4M75F

Crystal structure of lsm1-7 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
90
structure length
75
Chain Sequence
RKKFEGPREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 7
structure length 75
sequence length 90
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75F00
3AHUA 1Y96A 3QUIA 3RKYA 2DTHA 1KQ2A 4JRKA 1D3BA 4PJOE 4NOYA 4M78C 5GMKe 4XTUA 1JBMA 2EWNA 3JB9H 2JN0A 5LJ3g 1X01A 1WQ7A 3L2ZA 2YHTA 2DZCA 4F7UG 3INZA 3V7RA 4A53A 3RUXA 4C92E 4RCBA 3GIBA 2EJGA 5I21A 5GAOq 2E65A 3FIFA 5GAN7 1I4K1 2RM4A 3QO3A 3V7SA 4M75B 5LJ5h 4M78D 4XTWA 5GANg 4M78B 5GAN8 2FYKA 2E41A 4PJOD 4M77E 3JCMh 5GAMh 4M75F 4HT9A 3JB9D 4PJOB 2RD1A 1BIBA 1WPYA 4DQ2A 3EFSA 3RKWA 3VU3C 4EMGA 4PJOF 5GMKj 4EMHA 4XTYA 2QTXA 4C92D 4M78A 4XU1A 1LNXA 4C92B 3BW1A 5GAN4 4M75C 1WQWA 3JCMW 2DVEA 4C92F 4X9DA 2DTOA 4J6YA 4JRIA 4JUVA 4M77D 4M7AE 2DXTA 4M77B 1U1SA 1I81A 1I8FA 4M7DG 4PJOC 1B34B 4N0AC 4QVDA 3FB9A 3BFMA 5LJ5f 2I2LA 5GAOm 5GAOn 5LJ5e 2EAYA 1JRIA 4M77F 2DTIA 3JCMV 3V8KA 1KQ1A 4M75D 4M78G 1U1TA 3HFOA 3JCMf 5GAMf 5GAMe 4C92C 4PNOA 3JCMe 4Y91A 4WF2A 3RIRA 1TH7A 5LJ5d 4F7UE 1B34A 3JB9G 1LOJA 3BDUA 4M7AB 2K57A 5GAMd 3JCMd 2VXFA 3M4GA 4C8QE 4M77C 1LJOA 4XU0A 3FJPA 4MMLA 4EMKC 4M75A 5GAOp 4OP0A 1I5LA 2ZGWA 4M7AF 5GAN2 1HXDA 1N9SA 2YLCA 4J6XA 4C8QC 3L1AA 4XU2A 4PJOA 2RA2A 1M5Q1 4N0AA 4NL2A 3QHSA 2RB6A 5LJ3h 5GAN6 5LJ5j 1M8VA 4XTVA 5GANf 3V8LA 1BIAA 5GAOl 3JB9J 2E64A 3RESA 5GAMj 4EMKB 4J6WA 3SWNC 4C92A 3JB9I 4M7AC 5GMKm 4C8QD 5GANh 4C8QB 4F7UF 1MGQA 4M75G 1Y96B 4JLIA 5LJ5g 4HT8A 1HK9A 1WNLA 4C8QF 4M7DE 3JCMQ 2DZ9A 4M77A 4PJOG 1N9RA 4EMKA 4RCCA 4X9CA 4HA8A 5GAMg 2CGHA 3SWNB 3RKXA 4NL3A 3RERA 4C8QA 4M7DC 4M7AD 3JCMc 4M78E 3JCMX 4A54A 4C92G 3SB2A 4J5YA 5LJ3f 3HFNA 2E1HA 4V2SA 5LJ3e 5GANj 2HNIA 2FB7A 4XQ3A 5GAOr 2DEQA 3BY7A 3SWNA 5GMKh 3JCMP 1YCYA 3EFRA 4M7AA 2Y90A 4M7DD 4M77G 4M7DB 1H641 5LJ3d 5CAIA 3JCMJ 4F7UB 5GANe 4XTZA 5GMKl 4C8QG 2EJFA 5GAN3 3JCMb 4M7DF 3QSUA 5GMKi 3V7CA 2DJZA 4MMKA 5GANd 4XTXA 2YLBA 4M7DA 2DXUA 1D3BB 4M78F 2EJ9A 4F7UA 5GAN5 4QVCA 2VXEA 2VC8A 2DKGA 2E10A 5LJ3j 3JCMg 4M7AG 3PGGA 4XU3A 3V8JA 3JB9F 5DY9A 4M75E 3HSBA
chains in the Genus database with same CATH superfamily
1K73R 2CDTA 2E3IA 3EGDA 2QA4T 2EYXA 5D6XA 3A98A 3OS0A 1QVFA 3EFOB 1ZBXA 4OMOA 1NJIC 3CC7A 5HK3A 5LJ5h 1VQ8T 1FMWA 2LCLA 3VUZA 1NYGA 1O75A 2EYWA 1BI2A 2GQIA 3M0RA 3OA6A 3CCMQ 3EG9B 4OGCA 4PJOF 2C0IA 4XTYA 3BE3A 3JAME 3CMAA 1PM3A 3CCLT 2YT6A 1AWJA 2CP6A 3L42A 2KT8A 4IIOA 3OB9A 2OTLQ 1JU5C 4JRIA 4OVAA 1U1SA 5DM7R 2HQXA 1KD1C 1MV0B 2HSPA 5GAMf 4RTXA 1TOVA 1Q7YC 1CKAA 1B34A 3X26B 1LOJA 4Z88A 4IUTA 1YHQT 1Y57A 4E7IA 2D8HA 1YJNA 2VKNA 4LXCA 1W2BP 4E7JA 4KUDK 1H3HA 1GCPA 4DOWA 3EG9A 2AZVA 2MIOA 2DVJA 2HAXA 2RQRA 4RTTA 1MGQA 3T9NA 4NS5A 2RJFA 4FCYA 1XOVA 2DZ9A 2YUNA 3LGFA 4LNPA 5CIUA 3RKXA 3JCMc 2RI5A 1SPKA 2DYIA 3VS4A 3OYMA 4HVVA 3M53A 3CCRQ 1NJIR 5LJ3d 3MEWA 4KGXB 4M7DF 4JS4A 3CBOA 1O9SA 2V8IA 2VWFA 5FU7B 2FZKB 4JZ4A 2XDBA 1JXOA 3CCJA 2JXBA 3CPFA 3RMQA 5KYUB 3RKYA 1FXXA 2X4YA 4A4EA 1YWOA 1R0BG 1FWZA 3J81E 3PNWC 2K3BA 1IB8A 1X01A 4E7KA 1KD1R 4CC2A 3QO3A 1Q7YR 2RQWA 2EPDA 4QT7A 3CD6Q 4M75F 2CS7A 1W70A 2KRNA 5CK9A 2HZYA 3CBPA 3QZ9B 5GAN4 5L8RE 1YJ9A 2HQEA 4C0GA 3FLGA 4R0KA 4KRTA 2JMCA 5KYUA 1KG1A 4QVDA 3EG0A 5GAOn 2KVQG 3CQTA 2PVOB 2V1RA 1X2QA 2DL3A 4M77F 4CRIA 4N4GA 1VQMT 2V26A 1YWPA 1PD1A 4FYXB 1KC8C 1NM7A 3FJPA 1AVZC 5C6SA 2YLCA 2QDLA 4FSSA 1AD5A 2V8JA 2XICA 2K79A 1TG0A 3H0HA 3RESA 1QVGA 3UA6A 1R0CB 5IXFA 1YBYA 1PKTA 5KCOA 1MMAA 3OYAA 4RCCA 3FRNA 4M7AD 3OMGA 4M7DC 2F2XA 1YI2T 1TXQA 1AZEA 3BDLA 2OTJA 4J9FA 1VQLQ 2RO0A 2FB7A 1KQSA 4MZPA 3A5ZB 1WJRA 5GANe 4ZN1A 2I0NA 3A1PA 1IHWA 1M30A 4HKEA 3V7CA 2JM9A 4M4ZA 1K9MU 4F7UA 1AZGB 2XDPA 1BKBA 3FEOA 1QVFS 2EFIA 2OX7A 4M78C 4JJCA 1S72A 2CT4A 2K4YA 1RAAB 3CXCS 4GLMA 2DXCA 3REAB 3RUXA 5KE2A 2J05A 5GANg 3E9GA 2HD0A 1KC8R 3URGA 4QVZA 1FMVA 1YP5A 3G71Q 3EG2A 4OMFB 2COYA 1G3TA 2E4HA 3CC7T 5KE3A 3MJXA 5IXBA 1ZSZC 1Y7XA 3VS3A 1D0ZA 2EAYA 2LQ8A 4R56A 2JM8A 1C0MA 5D6YA 2LDMA 1Q82U 2QDYB 2LCSA 2L3SA 3CMAT 4BD3A 1YITA 1UHFA 3PFSA 3OS1A 2X4XA 1ZQ1A 3CCST 2L3PA 1N9SA 1KK7A 2EYYA 5LJ3h 2J06A 2FEIA 1Q81C 4A4HA 4J6WA 1JJ2P 1ZBJA 3CCQQ 5I11A 3CCEQ 4F16A 2BKDN 4L59A 4BACA 1YJNT 4LDWA 3C4SA 5FWCA 3LH5A 4J9BA 3CCVT 2QYZA 1H92A 2JZ2A 4DEYA 2GFUA 3GLXA 1K8AC 1K0XA 1SSFA 3CEYA 3SB2A 3HFNA 5GANj 4HVUA 3OBYA 1WA7A 1UFFA 4OMMA 2MAMA 1NPRA 2V1QA 4R55A 1H641 3JCMJ 4IUVA 3QPHA 1VQ9Q 2CZ0B 1WJSA 2O4XA 4LN2A 4M7DA 1PRLC 3H6ZA 2VXEA 1QCNA 2DL4A 3CC4Q 4YTLA 1EX4A 1UB4A 2OI3A 3QKJA 4JJNK 2ZPIB 1SKUB 3CCJT 2D0QB 5CKHA 2LRQA 1AT1B 3M5AA 1R77A 1QP3A 3OW2A 2LZ6B 3PIPA 3RKWA 2PVDB 1YJWA 5GMKj 2RK2A 2R58A 4M78A 1JXMA 2MK5A 1Q81R 2ZPBB 3A8LB 1YITQ 2PQWA 2J6KA 3VRZA 4P5NA 1UECA 2RQVA 1SHFA 4EIKA 1U1TA 2M16A 1SEMA 4F7UE 1GCQC 2LCCA 3C0CA 3VV0A 3ZEHA 3SFMA 1OX9A 2FPFA 3PT9A 1K8AR 4KH0B 4FU6A 4QKUA 2BE7D 4DBHA 1WHLA 1PHTA 4VUBA 3NPFA 1ZSZA 2O88A 2M02A 1XQHA 2OJ2A 2DILA 3CCUQ 5GAMj 2EQKA 2LJ1A 2C06A 5IHIA 4B9WA 4C0DB 4BI8B 2MF2A 2RF0A 1W4SA 1KQSS 6AT1B 1WHHA 2EGAA 1M90C 2JMAA 3VKIA 3PVQA 1ZLMA 1OX8A 1WXBA 1IRXA 1ZSGA 1TS9A 2P4TA 2O2OA 3MEUA 2R5MA 3TVTA 1NEGA 3JRZA 2EW3A 2DX1A 2WSEE 2C0TA 2OTJT 2VYTA 1KJWA 2QA4Q 4XK8E 3DLMA 1HYOA 1FMKA 3UWNA 4RTYA 3REBB 1D3BA 2BTTA 4RUGA 4AFZC 1N27A 2ZAEA 3N5BB 2DZCA 3OSSC 2L5QA 1VQ8Q 2DBKA 2E65A 3FIFA 1BU1A 2FRYA 3G6ET 2CREA 3IQLA 2KEAA 1BI3A 2CZ1B 1W2BA 3CCLQ 1OPKA 2RJEA 3OBWA 4K11A 3NFCA 1M1GA 3KXTA 3OYNA 5J39A 3KUFA 3RDVA 3S3OA 4N0AC 2FZGB 2K2MA 2ZPFB 3FB9A 3NGPA 4KBMB 2G6FX 1S1NA 4C5GA 4JS5A 5J26A 3JCMe 1YHQQ 2K2VA 2JTMA 1ZHIA 3BDUA 2HBPA 1M90R 2K5FA 4XU0A 4M7AF 5GAN2 1VQKA 3L1AA 2GBQA 4EMKB 1UDLA 1VQOA 1GCQA 1K76A 3VRYA 4E7SA 3LLRA 1SRLA 4C8QF 2L3RA 4MZMA 1VOMA 2NUPA 4NL3A 4M78E 1TUDA 4DBRA 2PUKB 1WZOA 4D6WA 3EGXA 1MMDA 4XQ3A 4FYVB 3JCMP 1VQ6T 2FG0A 2A37A 4RG8A 2KYBA 4C5HA 4GLKA 2CP2A 2KE9A 2E10A 4F04B 4XU3A 1ARKA 3WVEB 3CPWS 3NTKA 1RL2A 2BZ8A 2K9GA 3CC2A 1RAGB 1RAHB 4F7UG 1OV3A 1XTDA 2EJGA 1WXUA 2YRDA 1GL5A 2RI3A 2MMPA 3OYJA 2CUDA 2F5TX 2XG8D 1BIBA 1BYMA 4DBQA 5KCHA 1UEBA 4EPCA 2M0YA 1YFNA 5FW9A 3OYDA 2ZCFB 2RQUA 4A4FA 4C92F 2DTOA 2EBPA 4JUVA 3M55A 5CR2A 1I81A 1B34B 1BI1A 1N5ZA 3PTAA 1VQMQ 1OZ3A 1JRIA 2HEQA 4FW2A 1YJWT 2L89A 2DD5A 2HSEB 1Q86U 1MMGA 1K9AA 3META 2KSSA 3D7SB 1VYUA 5GAMd 2P84A 2VXFA 3VS6A 4A4KA 4MMLA 2X35A 4HCKA 2KMTA 4KGZB 1AWXA 3QDRB 1AEYA 1HXDA 4C8QC 1VIFA 4NL2A 1M5Q1 4N0AA 2ZPGB 3A8HB 3O5ZA 4ZGJB 3CCSA 2Z0WA 4HVWA 4RG2A 3LGLA 5FU6B 2JS0A 3J80E 1KIKA 2KDSA 3I5SA 2PUOB 1YI2Q 3CMEQ 3QBYA 1Q95G 3QWXX 2KXCA 2WSCE 4Z02A 2KXDA 4II1A 2DBMA 3CCVA 4L5GA 5GAOr 1QLYA 1U5SA 3EFRA 1OOTA 3G4SA 2CUBA 1M1KC 1YIJT 3F70A 1IHVA 1UHCA 3C95A 4IKFA 2VC8A 1OEBA 2LC4A 2MWPA 2J7IA 3OYEA 2EIFA 2DTHA 4BY6C 1JBMA 2EWNA 4LDYA 3J7AF 1VQ5A 1M9SA 5KYYA 1KSWA 1VQ7A 2DK3A 4Y92A 3RBBB 2IPOB 2PVGB 3V7SA 1K0SA 1GXIE 1D1AA 1WXTA 1W2BS 2OAUA 2DEUA 5I2MA 4HT9A 2MOXA 2W0ZA 3MP1A 2H3JA 3S3NA 1D0YA 1BBZA 3CC7Q 1T3SA 2D6FA 1OULA 2LQWA 4ZNXA 4J6YA 2QQ9A 1U8RA 2KK4A 4PJOC 1JJ2A 1M3BA 7AT1B 5LJ5e 5HCKA 2QQAA 3V8KA 2H8HA 4M78G 3E2UA 3CMAQ 4JDSA 1XNIA 1X6OA 2QQSA 2K57A 1QKXA 3EH1A 2FO0A 1WHGA 5CQXA 2O9SA 3TSZA 4ELYC 2QXFA 8ATCB 2QK0A 2EQMA 1M1KR 3MPUB 1R8OB 4LDUA 1YJNQ 2HL5C 1YCSB 5LJ5g 1VQKT 4RTVA 2GFAA 3E9FA 4MDXA 5AYFA 1RLPC 3RERA 4C8QA 2RHYA 4JJBA 3VS7A 2FVUA 4PLLA 5KYNA 3H41A 3M0QA 2FPDA 4J5YA 4OB0B 1G5VA 2KROA 4JPBW 3GOXA 2B86A 2CSIA 3DLLA 2L2PA 3TCJA 2DLPA 1VQOT 2J6OA 5GMKh 4ORZA 3ASKA 2LNHB 3VS2A 4F7UB 5GMKl 1EIFA 1GFCA 1OQKA 3QYHB 4RTWA 1SRMA 2DJZA 1E6HA 4Z8AA 2CH4A 3E1SA 1VIEA 1UGVA 1OU9A 3TQ7P 1RACB 1I1JA 3DB4A 4E7LA 2QG9B 2AHJB 5IH2A 1YNZA 2OTLT 3MP6A 3CCJQ 2BE9B 3CBMA 3CXCP 2E41A 5GAMh 4FYYB 4PJOB 3MEVA 1WPYA 4DQ2A 3UATA 3EFSA 4EMGA 3CC2T 3RR6A 2FHDA 4JLGA 2HCKA 1X6GA 4M75C 2JS2A 3G6EA 3GBQA 2VB6A 5GJWB 4OB2B 2DETA 2CYZB 2CP5A 2XMFA 3JCMf 4RKUE 1YJ9Q 2ZPHB 3JB9G 1BI0A 3O8VA 5J3BA 5FRMA 4HCCA 4M77C 3TEEA 2O9VA 1PC0A 1I5LA 4PFZA 5EC7A 1GRIA 4ZGDB 4PJOA 5GAN6 3HP9A 3VS1A 1M8VA 2AKKA 3C12A 5A2QE 3OYIA 1QWEA 2E64A 3SWNC 1ACMB 1IGQA 2EGEA 5GMKm 2DL7A 3HRSA 1E7OA 2IVWA 2YUOA 4TVRA 4E6RA 5IT9E 2E5QA 2JTFA 2QQBA 3GPLA 4V2SA 2HNIA 2WACA 1K4US 1M27C 2FPEA 2O4XB 3DKMA 5HKCA 4M7DB 3I56A 2OTJQ 1V76A 1VQ6A 2DXUA 2X3XD 1G2BA 2EJ9A 4ATOA 2M1HA 1OYXA 2ROTA 3V8JA 3LW5E 2DL5A 4ZTJA 3QUIA 3QJ6A 3G4ST 1ZX6A 5CCAA 2JN0A 2HKNA 4AMCA 1QW1A 3V7RA 4LDXA 2L8DA 2D0NA 5GAOq 4ANJA 4M75B 2G3RA 4M78B 1X6BA 2KI7A 2FYKA 3G6EQ 4PJOD 1S72Q 4OGEA 1MV3A 3SD4A 2K5LA 3PMIA 2GTOA 1RLQC 1VQ5T 4A63B 3WVDB 1VQ7T 5A0GA 1JJ2S 1WQWA 1WHMA 1VUBA 3L2RA 2X9HA 4M77B 2KYMA 1Q81U 2SRCA 2EQIA 2AT1B 2YXYA 4QQGA 2DTIA 2K5IA 2RI2A 2KRMA 1M2OA 4WF2A 2KAFA 2MYSA 4FW1A 1ZSZB 2QGFB 3MP8A 2YRVA 1Z9ZA 4M75A 2KR3A 2ZPEB 3OSVA 1IZ6A 1QMCA 2DXBA 2ATCB 3V8LA 2RMOA 1SF9A 1N8RU 1G3SA 3UPUA 1BB9A 1ZA1B 3QYGB 1I0CA 4M77A 2YUPA 3AT1B 2YSQA 4J83A 4CC3A 5LJ3e 4PJJA 3EG1A 2A7YA 3SWNA 1QVGS 1KFZA 4M7DD 5IHNA 1PCXA 1IXDA 1NG2A 1EFNA 1M2VA 4XTZA 4OMNA 1UGPB 3PIOA 3QSUA 2YLBA 2DE0X 2JTEA 1D3BB 1U3OA 3G1JA 3M0UA 2RH2A 3MEAA 4J9DA 1YIJA 2O01E 4PJOE 4J9GA 1NPPA 2E6ZA 1PD0A 2QGGA 5LJ3g 1C6VX 1PRMC 1I07A 2RQTA 3VS5A 1BK2A 5IN1A 3I9QA 4M78D 4E7ZA 2KY9A 2FRWA 3TSWA 2CKKA 2JOYA 1T3LA 3X28B 1RUWA 4RTUA 2EKOA 4J7IA 5GJVB 4C0ZA 1QKWA 2M0OA 2W10A 4XU1A 4E7HA 1QP2A 1CSKA 4LE9A 3HL8A 1D09B 3I35A 2LP5A 3OYHA 3S3MA 4RTZA 4OB3B 5DLOA 4M77D 2ROLA 3M57A 2RHZA 5LJ5f 1E6GA 4O6JA 1YJWQ 2JVVA 2DIGA 4FIBA 1WJQA 3CCQT 3I55A 3ULRB 1ZUYA 4RMOA 3EAEA 4GY5A 3M4GA 2CSQA 3X20B 4J6XA 4KH1B 1VQPA 1QVPA 3H9NA 1VQ4A 4XU2A 2RA2A 1D1BA 2GQVA 4DOVA 1DJ7B 4J7FA 4DBFA 2NUPB 2MWOA 2ESWA 5CO7A 1RAEB 2RHIA 2EVRA 1PSFA 5IAYA 3P8DA 4HCZA 4J9HA 4M7DE 3EGXB 3NTHA 4HA8A 2K7AA 1T0HA 1ZUUA 3DB3A 3P8BB 4CC7A 1X43A 2LJ0A 3JCMX 5AT1B 2SEMA 3CC4T 4AG2C 3MCAB 3OS2A 4KULA 4PFOA 3HTRA 3ER0A 1AWOA 3P8HA 1QQJA 1IGUA 2P0QA 2M9UA 2QAZA 2LVMA 4C8QG 4HXJA 2XKOC 1XJWB 5GANd 4XTXA 2D1XA 1G3WA 5C0MA 5GAN5 1OZ2A 3JCMg 4M75E 1WIEA 3OS5A 1WHJA 1HJDA 3I56T 4JRKA 1X75C 4E2FB 3KBGA 3QG1A 2O31A 3KFVA 2LX9A 3OQ5A 3CPWP 2X51A 4MZTA 5GAN7 2HKQB 2NUTA 2OTLA 4M77E 4Z89A 3JB9D 4IIMA 1A0NB 2OAWA 3LWIA 3SDZA 1MHNA 5I22A 3FC3A 1RI0A 1UUEA 5CQYA 4L6V5 1K73U 4B6MA 1QCFA 1I8FA 2DJQA 2L3QA 4OF1A 1Q86C 3OW2S 4PNOA 3OY9A 2NUZA 4Y91A 1HSQA 1PWTA 3HKSA 4HCBA 3L2WA 3NHNA 2COZA 1NLOC 2IG0A 3E19A 3JSCA 4J9EA 1UJ0A 1WDXA 2J6FA 2RJCA 3QHSA 2E3HA 3JV3A 4LUEA 4J8OA 2YUQA 3S6WA 2DA9A 4PL6A 4M7AC 2QASA 4F7UF 1QWFA 2FL7A 1VQKQ 2CP3A 1WNLA 2F2VA 4PJOG 4LUDA 2AIRB 3A8GB 3QIIA 2JUFA 2NYSA 1I5OB 3R6OA 1D1CA 4QQDA 1ABQA 1VQOQ 3M0PA 2P4RA 5FU7C 1UTIA 2Y90A 1MUZA 3M0SA 4BE0A 4KUIA 2ENMA 2PZ1A 3CXCA 5GMKi 1RADB 4MMKA 3HHTB 1UJYA 1X27A 1K1ZA 4Y28E 3ME9A 2QTVA 5FWBA 5KYYB 2LJ3A 4NOYA 3CD6A 4WCIA 2A28A 4A53A 5EG2A 1RABB 1Q86R 3QXEB 2RM4A 4XTWA 1NJIU 4J9CA 2DYBA 1D0XA 2F5KA 2GGRA 3EFOA 1LCKA 2X3WD 4LDVA 1JEGA 3CC2Q 1M3CA 4GBQA 3SHWA 2HMAA 4EMHA 4DA4A 1VQNT 1KHIA 1JB0E 5KYWB 1VYTA 4X9DA 1BCMA 4M7DG 3TREA 4C5EA 2LQKA 3PE0A 1PSEA 1KD1U 4C92C 3RIRA 1UE9A 1GBRA 3M58A 1Q7YU 3PMTA 4FYWB 4M7AB 2LMJA 2VGMA 4FT4A 1U06A 5L23A 4OB1B 1B7TA 3OYKA 2R5AA 2M51A 2LTOA 5GAOl 1BIAA 5CVIA 3I55T 1NLPC 4BI4A 1MMNA 5GANh 1UGSB 1VQLA 4C8QB 1M1KU 5KYWA 2CZ7B 3FDRA 3GNGA 4M75G 2DRKA 2HDAA 1F1BB 5HK0A 2VVKA 1N9RA 2MPXC 1VQPT 4C0FA 1VQ4T 3CCSQ 2AK5A 2QEXT 5LJ3f 2E1HA 2JNGA 3VS0A 5I2SA 2DEQA 3M0TA 4M7AA 2YRCA 4M77G 5IHKA 2MI6A 2XK0A 3HRTA 5LL6S 4AFSC 5A0LA 2K6DA 3EG3A 9ATCB 1C1AA 3CCVQ 2DRMA 4OMPA 4PFPA 2RHXA 4M78F 2GCXA 2E12A 1NE8A 2BUDA 4XAXB 2DL8A 3G4SQ 1RAIB 5M9OA 4CC4B 1KQ2A 4ZTFA 3OYLA 5HY6A 1NBEB 1TUCA 3OYYA 3L2ZA 4BI3A 3INZA 3HRUA 3G71A 2BZYA 1AHJB 2KRSA 3ZL7C 5DLQE 1V1CA 4N4IA 4BY6B 5GAN8 1K9MC 5ECAA 2CP7A 1VQ5Q 2H3EB 3VU3C 1VQ7Q 3G7ZA 1LNXA 4C92B 5FLXE 3CCMT 4IUQA 4ELZC 3JCMW 2DVEA 3PVLA 2DXTA 1WGSA 2JJ9A 4PLIA 1QVFP 5GAOm 3QJYA 2E6NA 3JCMV 2A3LA 1KQ1A 2KQWA 5D7UA 3HFOA 1TU0B 1Y07A 2FZCB 1TH7A 3CMET 3JCMd 1KC8U 2ECZA 3CCQA 1HD3A 1VA7A 3CCEA 3MHXA 3LYIA 2X4JA 5CKFA 4AFUC 3L2QA 1EZZB 3EGUA 2RJDA 1B3QA 5LJ5j 1LVKA 2NWMA 4C92A 1OPLA 2LNVA 4C8QD 5CKDA 1Q82C 1FX7A 2XD0A 1QCOA 4KGVB 2K3XA 4JJDA 2PU9B 3A8OB 4ZGEB 3WXMB 3Q1JA 1VQ9A 4PJLA 1W1FA 3RMSA 1G3YA 1M1FA 4D8KA 4B9XA 1CKBA 1G8XA 2LT1A 1ZUKA 3BY7A 2A0FB 2D9TA 3CC4A 2EQJA 3CCRT 5D6WA 5GAN3 3JCMb 1K9MR 1Z9QA 1RAFB 4BE1A 2X4WA 1FYNA 2MCNA 3OMCA 2DKGA 3VYHB 2Y4XA 3ZFJA 3H0IA 4PJMA 3JB9F 3GF5A 1TTHB 3I5RA 1GFDA 5GMKe 3UF4A 3EHRA 3JB9H 2YHTA 1SG5A 3GIBA 2RN8A 1I4K1 4JRPA 1MNDA 2KNBB 4MDWA 3VJPA 1IO6A 2PNIA 2RD1A 3CD6T 4OMQA 2QTXA 4C92D 2LQNA 4J9IA 3M59A 2VUBA 1NYFA 2VV5A 1NEBA 2DD4A 3SEMA 3C94A 2C0OA 4AG1C 3THKA 2XI9A 4M7AE 2PTKA 3X24B 1WFWA 1RI9A 3BFMA 1Q82R 1SHGA 2RHUA 2KT1A 1ZA2B 2GNCA 4N4HA 2V8KA 5GAMe 4F17A 1OU8A 1VYVA 2EYQA 3CCUA 1SSHA 2CZ6B 3VUBA 4C8QE 5GAOp 1PKSA 4IURA 4OP0A 1T0JA 2RB6A 3M56A 4C0DC 2P0PA 1AWWA 1N8RC 2AKLA 2XDDA 3UA7A 1WHKA 2DMOA 3JB9I 4BDZA 4ESRA 4JLIA 2RK1A 4EDUA 4BE2A 1X2KA 2R57A 3QWYA 2DAQA 5GAMg 2CGHA 4DEXA 3SWNB 1M2VB 4BB7A 5CKBA 1K8AU 4FT2A 3OYFA 2DPPB 1VQLT 4X1VA 3NTIA 2JW4A 3CPWA 1LPLA 3MKDA 2ZZDA 5CAIA 2QA4A 2WSFE 2QQRA 1X69A 2Y4YA 4LD9K 2IIMA 1QVGP 2EKHA 3L2VA 3NMZC 2LT4A 4X34A 2EYZA 4AT1B 1OI1A 8AT1B 5CKEA 1VQ8A 3I56Q 4F14A 3HSBA 3R6NA 2LX7A 1TWBA 4XTUA 1VQ6Q 1H8KA 1UG1A 1KQSP 4C92E 1TSFA 3CCLA 4RCBA 3UDCA 1V29B 2BIVA 4A4GA 2YDLA 3JCMh 5FRNA 1YJ9T 3VYGA 2VASA 1M8MA 2GTJA 1G83A 2BZXA 4ME7A 4JRQA 1P92A 5A0DA 1WLPB 3G71T 1ABOA 1YHQA 3LX7A 1N8RR 2E5KA 1PG5B 3HPWA 2HL3A 1VQNA 4FL6A 4Q5WA 5KYXB 2P0KA 2B8AA 4M75D 4D8DA 1B07A 3FJ5A 4PKCC 4PJNA 5LJ5d 1M3AA 2EQUA 1LJOA 2VGNA 2JT4A 3M54A 4EMKC 4AFQC 2ZGWA 2RPNA 2KGTA 1JQQA 3OYGA 3GNFB 1M4ZA 2XIDA 3JB9J 2DFUA 1WI7A 2CT3A 2HBWA 1WYXA 3OYCA 1MNEA 2AZSA 1Y96B 4HT8A 4BDYA 4WTOB 1HK9A 2ED1A 3CCET 3JCMQ 4X9CA 1AOJA 2DERA 2HQHA 5KYXA 3EH2A 3LWHA 4A54A 1WX6A 1N6AA 1IREB 1M90U 3M9QA 2QEXA 2F2WA 1JO8A 4JZ3A 1VQ9T 2DNUA 4QVCA 1S72T 4BUGA 5LJ3j 4M7AG 1UGQB 2DF6A 4FSXA 2DM1A 3AHUA 1Y96A 1Y0MA 2K3YA 4UC4A 2NUTB 1WQ7A 4PK4A 1YIJQ 5I21A 1H3ZA 1Y71A 2DO3A 3OYBA 4ZN3A 1VQNQ 2COWA 1GBQA 1VQMA 2XHCA 3BW1A 3H0FA 2A08A 2XU8A 1K73C 3L2UA 2A36A 2I2LA 3QDFA 3CCMA 3LH0A 1YITT 3A8MB 3EHQA 4FM4B 4LD6A 3M4YA 3GP8A 2E70A 1W6XA 1UGRB 3RNJA 2NLUA 3OW2P 2F69A 2ED0A 5FU6C 2YWWA 3CMEA 1YI2A 3I55Q 4XTVA 1J3TA 5GANf 3ZBDA 4QQ6A 3TU4K 5FROA 4IUPA 3CCUT 1BCOA 4OMLA 4QW2A 3EGDB 3QZ5B 2ABLA 1VQPQ 1NZ9A 1VQ4Q 1KHCA 3UT1A 4IUUA 3H8ZA 4EMKA 2QEXQ 4E47A 2DIQA 1YN8A 2D8JA 3U23A 4CI0C 3X25B 4C92G 5KH6A 1TUGB 2KBTA 1YCYA 2F1LA 4KT0E 3MO8A 4O5VA 2RNAA 2EJFA 4C5IA 2L0AA 2CH4W 1PNJA 2EGCA 2QI2A 2GF7A 3CCRA 3PGGA 5DY9A 2CP0A
chains in the Genus database with same CATH topology
3QUIA 3UWNA 2QA4T 3QJ6A 1KQ2A 3G4ST 1D3BA 4ZTFA 3OYLA 5D6XA 5HY6A 5CCAA 1N27A 2JN0A 3OS0A 1QVFA 3OYYA 3N5BB 3L2ZA 2DZCA 1QW1A 3OSSC 4BI3A 1ZBXA 2L5QA 3HRUA 3INZA 3V7RA 3G71A 2L8DA 4LDXA 5GAOq 1NJIC 1AHJB 2E65A 3FIFA 3CC7A 5HK3A 5LJ5h 4M75B 2G3RA 5DLQE 1VQ8T 4M78B 2LCLA 4N4IA 4BY6B 3VUZA 5GAN8 2FYKA 1K9MC 4PJOD 1O75A 4OGEA 1BI2A 3SD4A 3G6ET 2K5LA 3PMIA 3OA6A 3VU3C 1BI3A 4OGCA 4PJOF 2CZ1B 1W2BA 4XTYA 3G7ZA 1LNXA 4C92B 5FLXE 1VQ5T 2RJEA 3OBWA 3WVDB 4IUQA 3JAME 3CMAA 3NFCA 3CCMT 5A0GA 3CCLT 1VQ7T 4ELZC 1JJ2S 3L42A 1WQWA 3JCMW 1M1GA 2DVEA 1VUBA 3OB9A 3KXTA 4JRIA 3OYNA 5J39A 3KUFA 3L2RA 2DXTA 1WGSA 1U1SA 4M77B 4OVAA 3S3OA 4N0AC 4PLIA 2ZPFB 3FB9A 5DM7R 5GAOm 1Q81U 3QJYA 4KBMB 2E6NA 2HQXA 4QQGA 3JCMV 2DTIA 1KD1C 2A3LA 4C5GA 1KQ1A 2KQWA 2K5IA 5GAMf 4JS5A 3HFOA 2RI2A 5J26A 3JCMe 1Y07A 4WF2A 5DY9A 2KAFA 1Q7YC 1TH7A 1B34A 2K2VA 3X26B 1LOJA 2JTMA 1ZHIA 3BDUA 2HBPA 4IUTA 3CMET 1YHQT 3JCMd 3MP8A 2YRVA 1KC8U 2K5FA 4XU0A 4E7IA 4M75A 1YJNA 3CCQA 2ZPEB 3OSVA 3MHXA 3CCEA 5GAN2 1VQKA 3LYIA 4M7AF 2X4JA 5CKFA 4E7JA 4KUDK 1IZ6A 3L1AA 3L2QA 2DXBA 2RJDA 5LJ5j 3V8LA 4DOWA 4EMKB 4C92A 1N8RU 2LNVA 1G3SA 4C8QD 5CKDA 1Q82C 2HAXA 1VQOA 1FX7A 1MGQA 3T9NA 3UPUA 2XD0A 3QYGB 2RJFA 4NS5A 2K3XA 3LLRA 4C8QF 1XOVA 2DZ9A 2L3RA 3LGFA 4M77A 4MZMA 5CIUA 2PU9B 4J83A 3RKXA 3A8OB 4ZGEB 3WXMB 3Q1JA 4NL3A 3JCMc 4ZTJA 1VQ9A 4M78E 3RMSA 2PUKB 1G3YA 1M1FA 2RI5A 5LJ3e 4D6WA 4B9XA 4XQ3A 3OYMA 2LT1A 3M53A 3BY7A 3SWNA 2A7YA 1QVGS 3JCMP 1VQ6T 4M7DD 2D9TA 5LJ3d 3CC4A 4XTZA 2EQJA 3MEWA 3CCRT 5D6WA 5GAN3 3JCMb 4RG8A 4M7DF 1UGPB 3PIOA 4JS4A 3QSUA 3CBOA 4C5HA 4BE1A 4GLKA 1O9SA 2X4WA 2YLBA 2V8IA 5FU7B 1D3BB 2XDBA 3OMCA 3CCJA 2DKGA 2E10A 3VYHB 2Y4XA 3CPFA 4XU3A 2RH2A 3MEAA 3RMQA 3ZFJA 1YIJA 3JB9F 3WVEB 3RKYA 1FXXA 3GF5A 2X4YA 4A4EA 3CPWS 2O01E 4PJOE 3NTKA 1RL2A 5GMKe 1NPPA 2E6ZA 1FWZA 3J81E 3JB9H 3PNWC 3CC2A 5LJ3g 1X01A 4E7KA 4F7UG 2YHTA 1XTDA 3GIBA 2EJGA 5IN1A 1I4K1 3QO3A 4JRPA 2RI3A 4M78D 2KY9A 2MMPA 4MDWA 3VJPA 3OYJA 2CKKA 2F5TX 2XG8D 2CS7A 4M75F 2JOYA 1BIBA 2RD1A 3X28B 1BYMA 2EKOA 5KCHA 1UEBA 3CD6T 4J7IA 4EPCA 5CK9A 4C0ZA 2M0OA 2QTXA 3CBPA 4C92D 3QZ9B 3M59A 4XU1A 2VUBA 4E7HA 1QP2A 2VV5A 3OYDA 3HL8A 5GAN4 2DD4A 2ZCFB 5L8RE 2HQEA 3OYHA 1YJ9A 4C0GA 3C94A 4A4FA 3S3MA 4C92F 2XI9A 2DTOA 3FLGA 4OB3B 4JUVA 4M77D 5DLOA 4M7AE 3M55A 5CR2A 1I81A 3X24B 3M57A 2RHZA 1B34B 1BI1A 4QVDA 1KG1A 3BFMA 5LJ5f 5GAOn 4O6JA 2KVQG 2RHUA 3PTAA 1OZ3A 2JVVA 1JRIA 2PVOB 4M77F 4CRIA 2DIGA 4FIBA 4N4HA 4N4GA 2V8KA 1VQMT 1YJWT 2L89A 5GAMe 2DD5A 1WJQA 3CCQT 1Q86U 3I55A 2EYQA 3META 1KC8C 3CCUA 4RMOA 3EAEA 2KSSA 2CZ6B 3VUBA 4GY5A 5GAMd 2VXFA 3M4GA 4C8QE 4A4KA 5GAOp 3FJPA 2X35A 4MMLA 2KMTA 4IURA 4OP0A 3QDRB 3X20B 5C6SA 1HXDA 2YLCA 4J6XA 4C8QC 1VQPA 1QVPA 1VIFA 1VQ4A 4XU2A 2RA2A 1M5Q1 2GQVA 4N0AA 4NL2A 2RB6A 2ZPGB 3A8HB 3M56A 2P0PA 4C0DC 4DOVA 4ZGJB 1DJ7B 2V8JA 2XICA 1N8RC 3CCSA 2XDDA 3RESA 4J7FA 3JB9I 4BDZA 1QVGA 2MWOA 1YBYA 4RG2A 5CO7A 5KCOA 3LGLA 4JLIA 5FU6B 3J80E 2RHIA 5IAYA 1PSFA 2RK1A 3P8DA 2KDSA 4EDUA 4HCZA 4BE2A 4M7DE 3OYAA 2PUOB 2R57A 4RCCA 2DAQA 3FRNA 3NTHA 2CGHA 3QBYA 4HA8A 5GAMg 3SWNB 4M7AD 3OMGA 4M7DC 1YI2T 3DB3A 3P8BB 3JCMX 3BDLA 3CC4T 4BB7A 2OTJA 2WSCE 5CKBA 1K8AU 4Z02A 3MCAB 3OS2A 2RO0A 4II1A 2FB7A 4KULA 4FT2A 3CCVA 3OYFA 2DPPB 3ER0A 4L5GA 3NTIA 4MZPA 5GAOr 1KQSA 1VQLT 3P8HA 3CPWA 3EFRA 2P0QA 3A5ZB 2ZZDA 2M9UA 5CAIA 1WJRA 3G4SA 5GANe 2QA4A 2WSFE 2LVMA 4C8QG 1M1KC 2QQRA 2Y4YA 4LD9K 4ZN1A 2XKOC 1YIJT 3F70A 4HKEA 3V7CA 5GANd 4XTXA 3L2VA 3C95A 2LT4A 1G3WA 5C0MA 1K9MU 4IKFA 4F7UA 4X34A 5GAN5 1OI1A 1OZ2A 2XDPA 2VC8A 3JCMg 5CKEA 1VQ8A 2LC4A 1BKBA 4M75E 2MWPA 3FEOA 3OYEA 3HSBA 2EIFA 1QVFS 3OS5A 2DTHA 3I56T 4JRKA 1X75C 2EFIA 3KBGA 4M78C 4XTUA 4BY6C 1S72A 1JBMA 2EWNA 3QG1A 4LDYA 3OQ5A 2LX9A 3J7AF 2K4YA 1VQ5A 1M9SA 3CXCS 4C92E 1VQ7A 2DK3A 2DXCA 4RCBA 3RUXA 3UDCA 3CCLA 5KE2A 4MZTA 5GAN7 1V29B 2PVGB 3V7SA 2BIVA 5GANg 1GXIE 3E9GA 2HD0A 4A4GA 1W2BS 2OTLA 2OAUA 4M77E 3JCMh 3URGA 4QVZA 5I2MA 5FRNA 3JB9D 1YJ9T 3VYGA 4HT9A 3MP1A 2H3JA 3LWIA 3S3NA 3SDZA 1MHNA 4ME7A 4JRQA 3FC3A 4OMFB 1P92A 1RI0A 2D6FA 5A0DA 3G71T 5CQYA 1G3TA 4L6V5 1YHQA 3CC7T 3LX7A 4J6YA 5KE3A 1K73U 2QQ9A 1U8RA 1I8FA 2KK4A 1Y7XA 3HPWA 1VQNA 4PJOC 1JJ2A 4FL6A 4Q5WA 5LJ5e 2EAYA 2LQ8A 4R56A 2QQAA 2P0KA 5D6YA 4OF1A 2LDMA 2B8AA 4M75D 4M78G 3V8KA 3OW2S 1Q82U 1Q86C 4PNOA 4JDSA 3OY9A 4Y91A 4PKCC 2QDYB 1XNIA 5LJ5d 1X6OA 2QQSA 3CMAT 4BD3A 3HKSA 1YITA 3PFSA 2EQUA 2K57A 3OS1A 3L2WA 4HCBA 1LJOA 2VGNA 2X4XA 3M54A 4EMKC 1ZQ1A 3CCST 2IG0A 5CQXA 2ZGWA 3E19A 1N9SA 3JSCA 4ELYC 2QXFA 2RJCA 5LJ3h 3OYGA 3QHSA 3GNFB 1M4ZA 1Q81C 4A4HA 2XIDA 2EQMA 3JB9J 4J8OA 3S6WA 4J6WA 1R8OB 4PL6A 4M7AC 4LDUA 4F7UF 3OYCA 1Y96B 2FL7A 5LJ5g 2BKDN 4L59A 4BACA 1HK9A 4BDYA 1WNLA 1YJNT 4LDWA 4HT8A 3C4SA 3JCMQ 3CCET 4PJOG 1VQKT 2GFAA 3E9FA 4X9CA 3CCVT 3A8GB 4MDXA 2JZ2A 3QIIA 5AYFA 2JUFA 4C8QA 3RERA 2RHYA 2GFUA 3GLXA 3LWHA 1K8AC 2FVUA 4PLLA 4A54A 1SSFA 3CEYA 3R6OA 4J5YA 1N6AA 3HFNA 4OB0B 4QQDA 3SB2A 5GANj 1G5VA 1IREB 3GOXA 1M90U 3OBYA 3DLLA 3TCJA 3M9QA 1VQOT 5FU7C 5GMKh 2MAMA 1NPRA 3ASKA 2QEXA 2Y90A 4R55A 1H641 3JCMJ 4IUVA 4F7UB 5GMKl 1EIFA 4BE0A 3QPHA 4KUIA 3QYHB 2CZ0B 3CXCA 5GMKi 1VQ9T 1WJSA 2DJZA 4MMKA 2O4XA 3HHTB 4M7DA 3H6ZA 3E1SA 1VIEA 4QVCA 2VXEA 1S72T 4BUGA 4Y28E 5LJ3j 4M7AG 1UGQB 3ME9A 4FSXA 4YTLA 3AHUA 1UB4A 1Y96A 3QKJA 4JJNK 3DB4A 2K3YA 4UC4A 4E7LA 4NOYA 2AHJB 2ZPIB 3CD6A 2OTLT 1WQ7A 3MP6A 4A53A 5EG2A 5I21A 1H3ZA 3QXEB 2RM4A 3CCJT 3CBMA 1Y71A 2D0QB 4XTWA 1NJIU 5CKHA 2DO3A 2LRQA 2F5KA 2E41A 3M5AA 4LDVA 5GAMh 4PJOB 3OYBA 3MEVA 1QP3A 3OW2A 1WPYA 4DQ2A 4ZN3A 3PIPA 3EFSA 3RKWA 4EMGA 2PVDB 1YJWA 1VQMA 5GMKj 4EMHA 4DA4A 3CC2T 2RK2A 2R58A 4M78A 2FHDA 4JLGA 1VQNT 2XHCA 1KHIA 1JB0E 3BW1A 2XU8A 1K73C 4M75C 3L2UA 2ZPBB 3G6EA 4X9DA 3A8LB 4OB2B 4M7DG 2PQWA 3TREA 4C5EA 2I2LA 3CCMA 4P5NA 2LQKA 3LH0A 1YITT 1PSEA 2CYZB 3A8MB 4FM4B 1U1TA 3JCMf 4LD6A 1KD1U 4RKUE 4C92C 3M4YA 3GP8A 2E70A 2ZPHB 2M16A 3RIRA 4F7UE 1UGRB 3JB9G 1BI0A 3O8VA 2LCCA 3M58A 3VV0A 3PMTA 3PT9A 5J3BA 3SFMA 4M7AB 2NLUA 3ZEHA 1Q7YU 5FRMA 4HCCA 4M77C 3TEEA 2VGMA 4FT4A 2F69A 4FU6A 1I5LA 4OB1B 4VUBA 3OYKA 5FU6C 4ZGDB 4PJOA 5GAN6 1YI2A 3CMEA 3HP9A 1M8VA 1XQHA 4XTVA 2R5AA 5GANf 3C12A 2LTOA 3ZBDA 1BIAA 5GAOl 5A2QE 2E64A 3OYIA 5CVIA 5GAMj 4QQ6A 3I55T 3TU4K 3SWNC 5FROA 2EQKA 4IUPA 4BI4A 2C06A 5GMKm 5GANh 1UGSB 3CCUT 1VQLA 4C8QB 4B9WA 1M1KU 2CZ7B 3FDRA 3GNGA 3HRSA 4M75G 4QW2A 3QZ5B 4C0DB 1NZ9A 4BI8B 1KHCA 3UT1A 4IUUA 2IVWA 3H8ZA 5HK0A 1N9RA 4EMKA 2MF2A 1VQPT 4E47A 4C0FA 4TVRA 2DIQA 1VQ4T 4CI0C 2QEXT 1W4SA 5IT9E 1KQSS 2E5QA 2JTFA 3X25B 4C92G 5KH6A 1M90C 5LJ3f 2QQBA 2E1HA 3GPLA 4V2SA 2HNIA 2WACA 2JNGA 3VKIA 5I2SA 2DEQA 1YCYA 2O4XB 3DKMA 4M7AA 4KT0E 4M77G 3MO8A 5HKCA 4M7DB 3I56A 2P4TA 2MI6A 2XK0A 3HRTA 4O5VA 5LL6S 3MEUA 5A0LA 2EJFA 2R5MA 4C5IA 3JRZA 1VQ6A 2WSEE 2OTJT 2DXUA 2RHXA 4M78F 4ATOA 2EJ9A 2VYTA 2QI2A 2GCXA 2E12A 1NE8A 2BUDA 2GF7A 2M1HA 4XAXB 3CCRA 3PGGA 3V8JA 3LW5E 5M9OA 1OYXA 4XK8E 3DLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHU A;  1Y96 A;  3QUI A;  3RKY A;  2DTH A;  1KQ2 A;  4JRK A;  1D3B A;  4PJO E;  4NOY A;  4M78 C;  5GMK e;  4XTU A;  1JBM A;  2EWN A;  3JB9 H;  2JN0 A;  5LJ3 g;  1X01 A;  1WQ7 A;  3L2Z A;  2YHT A;  2DZC A;  4F7U G;  3INZ A;  3V7R A;  4A53 A;  3RUX A;  4C92 E;  4RCB A;  3GIB A;  2EJG A;  5I21 A;  5GAO q;  2E65 A;  3FIF A;  5GAN 7;  1I4K 1;  2RM4 A;  3QO3 A;  3V7S A;  4M75 B;  5LJ5 h;  4M78 D;  4XTW A;  5GAN g;  4M78 B;  5GAN 8;  2FYK A;  2E41 A;  4PJO D;  4M77 E;  3JCM h;  5GAM h;  4M75 F;  4HT9 A;  3JB9 D;  4PJO B;  2RD1 A;  1BIB A;  1WPY A;  4DQ2 A;  3EFS A;  3RKW A;  3VU3 C;  4EMG A;  4PJO F;  5GMK j;  4EMH A;  4XTY A;  2QTX A;  4C92 D;  4M78 A;  4XU1 A;  1LNX A;  4C92 B;  3BW1 A;  5GAN 4;  4M75 C;  1WQW A;  3JCM W;  2DVE A;  4C92 F;  4X9D A;  2DTO A;  4J6Y A;  4JRI A;  4JUV A;  4M77 D;  4M7A E;  2DXT A;  4M77 B;  1U1S A;  1I81 A;  1I8F A;  4M7D G;  4PJO C;  1B34 B;  4N0A C;  4QVD A;  3FB9 A;  3BFM A;  5LJ5 f;  2I2L A;  5GAO m;  5GAO n;  5LJ5 e;  2EAY A;  1JRI A;  4M77 F;  2DTI A;  3JCM V;  3V8K A;  1KQ1 A;  4M75 D;  4M78 G;  1U1T A;  3HFO A;  3JCM f;  5GAM f;  5GAM e;  4C92 C;  4PNO A;  3JCM e;  4Y91 A;  4WF2 A;  3RIR A;  1TH7 A;  5LJ5 d;  4F7U E;  1B34 A;  3JB9 G;  1LOJ A;  3BDU A;  4M7A B;  2K57 A;  5GAM d;  3JCM d;  2VXF A;  3M4G A;  4C8Q E;  4M77 C;  1LJO A;  4XU0 A;  3FJP A;  4MML A;  4EMK C;  4M75 A;  5GAO p;  4OP0 A;  1I5L A;  2ZGW A;  4M7A F;  5GAN 2;  1HXD A;  1N9S A;  2YLC A;  4J6X A;  4C8Q C;  3L1A A;  4XU2 A;  4PJO A;  2RA2 A;  1M5Q 1;  4N0A A;  4NL2 A;  3QHS A;  2RB6 A;  5LJ3 h;  5GAN 6;  5LJ5 j;  1M8V A;  4XTV A;  5GAN f;  3V8L A;  1BIA A;  5GAO l;  3JB9 J;  2E64 A;  3RES A;  5GAM j;  4EMK B;  4J6W A;  3SWN C;  4C92 A;  3JB9 I;  4M7A C;  5GMK m;  4C8Q D;  5GAN h;  4C8Q B;  4F7U F;  1MGQ A;  4M75 G;  1Y96 B;  4JLI A;  5LJ5 g;  4HT8 A;  1HK9 A;  1WNL A;  4C8Q F;  4M7D E;  3JCM Q;  2DZ9 A;  4M77 A;  4PJO G;  1N9R A;  4EMK A;  4RCC A;  4X9C A;  4HA8 A;  5GAM g;  2CGH A;  3SWN B;  3RKX A;  4NL3 A;  3RER A;  4C8Q A;  4M7D C;  4M7A D;  3JCM c;  4M78 E;  3JCM X;  4A54 A;  4C92 G;  3SB2 A;  4J5Y A;  5LJ3 f;  3HFN A;  2E1H A;  4V2S A;  5LJ3 e;  5GAN j;  2HNI A;  2FB7 A;  4XQ3 A;  5GAO r;  2DEQ A;  3BY7 A;  3SWN A;  5GMK h;  3JCM P;  1YCY A;  3EFR A;  4M7A A;  2Y90 A;  4M7D D;  4M77 G;  4M7D B;  1H64 1;  5LJ3 d;  5CAI A;  3JCM J;  4F7U B;  5GAN e;  4XTZ A;  5GMK l;  4C8Q G;  2EJF A;  5GAN 3;  3JCM b;  4M7D F;  3QSU A;  5GMK i;  3V7C A;  2DJZ A;  4MMK A;  5GAN d;  4XTX A;  2YLB A;  4M7D A;  2DXU A;  1D3B B;  4M78 F;  2EJ9 A;  4F7U A;  5GAN 5;  4QVC A;  2VXE A;  2VC8 A;  2DKG A;  2E10 A;  5LJ3 j;  3JCM g;  4M7A G;  3PGG A;  4XU3 A;  3V8J A;  3JB9 F;  5DY9 A;  4M75 E;  3HSB A; 
#chains in the Genus database with same CATH topology
 1K73 R;  2CDT A;  2E3I A;  3EGD A;  2QA4 T;  2EYX A;  5D6X A;  3A98 A;  3OS0 A;  1QVF A;  3EFO B;  1ZBX A;  4OMO A;  1NJI C;  3CC7 A;  5HK3 A;  5LJ5 h;  1VQ8 T;  1FMW A;  2LCL A;  3VUZ A;  1NYG A;  1O75 A;  2EYW A;  1BI2 A;  2GQI A;  3M0R A;  3OA6 A;  3CCM Q;  3EG9 B;  4OGC A;  4PJO F;  2C0I A;  4XTY A;  3BE3 A;  3JAM E;  3CMA A;  1PM3 A;  3CCL T;  2YT6 A;  1AWJ A;  2CP6 A;  3L42 A;  2KT8 A;  4IIO A;  3OB9 A;  2OTL Q;  1JU5 C;  4JRI A;  4OVA A;  1U1S A;  5DM7 R;  2HQX A;  1KD1 C;  1MV0 B;  2HSP A;  5GAM f;  4RTX A;  1TOV A;  1Q7Y C;  1CKA A;  1B34 A;  3X26 B;  1LOJ A;  4Z88 A;  4IUT A;  1YHQ T;  1Y57 A;  4E7I A;  2D8H A;  1YJN A;  2VKN A;  4LXC A;  1W2B P;  4E7J A;  4KUD K;  1H3H A;  1GCP A;  4DOW A;  3EG9 A;  2AZV A;  2MIO A;  2DVJ A;  2HAX A;  2RQR A;  4RTT A;  1MGQ A;  3T9N A;  4NS5 A;  2RJF A;  4FCY A;  1XOV A;  2DZ9 A;  2YUN A;  3LGF A;  4LNP A;  5CIU A;  3RKX A;  3JCM c;  2RI5 A;  1SPK A;  2DYI A;  3VS4 A;  3OYM A;  4HVV A;  3M53 A;  3CCR Q;  1NJI R;  5LJ3 d;  3MEW A;  4KGX B;  4M7D F;  4JS4 A;  3CBO A;  1O9S A;  2V8I A;  2VWF A;  5FU7 B;  2FZK B;  4JZ4 A;  2XDB A;  1JXO A;  3CCJ A;  2JXB A;  3CPF A;  3RMQ A;  5KYU B;  3RKY A;  1FXX A;  2X4Y A;  4A4E A;  1YWO A;  1R0B G;  1FWZ A;  3J81 E;  3PNW C;  2K3B A;  1IB8 A;  1X01 A;  4E7K A;  1KD1 R;  4CC2 A;  3QO3 A;  1Q7Y R;  2RQW A;  2EPD A;  4QT7 A;  3CD6 Q;  4M75 F;  2CS7 A;  1W70 A;  2KRN A;  5CK9 A;  2HZY A;  3CBP A;  3QZ9 B;  5GAN 4;  5L8R E;  1YJ9 A;  2HQE A;  4C0G A;  3FLG A;  4R0K A;  4KRT A;  2JMC A;  5KYU A;  1KG1 A;  4QVD A;  3EG0 A;  5GAO n;  2KVQ G;  3CQT A;  2PVO B;  2V1R A;  1X2Q A;  2DL3 A;  4M77 F;  4CRI A;  4N4G A;  1VQM T;  2V26 A;  1YWP A;  1PD1 A;  4FYX B;  1KC8 C;  1NM7 A;  3FJP A;  1AVZ C;  5C6S A;  2YLC A;  2QDL A;  4FSS A;  1AD5 A;  2V8J A;  2XIC A;  2K79 A;  1TG0 A;  3H0H A;  3RES A;  1QVG A;  3UA6 A;  1R0C B;  5IXF A;  1YBY A;  1PKT A;  5KCO A;  1MMA A;  3OYA A;  4RCC A;  3FRN A;  4M7A D;  3OMG A;  4M7D C;  2F2X A;  1YI2 T;  1TXQ A;  1AZE A;  3BDL A;  2OTJ A;  4J9F A;  1VQL Q;  2RO0 A;  2FB7 A;  1KQS A;  4MZP A;  3A5Z B;  1WJR A;  5GAN e;  4ZN1 A;  2I0N A;  3A1P A;  1IHW A;  1M30 A;  4HKE A;  3V7C A;  2JM9 A;  4M4Z A;  1K9M U;  4F7U A;  1AZG B;  2XDP A;  1BKB A;  3FEO A;  1QVF S;  2EFI A;  2OX7 A;  4M78 C;  4JJC A;  1S72 A;  2CT4 A;  2K4Y A;  1RAA B;  3CXC S;  4GLM A;  2DXC A;  3REA B;  3RUX A;  5KE2 A;  2J05 A;  5GAN g;  3E9G A;  2HD0 A;  1KC8 R;  3URG A;  4QVZ A;  1FMV A;  1YP5 A;  3G71 Q;  3EG2 A;  4OMF B;  2COY A;  1G3T A;  2E4H A;  3CC7 T;  5KE3 A;  3MJX A;  5IXB A;  1ZSZ C;  1Y7X A;  3VS3 A;  1D0Z A;  2EAY A;  2LQ8 A;  4R56 A;  2JM8 A;  1C0M A;  5D6Y A;  2LDM A;  1Q82 U;  2QDY B;  2LCS A;  2L3S A;  3CMA T;  4BD3 A;  1YIT A;  1UHF A;  3PFS A;  3OS1 A;  2X4X A;  1ZQ1 A;  3CCS T;  2L3P A;  1N9S A;  1KK7 A;  2EYY A;  5LJ3 h;  2J06 A;  2FEI A;  1Q81 C;  4A4H A;  4J6W A;  1JJ2 P;  1ZBJ A;  3CCQ Q;  5I11 A;  3CCE Q;  4F16 A;  2BKD N;  4L59 A;  4BAC A;  1YJN T;  4LDW A;  3C4S A;  5FWC A;  3LH5 A;  4J9B A;  3CCV T;  2QYZ A;  1H92 A;  2JZ2 A;  4DEY A;  2GFU A;  3GLX A;  1K8A C;  1K0X A;  1SSF A;  3CEY A;  3SB2 A;  3HFN A;  5GAN j;  4HVU A;  3OBY A;  1WA7 A;  1UFF A;  4OMM A;  2MAM A;  1NPR A;  2V1Q A;  4R55 A;  1H64 1;  3JCM J;  4IUV A;  3QPH A;  1VQ9 Q;  2CZ0 B;  1WJS A;  2O4X A;  4LN2 A;  4M7D A;  1PRL C;  3H6Z A;  2VXE A;  1QCN A;  2DL4 A;  3CC4 Q;  4YTL A;  1EX4 A;  1UB4 A;  2OI3 A;  3QKJ A;  4JJN K;  2ZPI B;  1SKU B;  3CCJ T;  2D0Q B;  5CKH A;  2LRQ A;  1AT1 B;  3M5A A;  1R77 A;  1QP3 A;  3OW2 A;  2LZ6 B;  3PIP A;  3RKW A;  2PVD B;  1YJW A;  5GMK j;  2RK2 A;  2R58 A;  4M78 A;  1JXM A;  2MK5 A;  1Q81 R;  2ZPB B;  3A8L B;  1YIT Q;  2PQW A;  2J6K A;  3VRZ A;  4P5N A;  1UEC A;  2RQV A;  1SHF A;  4EIK A;  1U1T A;  2M16 A;  1SEM A;  4F7U E;  1GCQ C;  2LCC A;  3C0C A;  3VV0 A;  3ZEH A;  3SFM A;  1OX9 A;  2FPF A;  3PT9 A;  1K8A R;  4KH0 B;  4FU6 A;  4QKU A;  2BE7 D;  4DBH A;  1WHL A;  1PHT A;  4VUB A;  3NPF A;  1ZSZ A;  2O88 A;  2M02 A;  1XQH A;  2OJ2 A;  2DIL A;  3CCU Q;  5GAM j;  2EQK A;  2LJ1 A;  2C06 A;  5IHI A;  4B9W A;  4C0D B;  4BI8 B;  2MF2 A;  2RF0 A;  1W4S A;  1KQS S;  6AT1 B;  1WHH A;  2EGA A;  1M90 C;  2JMA A;  3VKI A;  3PVQ A;  1ZLM A;  1OX8 A;  1WXB A;  1IRX A;  1ZSG A;  1TS9 A;  2P4T A;  2O2O A;  3MEU A;  2R5M A;  3TVT A;  1NEG A;  3JRZ A;  2EW3 A;  2DX1 A;  2WSE E;  2C0T A;  2OTJ T;  2VYT A;  1KJW A;  2QA4 Q;  4XK8 E;  3DLM A;  1HYO A;  1FMK A;  3UWN A;  4RTY A;  3REB B;  1D3B A;  2BTT A;  4RUG A;  4AFZ C;  1N27 A;  2ZAE A;  3N5B B;  2DZC A;  3OSS C;  2L5Q A;  1VQ8 Q;  2DBK A;  2E65 A;  3FIF A;  1BU1 A;  2FRY A;  3G6E T;  2CRE A;  3IQL A;  2KEA A;  1BI3 A;  2CZ1 B;  1W2B A;  3CCL Q;  1OPK A;  2RJE A;  3OBW A;  4K11 A;  3NFC A;  1M1G A;  3KXT A;  3OYN A;  5J39 A;  3KUF A;  3RDV A;  3S3O A;  4N0A C;  2FZG B;  2K2M A;  2ZPF B;  3FB9 A;  3NGP A;  4KBM B;  2G6F X;  1S1N A;  4C5G A;  4JS5 A;  5J26 A;  3JCM e;  1YHQ Q;  2K2V A;  2JTM A;  1ZHI A;  3BDU A;  2HBP A;  1M90 R;  2K5F A;  4XU0 A;  4M7A F;  5GAN 2;  1VQK A;  3L1A A;  2GBQ A;  4EMK B;  1UDL A;  1VQO A;  1GCQ A;  1K76 A;  3VRY A;  4E7S A;  3LLR A;  1SRL A;  4C8Q F;  2L3R A;  4MZM A;  1VOM A;  2NUP A;  4NL3 A;  4M78 E;  1TUD A;  4DBR A;  2PUK B;  1WZO A;  4D6W A;  3EGX A;  1MMD A;  4XQ3 A;  4FYV B;  3JCM P;  1VQ6 T;  2FG0 A;  2A37 A;  4RG8 A;  2KYB A;  4C5H A;  4GLK A;  2CP2 A;  2KE9 A;  2E10 A;  4F04 B;  4XU3 A;  1ARK A;  3WVE B;  3CPW S;  3NTK A;  1RL2 A;  2BZ8 A;  2K9G A;  3CC2 A;  1RAG B;  1RAH B;  4F7U G;  1OV3 A;  1XTD A;  2EJG A;  1WXU A;  2YRD A;  1GL5 A;  2RI3 A;  2MMP A;  3OYJ A;  2CUD A;  2F5T X;  2XG8 D;  1BIB A;  1BYM A;  4DBQ A;  5KCH A;  1UEB A;  4EPC A;  2M0Y A;  1YFN A;  5FW9 A;  3OYD A;  2ZCF B;  2RQU A;  4A4F A;  4C92 F;  2DTO A;  2EBP A;  4JUV A;  3M55 A;  5CR2 A;  1I81 A;  1B34 B;  1BI1 A;  1N5Z A;  3PTA A;  1VQM Q;  1OZ3 A;  1JRI A;  2HEQ A;  4FW2 A;  1YJW T;  2L89 A;  2DD5 A;  2HSE B;  1Q86 U;  1MMG A;  1K9A A;  3MET A;  2KSS A;  3D7S B;  1VYU A;  5GAM d;  2P84 A;  2VXF A;  3VS6 A;  4A4K A;  4MML A;  2X35 A;  4HCK A;  2KMT A;  4KGZ B;  1AWX A;  3QDR B;  1AEY A;  1HXD A;  4C8Q C;  1VIF A;  4NL2 A;  1M5Q 1;  4N0A A;  2ZPG B;  3A8H B;  3O5Z A;  4ZGJ B;  3CCS A;  2Z0W A;  4HVW A;  4RG2 A;  3LGL A;  5FU6 B;  2JS0 A;  3J80 E;  1KIK A;  2KDS A;  3I5S A;  2PUO B;  1YI2 Q;  3CME Q;  3QBY A;  1Q95 G;  3QWX X;  2KXC A;  2WSC E;  4Z02 A;  2KXD A;  4II1 A;  2DBM A;  3CCV A;  4L5G A;  5GAO r;  1QLY A;  1U5S A;  3EFR A;  1OOT A;  3G4S A;  2CUB A;  1M1K C;  1YIJ T;  3F70 A;  1IHV A;  1UHC A;  3C95 A;  4IKF A;  2VC8 A;  1OEB A;  2LC4 A;  2MWP A;  2J7I A;  3OYE A;  2EIF A;  2DTH A;  4BY6 C;  1JBM A;  2EWN A;  4LDY A;  3J7A F;  1VQ5 A;  1M9S A;  5KYY A;  1KSW A;  1VQ7 A;  2DK3 A;  4Y92 A;  3RBB B;  2IPO B;  2PVG B;  3V7S A;  1K0S A;  1GXI E;  1D1A A;  1WXT A;  1W2B S;  2OAU A;  2DEU A;  5I2M A;  4HT9 A;  2MOX A;  2W0Z A;  3MP1 A;  2H3J A;  3S3N A;  1D0Y A;  1BBZ A;  3CC7 Q;  1T3S A;  2D6F A;  1OUL A;  2LQW A;  4ZNX A;  4J6Y A;  2QQ9 A;  1U8R A;  2KK4 A;  4PJO C;  1JJ2 A;  1M3B A;  7AT1 B;  5LJ5 e;  5HCK A;  2QQA A;  3V8K A;  2H8H A;  4M78 G;  3E2U A;  3CMA Q;  4JDS A;  1XNI A;  1X6O A;  2QQS A;  2K57 A;  1QKX A;  3EH1 A;  2FO0 A;  1WHG A;  5CQX A;  2O9S A;  3TSZ A;  4ELY C;  2QXF A;  8ATC B;  2QK0 A;  2EQM A;  1M1K R;  3MPU B;  1R8O B;  4LDU A;  1YJN Q;  2HL5 C;  1YCS B;  5LJ5 g;  1VQK T;  4RTV A;  2GFA A;  3E9F A;  4MDX A;  5AYF A;  1RLP C;  3RER A;  4C8Q A;  2RHY A;  4JJB A;  3VS7 A;  2FVU A;  4PLL A;  5KYN A;  3H41 A;  3M0Q A;  2FPD A;  4J5Y A;  4OB0 B;  1G5V A;  2KRO A;  4JPB W;  3GOX A;  2B86 A;  2CSI A;  3DLL A;  2L2P A;  3TCJ A;  2DLP A;  1VQO T;  2J6O A;  5GMK h;  4ORZ A;  3ASK A;  2LNH B;  3VS2 A;  4F7U B;  5GMK l;  1EIF A;  1GFC A;  1OQK A;  3QYH B;  4RTW A;  1SRM A;  2DJZ A;  1E6H A;  4Z8A A;  2CH4 A;  3E1S A;  1VIE A;  1UGV A;  1OU9 A;  3TQ7 P;  1RAC B;  1I1J A;  3DB4 A;  4E7L A;  2QG9 B;  2AHJ B;  5IH2 A;  1YNZ A;  2OTL T;  3MP6 A;  3CCJ Q;  2BE9 B;  3CBM A;  3CXC P;  2E41 A;  5GAM h;  4FYY B;  4PJO B;  3MEV A;  1WPY A;  4DQ2 A;  3UAT A;  3EFS A;  4EMG A;  3CC2 T;  3RR6 A;  2FHD A;  4JLG A;  2HCK A;  1X6G A;  4M75 C;  2JS2 A;  3G6E A;  3GBQ A;  2VB6 A;  5GJW B;  4OB2 B;  2DET A;  2CYZ B;  2CP5 A;  2XMF A;  3JCM f;  4RKU E;  1YJ9 Q;  2ZPH B;  3JB9 G;  1BI0 A;  3O8V A;  5J3B A;  5FRM A;  4HCC A;  4M77 C;  3TEE A;  2O9V A;  1PC0 A;  1I5L A;  4PFZ A;  5EC7 A;  1GRI A;  4ZGD B;  4PJO A;  5GAN 6;  3HP9 A;  3VS1 A;  1M8V A;  2AKK A;  3C12 A;  5A2Q E;  3OYI A;  1QWE A;  2E64 A;  3SWN C;  1ACM B;  1IGQ A;  2EGE A;  5GMK m;  2DL7 A;  3HRS A;  1E7O A;  2IVW A;  2YUO A;  4TVR A;  4E6R A;  5IT9 E;  2E5Q A;  2JTF A;  2QQB A;  3GPL A;  4V2S A;  2HNI A;  2WAC A;  1K4U S;  1M27 C;  2FPE A;  2O4X B;  3DKM A;  5HKC A;  4M7D B;  3I56 A;  2OTJ Q;  1V76 A;  1VQ6 A;  2DXU A;  2X3X D;  1G2B A;  2EJ9 A;  4ATO A;  2M1H A;  1OYX A;  2ROT A;  3V8J A;  3LW5 E;  2DL5 A;  4ZTJ A;  3QUI A;  3QJ6 A;  3G4S T;  1ZX6 A;  5CCA A;  2JN0 A;  2HKN A;  4AMC A;  1QW1 A;  3V7R A;  4LDX A;  2L8D A;  2D0N A;  5GAO q;  4ANJ A;  4M75 B;  2G3R A;  4M78 B;  1X6B A;  2KI7 A;  2FYK A;  3G6E Q;  4PJO D;  1S72 Q;  4OGE A;  1MV3 A;  3SD4 A;  2K5L A;  3PMI A;  2GTO A;  1RLQ C;  1VQ5 T;  4A63 B;  3WVD B;  1VQ7 T;  5A0G A;  1JJ2 S;  1WQW A;  1WHM A;  1VUB A;  3L2R A;  2X9H A;  4M77 B;  2KYM A;  1Q81 U;  2SRC A;  2EQI A;  2AT1 B;  2YXY A;  4QQG A;  2DTI A;  2K5I A;  2RI2 A;  2KRM A;  1M2O A;  4WF2 A;  2KAF A;  2MYS A;  4FW1 A;  1ZSZ B;  2QGF B;  3MP8 A;  2YRV A;  1Z9Z A;  4M75 A;  2KR3 A;  2ZPE B;  3OSV A;  1IZ6 A;  1QMC A;  2DXB A;  2ATC B;  3V8L A;  2RMO A;  1SF9 A;  1N8R U;  1G3S A;  3UPU A;  1BB9 A;  1ZA1 B;  3QYG B;  1I0C A;  4M77 A;  2YUP A;  3AT1 B;  2YSQ A;  4J83 A;  4CC3 A;  5LJ3 e;  4PJJ A;  3EG1 A;  2A7Y A;  3SWN A;  1QVG S;  1KFZ A;  4M7D D;  5IHN A;  1PCX A;  1IXD A;  1NG2 A;  1EFN A;  1M2V A;  4XTZ A;  4OMN A;  1UGP B;  3PIO A;  3QSU A;  2YLB A;  2DE0 X;  2JTE A;  1D3B B;  1U3O A;  3G1J A;  3M0U A;  2RH2 A;  3MEA A;  4J9D A;  1YIJ A;  2O01 E;  4PJO E;  4J9G A;  1NPP A;  2E6Z A;  1PD0 A;  2QGG A;  5LJ3 g;  1C6V X;  1PRM C;  1I07 A;  2RQT A;  3VS5 A;  1BK2 A;  5IN1 A;  3I9Q A;  4M78 D;  4E7Z A;  2KY9 A;  2FRW A;  3TSW A;  2CKK A;  2JOY A;  1T3L A;  3X28 B;  1RUW A;  4RTU A;  2EKO A;  4J7I A;  5GJV B;  4C0Z A;  1QKW A;  2M0O A;  2W10 A;  4XU1 A;  4E7H A;  1QP2 A;  1CSK A;  4LE9 A;  3HL8 A;  1D09 B;  3I35 A;  2LP5 A;  3OYH A;  3S3M A;  4RTZ A;  4OB3 B;  5DLO A;  4M77 D;  2ROL A;  3M57 A;  2RHZ A;  5LJ5 f;  1E6G A;  4O6J A;  1YJW Q;  2JVV A;  2DIG A;  4FIB A;  1WJQ A;  3CCQ T;  3I55 A;  3ULR B;  1ZUY A;  4RMO A;  3EAE A;  4GY5 A;  3M4G A;  2CSQ A;  3X20 B;  4J6X A;  4KH1 B;  1VQP A;  1QVP A;  3H9N A;  1VQ4 A;  4XU2 A;  2RA2 A;  1D1B A;  2GQV A;  4DOV A;  1DJ7 B;  4J7F A;  4DBF A;  2NUP B;  2MWO A;  2ESW A;  5CO7 A;  1RAE B;  2RHI A;  2EVR A;  1PSF A;  5IAY A;  3P8D A;  4HCZ A;  4J9H A;  4M7D E;  3EGX B;  3NTH A;  4HA8 A;  2K7A A;  1T0H A;  1ZUU A;  3DB3 A;  3P8B B;  4CC7 A;  1X43 A;  2LJ0 A;  3JCM X;  5AT1 B;  2SEM A;  3CC4 T;  4AG2 C;  3MCA B;  3OS2 A;  4KUL A;  4PFO A;  3HTR A;  3ER0 A;  1AWO A;  3P8H A;  1QQJ A;  1IGU A;  2P0Q A;  2M9U A;  2QAZ A;  2LVM A;  4C8Q G;  4HXJ A;  2XKO C;  1XJW B;  5GAN d;  4XTX A;  2D1X A;  1G3W A;  5C0M A;  5GAN 5;  1OZ2 A;  3JCM g;  4M75 E;  1WIE A;  3OS5 A;  1WHJ A;  1HJD A;  3I56 T;  4JRK A;  1X75 C;  4E2F B;  3KBG A;  3QG1 A;  2O31 A;  3KFV A;  2LX9 A;  3OQ5 A;  3CPW P;  2X51 A;  4MZT A;  5GAN 7;  2HKQ B;  2NUT A;  2OTL A;  4M77 E;  4Z89 A;  3JB9 D;  4IIM A;  1A0N B;  2OAW A;  3LWI A;  3SDZ A;  1MHN A;  5I22 A;  3FC3 A;  1RI0 A;  1UUE A;  5CQY A;  4L6V 5;  1K73 U;  4B6M A;  1QCF A;  1I8F A;  2DJQ A;  2L3Q A;  4OF1 A;  1Q86 C;  3OW2 S;  4PNO A;  3OY9 A;  2NUZ A;  4Y91 A;  1HSQ A;  1PWT A;  3HKS A;  4HCB A;  3L2W A;  3NHN A;  2COZ A;  1NLO C;  2IG0 A;  3E19 A;  3JSC A;  4J9E A;  1UJ0 A;  1WDX A;  2J6F A;  2RJC A;  3QHS A;  2E3H A;  3JV3 A;  4LUE A;  4J8O A;  2YUQ A;  3S6W A;  2DA9 A;  4PL6 A;  4M7A C;  2QAS A;  4F7U F;  1QWF A;  2FL7 A;  1VQK Q;  2CP3 A;  1WNL A;  2F2V A;  4PJO G;  4LUD A;  2AIR B;  3A8G B;  3QII A;  2JUF A;  2NYS A;  1I5O B;  3R6O A;  1D1C A;  4QQD A;  1ABQ A;  1VQO Q;  3M0P A;  2P4R A;  5FU7 C;  1UTI A;  2Y90 A;  1MUZ A;  3M0S A;  4BE0 A;  4KUI A;  2ENM A;  2PZ1 A;  3CXC A;  5GMK i;  1RAD B;  4MMK A;  3HHT B;  1UJY A;  1X27 A;  1K1Z A;  4Y28 E;  3ME9 A;  2QTV A;  5FWB A;  5KYY B;  2LJ3 A;  4NOY A;  3CD6 A;  4WCI A;  2A28 A;  4A53 A;  5EG2 A;  1RAB B;  1Q86 R;  3QXE B;  2RM4 A;  4XTW A;  1NJI U;  4J9C A;  2DYB A;  1D0X A;  2F5K A;  2GGR A;  3EFO A;  1LCK A;  2X3W D;  4LDV A;  1JEG A;  3CC2 Q;  1M3C A;  4GBQ A;  3SHW A;  2HMA A;  4EMH A;  4DA4 A;  1VQN T;  1KHI A;  1JB0 E;  5KYW B;  1VYT A;  4X9D A;  1BCM A;  4M7D G;  3TRE A;  4C5E A;  2LQK A;  3PE0 A;  1PSE A;  1KD1 U;  4C92 C;  3RIR A;  1UE9 A;  1GBR A;  3M58 A;  1Q7Y U;  3PMT A;  4FYW B;  4M7A B;  2LMJ A;  2VGM A;  4FT4 A;  1U06 A;  5L23 A;  4OB1 B;  1B7T A;  3OYK A;  2R5A A;  2M51 A;  2LTO A;  5GAO l;  1BIA A;  5CVI A;  3I55 T;  1NLP C;  4BI4 A;  1MMN A;  5GAN h;  1UGS B;  1VQL A;  4C8Q B;  1M1K U;  5KYW A;  2CZ7 B;  3FDR A;  3GNG A;  4M75 G;  2DRK A;  2HDA A;  1F1B B;  5HK0 A;  2VVK A;  1N9R A;  2MPX C;  1VQP T;  4C0F A;  1VQ4 T;  3CCS Q;  2AK5 A;  2QEX T;  5LJ3 f;  2E1H A;  2JNG A;  3VS0 A;  5I2S A;  2DEQ A;  3M0T A;  4M7A A;  2YRC A;  4M77 G;  5IHK A;  2MI6 A;  2XK0 A;  3HRT A;  5LL6 S;  4AFS C;  5A0L A;  2K6D A;  3EG3 A;  9ATC B;  1C1A A;  3CCV Q;  2DRM A;  4OMP A;  4PFP A;  2RHX A;  4M78 F;  2GCX A;  2E12 A;  1NE8 A;  2BUD A;  4XAX B;  2DL8 A;  3G4S Q;  1RAI B;  5M9O A;  4CC4 B;  1KQ2 A;  4ZTF A;  3OYL A;  5HY6 A;  1NBE B;  1TUC A;  3OYY A;  3L2Z A;  4BI3 A;  3INZ A;  3HRU A;  3G71 A;  2BZY A;  1AHJ B;  2KRS A;  3ZL7 C;  5DLQ E;  1V1C A;  4N4I A;  4BY6 B;  5GAN 8;  1K9M C;  5ECA A;  2CP7 A;  1VQ5 Q;  2H3E B;  3VU3 C;  1VQ7 Q;  3G7Z A;  1LNX A;  4C92 B;  5FLX E;  3CCM T;  4IUQ A;  4ELZ C;  3JCM W;  2DVE A;  3PVL A;  2DXT A;  1WGS A;  2JJ9 A;  4PLI A;  1QVF P;  5GAO m;  3QJY A;  2E6N A;  3JCM V;  2A3L A;  1KQ1 A;  2KQW A;  5D7U A;  3HFO A;  1TU0 B;  1Y07 A;  2FZC B;  1TH7 A;  3CME T;  3JCM d;  1KC8 U;  2ECZ A;  3CCQ A;  1HD3 A;  1VA7 A;  3CCE A;  3MHX A;  3LYI A;  2X4J A;  5CKF A;  4AFU C;  3L2Q A;  1EZZ B;  3EGU A;  2RJD A;  1B3Q A;  5LJ5 j;  1LVK A;  2NWM A;  4C92 A;  1OPL A;  2LNV A;  4C8Q D;  5CKD A;  1Q82 C;  1FX7 A;  2XD0 A;  1QCO A;  4KGV B;  2K3X A;  4JJD A;  2PU9 B;  3A8O B;  4ZGE B;  3WXM B;  3Q1J A;  1VQ9 A;  4PJL A;  1W1F A;  3RMS A;  1G3Y A;  1M1F A;  4D8K A;  4B9X A;  1CKB A;  1G8X A;  2LT1 A;  1ZUK A;  3BY7 A;  2A0F B;  2D9T A;  3CC4 A;  2EQJ A;  3CCR T;  5D6W A;  5GAN 3;  3JCM b;  1K9M R;  1Z9Q A;  1RAF B;  4BE1 A;  2X4W A;  1FYN A;  2MCN A;  3OMC A;  2DKG A;  3VYH B;  2Y4X A;  3ZFJ A;  3H0I A;  4PJM A;  3JB9 F;  3GF5 A;  1TTH B;  3I5R A;  1GFD A;  5GMK e;  3UF4 A;  3EHR A;  3JB9 H;  2YHT A;  1SG5 A;  3GIB A;  2RN8 A;  1I4K 1;  4JRP A;  1MND A;  2KNB B;  4MDW A;  3VJP A;  1IO6 A;  2PNI A;  2RD1 A;  3CD6 T;  4OMQ A;  2QTX A;  4C92 D;  2LQN A;  4J9I A;  3M59 A;  2VUB A;  1NYF A;  2VV5 A;  1NEB A;  2DD4 A;  3SEM A;  3C94 A;  2C0O A;  4AG1 C;  3THK A;  2XI9 A;  4M7A E;  2PTK A;  3X24 B;  1WFW A;  1RI9 A;  3BFM A;  1Q82 R;  1SHG A;  2RHU A;  2KT1 A;  1ZA2 B;  2GNC A;  4N4H A;  2V8K A;  5GAM e;  4F17 A;  1OU8 A;  1VYV A;  2EYQ A;  3CCU A;  1SSH A;  2CZ6 B;  3VUB A;  4C8Q E;  5GAO p;  1PKS A;  4IUR A;  4OP0 A;  1T0J A;  2RB6 A;  3M56 A;  4C0D C;  2P0P A;  1AWW A;  1N8R C;  2AKL A;  2XDD A;  3UA7 A;  1WHK A;  2DMO A;  3JB9 I;  4BDZ A;  4ESR A;  4JLI A;  2RK1 A;  4EDU A;  4BE2 A;  1X2K A;  2R57 A;  3QWY A;  2DAQ A;  5GAM g;  2CGH A;  4DEX A;  3SWN B;  1M2V B;  4BB7 A;  5CKB A;  1K8A U;  4FT2 A;  3OYF A;  2DPP B;  1VQL T;  4X1V A;  3NTI A;  2JW4 A;  3CPW A;  1LPL A;  3MKD A;  2ZZD A;  5CAI A;  2QA4 A;  2WSF E;  2QQR A;  1X69 A;  2Y4Y A;  4LD9 K;  2IIM A;  1QVG P;  2EKH A;  3L2V A;  3NMZ C;  2LT4 A;  4X34 A;  2EYZ A;  4AT1 B;  1OI1 A;  8AT1 B;  5CKE A;  1VQ8 A;  3I56 Q;  4F14 A;  3HSB A;  3R6N A;  2LX7 A;  1TWB A;  4XTU A;  1VQ6 Q;  1H8K A;  1UG1 A;  1KQS P;  4C92 E;  1TSF A;  3CCL A;  4RCB A;  3UDC A;  1V29 B;  2BIV A;  4A4G A;  2YDL A;  3JCM h;  5FRN A;  1YJ9 T;  3VYG A;  2VAS A;  1M8M A;  2GTJ A;  1G83 A;  2BZX A;  4ME7 A;  4JRQ A;  1P92 A;  5A0D A;  1WLP B;  3G71 T;  1ABO A;  1YHQ A;  3LX7 A;  1N8R R;  2E5K A;  1PG5 B;  3HPW A;  2HL3 A;  1VQN A;  4FL6 A;  4Q5W A;  5KYX B;  2P0K A;  2B8A A;  4M75 D;  4D8D A;  1B07 A;  3FJ5 A;  4PKC C;  4PJN A;  5LJ5 d;  1M3A A;  2EQU A;  1LJO A;  2VGN A;  2JT4 A;  3M54 A;  4EMK C;  4AFQ C;  2ZGW A;  2RPN A;  2KGT A;  1JQQ A;  3OYG A;  3GNF B;  1M4Z A;  2XID A;  3JB9 J;  2DFU A;  1WI7 A;  2CT3 A;  2HBW A;  1WYX A;  3OYC A;  1MNE A;  2AZS A;  1Y96 B;  4HT8 A;  4BDY A;  4WTO B;  1HK9 A;  2ED1 A;  3CCE T;  3JCM Q;  4X9C A;  1AOJ A;  2DER A;  2HQH A;  5KYX A;  3EH2 A;  3LWH A;  4A54 A;  1WX6 A;  1N6A A;  1IRE B;  1M90 U;  3M9Q A;  2QEX A;  2F2W A;  1JO8 A;  4JZ3 A;  1VQ9 T;  2DNU A;  4QVC A;  1S72 T;  4BUG A;  5LJ3 j;  4M7A G;  1UGQ B;  2DF6 A;  4FSX A;  2DM1 A;  3AHU A;  1Y96 A;  1Y0M A;  2K3Y A;  4UC4 A;  2NUT B;  1WQ7 A;  4PK4 A;  1YIJ Q;  5I21 A;  1H3Z A;  1Y71 A;  2DO3 A;  3OYB A;  4ZN3 A;  1VQN Q;  2COW A;  1GBQ A;  1VQM A;  2XHC A;  3BW1 A;  3H0F A;  2A08 A;  2XU8 A;  1K73 C;  3L2U A;  2A36 A;  2I2L A;  3QDF A;  3CCM A;  3LH0 A;  1YIT T;  3A8M B;  3EHQ A;  4FM4 B;  4LD6 A;  3M4Y A;  3GP8 A;  2E70 A;  1W6X A;  1UGR B;  3RNJ A;  2NLU A;  3OW2 P;  2F69 A;  2ED0 A;  5FU6 C;  2YWW A;  3CME A;  1YI2 A;  3I55 Q;  4XTV A;  1J3T A;  5GAN f;  3ZBD A;  4QQ6 A;  3TU4 K;  5FRO A;  4IUP A;  3CCU T;  1BCO A;  4OML A;  4QW2 A;  3EGD B;  3QZ5 B;  2ABL A;  1VQP Q;  1NZ9 A;  1VQ4 Q;  1KHC A;  3UT1 A;  4IUU A;  3H8Z A;  4EMK A;  2QEX Q;  4E47 A;  2DIQ A;  1YN8 A;  2D8J A;  3U23 A;  4CI0 C;  3X25 B;  4C92 G;  5KH6 A;  1TUG B;  2KBT A;  1YCY A;  2F1L A;  4KT0 E;  3MO8 A;  4O5V A;  2RNA A;  2EJF A;  4C5I A;  2L0A A;  2CH4 W;  1PNJ A;  2EGC A;  2QI2 A;  2GF7 A;  3CCR A;  3PGG A;  5DY9 A;  2CP0 A; 
#chains in the Genus database with same CATH homology
 3QUI A;  3UWN A;  2QA4 T;  3QJ6 A;  1KQ2 A;  3G4S T;  1D3B A;  4ZTF A;  3OYL A;  5D6X A;  5HY6 A;  5CCA A;  1N27 A;  2JN0 A;  3OS0 A;  1QVF A;  3OYY A;  3N5B B;  3L2Z A;  2DZC A;  1QW1 A;  3OSS C;  4BI3 A;  1ZBX A;  2L5Q A;  3HRU A;  3INZ A;  3V7R A;  3G71 A;  2L8D A;  4LDX A;  5GAO q;  1NJI C;  1AHJ B;  2E65 A;  3FIF A;  3CC7 A;  5HK3 A;  5LJ5 h;  4M75 B;  2G3R A;  5DLQ E;  1VQ8 T;  4M78 B;  2LCL A;  4N4I A;  4BY6 B;  3VUZ A;  5GAN 8;  2FYK A;  1K9M C;  4PJO D;  1O75 A;  4OGE A;  1BI2 A;  3SD4 A;  3G6E T;  2K5L A;  3PMI A;  3OA6 A;  3VU3 C;  1BI3 A;  4OGC A;  4PJO F;  2CZ1 B;  1W2B A;  4XTY A;  3G7Z A;  1LNX A;  4C92 B;  5FLX E;  1VQ5 T;  2RJE A;  3OBW A;  3WVD B;  4IUQ A;  3JAM E;  3CMA A;  3NFC A;  3CCM T;  5A0G A;  3CCL T;  1VQ7 T;  4ELZ C;  1JJ2 S;  3L42 A;  1WQW A;  3JCM W;  1M1G A;  2DVE A;  1VUB A;  3OB9 A;  3KXT A;  4JRI A;  3OYN A;  5J39 A;  3KUF A;  3L2R A;  2DXT A;  1WGS A;  1U1S A;  4M77 B;  4OVA A;  3S3O A;  4N0A C;  4PLI A;  2ZPF B;  3FB9 A;  5DM7 R;  5GAO m;  1Q81 U;  3QJY A;  4KBM B;  2E6N A;  2HQX A;  4QQG A;  3JCM V;  2DTI A;  1KD1 C;  2A3L A;  4C5G A;  1KQ1 A;  2KQW A;  2K5I A;  5GAM f;  4JS5 A;  3HFO A;  2RI2 A;  5J26 A;  3JCM e;  1Y07 A;  4WF2 A;  5DY9 A;  2KAF A;  1Q7Y C;  1TH7 A;  1B34 A;  2K2V A;  3X26 B;  1LOJ A;  2JTM A;  1ZHI A;  3BDU A;  2HBP A;  4IUT A;  3CME T;  1YHQ T;  3JCM d;  3MP8 A;  2YRV A;  1KC8 U;  2K5F A;  4XU0 A;  4E7I A;  4M75 A;  1YJN A;  3CCQ A;  2ZPE B;  3OSV A;  3MHX A;  3CCE A;  5GAN 2;  1VQK A;  3LYI A;  4M7A F;  2X4J A;  5CKF A;  4E7J A;  4KUD K;  1IZ6 A;  3L1A A;  3L2Q A;  2DXB A;  2RJD A;  5LJ5 j;  3V8L A;  4DOW A;  4EMK B;  4C92 A;  1N8R U;  2LNV A;  1G3S A;  4C8Q D;  5CKD A;  1Q82 C;  2HAX A;  1VQO A;  1FX7 A;  1MGQ A;  3T9N A;  3UPU A;  2XD0 A;  3QYG B;  2RJF A;  4NS5 A;  2K3X A;  3LLR A;  4C8Q F;  1XOV A;  2DZ9 A;  2L3R A;  3LGF A;  4M77 A;  4MZM A;  5CIU A;  2PU9 B;  4J83 A;  3RKX A;  3A8O B;  4ZGE B;  3WXM B;  3Q1J A;  4NL3 A;  3JCM c;  4ZTJ A;  1VQ9 A;  4M78 E;  3RMS A;  2PUK B;  1G3Y A;  1M1F A;  2RI5 A;  5LJ3 e;  4D6W A;  4B9X A;  4XQ3 A;  3OYM A;  2LT1 A;  3M53 A;  3BY7 A;  3SWN A;  2A7Y A;  1QVG S;  3JCM P;  1VQ6 T;  4M7D D;  2D9T A;  5LJ3 d;  3CC4 A;  4XTZ A;  2EQJ A;  3MEW A;  3CCR T;  5D6W A;  5GAN 3;  3JCM b;  4RG8 A;  4M7D F;  1UGP B;  3PIO A;  4JS4 A;  3QSU A;  3CBO A;  4C5H A;  4BE1 A;  4GLK A;  1O9S A;  2X4W A;  2YLB A;  2V8I A;  5FU7 B;  1D3B B;  2XDB A;  3OMC A;  3CCJ A;  2DKG A;  2E10 A;  3VYH B;  2Y4X A;  3CPF A;  4XU3 A;  2RH2 A;  3MEA A;  3RMQ A;  3ZFJ A;  1YIJ A;  3JB9 F;  3WVE B;  3RKY A;  1FXX A;  3GF5 A;  2X4Y A;  4A4E A;  3CPW S;  2O01 E;  4PJO E;  3NTK A;  1RL2 A;  5GMK e;  1NPP A;  2E6Z A;  1FWZ A;  3J81 E;  3JB9 H;  3PNW C;  3CC2 A;  5LJ3 g;  1X01 A;  4E7K A;  4F7U G;  2YHT A;  1XTD A;  3GIB A;  2EJG A;  5IN1 A;  1I4K 1;  3QO3 A;  4JRP A;  2RI3 A;  4M78 D;  2KY9 A;  2MMP A;  4MDW A;  3VJP A;  3OYJ A;  2CKK A;  2F5T X;  2XG8 D;  2CS7 A;  4M75 F;  2JOY A;  1BIB A;  2RD1 A;  3X28 B;  1BYM A;  2EKO A;  5KCH A;  1UEB A;  3CD6 T;  4J7I A;  4EPC A;  5CK9 A;  4C0Z A;  2M0O A;  2QTX A;  3CBP A;  4C92 D;  3QZ9 B;  3M59 A;  4XU1 A;  2VUB A;  4E7H A;  1QP2 A;  2VV5 A;  3OYD A;  3HL8 A;  5GAN 4;  2DD4 A;  2ZCF B;  5L8R E;  2HQE A;  3OYH A;  1YJ9 A;  4C0G A;  3C94 A;  4A4F A;  3S3M A;  4C92 F;  2XI9 A;  2DTO A;  3FLG A;  4OB3 B;  4JUV A;  4M77 D;  5DLO A;  4M7A E;  3M55 A;  5CR2 A;  1I81 A;  3X24 B;  3M57 A;  2RHZ A;  1B34 B;  1BI1 A;  4QVD A;  1KG1 A;  3BFM A;  5LJ5 f;  5GAO n;  4O6J A;  2KVQ G;  2RHU A;  3PTA A;  1OZ3 A;  2JVV A;  1JRI A;  2PVO B;  4M77 F;  4CRI A;  2DIG A;  4FIB A;  4N4H A;  4N4G A;  2V8K A;  1VQM T;  1YJW T;  2L89 A;  5GAM e;  2DD5 A;  1WJQ A;  3CCQ T;  1Q86 U;  3I55 A;  2EYQ A;  3MET A;  1KC8 C;  3CCU A;  4RMO A;  3EAE A;  2KSS A;  2CZ6 B;  3VUB A;  4GY5 A;  5GAM d;  2VXF A;  3M4G A;  4C8Q E;  4A4K A;  5GAO p;  3FJP A;  2X35 A;  4MML A;  2KMT A;  4IUR A;  4OP0 A;  3QDR B;  3X20 B;  5C6S A;  1HXD A;  2YLC A;  4J6X A;  4C8Q C;  1VQP A;  1QVP A;  1VIF A;  1VQ4 A;  4XU2 A;  2RA2 A;  1M5Q 1;  2GQV A;  4N0A A;  4NL2 A;  2RB6 A;  2ZPG B;  3A8H B;  3M56 A;  2P0P A;  4C0D C;  4DOV A;  4ZGJ B;  1DJ7 B;  2V8J A;  2XIC A;  1N8R C;  3CCS A;  2XDD A;  3RES A;  4J7F A;  3JB9 I;  4BDZ A;  1QVG A;  2MWO A;  1YBY A;  4RG2 A;  5CO7 A;  5KCO A;  3LGL A;  4JLI A;  5FU6 B;  3J80 E;  2RHI A;  5IAY A;  1PSF A;  2RK1 A;  3P8D A;  2KDS A;  4EDU A;  4HCZ A;  4BE2 A;  4M7D E;  3OYA A;  2PUO B;  2R57 A;  4RCC A;  2DAQ A;  3FRN A;  3NTH A;  2CGH A;  3QBY A;  4HA8 A;  5GAM g;  3SWN B;  4M7A D;  3OMG A;  4M7D C;  1YI2 T;  3DB3 A;  3P8B B;  3JCM X;  3BDL A;  3CC4 T;  4BB7 A;  2OTJ A;  2WSC E;  5CKB A;  1K8A U;  4Z02 A;  3MCA B;  3OS2 A;  2RO0 A;  4II1 A;  2FB7 A;  4KUL A;  4FT2 A;  3CCV A;  3OYF A;  2DPP B;  3ER0 A;  4L5G A;  3NTI A;  4MZP A;  5GAO r;  1KQS A;  1VQL T;  3P8H A;  3CPW A;  3EFR A;  2P0Q A;  3A5Z B;  2ZZD A;  2M9U A;  5CAI A;  1WJR A;  3G4S A;  5GAN e;  2QA4 A;  2WSF E;  2LVM A;  4C8Q G;  1M1K C;  2QQR A;  2Y4Y A;  4LD9 K;  4ZN1 A;  2XKO C;  1YIJ T;  3F70 A;  4HKE A;  3V7C A;  5GAN d;  4XTX A;  3L2V A;  3C95 A;  2LT4 A;  1G3W A;  5C0M A;  1K9M U;  4IKF A;  4F7U A;  4X34 A;  5GAN 5;  1OI1 A;  1OZ2 A;  2XDP A;  2VC8 A;  3JCM g;  5CKE A;  1VQ8 A;  2LC4 A;  1BKB A;  4M75 E;  2MWP A;  3FEO A;  3OYE A;  3HSB A;  2EIF A;  1QVF S;  3OS5 A;  2DTH A;  3I56 T;  4JRK A;  1X75 C;  2EFI A;  3KBG A;  4M78 C;  4XTU A;  4BY6 C;  1S72 A;  1JBM A;  2EWN A;  3QG1 A;  4LDY A;  3OQ5 A;  2LX9 A;  3J7A F;  2K4Y A;  1VQ5 A;  1M9S A;  3CXC S;  4C92 E;  1VQ7 A;  2DK3 A;  2DXC A;  4RCB A;  3RUX A;  3UDC A;  3CCL A;  5KE2 A;  4MZT A;  5GAN 7;  1V29 B;  2PVG B;  3V7S A;  2BIV A;  5GAN g;  1GXI E;  3E9G A;  2HD0 A;  4A4G A;  1W2B S;  2OTL A;  2OAU A;  4M77 E;  3JCM h;  3URG A;  4QVZ A;  5I2M A;  5FRN A;  3JB9 D;  1YJ9 T;  3VYG A;  4HT9 A;  3MP1 A;  2H3J A;  3LWI A;  3S3N A;  3SDZ A;  1MHN A;  4ME7 A;  4JRQ A;  3FC3 A;  4OMF B;  1P92 A;  1RI0 A;  2D6F A;  5A0D A;  3G71 T;  5CQY A;  1G3T A;  4L6V 5;  1YHQ A;  3CC7 T;  3LX7 A;  4J6Y A;  5KE3 A;  1K73 U;  2QQ9 A;  1U8R A;  1I8F A;  2KK4 A;  1Y7X A;  3HPW A;  1VQN A;  4PJO C;  1JJ2 A;  4FL6 A;  4Q5W A;  5LJ5 e;  2EAY A;  2LQ8 A;  4R56 A;  2QQA A;  2P0K A;  5D6Y A;  4OF1 A;  2LDM A;  2B8A A;  4M75 D;  4M78 G;  3V8K A;  3OW2 S;  1Q82 U;  1Q86 C;  4PNO A;  4JDS A;  3OY9 A;  4Y91 A;  4PKC C;  2QDY B;  1XNI A;  5LJ5 d;  1X6O A;  2QQS A;  3CMA T;  4BD3 A;  3HKS A;  1YIT A;  3PFS A;  2EQU A;  2K57 A;  3OS1 A;  3L2W A;  4HCB A;  1LJO A;  2VGN A;  2X4X A;  3M54 A;  4EMK C;  1ZQ1 A;  3CCS T;  2IG0 A;  5CQX A;  2ZGW A;  3E19 A;  1N9S A;  3JSC A;  4ELY C;  2QXF A;  2RJC A;  5LJ3 h;  3OYG A;  3QHS A;  3GNF B;  1M4Z A;  1Q81 C;  4A4H A;  2XID A;  2EQM A;  3JB9 J;  4J8O A;  3S6W A;  4J6W A;  1R8O B;  4PL6 A;  4M7A C;  4LDU A;  4F7U F;  3OYC A;  1Y96 B;  2FL7 A;  5LJ5 g;  2BKD N;  4L59 A;  4BAC A;  1HK9 A;  4BDY A;  1WNL A;  1YJN T;  4LDW A;  4HT8 A;  3C4S A;  3JCM Q;  3CCE T;  4PJO G;  1VQK T;  2GFA A;  3E9F A;  4X9C A;  3CCV T;  3A8G B;  4MDX A;  2JZ2 A;  3QII A;  5AYF A;  2JUF A;  4C8Q A;  3RER A;  2RHY A;  2GFU A;  3GLX A;  3LWH A;  1K8A C;  2FVU A;  4PLL A;  4A54 A;  1SSF A;  3CEY A;  3R6O A;  4J5Y A;  1N6A A;  3HFN A;  4OB0 B;  4QQD A;  3SB2 A;  5GAN j;  1G5V A;  1IRE B;  3GOX A;  1M90 U;  3OBY A;  3DLL A;  3TCJ A;  3M9Q A;  1VQO T;  5FU7 C;  5GMK h;  2MAM A;  1NPR A;  3ASK A;  2QEX A;  2Y90 A;  4R55 A;  1H64 1;  3JCM J;  4IUV A;  4F7U B;  5GMK l;  1EIF A;  4BE0 A;  3QPH A;  4KUI A;  3QYH B;  2CZ0 B;  3CXC A;  5GMK i;  1VQ9 T;  1WJS A;  2DJZ A;  4MMK A;  2O4X A;  3HHT B;  4M7D A;  3H6Z A;  3E1S A;  1VIE A;  4QVC A;  2VXE A;  1S72 T;  4BUG A;  4Y28 E;  5LJ3 j;  4M7A G;  1UGQ B;  3ME9 A;  4FSX A;  4YTL A;  3AHU A;  1UB4 A;  1Y96 A;  3QKJ A;  4JJN K;  3DB4 A;  2K3Y A;  4UC4 A;  4E7L A;  4NOY A;  2AHJ B;  2ZPI B;  3CD6 A;  2OTL T;  1WQ7 A;  3MP6 A;  4A53 A;  5EG2 A;  5I21 A;  1H3Z A;  3QXE B;  2RM4 A;  3CCJ T;  3CBM A;  1Y71 A;  2D0Q B;  4XTW A;  1NJI U;  5CKH A;  2DO3 A;  2LRQ A;  2F5K A;  2E41 A;  3M5A A;  4LDV A;  5GAM h;  4PJO B;  3OYB A;  3MEV A;  1QP3 A;  3OW2 A;  1WPY A;  4DQ2 A;  4ZN3 A;  3PIP A;  3EFS A;  3RKW A;  4EMG A;  2PVD B;  1YJW A;  1VQM A;  5GMK j;  4EMH A;  4DA4 A;  3CC2 T;  2RK2 A;  2R58 A;  4M78 A;  2FHD A;  4JLG A;  1VQN T;  2XHC A;  1KHI A;  1JB0 E;  3BW1 A;  2XU8 A;  1K73 C;  4M75 C;  3L2U A;  2ZPB B;  3G6E A;  4X9D A;  3A8L B;  4OB2 B;  4M7D G;  2PQW A;  3TRE A;  4C5E A;  2I2L A;  3CCM A;  4P5N A;  2LQK A;  3LH0 A;  1YIT T;  1PSE A;  2CYZ B;  3A8M B;  4FM4 B;  1U1T A;  3JCM f;  4LD6 A;  1KD1 U;  4RKU E;  4C92 C;  3M4Y A;  3GP8 A;  2E70 A;  2ZPH B;  2M16 A;  3RIR A;  4F7U E;  1UGR B;  3JB9 G;  1BI0 A;  3O8V A;  2LCC A;  3M58 A;  3VV0 A;  3PMT A;  3PT9 A;  5J3B A;  3SFM A;  4M7A B;  2NLU A;  3ZEH A;  1Q7Y U;  5FRM A;  4HCC A;  4M77 C;  3TEE A;  2VGM A;  4FT4 A;  2F69 A;  4FU6 A;  1I5L A;  4OB1 B;  4VUB A;  3OYK A;  5FU6 C;  4ZGD B;  4PJO A;  5GAN 6;  1YI2 A;  3CME A;  3HP9 A;  1M8V A;  1XQH A;  4XTV A;  2R5A A;  5GAN f;  3C12 A;  2LTO A;  3ZBD A;  1BIA A;  5GAO l;  5A2Q E;  2E64 A;  3OYI A;  5CVI A;  5GAM j;  4QQ6 A;  3I55 T;  3TU4 K;  3SWN C;  5FRO A;  2EQK A;  4IUP A;  4BI4 A;  2C06 A;  5GMK m;  5GAN h;  1UGS B;  3CCU T;  1VQL A;  4C8Q B;  4B9W A;  1M1K U;  2CZ7 B;  3FDR A;  3GNG A;  3HRS A;  4M75 G;  4QW2 A;  3QZ5 B;  4C0D B;  1NZ9 A;  4BI8 B;  1KHC A;  3UT1 A;  4IUU A;  2IVW A;  3H8Z A;  5HK0 A;  1N9R A;  4EMK A;  2MF2 A;  1VQP T;  4E47 A;  4C0F A;  4TVR A;  2DIQ A;  1VQ4 T;  4CI0 C;  2QEX T;  1W4S A;  5IT9 E;  1KQS S;  2E5Q A;  2JTF A;  3X25 B;  4C92 G;  5KH6 A;  1M90 C;  5LJ3 f;  2QQB A;  2E1H A;  3GPL A;  4V2S A;  2HNI A;  2WAC A;  2JNG A;  3VKI A;  5I2S A;  2DEQ A;  1YCY A;  2O4X B;  3DKM A;  4M7A A;  4KT0 E;  4M77 G;  3MO8 A;  5HKC A;  4M7D B;  3I56 A;  2P4T A;  2MI6 A;  2XK0 A;  3HRT A;  4O5V A;  5LL6 S;  3MEU A;  5A0L A;  2EJF A;  2R5M A;  4C5I A;  3JRZ A;  1VQ6 A;  2WSE E;  2OTJ T;  2DXU A;  2RHX A;  4M78 F;  4ATO A;  2EJ9 A;  2VYT A;  2QI2 A;  2GCX A;  2E12 A;  1NE8 A;  2BUD A;  2GF7 A;  2M1H A;  4XAX B;  3CCR A;  3PGG A;  3V8J A;  3LW5 E;  5M9O A;  1OYX A;  4XK8 E;  3DLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...