A;  1Y57 A;  3PE0 A;  1YIJ Q;  4PJO D;  4BI8 B;  1WJQ A;  1VYV A;  1NLO C;  3CCR Q;  2DE0 X;  1WNL A;  5GAO q;  5GMK l;  2RJC A;  5HK3 A;  4M7A D;  2BUD A;  3OYJ A;  4E7S A;  3FDR A;  2DX1 A;  2EJ9 A;  5CKE A;  2XG8 D;  4JJN K;  2JS0 A;  2J6K A;  4E7K A;  3INZ A;  1Q7Y C;  3JCM h;  1W2B P;  1M27 C;  1PD1 A;  1WHG A;  5DY9 A;  2EYZ A;  4RG8 A;  2DXT A;  4IUR A;  3FRN A;  1AEY A;  4JJC A;  1IO6 A;  1OV3 A;  1X75 C;  4CC2 A;  4RCC A;  4FT4 A;  2RHZ A;  4M75 F;  4F04 B;  4EMG A;  1FYN A;  4BE0 A;  1IZ6 A;  3HSB A;  4YTL A;  4LDX A;  4JLG A;  2LJ1 A;  3JB9 J;  3QG1 A;  1JJ2 P;  1VYT A;  1WHH A;  1VQ5 Q;  4J7I A;  3MEW A;  1C1A A;  1OPL A;  1M1K U;  2QXF A;  4M78 E;  3JCM c;  1E7O A;  2RHU A;  1Q86 R;  1RAA B;  2LT1 A;  5FWC A;  1WX6 A;  2DD5 A;  4IKF A;  3JCM X;  1TUC A;  2KXC A;  4CC4 B;  1TXQ A;  5L23 A;  2RI2 A;  4E6R A;  4JS5 A;  3CXC A;  1U06 A;  1GRI A;  4ZTF A;  1AWO A;  1NEG A;  4MZM A;  2QQB A;  4PFP A;  5GAO r;  3S6W A;  1ZA2 B;  1UJY A;  1MND A;  1VQK A;  4A4K A;  3EHR A;  5I21 A;  1TUD A;  3EG3 A;  5FRN A;  4QQ6 A;  1CKB A;  1GCQ A;  3DLL A;  4XK8 E;  1VQ7 A;  3SDZ A;  2QAS A;  1UHC A;  3I5R A;  5D7U A;  4GLM A;  3TSZ A;  4PJL A;  3RIR A;  5LJ5 e;  3QXE B;  2RJD A;  6AT1 B;  3IQL A;  1M8V A;  4M7D E;  5DM7 R;  3BFM A;  3VS6 A;  2KE9 A;  2DMO A;  4BDZ A;  1Q81 R;  2COY A;  2MOX A;  2M02 A;  2OTL T;  1R8O B;  3LWI A;  5KYX A;  1Q86 U;  2ZPE B;  5FU7 B;  3PTA A;  1Q86 C;  4MMK A;  2GCX A;  2LQW A;  2H3E B;  3CBM A;  1AWX A;  1YHQ A;  1SG5 A;  5LJ5 g;  3MHX A;  4ZGE B;  5KYU B;  4R56 A;  3PT9 A;  2KNB B;  4B6M A;  3LH0 A;  2CKK A;  2YUQ A;  4RCB A;  1QVF S;  1YN8 A;  2K3X A;  1VQ8 T;  3CCQ T;  2LRQ A;  4X9C A;  3OYD A;  2FPF A;  3I55 A;  4RUG A;  1K8A R;  1G3T A;  1NPR A;  1RL2 A;  3BDU A;  2K3B A;  2X3X D;  4ZTJ A;  3M0P A;  1IXD A;  2E64 A;  2PNI A;  3ZFJ A;  4DBF A;  3CCL Q;  2K3Y A;  1O9S A;  4M78 B;  2VXE A;  5HKC A;  2X4X A;  1VQP Q;  3QSU A;  1MGQ A;  2HQE A;  1ZSZ A;  1YI2 A;  3QDF A;  2KMT A;  2CS7 A;  4PFZ A;  3CCJ Q;  1UGQ B;  2K57 A;  4C8Q F;  5IN1 A;  1T3S A;  3NMZ C;  2SRC A;  1WXU A;  2X35 A;  2AKK A;  3M53 A;  1UTI A;  4ZGD B;  2DYI A;  4C0F A;  3HHT B;  1Q81 U;  2ROT A;  3H8Z A;  4KGZ B;  3OSV A;  2RQT A;  1VQO Q;  5GMK m;  1IRX A;  4DA4 A;  5IHK A;  1X6B A;  2OTJ T;  4BY6 B;  2AT1 B;  4OMM A;  3PIP A;  2V26 A;  3FJ5 A;  2KRS A;  1NLP C;  1Y71 A;  3CD6 T;  5GAN 5;  1EX4 A;  2QGG A;  2CGH A;  5GAN g;  4BE1 A;  2HZY A;  4UC4 A;  3OW2 A;  2D8H A;  1GCQ C;  3CCM A;  1BIA A;  1VQN Q;  4CRI A;  2DL5 A;  3M58 A;  4LUD A;  2CUB A;  2L0A A;  1KD1 R;  4FIB A;  2HKN A;  2M0Y A;  4FYX B;  1K8A U;  1HJD A;  2DIQ A;  3MEV A;  1KHI A;  3EH1 A;  1K1Z A;  4Q5W A;  1Q82 R;  5I2M A;  1K9M C;  2P84 A;  4J6X A;  4OMN A;  2ED1 A;  4FCY A;  3C0C A;  3L2R A;  3VYH B;  1WXB A;  4R0K A;  2GQI A;  5M9O A;  5EC7 A;  4OGE A;  2HD0 A;  4F7U G;  1UGV A;  3CC4 A;  2MWP A;  2E6N A;  3VYG A;  3I5S A;  3U23 A;  4IUQ A;  3CC7 A;  2OAU A;  2COW A;  3OYL A;  2K6D A;  2F2V A;  1RUW A;  2O01 E;  2VC8 A;  1PSE A;  3SFM A;  4LDV A;  5HK0 A;  4E47 A;  3M0R A;  5KYU A;  4MZP A;  4M75 E;  3QYH B;  4LXC A;  1YJW A;  1O75 A;  5GAN f;  4J9F A;  3MEA A;  4M7D G;  2E65 A;  2CH4 W;  4E7J A;  5CKD A;  3JB9 H;  2LP5 A;  4XU3 A;  4ESR A;  3G7Z A;  3QZ9 B;  1OU8 A;  2GF7 A;  1ABQ A;  1X2Q A;  2Y4Y A;  5LJ3 j;  3S3O A;  1KD1 U;  1ZSZ C;  1KD1 C;  4E7H A;  1HYO A;  4RTY A;  2HL5 C;  3MCA B;  5CKB A;  2MI6 A;  1Q82 U;  3O8V A;  1VQ9 A;  4WCI A;  3G71 A;  4LD6 A;  4QT7 A;  2L3Q A;  5D6Y A;  2E6Z A;  4J83 A;  5IHI A;  1B34 B;  4AMC A;  4PKC C;  4OB0 B;  1YJ9 T;  5IT9 E;  1I8F A;  1M3C A;  4M77 G;  1YJN A;  1K73 R;  1BCM A;  4F14 A;  2DXB A;  4NL2 A;  1PKS A;  1G3W A;  2RA2 A;  4GLK A;  1ZQ1 A;  2YXY A;  5CK9 A;  1WYX A;  3M5A A;  1VOM A;  3CCE T;  2QG9 B;  1B07 A;  1NE8 A;  1GL5 A;  2P0K A;  1VQK Q;  1PRL C;  1GFC A;  2PUK B;  3EFO B;  1OQK A;  2D9T A;  1VQ7 Q;  3H9N A;  4C92 D;  4IUU A;  1QVG P;  3S3N A;  2E5Q A;  3OYA A;  4M7D A;  5LJ3 d;  4BI3 A;  4F7U F;  5KYW A;  4V2S A;  3UA6 A;  5CQY A;  4J9D A;  2L89 A;  4ZN3 A;  3FIF A;  4PJO F;  1TH7 A;  3VV0 A;  1QKW A;  3AT1 B;  3CC2 T;  2YWW A;  3SHW A;  4RTV A;  3PIO A;  1UGP B;  4M7A F;  3GPL A;  1N6A A;  4M75 B;  1AHJ B;  3JCM Q;  5KCO A;  2GGR A;  1K9A A;  4OB1 B;  3LWH A;  3HPW A;  4C5H A;  1W1F A;  2JMA A;  3V7S A;  3O5Z A;  1X69 A;  2MF2 A;  2D1X A;  3CCV T;  1OZ2 A;  1YHQ Q;  4PJN A;  1MMN A;  3CCS A;  1KQ2 A;  4A4F A;  2DFU A;  5AT1 B;  1JQQ A;  4O5V A;  2D0N A;  3RUX A;  3A8H B;  1YNZ A;  1K73 U;  1WFW A;  1FXX A;  3A8M B;  3E2U A;  3CXC P;  1ZHI A;  4J9B A;  1B7T A;  3I55 Q;  3SEM A;  4M77 A;  2CP0 A;  2JW4 A;  5KE2 A;  4A53 A;  1PM3 A;  2KAF A;  1BYM A;  4RTU A;  2CP3 A;  3A5Z B;  4M78 C;  2EGE A;  2COZ A;  1VQM A;  2NLU A;  2DXU A;  3WXM B;  1MHN A;  2WAC A;  2HSE B;  2K9G A;  3PGG A;  5I22 A;  2ZPG B;  3CME A;  5CCA A;  4KRT A;  1YI2 Q;  1PSF A;  3UAT A;  3NGP A;  1KG1 A;  5A0L A;  1OX8 A;  2QA4 A;  4ZNX A;  4E7L A;  4LNP A;  4M77 F;  3EGD A;  1WQ7 A;  5LJ5 j;  2OX7 A;  2M0O A;  3R6N A;  3SWN A;  2EIF A;  3OYI A;  2CZ6 B;  1KQS P;  1NYG A;  1G5V A;  2NUZ A;  5LJ3 h;  4TVR A;  2CZ1 B;  2YRD A;  5D6W A;  3WVE B;  1N5Z A;  2MCN A;  2DET A;  1I4K 1;  2CT4 A;  1U3O A;  2RI3 A;  2JXB A;  3MKD A;  2JTE A;  2D0Q B;  2E41 A;  5KE3 A;  3OW2 S;  2RQV A;  1IHV A;  3A8G B;  3H6Z A;  2H3J A;  2FPE A;  4JZ3 A;  1OZ3 A;  2MIO A;  5ECA A;  3S3M A;  1ARK A;  3CCM Q;  2J06 A;  5HY6 A;  2CP7 A;  3OSS C;  2ZPI B;  4KH0 B;  2E70 A;  3CCU T;  4M7D C;  2KQW A;  4M78 D;  3GNG A;  1WLP B;  4L59 A;  1BBZ A;  2RO0 A;  3VS1 A;  3MP6 A;  2J7I A;  2JM8 A;  1VQ6 A;  3D7S B;  3LGF A;  3LX7 A;  3VU3 C;  3HTR A;  2X4Y A;  1JJ2 S;  1WI7 A;  4E7I A;  4AT1 B;  1RI0 A;  4MZT A;  3FEO A;  2ZCF B;  2D8J A;  3HFO A;  2L3P A;  5GAM f;  1E6G A;  1JXM A;  2LQ8 A;  1RAC B;  3PNW C;  4FL6 A;  3URG A;  3MP1 A;  5KYX B;  3CC4 Q;  1PWT A;  5I2S A;  2XK0 A;  4M75 A;  5LJ5 d;  2XDP A;  2EBP A;  3ER0 A;  3CC7 Q;  2X3W D;  5GAN j;  2J6F A;  2YT6 A;  2DLP A;  1NPP A;  2NWM A;  1RAD B;  5FU6 B;  2YHT A;  1F1B B;  1IHW A;  1BI0 A;  1WPY A;  2FO0 A;  1GBR A;  1BI1 A;  4QQD A;  4AG1 C;  1YJW Q;  3OYE A;  4XTZ A;  2D6F A;  3CQT A;  2JTF A;  2HKQ B;  2LX9 A;  1I0C A;  3F70 A;  5IH2 A;  3J80 E;  2CUD A;  4A4E A;  1M4Z A;  1MV3 A;  1N9S A;  2RB6 A;  2C0I A;  4LE9 A;  2KXD A;  2X9H A;  3A1P A;  1TS9 A;  2LCS A;  3FC3 A;  1M90 R;  4Z89 A;  1FWZ A;  2L8D A;  2LNV A;  2V1R A;  1ZSZ B;  2EKO A;  3I56 Q;  2QTX A;  3TVT A;  1M2V A;  5J3B A;  3T9N A;  2DD4 A;  4XU0 A;  4DOW A;  3M4G A;  1R0B G;  2DO3 A;  1MUZ A;  5CKF A;  2CYZ B;  1M1K C;  2F2X A;  2WSF E;  3SWN C;  1RAG B;  3ZBD A;  1VQ9 Q;  3G71 Q;  8ATC B;  1KSW A;  1V1C A;  5GAN 6;  1TU0 B;  3GOX A;  2EYY A;  4BE2 A;  4MDW A;  2YRC A;  1RAI B;  1M5Q 1;  1NBE B;  2ROL A;  2VKN A;  1FMV A;  4FSS A;  4X9D A;  5J26 A;  2DZC A;  4FSX A;  4C8Q G;  1XQH A;  1C6V X;  3RNJ A;  1BI2 A;  3QDR B;  5GAN d;  2CSI A;  2OAW A;  2ECZ A;  4QVD A;  1CKA A;  2QQS A;  2LJ3 A;  3RKW A;  1RAH B;  1C0M A;  2M16 A;  4KGV B;  2KVQ G;  1CSK A;  4F7U E;  3L2U A;  2QEX T;  3QWX X;  3JV3 A;  3X24 B;  5LJ5 h;  1J3T A;  4QW2 A;  2XDD A;  3M0S A;  2EW3 A;  2RJE A;  1YWO A;  2E3I A;  4HA8 A;  4B9X A;  2LTO A;  2GFU A;  4DBR A;  3DKM A;  2YLB A;  4D8D A;  1VQL Q;  1EZZ B;  2VB6 A;  5FRO A;  4M7A E;  2FZG B;  4C92 G;  4J5Y A;  1M30 A;  2YUN A;  4ME7 A;  1M90 U;  4LDU A;  2XKO C;  4FYY B;  1D1C A;  2RHY A;  3QJY A;  2KRN A;  2OTL A; 
#chains in the Genus database with same CATH homology
 1HD3 A;  1EFN A;  2KR3 A;  2E5K A;  3PVQ A;  1UGV A;  3EG2 A;  2EVR A;  3I5S A;  3U23 A;  1OOT A;  1K76 A;  2KT1 A;  2K6D A;  1QLY A;  2F2V A;  2HSP A;  1RUW A;  4JJB A;  2C0T A;  1K0X A;  2DL4 A;  2KRO A;  4ORZ A;  1UE9 A;  4DEY A;  1T0J A;  1LCK A;  4CC7 A;  2EGA A;  1AVZ C;  2JMC A;  3M0R A;  3TSW A;  3VS0 A;  2RQU A;  4J9H A;  2CSQ A;  2KYM A;  4J9F A;  1G83 A;  1W6X A;  4RTZ A;  2L2P A;  2CT3 A;  4DEX A;  4Y92 A;  1I1J A;  1AWJ A;  2CH4 W;  2LP5 A;  1K4U S;  1SHF A;  2ESW A;  4ESR A;  2EYW A;  2DIL A;  1VA7 A;  2AZS A;  3EHQ A;  1ABQ A;  1X2Q A;  2FPD A;  3THK A;  4J9I A;  2VVK A;  4HCK A;  2A36 A;  1PRM C;  1WA7 A;  4RTY A;  1ZUK A;  2G6F X;  3EGU A;  1SSH A;  4HVW A;  4WCI A;  4QT7 A;  3VS5 A;  2IIM A;  2L3Q A;  1ABO A;  2DL3 A;  1QWF A;  5IHI A;  3VS7 A;  2RPN A;  2EGC A;  1YP5 A;  1TG0 A;  1OEB A;  5HCK A;  1H92 A;  1NEB A;  1WXT A;  1X6G A;  4JPB W;  1G2B A;  4AFQ C;  2DRM A;  2FEI A;  1W70 A;  4IIO A;  2HCK A;  2CH4 A;  4HVV A;  1M3C A;  3NHN A;  1RLP C;  3ULR B;  2ENM A;  4F14 A;  2AK5 A;  1PKS A;  1RI9 A;  1WYX A;  2J05 A;  5IHN A;  1QWE A;  3NPF A;  3M0U A;  1B07 A;  2BZY A;  4JJD A;  4AFZ C;  3I9Q A;  4OMQ A;  1XOV A;  1GL5 A;  3REB B;  2B86 A;  1PRL C;  1GFC A;  1Y0M A;  1UJ0 A;  2YUO A;  1M8M A;  4LN2 A;  1AZE A;  2FRW A;  2AKL A;  1SRL A;  4F17 A;  4RTW A;  2CDT A;  1MV0 B;  1UEC A;  1ZBJ A;  1PHT A;  1UDL A;  2A08 A;  1GCP A;  4RTT A;  1PKT A;  4Z88 A;  2LQN A;  2KT8 A;  4EIK A;  3UA6 A;  2XMF A;  5I11 A;  4J9D A;  1ZX6 A;  1JXO A;  3A98 A;  3EG0 A;  1BU1 A;  1AZG B;  4OMP A;  2ABL A;  1A0N B;  1YWP A;  1QKW A;  2RNA A;  2RQR A;  4K11 A;  1T3L A;  3SHW A;  4RTV A;  1UHF A;  1RLQ C;  1Y57 A;  2FRY A;  3PE0 A;  4AG2 C;  3H0F A;  2GGR A;  1K9A A;  2BZ8 A;  1JO8 A;  1VYV A;  1NLO C;  3H0I A;  2DE0 X;  1ZSG A;  1W1F A;  2JMA A;  1UFF A;  3O5Z A;  1X69 A;  2KEA A;  1QKX A;  2D1X A;  2DM1 A;  1M3B A;  4GBQ A;  2DJQ A;  2DX1 A;  4RTX A;  4F16 A;  1Z9Z A;  2A37 A;  2JS0 A;  1JQQ A;  2D0N A;  2J6K A;  1YNZ A;  1NYF A;  1WFW A;  4X1V A;  2YUP A;  4J9B A;  1M27 C;  2RF0 A;  3SEM A;  1I07 A;  2KRM A;  2L3S A;  1AOJ A;  2DL7 A;  2JW4 A;  4Z8A A;  2EYZ A;  2YSQ A;  1AEY A;  4JJC A;  1IO6 A;  4RTU A;  1OV3 A;  4CC2 A;  1VYU A;  2DVJ A;  2EGE A;  2BZX A;  1K0S A;  1UG1 A;  1FYN A;  1M3A A;  4HVU A;  2LJ1 A;  5I22 A;  2K9G A;  2LX7 A;  1JEG A;  3VS3 A;  1VYT A;  2V1Q A;  5GJV B;  4KRT A;  3UAT A;  3NGP A;  1OPL A;  3VRY A;  1UUE A;  4LUE A;  2VWF A;  1E7O A;  4ZNX A;  3M0T A;  4LNP A;  1GFD A;  1QCF A;  2K7A A;  5FWC A;  1WX6 A;  3R6N A;  1NYG A;  1TUC A;  2DA9 A;  2FG0 A;  2JS2 A;  2KXC A;  4CC4 B;  2NUZ A;  2PTK A;  3GBQ A;  5L23 A;  4E6R A;  2JT4 A;  1KFZ A;  2HEQ A;  1U06 A;  5IXF A;  1GRI A;  1N5Z A;  2MCN A;  1ZLM A;  2CT4 A;  4J9C A;  1AWO A;  2YDL A;  1U3O A;  2EYX A;  2OI3 A;  2JXB A;  1ZUY A;  1NEG A;  2JTE A;  2LNH B;  2RQV A;  1UJY A;  2FPE A;  1NM7 A;  4JZ3 A;  2MIO A;  2RMO A;  5ECA A;  3EHR A;  1ARK A;  2AZV A;  1TUD A;  2J06 A;  3EG3 A;  1CKB A;  1GCQ A;  2SEM A;  2O9S A;  2K79 A;  2KYB A;  5IXB A;  3LH5 A;  1WLP B;  1S1N A;  1BBZ A;  4JZ4 A;  3VS1 A;  1UHC A;  3I5R A;  4GLM A;  3TSZ A;  2J7I A;  2JM8 A;  1H8K A;  4A63 B;  1WI7 A;  2OJ2 A;  1SRM A;  3IQL A;  2D8J A;  2L3P A;  1B3Q A;  1E6G A;  1JXM A;  3VS6 A;  2KE9 A;  1FMK A;  2LMJ A;  2DBK A;  2DMO A;  2MOX A;  4M4Z A;  2DRK A;  1PWT A;  2EBP A;  3QWY A;  2GBQ A;  1BK2 A;  2X3W D;  2C0O A;  2J6F A;  4AFU C;  2YT6 A;  2DLP A;  3KFV A;  2LQW A;  2K2M A;  2NWM A;  4OMO A;  1AWX A;  2DNU A;  2FO0 A;  1NG2 A;  1GBR A;  2KNB B;  1YCS B;  2YUQ A;  2JM9 A;  3PVL A;  1YN8 A;  4AG1 C;  2H8H A;  1ZUU A;  2EPD A;  1SEM A;  2F2W A;  1AWW A;  2CRE A;  2FPF A;  4RUG A;  4J9G A;  3CQT A;  5IH2 A;  1I0C A;  2CUD A;  2K3B A;  3H41 A;  1X43 A;  2X3X D;  2DBM A;  1MV3 A;  1OPK A;  2C0I A;  4LE9 A;  1Z9Q A;  2KXD A;  3M0P A;  2BTT A;  2O2O A;  3UF4 A;  2PNI A;  3UA7 A;  2LCS A;  2LZ6 B;  4Z89 A;  1E6H A;  1BB9 A;  3VRZ A;  1T0H A;  2V1R A;  2DYB A;  1U5S A;  3TVT A;  2DL8 A;  1H3H A;  3H0H A;  2RQW A;  1MUZ A;  4J9E A;  3RBB B;  2DF6 A;  2F2X A;  3VS4 A;  1WDX A;  2W10 A;  1KSW A;  1V1C A;  2J6O A;  2ED0 A;  1SHG A;  2I0N A;  5FW9 A;  2EYY A;  2M51 A;  2LJ0 A;  1JU5 C;  1T3S A;  3NMZ C;  2SRC A;  3EG1 A;  2ROL A;  1WXU A;  4D8K A;  2AKK A;  3REA B;  2VKN A;  2O9V A;  1UTI A;  4FSS A;  4IIM A;  2EQI A;  2O88 A;  2PZ1 A;  2ROT A;  3RNJ A;  3M0Q A;  2RQT A;  4AFS C;  2A28 A;  2CSI A;  2EKH A;  2OAW A;  2ECZ A;  1CKA A;  5IHK A;  2RN8 A;  1HSQ A;  2W0Z A;  2LJ3 A;  1X6B A;  1KIK A;  2GTO A;  4OMM A;  4HXJ A;  3FJ5 A;  2KRS A;  1NLP C;  1CSK A;  1AD5 A;  1GBQ A;  1X27 A;  4CC3 A;  3QWX X;  2QDL A;  2D8H A;  3I35 A;  4OML A;  1GCQ C;  3JV3 A;  1J3T A;  2DL5 A;  4LUD A;  3M0S A;  2EW3 A;  2L0A A;  2CUB A;  1YWO A;  1SPK A;  1X2K A;  2M0Y A;  2GTJ A;  1KJW A;  4D8D A;  2HBW A;  1HJD A;  2GNC A;  3ZL7 C;  1K1Z A;  1PNJ A;  5GJW B;  2O31 A;  4OMN A;  2HDA A;  2ED1 A;  5FWB A;  3C0C A;  1M30 A;  2KGT A;  2KBT A;  2YUN A;  2P4R A;  1WXB A;  4R0K A;  1WIE A;  3VS2 A;  2GQI A;  2KRN A;  5EC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...