4J9CA

Crystal structure of the abl-sh3 domain h59q-n96t mutant complexed with the designed high-affinity peptide ligand p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNQTGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed high-affinity peptide ligand P17
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9cA00
1E6HA 1KSWA 3EHQA 3REBB 3ULRB 1NLOC 2DE0X 2MCNA 3UA6A 1M3CA 4LE9A 2GTOA 3M0TA 2MIOA 1X69A 2W10A 4LN2A 4DEYA 4AFZC 2RMOA 2DX1A 2P4RA 4HXJA 1I07A 1X2KA 2ROLA 1I1JA 2JTEA 1M30A 2ED0A 2D1XA 2H8HA 2RQTA 2KNBB 3VS0A 1YWOA 1X43A 4JZ3A 2JM8A 1AWXA 5ECAA 4EIKA 2EGCA 2KR3A 2EW3A 4RTWA 1YCSB 3PE0A 4GBQA 2D8JA 2NWMA 4J9DA 1T3SA 1MV3A 1Y57A 4LUEA 1NLPC 2FRYA 2K7AA 2EYWA 1GBQA 2LJ3A 2CT3A 4Z89A 1KIKA 2KRMA 1NM7A 1BBZA 3C0CA 2AK5A 5I22A 1U3OA 2SRCA 1ABQA 1SSHA 3KFVA 2HSPA 3A98A 1LCKA 2RF0A 2X3WD 1U5SA 2HDAA 1GRIA 2ED1A 2HEQA 1SPKA 2FRWA 2DLPA 1GFCA 4D8DA 1X2QA 4RTUA 1WA7A 2RQVA 4HVUA 2JT4A 3PVQA 2C0TA 2KT8A 1AEYA 2EGEA 1AWOA 2K2MA 4HVWA 4KRTA 1T3LA 3EG1A 3EG0A 1B07A 2J7IA 4X1VA 2DL8A 2BTTA 3UF4A 5GJVB 2EYZA 4RTTA 2DMOA 1ZUKA 2G6FX 2EQIA 1K9AA 3SEMA 1BB9A 2SEMA 3VRZA 3IQLA 1PKTA 4OMLA 4F17A 1UG1A 2J6OA 2VKNA 2LJ1A 2AKLA 1MV0B 1GFDA 1PRLC 2M51A 1K4US 5IHNA 2OAWA 1RLQC 3UA7A 4RUGA 2RPNA 1SEMA 4FSSA 1RLPC 2DILA 2KRNA 2KRSA 2LP5A 3VS7A 5EC7A 1CSKA 2YUOA 3M0PA 4J9HA 2EYXA 2CREA 4HVVA 1M3BA 1QWFA 2J06A 1OV3A 2QDLA 4J9EA 1SHFA 1VYTA 4HCKA 3VS6A 2EPDA 1ZSGA 2GTJA 1Y0MA 1ZX6A 2DM1A 1NYGA 4J9FA 4LNPA 4CC2A 2HCKA 2CH4W 3TVTA 3QWYA 3VS5A 4Z88A 5FWBA 2DL5A 1U06A 1PHTA 2ABLA 3M0QA 4AG2C 5IXBA 1CKBA 2A36A 1V1CA 1YN8A 2OJ2A 1VYUA 1KJWA 1WX6A 2F2XA 5I11A 1WXTA 1PWTA 4GLMA 1K0XA 2YSQA 2FEIA 3NGPA 2HBWA 1RUWA 2JMCA 2AKKA 4AFUC 1JU5C 1ZBJA 2D0NA 4AFQC 2DYBA 2DL4A 1XOVA 1TG0A 1N5ZA 1GCQC 1K76A 1UGVA 2V1RA 2FG0A 2ECZA 1K0SA 1YNZA 2C0OA 3O5ZA 1W1FA 2X3XD 2LNHB 1I0CA 1EFNA 2KGTA 3H0HA 3VRYA 1YP5A 4RTXA 3EGUA 1NG2A 2DJQA 5IHKA 2O9SA 1HSQA 2DA9A 4JPBW 2RN8A 4CC3A 1B3QA 1AVZC 2ESWA 2L3SA 4E6RA 3PVLA 3FJ5A 2EGAA 2PNIA 1BU1A 4R0KA 1OOTA 1AWJA 1Z9ZA 3VS2A 2FPDA 4IIMA 5IHIA 3VS3A 1W6XA 2J6FA 4RTYA 5FWCA 2LX7A 2JW4A 2GNCA 3I5RA 1AZEA 2I0NA 1UFFA 1UHFA 1X6BA 1T0JA 3UATA 1VA7A 1FYNA 2O2OA 2DRMA 1JO8A 1WIEA 3EHRA 4OMPA 2MOXA 5FW9A 3R6NA 5L23A 1ZUUA 2L3QA 1UUEA 1NYFA 1CKAA 1UE9A 4OMQA 4Z8AA 4JZ4A 2O9VA 3EG2A 1M27C 2FPFA 2L2PA 4J9IA 4JJBA 1NEGA 1K1ZA 2RNAA 3H41A 2CUBA 2LJ0A 2AZSA 2BZYA 3ZL7C 2OI3A 1GL5A 2KXCA 2F2WA 2JM9A 1ZLMA 3VS1A 4CC7A 1ZUYA 3GBQA 2CH4A 1M8MA 1PRMC 1JXMA 2PZ1A 3I5SA 5IXFA 1T0HA 4OMOA 1ABOA 1UTIA 1JQQA 3THKA 4IIOA 1QCFA 2NUZA 1X27A 1BK2A 1G2BA 2DBMA 2K3BA 1GBRA 1UECA 3QWXX 4AFSC 3EG3A 4QT7A 1A0NB 4JJCA 2EYYA 2ENMA 2K6DA 3NHNA 4J9BA 2DNUA 4F16A 1UJ0A 4K11A 3VS4A 1AZGB 4OMMA 2JMAA 4A63B 1WLPB 1GCQA 4ORZA 2D8HA 4ZNXA 1GCPA 1QWEA 1S1NA 1AOJA 1FMKA 2CUDA 2YUNA 2AZVA 3H0IA 5IH2A 4F14A 1E7OA 1W70A 1YWPA 3TSWA 1UJYA 4ESRA 2K9GA 2YT6A 4J9GA 2LCSA 4DEXA 2DVJA 2EKHA 2KYBA 1HJDA 1KFZA 1WXBA 2CDTA 1M3AA 1QKXA 1OPKA 2CT4A 2F2VA 2KEAA 2L0AA 1UDLA 1AD5A 1NEBA 4RTZA 2FO0A 1H92A 1RI9A 1VYVA 1G83A 2YUQA 2LQNA 1J3TA 2LZ6B 1WDXA 1HD3A 1TUCA 2JS2A 2A08A 2LQWA 2EVRA 3RNJA 2PTKA 2L3PA 2BZXA 2J6KA 2KBTA 1E6GA 2RQWA 1PNJA 1Z9QA 4D8KA 1SRLA 2J05A 1H8KA 1JXOA 2M0YA 2A28A 5HCKA 1PKSA 1SHGA 2CSIA 4RTVA 2JXBA 2LMJA 2V1QA 2GGRA 2VWFA 4AG1C 2YDLA 4Y92A 1X6GA 1WYXA 3RBBB 2C0IA 2CSQA 2GBQA 1WFWA 2XMFA 3U23A 4J9CA 2JS0A 4M4ZA 3SHWA 3TSZA 2DL7A 4OMNA 2RQUA 2EBPA 1UHCA 3H0FA 3JV3A 1WXUA 1SRMA 2KYMA 3LH5A 1ARKA 2B86A 2ROTA 1WI7A 2KXDA 1AWWA 2RQRA 1MUZA 2O31A 2O88A 3I35A 1OPLA 5GJWB 2BZ8A 4LUDA 2IIMA 3NPFA 2DL3A 4WCIA 3M0RA 2KT1A 2KROA 2VVKA 1OEBA 2K79A 3CQTA 2DRKA 2KE9A 1QKWA 2DBKA 4CC4B 2YUPA 3I9QA 1H3HA 2A37A 1QLYA 1TUDA 3NMZC 2GQIA 1JEGA 4JJDA 3M0UA 3REAB 1IO6A 2E5KA 2FPEA 2DF6A 3M0SA 2W0ZA
chains in the Genus database with same CATH superfamily
1E6HA 1NLOC 2DE0X 1VQNQ 5FLXE 1MNEA 1YJWA 1VQ7Q 2YXYA 2DX1A 2P4RA 5GMKi 1M90R 2FZKB 1I07A 1X01A 4GLKA 1VQKT 1YJ9T 1TWBA 3P8HA 1YWOA 1Q7YU 3M5AA 4QW2A 2KR3A 3CD6A 3PE0A 2RHZA 3V8JA 2OTLT 2D8JA 1PSFA 4J9DA 4BE2A 2RI5A 1NLPC 2FRYA 3QG1A 1GBQA 5J39A 2DXTA 2YWWA 1SG5A 2JN0A 5C6SA 1NM7A 4C92A 1WQ7A 5GMKl 2VASA 1U3OA 2GQVA 1VQ4T 1ABQA 1I81A 2RF0A 1QQJA 5D6WA 3CCLQ 4M78G 2OTJQ 2DLPA 4BUGA 4D8DA 4RTUA 4PFOA 4E2FB 2OX7A 4M7AA 3GOXA 4OF1A 2VXEA 1BI2A 2HL3A 2KT8A 2DXCA 4HVWA 3EG1A 3EG0A 2J7IA 3C95A 4M77G 2BTTA 3UF4A 4RTTA 1QVFS 5CCAA 2DMOA 2EQIA 3G71Q 3SEMA 3DKMA 3FB9A 2MWOA 4PNOA 1Q82C 1B7TA 3HPWA 2DXBA 2DK3A 3IQLA 3C94A 4BDYA 2F5TX 2KI7A 4F17A 2J6OA 1M9SA 4MDWA 3L42A 5LJ3d 1K73C 3CCRA 2GFAA 5GANg 2CP3A 5AYFA 2OAWA 4RUGA 1D0YA 4JDSA 1KD1C 4KGXB 5FU7C 4L5GA 4C0DC 3HHTB 2KRSA 2K3XA 1R0BG 3VS7A 1YHQA 5EC7A 1BIAA 4KGZB 2EYXA 4HVVA 3EGXB 4EDUA 2J06A 3OYGA 2QDLA 3O8VA 1FX7A 1VYTA 4M75G 1I5OB 4ZTFA 1H641 1X6OA 3PMTA 2QQRA 4BI3A 2K2VA 2E1HA 2R5AA 4CC2A 5IT9E 3TVTA 3QWYA 3VS5A 3HRTA 1BI3A 5A0DA 3M0QA 3OMGA 1VQPQ 4AG2C 1KC8C 1PWTA 3CCMA 2HBWA 1VQMT 4AFUC 1JU5C 4PJLA 5GAN7 1LNXA 5DM7R 4RMOA 1K76A 2V1RA 2MPXC 3VYGA 2PUOB 2ECZA 2HBPA 5L8RE 2XDBA 2QEXA 3CMAT 1YNZA 2EQMA 1VIFA 3AT1B 3CMEQ 1UGPB 1W1FA 2QA4A 4M77A 1I0CA 5GANf 1EFNA 5GAN5 3RKXA 4PJJA 2JUFA 9ATCB 1YP5A 2FB7A 3VU3C 4RTXA 4KH0B 2HQHA 3HSBA 4EMGA 1RAHB 5A0GA 5IHKA 2O9SA 4XU0A 4FSXA 4JLGA 8AT1B 3X28B 1B3QA 3OYAA 2RH2A 5CAIA 2P4TA 1VQ8T 2PNIA 2DKGA 4YTLA 3NTKA 1AWJA 3VS2A 1N6AA 2FHDA 5A2QE 2XIDA 2JTFA 1D3BA 1RAIB 3DLMA 2RHUA 3RMQA 4L6V5 3VS3A 4ZGDB 1QVPA 1W4SA 2LX7A 2GNCA 3I5RA 1WHKA 2FZGB 2I0NA 4M75A 4AMCA 2K57A 1VA7A 2D0QB 3HP9A 1VOMA 4M7DD 3LX7A 1JO8A 3EHRA 4OMPA 3R6NA 1QVFA 5L23A 4C8QG 2DEUA 2L3QA 2HQXA 2AIRB 2L3RA 4F7UE 1CKAA 1ZHIA 1M27C 3JB9G 3CPWS 3G4ST 3VYHB 2RNAA 2EJGA 2HAXA 2BIVA 1SSFA 3A8OB 3FJPA 2CP2A 1ZLMA 3JCMg 1ZUYA 3CC7T 4E47A 3SWNB 1PCXA 3A8MB 1PRMC 1VQLQ 1T0HA 4OMOA 1ABOA 4HT8A 1UTIA 3THKA 2XICA 1Q86U 1FWZA 2ZPEB 1BK2A 4M7DC 3UT1A 2DBMA 3CXCP 3L2ZA 2K3BA 1WJRA 3EG3A 2XDPA 1D1CA 1YHQQ 2XU8A 2WSFE 2ATCB 4JJCA 4EMKA 2ENMA 4PJOG 2E6NA 3G6ET 5DLOA 2GFUA 4K11A 4OMMA 1C1AA 1WLPB 3OYNA 4LDYA 2COYA 5LJ5j 1S1NA 3S3OA 1AOJA 1FMKA 1BCMA 2V8JA 1W70A 5HK3A 2RI3A 3M4YA 4HCZA 1VQOT 1UJYA 5CKHA 2ZGWA 3I56T 3L2VA 2YT6A 2LC4A 2DVJA 2EKHA 1HJDA 1QVGS 2CDTA 3PMIA 1KQ2A 2HNIA 1Y7XA 2F2VA 5CKDA 2L0AA 2LCLA 1AD5A 4F7UA 4JRPA 2FO0A 5GAOn 1H92A 1RI9A 1VYVA 4IUTA 3HRUA 4OMFB 3CCUQ 2E70A 1G8XA 5LJ3j 3JCMf 3T9NA 2RJFA 2WACA 1YI2T 2JVVA 4JRIA 4LD9K 1V29B 3HFOA 1PNJA 4C92B 1Z9QA 4D8KA 2M0YA 1IHVA 2LRQA 2JXBA 2V1QA 3L2UA 4Y92A 1VQ6Q 3RBBB 2C0IA 2CSQA 2DETA 3ER0A 1WFWA 3U23A 1YBYA 2JS0A 3A8GB 5KYUA 1M2OA 3QJ6A 2RQUA 3HKSA 1W2BA 2EBPA 2LT1A 4C92F 2ZPBB 3H0FA 1M2VB 3QIIA 2KYMA 5GAMg 4XTUA 1ARKA 4JJNK 3CCVQ 1WI7A 2KXDA 3I35A 2FYKA 1QVGP 2NYSA 2BZ8A 4LUDA 3I55T 4NL3A 4LD6A 4PJOA 4WCIA 3M0RA 1KD1R 3NTIA 2DXUA 3MKDA 2DRKA 3OYEA 2ZCFB 2PUKB 1FMWA 2MWPA 3EG9B 4MZTA 3EFRA 4PJMA 4KH1B 4J6YA 3MPUB 3PNWC 4FYVB 2DF6A 2CZ6B 2DYIA 2E6ZA 3RESA 2W0ZA 3ULRB 1M1KR 1IZ6A 2GTOA 3OS0A 3CCST 2MIOA 4LN2A 2RMOA 1VQ5T 3H8ZA 2F69A 2ROLA 1I1JA 2CP0A 3QDRB 2ED0A 4LDWA 5CIUA 2D1XA 2KNBB 4FCYA 3CCLA 3EFOB 1NJIR 4JZ3A 2JM8A 3OMCA 1AWXA 3HTRA 4PJNA 4EIKA 4MDXA 4QVCA 2EGCA 2HMAA 1KQSP 2QTVA 1YITQ 1R0CB 3ZEHA 1Y57A 4LUEA 2AHJB 5GMKm 3MP1A 2LJ3A 1MMNA 3G7ZA 3OA6A 4WF2A 4OGEA 1WHJA 2MF2A 5I22A 2DEQA 4FYXB 1SSHA 3G71A 3JCMJ 3A98A 3PGGA 3JCMe 2X3WD 2HDAA 1GRIA 1IHWA 1QCOA 3QPHA 4NOYA 2MI6A 1GFCA 3S6WA 3QBYA 2RQVA 4OGCA 4HVUA 4JRQA 4C0ZA 2JT4A 3OW2S 2E10A 2EGEA 2O01E 2VGNA 3JB9J 2K2MA 1QP2A 2RK2A 4X1VA 1VQ9T 1YIJT 2M02A 3X26B 1MHNA 1ZUKA 2E3IA 1K9AA 2H3JA 1B34B 3CCJT 4OMLA 2K5IA 1M1KU 1D09B 4OB0B 2QQ9A 5I2SA 2M51A 1K4US 4A4GA 1D3BB 3UA7A 4DBFA 1YJNT 1U1SA 1VQPA 1BIBA 5FRNA 4M7AE 1WHHA 1VQNT 2DILA 3CC4T 2V8KA 2LP5A 2X4XA 2R58A 1PC0A 4B6MA 1VQ7T 2YUOA 3R6OA 1QCNA 3M0PA 1GXIE 3PIPA 3QDFA 1M3BA 3UDCA 1OV3A 2XK0A 3ME9A 3LYIA 2IG0A 1ZSZA 3J80E 3TQ7P 3FIFA 1UEBA 5KCOA 3A5ZB 4OP0A 4HCKA 3OW2P 2V26A 1WHMA 2QDYB 3OBWA 2DM1A 2CZ7B 1S72T 1NYGA 1ZA1B 4Z88A 3CMEA 5KYXB 4HCBA 2A36A 2OJ2A 3CCEQ 4GLMA 2E12A 5C0MA 4LDXA 1RUWA 1JB0E 2QGGA 1WZOA 2D0NA 2ZAEA 5CVIA 3EGDA 1RAEB 3L1AA 2DL4A 2CP5A 1TG0A 1N5ZA 3L2RA 1GCQC 3EFSA 4RCBA 2OTJT 3GLXA 5CKBA 1TSFA 3CCQT 2C0OA 5GANd 2X3XD 4M7DG 1K8AC 2GCXA 5GANh 3BDUA 1K9MU 3D7SB 4AT1B 1YJ9Q 3V7CA 2KY9A 2YLBA 3EGUA 3JSCA 5A0LA 2DJQA 1Q81U 1R8OB 1WGSA 1TUGB 1AVZC 4M78E 3JCMW 3CC2T 3E9GA 1NPRA 2L3SA 3DB4A 2EGAA 2OTLQ 1X75C 3LGLA 1OULA 3M59A 3JCMb 3RMSA 5GAN3 4VUBA 1JJ2P 5IHIA 3QKJA 1JRIA 2J6FA 1VQ4Q 3RERA 4M77E 3QJYA 3RDVA 1UFFA 5D7UA 1ZQ1A 1T0JA 3UATA 3OS1A 2M9UA 1VQLA 2O2OA 3JCMc 2YLCA 3HRSA 1YFNA 3F70A 5FW9A 1M90U 4F7UF 3BW1A 3GNGA 2DTHA 3SWNC 1ZUUA 4LDVA 4R55A 3LH0A 1UE9A 2YHTA 1KG1A 4KUIA 2DIQA 3EG2A 2RHXA 4J5YA 4RG8A 1K1ZA 4FIBA 3PT9A 3H41A 2CUBA 2IVWA 3JCMV 1GL5A 3LGFA 3OYYA 3JB9F 2F2WA 2HZYA 1N8RR 1M8MA 3GP8A 4RCCA 2PVGB 4C5IA 3OYBA 4Z02A 4M75E 5LJ5g 4QVZA 5D6YA 2NUZA 2RO0A 4IUUA 2VGMA 4DBRA 1YJWT 1UECA 4C92D 2HSEB 2E4HA 2ZPHB 4M78A 1QMCA 2LT4A 4F16A 1C0MA 1UJ0A 2X4YA 3VS4A 4BACA 4LXCA 1I4K1 3SDZA 2EQKA 4OVAA 4A63B 4JS5A 3CCUA 3JB9H 1XQHA 3VUBA 4ORZA 1GCPA 2JJ9A 2VV5A 1IGQA 2Z0WA 1G3WA 3CD6T 5LJ3g 4IUPA 2C06A 3TSWA 2WSCE 1OZ3A 2LX9A 2A3LA 4MZPA 4J9GA 2KYBA 2NUPB 1TTHB 3ZBDA 1OPKA 1VQ6A 2RA2A 1UDLA 4C92C 4Y28E 1VQMQ 2DAQA 2YUQA 1G83A 4FT2A 2LQNA 1J3TA 4Y91A 5CQYA 3FLGA 3JCMd 1TUCA 2DVEA 2HKNA 2A08A 2X9HA 4E7KA 1Q7YC 2EVRA 3RNJA 3JCMh 3CCVA 3X25B 1IGUA 3M58A 3CXCS 2J6KA 5LJ5f 3WXMB 4C5GA 2CP7A 5HCKA 1PKSA 1SHGA 4RTVA 2LMJA 3X20B 2E64A 3QHSA 4OB2B 4FT4A 2GBQA 3OYFA 3RKWA 2PU9B 3TSZA 2EFIA 2DL7A 5GAN6 2CKKA 2EYQA 5KH6A 2CS7A 1K9MC 1I5LA 1VQ8Q 1G3YA 3CCRT 2B86A 2JTMA 2ROTA 2RQRA 4PFPA 2O88A 4KBMB 4CI0C 2PQWA 2R57A 4C8QE 1AHJB 3CBPA 1WJQA 2OAUA 5LJ3f 4ELZC 2DL3A 5KE3A 1SF9A 3CQTA 2NUTB 1YHQT 3OYLA 1Y96B 2DFUA 1NE8A 1QKWA 1OU8A 4FW2A 2DBKA 3LW5E 2YUPA 1H3HA 2R5MA 1QLYA 3NFCA 3NMZC 4JJDA 3V8LA 2FPEA 4BE1A 4ZGJB 2O4XB 3OYDA 5I2MA 1OYXA 3REBB 1YITA 3S3MA 2MCNA 4BDZA 3M0TA 4HT9A 1X69A 2W10A 4F04B 2EAYA 1M1FA 4II1A 3NTHA 3G4SQ 4HXJA 1X2KA 1PM3A 2KMTA 3A1PA 5GMKe 1M90C 2E3HA 3CCMT 1W2BP 4PJOE 2H8HA 3VS0A 3S3NA 2P0QA 1O75A 3OQ5A 5GANe 5ECAA 2V8IA 4XTZA 4ZTJA 4RTWA 2D9TA 1YCSB 1G5VA 4GY5A 4GBQA 1BI1A 3EH2A 3JRZA 2NWMA 5CKFA 2QEXT 3OYIA 2K7AA 2A0FB 2YRCA 4PLLA 5DY9A 3VUZA 2QA4T 2CT3A 3JCMX 1BBZA 2EQJA 2F5KA 3L2WA 1D0XA 4E7SA 4BB7A 2HQEA 3OSSC 1LCKA 4E7ZA 3EGDB 2RM4A 4XTWA 4C8QA 4Q5WA 1SPKA 1IREB 3BFMA 2FRWA 3MP8A 1DJ7B 3RR6A 1X2QA 1TH7A 1WA7A 2VC8A 1U1TA 1VIEA 1F1BB 3L2QA 3BDLA 3QSUA 2C0TA 1VQOQ 1AWOA 1NPPA 4PK4A 3I56Q 1T3LA 1HYOA 1BCOA 1B07A 2K4YA 3CBOA 3FDRA 2DL8A 2EYZA 1Q82R 3FEOA 2G6FX 2CP6A 5KYYA 3CXCA 4MMKA 4M7AB 3BE3A 1BB9A 2SEMA 3VRZA 3GNFB 4WTOB 5KYWA 4XTXA 3VKIA 1UG1A 3FRNA 1KQSS 1K73R 4ZN3A 3P8BB 3TREA 5IHNA 1RLQC 2PVDB 4M7AF 1SEMA 4FSSA 3SFMA 3CCEA 2E5QA 2QQSA 1UGQB 2DJZA 2L8DA 4OB3B 3CPWA 1QWFA 1Y07A 4EMHA 4J9EA 4NS5A 5HY6A 4QVDA 3J81E 5AT1B 2XI9A 3VS6A 1ZSGA 2GTJA 3CEYA 3MCAB 3M55A 4LNPA 2RHIA 2E41A 5FWBA 4KT0E 3E19A 1KC8R 3I55Q 1CKBA 4PLIA 1VYUA 3OYKA 1WX6A 2F2XA 1UGSB 1WXTA 1K0XA 2GF7A 1VQKA 1C6VX 1YJ9A 5GAOp 4O6JA 1PD0A 4XK8E 1EZZB 2AKKA 2JMCA 2NLUA 1MMDA 2DYBA 3ASKA 4QQGA 2ZPGB 1UGVA 2FG0A 2E65A 2OTLA 1UB4A 3JB9D 2LTOA 5GAMf 2KQWA 3MEWA 1K0SA 3MP6A 3OYHA 3PIOA 3CCSQ 2EKOA 1G3SA 3O5ZA 2JOYA 4M78B 2DO3A 2LNHB 4BY6C 1Q86C 1VQ5Q 2B8AA 3RUXA 1VQ4A 2KGTA 3H0HA 4A53A 2QAZA 5FROA 3VRYA 4XQ3A 1XJWB 4FYYB 1QVGA 2KK4A 2XD0A 1RI0A 1HSQA 4FW1A 2DA9A 4JPBW 4M78F 1RL2A 3KBGA 4M77B 2ESWA 1KD1U 3PVLA 3FJ5A 4R56A 3MHXA 1UGRB 3WVDB 3OYMA 1OOTA 4ZGEB 2QGFB 2CZ0B 1M4ZA 2MMPA 2KVQG 1LJOA 3ZFJA 4CRIA 3LWIA 5FWCA 3BY7A 2JW4A 5DLQE 2KDSA 4M77F 2ZPFB 1TOVA 2CGHA 4NL2A 1UHFA 2RB6A 3OY9A 1JBMA 1X6BA 1RABB 4C92G 2QK0A 5I21A 4HA8A 4V2SA 2DRMA 1WIEA 4C0FA 4XU2A 3M53A 4IUQA 5GAOl 4Z8AA 4FYWB 2XG8D 3EH1A 5KYNA 1NJIU 1WHGA 2FPFA 4M75B 4DOVA 2L2PA 4J9IA 1EX4A 1NEGA 4JJBA 4JUVA 1KQSA 1VQ9Q 1YIJQ 2M1HA 2LJ0A 5IAYA 2AZSA 3ZL7C 1WNLA 3V7RA 2KXCA 2RJDA 2JM9A 2BUDA 3VS1A 1WJSA 4CC7A 1YCYA 4FM4B 5HKCA 4B9WA 2CH4A 2IPOB 1JXMA 2PZ1A 2K3YA 5IXFA 4M75F 4X9DA 1JQQA 2BE7D 4RKUE 1QCFA 4OB1B 2QTXA 1VUBA 4BI8B 2H3EB 1WQWA 1JJ2S 1YJNQ 1GBRA 2Y4XA 2RJEA 4QT7A 2X4JA 3CC4Q 5IN1A 2EYYA 3INZA 4XTYA 1G3TA 4HCCA 4N0AC 1VQMA 1AZGB 3CCLT 5GAMe 1OQKA 3AHUA 3DLLA 2D8HA 5FU6C 1OX9A 5GMKh 1QWEA 2YUNA 2AZVA 1QW1A 4J83A 2EQUA 4EMKB 1S72Q 3CMAA 1BI0A 4ESRA 3MJXA 3A8LB 3JB9I 4DEXA 1VQKQ 3MEAA 3UWNA 1WXBA 1N9RA 1QKXA 3A8HB 2ZZDA 3H9NA 2X4WA 2X35A 4M7DE 4BE0A 2RJCA 3G71T 3PFSA 3GPLA 2VUBA 3P8DA 1NEBA 4C0GA 4E7JA 4P5NA 3X24B 4BY6B 1HD3A 2LQKA 3OB9A 1VQ8A 1MGQA 1OZ2A 2PTKA 4UC4A 4JRKA 3CCQQ 5LJ5d 4F7UB 1FMVA 1M2VA 1E6GA 2MYSA 5EG2A 2YRDA 3OW2A 2DERA 5LJ5h 5GAN2 2A28A 1AT1B 5CK9A 2VWFA 2GGRA 4AG1C 2YDLA 4C8QB 1X6GA 1WYXA 4X34A 4IKFA 4J9CA 3SHWA 4PFZA 5M9OA 3TU4K 1UHCA 1KQ1A 3JV3A 1WXUA 1OU9A 1SRMA 8ATCB 1SKUB 3CC2Q 4J6WA 3EG9A 3KUFA 4C8QF 1OPLA 2DD4A 3DB3A 5GJWB 4XU1A 1VQPT 3G4SA 2WSEE 2KT1A 5LJ3h 2KROA 5KYUB 1OEBA 5KYYB 5KYWB 2COWA 3I9QA 3CC7A 2A37A 4QQDA 4MMLA 2GQIA 1ZSZC 3M0UA 3REAB 1IO6A 1Q95G 3M0SA 4PJOB 1ZBXA 3HL8A 1M1GA 4M7DA 3EFOA 1KSWA 3EHQA 1FXXA 2HL5C 2QXFA 5D6XA 1M3CA 2DPPB 4LE9A 3UA6A 1V76A 3GF5A 1M1KC 3Q1JA 3CMET 1KHIA 4KGVB 3G1JA 4DEYA 4AFZC 3VJPA 3JAME 2LCCA 1EIFA 4J7FA 3G6EA 2JTEA 1M30A 4A4FA 4PJOF 1QVFP 4M7AD 2XKOC 2RQTA 1X43A 4D6WA 1JJ2A 5GAN8 2RD1A 3OYCA 1NJIC 2F1LA 1RACB 1BKBA 1KK7A 2EW3A 3M57A 1RAGB 2KAFA 1XTDA 3TCJA 1R77A 1WHLA 1ZA2B 1VQOA 1T3SA 1MV3A 5CKEA 3I56A 3QO3A 1YJWQ 2EYWA 3OBYA 4Z89A 1KIKA 1D1AA 2KRMA 5FU6B 1IB8A 1Q86R 3C0CA 2AK5A 2SRCA 3KFVA 2HSPA 1LVKA 2QQAA 1U5SA 3E2UA 4N4IA 2ED1A 2HEQA 1U8RA 4QKUA 4PL6A 4FL6A 1N9SA 1PG5B 3MEVA 3OYJA 4M7AC 3H6ZA 3CMAQ 1B34A 1YI2A 3PVQA 3CD6Q 2FVUA 1AEYA 1RADB 2LNVA 3M56A 4E7LA 3QYGB 4KRTA 1HK9A 1N8RU 2VB6A 4FU6A 3PTAA 1QP3A 1XNIA 5GJVB 2DTOA 4ATOA 1W2BS 4XTVA 3MO8A 2JZ2A 1PKTA 2EJ9A 2BE9B 4KUDK 2A7YA 1VQLT 4X9CA 4A4EA 2VKNA 3CBMA 4F7UG 4XU3A 2LJ1A 2AKLA 1PSEA 4IURA 2DIGA 1MV0B 7AT1B 1Q81C 1GFDA 1PRLC 3LWHA 2D6FA 3URGA 3JCMP 1TU0B 5J3BA 2RPNA 3I55A 3HFNA 1Y71A 4M78D 2XHCA 1RLPC 5CQXA 3V7SA 2KRNA 1OI1A 1CSKA 1MMGA 2YRVA 4J9HA 2CREA 5KYXA 3RKYA 4TVRA 2G3RA 5GMKj 2P0KA 3C4SA 4J8OA 1SHFA 4JLIA 1PD1A 3V8KA 2EPDA 3N5BB 1ACMB 4M77D 5GANj 2L5QA 1Y0MA 1ZX6A 3E1SA 2COZA 2M16A 4J9FA 3CCRQ 2RHYA 5FU7B 2HCKA 2CH4W 3CCSA 4C0DB 4ELYC 2FL7A 1BYMA 2DL5A 5CR2A 5J26A 2P84A 2KSSA 1U06A 1PHTA 2ABLA 3OS5A 5IXBA 1VQ5A 1V1CA 1YN8A 4LDUA 1ZSZB 1RAAB 1RAFB 1KJWA 5I11A 2YSQA 2Y4YA 1M5Q1 2FEIA 3CC7Q 3NGPA 1MMAA 4M78C 2QYZA 1TXQA 1H3ZA 4PKCC 3QZ5B 4DA4A 4A4KA 1ZBJA 3E9FA 4AFQC 3CCUT 4E7HA 3RIRA 1XOVA 5GAMd 4ZN1A 5GAMh 1D0ZA 4ANJA 4M77C 3UPUA 4M75D 1K8AR 3G6EQ 3CPWP 3FC3A 3QYHB 1D1BA 1VQ6T 3SB2A 2JNGA 3CCMQ 2LVMA 1NG2A 2K5FA 4J6XA 5LJ5e 4E7IA 1LPLA 2RN8A 4CC3A 2HD0A 3WVEB 4E6RA 3CCVT 1BU1A 4R0KA 1Z9ZA 4J7IA 2QEXQ 3M54A 2FPDA 5GAN4 4IIMA 2QA4Q 1W6XA 1VQ9A 3TEEA 1YIJA 4RTYA 4N4GA 4ME7A 4M75C 5CO7A 3CCJA 1AZEA 4A54A 3J7AF 3EGXA 5LJ3e 1FYNA 4QQ6A 1YI2Q 5GAOm 4BI4A 2MOXA 2Y90A 1UUEA 1NYFA 4OMQA 3QUIA 4JZ4A 2DZ9A 1YJNA 2O9VA 3OS2A 3CPFA 4JS4A 2VXFA 1VQNA 3CC4A 4RG2A 2I2LA 1O9SA 1VQ7A 4A4HA 2BZYA 2OI3A 1MNDA 2FZCB 5KE2A 2AT1B 3GBQA 3OSVA 2BKDN 4O5VA 3I5SA 1WPYA 1N8RC 1IRXA 1HXDA 3MEUA 4IIOA 1S72A 1X27A 1YITT 1K8AU 2RK1A 1G2BA 3QWXX 4AFSC 4EMKC 3C12A 2EJFA 1A0NB 4BD3A 2QG9B 1OX8A 2K6DA 3NHNA 4J9BA 4C8QD 3KXTA 2DNUA 1NBEB 4N0AA 2JMAA 2P0PA 4DBHA 2NUPA 5FRMA 6AT1B 1GCQA 3M4GA 4ZNXA 1NZ9A 4M7DB 2LQ8A 2CYZB 2CUDA 2OTJA 3H0IA 2LDMA 5IH2A 4F14A 1E7OA 1LOJA 1TS9A 1Q82U 1YWPA 3CCQA 4DOWA 2K9GA 4N4HA 2LCSA 3EAEA 1KFZA 4L59A 2M0OA 2EIFA 1M3AA 4M7DF 2CT4A 4XAXB 1K73U 2KEAA 4DQ2A 4RTZA 2L89A 5KCHA 4B9XA 4C8QC 2LZ6B 1WDXA 4KULA 1Q7YR 3VV0A 2EWNA 3CC2A 2JS2A 5GAOq 4MZMA 2LQWA 4PJOD 4C5HA 5LL6S 3SD4A 2L3PA 5HK0A 2BZXA 1M8VA 2KBTA 4HKEA 2RQWA 1I8FA 1SRLA 2J05A 2RI2A 1H8KA 1JXOA 2CSIA 3M9QA 3LLRA 3QZ9B 3JCMQ 2XMFA 4M4ZA 2MK5A 4OMNA 2ZPIB 1KC8U 2NUTA 1IXDA 1Y96A 3SWNA 2MAMA 1K9MR 4C92E 2K5LA 3QXEB 3LH5A 4EPCA 2HKQB 2QASA 4M7AG 1AWWA 1MUZA 2O31A 1KHCA 4IUVA 2XDDA 1Q81R 5GAOr 4C5EA 3GIBA 4PJOC 2IIMA 3NPFA 2O4XA 2DTIA 2PVOB 3CCET 2VVKA 2K79A 3CCJQ 2VYTA 3META 1N27A 4DBQA 2KE9A 2CZ1B 4CC4B 2DD5A 1TUDA 2QI2A 2X51A 1JEGA 2E5KA 5GAMj 2QQBA 2DZCA 1P92A
chains in the Genus database with same CATH topology
1E6HA 1KSWA 3EHQA 3REBB 3ULRB 1NLOC 2DE0X 2MCNA 3UA6A 1M3CA 4LE9A 2GTOA 3M0TA 2MIOA 1X69A 2W10A 4LN2A 4DEYA 4AFZC 2RMOA 2DX1A 2P4RA 4HXJA 1I07A 1X2KA 2ROLA 1I1JA 2JTEA 1M30A 2ED0A 2D1XA 2H8HA 2RQTA 2KNBB 3VS0A 1YWOA 1X43A 4JZ3A 2JM8A 1AWXA 5ECAA 4EIKA 2EGCA 2KR3A 2EW3A 4RTWA 1YCSB 3PE0A 4GBQA 2D8JA 2NWMA 4J9DA 1T3SA 1MV3A 1Y57A 4LUEA 1NLPC 2FRYA 2K7AA 2EYWA 1GBQA 2LJ3A 2CT3A 4Z89A 1KIKA 2KRMA 1NM7A 1BBZA 3C0CA 2AK5A 5I22A 1U3OA 2SRCA 1ABQA 1SSHA 3KFVA 2HSPA 3A98A 1LCKA 2RF0A 2X3WD 1U5SA 2HDAA 1GRIA 2ED1A 2HEQA 1SPKA 2FRWA 2DLPA 1GFCA 4D8DA 1X2QA 4RTUA 1WA7A 2RQVA 4HVUA 2JT4A 3PVQA 2C0TA 2KT8A 1AEYA 2EGEA 1AWOA 2K2MA 4HVWA 4KRTA 1T3LA 3EG1A 3EG0A 1B07A 2J7IA 4X1VA 2DL8A 2BTTA 3UF4A 5GJVB 2EYZA 4RTTA 2DMOA 1ZUKA 2G6FX 2EQIA 1K9AA 3SEMA 1BB9A 2SEMA 3VRZA 3IQLA 1PKTA 4OMLA 4F17A 1UG1A 2J6OA 2VKNA 2LJ1A 2AKLA 1MV0B 1GFDA 1PRLC 2M51A 1K4US 5IHNA 2OAWA 1RLQC 3UA7A 4RUGA 2RPNA 1SEMA 4FSSA 1RLPC 2DILA 2KRNA 2KRSA 2LP5A 3VS7A 5EC7A 1CSKA 2YUOA 3M0PA 4J9HA 2EYXA 2CREA 4HVVA 1M3BA 1QWFA 2J06A 1OV3A 2QDLA 4J9EA 1SHFA 1VYTA 4HCKA 3VS6A 2EPDA 1ZSGA 2GTJA 1Y0MA 1ZX6A 2DM1A 1NYGA 4J9FA 4LNPA 4CC2A 2HCKA 2CH4W 3TVTA 3QWYA 3VS5A 4Z88A 5FWBA 2DL5A 1U06A 1PHTA 2ABLA 3M0QA 4AG2C 5IXBA 1CKBA 2A36A 1V1CA 1YN8A 2OJ2A 1VYUA 1KJWA 1WX6A 2F2XA 5I11A 1WXTA 1PWTA 4GLMA 1K0XA 2YSQA 2FEIA 3NGPA 2HBWA 1RUWA 2JMCA 2AKKA 4AFUC 1JU5C 1ZBJA 2D0NA 4AFQC 2DYBA 2DL4A 1XOVA 1TG0A 1N5ZA 1GCQC 1K76A 1UGVA 2V1RA 2FG0A 2ECZA 1K0SA 1YNZA 2C0OA 3O5ZA 1W1FA 2X3XD 2LNHB 1I0CA 1EFNA 2KGTA 3H0HA 3VRYA 1YP5A 4RTXA 3EGUA 1NG2A 2DJQA 5IHKA 2O9SA 1HSQA 2DA9A 4JPBW 2RN8A 4CC3A 1B3QA 1AVZC 2ESWA 2L3SA 4E6RA 3PVLA 3FJ5A 2EGAA 2PNIA 1BU1A 4R0KA 1OOTA 1AWJA 1Z9ZA 3VS2A 2FPDA 4IIMA 5IHIA 3VS3A 1W6XA 2J6FA 4RTYA 5FWCA 2LX7A 2JW4A 2GNCA 3I5RA 1AZEA 2I0NA 1UFFA 1UHFA 1X6BA 1T0JA 3UATA 1VA7A 1FYNA 2O2OA 2DRMA 1JO8A 1WIEA 3EHRA 4OMPA 2MOXA 5FW9A 3R6NA 5L23A 1ZUUA 2L3QA 1UUEA 1NYFA 1CKAA 1UE9A 4OMQA 4Z8AA 4JZ4A 2O9VA 3EG2A 1M27C 2FPFA 2L2PA 4J9IA 4JJBA 1NEGA 1K1ZA 2RNAA 3H41A 2CUBA 2LJ0A 2AZSA 2BZYA 3ZL7C 2OI3A 1GL5A 2KXCA 2F2WA 2JM9A 1ZLMA 3VS1A 4CC7A 1ZUYA 3GBQA 2CH4A 1M8MA 1PRMC 1JXMA 2PZ1A 3I5SA 5IXFA 1T0HA 4OMOA 1ABOA 1UTIA 1JQQA 3THKA 4IIOA 1QCFA 2NUZA 1X27A 1BK2A 1G2BA 2DBMA 2K3BA 1GBRA 1UECA 3QWXX 4AFSC 3EG3A 4QT7A 1A0NB 4JJCA 2EYYA 2ENMA 2K6DA 3NHNA 4J9BA 2DNUA 4F16A 1UJ0A 4K11A 3VS4A 1AZGB 4OMMA 2JMAA 4A63B 1WLPB 1GCQA 4ORZA 2D8HA 4ZNXA 1GCPA 1QWEA 1S1NA 1AOJA 1FMKA 2CUDA 2YUNA 2AZVA 3H0IA 5IH2A 4F14A 1E7OA 1W70A 1YWPA 3TSWA 1UJYA 4ESRA 2K9GA 2YT6A 4J9GA 2LCSA 4DEXA 2DVJA 2EKHA 2KYBA 1HJDA 1KFZA 1WXBA 2CDTA 1M3AA 1QKXA 1OPKA 2CT4A 2F2VA 2KEAA 2L0AA 1UDLA 1AD5A 1NEBA 4RTZA 2FO0A 1H92A 1RI9A 1VYVA 1G83A 2YUQA 2LQNA 1J3TA 2LZ6B 1WDXA 1HD3A 1TUCA 2JS2A 2A08A 2LQWA 2EVRA 3RNJA 2PTKA 2L3PA 2BZXA 2J6KA 2KBTA 1E6GA 2RQWA 1PNJA 1Z9QA 4D8KA 1SRLA 2J05A 1H8KA 1JXOA 2M0YA 2A28A 5HCKA 1PKSA 1SHGA 2CSIA 4RTVA 2JXBA 2LMJA 2V1QA 2GGRA 2VWFA 4AG1C 2YDLA 4Y92A 1X6GA 1WYXA 3RBBB 2C0IA 2CSQA 2GBQA 1WFWA 2XMFA 3U23A 4J9CA 2JS0A 4M4ZA 3SHWA 3TSZA 2DL7A 4OMNA 2RQUA 2EBPA 1UHCA 3H0FA 3JV3A 1WXUA 1SRMA 2KYMA 3LH5A 1ARKA 2B86A 2ROTA 1WI7A 2KXDA 1AWWA 2RQRA 1MUZA 2O31A 2O88A 3I35A 1OPLA 5GJWB 2BZ8A 4LUDA 2IIMA 3NPFA 2DL3A 4WCIA 3M0RA 2KT1A 2KROA 2VVKA 1OEBA 2K79A 3CQTA 2DRKA 2KE9A 1QKWA 2DBKA 4CC4B 2YUPA 3I9QA 1H3HA 2A37A 1QLYA 1TUDA 3NMZC 2GQIA 1JEGA 4JJDA 3M0UA 3REAB 1IO6A 2E5KA 2FPEA 2DF6A 3M0SA 2W0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6H A;  1KSW A;  3EHQ A;  3REB B;  3ULR B;  1NLO C;  2DE0 X;  2MCN A;  3UA6 A;  1M3C A;  4LE9 A;  2GTO A;  3M0T A;  2MIO A;  1X69 A;  2W10 A;  4LN2 A;  4DEY A;  4AFZ C;  2RMO A;  2DX1 A;  2P4R A;  4HXJ A;  1I07 A;  1X2K A;  2ROL A;  1I1J A;  2JTE A;  1M30 A;  2ED0 A;  2D1X A;  2H8H A;  2RQT A;  2KNB B;  3VS0 A;  1YWO A;  1X43 A;  4JZ3 A;  2JM8 A;  1AWX A;  5ECA A;  4EIK A;  2EGC A;  2KR3 A;  2EW3 A;  4RTW A;  1YCS B;  3PE0 A;  4GBQ A;  2D8J A;  2NWM A;  4J9D A;  1T3S A;  1MV3 A;  1Y57 A;  4LUE A;  1NLP C;  2FRY A;  2K7A A;  2EYW A;  1GBQ A;  2LJ3 A;  2CT3 A;  4Z89 A;  1KIK A;  2KRM A;  1NM7 A;  1BBZ A;  3C0C A;  2AK5 A;  5I22 A;  1U3O A;  2SRC A;  1ABQ A;  1SSH A;  3KFV A;  2HSP A;  3A98 A;  1LCK A;  2RF0 A;  2X3W D;  1U5S A;  2HDA A;  1GRI A;  2ED1 A;  2HEQ A;  1SPK A;  2FRW A;  2DLP A;  1GFC A;  4D8D A;  1X2Q A;  4RTU A;  1WA7 A;  2RQV A;  4HVU A;  2JT4 A;  3PVQ A;  2C0T A;  2KT8 A;  1AEY A;  2EGE A;  1AWO A;  2K2M A;  4HVW A;  4KRT A;  1T3L A;  3EG1 A;  3EG0 A;  1B07 A;  2J7I A;  4X1V A;  2DL8 A;  2BTT A;  3UF4 A;  5GJV B;  2EYZ A;  4RTT A;  2DMO A;  1ZUK A;  2G6F X;  2EQI A;  1K9A A;  3SEM A;  1BB9 A;  2SEM A;  3VRZ A;  3IQL A;  1PKT A;  4OML A;  4F17 A;  1UG1 A;  2J6O A;  2VKN A;  2LJ1 A;  2AKL A;  1MV0 B;  1GFD A;  1PRL C;  2M51 A;  1K4U S;  5IHN A;  2OAW A;  1RLQ C;  3UA7 A;  4RUG A;  2RPN A;  1SEM A;  4FSS A;  1RLP C;  2DIL A;  2KRN A;  2KRS A;  2LP5 A;  3VS7 A;  5EC7 A;  1CSK A;  2YUO A;  3M0P A;  4J9H A;  2EYX A;  2CRE A;  4HVV A;  1M3B A;  1QWF A;  2J06 A;  1OV3 A;  2QDL A;  4J9E A;  1SHF A;  1VYT A;  4HCK A;  3VS6 A;  2EPD A;  1ZSG A;  2GTJ A;  1Y0M A;  1ZX6 A;  2DM1 A;  1NYG A;  4J9F A;  4LNP A;  4CC2 A;  2HCK A;  2CH4 W;  3TVT A;  3QWY A;  3VS5 A;  4Z88 A;  5FWB A;  2DL5 A;  1U06 A;  1PHT A;  2ABL A;  3M0Q A;  4AG2 C;  5IXB A;  1CKB A;  2A36 A;  1V1C A;  1YN8 A;  2OJ2 A;  1VYU A;  1KJW A;  1WX6 A;  2F2X A;  5I11 A;  1WXT A;  1PWT A;  4GLM A;  1K0X A;  2YSQ A;  2FEI A;  3NGP A;  2HBW A;  1RUW A;  2JMC A;  2AKK A;  4AFU C;  1JU5 C;  1ZBJ A;  2D0N A;  4AFQ C;  2DYB A;  2DL4 A;  1XOV A;  1TG0 A;  1N5Z A;  1GCQ C;  1K76 A;  1UGV A;  2V1R A;  2FG0 A;  2ECZ A;  1K0S A;  1YNZ A;  2C0O A;  3O5Z A;  1W1F A;  2X3X D;  2LNH B;  1I0C A;  1EFN A;  2KGT A;  3H0H A;  3VRY A;  1YP5 A;  4RTX A;  3EGU A;  1NG2 A;  2DJQ A;  5IHK A;  2O9S A;  1HSQ A;  2DA9 A;  4JPB W;  2RN8 A;  4CC3 A;  1B3Q A;  1AVZ C;  2ESW A;  2L3S A;  4E6R A;  3PVL A;  3FJ5 A;  2EGA A;  2PNI A;  1BU1 A;  4R0K A;  1OOT A;  1AWJ A;  1Z9Z A;  3VS2 A;  2FPD A;  4IIM A;  5IHI A;  3VS3 A;  1W6X A;  2J6F A;  4RTY A;  5FWC A;  2LX7 A;  2JW4 A;  2GNC A;  3I5R A;  1AZE A;  2I0N A;  1UFF A;  1UHF A;  1X6B A;  1T0J A;  3UAT A;  1VA7 A;  1FYN A;  2O2O A;  2DRM A;  1JO8 A;  1WIE A;  3EHR A;  4OMP A;  2MOX A;  5FW9 A;  3R6N A;  5L23 A;  1ZUU A;  2L3Q A;  1UUE A;  1NYF A;  1CKA A;  1UE9 A;  4OMQ A;  4Z8A A;  4JZ4 A;  2O9V A;  3EG2 A;  1M27 C;  2FPF A;  2L2P A;  4J9I A;  4JJB A;  1NEG A;  1K1Z A;  2RNA A;  3H41 A;  2CUB A;  2LJ0 A;  2AZS A;  2BZY A;  3ZL7 C;  2OI3 A;  1GL5 A;  2KXC A;  2F2W A;  2JM9 A;  1ZLM A;  3VS1 A;  4CC7 A;  1ZUY A;  3GBQ A;  2CH4 A;  1M8M A;  1PRM C;  1JXM A;  2PZ1 A;  3I5S A;  5IXF A;  1T0H A;  4OMO A;  1ABO A;  1UTI A;  1JQQ A;  3THK A;  4IIO A;  1QCF A;  2NUZ A;  1X27 A;  1BK2 A;  1G2B A;  2DBM A;  2K3B A;  1GBR A;  1UEC A;  3QWX X;  4AFS C;  3EG3 A;  4QT7 A;  1A0N B;  4JJC A;  2EYY A;  2ENM A;  2K6D A;  3NHN A;  4J9B A;  2DNU A;  4F16 A;  1UJ0 A;  4K11 A;  3VS4 A;  1AZG B;  4OMM A;  2JMA A;  4A63 B;  1WLP B;  1GCQ A;  4ORZ A;  2D8H A;  4ZNX A;  1GCP A;  1QWE A;  1S1N A;  1AOJ A;  1FMK A;  2CUD A;  2YUN A;  2AZV A;  3H0I A;  5IH2 A;  4F14 A;  1E7O A;  1W70 A;  1YWP A;  3TSW A;  1UJY A;  4ESR A;  2K9G A;  2YT6 A;  4J9G A;  2LCS A;  4DEX A;  2DVJ A;  2EKH A;  2KYB A;  1HJD A;  1KFZ A;  1WXB A;  2CDT A;  1M3A A;  1QKX A;  1OPK A;  2CT4 A;  2F2V A;  2KEA A;  2L0A A;  1UDL A;  1AD5 A;  1NEB A;  4RTZ A;  2FO0 A;  1H92 A;  1RI9 A;  1VYV A;  1G83 A;  2YUQ A;  2LQN A;  1J3T A;  2LZ6 B;  1WDX A;  1HD3 A;  1TUC A;  2JS2 A;  2A08 A;  2LQW A;  2EVR A;  3RNJ A;  2PTK A;  2L3P A;  2BZX A;  2J6K A;  2KBT A;  1E6G A;  2RQW A;  1PNJ A;  1Z9Q A;  4D8K A;  1SRL A;  2J05 A;  1H8K A;  1JXO A;  2M0Y A;  2A28 A;  5HCK A;  1PKS A;  1SHG A;  2CSI A;  4RTV A;  2JXB A;  2LMJ A;  2V1Q A;  2GGR A;  2VWF A;  4AG1 C;  2YDL A;  4Y92 A;  1X6G A;  1WYX A;  3RBB B;  2C0I A;  2CSQ A;  2GBQ A;  1WFW A;  2XMF A;  3U23 A;  4J9C A;  2JS0 A;  4M4Z A;  3SHW A;  3TSZ A;  2DL7 A;  4OMN A;  2RQU A;  2EBP A;  1UHC A;  3H0F A;  3JV3 A;  1WXU A;  1SRM A;  2KYM A;  3LH5 A;  1ARK A;  2B86 A;  2ROT A;  1WI7 A;  2KXD A;  1AWW A;  2RQR A;  1MUZ A;  2O31 A;  2O88 A;  3I35 A;  1OPL A;  5GJW B;  2BZ8 A;  4LUD A;  2IIM A;  3NPF A;  2DL3 A;  4WCI A;  3M0R A;  2KT1 A;  2KRO A;  2VVK A;  1OEB A;  2K79 A;  3CQT A;  2DRK A;  2KE9 A;  1QKW A;  2DBK A;  4CC4 B;  2YUP A;  3I9Q A;  1H3H A;  2A37 A;  1QLY A;  1TUD A;  3NMZ C;  2GQI A;  1JEG A;  4JJD A;  3M0U A;  3REA B;  1IO6 A;  2E5K A;  2FPE A;  2DF6 A;  3M0S A;  2W0Z A; 
#chains in the Genus database with same CATH topology
 1E6H A;  1NLO C;  2DE0 X;  1VQN Q;  5FLX E;  1MNE A;  1YJW A;  1VQ7 Q;  2YXY A;  2DX1 A;  2P4R A;  5GMK i;  1M90 R;  2FZK B;  1I07 A;  1X01 A;  4GLK A;  1VQK T;  1YJ9 T;  1TWB A;  3P8H A;  1YWO A;  1Q7Y U;  3M5A A;  4QW2 A;  2KR3 A;  3CD6 A;  3PE0 A;  2RHZ A;  3V8J A;  2OTL T;  2D8J A;  1PSF A;  4J9D A;  4BE2 A;  2RI5 A;  1NLP C;  2FRY A;  3QG1 A;  1GBQ A;  5J39 A;  2DXT A;  2YWW A;  1SG5 A;  2JN0 A;  5C6S A;  1NM7 A;  4C92 A;  1WQ7 A;  5GMK l;  2VAS A;  1U3O A;  2GQV A;  1VQ4 T;  1ABQ A;  1I81 A;  2RF0 A;  1QQJ A;  5D6W A;  3CCL Q;  4M78 G;  2OTJ Q;  2DLP A;  4BUG A;  4D8D A;  4RTU A;  4PFO A;  4E2F B;  2OX7 A;  4M7A A;  3GOX A;  4OF1 A;  2VXE A;  1BI2 A;  2HL3 A;  2KT8 A;  2DXC A;  4HVW A;  3EG1 A;  3EG0 A;  2J7I A;  3C95 A;  4M77 G;  2BTT A;  3UF4 A;  4RTT A;  1QVF S;  5CCA A;  2DMO A;  2EQI A;  3G71 Q;  3SEM A;  3DKM A;  3FB9 A;  2MWO A;  4PNO A;  1Q82 C;  1B7T A;  3HPW A;  2DXB A;  2DK3 A;  3IQL A;  3C94 A;  4BDY A;  2F5T X;  2KI7 A;  4F17 A;  2J6O A;  1M9S A;  4MDW A;  3L42 A;  5LJ3 d;  1K73 C;  3CCR A;  2GFA A;  5GAN g;  2CP3 A;  5AYF A;  2OAW A;  4RUG A;  1D0Y A;  4JDS A;  1KD1 C;  4KGX B;  5FU7 C;  4L5G A;  4C0D C;  3HHT B;  2KRS A;  2K3X A;  1R0B G;  3VS7 A;  1YHQ A;  5EC7 A;  1BIA A;  4KGZ B;  2EYX A;  4HVV A;  3EGX B;  4EDU A;  2J06 A;  3OYG A;  2QDL A;  3O8V A;  1FX7 A;  1VYT A;  4M75 G;  1I5O B;  4ZTF A;  1H64 1;  1X6O A;  3PMT A;  2QQR A;  4BI3 A;  2K2V A;  2E1H A;  2R5A A;  4CC2 A;  5IT9 E;  3TVT A;  3QWY A;  3VS5 A;  3HRT A;  1BI3 A;  5A0D A;  3M0Q A;  3OMG A;  1VQP Q;  4AG2 C;  1KC8 C;  1PWT A;  3CCM A;  2HBW A;  1VQM T;  4AFU C;  1JU5 C;  4PJL A;  5GAN 7;  1LNX A;  5DM7 R;  4RMO A;  1K76 A;  2V1R A;  2MPX C;  3VYG A;  2PUO B;  2ECZ A;  2HBP A;  5L8R E;  2XDB A;  2QEX A;  3CMA T;  1YNZ A;  2EQM A;  1VIF A;  3AT1 B;  3CME Q;  1UGP B;  1W1F A;  2QA4 A;  4M77 A;  1I0C A;  5GAN f;  1EFN A;  5GAN 5;  3RKX A;  4PJJ A;  2JUF A;  9ATC B;  1YP5 A;  2FB7 A;  3VU3 C;  4RTX A;  4KH0 B;  2HQH A;  3HSB A;  4EMG A;  1RAH B;  5A0G A;  5IHK A;  2O9S A;  4XU0 A;  4FSX A;  4JLG A;  8AT1 B;  3X28 B;  1B3Q A;  3OYA A;  2RH2 A;  5CAI A;  2P4T A;  1VQ8 T;  2PNI A;  2DKG A;  4YTL A;  3NTK A;  1AWJ A;  3VS2 A;  1N6A A;  2FHD A;  5A2Q E;  2XID A;  2JTF A;  1D3B A;  1RAI B;  3DLM A;  2RHU A;  3RMQ A;  4L6V 5;  3VS3 A;  4ZGD B;  1QVP A;  1W4S A;  2LX7 A;  2GNC A;  3I5R A;  1WHK A;  2FZG B;  2I0N A;  4M75 A;  4AMC A;  2K57 A;  1VA7 A;  2D0Q B;  3HP9 A;  1VOM A;  4M7D D;  3LX7 A;  1JO8 A;  3EHR A;  4OMP A;  3R6N A;  1QVF A;  5L23 A;  4C8Q G;  2DEU A;  2L3Q A;  2HQX A;  2AIR B;  2L3R A;  4F7U E;  1CKA A;  1ZHI A;  1M27 C;  3JB9 G;  3CPW S;  3G4S T;  3VYH B;  2RNA A;  2EJG A;  2HAX A;  2BIV A;  1SSF A;  3A8O B;  3FJP A;  2CP2 A;  1ZLM A;  3JCM g;  1ZUY A;  3CC7 T;  4E47 A;  3SWN B;  1PCX A;  3A8M B;  1PRM C;  1VQL Q;  1T0H A;  4OMO A;  1ABO A;  4HT8 A;  1UTI A;  3THK A;  2XIC A;  1Q86 U;  1FWZ A;  2ZPE B;  1BK2 A;  4M7D C;  3UT1 A;  2DBM A;  3CXC P;  3L2Z A;  2K3B A;  1WJR A;  3EG3 A;  2XDP A;  1D1C A;  1YHQ Q;  2XU8 A;  2WSF E;  2ATC B;  4JJC A;  4EMK A;  2ENM A;  4PJO G;  2E6N A;  3G6E T;  5DLO A;  2GFU A;  4K11 A;  4OMM A;  1C1A A;  1WLP B;  3OYN A;  4LDY A;  2COY A;  5LJ5 j;  1S1N A;  3S3O A;  1AOJ A;  1FMK A;  1BCM A;  2V8J A;  1W70 A;  5HK3 A;  2RI3 A;  3M4Y A;  4HCZ A;  1VQO T;  1UJY A;  5CKH A;  2ZGW A;  3I56 T;  3L2V A;  2YT6 A;  2LC4 A;  2DVJ A;  2EKH A;  1HJD A;  1QVG S;  2CDT A;  3PMI A;  1KQ2 A;  2HNI A;  1Y7X A;  2F2V A;  5CKD A;  2L0A A;  2LCL A;  1AD5 A;  4F7U A;  4JRP A;  2FO0 A;  5GAO n;  1H92 A;  1RI9 A;  1VYV A;  4IUT A;  3HRU A;  4OMF B;  3CCU Q;  2E70 A;  1G8X A;  5LJ3 j;  3JCM f;  3T9N A;  2RJF A;  2WAC A;  1YI2 T;  2JVV A;  4JRI A;  4LD9 K;  1V29 B;  3HFO A;  1PNJ A;  4C92 B;  1Z9Q A;  4D8K A;  2M0Y A;  1IHV A;  2LRQ A;  2JXB A;  2V1Q A;  3L2U A;  4Y92 A;  1VQ6 Q;  3RBB B;  2C0I A;  2CSQ A;  2DET A;  3ER0 A;  1WFW A;  3U23 A;  1YBY A;  2JS0 A;  3A8G B;  5KYU A;  1M2O A;  3QJ6 A;  2RQU A;  3HKS A;  1W2B A;  2EBP A;  2LT1 A;  4C92 F;  2ZPB B;  3H0F A;  1M2V B;  3QII A;  2KYM A;  5GAM g;  4XTU A;  1ARK A;  4JJN K;  3CCV Q;  1WI7 A;  2KXD A;  3I35 A;  2FYK A;  1QVG P;  2NYS A;  2BZ8 A;  4LUD A;  3I55 T;  4NL3 A;  4LD6 A;  4PJO A;  4WCI A;  3M0R A;  1KD1 R;  3NTI A;  2DXU A;  3MKD A;  2DRK A;  3OYE A;  2ZCF B;  2PUK B;  1FMW A;  2MWP A;  3EG9 B;  4MZT A;  3EFR A;  4PJM A;  4KH1 B;  4J6Y A;  3MPU B;  3PNW C;  4FYV B;  2DF6 A;  2CZ6 B;  2DYI A;  2E6Z A;  3RES A;  2W0Z A;  3ULR B;  1M1K R;  1IZ6 A;  2GTO A;  3OS0 A;  3CCS T;  2MIO A;  4LN2 A;  2RMO A;  1VQ5 T;  3H8Z A;  2F69 A;  2ROL A;  1I1J A;  2CP0 A;  3QDR B;  2ED0 A;  4LDW A;  5CIU A;  2D1X A;  2KNB B;  4FCY A;  3CCL A;  3EFO B;  1NJI R;  4JZ3 A;  2JM8 A;  3OMC A;  1AWX A;  3HTR A;  4PJN A;  4EIK A;  4MDX A;  4QVC A;  2EGC A;  2HMA A;  1KQS P;  2QTV A;  1YIT Q;  1R0C B;  3ZEH A;  1Y57 A;  4LUE A;  2AHJ B;  5GMK m;  3MP1 A;  2LJ3 A;  1MMN A;  3G7Z A;  3OA6 A;  4WF2 A;  4OGE A;  1WHJ A;  2MF2 A;  5I22 A;  2DEQ A;  4FYX B;  1SSH A;  3G71 A;  3JCM J;  3A98 A;  3PGG A;  3JCM e;  2X3W D;  2HDA A;  1GRI A;  1IHW A;  1QCO A;  3QPH A;  4NOY A;  2MI6 A;  1GFC A;  3S6W A;  3QBY A;  2RQV A;  4OGC A;  4HVU A;  4JRQ A;  4C0Z A;  2JT4 A;  3OW2 S;  2E10 A;  2EGE A;  2O01 E;  2VGN A;  3JB9 J;  2K2M A;  1QP2 A;  2RK2 A;  4X1V A;  1VQ9 T;  1YIJ T;  2M02 A;  3X26 B;  1MHN A;  1ZUK A;  2E3I A;  1K9A A;  2H3J A;  1B34 B;  3CCJ T;  4OML A;  2K5I A;  1M1K U;  1D09 B;  4OB0 B;  2QQ9 A;  5I2S A;  2M51 A;  1K4U S;  4A4G A;  1D3B B;  3UA7 A;  4DBF A;  1YJN T;  1U1S A;  1VQP A;  1BIB A;  5FRN A;  4M7A E;  1WHH A;  1VQN T;  2DIL A;  3CC4 T;  2V8K A;  2LP5 A;  2X4X A;  2R58 A;  1PC0 A;  4B6M A;  1VQ7 T;  2YUO A;  3R6O A;  1QCN A;  3M0P A;  1GXI E;  3PIP A;  3QDF A;  1M3B A;  3UDC A;  1OV3 A;  2XK0 A;  3ME9 A;  3LYI A;  2IG0 A;  1ZSZ A;  3J80 E;  3TQ7 P;  3FIF A;  1UEB A;  5KCO A;  3A5Z B;  4OP0 A;  4HCK A;  3OW2 P;  2V26 A;  1WHM A;  2QDY B;  3OBW A;  2DM1 A;  2CZ7 B;  1S72 T;  1NYG A;  1ZA1 B;  4Z88 A;  3CME A;  5KYX B;  4HCB A;  2A36 A;  2OJ2 A;  3CCE Q;  4GLM A;  2E12 A;  5C0M A;  4LDX A;  1RUW A;  1JB0 E;  2QGG A;  1WZO A;  2D0N A;  2ZAE A;  5CVI A;  3EGD A;  1RAE B;  3L1A A;  2DL4 A;  2CP5 A;  1TG0 A;  1N5Z A;  3L2R A;  1GCQ C;  3EFS A;  4RCB A;  2OTJ T;  3GLX A;  5CKB A;  1TSF A;  3CCQ T;  2C0O A;  5GAN d;  2X3X D;  4M7D G;  1K8A C;  2GCX A;  5GAN h;  3BDU A;  1K9M U;  3D7S B;  4AT1 B;  1YJ9 Q;  3V7C A;  2KY9 A;  2YLB A;  3EGU A;  3JSC A;  5A0L A;  2DJQ A;  1Q81 U;  1R8O B;  1WGS A;  1TUG B;  1AVZ C;  4M78 E;  3JCM W;  3CC2 T;  3E9G A;  1NPR A;  2L3S A;  3DB4 A;  2EGA A;  2OTL Q;  1X75 C;  3LGL A;  1OUL A;  3M59 A;  3JCM b;  3RMS A;  5GAN 3;  4VUB A;  1JJ2 P;  5IHI A;  3QKJ A;  1JRI A;  2J6F A;  1VQ4 Q;  3RER A;  4M77 E;  3QJY A;  3RDV A;  1UFF A;  5D7U A;  1ZQ1 A;  1T0J A;  3UAT A;  3OS1 A;  2M9U A;  1VQL A;  2O2O A;  3JCM c;  2YLC A;  3HRS A;  1YFN A;  3F70 A;  5FW9 A;  1M90 U;  4F7U F;  3BW1 A;  3GNG A;  2DTH A;  3SWN C;  1ZUU A;  4LDV A;  4R55 A;  3LH0 A;  1UE9 A;  2YHT A;  1KG1 A;  4KUI A;  2DIQ A;  3EG2 A;  2RHX A;  4J5Y A;  4RG8 A;  1K1Z A;  4FIB A;  3PT9 A;  3H41 A;  2CUB A;  2IVW A;  3JCM V;  1GL5 A;  3LGF A;  3OYY A;  3JB9 F;  2F2W A;  2HZY A;  1N8R R;  1M8M A;  3GP8 A;  4RCC A;  2PVG B;  4C5I A;  3OYB A;  4Z02 A;  4M75 E;  5LJ5 g;  4QVZ A;  5D6Y A;  2NUZ A;  2RO0 A;  4IUU A;  2VGM A;  4DBR A;  1YJW T;  1UEC A;  4C92 D;  2HSE B;  2E4H A;  2ZPH B;  4M78 A;  1QMC A;  2LT4 A;  4F16 A;  1C0M A;  1UJ0 A;  2X4Y A;  3VS4 A;  4BAC A;  4LXC A;  1I4K 1;  3SDZ A;  2EQK A;  4OVA A;  4A63 B;  4JS5 A;  3CCU A;  3JB9 H;  1XQH A;  3VUB A;  4ORZ A;  1GCP A;  2JJ9 A;  2VV5 A;  1IGQ A;  2Z0W A;  1G3W A;  3CD6 T;  5LJ3 g;  4IUP A;  2C06 A;  3TSW A;  2WSC E;  1OZ3 A;  2LX9 A;  2A3L A;  4MZP A;  4J9G A;  2KYB A;  2NUP B;  1TTH B;  3ZBD A;  1OPK A;  1VQ6 A;  2RA2 A;  1UDL A;  4C92 C;  4Y28 E;  1VQM Q;  2DAQ A;  2YUQ A;  1G83 A;  4FT2 A;  2LQN A;  1J3T A;  4Y91 A;  5CQY A;  3FLG A;  3JCM d;  1TUC A;  2DVE A;  2HKN A;  2A08 A;  2X9H A;  4E7K A;  1Q7Y C;  2EVR A;  3RNJ A;  3JCM h;  3CCV A;  3X25 B;  1IGU A;  3M58 A;  3CXC S;  2J6K A;  5LJ5 f;  3WXM B;  4C5G A;  2CP7 A;  5HCK A;  1PKS A;  1SHG A;  4RTV A;  2LMJ A;  3X20 B;  2E64 A;  3QHS A;  4OB2 B;  4FT4 A;  2GBQ A;  3OYF A;  3RKW A;  2PU9 B;  3TSZ A;  2EFI A;  2DL7 A;  5GAN 6;  2CKK A;  2EYQ A;  5KH6 A;  2CS7 A;  1K9M C;  1I5L A;  1VQ8 Q;  1G3Y A;  3CCR T;  2B86 A;  2JTM A;  2ROT A;  2RQR A;  4PFP A;  2O88 A;  4KBM B;  4CI0 C;  2PQW A;  2R57 A;  4C8Q E;  1AHJ B;  3CBP A;  1WJQ A;  2OAU A;  5LJ3 f;  4ELZ C;  2DL3 A;  5KE3 A;  1SF9 A;  3CQT A;  2NUT B;  1YHQ T;  3OYL A;  1Y96 B;  2DFU A;  1NE8 A;  1QKW A;  1OU8 A;  4FW2 A;  2DBK A;  3LW5 E;  2YUP A;  1H3H A;  2R5M A;  1QLY A;  3NFC A;  3NMZ C;  4JJD A;  3V8L A;  2FPE A;  4BE1 A;  4ZGJ B;  2O4X B;  3OYD A;  5I2M A;  1OYX A;  3REB B;  1YIT A;  3S3M A;  2MCN A;  4BDZ A;  3M0T A;  4HT9 A;  1X69 A;  2W10 A;  4F04 B;  2EAY A;  1M1F A;  4II1 A;  3NTH A;  3G4S Q;  4HXJ A;  1X2K A;  1PM3 A;  2KMT A;  3A1P A;  5GMK e;  1M90 C;  2E3H A;  3CCM T;  1W2B P;  4PJO E;  2H8H A;  3VS0 A;  3S3N A;  2P0Q A;  1O75 A;  3OQ5 A;  5GAN e;  5ECA A;  2V8I A;  4XTZ A;  4ZTJ A;  4RTW A;  2D9T A;  1YCS B;  1G5V A;  4GY5 A;  4GBQ A;  1BI1 A;  3EH2 A;  3JRZ A;  2NWM A;  5CKF A;  2QEX T;  3OYI A;  2K7A A;  2A0F B;  2YRC A;  4PLL A;  5DY9 A;  3VUZ A;  2QA4 T;  2CT3 A;  3JCM X;  1BBZ A;  2EQJ A;  2F5K A;  3L2W A;  1D0X A;  4E7S A;  4BB7 A;  2HQE A;  3OSS C;  1LCK A;  4E7Z A;  3EGD B;  2RM4 A;  4XTW A;  4C8Q A;  4Q5W A;  1SPK A;  1IRE B;  3BFM A;  2FRW A;  3MP8 A;  1DJ7 B;  3RR6 A;  1X2Q A;  1TH7 A;  1WA7 A;  2VC8 A;  1U1T A;  1VIE A;  1F1B B;  3L2Q A;  3BDL A;  3QSU A;  2C0T A;  1VQO Q;  1AWO A;  1NPP A;  4PK4 A;  3I56 Q;  1T3L A;  1HYO A;  1BCO A;  1B07 A;  2K4Y A;  3CBO A;  3FDR A;  2DL8 A;  2EYZ A;  1Q82 R;  3FEO A;  2G6F X;  2CP6 A;  5KYY A;  3CXC A;  4MMK A;  4M7A B;  3BE3 A;  1BB9 A;  2SEM A;  3VRZ A;  3GNF B;  4WTO B;  5KYW A;  4XTX A;  3VKI A;  1UG1 A;  3FRN A;  1KQS S;  1K73 R;  4ZN3 A;  3P8B B;  3TRE A;  5IHN A;  1RLQ C;  2PVD B;  4M7A F;  1SEM A;  4FSS A;  3SFM A;  3CCE A;  2E5Q A;  2QQS A;  1UGQ B;  2DJZ A;  2L8D A;  4OB3 B;  3CPW A;  1QWF A;  1Y07 A;  4EMH A;  4J9E A;  4NS5 A;  5HY6 A;  4QVD A;  3J81 E;  5AT1 B;  2XI9 A;  3VS6 A;  1ZSG A;  2GTJ A;  3CEY A;  3MCA B;  3M55 A;  4LNP A;  2RHI A;  2E41 A;  5FWB A;  4KT0 E;  3E19 A;  1KC8 R;  3I55 Q;  1CKB A;  4PLI A;  1VYU A;  3OYK A;  1WX6 A;  2F2X A;  1UGS B;  1WXT A;  1K0X A;  2GF7 A;  1VQK A;  1C6V X;  1YJ9 A;  5GAO p;  4O6J A;  1PD0 A;  4XK8 E;  1EZZ B;  2AKK A;  2JMC A;  2NLU A;  1MMD A;  2DYB A;  3ASK A;  4QQG A;  2ZPG B;  1UGV A;  2FG0 A;  2E65 A;  2OTL A;  1UB4 A;  3JB9 D;  2LTO A;  5GAM f;  2KQW A;  3MEW A;  1K0S A;  3MP6 A;  3OYH A;  3PIO A;  3CCS Q;  2EKO A;  1G3S A;  3O5Z A;  2JOY A;  4M78 B;  2DO3 A;  2LNH B;  4BY6 C;  1Q86 C;  1VQ5 Q;  2B8A A;  3RUX A;  1VQ4 A;  2KGT A;  3H0H A;  4A53 A;  2QAZ A;  5FRO A;  3VRY A;  4XQ3 A;  1XJW B;  4FYY B;  1QVG A;  2KK4 A;  2XD0 A;  1RI0 A;  1HSQ A;  4FW1 A;  2DA9 A;  4JPB W;  4M78 F;  1RL2 A;  3KBG A;  4M77 B;  2ESW A;  1KD1 U;  3PVL A;  3FJ5 A;  4R56 A;  3MHX A;  1UGR B;  3WVD B;  3OYM A;  1OOT A;  4ZGE B;  2QGF B;  2CZ0 B;  1M4Z A;  2MMP A;  2KVQ G;  1LJO A;  3ZFJ A;  4CRI A;  3LWI A;  5FWC A;  3BY7 A;  2JW4 A;  5DLQ E;  2KDS A;  4M77 F;  2ZPF B;  1TOV A;  2CGH A;  4NL2 A;  1UHF A;  2RB6 A;  3OY9 A;  1JBM A;  1X6B A;  1RAB B;  4C92 G;  2QK0 A;  5I21 A;  4HA8 A;  4V2S A;  2DRM A;  1WIE A;  4C0F A;  4XU2 A;  3M53 A;  4IUQ A;  5GAO l;  4Z8A A;  4FYW B;  2XG8 D;  3EH1 A;  5KYN A;  1NJI U;  1WHG A;  2FPF A;  4M75 B;  4DOV A;  2L2P A;  4J9I A;  1EX4 A;  1NEG A;  4JJB A;  4JUV A;  1KQS A;  1VQ9 Q;  1YIJ Q;  2M1H A;  2LJ0 A;  5IAY A;  2AZS A;  3ZL7 C;  1WNL A;  3V7R A;  2KXC A;  2RJD A;  2JM9 A;  2BUD A;  3VS1 A;  1WJS A;  4CC7 A;  1YCY A;  4FM4 B;  5HKC A;  4B9W A;  2CH4 A;  2IPO B;  1JXM A;  2PZ1 A;  2K3Y A;  5IXF A;  4M75 F;  4X9D A;  1JQQ A;  2BE7 D;  4RKU E;  1QCF A;  4OB1 B;  2QTX A;  1VUB A;  4BI8 B;  2H3E B;  1WQW A;  1JJ2 S;  1YJN Q;  1GBR A;  2Y4X A;  2RJE A;  4QT7 A;  2X4J A;  3CC4 Q;  5IN1 A;  2EYY A;  3INZ A;  4XTY A;  1G3T A;  4HCC A;  4N0A C;  1VQM A;  1AZG B;  3CCL T;  5GAM e;  1OQK A;  3AHU A;  3DLL A;  2D8H A;  5FU6 C;  1OX9 A;  5GMK h;  1QWE A;  2YUN A;  2AZV A;  1QW1 A;  4J83 A;  2EQU A;  4EMK B;  1S72 Q;  3CMA A;  1BI0 A;  4ESR A;  3MJX A;  3A8L B;  3JB9 I;  4DEX A;  1VQK Q;  3MEA A;  3UWN A;  1WXB A;  1N9R A;  1QKX A;  3A8H B;  2ZZD A;  3H9N A;  2X4W A;  2X35 A;  4M7D E;  4BE0 A;  2RJC A;  3G71 T;  3PFS A;  3GPL A;  2VUB A;  3P8D A;  1NEB A;  4C0G A;  4E7J A;  4P5N A;  3X24 B;  4BY6 B;  1HD3 A;  2LQK A;  3OB9 A;  1VQ8 A;  1MGQ A;  1OZ2 A;  2PTK A;  4UC4 A;  4JRK A;  3CCQ Q;  5LJ5 d;  4F7U B;  1FMV A;  1M2V A;  1E6G A;  2MYS A;  5EG2 A;  2YRD A;  3OW2 A;  2DER A;  5LJ5 h;  5GAN 2;  2A28 A;  1AT1 B;  5CK9 A;  2VWF A;  2GGR A;  4AG1 C;  2YDL A;  4C8Q B;  1X6G A;  1WYX A;  4X34 A;  4IKF A;  4J9C A;  3SHW A;  4PFZ A;  5M9O A;  3TU4 K;  1UHC A;  1KQ1 A;  3JV3 A;  1WXU A;  1OU9 A;  1SRM A;  8ATC B;  1SKU B;  3CC2 Q;  4J6W A;  3EG9 A;  3KUF A;  4C8Q F;  1OPL A;  2DD4 A;  3DB3 A;  5GJW B;  4XU1 A;  1VQP T;  3G4S A;  2WSE E;  2KT1 A;  5LJ3 h;  2KRO A;  5KYU B;  1OEB A;  5KYY B;  5KYW B;  2COW A;  3I9Q A;  3CC7 A;  2A37 A;  4QQD A;  4MML A;  2GQI A;  1ZSZ C;  3M0U A;  3REA B;  1IO6 A;  1Q95 G;  3M0S A;  4PJO B;  1ZBX A;  3HL8 A;  1M1G A;  4M7D A;  3EFO A;  1KSW A;  3EHQ A;  1FXX A;  2HL5 C;  2QXF A;  5D6X A;  1M3C A;  2DPP B;  4LE9 A;  3UA6 A;  1V76 A;  3GF5 A;  1M1K C;  3Q1J A;  3CME T;  1KHI A;  4KGV B;  3G1J A;  4DEY A;  4AFZ C;  3VJP A;  3JAM E;  2LCC A;  1EIF A;  4J7F A;  3G6E A;  2JTE A;  1M30 A;  4A4F A;  4PJO F;  1QVF P;  4M7A D;  2XKO C;  2RQT A;  1X43 A;  4D6W A;  1JJ2 A;  5GAN 8;  2RD1 A;  3OYC A;  1NJI C;  2F1L A;  1RAC B;  1BKB A;  1KK7 A;  2EW3 A;  3M57 A;  1RAG B;  2KAF A;  1XTD A;  3TCJ A;  1R77 A;  1WHL A;  1ZA2 B;  1VQO A;  1T3S A;  1MV3 A;  5CKE A;  3I56 A;  3QO3 A;  1YJW Q;  2EYW A;  3OBY A;  4Z89 A;  1KIK A;  1D1A A;  2KRM A;  5FU6 B;  1IB8 A;  1Q86 R;  3C0C A;  2AK5 A;  2SRC A;  3KFV A;  2HSP A;  1LVK A;  2QQA A;  1U5S A;  3E2U A;  4N4I A;  2ED1 A;  2HEQ A;  1U8R A;  4QKU A;  4PL6 A;  4FL6 A;  1N9S A;  1PG5 B;  3MEV A;  3OYJ A;  4M7A C;  3H6Z A;  3CMA Q;  1B34 A;  1YI2 A;  3PVQ A;  3CD6 Q;  2FVU A;  1AEY A;  1RAD B;  2LNV A;  3M56 A;  4E7L A;  3QYG B;  4KRT A;  1HK9 A;  1N8R U;  2VB6 A;  4FU6 A;  3PTA A;  1QP3 A;  1XNI A;  5GJV B;  2DTO A;  4ATO A;  1W2B S;  4XTV A;  3MO8 A;  2JZ2 A;  1PKT A;  2EJ9 A;  2BE9 B;  4KUD K;  2A7Y A;  1VQL T;  4X9C A;  4A4E A;  2VKN A;  3CBM A;  4F7U G;  4XU3 A;  2LJ1 A;  2AKL A;  1PSE A;  4IUR A;  2DIG A;  1MV0 B;  7AT1 B;  1Q81 C;  1GFD A;  1PRL C;  3LWH A;  2D6F A;  3URG A;  3JCM P;  1TU0 B;  5J3B A;  2RPN A;  3I55 A;  3HFN A;  1Y71 A;  4M78 D;  2XHC A;  1RLP C;  5CQX A;  3V7S A;  2KRN A;  1OI1 A;  1CSK A;  1MMG A;  2YRV A;  4J9H A;  2CRE A;  5KYX A;  3RKY A;  4TVR A;  2G3R A;  5GMK j;  2P0K A;  3C4S A;  4J8O A;  1SHF A;  4JLI A;  1PD1 A;  3V8K A;  2EPD A;  3N5B B;  1ACM B;  4M77 D;  5GAN j;  2L5Q A;  1Y0M A;  1ZX6 A;  3E1S A;  2COZ A;  2M16 A;  4J9F A;  3CCR Q;  2RHY A;  5FU7 B;  2HCK A;  2CH4 W;  3CCS A;  4C0D B;  4ELY C;  2FL7 A;  1BYM A;  2DL5 A;  5CR2 A;  5J26 A;  2P84 A;  2KSS A;  1U06 A;  1PHT A;  2ABL A;  3OS5 A;  5IXB A;  1VQ5 A;  1V1C A;  1YN8 A;  4LDU A;  1ZSZ B;  1RAA B;  1RAF B;  1KJW A;  5I11 A;  2YSQ A;  2Y4Y A;  1M5Q 1;  2FEI A;  3CC7 Q;  3NGP A;  1MMA A;  4M78 C;  2QYZ A;  1TXQ A;  1H3Z A;  4PKC C;  3QZ5 B;  4DA4 A;  4A4K A;  1ZBJ A;  3E9F A;  4AFQ C;  3CCU T;  4E7H A;  3RIR A;  1XOV A;  5GAM d;  4ZN1 A;  5GAM h;  1D0Z A;  4ANJ A;  4M77 C;  3UPU A;  4M75 D;  1K8A R;  3G6E Q;  3CPW P;  3FC3 A;  3QYH B;  1D1B A;  1VQ6 T;  3SB2 A;  2JNG A;  3CCM Q;  2LVM A;  1NG2 A;  2K5F A;  4J6X A;  5LJ5 e;  4E7I A;  1LPL A;  2RN8 A;  4CC3 A;  2HD0 A;  3WVE B;  4E6R A;  3CCV T;  1BU1 A;  4R0K A;  1Z9Z A;  4J7I A;  2QEX Q;  3M54 A;  2FPD A;  5GAN 4;  4IIM A;  2QA4 Q;  1W6X A;  1VQ9 A;  3TEE A;  1YIJ A;  4RTY A;  4N4G A;  4ME7 A;  4M75 C;  5CO7 A;  3CCJ A;  1AZE A;  4A54 A;  3J7A F;  3EGX A;  5LJ3 e;  1FYN A;  4QQ6 A;  1YI2 Q;  5GAO m;  4BI4 A;  2MOX A;  2Y90 A;  1UUE A;  1NYF A;  4OMQ A;  3QUI A;  4JZ4 A;  2DZ9 A;  1YJN A;  2O9V A;  3OS2 A;  3CPF A;  4JS4 A;  2VXF A;  1VQN A;  3CC4 A;  4RG2 A;  2I2L A;  1O9S A;  1VQ7 A;  4A4H A;  2BZY A;  2OI3 A;  1MND A;  2FZC B;  5KE2 A;  2AT1 B;  3GBQ A;  3OSV A;  2BKD N;  4O5V A;  3I5S A;  1WPY A;  1N8R C;  1IRX A;  1HXD A;  3MEU A;  4IIO A;  1S72 A;  1X27 A;  1YIT T;  1K8A U;  2RK1 A;  1G2B A;  3QWX X;  4AFS C;  4EMK C;  3C12 A;  2EJF A;  1A0N B;  4BD3 A;  2QG9 B;  1OX8 A;  2K6D A;  3NHN A;  4J9B A;  4C8Q D;  3KXT A;  2DNU A;  1NBE B;  4N0A A;  2JMA A;  2P0P A;  4DBH A;  2NUP A;  5FRM A;  6AT1 B;  1GCQ A;  3M4G A;  4ZNX A;  1NZ9 A;  4M7D B;  2LQ8 A;  2CYZ B;  2CUD A;  2OTJ A;  3H0I A;  2LDM A;  5IH2 A;  4F14 A;  1E7O A;  1LOJ A;  1TS9 A;  1Q82 U;  1YWP A;  3CCQ A;  4DOW A;  2K9G A;  4N4H A;  2LCS A;  3EAE A;  1KFZ A;  4L59 A;  2M0O A;  2EIF A;  1M3A A;  4M7D F;  2CT4 A;  4XAX B;  1K73 U;  2KEA A;  4DQ2 A;  4RTZ A;  2L89 A;  5KCH A;  4B9X A;  4C8Q C;  2LZ6 B;  1WDX A;  4KUL A;  1Q7Y R;  3VV0 A;  2EWN A;  3CC2 A;  2JS2 A;  5GAO q;  4MZM A;  2LQW A;  4PJO D;  4C5H A;  5LL6 S;  3SD4 A;  2L3P A;  5HK0 A;  2BZX A;  1M8V A;  2KBT A;  4HKE A;  2RQW A;  1I8F A;  1SRL A;  2J05 A;  2RI2 A;  1H8K A;  1JXO A;  2CSI A;  3M9Q A;  3LLR A;  3QZ9 B;  3JCM Q;  2XMF A;  4M4Z A;  2MK5 A;  4OMN A;  2ZPI B;  1KC8 U;  2NUT A;  1IXD A;  1Y96 A;  3SWN A;  2MAM A;  1K9M R;  4C92 E;  2K5L A;  3QXE B;  3LH5 A;  4EPC A;  2HKQ B;  2QAS A;  4M7A G;  1AWW A;  1MUZ A;  2O31 A;  1KHC A;  4IUV A;  2XDD A;  1Q81 R;  5GAO r;  4C5E A;  3GIB A;  4PJO C;  2IIM A;  3NPF A;  2O4X A;  2DTI A;  2PVO B;  3CCE T;  2VVK A;  2K79 A;  3CCJ Q;  2VYT A;  3MET A;  1N27 A;  4DBQ A;  2KE9 A;  2CZ1 B;  4CC4 B;  2DD5 A;  1TUD A;  2QI2 A;  2X51 A;  1JEG A;  2E5K A;  5GAM j;  2QQB A;  2DZC A;  1P92 A; 
#chains in the Genus database with same CATH homology
 1E6H A;  1KSW A;  3EHQ A;  3REB B;  3ULR B;  1NLO C;  2DE0 X;  2MCN A;  3UA6 A;  1M3C A;  4LE9 A;  2GTO A;  3M0T A;  2MIO A;  1X69 A;  2W10 A;  4LN2 A;  4DEY A;  4AFZ C;  2RMO A;  2DX1 A;  2P4R A;  4HXJ A;  1I07 A;  1X2K A;  2ROL A;  1I1J A;  2JTE A;  1M30 A;  2ED0 A;  2D1X A;  2H8H A;  2RQT A;  2KNB B;  3VS0 A;  1YWO A;  1X43 A;  4JZ3 A;  2JM8 A;  1AWX A;  5ECA A;  4EIK A;  2EGC A;  2KR3 A;  2EW3 A;  4RTW A;  1YCS B;  3PE0 A;  4GBQ A;  2D8J A;  2NWM A;  4J9D A;  1T3S A;  1MV3 A;  1Y57 A;  4LUE A;  1NLP C;  2FRY A;  2K7A A;  2EYW A;  1GBQ A;  2LJ3 A;  2CT3 A;  4Z89 A;  1KIK A;  2KRM A;  1NM7 A;  1BBZ A;  3C0C A;  2AK5 A;  5I22 A;  1U3O A;  2SRC A;  1ABQ A;  1SSH A;  3KFV A;  2HSP A;  3A98 A;  1LCK A;  2RF0 A;  2X3W D;  1U5S A;  2HDA A;  1GRI A;  2ED1 A;  2HEQ A;  1SPK A;  2FRW A;  2DLP A;  1GFC A;  4D8D A;  1X2Q A;  4RTU A;  1WA7 A;  2RQV A;  4HVU A;  2JT4 A;  3PVQ A;  2C0T A;  2KT8 A;  1AEY A;  2EGE A;  1AWO A;  2K2M A;  4HVW A;  4KRT A;  1T3L A;  3EG1 A;  3EG0 A;  1B07 A;  2J7I A;  4X1V A;  2DL8 A;  2BTT A;  3UF4 A;  5GJV B;  2EYZ A;  4RTT A;  2DMO A;  1ZUK A;  2G6F X;  2EQI A;  1K9A A;  3SEM A;  1BB9 A;  2SEM A;  3VRZ A;  3IQL A;  1PKT A;  4OML A;  4F17 A;  1UG1 A;  2J6O A;  2VKN A;  2LJ1 A;  2AKL A;  1MV0 B;  1GFD A;  1PRL C;  2M51 A;  1K4U S;  5IHN A;  2OAW A;  1RLQ C;  3UA7 A;  4RUG A;  2RPN A;  1SEM A;  4FSS A;  1RLP C;  2DIL A;  2KRN A;  2KRS A;  2LP5 A;  3VS7 A;  5EC7 A;  1CSK A;  2YUO A;  3M0P A;  4J9H A;  2EYX A;  2CRE A;  4HVV A;  1M3B A;  1QWF A;  2J06 A;  1OV3 A;  2QDL A;  4J9E A;  1SHF A;  1VYT A;  4HCK A;  3VS6 A;  2EPD A;  1ZSG A;  2GTJ A;  1Y0M A;  1ZX6 A;  2DM1 A;  1NYG A;  4J9F A;  4LNP A;  4CC2 A;  2HCK A;  2CH4 W;  3TVT A;  3QWY A;  3VS5 A;  4Z88 A;  5FWB A;  2DL5 A;  1U06 A;  1PHT A;  2ABL A;  3M0Q A;  4AG2 C;  5IXB A;  1CKB A;  2A36 A;  1V1C A;  1YN8 A;  2OJ2 A;  1VYU A;  1KJW A;  1WX6 A;  2F2X A;  5I11 A;  1WXT A;  1PWT A;  4GLM A;  1K0X A;  2YSQ A;  2FEI A;  3NGP A;  2HBW A;  1RUW A;  2JMC A;  2AKK A;  4AFU C;  1JU5 C;  1ZBJ A;  2D0N A;  4AFQ C;  2DYB A;  2DL4 A;  1XOV A;  1TG0 A;  1N5Z A;  1GCQ C;  1K76 A;  1UGV A;  2V1R A;  2FG0 A;  2ECZ A;  1K0S A;  1YNZ A;  2C0O A;  3O5Z A;  1W1F A;  2X3X D;  2LNH B;  1I0C A;  1EFN A;  2KGT A;  3H0H A;  3VRY A;  1YP5 A;  4RTX A;  3EGU A;  1NG2 A;  2DJQ A;  5IHK A;  2O9S A;  1HSQ A;  2DA9 A;  4JPB W;  2RN8 A;  4CC3 A;  1B3Q A;  1AVZ C;  2ESW A;  2L3S A;  4E6R A;  3PVL A;  3FJ5 A;  2EGA A;  2PNI A;  1BU1 A;  4R0K A;  1OOT A;  1AWJ A;  1Z9Z A;  3VS2 A;  2FPD A;  4IIM A;  5IHI A;  3VS3 A;  1W6X A;  2J6F A;  4RTY A;  5FWC A;  2LX7 A;  2JW4 A;  2GNC A;  3I5R A;  1AZE A;  2I0N A;  1UFF A;  1UHF A;  1X6B A;  1T0J A;  3UAT A;  1VA7 A;  1FYN A;  2O2O A;  2DRM A;  1JO8 A;  1WIE A;  3EHR A;  4OMP A;  2MOX A;  5FW9 A;  3R6N A;  5L23 A;  1ZUU A;  2L3Q A;  1UUE A;  1NYF A;  1CKA A;  1UE9 A;  4OMQ A;  4Z8A A;  4JZ4 A;  2O9V A;  3EG2 A;  1M27 C;  2FPF A;  2L2P A;  4J9I A;  4JJB A;  1NEG A;  1K1Z A;  2RNA A;  3H41 A;  2CUB A;  2LJ0 A;  2AZS A;  2BZY A;  3ZL7 C;  2OI3 A;  1GL5 A;  2KXC A;  2F2W A;  2JM9 A;  1ZLM A;  3VS1 A;  4CC7 A;  1ZUY A;  3GBQ A;  2CH4 A;  1M8M A;  1PRM C;  1JXM A;  2PZ1 A;  3I5S A;  5IXF A;  1T0H A;  4OMO A;  1ABO A;  1UTI A;  1JQQ A;  3THK A;  4IIO A;  1QCF A;  2NUZ A;  1X27 A;  1BK2 A;  1G2B A;  2DBM A;  2K3B A;  1GBR A;  1UEC A;  3QWX X;  4AFS C;  3EG3 A;  4QT7 A;  1A0N B;  4JJC A;  2EYY A;  2ENM A;  2K6D A;  3NHN A;  4J9B A;  2DNU A;  4F16 A;  1UJ0 A;  4K11 A;  3VS4 A;  1AZG B;  4OMM A;  2JMA A;  4A63 B;  1WLP B;  1GCQ A;  4ORZ A;  2D8H A;  4ZNX A;  1GCP A;  1QWE A;  1S1N A;  1AOJ A;  1FMK A;  2CUD A;  2YUN A;  2AZV A;  3H0I A;  5IH2 A;  4F14 A;  1E7O A;  1W70 A;  1YWP A;  3TSW A;  1UJY A;  4ESR A;  2K9G A;  2YT6 A;  4J9G A;  2LCS A;  4DEX A;  2DVJ A;  2EKH A;  2KYB A;  1HJD A;  1KFZ A;  1WXB A;  2CDT A;  1M3A A;  1QKX A;  1OPK A;  2CT4 A;  2F2V A;  2KEA A;  2L0A A;  1UDL A;  1AD5 A;  1NEB A;  4RTZ A;  2FO0 A;  1H92 A;  1RI9 A;  1VYV A;  1G83 A;  2YUQ A;  2LQN A;  1J3T A;  2LZ6 B;  1WDX A;  1HD3 A;  1TUC A;  2JS2 A;  2A08 A;  2LQW A;  2EVR A;  3RNJ A;  2PTK A;  2L3P A;  2BZX A;  2J6K A;  2KBT A;  1E6G A;  2RQW A;  1PNJ A;  1Z9Q A;  4D8K A;  1SRL A;  2J05 A;  1H8K A;  1JXO A;  2M0Y A;  2A28 A;  5HCK A;  1PKS A;  1SHG A;  2CSI A;  4RTV A;  2JXB A;  2LMJ A;  2V1Q A;  2GGR A;  2VWF A;  4AG1 C;  2YDL A;  4Y92 A;  1X6G A;  1WYX A;  3RBB B;  2C0I A;  2CSQ A;  2GBQ A;  1WFW A;  2XMF A;  3U23 A;  4J9C A;  2JS0 A;  4M4Z A;  3SHW A;  3TSZ A;  2DL7 A;  4OMN A;  2RQU A;  2EBP A;  1UHC A;  3H0F A;  3JV3 A;  1WXU A;  1SRM A;  2KYM A;  3LH5 A;  1ARK A;  2B86 A;  2ROT A;  1WI7 A;  2KXD A;  1AWW A;  2RQR A;  1MUZ A;  2O31 A;  2O88 A;  3I35 A;  1OPL A;  5GJW B;  2BZ8 A;  4LUD A;  2IIM A;  3NPF A;  2DL3 A;  4WCI A;  3M0R A;  2KT1 A;  2KRO A;  2VVK A;  1OEB A;  2K79 A;  3CQT A;  2DRK A;  2KE9 A;  1QKW A;  2DBK A;  4CC4 B;  2YUP A;  3I9Q A;  1H3H A;  2A37 A;  1QLY A;  1TUD A;  3NMZ C;  2GQI A;  1JEG A;  4JJD A;  3M0U A;  3REA B;  1IO6 A;  2E5K A;  2FPE A;  2DF6 A;  3M0S A;  2W0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...