4AFSC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDSIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
molecule tags Hydrolase/de novo protein
source organism Homo sapiens
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afsC00
2X3XD 4OMOA 1GRIA 2F2VA 1PWTA 3LH5A 1H8KA 2LJ3A 4AFQC 2DRKA 2J7IA 1M3AA 4JZ3A 1ZUKA 2AZSA 3VS6A 1K4US 1OOTA 4CC7A 2VVKA 3A98A 1NYGA 2AKKA 1OPLA 2P4RA 1WFWA 2RQWA 4J9HA 2YUOA 2CT3A 2JMCA 1XOVA 4F17A 2MOXA 2K9GA 3I35A 4X1VA 5IH2A 2ROTA 2EKHA 2DE0X 1T0JA 2KBTA 1QKXA 3EG2A 2FRWA 2KNBB 2KGTA 2LQNA 1FYNA 2ENMA 3U23A 1UGVA 2LMJA 4OMLA 2C0TA 1JO8A 2MIOA 2JM9A 3IQLA 2HSPA 2CSIA 2ESWA 4QT7A 4F16A 1B07A 4Y92A 2L3SA 2YUNA 1JU5C 1AD5A 1ARKA 3PVLA 4Z89A 2J06A 1WI7A 1UDLA 2KYMA 1QWFA 1Y57A 1SHFA 2BTTA 2ED1A 1V1CA 2FEIA 2RQTA 1WIEA 1JEGA 2KRMA 2L0AA 3FJ5A 5FW9A 2L3PA 2YUPA 1KJWA 2EVRA 2LQWA 2PNIA 3NPFA 1UHFA 4IIMA 2EGAA 2EBPA 2L3QA 5ECAA 2F2WA 4LNPA 2O88A 2AKLA 1TUCA 2RPNA 3M0PA 3NMZC 2NUZA 1YCSB 1PKSA 2GGRA 5FWCA 3VS3A 2EPDA 2CUBA 1UUEA 2VWFA 2J6FA 2V1RA 2M0YA 2BZYA 1M8MA 2K2MA 2JMAA 3TSWA 3VS2A 1M3BA 1MV0B 3VS1A 2NWMA 4J9CA 2EYWA 1FMKA 2O9VA 1BBZA 4J9FA 2O31A 4J9GA 2CREA 2CDTA 2DRMA 2CUDA 1UJ0A 4CC2A 4JZ4A 1NLPC 1ZUYA 1M30A 2KXCA 1AOJA 1GCQA 1WX6A 1WXTA 2DL8A 1CKBA 2YSQA 1K0SA 2DLPA 4LUDA 4RTTA 1GCPA 2H8HA 5GJWB 5IXBA 2A36A 4J9EA 2KT1A 1QWEA 3QWXX 4A63B 1GFDA 1BU1A 1VYUA 2M51A 2F2XA 2KR3A 5IXFA 2PZ1A 3TVTA 4HCKA 2X3WD 2YT6A 1SRLA 4WCIA 1YWPA 2FO0A 2SEMA 3RNJA 1UHCA 3QWYA 2DMOA 3C0CA 1OPKA 3EG3A 1YP5A 3ULRB 2GQIA 4CC4B 3JV3A 4ZNXA 1KSWA 2L2PA 4D8DA 2EW3A 3M0UA 1QCFA 1ABOA 4GLMA 1CKAA 5I22A 1RI9A 2LNHB 2O2OA 2EYZA 1Z9QA 4JJDA 2A08A 1NYFA 2D0NA 2KROA 1NEGA 2AK5A 2HBWA 4OMPA 2I0NA 1ZX6A 1RLQC 2BZXA 1TUDA 2D1XA 2ED0A 3VS0A 1K76A 4JJCA 1U3OA 1K0XA 1NM7A 5IHIA 2FG0A 2DBKA 1M27C 3NHNA 2V1QA 2CH4A 2ROLA 3VRZA 1N5ZA 1U06A 1X6BA 4RTUA 2K3BA 1AWWA 2XMFA 2OJ2A 2FRYA 5IHKA 3I5SA 2DILA 2KYBA 1UECA 4RTZA 1X69A 4RTWA 4LUEA 1I0CA 1NLOC 4M4ZA 1E7OA 5HCKA 1BB9A 2IIMA 1W6XA 2D8HA 2DM1A 2DL5A 3NGPA 1PRMC 5GJVB 2JTEA 2DJQA 3VS7A 1MUZA 2FPEA 1SRMA 2QDLA 3R6NA 5EC7A 2AZVA 3VS4A 2JS0A 2DL3A 2JS2A 2E5KA 2JT4A 4LN2A 2DA9A 4J9IA 2YUQA 2J05A 2W10A 4OMMA 4F14A 1ZLMA 3H0IA 2OAWA 4D8KA 1E6GA 1ZUUA 1Z9ZA 2DF6A 2GTOA 3PVQA 1S1NA 2BZ8A 1WLPB 2EYYA 5L23A 4RUGA 4CC3A 2C0OA 1UJYA 2DL7A 2C0IA 2B86A 2PTKA 3VS5A 2W0ZA 2LCSA 1I07A 2ABLA 2FPFA 4HVVA 3UATA 1GCQC 1QLYA 1PNJA 1QKWA 2CSQA 4Z8AA 4RTYA 4K11A 3RBBB 2DNUA 3REAB 1NG2A 1W1FA 2G6FX 1U5SA 2A28A 4RTVA 2LJ1A 1K1ZA 1VYTA 3SEMA 1E6HA 4JPBW 3VRYA 2JXBA 2JW4A 2CT4A 1WYXA 3EHQA 2RQUA 2EGCA 1G83A 2RQRA 2SRCA 1VA7A 1CSKA 2KEAA 4GBQA 2LJ0A 3UF4A 1H92A 1JQQA 1MV3A 1W70A 2DX1A 2KE9A 3H0HA 1K9AA 1X6GA 1H3HA 2CH4W 3SHWA 2JM8A 1OEBA 1AWJA 3UA7A 1EFNA 3EG1A 2DBMA 2O9SA 1GBRA 2DVJA 1GBQA 1T3LA 1G2BA 1X2QA 4Z88A 3CQTA 4AFSC 1GFCA 2DYBA 4DEXA 3TSZA 3EGUA 1WA7A 1GL5A 1RLPC 4RTXA 2J6OA 3REBB 2KXDA 1YNZA 2EQIA 2GNCA 1RUWA 3KFVA 2LZ6B 1AEYA 5I11A 4HVWA 2MCNA 1AZGB 3M0RA 4R0KA 4OMNA 1Y0MA 1AWXA 4AFZC 3I9QA 3I5RA 3EG0A 4JJBA 2RNAA 1VYVA 1J3TA 3M0QA 1B3QA 3UA6A 4EIKA 2ECZA 1HD3A 3ZL7C 2HDAA 1X43A 2RQVA 1PRLC 4J9BA 4J9DA 3H41A 1AWOA 3M0SA 1KFZA 1SSHA 1UG1A 2KRNA 4ORZA 2LX7A 1UFFA 2A37A 5IHNA 2GBQA 5FWBA 1AVZC 1PKTA 4AG2C 2K6DA 1NEBA 1YWOA 2OI3A 4DEYA 1JXOA 1WXBA 2K79A 2RN8A 2VKNA 1YN8A 2LP5A 3PE0A 1T3SA 4HVUA 4HXJA 1LCKA 2KT8A 4AFUC 3THKA 1SHGA 3M0TA 1JXMA 1AZEA 1M3CA 1X2KA 4KRTA 1WXUA 4ESRA 1PHTA 1IO6A 3H0FA 1WDXA 4OMQA 1HSQA 2YDLA 1UE9A 3GBQA 2GTJA 2RF0A 2HEQA 4FSSA 4AG1C 2J6KA 2DL4A 1SEMA 4E6RA 3O5ZA 1ZSGA 1TG0A 2HCKA 1X27A 1BK2A 1HJDA 1KIKA 1T0HA 2D8JA 3EHRA 2K7AA 2FPDA 2KRSA 1OV3A 1A0NB 1I1JA 1SPKA 1UTIA 4IIOA 2EYXA 2RMOA 4LE9A 2EGEA 1ABQA 1ZBJA
chains in the Genus database with same CATH superfamily
4RKUE 2F2VA 5GAMe 1PWTA 2DTHA 5GAMd 2DD4A 4AFQC 4E47A 1MNEA 2HQXA 2MPXC 2QEXT 2X4WA 1KQ1A 2R57A 4JZ3A 2OTJT 1ZUKA 1K4US 3HRUA 2FVUA 4XTZA 1OOTA 5GMKh 2VVKA 4C8QE 4A4GA 1YITQ 1OPLA 2P4RA 1BIBA 4M7AB 5CK9A 2JMCA 4F7UB 1MMGA 2MOXA 3H9NA 4M77A 4X1VA 5IH2A 3L2UA 2QTXA 4C8QA 2DE0X 2QA4Q 3ME9A 1VQ6T 2LTOA 1X01A 1QKXA 1FYNA 2CP3A 4A4EA 4M7DG 2KY9A 4JDSA 2NUPA 3U23A 2LNVA 4OMLA 3OBYA 1Y96B 3CD6Q 1W4SA 2JM9A 3IQLA 3P8BB 5GANe 2O4XB 4M75D 3C12A 4QT7A 4F16A 1BI0A 1NZ9A 1B07A 4Y92A 2YUNA 4M7DC 2DTIA 3PVLA 2J06A 2KMTA 2RHZA 1VIEA 2KK4A 1UDLA 2KYMA 1Y57A 1SHFA 2BTTA 3ZFJA 4C8QB 2VC8A 5KYUA 1M90C 3JRZA 1G3WA 5KYWB 2EVRA 2LQWA 2WSFE 2PNIA 3CBMA 1SKUB 2O88A 1M8VA 2AKLA 1S72A 2RJFA 3J7AF 3H6ZA 3M0PA 1VQ7T 4MMLA 3NMZC 1YCSB 3JB9G 1PKSA 1TH7A 2FHDA 4E7LA 2CUBA 4E7IA 2VWFA 3I56Q 4B9WA 1M8MA 2K2MA 2QA4A 2BIVA 3VUZA 1VQ9T 3CCQT 2EYWA 4DBHA 3X25B 2CDTA 3SWNC 1YITA 4CC2A 4HCBA 5KH6A 1ZUYA 1QP3A 1GCQA 3I55T 1HK9A 3LX7A 4C8QC 1LVKA 1W2BS 1CKBA 2L3RA 2H8HA 2P0PA 4J9EA 2DZCA 3NFCA 4XU1A 1QWEA 3QWXX 3INZA 1VYUA 1RADB 3LLRA 3C4SA 4HCKA 5J26A 1RAFB 4C0GA 1N8RU 1QCNA 1UHCA 3OSSC 4E7KA 1N9SA 3MP8A 3ULRB 3WXMB 2GQIA 1YJWA 3CC7A 1Y71A 1CKAA 4KT0E 1N9RA 1RI9A 4J6XA 2EYZA 1Q81C 4IKFA 1WHMA 2RK2A 8AT1B 3X26B 1ZX6A 1K73C 2D1XA 2D9TA 1IHWA 4HCZA 3VS0A 4AMCA 4PJOB 4JJCA 2XU8A 3JSCA 1M27C 3X20B 2VXEA 2ROLA 3RDVA 4E2FB 4RTUA 2K3BA 1MMNA 4C92D 2XMFA 2Y90A 2FRYA 4ME7A 4F7UG 1MHNA 2DILA 2QEXQ 1M90R 1MNDA 1M5Q1 4WF2A 1H641 4RTWA 1ZA2B 4Y28E 4PJMA 1W6XA 2D8HA 2DL5A 4J6WA 4PFOA 1VQ8Q 5J39A 3A8GB 3CPWA 2YWWA 1TSFA 5FLXE 2LC4A 4M7DF 3VS4A 1GXIE 5KYXB 1VQ5A 1XQHA 2RJCA 2YUQA 2W10A 4M7DD 1ZLMA 1WHJA 3NTKA 2OAWA 1PM3A 1ZBXA 3KBGA 1Z9ZA 3CMEA 3OYNA 4C92F 3ASKA 2E3IA 3S6WA 1WLPB 2DL7A 2C0IA 2PTKA 3E19A 5GAN4 4HVVA 3I55Q 1K73R 1QVPA 5GAN7 1YI2A 4PFZA 2MYSA 4EMHA 1YIJQ 3REAB 4M7AF 2XG8D 2G6FX 3V7RA 1QVFS 1K1ZA 3JCMX 4ELYC 1VQMT 3MKDA 4DBQA 3CC7Q 2K57A 1HXDA 4QQGA 2BUDA 3MPUB 3G71A 2PU9B 1WYXA 3G71Q 3EHQA 2CP2A 4OP0A 1WQWA 5D6XA 1D0XA 2K3YA 2KEAA 4GBQA 2LJ0A 3GIBA 3UF4A 1H92A 1OULA 4ZTJA 2F5TX 3H0HA 2LRQA 1Q81R 3I56T 5KYNA 3SHWA 2L89A 2RHIA 5GAMj 4E7HA 1YIJA 1OEBA 3R6OA 5LJ3g 3I56A 4NOYA 1Q86U 2DEQA 2O9SA 1GBQA 1XJWB 4PLIA 2P0QA 1G2BA 2HMAA 5GAN5 3L2WA 3CCVQ 4DEXA 3G71T 3LWIA 3QHSA 2CZ6B 4BDYA 2J6OA 3CMEQ 4M77F 1RABB 2OX7A 4BACA 2C06A 3KFVA 2BE7D 1AEYA 3QPHA 4RMOA 2QYZA 3OMGA 3QZ5B 3V8LA 4R0KA 2V8KA 1YFNA 1Q86C 4VUBA 2EQUA 2FYKA 3ZEHA 4C8QG 4F04B 4AFZC 4M77G 1M9SA 2DXUA 2RNAA 2MAMA 2ECZA 3RR6A 2ZPHB 5GAOl 2HDAA 1X43A 1VQ7Q 6AT1B 3CCLT 3CMET 2HSEB 2QAZA 4Z02A 3OYEA 2A37A 3VUBA 5FWBA 2I2LA 3DLLA 1BCMA 4KUIA 4JLGA 2WSCE 1M90U 1AVZC 4C92C 4AG2C 3EG9A 1JXOA 4WTOB 2VKNA 1YN8A 1Y7XA 4HVUA 2KT8A 3RERA 5HK3A 1FWZA 3HFOA 1LOJA 3OYYA 4IUPA 4OMQA 1YJ9Q 3GBQA 2RF0A 4FSSA 2XHCA 2NYSA 1IREB 1UEBA 3DB4A 2E10A 3META 1ZSGA 5L8RE 2VV5A 3CCJT 2HCKA 2ZAEA 3OYMA 3TEEA 1HYOA 1YJWQ 1KIKA 3M54A 4X9DA 5EG2A 3SB2A 2K5IA 1A0NB 2E6ZA 3L2ZA 3CCVT 2CZ1B 3JB9J 3CCEA 5CAIA 2MMPA 2K5FA 4N0AA 1I8FA 1ABQA 1X75C 3MEAA 2LVMA 1I5LA 1UB4A 4M7DE 4LXCA 2FZKB 4ELZC 3OW2S 3LH5A 3BDUA 2M9UA 1JJ2P 1BIAA 3VYGA 3M59A 2O4XA 3OQ5A 2E41A 2RJDA 1N8RC 2AZSA 2QG9B 1H3ZA 3FC3A 1YHQQ 1WHGA 1WFWA 2RQWA 2V8IA 1D1BA 4F17A 2OTLQ 4IUUA 1VQ4A 2K9GA 3I35A 4XTYA 2ZPGB 3L2RA 5GMKm 2KI7A 2EKHA 1NE8A 1T0JA 2KBTA 4OVAA 4A4HA 2RA2A 2EFIA 1G3YA 3OY9A 2ENMA 1PD0A 2NLUA 2C0TA 1JO8A 3V7CA 3QO3A 1N27A 2GF7A 1OU8A 4C0FA 2L3SA 1WGSA 3CCQA 1VQ9A 5LJ5f 2XD0A 2ZPEB 1AD5A 1VQOT 1R0BG 2MI6A 2HKQB 1WI7A 1X6OA 2L0AA 2L3PA 2YUPA 4J8OA 4BDZA 1VQ9Q 5DLQE 4DA4A 4M7DA 3CCUT 5GAOr 1UGSB 2RPNA 5GMKe 2NUZA 3HRTA 1KK7A 1QVFP 5FWCA 5GAMh 3CCRT 2JMAA 1BI2A 5CKEA 5AYFA 2O9VA 4QVCA 3AHUA 3G4ST 4E7JA 4J9FA 3JB9D 4ANJA 3A8MB 1ZSZA 3A1PA 1NLPC 3CCLQ 5GMKl 2P84A 1M30A 2KXCA 1WX6A 4XTVA 2YSQA 5GAOn 4RTTA 3WVDB 3RKXA 5IXBA 4MMKA 3CCRQ 1WJQA 4A63B 2NUTB 3RIRA 2M51A 4R56A 2F2XA 2KR3A 2PZ1A 4LDVA 5LJ5h 3CCJQ 2LQKA 4OB2B 1IXDA 3GNFB 1SRLA 1YWPA 2FO0A 3RNJA 2DMOA 1VQKQ 5CVIA 3BE3A 1QVGA 1WZOA 3E9GA 1G3SA 3TQ7P 2K4YA 3JV3A 1PD1A 4ZNXA 1ZA1B 5FU6B 1KSWA 4D8DA 2ZCFB 2EJ9A 1G5VA 4KULA 4QKUA 1RACB 1Z9QA 2CZ0B 4JJDA 4IUVA 1NYFA 1NEGA 4XAXB 2HBWA 4M75B 2LCCA 1QMCA 3SDZA 3CCMT 2D0QB 2EQMA 5CKFA 3AT1B 1TUDA 2EWNA 2HAXA 1K8AR 1YCYA 3J80E 2HQHA 4TVRA 1B7TA 1U3OA 2V1QA 2CH4A 2COZA 1M1FA 2JOYA 2IVWA 1X6BA 4MZTA 2CZ7B 1TTHB 1FMVA 5IHKA 4JLIA 4C0ZA 1UECA 5A0GA 4RTZA 1X69A 4M78B 5LJ5e 3OS1A 1M4ZA 1E7OA 1BB9A 3NGPA 4XK8E 2HL5C 3NTHA 2JTFA 1D09B 1KC8R 5EC7A 2AZVA 1DJ7B 3ZBDA 2VUBA 2DL3A 3CBOA 3X28B 1M1KR 2JT4A 3CCMA 5A2QE 1TOVA 2RJEA 4RCBA 1YJ9T 3G6EQ 3H0IA 2Z0WA 1ZUUA 2XICA 2DXBA 2X4JA 2DF6A 3HHTB 1YJNQ 4IUQA 3PVQA 3RMQA 5FRMA 3H8ZA 2BZ8A 3QJ6A 2MWPA 3FJPA 2EYYA 2QTVA 2XDBA 1UJYA 2HKNA 2CP5A 2PVOB 1OZ3A 3TU4K 1F1BB 1YHQA 2COYA 3Q1JA 3UATA 3JCMV 3TCJA 1QLYA 1K8AC 3LWHA 2MK5A 3ER0A 3KXTA 4JS4A 4HKEA 2X35A 4FL6A 1W1FA 1Q86R 2RHUA 1NPPA 2A28A 2LJ1A 2YRDA 1OZ2A 3OYGA 3JB9F 3SEMA 3VRYA 2JXBA 2CT4A 4J7IA 3CPWP 3CCUQ 5LJ3f 3HSBA 2RQRA 3LW5E 2CS7A 2VGMA 2EJGA 1JQQA 1MV3A 3G4SA 2KE9A 2DX1A 1K9AA 1X6GA 3OMCA 5GAN2 3M53A 1H3HA 3PMIA 1RI0A 5KYYB 4QQDA 3EG1A 1JBMA 8ATCB 2DBMA 3QYGB 3GP8A 3F70A 2V8JA 4BI8B 1T3LA 3QYHB 3CC2T 2P4TA 3OSVA 2H3JA 4AFSC 2K5LA 2DYBA 1ZQ1A 2QGGA 2PVGB 1GL5A 4B9XA 3CMAQ 3L42A 2GNCA 4O6JA 2EIFA 2LZ6B 1OU9A 3CCMQ 1RAHB 2EKOA 2MCNA 4BI3A 1YI2T 1EIFA 4OMNA 1VQOA 5GAMf 1Y0MA 1VQ8T 1ZSZB 3A8HB 3QKJA 3M0QA 1J3TA 1Y07A 2RK1A 3UA6A 2DXTA 4EIKA 4L59A 1HD3A 4PJOC 4UC4A 5KYUB 2NUTA 2ZGWA 4GLKA 4J9BA 4QVZA 4J9DA 3MEWA 3M0SA 1KD1R 3BY7A 1SSHA 1UG1A 4KH1B 4L5GA 2YRCA 5D7UA 3UPUA 1VQ5T 4OGCA 4YTLA 1BI1A 3CCQQ 1PKTA 1NEBA 4DEYA 1D1AA 3HKSA 3BDLA 4M78G 4X9CA 1RAGB 4HXJA 4A4KA 4AFUC 2BKDN 4DBRA 1NPRA 3EGXB 1SHGA 1M3CA 4D6WA 5DY9A 3CC4Q 3QDFA 1WXUA 1RL2A 4QW2A 4A53A 3EGDB 1PHTA 4JJNK 1IO6A 4ZGDB 2QQSA 2GTJA 1U1SA 4M78F 4AG1C 2O01E 2DL4A 2X4XA 1SEMA 2MWOA 1IGUA 3MEUA 4PFPA 4LDYA 2EJFA 3OYAA 1HJDA 2DXCA 9ATCB 3EHRA 3CCVA 2FPDA 4C5IA 4BY6B 1IHVA 2XDDA 1I1JA 4FSXA 1UTIA 3OW2P 2K2VA 1EZZB 4LE9A 3MO8A 4PLLA 3EGDA 4KGXB 1VQLQ 2KAFA 2X3XD 1N8RR 4BE0A 4OMOA 3RKWA 5CKDA 1M2VA 2CKKA 1H8KA 2LJ3A 5LJ5g 1G3TA 2J7IA 1M3AA 3UT1A 4XTXA 5CKBA 1VQLA 2RI5A 4KGZB 2ZZDA 2DPPB 1YJWT 3VS6A 4CC7A 3A98A 4J6YA 4KGVB 2XIDA 3PIPA 1TUGB 2R5AA 4E7ZA 4B6MA 2F1LA 5A0LA 4CI0C 1XOVA 3P8HA 3E1SA 1UGQB 1O9SA 3HRSA 2ROTA 2H3EB 2WSEE 1VIFA 3RMSA 2FRWA 2OTJQ 2KGTA 2LQNA 3JB9I 3I55A 1UGVA 3JCMQ 2KQWA 2CSIA 2ESWA 4KH0B 3X24B 3LGLA 1M1GA 1VQ8A 3OYFA 3OYIA 3CMAT 4DBFA 3PGGA 2RB6A 4Z89A 1KD1U 2CP0A 3DKMA 3LGFA 1QWFA 2ED1A 2FEIA 2FZCB 1WIEA 1VQ7A 2KRMA 5FW9A 4J5YA 1S72T 1S72Q 3T9NA 1R77A 3LYIA 3P8DA 1XTDA 3NPFA 3RKYA 4IIMA 2EGAA 2L3QA 5GANj 3PFSA 5ECAA 3CC2A 5KE3A 4BB7A 1TS9A 1VQOQ 2GGRA 3VS3A 5LJ3h 4PJOD 2NUPB 1UUEA 1K9MC 2J6FA 2V1RA 2BZYA 1JJ2A 3TSWA 3VS2A 1VQ4Q 1YIJT 1M3BA 2LX9A 4XQ3A 3CPWS 2NWMA 4J9CA 1O75A 1FMKA 2RI2A 5CKHA 3G1JA 5FU7C 1BBZA 3QZ9B 2O31A 2G3RA 1LPLA 3GNGA 4J9GA 2E64A 3MEVA 1EX4A 1UJ0A 1UGPB 3HTRA 1JRIA 4MZMA 1AOJA 4OMFB 2XKOC 4II1A 4KBMB 2RHYA 2DLPA 4GY5A 4LUDA 1Q81U 1GCPA 5GJWB 2DIGA 2AT1B 4XTWA 4M78D 5IXFA 5I2MA 5HK0A 1BKBA 2X3WD 3CPFA 3HPWA 2YT6A 4WCIA 2SEMA 2HQEA 2QI2A 3C0CA 1VQKT 4M7AC 1OPKA 3JCMe 3O8VA 1Q82C 1YP5A 1KQSP 4CC4B 3SD4A 4A4FA 2KSSA 4N4HA 3MHXA 1P92A 2EW3A 1QCFA 5LJ3j 3MP6A 5IT9E 2YLCA 4LDWA 2O2OA 2EAYA 2RHXA 3G7ZA 2HL3A 2A08A 2D0NA 2KROA 1D1CA 2AK5A 1YJ9A 1VUBA 2GQVA 4OMPA 2I0NA 3EAEA 3M4GA 3SWNB 1RLQC 1WJRA 1M1KC 2BZXA 1D3BB 2E4HA 4PJLA 4FYXB 1K76A 1Q7YR 1K0XA 4JUVA 5CO7A 4M75E 1MGQA 1NM7A 3DB3A 3L2VA 5IHIA 2FG0A 2VB6A 3VYHB 1QCOA 3EGXA 1QVFA 5GANf 2L8DA 1AWWA 3OYJA 2KYBA 1OX8A 4PJNA 1I0CA 4M4ZA 1UGRB 5HCKA 2RD1A 3MP1A 5HKCA 1K73U 2IIMA 3GPLA 4EMGA 3CC4A 3SWNA 3JCMW 1PRMC 4FM4B 2X9HA 3EFOB 5GJVB 3EH2A 2JTEA 5DLOA 3VS7A 1MUZA 2FPEA 1SRMA 3R6NA 2QK0A 3CD6A 1YBYA 2A7YA 2XDPA 3C94A 2JS0A 3OS0A 2E5KA 4J9IA 2XK0A 2J05A 2DZ9A 1TXQA 4F14A 1E6GA 1QP2A 1WPYA 2GTOA 3OS5A 1Q7YU 4CC3A 2C0OA 2PQWA 3VV0A 3OYHA 4N4GA 4PKCC 2B86A 1QW1A 1RAAB 4C92B 4EMKA 3KUFA 2LCSA 4BE2A 1I07A 2ABLA 2FPFA 2GCXA 3CEYA 1QKWA 3PT9A 4Z8AA 4RTYA 4K11A 3RBBB 2GFUA 1IGQA 1U5SA 2EYQA 1VYTA 3JCMg 1E6HA 1TU0B 2YXYA 4C92A 4EMKB 3CCSA 2YHTA 2JW4A 3CCSQ 1YITT 1FX7A 1G83A 2EGCA 2SRCA 1VA7A 5A0DA 1W70A 2YRVA 5I21A 2V26A 1PSEA 2PUKB 1OQKA 4BUGA 2COWA 2CH4W 3M58A 2QA4T 1K9MR 4N4IA 3CCRA 2VXFA 4DQ2A 1AWJA 1YI2Q 1EFNA 3S3NA 3EH1A 5AT1B 4BI4A 4J7FA 1GBRA 2DVJA 2DEUA 2FB7A 1C1AA 4FYWB 1KHCA 2HNIA 2E1HA 1X2QA 4HT8A 3CCUA 1G8XA 2DAQA 3CQTA 4C5HA 1AT1B 4M78C 1JJ2S 1GFCA 1D3BA 4FU6A 2X51A 1KC8C 3TSZA 1LNXA 1WA7A 3OW2A 2M16A 5FU6C 3REBB 3EFSA 4PJOA 2KXDA 2B8AA 1YNZA 2EQIA 1RUWA 2DFUA 3J81E 5D6WA 2KDSA 2AIRB 2RO0A 1VQ6Q 3GF5A 1AZGB 3HP9A 3M0RA 4PJOG 3QXEB 5LJ3e 1AWXA 3CC2Q 1OYXA 3M57A 1JB0E 5IN1A 3I9QA 3I5RA 3EG0A 4HT9A 1IB8A 2A3LA 4PK4A 1KC8U 3ZL7C 2RQVA 2HBPA 2IG0A 2EQKA 5CCAA 2JUFA 2KRNA 4ORZA 4DOWA 2LX7A 5LJ5d 1UFFA 4OB0B 3DLMA 1VQ4T 2JTMA 3D7SB 3URGA 1YWOA 3CD6T 3PIOA 1WXBA 1SSFA 2RN8A 2LP5A 3M9QA 3PE0A 5GANd 4M7DB 2ZPIB 3THKA 1FMWA 4C8QD 2D6FA 4OF1A 3M0TA 3MCAB 1X2KA 5KYXA 4RG8A 4BY6C 4AT1B 4J83A 2OTJA 3H0FA 5GAN8 1HSQA 1K8AU 1UE9A 5KCOA 4XU2A 4PJJA 3OYDA 2CP6A 2R58A 2J6KA 3V7SA 3EFOA 3BFMA 1PSFA 1QQJA 2QDYB 1TG0A 1KQSS 2E3HA 5HY6A 1BK2A 1VQPA 3G4SQ 3CCET 3V8KA 4ZTFA 3QG1A 2AHJB 1VOMA 3HFNA 5CQYA 2WACA 2GFAA 4IIOA 5GAMg 4PJOF 3OYLA 1NJIR 2LDMA 1R8OB 4EPCA 3CCJA 4O5VA 1WJSA 4C92G 3E9FA 5GAOp 1MMAA 1GRIA 1I4K1 5FU7B 2DO3A 2VYTA 2DRKA 5GANh 1D0ZA 3VKIA 5KE2A 4M7AE 3OB9A 4M75A 4M7AA 1VQNT 3JAME 3M55A 2PVDB 3QUIA 1Q82U 1Q82R 1NYGA 2AKKA 1VQKA 4XTUA 3JCMc 1C0MA 4J9HA 2YUOA 2CT3A 4HA8A 1ZSZC 1BCOA 5FROA 1Y96A 4NL3A 4JRQA 4LD6A 4PJOE 1V76A 1U1TA 3FEOA 2HZYA 1FXXA 3G6EA 3EG2A 4F7UE 2KNBB 4IURA 4OB3B 5IAYA 2Y4YA 2PUOB 4V2SA 3CCLA 4EDUA 2LMJA 1XNIA 2MIOA 2F69A 2A0FB 2HSPA 4ZGJB 3CXCP 2JNGA 1JU5C 5GAOq 4N0AC 1KHIA 4KUDK 2M02A 4E7SA 1ARKA 3QSUA 4RG2A 3A5ZB 2DD5A 1V1CA 2RQTA 4M77B 2X4YA 1JEGA 3FJ5A 1NJIC 1Q95G 3C95A 2JJ9A 1KJWA 4MDXA 3L1AA 1SF9A 3UDCA 1UHFA 2EBPA 1KQSA 3M4YA 2F2WA 4LNPA 3L2QA 5CIUA 3EG9B 1TUCA 2IPOB 3FIFA 4M78E 4ZN1A 2EPDA 4C5EA 2DYIA 2LCLA 3A8OB 2M0YA 4C92E 5GMKi 4FT4A 1MV0B 3VS1A 3CMAA 4M75F 3OYBA 1NJIU 2DTOA 1Q7YC 5M9OA 1RAIB 2CREA 2DRMA 2CUDA 4EMKC 4JZ4A 4FCYA 2QXFA 4BE1A 2DKGA 1WXTA 2DL8A 2E65A 1VQMA 1K0SA 2DIQA 1I5OB 2M1HA 2HD0A 2DETA 2A36A 2KT1A 1GFDA 1BU1A 3JCMf 1M2VB 4R55A 1U8RA 2QQ9A 3TVTA 3FRNA 4F7UF 3QWYA 2R5MA 3VU3C 3CCEQ 1M2OA 1QVGP 3EG3A 3PTAA 1WHHA 2QQBA 2ZPBB 1V29B 2E12A 2OAUA 1VQNA 5C6SA 3OA6A 3PMTA 1PCXA 2L2PA 3M0UA 3NTIA 1ABOA 2OTLT 4GLMA 1VQLT 2QQAA 5I22A 2LNHB 1KQ2A 3M5AA 5CR2A 4X34A 4XU3A 4LD9K 2E70A 2K3XA 5I2SA 4RCCA 2F5KA 2VASA 5LJ5j 1B34A 3VJPA 3N5BB 5GMKj 3E2UA 4DOVA 2ED0A 2CP7A 4M78A 2EQJA 4M77E 4PNOA 3QJYA 2DBKA 1VQPT 1MMDA 2FL7A 3NHNA 1BYMA 2RM4A 1YJNA 3VRZA 5KYYA 1N5ZA 1IZ6A 1U06A 3JCMb 1KD1C 2OJ2A 3I5SA 4QVDA 3EFRA 3WVEB 4L6V5 4LUEA 1NLOC 2DM1A 1YJNT 4M7AG 2DJQA 3OBWA 3JCMh 4M77D 2QDLA 5FRNA 2YLBA 4OGEA 4Q5WA 2JS2A 5GAN6 5KCHA 3A8LB 4LN2A 2DA9A 4MZPA 1K9MU 4OMMA 5C0MA 2BE9B 4D8KA 5GAN3 4IUTA 3GOXA 1R0CB 4HCCA 2OTLA 1S1NA 1NBEB 3S3OA 3QBYA 5L23A 3CC7T 4RUGA 2QASA 1SG5A 3OS2A 3PNWC 2LT4A 2L5QA 4QQ6A 4C0DB 3VS5A 2W0ZA 1LJOA 2CGHA 1GCQC 1WHLA 3QIIA 3TREA 1PNJA 2CSQA 2DNUA 2KVQG 1NG2A 3S3MA 1OX9A 4P5NA 4RTVA 1VQMQ 1ACMB 2QGFB 4JPBW 4FW2A 1ZHIA 1C6VX 2RQUA 3V8JA 3RESA 5J3BA 5LJ3d 1CSKA 4JRIA 3CBPA 4ZN3A 3JCMd 1B34B 2JM8A 2JZ2A 4NS5A 1W2BP 3FB9A 3UA7A 1W2BA 1M1KU 3CXCS 4C0DC 5GANg 4M75C 4ZGEB 1PC0A 2JVVA 4Z88A 2DJZA 3CCST 3JCMP 1VQPQ 3EGUA 4M7AD 1RLPC 4RTXA 2VGNA 4FT2A 2MF2A 3UWNA 4C8QF 4Y91A 4OB1B 4A54A 5CQXA 3HL8A 4M75G 5LL6S 5I11A 1N6AA 4HVWA 4ATOA 4FW1A 1D0YA 1WNLA 3JB9H 2ATCB 4FYYB 1YHQT 4JJBA 3JCMJ 1VYVA 4FYVB 4MDWA 3QDRB 1B3QA 4PL6A 1OI1A 2QQRA 2FZGB 1PRLC 1WQ7A 2XI9A 4BD3A 3H41A 1AWOA 3OYKA 1TWBA 2DVEA 1KFZA 2ZPFB 4NL2A 3G6ET 5IHNA 1VQ6A 2GBQA 1VQ5Q 1BI3A 4JRKA 5GAOm 2RH2A 1IRXA 2DERA 2RI3A 2K6DA 2LQ8A 2OI3A 5D6YA 2K79A 3MJXA 1T3SA 3FDRA 1LCKA 3RUXA 4XU0A 1AZEA 1JXMA 4KRTA 3CC4T 3CXCA 1I81A 4ESRA 2Y4XA 2DK3A 2E6NA 3LH0A 4M77C 1WDXA 2YDLA 2QEXA 1AHJB 2HEQA 4LDXA 1WHKA 1KG1A 2M0OA 4F7UA 1RAEB 4E6RA 3O5ZA 1QVGS 2JN0A 7AT1B 1X27A 4FIBA 2E5QA 2CYZB 2LT1A 1VQNQ 1T0HA 2D8JA 3BW1A 2K7AA 3OYCA 5KYWA 2KRSA 1OV3A 3SFMA 4CRIA 1SPKA 2EYXA 2P0KA 1PG5B 3FLGA 4LDUA 5DM7R 4C5GA 4JS5A 2RMOA 4JRPA 3M56A 2EGEA 3GLXA 1ZBJA
chains in the Genus database with same CATH topology
2X3XD 4OMOA 1GRIA 2F2VA 1PWTA 3LH5A 1H8KA 2LJ3A 4AFQC 2DRKA 2J7IA 1M3AA 4JZ3A 1ZUKA 2AZSA 3VS6A 1K4US 1OOTA 4CC7A 2VVKA 3A98A 1NYGA 2AKKA 1OPLA 2P4RA 1WFWA 2RQWA 4J9HA 2YUOA 2CT3A 2JMCA 1XOVA 4F17A 2MOXA 2K9GA 3I35A 4X1VA 5IH2A 2ROTA 2EKHA 2DE0X 1T0JA 2KBTA 1QKXA 3EG2A 2FRWA 2KNBB 2KGTA 2LQNA 1FYNA 2ENMA 3U23A 1UGVA 2LMJA 4OMLA 2C0TA 1JO8A 2MIOA 2JM9A 3IQLA 2HSPA 2CSIA 2ESWA 4QT7A 4F16A 1B07A 4Y92A 2L3SA 2YUNA 1JU5C 1AD5A 1ARKA 3PVLA 4Z89A 2J06A 1WI7A 1UDLA 2KYMA 1QWFA 1Y57A 1SHFA 2BTTA 2ED1A 1V1CA 2FEIA 2RQTA 1WIEA 1JEGA 2KRMA 2L0AA 3FJ5A 5FW9A 2L3PA 2YUPA 1KJWA 2EVRA 2LQWA 2PNIA 3NPFA 1UHFA 4IIMA 2EGAA 2EBPA 2L3QA 5ECAA 2F2WA 4LNPA 2O88A 2AKLA 1TUCA 2RPNA 3M0PA 3NMZC 2NUZA 1YCSB 1PKSA 2GGRA 5FWCA 3VS3A 2EPDA 2CUBA 1UUEA 2VWFA 2J6FA 2V1RA 2M0YA 2BZYA 1M8MA 2K2MA 2JMAA 3TSWA 3VS2A 1M3BA 1MV0B 3VS1A 2NWMA 4J9CA 2EYWA 1FMKA 2O9VA 1BBZA 4J9FA 2O31A 4J9GA 2CREA 2CDTA 2DRMA 2CUDA 1UJ0A 4CC2A 4JZ4A 1NLPC 1ZUYA 1M30A 2KXCA 1AOJA 1GCQA 1WX6A 1WXTA 2DL8A 1CKBA 2YSQA 1K0SA 2DLPA 4LUDA 4RTTA 1GCPA 2H8HA 5GJWB 5IXBA 2A36A 4J9EA 2KT1A 1QWEA 3QWXX 4A63B 1GFDA 1BU1A 1VYUA 2M51A 2F2XA 2KR3A 5IXFA 2PZ1A 3TVTA 4HCKA 2X3WD 2YT6A 1SRLA 4WCIA 1YWPA 2FO0A 2SEMA 3RNJA 1UHCA 3QWYA 2DMOA 3C0CA 1OPKA 3EG3A 1YP5A 3ULRB 2GQIA 4CC4B 3JV3A 4ZNXA 1KSWA 2L2PA 4D8DA 2EW3A 3M0UA 1QCFA 1ABOA 4GLMA 1CKAA 5I22A 1RI9A 2LNHB 2O2OA 2EYZA 1Z9QA 4JJDA 2A08A 1NYFA 2D0NA 2KROA 1NEGA 2AK5A 2HBWA 4OMPA 2I0NA 1ZX6A 1RLQC 2BZXA 1TUDA 2D1XA 2ED0A 3VS0A 1K76A 4JJCA 1U3OA 1K0XA 1NM7A 5IHIA 2FG0A 2DBKA 1M27C 3NHNA 2V1QA 2CH4A 2ROLA 3VRZA 1N5ZA 1U06A 1X6BA 4RTUA 2K3BA 1AWWA 2XMFA 2OJ2A 2FRYA 5IHKA 3I5SA 2DILA 2KYBA 1UECA 4RTZA 1X69A 4RTWA 4LUEA 1I0CA 1NLOC 4M4ZA 1E7OA 5HCKA 1BB9A 2IIMA 1W6XA 2D8HA 2DM1A 2DL5A 3NGPA 1PRMC 5GJVB 2JTEA 2DJQA 3VS7A 1MUZA 2FPEA 1SRMA 2QDLA 3R6NA 5EC7A 2AZVA 3VS4A 2JS0A 2DL3A 2JS2A 2E5KA 2JT4A 4LN2A 2DA9A 4J9IA 2YUQA 2J05A 2W10A 4OMMA 4F14A 1ZLMA 3H0IA 2OAWA 4D8KA 1E6GA 1ZUUA 1Z9ZA 2DF6A 2GTOA 3PVQA 1S1NA 2BZ8A 1WLPB 2EYYA 5L23A 4RUGA 4CC3A 2C0OA 1UJYA 2DL7A 2C0IA 2B86A 2PTKA 3VS5A 2W0ZA 2LCSA 1I07A 2ABLA 2FPFA 4HVVA 3UATA 1GCQC 1QLYA 1PNJA 1QKWA 2CSQA 4Z8AA 4RTYA 4K11A 3RBBB 2DNUA 3REAB 1NG2A 1W1FA 2G6FX 1U5SA 2A28A 4RTVA 2LJ1A 1K1ZA 1VYTA 3SEMA 1E6HA 4JPBW 3VRYA 2JXBA 2JW4A 2CT4A 1WYXA 3EHQA 2RQUA 2EGCA 1G83A 2RQRA 2SRCA 1VA7A 1CSKA 2KEAA 4GBQA 2LJ0A 3UF4A 1H92A 1JQQA 1MV3A 1W70A 2DX1A 2KE9A 3H0HA 1K9AA 1X6GA 1H3HA 2CH4W 3SHWA 2JM8A 1OEBA 1AWJA 3UA7A 1EFNA 3EG1A 2DBMA 2O9SA 1GBRA 2DVJA 1GBQA 1T3LA 1G2BA 1X2QA 4Z88A 3CQTA 4AFSC 1GFCA 2DYBA 4DEXA 3TSZA 3EGUA 1WA7A 1GL5A 1RLPC 4RTXA 2J6OA 3REBB 2KXDA 1YNZA 2EQIA 2GNCA 1RUWA 3KFVA 2LZ6B 1AEYA 5I11A 4HVWA 2MCNA 1AZGB 3M0RA 4R0KA 4OMNA 1Y0MA 1AWXA 4AFZC 3I9QA 3I5RA 3EG0A 4JJBA 2RNAA 1VYVA 1J3TA 3M0QA 1B3QA 3UA6A 4EIKA 2ECZA 1HD3A 3ZL7C 2HDAA 1X43A 2RQVA 1PRLC 4J9BA 4J9DA 3H41A 1AWOA 3M0SA 1KFZA 1SSHA 1UG1A 2KRNA 4ORZA 2LX7A 1UFFA 2A37A 5IHNA 2GBQA 5FWBA 1AVZC 1PKTA 4AG2C 2K6DA 1NEBA 1YWOA 2OI3A 4DEYA 1JXOA 1WXBA 2K79A 2RN8A 2VKNA 1YN8A 2LP5A 3PE0A 1T3SA 4HVUA 4HXJA 1LCKA 2KT8A 4AFUC 3THKA 1SHGA 3M0TA 1JXMA 1AZEA 1M3CA 1X2KA 4KRTA 1WXUA 4ESRA 1PHTA 1IO6A 3H0FA 1WDXA 4OMQA 1HSQA 2YDLA 1UE9A 3GBQA 2GTJA 2RF0A 2HEQA 4FSSA 4AG1C 2J6KA 2DL4A 1SEMA 4E6RA 3O5ZA 1ZSGA 1TG0A 2HCKA 1X27A 1BK2A 1HJDA 1KIKA 1T0HA 2D8JA 3EHRA 2K7AA 2FPDA 2KRSA 1OV3A 1A0NB 1I1JA 1SPKA 1UTIA 4IIOA 2EYXA 2RMOA 4LE9A 2EGEA 1ABQA 1ZBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X D;  4OMO A;  1GRI A;  2F2V A;  1PWT A;  3LH5 A;  1H8K A;  2LJ3 A;  4AFQ C;  2DRK A;  2J7I A;  1M3A A;  4JZ3 A;  1ZUK A;  2AZS A;  3VS6 A;  1K4U S;  1OOT A;  4CC7 A;  2VVK A;  3A98 A;  1NYG A;  2AKK A;  1OPL A;  2P4R A;  1WFW A;  2RQW A;  4J9H A;  2YUO A;  2CT3 A;  2JMC A;  1XOV A;  4F17 A;  2MOX A;  2K9G A;  3I35 A;  4X1V A;  5IH2 A;  2ROT A;  2EKH A;  2DE0 X;  1T0J A;  2KBT A;  1QKX A;  3EG2 A;  2FRW A;  2KNB B;  2KGT A;  2LQN A;  1FYN A;  2ENM A;  3U23 A;  1UGV A;  2LMJ A;  4OML A;  2C0T A;  1JO8 A;  2MIO A;  2JM9 A;  3IQL A;  2HSP A;  2CSI A;  2ESW A;  4QT7 A;  4F16 A;  1B07 A;  4Y92 A;  2L3S A;  2YUN A;  1JU5 C;  1AD5 A;  1ARK A;  3PVL A;  4Z89 A;  2J06 A;  1WI7 A;  1UDL A;  2KYM A;  1QWF A;  1Y57 A;  1SHF A;  2BTT A;  2ED1 A;  1V1C A;  2FEI A;  2RQT A;  1WIE A;  1JEG A;  2KRM A;  2L0A A;  3FJ5 A;  5FW9 A;  2L3P A;  2YUP A;  1KJW A;  2EVR A;  2LQW A;  2PNI A;  3NPF A;  1UHF A;  4IIM A;  2EGA A;  2EBP A;  2L3Q A;  5ECA A;  2F2W A;  4LNP A;  2O88 A;  2AKL A;  1TUC A;  2RPN A;  3M0P A;  3NMZ C;  2NUZ A;  1YCS B;  1PKS A;  2GGR A;  5FWC A;  3VS3 A;  2EPD A;  2CUB A;  1UUE A;  2VWF A;  2J6F A;  2V1R A;  2M0Y A;  2BZY A;  1M8M A;  2K2M A;  2JMA A;  3TSW A;  3VS2 A;  1M3B A;  1MV0 B;  3VS1 A;  2NWM A;  4J9C A;  2EYW A;  1FMK A;  2O9V A;  1BBZ A;  4J9F A;  2O31 A;  4J9G A;  2CRE A;  2CDT A;  2DRM A;  2CUD A;  1UJ0 A;  4CC2 A;  4JZ4 A;  1NLP C;  1ZUY A;  1M30 A;  2KXC A;  1AOJ A;  1GCQ A;  1WX6 A;  1WXT A;  2DL8 A;  1CKB A;  2YSQ A;  1K0S A;  2DLP A;  4LUD A;  4RTT A;  1GCP A;  2H8H A;  5GJW B;  5IXB A;  2A36 A;  4J9E A;  2KT1 A;  1QWE A;  3QWX X;  4A63 B;  1GFD A;  1BU1 A;  1VYU A;  2M51 A;  2F2X A;  2KR3 A;  5IXF A;  2PZ1 A;  3TVT A;  4HCK A;  2X3W D;  2YT6 A;  1SRL A;  4WCI A;  1YWP A;  2FO0 A;  2SEM A;  3RNJ A;  1UHC A;  3QWY A;  2DMO A;  3C0C A;  1OPK A;  3EG3 A;  1YP5 A;  3ULR B;  2GQI A;  4CC4 B;  3JV3 A;  4ZNX A;  1KSW A;  2L2P A;  4D8D A;  2EW3 A;  3M0U A;  1QCF A;  1ABO A;  4GLM A;  1CKA A;  5I22 A;  1RI9 A;  2LNH B;  2O2O A;  2EYZ A;  1Z9Q A;  4JJD A;  2A08 A;  1NYF A;  2D0N A;  2KRO A;  1NEG A;  2AK5 A;  2HBW A;  4OMP A;  2I0N A;  1ZX6 A;  1RLQ C;  2BZX A;  1TUD A;  2D1X A;  2ED0 A;  3VS0 A;  1K76 A;  4JJC A;  1U3O A;  1K0X A;  1NM7 A;  5IHI A;  2FG0 A;  2DBK A;  1M27 C;  3NHN A;  2V1Q A;  2CH4 A;  2ROL A;  3VRZ A;  1N5Z A;  1U06 A;  1X6B A;  4RTU A;  2K3B A;  1AWW A;  2XMF A;  2OJ2 A;  2FRY A;  5IHK A;  3I5S A;  2DIL A;  2KYB A;  1UEC A;  4RTZ A;  1X69 A;  4RTW A;  4LUE A;  1I0C A;  1NLO C;  4M4Z A;  1E7O A;  5HCK A;  1BB9 A;  2IIM A;  1W6X A;  2D8H A;  2DM1 A;  2DL5 A;  3NGP A;  1PRM C;  5GJV B;  2JTE A;  2DJQ A;  3VS7 A;  1MUZ A;  2FPE A;  1SRM A;  2QDL A;  3R6N A;  5EC7 A;  2AZV A;  3VS4 A;  2JS0 A;  2DL3 A;  2JS2 A;  2E5K A;  2JT4 A;  4LN2 A;  2DA9 A;  4J9I A;  2YUQ A;  2J05 A;  2W10 A;  4OMM A;  4F14 A;  1ZLM A;  3H0I A;  2OAW A;  4D8K A;  1E6G A;  1ZUU A;  1Z9Z A;  2DF6 A;  2GTO A;  3PVQ A;  1S1N A;  2BZ8 A;  1WLP B;  2EYY A;  5L23 A;  4RUG A;  4CC3 A;  2C0O A;  1UJY A;  2DL7 A;  2C0I A;  2B86 A;  2PTK A;  3VS5 A;  2W0Z A;  2LCS A;  1I07 A;  2ABL A;  2FPF A;  4HVV A;  3UAT A;  1GCQ C;  1QLY A;  1PNJ A;  1QKW A;  2CSQ A;  4Z8A A;  4RTY A;  4K11 A;  3RBB B;  2DNU A;  3REA B;  1NG2 A;  1W1F A;  2G6F X;  1U5S A;  2A28 A;  4RTV A;  2LJ1 A;  1K1Z A;  1VYT A;  3SEM A;  1E6H A;  4JPB W;  3VRY A;  2JXB A;  2JW4 A;  2CT4 A;  1WYX A;  3EHQ A;  2RQU A;  2EGC A;  1G83 A;  2RQR A;  2SRC A;  1VA7 A;  1CSK A;  2KEA A;  4GBQ A;  2LJ0 A;  3UF4 A;  1H92 A;  1JQQ A;  1MV3 A;  1W70 A;  2DX1 A;  2KE9 A;  3H0H A;  1K9A A;  1X6G A;  1H3H A;  2CH4 W;  3SHW A;  2JM8 A;  1OEB A;  1AWJ A;  3UA7 A;  1EFN A;  3EG1 A;  2DBM A;  2O9S A;  1GBR A;  2DVJ A;  1GBQ A;  1T3L A;  1G2B A;  1X2Q A;  4Z88 A;  3CQT A;  4AFS C;  1GFC A;  2DYB A;  4DEX A;  3TSZ A;  3EGU A;  1WA7 A;  1GL5 A;  1RLP C;  4RTX A;  2J6O A;  3REB B;  2KXD A;  1YNZ A;  2EQI A;  2GNC A;  1RUW A;  3KFV A;  2LZ6 B;  1AEY A;  5I11 A;  4HVW A;  2MCN A;  1AZG B;  3M0R A;  4R0K A;  4OMN A;  1Y0M A;  1AWX A;  4AFZ C;  3I9Q A;  3I5R A;  3EG0 A;  4JJB A;  2RNA A;  1VYV A;  1J3T A;  3M0Q A;  1B3Q A;  3UA6 A;  4EIK A;  2ECZ A;  1HD3 A;  3ZL7 C;  2HDA A;  1X43 A;  2RQV A;  1PRL C;  4J9B A;  4J9D A;  3H41 A;  1AWO A;  3M0S A;  1KFZ A;  1SSH A;  1UG1 A;  2KRN A;  4ORZ A;  2LX7 A;  1UFF A;  2A37 A;  5IHN A;  2GBQ A;  5FWB A;  1AVZ C;  1PKT A;  4AG2 C;  2K6D A;  1NEB A;  1YWO A;  2OI3 A;  4DEY A;  1JXO A;  1WXB A;  2K79 A;  2RN8 A;  2VKN A;  1YN8 A;  2LP5 A;  3PE0 A;  1T3S A;  4HVU A;  4HXJ A;  1LCK A;  2KT8 A;  4AFU C;  3THK A;  1SHG A;  3M0T A;  1JXM A;  1AZE A;  1M3C A;  1X2K A;  4KRT A;  1WXU A;  4ESR A;  1PHT A;  1IO6 A;  3H0F A;  1WDX A;  4OMQ A;  1HSQ A;  2YDL A;  1UE9 A;  3GBQ A;  2GTJ A;  2RF0 A;  2HEQ A;  4FSS A;  4AG1 C;  2J6K A;  2DL4 A;  1SEM A;  4E6R A;  3O5Z A;  1ZSG A;  1TG0 A;  2HCK A;  1X27 A;  1BK2 A;  1HJD A;  1KIK A;  1T0H A;  2D8J A;  3EHR A;  2K7A A;  2FPD A;  2KRS A;  1OV3 A;  1A0N B;  1I1J A;  1SPK A;  1UTI A;  4IIO A;  2EYX A;  2RMO A;  4LE9 A;  2EGE A;  1ABQ A;  1ZBJ A; 
#chains in the Genus database with same CATH topology
 4RKU E;  2F2V A;  5GAM e;  1PWT A;  2DTH A;  5GAM d;  2DD4 A;  4AFQ C;  4E47 A;  1MNE A;  2HQX A;  2MPX C;  2QEX T;  2X4W A;  1KQ1 A;  2R57 A;  4JZ3 A;  2OTJ T;  1ZUK A;  1K4U S;  3HRU A;  2FVU A;  4XTZ A;  1OOT A;  5GMK h;  2VVK A;  4C8Q E;  4A4G A;  1YIT Q;  1OPL A;  2P4R A;  1BIB A;  4M7A B;  5CK9 A;  2JMC A;  4F7U B;  1MMG A;  2MOX A;  3H9N A;  4M77 A;  4X1V A;  5IH2 A;  3L2U A;  2QTX A;  4C8Q A;  2DE0 X;  2QA4 Q;  3ME9 A;  1VQ6 T;  2LTO A;  1X01 A;  1QKX A;  1FYN A;  2CP3 A;  4A4E A;  4M7D G;  2KY9 A;  4JDS A;  2NUP A;  3U23 A;  2LNV A;  4OML A;  3OBY A;  1Y96 B;  3CD6 Q;  1W4S A;  2JM9 A;  3IQL A;  3P8B B;  5GAN e;  2O4X B;  4M75 D;  3C12 A;  4QT7 A;  4F16 A;  1BI0 A;  1NZ9 A;  1B07 A;  4Y92 A;  2YUN A;  4M7D C;  2DTI A;  3PVL A;  2J06 A;  2KMT A;  2RHZ A;  1VIE A;  2KK4 A;  1UDL A;  2KYM A;  1Y57 A;  1SHF A;  2BTT A;  3ZFJ A;  4C8Q B;  2VC8 A;  5KYU A;  1M90 C;  3JRZ A;  1G3W A;  5KYW B;  2EVR A;  2LQW A;  2WSF E;  2PNI A;  3CBM A;  1SKU B;  2O88 A;  1M8V A;  2AKL A;  1S72 A;  2RJF A;  3J7A F;  3H6Z A;  3M0P A;  1VQ7 T;  4MML A;  3NMZ C;  1YCS B;  3JB9 G;  1PKS A;  1TH7 A;  2FHD A;  4E7L A;  2CUB A;  4E7I A;  2VWF A;  3I56 Q;  4B9W A;  1M8M A;  2K2M A;  2QA4 A;  2BIV A;  3VUZ A;  1VQ9 T;  3CCQ T;  2EYW A;  4DBH A;  3X25 B;  2CDT A;  3SWN C;  1YIT A;  4CC2 A;  4HCB A;  5KH6 A;  1ZUY A;  1QP3 A;  1GCQ A;  3I55 T;  1HK9 A;  3LX7 A;  4C8Q C;  1LVK A;  1W2B S;  1CKB A;  2L3R A;  2H8H A;  2P0P A;  4J9E A;  2DZC A;  3NFC A;  4XU1 A;  1QWE A;  3QWX X;  3INZ A;  1VYU A;  1RAD B;  3LLR A;  3C4S A;  4HCK A;  5J26 A;  1RAF B;  4C0G A;  1N8R U;  1QCN A;  1UHC A;  3OSS C;  4E7K A;  1N9S A;  3MP8 A;  3ULR B;  3WXM B;  2GQI A;  1YJW A;  3CC7 A;  1Y71 A;  1CKA A;  4KT0 E;  1N9R A;  1RI9 A;  4J6X A;  2EYZ A;  1Q81 C;  4IKF A;  1WHM A;  2RK2 A;  8AT1 B;  3X26 B;  1ZX6 A;  1K73 C;  2D1X A;  2D9T A;  1IHW A;  4HCZ A;  3VS0 A;  4AMC A;  4PJO B;  4JJC A;  2XU8 A;  3JSC A;  1M27 C;  3X20 B;  2VXE A;  2ROL A;  3RDV A;  4E2F B;  4RTU A;  2K3B A;  1MMN A;  4C92 D;  2XMF A;  2Y90 A;  2FRY A;  4ME7 A;  4F7U G;  1MHN A;  2DIL A;  2QEX Q;  1M90 R;  1MND A;  1M5Q 1;  4WF2 A;  1H64 1;  4RTW A;  1ZA2 B;  4Y28 E;  4PJM A;  1W6X A;  2D8H A;  2DL5 A;  4J6W A;  4PFO A;  1VQ8 Q;  5J39 A;  3A8G B;  3CPW A;  2YWW A;  1TSF A;  5FLX E;  2LC4 A;  4M7D F;  3VS4 A;  1GXI E;  5KYX B;  1VQ5 A;  1XQH A;  2RJC A;  2YUQ A;  2W10 A;  4M7D D;  1ZLM A;  1WHJ A;  3NTK A;  2OAW A;  1PM3 A;  1ZBX A;  3KBG A;  1Z9Z A;  3CME A;  3OYN A;  4C92 F;  3ASK A;  2E3I A;  3S6W A;  1WLP B;  2DL7 A;  2C0I A;  2PTK A;  3E19 A;  5GAN 4;  4HVV A;  3I55 Q;  1K73 R;  1QVP A;  5GAN 7;  1YI2 A;  4PFZ A;  2MYS A;  4EMH A;  1YIJ Q;  3REA B;  4M7A F;  2XG8 D;  2G6F X;  3V7R A;  1QVF S;  1K1Z A;  3JCM X;  4ELY C;  1VQM T;  3MKD A;  4DBQ A;  3CC7 Q;  2K57 A;  1HXD A;  4QQG A;  2BUD A;  3MPU B;  3G71 A;  2PU9 B;  1WYX A;  3G71 Q;  3EHQ A;  2CP2 A;  4OP0 A;  1WQW A;  5D6X A;  1D0X A;  2K3Y A;  2KEA A;  4GBQ A;  2LJ0 A;  3GIB A;  3UF4 A;  1H92 A;  1OUL A;  4ZTJ A;  2F5T X;  3H0H A;  2LRQ A;  1Q81 R;  3I56 T;  5KYN A;  3SHW A;  2L89 A;  2RHI A;  5GAM j;  4E7H A;  1YIJ A;  1OEB A;  3R6O A;  5LJ3 g;  3I56 A;  4NOY A;  1Q86 U;  2DEQ A;  2O9S A;  1GBQ A;  1XJW B;  4PLI A;  2P0Q A;  1G2B A;  2HMA A;  5GAN 5;  3L2W A;  3CCV Q;  4DEX A;  3G71 T;  3LWI A;  3QHS A;  2CZ6 B;  4BDY A;  2J6O A;  3CME Q;  4M77 F;  1RAB B;  2OX7 A;  4BAC A;  2C06 A;  3KFV A;  2BE7 D;  1AEY A;  3QPH A;  4RMO A;  2QYZ A;  3OMG A;  3QZ5 B;  3V8L A;  4R0K A;  2V8K A;  1YFN A;  1Q86 C;  4VUB A;  2EQU A;  2FYK A;  3ZEH A;  4C8Q G;  4F04 B;  4AFZ C;  4M77 G;  1M9S A;  2DXU A;  2RNA A;  2MAM A;  2ECZ A;  3RR6 A;  2ZPH B;  5GAO l;  2HDA A;  1X43 A;  1VQ7 Q;  6AT1 B;  3CCL T;  3CME T;  2HSE B;  2QAZ A;  4Z02 A;  3OYE A;  2A37 A;  3VUB A;  5FWB A;  2I2L A;  3DLL A;  1BCM A;  4KUI A;  4JLG A;  2WSC E;  1M90 U;  1AVZ C;  4C92 C;  4AG2 C;  3EG9 A;  1JXO A;  4WTO B;  2VKN A;  1YN8 A;  1Y7X A;  4HVU A;  2KT8 A;  3RER A;  5HK3 A;  1FWZ A;  3HFO A;  1LOJ A;  3OYY A;  4IUP A;  4OMQ A;  1YJ9 Q;  3GBQ A;  2RF0 A;  4FSS A;  2XHC A;  2NYS A;  1IRE B;  1UEB A;  3DB4 A;  2E10 A;  3MET A;  1ZSG A;  5L8R E;  2VV5 A;  3CCJ T;  2HCK A;  2ZAE A;  3OYM A;  3TEE A;  1HYO A;  1YJW Q;  1KIK A;  3M54 A;  4X9D A;  5EG2 A;  3SB2 A;  2K5I A;  1A0N B;  2E6Z A;  3L2Z A;  3CCV T;  2CZ1 B;  3JB9 J;  3CCE A;  5CAI A;  2MMP A;  2K5F A;  4N0A A;  1I8F A;  1ABQ A;  1X75 C;  3MEA A;  2LVM A;  1I5L A;  1UB4 A;  4M7D E;  4LXC A;  2FZK B;  4ELZ C;  3OW2 S;  3LH5 A;  3BDU A;  2M9U A;  1JJ2 P;  1BIA A;  3VYG A;  3M59 A;  2O4X A;  3OQ5 A;  2E41 A;  2RJD A;  1N8R C;  2AZS A;  2QG9 B;  1H3Z A;  3FC3 A;  1YHQ Q;  1WHG A;  1WFW A;  2RQW A;  2V8I A;  1D1B A;  4F17 A;  2OTL Q;  4IUU A;  1VQ4 A;  2K9G A;  3I35 A;  4XTY A;  2ZPG B;  3L2R A;  5GMK m;  2KI7 A;  2EKH A;  1NE8 A;  1T0J A;  2KBT A;  4OVA A;  4A4H A;  2RA2 A;  2EFI A;  1G3Y A;  3OY9 A;  2ENM A;  1PD0 A;  2NLU A;  2C0T A;  1JO8 A;  3V7C A;  3QO3 A;  1N27 A;  2GF7 A;  1OU8 A;  4C0F A;  2L3S A;  1WGS A;  3CCQ A;  1VQ9 A;  5LJ5 f;  2XD0 A;  2ZPE B;  1AD5 A;  1VQO T;  1R0B G;  2MI6 A;  2HKQ B;  1WI7 A;  1X6O A;  2L0A A;  2L3P A;  2YUP A;  4J8O A;  4BDZ A;  1VQ9 Q;  5DLQ E;  4DA4 A;  4M7D A;  3CCU T;  5GAO r;  1UGS B;  2RPN A;  5GMK e;  2NUZ A;  3HRT A;  1KK7 A;  1QVF P;  5FWC A;  5GAM h;  3CCR T;  2JMA A;  1BI2 A;  5CKE A;  5AYF A;  2O9V A;  4QVC A;  3AHU A;  3G4S T;  4E7J A;  4J9F A;  3JB9 D;  4ANJ A;  3A8M B;  1ZSZ A;  3A1P A;  1NLP C;  3CCL Q;  5GMK l;  2P84 A;  1M30 A;  2KXC A;  1WX6 A;  4XTV A;  2YSQ A;  5GAO n;  4RTT A;  3WVD B;  3RKX A;  5IXB A;  4MMK A;  3CCR Q;  1WJQ A;  4A63 B;  2NUT B;  3RIR A;  2M51 A;  4R56 A;  2F2X A;  2KR3 A;  2PZ1 A;  4LDV A;  5LJ5 h;  3CCJ Q;  2LQK A;  4OB2 B;  1IXD A;  3GNF B;  1SRL A;  1YWP A;  2FO0 A;  3RNJ A;  2DMO A;  1VQK Q;  5CVI A;  3BE3 A;  1QVG A;  1WZO A;  3E9G A;  1G3S A;  3TQ7 P;  2K4Y A;  3JV3 A;  1PD1 A;  4ZNX A;  1ZA1 B;  5FU6 B;  1KSW A;  4D8D A;  2ZCF B;  2EJ9 A;  1G5V A;  4KUL A;  4QKU A;  1RAC B;  1Z9Q A;  2CZ0 B;  4JJD A;  4IUV A;  1NYF A;  1NEG A;  4XAX B;  2HBW A;  4M75 B;  2LCC A;  1QMC A;  3SDZ A;  3CCM T;  2D0Q B;  2EQM A;  5CKF A;  3AT1 B;  1TUD A;  2EWN A;  2HAX A;  1K8A R;  1YCY A;  3J80 E;  2HQH A;  4TVR A;  1B7T A;  1U3O A;  2V1Q A;  2CH4 A;  2COZ A;  1M1F A;  2JOY A;  2IVW A;  1X6B A;  4MZT A;  2CZ7 B;  1TTH B;  1FMV A;  5IHK A;  4JLI A;  4C0Z A;  1UEC A;  5A0G A;  4RTZ A;  1X69 A;  4M78 B;  5LJ5 e;  3OS1 A;  1M4Z A;  1E7O A;  1BB9 A;  3NGP A;  4XK8 E;  2HL5 C;  3NTH A;  2JTF A;  1D09 B;  1KC8 R;  5EC7 A;  2AZV A;  1DJ7 B;  3ZBD A;  2VUB A;  2DL3 A;  3CBO A;  3X28 B;  1M1K R;  2JT4 A;  3CCM A;  5A2Q E;  1TOV A;  2RJE A;  4RCB A;  1YJ9 T;  3G6E Q;  3H0I A;  2Z0W A;  1ZUU A;  2XIC A;  2DXB A;  2X4J A;  2DF6 A;  3HHT B;  1YJN Q;  4IUQ A;  3PVQ A;  3RMQ A;  5FRM A;  3H8Z A;  2BZ8 A;  3QJ6 A;  2MWP A;  3FJP A;  2EYY A;  2QTV A;  2XDB A;  1UJY A;  2HKN A;  2CP5 A;  2PVO B;  1OZ3 A;  3TU4 K;  1F1B B;  1YHQ A;  2COY A;  3Q1J A;  3UAT A;  3JCM V;  3TCJ A;  1QLY A;  1K8A C;  3LWH A;  2MK5 A;  3ER0 A;  3KXT A;  4JS4 A;  4HKE A;  2X35 A;  4FL6 A;  1W1F A;  1Q86 R;  2RHU A;  1NPP A;  2A28 A;  2LJ1 A;  2YRD A;  1OZ2 A;  3OYG A;  3JB9 F;  3SEM A;  3VRY A;  2JXB A;  2CT4 A;  4J7I A;  3CPW P;  3CCU Q;  5LJ3 f;  3HSB A;  2RQR A;  3LW5 E;  2CS7 A;  2VGM A;  2EJG A;  1JQQ A;  1MV3 A;  3G4S A;  2KE9 A;  2DX1 A;  1K9A A;  1X6G A;  3OMC A;  5GAN 2;  3M53 A;  1H3H A;  3PMI A;  1RI0 A;  5KYY B;  4QQD A;  3EG1 A;  1JBM A;  8ATC B;  2DBM A;  3QYG B;  3GP8 A;  3F70 A;  2V8J A;  4BI8 B;  1T3L A;  3QYH B;  3CC2 T;  2P4T A;  3OSV A;  2H3J A;  4AFS C;  2K5L A;  2DYB A;  1ZQ1 A;  2QGG A;  2PVG B;  1GL5 A;  4B9X A;  3CMA Q;  3L42 A;  2GNC A;  4O6J A;  2EIF A;  2LZ6 B;  1OU9 A;  3CCM Q;  1RAH B;  2EKO A;  2MCN A;  4BI3 A;  1YI2 T;  1EIF A;  4OMN A;  1VQO A;  5GAM f;  1Y0M A;  1VQ8 T;  1ZSZ B;  3A8H B;  3QKJ A;  3M0Q A;  1J3T A;  1Y07 A;  2RK1 A;  3UA6 A;  2DXT A;  4EIK A;  4L59 A;  1HD3 A;  4PJO C;  4UC4 A;  5KYU B;  2NUT A;  2ZGW A;  4GLK A;  4J9B A;  4QVZ A;  4J9D A;  3MEW A;  3M0S A;  1KD1 R;  3BY7 A;  1SSH A;  1UG1 A;  4KH1 B;  4L5G A;  2YRC A;  5D7U A;  3UPU A;  1VQ5 T;  4OGC A;  4YTL A;  1BI1 A;  3CCQ Q;  1PKT A;  1NEB A;  4DEY A;  1D1A A;  3HKS A;  3BDL A;  4M78 G;  4X9C A;  1RAG B;  4HXJ A;  4A4K A;  4AFU C;  2BKD N;  4DBR A;  1NPR A;  3EGX B;  1SHG A;  1M3C A;  4D6W A;  5DY9 A;  3CC4 Q;  3QDF A;  1WXU A;  1RL2 A;  4QW2 A;  4A53 A;  3EGD B;  1PHT A;  4JJN K;  1IO6 A;  4ZGD B;  2QQS A;  2GTJ A;  1U1S A;  4M78 F;  4AG1 C;  2O01 E;  2DL4 A;  2X4X A;  1SEM A;  2MWO A;  1IGU A;  3MEU A;  4PFP A;  4LDY A;  2EJF A;  3OYA A;  1HJD A;  2DXC A;  9ATC B;  3EHR A;  3CCV A;  2FPD A;  4C5I A;  4BY6 B;  1IHV A;  2XDD A;  1I1J A;  4FSX A;  1UTI A;  3OW2 P;  2K2V A;  1EZZ B;  4LE9 A;  3MO8 A;  4PLL A;  3EGD A;  4KGX B;  1VQL Q;  2KAF A;  2X3X D;  1N8R R;  4BE0 A;  4OMO A;  3RKW A;  5CKD A;  1M2V A;  2CKK A;  1H8K A;  2LJ3 A;  5LJ5 g;  1G3T A;  2J7I A;  1M3A A;  3UT1 A;  4XTX A;  5CKB A;  1VQL A;  2RI5 A;  4KGZ B;  2ZZD A;  2DPP B;  1YJW T;  3VS6 A;  4CC7 A;  3A98 A;  4J6Y A;  4KGV B;  2XID A;  3PIP A;  1TUG B;  2R5A A;  4E7Z A;  4B6M A;  2F1L A;  5A0L A;  4CI0 C;  1XOV A;  3P8H A;  3E1S A;  1UGQ B;  1O9S A;  3HRS A;  2ROT A;  2H3E B;  2WSE E;  1VIF A;  3RMS A;  2FRW A;  2OTJ Q;  2KGT A;  2LQN A;  3JB9 I;  3I55 A;  1UGV A;  3JCM Q;  2KQW A;  2CSI A;  2ESW A;  4KH0 B;  3X24 B;  3LGL A;  1M1G A;  1VQ8 A;  3OYF A;  3OYI A;  3CMA T;  4DBF A;  3PGG A;  2RB6 A;  4Z89 A;  1KD1 U;  2CP0 A;  3DKM A;  3LGF A;  1QWF A;  2ED1 A;  2FEI A;  2FZC B;  1WIE A;  1VQ7 A;  2KRM A;  5FW9 A;  4J5Y A;  1S72 T;  1S72 Q;  3T9N A;  1R77 A;  3LYI A;  3P8D A;  1XTD A;  3NPF A;  3RKY A;  4IIM A;  2EGA A;  2L3Q A;  5GAN j;  3PFS A;  5ECA A;  3CC2 A;  5KE3 A;  4BB7 A;  1TS9 A;  1VQO Q;  2GGR A;  3VS3 A;  5LJ3 h;  4PJO D;  2NUP B;  1UUE A;  1K9M C;  2J6F A;  2V1R A;  2BZY A;  1JJ2 A;  3TSW A;  3VS2 A;  1VQ4 Q;  1YIJ T;  1M3B A;  2LX9 A;  4XQ3 A;  3CPW S;  2NWM A;  4J9C A;  1O75 A;  1FMK A;  2RI2 A;  5CKH A;  3G1J A;  5FU7 C;  1BBZ A;  3QZ9 B;  2O31 A;  2G3R A;  1LPL A;  3GNG A;  4J9G A;  2E64 A;  3MEV A;  1EX4 A;  1UJ0 A;  1UGP B;  3HTR A;  1JRI A;  4MZM A;  1AOJ A;  4OMF B;  2XKO C;  4II1 A;  4KBM B;  2RHY A;  2DLP A;  4GY5 A;  4LUD A;  1Q81 U;  1GCP A;  5GJW B;  2DIG A;  2AT1 B;  4XTW A;  4M78 D;  5IXF A;  5I2M A;  5HK0 A;  1BKB A;  2X3W D;  3CPF A;  3HPW A;  2YT6 A;  4WCI A;  2SEM A;  2HQE A;  2QI2 A;  3C0C A;  1VQK T;  4M7A C;  1OPK A;  3JCM e;  3O8V A;  1Q82 C;  1YP5 A;  1KQS P;  4CC4 B;  3SD4 A;  4A4F A;  2KSS A;  4N4H A;  3MHX A;  1P92 A;  2EW3 A;  1QCF A;  5LJ3 j;  3MP6 A;  5IT9 E;  2YLC A;  4LDW A;  2O2O A;  2EAY A;  2RHX A;  3G7Z A;  2HL3 A;  2A08 A;  2D0N A;  2KRO A;  1D1C A;  2AK5 A;  1YJ9 A;  1VUB A;  2GQV A;  4OMP A;  2I0N A;  3EAE A;  3M4G A;  3SWN B;  1RLQ C;  1WJR A;  1M1K C;  2BZX A;  1D3B B;  2E4H A;  4PJL A;  4FYX B;  1K76 A;  1Q7Y R;  1K0X A;  4JUV A;  5CO7 A;  4M75 E;  1MGQ A;  1NM7 A;  3DB3 A;  3L2V A;  5IHI A;  2FG0 A;  2VB6 A;  3VYH B;  1QCO A;  3EGX A;  1QVF A;  5GAN f;  2L8D A;  1AWW A;  3OYJ A;  2KYB A;  1OX8 A;  4PJN A;  1I0C A;  4M4Z A;  1UGR B;  5HCK A;  2RD1 A;  3MP1 A;  5HKC A;  1K73 U;  2IIM A;  3GPL A;  4EMG A;  3CC4 A;  3SWN A;  3JCM W;  1PRM C;  4FM4 B;  2X9H A;  3EFO B;  5GJV B;  3EH2 A;  2JTE A;  5DLO A;  3VS7 A;  1MUZ A;  2FPE A;  1SRM A;  3R6N A;  2QK0 A;  3CD6 A;  1YBY A;  2A7Y A;  2XDP A;  3C94 A;  2JS0 A;  3OS0 A;  2E5K A;  4J9I A;  2XK0 A;  2J05 A;  2DZ9 A;  1TXQ A;  4F14 A;  1E6G A;  1QP2 A;  1WPY A;  2GTO A;  3OS5 A;  1Q7Y U;  4CC3 A;  2C0O A;  2PQW A;  3VV0 A;  3OYH A;  4N4G A;  4PKC C;  2B86 A;  1QW1 A;  1RAA B;  4C92 B;  4EMK A;  3KUF A;  2LCS A;  4BE2 A;  1I07 A;  2ABL A;  2FPF A;  2GCX A;  3CEY A;  1QKW A;  3PT9 A;  4Z8A A;  4RTY A;  4K11 A;  3RBB B;  2GFU A;  1IGQ A;  1U5S A;  2EYQ A;  1VYT A;  3JCM g;  1E6H A;  1TU0 B;  2YXY A;  4C92 A;  4EMK B;  3CCS A;  2YHT A;  2JW4 A;  3CCS Q;  1YIT T;  1FX7 A;  1G83 A;  2EGC A;  2SRC A;  1VA7 A;  5A0D A;  1W70 A;  2YRV A;  5I21 A;  2V26 A;  1PSE A;  2PUK B;  1OQK A;  4BUG A;  2COW A;  2CH4 W;  3M58 A;  2QA4 T;  1K9M R;  4N4I A;  3CCR A;  2VXF A;  4DQ2 A;  1AWJ A;  1YI2 Q;  1EFN A;  3S3N A;  3EH1 A;  5AT1 B;  4BI4 A;  4J7F A;  1GBR A;  2DVJ A;  2DEU A;  2FB7 A;  1C1A A;  4FYW B;  1KHC A;  2HNI A;  2E1H A;  1X2Q A;  4HT8 A;  3CCU A;  1G8X A;  2DAQ A;  3CQT A;  4C5H A;  1AT1 B;  4M78 C;  1JJ2 S;  1GFC A;  1D3B A;  4FU6 A;  2X51 A;  1KC8 C;  3TSZ A;  1LNX A;  1WA7 A;  3OW2 A;  2M16 A;  5FU6 C;  3REB B;  3EFS A;  4PJO A;  2KXD A;  2B8A A;  1YNZ A;  2EQI A;  1RUW A;  2DFU A;  3J81 E;  5D6W A;  2KDS A;  2AIR B;  2RO0 A;  1VQ6 Q;  3GF5 A;  1AZG B;  3HP9 A;  3M0R A;  4PJO G;  3QXE B;  5LJ3 e;  1AWX A;  3CC2 Q;  1OYX A;  3M57 A;  1JB0 E;  5IN1 A;  3I9Q A;  3I5R A;  3EG0 A;  4HT9 A;  1IB8 A;  2A3L A;  4PK4 A;  1KC8 U;  3ZL7 C;  2RQV A;  2HBP A;  2IG0 A;  2EQK A;  5CCA A;  2JUF A;  2KRN A;  4ORZ A;  4DOW A;  2LX7 A;  5LJ5 d;  1UFF A;  4OB0 B;  3DLM A;  1VQ4 T;  2JTM A;  3D7S B;  3URG A;  1YWO A;  3CD6 T;  3PIO A;  1WXB A;  1SSF A;  2RN8 A;  2LP5 A;  3M9Q A;  3PE0 A;  5GAN d;  4M7D B;  2ZPI B;  3THK A;  1FMW A;  4C8Q D;  2D6F A;  4OF1 A;  3M0T A;  3MCA B;  1X2K A;  5KYX A;  4RG8 A;  4BY6 C;  4AT1 B;  4J83 A;  2OTJ A;  3H0F A;  5GAN 8;  1HSQ A;  1K8A U;  1UE9 A;  5KCO A;  4XU2 A;  4PJJ A;  3OYD A;  2CP6 A;  2R58 A;  2J6K A;  3V7S A;  3EFO A;  3BFM A;  1PSF A;  1QQJ A;  2QDY B;  1TG0 A;  1KQS S;  2E3H A;  5HY6 A;  1BK2 A;  1VQP A;  3G4S Q;  3CCE T;  3V8K A;  4ZTF A;  3QG1 A;  2AHJ B;  1VOM A;  3HFN A;  5CQY A;  2WAC A;  2GFA A;  4IIO A;  5GAM g;  4PJO F;  3OYL A;  1NJI R;  2LDM A;  1R8O B;  4EPC A;  3CCJ A;  4O5V A;  1WJS A;  4C92 G;  3E9F A;  5GAO p;  1MMA A;  1GRI A;  1I4K 1;  5FU7 B;  2DO3 A;  2VYT A;  2DRK A;  5GAN h;  1D0Z A;  3VKI A;  5KE2 A;  4M7A E;  3OB9 A;  4M75 A;  4M7A A;  1VQN T;  3JAM E;  3M55 A;  2PVD B;  3QUI A;  1Q82 U;  1Q82 R;  1NYG A;  2AKK A;  1VQK A;  4XTU A;  3JCM c;  1C0M A;  4J9H A;  2YUO A;  2CT3 A;  4HA8 A;  1ZSZ C;  1BCO A;  5FRO A;  1Y96 A;  4NL3 A;  4JRQ A;  4LD6 A;  4PJO E;  1V76 A;  1U1T A;  3FEO A;  2HZY A;  1FXX A;  3G6E A;  3EG2 A;  4F7U E;  2KNB B;  4IUR A;  4OB3 B;  5IAY A;  2Y4Y A;  2PUO B;  4V2S A;  3CCL A;  4EDU A;  2LMJ A;  1XNI A;  2MIO A;  2F69 A;  2A0F B;  2HSP A;  4ZGJ B;  3CXC P;  2JNG A;  1JU5 C;  5GAO q;  4N0A C;  1KHI A;  4KUD K;  2M02 A;  4E7S A;  1ARK A;  3QSU A;  4RG2 A;  3A5Z B;  2DD5 A;  1V1C A;  2RQT A;  4M77 B;  2X4Y A;  1JEG A;  3FJ5 A;  1NJI C;  1Q95 G;  3C95 A;  2JJ9 A;  1KJW A;  4MDX A;  3L1A A;  1SF9 A;  3UDC A;  1UHF A;  2EBP A;  1KQS A;  3M4Y A;  2F2W A;  4LNP A;  3L2Q A;  5CIU A;  3EG9 B;  1TUC A;  2IPO B;  3FIF A;  4M78 E;  4ZN1 A;  2EPD A;  4C5E A;  2DYI A;  2LCL A;  3A8O B;  2M0Y A;  4C92 E;  5GMK i;  4FT4 A;  1MV0 B;  3VS1 A;  3CMA A;  4M75 F;  3OYB A;  1NJI U;  2DTO A;  1Q7Y C;  5M9O A;  1RAI B;  2CRE A;  2DRM A;  2CUD A;  4EMK C;  4JZ4 A;  4FCY A;  2QXF A;  4BE1 A;  2DKG A;  1WXT A;  2DL8 A;  2E65 A;  1VQM A;  1K0S A;  2DIQ A;  1I5O B;  2M1H A;  2HD0 A;  2DET A;  2A36 A;  2KT1 A;  1GFD A;  1BU1 A;  3JCM f;  1M2V B;  4R55 A;  1U8R A;  2QQ9 A;  3TVT A;  3FRN A;  4F7U F;  3QWY A;  2R5M A;  3VU3 C;  3CCE Q;  1M2O A;  1QVG P;  3EG3 A;  3PTA A;  1WHH A;  2QQB A;  2ZPB B;  1V29 B;  2E12 A;  2OAU A;  1VQN A;  5C6S A;  3OA6 A;  3PMT A;  1PCX A;  2L2P A;  3M0U A;  3NTI A;  1ABO A;  2OTL T;  4GLM A;  1VQL T;  2QQA A;  5I22 A;  2LNH B;  1KQ2 A;  3M5A A;  5CR2 A;  4X34 A;  4XU3 A;  4LD9 K;  2E70 A;  2K3X A;  5I2S A;  4RCC A;  2F5K A;  2VAS A;  5LJ5 j;  1B34 A;  3VJP A;  3N5B B;  5GMK j;  3E2U A;  4DOV A;  2ED0 A;  2CP7 A;  4M78 A;  2EQJ A;  4M77 E;  4PNO A;  3QJY A;  2DBK A;  1VQP T;  1MMD A;  2FL7 A;  3NHN A;  1BYM A;  2RM4 A;  1YJN A;  3VRZ A;  5KYY A;  1N5Z A;  1IZ6 A;  1U06 A;  3JCM b;  1KD1 C;  2OJ2 A;  3I5S A;  4QVD A;  3EFR A;  3WVE B;  4L6V 5;  4LUE A;  1NLO C;  2DM1 A;  1YJN T;  4M7A G;  2DJQ A;  3OBW A;  3JCM h;  4M77 D;  2QDL A;  5FRN A;  2YLB A;  4OGE A;  4Q5W A;  2JS2 A;  5GAN 6;  5KCH A;  3A8L B;  4LN2 A;  2DA9 A;  4MZP A;  1K9M U;  4OMM A;  5C0M A;  2BE9 B;  4D8K A;  5GAN 3;  4IUT A;  3GOX A;  1R0C B;  4HCC A;  2OTL A;  1S1N A;  1NBE B;  3S3O A;  3QBY A;  5L23 A;  3CC7 T;  4RUG A;  2QAS A;  1SG5 A;  3OS2 A;  3PNW C;  2LT4 A;  2L5Q A;  4QQ6 A;  4C0D B;  3VS5 A;  2W0Z A;  1LJO A;  2CGH A;  1GCQ C;  1WHL A;  3QII A;  3TRE A;  1PNJ A;  2CSQ A;  2DNU A;  2KVQ G;  1NG2 A;  3S3M A;  1OX9 A;  4P5N A;  4RTV A;  1VQM Q;  1ACM B;  2QGF B;  4JPB W;  4FW2 A;  1ZHI A;  1C6V X;  2RQU A;  3V8J A;  3RES A;  5J3B A;  5LJ3 d;  1CSK A;  4JRI A;  3CBP A;  4ZN3 A;  3JCM d;  1B34 B;  2JM8 A;  2JZ2 A;  4NS5 A;  1W2B P;  3FB9 A;  3UA7 A;  1W2B A;  1M1K U;  3CXC S;  4C0D C;  5GAN g;  4M75 C;  4ZGE B;  1PC0 A;  2JVV A;  4Z88 A;  2DJZ A;  3CCS T;  3JCM P;  1VQP Q;  3EGU A;  4M7A D;  1RLP C;  4RTX A;  2VGN A;  4FT2 A;  2MF2 A;  3UWN A;  4C8Q F;  4Y91 A;  4OB1 B;  4A54 A;  5CQX A;  3HL8 A;  4M75 G;  5LL6 S;  5I11 A;  1N6A A;  4HVW A;  4ATO A;  4FW1 A;  1D0Y A;  1WNL A;  3JB9 H;  2ATC B;  4FYY B;  1YHQ T;  4JJB A;  3JCM J;  1VYV A;  4FYV B;  4MDW A;  3QDR B;  1B3Q A;  4PL6 A;  1OI1 A;  2QQR A;  2FZG B;  1PRL C;  1WQ7 A;  2XI9 A;  4BD3 A;  3H41 A;  1AWO A;  3OYK A;  1TWB A;  2DVE A;  1KFZ A;  2ZPF B;  4NL2 A;  3G6E T;  5IHN A;  1VQ6 A;  2GBQ A;  1VQ5 Q;  1BI3 A;  4JRK A;  5GAO m;  2RH2 A;  1IRX A;  2DER A;  2RI3 A;  2K6D A;  2LQ8 A;  2OI3 A;  5D6Y A;  2K79 A;  3MJX A;  1T3S A;  3FDR A;  1LCK A;  3RUX A;  4XU0 A;  1AZE A;  1JXM A;  4KRT A;  3CC4 T;  3CXC A;  1I81 A;  4ESR A;  2Y4X A;  2DK3 A;  2E6N A;  3LH0 A;  4M77 C;  1WDX A;  2YDL A;  2QEX A;  1AHJ B;  2HEQ A;  4LDX A;  1WHK A;  1KG1 A;  2M0O A;  4F7U A;  1RAE B;  4E6R A;  3O5Z A;  1QVG S;  2JN0 A;  7AT1 B;  1X27 A;  4FIB A;  2E5Q A;  2CYZ B;  2LT1 A;  1VQN Q;  1T0H A;  2D8J A;  3BW1 A;  2K7A A;  3OYC A;  5KYW A;  2KRS A;  1OV3 A;  3SFM A;  4CRI A;  1SPK A;  2EYX A;  2P0K A;  1PG5 B;  3FLG A;  4LDU A;  5DM7 R;  4C5G A;  4JS5 A;  2RMO A;  4JRP A;  3M56 A;  2EGE A;  3GLX A;  1ZBJ A; 
#chains in the Genus database with same CATH homology
 2X3X D;  4OMO A;  1GRI A;  2F2V A;  1PWT A;  3LH5 A;  1H8K A;  2LJ3 A;  4AFQ C;  2DRK A;  2J7I A;  1M3A A;  4JZ3 A;  1ZUK A;  2AZS A;  3VS6 A;  1K4U S;  1OOT A;  4CC7 A;  2VVK A;  3A98 A;  1NYG A;  2AKK A;  1OPL A;  2P4R A;  1WFW A;  2RQW A;  4J9H A;  2YUO A;  2CT3 A;  2JMC A;  1XOV A;  4F17 A;  2MOX A;  2K9G A;  3I35 A;  4X1V A;  5IH2 A;  2ROT A;  2EKH A;  2DE0 X;  1T0J A;  2KBT A;  1QKX A;  3EG2 A;  2FRW A;  2KNB B;  2KGT A;  2LQN A;  1FYN A;  2ENM A;  3U23 A;  1UGV A;  2LMJ A;  4OML A;  2C0T A;  1JO8 A;  2MIO A;  2JM9 A;  3IQL A;  2HSP A;  2CSI A;  2ESW A;  4QT7 A;  4F16 A;  1B07 A;  4Y92 A;  2L3S A;  2YUN A;  1JU5 C;  1AD5 A;  1ARK A;  3PVL A;  4Z89 A;  2J06 A;  1WI7 A;  1UDL A;  2KYM A;  1QWF A;  1Y57 A;  1SHF A;  2BTT A;  2ED1 A;  1V1C A;  2FEI A;  2RQT A;  1WIE A;  1JEG A;  2KRM A;  2L0A A;  3FJ5 A;  5FW9 A;  2L3P A;  2YUP A;  1KJW A;  2EVR A;  2LQW A;  2PNI A;  3NPF A;  1UHF A;  4IIM A;  2EGA A;  2EBP A;  2L3Q A;  5ECA A;  2F2W A;  4LNP A;  2O88 A;  2AKL A;  1TUC A;  2RPN A;  3M0P A;  3NMZ C;  2NUZ A;  1YCS B;  1PKS A;  2GGR A;  5FWC A;  3VS3 A;  2EPD A;  2CUB A;  1UUE A;  2VWF A;  2J6F A;  2V1R A;  2M0Y A;  2BZY A;  1M8M A;  2K2M A;  2JMA A;  3TSW A;  3VS2 A;  1M3B A;  1MV0 B;  3VS1 A;  2NWM A;  4J9C A;  2EYW A;  1FMK A;  2O9V A;  1BBZ A;  4J9F A;  2O31 A;  4J9G A;  2CRE A;  2CDT A;  2DRM A;  2CUD A;  1UJ0 A;  4CC2 A;  4JZ4 A;  1NLP C;  1ZUY A;  1M30 A;  2KXC A;  1AOJ A;  1GCQ A;  1WX6 A;  1WXT A;  2DL8 A;  1CKB A;  2YSQ A;  1K0S A;  2DLP A;  4LUD A;  4RTT A;  1GCP A;  2H8H A;  5GJW B;  5IXB A;  2A36 A;  4J9E A;  2KT1 A;  1QWE A;  3QWX X;  4A63 B;  1GFD A;  1BU1 A;  1VYU A;  2M51 A;  2F2X A;  2KR3 A;  5IXF A;  2PZ1 A;  3TVT A;  4HCK A;  2X3W D;  2YT6 A;  1SRL A;  4WCI A;  1YWP A;  2FO0 A;  2SEM A;  3RNJ A;  1UHC A;  3QWY A;  2DMO A;  3C0C A;  1OPK A;  3EG3 A;  1YP5 A;  3ULR B;  2GQI A;  4CC4 B;  3JV3 A;  4ZNX A;  1KSW A;  2L2P A;  4D8D A;  2EW3 A;  3M0U A;  1QCF A;  1ABO A;  4GLM A;  1CKA A;  5I22 A;  1RI9 A;  2LNH B;  2O2O A;  2EYZ A;  1Z9Q A;  4JJD A;  2A08 A;  1NYF A;  2D0N A;  2KRO A;  1NEG A;  2AK5 A;  2HBW A;  4OMP A;  2I0N A;  1ZX6 A;  1RLQ C;  2BZX A;  1TUD A;  2D1X A;  2ED0 A;  3VS0 A;  1K76 A;  4JJC A;  1U3O A;  1K0X A;  1NM7 A;  5IHI A;  2FG0 A;  2DBK A;  1M27 C;  3NHN A;  2V1Q A;  2CH4 A;  2ROL A;  3VRZ A;  1N5Z A;  1U06 A;  1X6B A;  4RTU A;  2K3B A;  1AWW A;  2XMF A;  2OJ2 A;  2FRY A;  5IHK A;  3I5S A;  2DIL A;  2KYB A;  1UEC A;  4RTZ A;  1X69 A;  4RTW A;  4LUE A;  1I0C A;  1NLO C;  4M4Z A;  1E7O A;  5HCK A;  1BB9 A;  2IIM A;  1W6X A;  2D8H A;  2DM1 A;  2DL5 A;  3NGP A;  1PRM C;  5GJV B;  2JTE A;  2DJQ A;  3VS7 A;  1MUZ A;  2FPE A;  1SRM A;  2QDL A;  3R6N A;  5EC7 A;  2AZV A;  3VS4 A;  2JS0 A;  2DL3 A;  2JS2 A;  2E5K A;  2JT4 A;  4LN2 A;  2DA9 A;  4J9I A;  2YUQ A;  2J05 A;  2W10 A;  4OMM A;  4F14 A;  1ZLM A;  3H0I A;  2OAW A;  4D8K A;  1E6G A;  1ZUU A;  1Z9Z A;  2DF6 A;  2GTO A;  3PVQ A;  1S1N A;  2BZ8 A;  1WLP B;  2EYY A;  5L23 A;  4RUG A;  4CC3 A;  2C0O A;  1UJY A;  2DL7 A;  2C0I A;  2B86 A;  2PTK A;  3VS5 A;  2W0Z A;  2LCS A;  1I07 A;  2ABL A;  2FPF A;  4HVV A;  3UAT A;  1GCQ C;  1QLY A;  1PNJ A;  1QKW A;  2CSQ A;  4Z8A A;  4RTY A;  4K11 A;  3RBB B;  2DNU A;  3REA B;  1NG2 A;  1W1F A;  2G6F X;  1U5S A;  2A28 A;  4RTV A;  2LJ1 A;  1K1Z A;  1VYT A;  3SEM A;  1E6H A;  4JPB W;  3VRY A;  2JXB A;  2JW4 A;  2CT4 A;  1WYX A;  3EHQ A;  2RQU A;  2EGC A;  1G83 A;  2RQR A;  2SRC A;  1VA7 A;  1CSK A;  2KEA A;  4GBQ A;  2LJ0 A;  3UF4 A;  1H92 A;  1JQQ A;  1MV3 A;  1W70 A;  2DX1 A;  2KE9 A;  3H0H A;  1K9A A;  1X6G A;  1H3H A;  2CH4 W;  3SHW A;  2JM8 A;  1OEB A;  1AWJ A;  3UA7 A;  1EFN A;  3EG1 A;  2DBM A;  2O9S A;  1GBR A;  2DVJ A;  1GBQ A;  1T3L A;  1G2B A;  1X2Q A;  4Z88 A;  3CQT A;  4AFS C;  1GFC A;  2DYB A;  4DEX A;  3TSZ A;  3EGU A;  1WA7 A;  1GL5 A;  1RLP C;  4RTX A;  2J6O A;  3REB B;  2KXD A;  1YNZ A;  2EQI A;  2GNC A;  1RUW A;  3KFV A;  2LZ6 B;  1AEY A;  5I11 A;  4HVW A;  2MCN A;  1AZG B;  3M0R A;  4R0K A;  4OMN A;  1Y0M A;  1AWX A;  4AFZ C;  3I9Q A;  3I5R A;  3EG0 A;  4JJB A;  2RNA A;  1VYV A;  1J3T A;  3M0Q A;  1B3Q A;  3UA6 A;  4EIK A;  2ECZ A;  1HD3 A;  3ZL7 C;  2HDA A;  1X43 A;  2RQV A;  1PRL C;  4J9B A;  4J9D A;  3H41 A;  1AWO A;  3M0S A;  1KFZ A;  1SSH A;  1UG1 A;  2KRN A;  4ORZ A;  2LX7 A;  1UFF A;  2A37 A;  5IHN A;  2GBQ A;  5FWB A;  1AVZ C;  1PKT A;  4AG2 C;  2K6D A;  1NEB A;  1YWO A;  2OI3 A;  4DEY A;  1JXO A;  1WXB A;  2K79 A;  2RN8 A;  2VKN A;  1YN8 A;  2LP5 A;  3PE0 A;  1T3S A;  4HVU A;  4HXJ A;  1LCK A;  2KT8 A;  4AFU C;  3THK A;  1SHG A;  3M0T A;  1JXM A;  1AZE A;  1M3C A;  1X2K A;  4KRT A;  1WXU A;  4ESR A;  1PHT A;  1IO6 A;  3H0F A;  1WDX A;  4OMQ A;  1HSQ A;  2YDL A;  1UE9 A;  3GBQ A;  2GTJ A;  2RF0 A;  2HEQ A;  4FSS A;  4AG1 C;  2J6K A;  2DL4 A;  1SEM A;  4E6R A;  3O5Z A;  1ZSG A;  1TG0 A;  2HCK A;  1X27 A;  1BK2 A;  1HJD A;  1KIK A;  1T0H A;  2D8J A;  3EHR A;  2K7A A;  2FPD A;  2KRS A;  1OV3 A;  1A0N B;  1I1J A;  1SPK A;  1UTI A;  4IIO A;  2EYX A;  2RMO A;  4LE9 A;  2EGE A;  1ABQ A;  1ZBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...