4M75F

Crystal structure of lsm1-7 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
90
structure length
75
Chain Sequence
RKKFEGPREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 7
structure length 75
sequence length 90
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75F00
4M75G 1I8FA 2FB7A 2FYKA 5GAN7 5GAMg 2EWNA 5GMKh 3FJPA 4EMKC 4M75B 3JB9G 4C92C 4C92F 5GAMj 1U1TA 4C92D 1HXDA 3BY7A 1MGQA 4A54A 4M7DB 4XTVA 1I81A 3V7CA 2VXFA 4C8QA 4F7UB 2K57A 4XQ3A 3JCMX 2EJ9A 1D3BB 4XTXA 3RKXA 4M75F 3SB2A 1M8VA 2E64A 1Y96B 1JBMA 3HFNA 3FIFA 4M75D 3EFRA 3JB9F 4J6XA 4EMKB 5LJ5e 3JB9J 4C92B 4M78C 3JB9D 5GANd 5LJ3e 4M78A 3SWNC 1BIAA 3QSUA 4J5YA 4JRIA 3RKWA 5GMKj 4M78E 1M5Q1 4XTYA 2YLBA 4EMGA 4PJOA 1YCYA 3JB9H 1I4K1 2DZ9A 2E65A 2E41A 5GAN5 1B34A 2QTXA 2E10A 2YHTA 3QHSA 3V8JA 1LJOA 4HA8A 4M78G 4NL2A 4JUVA 4M7AA 1KQ1A 5LJ5f 4RCCA 5GAMd 4M7AE 3EFSA 3V8KA 3JCMf 5LJ3f 3L2ZA 4C8QC 5LJ5h 2E1HA 5GAN4 5GAOl 3JCMh 5LJ3h 3SWNB 4F7UG 3V8LA 5GAOm 4C8QE 4HT8A 3AHUA 1LNXA 2RB6A 2DZCA 2RD1A 4XTZA 4M7AG 3HFOA 4J6WA 4MMLA 4X9DA 3BDUA 3JCMJ 4PJOD 5GAOr 3JCMc 4M78F 4Y91A 4C8QG 4N0AA 2I2LA 1N9RA 1X01A 3JCMe 5GAN3 3JCMW 3RUXA 3QUIA 4M78D 1WNLA 4PJOC 4C8QB 4DQ2A 1U1SA 4XTWA 5GANe 3M4GA 1N9SA 2VC8A 5LJ5g 4M77A 4PJOE 1WQWA 5LJ3g 2DKGA 2EAYA 4M77E 2YLCA 4MMKA 1LOJA 5LJ5j 4QVCA 4M7AF 4M7AC 1BIBA 5LJ3j 1WQ7A 4M7AD 3L1AA 4M75A 4C8QF 1WPYA 4NOYA 4M78B 4WF2A 4XU0A 5DY9A 4PJOG 3RKYA 5CAIA 4C8QD 5GMKi 4HT9A 4M7DC 4M77G 4M7DA 4A53A 2DXUA 4RCBA 5GAMe 5GANf 3GIBA 4PJOB 3BW1A 3JB9I 1H641 5GMKl 5GAOp 4F7UA 2JN0A 5GANh 4M7DE 1D3BA 2DTOA 5GMKm 4F7UE 3JCMQ 2DEQA 1B34B 3RESA 4JRKA 2HNIA 2RM4A 4N0AC 1Y96A 2Y90A 4M7AB 3RIRA 2CGHA 3JCMb 4X9CA 5GAN8 5GAOn 4M7DG 4QVDA 2DTHA 2DTIA 4PJOF 3JCMV 4EMKA 3PGGA 4C92A 2DJZA 3QO3A 4M77C 4M77F 2EJFA 2RA2A 3INZA 2EJGA 4XU1A 3V7SA 3FB9A 4C92E 5GAMf 5GAN2 4JLIA 5GAMh 1KQ2A 4M77D 2ZGWA 3JCMg 3HSBA 1I5LA 3V7RA 4XTUA 5GMKe 5GAOq 4OP0A 4M75C 4PNOA 3BFMA 4XU3A 2VXEA 4J6YA 5LJ5d 5GANg 2DVEA 4C92G 3JCMd 5LJ3d 4EMHA 4V2SA 4M75E 2DXTA 5I21A 5GANj 4M7DF 3RERA 4XU2A 1HK9A 4M7DD 4F7UF 3JCMP 1TH7A 3VU3C 4M77B 4NL3A 3SWNA 1JRIA 5GAN6
chains in the Genus database with same CATH superfamily
1WYXA 2LC4A 2A7YA 1Q81R 4X34A 2LVMA 3KBGA 2PQWA 2L89A 4QW2A 4Z88A 1V76A 4ZGDB 2RQUA 1YHQT 3J7AF 5J3BA 4FYYB 3GLXA 3RKXA 1IHWA 2XDBA 1BYMA 1QP2A 3L2RA 1QP3A 2DD4A 2D9TA 1WDXA 2LX7A 1BIAA 3RKWA 3GPLA 1Y07A 2C0OA 3CCVA 2KQWA 2I0NA 2VYTA 2LCLA 3OYHA 2E10A 3V8JA 4J9DA 3V8KA 2OTLT 4OVAA 3S3MA 3CCLT 2CP2A 4C8QE 1LCKA 4HT8A 2DNUA 3CPFA 3HTRA 2MCNA 2RD1A 2DXCA 2DX1A 1G5VA 1WHLA 2MOXA 3DB4A 1VQ6T 3G1JA 4JS4A 2E6ZA 1D0YA 1QVGS 1AWOA 3UA6A 2FG0A 2OTJA 2GFUA 1B07A 4L59A 4MMKA 5CKDA 5LJ5j 3S3NA 2QQSA 1WPYA 4PJOG 2HQXA 4XU0A 4C8QD 2F1LA 1KD1C 1IRXA 2LCSA 1WHGA 1B34B 4IIMA 2LNVA 2O31A 1U06A 5GAN8 4E2FB 1GBQA 3OS2A 5HK3A 3CCMA 3PGGA 3V7SA 4A4EA 3INZA 4B6MA 1CSKA 1ZUYA 4BDYA 2DD5A 3NTKA 4PNOA 4BE2A 2DVEA 2KGTA 3JCMd 3ZL7C 1G83A 1YITT 1YJWQ 1T0HA 1PG5B 2CDTA 1U8RA 1VQOA 4M75G 1O9SA 2L3PA 3A8GB 1VQPQ 2EQUA 2RQTA 2V8KA 1D09B 1K76A 1OEBA 3CC4T 3CCEA 2CYZB 2QASA 2M02A 3TEEA 2DXBA 5CQYA 1PD0A 1YIJQ 2QXFA 3R6NA 3EH2A 1M2VB 4XQ3A 1KIKA 2GBQA 2EPDA 4JZ3A 2O88A 1TXQA 1VQKA 2HD0A 2DETA 1VQLA 2KXDA 1M5Q1 1EFNA 2J7IA 4J8OA 2E41A 4JJCA 1LJOA 4JUVA 2F2VA 3DLLA 5KYUA 4C0DC 1YHQQ 4OB1B 1PC0A 4JJBA 4IUVA 2QYZA 2GF7A 1VQ5A 4PJMA 3DB3A 2K2VA 3VS1A 3QUIA 1K9MU 2EKHA 1I07A 3CCUA 4Z89A 5LJ5g 5CK9A 2K6DA 4M77E 3EG3A 1MNEA 3MJXA 3VS2A 3S6WA 1MNDA 2X4JA 4J7IA 4OGEA 3OYAA 2ZZDA 5GMKl 4D6WA 4MDXA 2EQJA 2HNIA 2KYBA 2PVDB 2V8IA 1TOVA 1Y96A 3WVDB 1YJNA 1VQ6Q 1M2OA 1X2KA 2DTHA 2RJCA 4JLIA 4M77D 5C6SA 2JS0A 2COWA 2WACA 2XI9A 5FWCA 3T9NA 4E7KA 3SDZA 2OAWA 2KY9A 2YXYA 3TQ7P 1RAGB 3OB9A 4NL3A 4HCBA 1U5SA 1QVGA 1QWFA 3FLGA 1N8RR 3EH1A 2FL7A 2B86A 2KR3A 4XTVA 4IUQA 4OMPA 4RTYA 2KT8A 2OX7A 2EGCA 2ROTA 1M1KU 1Y7XA 3UWNA 2VASA 4E7IA 5LJ5e 3OSVA 3OBYA 2YRVA 4CC7A 1M1GA 2JZ2A 1YITQ 1ZA2B 5GMKj 3NMZC 2YLBA 3M57A 1RAHB 1KC8U 1H3ZA 4MDWA 1ACMB 4HA8A 5CKFA 4O5VA 5GAMd 3EFSA 3CC2A 3R6OA 5IHIA 1QVFS 2JTMA 2QGGA 1RAEB 5CO7A 3CCRA 6AT1B 9ATCB 1Y57A 2KI7A 1IZ6A 3JCMc 4Y91A 2RMOA 3TVTA 2PZ1A 3M4GA 3N5BB 1QKXA 1ZUKA 2NUZA 3CCST 3H41A 4AG1C 5LJ3j 4LDXA 2PUOB 3EGXA 1UHCA 4JZ4A 1HSQA 4A4HA 1AWWA 4CC3A 1N6AA 2K5IA 4PFZA 1T0JA 2JN0A 2QEXQ 4Z8AA 1Q86R 2M0OA 2RQVA 2L5QA 2KMTA 1ZA1B 2L0AA 3OS5A 1YWOA 2EJFA 1QVPA 4F17A 1OPKA 3MHXA 3G4SA 4WCIA 3H0IA 1C0MA 4J6YA 3OYBA 3I55A 3I9QA 4RTTA 1K0SA 4F7UF 1TH7A 3C4SA 1BKBA 3QYHB 1IO6A 3WVEB 4E7LA 1M90U 1HXDA 3BY7A 3OA6A 2DK3A 2F5TX 1D3BB 1VOMA 2CREA 1WHKA 2JS2A 1Q7YU 4J6XA 2J6OA 2OI3A 3QG1A 1VQ4A 4JRIA 1SEMA 5KYXB 4KGZB 3P8HA 4HVWA 2CUDA 2QTXA 4DBFA 4KGXB 3VS3A 1QCFA 3ULRB 1KQ1A 2GTJA 5LJ5h 3GBQA 2LT1A 1J3TA 2RI5A 4E7SA 1X6BA 2P0QA 3M58A 2CZ0B 2MIOA 2ZPBB 1JQQA 2RNAA 1VA7A 1VQ8A 5LJ3g 1FX7A 3HRTA 5KH6A 1LOJA 4QVCA 5CVIA 3OYNA 2MPXC 4WF2A 1QLYA 2W0ZA 2DL7A 2CKKA 3OMGA 2XHCA 2DIGA 3VS5A 4DEXA 4IIOA 3PVLA 2RF0A 2HL3A 2JOYA 1V1CA 3J80E 2PNIA 2DEQA 1YI2A 2GGRA 1ZQ1A 2PU9B 1NJIC 2WSFE 2DTIA 1R77A 1Q82R 1AWXA 2ATCB 3M4YA 1UHFA 1GL5A 2X35A 2FPFA 1YJ9A 1QVFA 4XTUA 5GMKe 1WJRA 1K73C 3CCSQ 2VXEA 1WXUA 2P4RA 2HAXA 1TG0A 5HK0A 4M7DF 4R56A 1Q81C 2D0NA 1UGVA 1WA7A 4TVRA 3E19A 4RG2A 2EWNA 7AT1B 5KYWB 3M9QA 1JJ2S 2E3IA 3C94A 4J9GA 3PMTA 3QWXX 4F7UB 1AEYA 2L2PA 1B7TA 4ELYC 2KDSA 1RACB 5LJ3e 5IHNA 2C0IA 3OBWA 1M9SA 3LGLA 4RTWA 2AKKA 3CPWS 4ORZA 2O9VA 4JRQA 2V1QA 2Y4XA 4ZGEB 5LJ5f 4GLMA 5KYWA 1QWEA 2ECZA 1NEGA 2CP7A 1PWTA 3H8ZA 1IGQA 3BDUA 2BKDN 2D8HA 1YNZA 5IH2A 5GAOr 5HY6A 1VQNQ 2HKNA 3PNWC 4ANJA 3UPUA 2Z0WA 4DQ2A 4CC2A 2YWWA 2ZPGB 1NZ9A 3NTHA 5A0LA 3X24B 4KRTA 1G3YA 1S1NA 4M7DC 4DBRA 2JTFA 3GIBA 1T3SA 4PJOB 3G6EQ 2BZXA 4HCZA 1K8AU 1X27A 3SD4A 3EGDB 2CGHA 2EYZA 3NFCA 5KE3A 2XIDA 4M77C 4PJJA 1KQ2A 3PVQA 4VUBA 1FYNA 2P84A 2SEMA 3WXMB 3VS6A 2F5KA 4RKUE 1YJWT 3I5RA 3LX7A 3E9GA 1MMGA 2MK5A 3EG0A 2V8JA 5IXFA 4IUTA 3CCQA 4KUDK 5GMKh 4M75B 4E7HA 3OQ5A 1TTHB 4M7DB 4AFZC 3UA7A 1I81A 3V7CA 1C1AA 2VXFA 1I0CA 1VQ7A 1WFWA 2QQ9A 2CS7A 2XMFA 3M54A 2MI6A 2M1HA 2QK0A 2QGFB 2RHUA 1W6XA 5GANd 3CCVT 2LT4A 3HP9A 3G7ZA 1G3SA 1M30A 2ED0A 2F2WA 1QQJA 2AK5A 1HYOA 3QHSA 2L3SA 1MHNA 5FRNA 3RR6A 3L2ZA 5GAN4 5FRMA 4EPCA 5LJ3h 4BE0A 5GAOm 2DL5A 2RB6A 3TSWA 2L8DA 5CQXA 1G3TA 3LYIA 4C8QG 1JJ2A 4M77A 1BCOA 2LQKA 1SRLA 4LDVA 3MEVA 1SHGA 4BUGA 4YTLA 2DBMA 4AG2C 1QVFP 2KROA 4LDWA 2LTOA 1JXOA 3O5ZA 2RHZA 4AFUC 1GXIE 3CPWA 1KFZA 2DO3A 4F7UE 3HSBA 3REBB 2RM4A 3FEOA 1ZSGA 3L2VA 3CBOA 2P4TA 1ZHIA 3LH0A 1TUDA 2DJZA 3GOXA 4MZMA 4OB2B 2NYSA 1GRIA 1K9AA 3CBPA 1YHQA 1XNIA 4RTVA 2HBPA 2YDLA 2ZCFB 5CCAA 5GAOq 4ZTJA 1P92A 3ER0A 2JNGA 4KUIA 2JJ9A 4PLIA 1N8RC 1KG1A 4FYVB 3X20B 3NGPA 4E47A 1FXXA 2DYIA 1VIEA 1PKTA 5GAN7 3CCET 1PRMC 2VWFA 4IUUA 4C92F 2LCCA 2ZPIB 4ESRA 3RMSA 2COZA 4FU6A 2VVKA 3CXCS 2K9GA 1KHIA 2EJ9A 4XTXA 2OTLA 1K9MR 3CCLA 3CCJT 1DJ7B 3EFRA 1VQLT 3JB9F 4OB0B 3JB9J 5AYFA 2JM9A 1G8XA 2FRYA 1X43A 3JB9H 1NBEB 2HCKA 3A5ZB 4DA4A 5GAN5 3CMET 1B34A 3O8VA 3OYCA 4ZN1A 3A8LB 2J06A 5A2QE 3THKA 5LJ3f 2BE7D 4F16A 2BTTA 3EFOB 2EYYA 1ZBXA 2A08A 4LN2A 2EGAA 1I5OB 2FHDA 2CZ7B 3RNJA 1WNLA 3HL8A 2K4YA 3EAEA 3CMAT 3CCVQ 4C5IA 2LQNA 1ZX6A 2JXBA 2LJ1A 2ESWA 4M7AF 4J9HA 1BIBA 5AT1B 1WHMA 1NE8A 2YUPA 2KE9A 2RI3A 1W2BS 2E3HA 4LDUA 4M77G 1Q86C 1PHTA 3L2WA 2QEXT 4M7DE 1D1AA 1K0XA 1M2VA 1YITA 2GQIA 3RIRA 3EFOA 1UDLA 1UB4A 1M1KR 2DEUA 3OY9A 4XU1A 3OYIA 3CC4A 4E6RA 1WHHA 2D8JA 1BI3A 3SFMA 3CC7T 4XU3A 3RMQA 4KGVB 1RAAB 4A4GA 1KC8R 4BE1A 2KYMA 4M7DD 2O4XB 3QKJA 1OV3A 2XG8D 3VJPA 4J9BA 1D0XA 4QVZA 5KYNA 3OS1A 1MUZA 3H9NA 1U1TA 1WIEA 2XK0A 4A54A 2CT4A 2BZ8A 4MZPA 5I11A 3QJ6A 3JRZA 1CKBA 1OPLA 4EMKB 4PLLA 3VUZA 1WJQA 4C92B 2WSCE 1GFDA 2CH4W 1NG2A 3LGFA 1JJ2P 3RDVA 2O4XA 2IPOB 1RI0A 4L5GA 2M51A 4RG8A 3CCEQ 4LNPA 2QQBA 4DBQA 2VV5A 3E2UA 2DERA 4AFSC 1VQ9T 3SWNB 3VKIA 8ATCB 1VQKQ 4OMLA 2KK4A 3CCJQ 3CPWP 3JCMJ 1VQLQ 4M78F 2YT6A 1AWJA 2A28A 1N9SA 1SG5A 1UJ0A 3CXCA 3FJ5A 2GFAA 2MYSA 3CMEQ 4AMCA 3BE3A 1R8OB 3RKYA 4F14A 1M90R 5GAOp 2HMAA 3META 3ZFJA 1Q82C 5GMKm 1A0NB 4OMMA 2F69A 2O2OA 4A4KA 4M7AB 1H8KA 1Q7YR 5EC7A 3CBMA 3Q1JA 1YFNA 3LW5E 4LD9K 2CP3A 3FB9A 3CMAQ 1TUCA 4CC4B 2Y4YA 1JXMA 4DEYA 2RI2A 1I5LA 4FW2A 4JJDA 2LNHB 5GJVB 4EMHA 2EFIA 1UE9A 5IXBA 5J26A 1JRIA 5GAN6 2KRNA 1I8FA 3GNFB 5CR2A 1M3AA 2PTKA 3C12A 3QDFA 3VRZA 2DM1A 3QIIA 5GAMj 1NPRA 1MGQA 2RHIA 1WJSA 1XQHA 1X2QA 2A37A 1W2BA 1ZUUA 2PVGB 2LX9A 1KD1U 1EX4A 3CC7Q 1D1BA 2JT4A 1M8VA 3HFNA 1E6GA 4LE9A 1VQ4T 4M78C 2BE9B 1AZGB 1BCMA 1RUWA 2FZCB 1I4K1 3GP8A 3G71T 3S3OA 2QAZA 1QMCA 4FM4B 2BZYA 4OMOA 4FL6A 3CCSA 3I56T 5KCHA 2E1HA 3C95A 2EKOA 5KYYB 2GCXA 3A8OB 3AHUA 1WXBA 1AVZC 1ZBJA 4BACA 3L2UA 2LQ8A 5DLQE 1VQNT 4IURA 1PNJA 1B3QA 4L6V5 2DVJA 2VC8A 3ME9A 4OMNA 3M0RA 4BD3A 2EGEA 1WQWA 2CP5A 2ED1A 4BY6B 2YLCA 3ZEHA 3HRSA 4DOWA 3OYYA 3PFSA 3CC2Q 4M78B 4MZTA 5CKHA 3LLRA 4ZGJB 4AT1B 3QJYA 3G6ET 1VQ9Q 3EG9B 3HPWA 3JB9I 2IIMA 1D3BA 4J7FA 1MV0B 1BI0A 3JSCA 3QYGB 4QVDA 3MEUA 4PJOF 4ELZC 1JEGA 2MF2A 4C92E 1YJ9T 1S72T 5KYXA 4OP0A 1UECA 1W70A 1TU0B 1WZOA 2D0QB 2XU8A 1OU8A 3P8BB 2QA4T 1PSEA 3EG9A 1UGQB 1Y0MA 5GAMg 3PTAA 3VS4A 1ABQA 3KFVA 3MKDA 1M1FA 4BB7A 4C92D 1GCPA 2DJQA 4FW1A 4II1A 1UUEA 4JS5A 2FO0A 1RAIB 4M75F 3VV0A 4QQ6A 2HZYA 2E64A 1EZZB 4LXCA 3I55Q 1VYUA 4KULA 2EQMA 4JRPA 3JB9D 2NUPB 1FMVA 4BI3A 3QSUA 4D8DA 4XTYA 2MMPA 4EMGA 2RN8A 3QXEB 1YCYA 2L3RA 2QQRA 2YUOA 4ZTFA 1YBYA 2H3EB 4FT4A 2QG9B 1ZSZC 3CXCP 1AT1B 4FT2A 1K8AR 4NL2A 1R0BG 4RCCA 2K5LA 4M7AE 1JU5C 1KHCA 1XJWB 2DFUA 3JCMh 2AIRB 2CP0A 3I5SA 3NTIA 2P0PA 3HFOA 1VQMA 1WGSA 5IN1A 2PVOB 5DLOA 4KT0E 1VQ4Q 1H92A 2JUFA 2A0FB 2DYBA 3P8DA 4PJOC 3CEYA 4C8QB 2ZAEA 3CD6T 2DILA 2KSSA 2EAYA 3RBBB 3G71Q 2GTOA 1M4ZA 1RLQC 1UGPB 4M7AD 2GNCA 1WXTA 4NOYA 2DL8A 3I56Q 4PKCC 5GAMe 4F7UA 1G2BA 2HSEB 4Y92A 3UT1A 3JCMQ 2MWOA 1ZSZB 2H3JA 3MCAB 2W10A 2DF6A 3M0QA 2LMJA 1LPLA 1PM3A 4KH1B 2K3YA 3OYMA 2LRQA 1W2BP 2OAUA 4ATOA 4M75C 1LVKA 2HDAA 3CCQT 1UGSB 2EIFA 2LJ0A 2X4WA 3A8MB 2JMCA 1YI2Q 4KBMB 5I2SA 5C0MA 2ROLA 3EG1A 3FJPA 4BI8B 3M59A 2WSEE 1K9MC 2DL4A 3F70A 2D6FA 1VQ7T 3LWIA 5IHKA 1UFFA 2QI2A 1SRMA 1YJ9Q 1S72Q 1FWZA 1SKUB 1JBMA 4NS5A 5FU6B 4A63B 4M78E 2DLPA 3M0TA 2QA4Q 4C0FA 4PJOA 2HBWA 3EGDA 1JB0E 3MP6A 3JCMf 2EVRA 1X6GA 2HKQB 4LDYA 1RAFB 1LNXA 3VS7A 2ZPHB 1PCXA 4J6WA 2JTEA 3EGUA 2R57A 1OQKA 1RABB 4C5EA 4M78D 3L2QA 5FROA 2K7AA 1U1SA 1R0CB 4GLKA 2LQWA 4WTOB 4HVVA 4C5GA 1NM7A 4M75A 2QDYB 4M7DA 3M0SA 1YJWA 2DBKA 1UG1A 3KXTA 5L23A 1Q95G 1M1KC 3OS0A 3MO8A 3DKMA 2QDLA 4JRKA 2X4YA 4N0AC 1VQPA 5IAYA 2K5FA 3PMIA 3KUFA 4N4HA 2G6FX 2JW4A 3CQTA 3TCJA 2OTJT 1PRLC 3QO3A 4F7UG 2X3XD 2RQWA 1SF9A 3M0UA 1YIJA 5GAMh 1KC8C 3CD6Q 5HKCA 4BDZA 3E1SA 5A0GA 1KJWA 3UF4A 5LJ5d 2FPEA 2XDDA 4V2SA 3OYKA 2DXTA 5GANj 2PUKB 1MMAA 4B9XA 2EBPA 2E6NA 3OYLA 5I2MA 1MMNA 2FB7A 5FLXE 3OW2P 2JMAA 3U23A 2RO0A 3CCMT 2CUBA 2XICA 2CZ1B 4B9WA 2X3WD 3OYGA 5L8RE 2RJEA 2AHJB 3PIPA 2O9SA 3GNGA 2R5AA 3M55A 2B8AA 2KBTA 5D7UA 3SB2A 3OSSC 4R55A 3M53A 1VQOT 2KRSA 1NJIU 4J5YA 4A4FA 3CCQQ 4HCKA 3H6ZA 3GF5A 1OX8A 4OMQA 2CSQA 1K73U 2VKNA 1OU9A 2KNBB 3MEAA 5HCKA 1VQ7Q 3EHQA 4FSSA 1VQKT 1Q81U 2E5QA 3OYFA 1OI1A 1SPKA 4X9DA 1M8MA 3X25B 1YP5A 4N0AA 2DIQA 1VQ6A 1WHJA 3AT1B 2RH2A 4XTWA 4PJNA 4JLGA 4PJOE 2DRMA 1IGUA 1M90C 2YUQA 3L1AA 3PE0A 4X1VA 1GFCA 3BDLA 4EIKA 2KVQG 1VQ5T 1YN8A 1Q7YC 1F1BB 2KXCA 1FMWA 4M4ZA 3RESA 2RHYA 3M0PA 1IXDA 2G3RA 3MPUB 4P5NA 5FU7C 3JCMb 4M7DG 3JCMV 5KYUB 3CCUT 4N4IA 2FZGB 3QPHA 5GAMf 4PJOD 3HKSA 2KAFA 5CIUA 5FWBA 3E9FA 1AOJA 3V7RA 5M9OA 3PT9A 5GANg 2E5KA 1PKSA 4M75E 5ECAA 3CCJA 4CI0C 3RERA 1N27A 2E4HA 2COYA 2X51A 4IUPA 1YJNT 2FYKA 2ZPEB 4EMKC 2HSPA 4C92C 2R58A 2E70A 3CMEA 5LL6S 4KH0B 2ZPFB 2OTJQ 2FPDA 2K57A 1OZ2A 5CKEA 2FEIA 1Y96B 4M75D 5FU7B 1OULA 2EW3A 2LZ6B 1KQSP 2EYXA 3SWNC 1Z9ZA 4EDUA 3CMAA 1WX6A 2ABLA 3CCMQ 5GJWB 3NHNA 1BI1A 2MWPA 4HKEA 4HXJA 2EQIA 3VS0A 1MV3A 2QTVA 2OTLQ 3LH5A 3CCLQ 2DZCA 2RK1A 1ZLMA 1EIFA 2QEXA 2H8HA 3J81E 3QZ9B 4QT7A 3A98A 4OMFB 2E12A 2I2LA 5GAN3 3HHTB 1MMDA 1VQOQ 1IHVA 4RMOA 5GANe 4C0DB 1K4US 2DKGA 4M7AC 3FC3A 3CC2T 3CC7A 1QCOA 2KEAA 3ZBDA 2DPPB 2ENMA 1NYFA 4N4GA 2VGNA 5GMKi 4A53A 5DM7R 1TS9A 4OF1A 1JO8A 3ASKA 2IG0A 1H641 2HQHA 3BW1A 1QKWA 3QBYA 1Y71A 3CCRT 1Z9QA 3JAME 1KD1R 2RHXA 4EMKA 3FDRA 4C92A 2RA2A 1ABOA 5GAN2 3JCMg 2ZGWA 3OMCA 8AT1B 3MEWA 1TWBA 2M9UA 1VYVA 1XTDA 5LJ3d 3OYJA 2LJ3A 1T3LA 1HK9A 1BK2A 1VQ5Q 3SWNA 3I35A 2XD0A 2K2MA 4Q5WA 4ZNXA 3EGXB 4RTUA 3OW2S 3D7SB 3CC4Q 2K79A 4PK4A 3CCUQ 1H3HA 1NEBA 3G4ST 4JJNK 2M0YA 1M27C 1VUBA 4C0GA 5I22A 3I55T 1VQ9A 2BIVA 3FIFA 1BI2A 2K3XA 2A3LA 2IVWA 4QQDA 1W1FA 3UDCA 2CH4A 2K3BA 2YRDA 1I1JA 1K8AC 1NLPC 1YJNQ 4DBHA 2E65A 1NYGA 2XKOC 2NUTB 1SHFA 1FMKA 2YHTA 4M7AA 4LUEA 5D6XA 1AZEA 4GBQA 3V8LA 1N8RU 4BY6C 2VUBA 3X28B 4PFOA 2DE0X 3SHWA 4MMLA 1OOTA 2EQKA 3JCMW 3JCMe 1N9RA 2SRCA 3RUXA 4J9CA 1W4SA 2RJFA 2YSQA 2X9HA 4C8QF 3A1PA 1RL2A 2NUTA 4HT9A 3JV3A 3H0HA 2DXUA 3PIOA 5KE2A 5GANh 4J9EA 3VUBA 1RLPC 1GCQC 4OGCA 2AKLA 1NPPA 1XOVA 3QWYA 2Y90A 1AD5A 4XAXB 3LWHA 4X9CA 1VYTA 5GAOn 2KRMA 1VQ8T 1WI7A 4DOVA 4R0KA 1UTIA 3FRNA 4JDSA 3BFMA 2LDMA 1RADB 4C92G 5I21A 4ZN3A 1NLOC 3QZ5B 4XU2A 4PFPA 2FVUA 1YI2T 5KYYA 1IB8A 3CCRQ 3L42A 2DRKA 4LD6A 4FSXA 1PD1A 3JB9G 3G71A 1TSFA 2C06A 2L3QA 4C5HA 1D1CA 4BI4A 3JCMX 3I56A 1Q86U 1E6HA 1QW1A 1D0ZA 1U3OA 1UEBA 2C0TA 1HJDA 2FZKB 5D6WA 1UJYA 1SSFA 3EHRA 4J9IA 4M78A 1VQNA 2HL5C 2D1XA 4Z02A 1KQSS 2MAMA 1BBZA 1HD3A 1OZ3A 3A8HB 5EG2A 1QCNA 1X69A 3VYHB 4E7ZA 2BUDA 4RTXA 2CP6A 4C8QC 5CKBA 3G4SQ 2VB6A 2J6FA 2CZ6B 1VQMT 4XTZA 3G6EA 3EG2A 4M7AG 4D8KA 3X26B 2DL3A 3OYDA 3NPFA 2RQRA 2R5MA 2V26A 4LUDA 1GCQA 1QVGP 1O75A 4FIBA 2AT1B 1SSHA 3OW2A 4C0ZA 2J6KA 4K11A 2J05A 4GY5A 3MP1A 1S72A 1K1ZA 2HEQA 3M56A 2NLUA 5CAIA 4RCBA 4E7JA 2RK2A 3OYEA 5GANf 3TU4K 4F04B 1BB9A 4O6JA 3IQLA 2KT1A 1AHJB 2EYQA 2QA4A 2EYWA 3HRUA 4FYXB 2DMOA 2NUPA 4M77F 2EJGA 2OJ2A 4UC4A 4RTZA 2M16A 4HCCA 2V1RA 2CSIA 1PSFA 5IT9E 4J9FA 1M3CA 5A0DA 1TUGB 4FCYA 1E7OA 3REAB 4JPBW 2VGMA 3C0CA 2X4XA 1CKAA 2LP5A 4QKUA 5FU6C 4ME7A 1VQ8Q 4CRIA 4C8QA 2YRCA 1IREB 4FYWB 2AZSA 1YCSB 1Q82U 3M5AA 3TREA 4RUGA 1GBRA 4PJLA 1G3WA 3QDRB 4AFQC 4OB3B 2DA9A 2DZ9A 2JM8A 3CD6A 2YUNA 4QQGA 1ZSZA 4HVUA 4M78G 3VYGA 4Y28E 1BU1A 2JVVA 5GAOl 1C6VX 2A36A 1UGRB 3H0FA 4J83A 3UATA 5KCOA 4IKFA 4PL6A 2FRWA 3TSZA 3MP8A 1X01A 1M3BA 1ARKA 1RI9A 3URGA 1WQ7A 1OYXA 2GQVA 5J39A 5DY9A 2O01E 2F2XA 1X6OA 3VRYA 1KK7A 5D6YA 1VQMQ 2DAQA 2DTOA 1VQPT 1KQSA 1YWPA 1N5ZA 2QQAA 1VIFA 1WLPB 2RPNA 1OX9A 2P0KA 5FW9A 1KSWA 2NWMA 1YIJT 2CT3A 1NJIR 3SEMA 3DLMA 1V29B 2AZVA 4XK8E 2RJDA 2XDPA 3JCMP 1K73R 3VU3C 2HQEA 4M77B 1X75C
chains in the Genus database with same CATH topology
4TVRA 1YJNT 3CCMA 2LC4A 1I8FA 2FYKA 3E19A 3GNFB 4RG2A 2A7YA 5CR2A 2EWNA 2ZPEB 3C12A 4X34A 4EMKC 2LVMA 3KBGA 2PQWA 3M9QA 3QIIA 4C92C 3C94A 1NPRA 2R58A 5GAMj 1JJ2S 2E70A 2L89A 4QW2A 5LL6S 3CMEA 2ZPFB 1MGQA 2RHIA 3PMTA 4ZGDB 1WJSA 1YHQT 1XQHA 1W2BA 3J7AF 5J3BA 4F7UB 2K57A 3GLXA 1OZ2A 2PVGB 3RKXA 2LX9A 1KD1U 5CKEA 1M8VA 3HFNA 1Y96B 4M75D 5FU7B 2XDBA 1BYMA 4M7DA 1QP2A 4ELYC 3L2RA 1QP3A 1VQ4T 2DD4A 2KDSA 2D9TA 4M78C 5LJ3e 3SWNC 3OBWA 1M9SA 1BIAA 3LGLA 3RKWA 3GPLA 1Y07A 3CPWS 3CCVA 4EDUA 1I4K1 2KQWA 2VYTA 3GP8A 3G71T 3CMAA 4JRQA 3S3OA 2Y4XA 2LCLA 3OYHA 2E10A 3V8JA 4M7AC 4ZGEB 4FM4B 5LJ5f 1BI1A 4FL6A 3CCSA 2MWPA 4HKEA 3V8KA 5KCHA 3I56T 4OVAA 3S3MA 2E1HA 3C95A 2EKOA 3CCLT 2GCXA 4C8QE 4HT8A 3A8OB 3AHUA 3CPFA 3H8ZA 2DZCA 2RD1A 2RK1A 2DXCA 1EIFA 2QEXA 1G5VA 3DB4A 3BDUA 4BACA 3J81E 3L2UA 2BKDN 2LQ8A 3QZ9B 5DLQE 1VQNT 4IURA 1VQ6T 5GAOr 4OMFB 5HY6A 2E12A 2I2LA 5GAN3 3HHTB 3PNWC 3UPUA 4RMOA 4JS4A 4L6V5 2E6ZA 4DQ2A 1QVGS 5GANe 4C0DB 2VC8A 3ME9A 2OTJA 4BD3A 1WQWA 2GFUA 2DKGA 4L59A 4MMKA 2YLCA 2ZPGB 4BY6B 1NZ9A 3ZEHA 3HRSA 5CKDA 4DOWA 5LJ5j 3FC3A 2QQSA 3OYYA 3CC2T 3NTHA 5A0LA 3CC7A 3X24B 3PFSA 3ZBDA 2DPPB 4N4GA 1WPYA 2VGNA 4M78B 1G3YA 2HQXA 4MZTA 4XU0A 5CKHA 3LLRA 4PJOG 4C8QD 4ZGJB 3QJYA 5GMKi 2JTFA 4A53A 3G6ET 5DM7R 1KD1C 3GIBA 4OF1A 3ASKA 3BW1A 2IG0A 1H641 3HPWA 3QBYA 3JB9I 3CCRT 1Y71A 4PJOB 1D3BA 4HCZA 1K8AU 3JAME 4J7FA 1B34B 3SD4A 2CGHA 2LNVA 3NFCA 1BI0A 3JSCA 3QYGB 5GAN8 2RHXA 5KE3A 4QVDA 4EMKA 3MEUA 4PJOF 4ELZC 5HK3A 3OS2A 3FDRA 2MF2A 2XIDA 3PGGA 3V7SA 4A4EA 4M77C 4C92A 2RA2A 3INZA 5GAN2 4C92E 4BDYA 1YJ9T 1KQ2A 3JCMg 2ZGWA 1S72T 3OMCA 4VUBA 2DD5A 3MEWA 3NTKA 2M9UA 4OP0A 4PNOA 4BE2A 3WXMB 2DVEA 1XTDA 2F5KA 4RKUE 5LJ3d 3JCMd 3OYJA 1YJWT 2D0QB 3LX7A 1YITT 1HK9A 2XU8A 3E9GA 1U8RA 3P8BB 2QA4T 2V8JA 3SWNA 1VQOA 1PSEA 4IUTA 3CCQA 4M75G 1O9SA 2XD0A 1UGQB 3A8GB 4KUDK 2EQUA 5GAMg 2V8KA 3PTAA 5GMKh 4M75B 4E7HA 4Q5WA 3CC4T 3CCEA 1M1FA 4BB7A 2CYZB 3TEEA 3OQ5A 3OW2S 2DXBA 4C92D 5CQYA 4M7DB 4II1A 3G4ST 4JJNK 2QXFA 1I81A 1VUBA 3V7CA 2VXFA 4JS5A 1VQ7A 4XQ3A 4C0GA 2QQ9A 3I55T 1VQ9A 2CS7A 4M75F 4QQ6A 3VV0A 3LWHA 2E64A 3M54A 2BIVA 3FIFA 1BI2A 2MI6A 1VQKA 2HD0A 2K3XA 2A3LA 2IVWA 2M1HA 4KULA 2EQMA 4QQDA 3UDCA 1VQLA 4JRPA 2RHUA 3JB9D 5GANd 4BI3A 3QSUA 3CCVT 2LT4A 3HP9A 1K8AC 3G7ZA 1M5Q1 2MMPA 4XTYA 4EMGA 3QXEB 1YCYA 4J8OA 2L3RA 2QQRA 4ZTFA 1G3SA 1YBYA 2E65A 4FT4A 2XKOC 2E41A 2YHTA 4FT2A 3QHSA 4M7AA 1LJOA 4NL2A 4JUVA 1MHNA 4RCCA 5FRNA 2K5LA 3DLLA 4M7AE 5D6XA 3L2ZA 5GAN4 1KHCA 4C0DC 5FRMA 4OB1B 5LJ3h 3JCMh 4EPCA 4BE0A 5GAOm 4IUVA 3V8LA 1N8RU 4BY6C 2RB6A 2VUBA 2GF7A 3X28B 3NTIA 2P0PA 2L8DA 3HFOA 5CQXA 1VQMA 1VQ5A 4MMLA 1G3TA 1WGSA 3DB3A 3LYIA 5IN1A 2PVOB 2EQKA 3JCMW 4C8QG 2K2VA 1N9RA 5DLOA 3JCMe 1M90U 1JJ2A 4KT0E 3RUXA 3QUIA 2JUFA 1K9MU 3P8DA 1W4SA 4PJOC 3CEYA 4C8QB 3CD6T 2RJFA 3CCUA 5LJ5g 4M77A 2KSSA 5CK9A 1I5LA 2LQKA 2EAYA 4LDVA 4M77E 3MEVA 4BUGA 1M4ZA 1UGPB 4M7AD 4YTLA 4C8QF 3S6WA 4LDWA 4XAXB 1RL2A 4NOYA 2LTOA 2X4JA 4HT9A 4J7IA 4PKCC 5GAMe 2DXUA 2RHZA 3PIOA 4OGEA 3OYAA 2ZZDA 5GMKl 4D6WA 5KE2A 4F7UA 5GANh 4MDXA 1GXIE 3VUBA 3CPWA 2EQJA 3UT1A 2DO3A 4OGCA 4F7UE 3JCMQ 3HSBA 2RM4A 1NPPA 1XOVA 1Y96A 2MWOA 2H3JA 2HNIA 2PVDB 2V8IA 2Y90A 3FEOA 3MCAB 3WVDB 4X9CA 1YJNA 3L2VA 3CBOA 5GAOn 2P4TA 2DTHA 1ZHIA 3LH0A 2RJCA 2DJZA 1VQ8T 3GOXA 4MZMA 4DOVA 4JLIA 4OB2B 4M77D 3CBPA 5C6SA 1YHQA 2K3YA 1XNIA 3OYMA 2LRQA 3FRNA 2HBPA 2OAUA 2ZCFB 2WACA 4JDSA 4M75C 5CCAA 2XI9A 3BFMA 2LDMA 5GAOq 4ATOA 4ZTJA 1P92A 3ER0A 3T9NA 2JNGA 4C92G 4E7KA 4KUIA 3SDZA 5I21A 4ZN3A 4PLIA 3QZ5B 2KY9A 4XU2A 1N8RC 1KG1A 2FVUA 3CCQT 1UGSB 2EIFA 3OB9A 4NL3A 1YI2T 4HCBA 3X20B 1QVGA 4E47A 2X4WA 3A8MB 1FXXA 3L42A 1VIEA 4KBMB 4LD6A 3FLGA 4FSXA 5GAN7 5I2SA 3CCET 5C0MA 3FJPA 4BI8B 3M59A 2WSEE 3JB9G 4IUUA 4C92F 3G71A 1K9MC 3F70A 2FL7A 2LCCA 2ZPIB 2C06A 2D6FA 1VQ7T 4XTVA 4C5HA 3RMSA 3LWIA 4FU6A 4IUQA 3CXCS 2QI2A 4BI4A 3JCMX 1KHIA 2EJ9A 4XTXA 3I56A 1Q86U 2OTLA 1FWZA 3CCLA 1QW1A 1JBMA 1UEBA 3CCJT 1M1KU 1DJ7B 3EFRA 1Y7XA 3UWNA 1VQLT 3JB9F 4OB0B 5D6WA 4E7IA 5LJ5e 3OSVA 3OBYA 3JB9J 2YRVA 5AYFA 1SSFA 4NS5A 4M78A 1M1GA 5FU6B 2JZ2A 1VQNA 5GMKj 4M78E 4Z02A 1KQSS 2MAMA 2YLBA 4C0FA 4PJOA 3JB9H 3A5ZB 3M57A 1OZ3A 4DA4A 1KC8U 1H3ZA 3A8HB 5EG2A 5GAN5 3CMET 1B34A 3O8VA 4MDWA 3OYCA 4ZN1A 3A8LB 4HA8A 1JB0E 5CKFA 3VYHB 2OTLT 2BUDA 3MP6A 4O5VA 3EFSA 5GAMd 5A2QE 3JCMf 5LJ3f 4C8QC 3CC2A 5CKBA 3R6OA 4LDYA 1QVFS 1LNXA 2CZ6B 2JTMA 1VQMT 4XTZA 3G6EA 5CO7A 2ZPHB 4M7AG 4J6WA 1ZBXA 3X26B 3OYDA 3CCRA 2R57A 2R5MA 3JCMc 1IZ6A 1O75A 4FIBA 4Y91A 4C5EA 2FHDA 2CZ7B 4M78D 3L2QA 1WNLA 5FROA 3HL8A 3OW2A 2K4YA 3EAEA 4C0ZA 3CMAT 1U1SA 3M4GA 4GY5A 4C5IA 3N5BB 4GLKA 4M7AF 3MP1A 3CCST 1S72A 1BIBA 5LJ3j 4C5GA 3M56A 4M75A 1NE8A 2NLUA 4LDXA 2PUOB 2RI3A 5CAIA 4A4HA 1W2BS 2QDYB 4LDUA 4M77G 1Q86C 3L2WA 4RCBA 4E7JA 2RK2A 3OYEA 5GANf 2QEXT 3TU4K 1N6AA 1YJWA 2K5IA 3KXTA 4M7DE 2JN0A 4O6JA 1YITA 1M1KC 3OS0A 3MO8A 3DKMA 4JRKA 1AHJB 2EYQA 2X4YA 4N0AC 3RIRA 2QA4A 1VQPA 5IAYA 2M0OA 2K5FA 3HRUA 3PMIA 3KUFA 4N4HA 2L5QA 1UB4A 2KMTA 3TCJA 2OTJT 3OY9A 3OS5A 3QO3A 4XU1A 4M77F 2EJFA 4F7UG 3OYIA 1QVPA 2EJGA 3CC4A 1YIJA 5GAMh 1KC8C 5HKCA 3MHXA 1BI3A 3SFMA 4UC4A 4BDZA 3E1SA 5A0GA 3G4SA 3CC7T 2M16A 4HCCA 4XU3A 5LJ5d 4J6YA 3RMQA 3OYBA 3I55A 2XDDA 4A4GA 4V2SA 3OYKA 2DXTA 5GANj 2PUKB 4BE1A 4B9XA 4M7DD 4F7UF 1TH7A 1PSFA 2E6NA 2O4XB 3QKJA 3C4SA 5I2MA 3OYLA 5IT9E 2XG8D 3VJPA 5A0DA 1BKBA 4QVZA 2FB7A 3QYHB 5FLXE 2VGMA 2RO0A 3CCMT 3OS1A 2X4XA 3WVEB 2XICA 2CZ1B 4B9WA 5FU6C 3OYGA 1U1TA 5L8RE 2RJEA 4ME7A 1HXDA 2AHJB 3BY7A 2XK0A 4A54A 3OA6A 4E7LA 3PIPA 3GNGA 4CRIA 2DK3A 4C8QA 2F5TX 2R5AA 3M55A 2B8AA 1D3BB 4MZPA 1IREB 3SB2A 3QJ6A 1Q7YU 3OSSC 3JRZA 1Q82U 4R55A 3M5AA 3TREA 4J6XA 4EMKB 4PLLA 3VUZA 3M53A 1WJQA 4C92B 1G3WA 2WSCE 1VQOT 3QDRB 3QG1A 1NJIU 4OB3B 1VQ4A 4J5YA 4JRIA 3LGFA 4A4FA 3P8HA 2O4XA 1RI0A 2DZ9A 3H6ZA 4L5GA 3CD6A 3GF5A 2QTXA 4RG8A 4QQGA 2QQBA 4M78G 3VYGA 2VV5A 4Y28E 1KQ1A 1K73U 2JVVA 5LJ5h 5GAOl 3MEAA 1VQ9T 2LT1A 2RI5A 3SWNB 1UGRB 3VKIA 2P0QA 3M58A 1Q81U 2CZ0B 2E5QA 4J83A 1VQKT 3OYFA 1OI1A 2ZPBB 4M7DC 5KCOA 4X9DA 4IKFA 4PL6A 2KK4A 3JCMJ 3MP8A 3X25B 4M78F 4N0AA 2DIQA 1X01A 1VQ6A 2RH2A 4XTWA 1N9SA 4JLGA 4PJOE 3CXCA 1VQ8A 3URGA 5LJ3g 1FX7A 3HRTA 5KH6A 1LOJA 4QVCA 2GFAA 5CVIA 1M90C 1WQ7A 1OYXA 3L1AA 1R8OB 2GQVA 3OYNA 5J39A 4WF2A 3BDLA 3RKYA 2KVQG 5DY9A 2O01E 1X6OA 2CKKA 1VQ5T 3OMGA 2XHCA 5GAOp 2DIGA 1Q7YC 3ZFJA 3META 5D6YA 1KQSA 2DAQA 2DTOA 2JOYA 5GMKm 3J80E 1VQPT 1Q82C 2F69A 2DEQA 4A4KA 3RESA 2QQAA 2RHYA 1YI2A 1VIFA 1ZQ1A 2G3RA 2PU9B 4P5NA 5FU7C 4M7AB 3JCMb 1NJIC 2WSFE 4M7DG 3JCMV 2DTIA 2P0KA 3CBMA 3CCUT 4N4IA 1YIJT 3Q1JA 3QPHA 3LW5E 3M4YA 5GAMf 4LD9K 4PJOD 3FB9A 3HKSA 2KAFA 5CIUA 2X35A 3E9FA 2Y4YA 2RI2A 3V7RA 1YJ9A 4XTUA 5M9OA 3DLMA 1V29B 1WJRA 3PT9A 5GMKe 1K73C 1QVFA 4XK8E 2VXEA 5GANg 2HAXA 4EMHA 2EFIA 4M75E 2RJDA 5HK0A 4R56A 4M7DF 3CCJA 4CI0C 2XDPA 1N27A 3RERA 4IUPA 3JCMP 1Q81C 5J26A 3VU3C 2HQEA 4M77B 1X75C 3S3NA 1JRIA 5GAN6
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  1I8F A;  2FB7 A;  2FYK A;  5GAN 7;  5GAM g;  2EWN A;  5GMK h;  3FJP A;  4EMK C;  4M75 B;  3JB9 G;  4C92 C;  4C92 F;  5GAM j;  1U1T A;  4C92 D;  1HXD A;  3BY7 A;  1MGQ A;  4A54 A;  4M7D B;  4XTV A;  1I81 A;  3V7C A;  2VXF A;  4C8Q A;  4F7U B;  2K57 A;  4XQ3 A;  3JCM X;  2EJ9 A;  1D3B B;  4XTX A;  3RKX A;  4M75 F;  3SB2 A;  1M8V A;  2E64 A;  1Y96 B;  1JBM A;  3HFN A;  3FIF A;  4M75 D;  3EFR A;  3JB9 F;  4J6X A;  4EMK B;  5LJ5 e;  3JB9 J;  4C92 B;  4M78 C;  3JB9 D;  5GAN d;  5LJ3 e;  4M78 A;  3SWN C;  1BIA A;  3QSU A;  4J5Y A;  4JRI A;  3RKW A;  5GMK j;  4M78 E;  1M5Q 1;  4XTY A;  2YLB A;  4EMG A;  4PJO A;  1YCY A;  3JB9 H;  1I4K 1;  2DZ9 A;  2E65 A;  2E41 A;  5GAN 5;  1B34 A;  2QTX A;  2E10 A;  2YHT A;  3QHS A;  3V8J A;  1LJO A;  4HA8 A;  4M78 G;  4NL2 A;  4JUV A;  4M7A A;  1KQ1 A;  5LJ5 f;  4RCC A;  5GAM d;  4M7A E;  3EFS A;  3V8K A;  3JCM f;  5LJ3 f;  3L2Z A;  4C8Q C;  5LJ5 h;  2E1H A;  5GAN 4;  5GAO l;  3JCM h;  5LJ3 h;  3SWN B;  4F7U G;  3V8L A;  5GAO m;  4C8Q E;  4HT8 A;  3AHU A;  1LNX A;  2RB6 A;  2DZC A;  2RD1 A;  4XTZ A;  4M7A G;  3HFO A;  4J6W A;  4MML A;  4X9D A;  3BDU A;  3JCM J;  4PJO D;  5GAO r;  3JCM c;  4M78 F;  4Y91 A;  4C8Q G;  4N0A A;  2I2L A;  1N9R A;  1X01 A;  3JCM e;  5GAN 3;  3JCM W;  3RUX A;  3QUI A;  4M78 D;  1WNL A;  4PJO C;  4C8Q B;  4DQ2 A;  1U1S A;  4XTW A;  5GAN e;  3M4G A;  1N9S A;  2VC8 A;  5LJ5 g;  4M77 A;  4PJO E;  1WQW A;  5LJ3 g;  2DKG A;  2EAY A;  4M77 E;  2YLC A;  4MMK A;  1LOJ A;  5LJ5 j;  4QVC A;  4M7A F;  4M7A C;  1BIB A;  5LJ3 j;  1WQ7 A;  4M7A D;  3L1A A;  4M75 A;  4C8Q F;  1WPY A;  4NOY A;  4M78 B;  4WF2 A;  4XU0 A;  5DY9 A;  4PJO G;  3RKY A;  5CAI A;  4C8Q D;  5GMK i;  4HT9 A;  4M7D C;  4M77 G;  4M7D A;  4A53 A;  2DXU A;  4RCB A;  5GAM e;  5GAN f;  3GIB A;  4PJO B;  3BW1 A;  3JB9 I;  1H64 1;  5GMK l;  5GAO p;  4F7U A;  2JN0 A;  5GAN h;  4M7D E;  1D3B A;  2DTO A;  5GMK m;  4F7U E;  3JCM Q;  2DEQ A;  1B34 B;  3RES A;  4JRK A;  2HNI A;  2RM4 A;  4N0A C;  1Y96 A;  2Y90 A;  4M7A B;  3RIR A;  2CGH A;  3JCM b;  4X9C A;  5GAN 8;  5GAO n;  4M7D G;  4QVD A;  2DTH A;  2DTI A;  4PJO F;  3JCM V;  4EMK A;  3PGG A;  4C92 A;  2DJZ A;  3QO3 A;  4M77 C;  4M77 F;  2EJF A;  2RA2 A;  3INZ A;  2EJG A;  4XU1 A;  3V7S A;  3FB9 A;  4C92 E;  5GAM f;  5GAN 2;  4JLI A;  5GAM h;  1KQ2 A;  4M77 D;  2ZGW A;  3JCM g;  3HSB A;  1I5L A;  3V7R A;  4XTU A;  5GMK e;  5GAO q;  4OP0 A;  4M75 C;  4PNO A;  3BFM A;  4XU3 A;  2VXE A;  4J6Y A;  5LJ5 d;  5GAN g;  2DVE A;  4C92 G;  3JCM d;  5LJ3 d;  4EMH A;  4V2S A;  4M75 E;  2DXT A;  5I21 A;  5GAN j;  4M7D F;  3RER A;  4XU2 A;  1HK9 A;  4M7D D;  4F7U F;  3JCM P;  1TH7 A;  3VU3 C;  4M77 B;  4NL3 A;  3SWN A;  1JRI A;  5GAN 6; 
#chains in the Genus database with same CATH topology
 1WYX A;  2LC4 A;  2A7Y A;  1Q81 R;  4X34 A;  2LVM A;  3KBG A;  2PQW A;  2L89 A;  4QW2 A;  4Z88 A;  1V76 A;  4ZGD B;  2RQU A;  1YHQ T;  3J7A F;  5J3B A;  4FYY B;  3GLX A;  3RKX A;  1IHW A;  2XDB A;  1BYM A;  1QP2 A;  3L2R A;  1QP3 A;  2DD4 A;  2D9T A;  1WDX A;  2LX7 A;  1BIA A;  3RKW A;  3GPL A;  1Y07 A;  2C0O A;  3CCV A;  2KQW A;  2I0N A;  2VYT A;  2LCL A;  3OYH A;  2E10 A;  3V8J A;  4J9D A;  3V8K A;  2OTL T;  4OVA A;  3S3M A;  3CCL T;  2CP2 A;  4C8Q E;  1LCK A;  4HT8 A;  2DNU A;  3CPF A;  3HTR A;  2MCN A;  2RD1 A;  2DXC A;  2DX1 A;  1G5V A;  1WHL A;  2MOX A;  3DB4 A;  1VQ6 T;  3G1J A;  4JS4 A;  2E6Z A;  1D0Y A;  1QVG S;  1AWO A;  3UA6 A;  2FG0 A;  2OTJ A;  2GFU A;  1B07 A;  4L59 A;  4MMK A;  5CKD A;  5LJ5 j;  3S3N A;  2QQS A;  1WPY A;  4PJO G;  2HQX A;  4XU0 A;  4C8Q D;  2F1L A;  1KD1 C;  1IRX A;  2LCS A;  1WHG A;  1B34 B;  4IIM A;  2LNV A;  2O31 A;  1U06 A;  5GAN 8;  4E2F B;  1GBQ A;  3OS2 A;  5HK3 A;  3CCM A;  3PGG A;  3V7S A;  4A4E A;  3INZ A;  4B6M A;  1CSK A;  1ZUY A;  4BDY A;  2DD5 A;  3NTK A;  4PNO A;  4BE2 A;  2DVE A;  2KGT A;  3JCM d;  3ZL7 C;  1G83 A;  1YIT T;  1YJW Q;  1T0H A;  1PG5 B;  2CDT A;  1U8R A;  1VQO A;  4M75 G;  1O9S A;  2L3P A;  3A8G B;  1VQP Q;  2EQU A;  2RQT A;  2V8K A;  1D09 B;  1K76 A;  1OEB A;  3CC4 T;  3CCE A;  2CYZ B;  2QAS A;  2M02 A;  3TEE A;  2DXB A;  5CQY A;  1PD0 A;  1YIJ Q;  2QXF A;  3R6N A;  3EH2 A;  1M2V B;  4XQ3 A;  1KIK A;  2GBQ A;  2EPD A;  4JZ3 A;  2O88 A;  1TXQ A;  1VQK A;  2HD0 A;  2DET A;  1VQL A;  2KXD A;  1M5Q 1;  1EFN A;  2J7I A;  4J8O A;  2E41 A;  4JJC A;  1LJO A;  4JUV A;  2F2V A;  3DLL A;  5KYU A;  4C0D C;  1YHQ Q;  4OB1 B;  1PC0 A;  4JJB A;  4IUV A;  2QYZ A;  2GF7 A;  1VQ5 A;  4PJM A;  3DB3 A;  2K2V A;  3VS1 A;  3QUI A;  1K9M U;  2EKH A;  1I07 A;  3CCU A;  4Z89 A;  5LJ5 g;  5CK9 A;  2K6D A;  4M77 E;  3EG3 A;  1MNE A;  3MJX A;  3VS2 A;  3S6W A;  1MND A;  2X4J A;  4J7I A;  4OGE A;  3OYA A;  2ZZD A;  5GMK l;  4D6W A;  4MDX A;  2EQJ A;  2HNI A;  2KYB A;  2PVD B;  2V8I A;  1TOV A;  1Y96 A;  3WVD B;  1YJN A;  1VQ6 Q;  1M2O A;  1X2K A;  2DTH A;  2RJC A;  4JLI A;  4M77 D;  5C6S A;  2JS0 A;  2COW A;  2WAC A;  2XI9 A;  5FWC A;  3T9N A;  4E7K A;  3SDZ A;  2OAW A;  2KY9 A;  2YXY A;  3TQ7 P;  1RAG B;  3OB9 A;  4NL3 A;  4HCB A;  1U5S A;  1QVG A;  1QWF A;  3FLG A;  1N8R R;  3EH1 A;  2FL7 A;  2B86 A;  2KR3 A;  4XTV A;  4IUQ A;  4OMP A;  4RTY A;  2KT8 A;  2OX7 A;  2EGC A;  2ROT A;  1M1K U;  1Y7X A;  3UWN A;  2VAS A;  4E7I A;  5LJ5 e;  3OSV A;  3OBY A;  2YRV A;  4CC7 A;  1M1G A;  2JZ2 A;  1YIT Q;  1ZA2 B;  5GMK j;  3NMZ C;  2YLB A;  3M57 A;  1RAH B;  1KC8 U;  1H3Z A;  4MDW A;  1ACM B;  4HA8 A;  5CKF A;  4O5V A;  5GAM d;  3EFS A;  3CC2 A;  3R6O A;  5IHI A;  1QVF S;  2JTM A;  2QGG A;  1RAE B;  5CO7 A;  3CCR A;  6AT1 B;  9ATC B;  1Y57 A;  2KI7 A;  1IZ6 A;  3JCM c;  4Y91 A;  2RMO A;  3TVT A;  2PZ1 A;  3M4G A;  3N5B B;  1QKX A;  1ZUK A;  2NUZ A;  3CCS T;  3H41 A;  4AG1 C;  5LJ3 j;  4LDX A;  2PUO B;  3EGX A;  1UHC A;  4JZ4 A;  1HSQ A;  4A4H A;  1AWW A;  4CC3 A;  1N6A A;  2K5I A;  4PFZ A;  1T0J A;  2JN0 A;  2QEX Q;  4Z8A A;  1Q86 R;  2M0O A;  2RQV A;  2L5Q A;  2KMT A;  1ZA1 B;  2L0A A;  3OS5 A;  1YWO A;  2EJF A;  1QVP A;  4F17 A;  1OPK A;  3MHX A;  3G4S A;  4WCI A;  3H0I A;  1C0M A;  4J6Y A;  3OYB A;  3I55 A;  3I9Q A;  4RTT A;  1K0S A;  4F7U F;  1TH7 A;  3C4S A;  1BKB A;  3QYH B;  1IO6 A;  3WVE B;  4E7L A;  1M90 U;  1HXD A;  3BY7 A;  3OA6 A;  2DK3 A;  2F5T X;  1D3B B;  1VOM A;  2CRE A;  1WHK A;  2JS2 A;  1Q7Y U;  4J6X A;  2J6O A;  2OI3 A;  3QG1 A;  1VQ4 A;  4JRI A;  1SEM A;  5KYX B;  4KGZ B;  3P8H A;  4HVW A;  2CUD A;  2QTX A;  4DBF A;  4KGX B;  3VS3 A;  1QCF A;  3ULR B;  1KQ1 A;  2GTJ A;  5LJ5 h;  3GBQ A;  2LT1 A;  1J3T A;  2RI5 A;  4E7S A;  1X6B A;  2P0Q A;  3M58 A;  2CZ0 B;  2MIO A;  2ZPB B;  1JQQ A;  2RNA A;  1VA7 A;  1VQ8 A;  5LJ3 g;  1FX7 A;  3HRT A;  5KH6 A;  1LOJ A;  4QVC A;  5CVI A;  3OYN A;  2MPX C;  4WF2 A;  1QLY A;  2W0Z A;  2DL7 A;  2CKK A;  3OMG A;  2XHC A;  2DIG A;  3VS5 A;  4DEX A;  4IIO A;  3PVL A;  2RF0 A;  2HL3 A;  2JOY A;  1V1C A;  3J80 E;  2PNI A;  2DEQ A;  1YI2 A;  2GGR A;  1ZQ1 A;  2PU9 B;  1NJI C;  2WSF E;  2DTI A;  1R77 A;  1Q82 R;  1AWX A;  2ATC B;  3M4Y A;  1UHF A;  1GL5 A;  2X35 A;  2FPF A;  1YJ9 A;  1QVF A;  4XTU A;  5GMK e;  1WJR A;  1K73 C;  3CCS Q;  2VXE A;  1WXU A;  2P4R A;  2HAX A;  1TG0 A;  5HK0 A;  4M7D F;  4R56 A;  1Q81 C;  2D0N A;  1UGV A;  1WA7 A;  4TVR A;  3E19 A;  4RG2 A;  2EWN A;  7AT1 B;  5KYW B;  3M9Q A;  1JJ2 S;  2E3I A;  3C94 A;  4J9G A;  3PMT A;  3QWX X;  4F7U B;  1AEY A;  2L2P A;  1B7T A;  4ELY C;  2KDS A;  1RAC B;  5LJ3 e;  5IHN A;  2C0I A;  3OBW A;  1M9S A;  3LGL A;  4RTW A;  2AKK A;  3CPW S;  4ORZ A;  2O9V A;  4JRQ A;  2V1Q A;  2Y4X A;  4ZGE B;  5LJ5 f;  4GLM A;  5KYW A;  1QWE A;  2ECZ A;  1NEG A;  2CP7 A;  1PWT A;  3H8Z A;  1IGQ A;  3BDU A;  2BKD N;  2D8H A;  1YNZ A;  5IH2 A;  5GAO r;  5HY6 A;  1VQN Q;  2HKN A;  3PNW C;  4ANJ A;  3UPU A;  2Z0W A;  4DQ2 A;  4CC2 A;  2YWW A;  2ZPG B;  1NZ9 A;  3NTH A;  5A0L A;  3X24 B;  4KRT A;  1G3Y A;  1S1N A;  4M7D C;  4DBR A;  2JTF A;  3GIB A;  1T3S A;  4PJO B;  3G6E Q;  2BZX A;  4HCZ A;  1K8A U;  1X27 A;  3SD4 A;  3EGD B;  2CGH A;  2EYZ A;  3NFC A;  5KE3 A;  2XID A;  4M77 C;  4PJJ A;  1KQ2 A;  3PVQ A;  4VUB A;  1FYN A;  2P84 A;  2SEM A;  3WXM B;  3VS6 A;  2F5K A;  4RKU E;  1YJW T;  3I5R A;  3LX7 A;  3E9G A;  1MMG A;  2MK5 A;  3EG0 A;  2V8J A;  5IXF A;  4IUT A;  3CCQ A;  4KUD K;  5GMK h;  4M75 B;  4E7H A;  3OQ5 A;  1TTH B;  4M7D B;  4AFZ C;  3UA7 A;  1I81 A;  3V7C A;  1C1A A;  2VXF A;  1I0C A;  1VQ7 A;  1WFW A;  2QQ9 A;  2CS7 A;  2XMF A;  3M54 A;  2MI6 A;  2M1H A;  2QK0 A;  2QGF B;  2RHU A;  1W6X A;  5GAN d;  3CCV T;  2LT4 A;  3HP9 A;  3G7Z A;  1G3S A;  1M30 A;  2ED0 A;  2F2W A;  1QQJ A;  2AK5 A;  1HYO A;  3QHS A;  2L3S A;  1MHN A;  5FRN A;  3RR6 A;  3L2Z A;  5GAN 4;  5FRM A;  4EPC A;  5LJ3 h;  4BE0 A;  5GAO m;  2DL5 A;  2RB6 A;  3TSW A;  2L8D A;  5CQX A;  1G3T A;  3LYI A;  4C8Q G;  1JJ2 A;  4M77 A;  1BCO A;  2LQK A;  1SRL A;  4LDV A;  3MEV A;  1SHG A;  4BUG A;  4YTL A;  2DBM A;  4AG2 C;  1QVF P;  2KRO A;  4LDW A;  2LTO A;  1JXO A;  3O5Z A;  2RHZ A;  4AFU C;  1GXI E;  3CPW A;  1KFZ A;  2DO3 A;  4F7U E;  3HSB A;  3REB B;  2RM4 A;  3FEO A;  1ZSG A;  3L2V A;  3CBO A;  2P4T A;  1ZHI A;  3LH0 A;  1TUD A;  2DJZ A;  3GOX A;  4MZM A;  4OB2 B;  2NYS A;  1GRI A;  1K9A A;  3CBP A;  1YHQ A;  1XNI A;  4RTV A;  2HBP A;  2YDL A;  2ZCF B;  5CCA A;  5GAO q;  4ZTJ A;  1P92 A;  3ER0 A;  2JNG A;  4KUI A;  2JJ9 A;  4PLI A;  1N8R C;  1KG1 A;  4FYV B;  3X20 B;  3NGP A;  4E47 A;  1FXX A;  2DYI A;  1VIE A;  1PKT A;  5GAN 7;  3CCE T;  1PRM C;  2VWF A;  4IUU A;  4C92 F;  2LCC A;  2ZPI B;  4ESR A;  3RMS A;  2COZ A;  4FU6 A;  2VVK A;  3CXC S;  2K9G A;  1KHI A;  2EJ9 A;  4XTX A;  2OTL A;  1K9M R;  3CCL A;  3CCJ T;  1DJ7 B;  3EFR A;  1VQL T;  3JB9 F;  4OB0 B;  3JB9 J;  5AYF A;  2JM9 A;  1G8X A;  2FRY A;  1X43 A;  3JB9 H;  1NBE B;  2HCK A;  3A5Z B;  4DA4 A;  5GAN 5;  3CME T;  1B34 A;  3O8V A;  3OYC A;  4ZN1 A;  3A8L B;  2J06 A;  5A2Q E;  3THK A;  5LJ3 f;  2BE7 D;  4F16 A;  2BTT A;  3EFO B;  2EYY A;  1ZBX A;  2A08 A;  4LN2 A;  2EGA A;  1I5O B;  2FHD A;  2CZ7 B;  3RNJ A;  1WNL A;  3HL8 A;  2K4Y A;  3EAE A;  3CMA T;  3CCV Q;  4C5I A;  2LQN A;  1ZX6 A;  2JXB A;  2LJ1 A;  2ESW A;  4M7A F;  4J9H A;  1BIB A;  5AT1 B;  1WHM A;  1NE8 A;  2YUP A;  2KE9 A;  2RI3 A;  1W2B S;  2E3H A;  4LDU A;  4M77 G;  1Q86 C;  1PHT A;  3L2W A;  2QEX T;  4M7D E;  1D1A A;  1K0X A;  1M2V A;  1YIT A;  2GQI A;  3RIR A;  3EFO A;  1UDL A;  1UB4 A;  1M1K R;  2DEU A;  3OY9 A;  4XU1 A;  3OYI A;  3CC4 A;  4E6R A;  1WHH A;  2D8J A;  1BI3 A;  3SFM A;  3CC7 T;  4XU3 A;  3RMQ A;  4KGV B;  1RAA B;  4A4G A;  1KC8 R;  4BE1 A;  2KYM A;  4M7D D;  2O4X B;  3QKJ A;  1OV3 A;  2XG8 D;  3VJP A;  4J9B A;  1D0X A;  4QVZ A;  5KYN A;  3OS1 A;  1MUZ A;  3H9N A;  1U1T A;  1WIE A;  2XK0 A;  4A54 A;  2CT4 A;  2BZ8 A;  4MZP A;  5I11 A;  3QJ6 A;  3JRZ A;  1CKB A;  1OPL A;  4EMK B;  4PLL A;  3VUZ A;  1WJQ A;  4C92 B;  2WSC E;  1GFD A;  2CH4 W;  1NG2 A;  3LGF A;  1JJ2 P;  3RDV A;  2O4X A;  2IPO B;  1RI0 A;  4L5G A;  2M51 A;  4RG8 A;  3CCE Q;  4LNP A;  2QQB A;  4DBQ A;  2VV5 A;  3E2U A;  2DER A;  4AFS C;  1VQ9 T;  3SWN B;  3VKI A;  8ATC B;  1VQK Q;  4OML A;  2KK4 A;  3CCJ Q;  3CPW P;  3JCM J;  1VQL Q;  4M78 F;  2YT6 A;  1AWJ A;  2A28 A;  1N9S A;  1SG5 A;  1UJ0 A;  3CXC A;  3FJ5 A;  2GFA A;  2MYS A;  3CME Q;  4AMC A;  3BE3 A;  1R8O B;  3RKY A;  4F14 A;  1M90 R;  5GAO p;  2HMA A;  3MET A;  3ZFJ A;  1Q82 C;  5GMK m;  1A0N B;  4OMM A;  2F69 A;  2O2O A;  4A4K A;  4M7A B;  1H8K A;  1Q7Y R;  5EC7 A;  3CBM A;  3Q1J A;  1YFN A;  3LW5 E;  4LD9 K;  2CP3 A;  3FB9 A;  3CMA Q;  1TUC A;  4CC4 B;  2Y4Y A;  1JXM A;  4DEY A;  2RI2 A;  1I5L A;  4FW2 A;  4JJD A;  2LNH B;  5GJV B;  4EMH A;  2EFI A;  1UE9 A;  5IXB A;  5J26 A;  1JRI A;  5GAN 6;  2KRN A;  1I8F A;  3GNF B;  5CR2 A;  1M3A A;  2PTK A;  3C12 A;  3QDF A;  3VRZ A;  2DM1 A;  3QII A;  5GAM j;  1NPR A;  1MGQ A;  2RHI A;  1WJS A;  1XQH A;  1X2Q A;  2A37 A;  1W2B A;  1ZUU A;  2PVG B;  2LX9 A;  1KD1 U;  1EX4 A;  3CC7 Q;  1D1B A;  2JT4 A;  1M8V A;  3HFN A;  1E6G A;  4LE9 A;  1VQ4 T;  4M78 C;  2BE9 B;  1AZG B;  1BCM A;  1RUW A;  2FZC B;  1I4K 1;  3GP8 A;  3G71 T;  3S3O A;  2QAZ A;  1QMC A;  4FM4 B;  2BZY A;  4OMO A;  4FL6 A;  3CCS A;  3I56 T;  5KCH A;  2E1H A;  3C95 A;  2EKO A;  5KYY B;  2GCX A;  3A8O B;  3AHU A;  1WXB A;  1AVZ C;  1ZBJ A;  4BAC A;  3L2U A;  2LQ8 A;  5DLQ E;  1VQN T;  4IUR A;  1PNJ A;  1B3Q A;  4L6V 5;  2DVJ A;  2VC8 A;  3ME9 A;  4OMN A;  3M0R A;  4BD3 A;  2EGE A;  1WQW A;  2CP5 A;  2ED1 A;  4BY6 B;  2YLC A;  3ZEH A;  3HRS A;  4DOW A;  3OYY A;  3PFS A;  3CC2 Q;  4M78 B;  4MZT A;  5CKH A;  3LLR A;  4ZGJ B;  4AT1 B;  3QJY A;  3G6E T;  1VQ9 Q;  3EG9 B;  3HPW A;  3JB9 I;  2IIM A;  1D3B A;  4J7F A;  1MV0 B;  1BI0 A;  3JSC A;  3QYG B;  4QVD A;  3MEU A;  4PJO F;  4ELZ C;  1JEG A;  2MF2 A;  4C92 E;  1YJ9 T;  1S72 T;  5KYX A;  4OP0 A;  1UEC A;  1W70 A;  1TU0 B;  1WZO A;  2D0Q B;  2XU8 A;  1OU8 A;  3P8B B;  2QA4 T;  1PSE A;  3EG9 A;  1UGQ B;  1Y0M A;  5GAM g;  3PTA A;  3VS4 A;  1ABQ A;  3KFV A;  3MKD A;  1M1F A;  4BB7 A;  4C92 D;  1GCP A;  2DJQ A;  4FW1 A;  4II1 A;  1UUE A;  4JS5 A;  2FO0 A;  1RAI B;  4M75 F;  3VV0 A;  4QQ6 A;  2HZY A;  2E64 A;  1EZZ B;  4LXC A;  3I55 Q;  1VYU A;  4KUL A;  2EQM A;  4JRP A;  3JB9 D;  2NUP B;  1FMV A;  4BI3 A;  3QSU A;  4D8D A;  4XTY A;  2MMP A;  4EMG A;  2RN8 A;  3QXE B;  1YCY A;  2L3R A;  2QQR A;  2YUO A;  4ZTF A;  1YBY A;  2H3E B;  4FT4 A;  2QG9 B;  1ZSZ C;  3CXC P;  1AT1 B;  4FT2 A;  1K8A R;  4NL2 A;  1R0B G;  4RCC A;  2K5L A;  4M7A E;  1JU5 C;  1KHC A;  1XJW B;  2DFU A;  3JCM h;  2AIR B;  2CP0 A;  3I5S A;  3NTI A;  2P0P A;  3HFO A;  1VQM A;  1WGS A;  5IN1 A;  2PVO B;  5DLO A;  4KT0 E;  1VQ4 Q;  1H92 A;  2JUF A;  2A0F B;  2DYB A;  3P8D A;  4PJO C;  3CEY A;  4C8Q B;  2ZAE A;  3CD6 T;  2DIL A;  2KSS A;  2EAY A;  3RBB B;  3G71 Q;  2GTO A;  1M4Z A;  1RLQ C;  1UGP B;  4M7A D;  2GNC A;  1WXT A;  4NOY A;  2DL8 A;  3I56 Q;  4PKC C;  5GAM e;  4F7U A;  1G2B A;  2HSE B;  4Y92 A;  3UT1 A;  3JCM Q;  2MWO A;  1ZSZ B;  2H3J A;  3MCA B;  2W10 A;  2DF6 A;  3M0Q A;  2LMJ A;  1LPL A;  1PM3 A;  4KH1 B;  2K3Y A;  3OYM A;  2LRQ A;  1W2B P;  2OAU A;  4ATO A;  4M75 C;  1LVK A;  2HDA A;  3CCQ T;  1UGS B;  2EIF A;  2LJ0 A;  2X4W A;  3A8M B;  2JMC A;  1YI2 Q;  4KBM B;  5I2S A;  5C0M A;  2ROL A;  3EG1 A;  3FJP A;  4BI8 B;  3M59 A;  2WSE E;  1K9M C;  2DL4 A;  3F70 A;  2D6F A;  1VQ7 T;  3LWI A;  5IHK A;  1UFF A;  2QI2 A;  1SRM A;  1YJ9 Q;  1S72 Q;  1FWZ A;  1SKU B;  1JBM A;  4NS5 A;  5FU6 B;  4A63 B;  4M78 E;  2DLP A;  3M0T A;  2QA4 Q;  4C0F A;  4PJO A;  2HBW A;  3EGD A;  1JB0 E;  3MP6 A;  3JCM f;  2EVR A;  1X6G A;  2HKQ B;  4LDY A;  1RAF B;  1LNX A;  3VS7 A;  2ZPH B;  1PCX A;  4J6W A;  2JTE A;  3EGU A;  2R57 A;  1OQK A;  1RAB B;  4C5E A;  4M78 D;  3L2Q A;  5FRO A;  2K7A A;  1U1S A;  1R0C B;  4GLK A;  2LQW A;  4WTO B;  4HVV A;  4C5G A;  1NM7 A;  4M75 A;  2QDY B;  4M7D A;  3M0S A;  1YJW A;  2DBK A;  1UG1 A;  3KXT A;  5L23 A;  1Q95 G;  1M1K C;  3OS0 A;  3MO8 A;  3DKM A;  2QDL A;  4JRK A;  2X4Y A;  4N0A C;  1VQP A;  5IAY A;  2K5F A;  3PMI A;  3KUF A;  4N4H A;  2G6F X;  2JW4 A;  3CQT A;  3TCJ A;  2OTJ T;  1PRL C;  3QO3 A;  4F7U G;  2X3X D;  2RQW A;  1SF9 A;  3M0U A;  1YIJ A;  5GAM h;  1KC8 C;  3CD6 Q;  5HKC A;  4BDZ A;  3E1S A;  5A0G A;  1KJW A;  3UF4 A;  5LJ5 d;  2FPE A;  2XDD A;  4V2S A;  3OYK A;  2DXT A;  5GAN j;  2PUK B;  1MMA A;  4B9X A;  2EBP A;  2E6N A;  3OYL A;  5I2M A;  1MMN A;  2FB7 A;  5FLX E;  3OW2 P;  2JMA A;  3U23 A;  2RO0 A;  3CCM T;  2CUB A;  2XIC A;  2CZ1 B;  4B9W A;  2X3W D;  3OYG A;  5L8R E;  2RJE A;  2AHJ B;  3PIP A;  2O9S A;  3GNG A;  2R5A A;  3M55 A;  2B8A A;  2KBT A;  5D7U A;  3SB2 A;  3OSS C;  4R55 A;  3M53 A;  1VQO T;  2KRS A;  1NJI U;  4J5Y A;  4A4F A;  3CCQ Q;  4HCK A;  3H6Z A;  3GF5 A;  1OX8 A;  4OMQ A;  2CSQ A;  1K73 U;  2VKN A;  1OU9 A;  2KNB B;  3MEA A;  5HCK A;  1VQ7 Q;  3EHQ A;  4FSS A;  1VQK T;  1Q81 U;  2E5Q A;  3OYF A;  1OI1 A;  1SPK A;  4X9D A;  1M8M A;  3X25 B;  1YP5 A;  4N0A A;  2DIQ A;  1VQ6 A;  1WHJ A;  3AT1 B;  2RH2 A;  4XTW A;  4PJN A;  4JLG A;  4PJO E;  2DRM A;  1IGU A;  1M90 C;  2YUQ A;  3L1A A;  3PE0 A;  4X1V A;  1GFC A;  3BDL A;  4EIK A;  2KVQ G;  1VQ5 T;  1YN8 A;  1Q7Y C;  1F1B B;  2KXC A;  1FMW A;  4M4Z A;  3RES A;  2RHY A;  3M0P A;  1IXD A;  2G3R A;  3MPU B;  4P5N A;  5FU7 C;  3JCM b;  4M7D G;  3JCM V;  5KYU B;  3CCU T;  4N4I A;  2FZG B;  3QPH A;  5GAM f;  4PJO D;  3HKS A;  2KAF A;  5CIU A;  5FWB A;  3E9F A;  1AOJ A;  3V7R A;  5M9O A;  3PT9 A;  5GAN g;  2E5K A;  1PKS A;  4M75 E;  5ECA A;  3CCJ A;  4CI0 C;  3RER A;  1N27 A;  2E4H A;  2COY A;  2X51 A;  4IUP A;  1YJN T;  2FYK A;  2ZPE B;  4EMK C;  2HSP A;  4C92 C;  2R58 A;  2E70 A;  3CME A;  5LL6 S;  4KH0 B;  2ZPF B;  2OTJ Q;  2FPD A;  2K57 A;  1OZ2 A;  5CKE A;  2FEI A;  1Y96 B;  4M75 D;  5FU7 B;  1OUL A;  2EW3 A;  2LZ6 B;  1KQS P;  2EYX A;  3SWN C;  1Z9Z A;  4EDU A;  3CMA A;  1WX6 A;  2ABL A;  3CCM Q;  5GJW B;  3NHN A;  1BI1 A;  2MWP A;  4HKE A;  4HXJ A;  2EQI A;  3VS0 A;  1MV3 A;  2QTV A;  2OTL Q;  3LH5 A;  3CCL Q;  2DZC A;  2RK1 A;  1ZLM A;  1EIF A;  2QEX A;  2H8H A;  3J81 E;  3QZ9 B;  4QT7 A;  3A98 A;  4OMF B;  2E12 A;  2I2L A;  5GAN 3;  3HHT B;  1MMD A;  1VQO Q;  1IHV A;  4RMO A;  5GAN e;  4C0D B;  1K4U S;  2DKG A;  4M7A C;  3FC3 A;  3CC2 T;  3CC7 A;  1QCO A;  2KEA A;  3ZBD A;  2DPP B;  2ENM A;  1NYF A;  4N4G A;  2VGN A;  5GMK i;  4A53 A;  5DM7 R;  1TS9 A;  4OF1 A;  1JO8 A;  3ASK A;  2IG0 A;  1H64 1;  2HQH A;  3BW1 A;  1QKW A;  3QBY A;  1Y71 A;  3CCR T;  1Z9Q A;  3JAM E;  1KD1 R;  2RHX A;  4EMK A;  3FDR A;  4C92 A;  2RA2 A;  1ABO A;  5GAN 2;  3JCM g;  2ZGW A;  3OMC A;  8AT1 B;  3MEW A;  1TWB A;  2M9U A;  1VYV A;  1XTD A;  5LJ3 d;  3OYJ A;  2LJ3 A;  1T3L A;  1HK9 A;  1BK2 A;  1VQ5 Q;  3SWN A;  3I35 A;  2XD0 A;  2K2M A;  4Q5W A;  4ZNX A;  3EGX B;  4RTU A;  3OW2 S;  3D7S B;  3CC4 Q;  2K79 A;  4PK4 A;  3CCU Q;  1H3H A;  1NEB A;  3G4S T;  4JJN K;  2M0Y A;  1M27 C;  1VUB A;  4C0G A;  5I22 A;  3I55 T;  1VQ9 A;  2BIV A;  3FIF A;  1BI2 A;  2K3X A;  2A3L A;  2IVW A;  4QQD A;  1W1F A;  3UDC A;  2CH4 A;  2K3B A;  2YRD A;  1I1J A;  1K8A C;  1NLP C;  1YJN Q;  4DBH A;  2E65 A;  1NYG A;  2XKO C;  2NUT B;  1SHF A;  1FMK A;  2YHT A;  4M7A A;  4LUE A;  5D6X A;  1AZE A;  4GBQ A;  3V8L A;  1N8R U;  4BY6 C;  2VUB A;  3X28 B;  4PFO A;  2DE0 X;  3SHW A;  4MML A;  1OOT A;  2EQK A;  3JCM W;  3JCM e;  1N9R A;  2SRC A;  3RUX A;  4J9C A;  1W4S A;  2RJF A;  2YSQ A;  2X9H A;  4C8Q F;  3A1P A;  1RL2 A;  2NUT A;  4HT9 A;  3JV3 A;  3H0H A;  2DXU A;  3PIO A;  5KE2 A;  5GAN h;  4J9E A;  3VUB A;  1RLP C;  1GCQ C;  4OGC A;  2AKL A;  1NPP A;  1XOV A;  3QWY A;  2Y90 A;  1AD5 A;  4XAX B;  3LWH A;  4X9C A;  1VYT A;  5GAO n;  2KRM A;  1VQ8 T;  1WI7 A;  4DOV A;  4R0K A;  1UTI A;  3FRN A;  4JDS A;  3BFM A;  2LDM A;  1RAD B;  4C92 G;  5I21 A;  4ZN3 A;  1NLO C;  3QZ5 B;  4XU2 A;  4PFP A;  2FVU A;  1YI2 T;  5KYY A;  1IB8 A;  3CCR Q;  3L42 A;  2DRK A;  4LD6 A;  4FSX A;  1PD1 A;  3JB9 G;  3G71 A;  1TSF A;  2C06 A;  2L3Q A;  4C5H A;  1D1C A;  4BI4 A;  3JCM X;  3I56 A;  1Q86 U;  1E6H A;  1QW1 A;  1D0Z A;  1U3O A;  1UEB A;  2C0T A;  1HJD A;  2FZK B;  5D6W A;  1UJY A;  1SSF A;  3EHR A;  4J9I A;  4M78 A;  1VQN A;  2HL5 C;  2D1X A;  4Z02 A;  1KQS S;  2MAM A;  1BBZ A;  1HD3 A;  1OZ3 A;  3A8H B;  5EG2 A;  1QCN A;  1X69 A;  3VYH B;  4E7Z A;  2BUD A;  4RTX A;  2CP6 A;  4C8Q C;  5CKB A;  3G4S Q;  2VB6 A;  2J6F A;  2CZ6 B;  1VQM T;  4XTZ A;  3G6E A;  3EG2 A;  4M7A G;  4D8K A;  3X26 B;  2DL3 A;  3OYD A;  3NPF A;  2RQR A;  2R5M A;  2V26 A;  4LUD A;  1GCQ A;  1QVG P;  1O75 A;  4FIB A;  2AT1 B;  1SSH A;  3OW2 A;  4C0Z A;  2J6K A;  4K11 A;  2J05 A;  4GY5 A;  3MP1 A;  1S72 A;  1K1Z A;  2HEQ A;  3M56 A;  2NLU A;  5CAI A;  4RCB A;  4E7J A;  2RK2 A;  3OYE A;  5GAN f;  3TU4 K;  4F04 B;  1BB9 A;  4O6J A;  3IQL A;  2KT1 A;  1AHJ B;  2EYQ A;  2QA4 A;  2EYW A;  3HRU A;  4FYX B;  2DMO A;  2NUP A;  4M77 F;  2EJG A;  2OJ2 A;  4UC4 A;  4RTZ A;  2M16 A;  4HCC A;  2V1R A;  2CSI A;  1PSF A;  5IT9 E;  4J9F A;  1M3C A;  5A0D A;  1TUG B;  4FCY A;  1E7O A;  3REA B;  4JPB W;  2VGM A;  3C0C A;  2X4X A;  1CKA A;  2LP5 A;  4QKU A;  5FU6 C;  4ME7 A;  1VQ8 Q;  4CRI A;  4C8Q A;  2YRC A;  1IRE B;  4FYW B;  2AZS A;  1YCS B;  1Q82 U;  3M5A A;  3TRE A;  4RUG A;  1GBR A;  4PJL A;  1G3W A;  3QDR B;  4AFQ C;  4OB3 B;  2DA9 A;  2DZ9 A;  2JM8 A;  3CD6 A;  2YUN A;  4QQG A;  1ZSZ A;  4HVU A;  4M78 G;  3VYG A;  4Y28 E;  1BU1 A;  2JVV A;  5GAO l;  1C6V X;  2A36 A;  1UGR B;  3H0F A;  4J83 A;  3UAT A;  5KCO A;  4IKF A;  4PL6 A;  2FRW A;  3TSZ A;  3MP8 A;  1X01 A;  1M3B A;  1ARK A;  1RI9 A;  3URG A;  1WQ7 A;  1OYX A;  2GQV A;  5J39 A;  5DY9 A;  2O01 E;  2F2X A;  1X6O A;  3VRY A;  1KK7 A;  5D6Y A;  1VQM Q;  2DAQ A;  2DTO A;  1VQP T;  1KQS A;  1YWP A;  1N5Z A;  2QQA A;  1VIF A;  1WLP B;  2RPN A;  1OX9 A;  2P0K A;  5FW9 A;  1KSW A;  2NWM A;  1YIJ T;  2CT3 A;  1NJI R;  3SEM A;  3DLM A;  1V29 B;  2AZV A;  4XK8 E;  2RJD A;  2XDP A;  3JCM P;  1K73 R;  3VU3 C;  2HQE A;  4M77 B;  1X75 C; 
#chains in the Genus database with same CATH homology
 4TVR A;  1YJN T;  3CCM A;  2LC4 A;  1I8F A;  2FYK A;  3E19 A;  3GNF B;  4RG2 A;  2A7Y A;  5CR2 A;  2EWN A;  2ZPE B;  3C12 A;  4X34 A;  4EMK C;  2LVM A;  3KBG A;  2PQW A;  3M9Q A;  3QII A;  4C92 C;  3C94 A;  1NPR A;  2R58 A;  5GAM j;  1JJ2 S;  2E70 A;  2L89 A;  4QW2 A;  5LL6 S;  3CME A;  2ZPF B;  1MGQ A;  2RHI A;  3PMT A;  4ZGD B;  1WJS A;  1YHQ T;  1XQH A;  1W2B A;  3J7A F;  5J3B A;  4F7U B;  2K57 A;  3GLX A;  1OZ2 A;  2PVG B;  3RKX A;  2LX9 A;  1KD1 U;  5CKE A;  1M8V A;  3HFN A;  1Y96 B;  4M75 D;  5FU7 B;  2XDB A;  1BYM A;  4M7D A;  1QP2 A;  4ELY C;  3L2R A;  1QP3 A;  1VQ4 T;  2DD4 A;  2KDS A;  2D9T A;  4M78 C;  5LJ3 e;  3SWN C;  3OBW A;  1M9S A;  1BIA A;  3LGL A;  3RKW A;  3GPL A;  1Y07 A;  3CPW S;  3CCV A;  4EDU A;  1I4K 1;  2KQW A;  2VYT A;  3GP8 A;  3G71 T;  3CMA A;  4JRQ A;  3S3O A;  2Y4X A;  2LCL A;  3OYH A;  2E10 A;  3V8J A;  4M7A C;  4ZGE B;  4FM4 B;  5LJ5 f;  1BI1 A;  4FL6 A;  3CCS A;  2MWP A;  4HKE A;  3V8K A;  5KCH A;  3I56 T;  4OVA A;  3S3M A;  2E1H A;  3C95 A;  2EKO A;  3CCL T;  2GCX A;  4C8Q E;  4HT8 A;  3A8O B;  3AHU A;  3CPF A;  3H8Z A;  2DZC A;  2RD1 A;  2RK1 A;  2DXC A;  1EIF A;  2QEX A;  1G5V A;  3DB4 A;  3BDU A;  4BAC A;  3J81 E;  3L2U A;  2BKD N;  2LQ8 A;  3QZ9 B;  5DLQ E;  1VQN T;  4IUR A;  1VQ6 T;  5GAO r;  4OMF B;  5HY6 A;  2E12 A;  2I2L A;  5GAN 3;  3HHT B;  3PNW C;  3UPU A;  4RMO A;  4JS4 A;  4L6V 5;  2E6Z A;  4DQ2 A;  1QVG S;  5GAN e;  4C0D B;  2VC8 A;  3ME9 A;  2OTJ A;  4BD3 A;  1WQW A;  2GFU A;  2DKG A;  4L59 A;  4MMK A;  2YLC A;  2ZPG B;  4BY6 B;  1NZ9 A;  3ZEH A;  3HRS A;  5CKD A;  4DOW A;  5LJ5 j;  3FC3 A;  2QQS A;  3OYY A;  3CC2 T;  3NTH A;  5A0L A;  3CC7 A;  3X24 B;  3PFS A;  3ZBD A;  2DPP B;  4N4G A;  1WPY A;  2VGN A;  4M78 B;  1G3Y A;  2HQX A;  4MZT A;  4XU0 A;  5CKH A;  3LLR A;  4PJO G;  4C8Q D;  4ZGJ B;  3QJY A;  5GMK i;  2JTF A;  4A53 A;  3G6E T;  5DM7 R;  1KD1 C;  3GIB A;  4OF1 A;  3ASK A;  3BW1 A;  2IG0 A;  1H64 1;  3HPW A;  3QBY A;  3JB9 I;  3CCR T;  1Y71 A;  4PJO B;  1D3B A;  4HCZ A;  1K8A U;  3JAM E;  4J7F A;  1B34 B;  3SD4 A;  2CGH A;  2LNV A;  3NFC A;  1BI0 A;  3JSC A;  3QYG B;  5GAN 8;  2RHX A;  5KE3 A;  4QVD A;  4EMK A;  3MEU A;  4PJO F;  4ELZ C;  5HK3 A;  3OS2 A;  3FDR A;  2MF2 A;  2XID A;  3PGG A;  3V7S A;  4A4E A;  4M77 C;  4C92 A;  2RA2 A;  3INZ A;  5GAN 2;  4C92 E;  4BDY A;  1YJ9 T;  1KQ2 A;  3JCM g;  2ZGW A;  1S72 T;  3OMC A;  4VUB A;  2DD5 A;  3MEW A;  3NTK A;  2M9U A;  4OP0 A;  4PNO A;  4BE2 A;  3WXM B;  2DVE A;  1XTD A;  2F5K A;  4RKU E;  5LJ3 d;  3JCM d;  3OYJ A;  1YJW T;  2D0Q B;  3LX7 A;  1YIT T;  1HK9 A;  2XU8 A;  3E9G A;  1U8R A;  3P8B B;  2QA4 T;  2V8J A;  3SWN A;  1VQO A;  1PSE A;  4IUT A;  3CCQ A;  4M75 G;  1O9S A;  2XD0 A;  1UGQ B;  3A8G B;  4KUD K;  2EQU A;  5GAM g;  2V8K A;  3PTA A;  5GMK h;  4M75 B;  4E7H A;  4Q5W A;  3CC4 T;  3CCE A;  1M1F A;  4BB7 A;  2CYZ B;  3TEE A;  3OQ5 A;  3OW2 S;  2DXB A;  4C92 D;  5CQY A;  4M7D B;  4II1 A;  3G4S T;  4JJN K;  2QXF A;  1I81 A;  1VUB A;  3V7C A;  2VXF A;  4JS5 A;  1VQ7 A;  4XQ3 A;  4C0G A;  2QQ9 A;  3I55 T;  1VQ9 A;  2CS7 A;  4M75 F;  4QQ6 A;  3VV0 A;  3LWH A;  2E64 A;  3M54 A;  2BIV A;  3FIF A;  1BI2 A;  2MI6 A;  1VQK A;  2HD0 A;  2K3X A;  2A3L A;  2IVW A;  2M1H A;  4KUL A;  2EQM A;  4QQD A;  3UDC A;  1VQL A;  4JRP A;  2RHU A;  3JB9 D;  5GAN d;  4BI3 A;  3QSU A;  3CCV T;  2LT4 A;  3HP9 A;  1K8A C;  3G7Z A;  1M5Q 1;  2MMP A;  4XTY A;  4EMG A;  3QXE B;  1YCY A;  4J8O A;  2L3R A;  2QQR A;  4ZTF A;  1G3S A;  1YBY A;  2E65 A;  4FT4 A;  2XKO C;  2E41 A;  2YHT A;  4FT2 A;  3QHS A;  4M7A A;  1LJO A;  4NL2 A;  4JUV A;  1MHN A;  4RCC A;  5FRN A;  2K5L A;  3DLL A;  4M7A E;  5D6X A;  3L2Z A;  5GAN 4;  1KHC A;  4C0D C;  5FRM A;  4OB1 B;  5LJ3 h;  3JCM h;  4EPC A;  4BE0 A;  5GAO m;  4IUV A;  3V8L A;  1N8R U;  4BY6 C;  2RB6 A;  2VUB A;  2GF7 A;  3X28 B;  3NTI A;  2P0P A;  2L8D A;  3HFO A;  5CQX A;  1VQM A;  1VQ5 A;  4MML A;  1G3T A;  1WGS A;  3DB3 A;  3LYI A;  5IN1 A;  2PVO B;  2EQK A;  3JCM W;  4C8Q G;  2K2V A;  1N9R A;  5DLO A;  3JCM e;  1M90 U;  1JJ2 A;  4KT0 E;  3RUX A;  3QUI A;  2JUF A;  1K9M U;  3P8D A;  1W4S A;  4PJO C;  3CEY A;  4C8Q B;  3CD6 T;  2RJF A;  3CCU A;  5LJ5 g;  4M77 A;  2KSS A;  5CK9 A;  1I5L A;  2LQK A;  2EAY A;  4LDV A;  4M77 E;  3MEV A;  4BUG A;  1M4Z A;  1UGP B;  4M7A D;  4YTL A;  4C8Q F;  3S6W A;  4LDW A;  4XAX B;  1RL2 A;  4NOY A;  2LTO A;  2X4J A;  4HT9 A;  4J7I A;  4PKC C;  5GAM e;  2DXU A;  2RHZ A;  3PIO A;  4OGE A;  3OYA A;  2ZZD A;  5GMK l;  4D6W A;  5KE2 A;  4F7U A;  5GAN h;  4MDX A;  1GXI E;  3VUB A;  3CPW A;  2EQJ A;  3UT1 A;  2DO3 A;  4OGC A;  4F7U E;  3JCM Q;  3HSB A;  2RM4 A;  1NPP A;  1XOV A;  1Y96 A;  2MWO A;  2H3J A;  2HNI A;  2PVD B;  2V8I A;  2Y90 A;  3FEO A;  3MCA B;  3WVD B;  4X9C A;  1YJN A;  3L2V A;  3CBO A;  5GAO n;  2P4T A;  2DTH A;  1ZHI A;  3LH0 A;  2RJC A;  2DJZ A;  1VQ8 T;  3GOX A;  4MZM A;  4DOV A;  4JLI A;  4OB2 B;  4M77 D;  3CBP A;  5C6S A;  1YHQ A;  2K3Y A;  1XNI A;  3OYM A;  2LRQ A;  3FRN A;  2HBP A;  2OAU A;  2ZCF B;  2WAC A;  4JDS A;  4M75 C;  5CCA A;  2XI9 A;  3BFM A;  2LDM A;  5GAO q;  4ATO A;  4ZTJ A;  1P92 A;  3ER0 A;  3T9N A;  2JNG A;  4C92 G;  4E7K A;  4KUI A;  3SDZ A;  5I21 A;  4ZN3 A;  4PLI A;  3QZ5 B;  2KY9 A;  4XU2 A;  1N8R C;  1KG1 A;  2FVU A;  3CCQ T;  1UGS B;  2EIF A;  3OB9 A;  4NL3 A;  1YI2 T;  4HCB A;  3X20 B;  1QVG A;  4E47 A;  2X4W A;  3A8M B;  1FXX A;  3L42 A;  1VIE A;  4KBM B;  4LD6 A;  3FLG A;  4FSX A;  5GAN 7;  5I2S A;  3CCE T;  5C0M A;  3FJP A;  4BI8 B;  3M59 A;  2WSE E;  3JB9 G;  4IUU A;  4C92 F;  3G71 A;  1K9M C;  3F70 A;  2FL7 A;  2LCC A;  2ZPI B;  2C06 A;  2D6F A;  1VQ7 T;  4XTV A;  4C5H A;  3RMS A;  3LWI A;  4FU6 A;  4IUQ A;  3CXC S;  2QI2 A;  4BI4 A;  3JCM X;  1KHI A;  2EJ9 A;  4XTX A;  3I56 A;  1Q86 U;  2OTL A;  1FWZ A;  3CCL A;  1QW1 A;  1JBM A;  1UEB A;  3CCJ T;  1M1K U;  1DJ7 B;  3EFR A;  1Y7X A;  3UWN A;  1VQL T;  3JB9 F;  4OB0 B;  5D6W A;  4E7I A;  5LJ5 e;  3OSV A;  3OBY A;  3JB9 J;  2YRV A;  5AYF A;  1SSF A;  4NS5 A;  4M78 A;  1M1G A;  5FU6 B;  2JZ2 A;  1VQN A;  5GMK j;  4M78 E;  4Z02 A;  1KQS S;  2MAM A;  2YLB A;  4C0F A;  4PJO A;  3JB9 H;  3A5Z B;  3M57 A;  1OZ3 A;  4DA4 A;  1KC8 U;  1H3Z A;  3A8H B;  5EG2 A;  5GAN 5;  3CME T;  1B34 A;  3O8V A;  4MDW A;  3OYC A;  4ZN1 A;  3A8L B;  4HA8 A;  1JB0 E;  5CKF A;  3VYH B;  2OTL T;  2BUD A;  3MP6 A;  4O5V A;  3EFS A;  5GAM d;  5A2Q E;  3JCM f;  5LJ3 f;  4C8Q C;  3CC2 A;  5CKB A;  3R6O A;  4LDY A;  1QVF S;  1LNX A;  2CZ6 B;  2JTM A;  1VQM T;  4XTZ A;  3G6E A;  5CO7 A;  2ZPH B;  4M7A G;  4J6W A;  1ZBX A;  3X26 B;  3OYD A;  3CCR A;  2R57 A;  2R5M A;  3JCM c;  1IZ6 A;  1O75 A;  4FIB A;  4Y91 A;  4C5E A;  2FHD A;  2CZ7 B;  4M78 D;  3L2Q A;  1WNL A;  5FRO A;  3HL8 A;  3OW2 A;  2K4Y A;  3EAE A;  4C0Z A;  3CMA T;  1U1S A;  3M4G A;  4GY5 A;  4C5I A;  3N5B B;  4GLK A;  4M7A F;  3MP1 A;  3CCS T;  1S72 A;  1BIB A;  5LJ3 j;  4C5G A;  3M56 A;  4M75 A;  1NE8 A;  2NLU A;  4LDX A;  2PUO B;  2RI3 A;  5CAI A;  4A4H A;  1W2B S;  2QDY B;  4LDU A;  4M77 G;  1Q86 C;  3L2W A;  4RCB A;  4E7J A;  2RK2 A;  3OYE A;  5GAN f;  2QEX T;  3TU4 K;  1N6A A;  1YJW A;  2K5I A;  3KXT A;  4M7D E;  2JN0 A;  4O6J A;  1YIT A;  1M1K C;  3OS0 A;  3MO8 A;  3DKM A;  4JRK A;  1AHJ B;  2EYQ A;  2X4Y A;  4N0A C;  3RIR A;  2QA4 A;  1VQP A;  5IAY A;  2M0O A;  2K5F A;  3HRU A;  3PMI A;  3KUF A;  4N4H A;  2L5Q A;  1UB4 A;  2KMT A;  3TCJ A;  2OTJ T;  3OY9 A;  3OS5 A;  3QO3 A;  4XU1 A;  4M77 F;  2EJF A;  4F7U G;  3OYI A;  1QVP A;  2EJG A;  3CC4 A;  1YIJ A;  5GAM h;  1KC8 C;  5HKC A;  3MHX A;  1BI3 A;  3SFM A;  4UC4 A;  4BDZ A;  3E1S A;  5A0G A;  3G4S A;  3CC7 T;  2M16 A;  4HCC A;  4XU3 A;  5LJ5 d;  4J6Y A;  3RMQ A;  3OYB A;  3I55 A;  2XDD A;  4A4G A;  4V2S A;  3OYK A;  2DXT A;  5GAN j;  2PUK B;  4BE1 A;  4B9X A;  4M7D D;  4F7U F;  1TH7 A;  1PSF A;  2E6N A;  2O4X B;  3QKJ A;  3C4S A;  5I2M A;  3OYL A;  5IT9 E;  2XG8 D;  3VJP A;  5A0D A;  1BKB A;  4QVZ A;  2FB7 A;  3QYH B;  5FLX E;  2VGM A;  2RO0 A;  3CCM T;  3OS1 A;  2X4X A;  3WVE B;  2XIC A;  2CZ1 B;  4B9W A;  5FU6 C;  3OYG A;  1U1T A;  5L8R E;  2RJE A;  4ME7 A;  1HXD A;  2AHJ B;  3BY7 A;  2XK0 A;  4A54 A;  3OA6 A;  4E7L A;  3PIP A;  3GNG A;  4CRI A;  2DK3 A;  4C8Q A;  2F5T X;  2R5A A;  3M55 A;  2B8A A;  1D3B B;  4MZP A;  1IRE B;  3SB2 A;  3QJ6 A;  1Q7Y U;  3OSS C;  3JRZ A;  1Q82 U;  4R55 A;  3M5A A;  3TRE A;  4J6X A;  4EMK B;  4PLL A;  3VUZ A;  3M53 A;  1WJQ A;  4C92 B;  1G3W A;  2WSC E;  1VQO T;  3QDR B;  3QG1 A;  1NJI U;  4OB3 B;  1VQ4 A;  4J5Y A;  4JRI A;  3LGF A;  4A4F A;  3P8H A;  2O4X A;  1RI0 A;  2DZ9 A;  3H6Z A;  4L5G A;  3CD6 A;  3GF5 A;  2QTX A;  4RG8 A;  4QQG A;  2QQB A;  4M78 G;  3VYG A;  2VV5 A;  4Y28 E;  1KQ1 A;  1K73 U;  2JVV A;  5LJ5 h;  5GAO l;  3MEA A;  1VQ9 T;  2LT1 A;  2RI5 A;  3SWN B;  1UGR B;  3VKI A;  2P0Q A;  3M58 A;  1Q81 U;  2CZ0 B;  2E5Q A;  4J83 A;  1VQK T;  3OYF A;  1OI1 A;  2ZPB B;  4M7D C;  5KCO A;  4X9D A;  4IKF A;  4PL6 A;  2KK4 A;  3JCM J;  3MP8 A;  3X25 B;  4M78 F;  4N0A A;  2DIQ A;  1X01 A;  1VQ6 A;  2RH2 A;  4XTW A;  1N9S A;  4JLG A;  4PJO E;  3CXC A;  1VQ8 A;  3URG A;  5LJ3 g;  1FX7 A;  3HRT A;  5KH6 A;  1LOJ A;  4QVC A;  2GFA A;  5CVI A;  1M90 C;  1WQ7 A;  1OYX A;  3L1A A;  1R8O B;  2GQV A;  3OYN A;  5J39 A;  4WF2 A;  3BDL A;  3RKY A;  2KVQ G;  5DY9 A;  2O01 E;  1X6O A;  2CKK A;  1VQ5 T;  3OMG A;  2XHC A;  5GAO p;  2DIG A;  1Q7Y C;  3ZFJ A;  3MET A;  5D6Y A;  1KQS A;  2DAQ A;  2DTO A;  2JOY A;  5GMK m;  3J80 E;  1VQP T;  1Q82 C;  2F69 A;  2DEQ A;  4A4K A;  3RES A;  2QQA A;  2RHY A;  1YI2 A;  1VIF A;  1ZQ1 A;  2G3R A;  2PU9 B;  4P5N A;  5FU7 C;  4M7A B;  3JCM b;  1NJI C;  2WSF E;  4M7D G;  3JCM V;  2DTI A;  2P0K A;  3CBM A;  3CCU T;  4N4I A;  1YIJ T;  3Q1J A;  3QPH A;  3LW5 E;  3M4Y A;  5GAM f;  4LD9 K;  4PJO D;  3FB9 A;  3HKS A;  2KAF A;  5CIU A;  2X35 A;  3E9F A;  2Y4Y A;  2RI2 A;  3V7R A;  1YJ9 A;  4XTU A;  5M9O A;  3DLM A;  1V29 B;  1WJR A;  3PT9 A;  5GMK e;  1K73 C;  1QVF A;  4XK8 E;  2VXE A;  5GAN g;  2HAX A;  4EMH A;  2EFI A;  4M75 E;  2RJD A;  5HK0 A;  4R56 A;  4M7D F;  3CCJ A;  4CI0 C;  2XDP A;  1N27 A;  3RER A;  4IUP A;  3JCM P;  1Q81 C;  5J26 A;  3VU3 C;  2HQE A;  4M77 B;  1X75 C;  3S3N A;  1JRI A;  5GAN 6; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...