4AFSC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDSIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afsC00
1ABOA 3THKA 3I5SA 2FRYA 4AFQC 1GL5A 2GGRA 2KBTA 2FO0A 1X6BA 2L3PA 2KXCA 1OPLA 3PVLA 3EG3A 4F16A 2KT1A 1K1ZA 4F17A 1RLPC 1AWJA 2A08A 1ZUUA 1XOVA 3TSWA 1T3SA 2VVKA 4HVVA 2O9VA 4AG1C 2JTEA 2KT8A 2DX1A 2O2OA 2HBWA 2YUNA 2CT3A 2DILA 2EGEA 2MIOA 3VS4A 2EYZA 4LNPA 2J06A 4RTYA 1VYVA 4JPBW 2RF0A 4OMPA 2DYBA 2JM8A 1SHFA 2E5KA 1BU1A 2GTOA 3IQLA 1NLPC 4EIKA 2J7IA 2EGCA 2W0ZA 2AK5A 2ED0A 2DA9A 2JS0A 1PHTA 2GTJA 2DL4A 3VS1A 3H41A 1U5SA 1B3QA 3QWXX 4LUEA 2O9SA 1MUZA 3RBBB 1UG1A 2ROLA 2ABLA 1GRIA 3EGUA 3M0UA 4OMLA 2CUBA 2MCNA 5IXFA 4DEXA 1X6GA 1H3HA 1GFCA 1PKTA 2RQRA 1A0NB 1KIKA 2JT4A 1X2QA 2GNCA 3EG0A 2LCSA 1SEMA 2HCKA 4Z89A 3KFVA 1TUCA 1JXOA 1M27C 2CUDA 2YUQA 4RTTA 1X2KA 2DNUA 2J6OA 1GBQA 1QWFA 2EBPA 2D8HA 2YT6A 2L3QA 2KR3A 1U06A 2OI3A 1YP5A 1U3OA 2YUOA 1K0XA 1E6HA 3R6NA 2XMFA 3REAB 1AWOA 4J9HA 2DMOA 2EKHA 2FPFA 4IIOA 1V1CA 4M4ZA 2SEMA 1WX6A 1HSQA 1YWOA 1LCKA 1UGVA 3VS3A 5L23A 2VWFA 1JQQA 1T0JA 2J6KA 1E7OA 1J3TA 1M30A 1SHGA 1K76A 3VS2A 2HDAA 1OOTA 4AFZC 1WDXA 3VS6A 1GCPA 1PRLC 1Z9QA 1QKWA 4AG2C 1X69A 1ABQA 2LQWA 2L2PA 1AD5A 1UTIA 1WLPB 4GLMA 4CC2A 2KEAA 5EC7A 3EG2A 2YDLA 4OMQA 1WA7A 2DE0X 1VA7A 3UF4A 2K3BA 1UUEA 2CSIA 2ED1A 2EYWA 2NUZA 4CC4B 3LH5A 2KNBB 1NEBA 3SEMA 3SHWA 2KRNA 2AZSA 1M3BA 2DL7A 5FW9A 2KYMA 2KGTA 1ZSGA 1CKBA 4HCKA 3I35A 1AWWA 1RLQC 3M0PA 4D8KA 1KFZA 1W6XA 3UA6A 1X43A 4HVWA 1BK2A 1UJ0A 2C0TA 5GJVB 2DRKA 3H0FA 2AKKA 2HEQA 1VYUA 2D1XA 2LJ1A 2LJ0A 4K11A 5IXBA 2JM9A 3UATA 1JU5C 1K4US 1AZGB 1WI7A 2DF6A 2DBKA 2F2WA 1NM7A 3I9QA 1RI9A 2IIMA 2J6FA 4WCIA 1HD3A 2EYYA 3H0IA 2J05A 4J9FA 2EQIA 3M0QA 2P4RA 1AEYA 2L0AA 2NWMA 2PZ1A 4D8DA 4E6RA 3A98A 4RTVA 3VS0A 1YWPA 1QKXA 2FRWA 3NGPA 2LQNA 5I22A 1X27A 1NLOC 1UDLA 1GFDA 2JW4A 2RMOA 2MOXA 2DLPA 4JJDA 1VYTA 2JMAA 4KRTA 1GCQC 1T0HA 4A63B 1SRLA 2KRSA 1KJWA 2KYBA 2BZ8A 2RQWA 2B86A 2RNAA 1S1NA 4DEYA 2D8JA 2EVRA 2X3WD 1EFNA 1UE9A 1Z9ZA 4X1VA 3UA7A 2CDTA 2V1QA 3RNJA 1ARKA 1H92A 2LNHB 1MV0B 2I0NA 2DL5A 3VRZA 1OEBA 5ECAA 2CSQA 4J9IA 4CC7A 3GBQA 1T3LA 1UHFA 4ORZA 3M0TA 2QDLA 2DVJA 4OMOA 2CT4A 2BTTA 2L3SA 2ECZA 3EHQA 3QWYA 2FPEA 5FWCA 1FYNA 4LUDA 3I5RA 1ZX6A 2D0NA 1AOJA 3H0HA 2GBQA 3EHRA 2OAWA 2RN8A 4F14A 1PWTA 2DRMA 1M3CA 1WYXA 4GBQA 5IHNA 1SRMA 1TG0A 1ZUKA 1YNZA 2X3XD 1B07A 2LMJA 1WIEA 3PVQA 4RTUA 1I1JA 3VS5A 1JEGA 2ESWA 4J9BA 1WXTA 2M0YA 1UFFA 4J9CA 1HJDA 1ZBJA 2DM1A 1K9AA 1JXMA 3PE0A 1WXUA 1OV3A 1W1FA 2JXBA 5I11A 2RQVA 2RQTA 4J9GA 2KE9A 1IO6A 5IH2A 2CH4W 1E6GA 2VKNA 4AFUC 3TSZA 3M0SA 2BZYA 1M3AA 4HXJA 4JJCA 2KRMA 1RUWA 4RTXA 1ZUYA 2FEIA 2HSPA 2A28A 4J9EA 4OMNA 2LP5A 5GJWB 2C0OA 2G6FX 1N5ZA 1WXBA 1UECA 1CKAA 1NEGA 2A37A 4RTWA 2FG0A 2PNIA 2KROA 4OMMA 2BZXA 4QT7A 3C0CA 2AZVA 2K2MA 3NHNA 1KSWA 3VS7A 2O31A 2C0IA 3REBB 2CH4A 2M51A 3CQTA 4FSSA 3M0RA 4ZNXA 3EG1A 1NG2A 2K6DA 1W70A 2DBMA 2JMCA 1I07A 3VRYA 1OPKA 2LJ3A 4Z8AA 1M8MA 1G2BA 5IHIA 2ROTA 4HVUA 2EPDA 1WFWA 5FWBA 2RQUA 2F2XA 4RTZA 4CC3A 1I0CA 3NMZC 1BBZA 2V1RA 1GBRA 2PTKA 3FJ5A 1QLYA 4Y92A 3TVTA 2AKLA 3NPFA 1AWXA 1Y57A 1PRMC 2W10A 2EYXA 1UJYA 2K7AA 1PKSA 1NYGA 4J9DA 5HCKA 4IIMA 3U23A 2A36A 1YN8A 4R0KA 1QWEA 1YCSB 2H8HA 4LE9A 1SSHA 1JO8A 1UHCA 4RUGA 4JZ3A 2OJ2A 1AZEA 3JV3A 2ENMA 3ZL7C 2YSQA 2DJQA 2K79A 1G83A 1QCFA 2F2VA 1ZLMA 3O5ZA 1CSKA 1H8KA 1Y0MA 1BB9A 2K9GA 5IHKA 4AFSC 1PNJA 4Z88A 2DL8A 1NYFA 1FMKA 2DL3A 2FPDA 1TUDA 2KXDA 4LN2A 1AVZC 2CREA 2EW3A 2RPNA 1GCQA 2LX7A 4ESRA 2SRCA 1K0SA 4JJBA 2JS2A 1SPKA 2LZ6B 3ULRB 2YUPA 4JZ4A 2O88A 2EGAA 2GQIA 1MV3A
chains in the Genus database with same CATH superfamily
3X28B 3THKA 3I5SA 2FRYA 1GL5A 2COYA 2JZ2A 2X4WA 5GAN7 2VGMA 2KBTA 3C4SA 1X6BA 1FMVA 1OI1A 2RI5A 3PVLA 4M75A 4F16A 1YHQT 3S3MA 1K1ZA 3LLRA 1KHCA 1AWJA 1RLPC 1KQSA 4FU6A 1Q86U 1XOVA 1NPPA 1T3SA 3M9QA 4QVDA 2YRCA 1SSFA 2EYQA 2HBWA 1K73U 4PLIA 3NTIA 3QG1A 1VQ6A 2F69A 4BI4A 1SHFA 1IGQA 1AHJB 5AT1B 3UT1A 3OYGA 3JCMg 4TVRA 4DBFA 4BI3A 4EIKA 1KC8C 2ED0A 1PHTA 2KI7A 3H41A 4M77C 1U5SA 4LUEA 2DZCA 3RIRA 2O9SA 3WVDB 4E7ZA 2JN0A 2R58A 2ROLA 5CAIA 3HP9A 3CD6Q 4Z02A 2AHJB 2WSEE 1KIKA 1QVPA 2GNCA 1B34B 2V8JA 5IN1A 1TUCA 4Y28E 4DQ2A 2O01E 5GAN4 3CPWP 3S3NA 2YUQA 4EDUA 2CP2A 5LJ5d 3E2UA 4C0ZA 5KE2A 2FB7A 2YT6A 1YP5A 4M78B 1K0XA 4ZTFA 4HT9A 4J9HA 1F1BB 3OYFA 2BE7D 2EKHA 2A3LA 3JB9F 3QJ6A 3X25B 3QBYA 1VQ9A 1HSQA 1I4K1 2DIGA 1YWOA 5DLOA 5GANe 1LCKA 5LJ3g 2MAMA 1QW1A 1TU0B 4XTXA 2VWFA 1JQQA 3ZEHA 2J6KA 1Q82C 3VS2A 2RA2A 1WDXA 3ER0A 1X69A 1U1TA 2KSSA 2L2PA 2DAQA 2EJGA 1M2VA 2QK0A 1WLPB 3LWHA 2HAXA 3QIIA 2P0PA 2RI3A 2PQWA 5LJ3h 2QA4Q 4CC4B 3LH5A 4ELZC 1NEBA 3JB9H 3MCAB 2BIVA 2DXUA 2PUKB 1MGQA 2COWA 1M3BA 3CCRT 2OAUA 1PD1A 1RAHB 2YXYA 3S6WA 2OTLQ 1I5LA 3CCVT 2E41A 1NJIR 2F5KA 4PJNA 2L8DA 4V2SA 2FHDA 2X4YA 4ZGDB 3I55T 5LJ5g 1X43A 3AHUA 5KYYB 4KULA 4HVWA 3MEAA 1BK2A 2C0TA 2DRKA 3JCMV 1VYUA 2D1XA 2LJ1A 4K11A 2A7YA 4M7AD 3JB9J 1M90C 1PD0A 2EAYA 2OTJT 2VB6A 2DF6A 2DBKA 4FYXB 4FM4B 3CCLT 4GLKA 4FW2A 3RR6A 4M78D 3TCJA 3R6OA 2J05A 3EFSA 2GCXA 4RCCA 5LJ5h 4D8DA 3A98A 3V7SA 4PK4A 2ZGWA 3VS0A 2VV5A 4AT1B 1RAEB 1UDLA 2K57A 4BD3A 3CMAA 2QASA 1M1KR 1GFDA 4RMOA 2XD0A 2DLPA 3A8OB 4C8QC 4JJDA 1VYTA 2JMAA 2VUBA 4KRTA 4C92C 1NJIU 2KYBA 1YJNA 3PGGA 4O6JA 2G3RA 1S1NA 2X3WD 2K5IA 2D0QB 2QQ9A 2LQ8A 1Z9ZA 2V1QA 1H92A 4F7UE 1UB4A 3X20B 1KG1A 1MV0B 1IHWA 1OEBA 4M75C 3G4SA 3L1AA 5GMKl 5GAOq 2QDLA 4OMOA 2CT4A 4FYWB 2RM4A 1FYNA 4LUDA 3VUZA 2F1LA 3GNFB 3I56T 2GBQA 3OQ5A 1QVFA 2NUTB 2OAWA 2RD1A 4F14A 1PWTA 1SF9A 3OS5A 4XU0A 3TREA 1SRMA 1TG0A 3CCET 4J8OA 2ATCB 1ZUKA 1YNZA 5D6XA 2KK4A 3CC7Q 3J7AF 4RTUA 1I1JA 3VS5A 4M7DB 1FXXA 5GAN8 2LC4A 4J9BA 3GP8A 3CCJQ 1W2BS 4ZN3A 3GIBA 4MZPA 1Y71A 2DM1A 1Y7XA 1W1FA 3G6EQ 2EWNA 3OS0A 1IO6A 2DIQA 4M77D 1D3BA 3WXMB 3OYJA 4DBHA 3JRZA 4HCBA 1NE8A 1WHMA 2KRMA 1Y07A 2ZPIB 4BE0A 4RTXA 2FEIA 1VQPQ 3EGDB 4JS5A 1YI2Q 2A28A 2LP5A 4KGVB 4XTWA 3X24B 3DB3A 6AT1B 1NEGA 2PNIA 2KROA 4OMMA 2BZXA 2RK1A 1K8AC 2HKQB 2L89A 5FRMA 4XU3A 3OYKA 3CCUQ 1ACMB 2AZVA 5KYUA 2HD0A 4OB2B 3VV0A 3OYLA 2O31A 5A2QE 5GAMg 3CD6A 1LVKA 4E2FB 1KC8R 1G3YA 1OPKA 4F7UG 2B8AA 4XK8E 4IKFA 3H9NA 3QKJA 1KHIA 1G2BA 2ROTA 1YCYA 1NBEB 3CC2T 1QVGA 5LJ3j 2DEQA 4C92B 2F2XA 2AIRB 4QKUA 1BBZA 3OY9A 1VQ7A 5GAMh 4A53A 1QLYA 3TVTA 2AKLA 3P8BB 1AWXA 4C0DC 3CC4T 3HFOA 4WF2A 3H8ZA 1NYGA 3CCMQ 3HTRA 3MP1A 5D6YA 1YBYA 3LGFA 1UHCA 2FZCB 4RCBA 4M7DF 3FRNA 3JV3A 2LCLA 2CP5A 2YSQA 4ELYC 2K79A 3MJXA 1G83A 3QUIA 4C0GA 2F2VA 5A0DA 4FT2A 1Y0MA 1BB9A 3SDZA 2K2VA 1BI2A 4M77G 2CZ0B 1BKBA 2PVOB 1VQ6T 2LX9A 2DZ9A 3M57A 1Q82R 3Q1JA 3V8KA 1VQ4T 2EIFA 3UWNA 1SPKA 3ULRB 4F04B 4JZ4A 5GAOp 2OTLA 3VYHB 3L2UA 2GQIA 1MV3A 1LNXA 3ZFJA 2DVEA 4E47A 4AFQC 2DPPB 1B7TA 2CGHA 3QZ5B 2QYZA 2L3PA 5KH6A 4L5GA 1O75A 4F17A 3LYIA 3EH2A 5KYWA 1VQMA 1JJ2S 2YRVA 2VVKA 4NL2A 3C95A 3EGXA 4HCZA 4C8QD 4C92D 2GFAA 2QXFA 2YUNA 2CT3A 2DKGA 2EGEA 4FSXA 3VS4A 2J06A 4RTYA 1VYVA 1U8RA 2RF0A 3CXCP 2E5KA 1BU1A 1M90R 2GTOA 3OYCA 1C0MA 4PJOA 4EMKB 3NTKA 2J7IA 4JLIA 2EGCA 2W0ZA 4M75D 2MI6A 2GTJA 1S72Q 1VQ9T 1VQLT 3QO3A 1MUZA 1ZQ1A 3RBBB 3M0UA 2ABLA 2CUBA 4DEXA 1X6GA 1GFCA 5J3BA 4XTVA 1M1FA 1M5Q1 2DYIA 3M5AA 1M4ZA 4C5EA 3CMAQ 1JXOA 4DBQA 3SWNC 2CP0A 5CQXA 4X34A 3JCMW 1YJNQ 2DNUA 4JUVA 2X9HA 1QWFA 2EBPA 2D8HA 5LJ3f 1N8RU 4LXCA 5I2SA 4IUQA 3D7SB 3OB9A 1E6HA 2M9UA 3R6NA 4A4FA 1AWOA 2LDMA 3PFSA 2YHTA 1PSFA 3G4SQ 4LD9K 5D6WA 3CMET 3T9NA 3CPWS 3PMTA 4J7IA 1UGVA 2QGGA 2XDDA 4A4EA 1K9MC 5EG2A 2MWPA 3JB9I 3X26B 1T0JA 1WNLA 5GMKi 5GAN6 3OA6A 1SHGA 3WVEB 3CCJA 4ZGJB 3OS2A 3LW5E 1PRLC 3RKWA 4XTZA 2HQHA 2LQWA 1UGQB 1AD5A 3SB2A 4GLMA 2KEAA 5EC7A 4ANJA 2GFUA 3EG2A 2YDLA 4ZGEB 2DE0X 3UF4A 1UUEA 2CSIA 2EYWA 3OYMA 2HNIA 2E70A 2ZPEB 3FDRA 5GAMj 2E10A 1VQPA 3HL8A 1YI2A 1QP2A 4M75G 1VQ5Q 2KYMA 1KD1U 1CKBA 1BIBA 4HCKA 3GNGA 3M0PA 1V29B 4KH1B 1VIFA 3MPUB 1TS9A 3CCUA 3TQ7P 1N9RA 3LX7A 1JJ2A 5GJVB 2AKKA 2FZKB 3G1JA 2P0KA 3UATA 2CZ7B 3QZ9B 1AZGB 1WI7A 3URGA 8AT1B 1NM7A 3DB4A 5GANd 1UGSB 3EFOA 4WCIA 2H3JA 5CKBA 2EYYA 3QDRB 2QQAA 2EQIA 3OYAA 1WJSA 1WHGA 1R0CB 2NWMA 1Q81C 2IVWA 2LQNA 1X27A 1NLOC 4Y91A 2JW4A 2E4HA 2RMOA 1NZ9A 3JCMh 4BY6C 4AMCA 1LPLA 2RO0A 3TU4K 1YJWA 1OU9A 4A63B 2RI2A 2KRSA 4M7AB 2BZ8A 4J6XA 3CCMA 1KK7A 3OYBA 2RNAA 3QYHB 1OYXA 4BE2A 1EFNA 2EQMA 1UE9A 3SWNB 4X1VA 3ZBDA 1ARKA 2YLCA 5HKCA 2NYSA 2LNHB 4MZTA 1VQ7Q 1G8XA 2I2LA 5ECAA 2EQJA 2KQWA 4J9IA 4DOWA 1WHKA 5IT9E 3GBQA 1T3LA 1ZSZA 4II1A 1Q7YC 2L3SA 3EHQA 4JJNK 1WJRA 1BI1A 3I5RA 5LJ3e 3H0HA 3EAEA 1UGPB 3CPWA 3ASKA 5GANg 1WYXA 3CBPA 1I8FA 3QXEB 5IHNA 1TH7A 4Q5WA 4KH0B 4F7UB 4C5IA 5GAN5 2E65A 5GMKj 3CCSA 3CD6T 4PFOA 3JCMQ 2M0YA 1VQKA 1HJDA 5FU6C 3HRUA 1K9AA 1WQ7A 1WXUA 5DY9A 2D9TA 2RHXA 5GANh 2O4XB 4J9GA 1RAIB 2DO3A 3CCQQ 2CH4W 3FEOA 1E6GA 3M0SA 2E12A 2M02A 3E19A 2CP7A 5GAMf 1ZUYA 7AT1B 4EMGA 3MP8A 3G71Q 1VQMQ 4OMNA 2XI9A 1WXBA 1S72A 4O5VA 3PTAA 2A37A 1RABB 2FYKA 4M7AF 1RAGB 4QT7A 2EJ9A 4LD6A 2D6FA 2JTMA 5C6SA 2VXEA 3J81E 3QPHA 1XNIA 4KBMB 4M77B 2K5FA 4M78F 4FSSA 3CQTA 3M0RA 3RKYA 5CKDA 2DBMA 4IUUA 1I07A 3VRYA 4C5HA 2VASA 2LJ3A 4Z8AA 3EG9A 2P84A 4HA8A 1M8MA 4IURA 5IHIA 4P5NA 1MMGA 2RH2A 4HVUA 2LVMA 1WFWA 1WPYA 2RHYA 1MHNA 4BY6B 4RTZA 2QA4T 1XTDA 3M54A 1YITQ 1GBRA 2Z0WA 3L2WA 3FJ5A 3OMCA 2HKNA 1QVFP 1Y57A 2W10A 2OTLT 4FL6A 3S3OA 4J9DA 3V8LA 2HZYA 4QVZA 1YN8A 2HBPA 1YCSB 4F7UF 2H8HA 1OZ2A 5KYXB 4RUGA 1VQNQ 2OJ2A 4OVAA 1M1KU 3M4GA 2JTFA 2QQSA 1D1BA 4R56A 1Q86C 1CSKA 2JNGA 1AT1B 1H8KA 3PNWC 3C94A 5FLXE 1NPRA 1K9MR 4AFSC 1PNJA 4ZTJA 3MEUA 1FMKA 1K73C 1ZA1B 2OX7A 2PUOB 2WSCE 2M0OA 1AVZC 4B9WA 2RPNA 3HKSA 1PC0A 2LX7A 4J5YA 2H3EB 2SRCA 1IGUA 5CKHA 2ZPHB 5J26A 4PNOA 3OW2P 1VQ5A 2O88A 4QVCA 2LQKA 1WHJA 1K4US 1WHLA 1ABOA 1B34A 1IZ6A 2DJZA 2ZPGB 1GXIE 2ZAEA 5FU6B 1MMAA 2NUPB 1YIJQ 2KXCA 5J39A 4JDSA 3EG3A 2KT1A 4ME7A 4M77F 2A08A 3TSWA 4M78A 2VYTA 3M56A 2XKOC 4HVVA 4FT4A 2DTHA 4AG1C 2KT8A 4PKCC 1RACB 2DX1A 2MPXC 2O2OA 3H6ZA 2VC8A 4JPBW 4OMPA 2JM8A 1QVGP 1Y96B 1I81A 1X75C 3MEVA 1IXDA 3IQLA 3EFRA 2AK5A 3RMSA 1G3WA 3VS1A 3L2RA 1B3QA 2V8KA 1IRXA 2DXCA 1UG1A 3CC7T 3EGUA 2MCNA 4OMLA 2E5QA 4C8QB 3CXCS 1BIAA 5IXFA 1C6VX 2K3YA 1PKTA 3CCJT 4N0AA 4DOVA 4RKUE 2JT4A 2CYZB 2WACA 3EG0A 1SEMA 2HCKA 4MDXA 4PJOE 3KFVA 3G6ET 1X01A 1YJWQ 4PJOD 3P8HA 1XJWB 5CCAA 4E7KA 1QCOA 1X2KA 3QJYA 2E64A 2J6OA 3I55A 1GBQA 4M75B 3KUFA 1RAAB 4A4GA 1HK9A 2OI3A 2KR3A 1U06A 2YUOA 1U3OA 2JUFA 3BDUA 5KYYA 1KC8U 4E7LA 4J7FA 1VQPT 1YI2T 2DMOA 3BE3A 2OTJA 3E1SA 4M7DE 3GLXA 4PJJA 5HK0A 1V1CA 1TOVA 3DKMA 5CKEA 1WX6A 3FB9A 4QQGA 3MHXA 3CCUT 1Q7YR 4DBRA 3CBOA 5I21A 5LJ5j 1E7OA 2EQKA 1M30A 2HDAA 3KBGA 4EMHA 3A8GB 1GCPA 3OYEA 1ABQA 2DD4A 3CCQA 3OYYA 4PJLA 5M9OA 5CQYA 1WA7A 1W2BA 1VA7A 2FZGB 2DERA 2K3BA 2ED1A 1D0XA 3CCSQ 4XQ3A 2KNBB 3SEMA 2E6NA 2EJFA 3SHWA 2AZSA 4KT0E 2P0QA 3G71A 1VQKQ 3N5BB 3JCMf 2KGTA 1ZSGA 2KMTA 1YJWT 3G7ZA 4QQ6A 1AWWA 4WTOB 1RLQC 1RAFB 3CCMT 1NJIC 3HRTA 4FCYA 4ZN1A 4L59A 1RL2A 2JJ9A 3VUBA 4OMFB 1G5VA 1Q82U 4C8QF 2VXFA 4XTUA 4C92F 5GMKe 2HSEB 3PIOA 2HEQA 5IXBA 4OGCA 5IAYA 2L3RA 2F2WA 4C0FA 1VQOQ 2NUTA 3I9QA 1RI9A 4PJOG 2J6FA 3OYDA 2M1HA 1HD3A 3JCMc 2FL7A 3OYNA 4M75F 3M0QA 2P4RA 4E7JA 2QEXQ 2L0AA 4E6RA 3JCMX 4JS4A 1FWZA 1YITA 1QKXA 2BUDA 1YJ9Q 4M7DA 3NGPA 3DLLA 1M2VB 1P92A 1T0HA 1VUBA 4UC4A 5GAOr 2VGNA 2JOYA 3HHTB 4EPCA 2RHUA 2B86A 5I2MA 3PIPA 2DETA 2D8JA 4C0DB 2F5TX 3CCST 1VQNA 1M90U 1U1SA 1YHQQ 3RNJA 5LL6S 3JCMb 2HMAA 2I0NA 2DL5A 1PM3A 3EGDA 3QHSA 4ORZA 3M0TA 2DVJA 2BTTA 4MMLA 4RG2A 3NFCA 2ECZA 3QWYA 5A0LA 2FPEA 5FWCA 1OZ3A 4KGXB 1VQ8A 1M1GA 2D0NA 1AOJA 1HXDA 3EHRA 1QCNA 4BI8B 4CRIA 2LT1A 1IB8A 2Y4XA 1H641 4DA4A 1TSFA 2DTIA 3VJPA 2XHCA 1KQSP 2DRMA 4A4KA 1M3CA 4A54A 2DTOA 2YRDA 4NS5A 1S72T 3JAME 4BE1A 3OSVA 4PLLA 4GBQA 2HQXA 2Y4YA 1D1AA 3CC2A 1Q95G 1YIJA 3PVQA 4PL6A 2XDPA 5LJ5f 4XTYA 1JEGA 2QQBA 1WXTA 2BE9B 4J9CA 1ZBJA 3CC4A 4J6YA 3CMAT 2P4TA 1JXMA 1OV3A 3VU3C 2JXBA 4XU1A 2AT1B 2KE9A 3ME9A 1YJNT 3VKIA 2VKNA 3TSZA 2BZYA 3HPWA 4L6V5 3EH1A 4JJCA 1RUWA 2QG9B 1VIEA 2MYSA 1LOJA 2CP6A 2R5MA 5CVIA 3CBMA 3M59A 2MK5A 3G4ST 5GJWB 2G6FX 1R8OB 3VYGA 1UECA 4B9XA 2QDYB 1M8VA 1D0YA 3JCMe 4RTWA 2QTVA 1K8AR 2QTXA 5LJ3d 3C0CA 1ZBXA 2K2MA 3NHNA 3O8VA 1KSWA 3VS7A 4PFZA 2MF2A 4RG8A 2C0IA 2CH4A 2M51A 1VQ4A 4ZNXA 3EG1A 2K6DA 1W70A 3GOXA 2JMCA 1EZZB 3MO8A 5KYNA 3HFNA 1JRIA 4A4HA 1KQ1A 3OS1A 4E7IA 3QYGB 4OB1B 1WZOA 2DEUA 1H3ZA 1D09B 5FWBA 4FIBA 4CC3A 1I0CA 1SG5A 4QW2A 1TTHB 2E3HA 3GF5A 3NMZC 2V1RA 2ZCFB 3OBWA 4IUVA 2MWOA 5GAOl 3M4YA 4Y92A 4J83A 3NPFA 1VQ5T 3CCRQ 2L5QA 2EYXA 4R55A 1K8AU 1D3BB 1PKSA 3FLGA 2GQVA 2RJCA 5HCKA 3CCVQ 2CS7A 3U23A 4LDVA 5FROA 5CK9A 1SSHA 3JB9D 3I55Q 1YFNA 3SD4A 1AZEA 2EFIA 4ATOA 3ZL7C 1QCFA 1ZLMA 3M55A 3O5ZA 2OTJQ 1QVFS 4CI0C 1EIFA 1N6AA 4EMKA 2K9GA 4LDYA 4PJOC 1VQLA 5KYUB 3CCLQ 2ZZDA 2COZA 4X9CA 2M16A 2DL8A 1BCOA 4LN2A 5CR2A 2BKDN 1MNEA 2K5LA 2PVGB 1GCQA 1K0SA 3JSCA 1BCMA 2YUPA 2CZ6B 3PT9A 2EGAA 2MMPA 2E1HA 2EQUA 4M7DC 1C1AA 4OGEA 1VOMA 2GGRA 3GPLA 3OYHA 3QDFA 2FO0A 2NLUA 4GY5A 1OPLA 2RJDA 3P8DA 5LJ5e 1JBMA 1VQ7T 1DJ7B 1ZUUA 1RADB 5GAN3 2CP3A 2O9VA 4BUGA 3OW2S 1VQOA 1MMDA 2IPOB 2JTEA 3CMEA 2DILA 4KUDK 2MIOA 4MZMA 2EYZA 4LNPA 2RJEA 4M7AE 2DYBA 4MDWA 2ZPFB 2QEXA 3A1PA 3RUXA 2RHZA 2KAFA 1N8RC 3I56Q 4LDXA 2LNVA 3AT1B 4LDWA 1YJ9A 1NLPC 1LJOA 3CEYA 3V8JA 2RHIA 4M78E 2DA9A 2JS0A 2DL4A 4PJMA 3QWXX 4VUBA 2WSFE 3FJPA 3L42A 3CCEQ 3OMGA 3JB9G 4KGZB 3OYIA 1GRIA 1QMCA 1QVGS 1H3HA 1YHQA 2RQRA 3E9FA 4X9DA 1A0NB 5FU7C 1X2QA 2LCSA 5GAN2 4Z89A 5DLQE 1TUGB 2A0FB 3A8HB 5CO7A 1M27C 2LCCA 2CUDA 2QQRA 3CCQT 4QQDA 4RTTA 1WHHA 4JRPA 4J6WA 3CPFA 1SKUB 1PG5B 5KYWB 2L3QA 2XMFA 3REAB 3EGXB 3G71T 1VQMT 5GAOm 2IG0A 2FPFA 4IIOA 1X6OA 2KDSA 4M4ZA 2LT4A 2SEMA 1KD1C 5L8RE 3LGLA 3OBYA 3VS3A 5L23A 1KQ2A 4PJOB 2CZ1B 5GAMd 2PVDB 1VQ8Q 1J3TA 1K76A 1OOTA 4AFZC 2LRQA 3VS6A 1Z9QA 3C12A 1QKWA 4AG2C 5A0GA 2DK3A 4B6MA 3E9GA 4N4IA 5KCOA 2Y90A 1UTIA 1FX7A 4CC2A 1D1CA 4M7AA 2XU8A 4OMQA 3UDCA 4D6WA 3CC2Q 4XAXB 2NUZA 4HT8A 1YITT 4KUIA 4M7AG 3NTHA 1N9SA 2KRNA 2LTOA 3SWNA 2DL7A 1O9SA 5FW9A 3RERA 1OULA 3CC4Q 1FMWA 5CIUA 4M77E 3A5ZB 2V8IA 3I35A 1K9MU 5HY6A 4M78G 4D8KA 1KFZA 2E3IA 1W6XA 4YTLA 2FVUA 1ZSZC 2GF7A 3UA6A 5HK3A 3KXTA 1VQNT 3HRSA 3RKXA 1UJ0A 3RMQA 1OX9A 3H0FA 3OW2A 2LJ0A 2JM9A 2XG8D 1JU5C 5GAMe 2V26A 4MMKA 5KCHA 2IIMA 2RB6A 4EMKC 2JVVA 4OF1A 1M2OA 3H0IA 4J9FA 1VQ8T 1VQ6Q 1AEYA 4F7UA 2PZ1A 2YWWA 1Q81R 3M58A 4RTVA 3META 1YWPA 4BACA 2XICA 2FRWA 5I22A 1VQ4Q 3CCRA 4C5GA 2MOXA 2X4XA 1GCQC 8ATCB 1MMNA 1SRLA 3CCVA 1KJWA 5GANj 1R0BG 2R57A 5FU7B 2RQWA 1MNDA 1YIJT 1QP3A 4IUTA 2O4XA 4DEYA 2EVRA 2HL5C 4PJOF 3QSUA 3UA7A 1BI0A 2CDTA 3M53A 3VRZA 3JCMP 2CSQA 3V7CA 4CC7A 4E7SA 2C06A 1G3SA 1EX4A 3BFMA 4BDZA 1UHFA 3CCLA 4M7DD 3MKDA 3RDVA 2YLBA 1XQHA 3JCMJ 2R5AA 5DM7R 3V7RA 2KY9A 1Q81U 3A8LB 3MEWA 1ZX6A 2RJFA 2K3XA 4JLGA 1W2BP 2DXBA 4FYVB 2RN8A 2HL3A 1JB0E 3EFOB 4M77A 4OB3B 1N27A 4FW1A 5GMKm 5GAOn 1HYOA 1VQ9Q 1VQLQ 2CKKA 4BDYA 2X3XD 1B07A 2XIDA 2LMJA 1WIEA 2QA4A 1D0ZA 2ESWA 3RESA 1UFFA 1PSEA 3A8MB 3BDLA 1G3TA 1PCXA 3L2ZA 3PE0A 1KQSS 5CKFA 4XU2A 5I11A 4BB7A 2RQVA 2RQTA 1Q7YU 5IH2A 3INZA 4IUPA 4AFUC 2XDBA 2ZPBB 1M3AA 4HXJA 2RK2A 1I5OB 1IREB 2KVQG 5KYXA 3I56A 2HSPA 4C8QE 3SFMA 1ZSZB 4C92E 4J9EA 2C0OA 3HSBA 1N5ZA 1UEBA 4HKEA 1CKAA 2FG0A 3CMEQ 5C0MA 3CCEA 2E6ZA 1BYMA 4N4HA 4JRIA 4JRKA 2EKOA 4NL3A 1N8RR 1M9SA 4M75E 3REBB 2DD5A 4OB0B 3UPUA 1WGSA 4OP0A 1NG2A 9ATCB 5KE3A 1M1KC 4HCCA 2XK0A 1W4SA 1OU8A 2HQEA 3BY7A 1UGRB 1WQWA 4M7DG 2X35A 3CXCA 2EPDA 3L2VA 3PMIA 5AYFA 4FYYB 2RQUA 3BW1A 5GMKh 1TWBA 3FC3A 1IHVA 2NUPA 4M7AC 3F70A 3MP6A 1OQKA 2PTKA 1VQKT 1QQJA 4E7HA 4LDUA 1PRMC 2PU9B 1WJQA 1UJYA 2K7AA 4M78C 4IIMA 5GANf 1RI0A 2K4YA 2A36A 1BI3A 4R0KA 1QWEA 2X51A 4LE9A 2QGFB 1JO8A 3LH0A 4JRQA 1R77A 4JZ3A 1TXQA 2DXTA 2ENMA 2DJQA 4NOYA 3JCMd 2X4JA 1ZHIA 1Y96A 1VQOT 1Q86R 1V76A 3DLMA 1KD1R 2DFUA 5D7UA 5IHKA 3TEEA 3L2QA 4Z88A 3CC7A 2QI2A 1NYFA 1ZA2B 1K73R 3FIFA 2DL3A 2FPDA 2QEXT 1TUDA 2KXDA 3J80E 2CREA 4PFPA 2EW3A 3OSSC 4C8QA 1YJ9T 1OX8A 4C92A 3EG9B 1JJ2P 4ESRA 4N4GA 3LWIA 4JJBA 2JS2A 2QAZA 2LZ6B 3G6EA 4C8QG 5FRNA 4C92G 4N0AC
chains in the Genus database with same CATH topology
1ABOA 3THKA 3I5SA 2FRYA 4AFQC 1GL5A 2GGRA 2KBTA 2FO0A 1X6BA 2L3PA 2KXCA 1OPLA 3PVLA 3EG3A 4F16A 2KT1A 1K1ZA 4F17A 1RLPC 1AWJA 2A08A 1ZUUA 1XOVA 3TSWA 1T3SA 2VVKA 4HVVA 2O9VA 4AG1C 2JTEA 2KT8A 2DX1A 2O2OA 2HBWA 2YUNA 2CT3A 2DILA 2EGEA 2MIOA 3VS4A 2EYZA 4LNPA 2J06A 4RTYA 1VYVA 4JPBW 2RF0A 4OMPA 2DYBA 2JM8A 1SHFA 2E5KA 1BU1A 2GTOA 3IQLA 1NLPC 4EIKA 2J7IA 2EGCA 2W0ZA 2AK5A 2ED0A 2DA9A 2JS0A 1PHTA 2GTJA 2DL4A 3VS1A 3H41A 1U5SA 1B3QA 3QWXX 4LUEA 2O9SA 1MUZA 3RBBB 1UG1A 2ROLA 2ABLA 1GRIA 3EGUA 3M0UA 4OMLA 2CUBA 2MCNA 5IXFA 4DEXA 1X6GA 1H3HA 1GFCA 1PKTA 2RQRA 1A0NB 1KIKA 2JT4A 1X2QA 2GNCA 3EG0A 2LCSA 1SEMA 2HCKA 4Z89A 3KFVA 1TUCA 1JXOA 1M27C 2CUDA 2YUQA 4RTTA 1X2KA 2DNUA 2J6OA 1GBQA 1QWFA 2EBPA 2D8HA 2YT6A 2L3QA 2KR3A 1U06A 2OI3A 1YP5A 1U3OA 2YUOA 1K0XA 1E6HA 3R6NA 2XMFA 3REAB 1AWOA 4J9HA 2DMOA 2EKHA 2FPFA 4IIOA 1V1CA 4M4ZA 2SEMA 1WX6A 1HSQA 1YWOA 1LCKA 1UGVA 3VS3A 5L23A 2VWFA 1JQQA 1T0JA 2J6KA 1E7OA 1J3TA 1M30A 1SHGA 1K76A 3VS2A 2HDAA 1OOTA 4AFZC 1WDXA 3VS6A 1GCPA 1PRLC 1Z9QA 1QKWA 4AG2C 1X69A 1ABQA 2LQWA 2L2PA 1AD5A 1UTIA 1WLPB 4GLMA 4CC2A 2KEAA 5EC7A 3EG2A 2YDLA 4OMQA 1WA7A 2DE0X 1VA7A 3UF4A 2K3BA 1UUEA 2CSIA 2ED1A 2EYWA 2NUZA 4CC4B 3LH5A 2KNBB 1NEBA 3SEMA 3SHWA 2KRNA 2AZSA 1M3BA 2DL7A 5FW9A 2KYMA 2KGTA 1ZSGA 1CKBA 4HCKA 3I35A 1AWWA 1RLQC 3M0PA 4D8KA 1KFZA 1W6XA 3UA6A 1X43A 4HVWA 1BK2A 1UJ0A 2C0TA 5GJVB 2DRKA 3H0FA 2AKKA 2HEQA 1VYUA 2D1XA 2LJ1A 2LJ0A 4K11A 5IXBA 2JM9A 3UATA 1JU5C 1K4US 1AZGB 1WI7A 2DF6A 2DBKA 2F2WA 1NM7A 3I9QA 1RI9A 2IIMA 2J6FA 4WCIA 1HD3A 2EYYA 3H0IA 2J05A 4J9FA 2EQIA 3M0QA 2P4RA 1AEYA 2L0AA 2NWMA 2PZ1A 4D8DA 4E6RA 3A98A 4RTVA 3VS0A 1YWPA 1QKXA 2FRWA 3NGPA 2LQNA 5I22A 1X27A 1NLOC 1UDLA 1GFDA 2JW4A 2RMOA 2MOXA 2DLPA 4JJDA 1VYTA 2JMAA 4KRTA 1GCQC 1T0HA 4A63B 1SRLA 2KRSA 1KJWA 2KYBA 2BZ8A 2RQWA 2B86A 2RNAA 1S1NA 4DEYA 2D8JA 2EVRA 2X3WD 1EFNA 1UE9A 1Z9ZA 4X1VA 3UA7A 2CDTA 2V1QA 3RNJA 1ARKA 1H92A 2LNHB 1MV0B 2I0NA 2DL5A 3VRZA 1OEBA 5ECAA 2CSQA 4J9IA 4CC7A 3GBQA 1T3LA 1UHFA 4ORZA 3M0TA 2QDLA 2DVJA 4OMOA 2CT4A 2BTTA 2L3SA 2ECZA 3EHQA 3QWYA 2FPEA 5FWCA 1FYNA 4LUDA 3I5RA 1ZX6A 2D0NA 1AOJA 3H0HA 2GBQA 3EHRA 2OAWA 2RN8A 4F14A 1PWTA 2DRMA 1M3CA 1WYXA 4GBQA 5IHNA 1SRMA 1TG0A 1ZUKA 1YNZA 2X3XD 1B07A 2LMJA 1WIEA 3PVQA 4RTUA 1I1JA 3VS5A 1JEGA 2ESWA 4J9BA 1WXTA 2M0YA 1UFFA 4J9CA 1HJDA 1ZBJA 2DM1A 1K9AA 1JXMA 3PE0A 1WXUA 1OV3A 1W1FA 2JXBA 5I11A 2RQVA 2RQTA 4J9GA 2KE9A 1IO6A 5IH2A 2CH4W 1E6GA 2VKNA 4AFUC 3TSZA 3M0SA 2BZYA 1M3AA 4HXJA 4JJCA 2KRMA 1RUWA 4RTXA 1ZUYA 2FEIA 2HSPA 2A28A 4J9EA 4OMNA 2LP5A 5GJWB 2C0OA 2G6FX 1N5ZA 1WXBA 1UECA 1CKAA 1NEGA 2A37A 4RTWA 2FG0A 2PNIA 2KROA 4OMMA 2BZXA 4QT7A 3C0CA 2AZVA 2K2MA 3NHNA 1KSWA 3VS7A 2O31A 2C0IA 3REBB 2CH4A 2M51A 3CQTA 4FSSA 3M0RA 4ZNXA 3EG1A 1NG2A 2K6DA 1W70A 2DBMA 2JMCA 1I07A 3VRYA 1OPKA 2LJ3A 4Z8AA 1M8MA 1G2BA 5IHIA 2ROTA 4HVUA 2EPDA 1WFWA 5FWBA 2RQUA 2F2XA 4RTZA 4CC3A 1I0CA 3NMZC 1BBZA 2V1RA 1GBRA 2PTKA 3FJ5A 1QLYA 4Y92A 3TVTA 2AKLA 3NPFA 1AWXA 1Y57A 1PRMC 2W10A 2EYXA 1UJYA 2K7AA 1PKSA 1NYGA 4J9DA 5HCKA 4IIMA 3U23A 2A36A 1YN8A 4R0KA 1QWEA 1YCSB 2H8HA 4LE9A 1SSHA 1JO8A 1UHCA 4RUGA 4JZ3A 2OJ2A 1AZEA 3JV3A 2ENMA 3ZL7C 2YSQA 2DJQA 2K79A 1G83A 1QCFA 2F2VA 1ZLMA 3O5ZA 1CSKA 1H8KA 1Y0MA 1BB9A 2K9GA 5IHKA 4AFSC 1PNJA 4Z88A 2DL8A 1NYFA 1FMKA 2DL3A 2FPDA 1TUDA 2KXDA 4LN2A 1AVZC 2CREA 2EW3A 2RPNA 1GCQA 2LX7A 4ESRA 2SRCA 1K0SA 4JJBA 2JS2A 1SPKA 2LZ6B 3ULRB 2YUPA 4JZ4A 2O88A 2EGAA 2GQIA 1MV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABO A;  3THK A;  3I5S A;  2FRY A;  4AFQ C;  1GL5 A;  2GGR A;  2KBT A;  2FO0 A;  1X6B A;  2L3P A;  2KXC A;  1OPL A;  3PVL A;  3EG3 A;  4F16 A;  2KT1 A;  1K1Z A;  4F17 A;  1RLP C;  1AWJ A;  2A08 A;  1ZUU A;  1XOV A;  3TSW A;  1T3S A;  2VVK A;  4HVV A;  2O9V A;  4AG1 C;  2JTE A;  2KT8 A;  2DX1 A;  2O2O A;  2HBW A;  2YUN A;  2CT3 A;  2DIL A;  2EGE A;  2MIO A;  3VS4 A;  2EYZ A;  4LNP A;  2J06 A;  4RTY A;  1VYV A;  4JPB W;  2RF0 A;  4OMP A;  2DYB A;  2JM8 A;  1SHF A;  2E5K A;  1BU1 A;  2GTO A;  3IQL A;  1NLP C;  4EIK A;  2J7I A;  2EGC A;  2W0Z A;  2AK5 A;  2ED0 A;  2DA9 A;  2JS0 A;  1PHT A;  2GTJ A;  2DL4 A;  3VS1 A;  3H41 A;  1U5S A;  1B3Q A;  3QWX X;  4LUE A;  2O9S A;  1MUZ A;  3RBB B;  1UG1 A;  2ROL A;  2ABL A;  1GRI A;  3EGU A;  3M0U A;  4OML A;  2CUB A;  2MCN A;  5IXF A;  4DEX A;  1X6G A;  1H3H A;  1GFC A;  1PKT A;  2RQR A;  1A0N B;  1KIK A;  2JT4 A;  1X2Q A;  2GNC A;  3EG0 A;  2LCS A;  1SEM A;  2HCK A;  4Z89 A;  3KFV A;  1TUC A;  1JXO A;  1M27 C;  2CUD A;  2YUQ A;  4RTT A;  1X2K A;  2DNU A;  2J6O A;  1GBQ A;  1QWF A;  2EBP A;  2D8H A;  2YT6 A;  2L3Q A;  2KR3 A;  1U06 A;  2OI3 A;  1YP5 A;  1U3O A;  2YUO A;  1K0X A;  1E6H A;  3R6N A;  2XMF A;  3REA B;  1AWO A;  4J9H A;  2DMO A;  2EKH A;  2FPF A;  4IIO A;  1V1C A;  4M4Z A;  2SEM A;  1WX6 A;  1HSQ A;  1YWO A;  1LCK A;  1UGV A;  3VS3 A;  5L23 A;  2VWF A;  1JQQ A;  1T0J A;  2J6K A;  1E7O A;  1J3T A;  1M30 A;  1SHG A;  1K76 A;  3VS2 A;  2HDA A;  1OOT A;  4AFZ C;  1WDX A;  3VS6 A;  1GCP A;  1PRL C;  1Z9Q A;  1QKW A;  4AG2 C;  1X69 A;  1ABQ A;  2LQW A;  2L2P A;  1AD5 A;  1UTI A;  1WLP B;  4GLM A;  4CC2 A;  2KEA A;  5EC7 A;  3EG2 A;  2YDL A;  4OMQ A;  1WA7 A;  2DE0 X;  1VA7 A;  3UF4 A;  2K3B A;  1UUE A;  2CSI A;  2ED1 A;  2EYW A;  2NUZ A;  4CC4 B;  3LH5 A;  2KNB B;  1NEB A;  3SEM A;  3SHW A;  2KRN A;  2AZS A;  1M3B A;  2DL7 A;  5FW9 A;  2KYM A;  2KGT A;  1ZSG A;  1CKB A;  4HCK A;  3I35 A;  1AWW A;  1RLQ C;  3M0P A;  4D8K A;  1KFZ A;  1W6X A;  3UA6 A;  1X43 A;  4HVW A;  1BK2 A;  1UJ0 A;  2C0T A;  5GJV B;  2DRK A;  3H0F A;  2AKK A;  2HEQ A;  1VYU A;  2D1X A;  2LJ1 A;  2LJ0 A;  4K11 A;  5IXB A;  2JM9 A;  3UAT A;  1JU5 C;  1K4U S;  1AZG B;  1WI7 A;  2DF6 A;  2DBK A;  2F2W A;  1NM7 A;  3I9Q A;  1RI9 A;  2IIM A;  2J6F A;  4WCI A;  1HD3 A;  2EYY A;  3H0I A;  2J05 A;  4J9F A;  2EQI A;  3M0Q A;  2P4R A;  1AEY A;  2L0A A;  2NWM A;  2PZ1 A;  4D8D A;  4E6R A;  3A98 A;  4RTV A;  3VS0 A;  1YWP A;  1QKX A;  2FRW A;  3NGP A;  2LQN A;  5I22 A;  1X27 A;  1NLO C;  1UDL A;  1GFD A;  2JW4 A;  2RMO A;  2MOX A;  2DLP A;  4JJD A;  1VYT A;  2JMA A;  4KRT A;  1GCQ C;  1T0H A;  4A63 B;  1SRL A;  2KRS A;  1KJW A;  2KYB A;  2BZ8 A;  2RQW A;  2B86 A;  2RNA A;  1S1N A;  4DEY A;  2D8J A;  2EVR A;  2X3W D;  1EFN A;  1UE9 A;  1Z9Z A;  4X1V A;  3UA7 A;  2CDT A;  2V1Q A;  3RNJ A;  1ARK A;  1H92 A;  2LNH B;  1MV0 B;  2I0N A;  2DL5 A;  3VRZ A;  1OEB A;  5ECA A;  2CSQ A;  4J9I A;  4CC7 A;  3GBQ A;  1T3L A;  1UHF A;  4ORZ A;  3M0T A;  2QDL A;  2DVJ A;  4OMO A;  2CT4 A;  2BTT A;  2L3S A;  2ECZ A;  3EHQ A;  3QWY A;  2FPE A;  5FWC A;  1FYN A;  4LUD A;  3I5R A;  1ZX6 A;  2D0N A;  1AOJ A;  3H0H A;  2GBQ A;  3EHR A;  2OAW A;  2RN8 A;  4F14 A;  1PWT A;  2DRM A;  1M3C A;  1WYX A;  4GBQ A;  5IHN A;  1SRM A;  1TG0 A;  1ZUK A;  1YNZ A;  2X3X D;  1B07 A;  2LMJ A;  1WIE A;  3PVQ A;  4RTU A;  1I1J A;  3VS5 A;  1JEG A;  2ESW A;  4J9B A;  1WXT A;  2M0Y A;  1UFF A;  4J9C A;  1HJD A;  1ZBJ A;  2DM1 A;  1K9A A;  1JXM A;  3PE0 A;  1WXU A;  1OV3 A;  1W1F A;  2JXB A;  5I11 A;  2RQV A;  2RQT A;  4J9G A;  2KE9 A;  1IO6 A;  5IH2 A;  2CH4 W;  1E6G A;  2VKN A;  4AFU C;  3TSZ A;  3M0S A;  2BZY A;  1M3A A;  4HXJ A;  4JJC A;  2KRM A;  1RUW A;  4RTX A;  1ZUY A;  2FEI A;  2HSP A;  2A28 A;  4J9E A;  4OMN A;  2LP5 A;  5GJW B;  2C0O A;  2G6F X;  1N5Z A;  1WXB A;  1UEC A;  1CKA A;  1NEG A;  2A37 A;  4RTW A;  2FG0 A;  2PNI A;  2KRO A;  4OMM A;  2BZX A;  4QT7 A;  3C0C A;  2AZV A;  2K2M A;  3NHN A;  1KSW A;  3VS7 A;  2O31 A;  2C0I A;  3REB B;  2CH4 A;  2M51 A;  3CQT A;  4FSS A;  3M0R A;  4ZNX A;  3EG1 A;  1NG2 A;  2K6D A;  1W70 A;  2DBM A;  2JMC A;  1I07 A;  3VRY A;  1OPK A;  2LJ3 A;  4Z8A A;  1M8M A;  1G2B A;  5IHI A;  2ROT A;  4HVU A;  2EPD A;  1WFW A;  5FWB A;  2RQU A;  2F2X A;  4RTZ A;  4CC3 A;  1I0C A;  3NMZ C;  1BBZ A;  2V1R A;  1GBR A;  2PTK A;  3FJ5 A;  1QLY A;  4Y92 A;  3TVT A;  2AKL A;  3NPF A;  1AWX A;  1Y57 A;  1PRM C;  2W10 A;  2EYX A;  1UJY A;  2K7A A;  1PKS A;  1NYG A;  4J9D A;  5HCK A;  4IIM A;  3U23 A;  2A36 A;  1YN8 A;  4R0K A;  1QWE A;  1YCS B;  2H8H A;  4LE9 A;  1SSH A;  1JO8 A;  1UHC A;  4RUG A;  4JZ3 A;  2OJ2 A;  1AZE A;  3JV3 A;  2ENM A;  3ZL7 C;  2YSQ A;  2DJQ A;  2K79 A;  1G83 A;  1QCF A;  2F2V A;  1ZLM A;  3O5Z A;  1CSK A;  1H8K A;  1Y0M A;  1BB9 A;  2K9G A;  5IHK A;  4AFS C;  1PNJ A;  4Z88 A;  2DL8 A;  1NYF A;  1FMK A;  2DL3 A;  2FPD A;  1TUD A;  2KXD A;  4LN2 A;  1AVZ C;  2CRE A;  2EW3 A;  2RPN A;  1GCQ A;  2LX7 A;  4ESR A;  2SRC A;  1K0S A;  4JJB A;  2JS2 A;  1SPK A;  2LZ6 B;  3ULR B;  2YUP A;  4JZ4 A;  2O88 A;  2EGA A;  2GQI A;  1MV3 A; 
#chains in the Genus database with same CATH topology
 3X28 B;  3THK A;  3I5S A;  2FRY A;  1GL5 A;  2COY A;  2JZ2 A;  2X4W A;  5GAN 7;  2VGM A;  2KBT A;  3C4S A;  1X6B A;  1FMV A;  1OI1 A;  2RI5 A;  3PVL A;  4M75 A;  4F16 A;  1YHQ T;  3S3M A;  1K1Z A;  3LLR A;  1KHC A;  1AWJ A;  1RLP C;  1KQS A;  4FU6 A;  1Q86 U;  1XOV A;  1NPP A;  1T3S A;  3M9Q A;  4QVD A;  2YRC A;  1SSF A;  2EYQ A;  2HBW A;  1K73 U;  4PLI A;  3NTI A;  3QG1 A;  1VQ6 A;  2F69 A;  4BI4 A;  1SHF A;  1IGQ A;  1AHJ B;  5AT1 B;  3UT1 A;  3OYG A;  3JCM g;  4TVR A;  4DBF A;  4BI3 A;  4EIK A;  1KC8 C;  2ED0 A;  1PHT A;  2KI7 A;  3H41 A;  4M77 C;  1U5S A;  4LUE A;  2DZC A;  3RIR A;  2O9S A;  3WVD B;  4E7Z A;  2JN0 A;  2R58 A;  2ROL A;  5CAI A;  3HP9 A;  3CD6 Q;  4Z02 A;  2AHJ B;  2WSE E;  1KIK A;  1QVP A;  2GNC A;  1B34 B;  2V8J A;  5IN1 A;  1TUC A;  4Y28 E;  4DQ2 A;  2O01 E;  5GAN 4;  3CPW P;  3S3N A;  2YUQ A;  4EDU A;  2CP2 A;  5LJ5 d;  3E2U A;  4C0Z A;  5KE2 A;  2FB7 A;  2YT6 A;  1YP5 A;  4M78 B;  1K0X A;  4ZTF A;  4HT9 A;  4J9H A;  1F1B B;  3OYF A;  2BE7 D;  2EKH A;  2A3L A;  3JB9 F;  3QJ6 A;  3X25 B;  3QBY A;  1VQ9 A;  1HSQ A;  1I4K 1;  2DIG A;  1YWO A;  5DLO A;  5GAN e;  1LCK A;  5LJ3 g;  2MAM A;  1QW1 A;  1TU0 B;  4XTX A;  2VWF A;  1JQQ A;  3ZEH A;  2J6K A;  1Q82 C;  3VS2 A;  2RA2 A;  1WDX A;  3ER0 A;  1X69 A;  1U1T A;  2KSS A;  2L2P A;  2DAQ A;  2EJG A;  1M2V A;  2QK0 A;  1WLP B;  3LWH A;  2HAX A;  3QII A;  2P0P A;  2RI3 A;  2PQW A;  5LJ3 h;  2QA4 Q;  4CC4 B;  3LH5 A;  4ELZ C;  1NEB A;  3JB9 H;  3MCA B;  2BIV A;  2DXU A;  2PUK B;  1MGQ A;  2COW A;  1M3B A;  3CCR T;  2OAU A;  1PD1 A;  1RAH B;  2YXY A;  3S6W A;  2OTL Q;  1I5L A;  3CCV T;  2E41 A;  1NJI R;  2F5K A;  4PJN A;  2L8D A;  4V2S A;  2FHD A;  2X4Y A;  4ZGD B;  3I55 T;  5LJ5 g;  1X43 A;  3AHU A;  5KYY B;  4KUL A;  4HVW A;  3MEA A;  1BK2 A;  2C0T A;  2DRK A;  3JCM V;  1VYU A;  2D1X A;  2LJ1 A;  4K11 A;  2A7Y A;  4M7A D;  3JB9 J;  1M90 C;  1PD0 A;  2EAY A;  2OTJ T;  2VB6 A;  2DF6 A;  2DBK A;  4FYX B;  4FM4 B;  3CCL T;  4GLK A;  4FW2 A;  3RR6 A;  4M78 D;  3TCJ A;  3R6O A;  2J05 A;  3EFS A;  2GCX A;  4RCC A;  5LJ5 h;  4D8D A;  3A98 A;  3V7S A;  4PK4 A;  2ZGW A;  3VS0 A;  2VV5 A;  4AT1 B;  1RAE B;  1UDL A;  2K57 A;  4BD3 A;  3CMA A;  2QAS A;  1M1K R;  1GFD A;  4RMO A;  2XD0 A;  2DLP A;  3A8O B;  4C8Q C;  4JJD A;  1VYT A;  2JMA A;  2VUB A;  4KRT A;  4C92 C;  1NJI U;  2KYB A;  1YJN A;  3PGG A;  4O6J A;  2G3R A;  1S1N A;  2X3W D;  2K5I A;  2D0Q B;  2QQ9 A;  2LQ8 A;  1Z9Z A;  2V1Q A;  1H92 A;  4F7U E;  1UB4 A;  3X20 B;  1KG1 A;  1MV0 B;  1IHW A;  1OEB A;  4M75 C;  3G4S A;  3L1A A;  5GMK l;  5GAO q;  2QDL A;  4OMO A;  2CT4 A;  4FYW B;  2RM4 A;  1FYN A;  4LUD A;  3VUZ A;  2F1L A;  3GNF B;  3I56 T;  2GBQ A;  3OQ5 A;  1QVF A;  2NUT B;  2OAW A;  2RD1 A;  4F14 A;  1PWT A;  1SF9 A;  3OS5 A;  4XU0 A;  3TRE A;  1SRM A;  1TG0 A;  3CCE T;  4J8O A;  2ATC B;  1ZUK A;  1YNZ A;  5D6X A;  2KK4 A;  3CC7 Q;  3J7A F;  4RTU A;  1I1J A;  3VS5 A;  4M7D B;  1FXX A;  5GAN 8;  2LC4 A;  4J9B A;  3GP8 A;  3CCJ Q;  1W2B S;  4ZN3 A;  3GIB A;  4MZP A;  1Y71 A;  2DM1 A;  1Y7X A;  1W1F A;  3G6E Q;  2EWN A;  3OS0 A;  1IO6 A;  2DIQ A;  4M77 D;  1D3B A;  3WXM B;  3OYJ A;  4DBH A;  3JRZ A;  4HCB A;  1NE8 A;  1WHM A;  2KRM A;  1Y07 A;  2ZPI B;  4BE0 A;  4RTX A;  2FEI A;  1VQP Q;  3EGD B;  4JS5 A;  1YI2 Q;  2A28 A;  2LP5 A;  4KGV B;  4XTW A;  3X24 B;  3DB3 A;  6AT1 B;  1NEG A;  2PNI A;  2KRO A;  4OMM A;  2BZX A;  2RK1 A;  1K8A C;  2HKQ B;  2L89 A;  5FRM A;  4XU3 A;  3OYK A;  3CCU Q;  1ACM B;  2AZV A;  5KYU A;  2HD0 A;  4OB2 B;  3VV0 A;  3OYL A;  2O31 A;  5A2Q E;  5GAM g;  3CD6 A;  1LVK A;  4E2F B;  1KC8 R;  1G3Y A;  1OPK A;  4F7U G;  2B8A A;  4XK8 E;  4IKF A;  3H9N A;  3QKJ A;  1KHI A;  1G2B A;  2ROT A;  1YCY A;  1NBE B;  3CC2 T;  1QVG A;  5LJ3 j;  2DEQ A;  4C92 B;  2F2X A;  2AIR B;  4QKU A;  1BBZ A;  3OY9 A;  1VQ7 A;  5GAM h;  4A53 A;  1QLY A;  3TVT A;  2AKL A;  3P8B B;  1AWX A;  4C0D C;  3CC4 T;  3HFO A;  4WF2 A;  3H8Z A;  1NYG A;  3CCM Q;  3HTR A;  3MP1 A;  5D6Y A;  1YBY A;  3LGF A;  1UHC A;  2FZC B;  4RCB A;  4M7D F;  3FRN A;  3JV3 A;  2LCL A;  2CP5 A;  2YSQ A;  4ELY C;  2K79 A;  3MJX A;  1G83 A;  3QUI A;  4C0G A;  2F2V A;  5A0D A;  4FT2 A;  1Y0M A;  1BB9 A;  3SDZ A;  2K2V A;  1BI2 A;  4M77 G;  2CZ0 B;  1BKB A;  2PVO B;  1VQ6 T;  2LX9 A;  2DZ9 A;  3M57 A;  1Q82 R;  3Q1J A;  3V8K A;  1VQ4 T;  2EIF A;  3UWN A;  1SPK A;  3ULR B;  4F04 B;  4JZ4 A;  5GAO p;  2OTL A;  3VYH B;  3L2U A;  2GQI A;  1MV3 A;  1LNX A;  3ZFJ A;  2DVE A;  4E47 A;  4AFQ C;  2DPP B;  1B7T A;  2CGH A;  3QZ5 B;  2QYZ A;  2L3P A;  5KH6 A;  4L5G A;  1O75 A;  4F17 A;  3LYI A;  3EH2 A;  5KYW A;  1VQM A;  1JJ2 S;  2YRV A;  2VVK A;  4NL2 A;  3C95 A;  3EGX A;  4HCZ A;  4C8Q D;  4C92 D;  2GFA A;  2QXF A;  2YUN A;  2CT3 A;  2DKG A;  2EGE A;  4FSX A;  3VS4 A;  2J06 A;  4RTY A;  1VYV A;  1U8R A;  2RF0 A;  3CXC P;  2E5K A;  1BU1 A;  1M90 R;  2GTO A;  3OYC A;  1C0M A;  4PJO A;  4EMK B;  3NTK A;  2J7I A;  4JLI A;  2EGC A;  2W0Z A;  4M75 D;  2MI6 A;  2GTJ A;  1S72 Q;  1VQ9 T;  1VQL T;  3QO3 A;  1MUZ A;  1ZQ1 A;  3RBB B;  3M0U A;  2ABL A;  2CUB A;  4DEX A;  1X6G A;  1GFC A;  5J3B A;  4XTV A;  1M1F A;  1M5Q 1;  2DYI A;  3M5A A;  1M4Z A;  4C5E A;  3CMA Q;  1JXO A;  4DBQ A;  3SWN C;  2CP0 A;  5CQX A;  4X34 A;  3JCM W;  1YJN Q;  2DNU A;  4JUV A;  2X9H A;  1QWF A;  2EBP A;  2D8H A;  5LJ3 f;  1N8R U;  4LXC A;  5I2S A;  4IUQ A;  3D7S B;  3OB9 A;  1E6H A;  2M9U A;  3R6N A;  4A4F A;  1AWO A;  2LDM A;  3PFS A;  2YHT A;  1PSF A;  3G4S Q;  4LD9 K;  5D6W A;  3CME T;  3T9N A;  3CPW S;  3PMT A;  4J7I A;  1UGV A;  2QGG A;  2XDD A;  4A4E A;  1K9M C;  5EG2 A;  2MWP A;  3JB9 I;  3X26 B;  1T0J A;  1WNL A;  5GMK i;  5GAN 6;  3OA6 A;  1SHG A;  3WVE B;  3CCJ A;  4ZGJ B;  3OS2 A;  3LW5 E;  1PRL C;  3RKW A;  4XTZ A;  2HQH A;  2LQW A;  1UGQ B;  1AD5 A;  3SB2 A;  4GLM A;  2KEA A;  5EC7 A;  4ANJ A;  2GFU A;  3EG2 A;  2YDL A;  4ZGE B;  2DE0 X;  3UF4 A;  1UUE A;  2CSI A;  2EYW A;  3OYM A;  2HNI A;  2E70 A;  2ZPE B;  3FDR A;  5GAM j;  2E10 A;  1VQP A;  3HL8 A;  1YI2 A;  1QP2 A;  4M75 G;  1VQ5 Q;  2KYM A;  1KD1 U;  1CKB A;  1BIB A;  4HCK A;  3GNG A;  3M0P A;  1V29 B;  4KH1 B;  1VIF A;  3MPU B;  1TS9 A;  3CCU A;  3TQ7 P;  1N9R A;  3LX7 A;  1JJ2 A;  5GJV B;  2AKK A;  2FZK B;  3G1J A;  2P0K A;  3UAT A;  2CZ7 B;  3QZ9 B;  1AZG B;  1WI7 A;  3URG A;  8AT1 B;  1NM7 A;  3DB4 A;  5GAN d;  1UGS B;  3EFO A;  4WCI A;  2H3J A;  5CKB A;  2EYY A;  3QDR B;  2QQA A;  2EQI A;  3OYA A;  1WJS A;  1WHG A;  1R0C B;  2NWM A;  1Q81 C;  2IVW A;  2LQN A;  1X27 A;  1NLO C;  4Y91 A;  2JW4 A;  2E4H A;  2RMO A;  1NZ9 A;  3JCM h;  4BY6 C;  4AMC A;  1LPL A;  2RO0 A;  3TU4 K;  1YJW A;  1OU9 A;  4A63 B;  2RI2 A;  2KRS A;  4M7A B;  2BZ8 A;  4J6X A;  3CCM A;  1KK7 A;  3OYB A;  2RNA A;  3QYH B;  1OYX A;  4BE2 A;  1EFN A;  2EQM A;  1UE9 A;  3SWN B;  4X1V A;  3ZBD A;  1ARK A;  2YLC A;  5HKC A;  2NYS A;  2LNH B;  4MZT A;  1VQ7 Q;  1G8X A;  2I2L A;  5ECA A;  2EQJ A;  2KQW A;  4J9I A;  4DOW A;  1WHK A;  5IT9 E;  3GBQ A;  1T3L A;  1ZSZ A;  4II1 A;  1Q7Y C;  2L3S A;  3EHQ A;  4JJN K;  1WJR A;  1BI1 A;  3I5R A;  5LJ3 e;  3H0H A;  3EAE A;  1UGP B;  3CPW A;  3ASK A;  5GAN g;  1WYX A;  3CBP A;  1I8F A;  3QXE B;  5IHN A;  1TH7 A;  4Q5W A;  4KH0 B;  4F7U B;  4C5I A;  5GAN 5;  2E65 A;  5GMK j;  3CCS A;  3CD6 T;  4PFO A;  3JCM Q;  2M0Y A;  1VQK A;  1HJD A;  5FU6 C;  3HRU A;  1K9A A;  1WQ7 A;  1WXU A;  5DY9 A;  2D9T A;  2RHX A;  5GAN h;  2O4X B;  4J9G A;  1RAI B;  2DO3 A;  3CCQ Q;  2CH4 W;  3FEO A;  1E6G A;  3M0S A;  2E12 A;  2M02 A;  3E19 A;  2CP7 A;  5GAM f;  1ZUY A;  7AT1 B;  4EMG A;  3MP8 A;  3G71 Q;  1VQM Q;  4OMN A;  2XI9 A;  1WXB A;  1S72 A;  4O5V A;  3PTA A;  2A37 A;  1RAB B;  2FYK A;  4M7A F;  1RAG B;  4QT7 A;  2EJ9 A;  4LD6 A;  2D6F A;  2JTM A;  5C6S A;  2VXE A;  3J81 E;  3QPH A;  1XNI A;  4KBM B;  4M77 B;  2K5F A;  4M78 F;  4FSS A;  3CQT A;  3M0R A;  3RKY A;  5CKD A;  2DBM A;  4IUU A;  1I07 A;  3VRY A;  4C5H A;  2VAS A;  2LJ3 A;  4Z8A A;  3EG9 A;  2P84 A;  4HA8 A;  1M8M A;  4IUR A;  5IHI A;  4P5N A;  1MMG A;  2RH2 A;  4HVU A;  2LVM A;  1WFW A;  1WPY A;  2RHY A;  1MHN A;  4BY6 B;  4RTZ A;  2QA4 T;  1XTD A;  3M54 A;  1YIT Q;  1GBR A;  2Z0W A;  3L2W A;  3FJ5 A;  3OMC A;  2HKN A;  1QVF P;  1Y57 A;  2W10 A;  2OTL T;  4FL6 A;  3S3O A;  4J9D A;  3V8L A;  2HZY A;  4QVZ A;  1YN8 A;  2HBP A;  1YCS B;  4F7U F;  2H8H A;  1OZ2 A;  5KYX B;  4RUG A;  1VQN Q;  2OJ2 A;  4OVA A;  1M1K U;  3M4G A;  2JTF A;  2QQS A;  1D1B A;  4R56 A;  1Q86 C;  1CSK A;  2JNG A;  1AT1 B;  1H8K A;  3PNW C;  3C94 A;  5FLX E;  1NPR A;  1K9M R;  4AFS C;  1PNJ A;  4ZTJ A;  3MEU A;  1FMK A;  1K73 C;  1ZA1 B;  2OX7 A;  2PUO B;  2WSC E;  2M0O A;  1AVZ C;  4B9W A;  2RPN A;  3HKS A;  1PC0 A;  2LX7 A;  4J5Y A;  2H3E B;  2SRC A;  1IGU A;  5CKH A;  2ZPH B;  5J26 A;  4PNO A;  3OW2 P;  1VQ5 A;  2O88 A;  4QVC A;  2LQK A;  1WHJ A;  1K4U S;  1WHL A;  1ABO A;  1B34 A;  1IZ6 A;  2DJZ A;  2ZPG B;  1GXI E;  2ZAE A;  5FU6 B;  1MMA A;  2NUP B;  1YIJ Q;  2KXC A;  5J39 A;  4JDS A;  3EG3 A;  2KT1 A;  4ME7 A;  4M77 F;  2A08 A;  3TSW A;  4M78 A;  2VYT A;  3M56 A;  2XKO C;  4HVV A;  4FT4 A;  2DTH A;  4AG1 C;  2KT8 A;  4PKC C;  1RAC B;  2DX1 A;  2MPX C;  2O2O A;  3H6Z A;  2VC8 A;  4JPB W;  4OMP A;  2JM8 A;  1QVG P;  1Y96 B;  1I81 A;  1X75 C;  3MEV A;  1IXD A;  3IQL A;  3EFR A;  2AK5 A;  3RMS A;  1G3W A;  3VS1 A;  3L2R A;  1B3Q A;  2V8K A;  1IRX A;  2DXC A;  1UG1 A;  3CC7 T;  3EGU A;  2MCN A;  4OML A;  2E5Q A;  4C8Q B;  3CXC S;  1BIA A;  5IXF A;  1C6V X;  2K3Y A;  1PKT A;  3CCJ T;  4N0A A;  4DOV A;  4RKU E;  2JT4 A;  2CYZ B;  2WAC A;  3EG0 A;  1SEM A;  2HCK A;  4MDX A;  4PJO E;  3KFV A;  3G6E T;  1X01 A;  1YJW Q;  4PJO D;  3P8H A;  1XJW B;  5CCA A;  4E7K A;  1QCO A;  1X2K A;  3QJY A;  2E64 A;  2J6O A;  3I55 A;  1GBQ A;  4M75 B;  3KUF A;  1RAA B;  4A4G A;  1HK9 A;  2OI3 A;  2KR3 A;  1U06 A;  2YUO A;  1U3O A;  2JUF A;  3BDU A;  5KYY A;  1KC8 U;  4E7L A;  4J7F A;  1VQP T;  1YI2 T;  2DMO A;  3BE3 A;  2OTJ A;  3E1S A;  4M7D E;  3GLX A;  4PJJ A;  5HK0 A;  1V1C A;  1TOV A;  3DKM A;  5CKE A;  1WX6 A;  3FB9 A;  4QQG A;  3MHX A;  3CCU T;  1Q7Y R;  4DBR A;  3CBO A;  5I21 A;  5LJ5 j;  1E7O A;  2EQK A;  1M30 A;  2HDA A;  3KBG A;  4EMH A;  3A8G B;  1GCP A;  3OYE A;  1ABQ A;  2DD4 A;  3CCQ A;  3OYY A;  4PJL A;  5M9O A;  5CQY A;  1WA7 A;  1W2B A;  1VA7 A;  2FZG B;  2DER A;  2K3B A;  2ED1 A;  1D0X A;  3CCS Q;  4XQ3 A;  2KNB B;  3SEM A;  2E6N A;  2EJF A;  3SHW A;  2AZS A;  4KT0 E;  2P0Q A;  3G71 A;  1VQK Q;  3N5B B;  3JCM f;  2KGT A;  1ZSG A;  2KMT A;  1YJW T;  3G7Z A;  4QQ6 A;  1AWW A;  4WTO B;  1RLQ C;  1RAF B;  3CCM T;  1NJI C;  3HRT A;  4FCY A;  4ZN1 A;  4L59 A;  1RL2 A;  2JJ9 A;  3VUB A;  4OMF B;  1G5V A;  1Q82 U;  4C8Q F;  2VXF A;  4XTU A;  4C92 F;  5GMK e;  2HSE B;  3PIO A;  2HEQ A;  5IXB A;  4OGC A;  5IAY A;  2L3R A;  2F2W A;  4C0F A;  1VQO Q;  2NUT A;  3I9Q A;  1RI9 A;  4PJO G;  2J6F A;  3OYD A;  2M1H A;  1HD3 A;  3JCM c;  2FL7 A;  3OYN A;  4M75 F;  3M0Q A;  2P4R A;  4E7J A;  2QEX Q;  2L0A A;  4E6R A;  3JCM X;  4JS4 A;  1FWZ A;  1YIT A;  1QKX A;  2BUD A;  1YJ9 Q;  4M7D A;  3NGP A;  3DLL A;  1M2V B;  1P92 A;  1T0H A;  1VUB A;  4UC4 A;  5GAO r;  2VGN A;  2JOY A;  3HHT B;  4EPC A;  2RHU A;  2B86 A;  5I2M A;  3PIP A;  2DET A;  2D8J A;  4C0D B;  2F5T X;  3CCS T;  1VQN A;  1M90 U;  1U1S A;  1YHQ Q;  3RNJ A;  5LL6 S;  3JCM b;  2HMA A;  2I0N A;  2DL5 A;  1PM3 A;  3EGD A;  3QHS A;  4ORZ A;  3M0T A;  2DVJ A;  2BTT A;  4MML A;  4RG2 A;  3NFC A;  2ECZ A;  3QWY A;  5A0L A;  2FPE A;  5FWC A;  1OZ3 A;  4KGX B;  1VQ8 A;  1M1G A;  2D0N A;  1AOJ A;  1HXD A;  3EHR A;  1QCN A;  4BI8 B;  4CRI A;  2LT1 A;  1IB8 A;  2Y4X A;  1H64 1;  4DA4 A;  1TSF A;  2DTI A;  3VJP A;  2XHC A;  1KQS P;  2DRM A;  4A4K A;  1M3C A;  4A54 A;  2DTO A;  2YRD A;  4NS5 A;  1S72 T;  3JAM E;  4BE1 A;  3OSV A;  4PLL A;  4GBQ A;  2HQX A;  2Y4Y A;  1D1A A;  3CC2 A;  1Q95 G;  1YIJ A;  3PVQ A;  4PL6 A;  2XDP A;  5LJ5 f;  4XTY A;  1JEG A;  2QQB A;  1WXT A;  2BE9 B;  4J9C A;  1ZBJ A;  3CC4 A;  4J6Y A;  3CMA T;  2P4T A;  1JXM A;  1OV3 A;  3VU3 C;  2JXB A;  4XU1 A;  2AT1 B;  2KE9 A;  3ME9 A;  1YJN T;  3VKI A;  2VKN A;  3TSZ A;  2BZY A;  3HPW A;  4L6V 5;  3EH1 A;  4JJC A;  1RUW A;  2QG9 B;  1VIE A;  2MYS A;  1LOJ A;  2CP6 A;  2R5M A;  5CVI A;  3CBM A;  3M59 A;  2MK5 A;  3G4S T;  5GJW B;  2G6F X;  1R8O B;  3VYG A;  1UEC A;  4B9X A;  2QDY B;  1M8V A;  1D0Y A;  3JCM e;  4RTW A;  2QTV A;  1K8A R;  2QTX A;  5LJ3 d;  3C0C A;  1ZBX A;  2K2M A;  3NHN A;  3O8V A;  1KSW A;  3VS7 A;  4PFZ A;  2MF2 A;  4RG8 A;  2C0I A;  2CH4 A;  2M51 A;  1VQ4 A;  4ZNX A;  3EG1 A;  2K6D A;  1W70 A;  3GOX A;  2JMC A;  1EZZ B;  3MO8 A;  5KYN A;  3HFN A;  1JRI A;  4A4H A;  1KQ1 A;  3OS1 A;  4E7I A;  3QYG B;  4OB1 B;  1WZO A;  2DEU A;  1H3Z A;  1D09 B;  5FWB A;  4FIB A;  4CC3 A;  1I0C A;  1SG5 A;  4QW2 A;  1TTH B;  2E3H A;  3GF5 A;  3NMZ C;  2V1R A;  2ZCF B;  3OBW A;  4IUV A;  2MWO A;  5GAO l;  3M4Y A;  4Y92 A;  4J83 A;  3NPF A;  1VQ5 T;  3CCR Q;  2L5Q A;  2EYX A;  4R55 A;  1K8A U;  1D3B B;  1PKS A;  3FLG A;  2GQV A;  2RJC A;  5HCK A;  3CCV Q;  2CS7 A;  3U23 A;  4LDV A;  5FRO A;  5CK9 A;  1SSH A;  3JB9 D;  3I55 Q;  1YFN A;  3SD4 A;  1AZE A;  2EFI A;  4ATO A;  3ZL7 C;  1QCF A;  1ZLM A;  3M55 A;  3O5Z A;  2OTJ Q;  1QVF S;  4CI0 C;  1EIF A;  1N6A A;  4EMK A;  2K9G A;  4LDY A;  4PJO C;  1VQL A;  5KYU B;  3CCL Q;  2ZZD A;  2COZ A;  4X9C A;  2M16 A;  2DL8 A;  1BCO A;  4LN2 A;  5CR2 A;  2BKD N;  1MNE A;  2K5L A;  2PVG B;  1GCQ A;  1K0S A;  3JSC A;  1BCM A;  2YUP A;  2CZ6 B;  3PT9 A;  2EGA A;  2MMP A;  2E1H A;  2EQU A;  4M7D C;  1C1A A;  4OGE A;  1VOM A;  2GGR A;  3GPL A;  3OYH A;  3QDF A;  2FO0 A;  2NLU A;  4GY5 A;  1OPL A;  2RJD A;  3P8D A;  5LJ5 e;  1JBM A;  1VQ7 T;  1DJ7 B;  1ZUU A;  1RAD B;  5GAN 3;  2CP3 A;  2O9V A;  4BUG A;  3OW2 S;  1VQO A;  1MMD A;  2IPO B;  2JTE A;  3CME A;  2DIL A;  4KUD K;  2MIO A;  4MZM A;  2EYZ A;  4LNP A;  2RJE A;  4M7A E;  2DYB A;  4MDW A;  2ZPF B;  2QEX A;  3A1P A;  3RUX A;  2RHZ A;  2KAF A;  1N8R C;  3I56 Q;  4LDX A;  2LNV A;  3AT1 B;  4LDW A;  1YJ9 A;  1NLP C;  1LJO A;  3CEY A;  3V8J A;  2RHI A;  4M78 E;  2DA9 A;  2JS0 A;  2DL4 A;  4PJM A;  3QWX X;  4VUB A;  2WSF E;  3FJP A;  3L42 A;  3CCE Q;  3OMG A;  3JB9 G;  4KGZ B;  3OYI A;  1GRI A;  1QMC A;  1QVG S;  1H3H A;  1YHQ A;  2RQR A;  3E9F A;  4X9D A;  1A0N B;  5FU7 C;  1X2Q A;  2LCS A;  5GAN 2;  4Z89 A;  5DLQ E;  1TUG B;  2A0F B;  3A8H B;  5CO7 A;  1M27 C;  2LCC A;  2CUD A;  2QQR A;  3CCQ T;  4QQD A;  4RTT A;  1WHH A;  4JRP A;  4J6W A;  3CPF A;  1SKU B;  1PG5 B;  5KYW B;  2L3Q A;  2XMF A;  3REA B;  3EGX B;  3G71 T;  1VQM T;  5GAO m;  2IG0 A;  2FPF A;  4IIO A;  1X6O A;  2KDS A;  4M4Z A;  2LT4 A;  2SEM A;  1KD1 C;  5L8R E;  3LGL A;  3OBY A;  3VS3 A;  5L23 A;  1KQ2 A;  4PJO B;  2CZ1 B;  5GAM d;  2PVD B;  1VQ8 Q;  1J3T A;  1K76 A;  1OOT A;  4AFZ C;  2LRQ A;  3VS6 A;  1Z9Q A;  3C12 A;  1QKW A;  4AG2 C;  5A0G A;  2DK3 A;  4B6M A;  3E9G A;  4N4I A;  5KCO A;  2Y90 A;  1UTI A;  1FX7 A;  4CC2 A;  1D1C A;  4M7A A;  2XU8 A;  4OMQ A;  3UDC A;  4D6W A;  3CC2 Q;  4XAX B;  2NUZ A;  4HT8 A;  1YIT T;  4KUI A;  4M7A G;  3NTH A;  1N9S A;  2KRN A;  2LTO A;  3SWN A;  2DL7 A;  1O9S A;  5FW9 A;  3RER A;  1OUL A;  3CC4 Q;  1FMW A;  5CIU A;  4M77 E;  3A5Z B;  2V8I A;  3I35 A;  1K9M U;  5HY6 A;  4M78 G;  4D8K A;  1KFZ A;  2E3I A;  1W6X A;  4YTL A;  2FVU A;  1ZSZ C;  2GF7 A;  3UA6 A;  5HK3 A;  3KXT A;  1VQN T;  3HRS A;  3RKX A;  1UJ0 A;  3RMQ A;  1OX9 A;  3H0F A;  3OW2 A;  2LJ0 A;  2JM9 A;  2XG8 D;  1JU5 C;  5GAM e;  2V26 A;  4MMK A;  5KCH A;  2IIM A;  2RB6 A;  4EMK C;  2JVV A;  4OF1 A;  1M2O A;  3H0I A;  4J9F A;  1VQ8 T;  1VQ6 Q;  1AEY A;  4F7U A;  2PZ1 A;  2YWW A;  1Q81 R;  3M58 A;  4RTV A;  3MET A;  1YWP A;  4BAC A;  2XIC A;  2FRW A;  5I22 A;  1VQ4 Q;  3CCR A;  4C5G A;  2MOX A;  2X4X A;  1GCQ C;  8ATC B;  1MMN A;  1SRL A;  3CCV A;  1KJW A;  5GAN j;  1R0B G;  2R57 A;  5FU7 B;  2RQW A;  1MND A;  1YIJ T;  1QP3 A;  4IUT A;  2O4X A;  4DEY A;  2EVR A;  2HL5 C;  4PJO F;  3QSU A;  3UA7 A;  1BI0 A;  2CDT A;  3M53 A;  3VRZ A;  3JCM P;  2CSQ A;  3V7C A;  4CC7 A;  4E7S A;  2C06 A;  1G3S A;  1EX4 A;  3BFM A;  4BDZ A;  1UHF A;  3CCL A;  4M7D D;  3MKD A;  3RDV A;  2YLB A;  1XQH A;  3JCM J;  2R5A A;  5DM7 R;  3V7R A;  2KY9 A;  1Q81 U;  3A8L B;  3MEW A;  1ZX6 A;  2RJF A;  2K3X A;  4JLG A;  1W2B P;  2DXB A;  4FYV B;  2RN8 A;  2HL3 A;  1JB0 E;  3EFO B;  4M77 A;  4OB3 B;  1N27 A;  4FW1 A;  5GMK m;  5GAO n;  1HYO A;  1VQ9 Q;  1VQL Q;  2CKK A;  4BDY A;  2X3X D;  1B07 A;  2XID A;  2LMJ A;  1WIE A;  2QA4 A;  1D0Z A;  2ESW A;  3RES A;  1UFF A;  1PSE A;  3A8M B;  3BDL A;  1G3T A;  1PCX A;  3L2Z A;  3PE0 A;  1KQS S;  5CKF A;  4XU2 A;  5I11 A;  4BB7 A;  2RQV A;  2RQT A;  1Q7Y U;  5IH2 A;  3INZ A;  4IUP A;  4AFU C;  2XDB A;  2ZPB B;  1M3A A;  4HXJ A;  2RK2 A;  1I5O B;  1IRE B;  2KVQ G;  5KYX A;  3I56 A;  2HSP A;  4C8Q E;  3SFM A;  1ZSZ B;  4C92 E;  4J9E A;  2C0O A;  3HSB A;  1N5Z A;  1UEB A;  4HKE A;  1CKA A;  2FG0 A;  3CME Q;  5C0M A;  3CCE A;  2E6Z A;  1BYM A;  4N4H A;  4JRI A;  4JRK A;  2EKO A;  4NL3 A;  1N8R R;  1M9S A;  4M75 E;  3REB B;  2DD5 A;  4OB0 B;  3UPU A;  1WGS A;  4OP0 A;  1NG2 A;  9ATC B;  5KE3 A;  1M1K C;  4HCC A;  2XK0 A;  1W4S A;  1OU8 A;  2HQE A;  3BY7 A;  1UGR B;  1WQW A;  4M7D G;  2X35 A;  3CXC A;  2EPD A;  3L2V A;  3PMI A;  5AYF A;  4FYY B;  2RQU A;  3BW1 A;  5GMK h;  1TWB A;  3FC3 A;  1IHV A;  2NUP A;  4M7A C;  3F70 A;  3MP6 A;  1OQK A;  2PTK A;  1VQK T;  1QQJ A;  4E7H A;  4LDU A;  1PRM C;  2PU9 B;  1WJQ A;  1UJY A;  2K7A A;  4M78 C;  4IIM A;  5GAN f;  1RI0 A;  2K4Y A;  2A36 A;  1BI3 A;  4R0K A;  1QWE A;  2X51 A;  4LE9 A;  2QGF B;  1JO8 A;  3LH0 A;  4JRQ A;  1R77 A;  4JZ3 A;  1TXQ A;  2DXT A;  2ENM A;  2DJQ A;  4NOY A;  3JCM d;  2X4J A;  1ZHI A;  1Y96 A;  1VQO T;  1Q86 R;  1V76 A;  3DLM A;  1KD1 R;  2DFU A;  5D7U A;  5IHK A;  3TEE A;  3L2Q A;  4Z88 A;  3CC7 A;  2QI2 A;  1NYF A;  1ZA2 B;  1K73 R;  3FIF A;  2DL3 A;  2FPD A;  2QEX T;  1TUD A;  2KXD A;  3J80 E;  2CRE A;  4PFP A;  2EW3 A;  3OSS C;  4C8Q A;  1YJ9 T;  1OX8 A;  4C92 A;  3EG9 B;  1JJ2 P;  4ESR A;  4N4G A;  3LWI A;  4JJB A;  2JS2 A;  2QAZ A;  2LZ6 B;  3G6E A;  4C8Q G;  5FRN A;  4C92 G;  4N0A C; 
#chains in the Genus database with same CATH homology
 1ABO A;  3THK A;  3I5S A;  2FRY A;  4AFQ C;  1GL5 A;  2GGR A;  2KBT A;  2FO0 A;  1X6B A;  2L3P A;  2KXC A;  1OPL A;  3PVL A;  3EG3 A;  4F16 A;  2KT1 A;  1K1Z A;  4F17 A;  1RLP C;  1AWJ A;  2A08 A;  1ZUU A;  1XOV A;  3TSW A;  1T3S A;  2VVK A;  4HVV A;  2O9V A;  4AG1 C;  2JTE A;  2KT8 A;  2DX1 A;  2O2O A;  2HBW A;  2YUN A;  2CT3 A;  2DIL A;  2EGE A;  2MIO A;  3VS4 A;  2EYZ A;  4LNP A;  2J06 A;  4RTY A;  1VYV A;  4JPB W;  2RF0 A;  4OMP A;  2DYB A;  2JM8 A;  1SHF A;  2E5K A;  1BU1 A;  2GTO A;  3IQL A;  1NLP C;  4EIK A;  2J7I A;  2EGC A;  2W0Z A;  2AK5 A;  2ED0 A;  2DA9 A;  2JS0 A;  1PHT A;  2GTJ A;  2DL4 A;  3VS1 A;  3H41 A;  1U5S A;  1B3Q A;  3QWX X;  4LUE A;  2O9S A;  1MUZ A;  3RBB B;  1UG1 A;  2ROL A;  2ABL A;  1GRI A;  3EGU A;  3M0U A;  4OML A;  2CUB A;  2MCN A;  5IXF A;  4DEX A;  1X6G A;  1H3H A;  1GFC A;  1PKT A;  2RQR A;  1A0N B;  1KIK A;  2JT4 A;  1X2Q A;  2GNC A;  3EG0 A;  2LCS A;  1SEM A;  2HCK A;  4Z89 A;  3KFV A;  1TUC A;  1JXO A;  1M27 C;  2CUD A;  2YUQ A;  4RTT A;  1X2K A;  2DNU A;  2J6O A;  1GBQ A;  1QWF A;  2EBP A;  2D8H A;  2YT6 A;  2L3Q A;  2KR3 A;  1U06 A;  2OI3 A;  1YP5 A;  1U3O A;  2YUO A;  1K0X A;  1E6H A;  3R6N A;  2XMF A;  3REA B;  1AWO A;  4J9H A;  2DMO A;  2EKH A;  2FPF A;  4IIO A;  1V1C A;  4M4Z A;  2SEM A;  1WX6 A;  1HSQ A;  1YWO A;  1LCK A;  1UGV A;  3VS3 A;  5L23 A;  2VWF A;  1JQQ A;  1T0J A;  2J6K A;  1E7O A;  1J3T A;  1M30 A;  1SHG A;  1K76 A;  3VS2 A;  2HDA A;  1OOT A;  4AFZ C;  1WDX A;  3VS6 A;  1GCP A;  1PRL C;  1Z9Q A;  1QKW A;  4AG2 C;  1X69 A;  1ABQ A;  2LQW A;  2L2P A;  1AD5 A;  1UTI A;  1WLP B;  4GLM A;  4CC2 A;  2KEA A;  5EC7 A;  3EG2 A;  2YDL A;  4OMQ A;  1WA7 A;  2DE0 X;  1VA7 A;  3UF4 A;  2K3B A;  1UUE A;  2CSI A;  2ED1 A;  2EYW A;  2NUZ A;  4CC4 B;  3LH5 A;  2KNB B;  1NEB A;  3SEM A;  3SHW A;  2KRN A;  2AZS A;  1M3B A;  2DL7 A;  5FW9 A;  2KYM A;  2KGT A;  1ZSG A;  1CKB A;  4HCK A;  3I35 A;  1AWW A;  1RLQ C;  3M0P A;  4D8K A;  1KFZ A;  1W6X A;  3UA6 A;  1X43 A;  4HVW A;  1BK2 A;  1UJ0 A;  2C0T A;  5GJV B;  2DRK A;  3H0F A;  2AKK A;  2HEQ A;  1VYU A;  2D1X A;  2LJ1 A;  2LJ0 A;  4K11 A;  5IXB A;  2JM9 A;  3UAT A;  1JU5 C;  1K4U S;  1AZG B;  1WI7 A;  2DF6 A;  2DBK A;  2F2W A;  1NM7 A;  3I9Q A;  1RI9 A;  2IIM A;  2J6F A;  4WCI A;  1HD3 A;  2EYY A;  3H0I A;  2J05 A;  4J9F A;  2EQI A;  3M0Q A;  2P4R A;  1AEY A;  2L0A A;  2NWM A;  2PZ1 A;  4D8D A;  4E6R A;  3A98 A;  4RTV A;  3VS0 A;  1YWP A;  1QKX A;  2FRW A;  3NGP A;  2LQN A;  5I22 A;  1X27 A;  1NLO C;  1UDL A;  1GFD A;  2JW4 A;  2RMO A;  2MOX A;  2DLP A;  4JJD A;  1VYT A;  2JMA A;  4KRT A;  1GCQ C;  1T0H A;  4A63 B;  1SRL A;  2KRS A;  1KJW A;  2KYB A;  2BZ8 A;  2RQW A;  2B86 A;  2RNA A;  1S1N A;  4DEY A;  2D8J A;  2EVR A;  2X3W D;  1EFN A;  1UE9 A;  1Z9Z A;  4X1V A;  3UA7 A;  2CDT A;  2V1Q A;  3RNJ A;  1ARK A;  1H92 A;  2LNH B;  1MV0 B;  2I0N A;  2DL5 A;  3VRZ A;  1OEB A;  5ECA A;  2CSQ A;  4J9I A;  4CC7 A;  3GBQ A;  1T3L A;  1UHF A;  4ORZ A;  3M0T A;  2QDL A;  2DVJ A;  4OMO A;  2CT4 A;  2BTT A;  2L3S A;  2ECZ A;  3EHQ A;  3QWY A;  2FPE A;  5FWC A;  1FYN A;  4LUD A;  3I5R A;  1ZX6 A;  2D0N A;  1AOJ A;  3H0H A;  2GBQ A;  3EHR A;  2OAW A;  2RN8 A;  4F14 A;  1PWT A;  2DRM A;  1M3C A;  1WYX A;  4GBQ A;  5IHN A;  1SRM A;  1TG0 A;  1ZUK A;  1YNZ A;  2X3X D;  1B07 A;  2LMJ A;  1WIE A;  3PVQ A;  4RTU A;  1I1J A;  3VS5 A;  1JEG A;  2ESW A;  4J9B A;  1WXT A;  2M0Y A;  1UFF A;  4J9C A;  1HJD A;  1ZBJ A;  2DM1 A;  1K9A A;  1JXM A;  3PE0 A;  1WXU A;  1OV3 A;  1W1F A;  2JXB A;  5I11 A;  2RQV A;  2RQT A;  4J9G A;  2KE9 A;  1IO6 A;  5IH2 A;  2CH4 W;  1E6G A;  2VKN A;  4AFU C;  3TSZ A;  3M0S A;  2BZY A;  1M3A A;  4HXJ A;  4JJC A;  2KRM A;  1RUW A;  4RTX A;  1ZUY A;  2FEI A;  2HSP A;  2A28 A;  4J9E A;  4OMN A;  2LP5 A;  5GJW B;  2C0O A;  2G6F X;  1N5Z A;  1WXB A;  1UEC A;  1CKA A;  1NEG A;  2A37 A;  4RTW A;  2FG0 A;  2PNI A;  2KRO A;  4OMM A;  2BZX A;  4QT7 A;  3C0C A;  2AZV A;  2K2M A;  3NHN A;  1KSW A;  3VS7 A;  2O31 A;  2C0I A;  3REB B;  2CH4 A;  2M51 A;  3CQT A;  4FSS A;  3M0R A;  4ZNX A;  3EG1 A;  1NG2 A;  2K6D A;  1W70 A;  2DBM A;  2JMC A;  1I07 A;  3VRY A;  1OPK A;  2LJ3 A;  4Z8A A;  1M8M A;  1G2B A;  5IHI A;  2ROT A;  4HVU A;  2EPD A;  1WFW A;  5FWB A;  2RQU A;  2F2X A;  4RTZ A;  4CC3 A;  1I0C A;  3NMZ C;  1BBZ A;  2V1R A;  1GBR A;  2PTK A;  3FJ5 A;  1QLY A;  4Y92 A;  3TVT A;  2AKL A;  3NPF A;  1AWX A;  1Y57 A;  1PRM C;  2W10 A;  2EYX A;  1UJY A;  2K7A A;  1PKS A;  1NYG A;  4J9D A;  5HCK A;  4IIM A;  3U23 A;  2A36 A;  1YN8 A;  4R0K A;  1QWE A;  1YCS B;  2H8H A;  4LE9 A;  1SSH A;  1JO8 A;  1UHC A;  4RUG A;  4JZ3 A;  2OJ2 A;  1AZE A;  3JV3 A;  2ENM A;  3ZL7 C;  2YSQ A;  2DJQ A;  2K79 A;  1G83 A;  1QCF A;  2F2V A;  1ZLM A;  3O5Z A;  1CSK A;  1H8K A;  1Y0M A;  1BB9 A;  2K9G A;  5IHK A;  4AFS C;  1PNJ A;  4Z88 A;  2DL8 A;  1NYF A;  1FMK A;  2DL3 A;  2FPD A;  1TUD A;  2KXD A;  4LN2 A;  1AVZ C;  2CRE A;  2EW3 A;  2RPN A;  1GCQ A;  2LX7 A;  4ESR A;  2SRC A;  1K0S A;  4JJB A;  2JS2 A;  1SPK A;  2LZ6 B;  3ULR B;  2YUP A;  4JZ4 A;  2O88 A;  2EGA A;  2GQI A;  1MV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...