2JTEA

Third sh3 domain of cd2ap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title The high resolution NMR structure of the third SH3 domain of CD2AP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jteA00
2J06A 3H0HA 1ABQA 5IHKA 2LQWA 2DILA 1WLPB 3I9QA 1NLOC 2X3WD 1PWTA 2FPEA 4IIOA 1WYXA 3I35A 2YUQA 3H41A 1G2BA 1NEGA 2O9SA 5IH2A 4RTTA 1Y0MA 4FSSA 2DL3A 2JM9A 1M3AA 3M0QA 2HCKA 1K1ZA 4J9GA 3I5RA 3UA7A 4QT7A 1GFDA 5I22A 1RUWA 3RBBB 1AWXA 2XMFA 2EQIA 4ZNXA 4ORZA 1VYTA 2K2MA 1H8KA 4J9DA 1ZUKA 1ZLMA 2RQTA 4J9BA 4DEYA 4RTVA 2JS0A 5EC7A 2J6FA 5L23A 4AG2C 1SRMA 1WFWA 2A28A 1WX6A 4F17A 1X2QA 2JW4A 4R0KA 3VS5A 3IQLA 2IIMA 3RNJA 1E6GA 2DNUA 4J9HA 2MOXA 2LQNA 3H0FA 2YSQA 2YDLA 1E6HA 4D8DA 2A36A 5GJWB 2NUZA 3I5SA 4M4ZA 4OMNA 4Z8AA 1UHFA 1UJ0A 2V1QA 2LJ1A 4CC3A 2PNIA 4ESRA 1NLPC 2X3XD 5IHNA 3EG2A 1NEBA 1AEYA 1B07A 2CH4A 2C0IA 4JJBA 1GCQA 1H3HA 2RQUA 4AFSC 4KRTA 2ESWA 2PZ1A 1ZUYA 2DJQA 2FO0A 3VS4A 4AG1C 3VS0A 1AWJA 2GNCA 1M3BA 5I11A 4Y92A 1AD5A 2A08A 3M0PA 2HDAA 4AFUC 2VKNA 3NMZC 2F2XA 2GGRA 2RNAA 3VS3A 4WCIA 2C0OA 1WXTA 1WDXA 3CQTA 1X27A 2L3QA 1AZGB 4JJDA 2LCSA 1UG1A 1MV3A 1RI9A 3EGUA 1PKTA 1X6GA 2C0TA 2K9GA 3SEMA 2DRKA 2JM8A 1UGVA 1UUEA 2YUNA 3GBQA 3PVLA 1E7OA 1PRMC 2O9VA 3C0CA 1CKBA 1RLQC 2O2OA 2LNHB 4D8KA 1HJDA 2D8HA 1QKXA 2AZSA 1SPKA 1A0NB 2A37A 2O88A 4RTXA 1QCFA 1I0CA 1NYGA 2J7IA 3NHNA 4HVUA 2RN8A 1ARKA 2CUDA 2KXDA 2EGEA 1BB9A 4JZ4A 2V1RA 2LZ6B 1Z9ZA 3QWXX 2EGCA 5IHIA 1AWOA 1TUDA 4EIKA 3LH5A 2DA9A 2YT6A 3EHQA 1X69A 1ZSGA 2L0AA 3R6NA 1YNZA 1Y57A 2DL8A 2VWFA 2KEAA 4RTUA 1OPKA 1B3QA 2HSPA 2ROLA 4J9FA 1NG2A 3PVQA 1FYNA 3A98A 2F2WA 1YWPA 1ZX6A 1KJWA 2RMOA 5HCKA 4LNPA 1ZBJA 2ABLA 3TVTA 4AFQC 4JPBW 3THKA 3VRYA 2YUPA 1T0JA 2DBKA 2J6OA 2ECZA 2JMAA 1PRLC 4K11A 1MV0B 2L3PA 2PTKA 1PNJA 2KR3A 1AOJA 4F16A 2H8HA 1YP5A 1G83A 1UTIA 2J6KA 3REAB 2DX1A 3EG1A 3QWYA 1LCKA 2J05A 2M0YA 2L2PA 3H0IA 4LUEA 2HBWA 1WI7A 1JU5C 4CC4B 1VA7A 4X1VA 2RF0A 1OV3A 1M27C 1S1NA 2W0ZA 1FMKA 2BTTA 1BK2A 1V1CA 2EYXA 2KRSA 3ZL7C 1OPLA 2VVKA 1SHGA 1K4US 2EYWA 2AKKA 2AK5A 2KRNA 1GL5A 1QLYA 2KT1A 2DBMA 5FWCA 3M0UA 2CREA 2AZVA 2CDTA 1MUZA 1N5ZA 2EKHA 4OMQA 1AVZC 1EFNA 2JTEA 2ROTA 2L3SA 2FEIA 1VYVA 1QWEA 2D1XA 2CSQA 2SEMA 2K3BA 1T3LA 5ECAA 2ED0A 2FRYA 3UF4A 1J3TA 2K79A 1YN8A 1M3CA 1RLPC 3KFVA 2DRMA 3M0SA 3ULRB 1W6XA 3JV3A 2KNBB 4LE9A 4GBQA 1KIKA 3VS6A 3SHWA 2OJ2A 4RUGA 2P4RA 2CT4A 2FG0A 1GCQC 1AZEA 1AWWA 1TUCA 4LN2A 1UDLA 3U23A 1CSKA 2I0NA 2MIOA 1X6BA 1GFCA 4JJCA 2BZXA 2F2VA 1KSWA 3O5ZA 2LMJA 4E6RA 4OMLA 1BBZA 1JO8A 2E5KA 2LJ3A 2DYBA 1UE9A 4IIMA 2EYZA 2RQRA 1HSQA 4HCKA 1X2KA 4HVVA 2RQVA 4HXJA 1UJYA 1SRLA 1GBRA 2DL7A 1QWFA 2KT8A 2DVJA 4OMMA 1IO6A 4LUDA 2GTOA 5IXFA 4AFZC 1WA7A 1U5SA 4RTZA 1UECA 3VRZA 2FPDA 2BZ8A 2MCNA 2KE9A 1U3OA 1UFFA 1JXOA 1SSHA 2ED1A 2LP5A 4RTWA 4RTYA 1K0SA 2W10A 1KFZA 2CSIA 1T3SA 1JXMA 5FW9A 1OEBA 3UA6A 2D0NA 2K6DA 1GRIA 1X43A 4DEXA 3EG0A 2DF6A 2DL4A 3PE0A 3EHRA 2FPFA 2EPDA 1SHFA 1YCSB 2RPNA 2QDLA 1K0XA 1M8MA 1HD3A 2GQIA 1I1JA 4Z89A 1UHCA 4J9EA 1K9AA 1NM7A 4HVWA 3EG3A 3UATA 1GCPA 1U06A 2G6FX 2KXCA 5FWBA 2O31A 4OMPA 5IXBA 2JXBA 1WXBA 1YWOA 1ABOA 2YUOA 2EVRA 1Z9QA 1GBQA 2BZYA 2DE0X 2GBQA 2EGAA 4JZ3A 2CT3A 2DMOA 2JMCA 2DM1A 1W70A 1NYFA 1ZUUA 2HEQA 1WIEA 3VS7A 3NPFA 3VS1A 1M30A 2EBPA 1WXUA 3M0RA 2SRCA 2K7AA 3TSWA 1JQQA 3TSZA 4Z88A 1H92A 1TG0A 2KBTA 2KYMA 2CUBA 1VYUA 3FJ5A 4F14A 2ENMA 4OMOA 1XOVA 2DLPA 1JEGA 1PKSA 4CC7A 4A63B 1I07A 2CH4W 4CC2A 1T0HA 4GLMA 3M0TA 2EYYA 2RQWA 3NGPA 2LX7A 2OI3A 2KRMA 2GTJA 4J9CA 2JT4A 2B86A 1BU1A 2KROA 2NWMA 2FRWA 3VS2A 1OOTA 5GJVB 2KYBA 1K76A 2LJ0A 2OAWA 2EW3A 1SEMA 2JS2A 2KGTA 2AKLA 1QKWA 1CKAA 3REBB 4J9IA 1PHTA 2M51A 1W1FA 2D8JA 2DL5A
chains in the Genus database with same CATH superfamily
2LCLA 2CKKA 4FSXA 4Y28E 3H0HA 1KC8R 2LQWA 2DILA 2CYZB 2FB7A 3A8HB 3I9QA 1XTDA 2KMTA 1YJ9A 3NFCA 3UT1A 4RCBA 1WYXA 3I35A 2RI5A 2O9SA 1KQSS 2JM9A 2GFUA 1QVFP 1M3AA 3M0QA 4DBRA 1GFDA 2V26A 1RUWA 1AWXA 2LNVA 2XMFA 1VQKT 1TUGB 1VYTA 2K2MA 1H8KA 2LX9A 4J9DA 2WACA 3L2WA 2RO0A 2XU8A 4J9BA 3CCRQ 4J6XA 5KYUA 2J6FA 4PNOA 1SRMA 1WFWA 1P92A 2A28A 1Q7YR 3OS0A 4C92F 1M1GA 5KYXA 5GAMg 1VOMA 3CC4Q 3RNJA 4XQ3A 2EYQA 3JB9H 2VB6A 1UB4A 2YDLA 2DKGA 4MZTA 3ME9A 3AHUA 2A36A 4M7AD 1D3BA 2E10A 3OYGA 4CC3A 2PNIA 2YRCA 4IUPA 3JB9F 1TH7A 4OB1B 2CH4A 3NTHA 4M78A 4EDUA 1VQ5Q 5IAYA 2RQUA 1H3HA 4AFSC 1VQ8Q 2QQAA 3EGDA 2RHXA 1ZUYA 3OYLA 2XICA 4AG1C 4C8QC 5GMKi 4M7DD 2DZCA 5GAMd 3EFSA 4FIBA 4LXCA 3JB9I 3JCMg 2ZAEA 4JRPA 2EQJA 1TU0B 1IRXA 3FRNA 1VQPT 2HDAA 4M75B 2AIRB 4AFUC 2GGRA 4NS5A 8AT1B 5FU7C 1WGSA 3TREA 2C0OA 3OYYA 3S3NA 2MI6A 1WXTA 3CQTA 1X27A 2OTJQ 1QMCA 3BW1A 2RD1A 1QW1A 4WTOB 3EGUA 4BB7A 3I56A 4E7LA 3QJYA 2HL5C 1UUEA 2YUNA 3JCMd 1YJWQ 1M1FA 3JCMb 1E7OA 1FX7A 2DXUA 8ATCB 4FYXB 4X9DA 3M57A 5KYXB 1XQHA 1QQJA 1Q86C 4M75E 4KT0E 4BACA 4C5GA 1M9SA 1WHKA 2HMAA 3PIPA 2QA4A 4F7UB 2VXEA 1QCFA 4M78G 2D9TA 3HKSA 4J5YA 1JJ2A 1NYGA 3H9NA 1VQ9T 1MNDA 1QP2A 3QIIA 4HVUA 1Y96A 2ZPFB 4KH0B 4LDVA 3FIFA 1TWBA 2KXDA 1TTHB 2V1RA 4XAXB 2NUTA 1Z9ZA 3EGDB 3MCAB 3PMTA 3JAME 4ZGEB 3E19A 3RMSA 1HXDA 3OYNA 1X69A 2RK2A 2L0AA 3HFNA 1YNZA 2YXYA 4KUIA 2VWFA 1SKUB 4PLIA 1OPKA 3SD4A 5GMKh 5CAIA 1B3QA 3CMAT 4F7UE 4J9FA 4O6JA 5L8RE 3GNFB 3M54A 5LJ5e 4LNPA 1HYOA 1Q82U 1JRIA 3CC7A 3CC2Q 2ABLA 4WF2A 2CS7A 1G3YA 2KQWA 1T0JA 3QKJA 1PSFA 2JMAA 2JTMA 4KUDK 5GAOn 2CGHA 3G4SQ 2PTKA 2E41A 1VQ6T 3D7SB 1LCKA 4E7HA 2WSFE 2M0YA 1K8AR 3MKDA 3BE3A 1RAAB 2F5KA 3EG9A 4LUEA 4EMKA 3E9GA 3CD6A 2CP5A 2DJZA 2HBWA 2LT4A 2QEXQ 2LRQA 1S1NA 1VIFA 2RJCA 2W0ZA 1ZQ1A 2XG8D 1KD1C 2EYXA 1R0BG 5CKHA 3M59A 4QVDA 5DLQE 1Y96B 4BI4A 1LJOA 3L2QA 1MMDA 5D6XA 2AKKA 3C4SA 2AK5A 4NOYA 4PJOF 1M8VA 5KH6A 1GL5A 1QLYA 2DBMA 2LQ8A 2V8JA 4HCZA 3M0UA 2RA2A 3SWNA 2CDTA 3G71T 1LPLA 3CXCA 1Q95G 1EFNA 1K73C 2ROTA 2FEIA 1QWEA 2K3BA 1T3LA 4RG2A 5CQYA 1D1AA 5I2SA 2K79A 3QXEB 3KFVA 1YFNA 3OW2S 3ULRB 1VQKQ 4M78C 1VQOQ 2K5IA 1TS9A 2XDBA 4M7DA 2CP3A 3RERA 2CT4A 1M1KC 4XTXA 2KI7A 3L1AA 1TUCA 3U23A 2JNGA 2MIOA 4C0DB 2QASA 4JJCA 4M77F 5FU6B 4PJNA 2F1LA 3CPWA 1BBZA 2E5KA 1UE9A 3CCMQ 2EYZA 4HCKA 4HVVA 4BY6C 2D6FA 1UEBA 2DL7A 1QWFA 1IO6A 1VQMQ 5CR2A 2DAQA 5KYWA 5CVIA 2BZ8A 4J83A 1SSHA 9ATCB 1IB8A 3VKIA 2RI2A 4QQ6A 1Q86R 3UA6A 3GF5A 1QVFA 3E2UA 1X43A 3HP9A 1KQSP 3X24B 2FPFA 3Q1JA 3NTIA 1I1JA 1JBMA 5GAN5 3DB4A 3META 1F1BB 1U06A 2KXCA 2FL7A 2R5MA 2O31A 4M7DG 5IXBA 1OX8A 2AHJB 4BI3A 1G3WA 2EVRA 2GBQA 3CCSA 1W70A 3I55T 1NYFA 4P5NA 5KYYB 3MO8A 4BD3A 2HEQA 1VQ7T 5KE3A 2QAZA 1LOJA 1M30A 2EBPA 1VQPA 2L3RA 2PQWA 2K7AA 3MEAA 1H92A 4PJOE 2CUBA 1RI0A 1VYUA 3QZ5B 3S3MA 3OB9A 3V7RA 1NPRA 2DLPA 1VIEA 1MGQA 4N4IA 5GAN3 1PM3A 1UGSB 1Y7XA 3NTKA 4A63B 4CC7A 4C0GA 2HQXA 1YIJA 3EGXA 2EYYA 4X34A 5CKEA 5GAOm 2CZ1B 2GTJA 4XTUA 2KROA 1K9MR 2FRWA 3VS2A 4OGEA 2OAWA 2EW3A 2JS2A 4C5HA 1CKAA 5LJ3h 4E7IA 5GAOl 2D8JA 3CCQT 3VUZA 2HKQB 2J06A 3M4YA 1ABQA 3P8DA 5IHKA 4EMKC 1VQ9A 1KD1R 4B9WA 1YITQ 4FT4A 2RHYA 3QZ9B 2X3WD 1PWTA 4ZGDB 2DK3A 5KE2A 3CMAQ 2QA4T 2FPEA 1PG5B 2GCXA 1VQLQ 3PT9A 1RAIB 4FSSA 2NUPB 2DL3A 1YJNT 2YRVA 1IGQA 3I5RA 1K73R 3SWNC 5I22A 2VV5A 4J6WA 1UGQB 4C92D 1KG1A 3JCMf 4M7AC 4PJMA 4XU1A 1BCMA 1PCXA 2BE7D 1G8XA 2E64A 2YRDA 4DEYA 1H641 2HQHA 4AG2C 2JTFA 3M58A 4DBHA 1U8RA 1X2QA 2ZPGB 5FRMA 1X75C 4B6MA 1C0MA 3INZA 4QQGA 3JB9D 2K5LA 5LJ3j 2X4YA 2LQNA 4M7DC 2YSQA 3TQ7P 2XKOC 3CC7T 2DIQA 2RJFA 2JOYA 3CCUT 2Z0WA 5GJWB 2NUZA 4RG8A 5J26A 3CCVA 1UHFA 2XIDA 4QVCA 1VQ6A 2LJ1A 3H6ZA 3HRTA 4ESRA 2IPOB 4J6YA 2X9HA 1AEYA 3G71Q 4ZN1A 2KK4A 4JJBA 3WVDB 3HTRA 5GAN8 4BDZA 2E3IA 2ESWA 2GF7A 2PZ1A 2DJQA 3FB9A 2HZYA 1SSFA 4IKFA 4XU2A 3VS0A 3N5BB 4PJJA 3CEYA 4C0FA 1AD5A 3C95A 4JJNK 3OBWA 4XTYA 2F2XA 4C8QB 1QP3A 3ASKA 3G71A 3P8BB 2RNAA 2E70A 5AT1B 2K4YA 2A3LA 2L3QA 2KSSA 2LCSA 1YJ9Q 1WQ7A 1MV3A 1OZ3A 5FU7B 4XU3A 3KBGA 1PKTA 1OZ2A 2QTXA 1X6GA 2DRKA 3PIOA 1KC8U 1OYXA 4QQDA 1UGVA 4M75F 3DLMA 4C8QE 1QKXA 3LX7A 3A5ZB 1EIFA 2AZSA 4F04B 2NLUA 1QVGS 1SPKA 1A0NB 2HQEA 3QYHB 2GQVA 3BDLA 2QGGA 1I0CA 4JLIA 1ZSZC 2J7IA 3L42A 3LYIA 1ARKA 2EQUA 2RN8A 2XDDA 1YCYA 1N9SA 1M5Q1 3QWXX 3OW2P 3HRUA 3RUXA 1TUDA 3LGFA 1Q7YU 5HK0A 5LJ3g 2ZPEB 1B34A 1ZBXA 1ZHIA 2GFAA 3L2ZA 5D6YA 3X25B 1RAGB 4CRIA 1XJWB 1QVPA 2NYSA 2DL8A 1M2VB 2KEAA 4OP0A 1FWZA 4F7UF 5GANe 5GMKm 2E6NA 1NG2A 3PVQA 3A98A 3ZEHA 4C5IA 1WHGA 4PLLA 1TSFA 1AHJB 5HCKA 1RAHB 4QKUA 5GMKl 3TEEA 3THKA 3M53A 5LJ3d 1QCNA 4A4EA 3OYCA 4K11A 4L6V5 1MV0B 2Y4XA 2KR3A 4DOWA 1YP5A 1OQKA 3I55A 1PD1A 3REAB 1VQ7A 3EG1A 2C06A 2YHTA 4C92A 3CCST 1KQSA 3G6ET 3H0IA 1JU5C 1VA7A 4X1VA 2RF0A 3I56Q 3M4GA 2KRSA 4MMKA 2MYSA 2OX7A 3A8OB 2RJEA 1R77A 2KT1A 1M90R 2BUDA 3OA6A 2DD4A 4J8OA 3PGGA 2CREA 1MUZA 4JS5A 1AVZC 5KYUB 2JTEA 2QA4Q 4XTWA 2L3SA 2D1XA 3UPUA 1YIJT 3O8VA 5ECAA 2ED0A 1ZA2B 2FRYA 1N8RR 1RADB 3RR6A 1J3TA 3FDRA 4HKEA 2E6ZA 3QDFA 1M3CA 2DTHA 3KUFA 5CO7A 3M0SA 3CCQA 1W6XA 1XNIA 4M77D 2PVGB 3VS6A 3SHWA 2VC8A 3T9NA 1D3BB 3OMCA 1UDLA 4KGZB 1VQ4T 1GFCA 2F2VA 4M78B 2O4XA 1YJNA 4C92G 1IHWA 2LJ3A 2QK0A 4PL6A 2M02A 1C1AA 2RQRA 5CKBA 3CC7Q 4PFZA 2M9UA 1UJYA 3JCMW 1EX4A 1SRLA 3CCUQ 4LUDA 2GTOA 4AFZC 2ZPBB 5IT9E 4RTZA 1UECA 3RDVA 3RKYA 2LTOA 2MCNA 1N6AA 4KGXB 4BY6B 3JB9G 1UFFA 2ED1A 1KFZA 2LP5A 4ZGJB 1K0SA 2CSIA 1WHJA 4HA8A 1BCOA 1JXMA 4M78E 4ZTJA 4E7KA 3CD6Q 1V29B 4DEXA 1YBYA 5GAMe 2COYA 3CCUA 1YHQT 1AT1B 1WJSA 4ATOA 3SFMA 2EPDA 1SHFA 1YCSB 2HSEB 3A1PA 1HD3A 1NZ9A 1UHCA 1D0ZA 1K8AU 1VUBA 5CIUA 3EFOA 3UATA 5GAOp 3CCVT 2G6FX 5CQXA 2QQSA 1WHHA 3CPFA 5FWBA 3MEUA 1ABOA 2LDMA 4PJLA 2BZYA 3OSVA 2EGAA 4XU0A 2DYIA 2QTVA 1G5VA 1ZUUA 3J7AF 3NPFA 2DFUA 2QI2A 3X26B 2K5FA 1D1BA 2SRCA 3JCMe 2CP0A 1IHVA 1S72T 4A4FA 7AT1B 4Z88A 4AT1B 2NUTB 3CPWS 4DA4A 3JCMQ 3FJ5A 2EJ9A 2YLBA 1MMNA 2MMPA 2ENMA 2RI3A 4M7AA 5C0MA 1O75A 2OTLA 5GANf 5GAN6 3SDZA 4CC2A 1IGUA 3OBYA 4OB3B 3M0TA 2LX7A 2KVQG 4J9CA 4OF1A 2B86A 2KYBA 3FLGA 1K76A 1VQNA 2LJ0A 2K2VA 3A8GB 3CCET 3L2RA 4J9IA 1PHTA 2M51A 3X20B 1W1FA 3JCMc 4C92C 1V76A 1WLPB 3WVEB 3HRSA 4B9XA 1RAFB 3AT1B 4HCBA 3LWHA 4ZTFA 4NL3A 3DKMA 2YUQA 1W2BA 1NEGA 5IH2A 3EG9B 4EMKB 1NBEB 1Y0MA 4JRKA 1YI2A 2BE9B 3J80E 1K1ZA 3OYKA 2PU9B 3RBBB 1Q86U 2EQIA 4ZNXA 5DLOA 2LCCA 1ZUKA 1D0YA 3CBMA 1QVGP 1H3ZA 1ACMB 3S6WA 4RTVA 3JSCA 1BI3A 2JS0A 4MDWA 4M7AG 3SWNB 5CKFA 4M77A 5L23A 2RM4A 3UDCA 3ER0A 4F17A 5GAN2 1NJIC 4M7AB 4A4HA 3CCSQ 1M4ZA 5CCAA 3IQLA 3OW2A 2IIMA 1Q81C 3J81E 1VQPQ 2P4TA 4J9HA 4XTZA 1E6HA 2E1HA 4D8DA 2JUFA 2HNIA 3UWNA 2JZ2A 3I5SA 4VUBA 4Z8AA 4OMNA 1UJ0A 2M16A 3OS2A 3M56A 1D09B 2HBPA 4M7DB 1NLPC 3QJ6A 2X3XD 3R6OA 1X6OA 1NEBA 3HPWA 1WHMA 1ZA1B 3CCLA 3G6EA 1B07A 1OU9A 1Y07A 3VUBA 1GCQA 3CCRT 5D7UA 1ZSZA 1YIJQ 1AWJA 2FYKA 2GNCA 4II1A 4OMFB 4Y92A 3CCJA 1G3TA 3QSUA 2CZ0B 4JRIA 3CC4T 2VKNA 2RB6A 3VS3A 4WCIA 3JCMV 5KYWB 4M7DE 1K9MU 3CBOA 1VQ9Q 1WDXA 4ELYC 2E4HA 1AZGB 4JJDA 4M75D 1UG1A 4M77G 3OYEA 1RI9A 2DXTA 3EH1A 3SEMA 1I8FA 1VQ5T 2LQKA 3OS1A 2IG0A 2JM8A 5GAMf 4OGCA 3PVLA 4JDSA 1KD1U 1PRMC 2O9VA 4Y91A 1NPPA 4C8QF 1CKBA 4IURA 2L8DA 3OS5A 4D8KA 1HJDA 1VQ4A 4A4KA 3URGA 5GAN7 2EKOA 3OQ5A 4J7FA 4DQ2A 2MF2A 1LVKA 4RTXA 1K73U 2P84A 2WSCE 2CP7A 2OTJT 3NHNA 2ZPHB 5LJ5h 3C12A 4MDXA 4FT2A 1BB9A 2K3XA 2M0OA 2EGCA 1U1SA 1AWOA 4JLGA 1ZSZB 4DBQA 4EIKA 3LH5A 2YT6A 4OB2B 3CCVQ 2DD5A 1VQ6Q 3R6NA 4RKUE 1JB0E 2DXCA 4RTUA 4L5GA 4RCCA 1M1KR 3OYIA 1YHQA 5FRNA 2F2WA 4PJOC 2RMOA 3GOXA 3EGXB 1ZBJA 3OY9A 2PVDB 3LGLA 4E7ZA 4E47A 3TVTA 2VUBA 3EFRA 1EZZB 2QQ9A 2VASA 2YUPA 2J6OA 2ECZA 1AOJA 3PMIA 3QHSA 1G83A 1UTIA 2DX1A 2R5AA 5GMKe 5LJ5j 3LH0A 3HL8A 3QWYA 1RABB 2B8AA 3M55A 1S72A 5AYFA 4HCCA 5HK3A 2E65A 1FMKA 1BK2A 4EPCA 4JS4A 1OX9A 1OPLA 1SHGA 2RJDA 1NJIR 2KRNA 4LD6A 3CC2T 4M77C 1WQWA 2O01E 3QPHA 1SF9A 5FWCA 3QO3A 1Q81R 2AZVA 1KQ2A 3VU3C 3GLXA 2L5QA 2XDPA 2OTLT 5DY9A 4JRQA 2EIFA 3MPUB 2DXBA 2EQMA 3UF4A 1PC0A 4C5EA 3CCEA 4BE1A 3JV3A 3CPWP 1VQNT 2KNBB 4A4GA 4LE9A 4N4GA 2FHDA 2OJ2A 1GCQC 3FEOA 4FYWB 1AWWA 4LN2A 1CSKA 2I0NA 2QXFA 1X6BA 2I2LA 2KDSA 4OMLA 5EG2A 3CMET 4IIMA 1Q82C 3LWIA 1HSQA 1YI2T 1X2KA 4M75A 4BE0A 2KT8A 4OMMA 5IXFA 2K3YA 5KYNA 2FPDA 1K8AC 2KE9A 1VQOT 1JXOA 2QQBA 3P8HA 2W10A 3I55Q 3C94A 5GAOr 4M78F 4QW2A 1VQ7Q 4BUGA 4IUVA 5FW9A 1OEBA 5LJ5g 2D0NA 1PD0A 2ZCFB 4O5VA 3V8KA 2ZPIB 2DF6A 3PE0A 3EHRA 3M5AA 3OSSC 3JCMX 1K0XA 1M8MA 2GQIA 4MZMA 3CCMT 2HL3A 3DLLA 2A7YA 4J9EA 1QVGA 4KGVB 4HVWA 1K9AA 1NM7A 3EH2A 3EG3A 4PFPA 4ZN3A 2Y4YA 4BE2A 1UGRB 3CCRA 1VQMT 3E1SA 2XHCA 4IUTA 4F7UA 5A0GA 4PJOD 3CCLT 2YUOA 3VV0A 1Z9QA 1GBQA 2MK5A 2DE0X 4KH1B 2LT1A 2JMCA 1Y71A 4FCYA 1M90U 1OULA 2JVVA 5LJ5d 1WIEA 3VS7A 1JJ2S 3CC4A 2QYZA 1WXUA 3M0RA 1WPYA 4R55A 4BDYA 3BDUA 3MEVA 3CCJT 3TSZA 1O9SA 1TG0A 3CCQQ 2KBTA 4M75G 3OYHA 4BI8B 4F14A 3OYFA 1B34B 1N8RU 2FZCB 2JN0A 1KHCA 1PKSA 1VQ5A 1VQ8A 1I07A 4GLMA 1YJNQ 3DB3A 3A8LB 3MP8A 2RQWA 2OI3A 4V2SA 2HD0A 2PUOB 1BU1A 4DBFA 2NWMA 3BY7A 3LW5E 4CI0C 3V8LA 4LDXA 2X51A 2H3EB 1M2OA 2KGTA 2AKLA 1QKWA 3REBB 2DTOA 5GAN4 4ELZC 2DL5A 3PTAA 3MHXA 4FW1A 1IXDA 1NLOC 2OTJA 4PKCC 1C6VX 4F7UG 4D6WA 2VXFA 1SG5A 4A54A 4IIOA 2M1HA 3H41A 4C92B 1G2BA 2VGNA 2AT1B 2MWOA 4RTTA 4LDWA 1YJWA 2HCKA 2VGMA 4J9GA 3UA7A 4QT7A 1TOVA 2R58A 2XK0A 5I2MA 5LJ3e 4LDUA 4ORZA 4FL6A 2QQRA 1ZLMA 2RQTA 3MP1A 5EC7A 4OB0B 6AT1B 4N4HA 5KCHA 4E7JA 1WX6A 1X01A 3H8ZA 3E9FA 1YITT 2JW4A 4R0KA 3CXCS 3VS5A 4C92E 2RH2A 2K57A 1U1TA 1VQLT 1E6GA 2DNUA 2MOXA 3H0FA 5GAOq 3HHTB 5M9OA 4EMHA 5CKDA 1BIBA 1KHIA 2F5TX 2ZGWA 5J39A 2DEQA 4M4ZA 2V1QA 1RL2A 5A0LA 5IHNA 4FW2A 1Q82R 3EG2A 3OYBA 2CP2A 1W4SA 1WJRA 2C0IA 2COZA 1B7TA 4M7AF 1K9MC 2OTLQ 2P0QA 4KRTA 4M75C 2FO0A 3VS4A 2O4XB 1MMAA 4JUVA 3QG1A 1M3BA 3VYHB 5I11A 3CC2A 4EMGA 2WSEE 2A08A 1KK7A 1QCOA 4KBMB 1D0XA 4FYYB 1VQNQ 5CK9A 3M0PA 1UGPB 1WNLA 2COWA 1W2BS 1KQ1A 1R8OB 3NMZC 2XI9A 1DJ7B 3G4SA 2X4JA 3V7CA 4M7DF 1FMVA 2E12A 2D0QB 5A0DA 5GMKj 2RK1A 1MHNA 3QUIA 4C8QD 2DTIA 4AMCA 1TXQA 2QEXA 2C0TA 2K9GA 3CMEQ 4NL2A 4R56A 4HT8A 3GP8A 2EQKA 4PJOA 1QVFS 3GBQA 1YI2Q 1WJQA 3C0CA 4N0AA 2FZGB 2F69A 4XK8E 3TCJA 1RLQC 5C6SA 4LD9K 2O2OA 2LNHB 2D8HA 3OYMA 3EFOB 4LDYA 2P0KA 1BI1A 2LVMA 2A37A 3KXTA 3RESA 1I81A 5GANh 2O88A 3CMEA 5KYYA 2QGFB 4YTLA 3LLRA 4HT9A 2CUDA 3G7ZA 1YJ9T 2EGEA 2PUKB 4X9CA 4JZ4A 2LC4A 2LZ6B 2EAYA 5IHIA 2DETA 2X4WA 2EFIA 3EAEA 4RMOA 3L2UA 4IUQA 1VQKA 1VQOA 2DA9A 3QDRB 4PFOA 2YLCA 3EHQA 1ZSGA 2EJFA 5D6WA 1Y57A 2X35A 3ZBDA 1WZOA 3JB9J 3CCLQ 3G6EQ 1BKBA 2HSPA 2ROLA 3S3OA 5HKCA 3RIRA 3OYJA 1FYNA 2E3HA 2VYTA 1YWPA 1ZX6A 1KJWA 3CCMA 4KULA 3CCJQ 4C0ZA 4PJOG 4AFQC 1LNXA 4JPBW 3F70A 3VRYA 2QDYB 1VQMA 2DBKA 3OYDA 4PJOB 1PRLC 5GANj 4Z02A 2L3PA 1PNJA 4F16A 4FU6A 2H8HA 2J6KA 4M7AE 2J05A 5FROA 3JRZA 1WHLA 2L2PA 1N27A 1BYMA 2NUPA 1WI7A 4CC4B 2CZ7B 1OV3A 1M27C 1KC8C 1G3SA 2BTTA 1V1CA 2JJ9A 4ANJA 3ZL7C 2E5QA 2VVKA 2DZ9A 1K4US 1RAEB 2EYWA 1OI1A 2DPPB 5LJ3f 1VQ4Q 4GY5A 2P0PA 2MAMA 3FJPA 2MPXC 4XTVA 1N5ZA 2EKHA 4OMQA 1PSEA 1VYVA 4M77B 2CSQA 4Q5WA 1VQ8T 2SEMA 4DOVA 3RKXA 1JJ2P 4IUUA 5DM7R 1YN8A 3GIBA 2X4XA 1RLPC 1R0CB 2DRMA 3M9QA 5LJ5f 3I56T 2G3RA 1Q7YC 4C0DC 2L89A 4GBQA 1KIKA 5FU6C 5A2QE 4RUGA 2P4RA 2FG0A 2H3JA 2OAUA 1AZEA 2Y90A 3HFOA 4FYVB 5IN1A 3QBYA 4QVZA 2BZXA 1KSWA 3O5ZA 1FMWA 2LMJA 5FLXE 3A8MB 4E6RA 4M77E 1YHQQ 3PNWC 2PVOB 1JO8A 4FM4B 2DYBA 4J7IA 5KCOA 3TU4K 2BKDN 5GAMh 1HK9A 1RACB 1BI0A 1YJWT 4UC4A 2R57A 2RQVA 4A53A 4HXJA 4M78D 4C8QA 1GBRA 1M1KU 2DVJA 4PK4A 3MEWA 1WA7A 1U5SA 2CZ6B 3VRZA 1MNEA 2CP6A 1U3OA 4RTWA 4RTYA 3VYGA 1YITA 2DERA 5GANg 3CMAA 2YWWA 1T3SA 2RHIA 5I21A 4MZPA 1VQLA 1I5LA 3WXMB 2FVUA 4E7SA 2K6DA 3RKWA 1GRIA 1S72Q 3RMQA 4N0AC 3EG0A 3OMGA 3V7SA 2DL4A 2ATCB 1M90C 2DO3A 3VJPA 3JCMh 2RPNA 5HY6A 2QDLA 3JCMJ 1I4K1 2EWNA 5J3BA 3SB2A 3FC3A 2MWPA 3GNGA 4Z89A 1FXXA 2BIVA 3ZFJA 3BFMA 1GCPA 1GXIE 4OMPA 4ME7A 2IVWA 3HSBA 2JXBA 1WXBA 1YWOA 1N8RC 3V8JA 5GANd 1BI2A 4MMLA 2RHZA 4JZ3A 2CT3A 2DMOA 5GAMj 1NJIU 2DM1A 3CXCP 3OYAA 2DVEA 3QYGB 3VS1A 1Q81U 3CCEQ 3CD6T 3TSWA 5LL6S 2KAFA 1JQQA 2XD0A 3GPLA 3CBPA 2RHUA 2KYMA 1I5OB 4C8QG 1N9RA 2DIGA 3MP6A 3JCMP 1M2VA 3G4ST 2ZZDA 4L59A 4OMOA 1XOVA 1OU8A 4TVRA 1JEGA 4E2FB 3L2VA 2EJGA 2CH4W 2V8IA 1IREB 1T0HA 2QG9B 1BIAA 1MMGA 3G1JA 2DEUA 2V8KA 3X28B 3MJXA 3NGPA 2QEXT 2KRMA 2JT4A 1OOTA 5GJVB 1D1CA 2A0FB 3PFSA 1SEMA 2HKNA 1NE8A 4GLKA 1W2BP 2KY9A 4OVAA 2FZKB 2HAXA 1IZ6A
chains in the Genus database with same CATH topology
2J06A 3H0HA 1ABQA 5IHKA 2LQWA 2DILA 1WLPB 3I9QA 1NLOC 2X3WD 1PWTA 2FPEA 4IIOA 1WYXA 3I35A 2YUQA 3H41A 1G2BA 1NEGA 2O9SA 5IH2A 4RTTA 1Y0MA 4FSSA 2DL3A 2JM9A 1M3AA 3M0QA 2HCKA 1K1ZA 4J9GA 3I5RA 3UA7A 4QT7A 1GFDA 5I22A 1RUWA 3RBBB 1AWXA 2XMFA 2EQIA 4ZNXA 4ORZA 1VYTA 2K2MA 1H8KA 4J9DA 1ZUKA 1ZLMA 2RQTA 4J9BA 4DEYA 4RTVA 2JS0A 5EC7A 2J6FA 5L23A 4AG2C 1SRMA 1WFWA 2A28A 1WX6A 4F17A 1X2QA 2JW4A 4R0KA 3VS5A 3IQLA 2IIMA 3RNJA 1E6GA 2DNUA 4J9HA 2MOXA 2LQNA 3H0FA 2YSQA 2YDLA 1E6HA 4D8DA 2A36A 5GJWB 2NUZA 3I5SA 4M4ZA 4OMNA 4Z8AA 1UHFA 1UJ0A 2V1QA 2LJ1A 4CC3A 2PNIA 4ESRA 1NLPC 2X3XD 5IHNA 3EG2A 1NEBA 1AEYA 1B07A 2CH4A 2C0IA 4JJBA 1GCQA 1H3HA 2RQUA 4AFSC 4KRTA 2ESWA 2PZ1A 1ZUYA 2DJQA 2FO0A 3VS4A 4AG1C 3VS0A 1AWJA 2GNCA 1M3BA 5I11A 4Y92A 1AD5A 2A08A 3M0PA 2HDAA 4AFUC 2VKNA 3NMZC 2F2XA 2GGRA 2RNAA 3VS3A 4WCIA 2C0OA 1WXTA 1WDXA 3CQTA 1X27A 2L3QA 1AZGB 4JJDA 2LCSA 1UG1A 1MV3A 1RI9A 3EGUA 1PKTA 1X6GA 2C0TA 2K9GA 3SEMA 2DRKA 2JM8A 1UGVA 1UUEA 2YUNA 3GBQA 3PVLA 1E7OA 1PRMC 2O9VA 3C0CA 1CKBA 1RLQC 2O2OA 2LNHB 4D8KA 1HJDA 2D8HA 1QKXA 2AZSA 1SPKA 1A0NB 2A37A 2O88A 4RTXA 1QCFA 1I0CA 1NYGA 2J7IA 3NHNA 4HVUA 2RN8A 1ARKA 2CUDA 2KXDA 2EGEA 1BB9A 4JZ4A 2V1RA 2LZ6B 1Z9ZA 3QWXX 2EGCA 5IHIA 1AWOA 1TUDA 4EIKA 3LH5A 2DA9A 2YT6A 3EHQA 1X69A 1ZSGA 2L0AA 3R6NA 1YNZA 1Y57A 2DL8A 2VWFA 2KEAA 4RTUA 1OPKA 1B3QA 2HSPA 2ROLA 4J9FA 1NG2A 3PVQA 1FYNA 3A98A 2F2WA 1YWPA 1ZX6A 1KJWA 2RMOA 5HCKA 4LNPA 1ZBJA 2ABLA 3TVTA 4AFQC 4JPBW 3THKA 3VRYA 2YUPA 1T0JA 2DBKA 2J6OA 2ECZA 2JMAA 1PRLC 4K11A 1MV0B 2L3PA 2PTKA 1PNJA 2KR3A 1AOJA 4F16A 2H8HA 1YP5A 1G83A 1UTIA 2J6KA 3REAB 2DX1A 3EG1A 3QWYA 1LCKA 2J05A 2M0YA 2L2PA 3H0IA 4LUEA 2HBWA 1WI7A 1JU5C 4CC4B 1VA7A 4X1VA 2RF0A 1OV3A 1M27C 1S1NA 2W0ZA 1FMKA 2BTTA 1BK2A 1V1CA 2EYXA 2KRSA 3ZL7C 1OPLA 2VVKA 1SHGA 1K4US 2EYWA 2AKKA 2AK5A 2KRNA 1GL5A 1QLYA 2KT1A 2DBMA 5FWCA 3M0UA 2CREA 2AZVA 2CDTA 1MUZA 1N5ZA 2EKHA 4OMQA 1AVZC 1EFNA 2JTEA 2ROTA 2L3SA 2FEIA 1VYVA 1QWEA 2D1XA 2CSQA 2SEMA 2K3BA 1T3LA 5ECAA 2ED0A 2FRYA 3UF4A 1J3TA 2K79A 1YN8A 1M3CA 1RLPC 3KFVA 2DRMA 3M0SA 3ULRB 1W6XA 3JV3A 2KNBB 4LE9A 4GBQA 1KIKA 3VS6A 3SHWA 2OJ2A 4RUGA 2P4RA 2CT4A 2FG0A 1GCQC 1AZEA 1AWWA 1TUCA 4LN2A 1UDLA 3U23A 1CSKA 2I0NA 2MIOA 1X6BA 1GFCA 4JJCA 2BZXA 2F2VA 1KSWA 3O5ZA 2LMJA 4E6RA 4OMLA 1BBZA 1JO8A 2E5KA 2LJ3A 2DYBA 1UE9A 4IIMA 2EYZA 2RQRA 1HSQA 4HCKA 1X2KA 4HVVA 2RQVA 4HXJA 1UJYA 1SRLA 1GBRA 2DL7A 1QWFA 2KT8A 2DVJA 4OMMA 1IO6A 4LUDA 2GTOA 5IXFA 4AFZC 1WA7A 1U5SA 4RTZA 1UECA 3VRZA 2FPDA 2BZ8A 2MCNA 2KE9A 1U3OA 1UFFA 1JXOA 1SSHA 2ED1A 2LP5A 4RTWA 4RTYA 1K0SA 2W10A 1KFZA 2CSIA 1T3SA 1JXMA 5FW9A 1OEBA 3UA6A 2D0NA 2K6DA 1GRIA 1X43A 4DEXA 3EG0A 2DF6A 2DL4A 3PE0A 3EHRA 2FPFA 2EPDA 1SHFA 1YCSB 2RPNA 2QDLA 1K0XA 1M8MA 1HD3A 2GQIA 1I1JA 4Z89A 1UHCA 4J9EA 1K9AA 1NM7A 4HVWA 3EG3A 3UATA 1GCPA 1U06A 2G6FX 2KXCA 5FWBA 2O31A 4OMPA 5IXBA 2JXBA 1WXBA 1YWOA 1ABOA 2YUOA 2EVRA 1Z9QA 1GBQA 2BZYA 2DE0X 2GBQA 2EGAA 4JZ3A 2CT3A 2DMOA 2JMCA 2DM1A 1W70A 1NYFA 1ZUUA 2HEQA 1WIEA 3VS7A 3NPFA 3VS1A 1M30A 2EBPA 1WXUA 3M0RA 2SRCA 2K7AA 3TSWA 1JQQA 3TSZA 4Z88A 1H92A 1TG0A 2KBTA 2KYMA 2CUBA 1VYUA 3FJ5A 4F14A 2ENMA 4OMOA 1XOVA 2DLPA 1JEGA 1PKSA 4CC7A 4A63B 1I07A 2CH4W 4CC2A 1T0HA 4GLMA 3M0TA 2EYYA 2RQWA 3NGPA 2LX7A 2OI3A 2KRMA 2GTJA 4J9CA 2JT4A 2B86A 1BU1A 2KROA 2NWMA 2FRWA 3VS2A 1OOTA 5GJVB 2KYBA 1K76A 2LJ0A 2OAWA 2EW3A 1SEMA 2JS2A 2KGTA 2AKLA 1QKWA 1CKAA 3REBB 4J9IA 1PHTA 2M51A 1W1FA 2D8JA 2DL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J06 A;  3H0H A;  1ABQ A;  5IHK A;  2LQW A;  2DIL A;  1WLP B;  3I9Q A;  1NLO C;  2X3W D;  1PWT A;  2FPE A;  4IIO A;  1WYX A;  3I35 A;  2YUQ A;  3H41 A;  1G2B A;  1NEG A;  2O9S A;  5IH2 A;  4RTT A;  1Y0M A;  4FSS A;  2DL3 A;  2JM9 A;  1M3A A;  3M0Q A;  2HCK A;  1K1Z A;  4J9G A;  3I5R A;  3UA7 A;  4QT7 A;  1GFD A;  5I22 A;  1RUW A;  3RBB B;  1AWX A;  2XMF A;  2EQI A;  4ZNX A;  4ORZ A;  1VYT A;  2K2M A;  1H8K A;  4J9D A;  1ZUK A;  1ZLM A;  2RQT A;  4J9B A;  4DEY A;  4RTV A;  2JS0 A;  5EC7 A;  2J6F A;  5L23 A;  4AG2 C;  1SRM A;  1WFW A;  2A28 A;  1WX6 A;  4F17 A;  1X2Q A;  2JW4 A;  4R0K A;  3VS5 A;  3IQL A;  2IIM A;  3RNJ A;  1E6G A;  2DNU A;  4J9H A;  2MOX A;  2LQN A;  3H0F A;  2YSQ A;  2YDL A;  1E6H A;  4D8D A;  2A36 A;  5GJW B;  2NUZ A;  3I5S A;  4M4Z A;  4OMN A;  4Z8A A;  1UHF A;  1UJ0 A;  2V1Q A;  2LJ1 A;  4CC3 A;  2PNI A;  4ESR A;  1NLP C;  2X3X D;  5IHN A;  3EG2 A;  1NEB A;  1AEY A;  1B07 A;  2CH4 A;  2C0I A;  4JJB A;  1GCQ A;  1H3H A;  2RQU A;  4AFS C;  4KRT A;  2ESW A;  2PZ1 A;  1ZUY A;  2DJQ A;  2FO0 A;  3VS4 A;  4AG1 C;  3VS0 A;  1AWJ A;  2GNC A;  1M3B A;  5I11 A;  4Y92 A;  1AD5 A;  2A08 A;  3M0P A;  2HDA A;  4AFU C;  2VKN A;  3NMZ C;  2F2X A;  2GGR A;  2RNA A;  3VS3 A;  4WCI A;  2C0O A;  1WXT A;  1WDX A;  3CQT A;  1X27 A;  2L3Q A;  1AZG B;  4JJD A;  2LCS A;  1UG1 A;  1MV3 A;  1RI9 A;  3EGU A;  1PKT A;  1X6G A;  2C0T A;  2K9G A;  3SEM A;  2DRK A;  2JM8 A;  1UGV A;  1UUE A;  2YUN A;  3GBQ A;  3PVL A;  1E7O A;  1PRM C;  2O9V A;  3C0C A;  1CKB A;  1RLQ C;  2O2O A;  2LNH B;  4D8K A;  1HJD A;  2D8H A;  1QKX A;  2AZS A;  1SPK A;  1A0N B;  2A37 A;  2O88 A;  4RTX A;  1QCF A;  1I0C A;  1NYG A;  2J7I A;  3NHN A;  4HVU A;  2RN8 A;  1ARK A;  2CUD A;  2KXD A;  2EGE A;  1BB9 A;  4JZ4 A;  2V1R A;  2LZ6 B;  1Z9Z A;  3QWX X;  2EGC A;  5IHI A;  1AWO A;  1TUD A;  4EIK A;  3LH5 A;  2DA9 A;  2YT6 A;  3EHQ A;  1X69 A;  1ZSG A;  2L0A A;  3R6N A;  1YNZ A;  1Y57 A;  2DL8 A;  2VWF A;  2KEA A;  4RTU A;  1OPK A;  1B3Q A;  2HSP A;  2ROL A;  4J9F A;  1NG2 A;  3PVQ A;  1FYN A;  3A98 A;  2F2W A;  1YWP A;  1ZX6 A;  1KJW A;  2RMO A;  5HCK A;  4LNP A;  1ZBJ A;  2ABL A;  3TVT A;  4AFQ C;  4JPB W;  3THK A;  3VRY A;  2YUP A;  1T0J A;  2DBK A;  2J6O A;  2ECZ A;  2JMA A;  1PRL C;  4K11 A;  1MV0 B;  2L3P A;  2PTK A;  1PNJ A;  2KR3 A;  1AOJ A;  4F16 A;  2H8H A;  1YP5 A;  1G83 A;  1UTI A;  2J6K A;  3REA B;  2DX1 A;  3EG1 A;  3QWY A;  1LCK A;  2J05 A;  2M0Y A;  2L2P A;  3H0I A;  4LUE A;  2HBW A;  1WI7 A;  1JU5 C;  4CC4 B;  1VA7 A;  4X1V A;  2RF0 A;  1OV3 A;  1M27 C;  1S1N A;  2W0Z A;  1FMK A;  2BTT A;  1BK2 A;  1V1C A;  2EYX A;  2KRS A;  3ZL7 C;  1OPL A;  2VVK A;  1SHG A;  1K4U S;  2EYW A;  2AKK A;  2AK5 A;  2KRN A;  1GL5 A;  1QLY A;  2KT1 A;  2DBM A;  5FWC A;  3M0U A;  2CRE A;  2AZV A;  2CDT A;  1MUZ A;  1N5Z A;  2EKH A;  4OMQ A;  1AVZ C;  1EFN A;  2JTE A;  2ROT A;  2L3S A;  2FEI A;  1VYV A;  1QWE A;  2D1X A;  2CSQ A;  2SEM A;  2K3B A;  1T3L A;  5ECA A;  2ED0 A;  2FRY A;  3UF4 A;  1J3T A;  2K79 A;  1YN8 A;  1M3C A;  1RLP C;  3KFV A;  2DRM A;  3M0S A;  3ULR B;  1W6X A;  3JV3 A;  2KNB B;  4LE9 A;  4GBQ A;  1KIK A;  3VS6 A;  3SHW A;  2OJ2 A;  4RUG A;  2P4R A;  2CT4 A;  2FG0 A;  1GCQ C;  1AZE A;  1AWW A;  1TUC A;  4LN2 A;  1UDL A;  3U23 A;  1CSK A;  2I0N A;  2MIO A;  1X6B A;  1GFC A;  4JJC A;  2BZX A;  2F2V A;  1KSW A;  3O5Z A;  2LMJ A;  4E6R A;  4OML A;  1BBZ A;  1JO8 A;  2E5K A;  2LJ3 A;  2DYB A;  1UE9 A;  4IIM A;  2EYZ A;  2RQR A;  1HSQ A;  4HCK A;  1X2K A;  4HVV A;  2RQV A;  4HXJ A;  1UJY A;  1SRL A;  1GBR A;  2DL7 A;  1QWF A;  2KT8 A;  2DVJ A;  4OMM A;  1IO6 A;  4LUD A;  2GTO A;  5IXF A;  4AFZ C;  1WA7 A;  1U5S A;  4RTZ A;  1UEC A;  3VRZ A;  2FPD A;  2BZ8 A;  2MCN A;  2KE9 A;  1U3O A;  1UFF A;  1JXO A;  1SSH A;  2ED1 A;  2LP5 A;  4RTW A;  4RTY A;  1K0S A;  2W10 A;  1KFZ A;  2CSI A;  1T3S A;  1JXM A;  5FW9 A;  1OEB A;  3UA6 A;  2D0N A;  2K6D A;  1GRI A;  1X43 A;  4DEX A;  3EG0 A;  2DF6 A;  2DL4 A;  3PE0 A;  3EHR A;  2FPF A;  2EPD A;  1SHF A;  1YCS B;  2RPN A;  2QDL A;  1K0X A;  1M8M A;  1HD3 A;  2GQI A;  1I1J A;  4Z89 A;  1UHC A;  4J9E A;  1K9A A;  1NM7 A;  4HVW A;  3EG3 A;  3UAT A;  1GCP A;  1U06 A;  2G6F X;  2KXC A;  5FWB A;  2O31 A;  4OMP A;  5IXB A;  2JXB A;  1WXB A;  1YWO A;  1ABO A;  2YUO A;  2EVR A;  1Z9Q A;  1GBQ A;  2BZY A;  2DE0 X;  2GBQ A;  2EGA A;  4JZ3 A;  2CT3 A;  2DMO A;  2JMC A;  2DM1 A;  1W70 A;  1NYF A;  1ZUU A;  2HEQ A;  1WIE A;  3VS7 A;  3NPF A;  3VS1 A;  1M30 A;  2EBP A;  1WXU A;  3M0R A;  2SRC A;  2K7A A;  3TSW A;  1JQQ A;  3TSZ A;  4Z88 A;  1H92 A;  1TG0 A;  2KBT A;  2KYM A;  2CUB A;  1VYU A;  3FJ5 A;  4F14 A;  2ENM A;  4OMO A;  1XOV A;  2DLP A;  1JEG A;  1PKS A;  4CC7 A;  4A63 B;  1I07 A;  2CH4 W;  4CC2 A;  1T0H A;  4GLM A;  3M0T A;  2EYY A;  2RQW A;  3NGP A;  2LX7 A;  2OI3 A;  2KRM A;  2GTJ A;  4J9C A;  2JT4 A;  2B86 A;  1BU1 A;  2KRO A;  2NWM A;  2FRW A;  3VS2 A;  1OOT A;  5GJV B;  2KYB A;  1K76 A;  2LJ0 A;  2OAW A;  2EW3 A;  1SEM A;  2JS2 A;  2KGT A;  2AKL A;  1QKW A;  1CKA A;  3REB B;  4J9I A;  1PHT A;  2M51 A;  1W1F A;  2D8J A;  2DL5 A; 
#chains in the Genus database with same CATH topology
 2LCL A;  2CKK A;  4FSX A;  4Y28 E;  3H0H A;  1KC8 R;  2LQW A;  2DIL A;  2CYZ B;  2FB7 A;  3A8H B;  3I9Q A;  1XTD A;  2KMT A;  1YJ9 A;  3NFC A;  3UT1 A;  4RCB A;  1WYX A;  3I35 A;  2RI5 A;  2O9S A;  1KQS S;  2JM9 A;  2GFU A;  1QVF P;  1M3A A;  3M0Q A;  4DBR A;  1GFD A;  2V26 A;  1RUW A;  1AWX A;  2LNV A;  2XMF A;  1VQK T;  1TUG B;  1VYT A;  2K2M A;  1H8K A;  2LX9 A;  4J9D A;  2WAC A;  3L2W A;  2RO0 A;  2XU8 A;  4J9B A;  3CCR Q;  4J6X A;  5KYU A;  2J6F A;  4PNO A;  1SRM A;  1WFW A;  1P92 A;  2A28 A;  1Q7Y R;  3OS0 A;  4C92 F;  1M1G A;  5KYX A;  5GAM g;  1VOM A;  3CC4 Q;  3RNJ A;  4XQ3 A;  2EYQ A;  3JB9 H;  2VB6 A;  1UB4 A;  2YDL A;  2DKG A;  4MZT A;  3ME9 A;  3AHU A;  2A36 A;  4M7A D;  1D3B A;  2E10 A;  3OYG A;  4CC3 A;  2PNI A;  2YRC A;  4IUP A;  3JB9 F;  1TH7 A;  4OB1 B;  2CH4 A;  3NTH A;  4M78 A;  4EDU A;  1VQ5 Q;  5IAY A;  2RQU A;  1H3H A;  4AFS C;  1VQ8 Q;  2QQA A;  3EGD A;  2RHX A;  1ZUY A;  3OYL A;  2XIC A;  4AG1 C;  4C8Q C;  5GMK i;  4M7D D;  2DZC A;  5GAM d;  3EFS A;  4FIB A;  4LXC A;  3JB9 I;  3JCM g;  2ZAE A;  4JRP A;  2EQJ A;  1TU0 B;  1IRX A;  3FRN A;  1VQP T;  2HDA A;  4M75 B;  2AIR B;  4AFU C;  2GGR A;  4NS5 A;  8AT1 B;  5FU7 C;  1WGS A;  3TRE A;  2C0O A;  3OYY A;  3S3N A;  2MI6 A;  1WXT A;  3CQT A;  1X27 A;  2OTJ Q;  1QMC A;  3BW1 A;  2RD1 A;  1QW1 A;  4WTO B;  3EGU A;  4BB7 A;  3I56 A;  4E7L A;  3QJY A;  2HL5 C;  1UUE A;  2YUN A;  3JCM d;  1YJW Q;  1M1F A;  3JCM b;  1E7O A;  1FX7 A;  2DXU A;  8ATC B;  4FYX B;  4X9D A;  3M57 A;  5KYX B;  1XQH A;  1QQJ A;  1Q86 C;  4M75 E;  4KT0 E;  4BAC A;  4C5G A;  1M9S A;  1WHK A;  2HMA A;  3PIP A;  2QA4 A;  4F7U B;  2VXE A;  1QCF A;  4M78 G;  2D9T A;  3HKS A;  4J5Y A;  1JJ2 A;  1NYG A;  3H9N A;  1VQ9 T;  1MND A;  1QP2 A;  3QII A;  4HVU A;  1Y96 A;  2ZPF B;  4KH0 B;  4LDV A;  3FIF A;  1TWB A;  2KXD A;  1TTH B;  2V1R A;  4XAX B;  2NUT A;  1Z9Z A;  3EGD B;  3MCA B;  3PMT A;  3JAM E;  4ZGE B;  3E19 A;  3RMS A;  1HXD A;  3OYN A;  1X69 A;  2RK2 A;  2L0A A;  3HFN A;  1YNZ A;  2YXY A;  4KUI A;  2VWF A;  1SKU B;  4PLI A;  1OPK A;  3SD4 A;  5GMK h;  5CAI A;  1B3Q A;  3CMA T;  4F7U E;  4J9F A;  4O6J A;  5L8R E;  3GNF B;  3M54 A;  5LJ5 e;  4LNP A;  1HYO A;  1Q82 U;  1JRI A;  3CC7 A;  3CC2 Q;  2ABL A;  4WF2 A;  2CS7 A;  1G3Y A;  2KQW A;  1T0J A;  3QKJ A;  1PSF A;  2JMA A;  2JTM A;  4KUD K;  5GAO n;  2CGH A;  3G4S Q;  2PTK A;  2E41 A;  1VQ6 T;  3D7S B;  1LCK A;  4E7H A;  2WSF E;  2M0Y A;  1K8A R;  3MKD A;  3BE3 A;  1RAA B;  2F5K A;  3EG9 A;  4LUE A;  4EMK A;  3E9G A;  3CD6 A;  2CP5 A;  2DJZ A;  2HBW A;  2LT4 A;  2QEX Q;  2LRQ A;  1S1N A;  1VIF A;  2RJC A;  2W0Z A;  1ZQ1 A;  2XG8 D;  1KD1 C;  2EYX A;  1R0B G;  5CKH A;  3M59 A;  4QVD A;  5DLQ E;  1Y96 B;  4BI4 A;  1LJO A;  3L2Q A;  1MMD A;  5D6X A;  2AKK A;  3C4S A;  2AK5 A;  4NOY A;  4PJO F;  1M8V A;  5KH6 A;  1GL5 A;  1QLY A;  2DBM A;  2LQ8 A;  2V8J A;  4HCZ A;  3M0U A;  2RA2 A;  3SWN A;  2CDT A;  3G71 T;  1LPL A;  3CXC A;  1Q95 G;  1EFN A;  1K73 C;  2ROT A;  2FEI A;  1QWE A;  2K3B A;  1T3L A;  4RG2 A;  5CQY A;  1D1A A;  5I2S A;  2K79 A;  3QXE B;  3KFV A;  1YFN A;  3OW2 S;  3ULR B;  1VQK Q;  4M78 C;  1VQO Q;  2K5I A;  1TS9 A;  2XDB A;  4M7D A;  2CP3 A;  3RER A;  2CT4 A;  1M1K C;  4XTX A;  2KI7 A;  3L1A A;  1TUC A;  3U23 A;  2JNG A;  2MIO A;  4C0D B;  2QAS A;  4JJC A;  4M77 F;  5FU6 B;  4PJN A;  2F1L A;  3CPW A;  1BBZ A;  2E5K A;  1UE9 A;  3CCM Q;  2EYZ A;  4HCK A;  4HVV A;  4BY6 C;  2D6F A;  1UEB A;  2DL7 A;  1QWF A;  1IO6 A;  1VQM Q;  5CR2 A;  2DAQ A;  5KYW A;  5CVI A;  2BZ8 A;  4J83 A;  1SSH A;  9ATC B;  1IB8 A;  3VKI A;  2RI2 A;  4QQ6 A;  1Q86 R;  3UA6 A;  3GF5 A;  1QVF A;  3E2U A;  1X43 A;  3HP9 A;  1KQS P;  3X24 B;  2FPF A;  3Q1J A;  3NTI A;  1I1J A;  1JBM A;  5GAN 5;  3DB4 A;  3MET A;  1F1B B;  1U06 A;  2KXC A;  2FL7 A;  2R5M A;  2O31 A;  4M7D G;  5IXB A;  1OX8 A;  2AHJ B;  4BI3 A;  1G3W A;  2EVR A;  2GBQ A;  3CCS A;  1W70 A;  3I55 T;  1NYF A;  4P5N A;  5KYY B;  3MO8 A;  4BD3 A;  2HEQ A;  1VQ7 T;  5KE3 A;  2QAZ A;  1LOJ A;  1M30 A;  2EBP A;  1VQP A;  2L3R A;  2PQW A;  2K7A A;  3MEA A;  1H92 A;  4PJO E;  2CUB A;  1RI0 A;  1VYU A;  3QZ5 B;  3S3M A;  3OB9 A;  3V7R A;  1NPR A;  2DLP A;  1VIE A;  1MGQ A;  4N4I A;  5GAN 3;  1PM3 A;  1UGS B;  1Y7X A;  3NTK A;  4A63 B;  4CC7 A;  4C0G A;  2HQX A;  1YIJ A;  3EGX A;  2EYY A;  4X34 A;  5CKE A;  5GAO m;  2CZ1 B;  2GTJ A;  4XTU A;  2KRO A;  1K9M R;  2FRW A;  3VS2 A;  4OGE A;  2OAW A;  2EW3 A;  2JS2 A;  4C5H A;  1CKA A;  5LJ3 h;  4E7I A;  5GAO l;  2D8J A;  3CCQ T;  3VUZ A;  2HKQ B;  2J06 A;  3M4Y A;  1ABQ A;  3P8D A;  5IHK A;  4EMK C;  1VQ9 A;  1KD1 R;  4B9W A;  1YIT Q;  4FT4 A;  2RHY A;  3QZ9 B;  2X3W D;  1PWT A;  4ZGD B;  2DK3 A;  5KE2 A;  3CMA Q;  2QA4 T;  2FPE A;  1PG5 B;  2GCX A;  1VQL Q;  3PT9 A;  1RAI B;  4FSS A;  2NUP B;  2DL3 A;  1YJN T;  2YRV A;  1IGQ A;  3I5R A;  1K73 R;  3SWN C;  5I22 A;  2VV5 A;  4J6W A;  1UGQ B;  4C92 D;  1KG1 A;  3JCM f;  4M7A C;  4PJM A;  4XU1 A;  1BCM A;  1PCX A;  2BE7 D;  1G8X A;  2E64 A;  2YRD A;  4DEY A;  1H64 1;  2HQH A;  4AG2 C;  2JTF A;  3M58 A;  4DBH A;  1U8R A;  1X2Q A;  2ZPG B;  5FRM A;  1X75 C;  4B6M A;  1C0M A;  3INZ A;  4QQG A;  3JB9 D;  2K5L A;  5LJ3 j;  2X4Y A;  2LQN A;  4M7D C;  2YSQ A;  3TQ7 P;  2XKO C;  3CC7 T;  2DIQ A;  2RJF A;  2JOY A;  3CCU T;  2Z0W A;  5GJW B;  2NUZ A;  4RG8 A;  5J26 A;  3CCV A;  1UHF A;  2XID A;  4QVC A;  1VQ6 A;  2LJ1 A;  3H6Z A;  3HRT A;  4ESR A;  2IPO B;  4J6Y A;  2X9H A;  1AEY A;  3G71 Q;  4ZN1 A;  2KK4 A;  4JJB A;  3WVD B;  3HTR A;  5GAN 8;  4BDZ A;  2E3I A;  2ESW A;  2GF7 A;  2PZ1 A;  2DJQ A;  3FB9 A;  2HZY A;  1SSF A;  4IKF A;  4XU2 A;  3VS0 A;  3N5B B;  4PJJ A;  3CEY A;  4C0F A;  1AD5 A;  3C95 A;  4JJN K;  3OBW A;  4XTY A;  2F2X A;  4C8Q B;  1QP3 A;  3ASK A;  3G71 A;  3P8B B;  2RNA A;  2E70 A;  5AT1 B;  2K4Y A;  2A3L A;  2L3Q A;  2KSS A;  2LCS A;  1YJ9 Q;  1WQ7 A;  1MV3 A;  1OZ3 A;  5FU7 B;  4XU3 A;  3KBG A;  1PKT A;  1OZ2 A;  2QTX A;  1X6G A;  2DRK A;  3PIO A;  1KC8 U;  1OYX A;  4QQD A;  1UGV A;  4M75 F;  3DLM A;  4C8Q E;  1QKX A;  3LX7 A;  3A5Z B;  1EIF A;  2AZS A;  4F04 B;  2NLU A;  1QVG S;  1SPK A;  1A0N B;  2HQE A;  3QYH B;  2GQV A;  3BDL A;  2QGG A;  1I0C A;  4JLI A;  1ZSZ C;  2J7I A;  3L42 A;  3LYI A;  1ARK A;  2EQU A;  2RN8 A;  2XDD A;  1YCY A;  1N9S A;  1M5Q 1;  3QWX X;  3OW2 P;  3HRU A;  3RUX A;  1TUD A;  3LGF A;  1Q7Y U;  5HK0 A;  5LJ3 g;  2ZPE B;  1B34 A;  1ZBX A;  1ZHI A;  2GFA A;  3L2Z A;  5D6Y A;  3X25 B;  1RAG B;  4CRI A;  1XJW B;  1QVP A;  2NYS A;  2DL8 A;  1M2V B;  2KEA A;  4OP0 A;  1FWZ A;  4F7U F;  5GAN e;  5GMK m;  2E6N A;  1NG2 A;  3PVQ A;  3A98 A;  3ZEH A;  4C5I A;  1WHG A;  4PLL A;  1TSF A;  1AHJ B;  5HCK A;  1RAH B;  4QKU A;  5GMK l;  3TEE A;  3THK A;  3M53 A;  5LJ3 d;  1QCN A;  4A4E A;  3OYC A;  4K11 A;  4L6V 5;  1MV0 B;  2Y4X A;  2KR3 A;  4DOW A;  1YP5 A;  1OQK A;  3I55 A;  1PD1 A;  3REA B;  1VQ7 A;  3EG1 A;  2C06 A;  2YHT A;  4C92 A;  3CCS T;  1KQS A;  3G6E T;  3H0I A;  1JU5 C;  1VA7 A;  4X1V A;  2RF0 A;  3I56 Q;  3M4G A;  2KRS A;  4MMK A;  2MYS A;  2OX7 A;  3A8O B;  2RJE A;  1R77 A;  2KT1 A;  1M90 R;  2BUD A;  3OA6 A;  2DD4 A;  4J8O A;  3PGG A;  2CRE A;  1MUZ A;  4JS5 A;  1AVZ C;  5KYU B;  2JTE A;  2QA4 Q;  4XTW A;  2L3S A;  2D1X A;  3UPU A;  1YIJ T;  3O8V A;  5ECA A;  2ED0 A;  1ZA2 B;  2FRY A;  1N8R R;  1RAD B;  3RR6 A;  1J3T A;  3FDR A;  4HKE A;  2E6Z A;  3QDF A;  1M3C A;  2DTH A;  3KUF A;  5CO7 A;  3M0S A;  3CCQ A;  1W6X A;  1XNI A;  4M77 D;  2PVG B;  3VS6 A;  3SHW A;  2VC8 A;  3T9N A;  1D3B B;  3OMC A;  1UDL A;  4KGZ B;  1VQ4 T;  1GFC A;  2F2V A;  4M78 B;  2O4X A;  1YJN A;  4C92 G;  1IHW A;  2LJ3 A;  2QK0 A;  4PL6 A;  2M02 A;  1C1A A;  2RQR A;  5CKB A;  3CC7 Q;  4PFZ A;  2M9U A;  1UJY A;  3JCM W;  1EX4 A;  1SRL A;  3CCU Q;  4LUD A;  2GTO A;  4AFZ C;  2ZPB B;  5IT9 E;  4RTZ A;  1UEC A;  3RDV A;  3RKY A;  2LTO A;  2MCN A;  1N6A A;  4KGX B;  4BY6 B;  3JB9 G;  1UFF A;  2ED1 A;  1KFZ A;  2LP5 A;  4ZGJ B;  1K0S A;  2CSI A;  1WHJ A;  4HA8 A;  1BCO A;  1JXM A;  4M78 E;  4ZTJ A;  4E7K A;  3CD6 Q;  1V29 B;  4DEX A;  1YBY A;  5GAM e;  2COY A;  3CCU A;  1YHQ T;  1AT1 B;  1WJS A;  4ATO A;  3SFM A;  2EPD A;  1SHF A;  1YCS B;  2HSE B;  3A1P A;  1HD3 A;  1NZ9 A;  1UHC A;  1D0Z A;  1K8A U;  1VUB A;  5CIU A;  3EFO A;  3UAT A;  5GAO p;  3CCV T;  2G6F X;  5CQX A;  2QQS A;  1WHH A;  3CPF A;  5FWB A;  3MEU A;  1ABO A;  2LDM A;  4PJL A;  2BZY A;  3OSV A;  2EGA A;  4XU0 A;  2DYI A;  2QTV A;  1G5V A;  1ZUU A;  3J7A F;  3NPF A;  2DFU A;  2QI2 A;  3X26 B;  2K5F A;  1D1B A;  2SRC A;  3JCM e;  2CP0 A;  1IHV A;  1S72 T;  4A4F A;  7AT1 B;  4Z88 A;  4AT1 B;  2NUT B;  3CPW S;  4DA4 A;  3JCM Q;  3FJ5 A;  2EJ9 A;  2YLB A;  1MMN A;  2MMP A;  2ENM A;  2RI3 A;  4M7A A;  5C0M A;  1O75 A;  2OTL A;  5GAN f;  5GAN 6;  3SDZ A;  4CC2 A;  1IGU A;  3OBY A;  4OB3 B;  3M0T A;  2LX7 A;  2KVQ G;  4J9C A;  4OF1 A;  2B86 A;  2KYB A;  3FLG A;  1K76 A;  1VQN A;  2LJ0 A;  2K2V A;  3A8G B;  3CCE T;  3L2R A;  4J9I A;  1PHT A;  2M51 A;  3X20 B;  1W1F A;  3JCM c;  4C92 C;  1V76 A;  1WLP B;  3WVE B;  3HRS A;  4B9X A;  1RAF B;  3AT1 B;  4HCB A;  3LWH A;  4ZTF A;  4NL3 A;  3DKM A;  2YUQ A;  1W2B A;  1NEG A;  5IH2 A;  3EG9 B;  4EMK B;  1NBE B;  1Y0M A;  4JRK A;  1YI2 A;  2BE9 B;  3J80 E;  1K1Z A;  3OYK A;  2PU9 B;  3RBB B;  1Q86 U;  2EQI A;  4ZNX A;  5DLO A;  2LCC A;  1ZUK A;  1D0Y A;  3CBM A;  1QVG P;  1H3Z A;  1ACM B;  3S6W A;  4RTV A;  3JSC A;  1BI3 A;  2JS0 A;  4MDW A;  4M7A G;  3SWN B;  5CKF A;  4M77 A;  5L23 A;  2RM4 A;  3UDC A;  3ER0 A;  4F17 A;  5GAN 2;  1NJI C;  4M7A B;  4A4H A;  3CCS Q;  1M4Z A;  5CCA A;  3IQL A;  3OW2 A;  2IIM A;  1Q81 C;  3J81 E;  1VQP Q;  2P4T A;  4J9H A;  4XTZ A;  1E6H A;  2E1H A;  4D8D A;  2JUF A;  2HNI A;  3UWN A;  2JZ2 A;  3I5S A;  4VUB A;  4Z8A A;  4OMN A;  1UJ0 A;  2M16 A;  3OS2 A;  3M56 A;  1D09 B;  2HBP A;  4M7D B;  1NLP C;  3QJ6 A;  2X3X D;  3R6O A;  1X6O A;  1NEB A;  3HPW A;  1WHM A;  1ZA1 B;  3CCL A;  3G6E A;  1B07 A;  1OU9 A;  1Y07 A;  3VUB A;  1GCQ A;  3CCR T;  5D7U A;  1ZSZ A;  1YIJ Q;  1AWJ A;  2FYK A;  2GNC A;  4II1 A;  4OMF B;  4Y92 A;  3CCJ A;  1G3T A;  3QSU A;  2CZ0 B;  4JRI A;  3CC4 T;  2VKN A;  2RB6 A;  3VS3 A;  4WCI A;  3JCM V;  5KYW B;  4M7D E;  1K9M U;  3CBO A;  1VQ9 Q;  1WDX A;  4ELY C;  2E4H A;  1AZG B;  4JJD A;  4M75 D;  1UG1 A;  4M77 G;  3OYE A;  1RI9 A;  2DXT A;  3EH1 A;  3SEM A;  1I8F A;  1VQ5 T;  2LQK A;  3OS1 A;  2IG0 A;  2JM8 A;  5GAM f;  4OGC A;  3PVL A;  4JDS A;  1KD1 U;  1PRM C;  2O9V A;  4Y91 A;  1NPP A;  4C8Q F;  1CKB A;  4IUR A;  2L8D A;  3OS5 A;  4D8K A;  1HJD A;  1VQ4 A;  4A4K A;  3URG A;  5GAN 7;  2EKO A;  3OQ5 A;  4J7F A;  4DQ2 A;  2MF2 A;  1LVK A;  4RTX A;  1K73 U;  2P84 A;  2WSC E;  2CP7 A;  2OTJ T;  3NHN A;  2ZPH B;  5LJ5 h;  3C12 A;  4MDX A;  4FT2 A;  1BB9 A;  2K3X A;  2M0O A;  2EGC A;  1U1S A;  1AWO A;  4JLG A;  1ZSZ B;  4DBQ A;  4EIK A;  3LH5 A;  2YT6 A;  4OB2 B;  3CCV Q;  2DD5 A;  1VQ6 Q;  3R6N A;  4RKU E;  1JB0 E;  2DXC A;  4RTU A;  4L5G A;  4RCC A;  1M1K R;  3OYI A;  1YHQ A;  5FRN A;  2F2W A;  4PJO C;  2RMO A;  3GOX A;  3EGX B;  1ZBJ A;  3OY9 A;  2PVD B;  3LGL A;  4E7Z A;  4E47 A;  3TVT A;  2VUB A;  3EFR A;  1EZZ B;  2QQ9 A;  2VAS A;  2YUP A;  2J6O A;  2ECZ A;  1AOJ A;  3PMI A;  3QHS A;  1G83 A;  1UTI A;  2DX1 A;  2R5A A;  5GMK e;  5LJ5 j;  3LH0 A;  3HL8 A;  3QWY A;  1RAB B;  2B8A A;  3M55 A;  1S72 A;  5AYF A;  4HCC A;  5HK3 A;  2E65 A;  1FMK A;  1BK2 A;  4EPC A;  4JS4 A;  1OX9 A;  1OPL A;  1SHG A;  2RJD A;  1NJI R;  2KRN A;  4LD6 A;  3CC2 T;  4M77 C;  1WQW A;  2O01 E;  3QPH A;  1SF9 A;  5FWC A;  3QO3 A;  1Q81 R;  2AZV A;  1KQ2 A;  3VU3 C;  3GLX A;  2L5Q A;  2XDP A;  2OTL T;  5DY9 A;  4JRQ A;  2EIF A;  3MPU B;  2DXB A;  2EQM A;  3UF4 A;  1PC0 A;  4C5E A;  3CCE A;  4BE1 A;  3JV3 A;  3CPW P;  1VQN T;  2KNB B;  4A4G A;  4LE9 A;  4N4G A;  2FHD A;  2OJ2 A;  1GCQ C;  3FEO A;  4FYW B;  1AWW A;  4LN2 A;  1CSK A;  2I0N A;  2QXF A;  1X6B A;  2I2L A;  2KDS A;  4OML A;  5EG2 A;  3CME T;  4IIM A;  1Q82 C;  3LWI A;  1HSQ A;  1YI2 T;  1X2K A;  4M75 A;  4BE0 A;  2KT8 A;  4OMM A;  5IXF A;  2K3Y A;  5KYN A;  2FPD A;  1K8A C;  2KE9 A;  1VQO T;  1JXO A;  2QQB A;  3P8H A;  2W10 A;  3I55 Q;  3C94 A;  5GAO r;  4M78 F;  4QW2 A;  1VQ7 Q;  4BUG A;  4IUV A;  5FW9 A;  1OEB A;  5LJ5 g;  2D0N A;  1PD0 A;  2ZCF B;  4O5V A;  3V8K A;  2ZPI B;  2DF6 A;  3PE0 A;  3EHR A;  3M5A A;  3OSS C;  3JCM X;  1K0X A;  1M8M A;  2GQI A;  4MZM A;  3CCM T;  2HL3 A;  3DLL A;  2A7Y A;  4J9E A;  1QVG A;  4KGV B;  4HVW A;  1K9A A;  1NM7 A;  3EH2 A;  3EG3 A;  4PFP A;  4ZN3 A;  2Y4Y A;  4BE2 A;  1UGR B;  3CCR A;  1VQM T;  3E1S A;  2XHC A;  4IUT A;  4F7U A;  5A0G A;  4PJO D;  3CCL T;  2YUO A;  3VV0 A;  1Z9Q A;  1GBQ A;  2MK5 A;  2DE0 X;  4KH1 B;  2LT1 A;  2JMC A;  1Y71 A;  4FCY A;  1M90 U;  1OUL A;  2JVV A;  5LJ5 d;  1WIE A;  3VS7 A;  1JJ2 S;  3CC4 A;  2QYZ A;  1WXU A;  3M0R A;  1WPY A;  4R55 A;  4BDY A;  3BDU A;  3MEV A;  3CCJ T;  3TSZ A;  1O9S A;  1TG0 A;  3CCQ Q;  2KBT A;  4M75 G;  3OYH A;  4BI8 B;  4F14 A;  3OYF A;  1B34 B;  1N8R U;  2FZC B;  2JN0 A;  1KHC A;  1PKS A;  1VQ5 A;  1VQ8 A;  1I07 A;  4GLM A;  1YJN Q;  3DB3 A;  3A8L B;  3MP8 A;  2RQW A;  2OI3 A;  4V2S A;  2HD0 A;  2PUO B;  1BU1 A;  4DBF A;  2NWM A;  3BY7 A;  3LW5 E;  4CI0 C;  3V8L A;  4LDX A;  2X51 A;  2H3E B;  1M2O A;  2KGT A;  2AKL A;  1QKW A;  3REB B;  2DTO A;  5GAN 4;  4ELZ C;  2DL5 A;  3PTA A;  3MHX A;  4FW1 A;  1IXD A;  1NLO C;  2OTJ A;  4PKC C;  1C6V X;  4F7U G;  4D6W A;  2VXF A;  1SG5 A;  4A54 A;  4IIO A;  2M1H A;  3H41 A;  4C92 B;  1G2B A;  2VGN A;  2AT1 B;  2MWO A;  4RTT A;  4LDW A;  1YJW A;  2HCK A;  2VGM A;  4J9G A;  3UA7 A;  4QT7 A;  1TOV A;  2R58 A;  2XK0 A;  5I2M A;  5LJ3 e;  4LDU A;  4ORZ A;  4FL6 A;  2QQR A;  1ZLM A;  2RQT A;  3MP1 A;  5EC7 A;  4OB0 B;  6AT1 B;  4N4H A;  5KCH A;  4E7J A;  1WX6 A;  1X01 A;  3H8Z A;  3E9F A;  1YIT T;  2JW4 A;  4R0K A;  3CXC S;  3VS5 A;  4C92 E;  2RH2 A;  2K57 A;  1U1T A;  1VQL T;  1E6G A;  2DNU A;  2MOX A;  3H0F A;  5GAO q;  3HHT B;  5M9O A;  4EMH A;  5CKD A;  1BIB A;  1KHI A;  2F5T X;  2ZGW A;  5J39 A;  2DEQ A;  4M4Z A;  2V1Q A;  1RL2 A;  5A0L A;  5IHN A;  4FW2 A;  1Q82 R;  3EG2 A;  3OYB A;  2CP2 A;  1W4S A;  1WJR A;  2C0I A;  2COZ A;  1B7T A;  4M7A F;  1K9M C;  2OTL Q;  2P0Q A;  4KRT A;  4M75 C;  2FO0 A;  3VS4 A;  2O4X B;  1MMA A;  4JUV A;  3QG1 A;  1M3B A;  3VYH B;  5I11 A;  3CC2 A;  4EMG A;  2WSE E;  2A08 A;  1KK7 A;  1QCO A;  4KBM B;  1D0X A;  4FYY B;  1VQN Q;  5CK9 A;  3M0P A;  1UGP B;  1WNL A;  2COW A;  1W2B S;  1KQ1 A;  1R8O B;  3NMZ C;  2XI9 A;  1DJ7 B;  3G4S A;  2X4J A;  3V7C A;  4M7D F;  1FMV A;  2E12 A;  2D0Q B;  5A0D A;  5GMK j;  2RK1 A;  1MHN A;  3QUI A;  4C8Q D;  2DTI A;  4AMC A;  1TXQ A;  2QEX A;  2C0T A;  2K9G A;  3CME Q;  4NL2 A;  4R56 A;  4HT8 A;  3GP8 A;  2EQK A;  4PJO A;  1QVF S;  3GBQ A;  1YI2 Q;  1WJQ A;  3C0C A;  4N0A A;  2FZG B;  2F69 A;  4XK8 E;  3TCJ A;  1RLQ C;  5C6S A;  4LD9 K;  2O2O A;  2LNH B;  2D8H A;  3OYM A;  3EFO B;  4LDY A;  2P0K A;  1BI1 A;  2LVM A;  2A37 A;  3KXT A;  3RES A;  1I81 A;  5GAN h;  2O88 A;  3CME A;  5KYY A;  2QGF B;  4YTL A;  3LLR A;  4HT9 A;  2CUD A;  3G7Z A;  1YJ9 T;  2EGE A;  2PUK B;  4X9C A;  4JZ4 A;  2LC4 A;  2LZ6 B;  2EAY A;  5IHI A;  2DET A;  2X4W A;  2EFI A;  3EAE A;  4RMO A;  3L2U A;  4IUQ A;  1VQK A;  1VQO A;  2DA9 A;  3QDR B;  4PFO A;  2YLC A;  3EHQ A;  1ZSG A;  2EJF A;  5D6W A;  1Y57 A;  2X35 A;  3ZBD A;  1WZO A;  3JB9 J;  3CCL Q;  3G6E Q;  1BKB A;  2HSP A;  2ROL A;  3S3O A;  5HKC A;  3RIR A;  3OYJ A;  1FYN A;  2E3H A;  2VYT A;  1YWP A;  1ZX6 A;  1KJW A;  3CCM A;  4KUL A;  3CCJ Q;  4C0Z A;  4PJO G;  4AFQ C;  1LNX A;  4JPB W;  3F70 A;  3VRY A;  2QDY B;  1VQM A;  2DBK A;  3OYD A;  4PJO B;  1PRL C;  5GAN j;  4Z02 A;  2L3P A;  1PNJ A;  4F16 A;  4FU6 A;  2H8H A;  2J6K A;  4M7A E;  2J05 A;  5FRO A;  3JRZ A;  1WHL A;  2L2P A;  1N27 A;  1BYM A;  2NUP A;  1WI7 A;  4CC4 B;  2CZ7 B;  1OV3 A;  1M27 C;  1KC8 C;  1G3S A;  2BTT A;  1V1C A;  2JJ9 A;  4ANJ A;  3ZL7 C;  2E5Q A;  2VVK A;  2DZ9 A;  1K4U S;  1RAE B;  2EYW A;  1OI1 A;  2DPP B;  5LJ3 f;  1VQ4 Q;  4GY5 A;  2P0P A;  2MAM A;  3FJP A;  2MPX C;  4XTV A;  1N5Z A;  2EKH A;  4OMQ A;  1PSE A;  1VYV A;  4M77 B;  2CSQ A;  4Q5W A;  1VQ8 T;  2SEM A;  4DOV A;  3RKX A;  1JJ2 P;  4IUU A;  5DM7 R;  1YN8 A;  3GIB A;  2X4X A;  1RLP C;  1R0C B;  2DRM A;  3M9Q A;  5LJ5 f;  3I56 T;  2G3R A;  1Q7Y C;  4C0D C;  2L89 A;  4GBQ A;  1KIK A;  5FU6 C;  5A2Q E;  4RUG A;  2P4R A;  2FG0 A;  2H3J A;  2OAU A;  1AZE A;  2Y90 A;  3HFO A;  4FYV B;  5IN1 A;  3QBY A;  4QVZ A;  2BZX A;  1KSW A;  3O5Z A;  1FMW A;  2LMJ A;  5FLX E;  3A8M B;  4E6R A;  4M77 E;  1YHQ Q;  3PNW C;  2PVO B;  1JO8 A;  4FM4 B;  2DYB A;  4J7I A;  5KCO A;  3TU4 K;  2BKD N;  5GAM h;  1HK9 A;  1RAC B;  1BI0 A;  1YJW T;  4UC4 A;  2R57 A;  2RQV A;  4A53 A;  4HXJ A;  4M78 D;  4C8Q A;  1GBR A;  1M1K U;  2DVJ A;  4PK4 A;  3MEW A;  1WA7 A;  1U5S A;  2CZ6 B;  3VRZ A;  1MNE A;  2CP6 A;  1U3O A;  4RTW A;  4RTY A;  3VYG A;  1YIT A;  2DER A;  5GAN g;  3CMA A;  2YWW A;  1T3S A;  2RHI A;  5I21 A;  4MZP A;  1VQL A;  1I5L A;  3WXM B;  2FVU A;  4E7S A;  2K6D A;  3RKW A;  1GRI A;  1S72 Q;  3RMQ A;  4N0A C;  3EG0 A;  3OMG A;  3V7S A;  2DL4 A;  2ATC B;  1M90 C;  2DO3 A;  3VJP A;  3JCM h;  2RPN A;  5HY6 A;  2QDL A;  3JCM J;  1I4K 1;  2EWN A;  5J3B A;  3SB2 A;  3FC3 A;  2MWP A;  3GNG A;  4Z89 A;  1FXX A;  2BIV A;  3ZFJ A;  3BFM A;  1GCP A;  1GXI E;  4OMP A;  4ME7 A;  2IVW A;  3HSB A;  2JXB A;  1WXB A;  1YWO A;  1N8R C;  3V8J A;  5GAN d;  1BI2 A;  4MML A;  2RHZ A;  4JZ3 A;  2CT3 A;  2DMO A;  5GAM j;  1NJI U;  2DM1 A;  3CXC P;  3OYA A;  2DVE A;  3QYG B;  3VS1 A;  1Q81 U;  3CCE Q;  3CD6 T;  3TSW A;  5LL6 S;  2KAF A;  1JQQ A;  2XD0 A;  3GPL A;  3CBP A;  2RHU A;  2KYM A;  1I5O B;  4C8Q G;  1N9R A;  2DIG A;  3MP6 A;  3JCM P;  1M2V A;  3G4S T;  2ZZD A;  4L59 A;  4OMO A;  1XOV A;  1OU8 A;  4TVR A;  1JEG A;  4E2F B;  3L2V A;  2EJG A;  2CH4 W;  2V8I A;  1IRE B;  1T0H A;  2QG9 B;  1BIA A;  1MMG A;  3G1J A;  2DEU A;  2V8K A;  3X28 B;  3MJX A;  3NGP A;  2QEX T;  2KRM A;  2JT4 A;  1OOT A;  5GJV B;  1D1C A;  2A0F B;  3PFS A;  1SEM A;  2HKN A;  1NE8 A;  4GLK A;  1W2B P;  2KY9 A;  4OVA A;  2FZK B;  2HAX A;  1IZ6 A; 
#chains in the Genus database with same CATH homology
 2J06 A;  3H0H A;  1ABQ A;  5IHK A;  2LQW A;  2DIL A;  1WLP B;  3I9Q A;  1NLO C;  2X3W D;  1PWT A;  2FPE A;  4IIO A;  1WYX A;  3I35 A;  2YUQ A;  3H41 A;  1G2B A;  1NEG A;  2O9S A;  5IH2 A;  4RTT A;  1Y0M A;  4FSS A;  2DL3 A;  2JM9 A;  1M3A A;  3M0Q A;  2HCK A;  1K1Z A;  4J9G A;  3I5R A;  3UA7 A;  4QT7 A;  1GFD A;  5I22 A;  1RUW A;  3RBB B;  1AWX A;  2XMF A;  2EQI A;  4ZNX A;  4ORZ A;  1VYT A;  2K2M A;  1H8K A;  4J9D A;  1ZUK A;  1ZLM A;  2RQT A;  4J9B A;  4DEY A;  4RTV A;  2JS0 A;  5EC7 A;  2J6F A;  5L23 A;  4AG2 C;  1SRM A;  1WFW A;  2A28 A;  1WX6 A;  4F17 A;  1X2Q A;  2JW4 A;  4R0K A;  3VS5 A;  3IQL A;  2IIM A;  3RNJ A;  1E6G A;  2DNU A;  4J9H A;  2MOX A;  2LQN A;  3H0F A;  2YSQ A;  2YDL A;  1E6H A;  4D8D A;  2A36 A;  5GJW B;  2NUZ A;  3I5S A;  4M4Z A;  4OMN A;  4Z8A A;  1UHF A;  1UJ0 A;  2V1Q A;  2LJ1 A;  4CC3 A;  2PNI A;  4ESR A;  1NLP C;  2X3X D;  5IHN A;  3EG2 A;  1NEB A;  1AEY A;  1B07 A;  2CH4 A;  2C0I A;  4JJB A;  1GCQ A;  1H3H A;  2RQU A;  4AFS C;  4KRT A;  2ESW A;  2PZ1 A;  1ZUY A;  2DJQ A;  2FO0 A;  3VS4 A;  4AG1 C;  3VS0 A;  1AWJ A;  2GNC A;  1M3B A;  5I11 A;  4Y92 A;  1AD5 A;  2A08 A;  3M0P A;  2HDA A;  4AFU C;  2VKN A;  3NMZ C;  2F2X A;  2GGR A;  2RNA A;  3VS3 A;  4WCI A;  2C0O A;  1WXT A;  1WDX A;  3CQT A;  1X27 A;  2L3Q A;  1AZG B;  4JJD A;  2LCS A;  1UG1 A;  1MV3 A;  1RI9 A;  3EGU A;  1PKT A;  1X6G A;  2C0T A;  2K9G A;  3SEM A;  2DRK A;  2JM8 A;  1UGV A;  1UUE A;  2YUN A;  3GBQ A;  3PVL A;  1E7O A;  1PRM C;  2O9V A;  3C0C A;  1CKB A;  1RLQ C;  2O2O A;  2LNH B;  4D8K A;  1HJD A;  2D8H A;  1QKX A;  2AZS A;  1SPK A;  1A0N B;  2A37 A;  2O88 A;  4RTX A;  1QCF A;  1I0C A;  1NYG A;  2J7I A;  3NHN A;  4HVU A;  2RN8 A;  1ARK A;  2CUD A;  2KXD A;  2EGE A;  1BB9 A;  4JZ4 A;  2V1R A;  2LZ6 B;  1Z9Z A;  3QWX X;  2EGC A;  5IHI A;  1AWO A;  1TUD A;  4EIK A;  3LH5 A;  2DA9 A;  2YT6 A;  3EHQ A;  1X69 A;  1ZSG A;  2L0A A;  3R6N A;  1YNZ A;  1Y57 A;  2DL8 A;  2VWF A;  2KEA A;  4RTU A;  1OPK A;  1B3Q A;  2HSP A;  2ROL A;  4J9F A;  1NG2 A;  3PVQ A;  1FYN A;  3A98 A;  2F2W A;  1YWP A;  1ZX6 A;  1KJW A;  2RMO A;  5HCK A;  4LNP A;  1ZBJ A;  2ABL A;  3TVT A;  4AFQ C;  4JPB W;  3THK A;  3VRY A;  2YUP A;  1T0J A;  2DBK A;  2J6O A;  2ECZ A;  2JMA A;  1PRL C;  4K11 A;  1MV0 B;  2L3P A;  2PTK A;  1PNJ A;  2KR3 A;  1AOJ A;  4F16 A;  2H8H A;  1YP5 A;  1G83 A;  1UTI A;  2J6K A;  3REA B;  2DX1 A;  3EG1 A;  3QWY A;  1LCK A;  2J05 A;  2M0Y A;  2L2P A;  3H0I A;  4LUE A;  2HBW A;  1WI7 A;  1JU5 C;  4CC4 B;  1VA7 A;  4X1V A;  2RF0 A;  1OV3 A;  1M27 C;  1S1N A;  2W0Z A;  1FMK A;  2BTT A;  1BK2 A;  1V1C A;  2EYX A;  2KRS A;  3ZL7 C;  1OPL A;  2VVK A;  1SHG A;  1K4U S;  2EYW A;  2AKK A;  2AK5 A;  2KRN A;  1GL5 A;  1QLY A;  2KT1 A;  2DBM A;  5FWC A;  3M0U A;  2CRE A;  2AZV A;  2CDT A;  1MUZ A;  1N5Z A;  2EKH A;  4OMQ A;  1AVZ C;  1EFN A;  2JTE A;  2ROT A;  2L3S A;  2FEI A;  1VYV A;  1QWE A;  2D1X A;  2CSQ A;  2SEM A;  2K3B A;  1T3L A;  5ECA A;  2ED0 A;  2FRY A;  3UF4 A;  1J3T A;  2K79 A;  1YN8 A;  1M3C A;  1RLP C;  3KFV A;  2DRM A;  3M0S A;  3ULR B;  1W6X A;  3JV3 A;  2KNB B;  4LE9 A;  4GBQ A;  1KIK A;  3VS6 A;  3SHW A;  2OJ2 A;  4RUG A;  2P4R A;  2CT4 A;  2FG0 A;  1GCQ C;  1AZE A;  1AWW A;  1TUC A;  4LN2 A;  1UDL A;  3U23 A;  1CSK A;  2I0N A;  2MIO A;  1X6B A;  1GFC A;  4JJC A;  2BZX A;  2F2V A;  1KSW A;  3O5Z A;  2LMJ A;  4E6R A;  4OML A;  1BBZ A;  1JO8 A;  2E5K A;  2LJ3 A;  2DYB A;  1UE9 A;  4IIM A;  2EYZ A;  2RQR A;  1HSQ A;  4HCK A;  1X2K A;  4HVV A;  2RQV A;  4HXJ A;  1UJY A;  1SRL A;  1GBR A;  2DL7 A;  1QWF A;  2KT8 A;  2DVJ A;  4OMM A;  1IO6 A;  4LUD A;  2GTO A;  5IXF A;  4AFZ C;  1WA7 A;  1U5S A;  4RTZ A;  1UEC A;  3VRZ A;  2FPD A;  2BZ8 A;  2MCN A;  2KE9 A;  1U3O A;  1UFF A;  1JXO A;  1SSH A;  2ED1 A;  2LP5 A;  4RTW A;  4RTY A;  1K0S A;  2W10 A;  1KFZ A;  2CSI A;  1T3S A;  1JXM A;  5FW9 A;  1OEB A;  3UA6 A;  2D0N A;  2K6D A;  1GRI A;  1X43 A;  4DEX A;  3EG0 A;  2DF6 A;  2DL4 A;  3PE0 A;  3EHR A;  2FPF A;  2EPD A;  1SHF A;  1YCS B;  2RPN A;  2QDL A;  1K0X A;  1M8M A;  1HD3 A;  2GQI A;  1I1J A;  4Z89 A;  1UHC A;  4J9E A;  1K9A A;  1NM7 A;  4HVW A;  3EG3 A;  3UAT A;  1GCP A;  1U06 A;  2G6F X;  2KXC A;  5FWB A;  2O31 A;  4OMP A;  5IXB A;  2JXB A;  1WXB A;  1YWO A;  1ABO A;  2YUO A;  2EVR A;  1Z9Q A;  1GBQ A;  2BZY A;  2DE0 X;  2GBQ A;  2EGA A;  4JZ3 A;  2CT3 A;  2DMO A;  2JMC A;  2DM1 A;  1W70 A;  1NYF A;  1ZUU A;  2HEQ A;  1WIE A;  3VS7 A;  3NPF A;  3VS1 A;  1M30 A;  2EBP A;  1WXU A;  3M0R A;  2SRC A;  2K7A A;  3TSW A;  1JQQ A;  3TSZ A;  4Z88 A;  1H92 A;  1TG0 A;  2KBT A;  2KYM A;  2CUB A;  1VYU A;  3FJ5 A;  4F14 A;  2ENM A;  4OMO A;  1XOV A;  2DLP A;  1JEG A;  1PKS A;  4CC7 A;  4A63 B;  1I07 A;  2CH4 W;  4CC2 A;  1T0H A;  4GLM A;  3M0T A;  2EYY A;  2RQW A;  3NGP A;  2LX7 A;  2OI3 A;  2KRM A;  2GTJ A;  4J9C A;  2JT4 A;  2B86 A;  1BU1 A;  2KRO A;  2NWM A;  2FRW A;  3VS2 A;  1OOT A;  5GJV B;  2KYB A;  1K76 A;  2LJ0 A;  2OAW A;  2EW3 A;  1SEM A;  2JS2 A;  2KGT A;  2AKL A;  1QKW A;  1CKA A;  3REB B;  4J9I A;  1PHT A;  2M51 A;  1W1F A;  2D8J A;  2DL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...