4J9CA

Crystal structure of the abl-sh3 domain h59q-n96t mutant complexed with the designed high-affinity peptide ligand p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNQTGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed high-affinity peptide ligand P17
rcsb
source organism Homo sapiens
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9cA00
2EYZA 1M3AA 1I0CA 3U23A 4CC4B 1JO8A 1TUDA 4HCKA 2LQWA 2KROA 4RTXA 1VA7A 3PVQA 1BU1A 2DILA 4CC2A 2KGTA 1WYXA 1SRLA 2K2MA 3VS4A 4CC3A 2DVJA 2RMOA 2EPDA 2X3WD 2B86A 2GGRA 2EGCA 2XMFA 1FYNA 4F14A 1NLOC 1W70A 2GTJA 3I9QA 2C0OA 1AVZC 1WXBA 3A98A 1PKTA 3UA6A 1UJ0A 4RTVA 5I11A 3VS6A 5IXBA 1M30A 2J6FA 1UTIA 3M0QA 3H0FA 3M0RA 2GBQA 2EYWA 2DL3A 2FRWA 3QWXX 2DRMA 1HSQA 2JT4A 1YWPA 3THKA 3EHRA 4OMMA 1OPKA 1CKAA 3UA7A 1WA7A 2SRCA 2RN8A 2L0AA 1QKWA 1NEGA 4OMNA 1UE9A 2NWMA 5IHKA 2CDTA 3VS7A 5IH2A 1AWWA 2JXBA 1AWOA 4DEXA 2K9GA 2D8JA 4ESRA 2K79A 1K9AA 2DJQA 1AOJA 4J9EA 1SHGA 2RQTA 1WIEA 2BZXA 1S1NA 2O2OA 1K1ZA 2DRKA 2RQWA 1X69A 1WLPB 2CSQA 4IIMA 2FG0A 3I35A 4JJBA 4RTWA 2CT4A 2AZVA 3ZL7C 4GLMA 2MCNA 1PHTA 2L2PA 2HEQA 3EG1A 2LQNA 1T0JA 1GCPA 1J3TA 5FWBA 1HJDA 1EFNA 1JXMA 2KNBB 1X27A 2KRMA 1IO6A 2RQUA 2W0ZA 4ORZA 2JW4A 2OAWA 4K11A 4F16A 2J7IA 3UATA 2JM8A 1W6XA 2A08A 4AG2C 1WFWA 2VVKA 1E6HA 3QWYA 1WXTA 1NM7A 4GBQA 2YDLA 1HD3A 2JM9A 2KYBA 2HBWA 2BTTA 2GTOA 1JEGA 1MV0B 1RLPC 2CH4W 3RNJA 1UHFA 2CT3A 2D0NA 2EYXA 2FPDA 1TUCA 3M0SA 4LUEA 1VYTA 4JJCA 5I22A 1GCQC 1OPLA 1JQQA 5ECAA 2IIMA 2OJ2A 4HVUA 3VS0A 1NLPC 4LNPA 1SPKA 5FW9A 5IHIA 2PNIA 1RUWA 2AKLA 1PWTA 1ABQA 2J05A 4AG1C 1WI7A 1H3HA 2DA9A 2DNUA 2EGEA 1WXUA 1I07A 2AKKA 1ZSGA 2DL4A 2CSIA 4HVVA 5GJWB 2LX7A 3IQLA 2EKHA 2YUPA 1M3BA 3EG2A 3VRZA 2FRYA 2L3QA 4AFUC 4E6RA 3NGPA 4RTYA 2FO0A 2ED0A 2LCSA 2EBPA 1Y0MA 1QCFA 3FJ5A 3VS2A 2KRSA 2CUBA 1E7OA 4J9DA 2KE9A 3EGUA 4RTZA 4HXJA 2LJ0A 5IXFA 1QWEA 3PE0A 1AD5A 4CC7A 2EW3A 2LNHB 2V1QA 2ABLA 2QDLA 1UHCA 2PTKA 2H8HA 1OEBA 3KFVA 2O31A 4FSSA 4X1VA 3R6NA 1MV3A 2F2WA 1BK2A 1ZLMA 2J6KA 3NHNA 1PRLC 1KFZA 3CQTA 2DL5A 3GBQA 1FMKA 2KRNA 3TVTA 4HVWA 1MUZA 1ABOA 1B3QA 1SHFA 3VS1A 3LH5A 4Z88A 1QWFA 1VYUA 2RQRA 2HSPA 2A36A 5L23A 1SSHA 2ENMA 3H0HA 2KR3A 2K3BA 1KIKA 1X2KA 4M4ZA 2CUDA 1OV3A 2LZ6B 2CH4A 1M8MA 1AWJA 2A28A 1NYGA 2EQIA 1GFCA 3VS5A 3SHWA 1BB9A 2ROLA 1VYVA 2MIOA 2RQVA 3PVLA 2KXCA 4IIOA 3UF4A 3TSWA 5IHNA 1PNJA 4JZ4A 1KSWA 4J9FA 4J9HA 1UJYA 2YUQA 1N5ZA 2RPNA 2KT8A 2BZ8A 2P4RA 2ED1A 1H8KA 1QLYA 2A37A 4D8DA 1K76A 2LJ3A 2M51A 1CKBA 2FEIA 4J9IA 3M0TA 1BBZA 2F2XA 1WX6A 1U3OA 1M27C 1YWOA 2DE0X 2AK5A 2KEAA 2ROTA 2W10A 1X43A 1ZUYA 2DX1A 2E5KA 2YSQA 1JXOA 1LCKA 1K4US 2YUOA 4R0KA 2D8HA 1TG0A 2DLPA 4AFZC 1AEYA 3M0PA 2PZ1A 1W1FA 2DM1A 4QT7A 1UGVA 2JTEA 3TSZA 2DBKA 1ZUKA 2M0YA 1YN8A 1U06A 4OMQA 4RTTA 1CSKA 2EYYA 2L3PA 2VWFA 1Z9ZA 2V1RA 3JV3A 2DYBA 1T3LA 2KT1A 1I1JA 4JPBW 2K6DA 1UECA 2RF0A 3VRYA 1UFFA 3REBB 1K0SA 2G6FX 2D1XA 4J9BA 4F17A 3ULRB 4RUGA 5FWCA 2CREA 4Z89A 2KYMA 2O9VA 4AFSC 1GRIA 1GL5A 1B07A 1A0NB 2O9SA 2NUZA 2GNCA 1KJWA 4ZNXA 2DL7A 2GQIA 1G83A 1JU5C 1T0HA 4J9GA 1UDLA 3VS3A 2FPFA 4RTUA 4J9CA 2EGAA 1PRMC 2EVRA 2L3SA 1RLQC 2ESWA 2LMJA 1WDXA 1Z9QA 3SEMA 2K7AA 1PKSA 1GBQA 1QKXA 1UG1A 4Z8AA 1X6BA 3H0IA 4OMPA 3C0CA 2DL8A 1X2QA 2VKNA 3H41A 3I5SA 1G2BA 3EHQA 1NEBA 1OOTA 3I5RA 3NPFA 4Y92A 1AWXA 3NMZC 2YUNA 1YNZA 1Y57A 1ZBJA 2J06A 2DF6A 1SRMA 4LE9A 2AZSA 2DBMA 1T3SA 5EC7A 2KXDA 2O88A 1ZX6A 4KRTA 1SEMA 5HCKA 1NYFA 2LJ1A 2SEMA 1U5SA 3REAB 2MOXA 2DMOA 2C0IA 2I0NA 1ARKA 2JS0A 1RI9A 1XOVA 1YP5A 2RNAA 1AZEA 2JMCA 1V1CA 2X3XD 1GFDA 1YCSB 1GCQA 4OMLA 2JS2A 2YT6A 4D8KA 4JJDA 3RBBB 4AFQC 4WCIA 1M3CA 1AZGB 4DEYA 1E6GA 2ECZA 2HCKA 2FPEA 4JZ3A 2JMAA 4EIKA 4OMOA 1UUEA 2OI3A 2LP5A 1H92A 3M0UA 2KBTA 1GBRA 2BZYA 1NG2A 1ZUUA 1X6GA 2C0TA 2F2VA 4LUDA 4A63B 3EG0A 4LN2A 3O5ZA 2HDAA 5GJVB 3EG3A 2J6OA 1K0XA
chains in the Genus database with same CATH superfamily
2EYZA 3EFOA 1DJ7B 4JRKA 3U23A 1UGPB 2M02A 2OTJT 1JO8A 1TUDA 1H3ZA 1KHCA 2LQWA 2QK0A 2RJDA 1VQLA 3JAME 4E7JA 1VA7A 3PVQA 1BU1A 2Y4YA 2KGTA 1WYXA 5FROA 1P92A 1BI1A 4CC3A 3HL8A 3C4SA 1PSEA 1LOJA 2X3WD 2EGCA 4BE0A 1FYNA 4E7KA 4M7AG 2C0OA 3UA6A 3CMAT 4RTVA 2QGGA 2Y4XA 3CEYA 4M77E 5CIUA 3VS6A 3JB9J 2OTJA 3KUFA 3M56A 4FYWB 1B34B 4M75C 4MMLA 4C0ZA 1UTIA 3M0QA 3H0FA 4KT0E 4AT1B 3JB9F 2YWWA 4JDSA 2QA4Q 2QG9B 3D7SB 1JJ2S 2JT4A 5EG2A 1YWPA 1M2VA 3EHRA 4E2FB 1K9MU 2SRCA 2RHUA 1D1AA 3C12A 4OMNA 4LD6A 2P84A 3CCUT 2QDYB 1K9MC 5IH2A 1AWWA 2JXBA 3CC4Q 1AWOA 3PMIA 4C8QF 3CPFA 1ZA2B 1SG5A 4C92C 1UB4A 4RKUE 3GNGA 2D8JA 3OSVA 2KVQG 2LVMA 1K9AA 1VQ9Q 2GFUA 3V8JA 3P8BB 3QZ9B 2JVVA 5GMKi 3WXMB 4CRIA 2BZXA 2V8IA 1YJ9T 3I56Q 1K1ZA 3ZFJA 3CCUA 2DTOA 1X69A 5KYWB 2FG0A 1JB0E 2K5LA 4MDXA 1KD1U 1LJOA 2AZVA 2K5FA 5AYFA 1VQ8T 1VQKQ 2COZA 3ZL7C 4M7AE 2MCNA 2L2PA 4M78A 2LQNA 3A8HB 2L3RA 4KGXB 1J3TA 1M2OA 3E9FA 2RQUA 4QQDA 2CS7A 4M7AF 2OAWA 3HTRA 1YJ9A 2JM8A 1W6XA 3MP1A 1WFWA 2VVKA 1E6HA 3EAEA 3QWYA 1NM7A 2YDLA 3CCQQ 2EJGA 1WQWA 3HFOA 2KYBA 1W2BS 1WHLA 4DA4A 1VQ8A 5KH6A 4IKFA 1RLPC 3QDRB 2HKQB 3EGXB 3DB3A 2DXBA 1RAHB 1QCNA 2K3YA 1KD1R 1VYTA 5I22A 3OS5A 1PC0A 2IIMA 3N5BB 1ZSZB 3QG1A 4UC4A 3VS0A 5DM7R 4LNPA 1FMWA 3AT1B 3OYMA 2JZ2A 2COYA 4AG1C 1WI7A 1M5Q1 3CCEQ 1YHQT 2ZPGB 3MP6A 5GAN6 4J6XA 2DXCA 2CSIA 3MEVA 2DTIA 4QW2A 4WF2A 3QBYA 4J7IA 4M7DG 2FRYA 2MI6A 2L3QA 3L2ZA 2BIVA 3P8HA 1QCFA 3VS2A 3FRNA 1NPRA 5KYUB 1YHQA 3UDCA 3OYJA 2KE9A 4RTZA 5IT9E 5HY6A 1MMNA 1AD5A 4F7UG 2EW3A 5A0DA 1KQ2A 2PTKA 3CCVQ 2RHZA 3G4ST 3CC7Q 4L6V5 2F2WA 5KE2A 4C92F 3CQTA 1UGRB 3LWHA 3A8MB 2QI2A 3TVTA 4HVWA 1Y71A 2HBPA 3VS1A 2E4HA 1JJ2A 2HSPA 5L23A 4C8QB 2YHTA 4A53A 4RCBA 1ZHIA 1X2KA 4M4ZA 3G4SA 4HT9A 1M8MA 3VS5A 5I21A 2FZGB 3SHWA 5D6XA 3JCMc 1BB9A 3V8LA 4IUVA 2GFAA 2ROLA 3BFMA 1PNJA 1M9SA 3CMAQ 4J9HA 4X9DA 4DOWA 2YUQA 2B8AA 4M7DF 5GAN5 1RADB 3O8VA 1QLYA 2A37A 2M51A 4OVAA 1OZ2A 2FEIA 4J9IA 3GLXA 4ZGJB 2F2XA 4C0DC 4IUTA 2KEAA 4BUGA 2ROTA 2W10A 2XHCA 3LLRA 1MMDA 4F7UF 3JCMP 2DLPA 4AFZC 3QIIA 4PJOC 2O4XA 1OU8A 1UGVA 2DBKA 1YN8A 1YJNT 4OMQA 4RTTA 1NPPA 3WVDB 2FVUA 5LJ3f 1Z9ZA 2HQHA 1W2BA 3PFSA 2VYTA 1VQ7T 2RJFA 2K6DA 4C0FA 3QZ5B 2D9TA 4L59A 1BI3A 2ZZDA 5LL6S 4J9BA 2E64A 2M0OA 2ATCB 3CCLA 4RUGA 2X35A 4Z89A 1VQ6T 1WJRA 5CQYA 3MPUB 1YJNA 5A0LA 3RMQA 3T9NA 2QXFA 3R6OA 4R55A 1GL5A 1A0NB 2GNCA 4ZNXA 1R0BG 3OYNA 1G83A 1JU5C 1WPYA 1VQ7A 3X26B 4A54A 3EFRA 2F1LA 3OYKA 4RTUA 4M75B 2CP2A 2VXEA 4NS5A 2EVRA 5GAN4 3A1PA 4GY5A 4QVCA 2VB6A 3JB9I 1WDXA 1VQ6A 3CPWS 1GBQA 1WQ7A 3C0CA 1XTDA 1G2BA 1NEBA 4E7SA 2NUTA 3M55A 1LVKA 2J06A 2R57A 4C92B 1VQOT 5LJ3g 1EIFA 1MGQA 2O88A 4XTXA 5CCAA 2VGNA 4KRTA 5GMKe 3INZA 5GAMd 5L8RE 3SWNA 1UGQB 1M2VB 2JTMA 1U5SA 2KQWA 1VQ5Q 4ME7A 1FMVA 1RAFB 1OX8A 1D09B 1ARKA 2JS0A 3HHTB 3PIOA 4BDZA 3HRUA 1M4ZA 2RI5A 1BYMA 3CMEQ 1V1CA 5C6SA 2RO0A 1YCSB 4OMLA 2YT6A 2FB7A 1LPLA 4FM4B 4BD3A 3CC4T 3X24B 3J7AF 3OYAA 3OS0A 2JMAA 1QVGS 1UUEA 3CCSA 2QA4A 1GBRA 3L42A 4NOYA 3EG9A 2F2VA 1X6GA 4FW2A 5CQXA 4J8OA 4LN2A 3O5ZA 5GJVB 2ZCFB 1Y96A 3CC4A 2KROA 1ZA1B 3UT1A 2GQVA 2X4JA 1VQKT 2DILA 3URGA 4CC2A 1QP3A 5GAMj 1SRLA 2K2MA 2DVJA 5GANh 2EQUA 1VQ9A 4Y28E 2B86A 4LDVA 4F14A 1W70A 1TWBA 2GTJA 3I9QA 3MO8A 1AVZC 1WXBA 3A98A 2X51A 3I56A 5IXBA 1N8RC 3G71T 1M30A 3CCQT 4PFZA 1SKUB 4ZTJA 1YIJA 2YRCA 1I5LA 4LD9K 2FRWA 1RABB 2DRMA 1HSQA 4FT2A 2KK4A 4A4HA 1Q7YU 4M75D 2RN8A 3QKJA 2NWMA 4ELZC 4NL3A 1Q7YC 1M90C 5IHKA 3VS7A 3P8DA 4M77C 3EH1A 1BCOA 1YJWQ 1IZ6A 2HD0A 4ANJA 3CBMA 3M57A 3CCQA 4LDXA 3FJPA 4DEXA 2QTVA 1HK9A 2K9GA 2P0QA 3LW5E 1NJIU 1NE8A 3VYGA 3CCET 1EZZB 2GCXA 1AOJA 4J9EA 2E6ZA 1D1BA 1NJIC 2CGHA 1WIEA 1S1NA 3S3MA 2O2OA 4RG8A 2XK0A 5A0GA 2VGMA 1VQPT 5KCOA 3NTIA 4JJBA 4RTWA 4QQ6A 4FT4A 4L5GA 1QVFP 4OB0B 4M7AA 9ATCB 2LRQA 1KQSP 1O75A 1N9SA 5GAMh 3CPWA 1S72Q 2EFIA 3QXEB 1FX7A 4KH0B 3CCEA 3RESA 4E7HA 5FWBA 3L2RA 1HJDA 2F5KA 1X27A 5LJ5f 2HSEB 4XU3A 4OB1B 1IHWA 4AG2C 5KYYA 1WHJA 1WXTA 3MEWA 4C8QG 1HD3A 1N27A 2JM9A 3DKMA 2HBWA 3CCVT 2BTTA 1JEGA 3CC7T 4JS4A 4JRQA 2D0NA 3QO3A 2EYXA 1Q95G 3KBGA 2FPDA 4PNOA 4J6YA 4QVZA 2ZPBB 3CXCP 1JQQA 1K8AR 4C0DB 3V7CA 2H3EB 1SPKA 5FW9A 5IHIA 1TS9A 1TOVA 1RUWA 2AKLA 1PWTA 4XTZA 3CC7A 4P5NA 2LDMA 2MWOA 1H3HA 3JCMe 1V76A 4PJOB 1WXUA 2LT4A 1VQOQ 2HAXA 1ZSGA 2QQAA 1QVGA 4HVVA 4J5YA 4MZTA 5GJWB 3IQLA 3EGDA 1D0YA 3M4YA 2JOYA 2OTLQ 3EG2A 2MPXC 3VRZA 4PJJA 3LGFA 3TREA 3MCAB 2P4TA 3H9NA 4E6RA 2YLCA 5GANf 3BY7A 3FJ5A 4BI3A 5LJ5g 2CUBA 4J9DA 5J3BA 4C8QE 2DPPB 2LJ0A 1XQHA 1VQNT 3CMAA 2QTXA 4CC7A 4ZGEB 2D6FA 5LJ3e 2QDLA 4R56A 1OEBA 2O31A 3GP8A 3R6NA 1KC8C 1ZLMA 2X9HA 2J6KA 3TU4K 4WTOB 4XTVA 4BDYA 5J26A 3ZBDA 1N9RA 2E3HA 5FRNA 1VIEA 1MUZA 5CKFA 3LH5A 2RHIA 4J7FA 3PT9A 2ENMA 4XAXB 1K9MR 3JCMJ 2QAZA 2K3BA 1BI0A 2MF2A 3TEEA 4M75G 1NYGA 2LNVA 2NLUA 1VYVA 4IIOA 2KXCA 5IHNA 4JZ4A 2EAYA 3L1AA 1B7TA 3G71Q 2KT8A 5GANg 5GAMf 4DBFA 1CKBA 4C92G 1Q82U 1U3OA 1M27C 1YWOA 3QHSA 2DE0X 5KYNA 3ASKA 4HT8A 3HSBA 4M78C 5HK0A 1Q82C 3JCMQ 2FL7A 2YSQA 1C1AA 1K4US 4FIBA 8ATCB 3M59A 1D1CA 4RG2A 3OYHA 2NYSA 3GF5A 3F70A 5FRMA 3DB4A 1AEYA 2NUPA 4DBRA 2PZ1A 5IN1A 2DM1A 2JTEA 1ZQ1A 3TSZA 1PD1A 3OW2P 3RUXA 2DIQA 4PJOD 2XU8A 1VQ5T 1I1JA 4JPBW 4ELYC 1VQPQ 1UECA 5M9OA 3RMSA 5CVIA 2EJFA 4XTYA 2G6FX 3CMET 4M75F 2QYZA 2A0FB 4F17A 2CREA 2CZ6B 4IUUA 4PLLA 4A4KA 5GAOm 5CKEA 4D6WA 3CCRQ 5GAMg 2NUZA 4OGEA 2GQIA 1VQMQ 4BB7A 1T0HA 2OAUA 5KYXB 4C92E 2XDBA 3LYIA 2CYZB 2FPFA 5FU7C 2EGAA 1BKBA 3VJPA 2ESWA 2LMJA 1HXDA 2BE7D 2K7AA 1QKXA 1UG1A 3HRSA 1X6BA 2E1HA 4OMPA 2VKNA 3A8LB 3H41A 2DK3A 4JJNK 1YBYA 4II1A 2EQKA 3I5RA 4O5VA 3OBWA 4M77B 2QQRA 5GAN3 2LQKA 4DBQA 1AWXA 1PD0A 3M53A 2E6NA 1ZBJA 3A8GB 4BACA 1PSFA 5EC7A 1TU0B 2HQXA 1X01A 3OQ5A 3DLLA 4KGZB 5HCKA 3WVEB 1NYFA 4M7DE 1O9SA 2LJ1A 3REAB 2VASA 3CCMQ 2MAMA 4EPCA 1C6VX 2DMOA 1OI1A 1PM3A 2M1HA 1RAAB 2DFUA 2I0NA 2EKOA 2CKKA 1RI9A 2RNAA 2KSSA 1AZEA 2D0QB 5GAOl 3LGLA 4TVRA 1GFDA 1GCQA 5I2SA 2JS2A 2E12A 1RACB 2RD1A 2ZPIB 1Y7XA 3JCMW 4WCIA 1M3CA 2MMPA 4XQ3A 4F7UE 3QYGB 1YJWT 2FPEA 1IRXA 1VQNQ 4M78F 4OMOA 1BI2A 2X4XA 3VUBA 1U8RA 2PUOB 3M0UA 2CP3A 2BZYA 1NG2A 5DLOA 4LUDA 4A63B 3PNWC 4CI0C 2CP7A 3EG0A 1B34A 4DQ2A 1G5VA 2J6OA 1GXIE 2A7YA 1M3AA 1H641 3QJ6A 1YJWA 4LXCA 1JRIA 2KMTA 1NBEB 2JJ9A 2ZPEB 1S72T 3VS4A 2WACA 5KYYB 2XDPA 2DJZA 1TH7A 2RMOA 3E19A 2XMFA 1NLOC 2HMAA 2K5IA 2EQJA 2ZAEA 3OS2A 1UJ0A 1I5OB 1QW1A 1KG1A 3G6EQ 4KUDK 1D3BB 4O6JA 3M0RA 4ZN1A 2GBQA 3EFOB 4RMOA 2DL3A 2EYWA 3QWXX 3THKA 1KQ1A 3GPLA 5KYWA 5CO7A 1JBMA 1S72A 1LNXA 4V2SA 4OMMA 3OSSC 2EYQA 1OPKA 4PJOG 1WA7A 1TTHB 3OYYA 2L0AA 3GNFB 1NEGA 1Q81U 4MZPA 3E9GA 2CDTA 4C5IA 2Z0WA 1VOMA 2CZ7B 1Q81C 3JCMV 2R5MA 3OMGA 3RERA 1KK7A 2ZGWA 1MHNA 4M77D 3NTKA 3UPUA 1SHGA 4MMKA 2HQEA 3VV0A 2P0PA 2DRKA 3CBPA 3EGXA 3X20B 2GF7A 4B9XA 2OTLT 4IIMA 1QVGP 5GAN2 3TQ7P 1BIAA 1Q81R 4MZMA 5GMKj 4GLMA 1PHTA 1WJQA 5FU6C 3MKDA 3V7SA 1IGQA 1T0JA 1GCPA 1WHHA 2HZYA 1VQOA 2KNBB 2W0ZA 4K11A 5GMKm 2J7IA 2K57A 3UATA 1VQ4Q 1KHIA 2A08A 3OA6A 5HKCA 2OTLA 3RIRA 1Q86U 4GBQA 1WZOA 3SWNC 3L2VA 1QMCA 4BY6C 3SB2A 2HL3A 1Q86C 1SF9A 1UHFA 2CT3A 4RCCA 1F1BB 5HK3A 4PJOF 2QEXQ 3M0SA 4LUEA 1OPLA 5ECAA 7AT1B 4HVUA 4M78B 1NLPC 2XICA 1G3YA 2Y90A 1WHGA 1ABQA 4JLGA 2J05A 4PJMA 4BE1A 3GIBA 2BKDN 3FIFA 3MHXA 2AKKA 3J81E 1N8RU 2DL4A 4OB3B 2LX7A 1BCMA 2YUPA 3L2QA 1M3BA 4ATOA 1RI0A 2ZPFB 2RHYA 1W4SA 3RKXA 3NGPA 1UGSB 4RTYA 1VQKA 4QVDA 2ED0A 2E65A 3H6ZA 2K2VA 2LCSA 6AT1B 1WHKA 5GMKh 5GMKl 3JRZA 4C8QA 1OULA 1M90U 3EGUA 3OYFA 4HXJA 3OYGA 5IXFA 4Y91A 2IVWA 3SD4A 2V1QA 3G71A 3CCJT 2M9UA 1UHCA 4AMCA 3OMCA 1N8RR 3KFVA 3L2UA 4X1VA 3NHNA 1VIFA 3HP9A 5FU7B 2DL5A 1YI2Q 2KRNA 4J83A 4Z02A 1R77A 2LQ8A 4Z88A 1QWFA 1RAGB 4E47A 2CZ0B 2A36A 1Q7YR 1M90R 3H0HA 2YRDA 3BE3A 3LWIA 2CH4A 1AWJA 2A28A 2EQIA 2I2LA 1RL2A 1TSFA 3JCMd 1MNDA 3MEAA 2MIOA 3PVLA 3E1SA 3CCRT 1KSWA 4J9FA 1NJIR 5CAIA 1VQMT 1AT1B 2RPNA 2G3RA 4M77G 1VQPA 2BZ8A 2QQ9A 1IREB 2XD0A 1H8KA 2DVEA 3QDFA 4M7AC 1QCOA 2V8KA 2WSFE 3M0TA 1BBZA 4FYYB 2WSCE 2DERA 2AHJB 2AK5A 1IGUA 3OY9A 3TCJA 1OQKA 2E5KA 1JXOA 3OYBA 4C5EA 2YUOA 1VQMA 2D8HA 4N4GA 3QYHB 1TG0A 4DOVA 2YLBA 2VXFA 3BW1A 1JJ2P 4M78D 5D7UA 1M1KU 5LJ3d 3CCVA 3M0PA 4PFOA 1KQSS 3BDUA 4QT7A 4KBMB 2E5QA 1MMGA 2M0YA 3I55Q 2COWA 1M1KC 1U06A 5GAOp 1OU9A 2EYYA 1XNIA 4M75A 4XU1A 2A3LA 5AT1B 2KY9A 3RR6A 2RM4A 3CCMT 2V1RA 3JV3A 2DYBA 1T3LA 4LDWA 2DETA 3OYCA 3FDRA 2RF0A 1UFFA 3REBB 2F69A 3KXTA 3H8ZA 4FYVB 2PU9B 3ULRB 2E41A 4N4HA 2RI3A 4PJNA 2LCCA 1PG5B 4C0GA 2KAFA 2O9VA 1M1KR 1GRIA 2O4XB 3CXCS 2K4YA 4C92A 2DEUA 3CCMA 1KJWA 2RB6A 1KC8U 3CCSQ 4M77F 3DLMA 2K3XA 3FB9A 1PRMC 2L3SA 2LT1A 1RLQC 4JS5A 3V8KA 1Z9QA 3SEMA 4EMKA 3ME9A 5LJ3j 3M5AA 2DL8A 3EHQA 1VQNA 1W2BP 3NPFA 1NZ9A 4Y92A 2YUNA 1YNZA 3G7ZA 3A8OB 2QQSA 3CD6Q 2E10A 2AZSA 2DBMA 2RH2A 1EX4A 1T3SA 4M7DA 1ZX6A 1KC8R 2XI9A 4N0AA 1SEMA 4EMKC 2FYKA 5D6YA 4B9WA 3G6ET 2CZ1B 1YIJQ 2C0IA 3G1JA 3X28B 5A2QE 3JCMh 4QKUA 2DEQA 1KD1C 3MEUA 4NL2A 2DXUA 4F7UA 2DO3A 5J39A 2LTOA 5FU6B 3RBBB 5C0MA 4M7DC 2DD5A 4FW1A 1AZGB 4N0AC 2NUTB 2ECZA 2HCKA 1V29B 3ER0A 3G6EA 4EIKA 1TUGB 2M16A 2RA2A 3PIPA 2OI3A 4HA8A 1G3WA 3CCJQ 1VUBA 3FLGA 2AIRB 3SWNB 4HCCA 4BY6B 2L8DA 3META 3NFCA 3CC2Q 3EG3A 3JCMb 1Y07A 4C5GA 1I0CA 5LJ3h 4CC4B 2HNIA 1YITQ 4HCKA 4RTXA 4M75E 1Q82R 2P0KA 4IUQA 2QASA 5KCHA 2RI2A 2EPDA 2GGRA 4PL6A 4XU0A 2PVOB 1VQ4T 1PKTA 5I11A 1QVFA 1RAIB 2WSEE 1KQSA 3EG9B 1VQ5A 2J6FA 4M78G 3QSUA 2JNGA 1Y96B 4B6MA 3CMEA 1CKAA 3UA7A 2QEXT 1QKWA 4FSXA 2IPOB 3OW2S 1UE9A 3V7RA 2EIFA 1VQ4A 1M8VA 4ZGDB 2V26A 2HKNA 4OB2B 3OB9A 1VQLQ 4DBHA 2QQBA 1ACMB 1SSFA 4EDUA 4BE2A 4ESRA 4X34A 2E70A 2K79A 2DJQA 3CXCA 1K73U 4FL6A 3JCMX 2X4WA 2QEXA 2RQTA 4C5HA 4YTLA 3E2UA 3GOXA 2O01E 2XDDA 1K73C 2RQWA 3LH0A 1WLPB 2CSQA 4JRIA 4OF1A 3OS1A 2OTJQ 2JUFA 3I35A 4KUIA 1MNEA 5I2MA 1XJWB 2CT4A 2CP0A 3SFMA 5LJ5d 3M58A 4HCBA 4OP0A 2HEQA 2DTHA 3EG1A 4VUBA 1JXMA 1EFNA 2KRMA 1IO6A 4ORZA 4ZN3A 2JW4A 4M78E 4F16A 2F5TX 3RDVA 4A4GA 4JUVA 4PJOA 1K73R 3JCMf 1C0MA 4J6WA 2GTOA 2C06A 5DY9A 1MV0B 1OZ3A 1YFNA 3RNJA 2CH4W 1FWZA 1YCYA 4PLIA 4IURA 1YI2T 3S3OA 1TUCA 4M7AB 4JJCA 1GCQC 4XU2A 3CCUQ 1R8OB 2OX7A 2FZKB 2VUBA 2OJ2A 3OYDA 4Q5WA 5LJ5e 2PUKB 2ZPHB 5CKHA 2JN0A 2PNIA 2LX9A 2YRVA 2FZCB 3CCLT 1WNLA 2DA9A 2DNUA 2EGEA 5CKDA 1G8XA 1I07A 1QP2A 1YI2A 3CPWP 5GAOr 2L5QA 4KGVB 1BIBA 3M54A 5LJ5j 3QJYA 5GAN7 1YJ9Q 2VC8A 5GANd 4KH1B 2EKHA 2DKGA 1X75C 5CK9A 1OX9A 1UEBA 4AFUC 3BDLA 1QVPA 3S3NA 3QPHA 1VQ8Q 1HYOA 4JRPA 4FYXB 2FO0A 3MP8A 2EBPA 3EFSA 1Y0MA 3M4GA 2LCLA 4OGCA 2KRSA 2MWPA 1E7OA 2PQWA 2R5AA 4FU6A 4XTUA 2E3IA 1G3TA 2MK5A 5GAOq 3JCMg 1QWEA 4FCYA 3PE0A 5D6WA 4PJLA 2LNHB 2RK2A 2ABLA 1D0ZA 1FXXA 2L89A 3OYIA 2H8HA 4FSSA 2DD4A 2KI7A 1MV3A 1TXQA 1BK2A 3JB9D 1PRLC 4PKCC 1KFZA 3EGDB 4LDYA 3SDZA 3I55T 4OMFB 4BI8B 4PFPA 3C94A 3GBQA 1FMKA 3OBYA 1ABOA 5GANe 1B3QA 1SHFA 2BE9B 3CBOA 4BI4A 3AHUA 1VYUA 2RHXA 2RQRA 3Q1JA 3VU3C 2DZCA 1SSHA 4EMGA 2KR3A 4C8QD 1KIKA 2CUDA 3OW2A 1OV3A 4EMHA 2LZ6B 5GANj 1M1FA 1GFCA 1ZSZA 2DXTA 3I55A 4XK8E 3S6WA 1YHQQ 2R58A 3UWNA 2RK1A 3C95A 2RJCA 2RQVA 5FLXE 2DIGA 3UF4A 5LJ5h 3TSWA 2VV5A 8AT1B 4E7LA 5CKBA 1N6AA 4HKEA 3HRTA 1UJYA 3PMTA 3VYHB 3CCST 1N5ZA 3JSCA 4EMKB 2QA4T 2P4RA 1PCXA 3HFNA 2ED1A 4PJOE 3MJXA 1RAEB 4D8DA 1K76A 2LJ3A 3QUIA 2EJ9A 1I81A 2XIDA 1WX6A 2V8JA 2RJEA 3RKWA 1X6OA 1ZSZC 1X43A 4XTWA 5KE3A 1U1SA 4M7AD 1ZUYA 2DX1A 1LCKA 4R0KA 4M7DB 5KYUA 4ZTFA 1WJSA 2QGFB 3G4SQ 3CD6T 1W1FA 1VQ9T 5GAOn 1ZUKA 2DAQA 1Q86R 5GAMe 5KYXA 2XKOC 4MDWA 1CSKA 3PTAA 4IUPA 1IXDA 3I56T 3FC3A 2L3PA 2VWFA 3HKSA 3VUZA 1YIJT 2KT1A 4F7UB 1ZBXA 4PK4A 3JB9H 3VRYA 1K0SA 1MMAA 1WGSA 2D1XA 5DLQE 3CD6A 2CP6A 3L2WA 2JTFA 5FWCA 2KYMA 4M77A 2FHDA 3NTHA 2KDSA 4AFSC 2DZ9A 2NUPB 1B07A 2O9SA 2DL7A 2PVGB 4LDUA 4J9GA 1UDLA 1I8FA 2EWNA 1R0CB 3VS3A 1OYXA 4GLKA 4J9CA 3PGGA 3CC2T 1G3SA 4E7IA 2CP5A 1M1GA 1PKSA 4C8QC 4HCZA 4QQGA 4Z8AA 1YITT 3H0IA 4E7ZA 4KULA 1X2QA 3ZEHA 3I5SA 3X25B 2AT1B 1OOTA 2XG8D 2HL5C 3OYEA 2PVDB 3CCJA 3NMZC 1Y57A 1U1TA 1IB8A 2DF6A 3CCLQ 1SRMA 4LE9A 2KXDA 3CC2A 1YJNQ 3RKYA 4C92D 2H3JA 4F04B 3FEOA 2EQMA 5GAN8 1QQJA 3VKIA 2SEMA 1YITA 1D0XA 2BUDA 2MOXA 4N4IA 4A4FA 3M9QA 5IAYA 2MYSA 2IG0A 3JB9G 1VQ7Q 2X4YA 5CR2A 1XOVA 1YP5A 4A4EA 4JLIA 2JMCA 3LX7A 2LC4A 1K8AU 1AHJB 2X3XD 3J80E 1VQ6Q 1K8AC 4D8KA 4JJDA 4AFQC 4DEYA 1E6GA 3CCRA 4JZ3A 1VQLT 3A5ZB 1WHMA 2YXYA 3EH2A 2LP5A 1IHVA 1QVFS 1H92A 4M7DD 1I4K1 2KBTA 2DYIA 3HPWA 3OYLA 1ZUUA 2C0TA 1D3BA 2HDAA 4X9CA 1K0XA
chains in the Genus database with same CATH topology
2EYZA 1M3AA 1I0CA 3U23A 4CC4B 1JO8A 1TUDA 4HCKA 2LQWA 2KROA 4RTXA 1VA7A 3PVQA 1BU1A 2DILA 4CC2A 2KGTA 1WYXA 1SRLA 2K2MA 3VS4A 4CC3A 2DVJA 2RMOA 2EPDA 2X3WD 2B86A 2GGRA 2EGCA 2XMFA 1FYNA 4F14A 1NLOC 1W70A 2GTJA 3I9QA 2C0OA 1AVZC 1WXBA 3A98A 1PKTA 3UA6A 1UJ0A 4RTVA 5I11A 3VS6A 5IXBA 1M30A 2J6FA 1UTIA 3M0QA 3H0FA 3M0RA 2GBQA 2EYWA 2DL3A 2FRWA 3QWXX 2DRMA 1HSQA 2JT4A 1YWPA 3THKA 3EHRA 4OMMA 1OPKA 1CKAA 3UA7A 1WA7A 2SRCA 2RN8A 2L0AA 1QKWA 1NEGA 4OMNA 1UE9A 2NWMA 5IHKA 2CDTA 3VS7A 5IH2A 1AWWA 2JXBA 1AWOA 4DEXA 2K9GA 2D8JA 4ESRA 2K79A 1K9AA 2DJQA 1AOJA 4J9EA 1SHGA 2RQTA 1WIEA 2BZXA 1S1NA 2O2OA 1K1ZA 2DRKA 2RQWA 1X69A 1WLPB 2CSQA 4IIMA 2FG0A 3I35A 4JJBA 4RTWA 2CT4A 2AZVA 3ZL7C 4GLMA 2MCNA 1PHTA 2L2PA 2HEQA 3EG1A 2LQNA 1T0JA 1GCPA 1J3TA 5FWBA 1HJDA 1EFNA 1JXMA 2KNBB 1X27A 2KRMA 1IO6A 2RQUA 2W0ZA 4ORZA 2JW4A 2OAWA 4K11A 4F16A 2J7IA 3UATA 2JM8A 1W6XA 2A08A 4AG2C 1WFWA 2VVKA 1E6HA 3QWYA 1WXTA 1NM7A 4GBQA 2YDLA 1HD3A 2JM9A 2KYBA 2HBWA 2BTTA 2GTOA 1JEGA 1MV0B 1RLPC 2CH4W 3RNJA 1UHFA 2CT3A 2D0NA 2EYXA 2FPDA 1TUCA 3M0SA 4LUEA 1VYTA 4JJCA 5I22A 1GCQC 1OPLA 1JQQA 5ECAA 2IIMA 2OJ2A 4HVUA 3VS0A 1NLPC 4LNPA 1SPKA 5FW9A 5IHIA 2PNIA 1RUWA 2AKLA 1PWTA 1ABQA 2J05A 4AG1C 1WI7A 1H3HA 2DA9A 2DNUA 2EGEA 1WXUA 1I07A 2AKKA 1ZSGA 2DL4A 2CSIA 4HVVA 5GJWB 2LX7A 3IQLA 2EKHA 2YUPA 1M3BA 3EG2A 3VRZA 2FRYA 2L3QA 4AFUC 4E6RA 3NGPA 4RTYA 2FO0A 2ED0A 2LCSA 2EBPA 1Y0MA 1QCFA 3FJ5A 3VS2A 2KRSA 2CUBA 1E7OA 4J9DA 2KE9A 3EGUA 4RTZA 4HXJA 2LJ0A 5IXFA 1QWEA 3PE0A 1AD5A 4CC7A 2EW3A 2LNHB 2V1QA 2ABLA 2QDLA 1UHCA 2PTKA 2H8HA 1OEBA 3KFVA 2O31A 4FSSA 4X1VA 3R6NA 1MV3A 2F2WA 1BK2A 1ZLMA 2J6KA 3NHNA 1PRLC 1KFZA 3CQTA 2DL5A 3GBQA 1FMKA 2KRNA 3TVTA 4HVWA 1MUZA 1ABOA 1B3QA 1SHFA 3VS1A 3LH5A 4Z88A 1QWFA 1VYUA 2RQRA 2HSPA 2A36A 5L23A 1SSHA 2ENMA 3H0HA 2KR3A 2K3BA 1KIKA 1X2KA 4M4ZA 2CUDA 1OV3A 2LZ6B 2CH4A 1M8MA 1AWJA 2A28A 1NYGA 2EQIA 1GFCA 3VS5A 3SHWA 1BB9A 2ROLA 1VYVA 2MIOA 2RQVA 3PVLA 2KXCA 4IIOA 3UF4A 3TSWA 5IHNA 1PNJA 4JZ4A 1KSWA 4J9FA 4J9HA 1UJYA 2YUQA 1N5ZA 2RPNA 2KT8A 2BZ8A 2P4RA 2ED1A 1H8KA 1QLYA 2A37A 4D8DA 1K76A 2LJ3A 2M51A 1CKBA 2FEIA 4J9IA 3M0TA 1BBZA 2F2XA 1WX6A 1U3OA 1M27C 1YWOA 2DE0X 2AK5A 2KEAA 2ROTA 2W10A 1X43A 1ZUYA 2DX1A 2E5KA 2YSQA 1JXOA 1LCKA 1K4US 2YUOA 4R0KA 2D8HA 1TG0A 2DLPA 4AFZC 1AEYA 3M0PA 2PZ1A 1W1FA 2DM1A 4QT7A 1UGVA 2JTEA 3TSZA 2DBKA 1ZUKA 2M0YA 1YN8A 1U06A 4OMQA 4RTTA 1CSKA 2EYYA 2L3PA 2VWFA 1Z9ZA 2V1RA 3JV3A 2DYBA 1T3LA 2KT1A 1I1JA 4JPBW 2K6DA 1UECA 2RF0A 3VRYA 1UFFA 3REBB 1K0SA 2G6FX 2D1XA 4J9BA 4F17A 3ULRB 4RUGA 5FWCA 2CREA 4Z89A 2KYMA 2O9VA 4AFSC 1GRIA 1GL5A 1B07A 1A0NB 2O9SA 2NUZA 2GNCA 1KJWA 4ZNXA 2DL7A 2GQIA 1G83A 1JU5C 1T0HA 4J9GA 1UDLA 3VS3A 2FPFA 4RTUA 4J9CA 2EGAA 1PRMC 2EVRA 2L3SA 1RLQC 2ESWA 2LMJA 1WDXA 1Z9QA 3SEMA 2K7AA 1PKSA 1GBQA 1QKXA 1UG1A 4Z8AA 1X6BA 3H0IA 4OMPA 3C0CA 2DL8A 1X2QA 2VKNA 3H41A 3I5SA 1G2BA 3EHQA 1NEBA 1OOTA 3I5RA 3NPFA 4Y92A 1AWXA 3NMZC 2YUNA 1YNZA 1Y57A 1ZBJA 2J06A 2DF6A 1SRMA 4LE9A 2AZSA 2DBMA 1T3SA 5EC7A 2KXDA 2O88A 1ZX6A 4KRTA 1SEMA 5HCKA 1NYFA 2LJ1A 2SEMA 1U5SA 3REAB 2MOXA 2DMOA 2C0IA 2I0NA 1ARKA 2JS0A 1RI9A 1XOVA 1YP5A 2RNAA 1AZEA 2JMCA 1V1CA 2X3XD 1GFDA 1YCSB 1GCQA 4OMLA 2JS2A 2YT6A 4D8KA 4JJDA 3RBBB 4AFQC 4WCIA 1M3CA 1AZGB 4DEYA 1E6GA 2ECZA 2HCKA 2FPEA 4JZ3A 2JMAA 4EIKA 4OMOA 1UUEA 2OI3A 2LP5A 1H92A 3M0UA 2KBTA 1GBRA 2BZYA 1NG2A 1ZUUA 1X6GA 2C0TA 2F2VA 4LUDA 4A63B 3EG0A 4LN2A 3O5ZA 2HDAA 5GJVB 3EG3A 2J6OA 1K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYZ A;  1M3A A;  1I0C A;  3U23 A;  4CC4 B;  1JO8 A;  1TUD A;  4HCK A;  2LQW A;  2KRO A;  4RTX A;  1VA7 A;  3PVQ A;  1BU1 A;  2DIL A;  4CC2 A;  2KGT A;  1WYX A;  1SRL A;  2K2M A;  3VS4 A;  4CC3 A;  2DVJ A;  2RMO A;  2EPD A;  2X3W D;  2B86 A;  2GGR A;  2EGC A;  2XMF A;  1FYN A;  4F14 A;  1NLO C;  1W70 A;  2GTJ A;  3I9Q A;  2C0O A;  1AVZ C;  1WXB A;  3A98 A;  1PKT A;  3UA6 A;  1UJ0 A;  4RTV A;  5I11 A;  3VS6 A;  5IXB A;  1M30 A;  2J6F A;  1UTI A;  3M0Q A;  3H0F A;  3M0R A;  2GBQ A;  2EYW A;  2DL3 A;  2FRW A;  3QWX X;  2DRM A;  1HSQ A;  2JT4 A;  1YWP A;  3THK A;  3EHR A;  4OMM A;  1OPK A;  1CKA A;  3UA7 A;  1WA7 A;  2SRC A;  2RN8 A;  2L0A A;  1QKW A;  1NEG A;  4OMN A;  1UE9 A;  2NWM A;  5IHK A;  2CDT A;  3VS7 A;  5IH2 A;  1AWW A;  2JXB A;  1AWO A;  4DEX A;  2K9G A;  2D8J A;  4ESR A;  2K79 A;  1K9A A;  2DJQ A;  1AOJ A;  4J9E A;  1SHG A;  2RQT A;  1WIE A;  2BZX A;  1S1N A;  2O2O A;  1K1Z A;  2DRK A;  2RQW A;  1X69 A;  1WLP B;  2CSQ A;  4IIM A;  2FG0 A;  3I35 A;  4JJB A;  4RTW A;  2CT4 A;  2AZV A;  3ZL7 C;  4GLM A;  2MCN A;  1PHT A;  2L2P A;  2HEQ A;  3EG1 A;  2LQN A;  1T0J A;  1GCP A;  1J3T A;  5FWB A;  1HJD A;  1EFN A;  1JXM A;  2KNB B;  1X27 A;  2KRM A;  1IO6 A;  2RQU A;  2W0Z A;  4ORZ A;  2JW4 A;  2OAW A;  4K11 A;  4F16 A;  2J7I A;  3UAT A;  2JM8 A;  1W6X A;  2A08 A;  4AG2 C;  1WFW A;  2VVK A;  1E6H A;  3QWY A;  1WXT A;  1NM7 A;  4GBQ A;  2YDL A;  1HD3 A;  2JM9 A;  2KYB A;  2HBW A;  2BTT A;  2GTO A;  1JEG A;  1MV0 B;  1RLP C;  2CH4 W;  3RNJ A;  1UHF A;  2CT3 A;  2D0N A;  2EYX A;  2FPD A;  1TUC A;  3M0S A;  4LUE A;  1VYT A;  4JJC A;  5I22 A;  1GCQ C;  1OPL A;  1JQQ A;  5ECA A;  2IIM A;  2OJ2 A;  4HVU A;  3VS0 A;  1NLP C;  4LNP A;  1SPK A;  5FW9 A;  5IHI A;  2PNI A;  1RUW A;  2AKL A;  1PWT A;  1ABQ A;  2J05 A;  4AG1 C;  1WI7 A;  1H3H A;  2DA9 A;  2DNU A;  2EGE A;  1WXU A;  1I07 A;  2AKK A;  1ZSG A;  2DL4 A;  2CSI A;  4HVV A;  5GJW B;  2LX7 A;  3IQL A;  2EKH A;  2YUP A;  1M3B A;  3EG2 A;  3VRZ A;  2FRY A;  2L3Q A;  4AFU C;  4E6R A;  3NGP A;  4RTY A;  2FO0 A;  2ED0 A;  2LCS A;  2EBP A;  1Y0M A;  1QCF A;  3FJ5 A;  3VS2 A;  2KRS A;  2CUB A;  1E7O A;  4J9D A;  2KE9 A;  3EGU A;  4RTZ A;  4HXJ A;  2LJ0 A;  5IXF A;  1QWE A;  3PE0 A;  1AD5 A;  4CC7 A;  2EW3 A;  2LNH B;  2V1Q A;  2ABL A;  2QDL A;  1UHC A;  2PTK A;  2H8H A;  1OEB A;  3KFV A;  2O31 A;  4FSS A;  4X1V A;  3R6N A;  1MV3 A;  2F2W A;  1BK2 A;  1ZLM A;  2J6K A;  3NHN A;  1PRL C;  1KFZ A;  3CQT A;  2DL5 A;  3GBQ A;  1FMK A;  2KRN A;  3TVT A;  4HVW A;  1MUZ A;  1ABO A;  1B3Q A;  1SHF A;  3VS1 A;  3LH5 A;  4Z88 A;  1QWF A;  1VYU A;  2RQR A;  2HSP A;  2A36 A;  5L23 A;  1SSH A;  2ENM A;  3H0H A;  2KR3 A;  2K3B A;  1KIK A;  1X2K A;  4M4Z A;  2CUD A;  1OV3 A;  2LZ6 B;  2CH4 A;  1M8M A;  1AWJ A;  2A28 A;  1NYG A;  2EQI A;  1GFC A;  3VS5 A;  3SHW A;  1BB9 A;  2ROL A;  1VYV A;  2MIO A;  2RQV A;  3PVL A;  2KXC A;  4IIO A;  3UF4 A;  3TSW A;  5IHN A;  1PNJ A;  4JZ4 A;  1KSW A;  4J9F A;  4J9H A;  1UJY A;  2YUQ A;  1N5Z A;  2RPN A;  2KT8 A;  2BZ8 A;  2P4R A;  2ED1 A;  1H8K A;  1QLY A;  2A37 A;  4D8D A;  1K76 A;  2LJ3 A;  2M51 A;  1CKB A;  2FEI A;  4J9I A;  3M0T A;  1BBZ A;  2F2X A;  1WX6 A;  1U3O A;  1M27 C;  1YWO A;  2DE0 X;  2AK5 A;  2KEA A;  2ROT A;  2W10 A;  1X43 A;  1ZUY A;  2DX1 A;  2E5K A;  2YSQ A;  1JXO A;  1LCK A;  1K4U S;  2YUO A;  4R0K A;  2D8H A;  1TG0 A;  2DLP A;  4AFZ C;  1AEY A;  3M0P A;  2PZ1 A;  1W1F A;  2DM1 A;  4QT7 A;  1UGV A;  2JTE A;  3TSZ A;  2DBK A;  1ZUK A;  2M0Y A;  1YN8 A;  1U06 A;  4OMQ A;  4RTT A;  1CSK A;  2EYY A;  2L3P A;  2VWF A;  1Z9Z A;  2V1R A;  3JV3 A;  2DYB A;  1T3L A;  2KT1 A;  1I1J A;  4JPB W;  2K6D A;  1UEC A;  2RF0 A;  3VRY A;  1UFF A;  3REB B;  1K0S A;  2G6F X;  2D1X A;  4J9B A;  4F17 A;  3ULR B;  4RUG A;  5FWC A;  2CRE A;  4Z89 A;  2KYM A;  2O9V A;  4AFS C;  1GRI A;  1GL5 A;  1B07 A;  1A0N B;  2O9S A;  2NUZ A;  2GNC A;  1KJW A;  4ZNX A;  2DL7 A;  2GQI A;  1G83 A;  1JU5 C;  1T0H A;  4J9G A;  1UDL A;  3VS3 A;  2FPF A;  4RTU A;  4J9C A;  2EGA A;  1PRM C;  2EVR A;  2L3S A;  1RLQ C;  2ESW A;  2LMJ A;  1WDX A;  1Z9Q A;  3SEM A;  2K7A A;  1PKS A;  1GBQ A;  1QKX A;  1UG1 A;  4Z8A A;  1X6B A;  3H0I A;  4OMP A;  3C0C A;  2DL8 A;  1X2Q A;  2VKN A;  3H41 A;  3I5S A;  1G2B A;  3EHQ A;  1NEB A;  1OOT A;  3I5R A;  3NPF A;  4Y92 A;  1AWX A;  3NMZ C;  2YUN A;  1YNZ A;  1Y57 A;  1ZBJ A;  2J06 A;  2DF6 A;  1SRM A;  4LE9 A;  2AZS A;  2DBM A;  1T3S A;  5EC7 A;  2KXD A;  2O88 A;  1ZX6 A;  4KRT A;  1SEM A;  5HCK A;  1NYF A;  2LJ1 A;  2SEM A;  1U5S A;  3REA B;  2MOX A;  2DMO A;  2C0I A;  2I0N A;  1ARK A;  2JS0 A;  1RI9 A;  1XOV A;  1YP5 A;  2RNA A;  1AZE A;  2JMC A;  1V1C A;  2X3X D;  1GFD A;  1YCS B;  1GCQ A;  4OML A;  2JS2 A;  2YT6 A;  4D8K A;  4JJD A;  3RBB B;  4AFQ C;  4WCI A;  1M3C A;  1AZG B;  4DEY A;  1E6G A;  2ECZ A;  2HCK A;  2FPE A;  4JZ3 A;  2JMA A;  4EIK A;  4OMO A;  1UUE A;  2OI3 A;  2LP5 A;  1H92 A;  3M0U A;  2KBT A;  1GBR A;  2BZY A;  1NG2 A;  1ZUU A;  1X6G A;  2C0T A;  2F2V A;  4LUD A;  4A63 B;  3EG0 A;  4LN2 A;  3O5Z A;  2HDA A;  5GJV B;  3EG3 A;  2J6O A;  1K0X A; 
#chains in the Genus database with same CATH topology
 2EYZ A;  3EFO A;  1DJ7 B;  4JRK A;  3U23 A;  1UGP B;  2M02 A;  2OTJ T;  1JO8 A;  1TUD A;  1H3Z A;  1KHC A;  2LQW A;  2QK0 A;  2RJD A;  1VQL A;  3JAM E;  4E7J A;  1VA7 A;  3PVQ A;  1BU1 A;  2Y4Y A;  2KGT A;  1WYX A;  5FRO A;  1P92 A;  1BI1 A;  4CC3 A;  3HL8 A;  3C4S A;  1PSE A;  1LOJ A;  2X3W D;  2EGC A;  4BE0 A;  1FYN A;  4E7K A;  4M7A G;  2C0O A;  3UA6 A;  3CMA T;  4RTV A;  2QGG A;  2Y4X A;  3CEY A;  4M77 E;  5CIU A;  3VS6 A;  3JB9 J;  2OTJ A;  3KUF A;  3M56 A;  4FYW B;  1B34 B;  4M75 C;  4MML A;  4C0Z A;  1UTI A;  3M0Q A;  3H0F A;  4KT0 E;  4AT1 B;  3JB9 F;  2YWW A;  4JDS A;  2QA4 Q;  2QG9 B;  3D7S B;  1JJ2 S;  2JT4 A;  5EG2 A;  1YWP A;  1M2V A;  3EHR A;  4E2F B;  1K9M U;  2SRC A;  2RHU A;  1D1A A;  3C12 A;  4OMN A;  4LD6 A;  2P84 A;  3CCU T;  2QDY B;  1K9M C;  5IH2 A;  1AWW A;  2JXB A;  3CC4 Q;  1AWO A;  3PMI A;  4C8Q F;  3CPF A;  1ZA2 B;  1SG5 A;  4C92 C;  1UB4 A;  4RKU E;  3GNG A;  2D8J A;  3OSV A;  2KVQ G;  2LVM A;  1K9A A;  1VQ9 Q;  2GFU A;  3V8J A;  3P8B B;  3QZ9 B;  2JVV A;  5GMK i;  3WXM B;  4CRI A;  2BZX A;  2V8I A;  1YJ9 T;  3I56 Q;  1K1Z A;  3ZFJ A;  3CCU A;  2DTO A;  1X69 A;  5KYW B;  2FG0 A;  1JB0 E;  2K5L A;  4MDX A;  1KD1 U;  1LJO A;  2AZV A;  2K5F A;  5AYF A;  1VQ8 T;  1VQK Q;  2COZ A;  3ZL7 C;  4M7A E;  2MCN A;  2L2P A;  4M78 A;  2LQN A;  3A8H B;  2L3R A;  4KGX B;  1J3T A;  1M2O A;  3E9F A;  2RQU A;  4QQD A;  2CS7 A;  4M7A F;  2OAW A;  3HTR A;  1YJ9 A;  2JM8 A;  1W6X A;  3MP1 A;  1WFW A;  2VVK A;  1E6H A;  3EAE A;  3QWY A;  1NM7 A;  2YDL A;  3CCQ Q;  2EJG A;  1WQW A;  3HFO A;  2KYB A;  1W2B S;  1WHL A;  4DA4 A;  1VQ8 A;  5KH6 A;  4IKF A;  1RLP C;  3QDR B;  2HKQ B;  3EGX B;  3DB3 A;  2DXB A;  1RAH B;  1QCN A;  2K3Y A;  1KD1 R;  1VYT A;  5I22 A;  3OS5 A;  1PC0 A;  2IIM A;  3N5B B;  1ZSZ B;  3QG1 A;  4UC4 A;  3VS0 A;  5DM7 R;  4LNP A;  1FMW A;  3AT1 B;  3OYM A;  2JZ2 A;  2COY A;  4AG1 C;  1WI7 A;  1M5Q 1;  3CCE Q;  1YHQ T;  2ZPG B;  3MP6 A;  5GAN 6;  4J6X A;  2DXC A;  2CSI A;  3MEV A;  2DTI A;  4QW2 A;  4WF2 A;  3QBY A;  4J7I A;  4M7D G;  2FRY A;  2MI6 A;  2L3Q A;  3L2Z A;  2BIV A;  3P8H A;  1QCF A;  3VS2 A;  3FRN A;  1NPR A;  5KYU B;  1YHQ A;  3UDC A;  3OYJ A;  2KE9 A;  4RTZ A;  5IT9 E;  5HY6 A;  1MMN A;  1AD5 A;  4F7U G;  2EW3 A;  5A0D A;  1KQ2 A;  2PTK A;  3CCV Q;  2RHZ A;  3G4S T;  3CC7 Q;  4L6V 5;  2F2W A;  5KE2 A;  4C92 F;  3CQT A;  1UGR B;  3LWH A;  3A8M B;  2QI2 A;  3TVT A;  4HVW A;  1Y71 A;  2HBP A;  3VS1 A;  2E4H A;  1JJ2 A;  2HSP A;  5L23 A;  4C8Q B;  2YHT A;  4A53 A;  4RCB A;  1ZHI A;  1X2K A;  4M4Z A;  3G4S A;  4HT9 A;  1M8M A;  3VS5 A;  5I21 A;  2FZG B;  3SHW A;  5D6X A;  3JCM c;  1BB9 A;  3V8L A;  4IUV A;  2GFA A;  2ROL A;  3BFM A;  1PNJ A;  1M9S A;  3CMA Q;  4J9H A;  4X9D A;  4DOW A;  2YUQ A;  2B8A A;  4M7D F;  5GAN 5;  1RAD B;  3O8V A;  1QLY A;  2A37 A;  2M51 A;  4OVA A;  1OZ2 A;  2FEI A;  4J9I A;  3GLX A;  4ZGJ B;  2F2X A;  4C0D C;  4IUT A;  2KEA A;  4BUG A;  2ROT A;  2W10 A;  2XHC A;  3LLR A;  1MMD A;  4F7U F;  3JCM P;  2DLP A;  4AFZ C;  3QII A;  4PJO C;  2O4X A;  1OU8 A;  1UGV A;  2DBK A;  1YN8 A;  1YJN T;  4OMQ A;  4RTT A;  1NPP A;  3WVD B;  2FVU A;  5LJ3 f;  1Z9Z A;  2HQH A;  1W2B A;  3PFS A;  2VYT A;  1VQ7 T;  2RJF A;  2K6D A;  4C0F A;  3QZ5 B;  2D9T A;  4L59 A;  1BI3 A;  2ZZD A;  5LL6 S;  4J9B A;  2E64 A;  2M0O A;  2ATC B;  3CCL A;  4RUG A;  2X35 A;  4Z89 A;  1VQ6 T;  1WJR A;  5CQY A;  3MPU B;  1YJN A;  5A0L A;  3RMQ A;  3T9N A;  2QXF A;  3R6O A;  4R55 A;  1GL5 A;  1A0N B;  2GNC A;  4ZNX A;  1R0B G;  3OYN A;  1G83 A;  1JU5 C;  1WPY A;  1VQ7 A;  3X26 B;  4A54 A;  3EFR A;  2F1L A;  3OYK A;  4RTU A;  4M75 B;  2CP2 A;  2VXE A;  4NS5 A;  2EVR A;  5GAN 4;  3A1P A;  4GY5 A;  4QVC A;  2VB6 A;  3JB9 I;  1WDX A;  1VQ6 A;  3CPW S;  1GBQ A;  1WQ7 A;  3C0C A;  1XTD A;  1G2B A;  1NEB A;  4E7S A;  2NUT A;  3M55 A;  1LVK A;  2J06 A;  2R57 A;  4C92 B;  1VQO T;  5LJ3 g;  1EIF A;  1MGQ A;  2O88 A;  4XTX A;  5CCA A;  2VGN A;  4KRT A;  5GMK e;  3INZ A;  5GAM d;  5L8R E;  3SWN A;  1UGQ B;  1M2V B;  2JTM A;  1U5S A;  2KQW A;  1VQ5 Q;  4ME7 A;  1FMV A;  1RAF B;  1OX8 A;  1D09 B;  1ARK A;  2JS0 A;  3HHT B;  3PIO A;  4BDZ A;  3HRU A;  1M4Z A;  2RI5 A;  1BYM A;  3CME Q;  1V1C A;  5C6S A;  2RO0 A;  1YCS B;  4OML A;  2YT6 A;  2FB7 A;  1LPL A;  4FM4 B;  4BD3 A;  3CC4 T;  3X24 B;  3J7A F;  3OYA A;  3OS0 A;  2JMA A;  1QVG S;  1UUE A;  3CCS A;  2QA4 A;  1GBR A;  3L42 A;  4NOY A;  3EG9 A;  2F2V A;  1X6G A;  4FW2 A;  5CQX A;  4J8O A;  4LN2 A;  3O5Z A;  5GJV B;  2ZCF B;  1Y96 A;  3CC4 A;  2KRO A;  1ZA1 B;  3UT1 A;  2GQV A;  2X4J A;  1VQK T;  2DIL A;  3URG A;  4CC2 A;  1QP3 A;  5GAM j;  1SRL A;  2K2M A;  2DVJ A;  5GAN h;  2EQU A;  1VQ9 A;  4Y28 E;  2B86 A;  4LDV A;  4F14 A;  1W70 A;  1TWB A;  2GTJ A;  3I9Q A;  3MO8 A;  1AVZ C;  1WXB A;  3A98 A;  2X51 A;  3I56 A;  5IXB A;  1N8R C;  3G71 T;  1M30 A;  3CCQ T;  4PFZ A;  1SKU B;  4ZTJ A;  1YIJ A;  2YRC A;  1I5L A;  4LD9 K;  2FRW A;  1RAB B;  2DRM A;  1HSQ A;  4FT2 A;  2KK4 A;  4A4H A;  1Q7Y U;  4M75 D;  2RN8 A;  3QKJ A;  2NWM A;  4ELZ C;  4NL3 A;  1Q7Y C;  1M90 C;  5IHK A;  3VS7 A;  3P8D A;  4M77 C;  3EH1 A;  1BCO A;  1YJW Q;  1IZ6 A;  2HD0 A;  4ANJ A;  3CBM A;  3M57 A;  3CCQ A;  4LDX A;  3FJP A;  4DEX A;  2QTV A;  1HK9 A;  2K9G A;  2P0Q A;  3LW5 E;  1NJI U;  1NE8 A;  3VYG A;  3CCE T;  1EZZ B;  2GCX A;  1AOJ A;  4J9E A;  2E6Z A;  1D1B A;  1NJI C;  2CGH A;  1WIE A;  1S1N A;  3S3M A;  2O2O A;  4RG8 A;  2XK0 A;  5A0G A;  2VGM A;  1VQP T;  5KCO A;  3NTI A;  4JJB A;  4RTW A;  4QQ6 A;  4FT4 A;  4L5G A;  1QVF P;  4OB0 B;  4M7A A;  9ATC B;  2LRQ A;  1KQS P;  1O75 A;  1N9S A;  5GAM h;  3CPW A;  1S72 Q;  2EFI A;  3QXE B;  1FX7 A;  4KH0 B;  3CCE A;  3RES A;  4E7H A;  5FWB A;  3L2R A;  1HJD A;  2F5K A;  1X27 A;  5LJ5 f;  2HSE B;  4XU3 A;  4OB1 B;  1IHW A;  4AG2 C;  5KYY A;  1WHJ A;  1WXT A;  3MEW A;  4C8Q G;  1HD3 A;  1N27 A;  2JM9 A;  3DKM A;  2HBW A;  3CCV T;  2BTT A;  1JEG A;  3CC7 T;  4JS4 A;  4JRQ A;  2D0N A;  3QO3 A;  2EYX A;  1Q95 G;  3KBG A;  2FPD A;  4PNO A;  4J6Y A;  4QVZ A;  2ZPB B;  3CXC P;  1JQQ A;  1K8A R;  4C0D B;  3V7C A;  2H3E B;  1SPK A;  5FW9 A;  5IHI A;  1TS9 A;  1TOV A;  1RUW A;  2AKL A;  1PWT A;  4XTZ A;  3CC7 A;  4P5N A;  2LDM A;  2MWO A;  1H3H A;  3JCM e;  1V76 A;  4PJO B;  1WXU A;  2LT4 A;  1VQO Q;  2HAX A;  1ZSG A;  2QQA A;  1QVG A;  4HVV A;  4J5Y A;  4MZT A;  5GJW B;  3IQL A;  3EGD A;  1D0Y A;  3M4Y A;  2JOY A;  2OTL Q;  3EG2 A;  2MPX C;  3VRZ A;  4PJJ A;  3LGF A;  3TRE A;  3MCA B;  2P4T A;  3H9N A;  4E6R A;  2YLC A;  5GAN f;  3BY7 A;  3FJ5 A;  4BI3 A;  5LJ5 g;  2CUB A;  4J9D A;  5J3B A;  4C8Q E;  2DPP B;  2LJ0 A;  1XQH A;  1VQN T;  3CMA A;  2QTX A;  4CC7 A;  4ZGE B;  2D6F A;  5LJ3 e;  2QDL A;  4R56 A;  1OEB A;  2O31 A;  3GP8 A;  3R6N A;  1KC8 C;  1ZLM A;  2X9H A;  2J6K A;  3TU4 K;  4WTO B;  4XTV A;  4BDY A;  5J26 A;  3ZBD A;  1N9R A;  2E3H A;  5FRN A;  1VIE A;  1MUZ A;  5CKF A;  3LH5 A;  2RHI A;  4J7F A;  3PT9 A;  2ENM A;  4XAX B;  1K9M R;  3JCM J;  2QAZ A;  2K3B A;  1BI0 A;  2MF2 A;  3TEE A;  4M75 G;  1NYG A;  2LNV A;  2NLU A;  1VYV A;  4IIO A;  2KXC A;  5IHN A;  4JZ4 A;  2EAY A;  3L1A A;  1B7T A;  3G71 Q;  2KT8 A;  5GAN g;  5GAM f;  4DBF A;  1CKB A;  4C92 G;  1Q82 U;  1U3O A;  1M27 C;  1YWO A;  3QHS A;  2DE0 X;  5KYN A;  3ASK A;  4HT8 A;  3HSB A;  4M78 C;  5HK0 A;  1Q82 C;  3JCM Q;  2FL7 A;  2YSQ A;  1C1A A;  1K4U S;  4FIB A;  8ATC B;  3M59 A;  1D1C A;  4RG2 A;  3OYH A;  2NYS A;  3GF5 A;  3F70 A;  5FRM A;  3DB4 A;  1AEY A;  2NUP A;  4DBR A;  2PZ1 A;  5IN1 A;  2DM1 A;  2JTE A;  1ZQ1 A;  3TSZ A;  1PD1 A;  3OW2 P;  3RUX A;  2DIQ A;  4PJO D;  2XU8 A;  1VQ5 T;  1I1J A;  4JPB W;  4ELY C;  1VQP Q;  1UEC A;  5M9O A;  3RMS A;  5CVI A;  2EJF A;  4XTY A;  2G6F X;  3CME T;  4M75 F;  2QYZ A;  2A0F B;  4F17 A;  2CRE A;  2CZ6 B;  4IUU A;  4PLL A;  4A4K A;  5GAO m;  5CKE A;  4D6W A;  3CCR Q;  5GAM g;  2NUZ A;  4OGE A;  2GQI A;  1VQM Q;  4BB7 A;  1T0H A;  2OAU A;  5KYX B;  4C92 E;  2XDB A;  3LYI A;  2CYZ B;  2FPF A;  5FU7 C;  2EGA A;  1BKB A;  3VJP A;  2ESW A;  2LMJ A;  1HXD A;  2BE7 D;  2K7A A;  1QKX A;  1UG1 A;  3HRS A;  1X6B A;  2E1H A;  4OMP A;  2VKN A;  3A8L B;  3H41 A;  2DK3 A;  4JJN K;  1YBY A;  4II1 A;  2EQK A;  3I5R A;  4O5V A;  3OBW A;  4M77 B;  2QQR A;  5GAN 3;  2LQK A;  4DBQ A;  1AWX A;  1PD0 A;  3M53 A;  2E6N A;  1ZBJ A;  3A8G B;  4BAC A;  1PSF A;  5EC7 A;  1TU0 B;  2HQX A;  1X01 A;  3OQ5 A;  3DLL A;  4KGZ B;  5HCK A;  3WVE B;  1NYF A;  4M7D E;  1O9S A;  2LJ1 A;  3REA B;  2VAS A;  3CCM Q;  2MAM A;  4EPC A;  1C6V X;  2DMO A;  1OI1 A;  1PM3 A;  2M1H A;  1RAA B;  2DFU A;  2I0N A;  2EKO A;  2CKK A;  1RI9 A;  2RNA A;  2KSS A;  1AZE A;  2D0Q B;  5GAO l;  3LGL A;  4TVR A;  1GFD A;  1GCQ A;  5I2S A;  2JS2 A;  2E12 A;  1RAC B;  2RD1 A;  2ZPI B;  1Y7X A;  3JCM W;  4WCI A;  1M3C A;  2MMP A;  4XQ3 A;  4F7U E;  3QYG B;  1YJW T;  2FPE A;  1IRX A;  1VQN Q;  4M78 F;  4OMO A;  1BI2 A;  2X4X A;  3VUB A;  1U8R A;  2PUO B;  3M0U A;  2CP3 A;  2BZY A;  1NG2 A;  5DLO A;  4LUD A;  4A63 B;  3PNW C;  4CI0 C;  2CP7 A;  3EG0 A;  1B34 A;  4DQ2 A;  1G5V A;  2J6O A;  1GXI E;  2A7Y A;  1M3A A;  1H64 1;  3QJ6 A;  1YJW A;  4LXC A;  1JRI A;  2KMT A;  1NBE B;  2JJ9 A;  2ZPE B;  1S72 T;  3VS4 A;  2WAC A;  5KYY B;  2XDP A;  2DJZ A;  1TH7 A;  2RMO A;  3E19 A;  2XMF A;  1NLO C;  2HMA A;  2K5I A;  2EQJ A;  2ZAE A;  3OS2 A;  1UJ0 A;  1I5O B;  1QW1 A;  1KG1 A;  3G6E Q;  4KUD K;  1D3B B;  4O6J A;  3M0R A;  4ZN1 A;  2GBQ A;  3EFO B;  4RMO A;  2DL3 A;  2EYW A;  3QWX X;  3THK A;  1KQ1 A;  3GPL A;  5KYW A;  5CO7 A;  1JBM A;  1S72 A;  1LNX A;  4V2S A;  4OMM A;  3OSS C;  2EYQ A;  1OPK A;  4PJO G;  1WA7 A;  1TTH B;  3OYY A;  2L0A A;  3GNF B;  1NEG A;  1Q81 U;  4MZP A;  3E9G A;  2CDT A;  4C5I A;  2Z0W A;  1VOM A;  2CZ7 B;  1Q81 C;  3JCM V;  2R5M A;  3OMG A;  3RER A;  1KK7 A;  2ZGW A;  1MHN A;  4M77 D;  3NTK A;  3UPU A;  1SHG A;  4MMK A;  2HQE A;  3VV0 A;  2P0P A;  2DRK A;  3CBP A;  3EGX A;  3X20 B;  2GF7 A;  4B9X A;  2OTL T;  4IIM A;  1QVG P;  5GAN 2;  3TQ7 P;  1BIA A;  1Q81 R;  4MZM A;  5GMK j;  4GLM A;  1PHT A;  1WJQ A;  5FU6 C;  3MKD A;  3V7S A;  1IGQ A;  1T0J A;  1GCP A;  1WHH A;  2HZY A;  1VQO A;  2KNB B;  2W0Z A;  4K11 A;  5GMK m;  2J7I A;  2K57 A;  3UAT A;  1VQ4 Q;  1KHI A;  2A08 A;  3OA6 A;  5HKC A;  2OTL A;  3RIR A;  1Q86 U;  4GBQ A;  1WZO A;  3SWN C;  3L2V A;  1QMC A;  4BY6 C;  3SB2 A;  2HL3 A;  1Q86 C;  1SF9 A;  1UHF A;  2CT3 A;  4RCC A;  1F1B B;  5HK3 A;  4PJO F;  2QEX Q;  3M0S A;  4LUE A;  1OPL A;  5ECA A;  7AT1 B;  4HVU A;  4M78 B;  1NLP C;  2XIC A;  1G3Y A;  2Y90 A;  1WHG A;  1ABQ A;  4JLG A;  2J05 A;  4PJM A;  4BE1 A;  3GIB A;  2BKD N;  3FIF A;  3MHX A;  2AKK A;  3J81 E;  1N8R U;  2DL4 A;  4OB3 B;  2LX7 A;  1BCM A;  2YUP A;  3L2Q A;  1M3B A;  4ATO A;  1RI0 A;  2ZPF B;  2RHY A;  1W4S A;  3RKX A;  3NGP A;  1UGS B;  4RTY A;  1VQK A;  4QVD A;  2ED0 A;  2E65 A;  3H6Z A;  2K2V A;  2LCS A;  6AT1 B;  1WHK A;  5GMK h;  5GMK l;  3JRZ A;  4C8Q A;  1OUL A;  1M90 U;  3EGU A;  3OYF A;  4HXJ A;  3OYG A;  5IXF A;  4Y91 A;  2IVW A;  3SD4 A;  2V1Q A;  3G71 A;  3CCJ T;  2M9U A;  1UHC A;  4AMC A;  3OMC A;  1N8R R;  3KFV A;  3L2U A;  4X1V A;  3NHN A;  1VIF A;  3HP9 A;  5FU7 B;  2DL5 A;  1YI2 Q;  2KRN A;  4J83 A;  4Z02 A;  1R77 A;  2LQ8 A;  4Z88 A;  1QWF A;  1RAG B;  4E47 A;  2CZ0 B;  2A36 A;  1Q7Y R;  1M90 R;  3H0H A;  2YRD A;  3BE3 A;  3LWI A;  2CH4 A;  1AWJ A;  2A28 A;  2EQI A;  2I2L A;  1RL2 A;  1TSF A;  3JCM d;  1MND A;  3MEA A;  2MIO A;  3PVL A;  3E1S A;  3CCR T;  1KSW A;  4J9F A;  1NJI R;  5CAI A;  1VQM T;  1AT1 B;  2RPN A;  2G3R A;  4M77 G;  1VQP A;  2BZ8 A;  2QQ9 A;  1IRE B;  2XD0 A;  1H8K A;  2DVE A;  3QDF A;  4M7A C;  1QCO A;  2V8K A;  2WSF E;  3M0T A;  1BBZ A;  4FYY B;  2WSC E;  2DER A;  2AHJ B;  2AK5 A;  1IGU A;  3OY9 A;  3TCJ A;  1OQK A;  2E5K A;  1JXO A;  3OYB A;  4C5E A;  2YUO A;  1VQM A;  2D8H A;  4N4G A;  3QYH B;  1TG0 A;  4DOV A;  2YLB A;  2VXF A;  3BW1 A;  1JJ2 P;  4M78 D;  5D7U A;  1M1K U;  5LJ3 d;  3CCV A;  3M0P A;  4PFO A;  1KQS S;  3BDU A;  4QT7 A;  4KBM B;  2E5Q A;  1MMG A;  2M0Y A;  3I55 Q;  2COW A;  1M1K C;  1U06 A;  5GAO p;  1OU9 A;  2EYY A;  1XNI A;  4M75 A;  4XU1 A;  2A3L A;  5AT1 B;  2KY9 A;  3RR6 A;  2RM4 A;  3CCM T;  2V1R A;  3JV3 A;  2DYB A;  1T3L A;  4LDW A;  2DET A;  3OYC A;  3FDR A;  2RF0 A;  1UFF A;  3REB B;  2F69 A;  3KXT A;  3H8Z A;  4FYV B;  2PU9 B;  3ULR B;  2E41 A;  4N4H A;  2RI3 A;  4PJN A;  2LCC A;  1PG5 B;  4C0G A;  2KAF A;  2O9V A;  1M1K R;  1GRI A;  2O4X B;  3CXC S;  2K4Y A;  4C92 A;  2DEU A;  3CCM A;  1KJW A;  2RB6 A;  1KC8 U;  3CCS Q;  4M77 F;  3DLM A;  2K3X A;  3FB9 A;  1PRM C;  2L3S A;  2LT1 A;  1RLQ C;  4JS5 A;  3V8K A;  1Z9Q A;  3SEM A;  4EMK A;  3ME9 A;  5LJ3 j;  3M5A A;  2DL8 A;  3EHQ A;  1VQN A;  1W2B P;  3NPF A;  1NZ9 A;  4Y92 A;  2YUN A;  1YNZ A;  3G7Z A;  3A8O B;  2QQS A;  3CD6 Q;  2E10 A;  2AZS A;  2DBM A;  2RH2 A;  1EX4 A;  1T3S A;  4M7D A;  1ZX6 A;  1KC8 R;  2XI9 A;  4N0A A;  1SEM A;  4EMK C;  2FYK A;  5D6Y A;  4B9W A;  3G6E T;  2CZ1 B;  1YIJ Q;  2C0I A;  3G1J A;  3X28 B;  5A2Q E;  3JCM h;  4QKU A;  2DEQ A;  1KD1 C;  3MEU A;  4NL2 A;  2DXU A;  4F7U A;  2DO3 A;  5J39 A;  2LTO A;  5FU6 B;  3RBB B;  5C0M A;  4M7D C;  2DD5 A;  4FW1 A;  1AZG B;  4N0A C;  2NUT B;  2ECZ A;  2HCK A;  1V29 B;  3ER0 A;  3G6E A;  4EIK A;  1TUG B;  2M16 A;  2RA2 A;  3PIP A;  2OI3 A;  4HA8 A;  1G3W A;  3CCJ Q;  1VUB A;  3FLG A;  2AIR B;  3SWN B;  4HCC A;  4BY6 B;  2L8D A;  3MET A;  3NFC A;  3CC2 Q;  3EG3 A;  3JCM b;  1Y07 A;  4C5G A;  1I0C A;  5LJ3 h;  4CC4 B;  2HNI A;  1YIT Q;  4HCK A;  4RTX A;  4M75 E;  1Q82 R;  2P0K A;  4IUQ A;  2QAS A;  5KCH A;  2RI2 A;  2EPD A;  2GGR A;  4PL6 A;  4XU0 A;  2PVO B;  1VQ4 T;  1PKT A;  5I11 A;  1QVF A;  1RAI B;  2WSE E;  1KQS A;  3EG9 B;  1VQ5 A;  2J6F A;  4M78 G;  3QSU A;  2JNG A;  1Y96 B;  4B6M A;  3CME A;  1CKA A;  3UA7 A;  2QEX T;  1QKW A;  4FSX A;  2IPO B;  3OW2 S;  1UE9 A;  3V7R A;  2EIF A;  1VQ4 A;  1M8V A;  4ZGD B;  2V26 A;  2HKN A;  4OB2 B;  3OB9 A;  1VQL Q;  4DBH A;  2QQB A;  1ACM B;  1SSF A;  4EDU A;  4BE2 A;  4ESR A;  4X34 A;  2E70 A;  2K79 A;  2DJQ A;  3CXC A;  1K73 U;  4FL6 A;  3JCM X;  2X4W A;  2QEX A;  2RQT A;  4C5H A;  4YTL A;  3E2U A;  3GOX A;  2O01 E;  2XDD A;  1K73 C;  2RQW A;  3LH0 A;  1WLP B;  2CSQ A;  4JRI A;  4OF1 A;  3OS1 A;  2OTJ Q;  2JUF A;  3I35 A;  4KUI A;  1MNE A;  5I2M A;  1XJW B;  2CT4 A;  2CP0 A;  3SFM A;  5LJ5 d;  3M58 A;  4HCB A;  4OP0 A;  2HEQ A;  2DTH A;  3EG1 A;  4VUB A;  1JXM A;  1EFN A;  2KRM A;  1IO6 A;  4ORZ A;  4ZN3 A;  2JW4 A;  4M78 E;  4F16 A;  2F5T X;  3RDV A;  4A4G A;  4JUV A;  4PJO A;  1K73 R;  3JCM f;  1C0M A;  4J6W A;  2GTO A;  2C06 A;  5DY9 A;  1MV0 B;  1OZ3 A;  1YFN A;  3RNJ A;  2CH4 W;  1FWZ A;  1YCY A;  4PLI A;  4IUR A;  1YI2 T;  3S3O A;  1TUC A;  4M7A B;  4JJC A;  1GCQ C;  4XU2 A;  3CCU Q;  1R8O B;  2OX7 A;  2FZK B;  2VUB A;  2OJ2 A;  3OYD A;  4Q5W A;  5LJ5 e;  2PUK B;  2ZPH B;  5CKH A;  2JN0 A;  2PNI A;  2LX9 A;  2YRV A;  2FZC B;  3CCL T;  1WNL A;  2DA9 A;  2DNU A;  2EGE A;  5CKD A;  1G8X A;  1I07 A;  1QP2 A;  1YI2 A;  3CPW P;  5GAO r;  2L5Q A;  4KGV B;  1BIB A;  3M54 A;  5LJ5 j;  3QJY A;  5GAN 7;  1YJ9 Q;  2VC8 A;  5GAN d;  4KH1 B;  2EKH A;  2DKG A;  1X75 C;  5CK9 A;  1OX9 A;  1UEB A;  4AFU C;  3BDL A;  1QVP A;  3S3N A;  3QPH A;  1VQ8 Q;  1HYO A;  4JRP A;  4FYX B;  2FO0 A;  3MP8 A;  2EBP A;  3EFS A;  1Y0M A;  3M4G A;  2LCL A;  4OGC A;  2KRS A;  2MWP A;  1E7O A;  2PQW A;  2R5A A;  4FU6 A;  4XTU A;  2E3I A;  1G3T A;  2MK5 A;  5GAO q;  3JCM g;  1QWE A;  4FCY A;  3PE0 A;  5D6W A;  4PJL A;  2LNH B;  2RK2 A;  2ABL A;  1D0Z A;  1FXX A;  2L89 A;  3OYI A;  2H8H A;  4FSS A;  2DD4 A;  2KI7 A;  1MV3 A;  1TXQ A;  1BK2 A;  3JB9 D;  1PRL C;  4PKC C;  1KFZ A;  3EGD B;  4LDY A;  3SDZ A;  3I55 T;  4OMF B;  4BI8 B;  4PFP A;  3C94 A;  3GBQ A;  1FMK A;  3OBY A;  1ABO A;  5GAN e;  1B3Q A;  1SHF A;  2BE9 B;  3CBO A;  4BI4 A;  3AHU A;  1VYU A;  2RHX A;  2RQR A;  3Q1J A;  3VU3 C;  2DZC A;  1SSH A;  4EMG A;  2KR3 A;  4C8Q D;  1KIK A;  2CUD A;  3OW2 A;  1OV3 A;  4EMH A;  2LZ6 B;  5GAN j;  1M1F A;  1GFC A;  1ZSZ A;  2DXT A;  3I55 A;  4XK8 E;  3S6W A;  1YHQ Q;  2R58 A;  3UWN A;  2RK1 A;  3C95 A;  2RJC A;  2RQV A;  5FLX E;  2DIG A;  3UF4 A;  5LJ5 h;  3TSW A;  2VV5 A;  8AT1 B;  4E7L A;  5CKB A;  1N6A A;  4HKE A;  3HRT A;  1UJY A;  3PMT A;  3VYH B;  3CCS T;  1N5Z A;  3JSC A;  4EMK B;  2QA4 T;  2P4R A;  1PCX A;  3HFN A;  2ED1 A;  4PJO E;  3MJX A;  1RAE B;  4D8D A;  1K76 A;  2LJ3 A;  3QUI A;  2EJ9 A;  1I81 A;  2XID A;  1WX6 A;  2V8J A;  2RJE A;  3RKW A;  1X6O A;  1ZSZ C;  1X43 A;  4XTW A;  5KE3 A;  1U1S A;  4M7A D;  1ZUY A;  2DX1 A;  1LCK A;  4R0K A;  4M7D B;  5KYU A;  4ZTF A;  1WJS A;  2QGF B;  3G4S Q;  3CD6 T;  1W1F A;  1VQ9 T;  5GAO n;  1ZUK A;  2DAQ A;  1Q86 R;  5GAM e;  5KYX A;  2XKO C;  4MDW A;  1CSK A;  3PTA A;  4IUP A;  1IXD A;  3I56 T;  3FC3 A;  2L3P A;  2VWF A;  3HKS A;  3VUZ A;  1YIJ T;  2KT1 A;  4F7U B;  1ZBX A;  4PK4 A;  3JB9 H;  3VRY A;  1K0S A;  1MMA A;  1WGS A;  2D1X A;  5DLQ E;  3CD6 A;  2CP6 A;  3L2W A;  2JTF A;  5FWC A;  2KYM A;  4M77 A;  2FHD A;  3NTH A;  2KDS A;  4AFS C;  2DZ9 A;  2NUP B;  1B07 A;  2O9S A;  2DL7 A;  2PVG B;  4LDU A;  4J9G A;  1UDL A;  1I8F A;  2EWN A;  1R0C B;  3VS3 A;  1OYX A;  4GLK A;  4J9C A;  3PGG A;  3CC2 T;  1G3S A;  4E7I A;  2CP5 A;  1M1G A;  1PKS A;  4C8Q C;  4HCZ A;  4QQG A;  4Z8A A;  1YIT T;  3H0I A;  4E7Z A;  4KUL A;  1X2Q A;  3ZEH A;  3I5S A;  3X25 B;  2AT1 B;  1OOT A;  2XG8 D;  2HL5 C;  3OYE A;  2PVD B;  3CCJ A;  3NMZ C;  1Y57 A;  1U1T A;  1IB8 A;  2DF6 A;  3CCL Q;  1SRM A;  4LE9 A;  2KXD A;  3CC2 A;  1YJN Q;  3RKY A;  4C92 D;  2H3J A;  4F04 B;  3FEO A;  2EQM A;  5GAN 8;  1QQJ A;  3VKI A;  2SEM A;  1YIT A;  1D0X A;  2BUD A;  2MOX A;  4N4I A;  4A4F A;  3M9Q A;  5IAY A;  2MYS A;  2IG0 A;  3JB9 G;  1VQ7 Q;  2X4Y A;  5CR2 A;  1XOV A;  1YP5 A;  4A4E A;  4JLI A;  2JMC A;  3LX7 A;  2LC4 A;  1K8A U;  1AHJ B;  2X3X D;  3J80 E;  1VQ6 Q;  1K8A C;  4D8K A;  4JJD A;  4AFQ C;  4DEY A;  1E6G A;  3CCR A;  4JZ3 A;  1VQL T;  3A5Z B;  1WHM A;  2YXY A;  3EH2 A;  2LP5 A;  1IHV A;  1QVF S;  1H92 A;  4M7D D;  1I4K 1;  2KBT A;  2DYI A;  3HPW A;  3OYL A;  1ZUU A;  2C0T A;  1D3B A;  2HDA A;  4X9C A;  1K0X A; 
#chains in the Genus database with same CATH homology
 2EYZ A;  1M3A A;  1I0C A;  3U23 A;  4CC4 B;  1JO8 A;  1TUD A;  4HCK A;  2LQW A;  2KRO A;  4RTX A;  1VA7 A;  3PVQ A;  1BU1 A;  2DIL A;  4CC2 A;  2KGT A;  1WYX A;  1SRL A;  2K2M A;  3VS4 A;  4CC3 A;  2DVJ A;  2RMO A;  2EPD A;  2X3W D;  2B86 A;  2GGR A;  2EGC A;  2XMF A;  1FYN A;  4F14 A;  1NLO C;  1W70 A;  2GTJ A;  3I9Q A;  2C0O A;  1AVZ C;  1WXB A;  3A98 A;  1PKT A;  3UA6 A;  1UJ0 A;  4RTV A;  5I11 A;  3VS6 A;  5IXB A;  1M30 A;  2J6F A;  1UTI A;  3M0Q A;  3H0F A;  3M0R A;  2GBQ A;  2EYW A;  2DL3 A;  2FRW A;  3QWX X;  2DRM A;  1HSQ A;  2JT4 A;  1YWP A;  3THK A;  3EHR A;  4OMM A;  1OPK A;  1CKA A;  3UA7 A;  1WA7 A;  2SRC A;  2RN8 A;  2L0A A;  1QKW A;  1NEG A;  4OMN A;  1UE9 A;  2NWM A;  5IHK A;  2CDT A;  3VS7 A;  5IH2 A;  1AWW A;  2JXB A;  1AWO A;  4DEX A;  2K9G A;  2D8J A;  4ESR A;  2K79 A;  1K9A A;  2DJQ A;  1AOJ A;  4J9E A;  1SHG A;  2RQT A;  1WIE A;  2BZX A;  1S1N A;  2O2O A;  1K1Z A;  2DRK A;  2RQW A;  1X69 A;  1WLP B;  2CSQ A;  4IIM A;  2FG0 A;  3I35 A;  4JJB A;  4RTW A;  2CT4 A;  2AZV A;  3ZL7 C;  4GLM A;  2MCN A;  1PHT A;  2L2P A;  2HEQ A;  3EG1 A;  2LQN A;  1T0J A;  1GCP A;  1J3T A;  5FWB A;  1HJD A;  1EFN A;  1JXM A;  2KNB B;  1X27 A;  2KRM A;  1IO6 A;  2RQU A;  2W0Z A;  4ORZ A;  2JW4 A;  2OAW A;  4K11 A;  4F16 A;  2J7I A;  3UAT A;  2JM8 A;  1W6X A;  2A08 A;  4AG2 C;  1WFW A;  2VVK A;  1E6H A;  3QWY A;  1WXT A;  1NM7 A;  4GBQ A;  2YDL A;  1HD3 A;  2JM9 A;  2KYB A;  2HBW A;  2BTT A;  2GTO A;  1JEG A;  1MV0 B;  1RLP C;  2CH4 W;  3RNJ A;  1UHF A;  2CT3 A;  2D0N A;  2EYX A;  2FPD A;  1TUC A;  3M0S A;  4LUE A;  1VYT A;  4JJC A;  5I22 A;  1GCQ C;  1OPL A;  1JQQ A;  5ECA A;  2IIM A;  2OJ2 A;  4HVU A;  3VS0 A;  1NLP C;  4LNP A;  1SPK A;  5FW9 A;  5IHI A;  2PNI A;  1RUW A;  2AKL A;  1PWT A;  1ABQ A;  2J05 A;  4AG1 C;  1WI7 A;  1H3H A;  2DA9 A;  2DNU A;  2EGE A;  1WXU A;  1I07 A;  2AKK A;  1ZSG A;  2DL4 A;  2CSI A;  4HVV A;  5GJW B;  2LX7 A;  3IQL A;  2EKH A;  2YUP A;  1M3B A;  3EG2 A;  3VRZ A;  2FRY A;  2L3Q A;  4AFU C;  4E6R A;  3NGP A;  4RTY A;  2FO0 A;  2ED0 A;  2LCS A;  2EBP A;  1Y0M A;  1QCF A;  3FJ5 A;  3VS2 A;  2KRS A;  2CUB A;  1E7O A;  4J9D A;  2KE9 A;  3EGU A;  4RTZ A;  4HXJ A;  2LJ0 A;  5IXF A;  1QWE A;  3PE0 A;  1AD5 A;  4CC7 A;  2EW3 A;  2LNH B;  2V1Q A;  2ABL A;  2QDL A;  1UHC A;  2PTK A;  2H8H A;  1OEB A;  3KFV A;  2O31 A;  4FSS A;  4X1V A;  3R6N A;  1MV3 A;  2F2W A;  1BK2 A;  1ZLM A;  2J6K A;  3NHN A;  1PRL C;  1KFZ A;  3CQT A;  2DL5 A;  3GBQ A;  1FMK A;  2KRN A;  3TVT A;  4HVW A;  1MUZ A;  1ABO A;  1B3Q A;  1SHF A;  3VS1 A;  3LH5 A;  4Z88 A;  1QWF A;  1VYU A;  2RQR A;  2HSP A;  2A36 A;  5L23 A;  1SSH A;  2ENM A;  3H0H A;  2KR3 A;  2K3B A;  1KIK A;  1X2K A;  4M4Z A;  2CUD A;  1OV3 A;  2LZ6 B;  2CH4 A;  1M8M A;  1AWJ A;  2A28 A;  1NYG A;  2EQI A;  1GFC A;  3VS5 A;  3SHW A;  1BB9 A;  2ROL A;  1VYV A;  2MIO A;  2RQV A;  3PVL A;  2KXC A;  4IIO A;  3UF4 A;  3TSW A;  5IHN A;  1PNJ A;  4JZ4 A;  1KSW A;  4J9F A;  4J9H A;  1UJY A;  2YUQ A;  1N5Z A;  2RPN A;  2KT8 A;  2BZ8 A;  2P4R A;  2ED1 A;  1H8K A;  1QLY A;  2A37 A;  4D8D A;  1K76 A;  2LJ3 A;  2M51 A;  1CKB A;  2FEI A;  4J9I A;  3M0T A;  1BBZ A;  2F2X A;  1WX6 A;  1U3O A;  1M27 C;  1YWO A;  2DE0 X;  2AK5 A;  2KEA A;  2ROT A;  2W10 A;  1X43 A;  1ZUY A;  2DX1 A;  2E5K A;  2YSQ A;  1JXO A;  1LCK A;  1K4U S;  2YUO A;  4R0K A;  2D8H A;  1TG0 A;  2DLP A;  4AFZ C;  1AEY A;  3M0P A;  2PZ1 A;  1W1F A;  2DM1 A;  4QT7 A;  1UGV A;  2JTE A;  3TSZ A;  2DBK A;  1ZUK A;  2M0Y A;  1YN8 A;  1U06 A;  4OMQ A;  4RTT A;  1CSK A;  2EYY A;  2L3P A;  2VWF A;  1Z9Z A;  2V1R A;  3JV3 A;  2DYB A;  1T3L A;  2KT1 A;  1I1J A;  4JPB W;  2K6D A;  1UEC A;  2RF0 A;  3VRY A;  1UFF A;  3REB B;  1K0S A;  2G6F X;  2D1X A;  4J9B A;  4F17 A;  3ULR B;  4RUG A;  5FWC A;  2CRE A;  4Z89 A;  2KYM A;  2O9V A;  4AFS C;  1GRI A;  1GL5 A;  1B07 A;  1A0N B;  2O9S A;  2NUZ A;  2GNC A;  1KJW A;  4ZNX A;  2DL7 A;  2GQI A;  1G83 A;  1JU5 C;  1T0H A;  4J9G A;  1UDL A;  3VS3 A;  2FPF A;  4RTU A;  4J9C A;  2EGA A;  1PRM C;  2EVR A;  2L3S A;  1RLQ C;  2ESW A;  2LMJ A;  1WDX A;  1Z9Q A;  3SEM A;  2K7A A;  1PKS A;  1GBQ A;  1QKX A;  1UG1 A;  4Z8A A;  1X6B A;  3H0I A;  4OMP A;  3C0C A;  2DL8 A;  1X2Q A;  2VKN A;  3H41 A;  3I5S A;  1G2B A;  3EHQ A;  1NEB A;  1OOT A;  3I5R A;  3NPF A;  4Y92 A;  1AWX A;  3NMZ C;  2YUN A;  1YNZ A;  1Y57 A;  1ZBJ A;  2J06 A;  2DF6 A;  1SRM A;  4LE9 A;  2AZS A;  2DBM A;  1T3S A;  5EC7 A;  2KXD A;  2O88 A;  1ZX6 A;  4KRT A;  1SEM A;  5HCK A;  1NYF A;  2LJ1 A;  2SEM A;  1U5S A;  3REA B;  2MOX A;  2DMO A;  2C0I A;  2I0N A;  1ARK A;  2JS0 A;  1RI9 A;  1XOV A;  1YP5 A;  2RNA A;  1AZE A;  2JMC A;  1V1C A;  2X3X D;  1GFD A;  1YCS B;  1GCQ A;  4OML A;  2JS2 A;  2YT6 A;  4D8K A;  4JJD A;  3RBB B;  4AFQ C;  4WCI A;  1M3C A;  1AZG B;  4DEY A;  1E6G A;  2ECZ A;  2HCK A;  2FPE A;  4JZ3 A;  2JMA A;  4EIK A;  4OMO A;  1UUE A;  2OI3 A;  2LP5 A;  1H92 A;  3M0U A;  2KBT A;  1GBR A;  2BZY A;  1NG2 A;  1ZUU A;  1X6G A;  2C0T A;  2F2V A;  4LUD A;  4A63 B;  3EG0 A;  4LN2 A;  3O5Z A;  2HDA A;  5GJV B;  3EG3 A;  2J6O A;  1K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...