2HSPA

Solution structure of the sh3 domain of phospholipase cgamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphoric diester hydrolase
molecule keywords PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)
publication title Solution structure of the SH3 domain of phospholipase C-gamma.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 71
sequence length 71
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2hspA00
4RUGA 1KSWA 4OMLA 2K2MA 4J9BA 5L23A 1H3HA 2CSIA 1K1ZA 1GCPA 2L3SA 1WLPB 1W6XA 4CC3A 2PTKA 1WIEA 1ZUKA 2JW4A 2LJ1A 1E6HA 1JO8A 2KYMA 1MUZA 2EGAA 1GBRA 1AWXA 5IHNA 2MOXA 1QWFA 4JZ4A 4J9HA 1UHCA 2EYXA 2A37A 2O9SA 2DX1A 2RF0A 1V1CA 3IQLA 3SEMA 1NYFA 2JTEA 1BK2A 2W10A 1GL5A 1W1FA 1NLPC 2D8JA 2L3PA 1GFDA 2CDTA 2KRSA 3M0UA 2IIMA 4DEXA 1WA7A 3H0FA 4K11A 4AFQC 2MIOA 2DE0X 1CKBA 2HCKA 2L0AA 3VS0A 3H0HA 3VRZA 2ENMA 1HSQA 1ZSGA 1X69A 5IHKA 1K9AA 2PZ1A 4J9CA 1U06A 2BZXA 2DL7A 1QCFA 1GFCA 4D8KA 3I9QA 1QLYA 3R6NA 2F2WA 2KT8A 2O9VA 4HXJA 1T3SA 2BTTA 2V1QA 2J6KA 1Y0MA 3UF4A 2EPDA 3SHWA 1B3QA 2JMCA 2GGRA 2X3WD 3KFVA 4LUDA 1VA7A 4F16A 3M0SA 2LNHB 1MV0B 2EKHA 2RQRA 1ZUUA 3I5SA 1I07A 2JS0A 2GTJA 3VS4A 3FJ5A 5GJWB 2K9GA 5I11A 4LNPA 1M3CA 4EIKA 3QWYA 1OEBA 1FMKA 1UFFA 4HVWA 1VYUA 1X2QA 1SEMA 2KT1A 2A08A 4AG2C 5I22A 1W70A 2EBPA 4JZ3A 1UG1A 2GBQA 2MCNA 2KXCA 1GCQC 4QT7A 1SRLA 1WXTA 2W0ZA 4GBQA 2GNCA 3I35A 2DNUA 3UA6A 2AKLA 2ABLA 1X43A 1WX6A 2H8HA 2EYWA 3M0TA 4Z89A 2AZVA 2J6OA 2J7IA 2LQNA 1Y57A 1UE9A 4OMOA 1ZBJA 3PVLA 4IIOA 2KROA 4OMPA 4J9IA 1T0JA 3PVQA 4OMNA 2LJ0A 4CC4B 1NLOC 2AKKA 4FSSA 2LQWA 1OV3A 2M51A 1PKTA 3H0IA 4GLMA 1K4US 3VS1A 2DVJA 3UA7A 1JXOA 1AVZC 2FO0A 2L3QA 4RTTA 2ESWA 1H92A 2J6FA 4X1VA 2YUOA 1PHTA 2EVRA 1LCKA 1NM7A 3EG3A 2M0YA 2YUNA 1G83A 2YDLA 1PKSA 4OMMA 2B86A 3C0CA 1NYGA 2QDLA 2BZ8A 4R0KA 1RLQC 2P4RA 2FPFA 2CH4A 2OAWA 2FPEA 5IXBA 3NPFA 2DL3A 2X3XD 2J05A 2JMAA 2RNAA 3EG1A 1U5SA 1AD5A 2RMOA 4Z8AA 2DLPA 1Z9ZA 1H8KA 4DEYA 2EW3A 2SRCA 3VRYA 1SPKA 4Z88A 2KYBA 2YT6A 4WCIA 4RTZA 4ZNXA 1GRIA 2DRKA 1UJYA 1NG2A 4LUEA 2HEQA 1ABOA 1TUDA 1BB9A 3LH5A 1K0SA 1VYTA 5EC7A 1U3OA 4AG1C 4ESRA 1OPLA 1S1NA 2FRYA 1YP5A 3REBB 4J9DA 2OJ2A 3VS3A 1AZGB 3EG2A 2SEMA 1CSKA 2O2OA 2DF6A 1WXBA 2D0NA 1SHFA 1I1JA 2O31A 4HVVA 4J9GA 3TSWA 2C0TA 1WDXA 2D8HA 4RTUA 3U23A 2HDAA 2D1XA 2LCSA 3GBQA 1UTIA 4KRTA 1UHFA 4JJCA 4ORZA 2AK5A 3NGPA 1M8MA 2DA9A 2LX7A 1HD3A 2K3BA 1XOVA 1WFWA 1NEBA 1EFNA 2FEIA 1N5ZA 3EHRA 3THKA 2GTOA 2LP5A 2RPNA 5FWCA 1WI7A 2DYBA 4Y92A 4HCKA 1KJWA 1QKWA 2NWMA 4HVUA 3ZL7C 1UECA 2EQIA 1AZEA 3A98A 3TSZA 2K6DA 2O88A 4F17A 4E6RA 2L2PA 1T0HA 2RQUA 2K7AA 2CT4A 2GQIA 2YSQA 1A0NB 2JXBA 2KGTA 2RQTA 1K0XA 1RLPC 2DBKA 2K79A 1OOTA 4J9EA 2F2VA 1AWJA 1X6GA 4LE9A 4JJBA 1KFZA 1KIKA 1QWEA 1T3LA 3RBBB 1NEGA 1E7OA 1BBZA 1AWOA 2RQVA 1CKAA 1K76A 3EG0A 2RQWA 2C0OA 3O5ZA 1PNJA 2DL5A 3H41A 4CC7A 1PRMC 1YWPA 2ECZA 1WXUA 1ZUYA 2DRMA 1PRLC 1TG0A 1SRMA 2FPDA 3RNJA 1M3BA 2A28A 4AFUC 2VKNA 2HSPA 2EYYA 1JXMA 3JV3A 4M4ZA 5FW9A 1G2BA 3CQTA 4JJDA 1PWTA 1YNZA 3EGUA 2LZ6B 2YUQA 3TVTA 2VVKA 2CSQA 2ROLA 1RUWA 5FWBA 1GBQA 1YCSB 2CUBA 3VS5A 3M0QA 1MV3A 2KE9A 1RI9A 1AOJA 1VYVA 1AWWA 2KEAA 2KBTA 2LJ3A 2G6FX 1ARKA 1JQQA 4J9FA 2KXDA 4RTXA 4RTYA 4OMQA 1BU1A 2XMFA 2JM8A 2RN8A 1SSHA 2KNBB 2YUPA 3ULRB 2CREA 2KR3A 3NHNA 2KRNA 2ROTA 2EYZA 2E5KA 4D8DA 4LN2A 2HBWA 1M3AA 1M30A 1UUEA 2F2XA 2DL8A 2ED0A 1YN8A 1TUCA 3M0RA 1HJDA 4JPBW 1GCQA 2V1RA 2BZYA 4F14A 1ZLMA 3QWXX 1UDLA 3M0PA 1E6GA 2C0IA 4AFZC 2KRMA 2CH4W 3VS7A 2ED1A 1X27A 2EGEA 2CUDA 1JEGA 1UJ0A 2VWFA 1B07A 1UGVA 2DL4A 3VS6A 3I5RA 2JT4A 2FRWA 2DMOA 3NMZC 1JU5C 4AFSC 1SHGA 4RTWA 5IH2A 4IIMA 2I0NA 1X6BA 3REAB 1J3TA 1X2KA 2JS2A 1IO6A 2OI3A 5GJVB 1ABQA 3UATA 2J06A 1QKXA 3PE0A 5IXFA 4RTVA 1WYXA 1M27C 5HCKA 2AZSA 2PNIA 1AEYA 4A63B 3EHQA 1FYNA 1Z9QA 5IHIA 2JM9A 1I0CA 2NUZA 2LMJA 2EGCA 2CT3A 3VS2A 4CC2A 2DBMA 5ECAA 1YWOA 1ZX6A 2DJQA 2DM1A 1OPKA 2DILA 2FG0A 2A36A
chains in the Genus database with same CATH superfamily
4RUGA 1KSWA 3RDVA 1OZ2A 4MDWA 2EYQA 3CBMA 1K1ZA 1GCPA 1M1KR 1NPPA 4LXCA 2PTKA 5GMKe 5GANf 1KK7A 4FYXB 2LJ1A 2XG8D 4OB1B 3HFOA 3JCMh 1NJIC 1D3BB 2M9UA 1D1CA 4PJOD 3M5AA 1UHCA 2QA4A 3JAME 2RHXA 4XQ3A 3JSCA 2LC4A 5HKCA 3IQLA 1NYFA 3ME9A 3CCRA 3QXEB 2JTEA 2WACA 1GL5A 3QYGB 1NLPC 2D8JA 2CDTA 1TXQA 2AIRB 4L6V5 4K11A 2HCKA 1QMCA 2RK1A 1NE8A 2EKOA 4ELYC 1M90C 5IHKA 5J39A 1K9AA 1VQPA 1N6AA 2BZXA 3H8ZA 4M78C 1QCFA 1NJIU 1GFCA 4D8KA 1QLYA 1VQNT 2CS7A 3V8LA 3UF4A 1VQMA 2JMCA 3KFVA 2QTXA 4F16A 3M0SA 4M75A 1MV0B 4QQDA 2MF2A 3QDRB 4FW1A 2DTHA 2DO3A 5GAN3 1M1FA 2LCLA 3V7SA 4M77B 4ZN1A 1QVGA 3FDRA 1YFNA 2QQ9A 4M77E 1IGQA 4HVWA 2MI6A 5GMKj 1VYUA 3CCJQ 1M90U 4HCZA 1OX8A 2A08A 5I22A 2JNGA 3CCST 3G7ZA 1R0CB 4QT7A 3RUXA 2KDSA 3VU3C 4AT1B 4A4KA 2P0PA 2ABLA 4BDYA 4Z89A 5LJ5h 3RIRA 3NTHA 3MHXA 3P8DA 3OYKA 4JS4A 1Y57A 2H3EB 3JB9G 2R5MA 1UE9A 2K5LA 1WHLA 1JJ2S 2PUOB 4DOVA 5GAMe 6AT1B 4J9IA 2DEUA 1RAIB 3EH1A 1VQ8T 1BIBA 2QA4Q 2LQWA 3JRZA 3CCRQ 3CMAT 4FYVB 3MKDA 3OBWA 3LYIA 1BI3A 5KYNA 3H0IA 2QEXT 3EFRA 3VS1A 1MHNA 3CEYA 1YJNA 1BI0A 2FO0A 4F7UG 2ESWA 5GAOm 2J6FA 4BE0A 2EVRA 4A4FA 1NM7A 4VUBA 2A7YA 1VQPQ 1VQ4A 2YUNA 1G83A 1Q86R 3OYNA 5GAOl 1M9SA 3J81E 3OMCA 3M9QA 4MZPA 3JCMd 2QK0A 1VQMQ 1JBMA 3M57A 2P4RA 2FPFA 2FL7A 2O4XB 2CH4A 3NTIA 3RR6A 4MZTA 1YJ9T 2DL3A 2X3XD 2J05A 2RNAA 3EG1A 4JRIA 2KAFA 1AD5A 4J7FA 2DLPA 4M78A 3V7CA 2JTFA 3EG9B 5GAN6 2D0QB 4WF2A 2DK3A 3FLGA 1B34A 3LLRA 4C92B 5GAMj 1TUDA 3J80E 5GAMg 3FIFA 2RJEA 3REBB 4C92E 1N8RC 1H3ZA 2HKQB 3F70A 5CKBA 3EG2A 2EQMA 1WXBA 2D0NA 1WJSA 2C0TA 3U23A 2D8HA 4MMKA 4C92F 2HDAA 2D1XA 1Q7YC 2LCSA 4RMOA 3GBQA 4C8QC 4KH0B 4ORZA 4E7HA 2QGFB 2RK2A 3BY7A 3NGPA 3PIPA 4O6JA 4J7IA 2K3BA 5J3BA 4E47A 2XHCA 4UC4A 1I4K1 1IZ6A 3THKA 2GTOA 2RPNA 4ZGEB 5FWCA 1YJNQ 2BIVA 4Y92A 4HCKA 1KJWA 2QXFA 1VIFA 3CCQA 2OAUA 3OQ5A 3ZL7C 4E7JA 3A8HB 2HL3A 2EQIA 1N8RU 2FVUA 2HL5C 3A98A 4QW2A 3CCVT 4KULA 1VOMA 2K6DA 4M77D 1VQ4Q 1NJIR 2DETA 4E6RA 5LJ5d 3QJYA 1A0NB 3OW2S 1HYOA 2QDYB 4BY6B 1Q7YU 1YJWA 2MYSA 2LCCA 1YIJT 2K79A 2XDDA 2HAXA 1AWJA 1QVFP 3AHUA 5I2MA 3RBBB 1K76A 3HRSA 3QUIA 1PSFA 5D6XA 4XTUA 2C0OA 5CKEA 4Y91A 2E41A 1M90R 4FIBA 1AHJB 1WXUA 3JCMP 1PM3A 1TG0A 4AFUC 4IKFA 2HSPA 4LDWA 4XK8E 4M4ZA 5FW9A 3LGFA 5M9OA 3EGUA 2WSFE 3AT1B 2VVKA 1KHIA 1IGUA 2ROLA 3CPWA 3QSUA 2RJCA 4GY5A 1ZBXA 2LNVA 3EFOB 3H9NA 1NBEB 1OI1A 2RI3A 5J26A 1MV3A 4X34A 1AWWA 2LJ3A 3JB9I 4J9FA 4BB7A 3HP9A 1OU9A 2KNBB 3M55A 2GFAA 3NHNA 3G6ET 2ROTA 2E5KA 4E7LA 4LN2A 4N4HA 3QJ6A 3HL8A 3VUBA 4C8QA 2KK4A 1Q82C 1UUEA 1RAHB 3FRNA 5CKHA 5GAOq 2F2XA 4II1A 3L2UA 5LJ3e 3R6OA 4M7AF 1NPRA 3QPHA 4ZTJA 2V1RA 3OS1A 2BZYA 1ZLMA 4M7DC 5GANd 1YJWQ 3G4SA 2P84A 3WVDB 2CP3A 3G71A 2P0QA 2XU8A 1SSFA 3CCUT 2O01E 4ATOA 3E19A 2CZ7B 4C0DB 4M75G 2VV5A 3NMZC 3CCJT 1JU5C 4FU6A 2DIGA 4RTWA 3CD6A 2DD4A 3UPUA 1Q82U 1IO6A 5GJVB 1ABQA 4OF1A 3S3NA 2AT1B 1M2VB 4E7IA 3CBPA 1G3SA 4F04B 5FLXE 3OY9A 3KXTA 3LW5E 4ANJA 3P8HA 5IHIA 3GNFB 1I0CA 2LX9A 2NUZA 3GOXA 1AT1B 4EMKA 3CCLT 3UT1A 3VS2A 2EWNA 1YWOA 2PVGB 4C0ZA 1ZX6A 1M1GA 3JCMV 2DM1A 2JTMA 2RB6A 2R57A 3EGDB 3CCRT 4OMLA 5IAYA 1D0ZA 2K2MA 4J9BA 2E5QA 1I8FA 1O9SA 1WHMA 2CSIA 4PJOF 5LJ3j 4OMFB 2CP5A 1TS9A 3OS2A 5LJ3g 2YLBA 2JW4A 3CC2Q 1JO8A 1N8RR 2VB6A 2QQBA 1MUZA 3EGXA 1GBRA 1AWXA 5IHNA 2PU9B 2F5KA 4KGVB 2JZ2A 4J9HA 1YHQT 4PLLA 2EYXA 4JJNK 1UGPB 3OYDA 1VQMT 1X6OA 2O9SA 1Q7YR 2RF0A 2ZAEA 3SEMA 5A0DA 2DKGA 3G4SQ 1W1FA 3NTKA 3CBOA 3G71Q 2ZPGB 2V8KA 2E70A 3M0UA 5GAMf 4DEXA 2CYZB 4AFQC 2L0AA 3VS0A 4PKCC 2OTJA 3VRZA 2LT4A 1UGSB 4DBHA 1ZSGA 4E7ZA 3HPWA 2CZ0B 2XDPA 3CMEA 2PZ1A 3JCMJ 4AMCA 1U06A 3M53A 4M7DA 2XIDA 2RHZA 1RI0A 3I9QA 2HNIA 1M4ZA 3Q1JA 4M78G 2NUPB 3R6NA 2J6KA 2EPDA 3SHWA 1B3QA 5A0LA 2GGRA 2X3WD 2MWOA 4E7SA 2DIQA 1ZHIA 2EKHA 2LNHB 4FT2A 5KYWA 1VQLA 4C5EA 3I5SA 1I5OB 5FU6C 4EMGA 2RI2A 1U1TA 2K9GA 4LNPA 1M3CA 3DKMA 1JJ2A 1FMKA 1X2QA 4C5GA 1WGSA 3DLMA 5FROA 4JZ3A 1EIFA 4IUVA 3CCMT 1UG1A 2GBQA 3CC7T 2KXCA 5CVIA 2GNCA 3UA6A 2AKLA 1X43A 1WX6A 5DY9A 1VQ6T 4IUQA 2L89A 3MPUB 3JCMQ 2NUTB 4X9DA 4XU0A 4KT0E 5A2QE 1VQ4T 2X51A 1I5LA 3GPLA 4IIOA 2KROA 2XICA 4OMPA 2C06A 2EJFA 2EQUA 1T0JA 2LJ0A 2DZCA 1D3BA 1Y71A 3OYLA 5CQXA 1UB4A 5HK3A 5A0GA 3L2VA 2F69A 2E64A 3PMTA 2DVJA 1Y96B 2OTJQ 1H92A 3A8MB 5GAN7 1LCKA 5DM7R 2XKOC 3CMEQ 2D9TA 1QVFS 3FEOA 2M0YA 3OB9A 4O5VA 1PKSA 1Q82R 1VQ5A 4OMMA 2ZGWA 3CXCP 3QIIA 3JB9D 2BZ8A 3PTAA 3M4GA 1VQLQ 3OBYA 5CCAA 2G3RA 2NLUA 3NPFA 3L2RA 4OVAA 3VKIA 1G3WA 1G3TA 1Z9ZA 1H8KA 4C92C 4DEYA 4X9CA 2EW3A 2SRCA 3JCMe 4Z88A 2K2VA 2YT6A 3MP6A 1KQSP 5KYYB 2DXBA 2EJ9A 1RAAB 3A8LB 1BYMA 1ABOA 3V7RA 2DAQA 1U3OA 2ZCFB 3META 3TREA 4ESRA 2CP7A 1S1NA 3CCQT 2OJ2A 1AZGB 1SG5A 1RAFB 3HTRA 3N5BB 1CSKA 4KUDK 2O31A 1I1JA 2VYTA 4HVVA 3S3MA 3CPFA 1VQOT 2AHJB 3RKYA 2KSSA 4JRKA 4QKUA 1KG1A 1UHFA 4JJCA 4C8QG 4CI0C 2AK5A 1YJWT 1M8MA 3MJXA 1XOVA 1WFWA 3OW2A 3DB4A 1NEBA 5LL6S 2MAMA 1N5ZA 4M77F 1K73C 4HVUA 4BY6C 2QI2A 1UECA 1YITA 2HKNA 4A53A 3TSZA 1R0BG 4DOWA 2O88A 1VQ5Q 1T0HA 2L2PA 3OYMA 2K7AA 2CT4A 2YSQA 5GAN8 2JXBA 2RQTA 4L5GA 3QZ9B 4M75E 4PNOA 4QVCA 1VQ7A 2HD0A 2F2VA 4BI3A 5LJ3f 1X01A 2QG9B 5LJ5e 2YWWA 5HY6A 1BBZA 2O4XA 2RQVA 5KYXB 1PD1A 1K73U 3H41A 4MZMA 2CP6A 2ECZA 1C6VX 2DRMA 1WQ7A 4EPCA 2VKNA 4QQGA 4C92A 2LDMA 1PWTA 1TWBA 2YUQA 2HQEA 2CSQA 5FWBA 1YCSB 4M7AC 2EFIA 2CUBA 1VQ9A 3SD4A 4BUGA 1AOJA 2KBTA 1WHGA 1W2BP 4J6XA 3G71T 3CCET 3TEEA 4FCYA 1BU1A 2YUPA 4JRQA 2LRQA 4A4HA 2KR3A 2RD1A 1WJQA 2X35A 4JRPA 1RL2A 2DD5A 4ZGDB 5GANh 1YITQ 1V29B 1XJWB 3CD6T 5KCHA 3QG1A 8ATCB 2B8AA 5KH6A 3GLXA 2CKKA 4F14A 3BFMA 1UDLA 4C0DC 4M7DG 1BKBA 1VQ7Q 1XTDA 3OYYA 1EZZB 2CH4W 2YRVA 1SF9A 2CUDA 1JEGA 1RAGB 2E4HA 2VWFA 1B07A 2K4YA 1OZ3A 2XK0A 1FMWA 3VS6A 1B34B 3I5RA 2DMOA 4AFSC 1SHGA 5IH2A 3I56A 2DZ9A 1J3TA 1X2KA 2OI3A 2QGGA 5GAMd 2DJZA 3OSVA 4IUUA 3PE0A 4PJOC 4FT4A 4LDXA 1WYXA 2X4JA 4V2SA 4OGCA 1M27C 2GF7A 5HCKA 2GCXA 4OB0B 4A63B 1M8VA 2X4XA 3EHQA 1FYNA 2QQRA 1U1SA 1UGRB 2CT3A 4CC2A 2ZPFB 1PC0A 1VQ9Q 1U8RA 2FG0A 3A1PA 4XTYA 1N9SA 3RMQA 1QCOA 4M75D 5L23A 3EFOA 1H3HA 2XD0A 1W6XA 4CC3A 1OYXA 4JS5A 2OTJT 4C0FA 3L2WA 1ZUKA 1DJ7B 3CMET 3SWNC 1SKUB 2KYMA 4M7AA 2KMTA 2D6FA 1IREB 1QWFA 3RERA 2FZKB 4JZ4A 1K8AC 1VQ8A 2A37A 2IPOB 4ME7A 2ZPIB 1V1CA 4HCBA 3QYHB 2RI5A 3FJPA 4Y28E 1GFDA 4IUTA 4E2FB 4BACA 1WA7A 3H0FA 2BKDN 1CKBA 4JDSA 4PFPA 3CXCS 3H0HA 2IVWA 2ENMA 1HSQA 2MWPA 2DVEA 2HBPA 4PK4A 3CC2A 1TH7A 3OSSC 1GXIE 1K73R 4ZTFA 1KQ1A 4J9CA 1KHCA 2CZ1B 3I56Q 4KUIA 2K3YA 4LD6A 2V8JA 2LT1A 1T3SA 2BTTA 2V1QA 2OTLA 1VQNQ 1IHVA 4LUDA 1K8AU 2MPXC 1KQSS 2HQXA 3UDCA 2RQRA 1ZUUA 1G3YA 4PJMA 4XU3A 5CKDA 4RCBA 5KYUA 1YJ9A 1I07A 2JS0A 3OYBA 1QCNA 2GTJA 3VS4A 3FJ5A 3QWYA 3L2QA 1PG5B 2GQVA 4PJOA 2LQ8A 2KT1A 2CP0A 4IURA 1W70A 2EBPA 3MP1A 1FWZA 1GCQC 3CCSQ 2ZPEB 2BUDA 1NZ9A 3BDUA 4GBQA 4J6YA 3I35A 2DNUA 1D09B 3M58A 2DERA 4XU2A 2J6OA 4C8QE 2J7IA 4M78D 4FL6A 2MMPA 2LQNA 3HSBA 3OA6A 4OMOA 1ZBJA 3PVLA 1VQ5T 2QA4T 3GIBA 1VQ8Q 3RMSA 4FSSA 3OYCA 3MEUA 1ZSZB 1YBYA 4PJLA 1OV3A 1C0MA 3C12A 2M51A 4DBRA 4GLMA 1K4US 2QEXQ 3SWNA 3UA7A 1JXOA 2L3QA 4RTTA 3X28B 3ASKA 3BDLA 4HA8A 3JB9F 4X1VA 1PHTA 3GP8A 1VQPT 3EG3A 1Y7XA 4F7UB 2CP2A 2EAYA 5L8RE 1QP2A 1NYGA 1EX4A 2OTLQ 4F7UE 4R0KA 4EMKB 1XQHA 2KI7A 2Y90A 2DXCA 2HZYA 2OAWA 4HT9A 2DEQA 3MP8A 4F7UF 1YJ9Q 2JMAA 4Z8AA 5GAN4 4FSXA 2Y4YA 4C92G 2JUFA 4EDUA 1H641 5KE2A 2KVQG 4WCIA 3NFCA 4RTZA 3PIOA 2L3RA 5LJ3d 2DRKA 3JCMc 4LUEA 4ZGJB 3I55A 4M77C 1VYTA 5EC7A 4AG1C 3OYIA 1OPLA 2FRYA 1YP5A 4J9DA 3SFMA 3VS3A 3X24B 2SEMA 1YITT 1W2BS 2O2OA 3JCMW 1WNLA 4J9GA 2K5IA 2EJGA 3HFNA 4DBFA 3TSWA 1HK9A 1I81A 1QW1A 1G8XA 1UTIA 4LD9K 4KRTA 1WHJA 1LNXA 2LX7A 3MO8A 2L8DA 4OGEA 1QVGP 2RHIA 1MMDA 3ER0A 2LP5A 1K9MC 3H6ZA 1YJNT 4M7DB 1WI7A 2CZ6B 2DYBA 2COYA 1PD0A 2QQSA 2FYKA 1QKWA 2NWMA 3VUZA 3E2UA 4M7DE 3PNWC 1AZEA 1Y96A 2FZCB 4A4GA 3CCVQ 5D6WA 2XI9A 2PQWA 4NS5A 5GAN2 2GQIA 4QVZA 2KGTA 1K0XA 3E9FA 3TQ7P 2X9HA 3HRUA 2DBKA 4C0GA 1K8AR 3TCJA 1YIJQ 2YRDA 4J9EA 5GMKh 5KE3A 5DLQE 1KFZA 3CCUA 4C8QD 1OULA 2VXFA 5GMKi 2F5TX 1KIKA 1MMGA 3G1JA 1E7OA 4PL6A 3HHTB 4B6MA 1K9MU 5IN1A 1VQ9T 3O5ZA 4HKEA 1PNJA 4RG8A 2DL5A 2E6NA 4CC7A 5EG2A 5FU7B 3X20B 1BI1A 1RAEB 1ZUYA 1PRLC 4XTVA 3I55Q 1SRMA 3RNJA 1M3BA 2A28A 3FB9A 4BI4A 5KYYA 2KQWA 1JXMA 1Q81R 1RACB 1G2BA 7AT1B 3M54A 2LZ6B 3CCLA 2VASA 3TVTA 1RUWA 1ZQ1A 4M7AG 1JRIA 3CC4A 2KEAA 4M77A 4HT8A 1D1BA 4IUPA 3MEVA 4RTXA 3S6WA 4RTYA 4OMQA 4P5NA 2JM8A 2RN8A 2CREA 2DPPB 4WTOB 2EYZA 2RHYA 3G6EQ 4D8DA 4LDYA 2HBWA 4N0AC 3LWHA 3BW1A 3D7SB 3MEWA 4XTXA 4XTZA 4JLIA 3I56T 4RG2A 3WXMB 2ED0A 1HXDA 2GFUA 1TUCA 1YHQA 3GF5A 1HJDA 1LOJA 3RESA 3EAEA 4DQ2A 3WVEB 2COWA 1VQKA 2E6ZA 3S3OA 1N27A 1TTHB 2C0IA 4R55A 2KRMA 4CRIA 3CCUQ 2CGHA 2ED1A 4HCCA 1UJ0A 2JJ9A 1UGVA 5GAMh 2DL4A 1WZOA 2JT4A 1QVPA 2FRWA 5GAOr 2RH2A 5FU6B 3ZEHA 2JS2A 4M75B 4D6WA 4KH1B 3UATA 2DTIA 2HSEB 4Z02A 5KYXA 3E9GA 1QKXA 3A8OB 3QBYA 3MCAB 3A8GB 4BDZA 5IXFA 2DXTA 4PJOG 4A54A 2QTVA 4NOYA 1Y07A 1MNEA 2F1LA 1YCYA 5CIUA 2AZSA 2LVMA 2PNIA 1AEYA 4JUVA 2E1HA 3EFSA 3JCMg 5IT9E 2JM9A 2PVDB 4M75F 2FZGB 4FM4B 2E3IA 4M7DD 3CCLQ 1WJRA 3LH0A 2DBMA 3QDFA 4LDVA 1YI2A 1Q95G 2DJQA 1OPKA 2DILA 3CC4Q 2A36A 2MK5A 1BCOA 3CCMA 3CC7A 3TU4K 2L3SA 1WLPB 1FXXA 3EG9A 4MMLA 4C5IA 3P8BB 3LWIA 1IRXA 1MMAA 1VQ6A 2ZPHB 1WIEA 3CC2T 1D1AA 2OX7A 2WSCE 1E6HA 3CXCA 2EGAA 2PVOB 1S72A 2ZPBB 2MOXA 1V76A 2LTOA 4RCCA 3C95A 5AT1B 1YHQQ 2OTLT 2DX1A 2I2LA 2HQHA 1VUBA 3G4ST 1VQKQ 1BK2A 2W10A 3CPWP 2L3PA 2KRSA 4N0AA 2IIMA 2ZZDA 1KQSA 2MIOA 2DE0X 4PFZA 1PSEA 1KC8R 2P4TA 5I21A 1BCMA 1K9MR 1X69A 4OP0A 2DL7A 2L5QA 2QAZA 1G5VA 2F2WA 1ZA2B 2KT8A 3J7AF 2O9VA 4HXJA 2BE9B 4BE1A 5LJ5j 5FRMA 1Y0MA 1JB0E 5LJ5g 2E65A 1VA7A 1FX7A 4M78B 5GAOp 5CR2A 5C0MA 3SB2A 4M78E 3OYGA 1R77A 1QP3A 5GJWB 5I11A 1YI2Q 4EIKA 4B9WA 1OEBA 5GANe 3HRTA 1D0YA 1UFFA 3DB3A 3OYHA 4XTWA 1TU0B 1SEMA 4BI8B 4M78F 2VXEA 5GAN5 4AG2C 3OYAA 2MCNA 2YXYA 3CCMQ 1SRLA 1WXTA 3CC7Q 2W0ZA 2P0KA 1C1AA 5GAOn 2E3HA 5DLOA 1VQNA 3SDZA 3X26B 4FYYB 8AT1B 2H8HA 2EYWA 3M0TA 4XAXB 1VQ6Q 2AZVA 2E12A 3QHSA 1QVGS 3LGLA 4QQ6A 1ZSZC 1QQJA 4QVDA 1VQOA 3JCMX 1S72Q 3PVQA 2IG0A 3LX7A 4OMNA 4CC4B 2ATCB 4LDUA 1NLOC 2AKKA 1KD1C 4KBMB 3JB9H 3L2ZA 4PJJA 1MMNA 1WPYA 5I2SA 1ZA1B 3CCSA 2A0FB 1PKTA 5CO7A 2NYSA 2DTOA 1AVZC 4NL2A 2VGNA 4BD3A 2YUOA 3E1SA 1MGQA 4EMKC 2M1HA 4KGXB 4DA4A 1IXDA 2YDLA 1RABB 4PJNA 2COZA 2B86A 3I55T 2VC8A 3C0CA 2QDLA 2EIFA 1N9RA 4ZN3A 2K3XA 1RLQC 5GANj 1VQLT 1KD1U 3CMAA 2K5FA 4J5YA 5CK9A 5GANg 2FPEA 2QYZA 2JN0A 5IXBA 3GNGA 2QEXA 4J8OA 3L42A 4PFOA 1U5SA 3RKWA 4OB2B 2RMOA 3M59A 3MEAA 1W2BA 1UGQB 5LJ3h 3VRYA 2RHUA 1SPKA 2H3JA 2KYBA 3HKSA 3JCMb 1M1KC 2V26A 3KBGA 4ZNXA 1GRIA 4B9XA 1UJYA 1NG2A 4M7AB 2HEQA 4J6WA 1BB9A 3LH5A 1K0SA 3V8JA 1Q81C 4M77G 4MDXA 1D0XA 4M7AE 2DYIA 4DBQA 3CCQQ 2DF6A 1M2VA 4OB3B 1SHFA 2RJFA 5C6SA 1VQOQ 4PLIA 1WDXA 2VGMA 4RTUA 3BE3A 4FW2A 5D7UA 3OYFA 4NL3A 2DA9A 1HD3A 3QKJA 2WSEE 2LQKA 2X4WA 3T9NA 3CCEA 1IHWA 1EFNA 1JJ2P 4C92D 1M1KU 1PCXA 2FEIA 3EHRA 4C8QB 1ZSZA 3EGDA 2A3LA 3OS0A 1OU8A 3JCMf 5KCOA 2M16A 5FRNA 3M56A 1Q81U 1M2OA 2M0OA 2DFUA 1BIAA 4FYWB 4F17A 2VUBA 4C8QF 9ATCB 1VIEA 2RQUA 1QVFA 3V8KA 5KYUB 2KY9A 5CAIA 1MNDA 1RLPC 4F7UA 1OOTA 1B7TA 3QO3A 2RJDA 4BE2A 1X6GA 4LE9A 3CMAQ 4C5HA 4JJBA 3X25B 3RKXA 2FHDA 5FU7C 3EH2A 3DLLA 1KQ2A 4PJOB 3VJPA 1QWEA 1T3LA 1NEGA 1AWOA 2R58A 2X4YA 1CKAA 3JB9J 3URGA 3EG0A 4PJOE 2Y4XA 1F1BB 2RQWA 3CC4T 1M5Q1 2RA2A 3CCVA 4J83A 5D6YA 4ELZC 1PRMC 1YWPA 2FB7A 2PUKB 3PGGA 3PFSA 1LVKA 1LJOA 2FPDA 1TSFA 2YHTA 1YIJA 2EYYA 3JV3A 2NUPA 3CQTA 4JJDA 3OYJA 1OX9A 1YNZA 4R56A 4E7KA 2XDBA 1O75A 1ACMB 2JVVA 3L1AA 2HMAA 1GBQA 3ZBDA 2Z0WA 2RM4A 5AYFA 3VS5A 3M0QA 4JLGA 2KE9A 1RI9A 3SWNB 4N4IA 4XU1A 1VQKT 1VYVA 2RO0A 1WQWA 2G6FX 1ARKA 1JQQA 2DXUA 2KXDA 3CCEQ 2QQAA 5LJ5f 2XMFA 1SSHA 3ULRB 1W4SA 5HK0A 3EGXB 3VYGA 1WHKA 2KRNA 3QZ5B 3INZA 2K57A 1M3AA 4Q5WA 1FMVA 1Q86C 1X75C 3CPWS 1M30A 4RKUE 2QASA 3CD6Q 2DL8A 1RADB 1YN8A 2BE7D 1R8OB 3M0RA 2NUTA 4JPBW 1GCQA 4EMHA 1P92A 2EQJA 3QWXX 3M0PA 3OS5A 3UWNA 4TVRA 2R5AA 1VQ7T 3O8VA 1E6GA 5CQYA 3VYHB 1KD1R 1WHHA 4AFZC 2EQKA 1KC8C 4M7AD 3VS7A 3FC3A 1X27A 1LPLA 2EGEA 3C4SA 4M75C 1BI2A 1YI2T 3G6EA 4N4GA 3OW2P 1TOVA 2YRCA 5GMKm 3PMIA 1UEBA 2V8IA 3PT9A 2JOYA 2E10A 4IIMA 2I0NA 1IB8A 1X6BA 3REAB 1Q86U 4YTLA 5KYWB 2J06A 5GMKl 3M4YA 4M7DF 1TUGB 4RTVA 5CKFA 4A4EA 1XNIA 3KUFA 1Z9QA 1OQKA 2LMJA 4KGZB 3C94A 2EGCA 1S72T 4GLKA 1KC8U 3OMGA 5ECAA 3OYEA 3VV0A 2YLCA 4L59A 2M02A 3CCJA 3A5ZB 3ZFJA
chains in the Genus database with same CATH topology
4RUGA 1KSWA 4OMLA 2K2MA 4J9BA 5L23A 1H3HA 2CSIA 1K1ZA 1GCPA 2L3SA 1WLPB 1W6XA 4CC3A 2PTKA 1WIEA 1ZUKA 2JW4A 2LJ1A 1E6HA 1JO8A 2KYMA 1MUZA 2EGAA 1GBRA 1AWXA 5IHNA 2MOXA 1QWFA 4JZ4A 4J9HA 1UHCA 2EYXA 2A37A 2O9SA 2DX1A 2RF0A 1V1CA 3IQLA 3SEMA 1NYFA 2JTEA 1BK2A 2W10A 1GL5A 1W1FA 1NLPC 2D8JA 2L3PA 1GFDA 2CDTA 2KRSA 3M0UA 2IIMA 4DEXA 1WA7A 3H0FA 4K11A 4AFQC 2MIOA 2DE0X 1CKBA 2HCKA 2L0AA 3VS0A 3H0HA 3VRZA 2ENMA 1HSQA 1ZSGA 1X69A 5IHKA 1K9AA 2PZ1A 4J9CA 1U06A 2BZXA 2DL7A 1QCFA 1GFCA 4D8KA 3I9QA 1QLYA 3R6NA 2F2WA 2KT8A 2O9VA 4HXJA 1T3SA 2BTTA 2V1QA 2J6KA 1Y0MA 3UF4A 2EPDA 3SHWA 1B3QA 2JMCA 2GGRA 2X3WD 3KFVA 4LUDA 1VA7A 4F16A 3M0SA 2LNHB 1MV0B 2EKHA 2RQRA 1ZUUA 3I5SA 1I07A 2JS0A 2GTJA 3VS4A 3FJ5A 5GJWB 2K9GA 5I11A 4LNPA 1M3CA 4EIKA 3QWYA 1OEBA 1FMKA 1UFFA 4HVWA 1VYUA 1X2QA 1SEMA 2KT1A 2A08A 4AG2C 5I22A 1W70A 2EBPA 4JZ3A 1UG1A 2GBQA 2MCNA 2KXCA 1GCQC 4QT7A 1SRLA 1WXTA 2W0ZA 4GBQA 2GNCA 3I35A 2DNUA 3UA6A 2AKLA 2ABLA 1X43A 1WX6A 2H8HA 2EYWA 3M0TA 4Z89A 2AZVA 2J6OA 2J7IA 2LQNA 1Y57A 1UE9A 4OMOA 1ZBJA 3PVLA 4IIOA 2KROA 4OMPA 4J9IA 1T0JA 3PVQA 4OMNA 2LJ0A 4CC4B 1NLOC 2AKKA 4FSSA 2LQWA 1OV3A 2M51A 1PKTA 3H0IA 4GLMA 1K4US 3VS1A 2DVJA 3UA7A 1JXOA 1AVZC 2FO0A 2L3QA 4RTTA 2ESWA 1H92A 2J6FA 4X1VA 2YUOA 1PHTA 2EVRA 1LCKA 1NM7A 3EG3A 2M0YA 2YUNA 1G83A 2YDLA 1PKSA 4OMMA 2B86A 3C0CA 1NYGA 2QDLA 2BZ8A 4R0KA 1RLQC 2P4RA 2FPFA 2CH4A 2OAWA 2FPEA 5IXBA 3NPFA 2DL3A 2X3XD 2J05A 2JMAA 2RNAA 3EG1A 1U5SA 1AD5A 2RMOA 4Z8AA 2DLPA 1Z9ZA 1H8KA 4DEYA 2EW3A 2SRCA 3VRYA 1SPKA 4Z88A 2KYBA 2YT6A 4WCIA 4RTZA 4ZNXA 1GRIA 2DRKA 1UJYA 1NG2A 4LUEA 2HEQA 1ABOA 1TUDA 1BB9A 3LH5A 1K0SA 1VYTA 5EC7A 1U3OA 4AG1C 4ESRA 1OPLA 1S1NA 2FRYA 1YP5A 3REBB 4J9DA 2OJ2A 3VS3A 1AZGB 3EG2A 2SEMA 1CSKA 2O2OA 2DF6A 1WXBA 2D0NA 1SHFA 1I1JA 2O31A 4HVVA 4J9GA 3TSWA 2C0TA 1WDXA 2D8HA 4RTUA 3U23A 2HDAA 2D1XA 2LCSA 3GBQA 1UTIA 4KRTA 1UHFA 4JJCA 4ORZA 2AK5A 3NGPA 1M8MA 2DA9A 2LX7A 1HD3A 2K3BA 1XOVA 1WFWA 1NEBA 1EFNA 2FEIA 1N5ZA 3EHRA 3THKA 2GTOA 2LP5A 2RPNA 5FWCA 1WI7A 2DYBA 4Y92A 4HCKA 1KJWA 1QKWA 2NWMA 4HVUA 3ZL7C 1UECA 2EQIA 1AZEA 3A98A 3TSZA 2K6DA 2O88A 4F17A 4E6RA 2L2PA 1T0HA 2RQUA 2K7AA 2CT4A 2GQIA 2YSQA 1A0NB 2JXBA 2KGTA 2RQTA 1K0XA 1RLPC 2DBKA 2K79A 1OOTA 4J9EA 2F2VA 1AWJA 1X6GA 4LE9A 4JJBA 1KFZA 1KIKA 1QWEA 1T3LA 3RBBB 1NEGA 1E7OA 1BBZA 1AWOA 2RQVA 1CKAA 1K76A 3EG0A 2RQWA 2C0OA 3O5ZA 1PNJA 2DL5A 3H41A 4CC7A 1PRMC 1YWPA 2ECZA 1WXUA 1ZUYA 2DRMA 1PRLC 1TG0A 1SRMA 2FPDA 3RNJA 1M3BA 2A28A 4AFUC 2VKNA 2HSPA 2EYYA 1JXMA 3JV3A 4M4ZA 5FW9A 1G2BA 3CQTA 4JJDA 1PWTA 1YNZA 3EGUA 2LZ6B 2YUQA 3TVTA 2VVKA 2CSQA 2ROLA 1RUWA 5FWBA 1GBQA 1YCSB 2CUBA 3VS5A 3M0QA 1MV3A 2KE9A 1RI9A 1AOJA 1VYVA 1AWWA 2KEAA 2KBTA 2LJ3A 2G6FX 1ARKA 1JQQA 4J9FA 2KXDA 4RTXA 4RTYA 4OMQA 1BU1A 2XMFA 2JM8A 2RN8A 1SSHA 2KNBB 2YUPA 3ULRB 2CREA 2KR3A 3NHNA 2KRNA 2ROTA 2EYZA 2E5KA 4D8DA 4LN2A 2HBWA 1M3AA 1M30A 1UUEA 2F2XA 2DL8A 2ED0A 1YN8A 1TUCA 3M0RA 1HJDA 4JPBW 1GCQA 2V1RA 2BZYA 4F14A 1ZLMA 3QWXX 1UDLA 3M0PA 1E6GA 2C0IA 4AFZC 2KRMA 2CH4W 3VS7A 2ED1A 1X27A 2EGEA 2CUDA 1JEGA 1UJ0A 2VWFA 1B07A 1UGVA 2DL4A 3VS6A 3I5RA 2JT4A 2FRWA 2DMOA 3NMZC 1JU5C 4AFSC 1SHGA 4RTWA 5IH2A 4IIMA 2I0NA 1X6BA 3REAB 1J3TA 1X2KA 2JS2A 1IO6A 2OI3A 5GJVB 1ABQA 3UATA 2J06A 1QKXA 3PE0A 5IXFA 4RTVA 1WYXA 1M27C 5HCKA 2AZSA 2PNIA 1AEYA 4A63B 3EHQA 1FYNA 1Z9QA 5IHIA 2JM9A 1I0CA 2NUZA 2LMJA 2EGCA 2CT3A 3VS2A 4CC2A 2DBMA 5ECAA 1YWOA 1ZX6A 2DJQA 2DM1A 1OPKA 2DILA 2FG0A 2A36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUG A;  1KSW A;  4OML A;  2K2M A;  4J9B A;  5L23 A;  1H3H A;  2CSI A;  1K1Z A;  1GCP A;  2L3S A;  1WLP B;  1W6X A;  4CC3 A;  2PTK A;  1WIE A;  1ZUK A;  2JW4 A;  2LJ1 A;  1E6H A;  1JO8 A;  2KYM A;  1MUZ A;  2EGA A;  1GBR A;  1AWX A;  5IHN A;  2MOX A;  1QWF A;  4JZ4 A;  4J9H A;  1UHC A;  2EYX A;  2A37 A;  2O9S A;  2DX1 A;  2RF0 A;  1V1C A;  3IQL A;  3SEM A;  1NYF A;  2JTE A;  1BK2 A;  2W10 A;  1GL5 A;  1W1F A;  1NLP C;  2D8J A;  2L3P A;  1GFD A;  2CDT A;  2KRS A;  3M0U A;  2IIM A;  4DEX A;  1WA7 A;  3H0F A;  4K11 A;  4AFQ C;  2MIO A;  2DE0 X;  1CKB A;  2HCK A;  2L0A A;  3VS0 A;  3H0H A;  3VRZ A;  2ENM A;  1HSQ A;  1ZSG A;  1X69 A;  5IHK A;  1K9A A;  2PZ1 A;  4J9C A;  1U06 A;  2BZX A;  2DL7 A;  1QCF A;  1GFC A;  4D8K A;  3I9Q A;  1QLY A;  3R6N A;  2F2W A;  2KT8 A;  2O9V A;  4HXJ A;  1T3S A;  2BTT A;  2V1Q A;  2J6K A;  1Y0M A;  3UF4 A;  2EPD A;  3SHW A;  1B3Q A;  2JMC A;  2GGR A;  2X3W D;  3KFV A;  4LUD A;  1VA7 A;  4F16 A;  3M0S A;  2LNH B;  1MV0 B;  2EKH A;  2RQR A;  1ZUU A;  3I5S A;  1I07 A;  2JS0 A;  2GTJ A;  3VS4 A;  3FJ5 A;  5GJW B;  2K9G A;  5I11 A;  4LNP A;  1M3C A;  4EIK A;  3QWY A;  1OEB A;  1FMK A;  1UFF A;  4HVW A;  1VYU A;  1X2Q A;  1SEM A;  2KT1 A;  2A08 A;  4AG2 C;  5I22 A;  1W70 A;  2EBP A;  4JZ3 A;  1UG1 A;  2GBQ A;  2MCN A;  2KXC A;  1GCQ C;  4QT7 A;  1SRL A;  1WXT A;  2W0Z A;  4GBQ A;  2GNC A;  3I35 A;  2DNU A;  3UA6 A;  2AKL A;  2ABL A;  1X43 A;  1WX6 A;  2H8H A;  2EYW A;  3M0T A;  4Z89 A;  2AZV A;  2J6O A;  2J7I A;  2LQN A;  1Y57 A;  1UE9 A;  4OMO A;  1ZBJ A;  3PVL A;  4IIO A;  2KRO A;  4OMP A;  4J9I A;  1T0J A;  3PVQ A;  4OMN A;  2LJ0 A;  4CC4 B;  1NLO C;  2AKK A;  4FSS A;  2LQW A;  1OV3 A;  2M51 A;  1PKT A;  3H0I A;  4GLM A;  1K4U S;  3VS1 A;  2DVJ A;  3UA7 A;  1JXO A;  1AVZ C;  2FO0 A;  2L3Q A;  4RTT A;  2ESW A;  1H92 A;  2J6F A;  4X1V A;  2YUO A;  1PHT A;  2EVR A;  1LCK A;  1NM7 A;  3EG3 A;  2M0Y A;  2YUN A;  1G83 A;  2YDL A;  1PKS A;  4OMM A;  2B86 A;  3C0C A;  1NYG A;  2QDL A;  2BZ8 A;  4R0K A;  1RLQ C;  2P4R A;  2FPF A;  2CH4 A;  2OAW A;  2FPE A;  5IXB A;  3NPF A;  2DL3 A;  2X3X D;  2J05 A;  2JMA A;  2RNA A;  3EG1 A;  1U5S A;  1AD5 A;  2RMO A;  4Z8A A;  2DLP A;  1Z9Z A;  1H8K A;  4DEY A;  2EW3 A;  2SRC A;  3VRY A;  1SPK A;  4Z88 A;  2KYB A;  2YT6 A;  4WCI A;  4RTZ A;  4ZNX A;  1GRI A;  2DRK A;  1UJY A;  1NG2 A;  4LUE A;  2HEQ A;  1ABO A;  1TUD A;  1BB9 A;  3LH5 A;  1K0S A;  1VYT A;  5EC7 A;  1U3O A;  4AG1 C;  4ESR A;  1OPL A;  1S1N A;  2FRY A;  1YP5 A;  3REB B;  4J9D A;  2OJ2 A;  3VS3 A;  1AZG B;  3EG2 A;  2SEM A;  1CSK A;  2O2O A;  2DF6 A;  1WXB A;  2D0N A;  1SHF A;  1I1J A;  2O31 A;  4HVV A;  4J9G A;  3TSW A;  2C0T A;  1WDX A;  2D8H A;  4RTU A;  3U23 A;  2HDA A;  2D1X A;  2LCS A;  3GBQ A;  1UTI A;  4KRT A;  1UHF A;  4JJC A;  4ORZ A;  2AK5 A;  3NGP A;  1M8M A;  2DA9 A;  2LX7 A;  1HD3 A;  2K3B A;  1XOV A;  1WFW A;  1NEB A;  1EFN A;  2FEI A;  1N5Z A;  3EHR A;  3THK A;  2GTO A;  2LP5 A;  2RPN A;  5FWC A;  1WI7 A;  2DYB A;  4Y92 A;  4HCK A;  1KJW A;  1QKW A;  2NWM A;  4HVU A;  3ZL7 C;  1UEC A;  2EQI A;  1AZE A;  3A98 A;  3TSZ A;  2K6D A;  2O88 A;  4F17 A;  4E6R A;  2L2P A;  1T0H A;  2RQU A;  2K7A A;  2CT4 A;  2GQI A;  2YSQ A;  1A0N B;  2JXB A;  2KGT A;  2RQT A;  1K0X A;  1RLP C;  2DBK A;  2K79 A;  1OOT A;  4J9E A;  2F2V A;  1AWJ A;  1X6G A;  4LE9 A;  4JJB A;  1KFZ A;  1KIK A;  1QWE A;  1T3L A;  3RBB B;  1NEG A;  1E7O A;  1BBZ A;  1AWO A;  2RQV A;  1CKA A;  1K76 A;  3EG0 A;  2RQW A;  2C0O A;  3O5Z A;  1PNJ A;  2DL5 A;  3H41 A;  4CC7 A;  1PRM C;  1YWP A;  2ECZ A;  1WXU A;  1ZUY A;  2DRM A;  1PRL C;  1TG0 A;  1SRM A;  2FPD A;  3RNJ A;  1M3B A;  2A28 A;  4AFU C;  2VKN A;  2HSP A;  2EYY A;  1JXM A;  3JV3 A;  4M4Z A;  5FW9 A;  1G2B A;  3CQT A;  4JJD A;  1PWT A;  1YNZ A;  3EGU A;  2LZ6 B;  2YUQ A;  3TVT A;  2VVK A;  2CSQ A;  2ROL A;  1RUW A;  5FWB A;  1GBQ A;  1YCS B;  2CUB A;  3VS5 A;  3M0Q A;  1MV3 A;  2KE9 A;  1RI9 A;  1AOJ A;  1VYV A;  1AWW A;  2KEA A;  2KBT A;  2LJ3 A;  2G6F X;  1ARK A;  1JQQ A;  4J9F A;  2KXD A;  4RTX A;  4RTY A;  4OMQ A;  1BU1 A;  2XMF A;  2JM8 A;  2RN8 A;  1SSH A;  2KNB B;  2YUP A;  3ULR B;  2CRE A;  2KR3 A;  3NHN A;  2KRN A;  2ROT A;  2EYZ A;  2E5K A;  4D8D A;  4LN2 A;  2HBW A;  1M3A A;  1M30 A;  1UUE A;  2F2X A;  2DL8 A;  2ED0 A;  1YN8 A;  1TUC A;  3M0R A;  1HJD A;  4JPB W;  1GCQ A;  2V1R A;  2BZY A;  4F14 A;  1ZLM A;  3QWX X;  1UDL A;  3M0P A;  1E6G A;  2C0I A;  4AFZ C;  2KRM A;  2CH4 W;  3VS7 A;  2ED1 A;  1X27 A;  2EGE A;  2CUD A;  1JEG A;  1UJ0 A;  2VWF A;  1B07 A;  1UGV A;  2DL4 A;  3VS6 A;  3I5R A;  2JT4 A;  2FRW A;  2DMO A;  3NMZ C;  1JU5 C;  4AFS C;  1SHG A;  4RTW A;  5IH2 A;  4IIM A;  2I0N A;  1X6B A;  3REA B;  1J3T A;  1X2K A;  2JS2 A;  1IO6 A;  2OI3 A;  5GJV B;  1ABQ A;  3UAT A;  2J06 A;  1QKX A;  3PE0 A;  5IXF A;  4RTV A;  1WYX A;  1M27 C;  5HCK A;  2AZS A;  2PNI A;  1AEY A;  4A63 B;  3EHQ A;  1FYN A;  1Z9Q A;  5IHI A;  2JM9 A;  1I0C A;  2NUZ A;  2LMJ A;  2EGC A;  2CT3 A;  3VS2 A;  4CC2 A;  2DBM A;  5ECA A;  1YWO A;  1ZX6 A;  2DJQ A;  2DM1 A;  1OPK A;  2DIL A;  2FG0 A;  2A36 A; 
#chains in the Genus database with same CATH topology
 4RUG A;  1KSW A;  3RDV A;  1OZ2 A;  4MDW A;  2EYQ A;  3CBM A;  1K1Z A;  1GCP A;  1M1K R;  1NPP A;  4LXC A;  2PTK A;  5GMK e;  5GAN f;  1KK7 A;  4FYX B;  2LJ1 A;  2XG8 D;  4OB1 B;  3HFO A;  3JCM h;  1NJI C;  1D3B B;  2M9U A;  1D1C A;  4PJO D;  3M5A A;  1UHC A;  2QA4 A;  3JAM E;  2RHX A;  4XQ3 A;  3JSC A;  2LC4 A;  5HKC A;  3IQL A;  1NYF A;  3ME9 A;  3CCR A;  3QXE B;  2JTE A;  2WAC A;  1GL5 A;  3QYG B;  1NLP C;  2D8J A;  2CDT A;  1TXQ A;  2AIR B;  4L6V 5;  4K11 A;  2HCK A;  1QMC A;  2RK1 A;  1NE8 A;  2EKO A;  4ELY C;  1M90 C;  5IHK A;  5J39 A;  1K9A A;  1VQP A;  1N6A A;  2BZX A;  3H8Z A;  4M78 C;  1QCF A;  1NJI U;  1GFC A;  4D8K A;  1QLY A;  1VQN T;  2CS7 A;  3V8L A;  3UF4 A;  1VQM A;  2JMC A;  3KFV A;  2QTX A;  4F16 A;  3M0S A;  4M75 A;  1MV0 B;  4QQD A;  2MF2 A;  3QDR B;  4FW1 A;  2DTH A;  2DO3 A;  5GAN 3;  1M1F A;  2LCL A;  3V7S A;  4M77 B;  4ZN1 A;  1QVG A;  3FDR A;  1YFN A;  2QQ9 A;  4M77 E;  1IGQ A;  4HVW A;  2MI6 A;  5GMK j;  1VYU A;  3CCJ Q;  1M90 U;  4HCZ A;  1OX8 A;  2A08 A;  5I22 A;  2JNG A;  3CCS T;  3G7Z A;  1R0C B;  4QT7 A;  3RUX A;  2KDS A;  3VU3 C;  4AT1 B;  4A4K A;  2P0P A;  2ABL A;  4BDY A;  4Z89 A;  5LJ5 h;  3RIR A;  3NTH A;  3MHX A;  3P8D A;  3OYK A;  4JS4 A;  1Y57 A;  2H3E B;  3JB9 G;  2R5M A;  1UE9 A;  2K5L A;  1WHL A;  1JJ2 S;  2PUO B;  4DOV A;  5GAM e;  6AT1 B;  4J9I A;  2DEU A;  1RAI B;  3EH1 A;  1VQ8 T;  1BIB A;  2QA4 Q;  2LQW A;  3JRZ A;  3CCR Q;  3CMA T;  4FYV B;  3MKD A;  3OBW A;  3LYI A;  1BI3 A;  5KYN A;  3H0I A;  2QEX T;  3EFR A;  3VS1 A;  1MHN A;  3CEY A;  1YJN A;  1BI0 A;  2FO0 A;  4F7U G;  2ESW A;  5GAO m;  2J6F A;  4BE0 A;  2EVR A;  4A4F A;  1NM7 A;  4VUB A;  2A7Y A;  1VQP Q;  1VQ4 A;  2YUN A;  1G83 A;  1Q86 R;  3OYN A;  5GAO l;  1M9S A;  3J81 E;  3OMC A;  3M9Q A;  4MZP A;  3JCM d;  2QK0 A;  1VQM Q;  1JBM A;  3M57 A;  2P4R A;  2FPF A;  2FL7 A;  2O4X B;  2CH4 A;  3NTI A;  3RR6 A;  4MZT A;  1YJ9 T;  2DL3 A;  2X3X D;  2J05 A;  2RNA A;  3EG1 A;  4JRI A;  2KAF A;  1AD5 A;  4J7F A;  2DLP A;  4M78 A;  3V7C A;  2JTF A;  3EG9 B;  5GAN 6;  2D0Q B;  4WF2 A;  2DK3 A;  3FLG A;  1B34 A;  3LLR A;  4C92 B;  5GAM j;  1TUD A;  3J80 E;  5GAM g;  3FIF A;  2RJE A;  3REB B;  4C92 E;  1N8R C;  1H3Z A;  2HKQ B;  3F70 A;  5CKB A;  3EG2 A;  2EQM A;  1WXB A;  2D0N A;  1WJS A;  2C0T A;  3U23 A;  2D8H A;  4MMK A;  4C92 F;  2HDA A;  2D1X A;  1Q7Y C;  2LCS A;  4RMO A;  3GBQ A;  4C8Q C;  4KH0 B;  4ORZ A;  4E7H A;  2QGF B;  2RK2 A;  3BY7 A;  3NGP A;  3PIP A;  4O6J A;  4J7I A;  2K3B A;  5J3B A;  4E47 A;  2XHC A;  4UC4 A;  1I4K 1;  1IZ6 A;  3THK A;  2GTO A;  2RPN A;  4ZGE B;  5FWC A;  1YJN Q;  2BIV A;  4Y92 A;  4HCK A;  1KJW A;  2QXF A;  1VIF A;  3CCQ A;  2OAU A;  3OQ5 A;  3ZL7 C;  4E7J A;  3A8H B;  2HL3 A;  2EQI A;  1N8R U;  2FVU A;  2HL5 C;  3A98 A;  4QW2 A;  3CCV T;  4KUL A;  1VOM A;  2K6D A;  4M77 D;  1VQ4 Q;  1NJI R;  2DET A;  4E6R A;  5LJ5 d;  3QJY A;  1A0N B;  3OW2 S;  1HYO A;  2QDY B;  4BY6 B;  1Q7Y U;  1YJW A;  2MYS A;  2LCC A;  1YIJ T;  2K79 A;  2XDD A;  2HAX A;  1AWJ A;  1QVF P;  3AHU A;  5I2M A;  3RBB B;  1K76 A;  3HRS A;  3QUI A;  1PSF A;  5D6X A;  4XTU A;  2C0O A;  5CKE A;  4Y91 A;  2E41 A;  1M90 R;  4FIB A;  1AHJ B;  1WXU A;  3JCM P;  1PM3 A;  1TG0 A;  4AFU C;  4IKF A;  2HSP A;  4LDW A;  4XK8 E;  4M4Z A;  5FW9 A;  3LGF A;  5M9O A;  3EGU A;  2WSF E;  3AT1 B;  2VVK A;  1KHI A;  1IGU A;  2ROL A;  3CPW A;  3QSU A;  2RJC A;  4GY5 A;  1ZBX A;  2LNV A;  3EFO B;  3H9N A;  1NBE B;  1OI1 A;  2RI3 A;  5J26 A;  1MV3 A;  4X34 A;  1AWW A;  2LJ3 A;  3JB9 I;  4J9F A;  4BB7 A;  3HP9 A;  1OU9 A;  2KNB B;  3M55 A;  2GFA A;  3NHN A;  3G6E T;  2ROT A;  2E5K A;  4E7L A;  4LN2 A;  4N4H A;  3QJ6 A;  3HL8 A;  3VUB A;  4C8Q A;  2KK4 A;  1Q82 C;  1UUE A;  1RAH B;  3FRN A;  5CKH A;  5GAO q;  2F2X A;  4II1 A;  3L2U A;  5LJ3 e;  3R6O A;  4M7A F;  1NPR A;  3QPH A;  4ZTJ A;  2V1R A;  3OS1 A;  2BZY A;  1ZLM A;  4M7D C;  5GAN d;  1YJW Q;  3G4S A;  2P84 A;  3WVD B;  2CP3 A;  3G71 A;  2P0Q A;  2XU8 A;  1SSF A;  3CCU T;  2O01 E;  4ATO A;  3E19 A;  2CZ7 B;  4C0D B;  4M75 G;  2VV5 A;  3NMZ C;  3CCJ T;  1JU5 C;  4FU6 A;  2DIG A;  4RTW A;  3CD6 A;  2DD4 A;  3UPU A;  1Q82 U;  1IO6 A;  5GJV B;  1ABQ A;  4OF1 A;  3S3N A;  2AT1 B;  1M2V B;  4E7I A;  3CBP A;  1G3S A;  4F04 B;  5FLX E;  3OY9 A;  3KXT A;  3LW5 E;  4ANJ A;  3P8H A;  5IHI A;  3GNF B;  1I0C A;  2LX9 A;  2NUZ A;  3GOX A;  1AT1 B;  4EMK A;  3CCL T;  3UT1 A;  3VS2 A;  2EWN A;  1YWO A;  2PVG B;  4C0Z A;  1ZX6 A;  1M1G A;  3JCM V;  2DM1 A;  2JTM A;  2RB6 A;  2R57 A;  3EGD B;  3CCR T;  4OML A;  5IAY A;  1D0Z A;  2K2M A;  4J9B A;  2E5Q A;  1I8F A;  1O9S A;  1WHM A;  2CSI A;  4PJO F;  5LJ3 j;  4OMF B;  2CP5 A;  1TS9 A;  3OS2 A;  5LJ3 g;  2YLB A;  2JW4 A;  3CC2 Q;  1JO8 A;  1N8R R;  2VB6 A;  2QQB A;  1MUZ A;  3EGX A;  1GBR A;  1AWX A;  5IHN A;  2PU9 B;  2F5K A;  4KGV B;  2JZ2 A;  4J9H A;  1YHQ T;  4PLL A;  2EYX A;  4JJN K;  1UGP B;  3OYD A;  1VQM T;  1X6O A;  2O9S A;  1Q7Y R;  2RF0 A;  2ZAE A;  3SEM A;  5A0D A;  2DKG A;  3G4S Q;  1W1F A;  3NTK A;  3CBO A;  3G71 Q;  2ZPG B;  2V8K A;  2E70 A;  3M0U A;  5GAM f;  4DEX A;  2CYZ B;  4AFQ C;  2L0A A;  3VS0 A;  4PKC C;  2OTJ A;  3VRZ A;  2LT4 A;  1UGS B;  4DBH A;  1ZSG A;  4E7Z A;  3HPW A;  2CZ0 B;  2XDP A;  3CME A;  2PZ1 A;  3JCM J;  4AMC A;  1U06 A;  3M53 A;  4M7D A;  2XID A;  2RHZ A;  1RI0 A;  3I9Q A;  2HNI A;  1M4Z A;  3Q1J A;  4M78 G;  2NUP B;  3R6N A;  2J6K A;  2EPD A;  3SHW A;  1B3Q A;  5A0L A;  2GGR A;  2X3W D;  2MWO A;  4E7S A;  2DIQ A;  1ZHI A;  2EKH A;  2LNH B;  4FT2 A;  5KYW A;  1VQL A;  4C5E A;  3I5S A;  1I5O B;  5FU6 C;  4EMG A;  2RI2 A;  1U1T A;  2K9G A;  4LNP A;  1M3C A;  3DKM A;  1JJ2 A;  1FMK A;  1X2Q A;  4C5G A;  1WGS A;  3DLM A;  5FRO A;  4JZ3 A;  1EIF A;  4IUV A;  3CCM T;  1UG1 A;  2GBQ A;  3CC7 T;  2KXC A;  5CVI A;  2GNC A;  3UA6 A;  2AKL A;  1X43 A;  1WX6 A;  5DY9 A;  1VQ6 T;  4IUQ A;  2L89 A;  3MPU B;  3JCM Q;  2NUT B;  4X9D A;  4XU0 A;  4KT0 E;  5A2Q E;  1VQ4 T;  2X51 A;  1I5L A;  3GPL A;  4IIO A;  2KRO A;  2XIC A;  4OMP A;  2C06 A;  2EJF A;  2EQU A;  1T0J A;  2LJ0 A;  2DZC A;  1D3B A;  1Y71 A;  3OYL A;  5CQX A;  1UB4 A;  5HK3 A;  5A0G A;  3L2V A;  2F69 A;  2E64 A;  3PMT A;  2DVJ A;  1Y96 B;  2OTJ Q;  1H92 A;  3A8M B;  5GAN 7;  1LCK A;  5DM7 R;  2XKO C;  3CME Q;  2D9T A;  1QVF S;  3FEO A;  2M0Y A;  3OB9 A;  4O5V A;  1PKS A;  1Q82 R;  1VQ5 A;  4OMM A;  2ZGW A;  3CXC P;  3QII A;  3JB9 D;  2BZ8 A;  3PTA A;  3M4G A;  1VQL Q;  3OBY A;  5CCA A;  2G3R A;  2NLU A;  3NPF A;  3L2R A;  4OVA A;  3VKI A;  1G3W A;  1G3T A;  1Z9Z A;  1H8K A;  4C92 C;  4DEY A;  4X9C A;  2EW3 A;  2SRC A;  3JCM e;  4Z88 A;  2K2V A;  2YT6 A;  3MP6 A;  1KQS P;  5KYY B;  2DXB A;  2EJ9 A;  1RAA B;  3A8L B;  1BYM A;  1ABO A;  3V7R A;  2DAQ A;  1U3O A;  2ZCF B;  3MET A;  3TRE A;  4ESR A;  2CP7 A;  1S1N A;  3CCQ T;  2OJ2 A;  1AZG B;  1SG5 A;  1RAF B;  3HTR A;  3N5B B;  1CSK A;  4KUD K;  2O31 A;  1I1J A;  2VYT A;  4HVV A;  3S3M A;  3CPF A;  1VQO T;  2AHJ B;  3RKY A;  2KSS A;  4JRK A;  4QKU A;  1KG1 A;  1UHF A;  4JJC A;  4C8Q G;  4CI0 C;  2AK5 A;  1YJW T;  1M8M A;  3MJX A;  1XOV A;  1WFW A;  3OW2 A;  3DB4 A;  1NEB A;  5LL6 S;  2MAM A;  1N5Z A;  4M77 F;  1K73 C;  4HVU A;  4BY6 C;  2QI2 A;  1UEC A;  1YIT A;  2HKN A;  4A53 A;  3TSZ A;  1R0B G;  4DOW A;  2O88 A;  1VQ5 Q;  1T0H A;  2L2P A;  3OYM A;  2K7A A;  2CT4 A;  2YSQ A;  5GAN 8;  2JXB A;  2RQT A;  4L5G A;  3QZ9 B;  4M75 E;  4PNO A;  4QVC A;  1VQ7 A;  2HD0 A;  2F2V A;  4BI3 A;  5LJ3 f;  1X01 A;  2QG9 B;  5LJ5 e;  2YWW A;  5HY6 A;  1BBZ A;  2O4X A;  2RQV A;  5KYX B;  1PD1 A;  1K73 U;  3H41 A;  4MZM A;  2CP6 A;  2ECZ A;  1C6V X;  2DRM A;  1WQ7 A;  4EPC A;  2VKN A;  4QQG A;  4C92 A;  2LDM A;  1PWT A;  1TWB A;  2YUQ A;  2HQE A;  2CSQ A;  5FWB A;  1YCS B;  4M7A C;  2EFI A;  2CUB A;  1VQ9 A;  3SD4 A;  4BUG A;  1AOJ A;  2KBT A;  1WHG A;  1W2B P;  4J6X A;  3G71 T;  3CCE T;  3TEE A;  4FCY A;  1BU1 A;  2YUP A;  4JRQ A;  2LRQ A;  4A4H A;  2KR3 A;  2RD1 A;  1WJQ A;  2X35 A;  4JRP A;  1RL2 A;  2DD5 A;  4ZGD B;  5GAN h;  1YIT Q;  1V29 B;  1XJW B;  3CD6 T;  5KCH A;  3QG1 A;  8ATC B;  2B8A A;  5KH6 A;  3GLX A;  2CKK A;  4F14 A;  3BFM A;  1UDL A;  4C0D C;  4M7D G;  1BKB A;  1VQ7 Q;  1XTD A;  3OYY A;  1EZZ B;  2CH4 W;  2YRV A;  1SF9 A;  2CUD A;  1JEG A;  1RAG B;  2E4H A;  2VWF A;  1B07 A;  2K4Y A;  1OZ3 A;  2XK0 A;  1FMW A;  3VS6 A;  1B34 B;  3I5R A;  2DMO A;  4AFS C;  1SHG A;  5IH2 A;  3I56 A;  2DZ9 A;  1J3T A;  1X2K A;  2OI3 A;  2QGG A;  5GAM d;  2DJZ A;  3OSV A;  4IUU A;  3PE0 A;  4PJO C;  4FT4 A;  4LDX A;  1WYX A;  2X4J A;  4V2S A;  4OGC A;  1M27 C;  2GF7 A;  5HCK A;  2GCX A;  4OB0 B;  4A63 B;  1M8V A;  2X4X A;  3EHQ A;  1FYN A;  2QQR A;  1U1S A;  1UGR B;  2CT3 A;  4CC2 A;  2ZPF B;  1PC0 A;  1VQ9 Q;  1U8R A;  2FG0 A;  3A1P A;  4XTY A;  1N9S A;  3RMQ A;  1QCO A;  4M75 D;  5L23 A;  3EFO A;  1H3H A;  2XD0 A;  1W6X A;  4CC3 A;  1OYX A;  4JS5 A;  2OTJ T;  4C0F A;  3L2W A;  1ZUK A;  1DJ7 B;  3CME T;  3SWN C;  1SKU B;  2KYM A;  4M7A A;  2KMT A;  2D6F A;  1IRE B;  1QWF A;  3RER A;  2FZK B;  4JZ4 A;  1K8A C;  1VQ8 A;  2A37 A;  2IPO B;  4ME7 A;  2ZPI B;  1V1C A;  4HCB A;  3QYH B;  2RI5 A;  3FJP A;  4Y28 E;  1GFD A;  4IUT A;  4E2F B;  4BAC A;  1WA7 A;  3H0F A;  2BKD N;  1CKB A;  4JDS A;  4PFP A;  3CXC S;  3H0H A;  2IVW A;  2ENM A;  1HSQ A;  2MWP A;  2DVE A;  2HBP A;  4PK4 A;  3CC2 A;  1TH7 A;  3OSS C;  1GXI E;  1K73 R;  4ZTF A;  1KQ1 A;  4J9C A;  1KHC A;  2CZ1 B;  3I56 Q;  4KUI A;  2K3Y A;  4LD6 A;  2V8J A;  2LT1 A;  1T3S A;  2BTT A;  2V1Q A;  2OTL A;  1VQN Q;  1IHV A;  4LUD A;  1K8A U;  2MPX C;  1KQS S;  2HQX A;  3UDC A;  2RQR A;  1ZUU A;  1G3Y A;  4PJM A;  4XU3 A;  5CKD A;  4RCB A;  5KYU A;  1YJ9 A;  1I07 A;  2JS0 A;  3OYB A;  1QCN A;  2GTJ A;  3VS4 A;  3FJ5 A;  3QWY A;  3L2Q A;  1PG5 B;  2GQV A;  4PJO A;  2LQ8 A;  2KT1 A;  2CP0 A;  4IUR A;  1W70 A;  2EBP A;  3MP1 A;  1FWZ A;  1GCQ C;  3CCS Q;  2ZPE B;  2BUD A;  1NZ9 A;  3BDU A;  4GBQ A;  4J6Y A;  3I35 A;  2DNU A;  1D09 B;  3M58 A;  2DER A;  4XU2 A;  2J6O A;  4C8Q E;  2J7I A;  4M78 D;  4FL6 A;  2MMP A;  2LQN A;  3HSB A;  3OA6 A;  4OMO A;  1ZBJ A;  3PVL A;  1VQ5 T;  2QA4 T;  3GIB A;  1VQ8 Q;  3RMS A;  4FSS A;  3OYC A;  3MEU A;  1ZSZ B;  1YBY A;  4PJL A;  1OV3 A;  1C0M A;  3C12 A;  2M51 A;  4DBR A;  4GLM A;  1K4U S;  2QEX Q;  3SWN A;  3UA7 A;  1JXO A;  2L3Q A;  4RTT A;  3X28 B;  3ASK A;  3BDL A;  4HA8 A;  3JB9 F;  4X1V A;  1PHT A;  3GP8 A;  1VQP T;  3EG3 A;  1Y7X A;  4F7U B;  2CP2 A;  2EAY A;  5L8R E;  1QP2 A;  1NYG A;  1EX4 A;  2OTL Q;  4F7U E;  4R0K A;  4EMK B;  1XQH A;  2KI7 A;  2Y90 A;  2DXC A;  2HZY A;  2OAW A;  4HT9 A;  2DEQ A;  3MP8 A;  4F7U F;  1YJ9 Q;  2JMA A;  4Z8A A;  5GAN 4;  4FSX A;  2Y4Y A;  4C92 G;  2JUF A;  4EDU A;  1H64 1;  5KE2 A;  2KVQ G;  4WCI A;  3NFC A;  4RTZ A;  3PIO A;  2L3R A;  5LJ3 d;  2DRK A;  3JCM c;  4LUE A;  4ZGJ B;  3I55 A;  4M77 C;  1VYT A;  5EC7 A;  4AG1 C;  3OYI A;  1OPL A;  2FRY A;  1YP5 A;  4J9D A;  3SFM A;  3VS3 A;  3X24 B;  2SEM A;  1YIT T;  1W2B S;  2O2O A;  3JCM W;  1WNL A;  4J9G A;  2K5I A;  2EJG A;  3HFN A;  4DBF A;  3TSW A;  1HK9 A;  1I81 A;  1QW1 A;  1G8X A;  1UTI A;  4LD9 K;  4KRT A;  1WHJ A;  1LNX A;  2LX7 A;  3MO8 A;  2L8D A;  4OGE A;  1QVG P;  2RHI A;  1MMD A;  3ER0 A;  2LP5 A;  1K9M C;  3H6Z A;  1YJN T;  4M7D B;  1WI7 A;  2CZ6 B;  2DYB A;  2COY A;  1PD0 A;  2QQS A;  2FYK A;  1QKW A;  2NWM A;  3VUZ A;  3E2U A;  4M7D E;  3PNW C;  1AZE A;  1Y96 A;  2FZC B;  4A4G A;  3CCV Q;  5D6W A;  2XI9 A;  2PQW A;  4NS5 A;  5GAN 2;  2GQI A;  4QVZ A;  2KGT A;  1K0X A;  3E9F A;  3TQ7 P;  2X9H A;  3HRU A;  2DBK A;  4C0G A;  1K8A R;  3TCJ A;  1YIJ Q;  2YRD A;  4J9E A;  5GMK h;  5KE3 A;  5DLQ E;  1KFZ A;  3CCU A;  4C8Q D;  1OUL A;  2VXF A;  5GMK i;  2F5T X;  1KIK A;  1MMG A;  3G1J A;  1E7O A;  4PL6 A;  3HHT B;  4B6M A;  1K9M U;  5IN1 A;  1VQ9 T;  3O5Z A;  4HKE A;  1PNJ A;  4RG8 A;  2DL5 A;  2E6N A;  4CC7 A;  5EG2 A;  5FU7 B;  3X20 B;  1BI1 A;  1RAE B;  1ZUY A;  1PRL C;  4XTV A;  3I55 Q;  1SRM A;  3RNJ A;  1M3B A;  2A28 A;  3FB9 A;  4BI4 A;  5KYY A;  2KQW A;  1JXM A;  1Q81 R;  1RAC B;  1G2B A;  7AT1 B;  3M54 A;  2LZ6 B;  3CCL A;  2VAS A;  3TVT A;  1RUW A;  1ZQ1 A;  4M7A G;  1JRI A;  3CC4 A;  2KEA A;  4M77 A;  4HT8 A;  1D1B A;  4IUP A;  3MEV A;  4RTX A;  3S6W A;  4RTY A;  4OMQ A;  4P5N A;  2JM8 A;  2RN8 A;  2CRE A;  2DPP B;  4WTO B;  2EYZ A;  2RHY A;  3G6E Q;  4D8D A;  4LDY A;  2HBW A;  4N0A C;  3LWH A;  3BW1 A;  3D7S B;  3MEW A;  4XTX A;  4XTZ A;  4JLI A;  3I56 T;  4RG2 A;  3WXM B;  2ED0 A;  1HXD A;  2GFU A;  1TUC A;  1YHQ A;  3GF5 A;  1HJD A;  1LOJ A;  3RES A;  3EAE A;  4DQ2 A;  3WVE B;  2COW A;  1VQK A;  2E6Z A;  3S3O A;  1N27 A;  1TTH B;  2C0I A;  4R55 A;  2KRM A;  4CRI A;  3CCU Q;  2CGH A;  2ED1 A;  4HCC A;  1UJ0 A;  2JJ9 A;  1UGV A;  5GAM h;  2DL4 A;  1WZO A;  2JT4 A;  1QVP A;  2FRW A;  5GAO r;  2RH2 A;  5FU6 B;  3ZEH A;  2JS2 A;  4M75 B;  4D6W A;  4KH1 B;  3UAT A;  2DTI A;  2HSE B;  4Z02 A;  5KYX A;  3E9G A;  1QKX A;  3A8O B;  3QBY A;  3MCA B;  3A8G B;  4BDZ A;  5IXF A;  2DXT A;  4PJO G;  4A54 A;  2QTV A;  4NOY A;  1Y07 A;  1MNE A;  2F1L A;  1YCY A;  5CIU A;  2AZS A;  2LVM A;  2PNI A;  1AEY A;  4JUV A;  2E1H A;  3EFS A;  3JCM g;  5IT9 E;  2JM9 A;  2PVD B;  4M75 F;  2FZG B;  4FM4 B;  2E3I A;  4M7D D;  3CCL Q;  1WJR A;  3LH0 A;  2DBM A;  3QDF A;  4LDV A;  1YI2 A;  1Q95 G;  2DJQ A;  1OPK A;  2DIL A;  3CC4 Q;  2A36 A;  2MK5 A;  1BCO A;  3CCM A;  3CC7 A;  3TU4 K;  2L3S A;  1WLP B;  1FXX A;  3EG9 A;  4MML A;  4C5I A;  3P8B B;  3LWI A;  1IRX A;  1MMA A;  1VQ6 A;  2ZPH B;  1WIE A;  3CC2 T;  1D1A A;  2OX7 A;  2WSC E;  1E6H A;  3CXC A;  2EGA A;  2PVO B;  1S72 A;  2ZPB B;  2MOX A;  1V76 A;  2LTO A;  4RCC A;  3C95 A;  5AT1 B;  1YHQ Q;  2OTL T;  2DX1 A;  2I2L A;  2HQH A;  1VUB A;  3G4S T;  1VQK Q;  1BK2 A;  2W10 A;  3CPW P;  2L3P A;  2KRS A;  4N0A A;  2IIM A;  2ZZD A;  1KQS A;  2MIO A;  2DE0 X;  4PFZ A;  1PSE A;  1KC8 R;  2P4T A;  5I21 A;  1BCM A;  1K9M R;  1X69 A;  4OP0 A;  2DL7 A;  2L5Q A;  2QAZ A;  1G5V A;  2F2W A;  1ZA2 B;  2KT8 A;  3J7A F;  2O9V A;  4HXJ A;  2BE9 B;  4BE1 A;  5LJ5 j;  5FRM A;  1Y0M A;  1JB0 E;  5LJ5 g;  2E65 A;  1VA7 A;  1FX7 A;  4M78 B;  5GAO p;  5CR2 A;  5C0M A;  3SB2 A;  4M78 E;  3OYG A;  1R77 A;  1QP3 A;  5GJW B;  5I11 A;  1YI2 Q;  4EIK A;  4B9W A;  1OEB A;  5GAN e;  3HRT A;  1D0Y A;  1UFF A;  3DB3 A;  3OYH A;  4XTW A;  1TU0 B;  1SEM A;  4BI8 B;  4M78 F;  2VXE A;  5GAN 5;  4AG2 C;  3OYA A;  2MCN A;  2YXY A;  3CCM Q;  1SRL A;  1WXT A;  3CC7 Q;  2W0Z A;  2P0K A;  1C1A A;  5GAO n;  2E3H A;  5DLO A;  1VQN A;  3SDZ A;  3X26 B;  4FYY B;  8AT1 B;  2H8H A;  2EYW A;  3M0T A;  4XAX B;  1VQ6 Q;  2AZV A;  2E12 A;  3QHS A;  1QVG S;  3LGL A;  4QQ6 A;  1ZSZ C;  1QQJ A;  4QVD A;  1VQO A;  3JCM X;  1S72 Q;  3PVQ A;  2IG0 A;  3LX7 A;  4OMN A;  4CC4 B;  2ATC B;  4LDU A;  1NLO C;  2AKK A;  1KD1 C;  4KBM B;  3JB9 H;  3L2Z A;  4PJJ A;  1MMN A;  1WPY A;  5I2S A;  1ZA1 B;  3CCS A;  2A0F B;  1PKT A;  5CO7 A;  2NYS A;  2DTO A;  1AVZ C;  4NL2 A;  2VGN A;  4BD3 A;  2YUO A;  3E1S A;  1MGQ A;  4EMK C;  2M1H A;  4KGX B;  4DA4 A;  1IXD A;  2YDL A;  1RAB B;  4PJN A;  2COZ A;  2B86 A;  3I55 T;  2VC8 A;  3C0C A;  2QDL A;  2EIF A;  1N9R A;  4ZN3 A;  2K3X A;  1RLQ C;  5GAN j;  1VQL T;  1KD1 U;  3CMA A;  2K5F A;  4J5Y A;  5CK9 A;  5GAN g;  2FPE A;  2QYZ A;  2JN0 A;  5IXB A;  3GNG A;  2QEX A;  4J8O A;  3L42 A;  4PFO A;  1U5S A;  3RKW A;  4OB2 B;  2RMO A;  3M59 A;  3MEA A;  1W2B A;  1UGQ B;  5LJ3 h;  3VRY A;  2RHU A;  1SPK A;  2H3J A;  2KYB A;  3HKS A;  3JCM b;  1M1K C;  2V26 A;  3KBG A;  4ZNX A;  1GRI A;  4B9X A;  1UJY A;  1NG2 A;  4M7A B;  2HEQ A;  4J6W A;  1BB9 A;  3LH5 A;  1K0S A;  3V8J A;  1Q81 C;  4M77 G;  4MDX A;  1D0X A;  4M7A E;  2DYI A;  4DBQ A;  3CCQ Q;  2DF6 A;  1M2V A;  4OB3 B;  1SHF A;  2RJF A;  5C6S A;  1VQO Q;  4PLI A;  1WDX A;  2VGM A;  4RTU A;  3BE3 A;  4FW2 A;  5D7U A;  3OYF A;  4NL3 A;  2DA9 A;  1HD3 A;  3QKJ A;  2WSE E;  2LQK A;  2X4W A;  3T9N A;  3CCE A;  1IHW A;  1EFN A;  1JJ2 P;  4C92 D;  1M1K U;  1PCX A;  2FEI A;  3EHR A;  4C8Q B;  1ZSZ A;  3EGD A;  2A3L A;  3OS0 A;  1OU8 A;  3JCM f;  5KCO A;  2M16 A;  5FRN A;  3M56 A;  1Q81 U;  1M2O A;  2M0O A;  2DFU A;  1BIA A;  4FYW B;  4F17 A;  2VUB A;  4C8Q F;  9ATC B;  1VIE A;  2RQU A;  1QVF A;  3V8K A;  5KYU B;  2KY9 A;  5CAI A;  1MND A;  1RLP C;  4F7U A;  1OOT A;  1B7T A;  3QO3 A;  2RJD A;  4BE2 A;  1X6G A;  4LE9 A;  3CMA Q;  4C5H A;  4JJB A;  3X25 B;  3RKX A;  2FHD A;  5FU7 C;  3EH2 A;  3DLL A;  1KQ2 A;  4PJO B;  3VJP A;  1QWE A;  1T3L A;  1NEG A;  1AWO A;  2R58 A;  2X4Y A;  1CKA A;  3JB9 J;  3URG A;  3EG0 A;  4PJO E;  2Y4X A;  1F1B B;  2RQW A;  3CC4 T;  1M5Q 1;  2RA2 A;  3CCV A;  4J83 A;  5D6Y A;  4ELZ C;  1PRM C;  1YWP A;  2FB7 A;  2PUK B;  3PGG A;  3PFS A;  1LVK A;  1LJO A;  2FPD A;  1TSF A;  2YHT A;  1YIJ A;  2EYY A;  3JV3 A;  2NUP A;  3CQT A;  4JJD A;  3OYJ A;  1OX9 A;  1YNZ A;  4R56 A;  4E7K A;  2XDB A;  1O75 A;  1ACM B;  2JVV A;  3L1A A;  2HMA A;  1GBQ A;  3ZBD A;  2Z0W A;  2RM4 A;  5AYF A;  3VS5 A;  3M0Q A;  4JLG A;  2KE9 A;  1RI9 A;  3SWN B;  4N4I A;  4XU1 A;  1VQK T;  1VYV A;  2RO0 A;  1WQW A;  2G6F X;  1ARK A;  1JQQ A;  2DXU A;  2KXD A;  3CCE Q;  2QQA A;  5LJ5 f;  2XMF A;  1SSH A;  3ULR B;  1W4S A;  5HK0 A;  3EGX B;  3VYG A;  1WHK A;  2KRN A;  3QZ5 B;  3INZ A;  2K57 A;  1M3A A;  4Q5W A;  1FMV A;  1Q86 C;  1X75 C;  3CPW S;  1M30 A;  4RKU E;  2QAS A;  3CD6 Q;  2DL8 A;  1RAD B;  1YN8 A;  2BE7 D;  1R8O B;  3M0R A;  2NUT A;  4JPB W;  1GCQ A;  4EMH A;  1P92 A;  2EQJ A;  3QWX X;  3M0P A;  3OS5 A;  3UWN A;  4TVR A;  2R5A A;  1VQ7 T;  3O8V A;  1E6G A;  5CQY A;  3VYH B;  1KD1 R;  1WHH A;  4AFZ C;  2EQK A;  1KC8 C;  4M7A D;  3VS7 A;  3FC3 A;  1X27 A;  1LPL A;  2EGE A;  3C4S A;  4M75 C;  1BI2 A;  1YI2 T;  3G6E A;  4N4G A;  3OW2 P;  1TOV A;  2YRC A;  5GMK m;  3PMI A;  1UEB A;  2V8I A;  3PT9 A;  2JOY A;  2E10 A;  4IIM A;  2I0N A;  1IB8 A;  1X6B A;  3REA B;  1Q86 U;  4YTL A;  5KYW B;  2J06 A;  5GMK l;  3M4Y A;  4M7D F;  1TUG B;  4RTV A;  5CKF A;  4A4E A;  1XNI A;  3KUF A;  1Z9Q A;  1OQK A;  2LMJ A;  4KGZ B;  3C94 A;  2EGC A;  1S72 T;  4GLK A;  1KC8 U;  3OMG A;  5ECA A;  3OYE A;  3VV0 A;  2YLC A;  4L59 A;  2M02 A;  3CCJ A;  3A5Z B;  3ZFJ A; 
#chains in the Genus database with same CATH homology
 4RUG A;  1KSW A;  4OML A;  2K2M A;  4J9B A;  5L23 A;  1H3H A;  2CSI A;  1K1Z A;  1GCP A;  2L3S A;  1WLP B;  1W6X A;  4CC3 A;  2PTK A;  1WIE A;  1ZUK A;  2JW4 A;  2LJ1 A;  1E6H A;  1JO8 A;  2KYM A;  1MUZ A;  2EGA A;  1GBR A;  1AWX A;  5IHN A;  2MOX A;  1QWF A;  4JZ4 A;  4J9H A;  1UHC A;  2EYX A;  2A37 A;  2O9S A;  2DX1 A;  2RF0 A;  1V1C A;  3IQL A;  3SEM A;  1NYF A;  2JTE A;  1BK2 A;  2W10 A;  1GL5 A;  1W1F A;  1NLP C;  2D8J A;  2L3P A;  1GFD A;  2CDT A;  2KRS A;  3M0U A;  2IIM A;  4DEX A;  1WA7 A;  3H0F A;  4K11 A;  4AFQ C;  2MIO A;  2DE0 X;  1CKB A;  2HCK A;  2L0A A;  3VS0 A;  3H0H A;  3VRZ A;  2ENM A;  1HSQ A;  1ZSG A;  1X69 A;  5IHK A;  1K9A A;  2PZ1 A;  4J9C A;  1U06 A;  2BZX A;  2DL7 A;  1QCF A;  1GFC A;  4D8K A;  3I9Q A;  1QLY A;  3R6N A;  2F2W A;  2KT8 A;  2O9V A;  4HXJ A;  1T3S A;  2BTT A;  2V1Q A;  2J6K A;  1Y0M A;  3UF4 A;  2EPD A;  3SHW A;  1B3Q A;  2JMC A;  2GGR A;  2X3W D;  3KFV A;  4LUD A;  1VA7 A;  4F16 A;  3M0S A;  2LNH B;  1MV0 B;  2EKH A;  2RQR A;  1ZUU A;  3I5S A;  1I07 A;  2JS0 A;  2GTJ A;  3VS4 A;  3FJ5 A;  5GJW B;  2K9G A;  5I11 A;  4LNP A;  1M3C A;  4EIK A;  3QWY A;  1OEB A;  1FMK A;  1UFF A;  4HVW A;  1VYU A;  1X2Q A;  1SEM A;  2KT1 A;  2A08 A;  4AG2 C;  5I22 A;  1W70 A;  2EBP A;  4JZ3 A;  1UG1 A;  2GBQ A;  2MCN A;  2KXC A;  1GCQ C;  4QT7 A;  1SRL A;  1WXT A;  2W0Z A;  4GBQ A;  2GNC A;  3I35 A;  2DNU A;  3UA6 A;  2AKL A;  2ABL A;  1X43 A;  1WX6 A;  2H8H A;  2EYW A;  3M0T A;  4Z89 A;  2AZV A;  2J6O A;  2J7I A;  2LQN A;  1Y57 A;  1UE9 A;  4OMO A;  1ZBJ A;  3PVL A;  4IIO A;  2KRO A;  4OMP A;  4J9I A;  1T0J A;  3PVQ A;  4OMN A;  2LJ0 A;  4CC4 B;  1NLO C;  2AKK A;  4FSS A;  2LQW A;  1OV3 A;  2M51 A;  1PKT A;  3H0I A;  4GLM A;  1K4U S;  3VS1 A;  2DVJ A;  3UA7 A;  1JXO A;  1AVZ C;  2FO0 A;  2L3Q A;  4RTT A;  2ESW A;  1H92 A;  2J6F A;  4X1V A;  2YUO A;  1PHT A;  2EVR A;  1LCK A;  1NM7 A;  3EG3 A;  2M0Y A;  2YUN A;  1G83 A;  2YDL A;  1PKS A;  4OMM A;  2B86 A;  3C0C A;  1NYG A;  2QDL A;  2BZ8 A;  4R0K A;  1RLQ C;  2P4R A;  2FPF A;  2CH4 A;  2OAW A;  2FPE A;  5IXB A;  3NPF A;  2DL3 A;  2X3X D;  2J05 A;  2JMA A;  2RNA A;  3EG1 A;  1U5S A;  1AD5 A;  2RMO A;  4Z8A A;  2DLP A;  1Z9Z A;  1H8K A;  4DEY A;  2EW3 A;  2SRC A;  3VRY A;  1SPK A;  4Z88 A;  2KYB A;  2YT6 A;  4WCI A;  4RTZ A;  4ZNX A;  1GRI A;  2DRK A;  1UJY A;  1NG2 A;  4LUE A;  2HEQ A;  1ABO A;  1TUD A;  1BB9 A;  3LH5 A;  1K0S A;  1VYT A;  5EC7 A;  1U3O A;  4AG1 C;  4ESR A;  1OPL A;  1S1N A;  2FRY A;  1YP5 A;  3REB B;  4J9D A;  2OJ2 A;  3VS3 A;  1AZG B;  3EG2 A;  2SEM A;  1CSK A;  2O2O A;  2DF6 A;  1WXB A;  2D0N A;  1SHF A;  1I1J A;  2O31 A;  4HVV A;  4J9G A;  3TSW A;  2C0T A;  1WDX A;  2D8H A;  4RTU A;  3U23 A;  2HDA A;  2D1X A;  2LCS A;  3GBQ A;  1UTI A;  4KRT A;  1UHF A;  4JJC A;  4ORZ A;  2AK5 A;  3NGP A;  1M8M A;  2DA9 A;  2LX7 A;  1HD3 A;  2K3B A;  1XOV A;  1WFW A;  1NEB A;  1EFN A;  2FEI A;  1N5Z A;  3EHR A;  3THK A;  2GTO A;  2LP5 A;  2RPN A;  5FWC A;  1WI7 A;  2DYB A;  4Y92 A;  4HCK A;  1KJW A;  1QKW A;  2NWM A;  4HVU A;  3ZL7 C;  1UEC A;  2EQI A;  1AZE A;  3A98 A;  3TSZ A;  2K6D A;  2O88 A;  4F17 A;  4E6R A;  2L2P A;  1T0H A;  2RQU A;  2K7A A;  2CT4 A;  2GQI A;  2YSQ A;  1A0N B;  2JXB A;  2KGT A;  2RQT A;  1K0X A;  1RLP C;  2DBK A;  2K79 A;  1OOT A;  4J9E A;  2F2V A;  1AWJ A;  1X6G A;  4LE9 A;  4JJB A;  1KFZ A;  1KIK A;  1QWE A;  1T3L A;  3RBB B;  1NEG A;  1E7O A;  1BBZ A;  1AWO A;  2RQV A;  1CKA A;  1K76 A;  3EG0 A;  2RQW A;  2C0O A;  3O5Z A;  1PNJ A;  2DL5 A;  3H41 A;  4CC7 A;  1PRM C;  1YWP A;  2ECZ A;  1WXU A;  1ZUY A;  2DRM A;  1PRL C;  1TG0 A;  1SRM A;  2FPD A;  3RNJ A;  1M3B A;  2A28 A;  4AFU C;  2VKN A;  2HSP A;  2EYY A;  1JXM A;  3JV3 A;  4M4Z A;  5FW9 A;  1G2B A;  3CQT A;  4JJD A;  1PWT A;  1YNZ A;  3EGU A;  2LZ6 B;  2YUQ A;  3TVT A;  2VVK A;  2CSQ A;  2ROL A;  1RUW A;  5FWB A;  1GBQ A;  1YCS B;  2CUB A;  3VS5 A;  3M0Q A;  1MV3 A;  2KE9 A;  1RI9 A;  1AOJ A;  1VYV A;  1AWW A;  2KEA A;  2KBT A;  2LJ3 A;  2G6F X;  1ARK A;  1JQQ A;  4J9F A;  2KXD A;  4RTX A;  4RTY A;  4OMQ A;  1BU1 A;  2XMF A;  2JM8 A;  2RN8 A;  1SSH A;  2KNB B;  2YUP A;  3ULR B;  2CRE A;  2KR3 A;  3NHN A;  2KRN A;  2ROT A;  2EYZ A;  2E5K A;  4D8D A;  4LN2 A;  2HBW A;  1M3A A;  1M30 A;  1UUE A;  2F2X A;  2DL8 A;  2ED0 A;  1YN8 A;  1TUC A;  3M0R A;  1HJD A;  4JPB W;  1GCQ A;  2V1R A;  2BZY A;  4F14 A;  1ZLM A;  3QWX X;  1UDL A;  3M0P A;  1E6G A;  2C0I A;  4AFZ C;  2KRM A;  2CH4 W;  3VS7 A;  2ED1 A;  1X27 A;  2EGE A;  2CUD A;  1JEG A;  1UJ0 A;  2VWF A;  1B07 A;  1UGV A;  2DL4 A;  3VS6 A;  3I5R A;  2JT4 A;  2FRW A;  2DMO A;  3NMZ C;  1JU5 C;  4AFS C;  1SHG A;  4RTW A;  5IH2 A;  4IIM A;  2I0N A;  1X6B A;  3REA B;  1J3T A;  1X2K A;  2JS2 A;  1IO6 A;  2OI3 A;  5GJV B;  1ABQ A;  3UAT A;  2J06 A;  1QKX A;  3PE0 A;  5IXF A;  4RTV A;  1WYX A;  1M27 C;  5HCK A;  2AZS A;  2PNI A;  1AEY A;  4A63 B;  3EHQ A;  1FYN A;  1Z9Q A;  5IHI A;  2JM9 A;  1I0C A;  2NUZ A;  2LMJ A;  2EGC A;  2CT3 A;  3VS2 A;  4CC2 A;  2DBM A;  5ECA A;  1YWO A;  1ZX6 A;  2DJQ A;  2DM1 A;  1OPK A;  2DIL A;  2FG0 A;  2A36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...