4M75F

Crystal structure of lsm1-7 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
90
structure length
75
Chain Sequence
b'RKKFEGPREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 7
structure length 75
sequence length 90
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75F00
2DXTA 4HT8A 4M78B 5LJ5j 4M78F 5LJ3d 2DKGA 5GANg 4M78D 4QVCA 3JCMd 3RIRA 2EJGA 4M78G 3M4GA 3V8JA 1I81A 1LOJA 4XTXA 5GAN6 1WNLA 5CAIA 3JB9H 5LJ5f 4F7UA 2DVEA 3L1AA 5LJ3h 1LJOA 2YLCA 1WPYA 5GAN2 4C92A 5LJ5g 4JUVA 1H641 5GAN4 2K57A 2RD1A 4M75E 2DEQA 1JRIA 4PJOE 2RM4A 2VXEA 1WQ7A 4M77E 4N0AA 4EMHA 5GAMj 4XU2A 3BFMA 3JCMP 3QHSA 1I4K1 4C92C 2EAYA 4XU0A 1I5LA 4NL3A 4MMLA 4EMKC 4A53A 5GANf 5GMKe 2DTIA 1BIAA 2DTHA 2ZGWA 2DZ9A 3QUIA 4N0AC 4C8QA 4C8QG 1N9SA 5GAMg 5GAOn 3HSBA 4M78E 1LNXA 4WF2A 4PNOA 2HNIA 2QTXA 4X9CA 1X01A 5DY9A 3JB9J 4M7AA 5LJ5h 2E65A 4F7UG 1KQ2A 4M7DA 5GANe 4C92D 3RERA 4M7DG 3INZA 4EMKB 5GAOm 1N9RA 4C92G 4XU3A 3VU3C 3JCMX 4A54A 3RKXA 4J5YA 1D3BA 4C8QC 1MGQA 2JN0A 4XQ3A 5GMKh 2FYKA 3SWNA 2FB7A 5LJ5e 5GANd 4M7AC 4M7DC 2E1HA 3L2ZA 1WQWA 2RA2A 1YCYA 5LJ3j 4V2SA 1B34A 4XTZA 3FIFA 4JRIA 3FB9A 3BDUA 4C8QB 4C8QF 5GANh 2DXUA 5GAMf 1BIBA 2VXFA 4XTWA 2YHTA 4C8QD 4XU1A 5LJ5d 5GAOl 2EWNA 3SWNC 3EFSA 3RUXA 4M7AB 4M7AF 3GIBA 4HT9A 1I8FA 3JCMQ 4F7UB 5GAOr 4F7UF 4M7DB 4M7DF 4J6YA 4M7AD 5GAN8 1M8VA 5LJ3g 4C92B 1Y96A 4J6XA 3JCMf 2DJZA 4C92F 4F7UE 5GAN7 4M7AG 1U1TA 3BW1A 5GAMe 4M7DD 4M7DE 5GAOp 3JCMg 4NOYA 4HA8A 3JCMV 4C92E 4EMGA 4J6WA 4M75G 2EJ9A 4M75A 2Y90A 3QSUA 4PJOA 3HFOA 4JLIA 4M77A 2CGHA 3V8KA 3RKWA 5GMKm 3V8LA 3JB9I 1U1SA 3JCMJ 4PJOD 4Y91A 5GAMd 3FJPA 4XTUA 1B34B 3AHUA 2E10A 4X9DA 4DQ2A 3JCMW 2YLBA 4M75C 4PJOC 4M77C 4JRKA 2DTOA 5GAMh 4M78A 2E64A 4C8QE 3EFRA 5GMKl 3QO3A 5GAOq 3PGGA 1Y96B 2DZCA 5LJ3f 5GMKj 5GAN3 4M7AE 3JCMh 4M75B 1HXDA 4M75F 4PJOB 4PJOF 4M77B 4M77F 4EMKA 5GMKi 1JBMA 1HK9A 1D3BB 2EJFA 4M75D 2RB6A 4M78C 4NL2A 4M77D 4RCBA 4XTVA 4XTYA 4PJOG 3JB9F 4QVDA 4M77G 3JB9D 5GANj 5LJ3e 3SWNB 5GAN5 3JB9G 1M5Q1 3RKYA 3HFNA 4RCCA 4MMKA 1KQ1A 2VC8A 3RESA 3V7CA 3V7RA 3JCMc 3SB2A 3BY7A 1TH7A 3V7SA 3JCMe 3JCMb 2E41A 2I2LA 5I21A 4OP0A
chains in the Genus database with same CATH superfamily
4AFUC 1K73U 2AZVA 4MZPA 1XTDA 1OU9A 4QVCA 1M90C 3CEYA 1KHIA 1PD0A 1VQ6Q 3I55A 5LJ3h 3CC4A 2NWMA 1NYGA 1PKTA 4E2FB 2QQ9A 2LX7A 2KRSA 3C4SA 4OMMA 4YTLA 3TU4K 3O8VA 4C92C 1QVGP 3CCSA 1JXMA 1IREB 2F2XA 3UA7A 4C8QG 2C0IA 2HSPA 1KQ2A 4M7DG 1X43A 4XU3A 1MMNA 3MEAA 2AZSA 3S3NA 4R55A 2CUBA 1D09B 4XTWA 1MUZA 4XU1A 3OYHA 3MJXA 3DLLA 3CCLQ 2KQWA 5GAMe 2DO3A 3JCMg 4E7IA 1U06A 1VOMA 1QQJA 2CSIA 5FLXE 3OQ5A 3X24B 2DL7A 4J9IA 4LD6A 4DQ2A 4MDXA 4PKCC 5GAMh 5GJVB 1UE9A 3EHRA 1G8XA 1FMVA 3C0CA 3M53A 4M7AE 2DXBA 4Q5WA 4M77F 1KQSA 3JB9D 1SSHA 3G71A 5IAYA 3WVEB 1K8AU 1N8RU 3QDRB 5FROA 3QDFA 2DL5A 4OF1A 5I21A 1PRLC 1NZ9A 2EQIA 2JS2A 2VGNA 3OYIA 1MNEA 2EQKA 2KBTA 5A0GA 3GPLA 2X4XA 2WSFE 4F7UA 2VWFA 4BE0A 2RI3A 1WYXA 3KXTA 4DA4A 3ER0A 1K4US 6AT1B 1YJNA 4F04B 3EG3A 4KH1B 2IVWA 3MPUB 2BKDN 1BI0A 1J3TA 4A63B 1TXQA 4JRPA 4PNOA 3L2WA 1UG1A 2QGFB 1WGSA 1ZBJA 4F7UG 1YFNA 4C92D 4BE2A 1YJ9A 4IUQA 4BACA 2ROLA 5KE3A 2DJQA 4ELZC 5A2QE 3CCUA 3CCVQ 1BBZA 2M9UA 4OVAA 4ZTFA 1OYXA 1NJIU 1YWOA 2ZPIB 2YWWA 1TUCA 4XTZA 4RTVA 5J26A 1AEYA 2YHTA 3CC2Q 2QA4Q 3MEUA 1FX7A 4TVRA 2VB6A 2COYA 3A8OB 2DE0X 3T9NA 4PJOA 5KCOA 2L3SA 3VS4A 3META 2HCKA 1RI0A 3CBOA 1YITQ 1OV3A 3RNJA 3AHUA 2X4YA 2E5KA 2J06A 2YLBA 2YRDA 5C0MA 2KNBB 1S72A 1B07A 4ZTJA 2E12A 2VVKA 5GAN3 3L2UA 1CKBA 1BYMA 3G6ET 2EBPA 1R77A 3NFCA 4RUGA 3CCMA 4PJOG 4QVDA 3VS6A 8AT1B 3LGLA 3X26B 3RKYA 3TEEA 3ZFJA 3OYJA 2M16A 3EGDA 1Q82R 2EYWA 1VQ4T 4AG1C 3S3MA 2KGTA 3NMZC 2HZYA 1JO8A 1TSFA 4M77E 4JRQA 2NYSA 2LJ1A 3CMAQ 1F1BB 1GFDA 3PMIA 2QQSA 2ED1A 5GANf 2DTIA 3HSBA 1WZOA 3N5BB 3PT9A 1YP5A 1X01A 4PFOA 4EIKA 1VQLA 3OW2S 2DFUA 4HCBA 3VU3C 1R8OB 2CSQA 4J5YA 1IGUA 1M8MA 2NUPA 4QQDA 1K9MU 1VQOA 1GXIE 2GQIA 1RAGB 5LJ5e 3G4SA 4M7AC 2D8JA 2RQTA 3RR6A 5IXBA 1KD1R 1W2BA 3I5RA 4C8QB 5ECAA 1QCNA 2QDLA 5HKCA 1M2VA 3X25B 2PTKA 3I55T 1D1CA 4M7DB 3CD6A 3CC4T 4C92F 4M7DE 1UEBA 2KAFA 2R5AA 3BW1A 4M75G 2OTJT 1Q86U 4KGVB 1VQ8Q 3R6NA 3L2QA 4R56A 2IIMA 3VS3A 1MHNA 4JPBW 1N27A 3UATA 2P84A 4QVZA 4HVUA 4MZMA 4PJOF 1NEGA 3CMEA 1NPPA 3JAME 2EJFA 3P8BB 2X3XD 3JSCA 5GANj 2CZ1B 2O2OA 2HKNA 3SB2A 2BE7D 4IIOA 3PNWC 2C06A 2I0NA 2KK4A 4M78B 2LNVA 1PSEA 4RG2A 3V8JA 1I81A 1OX8A 4XTXA 5GAN6 1YHQT 4BDZA 5CO7A 3SHWA 2KROA 2K5FA 3EG2A 1H641 4LDVA 2O4XA 2RJFA 4B6MA 2ZAEA 3M59A 2X3WD 3NPFA 2ZPGB 4J83A 5CR2A 3QHSA 2ABLA 3RMQA 5FU7B 1K9AA 4XU0A 3PFSA 1OEBA 4A53A 4N0AC 3D7SB 2YSQA 2PVDB 1M3CA 3A8LB 5J3BA 3JB9J 1MMDA 3NHNA 4FT2A 4O6JA 2ESWA 2PVOB 3RKXA 3G71T 2QG9B 3EFOA 3M56A 2LQNA 3CCEA 2FYKA 2F69A 3G1JA 1AWWA 2CP0A 1K73R 2LZ6B 2DYIA 3OYEA 1G3WA 2DL4A 2LT4A 3UWNA 4F7UB 3GLXA 4E7SA 2ATCB 4M7AD 5LJ3g 4F7UE 1QVFS 5GAOp 3JCMV 1QKWA 2DYBA 2MIOA 4JLIA 1M90U 3E9FA 1QCOA 2DRKA 3EGXB 2H3EB 1YJNT 2PUOB 4OB0B 2RJCA 1M2OA 1S1NA 4A4GA 3CC7A 2GFAA 4M77C 5KYYB 2E64A 5D6YA 2JTFA 4DOWA 3GNFB 2MPXC 2JMCA 3GP8A 3CCUT 3Q1JA 4JJCA 2FEIA 2NUTB 2GTJA 4FYWB 5A0DA 5DLOA 3BY7A 2EW3A 5FW9A 2A36A 3G7ZA 1LCKA 2W10A 1YI2A 1ZA2B 3SFMA 3VS5A 1Q95G 3VYHB 2DKGA 4BY6B 1VQNA 3CPWP 5L23A 3M0RA 5HK0A 3H9NA 5CQYA 4RKUE 1K9MC 1VQKA 4BD3A 3SD4A 3AT1B 2EYQA 2CZ6B 2RD1A 1GFCA 4PJOE 2RM4A 1WQ7A 4L59A 3QXEB 2EIFA 1ZSZB 3HHTB 3NTIA 4DEXA 1GL5A 4J9CA 1S72T 5GAMg 1QVPA 2DBKA 1RAFB 1TU0B 4X9CA 1Q86C 5KYWB 2CUDA 3OYBA 1UJ0A 1K8AR 2J7IA 1N8RR 2PVGB 1PSFA 1QKXA 3SWNA 2FB7A 2OJ2A 2CP6A 5GANd 1NM7A 1BK2A 3OYCA 3G6EQ 1YCYA 5HY6A 2KXDA 2EGCA 2XKOC 2EWNA 2RI2A 1PM3A 4KT0E 1I8FA 1Q7YC 4OMPA 3PTAA 2DF6A 5KCHA 1OZ3A 4C0DB 1UFFA 2YT6A 3EG9A 3CCJQ 1GBQA 1H8KA 2IPOB 2EKHA 4E7LA 2COWA 1AWJA 1AVZC 1VQ5A 1T0HA 5GJWB 2DMOA 3X20B 1VQ4Q 4RTXA 4HXJA 2E10A 1H92A 1VA7A 2XD0A 4KUIA 2HL5C 1UGSB 2ECZA 4WTOB 1VQLT 3M4YA 1WXUA 3M9QA 3O5ZA 2LP5A 2MK5A 4M75B 1HXDA 1RABB 2EQJA 3GIBA 1X2KA 3NTKA 2EGAA 2GFUA 1VQ9A 2NUPB 4RCBA 3THKA 1JQQA 4M77D 1VQOT 3G4ST 1KJWA 1NJIR 2D9TA 1WX6A 4RCCA 2H8HA 3HRSA 1VQ7A 1QVFP 2LTOA 1WPYA 2RPNA 1A0NB 2PNIA 2QQAA 4C0GA 4PFZA 1M27C 3CD6T 1LOJA 2BZYA 3U23A 1ZLMA 5LJ5f 2D6FA 2FG0A 2F2VA 4BI8B 1WJSA 2ZCFB 2LRQA 1JRIA 3H6ZA 2E5QA 1SRMA 1I4K1 3OYAA 3REAB 1JJ2P 4EMKC 2OTJQ 3J7AF 2DTHA 4C8QA 2YRVA 1N9SA 2FRYA 4PJMA 4PK4A 3PMTA 2VV5A 2ZZDA 3CMET 4M7DA 1VQPA 3QYHB 1D3BA 3RMSA 1MGQA 4ZGJB 2F1LA 1VQMA 3CCRA 1RAAB 1X6OA 2E1HA 1BI2A 2XK0A 2L89A 3EG0A 1M1KC 2K3BA 2HDAA 5CKEA 4JJNK 4DBHA 4J9BA 2C0OA 4C0FA 2J6FA 3EFSA 2JXBA 2LDMA 4ESRA 3PE0A 3OY9A 1O9SA 2O4XB 1K0XA 2WACA 1E6GA 4NOYA 4X34A 2E4HA 2KXCA 4ZNXA 2YUOA 2EYYA 4Z89A 3E19A 1YHQQ 1U1SA 3WXMB 4P5NA 1VQ6A 1OQKA 1AOJA 1M3AA 3VRYA 5KH6A 4PJOC 4JDSA 2A3LA 4JRKA 3OMGA 2DTOA 4M78A 1E7OA 2V8JA 3MEWA 1EX4A 4Y28E 5EC7A 5CK9A 5GMKj 1QLYA 3DLMA 1SRLA 4BDYA 2QDYB 2KSSA 1M1FA 5GAN7 4XTVA 3M0UA 1SHGA 3EFOB 4LDUA 4RMOA 3CCET 4X1VA 1M5Q1 4MMKA 1OPLA 4L6V5 1TH7A 2AKLA 3OYFA 1OPKA 3ME9A 1HSQA 2XG8D 3HTRA 4DBFA 3G71Q 2Y4XA 2NLUA 4RG8A 3UT1A 4M78G 2BTTA 4JS5A 1AHJB 4KUDK 5LJ5g 2QGGA 3PVLA 2K57A 2KRMA 3OYNA 2HSEB 1VIEA 2CZ0B 2QEXT 2DETA 3M0QA 1CKAA 2E3HA 3CC7T 3CCLA 1ABOA 1WHMA 3OS2A 3CXCS 2HNIA 4D8DA 1PNJA 3S6WA 2EYZA 1KG1A 4A54A 1Q81U 4QQ6A 1YJWT 3EGXA 3L2ZA 1YI2T 2O9SA 1IB8A 2XI9A 3CCQQ 1LVKA 1WHHA 2RA2A 1VQNT 4C8QF 4IUPA 4D6WA 2FPFA 5KYYA 1PG5B 2XU8A 2D8HA 4M7DF 4J6YA 4B9XA 5GAN8 4QT7A 4J6XA 1SG5A 2FVUA 1ARKA 2P0KA 2EJ9A 2Y90A 1BU1A 2PUKB 2QI2A 1W1FA 2KI7A 2B8AA 1D1BA 2NUTA 3BE3A 3LH5A 2AK5A 5IHIA 3VS7A 1WJQA 1QWEA 3CPWA 3QIIA 4QKUA 3S3OA 2LNHB 4FW1A 2DIQA 5GMKm 2G6FX 4PJOD 3FEOA 1KC8C 4XTYA 3HPWA 2OTLQ 2VUBA 1T3SA 1FMKA 1Y71A 3SWNB 1H3HA 3RESA 4N4HA 3M58A 3V7RA 3EHQA 4UC4A 2P0PA 4Y92A 1G2BA 4OB2B 1ZSZA 4M78F 4FU6A 3JCMd 1WI7A 2QXFA 4FIBA 2ZPEB 3CCVA 1WHLA 4BUGA 2RN8A 5GAN2 3EG9B 2XDDA 1UB4A 5KYWA 1C1AA 1M1GA 1M90R 3PIOA 2V1QA 3L42A 1WJRA 3OSSC 1VQ5T 5AYFA 3CC2A 1NEBA 3MKDA 3BFMA 1K0SA 2E6NA 2QA4A 4NL3A 4FSXA 2AT1B 2E3IA 5LL6S 4OB3B 4NS5A 2QTXA 2X35A 2LCCA 3SDZA 2E6ZA 1VQ9T 2GNCA 2RI5A 3QKJA 5CIUA 2RO0A 1YIJQ 1TUDA 3OYDA 1VQLQ 1TS9A 1VQ7T 3VJPA 1QMCA 2HEQA 1EFNA 4J8OA 1WQWA 2K5LA 1KQSS 4HCCA 2CZ7B 4F7UF 2HD0A 4J9FA 1IHWA 2A0FB 2DXCA 1D1AA 1WHKA 3HRTA 4M75A 1EIFA 3HFOA 2RH2A 1IO6A 5CKHA 3CD6Q 3JB9I 2CH4W 2NUZA 2L3QA 2O01E 4K11A 4L5GA 3JCMW 3QZ9B 1QP2A 2LMJA 2EKOA 3PIPA 2A28A 2RHXA 3M5AA 4C8QE 4DBQA 3QO3A 1Y96B 5LJ3f 2XICA 1VQPT 3CMAA 3JCMh 2Y4YA 2RNAA 4AFQC 5GMKi 2BUDA 1D3BB 3JCMJ 3QJYA 5AT1B 4AT1B 1QWFA 2X4JA 1PKSA 1KQ1A 3I56A 3JCMc 2OAUA 5KYXB 1T3LA 3CCST 2DXTA 2ENMA 2JW4A 1JJ2A 2MMPA 1Q81C 5DLQE 4IUVA 5CKDA 1OU8A 1WNLA 3VUZA 1UGVA 4AFSC 2YLCA 2GGRA 4LDXA 1ABQA 2KR3A 4AG2C 2X9HA 1I07A 4WCIA 5I2MA 1Q7YU 3JCMP 1VQ6T 1JB0E 1OZ2A 1NPRA 2JTEA 1QVGA 3I9QA 2ZGWA 2DZ9A 3A8GB 4M78E 2K2MA 2JNGA 2COZA 5HCKA 1WXBA 1VQ8A 2FL7A 4A4KA 3L2RA 3QJ6A 1QCFA 1MMAA 1X6GA 2D1XA 3OS0A 1Z9QA 2V1RA 1JEGA 2K2VA 3M57A 1NBEB 2MCNA 4Z02A 5J39A 3FRNA 4FL6A 2HBPA 3LW5E 1AT1B 2DBMA 5LJ3j 2F5KA 3FB9A 2QAZA 1RL2A 5GAMf 3ZBDA 2OAWA 3JRZA 2RQRA 3SWNC 3RUXA 4OMOA 1R0BG 1D0XA 4OMNA 1OX9A 3FLGA 4EMGA 2CP3A 2ZPBB 2CGHA 5A0LA 3TCJA 4VUBA 1B34B 3A98A 2GBQA 1MMGA 3KUFA 4F17A 2D0NA 3CQTA 5IT9E 2EQMA 2QEXQ 4ZGDB 2DZCA 4RTYA 4OMQA 3QYGB 2DL8A 4M75F 5IXFA 1R0CB 4RTUA 3OW2P 4JZ3A 4CC3A 2DX1A 2KVQG 4FW2A 1KK7A 3VV0A 3EH1A 1YJWQ 1UGQB 1YWPA 1OOTA 4LN2A 1YI2Q 1YJ9T 4J9DA 4JUVA 2DEUA 5GAN4 1W2BS 2RMOA 1M1KU 2AKKA 2DIGA 3CBPA 4OGCA 2VXEA 2CT4A 5GAMj 4GLMA 1C6VX 4JJBA 4KRTA 1GRIA 2LQ8A 2OI3A 4MMLA 2ZPHB 3QUIA 2JMAA 1LNXA 1BKBA 3KBGA 1Q82U 2RHIA 2SEMA 4J9GA 1UGPB 2VGMA 3JCMX 4C8QC 3PVQA 2QYZA 1WA7A 3DB4A 4XQ3A 2KT1A 3QZ5B 1WHGA 3HP9A 2EFIA 5KYNA 4M7DC 4R0KA 4O5VA 4V2SA 5IH2A 3BDUA 2RHZA 2DXUA 2HL3A 3CCVT 1X27A 3LYIA 3H0IA 2DA9A 3P8HA 1SEMA 2FPEA 3E2UA 3CCMT 5FU6B 1RI9A 3CC2T 3LGFA 7AT1B 2CT3A 3RKWA 2PU9B 4ANJA 2LCSA 2WSCE 1KFZA 1W70A 4GBQA 1H3ZA 2FO0A 4XTUA 3M55A 1KD1U 4C5HA 1E6HA 2EYXA 2HMAA 4CC7A 1G83A 2O9VA 4A4EA 3QWXX 1C0MA 4M78C 1KIKA 3HRUA 3F70A 3HFNA 4ELYC 3JCMb 1I0CA 2QK0A 3RDVA 5LJ3d 1CSKA 3GOXA 1OULA 4KULA 3JB9H 3MCAB 1LJOA 1SPKA 5FU7C 5IN1A 3A8MB 3UDCA 2B86A 3G6EA 1YBYA 3TQ7P 3DB3A 4M75E 2KDSA 1FWZA 1I1JA 4OB1B 2D0QB 2YUPA 3CCJA 1IZ6A 1PC0A 4QQGA 1BCMA 4II1A 2M1HA 3FDRA 5I11A 1V1CA 1X69A 1SHFA 1ZA1B 2RQWA 5GANe 3RERA 2YUNA 2RHYA 4Z88A 2JT4A 1PCXA 3LH0A 2FHDA 3I56T 3I55Q 4XK8E 3CC4Q 2KRNA 4ATOA 2F2WA 1KC8U 5GANh 2DD5A 4C8QD 1VIFA 2L2PA 1RAEB 4ZN1A 5GAOr 3JCMQ 2G3RA 2FRWA 1Y96A 3A1PA 3J81E 4M7DD 3IQLA 3CCSQ 3H0FA 3QSUA 1Z9ZA 4FM4B 2KE9A 2L0AA 1B3QA 4BI4A 1D0YA 1IGQA 1RUWA 3KFVA 2JUFA 2P0QA 5GAMd 1IHVA 3GF5A 5I2SA 3SEMA 1SKUB 3LWIA 5KYXA 1N5ZA 3FJ5A 4RTZA 4DBRA 3QBYA 1AWOA 4IUTA 2RQUA 4J9HA 1VQ8T 3BDLA 1HK9A 1LPLA 1WFWA 2F5TX 4KH0B 2XDBA 2CH4A 4BY6C 3DKMA 2OTJA 5GAN5 2VKNA 3VS2A 1SF9A 1Q82C 2DD4A 2DVJA 5LJ5j 2RJDA 1O75A 2BE9B 1RLPC 4M78D 3OYKA 1WXTA 2EJGA 3LLRA 2Z0WA 3M4GA 3RIRA 1ZSGA 1TWBA 2J6KA 3M0TA 1RACB 3C94A 3L1AA 3MEVA 1UTIA 3GNGA 1ZSZC 4E6RA 2KYBA 1K9MR 1ZBXA 2EPDA 2M02A 2CP7A 3R6OA 4N4GA 2EAYA 2GQVA 4PJJA 1XJWB 5FU6C 1TUGB 3MHXA 4HKEA 2MAMA 1YHQA 4BE1A 1G3TA 2LC4A 2DRMA 4ZN3A 1KD1C 1Q86R 1VUBA 3EAEA 3TREA 5I22A 3OMCA 2SRCA 3UF4A 2DLPA 2DNUA 2EQUA 3OYMA 4C0DC 1B34A 3M0SA 4F16A 2RK2A 4PFPA 4M7AB 4HT9A 1YJNQ 1G5VA 5CQXA 1M8VA 4E7ZA 4ZGEB 4IKFA 2VYTA 4A4FA 5HK3A 4HA8A 2CYZB 1Q7YR 1PHTA 2LCLA 1NYFA 1FXXA 2GCXA 3OW2A 1WDXA 2JS0A 1YJ9Q 1YN8A 1EZZB 4KBMB 4M75C 3L2VA 1GCQA 3CCUQ 3VRZA 3OS1A 1AZGB 3EFRA 1W6XA 1Y57A 2JZ2A 4CC4B 3QWYA 1VQKT 3HL8A 2K5IA 2X4WA 3E9GA 2LJ3A 2HQXA 4EMKA 2K3YA 4NL2A 2XDPA 2R58A 2RQVA 5D7UA 1MV0B 4HCZA 3JB9G 2DL3A 4LDYA 5FRMA 4PJNA 1XQHA 2QASA 4HT8A 1BB9A 3P8DA 4IUUA 5D6WA 3M0PA 1ZUYA 4AFZC 3OB9A 4ME7A 4RTTA 1X2QA 4CC2A 2DVEA 5CKBA 2O88A 1UHFA 4C92A 1RAHB 4E7KA 3CCQA 2MWPA 3LWHA 1BI1A 2DEQA 5CVIA 4PLIA 2DPPB 1S72Q 2BZ8A 1OI1A 2MF2A 2A08A 1FYNA 2KEAA 3CCMQ 4KGZB 3A5ZB 4C5GA 2ED0A 4Z8AA 5GAOn 4WF2A 5CCAA 1PD1A 1ZUKA 3CBMA 3EH2A 1WIEA 4LUDA 4C92G 1HJDA 4LDWA 1K73C 4A4HA 4OMFB 2E70A 2JN0A 1AWXA 1G3SA 4B9WA 2V8KA 2DAQA 2QTVA 2LX9A 4DOVA 4EDUA 5LJ5d 5GAOl 2OTLA 3MP8A 1M1KR 1VYTA 2K7AA 1YITA 1XOVA 1MNDA 2YUQA 2L3RA 3V8KA 3J80E 3V8LA 1NG2A 3FJPA 3OS5A 3CCJT 4PL6A 3GBQA 3URGA 4BI3A 2HBWA 1VQOQ 3G4SQ 5GAOq 3CPFA 1IRXA 2RF0A 1P92A 3I5SA 4M77B 4M75D 2CS7A 3JB9F 1NLOC 2K79A 3CXCP 2R57A 2QQBA 1HD3A 2LVMA 1TTHB 3JCMe 3V7SA 4OMLA 2DERA 2I2LA 1TOVA 3H41A 1QVFA 2FZCB 4CRIA 1AZEA 2QQRA 2WSEE 5KYUB 3I56Q 1YIJA 5CAIA 3RBBB 3ASKA 4HCKA 1QP3A 2AHJB 3MP6A 1VQMT 3CCRT 3TSZA 4FYXB 1SSFA 3CMEQ 3ZL7C 2HAXA 2HKQB 2P4TA 1YCSB 5GMKe 4OGEA 2FZGB 4FSSA 1K8AC 5DM7R 1N8RC 5LJ5h 2E65A 1AD5A 2EGEA 3INZA 3MO8A 1N9RA 3UA6A 3CPWS 1Y07A 5GMKh 3OYGA 2BIVA 2CKKA 1W4SA 4LNPA 1UDLA 4GY5A 3FIFA 2MOXA 2GTOA 5FWBA 2YRCA 2BZXA 2AIRB 9ATCB 2VASA 1X75C 2KY9A 2CDTA 3EGUA 4AMCA 2XHCA 3C12A 3OBYA 4GLKA 1NLPC 3EG1A 2DK3A 2ZPFB 4X9DA 3E1SA 1M4ZA 2R5MA 2K9GA 3CCEQ 4MZTA 3TVTA 4QW2A 4JZ4A 2H3JA 3FC3A 1NJIC 4FT4A 2KMTA 3OBWA 4MDWA 4EPCA 2RB6A 1NE8A 2K3XA 5C6SA 1GCPA 1ACMB 2RJEA 4LE9A 3CCLT 1KC8R 3A8HB 2J6OA 4PLLA 3VS0A 5GANg 3NGPA 3WVDB 2PQWA 4C5IA 2ROTA 1WHJA 1I5OB 3VS1A 4DEYA 3CC7Q 2JJ9A 1KQSP 3QG1A 1V29B 1N6AA 3H0HA 4LUEA 4EMHA 2LT1A 2CP5A 4XU2A 1GBRA 5FRNA 1PRMC 1VYVA 3OSVA 1B7TA 1BIAA 2MYSA 4BB7A 4M7AA 2L3PA 4EMKB 5GAOm 1VQNQ 1K1ZA 1VQKQ 4KGXB 2QEXA 4E7HA 1X6BA 2OX7A 2PZ1A 1BCOA 3JV3A 1XNIA 3REBB 1JXOA 1BIBA 2VXFA 1G3YA 4N4IA 3I35A 1ZX6A 4J7IA 1UGRB 8ATCB 4C92B 4M7AG 2DJZA 4C0ZA 1U3OA 2DM1A 3ZEHA 1U1TA 3CCQT 3HKSA 4C92E 2KYMA 1JJ2S 4J6WA 2RK1A 3M54A 1HYOA 1BI3A 1YJWA 2XIDA 2XMFA 2K4YA 2CP2A 2YXYA 3PGGA 2JTMA 4FYVB 4PJOB 1QVGS 1JBMA 5IHNA 1ZUUA 4M4ZA 4FCYA 3C95A 3X28B 1DJ7B 4IURA 2VC8A 5EG2A 3V7CA 2QA4T 2HQHA 2E41A 2KT8A 2M51A 2IG0A 4JLGA 2W0ZA 4LD9K 2V26A 2OTLT 1VQ5Q 3ULRB 2M0YA 1M9SA 1V76A 5D6XA 1UUEA 4XAXB 1U5SA 1YITT 2MI6A 1Q81R 2FZKB 4N0AA 1UECA 3LX7A 2MWOA 3VUBA 3VYGA 3OYLA 2EVRA 1ZQ1A 1ZHIA 1D0ZA 4J9EA 1IXDA 2C0TA 2K6DA 2O31A 1Y0MA 1QW1A 1VQ9Q 3EGDB 1Y7XA 1PWTA 1UHCA 1RADB 4PJLA 1KSWA 1VQ7Q 1T0JA 5DY9A 3H8ZA 4D8KA 2P4RA 2RHUA 4HVVA 5CKFA 5FWCA 4RTWA 1RLQC 2HQEA 1JU5C 1KHCA 1YNZA 1FMWA 2JVVA 4F14A 2FPDA 2X51A 4JJDA 4JRIA 1K76A 5M9OA 4C5EA 1YIJT 1RAIB 1VYUA 2JM8A 4M7AF 3OYYA 1WLPB 3QPHA 3CMAT 1VQ4A 3JCMf 1TG0A 4HVWA 4M77A 4J7FA 2LJ0A 4FYYB 5L8RE 3CXCA 4JS4A 4Y91A 2A7YA 2LQWA 1VQPQ 1MV3A 1U8RA 1W2BP 1VQMQ 4ORZA 1M2VB 3MP1A 3CCRQ 5GMKl 5KYUA 4IIMA 4CI0C 3NTHA 2A37A 1UJYA 4LXCA 5KE2A 1M3BA 2DILA 2L8DA 1M30A 1GCQC 3TSWA 4E47A 3OA6A 2J05A 2YDLA 3VKIA 4M77G 5IHKA 4E7JA 5LJ3e 2L5QA 2CREA 2JOYA 2V8IA 3UPUA 1I5LA 2GF7A 2JM9A 2M0OA 2LQKA 4OP0A
chains in the Genus database with same CATH topology
2DXTA 1YI2A 4HT8A 1JJ2A 3SFMA 3VYHB 4BY6B 2DKGA 1K73U 4MZPA 1VQNA 1XTDA 2MMPA 3P8DA 4IUUA 5D6WA 4QVCA 1Q81C 1M90C 5HK0A 5DLQE 4IUVA 5CQYA 3CEYA 3OB9A 4ME7A 5CKDA 1KHIA 4RKUE 1WNLA 1K9MC 3VUZA 1VQKA 3I55A 4BD3A 2DVEA 5LJ3h 3SD4A 5CKBA 2YLCA 2EYQA 4C92A 3CC4A 4E7KA 4LDXA 3CCQA 2CZ6B 2MWPA 3LWHA 1BI1A 2QQ9A 2RD1A 2DEQA 5CVIA 4PLIA 2DPPB 4PJOE 2RM4A 1WQ7A 5I2MA 3C4SA 1OI1A 1Q7YU 4L59A 3JCMP 1VQ6T 3QXEB 4YTLA 2EIFA 3O8VA 2MF2A 3TU4K 4C92C 1JB0E 1OZ2A 3HHTB 1NPRA 3NTIA 3CCSA 1QVGA 1IREB 3A5ZB 2ZGWA 4C5GA 2DZ9A 3A8GB 4C8QG 5GAMg 5GAOn 1S72T 1QVPA 4M78E 4WF2A 2JNGA 5CCAA 4X9CA 3CBMA 1Q86C 1VQ8A 2FL7A 4A4KA 1KQ2A 4M7DG 3L2RA 3QJ6A 4C92G 3OYBA 4XU3A 3MEAA 4LDWA 1K73C 3OS0A 4A4HA 4OMFB 2PVGB 2K2VA 2E70A 2JN0A 1PSFA 3M57A 1G3SA 2FB7A 4Z02A 3SWNA 4B9WA 5J39A 3FRNA 5GANd 4FL6A 4R55A 2HBPA 3OYCA 2V8KA 3LW5E 2DAQA 1YCYA 5LJ3j 2LX9A 5HY6A 4DOVA 4EDUA 2F5KA 3FB9A 2XKOC 1RL2A 5GAMf 4XTWA 5LJ5d 4XU1A 3OYHA 3ZBDA 5GAOl 2EWNA 3JRZA 2OTLA 3SWNC 2RI2A 3RUXA 4KT0E 3DLLA 1I8FA 1Q7YC 3MP8A 3PTAA 2KQWA 1OZ3A 5KCHA 4C0DB 5GAMe 2DO3A 3JCMg 4E7IA 3FLGA 1XOVA 4EMGA 1YITA 2ZPBB 2CGHA 4E7LA 2L3RA 3V8KA 3J80E 1VQ5A 3V8LA 3X20B 5FLXE 5A0LA 3TCJA 3OQ5A 3X24B 3FJPA 3OS5A 4VUBA 1B34B 2E10A 4LD6A 4DQ2A 3CCJT 3KUFA 4PL6A 3CCST 4MDXA 3URGA 4BI3A 4PKCC 2XD0A 5GAMh 2EQMA 4KUIA 5IT9E 1UGSB 5GAOq 4ZGDB 3CPFA 1VQLT 3M4YA 1P92A 2DZCA 3M53A 3M9QA 4M7AE 2DXBA 4M75B 1HXDA 3QYGB 4M75F 4Q5WA 4M7DD 2EQJA 4M77B 4M77F 3GIBA 3NTKA 4M75D 2GFUA 1VQ9A 2CS7A 4RCBA 3JB9F 4M77D 1KQSA 1VQOT 3JB9D 3G4ST 3G71A 2R57A 5IAYA 2QQBA 2D9TA 3WVEB 1K8AU 4RCCA 1N8RU 2LVMA 3QDRB 5FROA 3JCMe 3V7SA 3HRSA 1VQ7A 2LTOA 2I2LA 1WPYA 4OF1A 5I21A 1QVFA 2QQAA 1NZ9A 2VGNA 2KVQG 3OYIA 4C0GA 4CRIA 2EQKA 2QQRA 2WSEE 3VV0A 2X4XA 5A0GA 3GPLA 2WSFE 1YIJA 3CD6T 1LOJA 1UGQB 5CAIA 5LJ5f 4F7UA 3ASKA 1YJ9T 1QP3A 2AHJB 4JUVA 4BI8B 1WJSA 2ZCFB 3MP6A 4BE0A 2RI3A 5GAN4 1W2BS 3KXTA 1M1KU 4M7DE 2LRQA 4DA4A 1JRIA 2DIGA 3CBPA 1VQMT 4OGCA 2VXEA 3CCRT 3H6ZA 2E5QA 5GAMj 3ER0A 1I4K1 1YJNA 3OYAA 1SSFA 2LQ8A 2HAXA 4MMLA 2IVWA 2P4TA 2ZPHB 4EMKC 2BKDN 1BI0A 5GMKe 3J7AF 2DTHA 3QUIA 4OGEA 4C8QA 2YRVA 1N9SA 1M8VA 1LNXA 4JRPA 4PNOA 3L2WA 1BKBA 3KBGA 1K8AC 5DM7R 1N8RC 1Q82U 3PMTA 2VV5A 1WGSA 2RHIA 1XQHA 2ZZDA 2E65A 4F7UG 5LJ5h 3CMET 4M7DA 4C92D 4BE2A 1UGPB 3INZA 1YJ9A 4IUQA 3MO8A 1N9RA 4BACA 1VQPA 2VGMA 3QYHB 5KE3A 4C8QC 3JCMX 1D3BA 4ELZC 3RMSA 5A2QE 1MGQA 3CCUA 4ZGJB 3CPWS 1VQMA 1Y07A 2M9UA 3DB4A 4XQ3A 5GMKh 3QZ5B 3OYGA 4OVAA 3HP9A 2EFIA 2BIVA 3CCRA 4ZTFA 1OYXA 1NJIU 1X6OA 4M7DC 2E1HA 4O5VA 1BI2A 1W4SA 2CKKA 2XK0A 2ZPIB 2L89A 4GY5A 4V2SA 4XTZA 3FIFA 5J26A 3BDUA 1M1KC 2RHZA 2DXUA 5CKEA 4JJNK 2YHTA 3CCVT 4C0FA 3EFSA 2LDMA 3LYIA 3P8HA 3MEUA 3OY9A 1FX7A 4TVRA 1O9SA 2O4XB 2WACA 3A8OB 4NOYA 4X34A 3T9NA 3CCMT 1X75C 2KY9A 5FU6B 5KCOA 4PJOA 3CC2T 3LGFA 3META 1RI0A 3RKWA 2PU9B 2XHCA 3C12A 3E19A 3OBYA 1U1SA 4GLKA 2WSCE 2D6FA 3CBOA 3V7CA 3WXMB 4P5NA 1VQ6A 4XTUA 1H3ZA 3AHUA 2DK3A 2X4YA 2ZPFB 4X9DA 3M55A 2YLBA 5KH6A 4PJOC 1KD1U 3E1SA 1M4ZA 4JDSA 2R5MA 4C5HA 2A3LA 4JRKA 5C0MA 3OMGA 2DTOA 4M78A 4MZTA 1S72A 4QW2A 2H3JA 3MEWA 2V8JA 3FC3A 4Y28E 5CK9A 4ZTJA 2E12A 5GMKj 1NJIC 3DLMA 5GAN3 4FT4A 3L2UA 2KMTA 3OBWA 4BDYA 1BYMA 4A4EA 2QDYB 4MDWA 3G6ET 2KSSA 1M1FA 3NFCA 4EPCA 4XTVA 5GAN7 2RB6A 4M78C 3CCMA 4LDUA 1NE8A 4PJOG 2K3XA 4QVDA 3HRUA 4RMOA 3CCET 3F70A 3LGLA 5C6SA 3X26B 1M5Q1 3RKYA 3HFNA 4MMKA 4ELYC 3JCMb 4L6V5 2RJEA 1TH7A 3TEEA 3OYFA 3CCLT 3ZFJA 3ME9A 3OYJA 3A8HB 2XG8D 5LJ3d 4PLLA 3GOXA 2Y4XA 2NLUA 5GANg 3WVDB 2PQWA 4RG8A 3UT1A 4M78G 1VQ5T 4JS5A 2M16A 4KULA 4C5IA 1VQ4T 3JB9H 3S3MA 3MCAB 1AHJB 1LJOA 5FU7C 4KUDK 5IN1A 3A8MB 5LJ5g 3UDCA 3G6EA 2K57A 1YBYA 3QG1A 1V29B 3DB3A 1N6AA 2KDSA 4M75E 3OYNA 4M77E 4JRQA 4EMHA 1VIEA 2CZ0B 2LT1A 4XU2A 2QEXT 1FWZA 4OB1B 2D0QB 5FRNA 3CC7T 3CCLA 3PMIA 2QQSA 3OSVA 3OS2A 5GANf 3CCJA 1IZ6A 2DTIA 1BIAA 4QQGA 4II1A 2M1HA 3FDRA 3N5BB 3HSBA 3PT9A 3CXCS 2HNIA 4BB7A 1X01A 4M7AA 1VQLA 3OW2S 5GANe 3RERA 3S6WA 2RHYA 4EMKB 5GAOm 4HCBA 3VU3C 1R8OB 1KG1A 4A54A 1Q81U 4J5YA 3LH0A 2FHDA 4QQDA 4QQ6A 3I56T 1VQOA 1K9MU 1GXIE 5LJ5e 2QEXA 4XK8E 3G4SA 1YJWT 4E7HA 4M7AC 3L2ZA 1YI2T 1XNIA 2XI9A 2RA2A 1W2BA 4ATOA 1VQNT 4C8QB 4C8QF 4IUPA 4D6WA 5GANh 1KC8U 1BIBA 2DD5A 1G3YA 2VXFA 4C8QD 1VIFA 5HKCA 2XU8A 4N4IA 3X25B 4ZN1A 3I55T 5GAOr 3JCMQ 4J7IA 2G3RA 4M7DB 1UGRB 3CD6A 4J6YA 4B9XA 5GAN8 3CC4T 4M7DF 4C92B 1Y96A 4J6XA 4C92F 2DJZA 4C0ZA 2FVUA 1UEBA 2KAFA 1U1TA 2P0KA 2R5AA 3BW1A 3HKSA 3ZEHA 4C92E 3CCQT 3QSUA 1JJ2S 4J6WA 4M75G 2EJ9A 2RK1A 2Y90A 4FM4B 2PUKB 2QI2A 3M54A 2OTJT 4BI4A 1Q86U 1BI3A 2B8AA 5GAMd 2JUFA 2P0QA 1YJWA 3L2QA 2XIDA 3GF5A 5I2SA 4R56A 3LWIA 1WJQA 1MHNA 2K4YA 3CPWA 3QBYA 4IUTA 3QIIA 3S3OA 1N27A 3PGGA 1VQ8T 2JTMA 3BDLA 4QVZA 4MZMA 4PJOB 4PJOF 3CMEA 1NPPA 1QVGS 3JAME 1JBMA 1HK9A 2DIQA 2EJFA 2F5TX 3P8BB 5GMKm 3FEOA 1KC8C 4XTYA 2XDBA 3HPWA 4BY6C 3DKMA 4PJOD 3JSCA 2OTJA 2VUBA 3C95A 5GANj 1Y71A 3SWNB 5GAN5 3X28B 2CZ1B 1DJ7B 4IURA 2VC8A 4N4HA 3M58A 5EG2A 3RESA 4UC4A 3SB2A 2P0PA 3V7RA 2QA4T 1Q82C 2E41A 2DD4A 4JLGA 2IG0A 3PNWC 2C06A 2KK4A 4M78B 4OB2B 4M78F 5LJ5j 2RJDA 1O75A 2LNVA 4FU6A 1PSEA 4LD9K 2OTLT 4M78D 3OYKA 3JCMd 3LLRA 2EJGA 4RG2A 3M4GA 3RIRA 2QXFA 1I81A 4FIBA 4XTXA 3V8JA 2ZPEB 1M9SA 5GAN6 3CCVA 1YHQT 4BUGA 3C94A 5CO7A 3L1AA 5D6XA 4BDZA 2K5FA 3MEVA 5GAN2 4XAXB 2XDDA 1UB4A 3GNGA 1YITT 1H641 2MI6A 4LDVA 1M1GA 2O4XA 2RJFA 3PIOA 3L42A 3M59A 1WJRA 3OSSC 4N0AA 3LX7A 3VUBA 1ZBXA 2MWOA 2ZPGB 5AYFA 3VYGA 3OYLA 3CC2A 4J83A 1ZQ1A 3BFMA 5CR2A 1ZHIA 3QHSA 3RMQA 5FU7B 2E6NA 3R6OA 4N4GA 2QA4A 2EAYA 4XU0A 4NL3A 2GQVA 3PFSA 1QW1A 4FSXA 4A53A 5FU6C 4N0AC 3MHXA 4HKEA 5LL6S 1Y7XA 4OB3B 2MAMA 4NS5A 2QTXA 2X35A 2PVDB 3A8LB 5J3BA 5DY9A 3JB9J 2LCCA 3H8ZA 4BE1A 1YHQA 3J81E 1G3TA 4FT2A 3SDZA 2E6ZA 2LC4A 2RHUA 4O6JA 1VQ9T 2RI5A 3QKJA 2PVOB 5CIUA 3RKXA 3G71T 5CKFA 2RO0A 4ZN3A 1KD1C 3M56A 3OYDA 1VUBA 3EAEA 2HQEA 3TREA 2FYKA 3CCEA 1VQ7T 2F69A 3OMCA 3VJPA 1KHCA 4J8OA 1WQWA 2EQUA 3OYMA 2JVVA 4C0DC 1B34A 4JRIA 5M9OA 2K5LA 4C5EA 3OYEA 1G3WA 2RK2A 1YIJT 2LT4A 1KQSS 4HCCA 4M7AB 3UWNA 4M7AF 4HT9A 3OYYA 2CZ7B 3GLXA 4F7UB 2HD0A 3QPHA 5CQXA 4F7UF 4M7AD 4IKFA 4ZGEB 5LJ3g 3CMAT 1VQ4A 2DXCA 3JCMf 4F7UE 2VYTA 4A4FA 3HRTA 1QVFS 5GAOp 5HK3A 3JCMV 4HA8A 4M75A 1EIFA 2CYZB 3HFOA 4JLIA 4M77A 1M90U 2RH2A 4J7FA 3E9FA 5CKHA 5L8RE 3CXCA 3JB9I 4JS4A 2LCLA 1YJNT 2PUOB 4Y91A 4OB0B 2RJCA 1FXXA 2A7YA 2GCXA 2O01E 4L5GA 3OW2A 3S3NA 3JCMW 1U8RA 4KBMB 4M75C 3QZ9B 4A4GA 3CC7A 2GFAA 1QP2A 3L2VA 4M77C 3OS1A 2EKOA 3PIPA 3MP1A 2E64A 2RHXA 1G5VA 5D6YA 3M5AA 4C8QE 3EFRA 5GMKl 3QO3A 2JZ2A 1VQKT 1Y96B 2JTFA 3HL8A 4DOWA 3GNFB 3NTHA 4CI0C 5LJ3f 5KE2A 2XICA 2L8DA 1VQPT 3CMAA 2K5IA 2X4WA 2Y4YA 3E9GA 3JCMh 4E47A 3OA6A 3GP8A 2HQXA 4EMKA 5GMKi 3CCUT 2BUDA 1D3BB 2K3YA 4NL2A 2XDPA 3JCMJ 3Q1JA 2R58A 3VKIA 3QJYA 4M77G 4HCZA 5LJ3e 4E7JA 2X4JA 2L5QA 3JB9G 2JOYA 5DLOA 5A0DA 2V8IA 3UPUA 1KQ1A 4LDYA 2GF7A 3I56A 1I5LA 3JCMc 3BY7A 2OAUA 5FRMA 4M7AG 2M0OA 3G7ZA 2LQKA 4OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXT A;  4HT8 A;  4M78 B;  5LJ5 j;  4M78 F;  5LJ3 d;  2DKG A;  5GAN g;  4M78 D;  4QVC A;  3JCM d;  3RIR A;  2EJG A;  4M78 G;  3M4G A;  3V8J A;  1I81 A;  1LOJ A;  4XTX A;  5GAN 6;  1WNL A;  5CAI A;  3JB9 H;  5LJ5 f;  4F7U A;  2DVE A;  3L1A A;  5LJ3 h;  1LJO A;  2YLC A;  1WPY A;  5GAN 2;  4C92 A;  5LJ5 g;  4JUV A;  1H64 1;  5GAN 4;  2K57 A;  2RD1 A;  4M75 E;  2DEQ A;  1JRI A;  4PJO E;  2RM4 A;  2VXE A;  1WQ7 A;  4M77 E;  4N0A A;  4EMH A;  5GAM j;  4XU2 A;  3BFM A;  3JCM P;  3QHS A;  1I4K 1;  4C92 C;  2EAY A;  4XU0 A;  1I5L A;  4NL3 A;  4MML A;  4EMK C;  4A53 A;  5GAN f;  5GMK e;  2DTI A;  1BIA A;  2DTH A;  2ZGW A;  2DZ9 A;  3QUI A;  4N0A C;  4C8Q A;  4C8Q G;  1N9S A;  5GAM g;  5GAO n;  3HSB A;  4M78 E;  1LNX A;  4WF2 A;  4PNO A;  2HNI A;  2QTX A;  4X9C A;  1X01 A;  5DY9 A;  3JB9 J;  4M7A A;  5LJ5 h;  2E65 A;  4F7U G;  1KQ2 A;  4M7D A;  5GAN e;  4C92 D;  3RER A;  4M7D G;  3INZ A;  4EMK B;  5GAO m;  1N9R A;  4C92 G;  4XU3 A;  3VU3 C;  3JCM X;  4A54 A;  3RKX A;  4J5Y A;  1D3B A;  4C8Q C;  1MGQ A;  2JN0 A;  4XQ3 A;  5GMK h;  2FYK A;  3SWN A;  2FB7 A;  5LJ5 e;  5GAN d;  4M7A C;  4M7D C;  2E1H A;  3L2Z A;  1WQW A;  2RA2 A;  1YCY A;  5LJ3 j;  4V2S A;  1B34 A;  4XTZ A;  3FIF A;  4JRI A;  3FB9 A;  3BDU A;  4C8Q B;  4C8Q F;  5GAN h;  2DXU A;  5GAM f;  1BIB A;  2VXF A;  4XTW A;  2YHT A;  4C8Q D;  4XU1 A;  5LJ5 d;  5GAO l;  2EWN A;  3SWN C;  3EFS A;  3RUX A;  4M7A B;  4M7A F;  3GIB A;  4HT9 A;  1I8F A;  3JCM Q;  4F7U B;  5GAO r;  4F7U F;  4M7D B;  4M7D F;  4J6Y A;  4M7A D;  5GAN 8;  1M8V A;  5LJ3 g;  4C92 B;  1Y96 A;  4J6X A;  3JCM f;  2DJZ A;  4C92 F;  4F7U E;  5GAN 7;  4M7A G;  1U1T A;  3BW1 A;  5GAM e;  4M7D D;  4M7D E;  5GAO p;  3JCM g;  4NOY A;  4HA8 A;  3JCM V;  4C92 E;  4EMG A;  4J6W A;  4M75 G;  2EJ9 A;  4M75 A;  2Y90 A;  3QSU A;  4PJO A;  3HFO A;  4JLI A;  4M77 A;  2CGH A;  3V8K A;  3RKW A;  5GMK m;  3V8L A;  3JB9 I;  1U1S A;  3JCM J;  4PJO D;  4Y91 A;  5GAM d;  3FJP A;  4XTU A;  1B34 B;  3AHU A;  2E10 A;  4X9D A;  4DQ2 A;  3JCM W;  2YLB A;  4M75 C;  4PJO C;  4M77 C;  4JRK A;  2DTO A;  5GAM h;  4M78 A;  2E64 A;  4C8Q E;  3EFR A;  5GMK l;  3QO3 A;  5GAO q;  3PGG A;  1Y96 B;  2DZC A;  5LJ3 f;  5GMK j;  5GAN 3;  4M7A E;  3JCM h;  4M75 B;  1HXD A;  4M75 F;  4PJO B;  4PJO F;  4M77 B;  4M77 F;  4EMK A;  5GMK i;  1JBM A;  1HK9 A;  1D3B B;  2EJF A;  4M75 D;  2RB6 A;  4M78 C;  4NL2 A;  4M77 D;  4RCB A;  4XTV A;  4XTY A;  4PJO G;  3JB9 F;  4QVD A;  4M77 G;  3JB9 D;  5GAN j;  5LJ3 e;  3SWN B;  5GAN 5;  3JB9 G;  1M5Q 1;  3RKY A;  3HFN A;  4RCC A;  4MMK A;  1KQ1 A;  2VC8 A;  3RES A;  3V7C A;  3V7R A;  3JCM c;  3SB2 A;  3BY7 A;  1TH7 A;  3V7S A;  3JCM e;  3JCM b;  2E41 A;  2I2L A;  5I21 A;  4OP0 A; 
#chains in the Genus database with same CATH topology
 4AFU C;  1K73 U;  2AZV A;  4MZP A;  1XTD A;  1OU9 A;  4QVC A;  1M90 C;  3CEY A;  1KHI A;  1PD0 A;  1VQ6 Q;  3I55 A;  5LJ3 h;  3CC4 A;  2NWM A;  1NYG A;  1PKT A;  4E2F B;  2QQ9 A;  2LX7 A;  2KRS A;  3C4S A;  4OMM A;  4YTL A;  3TU4 K;  3O8V A;  4C92 C;  1QVG P;  3CCS A;  1JXM A;  1IRE B;  2F2X A;  3UA7 A;  4C8Q G;  2C0I A;  2HSP A;  1KQ2 A;  4M7D G;  1X43 A;  4XU3 A;  1MMN A;  3MEA A;  2AZS A;  3S3N A;  4R55 A;  2CUB A;  1D09 B;  4XTW A;  1MUZ A;  4XU1 A;  3OYH A;  3MJX A;  3DLL A;  3CCL Q;  2KQW A;  5GAM e;  2DO3 A;  3JCM g;  4E7I A;  1U06 A;  1VOM A;  1QQJ A;  2CSI A;  5FLX E;  3OQ5 A;  3X24 B;  2DL7 A;  4J9I A;  4LD6 A;  4DQ2 A;  4MDX A;  4PKC C;  5GAM h;  5GJV B;  1UE9 A;  3EHR A;  1G8X A;  1FMV A;  3C0C A;  3M53 A;  4M7A E;  2DXB A;  4Q5W A;  4M77 F;  1KQS A;  3JB9 D;  1SSH A;  3G71 A;  5IAY A;  3WVE B;  1K8A U;  1N8R U;  3QDR B;  5FRO A;  3QDF A;  2DL5 A;  4OF1 A;  5I21 A;  1PRL C;  1NZ9 A;  2EQI A;  2JS2 A;  2VGN A;  3OYI A;  1MNE A;  2EQK A;  2KBT A;  5A0G A;  3GPL A;  2X4X A;  2WSF E;  4F7U A;  2VWF A;  4BE0 A;  2RI3 A;  1WYX A;  3KXT A;  4DA4 A;  3ER0 A;  1K4U S;  6AT1 B;  1YJN A;  4F04 B;  3EG3 A;  4KH1 B;  2IVW A;  3MPU B;  2BKD N;  1BI0 A;  1J3T A;  4A63 B;  1TXQ A;  4JRP A;  4PNO A;  3L2W A;  1UG1 A;  2QGF B;  1WGS A;  1ZBJ A;  4F7U G;  1YFN A;  4C92 D;  4BE2 A;  1YJ9 A;  4IUQ A;  4BAC A;  2ROL A;  5KE3 A;  2DJQ A;  4ELZ C;  5A2Q E;  3CCU A;  3CCV Q;  1BBZ A;  2M9U A;  4OVA A;  4ZTF A;  1OYX A;  1NJI U;  1YWO A;  2ZPI B;  2YWW A;  1TUC A;  4XTZ A;  4RTV A;  5J26 A;  1AEY A;  2YHT A;  3CC2 Q;  2QA4 Q;  3MEU A;  1FX7 A;  4TVR A;  2VB6 A;  2COY A;  3A8O B;  2DE0 X;  3T9N A;  4PJO A;  5KCO A;  2L3S A;  3VS4 A;  3MET A;  2HCK A;  1RI0 A;  3CBO A;  1YIT Q;  1OV3 A;  3RNJ A;  3AHU A;  2X4Y A;  2E5K A;  2J06 A;  2YLB A;  2YRD A;  5C0M A;  2KNB B;  1S72 A;  1B07 A;  4ZTJ A;  2E12 A;  2VVK A;  5GAN 3;  3L2U A;  1CKB A;  1BYM A;  3G6E T;  2EBP A;  1R77 A;  3NFC A;  4RUG A;  3CCM A;  4PJO G;  4QVD A;  3VS6 A;  8AT1 B;  3LGL A;  3X26 B;  3RKY A;  3TEE A;  3ZFJ A;  3OYJ A;  2M16 A;  3EGD A;  1Q82 R;  2EYW A;  1VQ4 T;  4AG1 C;  3S3M A;  2KGT A;  3NMZ C;  2HZY A;  1JO8 A;  1TSF A;  4M77 E;  4JRQ A;  2NYS A;  2LJ1 A;  3CMA Q;  1F1B B;  1GFD A;  3PMI A;  2QQS A;  2ED1 A;  5GAN f;  2DTI A;  3HSB A;  1WZO A;  3N5B B;  3PT9 A;  1YP5 A;  1X01 A;  4PFO A;  4EIK A;  1VQL A;  3OW2 S;  2DFU A;  4HCB A;  3VU3 C;  1R8O B;  2CSQ A;  4J5Y A;  1IGU A;  1M8M A;  2NUP A;  4QQD A;  1K9M U;  1VQO A;  1GXI E;  2GQI A;  1RAG B;  5LJ5 e;  3G4S A;  4M7A C;  2D8J A;  2RQT A;  3RR6 A;  5IXB A;  1KD1 R;  1W2B A;  3I5R A;  4C8Q B;  5ECA A;  1QCN A;  2QDL A;  5HKC A;  1M2V A;  3X25 B;  2PTK A;  3I55 T;  1D1C A;  4M7D B;  3CD6 A;  3CC4 T;  4C92 F;  4M7D E;  1UEB A;  2KAF A;  2R5A A;  3BW1 A;  4M75 G;  2OTJ T;  1Q86 U;  4KGV B;  1VQ8 Q;  3R6N A;  3L2Q A;  4R56 A;  2IIM A;  3VS3 A;  1MHN A;  4JPB W;  1N27 A;  3UAT A;  2P84 A;  4QVZ A;  4HVU A;  4MZM A;  4PJO F;  1NEG A;  3CME A;  1NPP A;  3JAM E;  2EJF A;  3P8B B;  2X3X D;  3JSC A;  5GAN j;  2CZ1 B;  2O2O A;  2HKN A;  3SB2 A;  2BE7 D;  4IIO A;  3PNW C;  2C06 A;  2I0N A;  2KK4 A;  4M78 B;  2LNV A;  1PSE A;  4RG2 A;  3V8J A;  1I81 A;  1OX8 A;  4XTX A;  5GAN 6;  1YHQ T;  4BDZ A;  5CO7 A;  3SHW A;  2KRO A;  2K5F A;  3EG2 A;  1H64 1;  4LDV A;  2O4X A;  2RJF A;  4B6M A;  2ZAE A;  3M59 A;  2X3W D;  3NPF A;  2ZPG B;  4J83 A;  5CR2 A;  3QHS A;  2ABL A;  3RMQ A;  5FU7 B;  1K9A A;  4XU0 A;  3PFS A;  1OEB A;  4A53 A;  4N0A C;  3D7S B;  2YSQ A;  2PVD B;  1M3C A;  3A8L B;  5J3B A;  3JB9 J;  1MMD A;  3NHN A;  4FT2 A;  4O6J A;  2ESW A;  2PVO B;  3RKX A;  3G71 T;  2QG9 B;  3EFO A;  3M56 A;  2LQN A;  3CCE A;  2FYK A;  2F69 A;  3G1J A;  1AWW A;  2CP0 A;  1K73 R;  2LZ6 B;  2DYI A;  3OYE A;  1G3W A;  2DL4 A;  2LT4 A;  3UWN A;  4F7U B;  3GLX A;  4E7S A;  2ATC B;  4M7A D;  5LJ3 g;  4F7U E;  1QVF S;  5GAO p;  3JCM V;  1QKW A;  2DYB A;  2MIO A;  4JLI A;  1M90 U;  3E9F A;  1QCO A;  2DRK A;  3EGX B;  2H3E B;  1YJN T;  2PUO B;  4OB0 B;  2RJC A;  1M2O A;  1S1N A;  4A4G A;  3CC7 A;  2GFA A;  4M77 C;  5KYY B;  2E64 A;  5D6Y A;  2JTF A;  4DOW A;  3GNF B;  2MPX C;  2JMC A;  3GP8 A;  3CCU T;  3Q1J A;  4JJC A;  2FEI A;  2NUT B;  2GTJ A;  4FYW B;  5A0D A;  5DLO A;  3BY7 A;  2EW3 A;  5FW9 A;  2A36 A;  3G7Z A;  1LCK A;  2W10 A;  1YI2 A;  1ZA2 B;  3SFM A;  3VS5 A;  1Q95 G;  3VYH B;  2DKG A;  4BY6 B;  1VQN A;  3CPW P;  5L23 A;  3M0R A;  5HK0 A;  3H9N A;  5CQY A;  4RKU E;  1K9M C;  1VQK A;  4BD3 A;  3SD4 A;  3AT1 B;  2EYQ A;  2CZ6 B;  2RD1 A;  1GFC A;  4PJO E;  2RM4 A;  1WQ7 A;  4L59 A;  3QXE B;  2EIF A;  1ZSZ B;  3HHT B;  3NTI A;  4DEX A;  1GL5 A;  4J9C A;  1S72 T;  5GAM g;  1QVP A;  2DBK A;  1RAF B;  1TU0 B;  4X9C A;  1Q86 C;  5KYW B;  2CUD A;  3OYB A;  1UJ0 A;  1K8A R;  2J7I A;  1N8R R;  2PVG B;  1PSF A;  1QKX A;  3SWN A;  2FB7 A;  2OJ2 A;  2CP6 A;  5GAN d;  1NM7 A;  1BK2 A;  3OYC A;  3G6E Q;  1YCY A;  5HY6 A;  2KXD A;  2EGC A;  2XKO C;  2EWN A;  2RI2 A;  1PM3 A;  4KT0 E;  1I8F A;  1Q7Y C;  4OMP A;  3PTA A;  2DF6 A;  5KCH A;  1OZ3 A;  4C0D B;  1UFF A;  2YT6 A;  3EG9 A;  3CCJ Q;  1GBQ A;  1H8K A;  2IPO B;  2EKH A;  4E7L A;  2COW A;  1AWJ A;  1AVZ C;  1VQ5 A;  1T0H A;  5GJW B;  2DMO A;  3X20 B;  1VQ4 Q;  4RTX A;  4HXJ A;  2E10 A;  1H92 A;  1VA7 A;  2XD0 A;  4KUI A;  2HL5 C;  1UGS B;  2ECZ A;  4WTO B;  1VQL T;  3M4Y A;  1WXU A;  3M9Q A;  3O5Z A;  2LP5 A;  2MK5 A;  4M75 B;  1HXD A;  1RAB B;  2EQJ A;  3GIB A;  1X2K A;  3NTK A;  2EGA A;  2GFU A;  1VQ9 A;  2NUP B;  4RCB A;  3THK A;  1JQQ A;  4M77 D;  1VQO T;  3G4S T;  1KJW A;  1NJI R;  2D9T A;  1WX6 A;  4RCC A;  2H8H A;  3HRS A;  1VQ7 A;  1QVF P;  2LTO A;  1WPY A;  2RPN A;  1A0N B;  2PNI A;  2QQA A;  4C0G A;  4PFZ A;  1M27 C;  3CD6 T;  1LOJ A;  2BZY A;  3U23 A;  1ZLM A;  5LJ5 f;  2D6F A;  2FG0 A;  2F2V A;  4BI8 B;  1WJS A;  2ZCF B;  2LRQ A;  1JRI A;  3H6Z A;  2E5Q A;  1SRM A;  1I4K 1;  3OYA A;  3REA B;  1JJ2 P;  4EMK C;  2OTJ Q;  3J7A F;  2DTH A;  4C8Q A;  2YRV A;  1N9S A;  2FRY A;  4PJM A;  4PK4 A;  3PMT A;  2VV5 A;  2ZZD A;  3CME T;  4M7D A;  1VQP A;  3QYH B;  1D3B A;  3RMS A;  1MGQ A;  4ZGJ B;  2F1L A;  1VQM A;  3CCR A;  1RAA B;  1X6O A;  2E1H A;  1BI2 A;  2XK0 A;  2L89 A;  3EG0 A;  1M1K C;  2K3B A;  2HDA A;  5CKE A;  4JJN K;  4DBH A;  4J9B A;  2C0O A;  4C0F A;  2J6F A;  3EFS A;  2JXB A;  2LDM A;  4ESR A;  3PE0 A;  3OY9 A;  1O9S A;  2O4X B;  1K0X A;  2WAC A;  1E6G A;  4NOY A;  4X34 A;  2E4H A;  2KXC A;  4ZNX A;  2YUO A;  2EYY A;  4Z89 A;  3E19 A;  1YHQ Q;  1U1S A;  3WXM B;  4P5N A;  1VQ6 A;  1OQK A;  1AOJ A;  1M3A A;  3VRY A;  5KH6 A;  4PJO C;  4JDS A;  2A3L A;  4JRK A;  3OMG A;  2DTO A;  4M78 A;  1E7O A;  2V8J A;  3MEW A;  1EX4 A;  4Y28 E;  5EC7 A;  5CK9 A;  5GMK j;  1QLY A;  3DLM A;  1SRL A;  4BDY A;  2QDY B;  2KSS A;  1M1F A;  5GAN 7;  4XTV A;  3M0U A;  1SHG A;  3EFO B;  4LDU A;  4RMO A;  3CCE T;  4X1V A;  1M5Q 1;  4MMK A;  1OPL A;  4L6V 5;  1TH7 A;  2AKL A;  3OYF A;  1OPK A;  3ME9 A;  1HSQ A;  2XG8 D;  3HTR A;  4DBF A;  3G71 Q;  2Y4X A;  2NLU A;  4RG8 A;  3UT1 A;  4M78 G;  2BTT A;  4JS5 A;  1AHJ B;  4KUD K;  5LJ5 g;  2QGG A;  3PVL A;  2K57 A;  2KRM A;  3OYN A;  2HSE B;  1VIE A;  2CZ0 B;  2QEX T;  2DET A;  3M0Q A;  1CKA A;  2E3H A;  3CC7 T;  3CCL A;  1ABO A;  1WHM A;  3OS2 A;  3CXC S;  2HNI A;  4D8D A;  1PNJ A;  3S6W A;  2EYZ A;  1KG1 A;  4A54 A;  1Q81 U;  4QQ6 A;  1YJW T;  3EGX A;  3L2Z A;  1YI2 T;  2O9S A;  1IB8 A;  2XI9 A;  3CCQ Q;  1LVK A;  1WHH A;  2RA2 A;  1VQN T;  4C8Q F;  4IUP A;  4D6W A;  2FPF A;  5KYY A;  1PG5 B;  2XU8 A;  2D8H A;  4M7D F;  4J6Y A;  4B9X A;  5GAN 8;  4QT7 A;  4J6X A;  1SG5 A;  2FVU A;  1ARK A;  2P0K A;  2EJ9 A;  2Y90 A;  1BU1 A;  2PUK B;  2QI2 A;  1W1F A;  2KI7 A;  2B8A A;  1D1B A;  2NUT A;  3BE3 A;  3LH5 A;  2AK5 A;  5IHI A;  3VS7 A;  1WJQ A;  1QWE A;  3CPW A;  3QII A;  4QKU A;  3S3O A;  2LNH B;  4FW1 A;  2DIQ A;  5GMK m;  2G6F X;  4PJO D;  3FEO A;  1KC8 C;  4XTY A;  3HPW A;  2OTL Q;  2VUB A;  1T3S A;  1FMK A;  1Y71 A;  3SWN B;  1H3H A;  3RES A;  4N4H A;  3M58 A;  3V7R A;  3EHQ A;  4UC4 A;  2P0P A;  4Y92 A;  1G2B A;  4OB2 B;  1ZSZ A;  4M78 F;  4FU6 A;  3JCM d;  1WI7 A;  2QXF A;  4FIB A;  2ZPE B;  3CCV A;  1WHL A;  4BUG A;  2RN8 A;  5GAN 2;  3EG9 B;  2XDD A;  1UB4 A;  5KYW A;  1C1A A;  1M1G A;  1M90 R;  3PIO A;  2V1Q A;  3L42 A;  1WJR A;  3OSS C;  1VQ5 T;  5AYF A;  3CC2 A;  1NEB A;  3MKD A;  3BFM A;  1K0S A;  2E6N A;  2QA4 A;  4NL3 A;  4FSX A;  2AT1 B;  2E3I A;  5LL6 S;  4OB3 B;  4NS5 A;  2QTX A;  2X35 A;  2LCC A;  3SDZ A;  2E6Z A;  1VQ9 T;  2GNC A;  2RI5 A;  3QKJ A;  5CIU A;  2RO0 A;  1YIJ Q;  1TUD A;  3OYD A;  1VQL Q;  1TS9 A;  1VQ7 T;  3VJP A;  1QMC A;  2HEQ A;  1EFN A;  4J8O A;  1WQW A;  2K5L A;  1KQS S;  4HCC A;  2CZ7 B;  4F7U F;  2HD0 A;  4J9F A;  1IHW A;  2A0F B;  2DXC A;  1D1A A;  1WHK A;  3HRT A;  4M75 A;  1EIF A;  3HFO A;  2RH2 A;  1IO6 A;  5CKH A;  3CD6 Q;  3JB9 I;  2CH4 W;  2NUZ A;  2L3Q A;  2O01 E;  4K11 A;  4L5G A;  3JCM W;  3QZ9 B;  1QP2 A;  2LMJ A;  2EKO A;  3PIP A;  2A28 A;  2RHX A;  3M5A A;  4C8Q E;  4DBQ A;  3QO3 A;  1Y96 B;  5LJ3 f;  2XIC A;  1VQP T;  3CMA A;  3JCM h;  2Y4Y A;  2RNA A;  4AFQ C;  5GMK i;  2BUD A;  1D3B B;  3JCM J;  3QJY A;  5AT1 B;  4AT1 B;  1QWF A;  2X4J A;  1PKS A;  1KQ1 A;  3I56 A;  3JCM c;  2OAU A;  5KYX B;  1T3L A;  3CCS T;  2DXT A;  2ENM A;  2JW4 A;  1JJ2 A;  2MMP A;  1Q81 C;  5DLQ E;  4IUV A;  5CKD A;  1OU8 A;  1WNL A;  3VUZ A;  1UGV A;  4AFS C;  2YLC A;  2GGR A;  4LDX A;  1ABQ A;  2KR3 A;  4AG2 C;  2X9H A;  1I07 A;  4WCI A;  5I2M A;  1Q7Y U;  3JCM P;  1VQ6 T;  1JB0 E;  1OZ2 A;  1NPR A;  2JTE A;  1QVG A;  3I9Q A;  2ZGW A;  2DZ9 A;  3A8G B;  4M78 E;  2K2M A;  2JNG A;  2COZ A;  5HCK A;  1WXB A;  1VQ8 A;  2FL7 A;  4A4K A;  3L2R A;  3QJ6 A;  1QCF A;  1MMA A;  1X6G A;  2D1X A;  3OS0 A;  1Z9Q A;  2V1R A;  1JEG A;  2K2V A;  3M57 A;  1NBE B;  2MCN A;  4Z02 A;  5J39 A;  3FRN A;  4FL6 A;  2HBP A;  3LW5 E;  1AT1 B;  2DBM A;  5LJ3 j;  2F5K A;  3FB9 A;  2QAZ A;  1RL2 A;  5GAM f;  3ZBD A;  2OAW A;  3JRZ A;  2RQR A;  3SWN C;  3RUX A;  4OMO A;  1R0B G;  1D0X A;  4OMN A;  1OX9 A;  3FLG A;  4EMG A;  2CP3 A;  2ZPB B;  2CGH A;  5A0L A;  3TCJ A;  4VUB A;  1B34 B;  3A98 A;  2GBQ A;  1MMG A;  3KUF A;  4F17 A;  2D0N A;  3CQT A;  5IT9 E;  2EQM A;  2QEX Q;  4ZGD B;  2DZC A;  4RTY A;  4OMQ A;  3QYG B;  2DL8 A;  4M75 F;  5IXF A;  1R0C B;  4RTU A;  3OW2 P;  4JZ3 A;  4CC3 A;  2DX1 A;  2KVQ G;  4FW2 A;  1KK7 A;  3VV0 A;  3EH1 A;  1YJW Q;  1UGQ B;  1YWP A;  1OOT A;  4LN2 A;  1YI2 Q;  1YJ9 T;  4J9D A;  4JUV A;  2DEU A;  5GAN 4;  1W2B S;  2RMO A;  1M1K U;  2AKK A;  2DIG A;  3CBP A;  4OGC A;  2VXE A;  2CT4 A;  5GAM j;  4GLM A;  1C6V X;  4JJB A;  4KRT A;  1GRI A;  2LQ8 A;  2OI3 A;  4MML A;  2ZPH B;  3QUI A;  2JMA A;  1LNX A;  1BKB A;  3KBG A;  1Q82 U;  2RHI A;  2SEM A;  4J9G A;  1UGP B;  2VGM A;  3JCM X;  4C8Q C;  3PVQ A;  2QYZ A;  1WA7 A;  3DB4 A;  4XQ3 A;  2KT1 A;  3QZ5 B;  1WHG A;  3HP9 A;  2EFI A;  5KYN A;  4M7D C;  4R0K A;  4O5V A;  4V2S A;  5IH2 A;  3BDU A;  2RHZ A;  2DXU A;  2HL3 A;  3CCV T;  1X27 A;  3LYI A;  3H0I A;  2DA9 A;  3P8H A;  1SEM A;  2FPE A;  3E2U A;  3CCM T;  5FU6 B;  1RI9 A;  3CC2 T;  3LGF A;  7AT1 B;  2CT3 A;  3RKW A;  2PU9 B;  4ANJ A;  2LCS A;  2WSC E;  1KFZ A;  1W70 A;  4GBQ A;  1H3Z A;  2FO0 A;  4XTU A;  3M55 A;  1KD1 U;  4C5H A;  1E6H A;  2EYX A;  2HMA A;  4CC7 A;  1G83 A;  2O9V A;  4A4E A;  3QWX X;  1C0M A;  4M78 C;  1KIK A;  3HRU A;  3F70 A;  3HFN A;  4ELY C;  3JCM b;  1I0C A;  2QK0 A;  3RDV A;  5LJ3 d;  1CSK A;  3GOX A;  1OUL A;  4KUL A;  3JB9 H;  3MCA B;  1LJO A;  1SPK A;  5FU7 C;  5IN1 A;  3A8M B;  3UDC A;  2B86 A;  3G6E A;  1YBY A;  3TQ7 P;  3DB3 A;  4M75 E;  2KDS A;  1FWZ A;  1I1J A;  4OB1 B;  2D0Q B;  2YUP A;  3CCJ A;  1IZ6 A;  1PC0 A;  4QQG A;  1BCM A;  4II1 A;  2M1H A;  3FDR A;  5I11 A;  1V1C A;  1X69 A;  1SHF A;  1ZA1 B;  2RQW A;  5GAN e;  3RER A;  2YUN A;  2RHY A;  4Z88 A;  2JT4 A;  1PCX A;  3LH0 A;  2FHD A;  3I56 T;  3I55 Q;  4XK8 E;  3CC4 Q;  2KRN A;  4ATO A;  2F2W A;  1KC8 U;  5GAN h;  2DD5 A;  4C8Q D;  1VIF A;  2L2P A;  1RAE B;  4ZN1 A;  5GAO r;  3JCM Q;  2G3R A;  2FRW A;  1Y96 A;  3A1P A;  3J81 E;  4M7D D;  3IQL A;  3CCS Q;  3H0F A;  3QSU A;  1Z9Z A;  4FM4 B;  2KE9 A;  2L0A A;  1B3Q A;  4BI4 A;  1D0Y A;  1IGQ A;  1RUW A;  3KFV A;  2JUF A;  2P0Q A;  5GAM d;  1IHV A;  3GF5 A;  5I2S A;  3SEM A;  1SKU B;  3LWI A;  5KYX A;  1N5Z A;  3FJ5 A;  4RTZ A;  4DBR A;  3QBY A;  1AWO A;  4IUT A;  2RQU A;  4J9H A;  1VQ8 T;  3BDL A;  1HK9 A;  1LPL A;  1WFW A;  2F5T X;  4KH0 B;  2XDB A;  2CH4 A;  4BY6 C;  3DKM A;  2OTJ A;  5GAN 5;  2VKN A;  3VS2 A;  1SF9 A;  1Q82 C;  2DD4 A;  2DVJ A;  5LJ5 j;  2RJD A;  1O75 A;  2BE9 B;  1RLP C;  4M78 D;  3OYK A;  1WXT A;  2EJG A;  3LLR A;  2Z0W A;  3M4G A;  3RIR A;  1ZSG A;  1TWB A;  2J6K A;  3M0T A;  1RAC B;  3C94 A;  3L1A A;  3MEV A;  1UTI A;  3GNG A;  1ZSZ C;  4E6R A;  2KYB A;  1K9M R;  1ZBX A;  2EPD A;  2M02 A;  2CP7 A;  3R6O A;  4N4G A;  2EAY A;  2GQV A;  4PJJ A;  1XJW B;  5FU6 C;  1TUG B;  3MHX A;  4HKE A;  2MAM A;  1YHQ A;  4BE1 A;  1G3T A;  2LC4 A;  2DRM A;  4ZN3 A;  1KD1 C;  1Q86 R;  1VUB A;  3EAE A;  3TRE A;  5I22 A;  3OMC A;  2SRC A;  3UF4 A;  2DLP A;  2DNU A;  2EQU A;  3OYM A;  4C0D C;  1B34 A;  3M0S A;  4F16 A;  2RK2 A;  4PFP A;  4M7A B;  4HT9 A;  1YJN Q;  1G5V A;  5CQX A;  1M8V A;  4E7Z A;  4ZGE B;  4IKF A;  2VYT A;  4A4F A;  5HK3 A;  4HA8 A;  2CYZ B;  1Q7Y R;  1PHT A;  2LCL A;  1NYF A;  1FXX A;  2GCX A;  3OW2 A;  1WDX A;  2JS0 A;  1YJ9 Q;  1YN8 A;  1EZZ B;  4KBM B;  4M75 C;  3L2V A;  1GCQ A;  3CCU Q;  3VRZ A;  3OS1 A;  1AZG B;  3EFR A;  1W6X A;  1Y57 A;  2JZ2 A;  4CC4 B;  3QWY A;  1VQK T;  3HL8 A;  2K5I A;  2X4W A;  3E9G A;  2LJ3 A;  2HQX A;  4EMK A;  2K3Y A;  4NL2 A;  2XDP A;  2R58 A;  2RQV A;  5D7U A;  1MV0 B;  4HCZ A;  3JB9 G;  2DL3 A;  4LDY A;  5FRM A;  4PJN A;  1XQH A;  2QAS A;  4HT8 A;  1BB9 A;  3P8D A;  4IUU A;  5D6W A;  3M0P A;  1ZUY A;  4AFZ C;  3OB9 A;  4ME7 A;  4RTT A;  1X2Q A;  4CC2 A;  2DVE A;  5CKB A;  2O88 A;  1UHF A;  4C92 A;  1RAH B;  4E7K A;  3CCQ A;  2MWP A;  3LWH A;  1BI1 A;  2DEQ A;  5CVI A;  4PLI A;  2DPP B;  1S72 Q;  2BZ8 A;  1OI1 A;  2MF2 A;  2A08 A;  1FYN A;  2KEA A;  3CCM Q;  4KGZ B;  3A5Z B;  4C5G A;  2ED0 A;  4Z8A A;  5GAO n;  4WF2 A;  5CCA A;  1PD1 A;  1ZUK A;  3CBM A;  3EH2 A;  1WIE A;  4LUD A;  4C92 G;  1HJD A;  4LDW A;  1K73 C;  4A4H A;  4OMF B;  2E70 A;  2JN0 A;  1AWX A;  1G3S A;  4B9W A;  2V8K A;  2DAQ A;  2QTV A;  2LX9 A;  4DOV A;  4EDU A;  5LJ5 d;  5GAO l;  2OTL A;  3MP8 A;  1M1K R;  1VYT A;  2K7A A;  1YIT A;  1XOV A;  1MND A;  2YUQ A;  2L3R A;  3V8K A;  3J80 E;  3V8L A;  1NG2 A;  3FJP A;  3OS5 A;  3CCJ T;  4PL6 A;  3GBQ A;  3URG A;  4BI3 A;  2HBW A;  1VQO Q;  3G4S Q;  5GAO q;  3CPF A;  1IRX A;  2RF0 A;  1P92 A;  3I5S A;  4M77 B;  4M75 D;  2CS7 A;  3JB9 F;  1NLO C;  2K79 A;  3CXC P;  2R57 A;  2QQB A;  1HD3 A;  2LVM A;  1TTH B;  3JCM e;  3V7S A;  4OML A;  2DER A;  2I2L A;  1TOV A;  3H41 A;  1QVF A;  2FZC B;  4CRI A;  1AZE A;  2QQR A;  2WSE E;  5KYU B;  3I56 Q;  1YIJ A;  5CAI A;  3RBB B;  3ASK A;  4HCK A;  1QP3 A;  2AHJ B;  3MP6 A;  1VQM T;  3CCR T;  3TSZ A;  4FYX B;  1SSF A;  3CME Q;  3ZL7 C;  2HAX A;  2HKQ B;  2P4T A;  1YCS B;  5GMK e;  4OGE A;  2FZG B;  4FSS A;  1K8A C;  5DM7 R;  1N8R C;  5LJ5 h;  2E65 A;  1AD5 A;  2EGE A;  3INZ A;  3MO8 A;  1N9R A;  3UA6 A;  3CPW S;  1Y07 A;  5GMK h;  3OYG A;  2BIV A;  2CKK A;  1W4S A;  4LNP A;  1UDL A;  4GY5 A;  3FIF A;  2MOX A;  2GTO A;  5FWB A;  2YRC A;  2BZX A;  2AIR B;  9ATC B;  2VAS A;  1X75 C;  2KY9 A;  2CDT A;  3EGU A;  4AMC A;  2XHC A;  3C12 A;  3OBY A;  4GLK A;  1NLP C;  3EG1 A;  2DK3 A;  2ZPF B;  4X9D A;  3E1S A;  1M4Z A;  2R5M A;  2K9G A;  3CCE Q;  4MZT A;  3TVT A;  4QW2 A;  4JZ4 A;  2H3J A;  3FC3 A;  1NJI C;  4FT4 A;  2KMT A;  3OBW A;  4MDW A;  4EPC A;  2RB6 A;  1NE8 A;  2K3X A;  5C6S A;  1GCP A;  1ACM B;  2RJE A;  4LE9 A;  3CCL T;  1KC8 R;  3A8H B;  2J6O A;  4PLL A;  3VS0 A;  5GAN g;  3NGP A;  3WVD B;  2PQW A;  4C5I A;  2ROT A;  1WHJ A;  1I5O B;  3VS1 A;  4DEY A;  3CC7 Q;  2JJ9 A;  1KQS P;  3QG1 A;  1V29 B;  1N6A A;  3H0H A;  4LUE A;  4EMH A;  2LT1 A;  2CP5 A;  4XU2 A;  1GBR A;  5FRN A;  1PRM C;  1VYV A;  3OSV A;  1B7T A;  1BIA A;  2MYS A;  4BB7 A;  4M7A A;  2L3P A;  4EMK B;  5GAO m;  1VQN Q;  1K1Z A;  1VQK Q;  4KGX B;  2QEX A;  4E7H A;  1X6B A;  2OX7 A;  2PZ1 A;  1BCO A;  3JV3 A;  1XNI A;  3REB B;  1JXO A;  1BIB A;  2VXF A;  1G3Y A;  4N4I A;  3I35 A;  1ZX6 A;  4J7I A;  1UGR B;  8ATC B;  4C92 B;  4M7A G;  2DJZ A;  4C0Z A;  1U3O A;  2DM1 A;  3ZEH A;  1U1T A;  3CCQ T;  3HKS A;  4C92 E;  2KYM A;  1JJ2 S;  4J6W A;  2RK1 A;  3M54 A;  1HYO A;  1BI3 A;  1YJW A;  2XID A;  2XMF A;  2K4Y A;  2CP2 A;  2YXY A;  3PGG A;  2JTM A;  4FYV B;  4PJO B;  1QVG S;  1JBM A;  5IHN A;  1ZUU A;  4M4Z A;  4FCY A;  3C95 A;  3X28 B;  1DJ7 B;  4IUR A;  2VC8 A;  5EG2 A;  3V7C A;  2QA4 T;  2HQH A;  2E41 A;  2KT8 A;  2M51 A;  2IG0 A;  4JLG A;  2W0Z A;  4LD9 K;  2V26 A;  2OTL T;  1VQ5 Q;  3ULR B;  2M0Y A;  1M9S A;  1V76 A;  5D6X A;  1UUE A;  4XAX B;  1U5S A;  1YIT T;  2MI6 A;  1Q81 R;  2FZK B;  4N0A A;  1UEC A;  3LX7 A;  2MWO A;  3VUB A;  3VYG A;  3OYL A;  2EVR A;  1ZQ1 A;  1ZHI A;  1D0Z A;  4J9E A;  1IXD A;  2C0T A;  2K6D A;  2O31 A;  1Y0M A;  1QW1 A;  1VQ9 Q;  3EGD B;  1Y7X A;  1PWT A;  1UHC A;  1RAD B;  4PJL A;  1KSW A;  1VQ7 Q;  1T0J A;  5DY9 A;  3H8Z A;  4D8K A;  2P4R A;  2RHU A;  4HVV A;  5CKF A;  5FWC A;  4RTW A;  1RLQ C;  2HQE A;  1JU5 C;  1KHC A;  1YNZ A;  1FMW A;  2JVV A;  4F14 A;  2FPD A;  2X51 A;  4JJD A;  4JRI A;  1K76 A;  5M9O A;  4C5E A;  1YIJ T;  1RAI B;  1VYU A;  2JM8 A;  4M7A F;  3OYY A;  1WLP B;  3QPH A;  3CMA T;  1VQ4 A;  3JCM f;  1TG0 A;  4HVW A;  4M77 A;  4J7F A;  2LJ0 A;  4FYY B;  5L8R E;  3CXC A;  4JS4 A;  4Y91 A;  2A7Y A;  2LQW A;  1VQP Q;  1MV3 A;  1U8R A;  1W2B P;  1VQM Q;  4ORZ A;  1M2V B;  3MP1 A;  3CCR Q;  5GMK l;  5KYU A;  4IIM A;  4CI0 C;  3NTH A;  2A37 A;  1UJY A;  4LXC A;  5KE2 A;  1M3B A;  2DIL A;  2L8D A;  1M30 A;  1GCQ C;  3TSW A;  4E47 A;  3OA6 A;  2J05 A;  2YDL A;  3VKI A;  4M77 G;  5IHK A;  4E7J A;  5LJ3 e;  2L5Q A;  2CRE A;  2JOY A;  2V8I A;  3UPU A;  1I5L A;  2GF7 A;  2JM9 A;  2M0O A;  2LQK A;  4OP0 A; 
#chains in the Genus database with same CATH homology
 2DXT A;  1YI2 A;  4HT8 A;  1JJ2 A;  3SFM A;  3VYH B;  4BY6 B;  2DKG A;  1K73 U;  4MZP A;  1VQN A;  1XTD A;  2MMP A;  3P8D A;  4IUU A;  5D6W A;  4QVC A;  1Q81 C;  1M90 C;  5HK0 A;  5DLQ E;  4IUV A;  5CQY A;  3CEY A;  3OB9 A;  4ME7 A;  5CKD A;  1KHI A;  4RKU E;  1WNL A;  1K9M C;  3VUZ A;  1VQK A;  3I55 A;  4BD3 A;  2DVE A;  5LJ3 h;  3SD4 A;  5CKB A;  2YLC A;  2EYQ A;  4C92 A;  3CC4 A;  4E7K A;  4LDX A;  3CCQ A;  2CZ6 B;  2MWP A;  3LWH A;  1BI1 A;  2QQ9 A;  2RD1 A;  2DEQ A;  5CVI A;  4PLI A;  2DPP B;  4PJO E;  2RM4 A;  1WQ7 A;  5I2M A;  3C4S A;  1OI1 A;  1Q7Y U;  4L59 A;  3JCM P;  1VQ6 T;  3QXE B;  4YTL A;  2EIF A;  3O8V A;  2MF2 A;  3TU4 K;  4C92 C;  1JB0 E;  1OZ2 A;  3HHT B;  1NPR A;  3NTI A;  3CCS A;  1QVG A;  1IRE B;  3A5Z B;  2ZGW A;  4C5G A;  2DZ9 A;  3A8G B;  4C8Q G;  5GAM g;  5GAO n;  1S72 T;  1QVP A;  4M78 E;  4WF2 A;  2JNG A;  5CCA A;  4X9C A;  3CBM A;  1Q86 C;  1VQ8 A;  2FL7 A;  4A4K A;  1KQ2 A;  4M7D G;  3L2R A;  3QJ6 A;  4C92 G;  3OYB A;  4XU3 A;  3MEA A;  4LDW A;  1K73 C;  3OS0 A;  4A4H A;  4OMF B;  2PVG B;  2K2V A;  2E70 A;  2JN0 A;  1PSF A;  3M57 A;  1G3S A;  2FB7 A;  4Z02 A;  3SWN A;  4B9W A;  5J39 A;  3FRN A;  5GAN d;  4FL6 A;  4R55 A;  2HBP A;  3OYC A;  2V8K A;  3LW5 E;  2DAQ A;  1YCY A;  5LJ3 j;  2LX9 A;  5HY6 A;  4DOV A;  4EDU A;  2F5K A;  3FB9 A;  2XKO C;  1RL2 A;  5GAM f;  4XTW A;  5LJ5 d;  4XU1 A;  3OYH A;  3ZBD A;  5GAO l;  2EWN A;  3JRZ A;  2OTL A;  3SWN C;  2RI2 A;  3RUX A;  4KT0 E;  3DLL A;  1I8F A;  1Q7Y C;  3MP8 A;  3PTA A;  2KQW A;  1OZ3 A;  5KCH A;  4C0D B;  5GAM e;  2DO3 A;  3JCM g;  4E7I A;  3FLG A;  1XOV A;  4EMG A;  1YIT A;  2ZPB B;  2CGH A;  4E7L A;  2L3R A;  3V8K A;  3J80 E;  1VQ5 A;  3V8L A;  3X20 B;  5FLX E;  5A0L A;  3TCJ A;  3OQ5 A;  3X24 B;  3FJP A;  3OS5 A;  4VUB A;  1B34 B;  2E10 A;  4LD6 A;  4DQ2 A;  3CCJ T;  3KUF A;  4PL6 A;  3CCS T;  4MDX A;  3URG A;  4BI3 A;  4PKC C;  2XD0 A;  5GAM h;  2EQM A;  4KUI A;  5IT9 E;  1UGS B;  5GAO q;  4ZGD B;  3CPF A;  1VQL T;  3M4Y A;  1P92 A;  2DZC A;  3M53 A;  3M9Q A;  4M7A E;  2DXB A;  4M75 B;  1HXD A;  3QYG B;  4M75 F;  4Q5W A;  4M7D D;  2EQJ A;  4M77 B;  4M77 F;  3GIB A;  3NTK A;  4M75 D;  2GFU A;  1VQ9 A;  2CS7 A;  4RCB A;  3JB9 F;  4M77 D;  1KQS A;  1VQO T;  3JB9 D;  3G4S T;  3G71 A;  2R57 A;  5IAY A;  2QQB A;  2D9T A;  3WVE B;  1K8A U;  4RCC A;  1N8R U;  2LVM A;  3QDR B;  5FRO A;  3JCM e;  3V7S A;  3HRS A;  1VQ7 A;  2LTO A;  2I2L A;  1WPY A;  4OF1 A;  5I21 A;  1QVF A;  2QQA A;  1NZ9 A;  2VGN A;  2KVQ G;  3OYI A;  4C0G A;  4CRI A;  2EQK A;  2QQR A;  2WSE E;  3VV0 A;  2X4X A;  5A0G A;  3GPL A;  2WSF E;  1YIJ A;  3CD6 T;  1LOJ A;  1UGQ B;  5CAI A;  5LJ5 f;  4F7U A;  3ASK A;  1YJ9 T;  1QP3 A;  2AHJ B;  4JUV A;  4BI8 B;  1WJS A;  2ZCF B;  3MP6 A;  4BE0 A;  2RI3 A;  5GAN 4;  1W2B S;  3KXT A;  1M1K U;  4M7D E;  2LRQ A;  4DA4 A;  1JRI A;  2DIG A;  3CBP A;  1VQM T;  4OGC A;  2VXE A;  3CCR T;  3H6Z A;  2E5Q A;  5GAM j;  3ER0 A;  1I4K 1;  1YJN A;  3OYA A;  1SSF A;  2LQ8 A;  2HAX A;  4MML A;  2IVW A;  2P4T A;  2ZPH B;  4EMK C;  2BKD N;  1BI0 A;  5GMK e;  3J7A F;  2DTH A;  3QUI A;  4OGE A;  4C8Q A;  2YRV A;  1N9S A;  1M8V A;  1LNX A;  4JRP A;  4PNO A;  3L2W A;  1BKB A;  3KBG A;  1K8A C;  5DM7 R;  1N8R C;  1Q82 U;  3PMT A;  2VV5 A;  1WGS A;  2RHI A;  1XQH A;  2ZZD A;  2E65 A;  4F7U G;  5LJ5 h;  3CME T;  4M7D A;  4C92 D;  4BE2 A;  1UGP B;  3INZ A;  1YJ9 A;  4IUQ A;  3MO8 A;  1N9R A;  4BAC A;  1VQP A;  2VGM A;  3QYH B;  5KE3 A;  4C8Q C;  3JCM X;  1D3B A;  4ELZ C;  3RMS A;  5A2Q E;  1MGQ A;  3CCU A;  4ZGJ B;  3CPW S;  1VQM A;  1Y07 A;  2M9U A;  3DB4 A;  4XQ3 A;  5GMK h;  3QZ5 B;  3OYG A;  4OVA A;  3HP9 A;  2EFI A;  2BIV A;  3CCR A;  4ZTF A;  1OYX A;  1NJI U;  1X6O A;  4M7D C;  2E1H A;  4O5V A;  1BI2 A;  1W4S A;  2CKK A;  2XK0 A;  2ZPI B;  2L89 A;  4GY5 A;  4V2S A;  4XTZ A;  3FIF A;  5J26 A;  3BDU A;  1M1K C;  2RHZ A;  2DXU A;  5CKE A;  4JJN K;  2YHT A;  3CCV T;  4C0F A;  3EFS A;  2LDM A;  3LYI A;  3P8H A;  3MEU A;  3OY9 A;  1FX7 A;  4TVR A;  1O9S A;  2O4X B;  2WAC A;  3A8O B;  4NOY A;  4X34 A;  3T9N A;  3CCM T;  1X75 C;  2KY9 A;  5FU6 B;  5KCO A;  4PJO A;  3CC2 T;  3LGF A;  3MET A;  1RI0 A;  3RKW A;  2PU9 B;  2XHC A;  3C12 A;  3E19 A;  3OBY A;  1U1S A;  4GLK A;  2WSC E;  2D6F A;  3CBO A;  3V7C A;  3WXM B;  4P5N A;  1VQ6 A;  4XTU A;  1H3Z A;  3AHU A;  2DK3 A;  2X4Y A;  2ZPF B;  4X9D A;  3M55 A;  2YLB A;  5KH6 A;  4PJO C;  1KD1 U;  3E1S A;  1M4Z A;  4JDS A;  2R5M A;  4C5H A;  2A3L A;  4JRK A;  5C0M A;  3OMG A;  2DTO A;  4M78 A;  4MZT A;  1S72 A;  4QW2 A;  2H3J A;  3MEW A;  2V8J A;  3FC3 A;  4Y28 E;  5CK9 A;  4ZTJ A;  2E12 A;  5GMK j;  1NJI C;  3DLM A;  5GAN 3;  4FT4 A;  3L2U A;  2KMT A;  3OBW A;  4BDY A;  1BYM A;  4A4E A;  2QDY B;  4MDW A;  3G6E T;  2KSS A;  1M1F A;  3NFC A;  4EPC A;  4XTV A;  5GAN 7;  2RB6 A;  4M78 C;  3CCM A;  4LDU A;  1NE8 A;  4PJO G;  2K3X A;  4QVD A;  3HRU A;  4RMO A;  3CCE T;  3F70 A;  3LGL A;  5C6S A;  3X26 B;  1M5Q 1;  3RKY A;  3HFN A;  4MMK A;  4ELY C;  3JCM b;  4L6V 5;  2RJE A;  1TH7 A;  3TEE A;  3OYF A;  3CCL T;  3ZFJ A;  3ME9 A;  3OYJ A;  3A8H B;  2XG8 D;  5LJ3 d;  4PLL A;  3GOX A;  2Y4X A;  2NLU A;  5GAN g;  3WVD B;  2PQW A;  4RG8 A;  3UT1 A;  4M78 G;  1VQ5 T;  4JS5 A;  2M16 A;  4KUL A;  4C5I A;  1VQ4 T;  3JB9 H;  3S3M A;  3MCA B;  1AHJ B;  1LJO A;  5FU7 C;  4KUD K;  5IN1 A;  3A8M B;  5LJ5 g;  3UDC A;  3G6E A;  2K57 A;  1YBY A;  3QG1 A;  1V29 B;  3DB3 A;  1N6A A;  2KDS A;  4M75 E;  3OYN A;  4M77 E;  4JRQ A;  4EMH A;  1VIE A;  2CZ0 B;  2LT1 A;  4XU2 A;  2QEX T;  1FWZ A;  4OB1 B;  2D0Q B;  5FRN A;  3CC7 T;  3CCL A;  3PMI A;  2QQS A;  3OSV A;  3OS2 A;  5GAN f;  3CCJ A;  1IZ6 A;  2DTI A;  1BIA A;  4QQG A;  4II1 A;  2M1H A;  3FDR A;  3N5B B;  3HSB A;  3PT9 A;  3CXC S;  2HNI A;  4BB7 A;  1X01 A;  4M7A A;  1VQL A;  3OW2 S;  5GAN e;  3RER A;  3S6W A;  2RHY A;  4EMK B;  5GAO m;  4HCB A;  3VU3 C;  1R8O B;  1KG1 A;  4A54 A;  1Q81 U;  4J5Y A;  3LH0 A;  2FHD A;  4QQD A;  4QQ6 A;  3I56 T;  1VQO A;  1K9M U;  1GXI E;  5LJ5 e;  2QEX A;  4XK8 E;  3G4S A;  1YJW T;  4E7H A;  4M7A C;  3L2Z A;  1YI2 T;  1XNI A;  2XI9 A;  2RA2 A;  1W2B A;  4ATO A;  1VQN T;  4C8Q B;  4C8Q F;  4IUP A;  4D6W A;  5GAN h;  1KC8 U;  1BIB A;  2DD5 A;  1G3Y A;  2VXF A;  4C8Q D;  1VIF A;  5HKC A;  2XU8 A;  4N4I A;  3X25 B;  4ZN1 A;  3I55 T;  5GAO r;  3JCM Q;  4J7I A;  2G3R A;  4M7D B;  1UGR B;  3CD6 A;  4J6Y A;  4B9X A;  5GAN 8;  3CC4 T;  4M7D F;  4C92 B;  1Y96 A;  4J6X A;  4C92 F;  2DJZ A;  4C0Z A;  2FVU A;  1UEB A;  2KAF A;  1U1T A;  2P0K A;  2R5A A;  3BW1 A;  3HKS A;  3ZEH A;  4C92 E;  3CCQ T;  3QSU A;  1JJ2 S;  4J6W A;  4M75 G;  2EJ9 A;  2RK1 A;  2Y90 A;  4FM4 B;  2PUK B;  2QI2 A;  3M54 A;  2OTJ T;  4BI4 A;  1Q86 U;  1BI3 A;  2B8A A;  5GAM d;  2JUF A;  2P0Q A;  1YJW A;  3L2Q A;  2XID A;  3GF5 A;  5I2S A;  4R56 A;  3LWI A;  1WJQ A;  1MHN A;  2K4Y A;  3CPW A;  3QBY A;  4IUT A;  3QII A;  3S3O A;  1N27 A;  3PGG A;  1VQ8 T;  2JTM A;  3BDL A;  4QVZ A;  4MZM A;  4PJO B;  4PJO F;  3CME A;  1NPP A;  1QVG S;  3JAM E;  1JBM A;  1HK9 A;  2DIQ A;  2EJF A;  2F5T X;  3P8B B;  5GMK m;  3FEO A;  1KC8 C;  4XTY A;  2XDB A;  3HPW A;  4BY6 C;  3DKM A;  4PJO D;  3JSC A;  2OTJ A;  2VUB A;  3C95 A;  5GAN j;  1Y71 A;  3SWN B;  5GAN 5;  3X28 B;  2CZ1 B;  1DJ7 B;  4IUR A;  2VC8 A;  4N4H A;  3M58 A;  5EG2 A;  3RES A;  4UC4 A;  3SB2 A;  2P0P A;  3V7R A;  2QA4 T;  1Q82 C;  2E41 A;  2DD4 A;  4JLG A;  2IG0 A;  3PNW C;  2C06 A;  2KK4 A;  4M78 B;  4OB2 B;  4M78 F;  5LJ5 j;  2RJD A;  1O75 A;  2LNV A;  4FU6 A;  1PSE A;  4LD9 K;  2OTL T;  4M78 D;  3OYK A;  3JCM d;  3LLR A;  2EJG A;  4RG2 A;  3M4G A;  3RIR A;  2QXF A;  1I81 A;  4FIB A;  4XTX A;  3V8J A;  2ZPE B;  1M9S A;  5GAN 6;  3CCV A;  1YHQ T;  4BUG A;  3C94 A;  5CO7 A;  3L1A A;  5D6X A;  4BDZ A;  2K5F A;  3MEV A;  5GAN 2;  4XAX B;  2XDD A;  1UB4 A;  3GNG A;  1YIT T;  1H64 1;  2MI6 A;  4LDV A;  1M1G A;  2O4X A;  2RJF A;  3PIO A;  3L42 A;  3M59 A;  1WJR A;  3OSS C;  4N0A A;  3LX7 A;  3VUB A;  1ZBX A;  2MWO A;  2ZPG B;  5AYF A;  3VYG A;  3OYL A;  3CC2 A;  4J83 A;  1ZQ1 A;  3BFM A;  5CR2 A;  1ZHI A;  3QHS A;  3RMQ A;  5FU7 B;  2E6N A;  3R6O A;  4N4G A;  2QA4 A;  2EAY A;  4XU0 A;  4NL3 A;  2GQV A;  3PFS A;  1QW1 A;  4FSX A;  4A53 A;  5FU6 C;  4N0A C;  3MHX A;  4HKE A;  5LL6 S;  1Y7X A;  4OB3 B;  2MAM A;  4NS5 A;  2QTX A;  2X35 A;  2PVD B;  3A8L B;  5J3B A;  5DY9 A;  3JB9 J;  2LCC A;  3H8Z A;  4BE1 A;  1YHQ A;  3J81 E;  1G3T A;  4FT2 A;  3SDZ A;  2E6Z A;  2LC4 A;  2RHU A;  4O6J A;  1VQ9 T;  2RI5 A;  3QKJ A;  2PVO B;  5CIU A;  3RKX A;  3G71 T;  5CKF A;  2RO0 A;  4ZN3 A;  1KD1 C;  3M56 A;  3OYD A;  1VUB A;  3EAE A;  2HQE A;  3TRE A;  2FYK A;  3CCE A;  1VQ7 T;  2F69 A;  3OMC A;  3VJP A;  1KHC A;  4J8O A;  1WQW A;  2EQU A;  3OYM A;  2JVV A;  4C0D C;  1B34 A;  4JRI A;  5M9O A;  2K5L A;  4C5E A;  3OYE A;  1G3W A;  2RK2 A;  1YIJ T;  2LT4 A;  1KQS S;  4HCC A;  4M7A B;  3UWN A;  4M7A F;  4HT9 A;  3OYY A;  2CZ7 B;  3GLX A;  4F7U B;  2HD0 A;  3QPH A;  5CQX A;  4F7U F;  4M7A D;  4IKF A;  4ZGE B;  5LJ3 g;  3CMA T;  1VQ4 A;  2DXC A;  3JCM f;  4F7U E;  2VYT A;  4A4F A;  3HRT A;  1QVF S;  5GAO p;  5HK3 A;  3JCM V;  4HA8 A;  4M75 A;  1EIF A;  2CYZ B;  3HFO A;  4JLI A;  4M77 A;  1M90 U;  2RH2 A;  4J7F A;  3E9F A;  5CKH A;  5L8R E;  3CXC A;  3JB9 I;  4JS4 A;  2LCL A;  1YJN T;  2PUO B;  4Y91 A;  4OB0 B;  2RJC A;  1FXX A;  2A7Y A;  2GCX A;  2O01 E;  4L5G A;  3OW2 A;  3S3N A;  3JCM W;  1U8R A;  4KBM B;  4M75 C;  3QZ9 B;  4A4G A;  3CC7 A;  2GFA A;  1QP2 A;  3L2V A;  4M77 C;  3OS1 A;  2EKO A;  3PIP A;  3MP1 A;  2E64 A;  2RHX A;  1G5V A;  5D6Y A;  3M5A A;  4C8Q E;  3EFR A;  5GMK l;  3QO3 A;  2JZ2 A;  1VQK T;  1Y96 B;  2JTF A;  3HL8 A;  4DOW A;  3GNF B;  3NTH A;  4CI0 C;  5LJ3 f;  5KE2 A;  2XIC A;  2L8D A;  1VQP T;  3CMA A;  2K5I A;  2X4W A;  2Y4Y A;  3E9G A;  3JCM h;  4E47 A;  3OA6 A;  3GP8 A;  2HQX A;  4EMK A;  5GMK i;  3CCU T;  2BUD A;  1D3B B;  2K3Y A;  4NL2 A;  2XDP A;  3JCM J;  3Q1J A;  2R58 A;  3VKI A;  3QJY A;  4M77 G;  4HCZ A;  5LJ3 e;  4E7J A;  2X4J A;  2L5Q A;  3JB9 G;  2JOY A;  5DLO A;  5A0D A;  2V8I A;  3UPU A;  1KQ1 A;  4LDY A;  2GF7 A;  3I56 A;  1I5L A;  3JCM c;  3BY7 A;  2OAU A;  5FRM A;  4M7A G;  2M0O A;  3G7Z A;  2LQK A;  4OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...