2RD1A

X-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
TNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative outer membrane lipoprotein
publication title X-Ray structure of the protein Q7CQI7.
rcsb
source organism Salmonella typhimurium lt2
total genus 5
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rd1A00
3V8KA 1I8FA 4NL3A 3GIBA 3JB9I 3SWNB 1YCYA 1D3BB 2FYKA 2EJ9A 4NL2A 4C92B 1WQ7A 1BIAA 2YLCA 5GAOp 5GAMe 3RIRA 5GAN3 2DTIA 5GANh 4J6WA 1M5Q1 4JRIA 2DEQA 3V7CA 1WNLA 3FB9A 3L2ZA 5LJ5h 3V7SA 4F7UA 4PJOA 1JBMA 4C8QA 4RCBA 1U1TA 2DZCA 2RD1A 5GANf 5GMKh 5GAMj 5GMKl 2RA2A 2K57A 4Y91A 1X01A 4DQ2A 4M78C 5GANe 3JCMb 1U1SA 5GAN8 4J6XA 1H641 4M7AC 4M78D 3HFOA 3JCMQ 3V7RA 3JCMJ 3QSUA 5GAMg 4F7UB 1HXDA 3JCMc 4M7AD 5GAMd 4EMKC 5LJ5e 3BDUA 4M7DB 1LNXA 4PJOB 4C8QB 4XU3A 3VU3C 1B34A 2E41A 5GAOl 5LJ3f 5GMKe 3FIFA 5I21A 3JCMh 4JUVA 4QVCA 4MMKA 4JLIA 2EWNA 2CGHA 4J6YA 4M78G 4M78E 1WPYA 4M77B 4M78F 4XTUA 4C92F 2E65A 3JCMX 4M7AG 4M7AE 4M7AF 2ZGWA 5GMKi 4M75C 4QVDA 5LJ5j 1Y96A 4MMLA 5GAN6 4J5YA 4M75D 3JCMf 3AHUA 4XQ3A 5LJ3g 3HSBA 5GMKj 5CAIA 2YHTA 3BY7A 3RKXA 1I4K1 4EMGA 2EJFA 2DXTA 2VXEA 5LJ5g 3RUXA 5LJ5d 3JCMe 5DY9A 1WQWA 3SWNC 2DTHA 1HK9A 1I5LA 5GMKm 4C92C 5LJ3h 1Y96B 4M75G 4M75F 3JB9D 2JN0A 4M75E 4C92D 2EJGA 1LJOA 5GAOn 2E1HA 5GAN5 2YLBA 5LJ3d 3V8LA 4M7DF 4XTVA 2RB6A 5GAOm 2DJZA 4XTWA 5GAN7 3JB9G 4N0AC 3JB9F 5GANj 4C92G 4C92E 5LJ3e 3JCMd 4M77F 1LOJA 4M77E 1MGQA 4V2SA 5GAN2 4X9DA 4A54A 1M8VA 4PNOA 3SWNA 5GANg 2QTXA 5GANd 3JB9H 1B34B 2DKGA 4M78A 3V8JA 4M7AA 4PJOC 4M7DC 2DVEA 3QHSA 4C8QC 3RERA 1KQ1A 3FJPA 3INZA 5LJ3j 4PJOD 4EMKA 4M7DD 4C8QD 3SB2A 4NOYA 3QO3A 1I81A 5GAOq 4XTZA 4M77C 4HT9A 3M4GA 2Y90A 5GAMf 4M78B 2E64A 2HNIA 3EFRA 4N0AA 2DZ9A 2FB7A 3BW1A 4M77D 4OP0A 2RM4A 4X9CA 4M7AB 4F7UF 2I2LA 4PJOG 4PJOF 4F7UG 4F7UE 1KQ2A 4M7DG 4C8QG 2EAYA 4C8QF 1TH7A 4C8QE 4M75A 4EMKB 4M7DE 3EFSA 3PGGA 4WF2A 3JCMP 4A53A 4XTYA 3JCMW 3JCMg 3JCMV 5GAN4 2VC8A 3L1AA 4M77G 3JB9J 3HFNA 4M7DA 4HT8A 3QUIA 3RKYA 3RKWA 4JRKA 2DTOA 4EMHA 4XU1A 5GAOr 1D3BA 1N9RA 3RESA 4XU0A 2DXUA 4M75B 4C92A 1BIBA 3BFMA 5GAMh 5LJ5f 4RCCA 1JRIA 4M77A 2VXFA 4XU2A 4XTXA 4PJOE 2E10A 1N9SA 4HA8A
chains in the Genus database with same CATH superfamily
3V8KA 2ZPGB 2QQ9A 2YRVA 5GJVB 1SSHA 5CQYA 5GAOp 1M2OA 3UATA 4OMFB 3QXEB 1WX6A 5GANh 1YHQQ 1OZ3A 1M27C 3A98A 1ABQA 2XG8D 3V7SA 3EGXB 1KFZA 2K79A 5KYWA 1G83A 1VQ9A 1H641 2EYQA 3JCMQ 6AT1B 5FRMA 1KIKA 1QKWA 2JUFA 1KD1R 1K9MC 2E41A 1WFWA 1YIJT 1RUWA 1XQHA 2ZGWA 2IPOB 4M75C 1X75C 3HRUA 2MPXC 1UECA 1YI2A 4XQ3A 1MNEA 3SD4A 1VQ4Q 2BUDA 2RN8A 4QKUA 1WJQA 2QYZA 1YJ9A 2NLUA 1SHFA 3M57A 2HKQB 3OYIA 1U8RA 3OBWA 3I5SA 2CREA 2CP2A 2AKLA 2PVGB 5CKBA 2LVMA 2EPDA 2LQKA 1H3HA 4J8OA 3OY9A 2RQTA 2F69A 2P4TA 2DVJA 1BB9A 2YWWA 4HKEA 4OB2B 4JRQA 1RABB 4XTZA 1VQ8A 3M4GA 5LJ3g 1JXMA 4OVAA 1UGVA 4OMQA 4F7UF 1PRLC 4PJOG 2EAYA 1Q81U 1W2BP 3EFSA 3PGGA 4WF2A 4Z02A 3L2QA 3G7ZA 3JCMW 3QPHA 3C94A 2DEUA 1VQ4A 1G8XA 4JZ4A 3M0TA 1WJRA 4RUGA 4BE0A 5GAMh 4C0ZA 3I56A 2O88A 4OMNA 1OOTA 3EGXA 2OTJT 3GF5A 2P0QA 4OB1B 3X28B 5D7UA 5IHKA 1M30A 3J7AF 4C5IA 2PTKA 1SPKA 2PU9B 3RMQA 1FWZA 4Q5WA 4ME7A 1XNIA 5ECAA 3PMTA 2KAFA 3LW5E 1EZZB 2KROA 2E6NA 3HFOA 3JCMJ 3QSUA 1EIFA 1PRMC 2RHYA 5FWCA 3OQ5A 1PD1A 1VQ5A 3HHTB 5LL6S 4KULA 1TXQA 5LJ3f 2EFIA 1VQLQ 2VB6A 1NJIC 5L8RE 2GBQA 3CPWP 5GAN6 3CCMQ 1YFNA 2K7AA 2YHTA 1C0MA 2DD4A 2JS2A 1VQNQ 3LH0A 4RTVA 2F2VA 3CCST 2LJ0A 4B6MA 2DXCA 2KR3A 1BI0A 3CC4T 2GCXA 1LJOA 5GAN5 4JPBW 1D0YA 2H3EB 3G6EQ 1WHJA 1C1AA 3DKMA 2FL7A 2DBKA 4KUIA 2RQRA 2RJEA 2NUTA 3GBQA 3M53A 2QQBA 4WTOB 1Y0MA 3CCUT 3CCQT 3INZA 2QI2A 2QEXA 4HT9A 4M78B 4N0AA 4KUDK 2YUPA 4M77D 2A7YA 2RMOA 2MIOA 1Y07A 3OYHA 4OB3B 4XTYA 3OW2P 4PJNA 2QASA 2EYYA 1VQOT 4QQGA 1QVFP 1Q86R 3I55T 1PHTA 3DLLA 4M77A 4PJJA 2MAMA 2DL8A 2DL5A 1ZLMA 4GY5A 2EJ9A 2JXBA 2X3WD 1WQ7A 4E7JA 2RK2A 4MDXA 2M0YA 3CCET 1CKAA 1MUZA 5DLQE 4F16A 2DD5A 2L3SA 2GTOA 3FB9A 4J9CA 3OB9A 3QIIA 4BI3A 5CCAA 5HK3A 3HP9A 4DQ2A 1PC0A 1K9AA 3HTRA 2OTJA 1I1JA 4J9DA 4FW1A 3VKIA 3CXCA 4XAXB 1KQSA 1RAIB 3VU3C 3ME9A 5GAOl 3BDLA 4JLIA 1M3CA 1V29B 4JDSA 4BDZA 2WSFE 1Q82R 1E6HA 1IREB 2M1HA 3CMET 1G3WA 1G2BA 3G4SQ 5LJ5g 4MZTA 1WQWA 3SWNC 2FVUA 1K73R 2M02A 2DE0X 4J7IA 1ZA2B 5GAOn 2FZKB 3NMZC 3OYFA 2QDLA 2YLBA 4M7DF 1M1FA 2EYZA 4D6WA 2P4RA 4FIBA 4C92E 1UGRB 5GAN2 2BZXA 1M8VA 3CCSA 1B34B 4M78A 5I11A 1RI0A 4KH1B 3EH1A 3CC4A 4KH0B 3FJPA 1YWPA 4D8KA 2RI3A 3OBYA 2NUPA 1S72T 1KC8C 1K73U 2WSCE 2O9VA 2YXYA 4OP0A 4M7AB 3CCVT 3QZ5B 5J26A 4C8QE 2HD0A 2R57A 1BI3A 1MMGA 4BUGA 2PUOB 4GLKA 4M77G 1SRMA 3CCUA 3QUIA 3CCQA 1JJ2A 3E19A 3G4SA 4KGVB 3LLRA 1JU5C 2HQXA 2O2OA 5LJ5f 1SRLA 1VYVA 3VS3A 1FYNA 1VIEA 2LX7A 2IG0A 3CCLA 3MEUA 4FSSA 3MO8A 3JAME 2EIFA 3EG9B 1M4ZA 2O31A 3OYLA 1BBZA 2LTOA 3CC2T 1K0SA 2DJQA 2ED1A 1D1AA 1OPKA 3VUBA 3CCEA 1PG5B 1WHGA 3KFVA 3JCMh 2J6FA 4JUVA 4MMKA 1PSFA 2CGHA 1O9SA 3MP1A 4MMLA 3RBBB 2DL7A 5AYFA 1PKTA 3P8BB 5KE3A 2H8HA 1YJNA 1VIFA 1I5LA 2D0QB 1RI9A 1YN8A 2CSQA 4M75E 3OS1A 2CDTA 2ESWA 3NHNA 2MCNA 3A8HB 3MPUB 4AFZC 4JRPA 3CMEA 5GANj 1SEMA 4C5EA 2EGEA 4A4EA 1RAEB 3G71T 2L5QA 4M7AA 4M7DC 1X69A 2RJFA 4OMMA 2ZPBB 5FU7B 2QGFB 5LJ3d 2RHZA 4F7UG 4PLIA 2BZ8A 1J3TA 1KQ2A 4C8QF 4ZTJA 4Y28E 4KGXB 3EG1A 2CP5A 4JRKA 4PKCC 3TEEA 2X4WA 4XU2A 2P0KA 1PM3A 1K9MR 1AWWA 4CC7A 5L23A 2DL3A 3CCJT 1QCOA 1QVGA 3EG9A 4OB0B 2G6FX 2L0AA 2HCKA 3TSWA 1M1KR 4LN2A 2HAXA 4EDUA 1K76A 2FO0A 1U1SA 2QQRA 3CBOA 2HMAA 4EMKC 4PJOB 2X4JA 2HL3A 1VQ9T 3I35A 1QVPA 1K9MU 5GMKe 4JJNK 2JJ9A 1LPLA 1JQQA 1WPYA 2KBTA 9ATCB 4J9FA 2RO0A 3CC2A 2EKOA 2EJFA 3L2VA 1VOMA 3RUXA 2FPDA 5M9OA 3HPWA 1M1KU 4J83A 4M75F 1YJ9T 1S1NA 2J05A 1HYOA 2RNAA 3D7SB 4KRTA 1Y7XA 2MF2A 4RMOA 1SF9A 3EH2A 1Q7YR 1NZ9A 3KUFA 2A08A 2XDDA 5FRNA 2ENMA 1YHQT 1VQ7Q 2K5FA 2V8IA 3RDVA 1AWXA 2Y4XA 1D1BA 3H41A 3KBGA 3M58A 1VQMQ 1TH7A 1VQ8T 5IAYA 2DRMA 4LDXA 5HK0A 4OGCA 2GQVA 1WA7A 1VQKQ 1VQ6A 4DOWA 2DBMA 2MMPA 2VASA 2COYA 5C6SA 1VQ4T 2LT1A 3FLGA 3CCRA 4MZMA 3RNJA 3NPFA 2HQHA 3I5RA 3I56T 2JM9A 1U3OA 1BIAA 3VYHB 2JTFA 1IXDA 1M5Q1 4AG2C 3V7CA 5I2SA 1UB4A 2EKHA 2CH4A 4PJOA 2A0FB 1GXIE 2W0ZA 3O8VA 4ANJA 3FJ5A 2DZCA 1E6GA 2QA4Q 3LH5A 4UC4A 3L42A 2CH4W 2EW3A 4YTLA 4DEXA 4FM4B 1NEBA 1E7OA 2XHCA 4A4HA 4FYXB 4E7IA 1TWBA 5CKHA 2LCSA 1VQ5T 1NJIU 5GMKi 1UFFA 3SEMA 2DX1A 4R0KA 4QVDA 2ED0A 2GQIA 3TVTA 2CUBA 3E2UA 1X6OA 5LJ5d 2DTHA 1HK9A 3CD6Q 2XKOC 1WHKA 1Y96B 4C92D 1FMKA 8AT1B 2YUQA 3FC3A 2QQAA 5LJ3e 3VRZA 2FRWA 2CT3A 3THKA 1AWOA 1Z9ZA 3JB9H 3V8JA 4AFUC 2XIDA 2DK3A 2NUZA 1UTIA 1AZEA 1QP2A 1RLQC 4BY6B 2B8AA 1IRXA 4LDYA 5FROA 2R58A 4C8QD 4NOYA 3A8LB 1Q81R 1R0CB 4A4KA 2QEXT 2JT4A 4RTWA 3RMSA 2JNGA 4LDVA 1MV0B 2E6ZA 5CKDA 5FU6B 4AMCA 1YHQA 3RKWA 1VQLT 1OI1A 2P0PA 2C0OA 2K3BA 1ZX6A 2MI6A 4FYYB 2X3XD 3CCMT 2NUTB 1VQNT 3JB9I 3AT1B 2FYKA 5A0LA 1F1BB 3EHRA 4LNPA 1TSFA 4B9XA 3QJ6A 2DTIA 1OZ2A 2DIQA 1UJ0A 3G6ET 1Q95G 2F1LA 2DETA 1MNDA 3S3MA 4RCBA 5GMKl 2K57A 5EG2A 5DLOA 5GAN8 2BE7D 1M9SA 3QBYA 2FG0A 3ZFJA 4QVCA 3ULRB 1M2VB 3PNWC 2HDAA 4M77B 4JJBA 1RACB 4ESRA 3OYJA 1Y96A 5KCHA 1K8AC 4M75D 2JVVA 1ZSGA 1EX4A 3PT9A 3RKXA 1X6BA 3C0CA 1WHHA 2A36A 2D1XA 1T0HA 4CC2A 1QCNA 2GFUA 2KNBB 4ZGDB 2QAZA 1PCXA 3L2RA 2RH2A 2DAQA 3PVLA 2LRQA 1OULA 3LGLA 2HBWA 2PNIA 1AT1B 4C92G 2O9SA 3GLXA 3EFOB 3ZEHA 4C5HA 1SHGA 4F17A 4EPCA 3M0SA 1U06A 3VS5A 4BACA 4MZPA 1WI7A 1T3LA 2RI2A 5KYYB 3URGA 1KC8U 2E64A 5D6XA 4BB7A 2FB7A 3BW1A 2RM4A 3RERA 1VUBA 1XTDA 2AZSA 4C8QG 4M7DE 1YITQ 3HL8A 3VV0A 2L3QA 4DEYA 5GAN4 3JB9J 1T3SA 3GP8A 4HT8A 3RKYA 2EQKA 3OYAA 4EMHA 2DM1A 2V1RA 3HRTA 4Z8AA 1FMVA 3GPLA 2BE9B 3A8OB 3X24B 2CT4A 1JRIA 4RCCA 1V1CA 2YRDA 5IHIA 2OTLQ 3G4ST 1YCYA 1D3BB 3CBMA 1NEGA 5CO7A 2KSSA 4L5GA 3OMCA 2KXDA 2JM8A 4J6WA 1VQLA 2I0NA 1UGPB 2DMOA 2NUPB 2X35A 1GRIA 3CXCS 3CCLT 2DO3A 2JW4A 1KQSS 3H8ZA 1M1GA 4LXCA 1QMCA 3CCMA 3MHXA 1I0CA 2CP6A 1OX9A 2Y4YA 1VQNA 4M78C 1M2VA 4HVWA 1D09B 5GAMg 4F7UB 5LJ5e 4CC4B 1ZSZB 4JJCA 4ZN3A 1KD1C 3PFSA 1WZOA 3G6EA 1YITA 2E65A 1Y57A 2D9TA 3HSBA 1NM7A 5GMKj 3M4YA 1M3AA 2KRMA 4J9BA 4EIKA 5A0GA 1N8RR 3VS7A 4J7FA 2FRYA 2HQEA 4A4GA 3MCAB 4M75G 4FCYA 4LD6A 1YJNT 1JXOA 5CKEA 3EFOA 2QK0A 4RTXA 3V8LA 4XTVA 1TG0A 2RB6A 4DBQA 2LJ3A 2DFUA 4JZ3A 5KYYA 2E3IA 2YUOA 1MMAA 2COZA 3P8DA 2DVEA 4BI4A 1RL2A 1YJWQ 1ZHIA 5IHNA 1OV3A 1N8RU 2ZCFB 3SHWA 5GAMf 1JJ2S 1ZA1B 2I2LA 4PJLA 3NFCA 1GL5A 3MEWA 2J06A 1D3BA 3UA6A 1QWFA 3R6NA 1X2QA 2XDBA 2V8JA 3ZBDA 1TTHB 5CKFA 2KE9A 3I9QA 4XTXA 3ER0A 4K11A 1AZGB 1W2BA 3MP6A 4ATOA 1QQJA 2GNCA 2KT8A 2KK4A 1VQOQ 2SRCA 3EG2A 2RI5A 1BI2A 1IZ6A 4E7SA 2L3PA 3RIRA 2OI3A 2MK5A 2X4XA 3I55Q 5IXFA 2E4HA 1Z9QA 4F7UA 3OYDA 4ZGEB 4II1A 3M0QA 2H3JA 1ZSZA 2DL4A 2F2XA 2QDYB 3PTAA 1YJWA 1GCQC 3VUZA 4M7AC 1A0NB 1M3BA 4ZTFA 4C0DB 4AT1B 4A63B 4E2FB 4C0FA 4HCZA 4DBFA 4J9HA 1VYUA 2VGMA 2KYBA 3PIOA 3OYGA 1YWOA 2DXTA 2CUDA 5DY9A 3M0RA 1OEBA 4BDYA 1W6XA 2K2VA 5CK9A 3DB4A 3CPWA 4L6V5 3OMGA 4XTWA 2OAUA 1I07A 3EHQA 2RPNA 1LOJA 1NYFA 4DOVA 1JO8A 2EQMA 1ZUUA 2VUBA 4PNOA 3SWNA 4F14A 5IH2A 1WXBA 2OJ2A 1QCFA 4ZGJB 4VUBA 3OYKA 2EYXA 4PL6A 1KQ1A 2RQWA 5LJ3j 2PZ1A 3CC7Q 1P92A 3H6ZA 4RTUA 2XI9A 4PFOA 3EGDB 1RAHB 3M54A 4HVUA 3VS1A 2GTJA 2VKNA 3NTHA 1WGSA 3GNGA 1S72Q 1Q86C 1QVGS 1IHVA 1BIBA 4RTYA 4HCKA 2VXFA 1VQ6T 1YNZA 2XDPA 4Z89A 4NL3A 2ZZDA 3GIBA 2P84A 2JZ2A 4JLGA 5FLXE 3OW2A 1AVZC 1JB0E 2COWA 2DILA 5KYXB 1QVFA 3CCRT 4N4HA 4QVZA 4JRIA 2M9UA 3S3OA 5KH6A 1SKUB 1PD0A 3MEAA 2G3RA 3DB3A 5GMKh 3ASKA 1N27A 1X01A 1YP5A 3LYIA 4FSXA 2DNUA 4BD3A 1KSWA 4DBRA 2WSEE 3QWYA 1TUGB 2XICA 1YCSB 1X27A 3Q1JA 4J6YA 3JCMX 2YDLA 1ZBJA 1CSKA 2LQNA 2HSEB 1Q82C 3UT1A 1I4K1 4EMGA 4E47A 1B3QA 1WDXA 1LVKA 2CP0A 2DPPB 4OMOA 1K73C 1KK7A 1OPLA 4B9WA 2O01E 1UHFA 2EBPA 2QXFA 3ZL7C 3CMAQ 2RJDA 5GAN7 3JB9F 1UG1A 2EQUA 1ZUYA 4M77E 3H9NA 3M5AA 1TU0B 1PSEA 3H0IA 2QTXA 1IGQA 3TSZA 3REBB 2C0IA 1YBYA 2RHIA 4PJOC 2HEQA 1G3YA 1WJSA 2KVQG 3EGDA 4M7DD 3P8HA 3SB2A 3DLMA 2L8DA 2A3LA 2QA4T 4X9CA 3S3NA 3O5ZA 1MMDA 2QGGA 1R8OB 1TUDA 4E7KA 4M7DA 4KBMB 1X6GA 2JMCA 2RHUA 1RADB 4GBQA 1UE9A 5KYXA 1XJWB 4J9GA 3FRNA 4HA8A 3CBPA 2RK1A 3TREA 2BTTA 3OYBA 1WXTA 4ZN1A 4C92B 1M90C 4AG1C 3UF4A 1KG1A 1VQPQ 3A5ZB 3M56A 3SFMA 5A0DA 2JMAA 2VYTA 1NLOC 4LUDA 3CCJQ 4CRIA 3FEOA 1HSQA 2QG9B 3JCMc 5GAMd 3N5BB 2MWOA 4OMLA 4C8QB 4XU3A 3IQLA 4NS5A 1WIEA 3QZ9B 4IUPA 1NJIR 4M78E 3OYNA 3OYCA 4E7LA 3PIPA 5LJ5j 4D8DA 3AHUA 1K8AU 3PVQA 2ECZA 2LX9A 1G3TA 4QT7A 1GFDA 4N4IA 3QG1A 1NPPA 5LJ3h 1NPRA 2QQSA 2KYMA 1BI1A 1VQ7A 4J9IA 3C4SA 2LT4A 2RJCA 1HJDA 1R77A 1VQMA 1W4SA 1QWEA 2KI7A 1YI2Q 4M77F 2CSIA 1WHMA 2CYZB 1VQKA 3C12A 2JTMA 2LDMA 1W1FA 2LNVA 2QTVA 3F70A 3PE0A 3J81E 2DIGA 2BZYA 2DYBA 4M7DG 2X9HA 1B07A 2HSPA 4M4ZA 3HFNA 2FEIA 1V76A 5I2MA 2DLPA 1N9RA 4RG2A 3RESA 2DXUA 4M75B 4C92A 2LZ6B 2YRCA 2D0NA 3VS0A 1U5SA 1VQ8Q 1UGQB 1WLPB 2QA4A 1I8FA 2VVKA 4NL2A 3HKSA 2GF7A 1G3SA 4RTTA 2AIRB 5GAN3 3CXCP 1G5VA 1IO6A 1KQSP 2EQIA 1AD5A 2CS7A 2K6DA 5J39A 1T0JA 4BY6C 2XMFA 4C8QA 1QP3A 1OU9A 2RD1A 4QQ6A 4E6RA 3I56Q 1M1KC 2D6FA 4Y91A 2EYWA 5GANe 3JSCA 1C6VX 4J6XA 2DF6A 3CD6A 2M0OA 2V1QA 2LCCA 2L89A 1PKSA 3JV3A 1OU8A 5D6YA 1KD1U 4PFPA 2K5LA 5FU6C 4M78F 4XTUA 3X25B 1FX7A 4M7AE 2YSQA 4PJMA 1VYTA 2R5AA 3FDRA 3C95A 3MEVA 1XOVA 1YITT 3BY7A 4CI0C 2AT1B 1BKBA 4BE1A 2RQUA 3S6WA 3LWIA 2KRSA 3TU4K 2LMJA 3JB9D 2JN0A 1VQ5Q 4RTZA 2FPEA 1IGUA 2E1HA 2D8JA 3MJXA 1NYGA 4ELYC 5GAOm 2C06A 2OTLT 4N0AC 2AK5A 3A8MB 5GANg 2MOXA 4KGZB 1R0BG 1Q7YC 2YT6A 2ZPHB 2ZAEA 4HVVA 1MMNA 3OSSC 2J7IA 4C0GA 1YIJQ 1KC8R 1JJ2P 2YUNA 3QO3A 3TCJA 4O6JA 4M77C 4HCBA 3L2UA 4M75A 2F5KA 1UGSB 4PK4A 2J6KA 2L3RA 3JCMV 1GBQA 1SSFA 4XU1A 3A8GB 5KYUB 1AHJB 1PWTA 4FL6A 5KYNA 4ORZA 1N9SA 2BKDN 1BCOA 2QEXQ 3M0UA 3WXMB 4QQDA 5I22A 4LDUA 5C0MA 4R55A 3QDRB 2MWPA 3M59A 5GAMe 3LGFA 2K3YA 2AZVA 1M8MA 1X43A 5LJ5h 1GBRA 5GANf 5KCOA 1QW1A 3VJPA 4PFZA 3T9NA 1YIJA 2KGTA 3BDUA 5CR2A 1YJWT 3GOXA 5HCKA 2HBPA 5I21A 4JS5A 1UDLA 4X1VA 4HXJA 4FYWB 4M7AF 3VS4A 2J6OA 5D6WA 2LC4A 2DYIA 1QKXA 4PLLA 2DERA 2E5KA 4J9EA 2KMTA 1K0XA 2OTJQ 1JEGA 4MDWA 3OS0A 2R5MA 1KHIA 1TUCA 3RR6A 1BU1A 2VWFA 1PNJA 3QYGB 1H8KA 3JB9G 3M0PA 2W10A 1W70A 3JCMd 1LCKA 2PQWA 2Z0WA 2ZPEB 3VS6A 4BI8B 4V2SA 2CP7A 3M55A 3REAB 1ZSZC 5FWBA 2IVWA 1I81A 5GAOq 2LQWA 3J80E 2OTLA 4JJDA 2DZ9A 4GLMA 2DRKA 1FXXA 4HCCA 1Q81C 4PJOE 5KYUA 1OYXA 1QLYA 4FU6A 1FMWA 1W2BS 4IKFA 2WACA 3L1AA 3CCSQ 1QVGP 4IUQA 3U23A 3CC4Q 2EVRA 1RLPC 2CZ0B 4LDWA 1Q86U 1OX8A 1IB8A 3H0FA 2K4YA 3OS2A 2CZ7B 1B7TA 2HKNA 2XK0A 3SWNB 4DA4A 3OYYA 2YLCA 3E9GA 3JRZA 1KHCA 1BK2A 2DEQA 3CCUQ 3CCQQ 3L2WA 3NTIA 4OGEA 1N5ZA 4E7HA 1U1TA 2RA2A 3OS5A 3JCMb 3GNFB 3QWXX 4M78D 4Y92A 2LCLA 5FW9A 2GFAA 3CCLQ 3FIFA 2E12A 2V26A 3CC7T 2KDSA 4IUUA 3CPFA 2LP5A 3CEYA 1Q82U 3CPWS 1BCMA 4FYVB 2HZYA 4XK8E 3BE3A 5CIUA 2B86A 5CVIA 3CCEQ 5HKCA 2KQWA 2XD0A 2JOYA 4E7ZA 1WXUA 1RAGB 3OSVA 3EGUA 2VGNA 4A54A 1MHNA 1KJWA 4LUEA 4A4FA 1YJNQ 2EGCA 5J3BA 5EC7A 2K2MA 3UWNA 4N4GA 3E9FA 4C0DC 3H0HA 1ZBXA 3META 1M90R 4LD9K 4PJOF 5DM7R 3CMEQ 1VQOA 1HD3A 2LJ1A 4JS4A 3UPUA 3MKDA 2O4XB 2L2PA 2VC8A 3I55A 3OW2S 1D1CA 1QVFS 3BFMA 3QJYA 3PMIA 2E10A 3UDCA 1N6AA 4KT0E 4F04B 1RAAB 5GJWB 4Z88A 3KXTA 1M90U 2ZPFB 2ABLA 3QDFA 4WCIA 3CMAT 3L2ZA 2PVOB 3MP8A 1DJ7B 4ZNXA 3CCVQ 4M7AD 7AT1B 4M7DB 1LNXA 1GCPA 1K4US 1I5OB 3E1SA 1B34A 3EAEA 1D0ZA 2EQJA 4P5NA 3NGPA 4M78G 4C92F 5A2QE 3LWHA 2AKKA 4J5YA 2NWMA 1GCQA 5CAIA 2KRNA 4FT2A 3JCMe 4IURA 5FU7C 1N8RC 2E70A 2RHXA 2K5IA 1IHWA 1GFCA 2FHDA 2XU8A 2ROTA 1UEBA 3CC7A 4DBHA 2LQ8A 4CC3A 2PVDB 2JS0A 4AFSC 3NTKA 1AOJA 4X34A 1VQ7T 3OYMA 5IXBA 2K3XA 1H92A 2C0TA 2KY9A 3CC2Q 5GANd 3CQTA 1UUEA 2AHJB 1VQMT 2OAWA 3VYGA 1ARKA 2E3HA 1NBEB 1S72A 1VQPT 1AWJA 3QHSA 3R6OA 3G1JA 2IIMA 4L59A 3CCVA 2ROLA 2KT1A 1VQKT 2O4XA 2JTEA 2CZ6B 8ATCB 2HNIA 2V8KA 1NLPC 4EMKB 1D0XA 3QKJA 3JCMP 4A53A 1X2KA 2HL5C 4TVRA 3JCMg 1ACMB 2CKKA 4OF1A 2EGAA 1NG2A 4IIOA 2DTOA 5IT9E 4FT4A 5CQXA 4XU0A 4FW2A 1ZQ1A 1CKBA 1VA7A 4IUTA 3VS2A 2F2WA 4IUVA 1NE8A 2PUKB 4C5GA 2A28A 3X20B 4QW2A 2KXCA 3G71Q 4O5VA 2CP3A 4RKUE 2A37A 5KE2A 1WNLA 3UA7A 1RAFB 1VQ6Q 1ABOA 1JBMA 3X26B 5GAMj 2VV5A 3LX7A 1YI2T 2M16A 1K1ZA 3EG3A 3CCRQ 3V7RA 3WVEB 1HXDA 4R56A 2E5QA 2MYSA 2ZPIB 3VRYA 3CD6T 5KYWB 2FPFA 2NYSA 2EWNA 3A1PA 3CMAA 5HY6A 4M7AG 1TS9A 2RQVA 1K8AR 1AEYA 1UJYA 3JCMf 3OA6A 4IIMA 1UHCA 2KEAA 4BE2A 2VXEA 2BIVA 4OMPA 5GMKm 2DA9A 4C92C 4ELZC 1TOVA 2M51A 4LE9A 1ZUKA 2EJGA 4RG8A 1WHLA 1BYMA 3EG0A 2ATCB 2DJZA 3SDZA 3G71A 1MGQA 4X9DA 2F5TX 2DKGA 2X51A 1SG5A 1Q7YU 4C8QC 1VQ9Q 4PJOD 2X4YA 4EMKA 2OX7A 1MV3A 1OQKA 1O75A 3TQ7P 1WYXA 5AT1B 5IN1A 2RF0A 2Y90A 3EFRA 3QYHB 4F7UE 2LNHB 1H3ZA 2FZCB 4AFQC 3WVDB 1Y71A 3OYEA 2SEMA 1VQPA 3HRSA 3M9QA 5GAOr 1YJ9Q 2FZGB 2CZ1B 2GGRA 2D8HA 2K9GA 3CCJA 2DXBA 1EFNA
chains in the Genus database with same CATH topology
3V8KA 2ZPGB 2QQ9A 2YRVA 3MP6A 4QQDA 3WXMB 4ATOA 2KK4A 4LDUA 5CQYA 5C0MA 4R55A 3CCJT 2RI5A 3QDRB 1QVGA 1BI2A 1IZ6A 5GAOp 2MWPA 3M59A 4OB0B 5GAMe 4OMFB 3QXEB 3RIRA 3LGFA 5GANh 2K3YA 2X4XA 1OZ3A 2XG8D 5LJ5h 3V7SA 4F7UA 3OYDA 4ZGEB 4II1A 2H3JA 5GANf 2QDYB 2HAXA 4EDUA 3PTAA 5KCOA 1QW1A 1YJWA 3VJPA 1U1SA 3VUZA 1VQ9A 2QQRA 1H641 4M7AC 2EYQA 3JCMQ 5FRMA 3CBOA 3T9NA 1YIJA 4EMKC 4PJOB 2JUFA 3BDUA 2X4JA 5CR2A 1YJWT 1VQ9T 1K9MC 2E41A 1QVPA 3GOXA 4ZTFA 1K9MU 5GMKe 4C0DB 2HBPA 5I21A 4JJNK 4JS5A 1YIJT 1WPYA 4C0FA 4HCZA 4M7AF 1XQHA 2ZGWA 5D6WA 4M75C 2LC4A 1X75C 3HRUA 2RO0A 1YI2A 2VGMA 4XQ3A 4PLLA 3SD4A 3PIOA 2BUDA 1WJQA 3CC2A 2EKOA 3OYGA 2EJFA 2DXTA 2KMTA 3L2VA 3RUXA 1YJ9A 5M9OA 5DY9A 2NLUA 3HPWA 1M1KU 4MDWA 4J83A 3M57A 4M75F 3OS0A 1YJ9T 2R5MA 1KHIA 3OYIA 4BDYA 1U8RA 2K2VA 5CK9A 3DB4A 3CPWA 3OBWA 3QYGB 4L6V5 3OMGA 4XTWA 3JB9G 2OAUA 1Y7XA 2MF2A 2PQWA 3JCMd 4RMOA 2ZPEB 1LOJA 4DOVA 4BI8B 4V2SA 2PVGB 2EQMA 2VUBA 1NZ9A 4PNOA 3SWNA 3M55A 5CKBA 3KUFA 2LVMA 4ZGJB 4VUBA 2XDDA 3OYKA 5FRNA 1YHQT 2LQKA 4PL6A 4J8OA 1KQ1A 3OY9A 5LJ3j 2F69A 2P4TA 4HKEA 4OB2B 2IVWA 4JRQA 1I81A 1P92A 2K5FA 3H6ZA 2V8IA 4XTZA 5GAOq 1VQ8A 3M4GA 5LJ3g 3J80E 2OTLA 4OVAA 2DZ9A 2XI9A 4F7UF 2Y4XA 1FXXA 4PJOG 1Q81C 4HCCA 3KBGA 4PJOE 3M58A 2EAYA 1OYXA 1TH7A 1Q81U 3M54A 1VQ8T 5IAYA 3EFSA 3PGGA 4WF2A 4Z02A 3L2QA 4LDXA 4FU6A 3G7ZA 3JCMW 5HK0A 1W2BS 4IKFA 3QPHA 2WACA 3L1AA 3C94A 2GQVA 1WGSA 3NTHA 4IUQA 4OGCA 3GNGA 1VQ4A 1Q86C 1VQ6A 1QVGS 4DOWA 2CZ0B 4LDWA 1WJRA 1Q86U 1BIBA 4BE0A 5GAMh 2MMPA 4C0ZA 3I56A 2VXFA 2K4YA 5C6SA 3OS2A 2LT1A 2CZ7B 1VQ4T 1VQ6T 3FLGA 2XK0A 2XDPA 4NL3A 3CCRA 2ZZDA 4MZMA 3GIBA 3SWNB 3I56T 2JZ2A 4JLGA 5FLXE 3OW2A 1JB0E 2OTJT 4DA4A 3GF5A 2P0QA 3OYYA 4OB1B 1BIAA 2YLCA 3X28B 1QVFA 3E9GA 3VYHB 4N4HA 3JRZA 3CCRT 2JTFA 1KHCA 4QVZA 3J7AF 1M5Q1 4JRIA 4C5IA 2M9UA 2DEQA 3V7CA 5I2SA 5KH6A 2PU9B 1UB4A 3S3OA 3RMQA 1FWZA 3MEAA 3NTIA 4OGEA 3L2WA 4Q5WA 4PJOA 4E7HA 4ME7A 2G3RA 3DB3A 1GXIE 3O8VA 1U1TA 2DZCA 1XNIA 5GMKh 3ASKA 2RA2A 1N27A 2KAFA 3OS5A 3LW5E 3PMTA 1X01A 3JCMb 3GNFB 2E6NA 4M78D 3HFOA 3JCMJ 3QSUA 2LCLA 4UC4A 3L42A 3LYIA 1EIFA 4YTLA 2RHYA 4FSXA 4FM4B 3OQ5A 1VQ5A 3HHTB 4BD3A 5LL6S 2GFAA 2WSEE 2XHCA 4KULA 4A4HA 5LJ3f 3FIFA 2E12A 3CC7T 2EFIA 2XICA 4J6YA 3Q1JA 3JCMX 4E7IA 5CKHA 2KDSA 1NJIC 1VQ5T 4IUUA 5L8RE 1NJIU 5GMKi 3CPFA 4QVDA 1Q82C 5GAN6 3UT1A 3CEYA 1Q82U 3CPWS 2YHTA 1I4K1 4EMGA 2DD4A 4E47A 3LH0A 1X6OA 5LJ5d 4XK8E 5CIUA 2DTHA 1HK9A 3CCST 2XKOC 5CVIA 2DPPB 1Y96B 2DXCA 1K73C 1BI0A 3CC4T 2GCXA 4C92D 1LJOA 5HKCA 4B9WA 5GAN5 2KQWA 2XD0A 2O01E 2JOYA 2QXFA 3FC3A 2QQAA 2RJDA 5GAN7 3DKMA 3JB9F 2FL7A 3OSVA 5LJ3e 2EQUA 4KUIA 2RJEA 2VGNA 4M77E 3M5AA 4A54A 1PSEA 1MHNA 2QTXA 3M53A 3JB9H 4A4FA 3V8JA 2QQBA 5J3BA 2XIDA 2DK3A 1YBYA 2RHIA 4PJOC 3CCUT 1G3YA 1QP2A 3CCQT 3INZA 1WJSA 2KVQG 3UWNA 4BY6B 2B8AA 4M7DD 4LDYA 4C8QD 5FROA 2R58A 3P8HA 4N4GA 3E9FA 4C0DC 3SB2A 4NOYA 3DLMA 2L8DA 1ZBXA 2QI2A 2A3LA 3A8LB 3META 2QEXA 4HT9A 4M78B 4N0AA 4KUDK 4LD9K 4M77D 2A7YA 2QA4T 4A4KA 1Y07A 4X9CA 3OYHA 4PJOF 5DM7R 3S3NA 1VQOA 4OB3B 2QEXT 3RMSA 2JNGA 4JS4A 3UPUA 4LDVA 4XTYA 2O4XB 1R8OB 2E6ZA 5CKDA 4E7KA 2VC8A 3I55A 1VQOT 5FU6B 1YHQA 4QQGA 3RKWA 4KBMB 3OW2S 1VQLT 1OI1A 4M7DA 2RHUA 2P0PA 1QVFS 3I55T 3BFMA 3QJYA 2MI6A 3DLLA 4M77A 3PMIA 3FRNA 3CCMT 2E10A 2MAMA 4HA8A 3CBPA 2RK1A 4GY5A 3UDCA 3TREA 1N6AA 3JB9I 1VQNT 2FYKA 4KT0E 2EJ9A 3OYBA 4ZN1A 4C92B 1WQ7A 5A0LA 4E7JA 1M90C 2RK2A 4MDXA 3CCET 4B9XA 3KXTA 1M90U 3QJ6A 5DLQE 2DTIA 2ZPFB 1KG1A 1OZ2A 2DD5A 3A5ZB 3M56A 2DIQA 3SFMA 5A0DA 3G6ET 3FB9A 3L2ZA 3CMAT 2VYTA 3S3MA 2PVOB 3OB9A 4RCBA 3MP8A 3QIIA 4BI3A 5CCAA 5HK3A 5GMKl 1DJ7B 2K57A 3HP9A 4CRIA 5EG2A 4DQ2A 5DLOA 3FEOA 5GAN8 2OTJA 1M9SA 3QBYA 3JCMc 4M7AD 5GAMd 3VKIA 3N5BB 3CXCA 4M7DB 1LNXA 2MWOA 4C8QB 4XAXB 3E1SA 1KQSA 4XU3A 4NS5A 3VU3C 1B34A 3EAEA 3ME9A 5GAOl 3BDLA 3ZFJA 2EQJA 3QZ9B 4P5NA 4QVCA 4IUPA 3PNWC 4JLIA 4M78G 1V29B 4C92F 4M78E 4M77B 4JDSA 4BDZA 3OYNA 3OYCA 2WSFE 5A2QE 3PIPA 4E7LA 3LWHA 1IREB 5LJ5j 3OYJA 1Y96A 2M1HA 4J5YA 5KCHA 3CMET 1G3WA 2JVVA 4M75D 1K8AC 3AHUA 1K8AU 3PT9A 5CAIA 3RKXA 4FT2A 5LJ5g 3JCMe 4MZTA 2LX9A 1G3TA 1WQWA 3SWNC 4IURA 5FU7C 2FVUA 3QG1A 4N4IA 2E70A 2RHXA 1N8RC 2GFUA 1NPPA 2K5IA 4J7IA 1NPRA 5LJ3h 4ZGDB 2QQSA 2FHDA 2XU8A 1UEBA 5GAOn 3L2RA 1BI1A 3OYFA 3CC7A 2RH2A 1VQ7A 2YLBA 2DAQA 2LQ8A 3C4SA 2LT4A 4M7DF 1M1FA 2LRQA 2PVDB 2RJCA 3LGLA 3NTKA 4X34A 4D6WA 1VQ7T 4C92G 4FIBA 1VQMA 3OYMA 4C92E 1W4SA 2K3XA 3GLXA 1UGRB 4M77F 2KY9A 5GAN2 3ZEHA 4C5HA 1M8VA 5GANd 3CCSA 1B34B 2AHJB 2CYZB 1VQMT 4M78A 3VYGA 4EPCA 1VQKA 1S72A 3C12A 1RI0A 2JTMA 2LDMA 4BACA 1VQPT 3QHSA 4MZPA 3CC4A 3FJPA 3R6OA 4L59A 2RI2A 2RI3A 3OBYA 2LNVA 3F70A 3J81E 3CCVA 1S72T 2O4XA 3URGA 1VQKT 1KC8C 1K73U 2DIGA 2WSCE 1KC8U 2CZ6B 2E64A 2HNIA 2V8KA 5D6XA 2FB7A 3BW1A 4OP0A 4BB7A 4M7AB 2RM4A 3RERA 1VUBA 3CCVT 1XTDA 3QZ5B 4M7DG 5J26A 4C8QG 4M7DE 4EMKB 4C8QE 2HD0A 2R57A 3HL8A 3QKJA 3VV0A 1BI3A 4BUGA 3JCMP 4A53A 3G6EA 4TVRA 2PUOB 3JCMg 5GAN4 2CKKA 4GLKA 4OF1A 3JB9J 4M77G 3HFNA 3GP8A 3CCUA 3QUIA 3RKYA 4HT8A 2EQKA 3CCQA 2DTOA 5I2MA 4EMHA 3OYAA 1JJ2A 3HRTA 5IT9E 1N9RA 4FT4A 4RG2A 5CQXA 3RESA 4XU0A 3GPLA 2DXUA 4M75B 3E19A 4C92A 3G4SA 3A8OB 1ZQ1A 3LLRA 2HQXA 5LJ5f 3X24B 4IUTA 1JRIA 4RCCA 1UGQB 4IUVA 2QA4A 1NE8A 2PUKB 1I8FA 3G4ST 1YCYA 4C5GA 1D3BB 1VIEA 3CBMA 4NL2A 3HKSA 5CO7A 2KSSA 2GF7A 1G3SA 3OMCA 4L5GA 3X20B 2IG0A 4QW2A 3CCLA 5GAN3 3MEUA 4O5VA 1VQLA 4J6WA 4RKUE 3MO8A 1G5VA 1UGPB 2X35A 5KE2A 1WNLA 3CXCS 3JAME 2CS7A 3CCLT 5J39A 2DO3A 4BY6C 1KQSS 3H8ZA 1M1GA 1JBMA 2EIFA 1QP3A 4C8QA 2RD1A 3X26B 4QQ6A 3CCMA 1M4ZA 3MHXA 5GAMj 2VV5A 1M1KC 2D6FA 3LX7A 1YI2T 2M16A 2Y4YA 4Y91A 1VQNA 4M78C 5GANe 3OYLA 3JSCA 2LTOA 3CC2T 4J6XA 3CD6A 3V7RA 3VUBA 3WVEB 4F7UB 1HXDA 5GAMg 4R56A 2E5QA 5LJ5e 2M0OA 3CCEA 2LCCA 2L89A 2ZPIB 4ZN3A 3CD6T 1KD1C 3JCMh 5D6YA 4JUVA 3PFSA 1KD1U 2K5LA 4MMKA 1PSFA 2CGHA 2EWNA 4M78F 4XTUA 5FU6C 5HY6A 3X25B 1FX7A 3CMAA 2E65A 1YITA 4M7AG 4M7AE 1O9SA 2D9TA 3MP1A 4MMLA 2R5AA 3JCMf 3FDRA 3OA6A 3C95A 3MEVA 1XOVA 5AYFA 1YITT 5GMKj 3HSBA 3BY7A 4BE2A 3M4YA 3P8BB 4CI0C 2VXEA 2BIVA 1BKBA 5KE3A 4BE1A 5A0GA 3S6WA 3LWIA 1YJNA 1VIFA 1I5LA 2D0QB 5GMKm 3TU4K 4J7FA 2HQEA 4A4GA 4C92C 3MCAB 4M75G 4ELZC 3JB9D 2JN0A 4M75E 3OS1A 2EJGA 4LD6A 4RG8A 1YJNT 5CKEA 2E1HA 1BYMA 3A8HB 4JRPA 3V8LA 4XTVA 2RB6A 4ELYC 5GAOm 2DJZA 2C06A 2OTLT 4N0AC 3SDZA 3CMEA 5GANj 4C5EA 3G71A 4A4EA 1MGQA 3A8MB 4X9DA 5GANg 2F5TX 3G71T 2DKGA 2L5QA 1Q7YC 1Q7YU 3P8DA 2ZPHB 4M7AA 4M7DC 2DVEA 4BI4A 1RL2A 3OSSC 4C8QC 4PJOD 2X4YA 4EMKA 2RJFA 1ZHIA 4C0GA 1N8RU 1O75A 2ZPBB 3QO3A 3TCJA 4O6JA 5FU7B 2ZCFB 4M77C 5IN1A 4HCBA 5GAMf 2Y90A 3EFRA 1JJ2S 5LJ3d 2RHZA 4F7UG 4PLIA 3QYHB 3L2UA 4F7UE 2I2LA 1KQ2A 4C8QF 4ZTJA 3NFCA 4M75A 1H3ZA 2F5KA 1UGSB 4Y28E 2L3RA 3JCMV 3WVDB 1Y71A 3MEWA 3OYEA 1SSFA 1VQPA 3HRSA 3M9QA 4JRKA 5GAOr 4XU1A 1D3BA 4PKCC 2CZ1B 3A8GB 3TEEA 2X4WA 1AHJB 2V8JA 3ZBDA 2XDBA 5CKFA 4XU2A 2P0KA 4FL6A 4XTXA 3ER0A 3CCJA 1N9SA 2DXBA 2BKDN 1W2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8K A;  1I8F A;  4NL3 A;  3GIB A;  3JB9 I;  3SWN B;  1YCY A;  1D3B B;  2FYK A;  2EJ9 A;  4NL2 A;  4C92 B;  1WQ7 A;  1BIA A;  2YLC A;  5GAO p;  5GAM e;  3RIR A;  5GAN 3;  2DTI A;  5GAN h;  4J6W A;  1M5Q 1;  4JRI A;  2DEQ A;  3V7C A;  1WNL A;  3FB9 A;  3L2Z A;  5LJ5 h;  3V7S A;  4F7U A;  4PJO A;  1JBM A;  4C8Q A;  4RCB A;  1U1T A;  2DZC A;  2RD1 A;  5GAN f;  5GMK h;  5GAM j;  5GMK l;  2RA2 A;  2K57 A;  4Y91 A;  1X01 A;  4DQ2 A;  4M78 C;  5GAN e;  3JCM b;  1U1S A;  5GAN 8;  4J6X A;  1H64 1;  4M7A C;  4M78 D;  3HFO A;  3JCM Q;  3V7R A;  3JCM J;  3QSU A;  5GAM g;  4F7U B;  1HXD A;  3JCM c;  4M7A D;  5GAM d;  4EMK C;  5LJ5 e;  3BDU A;  4M7D B;  1LNX A;  4PJO B;  4C8Q B;  4XU3 A;  3VU3 C;  1B34 A;  2E41 A;  5GAO l;  5LJ3 f;  5GMK e;  3FIF A;  5I21 A;  3JCM h;  4JUV A;  4QVC A;  4MMK A;  4JLI A;  2EWN A;  2CGH A;  4J6Y A;  4M78 G;  4M78 E;  1WPY A;  4M77 B;  4M78 F;  4XTU A;  4C92 F;  2E65 A;  3JCM X;  4M7A G;  4M7A E;  4M7A F;  2ZGW A;  5GMK i;  4M75 C;  4QVD A;  5LJ5 j;  1Y96 A;  4MML A;  5GAN 6;  4J5Y A;  4M75 D;  3JCM f;  3AHU A;  4XQ3 A;  5LJ3 g;  3HSB A;  5GMK j;  5CAI A;  2YHT A;  3BY7 A;  3RKX A;  1I4K 1;  4EMG A;  2EJF A;  2DXT A;  2VXE A;  5LJ5 g;  3RUX A;  5LJ5 d;  3JCM e;  5DY9 A;  1WQW A;  3SWN C;  2DTH A;  1HK9 A;  1I5L A;  5GMK m;  4C92 C;  5LJ3 h;  1Y96 B;  4M75 G;  4M75 F;  3JB9 D;  2JN0 A;  4M75 E;  4C92 D;  2EJG A;  1LJO A;  5GAO n;  2E1H A;  5GAN 5;  2YLB A;  5LJ3 d;  3V8L A;  4M7D F;  4XTV A;  2RB6 A;  5GAO m;  2DJZ A;  4XTW A;  5GAN 7;  3JB9 G;  4N0A C;  3JB9 F;  5GAN j;  4C92 G;  4C92 E;  5LJ3 e;  3JCM d;  4M77 F;  1LOJ A;  4M77 E;  1MGQ A;  4V2S A;  5GAN 2;  4X9D A;  4A54 A;  1M8V A;  4PNO A;  3SWN A;  5GAN g;  2QTX A;  5GAN d;  3JB9 H;  1B34 B;  2DKG A;  4M78 A;  3V8J A;  4M7A A;  4PJO C;  4M7D C;  2DVE A;  3QHS A;  4C8Q C;  3RER A;  1KQ1 A;  3FJP A;  3INZ A;  5LJ3 j;  4PJO D;  4EMK A;  4M7D D;  4C8Q D;  3SB2 A;  4NOY A;  3QO3 A;  1I81 A;  5GAO q;  4XTZ A;  4M77 C;  4HT9 A;  3M4G A;  2Y90 A;  5GAM f;  4M78 B;  2E64 A;  2HNI A;  3EFR A;  4N0A A;  2DZ9 A;  2FB7 A;  3BW1 A;  4M77 D;  4OP0 A;  2RM4 A;  4X9C A;  4M7A B;  4F7U F;  2I2L A;  4PJO G;  4PJO F;  4F7U G;  4F7U E;  1KQ2 A;  4M7D G;  4C8Q G;  2EAY A;  4C8Q F;  1TH7 A;  4C8Q E;  4M75 A;  4EMK B;  4M7D E;  3EFS A;  3PGG A;  4WF2 A;  3JCM P;  4A53 A;  4XTY A;  3JCM W;  3JCM g;  3JCM V;  5GAN 4;  2VC8 A;  3L1A A;  4M77 G;  3JB9 J;  3HFN A;  4M7D A;  4HT8 A;  3QUI A;  3RKY A;  3RKW A;  4JRK A;  2DTO A;  4EMH A;  4XU1 A;  5GAO r;  1D3B A;  1N9R A;  3RES A;  4XU0 A;  2DXU A;  4M75 B;  4C92 A;  1BIB A;  3BFM A;  5GAM h;  5LJ5 f;  4RCC A;  1JRI A;  4M77 A;  2VXF A;  4XU2 A;  4XTX A;  4PJO E;  2E10 A;  1N9S A;  4HA8 A; 
#chains in the Genus database with same CATH topology
 3V8K A;  2ZPG B;  2QQ9 A;  2YRV A;  5GJV B;  1SSH A;  5CQY A;  5GAO p;  1M2O A;  3UAT A;  4OMF B;  3QXE B;  1WX6 A;  5GAN h;  1YHQ Q;  1OZ3 A;  1M27 C;  3A98 A;  1ABQ A;  2XG8 D;  3V7S A;  3EGX B;  1KFZ A;  2K79 A;  5KYW A;  1G83 A;  1VQ9 A;  1H64 1;  2EYQ A;  3JCM Q;  6AT1 B;  5FRM A;  1KIK A;  1QKW A;  2JUF A;  1KD1 R;  1K9M C;  2E41 A;  1WFW A;  1YIJ T;  1RUW A;  1XQH A;  2ZGW A;  2IPO B;  4M75 C;  1X75 C;  3HRU A;  2MPX C;  1UEC A;  1YI2 A;  4XQ3 A;  1MNE A;  3SD4 A;  1VQ4 Q;  2BUD A;  2RN8 A;  4QKU A;  1WJQ A;  2QYZ A;  1YJ9 A;  2NLU A;  1SHF A;  3M57 A;  2HKQ B;  3OYI A;  1U8R A;  3OBW A;  3I5S A;  2CRE A;  2CP2 A;  2AKL A;  2PVG B;  5CKB A;  2LVM A;  2EPD A;  2LQK A;  1H3H A;  4J8O A;  3OY9 A;  2RQT A;  2F69 A;  2P4T A;  2DVJ A;  1BB9 A;  2YWW A;  4HKE A;  4OB2 B;  4JRQ A;  1RAB B;  4XTZ A;  1VQ8 A;  3M4G A;  5LJ3 g;  1JXM A;  4OVA A;  1UGV A;  4OMQ A;  4F7U F;  1PRL C;  4PJO G;  2EAY A;  1Q81 U;  1W2B P;  3EFS A;  3PGG A;  4WF2 A;  4Z02 A;  3L2Q A;  3G7Z A;  3JCM W;  3QPH A;  3C94 A;  2DEU A;  1VQ4 A;  1G8X A;  4JZ4 A;  3M0T A;  1WJR A;  4RUG A;  4BE0 A;  5GAM h;  4C0Z A;  3I56 A;  2O88 A;  4OMN A;  1OOT A;  3EGX A;  2OTJ T;  3GF5 A;  2P0Q A;  4OB1 B;  3X28 B;  5D7U A;  5IHK A;  1M30 A;  3J7A F;  4C5I A;  2PTK A;  1SPK A;  2PU9 B;  3RMQ A;  1FWZ A;  4Q5W A;  4ME7 A;  1XNI A;  5ECA A;  3PMT A;  2KAF A;  3LW5 E;  1EZZ B;  2KRO A;  2E6N A;  3HFO A;  3JCM J;  3QSU A;  1EIF A;  1PRM C;  2RHY A;  5FWC A;  3OQ5 A;  1PD1 A;  1VQ5 A;  3HHT B;  5LL6 S;  4KUL A;  1TXQ A;  5LJ3 f;  2EFI A;  1VQL Q;  2VB6 A;  1NJI C;  5L8R E;  2GBQ A;  3CPW P;  5GAN 6;  3CCM Q;  1YFN A;  2K7A A;  2YHT A;  1C0M A;  2DD4 A;  2JS2 A;  1VQN Q;  3LH0 A;  4RTV A;  2F2V A;  3CCS T;  2LJ0 A;  4B6M A;  2DXC A;  2KR3 A;  1BI0 A;  3CC4 T;  2GCX A;  1LJO A;  5GAN 5;  4JPB W;  1D0Y A;  2H3E B;  3G6E Q;  1WHJ A;  1C1A A;  3DKM A;  2FL7 A;  2DBK A;  4KUI A;  2RQR A;  2RJE A;  2NUT A;  3GBQ A;  3M53 A;  2QQB A;  4WTO B;  1Y0M A;  3CCU T;  3CCQ T;  3INZ A;  2QI2 A;  2QEX A;  4HT9 A;  4M78 B;  4N0A A;  4KUD K;  2YUP A;  4M77 D;  2A7Y A;  2RMO A;  2MIO A;  1Y07 A;  3OYH A;  4OB3 B;  4XTY A;  3OW2 P;  4PJN A;  2QAS A;  2EYY A;  1VQO T;  4QQG A;  1QVF P;  1Q86 R;  3I55 T;  1PHT A;  3DLL A;  4M77 A;  4PJJ A;  2MAM A;  2DL8 A;  2DL5 A;  1ZLM A;  4GY5 A;  2EJ9 A;  2JXB A;  2X3W D;  1WQ7 A;  4E7J A;  2RK2 A;  4MDX A;  2M0Y A;  3CCE T;  1CKA A;  1MUZ A;  5DLQ E;  4F16 A;  2DD5 A;  2L3S A;  2GTO A;  3FB9 A;  4J9C A;  3OB9 A;  3QII A;  4BI3 A;  5CCA A;  5HK3 A;  3HP9 A;  4DQ2 A;  1PC0 A;  1K9A A;  3HTR A;  2OTJ A;  1I1J A;  4J9D A;  4FW1 A;  3VKI A;  3CXC A;  4XAX B;  1KQS A;  1RAI B;  3VU3 C;  3ME9 A;  5GAO l;  3BDL A;  4JLI A;  1M3C A;  1V29 B;  4JDS A;  4BDZ A;  2WSF E;  1Q82 R;  1E6H A;  1IRE B;  2M1H A;  3CME T;  1G3W A;  1G2B A;  3G4S Q;  5LJ5 g;  4MZT A;  1WQW A;  3SWN C;  2FVU A;  1K73 R;  2M02 A;  2DE0 X;  4J7I A;  1ZA2 B;  5GAO n;  2FZK B;  3NMZ C;  3OYF A;  2QDL A;  2YLB A;  4M7D F;  1M1F A;  2EYZ A;  4D6W A;  2P4R A;  4FIB A;  4C92 E;  1UGR B;  5GAN 2;  2BZX A;  1M8V A;  3CCS A;  1B34 B;  4M78 A;  5I11 A;  1RI0 A;  4KH1 B;  3EH1 A;  3CC4 A;  4KH0 B;  3FJP A;  1YWP A;  4D8K A;  2RI3 A;  3OBY A;  2NUP A;  1S72 T;  1KC8 C;  1K73 U;  2WSC E;  2O9V A;  2YXY A;  4OP0 A;  4M7A B;  3CCV T;  3QZ5 B;  5J26 A;  4C8Q E;  2HD0 A;  2R57 A;  1BI3 A;  1MMG A;  4BUG A;  2PUO B;  4GLK A;  4M77 G;  1SRM A;  3CCU A;  3QUI A;  3CCQ A;  1JJ2 A;  3E19 A;  3G4S A;  4KGV B;  3LLR A;  1JU5 C;  2HQX A;  2O2O A;  5LJ5 f;  1SRL A;  1VYV A;  3VS3 A;  1FYN A;  1VIE A;  2LX7 A;  2IG0 A;  3CCL A;  3MEU A;  4FSS A;  3MO8 A;  3JAM E;  2EIF A;  3EG9 B;  1M4Z A;  2O31 A;  3OYL A;  1BBZ A;  2LTO A;  3CC2 T;  1K0S A;  2DJQ A;  2ED1 A;  1D1A A;  1OPK A;  3VUB A;  3CCE A;  1PG5 B;  1WHG A;  3KFV A;  3JCM h;  2J6F A;  4JUV A;  4MMK A;  1PSF A;  2CGH A;  1O9S A;  3MP1 A;  4MML A;  3RBB B;  2DL7 A;  5AYF A;  1PKT A;  3P8B B;  5KE3 A;  2H8H A;  1YJN A;  1VIF A;  1I5L A;  2D0Q B;  1RI9 A;  1YN8 A;  2CSQ A;  4M75 E;  3OS1 A;  2CDT A;  2ESW A;  3NHN A;  2MCN A;  3A8H B;  3MPU B;  4AFZ C;  4JRP A;  3CME A;  5GAN j;  1SEM A;  4C5E A;  2EGE A;  4A4E A;  1RAE B;  3G71 T;  2L5Q A;  4M7A A;  4M7D C;  1X69 A;  2RJF A;  4OMM A;  2ZPB B;  5FU7 B;  2QGF B;  5LJ3 d;  2RHZ A;  4F7U G;  4PLI A;  2BZ8 A;  1J3T A;  1KQ2 A;  4C8Q F;  4ZTJ A;  4Y28 E;  4KGX B;  3EG1 A;  2CP5 A;  4JRK A;  4PKC C;  3TEE A;  2X4W A;  4XU2 A;  2P0K A;  1PM3 A;  1K9M R;  1AWW A;  4CC7 A;  5L23 A;  2DL3 A;  3CCJ T;  1QCO A;  1QVG A;  3EG9 A;  4OB0 B;  2G6F X;  2L0A A;  2HCK A;  3TSW A;  1M1K R;  4LN2 A;  2HAX A;  4EDU A;  1K76 A;  2FO0 A;  1U1S A;  2QQR A;  3CBO A;  2HMA A;  4EMK C;  4PJO B;  2X4J A;  2HL3 A;  1VQ9 T;  3I35 A;  1QVP A;  1K9M U;  5GMK e;  4JJN K;  2JJ9 A;  1LPL A;  1JQQ A;  1WPY A;  2KBT A;  9ATC B;  4J9F A;  2RO0 A;  3CC2 A;  2EKO A;  2EJF A;  3L2V A;  1VOM A;  3RUX A;  2FPD A;  5M9O A;  3HPW A;  1M1K U;  4J83 A;  4M75 F;  1YJ9 T;  1S1N A;  2J05 A;  1HYO A;  2RNA A;  3D7S B;  4KRT A;  1Y7X A;  2MF2 A;  4RMO A;  1SF9 A;  3EH2 A;  1Q7Y R;  1NZ9 A;  3KUF A;  2A08 A;  2XDD A;  5FRN A;  2ENM A;  1YHQ T;  1VQ7 Q;  2K5F A;  2V8I A;  3RDV A;  1AWX A;  2Y4X A;  1D1B A;  3H41 A;  3KBG A;  3M58 A;  1VQM Q;  1TH7 A;  1VQ8 T;  5IAY A;  2DRM A;  4LDX A;  5HK0 A;  4OGC A;  2GQV A;  1WA7 A;  1VQK Q;  1VQ6 A;  4DOW A;  2DBM A;  2MMP A;  2VAS A;  2COY A;  5C6S A;  1VQ4 T;  2LT1 A;  3FLG A;  3CCR A;  4MZM A;  3RNJ A;  3NPF A;  2HQH A;  3I5R A;  3I56 T;  2JM9 A;  1U3O A;  1BIA A;  3VYH B;  2JTF A;  1IXD A;  1M5Q 1;  4AG2 C;  3V7C A;  5I2S A;  1UB4 A;  2EKH A;  2CH4 A;  4PJO A;  2A0F B;  1GXI E;  2W0Z A;  3O8V A;  4ANJ A;  3FJ5 A;  2DZC A;  1E6G A;  2QA4 Q;  3LH5 A;  4UC4 A;  3L42 A;  2CH4 W;  2EW3 A;  4YTL A;  4DEX A;  4FM4 B;  1NEB A;  1E7O A;  2XHC A;  4A4H A;  4FYX B;  4E7I A;  1TWB A;  5CKH A;  2LCS A;  1VQ5 T;  1NJI U;  5GMK i;  1UFF A;  3SEM A;  2DX1 A;  4R0K A;  4QVD A;  2ED0 A;  2GQI A;  3TVT A;  2CUB A;  3E2U A;  1X6O A;  5LJ5 d;  2DTH A;  1HK9 A;  3CD6 Q;  2XKO C;  1WHK A;  1Y96 B;  4C92 D;  1FMK A;  8AT1 B;  2YUQ A;  3FC3 A;  2QQA A;  5LJ3 e;  3VRZ A;  2FRW A;  2CT3 A;  3THK A;  1AWO A;  1Z9Z A;  3JB9 H;  3V8J A;  4AFU C;  2XID A;  2DK3 A;  2NUZ A;  1UTI A;  1AZE A;  1QP2 A;  1RLQ C;  4BY6 B;  2B8A A;  1IRX A;  4LDY A;  5FRO A;  2R58 A;  4C8Q D;  4NOY A;  3A8L B;  1Q81 R;  1R0C B;  4A4K A;  2QEX T;  2JT4 A;  4RTW A;  3RMS A;  2JNG A;  4LDV A;  1MV0 B;  2E6Z A;  5CKD A;  5FU6 B;  4AMC A;  1YHQ A;  3RKW A;  1VQL T;  1OI1 A;  2P0P A;  2C0O A;  2K3B A;  1ZX6 A;  2MI6 A;  4FYY B;  2X3X D;  3CCM T;  2NUT B;  1VQN T;  3JB9 I;  3AT1 B;  2FYK A;  5A0L A;  1F1B B;  3EHR A;  4LNP A;  1TSF A;  4B9X A;  3QJ6 A;  2DTI A;  1OZ2 A;  2DIQ A;  1UJ0 A;  3G6E T;  1Q95 G;  2F1L A;  2DET A;  1MND A;  3S3M A;  4RCB A;  5GMK l;  2K57 A;  5EG2 A;  5DLO A;  5GAN 8;  2BE7 D;  1M9S A;  3QBY A;  2FG0 A;  3ZFJ A;  4QVC A;  3ULR B;  1M2V B;  3PNW C;  2HDA A;  4M77 B;  4JJB A;  1RAC B;  4ESR A;  3OYJ A;  1Y96 A;  5KCH A;  1K8A C;  4M75 D;  2JVV A;  1ZSG A;  1EX4 A;  3PT9 A;  3RKX A;  1X6B A;  3C0C A;  1WHH A;  2A36 A;  2D1X A;  1T0H A;  4CC2 A;  1QCN A;  2GFU A;  2KNB B;  4ZGD B;  2QAZ A;  1PCX A;  3L2R A;  2RH2 A;  2DAQ A;  3PVL A;  2LRQ A;  1OUL A;  3LGL A;  2HBW A;  2PNI A;  1AT1 B;  4C92 G;  2O9S A;  3GLX A;  3EFO B;  3ZEH A;  4C5H A;  1SHG A;  4F17 A;  4EPC A;  3M0S A;  1U06 A;  3VS5 A;  4BAC A;  4MZP A;  1WI7 A;  1T3L A;  2RI2 A;  5KYY B;  3URG A;  1KC8 U;  2E64 A;  5D6X A;  4BB7 A;  2FB7 A;  3BW1 A;  2RM4 A;  3RER A;  1VUB A;  1XTD A;  2AZS A;  4C8Q G;  4M7D E;  1YIT Q;  3HL8 A;  3VV0 A;  2L3Q A;  4DEY A;  5GAN 4;  3JB9 J;  1T3S A;  3GP8 A;  4HT8 A;  3RKY A;  2EQK A;  3OYA A;  4EMH A;  2DM1 A;  2V1R A;  3HRT A;  4Z8A A;  1FMV A;  3GPL A;  2BE9 B;  3A8O B;  3X24 B;  2CT4 A;  1JRI A;  4RCC A;  1V1C A;  2YRD A;  5IHI A;  2OTL Q;  3G4S T;  1YCY A;  1D3B B;  3CBM A;  1NEG A;  5CO7 A;  2KSS A;  4L5G A;  3OMC A;  2KXD A;  2JM8 A;  4J6W A;  1VQL A;  2I0N A;  1UGP B;  2DMO A;  2NUP B;  2X35 A;  1GRI A;  3CXC S;  3CCL T;  2DO3 A;  2JW4 A;  1KQS S;  3H8Z A;  1M1G A;  4LXC A;  1QMC A;  3CCM A;  3MHX A;  1I0C A;  2CP6 A;  1OX9 A;  2Y4Y A;  1VQN A;  4M78 C;  1M2V A;  4HVW A;  1D09 B;  5GAM g;  4F7U B;  5LJ5 e;  4CC4 B;  1ZSZ B;  4JJC A;  4ZN3 A;  1KD1 C;  3PFS A;  1WZO A;  3G6E A;  1YIT A;  2E65 A;  1Y57 A;  2D9T A;  3HSB A;  1NM7 A;  5GMK j;  3M4Y A;  1M3A A;  2KRM A;  4J9B A;  4EIK A;  5A0G A;  1N8R R;  3VS7 A;  4J7F A;  2FRY A;  2HQE A;  4A4G A;  3MCA B;  4M75 G;  4FCY A;  4LD6 A;  1YJN T;  1JXO A;  5CKE A;  3EFO A;  2QK0 A;  4RTX A;  3V8L A;  4XTV A;  1TG0 A;  2RB6 A;  4DBQ A;  2LJ3 A;  2DFU A;  4JZ3 A;  5KYY A;  2E3I A;  2YUO A;  1MMA A;  2COZ A;  3P8D A;  2DVE A;  4BI4 A;  1RL2 A;  1YJW Q;  1ZHI A;  5IHN A;  1OV3 A;  1N8R U;  2ZCF B;  3SHW A;  5GAM f;  1JJ2 S;  1ZA1 B;  2I2L A;  4PJL A;  3NFC A;  1GL5 A;  3MEW A;  2J06 A;  1D3B A;  3UA6 A;  1QWF A;  3R6N A;  1X2Q A;  2XDB A;  2V8J A;  3ZBD A;  1TTH B;  5CKF A;  2KE9 A;  3I9Q A;  4XTX A;  3ER0 A;  4K11 A;  1AZG B;  1W2B A;  3MP6 A;  4ATO A;  1QQJ A;  2GNC A;  2KT8 A;  2KK4 A;  1VQO Q;  2SRC A;  3EG2 A;  2RI5 A;  1BI2 A;  1IZ6 A;  4E7S A;  2L3P A;  3RIR A;  2OI3 A;  2MK5 A;  2X4X A;  3I55 Q;  5IXF A;  2E4H A;  1Z9Q A;  4F7U A;  3OYD A;  4ZGE B;  4II1 A;  3M0Q A;  2H3J A;  1ZSZ A;  2DL4 A;  2F2X A;  2QDY B;  3PTA A;  1YJW A;  1GCQ C;  3VUZ A;  4M7A C;  1A0N B;  1M3B A;  4ZTF A;  4C0D B;  4AT1 B;  4A63 B;  4E2F B;  4C0F A;  4HCZ A;  4DBF A;  4J9H A;  1VYU A;  2VGM A;  2KYB A;  3PIO A;  3OYG A;  1YWO A;  2DXT A;  2CUD A;  5DY9 A;  3M0R A;  1OEB A;  4BDY A;  1W6X A;  2K2V A;  5CK9 A;  3DB4 A;  3CPW A;  4L6V 5;  3OMG A;  4XTW A;  2OAU A;  1I07 A;  3EHQ A;  2RPN A;  1LOJ A;  1NYF A;  4DOV A;  1JO8 A;  2EQM A;  1ZUU A;  2VUB A;  4PNO A;  3SWN A;  4F14 A;  5IH2 A;  1WXB A;  2OJ2 A;  1QCF A;  4ZGJ B;  4VUB A;  3OYK A;  2EYX A;  4PL6 A;  1KQ1 A;  2RQW A;  5LJ3 j;  2PZ1 A;  3CC7 Q;  1P92 A;  3H6Z A;  4RTU A;  2XI9 A;  4PFO A;  3EGD B;  1RAH B;  3M54 A;  4HVU A;  3VS1 A;  2GTJ A;  2VKN A;  3NTH A;  1WGS A;  3GNG A;  1S72 Q;  1Q86 C;  1QVG S;  1IHV A;  1BIB A;  4RTY A;  4HCK A;  2VXF A;  1VQ6 T;  1YNZ A;  2XDP A;  4Z89 A;  4NL3 A;  2ZZD A;  3GIB A;  2P84 A;  2JZ2 A;  4JLG A;  5FLX E;  3OW2 A;  1AVZ C;  1JB0 E;  2COW A;  2DIL A;  5KYX B;  1QVF A;  3CCR T;  4N4H A;  4QVZ A;  4JRI A;  2M9U A;  3S3O A;  5KH6 A;  1SKU B;  1PD0 A;  3MEA A;  2G3R A;  3DB3 A;  5GMK h;  3ASK A;  1N27 A;  1X01 A;  1YP5 A;  3LYI A;  4FSX A;  2DNU A;  4BD3 A;  1KSW A;  4DBR A;  2WSE E;  3QWY A;  1TUG B;  2XIC A;  1YCS B;  1X27 A;  3Q1J A;  4J6Y A;  3JCM X;  2YDL A;  1ZBJ A;  1CSK A;  2LQN A;  2HSE B;  1Q82 C;  3UT1 A;  1I4K 1;  4EMG A;  4E47 A;  1B3Q A;  1WDX A;  1LVK A;  2CP0 A;  2DPP B;  4OMO A;  1K73 C;  1KK7 A;  1OPL A;  4B9W A;  2O01 E;  1UHF A;  2EBP A;  2QXF A;  3ZL7 C;  3CMA Q;  2RJD A;  5GAN 7;  3JB9 F;  1UG1 A;  2EQU A;  1ZUY A;  4M77 E;  3H9N A;  3M5A A;  1TU0 B;  1PSE A;  3H0I A;  2QTX A;  1IGQ A;  3TSZ A;  3REB B;  2C0I A;  1YBY A;  2RHI A;  4PJO C;  2HEQ A;  1G3Y A;  1WJS A;  2KVQ G;  3EGD A;  4M7D D;  3P8H A;  3SB2 A;  3DLM A;  2L8D A;  2A3L A;  2QA4 T;  4X9C A;  3S3N A;  3O5Z A;  1MMD A;  2QGG A;  1R8O B;  1TUD A;  4E7K A;  4M7D A;  4KBM B;  1X6G A;  2JMC A;  2RHU A;  1RAD B;  4GBQ A;  1UE9 A;  5KYX A;  1XJW B;  4J9G A;  3FRN A;  4HA8 A;  3CBP A;  2RK1 A;  3TRE A;  2BTT A;  3OYB A;  1WXT A;  4ZN1 A;  4C92 B;  1M90 C;  4AG1 C;  3UF4 A;  1KG1 A;  1VQP Q;  3A5Z B;  3M56 A;  3SFM A;  5A0D A;  2JMA A;  2VYT A;  1NLO C;  4LUD A;  3CCJ Q;  4CRI A;  3FEO A;  1HSQ A;  2QG9 B;  3JCM c;  5GAM d;  3N5B B;  2MWO A;  4OML A;  4C8Q B;  4XU3 A;  3IQL A;  4NS5 A;  1WIE A;  3QZ9 B;  4IUP A;  1NJI R;  4M78 E;  3OYN A;  3OYC A;  4E7L A;  3PIP A;  5LJ5 j;  4D8D A;  3AHU A;  1K8A U;  3PVQ A;  2ECZ A;  2LX9 A;  1G3T A;  4QT7 A;  1GFD A;  4N4I A;  3QG1 A;  1NPP A;  5LJ3 h;  1NPR A;  2QQS A;  2KYM A;  1BI1 A;  1VQ7 A;  4J9I A;  3C4S A;  2LT4 A;  2RJC A;  1HJD A;  1R77 A;  1VQM A;  1W4S A;  1QWE A;  2KI7 A;  1YI2 Q;  4M77 F;  2CSI A;  1WHM A;  2CYZ B;  1VQK A;  3C12 A;  2JTM A;  2LDM A;  1W1F A;  2LNV A;  2QTV A;  3F70 A;  3PE0 A;  3J81 E;  2DIG A;  2BZY A;  2DYB A;  4M7D G;  2X9H A;  1B07 A;  2HSP A;  4M4Z A;  3HFN A;  2FEI A;  1V76 A;  5I2M A;  2DLP A;  1N9R A;  4RG2 A;  3RES A;  2DXU A;  4M75 B;  4C92 A;  2LZ6 B;  2YRC A;  2D0N A;  3VS0 A;  1U5S A;  1VQ8 Q;  1UGQ B;  1WLP B;  2QA4 A;  1I8F A;  2VVK A;  4NL2 A;  3HKS A;  2GF7 A;  1G3S A;  4RTT A;  2AIR B;  5GAN 3;  3CXC P;  1G5V A;  1IO6 A;  1KQS P;  2EQI A;  1AD5 A;  2CS7 A;  2K6D A;  5J39 A;  1T0J A;  4BY6 C;  2XMF A;  4C8Q A;  1QP3 A;  1OU9 A;  2RD1 A;  4QQ6 A;  4E6R A;  3I56 Q;  1M1K C;  2D6F A;  4Y91 A;  2EYW A;  5GAN e;  3JSC A;  1C6V X;  4J6X A;  2DF6 A;  3CD6 A;  2M0O A;  2V1Q A;  2LCC A;  2L89 A;  1PKS A;  3JV3 A;  1OU8 A;  5D6Y A;  1KD1 U;  4PFP A;  2K5L A;  5FU6 C;  4M78 F;  4XTU A;  3X25 B;  1FX7 A;  4M7A E;  2YSQ A;  4PJM A;  1VYT A;  2R5A A;  3FDR A;  3C95 A;  3MEV A;  1XOV A;  1YIT T;  3BY7 A;  4CI0 C;  2AT1 B;  1BKB A;  4BE1 A;  2RQU A;  3S6W A;  3LWI A;  2KRS A;  3TU4 K;  2LMJ A;  3JB9 D;  2JN0 A;  1VQ5 Q;  4RTZ A;  2FPE A;  1IGU A;  2E1H A;  2D8J A;  3MJX A;  1NYG A;  4ELY C;  5GAO m;  2C06 A;  2OTL T;  4N0A C;  2AK5 A;  3A8M B;  5GAN g;  2MOX A;  4KGZ B;  1R0B G;  1Q7Y C;  2YT6 A;  2ZPH B;  2ZAE A;  4HVV A;  1MMN A;  3OSS C;  2J7I A;  4C0G A;  1YIJ Q;  1KC8 R;  1JJ2 P;  2YUN A;  3QO3 A;  3TCJ A;  4O6J A;  4M77 C;  4HCB A;  3L2U A;  4M75 A;  2F5K A;  1UGS B;  4PK4 A;  2J6K A;  2L3R A;  3JCM V;  1GBQ A;  1SSF A;  4XU1 A;  3A8G B;  5KYU B;  1AHJ B;  1PWT A;  4FL6 A;  5KYN A;  4ORZ A;  1N9S A;  2BKD N;  1BCO A;  2QEX Q;  3M0U A;  3WXM B;  4QQD A;  5I22 A;  4LDU A;  5C0M A;  4R55 A;  3QDR B;  2MWP A;  3M59 A;  5GAM e;  3LGF A;  2K3Y A;  2AZV A;  1M8M A;  1X43 A;  5LJ5 h;  1GBR A;  5GAN f;  5KCO A;  1QW1 A;  3VJP A;  4PFZ A;  3T9N A;  1YIJ A;  2KGT A;  3BDU A;  5CR2 A;  1YJW T;  3GOX A;  5HCK A;  2HBP A;  5I21 A;  4JS5 A;  1UDL A;  4X1V A;  4HXJ A;  4FYW B;  4M7A F;  3VS4 A;  2J6O A;  5D6W A;  2LC4 A;  2DYI A;  1QKX A;  4PLL A;  2DER A;  2E5K A;  4J9E A;  2KMT A;  1K0X A;  2OTJ Q;  1JEG A;  4MDW A;  3OS0 A;  2R5M A;  1KHI A;  1TUC A;  3RR6 A;  1BU1 A;  2VWF A;  1PNJ A;  3QYG B;  1H8K A;  3JB9 G;  3M0P A;  2W10 A;  1W70 A;  3JCM d;  1LCK A;  2PQW A;  2Z0W A;  2ZPE B;  3VS6 A;  4BI8 B;  4V2S A;  2CP7 A;  3M55 A;  3REA B;  1ZSZ C;  5FWB A;  2IVW A;  1I81 A;  5GAO q;  2LQW A;  3J80 E;  2OTL A;  4JJD A;  2DZ9 A;  4GLM A;  2DRK A;  1FXX A;  4HCC A;  1Q81 C;  4PJO E;  5KYU A;  1OYX A;  1QLY A;  4FU6 A;  1FMW A;  1W2B S;  4IKF A;  2WAC A;  3L1A A;  3CCS Q;  1QVG P;  4IUQ A;  3U23 A;  3CC4 Q;  2EVR A;  1RLP C;  2CZ0 B;  4LDW A;  1Q86 U;  1OX8 A;  1IB8 A;  3H0F A;  2K4Y A;  3OS2 A;  2CZ7 B;  1B7T A;  2HKN A;  2XK0 A;  3SWN B;  4DA4 A;  3OYY A;  2YLC A;  3E9G A;  3JRZ A;  1KHC A;  1BK2 A;  2DEQ A;  3CCU Q;  3CCQ Q;  3L2W A;  3NTI A;  4OGE A;  1N5Z A;  4E7H A;  1U1T A;  2RA2 A;  3OS5 A;  3JCM b;  3GNF B;  3QWX X;  4M78 D;  4Y92 A;  2LCL A;  5FW9 A;  2GFA A;  3CCL Q;  3FIF A;  2E12 A;  2V26 A;  3CC7 T;  2KDS A;  4IUU A;  3CPF A;  2LP5 A;  3CEY A;  1Q82 U;  3CPW S;  1BCM A;  4FYV B;  2HZY A;  4XK8 E;  3BE3 A;  5CIU A;  2B86 A;  5CVI A;  3CCE Q;  5HKC A;  2KQW A;  2XD0 A;  2JOY A;  4E7Z A;  1WXU A;  1RAG B;  3OSV A;  3EGU A;  2VGN A;  4A54 A;  1MHN A;  1KJW A;  4LUE A;  4A4F A;  1YJN Q;  2EGC A;  5J3B A;  5EC7 A;  2K2M A;  3UWN A;  4N4G A;  3E9F A;  4C0D C;  3H0H A;  1ZBX A;  3MET A;  1M90 R;  4LD9 K;  4PJO F;  5DM7 R;  3CME Q;  1VQO A;  1HD3 A;  2LJ1 A;  4JS4 A;  3UPU A;  3MKD A;  2O4X B;  2L2P A;  2VC8 A;  3I55 A;  3OW2 S;  1D1C A;  1QVF S;  3BFM A;  3QJY A;  3PMI A;  2E10 A;  3UDC A;  1N6A A;  4KT0 E;  4F04 B;  1RAA B;  5GJW B;  4Z88 A;  3KXT A;  1M90 U;  2ZPF B;  2ABL A;  3QDF A;  4WCI A;  3CMA T;  3L2Z A;  2PVO B;  3MP8 A;  1DJ7 B;  4ZNX A;  3CCV Q;  4M7A D;  7AT1 B;  4M7D B;  1LNX A;  1GCP A;  1K4U S;  1I5O B;  3E1S A;  1B34 A;  3EAE A;  1D0Z A;  2EQJ A;  4P5N A;  3NGP A;  4M78 G;  4C92 F;  5A2Q E;  3LWH A;  2AKK A;  4J5Y A;  2NWM A;  1GCQ A;  5CAI A;  2KRN A;  4FT2 A;  3JCM e;  4IUR A;  5FU7 C;  1N8R C;  2E70 A;  2RHX A;  2K5I A;  1IHW A;  1GFC A;  2FHD A;  2XU8 A;  2ROT A;  1UEB A;  3CC7 A;  4DBH A;  2LQ8 A;  4CC3 A;  2PVD B;  2JS0 A;  4AFS C;  3NTK A;  1AOJ A;  4X34 A;  1VQ7 T;  3OYM A;  5IXB A;  2K3X A;  1H92 A;  2C0T A;  2KY9 A;  3CC2 Q;  5GAN d;  3CQT A;  1UUE A;  2AHJ B;  1VQM T;  2OAW A;  3VYG A;  1ARK A;  2E3H A;  1NBE B;  1S72 A;  1VQP T;  1AWJ A;  3QHS A;  3R6O A;  3G1J A;  2IIM A;  4L59 A;  3CCV A;  2ROL A;  2KT1 A;  1VQK T;  2O4X A;  2JTE A;  2CZ6 B;  8ATC B;  2HNI A;  2V8K A;  1NLP C;  4EMK B;  1D0X A;  3QKJ A;  3JCM P;  4A53 A;  1X2K A;  2HL5 C;  4TVR A;  3JCM g;  1ACM B;  2CKK A;  4OF1 A;  2EGA A;  1NG2 A;  4IIO A;  2DTO A;  5IT9 E;  4FT4 A;  5CQX A;  4XU0 A;  4FW2 A;  1ZQ1 A;  1CKB A;  1VA7 A;  4IUT A;  3VS2 A;  2F2W A;  4IUV A;  1NE8 A;  2PUK B;  4C5G A;  2A28 A;  3X20 B;  4QW2 A;  2KXC A;  3G71 Q;  4O5V A;  2CP3 A;  4RKU E;  2A37 A;  5KE2 A;  1WNL A;  3UA7 A;  1RAF B;  1VQ6 Q;  1ABO A;  1JBM A;  3X26 B;  5GAM j;  2VV5 A;  3LX7 A;  1YI2 T;  2M16 A;  1K1Z A;  3EG3 A;  3CCR Q;  3V7R A;  3WVE B;  1HXD A;  4R56 A;  2E5Q A;  2MYS A;  2ZPI B;  3VRY A;  3CD6 T;  5KYW B;  2FPF A;  2NYS A;  2EWN A;  3A1P A;  3CMA A;  5HY6 A;  4M7A G;  1TS9 A;  2RQV A;  1K8A R;  1AEY A;  1UJY A;  3JCM f;  3OA6 A;  4IIM A;  1UHC A;  2KEA A;  4BE2 A;  2VXE A;  2BIV A;  4OMP A;  5GMK m;  2DA9 A;  4C92 C;  4ELZ C;  1TOV A;  2M51 A;  4LE9 A;  1ZUK A;  2EJG A;  4RG8 A;  1WHL A;  1BYM A;  3EG0 A;  2ATC B;  2DJZ A;  3SDZ A;  3G71 A;  1MGQ A;  4X9D A;  2F5T X;  2DKG A;  2X51 A;  1SG5 A;  1Q7Y U;  4C8Q C;  1VQ9 Q;  4PJO D;  2X4Y A;  4EMK A;  2OX7 A;  1MV3 A;  1OQK A;  1O75 A;  3TQ7 P;  1WYX A;  5AT1 B;  5IN1 A;  2RF0 A;  2Y90 A;  3EFR A;  3QYH B;  4F7U E;  2LNH B;  1H3Z A;  2FZC B;  4AFQ C;  3WVD B;  1Y71 A;  3OYE A;  2SEM A;  1VQP A;  3HRS A;  3M9Q A;  5GAO r;  1YJ9 Q;  2FZG B;  2CZ1 B;  2GGR A;  2D8H A;  2K9G A;  3CCJ A;  2DXB A;  1EFN A; 
#chains in the Genus database with same CATH homology
 3V8K A;  2ZPG B;  2QQ9 A;  2YRV A;  3MP6 A;  4QQD A;  3WXM B;  4ATO A;  2KK4 A;  4LDU A;  5CQY A;  5C0M A;  4R55 A;  3CCJ T;  2RI5 A;  3QDR B;  1QVG A;  1BI2 A;  1IZ6 A;  5GAO p;  2MWP A;  3M59 A;  4OB0 B;  5GAM e;  4OMF B;  3QXE B;  3RIR A;  3LGF A;  5GAN h;  2K3Y A;  2X4X A;  1OZ3 A;  2XG8 D;  5LJ5 h;  3V7S A;  4F7U A;  3OYD A;  4ZGE B;  4II1 A;  2H3J A;  5GAN f;  2QDY B;  2HAX A;  4EDU A;  3PTA A;  5KCO A;  1QW1 A;  1YJW A;  3VJP A;  1U1S A;  3VUZ A;  1VQ9 A;  2QQR A;  1H64 1;  4M7A C;  2EYQ A;  3JCM Q;  5FRM A;  3CBO A;  3T9N A;  1YIJ A;  4EMK C;  4PJO B;  2JUF A;  3BDU A;  2X4J A;  5CR2 A;  1YJW T;  1VQ9 T;  1K9M C;  2E41 A;  1QVP A;  3GOX A;  4ZTF A;  1K9M U;  5GMK e;  4C0D B;  2HBP A;  5I21 A;  4JJN K;  4JS5 A;  1YIJ T;  1WPY A;  4C0F A;  4HCZ A;  4M7A F;  1XQH A;  2ZGW A;  5D6W A;  4M75 C;  2LC4 A;  1X75 C;  3HRU A;  2RO0 A;  1YI2 A;  2VGM A;  4XQ3 A;  4PLL A;  3SD4 A;  3PIO A;  2BUD A;  1WJQ A;  3CC2 A;  2EKO A;  3OYG A;  2EJF A;  2DXT A;  2KMT A;  3L2V A;  3RUX A;  1YJ9 A;  5M9O A;  5DY9 A;  2NLU A;  3HPW A;  1M1K U;  4MDW A;  4J83 A;  3M57 A;  4M75 F;  3OS0 A;  1YJ9 T;  2R5M A;  1KHI A;  3OYI A;  4BDY A;  1U8R A;  2K2V A;  5CK9 A;  3DB4 A;  3CPW A;  3OBW A;  3QYG B;  4L6V 5;  3OMG A;  4XTW A;  3JB9 G;  2OAU A;  1Y7X A;  2MF2 A;  2PQW A;  3JCM d;  4RMO A;  2ZPE B;  1LOJ A;  4DOV A;  4BI8 B;  4V2S A;  2PVG B;  2EQM A;  2VUB A;  1NZ9 A;  4PNO A;  3SWN A;  3M55 A;  5CKB A;  3KUF A;  2LVM A;  4ZGJ B;  4VUB A;  2XDD A;  3OYK A;  5FRN A;  1YHQ T;  2LQK A;  4PL6 A;  4J8O A;  1KQ1 A;  3OY9 A;  5LJ3 j;  2F69 A;  2P4T A;  4HKE A;  4OB2 B;  2IVW A;  4JRQ A;  1I81 A;  1P92 A;  2K5F A;  3H6Z A;  2V8I A;  4XTZ A;  5GAO q;  1VQ8 A;  3M4G A;  5LJ3 g;  3J80 E;  2OTL A;  4OVA A;  2DZ9 A;  2XI9 A;  4F7U F;  2Y4X A;  1FXX A;  4PJO G;  1Q81 C;  4HCC A;  3KBG A;  4PJO E;  3M58 A;  2EAY A;  1OYX A;  1TH7 A;  1Q81 U;  3M54 A;  1VQ8 T;  5IAY A;  3EFS A;  3PGG A;  4WF2 A;  4Z02 A;  3L2Q A;  4LDX A;  4FU6 A;  3G7Z A;  3JCM W;  5HK0 A;  1W2B S;  4IKF A;  3QPH A;  2WAC A;  3L1A A;  3C94 A;  2GQV A;  1WGS A;  3NTH A;  4IUQ A;  4OGC A;  3GNG A;  1VQ4 A;  1Q86 C;  1VQ6 A;  1QVG S;  4DOW A;  2CZ0 B;  4LDW A;  1WJR A;  1Q86 U;  1BIB A;  4BE0 A;  5GAM h;  2MMP A;  4C0Z A;  3I56 A;  2VXF A;  2K4Y A;  5C6S A;  3OS2 A;  2LT1 A;  2CZ7 B;  1VQ4 T;  1VQ6 T;  3FLG A;  2XK0 A;  2XDP A;  4NL3 A;  3CCR A;  2ZZD A;  4MZM A;  3GIB A;  3SWN B;  3I56 T;  2JZ2 A;  4JLG A;  5FLX E;  3OW2 A;  1JB0 E;  2OTJ T;  4DA4 A;  3GF5 A;  2P0Q A;  3OYY A;  4OB1 B;  1BIA A;  2YLC A;  3X28 B;  1QVF A;  3E9G A;  3VYH B;  4N4H A;  3JRZ A;  3CCR T;  2JTF A;  1KHC A;  4QVZ A;  3J7A F;  1M5Q 1;  4JRI A;  4C5I A;  2M9U A;  2DEQ A;  3V7C A;  5I2S A;  5KH6 A;  2PU9 B;  1UB4 A;  3S3O A;  3RMQ A;  1FWZ A;  3MEA A;  3NTI A;  4OGE A;  3L2W A;  4Q5W A;  4PJO A;  4E7H A;  4ME7 A;  2G3R A;  3DB3 A;  1GXI E;  3O8V A;  1U1T A;  2DZC A;  1XNI A;  5GMK h;  3ASK A;  2RA2 A;  1N27 A;  2KAF A;  3OS5 A;  3LW5 E;  3PMT A;  1X01 A;  3JCM b;  3GNF B;  2E6N A;  4M78 D;  3HFO A;  3JCM J;  3QSU A;  2LCL A;  4UC4 A;  3L42 A;  3LYI A;  1EIF A;  4YTL A;  2RHY A;  4FSX A;  4FM4 B;  3OQ5 A;  1VQ5 A;  3HHT B;  4BD3 A;  5LL6 S;  2GFA A;  2WSE E;  2XHC A;  4KUL A;  4A4H A;  5LJ3 f;  3FIF A;  2E12 A;  3CC7 T;  2EFI A;  2XIC A;  4J6Y A;  3Q1J A;  3JCM X;  4E7I A;  5CKH A;  2KDS A;  1NJI C;  1VQ5 T;  4IUU A;  5L8R E;  1NJI U;  5GMK i;  3CPF A;  4QVD A;  1Q82 C;  5GAN 6;  3UT1 A;  3CEY A;  1Q82 U;  3CPW S;  2YHT A;  1I4K 1;  4EMG A;  2DD4 A;  4E47 A;  3LH0 A;  1X6O A;  5LJ5 d;  4XK8 E;  5CIU A;  2DTH A;  1HK9 A;  3CCS T;  2XKO C;  5CVI A;  2DPP B;  1Y96 B;  2DXC A;  1K73 C;  1BI0 A;  3CC4 T;  2GCX A;  4C92 D;  1LJO A;  5HKC A;  4B9W A;  5GAN 5;  2KQW A;  2XD0 A;  2O01 E;  2JOY A;  2QXF A;  3FC3 A;  2QQA A;  2RJD A;  5GAN 7;  3DKM A;  3JB9 F;  2FL7 A;  3OSV A;  5LJ3 e;  2EQU A;  4KUI A;  2RJE A;  2VGN A;  4M77 E;  3M5A A;  4A54 A;  1PSE A;  1MHN A;  2QTX A;  3M53 A;  3JB9 H;  4A4F A;  3V8J A;  2QQB A;  5J3B A;  2XID A;  2DK3 A;  1YBY A;  2RHI A;  4PJO C;  3CCU T;  1G3Y A;  1QP2 A;  3CCQ T;  3INZ A;  1WJS A;  2KVQ G;  3UWN A;  4BY6 B;  2B8A A;  4M7D D;  4LDY A;  4C8Q D;  5FRO A;  2R58 A;  3P8H A;  4N4G A;  3E9F A;  4C0D C;  3SB2 A;  4NOY A;  3DLM A;  2L8D A;  1ZBX A;  2QI2 A;  2A3L A;  3A8L B;  3MET A;  2QEX A;  4HT9 A;  4M78 B;  4N0A A;  4KUD K;  4LD9 K;  4M77 D;  2A7Y A;  2QA4 T;  4A4K A;  1Y07 A;  4X9C A;  3OYH A;  4PJO F;  5DM7 R;  3S3N A;  1VQO A;  4OB3 B;  2QEX T;  3RMS A;  2JNG A;  4JS4 A;  3UPU A;  4LDV A;  4XTY A;  2O4X B;  1R8O B;  2E6Z A;  5CKD A;  4E7K A;  2VC8 A;  3I55 A;  1VQO T;  5FU6 B;  1YHQ A;  4QQG A;  3RKW A;  4KBM B;  3OW2 S;  1VQL T;  1OI1 A;  4M7D A;  2RHU A;  2P0P A;  1QVF S;  3I55 T;  3BFM A;  3QJY A;  2MI6 A;  3DLL A;  4M77 A;  3PMI A;  3FRN A;  3CCM T;  2E10 A;  2MAM A;  4HA8 A;  3CBP A;  2RK1 A;  4GY5 A;  3UDC A;  3TRE A;  1N6A A;  3JB9 I;  1VQN T;  2FYK A;  4KT0 E;  2EJ9 A;  3OYB A;  4ZN1 A;  4C92 B;  1WQ7 A;  5A0L A;  4E7J A;  1M90 C;  2RK2 A;  4MDX A;  3CCE T;  4B9X A;  3KXT A;  1M90 U;  3QJ6 A;  5DLQ E;  2DTI A;  2ZPF B;  1KG1 A;  1OZ2 A;  2DD5 A;  3A5Z B;  3M56 A;  2DIQ A;  3SFM A;  5A0D A;  3G6E T;  3FB9 A;  3L2Z A;  3CMA T;  2VYT A;  3S3M A;  2PVO B;  3OB9 A;  4RCB A;  3MP8 A;  3QII A;  4BI3 A;  5CCA A;  5HK3 A;  5GMK l;  1DJ7 B;  2K57 A;  3HP9 A;  4CRI A;  5EG2 A;  4DQ2 A;  5DLO A;  3FEO A;  5GAN 8;  2OTJ A;  1M9S A;  3QBY A;  3JCM c;  4M7A D;  5GAM d;  3VKI A;  3N5B B;  3CXC A;  4M7D B;  1LNX A;  2MWO A;  4C8Q B;  4XAX B;  3E1S A;  1KQS A;  4XU3 A;  4NS5 A;  3VU3 C;  1B34 A;  3EAE A;  3ME9 A;  5GAO l;  3BDL A;  3ZFJ A;  2EQJ A;  3QZ9 B;  4P5N A;  4QVC A;  4IUP A;  3PNW C;  4JLI A;  4M78 G;  1V29 B;  4C92 F;  4M78 E;  4M77 B;  4JDS A;  4BDZ A;  3OYN A;  3OYC A;  2WSF E;  5A2Q E;  3PIP A;  4E7L A;  3LWH A;  1IRE B;  5LJ5 j;  3OYJ A;  1Y96 A;  2M1H A;  4J5Y A;  5KCH A;  3CME T;  1G3W A;  2JVV A;  4M75 D;  1K8A C;  3AHU A;  1K8A U;  3PT9 A;  5CAI A;  3RKX A;  4FT2 A;  5LJ5 g;  3JCM e;  4MZT A;  2LX9 A;  1G3T A;  1WQW A;  3SWN C;  4IUR A;  5FU7 C;  2FVU A;  3QG1 A;  4N4I A;  2E70 A;  2RHX A;  1N8R C;  2GFU A;  1NPP A;  2K5I A;  4J7I A;  1NPR A;  5LJ3 h;  4ZGD B;  2QQS A;  2FHD A;  2XU8 A;  1UEB A;  5GAO n;  3L2R A;  1BI1 A;  3OYF A;  3CC7 A;  2RH2 A;  1VQ7 A;  2YLB A;  2DAQ A;  2LQ8 A;  3C4S A;  2LT4 A;  4M7D F;  1M1F A;  2LRQ A;  2PVD B;  2RJC A;  3LGL A;  3NTK A;  4X34 A;  4D6W A;  1VQ7 T;  4C92 G;  4FIB A;  1VQM A;  3OYM A;  4C92 E;  1W4S A;  2K3X A;  3GLX A;  1UGR B;  4M77 F;  2KY9 A;  5GAN 2;  3ZEH A;  4C5H A;  1M8V A;  5GAN d;  3CCS A;  1B34 B;  2AHJ B;  2CYZ B;  1VQM T;  4M78 A;  3VYG A;  4EPC A;  1VQK A;  1S72 A;  3C12 A;  1RI0 A;  2JTM A;  2LDM A;  4BAC A;  1VQP T;  3QHS A;  4MZP A;  3CC4 A;  3FJP A;  3R6O A;  4L59 A;  2RI2 A;  2RI3 A;  3OBY A;  2LNV A;  3F70 A;  3J81 E;  3CCV A;  1S72 T;  2O4X A;  3URG A;  1VQK T;  1KC8 C;  1K73 U;  2DIG A;  2WSC E;  1KC8 U;  2CZ6 B;  2E64 A;  2HNI A;  2V8K A;  5D6X A;  2FB7 A;  3BW1 A;  4OP0 A;  4BB7 A;  4M7A B;  2RM4 A;  3RER A;  1VUB A;  3CCV T;  1XTD A;  3QZ5 B;  4M7D G;  5J26 A;  4C8Q G;  4M7D E;  4EMK B;  4C8Q E;  2HD0 A;  2R57 A;  3HL8 A;  3QKJ A;  3VV0 A;  1BI3 A;  4BUG A;  3JCM P;  4A53 A;  3G6E A;  4TVR A;  2PUO B;  3JCM g;  5GAN 4;  2CKK A;  4GLK A;  4OF1 A;  3JB9 J;  4M77 G;  3HFN A;  3GP8 A;  3CCU A;  3QUI A;  3RKY A;  4HT8 A;  2EQK A;  3CCQ A;  2DTO A;  5I2M A;  4EMH A;  3OYA A;  1JJ2 A;  3HRT A;  5IT9 E;  1N9R A;  4FT4 A;  4RG2 A;  5CQX A;  3RES A;  4XU0 A;  3GPL A;  2DXU A;  4M75 B;  3E19 A;  4C92 A;  3G4S A;  3A8O B;  1ZQ1 A;  3LLR A;  2HQX A;  5LJ5 f;  3X24 B;  4IUT A;  1JRI A;  4RCC A;  1UGQ B;  4IUV A;  2QA4 A;  1NE8 A;  2PUK B;  1I8F A;  3G4S T;  1YCY A;  4C5G A;  1D3B B;  1VIE A;  3CBM A;  4NL2 A;  3HKS A;  5CO7 A;  2KSS A;  2GF7 A;  1G3S A;  3OMC A;  4L5G A;  3X20 B;  2IG0 A;  4QW2 A;  3CCL A;  5GAN 3;  3MEU A;  4O5V A;  1VQL A;  4J6W A;  4RKU E;  3MO8 A;  1G5V A;  1UGP B;  2X35 A;  5KE2 A;  1WNL A;  3CXC S;  3JAM E;  2CS7 A;  3CCL T;  5J39 A;  2DO3 A;  4BY6 C;  1KQS S;  3H8Z A;  1M1G A;  1JBM A;  2EIF A;  1QP3 A;  4C8Q A;  2RD1 A;  3X26 B;  4QQ6 A;  3CCM A;  1M4Z A;  3MHX A;  5GAM j;  2VV5 A;  1M1K C;  2D6F A;  3LX7 A;  1YI2 T;  2M16 A;  2Y4Y A;  4Y91 A;  1VQN A;  4M78 C;  5GAN e;  3OYL A;  3JSC A;  2LTO A;  3CC2 T;  4J6X A;  3CD6 A;  3V7R A;  3VUB A;  3WVE B;  4F7U B;  1HXD A;  5GAM g;  4R56 A;  2E5Q A;  5LJ5 e;  2M0O A;  3CCE A;  2LCC A;  2L89 A;  2ZPI B;  4ZN3 A;  3CD6 T;  1KD1 C;  3JCM h;  5D6Y A;  4JUV A;  3PFS A;  1KD1 U;  2K5L A;  4MMK A;  1PSF A;  2CGH A;  2EWN A;  4M78 F;  4XTU A;  5FU6 C;  5HY6 A;  3X25 B;  1FX7 A;  3CMA A;  2E65 A;  1YIT A;  4M7A G;  4M7A E;  1O9S A;  2D9T A;  3MP1 A;  4MML A;  2R5A A;  3JCM f;  3FDR A;  3OA6 A;  3C95 A;  3MEV A;  1XOV A;  5AYF A;  1YIT T;  5GMK j;  3HSB A;  3BY7 A;  4BE2 A;  3M4Y A;  3P8B B;  4CI0 C;  2VXE A;  2BIV A;  1BKB A;  5KE3 A;  4BE1 A;  5A0G A;  3S6W A;  3LWI A;  1YJN A;  1VIF A;  1I5L A;  2D0Q B;  5GMK m;  3TU4 K;  4J7F A;  2HQE A;  4A4G A;  4C92 C;  3MCA B;  4M75 G;  4ELZ C;  3JB9 D;  2JN0 A;  4M75 E;  3OS1 A;  2EJG A;  4LD6 A;  4RG8 A;  1YJN T;  5CKE A;  2E1H A;  1BYM A;  3A8H B;  4JRP A;  3V8L A;  4XTV A;  2RB6 A;  4ELY C;  5GAO m;  2DJZ A;  2C06 A;  2OTL T;  4N0A C;  3SDZ A;  3CME A;  5GAN j;  4C5E A;  3G71 A;  4A4E A;  1MGQ A;  3A8M B;  4X9D A;  5GAN g;  2F5T X;  3G71 T;  2DKG A;  2L5Q A;  1Q7Y C;  1Q7Y U;  3P8D A;  2ZPH B;  4M7A A;  4M7D C;  2DVE A;  4BI4 A;  1RL2 A;  3OSS C;  4C8Q C;  4PJO D;  2X4Y A;  4EMK A;  2RJF A;  1ZHI A;  4C0G A;  1N8R U;  1O75 A;  2ZPB B;  3QO3 A;  3TCJ A;  4O6J A;  5FU7 B;  2ZCF B;  4M77 C;  5IN1 A;  4HCB A;  5GAM f;  2Y90 A;  3EFR A;  1JJ2 S;  5LJ3 d;  2RHZ A;  4F7U G;  4PLI A;  3QYH B;  3L2U A;  4F7U E;  2I2L A;  1KQ2 A;  4C8Q F;  4ZTJ A;  3NFC A;  4M75 A;  1H3Z A;  2F5K A;  1UGS B;  4Y28 E;  2L3R A;  3JCM V;  3WVD B;  1Y71 A;  3MEW A;  3OYE A;  1SSF A;  1VQP A;  3HRS A;  3M9Q A;  4JRK A;  5GAO r;  4XU1 A;  1D3B A;  4PKC C;  2CZ1 B;  3A8G B;  3TEE A;  2X4W A;  1AHJ B;  2V8J A;  3ZBD A;  2XDB A;  5CKF A;  4XU2 A;  2P0K A;  4FL6 A;  4XTX A;  3ER0 A;  3CCJ A;  1N9S A;  2DXB A;  2BKD N;  1W2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...