2JTEA

Third sh3 domain of cd2ap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title The high resolution NMR structure of the third SH3 domain of CD2AP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jteA00
2L2PA 4J9HA 1X69A 2W10A 4JJDA 2EYYA 3THKA 1WXUA 1UJ0A 1V1CA 1Y0MA 1Z9ZA 4GLMA 1HJDA 1PNJA 1G2BA 1JQQA 1UHFA 1ZLMA 2O9VA 1VYTA 1GCQC 3U23A 2AK5A 1PHTA 3ULRB 1GBRA 2BZXA 2CUBA 3EG2A 1X43A 1FMKA 1SEMA 2CSIA 2O88A 3H0HA 1JO8A 2JTEA 2LQNA 3VS3A 2EKHA 1UFFA 2EYXA 2ECZA 5FWBA 1MUZA 2CT4A 4AFZC 3EG3A 1BU1A 1K0XA 1E6HA 1YNZA 1NYFA 1QWFA 5EC7A 1CKAA 1BBZA 4OMLA 3CQTA 4OMMA 4OMPA 2F2VA 2LCSA 2ROLA 2EPDA 3VRZA 2J6FA 5IHKA 3VS6A 2ESWA 2JXBA 2M0YA 1K76A 4RTVA 1GCQA 2DLPA 4AFQC 2DL5A 2GNCA 2KROA 2SRCA 4RUGA 3VS7A 2DILA 2EGCA 3TVTA 1H3HA 2RQWA 2FRYA 1PWTA 2H8HA 1GRIA 4D8DA 1PKTA 2F2WA 2VVKA 2V1QA 2RQVA 1JXOA 1ARKA 1X6GA 2HBWA 2MCNA 1UGVA 4DEYA 1B07A 2DNUA 2CREA 2LMJA 2L3PA 5GJWB 1RI9A 1WX6A 2QDLA 1J3TA 1AD5A 4OMQA 2ENMA 3TSZA 2J7IA 4LUEA 1RUWA 3EHRA 1WFWA 3VRYA 4CC7A 1TUCA 2RNAA 2BTTA 3JV3A 2A08A 5IH2A 2J05A 4WCIA 4HXJA 2D1XA 3M0QA 1RLQC 4JJBA 3H0IA 3H41A 2LP5A 1HD3A 3VS4A 3SEMA 1OPLA 1AZGB 5FWCA 1GFDA 2O9SA 1UHCA 2DL4A 2DRMA 2YUPA 1AVZC 2YUNA 1OPKA 2CH4A 2DYBA 2FEIA 2G6FX 2K2MA 2KXCA 4D8KA 4ESRA 1K0SA 1OEBA 1W1FA 3M0TA 1AWJA 3PE0A 2GGRA 4F14A 4LN2A 2KT8A 4HVWA 1M8MA 2PTKA 4JJCA 1BK2A 3IQLA 4K11A 1I07A 2ABLA 2GTOA 1WYXA 1TUDA 1U3OA 1CSKA 1NLOC 2VWFA 2DMOA 1Y57A 2V1RA 1NEBA 2ED0A 2JT4A 2K3BA 2I0NA 4CC3A 1YN8A 2L0AA 1T0HA 1GCPA 2AZVA 4RTXA 5IXBA 2LZ6B 5IHIA 3C0CA 4X1VA 3NHNA 2EYZA 2DJQA 1ABQA 4IIOA 1MV3A 1OV3A 2FPDA 1X27A 3NPFA 1ABOA 1JU5C 1K1ZA 4LE9A 1AWXA 2KR3A 1NLPC 3RBBB 1UECA 1U06A 1GBQA 4JZ3A 2K6DA 2J06A 1AZEA 1NYGA 2RN8A 2DL3A 4J9CA 2YUQA 5HCKA 4RTUA 2LJ3A 1UG1A 4OMNA 2A28A 4AG2C 1QKXA 3EG0A 1SHFA 1T0JA 1I0CA 1UDLA 2X3WD 4RTTA 4J9BA 1YWOA 2MIOA 1YWPA 2JMAA 1IO6A 1UTIA 2CT3A 4OMOA 1UE9A 2C0TA 3VS5A 1A0NB 4ZNXA 2JMCA 3A98A 3FJ5A 1ZUUA 4LUDA 1KFZA 2DL8A 4AG1C 1YCSB 2K7AA 4CC4B 5IXFA 3TSWA 1SRLA 2KEAA 2KGTA 3LH5A 2BZ8A 1OOTA 3EGUA 2L3QA 2L3SA 2GBQA 3RNJA 2RQRA 1PKSA 2AZSA 2XMFA 2HDAA 4HVVA 3I5SA 2F2XA 3R6NA 1X2QA 1JEGA 1TG0A 1SHGA 1GFCA 2JM8A 3REBB 3EG1A 2DL7A 1XOVA 2J6KA 3M0PA 1VYVA 2D0NA 2FPEA 2LJ1A 2JS2A 3SHWA 2C0IA 2LX7A 1JXMA 2A37A 2X3XD 3EHQA 2JW4A 1EFNA 4E6RA 2FG0A 1K9AA 2RPNA 2KYMA 2K9GA 2EGEA 4M4ZA 1UJYA 2K79A 1VA7A 2LQWA 3UA6A 2PNIA 1ZUKA 2J6OA 2KNBB 1N5ZA 1QKWA 1WI7A 2PZ1A 3VS2A 1SPKA 2DBKA 3O5ZA 2RQUA 2CUDA 2FPFA 4IIMA 4CC2A 1AWOA 2DVJA 3PVLA 4HCKA 3UA7A 4Y92A 2M51A 2CSQA 2E5KA 4FSSA 1QLYA 5I22A 1KJWA 2YDLA 4F16A 2NUZA 1H8KA 4HVUA 2EBPA 2FO0A 3I35A 1W70A 4Z89A 1HSQA 1I1JA 1WXTA 1B3QA 1X6BA 2HSPA 1WLPB 2KRMA 3UATA 2O2OA 2MOXA 2P4RA 1T3LA 1W6XA 2CH4W 4J9DA 2D8HA 1M30A 3NGPA 4JZ4A 1S1NA 1U5SA 2DX1A 4RTZA 3I5RA 1LCKA 2EQIA 2O31A 2HEQA 1M27C 1NG2A 2DRKA 2DM1A 1E7OA 2HCKA 3QWXX 4J9GA 2EVRA 3KFVA 2YT6A 2SEMA 3QWYA 1RLPC 1T3SA 2BZYA 5ECAA 2KXDA 2KE9A 1K4US 1E6GA 1AEYA 1UUEA 1NEGA 1SRMA 1QWEA 2B86A 5I11A 2GTJA 1M3CA 2W0ZA 1VYUA 1X2KA 2IIMA 1AOJA 3VS1A 2EGAA 5GJVB 1GL5A 1Z9QA 2CDTA 1WXBA 3M0SA 2VKNA 2FRWA 1ZX6A 2KRSA 4KRTA 4JPBW 1BB9A 2YUOA 4AFUC 1CKBA 4F17A 2OAWA 2RQTA 3GBQA 3M0RA 4A63B 2KRNA 1WA7A 2JM9A 1H92A 1ZBJA 2A36A 5L23A 1NM7A 2OJ2A 2AKLA 1PRMC 3H0FA 4DEXA 2RF0A 1KIKA 1QCFA 2GQIA 3NMZC 1WIEA 2RMOA 2C0OA 2JS0A 4J9IA 4EIKA 3UF4A 2DA9A 2EYWA 4AFSC 1KSWA 1G83A 4Z88A 2KYBA 2DE0X 3REAB 2OI3A 1PRLC 2DBMA 4QT7A 3ZL7C 5FW9A 4RTWA 2ED1A 3I9QA 1YP5A 1M3BA 1M3AA 2D8JA 2KT1A 4RTYA 2KBTA 4J9EA 5IHNA 2AKKA 4J9FA 4R0KA 4Z8AA 1FYNA 4ORZA 2ROTA 1SSHA 2EW3A 2LNHB 1ZSGA 1WDXA 3M0UA 3VS0A 1MV0B 4GBQA 2DF6A 4LNPA 2NWMA 2LJ0A 1ZUYA 3PVQA 1AWWA 2YSQA
chains in the Genus database with same CATH superfamily
4E7LA 4L5GA 4EMKB 1WXUA 1YIJA 1Z9ZA 3MHXA 4XTXA 1AT1B 1G2BA 1ZLMA 2O9VA 3A1PA 3UPUA 1VQOQ 3L2ZA 2AK5A 2OAUA 4M7DG 4M75B 5KCHA 2FVUA 1YITT 2HNIA 2KI7A 2WSFE 3H0HA 1TH7A 2EJFA 3QKJA 4XTVA 4HT9A 3MJXA 1YJ9T 2CT4A 4AFZC 1NJIU 3UT1A 3EH2A 4XTZA 1V76A 1YNZA 4C0ZA 3OBYA 1IXDA 3UWNA 2DO3A 4F7UF 4RG8A 3GLXA 4NS5A 1B7TA 4L6V5 1WHMA 3OS5A 1CKAA 1PSEA 3CQTA 5GAN4 4E7ZA 3TQ7P 3EG9A 2AT1B 5M9OA 2EPDA 3G71T 1TS9A 4BE0A 1JJ2A 3M53A 5IHKA 4M7AG 2GFUA 5GMKj 4BD3A 1VQ7Q 1GCQA 3NTHA 2DL5A 2GNCA 3M9QA 3ZBDA 1H3HA 2OTLA 1PWTA 1VQKT 3RESA 4PJOF 2JTFA 5DY9A 3OW2P 1FWZA 1X6GA 2HBWA 3FDRA 3VU3C 1OZ2A 2EKOA 4DEYA 3BY7A 4M78E 2L3PA 5GAMe 3OYLA 2VXEA 3CCUA 2F1LA 2LQKA 4OMQA 2ENMA 3QBYA 1XQHA 1RUWA 3HRUA 1WFWA 4M75D 3PMTA 5LJ3e 2IPOB 3VRYA 4CC7A 1PD0A 2M16A 2RNAA 5KYYA 1S72Q 5IH2A 2LP5A 1HD3A 3VS4A 3SEMA 3CMAA 1M2OA 4FCYA 2X4WA 3H9NA 2XDDA 3RERA 5I2MA 1FX7A 2DL4A 5KYXB 1R0CB 1AVZC 2YUNA 4C0FA 1G5VA 2K2MA 4JRQA 4QQGA 1K8AR 4A4GA 1BCMA 4LN2A 5GAOl 5KYWA 2KMTA 2PTKA 3JRZA 1VQPA 3QUIA 4C92F 3OW2A 2NUTB 4J7FA 4QVDA 3FC3A 2GTOA 3S3NA 1EX4A 1WYXA 5KE2A 1U3OA 1CSKA 3DLLA 2VWFA 4O6JA 2DMOA 2K5LA 2GCXA 2K2VA 1YN8A 1Q81C 3M59A 2ZCFB 2LTOA 1W2BS 2LZ6B 3SWNC 2FZCB 1OYXA 3NHNA 1N8RR 2COYA 2EYZA 2DJQA 3CPWS 1Q95G 4PFOA 1JU5C 1K1ZA 2YLCA 2KR3A 1IRXA 4OB1B 4PLLA 2J06A 1NYGA 1M2VA 3QXEB 3CCQQ 3HPWA 2YUQA 5HCKA 1VQOA 4RTUA 2HKNA 1UG1A 2VUBA 1MHNA 3EG0A 1IGUA 2QA4T 3I56T 2R57A 1I0CA 3L2RA 3OYJA 4RTTA 3TU4K 2M0OA 1YWPA 2JMAA 1A0NB 2C0TA 3OS2A 1RAFB 2E12A 3DB4A 1ZA2B 1RABB 4M77F 4MZTA 4HCZA 1YCSB 5GANh 3JCMf 1X75C 2YHTA 2BZ8A 1OOTA 1VIFA 4RG2A 1NPRA 2RQRA 1PKSA 2AZSA 4ZN1A 2CYZB 1O75A 3BDLA 1HK9A 2HDAA 4LXCA 4WTOB 2COZA 1VQ7A 1ZA1B 2JM8A 1UGPB 4A4KA 2R58A 4OGEA 1FXXA 2J6KA 3JCMg 3M0PA 3A8MB 2D0NA 2LX7A 1K9AA 1TWBA 2K57A 3ASKA 1B34A 3MEWA 2F5KA 1G3SA 5CKDA 4C8QB 2J6OA 3RKWA 2PZ1A 5HK3A 5FU7B 4E7JA 3CXCS 1VQLT 3G6ET 3PT9A 2CUDA 2DERA 4IURA 1MMDA 4Y92A 2E3HA 2E5KA 2OTJQ 3CCET 1N6AA 4FSSA 3RKXA 2YDLA 4F16A 5GANd 5CQYA 4RCCA 4MMKA 1S72A 1KC8U 1HSQA 1WXTA 1M90U 1O9SA 1WLPB 2A3LA 3OYHA 2DYIA 4CI0C 1QMCA 3M58A 3UATA 2O2OA 4FW2A 2P4RA 1T3LA 1TSFA 2LC4A 4BUGA 1KK7A 1W6XA 2D8HA 3CBPA 3V8JA 5CVIA 4IUVA 3V8LA 5GMKh 3I56A 3QYGB 4M78G 3EGXB 1LCKA 1BCOA 4PJOC 2EIFA 4OF1A 3JCMX 1M27C 4WF2A 2G3RA 2QQ9A 4ANJA 1VQ8T 1E7OA 2E6NA 2HCKA 1M1KR 3OYGA 2YT6A 4A53A 3OMCA 4BB7A 3QPHA 4KBMB 5A0DA 3S3OA 2BZYA 4Y28E 2CP6A 2EAYA 9ATCB 2DTIA 1MNEA 1VYUA 3X20B 1VUBA 3VS1A 3OY9A 1PC0A 3ZFJA 2RJFA 2KRSA 4MMLA 2R5MA 4KRTA 2M9UA 1CKBA 3S3MA 4D6WA 1ZBJA 4BDZA 5L23A 3FLGA 1I5LA 4KH0B 4JDSA 2OJ2A 3VYHB 5CAIA 3AT1B 3H0FA 3HTRA 5GAN2 3A5ZB 3CCQA 2GQIA 1QVFP 5A0GA 2DXBA 2P0KA 2YXYA 1G3YA 2C0OA 1M5Q1 2JS0A 4J8OA 2E4HA 4AFSC 4C92C 2CP5A 1G83A 3REAB 2DE0X 3MP6A 1VQLA 1M1GA 4QT7A 3CD6T 2KY9A 3R6OA 5KYNA 5L8RE 4RTWA 3KUFA 1G8XA 3OYDA 3MP8A 1D1CA 1M3BA 2DD5A 2EJGA 1RADB 1JBMA 2QGFB 3ER0A 5IHNA 4PL6A 2YRVA 1NE8A 2IG0A 2EW3A 2LNHB 3M0UA 3VS0A 4GBQA 1U8RA 1K73U 2LJ0A 3OYYA 3CCMQ 2V26A 1YI2Q 2YSQA 1VQ4T 4M7AF 2V8JA 2EYYA 4BE2A 2AHJB 2NLUA 4GLMA 1UJ0A 2L8DA 2QQBA 1PNJA 1JQQA 1UHFA 1WGSA 1GCQC 2F5TX 2QQRA 5GANe 2E6ZA 1YJWQ 1C6VX 1QVFA 2DXCA 1OX8A 1PHTA 3SB2A 3QG1A 3JB9J 4DOVA 3H8ZA 1GBRA 2E65A 3OS1A 1OQKA 1FMKA 1SEMA 3I55T 3JCMb 2QDYB 4M77C 3JB9G 2KVQG 2PVGB 2L89A 2EYXA 3JB9H 1MUZA 2A7YA 4RMOA 4M7DB 1BU1A 4LDWA 1NYFA 2OTJA 2JVVA 4F7UA 2K3XA 3CCJT 3FB9A 4ZTJA 4OMPA 5HKCA 2QGGA 3GOXA 3E1SA 2LCSA 1I4K1 1MNDA 2RH2A 3V7CA 1LJOA 2M0YA 1K76A 2FYKA 2QASA 4J6YA 2KROA 2E70A 4A54A 3EFOB 1U1TA 3VS7A 3MPUB 2LDMA 2LT4A 2FRYA 1B34B 4M75F 1X01A 2WSCE 1PKTA 3L2WA 2X9HA 5GAMf 4PJOA 2VVKA 3HFNA 2V1QA 1JXOA 5LJ5f 3FIFA 2EQKA 3NTIA 5DLOA 2DXUA 1Q82U 2DNUA 5LJ3f 2CREA 2LMJA 3JCMQ 2NUPB 5GJWB 1YITQ 4BDYA 4FT2A 2QDLA 3Q1JA 1AD5A 2KQWA 5GAOm 2PUKB 2HQEA 5GMKe 1YJ9Q 3E2UA 5GAMg 1JB0E 4VUBA 2QEXT 2A08A 2O4XB 5KYUA 5LJ5g 1SSFA 4BY6C 4HXJA 2FB7A 3LX7A 1Y71A 2PUOB 4FL6A 2Y4XA 5LJ3g 2E10A 4X9CA 4M7DD 1AZGB 4E2FB 3G71Q 1VQNT 1GFDA 4NL3A 4ZTFA 3CC7T 2YUPA 1VQ9T 3JAME 1OPKA 2CH4A 1VQ6T 1UB4A 1KD1C 4JLGA 1K0SA 1W1FA 2HL5C 1AWJA 3TCJA 2VB6A 3QSUA 1G3TA 2KT8A 1MMAA 2QQAA 3P8HA 2Y4YA 1VQKQ 2NYSA 1NBEB 4C92A 4K11A 4DBFA 2HAXA 2QK0A 4R56A 3JCMW 2E5QA 1NEBA 2JT4A 1OX9A 3RR6A 3A8OB 4M7AD 2L0AA 2AZVA 1GCPA 3SWNB 5IXBA 5IHIA 1WHHA 4F04B 1WQWA 4DA4A 4X1VA 1K9MC 3A8GB 4OB3B 4F7UE 1ABQA 2E41A 3JB9I 2X35A 2XHCA 1OV3A 3CCMA 1YI2A 3VKIA 4CRIA 1AWXA 1NLPC 2ZPEB 4PJMA 1GBQA 2K6DA 1BI3A 1RAGB 1LVKA 1WNLA 1X6OA 1YJWA 4AG2C 1Q7YC 1QKXA 1SHFA 3CPFA 2BUDA 2X3WD 3OYAA 1UE9A 3VS5A 1YHQT 4PJOE 2JMCA 3A98A 4JUVA 4KH1B 3JCMP 4M77A 3KXTA 1BI1A 4P5NA 4AG1C 2JZ2A 1QVGP 2MWPA 4E47A 4GLKA 1VQMT 1ACMB 2KEAA 1KC8R 3BW1A 1M90R 2VYTA 2GBQA 1OU9A 3RNJA 2EQJA 3G1JA 4B6MA 2XD0A 2XMFA 5GAN5 3EGDA 2EWNA 4BI4A 2CP2A 2F2XA 1FMWA 1SHGA 3F70A 4LDUA 3REBB 2E64A 2QAZA 4DQ2A 2FZGB 3X24B 2FPEA 3SD4A 5GAN6 2C0IA 2A37A 3EHQA 2GQVA 4E6RA 2FG0A 2BE7D 2RPNA 3L2VA 2GFAA 4M4ZA 7AT1B 1UJYA 4ZN3A 2K79A 2DAQA 2QA4Q 3I56Q 1VA7A 3OYFA 2PNIA 1NZ9A 4HA8A 2RQUA 1YITA 4C92E 2QTVA 2FPFA 4CC2A 1AWOA 2DVJA 3PVLA 4HCKA 4ELZC 3UA7A 3CMET 2M51A 1QVGA 1YJ9A 1QLYA 2CP3A 3URGA 3O8VA 1H8KA 4HVUA 1RACB 2HQXA 1W70A 2COWA 2HSPA 4PJJA 1PM3A 3AHUA 3G71A 2ZPFB 3BE3A 4N4HA 3T9NA 4X34A 1RL2A 3EAEA 2EQIA 2O31A 5C0MA 1P92A 1M8VA 4BACA 1YHQA 3P8DA 4C8QF 4J9GA 3CC4T 1VQKA 1ZHIA 1KQSP 2EVRA 3KFVA 2BKDN 4M78B 2MMPA 5GAOp 1BYMA 1RLPC 1T3SA 2X4XA 2KE9A 1K4US 1E6GA 1AEYA 1MMGA 1XJWB 4JRIA 4EMHA 2B86A 2EFIA 1VQLQ 4M77E 5GAMj 3G6EQ 1KHCA 2W0ZA 1VQ5T 1X2KA 5LJ5j 1H3ZA 4C0DB 1K73R 4O5VA 2EGAA 5IN1A 3M0SA 1WXBA 3CCEQ 5LJ3j 4YTLA 4F17A 2RQTA 3GBQA 5GMKl 2JM9A 1H92A 3CC2T 4LDYA 5DM7R 1NM7A 1LPLA 1QCOA 4PFPA 4DEXA 1ZSZA 2RF0A 2CZ6B 3NMZC 2DIQA 2MI6A 1D3BA 3LWIA 5J39A 1YBYA 3UF4A 1QCNA 2DA9A 1KG1A 2KYBA 3GNFB 1PRLC 2DBMA 1VQ8Q 1JJ2S 1KQSA 5FW9A 4F7UG 5CKBA 2ED1A 1OU8A 3M54A 1UGSB 1YP5A 4LDXA 1M3AA 2KT1A 4RTYA 3GNGA 5J3BA 3V8KA 2AKKA 2XI9A 1FYNA 1D09B 2DZ9A 5GAOn 2ROTA 4ELYC 1ZSGA 2EYQA 4XU2A 3CCLT 1UEBA 2P0PA 4M78D 2NWMA 1ZUYA 3EG9B 3G7ZA 4M7AA 2L2PA 4J9HA 5CKFA 2HZYA 5GANf 1WJQA 1X69A 2W10A 3M55A 2VGMA 3THKA 1Y0MA 3CCRT 1V1CA 1C1AA 5GMKi 4PJOG 2VASA 1HJDA 2RJDA 1EZZB 5GAN8 3E19A 3PMIA 5EG2A 2JJ9A 3J81E 1Q86C 3ULRB 1Q82R 4XU0A 1N9SA 4HT8A 4DOWA 2QA4A 1X43A 1RAIB 5GANg 1D1AA 2O88A 1JO8A 2LQNA 2DTOA 3L42A 3VS3A 2EKHA 2ECZA 3CD6Q 3EG3A 1K8AC 3C94A 1K0XA 1Y96A 1QWFA 2K4YA 3GF5A 3NFCA 2RI2A 1BKBA 3UDCA 1M4ZA 1RAEB 3E9FA 4NL2A 4OMLA 1DJ7B 4OMMA 2XICA 3FRNA 2MK5A 2F2VA 5KYYB 3VRZA 1BIBA 1JRIA 3C95A 3VS6A 3OW2S 5CKEA 3C4SA 5CCAA 4EMKA 4BE1A 1I5OB 4C8QD 2K3YA 4RTVA 1VQ4Q 2D0QB 2JUFA 2SRCA 1N8RC 3M57A 4OGCA 2EGCA 3QHSA 4KGVB 3J80E 3RUXA 5KCOA 2MWOA 1OZ3A 4C92G 4M75A 1GRIA 4D8DA 2F2WA 1HXDA 2YRDA 3EFRA 1BIAA 4E7SA 1ARKA 3FJPA 4DBRA 1UGVA 1WHLA 1WJRA 1B07A 5KYWB 4Y91A 4C5EA 4M7DF 4OVAA 3I55Q 1WX6A 4ZGJB 1YJNT 3TSZA 2DEQA 3G6EA 2J7IA 4XAXB 4LUEA 5CK9A 1QP3A 2JOYA 2K5FA 2RA2A 2HMAA 3QO3A 1TUCA 4MDXA 2LCLA 3JV3A 3CCEA 4BY6B 4PJLA 3CCJQ 2J05A 4WCIA 2V8IA 4EMGA 1RLQC 1TOVA 2DTHA 3G4ST 3H0IA 3H41A 2DETA 3A8HB 4QVZA 1OPLA 3CCST 3HP9A 2YLBA 5FWCA 2VGNA 4M7AE 3PIPA 1D0YA 3JB9D 2P84A 3CCVT 1M2VB 4ESRA 2FEIA 1OEBA 2RD1A 3M0TA 2GGRA 4M77G 5FU7C 4HVWA 4GY5A 4JJCA 3IQLA 1I07A 2RJEA 2X51A 1VQ8A 2CZ7B 3VV0A 3OYMA 2ABLA 4IKFA 1TUDA 1Y7XA 1NLOC 2P4TA 2P0QA 1U1SA 1Y57A 2V1RA 3H6ZA 4RCBA 2K3BA 2I0NA 4CC3A 2R5AA 1WHKA 2MPXC 4RTXA 3OA6A 4PNOA 3CBMA 2HL3A 1PSFA 3C0CA 2KK4A 3QIIA 4X9DA 4JS5A 5KE3A 4BI3A 2E1HA 5HK0A 2XDPA 1TTHB 4IIOA 5LJ5h 1QQJA 1MV3A 2FPDA 2PVDB 3NPFA 1ABOA 2QEXQ 2KSSA 1YIJT 4QQDA 4LE9A 4J7IA 3ZEHA 3RBBB 2DKGA 1UECA 1U06A 1KQ2A 5CQXA 1AZEA 3PTAA 2RN8A 1W2BP 3JCMJ 1VQNQ 2DIGA 3LYIA 1V29B 2DXTA 2LJ3A 4OMNA 4FW1A 3JCMc 3CPWP 3CC7Q 1T0JA 4N0AA 1VQ9Q 1I8FA 4J9BA 1YWOA 5J26A 4M75E 2NUTA 3MKDA 1VQ6Q 1UTIA 2CT3A 4OMOA 1VIEA 1WJSA 2RHUA 3OQ5A 3FJ5A 2MF2A 1MGQA 3OYCA 3GP8A 4LUDA 1QP2A 1KFZA 3CD6A 2RK1A 2DL8A 3OYNA 5IXFA 2I2LA 3A8LB 2ZZDA 3PFSA 3TSWA 1M1KC 2WSEE 5DLQE 1QW1A 4Q5WA 1I81A 2L3SA 4B9WA 3G4SA 2A0FB 5GAOq 3BDUA 3SFMA 5A0LA 2GF7A 4A4FA 5LJ5d 3MO8A 4HVVA 3R6NA 1JEGA 2HKQB 5I2SA 1TG0A 1UGRB 2OTLT 1VQ4A 2QQSA 2X4JA 2DL7A 4J6WA 5IT9E 2DFUA 4IUPA 3OB9A 1W2BA 1OI1A 1VYVA 2JS2A 1EFNA 3HSBA 4FYYB 2KYMA 2K9GA 4PK4A 3CPWA 5GANj 1Q81R 3M5AA 2XK0A 3L2UA 4ATOA 4ZGEB 2LQWA 1N27A 3CCUT 1ZUKA 4OB2B 1QKWA 2RI3A 3VS2A 1UGQB 1SPKA 2DBKA 4OP0A 1YHQQ 3MEAA 3I55A 5FU6C 1WQ7A 2JTMA 3HRSA 3CEYA 3CBOA 5LL6S 5D6XA 3TREA 1VOMA 2PQWA 1KJWA 5I22A 2NUZA 4PJNA 2DJZA 1VQMQ 1NJIC 2L5QA 3CMAT 3GPLA 3CCJA 1I1JA 3NTKA 1B3QA 1X6BA 3CXCP 2KRMA 5IAYA 1R8OB 4ZGDB 2VC8A 1SG5A 4JRPA 4J9DA 1IHVA 4JS4A 1KD1U 1M30A 3NGPA 4JZ4A 2DK3A 4LDVA 1U5SA 2CZ0B 5D6YA 4E7HA 3I5RA 4A4EA 4QQ6A 5GMKm 1ZSZC 2HEQA 4FU6A 1VQPT 2CP0A 2DRKA 4Z02A 4C8QA 2HQHA 4V2SA 2ZPGB 3X26B 3QWXX 3VUBA 2FHDA 4M7DC 1BI2A 2ZPIB 2RHYA 2DVEA 2SEMA 3QWYA 3VUZA 8ATCB 1GXIE 3HKSA 1PD1A 5ECAA 2KXDA 5D7UA 4PLIA 1PCXA 1UUEA 1K9MU 2RO0A 1QWEA 3QJ6A 2GTJA 1IREB 1XTDA 1QVFS 3CMEQ 3DB3A 5GJVB 1GL5A 2CDTA 3J7AF 2VKNA 2FRWA 4FT4A 4FM4B 2YUOA 4AFUC 2D6FA 3M0RA 4A63B 2KRNA 1RAHB 2QEXA 2RK2A 3CXCA 2DEUA 2A36A 1Q7YU 2ZAEA 1VQOT 5D6WA 4M7AC 1PRMC 3EGXA 4JRKA 1VQNA 1KIKA 1WIEA 2RMOA 3CC7A 1VQ9A 4J9IA 3MCAB 4L59A 2EYWA 1VQ6A 5LJ5e 4M78F 1D1BA 4R55A 4IUUA 3CC4Q 1WZOA 1BI0A 3RMQA 2D8JA 4KGXB 1NPPA 4J9EA 4J9FA 4DBHA 2LX9A 4R0KA 3TEEA 4PKCC 1SSHA 2RI5A 1Q86R 1AHJB 4F7UB 3RMSA 2YWWA 2HBPA 3OYEA 1VQ5Q 1MV0B 2DF6A 1VQ7T 1AWWA 1KQ1A 4HKEA 4JJDA 4M75G 4NOYA 4FIBA 5CR2A 4EMKC 3CC2Q 1VYTA 2WACA 4C5HA 4QKUA 1TUGB 3U23A 3JSCA 3RKYA 5C6SA 4M75C 2BZXA 2CUBA 3EG2A 4PJOB 2QI2A 3JCMh 4EDUA 2CSIA 3HL8A 1G3WA 4C8QE 2JTEA 5GAN7 1UFFA 1FMVA 5FWBA 2KAFA 2MAMA 1E6HA 5AYFA 5EC7A 1Q81U 2VXFA 3QZ9B 1S72T 1VQMA 1BBZA 5A2QE 2QTXA 2ROLA 4MZMA 2C06A 5KYUB 2V8KA 2J6FA 3CCLQ 5CO7A 4C5IA 2ESWA 2JXBA 4IUTA 2VV5A 2DPPB 4FYVB 3KBGA 4KGZB 2JNGA 2E3IA 2DLPA 4AFQC 2X4YA 3INZA 2YRCA 2K5IA 4XQ3A 1LNXA 4RUGA 2DILA 3TVTA 2RQWA 2IVWA 2CGHA 5GAOr 3CCRQ 3DKMA 2H8HA 2HD0A 1M9SA 3MEUA 3QYHB 2RQVA 5I21A 4UC4A 3E9GA 5FRMA 2MCNA 4EPCA 3X28B 3JCMd 4M7DA 1MMNA 4C92B 2RM4A 1RI9A 1J3TA 3OSSC 3FEOA 4XU3A 3JB9F 3EHRA 2BIVA 2FL7A 2LT1A 3CMEA 2BTTA 4PJOD 3N5BB 4FYXB 2QXFA 4XTWA 3LW5E 2AIRB 3M4GA 2D1XA 4JJBA 3M0QA 2EQUA 1WHGA 5FLXE 1TXQA 1WPYA 5FRNA 2RHXA 3CCQT 1KC8C 3EFOA 2O9SA 1UHCA 1M90C 2RHIA 3L1AA 5CKHA 2CKKA 2DRMA 2LQ8A 3WVEB 2QYZA 1IHWA 2DYBA 2KXCA 4D8KA 2G6FX 4II1A 3LWHA 3PE0A 4F14A 2LNVA 2CP7A 4FYWB 1M8MA 4N0AC 1BK2A 2NUPA 2RJCA 3CC4A 2L3RA 2OX7A 4N4GA 2ED0A 2PU9B 1YFNA 4M77B 3PNWC 2QG9B 4KT0E 1T0HA 2RB6A 4XTUA 4XTYA 1YJNQ 2EJ9A 2O4XA 4IUQA 3VYGA 4MZPA 3DLMA 3RDVA 1VQ5A 4RKUE 1EIFA 4C92D 1R0BG 1X27A 4C0GA 2BE9B 3PIOA 4KUIA 4HCBA 3LH0A 3EGDB 3G4SQ 4JZ3A 3CCSQ 4KULA 2FZKB 1Q86U 5HY6A 5KH6A 2DL3A 3CC2A 4J9CA 2O01E 4AMCA 1QVGS 2A28A 2LVMA 1M1FA 2MYSA 1UDLA 2LRQA 4M78C 3CCVQ 4XK8E 2MIOA 2Y90A 1IO6A 1K8AU 3EFSA 4ZNXA 4MDWA 4DBQA 4QVCA 1ZUUA 5AT1B 3S6WA 2OTJT 3JCMV 1N9RA 4C0DC 2Z0WA 2K7AA 4CC4B 3SWNA 4M7DE 2H3JA 1SRLA 8AT1B 1IZ6A 2KGTA 1ZBXA 3LH5A 4J6XA 3EGUA 2L3QA 3X25B 1KHIA 3V7RA 4QW2A 1N8RU 2DZCA 3JCMe 1KD1R 2M1HA 3CCLA 3I5SA 3HHTB 4M77D 1X2QA 4J5YA 1GFCA 2KDSA 3EG1A 1K73C 1YIJQ 1SKUB 1XOVA 3MEVA 4C8QG 1TU0B 3OMGA 3QZ5B 2LJ1A 3LLRA 2EQMA 3SHWA 3CCRA 1ZQ1A 3V7SA 1JXMA 2X3XD 2JW4A 1NJIR 2XDBA 1W4SA 3MP1A 4TVRA 2EGEA 2LCCA 4BI8B 2CS7A 1F1BB 1IB8A 4PFZA 3UA6A 4A4HA 2KNBB 2D9TA 1N5ZA 1WI7A 1K9MR 4C8QC 3O5ZA 5FU6B 3HRTA 4IIMA 2CZ1B 2CSQA 2HSEB 1LOJA 3C12A 1HYOA 2EBPA 3GIBA 2FO0A 3I35A 4OB0B 4Z89A 2F69A 6AT1B 1Q7YR 3WXMB 3LGFA 2MOXA 1KQSS 5GAMh 4JJNK 2CH4W 3WVDB 2M02A 2ZGWA 3META 1S1NA 2XKOC 4KUDK 1SF9A 2DX1A 2XIDA 4RTZA 1WHJA 2OTLQ 5LJ3h 1ZSZB 5KYXA 3OYIA 3ME9A 1D3BB 3P8BB 4E7KA 4N4IA 1NG2A 3M4YA 4FSXA 1RI0A 1YCYA 3HFOA 2DM1A 3OSVA 4E7IA 3OBWA 3BFMA 1IGQA 3CCUQ 3L2QA 1NEGA 1SRMA 1QVPA 3OS0A 3OYBA 5I11A 1Q82C 2XU8A 1M3CA 1YJNA 2IIMA 1AOJA 4ME7A 3RIRA 1Z9QA 3CCMT 1YI2T 1ZX6A 3QJYA 4JPBW 1BB9A 2OAWA 3SDZA 1PG5B 3LGLA 1XNIA 3CMAQ 1WA7A 1H641 4AT1B 4M7AB 4JLIA 2B8AA 2AKLA 1YJWT 3CCSA 5GAMd 4OMFB 3EH1A 1QCFA 4C5GA 3VJPA 4LD6A 1R77A 5LJ3d 4EIKA 3D7SB 3CCVA 1D0ZA 4LD9K 1KSWA 3M56A 3OYKA 4M78A 4Z88A 1VQPQ 2RHZA 2OI3A 4B9XA 3QDFA 3ZL7C 2DD4A 1M1KU 1C0MA 4XU1A 5CIUA 3I9QA 4HCCA 2ZPHB 2KBTA 5GAN3 1Y96B 1OULA 4Z8AA 2XG8D 5FROA 3QDRB 4ORZA 2JN0A 1Y07A 3PGGA 1WDXA 2PVOB 1D0XA 2ATCB 4LNPA 1JJ2P 4J83A 3PVQA 2H3EB 2ZPBB 1RAAB
chains in the Genus database with same CATH topology
2L2PA 4J9HA 1X69A 2W10A 4JJDA 2EYYA 3THKA 1WXUA 1UJ0A 1V1CA 1Y0MA 1Z9ZA 4GLMA 1HJDA 1PNJA 1G2BA 1JQQA 1UHFA 1ZLMA 2O9VA 1VYTA 1GCQC 3U23A 2AK5A 1PHTA 3ULRB 1GBRA 2BZXA 2CUBA 3EG2A 1X43A 1FMKA 1SEMA 2CSIA 2O88A 3H0HA 1JO8A 2JTEA 2LQNA 3VS3A 2EKHA 1UFFA 2EYXA 2ECZA 5FWBA 1MUZA 2CT4A 4AFZC 3EG3A 1BU1A 1K0XA 1E6HA 1YNZA 1NYFA 1QWFA 5EC7A 1CKAA 1BBZA 4OMLA 3CQTA 4OMMA 4OMPA 2F2VA 2LCSA 2ROLA 2EPDA 3VRZA 2J6FA 5IHKA 3VS6A 2ESWA 2JXBA 2M0YA 1K76A 4RTVA 1GCQA 2DLPA 4AFQC 2DL5A 2GNCA 2KROA 2SRCA 4RUGA 3VS7A 2DILA 2EGCA 3TVTA 1H3HA 2RQWA 2FRYA 1PWTA 2H8HA 1GRIA 4D8DA 1PKTA 2F2WA 2VVKA 2V1QA 2RQVA 1JXOA 1ARKA 1X6GA 2HBWA 2MCNA 1UGVA 4DEYA 1B07A 2DNUA 2CREA 2LMJA 2L3PA 5GJWB 1RI9A 1WX6A 2QDLA 1J3TA 1AD5A 4OMQA 2ENMA 3TSZA 2J7IA 4LUEA 1RUWA 3EHRA 1WFWA 3VRYA 4CC7A 1TUCA 2RNAA 2BTTA 3JV3A 2A08A 5IH2A 2J05A 4WCIA 4HXJA 2D1XA 3M0QA 1RLQC 4JJBA 3H0IA 3H41A 2LP5A 1HD3A 3VS4A 3SEMA 1OPLA 1AZGB 5FWCA 1GFDA 2O9SA 1UHCA 2DL4A 2DRMA 2YUPA 1AVZC 2YUNA 1OPKA 2CH4A 2DYBA 2FEIA 2G6FX 2K2MA 2KXCA 4D8KA 4ESRA 1K0SA 1OEBA 1W1FA 3M0TA 1AWJA 3PE0A 2GGRA 4F14A 4LN2A 2KT8A 4HVWA 1M8MA 2PTKA 4JJCA 1BK2A 3IQLA 4K11A 1I07A 2ABLA 2GTOA 1WYXA 1TUDA 1U3OA 1CSKA 1NLOC 2VWFA 2DMOA 1Y57A 2V1RA 1NEBA 2ED0A 2JT4A 2K3BA 2I0NA 4CC3A 1YN8A 2L0AA 1T0HA 1GCPA 2AZVA 4RTXA 5IXBA 2LZ6B 5IHIA 3C0CA 4X1VA 3NHNA 2EYZA 2DJQA 1ABQA 4IIOA 1MV3A 1OV3A 2FPDA 1X27A 3NPFA 1ABOA 1JU5C 1K1ZA 4LE9A 1AWXA 2KR3A 1NLPC 3RBBB 1UECA 1U06A 1GBQA 4JZ3A 2K6DA 2J06A 1AZEA 1NYGA 2RN8A 2DL3A 4J9CA 2YUQA 5HCKA 4RTUA 2LJ3A 1UG1A 4OMNA 2A28A 4AG2C 1QKXA 3EG0A 1SHFA 1T0JA 1I0CA 1UDLA 2X3WD 4RTTA 4J9BA 1YWOA 2MIOA 1YWPA 2JMAA 1IO6A 1UTIA 2CT3A 4OMOA 1UE9A 2C0TA 3VS5A 1A0NB 4ZNXA 2JMCA 3A98A 3FJ5A 1ZUUA 4LUDA 1KFZA 2DL8A 4AG1C 1YCSB 2K7AA 4CC4B 5IXFA 3TSWA 1SRLA 2KEAA 2KGTA 3LH5A 2BZ8A 1OOTA 3EGUA 2L3QA 2L3SA 2GBQA 3RNJA 2RQRA 1PKSA 2AZSA 2XMFA 2HDAA 4HVVA 3I5SA 2F2XA 3R6NA 1X2QA 1JEGA 1TG0A 1SHGA 1GFCA 2JM8A 3REBB 3EG1A 2DL7A 1XOVA 2J6KA 3M0PA 1VYVA 2D0NA 2FPEA 2LJ1A 2JS2A 3SHWA 2C0IA 2LX7A 1JXMA 2A37A 2X3XD 3EHQA 2JW4A 1EFNA 4E6RA 2FG0A 1K9AA 2RPNA 2KYMA 2K9GA 2EGEA 4M4ZA 1UJYA 2K79A 1VA7A 2LQWA 3UA6A 2PNIA 1ZUKA 2J6OA 2KNBB 1N5ZA 1QKWA 1WI7A 2PZ1A 3VS2A 1SPKA 2DBKA 3O5ZA 2RQUA 2CUDA 2FPFA 4IIMA 4CC2A 1AWOA 2DVJA 3PVLA 4HCKA 3UA7A 4Y92A 2M51A 2CSQA 2E5KA 4FSSA 1QLYA 5I22A 1KJWA 2YDLA 4F16A 2NUZA 1H8KA 4HVUA 2EBPA 2FO0A 3I35A 1W70A 4Z89A 1HSQA 1I1JA 1WXTA 1B3QA 1X6BA 2HSPA 1WLPB 2KRMA 3UATA 2O2OA 2MOXA 2P4RA 1T3LA 1W6XA 2CH4W 4J9DA 2D8HA 1M30A 3NGPA 4JZ4A 1S1NA 1U5SA 2DX1A 4RTZA 3I5RA 1LCKA 2EQIA 2O31A 2HEQA 1M27C 1NG2A 2DRKA 2DM1A 1E7OA 2HCKA 3QWXX 4J9GA 2EVRA 3KFVA 2YT6A 2SEMA 3QWYA 1RLPC 1T3SA 2BZYA 5ECAA 2KXDA 2KE9A 1K4US 1E6GA 1AEYA 1UUEA 1NEGA 1SRMA 1QWEA 2B86A 5I11A 2GTJA 1M3CA 2W0ZA 1VYUA 1X2KA 2IIMA 1AOJA 3VS1A 2EGAA 5GJVB 1GL5A 1Z9QA 2CDTA 1WXBA 3M0SA 2VKNA 2FRWA 1ZX6A 2KRSA 4KRTA 4JPBW 1BB9A 2YUOA 4AFUC 1CKBA 4F17A 2OAWA 2RQTA 3GBQA 3M0RA 4A63B 2KRNA 1WA7A 2JM9A 1H92A 1ZBJA 2A36A 5L23A 1NM7A 2OJ2A 2AKLA 1PRMC 3H0FA 4DEXA 2RF0A 1KIKA 1QCFA 2GQIA 3NMZC 1WIEA 2RMOA 2C0OA 2JS0A 4J9IA 4EIKA 3UF4A 2DA9A 2EYWA 4AFSC 1KSWA 1G83A 4Z88A 2KYBA 2DE0X 3REAB 2OI3A 1PRLC 2DBMA 4QT7A 3ZL7C 5FW9A 4RTWA 2ED1A 3I9QA 1YP5A 1M3BA 1M3AA 2D8JA 2KT1A 4RTYA 2KBTA 4J9EA 5IHNA 2AKKA 4J9FA 4R0KA 4Z8AA 1FYNA 4ORZA 2ROTA 1SSHA 2EW3A 2LNHB 1ZSGA 1WDXA 3M0UA 3VS0A 1MV0B 4GBQA 2DF6A 4LNPA 2NWMA 2LJ0A 1ZUYA 3PVQA 1AWWA 2YSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2P A;  4J9H A;  1X69 A;  2W10 A;  4JJD A;  2EYY A;  3THK A;  1WXU A;  1UJ0 A;  1V1C A;  1Y0M A;  1Z9Z A;  4GLM A;  1HJD A;  1PNJ A;  1G2B A;  1JQQ A;  1UHF A;  1ZLM A;  2O9V A;  1VYT A;  1GCQ C;  3U23 A;  2AK5 A;  1PHT A;  3ULR B;  1GBR A;  2BZX A;  2CUB A;  3EG2 A;  1X43 A;  1FMK A;  1SEM A;  2CSI A;  2O88 A;  3H0H A;  1JO8 A;  2JTE A;  2LQN A;  3VS3 A;  2EKH A;  1UFF A;  2EYX A;  2ECZ A;  5FWB A;  1MUZ A;  2CT4 A;  4AFZ C;  3EG3 A;  1BU1 A;  1K0X A;  1E6H A;  1YNZ A;  1NYF A;  1QWF A;  5EC7 A;  1CKA A;  1BBZ A;  4OML A;  3CQT A;  4OMM A;  4OMP A;  2F2V A;  2LCS A;  2ROL A;  2EPD A;  3VRZ A;  2J6F A;  5IHK A;  3VS6 A;  2ESW A;  2JXB A;  2M0Y A;  1K76 A;  4RTV A;  1GCQ A;  2DLP A;  4AFQ C;  2DL5 A;  2GNC A;  2KRO A;  2SRC A;  4RUG A;  3VS7 A;  2DIL A;  2EGC A;  3TVT A;  1H3H A;  2RQW A;  2FRY A;  1PWT A;  2H8H A;  1GRI A;  4D8D A;  1PKT A;  2F2W A;  2VVK A;  2V1Q A;  2RQV A;  1JXO A;  1ARK A;  1X6G A;  2HBW A;  2MCN A;  1UGV A;  4DEY A;  1B07 A;  2DNU A;  2CRE A;  2LMJ A;  2L3P A;  5GJW B;  1RI9 A;  1WX6 A;  2QDL A;  1J3T A;  1AD5 A;  4OMQ A;  2ENM A;  3TSZ A;  2J7I A;  4LUE A;  1RUW A;  3EHR A;  1WFW A;  3VRY A;  4CC7 A;  1TUC A;  2RNA A;  2BTT A;  3JV3 A;  2A08 A;  5IH2 A;  2J05 A;  4WCI A;  4HXJ A;  2D1X A;  3M0Q A;  1RLQ C;  4JJB A;  3H0I A;  3H41 A;  2LP5 A;  1HD3 A;  3VS4 A;  3SEM A;  1OPL A;  1AZG B;  5FWC A;  1GFD A;  2O9S A;  1UHC A;  2DL4 A;  2DRM A;  2YUP A;  1AVZ C;  2YUN A;  1OPK A;  2CH4 A;  2DYB A;  2FEI A;  2G6F X;  2K2M A;  2KXC A;  4D8K A;  4ESR A;  1K0S A;  1OEB A;  1W1F A;  3M0T A;  1AWJ A;  3PE0 A;  2GGR A;  4F14 A;  4LN2 A;  2KT8 A;  4HVW A;  1M8M A;  2PTK A;  4JJC A;  1BK2 A;  3IQL A;  4K11 A;  1I07 A;  2ABL A;  2GTO A;  1WYX A;  1TUD A;  1U3O A;  1CSK A;  1NLO C;  2VWF A;  2DMO A;  1Y57 A;  2V1R A;  1NEB A;  2ED0 A;  2JT4 A;  2K3B A;  2I0N A;  4CC3 A;  1YN8 A;  2L0A A;  1T0H A;  1GCP A;  2AZV A;  4RTX A;  5IXB A;  2LZ6 B;  5IHI A;  3C0C A;  4X1V A;  3NHN A;  2EYZ A;  2DJQ A;  1ABQ A;  4IIO A;  1MV3 A;  1OV3 A;  2FPD A;  1X27 A;  3NPF A;  1ABO A;  1JU5 C;  1K1Z A;  4LE9 A;  1AWX A;  2KR3 A;  1NLP C;  3RBB B;  1UEC A;  1U06 A;  1GBQ A;  4JZ3 A;  2K6D A;  2J06 A;  1AZE A;  1NYG A;  2RN8 A;  2DL3 A;  4J9C A;  2YUQ A;  5HCK A;  4RTU A;  2LJ3 A;  1UG1 A;  4OMN A;  2A28 A;  4AG2 C;  1QKX A;  3EG0 A;  1SHF A;  1T0J A;  1I0C A;  1UDL A;  2X3W D;  4RTT A;  4J9B A;  1YWO A;  2MIO A;  1YWP A;  2JMA A;  1IO6 A;  1UTI A;  2CT3 A;  4OMO A;  1UE9 A;  2C0T A;  3VS5 A;  1A0N B;  4ZNX A;  2JMC A;  3A98 A;  3FJ5 A;  1ZUU A;  4LUD A;  1KFZ A;  2DL8 A;  4AG1 C;  1YCS B;  2K7A A;  4CC4 B;  5IXF A;  3TSW A;  1SRL A;  2KEA A;  2KGT A;  3LH5 A;  2BZ8 A;  1OOT A;  3EGU A;  2L3Q A;  2L3S A;  2GBQ A;  3RNJ A;  2RQR A;  1PKS A;  2AZS A;  2XMF A;  2HDA A;  4HVV A;  3I5S A;  2F2X A;  3R6N A;  1X2Q A;  1JEG A;  1TG0 A;  1SHG A;  1GFC A;  2JM8 A;  3REB B;  3EG1 A;  2DL7 A;  1XOV A;  2J6K A;  3M0P A;  1VYV A;  2D0N A;  2FPE A;  2LJ1 A;  2JS2 A;  3SHW A;  2C0I A;  2LX7 A;  1JXM A;  2A37 A;  2X3X D;  3EHQ A;  2JW4 A;  1EFN A;  4E6R A;  2FG0 A;  1K9A A;  2RPN A;  2KYM A;  2K9G A;  2EGE A;  4M4Z A;  1UJY A;  2K79 A;  1VA7 A;  2LQW A;  3UA6 A;  2PNI A;  1ZUK A;  2J6O A;  2KNB B;  1N5Z A;  1QKW A;  1WI7 A;  2PZ1 A;  3VS2 A;  1SPK A;  2DBK A;  3O5Z A;  2RQU A;  2CUD A;  2FPF A;  4IIM A;  4CC2 A;  1AWO A;  2DVJ A;  3PVL A;  4HCK A;  3UA7 A;  4Y92 A;  2M51 A;  2CSQ A;  2E5K A;  4FSS A;  1QLY A;  5I22 A;  1KJW A;  2YDL A;  4F16 A;  2NUZ A;  1H8K A;  4HVU A;  2EBP A;  2FO0 A;  3I35 A;  1W70 A;  4Z89 A;  1HSQ A;  1I1J A;  1WXT A;  1B3Q A;  1X6B A;  2HSP A;  1WLP B;  2KRM A;  3UAT A;  2O2O A;  2MOX A;  2P4R A;  1T3L A;  1W6X A;  2CH4 W;  4J9D A;  2D8H A;  1M30 A;  3NGP A;  4JZ4 A;  1S1N A;  1U5S A;  2DX1 A;  4RTZ A;  3I5R A;  1LCK A;  2EQI A;  2O31 A;  2HEQ A;  1M27 C;  1NG2 A;  2DRK A;  2DM1 A;  1E7O A;  2HCK A;  3QWX X;  4J9G A;  2EVR A;  3KFV A;  2YT6 A;  2SEM A;  3QWY A;  1RLP C;  1T3S A;  2BZY A;  5ECA A;  2KXD A;  2KE9 A;  1K4U S;  1E6G A;  1AEY A;  1UUE A;  1NEG A;  1SRM A;  1QWE A;  2B86 A;  5I11 A;  2GTJ A;  1M3C A;  2W0Z A;  1VYU A;  1X2K A;  2IIM A;  1AOJ A;  3VS1 A;  2EGA A;  5GJV B;  1GL5 A;  1Z9Q A;  2CDT A;  1WXB A;  3M0S A;  2VKN A;  2FRW A;  1ZX6 A;  2KRS A;  4KRT A;  4JPB W;  1BB9 A;  2YUO A;  4AFU C;  1CKB A;  4F17 A;  2OAW A;  2RQT A;  3GBQ A;  3M0R A;  4A63 B;  2KRN A;  1WA7 A;  2JM9 A;  1H92 A;  1ZBJ A;  2A36 A;  5L23 A;  1NM7 A;  2OJ2 A;  2AKL A;  1PRM C;  3H0F A;  4DEX A;  2RF0 A;  1KIK A;  1QCF A;  2GQI A;  3NMZ C;  1WIE A;  2RMO A;  2C0O A;  2JS0 A;  4J9I A;  4EIK A;  3UF4 A;  2DA9 A;  2EYW A;  4AFS C;  1KSW A;  1G83 A;  4Z88 A;  2KYB A;  2DE0 X;  3REA B;  2OI3 A;  1PRL C;  2DBM A;  4QT7 A;  3ZL7 C;  5FW9 A;  4RTW A;  2ED1 A;  3I9Q A;  1YP5 A;  1M3B A;  1M3A A;  2D8J A;  2KT1 A;  4RTY A;  2KBT A;  4J9E A;  5IHN A;  2AKK A;  4J9F A;  4R0K A;  4Z8A A;  1FYN A;  4ORZ A;  2ROT A;  1SSH A;  2EW3 A;  2LNH B;  1ZSG A;  1WDX A;  3M0U A;  3VS0 A;  1MV0 B;  4GBQ A;  2DF6 A;  4LNP A;  2NWM A;  2LJ0 A;  1ZUY A;  3PVQ A;  1AWW A;  2YSQ A; 
#chains in the Genus database with same CATH topology
 4E7L A;  4L5G A;  4EMK B;  1WXU A;  1YIJ A;  1Z9Z A;  3MHX A;  4XTX A;  1AT1 B;  1G2B A;  1ZLM A;  2O9V A;  3A1P A;  3UPU A;  1VQO Q;  3L2Z A;  2AK5 A;  2OAU A;  4M7D G;  4M75 B;  5KCH A;  2FVU A;  1YIT T;  2HNI A;  2KI7 A;  2WSF E;  3H0H A;  1TH7 A;  2EJF A;  3QKJ A;  4XTV A;  4HT9 A;  3MJX A;  1YJ9 T;  2CT4 A;  4AFZ C;  1NJI U;  3UT1 A;  3EH2 A;  4XTZ A;  1V76 A;  1YNZ A;  4C0Z A;  3OBY A;  1IXD A;  3UWN A;  2DO3 A;  4F7U F;  4RG8 A;  3GLX A;  4NS5 A;  1B7T A;  4L6V 5;  1WHM A;  3OS5 A;  1CKA A;  1PSE A;  3CQT A;  5GAN 4;  4E7Z A;  3TQ7 P;  3EG9 A;  2AT1 B;  5M9O A;  2EPD A;  3G71 T;  1TS9 A;  4BE0 A;  1JJ2 A;  3M53 A;  5IHK A;  4M7A G;  2GFU A;  5GMK j;  4BD3 A;  1VQ7 Q;  1GCQ A;  3NTH A;  2DL5 A;  2GNC A;  3M9Q A;  3ZBD A;  1H3H A;  2OTL A;  1PWT A;  1VQK T;  3RES A;  4PJO F;  2JTF A;  5DY9 A;  3OW2 P;  1FWZ A;  1X6G A;  2HBW A;  3FDR A;  3VU3 C;  1OZ2 A;  2EKO A;  4DEY A;  3BY7 A;  4M78 E;  2L3P A;  5GAM e;  3OYL A;  2VXE A;  3CCU A;  2F1L A;  2LQK A;  4OMQ A;  2ENM A;  3QBY A;  1XQH A;  1RUW A;  3HRU A;  1WFW A;  4M75 D;  3PMT A;  5LJ3 e;  2IPO B;  3VRY A;  4CC7 A;  1PD0 A;  2M16 A;  2RNA A;  5KYY A;  1S72 Q;  5IH2 A;  2LP5 A;  1HD3 A;  3VS4 A;  3SEM A;  3CMA A;  1M2O A;  4FCY A;  2X4W A;  3H9N A;  2XDD A;  3RER A;  5I2M A;  1FX7 A;  2DL4 A;  5KYX B;  1R0C B;  1AVZ C;  2YUN A;  4C0F A;  1G5V A;  2K2M A;  4JRQ A;  4QQG A;  1K8A R;  4A4G A;  1BCM A;  4LN2 A;  5GAO l;  5KYW A;  2KMT A;  2PTK A;  3JRZ A;  1VQP A;  3QUI A;  4C92 F;  3OW2 A;  2NUT B;  4J7F A;  4QVD A;  3FC3 A;  2GTO A;  3S3N A;  1EX4 A;  1WYX A;  5KE2 A;  1U3O A;  1CSK A;  3DLL A;  2VWF A;  4O6J A;  2DMO A;  2K5L A;  2GCX A;  2K2V A;  1YN8 A;  1Q81 C;  3M59 A;  2ZCF B;  2LTO A;  1W2B S;  2LZ6 B;  3SWN C;  2FZC B;  1OYX A;  3NHN A;  1N8R R;  2COY A;  2EYZ A;  2DJQ A;  3CPW S;  1Q95 G;  4PFO A;  1JU5 C;  1K1Z A;  2YLC A;  2KR3 A;  1IRX A;  4OB1 B;  4PLL A;  2J06 A;  1NYG A;  1M2V A;  3QXE B;  3CCQ Q;  3HPW A;  2YUQ A;  5HCK A;  1VQO A;  4RTU A;  2HKN A;  1UG1 A;  2VUB A;  1MHN A;  3EG0 A;  1IGU A;  2QA4 T;  3I56 T;  2R57 A;  1I0C A;  3L2R A;  3OYJ A;  4RTT A;  3TU4 K;  2M0O A;  1YWP A;  2JMA A;  1A0N B;  2C0T A;  3OS2 A;  1RAF B;  2E12 A;  3DB4 A;  1ZA2 B;  1RAB B;  4M77 F;  4MZT A;  4HCZ A;  1YCS B;  5GAN h;  3JCM f;  1X75 C;  2YHT A;  2BZ8 A;  1OOT A;  1VIF A;  4RG2 A;  1NPR A;  2RQR A;  1PKS A;  2AZS A;  4ZN1 A;  2CYZ B;  1O75 A;  3BDL A;  1HK9 A;  2HDA A;  4LXC A;  4WTO B;  2COZ A;  1VQ7 A;  1ZA1 B;  2JM8 A;  1UGP B;  4A4K A;  2R58 A;  4OGE A;  1FXX A;  2J6K A;  3JCM g;  3M0P A;  3A8M B;  2D0N A;  2LX7 A;  1K9A A;  1TWB A;  2K57 A;  3ASK A;  1B34 A;  3MEW A;  2F5K A;  1G3S A;  5CKD A;  4C8Q B;  2J6O A;  3RKW A;  2PZ1 A;  5HK3 A;  5FU7 B;  4E7J A;  3CXC S;  1VQL T;  3G6E T;  3PT9 A;  2CUD A;  2DER A;  4IUR A;  1MMD A;  4Y92 A;  2E3H A;  2E5K A;  2OTJ Q;  3CCE T;  1N6A A;  4FSS A;  3RKX A;  2YDL A;  4F16 A;  5GAN d;  5CQY A;  4RCC A;  4MMK A;  1S72 A;  1KC8 U;  1HSQ A;  1WXT A;  1M90 U;  1O9S A;  1WLP B;  2A3L A;  3OYH A;  2DYI A;  4CI0 C;  1QMC A;  3M58 A;  3UAT A;  2O2O A;  4FW2 A;  2P4R A;  1T3L A;  1TSF A;  2LC4 A;  4BUG A;  1KK7 A;  1W6X A;  2D8H A;  3CBP A;  3V8J A;  5CVI A;  4IUV A;  3V8L A;  5GMK h;  3I56 A;  3QYG B;  4M78 G;  3EGX B;  1LCK A;  1BCO A;  4PJO C;  2EIF A;  4OF1 A;  3JCM X;  1M27 C;  4WF2 A;  2G3R A;  2QQ9 A;  4ANJ A;  1VQ8 T;  1E7O A;  2E6N A;  2HCK A;  1M1K R;  3OYG A;  2YT6 A;  4A53 A;  3OMC A;  4BB7 A;  3QPH A;  4KBM B;  5A0D A;  3S3O A;  2BZY A;  4Y28 E;  2CP6 A;  2EAY A;  9ATC B;  2DTI A;  1MNE A;  1VYU A;  3X20 B;  1VUB A;  3VS1 A;  3OY9 A;  1PC0 A;  3ZFJ A;  2RJF A;  2KRS A;  4MML A;  2R5M A;  4KRT A;  2M9U A;  1CKB A;  3S3M A;  4D6W A;  1ZBJ A;  4BDZ A;  5L23 A;  3FLG A;  1I5L A;  4KH0 B;  4JDS A;  2OJ2 A;  3VYH B;  5CAI A;  3AT1 B;  3H0F A;  3HTR A;  5GAN 2;  3A5Z B;  3CCQ A;  2GQI A;  1QVF P;  5A0G A;  2DXB A;  2P0K A;  2YXY A;  1G3Y A;  2C0O A;  1M5Q 1;  2JS0 A;  4J8O A;  2E4H A;  4AFS C;  4C92 C;  2CP5 A;  1G83 A;  3REA B;  2DE0 X;  3MP6 A;  1VQL A;  1M1G A;  4QT7 A;  3CD6 T;  2KY9 A;  3R6O A;  5KYN A;  5L8R E;  4RTW A;  3KUF A;  1G8X A;  3OYD A;  3MP8 A;  1D1C A;  1M3B A;  2DD5 A;  2EJG A;  1RAD B;  1JBM A;  2QGF B;  3ER0 A;  5IHN A;  4PL6 A;  2YRV A;  1NE8 A;  2IG0 A;  2EW3 A;  2LNH B;  3M0U A;  3VS0 A;  4GBQ A;  1U8R A;  1K73 U;  2LJ0 A;  3OYY A;  3CCM Q;  2V26 A;  1YI2 Q;  2YSQ A;  1VQ4 T;  4M7A F;  2V8J A;  2EYY A;  4BE2 A;  2AHJ B;  2NLU A;  4GLM A;  1UJ0 A;  2L8D A;  2QQB A;  1PNJ A;  1JQQ A;  1UHF A;  1WGS A;  1GCQ C;  2F5T X;  2QQR A;  5GAN e;  2E6Z A;  1YJW Q;  1C6V X;  1QVF A;  2DXC A;  1OX8 A;  1PHT A;  3SB2 A;  3QG1 A;  3JB9 J;  4DOV A;  3H8Z A;  1GBR A;  2E65 A;  3OS1 A;  1OQK A;  1FMK A;  1SEM A;  3I55 T;  3JCM b;  2QDY B;  4M77 C;  3JB9 G;  2KVQ G;  2PVG B;  2L89 A;  2EYX A;  3JB9 H;  1MUZ A;  2A7Y A;  4RMO A;  4M7D B;  1BU1 A;  4LDW A;  1NYF A;  2OTJ A;  2JVV A;  4F7U A;  2K3X A;  3CCJ T;  3FB9 A;  4ZTJ A;  4OMP A;  5HKC A;  2QGG A;  3GOX A;  3E1S A;  2LCS A;  1I4K 1;  1MND A;  2RH2 A;  3V7C A;  1LJO A;  2M0Y A;  1K76 A;  2FYK A;  2QAS A;  4J6Y A;  2KRO A;  2E70 A;  4A54 A;  3EFO B;  1U1T A;  3VS7 A;  3MPU B;  2LDM A;  2LT4 A;  2FRY A;  1B34 B;  4M75 F;  1X01 A;  2WSC E;  1PKT A;  3L2W A;  2X9H A;  5GAM f;  4PJO A;  2VVK A;  3HFN A;  2V1Q A;  1JXO A;  5LJ5 f;  3FIF A;  2EQK A;  3NTI A;  5DLO A;  2DXU A;  1Q82 U;  2DNU A;  5LJ3 f;  2CRE A;  2LMJ A;  3JCM Q;  2NUP B;  5GJW B;  1YIT Q;  4BDY A;  4FT2 A;  2QDL A;  3Q1J A;  1AD5 A;  2KQW A;  5GAO m;  2PUK B;  2HQE A;  5GMK e;  1YJ9 Q;  3E2U A;  5GAM g;  1JB0 E;  4VUB A;  2QEX T;  2A08 A;  2O4X B;  5KYU A;  5LJ5 g;  1SSF A;  4BY6 C;  4HXJ A;  2FB7 A;  3LX7 A;  1Y71 A;  2PUO B;  4FL6 A;  2Y4X A;  5LJ3 g;  2E10 A;  4X9C A;  4M7D D;  1AZG B;  4E2F B;  3G71 Q;  1VQN T;  1GFD A;  4NL3 A;  4ZTF A;  3CC7 T;  2YUP A;  1VQ9 T;  3JAM E;  1OPK A;  2CH4 A;  1VQ6 T;  1UB4 A;  1KD1 C;  4JLG A;  1K0S A;  1W1F A;  2HL5 C;  1AWJ A;  3TCJ A;  2VB6 A;  3QSU A;  1G3T A;  2KT8 A;  1MMA A;  2QQA A;  3P8H A;  2Y4Y A;  1VQK Q;  2NYS A;  1NBE B;  4C92 A;  4K11 A;  4DBF A;  2HAX A;  2QK0 A;  4R56 A;  3JCM W;  2E5Q A;  1NEB A;  2JT4 A;  1OX9 A;  3RR6 A;  3A8O B;  4M7A D;  2L0A A;  2AZV A;  1GCP A;  3SWN B;  5IXB A;  5IHI A;  1WHH A;  4F04 B;  1WQW A;  4DA4 A;  4X1V A;  1K9M C;  3A8G B;  4OB3 B;  4F7U E;  1ABQ A;  2E41 A;  3JB9 I;  2X35 A;  2XHC A;  1OV3 A;  3CCM A;  1YI2 A;  3VKI A;  4CRI A;  1AWX A;  1NLP C;  2ZPE B;  4PJM A;  1GBQ A;  2K6D A;  1BI3 A;  1RAG B;  1LVK A;  1WNL A;  1X6O A;  1YJW A;  4AG2 C;  1Q7Y C;  1QKX A;  1SHF A;  3CPF A;  2BUD A;  2X3W D;  3OYA A;  1UE9 A;  3VS5 A;  1YHQ T;  4PJO E;  2JMC A;  3A98 A;  4JUV A;  4KH1 B;  3JCM P;  4M77 A;  3KXT A;  1BI1 A;  4P5N A;  4AG1 C;  2JZ2 A;  1QVG P;  2MWP A;  4E47 A;  4GLK A;  1VQM T;  1ACM B;  2KEA A;  1KC8 R;  3BW1 A;  1M90 R;  2VYT A;  2GBQ A;  1OU9 A;  3RNJ A;  2EQJ A;  3G1J A;  4B6M A;  2XD0 A;  2XMF A;  5GAN 5;  3EGD A;  2EWN A;  4BI4 A;  2CP2 A;  2F2X A;  1FMW A;  1SHG A;  3F70 A;  4LDU A;  3REB B;  2E64 A;  2QAZ A;  4DQ2 A;  2FZG B;  3X24 B;  2FPE A;  3SD4 A;  5GAN 6;  2C0I A;  2A37 A;  3EHQ A;  2GQV A;  4E6R A;  2FG0 A;  2BE7 D;  2RPN A;  3L2V A;  2GFA A;  4M4Z A;  7AT1 B;  1UJY A;  4ZN3 A;  2K79 A;  2DAQ A;  2QA4 Q;  3I56 Q;  1VA7 A;  3OYF A;  2PNI A;  1NZ9 A;  4HA8 A;  2RQU A;  1YIT A;  4C92 E;  2QTV A;  2FPF A;  4CC2 A;  1AWO A;  2DVJ A;  3PVL A;  4HCK A;  4ELZ C;  3UA7 A;  3CME T;  2M51 A;  1QVG A;  1YJ9 A;  1QLY A;  2CP3 A;  3URG A;  3O8V A;  1H8K A;  4HVU A;  1RAC B;  2HQX A;  1W70 A;  2COW A;  2HSP A;  4PJJ A;  1PM3 A;  3AHU A;  3G71 A;  2ZPF B;  3BE3 A;  4N4H A;  3T9N A;  4X34 A;  1RL2 A;  3EAE A;  2EQI A;  2O31 A;  5C0M A;  1P92 A;  1M8V A;  4BAC A;  1YHQ A;  3P8D A;  4C8Q F;  4J9G A;  3CC4 T;  1VQK A;  1ZHI A;  1KQS P;  2EVR A;  3KFV A;  2BKD N;  4M78 B;  2MMP A;  5GAO p;  1BYM A;  1RLP C;  1T3S A;  2X4X A;  2KE9 A;  1K4U S;  1E6G A;  1AEY A;  1MMG A;  1XJW B;  4JRI A;  4EMH A;  2B86 A;  2EFI A;  1VQL Q;  4M77 E;  5GAM j;  3G6E Q;  1KHC A;  2W0Z A;  1VQ5 T;  1X2K A;  5LJ5 j;  1H3Z A;  4C0D B;  1K73 R;  4O5V A;  2EGA A;  5IN1 A;  3M0S A;  1WXB A;  3CCE Q;  5LJ3 j;  4YTL A;  4F17 A;  2RQT A;  3GBQ A;  5GMK l;  2JM9 A;  1H92 A;  3CC2 T;  4LDY A;  5DM7 R;  1NM7 A;  1LPL A;  1QCO A;  4PFP A;  4DEX A;  1ZSZ A;  2RF0 A;  2CZ6 B;  3NMZ C;  2DIQ A;  2MI6 A;  1D3B A;  3LWI A;  5J39 A;  1YBY A;  3UF4 A;  1QCN A;  2DA9 A;  1KG1 A;  2KYB A;  3GNF B;  1PRL C;  2DBM A;  1VQ8 Q;  1JJ2 S;  1KQS A;  5FW9 A;  4F7U G;  5CKB A;  2ED1 A;  1OU8 A;  3M54 A;  1UGS B;  1YP5 A;  4LDX A;  1M3A A;  2KT1 A;  4RTY A;  3GNG A;  5J3B A;  3V8K A;  2AKK A;  2XI9 A;  1FYN A;  1D09 B;  2DZ9 A;  5GAO n;  2ROT A;  4ELY C;  1ZSG A;  2EYQ A;  4XU2 A;  3CCL T;  1UEB A;  2P0P A;  4M78 D;  2NWM A;  1ZUY A;  3EG9 B;  3G7Z A;  4M7A A;  2L2P A;  4J9H A;  5CKF A;  2HZY A;  5GAN f;  1WJQ A;  1X69 A;  2W10 A;  3M55 A;  2VGM A;  3THK A;  1Y0M A;  3CCR T;  1V1C A;  1C1A A;  5GMK i;  4PJO G;  2VAS A;  1HJD A;  2RJD A;  1EZZ B;  5GAN 8;  3E19 A;  3PMI A;  5EG2 A;  2JJ9 A;  3J81 E;  1Q86 C;  3ULR B;  1Q82 R;  4XU0 A;  1N9S A;  4HT8 A;  4DOW A;  2QA4 A;  1X43 A;  1RAI B;  5GAN g;  1D1A A;  2O88 A;  1JO8 A;  2LQN A;  2DTO A;  3L42 A;  3VS3 A;  2EKH A;  2ECZ A;  3CD6 Q;  3EG3 A;  1K8A C;  3C94 A;  1K0X A;  1Y96 A;  1QWF A;  2K4Y A;  3GF5 A;  3NFC A;  2RI2 A;  1BKB A;  3UDC A;  1M4Z A;  1RAE B;  3E9F A;  4NL2 A;  4OML A;  1DJ7 B;  4OMM A;  2XIC A;  3FRN A;  2MK5 A;  2F2V A;  5KYY B;  3VRZ A;  1BIB A;  1JRI A;  3C95 A;  3VS6 A;  3OW2 S;  5CKE A;  3C4S A;  5CCA A;  4EMK A;  4BE1 A;  1I5O B;  4C8Q D;  2K3Y A;  4RTV A;  1VQ4 Q;  2D0Q B;  2JUF A;  2SRC A;  1N8R C;  3M57 A;  4OGC A;  2EGC A;  3QHS A;  4KGV B;  3J80 E;  3RUX A;  5KCO A;  2MWO A;  1OZ3 A;  4C92 G;  4M75 A;  1GRI A;  4D8D A;  2F2W A;  1HXD A;  2YRD A;  3EFR A;  1BIA A;  4E7S A;  1ARK A;  3FJP A;  4DBR A;  1UGV A;  1WHL A;  1WJR A;  1B07 A;  5KYW B;  4Y91 A;  4C5E A;  4M7D F;  4OVA A;  3I55 Q;  1WX6 A;  4ZGJ B;  1YJN T;  3TSZ A;  2DEQ A;  3G6E A;  2J7I A;  4XAX B;  4LUE A;  5CK9 A;  1QP3 A;  2JOY A;  2K5F A;  2RA2 A;  2HMA A;  3QO3 A;  1TUC A;  4MDX A;  2LCL A;  3JV3 A;  3CCE A;  4BY6 B;  4PJL A;  3CCJ Q;  2J05 A;  4WCI A;  2V8I A;  4EMG A;  1RLQ C;  1TOV A;  2DTH A;  3G4S T;  3H0I A;  3H41 A;  2DET A;  3A8H B;  4QVZ A;  1OPL A;  3CCS T;  3HP9 A;  2YLB A;  5FWC A;  2VGN A;  4M7A E;  3PIP A;  1D0Y A;  3JB9 D;  2P84 A;  3CCV T;  1M2V B;  4ESR A;  2FEI A;  1OEB A;  2RD1 A;  3M0T A;  2GGR A;  4M77 G;  5FU7 C;  4HVW A;  4GY5 A;  4JJC A;  3IQL A;  1I07 A;  2RJE A;  2X51 A;  1VQ8 A;  2CZ7 B;  3VV0 A;  3OYM A;  2ABL A;  4IKF A;  1TUD A;  1Y7X A;  1NLO C;  2P4T A;  2P0Q A;  1U1S A;  1Y57 A;  2V1R A;  3H6Z A;  4RCB A;  2K3B A;  2I0N A;  4CC3 A;  2R5A A;  1WHK A;  2MPX C;  4RTX A;  3OA6 A;  4PNO A;  3CBM A;  2HL3 A;  1PSF A;  3C0C A;  2KK4 A;  3QII A;  4X9D A;  4JS5 A;  5KE3 A;  4BI3 A;  2E1H A;  5HK0 A;  2XDP A;  1TTH B;  4IIO A;  5LJ5 h;  1QQJ A;  1MV3 A;  2FPD A;  2PVD B;  3NPF A;  1ABO A;  2QEX Q;  2KSS A;  1YIJ T;  4QQD A;  4LE9 A;  4J7I A;  3ZEH A;  3RBB B;  2DKG A;  1UEC A;  1U06 A;  1KQ2 A;  5CQX A;  1AZE A;  3PTA A;  2RN8 A;  1W2B P;  3JCM J;  1VQN Q;  2DIG A;  3LYI A;  1V29 B;  2DXT A;  2LJ3 A;  4OMN A;  4FW1 A;  3JCM c;  3CPW P;  3CC7 Q;  1T0J A;  4N0A A;  1VQ9 Q;  1I8F A;  4J9B A;  1YWO A;  5J26 A;  4M75 E;  2NUT A;  3MKD A;  1VQ6 Q;  1UTI A;  2CT3 A;  4OMO A;  1VIE A;  1WJS A;  2RHU A;  3OQ5 A;  3FJ5 A;  2MF2 A;  1MGQ A;  3OYC A;  3GP8 A;  4LUD A;  1QP2 A;  1KFZ A;  3CD6 A;  2RK1 A;  2DL8 A;  3OYN A;  5IXF A;  2I2L A;  3A8L B;  2ZZD A;  3PFS A;  3TSW A;  1M1K C;  2WSE E;  5DLQ E;  1QW1 A;  4Q5W A;  1I81 A;  2L3S A;  4B9W A;  3G4S A;  2A0F B;  5GAO q;  3BDU A;  3SFM A;  5A0L A;  2GF7 A;  4A4F A;  5LJ5 d;  3MO8 A;  4HVV A;  3R6N A;  1JEG A;  2HKQ B;  5I2S A;  1TG0 A;  1UGR B;  2OTL T;  1VQ4 A;  2QQS A;  2X4J A;  2DL7 A;  4J6W A;  5IT9 E;  2DFU A;  4IUP A;  3OB9 A;  1W2B A;  1OI1 A;  1VYV A;  2JS2 A;  1EFN A;  3HSB A;  4FYY B;  2KYM A;  2K9G A;  4PK4 A;  3CPW A;  5GAN j;  1Q81 R;  3M5A A;  2XK0 A;  3L2U A;  4ATO A;  4ZGE B;  2LQW A;  1N27 A;  3CCU T;  1ZUK A;  4OB2 B;  1QKW A;  2RI3 A;  3VS2 A;  1UGQ B;  1SPK A;  2DBK A;  4OP0 A;  1YHQ Q;  3MEA A;  3I55 A;  5FU6 C;  1WQ7 A;  2JTM A;  3HRS A;  3CEY A;  3CBO A;  5LL6 S;  5D6X A;  3TRE A;  1VOM A;  2PQW A;  1KJW A;  5I22 A;  2NUZ A;  4PJN A;  2DJZ A;  1VQM Q;  1NJI C;  2L5Q A;  3CMA T;  3GPL A;  3CCJ A;  1I1J A;  3NTK A;  1B3Q A;  1X6B A;  3CXC P;  2KRM A;  5IAY A;  1R8O B;  4ZGD B;  2VC8 A;  1SG5 A;  4JRP A;  4J9D A;  1IHV A;  4JS4 A;  1KD1 U;  1M30 A;  3NGP A;  4JZ4 A;  2DK3 A;  4LDV A;  1U5S A;  2CZ0 B;  5D6Y A;  4E7H A;  3I5R A;  4A4E A;  4QQ6 A;  5GMK m;  1ZSZ C;  2HEQ A;  4FU6 A;  1VQP T;  2CP0 A;  2DRK A;  4Z02 A;  4C8Q A;  2HQH A;  4V2S A;  2ZPG B;  3X26 B;  3QWX X;  3VUB A;  2FHD A;  4M7D C;  1BI2 A;  2ZPI B;  2RHY A;  2DVE A;  2SEM A;  3QWY A;  3VUZ A;  8ATC B;  1GXI E;  3HKS A;  1PD1 A;  5ECA A;  2KXD A;  5D7U A;  4PLI A;  1PCX A;  1UUE A;  1K9M U;  2RO0 A;  1QWE A;  3QJ6 A;  2GTJ A;  1IRE B;  1XTD A;  1QVF S;  3CME Q;  3DB3 A;  5GJV B;  1GL5 A;  2CDT A;  3J7A F;  2VKN A;  2FRW A;  4FT4 A;  4FM4 B;  2YUO A;  4AFU C;  2D6F A;  3M0R A;  4A63 B;  2KRN A;  1RAH B;  2QEX A;  2RK2 A;  3CXC A;  2DEU A;  2A36 A;  1Q7Y U;  2ZAE A;  1VQO T;  5D6W A;  4M7A C;  1PRM C;  3EGX A;  4JRK A;  1VQN A;  1KIK A;  1WIE A;  2RMO A;  3CC7 A;  1VQ9 A;  4J9I A;  3MCA B;  4L59 A;  2EYW A;  1VQ6 A;  5LJ5 e;  4M78 F;  1D1B A;  4R55 A;  4IUU A;  3CC4 Q;  1WZO A;  1BI0 A;  3RMQ A;  2D8J A;  4KGX B;  1NPP A;  4J9E A;  4J9F A;  4DBH A;  2LX9 A;  4R0K A;  3TEE A;  4PKC C;  1SSH A;  2RI5 A;  1Q86 R;  1AHJ B;  4F7U B;  3RMS A;  2YWW A;  2HBP A;  3OYE A;  1VQ5 Q;  1MV0 B;  2DF6 A;  1VQ7 T;  1AWW A;  1KQ1 A;  4HKE A;  4JJD A;  4M75 G;  4NOY A;  4FIB A;  5CR2 A;  4EMK C;  3CC2 Q;  1VYT A;  2WAC A;  4C5H A;  4QKU A;  1TUG B;  3U23 A;  3JSC A;  3RKY A;  5C6S A;  4M75 C;  2BZX A;  2CUB A;  3EG2 A;  4PJO B;  2QI2 A;  3JCM h;  4EDU A;  2CSI A;  3HL8 A;  1G3W A;  4C8Q E;  2JTE A;  5GAN 7;  1UFF A;  1FMV A;  5FWB A;  2KAF A;  2MAM A;  1E6H A;  5AYF A;  5EC7 A;  1Q81 U;  2VXF A;  3QZ9 B;  1S72 T;  1VQM A;  1BBZ A;  5A2Q E;  2QTX A;  2ROL A;  4MZM A;  2C06 A;  5KYU B;  2V8K A;  2J6F A;  3CCL Q;  5CO7 A;  4C5I A;  2ESW A;  2JXB A;  4IUT A;  2VV5 A;  2DPP B;  4FYV B;  3KBG A;  4KGZ B;  2JNG A;  2E3I A;  2DLP A;  4AFQ C;  2X4Y A;  3INZ A;  2YRC A;  2K5I A;  4XQ3 A;  1LNX A;  4RUG A;  2DIL A;  3TVT A;  2RQW A;  2IVW A;  2CGH A;  5GAO r;  3CCR Q;  3DKM A;  2H8H A;  2HD0 A;  1M9S A;  3MEU A;  3QYH B;  2RQV A;  5I21 A;  4UC4 A;  3E9G A;  5FRM A;  2MCN A;  4EPC A;  3X28 B;  3JCM d;  4M7D A;  1MMN A;  4C92 B;  2RM4 A;  1RI9 A;  1J3T A;  3OSS C;  3FEO A;  4XU3 A;  3JB9 F;  3EHR A;  2BIV A;  2FL7 A;  2LT1 A;  3CME A;  2BTT A;  4PJO D;  3N5B B;  4FYX B;  2QXF A;  4XTW A;  3LW5 E;  2AIR B;  3M4G A;  2D1X A;  4JJB A;  3M0Q A;  2EQU A;  1WHG A;  5FLX E;  1TXQ A;  1WPY A;  5FRN A;  2RHX A;  3CCQ T;  1KC8 C;  3EFO A;  2O9S A;  1UHC A;  1M90 C;  2RHI A;  3L1A A;  5CKH A;  2CKK A;  2DRM A;  2LQ8 A;  3WVE B;  2QYZ A;  1IHW A;  2DYB A;  2KXC A;  4D8K A;  2G6F X;  4II1 A;  3LWH A;  3PE0 A;  4F14 A;  2LNV A;  2CP7 A;  4FYW B;  1M8M A;  4N0A C;  1BK2 A;  2NUP A;  2RJC A;  3CC4 A;  2L3R A;  2OX7 A;  4N4G A;  2ED0 A;  2PU9 B;  1YFN A;  4M77 B;  3PNW C;  2QG9 B;  4KT0 E;  1T0H A;  2RB6 A;  4XTU A;  4XTY A;  1YJN Q;  2EJ9 A;  2O4X A;  4IUQ A;  3VYG A;  4MZP A;  3DLM A;  3RDV A;  1VQ5 A;  4RKU E;  1EIF A;  4C92 D;  1R0B G;  1X27 A;  4C0G A;  2BE9 B;  3PIO A;  4KUI A;  4HCB A;  3LH0 A;  3EGD B;  3G4S Q;  4JZ3 A;  3CCS Q;  4KUL A;  2FZK B;  1Q86 U;  5HY6 A;  5KH6 A;  2DL3 A;  3CC2 A;  4J9C A;  2O01 E;  4AMC A;  1QVG S;  2A28 A;  2LVM A;  1M1F A;  2MYS A;  1UDL A;  2LRQ A;  4M78 C;  3CCV Q;  4XK8 E;  2MIO A;  2Y90 A;  1IO6 A;  1K8A U;  3EFS A;  4ZNX A;  4MDW A;  4DBQ A;  4QVC A;  1ZUU A;  5AT1 B;  3S6W A;  2OTJ T;  3JCM V;  1N9R A;  4C0D C;  2Z0W A;  2K7A A;  4CC4 B;  3SWN A;  4M7D E;  2H3J A;  1SRL A;  8AT1 B;  1IZ6 A;  2KGT A;  1ZBX A;  3LH5 A;  4J6X A;  3EGU A;  2L3Q A;  3X25 B;  1KHI A;  3V7R A;  4QW2 A;  1N8R U;  2DZC A;  3JCM e;  1KD1 R;  2M1H A;  3CCL A;  3I5S A;  3HHT B;  4M77 D;  1X2Q A;  4J5Y A;  1GFC A;  2KDS A;  3EG1 A;  1K73 C;  1YIJ Q;  1SKU B;  1XOV A;  3MEV A;  4C8Q G;  1TU0 B;  3OMG A;  3QZ5 B;  2LJ1 A;  3LLR A;  2EQM A;  3SHW A;  3CCR A;  1ZQ1 A;  3V7S A;  1JXM A;  2X3X D;  2JW4 A;  1NJI R;  2XDB A;  1W4S A;  3MP1 A;  4TVR A;  2EGE A;  2LCC A;  4BI8 B;  2CS7 A;  1F1B B;  1IB8 A;  4PFZ A;  3UA6 A;  4A4H A;  2KNB B;  2D9T A;  1N5Z A;  1WI7 A;  1K9M R;  4C8Q C;  3O5Z A;  5FU6 B;  3HRT A;  4IIM A;  2CZ1 B;  2CSQ A;  2HSE B;  1LOJ A;  3C12 A;  1HYO A;  2EBP A;  3GIB A;  2FO0 A;  3I35 A;  4OB0 B;  4Z89 A;  2F69 A;  6AT1 B;  1Q7Y R;  3WXM B;  3LGF A;  2MOX A;  1KQS S;  5GAM h;  4JJN K;  2CH4 W;  3WVD B;  2M02 A;  2ZGW A;  3MET A;  1S1N A;  2XKO C;  4KUD K;  1SF9 A;  2DX1 A;  2XID A;  4RTZ A;  1WHJ A;  2OTL Q;  5LJ3 h;  1ZSZ B;  5KYX A;  3OYI A;  3ME9 A;  1D3B B;  3P8B B;  4E7K A;  4N4I A;  1NG2 A;  3M4Y A;  4FSX A;  1RI0 A;  1YCY A;  3HFO A;  2DM1 A;  3OSV A;  4E7I A;  3OBW A;  3BFM A;  1IGQ A;  3CCU Q;  3L2Q A;  1NEG A;  1SRM A;  1QVP A;  3OS0 A;  3OYB A;  5I11 A;  1Q82 C;  2XU8 A;  1M3C A;  1YJN A;  2IIM A;  1AOJ A;  4ME7 A;  3RIR A;  1Z9Q A;  3CCM T;  1YI2 T;  1ZX6 A;  3QJY A;  4JPB W;  1BB9 A;  2OAW A;  3SDZ A;  1PG5 B;  3LGL A;  1XNI A;  3CMA Q;  1WA7 A;  1H64 1;  4AT1 B;  4M7A B;  4JLI A;  2B8A A;  2AKL A;  1YJW T;  3CCS A;  5GAM d;  4OMF B;  3EH1 A;  1QCF A;  4C5G A;  3VJP A;  4LD6 A;  1R77 A;  5LJ3 d;  4EIK A;  3D7S B;  3CCV A;  1D0Z A;  4LD9 K;  1KSW A;  3M56 A;  3OYK A;  4M78 A;  4Z88 A;  1VQP Q;  2RHZ A;  2OI3 A;  4B9X A;  3QDF A;  3ZL7 C;  2DD4 A;  1M1K U;  1C0M A;  4XU1 A;  5CIU A;  3I9Q A;  4HCC A;  2ZPH B;  2KBT A;  5GAN 3;  1Y96 B;  1OUL A;  4Z8A A;  2XG8 D;  5FRO A;  3QDR B;  4ORZ A;  2JN0 A;  1Y07 A;  3PGG A;  1WDX A;  2PVO B;  1D0X A;  2ATC B;  4LNP A;  1JJ2 P;  4J83 A;  3PVQ A;  2H3E B;  2ZPB B;  1RAA B; 
#chains in the Genus database with same CATH homology
 2L2P A;  4J9H A;  1X69 A;  2W10 A;  4JJD A;  2EYY A;  3THK A;  1WXU A;  1UJ0 A;  1V1C A;  1Y0M A;  1Z9Z A;  4GLM A;  1HJD A;  1PNJ A;  1G2B A;  1JQQ A;  1UHF A;  1ZLM A;  2O9V A;  1VYT A;  1GCQ C;  3U23 A;  2AK5 A;  1PHT A;  3ULR B;  1GBR A;  2BZX A;  2CUB A;  3EG2 A;  1X43 A;  1FMK A;  1SEM A;  2CSI A;  2O88 A;  3H0H A;  1JO8 A;  2JTE A;  2LQN A;  3VS3 A;  2EKH A;  1UFF A;  2EYX A;  2ECZ A;  5FWB A;  1MUZ A;  2CT4 A;  4AFZ C;  3EG3 A;  1BU1 A;  1K0X A;  1E6H A;  1YNZ A;  1NYF A;  1QWF A;  5EC7 A;  1CKA A;  1BBZ A;  4OML A;  3CQT A;  4OMM A;  4OMP A;  2F2V A;  2LCS A;  2ROL A;  2EPD A;  3VRZ A;  2J6F A;  5IHK A;  3VS6 A;  2ESW A;  2JXB A;  2M0Y A;  1K76 A;  4RTV A;  1GCQ A;  2DLP A;  4AFQ C;  2DL5 A;  2GNC A;  2KRO A;  2SRC A;  4RUG A;  3VS7 A;  2DIL A;  2EGC A;  3TVT A;  1H3H A;  2RQW A;  2FRY A;  1PWT A;  2H8H A;  1GRI A;  4D8D A;  1PKT A;  2F2W A;  2VVK A;  2V1Q A;  2RQV A;  1JXO A;  1ARK A;  1X6G A;  2HBW A;  2MCN A;  1UGV A;  4DEY A;  1B07 A;  2DNU A;  2CRE A;  2LMJ A;  2L3P A;  5GJW B;  1RI9 A;  1WX6 A;  2QDL A;  1J3T A;  1AD5 A;  4OMQ A;  2ENM A;  3TSZ A;  2J7I A;  4LUE A;  1RUW A;  3EHR A;  1WFW A;  3VRY A;  4CC7 A;  1TUC A;  2RNA A;  2BTT A;  3JV3 A;  2A08 A;  5IH2 A;  2J05 A;  4WCI A;  4HXJ A;  2D1X A;  3M0Q A;  1RLQ C;  4JJB A;  3H0I A;  3H41 A;  2LP5 A;  1HD3 A;  3VS4 A;  3SEM A;  1OPL A;  1AZG B;  5FWC A;  1GFD A;  2O9S A;  1UHC A;  2DL4 A;  2DRM A;  2YUP A;  1AVZ C;  2YUN A;  1OPK A;  2CH4 A;  2DYB A;  2FEI A;  2G6F X;  2K2M A;  2KXC A;  4D8K A;  4ESR A;  1K0S A;  1OEB A;  1W1F A;  3M0T A;  1AWJ A;  3PE0 A;  2GGR A;  4F14 A;  4LN2 A;  2KT8 A;  4HVW A;  1M8M A;  2PTK A;  4JJC A;  1BK2 A;  3IQL A;  4K11 A;  1I07 A;  2ABL A;  2GTO A;  1WYX A;  1TUD A;  1U3O A;  1CSK A;  1NLO C;  2VWF A;  2DMO A;  1Y57 A;  2V1R A;  1NEB A;  2ED0 A;  2JT4 A;  2K3B A;  2I0N A;  4CC3 A;  1YN8 A;  2L0A A;  1T0H A;  1GCP A;  2AZV A;  4RTX A;  5IXB A;  2LZ6 B;  5IHI A;  3C0C A;  4X1V A;  3NHN A;  2EYZ A;  2DJQ A;  1ABQ A;  4IIO A;  1MV3 A;  1OV3 A;  2FPD A;  1X27 A;  3NPF A;  1ABO A;  1JU5 C;  1K1Z A;  4LE9 A;  1AWX A;  2KR3 A;  1NLP C;  3RBB B;  1UEC A;  1U06 A;  1GBQ A;  4JZ3 A;  2K6D A;  2J06 A;  1AZE A;  1NYG A;  2RN8 A;  2DL3 A;  4J9C A;  2YUQ A;  5HCK A;  4RTU A;  2LJ3 A;  1UG1 A;  4OMN A;  2A28 A;  4AG2 C;  1QKX A;  3EG0 A;  1SHF A;  1T0J A;  1I0C A;  1UDL A;  2X3W D;  4RTT A;  4J9B A;  1YWO A;  2MIO A;  1YWP A;  2JMA A;  1IO6 A;  1UTI A;  2CT3 A;  4OMO A;  1UE9 A;  2C0T A;  3VS5 A;  1A0N B;  4ZNX A;  2JMC A;  3A98 A;  3FJ5 A;  1ZUU A;  4LUD A;  1KFZ A;  2DL8 A;  4AG1 C;  1YCS B;  2K7A A;  4CC4 B;  5IXF A;  3TSW A;  1SRL A;  2KEA A;  2KGT A;  3LH5 A;  2BZ8 A;  1OOT A;  3EGU A;  2L3Q A;  2L3S A;  2GBQ A;  3RNJ A;  2RQR A;  1PKS A;  2AZS A;  2XMF A;  2HDA A;  4HVV A;  3I5S A;  2F2X A;  3R6N A;  1X2Q A;  1JEG A;  1TG0 A;  1SHG A;  1GFC A;  2JM8 A;  3REB B;  3EG1 A;  2DL7 A;  1XOV A;  2J6K A;  3M0P A;  1VYV A;  2D0N A;  2FPE A;  2LJ1 A;  2JS2 A;  3SHW A;  2C0I A;  2LX7 A;  1JXM A;  2A37 A;  2X3X D;  3EHQ A;  2JW4 A;  1EFN A;  4E6R A;  2FG0 A;  1K9A A;  2RPN A;  2KYM A;  2K9G A;  2EGE A;  4M4Z A;  1UJY A;  2K79 A;  1VA7 A;  2LQW A;  3UA6 A;  2PNI A;  1ZUK A;  2J6O A;  2KNB B;  1N5Z A;  1QKW A;  1WI7 A;  2PZ1 A;  3VS2 A;  1SPK A;  2DBK A;  3O5Z A;  2RQU A;  2CUD A;  2FPF A;  4IIM A;  4CC2 A;  1AWO A;  2DVJ A;  3PVL A;  4HCK A;  3UA7 A;  4Y92 A;  2M51 A;  2CSQ A;  2E5K A;  4FSS A;  1QLY A;  5I22 A;  1KJW A;  2YDL A;  4F16 A;  2NUZ A;  1H8K A;  4HVU A;  2EBP A;  2FO0 A;  3I35 A;  1W70 A;  4Z89 A;  1HSQ A;  1I1J A;  1WXT A;  1B3Q A;  1X6B A;  2HSP A;  1WLP B;  2KRM A;  3UAT A;  2O2O A;  2MOX A;  2P4R A;  1T3L A;  1W6X A;  2CH4 W;  4J9D A;  2D8H A;  1M30 A;  3NGP A;  4JZ4 A;  1S1N A;  1U5S A;  2DX1 A;  4RTZ A;  3I5R A;  1LCK A;  2EQI A;  2O31 A;  2HEQ A;  1M27 C;  1NG2 A;  2DRK A;  2DM1 A;  1E7O A;  2HCK A;  3QWX X;  4J9G A;  2EVR A;  3KFV A;  2YT6 A;  2SEM A;  3QWY A;  1RLP C;  1T3S A;  2BZY A;  5ECA A;  2KXD A;  2KE9 A;  1K4U S;  1E6G A;  1AEY A;  1UUE A;  1NEG A;  1SRM A;  1QWE A;  2B86 A;  5I11 A;  2GTJ A;  1M3C A;  2W0Z A;  1VYU A;  1X2K A;  2IIM A;  1AOJ A;  3VS1 A;  2EGA A;  5GJV B;  1GL5 A;  1Z9Q A;  2CDT A;  1WXB A;  3M0S A;  2VKN A;  2FRW A;  1ZX6 A;  2KRS A;  4KRT A;  4JPB W;  1BB9 A;  2YUO A;  4AFU C;  1CKB A;  4F17 A;  2OAW A;  2RQT A;  3GBQ A;  3M0R A;  4A63 B;  2KRN A;  1WA7 A;  2JM9 A;  1H92 A;  1ZBJ A;  2A36 A;  5L23 A;  1NM7 A;  2OJ2 A;  2AKL A;  1PRM C;  3H0F A;  4DEX A;  2RF0 A;  1KIK A;  1QCF A;  2GQI A;  3NMZ C;  1WIE A;  2RMO A;  2C0O A;  2JS0 A;  4J9I A;  4EIK A;  3UF4 A;  2DA9 A;  2EYW A;  4AFS C;  1KSW A;  1G83 A;  4Z88 A;  2KYB A;  2DE0 X;  3REA B;  2OI3 A;  1PRL C;  2DBM A;  4QT7 A;  3ZL7 C;  5FW9 A;  4RTW A;  2ED1 A;  3I9Q A;  1YP5 A;  1M3B A;  1M3A A;  2D8J A;  2KT1 A;  4RTY A;  2KBT A;  4J9E A;  5IHN A;  2AKK A;  4J9F A;  4R0K A;  4Z8A A;  1FYN A;  4ORZ A;  2ROT A;  1SSH A;  2EW3 A;  2LNH B;  1ZSG A;  1WDX A;  3M0U A;  3VS0 A;  1MV0 B;  4GBQ A;  2DF6 A;  4LNP A;  2NWM A;  2LJ0 A;  1ZUY A;  3PVQ A;  1AWW A;  2YSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...