2HSPA

Solution structure of the sh3 domain of phospholipase cgamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)
publication title Solution structure of the SH3 domain of phospholipase C-gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphoric diester hydrolase
total genus 4
structure length 71
sequence length 71
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2hspA00
1RLPC 2JS2A 3JV3A 5I22A 2A36A 2VWFA 2DNUA 2DM1A 3UATA 1TUCA 5IH2A 2DBMA 1UFFA 1M30A 1WDXA 2ESWA 4RTXA 2CSIA 2KEAA 1SEMA 1M8MA 2VKNA 2YUNA 2K2MA 4JPBW 4CC4B 2RPNA 3VS1A 2P4RA 2GBQA 2X3XD 1ZSGA 2AZSA 1ZUUA 1GCQA 3EG0A 1AWJA 1MV3A 1W70A 4OMMA 1I0CA 1UECA 2W0ZA 2JT4A 4JJCA 1WFWA 2RQUA 2DL3A 1PRMC 5L23A 5GJVB 1QWFA 2JXBA 1M27C 1MV0B 2DA9A 2EYYA 2GTJA 4RTTA 1GCPA 3NMZC 1KIKA 4Y92A 1KJWA 1VYTA 4F14A 4AG1C 1QKWA 2PTKA 1X2KA 2EPDA 2FRWA 1AD5A 1WXUA 1SRLA 1ZUYA 3U23A 4RTZA 2M0YA 1GBQA 3C0CA 1BB9A 1HSQA 2DILA 4J9DA 3LH5A 2L3QA 1X6BA 1JEGA 2FPEA 5EC7A 2JTEA 2C0IA 2RNAA 1K9AA 3CQTA 2M51A 2SRCA 1FMKA 4CC2A 2FRYA 4EIKA 4Z88A 2JMAA 3EHQA 1X43A 1NEGA 2K6DA 1S1NA 1WYXA 2DBKA 2PNIA 2DMOA 2BZ8A 1VYVA 1YCSB 2F2WA 3H0IA 2RQRA 1I1JA 3H0HA 2HBWA 2DE0X 2FG0A 3SHWA 1K76A 3PE0A 5IHNA 4J9EA 1J3TA 3H0FA 3PVQA 1YNZA 1BU1A 1SHFA 1YWPA 4LN2A 4HVVA 3KFVA 2ECZA 1ABOA 2D8JA 1M3CA 1UHFA 2ED1A 2HSPA 2JMCA 1UE9A 2D0NA 2DX1A 1ARKA 1E7OA 2A28A 2RQTA 4OMNA 3THKA 2KRNA 1H8KA 2C0TA 4JZ4A 5ECAA 4LUEA 1EFNA 5IXFA 2EGCA 2C0OA 2NWMA 1XOVA 4Z8AA 3VRZA 1GCQC 3UA6A 4OMQA 1X69A 2IIMA 2ROTA 2LNHB 1PKTA 1ZX6A 2FO0A 5IHIA 1NYGA 2NUZA 2AZVA 1PNJA 1T0HA 4HVWA 2DYBA 3UF4A 2LX7A 4CC7A 1AWOA 1PRLC 3R6NA 2BTTA 4ORZA 1PKSA 2LJ1A 1UHCA 3SEMA 2X3WD 1T0JA 2CUBA 4M4ZA 2VVKA 5I11A 1Z9QA 4LE9A 2K7AA 5FWCA 3M0QA 2HDAA 3I35A 1YP5A 4J9FA 2SEMA 1KFZA 4IIOA 2ROLA 2EGAA 2RMOA 2K9GA 4HXJA 1RUWA 4GLMA 1WI7A 4OMOA 2EYXA 2ED0A 1AVZC 2PZ1A 4JZ3A 4AFZC 2KBTA 1JU5C 4J9HA 3I5SA 1T3LA 2A08A 4JJDA 2J6OA 4LNPA 3TVTA 3UA7A 1K0XA 1E6GA 1NLOC 1AWXA 2MOXA 2QDLA 1FYNA 2JW4A 1H92A 2J05A 2H8HA 4AG2C 3ULRB 2BZXA 1PWTA 5FWBA 1Y0MA 3EG1A 2KGTA 2AKLA 1Z9ZA 3QWXX 4F17A 2CSQA 4R0KA 1LCKA 2E5KA 2KXDA 2RN8A 1G83A 1Y57A 3M0RA 2EW3A 4HCKA 1V1CA 2KE9A 3VS7A 5IXBA 1K1ZA 1UG1A 2DRMA 4AFQC 2CH4W 1A0NB 3ZL7C 2O9SA 1W6XA 2KRMA 1SRMA 2KR3A 2RQWA 2CUDA 5FW9A 1YWOA 4GBQA 2KROA 2EQIA 3NHNA 2O2OA 3VS2A 4AFUC 2YDLA 2CT4A 1I07A 1JQQA 2YT6A 1K4US 2OJ2A 1W1FA 2KYBA 1U06A 3NGPA 1B07A 2KT8A 1SPKA 1BK2A 2L3SA 2YUQA 1OOTA 1PHTA 2JS0A 1QKXA 1X6GA 1HJDA 2MIOA 2KXCA 3EG3A 1X2QA 1VA7A 1WXBA 3REAB 4D8KA 1TUDA 1RI9A 2EYZA 1NLPC 2V1RA 4ESRA 1AZGB 1OPLA 1OEBA 1YN8A 4OMLA 1SHGA 2DL8A 1UJYA 4ZNXA 3M0SA 1U5SA 1ZLMA 2D8HA 3RNJA 1NM7A 1NYFA 2EGEA 1GFCA 4RUGA 2KNBB 3VS4A 4DEXA 2DF6A 3A98A 2V1QA 3EG2A 2W10A 4AFSC 2DRKA 2HCKA 2EKHA 1M3AA 1SSHA 2KYMA 2LZ6B 1WLPB 2I0NA 4LUDA 1JXOA 4F16A 2DL4A 2LQWA 2L3PA 3EGUA 2EVRA 2JM9A 4RTVA 1QWEA 2ENMA 1JO8A 5IHKA 2XMFA 4JJBA 4D8DA 1G2BA 2MCNA 1UTIA 4FSSA 1AZEA 2EBPA 1UJ0A 2BZYA 1AWWA 1OV3A 1MUZA 1U3OA 1RLQC 2L2PA 2FPFA 2CT3A 1UGVA 2AKKA 3RBBB 1CSKA 4J9BA 2O31A 4WCIA 2LQNA 3O5ZA 3VS5A 3M0TA 1TG0A 2DJQA 2YUOA 3IQLA 2FEIA 2J7IA 2DLPA 2CREA 5GJWB 4RTUA 2K3BA 3VS3A 3GBQA 4J9GA 2GQIA 4J9IA 1UDLA 1M3BA 2LCSA 2F2XA 1OPKA 2YUPA 3H41A 3M0UA 4OMPA 3REBB 2OAWA 1ZUKA 1QCFA 1VYUA 3TSWA 2CH4A 1QLYA 1ZBJA 2K79A 2FPDA 2O88A 1CKAA 2F2VA 2ABLA 4X1VA 1B3QA 2O9VA 4A63B 2D1XA 1T3SA 3PVLA 2B86A 1NG2A 1ABQA 1HD3A 1UUEA 2YSQA 1BBZA 2AK5A 1X27A 1AOJA 1KSWA 1WIEA 2JM8A 2GGRA 2GTOA 3NPFA 4CC3A 3M0PA 2LMJA 4DEYA 2J06A 1N5ZA 5HCKA 2EYWA 2A37A 3I5RA 1E6HA 2OI3A 4RTYA 2KT1A 3FJ5A 3VS0A 2J6FA 2LJ3A 1H3HA 2J6KA 2RF0A 2LP5A 4KRTA 3VRYA 1GFDA 4RTWA 1GBRA 4HVUA 2RQVA 2L0AA 2DVJA 1WA7A 1GL5A 1K0SA 2DL5A 4QT7A 4K11A 1WXTA 1WX6A 3TSZA 2CDTA 4Z89A 1JXMA 2G6FX 2KRSA 1GRIA 2DL7A 2LJ0A 3I9QA 2HEQA 4E6RA 4J9CA 2GNCA 1IO6A 1CKBA 3QWYA 3EHRA 3VS6A 4IIMA 1AEYA 1NEBA
chains in the Genus database with same CATH superfamily
3V7CA 1RLPC 3BDUA 2JS2A 2DJZA 3S6WA 2EFIA 2QEXT 2DXTA 2DNUA 2LC4A 4PJOD 5IH2A 5KE2A 2ESWA 4RTXA 2CSIA 1V29B 3VU3C 3CCJQ 4OB0B 2VKNA 2E6ZA 2RPNA 1LVKA 2X3XD 2JOYA 3D7SB 3QPHA 3CCEQ 5GAMf 3OYDA 2AZSA 4JRQA 1GCQA 3EG0A 3EG9B 1IHWA 2DKGA 2JN0A 2ZGWA 3CMEA 1W70A 4EPCA 4PJOG 1Q86U 2JT4A 1OU9A 3M58A 3A8HB 1D0XA 3PNWC 4M77F 4BE0A 1N9SA 5GAOp 4Z02A 1KIKA 1QVFP 1KJWA 1M2VA 1VYTA 2GF7A 1D1BA 1QKWA 2FRWA 2ZPEB 2ZZDA 4JLIA 4RTZA 2M0YA 2PVDB 3C0CA 1SF9A 4XTYA 1WQWA 1KQSP 2M02A 5EC7A 2C0IA 2RNAA 3LH0A 2LDMA 1JJ2A 1FMKA 3L42A 3I56T 4CC2A 3CCRQ 4M78B 2JMAA 4EMHA 1NEGA 4M78C 1WYXA 5I21A 1YJWT 2K5LA 5LJ3f 1VYVA 2COYA 3H0IA 3M57A 3CD6Q 1I1JA 3UT1A 1I5LA 1YCYA 4GLKA 1YIJT 3SHWA 2K3YA 4EMGA 4YTLA 3F70A 1WJSA 1PD1A 2ECZA 1M3CA 4HKEA 2DETA 2HSPA 2D0NA 2DX1A 1BYMA 3MP1A 4E7ZA 3V8JA 3THKA 1RADB 2VV5A 4M7DB 1M1KR 1M4ZA 5CR2A 4M7DC 1X69A 1Y96A 1ZX6A 1YHQQ 1NYGA 4OP0A 2MF2A 1PNJA 4XTUA 2DEQA 1NBEB 2DK3A 2DYBA 3CCMT 2LX7A 1MNEA 3R6NA 1KHCA 1M8VA 1WZOA 3CC7T 2X3WD 5FWCA 2P0KA 5KYXB 3CMAQ 2HDAA 5DLQE 4E7KA 1OZ2A 1N8RU 1BIBA 3TU4K 2LT1A 4BI3A 3CCQA 4DQ2A 4MMKA 4HCBA 2XK0A 3CC2A 1AVZC 2COWA 2QTVA 2KI7A 2DERA 2D6FA 5GMKm 1QVFA 2EJ9A 4KULA 2QQ9A 1I81A 2RM4A 1T3LA 4JJDA 3TVTA 3UA7A 4PJOB 2MK5A 5DLOA 4MZPA 3VKIA 4JS5A 2MAMA 4E7LA 2QQBA 2J05A 1KQSA 1VOMA 1Q81R 4IUTA 2BZXA 1Y0MA 2PVGB 4C8QF 3ER0A 3EG1A 1RI0A 2KGTA 2AKLA 1YJNA 1ZHIA 2E12A 2NUPB 2LQKA 4LXCA 2RHYA 2XICA 3CPWS 1Y07A 2KXDA 3M0RA 2ZAEA 4II1A 4EDUA 4HA8A 3EFOA 3VS7A 5IXBA 1XTDA 2DRMA 2M16A 2CH4W 3PGGA 2O9SA 1O75A 1SRMA 2EWNA 3HRTA 1G3YA 3LGFA 4OVAA 4N4GA 2X4YA 4PL6A 2KAFA 1U8RA 4ZTFA 3S3NA 1VQOT 1RAIB 1QVGP 3M4GA 3E1SA 1AHJB 2PUKB 3NGPA 3V7RA 3CCRT 1SPKA 1BK2A 1K73R 2YUQA 1OOTA 4RCCA 3QJ6A 3RR6A 2JS0A 1QKXA 4L59A 2P84A 2XDDA 2AIRB 1YJ9A 1XJWB 3CPFA 3REAB 4D8KA 5GAN6 1XNIA 3M55A 1RI9A 1ZQ1A 1TOVA 4ZGEB 1NLPC 2NUTB 1OEBA 3JCMc 4M75F 1YN8A 4OMLA 3CCUA 1D3BB 5GAOn 3CBOA 3M0SA 1VQ4Q 1FXXA 1NE8A 1MMGA 2D8HA 2R57A 4ZN3A 1UGSB 1NYFA 3DB3A 2EGEA 4RUGA 4JS4A 1H3ZA 1Y71A 1VQKQ 1Q82U 1YHQT 4DBRA 2W10A 1QVPA 2QA4Q 1PM3A 2A7YA 2KYMA 2LZ6B 4M77A 1WLPB 1ZA1B 1YI2Q 2B8AA 4F7UG 2YLBA 2DL4A 5CCAA 4J6WA 2L3PA 3EGUA 2HKNA 2JM9A 2PU9B 1Q95G 1WNLA 1JBMA 2HL5C 4DOWA 2XIDA 5IHKA 3VJPA 3JCMd 2X9HA 1VQPQ 1YFNA 4IUPA 2WSCE 3CMAT 3JB9D 4C5HA 2FB7A 2L2PA 2FPFA 3L2QA 2CP7A 2O4XA 1RAHB 4J6XA 1N9RA 3X20B 2LQNA 3O5ZA 3M0TA 3DLMA 1TG0A 3QZ9B 2FEIA 4RG8A 2CREA 5EG2A 3GBQA 4J9IA 3X28B 4Y28E 2BE7D 3JB9G 3CCLT 3OA6A 2CH4A 1QLYA 1ZBJA 2JVVA 2K79A 2LNVA 3JCMg 1QVGA 1VQPA 2HQHA 4J5YA 1VQMT 1B3QA 2EQJA 2DIQA 3VUBA 3TCJA 3FC3A 3MO8A 2CKKA 2O01E 2B86A 1VQ6A 5GMKh 1NZ9A 1NG2A 4QQGA 1HD3A 2E4HA 1UUEA 4FT4A 3G71Q 3MHXA 4C92F 1VQ5A 3JB9H 1KSWA 1WIEA 2QQSA 2GTOA 2VXFA 3LWIA 1WQ7A 2LMJA 4DEYA 1W2BA 3BY7A 5HCKA 2RK1A 3EGXB 2A37A 4PNOA 1ZBXA 2E3HA 1E6HA 3OS5A 4FIBA 4J7FA 1H3HA 2J6KA 2RJDA 2LP5A 4M77E 3OYLA 2M0OA 2VYTA 2EQUA 3CCSA 1LJOA 1RAAB 1BCOA 3FDRA 4RTWA 1K8AC 2X35A 2ATCB 1WA7A 1I5OB 5KYWA 3WVDB 2WACA 3OS2A 1M90R 4BUGA 1JXMA 3JSCA 3X26B 1KHIA 2HAXA 2KRSA 2DL7A 3I9QA 4E7SA 1ZSZC 2X4JA 4KH1B 1NEBA 5LJ5g 1NJIR 4MMLA 2EYQA 2ZPFB 5I22A 1VQ4T 4F7UB 4X9CA 4C8QA 2DAQA 2DBMA 1WDXA 2KEAA 4ATOA 4FCYA 3MKDA 2IVWA 1RAEB 3A8GB 4CC4B 2HNIA 2MWPA 2GBQA 1QP2A 2QA4T 2PUOB 4ZN1A 4ZGDB 2OTJA 4M78F 1D1CA 4OMMA 2DD5A 3CXCP 2W0ZA 3OYKA 2HSEB 1PRMC 3FLGA 5GJVB 3UPUA 2QGFB 1IGUA 1M27C 2E64A 4RTTA 4HCCA 3NMZC 4RCBA 1WHMA 4F14A 3RMSA 2CS7A 2PTKA 1X2KA 2EPDA 3Q1JA 3SWNA 3PFSA 3L2ZA 1WXUA 1JJ2S 4QW2A 1Q86R 1VQ7Q 1GBQA 2DILA 2L3QA 3JCMX 2JTEA 4BDYA 1K9AA 1G8XA 1VQ8A 3QG1A 4M7AE 3I55Q 3TEEA 4FU6A 3FJPA 1M1GA 2FRYA 4Z88A 4OF1A 2KSSA 4EMKC 4A54A 3V8LA 2IPOB 5GAMd 3L2WA 4M75A 2F2WA 3LGLA 2G3RA 4F04B 4XU1A 2DE0X 3R6OA 5KYNA 3M5AA 5AT1B 3OBWA 4J9EA 5CIUA 3G71T 3PVQA 1S72A 1TSFA 2AHJB 6AT1B 3KFVA 5GAOl 2ED1A 3JCMh 1UE9A 4N0AA 3G7ZA 2CYZB 4JRKA 2C0TA 4KUIA 2NWMA 3RDVA 1GCQC 1WHHA 1NPPA 2LNHB 2V8KA 1QQJA 4LDXA 2YRDA 5IHIA 4XU2A 2NUZA 3VYGA 3M59A 4A4HA 2FZKB 4PJOF 3CEYA 5M9OA 2K3XA 1UHCA 3OYCA 4XU3A 5LJ3d 2K5FA 2VVKA 1Z9QA 4OGCA 4BD3A 2X4WA 4J9FA 2SEMA 2RHUA 4WF2A 3CXCA 2K9GA 1KG1A 4HXJA 3MEAA 4P5NA 3G4SA 2DTIA 4OMOA 9ATCB 3EH2A 3C12A 4JZ3A 4VUBA 2H3JA 1VUBA 1C0MA 2FZGB 2RI2A 1PD0A 4J9HA 1K9MU 2C06A 3HSBA 1BI1A 5DM7R 2J6OA 1K0XA 4PFOA 4E2FB 1NLOC 4M75E 3CC7A 4HT9A 5GAMj 4JJNK 1N8RR 5D6YA 2BUDA 5KYUB 5LJ5h 4AG2C 5GMKe 4NOYA 5FWBA 5KYYA 2RJFA 5CVIA 1TUGB 1WGSA 1Z9ZA 3PIOA 3JCMW 3RERA 2DO3A 3ZEHA 3OYYA 1MMNA 2CSQA 2E5KA 2EJFA 1G83A 1Y57A 3LX7A 1TU0B 1UG1A 5GMKi 1A0NB 1VQNQ 1Q7YU 3QBYA 3JCMP 1WHKA 2KRMA 4IUQA 4KBMB 2RQWA 3CCVA 4BI4A 4PLLA 3QO3A 4BB7A 1VQ7T 4OB3B 1VQ9A 4GBQA 1VQLA 4C0DB 2O2OA 2CT4A 1I07A 4C0DC 1K4US 2OJ2A 5GANf 1W1FA 2CP2A 3GLXA 3FRNA 1U06A 2XD0A 3SD4A 3EAEA 3I55T 1I8FA 2KT8A 5LJ3j 3EG9A 2L3SA 1KD1C 3LW5E 3MEUA 2DFUA 5AYFA 4QVDA 3DKMA 1X2QA 3CCQQ 5GAN4 3H8ZA 1WXBA 1VQNA 1TUDA 3CC2Q 2EYZA 1AZGB 2YRCA 1WHJA 2MMPA 3GIBA 1SHGA 1UJYA 4ZNXA 3OYEA 1U5SA 1ZLMA 2CP3A 3PMTA 3RNJA 5CKDA 3ZFJA 3DB4A 1HK9A 2QK0A 2KNBB 5LL6S 3VS4A 2X51A 1TH7A 2YWWA 4L5GA 1YJNQ 3EG2A 4XTZA 2QI2A 3CMET 2HCKA 3EFOB 1SSHA 3CBMA 4KGZB 2LQWA 2EVRA 2VUBA 1QWEA 2KQWA 2ENMA 2P0QA 1D0YA 4JJBA 2XDBA 3A5ZB 4V2SA 1X01A 1Q82R 2MCNA 1UTIA 2X4XA 1LPLA 3CCJT 2EBPA 2QGGA 1OV3A 1MUZA 1U3OA 5J26A 4J9BA 3VYHB 2QYZA 2CGHA 3CCET 3NTIA 3QYHB 1R0BG 3VS5A 2WSFE 2YUOA 3BDLA 2WSEE 2J7IA 1U1TA 4M7AD 3JRZA 2DLPA 5KE3A 2PVOB 3VS3A 3LWHA 4J9GA 2GQIA 8ATCB 4PJMA 1IRXA 2DZ9A 5KCHA 2F2XA 1OPKA 3H41A 4OMPA 2EQMA 3G1JA 2QTXA 3EGDB 1ZUKA 1QCFA 2RD1A 1G3WA 1YJ9Q 3TSWA 1OX8A 1K9MC 3P8HA 4ELYC 2O88A 2ABLA 2FVUA 2VC8A 4MDWA 2O9VA 5IN1A 3QHSA 3GPLA 5KYXA 3CCUQ 4M7AG 4LD9K 1K8AU 1IB8A 4LDVA 3JCMe 1ACMB 3JCMb 4A53A 1W2BS 3HFNA 4J8OA 4MDXA 2JM8A 4PJJA 2E70A 3NPFA 1N5ZA 3C4SA 3E19A 1F1BB 3VS0A 4PJOA 2DYIA 4M77C 2LJ3A 3CD6T 1VQMA 1Q7YC 2JZ2A 4JRIA 3VRYA 2K2VA 1QMCA 4F7UF 4RKUE 3OMGA 2YLCA 1GBRA 2RQVA 2L0AA 4PK4A 4ELZC 2DL5A 4K11A 5GAOm 2NUPA 2JUFA 3TSZA 1OQKA 5D7UA 2K4YA 4J83A 2RHIA 2HEQA 4E6RA 1R77A 4NL3A 1IO6A 1CKBA 3QWYA 3CC2T 4IURA 3VS6A 2YXYA 1UEBA 3JV3A 2A36A 2DTHA 5CKEA 5FRNA 2DM1A 3UATA 3JB9F 3QYGB 5LJ5e 1TUCA 4DBQA 3C95A 1UFFA 1OULA 2VGNA 4CI0C 1HXDA 1B34B 2IG0A 1WJRA 2K2MA 1IGQA 2MWOA 4ZTJA 1YJNT 1VQ6Q 3QUIA 1ZSGA 5KCOA 3RKWA 4N4IA 1MV3A 1VQ5Q 4L6V5 2P4TA 3X25B 1UECA 5GAN3 2GCXA 5A2QE 4WTOB 1O9SA 2RQUA 2RB6A 2R5MA 1D3BA 5L23A 3S3OA 1YBYA 5FROA 2DA9A 3M54A 2EYYA 1OI1A 4Y92A 4AG1C 3G6EA 1FMVA 3CCSQ 1AD5A 2QDYB 1H641 1ZUYA 2OTLA 3U23A 1BB9A 4J9DA 2MPXC 3LH5A 4FYWB 4M7AB 4ZGJB 2FPEA 4XTVA 5J3BA 4M7AC 4KT0E 3CQTA 4UC4A 2SRCA 1PSFA 2CZ0B 2K57A 3JAME 2MYSA 3HRSA 1X43A 1YJ9T 2K6DA 2DBKA 4MZMA 2DMOA 2P0PA 2BZ8A 1YCSB 4RMOA 2HBWA 1IZ6A 3MP6A 1K76A 1SG5A 3PE0A 5IHNA 5FRMA 1J3TA 2F1LA 4TVRA 4X9DA 2AT1B 5CQYA 1YNZA 1BU1A 4DBFA 4FM4B 1SHFA 1YWPA 4LN2A 4HVVA 2EJGA 2JMCA 1ARKA 2HKQB 2DTOA 2FZCB 4OMNA 2A28A 2RQTA 3HTRA 5ECAA 1EFNA 2E41A 3P8BB 5IXFA 4Z8AA 1ZSZB 3UA6A 3CC4A 2ROTA 1KC8U 2FO0A 1QCNA 1OYXA 2OTJQ 1EX4A 3MPUB 1T0HA 1M1KC 1FX7A 2QEXQ 4CC7A 3MP8A 1AWOA 2BTTA 5FU6C 4ORZA 1ZA2B 5GAMe 1YITA 2LJ1A 2LRQA 4LE9A 3P8DA 4E7JA 2K7AA 3M0QA 3SWNC 3OYBA 2HMAA 2DXBA 2DVEA 2DIGA 2R5AA 4IIOA 1VQKT 2EGAA 2RMOA 3EGXA 4PFPA 2M1HA 4A4EA 5GMKl 3WVEB 5D6WA 1WI7A 1QCOA 3M53A 3V8KA 2ED0A 1YI2T 2PZ1A 1VQ8Q 3JCMJ 3M4YA 2CP5A 3I5SA 4M75C 4XTXA 2A08A 2QEXA 1VQPT 2MOXA 3META 4IUUA 1FYNA 2JW4A 2H8HA 2V8JA 3ULRB 1VQ6T 4LDYA 2LX9A 1BI0A 1I4K1 5LJ5f 3RKYA 4A4GA 1WPYA 1OU8A 2F69A 1S72Q 1VQ5T 4N0AC 3PIPA 3RMQA 1K9MR 4BI8B 5LJ3e 3EFSA 5CQXA 2BE9B 1KD1U 4R0KA 2RN8A 2E3IA 3SFMA 4Y91A 3O8VA 2CP0A 2EAYA 3HRUA 4M7DF 1V1CA 2KE9A 2RO0A 3DLLA 1K1ZA 4NS5A 4EMKB 3ZL7C 2RI5A 1V76A 4F7UA 1OZ3A 4A4FA 3CCST 5C6SA 2CUDA 4AMCA 3OYJA 3GP8A 2KROA 2EQIA 2KK4A 3OYNA 3VS2A 2YDLA 1NPRA 2YT6A 3TREA 1P92A 2Y4XA 4C8QE 1Q7YR 3QDRB 2ZPIB 4JUVA 4OGEA 2XI9A 3OW2P 1X6GA 3I56A 5A0LA 2MIOA 2H3EB 2HL3A 4X34A 2DXCA 1VA7A 3G4SQ 1YJWA 5CO7A 3PMIA 1C1AA 2HBPA 1BIAA 2V1RA 4ESRA 5GAMg 1YIJA 2DL8A 3OYGA 5HY6A 3J81E 1KQ2A 5CKBA 3CC7Q 5KYYB 4LD6A 1M2VB 4QVZA 3H6ZA 1NM7A 4C5EA 2YRVA 2HD0A 4DEXA 2DF6A 4KGXB 2V1QA 2Y4YA 3HP9A 4PKCC 2A3LA 5GANd 2OTJT 4NL2A 1QVFS 2ZCFB 4E7IA 4LUDA 1JXOA 1KC8C 2PQWA 3PTAA 2XMFA 1QP3A 3OQ5A 4F7UE 3CCMA 1KQSS 1G2BA 2L5QA 5D6XA 2KVQG 3FEOA 1UJ0A 2BZYA 3MJXA 4B9WA 3CCVQ 1AWWA 1SSFA 1GXIE 2LCCA 2CT3A 1VQ9Q 1VQLQ 5LJ3g 2O31A 4WCIA 4C92A 3OYAA 2RA2A 2NLUA 1VQ8T 3EH1A 4B6MA 5GANg 5GJWB 2RJEA 1OX9A 5CK9A 1UDLA 1M3BA 2YUPA 3ASKA 3KBGA 4IUVA 1Y96B 3GNGA 1CKAA 2F2VA 4M77D 3CCJA 4X1VA 2KDSA 4MZTA 4A63B 3E9GA 4XAXB 1T3SA 3PVLA 1KK7A 1S72T 3CCEA 1G3TA 3OW2A 1VQOQ 2QAZA 1BBZA 3J7AF 2AK5A 1X27A 3V7SA 1AOJA 3T9NA 3LYIA 1PCXA 3M0PA 2DXUA 4ANJA 4C0ZA 2EYWA 4M77G 2EIFA 3I5RA 2KY9A 4RTYA 1IXDA 1K8AR 4HT8A 5GANj 2XDPA 2QQAA 1EZZB 2R58A 2LT4A 2L89A 5KYUA 1MGQA 3C94A 4Q5WA 3GF5A 1GFDA 4KUDK 2QG9B 5A0DA 4KGVB 4LDUA 3OYHA 1K0SA 1VQOA 4QT7A 1MMAA 1WXTA 4QKUA 2G6FX 1U1SA 2XHCA 3BE3A 3SDZA 3CCRA 1R0CB 1GRIA 3HFOA 3N5BB 2LJ0A 3FB9A 4FT2A 4O6JA 4C92E 4D6WA 2GNCA 3G4ST 2YHTA 1M90C 4M78A 3CD6A 4IIMA 1BCMA 1TS9A 3EFRA 4BACA 2E65A 3CBPA 3E2UA 3JCMQ 4BE2A 3URGA 3TQ7P 3MEWA 2L3RA 1WHGA 3NTHA 2VWFA 2FL7A 2GQVA 4AT1B 4FW2A 1NJIC 1M30A 4C5GA 2QASA 4HCZA 1G5VA 1SEMA 1M8MA 2YUNA 2V8IA 4JPBW 4ME7A 5GAMh 1W4SA 1X75C 3VS1A 2P4RA 4M7AF 1ZUUA 1MHNA 5I2SA 2DEUA 4M7DA 1N6AA 1M5Q1 4XQ3A 1AWJA 1YHQA 3HHTB 1I0CA 4E47A 7AT1B 4JJCA 2EKOA 1WFWA 3VUZA 2DL3A 2ZPGB 5J39A 3CCLQ 5I2MA 1QVGS 4PJOC 4FYVB 1RL2A 1QWFA 2ZPBB 2JXBA 3CCVT 1MV0B 2GTJA 1GCPA 4FSXA 1VQMQ 1VQ9T 1RABB 1VQLT 3INZA 3CMAA 3ZBDA 3OS0A 1SRLA 3LLRA 4C8QD 1HSQA 1LNXA 1BI3A 1X6OA 2HQEA 1X6BA 1JEGA 4FW1A 2M51A 5GAOr 4XK8E 5CKHA 1Q86C 4EIKA 3EHQA 5LJ3h 1S1NA 1TWBA 2PNIA 4M78E 1VQNT 4OB1B 3CCLA 3RUXA 4M77B 5GMKj 2RQRA 2E10A 3H0HA 1D09B 5GANh 2FG0A 1RACB 4C8QG 1M1KU 3JB9J 1TXQA 3H0FA 3CPWP 3UWNA 2RI3A 4DBHA 1Y7XA 5KH6A 2JTMA 1ABOA 2D8JA 1UHFA 1XQHA 3BW1A 1DJ7B 2D9TA 2O4XB 1E7OA 2RH2A 3OSVA 2KRNA 1H8KA 3PT9A 4JZ4A 3L2VA 4LUEA 2EGCA 2C0OA 1XOVA 2E1HA 2LQ8A 3VRZA 4PLIA 2RHZA 1IREB 3A8LB 4KH0B 4OMQA 3X24B 4M7DE 2IIMA 3CCQT 3EGDA 1PKTA 1W2BP 1RAFB 2AZVA 2Z0WA 4JRPA 1B7TA 3OB9A 4HVWA 3UF4A 1PRLC 2I2LA 1PKSA 3BFMA 4M75D 5FU7B 3SEMA 1QW1A 4XU0A 2JJ9A 1T0JA 2CUBA 2GFAA 4M4ZA 5FU7C 5I11A 4J6YA 2V26A 1KC8R 2RHXA 3G6EQ 3J80E 2JTFA 1FWZA 3I35A 1YP5A 3HPWA 1VIEA 1KFZA 2OTLQ 2FYKA 3QSUA 2ROLA 3QIIA 4E7HA 1RUWA 4GLMA 1Q81U 3OYMA 2EYXA 2VXEA 5A0GA 4BE1A 4AFZC 4M75G 2DPPB 2KBTA 5HK3A 2MI6A 1JU5C 5HKCA 1FMWA 4LNPA 1R8OB 1MNDA 2NUTA 1HYOA 1E6GA 2DD4A 1AWXA 2XG8D 1VQ4A 2F5KA 4FYYB 4R55A 2GFUA 2QDLA 1D1AA 3AHUA 4PJOE 4CRIA 4LDWA 1H92A 2VGMA 1PWTA 2EQKA 1SKUB 2NYSA 1VQKA 8AT1B 2OX7A 1N8RC 1UGQB 4XTWA 5KYWB 3JB9I 5DY9A 3HKSA 1TTHB 2QA4A 1UB4A 3QWXX 5GAN8 4F17A 1YI2A 2HQXA 1LCKA 4PJLA 3AT1B 1UGPB 2EW3A 4HCKA 1G3SA 1PSEA 3L2RA 4AFQC 3CPWA 3CC4Q 1K73U 1W6XA 2FHDA 3OSSC 2KR3A 2CZ1B 3GOXA 2LTOA 5FW9A 1YWOA 2XU8A 1B34A 4O5VA 3NHNA 3CCUT 1KD1R 4AFUC 4C8QB 2ZPHB 2E6NA 1JQQA 4GY5A 3OMCA 1EIFA 4QVCA 4C8QC 1YITQ 2KYBA 5GAOq 1B07A 2JNGA 3A8MB 2CZ6B 3WXMB 3E9FA 3QZ5B 3QDFA 4C92D 4IKFA 1PHTA 4DOVA 5LJ5d 3JCMf 5CAIA 1BI2A 1HJDA 1WHLA 3SB2A 5HK0A 2KXCA 3EG3A 3RESA 1KQ1A 5GAN5 4PFZA 1OPLA 2CP6A 3GNFB 3OS1A 2HZYA 3UDCA 5FU6B 3G71A 1M1FA 2Y90A 4C92G 5GAN7 3JCMV 4M7AA 2DZCA 1JRIA 3CXCS 1PC0A 1UGRB 3SWNB 2BIVA 3NTKA 3L1AA 1AT1B 1GFCA 1M9SA 1PG5B 5IT9E 3A98A 3H9NA 4FYXB 4A4KA 4AFSC 2DRKA 4N4HA 4DA4A 4OB2B 3KXTA 2EKHA 1M3AA 3OBYA 4QQDA 2I0NA 4F16A 4RTVA 1JO8A 1D0ZA 4M75B 4D8DA 3A1PA 1AZEA 4FSSA 3G6ET 4C5IA 2XKOC 1RLQC 4C0FA 5IAYA 2OTLT 1UGVA 2AKKA 3RBBB 1CSKA 5FLXE 3FIFA 3QJYA 1Q82C 4BDZA 2DJQA 4JLGA 1ZSZA 3IQLA 4RTUA 2K3BA 3L2UA 1Q81C 2L8DA 1BKBA 2LCSA 2M9UA 3REBB 3M0UA 3OYFA 4M78D 2BKDN 2CZ7B 3I56Q 5LJ5j 3RIRA 2OAWA 2OAUA 1VYUA 5L8RE 5GANe 3MCAB 2K5IA 3OW2S 2F5TX 3MEVA 2FPDA 3VV0A 4B9XA 4R56A 4PJNA 1YJWQ 4JDSA 5C0MA 2D1XA 1M2OA 3OYIA 3QKJA 1YIJQ 2QXFA 2KMTA 2RK2A 1ABQA 3M9QA 2YSQA 2QQRA 4M78G 2GGRA 2LCLA 1IHVA 2LVMA 4CC3A 2J06A 2VASA 3CC4T 3QXEB 4M7DD 2VB6A 1VIFA 5GAN2 1M90U 2OI3A 2KT1A 3FJ5A 4FL6A 2J6FA 3OY9A 1JJ2P 2RF0A 1N27A 3S3MA 1WJQA 4KRTA 3A8OB 1K73C 4QQ6A 4OMFB 2COZA 1LOJA 1YITT 4HVUA 5CKFA 4BY6B 1VQ7A 4RG2A 1RAGB 2A0FB 2DVJA 1NJIU 4BY6C 3CCMQ 3NFCA 4C0GA 1GL5A 2RJCA 4M7DG 1WX6A 2CDTA 4Z89A 2D0QB 4C92B 1MMDA 3HL8A 3I55A 3KUFA 4C92C 4J9CA 3M56A 3RKXA 3ME9A 1JB0E 3EHRA 1C6VX 4J7IA 4EMKA 3CMEQ 1AEYA 2E5QA
chains in the Genus database with same CATH topology
1RLPC 2JS2A 3JV3A 5I22A 2A36A 2VWFA 2DNUA 2DM1A 3UATA 1TUCA 5IH2A 2DBMA 1UFFA 1M30A 1WDXA 2ESWA 4RTXA 2CSIA 2KEAA 1SEMA 1M8MA 2VKNA 2YUNA 2K2MA 4JPBW 4CC4B 2RPNA 3VS1A 2P4RA 2GBQA 2X3XD 1ZSGA 2AZSA 1ZUUA 1GCQA 3EG0A 1AWJA 1MV3A 1W70A 4OMMA 1I0CA 1UECA 2W0ZA 2JT4A 4JJCA 1WFWA 2RQUA 2DL3A 1PRMC 5L23A 5GJVB 1QWFA 2JXBA 1M27C 1MV0B 2DA9A 2EYYA 2GTJA 4RTTA 1GCPA 3NMZC 1KIKA 4Y92A 1KJWA 1VYTA 4F14A 4AG1C 1QKWA 2PTKA 1X2KA 2EPDA 2FRWA 1AD5A 1WXUA 1SRLA 1ZUYA 3U23A 4RTZA 2M0YA 1GBQA 3C0CA 1BB9A 1HSQA 2DILA 4J9DA 3LH5A 2L3QA 1X6BA 1JEGA 2FPEA 5EC7A 2JTEA 2C0IA 2RNAA 1K9AA 3CQTA 2M51A 2SRCA 1FMKA 4CC2A 2FRYA 4EIKA 4Z88A 2JMAA 3EHQA 1X43A 1NEGA 2K6DA 1S1NA 1WYXA 2DBKA 2PNIA 2DMOA 2BZ8A 1VYVA 1YCSB 2F2WA 3H0IA 2RQRA 1I1JA 3H0HA 2HBWA 2DE0X 2FG0A 3SHWA 1K76A 3PE0A 5IHNA 4J9EA 1J3TA 3H0FA 3PVQA 1YNZA 1BU1A 1SHFA 1YWPA 4LN2A 4HVVA 3KFVA 2ECZA 1ABOA 2D8JA 1M3CA 1UHFA 2ED1A 2HSPA 2JMCA 1UE9A 2D0NA 2DX1A 1ARKA 1E7OA 2A28A 2RQTA 4OMNA 3THKA 2KRNA 1H8KA 2C0TA 4JZ4A 5ECAA 4LUEA 1EFNA 5IXFA 2EGCA 2C0OA 2NWMA 1XOVA 4Z8AA 3VRZA 1GCQC 3UA6A 4OMQA 1X69A 2IIMA 2ROTA 2LNHB 1PKTA 1ZX6A 2FO0A 5IHIA 1NYGA 2NUZA 2AZVA 1PNJA 1T0HA 4HVWA 2DYBA 3UF4A 2LX7A 4CC7A 1AWOA 1PRLC 3R6NA 2BTTA 4ORZA 1PKSA 2LJ1A 1UHCA 3SEMA 2X3WD 1T0JA 2CUBA 4M4ZA 2VVKA 5I11A 1Z9QA 4LE9A 2K7AA 5FWCA 3M0QA 2HDAA 3I35A 1YP5A 4J9FA 2SEMA 1KFZA 4IIOA 2ROLA 2EGAA 2RMOA 2K9GA 4HXJA 1RUWA 4GLMA 1WI7A 4OMOA 2EYXA 2ED0A 1AVZC 2PZ1A 4JZ3A 4AFZC 2KBTA 1JU5C 4J9HA 3I5SA 1T3LA 2A08A 4JJDA 2J6OA 4LNPA 3TVTA 3UA7A 1K0XA 1E6GA 1NLOC 1AWXA 2MOXA 2QDLA 1FYNA 2JW4A 1H92A 2J05A 2H8HA 4AG2C 3ULRB 2BZXA 1PWTA 5FWBA 1Y0MA 3EG1A 2KGTA 2AKLA 1Z9ZA 3QWXX 4F17A 2CSQA 4R0KA 1LCKA 2E5KA 2KXDA 2RN8A 1G83A 1Y57A 3M0RA 2EW3A 4HCKA 1V1CA 2KE9A 3VS7A 5IXBA 1K1ZA 1UG1A 2DRMA 4AFQC 2CH4W 1A0NB 3ZL7C 2O9SA 1W6XA 2KRMA 1SRMA 2KR3A 2RQWA 2CUDA 5FW9A 1YWOA 4GBQA 2KROA 2EQIA 3NHNA 2O2OA 3VS2A 4AFUC 2YDLA 2CT4A 1I07A 1JQQA 2YT6A 1K4US 2OJ2A 1W1FA 2KYBA 1U06A 3NGPA 1B07A 2KT8A 1SPKA 1BK2A 2L3SA 2YUQA 1OOTA 1PHTA 2JS0A 1QKXA 1X6GA 1HJDA 2MIOA 2KXCA 3EG3A 1X2QA 1VA7A 1WXBA 3REAB 4D8KA 1TUDA 1RI9A 2EYZA 1NLPC 2V1RA 4ESRA 1AZGB 1OPLA 1OEBA 1YN8A 4OMLA 1SHGA 2DL8A 1UJYA 4ZNXA 3M0SA 1U5SA 1ZLMA 2D8HA 3RNJA 1NM7A 1NYFA 2EGEA 1GFCA 4RUGA 2KNBB 3VS4A 4DEXA 2DF6A 3A98A 2V1QA 3EG2A 2W10A 4AFSC 2DRKA 2HCKA 2EKHA 1M3AA 1SSHA 2KYMA 2LZ6B 1WLPB 2I0NA 4LUDA 1JXOA 4F16A 2DL4A 2LQWA 2L3PA 3EGUA 2EVRA 2JM9A 4RTVA 1QWEA 2ENMA 1JO8A 5IHKA 2XMFA 4JJBA 4D8DA 1G2BA 2MCNA 1UTIA 4FSSA 1AZEA 2EBPA 1UJ0A 2BZYA 1AWWA 1OV3A 1MUZA 1U3OA 1RLQC 2L2PA 2FPFA 2CT3A 1UGVA 2AKKA 3RBBB 1CSKA 4J9BA 2O31A 4WCIA 2LQNA 3O5ZA 3VS5A 3M0TA 1TG0A 2DJQA 2YUOA 3IQLA 2FEIA 2J7IA 2DLPA 2CREA 5GJWB 4RTUA 2K3BA 3VS3A 3GBQA 4J9GA 2GQIA 4J9IA 1UDLA 1M3BA 2LCSA 2F2XA 1OPKA 2YUPA 3H41A 3M0UA 4OMPA 3REBB 2OAWA 1ZUKA 1QCFA 1VYUA 3TSWA 2CH4A 1QLYA 1ZBJA 2K79A 2FPDA 2O88A 1CKAA 2F2VA 2ABLA 4X1VA 1B3QA 2O9VA 4A63B 2D1XA 1T3SA 3PVLA 2B86A 1NG2A 1ABQA 1HD3A 1UUEA 2YSQA 1BBZA 2AK5A 1X27A 1AOJA 1KSWA 1WIEA 2JM8A 2GGRA 2GTOA 3NPFA 4CC3A 3M0PA 2LMJA 4DEYA 2J06A 1N5ZA 5HCKA 2EYWA 2A37A 3I5RA 1E6HA 2OI3A 4RTYA 2KT1A 3FJ5A 3VS0A 2J6FA 2LJ3A 1H3HA 2J6KA 2RF0A 2LP5A 4KRTA 3VRYA 1GFDA 4RTWA 1GBRA 4HVUA 2RQVA 2L0AA 2DVJA 1WA7A 1GL5A 1K0SA 2DL5A 4QT7A 4K11A 1WXTA 1WX6A 3TSZA 2CDTA 4Z89A 1JXMA 2G6FX 2KRSA 1GRIA 2DL7A 2LJ0A 3I9QA 2HEQA 4E6RA 4J9CA 2GNCA 1IO6A 1CKBA 3QWYA 3EHRA 3VS6A 4IIMA 1AEYA 1NEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLP C;  2JS2 A;  3JV3 A;  5I22 A;  2A36 A;  2VWF A;  2DNU A;  2DM1 A;  3UAT A;  1TUC A;  5IH2 A;  2DBM A;  1UFF A;  1M30 A;  1WDX A;  2ESW A;  4RTX A;  2CSI A;  2KEA A;  1SEM A;  1M8M A;  2VKN A;  2YUN A;  2K2M A;  4JPB W;  4CC4 B;  2RPN A;  3VS1 A;  2P4R A;  2GBQ A;  2X3X D;  1ZSG A;  2AZS A;  1ZUU A;  1GCQ A;  3EG0 A;  1AWJ A;  1MV3 A;  1W70 A;  4OMM A;  1I0C A;  1UEC A;  2W0Z A;  2JT4 A;  4JJC A;  1WFW A;  2RQU A;  2DL3 A;  1PRM C;  5L23 A;  5GJV B;  1QWF A;  2JXB A;  1M27 C;  1MV0 B;  2DA9 A;  2EYY A;  2GTJ A;  4RTT A;  1GCP A;  3NMZ C;  1KIK A;  4Y92 A;  1KJW A;  1VYT A;  4F14 A;  4AG1 C;  1QKW A;  2PTK A;  1X2K A;  2EPD A;  2FRW A;  1AD5 A;  1WXU A;  1SRL A;  1ZUY A;  3U23 A;  4RTZ A;  2M0Y A;  1GBQ A;  3C0C A;  1BB9 A;  1HSQ A;  2DIL A;  4J9D A;  3LH5 A;  2L3Q A;  1X6B A;  1JEG A;  2FPE A;  5EC7 A;  2JTE A;  2C0I A;  2RNA A;  1K9A A;  3CQT A;  2M51 A;  2SRC A;  1FMK A;  4CC2 A;  2FRY A;  4EIK A;  4Z88 A;  2JMA A;  3EHQ A;  1X43 A;  1NEG A;  2K6D A;  1S1N A;  1WYX A;  2DBK A;  2PNI A;  2DMO A;  2BZ8 A;  1VYV A;  1YCS B;  2F2W A;  3H0I A;  2RQR A;  1I1J A;  3H0H A;  2HBW A;  2DE0 X;  2FG0 A;  3SHW A;  1K76 A;  3PE0 A;  5IHN A;  4J9E A;  1J3T A;  3H0F A;  3PVQ A;  1YNZ A;  1BU1 A;  1SHF A;  1YWP A;  4LN2 A;  4HVV A;  3KFV A;  2ECZ A;  1ABO A;  2D8J A;  1M3C A;  1UHF A;  2ED1 A;  2HSP A;  2JMC A;  1UE9 A;  2D0N A;  2DX1 A;  1ARK A;  1E7O A;  2A28 A;  2RQT A;  4OMN A;  3THK A;  2KRN A;  1H8K A;  2C0T A;  4JZ4 A;  5ECA A;  4LUE A;  1EFN A;  5IXF A;  2EGC A;  2C0O A;  2NWM A;  1XOV A;  4Z8A A;  3VRZ A;  1GCQ C;  3UA6 A;  4OMQ A;  1X69 A;  2IIM A;  2ROT A;  2LNH B;  1PKT A;  1ZX6 A;  2FO0 A;  5IHI A;  1NYG A;  2NUZ A;  2AZV A;  1PNJ A;  1T0H A;  4HVW A;  2DYB A;  3UF4 A;  2LX7 A;  4CC7 A;  1AWO A;  1PRL C;  3R6N A;  2BTT A;  4ORZ A;  1PKS A;  2LJ1 A;  1UHC A;  3SEM A;  2X3W D;  1T0J A;  2CUB A;  4M4Z A;  2VVK A;  5I11 A;  1Z9Q A;  4LE9 A;  2K7A A;  5FWC A;  3M0Q A;  2HDA A;  3I35 A;  1YP5 A;  4J9F A;  2SEM A;  1KFZ A;  4IIO A;  2ROL A;  2EGA A;  2RMO A;  2K9G A;  4HXJ A;  1RUW A;  4GLM A;  1WI7 A;  4OMO A;  2EYX A;  2ED0 A;  1AVZ C;  2PZ1 A;  4JZ3 A;  4AFZ C;  2KBT A;  1JU5 C;  4J9H A;  3I5S A;  1T3L A;  2A08 A;  4JJD A;  2J6O A;  4LNP A;  3TVT A;  3UA7 A;  1K0X A;  1E6G A;  1NLO C;  1AWX A;  2MOX A;  2QDL A;  1FYN A;  2JW4 A;  1H92 A;  2J05 A;  2H8H A;  4AG2 C;  3ULR B;  2BZX A;  1PWT A;  5FWB A;  1Y0M A;  3EG1 A;  2KGT A;  2AKL A;  1Z9Z A;  3QWX X;  4F17 A;  2CSQ A;  4R0K A;  1LCK A;  2E5K A;  2KXD A;  2RN8 A;  1G83 A;  1Y57 A;  3M0R A;  2EW3 A;  4HCK A;  1V1C A;  2KE9 A;  3VS7 A;  5IXB A;  1K1Z A;  1UG1 A;  2DRM A;  4AFQ C;  2CH4 W;  1A0N B;  3ZL7 C;  2O9S A;  1W6X A;  2KRM A;  1SRM A;  2KR3 A;  2RQW A;  2CUD A;  5FW9 A;  1YWO A;  4GBQ A;  2KRO A;  2EQI A;  3NHN A;  2O2O A;  3VS2 A;  4AFU C;  2YDL A;  2CT4 A;  1I07 A;  1JQQ A;  2YT6 A;  1K4U S;  2OJ2 A;  1W1F A;  2KYB A;  1U06 A;  3NGP A;  1B07 A;  2KT8 A;  1SPK A;  1BK2 A;  2L3S A;  2YUQ A;  1OOT A;  1PHT A;  2JS0 A;  1QKX A;  1X6G A;  1HJD A;  2MIO A;  2KXC A;  3EG3 A;  1X2Q A;  1VA7 A;  1WXB A;  3REA B;  4D8K A;  1TUD A;  1RI9 A;  2EYZ A;  1NLP C;  2V1R A;  4ESR A;  1AZG B;  1OPL A;  1OEB A;  1YN8 A;  4OML A;  1SHG A;  2DL8 A;  1UJY A;  4ZNX A;  3M0S A;  1U5S A;  1ZLM A;  2D8H A;  3RNJ A;  1NM7 A;  1NYF A;  2EGE A;  1GFC A;  4RUG A;  2KNB B;  3VS4 A;  4DEX A;  2DF6 A;  3A98 A;  2V1Q A;  3EG2 A;  2W10 A;  4AFS C;  2DRK A;  2HCK A;  2EKH A;  1M3A A;  1SSH A;  2KYM A;  2LZ6 B;  1WLP B;  2I0N A;  4LUD A;  1JXO A;  4F16 A;  2DL4 A;  2LQW A;  2L3P A;  3EGU A;  2EVR A;  2JM9 A;  4RTV A;  1QWE A;  2ENM A;  1JO8 A;  5IHK A;  2XMF A;  4JJB A;  4D8D A;  1G2B A;  2MCN A;  1UTI A;  4FSS A;  1AZE A;  2EBP A;  1UJ0 A;  2BZY A;  1AWW A;  1OV3 A;  1MUZ A;  1U3O A;  1RLQ C;  2L2P A;  2FPF A;  2CT3 A;  1UGV A;  2AKK A;  3RBB B;  1CSK A;  4J9B A;  2O31 A;  4WCI A;  2LQN A;  3O5Z A;  3VS5 A;  3M0T A;  1TG0 A;  2DJQ A;  2YUO A;  3IQL A;  2FEI A;  2J7I A;  2DLP A;  2CRE A;  5GJW B;  4RTU A;  2K3B A;  3VS3 A;  3GBQ A;  4J9G A;  2GQI A;  4J9I A;  1UDL A;  1M3B A;  2LCS A;  2F2X A;  1OPK A;  2YUP A;  3H41 A;  3M0U A;  4OMP A;  3REB B;  2OAW A;  1ZUK A;  1QCF A;  1VYU A;  3TSW A;  2CH4 A;  1QLY A;  1ZBJ A;  2K79 A;  2FPD A;  2O88 A;  1CKA A;  2F2V A;  2ABL A;  4X1V A;  1B3Q A;  2O9V A;  4A63 B;  2D1X A;  1T3S A;  3PVL A;  2B86 A;  1NG2 A;  1ABQ A;  1HD3 A;  1UUE A;  2YSQ A;  1BBZ A;  2AK5 A;  1X27 A;  1AOJ A;  1KSW A;  1WIE A;  2JM8 A;  2GGR A;  2GTO A;  3NPF A;  4CC3 A;  3M0P A;  2LMJ A;  4DEY A;  2J06 A;  1N5Z A;  5HCK A;  2EYW A;  2A37 A;  3I5R A;  1E6H A;  2OI3 A;  4RTY A;  2KT1 A;  3FJ5 A;  3VS0 A;  2J6F A;  2LJ3 A;  1H3H A;  2J6K A;  2RF0 A;  2LP5 A;  4KRT A;  3VRY A;  1GFD A;  4RTW A;  1GBR A;  4HVU A;  2RQV A;  2L0A A;  2DVJ A;  1WA7 A;  1GL5 A;  1K0S A;  2DL5 A;  4QT7 A;  4K11 A;  1WXT A;  1WX6 A;  3TSZ A;  2CDT A;  4Z89 A;  1JXM A;  2G6F X;  2KRS A;  1GRI A;  2DL7 A;  2LJ0 A;  3I9Q A;  2HEQ A;  4E6R A;  4J9C A;  2GNC A;  1IO6 A;  1CKB A;  3QWY A;  3EHR A;  3VS6 A;  4IIM A;  1AEY A;  1NEB A; 
#chains in the Genus database with same CATH topology
 3V7C A;  1RLP C;  3BDU A;  2JS2 A;  2DJZ A;  3S6W A;  2EFI A;  2QEX T;  2DXT A;  2DNU A;  2LC4 A;  4PJO D;  5IH2 A;  5KE2 A;  2ESW A;  4RTX A;  2CSI A;  1V29 B;  3VU3 C;  3CCJ Q;  4OB0 B;  2VKN A;  2E6Z A;  2RPN A;  1LVK A;  2X3X D;  2JOY A;  3D7S B;  3QPH A;  3CCE Q;  5GAM f;  3OYD A;  2AZS A;  4JRQ A;  1GCQ A;  3EG0 A;  3EG9 B;  1IHW A;  2DKG A;  2JN0 A;  2ZGW A;  3CME A;  1W70 A;  4EPC A;  4PJO G;  1Q86 U;  2JT4 A;  1OU9 A;  3M58 A;  3A8H B;  1D0X A;  3PNW C;  4M77 F;  4BE0 A;  1N9S A;  5GAO p;  4Z02 A;  1KIK A;  1QVF P;  1KJW A;  1M2V A;  1VYT A;  2GF7 A;  1D1B A;  1QKW A;  2FRW A;  2ZPE B;  2ZZD A;  4JLI A;  4RTZ A;  2M0Y A;  2PVD B;  3C0C A;  1SF9 A;  4XTY A;  1WQW A;  1KQS P;  2M02 A;  5EC7 A;  2C0I A;  2RNA A;  3LH0 A;  2LDM A;  1JJ2 A;  1FMK A;  3L42 A;  3I56 T;  4CC2 A;  3CCR Q;  4M78 B;  2JMA A;  4EMH A;  1NEG A;  4M78 C;  1WYX A;  5I21 A;  1YJW T;  2K5L A;  5LJ3 f;  1VYV A;  2COY A;  3H0I A;  3M57 A;  3CD6 Q;  1I1J A;  3UT1 A;  1I5L A;  1YCY A;  4GLK A;  1YIJ T;  3SHW A;  2K3Y A;  4EMG A;  4YTL A;  3F70 A;  1WJS A;  1PD1 A;  2ECZ A;  1M3C A;  4HKE A;  2DET A;  2HSP A;  2D0N A;  2DX1 A;  1BYM A;  3MP1 A;  4E7Z A;  3V8J A;  3THK A;  1RAD B;  2VV5 A;  4M7D B;  1M1K R;  1M4Z A;  5CR2 A;  4M7D C;  1X69 A;  1Y96 A;  1ZX6 A;  1YHQ Q;  1NYG A;  4OP0 A;  2MF2 A;  1PNJ A;  4XTU A;  2DEQ A;  1NBE B;  2DK3 A;  2DYB A;  3CCM T;  2LX7 A;  1MNE A;  3R6N A;  1KHC A;  1M8V A;  1WZO A;  3CC7 T;  2X3W D;  5FWC A;  2P0K A;  5KYX B;  3CMA Q;  2HDA A;  5DLQ E;  4E7K A;  1OZ2 A;  1N8R U;  1BIB A;  3TU4 K;  2LT1 A;  4BI3 A;  3CCQ A;  4DQ2 A;  4MMK A;  4HCB A;  2XK0 A;  3CC2 A;  1AVZ C;  2COW A;  2QTV A;  2KI7 A;  2DER A;  2D6F A;  5GMK m;  1QVF A;  2EJ9 A;  4KUL A;  2QQ9 A;  1I81 A;  2RM4 A;  1T3L A;  4JJD A;  3TVT A;  3UA7 A;  4PJO B;  2MK5 A;  5DLO A;  4MZP A;  3VKI A;  4JS5 A;  2MAM A;  4E7L A;  2QQB A;  2J05 A;  1KQS A;  1VOM A;  1Q81 R;  4IUT A;  2BZX A;  1Y0M A;  2PVG B;  4C8Q F;  3ER0 A;  3EG1 A;  1RI0 A;  2KGT A;  2AKL A;  1YJN A;  1ZHI A;  2E12 A;  2NUP B;  2LQK A;  4LXC A;  2RHY A;  2XIC A;  3CPW S;  1Y07 A;  2KXD A;  3M0R A;  2ZAE A;  4II1 A;  4EDU A;  4HA8 A;  3EFO A;  3VS7 A;  5IXB A;  1XTD A;  2DRM A;  2M16 A;  2CH4 W;  3PGG A;  2O9S A;  1O75 A;  1SRM A;  2EWN A;  3HRT A;  1G3Y A;  3LGF A;  4OVA A;  4N4G A;  2X4Y A;  4PL6 A;  2KAF A;  1U8R A;  4ZTF A;  3S3N A;  1VQO T;  1RAI B;  1QVG P;  3M4G A;  3E1S A;  1AHJ B;  2PUK B;  3NGP A;  3V7R A;  3CCR T;  1SPK A;  1BK2 A;  1K73 R;  2YUQ A;  1OOT A;  4RCC A;  3QJ6 A;  3RR6 A;  2JS0 A;  1QKX A;  4L59 A;  2P84 A;  2XDD A;  2AIR B;  1YJ9 A;  1XJW B;  3CPF A;  3REA B;  4D8K A;  5GAN 6;  1XNI A;  3M55 A;  1RI9 A;  1ZQ1 A;  1TOV A;  4ZGE B;  1NLP C;  2NUT B;  1OEB A;  3JCM c;  4M75 F;  1YN8 A;  4OML A;  3CCU A;  1D3B B;  5GAO n;  3CBO A;  3M0S A;  1VQ4 Q;  1FXX A;  1NE8 A;  1MMG A;  2D8H A;  2R57 A;  4ZN3 A;  1UGS B;  1NYF A;  3DB3 A;  2EGE A;  4RUG A;  4JS4 A;  1H3Z A;  1Y71 A;  1VQK Q;  1Q82 U;  1YHQ T;  4DBR A;  2W10 A;  1QVP A;  2QA4 Q;  1PM3 A;  2A7Y A;  2KYM A;  2LZ6 B;  4M77 A;  1WLP B;  1ZA1 B;  1YI2 Q;  2B8A A;  4F7U G;  2YLB A;  2DL4 A;  5CCA A;  4J6W A;  2L3P A;  3EGU A;  2HKN A;  2JM9 A;  2PU9 B;  1Q95 G;  1WNL A;  1JBM A;  2HL5 C;  4DOW A;  2XID A;  5IHK A;  3VJP A;  3JCM d;  2X9H A;  1VQP Q;  1YFN A;  4IUP A;  2WSC E;  3CMA T;  3JB9 D;  4C5H A;  2FB7 A;  2L2P A;  2FPF A;  3L2Q A;  2CP7 A;  2O4X A;  1RAH B;  4J6X A;  1N9R A;  3X20 B;  2LQN A;  3O5Z A;  3M0T A;  3DLM A;  1TG0 A;  3QZ9 B;  2FEI A;  4RG8 A;  2CRE A;  5EG2 A;  3GBQ A;  4J9I A;  3X28 B;  4Y28 E;  2BE7 D;  3JB9 G;  3CCL T;  3OA6 A;  2CH4 A;  1QLY A;  1ZBJ A;  2JVV A;  2K79 A;  2LNV A;  3JCM g;  1QVG A;  1VQP A;  2HQH A;  4J5Y A;  1VQM T;  1B3Q A;  2EQJ A;  2DIQ A;  3VUB A;  3TCJ A;  3FC3 A;  3MO8 A;  2CKK A;  2O01 E;  2B86 A;  1VQ6 A;  5GMK h;  1NZ9 A;  1NG2 A;  4QQG A;  1HD3 A;  2E4H A;  1UUE A;  4FT4 A;  3G71 Q;  3MHX A;  4C92 F;  1VQ5 A;  3JB9 H;  1KSW A;  1WIE A;  2QQS A;  2GTO A;  2VXF A;  3LWI A;  1WQ7 A;  2LMJ A;  4DEY A;  1W2B A;  3BY7 A;  5HCK A;  2RK1 A;  3EGX B;  2A37 A;  4PNO A;  1ZBX A;  2E3H A;  1E6H A;  3OS5 A;  4FIB A;  4J7F A;  1H3H A;  2J6K A;  2RJD A;  2LP5 A;  4M77 E;  3OYL A;  2M0O A;  2VYT A;  2EQU A;  3CCS A;  1LJO A;  1RAA B;  1BCO A;  3FDR A;  4RTW A;  1K8A C;  2X35 A;  2ATC B;  1WA7 A;  1I5O B;  5KYW A;  3WVD B;  2WAC A;  3OS2 A;  1M90 R;  4BUG A;  1JXM A;  3JSC A;  3X26 B;  1KHI A;  2HAX A;  2KRS A;  2DL7 A;  3I9Q A;  4E7S A;  1ZSZ C;  2X4J A;  4KH1 B;  1NEB A;  5LJ5 g;  1NJI R;  4MML A;  2EYQ A;  2ZPF B;  5I22 A;  1VQ4 T;  4F7U B;  4X9C A;  4C8Q A;  2DAQ A;  2DBM A;  1WDX A;  2KEA A;  4ATO A;  4FCY A;  3MKD A;  2IVW A;  1RAE B;  3A8G B;  4CC4 B;  2HNI A;  2MWP A;  2GBQ A;  1QP2 A;  2QA4 T;  2PUO B;  4ZN1 A;  4ZGD B;  2OTJ A;  4M78 F;  1D1C A;  4OMM A;  2DD5 A;  3CXC P;  2W0Z A;  3OYK A;  2HSE B;  1PRM C;  3FLG A;  5GJV B;  3UPU A;  2QGF B;  1IGU A;  1M27 C;  2E64 A;  4RTT A;  4HCC A;  3NMZ C;  4RCB A;  1WHM A;  4F14 A;  3RMS A;  2CS7 A;  2PTK A;  1X2K A;  2EPD A;  3Q1J A;  3SWN A;  3PFS A;  3L2Z A;  1WXU A;  1JJ2 S;  4QW2 A;  1Q86 R;  1VQ7 Q;  1GBQ A;  2DIL A;  2L3Q A;  3JCM X;  2JTE A;  4BDY A;  1K9A A;  1G8X A;  1VQ8 A;  3QG1 A;  4M7A E;  3I55 Q;  3TEE A;  4FU6 A;  3FJP A;  1M1G A;  2FRY A;  4Z88 A;  4OF1 A;  2KSS A;  4EMK C;  4A54 A;  3V8L A;  2IPO B;  5GAM d;  3L2W A;  4M75 A;  2F2W A;  3LGL A;  2G3R A;  4F04 B;  4XU1 A;  2DE0 X;  3R6O A;  5KYN A;  3M5A A;  5AT1 B;  3OBW A;  4J9E A;  5CIU A;  3G71 T;  3PVQ A;  1S72 A;  1TSF A;  2AHJ B;  6AT1 B;  3KFV A;  5GAO l;  2ED1 A;  3JCM h;  1UE9 A;  4N0A A;  3G7Z A;  2CYZ B;  4JRK A;  2C0T A;  4KUI A;  2NWM A;  3RDV A;  1GCQ C;  1WHH A;  1NPP A;  2LNH B;  2V8K A;  1QQJ A;  4LDX A;  2YRD A;  5IHI A;  4XU2 A;  2NUZ A;  3VYG A;  3M59 A;  4A4H A;  2FZK B;  4PJO F;  3CEY A;  5M9O A;  2K3X A;  1UHC A;  3OYC A;  4XU3 A;  5LJ3 d;  2K5F A;  2VVK A;  1Z9Q A;  4OGC A;  4BD3 A;  2X4W A;  4J9F A;  2SEM A;  2RHU A;  4WF2 A;  3CXC A;  2K9G A;  1KG1 A;  4HXJ A;  3MEA A;  4P5N A;  3G4S A;  2DTI A;  4OMO A;  9ATC B;  3EH2 A;  3C12 A;  4JZ3 A;  4VUB A;  2H3J A;  1VUB A;  1C0M A;  2FZG B;  2RI2 A;  1PD0 A;  4J9H A;  1K9M U;  2C06 A;  3HSB A;  1BI1 A;  5DM7 R;  2J6O A;  1K0X A;  4PFO A;  4E2F B;  1NLO C;  4M75 E;  3CC7 A;  4HT9 A;  5GAM j;  4JJN K;  1N8R R;  5D6Y A;  2BUD A;  5KYU B;  5LJ5 h;  4AG2 C;  5GMK e;  4NOY A;  5FWB A;  5KYY A;  2RJF A;  5CVI A;  1TUG B;  1WGS A;  1Z9Z A;  3PIO A;  3JCM W;  3RER A;  2DO3 A;  3ZEH A;  3OYY A;  1MMN A;  2CSQ A;  2E5K A;  2EJF A;  1G83 A;  1Y57 A;  3LX7 A;  1TU0 B;  1UG1 A;  5GMK i;  1A0N B;  1VQN Q;  1Q7Y U;  3QBY A;  3JCM P;  1WHK A;  2KRM A;  4IUQ A;  4KBM B;  2RQW A;  3CCV A;  4BI4 A;  4PLL A;  3QO3 A;  4BB7 A;  1VQ7 T;  4OB3 B;  1VQ9 A;  4GBQ A;  1VQL A;  4C0D B;  2O2O A;  2CT4 A;  1I07 A;  4C0D C;  1K4U S;  2OJ2 A;  5GAN f;  1W1F A;  2CP2 A;  3GLX A;  3FRN A;  1U06 A;  2XD0 A;  3SD4 A;  3EAE A;  3I55 T;  1I8F A;  2KT8 A;  5LJ3 j;  3EG9 A;  2L3S A;  1KD1 C;  3LW5 E;  3MEU A;  2DFU A;  5AYF A;  4QVD A;  3DKM A;  1X2Q A;  3CCQ Q;  5GAN 4;  3H8Z A;  1WXB A;  1VQN A;  1TUD A;  3CC2 Q;  2EYZ A;  1AZG B;  2YRC A;  1WHJ A;  2MMP A;  3GIB A;  1SHG A;  1UJY A;  4ZNX A;  3OYE A;  1U5S A;  1ZLM A;  2CP3 A;  3PMT A;  3RNJ A;  5CKD A;  3ZFJ A;  3DB4 A;  1HK9 A;  2QK0 A;  2KNB B;  5LL6 S;  3VS4 A;  2X51 A;  1TH7 A;  2YWW A;  4L5G A;  1YJN Q;  3EG2 A;  4XTZ A;  2QI2 A;  3CME T;  2HCK A;  3EFO B;  1SSH A;  3CBM A;  4KGZ B;  2LQW A;  2EVR A;  2VUB A;  1QWE A;  2KQW A;  2ENM A;  2P0Q A;  1D0Y A;  4JJB A;  2XDB A;  3A5Z B;  4V2S A;  1X01 A;  1Q82 R;  2MCN A;  1UTI A;  2X4X A;  1LPL A;  3CCJ T;  2EBP A;  2QGG A;  1OV3 A;  1MUZ A;  1U3O A;  5J26 A;  4J9B A;  3VYH B;  2QYZ A;  2CGH A;  3CCE T;  3NTI A;  3QYH B;  1R0B G;  3VS5 A;  2WSF E;  2YUO A;  3BDL A;  2WSE E;  2J7I A;  1U1T A;  4M7A D;  3JRZ A;  2DLP A;  5KE3 A;  2PVO B;  3VS3 A;  3LWH A;  4J9G A;  2GQI A;  8ATC B;  4PJM A;  1IRX A;  2DZ9 A;  5KCH A;  2F2X A;  1OPK A;  3H41 A;  4OMP A;  2EQM A;  3G1J A;  2QTX A;  3EGD B;  1ZUK A;  1QCF A;  2RD1 A;  1G3W A;  1YJ9 Q;  3TSW A;  1OX8 A;  1K9M C;  3P8H A;  4ELY C;  2O88 A;  2ABL A;  2FVU A;  2VC8 A;  4MDW A;  2O9V A;  5IN1 A;  3QHS A;  3GPL A;  5KYX A;  3CCU Q;  4M7A G;  4LD9 K;  1K8A U;  1IB8 A;  4LDV A;  3JCM e;  1ACM B;  3JCM b;  4A53 A;  1W2B S;  3HFN A;  4J8O A;  4MDX A;  2JM8 A;  4PJJ A;  2E70 A;  3NPF A;  1N5Z A;  3C4S A;  3E19 A;  1F1B B;  3VS0 A;  4PJO A;  2DYI A;  4M77 C;  2LJ3 A;  3CD6 T;  1VQM A;  1Q7Y C;  2JZ2 A;  4JRI A;  3VRY A;  2K2V A;  1QMC A;  4F7U F;  4RKU E;  3OMG A;  2YLC A;  1GBR A;  2RQV A;  2L0A A;  4PK4 A;  4ELZ C;  2DL5 A;  4K11 A;  5GAO m;  2NUP A;  2JUF A;  3TSZ A;  1OQK A;  5D7U A;  2K4Y A;  4J83 A;  2RHI A;  2HEQ A;  4E6R A;  1R77 A;  4NL3 A;  1IO6 A;  1CKB A;  3QWY A;  3CC2 T;  4IUR A;  3VS6 A;  2YXY A;  1UEB A;  3JV3 A;  2A36 A;  2DTH A;  5CKE A;  5FRN A;  2DM1 A;  3UAT A;  3JB9 F;  3QYG B;  5LJ5 e;  1TUC A;  4DBQ A;  3C95 A;  1UFF A;  1OUL A;  2VGN A;  4CI0 C;  1HXD A;  1B34 B;  2IG0 A;  1WJR A;  2K2M A;  1IGQ A;  2MWO A;  4ZTJ A;  1YJN T;  1VQ6 Q;  3QUI A;  1ZSG A;  5KCO A;  3RKW A;  4N4I A;  1MV3 A;  1VQ5 Q;  4L6V 5;  2P4T A;  3X25 B;  1UEC A;  5GAN 3;  2GCX A;  5A2Q E;  4WTO B;  1O9S A;  2RQU A;  2RB6 A;  2R5M A;  1D3B A;  5L23 A;  3S3O A;  1YBY A;  5FRO A;  2DA9 A;  3M54 A;  2EYY A;  1OI1 A;  4Y92 A;  4AG1 C;  3G6E A;  1FMV A;  3CCS Q;  1AD5 A;  2QDY B;  1H64 1;  1ZUY A;  2OTL A;  3U23 A;  1BB9 A;  4J9D A;  2MPX C;  3LH5 A;  4FYW B;  4M7A B;  4ZGJ B;  2FPE A;  4XTV A;  5J3B A;  4M7A C;  4KT0 E;  3CQT A;  4UC4 A;  2SRC A;  1PSF A;  2CZ0 B;  2K57 A;  3JAM E;  2MYS A;  3HRS A;  1X43 A;  1YJ9 T;  2K6D A;  2DBK A;  4MZM A;  2DMO A;  2P0P A;  2BZ8 A;  1YCS B;  4RMO A;  2HBW A;  1IZ6 A;  3MP6 A;  1K76 A;  1SG5 A;  3PE0 A;  5IHN A;  5FRM A;  1J3T A;  2F1L A;  4TVR A;  4X9D A;  2AT1 B;  5CQY A;  1YNZ A;  1BU1 A;  4DBF A;  4FM4 B;  1SHF A;  1YWP A;  4LN2 A;  4HVV A;  2EJG A;  2JMC A;  1ARK A;  2HKQ B;  2DTO A;  2FZC B;  4OMN A;  2A28 A;  2RQT A;  3HTR A;  5ECA A;  1EFN A;  2E41 A;  3P8B B;  5IXF A;  4Z8A A;  1ZSZ B;  3UA6 A;  3CC4 A;  2ROT A;  1KC8 U;  2FO0 A;  1QCN A;  1OYX A;  2OTJ Q;  1EX4 A;  3MPU B;  1T0H A;  1M1K C;  1FX7 A;  2QEX Q;  4CC7 A;  3MP8 A;  1AWO A;  2BTT A;  5FU6 C;  4ORZ A;  1ZA2 B;  5GAM e;  1YIT A;  2LJ1 A;  2LRQ A;  4LE9 A;  3P8D A;  4E7J A;  2K7A A;  3M0Q A;  3SWN C;  3OYB A;  2HMA A;  2DXB A;  2DVE A;  2DIG A;  2R5A A;  4IIO A;  1VQK T;  2EGA A;  2RMO A;  3EGX A;  4PFP A;  2M1H A;  4A4E A;  5GMK l;  3WVE B;  5D6W A;  1WI7 A;  1QCO A;  3M53 A;  3V8K A;  2ED0 A;  1YI2 T;  2PZ1 A;  1VQ8 Q;  3JCM J;  3M4Y A;  2CP5 A;  3I5S A;  4M75 C;  4XTX A;  2A08 A;  2QEX A;  1VQP T;  2MOX A;  3MET A;  4IUU A;  1FYN A;  2JW4 A;  2H8H A;  2V8J A;  3ULR B;  1VQ6 T;  4LDY A;  2LX9 A;  1BI0 A;  1I4K 1;  5LJ5 f;  3RKY A;  4A4G A;  1WPY A;  1OU8 A;  2F69 A;  1S72 Q;  1VQ5 T;  4N0A C;  3PIP A;  3RMQ A;  1K9M R;  4BI8 B;  5LJ3 e;  3EFS A;  5CQX A;  2BE9 B;  1KD1 U;  4R0K A;  2RN8 A;  2E3I A;  3SFM A;  4Y91 A;  3O8V A;  2CP0 A;  2EAY A;  3HRU A;  4M7D F;  1V1C A;  2KE9 A;  2RO0 A;  3DLL A;  1K1Z A;  4NS5 A;  4EMK B;  3ZL7 C;  2RI5 A;  1V76 A;  4F7U A;  1OZ3 A;  4A4F A;  3CCS T;  5C6S A;  2CUD A;  4AMC A;  3OYJ A;  3GP8 A;  2KRO A;  2EQI A;  2KK4 A;  3OYN A;  3VS2 A;  2YDL A;  1NPR A;  2YT6 A;  3TRE A;  1P92 A;  2Y4X A;  4C8Q E;  1Q7Y R;  3QDR B;  2ZPI B;  4JUV A;  4OGE A;  2XI9 A;  3OW2 P;  1X6G A;  3I56 A;  5A0L A;  2MIO A;  2H3E B;  2HL3 A;  4X34 A;  2DXC A;  1VA7 A;  3G4S Q;  1YJW A;  5CO7 A;  3PMI A;  1C1A A;  2HBP A;  1BIA A;  2V1R A;  4ESR A;  5GAM g;  1YIJ A;  2DL8 A;  3OYG A;  5HY6 A;  3J81 E;  1KQ2 A;  5CKB A;  3CC7 Q;  5KYY B;  4LD6 A;  1M2V B;  4QVZ A;  3H6Z A;  1NM7 A;  4C5E A;  2YRV A;  2HD0 A;  4DEX A;  2DF6 A;  4KGX B;  2V1Q A;  2Y4Y A;  3HP9 A;  4PKC C;  2A3L A;  5GAN d;  2OTJ T;  4NL2 A;  1QVF S;  2ZCF B;  4E7I A;  4LUD A;  1JXO A;  1KC8 C;  2PQW A;  3PTA A;  2XMF A;  1QP3 A;  3OQ5 A;  4F7U E;  3CCM A;  1KQS S;  1G2B A;  2L5Q A;  5D6X A;  2KVQ G;  3FEO A;  1UJ0 A;  2BZY A;  3MJX A;  4B9W A;  3CCV Q;  1AWW A;  1SSF A;  1GXI E;  2LCC A;  2CT3 A;  1VQ9 Q;  1VQL Q;  5LJ3 g;  2O31 A;  4WCI A;  4C92 A;  3OYA A;  2RA2 A;  2NLU A;  1VQ8 T;  3EH1 A;  4B6M A;  5GAN g;  5GJW B;  2RJE A;  1OX9 A;  5CK9 A;  1UDL A;  1M3B A;  2YUP A;  3ASK A;  3KBG A;  4IUV A;  1Y96 B;  3GNG A;  1CKA A;  2F2V A;  4M77 D;  3CCJ A;  4X1V A;  2KDS A;  4MZT A;  4A63 B;  3E9G A;  4XAX B;  1T3S A;  3PVL A;  1KK7 A;  1S72 T;  3CCE A;  1G3T A;  3OW2 A;  1VQO Q;  2QAZ A;  1BBZ A;  3J7A F;  2AK5 A;  1X27 A;  3V7S A;  1AOJ A;  3T9N A;  3LYI A;  1PCX A;  3M0P A;  2DXU A;  4ANJ A;  4C0Z A;  2EYW A;  4M77 G;  2EIF A;  3I5R A;  2KY9 A;  4RTY A;  1IXD A;  1K8A R;  4HT8 A;  5GAN j;  2XDP A;  2QQA A;  1EZZ B;  2R58 A;  2LT4 A;  2L89 A;  5KYU A;  1MGQ A;  3C94 A;  4Q5W A;  3GF5 A;  1GFD A;  4KUD K;  2QG9 B;  5A0D A;  4KGV B;  4LDU A;  3OYH A;  1K0S A;  1VQO A;  4QT7 A;  1MMA A;  1WXT A;  4QKU A;  2G6F X;  1U1S A;  2XHC A;  3BE3 A;  3SDZ A;  3CCR A;  1R0C B;  1GRI A;  3HFO A;  3N5B B;  2LJ0 A;  3FB9 A;  4FT2 A;  4O6J A;  4C92 E;  4D6W A;  2GNC A;  3G4S T;  2YHT A;  1M90 C;  4M78 A;  3CD6 A;  4IIM A;  1BCM A;  1TS9 A;  3EFR A;  4BAC A;  2E65 A;  3CBP A;  3E2U A;  3JCM Q;  4BE2 A;  3URG A;  3TQ7 P;  3MEW A;  2L3R A;  1WHG A;  3NTH A;  2VWF A;  2FL7 A;  2GQV A;  4AT1 B;  4FW2 A;  1NJI C;  1M30 A;  4C5G A;  2QAS A;  4HCZ A;  1G5V A;  1SEM A;  1M8M A;  2YUN A;  2V8I A;  4JPB W;  4ME7 A;  5GAM h;  1W4S A;  1X75 C;  3VS1 A;  2P4R A;  4M7A F;  1ZUU A;  1MHN A;  5I2S A;  2DEU A;  4M7D A;  1N6A A;  1M5Q 1;  4XQ3 A;  1AWJ A;  1YHQ A;  3HHT B;  1I0C A;  4E47 A;  7AT1 B;  4JJC A;  2EKO A;  1WFW A;  3VUZ A;  2DL3 A;  2ZPG B;  5J39 A;  3CCL Q;  5I2M A;  1QVG S;  4PJO C;  4FYV B;  1RL2 A;  1QWF A;  2ZPB B;  2JXB A;  3CCV T;  1MV0 B;  2GTJ A;  1GCP A;  4FSX A;  1VQM Q;  1VQ9 T;  1RAB B;  1VQL T;  3INZ A;  3CMA A;  3ZBD A;  3OS0 A;  1SRL A;  3LLR A;  4C8Q D;  1HSQ A;  1LNX A;  1BI3 A;  1X6O A;  2HQE A;  1X6B A;  1JEG A;  4FW1 A;  2M51 A;  5GAO r;  4XK8 E;  5CKH A;  1Q86 C;  4EIK A;  3EHQ A;  5LJ3 h;  1S1N A;  1TWB A;  2PNI A;  4M78 E;  1VQN T;  4OB1 B;  3CCL A;  3RUX A;  4M77 B;  5GMK j;  2RQR A;  2E10 A;  3H0H A;  1D09 B;  5GAN h;  2FG0 A;  1RAC B;  4C8Q G;  1M1K U;  3JB9 J;  1TXQ A;  3H0F A;  3CPW P;  3UWN A;  2RI3 A;  4DBH A;  1Y7X A;  5KH6 A;  2JTM A;  1ABO A;  2D8J A;  1UHF A;  1XQH A;  3BW1 A;  1DJ7 B;  2D9T A;  2O4X B;  1E7O A;  2RH2 A;  3OSV A;  2KRN A;  1H8K A;  3PT9 A;  4JZ4 A;  3L2V A;  4LUE A;  2EGC A;  2C0O A;  1XOV A;  2E1H A;  2LQ8 A;  3VRZ A;  4PLI A;  2RHZ A;  1IRE B;  3A8L B;  4KH0 B;  4OMQ A;  3X24 B;  4M7D E;  2IIM A;  3CCQ T;  3EGD A;  1PKT A;  1W2B P;  1RAF B;  2AZV A;  2Z0W A;  4JRP A;  1B7T A;  3OB9 A;  4HVW A;  3UF4 A;  1PRL C;  2I2L A;  1PKS A;  3BFM A;  4M75 D;  5FU7 B;  3SEM A;  1QW1 A;  4XU0 A;  2JJ9 A;  1T0J A;  2CUB A;  2GFA A;  4M4Z A;  5FU7 C;  5I11 A;  4J6Y A;  2V26 A;  1KC8 R;  2RHX A;  3G6E Q;  3J80 E;  2JTF A;  1FWZ A;  3I35 A;  1YP5 A;  3HPW A;  1VIE A;  1KFZ A;  2OTL Q;  2FYK A;  3QSU A;  2ROL A;  3QII A;  4E7H A;  1RUW A;  4GLM A;  1Q81 U;  3OYM A;  2EYX A;  2VXE A;  5A0G A;  4BE1 A;  4AFZ C;  4M75 G;  2DPP B;  2KBT A;  5HK3 A;  2MI6 A;  1JU5 C;  5HKC A;  1FMW A;  4LNP A;  1R8O B;  1MND A;  2NUT A;  1HYO A;  1E6G A;  2DD4 A;  1AWX A;  2XG8 D;  1VQ4 A;  2F5K A;  4FYY B;  4R55 A;  2GFU A;  2QDL A;  1D1A A;  3AHU A;  4PJO E;  4CRI A;  4LDW A;  1H92 A;  2VGM A;  1PWT A;  2EQK A;  1SKU B;  2NYS A;  1VQK A;  8AT1 B;  2OX7 A;  1N8R C;  1UGQ B;  4XTW A;  5KYW B;  3JB9 I;  5DY9 A;  3HKS A;  1TTH B;  2QA4 A;  1UB4 A;  3QWX X;  5GAN 8;  4F17 A;  1YI2 A;  2HQX A;  1LCK A;  4PJL A;  3AT1 B;  1UGP B;  2EW3 A;  4HCK A;  1G3S A;  1PSE A;  3L2R A;  4AFQ C;  3CPW A;  3CC4 Q;  1K73 U;  1W6X A;  2FHD A;  3OSS C;  2KR3 A;  2CZ1 B;  3GOX A;  2LTO A;  5FW9 A;  1YWO A;  2XU8 A;  1B34 A;  4O5V A;  3NHN A;  3CCU T;  1KD1 R;  4AFU C;  4C8Q B;  2ZPH B;  2E6N A;  1JQQ A;  4GY5 A;  3OMC A;  1EIF A;  4QVC A;  4C8Q C;  1YIT Q;  2KYB A;  5GAO q;  1B07 A;  2JNG A;  3A8M B;  2CZ6 B;  3WXM B;  3E9F A;  3QZ5 B;  3QDF A;  4C92 D;  4IKF A;  1PHT A;  4DOV A;  5LJ5 d;  3JCM f;  5CAI A;  1BI2 A;  1HJD A;  1WHL A;  3SB2 A;  5HK0 A;  2KXC A;  3EG3 A;  3RES A;  1KQ1 A;  5GAN 5;  4PFZ A;  1OPL A;  2CP6 A;  3GNF B;  3OS1 A;  2HZY A;  3UDC A;  5FU6 B;  3G71 A;  1M1F A;  2Y90 A;  4C92 G;  5GAN 7;  3JCM V;  4M7A A;  2DZC A;  1JRI A;  3CXC S;  1PC0 A;  1UGR B;  3SWN B;  2BIV A;  3NTK A;  3L1A A;  1AT1 B;  1GFC A;  1M9S A;  1PG5 B;  5IT9 E;  3A98 A;  3H9N A;  4FYX B;  4A4K A;  4AFS C;  2DRK A;  4N4H A;  4DA4 A;  4OB2 B;  3KXT A;  2EKH A;  1M3A A;  3OBY A;  4QQD A;  2I0N A;  4F16 A;  4RTV A;  1JO8 A;  1D0Z A;  4M75 B;  4D8D A;  3A1P A;  1AZE A;  4FSS A;  3G6E T;  4C5I A;  2XKO C;  1RLQ C;  4C0F A;  5IAY A;  2OTL T;  1UGV A;  2AKK A;  3RBB B;  1CSK A;  5FLX E;  3FIF A;  3QJY A;  1Q82 C;  4BDZ A;  2DJQ A;  4JLG A;  1ZSZ A;  3IQL A;  4RTU A;  2K3B A;  3L2U A;  1Q81 C;  2L8D A;  1BKB A;  2LCS A;  2M9U A;  3REB B;  3M0U A;  3OYF A;  4M78 D;  2BKD N;  2CZ7 B;  3I56 Q;  5LJ5 j;  3RIR A;  2OAW A;  2OAU A;  1VYU A;  5L8R E;  5GAN e;  3MCA B;  2K5I A;  3OW2 S;  2F5T X;  3MEV A;  2FPD A;  3VV0 A;  4B9X A;  4R56 A;  4PJN A;  1YJW Q;  4JDS A;  5C0M A;  2D1X A;  1M2O A;  3OYI A;  3QKJ A;  1YIJ Q;  2QXF A;  2KMT A;  2RK2 A;  1ABQ A;  3M9Q A;  2YSQ A;  2QQR A;  4M78 G;  2GGR A;  2LCL A;  1IHV A;  2LVM A;  4CC3 A;  2J06 A;  2VAS A;  3CC4 T;  3QXE B;  4M7D D;  2VB6 A;  1VIF A;  5GAN 2;  1M90 U;  2OI3 A;  2KT1 A;  3FJ5 A;  4FL6 A;  2J6F A;  3OY9 A;  1JJ2 P;  2RF0 A;  1N27 A;  3S3M A;  1WJQ A;  4KRT A;  3A8O B;  1K73 C;  4QQ6 A;  4OMF B;  2COZ A;  1LOJ A;  1YIT T;  4HVU A;  5CKF A;  4BY6 B;  1VQ7 A;  4RG2 A;  1RAG B;  2A0F B;  2DVJ A;  1NJI U;  4BY6 C;  3CCM Q;  3NFC A;  4C0G A;  1GL5 A;  2RJC A;  4M7D G;  1WX6 A;  2CDT A;  4Z89 A;  2D0Q B;  4C92 B;  1MMD A;  3HL8 A;  3I55 A;  3KUF A;  4C92 C;  4J9C A;  3M56 A;  3RKX A;  3ME9 A;  1JB0 E;  3EHR A;  1C6V X;  4J7I A;  4EMK A;  3CME Q;  1AEY A;  2E5Q A; 
#chains in the Genus database with same CATH homology
 1RLP C;  2JS2 A;  3JV3 A;  5I22 A;  2A36 A;  2VWF A;  2DNU A;  2DM1 A;  3UAT A;  1TUC A;  5IH2 A;  2DBM A;  1UFF A;  1M30 A;  1WDX A;  2ESW A;  4RTX A;  2CSI A;  2KEA A;  1SEM A;  1M8M A;  2VKN A;  2YUN A;  2K2M A;  4JPB W;  4CC4 B;  2RPN A;  3VS1 A;  2P4R A;  2GBQ A;  2X3X D;  1ZSG A;  2AZS A;  1ZUU A;  1GCQ A;  3EG0 A;  1AWJ A;  1MV3 A;  1W70 A;  4OMM A;  1I0C A;  1UEC A;  2W0Z A;  2JT4 A;  4JJC A;  1WFW A;  2RQU A;  2DL3 A;  1PRM C;  5L23 A;  5GJV B;  1QWF A;  2JXB A;  1M27 C;  1MV0 B;  2DA9 A;  2EYY A;  2GTJ A;  4RTT A;  1GCP A;  3NMZ C;  1KIK A;  4Y92 A;  1KJW A;  1VYT A;  4F14 A;  4AG1 C;  1QKW A;  2PTK A;  1X2K A;  2EPD A;  2FRW A;  1AD5 A;  1WXU A;  1SRL A;  1ZUY A;  3U23 A;  4RTZ A;  2M0Y A;  1GBQ A;  3C0C A;  1BB9 A;  1HSQ A;  2DIL A;  4J9D A;  3LH5 A;  2L3Q A;  1X6B A;  1JEG A;  2FPE A;  5EC7 A;  2JTE A;  2C0I A;  2RNA A;  1K9A A;  3CQT A;  2M51 A;  2SRC A;  1FMK A;  4CC2 A;  2FRY A;  4EIK A;  4Z88 A;  2JMA A;  3EHQ A;  1X43 A;  1NEG A;  2K6D A;  1S1N A;  1WYX A;  2DBK A;  2PNI A;  2DMO A;  2BZ8 A;  1VYV A;  1YCS B;  2F2W A;  3H0I A;  2RQR A;  1I1J A;  3H0H A;  2HBW A;  2DE0 X;  2FG0 A;  3SHW A;  1K76 A;  3PE0 A;  5IHN A;  4J9E A;  1J3T A;  3H0F A;  3PVQ A;  1YNZ A;  1BU1 A;  1SHF A;  1YWP A;  4LN2 A;  4HVV A;  3KFV A;  2ECZ A;  1ABO A;  2D8J A;  1M3C A;  1UHF A;  2ED1 A;  2HSP A;  2JMC A;  1UE9 A;  2D0N A;  2DX1 A;  1ARK A;  1E7O A;  2A28 A;  2RQT A;  4OMN A;  3THK A;  2KRN A;  1H8K A;  2C0T A;  4JZ4 A;  5ECA A;  4LUE A;  1EFN A;  5IXF A;  2EGC A;  2C0O A;  2NWM A;  1XOV A;  4Z8A A;  3VRZ A;  1GCQ C;  3UA6 A;  4OMQ A;  1X69 A;  2IIM A;  2ROT A;  2LNH B;  1PKT A;  1ZX6 A;  2FO0 A;  5IHI A;  1NYG A;  2NUZ A;  2AZV A;  1PNJ A;  1T0H A;  4HVW A;  2DYB A;  3UF4 A;  2LX7 A;  4CC7 A;  1AWO A;  1PRL C;  3R6N A;  2BTT A;  4ORZ A;  1PKS A;  2LJ1 A;  1UHC A;  3SEM A;  2X3W D;  1T0J A;  2CUB A;  4M4Z A;  2VVK A;  5I11 A;  1Z9Q A;  4LE9 A;  2K7A A;  5FWC A;  3M0Q A;  2HDA A;  3I35 A;  1YP5 A;  4J9F A;  2SEM A;  1KFZ A;  4IIO A;  2ROL A;  2EGA A;  2RMO A;  2K9G A;  4HXJ A;  1RUW A;  4GLM A;  1WI7 A;  4OMO A;  2EYX A;  2ED0 A;  1AVZ C;  2PZ1 A;  4JZ3 A;  4AFZ C;  2KBT A;  1JU5 C;  4J9H A;  3I5S A;  1T3L A;  2A08 A;  4JJD A;  2J6O A;  4LNP A;  3TVT A;  3UA7 A;  1K0X A;  1E6G A;  1NLO C;  1AWX A;  2MOX A;  2QDL A;  1FYN A;  2JW4 A;  1H92 A;  2J05 A;  2H8H A;  4AG2 C;  3ULR B;  2BZX A;  1PWT A;  5FWB A;  1Y0M A;  3EG1 A;  2KGT A;  2AKL A;  1Z9Z A;  3QWX X;  4F17 A;  2CSQ A;  4R0K A;  1LCK A;  2E5K A;  2KXD A;  2RN8 A;  1G83 A;  1Y57 A;  3M0R A;  2EW3 A;  4HCK A;  1V1C A;  2KE9 A;  3VS7 A;  5IXB A;  1K1Z A;  1UG1 A;  2DRM A;  4AFQ C;  2CH4 W;  1A0N B;  3ZL7 C;  2O9S A;  1W6X A;  2KRM A;  1SRM A;  2KR3 A;  2RQW A;  2CUD A;  5FW9 A;  1YWO A;  4GBQ A;  2KRO A;  2EQI A;  3NHN A;  2O2O A;  3VS2 A;  4AFU C;  2YDL A;  2CT4 A;  1I07 A;  1JQQ A;  2YT6 A;  1K4U S;  2OJ2 A;  1W1F A;  2KYB A;  1U06 A;  3NGP A;  1B07 A;  2KT8 A;  1SPK A;  1BK2 A;  2L3S A;  2YUQ A;  1OOT A;  1PHT A;  2JS0 A;  1QKX A;  1X6G A;  1HJD A;  2MIO A;  2KXC A;  3EG3 A;  1X2Q A;  1VA7 A;  1WXB A;  3REA B;  4D8K A;  1TUD A;  1RI9 A;  2EYZ A;  1NLP C;  2V1R A;  4ESR A;  1AZG B;  1OPL A;  1OEB A;  1YN8 A;  4OML A;  1SHG A;  2DL8 A;  1UJY A;  4ZNX A;  3M0S A;  1U5S A;  1ZLM A;  2D8H A;  3RNJ A;  1NM7 A;  1NYF A;  2EGE A;  1GFC A;  4RUG A;  2KNB B;  3VS4 A;  4DEX A;  2DF6 A;  3A98 A;  2V1Q A;  3EG2 A;  2W10 A;  4AFS C;  2DRK A;  2HCK A;  2EKH A;  1M3A A;  1SSH A;  2KYM A;  2LZ6 B;  1WLP B;  2I0N A;  4LUD A;  1JXO A;  4F16 A;  2DL4 A;  2LQW A;  2L3P A;  3EGU A;  2EVR A;  2JM9 A;  4RTV A;  1QWE A;  2ENM A;  1JO8 A;  5IHK A;  2XMF A;  4JJB A;  4D8D A;  1G2B A;  2MCN A;  1UTI A;  4FSS A;  1AZE A;  2EBP A;  1UJ0 A;  2BZY A;  1AWW A;  1OV3 A;  1MUZ A;  1U3O A;  1RLQ C;  2L2P A;  2FPF A;  2CT3 A;  1UGV A;  2AKK A;  3RBB B;  1CSK A;  4J9B A;  2O31 A;  4WCI A;  2LQN A;  3O5Z A;  3VS5 A;  3M0T A;  1TG0 A;  2DJQ A;  2YUO A;  3IQL A;  2FEI A;  2J7I A;  2DLP A;  2CRE A;  5GJW B;  4RTU A;  2K3B A;  3VS3 A;  3GBQ A;  4J9G A;  2GQI A;  4J9I A;  1UDL A;  1M3B A;  2LCS A;  2F2X A;  1OPK A;  2YUP A;  3H41 A;  3M0U A;  4OMP A;  3REB B;  2OAW A;  1ZUK A;  1QCF A;  1VYU A;  3TSW A;  2CH4 A;  1QLY A;  1ZBJ A;  2K79 A;  2FPD A;  2O88 A;  1CKA A;  2F2V A;  2ABL A;  4X1V A;  1B3Q A;  2O9V A;  4A63 B;  2D1X A;  1T3S A;  3PVL A;  2B86 A;  1NG2 A;  1ABQ A;  1HD3 A;  1UUE A;  2YSQ A;  1BBZ A;  2AK5 A;  1X27 A;  1AOJ A;  1KSW A;  1WIE A;  2JM8 A;  2GGR A;  2GTO A;  3NPF A;  4CC3 A;  3M0P A;  2LMJ A;  4DEY A;  2J06 A;  1N5Z A;  5HCK A;  2EYW A;  2A37 A;  3I5R A;  1E6H A;  2OI3 A;  4RTY A;  2KT1 A;  3FJ5 A;  3VS0 A;  2J6F A;  2LJ3 A;  1H3H A;  2J6K A;  2RF0 A;  2LP5 A;  4KRT A;  3VRY A;  1GFD A;  4RTW A;  1GBR A;  4HVU A;  2RQV A;  2L0A A;  2DVJ A;  1WA7 A;  1GL5 A;  1K0S A;  2DL5 A;  4QT7 A;  4K11 A;  1WXT A;  1WX6 A;  3TSZ A;  2CDT A;  4Z89 A;  1JXM A;  2G6F X;  2KRS A;  1GRI A;  2DL7 A;  2LJ0 A;  3I9Q A;  2HEQ A;  4E6R A;  4J9C A;  2GNC A;  1IO6 A;  1CKB A;  3QWY A;  3EHR A;  3VS6 A;  4IIM A;  1AEY A;  1NEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...