4AFSC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afsC00
2KXCA 2LX7A 4RTUA 4QT7A 4R0KA 1UTIA 2AKLA 4ZNXA 1WLPB 4AG1C 1AWOA 2FG0A 4JJBA 1VA7A 2EGCA 1Y0MA 2HCKA 2CUBA 1AOJA 4Z8AA 1BB9A 1OEBA 1FMKA 2K2MA 2GBQA 2YT6A 2OJ2A 2EKHA 2AZVA 5IHIA 1PKTA 1WDXA 2BTTA 4LUEA 2HBWA 2M51A 2I0NA 3UF4A 2MCNA 1GFCA 1JXOA 2GTJA 1KIKA 1SRMA 1OV3A 1KJWA 2NWMA 2RQVA 1UFFA 1WA7A 4JJDA 1JO8A 2JMCA 1UECA 1ZSGA 1K76A 2VWFA 1RLQC 4AFUC 4EIKA 1G2BA 1S1NA 3PVQA 2FRYA 3UA7A 1JEGA 4JZ4A 1ZX6A 4RTWA 2YUNA 3QWYA 3M0UA 1PNJA 1JXMA 1WXTA 1YNZA 1BBZA 2JMAA 1ZUUA 2KRSA 2X3XD 2BZYA 2FPEA 4JJCA 5IHNA 2MOXA 2RF0A 4D8KA 3EG3A 3VS0A 3VS6A 2KGTA 1AWXA 5GJVB 1U3OA 1T3SA 1M8MA 2O9SA 2CH4A 2YUQA 1AWJA 1ZBJA 2FPDA 4RUGA 2J6OA 1AVZC 4WCIA 1K1ZA 1YN8A 4LUDA 1GL5A 1CKBA 5GJWB 4KRTA 1E7OA 5I22A 2YUPA 4HVUA 1RUWA 1AZEA 2DLPA 1GBRA 2DBMA 2DILA 3RBBB 5IHKA 1WXBA 2PNIA 4RTYA 1YWOA 2O2OA 2V1RA 2JTEA 1NEGA 1M3BA 1UDLA 2RMOA 1JQQA 1X2KA 1WYXA 4F16A 2K9GA 2HSPA 1T3LA 1VYUA 4IIMA 2AK5A 1RLPC 1UJ0A 4CC2A 2D0NA 3R6NA 1SPKA 2LQWA 2LCSA 1PRLC 2CT3A 1HSQA 2DM1A 4RTTA 1UG1A 2RQTA 2OI3A 1UUEA 3VS4A 1LCKA 4M4ZA 4HCKA 2K6DA 2CUDA 3M0SA 4J9FA 3I5RA 1X69A 2L3SA 1ABOA 4DEYA 2A36A 2V1QA 2JM8A 2EVRA 2E5KA 2DMOA 1U5SA 1WFWA 2KRNA 2EPDA 2KYBA 3NPFA 1UJYA 2G6FX 2QDLA 3NHNA 3QWXX 4HXJA 1SHGA 1PWTA 2AZSA 4OMQA 1ARKA 1RI9A 1X2QA 4A63B 4RTXA 5L23A 1NYFA 2PTKA 2ROLA 2RQUA 1AWWA 4D8DA 4AFSC 1GCPA 2B86A 2W10A 4J9CA 3I5SA 2NUZA 1GRIA 2A28A 3A98A 4OMLA 3TSZA 1NM7A 4LN2A 4GLMA 4K11A 2J05A 2PZ1A 2C0IA 1KSWA 4LNPA 5FWBA 1Z9QA 2VKNA 1N5ZA 1VYTA 1H8KA 2A08A 2DRKA 2HDAA 4AFZC 2L3PA 2DBKA 3I9QA 2J06A 4GBQA 3KFVA 3EG2A 1GFDA 1WXUA 4J9IA 5IXFA 2KNBB 1TUDA 2KT8A 2EYXA 1K0SA 1EFNA 1B3QA 3M0QA 1NYGA 1SEMA 1UGVA 4AG2C 2K79A 1T0JA 2JXBA 2KYMA 5ECAA 2LP5A 5I11A 2GNCA 2M0YA 2RQRA 4J9HA 2DX1A 1ZLMA 4Y92A 2ABLA 4RTVA 2LZ6B 1HD3A 2L2PA 1NG2A 2J6FA 2AKKA 2JT4A 2DVJA 1M3AA 1CKAA 2DL7A 2O9VA 1BU1A 2KRMA 2D8JA 1TG0A 3VRYA 4JZ3A 2DA9A 1OPKA 1ZUKA 2EYYA 1SRLA 1PRMC 1OOTA 2FPFA 1VYVA 2RNAA 1TUCA 2LNHB 2F2VA 3RNJA 2L3QA 1WIEA 1IO6A 2H8HA 4ORZA 3VS5A 4AFQC 2LMJA 1K9AA 2KEAA 3ULRB 1H3HA 4OMNA 4J9GA 2J6KA 3TSWA 4JPBW 2EGAA 2F2XA 2LJ3A 2EQIA 3UA6A 2HEQA 1E6GA 2RPNA 1AD5A 2ECZA 4J9EA 2YDLA 1UE9A 4ESRA 1SHFA 2FRWA 3SHWA 2ED1A 2IIMA 1X43A 2P4RA 4HVWA 1UHFA 2DRMA 2OAWA 2RQWA 1OPLA 2ROTA 2SRCA 2DL3A 3EHRA 1Y57A 4J9DA 1X27A 1J3TA 1NLOC 3O5ZA 2KXDA 3H0IA 3NMZC 1WI7A 1M30A 1FYNA 1K4US 2DJQA 1NEBA 1PHTA 2F2WA 1H92A 2LJ0A 4IIOA 1QCFA 4DEXA 1I0CA 2XMFA 3UATA 2EYZA 3REAB 2GTOA 1QKWA 1QWFA 2ENMA 4LE9A 4OMMA 2KE9A 1KFZA 1AZGB 3VS3A 1GCQC 2O31A 1E6HA 2GGRA 2GQIA 2RN8A 1PKSA 1GBQA 2EYWA 4X1VA 1QKXA 3H0HA 1X6GA 2CH4W 2J7IA 1CSKA 3FJ5A 2DL5A 1M27C 2C0TA 2FO0A 4CC7A 1YWPA 4RTZA 1NLPC 2KT1A 2JW4A 1M3CA 2DL8A 4F14A 5IH2A 2K7AA 3LH5A 1MUZA 2YSQA 4OMOA 2L0AA 1GCQA 3THKA 2ESWA 2VVKA 3NGPA 3VS1A 4HVVA 3TVTA 2BZXA 2CREA 2DNUA 3SEMA 1AEYA 2DL4A 1QWEA 1Z9ZA 2LJ1A 5EC7A 2D1XA 1SSHA 2SEMA 3M0PA 3VRZA 2BZ8A 3EG1A 2KBTA 1G83A 4CC3A 3JV3A 3PVLA 1B07A 1JU5C 2A37A 2DE0X 5IXBA 1I1JA 2W0ZA 1WX6A 2EGEA 1X6BA 1ZUYA 3PE0A 1QLYA 4FSSA 2ED0A 1MV0B 2KROA 3REBB 5FW9A 2MIOA 1W6XA 2LQNA 1ABQA 2EW3A 4CC4B 3U23A 4F17A 3M0TA 3VS7A 2YUOA 3EHQA 2CSIA 4Z89A 2CT4A 5HCKA 1W1FA 2FEIA 2JS2A 2C0OA 1BK2A 4E6RA 3EGUA 2KR3A 1U06A 2D8HA 2JS0A 1K0XA 2O88A 3C0CA 5FWCA 2CDTA 2JM9A 1V1CA 3I35A 4OMPA 1I07A 3CQTA 4J9BA 3H0FA 1UHCA 1W70A 1A0NB 2X3WD 4Z88A 1HJDA 1YP5A 1YCSB 3GBQA 1XOVA 3EG0A 1T0HA 3IQLA 2DF6A 3M0RA 3H41A 3VS2A 1MV3A 2DYBA 2EBPA 2K3BA 3ZL7C 2CSQA
chains in the Genus database with same CATH superfamily
2KXCA 1NJIU 1F1BB 4XK8E 3VJPA 2OTJA 1EZZB 4OGCA 4LD9K 1WLPB 3JB9H 1AWOA 2R5AA 5A0DA 4JJBA 1MGQA 5KE2A 2E10A 3M4YA 1PSEA 2CUBA 4CI0C 2GFAA 2RHZA 4Z8AA 1AHJB 1D0YA 2YT6A 1OI1A 1BIAA 2F5TX 2MWOA 4FYXB 2BTTA 1TUGB 1YITT 3LGLA 1JXOA 1VQKT 1VQ7Q 1OV3A 2NWMA 3J81E 2JOYA 1M1GA 1RLQC 3PVQA 4EMGA 1JEGA 1O9SA 4PKCC 4E7KA 2XICA 4JZ4A 3LW5E 3CPWA 3JCMd 1BBZA 1RAHB 2PUKB 2JMAA 2QGGA 3NTIA 2BZYA 3CCLT 2E5QA 5GANf 2BE9B 3CC7T 3JCMX 2X4XA 2KGTA 3OYBA 1AWXA 3META 3C4SA 2CH4A 4MDXA 3CCEQ 1YJ9T 1AWJA 3L2ZA 2FPDA 3NFCA 1AT1B 2J6OA 1AVZC 1JB0E 3OYMA 1GL5A 5CQYA 5I22A 3OYLA 3BDUA 3JB9F 1RUWA 5HK3A 1AZEA 2DLPA 5HKCA 2DILA 3RBBB 5I21A 3DB3A 5DM7R 3CC2A 5IT9E 2V1RA 2YWWA 1WHLA 4JRIA 4C92E 1V29B 2EJFA 2RMOA 5KYUB 3CD6A 4LDXA 5CAIA 1M2VA 3LGFA 3HTRA 3JCMb 3OBWA 4E7LA 3OY9A 5L8RE 2EJGA 3MEVA 1UJ0A 3R6NA 3EG9B 1X01A 2WACA 1Q7YU 1LNXA 2CT3A 1HSQA 1FMWA 3G6EA 5IAYA 3PIOA 4P5NA 4M77D 4J9FA 5GAOp 3OS5A 4QW2A 4PK4A 4R55A 4FU6A 1ABOA 2A36A 1VQ6A 2ATCB 2JM8A 4BE1A 1VQMQ 2EVRA 4XQ3A 1U5SA 1WFWA 3I56T 5FLXE 2EPDA 2JNGA 3JB9I 4M75F 4ZGDB 1ACMB 1UJYA 1VQ8A 4X9DA 2L8DA 1M5Q1 1W2BP 4A63B 3TEEA 1XTDA 5L23A 3CCMT 4J6YA 2B86A 1Q86C 2DD4A 4J9CA 2A3LA 4KGVB 1GRIA 2A28A 2P0QA 3N5BB 2L3RA 2MMPA 4QVZA 2DETA 3X25B 2Y4XA 1KC8U 4LNPA 5FWBA 1VQLQ 1P92A 3R6OA 1N5ZA 4EMKC 1H8KA 1G3TA 2Y4YA 2LNVA 2DAQA 1IZ6A 2PVDB 2E12A 4AFZC 3GP8A 2ZGWA 1EX4A 3OYGA 3LWHA 1WXUA 3CCJT 2MAMA 3M59A 3CPWP 1ZSZB 1TUDA 2M16A 2EYXA 1EFNA 1NYGA 1SEMA 1VQ7T 4M7AA 1QP2A 2DERA 2OX7A 2K79A 2CZ1B 2KYMA 1SG5A 2LP5A 1C1AA 2DX1A 3I55A 3H9NA 2ABLA 4RTVA 1I5LA 1MMNA 2O4XA 3HRSA 4ZN3A 1VQPQ 2RI2A 1CKAA 2X4JA 3OQ5A 2KRMA 3VRYA 4JZ3A 4PFZA 4IURA 2DA9A 4BDZA 3S3MA 3QIIA 3RMSA 8AT1B 4M78C 3QDRB 1TWBA 2Z0WA 2FB7A 3GIBA 2OAUA 4ZN1A 2EQKA 3JCMJ 2P4TA 2VC8A 1PM3A 1WHKA 2KEAA 1PSFA 1H3HA 4Y91A 1YJWQ 4OMNA 2QA4A 4PNOA 1NJIR 2CZ7B 3VYHB 3UA6A 2V8KA 2CP6A 2MK5A 4PJOC 1W4SA 1AD5A 2ECZA 3QO3A 2BE7D 3A8HB 4HA8A 4Y28E 3PMTA 4N4GA 2FHDA 3URGA 2KY9A 1UHFA 2OAWA 1R8OB 2RQWA 2ROTA 2SRCA 3QSUA 1OU8A 1ZBXA 4LDWA 1X27A 1R0BG 4OMFB 1NLOC 2BIVA 2YLCA 2ZPGB 4M7DE 1H3ZA 1M30A 3JSCA 5HK0A 1YI2A 4C92B 3CC2Q 3VU3C 2DJQA 5CKBA 1NEBA 2HQEA 1H92A 4IIOA 2VASA 1QVFS 3HKSA 5GMKj 3UATA 3CD6Q 1D1BA 2PVOB 4M75D 2RJFA 1VQNA 1QWFA 1QVGA 2PVGB 1VQMT 1RI0A 5D6XA 1E6HA 1PC0A 2GGRA 4C8QE 4C92G 2QQBA 3AHUA 3A1PA 5GANh 1M1KU 3G6EQ 3H0HA 2COWA 1K73R 1RACB 3DLMA 2DEQA 3CXCS 1NLPC 2RB6A 1VQ6Q 1KQSP 3HRUA 4V2SA 5CVIA 4M7AE 4F14A 2EQMA 1SKUB 1D1CA 2QTXA 3LH5A 3ZBDA 4XU0A 1VQ8Q 1G5VA 2NUTA 1GCQA 1VQLT 3RDVA 4NL2A 4EDUA 4C5EA 2HKQB 4HVVA 2BZXA 3SEMA 2DL4A 3ER0A 4Z02A 5GAOq 1QWEA 2DIQA 1GXIE 3OMCA 1G3SA 2G3RA 5D6WA 3M0PA 4XU3A 4A4FA 1QQJA 2OTJT 2NUPA 1B07A 1JU5C 3CCQT 1JRIA 1I1JA 3G71T 4M77A 1WX6A 1ZUYA 1WHHA 3D7SB 2ED0A 3OB9A 1Q7YR 2FVUA 2KROA 3QPHA 5CKEA 2I2LA 2MIOA 2LQNA 2EW3A 3E2UA 1QCNA 3CCST 3DKMA 4NS5A 2YUOA 1YIJA 1Q7YC 5HCKA 1W1FA 2FEIA 2C0OA 1Q81R 1KQ2A 2DO3A 4X9CA 1ZA1B 3EGUA 1WHGA 2D8HA 2CYZB 2JS0A 1K0XA 1Y7XA 4IUVA 3CCUA 3C0CA 5GMKe 3M56A 5I2MA 1OU9A 1V1CA 3I35A 1BIBA 1I07A 5FU6C 3I55Q 3GPLA 3H0FA 2X3WD 1YCSB 3EG0A 5CKHA 3SD4A 2DF6A 5CQXA 1MV3A 4E7SA 2K3BA 3HHTB 2E3HA 3QUIA 2HQXA 2VV5A 4QT7A 5GAN7 1WHMA 1M2VB 2AKLA 1Q95G 1KQ1A 3PFSA 4ZNXA 2K57A 3SWNC 1TSFA 3OYKA 1VA7A 2EGCA 1KC8C 2DZ9A 2QA4Q 2ZPBB 5GAMj 3CCEA 1FMKA 4BD3A 3EFRA 2EKHA 1PKTA 1WDXA 3UT1A 1Y96A 2HBWA 1KHIA 3CC2T 1GFCA 1KIKA 3CMAT 1KJWA 2RQVA 2EKOA 1WA7A 4JJDA 2LCLA 1JO8A 3CD6T 1BCMA 2RH2A 4M7DB 3M5AA 4AFUC 5J26A 1G2BA 2F5KA 5GAN6 2RI5A 5GAN2 4RTWA 2YUNA 2HAXA 3MJXA 1YNZA 3BFMA 1I5OB 4HT9A 2KRSA 3G6ET 4FYYB 3OYNA 1SSFA 4JJCA 2BUDA 2HSEB 5GJVB 4M7DG 2HL5C 1VQNQ 1QW1A 4FSXA 3DLLA 1VQ6T 2YUQA 1ZBJA 4C8QB 3M54A 5CK9A 1YN8A 4LUDA 4BUGA 1E7OA 1Q82U 2CP7A 2YUPA 4HVUA 1K9MC 1GBRA 2B8AA 1VQ9T 1M2OA 1FMVA 3G4SA 1WXBA 2RM4A 4M7AB 2PNIA 3E19A 1YWOA 2O2OA 3P8DA 4XTZA 4C8QG 4PLIA 5A2QE 1JQQA 2E64A 4O6JA 4QKUA 4A4GA 4F16A 1U1TA 4B6MA 3S3OA 4RG2A 4JUVA 1IRXA 3FLGA 4XTUA 4M75A 5LJ3j 2LT4A 4DA4A 4IIMA 5HY6A 5GAMe 3OYJA 4KGZB 1SPKA 2LQWA 4M7AG 2K3YA 3V7CA 3BDLA 2DM1A 2V8JA 4RTTA 1UG1A 1UUEA 3VS4A 2K6DA 2CUDA 2RHXA 4LDVA 1JJ2S 3PIPA 4DEYA 1XNIA 4KUDK 5LJ5j 4A53A 1M1KR 4IUQA 2WSFE 3I55T 2KYBA 5FROA 1W2BA 4E7IA 2AHJB 2M02A 3QWXX 1YIJQ 1RAEB 4A4EA 2GCXA 4OMQA 1S72A 1RI9A 1X2QA 3S3NA 1M1KC 2DZCA 4RTXA 4IUUA 2PTKA 4N0AC 4D8DA 4BI8B 2W10A 1WJQA 3CCUQ 1VQPA 5GAN3 3OW2A 3TSZA 4OVAA 1NM7A 9ATCB 4LN2A 4AT1B 2MPXC 2QXFA 2RHYA 1TTHB 2PZ1A 4GLMA 2C0IA 4C5HA 3V7RA 4DOWA 3RKXA 3HPWA 2VKNA 3M55A 1VYTA 2QA4T 2DRKA 4FIBA 3P8BB 5GAMd 2QTVA 2HDAA 3J80E 2FZCB 3P8HA 3I9QA 2DBKA 2ZPFB 5KYXA 5KYYB 2J06A 1YJWA 3EFOA 3EG2A 1GFDA 4J9IA 4OB0B 2KT8A 2EAYA 1K0SA 4F04B 2XDPA 1K73U 4AG2C 1VUBA 3JCMf 1T0JA 5ECAA 3OA6A 1IHVA 4BY6B 2JTMA 2M0YA 1VQ4A 4E7HA 3M57A 1NG2A 2JT4A 1YI2T 2DL7A 2O9VA 2D8JA 2YRDA 1OPKA 1ZUKA 4F7UA 3EH2A 4C0DB 1PRMC 1OOTA 3HFNA 1UGRB 2RNAA 2NUTB 2F2VA 1VQNT 2L3QA 2RHUA 2LDMA 2DEUA 2KDSA 5LJ5e 1RAAB 1K9AA 3CMEQ 3HL8A 2VXEA 4M75E 1N6AA 3JCMV 2J6KA 5DLQE 1KG1A 1TS9A 2F2XA 2LJ3A 1XJWB 1BYMA 2HEQA 1HXDA 1E6GA 2YXYA 4J9EA 2NUPB 2HNIA 2DPPB 2K5IA 1UE9A 5GAN4 4XAXB 2ED1A 4M77B 3SHWA 2XU8A 3RMQA 2IIMA 2DFUA 1ZSZC 2CP5A 4HVWA 2DRMA 2EQUA 1Q81U 1R0CB 1OX8A 2RJDA 1OX9A 2VGMA 2H3JA 1J3TA 2EQJA 2M1HA 5LJ3d 1U1SA 5A0GA 1FYNA 3RIRA 4FW2A 3G4SQ 4B9WA 4C0ZA 5KH6A 3A8GB 4ZTFA 4JLIA 4C92F 2HD0A 1DJ7B 1I0CA 2XMFA 4M78F 2HBPA 2PUOB 1N27A 1D3BB 3ME9A 4OMMA 3OW2P 1KFZA 3JRZA 3TQ7P 5LJ5d 3QJYA 4XTXA 1PKSA 2OTLA 2KK4A 1YHQQ 3LLRA 2EYWA 4X1VA 1QKXA 2CZ6B 1QVFP 2QQAA 4JDSA 2J7IA 4PJOF 1CSKA 3DB4A 3GLXA 1M27C 1KQSA 4KH0B 4L5GA 3CCUT 3VKIA 2YHTA 2DK3A 2JW4A 3SWNA 1M3CA 1Q82R 4LXCA 4MDWA 4OMOA 1S72Q 2ESWA 1Y96B 1HK9A 5KE3A 4PJJA 4CRIA 1AEYA 1Z9ZA 2D1XA 1QP3A 2XHCA 3SFMA 3X20B 2SEMA 4C92C 4F7UE 1X75C 2KBTA 1G83A 3LWIA 2DXCA 4MMKA 2EIFA 1X6BA 5GAOl 4HCZA 2RK1A 4FSSA 3CCET 3JB9D 3REBB 4J5YA 1ABQA 5FRNA 4D6WA 4KUIA 3U23A 2AT1B 3MPUB 4II1A 4OGEA 4WF2A 3OYDA 3FDRA 4Z89A 4RCBA 4ELYC 1QVPA 3HP9A 4LDYA 3RKYA 4MZMA 3CC4A 1NJIC 2DD5A 2KQWA 4PFPA 5GMKi 4FW1A 2QG9B 5FWCA 2VGNA 3MCAB 1VQ4Q 3RESA 4Z88A 1HJDA 1XOVA 1VQOA 1OULA 2ZPEB 2DYBA 2MWPA 3CC7A 4ANJA 2LX7A 2DTHA 1WGSA 3EFSA 1K8AR 1HYOA 3A8OB 3UWNA 1YJNA 2K4YA 5CO7A 5CCAA 5GAMg 3MP8A 4M75B 3CCRA 1UGQB 3L2UA 1Y0MA 2DXBA 2X9HA 2YRCA 1AOJA 3GNGA 4EMHA 4OB1B 4X34A 2K2MA 1M1FA 2OJ2A 2AZVA 3EGXA 4L59A 2HMAA 4M78D 3G4ST 2M51A 2I0NA 3VYGA 2CS7A 4J8OA 3UF4A 2DVEA 2GTJA 3CBPA 2E4HA 3MP6A 3JCMh 3C12A 1R77A 3OYEA 2NLUA 5DLOA 4OF1A 2JMCA 2YRVA 3CPWS 2PU9B 3M4GA 1ZSGA 1K73C 2QAZA 2R58A 1K76A 3OS1A 3FIFA 4MZTA 8ATCB 4M7DF 2F1LA 3QWYA 3M0UA 4PL6A 1PNJA 1G3WA 4PJOD 1WXTA 2QEXA 3MP1A 4ZTJA 1ZUUA 4HCCA 3L2QA 5IHNA 4LDUA 2MOXA 2MYSA 4D8KA 3VS6A 3CEYA 2FZKB 1WPYA 1YFNA 3JAME 3QJ6A 4RUGA 1I81A 3NTHA 1FX7A 5CIUA 4C0FA 5KYUA 2OTLQ 4C8QF 1RAIB 1N9SA 1S72T 2NYSA 3RR6A 1KD1U 3KXTA 4KGXB 1NZ9A 1KHCA 3GF5A 5KYWA 3SDZA 3BY7A 4JRKA 1VQPT 4JS4A 1UGPB 4J7FA 4RCCA 4RTYA 2D6FA 4B9XA 1NEGA 1M3BA 2R57A 4OB2B 4J83A 3QYHB 4QQ6A 5LJ3g 1WYXA 2K9GA 2JVVA 2LX9A 1Q81C 4J6XA 2QASA 4M7DC 1VQ5Q 1RLPC 4CC2A 3TU4K 1YJWT 4F7UB 1ZHIA 1PCXA 1FXXA 2DJZA 2VB6A 2V8IA 2OI3A 1LCKA 4M4ZA 3L2WA 2Y90A 4ZGEB 5LJ5g 3PNWC 2LQ8A 1IGUA 3I5RA 2RA2A 3WVDB 3O8VA 1X69A 4HKEA 3E9FA 1LVKA 1MHNA 1QCOA 2E5KA 2KRNA 1MMAA 4C8QC 3NTKA 4F7UG 2LTOA 4WTOB 2RO0A 3NHNA 4HXJA 1SHGA 1PWTA 2AZSA 3FRNA 3BE3A 1JJ2P 2A0FB 3LYIA 2RQUA 1MMGA 2ROLA 4AFSC 1GCPA 3I5SA 3CC4Q 2NUZA 3A98A 4OMLA 4IKFA 5J39A 4M7AC 3EGDA 5GANj 2P0PA 3V7SA 1WQ7A 4K11A 1O75A 2HZYA 1C6VX 1VQOQ 3H6ZA 2L3PA 3OBYA 3CMEA 2KMTA 3CC7Q 4GBQA 4XU2A 2VUBA 4BE0A 2KNBB 2E1HA 1YJNQ 4TVRA 3M0QA 1YJ9Q 3CCRQ 4M7DD 1UGVA 3C94A 2E6NA 2JXBA 4BDYA 1N8RR 2RD1A 5I11A 4M77E 2GNCA 2RQRA 4J9HA 4EMKA 1ZLMA 2EYQA 3QHSA 2LZ6B 1VQ8T 2J6FA 1BU1A 2LVMA 2PQWA 1TG0A 3PMIA 2LC4A 1SRLA 1UEBA 2FPFA 2K2VA 1VYVA 4C8QD 4E47A 2BKDN 2A7YA 3VV0A 2C06A 1WIEA 1IO6A 1IGQA 4ORZA 3JB9J 2LMJA 2QEXQ 4RG8A 2O4XB 4RKUE 4RMOA 2H3EB 2QI2A 3TSWA 1IXDA 3FJPA 2EQIA 1B34A 2XD0A 2IG0A 2RPNA 1YHQA 4PLLA 3M53A 2YDLA 4ESRA 3G1JA 3SB2A 4M78A 2P4RA 2GF7A 2ZCFB 3Q1JA 1OPLA 5GANe 2HKNA 2DL3A 4C5GA 2YLBA 1Y57A 4J9DA 5DY9A 3H8ZA 1LPLA 1RAFB 3MEAA 4ELZC 3O5ZA 1MMDA 2KXDA 3H0IA 3CCMQ 4BY6C 2QYZA 4BB7A 1NPRA 1K4US 1V76A 4PJOA 3OYCA 1PHTA 2E65A 4PJMA 1QVGS 2AIRB 5GMKm 4DEXA 3JCMW 2EYZA 2FL7A 3REAB 3CCQA 4C0DC 3G71A 3AT1B 4XTWA 1QKWA 4LE9A 1AZGB 3VS3A 1GCQC 2O31A 1K8AU 3RKWA 2GQIA 1QVFA 4XU1A 5A0LA 5GAOn 1GBQA 3CCSA 2HQHA 2M9UA 4C5IA 3CCJQ 1SF9A 1X6GA 5CKFA 1RL2A 2E3IA 3V8LA 2XK0A 2HL3A 2C0TA 2FO0A 4CC7A 1YWPA 3CC4T 1I4K1 3X26B 3KBGA 2KT1A 3CCVA 2DL8A 2IVWA 5GAMf 2LCCA 1YCYA 4M77C 4XTVA 5GANd 4JRQA 1KD1R 1MUZA 4FT4A 2YSQA 2K5LA 4FL6A 3EGXB 3THKA 3CXCA 3QDFA 2MF2A 3QZ5B 2E41A 2P0KA 5FU7B 3VS1A 5KYNA 3TVTA 1VQOT 2XKOC 2DNUA 3CBOA 4HT8A 5LJ3e 1KD1C 5KCOA 3PTAA 4ATOA 2LJ1A 2KAFA 1N9RA 3JCMc 3J7AF 4QQDA 1QMCA 5I2SA 3VRZA 1YJNT 2BZ8A 2VXFA 4CC3A 3JV3A 3PVLA 3CCRT 4BI4A 5IXBA 2EGEA 3A8MB 6AT1B 3LX7A 1QLYA 1WNLA 3A8LB 2E70A 1MV0B 3G7ZA 4FM4B 5FW9A 3VS7A 2JJ9A 2CSIA 2CT4A 1M8VA 2LT1A 2JS2A 1VIFA 2FYKA 2DIGA 2XDBA 1BK2A 3CMAA 3OYHA 4Q5WA 1Y07A 4N4HA 4M78E 1MNDA 2EJ9A 2O88A 2RK2A 1C0MA 4BI3A 2RJCA 2CDTA 2JM9A 2XDDA 2DTIA 4DQ2A 3CQTA 3EH1A 1JBMA 4IUPA 4J9BA 1W70A 1A0NB 2XIDA 5KYWB 2QEXT 1YP5A 5AYFA 1T0HA 3HRTA 3M0RA 4BE2A 3VS2A 2QK0A 4O5VA 3VUZA 5CKDA 3ZL7C 4DBHA 3OYAA 3GOXA 4PJOE 4AMCA 4M77G 2CZ0B 4RTUA 4R0KA 3RUXA 2QDYB 1UTIA 4KBMB 2P84A 4JLGA 1IREB 5CR2A 5LJ3f 4AG1C 1B7TA 2FG0A 1I8FA 2XG8D 1Q86R 2HCKA 4M7DA 2LRQA 1NE8A 2GFUA 1BB9A 1OEBA 3KUFA 2GBQA 5GMKh 2QQRA 2L89A 2X4WA 2JZ2A 1RABB 5IHIA 4LUEA 1YIJT 1VQ9A 2FZGB 2VYTA 4OP0A 2MCNA 4KH1B 3T9NA 4MZPA 1YBYA 1SRMA 1BI3A 5LJ5f 2DXUA 1UFFA 1WJSA 1OZ2A 4C0GA 3OSVA 1UECA 1U8RA 2VWFA 4E7ZA 4EIKA 1S1NA 4QQGA 4C8QA 2FRYA 3UA7A 1VOMA 1ZX6A 1JXMA 1WJRA 2L5QA 4FYWB 2X35A 1VIEA 3ZFJA 2CP3A 3CXCP 2X3XD 3X28B 1Q82C 2FPEA 1VQ5A 5J3BA 2RF0A 3QXEB 2OTJQ 3EGDB 3EG3A 3VS0A 3CCQQ 3G71Q 1U3OA 1T3SA 4A4KA 1M8MA 2O9SA 1PG5B 4JJNK 2X4YA 5M9OA 3QBYA 2QQSA 1K1ZA 1TOVA 4WCIA 3CCSQ 4YTLA 4JRPA 4M75C 3QZ9B 1CKBA 1OQKA 5GJWB 4KRTA 2RJEA 3ASKA 2DKGA 4J7IA 2DBMA 7AT1B 2WSCE 5KCHA 1N8RU 4DBRA 5IHKA 4PFOA 1YITA 3HSBA 3CCVQ 2D0QB 1VQKA 2JTEA 3FC3A 1UDLA 2QGFB 3GNFB 4L6V5 2LQKA 3LH0A 3C95A 4EMKB 3JB9G 1X2KA 3BW1A 3WXMB 1OZ3A 2QQ9A 3L1AA 1WQWA 2HSPA 1T3LA 3S6WA 1K9MU 1VYUA 2AK5A 5LL6S 3CMET 2D0NA 3PT9A 1BCOA 2LCSA 5EG2A 1PRLC 3HFOA 2GQVA 3CCLA 2RQTA 4F7UF 1TH7A 2EFIA 4HCKA 3QKJA 1W2BS 3E9GA 3M0SA 2L3SA 4BACA 3MKDA 2V1QA 4DOVA 1YJ9A 2CP0A 4UC4A 2DMOA 1RADB 1B34B 3NPFA 2XI9A 1K8AC 1JJ2A 2G6FX 2QDLA 1M4ZA 3OW2S 1ARKA 4FT2A 1M90U 4C92D 1D0ZA 1NYFA 1AWWA 3UDCA 5KYYA 4M78B 3CMAQ 4QVCA 5GANg 2M0OA 2DXTA 5GAMh 5D6YA 3PGGA 3JCMg 4M75G 4R56A 2J05A 2RI3A 1KSWA 1Z9QA 1PD1A 2A08A 2JTFA 4PJOB 1XQHA 4M78G 3ZEHA 1YHQT 3E1SA 5GAN8 3JCMP 3KFVA 4N0AA 1BI2A 5IXFA 3FEOA 1B3QA 1BI1A 1D0XA 3F70A 4DBFA 4MMLA 4PJOG 5GAOr 4GLKA 4FCYA 3I56A 4Y92A 4DBQA 5KYXB 1HD3A 1VQ9Q 2L2PA 2AKKA 2DVJA 3EFOB 1M3AA 5C6SA 4E7JA 3CCMA 3EG9A 3OYFA 3VUBA 2EYYA 4KULA 4PJLA 1TUCA 2LNHB 4M7AF 4QVDA 1UB4A 2DTOA 1RAGB 3RNJA 3OSSC 2E6ZA 2H8HA 3JCMQ 1G3YA 3VS5A 4IUTA 4EPCA 4AFQC 3L42A 3ULRB 4J9GA 3TCJA 4JPBW 2EGAA 3L2RA 2WSEE 2MI6A 4KT0E 2K3XA 3MO8A 3CCJA 5LJ3h 1SHFA 2FRWA 3MHXA 3INZA 5GMKl 3M9QA 3CCVT 1TU0B 1X43A 4GY5A 1EIFA 1VQ7A 4FYVB 2R5MA 5GAOm 1ZA2B 3OMGA 1NPPA 2COYA 2ZPIB 3OYYA 3EHRA 1D3BA 2KVQG 2CP2A 1VQ4T 3NMZC 1WI7A 1YITQ 5LJ5h 3CPFA 1KC8R 2F2WA 1VQKQ 2LJ0A 3OS0A 1QCFA 4LD6A 3UPUA 2D9TA 1KK7A 4PJNA 3M58A 1ZSZA 2GTOA 3CBMA 2ENMA 2KE9A 3A5ZB 1FWZA 1OYXA 1KQSS 2RN8A 1QVGP 3CCLQ 1H641 2CH4W 1NBEB 1Q86U 3FB9A 3FJ5A 2DL5A 1ZQ1A 5D7UA 1WHJA 4ME7A 1LJOA 4RTZA 5FU6B 1WZOA 2RHIA 2F69A 1LOJA 2CGHA 2JUFA 5IH2A 2O01E 1MNEA 2K7AA 4N4IA 2ZZDA 1UGSB 2L0AA 4A54A 3L2VA 1YI2Q 2VVKA 2IPOB 3NGPA 3WVEB 1TXQA 2EWNA 2K5FA 2CREA 3MEWA 4NOYA 3MEUA 1BKBA 4E2FB 5FRMA 2CKKA 1N8RC 3V8JA 5EC7A 1SSHA 3X24B 3TREA 4ZGJB 3SWNB 1X6OA 3EG1A 2JN0A 1K9MR 1IHWA 2A37A 2DE0X 5AT1B 2W0ZA 5C0MA 3PE0A 5IN1A 3OYIA 3V8KA 1VQMA 1W6XA 4CC4B 2V26A 2X51A 2OTLT 1M9SA 4F17A 2ZAEA 2ZPHB 3M0TA 3EHQA 1G8XA 1Y71A 4M7AD 2KSSA 1D09B 3EAEA 4E6RA 2KR3A 4OB3B 1U06A 4C92A 1PD0A 4NL3A 4XTYA 1D1AA 4A4HA 4M77F 3QYGB 4OMPA 3I56Q 1M90R 1BI0A 2DYIA 3OS2A 1UHCA 4HCBA 4VUBA 1VQLA 3GBQA 4J6WA 3JCMe 3IQLA 1IB8A 3H41A 1M90C 1VQ5T 3RERA 2KI7A 5GAN5 5FU7C 2COZA 2EBPA 3QG1A 4JS5A 2CSQA
chains in the Genus database with same CATH topology
2KXCA 2LX7A 4RTUA 4QT7A 4R0KA 1UTIA 2AKLA 4ZNXA 1WLPB 4AG1C 1AWOA 2FG0A 4JJBA 1VA7A 2EGCA 1Y0MA 2HCKA 2CUBA 1AOJA 4Z8AA 1BB9A 1OEBA 1FMKA 2K2MA 2GBQA 2YT6A 2OJ2A 2EKHA 2AZVA 5IHIA 1PKTA 1WDXA 2BTTA 4LUEA 2HBWA 2M51A 2I0NA 3UF4A 2MCNA 1GFCA 1JXOA 2GTJA 1KIKA 1SRMA 1OV3A 1KJWA 2NWMA 2RQVA 1UFFA 1WA7A 4JJDA 1JO8A 2JMCA 1UECA 1ZSGA 1K76A 2VWFA 1RLQC 4AFUC 4EIKA 1G2BA 1S1NA 3PVQA 2FRYA 3UA7A 1JEGA 4JZ4A 1ZX6A 4RTWA 2YUNA 3QWYA 3M0UA 1PNJA 1JXMA 1WXTA 1YNZA 1BBZA 2JMAA 1ZUUA 2KRSA 2X3XD 2BZYA 2FPEA 4JJCA 5IHNA 2MOXA 2RF0A 4D8KA 3EG3A 3VS0A 3VS6A 2KGTA 1AWXA 5GJVB 1U3OA 1T3SA 1M8MA 2O9SA 2CH4A 2YUQA 1AWJA 1ZBJA 2FPDA 4RUGA 2J6OA 1AVZC 4WCIA 1K1ZA 1YN8A 4LUDA 1GL5A 1CKBA 5GJWB 4KRTA 1E7OA 5I22A 2YUPA 4HVUA 1RUWA 1AZEA 2DLPA 1GBRA 2DBMA 2DILA 3RBBB 5IHKA 1WXBA 2PNIA 4RTYA 1YWOA 2O2OA 2V1RA 2JTEA 1NEGA 1M3BA 1UDLA 2RMOA 1JQQA 1X2KA 1WYXA 4F16A 2K9GA 2HSPA 1T3LA 1VYUA 4IIMA 2AK5A 1RLPC 1UJ0A 4CC2A 2D0NA 3R6NA 1SPKA 2LQWA 2LCSA 1PRLC 2CT3A 1HSQA 2DM1A 4RTTA 1UG1A 2RQTA 2OI3A 1UUEA 3VS4A 1LCKA 4M4ZA 4HCKA 2K6DA 2CUDA 3M0SA 4J9FA 3I5RA 1X69A 2L3SA 1ABOA 4DEYA 2A36A 2V1QA 2JM8A 2EVRA 2E5KA 2DMOA 1U5SA 1WFWA 2KRNA 2EPDA 2KYBA 3NPFA 1UJYA 2G6FX 2QDLA 3NHNA 3QWXX 4HXJA 1SHGA 1PWTA 2AZSA 4OMQA 1ARKA 1RI9A 1X2QA 4A63B 4RTXA 5L23A 1NYFA 2PTKA 2ROLA 2RQUA 1AWWA 4D8DA 4AFSC 1GCPA 2B86A 2W10A 4J9CA 3I5SA 2NUZA 1GRIA 2A28A 3A98A 4OMLA 3TSZA 1NM7A 4LN2A 4GLMA 4K11A 2J05A 2PZ1A 2C0IA 1KSWA 4LNPA 5FWBA 1Z9QA 2VKNA 1N5ZA 1VYTA 1H8KA 2A08A 2DRKA 2HDAA 4AFZC 2L3PA 2DBKA 3I9QA 2J06A 4GBQA 3KFVA 3EG2A 1GFDA 1WXUA 4J9IA 5IXFA 2KNBB 1TUDA 2KT8A 2EYXA 1K0SA 1EFNA 1B3QA 3M0QA 1NYGA 1SEMA 1UGVA 4AG2C 2K79A 1T0JA 2JXBA 2KYMA 5ECAA 2LP5A 5I11A 2GNCA 2M0YA 2RQRA 4J9HA 2DX1A 1ZLMA 4Y92A 2ABLA 4RTVA 2LZ6B 1HD3A 2L2PA 1NG2A 2J6FA 2AKKA 2JT4A 2DVJA 1M3AA 1CKAA 2DL7A 2O9VA 1BU1A 2KRMA 2D8JA 1TG0A 3VRYA 4JZ3A 2DA9A 1OPKA 1ZUKA 2EYYA 1SRLA 1PRMC 1OOTA 2FPFA 1VYVA 2RNAA 1TUCA 2LNHB 2F2VA 3RNJA 2L3QA 1WIEA 1IO6A 2H8HA 4ORZA 3VS5A 4AFQC 2LMJA 1K9AA 2KEAA 3ULRB 1H3HA 4OMNA 4J9GA 2J6KA 3TSWA 4JPBW 2EGAA 2F2XA 2LJ3A 2EQIA 3UA6A 2HEQA 1E6GA 2RPNA 1AD5A 2ECZA 4J9EA 2YDLA 1UE9A 4ESRA 1SHFA 2FRWA 3SHWA 2ED1A 2IIMA 1X43A 2P4RA 4HVWA 1UHFA 2DRMA 2OAWA 2RQWA 1OPLA 2ROTA 2SRCA 2DL3A 3EHRA 1Y57A 4J9DA 1X27A 1J3TA 1NLOC 3O5ZA 2KXDA 3H0IA 3NMZC 1WI7A 1M30A 1FYNA 1K4US 2DJQA 1NEBA 1PHTA 2F2WA 1H92A 2LJ0A 4IIOA 1QCFA 4DEXA 1I0CA 2XMFA 3UATA 2EYZA 3REAB 2GTOA 1QKWA 1QWFA 2ENMA 4LE9A 4OMMA 2KE9A 1KFZA 1AZGB 3VS3A 1GCQC 2O31A 1E6HA 2GGRA 2GQIA 2RN8A 1PKSA 1GBQA 2EYWA 4X1VA 1QKXA 3H0HA 1X6GA 2CH4W 2J7IA 1CSKA 3FJ5A 2DL5A 1M27C 2C0TA 2FO0A 4CC7A 1YWPA 4RTZA 1NLPC 2KT1A 2JW4A 1M3CA 2DL8A 4F14A 5IH2A 2K7AA 3LH5A 1MUZA 2YSQA 4OMOA 2L0AA 1GCQA 3THKA 2ESWA 2VVKA 3NGPA 3VS1A 4HVVA 3TVTA 2BZXA 2CREA 2DNUA 3SEMA 1AEYA 2DL4A 1QWEA 1Z9ZA 2LJ1A 5EC7A 2D1XA 1SSHA 2SEMA 3M0PA 3VRZA 2BZ8A 3EG1A 2KBTA 1G83A 4CC3A 3JV3A 3PVLA 1B07A 1JU5C 2A37A 2DE0X 5IXBA 1I1JA 2W0ZA 1WX6A 2EGEA 1X6BA 1ZUYA 3PE0A 1QLYA 4FSSA 2ED0A 1MV0B 2KROA 3REBB 5FW9A 2MIOA 1W6XA 2LQNA 1ABQA 2EW3A 4CC4B 3U23A 4F17A 3M0TA 3VS7A 2YUOA 3EHQA 2CSIA 4Z89A 2CT4A 5HCKA 1W1FA 2FEIA 2JS2A 2C0OA 1BK2A 4E6RA 3EGUA 2KR3A 1U06A 2D8HA 2JS0A 1K0XA 2O88A 3C0CA 5FWCA 2CDTA 2JM9A 1V1CA 3I35A 4OMPA 1I07A 3CQTA 4J9BA 3H0FA 1UHCA 1W70A 1A0NB 2X3WD 4Z88A 1HJDA 1YP5A 1YCSB 3GBQA 1XOVA 3EG0A 1T0HA 3IQLA 2DF6A 3M0RA 3H41A 3VS2A 1MV3A 2DYBA 2EBPA 2K3BA 3ZL7C 2CSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXC A;  2LX7 A;  4RTU A;  4QT7 A;  4R0K A;  1UTI A;  2AKL A;  4ZNX A;  1WLP B;  4AG1 C;  1AWO A;  2FG0 A;  4JJB A;  1VA7 A;  2EGC A;  1Y0M A;  2HCK A;  2CUB A;  1AOJ A;  4Z8A A;  1BB9 A;  1OEB A;  1FMK A;  2K2M A;  2GBQ A;  2YT6 A;  2OJ2 A;  2EKH A;  2AZV A;  5IHI A;  1PKT A;  1WDX A;  2BTT A;  4LUE A;  2HBW A;  2M51 A;  2I0N A;  3UF4 A;  2MCN A;  1GFC A;  1JXO A;  2GTJ A;  1KIK A;  1SRM A;  1OV3 A;  1KJW A;  2NWM A;  2RQV A;  1UFF A;  1WA7 A;  4JJD A;  1JO8 A;  2JMC A;  1UEC A;  1ZSG A;  1K76 A;  2VWF A;  1RLQ C;  4AFU C;  4EIK A;  1G2B A;  1S1N A;  3PVQ A;  2FRY A;  3UA7 A;  1JEG A;  4JZ4 A;  1ZX6 A;  4RTW A;  2YUN A;  3QWY A;  3M0U A;  1PNJ A;  1JXM A;  1WXT A;  1YNZ A;  1BBZ A;  2JMA A;  1ZUU A;  2KRS A;  2X3X D;  2BZY A;  2FPE A;  4JJC A;  5IHN A;  2MOX A;  2RF0 A;  4D8K A;  3EG3 A;  3VS0 A;  3VS6 A;  2KGT A;  1AWX A;  5GJV B;  1U3O A;  1T3S A;  1M8M A;  2O9S A;  2CH4 A;  2YUQ A;  1AWJ A;  1ZBJ A;  2FPD A;  4RUG A;  2J6O A;  1AVZ C;  4WCI A;  1K1Z A;  1YN8 A;  4LUD A;  1GL5 A;  1CKB A;  5GJW B;  4KRT A;  1E7O A;  5I22 A;  2YUP A;  4HVU A;  1RUW A;  1AZE A;  2DLP A;  1GBR A;  2DBM A;  2DIL A;  3RBB B;  5IHK A;  1WXB A;  2PNI A;  4RTY A;  1YWO A;  2O2O A;  2V1R A;  2JTE A;  1NEG A;  1M3B A;  1UDL A;  2RMO A;  1JQQ A;  1X2K A;  1WYX A;  4F16 A;  2K9G A;  2HSP A;  1T3L A;  1VYU A;  4IIM A;  2AK5 A;  1RLP C;  1UJ0 A;  4CC2 A;  2D0N A;  3R6N A;  1SPK A;  2LQW A;  2LCS A;  1PRL C;  2CT3 A;  1HSQ A;  2DM1 A;  4RTT A;  1UG1 A;  2RQT A;  2OI3 A;  1UUE A;  3VS4 A;  1LCK A;  4M4Z A;  4HCK A;  2K6D A;  2CUD A;  3M0S A;  4J9F A;  3I5R A;  1X69 A;  2L3S A;  1ABO A;  4DEY A;  2A36 A;  2V1Q A;  2JM8 A;  2EVR A;  2E5K A;  2DMO A;  1U5S A;  1WFW A;  2KRN A;  2EPD A;  2KYB A;  3NPF A;  1UJY A;  2G6F X;  2QDL A;  3NHN A;  3QWX X;  4HXJ A;  1SHG A;  1PWT A;  2AZS A;  4OMQ A;  1ARK A;  1RI9 A;  1X2Q A;  4A63 B;  4RTX A;  5L23 A;  1NYF A;  2PTK A;  2ROL A;  2RQU A;  1AWW A;  4D8D A;  4AFS C;  1GCP A;  2B86 A;  2W10 A;  4J9C A;  3I5S A;  2NUZ A;  1GRI A;  2A28 A;  3A98 A;  4OML A;  3TSZ A;  1NM7 A;  4LN2 A;  4GLM A;  4K11 A;  2J05 A;  2PZ1 A;  2C0I A;  1KSW A;  4LNP A;  5FWB A;  1Z9Q A;  2VKN A;  1N5Z A;  1VYT A;  1H8K A;  2A08 A;  2DRK A;  2HDA A;  4AFZ C;  2L3P A;  2DBK A;  3I9Q A;  2J06 A;  4GBQ A;  3KFV A;  3EG2 A;  1GFD A;  1WXU A;  4J9I A;  5IXF A;  2KNB B;  1TUD A;  2KT8 A;  2EYX A;  1K0S A;  1EFN A;  1B3Q A;  3M0Q A;  1NYG A;  1SEM A;  1UGV A;  4AG2 C;  2K79 A;  1T0J A;  2JXB A;  2KYM A;  5ECA A;  2LP5 A;  5I11 A;  2GNC A;  2M0Y A;  2RQR A;  4J9H A;  2DX1 A;  1ZLM A;  4Y92 A;  2ABL A;  4RTV A;  2LZ6 B;  1HD3 A;  2L2P A;  1NG2 A;  2J6F A;  2AKK A;  2JT4 A;  2DVJ A;  1M3A A;  1CKA A;  2DL7 A;  2O9V A;  1BU1 A;  2KRM A;  2D8J A;  1TG0 A;  3VRY A;  4JZ3 A;  2DA9 A;  1OPK A;  1ZUK A;  2EYY A;  1SRL A;  1PRM C;  1OOT A;  2FPF A;  1VYV A;  2RNA A;  1TUC A;  2LNH B;  2F2V A;  3RNJ A;  2L3Q A;  1WIE A;  1IO6 A;  2H8H A;  4ORZ A;  3VS5 A;  4AFQ C;  2LMJ A;  1K9A A;  2KEA A;  3ULR B;  1H3H A;  4OMN A;  4J9G A;  2J6K A;  3TSW A;  4JPB W;  2EGA A;  2F2X A;  2LJ3 A;  2EQI A;  3UA6 A;  2HEQ A;  1E6G A;  2RPN A;  1AD5 A;  2ECZ A;  4J9E A;  2YDL A;  1UE9 A;  4ESR A;  1SHF A;  2FRW A;  3SHW A;  2ED1 A;  2IIM A;  1X43 A;  2P4R A;  4HVW A;  1UHF A;  2DRM A;  2OAW A;  2RQW A;  1OPL A;  2ROT A;  2SRC A;  2DL3 A;  3EHR A;  1Y57 A;  4J9D A;  1X27 A;  1J3T A;  1NLO C;  3O5Z A;  2KXD A;  3H0I A;  3NMZ C;  1WI7 A;  1M30 A;  1FYN A;  1K4U S;  2DJQ A;  1NEB A;  1PHT A;  2F2W A;  1H92 A;  2LJ0 A;  4IIO A;  1QCF A;  4DEX A;  1I0C A;  2XMF A;  3UAT A;  2EYZ A;  3REA B;  2GTO A;  1QKW A;  1QWF A;  2ENM A;  4LE9 A;  4OMM A;  2KE9 A;  1KFZ A;  1AZG B;  3VS3 A;  1GCQ C;  2O31 A;  1E6H A;  2GGR A;  2GQI A;  2RN8 A;  1PKS A;  1GBQ A;  2EYW A;  4X1V A;  1QKX A;  3H0H A;  1X6G A;  2CH4 W;  2J7I A;  1CSK A;  3FJ5 A;  2DL5 A;  1M27 C;  2C0T A;  2FO0 A;  4CC7 A;  1YWP A;  4RTZ A;  1NLP C;  2KT1 A;  2JW4 A;  1M3C A;  2DL8 A;  4F14 A;  5IH2 A;  2K7A A;  3LH5 A;  1MUZ A;  2YSQ A;  4OMO A;  2L0A A;  1GCQ A;  3THK A;  2ESW A;  2VVK A;  3NGP A;  3VS1 A;  4HVV A;  3TVT A;  2BZX A;  2CRE A;  2DNU A;  3SEM A;  1AEY A;  2DL4 A;  1QWE A;  1Z9Z A;  2LJ1 A;  5EC7 A;  2D1X A;  1SSH A;  2SEM A;  3M0P A;  3VRZ A;  2BZ8 A;  3EG1 A;  2KBT A;  1G83 A;  4CC3 A;  3JV3 A;  3PVL A;  1B07 A;  1JU5 C;  2A37 A;  2DE0 X;  5IXB A;  1I1J A;  2W0Z A;  1WX6 A;  2EGE A;  1X6B A;  1ZUY A;  3PE0 A;  1QLY A;  4FSS A;  2ED0 A;  1MV0 B;  2KRO A;  3REB B;  5FW9 A;  2MIO A;  1W6X A;  2LQN A;  1ABQ A;  2EW3 A;  4CC4 B;  3U23 A;  4F17 A;  3M0T A;  3VS7 A;  2YUO A;  3EHQ A;  2CSI A;  4Z89 A;  2CT4 A;  5HCK A;  1W1F A;  2FEI A;  2JS2 A;  2C0O A;  1BK2 A;  4E6R A;  3EGU A;  2KR3 A;  1U06 A;  2D8H A;  2JS0 A;  1K0X A;  2O88 A;  3C0C A;  5FWC A;  2CDT A;  2JM9 A;  1V1C A;  3I35 A;  4OMP A;  1I07 A;  3CQT A;  4J9B A;  3H0F A;  1UHC A;  1W70 A;  1A0N B;  2X3W D;  4Z88 A;  1HJD A;  1YP5 A;  1YCS B;  3GBQ A;  1XOV A;  3EG0 A;  1T0H A;  3IQL A;  2DF6 A;  3M0R A;  3H41 A;  3VS2 A;  1MV3 A;  2DYB A;  2EBP A;  2K3B A;  3ZL7 C;  2CSQ A; 
#chains in the Genus database with same CATH topology
 2KXC A;  1NJI U;  1F1B B;  4XK8 E;  3VJP A;  2OTJ A;  1EZZ B;  4OGC A;  4LD9 K;  1WLP B;  3JB9 H;  1AWO A;  2R5A A;  5A0D A;  4JJB A;  1MGQ A;  5KE2 A;  2E10 A;  3M4Y A;  1PSE A;  2CUB A;  4CI0 C;  2GFA A;  2RHZ A;  4Z8A A;  1AHJ B;  1D0Y A;  2YT6 A;  1OI1 A;  1BIA A;  2F5T X;  2MWO A;  4FYX B;  2BTT A;  1TUG B;  1YIT T;  3LGL A;  1JXO A;  1VQK T;  1VQ7 Q;  1OV3 A;  2NWM A;  3J81 E;  2JOY A;  1M1G A;  1RLQ C;  3PVQ A;  4EMG A;  1JEG A;  1O9S A;  4PKC C;  4E7K A;  2XIC A;  4JZ4 A;  3LW5 E;  3CPW A;  3JCM d;  1BBZ A;  1RAH B;  2PUK B;  2JMA A;  2QGG A;  3NTI A;  2BZY A;  3CCL T;  2E5Q A;  5GAN f;  2BE9 B;  3CC7 T;  3JCM X;  2X4X A;  2KGT A;  3OYB A;  1AWX A;  3MET A;  3C4S A;  2CH4 A;  4MDX A;  3CCE Q;  1YJ9 T;  1AWJ A;  3L2Z A;  2FPD A;  3NFC A;  1AT1 B;  2J6O A;  1AVZ C;  1JB0 E;  3OYM A;  1GL5 A;  5CQY A;  5I22 A;  3OYL A;  3BDU A;  3JB9 F;  1RUW A;  5HK3 A;  1AZE A;  2DLP A;  5HKC A;  2DIL A;  3RBB B;  5I21 A;  3DB3 A;  5DM7 R;  3CC2 A;  5IT9 E;  2V1R A;  2YWW A;  1WHL A;  4JRI A;  4C92 E;  1V29 B;  2EJF A;  2RMO A;  5KYU B;  3CD6 A;  4LDX A;  5CAI A;  1M2V A;  3LGF A;  3HTR A;  3JCM b;  3OBW A;  4E7L A;  3OY9 A;  5L8R E;  2EJG A;  3MEV A;  1UJ0 A;  3R6N A;  3EG9 B;  1X01 A;  2WAC A;  1Q7Y U;  1LNX A;  2CT3 A;  1HSQ A;  1FMW A;  3G6E A;  5IAY A;  3PIO A;  4P5N A;  4M77 D;  4J9F A;  5GAO p;  3OS5 A;  4QW2 A;  4PK4 A;  4R55 A;  4FU6 A;  1ABO A;  2A36 A;  1VQ6 A;  2ATC B;  2JM8 A;  4BE1 A;  1VQM Q;  2EVR A;  4XQ3 A;  1U5S A;  1WFW A;  3I56 T;  5FLX E;  2EPD A;  2JNG A;  3JB9 I;  4M75 F;  4ZGD B;  1ACM B;  1UJY A;  1VQ8 A;  4X9D A;  2L8D A;  1M5Q 1;  1W2B P;  4A63 B;  3TEE A;  1XTD A;  5L23 A;  3CCM T;  4J6Y A;  2B86 A;  1Q86 C;  2DD4 A;  4J9C A;  2A3L A;  4KGV B;  1GRI A;  2A28 A;  2P0Q A;  3N5B B;  2L3R A;  2MMP A;  4QVZ A;  2DET A;  3X25 B;  2Y4X A;  1KC8 U;  4LNP A;  5FWB A;  1VQL Q;  1P92 A;  3R6O A;  1N5Z A;  4EMK C;  1H8K A;  1G3T A;  2Y4Y A;  2LNV A;  2DAQ A;  1IZ6 A;  2PVD B;  2E12 A;  4AFZ C;  3GP8 A;  2ZGW A;  1EX4 A;  3OYG A;  3LWH A;  1WXU A;  3CCJ T;  2MAM A;  3M59 A;  3CPW P;  1ZSZ B;  1TUD A;  2M16 A;  2EYX A;  1EFN A;  1NYG A;  1SEM A;  1VQ7 T;  4M7A A;  1QP2 A;  2DER A;  2OX7 A;  2K79 A;  2CZ1 B;  2KYM A;  1SG5 A;  2LP5 A;  1C1A A;  2DX1 A;  3I55 A;  3H9N A;  2ABL A;  4RTV A;  1I5L A;  1MMN A;  2O4X A;  3HRS A;  4ZN3 A;  1VQP Q;  2RI2 A;  1CKA A;  2X4J A;  3OQ5 A;  2KRM A;  3VRY A;  4JZ3 A;  4PFZ A;  4IUR A;  2DA9 A;  4BDZ A;  3S3M A;  3QII A;  3RMS A;  8AT1 B;  4M78 C;  3QDR B;  1TWB A;  2Z0W A;  2FB7 A;  3GIB A;  2OAU A;  4ZN1 A;  2EQK A;  3JCM J;  2P4T A;  2VC8 A;  1PM3 A;  1WHK A;  2KEA A;  1PSF A;  1H3H A;  4Y91 A;  1YJW Q;  4OMN A;  2QA4 A;  4PNO A;  1NJI R;  2CZ7 B;  3VYH B;  3UA6 A;  2V8K A;  2CP6 A;  2MK5 A;  4PJO C;  1W4S A;  1AD5 A;  2ECZ A;  3QO3 A;  2BE7 D;  3A8H B;  4HA8 A;  4Y28 E;  3PMT A;  4N4G A;  2FHD A;  3URG A;  2KY9 A;  1UHF A;  2OAW A;  1R8O B;  2RQW A;  2ROT A;  2SRC A;  3QSU A;  1OU8 A;  1ZBX A;  4LDW A;  1X27 A;  1R0B G;  4OMF B;  1NLO C;  2BIV A;  2YLC A;  2ZPG B;  4M7D E;  1H3Z A;  1M30 A;  3JSC A;  5HK0 A;  1YI2 A;  4C92 B;  3CC2 Q;  3VU3 C;  2DJQ A;  5CKB A;  1NEB A;  2HQE A;  1H92 A;  4IIO A;  2VAS A;  1QVF S;  3HKS A;  5GMK j;  3UAT A;  3CD6 Q;  1D1B A;  2PVO B;  4M75 D;  2RJF A;  1VQN A;  1QWF A;  1QVG A;  2PVG B;  1VQM T;  1RI0 A;  5D6X A;  1E6H A;  1PC0 A;  2GGR A;  4C8Q E;  4C92 G;  2QQB A;  3AHU A;  3A1P A;  5GAN h;  1M1K U;  3G6E Q;  3H0H A;  2COW A;  1K73 R;  1RAC B;  3DLM A;  2DEQ A;  3CXC S;  1NLP C;  2RB6 A;  1VQ6 Q;  1KQS P;  3HRU A;  4V2S A;  5CVI A;  4M7A E;  4F14 A;  2EQM A;  1SKU B;  1D1C A;  2QTX A;  3LH5 A;  3ZBD A;  4XU0 A;  1VQ8 Q;  1G5V A;  2NUT A;  1GCQ A;  1VQL T;  3RDV A;  4NL2 A;  4EDU A;  4C5E A;  2HKQ B;  4HVV A;  2BZX A;  3SEM A;  2DL4 A;  3ER0 A;  4Z02 A;  5GAO q;  1QWE A;  2DIQ A;  1GXI E;  3OMC A;  1G3S A;  2G3R A;  5D6W A;  3M0P A;  4XU3 A;  4A4F A;  1QQJ A;  2OTJ T;  2NUP A;  1B07 A;  1JU5 C;  3CCQ T;  1JRI A;  1I1J A;  3G71 T;  4M77 A;  1WX6 A;  1ZUY A;  1WHH A;  3D7S B;  2ED0 A;  3OB9 A;  1Q7Y R;  2FVU A;  2KRO A;  3QPH A;  5CKE A;  2I2L A;  2MIO A;  2LQN A;  2EW3 A;  3E2U A;  1QCN A;  3CCS T;  3DKM A;  4NS5 A;  2YUO A;  1YIJ A;  1Q7Y C;  5HCK A;  1W1F A;  2FEI A;  2C0O A;  1Q81 R;  1KQ2 A;  2DO3 A;  4X9C A;  1ZA1 B;  3EGU A;  1WHG A;  2D8H A;  2CYZ B;  2JS0 A;  1K0X A;  1Y7X A;  4IUV A;  3CCU A;  3C0C A;  5GMK e;  3M56 A;  5I2M A;  1OU9 A;  1V1C A;  3I35 A;  1BIB A;  1I07 A;  5FU6 C;  3I55 Q;  3GPL A;  3H0F A;  2X3W D;  1YCS B;  3EG0 A;  5CKH A;  3SD4 A;  2DF6 A;  5CQX A;  1MV3 A;  4E7S A;  2K3B A;  3HHT B;  2E3H A;  3QUI A;  2HQX A;  2VV5 A;  4QT7 A;  5GAN 7;  1WHM A;  1M2V B;  2AKL A;  1Q95 G;  1KQ1 A;  3PFS A;  4ZNX A;  2K57 A;  3SWN C;  1TSF A;  3OYK A;  1VA7 A;  2EGC A;  1KC8 C;  2DZ9 A;  2QA4 Q;  2ZPB B;  5GAM j;  3CCE A;  1FMK A;  4BD3 A;  3EFR A;  2EKH A;  1PKT A;  1WDX A;  3UT1 A;  1Y96 A;  2HBW A;  1KHI A;  3CC2 T;  1GFC A;  1KIK A;  3CMA T;  1KJW A;  2RQV A;  2EKO A;  1WA7 A;  4JJD A;  2LCL A;  1JO8 A;  3CD6 T;  1BCM A;  2RH2 A;  4M7D B;  3M5A A;  4AFU C;  5J26 A;  1G2B A;  2F5K A;  5GAN 6;  2RI5 A;  5GAN 2;  4RTW A;  2YUN A;  2HAX A;  3MJX A;  1YNZ A;  3BFM A;  1I5O B;  4HT9 A;  2KRS A;  3G6E T;  4FYY B;  3OYN A;  1SSF A;  4JJC A;  2BUD A;  2HSE B;  5GJV B;  4M7D G;  2HL5 C;  1VQN Q;  1QW1 A;  4FSX A;  3DLL A;  1VQ6 T;  2YUQ A;  1ZBJ A;  4C8Q B;  3M54 A;  5CK9 A;  1YN8 A;  4LUD A;  4BUG A;  1E7O A;  1Q82 U;  2CP7 A;  2YUP A;  4HVU A;  1K9M C;  1GBR A;  2B8A A;  1VQ9 T;  1M2O A;  1FMV A;  3G4S A;  1WXB A;  2RM4 A;  4M7A B;  2PNI A;  3E19 A;  1YWO A;  2O2O A;  3P8D A;  4XTZ A;  4C8Q G;  4PLI A;  5A2Q E;  1JQQ A;  2E64 A;  4O6J A;  4QKU A;  4A4G A;  4F16 A;  1U1T A;  4B6M A;  3S3O A;  4RG2 A;  4JUV A;  1IRX A;  3FLG A;  4XTU A;  4M75 A;  5LJ3 j;  2LT4 A;  4DA4 A;  4IIM A;  5HY6 A;  5GAM e;  3OYJ A;  4KGZ B;  1SPK A;  2LQW A;  4M7A G;  2K3Y A;  3V7C A;  3BDL A;  2DM1 A;  2V8J A;  4RTT A;  1UG1 A;  1UUE A;  3VS4 A;  2K6D A;  2CUD A;  2RHX A;  4LDV A;  1JJ2 S;  3PIP A;  4DEY A;  1XNI A;  4KUD K;  5LJ5 j;  4A53 A;  1M1K R;  4IUQ A;  2WSF E;  3I55 T;  2KYB A;  5FRO A;  1W2B A;  4E7I A;  2AHJ B;  2M02 A;  3QWX X;  1YIJ Q;  1RAE B;  4A4E A;  2GCX A;  4OMQ A;  1S72 A;  1RI9 A;  1X2Q A;  3S3N A;  1M1K C;  2DZC A;  4RTX A;  4IUU A;  2PTK A;  4N0A C;  4D8D A;  4BI8 B;  2W10 A;  1WJQ A;  3CCU Q;  1VQP A;  5GAN 3;  3OW2 A;  3TSZ A;  4OVA A;  1NM7 A;  9ATC B;  4LN2 A;  4AT1 B;  2MPX C;  2QXF A;  2RHY A;  1TTH B;  2PZ1 A;  4GLM A;  2C0I A;  4C5H A;  3V7R A;  4DOW A;  3RKX A;  3HPW A;  2VKN A;  3M55 A;  1VYT A;  2QA4 T;  2DRK A;  4FIB A;  3P8B B;  5GAM d;  2QTV A;  2HDA A;  3J80 E;  2FZC B;  3P8H A;  3I9Q A;  2DBK A;  2ZPF B;  5KYX A;  5KYY B;  2J06 A;  1YJW A;  3EFO A;  3EG2 A;  1GFD A;  4J9I A;  4OB0 B;  2KT8 A;  2EAY A;  1K0S A;  4F04 B;  2XDP A;  1K73 U;  4AG2 C;  1VUB A;  3JCM f;  1T0J A;  5ECA A;  3OA6 A;  1IHV A;  4BY6 B;  2JTM A;  2M0Y A;  1VQ4 A;  4E7H A;  3M57 A;  1NG2 A;  2JT4 A;  1YI2 T;  2DL7 A;  2O9V A;  2D8J A;  2YRD A;  1OPK A;  1ZUK A;  4F7U A;  3EH2 A;  4C0D B;  1PRM C;  1OOT A;  3HFN A;  1UGR B;  2RNA A;  2NUT B;  2F2V A;  1VQN T;  2L3Q A;  2RHU A;  2LDM A;  2DEU A;  2KDS A;  5LJ5 e;  1RAA B;  1K9A A;  3CME Q;  3HL8 A;  2VXE A;  4M75 E;  1N6A A;  3JCM V;  2J6K A;  5DLQ E;  1KG1 A;  1TS9 A;  2F2X A;  2LJ3 A;  1XJW B;  1BYM A;  2HEQ A;  1HXD A;  1E6G A;  2YXY A;  4J9E A;  2NUP B;  2HNI A;  2DPP B;  2K5I A;  1UE9 A;  5GAN 4;  4XAX B;  2ED1 A;  4M77 B;  3SHW A;  2XU8 A;  3RMQ A;  2IIM A;  2DFU A;  1ZSZ C;  2CP5 A;  4HVW A;  2DRM A;  2EQU A;  1Q81 U;  1R0C B;  1OX8 A;  2RJD A;  1OX9 A;  2VGM A;  2H3J A;  1J3T A;  2EQJ A;  2M1H A;  5LJ3 d;  1U1S A;  5A0G A;  1FYN A;  3RIR A;  4FW2 A;  3G4S Q;  4B9W A;  4C0Z A;  5KH6 A;  3A8G B;  4ZTF A;  4JLI A;  4C92 F;  2HD0 A;  1DJ7 B;  1I0C A;  2XMF A;  4M78 F;  2HBP A;  2PUO B;  1N27 A;  1D3B B;  3ME9 A;  4OMM A;  3OW2 P;  1KFZ A;  3JRZ A;  3TQ7 P;  5LJ5 d;  3QJY A;  4XTX A;  1PKS A;  2OTL A;  2KK4 A;  1YHQ Q;  3LLR A;  2EYW A;  4X1V A;  1QKX A;  2CZ6 B;  1QVF P;  2QQA A;  4JDS A;  2J7I A;  4PJO F;  1CSK A;  3DB4 A;  3GLX A;  1M27 C;  1KQS A;  4KH0 B;  4L5G A;  3CCU T;  3VKI A;  2YHT A;  2DK3 A;  2JW4 A;  3SWN A;  1M3C A;  1Q82 R;  4LXC A;  4MDW A;  4OMO A;  1S72 Q;  2ESW A;  1Y96 B;  1HK9 A;  5KE3 A;  4PJJ A;  4CRI A;  1AEY A;  1Z9Z A;  2D1X A;  1QP3 A;  2XHC A;  3SFM A;  3X20 B;  2SEM A;  4C92 C;  4F7U E;  1X75 C;  2KBT A;  1G83 A;  3LWI A;  2DXC A;  4MMK A;  2EIF A;  1X6B A;  5GAO l;  4HCZ A;  2RK1 A;  4FSS A;  3CCE T;  3JB9 D;  3REB B;  4J5Y A;  1ABQ A;  5FRN A;  4D6W A;  4KUI A;  3U23 A;  2AT1 B;  3MPU B;  4II1 A;  4OGE A;  4WF2 A;  3OYD A;  3FDR A;  4Z89 A;  4RCB A;  4ELY C;  1QVP A;  3HP9 A;  4LDY A;  3RKY A;  4MZM A;  3CC4 A;  1NJI C;  2DD5 A;  2KQW A;  4PFP A;  5GMK i;  4FW1 A;  2QG9 B;  5FWC A;  2VGN A;  3MCA B;  1VQ4 Q;  3RES A;  4Z88 A;  1HJD A;  1XOV A;  1VQO A;  1OUL A;  2ZPE B;  2DYB A;  2MWP A;  3CC7 A;  4ANJ A;  2LX7 A;  2DTH A;  1WGS A;  3EFS A;  1K8A R;  1HYO A;  3A8O B;  3UWN A;  1YJN A;  2K4Y A;  5CO7 A;  5CCA A;  5GAM g;  3MP8 A;  4M75 B;  3CCR A;  1UGQ B;  3L2U A;  1Y0M A;  2DXB A;  2X9H A;  2YRC A;  1AOJ A;  3GNG A;  4EMH A;  4OB1 B;  4X34 A;  2K2M A;  1M1F A;  2OJ2 A;  2AZV A;  3EGX A;  4L59 A;  2HMA A;  4M78 D;  3G4S T;  2M51 A;  2I0N A;  3VYG A;  2CS7 A;  4J8O A;  3UF4 A;  2DVE A;  2GTJ A;  3CBP A;  2E4H A;  3MP6 A;  3JCM h;  3C12 A;  1R77 A;  3OYE A;  2NLU A;  5DLO A;  4OF1 A;  2JMC A;  2YRV A;  3CPW S;  2PU9 B;  3M4G A;  1ZSG A;  1K73 C;  2QAZ A;  2R58 A;  1K76 A;  3OS1 A;  3FIF A;  4MZT A;  8ATC B;  4M7D F;  2F1L A;  3QWY A;  3M0U A;  4PL6 A;  1PNJ A;  1G3W A;  4PJO D;  1WXT A;  2QEX A;  3MP1 A;  4ZTJ A;  1ZUU A;  4HCC A;  3L2Q A;  5IHN A;  4LDU A;  2MOX A;  2MYS A;  4D8K A;  3VS6 A;  3CEY A;  2FZK B;  1WPY A;  1YFN A;  3JAM E;  3QJ6 A;  4RUG A;  1I81 A;  3NTH A;  1FX7 A;  5CIU A;  4C0F A;  5KYU A;  2OTL Q;  4C8Q F;  1RAI B;  1N9S A;  1S72 T;  2NYS A;  3RR6 A;  1KD1 U;  3KXT A;  4KGX B;  1NZ9 A;  1KHC A;  3GF5 A;  5KYW A;  3SDZ A;  3BY7 A;  4JRK A;  1VQP T;  4JS4 A;  1UGP B;  4J7F A;  4RCC A;  4RTY A;  2D6F A;  4B9X A;  1NEG A;  1M3B A;  2R57 A;  4OB2 B;  4J83 A;  3QYH B;  4QQ6 A;  5LJ3 g;  1WYX A;  2K9G A;  2JVV A;  2LX9 A;  1Q81 C;  4J6X A;  2QAS A;  4M7D C;  1VQ5 Q;  1RLP C;  4CC2 A;  3TU4 K;  1YJW T;  4F7U B;  1ZHI A;  1PCX A;  1FXX A;  2DJZ A;  2VB6 A;  2V8I A;  2OI3 A;  1LCK A;  4M4Z A;  3L2W A;  2Y90 A;  4ZGE B;  5LJ5 g;  3PNW C;  2LQ8 A;  1IGU A;  3I5R A;  2RA2 A;  3WVD B;  3O8V A;  1X69 A;  4HKE A;  3E9F A;  1LVK A;  1MHN A;  1QCO A;  2E5K A;  2KRN A;  1MMA A;  4C8Q C;  3NTK A;  4F7U G;  2LTO A;  4WTO B;  2RO0 A;  3NHN A;  4HXJ A;  1SHG A;  1PWT A;  2AZS A;  3FRN A;  3BE3 A;  1JJ2 P;  2A0F B;  3LYI A;  2RQU A;  1MMG A;  2ROL A;  4AFS C;  1GCP A;  3I5S A;  3CC4 Q;  2NUZ A;  3A98 A;  4OML A;  4IKF A;  5J39 A;  4M7A C;  3EGD A;  5GAN j;  2P0P A;  3V7S A;  1WQ7 A;  4K11 A;  1O75 A;  2HZY A;  1C6V X;  1VQO Q;  3H6Z A;  2L3P A;  3OBY A;  3CME A;  2KMT A;  3CC7 Q;  4GBQ A;  4XU2 A;  2VUB A;  4BE0 A;  2KNB B;  2E1H A;  1YJN Q;  4TVR A;  3M0Q A;  1YJ9 Q;  3CCR Q;  4M7D D;  1UGV A;  3C94 A;  2E6N A;  2JXB A;  4BDY A;  1N8R R;  2RD1 A;  5I11 A;  4M77 E;  2GNC A;  2RQR A;  4J9H A;  4EMK A;  1ZLM A;  2EYQ A;  3QHS A;  2LZ6 B;  1VQ8 T;  2J6F A;  1BU1 A;  2LVM A;  2PQW A;  1TG0 A;  3PMI A;  2LC4 A;  1SRL A;  1UEB A;  2FPF A;  2K2V A;  1VYV A;  4C8Q D;  4E47 A;  2BKD N;  2A7Y A;  3VV0 A;  2C06 A;  1WIE A;  1IO6 A;  1IGQ A;  4ORZ A;  3JB9 J;  2LMJ A;  2QEX Q;  4RG8 A;  2O4X B;  4RKU E;  4RMO A;  2H3E B;  2QI2 A;  3TSW A;  1IXD A;  3FJP A;  2EQI A;  1B34 A;  2XD0 A;  2IG0 A;  2RPN A;  1YHQ A;  4PLL A;  3M53 A;  2YDL A;  4ESR A;  3G1J A;  3SB2 A;  4M78 A;  2P4R A;  2GF7 A;  2ZCF B;  3Q1J A;  1OPL A;  5GAN e;  2HKN A;  2DL3 A;  4C5G A;  2YLB A;  1Y57 A;  4J9D A;  5DY9 A;  3H8Z A;  1LPL A;  1RAF B;  3MEA A;  4ELZ C;  3O5Z A;  1MMD A;  2KXD A;  3H0I A;  3CCM Q;  4BY6 C;  2QYZ A;  4BB7 A;  1NPR A;  1K4U S;  1V76 A;  4PJO A;  3OYC A;  1PHT A;  2E65 A;  4PJM A;  1QVG S;  2AIR B;  5GMK m;  4DEX A;  3JCM W;  2EYZ A;  2FL7 A;  3REA B;  3CCQ A;  4C0D C;  3G71 A;  3AT1 B;  4XTW A;  1QKW A;  4LE9 A;  1AZG B;  3VS3 A;  1GCQ C;  2O31 A;  1K8A U;  3RKW A;  2GQI A;  1QVF A;  4XU1 A;  5A0L A;  5GAO n;  1GBQ A;  3CCS A;  2HQH A;  2M9U A;  4C5I A;  3CCJ Q;  1SF9 A;  1X6G A;  5CKF A;  1RL2 A;  2E3I A;  3V8L A;  2XK0 A;  2HL3 A;  2C0T A;  2FO0 A;  4CC7 A;  1YWP A;  3CC4 T;  1I4K 1;  3X26 B;  3KBG A;  2KT1 A;  3CCV A;  2DL8 A;  2IVW A;  5GAM f;  2LCC A;  1YCY A;  4M77 C;  4XTV A;  5GAN d;  4JRQ A;  1KD1 R;  1MUZ A;  4FT4 A;  2YSQ A;  2K5L A;  4FL6 A;  3EGX B;  3THK A;  3CXC A;  3QDF A;  2MF2 A;  3QZ5 B;  2E41 A;  2P0K A;  5FU7 B;  3VS1 A;  5KYN A;  3TVT A;  1VQO T;  2XKO C;  2DNU A;  3CBO A;  4HT8 A;  5LJ3 e;  1KD1 C;  5KCO A;  3PTA A;  4ATO A;  2LJ1 A;  2KAF A;  1N9R A;  3JCM c;  3J7A F;  4QQD A;  1QMC A;  5I2S A;  3VRZ A;  1YJN T;  2BZ8 A;  2VXF A;  4CC3 A;  3JV3 A;  3PVL A;  3CCR T;  4BI4 A;  5IXB A;  2EGE A;  3A8M B;  6AT1 B;  3LX7 A;  1QLY A;  1WNL A;  3A8L B;  2E70 A;  1MV0 B;  3G7Z A;  4FM4 B;  5FW9 A;  3VS7 A;  2JJ9 A;  2CSI A;  2CT4 A;  1M8V A;  2LT1 A;  2JS2 A;  1VIF A;  2FYK A;  2DIG A;  2XDB A;  1BK2 A;  3CMA A;  3OYH A;  4Q5W A;  1Y07 A;  4N4H A;  4M78 E;  1MND A;  2EJ9 A;  2O88 A;  2RK2 A;  1C0M A;  4BI3 A;  2RJC A;  2CDT A;  2JM9 A;  2XDD A;  2DTI A;  4DQ2 A;  3CQT A;  3EH1 A;  1JBM A;  4IUP A;  4J9B A;  1W70 A;  1A0N B;  2XID A;  5KYW B;  2QEX T;  1YP5 A;  5AYF A;  1T0H A;  3HRT A;  3M0R A;  4BE2 A;  3VS2 A;  2QK0 A;  4O5V A;  3VUZ A;  5CKD A;  3ZL7 C;  4DBH A;  3OYA A;  3GOX A;  4PJO E;  4AMC A;  4M77 G;  2CZ0 B;  4RTU A;  4R0K A;  3RUX A;  2QDY B;  1UTI A;  4KBM B;  2P84 A;  4JLG A;  1IRE B;  5CR2 A;  5LJ3 f;  4AG1 C;  1B7T A;  2FG0 A;  1I8F A;  2XG8 D;  1Q86 R;  2HCK A;  4M7D A;  2LRQ A;  1NE8 A;  2GFU A;  1BB9 A;  1OEB A;  3KUF A;  2GBQ A;  5GMK h;  2QQR A;  2L89 A;  2X4W A;  2JZ2 A;  1RAB B;  5IHI A;  4LUE A;  1YIJ T;  1VQ9 A;  2FZG B;  2VYT A;  4OP0 A;  2MCN A;  4KH1 B;  3T9N A;  4MZP A;  1YBY A;  1SRM A;  1BI3 A;  5LJ5 f;  2DXU A;  1UFF A;  1WJS A;  1OZ2 A;  4C0G A;  3OSV A;  1UEC A;  1U8R A;  2VWF A;  4E7Z A;  4EIK A;  1S1N A;  4QQG A;  4C8Q A;  2FRY A;  3UA7 A;  1VOM A;  1ZX6 A;  1JXM A;  1WJR A;  2L5Q A;  4FYW B;  2X35 A;  1VIE A;  3ZFJ A;  2CP3 A;  3CXC P;  2X3X D;  3X28 B;  1Q82 C;  2FPE A;  1VQ5 A;  5J3B A;  2RF0 A;  3QXE B;  2OTJ Q;  3EGD B;  3EG3 A;  3VS0 A;  3CCQ Q;  3G71 Q;  1U3O A;  1T3S A;  4A4K A;  1M8M A;  2O9S A;  1PG5 B;  4JJN K;  2X4Y A;  5M9O A;  3QBY A;  2QQS A;  1K1Z A;  1TOV A;  4WCI A;  3CCS Q;  4YTL A;  4JRP A;  4M75 C;  3QZ9 B;  1CKB A;  1OQK A;  5GJW B;  4KRT A;  2RJE A;  3ASK A;  2DKG A;  4J7I A;  2DBM A;  7AT1 B;  2WSC E;  5KCH A;  1N8R U;  4DBR A;  5IHK A;  4PFO A;  1YIT A;  3HSB A;  3CCV Q;  2D0Q B;  1VQK A;  2JTE A;  3FC3 A;  1UDL A;  2QGF B;  3GNF B;  4L6V 5;  2LQK A;  3LH0 A;  3C95 A;  4EMK B;  3JB9 G;  1X2K A;  3BW1 A;  3WXM B;  1OZ3 A;  2QQ9 A;  3L1A A;  1WQW A;  2HSP A;  1T3L A;  3S6W A;  1K9M U;  1VYU A;  2AK5 A;  5LL6 S;  3CME T;  2D0N A;  3PT9 A;  1BCO A;  2LCS A;  5EG2 A;  1PRL C;  3HFO A;  2GQV A;  3CCL A;  2RQT A;  4F7U F;  1TH7 A;  2EFI A;  4HCK A;  3QKJ A;  1W2B S;  3E9G A;  3M0S A;  2L3S A;  4BAC A;  3MKD A;  2V1Q A;  4DOV A;  1YJ9 A;  2CP0 A;  4UC4 A;  2DMO A;  1RAD B;  1B34 B;  3NPF A;  2XI9 A;  1K8A C;  1JJ2 A;  2G6F X;  2QDL A;  1M4Z A;  3OW2 S;  1ARK A;  4FT2 A;  1M90 U;  4C92 D;  1D0Z A;  1NYF A;  1AWW A;  3UDC A;  5KYY A;  4M78 B;  3CMA Q;  4QVC A;  5GAN g;  2M0O A;  2DXT A;  5GAM h;  5D6Y A;  3PGG A;  3JCM g;  4M75 G;  4R56 A;  2J05 A;  2RI3 A;  1KSW A;  1Z9Q A;  1PD1 A;  2A08 A;  2JTF A;  4PJO B;  1XQH A;  4M78 G;  3ZEH A;  1YHQ T;  3E1S A;  5GAN 8;  3JCM P;  3KFV A;  4N0A A;  1BI2 A;  5IXF A;  3FEO A;  1B3Q A;  1BI1 A;  1D0X A;  3F70 A;  4DBF A;  4MML A;  4PJO G;  5GAO r;  4GLK A;  4FCY A;  3I56 A;  4Y92 A;  4DBQ A;  5KYX B;  1HD3 A;  1VQ9 Q;  2L2P A;  2AKK A;  2DVJ A;  3EFO B;  1M3A A;  5C6S A;  4E7J A;  3CCM A;  3EG9 A;  3OYF A;  3VUB A;  2EYY A;  4KUL A;  4PJL A;  1TUC A;  2LNH B;  4M7A F;  4QVD A;  1UB4 A;  2DTO A;  1RAG B;  3RNJ A;  3OSS C;  2E6Z A;  2H8H A;  3JCM Q;  1G3Y A;  3VS5 A;  4IUT A;  4EPC A;  4AFQ C;  3L42 A;  3ULR B;  4J9G A;  3TCJ A;  4JPB W;  2EGA A;  3L2R A;  2WSE E;  2MI6 A;  4KT0 E;  2K3X A;  3MO8 A;  3CCJ A;  5LJ3 h;  1SHF A;  2FRW A;  3MHX A;  3INZ A;  5GMK l;  3M9Q A;  3CCV T;  1TU0 B;  1X43 A;  4GY5 A;  1EIF A;  1VQ7 A;  4FYV B;  2R5M A;  5GAO m;  1ZA2 B;  3OMG A;  1NPP A;  2COY A;  2ZPI B;  3OYY A;  3EHR A;  1D3B A;  2KVQ G;  2CP2 A;  1VQ4 T;  3NMZ C;  1WI7 A;  1YIT Q;  5LJ5 h;  3CPF A;  1KC8 R;  2F2W A;  1VQK Q;  2LJ0 A;  3OS0 A;  1QCF A;  4LD6 A;  3UPU A;  2D9T A;  1KK7 A;  4PJN A;  3M58 A;  1ZSZ A;  2GTO A;  3CBM A;  2ENM A;  2KE9 A;  3A5Z B;  1FWZ A;  1OYX A;  1KQS S;  2RN8 A;  1QVG P;  3CCL Q;  1H64 1;  2CH4 W;  1NBE B;  1Q86 U;  3FB9 A;  3FJ5 A;  2DL5 A;  1ZQ1 A;  5D7U A;  1WHJ A;  4ME7 A;  1LJO A;  4RTZ A;  5FU6 B;  1WZO A;  2RHI A;  2F69 A;  1LOJ A;  2CGH A;  2JUF A;  5IH2 A;  2O01 E;  1MNE A;  2K7A A;  4N4I A;  2ZZD A;  1UGS B;  2L0A A;  4A54 A;  3L2V A;  1YI2 Q;  2VVK A;  2IPO B;  3NGP A;  3WVE B;  1TXQ A;  2EWN A;  2K5F A;  2CRE A;  3MEW A;  4NOY A;  3MEU A;  1BKB A;  4E2F B;  5FRM A;  2CKK A;  1N8R C;  3V8J A;  5EC7 A;  1SSH A;  3X24 B;  3TRE A;  4ZGJ B;  3SWN B;  1X6O A;  3EG1 A;  2JN0 A;  1K9M R;  1IHW A;  2A37 A;  2DE0 X;  5AT1 B;  2W0Z A;  5C0M A;  3PE0 A;  5IN1 A;  3OYI A;  3V8K A;  1VQM A;  1W6X A;  4CC4 B;  2V26 A;  2X51 A;  2OTL T;  1M9S A;  4F17 A;  2ZAE A;  2ZPH B;  3M0T A;  3EHQ A;  1G8X A;  1Y71 A;  4M7A D;  2KSS A;  1D09 B;  3EAE A;  4E6R A;  2KR3 A;  4OB3 B;  1U06 A;  4C92 A;  1PD0 A;  4NL3 A;  4XTY A;  1D1A A;  4A4H A;  4M77 F;  3QYG B;  4OMP A;  3I56 Q;  1M90 R;  1BI0 A;  2DYI A;  3OS2 A;  1UHC A;  4HCB A;  4VUB A;  1VQL A;  3GBQ A;  4J6W A;  3JCM e;  3IQL A;  1IB8 A;  3H41 A;  1M90 C;  1VQ5 T;  3RER A;  2KI7 A;  5GAN 5;  5FU7 C;  2COZ A;  2EBP A;  3QG1 A;  4JS5 A;  2CSQ A; 
#chains in the Genus database with same CATH homology
 2KXC A;  2LX7 A;  4RTU A;  4QT7 A;  4R0K A;  1UTI A;  2AKL A;  4ZNX A;  1WLP B;  4AG1 C;  1AWO A;  2FG0 A;  4JJB A;  1VA7 A;  2EGC A;  1Y0M A;  2HCK A;  2CUB A;  1AOJ A;  4Z8A A;  1BB9 A;  1OEB A;  1FMK A;  2K2M A;  2GBQ A;  2YT6 A;  2OJ2 A;  2EKH A;  2AZV A;  5IHI A;  1PKT A;  1WDX A;  2BTT A;  4LUE A;  2HBW A;  2M51 A;  2I0N A;  3UF4 A;  2MCN A;  1GFC A;  1JXO A;  2GTJ A;  1KIK A;  1SRM A;  1OV3 A;  1KJW A;  2NWM A;  2RQV A;  1UFF A;  1WA7 A;  4JJD A;  1JO8 A;  2JMC A;  1UEC A;  1ZSG A;  1K76 A;  2VWF A;  1RLQ C;  4AFU C;  4EIK A;  1G2B A;  1S1N A;  3PVQ A;  2FRY A;  3UA7 A;  1JEG A;  4JZ4 A;  1ZX6 A;  4RTW A;  2YUN A;  3QWY A;  3M0U A;  1PNJ A;  1JXM A;  1WXT A;  1YNZ A;  1BBZ A;  2JMA A;  1ZUU A;  2KRS A;  2X3X D;  2BZY A;  2FPE A;  4JJC A;  5IHN A;  2MOX A;  2RF0 A;  4D8K A;  3EG3 A;  3VS0 A;  3VS6 A;  2KGT A;  1AWX A;  5GJV B;  1U3O A;  1T3S A;  1M8M A;  2O9S A;  2CH4 A;  2YUQ A;  1AWJ A;  1ZBJ A;  2FPD A;  4RUG A;  2J6O A;  1AVZ C;  4WCI A;  1K1Z A;  1YN8 A;  4LUD A;  1GL5 A;  1CKB A;  5GJW B;  4KRT A;  1E7O A;  5I22 A;  2YUP A;  4HVU A;  1RUW A;  1AZE A;  2DLP A;  1GBR A;  2DBM A;  2DIL A;  3RBB B;  5IHK A;  1WXB A;  2PNI A;  4RTY A;  1YWO A;  2O2O A;  2V1R A;  2JTE A;  1NEG A;  1M3B A;  1UDL A;  2RMO A;  1JQQ A;  1X2K A;  1WYX A;  4F16 A;  2K9G A;  2HSP A;  1T3L A;  1VYU A;  4IIM A;  2AK5 A;  1RLP C;  1UJ0 A;  4CC2 A;  2D0N A;  3R6N A;  1SPK A;  2LQW A;  2LCS A;  1PRL C;  2CT3 A;  1HSQ A;  2DM1 A;  4RTT A;  1UG1 A;  2RQT A;  2OI3 A;  1UUE A;  3VS4 A;  1LCK A;  4M4Z A;  4HCK A;  2K6D A;  2CUD A;  3M0S A;  4J9F A;  3I5R A;  1X69 A;  2L3S A;  1ABO A;  4DEY A;  2A36 A;  2V1Q A;  2JM8 A;  2EVR A;  2E5K A;  2DMO A;  1U5S A;  1WFW A;  2KRN A;  2EPD A;  2KYB A;  3NPF A;  1UJY A;  2G6F X;  2QDL A;  3NHN A;  3QWX X;  4HXJ A;  1SHG A;  1PWT A;  2AZS A;  4OMQ A;  1ARK A;  1RI9 A;  1X2Q A;  4A63 B;  4RTX A;  5L23 A;  1NYF A;  2PTK A;  2ROL A;  2RQU A;  1AWW A;  4D8D A;  4AFS C;  1GCP A;  2B86 A;  2W10 A;  4J9C A;  3I5S A;  2NUZ A;  1GRI A;  2A28 A;  3A98 A;  4OML A;  3TSZ A;  1NM7 A;  4LN2 A;  4GLM A;  4K11 A;  2J05 A;  2PZ1 A;  2C0I A;  1KSW A;  4LNP A;  5FWB A;  1Z9Q A;  2VKN A;  1N5Z A;  1VYT A;  1H8K A;  2A08 A;  2DRK A;  2HDA A;  4AFZ C;  2L3P A;  2DBK A;  3I9Q A;  2J06 A;  4GBQ A;  3KFV A;  3EG2 A;  1GFD A;  1WXU A;  4J9I A;  5IXF A;  2KNB B;  1TUD A;  2KT8 A;  2EYX A;  1K0S A;  1EFN A;  1B3Q A;  3M0Q A;  1NYG A;  1SEM A;  1UGV A;  4AG2 C;  2K79 A;  1T0J A;  2JXB A;  2KYM A;  5ECA A;  2LP5 A;  5I11 A;  2GNC A;  2M0Y A;  2RQR A;  4J9H A;  2DX1 A;  1ZLM A;  4Y92 A;  2ABL A;  4RTV A;  2LZ6 B;  1HD3 A;  2L2P A;  1NG2 A;  2J6F A;  2AKK A;  2JT4 A;  2DVJ A;  1M3A A;  1CKA A;  2DL7 A;  2O9V A;  1BU1 A;  2KRM A;  2D8J A;  1TG0 A;  3VRY A;  4JZ3 A;  2DA9 A;  1OPK A;  1ZUK A;  2EYY A;  1SRL A;  1PRM C;  1OOT A;  2FPF A;  1VYV A;  2RNA A;  1TUC A;  2LNH B;  2F2V A;  3RNJ A;  2L3Q A;  1WIE A;  1IO6 A;  2H8H A;  4ORZ A;  3VS5 A;  4AFQ C;  2LMJ A;  1K9A A;  2KEA A;  3ULR B;  1H3H A;  4OMN A;  4J9G A;  2J6K A;  3TSW A;  4JPB W;  2EGA A;  2F2X A;  2LJ3 A;  2EQI A;  3UA6 A;  2HEQ A;  1E6G A;  2RPN A;  1AD5 A;  2ECZ A;  4J9E A;  2YDL A;  1UE9 A;  4ESR A;  1SHF A;  2FRW A;  3SHW A;  2ED1 A;  2IIM A;  1X43 A;  2P4R A;  4HVW A;  1UHF A;  2DRM A;  2OAW A;  2RQW A;  1OPL A;  2ROT A;  2SRC A;  2DL3 A;  3EHR A;  1Y57 A;  4J9D A;  1X27 A;  1J3T A;  1NLO C;  3O5Z A;  2KXD A;  3H0I A;  3NMZ C;  1WI7 A;  1M30 A;  1FYN A;  1K4U S;  2DJQ A;  1NEB A;  1PHT A;  2F2W A;  1H92 A;  2LJ0 A;  4IIO A;  1QCF A;  4DEX A;  1I0C A;  2XMF A;  3UAT A;  2EYZ A;  3REA B;  2GTO A;  1QKW A;  1QWF A;  2ENM A;  4LE9 A;  4OMM A;  2KE9 A;  1KFZ A;  1AZG B;  3VS3 A;  1GCQ C;  2O31 A;  1E6H A;  2GGR A;  2GQI A;  2RN8 A;  1PKS A;  1GBQ A;  2EYW A;  4X1V A;  1QKX A;  3H0H A;  1X6G A;  2CH4 W;  2J7I A;  1CSK A;  3FJ5 A;  2DL5 A;  1M27 C;  2C0T A;  2FO0 A;  4CC7 A;  1YWP A;  4RTZ A;  1NLP C;  2KT1 A;  2JW4 A;  1M3C A;  2DL8 A;  4F14 A;  5IH2 A;  2K7A A;  3LH5 A;  1MUZ A;  2YSQ A;  4OMO A;  2L0A A;  1GCQ A;  3THK A;  2ESW A;  2VVK A;  3NGP A;  3VS1 A;  4HVV A;  3TVT A;  2BZX A;  2CRE A;  2DNU A;  3SEM A;  1AEY A;  2DL4 A;  1QWE A;  1Z9Z A;  2LJ1 A;  5EC7 A;  2D1X A;  1SSH A;  2SEM A;  3M0P A;  3VRZ A;  2BZ8 A;  3EG1 A;  2KBT A;  1G83 A;  4CC3 A;  3JV3 A;  3PVL A;  1B07 A;  1JU5 C;  2A37 A;  2DE0 X;  5IXB A;  1I1J A;  2W0Z A;  1WX6 A;  2EGE A;  1X6B A;  1ZUY A;  3PE0 A;  1QLY A;  4FSS A;  2ED0 A;  1MV0 B;  2KRO A;  3REB B;  5FW9 A;  2MIO A;  1W6X A;  2LQN A;  1ABQ A;  2EW3 A;  4CC4 B;  3U23 A;  4F17 A;  3M0T A;  3VS7 A;  2YUO A;  3EHQ A;  2CSI A;  4Z89 A;  2CT4 A;  5HCK A;  1W1F A;  2FEI A;  2JS2 A;  2C0O A;  1BK2 A;  4E6R A;  3EGU A;  2KR3 A;  1U06 A;  2D8H A;  2JS0 A;  1K0X A;  2O88 A;  3C0C A;  5FWC A;  2CDT A;  2JM9 A;  1V1C A;  3I35 A;  4OMP A;  1I07 A;  3CQT A;  4J9B A;  3H0F A;  1UHC A;  1W70 A;  1A0N B;  2X3W D;  4Z88 A;  1HJD A;  1YP5 A;  1YCS B;  3GBQ A;  1XOV A;  3EG0 A;  1T0H A;  3IQL A;  2DF6 A;  3M0R A;  3H41 A;  3VS2 A;  1MV3 A;  2DYB A;  2EBP A;  2K3B A;  3ZL7 C;  2CSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...