4M75F

Crystal structure of lsm1-7 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
90
structure length
75
Chain Sequence
b'RKKFEGPREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 7
structure length 75
sequence length 90
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75F00
4C92G 5GAN5 1Y96B 2K57A 4M77F 3JB9H 3RIRA 4DQ2A 3RERA 4XU2A 3M4GA 1I5LA 5LJ3e 4PJOE 5LJ3h 3JCMb 3V8JA 4PJOA 1H641 3JCMf 4PJOD 3RKWA 2E64A 3JCMX 4WF2A 3VU3C 2E1HA 4HA8A 3V7CA 5LJ3f 4A53A 2YHTA 4NOYA 5GAN3 3V7RA 3FIFA 1N9RA 2DTHA 3FB9A 4F7UG 4QVCA 3JCMQ 5GAOl 2EAYA 5LJ5f 1D3BB 4C8QD 2E65A 4C8QA 3HFNA 5CAIA 2QTXA 4M7DG 2DVEA 2E10A 4XU1A 1MGQA 4PJOB 3BDUA 4NL2A 5LJ5e 1WQWA 2EJFA 1KQ1A 4XTXA 1BIBA 4M7AB 5GANf 4OP0A 2RB6A 5GMKe 4J6XA 5GMKh 2ZGWA 2DXUA 4J6YA 2Y90A 4M77A 3RUXA 2RM4A 1HK9A 3JCMV 4Y91A 3BW1A 4M77D 3EFRA 4EMKB 5GANj 3QSUA 3BY7A 5LJ5g 3JCMe 3QO3A 4C92C 4C8QC 3V8KA 3SB2A 1I81A 1LNXA 2DKGA 5GAN2 1BIAA 2VC8A 4RCBA 5GAN6 5GAMg 2DZCA 4M75B 4XTYA 4M7DF 2I2LA 3SWNC 5GANg 1WNLA 5GAOn 4M75E 2EJGA 3JB9G 2CGHA 2EJ9A 1WPYA 2DTIA 3PGGA 4M7AC 4NL3A 4M7DB 4M75F 3JCMg 1JRIA 5GMKj 4M7DE 4EMHA 2DXTA 5GAN7 1WQ7A 3BFMA 4M77E 4F7UB 2RA2A 4N0AA 5GAMe 2DJZA 4MMKA 4C92A 5LJ5j 3JB9D 4HT8A 3HSBA 4M77B 4PJOC 4C92D 1YCYA 4F7UF 1TH7A 4M77C 5LJ3g 1U1SA 1M5Q1 2VXEA 2DZ9A 3INZA 3RESA 1B34A 5GMKi 4XU0A 5GAN8 5GAOq 4M7AG 5GAMj 3QUIA 3RKYA 5LJ5d 3JCMJ 4M77G 4M78G 4M75A 4PJOF 2E41A 3JB9J 4RCCA 5GAMd 4JUVA 1LJOA 1HXDA 3FJPA 1I4K1 1D3BA 5LJ3d 4M7DD 4M7DA 4C8QG 5GMKl 3SWNA 3JCMd 3SWNB 4JRKA 1B34B 4M75D 1KQ2A 2DEQA 3JB9I 4M78B 5DY9A 4C92E 2YLCA 3HFOA 5I21A 2FYKA 3AHUA 5GAMf 3QHSA 3L1AA 5GAOr 4HT9A 5GANd 4V2SA 4C92B 4X9CA 4F7UA 4JRIA 2YLBA 4N0AC 1I8FA 4C92F 4EMKA 2VXFA 3L2ZA 4XU3A 3V8LA 4XTZA 4M7AF 4A54A 2JN0A 4J5YA 4M78D 1JBMA 3JCMc 5LJ5h 4M78F 4PJOG 4M75G 4M78A 4XTUA 3V7SA 4QVDA 4M7DC 4XTWA 3RKXA 4M7AD 1X01A 2DTOA 4M78E 3GIBA 1LOJA 5GAOp 3JCMP 4M7AA 5GAMh 4X9DA 4XQ3A 4M7AE 3JCMW 4C8QF 1Y96A 4M75C 5GANe 5GANh 5GMKm 4J6WA 4JLIA 4MMLA 5GAOm 2FB7A 4EMGA 4C8QB 3JCMh 4M78C 4PNOA 4XTVA 4C8QE 3EFSA 5LJ3j 4EMKC 1U1TA 4F7UE 2EWNA 5GAN4 2RD1A 2HNIA 1N9SA 1M8VA 3JB9F
chains in the Genus database with same CATH superfamily
4LDUA 1UB4A 3EH1A 4DQ2A 4ZGEB 3OYKA 2K3BA 4OB3B 2HBPA 4A53A 1XTDA 5FWBA 3JAME 3V7RA 1BU1A 5IH2A 3E1SA 3F70A 2FPDA 3E2UA 1WZOA 2E65A 1NEGA 3E19A 1X27A 3CC2A 2PUOB 3VJPA 3OYLA 1YJ9A 3CCUQ 4J9DA 4O5VA 2OX7A 2DRKA 4F17A 2LCSA 2QQAA 2YRDA 1XJWB 3OS2A 1K76A 1BB9A 1UUEA 3OYHA 3SB2A 5HCKA 1W2BA 5GAMg 1X2QA 2COWA 2KEAA 1QWFA 2HSEB 4RTZA 1BCMA 3CCUT 1MMGA 1NLOC 3PT9A 2PNIA 1M90C 1XOVA 1H3ZA 4M77E 3G4SA 1K9AA 2YWWA 1JXOA 1B07A 1NJIC 2QAZA 1V76A 1NE8A 4WCIA 3OYMA 4FYYB 5IN1A 1R77A 2NUPB 3RBBB 4ZN3A 5LJ3d 1XNIA 5AT1B 4OMFB 4F16A 1OI1A 2EKOA 1K9MR 3CMAT 1VQ7A 2YRVA 1ACMB 3M0SA 2P0PA 1I8FA 4MZPA 2I0NA 2FPFA 2F69A 1JBMA 2KGTA 3GLXA 1WJRA 2YUOA 3GIBA 4RG2A 2LCLA 3JCMW 1QMCA 1KD1U 5GMKm 2AKKA 2KXDA 2LP5A 1EIFA 2E5KA 2RQVA 5KH6A 2CH4W 4FT2A 4QVZA 1Y96B 4LUEA 4GLKA 1XQHA 2JS0A 2L3RA 2R5AA 4OMQA 5KYWA 1SSHA 5FLXE 2VVKA 4QVCA 2J05A 3A98A 4C5EA 2HSPA 1Q82C 3H41A 4OMMA 3VS4A 3KUFA 2XHCA 3S3MA 1YHQA 1VQ9T 1ZX6A 4ESRA 1YITT 4IUUA 2F2WA 2EYZA 4RTUA 2LQKA 3D7SB 4C8QC 3I55A 1RLQC 1LNXA 3M0PA 1OYXA 4C5IA 5FWCA 3JB9G 2AKLA 4UC4A 4PLIA 3G71A 2KNBB 1YJNT 2C0TA 3H0HA 3CCLA 2CZ1B 5GAMe 2M51A 3OS5A 4J7FA 3EGDB 1BKBA 4RTWA 2DMOA 3MEVA 1CKBA 2E3HA 4XU0A 2CZ6B 2YRCA 4IUTA 2XICA 5LJ5d 2F2XA 3RKYA 3JCMJ 1D3BA 1NPRA 4KGXB 4FYXB 1FYNA 3LH5A 1E7OA 3NPFA 3QJ6A 4B6MA 1SHFA 4QKUA 3EG3A 1VQOQ 1N5ZA 2HQHA 2KY9A 5GANd 3CC4Q 1OQKA 3CPFA 4RTVA 5IXFA 4F14A 5L23A 2JXBA 4KULA 3UPUA 1Q7YC 1QKXA 2EVRA 1WXBA 3UATA 3R6OA 3OYCA 3CCVT 1M1GA 2J6FA 5GANe 2NLUA 2QGGA 1ABOA 3I55T 1UGPB 4E7IA 5KYWB 3H6ZA 4N4IA 4JJBA 3CMEA 1NPPA 2KAFA 2RHXA 2FO0A 3EGUA 1OX8A 3EHQA 1UGSB 3M0RA 2XDDA 2YDLA 1H641 4JPBW 3JCMX 1K73R 1QP2A 3G71Q 1C1AA 4PJLA 3FIFA 1TWBA 3DKMA 3I9QA 3JCMQ 2KRMA 2KT8A 2HKNA 3OYDA 2V8IA 1PRMC 3M53A 2EQUA 3NGPA 1Q86U 4EDUA 1M90R 4J6YA 1QCNA 1ABQA 1RAHB 1NJIR 4BDYA 4RCBA 4RTYA 1YI2Q 1R8OB 2EJGA 2QYZA 4M7AC 3LLRA 3VS0A 5GMKj 3ER0A 2DNUA 3CC2Q 3M4YA 4L5GA 1GXIE 3CXCP 2M16A 4J9GA 5GAN8 4M7AG 2Z0WA 4JLGA 1YFNA 4J8OA 2FZGB 5KYUB 3PVLA 3C94A 1Q7YU 1OZ3A 1WFWA 1WXTA 5GMKl 4JRKA 1ZSZC 2FRWA 4M75D 2O9SA 1I0CA 2OTJT 1AZGB 3CC4T 3SEMA 2DPPB 4XU3A 2O4XB 3HL8A 4J5YA 2CS7A 5A2QE 3A8GB 1QVGS 2G3RA 1EFNA 1UGQB 1AEYA 4LDVA 4RUGA 2A3LA 5GANh 4OMOA 2R5MA 1VQ5T 4HCKA 3VUZA 4E7JA 2DBKA 3JCMh 2NYSA 1VQLQ 4C5HA 1BYMA 2FZKB 3OB9A 4ZTFA 2KK4A 4HVUA 4XU2A 5D7UA 4PFZA 4PJOE 1FMVA 2LX7A 2HZYA 3TSWA 3G6EA 4F04B 5CKDA 3M56A 4N4GA 3PTAA 2M1HA 3M58A 4XU1A 1PCXA 1UDLA 4M7AB 3THKA 3OW2S 4M77A 4A63B 2A0FB 1JJ2A 3CXCS 2DJQA 2QA4Q 1PD1A 4ZTJA 4GLMA 1BIAA 3J80E 3LH0A 1WDXA 3QKJA 4JS4A 2VKNA 2GTOA 2EFIA 3J7AF 1EZZB 2ECZA 1RL2A 5A0LA 1OOTA 1ZSGA 2K9GA 2CT3A 4PJOF 2HBWA 1Q7YR 2EQIA 2P84A 3CPWS 4C8QG 4RTXA 4CC3A 2HQXA 1UFFA 4AFSC 5GAMf 3NTKA 1PSEA 4DA4A 2LRQA 3HP9A 1JO8A 5IT9E 2ZPFB 3L2UA 3MKDA 4J9BA 3OYBA 2XI9A 2LJ1A 4M7AA 4VUBA 3GF5A 2G6FX 1ZBXA 2L3PA 2DBMA 1K73C 5J26A 3HRTA 5LL6S 5D6YA 2KXCA 3WVDB 5GAN4 2QA4A 4HCZA 1I1JA 2CDTA 1VQOA 2EGAA 4BACA 3VU3C 1ZUKA 5LJ3f 1HYOA 2HD0A 3OYJA 5CKEA 2BZYA 3FB9A 4AG2C 5ECAA 5CAIA 1IGUA 3O5ZA 5LJ5e 4JS5A 4BE1A 2CREA 2XKOC 4ANJA 1CSKA 4J6XA 2GFAA 3MP8A 5KE3A 2RF0A 1SKUB 4TVRA 4PJNA 4C5GA 3SFMA 1PKSA 1I81A 1KD1R 2CT4A 2PUKB 1BK2A 2LCCA 5FU6B 2YT6A 5GANg 4B9WA 5HK0A 3JCMg 2COZA 3DLMA 3P8HA 3QBYA 1K8AC 3ZEHA 4QQ6A 1TUCA 4CRIA 4QQDA 1UTIA 5DM7R 2QQSA 2EQMA 2LQNA 5KYYB 2DD5A 2ZCFB 4M7DD 4FYWB 4D8DA 3OYAA 3SWNA 4C0FA 1SSFA 3NFCA 3NTIA 3O8VA 2ED1A 3CCST 1YIJA 3AHUA 1NLPC 1IHVA 1KHIA 3X28B 1WA7A 3CCRT 4X9CA 1ZSZB 2K5FA 4IUVA 2DL5A 1YJ9T 4XTZA 1KFZA 1NEBA 4A54A 2JN0A 1S72Q 3SD4A 3JCMc 1RAEB 3CCLT 1G5VA 2DM1A 4DOWA 2MWOA 4FCYA 3VRYA 4QQGA 1VQ5Q 3HTRA 1KJWA 3VV0A 5I11A 3NHNA 2K5IA 4OF1A 2QXFA 1N9SA 4AG1C 3MO8A 4JRPA 2EQJA 3L2WA 3CBOA 1W2BP 3M4GA 2JUFA 1G3SA 3X25B 1PWTA 2QQRA 1M1KR 1UE9A 3MP1A 4RKUE 1D1BA 1GFDA 2CP5A 4M7DG 1JXMA 4HCCA 3VS2A 2ZPEB 1MGQA 2C0IA 1MMNA 3OBWA 2HDAA 4LN2A 1AT1B 1YWOA 2Y4XA 3I5RA 1YJWT 2E6ZA 3DB4A 4Y91A 4M77D 2CH4A 1X6OA 3TSZA 2DZCA 1G2BA 2JS2A 2QEXQ 2EJ9A 1WPYA 2AHJB 2EGCA 4M75F 1FMWA 4JZ3A 1AWXA 1YBYA 1SG5A 4DBQA 2JOYA 1YITQ 2QTVA 1C0MA 2KBTA 4F7UB 1TUGB 2OTJA 3I35A 4J9IA 1WJQA 4ORZA 2DE0X 1K9MU 2FRYA 3LGLA 3MJXA 4M77C 4FT4A 4J9EA 5GAOq 1W2BS 2DEUA 2XDPA 3VYGA 2CSIA 3VYHB 3CBPA 5FRMA 1WLPB 2DL4A 1QQJA 5IHIA 1S1NA 3CMAQ 1V1CA 3L1AA 4AFQC 4FSSA 3EG9B 1M2VA 2YLBA 3CBMA 2RJEA 4BDZA 3CD6A 3V7SA 2KI7A 4M78E 1QCOA 1YJWA 1M8MA 1GCQC 1Y96A 4MMLA 3DLLA 2JM8A 2DFUA 1W1FA 1AWOA 5GJWB 1RLPC 4PNOA 3T9NA 2QEXT 1PSFA 3C0CA 1MNEA 2VGNA 2P4TA 2CSQA 1QKWA 3CC7A 4LNPA 5CK9A 3LW5E 1M2VB 5KCHA 4PJOA 5IXBA 1VYVA 2E64A 2OAUA 4M4ZA 2NUTA 3V7CA 3A8HB 2YHTA 1QVPA 4F7UG 5LJ5f 4C8QD 2OTJQ 5FU7B 4ME7A 1KD1C 3CCMA 3BDUA 2A37A 2OTLQ 1P92A 3P8DA 3VS7A 2VUBA 3M5AA 1AHJB 4P5NA 3RUXA 2P0QA 1T0HA 3OW2P 1N8RU 2L0AA 1B7TA 2RQUA 1D09B 2DIQA 5GAN2 2KRSA 3EGXA 4GBQA 2CP3A 2GTJA 4IURA 3X24B 2GCXA 2DF6A 3PGGA 4KT0E 4DBHA 2PTKA 4OMLA 1UEBA 3CD6Q 4EMHA 5GAN7 3SHWA 2QDLA 1WQ7A 3BFMA 3CCRQ 4XAXB 5IHNA 2WSEE 5D6WA 1S72T 4HCBA 2MOXA 5KYXA 1DJ7B 2KQWA 2PVGB 1Q82R 2CUBA 1JJ2P 1D1CA 3FJPA 1TOVA 1SHGA 3FDRA 1B34B 3A5ZB 2LT1A 1KQ2A 4BY6C 1VQ6A 4M78B 3A1PA 1SEMA 2F2VA 2R57A 4LDYA 4E7HA 1KIKA 2QA4T 4JRIA 4LDXA 3L2QA 2EGEA 3S3NA 4BI3A 4IKFA 4M78D 4M75G 1KC8R 2KRNA 1PM3A 2DTOA 2V1QA 4ELYC 1UHFA 4M7AE 4PFOA 4J9FA 4E7LA 2E70A 4DEYA 2CP0A 2DL7A 3EHRA 8AT1B 1N27A 1W4SA 3GP8A 3EG0A 2LVMA 2XIDA 2F5KA 3QWYA 2OJ2A 3RIRA 4NS5A 1WGSA 2XG8D 1H92A 2DLPA 1HD3A 4AT1B 3PNWC 1E6GA 4NOYA 2D8HA 3OSVA 4HXJA 2Y4YA 1VQ8Q 1KHCA 1K73U 3VKIA 1TSFA 3H9NA 2RO0A 1FMKA 5CKBA 1JQQA 2LMJA 2DA9A 1QVGA 1UJYA 1KSWA 2H3EB 3RMQA 3KXTA 2DKGA 4XK8E 4PJMA 4M7DF 2E3IA 2ZZDA 4HVVA 3L42A 3OYNA 4PK4A 4PJJA 4ZGJB 4PJOC 2J6OA 3E9FA 4YTLA 4BI8B 2L5QA 2RH2A 4RMOA 5GJVB 1O9SA 1TH7A 2QQ9A 1BBZA 2RHIA 2DIGA 2RK2A 4R56A 5GAMd 3ASKA 3OYYA 4E6RA 2O2OA 3FLGA 5CIUA 3CCJT 1VA7A 1PKTA 2DYIA 2EIFA 2BE7D 4BUGA 4V2SA 1VQLA 3OYIA 2EBPA 2GBQA 1TU0B 2BIVA 1SRMA 4E2FB 1QVFA 4M7AF 2RQRA 2O01E 2MWPA 3TU4K 3U23A 1IRXA 2K79A 1M2OA 4OB1B 3JCMP 4X9DA 3EGXB 3CCLQ 2YXYA 2PU9B 4IIMA 3EG1A 1KQSS 3I55Q 2CP7A 4BI4A 4XTVA 4C8QE 3URGA 3CCMQ 3A8LB 2JZ2A 1HJDA 2K2MA 3L2RA 3OSSC 1YNZA 4BD3A 1ZSZA 3LWHA 9ATCB 1IXDA 4PJOB 4NL2A 5M9OA 2X4YA 1WQWA 1BIBA 2ROTA 5J39A 2EYXA 2OTLT 3PMIA 3QXEB 1U06A 1AD5A 5KYUA 2DXUA 3QDRB 1VQ4A 1R0CB 1WX6A 2O9VA 2RM4A 2YUQA 3LYIA 3QO3A 2QI2A 3VRZA 4C92C 1D0YA 3RR6A 1M27C 5CCAA 1GBRA 3EFOA 1M4ZA 3OYFA 2V8JA 1MMDA 4HVWA 1Y71A 3VS1A 4O6JA 2D0QB 1FWZA 1X6GA 2L2PA 1GBQA 3I56A 5C6SA 2EPDA 3KFVA 5HY6A 3NTHA 2DZ9A 2PVOB 3S6WA 3CMEQ 4LUDA 5CR2A 1WHLA 2JT4A 4RCCA 1HXDA 4MZMA 4R55A 2K5LA 2EYQA 2LQ8A 3CCJQ 2RJDA 1AWWA 5DY9A 1N8RR 5A0DA 1UHCA 2XMFA 3CPWA 4F7UA 3QYHB 1QLYA 4EMKA 3LGFA 1K0SA 3CCQQ 2LJ0A 3HPWA 2K2VA 4PJOG 4M78A 4XTUA 3RKXA 2KYMA 2VV5A 5GAOp 1D0ZA 2RK1A 4C8QF 8ATCB 1O75A 2NUPA 1JU5C 4OB0B 2FB7A 4C8QB 1BCOA 4Z8AA 2VWFA 2AZSA 2DERA 1PD0A 2JMAA 1I07A 2LJ3A 4J7IA 2CYZB 1OPLA 1A0NB 2PQWA 1EX4A 4JJNK 3JCMf 1NZ9A 2E1HA 1VQNA 2O88A 5GAOl 3QWXX 3UT1A 2AIRB 2BKDN 3M9QA 3CCEQ 3A8MB 1GCPA 4ZNXA 5J3BA 2MYSA 4J9CA 2L3SA 4LD6A 2HL5C 2KMTA 4QW2A 2HQEA 3TREA 2M0OA 1Z9ZA 3CCVA 2RHYA 4EPCA 2JW4A 3CCSA 4LDWA 4OB2B 2QEXA 4KUIA 4Z89A 4E7SA 4XTYA 4FW1A 5GAOn 4KRTA 2DTIA 1Q95G 2D9TA 2GFUA 5CVIA 1Q82U 4M7DE 3CCQA 2DAQA 2P0KA 3ZFJA 5CQXA 3M55A 3G4SQ 2KSSA 3RESA 1M5Q1 1X43A 4OMPA 4BE2A 1AVZC 5KYNA 2RI3A 3OYEA 4M78G 3EFOB 2PVDB 4C0DB 5KYYA 1YWPA 2HEQA 3CCUA 3M0UA 4OGEA 3OYGA 4J83A 3MHXA 2FG0A 5L8RE 1QWEA 2X4XA 4C92E 1Q81U 3C95A 3QZ9B 3KBGA 1WI7A 1RAIB 3META 2FHDA 4N0AC 2JNGA 2VXFA 1YJ9Q 1IO6A 3PVQA 1M90U 3QG1A 2PZ1A 5LJ5h 1Q86R 1D0XA 4QVDA 1LOJA 2D0NA 1MHNA 4Z88A 2QK0A 1FX7A 2RHZA 2ROLA 2W0ZA 1AWJA 1NBEB 1K8AR 1MV0B 2RD1A 1GFCA 3CCSQ 1M1KU 3QJYA 4A4EA 2DK3A 4C92G 2K57A 2XDBA 3FEOA 3OMCA 5I2MA 3VS6A 1Q81C 2WACA 2DTHA 2EW3A 2ESWA 4WTOB 3FJ5A 5C0MA 1VQ7Q 2ABLA 2DVEA 2XU8A 2J06A 4XTXA 2MMPA 3WVEB 1IHWA 2RN8A 1JB0E 1I5OB 2ED0A 3JCMV 3TCJA 4BB7A 2DXCA 3BY7A 1OU8A 3ZBDA 2GQIA 3QZ5B 3R6NA 3CCET 2MCNA 3BE3A 1MNDA 1QW1A 2RJCA 1WHKA 3UA6A 2I2LA 1G83A 2J7IA 3C12A 2A28A 1VQMA 4M7DB 2NUZA 1M9SA 1G3TA 3CCJA 1LCKA 2SEMA 2OI3A 1ZUYA 2CZ7B 2KROA 3HSBA 2FVUA 1QCFA 2DILA 3M54A 5LJ3g 1N8RC 4GY5A 5GMKi 2P4RA 1WXUA 1SRLA 3OQ5A 1W70A 2QDYB 3JB9J 1NM7A 2GNCA 3C4SA 3G71T 2RNAA 4IIOA 1ARKA 4KGVB 3JB9I 2YLCA 4JZ4A 1QP3A 2A08A 2KR3A 1YCSB 5HK3A 4C92B 2AZVA 2RQTA 2WSFE 2RQWA 3PIPA 2JM9A 5CKFA 3IQLA 1YHQQ 5I22A 4XQ3A 4A4GA 2ZPIB 3UWNA 5KE2A 1KQSP 2ZPHB 4EMKC 1U1TA 4A4FA 2EWNA 3CC2T 4C0ZA 5GAN5 2HMAA 3CQTA 4M77F 3JB9H 1TXQA 3RERA 1PHTA 4RG8A 1RAGB 2LNVA 3V8JA 1VQ4T 2RMOA 3OS1A 5FU6C 3RKWA 1IREB 1F1BB 4HA8A 3UF4A 3CEYA 4FU6A 1X2KA 2OAWA 3EG9A 2VB6A 3ME9A 2F5TX 2E10A 3G1JA 3PMTA 4EIKA 2EJFA 3JV3A 1KQ1A 2MAMA 5KYXB 2A7YA 5GMKh 4FW2A 1CKAA 1VQPT 1G3YA 1K9MC 2JTMA 3ULRB 2YUPA 1RAAB 5LJ5g 3CC4A 3V8KA 2DD4A 2KT1A 2IPOB 4L6V5 4ZN1A 1KC8U 1X75C 2E12A 3EAEA 2F1LA 1GRIA 2DXTA 1VQOT 1OEBA 1NYFA 2BZXA 2RA2A 2DRMA 2DJZA 1M30A 1VQ5A 3OBYA 3SDZA 2XD0A 1OX9A 3INZA 3MCAB 1B34A 1Y7XA 1VOMA 4FYVB 4M77G 1ZBJA 2EKHA 3H8ZA 3HKSA 3OA6A 3EG2A 1I4K1 1OZ2A 1HSQA 4A4HA 1YIJQ 1PG5B 4E47A 2DEQA 3TQ7P 4BE0A 1YJNQ 1AOJA 2K6DA 2MIOA 1S72A 2WSCE 2XK0A 3V8LA 1J3TA 4DOVA 3NMZC 1W6XA 4KBMB 4M7AD 2LT4A 2LDMA 4CI0C 4KH0B 3I5SA 4JJDA 4EMGA 3VS3A 4ZGDB 3MPUB 5LJ3j 2FL7A 5DLQE 4F7UE 1U5SA 1YI2A 1VQ9Q 1UECA 1TTHB 3JB9F 1YHQT 2ZAEA 2MPXC 2RPNA 2LZ6B 5LJ3h 1ZUUA 3JCMb 1YITA 1JJ2S 4WF2A 1M3AA 1K1ZA 5GAN3 2L89A 5A0GA 3M0TA 3CMAA 4PL6A 3HFNA 2QTXA 3QIIA 1X69A 2EQKA 2GQVA 1BI3A 3QDFA 4OP0A 4A4KA 2LC4A 1M3CA 1SF9A 2V1RA 1KC8C 2DVJA 1H8KA 2Y90A 3HRSA 2A36A 2VGMA 2JTFA 2JJ9A 2EYYA 4M75B 4KH1B 3VS5A 3PIOA 1WNLA 4M75E 1BI2A 1VYTA 4NL3A 5EG2A 3M0QA 1MMAA 4ATOA 1VQPA 4QT7A 1QVFS 2YUNA 4N0AA 2X4JA 3M59A 5KCOA 1VQNT 2DXBA 2K4YA 1U1SA 2L8DA 2RI2A 3BDLA 4MDWA 1RACB 5FRNA 2E41A 2EYWA 1QVGP 1VQ9A 3ZL7C 4M7DA 2COYA 5CQYA 2B8AA 2H8HA 1UG1A 1PNJA 1B3QA 3G6EQ 5GAOr 2L3QA 1NJIU 3LWIA 3EGDA 1WHHA 2JTEA 2M02A 1VQMQ 2CKKA 1VQKT 1WJSA 3CMET 4M78F 1YJWQ 2MF2A 2OTLA 4XTWA 3GNFB 1VIEA 2YSQA 4M75C 1M1FA 1ZLMA 3CC7Q 2RHUA 3FRNA 3CCMT 2HNIA 2H3JA 1N6AA 4D6WA 3REAB 1I5LA 2GGRA 2FPEA 4IUQA 4AMCA 1VQNQ 2DL3A 1VQ4Q 1IZ6A 2X3WD 3G4ST 3X26B 4LE9A 1N9RA 2D1XA 1KG1A 1G8XA 4D8KA 2NWMA 1T3SA 1YI2T 1VQKQ 2HKQB 3PE0A 5DLOA 1IGQA 3GNGA 5GMKe 1WYXA 1TUDA 4JDSA 3Q1JA 5IAYA 3BW1A 3EFRA 3J81E 4R0KA 3JCMe 1BI0A 5D6XA 2E5QA 3M57A 2DETA 1OULA 4IUPA 3MP6A 3GPLA 2X9HA 3SWNC 3OS0A 3CC7T 2KDSA 2QGFB 1VQ6T 1LVKA 4C92A 2D6FA 4CC4B 4CC2A 2VXEA 1NG2A 1BI1A 1VQ8A 3EH2A 3MEWA 2DO3A 3QUIA 1GL5A 4DBRA 2O31A 1VIFA 3UA7A 3H0FA 3DB3A 3S3OA 3REBB 1C6VX 1D1AA 4Y28E 5HKCA 2FYKA 4DEXA 3AT1B 4HT9A 2BTTA 3LX7A 3TVTA 4N4HA 2X3XD 3MEAA 4E7ZA 1RI9A 1X01A 1RABB 2BZ8A 2QG9B 5GAOm 4OVAA 5FROA 4PLLA 2CP2A 4X1VA 1YIJT 3P8BB 1VQ7T 3EFSA 5EC7A 4OMNA 2IG0A 2KE9A 1YN8A 2KVQG 1M8VA 4FIBA 2DX1A 2RJFA 2MI6A 2D8JA 2IVWA 5LJ3e 4AFUC 3CCQT 2ZPGB 1YJNA 3HRUA 2BE9B 4PJOD 1T0JA 4DBFA 1Y07A 1D3BB 3JSCA 4C8QA 4B9XA 2VASA 1VQ8T 1PC0A 1UGRB 3JRZA 2RB6A 2ZGWA 2O4XA 4EMKB 1Z9QA 3GBQA 5AYFA 4KGZB 2BUDA 1RADB 2VC8A 3E9GA 1LPLA 4KUDK 1E6HA 1GCQA 2B86A 3RDVA 1PRLC 4HT8A 2SRCA 2K3YA 4M77B 2QASA 1YCYA 1AZEA 4E7KA 3GOXA 4LD9K 3MEUA 3N5BB 2KYBA 1WHMA 5GAMj 3OW2A 1RUWA 4J9HA 1RI0A 2HAXA 3CXCA 4HKEA 4JRQA 4JUVA 4PFPA 3JCMd 3SWNB 1IB8A 1OU9A 2DL8A 2E4HA 2K7AA 3HFOA 5I21A 3WXMB 4C0GA 1ZQ1A 1YP5A 4CC7A 2J6KA 3RMSA 3H0IA 4C92F 5FW9A 1VQPQ 4II1A 4Y92A 5IHKA 2DYBA 1MV3A 2K3XA 1OPKA 4L59A 1MUZA 2IIMA 1R0BG 7AT1B 1KQSA 5GAMh 2ENMA 1WHGA 2X35A 4J6WA 2FZCB 2AK5A 4M78C 3I56Q 3HHTB 2FEIA 1UJ0A 3VUBA 1VQMT 3CD6T 4X34A 4MDXA 4FSXA 2AT1B 3TEEA 4ELZC 4Z02A 1T3LA 4FM4B 2LNHB 1K0XA 1K4US 1OV3A 2E6NA 2EAYA 2LX9A 1VQLT 3RNJA 1KK7A 5CO7A 1FXXA 2LTOA 2QQBA 3PFSA 4K11A 1NYGA 2C06A 4JJCA 4BY6B 5CKHA 3OMGA 3OY9A 1WIEA 4FL6A 5GANf 3X20B 3QPHA 1VUBA 1WHJA 2C0OA 1Q86C 1X6BA 1V29B 1HK9A 3QSUA 4LXCA 1ZA2B 2W10A 3L2VA 1K8AU 1M3BA 5GANj 4AFZC 5GAN6 2R58A 1U3OA 1U8RA 3A8OB 2CGHA 2HL3A 1JRIA 2JMCA 5FU7C 2ZPBB 1TS9A 4MMKA 3UDCA 5LJ5j 3JB9D 1QVFP 4C92D 1Y0MA 2MK5A 4F7UF 3CCRA 1Q81R 1VQKA 3CCEA 1JEGA 3G7ZA 2RI5A 4Q5WA 1SPKA 4M75A 5I2SA 4PKCC 1UGVA 1Y57A 2M9UA 4C0DC 1M1KC 1LJOA 1H3HA 4MZTA 4OGCA 2GF7A 2NUTB 2CUDA 3G6ET 3QHSA 1VQ6Q 2LQWA 2VYTA 3L2ZA 4RTTA 1ZHIA 6AT1B 1ZA1B 3FC3A 2CZ0B 3CPWP 4M7DC 1VYUA 2ATCB 2V8KA 1RAFB 2JVVA 2HCKA 3CCVQ 2X4WA 2M0YA 1G3WA 2CP6A 1TG0A 4JLIA 3I56T 3QYGB 2V26A 2X51A
chains in the Genus database with same CATH topology
4LDUA 1UB4A 4DQ2A 3A8LB 1YHQT 2JZ2A 4ZGEB 5LJ3h 3OYKA 3JCMb 4OB3B 1YITA 3L2RA 1VQOA 1JJ2S 4MDXA 2HBPA 3OSSC 4WF2A 3VU3C 4A53A 4BACA 1XTDA 5LJ3f 3JAME 4BD3A 2HD0A 2L89A 3V7RA 3E1SA 5A0GA 5CKEA 3F70A 5GAN3 3FB9A 3OYJA 3CMAA 3LWHA 2E65A 4PL6A 3HFNA 5CAIA 2QTXA 3E19A 3QIIA 3CC2A 2EQKA 2PUOB 3VJPA 3OYLA 2GQVA 4NL2A 5M9OA 2X4YA 1WQWA 1BI3A 5LJ5e 4JS5A 4BE1A 1BIBA 2XKOC 5J39A 4OP0A 4O5VA 4A4KA 2OTLT 3PMIA 2LC4A 4J6XA 3QXEB 2GFAA 2DXUA 3MP8A 1KC8C 2QQAA 3QDRB 5KE3A 2Y90A 1VQ4A 2RM4A 3OS2A 3HRSA 3LYIA 3QO3A 4TVRA 2QI2A 4C92C 4C5GA 3SFMA 3OYHA 3SB2A 1W2BA 2VGMA 5CCAA 1I81A 2JTFA 5GAMg 2PUKB 1M4ZA 2LCCA 4M75B 5FU6B 3OYFA 2V8JA 3PIOA 5GANg 1WNLA 4B9WA 4M75E 1BI2A 5HK0A 3CCUT 1Y71A 4NL3A 5EG2A 3JCMg 3PT9A 3DLMA 3P8HA 1M90C 1XOVA 4ATOA 4O6JA 1VQPA 3QBYA 1QVFS 1K8AC 1H3ZA 2D0QB 4M77E 4N0AA 3G4SA 2X4JA 3M59A 3ZEHA 1FWZA 5KCOA 1VQNT 1NJIC 2DXBA 4QQ6A 3I56A 5C6SA 2K4YA 5HY6A 3NTHA 1U1SA 4CRIA 2DZ9A 4QQDA 2PVOB 1NE8A 3S6WA 2L8DA 2RI2A 3BDLA 5DM7R 4MDWA 3OYMA 5IN1A 5CR2A 2QQSA 5FRNA 2E41A 2EQMA 4RCCA 2DD5A 4ZN3A 5LJ3d 2ZCFB 1HXDA 1XNIA 4MZMA 4R55A 1VQ9A 3OYAA 4M7DD 4M7DA 2K5LA 3SWNA 2EYQA 5CQYA 2B8AA 2LQ8A 4C0FA 1SSFA 2RJDA 3NFCA 4OMFB 3NTIA 1OI1A 5DY9A 3O8VA 2EKOA 3CCST 1YIJA 3AHUA 1KHIA 5GAOr 3CMAT 1NJIU 3LWIA 5A0DA 3X28B 2YRVA 1VQ7A 3CCRT 4X9CA 4F7UA 2CKKA 3QYHB 3CPWA 1VQKT 2P0PA 1WJSA 3CMET 1I8FA 2K5FA 4IUVA 4MZPA 3LGFA 4EMKA 1YJ9T 2F69A 4XTZA 4A54A 2JN0A 3HPWA 1JBMA 2K2VA 3SD4A 3JCMc 4M78F 4PJOG 3GLXA 1WJRA 2MF2A 4M78A 4XTUA 2OTLA 4XTWA 3RKXA 3GIBA 2VV5A 4RG2A 5GAOp 2RK1A 3GNFB 3CCLT 2LCLA 1VIEA 1G5VA 3JCMW 4C8QF 4M75C 1KD1U 4DOWA 1O75A 2MWOA 5GMKm 4OB0B 2FB7A 4QQGA 4C8QB 1EIFA 5KH6A 3VV0A 1M1FA 2RHUA 2K5IA 3FRNA 2QXFA 2HNIA 4OF1A 1N9SA 3CCMT 2H3JA 3MO8A 4FT2A 4QVZA 1N6AA 4JRPA 4J7IA 1Y96B 4D6WA 4GLKA 1XQHA 2EQJA 3L2WA 3CBOA 2CYZB 3M4GA 2JUFA 1I5LA 1G3SA 2PQWA 4IUQA 3X25B 2QQRA 2L3RA 4JJNK 3JCMf 1NZ9A 1IZ6A 2E1HA 3MP1A 3G4ST 2R5AA 1VQNA 4RKUE 3X26B 1N9RA 5FLXE 4QVCA 5GAOl 3UT1A 2BKDN 3M9QA 3A8MB 1KG1A 4M7DG 5J3BA 4HCCA 4LD6A 2ZPEB 4C5EA 2KMTA 1Q82C 1MGQA 4QW2A 1YI2T 2HQEA 3TREA 3OBWA 2M0OA 3KUFA 2XHCA 3S3MA 1YHQA 5DLOA 1VQ9T 3GNGA 5GMKe 2Y4XA 4JDSA 3CCVA 2RHYA 2E6ZA 3DB4A 1YITT 1YJWT 3Q1JA 4IUUA 4EPCA 4Y91A 5IAYA 3BW1A 4M77D 3EFRA 3J81E 3JCMe 1BI0A 1X6OA 2E5QA 2LQKA 4LDWA 5D6XA 3CCSA 4C8QC 3I55A 1GXIE 3M57A 4OB2B 2QEXA 1LNXA 4KUIA 4IUPA 2DZCA 1OYXA 3MP6A 4XTYA 4C5IA 3SWNC 3GPLA 5GAOn 3JB9G 3OS0A 3CC7T 2EJ9A 1WPYA 2DTIA 4UC4A 4PLIA 2AHJB 4M75F 2GFUA 2D9TA 5CVIA 3G71A 1YBYA 1Q82U 2KDSA 4M7DE 3CCQA 2JOYA 1YJNT 3CCLA 2DAQA 2CZ1B 1VQ6T 2P0KA 5GAMe 4F7UB 3PTAA 3OS5A 3ZFJA 1YJ9A 4C92A 4J7FA 5CQXA 2OTJA 1WJQA 1BKBA 2D6FA 3M55A 1K9MU 2KSSA 3LGLA 2VXEA 1M5Q1 3MEVA 4M77C 3RESA 4FT4A 4BE2A 1BI1A 4XU0A 2CZ6B 5GAOq 1VQ8A 2RI3A 3MEWA 4IUTA 2DO3A 2XICA 3QUIA 3RKYA 5LJ5d 3OYEA 3JCMJ 1W2BS 4M78G 2PVDB 4C0DB 3CCUA 4OGEA 1VIFA 2XDPA 3OYGA 1D3BA 1NPRA 3VYGA 3VYHB 4J83A 3CBPA 3MHXA 3DB3A 3S3OA 5FRMA 5L8RE 4Y28E 2X4XA 4C92E 3QJ6A 1Q81U 5HKCA 2FYKA 3C95A 3QZ9B 3L1AA 4HT9A 2KY9A 5GANd 3KBGA 3CPFA 3LX7A 2YLBA 3CBMA 2RJEA 3META 2FHDA 4N0AC 2JNGA 4N4HA 4BDZA 2VXFA 3UPUA 4KULA 1M90U 1Q7YC 3CD6A 3MEAA 3QG1A 5LJ5h 3V7SA 4QVDA 1X01A 3R6OA 4M78E 3OYCA 1LOJA 1MHNA 3CCVT 1YJWA 1M1GA 1Y96A 5GANe 1FX7A 2RHZA 4MMLA 3DLLA 5GAOm 4OVAA 2NLUA 4PLLA 5FROA 1YIJT 3I55T 1UGPB 3P8BB 4PNOA 4E7IA 3T9NA 1VQ7T 3EFSA 2QEXT 1PSFA 2RD1A 2KVQG 2IG0A 3H6ZA 4N4IA 3CMEA 2VGNA 1M1KU 1M8VA 3QJYA 2P4TA 2DK3A 4A4EA 1NPPA 2K57A 4C92G 3CC7A 4FIBA 2KAFA 5CK9A 2RHXA 2RJFA 3LW5E 2MI6A 2IVWA 2XDBA 1UGSB 5KCHA 5LJ3e 2XDDA 3CCQT 2ZPGB 4PJOA 1H641 1YJNA 3FEOA 3HRUA 4PJOD 3JCMX 2E64A 2OAUA 3OMCA 5I2MA 3V7CA 1QP2A 3A8HB 2YHTA 1Q81C 2WACA 3FIFA 1QVPA 2DTHA 3DKMA 1Y07A 4F7UG 3JCMQ 5LJ5f 1D3BB 4C8QD 5C0MA 3OYDA 3JSCA 4C8QA 2V8IA 4ME7A 5FU7B 4B9XA 3M53A 2DVEA 2EQUA 1KD1C 1VQ8T 3CCMA 3BDUA 2XU8A 1UGRB 4XTXA 2MMPA 3WVEB 3JRZA 2RB6A 1JB0E 1P92A 1Q86U 3P8DA 2ZGWA 2VUBA 4EDUA 3M5AA 1AHJB 4J6YA 4P5NA 3RUXA 2P0QA 3JCMV 2O4XA 3TCJA 4BB7A 4EMKB 2DXCA 3BY7A 5AYFA 2BUDA 3QZ5B 3ZBDA 1N8RU 3CCET 4BDYA 2DIQA 5GAN2 1QW1A 2RJCA 2VC8A 3E9GA 4RCBA 2I2LA 4IURA 3X24B 1R8OB 2C06A 3C12A 4KUDK 2EJGA 1VQMA 2GCXA 3PGGA 4M7AC 4M7DB 3LLRA 4KT0E 5GMKj 1UEBA 1M9SA 1G3TA 4EMHA 5GAN7 3CCJA 1WQ7A 3BFMA 3ER0A 4HT8A 2CZ7B 2K3YA 4XAXB 3HSBA 2FVUA 4M77B 2WSEE 1YCYA 3M54A 4E7KA 3GOXA 3M4YA 4L5GA 5D6WA 5LJ3g 4GY5A 1S72T 1N8RC 4LD9K 3MEUA 4HCBA 3N5BB 5GMKi 2M16A 5GAN8 4M7AG 5GAMj 3OQ5A 3OW2A 1RI0A 1DJ7B 2KQWA 4JLGA 2PVGB 2QDYB 4J8OA 3JB9J 2HAXA 3CXCA 4HKEA 3C4SA 4JUVA 4JRQA 3FJPA 3C94A 1Q7YU 1OZ3A 3G71T 3JCMd 5GMKl 3SWNB 3FDRA 4JRKA 1B34B 4M75D 3A5ZB 2LT1A 1KQ2A 4BY6C 3JB9I 1VQ6A 4M78B 2YLCA 1QP3A 3HFOA 5I21A 2OTJT 3WXMB 2R57A 4LDYA 4C0GA 3CC4T 4E7HA 1ZQ1A 2DPPB 5HK3A 4C92B 3RMSA 2QA4T 4JRIA 4LDXA 2WSFE 4C92F 3L2QA 4XU3A 2O4XB 3PIPA 3S3NA 3HL8A 5CKFA 4BI3A 4IKFA 4J5YA 2CS7A 4M78D 4II1A 5A2QE 3A8GB 4M75G 2K3XA 1QVGS 4L59A 2DTOA 4ELYC 2G3RA 1UGQB 1KQSA 5GAMh 4LDVA 4XQ3A 4M7AE 2A3LA 2ZPIB 4A4GA 5GANh 2X35A 4J6WA 3UWNA 2R5MA 1VQ5T 4E7JA 3VUZA 4E7LA 2E70A 3JCMh 5KE2A 4M78C 3HHTB 4C5HA 2ZPHB 1BYMA 4EMKC 1U1TA 4A4FA 2EWNA 3CC2T 1N27A 1W4SA 3GP8A 4C0ZA 3OB9A 3VUBA 2LVMA 2XIDA 5GAN5 4ZTFA 2KK4A 2F5KA 4M77F 4X34A 1VQMT 3RIRA 3CD6T 4FSXA 4NS5A 1WGSA 2XG8D 4XU2A 3RERA 4RG8A 3TEEA 4PJOE 2LNVA 3V8JA 4Z02A 4ELZC 3OS1A 1VQ4T 5FU6C 3RKWA 1IREB 3PNWC 4FM4B 4HA8A 4NOYA 3CEYA 4FU6A 2E6NA 3G6EA 2EAYA 2LX9A 5CKDA 1VQLT 3OSVA 5CO7A 1FXXA 2LTOA 2QQBA 2Y4YA 3M56A 3ME9A 2F5TX 3PFSA 1KHCA 2E10A 2M1HA 3M58A 3PMTA 4N4GA 4XU1A 4BY6B 5CKHA 1K73U 3VKIA 3OMGA 3OY9A 2EJFA 1KQ1A 4FL6A 2MAMA 4M7AB 3X20B 5GANf 3QPHA 1VUBA 2RO0A 2A7YA 5GMKh 1Q86C 1VQPT 5CKBA 1G3YA 3OW2S 4M77A 1K9MC 1V29B 1HK9A 3QSUA 2JTMA 1JJ2A 3CXCS 5LJ5g 1QVGA 3CC4A 3L2VA 1K8AU 3V8KA 3RMQA 3KXTA 4ZTJA 2DKGA 5GANj 4XK8E 2DD4A 1BIAA 5GAN6 3J80E 2R58A 3LH0A 4L6V5 4M7DF 1U8RA 2ZZDA 3A8OB 3QKJA 4ZN1A 2CGHA 3L42A 4JS4A 1KC8U 1X75C 3OYNA 1JRIA 2E12A 3EAEA 2DXTA 1VQOT 4ZGJB 5FU7C 2EFIA 3J7AF 2RA2A 2ZPBB 4PJOC 2DJZA 4MMKA 3UDCA 3E9FA 5LJ5j 3JB9D 4YTLA 4BI8B 4C92D 1RL2A 2L5QA 1VQ5A 4F7UF 2RH2A 5A0LA 3OBYA 3SDZA 1O9SA 1TH7A 4RMOA 3CCRA 3CCEA 2QQ9A 3INZA 3MCAB 1VQKA 2XD0A 1B34A 3G7ZA 2RI5A 1Y7XA 4Q5WA 2RHIA 2DIGA 4M77G 4M75A 4PJOF 4PKCC 5I2SA 2RK2A 3H8ZA 4R56A 3CPWS 2M9UA 3HKSA 5GAMd 4C0DC 3OA6A 3ASKA 1LJOA 3OYYA 1M1KC 1I4K1 1OZ2A 4MZTA 4A4HA 4C8QG 4OGCA 2GF7A 3FLGA 5CIUA 4E47A 3CCJT 2DEQA 2HQXA 4BE0A 2EIFA 5GAMf 3G6ET 3QHSA 4PJOB 3NTKA 4BUGA 4V2SA 1PSEA 1VQLA 3OYIA 2LRQA 4DA4A 1S72A 3HP9A 2VYTA 2WSCE 5IT9E 2ZPFB 2XK0A 3L2ZA 3V8LA 2BIVA 3L2UA 4DOVA 1ZHIA 1QVFA 4M7AF 3OYBA 2O01E 2XI9A 2MWPA 2CZ0B 3FC3A 3TU4K 4KBMB 4M7DC 4M7AD 2LT4A 2V8KA 4M7AA 2JVVA 4OB1B 4VUBA 3JCMP 2LDMA 3GF5A 4X9DA 2X4WA 4CI0C 1ZBXA 1G3WA 2PU9B 1K73C 4JLIA 5J26A 4EMGA 3HRTA 5LL6S 1KQSS 4ZGDB 3I56T 3QYGB 4BI4A 3JB9H 4XTVA 5D6YA 4C8QE 3URGA 2FL7A 3WVDB 5DLQE 4F7UE 5LJ3j 5GAN4 1YI2A 2QA4A 4HCZA 3JB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  5GAN 5;  1Y96 B;  2K57 A;  4M77 F;  3JB9 H;  3RIR A;  4DQ2 A;  3RER A;  4XU2 A;  3M4G A;  1I5L A;  5LJ3 e;  4PJO E;  5LJ3 h;  3JCM b;  3V8J A;  4PJO A;  1H64 1;  3JCM f;  4PJO D;  3RKW A;  2E64 A;  3JCM X;  4WF2 A;  3VU3 C;  2E1H A;  4HA8 A;  3V7C A;  5LJ3 f;  4A53 A;  2YHT A;  4NOY A;  5GAN 3;  3V7R A;  3FIF A;  1N9R A;  2DTH A;  3FB9 A;  4F7U G;  4QVC A;  3JCM Q;  5GAO l;  2EAY A;  5LJ5 f;  1D3B B;  4C8Q D;  2E65 A;  4C8Q A;  3HFN A;  5CAI A;  2QTX A;  4M7D G;  2DVE A;  2E10 A;  4XU1 A;  1MGQ A;  4PJO B;  3BDU A;  4NL2 A;  5LJ5 e;  1WQW A;  2EJF A;  1KQ1 A;  4XTX A;  1BIB A;  4M7A B;  5GAN f;  4OP0 A;  2RB6 A;  5GMK e;  4J6X A;  5GMK h;  2ZGW A;  2DXU A;  4J6Y A;  2Y90 A;  4M77 A;  3RUX A;  2RM4 A;  1HK9 A;  3JCM V;  4Y91 A;  3BW1 A;  4M77 D;  3EFR A;  4EMK B;  5GAN j;  3QSU A;  3BY7 A;  5LJ5 g;  3JCM e;  3QO3 A;  4C92 C;  4C8Q C;  3V8K A;  3SB2 A;  1I81 A;  1LNX A;  2DKG A;  5GAN 2;  1BIA A;  2VC8 A;  4RCB A;  5GAN 6;  5GAM g;  2DZC A;  4M75 B;  4XTY A;  4M7D F;  2I2L A;  3SWN C;  5GAN g;  1WNL A;  5GAO n;  4M75 E;  2EJG A;  3JB9 G;  2CGH A;  2EJ9 A;  1WPY A;  2DTI A;  3PGG A;  4M7A C;  4NL3 A;  4M7D B;  4M75 F;  3JCM g;  1JRI A;  5GMK j;  4M7D E;  4EMH A;  2DXT A;  5GAN 7;  1WQ7 A;  3BFM A;  4M77 E;  4F7U B;  2RA2 A;  4N0A A;  5GAM e;  2DJZ A;  4MMK A;  4C92 A;  5LJ5 j;  3JB9 D;  4HT8 A;  3HSB A;  4M77 B;  4PJO C;  4C92 D;  1YCY A;  4F7U F;  1TH7 A;  4M77 C;  5LJ3 g;  1U1S A;  1M5Q 1;  2VXE A;  2DZ9 A;  3INZ A;  3RES A;  1B34 A;  5GMK i;  4XU0 A;  5GAN 8;  5GAO q;  4M7A G;  5GAM j;  3QUI A;  3RKY A;  5LJ5 d;  3JCM J;  4M77 G;  4M78 G;  4M75 A;  4PJO F;  2E41 A;  3JB9 J;  4RCC A;  5GAM d;  4JUV A;  1LJO A;  1HXD A;  3FJP A;  1I4K 1;  1D3B A;  5LJ3 d;  4M7D D;  4M7D A;  4C8Q G;  5GMK l;  3SWN A;  3JCM d;  3SWN B;  4JRK A;  1B34 B;  4M75 D;  1KQ2 A;  2DEQ A;  3JB9 I;  4M78 B;  5DY9 A;  4C92 E;  2YLC A;  3HFO A;  5I21 A;  2FYK A;  3AHU A;  5GAM f;  3QHS A;  3L1A A;  5GAO r;  4HT9 A;  5GAN d;  4V2S A;  4C92 B;  4X9C A;  4F7U A;  4JRI A;  2YLB A;  4N0A C;  1I8F A;  4C92 F;  4EMK A;  2VXF A;  3L2Z A;  4XU3 A;  3V8L A;  4XTZ A;  4M7A F;  4A54 A;  2JN0 A;  4J5Y A;  4M78 D;  1JBM A;  3JCM c;  5LJ5 h;  4M78 F;  4PJO G;  4M75 G;  4M78 A;  4XTU A;  3V7S A;  4QVD A;  4M7D C;  4XTW A;  3RKX A;  4M7A D;  1X01 A;  2DTO A;  4M78 E;  3GIB A;  1LOJ A;  5GAO p;  3JCM P;  4M7A A;  5GAM h;  4X9D A;  4XQ3 A;  4M7A E;  3JCM W;  4C8Q F;  1Y96 A;  4M75 C;  5GAN e;  5GAN h;  5GMK m;  4J6W A;  4JLI A;  4MML A;  5GAO m;  2FB7 A;  4EMG A;  4C8Q B;  3JCM h;  4M78 C;  4PNO A;  4XTV A;  4C8Q E;  3EFS A;  5LJ3 j;  4EMK C;  1U1T A;  4F7U E;  2EWN A;  5GAN 4;  2RD1 A;  2HNI A;  1N9S A;  1M8V A;  3JB9 F; 
#chains in the Genus database with same CATH topology
 4LDU A;  1UB4 A;  3EH1 A;  4DQ2 A;  4ZGE B;  3OYK A;  2K3B A;  4OB3 B;  2HBP A;  4A53 A;  1XTD A;  5FWB A;  3JAM E;  3V7R A;  1BU1 A;  5IH2 A;  3E1S A;  3F70 A;  2FPD A;  3E2U A;  1WZO A;  2E65 A;  1NEG A;  3E19 A;  1X27 A;  3CC2 A;  2PUO B;  3VJP A;  3OYL A;  1YJ9 A;  3CCU Q;  4J9D A;  4O5V A;  2OX7 A;  2DRK A;  4F17 A;  2LCS A;  2QQA A;  2YRD A;  1XJW B;  3OS2 A;  1K76 A;  1BB9 A;  1UUE A;  3OYH A;  3SB2 A;  5HCK A;  1W2B A;  5GAM g;  1X2Q A;  2COW A;  2KEA A;  1QWF A;  2HSE B;  4RTZ A;  1BCM A;  3CCU T;  1MMG A;  1NLO C;  3PT9 A;  2PNI A;  1M90 C;  1XOV A;  1H3Z A;  4M77 E;  3G4S A;  1K9A A;  2YWW A;  1JXO A;  1B07 A;  1NJI C;  2QAZ A;  1V76 A;  1NE8 A;  4WCI A;  3OYM A;  4FYY B;  5IN1 A;  1R77 A;  2NUP B;  3RBB B;  4ZN3 A;  5LJ3 d;  1XNI A;  5AT1 B;  4OMF B;  4F16 A;  1OI1 A;  2EKO A;  1K9M R;  3CMA T;  1VQ7 A;  2YRV A;  1ACM B;  3M0S A;  2P0P A;  1I8F A;  4MZP A;  2I0N A;  2FPF A;  2F69 A;  1JBM A;  2KGT A;  3GLX A;  1WJR A;  2YUO A;  3GIB A;  4RG2 A;  2LCL A;  3JCM W;  1QMC A;  1KD1 U;  5GMK m;  2AKK A;  2KXD A;  2LP5 A;  1EIF A;  2E5K A;  2RQV A;  5KH6 A;  2CH4 W;  4FT2 A;  4QVZ A;  1Y96 B;  4LUE A;  4GLK A;  1XQH A;  2JS0 A;  2L3R A;  2R5A A;  4OMQ A;  5KYW A;  1SSH A;  5FLX E;  2VVK A;  4QVC A;  2J05 A;  3A98 A;  4C5E A;  2HSP A;  1Q82 C;  3H41 A;  4OMM A;  3VS4 A;  3KUF A;  2XHC A;  3S3M A;  1YHQ A;  1VQ9 T;  1ZX6 A;  4ESR A;  1YIT T;  4IUU A;  2F2W A;  2EYZ A;  4RTU A;  2LQK A;  3D7S B;  4C8Q C;  3I55 A;  1RLQ C;  1LNX A;  3M0P A;  1OYX A;  4C5I A;  5FWC A;  3JB9 G;  2AKL A;  4UC4 A;  4PLI A;  3G71 A;  2KNB B;  1YJN T;  2C0T A;  3H0H A;  3CCL A;  2CZ1 B;  5GAM e;  2M51 A;  3OS5 A;  4J7F A;  3EGD B;  1BKB A;  4RTW A;  2DMO A;  3MEV A;  1CKB A;  2E3H A;  4XU0 A;  2CZ6 B;  2YRC A;  4IUT A;  2XIC A;  5LJ5 d;  2F2X A;  3RKY A;  3JCM J;  1D3B A;  1NPR A;  4KGX B;  4FYX B;  1FYN A;  3LH5 A;  1E7O A;  3NPF A;  3QJ6 A;  4B6M A;  1SHF A;  4QKU A;  3EG3 A;  1VQO Q;  1N5Z A;  2HQH A;  2KY9 A;  5GAN d;  3CC4 Q;  1OQK A;  3CPF A;  4RTV A;  5IXF A;  4F14 A;  5L23 A;  2JXB A;  4KUL A;  3UPU A;  1Q7Y C;  1QKX A;  2EVR A;  1WXB A;  3UAT A;  3R6O A;  3OYC A;  3CCV T;  1M1G A;  2J6F A;  5GAN e;  2NLU A;  2QGG A;  1ABO A;  3I55 T;  1UGP B;  4E7I A;  5KYW B;  3H6Z A;  4N4I A;  4JJB A;  3CME A;  1NPP A;  2KAF A;  2RHX A;  2FO0 A;  3EGU A;  1OX8 A;  3EHQ A;  1UGS B;  3M0R A;  2XDD A;  2YDL A;  1H64 1;  4JPB W;  3JCM X;  1K73 R;  1QP2 A;  3G71 Q;  1C1A A;  4PJL A;  3FIF A;  1TWB A;  3DKM A;  3I9Q A;  3JCM Q;  2KRM A;  2KT8 A;  2HKN A;  3OYD A;  2V8I A;  1PRM C;  3M53 A;  2EQU A;  3NGP A;  1Q86 U;  4EDU A;  1M90 R;  4J6Y A;  1QCN A;  1ABQ A;  1RAH B;  1NJI R;  4BDY A;  4RCB A;  4RTY A;  1YI2 Q;  1R8O B;  2EJG A;  2QYZ A;  4M7A C;  3LLR A;  3VS0 A;  5GMK j;  3ER0 A;  2DNU A;  3CC2 Q;  3M4Y A;  4L5G A;  1GXI E;  3CXC P;  2M16 A;  4J9G A;  5GAN 8;  4M7A G;  2Z0W A;  4JLG A;  1YFN A;  4J8O A;  2FZG B;  5KYU B;  3PVL A;  3C94 A;  1Q7Y U;  1OZ3 A;  1WFW A;  1WXT A;  5GMK l;  4JRK A;  1ZSZ C;  2FRW A;  4M75 D;  2O9S A;  1I0C A;  2OTJ T;  1AZG B;  3CC4 T;  3SEM A;  2DPP B;  4XU3 A;  2O4X B;  3HL8 A;  4J5Y A;  2CS7 A;  5A2Q E;  3A8G B;  1QVG S;  2G3R A;  1EFN A;  1UGQ B;  1AEY A;  4LDV A;  4RUG A;  2A3L A;  5GAN h;  4OMO A;  2R5M A;  1VQ5 T;  4HCK A;  3VUZ A;  4E7J A;  2DBK A;  3JCM h;  2NYS A;  1VQL Q;  4C5H A;  1BYM A;  2FZK B;  3OB9 A;  4ZTF A;  2KK4 A;  4HVU A;  4XU2 A;  5D7U A;  4PFZ A;  4PJO E;  1FMV A;  2LX7 A;  2HZY A;  3TSW A;  3G6E A;  4F04 B;  5CKD A;  3M56 A;  4N4G A;  3PTA A;  2M1H A;  3M58 A;  4XU1 A;  1PCX A;  1UDL A;  4M7A B;  3THK A;  3OW2 S;  4M77 A;  4A63 B;  2A0F B;  1JJ2 A;  3CXC S;  2DJQ A;  2QA4 Q;  1PD1 A;  4ZTJ A;  4GLM A;  1BIA A;  3J80 E;  3LH0 A;  1WDX A;  3QKJ A;  4JS4 A;  2VKN A;  2GTO A;  2EFI A;  3J7A F;  1EZZ B;  2ECZ A;  1RL2 A;  5A0L A;  1OOT A;  1ZSG A;  2K9G A;  2CT3 A;  4PJO F;  2HBW A;  1Q7Y R;  2EQI A;  2P84 A;  3CPW S;  4C8Q G;  4RTX A;  4CC3 A;  2HQX A;  1UFF A;  4AFS C;  5GAM f;  3NTK A;  1PSE A;  4DA4 A;  2LRQ A;  3HP9 A;  1JO8 A;  5IT9 E;  2ZPF B;  3L2U A;  3MKD A;  4J9B A;  3OYB A;  2XI9 A;  2LJ1 A;  4M7A A;  4VUB A;  3GF5 A;  2G6F X;  1ZBX A;  2L3P A;  2DBM A;  1K73 C;  5J26 A;  3HRT A;  5LL6 S;  5D6Y A;  2KXC A;  3WVD B;  5GAN 4;  2QA4 A;  4HCZ A;  1I1J A;  2CDT A;  1VQO A;  2EGA A;  4BAC A;  3VU3 C;  1ZUK A;  5LJ3 f;  1HYO A;  2HD0 A;  3OYJ A;  5CKE A;  2BZY A;  3FB9 A;  4AG2 C;  5ECA A;  5CAI A;  1IGU A;  3O5Z A;  5LJ5 e;  4JS5 A;  4BE1 A;  2CRE A;  2XKO C;  4ANJ A;  1CSK A;  4J6X A;  2GFA A;  3MP8 A;  5KE3 A;  2RF0 A;  1SKU B;  4TVR A;  4PJN A;  4C5G A;  3SFM A;  1PKS A;  1I81 A;  1KD1 R;  2CT4 A;  2PUK B;  1BK2 A;  2LCC A;  5FU6 B;  2YT6 A;  5GAN g;  4B9W A;  5HK0 A;  3JCM g;  2COZ A;  3DLM A;  3P8H A;  3QBY A;  1K8A C;  3ZEH A;  4QQ6 A;  1TUC A;  4CRI A;  4QQD A;  1UTI A;  5DM7 R;  2QQS A;  2EQM A;  2LQN A;  5KYY B;  2DD5 A;  2ZCF B;  4M7D D;  4FYW B;  4D8D A;  3OYA A;  3SWN A;  4C0F A;  1SSF A;  3NFC A;  3NTI A;  3O8V A;  2ED1 A;  3CCS T;  1YIJ A;  3AHU A;  1NLP C;  1IHV A;  1KHI A;  3X28 B;  1WA7 A;  3CCR T;  4X9C A;  1ZSZ B;  2K5F A;  4IUV A;  2DL5 A;  1YJ9 T;  4XTZ A;  1KFZ A;  1NEB A;  4A54 A;  2JN0 A;  1S72 Q;  3SD4 A;  3JCM c;  1RAE B;  3CCL T;  1G5V A;  2DM1 A;  4DOW A;  2MWO A;  4FCY A;  3VRY A;  4QQG A;  1VQ5 Q;  3HTR A;  1KJW A;  3VV0 A;  5I11 A;  3NHN A;  2K5I A;  4OF1 A;  2QXF A;  1N9S A;  4AG1 C;  3MO8 A;  4JRP A;  2EQJ A;  3L2W A;  3CBO A;  1W2B P;  3M4G A;  2JUF A;  1G3S A;  3X25 B;  1PWT A;  2QQR A;  1M1K R;  1UE9 A;  3MP1 A;  4RKU E;  1D1B A;  1GFD A;  2CP5 A;  4M7D G;  1JXM A;  4HCC A;  3VS2 A;  2ZPE B;  1MGQ A;  2C0I A;  1MMN A;  3OBW A;  2HDA A;  4LN2 A;  1AT1 B;  1YWO A;  2Y4X A;  3I5R A;  1YJW T;  2E6Z A;  3DB4 A;  4Y91 A;  4M77 D;  2CH4 A;  1X6O A;  3TSZ A;  2DZC A;  1G2B A;  2JS2 A;  2QEX Q;  2EJ9 A;  1WPY A;  2AHJ B;  2EGC A;  4M75 F;  1FMW A;  4JZ3 A;  1AWX A;  1YBY A;  1SG5 A;  4DBQ A;  2JOY A;  1YIT Q;  2QTV A;  1C0M A;  2KBT A;  4F7U B;  1TUG B;  2OTJ A;  3I35 A;  4J9I A;  1WJQ A;  4ORZ A;  2DE0 X;  1K9M U;  2FRY A;  3LGL A;  3MJX A;  4M77 C;  4FT4 A;  4J9E A;  5GAO q;  1W2B S;  2DEU A;  2XDP A;  3VYG A;  2CSI A;  3VYH B;  3CBP A;  5FRM A;  1WLP B;  2DL4 A;  1QQJ A;  5IHI A;  1S1N A;  3CMA Q;  1V1C A;  3L1A A;  4AFQ C;  4FSS A;  3EG9 B;  1M2V A;  2YLB A;  3CBM A;  2RJE A;  4BDZ A;  3CD6 A;  3V7S A;  2KI7 A;  4M78 E;  1QCO A;  1YJW A;  1M8M A;  1GCQ C;  1Y96 A;  4MML A;  3DLL A;  2JM8 A;  2DFU A;  1W1F A;  1AWO A;  5GJW B;  1RLP C;  4PNO A;  3T9N A;  2QEX T;  1PSF A;  3C0C A;  1MNE A;  2VGN A;  2P4T A;  2CSQ A;  1QKW A;  3CC7 A;  4LNP A;  5CK9 A;  3LW5 E;  1M2V B;  5KCH A;  4PJO A;  5IXB A;  1VYV A;  2E64 A;  2OAU A;  4M4Z A;  2NUT A;  3V7C A;  3A8H B;  2YHT A;  1QVP A;  4F7U G;  5LJ5 f;  4C8Q D;  2OTJ Q;  5FU7 B;  4ME7 A;  1KD1 C;  3CCM A;  3BDU A;  2A37 A;  2OTL Q;  1P92 A;  3P8D A;  3VS7 A;  2VUB A;  3M5A A;  1AHJ B;  4P5N A;  3RUX A;  2P0Q A;  1T0H A;  3OW2 P;  1N8R U;  2L0A A;  1B7T A;  2RQU A;  1D09 B;  2DIQ A;  5GAN 2;  2KRS A;  3EGX A;  4GBQ A;  2CP3 A;  2GTJ A;  4IUR A;  3X24 B;  2GCX A;  2DF6 A;  3PGG A;  4KT0 E;  4DBH A;  2PTK A;  4OML A;  1UEB A;  3CD6 Q;  4EMH A;  5GAN 7;  3SHW A;  2QDL A;  1WQ7 A;  3BFM A;  3CCR Q;  4XAX B;  5IHN A;  2WSE E;  5D6W A;  1S72 T;  4HCB A;  2MOX A;  5KYX A;  1DJ7 B;  2KQW A;  2PVG B;  1Q82 R;  2CUB A;  1JJ2 P;  1D1C A;  3FJP A;  1TOV A;  1SHG A;  3FDR A;  1B34 B;  3A5Z B;  2LT1 A;  1KQ2 A;  4BY6 C;  1VQ6 A;  4M78 B;  3A1P A;  1SEM A;  2F2V A;  2R57 A;  4LDY A;  4E7H A;  1KIK A;  2QA4 T;  4JRI A;  4LDX A;  3L2Q A;  2EGE A;  3S3N A;  4BI3 A;  4IKF A;  4M78 D;  4M75 G;  1KC8 R;  2KRN A;  1PM3 A;  2DTO A;  2V1Q A;  4ELY C;  1UHF A;  4M7A E;  4PFO A;  4J9F A;  4E7L A;  2E70 A;  4DEY A;  2CP0 A;  2DL7 A;  3EHR A;  8AT1 B;  1N27 A;  1W4S A;  3GP8 A;  3EG0 A;  2LVM A;  2XID A;  2F5K A;  3QWY A;  2OJ2 A;  3RIR A;  4NS5 A;  1WGS A;  2XG8 D;  1H92 A;  2DLP A;  1HD3 A;  4AT1 B;  3PNW C;  1E6G A;  4NOY A;  2D8H A;  3OSV A;  4HXJ A;  2Y4Y A;  1VQ8 Q;  1KHC A;  1K73 U;  3VKI A;  1TSF A;  3H9N A;  2RO0 A;  1FMK A;  5CKB A;  1JQQ A;  2LMJ A;  2DA9 A;  1QVG A;  1UJY A;  1KSW A;  2H3E B;  3RMQ A;  3KXT A;  2DKG A;  4XK8 E;  4PJM A;  4M7D F;  2E3I A;  2ZZD A;  4HVV A;  3L42 A;  3OYN A;  4PK4 A;  4PJJ A;  4ZGJ B;  4PJO C;  2J6O A;  3E9F A;  4YTL A;  4BI8 B;  2L5Q A;  2RH2 A;  4RMO A;  5GJV B;  1O9S A;  1TH7 A;  2QQ9 A;  1BBZ A;  2RHI A;  2DIG A;  2RK2 A;  4R56 A;  5GAM d;  3ASK A;  3OYY A;  4E6R A;  2O2O A;  3FLG A;  5CIU A;  3CCJ T;  1VA7 A;  1PKT A;  2DYI A;  2EIF A;  2BE7 D;  4BUG A;  4V2S A;  1VQL A;  3OYI A;  2EBP A;  2GBQ A;  1TU0 B;  2BIV A;  1SRM A;  4E2F B;  1QVF A;  4M7A F;  2RQR A;  2O01 E;  2MWP A;  3TU4 K;  3U23 A;  1IRX A;  2K79 A;  1M2O A;  4OB1 B;  3JCM P;  4X9D A;  3EGX B;  3CCL Q;  2YXY A;  2PU9 B;  4IIM A;  3EG1 A;  1KQS S;  3I55 Q;  2CP7 A;  4BI4 A;  4XTV A;  4C8Q E;  3URG A;  3CCM Q;  3A8L B;  2JZ2 A;  1HJD A;  2K2M A;  3L2R A;  3OSS C;  1YNZ A;  4BD3 A;  1ZSZ A;  3LWH A;  9ATC B;  1IXD A;  4PJO B;  4NL2 A;  5M9O A;  2X4Y A;  1WQW A;  1BIB A;  2ROT A;  5J39 A;  2EYX A;  2OTL T;  3PMI A;  3QXE B;  1U06 A;  1AD5 A;  5KYU A;  2DXU A;  3QDR B;  1VQ4 A;  1R0C B;  1WX6 A;  2O9V A;  2RM4 A;  2YUQ A;  3LYI A;  3QO3 A;  2QI2 A;  3VRZ A;  4C92 C;  1D0Y A;  3RR6 A;  1M27 C;  5CCA A;  1GBR A;  3EFO A;  1M4Z A;  3OYF A;  2V8J A;  1MMD A;  4HVW A;  1Y71 A;  3VS1 A;  4O6J A;  2D0Q B;  1FWZ A;  1X6G A;  2L2P A;  1GBQ A;  3I56 A;  5C6S A;  2EPD A;  3KFV A;  5HY6 A;  3NTH A;  2DZ9 A;  2PVO B;  3S6W A;  3CME Q;  4LUD A;  5CR2 A;  1WHL A;  2JT4 A;  4RCC A;  1HXD A;  4MZM A;  4R55 A;  2K5L A;  2EYQ A;  2LQ8 A;  3CCJ Q;  2RJD A;  1AWW A;  5DY9 A;  1N8R R;  5A0D A;  1UHC A;  2XMF A;  3CPW A;  4F7U A;  3QYH B;  1QLY A;  4EMK A;  3LGF A;  1K0S A;  3CCQ Q;  2LJ0 A;  3HPW A;  2K2V A;  4PJO G;  4M78 A;  4XTU A;  3RKX A;  2KYM A;  2VV5 A;  5GAO p;  1D0Z A;  2RK1 A;  4C8Q F;  8ATC B;  1O75 A;  2NUP A;  1JU5 C;  4OB0 B;  2FB7 A;  4C8Q B;  1BCO A;  4Z8A A;  2VWF A;  2AZS A;  2DER A;  1PD0 A;  2JMA A;  1I07 A;  2LJ3 A;  4J7I A;  2CYZ B;  1OPL A;  1A0N B;  2PQW A;  1EX4 A;  4JJN K;  3JCM f;  1NZ9 A;  2E1H A;  1VQN A;  2O88 A;  5GAO l;  3QWX X;  3UT1 A;  2AIR B;  2BKD N;  3M9Q A;  3CCE Q;  3A8M B;  1GCP A;  4ZNX A;  5J3B A;  2MYS A;  4J9C A;  2L3S A;  4LD6 A;  2HL5 C;  2KMT A;  4QW2 A;  2HQE A;  3TRE A;  2M0O A;  1Z9Z A;  3CCV A;  2RHY A;  4EPC A;  2JW4 A;  3CCS A;  4LDW A;  4OB2 B;  2QEX A;  4KUI A;  4Z89 A;  4E7S A;  4XTY A;  4FW1 A;  5GAO n;  4KRT A;  2DTI A;  1Q95 G;  2D9T A;  2GFU A;  5CVI A;  1Q82 U;  4M7D E;  3CCQ A;  2DAQ A;  2P0K A;  3ZFJ A;  5CQX A;  3M55 A;  3G4S Q;  2KSS A;  3RES A;  1M5Q 1;  1X43 A;  4OMP A;  4BE2 A;  1AVZ C;  5KYN A;  2RI3 A;  3OYE A;  4M78 G;  3EFO B;  2PVD B;  4C0D B;  5KYY A;  1YWP A;  2HEQ A;  3CCU A;  3M0U A;  4OGE A;  3OYG A;  4J83 A;  3MHX A;  2FG0 A;  5L8R E;  1QWE A;  2X4X A;  4C92 E;  1Q81 U;  3C95 A;  3QZ9 B;  3KBG A;  1WI7 A;  1RAI B;  3MET A;  2FHD A;  4N0A C;  2JNG A;  2VXF A;  1YJ9 Q;  1IO6 A;  3PVQ A;  1M90 U;  3QG1 A;  2PZ1 A;  5LJ5 h;  1Q86 R;  1D0X A;  4QVD A;  1LOJ A;  2D0N A;  1MHN A;  4Z88 A;  2QK0 A;  1FX7 A;  2RHZ A;  2ROL A;  2W0Z A;  1AWJ A;  1NBE B;  1K8A R;  1MV0 B;  2RD1 A;  1GFC A;  3CCS Q;  1M1K U;  3QJY A;  4A4E A;  2DK3 A;  4C92 G;  2K57 A;  2XDB A;  3FEO A;  3OMC A;  5I2M A;  3VS6 A;  1Q81 C;  2WAC A;  2DTH A;  2EW3 A;  2ESW A;  4WTO B;  3FJ5 A;  5C0M A;  1VQ7 Q;  2ABL A;  2DVE A;  2XU8 A;  2J06 A;  4XTX A;  2MMP A;  3WVE B;  1IHW A;  2RN8 A;  1JB0 E;  1I5O B;  2ED0 A;  3JCM V;  3TCJ A;  4BB7 A;  2DXC A;  3BY7 A;  1OU8 A;  3ZBD A;  2GQI A;  3QZ5 B;  3R6N A;  3CCE T;  2MCN A;  3BE3 A;  1MND A;  1QW1 A;  2RJC A;  1WHK A;  3UA6 A;  2I2L A;  1G83 A;  2J7I A;  3C12 A;  2A28 A;  1VQM A;  4M7D B;  2NUZ A;  1M9S A;  1G3T A;  3CCJ A;  1LCK A;  2SEM A;  2OI3 A;  1ZUY A;  2CZ7 B;  2KRO A;  3HSB A;  2FVU A;  1QCF A;  2DIL A;  3M54 A;  5LJ3 g;  1N8R C;  4GY5 A;  5GMK i;  2P4R A;  1WXU A;  1SRL A;  3OQ5 A;  1W70 A;  2QDY B;  3JB9 J;  1NM7 A;  2GNC A;  3C4S A;  3G71 T;  2RNA A;  4IIO A;  1ARK A;  4KGV B;  3JB9 I;  2YLC A;  4JZ4 A;  1QP3 A;  2A08 A;  2KR3 A;  1YCS B;  5HK3 A;  4C92 B;  2AZV A;  2RQT A;  2WSF E;  2RQW A;  3PIP A;  2JM9 A;  5CKF A;  3IQL A;  1YHQ Q;  5I22 A;  4XQ3 A;  4A4G A;  2ZPI B;  3UWN A;  5KE2 A;  1KQS P;  2ZPH B;  4EMK C;  1U1T A;  4A4F A;  2EWN A;  3CC2 T;  4C0Z A;  5GAN 5;  2HMA A;  3CQT A;  4M77 F;  3JB9 H;  1TXQ A;  3RER A;  1PHT A;  4RG8 A;  1RAG B;  2LNV A;  3V8J A;  1VQ4 T;  2RMO A;  3OS1 A;  5FU6 C;  3RKW A;  1IRE B;  1F1B B;  4HA8 A;  3UF4 A;  3CEY A;  4FU6 A;  1X2K A;  2OAW A;  3EG9 A;  2VB6 A;  3ME9 A;  2F5T X;  2E10 A;  3G1J A;  3PMT A;  4EIK A;  2EJF A;  3JV3 A;  1KQ1 A;  2MAM A;  5KYX B;  2A7Y A;  5GMK h;  4FW2 A;  1CKA A;  1VQP T;  1G3Y A;  1K9M C;  2JTM A;  3ULR B;  2YUP A;  1RAA B;  5LJ5 g;  3CC4 A;  3V8K A;  2DD4 A;  2KT1 A;  2IPO B;  4L6V 5;  4ZN1 A;  1KC8 U;  1X75 C;  2E12 A;  3EAE A;  2F1L A;  1GRI A;  2DXT A;  1VQO T;  1OEB A;  1NYF A;  2BZX A;  2RA2 A;  2DRM A;  2DJZ A;  1M30 A;  1VQ5 A;  3OBY A;  3SDZ A;  2XD0 A;  1OX9 A;  3INZ A;  3MCA B;  1B34 A;  1Y7X A;  1VOM A;  4FYV B;  4M77 G;  1ZBJ A;  2EKH A;  3H8Z A;  3HKS A;  3OA6 A;  3EG2 A;  1I4K 1;  1OZ2 A;  1HSQ A;  4A4H A;  1YIJ Q;  1PG5 B;  4E47 A;  2DEQ A;  3TQ7 P;  4BE0 A;  1YJN Q;  1AOJ A;  2K6D A;  2MIO A;  1S72 A;  2WSC E;  2XK0 A;  3V8L A;  1J3T A;  4DOV A;  3NMZ C;  1W6X A;  4KBM B;  4M7A D;  2LT4 A;  2LDM A;  4CI0 C;  4KH0 B;  3I5S A;  4JJD A;  4EMG A;  3VS3 A;  4ZGD B;  3MPU B;  5LJ3 j;  2FL7 A;  5DLQ E;  4F7U E;  1U5S A;  1YI2 A;  1VQ9 Q;  1UEC A;  1TTH B;  3JB9 F;  1YHQ T;  2ZAE A;  2MPX C;  2RPN A;  2LZ6 B;  5LJ3 h;  1ZUU A;  3JCM b;  1YIT A;  1JJ2 S;  4WF2 A;  1M3A A;  1K1Z A;  5GAN 3;  2L89 A;  5A0G A;  3M0T A;  3CMA A;  4PL6 A;  3HFN A;  2QTX A;  3QII A;  1X69 A;  2EQK A;  2GQV A;  1BI3 A;  3QDF A;  4OP0 A;  4A4K A;  2LC4 A;  1M3C A;  1SF9 A;  2V1R A;  1KC8 C;  2DVJ A;  1H8K A;  2Y90 A;  3HRS A;  2A36 A;  2VGM A;  2JTF A;  2JJ9 A;  2EYY A;  4M75 B;  4KH1 B;  3VS5 A;  3PIO A;  1WNL A;  4M75 E;  1BI2 A;  1VYT A;  4NL3 A;  5EG2 A;  3M0Q A;  1MMA A;  4ATO A;  1VQP A;  4QT7 A;  1QVF S;  2YUN A;  4N0A A;  2X4J A;  3M59 A;  5KCO A;  1VQN T;  2DXB A;  2K4Y A;  1U1S A;  2L8D A;  2RI2 A;  3BDL A;  4MDW A;  1RAC B;  5FRN A;  2E41 A;  2EYW A;  1QVG P;  1VQ9 A;  3ZL7 C;  4M7D A;  2COY A;  5CQY A;  2B8A A;  2H8H A;  1UG1 A;  1PNJ A;  1B3Q A;  3G6E Q;  5GAO r;  2L3Q A;  1NJI U;  3LWI A;  3EGD A;  1WHH A;  2JTE A;  2M02 A;  1VQM Q;  2CKK A;  1VQK T;  1WJS A;  3CME T;  4M78 F;  1YJW Q;  2MF2 A;  2OTL A;  4XTW A;  3GNF B;  1VIE A;  2YSQ A;  4M75 C;  1M1F A;  1ZLM A;  3CC7 Q;  2RHU A;  3FRN A;  3CCM T;  2HNI A;  2H3J A;  1N6A A;  4D6W A;  3REA B;  1I5L A;  2GGR A;  2FPE A;  4IUQ A;  4AMC A;  1VQN Q;  2DL3 A;  1VQ4 Q;  1IZ6 A;  2X3W D;  3G4S T;  3X26 B;  4LE9 A;  1N9R A;  2D1X A;  1KG1 A;  1G8X A;  4D8K A;  2NWM A;  1T3S A;  1YI2 T;  1VQK Q;  2HKQ B;  3PE0 A;  5DLO A;  1IGQ A;  3GNG A;  5GMK e;  1WYX A;  1TUD A;  4JDS A;  3Q1J A;  5IAY A;  3BW1 A;  3EFR A;  3J81 E;  4R0K A;  3JCM e;  1BI0 A;  5D6X A;  2E5Q A;  3M57 A;  2DET A;  1OUL A;  4IUP A;  3MP6 A;  3GPL A;  2X9H A;  3SWN C;  3OS0 A;  3CC7 T;  2KDS A;  2QGF B;  1VQ6 T;  1LVK A;  4C92 A;  2D6F A;  4CC4 B;  4CC2 A;  2VXE A;  1NG2 A;  1BI1 A;  1VQ8 A;  3EH2 A;  3MEW A;  2DO3 A;  3QUI A;  1GL5 A;  4DBR A;  2O31 A;  1VIF A;  3UA7 A;  3H0F A;  3DB3 A;  3S3O A;  3REB B;  1C6V X;  1D1A A;  4Y28 E;  5HKC A;  2FYK A;  4DEX A;  3AT1 B;  4HT9 A;  2BTT A;  3LX7 A;  3TVT A;  4N4H A;  2X3X D;  3MEA A;  4E7Z A;  1RI9 A;  1X01 A;  1RAB B;  2BZ8 A;  2QG9 B;  5GAO m;  4OVA A;  5FRO A;  4PLL A;  2CP2 A;  4X1V A;  1YIJ T;  3P8B B;  1VQ7 T;  3EFS A;  5EC7 A;  4OMN A;  2IG0 A;  2KE9 A;  1YN8 A;  2KVQ G;  1M8V A;  4FIB A;  2DX1 A;  2RJF A;  2MI6 A;  2D8J A;  2IVW A;  5LJ3 e;  4AFU C;  3CCQ T;  2ZPG B;  1YJN A;  3HRU A;  2BE9 B;  4PJO D;  1T0J A;  4DBF A;  1Y07 A;  1D3B B;  3JSC A;  4C8Q A;  4B9X A;  2VAS A;  1VQ8 T;  1PC0 A;  1UGR B;  3JRZ A;  2RB6 A;  2ZGW A;  2O4X A;  4EMK B;  1Z9Q A;  3GBQ A;  5AYF A;  4KGZ B;  2BUD A;  1RAD B;  2VC8 A;  3E9G A;  1LPL A;  4KUD K;  1E6H A;  1GCQ A;  2B86 A;  3RDV A;  1PRL C;  4HT8 A;  2SRC A;  2K3Y A;  4M77 B;  2QAS A;  1YCY A;  1AZE A;  4E7K A;  3GOX A;  4LD9 K;  3MEU A;  3N5B B;  2KYB A;  1WHM A;  5GAM j;  3OW2 A;  1RUW A;  4J9H A;  1RI0 A;  2HAX A;  3CXC A;  4HKE A;  4JRQ A;  4JUV A;  4PFP A;  3JCM d;  3SWN B;  1IB8 A;  1OU9 A;  2DL8 A;  2E4H A;  2K7A A;  3HFO A;  5I21 A;  3WXM B;  4C0G A;  1ZQ1 A;  1YP5 A;  4CC7 A;  2J6K A;  3RMS A;  3H0I A;  4C92 F;  5FW9 A;  1VQP Q;  4II1 A;  4Y92 A;  5IHK A;  2DYB A;  1MV3 A;  2K3X A;  1OPK A;  4L59 A;  1MUZ A;  2IIM A;  1R0B G;  7AT1 B;  1KQS A;  5GAM h;  2ENM A;  1WHG A;  2X35 A;  4J6W A;  2FZC B;  2AK5 A;  4M78 C;  3I56 Q;  3HHT B;  2FEI A;  1UJ0 A;  3VUB A;  1VQM T;  3CD6 T;  4X34 A;  4MDX A;  4FSX A;  2AT1 B;  3TEE A;  4ELZ C;  4Z02 A;  1T3L A;  4FM4 B;  2LNH B;  1K0X A;  1K4U S;  1OV3 A;  2E6N A;  2EAY A;  2LX9 A;  1VQL T;  3RNJ A;  1KK7 A;  5CO7 A;  1FXX A;  2LTO A;  2QQB A;  3PFS A;  4K11 A;  1NYG A;  2C06 A;  4JJC A;  4BY6 B;  5CKH A;  3OMG A;  3OY9 A;  1WIE A;  4FL6 A;  5GAN f;  3X20 B;  3QPH A;  1VUB A;  1WHJ A;  2C0O A;  1Q86 C;  1X6B A;  1V29 B;  1HK9 A;  3QSU A;  4LXC A;  1ZA2 B;  2W10 A;  3L2V A;  1K8A U;  1M3B A;  5GAN j;  4AFZ C;  5GAN 6;  2R58 A;  1U3O A;  1U8R A;  3A8O B;  2CGH A;  2HL3 A;  1JRI A;  2JMC A;  5FU7 C;  2ZPB B;  1TS9 A;  4MMK A;  3UDC A;  5LJ5 j;  3JB9 D;  1QVF P;  4C92 D;  1Y0M A;  2MK5 A;  4F7U F;  3CCR A;  1Q81 R;  1VQK A;  3CCE A;  1JEG A;  3G7Z A;  2RI5 A;  4Q5W A;  1SPK A;  4M75 A;  5I2S A;  4PKC C;  1UGV A;  1Y57 A;  2M9U A;  4C0D C;  1M1K C;  1LJO A;  1H3H A;  4MZT A;  4OGC A;  2GF7 A;  2NUT B;  2CUD A;  3G6E T;  3QHS A;  1VQ6 Q;  2LQW A;  2VYT A;  3L2Z A;  4RTT A;  1ZHI A;  6AT1 B;  1ZA1 B;  3FC3 A;  2CZ0 B;  3CPW P;  4M7D C;  1VYU A;  2ATC B;  2V8K A;  1RAF B;  2JVV A;  2HCK A;  3CCV Q;  2X4W A;  2M0Y A;  1G3W A;  2CP6 A;  1TG0 A;  4JLI A;  3I56 T;  3QYG B;  2V26 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 4LDU A;  1UB4 A;  4DQ2 A;  3A8L B;  1YHQ T;  2JZ2 A;  4ZGE B;  5LJ3 h;  3OYK A;  3JCM b;  4OB3 B;  1YIT A;  3L2R A;  1VQO A;  1JJ2 S;  4MDX A;  2HBP A;  3OSS C;  4WF2 A;  3VU3 C;  4A53 A;  4BAC A;  1XTD A;  5LJ3 f;  3JAM E;  4BD3 A;  2HD0 A;  2L89 A;  3V7R A;  3E1S A;  5A0G A;  5CKE A;  3F70 A;  5GAN 3;  3FB9 A;  3OYJ A;  3CMA A;  3LWH A;  2E65 A;  4PL6 A;  3HFN A;  5CAI A;  2QTX A;  3E19 A;  3QII A;  3CC2 A;  2EQK A;  2PUO B;  3VJP A;  3OYL A;  2GQV A;  4NL2 A;  5M9O A;  2X4Y A;  1WQW A;  1BI3 A;  5LJ5 e;  4JS5 A;  4BE1 A;  1BIB A;  2XKO C;  5J39 A;  4OP0 A;  4O5V A;  4A4K A;  2OTL T;  3PMI A;  2LC4 A;  4J6X A;  3QXE B;  2GFA A;  2DXU A;  3MP8 A;  1KC8 C;  2QQA A;  3QDR B;  5KE3 A;  2Y90 A;  1VQ4 A;  2RM4 A;  3OS2 A;  3HRS A;  3LYI A;  3QO3 A;  4TVR A;  2QI2 A;  4C92 C;  4C5G A;  3SFM A;  3OYH A;  3SB2 A;  1W2B A;  2VGM A;  5CCA A;  1I81 A;  2JTF A;  5GAM g;  2PUK B;  1M4Z A;  2LCC A;  4M75 B;  5FU6 B;  3OYF A;  2V8J A;  3PIO A;  5GAN g;  1WNL A;  4B9W A;  4M75 E;  1BI2 A;  5HK0 A;  3CCU T;  1Y71 A;  4NL3 A;  5EG2 A;  3JCM g;  3PT9 A;  3DLM A;  3P8H A;  1M90 C;  1XOV A;  4ATO A;  4O6J A;  1VQP A;  3QBY A;  1QVF S;  1K8A C;  1H3Z A;  2D0Q B;  4M77 E;  4N0A A;  3G4S A;  2X4J A;  3M59 A;  3ZEH A;  1FWZ A;  5KCO A;  1VQN T;  1NJI C;  2DXB A;  4QQ6 A;  3I56 A;  5C6S A;  2K4Y A;  5HY6 A;  3NTH A;  1U1S A;  4CRI A;  2DZ9 A;  4QQD A;  2PVO B;  1NE8 A;  3S6W A;  2L8D A;  2RI2 A;  3BDL A;  5DM7 R;  4MDW A;  3OYM A;  5IN1 A;  5CR2 A;  2QQS A;  5FRN A;  2E41 A;  2EQM A;  4RCC A;  2DD5 A;  4ZN3 A;  5LJ3 d;  2ZCF B;  1HXD A;  1XNI A;  4MZM A;  4R55 A;  1VQ9 A;  3OYA A;  4M7D D;  4M7D A;  2K5L A;  3SWN A;  2EYQ A;  5CQY A;  2B8A A;  2LQ8 A;  4C0F A;  1SSF A;  2RJD A;  3NFC A;  4OMF B;  3NTI A;  1OI1 A;  5DY9 A;  3O8V A;  2EKO A;  3CCS T;  1YIJ A;  3AHU A;  1KHI A;  5GAO r;  3CMA T;  1NJI U;  3LWI A;  5A0D A;  3X28 B;  2YRV A;  1VQ7 A;  3CCR T;  4X9C A;  4F7U A;  2CKK A;  3QYH B;  3CPW A;  1VQK T;  2P0P A;  1WJS A;  3CME T;  1I8F A;  2K5F A;  4IUV A;  4MZP A;  3LGF A;  4EMK A;  1YJ9 T;  2F69 A;  4XTZ A;  4A54 A;  2JN0 A;  3HPW A;  1JBM A;  2K2V A;  3SD4 A;  3JCM c;  4M78 F;  4PJO G;  3GLX A;  1WJR A;  2MF2 A;  4M78 A;  4XTU A;  2OTL A;  4XTW A;  3RKX A;  3GIB A;  2VV5 A;  4RG2 A;  5GAO p;  2RK1 A;  3GNF B;  3CCL T;  2LCL A;  1VIE A;  1G5V A;  3JCM W;  4C8Q F;  4M75 C;  1KD1 U;  4DOW A;  1O75 A;  2MWO A;  5GMK m;  4OB0 B;  2FB7 A;  4QQG A;  4C8Q B;  1EIF A;  5KH6 A;  3VV0 A;  1M1F A;  2RHU A;  2K5I A;  3FRN A;  2QXF A;  2HNI A;  4OF1 A;  1N9S A;  3CCM T;  2H3J A;  3MO8 A;  4FT2 A;  4QVZ A;  1N6A A;  4JRP A;  4J7I A;  1Y96 B;  4D6W A;  4GLK A;  1XQH A;  2EQJ A;  3L2W A;  3CBO A;  2CYZ B;  3M4G A;  2JUF A;  1I5L A;  1G3S A;  2PQW A;  4IUQ A;  3X25 B;  2QQR A;  2L3R A;  4JJN K;  3JCM f;  1NZ9 A;  1IZ6 A;  2E1H A;  3MP1 A;  3G4S T;  2R5A A;  1VQN A;  4RKU E;  3X26 B;  1N9R A;  5FLX E;  4QVC A;  5GAO l;  3UT1 A;  2BKD N;  3M9Q A;  3A8M B;  1KG1 A;  4M7D G;  5J3B A;  4HCC A;  4LD6 A;  2ZPE B;  4C5E A;  2KMT A;  1Q82 C;  1MGQ A;  4QW2 A;  1YI2 T;  2HQE A;  3TRE A;  3OBW A;  2M0O A;  3KUF A;  2XHC A;  3S3M A;  1YHQ A;  5DLO A;  1VQ9 T;  3GNG A;  5GMK e;  2Y4X A;  4JDS A;  3CCV A;  2RHY A;  2E6Z A;  3DB4 A;  1YIT T;  1YJW T;  3Q1J A;  4IUU A;  4EPC A;  4Y91 A;  5IAY A;  3BW1 A;  4M77 D;  3EFR A;  3J81 E;  3JCM e;  1BI0 A;  1X6O A;  2E5Q A;  2LQK A;  4LDW A;  5D6X A;  3CCS A;  4C8Q C;  3I55 A;  1GXI E;  3M57 A;  4OB2 B;  2QEX A;  1LNX A;  4KUI A;  4IUP A;  2DZC A;  1OYX A;  3MP6 A;  4XTY A;  4C5I A;  3SWN C;  3GPL A;  5GAO n;  3JB9 G;  3OS0 A;  3CC7 T;  2EJ9 A;  1WPY A;  2DTI A;  4UC4 A;  4PLI A;  2AHJ B;  4M75 F;  2GFU A;  2D9T A;  5CVI A;  3G71 A;  1YBY A;  1Q82 U;  2KDS A;  4M7D E;  3CCQ A;  2JOY A;  1YJN T;  3CCL A;  2DAQ A;  2CZ1 B;  1VQ6 T;  2P0K A;  5GAM e;  4F7U B;  3PTA A;  3OS5 A;  3ZFJ A;  1YJ9 A;  4C92 A;  4J7F A;  5CQX A;  2OTJ A;  1WJQ A;  1BKB A;  2D6F A;  3M55 A;  1K9M U;  2KSS A;  3LGL A;  2VXE A;  1M5Q 1;  3MEV A;  4M77 C;  3RES A;  4FT4 A;  4BE2 A;  1BI1 A;  4XU0 A;  2CZ6 B;  5GAO q;  1VQ8 A;  2RI3 A;  3MEW A;  4IUT A;  2DO3 A;  2XIC A;  3QUI A;  3RKY A;  5LJ5 d;  3OYE A;  3JCM J;  1W2B S;  4M78 G;  2PVD B;  4C0D B;  3CCU A;  4OGE A;  1VIF A;  2XDP A;  3OYG A;  1D3B A;  1NPR A;  3VYG A;  3VYH B;  4J83 A;  3CBP A;  3MHX A;  3DB3 A;  3S3O A;  5FRM A;  5L8R E;  4Y28 E;  2X4X A;  4C92 E;  3QJ6 A;  1Q81 U;  5HKC A;  2FYK A;  3C95 A;  3QZ9 B;  3L1A A;  4HT9 A;  2KY9 A;  5GAN d;  3KBG A;  3CPF A;  3LX7 A;  2YLB A;  3CBM A;  2RJE A;  3MET A;  2FHD A;  4N0A C;  2JNG A;  4N4H A;  4BDZ A;  2VXF A;  3UPU A;  4KUL A;  1M90 U;  1Q7Y C;  3CD6 A;  3MEA A;  3QG1 A;  5LJ5 h;  3V7S A;  4QVD A;  1X01 A;  3R6O A;  4M78 E;  3OYC A;  1LOJ A;  1MHN A;  3CCV T;  1YJW A;  1M1G A;  1Y96 A;  5GAN e;  1FX7 A;  2RHZ A;  4MML A;  3DLL A;  5GAO m;  4OVA A;  2NLU A;  4PLL A;  5FRO A;  1YIJ T;  3I55 T;  1UGP B;  3P8B B;  4PNO A;  4E7I A;  3T9N A;  1VQ7 T;  3EFS A;  2QEX T;  1PSF A;  2RD1 A;  2KVQ G;  2IG0 A;  3H6Z A;  4N4I A;  3CME A;  2VGN A;  1M1K U;  1M8V A;  3QJY A;  2P4T A;  2DK3 A;  4A4E A;  1NPP A;  2K57 A;  4C92 G;  3CC7 A;  4FIB A;  2KAF A;  5CK9 A;  2RHX A;  2RJF A;  3LW5 E;  2MI6 A;  2IVW A;  2XDB A;  1UGS B;  5KCH A;  5LJ3 e;  2XDD A;  3CCQ T;  2ZPG B;  4PJO A;  1H64 1;  1YJN A;  3FEO A;  3HRU A;  4PJO D;  3JCM X;  2E64 A;  2OAU A;  3OMC A;  5I2M A;  3V7C A;  1QP2 A;  3A8H B;  2YHT A;  1Q81 C;  2WAC A;  3FIF A;  1QVP A;  2DTH A;  3DKM A;  1Y07 A;  4F7U G;  3JCM Q;  5LJ5 f;  1D3B B;  4C8Q D;  5C0M A;  3OYD A;  3JSC A;  4C8Q A;  2V8I A;  4ME7 A;  5FU7 B;  4B9X A;  3M53 A;  2DVE A;  2EQU A;  1KD1 C;  1VQ8 T;  3CCM A;  3BDU A;  2XU8 A;  1UGR B;  4XTX A;  2MMP A;  3WVE B;  3JRZ A;  2RB6 A;  1JB0 E;  1P92 A;  1Q86 U;  3P8D A;  2ZGW A;  2VUB A;  4EDU A;  3M5A A;  1AHJ B;  4J6Y A;  4P5N A;  3RUX A;  2P0Q A;  3JCM V;  2O4X A;  3TCJ A;  4BB7 A;  4EMK B;  2DXC A;  3BY7 A;  5AYF A;  2BUD A;  3QZ5 B;  3ZBD A;  1N8R U;  3CCE T;  4BDY A;  2DIQ A;  5GAN 2;  1QW1 A;  2RJC A;  2VC8 A;  3E9G A;  4RCB A;  2I2L A;  4IUR A;  3X24 B;  1R8O B;  2C06 A;  3C12 A;  4KUD K;  2EJG A;  1VQM A;  2GCX A;  3PGG A;  4M7A C;  4M7D B;  3LLR A;  4KT0 E;  5GMK j;  1UEB A;  1M9S A;  1G3T A;  4EMH A;  5GAN 7;  3CCJ A;  1WQ7 A;  3BFM A;  3ER0 A;  4HT8 A;  2CZ7 B;  2K3Y A;  4XAX B;  3HSB A;  2FVU A;  4M77 B;  2WSE E;  1YCY A;  3M54 A;  4E7K A;  3GOX A;  3M4Y A;  4L5G A;  5D6W A;  5LJ3 g;  4GY5 A;  1S72 T;  1N8R C;  4LD9 K;  3MEU A;  4HCB A;  3N5B B;  5GMK i;  2M16 A;  5GAN 8;  4M7A G;  5GAM j;  3OQ5 A;  3OW2 A;  1RI0 A;  1DJ7 B;  2KQW A;  4JLG A;  2PVG B;  2QDY B;  4J8O A;  3JB9 J;  2HAX A;  3CXC A;  4HKE A;  3C4S A;  4JUV A;  4JRQ A;  3FJP A;  3C94 A;  1Q7Y U;  1OZ3 A;  3G71 T;  3JCM d;  5GMK l;  3SWN B;  3FDR A;  4JRK A;  1B34 B;  4M75 D;  3A5Z B;  2LT1 A;  1KQ2 A;  4BY6 C;  3JB9 I;  1VQ6 A;  4M78 B;  2YLC A;  1QP3 A;  3HFO A;  5I21 A;  2OTJ T;  3WXM B;  2R57 A;  4LDY A;  4C0G A;  3CC4 T;  4E7H A;  1ZQ1 A;  2DPP B;  5HK3 A;  4C92 B;  3RMS A;  2QA4 T;  4JRI A;  4LDX A;  2WSF E;  4C92 F;  3L2Q A;  4XU3 A;  2O4X B;  3PIP A;  3S3N A;  3HL8 A;  5CKF A;  4BI3 A;  4IKF A;  4J5Y A;  2CS7 A;  4M78 D;  4II1 A;  5A2Q E;  3A8G B;  4M75 G;  2K3X A;  1QVG S;  4L59 A;  2DTO A;  4ELY C;  2G3R A;  1UGQ B;  1KQS A;  5GAM h;  4LDV A;  4XQ3 A;  4M7A E;  2A3L A;  2ZPI B;  4A4G A;  5GAN h;  2X35 A;  4J6W A;  3UWN A;  2R5M A;  1VQ5 T;  4E7J A;  3VUZ A;  4E7L A;  2E70 A;  3JCM h;  5KE2 A;  4M78 C;  3HHT B;  4C5H A;  2ZPH B;  1BYM A;  4EMK C;  1U1T A;  4A4F A;  2EWN A;  3CC2 T;  1N27 A;  1W4S A;  3GP8 A;  4C0Z A;  3OB9 A;  3VUB A;  2LVM A;  2XID A;  5GAN 5;  4ZTF A;  2KK4 A;  2F5K A;  4M77 F;  4X34 A;  1VQM T;  3RIR A;  3CD6 T;  4FSX A;  4NS5 A;  1WGS A;  2XG8 D;  4XU2 A;  3RER A;  4RG8 A;  3TEE A;  4PJO E;  2LNV A;  3V8J A;  4Z02 A;  4ELZ C;  3OS1 A;  1VQ4 T;  5FU6 C;  3RKW A;  1IRE B;  3PNW C;  4FM4 B;  4HA8 A;  4NOY A;  3CEY A;  4FU6 A;  2E6N A;  3G6E A;  2EAY A;  2LX9 A;  5CKD A;  1VQL T;  3OSV A;  5CO7 A;  1FXX A;  2LTO A;  2QQB A;  2Y4Y A;  3M56 A;  3ME9 A;  2F5T X;  3PFS A;  1KHC A;  2E10 A;  2M1H A;  3M58 A;  3PMT A;  4N4G A;  4XU1 A;  4BY6 B;  5CKH A;  1K73 U;  3VKI A;  3OMG A;  3OY9 A;  2EJF A;  1KQ1 A;  4FL6 A;  2MAM A;  4M7A B;  3X20 B;  5GAN f;  3QPH A;  1VUB A;  2RO0 A;  2A7Y A;  5GMK h;  1Q86 C;  1VQP T;  5CKB A;  1G3Y A;  3OW2 S;  4M77 A;  1K9M C;  1V29 B;  1HK9 A;  3QSU A;  2JTM A;  1JJ2 A;  3CXC S;  5LJ5 g;  1QVG A;  3CC4 A;  3L2V A;  1K8A U;  3V8K A;  3RMQ A;  3KXT A;  4ZTJ A;  2DKG A;  5GAN j;  4XK8 E;  2DD4 A;  1BIA A;  5GAN 6;  3J80 E;  2R58 A;  3LH0 A;  4L6V 5;  4M7D F;  1U8R A;  2ZZD A;  3A8O B;  3QKJ A;  4ZN1 A;  2CGH A;  3L42 A;  4JS4 A;  1KC8 U;  1X75 C;  3OYN A;  1JRI A;  2E12 A;  3EAE A;  2DXT A;  1VQO T;  4ZGJ B;  5FU7 C;  2EFI A;  3J7A F;  2RA2 A;  2ZPB B;  4PJO C;  2DJZ A;  4MMK A;  3UDC A;  3E9F A;  5LJ5 j;  3JB9 D;  4YTL A;  4BI8 B;  4C92 D;  1RL2 A;  2L5Q A;  1VQ5 A;  4F7U F;  2RH2 A;  5A0L A;  3OBY A;  3SDZ A;  1O9S A;  1TH7 A;  4RMO A;  3CCR A;  3CCE A;  2QQ9 A;  3INZ A;  3MCA B;  1VQK A;  2XD0 A;  1B34 A;  3G7Z A;  2RI5 A;  1Y7X A;  4Q5W A;  2RHI A;  2DIG A;  4M77 G;  4M75 A;  4PJO F;  4PKC C;  5I2S A;  2RK2 A;  3H8Z A;  4R56 A;  3CPW S;  2M9U A;  3HKS A;  5GAM d;  4C0D C;  3OA6 A;  3ASK A;  1LJO A;  3OYY A;  1M1K C;  1I4K 1;  1OZ2 A;  4MZT A;  4A4H A;  4C8Q G;  4OGC A;  2GF7 A;  3FLG A;  5CIU A;  4E47 A;  3CCJ T;  2DEQ A;  2HQX A;  4BE0 A;  2EIF A;  5GAM f;  3G6E T;  3QHS A;  4PJO B;  3NTK A;  4BUG A;  4V2S A;  1PSE A;  1VQL A;  3OYI A;  2LRQ A;  4DA4 A;  1S72 A;  3HP9 A;  2VYT A;  2WSC E;  5IT9 E;  2ZPF B;  2XK0 A;  3L2Z A;  3V8L A;  2BIV A;  3L2U A;  4DOV A;  1ZHI A;  1QVF A;  4M7A F;  3OYB A;  2O01 E;  2XI9 A;  2MWP A;  2CZ0 B;  3FC3 A;  3TU4 K;  4KBM B;  4M7D C;  4M7A D;  2LT4 A;  2V8K A;  4M7A A;  2JVV A;  4OB1 B;  4VUB A;  3JCM P;  2LDM A;  3GF5 A;  4X9D A;  2X4W A;  4CI0 C;  1ZBX A;  1G3W A;  2PU9 B;  1K73 C;  4JLI A;  5J26 A;  4EMG A;  3HRT A;  5LL6 S;  1KQS S;  4ZGD B;  3I56 T;  3QYG B;  4BI4 A;  3JB9 H;  4XTV A;  5D6Y A;  4C8Q E;  3URG A;  2FL7 A;  3WVD B;  5DLQ E;  4F7U E;  5LJ3 j;  5GAN 4;  1YI2 A;  2QA4 A;  4HCZ A;  3JB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...