4AFSC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afsC00
2DRMA 2DX1A 3I35A 2FPEA 3PVLA 2DF6A 2J6OA 2L2PA 1ABOA 2L0AA 1GCQA 1AVZC 2LZ6B 3TSZA 1N5ZA 4OMMA 3U23A 3H0IA 2O2OA 1QCFA 3H0HA 2A08A 1K4US 4E6RA 3QWXX 3VS1A 5IHNA 3JV3A 1AWXA 1ZBJA 2RMOA 2RN8A 3UA7A 2YT6A 1WFWA 3EG1A 1QKXA 1ZSGA 2LCSA 1PRMC 1QWEA 4OMOA 2FPFA 2KGTA 2M51A 4IIOA 5IH2A 1M3CA 2ED0A 2GGRA 3PVQA 2AKLA 1ABQA 3IQLA 1JU5C 2RF0A 1AWWA 3EHQA 2QDLA 3CQTA 1UHCA 3NGPA 5GJWB 2EPDA 1BK2A 2CUDA 3EHRA 1HD3A 2AZSA 1ZX6A 4HXJA 3NHNA 3VS6A 1SHGA 2CREA 1WI7A 2FRWA 2A36A 2AK5A 2H8HA 4DEYA 2DVJA 4JPBW 4LE9A 4A63B 2RQVA 2GQIA 2ED1A 1GCPA 1X2KA 2JT4A 1WA7A 3ZL7C 4AFUC 4JZ3A 4JJCA 2RQRA 2OI3A 1VYTA 2KR3A 2BZYA 4J9EA 4AFZC 1M3BA 2J6FA 4GLMA 2GTOA 2DE0X 1WDXA 1NEGA 1NYFA 1PKSA 4RUGA 2KYBA 1K0XA 1ZUKA 2YUPA 1WX6A 1UGVA 1VA7A 2K6DA 2V1QA 2G6FX 1JXOA 2B86A 3REAB 1UECA 2DA9A 2KROA 2XMFA 4OMQA 4ZNXA 1NEBA 2VWFA 2I0NA 1PNJA 1WYXA 2DM1A 1JXMA 4DEXA 2ROTA 4J9DA 1AZEA 2L3SA 3VRZA 1TUCA 1GL5A 2BZ8A 5I22A 2K7AA 4AFSC 1U06A 4LNPA 2DMOA 3SHWA 2JMAA 1OV3A 2KNBB 2E5KA 2KBTA 4RTXA 2KXCA 2YUOA 4RTZA 4J9GA 1AZGB 2CUBA 2JTEA 3R6NA 2EKHA 3GBQA 2A28A 1XOVA 1W1FA 1A0NB 2LQNA 1I07A 2GBQA 4RTVA 2JW4A 3EGUA 4F17A 2BZXA 1G2BA 1SRLA 2EGCA 1SEMA 3VS7A 5IHIA 4WCIA 2JXBA 2ROLA 2LQWA 3QWYA 2YDLA 2VKNA 1Z9ZA 1AD5A 1SPKA 2PNIA 1LCKA 1QKWA 1GBRA 2D8HA 4LUDA 1PHTA 1K9AA 4GBQA 4OMPA 3UF4A 1WLPB 4J9BA 2PTKA 1SHFA 2C0TA 2HCKA 3C0CA 2K9GA 1T3SA 2J05A 1X43A 2LX7A 2HEQA 3M0RA 1PKTA 1ZUUA 2F2XA 2J6KA 1CSKA 4Z88A 1QWFA 2KRSA 1E6GA 2ESWA 2DYBA 2J06A 1UJ0A 1Y57A 1BBZA 4F14A 1X2QA 1UUEA 1IO6A 4OMNA 4AG2C 3I5SA 1X6GA 1YCSB 4FSSA 1NLPC 1JEGA 1GFCA 2EBPA 2X3WD 2W0ZA 2KE9A 1M3AA 1UHFA 2C0OA 2IIMA 2EGEA 2HBWA 2P4RA 4OMLA 2DLPA 1B07A 1RUWA 4F16A 3VS5A 2V1RA 1GCQC 2JS0A 2K2MA 4HVWA 1J3TA 4RTTA 1M30A 2EVRA 3EG2A 3SEMA 4D8DA 2K3BA 4RTUA 2BTTA 4HVVA 2JMCA 2D8JA 1X6BA 1TUDA 1AOJA 1MV3A 5I11A 2JM8A 1NG2A 5EC7A 1RLPC 4Y92A 4CC4B 2MOXA 1OEBA 2DL5A 1NM7A 1KFZA 4HVUA 1YWPA 1H3HA 5FW9A 1NYGA 2NUZA 1VYUA 3O5ZA 3FJ5A 2EYZA 2F2WA 3A98A 3KFVA 2DL3A 1UDLA 1WXBA 1E6HA 4J9IA 1RLQC 2SRCA 1VYVA 3THKA 1HJDA 2L3PA 5L23A 1FYNA 5IHKA 3ULRB 2LNHB 5HCKA 4IIMA 3VRYA 2DL4A 1ARKA 3UA6A 3VS3A 1WXUA 1I0CA 2PZ1A 4X1VA 1RI9A 2KXDA 2MCNA 1X69A 2ABLA 1FMKA 1PWTA 3VS0A 4AFQC 2DNUA 4JZ4A 1CKAA 1NLOC 1AEYA 4ORZA 1BB9A 5FWBA 3REBB 2CT3A 3EG3A 2J7IA 1H8KA 1EFNA 1W70A 2RNAA 1GBQA 1ZUYA 2RQTA 1KJWA 3M0TA 1OPLA 2K79A 5GJVB 1H92A 2CDTA 4LUEA 4RTWA 3PE0A 2L3QA 1M8MA 1SRMA 3RBBB 1OPKA 1HSQA 2A37A 1SSHA 1YP5A 2YSQA 1BU1A 2AKKA 3EG0A 3NMZC 3TVTA 1UTIA 2CSIA 1UE9A 2DILA 2FG0A 1WIEA 2FPDA 2RPNA 4CC3A 1UG1A 3UATA 2KEAA 4QT7A 1AWOA 2CT4A 4Z89A 1G83A 4KRTA 1T3LA 1B3QA 2W10A 2M0YA 2GNCA 1QLYA 4AG1C 2DL8A 2C0IA 2KRNA 2HDAA 2DJQA 4HCKA 4D8KA 2KRMA 1WXTA 3M0QA 3TSWA 2SEMA 1KSWA 1U5SA 2CH4A 1YWOA 1U3OA 4J9HA 2O88A 2FRYA 1V1CA 3M0PA 2AZVA 2D0NA 2VVKA 1KIKA 1K76A 2GTJA 3NPFA 2EGAA 3M0SA 3H0FA 2YUQA 4RTYA 2O9SA 2CH4W 3M0UA 2DBMA 2JM9A 2EQIA 2LMJA 4J9CA 1MV0B 2JS2A 1OOTA 1Y0MA 1YN8A 2ENMA 2F2VA 2X3XD 1Z9QA 2NWMA 1K1ZA 3RNJA 1W6XA 1T0HA 4CC2A 4JJBA 2KT1A 1CKBA 2DL7A 1MUZA 2MIOA 2EW3A 3VS4A 5IXFA 5FWCA 2LP5A 2RQWA 2DRKA 4CC7A 1M27C 1UFFA 1S1NA 1UJYA 2EYWA 2O9VA 2KYMA 2OAWA 1YNZA 1ZLMA 4LN2A 1E7OA 4J9FA 1X27A 2OJ2A 2LJ0A 1JQQA 5ECAA 2DBKA 2O31A 2EYXA 4JJDA 2KT8A 1TG0A 1PRLC 2D1XA 2ECZA 4Z8AA 4R0KA 3LH5A 4ESRA 1JO8A 1GFDA 1GRIA 2FO0A 4M4ZA 2LJ1A 1K0SA 3VS2A 3I9QA 3I5RA 1T0JA 1AWJA 5IXBA 1I1JA 4K11A 2EYYA 2FEIA 4EIKA 2HSPA 2CSQA 3H41A 2LJ3A 2RQUA 2YUNA
chains in the Genus database with same CATH superfamily
2A7YA 4VUBA 3RESA 1ABOA 2RK2A 1GCQA 1ZSZA 3JCMe 4M77E 4PJOC 3F70A 4IKFA 3TSZA 4KUIA 3LWIA 4OMMA 3H0IA 4EMKC 2JOYA 5DY9A 3G4SA 3VS1A 3HPWA 3M59A 4LDXA 4F04B 4V2SA 2RN8A 1K9MC 1WFWA 1QKXA 3MPUB 2LCSA 1PRMC 1QWEA 4XU2A 4OMOA 1M3CA 1M4ZA 2DO3A 2GGRA 4WF2A 3URGA 2X35A 2VYTA 3IQLA 4A53A 4DBRA 2O4XA 2RF0A 1VQLA 2F5KA 3EGDB 2QDLA 3CQTA 1UHCA 1BK2A 1MMNA 4BY6B 3EHRA 2DZCA 3HHTB 4C0FA 2RJEA 4M7AC 2HZYA 4IUTA 2H8HA 1VQPT 2R58A 2DD5A 1BI2A 2D0QB 4LE9A 3CCUT 2GQIA 3OSVA 3OYKA 3J7AF 2JT4A 2M16A 4JJCA 1Q82C 2AHJB 1TWBA 4J9EA 3C95A 3OW2A 1M3BA 5CIUA 1YBYA 2J6FA 4GLMA 5CKBA 1NYFA 2R57A 2YUPA 3QKJA 1WX6A 1Y96B 1K73U 3PIPA 2QA4Q 4MZPA 1UECA 2DA9A 2IPOB 3OYAA 3OYHA 1KHCA 5M9OA 3TEEA 2QQRA 1LOJA 2ROTA 3FDRA 1VQMA 3VRZA 4FT2A 2DMOA 1IREB 1OV3A 2KNBB 2KBTA 3RDVA 4LDUA 4RTZA 4J9GA 2CUBA 2LCLA 2K5IA 2EJ9A 1XOVA 2ZPIB 2QEXQ 1A0NB 4BE2A 2VXEA 4RTVA 4F17A 5HK3A 2L3RA 4M77F 4J6YA 2EKOA 2QEXT 2LQWA 3CMAA 3QWYA 2VKNA 1AD5A 1W2BP 2X9HA 1K9AA 5CK9A 1WLPB 3MJXA 4JRQA 4J9BA 2C0TA 5GAMj 2HCKA 2K9GA 5DM7R 3I56A 1T3SA 2J05A 1X43A 2CP5A 1Y07A 1Q86C 1QVGP 1PKTA 5LJ3f 1ACMB 3DLLA 2CS7A 3MKDA 1OX9A 4XU3A 2KRSA 3MEUA 2EIFA 2LNVA 1VOMA 1UJ0A 1Y57A 4F14A 3P8DA 1X2QA 1FWZA 4AG2C 1VQOQ 3CD6Q 2L89A 2V8JA 3I5SA 1M90R 1X6GA 1YCSB 1NLPC 1XNIA 3S3MA 1M3AA 2JTMA 2IIMA 4C92F 3CCQT 5CKDA 3N5BB 2HBWA 4C5EA 4M78G 1B07A 3CBPA 2EWNA 3JCMW 1VQ9A 2KAFA 3CCMQ 2RJDA 2YRVA 1WHJA 2DFUA 4M75D 4MMLA 1MNDA 1YJNT 3UPUA 5IT9E 4M77D 4C92G 1D1AA 3VYGA 2EVRA 3EG2A 3CCVA 5CCAA 7AT1B 2K3BA 2VXFA 4RTUA 2BTTA 2D8JA 3A8HB 1X6BA 1TUDA 1AOJA 1MV3A 5LJ5j 2JM8A 2MOXA 2ZGWA 1VQLQ 1KFZA 3BY7A 1YWPA 4N4IA 3GNFB 1U8RA 2LQKA 9ATCB 2NUPB 4BDYA 2NUZA 1VYUA 5GMKi 4QVCA 1JJ2S 2BUDA 2F2WA 3OYNA 2QAZA 2XHCA 2E1HA 1UDLA 5D6XA 3S3NA 1E6HA 1XQHA 4PFZA 4J9IA 1R0BG 2DYIA 4M77C 3M56A 1PD0A 1FYNA 2E64A 1Q86R 1K8AU 5IHKA 4IIMA 4GY5A 5GANe 2RI2A 1WXUA 2PZ1A 4TVRA 5CKFA 1RI9A 3EFOB 1X69A 2ABLA 4JZ4A 4E7SA 1VQ8T 1VQ5A 1AEYA 4KGVB 1K9MR 2DIQA 2HQXA 1EFNA 3CMEA 2FZGB 4M7DE 3I55Q 2RNAA 1YJWA 1Q81C 1W2BS 3PMTA 1KJWA 4M7DG 2P0QA 3RKWA 2EFIA 2DXTA 2K79A 3PNWC 3G71A 3D7SB 4QQGA 4HCZA 2CGHA 2L3QA 1M8MA 1H641 2IVWA 1KQSA 4C92C 1WJQA 3OYLA 1SSHA 3RMQA 4BDZA 2YSQA 1BU1A 3EG0A 3I55A 1VQNT 4KBMB 2KI7A 1VQLT 2LQ8A 1VQMT 1UE9A 2RI3A 2FPDA 3QHSA 1BYMA 2KDSA 2KEAA 1TS9A 4DOVA 3M4YA 3VYHB 1T3LA 3FC3A 4RCBA 1C0MA 5GAOr 3CBMA 2C0IA 2KRNA 3OB9A 8ATCB 3JCMc 1NPPA 3AT1B 4O6JA 5LJ5f 1U3OA 3INZA 2ZZDA 2FRYA 1V1CA 1YIJT 2OX7A 4M78E 5GAN2 3CD6T 3QG1A 3G7ZA 2MMPA 3BFMA 1WZOA 1YHQQ 2EGAA 3M0SA 4PJLA 4II1A 2O9SA 2DJZA 4NS5A 2CP3A 5LJ3g 2DBMA 1KG1A 1AT1B 4J9CA 1TSFA 1VQ6Q 3GNGA 2FYKA 2ENMA 1D0XA 4EMHA 1G3TA 3GF5A 3QYGB 3L2QA 2P4TA 2M9UA 5GMKl 3DKMA 4JS4A 2JNGA 4JJBA 3EAEA 5A0DA 3M57A 2VGMA 3VS4A 2MIOA 2EW3A 5IXFA 2QA4A 3X26B 1UGQB 4M7DA 3E9FA 4J6XA 1VQNQ 2BIVA 2HQEA 5GANj 1UFFA 1HXDA 4GLKA 4Y28E 2OAWA 4LN2A 3EG9A 1TTHB 4YTLA 1VQ4A 3QBYA 1Y7XA 1X27A 3UWNA 1JQQA 4KH1B 1Q81R 2EYXA 4FSXA 2DXBA 2GQVA 1PRLC 5CVIA 2D1XA 3CCLA 2PUOB 4R0KA 4KGZB 1OZ2A 4ESRA 1KD1R 1JO8A 2FO0A 2LJ1A 1K0SA 3I9QA 1T0JA 2QYZA 3CCRQ 2EYYA 1IB8A 1V29B 4LD9K 2FEIA 3H41A 4FYVB 2DTHA 2RQUA 4Z02A 2K57A 3I35A 4B9XA 3CCQQ 2F1LA 4FL6A 1AVZC 5DLOA 2LZ6B 5J26A 1BI3A 1FMWA 3I55T 4E7IA 4BI3A 1QCFA 2WSCE 2VC8A 3QWXX 1PCXA 1RABB 5IHNA 5CR2A 1KQ2A 2HMAA 2RHUA 3UA7A 2YT6A 1ZSGA 1WJSA 2OTJQ 3CPWS 3OSSC 2KK4A 2KQWA 1X6OA 3OA6A 4KH0B 3PMIA 2PVDB 1N27A 3OMGA 1N9SA 2YRCA 2Y90A 4BY6C 4KULA 3NGPA 3RERA 5GJWB 2EPDA 4E7LA 2CUDA 2YHTA 3GLXA 4A4KA 4HXJA 1IRXA 5I2MA 5D7UA 1YI2Q 5FLXE 1SHGA 2Y4XA 2FRWA 3E1SA 3EFOA 4CRIA 2AK5A 3WVEB 3CXCA 2QDYB 2PVOB 3G4ST 1I81A 4QVZA 1N6AA 4JPBW 2O01E 2RQVA 2XIDA 4E47A 3UDCA 3QSUA 4C0DB 4ZTJA 3ZL7C 4R55A 2E6NA 1KQSS 2OI3A 5KYXB 1VYTA 2KR3A 3TREA 2E3HA 5GMKe 1ZBXA 3LWHA 3FJPA 4R56A 2KYBA 4L59A 3X28B 2XDPA 5GAN6 2M02A 1JJ2P 4OP0A 1UGVA 2K6DA 4A54A 4ZGEB 3VV0A 2V1QA 2G6FX 3AHUA 2B86A 4DOWA 1YITQ 4M78B 5GAMd 2D9TA 2E70A 4FW1A 5J3BA 1VIFA 4LXCA 4ZNXA 1D0ZA 4OB1B 2GFUA 1D09B 4M7DF 1PNJA 1WYXA 4NL2A 1WHGA 1JXMA 4BE1A 4J9DA 1C6VX 2YLBA 1GL5A 3QDRB 2CP2A 5EG2A 3CCEQ 1U06A 4LNPA 1NE8A 3H9NA 3MEVA 4C8QB 4RG8A 3OYCA 2YUOA 4ME7A 4ATOA 2JTEA 3R6NA 2EKHA 4J8OA 2A28A 1W1FA 2A3LA 5KYYB 2LQNA 2GBQA 1H3ZA 1RAGB 3EGUA 1S72A 2EGCA 4O5VA 3VS7A 5IHIA 2JXBA 3PT9A 1Y71A 2FHDA 2PNIA 3OYIA 1LCKA 2CP6A 1GBRA 4LUDA 1PHTA 4OMPA 3MHXA 1DJ7B 1SHFA 2CP7A 2JTFA 1QW1A 2LX7A 4ZN1A 3M0RA 1MMGA 2JJ9A 1UB4A 4F7UA 2Z0WA 4UC4A 3G4SQ 3G71Q 1CSKA 1K8AC 4Z88A 5DLQE 1QVGS 5LJ5d 3OQ5A 3CC4Q 3WXMB 2ZPHB 4HCCA 4J7FA 1IO6A 4J5YA 3JCMh 4C8QF 5LJ3d 1QVFA 1Q82R 2W0ZA 2DKGA 1R0CB 3OYYA 3A8GB 1YJ9A 4FW2A 2C0OA 5FU7C 3OBWA 1N9RA 2YRDA 2P4RA 2DLPA 2MWOA 4KT0E 3C94A 4B6MA 1RUWA 4M78F 5GAOl 3VS5A 1QVFS 1M30A 3MEWA 1UGSB 3JRZA 4EPCA 3CC7T 3SWNA 5I11A 2XDDA 5EC7A 4RCCA 1XJWB 4DBHA 1OEBA 2MF2A 1NM7A 3HP9A 2LC4A 3CC7Q 2MI6A 4PJOE 1H3HA 2EYQA 3CCEA 1NYGA 3X20B 4JLIA 4QW2A 1YI2A 3M58A 4ZTFA 4FYYB 4JDSA 5GANf 5IN1A 1RAEB 3CC2A 1VQ9T 1VYVA 4M7AD 1RADB 5KCOA 1HJDA 5L23A 2RI5A 4MDXA 2QQSA 3ULRB 4ZGJB 2FB7A 2DIGA 3CC2T 4X1VA 4FCYA 2GCXA 3L2WA 1BCOA 4XTVA 2MCNA 5FU6B 2LDMA 2DNUA 2L5QA 3CC2Q 5CQYA 3OW2S 4PJOB 4ORZA 4M7AE 2GFAA 3LLRA 3M55A 5GAMe 3QO3A 2QA4T 2XICA 3EG3A 1ZHIA 1ZSZB 2FZCB 3S6WA 1RAAB 1Q81U 1MGQA 4C0GA 4RG2A 1B7TA 2RQTA 3V8JA 1VQ4T 1D1BA 1KHIA 4HT8A 3M0TA 2DEQA 2DEUA 2DXUA 3GOXA 2QTXA 1H92A 4LUEA 4QQDA 2EJFA 5GANg 4Q5WA 1LNXA 1OPKA 3HL8A 3LGLA 2EQMA 1M9SA 2X4XA 1EZZB 2AKKA 1NJIR 5GMKm 3NMZC 3EGXA 1WJRA 4A4GA 3G1JA 4OB3B 2FG0A 2X4JA 3L1AA 2NYSA 4M75E 3CXCS 5GAN8 4QT7A 1AWOA 2DTIA 4Z89A 1BKBA 1M1FA 3CXCP 1QLYA 2DTOA 2OTLT 2DERA 3JCMJ 4M78D 3M54A 4LDWA 2LTOA 1WXTA 3CMAQ 4BACA 4M77G 3JB9D 2SEMA 1KSWA 1U5SA 2CH4A 4KGXB 4BB7A 1C1AA 2AZVA 3CCSQ 5FROA 2CYZB 1BI1A 3ZBDA 1NJIC 2CZ7B 3JCMV 1K76A 3JCMd 4XTYA 1M1GA 2FZKB 4OB2B 4RTYA 5GAN5 4N0AC 3OS2A 1M5Q1 3V7CA 1ZA1B 2RJCA 3EH1A 2JM9A 2R5MA 3CEYA 3V7SA 2QI2A 1OOTA 1VIEA 1Y0MA 2YWWA 3JSCA 4N4HA 1YJNQ 1WHKA 2PUKB 5KH6A 5HK0A 3RNJA 1W6XA 4CC2A 2K4YA 3C12A 4M77B 2DL7A 2QEXA 1MUZA 1MMDA 2RQWA 5A0LA 4CC7A 1PSFA 1S1NA 5FRNA 1E7OA 4C92B 3T9NA 3L2UA 2WACA 2DBKA 3X25B 2V26A 2ECZA 3NTHA 1YHQA 4M4ZA 3VS2A 1OULA 1KC8U 1Q7YR 2DK3A 4C92E 4DQ2A 4K11A 1WHHA 1PSEA 2CSQA 5GAMh 3JB9H 2E41A 3BDLA 1WQ7A 3M4GA 2DX1A 1QVFP 2FPEA 4Y91A 3CD6A 1G3SA 2DF6A 8AT1B 1K8AR 2J6OA 2KY9A 1SG5A 2L0AA 3P8HA 2FVUA 4X34A 2HNIA 4KUDK 2ZCFB 1Y96A 5GANd 3LYIA 3J81E 4BUGA 1N5ZA 1G3YA 1U1SA 4LDVA 2X4YA 1TXQA 2O2OA 2M1HA 3H0HA 1QP2A 1X75C 4XTUA 3OS0A 3PTAA 5GMKj 2CZ6B 5AT1B 1VQNA 1JB0E 4PFOA 4X9CA 2WSEE 3EG1A 1ZA2B 4EMKB 4WTOB 3OYBA 1K9MU 3NFCA 3L2ZA 2OTJA 4J83A 4EDUA 2V8IA 2M51A 3CMEQ 3A5ZB 3JB9F 2O4XB 3PVQA 2AKLA 1ABQA 3LH0A 4JS5A 1I5OB 3PFSA 1JU5C 5FU6C 3CMET 2GF7A 1TU0B 4FYXB 4M7DC 4C92D 1TUGB 4ZGDB 1MMAA 2PU9B 3EGDA 2AZSA 2KSSA 3S3OA 3VS6A 1TH7A 2A36A 4FIBA 4HT9A 2V8KA 1W2BA 1VQOA 2ED1A 4EMGA 1GCPA 1X2KA 2K3YA 4CI0C 4AFUC 4JZ3A 4N0AA 1TOVA 2H3JA 4AFZC 2HL5C 4PJOG 3JB9G 1WDXA 1NBEB 2AT1B 1LPLA 2HKQB 4RUGA 5GAOq 3MO8A 4FYWB 3CCMA 3P8BB 3OS1A 1VA7A 1JXOA 3H6ZA 2QTVA 4OGEA 1RAFB 3JAME 3KUFA 1B34A 2XMFA 3M9QA 5KYUA 2QQBA 2VWFA 1KQSP 2I0NA 5CKHA 3V7RA 2L3SA 5LJ5g 1TUCA 3EFRA 1VQ6T 2K7AA 2RA2A 3SHWA 1BIBA 1RAHB 3EFSA 4M78C 1AZGB 3QDFA 3I56Q 2DXCA 1D3BB 1I07A 2QGFB 3X24B 5GAOp 4C8QG 1I4K1 2XKOC 2JW4A 4M75F 1SRLA 3CCUA 3BW1A 1S72Q 5CO7A 4DA4A 4NOYA 1GXIE 2EQKA 1R77A 2ROLA 2EAYA 1BI0A 1SPKA 2B8AA 3BDUA 4GBQA 3CPWP 3C0CA 1FMVA 3M5AA 2VB6A 5D6YA 3HRUA 4DBFA 2HEQA 6AT1B 1ZUUA 1VQPQ 2F2XA 2J6KA 3E9GA 4M75A 5LJ5h 3MP1A 2BE9B 1QWFA 4M75B 1KQ1A 2ESWA 5FU7B 4MZMA 2J06A 3GIBA 2E3IA 4IUPA 1YIJQ 1O9SA 2PQWA 3J80E 4FSSA 1JEGA 1GFCA 2EBPA 2X3WD 2HD0A 3HTRA 4QQ6A 3OYMA 1IHVA 1UHFA 2YLCA 1YHQT 2DPPB 3OYJA 3JCMg 4JRPA 1G3WA 3H8ZA 4MDWA 4D6WA 1PM3A 4OMLA 5GMKh 5I21A 2EQJA 4L6V5 3WVDB 5GAOn 2C06A 1GCQC 1SSFA 3KBGA 1BIAA 1J3TA 4RTTA 1QCOA 2COYA 4D8DA 4AMCA 5KYWA 2QQ9A 3JCMb 2HKNA 4JRKA 3RR6A 1D3BA 4HVUA 4ZN3A 1I8FA 1SF9A 1AHJB 5FW9A 4PJMA 2NLUA 3CC4A 3TQ7P 2EYZA 4XQ3A 3A98A 2NUPA 3LGFA 4XU0A 1WQWA 3OS5A 1IGUA 4F7UE 3JCMQ 3DLMA 4E2FB 3THKA 1UGPB 1HK9A 4ELYC 2K2VA 2E4HA 4RMOA 5HCKA 3C4SA 4C5IA 1YJWQ 1VQ7A 1VQ8Q 2JZ2A 1IXDA 2VUBA 1RI0A 1ZQ1A 4PJOD 4PL6A 1FMKA 1PWTA 2LT1A 3VS0A 4OVAA 4AFQC 5I2SA 1VQKT 2JN0A 3JCMP 4FM4B 5FWBA 3REBB 2CT3A 4E7ZA 3A1PA 4BI4A 4M78A 2A0FB 2BE7D 5L8RE 1W70A 1JRIA 5KYWB 5AYFA 1GBQA 4ANJA 3RIRA 4HA8A 3OBYA 1UGRB 2F5TX 2CDTA 4JUVA 3RUXA 3CCJT 1HSQA 4PJOA 2A37A 1YP5A 1WNLA 3FLGA 3ZEHA 3QYHB 1BCMA 3TVTA 4C8QD 5CAIA 1YFNA 2DILA 4PK4A 2RPNA 1M2VA 2K5LA 2ZAEA 2JVVA 2ZPEB 4FU6A 3V8KA 3HRSA 2CT4A 2E5QA 3QJYA 1YI2T 1RL2A 1G83A 3QJ6A 4KRTA 2GNCA 4PJOF 2IG0A 2DL8A 4AG1C 1K73R 3FRNA 2CP0A 3QIIA 2DJQA 2KRMA 3KXTA 1N8RU 1IZ6A 2COWA 4IUUA 1W4SA 3TU4K 1KC8C 1YWOA 4J9HA 4N4GA 1QVGA 2O88A 4M7AA 2E12A 3L2RA 4PLLA 3CCSA 1M1KR 1QCNA 3SWNC 3H0FA 2EQUA 5GAOm 4FT4A 2CH4W 2HL3A 2RHIA 1SKUB 2EQIA 3RKYA 4M7AF 2JS2A 4XTWA 4OMFB 1YN8A 1Q82U 3CCET 1YJ9Q 2X3XD 3I56T 2HSEB 2DAQA 2NWMA 3GPLA 1K1ZA 4PNOA 4A4HA 2KT1A 1YJ9T 1O75A 1CKBA 2E10A 1FX7A 2RJFA 2XDBA 5FWCA 3V8LA 2DRKA 3HSBA 1UJYA 2O9VA 2KYMA 3QUIA 4EMKA 4J9FA 1UEBA 2LJ0A 2X51A 1LJOA 5ECAA 4P5NA 3FEOA 5LJ3h 4JJDA 1TG0A 4XTXA 4Z8AA 3CCQA 2RK1A 4XK8E 4C0DC 1GRIA 3CPWA 5GAMf 3L2VA 3I5RA 2DZ9A 5IXBA 3BE3A 4PLIA 1VQOT 2HSPA 2YUNA 1WHMA 2LRQA 2DRMA 3CCRT 2LVMA 1YITT 3PVLA 3Q1JA 3RMSA 2L2PA 1RACB 5GAMg 4M75C 2LCCA 2I2LA 1Q7YC 2AIRB 4PKCC 1JJ2A 5A2QE 3CCMT 1R8OB 3U23A 2A08A 1K4US 4LD6A 4E6RA 4MMKA 1LVKA 2OTJT 1VQPA 3JV3A 3JB9I 1AWXA 1ZBJA 2RMOA 4J7IA 3G6EQ 1YCYA 2VGNA 2FPFA 2KGTA 4IIOA 5IH2A 2K3XA 2ED0A 3META 2KMTA 2PVGB 3G6ET 4M7DD 2R5AA 4JRIA 2VASA 1IHWA 3JB9J 1AWWA 3EHQA 1G8XA 1VQMQ 3QZ9B 1HD3A 3G6EA 1ZX6A 3FIFA 3NHNA 3VUZA 2CREA 1D1CA 1WI7A 4C0ZA 4C8QC 1VQ9Q 4DEYA 2XD0A 3VU3C 3NTIA 2DVJA 1NJIU 1OU9A 4A63B 4XU1A 2K5FA 5CQXA 3CBOA 5HKCA 1WA7A 4HKEA 4M75G 1YJWT 1OU8A 2RQRA 2QXFA 2BZYA 3NTKA 4F7UB 2GTOA 2DE0X 1NEGA 1PKSA 1K0XA 3SFMA 1VQKQ 1ZUKA 2LT4A 2LX9A 2P0PA 5CKEA 2QG9B 1K73C 3OYDA 3REAB 2XK0A 2KROA 3EG9B 4OMQA 1NEBA 4C5GA 1Q86U 2DETA 4E7KA 1FXXA 2EJGA 2DM1A 4DEXA 4C92A 1AZEA 4PJJA 2BZ8A 5I22A 4AFSC 4RKUE 1U1TA 2JMAA 1N8RC 1X01A 2E5KA 4RTXA 3CCJQ 2KXCA 3E19A 4MZTA 3ASKA 2RHYA 3M53A 3GBQA 1WHLA 1VQ5Q 1VQ7T 5HY6A 3VKIA 5GAN4 2BZXA 1G2BA 5KYUB 2M0OA 1D0YA 1SEMA 5KYYA 5J39A 4WCIA 5KYXA 1M1KC 2RM4A 5A0GA 2NUTB 3SD4A 2XI9A 1EIFA 2YDLA 1Z9ZA 3ME9A 1QKWA 2D8HA 1F1BB 4JLGA 3UF4A 3CCLQ 3SB2A 2PTKA 2XU8A 1M2OA 2OTLQ 2FL7A 3ZFJA 1M90C 3CC4T 2HBPA 5D6WA 5LJ5e 4L5GA 3E2UA 2F69A 2NUTA 3CCLT 4HCBA 3QXEB 1E6GA 4C5HA 4BI8B 2DYBA 4OB0B 2MPXC 1Q95G 1BBZA 5LJ3e 4E7HA 5IAYA 1UUEA 4OMNA 3CCST 3EGXB 2MYSA 1G5VA 4A4EA 1KD1C 2KE9A 2YXYA 3OMCA 5KYNA 1OI1A 1KC8R 2EGEA 2XG8D 4LDYA 1RAIB 1I5LA 4PJNA 1KK7A 2D6FA 4F16A 2V1RA 1OYXA 2JS0A 2K2MA 4HVWA 3A8OB 2COZA 3SEMA 3CCVQ 1N8RR 4HVVA 1EX4A 2JMCA 3OYGA 2QQAA 4QVDA 1NG2A 1RLPC 4Y92A 2CZ1B 3CCVT 1IGQA 4CC4B 2X4WA 2DL5A 1MNEA 2HQHA 1M1KU 3O5ZA 2RH2A 4XTZA 2E6ZA 5LJ3j 3FJ5A 2KVQG 3KFVA 2DL3A 2CKKA 1WXBA 3CPFA 1P92A 1RLQC 2SRCA 4IUVA 2L3PA 4QKUA 3OW2P 3DB4A 2JUFA 3JCMf 2RHXA 2LNHB 2ATCB 3VRYA 2DL4A 4NL3A 4C8QA 3G71T 4PFPA 1ARKA 3UA6A 1PG5B 5C6SA 3VS3A 1I0CA 3VUBA 5FRMA 1VQKA 1ZSZC 1WPYA 2KXDA 2VV5A 1XTDA 2P84A 1CKAA 1NLOC 2Y4YA 4OGCA 3DB3A 1BB9A 1YITA 5GAN3 1B34B 1QMCA 1PC0A 2J7IA 3SWNB 1YJNA 1VQ4Q 1H8KA 3R6OA 4B9WA 4BD3A 3OY9A 3A8MB 4ELZC 2HAXA 1KD1U 1NPRA 4XAXB 1ZUYA 3HFOA 2QK0A 3UT1A 1MHNA 3L42A 1OPLA 1VUBA 3CCJA 5GJVB 4RTWA 3PE0A 1SRMA 3RBBB 3FB9A 3ER0A 3TCJA 1JBMA 1YIJA 3O8VA 1M90U 4BE0A 2OAUA 5KCHA 1UTIA 2CSIA 4CC3A 1WIEA 1S72T 1UG1A 4DBQA 2P0KA 3UATA 1NZ9A 2ZPBB 2W10A 1B3QA 2M0YA 3HKSA 2E65A 2RO0A 4M77A 1HYOA 1OZ3A 3CCUQ 1OQKA 2HDAA 2MK5A 4HCKA 4D8KA 3M0QA 2DD4A 3QZ5B 4AT1B 3TSWA 2H3EB 4IURA 2ZPFB 2QASA 3M0PA 2BKDN 3JCMX 4F7UF 2D0NA 2VVKA 1KIKA 2RHZA 4M7AB 2GTJA 3NPFA 2YUQA 2RD1A 2G3RA 2CZ0B 3MP8A 4X9DA 3M0UA 3RKXA 3LX7A 3EH2A 2LMJA 4J6WA 4C8QE 3A8LB 1MV0B 4E7JA 3VJPA 4F7UG 5C0MA 4JJNK 2F2VA 2MWPA 1Z9QA 5GAN7 2QGGA 3PGGA 1VQ5T 1VQ8A 1VQ7Q 1T0HA 4M7DB 3MCAB 2MAMA 1QVPA 2L8DA 3CC7A 2OTLA 2RB6A 1Q7YU 3MEAA 1QQJA 2LP5A 1OX8A 3HRTA 1M27C 3GP8A 3QPHA 2EYWA 5KE3A 5LL6S 1YNZA 1ZLMA 3MP6A 4A4FA 2OJ2A 3PIOA 4OF1A 1WGSA 1QP3A 3LW5E 2O31A 1PD1A 3SDZA 2KT8A 3HFNA 5GANh 3LH5A 1GFDA 1V76A 5KE2A 1M2VB 1M8VA 2WSFE 2DVEA 2ZPGB 1AWJA 1I1JA 3CCRA 4M7AG 3CMAT 4EIKA 3OYEA 1VQ6A 4IUQA 2LJ3A 3OYFA
chains in the Genus database with same CATH topology
2DRMA 2DX1A 3I35A 2FPEA 3PVLA 2DF6A 2J6OA 2L2PA 1ABOA 2L0AA 1GCQA 1AVZC 2LZ6B 3TSZA 1N5ZA 4OMMA 3U23A 3H0IA 2O2OA 1QCFA 3H0HA 2A08A 1K4US 4E6RA 3QWXX 3VS1A 5IHNA 3JV3A 1AWXA 1ZBJA 2RMOA 2RN8A 3UA7A 2YT6A 1WFWA 3EG1A 1QKXA 1ZSGA 2LCSA 1PRMC 1QWEA 4OMOA 2FPFA 2KGTA 2M51A 4IIOA 5IH2A 1M3CA 2ED0A 2GGRA 3PVQA 2AKLA 1ABQA 3IQLA 1JU5C 2RF0A 1AWWA 3EHQA 2QDLA 3CQTA 1UHCA 3NGPA 5GJWB 2EPDA 1BK2A 2CUDA 3EHRA 1HD3A 2AZSA 1ZX6A 4HXJA 3NHNA 3VS6A 1SHGA 2CREA 1WI7A 2FRWA 2A36A 2AK5A 2H8HA 4DEYA 2DVJA 4JPBW 4LE9A 4A63B 2RQVA 2GQIA 2ED1A 1GCPA 1X2KA 2JT4A 1WA7A 3ZL7C 4AFUC 4JZ3A 4JJCA 2RQRA 2OI3A 1VYTA 2KR3A 2BZYA 4J9EA 4AFZC 1M3BA 2J6FA 4GLMA 2GTOA 2DE0X 1WDXA 1NEGA 1NYFA 1PKSA 4RUGA 2KYBA 1K0XA 1ZUKA 2YUPA 1WX6A 1UGVA 1VA7A 2K6DA 2V1QA 2G6FX 1JXOA 2B86A 3REAB 1UECA 2DA9A 2KROA 2XMFA 4OMQA 4ZNXA 1NEBA 2VWFA 2I0NA 1PNJA 1WYXA 2DM1A 1JXMA 4DEXA 2ROTA 4J9DA 1AZEA 2L3SA 3VRZA 1TUCA 1GL5A 2BZ8A 5I22A 2K7AA 4AFSC 1U06A 4LNPA 2DMOA 3SHWA 2JMAA 1OV3A 2KNBB 2E5KA 2KBTA 4RTXA 2KXCA 2YUOA 4RTZA 4J9GA 1AZGB 2CUBA 2JTEA 3R6NA 2EKHA 3GBQA 2A28A 1XOVA 1W1FA 1A0NB 2LQNA 1I07A 2GBQA 4RTVA 2JW4A 3EGUA 4F17A 2BZXA 1G2BA 1SRLA 2EGCA 1SEMA 3VS7A 5IHIA 4WCIA 2JXBA 2ROLA 2LQWA 3QWYA 2YDLA 2VKNA 1Z9ZA 1AD5A 1SPKA 2PNIA 1LCKA 1QKWA 1GBRA 2D8HA 4LUDA 1PHTA 1K9AA 4GBQA 4OMPA 3UF4A 1WLPB 4J9BA 2PTKA 1SHFA 2C0TA 2HCKA 3C0CA 2K9GA 1T3SA 2J05A 1X43A 2LX7A 2HEQA 3M0RA 1PKTA 1ZUUA 2F2XA 2J6KA 1CSKA 4Z88A 1QWFA 2KRSA 1E6GA 2ESWA 2DYBA 2J06A 1UJ0A 1Y57A 1BBZA 4F14A 1X2QA 1UUEA 1IO6A 4OMNA 4AG2C 3I5SA 1X6GA 1YCSB 4FSSA 1NLPC 1JEGA 1GFCA 2EBPA 2X3WD 2W0ZA 2KE9A 1M3AA 1UHFA 2C0OA 2IIMA 2EGEA 2HBWA 2P4RA 4OMLA 2DLPA 1B07A 1RUWA 4F16A 3VS5A 2V1RA 1GCQC 2JS0A 2K2MA 4HVWA 1J3TA 4RTTA 1M30A 2EVRA 3EG2A 3SEMA 4D8DA 2K3BA 4RTUA 2BTTA 4HVVA 2JMCA 2D8JA 1X6BA 1TUDA 1AOJA 1MV3A 5I11A 2JM8A 1NG2A 5EC7A 1RLPC 4Y92A 4CC4B 2MOXA 1OEBA 2DL5A 1NM7A 1KFZA 4HVUA 1YWPA 1H3HA 5FW9A 1NYGA 2NUZA 1VYUA 3O5ZA 3FJ5A 2EYZA 2F2WA 3A98A 3KFVA 2DL3A 1UDLA 1WXBA 1E6HA 4J9IA 1RLQC 2SRCA 1VYVA 3THKA 1HJDA 2L3PA 5L23A 1FYNA 5IHKA 3ULRB 2LNHB 5HCKA 4IIMA 3VRYA 2DL4A 1ARKA 3UA6A 3VS3A 1WXUA 1I0CA 2PZ1A 4X1VA 1RI9A 2KXDA 2MCNA 1X69A 2ABLA 1FMKA 1PWTA 3VS0A 4AFQC 2DNUA 4JZ4A 1CKAA 1NLOC 1AEYA 4ORZA 1BB9A 5FWBA 3REBB 2CT3A 3EG3A 2J7IA 1H8KA 1EFNA 1W70A 2RNAA 1GBQA 1ZUYA 2RQTA 1KJWA 3M0TA 1OPLA 2K79A 5GJVB 1H92A 2CDTA 4LUEA 4RTWA 3PE0A 2L3QA 1M8MA 1SRMA 3RBBB 1OPKA 1HSQA 2A37A 1SSHA 1YP5A 2YSQA 1BU1A 2AKKA 3EG0A 3NMZC 3TVTA 1UTIA 2CSIA 1UE9A 2DILA 2FG0A 1WIEA 2FPDA 2RPNA 4CC3A 1UG1A 3UATA 2KEAA 4QT7A 1AWOA 2CT4A 4Z89A 1G83A 4KRTA 1T3LA 1B3QA 2W10A 2M0YA 2GNCA 1QLYA 4AG1C 2DL8A 2C0IA 2KRNA 2HDAA 2DJQA 4HCKA 4D8KA 2KRMA 1WXTA 3M0QA 3TSWA 2SEMA 1KSWA 1U5SA 2CH4A 1YWOA 1U3OA 4J9HA 2O88A 2FRYA 1V1CA 3M0PA 2AZVA 2D0NA 2VVKA 1KIKA 1K76A 2GTJA 3NPFA 2EGAA 3M0SA 3H0FA 2YUQA 4RTYA 2O9SA 2CH4W 3M0UA 2DBMA 2JM9A 2EQIA 2LMJA 4J9CA 1MV0B 2JS2A 1OOTA 1Y0MA 1YN8A 2ENMA 2F2VA 2X3XD 1Z9QA 2NWMA 1K1ZA 3RNJA 1W6XA 1T0HA 4CC2A 4JJBA 2KT1A 1CKBA 2DL7A 1MUZA 2MIOA 2EW3A 3VS4A 5IXFA 5FWCA 2LP5A 2RQWA 2DRKA 4CC7A 1M27C 1UFFA 1S1NA 1UJYA 2EYWA 2O9VA 2KYMA 2OAWA 1YNZA 1ZLMA 4LN2A 1E7OA 4J9FA 1X27A 2OJ2A 2LJ0A 1JQQA 5ECAA 2DBKA 2O31A 2EYXA 4JJDA 2KT8A 1TG0A 1PRLC 2D1XA 2ECZA 4Z8AA 4R0KA 3LH5A 4ESRA 1JO8A 1GFDA 1GRIA 2FO0A 4M4ZA 2LJ1A 1K0SA 3VS2A 3I9QA 3I5RA 1T0JA 1AWJA 5IXBA 1I1JA 4K11A 2EYYA 2FEIA 4EIKA 2HSPA 2CSQA 3H41A 2LJ3A 2RQUA 2YUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRM A;  2DX1 A;  3I35 A;  2FPE A;  3PVL A;  2DF6 A;  2J6O A;  2L2P A;  1ABO A;  2L0A A;  1GCQ A;  1AVZ C;  2LZ6 B;  3TSZ A;  1N5Z A;  4OMM A;  3U23 A;  3H0I A;  2O2O A;  1QCF A;  3H0H A;  2A08 A;  1K4U S;  4E6R A;  3QWX X;  3VS1 A;  5IHN A;  3JV3 A;  1AWX A;  1ZBJ A;  2RMO A;  2RN8 A;  3UA7 A;  2YT6 A;  1WFW A;  3EG1 A;  1QKX A;  1ZSG A;  2LCS A;  1PRM C;  1QWE A;  4OMO A;  2FPF A;  2KGT A;  2M51 A;  4IIO A;  5IH2 A;  1M3C A;  2ED0 A;  2GGR A;  3PVQ A;  2AKL A;  1ABQ A;  3IQL A;  1JU5 C;  2RF0 A;  1AWW A;  3EHQ A;  2QDL A;  3CQT A;  1UHC A;  3NGP A;  5GJW B;  2EPD A;  1BK2 A;  2CUD A;  3EHR A;  1HD3 A;  2AZS A;  1ZX6 A;  4HXJ A;  3NHN A;  3VS6 A;  1SHG A;  2CRE A;  1WI7 A;  2FRW A;  2A36 A;  2AK5 A;  2H8H A;  4DEY A;  2DVJ A;  4JPB W;  4LE9 A;  4A63 B;  2RQV A;  2GQI A;  2ED1 A;  1GCP A;  1X2K A;  2JT4 A;  1WA7 A;  3ZL7 C;  4AFU C;  4JZ3 A;  4JJC A;  2RQR A;  2OI3 A;  1VYT A;  2KR3 A;  2BZY A;  4J9E A;  4AFZ C;  1M3B A;  2J6F A;  4GLM A;  2GTO A;  2DE0 X;  1WDX A;  1NEG A;  1NYF A;  1PKS A;  4RUG A;  2KYB A;  1K0X A;  1ZUK A;  2YUP A;  1WX6 A;  1UGV A;  1VA7 A;  2K6D A;  2V1Q A;  2G6F X;  1JXO A;  2B86 A;  3REA B;  1UEC A;  2DA9 A;  2KRO A;  2XMF A;  4OMQ A;  4ZNX A;  1NEB A;  2VWF A;  2I0N A;  1PNJ A;  1WYX A;  2DM1 A;  1JXM A;  4DEX A;  2ROT A;  4J9D A;  1AZE A;  2L3S A;  3VRZ A;  1TUC A;  1GL5 A;  2BZ8 A;  5I22 A;  2K7A A;  4AFS C;  1U06 A;  4LNP A;  2DMO A;  3SHW A;  2JMA A;  1OV3 A;  2KNB B;  2E5K A;  2KBT A;  4RTX A;  2KXC A;  2YUO A;  4RTZ A;  4J9G A;  1AZG B;  2CUB A;  2JTE A;  3R6N A;  2EKH A;  3GBQ A;  2A28 A;  1XOV A;  1W1F A;  1A0N B;  2LQN A;  1I07 A;  2GBQ A;  4RTV A;  2JW4 A;  3EGU A;  4F17 A;  2BZX A;  1G2B A;  1SRL A;  2EGC A;  1SEM A;  3VS7 A;  5IHI A;  4WCI A;  2JXB A;  2ROL A;  2LQW A;  3QWY A;  2YDL A;  2VKN A;  1Z9Z A;  1AD5 A;  1SPK A;  2PNI A;  1LCK A;  1QKW A;  1GBR A;  2D8H A;  4LUD A;  1PHT A;  1K9A A;  4GBQ A;  4OMP A;  3UF4 A;  1WLP B;  4J9B A;  2PTK A;  1SHF A;  2C0T A;  2HCK A;  3C0C A;  2K9G A;  1T3S A;  2J05 A;  1X43 A;  2LX7 A;  2HEQ A;  3M0R A;  1PKT A;  1ZUU A;  2F2X A;  2J6K A;  1CSK A;  4Z88 A;  1QWF A;  2KRS A;  1E6G A;  2ESW A;  2DYB A;  2J06 A;  1UJ0 A;  1Y57 A;  1BBZ A;  4F14 A;  1X2Q A;  1UUE A;  1IO6 A;  4OMN A;  4AG2 C;  3I5S A;  1X6G A;  1YCS B;  4FSS A;  1NLP C;  1JEG A;  1GFC A;  2EBP A;  2X3W D;  2W0Z A;  2KE9 A;  1M3A A;  1UHF A;  2C0O A;  2IIM A;  2EGE A;  2HBW A;  2P4R A;  4OML A;  2DLP A;  1B07 A;  1RUW A;  4F16 A;  3VS5 A;  2V1R A;  1GCQ C;  2JS0 A;  2K2M A;  4HVW A;  1J3T A;  4RTT A;  1M30 A;  2EVR A;  3EG2 A;  3SEM A;  4D8D A;  2K3B A;  4RTU A;  2BTT A;  4HVV A;  2JMC A;  2D8J A;  1X6B A;  1TUD A;  1AOJ A;  1MV3 A;  5I11 A;  2JM8 A;  1NG2 A;  5EC7 A;  1RLP C;  4Y92 A;  4CC4 B;  2MOX A;  1OEB A;  2DL5 A;  1NM7 A;  1KFZ A;  4HVU A;  1YWP A;  1H3H A;  5FW9 A;  1NYG A;  2NUZ A;  1VYU A;  3O5Z A;  3FJ5 A;  2EYZ A;  2F2W A;  3A98 A;  3KFV A;  2DL3 A;  1UDL A;  1WXB A;  1E6H A;  4J9I A;  1RLQ C;  2SRC A;  1VYV A;  3THK A;  1HJD A;  2L3P A;  5L23 A;  1FYN A;  5IHK A;  3ULR B;  2LNH B;  5HCK A;  4IIM A;  3VRY A;  2DL4 A;  1ARK A;  3UA6 A;  3VS3 A;  1WXU A;  1I0C A;  2PZ1 A;  4X1V A;  1RI9 A;  2KXD A;  2MCN A;  1X69 A;  2ABL A;  1FMK A;  1PWT A;  3VS0 A;  4AFQ C;  2DNU A;  4JZ4 A;  1CKA A;  1NLO C;  1AEY A;  4ORZ A;  1BB9 A;  5FWB A;  3REB B;  2CT3 A;  3EG3 A;  2J7I A;  1H8K A;  1EFN A;  1W70 A;  2RNA A;  1GBQ A;  1ZUY A;  2RQT A;  1KJW A;  3M0T A;  1OPL A;  2K79 A;  5GJV B;  1H92 A;  2CDT A;  4LUE A;  4RTW A;  3PE0 A;  2L3Q A;  1M8M A;  1SRM A;  3RBB B;  1OPK A;  1HSQ A;  2A37 A;  1SSH A;  1YP5 A;  2YSQ A;  1BU1 A;  2AKK A;  3EG0 A;  3NMZ C;  3TVT A;  1UTI A;  2CSI A;  1UE9 A;  2DIL A;  2FG0 A;  1WIE A;  2FPD A;  2RPN A;  4CC3 A;  1UG1 A;  3UAT A;  2KEA A;  4QT7 A;  1AWO A;  2CT4 A;  4Z89 A;  1G83 A;  4KRT A;  1T3L A;  1B3Q A;  2W10 A;  2M0Y A;  2GNC A;  1QLY A;  4AG1 C;  2DL8 A;  2C0I A;  2KRN A;  2HDA A;  2DJQ A;  4HCK A;  4D8K A;  2KRM A;  1WXT A;  3M0Q A;  3TSW A;  2SEM A;  1KSW A;  1U5S A;  2CH4 A;  1YWO A;  1U3O A;  4J9H A;  2O88 A;  2FRY A;  1V1C A;  3M0P A;  2AZV A;  2D0N A;  2VVK A;  1KIK A;  1K76 A;  2GTJ A;  3NPF A;  2EGA A;  3M0S A;  3H0F A;  2YUQ A;  4RTY A;  2O9S A;  2CH4 W;  3M0U A;  2DBM A;  2JM9 A;  2EQI A;  2LMJ A;  4J9C A;  1MV0 B;  2JS2 A;  1OOT A;  1Y0M A;  1YN8 A;  2ENM A;  2F2V A;  2X3X D;  1Z9Q A;  2NWM A;  1K1Z A;  3RNJ A;  1W6X A;  1T0H A;  4CC2 A;  4JJB A;  2KT1 A;  1CKB A;  2DL7 A;  1MUZ A;  2MIO A;  2EW3 A;  3VS4 A;  5IXF A;  5FWC A;  2LP5 A;  2RQW A;  2DRK A;  4CC7 A;  1M27 C;  1UFF A;  1S1N A;  1UJY A;  2EYW A;  2O9V A;  2KYM A;  2OAW A;  1YNZ A;  1ZLM A;  4LN2 A;  1E7O A;  4J9F A;  1X27 A;  2OJ2 A;  2LJ0 A;  1JQQ A;  5ECA A;  2DBK A;  2O31 A;  2EYX A;  4JJD A;  2KT8 A;  1TG0 A;  1PRL C;  2D1X A;  2ECZ A;  4Z8A A;  4R0K A;  3LH5 A;  4ESR A;  1JO8 A;  1GFD A;  1GRI A;  2FO0 A;  4M4Z A;  2LJ1 A;  1K0S A;  3VS2 A;  3I9Q A;  3I5R A;  1T0J A;  1AWJ A;  5IXB A;  1I1J A;  4K11 A;  2EYY A;  2FEI A;  4EIK A;  2HSP A;  2CSQ A;  3H41 A;  2LJ3 A;  2RQU A;  2YUN A; 
#chains in the Genus database with same CATH topology
 2A7Y A;  4VUB A;  3RES A;  1ABO A;  2RK2 A;  1GCQ A;  1ZSZ A;  3JCM e;  4M77 E;  4PJO C;  3F70 A;  4IKF A;  3TSZ A;  4KUI A;  3LWI A;  4OMM A;  3H0I A;  4EMK C;  2JOY A;  5DY9 A;  3G4S A;  3VS1 A;  3HPW A;  3M59 A;  4LDX A;  4F04 B;  4V2S A;  2RN8 A;  1K9M C;  1WFW A;  1QKX A;  3MPU B;  2LCS A;  1PRM C;  1QWE A;  4XU2 A;  4OMO A;  1M3C A;  1M4Z A;  2DO3 A;  2GGR A;  4WF2 A;  3URG A;  2X35 A;  2VYT A;  3IQL A;  4A53 A;  4DBR A;  2O4X A;  2RF0 A;  1VQL A;  2F5K A;  3EGD B;  2QDL A;  3CQT A;  1UHC A;  1BK2 A;  1MMN A;  4BY6 B;  3EHR A;  2DZC A;  3HHT B;  4C0F A;  2RJE A;  4M7A C;  2HZY A;  4IUT A;  2H8H A;  1VQP T;  2R58 A;  2DD5 A;  1BI2 A;  2D0Q B;  4LE9 A;  3CCU T;  2GQI A;  3OSV A;  3OYK A;  3J7A F;  2JT4 A;  2M16 A;  4JJC A;  1Q82 C;  2AHJ B;  1TWB A;  4J9E A;  3C95 A;  3OW2 A;  1M3B A;  5CIU A;  1YBY A;  2J6F A;  4GLM A;  5CKB A;  1NYF A;  2R57 A;  2YUP A;  3QKJ A;  1WX6 A;  1Y96 B;  1K73 U;  3PIP A;  2QA4 Q;  4MZP A;  1UEC A;  2DA9 A;  2IPO B;  3OYA A;  3OYH A;  1KHC A;  5M9O A;  3TEE A;  2QQR A;  1LOJ A;  2ROT A;  3FDR A;  1VQM A;  3VRZ A;  4FT2 A;  2DMO A;  1IRE B;  1OV3 A;  2KNB B;  2KBT A;  3RDV A;  4LDU A;  4RTZ A;  4J9G A;  2CUB A;  2LCL A;  2K5I A;  2EJ9 A;  1XOV A;  2ZPI B;  2QEX Q;  1A0N B;  4BE2 A;  2VXE A;  4RTV A;  4F17 A;  5HK3 A;  2L3R A;  4M77 F;  4J6Y A;  2EKO A;  2QEX T;  2LQW A;  3CMA A;  3QWY A;  2VKN A;  1AD5 A;  1W2B P;  2X9H A;  1K9A A;  5CK9 A;  1WLP B;  3MJX A;  4JRQ A;  4J9B A;  2C0T A;  5GAM j;  2HCK A;  2K9G A;  5DM7 R;  3I56 A;  1T3S A;  2J05 A;  1X43 A;  2CP5 A;  1Y07 A;  1Q86 C;  1QVG P;  1PKT A;  5LJ3 f;  1ACM B;  3DLL A;  2CS7 A;  3MKD A;  1OX9 A;  4XU3 A;  2KRS A;  3MEU A;  2EIF A;  2LNV A;  1VOM A;  1UJ0 A;  1Y57 A;  4F14 A;  3P8D A;  1X2Q A;  1FWZ A;  4AG2 C;  1VQO Q;  3CD6 Q;  2L89 A;  2V8J A;  3I5S A;  1M90 R;  1X6G A;  1YCS B;  1NLP C;  1XNI A;  3S3M A;  1M3A A;  2JTM A;  2IIM A;  4C92 F;  3CCQ T;  5CKD A;  3N5B B;  2HBW A;  4C5E A;  4M78 G;  1B07 A;  3CBP A;  2EWN A;  3JCM W;  1VQ9 A;  2KAF A;  3CCM Q;  2RJD A;  2YRV A;  1WHJ A;  2DFU A;  4M75 D;  4MML A;  1MND A;  1YJN T;  3UPU A;  5IT9 E;  4M77 D;  4C92 G;  1D1A A;  3VYG A;  2EVR A;  3EG2 A;  3CCV A;  5CCA A;  7AT1 B;  2K3B A;  2VXF A;  4RTU A;  2BTT A;  2D8J A;  3A8H B;  1X6B A;  1TUD A;  1AOJ A;  1MV3 A;  5LJ5 j;  2JM8 A;  2MOX A;  2ZGW A;  1VQL Q;  1KFZ A;  3BY7 A;  1YWP A;  4N4I A;  3GNF B;  1U8R A;  2LQK A;  9ATC B;  2NUP B;  4BDY A;  2NUZ A;  1VYU A;  5GMK i;  4QVC A;  1JJ2 S;  2BUD A;  2F2W A;  3OYN A;  2QAZ A;  2XHC A;  2E1H A;  1UDL A;  5D6X A;  3S3N A;  1E6H A;  1XQH A;  4PFZ A;  4J9I A;  1R0B G;  2DYI A;  4M77 C;  3M56 A;  1PD0 A;  1FYN A;  2E64 A;  1Q86 R;  1K8A U;  5IHK A;  4IIM A;  4GY5 A;  5GAN e;  2RI2 A;  1WXU A;  2PZ1 A;  4TVR A;  5CKF A;  1RI9 A;  3EFO B;  1X69 A;  2ABL A;  4JZ4 A;  4E7S A;  1VQ8 T;  1VQ5 A;  1AEY A;  4KGV B;  1K9M R;  2DIQ A;  2HQX A;  1EFN A;  3CME A;  2FZG B;  4M7D E;  3I55 Q;  2RNA A;  1YJW A;  1Q81 C;  1W2B S;  3PMT A;  1KJW A;  4M7D G;  2P0Q A;  3RKW A;  2EFI A;  2DXT A;  2K79 A;  3PNW C;  3G71 A;  3D7S B;  4QQG A;  4HCZ A;  2CGH A;  2L3Q A;  1M8M A;  1H64 1;  2IVW A;  1KQS A;  4C92 C;  1WJQ A;  3OYL A;  1SSH A;  3RMQ A;  4BDZ A;  2YSQ A;  1BU1 A;  3EG0 A;  3I55 A;  1VQN T;  4KBM B;  2KI7 A;  1VQL T;  2LQ8 A;  1VQM T;  1UE9 A;  2RI3 A;  2FPD A;  3QHS A;  1BYM A;  2KDS A;  2KEA A;  1TS9 A;  4DOV A;  3M4Y A;  3VYH B;  1T3L A;  3FC3 A;  4RCB A;  1C0M A;  5GAO r;  3CBM A;  2C0I A;  2KRN A;  3OB9 A;  8ATC B;  3JCM c;  1NPP A;  3AT1 B;  4O6J A;  5LJ5 f;  1U3O A;  3INZ A;  2ZZD A;  2FRY A;  1V1C A;  1YIJ T;  2OX7 A;  4M78 E;  5GAN 2;  3CD6 T;  3QG1 A;  3G7Z A;  2MMP A;  3BFM A;  1WZO A;  1YHQ Q;  2EGA A;  3M0S A;  4PJL A;  4II1 A;  2O9S A;  2DJZ A;  4NS5 A;  2CP3 A;  5LJ3 g;  2DBM A;  1KG1 A;  1AT1 B;  4J9C A;  1TSF A;  1VQ6 Q;  3GNG A;  2FYK A;  2ENM A;  1D0X A;  4EMH A;  1G3T A;  3GF5 A;  3QYG B;  3L2Q A;  2P4T A;  2M9U A;  5GMK l;  3DKM A;  4JS4 A;  2JNG A;  4JJB A;  3EAE A;  5A0D A;  3M57 A;  2VGM A;  3VS4 A;  2MIO A;  2EW3 A;  5IXF A;  2QA4 A;  3X26 B;  1UGQ B;  4M7D A;  3E9F A;  4J6X A;  1VQN Q;  2BIV A;  2HQE A;  5GAN j;  1UFF A;  1HXD A;  4GLK A;  4Y28 E;  2OAW A;  4LN2 A;  3EG9 A;  1TTH B;  4YTL A;  1VQ4 A;  3QBY A;  1Y7X A;  1X27 A;  3UWN A;  1JQQ A;  4KH1 B;  1Q81 R;  2EYX A;  4FSX A;  2DXB A;  2GQV A;  1PRL C;  5CVI A;  2D1X A;  3CCL A;  2PUO B;  4R0K A;  4KGZ B;  1OZ2 A;  4ESR A;  1KD1 R;  1JO8 A;  2FO0 A;  2LJ1 A;  1K0S A;  3I9Q A;  1T0J A;  2QYZ A;  3CCR Q;  2EYY A;  1IB8 A;  1V29 B;  4LD9 K;  2FEI A;  3H41 A;  4FYV B;  2DTH A;  2RQU A;  4Z02 A;  2K57 A;  3I35 A;  4B9X A;  3CCQ Q;  2F1L A;  4FL6 A;  1AVZ C;  5DLO A;  2LZ6 B;  5J26 A;  1BI3 A;  1FMW A;  3I55 T;  4E7I A;  4BI3 A;  1QCF A;  2WSC E;  2VC8 A;  3QWX X;  1PCX A;  1RAB B;  5IHN A;  5CR2 A;  1KQ2 A;  2HMA A;  2RHU A;  3UA7 A;  2YT6 A;  1ZSG A;  1WJS A;  2OTJ Q;  3CPW S;  3OSS C;  2KK4 A;  2KQW A;  1X6O A;  3OA6 A;  4KH0 B;  3PMI A;  2PVD B;  1N27 A;  3OMG A;  1N9S A;  2YRC A;  2Y90 A;  4BY6 C;  4KUL A;  3NGP A;  3RER A;  5GJW B;  2EPD A;  4E7L A;  2CUD A;  2YHT A;  3GLX A;  4A4K A;  4HXJ A;  1IRX A;  5I2M A;  5D7U A;  1YI2 Q;  5FLX E;  1SHG A;  2Y4X A;  2FRW A;  3E1S A;  3EFO A;  4CRI A;  2AK5 A;  3WVE B;  3CXC A;  2QDY B;  2PVO B;  3G4S T;  1I81 A;  4QVZ A;  1N6A A;  4JPB W;  2O01 E;  2RQV A;  2XID A;  4E47 A;  3UDC A;  3QSU A;  4C0D B;  4ZTJ A;  3ZL7 C;  4R55 A;  2E6N A;  1KQS S;  2OI3 A;  5KYX B;  1VYT A;  2KR3 A;  3TRE A;  2E3H A;  5GMK e;  1ZBX A;  3LWH A;  3FJP A;  4R56 A;  2KYB A;  4L59 A;  3X28 B;  2XDP A;  5GAN 6;  2M02 A;  1JJ2 P;  4OP0 A;  1UGV A;  2K6D A;  4A54 A;  4ZGE B;  3VV0 A;  2V1Q A;  2G6F X;  3AHU A;  2B86 A;  4DOW A;  1YIT Q;  4M78 B;  5GAM d;  2D9T A;  2E70 A;  4FW1 A;  5J3B A;  1VIF A;  4LXC A;  4ZNX A;  1D0Z A;  4OB1 B;  2GFU A;  1D09 B;  4M7D F;  1PNJ A;  1WYX A;  4NL2 A;  1WHG A;  1JXM A;  4BE1 A;  4J9D A;  1C6V X;  2YLB A;  1GL5 A;  3QDR B;  2CP2 A;  5EG2 A;  3CCE Q;  1U06 A;  4LNP A;  1NE8 A;  3H9N A;  3MEV A;  4C8Q B;  4RG8 A;  3OYC A;  2YUO A;  4ME7 A;  4ATO A;  2JTE A;  3R6N A;  2EKH A;  4J8O A;  2A28 A;  1W1F A;  2A3L A;  5KYY B;  2LQN A;  2GBQ A;  1H3Z A;  1RAG B;  3EGU A;  1S72 A;  2EGC A;  4O5V A;  3VS7 A;  5IHI A;  2JXB A;  3PT9 A;  1Y71 A;  2FHD A;  2PNI A;  3OYI A;  1LCK A;  2CP6 A;  1GBR A;  4LUD A;  1PHT A;  4OMP A;  3MHX A;  1DJ7 B;  1SHF A;  2CP7 A;  2JTF A;  1QW1 A;  2LX7 A;  4ZN1 A;  3M0R A;  1MMG A;  2JJ9 A;  1UB4 A;  4F7U A;  2Z0W A;  4UC4 A;  3G4S Q;  3G71 Q;  1CSK A;  1K8A C;  4Z88 A;  5DLQ E;  1QVG S;  5LJ5 d;  3OQ5 A;  3CC4 Q;  3WXM B;  2ZPH B;  4HCC A;  4J7F A;  1IO6 A;  4J5Y A;  3JCM h;  4C8Q F;  5LJ3 d;  1QVF A;  1Q82 R;  2W0Z A;  2DKG A;  1R0C B;  3OYY A;  3A8G B;  1YJ9 A;  4FW2 A;  2C0O A;  5FU7 C;  3OBW A;  1N9R A;  2YRD A;  2P4R A;  2DLP A;  2MWO A;  4KT0 E;  3C94 A;  4B6M A;  1RUW A;  4M78 F;  5GAO l;  3VS5 A;  1QVF S;  1M30 A;  3MEW A;  1UGS B;  3JRZ A;  4EPC A;  3CC7 T;  3SWN A;  5I11 A;  2XDD A;  5EC7 A;  4RCC A;  1XJW B;  4DBH A;  1OEB A;  2MF2 A;  1NM7 A;  3HP9 A;  2LC4 A;  3CC7 Q;  2MI6 A;  4PJO E;  1H3H A;  2EYQ A;  3CCE A;  1NYG A;  3X20 B;  4JLI A;  4QW2 A;  1YI2 A;  3M58 A;  4ZTF A;  4FYY B;  4JDS A;  5GAN f;  5IN1 A;  1RAE B;  3CC2 A;  1VQ9 T;  1VYV A;  4M7A D;  1RAD B;  5KCO A;  1HJD A;  5L23 A;  2RI5 A;  4MDX A;  2QQS A;  3ULR B;  4ZGJ B;  2FB7 A;  2DIG A;  3CC2 T;  4X1V A;  4FCY A;  2GCX A;  3L2W A;  1BCO A;  4XTV A;  2MCN A;  5FU6 B;  2LDM A;  2DNU A;  2L5Q A;  3CC2 Q;  5CQY A;  3OW2 S;  4PJO B;  4ORZ A;  4M7A E;  2GFA A;  3LLR A;  3M55 A;  5GAM e;  3QO3 A;  2QA4 T;  2XIC A;  3EG3 A;  1ZHI A;  1ZSZ B;  2FZC B;  3S6W A;  1RAA B;  1Q81 U;  1MGQ A;  4C0G A;  4RG2 A;  1B7T A;  2RQT A;  3V8J A;  1VQ4 T;  1D1B A;  1KHI A;  4HT8 A;  3M0T A;  2DEQ A;  2DEU A;  2DXU A;  3GOX A;  2QTX A;  1H92 A;  4LUE A;  4QQD A;  2EJF A;  5GAN g;  4Q5W A;  1LNX A;  1OPK A;  3HL8 A;  3LGL A;  2EQM A;  1M9S A;  2X4X A;  1EZZ B;  2AKK A;  1NJI R;  5GMK m;  3NMZ C;  3EGX A;  1WJR A;  4A4G A;  3G1J A;  4OB3 B;  2FG0 A;  2X4J A;  3L1A A;  2NYS A;  4M75 E;  3CXC S;  5GAN 8;  4QT7 A;  1AWO A;  2DTI A;  4Z89 A;  1BKB A;  1M1F A;  3CXC P;  1QLY A;  2DTO A;  2OTL T;  2DER A;  3JCM J;  4M78 D;  3M54 A;  4LDW A;  2LTO A;  1WXT A;  3CMA Q;  4BAC A;  4M77 G;  3JB9 D;  2SEM A;  1KSW A;  1U5S A;  2CH4 A;  4KGX B;  4BB7 A;  1C1A A;  2AZV A;  3CCS Q;  5FRO A;  2CYZ B;  1BI1 A;  3ZBD A;  1NJI C;  2CZ7 B;  3JCM V;  1K76 A;  3JCM d;  4XTY A;  1M1G A;  2FZK B;  4OB2 B;  4RTY A;  5GAN 5;  4N0A C;  3OS2 A;  1M5Q 1;  3V7C A;  1ZA1 B;  2RJC A;  3EH1 A;  2JM9 A;  2R5M A;  3CEY A;  3V7S A;  2QI2 A;  1OOT A;  1VIE A;  1Y0M A;  2YWW A;  3JSC A;  4N4H A;  1YJN Q;  1WHK A;  2PUK B;  5KH6 A;  5HK0 A;  3RNJ A;  1W6X A;  4CC2 A;  2K4Y A;  3C12 A;  4M77 B;  2DL7 A;  2QEX A;  1MUZ A;  1MMD A;  2RQW A;  5A0L A;  4CC7 A;  1PSF A;  1S1N A;  5FRN A;  1E7O A;  4C92 B;  3T9N A;  3L2U A;  2WAC A;  2DBK A;  3X25 B;  2V26 A;  2ECZ A;  3NTH A;  1YHQ A;  4M4Z A;  3VS2 A;  1OUL A;  1KC8 U;  1Q7Y R;  2DK3 A;  4C92 E;  4DQ2 A;  4K11 A;  1WHH A;  1PSE A;  2CSQ A;  5GAM h;  3JB9 H;  2E41 A;  3BDL A;  1WQ7 A;  3M4G A;  2DX1 A;  1QVF P;  2FPE A;  4Y91 A;  3CD6 A;  1G3S A;  2DF6 A;  8AT1 B;  1K8A R;  2J6O A;  2KY9 A;  1SG5 A;  2L0A A;  3P8H A;  2FVU A;  4X34 A;  2HNI A;  4KUD K;  2ZCF B;  1Y96 A;  5GAN d;  3LYI A;  3J81 E;  4BUG A;  1N5Z A;  1G3Y A;  1U1S A;  4LDV A;  2X4Y A;  1TXQ A;  2O2O A;  2M1H A;  3H0H A;  1QP2 A;  1X75 C;  4XTU A;  3OS0 A;  3PTA A;  5GMK j;  2CZ6 B;  5AT1 B;  1VQN A;  1JB0 E;  4PFO A;  4X9C A;  2WSE E;  3EG1 A;  1ZA2 B;  4EMK B;  4WTO B;  3OYB A;  1K9M U;  3NFC A;  3L2Z A;  2OTJ A;  4J83 A;  4EDU A;  2V8I A;  2M51 A;  3CME Q;  3A5Z B;  3JB9 F;  2O4X B;  3PVQ A;  2AKL A;  1ABQ A;  3LH0 A;  4JS5 A;  1I5O B;  3PFS A;  1JU5 C;  5FU6 C;  3CME T;  2GF7 A;  1TU0 B;  4FYX B;  4M7D C;  4C92 D;  1TUG B;  4ZGD B;  1MMA A;  2PU9 B;  3EGD A;  2AZS A;  2KSS A;  3S3O A;  3VS6 A;  1TH7 A;  2A36 A;  4FIB A;  4HT9 A;  2V8K A;  1W2B A;  1VQO A;  2ED1 A;  4EMG A;  1GCP A;  1X2K A;  2K3Y A;  4CI0 C;  4AFU C;  4JZ3 A;  4N0A A;  1TOV A;  2H3J A;  4AFZ C;  2HL5 C;  4PJO G;  3JB9 G;  1WDX A;  1NBE B;  2AT1 B;  1LPL A;  2HKQ B;  4RUG A;  5GAO q;  3MO8 A;  4FYW B;  3CCM A;  3P8B B;  3OS1 A;  1VA7 A;  1JXO A;  3H6Z A;  2QTV A;  4OGE A;  1RAF B;  3JAM E;  3KUF A;  1B34 A;  2XMF A;  3M9Q A;  5KYU A;  2QQB A;  2VWF A;  1KQS P;  2I0N A;  5CKH A;  3V7R A;  2L3S A;  5LJ5 g;  1TUC A;  3EFR A;  1VQ6 T;  2K7A A;  2RA2 A;  3SHW A;  1BIB A;  1RAH B;  3EFS A;  4M78 C;  1AZG B;  3QDF A;  3I56 Q;  2DXC A;  1D3B B;  1I07 A;  2QGF B;  3X24 B;  5GAO p;  4C8Q G;  1I4K 1;  2XKO C;  2JW4 A;  4M75 F;  1SRL A;  3CCU A;  3BW1 A;  1S72 Q;  5CO7 A;  4DA4 A;  4NOY A;  1GXI E;  2EQK A;  1R77 A;  2ROL A;  2EAY A;  1BI0 A;  1SPK A;  2B8A A;  3BDU A;  4GBQ A;  3CPW P;  3C0C A;  1FMV A;  3M5A A;  2VB6 A;  5D6Y A;  3HRU A;  4DBF A;  2HEQ A;  6AT1 B;  1ZUU A;  1VQP Q;  2F2X A;  2J6K A;  3E9G A;  4M75 A;  5LJ5 h;  3MP1 A;  2BE9 B;  1QWF A;  4M75 B;  1KQ1 A;  2ESW A;  5FU7 B;  4MZM A;  2J06 A;  3GIB A;  2E3I A;  4IUP A;  1YIJ Q;  1O9S A;  2PQW A;  3J80 E;  4FSS A;  1JEG A;  1GFC A;  2EBP A;  2X3W D;  2HD0 A;  3HTR A;  4QQ6 A;  3OYM A;  1IHV A;  1UHF A;  2YLC A;  1YHQ T;  2DPP B;  3OYJ A;  3JCM g;  4JRP A;  1G3W A;  3H8Z A;  4MDW A;  4D6W A;  1PM3 A;  4OML A;  5GMK h;  5I21 A;  2EQJ A;  4L6V 5;  3WVD B;  5GAO n;  2C06 A;  1GCQ C;  1SSF A;  3KBG A;  1BIA A;  1J3T A;  4RTT A;  1QCO A;  2COY A;  4D8D A;  4AMC A;  5KYW A;  2QQ9 A;  3JCM b;  2HKN A;  4JRK A;  3RR6 A;  1D3B A;  4HVU A;  4ZN3 A;  1I8F A;  1SF9 A;  1AHJ B;  5FW9 A;  4PJM A;  2NLU A;  3CC4 A;  3TQ7 P;  2EYZ A;  4XQ3 A;  3A98 A;  2NUP A;  3LGF A;  4XU0 A;  1WQW A;  3OS5 A;  1IGU A;  4F7U E;  3JCM Q;  3DLM A;  4E2F B;  3THK A;  1UGP B;  1HK9 A;  4ELY C;  2K2V A;  2E4H A;  4RMO A;  5HCK A;  3C4S A;  4C5I A;  1YJW Q;  1VQ7 A;  1VQ8 Q;  2JZ2 A;  1IXD A;  2VUB A;  1RI0 A;  1ZQ1 A;  4PJO D;  4PL6 A;  1FMK A;  1PWT A;  2LT1 A;  3VS0 A;  4OVA A;  4AFQ C;  5I2S A;  1VQK T;  2JN0 A;  3JCM P;  4FM4 B;  5FWB A;  3REB B;  2CT3 A;  4E7Z A;  3A1P A;  4BI4 A;  4M78 A;  2A0F B;  2BE7 D;  5L8R E;  1W70 A;  1JRI A;  5KYW B;  5AYF A;  1GBQ A;  4ANJ A;  3RIR A;  4HA8 A;  3OBY A;  1UGR B;  2F5T X;  2CDT A;  4JUV A;  3RUX A;  3CCJ T;  1HSQ A;  4PJO A;  2A37 A;  1YP5 A;  1WNL A;  3FLG A;  3ZEH A;  3QYH B;  1BCM A;  3TVT A;  4C8Q D;  5CAI A;  1YFN A;  2DIL A;  4PK4 A;  2RPN A;  1M2V A;  2K5L A;  2ZAE A;  2JVV A;  2ZPE B;  4FU6 A;  3V8K A;  3HRS A;  2CT4 A;  2E5Q A;  3QJY A;  1YI2 T;  1RL2 A;  1G83 A;  3QJ6 A;  4KRT A;  2GNC A;  4PJO F;  2IG0 A;  2DL8 A;  4AG1 C;  1K73 R;  3FRN A;  2CP0 A;  3QII A;  2DJQ A;  2KRM A;  3KXT A;  1N8R U;  1IZ6 A;  2COW A;  4IUU A;  1W4S A;  3TU4 K;  1KC8 C;  1YWO A;  4J9H A;  4N4G A;  1QVG A;  2O88 A;  4M7A A;  2E12 A;  3L2R A;  4PLL A;  3CCS A;  1M1K R;  1QCN A;  3SWN C;  3H0F A;  2EQU A;  5GAO m;  4FT4 A;  2CH4 W;  2HL3 A;  2RHI A;  1SKU B;  2EQI A;  3RKY A;  4M7A F;  2JS2 A;  4XTW A;  4OMF B;  1YN8 A;  1Q82 U;  3CCE T;  1YJ9 Q;  2X3X D;  3I56 T;  2HSE B;  2DAQ A;  2NWM A;  3GPL A;  1K1Z A;  4PNO A;  4A4H A;  2KT1 A;  1YJ9 T;  1O75 A;  1CKB A;  2E10 A;  1FX7 A;  2RJF A;  2XDB A;  5FWC A;  3V8L A;  2DRK A;  3HSB A;  1UJY A;  2O9V A;  2KYM A;  3QUI A;  4EMK A;  4J9F A;  1UEB A;  2LJ0 A;  2X51 A;  1LJO A;  5ECA A;  4P5N A;  3FEO A;  5LJ3 h;  4JJD A;  1TG0 A;  4XTX A;  4Z8A A;  3CCQ A;  2RK1 A;  4XK8 E;  4C0D C;  1GRI A;  3CPW A;  5GAM f;  3L2V A;  3I5R A;  2DZ9 A;  5IXB A;  3BE3 A;  4PLI A;  1VQO T;  2HSP A;  2YUN A;  1WHM A;  2LRQ A;  2DRM A;  3CCR T;  2LVM A;  1YIT T;  3PVL A;  3Q1J A;  3RMS A;  2L2P A;  1RAC B;  5GAM g;  4M75 C;  2LCC A;  2I2L A;  1Q7Y C;  2AIR B;  4PKC C;  1JJ2 A;  5A2Q E;  3CCM T;  1R8O B;  3U23 A;  2A08 A;  1K4U S;  4LD6 A;  4E6R A;  4MMK A;  1LVK A;  2OTJ T;  1VQP A;  3JV3 A;  3JB9 I;  1AWX A;  1ZBJ A;  2RMO A;  4J7I A;  3G6E Q;  1YCY A;  2VGN A;  2FPF A;  2KGT A;  4IIO A;  5IH2 A;  2K3X A;  2ED0 A;  3MET A;  2KMT A;  2PVG B;  3G6E T;  4M7D D;  2R5A A;  4JRI A;  2VAS A;  1IHW A;  3JB9 J;  1AWW A;  3EHQ A;  1G8X A;  1VQM Q;  3QZ9 B;  1HD3 A;  3G6E A;  1ZX6 A;  3FIF A;  3NHN A;  3VUZ A;  2CRE A;  1D1C A;  1WI7 A;  4C0Z A;  4C8Q C;  1VQ9 Q;  4DEY A;  2XD0 A;  3VU3 C;  3NTI A;  2DVJ A;  1NJI U;  1OU9 A;  4A63 B;  4XU1 A;  2K5F A;  5CQX A;  3CBO A;  5HKC A;  1WA7 A;  4HKE A;  4M75 G;  1YJW T;  1OU8 A;  2RQR A;  2QXF A;  2BZY A;  3NTK A;  4F7U B;  2GTO A;  2DE0 X;  1NEG A;  1PKS A;  1K0X A;  3SFM A;  1VQK Q;  1ZUK A;  2LT4 A;  2LX9 A;  2P0P A;  5CKE A;  2QG9 B;  1K73 C;  3OYD A;  3REA B;  2XK0 A;  2KRO A;  3EG9 B;  4OMQ A;  1NEB A;  4C5G A;  1Q86 U;  2DET A;  4E7K A;  1FXX A;  2EJG A;  2DM1 A;  4DEX A;  4C92 A;  1AZE A;  4PJJ A;  2BZ8 A;  5I22 A;  4AFS C;  4RKU E;  1U1T A;  2JMA A;  1N8R C;  1X01 A;  2E5K A;  4RTX A;  3CCJ Q;  2KXC A;  3E19 A;  4MZT A;  3ASK A;  2RHY A;  3M53 A;  3GBQ A;  1WHL A;  1VQ5 Q;  1VQ7 T;  5HY6 A;  3VKI A;  5GAN 4;  2BZX A;  1G2B A;  5KYU B;  2M0O A;  1D0Y A;  1SEM A;  5KYY A;  5J39 A;  4WCI A;  5KYX A;  1M1K C;  2RM4 A;  5A0G A;  2NUT B;  3SD4 A;  2XI9 A;  1EIF A;  2YDL A;  1Z9Z A;  3ME9 A;  1QKW A;  2D8H A;  1F1B B;  4JLG A;  3UF4 A;  3CCL Q;  3SB2 A;  2PTK A;  2XU8 A;  1M2O A;  2OTL Q;  2FL7 A;  3ZFJ A;  1M90 C;  3CC4 T;  2HBP A;  5D6W A;  5LJ5 e;  4L5G A;  3E2U A;  2F69 A;  2NUT A;  3CCL T;  4HCB A;  3QXE B;  1E6G A;  4C5H A;  4BI8 B;  2DYB A;  4OB0 B;  2MPX C;  1Q95 G;  1BBZ A;  5LJ3 e;  4E7H A;  5IAY A;  1UUE A;  4OMN A;  3CCS T;  3EGX B;  2MYS A;  1G5V A;  4A4E A;  1KD1 C;  2KE9 A;  2YXY A;  3OMC A;  5KYN A;  1OI1 A;  1KC8 R;  2EGE A;  2XG8 D;  4LDY A;  1RAI B;  1I5L A;  4PJN A;  1KK7 A;  2D6F A;  4F16 A;  2V1R A;  1OYX A;  2JS0 A;  2K2M A;  4HVW A;  3A8O B;  2COZ A;  3SEM A;  3CCV Q;  1N8R R;  4HVV A;  1EX4 A;  2JMC A;  3OYG A;  2QQA A;  4QVD A;  1NG2 A;  1RLP C;  4Y92 A;  2CZ1 B;  3CCV T;  1IGQ A;  4CC4 B;  2X4W A;  2DL5 A;  1MNE A;  2HQH A;  1M1K U;  3O5Z A;  2RH2 A;  4XTZ A;  2E6Z A;  5LJ3 j;  3FJ5 A;  2KVQ G;  3KFV A;  2DL3 A;  2CKK A;  1WXB A;  3CPF A;  1P92 A;  1RLQ C;  2SRC A;  4IUV A;  2L3P A;  4QKU A;  3OW2 P;  3DB4 A;  2JUF A;  3JCM f;  2RHX A;  2LNH B;  2ATC B;  3VRY A;  2DL4 A;  4NL3 A;  4C8Q A;  3G71 T;  4PFP A;  1ARK A;  3UA6 A;  1PG5 B;  5C6S A;  3VS3 A;  1I0C A;  3VUB A;  5FRM A;  1VQK A;  1ZSZ C;  1WPY A;  2KXD A;  2VV5 A;  1XTD A;  2P84 A;  1CKA A;  1NLO C;  2Y4Y A;  4OGC A;  3DB3 A;  1BB9 A;  1YIT A;  5GAN 3;  1B34 B;  1QMC A;  1PC0 A;  2J7I A;  3SWN B;  1YJN A;  1VQ4 Q;  1H8K A;  3R6O A;  4B9W A;  4BD3 A;  3OY9 A;  3A8M B;  4ELZ C;  2HAX A;  1KD1 U;  1NPR A;  4XAX B;  1ZUY A;  3HFO A;  2QK0 A;  3UT1 A;  1MHN A;  3L42 A;  1OPL A;  1VUB A;  3CCJ A;  5GJV B;  4RTW A;  3PE0 A;  1SRM A;  3RBB B;  3FB9 A;  3ER0 A;  3TCJ A;  1JBM A;  1YIJ A;  3O8V A;  1M90 U;  4BE0 A;  2OAU A;  5KCH A;  1UTI A;  2CSI A;  4CC3 A;  1WIE A;  1S72 T;  1UG1 A;  4DBQ A;  2P0K A;  3UAT A;  1NZ9 A;  2ZPB B;  2W10 A;  1B3Q A;  2M0Y A;  3HKS A;  2E65 A;  2RO0 A;  4M77 A;  1HYO A;  1OZ3 A;  3CCU Q;  1OQK A;  2HDA A;  2MK5 A;  4HCK A;  4D8K A;  3M0Q A;  2DD4 A;  3QZ5 B;  4AT1 B;  3TSW A;  2H3E B;  4IUR A;  2ZPF B;  2QAS A;  3M0P A;  2BKD N;  3JCM X;  4F7U F;  2D0N A;  2VVK A;  1KIK A;  2RHZ A;  4M7A B;  2GTJ A;  3NPF A;  2YUQ A;  2RD1 A;  2G3R A;  2CZ0 B;  3MP8 A;  4X9D A;  3M0U A;  3RKX A;  3LX7 A;  3EH2 A;  2LMJ A;  4J6W A;  4C8Q E;  3A8L B;  1MV0 B;  4E7J A;  3VJP A;  4F7U G;  5C0M A;  4JJN K;  2F2V A;  2MWP A;  1Z9Q A;  5GAN 7;  2QGG A;  3PGG A;  1VQ5 T;  1VQ8 A;  1VQ7 Q;  1T0H A;  4M7D B;  3MCA B;  2MAM A;  1QVP A;  2L8D A;  3CC7 A;  2OTL A;  2RB6 A;  1Q7Y U;  3MEA A;  1QQJ A;  2LP5 A;  1OX8 A;  3HRT A;  1M27 C;  3GP8 A;  3QPH A;  2EYW A;  5KE3 A;  5LL6 S;  1YNZ A;  1ZLM A;  3MP6 A;  4A4F A;  2OJ2 A;  3PIO A;  4OF1 A;  1WGS A;  1QP3 A;  3LW5 E;  2O31 A;  1PD1 A;  3SDZ A;  2KT8 A;  3HFN A;  5GAN h;  3LH5 A;  1GFD A;  1V76 A;  5KE2 A;  1M2V B;  1M8V A;  2WSF E;  2DVE A;  2ZPG B;  1AWJ A;  1I1J A;  3CCR A;  4M7A G;  3CMA T;  4EIK A;  3OYE A;  1VQ6 A;  4IUQ A;  2LJ3 A;  3OYF A; 
#chains in the Genus database with same CATH homology
 2DRM A;  2DX1 A;  3I35 A;  2FPE A;  3PVL A;  2DF6 A;  2J6O A;  2L2P A;  1ABO A;  2L0A A;  1GCQ A;  1AVZ C;  2LZ6 B;  3TSZ A;  1N5Z A;  4OMM A;  3U23 A;  3H0I A;  2O2O A;  1QCF A;  3H0H A;  2A08 A;  1K4U S;  4E6R A;  3QWX X;  3VS1 A;  5IHN A;  3JV3 A;  1AWX A;  1ZBJ A;  2RMO A;  2RN8 A;  3UA7 A;  2YT6 A;  1WFW A;  3EG1 A;  1QKX A;  1ZSG A;  2LCS A;  1PRM C;  1QWE A;  4OMO A;  2FPF A;  2KGT A;  2M51 A;  4IIO A;  5IH2 A;  1M3C A;  2ED0 A;  2GGR A;  3PVQ A;  2AKL A;  1ABQ A;  3IQL A;  1JU5 C;  2RF0 A;  1AWW A;  3EHQ A;  2QDL A;  3CQT A;  1UHC A;  3NGP A;  5GJW B;  2EPD A;  1BK2 A;  2CUD A;  3EHR A;  1HD3 A;  2AZS A;  1ZX6 A;  4HXJ A;  3NHN A;  3VS6 A;  1SHG A;  2CRE A;  1WI7 A;  2FRW A;  2A36 A;  2AK5 A;  2H8H A;  4DEY A;  2DVJ A;  4JPB W;  4LE9 A;  4A63 B;  2RQV A;  2GQI A;  2ED1 A;  1GCP A;  1X2K A;  2JT4 A;  1WA7 A;  3ZL7 C;  4AFU C;  4JZ3 A;  4JJC A;  2RQR A;  2OI3 A;  1VYT A;  2KR3 A;  2BZY A;  4J9E A;  4AFZ C;  1M3B A;  2J6F A;  4GLM A;  2GTO A;  2DE0 X;  1WDX A;  1NEG A;  1NYF A;  1PKS A;  4RUG A;  2KYB A;  1K0X A;  1ZUK A;  2YUP A;  1WX6 A;  1UGV A;  1VA7 A;  2K6D A;  2V1Q A;  2G6F X;  1JXO A;  2B86 A;  3REA B;  1UEC A;  2DA9 A;  2KRO A;  2XMF A;  4OMQ A;  4ZNX A;  1NEB A;  2VWF A;  2I0N A;  1PNJ A;  1WYX A;  2DM1 A;  1JXM A;  4DEX A;  2ROT A;  4J9D A;  1AZE A;  2L3S A;  3VRZ A;  1TUC A;  1GL5 A;  2BZ8 A;  5I22 A;  2K7A A;  4AFS C;  1U06 A;  4LNP A;  2DMO A;  3SHW A;  2JMA A;  1OV3 A;  2KNB B;  2E5K A;  2KBT A;  4RTX A;  2KXC A;  2YUO A;  4RTZ A;  4J9G A;  1AZG B;  2CUB A;  2JTE A;  3R6N A;  2EKH A;  3GBQ A;  2A28 A;  1XOV A;  1W1F A;  1A0N B;  2LQN A;  1I07 A;  2GBQ A;  4RTV A;  2JW4 A;  3EGU A;  4F17 A;  2BZX A;  1G2B A;  1SRL A;  2EGC A;  1SEM A;  3VS7 A;  5IHI A;  4WCI A;  2JXB A;  2ROL A;  2LQW A;  3QWY A;  2YDL A;  2VKN A;  1Z9Z A;  1AD5 A;  1SPK A;  2PNI A;  1LCK A;  1QKW A;  1GBR A;  2D8H A;  4LUD A;  1PHT A;  1K9A A;  4GBQ A;  4OMP A;  3UF4 A;  1WLP B;  4J9B A;  2PTK A;  1SHF A;  2C0T A;  2HCK A;  3C0C A;  2K9G A;  1T3S A;  2J05 A;  1X43 A;  2LX7 A;  2HEQ A;  3M0R A;  1PKT A;  1ZUU A;  2F2X A;  2J6K A;  1CSK A;  4Z88 A;  1QWF A;  2KRS A;  1E6G A;  2ESW A;  2DYB A;  2J06 A;  1UJ0 A;  1Y57 A;  1BBZ A;  4F14 A;  1X2Q A;  1UUE A;  1IO6 A;  4OMN A;  4AG2 C;  3I5S A;  1X6G A;  1YCS B;  4FSS A;  1NLP C;  1JEG A;  1GFC A;  2EBP A;  2X3W D;  2W0Z A;  2KE9 A;  1M3A A;  1UHF A;  2C0O A;  2IIM A;  2EGE A;  2HBW A;  2P4R A;  4OML A;  2DLP A;  1B07 A;  1RUW A;  4F16 A;  3VS5 A;  2V1R A;  1GCQ C;  2JS0 A;  2K2M A;  4HVW A;  1J3T A;  4RTT A;  1M30 A;  2EVR A;  3EG2 A;  3SEM A;  4D8D A;  2K3B A;  4RTU A;  2BTT A;  4HVV A;  2JMC A;  2D8J A;  1X6B A;  1TUD A;  1AOJ A;  1MV3 A;  5I11 A;  2JM8 A;  1NG2 A;  5EC7 A;  1RLP C;  4Y92 A;  4CC4 B;  2MOX A;  1OEB A;  2DL5 A;  1NM7 A;  1KFZ A;  4HVU A;  1YWP A;  1H3H A;  5FW9 A;  1NYG A;  2NUZ A;  1VYU A;  3O5Z A;  3FJ5 A;  2EYZ A;  2F2W A;  3A98 A;  3KFV A;  2DL3 A;  1UDL A;  1WXB A;  1E6H A;  4J9I A;  1RLQ C;  2SRC A;  1VYV A;  3THK A;  1HJD A;  2L3P A;  5L23 A;  1FYN A;  5IHK A;  3ULR B;  2LNH B;  5HCK A;  4IIM A;  3VRY A;  2DL4 A;  1ARK A;  3UA6 A;  3VS3 A;  1WXU A;  1I0C A;  2PZ1 A;  4X1V A;  1RI9 A;  2KXD A;  2MCN A;  1X69 A;  2ABL A;  1FMK A;  1PWT A;  3VS0 A;  4AFQ C;  2DNU A;  4JZ4 A;  1CKA A;  1NLO C;  1AEY A;  4ORZ A;  1BB9 A;  5FWB A;  3REB B;  2CT3 A;  3EG3 A;  2J7I A;  1H8K A;  1EFN A;  1W70 A;  2RNA A;  1GBQ A;  1ZUY A;  2RQT A;  1KJW A;  3M0T A;  1OPL A;  2K79 A;  5GJV B;  1H92 A;  2CDT A;  4LUE A;  4RTW A;  3PE0 A;  2L3Q A;  1M8M A;  1SRM A;  3RBB B;  1OPK A;  1HSQ A;  2A37 A;  1SSH A;  1YP5 A;  2YSQ A;  1BU1 A;  2AKK A;  3EG0 A;  3NMZ C;  3TVT A;  1UTI A;  2CSI A;  1UE9 A;  2DIL A;  2FG0 A;  1WIE A;  2FPD A;  2RPN A;  4CC3 A;  1UG1 A;  3UAT A;  2KEA A;  4QT7 A;  1AWO A;  2CT4 A;  4Z89 A;  1G83 A;  4KRT A;  1T3L A;  1B3Q A;  2W10 A;  2M0Y A;  2GNC A;  1QLY A;  4AG1 C;  2DL8 A;  2C0I A;  2KRN A;  2HDA A;  2DJQ A;  4HCK A;  4D8K A;  2KRM A;  1WXT A;  3M0Q A;  3TSW A;  2SEM A;  1KSW A;  1U5S A;  2CH4 A;  1YWO A;  1U3O A;  4J9H A;  2O88 A;  2FRY A;  1V1C A;  3M0P A;  2AZV A;  2D0N A;  2VVK A;  1KIK A;  1K76 A;  2GTJ A;  3NPF A;  2EGA A;  3M0S A;  3H0F A;  2YUQ A;  4RTY A;  2O9S A;  2CH4 W;  3M0U A;  2DBM A;  2JM9 A;  2EQI A;  2LMJ A;  4J9C A;  1MV0 B;  2JS2 A;  1OOT A;  1Y0M A;  1YN8 A;  2ENM A;  2F2V A;  2X3X D;  1Z9Q A;  2NWM A;  1K1Z A;  3RNJ A;  1W6X A;  1T0H A;  4CC2 A;  4JJB A;  2KT1 A;  1CKB A;  2DL7 A;  1MUZ A;  2MIO A;  2EW3 A;  3VS4 A;  5IXF A;  5FWC A;  2LP5 A;  2RQW A;  2DRK A;  4CC7 A;  1M27 C;  1UFF A;  1S1N A;  1UJY A;  2EYW A;  2O9V A;  2KYM A;  2OAW A;  1YNZ A;  1ZLM A;  4LN2 A;  1E7O A;  4J9F A;  1X27 A;  2OJ2 A;  2LJ0 A;  1JQQ A;  5ECA A;  2DBK A;  2O31 A;  2EYX A;  4JJD A;  2KT8 A;  1TG0 A;  1PRL C;  2D1X A;  2ECZ A;  4Z8A A;  4R0K A;  3LH5 A;  4ESR A;  1JO8 A;  1GFD A;  1GRI A;  2FO0 A;  4M4Z A;  2LJ1 A;  1K0S A;  3VS2 A;  3I9Q A;  3I5R A;  1T0J A;  1AWJ A;  5IXB A;  1I1J A;  4K11 A;  2EYY A;  2FEI A;  4EIK A;  2HSP A;  2CSQ A;  3H41 A;  2LJ3 A;  2RQU A;  2YUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...