4AFSC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afsC00
3EG0A 1GL5A 2D0NA 1WXTA 2LNHB 2RMOA 4OMOA 2LX7A 4RTZA 5IHKA 1ZBJA 5HCKA 2RNAA 1MUZA 3EGUA 1OV3A 1UTIA 2BZYA 4AG1C 1NLOC 1BB9A 4AFUC 1WI7A 4WCIA 3VS1A 1JEGA 1ABQA 2EQIA 1I0CA 2CSQA 2GTJA 2DLPA 1ZUKA 1UJ0A 3M0RA 2LP5A 4F14A 1G83A 4GBQA 2D8JA 4J9DA 3PVLA 1AWOA 2YUOA 1SEMA 1AEYA 2SRCA 2OAWA 3VS4A 2O9SA 1FMKA 2DM1A 2L0AA 3M0UA 1TUDA 2J6KA 1RI9A 4OMMA 2VVKA 3M0TA 1UG1A 2VWFA 3UF4A 2CH4A 2A36A 2JW4A 3U23A 3TVTA 1X43A 2ESWA 4M4ZA 2RQRA 2C0IA 1YWOA 2YUNA 3VS2A 2CH4W 1NYFA 1SHGA 2K79A 1CSKA 1NEGA 2AKKA 4R0KA 1RLPC 2KYBA 3TSZA 1X2QA 1M3BA 1U5SA 1FYNA 2CDTA 2XMFA 1UHFA 3EG2A 1K0XA 1WDXA 5GJVB 4OMQA 4RTUA 1PHTA 1UJYA 4Z89A 1U06A 1WXUA 2JT4A 3EG3A 3VRYA 1JXMA 1SRMA 4EIKA 2RPNA 4DEYA 4HXJA 4CC7A 4J9BA 2EBPA 1EFNA 2LCSA 3C0CA 2GBQA 2CUDA 1X2KA 3QWYA 2L3QA 4JJCA 1WA7A 2RF0A 3VS7A 1PKSA 1N5ZA 2DA9A 2L2PA 4Y92A 1JQQA 2BTTA 2VKNA 4FSSA 1UUEA 4RTXA 2X3WD 4HVUA 1YWPA 2GQIA 2X3XD 2FEIA 2L3SA 2KT8A 3M0SA 2EGCA 2DL7A 3M0PA 5ECAA 1X27A 1M3CA 1SHFA 2ABLA 4OMLA 1T0JA 1YNZA 1YCSB 1NLPC 3PVQA 4ESRA 2K2MA 1UE9A 1K9AA 2O88A 1GCQC 4OMNA 1XOVA 2AZVA 3I35A 2J05A 2A08A 2ROLA 2BZ8A 2LMJA 2MOXA 2DBKA 3H41A 1E7OA 1ZUYA 2CUBA 2O2OA 2ECZA 1U3OA 2I0NA 4JJDA 5I11A 1I07A 2DE0X 1M27C 1YN8A 4RTTA 1HSQA 2DL5A 2FPEA 4CC3A 2J06A 5EC7A 4A63B 3I5RA 2KYMA 1VYVA 4LN2A 2JS0A 1TUCA 1H3HA 2LJ0A 2OJ2A 5FWBA 4ZNXA 2RQTA 3REAB 3QWXX 2FRYA 2KRMA 4CC4B 1UECA 1V1CA 2J6FA 1AWWA 3M0QA 3UA6A 1GCPA 2C0TA 2KNBB 3ZL7C 2E5KA 2CT4A 2CT3A 2K7AA 3TSWA 1AVZC 2L3PA 3IQLA 4Z8AA 2K3BA 2NUZA 1B3QA 1CKBA 4AG2C 4DEXA 1GBRA 1K76A 2EYXA 2EYZA 2P4RA 2HEQA 4LNPA 1M30A 3THKA 2ED0A 1GFDA 2KEAA 1PNJA 4D8DA 1NM7A 1JXOA 1KSWA 1H92A 4RTWA 1AD5A 3UATA 1E6GA 1ZLMA 2O31A 1VYUA 1UFFA 4RTVA 2W0ZA 2JM8A 2IIMA 1RLQC 2ROTA 2FRWA 5FWCA 2FPFA 2LQNA 4LE9A 4J9HA 4AFQC 2B86A 2KXCA 3H0FA 2J6OA 2MCNA 1M8MA 1QWEA 2EVRA 5FW9A 1OEBA 2CSIA 3SEMA 4LUDA 2SEMA 1W70A 3I9QA 2LJ3A 1ZSGA 4QT7A 4CC2A 1T3SA 5L23A 2EGAA 2JM9A 2DL8A 2GNCA 1PRMC 2DBMA 2EYYA 2KE9A 3VS6A 2KGTA 1ZX6A 2RQUA 2JMAA 1KFZA 1KIKA 1GBQA 1E6HA 4J9CA 4J9EA 2G6FX 2RQVA 1AWXA 1S1NA 2BZXA 2EKHA 3REBB 1QKXA 2M51A 4J9IA 4RTYA 1GRIA 1W1FA 3EHQA 4JZ3A 5IXBA 2KT1A 1UDLA 2HBWA 1VYTA 1G2BA 2PNIA 1NEBA 3NHNA 2DILA 1PWTA 2M0YA 4OMPA 1QCFA 2C0OA 2OI3A 4D8KA 3EHRA 1UHCA 1WLPB 1GCQA 3CQTA 3RBBB 2FO0A 2KRNA 2YDLA 1OPKA 1JU5C 1J3TA 2J7IA 1GFCA 2HCKA 2YUPA 4GLMA 4J9FA 1OOTA 4K11A 2F2WA 1TG0A 3H0IA 1UGVA 2QDLA 1WFWA 2RN8A 2YUQA 2H8HA 1PKTA 2GGRA 2EGEA 2JMCA 2KXDA 5IH2A 2AK5A 1CKAA 1PRLC 3FJ5A 2DL3A 2F2VA 2HSPA 2PZ1A 4F16A 3JV3A 1WX6A 1BU1A 3I5SA 1Z9ZA 2ED1A 4ORZA 2W10A 3VS0A 1AOJA 4HVVA 2DYBA 1HD3A 2DRMA 2JS2A 1HJDA 2EW3A 1K4US 1ABOA 4J9GA 4X1VA 2KR3A 1SSHA 1A0NB 2KBTA 3UA7A 1QWFA 4F17A 1SPKA 3NPFA 2LJ1A 1WXBA 2EYWA 1H8KA 1T0HA 1Y57A 3ULRB 3GBQA 2A28A 2PTKA 3RNJA 2MIOA 3NGPA 1NG2A 1OPLA 2KROA 1M3AA 1QKWA 1ZUUA 2A37A 1X6GA 4AFZC 2DNUA 1AZGB 1MV3A 2D1XA 2JXBA 4IIMA 2DF6A 1B07A 2YT6A 2DMOA 1K0SA 3VS3A 3A98A 3O5ZA 1JO8A 1W6XA 2AZSA 2KRSA 1K1ZA 1RUWA 2YSQA 1SRLA 4LUEA 1WIEA 1BK2A 1YP5A 2NWMA 5IHNA 4AFSC 1BBZA 2DJQA 4JPBW 4JJBA 3VS5A 1IO6A 2K6DA 3SHWA 3LH5A 2V1RA 4E6RA 1WYXA 2CREA 2LZ6B 1Z9QA 4HCKA 2HDAA 2DRKA 3R6NA 3H0HA 2JTEA 2K9GA 5I22A 3EG1A 2RQWA 2O9VA 2V1QA 1VA7A 3VRZA 4HVWA 1NYGA 2EPDA 1KJWA 5IHIA 3NMZC 2ENMA 1QLYA 2AKLA 1X69A 2FG0A 5GJWB 3KFVA 1MV0B 1AZEA 2FPDA 1I1JA 3PE0A 1LCKA 2LQWA 1ARKA 2D8HA 2F2XA 4JZ4A 4Z88A 2DVJA 1AWJA 1T3LA 2DX1A 4RUGA 1X6BA 4IIOA 5IXFA 1Y0MA 2DL4A 4KRTA 2GTOA
chains in the Genus database with same CATH superfamily
3EG0A 4OB0B 1WXTA 3CPWS 4C8QA 5KYWB 5IHKA 3HKSA 3H9NA 4DBQA 3CMAT 3CXCS 4F7UG 2BZYA 1I0CA 4X9DA 1ZUKA 3CBMA 3CMEA 1OU9A 3PFSA 1VQPT 1HXDA 5IN1A 3TCJA 5GAOn 1WPYA 2COZA 4FYXB 2EIFA 2F5TX 3VS4A 2O9SA 5FU7B 4JJNK 1BCMA 2F69A 2QQRA 1RI9A 3WVDB 1R77A 4J83A 1OZ2A 2P0QA 1TOVA 2EQUA 2JW4A 3TVTA 4WTOB 1X43A 3ZEHA 4FIBA 1N9RA 4M4ZA 4HT9A 1QW1A 2RQRA 3N5BB 3MEVA 1YFNA 3EGDB 1D1BA 3EH2A 2YUNA 2WACA 4XK8E 2QEXT 2PUKB 4R0KA 1OYXA 4FYYB 1K8AC 1C6VX 2KYBA 1QVGA 4PJJA 2K3XA 5GAMd 3FIFA 1M3BA 1U5SA 3NFCA 4XTVA 1IB8A 4LDYA 2QA4Q 2ZGWA 1WHMA 1Y96B 4OMQA 4A4FA 1PHTA 1UJYA 5LJ3g 1WXUA 2LX9A 5C0MA 5KCHA 1JXMA 2KVQG 2V8KA 2FZCB 5A0GA 5LJ5e 3FEOA 2CUDA 1X2KA 5KE3A 1VQMT 1WHHA 2E41A 5I2MA 2DIQA 5LJ5h 1VQ8Q 1AHJB 2RF0A 1VIEA 2HMAA 3X25B 4OVAA 1YITT 1N5ZA 1VQ7Q 3G1JA 5IT9E 2VKNA 1VQ6T 3BY7A 1YWPA 2GQIA 2L3SA 1OU8A 1GXIE 3UWNA 5GANj 4QQ6A 1UEBA 4XAXB 1NPRA 1QVGP 2AIRB 2K2MA 2DJZA 4OMNA 1XOVA 3LGFA 2AZVA 2LQKA 3I35A 2A08A 2FYKA 4LDXA 2ROLA 2XK0A 2DFUA 2P84A 2DBKA 1I4K1 3PIPA 2RB6A 1JRIA 2CUBA 2KY9A 3I55A 1U3OA 2RI3A 4RTTA 5CQYA 2DL5A 2FB7A 2K5LA 1K8AR 1BIBA 1HK9A 2DD5A 5EC7A 3I5RA 1MNEA 3CC4Q 1TUCA 2E12A 4IUVA 2LJ0A 1H3HA 3TREA 4ZNXA 3NTKA 3REAB 2ZZDA 4XU2A 1V1CA 1AWWA 3CCST 3QJYA 3TQ7P 3JB9F 4C5HA 1BIAA 1GCPA 5DLOA 2C0TA 1YJWT 3G6EQ 4ME7A 3OY9A 1YIJQ 2CT3A 2K7AA 3TSWA 1AVZC 3IQLA 4Z8AA 2ZAEA 4AG2C 3CCQQ 4XTZA 4EMKB 4QKUA 1VQLQ 2WSCE 2EYZA 3G4SQ 4MZMA 8ATCB 2PQWA 4LNPA 3QIIA 4C92G 2YXYA 3THKA 5LJ3e 3G71T 5LJ5d 1VQKT 2E70A 1UGQB 4XU3A 4IKFA 1NM7A 1JXOA 1YI2Q 3MEUA 1WHLA 2P0PA 4M7DG 4IUTA 3OB9A 4KUIA 1P92A 3PMTA 3QDFA 1AD5A 5LJ3h 1ZLMA 2O31A 5GMKl 1UFFA 1Q95G 2HQEA 1IRXA 3MP6A 3JCMV 4C92E 2RI5A 4E7ZA 4J9HA 2EAYA 4C92D 4LXCA 2JOYA 2J6OA 2MCNA 1QWEA 2QQAA 1QCNA 4M7DD 2F5KA 1QVGS 2SEMA 1W70A 3I9QA 3A8HB 2YWWA 4QT7A 4TVRA 2A0FB 4CC2A 1ZHIA 3EAEA 2DL8A 4QQDA 5C6SA 2QYZA 4L5GA 3CCVT 4J9CA 5CKBA 1ZSZC 3OS2A 1S1NA 3M4GA 2M51A 4J9IA 5GAOm 3JCMQ 1GRIA 3G7ZA 3EHQA 2PVDB 1VQ5A 1RL2A 1VQNQ 4QVDA 2PNIA 2GFAA 4JRPA 2L5QA 2FVUA 1M1FA 2OTJQ 3J7AF 1QCFA 4OP0A 4D8KA 5DLQE 1GCQA 1KHIA 4FT2A 3OA6A 1QVFA 2FL7A 2KRNA 2YDLA 4F7UA 1KQ2A 2LC4A 1GFCA 1M4ZA 2YUPA 3A1PA 4JLGA 1WHJA 4GLMA 4J9FA 1I5OB 4OMFB 1TG0A 4CRIA 2E64A 4X9CA 2YUQA 4HCCA 3E2UA 4E2FB 3C95A 1CKAA 1PRLC 3CCUQ 4PK4A 2RD1A 2F2VA 3JV3A 1WX6A 1BU1A 1N8RC 5LJ3d 3X24B 4HVVA 1RADB 4C8QE 5CO7A 1YCYA 4C8QD 2NLUA 1MMDA 5CR2A 1OQKA 3OSVA 1HJDA 2KR3A 2CKKA 1Q82U 5D6YA 1A0NB 2KBTA 1SPKA 5A0DA 1D09B 1M2OA 2I2LA 2JNGA 3OYBA 4JLIA 3L2UA 1FWZA 3GBQA 2A28A 2MIOA 1QVFP 4OB3B 4LDWA 4V2SA 2A37A 4AFZC 1W2BP 4HCBA 2D1XA 4IIMA 1M1KC 2VXEA 2DF6A 4BB7A 3JB9I 3JB9J 1Q86C 3CCMQ 1Q81C 3QUIA 2G3RA 3OYMA 3OBYA 4Q5WA 1NZ9A 1JO8A 5FLXE 1SRLA 1WIEA 2X51A 4XTWA 2NWMA 1S72Q 2KAFA 4ZN1A 1NE8A 3VS5A 5GANh 3SHWA 3VYHB 4HT8A 2JN0A 4J6XA 2O4XA 1Z9QA 4HCKA 4A4KA 2RHXA 1VQ7A 1EZZB 5GMKe 2JTEA 2K9GA 4BD3A 2RQWA 1VA7A 2YRDA 1NYGA 1NPPA 4P5NA 1KJWA 3M58A 5CAIA 2L8DA 1HYOA 2DTHA 1Y71A 4EDUA 4M75G 3OYNA 1Y7XA 5GJWB 1MV0B 3BFMA 4FM4B 4FW1A 1I1JA 1G3SA 1RAHB 2L89A 1M1GA 5KH6A 5FU6B 4JZ4A 2DVJA 2VGNA 3X20B 1RAGB 4MZTA 2VGMA 4DBRA 1Y0MA 4KRTA 4BUGA 2HSEB 1YHQQ 1QVPA 4ELYC 5GAN6 2D0NA 4E7JA 4OMOA 6AT1B 2LX7A 4M7AG 1M1KR 4N4HA 1RAEB 2HQHA 5KYXA 2OTLA 3CC4A 2RNAA 2M0OA 1MUZA 1Q86R 1Q81R 2MYSA 1UTIA 3MP8A 1WQWA 5J3BA 1BB9A 2QASA 1VQ9T 1QVFS 4BY6C 1WI7A 1ABQA 1SG5A 1JBMA 3UPUA 2DLPA 4E47A 1W2BS 5KYYB 1UJ0A 4EMKA 2H3EB 3G6EA 1YIJA 4J9DA 1MMGA 3PVLA 4M7AD 2YUOA 3QO3A 4M77G 3CCQA 5CCAA 1N27A 3CPFA 2OAWA 2RI2A 2LNVA 2L0AA 2RK1A 4II1A 3H6ZA 3C12A 3HRSA 5GAN8 1H641 2XDPA 4C92A 5GANd 1UG1A 2LT4A 1D1AA 3FLGA 1VQPQ 2A36A 1RI0A 4M7DA 4NOYA 1PCXA 1YI2A 4M77E 4M77D 4J7FA 4KT0E 3SWNA 3MJXA 2Z0WA 3CCRT 1NEGA 2CZ1B 2CP0A 3TSZA 4C5GA 1X2QA 2BE9B 2NUPA 1D1CA 1FYNA 3GIBA 2CDTA 2XMFA 3EG2A 3NTHA 1IGQA 2RH2A 4Z89A 4C0GA 1M9SA 2JT4A 3VRYA 3OW2P 2DXBA 1M2VA 4ZN3A 4HXJA 3VJPA 2ZPIB 2DD4A 4CC7A 5CQXA 4MMLA 1D3BB 3EGXB 1UB4A 3S3MA 1K8AU 5GAN7 2QQSA 2F1LA 2CP7A 4ZGDB 3P8DA 1RACB 4R56A 3I56T 3QYGB 3CC2A 3TEEA 2PVGB 1G3TA 4LDUA 3JCMc 4E7IA 4M78G 4Y92A 1MMAA 2BTTA 4FSSA 1UUEA 2X3WD 4A4GA 1VQNA 1VQ4T 3JCMf 2X3XD 3CD6T 2EGCA 1V76A 4KUDK 2OTJA 3M0PA 3GNFB 5ECAA 3JCMW 2JZ2A 1X27A 5GAOq 3OS0A 1YITQ 1Y07A 4PKCC 1YCSB 1NLPC 4J5YA 1LJOA 4PJOE 2XG8D 4M78E 2LVMA 3L2RA 4PJOD 1VQ6Q 4M78D 1K9AA 2O88A 4FL6A 1GCQC 3OS1A 1KG1A 2YHTA 3ASKA 2J05A 3LW5E 2CZ6B 5AYFA 2VB6A 1E7OA 3JRZA 3LWIA 3OYCA 1B34B 4JJDA 5I11A 3MHXA 1YN8A 3CCUA 4AT1B 2KYMA 1VYVA 4N0AC 5CVIA 2QGFB 4LN2A 1JJ2A 3S3OA 1WJSA 2E10A 2OJ2A 3JCMP 5FWBA 4F7UE 3MP1A 4CC4B 2J6FA 3M0QA 4AMCA 2RHZA 4ZTJA 4EMHA 3UA6A 2K57A 2JUFA 1K73C 3QSUA 2COWA 2KSSA 1F1BB 3VKIA 2E5KA 2E3IA 2K3BA 1B3QA 1TXQA 3OW2S 2DXTA 3P8BB 4J7IA 4RCBA 5M9OA 3RUXA 3EH1A 1YJWQ 3CCMA 4MDXA 4C0DC 1M30A 2ED0A 3ZBDA 1MHNA 5L8RE 4RMOA 4BE1A 1PNJA 1ACMB 1KSWA 3PTAA 3RKWA 1H92A 4RTWA 2M1HA 1S72A 1E6GA 1TSFA 3LLRA 3META 2W0ZA 4XTXA 3FJPA 3OS5A 3G71Q 2ROTA 5FWCA 4A54A 3CCLT 4A53A 2YLBA 2KXCA 1UGRB 2LTOA 1OEBA 1D0ZA 2BUDA 1SSFA 3RESA 2BIVA 1OX9A 1ZSGA 3WXMB 1YJNT 4FCYA 1IXDA 1IGUA 3BW1A 3EFOB 4M75A 1LVKA 2EGAA 2NUTB 2GNCA 5FROA 4PNOA 1QP3A 3PGGA 1Q7YC 1GBQA 1E6HA 3A5ZB 4A4EA 2G6FX 1R0CB 4C0FA 1AWXA 1KD1C 2ATCB 2MK5A 4PFPA 4OF1A 3HTRA 3PMIA 4RTYA 2ZPEB 1W1FA 4KBMB 1K73R 4FYWB 4L6V5 4JZ3A 2HKNA 5IXBA 3A8GB 1UDLA 1WZOA 1PD1A 3E9GA 1O75A 3CCVQ 1VYTA 1YHQA 3CC7T 4HA8A 3DLLA 1UHCA 2R5AA 4M7AA 3JCMX 2CP5A 1FMVA 2FO0A 3CCJT 3OYJA 2HAXA 2C06A 2HCKA 1B7TA 1OOTA 2DK3A 3M5AA 2F2WA 2OTLQ 3CCET 4J6YA 1XQHA 4HKEA 2H8HA 3EG9B 1PKTA 3CMAA 4M77A 2EGEA 2JMCA 3VYGA 1C0MA 3EFSA 3HSBA 4F16A 3EFRA 3I5SA 1IZ6A 3RDVA 4ORZA 2W10A 2DYIA 1IHVA 5GAN2 2H3JA 5CKFA 4BI4A 1VQPA 3L2ZA 2RHYA 1OZ3A 1TS9A 4DBHA 4C92C 1K4US 2OAUA 2QTVA 1SSHA 5DY9A 4F17A 1PSEA 3NPFA 9ATCB 1Q7YR 1T0HA 4M7DC 1Y57A 3ULRB 4Y28E 2PTKA 4RG8A 1KD1R 2MWOA 1NG2A 3S6WA 3SWNC 1M3AA 1QKWA 1ZUUA 3SFMA 2RJFA 1MV3A 1LOJA 5KYUA 1XJWB 2QA4T 3QKJA 3VS3A 2IVWA 1R8OB 3OYDA 3A98A 5EG2A 3J80E 3O5ZA 4IUPA 4JDSA 2KRSA 1YJ9T 2EQJA 4LUEA 2FHDA 2QXFA 1BK2A 1EX4A 4M7DE 4PJNA 5IHNA 4AFSC 2MPXC 4JPBW 5FRNA 2EKOA 4BE2A 4JJBA 3JCMb 4PFOA 1W4SA 3OMGA 1N9SA 5GANg 3JAME 1VQ8T 2E3HA 1M1KU 1ZBXA 4C92F 2MAMA 1WYXA 4PJOA 4M78A 1Q86U 1Q81U 3JB9H 3EG1A 1VQOQ 3M55A 3QZ9B 4JS4A 1VQMA 5IHIA 3NMZC 3CC2Q 5HKCA 4C5EA 1YITA 3D7SB 1RAIB 1X69A 3V8LA 4D6WA 3MO8A 2X4WA 2HL5C 4O5VA 3A8LB 3MKDA 3SDZA 5KYWA 1VQ6A 1LCKA 2AHJB 2LQWA 2K3YA 2D8HA 2F2XA 4RG2A 4Z88A 4JRIA 1AWJA 5LJ5f 3BE3A 2DX1A 2RA2A 1X6BA 4RUGA 2JVVA 3KUFA 5A2QE 2DL4A 4C8QC 1ZSZB 2ZPBB 2GTOA 3BDLA 2RO0A 2LNHB 2RMOA 3BDUA 1WQ7A 3OBWA 4XQ3A 3OYLA 4RTZA 3VU3C 3QJ6A 5HCKA 1WJRA 3EGUA 4E7HA 1NLOC 2DTOA 4KGZB 4NS5A 1WGSA 1JEGA 2EQIA 1QMCA 1KHCA 5GAMj 3ZFJA 2E65A 2LP5A 1ZA1B 4F14A 3FRNA 1X6OA 1I81A 4C8QB 1PD0A 1RAAB 3EGDA 1SEMA 1RABB 1VQ9Q 2SRCA 1VQLT 1AEYA 2QQ9A 2QI2A 2HKQB 5CKDA 3G4ST 3M0UA 3CCSA 3NTIA 4L59A 2J6KA 2DZCA 1YJWA 4C8QF 1XTDA 2VWFA 2CH4A 3H8ZA 2OX7A 3OYFA 1Y96A 3Q1JA 3MEWA 3R6OA 2ESWA 3MCAB 4A4HA 3MPUB 1SF9A 5A0LA 3HL8A 3VS2A 2CH4W 4PL6A 2K79A 1TH7A 5GANe 2AKKA 3G71A 4DBFA 3OYAA 1VQKA 2O01E 1G3WA 5D6XA 4ATOA 1WNLA 4WF2A 1K0XA 1WDXA 2LRQA 5GJVB 3FDRA 3A8OB 4EPCA 3CCRQ 1U06A 3EG3A 2LCLA 4B9WA 4EIKA 2RPNA 1BCOA 2ZPFB 4DEYA 3X28B 2X4YA 2EBPA 3C0CA 1X75C 1G8XA 2XU8A 2R58A 3M9QA 4KULA 5IAYA 2DPPB 4FT4A 5LJ3f 4DOWA 2XIDA 3QWYA 4JJCA 1WA7A 2DA9A 3GNGA 2XDBA 1N8RR 4F04B 3M57A 3OYYA 3RR6A 4YTLA 3A8MB 3CCVA 1RAFB 2FEIA 2DL7A 4ZGEB 3HFOA 1M3CA 3QBYA 4OMLA 1FX7A 1VUBA 1T0JA 3RIRA 2HZYA 1TTHB 5KCOA 4M75E 1YNZA 1M90C 4M75D 3PVQA 2M9UA 1VQ4Q 1UE9A 4M7AC 4EMGA 2M02A 1XNIA 2JTMA 2LMJA 3E19A 2MOXA 2A7YA 2YRCA 3L2VA 3GP8A 5D7UA 3VV0A 2O2OA 4BDZA 4JUVA 5LJ5j 2CP3A 4CC3A 2J06A 4A63B 1U1TA 4M77C 3CMET 4M7AE 3CMAQ 2PU9B 3QWXX 2DKGA 2DTIA 3MEAA 3SD4A 1BI2A 1QQJA 3VUZA 4B6MA 1SKUB 1QCOA 1CKBA 4BY6B 3HRUA 1K76A 3JCMJ 2EYXA 3OSSC 1BI3A 1GFDA 3P8HA 3DB3A 1K73U 4D8DA 3OYKA 4BDYA 4C5IA 2R57A 5GAN5 2L3RA 1VYUA 3INZA 2QEXQ 1M90R 2R5MA 2IIMA 4X34A 4JRKA 1RLQC 1O9SA 2FRWA 3J81E 2B86A 4OB2B 3WVEB 4DOVA 1M8MA 1WHKA 2COYA 5KYNA 2EVRA 5FW9A 2XICA 3SEMA 1VQOA 4PJOC 4M78C 2LJ3A 2EFIA 1AT1B 5L23A 1KC8C 4FYVB 3AT1B 3VS6A 4BI8B 2QGGA 5HK3A 2CZ0B 2KGTA 1ZX6A 2RQUA 3QG1A 1VOMA 4J9EA 1VQMQ 2DEQA 3PIOA 2E5QA 2FZKB 4IUQA 2K2VA 2K5IA 2VV5A 3V8KA 3GLXA 1QKXA 2RJCA 1LNXA 1M5Q1 1BKBA 5LJ3j 2KT1A 3QDRB 2HBWA 1G2BA 4ZGJB 1PWTA 4OMPA 2C0OA 2OI3A 1Q7YU 3M56A 3V7RA 3CQTA 2P0KA 1KD1U 3ME9A 3I55T 4BACA 4NL2A 5J39A 1OPKA 1JU5C 2J7IA 4PJOF 4M78F 1KQ1A 3CBOA 2EYQA 5HK0A 2VASA 2QK0A 4E7SA 5FU7C 1WFWA 2RN8A 2GGRA 3CCJQ 2AK5A 3FJ5A 4FU6A 2JTFA 1VQ9A 2HSPA 5GAOl 1OX8A 2PZ1A 5AT1B 4F7UB 3L2QA 3VS0A 3CCEQ 1AOJA 2DEUA 1IHWA 4OB1B 2DYBA 1VIFA 4KH0B 2JS2A 4F7UF 1PC0A 1ABOA 1KC8R 2LCCA 4GY5A 3VUBA 3CCSQ 3QZ5B 1K9MC 3UA7A 2IPOB 2LJ1A 4KH1B 2GF7A 1D0XA 1WXBA 2EYWA 2D6FA 4BE0A 2XKOC 3M59A 3NGPA 3PNWC 3DLMA 3O8VA 3OYGA 2DNUA 1AZGB 3QHSA 2K4YA 2YT6A 1K0SA 1MMNA 2EJFA 3CCRA 1JJ2P 1VQKQ 3LX7A 1W6XA 2AZSA 3GF5A 2A3LA 1K1ZA 1DJ7B 2E6NA 1V29B 5GAN3 2E4HA 5KE2A 2DJQA 5CKEA 4FSXA 2RHUA 3M4YA 4C0DB 2EQKA 2V1RA 4HCZA 4ANJA 2KQWA 2CREA 2X4XA 4N4IA 1BI1A 2LZ6B 2HDAA 2DRKA 1YJ9Q 1NJIC 1LPLA 2HL3A 3R6NA 3H0HA 4OGEA 2VC8A 2V1QA 2O9VA 3DB4A 4IURA 4HVWA 2ENMA 1QLYA 2AKLA 3I56A 4Z02A 3HFNA 1VQ5T 2WSFE 3HP9A 2FG0A 2O4XB 4C0ZA 1VQ4A 3LGLA 3CD6A 2E1HA 4VUBA 4RKUE 5CKHA 1K9MR 5IXFA 4IIOA 5GAMf 4E7LA 3SB2A 5KYYA 2CS7A 3JB9G 1GL5A 3CBPA 2JJ9A 4J8OA 1ZBJA 1U8RA 2V8IA 5GAN4 1OV3A 4AG1C 2Y90A 4AFUC 4EMKC 2VYTA 4WCIA 5GMKj 4N4GA 3VS1A 5GMKi 2K5FA 2GTJA 2CSQA 2YLCA 3JB9D 3X26B 3E1SA 3M0RA 1YBYA 1G83A 4GBQA 2D8JA 2V26A 4IUUA 1G3YA 1AWOA 1JJ2S 5KYXB 1FMKA 5GAOp 2DM1A 3L42A 1NJIR 1TUDA 4OMMA 2VVKA 3M0TA 1JB0E 3UF4A 4E7KA 1N8RU 3QPHA 3AHUA 3UT1A 3U23A 2GCXA 2EWNA 2DXCA 4MMKA 1TWBA 3E9FA 2C0IA 3OYHA 1KQSA 1FXXA 1YWOA 3LYIA 4J6WA 2QTXA 3ER0A 4PLIA 1G5VA 1NYFA 2EJ9A 2QEXA 1SHGA 1IREB 1CSKA 1D3BA 2D9TA 1M8VA 3EGXA 1RLPC 3KXTA 4C92B 2Y4XA 2KDSA 4O6JA 2DVEA 1UHFA 2Y4YA 4M7DB 1N6AA 4RTUA 4JRQA 2P4TA 7AT1B 1SRMA 2EQMA 3SWNB 1UGPB 3CCLA 4J9BA 2ZCFB 5CIUA 1VQ7T 1EFNA 2LCSA 2GBQA 4M7DF 1KK7A 4Y91A 2ZPGB 2NUPB 2E6ZA 2L3QA 3JCMg 3RERA 2KMTA 3M53A 1YJNA 3VS7A 1UGSB 1PKSA 4PLLA 2L2PA 4QVZA 1JQQA 4RTXA 3V7SA 1M2VB 4HVUA 2X9HA 2KT8A 3M0SA 1KQSP 2BE7D 1B34A 1SHFA 2ABLA 2HD0A 2LDMA 1X01A 2WSEE 5D6WA 5LL6S 1I5LA 2QAZA 2CP6A 2MMPA 4ESRA 3TU4K 3CC7A 3DKMA 2BZ8A 1FMWA 3H41A 2OTLT 3CC4T 1ZUYA 2ECZA 3CCJA 2I0NA 2GFUA 1I07A 3RMQA 2RHIA 2DE0X 1M27C 2RJEA 2MWPA 2RJDA 1W2BA 1HSQA 2FPEA 3S3NA 4XTUA 2QG9B 1M90U 2HQXA 2CYZB 4C8QG 5I2SA 3G6ET 3CCEA 1YIJT 4RCCA 2JS0A 3T9NA 3L1AA 2RQTA 4N0AA 3CCQT 2RM4A 2FRYA 2KRMA 1UECA 2XI9A 3GOXA 2DZ9A 2DAQA 3URGA 3CMEQ 2KNBB 3ZL7C 2CT4A 2HBPA 2L3PA 2NUZA 2V8JA 4DEXA 2CP2A 2YRVA 3V8JA 1YI2T 1GBRA 1TUGB 4PFZA 4ZTFA 2P4RA 8AT1B 5FRMA 4DA4A 2HEQA 2DETA 4R55A 2KEAA 2LT1A 2DO3A 2MF2A 4OGCA 3QYHB 2PVOB 4DQ2A 2XD0A 1H3ZA 3UATA 3HHTB 3EFOA 1C1AA 1TU0B 1PG5B 2NUTA 4RTVA 2QA4A 3JCMe 1NBEB 2JM8A 2X35A 1KQSS 2B8AA 2FPFA 2LQNA 4LE9A 2DXUA 4AFQC 3OYEA 2AT1B 2DERA 2PUOB 3H0FA 3KBGA 1YJ9A 2IG0A 3JCMh 2CSIA 1VQOT 4LUDA 4M75C 5DM7R 1EIFA 2DIGA 3CC2T 5FU6C 1T3SA 1VQ8A 3V7CA 2JM9A 1ZA2B 1PRMC 2DBMA 2EYYA 2KE9A 3FC3A 3RMSA 1VQNT 2JMAA 4QQGA 1KFZA 1KIKA 4MZPA 2RQVA 4QW2A 2BZXA 2OTJT 2CGHA 2EKHA 3REBB 3I56Q 3HPWA 4XU0A 2QDYB 4XTYA 5GMKh 2MI6A 2EJGA 3CPWA 3LWHA 1KC8U 1ZQ1A 4M75B 2CZ7B 1NEBA 3NHNA 5GAMg 3CD6Q 2DILA 5CK9A 2M0YA 3GPLA 3EG9A 3M54A 4BI3A 4QVCA 3EHRA 2VUBA 1WLPB 3CXCA 1I8FA 1U1SA 3RBBB 4KGVB 4M75F 1J3TA 5GAOr 4LD9K 1OI1A 4CI0C 3CCUT 2KK4A 4PJLA 2RK2A 4K11A 3H0IA 3LH0A 2NYSA 1UGVA 2QDLA 1R0BG 5GMKm 1Q82C 3I55Q 4M7AB 2KXDA 5IH2A 3C94A 3C4SA 2DL3A 2QQBA 1Z9ZA 2ED1A 2X4JA 4M7AF 2M16A 3OW2A 4GLKA 1HD3A 2DRMA 4MDWA 2EW3A 2BKDN 4J9GA 4X1VA 3CPWP 1VQLA 2GQVA 4XU1A 5J26A 4M77B 3G4SA 1QWFA 3JCMd 4NL3A 1H8KA 3CCMT 2HNIA 3CXCP 3QXEB 3RNJA 1OPLA 2KROA 4M77F 1X6GA 3CEYA 2ZPHB 1S72T 1PSFA 3F70A 2JXBA 1B07A 2DMOA 1D0YA 1K9MU 2KI7A 1RUWA 1OULA 3L2WA 2YSQA 3RKYA 2LQ8A 1YP5A 4KGXB 1BBZA 1IO6A 2K6DA 3HRTA 3LH5A 4LDVA 4E6RA 2FZGB 5HY6A 5KYUB 4JS5A 4UC4A 3CCLQ 3FB9A 3UDCA 1MGQA 5I22A 3VRZA 1Q82R 5GAMe 5GANf 2EPDA 1YJNQ 1ZSZA 3PT9A 2XDDA 5LJ5g 1BYMA 4ELZC 5GAMh 1WJQA 4PJOG 1MNDA 3RKXA 2VXFA 1YHQT 3KFVA 4PJMA 4PJOB 2FPDA 1AZEA 4M78B 3PE0A 1BI0A 1NJIU 1ARKA 1QP2A 2D0QB 1T3LA 2XHCA 4FW2A 1VQ5Q 3OMCA 4LD6A 1WHGA 1PM3A 3CC7Q 3OQ5A 3JSCA 4B9XA 5I21A 3OYIA
chains in the Genus database with same CATH topology
3EG0A 1GL5A 2D0NA 1WXTA 2LNHB 2RMOA 4OMOA 2LX7A 4RTZA 5IHKA 1ZBJA 5HCKA 2RNAA 1MUZA 3EGUA 1OV3A 1UTIA 2BZYA 4AG1C 1NLOC 1BB9A 4AFUC 1WI7A 4WCIA 3VS1A 1JEGA 1ABQA 2EQIA 1I0CA 2CSQA 2GTJA 2DLPA 1ZUKA 1UJ0A 3M0RA 2LP5A 4F14A 1G83A 4GBQA 2D8JA 4J9DA 3PVLA 1AWOA 2YUOA 1SEMA 1AEYA 2SRCA 2OAWA 3VS4A 2O9SA 1FMKA 2DM1A 2L0AA 3M0UA 1TUDA 2J6KA 1RI9A 4OMMA 2VVKA 3M0TA 1UG1A 2VWFA 3UF4A 2CH4A 2A36A 2JW4A 3U23A 3TVTA 1X43A 2ESWA 4M4ZA 2RQRA 2C0IA 1YWOA 2YUNA 3VS2A 2CH4W 1NYFA 1SHGA 2K79A 1CSKA 1NEGA 2AKKA 4R0KA 1RLPC 2KYBA 3TSZA 1X2QA 1M3BA 1U5SA 1FYNA 2CDTA 2XMFA 1UHFA 3EG2A 1K0XA 1WDXA 5GJVB 4OMQA 4RTUA 1PHTA 1UJYA 4Z89A 1U06A 1WXUA 2JT4A 3EG3A 3VRYA 1JXMA 1SRMA 4EIKA 2RPNA 4DEYA 4HXJA 4CC7A 4J9BA 2EBPA 1EFNA 2LCSA 3C0CA 2GBQA 2CUDA 1X2KA 3QWYA 2L3QA 4JJCA 1WA7A 2RF0A 3VS7A 1PKSA 1N5ZA 2DA9A 2L2PA 4Y92A 1JQQA 2BTTA 2VKNA 4FSSA 1UUEA 4RTXA 2X3WD 4HVUA 1YWPA 2GQIA 2X3XD 2FEIA 2L3SA 2KT8A 3M0SA 2EGCA 2DL7A 3M0PA 5ECAA 1X27A 1M3CA 1SHFA 2ABLA 4OMLA 1T0JA 1YNZA 1YCSB 1NLPC 3PVQA 4ESRA 2K2MA 1UE9A 1K9AA 2O88A 1GCQC 4OMNA 1XOVA 2AZVA 3I35A 2J05A 2A08A 2ROLA 2BZ8A 2LMJA 2MOXA 2DBKA 3H41A 1E7OA 1ZUYA 2CUBA 2O2OA 2ECZA 1U3OA 2I0NA 4JJDA 5I11A 1I07A 2DE0X 1M27C 1YN8A 4RTTA 1HSQA 2DL5A 2FPEA 4CC3A 2J06A 5EC7A 4A63B 3I5RA 2KYMA 1VYVA 4LN2A 2JS0A 1TUCA 1H3HA 2LJ0A 2OJ2A 5FWBA 4ZNXA 2RQTA 3REAB 3QWXX 2FRYA 2KRMA 4CC4B 1UECA 1V1CA 2J6FA 1AWWA 3M0QA 3UA6A 1GCPA 2C0TA 2KNBB 3ZL7C 2E5KA 2CT4A 2CT3A 2K7AA 3TSWA 1AVZC 2L3PA 3IQLA 4Z8AA 2K3BA 2NUZA 1B3QA 1CKBA 4AG2C 4DEXA 1GBRA 1K76A 2EYXA 2EYZA 2P4RA 2HEQA 4LNPA 1M30A 3THKA 2ED0A 1GFDA 2KEAA 1PNJA 4D8DA 1NM7A 1JXOA 1KSWA 1H92A 4RTWA 1AD5A 3UATA 1E6GA 1ZLMA 2O31A 1VYUA 1UFFA 4RTVA 2W0ZA 2JM8A 2IIMA 1RLQC 2ROTA 2FRWA 5FWCA 2FPFA 2LQNA 4LE9A 4J9HA 4AFQC 2B86A 2KXCA 3H0FA 2J6OA 2MCNA 1M8MA 1QWEA 2EVRA 5FW9A 1OEBA 2CSIA 3SEMA 4LUDA 2SEMA 1W70A 3I9QA 2LJ3A 1ZSGA 4QT7A 4CC2A 1T3SA 5L23A 2EGAA 2JM9A 2DL8A 2GNCA 1PRMC 2DBMA 2EYYA 2KE9A 3VS6A 2KGTA 1ZX6A 2RQUA 2JMAA 1KFZA 1KIKA 1GBQA 1E6HA 4J9CA 4J9EA 2G6FX 2RQVA 1AWXA 1S1NA 2BZXA 2EKHA 3REBB 1QKXA 2M51A 4J9IA 4RTYA 1GRIA 1W1FA 3EHQA 4JZ3A 5IXBA 2KT1A 1UDLA 2HBWA 1VYTA 1G2BA 2PNIA 1NEBA 3NHNA 2DILA 1PWTA 2M0YA 4OMPA 1QCFA 2C0OA 2OI3A 4D8KA 3EHRA 1UHCA 1WLPB 1GCQA 3CQTA 3RBBB 2FO0A 2KRNA 2YDLA 1OPKA 1JU5C 1J3TA 2J7IA 1GFCA 2HCKA 2YUPA 4GLMA 4J9FA 1OOTA 4K11A 2F2WA 1TG0A 3H0IA 1UGVA 2QDLA 1WFWA 2RN8A 2YUQA 2H8HA 1PKTA 2GGRA 2EGEA 2JMCA 2KXDA 5IH2A 2AK5A 1CKAA 1PRLC 3FJ5A 2DL3A 2F2VA 2HSPA 2PZ1A 4F16A 3JV3A 1WX6A 1BU1A 3I5SA 1Z9ZA 2ED1A 4ORZA 2W10A 3VS0A 1AOJA 4HVVA 2DYBA 1HD3A 2DRMA 2JS2A 1HJDA 2EW3A 1K4US 1ABOA 4J9GA 4X1VA 2KR3A 1SSHA 1A0NB 2KBTA 3UA7A 1QWFA 4F17A 1SPKA 3NPFA 2LJ1A 1WXBA 2EYWA 1H8KA 1T0HA 1Y57A 3ULRB 3GBQA 2A28A 2PTKA 3RNJA 2MIOA 3NGPA 1NG2A 1OPLA 2KROA 1M3AA 1QKWA 1ZUUA 2A37A 1X6GA 4AFZC 2DNUA 1AZGB 1MV3A 2D1XA 2JXBA 4IIMA 2DF6A 1B07A 2YT6A 2DMOA 1K0SA 3VS3A 3A98A 3O5ZA 1JO8A 1W6XA 2AZSA 2KRSA 1K1ZA 1RUWA 2YSQA 1SRLA 4LUEA 1WIEA 1BK2A 1YP5A 2NWMA 5IHNA 4AFSC 1BBZA 2DJQA 4JPBW 4JJBA 3VS5A 1IO6A 2K6DA 3SHWA 3LH5A 2V1RA 4E6RA 1WYXA 2CREA 2LZ6B 1Z9QA 4HCKA 2HDAA 2DRKA 3R6NA 3H0HA 2JTEA 2K9GA 5I22A 3EG1A 2RQWA 2O9VA 2V1QA 1VA7A 3VRZA 4HVWA 1NYGA 2EPDA 1KJWA 5IHIA 3NMZC 2ENMA 1QLYA 2AKLA 1X69A 2FG0A 5GJWB 3KFVA 1MV0B 1AZEA 2FPDA 1I1JA 3PE0A 1LCKA 2LQWA 1ARKA 2D8HA 2F2XA 4JZ4A 4Z88A 2DVJA 1AWJA 1T3LA 2DX1A 4RUGA 1X6BA 4IIOA 5IXFA 1Y0MA 2DL4A 4KRTA 2GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG0 A;  1GL5 A;  2D0N A;  1WXT A;  2LNH B;  2RMO A;  4OMO A;  2LX7 A;  4RTZ A;  5IHK A;  1ZBJ A;  5HCK A;  2RNA A;  1MUZ A;  3EGU A;  1OV3 A;  1UTI A;  2BZY A;  4AG1 C;  1NLO C;  1BB9 A;  4AFU C;  1WI7 A;  4WCI A;  3VS1 A;  1JEG A;  1ABQ A;  2EQI A;  1I0C A;  2CSQ A;  2GTJ A;  2DLP A;  1ZUK A;  1UJ0 A;  3M0R A;  2LP5 A;  4F14 A;  1G83 A;  4GBQ A;  2D8J A;  4J9D A;  3PVL A;  1AWO A;  2YUO A;  1SEM A;  1AEY A;  2SRC A;  2OAW A;  3VS4 A;  2O9S A;  1FMK A;  2DM1 A;  2L0A A;  3M0U A;  1TUD A;  2J6K A;  1RI9 A;  4OMM A;  2VVK A;  3M0T A;  1UG1 A;  2VWF A;  3UF4 A;  2CH4 A;  2A36 A;  2JW4 A;  3U23 A;  3TVT A;  1X43 A;  2ESW A;  4M4Z A;  2RQR A;  2C0I A;  1YWO A;  2YUN A;  3VS2 A;  2CH4 W;  1NYF A;  1SHG A;  2K79 A;  1CSK A;  1NEG A;  2AKK A;  4R0K A;  1RLP C;  2KYB A;  3TSZ A;  1X2Q A;  1M3B A;  1U5S A;  1FYN A;  2CDT A;  2XMF A;  1UHF A;  3EG2 A;  1K0X A;  1WDX A;  5GJV B;  4OMQ A;  4RTU A;  1PHT A;  1UJY A;  4Z89 A;  1U06 A;  1WXU A;  2JT4 A;  3EG3 A;  3VRY A;  1JXM A;  1SRM A;  4EIK A;  2RPN A;  4DEY A;  4HXJ A;  4CC7 A;  4J9B A;  2EBP A;  1EFN A;  2LCS A;  3C0C A;  2GBQ A;  2CUD A;  1X2K A;  3QWY A;  2L3Q A;  4JJC A;  1WA7 A;  2RF0 A;  3VS7 A;  1PKS A;  1N5Z A;  2DA9 A;  2L2P A;  4Y92 A;  1JQQ A;  2BTT A;  2VKN A;  4FSS A;  1UUE A;  4RTX A;  2X3W D;  4HVU A;  1YWP A;  2GQI A;  2X3X D;  2FEI A;  2L3S A;  2KT8 A;  3M0S A;  2EGC A;  2DL7 A;  3M0P A;  5ECA A;  1X27 A;  1M3C A;  1SHF A;  2ABL A;  4OML A;  1T0J A;  1YNZ A;  1YCS B;  1NLP C;  3PVQ A;  4ESR A;  2K2M A;  1UE9 A;  1K9A A;  2O88 A;  1GCQ C;  4OMN A;  1XOV A;  2AZV A;  3I35 A;  2J05 A;  2A08 A;  2ROL A;  2BZ8 A;  2LMJ A;  2MOX A;  2DBK A;  3H41 A;  1E7O A;  1ZUY A;  2CUB A;  2O2O A;  2ECZ A;  1U3O A;  2I0N A;  4JJD A;  5I11 A;  1I07 A;  2DE0 X;  1M27 C;  1YN8 A;  4RTT A;  1HSQ A;  2DL5 A;  2FPE A;  4CC3 A;  2J06 A;  5EC7 A;  4A63 B;  3I5R A;  2KYM A;  1VYV A;  4LN2 A;  2JS0 A;  1TUC A;  1H3H A;  2LJ0 A;  2OJ2 A;  5FWB A;  4ZNX A;  2RQT A;  3REA B;  3QWX X;  2FRY A;  2KRM A;  4CC4 B;  1UEC A;  1V1C A;  2J6F A;  1AWW A;  3M0Q A;  3UA6 A;  1GCP A;  2C0T A;  2KNB B;  3ZL7 C;  2E5K A;  2CT4 A;  2CT3 A;  2K7A A;  3TSW A;  1AVZ C;  2L3P A;  3IQL A;  4Z8A A;  2K3B A;  2NUZ A;  1B3Q A;  1CKB A;  4AG2 C;  4DEX A;  1GBR A;  1K76 A;  2EYX A;  2EYZ A;  2P4R A;  2HEQ A;  4LNP A;  1M30 A;  3THK A;  2ED0 A;  1GFD A;  2KEA A;  1PNJ A;  4D8D A;  1NM7 A;  1JXO A;  1KSW A;  1H92 A;  4RTW A;  1AD5 A;  3UAT A;  1E6G A;  1ZLM A;  2O31 A;  1VYU A;  1UFF A;  4RTV A;  2W0Z A;  2JM8 A;  2IIM A;  1RLQ C;  2ROT A;  2FRW A;  5FWC A;  2FPF A;  2LQN A;  4LE9 A;  4J9H A;  4AFQ C;  2B86 A;  2KXC A;  3H0F A;  2J6O A;  2MCN A;  1M8M A;  1QWE A;  2EVR A;  5FW9 A;  1OEB A;  2CSI A;  3SEM A;  4LUD A;  2SEM A;  1W70 A;  3I9Q A;  2LJ3 A;  1ZSG A;  4QT7 A;  4CC2 A;  1T3S A;  5L23 A;  2EGA A;  2JM9 A;  2DL8 A;  2GNC A;  1PRM C;  2DBM A;  2EYY A;  2KE9 A;  3VS6 A;  2KGT A;  1ZX6 A;  2RQU A;  2JMA A;  1KFZ A;  1KIK A;  1GBQ A;  1E6H A;  4J9C A;  4J9E A;  2G6F X;  2RQV A;  1AWX A;  1S1N A;  2BZX A;  2EKH A;  3REB B;  1QKX A;  2M51 A;  4J9I A;  4RTY A;  1GRI A;  1W1F A;  3EHQ A;  4JZ3 A;  5IXB A;  2KT1 A;  1UDL A;  2HBW A;  1VYT A;  1G2B A;  2PNI A;  1NEB A;  3NHN A;  2DIL A;  1PWT A;  2M0Y A;  4OMP A;  1QCF A;  2C0O A;  2OI3 A;  4D8K A;  3EHR A;  1UHC A;  1WLP B;  1GCQ A;  3CQT A;  3RBB B;  2FO0 A;  2KRN A;  2YDL A;  1OPK A;  1JU5 C;  1J3T A;  2J7I A;  1GFC A;  2HCK A;  2YUP A;  4GLM A;  4J9F A;  1OOT A;  4K11 A;  2F2W A;  1TG0 A;  3H0I A;  1UGV A;  2QDL A;  1WFW A;  2RN8 A;  2YUQ A;  2H8H A;  1PKT A;  2GGR A;  2EGE A;  2JMC A;  2KXD A;  5IH2 A;  2AK5 A;  1CKA A;  1PRL C;  3FJ5 A;  2DL3 A;  2F2V A;  2HSP A;  2PZ1 A;  4F16 A;  3JV3 A;  1WX6 A;  1BU1 A;  3I5S A;  1Z9Z A;  2ED1 A;  4ORZ A;  2W10 A;  3VS0 A;  1AOJ A;  4HVV A;  2DYB A;  1HD3 A;  2DRM A;  2JS2 A;  1HJD A;  2EW3 A;  1K4U S;  1ABO A;  4J9G A;  4X1V A;  2KR3 A;  1SSH A;  1A0N B;  2KBT A;  3UA7 A;  1QWF A;  4F17 A;  1SPK A;  3NPF A;  2LJ1 A;  1WXB A;  2EYW A;  1H8K A;  1T0H A;  1Y57 A;  3ULR B;  3GBQ A;  2A28 A;  2PTK A;  3RNJ A;  2MIO A;  3NGP A;  1NG2 A;  1OPL A;  2KRO A;  1M3A A;  1QKW A;  1ZUU A;  2A37 A;  1X6G A;  4AFZ C;  2DNU A;  1AZG B;  1MV3 A;  2D1X A;  2JXB A;  4IIM A;  2DF6 A;  1B07 A;  2YT6 A;  2DMO A;  1K0S A;  3VS3 A;  3A98 A;  3O5Z A;  1JO8 A;  1W6X A;  2AZS A;  2KRS A;  1K1Z A;  1RUW A;  2YSQ A;  1SRL A;  4LUE A;  1WIE A;  1BK2 A;  1YP5 A;  2NWM A;  5IHN A;  4AFS C;  1BBZ A;  2DJQ A;  4JPB W;  4JJB A;  3VS5 A;  1IO6 A;  2K6D A;  3SHW A;  3LH5 A;  2V1R A;  4E6R A;  1WYX A;  2CRE A;  2LZ6 B;  1Z9Q A;  4HCK A;  2HDA A;  2DRK A;  3R6N A;  3H0H A;  2JTE A;  2K9G A;  5I22 A;  3EG1 A;  2RQW A;  2O9V A;  2V1Q A;  1VA7 A;  3VRZ A;  4HVW A;  1NYG A;  2EPD A;  1KJW A;  5IHI A;  3NMZ C;  2ENM A;  1QLY A;  2AKL A;  1X69 A;  2FG0 A;  5GJW B;  3KFV A;  1MV0 B;  1AZE A;  2FPD A;  1I1J A;  3PE0 A;  1LCK A;  2LQW A;  1ARK A;  2D8H A;  2F2X A;  4JZ4 A;  4Z88 A;  2DVJ A;  1AWJ A;  1T3L A;  2DX1 A;  4RUG A;  1X6B A;  4IIO A;  5IXF A;  1Y0M A;  2DL4 A;  4KRT A;  2GTO A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  4OB0 B;  1WXT A;  3CPW S;  4C8Q A;  5KYW B;  5IHK A;  3HKS A;  3H9N A;  4DBQ A;  3CMA T;  3CXC S;  4F7U G;  2BZY A;  1I0C A;  4X9D A;  1ZUK A;  3CBM A;  3CME A;  1OU9 A;  3PFS A;  1VQP T;  1HXD A;  5IN1 A;  3TCJ A;  5GAO n;  1WPY A;  2COZ A;  4FYX B;  2EIF A;  2F5T X;  3VS4 A;  2O9S A;  5FU7 B;  4JJN K;  1BCM A;  2F69 A;  2QQR A;  1RI9 A;  3WVD B;  1R77 A;  4J83 A;  1OZ2 A;  2P0Q A;  1TOV A;  2EQU A;  2JW4 A;  3TVT A;  4WTO B;  1X43 A;  3ZEH A;  4FIB A;  1N9R A;  4M4Z A;  4HT9 A;  1QW1 A;  2RQR A;  3N5B B;  3MEV A;  1YFN A;  3EGD B;  1D1B A;  3EH2 A;  2YUN A;  2WAC A;  4XK8 E;  2QEX T;  2PUK B;  4R0K A;  1OYX A;  4FYY B;  1K8A C;  1C6V X;  2KYB A;  1QVG A;  4PJJ A;  2K3X A;  5GAM d;  3FIF A;  1M3B A;  1U5S A;  3NFC A;  4XTV A;  1IB8 A;  4LDY A;  2QA4 Q;  2ZGW A;  1WHM A;  1Y96 B;  4OMQ A;  4A4F A;  1PHT A;  1UJY A;  5LJ3 g;  1WXU A;  2LX9 A;  5C0M A;  5KCH A;  1JXM A;  2KVQ G;  2V8K A;  2FZC B;  5A0G A;  5LJ5 e;  3FEO A;  2CUD A;  1X2K A;  5KE3 A;  1VQM T;  1WHH A;  2E41 A;  5I2M A;  2DIQ A;  5LJ5 h;  1VQ8 Q;  1AHJ B;  2RF0 A;  1VIE A;  2HMA A;  3X25 B;  4OVA A;  1YIT T;  1N5Z A;  1VQ7 Q;  3G1J A;  5IT9 E;  2VKN A;  1VQ6 T;  3BY7 A;  1YWP A;  2GQI A;  2L3S A;  1OU8 A;  1GXI E;  3UWN A;  5GAN j;  4QQ6 A;  1UEB A;  4XAX B;  1NPR A;  1QVG P;  2AIR B;  2K2M A;  2DJZ A;  4OMN A;  1XOV A;  3LGF A;  2AZV A;  2LQK A;  3I35 A;  2A08 A;  2FYK A;  4LDX A;  2ROL A;  2XK0 A;  2DFU A;  2P84 A;  2DBK A;  1I4K 1;  3PIP A;  2RB6 A;  1JRI A;  2CUB A;  2KY9 A;  3I55 A;  1U3O A;  2RI3 A;  4RTT A;  5CQY A;  2DL5 A;  2FB7 A;  2K5L A;  1K8A R;  1BIB A;  1HK9 A;  2DD5 A;  5EC7 A;  3I5R A;  1MNE A;  3CC4 Q;  1TUC A;  2E12 A;  4IUV A;  2LJ0 A;  1H3H A;  3TRE A;  4ZNX A;  3NTK A;  3REA B;  2ZZD A;  4XU2 A;  1V1C A;  1AWW A;  3CCS T;  3QJY A;  3TQ7 P;  3JB9 F;  4C5H A;  1BIA A;  1GCP A;  5DLO A;  2C0T A;  1YJW T;  3G6E Q;  4ME7 A;  3OY9 A;  1YIJ Q;  2CT3 A;  2K7A A;  3TSW A;  1AVZ C;  3IQL A;  4Z8A A;  2ZAE A;  4AG2 C;  3CCQ Q;  4XTZ A;  4EMK B;  4QKU A;  1VQL Q;  2WSC E;  2EYZ A;  3G4S Q;  4MZM A;  8ATC B;  2PQW A;  4LNP A;  3QII A;  4C92 G;  2YXY A;  3THK A;  5LJ3 e;  3G71 T;  5LJ5 d;  1VQK T;  2E70 A;  1UGQ B;  4XU3 A;  4IKF A;  1NM7 A;  1JXO A;  1YI2 Q;  3MEU A;  1WHL A;  2P0P A;  4M7D G;  4IUT A;  3OB9 A;  4KUI A;  1P92 A;  3PMT A;  3QDF A;  1AD5 A;  5LJ3 h;  1ZLM A;  2O31 A;  5GMK l;  1UFF A;  1Q95 G;  2HQE A;  1IRX A;  3MP6 A;  3JCM V;  4C92 E;  2RI5 A;  4E7Z A;  4J9H A;  2EAY A;  4C92 D;  4LXC A;  2JOY A;  2J6O A;  2MCN A;  1QWE A;  2QQA A;  1QCN A;  4M7D D;  2F5K A;  1QVG S;  2SEM A;  1W70 A;  3I9Q A;  3A8H B;  2YWW A;  4QT7 A;  4TVR A;  2A0F B;  4CC2 A;  1ZHI A;  3EAE A;  2DL8 A;  4QQD A;  5C6S A;  2QYZ A;  4L5G A;  3CCV T;  4J9C A;  5CKB A;  1ZSZ C;  3OS2 A;  1S1N A;  3M4G A;  2M51 A;  4J9I A;  5GAO m;  3JCM Q;  1GRI A;  3G7Z A;  3EHQ A;  2PVD B;  1VQ5 A;  1RL2 A;  1VQN Q;  4QVD A;  2PNI A;  2GFA A;  4JRP A;  2L5Q A;  2FVU A;  1M1F A;  2OTJ Q;  3J7A F;  1QCF A;  4OP0 A;  4D8K A;  5DLQ E;  1GCQ A;  1KHI A;  4FT2 A;  3OA6 A;  1QVF A;  2FL7 A;  2KRN A;  2YDL A;  4F7U A;  1KQ2 A;  2LC4 A;  1GFC A;  1M4Z A;  2YUP A;  3A1P A;  4JLG A;  1WHJ A;  4GLM A;  4J9F A;  1I5O B;  4OMF B;  1TG0 A;  4CRI A;  2E64 A;  4X9C A;  2YUQ A;  4HCC A;  3E2U A;  4E2F B;  3C95 A;  1CKA A;  1PRL C;  3CCU Q;  4PK4 A;  2RD1 A;  2F2V A;  3JV3 A;  1WX6 A;  1BU1 A;  1N8R C;  5LJ3 d;  3X24 B;  4HVV A;  1RAD B;  4C8Q E;  5CO7 A;  1YCY A;  4C8Q D;  2NLU A;  1MMD A;  5CR2 A;  1OQK A;  3OSV A;  1HJD A;  2KR3 A;  2CKK A;  1Q82 U;  5D6Y A;  1A0N B;  2KBT A;  1SPK A;  5A0D A;  1D09 B;  1M2O A;  2I2L A;  2JNG A;  3OYB A;  4JLI A;  3L2U A;  1FWZ A;  3GBQ A;  2A28 A;  2MIO A;  1QVF P;  4OB3 B;  4LDW A;  4V2S A;  2A37 A;  4AFZ C;  1W2B P;  4HCB A;  2D1X A;  4IIM A;  1M1K C;  2VXE A;  2DF6 A;  4BB7 A;  3JB9 I;  3JB9 J;  1Q86 C;  3CCM Q;  1Q81 C;  3QUI A;  2G3R A;  3OYM A;  3OBY A;  4Q5W A;  1NZ9 A;  1JO8 A;  5FLX E;  1SRL A;  1WIE A;  2X51 A;  4XTW A;  2NWM A;  1S72 Q;  2KAF A;  4ZN1 A;  1NE8 A;  3VS5 A;  5GAN h;  3SHW A;  3VYH B;  4HT8 A;  2JN0 A;  4J6X A;  2O4X A;  1Z9Q A;  4HCK A;  4A4K A;  2RHX A;  1VQ7 A;  1EZZ B;  5GMK e;  2JTE A;  2K9G A;  4BD3 A;  2RQW A;  1VA7 A;  2YRD A;  1NYG A;  1NPP A;  4P5N A;  1KJW A;  3M58 A;  5CAI A;  2L8D A;  1HYO A;  2DTH A;  1Y71 A;  4EDU A;  4M75 G;  3OYN A;  1Y7X A;  5GJW B;  1MV0 B;  3BFM A;  4FM4 B;  4FW1 A;  1I1J A;  1G3S A;  1RAH B;  2L89 A;  1M1G A;  5KH6 A;  5FU6 B;  4JZ4 A;  2DVJ A;  2VGN A;  3X20 B;  1RAG B;  4MZT A;  2VGM A;  4DBR A;  1Y0M A;  4KRT A;  4BUG A;  2HSE B;  1YHQ Q;  1QVP A;  4ELY C;  5GAN 6;  2D0N A;  4E7J A;  4OMO A;  6AT1 B;  2LX7 A;  4M7A G;  1M1K R;  4N4H A;  1RAE B;  2HQH A;  5KYX A;  2OTL A;  3CC4 A;  2RNA A;  2M0O A;  1MUZ A;  1Q86 R;  1Q81 R;  2MYS A;  1UTI A;  3MP8 A;  1WQW A;  5J3B A;  1BB9 A;  2QAS A;  1VQ9 T;  1QVF S;  4BY6 C;  1WI7 A;  1ABQ A;  1SG5 A;  1JBM A;  3UPU A;  2DLP A;  4E47 A;  1W2B S;  5KYY B;  1UJ0 A;  4EMK A;  2H3E B;  3G6E A;  1YIJ A;  4J9D A;  1MMG A;  3PVL A;  4M7A D;  2YUO A;  3QO3 A;  4M77 G;  3CCQ A;  5CCA A;  1N27 A;  3CPF A;  2OAW A;  2RI2 A;  2LNV A;  2L0A A;  2RK1 A;  4II1 A;  3H6Z A;  3C12 A;  3HRS A;  5GAN 8;  1H64 1;  2XDP A;  4C92 A;  5GAN d;  1UG1 A;  2LT4 A;  1D1A A;  3FLG A;  1VQP Q;  2A36 A;  1RI0 A;  4M7D A;  4NOY A;  1PCX A;  1YI2 A;  4M77 E;  4M77 D;  4J7F A;  4KT0 E;  3SWN A;  3MJX A;  2Z0W A;  3CCR T;  1NEG A;  2CZ1 B;  2CP0 A;  3TSZ A;  4C5G A;  1X2Q A;  2BE9 B;  2NUP A;  1D1C A;  1FYN A;  3GIB A;  2CDT A;  2XMF A;  3EG2 A;  3NTH A;  1IGQ A;  2RH2 A;  4Z89 A;  4C0G A;  1M9S A;  2JT4 A;  3VRY A;  3OW2 P;  2DXB A;  1M2V A;  4ZN3 A;  4HXJ A;  3VJP A;  2ZPI B;  2DD4 A;  4CC7 A;  5CQX A;  4MML A;  1D3B B;  3EGX B;  1UB4 A;  3S3M A;  1K8A U;  5GAN 7;  2QQS A;  2F1L A;  2CP7 A;  4ZGD B;  3P8D A;  1RAC B;  4R56 A;  3I56 T;  3QYG B;  3CC2 A;  3TEE A;  2PVG B;  1G3T A;  4LDU A;  3JCM c;  4E7I A;  4M78 G;  4Y92 A;  1MMA A;  2BTT A;  4FSS A;  1UUE A;  2X3W D;  4A4G A;  1VQN A;  1VQ4 T;  3JCM f;  2X3X D;  3CD6 T;  2EGC A;  1V76 A;  4KUD K;  2OTJ A;  3M0P A;  3GNF B;  5ECA A;  3JCM W;  2JZ2 A;  1X27 A;  5GAO q;  3OS0 A;  1YIT Q;  1Y07 A;  4PKC C;  1YCS B;  1NLP C;  4J5Y A;  1LJO A;  4PJO E;  2XG8 D;  4M78 E;  2LVM A;  3L2R A;  4PJO D;  1VQ6 Q;  4M78 D;  1K9A A;  2O88 A;  4FL6 A;  1GCQ C;  3OS1 A;  1KG1 A;  2YHT A;  3ASK A;  2J05 A;  3LW5 E;  2CZ6 B;  5AYF A;  2VB6 A;  1E7O A;  3JRZ A;  3LWI A;  3OYC A;  1B34 B;  4JJD A;  5I11 A;  3MHX A;  1YN8 A;  3CCU A;  4AT1 B;  2KYM A;  1VYV A;  4N0A C;  5CVI A;  2QGF B;  4LN2 A;  1JJ2 A;  3S3O A;  1WJS A;  2E10 A;  2OJ2 A;  3JCM P;  5FWB A;  4F7U E;  3MP1 A;  4CC4 B;  2J6F A;  3M0Q A;  4AMC A;  2RHZ A;  4ZTJ A;  4EMH A;  3UA6 A;  2K57 A;  2JUF A;  1K73 C;  3QSU A;  2COW A;  2KSS A;  1F1B B;  3VKI A;  2E5K A;  2E3I A;  2K3B A;  1B3Q A;  1TXQ A;  3OW2 S;  2DXT A;  3P8B B;  4J7I A;  4RCB A;  5M9O A;  3RUX A;  3EH1 A;  1YJW Q;  3CCM A;  4MDX A;  4C0D C;  1M30 A;  2ED0 A;  3ZBD A;  1MHN A;  5L8R E;  4RMO A;  4BE1 A;  1PNJ A;  1ACM B;  1KSW A;  3PTA A;  3RKW A;  1H92 A;  4RTW A;  2M1H A;  1S72 A;  1E6G A;  1TSF A;  3LLR A;  3MET A;  2W0Z A;  4XTX A;  3FJP A;  3OS5 A;  3G71 Q;  2ROT A;  5FWC A;  4A54 A;  3CCL T;  4A53 A;  2YLB A;  2KXC A;  1UGR B;  2LTO A;  1OEB A;  1D0Z A;  2BUD A;  1SSF A;  3RES A;  2BIV A;  1OX9 A;  1ZSG A;  3WXM B;  1YJN T;  4FCY A;  1IXD A;  1IGU A;  3BW1 A;  3EFO B;  4M75 A;  1LVK A;  2EGA A;  2NUT B;  2GNC A;  5FRO A;  4PNO A;  1QP3 A;  3PGG A;  1Q7Y C;  1GBQ A;  1E6H A;  3A5Z B;  4A4E A;  2G6F X;  1R0C B;  4C0F A;  1AWX A;  1KD1 C;  2ATC B;  2MK5 A;  4PFP A;  4OF1 A;  3HTR A;  3PMI A;  4RTY A;  2ZPE B;  1W1F A;  4KBM B;  1K73 R;  4FYW B;  4L6V 5;  4JZ3 A;  2HKN A;  5IXB A;  3A8G B;  1UDL A;  1WZO A;  1PD1 A;  3E9G A;  1O75 A;  3CCV Q;  1VYT A;  1YHQ A;  3CC7 T;  4HA8 A;  3DLL A;  1UHC A;  2R5A A;  4M7A A;  3JCM X;  2CP5 A;  1FMV A;  2FO0 A;  3CCJ T;  3OYJ A;  2HAX A;  2C06 A;  2HCK A;  1B7T A;  1OOT A;  2DK3 A;  3M5A A;  2F2W A;  2OTL Q;  3CCE T;  4J6Y A;  1XQH A;  4HKE A;  2H8H A;  3EG9 B;  1PKT A;  3CMA A;  4M77 A;  2EGE A;  2JMC A;  3VYG A;  1C0M A;  3EFS A;  3HSB A;  4F16 A;  3EFR A;  3I5S A;  1IZ6 A;  3RDV A;  4ORZ A;  2W10 A;  2DYI A;  1IHV A;  5GAN 2;  2H3J A;  5CKF A;  4BI4 A;  1VQP A;  3L2Z A;  2RHY A;  1OZ3 A;  1TS9 A;  4DBH A;  4C92 C;  1K4U S;  2OAU A;  2QTV A;  1SSH A;  5DY9 A;  4F17 A;  1PSE A;  3NPF A;  9ATC B;  1Q7Y R;  1T0H A;  4M7D C;  1Y57 A;  3ULR B;  4Y28 E;  2PTK A;  4RG8 A;  1KD1 R;  2MWO A;  1NG2 A;  3S6W A;  3SWN C;  1M3A A;  1QKW A;  1ZUU A;  3SFM A;  2RJF A;  1MV3 A;  1LOJ A;  5KYU A;  1XJW B;  2QA4 T;  3QKJ A;  3VS3 A;  2IVW A;  1R8O B;  3OYD A;  3A98 A;  5EG2 A;  3J80 E;  3O5Z A;  4IUP A;  4JDS A;  2KRS A;  1YJ9 T;  2EQJ A;  4LUE A;  2FHD A;  2QXF A;  1BK2 A;  1EX4 A;  4M7D E;  4PJN A;  5IHN A;  4AFS C;  2MPX C;  4JPB W;  5FRN A;  2EKO A;  4BE2 A;  4JJB A;  3JCM b;  4PFO A;  1W4S A;  3OMG A;  1N9S A;  5GAN g;  3JAM E;  1VQ8 T;  2E3H A;  1M1K U;  1ZBX A;  4C92 F;  2MAM A;  1WYX A;  4PJO A;  4M78 A;  1Q86 U;  1Q81 U;  3JB9 H;  3EG1 A;  1VQO Q;  3M55 A;  3QZ9 B;  4JS4 A;  1VQM A;  5IHI A;  3NMZ C;  3CC2 Q;  5HKC A;  4C5E A;  1YIT A;  3D7S B;  1RAI B;  1X69 A;  3V8L A;  4D6W A;  3MO8 A;  2X4W A;  2HL5 C;  4O5V A;  3A8L B;  3MKD A;  3SDZ A;  5KYW A;  1VQ6 A;  1LCK A;  2AHJ B;  2LQW A;  2K3Y A;  2D8H A;  2F2X A;  4RG2 A;  4Z88 A;  4JRI A;  1AWJ A;  5LJ5 f;  3BE3 A;  2DX1 A;  2RA2 A;  1X6B A;  4RUG A;  2JVV A;  3KUF A;  5A2Q E;  2DL4 A;  4C8Q C;  1ZSZ B;  2ZPB B;  2GTO A;  3BDL A;  2RO0 A;  2LNH B;  2RMO A;  3BDU A;  1WQ7 A;  3OBW A;  4XQ3 A;  3OYL A;  4RTZ A;  3VU3 C;  3QJ6 A;  5HCK A;  1WJR A;  3EGU A;  4E7H A;  1NLO C;  2DTO A;  4KGZ B;  4NS5 A;  1WGS A;  1JEG A;  2EQI A;  1QMC A;  1KHC A;  5GAM j;  3ZFJ A;  2E65 A;  2LP5 A;  1ZA1 B;  4F14 A;  3FRN A;  1X6O A;  1I81 A;  4C8Q B;  1PD0 A;  1RAA B;  3EGD A;  1SEM A;  1RAB B;  1VQ9 Q;  2SRC A;  1VQL T;  1AEY A;  2QQ9 A;  2QI2 A;  2HKQ B;  5CKD A;  3G4S T;  3M0U A;  3CCS A;  3NTI A;  4L59 A;  2J6K A;  2DZC A;  1YJW A;  4C8Q F;  1XTD A;  2VWF A;  2CH4 A;  3H8Z A;  2OX7 A;  3OYF A;  1Y96 A;  3Q1J A;  3MEW A;  3R6O A;  2ESW A;  3MCA B;  4A4H A;  3MPU B;  1SF9 A;  5A0L A;  3HL8 A;  3VS2 A;  2CH4 W;  4PL6 A;  2K79 A;  1TH7 A;  5GAN e;  2AKK A;  3G71 A;  4DBF A;  3OYA A;  1VQK A;  2O01 E;  1G3W A;  5D6X A;  4ATO A;  1WNL A;  4WF2 A;  1K0X A;  1WDX A;  2LRQ A;  5GJV B;  3FDR A;  3A8O B;  4EPC A;  3CCR Q;  1U06 A;  3EG3 A;  2LCL A;  4B9W A;  4EIK A;  2RPN A;  1BCO A;  2ZPF B;  4DEY A;  3X28 B;  2X4Y A;  2EBP A;  3C0C A;  1X75 C;  1G8X A;  2XU8 A;  2R58 A;  3M9Q A;  4KUL A;  5IAY A;  2DPP B;  4FT4 A;  5LJ3 f;  4DOW A;  2XID A;  3QWY A;  4JJC A;  1WA7 A;  2DA9 A;  3GNG A;  2XDB A;  1N8R R;  4F04 B;  3M57 A;  3OYY A;  3RR6 A;  4YTL A;  3A8M B;  3CCV A;  1RAF B;  2FEI A;  2DL7 A;  4ZGE B;  3HFO A;  1M3C A;  3QBY A;  4OML A;  1FX7 A;  1VUB A;  1T0J A;  3RIR A;  2HZY A;  1TTH B;  5KCO A;  4M75 E;  1YNZ A;  1M90 C;  4M75 D;  3PVQ A;  2M9U A;  1VQ4 Q;  1UE9 A;  4M7A C;  4EMG A;  2M02 A;  1XNI A;  2JTM A;  2LMJ A;  3E19 A;  2MOX A;  2A7Y A;  2YRC A;  3L2V A;  3GP8 A;  5D7U A;  3VV0 A;  2O2O A;  4BDZ A;  4JUV A;  5LJ5 j;  2CP3 A;  4CC3 A;  2J06 A;  4A63 B;  1U1T A;  4M77 C;  3CME T;  4M7A E;  3CMA Q;  2PU9 B;  3QWX X;  2DKG A;  2DTI A;  3MEA A;  3SD4 A;  1BI2 A;  1QQJ A;  3VUZ A;  4B6M A;  1SKU B;  1QCO A;  1CKB A;  4BY6 B;  3HRU A;  1K76 A;  3JCM J;  2EYX A;  3OSS C;  1BI3 A;  1GFD A;  3P8H A;  3DB3 A;  1K73 U;  4D8D A;  3OYK A;  4BDY A;  4C5I A;  2R57 A;  5GAN 5;  2L3R A;  1VYU A;  3INZ A;  2QEX Q;  1M90 R;  2R5M A;  2IIM A;  4X34 A;  4JRK A;  1RLQ C;  1O9S A;  2FRW A;  3J81 E;  2B86 A;  4OB2 B;  3WVE B;  4DOV A;  1M8M A;  1WHK A;  2COY A;  5KYN A;  2EVR A;  5FW9 A;  2XIC A;  3SEM A;  1VQO A;  4PJO C;  4M78 C;  2LJ3 A;  2EFI A;  1AT1 B;  5L23 A;  1KC8 C;  4FYV B;  3AT1 B;  3VS6 A;  4BI8 B;  2QGG A;  5HK3 A;  2CZ0 B;  2KGT A;  1ZX6 A;  2RQU A;  3QG1 A;  1VOM A;  4J9E A;  1VQM Q;  2DEQ A;  3PIO A;  2E5Q A;  2FZK B;  4IUQ A;  2K2V A;  2K5I A;  2VV5 A;  3V8K A;  3GLX A;  1QKX A;  2RJC A;  1LNX A;  1M5Q 1;  1BKB A;  5LJ3 j;  2KT1 A;  3QDR B;  2HBW A;  1G2B A;  4ZGJ B;  1PWT A;  4OMP A;  2C0O A;  2OI3 A;  1Q7Y U;  3M56 A;  3V7R A;  3CQT A;  2P0K A;  1KD1 U;  3ME9 A;  3I55 T;  4BAC A;  4NL2 A;  5J39 A;  1OPK A;  1JU5 C;  2J7I A;  4PJO F;  4M78 F;  1KQ1 A;  3CBO A;  2EYQ A;  5HK0 A;  2VAS A;  2QK0 A;  4E7S A;  5FU7 C;  1WFW A;  2RN8 A;  2GGR A;  3CCJ Q;  2AK5 A;  3FJ5 A;  4FU6 A;  2JTF A;  1VQ9 A;  2HSP A;  5GAO l;  1OX8 A;  2PZ1 A;  5AT1 B;  4F7U B;  3L2Q A;  3VS0 A;  3CCE Q;  1AOJ A;  2DEU A;  1IHW A;  4OB1 B;  2DYB A;  1VIF A;  4KH0 B;  2JS2 A;  4F7U F;  1PC0 A;  1ABO A;  1KC8 R;  2LCC A;  4GY5 A;  3VUB A;  3CCS Q;  3QZ5 B;  1K9M C;  3UA7 A;  2IPO B;  2LJ1 A;  4KH1 B;  2GF7 A;  1D0X A;  1WXB A;  2EYW A;  2D6F A;  4BE0 A;  2XKO C;  3M59 A;  3NGP A;  3PNW C;  3DLM A;  3O8V A;  3OYG A;  2DNU A;  1AZG B;  3QHS A;  2K4Y A;  2YT6 A;  1K0S A;  1MMN A;  2EJF A;  3CCR A;  1JJ2 P;  1VQK Q;  3LX7 A;  1W6X A;  2AZS A;  3GF5 A;  2A3L A;  1K1Z A;  1DJ7 B;  2E6N A;  1V29 B;  5GAN 3;  2E4H A;  5KE2 A;  2DJQ A;  5CKE A;  4FSX A;  2RHU A;  3M4Y A;  4C0D B;  2EQK A;  2V1R A;  4HCZ A;  4ANJ A;  2KQW A;  2CRE A;  2X4X A;  4N4I A;  1BI1 A;  2LZ6 B;  2HDA A;  2DRK A;  1YJ9 Q;  1NJI C;  1LPL A;  2HL3 A;  3R6N A;  3H0H A;  4OGE A;  2VC8 A;  2V1Q A;  2O9V A;  3DB4 A;  4IUR A;  4HVW A;  2ENM A;  1QLY A;  2AKL A;  3I56 A;  4Z02 A;  3HFN A;  1VQ5 T;  2WSF E;  3HP9 A;  2FG0 A;  2O4X B;  4C0Z A;  1VQ4 A;  3LGL A;  3CD6 A;  2E1H A;  4VUB A;  4RKU E;  5CKH A;  1K9M R;  5IXF A;  4IIO A;  5GAM f;  4E7L A;  3SB2 A;  5KYY A;  2CS7 A;  3JB9 G;  1GL5 A;  3CBP A;  2JJ9 A;  4J8O A;  1ZBJ A;  1U8R A;  2V8I A;  5GAN 4;  1OV3 A;  4AG1 C;  2Y90 A;  4AFU C;  4EMK C;  2VYT A;  4WCI A;  5GMK j;  4N4G A;  3VS1 A;  5GMK i;  2K5F A;  2GTJ A;  2CSQ A;  2YLC A;  3JB9 D;  3X26 B;  3E1S A;  3M0R A;  1YBY A;  1G83 A;  4GBQ A;  2D8J A;  2V26 A;  4IUU A;  1G3Y A;  1AWO A;  1JJ2 S;  5KYX B;  1FMK A;  5GAO p;  2DM1 A;  3L42 A;  1NJI R;  1TUD A;  4OMM A;  2VVK A;  3M0T A;  1JB0 E;  3UF4 A;  4E7K A;  1N8R U;  3QPH A;  3AHU A;  3UT1 A;  3U23 A;  2GCX A;  2EWN A;  2DXC A;  4MMK A;  1TWB A;  3E9F A;  2C0I A;  3OYH A;  1KQS A;  1FXX A;  1YWO A;  3LYI A;  4J6W A;  2QTX A;  3ER0 A;  4PLI A;  1G5V A;  1NYF A;  2EJ9 A;  2QEX A;  1SHG A;  1IRE B;  1CSK A;  1D3B A;  2D9T A;  1M8V A;  3EGX A;  1RLP C;  3KXT A;  4C92 B;  2Y4X A;  2KDS A;  4O6J A;  2DVE A;  1UHF A;  2Y4Y A;  4M7D B;  1N6A A;  4RTU A;  4JRQ A;  2P4T A;  7AT1 B;  1SRM A;  2EQM A;  3SWN B;  1UGP B;  3CCL A;  4J9B A;  2ZCF B;  5CIU A;  1VQ7 T;  1EFN A;  2LCS A;  2GBQ A;  4M7D F;  1KK7 A;  4Y91 A;  2ZPG B;  2NUP B;  2E6Z A;  2L3Q A;  3JCM g;  3RER A;  2KMT A;  3M53 A;  1YJN A;  3VS7 A;  1UGS B;  1PKS A;  4PLL A;  2L2P A;  4QVZ A;  1JQQ A;  4RTX A;  3V7S A;  1M2V B;  4HVU A;  2X9H A;  2KT8 A;  3M0S A;  1KQS P;  2BE7 D;  1B34 A;  1SHF A;  2ABL A;  2HD0 A;  2LDM A;  1X01 A;  2WSE E;  5D6W A;  5LL6 S;  1I5L A;  2QAZ A;  2CP6 A;  2MMP A;  4ESR A;  3TU4 K;  3CC7 A;  3DKM A;  2BZ8 A;  1FMW A;  3H41 A;  2OTL T;  3CC4 T;  1ZUY A;  2ECZ A;  3CCJ A;  2I0N A;  2GFU A;  1I07 A;  3RMQ A;  2RHI A;  2DE0 X;  1M27 C;  2RJE A;  2MWP A;  2RJD A;  1W2B A;  1HSQ A;  2FPE A;  3S3N A;  4XTU A;  2QG9 B;  1M90 U;  2HQX A;  2CYZ B;  4C8Q G;  5I2S A;  3G6E T;  3CCE A;  1YIJ T;  4RCC A;  2JS0 A;  3T9N A;  3L1A A;  2RQT A;  4N0A A;  3CCQ T;  2RM4 A;  2FRY A;  2KRM A;  1UEC A;  2XI9 A;  3GOX A;  2DZ9 A;  2DAQ A;  3URG A;  3CME Q;  2KNB B;  3ZL7 C;  2CT4 A;  2HBP A;  2L3P A;  2NUZ A;  2V8J A;  4DEX A;  2CP2 A;  2YRV A;  3V8J A;  1YI2 T;  1GBR A;  1TUG B;  4PFZ A;  4ZTF A;  2P4R A;  8AT1 B;  5FRM A;  4DA4 A;  2HEQ A;  2DET A;  4R55 A;  2KEA A;  2LT1 A;  2DO3 A;  2MF2 A;  4OGC A;  3QYH B;  2PVO B;  4DQ2 A;  2XD0 A;  1H3Z A;  3UAT A;  3HHT B;  3EFO A;  1C1A A;  1TU0 B;  1PG5 B;  2NUT A;  4RTV A;  2QA4 A;  3JCM e;  1NBE B;  2JM8 A;  2X35 A;  1KQS S;  2B8A A;  2FPF A;  2LQN A;  4LE9 A;  2DXU A;  4AFQ C;  3OYE A;  2AT1 B;  2DER A;  2PUO B;  3H0F A;  3KBG A;  1YJ9 A;  2IG0 A;  3JCM h;  2CSI A;  1VQO T;  4LUD A;  4M75 C;  5DM7 R;  1EIF A;  2DIG A;  3CC2 T;  5FU6 C;  1T3S A;  1VQ8 A;  3V7C A;  2JM9 A;  1ZA2 B;  1PRM C;  2DBM A;  2EYY A;  2KE9 A;  3FC3 A;  3RMS A;  1VQN T;  2JMA A;  4QQG A;  1KFZ A;  1KIK A;  4MZP A;  2RQV A;  4QW2 A;  2BZX A;  2OTJ T;  2CGH A;  2EKH A;  3REB B;  3I56 Q;  3HPW A;  4XU0 A;  2QDY B;  4XTY A;  5GMK h;  2MI6 A;  2EJG A;  3CPW A;  3LWH A;  1KC8 U;  1ZQ1 A;  4M75 B;  2CZ7 B;  1NEB A;  3NHN A;  5GAM g;  3CD6 Q;  2DIL A;  5CK9 A;  2M0Y A;  3GPL A;  3EG9 A;  3M54 A;  4BI3 A;  4QVC A;  3EHR A;  2VUB A;  1WLP B;  3CXC A;  1I8F A;  1U1S A;  3RBB B;  4KGV B;  4M75 F;  1J3T A;  5GAO r;  4LD9 K;  1OI1 A;  4CI0 C;  3CCU T;  2KK4 A;  4PJL A;  2RK2 A;  4K11 A;  3H0I A;  3LH0 A;  2NYS A;  1UGV A;  2QDL A;  1R0B G;  5GMK m;  1Q82 C;  3I55 Q;  4M7A B;  2KXD A;  5IH2 A;  3C94 A;  3C4S A;  2DL3 A;  2QQB A;  1Z9Z A;  2ED1 A;  2X4J A;  4M7A F;  2M16 A;  3OW2 A;  4GLK A;  1HD3 A;  2DRM A;  4MDW A;  2EW3 A;  2BKD N;  4J9G A;  4X1V A;  3CPW P;  1VQL A;  2GQV A;  4XU1 A;  5J26 A;  4M77 B;  3G4S A;  1QWF A;  3JCM d;  4NL3 A;  1H8K A;  3CCM T;  2HNI A;  3CXC P;  3QXE B;  3RNJ A;  1OPL A;  2KRO A;  4M77 F;  1X6G A;  3CEY A;  2ZPH B;  1S72 T;  1PSF A;  3F70 A;  2JXB A;  1B07 A;  2DMO A;  1D0Y A;  1K9M U;  2KI7 A;  1RUW A;  1OUL A;  3L2W A;  2YSQ A;  3RKY A;  2LQ8 A;  1YP5 A;  4KGX B;  1BBZ A;  1IO6 A;  2K6D A;  3HRT A;  3LH5 A;  4LDV A;  4E6R A;  2FZG B;  5HY6 A;  5KYU B;  4JS5 A;  4UC4 A;  3CCL Q;  3FB9 A;  3UDC A;  1MGQ A;  5I22 A;  3VRZ A;  1Q82 R;  5GAM e;  5GAN f;  2EPD A;  1YJN Q;  1ZSZ A;  3PT9 A;  2XDD A;  5LJ5 g;  1BYM A;  4ELZ C;  5GAM h;  1WJQ A;  4PJO G;  1MND A;  3RKX A;  2VXF A;  1YHQ T;  3KFV A;  4PJM A;  4PJO B;  2FPD A;  1AZE A;  4M78 B;  3PE0 A;  1BI0 A;  1NJI U;  1ARK A;  1QP2 A;  2D0Q B;  1T3L A;  2XHC A;  4FW2 A;  1VQ5 Q;  3OMC A;  4LD6 A;  1WHG A;  1PM3 A;  3CC7 Q;  3OQ5 A;  3JSC A;  4B9X A;  5I21 A;  3OYI A; 
#chains in the Genus database with same CATH homology
 3EG0 A;  1GL5 A;  2D0N A;  1WXT A;  2LNH B;  2RMO A;  4OMO A;  2LX7 A;  4RTZ A;  5IHK A;  1ZBJ A;  5HCK A;  2RNA A;  1MUZ A;  3EGU A;  1OV3 A;  1UTI A;  2BZY A;  4AG1 C;  1NLO C;  1BB9 A;  4AFU C;  1WI7 A;  4WCI A;  3VS1 A;  1JEG A;  1ABQ A;  2EQI A;  1I0C A;  2CSQ A;  2GTJ A;  2DLP A;  1ZUK A;  1UJ0 A;  3M0R A;  2LP5 A;  4F14 A;  1G83 A;  4GBQ A;  2D8J A;  4J9D A;  3PVL A;  1AWO A;  2YUO A;  1SEM A;  1AEY A;  2SRC A;  2OAW A;  3VS4 A;  2O9S A;  1FMK A;  2DM1 A;  2L0A A;  3M0U A;  1TUD A;  2J6K A;  1RI9 A;  4OMM A;  2VVK A;  3M0T A;  1UG1 A;  2VWF A;  3UF4 A;  2CH4 A;  2A36 A;  2JW4 A;  3U23 A;  3TVT A;  1X43 A;  2ESW A;  4M4Z A;  2RQR A;  2C0I A;  1YWO A;  2YUN A;  3VS2 A;  2CH4 W;  1NYF A;  1SHG A;  2K79 A;  1CSK A;  1NEG A;  2AKK A;  4R0K A;  1RLP C;  2KYB A;  3TSZ A;  1X2Q A;  1M3B A;  1U5S A;  1FYN A;  2CDT A;  2XMF A;  1UHF A;  3EG2 A;  1K0X A;  1WDX A;  5GJV B;  4OMQ A;  4RTU A;  1PHT A;  1UJY A;  4Z89 A;  1U06 A;  1WXU A;  2JT4 A;  3EG3 A;  3VRY A;  1JXM A;  1SRM A;  4EIK A;  2RPN A;  4DEY A;  4HXJ A;  4CC7 A;  4J9B A;  2EBP A;  1EFN A;  2LCS A;  3C0C A;  2GBQ A;  2CUD A;  1X2K A;  3QWY A;  2L3Q A;  4JJC A;  1WA7 A;  2RF0 A;  3VS7 A;  1PKS A;  1N5Z A;  2DA9 A;  2L2P A;  4Y92 A;  1JQQ A;  2BTT A;  2VKN A;  4FSS A;  1UUE A;  4RTX A;  2X3W D;  4HVU A;  1YWP A;  2GQI A;  2X3X D;  2FEI A;  2L3S A;  2KT8 A;  3M0S A;  2EGC A;  2DL7 A;  3M0P A;  5ECA A;  1X27 A;  1M3C A;  1SHF A;  2ABL A;  4OML A;  1T0J A;  1YNZ A;  1YCS B;  1NLP C;  3PVQ A;  4ESR A;  2K2M A;  1UE9 A;  1K9A A;  2O88 A;  1GCQ C;  4OMN A;  1XOV A;  2AZV A;  3I35 A;  2J05 A;  2A08 A;  2ROL A;  2BZ8 A;  2LMJ A;  2MOX A;  2DBK A;  3H41 A;  1E7O A;  1ZUY A;  2CUB A;  2O2O A;  2ECZ A;  1U3O A;  2I0N A;  4JJD A;  5I11 A;  1I07 A;  2DE0 X;  1M27 C;  1YN8 A;  4RTT A;  1HSQ A;  2DL5 A;  2FPE A;  4CC3 A;  2J06 A;  5EC7 A;  4A63 B;  3I5R A;  2KYM A;  1VYV A;  4LN2 A;  2JS0 A;  1TUC A;  1H3H A;  2LJ0 A;  2OJ2 A;  5FWB A;  4ZNX A;  2RQT A;  3REA B;  3QWX X;  2FRY A;  2KRM A;  4CC4 B;  1UEC A;  1V1C A;  2J6F A;  1AWW A;  3M0Q A;  3UA6 A;  1GCP A;  2C0T A;  2KNB B;  3ZL7 C;  2E5K A;  2CT4 A;  2CT3 A;  2K7A A;  3TSW A;  1AVZ C;  2L3P A;  3IQL A;  4Z8A A;  2K3B A;  2NUZ A;  1B3Q A;  1CKB A;  4AG2 C;  4DEX A;  1GBR A;  1K76 A;  2EYX A;  2EYZ A;  2P4R A;  2HEQ A;  4LNP A;  1M30 A;  3THK A;  2ED0 A;  1GFD A;  2KEA A;  1PNJ A;  4D8D A;  1NM7 A;  1JXO A;  1KSW A;  1H92 A;  4RTW A;  1AD5 A;  3UAT A;  1E6G A;  1ZLM A;  2O31 A;  1VYU A;  1UFF A;  4RTV A;  2W0Z A;  2JM8 A;  2IIM A;  1RLQ C;  2ROT A;  2FRW A;  5FWC A;  2FPF A;  2LQN A;  4LE9 A;  4J9H A;  4AFQ C;  2B86 A;  2KXC A;  3H0F A;  2J6O A;  2MCN A;  1M8M A;  1QWE A;  2EVR A;  5FW9 A;  1OEB A;  2CSI A;  3SEM A;  4LUD A;  2SEM A;  1W70 A;  3I9Q A;  2LJ3 A;  1ZSG A;  4QT7 A;  4CC2 A;  1T3S A;  5L23 A;  2EGA A;  2JM9 A;  2DL8 A;  2GNC A;  1PRM C;  2DBM A;  2EYY A;  2KE9 A;  3VS6 A;  2KGT A;  1ZX6 A;  2RQU A;  2JMA A;  1KFZ A;  1KIK A;  1GBQ A;  1E6H A;  4J9C A;  4J9E A;  2G6F X;  2RQV A;  1AWX A;  1S1N A;  2BZX A;  2EKH A;  3REB B;  1QKX A;  2M51 A;  4J9I A;  4RTY A;  1GRI A;  1W1F A;  3EHQ A;  4JZ3 A;  5IXB A;  2KT1 A;  1UDL A;  2HBW A;  1VYT A;  1G2B A;  2PNI A;  1NEB A;  3NHN A;  2DIL A;  1PWT A;  2M0Y A;  4OMP A;  1QCF A;  2C0O A;  2OI3 A;  4D8K A;  3EHR A;  1UHC A;  1WLP B;  1GCQ A;  3CQT A;  3RBB B;  2FO0 A;  2KRN A;  2YDL A;  1OPK A;  1JU5 C;  1J3T A;  2J7I A;  1GFC A;  2HCK A;  2YUP A;  4GLM A;  4J9F A;  1OOT A;  4K11 A;  2F2W A;  1TG0 A;  3H0I A;  1UGV A;  2QDL A;  1WFW A;  2RN8 A;  2YUQ A;  2H8H A;  1PKT A;  2GGR A;  2EGE A;  2JMC A;  2KXD A;  5IH2 A;  2AK5 A;  1CKA A;  1PRL C;  3FJ5 A;  2DL3 A;  2F2V A;  2HSP A;  2PZ1 A;  4F16 A;  3JV3 A;  1WX6 A;  1BU1 A;  3I5S A;  1Z9Z A;  2ED1 A;  4ORZ A;  2W10 A;  3VS0 A;  1AOJ A;  4HVV A;  2DYB A;  1HD3 A;  2DRM A;  2JS2 A;  1HJD A;  2EW3 A;  1K4U S;  1ABO A;  4J9G A;  4X1V A;  2KR3 A;  1SSH A;  1A0N B;  2KBT A;  3UA7 A;  1QWF A;  4F17 A;  1SPK A;  3NPF A;  2LJ1 A;  1WXB A;  2EYW A;  1H8K A;  1T0H A;  1Y57 A;  3ULR B;  3GBQ A;  2A28 A;  2PTK A;  3RNJ A;  2MIO A;  3NGP A;  1NG2 A;  1OPL A;  2KRO A;  1M3A A;  1QKW A;  1ZUU A;  2A37 A;  1X6G A;  4AFZ C;  2DNU A;  1AZG B;  1MV3 A;  2D1X A;  2JXB A;  4IIM A;  2DF6 A;  1B07 A;  2YT6 A;  2DMO A;  1K0S A;  3VS3 A;  3A98 A;  3O5Z A;  1JO8 A;  1W6X A;  2AZS A;  2KRS A;  1K1Z A;  1RUW A;  2YSQ A;  1SRL A;  4LUE A;  1WIE A;  1BK2 A;  1YP5 A;  2NWM A;  5IHN A;  4AFS C;  1BBZ A;  2DJQ A;  4JPB W;  4JJB A;  3VS5 A;  1IO6 A;  2K6D A;  3SHW A;  3LH5 A;  2V1R A;  4E6R A;  1WYX A;  2CRE A;  2LZ6 B;  1Z9Q A;  4HCK A;  2HDA A;  2DRK A;  3R6N A;  3H0H A;  2JTE A;  2K9G A;  5I22 A;  3EG1 A;  2RQW A;  2O9V A;  2V1Q A;  1VA7 A;  3VRZ A;  4HVW A;  1NYG A;  2EPD A;  1KJW A;  5IHI A;  3NMZ C;  2ENM A;  1QLY A;  2AKL A;  1X69 A;  2FG0 A;  5GJW B;  3KFV A;  1MV0 B;  1AZE A;  2FPD A;  1I1J A;  3PE0 A;  1LCK A;  2LQW A;  1ARK A;  2D8H A;  2F2X A;  4JZ4 A;  4Z88 A;  2DVJ A;  1AWJ A;  1T3L A;  2DX1 A;  4RUG A;  1X6B A;  4IIO A;  5IXF A;  1Y0M A;  2DL4 A;  4KRT A;  2GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...