2JTEA

Third sh3 domain of cd2ap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CD2-associated protein
publication title The high resolution NMR structure of the third SH3 domain of CD2AP.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jteA00
2BTTA 1WI7A 4F17A 4JJCA 4LNPA 1VA7A 2EYZA 2AZSA 1NEGA 2DVJA 1X69A 1KIKA 1GBQA 3QWYA 1GL5A 1NYGA 2CSQA 2KNBB 3ULRB 1BK2A 4OMQA 1K0XA 3VS7A 1VYTA 1HSQA 4AFUC 2YUPA 4J9FA 2LCSA 2KXDA 1ZUYA 2FPFA 2JMAA 4J9BA 4LUEA 4Z89A 1M8MA 2C0OA 1S1NA 4OMOA 2EKHA 2C0TA 2DA9A 2LP5A 2QDLA 4ESRA 2AZVA 1UECA 2L3PA 1X2KA 4J9DA 2RPNA 1SSHA 2KYBA 2J7IA 4K11A 1RI9A 4X1VA 2FPEA 4HVWA 2RQUA 1Y0MA 2DBKA 1MUZA 1NLPC 2KEAA 2VWFA 1T3SA 2CUBA 3H41A 4HVUA 1UGVA 4AG2C 2KT8A 1K0SA 2GTJA 2LJ0A 5EC7A 2L0AA 1K9AA 1UDLA 2SEMA 4J9EA 4E6RA 2AKKA 1X6BA 1UJ0A 2JTEA 2D1XA 1W6XA 1GCPA 1YNZA 2NWMA 4Z88A 3U23A 1X6GA 4AFQC 3M0RA 1SHGA 2DX1A 2OAWA 3KFVA 1I07A 1HJDA 1ABQA 2ROLA 2HEQA 2L2PA 4D8DA 2ESWA 4HVVA 2KE9A 4J9IA 1YCSB 5GJVB 1UE9A 3LH5A 1I0CA 2JS0A 2O2OA 1QKWA 3QWXX 3R6NA 1CSKA 1PNJA 2JXBA 3VS5A 5GJWB 2CT3A 2LMJA 2DRMA 2L3QA 1T3LA 4KRTA 1M30A 4Y92A 1WFWA 5IHKA 1CKAA 4GLMA 1CKBA 4RTXA 4CC4B 5L23A 2EGAA 3EHRA 1GRIA 4LE9A 1RLQC 2GGRA 1WXUA 1K1ZA 3VS6A 1UUEA 1YWPA 1VYUA 2K79A 2PNIA 3CQTA 4F14A 3PVLA 1AWOA 3VS4A 4J9HA 2SRCA 1MV0B 1JXMA 3M0UA 3SHWA 4OMLA 4FSSA 3ZL7C 3REBB 4OMNA 1WIEA 3UA6A 2DNUA 2LNHB 4AFSC 1FMKA 2MCNA 2L3SA 2EPDA 5I22A 1X43A 2K9GA 1AVZC 2J6OA 2M51A 3NGPA 1FYNA 1ZLMA 2D8JA 1TG0A 3EGUA 1QWEA 2LJ1A 2KROA 1OPKA 1VYVA 5IH2A 1GCQC 2GNCA 2HBWA 2DE0X 1AOJA 4ORZA 5IHIA 2ENMA 1E7OA 3I5RA 2B86A 2K7AA 2RQTA 1T0HA 3SEMA 2CT4A 2J05A 2DF6A 4QT7A 1NLOC 2W0ZA 2O9VA 2KXCA 2RQVA 1ZUUA 1AZEA 2YUNA 2FO0A 3M0SA 3NPFA 1KFZA 3I9QA 1X2QA 4R0KA 2RF0A 1JEGA 1BBZA 3I35A 3H0FA 1JU5C 1H3HA 1YWOA 1BB9A 1LCKA 1Y57A 2DBMA 2HCKA 1WXTA 2KRMA 2DRKA 1JQQA 4OMPA 3VS1A 1ZSGA 2C0IA 5IHNA 1RUWA 2EYYA 1AZGB 4JJBA 4RUGA 2KGTA 3H0IA 2OI3A 4CC3A 2CSIA 3VS3A 1IO6A 2KYMA 1WLPB 2OJ2A 2DJQA 4RTUA 4LN2A 2A28A 3EG2A 1M3AA 1PKSA 2MIOA 1SRMA 2CDTA 1KSWA 1AWWA 1AWXA 2JS2A 4JJDA 4IIMA 1YP5A 1OV3A 1AEYA 2BZ8A 3VRYA 2EQIA 2ABLA 3NHNA 3H0HA 1QLYA 4OMMA 3VS0A 2JM9A 2BZXA 4JZ4A 2FG0A 4HCKA 1UFFA 1JXOA 3VS2A 1OPLA 1A0NB 2FPDA 2RN8A 1GFDA 1U06A 2EBPA 2DL7A 4A63B 4Z8AA 1TUDA 2EYXA 2DL5A 2X3WD 1G83A 1H92A 2A37A 1V1CA 2DL3A 2EW3A 2KBTA 2YUQA 1UTIA 3FJ5A 2RQWA 1K4US 4ZNXA 5FWBA 2LZ6B 1PHTA 4AFZC 1UJYA 2GBQA 1UG1A 1E6HA 4RTYA 1E6GA 1NEBA 2ECZA 4JZ3A 2BZYA 3M0TA 4AG1C 2AK5A 2DLPA 3JV3A 3UA7A 5IXFA 2D8HA 4F16A 2K6DA 2IIMA 3EHQA 5FW9A 2DMOA 1Z9ZA 1OOTA 1ABOA 2J6KA 2W10A 3RNJA 2K2MA 1J3TA 3I5SA 4D8KA 1WXBA 1PWTA 2PZ1A 5FWCA 4J9GA 2KRNA 3TVTA 1SEMA 1W70A 2CREA 1NM7A 5I11A 2JMCA 2JW4A 2XMFA 2ROTA 2K3BA 1N5ZA 2O88A 2J06A 4M4ZA 1HD3A 2AKLA 2LQNA 1SRLA 2EYWA 2DYBA 2YSQA 1WX6A 3C0CA 4IIOA 1GBRA 1OEBA 3GBQA 2ED1A 1QCFA 2RMOA 2FRWA 4RTZA 2JT4A 4EIKA 1M27C 1B07A 1JO8A 1M3BA 2RQRA 2HDAA 4CC2A 1PRMC 2E5KA 2D0NA 1G2BA 1BU1A 1K76A 2FEIA 2J6FA 4HXJA 1H8KA 1RLPC 5HCKA 4WCIA 2VVKA 1UHCA 4DEXA 1U3OA 2A36A 2KRSA 3VRZA 1TUCA 2HSPA 2V1RA 2YDLA 3M0PA 1T0JA 2DL4A 2CUDA 1QKXA 2H8HA 1WYXA 2KT1A 2YUOA 1X27A 3RBBB 2F2VA 2CH4A 4J9CA 1PKTA 1XOVA 1B3QA 1SPKA 1NG2A 3THKA 4GBQA 2LJ3A 1MV3A 1YN8A 2DM1A 4RTWA 2DILA 1UHFA 2ED0A 3NMZC 2P4RA 3EG0A 1KJWA 3M0QA 2MOXA 2F2WA 2CH4W 1AWJA 2M0YA 2RNAA 2VKNA 5ECAA 1ARKA 2V1QA 4CC7A 2FRYA 1EFNA 1ZX6A 3UF4A 2A08A 1QWFA 5IXBA 1GCQA 1NYFA 2F2XA 3EG1A 3TSWA 2JM8A 4LUDA 4DEYA 2EGCA 1AD5A 3EG3A 3REAB 4RTTA 2GQIA 2YT6A 2PTKA 1ZBJA 1M3CA 2NUZA 2O9SA 4RTVA 1U5SA 2GTOA 1WDXA 1ZUKA 2LQWA 3PE0A 1Z9QA 1W1FA 1SHFA 1WA7A 2DL8A 3UATA 2I0NA 3O5ZA 3A98A 3IQLA 1I1JA 2G6FX 2LX7A 2O31A 3TSZA 1GFCA 3PVQA 2KR3A 2EGEA 2X3XD 4JPBW 2EVRA 1PRLC
chains in the Genus database with same CATH superfamily
3A8LB 1VA7A 1AT1B 4J7FA 2DVJA 4FYXB 3QWYA 2KNBB 5J26A 4OMQA 3CEYA 4J9FA 2QXFA 3I55T 2WSFE 1JJ2S 4FT2A 4Z89A 2C0OA 4PJOB 5GAMd 4OMOA 2PQWA 2DA9A 3CCEA 2LP5A 5GAOm 2DYIA 1O9SA 1UECA 3OYNA 1VOMA 3EGXB 1N8RR 4J9DA 2KY9A 3PFSA 2V26A 3HRUA 3EFOB 1U1SA 2KYBA 4C0ZA 2J7IA 4K11A 4O6JA 1VQ9T 4BI4A 4R56A 4IUUA 4PNOA 4GLKA 4XTUA 2WSCE 2HKNA 1ZA1B 2E10A 2CUBA 4F04B 1ZA2B 2KT8A 4ZGJB 5KH6A 2D6FA 5KYNA 2E41A 1K9AA 4E6RA 2CP5A 2JTFA 1UJ0A 1W6XA 2M9UA 2EQJA 5CKEA 4C0DB 1YJ9Q 2NWMA 3GP8A 3ASKA 2LT4A 3CBPA 1SHGA 3KFVA 4ZGDB 3OS0A 1Y96B 2O4XA 1ABQA 3P8HA 2L2PA 4PJLA 5LJ3j 2HD0A 1UEBA 5GJVB 1M1KR 1MMAA 5GAMg 2JS0A 4BUGA 2OAUA 1YJ9A 3HRSA 2MK5A 1CSKA 4M75F 1EIFA 1Q86C 3ZEHA 1YHQQ 2L3QA 2COWA 4Y92A 4HKEA 3GNFB 2EGAA 4FW1A 2LRQA 1WXUA 1K9MU 4KT0E 3VS6A 3I56Q 4C8QF 1VQMQ 1IXDA 2RM4A 1BCOA 2X4YA 2LVMA 1JXMA 1WIEA 1QVFP 2ZZDA 2DNUA 3EH1A 5GAN2 4AFSC 4LDVA 3I56A 1VQMA 2EWNA 2J6OA 3NGPA 1Y71A 3RMSA 1QWEA 2HNIA 2OTLT 2GNCA 2XI9A 1JJ2A 2DE0X 2QEXQ 3L2RA 3HHTB 2GCXA 2R5MA 3ER0A 3LGFA 4PJOD 2XDDA 2B86A 3TREA 1T0HA 2DF6A 4QT7A 1NLOC 2O9VA 3FC3A 2KXCA 4RG8A 2YRVA 2DXCA 1M5Q1 2K5FA 2E64A 3NPFA 4BDYA 2JNGA 1FMVA 3MJXA 4FW2A 3LX7A 1KFZA 3RESA 4MDXA 2QEXA 4R0KA 1MMNA 1JEGA 4N0AC 1M9SA 3OYAA 1YJWQ 1H3HA 1BB9A 1LCKA 1Y57A 3CCJT 3HTRA 3X26B 3HSBA 2QG9B 3G1JA 2QGFB 1VQ4T 4OMPA 3VS1A 2C0IA 1VQLQ 5IHNA 3X24B 3M59A 4EDUA 1PD0A 2KGTA 3SWNA 1WHMA 4CC3A 2HL5C 3M4GA 1IO6A 1QMCA 4PFOA 2OJ2A 3OS2A 3EG2A 1YJWA 1KD1U 1M3AA 2RJCA 3CCMT 3OMCA 1KSWA 4OB1B 4PJOG 1N6AA 4LXCA 4IIMA 3OYEA 1VQLA 4N4IA 2LC4A 2BZ8A 4B9WA 2EQIA 2ABLA 4IURA 4HCKA 4F7UB 5CCAA 1X75C 1M2OA 3EG9B 2JUFA 2K4YA 3V8LA 4E7IA 3OYIA 1VQ8T 1YBYA 4Z8AA 5CQXA 2LTOA 2KSSA 1K73R 5GAN7 2MWPA 1G83A 1H92A 1M90U 4WF2A 3GOXA 1Y7XA 2RQWA 4ZNXA 1JRIA 3AT1B 3RIRA 1WQ7A 3BE3A 3WVDB 3CMAT 2NUPB 3OYGA 1UJYA 1QP3A 5C0MA 1E6HA 2F69A 4PJOE 1IZ6A 1ZHIA 4XTZA 4C5HA 2BZYA 2M02A 3J80E 2JVVA 4PFPA 4ME7A 3ZFJA 2ZPIB 4QKUA 1PC0A 4JLGA 2IIMA 2IG0A 5FLXE 4PJOA 2MMPA 2J6KA 2ATCB 3EGXA 2K2MA 5FU7B 2P4TA 2VUBA 4Q5WA 3I5SA 3EFOA 5J39A 3FEOA 2KRNA 1V29B 2IVWA 4FT4A 1NM7A 5I11A 2ROTA 1TTHB 1BCMA 1N5ZA 2O88A 2OTJT 4M4ZA 2LT1A 4DOVA 1HD3A 2AKLA 4C0FA 4D6WA 4IKFA 2DYBA 1OU9A 3C0CA 4IIOA 1FMWA 1OEBA 3GBQA 1QCFA 5GAOn 5CQYA 3V7RA 2FRWA 4PL6A 3VU3C 1JJ2P 3G7ZA 3H9NA 2NLUA 1M3BA 2B8AA 4RCCA 5D6WA 3PGGA 1Y96A 1BU1A 2J6FA 3DKMA 1H8KA 2FHDA 3CD6T 4XTYA 1RLPC 1KC8C 4OB2B 4XU1A 1UHCA 4LD9K 2P0KA 2D0QB 1VQPQ 3RDVA 3FRNA 3C12A 3CCLT 5LJ5h 1T0JA 1VQNQ 2DL4A 2CUDA 2H8HA 2KT1A 2QA4T 2QGGA 3JCMf 2MWOA 2YXYA 2DTHA 4J9CA 3OSVA 2XKOC 3OYKA 1B3QA 3ME9A 3WVEB 1YN8A 2DM1A 1VQPA 4M77B 2ED0A 3FB9A 3VYHB 2P4RA 3EG0A 3M0QA 2CH4W 2RNAA 1VQNA 3D7SB 3JB9F 4E7HA 5ECAA 4CC7A 1NPPA 4C0GA 4M7DC 3CCRT 2BE7D 3UF4A 3MEVA 5IXBA 2DFUA 3TSWA 5LJ5d 5LJ3f 2JM8A 3OYMA 4LUDA 3GNGA 4DEYA 2DXBA 4MMLA 5HY6A 3SWNC 2EJ9A 4DQ2A 3REAB 1N27A 4RTTA 1YI2T 1YJNT 3JCMW 2PTKA 1M3CA 2NUZA 1VQ7A 3MPUB 1WDXA 1B7TA 5M9OA 1KQ1A 5DY9A 4F7UG 3UATA 2XD0A 3O5ZA 3OBYA 4JRIA 1Q86U 2O31A 2YHTA 3L2QA 1YIJQ 2KR3A 2X3XD 5KE2A 3MP1A 1VIFA 4VUBA 1SG5A 1WI7A 1I81A 4LNPA 4F17A 2DVEA 4BY6C 4C5IA 3S3NA 3GPLA 3PIPA 1X6OA 3J7AF 3GF5A 2QK0A 1BK2A 1I4K1 2E5QA 3QJYA 1BI3A 5KYXB 3VS7A 3OA6A 1IRXA 2M0OA 1HSQA 4FIBA 4AFUC 4E7LA 2LCSA 5GANh 5D7UA 2YRDA 3E19A 2FPFA 3JCMc 4J9BA 4L5GA 5LJ5g 1YCYA 2VASA 3INZA 1M8MA 2H3EB 4MZTA 1K8AR 2QDLA 2AT1B 2AZVA 4ELZC 2L3PA 2XHCA 2FB7A 5GMKl 4F7UA 1D0ZA 4P5NA 1OI1A 3CC7T 2DETA 3EG9A 4MDWA 2VB6A 2XU8A 1RAIB 4BD3A 2RQUA 2DBKA 4X9CA 2KEAA 2VWFA 3QHSA 4E7JA 3CCET 3CC4Q 1QVPA 1IREB 3A1PA 2NUPA 2XIDA 3HKSA 2GQVA 5EC7A 4KULA 2SEMA 3JCMh 2AKKA 3QO3A 4DBHA 2GF7A 2D1XA 2K3XA 1OULA 1BIAA 4M7DB 4Z88A 4BE0A 3M0RA 2FZKB 2DX1A 3CC4A 4C0DC 2OX7A 3SD4A 1BI1A 4D8DA 2ESWA 4QVCA 2KE9A 4J9IA 1U1TA 1RAGB 1I0CA 4OMFB 3UPUA 2P0PA 1PNJA 2E3HA 2CT3A 2LMJA 5LJ3h 2VC8A 3X28B 2DRMA 2FZGB 3JCMd 1M30A 3H8ZA 2RK2A 2QYZA 1CKAA 4RTXA 1O75A 5L23A 3JAME 3EHRA 4LE9A 2PUKB 3V7CA 2KDSA 2GGRA 2PUOB 1VQOT 3GIBA 2HKQB 4F14A 2CZ0B 1AWOA 4J9HA 2RK1A 4N0AA 1I5OB 3TU4K 2PVDB 2DEQA 1BI0A 2Y4XA 5GANg 2CP0A 1MV0B 1YJ9T 3CCUQ 5AT1B 3ZL7C 3CCQQ 4PKCC 1KQ2A 3VKIA 4WTOB 2X4XA 2YRCA 3CMEQ 1WQWA 5LJ3d 2MCNA 5HK0A 2EPDA 3NFCA 1ZSZB 1XJWB 1X43A 2K9GA 1UGPB 2M51A 1FYNA 2JN0A 3EGUA 4C92B 1S72T 5AYFA 2RD1A 3TEEA 5HKCA 3CCQA 1HK9A 4IUVA 4BE1A 4HCBA 4DBRA 5DLOA 1AOJA 2E65A 2CP7A 1Q81C 4BDZA 1E7OA 2K7AA 3SEMA 3JB9I 4M77E 3I56T 2FO0A 2V8JA 1VQMT 3E9GA 1RL2A 3JCMg 2YLBA 4ATOA 5GMKi 5CAIA 3QYHB 4C92F 4M77A 3QDRB 3I35A 1FWZA 5CIUA 4BACA 2DBMA 1XQHA 2AIRB 1ZSGA 3CPFA 1RUWA 3RR6A 1K9MR 3OYYA 3DLMA 3P8DA 1QVGS 2OI3A 4ELYC 1C0MA 1WLPB 4KH0B 1LNXA 2K5LA 4RTUA 2DK3A 3VV0A 4M75B 3MCAB 1SRMA 2PU9B 3CCSQ 1OQKA 1AWWA 1ZBXA 2JS2A 4JJDA 8ATCB 2KAFA 2NUTB 1KC8U 3RKYA 3G6EQ 5IAYA 3C4SA 3NHNA 2E3IA 4IUQA 4C8QB 4PFZA 1VQ6Q 1KK7A 1OPLA 3ZBDA 2LQKA 7AT1B 2R5AA 2FPDA 3CCSA 2V8IA 2EBPA 3MEAA 4A4GA 1IGQA 4N4GA 4ANJA 5KYUB 4KBMB 5HK3A 1TXQA 2DL5A 2RJFA 3G6EA 2A37A 2YUQA 2QAZA 1YFNA 1UTIA 3FJ5A 1K4US 5CVIA 1VQ6A 5FWBA 1VQKQ 5KYWA 3JCMP 3OW2P 4AFZC 6AT1B 3H6ZA 5KYXA 2X35A 2WSEE 5I2SA 3EGDB 4KGZB 3JV3A 5IXFA 5IT9E 2D8HA 1YHQA 1W2BS 1D0YA 4EMKC 3F70A 3VYGA 2K6DA 1HYOA 4XK8E 1VQKA 1G3TA 1Z9ZA 1OOTA 1ABOA 5A0DA 1KHCA 3RNJA 2CGHA 3GLXA 4OB0B 4D8KA 1LPLA 1KD1R 1MMGA 4Y28E 3TVTA 1W70A 1D3BB 5FU7C 4JS4A 1TU0B 2J06A 4DA4A 4Y91A 1WX6A 4XTWA 4M7DE 4RCBA 1BYMA 2RMOA 1EZZB 3KBGA 4KGXB 3V8KA 4Z02A 4J6YA 1OZ2A 3CXCS 2KI7A 1WNLA 3L1AA 1B07A 4J5YA 1M90R 4M7DA 2RQRA 2HDAA 1TH7A 2H3JA 2F5TX 3UWNA 4CC2A 1NJIC 1PRMC 2KQWA 4KUDK 2CP2A 1G2BA 1QVGA 3L2UA 3UDCA 5HCKA 1N9RA 2CKKA 2DXTA 3OY9A 3J81E 3M0PA 2QQSA 3MP8A 1G8XA 4YTLA 2Y4YA 2QTXA 4HT9A 3Q1JA 4IUPA 2XICA 1M2VB 5J3BA 4RTWA 4HT8A 1RAFB 2KK4A 4QW2A 5LL6S 1WHGA 3QZ5B 1KJWA 1D09B 1AWJA 1PG5B 2DO3A 4J7IA 4M77C 4C92E 1ARKA 2FRYA 4BI3A 4QVZA 2PVGB 1IB8A 3SDZA 4RKUE 1Q82C 1GCQA 2F2XA 3EG1A 2YLCA 3QPHA 2EGCA 2RI3A 1HXDA 4EMKB 1AD5A 3JSCA 2OTLQ 4OF1A 2ZPBB 2GQIA 1W2BA 3FLGA 3OYJA 2EFIA 1ZBJA 3M57A 1QP2A 4RTVA 5FRNA 2RI2A 2GTOA 3DB4A 1Q7YC 4XQ3A 1Z9QA 3NTIA 4BB7A 2DIGA 4FYYB 1R8OB 5DLQE 2RH2A 3KUFA 1ZQ1A 3OYCA 2EGEA 2E6NA 1RI0A 4BI8B 5GAOr 4DBFA 2BTTA 3CCJQ 3WXMB 4JJCA 2L3RA 1VQ7T 2EYZA 1WHKA 2AZSA 1NEGA 5D6XA 1KIKA 4M75E 3VUBA 1NYGA 3MEWA 3JB9H 5GAN5 2CSQA 4KUIA 3FIFA 3E2UA 3OYHA 1K0XA 5CKHA 5GMKe 1IHVA 1C1AA 3CXCA 3CCJA 4M75A 3OSSC 1WGSA 2KXDA 1MGQA 2DZCA 4M7AB 5D6YA 4C8QE 2NUTA 1V76A 4M78F 3OYLA 2YWWA 2VV5A 3BY7A 2VGNA 1MHNA 1R77A 1GXIE 5GMKm 1Q81U 4C8QA 4QQ6A 1SSHA 3LLRA 3CCVT 1RI9A 1LVKA 3JRZA 4X1VA 2BUDA 1TWBA 4PLLA 5KYUA 4M7AF 1Y0MA 3C94A 3AHUA 1MUZA 2MAMA 3KXTA 2HQEA 4J8OA 1NZ9A 2MYSA 5CKDA 1Q86R 4FM4B 1UGVA 2ZPEB 3RKWA 1K0SA 3R6OA 4PLIA 2HMAA 2RO0A 2L0AA 4J9EA 4JRPA 1JBMA 2R58A 4UC4A 1GCPA 3EGDA 3OYFA 2LCLA 1G3WA 5KCHA 3U23A 1N8RC 1X6GA 4AFQC 2DD4A 2EJGA 2OAWA 2HQXA 1KQSS 1SSFA 1B34B 4XTVA 2HEQA 5DM7R 2DTOA 4FYVB 4HVVA 5KCOA 1IGUA 3LH5A 1QKWA 3M9QA 3CC2Q 3R6NA 2JXBA 3VS5A 5C6SA 1UGRB 3MEUA 4KRTA 3N5BB 2COZA 1WHLA 1BI2A 5IHKA 4GLMA 4FYWB 4FSXA 3CBOA 5GAMe 3QSUA 1SF9A 2PNIA 1PM3A 3PVLA 3CC2A 2SRCA 2GFUA 2E1HA 3SHWA 1MMDA 2ZPHB 3LWHA 3REBB 4OMNA 1W2BP 3OBWA 1M1KC 1DJ7B 3PMTA 3L2VA 1FMKA 5GAMf 2L3SA 1XNIA 1AVZC 4C5GA 1NJIR 2P84A 3CD6Q 1YIJA 2LJ1A 1H3ZA 1OPKA 1WHHA 1H641 5IH2A 1GCQC 1ZSZC 1WPYA 5FU6C 2VGMA 4ORZA 4C92C 1YITT 2ENMA 3I5RA 1NBEB 2RQTA 4LDXA 2CT4A 2J05A 2QA4Q 2W0ZA 3MKDA 8AT1B 2RQVA 3HP9A 3META 3TCJA 3A8HB 4JRQA 4XAXB 5A0GA 3O8VA 3I9QA 1M2VA 1U8RA 3LYIA 2QDYB 1WJQA 2RF0A 3CCQT 3H0FA 3X25B 2FL7A 2HCKA 2FYKA 2LNVA 4O5VA 1WXTA 3JB9D 2KRMA 2QA4A 2RI5A 2DRKA 5CR2A 3G4SQ 4A54A 3LGLA 4EMGA 1AZGB 3QDFA 4JJBA 3HFOA 4E2FB 3H0IA 2KYMA 3LWIA 2DJQA 1TSFA 4LN2A 3URGA 1NJIU 2A28A 1BIBA 4M77D 4EMKA 2LDMA 2MIOA 2CDTA 1YI2Q 1YJNQ 1AWXA 2E12A 3T9NA 1UGQB 3G4SA 2IPOB 1QCNA 1YP5A 4M75C 1KQSA 2FVUA 3G71Q 1G3YA 3VRYA 5GAOp 4ZTFA 2K57A 4KH1B 4OMMA 3VS0A 4DBQA 2FG0A 1JXOA 3VS2A 2VXFA 2CP3A 4M78E 2RN8A 5EG2A 3P8BB 1YI2A 2DL7A 2ZAEA 1WJSA 2I2LA 4IUTA 1D1AA 4A63B 4C8QC 1TUDA 3E1SA 1TOVA 4JLIA 3JB9G 3JB9J 3G71A 2X3WD 2QI2A 1V1CA 2EW3A 4C5EA 2RHIA 2RA2A 4RG2A 1M1FA 4M7AE 3L2ZA 4M77G 2GBQA 2RJDA 1UG1A 2RHZA 3BW1A 2ECZA 3V8JA 4JUVA 3JCMX 3M0TA 2AK5A 2DLPA 5FROA 1Q82U 4QQDA 2HAXA 4F16A 2VYTA 3EH2A 3G6ET 1UGSB 2K5IA 3EHQA 5FW9A 2DZ9A 1Y07A 1VQ6T 1K73C 3RERA 3LW5E 5FU6B 1J3TA 2JJ9A 4OGCA 1Q7YU 1PWTA 3CC7Q 4J9GA 4XTXA 1SKUB 2RHYA 3OQ5A 3CCUA 1RACB 3S6WA 2JW4A 2XMFA 4FL6A 1YHQT 2DIQA 1KC8R 3CMEA 1WZOA 5GAOq 2LQNA 3HFNA 1SRLA 4A4KA 5GANj 2EYWA 1VQKT 2YSQA 3CCEQ 2DJZA 5GMKj 2A7YA 2ED1A 3A8OB 3CC7A 3FJPA 3QKJA 1PSFA 3MHXA 2JT4A 1OU8A 3A5ZB 4EIKA 2DERA 2GFAA 3C95A 2E5KA 2D0NA 3M5AA 4NL3A 1B34A 2K3YA 3HPWA 3QUIA 3OMGA 4WCIA 2VVKA 1VQ5Q 4BE2A 4DEXA 5LJ3g 2QEXT 1U3OA 2A36A 4M7DD 1LJOA 3VRZA 3OYBA 1RABB 1EX4A 2HSPA 4PJOF 2YUOA 2CP6A 1UB4A 1OYXA 2CZ1B 1OZ3A 3RBBB 1PKTA 4NOYA 1SPKA 1NG2A 1VQOQ 2QQ9A 1VQ5A 4GBQA 3MO8A 2F5KA 2DILA 3EFSA 1UHFA 4RMOA 1YJWT 2MOXA 1VUBA 4XU0A 1VQLT 1FXXA 1QCOA 2KVQG 4J6WA 1KQSP 1EFNA 1ZX6A 1VQOA 1XTDA 4X9DA 2A08A 1KG1A 1N8RU 2P0QA 2HL3A 3NTHA 1S72Q 3M55A 3EG3A 2QQAA 4HCZA 4FCYA 2X51A 4M7DG 3I55Q 2YT6A 3M58A 5CO7A 3QIIA 1ZUKA 3M54A 1W1FA 1SHFA 3TQ7P 5GAMj 2WACA 2I0NA 3A98A 5A2QE 5IN1A 5GAN6 2K2VA 1S72A 3IQLA 1I1JA 2G6FX 2LX7A 4C92D 4MZPA 2DD5A 5GAN8 4A53A 4E7ZA 3I55A 2E6ZA 5CKFA 3UT1A 4JPBW 4QQGA 1VQ9Q 1R0CB 2QQBA 2KMTA 1X69A 4J6XA 1GBQA 1GL5A 3CPWS 4A4EA 2ZPFB 3ULRB 4M78C 2JZ2A 1M1KU 4HCCA 1VYTA 2YUPA 1VQ9A 4ZN1A 4EMHA 4E47A 1ZUYA 2JMAA 4LUEA 2EAYA 4B9XA 2MI6A 1KHIA 1R0BG 1P92A 1S1NA 3BDUA 2EKHA 2C0TA 5GAOl 4M7AC 4TVRA 4ESRA 3BFMA 4C92G 1X2KA 2VXEA 2RPNA 4AMCA 4M75D 2L5QA 2EJFA 5LJ5e 4A4HA 2FPEA 4HVWA 1PD1A 4CRIA 4MZMA 1NLPC 2EQMA 1T3SA 3H41A 3S3MA 4HVUA 4C8QD 4AG2C 1RADB 4A4FA 2GTJA 3VUZA 2LJ0A 1WJRA 5LJ5f 1UDLA 3M56A 3MP6A 1X6BA 1K8AC 2JTEA 2HZYA 1MNEA 1BKBA 4LDWA 1RAAB 1YNZA 4PJJA 3OB9A 3QXEB 2MF2A 2CZ7B 2EIFA 4GY5A 4EPCA 3EFRA 3DLLA 2O01E 2Z0WA 1I07A 1HJDA 2ROLA 1M4ZA 2BE9B 1YCSB 1ZSZA 4NL2A 2JOYA 2Y90A 1UE9A 5KYYB 4M75G 1QW1A 2O2OA 3QWXX 4C92A 1C6VX 5GJWB 1VQPT 2MPXC 2CZ6B 2M16A 1T3LA 2V8KA 1WFWA 5FRMA 1CKBA 1VQNT 4CC4B 3QZ9B 1GRIA 2R57A 4C8QG 1RLQC 2NYSA 3JCMb 1K1ZA 1UUEA 1Q81R 2XG8D 1YWPA 1VYUA 2K79A 3CQTA 2D9TA 3VJPA 4F7UF 3VS4A 2OTLA 4PJMA 3M0UA 4OMLA 4FSSA 3OS5A 2C06A 1NE8A 5A0LA 2F1LA 3PNWC 4V2SA 4M78B 3UA6A 2LNHB 3CPWA 1VQ4Q 1D1BA 2E4HA 5I22A 5GANe 1ZLMA 2D8JA 1TG0A 2RHXA 2DEUA 2KROA 3CC2T 2JTMA 2CS7A 3LH0A 1VYVA 3JCMV 3L2WA 3A8GB 2HBWA 3CCMQ 5IHIA 1K73U 1X01A 1VQ4A 2QQRA 5GAN4 1WHJA 4LD6A 4ZN3A 1G3SA 1ZUUA 1AZEA 5GANf 4LDUA 2YUNA 3M0SA 3M4YA 1N9SA 1TS9A 4OGEA 3CCMA 3RUXA 5GAN3 1YIJT 1X2QA 3PT9A 2FZCB 1W4SA 1BBZA 1VQ8Q 4E7SA 1JU5C 1YWOA 2XK0A 2BIVA 1JQQA 2COYA 1OX9A 2X4WA 2EYYA 4RUGA 9ATCB 3JCMe 2PVOB 2CSIA 3VS3A 2ZGWA 1QVGP 3CMAQ 1VQ8A 1PKSA 3DB3A 1D1CA 1PSEA 2A3LA 3RKXA 3X20B 2ZPGB 2AHJB 3QYGB 1OV3A 1AEYA 4N4HA 3A8MB 4B6MA 1M1GA 4PK4A 3H0HA 1QLYA 5I21A 2JM9A 1I5LA 2BZXA 3CMAA 4JZ4A 1G5VA 1UFFA 5LJ3e 2LX9A 5CKBA 1A0NB 1AHJB 1GFDA 1U06A 2EYXA 4OB3B 1K9MC 3M53A 1D3BA 1RAHB 1VQ7Q 1ACMB 2CYZB 3G4ST 2DL3A 2KBTA 4QVDA 3PIOA 2XDPA 2OTJQ 1I8FA 2X9HA 4J83A 1Q95G 1F1BB 3CC4T 3OW2S 2LZ6B 1PHTA 1M8VA 4RTYA 1E6GA 1NEBA 4JZ3A 3SFMA 4JS5A 4II1A 2X4JA 4M77F 4CI0C 4AG1C 3UA7A 1QVFS 4M78D 4X34A 2OTJA 3G71T 2RB6A 4R55A 2O4XB 2L89A 4JRKA 2QTVA 2DMOA 2DXUA 3OS1A 2W10A 2DKGA 3RMQA 4XU2A 1NPRA 1WXBA 3QJ6A 2PZ1A 4LDYA 5FWCA 3CCVQ 3QBYA 2XDBA 1SEMA 2CREA 4M7AD 2HQHA 4XU3A 2JMCA 5CK9A 2K3BA 3HRTA 1MNDA 4FU6A 4E7KA 3CCLQ 1LOJA 4HA8A 5KYWB 3CPWP 1GBRA 3CD6A 1OX8A 2BKDN 3L42A 3CCVA 4DOWA 2DTIA 4L59A 4MMKA 4RTZA 2RJEA 3E9FA 2DPPB 2EQUA 3CCUT 2EKOA 4M78G 1M27C 5GMKh 3CXCP 1JO8A 4F7UE 2HBPA 3CCLA 4KGVB 3JCMJ 5L8RE 3OYDA 5I2MA 3BDLA 3CMET 1KD1C 1K76A 2FEIA 3CCRQ 4HXJA 4PJOC 4OVAA 2A0FB 3PMIA 5KE3A 5KYYA 5LJ5j 4M7AG 2EYQA 1Q82R 2M1HA 3HL8A 2KRSA 4NS5A 1TUCA 2V1RA 2YDLA 5GANd 2EQKA 1QKXA 3CCRA 1WYXA 1X27A 2F2VA 1QQJA 2CH4A 3JCMQ 4PJNA 2E70A 1XOVA 4JJNK 3THKA 1Q7YR 1M90C 2LJ3A 1MV3A 2QASA 3PTAA 1YJNA 1RAEB 3NMZC 3V7SA 2F2WA 2M0YA 2VKNA 1TUGB 4L6V5 2V1QA 4M78A 3EAEA 2RHUA 3CBMA 4ZGEB 4ZTJA 3FDRA 1JB0E 1K8AU 3OW2A 3SWNB 1QWFA 1NYFA 1VIEA 1VQ5T 2LCCA 3CCST 3S3OA 1IHWA 1QVFA 2O9SA 3SB2A 1YITQ 2L8DA 1U5SA 4M7AA 4M7DF 2LQWA 3PE0A 2HSEB 2G3RA 2LQ8A 1WA7A 2DL8A 4OP0A 2ZCFB 2DAQA 3NTKA 1PCXA 3TSZA 1GFCA 3PVQA 1FX7A 3QG1A 1D0XA 4AT1B 5GAMh 4JDSA 4BY6B 1YITA 2EVRA 1PRLC
chains in the Genus database with same CATH topology
2BTTA 1WI7A 4F17A 4JJCA 4LNPA 1VA7A 2EYZA 2AZSA 1NEGA 2DVJA 1X69A 1KIKA 1GBQA 3QWYA 1GL5A 1NYGA 2CSQA 2KNBB 3ULRB 1BK2A 4OMQA 1K0XA 3VS7A 1VYTA 1HSQA 4AFUC 2YUPA 4J9FA 2LCSA 2KXDA 1ZUYA 2FPFA 2JMAA 4J9BA 4LUEA 4Z89A 1M8MA 2C0OA 1S1NA 4OMOA 2EKHA 2C0TA 2DA9A 2LP5A 2QDLA 4ESRA 2AZVA 1UECA 2L3PA 1X2KA 4J9DA 2RPNA 1SSHA 2KYBA 2J7IA 4K11A 1RI9A 4X1VA 2FPEA 4HVWA 2RQUA 1Y0MA 2DBKA 1MUZA 1NLPC 2KEAA 2VWFA 1T3SA 2CUBA 3H41A 4HVUA 1UGVA 4AG2C 2KT8A 1K0SA 2GTJA 2LJ0A 5EC7A 2L0AA 1K9AA 1UDLA 2SEMA 4J9EA 4E6RA 2AKKA 1X6BA 1UJ0A 2JTEA 2D1XA 1W6XA 1GCPA 1YNZA 2NWMA 4Z88A 3U23A 1X6GA 4AFQC 3M0RA 1SHGA 2DX1A 2OAWA 3KFVA 1I07A 1HJDA 1ABQA 2ROLA 2HEQA 2L2PA 4D8DA 2ESWA 4HVVA 2KE9A 4J9IA 1YCSB 5GJVB 1UE9A 3LH5A 1I0CA 2JS0A 2O2OA 1QKWA 3QWXX 3R6NA 1CSKA 1PNJA 2JXBA 3VS5A 5GJWB 2CT3A 2LMJA 2DRMA 2L3QA 1T3LA 4KRTA 1M30A 4Y92A 1WFWA 5IHKA 1CKAA 4GLMA 1CKBA 4RTXA 4CC4B 5L23A 2EGAA 3EHRA 1GRIA 4LE9A 1RLQC 2GGRA 1WXUA 1K1ZA 3VS6A 1UUEA 1YWPA 1VYUA 2K79A 2PNIA 3CQTA 4F14A 3PVLA 1AWOA 3VS4A 4J9HA 2SRCA 1MV0B 1JXMA 3M0UA 3SHWA 4OMLA 4FSSA 3ZL7C 3REBB 4OMNA 1WIEA 3UA6A 2DNUA 2LNHB 4AFSC 1FMKA 2MCNA 2L3SA 2EPDA 5I22A 1X43A 2K9GA 1AVZC 2J6OA 2M51A 3NGPA 1FYNA 1ZLMA 2D8JA 1TG0A 3EGUA 1QWEA 2LJ1A 2KROA 1OPKA 1VYVA 5IH2A 1GCQC 2GNCA 2HBWA 2DE0X 1AOJA 4ORZA 5IHIA 2ENMA 1E7OA 3I5RA 2B86A 2K7AA 2RQTA 1T0HA 3SEMA 2CT4A 2J05A 2DF6A 4QT7A 1NLOC 2W0ZA 2O9VA 2KXCA 2RQVA 1ZUUA 1AZEA 2YUNA 2FO0A 3M0SA 3NPFA 1KFZA 3I9QA 1X2QA 4R0KA 2RF0A 1JEGA 1BBZA 3I35A 3H0FA 1JU5C 1H3HA 1YWOA 1BB9A 1LCKA 1Y57A 2DBMA 2HCKA 1WXTA 2KRMA 2DRKA 1JQQA 4OMPA 3VS1A 1ZSGA 2C0IA 5IHNA 1RUWA 2EYYA 1AZGB 4JJBA 4RUGA 2KGTA 3H0IA 2OI3A 4CC3A 2CSIA 3VS3A 1IO6A 2KYMA 1WLPB 2OJ2A 2DJQA 4RTUA 4LN2A 2A28A 3EG2A 1M3AA 1PKSA 2MIOA 1SRMA 2CDTA 1KSWA 1AWWA 1AWXA 2JS2A 4JJDA 4IIMA 1YP5A 1OV3A 1AEYA 2BZ8A 3VRYA 2EQIA 2ABLA 3NHNA 3H0HA 1QLYA 4OMMA 3VS0A 2JM9A 2BZXA 4JZ4A 2FG0A 4HCKA 1UFFA 1JXOA 3VS2A 1OPLA 1A0NB 2FPDA 2RN8A 1GFDA 1U06A 2EBPA 2DL7A 4A63B 4Z8AA 1TUDA 2EYXA 2DL5A 2X3WD 1G83A 1H92A 2A37A 1V1CA 2DL3A 2EW3A 2KBTA 2YUQA 1UTIA 3FJ5A 2RQWA 1K4US 4ZNXA 5FWBA 2LZ6B 1PHTA 4AFZC 1UJYA 2GBQA 1UG1A 1E6HA 4RTYA 1E6GA 1NEBA 2ECZA 4JZ3A 2BZYA 3M0TA 4AG1C 2AK5A 2DLPA 3JV3A 3UA7A 5IXFA 2D8HA 4F16A 2K6DA 2IIMA 3EHQA 5FW9A 2DMOA 1Z9ZA 1OOTA 1ABOA 2J6KA 2W10A 3RNJA 2K2MA 1J3TA 3I5SA 4D8KA 1WXBA 1PWTA 2PZ1A 5FWCA 4J9GA 2KRNA 3TVTA 1SEMA 1W70A 2CREA 1NM7A 5I11A 2JMCA 2JW4A 2XMFA 2ROTA 2K3BA 1N5ZA 2O88A 2J06A 4M4ZA 1HD3A 2AKLA 2LQNA 1SRLA 2EYWA 2DYBA 2YSQA 1WX6A 3C0CA 4IIOA 1GBRA 1OEBA 3GBQA 2ED1A 1QCFA 2RMOA 2FRWA 4RTZA 2JT4A 4EIKA 1M27C 1B07A 1JO8A 1M3BA 2RQRA 2HDAA 4CC2A 1PRMC 2E5KA 2D0NA 1G2BA 1BU1A 1K76A 2FEIA 2J6FA 4HXJA 1H8KA 1RLPC 5HCKA 4WCIA 2VVKA 1UHCA 4DEXA 1U3OA 2A36A 2KRSA 3VRZA 1TUCA 2HSPA 2V1RA 2YDLA 3M0PA 1T0JA 2DL4A 2CUDA 1QKXA 2H8HA 1WYXA 2KT1A 2YUOA 1X27A 3RBBB 2F2VA 2CH4A 4J9CA 1PKTA 1XOVA 1B3QA 1SPKA 1NG2A 3THKA 4GBQA 2LJ3A 1MV3A 1YN8A 2DM1A 4RTWA 2DILA 1UHFA 2ED0A 3NMZC 2P4RA 3EG0A 1KJWA 3M0QA 2MOXA 2F2WA 2CH4W 1AWJA 2M0YA 2RNAA 2VKNA 5ECAA 1ARKA 2V1QA 4CC7A 2FRYA 1EFNA 1ZX6A 3UF4A 2A08A 1QWFA 5IXBA 1GCQA 1NYFA 2F2XA 3EG1A 3TSWA 2JM8A 4LUDA 4DEYA 2EGCA 1AD5A 3EG3A 3REAB 4RTTA 2GQIA 2YT6A 2PTKA 1ZBJA 1M3CA 2NUZA 2O9SA 4RTVA 1U5SA 2GTOA 1WDXA 1ZUKA 2LQWA 3PE0A 1Z9QA 1W1FA 1SHFA 1WA7A 2DL8A 3UATA 2I0NA 3O5ZA 3A98A 3IQLA 1I1JA 2G6FX 2LX7A 2O31A 3TSZA 1GFCA 3PVQA 2KR3A 2EGEA 2X3XD 4JPBW 2EVRA 1PRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTT A;  1WI7 A;  4F17 A;  4JJC A;  4LNP A;  1VA7 A;  2EYZ A;  2AZS A;  1NEG A;  2DVJ A;  1X69 A;  1KIK A;  1GBQ A;  3QWY A;  1GL5 A;  1NYG A;  2CSQ A;  2KNB B;  3ULR B;  1BK2 A;  4OMQ A;  1K0X A;  3VS7 A;  1VYT A;  1HSQ A;  4AFU C;  2YUP A;  4J9F A;  2LCS A;  2KXD A;  1ZUY A;  2FPF A;  2JMA A;  4J9B A;  4LUE A;  4Z89 A;  1M8M A;  2C0O A;  1S1N A;  4OMO A;  2EKH A;  2C0T A;  2DA9 A;  2LP5 A;  2QDL A;  4ESR A;  2AZV A;  1UEC A;  2L3P A;  1X2K A;  4J9D A;  2RPN A;  1SSH A;  2KYB A;  2J7I A;  4K11 A;  1RI9 A;  4X1V A;  2FPE A;  4HVW A;  2RQU A;  1Y0M A;  2DBK A;  1MUZ A;  1NLP C;  2KEA A;  2VWF A;  1T3S A;  2CUB A;  3H41 A;  4HVU A;  1UGV A;  4AG2 C;  2KT8 A;  1K0S A;  2GTJ A;  2LJ0 A;  5EC7 A;  2L0A A;  1K9A A;  1UDL A;  2SEM A;  4J9E A;  4E6R A;  2AKK A;  1X6B A;  1UJ0 A;  2JTE A;  2D1X A;  1W6X A;  1GCP A;  1YNZ A;  2NWM A;  4Z88 A;  3U23 A;  1X6G A;  4AFQ C;  3M0R A;  1SHG A;  2DX1 A;  2OAW A;  3KFV A;  1I07 A;  1HJD A;  1ABQ A;  2ROL A;  2HEQ A;  2L2P A;  4D8D A;  2ESW A;  4HVV A;  2KE9 A;  4J9I A;  1YCS B;  5GJV B;  1UE9 A;  3LH5 A;  1I0C A;  2JS0 A;  2O2O A;  1QKW A;  3QWX X;  3R6N A;  1CSK A;  1PNJ A;  2JXB A;  3VS5 A;  5GJW B;  2CT3 A;  2LMJ A;  2DRM A;  2L3Q A;  1T3L A;  4KRT A;  1M30 A;  4Y92 A;  1WFW A;  5IHK A;  1CKA A;  4GLM A;  1CKB A;  4RTX A;  4CC4 B;  5L23 A;  2EGA A;  3EHR A;  1GRI A;  4LE9 A;  1RLQ C;  2GGR A;  1WXU A;  1K1Z A;  3VS6 A;  1UUE A;  1YWP A;  1VYU A;  2K79 A;  2PNI A;  3CQT A;  4F14 A;  3PVL A;  1AWO A;  3VS4 A;  4J9H A;  2SRC A;  1MV0 B;  1JXM A;  3M0U A;  3SHW A;  4OML A;  4FSS A;  3ZL7 C;  3REB B;  4OMN A;  1WIE A;  3UA6 A;  2DNU A;  2LNH B;  4AFS C;  1FMK A;  2MCN A;  2L3S A;  2EPD A;  5I22 A;  1X43 A;  2K9G A;  1AVZ C;  2J6O A;  2M51 A;  3NGP A;  1FYN A;  1ZLM A;  2D8J A;  1TG0 A;  3EGU A;  1QWE A;  2LJ1 A;  2KRO A;  1OPK A;  1VYV A;  5IH2 A;  1GCQ C;  2GNC A;  2HBW A;  2DE0 X;  1AOJ A;  4ORZ A;  5IHI A;  2ENM A;  1E7O A;  3I5R A;  2B86 A;  2K7A A;  2RQT A;  1T0H A;  3SEM A;  2CT4 A;  2J05 A;  2DF6 A;  4QT7 A;  1NLO C;  2W0Z A;  2O9V A;  2KXC A;  2RQV A;  1ZUU A;  1AZE A;  2YUN A;  2FO0 A;  3M0S A;  3NPF A;  1KFZ A;  3I9Q A;  1X2Q A;  4R0K A;  2RF0 A;  1JEG A;  1BBZ A;  3I35 A;  3H0F A;  1JU5 C;  1H3H A;  1YWO A;  1BB9 A;  1LCK A;  1Y57 A;  2DBM A;  2HCK A;  1WXT A;  2KRM A;  2DRK A;  1JQQ A;  4OMP A;  3VS1 A;  1ZSG A;  2C0I A;  5IHN A;  1RUW A;  2EYY A;  1AZG B;  4JJB A;  4RUG A;  2KGT A;  3H0I A;  2OI3 A;  4CC3 A;  2CSI A;  3VS3 A;  1IO6 A;  2KYM A;  1WLP B;  2OJ2 A;  2DJQ A;  4RTU A;  4LN2 A;  2A28 A;  3EG2 A;  1M3A A;  1PKS A;  2MIO A;  1SRM A;  2CDT A;  1KSW A;  1AWW A;  1AWX A;  2JS2 A;  4JJD A;  4IIM A;  1YP5 A;  1OV3 A;  1AEY A;  2BZ8 A;  3VRY A;  2EQI A;  2ABL A;  3NHN A;  3H0H A;  1QLY A;  4OMM A;  3VS0 A;  2JM9 A;  2BZX A;  4JZ4 A;  2FG0 A;  4HCK A;  1UFF A;  1JXO A;  3VS2 A;  1OPL A;  1A0N B;  2FPD A;  2RN8 A;  1GFD A;  1U06 A;  2EBP A;  2DL7 A;  4A63 B;  4Z8A A;  1TUD A;  2EYX A;  2DL5 A;  2X3W D;  1G83 A;  1H92 A;  2A37 A;  1V1C A;  2DL3 A;  2EW3 A;  2KBT A;  2YUQ A;  1UTI A;  3FJ5 A;  2RQW A;  1K4U S;  4ZNX A;  5FWB A;  2LZ6 B;  1PHT A;  4AFZ C;  1UJY A;  2GBQ A;  1UG1 A;  1E6H A;  4RTY A;  1E6G A;  1NEB A;  2ECZ A;  4JZ3 A;  2BZY A;  3M0T A;  4AG1 C;  2AK5 A;  2DLP A;  3JV3 A;  3UA7 A;  5IXF A;  2D8H A;  4F16 A;  2K6D A;  2IIM A;  3EHQ A;  5FW9 A;  2DMO A;  1Z9Z A;  1OOT A;  1ABO A;  2J6K A;  2W10 A;  3RNJ A;  2K2M A;  1J3T A;  3I5S A;  4D8K A;  1WXB A;  1PWT A;  2PZ1 A;  5FWC A;  4J9G A;  2KRN A;  3TVT A;  1SEM A;  1W70 A;  2CRE A;  1NM7 A;  5I11 A;  2JMC A;  2JW4 A;  2XMF A;  2ROT A;  2K3B A;  1N5Z A;  2O88 A;  2J06 A;  4M4Z A;  1HD3 A;  2AKL A;  2LQN A;  1SRL A;  2EYW A;  2DYB A;  2YSQ A;  1WX6 A;  3C0C A;  4IIO A;  1GBR A;  1OEB A;  3GBQ A;  2ED1 A;  1QCF A;  2RMO A;  2FRW A;  4RTZ A;  2JT4 A;  4EIK A;  1M27 C;  1B07 A;  1JO8 A;  1M3B A;  2RQR A;  2HDA A;  4CC2 A;  1PRM C;  2E5K A;  2D0N A;  1G2B A;  1BU1 A;  1K76 A;  2FEI A;  2J6F A;  4HXJ A;  1H8K A;  1RLP C;  5HCK A;  4WCI A;  2VVK A;  1UHC A;  4DEX A;  1U3O A;  2A36 A;  2KRS A;  3VRZ A;  1TUC A;  2HSP A;  2V1R A;  2YDL A;  3M0P A;  1T0J A;  2DL4 A;  2CUD A;  1QKX A;  2H8H A;  1WYX A;  2KT1 A;  2YUO A;  1X27 A;  3RBB B;  2F2V A;  2CH4 A;  4J9C A;  1PKT A;  1XOV A;  1B3Q A;  1SPK A;  1NG2 A;  3THK A;  4GBQ A;  2LJ3 A;  1MV3 A;  1YN8 A;  2DM1 A;  4RTW A;  2DIL A;  1UHF A;  2ED0 A;  3NMZ C;  2P4R A;  3EG0 A;  1KJW A;  3M0Q A;  2MOX A;  2F2W A;  2CH4 W;  1AWJ A;  2M0Y A;  2RNA A;  2VKN A;  5ECA A;  1ARK A;  2V1Q A;  4CC7 A;  2FRY A;  1EFN A;  1ZX6 A;  3UF4 A;  2A08 A;  1QWF A;  5IXB A;  1GCQ A;  1NYF A;  2F2X A;  3EG1 A;  3TSW A;  2JM8 A;  4LUD A;  4DEY A;  2EGC A;  1AD5 A;  3EG3 A;  3REA B;  4RTT A;  2GQI A;  2YT6 A;  2PTK A;  1ZBJ A;  1M3C A;  2NUZ A;  2O9S A;  4RTV A;  1U5S A;  2GTO A;  1WDX A;  1ZUK A;  2LQW A;  3PE0 A;  1Z9Q A;  1W1F A;  1SHF A;  1WA7 A;  2DL8 A;  3UAT A;  2I0N A;  3O5Z A;  3A98 A;  3IQL A;  1I1J A;  2G6F X;  2LX7 A;  2O31 A;  3TSZ A;  1GFC A;  3PVQ A;  2KR3 A;  2EGE A;  2X3X D;  4JPB W;  2EVR A;  1PRL C; 
#chains in the Genus database with same CATH topology
 3A8L B;  1VA7 A;  1AT1 B;  4J7F A;  2DVJ A;  4FYX B;  3QWY A;  2KNB B;  5J26 A;  4OMQ A;  3CEY A;  4J9F A;  2QXF A;  3I55 T;  2WSF E;  1JJ2 S;  4FT2 A;  4Z89 A;  2C0O A;  4PJO B;  5GAM d;  4OMO A;  2PQW A;  2DA9 A;  3CCE A;  2LP5 A;  5GAO m;  2DYI A;  1O9S A;  1UEC A;  3OYN A;  1VOM A;  3EGX B;  1N8R R;  4J9D A;  2KY9 A;  3PFS A;  2V26 A;  3HRU A;  3EFO B;  1U1S A;  2KYB A;  4C0Z A;  2J7I A;  4K11 A;  4O6J A;  1VQ9 T;  4BI4 A;  4R56 A;  4IUU A;  4PNO A;  4GLK A;  4XTU A;  2WSC E;  2HKN A;  1ZA1 B;  2E10 A;  2CUB A;  4F04 B;  1ZA2 B;  2KT8 A;  4ZGJ B;  5KH6 A;  2D6F A;  5KYN A;  2E41 A;  1K9A A;  4E6R A;  2CP5 A;  2JTF A;  1UJ0 A;  1W6X A;  2M9U A;  2EQJ A;  5CKE A;  4C0D B;  1YJ9 Q;  2NWM A;  3GP8 A;  3ASK A;  2LT4 A;  3CBP A;  1SHG A;  3KFV A;  4ZGD B;  3OS0 A;  1Y96 B;  2O4X A;  1ABQ A;  3P8H A;  2L2P A;  4PJL A;  5LJ3 j;  2HD0 A;  1UEB A;  5GJV B;  1M1K R;  1MMA A;  5GAM g;  2JS0 A;  4BUG A;  2OAU A;  1YJ9 A;  3HRS A;  2MK5 A;  1CSK A;  4M75 F;  1EIF A;  1Q86 C;  3ZEH A;  1YHQ Q;  2L3Q A;  2COW A;  4Y92 A;  4HKE A;  3GNF B;  2EGA A;  4FW1 A;  2LRQ A;  1WXU A;  1K9M U;  4KT0 E;  3VS6 A;  3I56 Q;  4C8Q F;  1VQM Q;  1IXD A;  2RM4 A;  1BCO A;  2X4Y A;  2LVM A;  1JXM A;  1WIE A;  1QVF P;  2ZZD A;  2DNU A;  3EH1 A;  5GAN 2;  4AFS C;  4LDV A;  3I56 A;  1VQM A;  2EWN A;  2J6O A;  3NGP A;  1Y71 A;  3RMS A;  1QWE A;  2HNI A;  2OTL T;  2GNC A;  2XI9 A;  1JJ2 A;  2DE0 X;  2QEX Q;  3L2R A;  3HHT B;  2GCX A;  2R5M A;  3ER0 A;  3LGF A;  4PJO D;  2XDD A;  2B86 A;  3TRE A;  1T0H A;  2DF6 A;  4QT7 A;  1NLO C;  2O9V A;  3FC3 A;  2KXC A;  4RG8 A;  2YRV A;  2DXC A;  1M5Q 1;  2K5F A;  2E64 A;  3NPF A;  4BDY A;  2JNG A;  1FMV A;  3MJX A;  4FW2 A;  3LX7 A;  1KFZ A;  3RES A;  4MDX A;  2QEX A;  4R0K A;  1MMN A;  1JEG A;  4N0A C;  1M9S A;  3OYA A;  1YJW Q;  1H3H A;  1BB9 A;  1LCK A;  1Y57 A;  3CCJ T;  3HTR A;  3X26 B;  3HSB A;  2QG9 B;  3G1J A;  2QGF B;  1VQ4 T;  4OMP A;  3VS1 A;  2C0I A;  1VQL Q;  5IHN A;  3X24 B;  3M59 A;  4EDU A;  1PD0 A;  2KGT A;  3SWN A;  1WHM A;  4CC3 A;  2HL5 C;  3M4G A;  1IO6 A;  1QMC A;  4PFO A;  2OJ2 A;  3OS2 A;  3EG2 A;  1YJW A;  1KD1 U;  1M3A A;  2RJC A;  3CCM T;  3OMC A;  1KSW A;  4OB1 B;  4PJO G;  1N6A A;  4LXC A;  4IIM A;  3OYE A;  1VQL A;  4N4I A;  2LC4 A;  2BZ8 A;  4B9W A;  2EQI A;  2ABL A;  4IUR A;  4HCK A;  4F7U B;  5CCA A;  1X75 C;  1M2O A;  3EG9 B;  2JUF A;  2K4Y A;  3V8L A;  4E7I A;  3OYI A;  1VQ8 T;  1YBY A;  4Z8A A;  5CQX A;  2LTO A;  2KSS A;  1K73 R;  5GAN 7;  2MWP A;  1G83 A;  1H92 A;  1M90 U;  4WF2 A;  3GOX A;  1Y7X A;  2RQW A;  4ZNX A;  1JRI A;  3AT1 B;  3RIR A;  1WQ7 A;  3BE3 A;  3WVD B;  3CMA T;  2NUP B;  3OYG A;  1UJY A;  1QP3 A;  5C0M A;  1E6H A;  2F69 A;  4PJO E;  1IZ6 A;  1ZHI A;  4XTZ A;  4C5H A;  2BZY A;  2M02 A;  3J80 E;  2JVV A;  4PFP A;  4ME7 A;  3ZFJ A;  2ZPI B;  4QKU A;  1PC0 A;  4JLG A;  2IIM A;  2IG0 A;  5FLX E;  4PJO A;  2MMP A;  2J6K A;  2ATC B;  3EGX A;  2K2M A;  5FU7 B;  2P4T A;  2VUB A;  4Q5W A;  3I5S A;  3EFO A;  5J39 A;  3FEO A;  2KRN A;  1V29 B;  2IVW A;  4FT4 A;  1NM7 A;  5I11 A;  2ROT A;  1TTH B;  1BCM A;  1N5Z A;  2O88 A;  2OTJ T;  4M4Z A;  2LT1 A;  4DOV A;  1HD3 A;  2AKL A;  4C0F A;  4D6W A;  4IKF A;  2DYB A;  1OU9 A;  3C0C A;  4IIO A;  1FMW A;  1OEB A;  3GBQ A;  1QCF A;  5GAO n;  5CQY A;  3V7R A;  2FRW A;  4PL6 A;  3VU3 C;  1JJ2 P;  3G7Z A;  3H9N A;  2NLU A;  1M3B A;  2B8A A;  4RCC A;  5D6W A;  3PGG A;  1Y96 A;  1BU1 A;  2J6F A;  3DKM A;  1H8K A;  2FHD A;  3CD6 T;  4XTY A;  1RLP C;  1KC8 C;  4OB2 B;  4XU1 A;  1UHC A;  4LD9 K;  2P0K A;  2D0Q B;  1VQP Q;  3RDV A;  3FRN A;  3C12 A;  3CCL T;  5LJ5 h;  1T0J A;  1VQN Q;  2DL4 A;  2CUD A;  2H8H A;  2KT1 A;  2QA4 T;  2QGG A;  3JCM f;  2MWO A;  2YXY A;  2DTH A;  4J9C A;  3OSV A;  2XKO C;  3OYK A;  1B3Q A;  3ME9 A;  3WVE B;  1YN8 A;  2DM1 A;  1VQP A;  4M77 B;  2ED0 A;  3FB9 A;  3VYH B;  2P4R A;  3EG0 A;  3M0Q A;  2CH4 W;  2RNA A;  1VQN A;  3D7S B;  3JB9 F;  4E7H A;  5ECA A;  4CC7 A;  1NPP A;  4C0G A;  4M7D C;  3CCR T;  2BE7 D;  3UF4 A;  3MEV A;  5IXB A;  2DFU A;  3TSW A;  5LJ5 d;  5LJ3 f;  2JM8 A;  3OYM A;  4LUD A;  3GNG A;  4DEY A;  2DXB A;  4MML A;  5HY6 A;  3SWN C;  2EJ9 A;  4DQ2 A;  3REA B;  1N27 A;  4RTT A;  1YI2 T;  1YJN T;  3JCM W;  2PTK A;  1M3C A;  2NUZ A;  1VQ7 A;  3MPU B;  1WDX A;  1B7T A;  5M9O A;  1KQ1 A;  5DY9 A;  4F7U G;  3UAT A;  2XD0 A;  3O5Z A;  3OBY A;  4JRI A;  1Q86 U;  2O31 A;  2YHT A;  3L2Q A;  1YIJ Q;  2KR3 A;  2X3X D;  5KE2 A;  3MP1 A;  1VIF A;  4VUB A;  1SG5 A;  1WI7 A;  1I81 A;  4LNP A;  4F17 A;  2DVE A;  4BY6 C;  4C5I A;  3S3N A;  3GPL A;  3PIP A;  1X6O A;  3J7A F;  3GF5 A;  2QK0 A;  1BK2 A;  1I4K 1;  2E5Q A;  3QJY A;  1BI3 A;  5KYX B;  3VS7 A;  3OA6 A;  1IRX A;  2M0O A;  1HSQ A;  4FIB A;  4AFU C;  4E7L A;  2LCS A;  5GAN h;  5D7U A;  2YRD A;  3E19 A;  2FPF A;  3JCM c;  4J9B A;  4L5G A;  5LJ5 g;  1YCY A;  2VAS A;  3INZ A;  1M8M A;  2H3E B;  4MZT A;  1K8A R;  2QDL A;  2AT1 B;  2AZV A;  4ELZ C;  2L3P A;  2XHC A;  2FB7 A;  5GMK l;  4F7U A;  1D0Z A;  4P5N A;  1OI1 A;  3CC7 T;  2DET A;  3EG9 A;  4MDW A;  2VB6 A;  2XU8 A;  1RAI B;  4BD3 A;  2RQU A;  2DBK A;  4X9C A;  2KEA A;  2VWF A;  3QHS A;  4E7J A;  3CCE T;  3CC4 Q;  1QVP A;  1IRE B;  3A1P A;  2NUP A;  2XID A;  3HKS A;  2GQV A;  5EC7 A;  4KUL A;  2SEM A;  3JCM h;  2AKK A;  3QO3 A;  4DBH A;  2GF7 A;  2D1X A;  2K3X A;  1OUL A;  1BIA A;  4M7D B;  4Z88 A;  4BE0 A;  3M0R A;  2FZK B;  2DX1 A;  3CC4 A;  4C0D C;  2OX7 A;  3SD4 A;  1BI1 A;  4D8D A;  2ESW A;  4QVC A;  2KE9 A;  4J9I A;  1U1T A;  1RAG B;  1I0C A;  4OMF B;  3UPU A;  2P0P A;  1PNJ A;  2E3H A;  2CT3 A;  2LMJ A;  5LJ3 h;  2VC8 A;  3X28 B;  2DRM A;  2FZG B;  3JCM d;  1M30 A;  3H8Z A;  2RK2 A;  2QYZ A;  1CKA A;  4RTX A;  1O75 A;  5L23 A;  3JAM E;  3EHR A;  4LE9 A;  2PUK B;  3V7C A;  2KDS A;  2GGR A;  2PUO B;  1VQO T;  3GIB A;  2HKQ B;  4F14 A;  2CZ0 B;  1AWO A;  4J9H A;  2RK1 A;  4N0A A;  1I5O B;  3TU4 K;  2PVD B;  2DEQ A;  1BI0 A;  2Y4X A;  5GAN g;  2CP0 A;  1MV0 B;  1YJ9 T;  3CCU Q;  5AT1 B;  3ZL7 C;  3CCQ Q;  4PKC C;  1KQ2 A;  3VKI A;  4WTO B;  2X4X A;  2YRC A;  3CME Q;  1WQW A;  5LJ3 d;  2MCN A;  5HK0 A;  2EPD A;  3NFC A;  1ZSZ B;  1XJW B;  1X43 A;  2K9G A;  1UGP B;  2M51 A;  1FYN A;  2JN0 A;  3EGU A;  4C92 B;  1S72 T;  5AYF A;  2RD1 A;  3TEE A;  5HKC A;  3CCQ A;  1HK9 A;  4IUV A;  4BE1 A;  4HCB A;  4DBR A;  5DLO A;  1AOJ A;  2E65 A;  2CP7 A;  1Q81 C;  4BDZ A;  1E7O A;  2K7A A;  3SEM A;  3JB9 I;  4M77 E;  3I56 T;  2FO0 A;  2V8J A;  1VQM T;  3E9G A;  1RL2 A;  3JCM g;  2YLB A;  4ATO A;  5GMK i;  5CAI A;  3QYH B;  4C92 F;  4M77 A;  3QDR B;  3I35 A;  1FWZ A;  5CIU A;  4BAC A;  2DBM A;  1XQH A;  2AIR B;  1ZSG A;  3CPF A;  1RUW A;  3RR6 A;  1K9M R;  3OYY A;  3DLM A;  3P8D A;  1QVG S;  2OI3 A;  4ELY C;  1C0M A;  1WLP B;  4KH0 B;  1LNX A;  2K5L A;  4RTU A;  2DK3 A;  3VV0 A;  4M75 B;  3MCA B;  1SRM A;  2PU9 B;  3CCS Q;  1OQK A;  1AWW A;  1ZBX A;  2JS2 A;  4JJD A;  8ATC B;  2KAF A;  2NUT B;  1KC8 U;  3RKY A;  3G6E Q;  5IAY A;  3C4S A;  3NHN A;  2E3I A;  4IUQ A;  4C8Q B;  4PFZ A;  1VQ6 Q;  1KK7 A;  1OPL A;  3ZBD A;  2LQK A;  7AT1 B;  2R5A A;  2FPD A;  3CCS A;  2V8I A;  2EBP A;  3MEA A;  4A4G A;  1IGQ A;  4N4G A;  4ANJ A;  5KYU B;  4KBM B;  5HK3 A;  1TXQ A;  2DL5 A;  2RJF A;  3G6E A;  2A37 A;  2YUQ A;  2QAZ A;  1YFN A;  1UTI A;  3FJ5 A;  1K4U S;  5CVI A;  1VQ6 A;  5FWB A;  1VQK Q;  5KYW A;  3JCM P;  3OW2 P;  4AFZ C;  6AT1 B;  3H6Z A;  5KYX A;  2X35 A;  2WSE E;  5I2S A;  3EGD B;  4KGZ B;  3JV3 A;  5IXF A;  5IT9 E;  2D8H A;  1YHQ A;  1W2B S;  1D0Y A;  4EMK C;  3F70 A;  3VYG A;  2K6D A;  1HYO A;  4XK8 E;  1VQK A;  1G3T A;  1Z9Z A;  1OOT A;  1ABO A;  5A0D A;  1KHC A;  3RNJ A;  2CGH A;  3GLX A;  4OB0 B;  4D8K A;  1LPL A;  1KD1 R;  1MMG A;  4Y28 E;  3TVT A;  1W70 A;  1D3B B;  5FU7 C;  4JS4 A;  1TU0 B;  2J06 A;  4DA4 A;  4Y91 A;  1WX6 A;  4XTW A;  4M7D E;  4RCB A;  1BYM A;  2RMO A;  1EZZ B;  3KBG A;  4KGX B;  3V8K A;  4Z02 A;  4J6Y A;  1OZ2 A;  3CXC S;  2KI7 A;  1WNL A;  3L1A A;  1B07 A;  4J5Y A;  1M90 R;  4M7D A;  2RQR A;  2HDA A;  1TH7 A;  2H3J A;  2F5T X;  3UWN A;  4CC2 A;  1NJI C;  1PRM C;  2KQW A;  4KUD K;  2CP2 A;  1G2B A;  1QVG A;  3L2U A;  3UDC A;  5HCK A;  1N9R A;  2CKK A;  2DXT A;  3OY9 A;  3J81 E;  3M0P A;  2QQS A;  3MP8 A;  1G8X A;  4YTL A;  2Y4Y A;  2QTX A;  4HT9 A;  3Q1J A;  4IUP A;  2XIC A;  1M2V B;  5J3B A;  4RTW A;  4HT8 A;  1RAF B;  2KK4 A;  4QW2 A;  5LL6 S;  1WHG A;  3QZ5 B;  1KJW A;  1D09 B;  1AWJ A;  1PG5 B;  2DO3 A;  4J7I A;  4M77 C;  4C92 E;  1ARK A;  2FRY A;  4BI3 A;  4QVZ A;  2PVG B;  1IB8 A;  3SDZ A;  4RKU E;  1Q82 C;  1GCQ A;  2F2X A;  3EG1 A;  2YLC A;  3QPH A;  2EGC A;  2RI3 A;  1HXD A;  4EMK B;  1AD5 A;  3JSC A;  2OTL Q;  4OF1 A;  2ZPB B;  2GQI A;  1W2B A;  3FLG A;  3OYJ A;  2EFI A;  1ZBJ A;  3M57 A;  1QP2 A;  4RTV A;  5FRN A;  2RI2 A;  2GTO A;  3DB4 A;  1Q7Y C;  4XQ3 A;  1Z9Q A;  3NTI A;  4BB7 A;  2DIG A;  4FYY B;  1R8O B;  5DLQ E;  2RH2 A;  3KUF A;  1ZQ1 A;  3OYC A;  2EGE A;  2E6N A;  1RI0 A;  4BI8 B;  5GAO r;  4DBF A;  2BTT A;  3CCJ Q;  3WXM B;  4JJC A;  2L3R A;  1VQ7 T;  2EYZ A;  1WHK A;  2AZS A;  1NEG A;  5D6X A;  1KIK A;  4M75 E;  3VUB A;  1NYG A;  3MEW A;  3JB9 H;  5GAN 5;  2CSQ A;  4KUI A;  3FIF A;  3E2U A;  3OYH A;  1K0X A;  5CKH A;  5GMK e;  1IHV A;  1C1A A;  3CXC A;  3CCJ A;  4M75 A;  3OSS C;  1WGS A;  2KXD A;  1MGQ A;  2DZC A;  4M7A B;  5D6Y A;  4C8Q E;  2NUT A;  1V76 A;  4M78 F;  3OYL A;  2YWW A;  2VV5 A;  3BY7 A;  2VGN A;  1MHN A;  1R77 A;  1GXI E;  5GMK m;  1Q81 U;  4C8Q A;  4QQ6 A;  1SSH A;  3LLR A;  3CCV T;  1RI9 A;  1LVK A;  3JRZ A;  4X1V A;  2BUD A;  1TWB A;  4PLL A;  5KYU A;  4M7A F;  1Y0M A;  3C94 A;  3AHU A;  1MUZ A;  2MAM A;  3KXT A;  2HQE A;  4J8O A;  1NZ9 A;  2MYS A;  5CKD A;  1Q86 R;  4FM4 B;  1UGV A;  2ZPE B;  3RKW A;  1K0S A;  3R6O A;  4PLI A;  2HMA A;  2RO0 A;  2L0A A;  4J9E A;  4JRP A;  1JBM A;  2R58 A;  4UC4 A;  1GCP A;  3EGD A;  3OYF A;  2LCL A;  1G3W A;  5KCH A;  3U23 A;  1N8R C;  1X6G A;  4AFQ C;  2DD4 A;  2EJG A;  2OAW A;  2HQX A;  1KQS S;  1SSF A;  1B34 B;  4XTV A;  2HEQ A;  5DM7 R;  2DTO A;  4FYV B;  4HVV A;  5KCO A;  1IGU A;  3LH5 A;  1QKW A;  3M9Q A;  3CC2 Q;  3R6N A;  2JXB A;  3VS5 A;  5C6S A;  1UGR B;  3MEU A;  4KRT A;  3N5B B;  2COZ A;  1WHL A;  1BI2 A;  5IHK A;  4GLM A;  4FYW B;  4FSX A;  3CBO A;  5GAM e;  3QSU A;  1SF9 A;  2PNI A;  1PM3 A;  3PVL A;  3CC2 A;  2SRC A;  2GFU A;  2E1H A;  3SHW A;  1MMD A;  2ZPH B;  3LWH A;  3REB B;  4OMN A;  1W2B P;  3OBW A;  1M1K C;  1DJ7 B;  3PMT A;  3L2V A;  1FMK A;  5GAM f;  2L3S A;  1XNI A;  1AVZ C;  4C5G A;  1NJI R;  2P84 A;  3CD6 Q;  1YIJ A;  2LJ1 A;  1H3Z A;  1OPK A;  1WHH A;  1H64 1;  5IH2 A;  1GCQ C;  1ZSZ C;  1WPY A;  5FU6 C;  2VGM A;  4ORZ A;  4C92 C;  1YIT T;  2ENM A;  3I5R A;  1NBE B;  2RQT A;  4LDX A;  2CT4 A;  2J05 A;  2QA4 Q;  2W0Z A;  3MKD A;  8AT1 B;  2RQV A;  3HP9 A;  3MET A;  3TCJ A;  3A8H B;  4JRQ A;  4XAX B;  5A0G A;  3O8V A;  3I9Q A;  1M2V A;  1U8R A;  3LYI A;  2QDY B;  1WJQ A;  2RF0 A;  3CCQ T;  3H0F A;  3X25 B;  2FL7 A;  2HCK A;  2FYK A;  2LNV A;  4O5V A;  1WXT A;  3JB9 D;  2KRM A;  2QA4 A;  2RI5 A;  2DRK A;  5CR2 A;  3G4S Q;  4A54 A;  3LGL A;  4EMG A;  1AZG B;  3QDF A;  4JJB A;  3HFO A;  4E2F B;  3H0I A;  2KYM A;  3LWI A;  2DJQ A;  1TSF A;  4LN2 A;  3URG A;  1NJI U;  2A28 A;  1BIB A;  4M77 D;  4EMK A;  2LDM A;  2MIO A;  2CDT A;  1YI2 Q;  1YJN Q;  1AWX A;  2E12 A;  3T9N A;  1UGQ B;  3G4S A;  2IPO B;  1QCN A;  1YP5 A;  4M75 C;  1KQS A;  2FVU A;  3G71 Q;  1G3Y A;  3VRY A;  5GAO p;  4ZTF A;  2K57 A;  4KH1 B;  4OMM A;  3VS0 A;  4DBQ A;  2FG0 A;  1JXO A;  3VS2 A;  2VXF A;  2CP3 A;  4M78 E;  2RN8 A;  5EG2 A;  3P8B B;  1YI2 A;  2DL7 A;  2ZAE A;  1WJS A;  2I2L A;  4IUT A;  1D1A A;  4A63 B;  4C8Q C;  1TUD A;  3E1S A;  1TOV A;  4JLI A;  3JB9 G;  3JB9 J;  3G71 A;  2X3W D;  2QI2 A;  1V1C A;  2EW3 A;  4C5E A;  2RHI A;  2RA2 A;  4RG2 A;  1M1F A;  4M7A E;  3L2Z A;  4M77 G;  2GBQ A;  2RJD A;  1UG1 A;  2RHZ A;  3BW1 A;  2ECZ A;  3V8J A;  4JUV A;  3JCM X;  3M0T A;  2AK5 A;  2DLP A;  5FRO A;  1Q82 U;  4QQD A;  2HAX A;  4F16 A;  2VYT A;  3EH2 A;  3G6E T;  1UGS B;  2K5I A;  3EHQ A;  5FW9 A;  2DZ9 A;  1Y07 A;  1VQ6 T;  1K73 C;  3RER A;  3LW5 E;  5FU6 B;  1J3T A;  2JJ9 A;  4OGC A;  1Q7Y U;  1PWT A;  3CC7 Q;  4J9G A;  4XTX A;  1SKU B;  2RHY A;  3OQ5 A;  3CCU A;  1RAC B;  3S6W A;  2JW4 A;  2XMF A;  4FL6 A;  1YHQ T;  2DIQ A;  1KC8 R;  3CME A;  1WZO A;  5GAO q;  2LQN A;  3HFN A;  1SRL A;  4A4K A;  5GAN j;  2EYW A;  1VQK T;  2YSQ A;  3CCE Q;  2DJZ A;  5GMK j;  2A7Y A;  2ED1 A;  3A8O B;  3CC7 A;  3FJP A;  3QKJ A;  1PSF A;  3MHX A;  2JT4 A;  1OU8 A;  3A5Z B;  4EIK A;  2DER A;  2GFA A;  3C95 A;  2E5K A;  2D0N A;  3M5A A;  4NL3 A;  1B34 A;  2K3Y A;  3HPW A;  3QUI A;  3OMG A;  4WCI A;  2VVK A;  1VQ5 Q;  4BE2 A;  4DEX A;  5LJ3 g;  2QEX T;  1U3O A;  2A36 A;  4M7D D;  1LJO A;  3VRZ A;  3OYB A;  1RAB B;  1EX4 A;  2HSP A;  4PJO F;  2YUO A;  2CP6 A;  1UB4 A;  1OYX A;  2CZ1 B;  1OZ3 A;  3RBB B;  1PKT A;  4NOY A;  1SPK A;  1NG2 A;  1VQO Q;  2QQ9 A;  1VQ5 A;  4GBQ A;  3MO8 A;  2F5K A;  2DIL A;  3EFS A;  1UHF A;  4RMO A;  1YJW T;  2MOX A;  1VUB A;  4XU0 A;  1VQL T;  1FXX A;  1QCO A;  2KVQ G;  4J6W A;  1KQS P;  1EFN A;  1ZX6 A;  1VQO A;  1XTD A;  4X9D A;  2A08 A;  1KG1 A;  1N8R U;  2P0Q A;  2HL3 A;  3NTH A;  1S72 Q;  3M55 A;  3EG3 A;  2QQA A;  4HCZ A;  4FCY A;  2X51 A;  4M7D G;  3I55 Q;  2YT6 A;  3M58 A;  5CO7 A;  3QII A;  1ZUK A;  3M54 A;  1W1F A;  1SHF A;  3TQ7 P;  5GAM j;  2WAC A;  2I0N A;  3A98 A;  5A2Q E;  5IN1 A;  5GAN 6;  2K2V A;  1S72 A;  3IQL A;  1I1J A;  2G6F X;  2LX7 A;  4C92 D;  4MZP A;  2DD5 A;  5GAN 8;  4A53 A;  4E7Z A;  3I55 A;  2E6Z A;  5CKF A;  3UT1 A;  4JPB W;  4QQG A;  1VQ9 Q;  1R0C B;  2QQB A;  2KMT A;  1X69 A;  4J6X A;  1GBQ A;  1GL5 A;  3CPW S;  4A4E A;  2ZPF B;  3ULR B;  4M78 C;  2JZ2 A;  1M1K U;  4HCC A;  1VYT A;  2YUP A;  1VQ9 A;  4ZN1 A;  4EMH A;  4E47 A;  1ZUY A;  2JMA A;  4LUE A;  2EAY A;  4B9X A;  2MI6 A;  1KHI A;  1R0B G;  1P92 A;  1S1N A;  3BDU A;  2EKH A;  2C0T A;  5GAO l;  4M7A C;  4TVR A;  4ESR A;  3BFM A;  4C92 G;  1X2K A;  2VXE A;  2RPN A;  4AMC A;  4M75 D;  2L5Q A;  2EJF A;  5LJ5 e;  4A4H A;  2FPE A;  4HVW A;  1PD1 A;  4CRI A;  4MZM A;  1NLP C;  2EQM A;  1T3S A;  3H41 A;  3S3M A;  4HVU A;  4C8Q D;  4AG2 C;  1RAD B;  4A4F A;  2GTJ A;  3VUZ A;  2LJ0 A;  1WJR A;  5LJ5 f;  1UDL A;  3M56 A;  3MP6 A;  1X6B A;  1K8A C;  2JTE A;  2HZY A;  1MNE A;  1BKB A;  4LDW A;  1RAA B;  1YNZ A;  4PJJ A;  3OB9 A;  3QXE B;  2MF2 A;  2CZ7 B;  2EIF A;  4GY5 A;  4EPC A;  3EFR A;  3DLL A;  2O01 E;  2Z0W A;  1I07 A;  1HJD A;  2ROL A;  1M4Z A;  2BE9 B;  1YCS B;  1ZSZ A;  4NL2 A;  2JOY A;  2Y90 A;  1UE9 A;  5KYY B;  4M75 G;  1QW1 A;  2O2O A;  3QWX X;  4C92 A;  1C6V X;  5GJW B;  1VQP T;  2MPX C;  2CZ6 B;  2M16 A;  1T3L A;  2V8K A;  1WFW A;  5FRM A;  1CKB A;  1VQN T;  4CC4 B;  3QZ9 B;  1GRI A;  2R57 A;  4C8Q G;  1RLQ C;  2NYS A;  3JCM b;  1K1Z A;  1UUE A;  1Q81 R;  2XG8 D;  1YWP A;  1VYU A;  2K79 A;  3CQT A;  2D9T A;  3VJP A;  4F7U F;  3VS4 A;  2OTL A;  4PJM A;  3M0U A;  4OML A;  4FSS A;  3OS5 A;  2C06 A;  1NE8 A;  5A0L A;  2F1L A;  3PNW C;  4V2S A;  4M78 B;  3UA6 A;  2LNH B;  3CPW A;  1VQ4 Q;  1D1B A;  2E4H A;  5I22 A;  5GAN e;  1ZLM A;  2D8J A;  1TG0 A;  2RHX A;  2DEU A;  2KRO A;  3CC2 T;  2JTM A;  2CS7 A;  3LH0 A;  1VYV A;  3JCM V;  3L2W A;  3A8G B;  2HBW A;  3CCM Q;  5IHI A;  1K73 U;  1X01 A;  1VQ4 A;  2QQR A;  5GAN 4;  1WHJ A;  4LD6 A;  4ZN3 A;  1G3S A;  1ZUU A;  1AZE A;  5GAN f;  4LDU A;  2YUN A;  3M0S A;  3M4Y A;  1N9S A;  1TS9 A;  4OGE A;  3CCM A;  3RUX A;  5GAN 3;  1YIJ T;  1X2Q A;  3PT9 A;  2FZC B;  1W4S A;  1BBZ A;  1VQ8 Q;  4E7S A;  1JU5 C;  1YWO A;  2XK0 A;  2BIV A;  1JQQ A;  2COY A;  1OX9 A;  2X4W A;  2EYY A;  4RUG A;  9ATC B;  3JCM e;  2PVO B;  2CSI A;  3VS3 A;  2ZGW A;  1QVG P;  3CMA Q;  1VQ8 A;  1PKS A;  3DB3 A;  1D1C A;  1PSE A;  2A3L A;  3RKX A;  3X20 B;  2ZPG B;  2AHJ B;  3QYG B;  1OV3 A;  1AEY A;  4N4H A;  3A8M B;  4B6M A;  1M1G A;  4PK4 A;  3H0H A;  1QLY A;  5I21 A;  2JM9 A;  1I5L A;  2BZX A;  3CMA A;  4JZ4 A;  1G5V A;  1UFF A;  5LJ3 e;  2LX9 A;  5CKB A;  1A0N B;  1AHJ B;  1GFD A;  1U06 A;  2EYX A;  4OB3 B;  1K9M C;  3M53 A;  1D3B A;  1RAH B;  1VQ7 Q;  1ACM B;  2CYZ B;  3G4S T;  2DL3 A;  2KBT A;  4QVD A;  3PIO A;  2XDP A;  2OTJ Q;  1I8F A;  2X9H A;  4J83 A;  1Q95 G;  1F1B B;  3CC4 T;  3OW2 S;  2LZ6 B;  1PHT A;  1M8V A;  4RTY A;  1E6G A;  1NEB A;  4JZ3 A;  3SFM A;  4JS5 A;  4II1 A;  2X4J A;  4M77 F;  4CI0 C;  4AG1 C;  3UA7 A;  1QVF S;  4M78 D;  4X34 A;  2OTJ A;  3G71 T;  2RB6 A;  4R55 A;  2O4X B;  2L89 A;  4JRK A;  2QTV A;  2DMO A;  2DXU A;  3OS1 A;  2W10 A;  2DKG A;  3RMQ A;  4XU2 A;  1NPR A;  1WXB A;  3QJ6 A;  2PZ1 A;  4LDY A;  5FWC A;  3CCV Q;  3QBY A;  2XDB A;  1SEM A;  2CRE A;  4M7A D;  2HQH A;  4XU3 A;  2JMC A;  5CK9 A;  2K3B A;  3HRT A;  1MND A;  4FU6 A;  4E7K A;  3CCL Q;  1LOJ A;  4HA8 A;  5KYW B;  3CPW P;  1GBR A;  3CD6 A;  1OX8 A;  2BKD N;  3L42 A;  3CCV A;  4DOW A;  2DTI A;  4L59 A;  4MMK A;  4RTZ A;  2RJE A;  3E9F A;  2DPP B;  2EQU A;  3CCU T;  2EKO A;  4M78 G;  1M27 C;  5GMK h;  3CXC P;  1JO8 A;  4F7U E;  2HBP A;  3CCL A;  4KGV B;  3JCM J;  5L8R E;  3OYD A;  5I2M A;  3BDL A;  3CME T;  1KD1 C;  1K76 A;  2FEI A;  3CCR Q;  4HXJ A;  4PJO C;  4OVA A;  2A0F B;  3PMI A;  5KE3 A;  5KYY A;  5LJ5 j;  4M7A G;  2EYQ A;  1Q82 R;  2M1H A;  3HL8 A;  2KRS A;  4NS5 A;  1TUC A;  2V1R A;  2YDL A;  5GAN d;  2EQK A;  1QKX A;  3CCR A;  1WYX A;  1X27 A;  2F2V A;  1QQJ A;  2CH4 A;  3JCM Q;  4PJN A;  2E70 A;  1XOV A;  4JJN K;  3THK A;  1Q7Y R;  1M90 C;  2LJ3 A;  1MV3 A;  2QAS A;  3PTA A;  1YJN A;  1RAE B;  3NMZ C;  3V7S A;  2F2W A;  2M0Y A;  2VKN A;  1TUG B;  4L6V 5;  2V1Q A;  4M78 A;  3EAE A;  2RHU A;  3CBM A;  4ZGE B;  4ZTJ A;  3FDR A;  1JB0 E;  1K8A U;  3OW2 A;  3SWN B;  1QWF A;  1NYF A;  1VIE A;  1VQ5 T;  2LCC A;  3CCS T;  3S3O A;  1IHW A;  1QVF A;  2O9S A;  3SB2 A;  1YIT Q;  2L8D A;  1U5S A;  4M7A A;  4M7D F;  2LQW A;  3PE0 A;  2HSE B;  2G3R A;  2LQ8 A;  1WA7 A;  2DL8 A;  4OP0 A;  2ZCF B;  2DAQ A;  3NTK A;  1PCX A;  3TSZ A;  1GFC A;  3PVQ A;  1FX7 A;  3QG1 A;  1D0X A;  4AT1 B;  5GAM h;  4JDS A;  4BY6 B;  1YIT A;  2EVR A;  1PRL C; 
#chains in the Genus database with same CATH homology
 2BTT A;  1WI7 A;  4F17 A;  4JJC A;  4LNP A;  1VA7 A;  2EYZ A;  2AZS A;  1NEG A;  2DVJ A;  1X69 A;  1KIK A;  1GBQ A;  3QWY A;  1GL5 A;  1NYG A;  2CSQ A;  2KNB B;  3ULR B;  1BK2 A;  4OMQ A;  1K0X A;  3VS7 A;  1VYT A;  1HSQ A;  4AFU C;  2YUP A;  4J9F A;  2LCS A;  2KXD A;  1ZUY A;  2FPF A;  2JMA A;  4J9B A;  4LUE A;  4Z89 A;  1M8M A;  2C0O A;  1S1N A;  4OMO A;  2EKH A;  2C0T A;  2DA9 A;  2LP5 A;  2QDL A;  4ESR A;  2AZV A;  1UEC A;  2L3P A;  1X2K A;  4J9D A;  2RPN A;  1SSH A;  2KYB A;  2J7I A;  4K11 A;  1RI9 A;  4X1V A;  2FPE A;  4HVW A;  2RQU A;  1Y0M A;  2DBK A;  1MUZ A;  1NLP C;  2KEA A;  2VWF A;  1T3S A;  2CUB A;  3H41 A;  4HVU A;  1UGV A;  4AG2 C;  2KT8 A;  1K0S A;  2GTJ A;  2LJ0 A;  5EC7 A;  2L0A A;  1K9A A;  1UDL A;  2SEM A;  4J9E A;  4E6R A;  2AKK A;  1X6B A;  1UJ0 A;  2JTE A;  2D1X A;  1W6X A;  1GCP A;  1YNZ A;  2NWM A;  4Z88 A;  3U23 A;  1X6G A;  4AFQ C;  3M0R A;  1SHG A;  2DX1 A;  2OAW A;  3KFV A;  1I07 A;  1HJD A;  1ABQ A;  2ROL A;  2HEQ A;  2L2P A;  4D8D A;  2ESW A;  4HVV A;  2KE9 A;  4J9I A;  1YCS B;  5GJV B;  1UE9 A;  3LH5 A;  1I0C A;  2JS0 A;  2O2O A;  1QKW A;  3QWX X;  3R6N A;  1CSK A;  1PNJ A;  2JXB A;  3VS5 A;  5GJW B;  2CT3 A;  2LMJ A;  2DRM A;  2L3Q A;  1T3L A;  4KRT A;  1M30 A;  4Y92 A;  1WFW A;  5IHK A;  1CKA A;  4GLM A;  1CKB A;  4RTX A;  4CC4 B;  5L23 A;  2EGA A;  3EHR A;  1GRI A;  4LE9 A;  1RLQ C;  2GGR A;  1WXU A;  1K1Z A;  3VS6 A;  1UUE A;  1YWP A;  1VYU A;  2K79 A;  2PNI A;  3CQT A;  4F14 A;  3PVL A;  1AWO A;  3VS4 A;  4J9H A;  2SRC A;  1MV0 B;  1JXM A;  3M0U A;  3SHW A;  4OML A;  4FSS A;  3ZL7 C;  3REB B;  4OMN A;  1WIE A;  3UA6 A;  2DNU A;  2LNH B;  4AFS C;  1FMK A;  2MCN A;  2L3S A;  2EPD A;  5I22 A;  1X43 A;  2K9G A;  1AVZ C;  2J6O A;  2M51 A;  3NGP A;  1FYN A;  1ZLM A;  2D8J A;  1TG0 A;  3EGU A;  1QWE A;  2LJ1 A;  2KRO A;  1OPK A;  1VYV A;  5IH2 A;  1GCQ C;  2GNC A;  2HBW A;  2DE0 X;  1AOJ A;  4ORZ A;  5IHI A;  2ENM A;  1E7O A;  3I5R A;  2B86 A;  2K7A A;  2RQT A;  1T0H A;  3SEM A;  2CT4 A;  2J05 A;  2DF6 A;  4QT7 A;  1NLO C;  2W0Z A;  2O9V A;  2KXC A;  2RQV A;  1ZUU A;  1AZE A;  2YUN A;  2FO0 A;  3M0S A;  3NPF A;  1KFZ A;  3I9Q A;  1X2Q A;  4R0K A;  2RF0 A;  1JEG A;  1BBZ A;  3I35 A;  3H0F A;  1JU5 C;  1H3H A;  1YWO A;  1BB9 A;  1LCK A;  1Y57 A;  2DBM A;  2HCK A;  1WXT A;  2KRM A;  2DRK A;  1JQQ A;  4OMP A;  3VS1 A;  1ZSG A;  2C0I A;  5IHN A;  1RUW A;  2EYY A;  1AZG B;  4JJB A;  4RUG A;  2KGT A;  3H0I A;  2OI3 A;  4CC3 A;  2CSI A;  3VS3 A;  1IO6 A;  2KYM A;  1WLP B;  2OJ2 A;  2DJQ A;  4RTU A;  4LN2 A;  2A28 A;  3EG2 A;  1M3A A;  1PKS A;  2MIO A;  1SRM A;  2CDT A;  1KSW A;  1AWW A;  1AWX A;  2JS2 A;  4JJD A;  4IIM A;  1YP5 A;  1OV3 A;  1AEY A;  2BZ8 A;  3VRY A;  2EQI A;  2ABL A;  3NHN A;  3H0H A;  1QLY A;  4OMM A;  3VS0 A;  2JM9 A;  2BZX A;  4JZ4 A;  2FG0 A;  4HCK A;  1UFF A;  1JXO A;  3VS2 A;  1OPL A;  1A0N B;  2FPD A;  2RN8 A;  1GFD A;  1U06 A;  2EBP A;  2DL7 A;  4A63 B;  4Z8A A;  1TUD A;  2EYX A;  2DL5 A;  2X3W D;  1G83 A;  1H92 A;  2A37 A;  1V1C A;  2DL3 A;  2EW3 A;  2KBT A;  2YUQ A;  1UTI A;  3FJ5 A;  2RQW A;  1K4U S;  4ZNX A;  5FWB A;  2LZ6 B;  1PHT A;  4AFZ C;  1UJY A;  2GBQ A;  1UG1 A;  1E6H A;  4RTY A;  1E6G A;  1NEB A;  2ECZ A;  4JZ3 A;  2BZY A;  3M0T A;  4AG1 C;  2AK5 A;  2DLP A;  3JV3 A;  3UA7 A;  5IXF A;  2D8H A;  4F16 A;  2K6D A;  2IIM A;  3EHQ A;  5FW9 A;  2DMO A;  1Z9Z A;  1OOT A;  1ABO A;  2J6K A;  2W10 A;  3RNJ A;  2K2M A;  1J3T A;  3I5S A;  4D8K A;  1WXB A;  1PWT A;  2PZ1 A;  5FWC A;  4J9G A;  2KRN A;  3TVT A;  1SEM A;  1W70 A;  2CRE A;  1NM7 A;  5I11 A;  2JMC A;  2JW4 A;  2XMF A;  2ROT A;  2K3B A;  1N5Z A;  2O88 A;  2J06 A;  4M4Z A;  1HD3 A;  2AKL A;  2LQN A;  1SRL A;  2EYW A;  2DYB A;  2YSQ A;  1WX6 A;  3C0C A;  4IIO A;  1GBR A;  1OEB A;  3GBQ A;  2ED1 A;  1QCF A;  2RMO A;  2FRW A;  4RTZ A;  2JT4 A;  4EIK A;  1M27 C;  1B07 A;  1JO8 A;  1M3B A;  2RQR A;  2HDA A;  4CC2 A;  1PRM C;  2E5K A;  2D0N A;  1G2B A;  1BU1 A;  1K76 A;  2FEI A;  2J6F A;  4HXJ A;  1H8K A;  1RLP C;  5HCK A;  4WCI A;  2VVK A;  1UHC A;  4DEX A;  1U3O A;  2A36 A;  2KRS A;  3VRZ A;  1TUC A;  2HSP A;  2V1R A;  2YDL A;  3M0P A;  1T0J A;  2DL4 A;  2CUD A;  1QKX A;  2H8H A;  1WYX A;  2KT1 A;  2YUO A;  1X27 A;  3RBB B;  2F2V A;  2CH4 A;  4J9C A;  1PKT A;  1XOV A;  1B3Q A;  1SPK A;  1NG2 A;  3THK A;  4GBQ A;  2LJ3 A;  1MV3 A;  1YN8 A;  2DM1 A;  4RTW A;  2DIL A;  1UHF A;  2ED0 A;  3NMZ C;  2P4R A;  3EG0 A;  1KJW A;  3M0Q A;  2MOX A;  2F2W A;  2CH4 W;  1AWJ A;  2M0Y A;  2RNA A;  2VKN A;  5ECA A;  1ARK A;  2V1Q A;  4CC7 A;  2FRY A;  1EFN A;  1ZX6 A;  3UF4 A;  2A08 A;  1QWF A;  5IXB A;  1GCQ A;  1NYF A;  2F2X A;  3EG1 A;  3TSW A;  2JM8 A;  4LUD A;  4DEY A;  2EGC A;  1AD5 A;  3EG3 A;  3REA B;  4RTT A;  2GQI A;  2YT6 A;  2PTK A;  1ZBJ A;  1M3C A;  2NUZ A;  2O9S A;  4RTV A;  1U5S A;  2GTO A;  1WDX A;  1ZUK A;  2LQW A;  3PE0 A;  1Z9Q A;  1W1F A;  1SHF A;  1WA7 A;  2DL8 A;  3UAT A;  2I0N A;  3O5Z A;  3A98 A;  3IQL A;  1I1J A;  2G6F X;  2LX7 A;  2O31 A;  3TSZ A;  1GFC A;  3PVQ A;  2KR3 A;  2EGE A;  2X3X D;  4JPB W;  2EVR A;  1PRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...