4AFSC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afsC00
3SEMA 1ABOA 2RQTA 2CH4A 3NGPA 3EHQA 4JJCA 1HJDA 2SRCA 5FWBA 2C0TA 2F2XA 2NUZA 1ARKA 1T3SA 1CSKA 3NMZC 1SPKA 2YUQA 1X2QA 1NEBA 2A37A 1H8KA 1B07A 2D8JA 2GQIA 1ABQA 1I07A 2HCKA 2L3PA 3UATA 2YUOA 2YUNA 2FPDA 4DEYA 1OPKA 2KT1A 1K0XA 4J9EA 1HD3A 2EGCA 4JZ4A 2RMOA 2KBTA 4RTUA 2ABLA 2HDAA 3REAB 2RNAA 2LNHB 4AG2C 3TSWA 1AD5A 2DBKA 2RF0A 3NHNA 1GFDA 1TUCA 1UTIA 2ED1A 2L0AA 4EIKA 2FRYA 1Y0MA 1Y57A 1RUWA 1ZSGA 2CUBA 4RTTA 1X27A 4JJBA 2O2OA 4OMQA 2C0OA 1YWOA 1T3LA 1U5SA 1YCSB 2LP5A 2DL5A 1I0CA 1LCKA 1VYTA 2F2WA 1AWXA 1N5ZA 2P4RA 1HSQA 1UHCA 5IXFA 4AG1C 5L23A 2QDLA 1ZUUA 5I11A 2DNUA 5IXBA 1K1ZA 1S1NA 3KFVA 1SHFA 4Z8AA 4ORZA 2EYZA 2CH4W 2X3XD 1K4US 1AVZC 2LJ3A 3FJ5A 3JV3A 1WXUA 4J9DA 2A08A 3RBBB 1OPLA 2KR3A 3VRYA 2ROLA 1X6BA 2FPFA 1AEYA 2OI3A 1OOTA 2V1QA 2PTKA 2K6DA 4DEXA 2DRMA 2FG0A 1NEGA 1WI7A 2JW4A 3UF4A 3ZL7C 1K9AA 4KRTA 1AWOA 1T0JA 1K76A 4AFZC 4WCIA 1YNZA 2EQIA 1VYVA 4LUEA 1SHGA 2CSIA 1AOJA 1MV3A 1W1FA 1YWPA 3CQTA 2DILA 3GBQA 4F16A 1WDXA 1GRIA 1H3HA 1E6GA 3TSZA 2JMCA 3IQLA 2EYWA 2DA9A 4IIMA 4D8DA 3VS6A 4RTWA 1GBQA 1ZLMA 1AWJA 1U06A 2GNCA 3I35A 1UJ0A 2LQWA 5FWCA 2AK5A 3THKA 1OV3A 3EG2A 4AFQC 1UHFA 3QWYA 1UDLA 1UE9A 1M3BA 2KRSA 3R6NA 1WXBA 1NYFA 1WIEA 2HBWA 1M8MA 1GBRA 1X43A 5IHIA 3I5RA 4RTZA 2KYBA 3H0IA 1QCFA 2FO0A 4RUGA 2VWFA 2MIOA 2RQWA 4J9HA 4ZNXA 3UA6A 2VVKA 2K3BA 1UUEA 1GCQA 1V1CA 1X6GA 2GBQA 3VS1A 2DX1A 2L2PA 3ULRB 1H92A 3VS2A 2J7IA 1IO6A 2KT8A 2J6OA 2KYMA 2DBMA 2DL8A 2D0NA 1VYUA 3EHRA 1OEBA 2I0NA 2W0ZA 2BZYA 2YT6A 1TG0A 1CKBA 2IIMA 3I9QA 2DL4A 4J9IA 2K7AA 2JM9A 3M0TA 1CKAA 2ESWA 2K79A 1WA7A 1T0HA 3NPFA 4LE9A 4Z88A 2JXBA 2DM1A 2KE9A 4R0KA 1ZUKA 2ENMA 3I5SA 1TUDA 3VS5A 2EVRA 1NYGA 2JS0A 1BBZA 3O5ZA 2DL3A 2AKLA 4CC3A 2C0IA 2RQUA 2V1RA 1NG2A 2KXCA 4LUDA 2EYXA 1J3TA 1JU5C 3EG0A 1M30A 1SEMA 1Z9ZA 4JZ3A 2O88A 2AZSA 4E6RA 2H8HA 3LH5A 2BZ8A 1WXTA 5FW9A 3VS4A 3M0PA 2DJQA 2LQNA 2EW3A 3U23A 2G6FX 3EGUA 1E6HA 4ESRA 4JJDA 2DL7A 2M51A 2DYBA 5ECAA 2K2MA 3PE0A 4HXJA 3QWXX 2EKHA 2A28A 2DVJA 4HVUA 2PNIA 3H41A 1ZBJA 1BB9A 2L3SA 1GCQC 1QWEA 2JT4A 4CC4B 3REBB 5GJVB 1FMKA 4OMPA 4RTVA 1W6XA 2KNBB 4A63B 2AZVA 4J9BA 1GFCA 2YSQA 1X69A 3H0HA 1KJWA 2M0YA 5IHKA 3M0QA 1JEGA 1YN8A 2BTTA 1UJYA 1I1JA 2JTEA 2W10A 1UFFA 1KSWA 5I22A 2E5KA 1QKXA 1RLPC 2CUDA 2CDTA 2OJ2A 2B86A 1QWFA 4RTXA 2JMAA 2KRMA 4OMLA 2EBPA 3RNJA 4GBQA 2J06A 3VRZA 2ROTA 1PNJA 1NM7A 3PVQA 2O9SA 3C0CA 2J6KA 1M3AA 4QT7A 1PHTA 1ZX6A 1XOVA 1PWTA 1Z9QA 2GTOA 2MCNA 1NLPC 3A98A 1G83A 1RLQC 4OMMA 1WX6A 4Z89A 1AZEA 2GGRA 4HVWA 2FEIA 1SRMA 2D1XA 2DE0X 3M0SA 1WLPB 2OAWA 2FPEA 3VS7A 4J9FA 5IHNA 4F17A 1PKTA 4LNPA 4FSSA 2EPDA 1G2BA 2AKKA 1B3QA 2J6FA 2EYYA 2GTJA 2LMJA 2RQRA 3PVLA 2CSQA 2VKNA 1JO8A 4JPBW 3TVTA 1YP5A 1M3CA 2DRKA 2DLPA 1KIKA 2D8HA 1QKWA 4LN2A 2O9VA 2DMOA 2CT4A 4HCKA 3VS3A 2YDLA 1X2KA 3M0UA 4J9CA 2KGTA 2ED0A 1AWWA 2O31A 1UG1A 2K9GA 4X1VA 1UGVA 1GL5A 4J9GA 1JXOA 4RTYA 3VS0A 5EC7A 1MUZA 1RI9A 2L3QA 1W70A 1BU1A 2RPNA 1NLOC 2PZ1A 3EG3A 1SSHA 1WYXA 2EGAA 4M4ZA 5GJWB 3SHWA 1PKSA 3UA7A 4F14A 2EGEA 2RN8A 2KROA 3EG1A 2KXDA 2KRNA 4AFSC 4Y92A 2CREA 1MV0B 2ECZA 1SRLA 5HCKA 2KEAA 2JM8A 1WFWA 1FYNA 1E7OA 2XMFA 1UECA 2LJ0A 1M27C 2MOXA 1KFZA 2F2VA 4HVVA 4IIOA 2RQVA 2LX7A 1A0NB 1BK2A 1GCPA 1AZGB 2A36A 2SEMA 2NWMA 1QLYA 2LJ1A 1EFNA 2DF6A 2CT3A 4GLMA 4CC2A 2HEQA 4CC7A 2LZ6B 1PRLC 1K0SA 5IH2A 3M0RA 1PRMC 2X3WD 3H0FA 2YUPA 4AFUC 4OMNA 1ZUYA 2LCSA 2BZXA 1JQQA 4K11A 1VA7A 1U3OA 2JS2A 4D8KA 2J05A 4OMOA 2FRWA 1JXMA 2HSPA
chains in the Genus database with same CATH superfamily
2CH4A 3NGPA 4PLLA 1RADB 1OX9A 1HJDA 2X4XA 4E7JA 1I4K1 4TVRA 1ARKA 4DQ2A 3HPWA 4HCZA 2JOYA 4J6YA 3AT1B 1SPKA 2R58A 1X2QA 1TUGB 4XAXB 4M78F 2D8JA 4DA4A 2NUTB 5GAOn 3RESA 1NZ9A 3UATA 1OZ3A 2YUOA 3OYYA 2YUNA 2D0QB 1OPKA 3RMSA 2GFUA 2M9UA 1HD3A 5CKEA 3I55Q 2HNIA 3REAB 3VKIA 3OY9A 3CMET 1AD5A 1WZOA 2RA2A 4ME7A 2VXEA 3PT9A 4EDUA 2AT1B 2FB7A 1Y0MA 1MGQA 1Y57A 1ZSGA 4JJBA 2O2OA 4QVDA 5A0GA 1YWOA 2Y4YA 3OB9A 1KQ2A 1AHJB 3WVDB 3NTKA 4M78C 5GMKl 1VYTA 3X24B 4M7DB 2ZPEB 2P4RA 2JTFA 1EX4A 5L23A 2R57A 5HK3A 1K1ZA 4HCBA 1FMWA 4KGZB 1WXUA 4J9DA 1MHNA 3QUIA 5CKDA 3I55A 4M78D 3OYAA 1OPLA 2KR3A 3A8HB 3VRYA 3CCUQ 1ZA1B 2ROLA 2QEXA 1M1KR 1KQSS 2OI3A 1OOTA 4C0FA 2V1QA 4DEXA 2DRMA 3UDCA 4BUGA 5GAN3 1YI2A 4O5VA 5KYUB 2RI2A 1AWOA 4L6V5 3P8HA 4F7UG 1VYVA 4M75D 3OYNA 4M75C 2ZPGB 1NE8A 1Q7YC 2MYSA 5GAMf 1YBYA 1GRIA 1VIFA 3JB9F 2QYZA 3FEOA 5GAN8 4RTWA 1C1AA 2EQMA 1PM3A 2I2LA 2QEXQ 1VQOQ 3CXCP 2RK2A 1UJ0A 3URGA 3L2QA 3EG2A 4AFQC 2OTJA 4LXCA 3TCJA 2DFUA 2RO0A 2XDPA 4KGVB 1VQ8T 3JB9I 1UE9A 3EH1A 1M3BA 1UGSB 3V8JA 2HBWA 1GBRA 5IHIA 1WHKA 3VYHB 4C92E 4KT0E 1WQWA 1OQKA 2RQWA 4ZNXA 1VQNQ 3AHUA 1UUEA 4OB1B 4KH1B 1JJ2P 2ZAEA 3QXEB 1KQ1A 4ZN1A 4C0GA 3VS2A 1QVGA 1IO6A 1YITA 2EYQA 2KT8A 3CC2Q 1LJOA 3META 5LJ3e 1C0MA 2F5KA 2DERA 1TG0A 1CKBA 3Q1JA 3INZA 2DL4A 3M54A 2JM9A 3M0TA 4OGEA 2ESWA 3SD4A 2HSEB 3FIFA 1K9MU 4QKUA 2JXBA 4Z88A 2E65A 4M7DD 1X75C 5CVIA 1TUDA 4XTWA 5GAN4 2QQRA 2JS0A 3QSUA 3L2ZA 1WHGA 4ZGJB 2COZA 4M7AE 1YJWT 2XKOC 4XU2A 4LUDA 2EYXA 2X4YA 1J3TA 5GMKi 5AYFA 3EG0A 4M75F 1Z9ZA 2V8JA 3CC4A 5C0MA 2H8HA 2F5TX 1ZSZC 1D1CA 2DIQA 4B9WA 1UGQB 2LQNA 2FZKB 2EW3A 3U23A 3OS1A 3EGUA 1E6HA 1RAAB 2E4HA 3LLRA 2F69A 2K2MA 2YWWA 3QWXX 2DVJA 4HVUA 3QYGB 3OYBA 3RIRA 1ZBJA 2L3SA 2FYKA 5GAMh 1MMNA 4J8OA 2JT4A 5GJVB 4A63B 3QYHB 1GFCA 1N8RC 4OMFB 1X69A 3H0HA 2M0YA 5IHKA 3G71T 2RB6A 4WTOB 4C92G 2BTTA 5GAMg 3CCEQ 1QVFS 5FRNA 3G71A 2HQXA 1I1JA 2FZCB 4J7IA 3H6ZA 1KSWA 1D1AA 2BE9B 4DBHA 4KGXB 1RLPC 2CUDA 3OSSC 2CDTA 1FX7A 3MHXA 1S72T 1WPYA 1SF9A 4RTXA 1BI3A 4BI3A 2JMAA 2KRMA 3UT1A 2M16A 4M77D 3QBYA 1NJIC 2LTOA 3CEYA 3CPWP 2IVWA 2J6KA 2KQWA 1BKBA 2FVUA 5GAOr 5I21A 5KYWA 2MCNA 4IURA 1YITQ 4M77G 4Z89A 5HY6A 2M0OA 1M1FA 1Y07A 1RI0A 3M0SA 2A7YA 4C0DC 1WLPB 2OAWA 3VS7A 3S3MA 4J9FA 3GPLA 4DBFA 1YIJA 5J26A 4OB2B 1RL2A 5IHNA 2RK1A 1Q81R 1VQ8A 3M56A 1YIJT 1IREB 4M78E 1B3QA 2EYYA 4HKEA 1G3SA 3JCMV 2VUBA 3HRSA 3PVLA 4XTUA 1TSFA 2QA4A 5KYYA 2D8HA 2LDMA 1QKWA 2KVQG 2CT4A 2YDLA 1IGUA 3CD6Q 1UG1A 3P8DA 4OP0A 3UWNA 1QVFA 4X1VA 2YRDA 5FU7C 1JXOA 1ZQ1A 3VS0A 4JLGA 4RG2A 1VQ7T 1BU1A 1NLOC 2OTLQ 4M7DC 2EGAA 4M4ZA 4F14A 5HK0A 2RN8A 4RCCA 3V7RA 1WJRA 2GF7A 4Y92A 1MV0B 3A8OB 1QCOA 1SRLA 3JB9G 2XG8D 3M59A 5GAMj 3CCJT 2H3EB 4XU3A 4LDVA 3QIIA 1FYNA 5KCOA 5HKCA 1KFZA 2ATCB 2BKDN 2MOXA 1Q82U 4ANJA 2XDDA 3FB9A 4IIOA 5L8RE 2LX7A 2CP2A 2DTOA 2X4JA 1Q82R 2SEMA 2NWMA 3KBGA 4M7AF 1UGPB 3X26B 4CC2A 4CC7A 2LZ6B 2X9HA 1PRLC 1RAGB 4DBQA 3QJ6A 3M0RA 4IUUA 1PRMC 3BW1A 3H0FA 2PVGB 3HSBA 2LCSA 4FU6A 3JCMd 2Y4XA 3PGGA 2DAQA 1JQQA 2OX7A 3CCSA 1VA7A 3CC2A 2XDBA 1U3OA 4FW2A 2KI7A 2FRWA 4KUIA 1DJ7B 2HSPA 2AZSA 3CC2T 2P0PA 2O01E 4C92C 2V8KA 4KH0B 4V2SA 1BI2A 5FWBA 3CCJQ 4ZGDB 3NFCA 1KHCA 1PCXA 3NMZC 2MMPA 4Q5WA 2EJFA 4LD9K 1PG5B 3X28B 3ER0A 4MZTA 2L3PA 2HKQB 4FYWB 2FPDA 4DEYA 2QAZA 3CPWA 4E7LA 2EGCA 4JZ4A 5KYXB 2ZPFB 3DLLA 3TSWA 2RF0A 2DBKA 2YLCA 3NHNA 2CYZB 2PQWA 2BUDA 1UTIA 2ED1A 4FW1A 4M77B 2X35A 1M1KU 1RUWA 2CUBA 4RTTA 5DY9A 4FYYB 3VYGA 2C0OA 2RHIA 3FC3A 1U5SA 1OX8A 2RHUA 1EZZB 3BFMA 2MAMA 3VUZA 1D09B 2RJEA 4X9DA 1PC0A 1UEBA 2LT1A 4JRQA 1XNIA 4O6JA 1TU0B 2LCCA 4HT9A 1HSQA 2XD0A 5IXFA 3DB3A 2DNUA 2JJ9A 1S1NA 4XQ3A 1YITT 2RJCA 4MDWA 3KFVA 1SHFA 1X01A 1IZ6A 3LWIA 2JNGA 4PFZA 3C95A 1K4US 3C94A 1VQPQ 3H8ZA 4F7UB 3RBBB 5KYNA 3C4SA 2QG9B 1IXDA 1LNXA 1YJWA 3PMIA 4UC4A 2PTKA 1OI1A 4C92B 1W2BP 1NEGA 1XJWB 4FCYA 4PJOB 5LJ5d 4KRTA 2RH2A 1RAEB 2MPXC 3CCJA 2NLUA 2D6FA 3QZ9B 3OA6A 3G71Q 1VQ9A 2XI9A 4N0AC 2CP0A 2CSIA 3CCRQ 3QZ5B 1MV3A 2QGFB 3E19A 1WHMA 4M75B 4FIBA 4QVCA 4F16A 1WDXA 1JRIA 1E6GA 3IQLA 3TEEA 3GOXA 3UPUA 3QDFA 1ZSZA 5EG2A 3EGXA 4QQ6A 4M75G 2LQ8A 4M7AB 1U06A 2GNCA 3I35A 2DZCA 2LQWA 5KE2A 3A8LB 3CCRT 5GAOm 1UHFA 1YJ9T 2K57A 4GY5A 5LJ5f 2D9TA 3CXCS 2KRSA 4PJOD 1NYFA 7AT1B 3JCMJ 3CC7T 4A53A 4RTZA 2KYBA 4RUGA 2MIOA 2WSFE 4HA8A 4B6MA 1VQ9Q 2B8AA 2XHCA 2VVKA 1PD1A 2K3BA 1OU9A 3VS1A 4NOYA 2HBPA 2DJZA 3ULRB 1RABB 1H92A 3L1AA 1VQ6T 2J6OA 1R0CB 2DL8A 2D0NA 1VYUA 4N4HA 4HCCA 2CKKA 3X20B 2OTJQ 2K5IA 2QQAA 2I0NA 1VQPT 2YT6A 4C92D 3I9QA 2PVOB 4J9IA 3SWNC 4BI8B 4E7IA 2K79A 1WA7A 3NPFA 4LE9A 5FROA 2DM1A 4BB7A 1ZUKA 2ENMA 5GAMd 4BDYA 1SKUB 2EVRA 2GQVA 2AKLA 2C0IA 4PJOC 1NG2A 3J80E 1VQKA 1JU5C 5GAN6 2O4XB 1WQ7A 4JZ3A 1KC8R 2L8DA 4E6RA 3LH5A 1WXTA 4XTXA 3CPWS 3VS4A 4CRIA 2G6FX 4ESRA 1Q81U 4M78A 2HQHA 4JJDA 2K3YA 2HKNA 5A2QE 1FXXA 1D3BB 5LJ5e 2A28A 4RKUE 1KQSA 1TH7A 1GCQC 1N9SA 4A4GA 4PK4A 4IUTA 4OMPA 3CXCA 3CMAQ 2KNBB 1QCNA 4J9BA 5GMKe 2YSQA 2K3XA 1KJWA 1JEGA 3M0QA 1K8AC 2CZ6B 2QASA 1YN8A 2M1HA 1M90C 1UFFA 4ELZC 1N6AA 5I22A 1JJ2A 1QKXA 4A4KA 5CO7A 2B86A 1QWFA 3E1SA 3CC4Q 4M7DG 4FT2A 3CCUT 4GBQA 3OYKA 2J06A 1PNJA 1NM7A 4FL6A 1G3WA 4BE1A 1PHTA 4RCBA 1ZX6A 3ZBDA 2RHZA 1XOVA 1Z9QA 4RMOA 2LC4A 2KDSA 3L42A 4IKFA 4OMMA 2GGRA 4HVWA 5GAOq 1K73U 5FU6B 1B7TA 2D1XA 3V8KA 3G4SA 2V26A 2QQ9A 3JCMh 3TU4K 2ZPIB 1R8OB 1G2BA 2NUPA 2DTIA 2LMJA 2MF2A 2RQRA 1YFNA 1F1BB 2COWA 3I56Q 2VKNA 4BDZA 4JPBW 2QA4Q 4M77A 2HL3A 4OB3B 1QVPA 1M3CA 2DRKA 2O9VA 2DMOA 4AT1B 1HXDA 4A4FA 4M77C 4BACA 4A4EA 1AWWA 5LL6S 3S6WA 2VB6A 2COYA 2LT4A 2K9GA 4J7FA 3CPFA 5LJ3h 4RTYA 5EC7A 2DZ9A 3GNGA 4C8QB 1W70A 1H641 4XK8E 1SSHA 1P92A 2QI2A 2EGEA 5IN1A 1JJ2S 3EG1A 2RM4A 4X9CA 4EMGA 5GANh 3S3NA 1KQSP 2CREA 5CCAA 2CZ0B 1YJNA 2NUTA 5DLQE 5GANd 2VASA 3SB2A 4F04B 2DO3A 2MWOA 1UECA 1M27C 5FRMA 3JSCA 2P84A 4JRIA 1VUBA 2VYTA 4MDXA 1BK2A 1MNDA 1Q95G 1AZGB 1QVGS 2CZ7B 3WVEB 2LJ1A 3KUFA 1YI2Q 2CT3A 1VQ4Q 4XU1A 5M9OA 4C8QD 1K0SA 3M5AA 4NS5A 2X3WD 3CCLT 4AFUC 1ZUYA 2BZXA 2VC8A 5CQYA 3CCLA 2DD5A 1K8AU 1MMGA 4M7DA 2JS2A 4D8KA 2J05A 4R56A 1VQ5A 2EAYA 3SWNB 3DKMA 1JXMA 2RQTA 1K73R 1ZSZB 1Y7XA 3EG9B 3OYLA 3OYGA 3EHQA 3EGXB 4XTZA 3L2RA 2FHDA 1WHJA 3QPHA 4JUVA 3HTRA 2F2XA 2NUZA 1T3SA 1VQ9T 1OU8A 1CSKA 3FJPA 2QTVA 2E12A 2KAFA 4C5GA 4M78G 2G3RA 2A37A 1H8KA 4C0DB 3EFRA 2GQIA 4GLKA 1JB0E 1YJ9Q 2DVEA 4A54A 3HKSA 2KT1A 3OYMA 4C8QC 1K0XA 2K2VA 2KBTA 1AT1B 2ABLA 2HDAA 5IT9E 2RNAA 2LNHB 1WJQA 4RG8A 1GFDA 1TUCA 1B34A 2CP5A 1ZA2B 2E6NA 3JCMP 1M2OA 4EIKA 4PJOE 2FRYA 4BY6B 1K73C 4PNOA 3CC7A 1X27A 3FDRA 1G5VA 3TQ7P 5FU7B 4OMQA 3A1PA 4IUQA 1T3LA 3I56A 1YCSB 2CP3A 1VQMT 3CCMQ 1YHQA 3RKYA 2DL5A 1I5LA 4EMKA 1NPRA 1M1GA 3OBYA 1N5ZA 2ZGWA 3LW5E 4MZMA 1UHCA 3LX7A 2QDLA 1KD1C 5I11A 1VQ6A 2OTLA 3H9NA 5AT1B 2X3XD 3MPUB 1AVZC 1JBMA 2X4WA 1VQPA 1U8RA 3S3OA 3OS0A 3MEAA 2A08A 3LYIA 3EFOB 5GAN5 4M78B 1X6BA 5CQXA 4PJNA 1AEYA 3OYFA 4LDYA 3OMCA 1WGSA 2FG0A 4F7UE 1UGRB 4M7AD 3ZL7C 3HFNA 4II1A 1K9AA 1YJNT 3DB4A 1VQLQ 1VQ5Q 1T0JA 2VGNA 3M53A 4AFZC 1MNEA 4WCIA 1YNZA 2P0QA 2YLBA 2IG0A 2EQIA 1I81A 3HRTA 3QHSA 4QW2A 4XTYA 3PIPA 1AOJA 1W1FA 2CP6A 2LRQA 1QVGP 1WNLA 1KK7A 3CQTA 5LJ5h 2DILA 1VQ8Q 1ZBXA 1VIEA 3PNWC 3TSZA 2EYWA 2DA9A 4IIMA 5LJ3d 4D8DA 1TS9A 3VS6A 2BE7D 4PFOA 1VQOT 1AWJA 4NL3A 3JRZA 4OB0B 5FWCA 4Z02A 2AK5A 5LJ3j 4EMHA 2YHTA 1RAIB 6AT1B 3MO8A 3QWYA 1HK9A 5CKHA 1UDLA 3R6NA 3L2UA 1O75A 1I5OB 1VQ5T 2E3IA 1M8MA 1X43A 2WSCE 4BE2A 1XTDA 1QCFA 3ZFJA 5A0LA 2VWFA 2EKOA 1QW1A 4OVAA 3F70A 1VQLT 1GCQA 3N5BB 3CCUA 2L2PA 1M9SA 5GAOp 4E7KA 4E7SA 1BIAA 1NPPA 2J7IA 2KYMA 2K5LA 4C5HA 5CR2A 3EHRA 4C8QF 5CK9A 3VUBA 4M75E 1GXIE 2VGMA 5KE3A 1T0HA 1LOJA 2OTJT 1M90U 2KE9A 4R0KA 5GMKj 2VV5A 3VS5A 2YXYA 5LJ3g 1NYGA 1HYOA 3O5ZA 1M90R 2QK0A 1U1TA 1N27A 2DL3A 2E64A 4CC3A 3D7SB 4C5IA 2V1RA 3CCRA 1Y96B 4JRPA 1K8AR 1N8RU 1OZ2A 1YJ9A 3PFSA 4KUDK 1YCYA 2EIFA 4C8QA 3PMTA 1QP2A 1W2BA 3RKWA 1M30A 3JB9J 4DOWA 1M8VA 1NJIR 1V76A 2R5MA 3CCMT 2KSSA 2EJGA 3CCMA 1YHQQ 2DJQA 3MCAB 3OS2A 2DL7A 2M51A 3P8BB 3CMEQ 3BY7A 4KBMB 3JCMX 3EFSA 1BI1A 2E6ZA 2OTLT 4PL6A 1BIBA 4QQDA 3RUXA 4JJNK 1KC8C 3J81E 1PSEA 1FMKA 1N8RR 2X51A 3E2UA 1W6XA 2YRCA 2AZVA 4OF1A 5KYYB 1G3TA 2QDYB 3WXMB 3CD6T 3OW2A 4BI4A 2QTXA 1UJYA 3MEWA 2E3HA 3M4GA 2EQJA 2W10A 2P4TA 2DXUA 2E5KA 1I8FA 3G7ZA 2JN0A 1IRXA 4N0AA 1YIJQ 2JTMA 5GAMe 4OMLA 2EBPA 3JCMf 3ZEHA 2A0FB 3RNJA 3CCQT 3CMAA 5GMKh 4C8QE 2ZPBB 3HHTB 3M9QA 2ROTA 3PVQA 4VUBA 3LGFA 3C0CA 3RKXA 4QT7A 5I2MA 5A0DA 2AHJB 5CKBA 1PWTA 3CCVQ 5CKFA 3BE3A 5DLOA 4M77F 3QDRB 3CCVT 3A98A 1G83A 1RLQC 5FU6C 2DXBA 1WX6A 1AZEA 2Y90A 3E9GA 2RD1A 4QVZA 2FEIA 2DE0X 1YI2T 1NBEB 1OULA 2DEQA 3DLMA 2FZGB 2MI6A 2DXTA 2EPDA 3MEVA 1S72Q 2IPOB 3MP6A 1VQLA 4FM4B 5I2SA 1Q86R 4BD3A 2EQUA 3QG1A 1WHHA 2XICA 1YP5A 2DLPA 3HFOA 4LN2A 2EFIA 3VS3A 1X2KA 3M0UA 2KGTA 2ED0A 3MP8A 1LVKA 3MJXA 1X6OA 3JCMc 4JS5A 2LNVA 4LDWA 8ATCB 4LDUA 2ZZDA 1GL5A 3OQ5A 4N4GA 4EMKB 1K9MC 1MUZA 1RI9A 1FMVA 2E10A 2PZ1A 4A4HA 3T9NA 4DOVA 1D1BA 3CBMA 1D0YA 1WYXA 3UA7A 2KROA 3LWHA 3RERA 2EWNA 2ECZA 4PJLA 5D6XA 3FLGA 3JB9H 5HCKA 5KYWB 1YHQT 4Y28E 4ELYC 2DEUA 3EFOA 2QA4T 1E7OA 2K5FA 3GNFB 2LJ0A 5KYXA 2F2VA 1QQJA 4HVVA 3JCMQ 1A0NB 1MMDA 4M7AG 1M2VB 5GMKm 3JB9D 3ME9A 1VOMA 3LH0A 3OYCA 2MWPA 1IB8A 2L5QA 3NTIA 1EFNA 4J6XA 4D6WA 2HEQA 4KULA 1ACMB 4XTVA 2DTHA 9ATCB 1UB4A 5IH2A 1LPLA 5KH6A 3A8GB 3M58A 4OMNA 3OBWA 3GP8A 4HT8A 1M1KC 1R0BG 2HMAA 3M57A 2DETA 4OMOA 2CP7A 4ATOA 4C8QG 3SEMA 1ABOA 4AMCA 1QMCA 3CC4T 4M7DE 4JJCA 3RDVA 1TOVA 2SRCA 4PJOF 2QQBA 2C0TA 2DKGA 1G3YA 1IGQA 1KD1R 3GIBA 2YUQA 4MMKA 4F7UA 3O8VA 1NEBA 2XU8A 4C0ZA 3CMAT 1KD1U 1QP3A 1B07A 3SFMA 1ABQA 1I07A 4MMLA 2HCKA 3M4YA 1VQKQ 1R77A 3CCQA 4PLIA 3A8MB 3BDUA 1VQOA 4J9EA 4QQGA 3OYJA 2RMOA 3ASKA 4RTUA 3OMGA 5LJ3f 4PJOA 1D0ZA 5FLXE 1EIFA 1RAFB 2QEXT 1W4SA 4AG2C 3CCST 3L2WA 4FT4A 1WHLA 2L0AA 3J7AF 1PSFA 3PIOA 1FWZA 2K4YA 4MZPA 5IAYA 2RHYA 1M4ZA 4PFPA 1S72A 2LP5A 2ZCFB 5CAIA 1I0CA 1LCKA 2P0KA 1YJNQ 2F2WA 1AWXA 4LD6A 1Y96A 4EMKC 4AG1C 5CIUA 1ZUUA 2LVMA 3E9FA 3HRUA 5IXBA 1M5Q1 4Z8AA 2KMTA 2KY9A 1Q82C 4ORZA 4P5NA 1VQ4A 4JRKA 4WF2A 2EYZA 2WACA 2CH4W 3G6ET 2LJ3A 3FJ5A 3JV3A 3VJPA 2RI5A 4J83A 3CCQQ 1BCOA 1VQ6Q 3QJYA 2FPFA 5GANg 2PUOB 4PJMA 5KCHA 2K6DA 4PKCC 4ZTFA 3OW2P 4JDSA 2H3JA 1WI7A 2JW4A 3UF4A 3G4ST 3JCMb 1BI0A 3CCET 1K76A 4L59A 1VQMA 1VQMQ 3JCMe 1G8XA 3CCEA 1K9MR 3EGDA 4LUEA 3QKJA 3CC7Q 1SHGA 2F1LA 1XQHA 1YWPA 4C5EA 4IUVA 3V8LA 1W2BS 3GBQA 1H3HA 3HL8A 2JMCA 1VQ7A 2CZ1B 4LDXA 1KHIA 1GBQA 1ZLMA 1WJSA 3GLXA 1O9SA 2O4XA 1Q86C 3OS5A 3THKA 1OV3A 3HP9A 3CMEA 4ZN3A 2JUFA 3EAEA 2L3RA 4ZGEB 4CI0C 8AT1B 3CBOA 4ZTJA 1C6VX 1Q81C 2A3LA 1WXBA 1WIEA 2RHXA 1U1SA 3I5RA 3H0IA 2FO0A 3QO3A 2CGHA 2JZ2A 3V7SA 4FYXB 1TTHB 5D6WA 3G4SQ 4J9HA 3UA6A 1D3BA 2XK0A 1YJWQ 1V1CA 2V8IA 1BCMA 1X6GA 2GBQA 2WSEE 2DX1A 2C06A 4C92A 2DBMA 2HQEA 3R6OA 4JLIA 5GAN2 2EJ9A 1KC8U 5C6SA 4OGCA 1OEBA 2E70A 2W0ZA 2BZYA 4J5YA 2IIMA 2JVVA 2K7AA 3NTHA 1CKAA 1PD0A 3VV0A 2QQSA 3G6EQ 3I5SA 4M75A 1BBZA 2HD0A 5GANj 4PJJA 2RQUA 4B9XA 3TREA 2DD4A 2KXCA 2PU9B 1VQNT 2OAUA 1SEMA 2LQKA 5J39A 4M7AA 1KG1A 2O88A 3OYIA 1NJIU 2MK5A 2LCLA 3M55A 4YTLA 1IHWA 2BZ8A 2CS7A 5FW9A 3KXTA 3M0PA 3C12A 1IHVA 1TWBA 2M02A 2DYBA 3PTAA 5ECAA 1H3ZA 3PE0A 3OYEA 4N4IA 4PJOG 4HXJA 2EKHA 1Q86U 2Z0WA 2PNIA 3H41A 5GANe 3CCSQ 1BB9A 5J3BA 5DM7R 5KYUA 2NUPB 1QWEA 4CC4B 3REBB 2EQKA 3MKDA 1QVFP 1M2VA 4RTVA 2YRVA 5D6YA 2HZYA 1VQKT 3CBPA 3JCMg 2R5AA 2JTEA 2GFAA 3I56T 4FYVB 1V29B 2OJ2A 4E7HA 1TXQA 3JCMW 4M7DF 2LX9A 5LJ5j 3FRNA 5GAN7 4DBRA 4J6WA 4X34A 3VRZA 2DXCA 2BIVA 2O9SA 3OYHA 3L2VA 1M3AA 4EPCA 4E2FB 2GTOA 1NLPC 4Y91A 4NL2A 3EH2A 2QGGA 1RACB 1SRMA 5D7UA 2FPEA 4F17A 1PKTA 4LNPA 4FSSA 2AKKA 2AIRB 3CD6A 3MP1A 4BY6C 2PVDB 1SSFA 2J6FA 2GTJA 3G1JA 2HAXA 4L5GA 2CSQA 1JO8A 3TVTA 2DK3A 2RJDA 5GANf 1KIKA 4E7ZA 1Q7YU 4JS4A 4HCKA 3V7CA 4J9CA 2O31A 4C92F 1Q7YR 1VQ7Q 4XU0A 3X25B 3SWNA 1UGVA 4J9GA 3I55T 2FL7A 2E41A 3RR6A 2QXFA 3EG9A 3OSVA 4FSXA 4R55A 3JAME 2L3QA 2RPNA 4F7UF 1N9RA 3EG3A 3SHWA 5GJWB 1PKSA 3CCVA 1Y71A 2KXDA 2KRNA 4AFSC 2E5QA 3A5ZB 2RI3A 1OYXA 4M7AC 3BDLA 2KEAA 2VXFA 2JM8A 1WFWA 1VQNA 2KK4A 3RMQA 3MEUA 2XMFA 1SG5A 2L89A 2DPPB 1D0XA 2E1HA 3VU3C 2PUKB 2RQVA 5LJ5g 1B34B 1GCPA 2DYIA 2ZPHB 2A36A 3LGLA 1QLYA 4IUPA 3CCLQ 2DF6A 2GCXA 3G6EA 1ZHIA 1BYMA 1RAHB 4GLMA 4M77E 1VQ4T 3EGDB 3SDZA 2YUPA 2XIDA 3OW2S 5GAOl 4E47A 4BE0A 4K11A 2NYSA 2HL5C 3OYDA 2DIGA 2RJFA 3GF5A 1MMAA
chains in the Genus database with same CATH topology
3SEMA 1ABOA 2RQTA 2CH4A 3NGPA 3EHQA 4JJCA 1HJDA 2SRCA 5FWBA 2C0TA 2F2XA 2NUZA 1ARKA 1T3SA 1CSKA 3NMZC 1SPKA 2YUQA 1X2QA 1NEBA 2A37A 1H8KA 1B07A 2D8JA 2GQIA 1ABQA 1I07A 2HCKA 2L3PA 3UATA 2YUOA 2YUNA 2FPDA 4DEYA 1OPKA 2KT1A 1K0XA 4J9EA 1HD3A 2EGCA 4JZ4A 2RMOA 2KBTA 4RTUA 2ABLA 2HDAA 3REAB 2RNAA 2LNHB 4AG2C 3TSWA 1AD5A 2DBKA 2RF0A 3NHNA 1GFDA 1TUCA 1UTIA 2ED1A 2L0AA 4EIKA 2FRYA 1Y0MA 1Y57A 1RUWA 1ZSGA 2CUBA 4RTTA 1X27A 4JJBA 2O2OA 4OMQA 2C0OA 1YWOA 1T3LA 1U5SA 1YCSB 2LP5A 2DL5A 1I0CA 1LCKA 1VYTA 2F2WA 1AWXA 1N5ZA 2P4RA 1HSQA 1UHCA 5IXFA 4AG1C 5L23A 2QDLA 1ZUUA 5I11A 2DNUA 5IXBA 1K1ZA 1S1NA 3KFVA 1SHFA 4Z8AA 4ORZA 2EYZA 2CH4W 2X3XD 1K4US 1AVZC 2LJ3A 3FJ5A 3JV3A 1WXUA 4J9DA 2A08A 3RBBB 1OPLA 2KR3A 3VRYA 2ROLA 1X6BA 2FPFA 1AEYA 2OI3A 1OOTA 2V1QA 2PTKA 2K6DA 4DEXA 2DRMA 2FG0A 1NEGA 1WI7A 2JW4A 3UF4A 3ZL7C 1K9AA 4KRTA 1AWOA 1T0JA 1K76A 4AFZC 4WCIA 1YNZA 2EQIA 1VYVA 4LUEA 1SHGA 2CSIA 1AOJA 1MV3A 1W1FA 1YWPA 3CQTA 2DILA 3GBQA 4F16A 1WDXA 1GRIA 1H3HA 1E6GA 3TSZA 2JMCA 3IQLA 2EYWA 2DA9A 4IIMA 4D8DA 3VS6A 4RTWA 1GBQA 1ZLMA 1AWJA 1U06A 2GNCA 3I35A 1UJ0A 2LQWA 5FWCA 2AK5A 3THKA 1OV3A 3EG2A 4AFQC 1UHFA 3QWYA 1UDLA 1UE9A 1M3BA 2KRSA 3R6NA 1WXBA 1NYFA 1WIEA 2HBWA 1M8MA 1GBRA 1X43A 5IHIA 3I5RA 4RTZA 2KYBA 3H0IA 1QCFA 2FO0A 4RUGA 2VWFA 2MIOA 2RQWA 4J9HA 4ZNXA 3UA6A 2VVKA 2K3BA 1UUEA 1GCQA 1V1CA 1X6GA 2GBQA 3VS1A 2DX1A 2L2PA 3ULRB 1H92A 3VS2A 2J7IA 1IO6A 2KT8A 2J6OA 2KYMA 2DBMA 2DL8A 2D0NA 1VYUA 3EHRA 1OEBA 2I0NA 2W0ZA 2BZYA 2YT6A 1TG0A 1CKBA 2IIMA 3I9QA 2DL4A 4J9IA 2K7AA 2JM9A 3M0TA 1CKAA 2ESWA 2K79A 1WA7A 1T0HA 3NPFA 4LE9A 4Z88A 2JXBA 2DM1A 2KE9A 4R0KA 1ZUKA 2ENMA 3I5SA 1TUDA 3VS5A 2EVRA 1NYGA 2JS0A 1BBZA 3O5ZA 2DL3A 2AKLA 4CC3A 2C0IA 2RQUA 2V1RA 1NG2A 2KXCA 4LUDA 2EYXA 1J3TA 1JU5C 3EG0A 1M30A 1SEMA 1Z9ZA 4JZ3A 2O88A 2AZSA 4E6RA 2H8HA 3LH5A 2BZ8A 1WXTA 5FW9A 3VS4A 3M0PA 2DJQA 2LQNA 2EW3A 3U23A 2G6FX 3EGUA 1E6HA 4ESRA 4JJDA 2DL7A 2M51A 2DYBA 5ECAA 2K2MA 3PE0A 4HXJA 3QWXX 2EKHA 2A28A 2DVJA 4HVUA 2PNIA 3H41A 1ZBJA 1BB9A 2L3SA 1GCQC 1QWEA 2JT4A 4CC4B 3REBB 5GJVB 1FMKA 4OMPA 4RTVA 1W6XA 2KNBB 4A63B 2AZVA 4J9BA 1GFCA 2YSQA 1X69A 3H0HA 1KJWA 2M0YA 5IHKA 3M0QA 1JEGA 1YN8A 2BTTA 1UJYA 1I1JA 2JTEA 2W10A 1UFFA 1KSWA 5I22A 2E5KA 1QKXA 1RLPC 2CUDA 2CDTA 2OJ2A 2B86A 1QWFA 4RTXA 2JMAA 2KRMA 4OMLA 2EBPA 3RNJA 4GBQA 2J06A 3VRZA 2ROTA 1PNJA 1NM7A 3PVQA 2O9SA 3C0CA 2J6KA 1M3AA 4QT7A 1PHTA 1ZX6A 1XOVA 1PWTA 1Z9QA 2GTOA 2MCNA 1NLPC 3A98A 1G83A 1RLQC 4OMMA 1WX6A 4Z89A 1AZEA 2GGRA 4HVWA 2FEIA 1SRMA 2D1XA 2DE0X 3M0SA 1WLPB 2OAWA 2FPEA 3VS7A 4J9FA 5IHNA 4F17A 1PKTA 4LNPA 4FSSA 2EPDA 1G2BA 2AKKA 1B3QA 2J6FA 2EYYA 2GTJA 2LMJA 2RQRA 3PVLA 2CSQA 2VKNA 1JO8A 4JPBW 3TVTA 1YP5A 1M3CA 2DRKA 2DLPA 1KIKA 2D8HA 1QKWA 4LN2A 2O9VA 2DMOA 2CT4A 4HCKA 3VS3A 2YDLA 1X2KA 3M0UA 4J9CA 2KGTA 2ED0A 1AWWA 2O31A 1UG1A 2K9GA 4X1VA 1UGVA 1GL5A 4J9GA 1JXOA 4RTYA 3VS0A 5EC7A 1MUZA 1RI9A 2L3QA 1W70A 1BU1A 2RPNA 1NLOC 2PZ1A 3EG3A 1SSHA 1WYXA 2EGAA 4M4ZA 5GJWB 3SHWA 1PKSA 3UA7A 4F14A 2EGEA 2RN8A 2KROA 3EG1A 2KXDA 2KRNA 4AFSC 4Y92A 2CREA 1MV0B 2ECZA 1SRLA 5HCKA 2KEAA 2JM8A 1WFWA 1FYNA 1E7OA 2XMFA 1UECA 2LJ0A 1M27C 2MOXA 1KFZA 2F2VA 4HVVA 4IIOA 2RQVA 2LX7A 1A0NB 1BK2A 1GCPA 1AZGB 2A36A 2SEMA 2NWMA 1QLYA 2LJ1A 1EFNA 2DF6A 2CT3A 4GLMA 4CC2A 2HEQA 4CC7A 2LZ6B 1PRLC 1K0SA 5IH2A 3M0RA 1PRMC 2X3WD 3H0FA 2YUPA 4AFUC 4OMNA 1ZUYA 2LCSA 2BZXA 1JQQA 4K11A 1VA7A 1U3OA 2JS2A 4D8KA 2J05A 4OMOA 2FRWA 1JXMA 2HSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEM A;  1ABO A;  2RQT A;  2CH4 A;  3NGP A;  3EHQ A;  4JJC A;  1HJD A;  2SRC A;  5FWB A;  2C0T A;  2F2X A;  2NUZ A;  1ARK A;  1T3S A;  1CSK A;  3NMZ C;  1SPK A;  2YUQ A;  1X2Q A;  1NEB A;  2A37 A;  1H8K A;  1B07 A;  2D8J A;  2GQI A;  1ABQ A;  1I07 A;  2HCK A;  2L3P A;  3UAT A;  2YUO A;  2YUN A;  2FPD A;  4DEY A;  1OPK A;  2KT1 A;  1K0X A;  4J9E A;  1HD3 A;  2EGC A;  4JZ4 A;  2RMO A;  2KBT A;  4RTU A;  2ABL A;  2HDA A;  3REA B;  2RNA A;  2LNH B;  4AG2 C;  3TSW A;  1AD5 A;  2DBK A;  2RF0 A;  3NHN A;  1GFD A;  1TUC A;  1UTI A;  2ED1 A;  2L0A A;  4EIK A;  2FRY A;  1Y0M A;  1Y57 A;  1RUW A;  1ZSG A;  2CUB A;  4RTT A;  1X27 A;  4JJB A;  2O2O A;  4OMQ A;  2C0O A;  1YWO A;  1T3L A;  1U5S A;  1YCS B;  2LP5 A;  2DL5 A;  1I0C A;  1LCK A;  1VYT A;  2F2W A;  1AWX A;  1N5Z A;  2P4R A;  1HSQ A;  1UHC A;  5IXF A;  4AG1 C;  5L23 A;  2QDL A;  1ZUU A;  5I11 A;  2DNU A;  5IXB A;  1K1Z A;  1S1N A;  3KFV A;  1SHF A;  4Z8A A;  4ORZ A;  2EYZ A;  2CH4 W;  2X3X D;  1K4U S;  1AVZ C;  2LJ3 A;  3FJ5 A;  3JV3 A;  1WXU A;  4J9D A;  2A08 A;  3RBB B;  1OPL A;  2KR3 A;  3VRY A;  2ROL A;  1X6B A;  2FPF A;  1AEY A;  2OI3 A;  1OOT A;  2V1Q A;  2PTK A;  2K6D A;  4DEX A;  2DRM A;  2FG0 A;  1NEG A;  1WI7 A;  2JW4 A;  3UF4 A;  3ZL7 C;  1K9A A;  4KRT A;  1AWO A;  1T0J A;  1K76 A;  4AFZ C;  4WCI A;  1YNZ A;  2EQI A;  1VYV A;  4LUE A;  1SHG A;  2CSI A;  1AOJ A;  1MV3 A;  1W1F A;  1YWP A;  3CQT A;  2DIL A;  3GBQ A;  4F16 A;  1WDX A;  1GRI A;  1H3H A;  1E6G A;  3TSZ A;  2JMC A;  3IQL A;  2EYW A;  2DA9 A;  4IIM A;  4D8D A;  3VS6 A;  4RTW A;  1GBQ A;  1ZLM A;  1AWJ A;  1U06 A;  2GNC A;  3I35 A;  1UJ0 A;  2LQW A;  5FWC A;  2AK5 A;  3THK A;  1OV3 A;  3EG2 A;  4AFQ C;  1UHF A;  3QWY A;  1UDL A;  1UE9 A;  1M3B A;  2KRS A;  3R6N A;  1WXB A;  1NYF A;  1WIE A;  2HBW A;  1M8M A;  1GBR A;  1X43 A;  5IHI A;  3I5R A;  4RTZ A;  2KYB A;  3H0I A;  1QCF A;  2FO0 A;  4RUG A;  2VWF A;  2MIO A;  2RQW A;  4J9H A;  4ZNX A;  3UA6 A;  2VVK A;  2K3B A;  1UUE A;  1GCQ A;  1V1C A;  1X6G A;  2GBQ A;  3VS1 A;  2DX1 A;  2L2P A;  3ULR B;  1H92 A;  3VS2 A;  2J7I A;  1IO6 A;  2KT8 A;  2J6O A;  2KYM A;  2DBM A;  2DL8 A;  2D0N A;  1VYU A;  3EHR A;  1OEB A;  2I0N A;  2W0Z A;  2BZY A;  2YT6 A;  1TG0 A;  1CKB A;  2IIM A;  3I9Q A;  2DL4 A;  4J9I A;  2K7A A;  2JM9 A;  3M0T A;  1CKA A;  2ESW A;  2K79 A;  1WA7 A;  1T0H A;  3NPF A;  4LE9 A;  4Z88 A;  2JXB A;  2DM1 A;  2KE9 A;  4R0K A;  1ZUK A;  2ENM A;  3I5S A;  1TUD A;  3VS5 A;  2EVR A;  1NYG A;  2JS0 A;  1BBZ A;  3O5Z A;  2DL3 A;  2AKL A;  4CC3 A;  2C0I A;  2RQU A;  2V1R A;  1NG2 A;  2KXC A;  4LUD A;  2EYX A;  1J3T A;  1JU5 C;  3EG0 A;  1M30 A;  1SEM A;  1Z9Z A;  4JZ3 A;  2O88 A;  2AZS A;  4E6R A;  2H8H A;  3LH5 A;  2BZ8 A;  1WXT A;  5FW9 A;  3VS4 A;  3M0P A;  2DJQ A;  2LQN A;  2EW3 A;  3U23 A;  2G6F X;  3EGU A;  1E6H A;  4ESR A;  4JJD A;  2DL7 A;  2M51 A;  2DYB A;  5ECA A;  2K2M A;  3PE0 A;  4HXJ A;  3QWX X;  2EKH A;  2A28 A;  2DVJ A;  4HVU A;  2PNI A;  3H41 A;  1ZBJ A;  1BB9 A;  2L3S A;  1GCQ C;  1QWE A;  2JT4 A;  4CC4 B;  3REB B;  5GJV B;  1FMK A;  4OMP A;  4RTV A;  1W6X A;  2KNB B;  4A63 B;  2AZV A;  4J9B A;  1GFC A;  2YSQ A;  1X69 A;  3H0H A;  1KJW A;  2M0Y A;  5IHK A;  3M0Q A;  1JEG A;  1YN8 A;  2BTT A;  1UJY A;  1I1J A;  2JTE A;  2W10 A;  1UFF A;  1KSW A;  5I22 A;  2E5K A;  1QKX A;  1RLP C;  2CUD A;  2CDT A;  2OJ2 A;  2B86 A;  1QWF A;  4RTX A;  2JMA A;  2KRM A;  4OML A;  2EBP A;  3RNJ A;  4GBQ A;  2J06 A;  3VRZ A;  2ROT A;  1PNJ A;  1NM7 A;  3PVQ A;  2O9S A;  3C0C A;  2J6K A;  1M3A A;  4QT7 A;  1PHT A;  1ZX6 A;  1XOV A;  1PWT A;  1Z9Q A;  2GTO A;  2MCN A;  1NLP C;  3A98 A;  1G83 A;  1RLQ C;  4OMM A;  1WX6 A;  4Z89 A;  1AZE A;  2GGR A;  4HVW A;  2FEI A;  1SRM A;  2D1X A;  2DE0 X;  3M0S A;  1WLP B;  2OAW A;  2FPE A;  3VS7 A;  4J9F A;  5IHN A;  4F17 A;  1PKT A;  4LNP A;  4FSS A;  2EPD A;  1G2B A;  2AKK A;  1B3Q A;  2J6F A;  2EYY A;  2GTJ A;  2LMJ A;  2RQR A;  3PVL A;  2CSQ A;  2VKN A;  1JO8 A;  4JPB W;  3TVT A;  1YP5 A;  1M3C A;  2DRK A;  2DLP A;  1KIK A;  2D8H A;  1QKW A;  4LN2 A;  2O9V A;  2DMO A;  2CT4 A;  4HCK A;  3VS3 A;  2YDL A;  1X2K A;  3M0U A;  4J9C A;  2KGT A;  2ED0 A;  1AWW A;  2O31 A;  1UG1 A;  2K9G A;  4X1V A;  1UGV A;  1GL5 A;  4J9G A;  1JXO A;  4RTY A;  3VS0 A;  5EC7 A;  1MUZ A;  1RI9 A;  2L3Q A;  1W70 A;  1BU1 A;  2RPN A;  1NLO C;  2PZ1 A;  3EG3 A;  1SSH A;  1WYX A;  2EGA A;  4M4Z A;  5GJW B;  3SHW A;  1PKS A;  3UA7 A;  4F14 A;  2EGE A;  2RN8 A;  2KRO A;  3EG1 A;  2KXD A;  2KRN A;  4AFS C;  4Y92 A;  2CRE A;  1MV0 B;  2ECZ A;  1SRL A;  5HCK A;  2KEA A;  2JM8 A;  1WFW A;  1FYN A;  1E7O A;  2XMF A;  1UEC A;  2LJ0 A;  1M27 C;  2MOX A;  1KFZ A;  2F2V A;  4HVV A;  4IIO A;  2RQV A;  2LX7 A;  1A0N B;  1BK2 A;  1GCP A;  1AZG B;  2A36 A;  2SEM A;  2NWM A;  1QLY A;  2LJ1 A;  1EFN A;  2DF6 A;  2CT3 A;  4GLM A;  4CC2 A;  2HEQ A;  4CC7 A;  2LZ6 B;  1PRL C;  1K0S A;  5IH2 A;  3M0R A;  1PRM C;  2X3W D;  3H0F A;  2YUP A;  4AFU C;  4OMN A;  1ZUY A;  2LCS A;  2BZX A;  1JQQ A;  4K11 A;  1VA7 A;  1U3O A;  2JS2 A;  4D8K A;  2J05 A;  4OMO A;  2FRW A;  1JXM A;  2HSP A; 
#chains in the Genus database with same CATH topology
 2CH4 A;  3NGP A;  4PLL A;  1RAD B;  1OX9 A;  1HJD A;  2X4X A;  4E7J A;  1I4K 1;  4TVR A;  1ARK A;  4DQ2 A;  3HPW A;  4HCZ A;  2JOY A;  4J6Y A;  3AT1 B;  1SPK A;  2R58 A;  1X2Q A;  1TUG B;  4XAX B;  4M78 F;  2D8J A;  4DA4 A;  2NUT B;  5GAO n;  3RES A;  1NZ9 A;  3UAT A;  1OZ3 A;  2YUO A;  3OYY A;  2YUN A;  2D0Q B;  1OPK A;  3RMS A;  2GFU A;  2M9U A;  1HD3 A;  5CKE A;  3I55 Q;  2HNI A;  3REA B;  3VKI A;  3OY9 A;  3CME T;  1AD5 A;  1WZO A;  2RA2 A;  4ME7 A;  2VXE A;  3PT9 A;  4EDU A;  2AT1 B;  2FB7 A;  1Y0M A;  1MGQ A;  1Y57 A;  1ZSG A;  4JJB A;  2O2O A;  4QVD A;  5A0G A;  1YWO A;  2Y4Y A;  3OB9 A;  1KQ2 A;  1AHJ B;  3WVD B;  3NTK A;  4M78 C;  5GMK l;  1VYT A;  3X24 B;  4M7D B;  2ZPE B;  2P4R A;  2JTF A;  1EX4 A;  5L23 A;  2R57 A;  5HK3 A;  1K1Z A;  4HCB A;  1FMW A;  4KGZ B;  1WXU A;  4J9D A;  1MHN A;  3QUI A;  5CKD A;  3I55 A;  4M78 D;  3OYA A;  1OPL A;  2KR3 A;  3A8H B;  3VRY A;  3CCU Q;  1ZA1 B;  2ROL A;  2QEX A;  1M1K R;  1KQS S;  2OI3 A;  1OOT A;  4C0F A;  2V1Q A;  4DEX A;  2DRM A;  3UDC A;  4BUG A;  5GAN 3;  1YI2 A;  4O5V A;  5KYU B;  2RI2 A;  1AWO A;  4L6V 5;  3P8H A;  4F7U G;  1VYV A;  4M75 D;  3OYN A;  4M75 C;  2ZPG B;  1NE8 A;  1Q7Y C;  2MYS A;  5GAM f;  1YBY A;  1GRI A;  1VIF A;  3JB9 F;  2QYZ A;  3FEO A;  5GAN 8;  4RTW A;  1C1A A;  2EQM A;  1PM3 A;  2I2L A;  2QEX Q;  1VQO Q;  3CXC P;  2RK2 A;  1UJ0 A;  3URG A;  3L2Q A;  3EG2 A;  4AFQ C;  2OTJ A;  4LXC A;  3TCJ A;  2DFU A;  2RO0 A;  2XDP A;  4KGV B;  1VQ8 T;  3JB9 I;  1UE9 A;  3EH1 A;  1M3B A;  1UGS B;  3V8J A;  2HBW A;  1GBR A;  5IHI A;  1WHK A;  3VYH B;  4C92 E;  4KT0 E;  1WQW A;  1OQK A;  2RQW A;  4ZNX A;  1VQN Q;  3AHU A;  1UUE A;  4OB1 B;  4KH1 B;  1JJ2 P;  2ZAE A;  3QXE B;  1KQ1 A;  4ZN1 A;  4C0G A;  3VS2 A;  1QVG A;  1IO6 A;  1YIT A;  2EYQ A;  2KT8 A;  3CC2 Q;  1LJO A;  3MET A;  5LJ3 e;  1C0M A;  2F5K A;  2DER A;  1TG0 A;  1CKB A;  3Q1J A;  3INZ A;  2DL4 A;  3M54 A;  2JM9 A;  3M0T A;  4OGE A;  2ESW A;  3SD4 A;  2HSE B;  3FIF A;  1K9M U;  4QKU A;  2JXB A;  4Z88 A;  2E65 A;  4M7D D;  1X75 C;  5CVI A;  1TUD A;  4XTW A;  5GAN 4;  2QQR A;  2JS0 A;  3QSU A;  3L2Z A;  1WHG A;  4ZGJ B;  2COZ A;  4M7A E;  1YJW T;  2XKO C;  4XU2 A;  4LUD A;  2EYX A;  2X4Y A;  1J3T A;  5GMK i;  5AYF A;  3EG0 A;  4M75 F;  1Z9Z A;  2V8J A;  3CC4 A;  5C0M A;  2H8H A;  2F5T X;  1ZSZ C;  1D1C A;  2DIQ A;  4B9W A;  1UGQ B;  2LQN A;  2FZK B;  2EW3 A;  3U23 A;  3OS1 A;  3EGU A;  1E6H A;  1RAA B;  2E4H A;  3LLR A;  2F69 A;  2K2M A;  2YWW A;  3QWX X;  2DVJ A;  4HVU A;  3QYG B;  3OYB A;  3RIR A;  1ZBJ A;  2L3S A;  2FYK A;  5GAM h;  1MMN A;  4J8O A;  2JT4 A;  5GJV B;  4A63 B;  3QYH B;  1GFC A;  1N8R C;  4OMF B;  1X69 A;  3H0H A;  2M0Y A;  5IHK A;  3G71 T;  2RB6 A;  4WTO B;  4C92 G;  2BTT A;  5GAM g;  3CCE Q;  1QVF S;  5FRN A;  3G71 A;  2HQX A;  1I1J A;  2FZC B;  4J7I A;  3H6Z A;  1KSW A;  1D1A A;  2BE9 B;  4DBH A;  4KGX B;  1RLP C;  2CUD A;  3OSS C;  2CDT A;  1FX7 A;  3MHX A;  1S72 T;  1WPY A;  1SF9 A;  4RTX A;  1BI3 A;  4BI3 A;  2JMA A;  2KRM A;  3UT1 A;  2M16 A;  4M77 D;  3QBY A;  1NJI C;  2LTO A;  3CEY A;  3CPW P;  2IVW A;  2J6K A;  2KQW A;  1BKB A;  2FVU A;  5GAO r;  5I21 A;  5KYW A;  2MCN A;  4IUR A;  1YIT Q;  4M77 G;  4Z89 A;  5HY6 A;  2M0O A;  1M1F A;  1Y07 A;  1RI0 A;  3M0S A;  2A7Y A;  4C0D C;  1WLP B;  2OAW A;  3VS7 A;  3S3M A;  4J9F A;  3GPL A;  4DBF A;  1YIJ A;  5J26 A;  4OB2 B;  1RL2 A;  5IHN A;  2RK1 A;  1Q81 R;  1VQ8 A;  3M56 A;  1YIJ T;  1IRE B;  4M78 E;  1B3Q A;  2EYY A;  4HKE A;  1G3S A;  3JCM V;  2VUB A;  3HRS A;  3PVL A;  4XTU A;  1TSF A;  2QA4 A;  5KYY A;  2D8H A;  2LDM A;  1QKW A;  2KVQ G;  2CT4 A;  2YDL A;  1IGU A;  3CD6 Q;  1UG1 A;  3P8D A;  4OP0 A;  3UWN A;  1QVF A;  4X1V A;  2YRD A;  5FU7 C;  1JXO A;  1ZQ1 A;  3VS0 A;  4JLG A;  4RG2 A;  1VQ7 T;  1BU1 A;  1NLO C;  2OTL Q;  4M7D C;  2EGA A;  4M4Z A;  4F14 A;  5HK0 A;  2RN8 A;  4RCC A;  3V7R A;  1WJR A;  2GF7 A;  4Y92 A;  1MV0 B;  3A8O B;  1QCO A;  1SRL A;  3JB9 G;  2XG8 D;  3M59 A;  5GAM j;  3CCJ T;  2H3E B;  4XU3 A;  4LDV A;  3QII A;  1FYN A;  5KCO A;  5HKC A;  1KFZ A;  2ATC B;  2BKD N;  2MOX A;  1Q82 U;  4ANJ A;  2XDD A;  3FB9 A;  4IIO A;  5L8R E;  2LX7 A;  2CP2 A;  2DTO A;  2X4J A;  1Q82 R;  2SEM A;  2NWM A;  3KBG A;  4M7A F;  1UGP B;  3X26 B;  4CC2 A;  4CC7 A;  2LZ6 B;  2X9H A;  1PRL C;  1RAG B;  4DBQ A;  3QJ6 A;  3M0R A;  4IUU A;  1PRM C;  3BW1 A;  3H0F A;  2PVG B;  3HSB A;  2LCS A;  4FU6 A;  3JCM d;  2Y4X A;  3PGG A;  2DAQ A;  1JQQ A;  2OX7 A;  3CCS A;  1VA7 A;  3CC2 A;  2XDB A;  1U3O A;  4FW2 A;  2KI7 A;  2FRW A;  4KUI A;  1DJ7 B;  2HSP A;  2AZS A;  3CC2 T;  2P0P A;  2O01 E;  4C92 C;  2V8K A;  4KH0 B;  4V2S A;  1BI2 A;  5FWB A;  3CCJ Q;  4ZGD B;  3NFC A;  1KHC A;  1PCX A;  3NMZ C;  2MMP A;  4Q5W A;  2EJF A;  4LD9 K;  1PG5 B;  3X28 B;  3ER0 A;  4MZT A;  2L3P A;  2HKQ B;  4FYW B;  2FPD A;  4DEY A;  2QAZ A;  3CPW A;  4E7L A;  2EGC A;  4JZ4 A;  5KYX B;  2ZPF B;  3DLL A;  3TSW A;  2RF0 A;  2DBK A;  2YLC A;  3NHN A;  2CYZ B;  2PQW A;  2BUD A;  1UTI A;  2ED1 A;  4FW1 A;  4M77 B;  2X35 A;  1M1K U;  1RUW A;  2CUB A;  4RTT A;  5DY9 A;  4FYY B;  3VYG A;  2C0O A;  2RHI A;  3FC3 A;  1U5S A;  1OX8 A;  2RHU A;  1EZZ B;  3BFM A;  2MAM A;  3VUZ A;  1D09 B;  2RJE A;  4X9D A;  1PC0 A;  1UEB A;  2LT1 A;  4JRQ A;  1XNI A;  4O6J A;  1TU0 B;  2LCC A;  4HT9 A;  1HSQ A;  2XD0 A;  5IXF A;  3DB3 A;  2DNU A;  2JJ9 A;  1S1N A;  4XQ3 A;  1YIT T;  2RJC A;  4MDW A;  3KFV A;  1SHF A;  1X01 A;  1IZ6 A;  3LWI A;  2JNG A;  4PFZ A;  3C95 A;  1K4U S;  3C94 A;  1VQP Q;  3H8Z A;  4F7U B;  3RBB B;  5KYN A;  3C4S A;  2QG9 B;  1IXD A;  1LNX A;  1YJW A;  3PMI A;  4UC4 A;  2PTK A;  1OI1 A;  4C92 B;  1W2B P;  1NEG A;  1XJW B;  4FCY A;  4PJO B;  5LJ5 d;  4KRT A;  2RH2 A;  1RAE B;  2MPX C;  3CCJ A;  2NLU A;  2D6F A;  3QZ9 B;  3OA6 A;  3G71 Q;  1VQ9 A;  2XI9 A;  4N0A C;  2CP0 A;  2CSI A;  3CCR Q;  3QZ5 B;  1MV3 A;  2QGF B;  3E19 A;  1WHM A;  4M75 B;  4FIB A;  4QVC A;  4F16 A;  1WDX A;  1JRI A;  1E6G A;  3IQL A;  3TEE A;  3GOX A;  3UPU A;  3QDF A;  1ZSZ A;  5EG2 A;  3EGX A;  4QQ6 A;  4M75 G;  2LQ8 A;  4M7A B;  1U06 A;  2GNC A;  3I35 A;  2DZC A;  2LQW A;  5KE2 A;  3A8L B;  3CCR T;  5GAO m;  1UHF A;  1YJ9 T;  2K57 A;  4GY5 A;  5LJ5 f;  2D9T A;  3CXC S;  2KRS A;  4PJO D;  1NYF A;  7AT1 B;  3JCM J;  3CC7 T;  4A53 A;  4RTZ A;  2KYB A;  4RUG A;  2MIO A;  2WSF E;  4HA8 A;  4B6M A;  1VQ9 Q;  2B8A A;  2XHC A;  2VVK A;  1PD1 A;  2K3B A;  1OU9 A;  3VS1 A;  4NOY A;  2HBP A;  2DJZ A;  3ULR B;  1RAB B;  1H92 A;  3L1A A;  1VQ6 T;  2J6O A;  1R0C B;  2DL8 A;  2D0N A;  1VYU A;  4N4H A;  4HCC A;  2CKK A;  3X20 B;  2OTJ Q;  2K5I A;  2QQA A;  2I0N A;  1VQP T;  2YT6 A;  4C92 D;  3I9Q A;  2PVO B;  4J9I A;  3SWN C;  4BI8 B;  4E7I A;  2K79 A;  1WA7 A;  3NPF A;  4LE9 A;  5FRO A;  2DM1 A;  4BB7 A;  1ZUK A;  2ENM A;  5GAM d;  4BDY A;  1SKU B;  2EVR A;  2GQV A;  2AKL A;  2C0I A;  4PJO C;  1NG2 A;  3J80 E;  1VQK A;  1JU5 C;  5GAN 6;  2O4X B;  1WQ7 A;  4JZ3 A;  1KC8 R;  2L8D A;  4E6R A;  3LH5 A;  1WXT A;  4XTX A;  3CPW S;  3VS4 A;  4CRI A;  2G6F X;  4ESR A;  1Q81 U;  4M78 A;  2HQH A;  4JJD A;  2K3Y A;  2HKN A;  5A2Q E;  1FXX A;  1D3B B;  5LJ5 e;  2A28 A;  4RKU E;  1KQS A;  1TH7 A;  1GCQ C;  1N9S A;  4A4G A;  4PK4 A;  4IUT A;  4OMP A;  3CXC A;  3CMA Q;  2KNB B;  1QCN A;  4J9B A;  5GMK e;  2YSQ A;  2K3X A;  1KJW A;  1JEG A;  3M0Q A;  1K8A C;  2CZ6 B;  2QAS A;  1YN8 A;  2M1H A;  1M90 C;  1UFF A;  4ELZ C;  1N6A A;  5I22 A;  1JJ2 A;  1QKX A;  4A4K A;  5CO7 A;  2B86 A;  1QWF A;  3E1S A;  3CC4 Q;  4M7D G;  4FT2 A;  3CCU T;  4GBQ A;  3OYK A;  2J06 A;  1PNJ A;  1NM7 A;  4FL6 A;  1G3W A;  4BE1 A;  1PHT A;  4RCB A;  1ZX6 A;  3ZBD A;  2RHZ A;  1XOV A;  1Z9Q A;  4RMO A;  2LC4 A;  2KDS A;  3L42 A;  4IKF A;  4OMM A;  2GGR A;  4HVW A;  5GAO q;  1K73 U;  5FU6 B;  1B7T A;  2D1X A;  3V8K A;  3G4S A;  2V26 A;  2QQ9 A;  3JCM h;  3TU4 K;  2ZPI B;  1R8O B;  1G2B A;  2NUP A;  2DTI A;  2LMJ A;  2MF2 A;  2RQR A;  1YFN A;  1F1B B;  2COW A;  3I56 Q;  2VKN A;  4BDZ A;  4JPB W;  2QA4 Q;  4M77 A;  2HL3 A;  4OB3 B;  1QVP A;  1M3C A;  2DRK A;  2O9V A;  2DMO A;  4AT1 B;  1HXD A;  4A4F A;  4M77 C;  4BAC A;  4A4E A;  1AWW A;  5LL6 S;  3S6W A;  2VB6 A;  2COY A;  2LT4 A;  2K9G A;  4J7F A;  3CPF A;  5LJ3 h;  4RTY A;  5EC7 A;  2DZ9 A;  3GNG A;  4C8Q B;  1W70 A;  1H64 1;  4XK8 E;  1SSH A;  1P92 A;  2QI2 A;  2EGE A;  5IN1 A;  1JJ2 S;  3EG1 A;  2RM4 A;  4X9C A;  4EMG A;  5GAN h;  3S3N A;  1KQS P;  2CRE A;  5CCA A;  2CZ0 B;  1YJN A;  2NUT A;  5DLQ E;  5GAN d;  2VAS A;  3SB2 A;  4F04 B;  2DO3 A;  2MWO A;  1UEC A;  1M27 C;  5FRM A;  3JSC A;  2P84 A;  4JRI A;  1VUB A;  2VYT A;  4MDX A;  1BK2 A;  1MND A;  1Q95 G;  1AZG B;  1QVG S;  2CZ7 B;  3WVE B;  2LJ1 A;  3KUF A;  1YI2 Q;  2CT3 A;  1VQ4 Q;  4XU1 A;  5M9O A;  4C8Q D;  1K0S A;  3M5A A;  4NS5 A;  2X3W D;  3CCL T;  4AFU C;  1ZUY A;  2BZX A;  2VC8 A;  5CQY A;  3CCL A;  2DD5 A;  1K8A U;  1MMG A;  4M7D A;  2JS2 A;  4D8K A;  2J05 A;  4R56 A;  1VQ5 A;  2EAY A;  3SWN B;  3DKM A;  1JXM A;  2RQT A;  1K73 R;  1ZSZ B;  1Y7X A;  3EG9 B;  3OYL A;  3OYG A;  3EHQ A;  3EGX B;  4XTZ A;  3L2R A;  2FHD A;  1WHJ A;  3QPH A;  4JUV A;  3HTR A;  2F2X A;  2NUZ A;  1T3S A;  1VQ9 T;  1OU8 A;  1CSK A;  3FJP A;  2QTV A;  2E12 A;  2KAF A;  4C5G A;  4M78 G;  2G3R A;  2A37 A;  1H8K A;  4C0D B;  3EFR A;  2GQI A;  4GLK A;  1JB0 E;  1YJ9 Q;  2DVE A;  4A54 A;  3HKS A;  2KT1 A;  3OYM A;  4C8Q C;  1K0X A;  2K2V A;  2KBT A;  1AT1 B;  2ABL A;  2HDA A;  5IT9 E;  2RNA A;  2LNH B;  1WJQ A;  4RG8 A;  1GFD A;  1TUC A;  1B34 A;  2CP5 A;  1ZA2 B;  2E6N A;  3JCM P;  1M2O A;  4EIK A;  4PJO E;  2FRY A;  4BY6 B;  1K73 C;  4PNO A;  3CC7 A;  1X27 A;  3FDR A;  1G5V A;  3TQ7 P;  5FU7 B;  4OMQ A;  3A1P A;  4IUQ A;  1T3L A;  3I56 A;  1YCS B;  2CP3 A;  1VQM T;  3CCM Q;  1YHQ A;  3RKY A;  2DL5 A;  1I5L A;  4EMK A;  1NPR A;  1M1G A;  3OBY A;  1N5Z A;  2ZGW A;  3LW5 E;  4MZM A;  1UHC A;  3LX7 A;  2QDL A;  1KD1 C;  5I11 A;  1VQ6 A;  2OTL A;  3H9N A;  5AT1 B;  2X3X D;  3MPU B;  1AVZ C;  1JBM A;  2X4W A;  1VQP A;  1U8R A;  3S3O A;  3OS0 A;  3MEA A;  2A08 A;  3LYI A;  3EFO B;  5GAN 5;  4M78 B;  1X6B A;  5CQX A;  4PJN A;  1AEY A;  3OYF A;  4LDY A;  3OMC A;  1WGS A;  2FG0 A;  4F7U E;  1UGR B;  4M7A D;  3ZL7 C;  3HFN A;  4II1 A;  1K9A A;  1YJN T;  3DB4 A;  1VQL Q;  1VQ5 Q;  1T0J A;  2VGN A;  3M53 A;  4AFZ C;  1MNE A;  4WCI A;  1YNZ A;  2P0Q A;  2YLB A;  2IG0 A;  2EQI A;  1I81 A;  3HRT A;  3QHS A;  4QW2 A;  4XTY A;  3PIP A;  1AOJ A;  1W1F A;  2CP6 A;  2LRQ A;  1QVG P;  1WNL A;  1KK7 A;  3CQT A;  5LJ5 h;  2DIL A;  1VQ8 Q;  1ZBX A;  1VIE A;  3PNW C;  3TSZ A;  2EYW A;  2DA9 A;  4IIM A;  5LJ3 d;  4D8D A;  1TS9 A;  3VS6 A;  2BE7 D;  4PFO A;  1VQO T;  1AWJ A;  4NL3 A;  3JRZ A;  4OB0 B;  5FWC A;  4Z02 A;  2AK5 A;  5LJ3 j;  4EMH A;  2YHT A;  1RAI B;  6AT1 B;  3MO8 A;  3QWY A;  1HK9 A;  5CKH A;  1UDL A;  3R6N A;  3L2U A;  1O75 A;  1I5O B;  1VQ5 T;  2E3I A;  1M8M A;  1X43 A;  2WSC E;  4BE2 A;  1XTD A;  1QCF A;  3ZFJ A;  5A0L A;  2VWF A;  2EKO A;  1QW1 A;  4OVA A;  3F70 A;  1VQL T;  1GCQ A;  3N5B B;  3CCU A;  2L2P A;  1M9S A;  5GAO p;  4E7K A;  4E7S A;  1BIA A;  1NPP A;  2J7I A;  2KYM A;  2K5L A;  4C5H A;  5CR2 A;  3EHR A;  4C8Q F;  5CK9 A;  3VUB A;  4M75 E;  1GXI E;  2VGM A;  5KE3 A;  1T0H A;  1LOJ A;  2OTJ T;  1M90 U;  2KE9 A;  4R0K A;  5GMK j;  2VV5 A;  3VS5 A;  2YXY A;  5LJ3 g;  1NYG A;  1HYO A;  3O5Z A;  1M90 R;  2QK0 A;  1U1T A;  1N27 A;  2DL3 A;  2E64 A;  4CC3 A;  3D7S B;  4C5I A;  2V1R A;  3CCR A;  1Y96 B;  4JRP A;  1K8A R;  1N8R U;  1OZ2 A;  1YJ9 A;  3PFS A;  4KUD K;  1YCY A;  2EIF A;  4C8Q A;  3PMT A;  1QP2 A;  1W2B A;  3RKW A;  1M30 A;  3JB9 J;  4DOW A;  1M8V A;  1NJI R;  1V76 A;  2R5M A;  3CCM T;  2KSS A;  2EJG A;  3CCM A;  1YHQ Q;  2DJQ A;  3MCA B;  3OS2 A;  2DL7 A;  2M51 A;  3P8B B;  3CME Q;  3BY7 A;  4KBM B;  3JCM X;  3EFS A;  1BI1 A;  2E6Z A;  2OTL T;  4PL6 A;  1BIB A;  4QQD A;  3RUX A;  4JJN K;  1KC8 C;  3J81 E;  1PSE A;  1FMK A;  1N8R R;  2X51 A;  3E2U A;  1W6X A;  2YRC A;  2AZV A;  4OF1 A;  5KYY B;  1G3T A;  2QDY B;  3WXM B;  3CD6 T;  3OW2 A;  4BI4 A;  2QTX A;  1UJY A;  3MEW A;  2E3H A;  3M4G A;  2EQJ A;  2W10 A;  2P4T A;  2DXU A;  2E5K A;  1I8F A;  3G7Z A;  2JN0 A;  1IRX A;  4N0A A;  1YIJ Q;  2JTM A;  5GAM e;  4OML A;  2EBP A;  3JCM f;  3ZEH A;  2A0F B;  3RNJ A;  3CCQ T;  3CMA A;  5GMK h;  4C8Q E;  2ZPB B;  3HHT B;  3M9Q A;  2ROT A;  3PVQ A;  4VUB A;  3LGF A;  3C0C A;  3RKX A;  4QT7 A;  5I2M A;  5A0D A;  2AHJ B;  5CKB A;  1PWT A;  3CCV Q;  5CKF A;  3BE3 A;  5DLO A;  4M77 F;  3QDR B;  3CCV T;  3A98 A;  1G83 A;  1RLQ C;  5FU6 C;  2DXB A;  1WX6 A;  1AZE A;  2Y90 A;  3E9G A;  2RD1 A;  4QVZ A;  2FEI A;  2DE0 X;  1YI2 T;  1NBE B;  1OUL A;  2DEQ A;  3DLM A;  2FZG B;  2MI6 A;  2DXT A;  2EPD A;  3MEV A;  1S72 Q;  2IPO B;  3MP6 A;  1VQL A;  4FM4 B;  5I2S A;  1Q86 R;  4BD3 A;  2EQU A;  3QG1 A;  1WHH A;  2XIC A;  1YP5 A;  2DLP A;  3HFO A;  4LN2 A;  2EFI A;  3VS3 A;  1X2K A;  3M0U A;  2KGT A;  2ED0 A;  3MP8 A;  1LVK A;  3MJX A;  1X6O A;  3JCM c;  4JS5 A;  2LNV A;  4LDW A;  8ATC B;  4LDU A;  2ZZD A;  1GL5 A;  3OQ5 A;  4N4G A;  4EMK B;  1K9M C;  1MUZ A;  1RI9 A;  1FMV A;  2E10 A;  2PZ1 A;  4A4H A;  3T9N A;  4DOV A;  1D1B A;  3CBM A;  1D0Y A;  1WYX A;  3UA7 A;  2KRO A;  3LWH A;  3RER A;  2EWN A;  2ECZ A;  4PJL A;  5D6X A;  3FLG A;  3JB9 H;  5HCK A;  5KYW B;  1YHQ T;  4Y28 E;  4ELY C;  2DEU A;  3EFO A;  2QA4 T;  1E7O A;  2K5F A;  3GNF B;  2LJ0 A;  5KYX A;  2F2V A;  1QQJ A;  4HVV A;  3JCM Q;  1A0N B;  1MMD A;  4M7A G;  1M2V B;  5GMK m;  3JB9 D;  3ME9 A;  1VOM A;  3LH0 A;  3OYC A;  2MWP A;  1IB8 A;  2L5Q A;  3NTI A;  1EFN A;  4J6X A;  4D6W A;  2HEQ A;  4KUL A;  1ACM B;  4XTV A;  2DTH A;  9ATC B;  1UB4 A;  5IH2 A;  1LPL A;  5KH6 A;  3A8G B;  3M58 A;  4OMN A;  3OBW A;  3GP8 A;  4HT8 A;  1M1K C;  1R0B G;  2HMA A;  3M57 A;  2DET A;  4OMO A;  2CP7 A;  4ATO A;  4C8Q G;  3SEM A;  1ABO A;  4AMC A;  1QMC A;  3CC4 T;  4M7D E;  4JJC A;  3RDV A;  1TOV A;  2SRC A;  4PJO F;  2QQB A;  2C0T A;  2DKG A;  1G3Y A;  1IGQ A;  1KD1 R;  3GIB A;  2YUQ A;  4MMK A;  4F7U A;  3O8V A;  1NEB A;  2XU8 A;  4C0Z A;  3CMA T;  1KD1 U;  1QP3 A;  1B07 A;  3SFM A;  1ABQ A;  1I07 A;  4MML A;  2HCK A;  3M4Y A;  1VQK Q;  1R77 A;  3CCQ A;  4PLI A;  3A8M B;  3BDU A;  1VQO A;  4J9E A;  4QQG A;  3OYJ A;  2RMO A;  3ASK A;  4RTU A;  3OMG A;  5LJ3 f;  4PJO A;  1D0Z A;  5FLX E;  1EIF A;  1RAF B;  2QEX T;  1W4S A;  4AG2 C;  3CCS T;  3L2W A;  4FT4 A;  1WHL A;  2L0A A;  3J7A F;  1PSF A;  3PIO A;  1FWZ A;  2K4Y A;  4MZP A;  5IAY A;  2RHY A;  1M4Z A;  4PFP A;  1S72 A;  2LP5 A;  2ZCF B;  5CAI A;  1I0C A;  1LCK A;  2P0K A;  1YJN Q;  2F2W A;  1AWX A;  4LD6 A;  1Y96 A;  4EMK C;  4AG1 C;  5CIU A;  1ZUU A;  2LVM A;  3E9F A;  3HRU A;  5IXB A;  1M5Q 1;  4Z8A A;  2KMT A;  2KY9 A;  1Q82 C;  4ORZ A;  4P5N A;  1VQ4 A;  4JRK A;  4WF2 A;  2EYZ A;  2WAC A;  2CH4 W;  3G6E T;  2LJ3 A;  3FJ5 A;  3JV3 A;  3VJP A;  2RI5 A;  4J83 A;  3CCQ Q;  1BCO A;  1VQ6 Q;  3QJY A;  2FPF A;  5GAN g;  2PUO B;  4PJM A;  5KCH A;  2K6D A;  4PKC C;  4ZTF A;  3OW2 P;  4JDS A;  2H3J A;  1WI7 A;  2JW4 A;  3UF4 A;  3G4S T;  3JCM b;  1BI0 A;  3CCE T;  1K76 A;  4L59 A;  1VQM A;  1VQM Q;  3JCM e;  1G8X A;  3CCE A;  1K9M R;  3EGD A;  4LUE A;  3QKJ A;  3CC7 Q;  1SHG A;  2F1L A;  1XQH A;  1YWP A;  4C5E A;  4IUV A;  3V8L A;  1W2B S;  3GBQ A;  1H3H A;  3HL8 A;  2JMC A;  1VQ7 A;  2CZ1 B;  4LDX A;  1KHI A;  1GBQ A;  1ZLM A;  1WJS A;  3GLX A;  1O9S A;  2O4X A;  1Q86 C;  3OS5 A;  3THK A;  1OV3 A;  3HP9 A;  3CME A;  4ZN3 A;  2JUF A;  3EAE A;  2L3R A;  4ZGE B;  4CI0 C;  8AT1 B;  3CBO A;  4ZTJ A;  1C6V X;  1Q81 C;  2A3L A;  1WXB A;  1WIE A;  2RHX A;  1U1S A;  3I5R A;  3H0I A;  2FO0 A;  3QO3 A;  2CGH A;  2JZ2 A;  3V7S A;  4FYX B;  1TTH B;  5D6W A;  3G4S Q;  4J9H A;  3UA6 A;  1D3B A;  2XK0 A;  1YJW Q;  1V1C A;  2V8I A;  1BCM A;  1X6G A;  2GBQ A;  2WSE E;  2DX1 A;  2C06 A;  4C92 A;  2DBM A;  2HQE A;  3R6O A;  4JLI A;  5GAN 2;  2EJ9 A;  1KC8 U;  5C6S A;  4OGC A;  1OEB A;  2E70 A;  2W0Z A;  2BZY A;  4J5Y A;  2IIM A;  2JVV A;  2K7A A;  3NTH A;  1CKA A;  1PD0 A;  3VV0 A;  2QQS A;  3G6E Q;  3I5S A;  4M75 A;  1BBZ A;  2HD0 A;  5GAN j;  4PJJ A;  2RQU A;  4B9X A;  3TRE A;  2DD4 A;  2KXC A;  2PU9 B;  1VQN T;  2OAU A;  1SEM A;  2LQK A;  5J39 A;  4M7A A;  1KG1 A;  2O88 A;  3OYI A;  1NJI U;  2MK5 A;  2LCL A;  3M55 A;  4YTL A;  1IHW A;  2BZ8 A;  2CS7 A;  5FW9 A;  3KXT A;  3M0P A;  3C12 A;  1IHV A;  1TWB A;  2M02 A;  2DYB A;  3PTA A;  5ECA A;  1H3Z A;  3PE0 A;  3OYE A;  4N4I A;  4PJO G;  4HXJ A;  2EKH A;  1Q86 U;  2Z0W A;  2PNI A;  3H41 A;  5GAN e;  3CCS Q;  1BB9 A;  5J3B A;  5DM7 R;  5KYU A;  2NUP B;  1QWE A;  4CC4 B;  3REB B;  2EQK A;  3MKD A;  1QVF P;  1M2V A;  4RTV A;  2YRV A;  5D6Y A;  2HZY A;  1VQK T;  3CBP A;  3JCM g;  2R5A A;  2JTE A;  2GFA A;  3I56 T;  4FYV B;  1V29 B;  2OJ2 A;  4E7H A;  1TXQ A;  3JCM W;  4M7D F;  2LX9 A;  5LJ5 j;  3FRN A;  5GAN 7;  4DBR A;  4J6W A;  4X34 A;  3VRZ A;  2DXC A;  2BIV A;  2O9S A;  3OYH A;  3L2V A;  1M3A A;  4EPC A;  4E2F B;  2GTO A;  1NLP C;  4Y91 A;  4NL2 A;  3EH2 A;  2QGG A;  1RAC B;  1SRM A;  5D7U A;  2FPE A;  4F17 A;  1PKT A;  4LNP A;  4FSS A;  2AKK A;  2AIR B;  3CD6 A;  3MP1 A;  4BY6 C;  2PVD B;  1SSF A;  2J6F A;  2GTJ A;  3G1J A;  2HAX A;  4L5G A;  2CSQ A;  1JO8 A;  3TVT A;  2DK3 A;  2RJD A;  5GAN f;  1KIK A;  4E7Z A;  1Q7Y U;  4JS4 A;  4HCK A;  3V7C A;  4J9C A;  2O31 A;  4C92 F;  1Q7Y R;  1VQ7 Q;  4XU0 A;  3X25 B;  3SWN A;  1UGV A;  4J9G A;  3I55 T;  2FL7 A;  2E41 A;  3RR6 A;  2QXF A;  3EG9 A;  3OSV A;  4FSX A;  4R55 A;  3JAM E;  2L3Q A;  2RPN A;  4F7U F;  1N9R A;  3EG3 A;  3SHW A;  5GJW B;  1PKS A;  3CCV A;  1Y71 A;  2KXD A;  2KRN A;  4AFS C;  2E5Q A;  3A5Z B;  2RI3 A;  1OYX A;  4M7A C;  3BDL A;  2KEA A;  2VXF A;  2JM8 A;  1WFW A;  1VQN A;  2KK4 A;  3RMQ A;  3MEU A;  2XMF A;  1SG5 A;  2L89 A;  2DPP B;  1D0X A;  2E1H A;  3VU3 C;  2PUK B;  2RQV A;  5LJ5 g;  1B34 B;  1GCP A;  2DYI A;  2ZPH B;  2A36 A;  3LGL A;  1QLY A;  4IUP A;  3CCL Q;  2DF6 A;  2GCX A;  3G6E A;  1ZHI A;  1BYM A;  1RAH B;  4GLM A;  4M77 E;  1VQ4 T;  3EGD B;  3SDZ A;  2YUP A;  2XID A;  3OW2 S;  5GAO l;  4E47 A;  4BE0 A;  4K11 A;  2NYS A;  2HL5 C;  3OYD A;  2DIG A;  2RJF A;  3GF5 A;  1MMA A; 
#chains in the Genus database with same CATH homology
 3SEM A;  1ABO A;  2RQT A;  2CH4 A;  3NGP A;  3EHQ A;  4JJC A;  1HJD A;  2SRC A;  5FWB A;  2C0T A;  2F2X A;  2NUZ A;  1ARK A;  1T3S A;  1CSK A;  3NMZ C;  1SPK A;  2YUQ A;  1X2Q A;  1NEB A;  2A37 A;  1H8K A;  1B07 A;  2D8J A;  2GQI A;  1ABQ A;  1I07 A;  2HCK A;  2L3P A;  3UAT A;  2YUO A;  2YUN A;  2FPD A;  4DEY A;  1OPK A;  2KT1 A;  1K0X A;  4J9E A;  1HD3 A;  2EGC A;  4JZ4 A;  2RMO A;  2KBT A;  4RTU A;  2ABL A;  2HDA A;  3REA B;  2RNA A;  2LNH B;  4AG2 C;  3TSW A;  1AD5 A;  2DBK A;  2RF0 A;  3NHN A;  1GFD A;  1TUC A;  1UTI A;  2ED1 A;  2L0A A;  4EIK A;  2FRY A;  1Y0M A;  1Y57 A;  1RUW A;  1ZSG A;  2CUB A;  4RTT A;  1X27 A;  4JJB A;  2O2O A;  4OMQ A;  2C0O A;  1YWO A;  1T3L A;  1U5S A;  1YCS B;  2LP5 A;  2DL5 A;  1I0C A;  1LCK A;  1VYT A;  2F2W A;  1AWX A;  1N5Z A;  2P4R A;  1HSQ A;  1UHC A;  5IXF A;  4AG1 C;  5L23 A;  2QDL A;  1ZUU A;  5I11 A;  2DNU A;  5IXB A;  1K1Z A;  1S1N A;  3KFV A;  1SHF A;  4Z8A A;  4ORZ A;  2EYZ A;  2CH4 W;  2X3X D;  1K4U S;  1AVZ C;  2LJ3 A;  3FJ5 A;  3JV3 A;  1WXU A;  4J9D A;  2A08 A;  3RBB B;  1OPL A;  2KR3 A;  3VRY A;  2ROL A;  1X6B A;  2FPF A;  1AEY A;  2OI3 A;  1OOT A;  2V1Q A;  2PTK A;  2K6D A;  4DEX A;  2DRM A;  2FG0 A;  1NEG A;  1WI7 A;  2JW4 A;  3UF4 A;  3ZL7 C;  1K9A A;  4KRT A;  1AWO A;  1T0J A;  1K76 A;  4AFZ C;  4WCI A;  1YNZ A;  2EQI A;  1VYV A;  4LUE A;  1SHG A;  2CSI A;  1AOJ A;  1MV3 A;  1W1F A;  1YWP A;  3CQT A;  2DIL A;  3GBQ A;  4F16 A;  1WDX A;  1GRI A;  1H3H A;  1E6G A;  3TSZ A;  2JMC A;  3IQL A;  2EYW A;  2DA9 A;  4IIM A;  4D8D A;  3VS6 A;  4RTW A;  1GBQ A;  1ZLM A;  1AWJ A;  1U06 A;  2GNC A;  3I35 A;  1UJ0 A;  2LQW A;  5FWC A;  2AK5 A;  3THK A;  1OV3 A;  3EG2 A;  4AFQ C;  1UHF A;  3QWY A;  1UDL A;  1UE9 A;  1M3B A;  2KRS A;  3R6N A;  1WXB A;  1NYF A;  1WIE A;  2HBW A;  1M8M A;  1GBR A;  1X43 A;  5IHI A;  3I5R A;  4RTZ A;  2KYB A;  3H0I A;  1QCF A;  2FO0 A;  4RUG A;  2VWF A;  2MIO A;  2RQW A;  4J9H A;  4ZNX A;  3UA6 A;  2VVK A;  2K3B A;  1UUE A;  1GCQ A;  1V1C A;  1X6G A;  2GBQ A;  3VS1 A;  2DX1 A;  2L2P A;  3ULR B;  1H92 A;  3VS2 A;  2J7I A;  1IO6 A;  2KT8 A;  2J6O A;  2KYM A;  2DBM A;  2DL8 A;  2D0N A;  1VYU A;  3EHR A;  1OEB A;  2I0N A;  2W0Z A;  2BZY A;  2YT6 A;  1TG0 A;  1CKB A;  2IIM A;  3I9Q A;  2DL4 A;  4J9I A;  2K7A A;  2JM9 A;  3M0T A;  1CKA A;  2ESW A;  2K79 A;  1WA7 A;  1T0H A;  3NPF A;  4LE9 A;  4Z88 A;  2JXB A;  2DM1 A;  2KE9 A;  4R0K A;  1ZUK A;  2ENM A;  3I5S A;  1TUD A;  3VS5 A;  2EVR A;  1NYG A;  2JS0 A;  1BBZ A;  3O5Z A;  2DL3 A;  2AKL A;  4CC3 A;  2C0I A;  2RQU A;  2V1R A;  1NG2 A;  2KXC A;  4LUD A;  2EYX A;  1J3T A;  1JU5 C;  3EG0 A;  1M30 A;  1SEM A;  1Z9Z A;  4JZ3 A;  2O88 A;  2AZS A;  4E6R A;  2H8H A;  3LH5 A;  2BZ8 A;  1WXT A;  5FW9 A;  3VS4 A;  3M0P A;  2DJQ A;  2LQN A;  2EW3 A;  3U23 A;  2G6F X;  3EGU A;  1E6H A;  4ESR A;  4JJD A;  2DL7 A;  2M51 A;  2DYB A;  5ECA A;  2K2M A;  3PE0 A;  4HXJ A;  3QWX X;  2EKH A;  2A28 A;  2DVJ A;  4HVU A;  2PNI A;  3H41 A;  1ZBJ A;  1BB9 A;  2L3S A;  1GCQ C;  1QWE A;  2JT4 A;  4CC4 B;  3REB B;  5GJV B;  1FMK A;  4OMP A;  4RTV A;  1W6X A;  2KNB B;  4A63 B;  2AZV A;  4J9B A;  1GFC A;  2YSQ A;  1X69 A;  3H0H A;  1KJW A;  2M0Y A;  5IHK A;  3M0Q A;  1JEG A;  1YN8 A;  2BTT A;  1UJY A;  1I1J A;  2JTE A;  2W10 A;  1UFF A;  1KSW A;  5I22 A;  2E5K A;  1QKX A;  1RLP C;  2CUD A;  2CDT A;  2OJ2 A;  2B86 A;  1QWF A;  4RTX A;  2JMA A;  2KRM A;  4OML A;  2EBP A;  3RNJ A;  4GBQ A;  2J06 A;  3VRZ A;  2ROT A;  1PNJ A;  1NM7 A;  3PVQ A;  2O9S A;  3C0C A;  2J6K A;  1M3A A;  4QT7 A;  1PHT A;  1ZX6 A;  1XOV A;  1PWT A;  1Z9Q A;  2GTO A;  2MCN A;  1NLP C;  3A98 A;  1G83 A;  1RLQ C;  4OMM A;  1WX6 A;  4Z89 A;  1AZE A;  2GGR A;  4HVW A;  2FEI A;  1SRM A;  2D1X A;  2DE0 X;  3M0S A;  1WLP B;  2OAW A;  2FPE A;  3VS7 A;  4J9F A;  5IHN A;  4F17 A;  1PKT A;  4LNP A;  4FSS A;  2EPD A;  1G2B A;  2AKK A;  1B3Q A;  2J6F A;  2EYY A;  2GTJ A;  2LMJ A;  2RQR A;  3PVL A;  2CSQ A;  2VKN A;  1JO8 A;  4JPB W;  3TVT A;  1YP5 A;  1M3C A;  2DRK A;  2DLP A;  1KIK A;  2D8H A;  1QKW A;  4LN2 A;  2O9V A;  2DMO A;  2CT4 A;  4HCK A;  3VS3 A;  2YDL A;  1X2K A;  3M0U A;  4J9C A;  2KGT A;  2ED0 A;  1AWW A;  2O31 A;  1UG1 A;  2K9G A;  4X1V A;  1UGV A;  1GL5 A;  4J9G A;  1JXO A;  4RTY A;  3VS0 A;  5EC7 A;  1MUZ A;  1RI9 A;  2L3Q A;  1W70 A;  1BU1 A;  2RPN A;  1NLO C;  2PZ1 A;  3EG3 A;  1SSH A;  1WYX A;  2EGA A;  4M4Z A;  5GJW B;  3SHW A;  1PKS A;  3UA7 A;  4F14 A;  2EGE A;  2RN8 A;  2KRO A;  3EG1 A;  2KXD A;  2KRN A;  4AFS C;  4Y92 A;  2CRE A;  1MV0 B;  2ECZ A;  1SRL A;  5HCK A;  2KEA A;  2JM8 A;  1WFW A;  1FYN A;  1E7O A;  2XMF A;  1UEC A;  2LJ0 A;  1M27 C;  2MOX A;  1KFZ A;  2F2V A;  4HVV A;  4IIO A;  2RQV A;  2LX7 A;  1A0N B;  1BK2 A;  1GCP A;  1AZG B;  2A36 A;  2SEM A;  2NWM A;  1QLY A;  2LJ1 A;  1EFN A;  2DF6 A;  2CT3 A;  4GLM A;  4CC2 A;  2HEQ A;  4CC7 A;  2LZ6 B;  1PRL C;  1K0S A;  5IH2 A;  3M0R A;  1PRM C;  2X3W D;  3H0F A;  2YUP A;  4AFU C;  4OMN A;  1ZUY A;  2LCS A;  2BZX A;  1JQQ A;  4K11 A;  1VA7 A;  1U3O A;  2JS2 A;  4D8K A;  2J05 A;  4OMO A;  2FRW A;  1JXM A;  2HSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...