2RD1A

X-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
TNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the protein Q7CQI7.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Structural genomics, unknown function
molecule keywords Putative outer membrane lipoprotein
total genus 5
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rd1A00
4EMKB 2E10A 4M7AG 3FIFA 2RD1A 4PJOC 3RIRA 4XU0A 2EWNA 4N0AC 5GAN2 4PJOD 3PGGA 4QVCA 3JCMg 4X9CA 4J6YA 3V8LA 5GANg 4A53A 3JCMJ 3BDUA 1TH7A 2DZ9A 3JCMQ 3JCMb 3GIBA 1KQ1A 1X01A 1B34A 2FB7A 2JN0A 4M77F 4XU2A 3RKWA 3JB9I 2I2LA 4HA8A 4J6XA 3RESA 2DTHA 2FYKA 4JUVA 4OP0A 4C92C 1LNXA 4M78A 4WF2A 4C8QG 4M75B 5LJ5g 4V2SA 4M77C 4XTZA 1KQ2A 4C92D 4PJOB 4QVDA 3VU3C 1D3BB 5GAN4 1I81A 4EMKA 4F7UA 3QO3A 5GAOn 5GAN7 4M75D 4PJOG 2EAYA 4M7DG 2CGHA 3JCMf 3JCMV 4F7UG 3JCMW 4M7DF 4HT8A 4M75A 4RCBA 5LJ5j 3JCMe 4M78D 1I8FA 3JCMh 4JLIA 1D3BA 1JRIA 4M78G 3SWNC 1B34B 4F7UB 3RUXA 4C8QB 4M7DC 4MMKA 3V8KA 4C92E 1M5Q1 2EJFA 3SWNA 2E1HA 4C8QF 5GMKj 4M78B 3HFNA 2RB6A 1M8VA 5GANj 1HXDA 5GAOl 4M77G 4M75E 5LJ3h 1BIAA 3V7RA 3V7CA 2DJZA 5LJ3e 5GAN5 5GAOm 1WQWA 5GANd 5GAMh 3QSUA 3JCMP 1MGQA 5LJ3f 4C92F 5GAMe 4XTUA 1U1SA 1WQ7A 4NL3A 3INZA 1N9RA 2DZCA 2RA2A 3V7SA 5GAMf 4PJOA 4M7DD 4HT9A 4Y91A 1LOJA 2ZGWA 5GAMj 4J6WA 1JBMA 1LJOA 3HSBA 4M75F 3L1AA 4M7DA 4M78F 4JRKA 4XTXA 1U1TA 3FJPA 2DKGA 5LJ3j 5GAOp 2VXEA 5GMKl 2E41A 4M7AB 1H641 1BIBA 5GANh 4M77B 4X9DA 4F7UF 1N9SA 3BFMA 4M75C 5GANe 5GMKh 2QTXA 4NOYA 2Y90A 4C8QD 5GMKm 3JB9J 1WNLA 3QHSA 4XTWA 4EMHA 4M7AE 2YHTA 5GANf 4J5YA 3SB2A 2HNIA 3RKXA 5CAIA 5GAN6 5DY9A 2DXTA 3JCMX 4EMKC 2DTOA 2DVEA 3M4GA 5LJ5h 4M7DE 5LJ3g 3L2ZA 4XTVA 5GAN3 4A54A 4C92A 3QUIA 5GAMg 5LJ5f 4M77E 4RCCA 4M78C 1WPYA 3HFOA 4C8QA 4PJOF 5LJ5e 2DEQA 5I21A 5GAOq 3JB9D 1I5LA 1I4K1 2RM4A 1HK9A 4C8QE 5LJ3d 3JCMc 5LJ5d 2VC8A 2DXUA 2YLBA 2K57A 5GAMd 4XTYA 3FB9A 2VXFA 2E65A 3JCMd 5GAN8 4M7AF 4M77D 4XQ3A 4N0AA 3V8JA 4PJOE 1YCYA 4JRIA 4PNOA 5GMKe 4F7UE 3JB9F 4EMGA 3RERA 1Y96B 4M77A 2EJGA 2YLCA 3BY7A 3EFSA 4XU3A 4NL2A 3EFRA 4M78E 2E64A 4M7DB 4M7AC 3JB9H 4DQ2A 4C92G 4C8QC 4M7AA 3SWNB 5GMKi 3AHUA 5GAOr 3BW1A 4XU1A 3RKYA 1Y96A 4MMLA 3JB9G 2DTIA 4C92B 4M75G 2EJ9A 4M7AD
chains in the Genus database with same CATH superfamily
2D1XA 2K9GA 4JJDA 4WCIA 2LNVA 3OBWA 3S3OA 3OYLA 2CP2A 1SRLA 1UGSB 1U5SA 3BDLA 4XAXB 1HD3A 2V8JA 1BI2A 3CMAA 3SEMA 4Y92A 3FJ5A 3CMAT 2HEQA 1K76A 3RBBB 1YHQQ 3CC7A 4CC3A 1BKBA 4HCZA 2X4XA 1WZOA 2E12A 1M90R 4RTWA 2FYKA 1CKAA 4WF2A 1VQMQ 2DYIA 1XQHA 3QG1A 3CCLA 5GAOn 1YJ9T 1WJQA 1LCKA 4BD3A 3NTHA 2CP0A 3JCMW 3T9NA 1VQ5A 1I8FA 3GF5A 2PUKB 1D3BA 1VQLQ 1PHTA 3J81E 1QKXA 2RHUA 1GXIE 1PCXA 1ABQA 3E2UA 4C92E 1M5Q1 3VUBA 4C8QF 4J83A 3G71Q 2O01E 2JM9A 3I9QA 2M02A 4OVAA 3CCVA 2BZXA 2MCNA 1UGVA 4DOWA 3JCMP 2QG9B 3HRUA 1K4US 5AYFA 2WSEE 4FU6A 1W1FA 4PJJA 1WX6A 1Y7XA 1TOVA 4RUGA 2YDLA 1M1FA 1Y07A 5CK9A 5IT9E 2RI5A 3G6EQ 2Y4YA 1WXBA 1QVFS 4F14A 3TCJA 5J26A 1H641 1N9SA 3OSSC 2B86A 1GBRA 4KT0E 1YN8A 2HDAA 3NPFA 2K5IA 4QKUA 1FMWA 2FPDA 1M9SA 2XI9A 4HCKA 2R5AA 5FRNA 2GTOA 2MF2A 3OW2P 2VC8A 2RNAA 1K73C 2ROTA 3LGLA 2GNCA 1I07A 4E7SA 1SPKA 4M77D 4XQ3A 4N0AA 3RERA 4J8OA 2RHZA 3CBMA 3CEYA 4M7DB 4M7AC 2DXCA 2EYZA 1ZX6A 2EJ9A 2ZAEA 2FPEA 2EWNA 4IIOA 2QASA 2MIOA 3E19A 3OS2A 4PJNA 2RPNA 4E7JA 1YITA 4KULA 3JCMQ 1G8XA 4DEYA 1M90C 2GFAA 3N5BB 5D6YA 1ZSZA 1RUWA 2QQ9A 3OS0A 4JRPA 4ZGDB 4V2SA 1W70A 2DX1A 3EG1A 4QQDA 1YI2T 4IUUA 1QVGS 1M3CA 3EG0A 1AZGB 1PKSA 2RHXA 3P8BB 1RI9A 1D0XA 1UG1A 3CD6T 2HBWA 1AZEA 2RH2A 1BBZA 1UHCA 3THKA 4M78B 5FU6B 2W10A 4BB7A 5LJ3h 1BIAA 2QDLA 5LJ3e 5GAOm 3M0UA 3QZ9B 3QSUA 3GLXA 1ZUYA 1MMNA 3CCSA 2BIVA 3JRZA 4K11A 3PTAA 4HCCA 2D8JA 2PVOB 1VQPA 3OMCA 5GAN6 2LQ8A 1OEBA 4ORZA 1H3HA 1K8AC 4FW2A 4PK4A 5LJ5f 4C0GA 1UGQB 4RCCA 4M78C 2RI3A 2HCKA 4FL6A 5I21A 2ENMA 5IXFA 5FU6C 4EPCA 3I56Q 4M7AF 4XU3A 2COZA 3EFSA 1YNZA 1ZQ1A 3OW2A 1KIKA 2ECZA 3JB9H 4RTZA 2EVRA 5HKCA 1TUDA 3HRSA 1WXUA 3CPFA 3JB9G 4Y91A 4PJOD 3GP8A 1WHMA 1WI7A 2XHCA 1RAIB 4R55A 2YUPA 2GGRA 4OGEA 2RQWA 1D1AA 2YUQA 5GANg 3R6NA 2RK2A 2V1RA 4J9GA 1Q82R 2MMPA 1YHQA 2GF7A 3H6ZA 4OF1A 4R0KA 1PD1A 2LX9A 4HA8A 4DBQA 2QEXT 1R77A 2F5TX 1LNXA 2CSQA 2OAWA 1Q86R 5EG2A 3CCQA 3CC2A 2FZGB 2GQIA 1KHIA 4KGXB 1ZBXA 1EZZB 2PVDB 3CMET 2F2VA 3A8HB 5FROA 4RCBA 4KBMB 3M5AA 1VQLT 2HL3A 5KYYB 1QWEA 2E1HA 4J9DA 5D7UA 5GMKj 1Q82U 3L2QA 1QW1A 2P0KA 4OMNA 5CKEA 2KRMA 1A0NB 4Y28E 2R58A 1U06A 1WQ7A 2DZCA 2JS2A 1PKTA 4FIBA 2L5QA 1YJNA 1EFNA 3CBPA 2E41A 3LX7A 2AZVA 2X4WA 4X9DA 4D8KA 1Y71A 1WNLA 2DXBA 4M7AE 1RAGB 3S3MA 4OB3B 3TU4K 3J80E 1VQ4T 1JEGA 1VQ4A 1TU0B 2KK4A 4MZTA 2LC4A 3HFOA 3C12A 2FRYA 4DBRA 5LJ3d 5LJ5d 1TG0A 3EGUA 2CZ1B 4Z8AA 1G3WA 2EQJA 1DJ7B 4JRIA 4LUEA 3FC3A 2XDBA 1RAAB 1R0BG 1VQ8A 1BCMA 3EFRA 3QYGB 2OAUA 4FW1A 4OMQA 4LXCA 3CCVQ 1YI2Q 3AHUA 1Y96A 2K5LA 2JNGA 2NUPA 4EMKB 5HK0A 4M7AG 2C0IA 3VJPA 1JJ2S 1YCSB 4ELZC 1VQ5T 2DZ9A 4IUVA 1KQ1A 1X01A 1KHCA 3CCJT 1KQSP 1MV0B 2CP6A 2LCSA 4M78A 1K9MR 2CT3A 4PKCC 3RMQA 3EAEA 3MP1A 1GCPA 3OYYA 2VB6A 4M75D 3OYNA 4ATOA 3MEUA 1KD1R 2LRQA 4J9BA 1MMAA 3SWNA 2OTLT 4OMFB 4KRTA 2JT4A 5GANd 2FZKB 4RKUE 2D0QB 5GAMe 4IUTA 1K9MU 4RG2A 4FYXB 3TSZA 5GAMj 3EH2A 4XTXA 3CCUT 1YIJQ 4M75C 3CMEQ 2ESWA 2KE9A 2HNIA 3X20B 2MOXA 5CAIA 3JCMX 3TSWA 2JTFA 4XTVA 3OY9A 2GTJA 3FEOA 5EC7A 2DVJA 1K9MC 5CCAA 4C8QA 3JB9D 5IN1A 2RM4A 1RAEB 1S72Q 1NJIR 4R56A 3M0SA 5GAN8 1BCOA 1OU8A 2CP3A 2YLCA 4BY6C 1Y57A 1UJ0A 4PL6A 2XDDA 4ZNXA 2LDMA 2I0NA 1G3SA 2D8HA 1YI2A 3G7ZA 2DL8A 1QP2A 1OULA 1MMGA 3VKIA 1MNEA 1ZSZB 4CC4B 3G6EA 2X4JA 2FPFA 1N6AA 3JAME 4JS4A 2RHIA 3EG9B 2JN0A 5KYYA 1SHGA 3CC7Q 1TSFA 3M55A 4M77C 4J9EA 5KCOA 1YJ9A 5GAN7 4HVVA 1KSWA 4PJOG 2CGHA 3ME9A 3R6OA 5LJ5j 3CCST 2PVGB 4JJNK 4M78G 2A3LA 5L23A 1LPLA 2AIRB 1W2BA 3QXEB 5D6WA 1IO6A 2O9VA 5KE2A 2E70A 1Q81C 1SG5A 5GJVB 2YXYA 5A0DA 4E7LA 1BU1A 4MDWA 3CC2Q 2F2WA 1YFNA 1Q86U 2EIFA 4LDVA 4J6WA 2CP5A 1U1TA 5GAOp 5GMKl 5GANh 4M77B 1VQOT 2LT1A 1ZHIA 2V8KA 3CCEQ 2ABLA 2KVQG 3FLGA 1GBQA 1YIJA 3I5RA 2JUFA 2DE0X 2DVEA 4M7DE 5LJ5h 1KC8R 1GFCA 1W6XA 4A4FA 1R8OB 2PU9B 2DA9A 2FO0A 3HL8A 3WXMB 2BZYA 1HK9A 1SEMA 5KYNA 4KUIA 2IG0A 1QMCA 1WXTA 4N4HA 1AWXA 3V8JA 2CT4A 4F7UE 3MJXA 3QJYA 2BTTA 4LDUA 1G5VA 5I2MA 1VQKA 3UATA 3LGFA 1OX9A 2ZPBB 3PNWC 2YUOA 3M54A 1AD5A 3CPWA 4MMLA 4HVWA 1VQ9T 1AWJA 1M1KU 3CCMT 4J6YA 2PUOB 4A53A 4JPBW 3A8GB 2RMOA 1IHVA 1B7TA 4OP0A 4M75B 1V76A 2EKHA 4EDUA 1K8AR 3VS3A 4E6RA 4B9XA 2BE7D 3OA6A 2CDTA 3JCMV 2HZYA 2RO0A 1VQKT 4HT8A 3UA6A 3L2RA 3CCMQ 5FWBA 3GPLA 5I22A 5A0LA 3PMIA 1I1JA 1RL2A 4N4GA 2YRVA 3MO8A 2Z0WA 1FMKA 4KGVB 4Q5WA 3TQ7P 5KYUB 3V7SA 4FSXA 1TUGB 1K8AU 1D09B 2LCLA 3FJPA 3CMAQ 2X3WD 3E9GA 2WACA 5IXBA 5GMKm 2LQNA 2YRDA 2JZ2A 2XU8A 2DL4A 2DXTA 4EMKC 2QK0A 3VS7A 4JLGA 1GRIA 4JRQA 4PJLA 1KD1C 1KK7A 1OPLA 2CYZB 4IUPA 1YHQT 2KDSA 6AT1B 2DBMA 2P4TA 4L6V5 2ROLA 3CCQT 3CC2T 1HSQA 4BUGA 2EFIA 1VYVA 4E7HA 1VQOA 1F1BB 1NM7A 2D6FA 1Y96B 2AHJB 2KYMA 3CBOA 5KYXB 2NUPB 3OYHA 1M2VA 5DM7R 1N8RC 2E64A 1X2KA 4DQ2A 4C92G 1LVKA 5CVIA 4DEXA 4XU1A 1V29B 2DYBA 2O88A 4X34A 5AT1B 3MP6A 3PGGA 2L0AA 3DLLA 2QA4A 4E7IA 2EGCA 2H3JA 1ZUKA 4KGZB 2LNHB 2FZCB 2DM1A 1RI0A 4C8QG 2JMCA 2A36A 3M56A 3P8HA 2NWMA 1YJNT 3ZFJA 8AT1B 3KUFA 3OYEA 2KEAA 2ED1A 1K9AA 1N8RU 2BZ8A 1ZA2B 2C0OA 1B34B 3MEAA 3QWXX 1IZ6A 2EQMA 4A4HA 3CC4A 1OI1A 4L5GA 5KE3A 1GFDA 5GAOl 1QCFA 4QQ6A 4FYWB 3X26B 1FYNA 4AFQC 4C5EA 3VYHB 1X6OA 1G83A 1LOJA 3S6WA 2X35A 4M75F 1T0HA 1Q7YC 2VKNA 4GLMA 4TVRA 2OTJA 2NYSA 3SB2A 2P84A 2DTOA 2DILA 3ER0A 1YJWQ 3LWIA 1FMVA 1OV3A 3X24B 1BK2A 2ZPHB 5M9OA 1YIJT 4C8QE 2YUNA 5HCKA 2RHYA 2OX7A 4HVUA 1ZSGA 3BE3A 4A63B 2DK3A 1K0XA 1QWFA 3MHXA 3CC7T 2DAQA 3VS0A 1VQ6T 4C8QC 3HHTB 2PTKA 3DB4A 3HP9A 4A4EA 2VGMA 2VVKA 2FG0A 3CQTA 2HQXA 3V8LA 4B9WA 2QDYB 1I0CA 2QQAA 3JB9I 3RESA 4GBQA 4C92C 1YP5A 1X6BA 3H0HA 1VQ6Q 2X51A 1P92A 1K73R 1KFZA 2P4RA 3UDCA 2L3RA 2HMAA 3P8DA 1M1GA 3SWNC 4MMKA 9ATCB 2DETA 2QA4T 1PG5B 2QEXQ 4ZTJA 1VYUA 3Q1JA 4M7DD 2FRWA 3OYFA 1IB8A 4ZTFA 2LQKA 3JB9J 1VA7A 3QHSA 3UA7A 4EMHA 1VQ9Q 2RJEA 1WFWA 4Z02A 1H92A 5IH2A 3D7SB 3C4SA 2K7AA 2QXFA 3G1JA 2RJDA 4PFOA 1JJ2P 1JU5C 1IRXA 1RAHB 3EG3A 2XK0A 2CREA 2IPOB 1M27C 2O31A 4IUQA 3EHQA 1QVFP 3JB9F 1X2QA 1NYGA 2KNBB 4D8DA 4GLKA 1UHFA 1UFFA 2RK1A 5DLQE 1O75A 2HKQB 4M77E 3L2WA 3NTIA 2E5KA 5IHIA 3H8ZA 1G3YA 1WJSA 1S72T 1TH7A 3PE0A 5KCHA 3GIBA 4WTOB 2GFUA 4QT7A 4J9CA 3RKWA 1B34A 4XU2A 2OTJQ 2IIMA 2J7IA 1X75C 4D6WA 1T3SA 2M51A 5LJ5g 1YITT 2SEMA 2KGTA 4C5IA 2D9TA 3M0TA 2KY9A 3CC4T 1WHLA 3OYBA 5IAYA 5CKDA 1NJIC 3JCMf 3GNGA 2MWPA 4M75A 4XK8E 5I2SA 1EX4A 1JRIA 2LCCA 1E6GA 3LWHA 4EIKA 1SF9A 1H8KA 3OQ5A 3M0QA 2COYA 2G3RA 3V7RA 1VQ4Q 2EYYA 2KSSA 1FWZA 4XTUA 1OYXA 1R0CB 3ULRB 4RTXA 2VASA 4J7FA 3A1PA 1M8MA 2FEIA 2KROA 4OMMA 5LL6S 2KRSA 4NOYA 5CKBA 2RJCA 3OYCA 3CCJA 4RG8A 1WLPB 4J5YA 5ECAA 5CKHA 3QWYA 1AVZC 4BDYA 1Z9QA 5J39A 4JDSA 4A54A 3QUIA 2OI3A 2QGGA 1MHNA 5CR2A 3OYKA 3CCRT 3VS4A 3KXTA 5IHNA 1Q82C 1OZ2A 1SKUB 2EKOA 2VXFA 2XG8D 3I35A 2CZ7B 2XIDA 1AEYA 2E3IA 4EMGA 3QPHA 3M53A 1RLPC 2DL3A 4QQGA 1HYOA 2J6KA 2O4XB 4F16A 3X25B 5GMKi 2RQVA 1UEBA 3MP8A 2J06A 4M75G 4M7AD 4J9IA 4OB0B 1M2VB 1OZ3A 1RACB 2DO3A 2DRMA 4Z89A 3JCMg 3O5ZA 1YJWT 4KH0B 3CCUA 1PC0A 1M90U 1VIEA 1AWOA 2IVWA 2J6FA 2I2LA 2XDPA 2F5KA 2DTHA 4MZPA 1RABB 2O9SA 3OYIA 4C92D 3EG2A 1I81A 1ZA1B 3FDRA 1OPKA 2KXCA 2A0FB 2DPPB 2EAYA 2L3QA 4ME7A 2EYXA 4C0ZA 3EGDA 2EQKA 4E7ZA 4IKFA 2LJ0A 1TS9A 3JCMh 3OS5A 2LJ3A 1VQ5Q 1VQ7Q 3V8KA 2NLUA 4J7IA 3M0PA 1KQSA 2NUZA 1NEBA 3V7CA 2JS0A 1WQWA 5GAMh 2QQBA 2K3XA 2E5QA 3OSVA 2A7YA 3INZA 1KJWA 3VRYA 4DBFA 3RNJA 1JJ2A 1OU9A 3OBYA 4OB2B 2EGEA 4M78F 3H9NA 2LP5A 3VS1A 3OW2S 1M2OA 2L89A 2EGAA 5HY6A 2QTXA 3TREA 2Y90A 1WHJA 4AFUC 2DEUA 3KBGA 5GANf 2L3PA 3E9FA 3TEEA 3OB9A 3GOXA 3MCAB 3URGA 1PM3A 1VYTA 5DLOA 3VV0A 4C92A 3OYDA 2KI7A 3CPWP 2RN8A 3NMZC 3EGXB 3CD6Q 3CCLT 1HJDA 4BI8B 4P5NA 1AWWA 1UGPB 4FYYB 1KD1U 4DOVA 2GBQA 4ZGJB 4FM4B 5CQXA 1WA7A 8ATCB 2K4YA 4HXJA 5GAOr 1X43A 3RKYA 3CXCP 2MK5A 1BI3A 3VUZA 4F17A 2K6DA 4XU0A 4LDXA 4OGCA 2ZPEB 1QCNA 3BDUA 3F70A 2QTVA 2P0PA 2DL5A 4HCBA 3C94A 3OMGA 4AFSC 5FLXE 4PJOB 1YJ9Q 4PFZA 1YJNQ 1PD0A 4JLIA 2XICA 1NBEB 1BB9A 3CCET 2O2OA 3CC4Q 4M4ZA 1Q81R 3L2VA 1M1KR 4M75E 3EFOB 5GAN5 2LTOA 2PNIA 3A98A 4LDYA 5LJ3f 1QLYA 4FT4A 2EW3A 3QDFA 1RADB 2HQHA 1OQKA 2VXEA 1PRLC 2K79A 1OX8A 3CCUQ 4UC4A 1PSEA 2D0NA 2DL7A 1EIFA 3DLMA 2YHTA 5FWCA 3CCQQ 3L2ZA 5GAN3 3WVEB 1M3BA 2LT4A 4IURA 3MEVA 1TTHB 3LLRA 2O4XA 1KC8U 2K3BA 4OB1B 2DBKA 2KBTA 5GAMd 1VQ7T 3EG9A 3FRNA 1NPPA 3RMSA 2DERA 1W4SA 3JCMd 2VWFA 4PJOE 1YBYA 3UWNA 1VQNA 1VQNT 2EJGA 1UECA 3A8LB 2DIGA 4CC2A 2HL5C 4M78E 3A8MB 3LH5A 3ZL7C 5C6SA 4AFZC 1NJIU 1OOTA 2JTEA 4J9FA 1T3LA 3NTKA 2YWWA 3BW1A 1QKWA 4X1VA 2QQSA 1NEGA 4AG1C 4E7KA 3FIFA 4PJOC 3X28B 4N0AC 3MEWA 4QVCA 3H41A 3RR6A 3OS1A 1YWPA 4BE2A 1KG1A 1D1CA 5GJWB 3CMEA 2HAXA 4JUVA 1J3TA 1BI1A 1UE9A 1M1KC 1D1BA 3REAB 3QYHB 4XTZA 3QJ6A 3VU3C 4EMKA 2NUTB 3QO3A 3M0RA 5KYWB 1VOMA 3TVTA 2ZCFB 1WDXA 4M78D 4JZ3A 1X6GA 4IIMA 2BUDA 1WIEA 4JZ4A 3RUXA 1VQ8Q 3GBQA 3G71A 1UJYA 4HKEA 2FL7A 2A28A 1AOJA 1M30A 1HXDA 4M77G 2C06A 4RTTA 1IGQA 2DJZA 2X3XD 4C92F 3PFSA 3NHNA 1WHGA 1ARKA 4BI3A 3CCRQ 1LJOA 1VQLA 5LJ3j 4II1A 4M7AB 1JB0E 2P0QA 2M9UA 2DLPA 1Q95G 4ZGEB 1AHJB 4A4KA 3QKJA 3H0IA 1XNIA 5A2QE 3A5ZB 2QQRA 4KUDK 1QP3A 2H8HA 4FYVB 3VRZA 1I4K1 1AT1B 1E6HA 2JVVA 2HD0A 3JCMc 2BKDN 3META 1ZLMA 3CCMA 2YT6A 3FB9A 3G4SA 3CCJQ 3CCEA 4PNOA 3I55T 4YTLA 1VQOQ 2RF0A 1IHWA 3DKMA 2M1HA 2DD5A 4NL2A 3L2UA 4BDZA 2EQIA 2JJ9A 2VV5A 1PRMC 2ED0A 2DTIA 2VUBA 5FU7C 2DNUA 1GL5A 2JOYA 1K0SA 2E10A 3RIRA 3EFOA 1WYXA 3C95A 3CD6A 1S72A 5HK3A 4BE1A 2MYSA 4BACA 2XKOC 4PJMA 1YITQ 1JQQA 3JCMb 1SHFA 2PZ1A 2FB7A 2YRCA 2LVMA 4DA4A 1QVGP 5FRMA 4JJBA 2RJFA 4QVDA 5GAN4 3PT9A 4F7UA 2OTJT 4OMLA 2M0YA 2ZZDA 1CSKA 1VQMT 3PVLA 4BY6B 4ZN3A 4M7DF 3GNFB 4JJCA 1TWBA 3MKDA 2CUBA 2Y4XA 3EHRA 1WGSA 3J7AF 3KFVA 2EJFA 2KT8A 1XTDA 4QVZA 1C6VX 3HFNA 5GANj 4LD6A 3L42A 5CQYA 3LYIA 4PLLA 1XJWB 1MUZA 2JW4A 4NL3A 3UPUA 1WJRA 5IHKA 2W0ZA 1FXXA 1JBMA 1NPRA 3L1AA 4M7DA 2DKGA 4RTUA 3EGDB 4ZN1A 3VS6A 3BFMA 2OTLA 2MWOA 2YSQA 3RKXA 5DY9A 1VQPQ 2MI6A 3C0CA 4FT2A 3EGXA 1QVGA 3PVQA 1YJWA 5L8RE 2H3EB 3QZ5B 3OYGA 2CP7A 5GAOq 2CKKA 2MPXC 2DFUA 3CCVT 4JS5A 2FVUA 3UF4A 4OMPA 1YCYA 5KYWA 2QEXA 1K1ZA 3EH1A 3H0FA 2GCXA 2CUDA 2HBPA 2LMJA 2PQWA 4CI0C 1IXDA 1T0JA 2A08A 5C0MA 2KT1A 4LN2A 4C92B 1JO8A 2NUTA 2RD1A 5I11A 2F1LA 2MAMA 2HSEB 2E4HA 2KYBA 4F04B 1W2BP 2LZ6B 4AMCA 3G4ST 3I56T 1C1AA 3DB3A 1I5OB 1ZBJA 4C0FA 3AT1B 5D6XA 1V1CA 1FX7A 1KQ2A 1TUCA 3VYGA 1D3BB 1GCQA 4M7DG 1PSFA 3REBB 2DJQA 2BE9B 1SSHA 2K2MA 4RTVA 2CSIA 3CPWS 4ELYC 1D0ZA 1XOVA 2GQVA 1S1NA 2M0OA 4J9HA 1M8VA 3SFMA 4L59A 2EYQA 2A37A 3HTRA 4MDXA 1JXOA 1TXQA 1ZUUA 3NGPA 2RA2A 3CXCA 4PJOA 2DRKA 2QI2A 4E47A 4JRKA 1Q7YR 4CC7A 1VQ7A 2K5FA 2JM8A 3G6ET 1VQPT 1SSFA 2ZPFB 2OTLQ 2EYWA 3VS2A 1X69A 2VYTA 5KYUA 1H3ZA 1VIFA 1VQ6A 3M59A 1ABOA 3I55A 1WHHA 1UDLA 4O6JA 4NS5A 1N5ZA 1Q81U 4KH1B 1IREB 2DXUA 3RDVA 2CH4A 3S3NA 2DIQA 4AG2C 3M58A 3G4SQ 4GY5A 2E65A 1RLQC 2LQWA 2OJ2A 4N4IA 4PLIA 3HRTA 4M77A 3SD4A 2RI2A 2KMTA 4C0DB 3M9QA 4LUDA 3M57A 1UTIA 4LNPA 2CZ6B 2AKKA 4PFPA 4B6MA 2HSPA 1Y0MA 3CCRA 2DMOA 4X9CA 1KQSS 3JCMJ 2E6ZA 2KQWA 2ZPIB 1UB4A 2EQUA 5J3BA 2E3HA 4J6XA 2KR3A 4QW2A 1G3TA 1ZSZC 2K2VA 1N8RR 1YWOA 4E2FB 3I5SA 1UGRB 2V26A 2RQTA 3E1SA 3JSCA 1Z9ZA 2COWA 1SRMA 1MMDA 3CCSQ 2V1QA 1PWTA 4RMOA 1UUEA 2CZ0B 2QA4Q 2L8DA 2RB6A 1VQMA 1NLPC 1ACMB 1MNDA 2J6OA 1KC8C 1U1SA 2HQEA 3I55Q 5CKFA 2K3YA 2X9HA 4HT9A 2ZGWA 3WVDB 1D0YA 4LDWA 1BYMA 1MV3A 4LD9K 4FSSA 2DD4A 1QQJA 1BIBA 1VQ9A 5GMKh 3M4YA 1WHKA 5GANe 3I56A 4XTWA 5FU7B 2AK5A 2ATCB 2R57A 2E6NA 1QVPA 4Z88A 5GAMg 3ASKA 4C0DC 5CO7A 1WPYA 4PJOF 1G2BA 3PIPA 3A8OB 2EPDA 1NG2A 1PNJA 2JMAA 3UT1A 3PIOA 2V8IA 2RQUA 2XMFA 4MZMA 5KH6A 2JXBA 4LE9A 3BY7A 3OYAA 1VQ8T 1QCOA 2DF6A 2R5MA 4VUBA 2EBPA 3SWNB 2HKNA 2FHDA 3U23A 1QVFA 3QBYA 3HKSA 4O5VA 5GAN2 3SHWA 3CXCS 2AT1B 4CRIA 1N27A 1NE8A 1Q86C 4OMOA 4RTYA 4AT1B 4M77F 4C5GA 2X4YA 2QAZA 2J05A 2L2PA 3CCLQ 3LH0A 4ANJA 5KYXA 3OYJA 1C0MA 2AZSA 2QGFB 2LJ1A 2ZPGB 2F69A 4F7UG 3JV3A 2CS7A 3JCMe 2KAFA 3NFCA 3VS5A 3OYMA 1B3QA 4F7UB 4C8QB 4M7DC 3ZEHA 2QYZA 2XD0A 3G71T 1E7OA 2KRNA 2JTMA 1K73U 1BI0A 1NZ9A 1O9SA 3MPUB 1M4ZA 1MGQA 2M16A 4BI4A 1N9RA 5GAMf 3QDRB 2B8AA 4C5HA 3HSBA 1VUBA 3SDZA 1IGUA 3HPWA 4FCYA 1RAFB 1CKBA 4F7UF 1VQNQ 4ESRA 4C8QD 2CH4W 1NLOC 2VGNA 2WSCE 3LW5E 2SRCA 3ZBDA 4A4GA 1Q7YU 4DBHA 1VQKQ 1GCQC 3M4GA 5LJ3g 5FW9A 1X27A 2G6FX 1NYFA 1W2BS 5A0GA 1JXMA 2C0TA 5LJ5e 2DEQA 1I5LA 3O8VA 2LX7A 5CIUA 2AKLA 1B07A 2RQRA 2YLBA 2K57A 3PMTA 4XTYA 2WSFE 2F2XA 5GMKe 3IQLA 1U8RA 3QIIA 7AT1B 1M3AA 4M7AA 2L3SA 2KXDA 4BE0A 1U3OA
chains in the Genus database with same CATH topology
2E10A 3VKIA 3NTIA 3G6EA 2X4JA 3H8ZA 2LNVA 3RIRA 1G3YA 1WJSA 3OBWA 3C95A 3S3OA 3CD6A 3OYLA 1N6AA 1S72A 1S72T 1UGSB 3JAME 5HK3A 3BDLA 4XAXB 4BE1A 2V8JA 2XKOC 1BI2A 1TH7A 3CMAA 3JCMb 5KCHA 4JS4A 4BACA 2RHIA 3CMAT 3GIBA 2GFUA 3CC7A 3RKWA 1B34A 1BKBA 2FB7A 2JN0A 4HCZA 4XU2A 2X4XA 2E12A 2LVMA 4DA4A 2FYKA 1X75C 4D6WA 3M55A 4WF2A 5LJ5g 1YITT 1XQHA 4M77C 3QG1A 5FRMA 3CCLA 2RJFA 4QVDA 4C5IA 5GAN4 3PT9A 4F7UA 2D9TA 5KCOA 5GAOn 2KY9A 1YJ9T 5GAN7 3CC4T 1WJQA 1YJ9A 4BD3A 2ZZDA 4PJOG 5IAYA 5CKDA 3OYBA 3NTHA 1NJIC 2CGHA 1VQMT 3JCMf 3GNGA 2MWPA 3ME9A 3JCMW 4BY6B 4ZN3A 3T9NA 4M75A 4XK8E 4M7DF 5I2SA 3R6OA 5LJ5j 3GNFB 3CCST 2PVGB 1VQ5A 1I8FA 3GF5A 2PUKB 1D3BA 1JRIA 2LCCA 2Y4XA 4M78G 2A3LA 3J81E 3LWHA 4JJNK 1WGSA 2RHUA 3J7AF 1GXIE 4C92E 1M5Q1 2EJFA 3VUBA 4C8QF 1XTDA 4J83A 4QVZA 3HFNA 3QXEB 5D6WA 5GANj 1W2BA 2O01E 4LD6A 3OQ5A 3L42A 5CQYA 2G3RA 4OVAA 5KE2A 2E70A 3CCVA 1Q81C 3LYIA 3V7RA 4PLLA 5A0DA 4E7LA 4DOWA 2KSSA 1FWZA 4MDWA 3JCMP 3HRUA 4XTUA 5AYFA 1OYXA 4NL3A 2WSEE 3UPUA 1WJRA 4FU6A 2EIFA 4LDVA 1Q86U 1Y7XA 1FXXA 1M1FA 1Y07A 4J7FA 5CK9A 4J6WA 1JBMA 1NPRA 2RI5A 5IT9E 3L1AA 4M7DA 2Y4YA 1U1TA 2DKGA 5GAOp 1QVFS 5GMKl 3TCJA 5J26A 1H641 5GANh 4M77B 4ZN1A 1VQOT 2LT1A 1N9SA 3BFMA 3OSSC 1ZHIA 5LL6S 4NOYA 5CKBA 2V8KA 2RJCA 3OYCA 2OTLA 3CCJA 2KVQG 3FLGA 4RG8A 1YIJA 4J5YA 4KT0E 2MWOA 3RKXA 5DY9A 2JUFA 2MI6A 2DVEA 5CKHA 4FT2A 5LJ5h 4M7DE 2K5IA 4A4FA 1QVGA 1R8OB 4BDYA 5J39A 1YJWA 4JDSA 4A54A 1M9SA 3QUIA 2PU9B 2XI9A 5L8RE 2R5AA 3HL8A 3QZ5B 3WXMB 3OYGA 5FRNA 1MHNA 5GAOq 2CKKA 1HK9A 2MF2A 5CR2A 3OYKA 3CCRT 2VC8A 1K73C 4KUIA 3CCVT 2IG0A 3LGLA 3KXTA 4JS5A 2FVUA 1Q82C 1OZ2A 2EKOA 2VXFA 4M77D 4N4HA 2XG8D 4N0AA 4XQ3A 3V8JA 1YCYA 2CZ7B 2XIDA 2QEXA 4F7UE 4EMGA 3RERA 4J8OA 2GCXA 3QJYA 3M53A 2RHZA 2HBPA 3CBMA 3CEYA 3QPHA 4LDUA 5I2MA 1G5VA 2PQWA 1VQKA 4QQGA 4CI0C 4M7DB 3LGFA 4M7AC 2ZPBB 2DXCA 2O4XB 3PNWC 3M54A 3X25B 5GMKi 5C0MA 3CPWA 1UEBA 3MP8A 4MMLA 1VQ9T 4C92B 4M75G 2EJ9A 4M7AD 1M1KU 4OB0B 2RD1A 1OZ3A 3CCMT 2EWNA 2DO3A 4C0DC 3E19A 3JCMg 1YJWT 3OS2A 4J6YA 2MAMA 2PUOB 4A53A 3CCUA 1M90U 4E7JA 1YITA 4KULA 3JCMQ 3G4ST 1M90C 3A8GB 2GFAA 1VIEA 3N5BB 3I56T 5D6YA 2IVWA 2I2LA 3DB3A 2XDPA 2QQ9A 2F5KA 2DTHA 4MZPA 3OS0A 4OP0A 4JRPA 4C0FA 4M75B 4ZGDB 4V2SA 5D6XA 3OYIA 1FX7A 4C92D 4EDUA 1KQ2A 4QQDA 3VYGA 1YI2T 1D3BB 4IUUA 1I81A 3FDRA 4B9XA 2DPPB 1QVGS 2EAYA 4M7DG 1PSFA 3OA6A 4ME7A 3JCMV 4C0ZA 2EQKA 2RHXA 2RO0A 3P8BB 1VQKT 4HT8A 3L2RA 4IKFA 3JCMh 3CPWS 4ELYC 3CD6T 2RH2A 1XOVA 3GPLA 3OS5A 3V8KA 2NLUA 5A0LA 2GQVA 3PMIA 4J7IA 2M0OA 4M78B 1M8VA 3SFMA 4L59A 5FU6B 1KQSA 1RL2A 2EYQA 4N4GA 4BB7A 5LJ3h 1BIAA 2YRVA 3V7CA 5LJ3e 5GAOm 4MDXA 1WQWA 3MO8A 3QZ9B 5GAMh 2QQBA 3QSUA 3GLXA 2K3XA 2E5QA 3OSVA 4Q5WA 2A7YA 3INZA 2RA2A 3V7SA 4FSXA 3CXCA 4PJOA 2QI2A 1JJ2A 1K8AU 3CCSA 3OBYA 2BIVA 4OB2B 4M78F 4E47A 4JRKA 3JRZA 2LCLA 3FJPA 3OW2S 2L89A 3E9GA 1VQ7A 2WACA 5GMKm 3PTAA 5HY6A 2QTXA 3TREA 2Y90A 4HCCA 2JZ2A 2XU8A 2K5FA 3G6ET 3KBGA 2PVOB 5GANf 3OMCA 1VQPA 1VQPT 1SSFA 3E9FA 3TEEA 5GAN6 2DXTA 2ZPFB 3OB9A 2LQ8A 4EMKC 3GOXA 4JLGA 3MCAB 3URGA 5DLOA 4JRQA 2VYTA 1H3ZA 1K8AC 1VIFA 3VV0A 1KD1C 4C92A 5LJ5f 1VQ6A 4C0GA 1UGQB 2CYZB 3M59A 4RCCA 4IUPA 2RI3A 4M78C 3OYDA 3I55A 2KDSA 4FL6A 1YHQT 5I21A 4O6JA 4NS5A 1Q81U 1IREB 2P4TA 4L6V5 2DXUA 5FU6C 3CCLT 3CCQT 2DIQA 3S3NA 3M58A 3CC2T 4GY5A 2E65A 4BI8B 4EPCA 4M7AF 4P5NA 4BUGA 2EFIA 4E7HA 1VQOA 2D6FA 1UGPB 4N4IA 1Y96B 4PLIA 3HRTA 2AHJB 2RI2A 4M77A 2KMTA 3CBOA 3EFSA 4XU3A 3SD4A 3M9QA 4C0DB 1KD1U 4DOVA 1ZQ1A 3OYHA 3OW2A 4ZGJB 5DM7R 1N8RC 2E64A 4FM4B 5CQXA 3M57A 3JB9H 4DQ2A 4C92G 5CVIA 5HKCA 2K4YA 2CZ6B 3HRSA 5GAOr 3CPFA 4XU1A 3RKYA 1V29B 3JB9G 4Y91A 4PJOD 3GP8A 4X34A 1BI3A 2XHCA 3VUZA 4R55A 3MP6A 4XU0A 4LDXA 4OGCA 4OGEA 3CCRA 3PGGA 4X9CA 1KQSS 5GANg 2ZPEB 2RK2A 3DLLA 2QA4A 4E7IA 3JCMJ 2H3JA 2E6ZA 2KQWA 2MMPA 2ZPIB 1UB4A 2P0PA 2EQUA 3BDUA 3F70A 2GF7A 3H6ZA 4OF1A 5J3BA 1YHQA 2LX9A 4HA8A 4J6XA 2QEXT 4HCBA 3C94A 2F5TX 1RI0A 1LNXA 4C8QG 3OMGA 4QW2A 3M56A 5EG2A 3P8HA 1G3TA 3CCQA 5FLXE 1YJNT 3CC2A 4PJOB 2K2VA 3ZFJA 3KUFA 3OYEA 1KHIA 1UGRB 1ZBXA 2PVDB 3CMET 3A8HB 5FROA 1N8RU 3E1SA 3JSCA 4RCBA 4KBMB 3M5AA 1VQLT 4JLIA 2XICA 1B34B 3MEAA 1IZ6A 4RMOA 2EQMA 4A4HA 3CCET 3CC4A 2E1HA 1OI1A 5GMKj 2CZ0B 2L8DA 2RB6A 4L5GA 1VQMA 3L2QA 5KE3A 1Q82U 1QW1A 3L2VA 5GAOl 4M75E 2P0KA 4QQ6A 2OTJT 3X26B 5GAN5 5CKEA 2LTOA 4Y28E 4LDYA 2R58A 5LJ3f 1KC8C 1U1SA 1WQ7A 2HQEA 3VYHB 2DZCA 4C5EA 5CKFA 1X6OA 2K3YA 4HT9A 1LOJA 2ZGWA 4FT4A 3WVDB 4FIBA 3S6WA 2X35A 4LDWA 4M75F 1BYMA 4LD9K 1Q7YC 2L5QA 1YJNA 2DD4A 2VXEA 3CBPA 2E41A 3LX7A 1BIBA 2X4WA 4X9DA 1VQ9A 5GMKh 3M4YA 5GANe 1Y71A 4TVRA 4UC4A 1PSEA 1WNLA 2DXBA 1EIFA 3DLMA 4XTWA 2YHTA 3I56A 4M7AE 3SB2A 2OTJA 3S3MA 5FU7B 4OB3B 2DTOA 3ER0A 3TU4K 3L2ZA 5GAN3 3WVEB 3J80E 1VQ4T 2R57A 2LT4A 4IURA 2E6NA 1VQ4A 1QVPA 2KK4A 5GAMg 3LWIA 3MEVA 3ASKA 4MZTA 2LC4A 1WPYA 3HFOA 3LLRA 2O4XA 5CO7A 4PJOF 3C12A 3X24B 1KC8U 2ZPHB 5M9OA 1YIJT 4C8QE 4OB1B 3PIPA 5LJ3d 3A8OB 5LJ5d 2RHYA 5GAMd 2CZ1B 1VQ7T 3FRNA 1NPPA 3RMSA 3UT1A 3PIOA 1W4SA 3JCMd 1G3WA 5FU7C 2EQJA 4PJOE 1YBYA 1DJ7B 2V8IA 3UWNA 4JRIA 2DK3A 4MZMA 3FC3A 5KH6A 1VQNA 1VQNT 3MHXA 2XDBA 2EJGA 3BY7A 3OYAA 3A8LB 3CC7T 1VQ8A 1VQ8T 2DIGA 3EFRA 2DAQA 4M78E 3QYGB 2OAUA 3A8MB 1VQ6T 5C6SA 2R5MA 4VUBA 4C8QC 1NJIU 3HHTB 3NTKA 3DB4A 3HP9A 3SWNB 3AHUA 3BW1A 1Y96A 2FHDA 4A4EA 2VGMA 1QVFA 3QBYA 2K5LA 2JNGA 2QQSA 4EMKB 5HK0A 4E7KA 4M7AG 3FIFA 4PJOC 3HKSA 4O5VA 3VJPA 4N0AC 3X28B 5GAN2 1JJ2S 3MEWA 4QVCA 2HQXA 3CXCS 3V8LA 4CRIA 1N27A 3G7ZA 4ELZC 1NE8A 3OS1A 4B9WA 2QDYB 1Q86C 1VQ5T 2DZ9A 4BE2A 4IUVA 2QQAA 1KQ1A 1X01A 1KHCA 4M77F 3JB9I 4C5GA 3CCJT 1KG1A 2X4YA 3CMEA 3RESA 2HAXA 4JUVA 4C92C 1BI1A 4M78A 1M1KC 3QYHB 3LH0A 4XTZA 3OYJA 3QJ6A 3VU3C 4PKCC 4EMKA 3RMQA 3QO3A 3EAEA 3MP1A 3OYYA 2ZPGB 1P92A 4M75D 3OYNA 4ATOA 2F69A 3MEUA 2ZCFB 4F7UG 3UDCA 2L3RA 2CS7A 3P8DA 4M78D 2KAFA 3JCMe 3NFCA 3OYMA 1M1GA 3SWNC 2BUDA 4F7UB 3RUXA 4C8QB 4M7DC 4MMKA 3ZEHA 2LRQA 3SWNA 2QA4T 2XD0A 3G71T 3G71A 4HKEA 2FL7A 2OTLT 1HXDA 4OMFB 2JTMA 4M77G 4ZTJA 1K73U 1BI0A 2C06A 1NZ9A 1O9SA 2DJZA 5GANd 1M4ZA 4RKUE 3Q1JA 1MGQA 4C92F 2D0QB 3PFSA 5GAMe 2M16A 4IUTA 4BI4A 1K9MU 1N9RA 4RG2A 5GAMf 4M7DD 3QDRB 4BI3A 5GAMj 2B8AA 4C5HA 1LJOA 3HSBA 1VQLA 3OYFA 4XTXA 1VUBA 5LJ3j 4ZTFA 4II1A 3SDZA 3HPWA 4M7AB 3CCUT 1JB0E 4F7UF 4M75C 2LQKA 4C8QD 2VGNA 2WSCE 3LW5E 3QHSA 3ZBDA 2P0QA 4A4GA 2M9UA 4EMHA 3JB9J 2RJEA 2HNIA 3X20B 4ZGEB 5CAIA 3JCMX 1Q7YU 1AHJB 3M4GA 4Z02A 4A4KA 5LJ3g 2JTFA 4XTVA 3QKJA 3OY9A 1XNIA 3FEOA 5A2QE 3A5ZB 2QQRA 3C4SA 4M77E 5A0GA 1QP3A 1W2BS 1K9MC 5CCAA 4KUDK 2QXFA 4C8QA 2RJDA 2DEQA 5LJ5e 3JB9D 3O8VA 1I5LA 1I4K1 2RM4A 5CIUA 5IN1A 2JVVA 2HD0A 3JCMc 2BKDN 3META 2YLBA 2K57A 3CCMA 4R56A 3PMTA 2XK0A 4XTYA 3FB9A 3G4SA 5GAN8 2WSFE 3CCEA 4IUQA 4PNOA 5GMKe 3I55T 3JB9F 4YTLA 2YLCA 4BY6C 3DKMA 2M1HA 2DD5A 4NL2A 4PL6A 2XDDA 3L2UA 1U8RA 3QIIA 4GLKA 4BDZA 2LDMA 2VV5A 1G3SA 2RK1A 5DLQE 4M7AA 1O75A 1YI2A 4BE0A 2DTIA 2VUBA 1QP2A 3L2WA 2JOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMK B;  2E10 A;  4M7A G;  3FIF A;  2RD1 A;  4PJO C;  3RIR A;  4XU0 A;  2EWN A;  4N0A C;  5GAN 2;  4PJO D;  3PGG A;  4QVC A;  3JCM g;  4X9C A;  4J6Y A;  3V8L A;  5GAN g;  4A53 A;  3JCM J;  3BDU A;  1TH7 A;  2DZ9 A;  3JCM Q;  3JCM b;  3GIB A;  1KQ1 A;  1X01 A;  1B34 A;  2FB7 A;  2JN0 A;  4M77 F;  4XU2 A;  3RKW A;  3JB9 I;  2I2L A;  4HA8 A;  4J6X A;  3RES A;  2DTH A;  2FYK A;  4JUV A;  4OP0 A;  4C92 C;  1LNX A;  4M78 A;  4WF2 A;  4C8Q G;  4M75 B;  5LJ5 g;  4V2S A;  4M77 C;  4XTZ A;  1KQ2 A;  4C92 D;  4PJO B;  4QVD A;  3VU3 C;  1D3B B;  5GAN 4;  1I81 A;  4EMK A;  4F7U A;  3QO3 A;  5GAO n;  5GAN 7;  4M75 D;  4PJO G;  2EAY A;  4M7D G;  2CGH A;  3JCM f;  3JCM V;  4F7U G;  3JCM W;  4M7D F;  4HT8 A;  4M75 A;  4RCB A;  5LJ5 j;  3JCM e;  4M78 D;  1I8F A;  3JCM h;  4JLI A;  1D3B A;  1JRI A;  4M78 G;  3SWN C;  1B34 B;  4F7U B;  3RUX A;  4C8Q B;  4M7D C;  4MMK A;  3V8K A;  4C92 E;  1M5Q 1;  2EJF A;  3SWN A;  2E1H A;  4C8Q F;  5GMK j;  4M78 B;  3HFN A;  2RB6 A;  1M8V A;  5GAN j;  1HXD A;  5GAO l;  4M77 G;  4M75 E;  5LJ3 h;  1BIA A;  3V7R A;  3V7C A;  2DJZ A;  5LJ3 e;  5GAN 5;  5GAO m;  1WQW A;  5GAN d;  5GAM h;  3QSU A;  3JCM P;  1MGQ A;  5LJ3 f;  4C92 F;  5GAM e;  4XTU A;  1U1S A;  1WQ7 A;  4NL3 A;  3INZ A;  1N9R A;  2DZC A;  2RA2 A;  3V7S A;  5GAM f;  4PJO A;  4M7D D;  4HT9 A;  4Y91 A;  1LOJ A;  2ZGW A;  5GAM j;  4J6W A;  1JBM A;  1LJO A;  3HSB A;  4M75 F;  3L1A A;  4M7D A;  4M78 F;  4JRK A;  4XTX A;  1U1T A;  3FJP A;  2DKG A;  5LJ3 j;  5GAO p;  2VXE A;  5GMK l;  2E41 A;  4M7A B;  1H64 1;  1BIB A;  5GAN h;  4M77 B;  4X9D A;  4F7U F;  1N9S A;  3BFM A;  4M75 C;  5GAN e;  5GMK h;  2QTX A;  4NOY A;  2Y90 A;  4C8Q D;  5GMK m;  3JB9 J;  1WNL A;  3QHS A;  4XTW A;  4EMH A;  4M7A E;  2YHT A;  5GAN f;  4J5Y A;  3SB2 A;  2HNI A;  3RKX A;  5CAI A;  5GAN 6;  5DY9 A;  2DXT A;  3JCM X;  4EMK C;  2DTO A;  2DVE A;  3M4G A;  5LJ5 h;  4M7D E;  5LJ3 g;  3L2Z A;  4XTV A;  5GAN 3;  4A54 A;  4C92 A;  3QUI A;  5GAM g;  5LJ5 f;  4M77 E;  4RCC A;  4M78 C;  1WPY A;  3HFO A;  4C8Q A;  4PJO F;  5LJ5 e;  2DEQ A;  5I21 A;  5GAO q;  3JB9 D;  1I5L A;  1I4K 1;  2RM4 A;  1HK9 A;  4C8Q E;  5LJ3 d;  3JCM c;  5LJ5 d;  2VC8 A;  2DXU A;  2YLB A;  2K57 A;  5GAM d;  4XTY A;  3FB9 A;  2VXF A;  2E65 A;  3JCM d;  5GAN 8;  4M7A F;  4M77 D;  4XQ3 A;  4N0A A;  3V8J A;  4PJO E;  1YCY A;  4JRI A;  4PNO A;  5GMK e;  4F7U E;  3JB9 F;  4EMG A;  3RER A;  1Y96 B;  4M77 A;  2EJG A;  2YLC A;  3BY7 A;  3EFS A;  4XU3 A;  4NL2 A;  3EFR A;  4M78 E;  2E64 A;  4M7D B;  4M7A C;  3JB9 H;  4DQ2 A;  4C92 G;  4C8Q C;  4M7A A;  3SWN B;  5GMK i;  3AHU A;  5GAO r;  3BW1 A;  4XU1 A;  3RKY A;  1Y96 A;  4MML A;  3JB9 G;  2DTI A;  4C92 B;  4M75 G;  2EJ9 A;  4M7A D; 
#chains in the Genus database with same CATH topology
 2D1X A;  2K9G A;  4JJD A;  4WCI A;  2LNV A;  3OBW A;  3S3O A;  3OYL A;  2CP2 A;  1SRL A;  1UGS B;  1U5S A;  3BDL A;  4XAX B;  1HD3 A;  2V8J A;  1BI2 A;  3CMA A;  3SEM A;  4Y92 A;  3FJ5 A;  3CMA T;  2HEQ A;  1K76 A;  3RBB B;  1YHQ Q;  3CC7 A;  4CC3 A;  1BKB A;  4HCZ A;  2X4X A;  1WZO A;  2E12 A;  1M90 R;  4RTW A;  2FYK A;  1CKA A;  4WF2 A;  1VQM Q;  2DYI A;  1XQH A;  3QG1 A;  3CCL A;  5GAO n;  1YJ9 T;  1WJQ A;  1LCK A;  4BD3 A;  3NTH A;  2CP0 A;  3JCM W;  3T9N A;  1VQ5 A;  1I8F A;  3GF5 A;  2PUK B;  1D3B A;  1VQL Q;  1PHT A;  3J81 E;  1QKX A;  2RHU A;  1GXI E;  1PCX A;  1ABQ A;  3E2U A;  4C92 E;  1M5Q 1;  3VUB A;  4C8Q F;  4J83 A;  3G71 Q;  2O01 E;  2JM9 A;  3I9Q A;  2M02 A;  4OVA A;  3CCV A;  2BZX A;  2MCN A;  1UGV A;  4DOW A;  3JCM P;  2QG9 B;  3HRU A;  1K4U S;  5AYF A;  2WSE E;  4FU6 A;  1W1F A;  4PJJ A;  1WX6 A;  1Y7X A;  1TOV A;  4RUG A;  2YDL A;  1M1F A;  1Y07 A;  5CK9 A;  5IT9 E;  2RI5 A;  3G6E Q;  2Y4Y A;  1WXB A;  1QVF S;  4F14 A;  3TCJ A;  5J26 A;  1H64 1;  1N9S A;  3OSS C;  2B86 A;  1GBR A;  4KT0 E;  1YN8 A;  2HDA A;  3NPF A;  2K5I A;  4QKU A;  1FMW A;  2FPD A;  1M9S A;  2XI9 A;  4HCK A;  2R5A A;  5FRN A;  2GTO A;  2MF2 A;  3OW2 P;  2VC8 A;  2RNA A;  1K73 C;  2ROT A;  3LGL A;  2GNC A;  1I07 A;  4E7S A;  1SPK A;  4M77 D;  4XQ3 A;  4N0A A;  3RER A;  4J8O A;  2RHZ A;  3CBM A;  3CEY A;  4M7D B;  4M7A C;  2DXC A;  2EYZ A;  1ZX6 A;  2EJ9 A;  2ZAE A;  2FPE A;  2EWN A;  4IIO A;  2QAS A;  2MIO A;  3E19 A;  3OS2 A;  4PJN A;  2RPN A;  4E7J A;  1YIT A;  4KUL A;  3JCM Q;  1G8X A;  4DEY A;  1M90 C;  2GFA A;  3N5B B;  5D6Y A;  1ZSZ A;  1RUW A;  2QQ9 A;  3OS0 A;  4JRP A;  4ZGD B;  4V2S A;  1W70 A;  2DX1 A;  3EG1 A;  4QQD A;  1YI2 T;  4IUU A;  1QVG S;  1M3C A;  3EG0 A;  1AZG B;  1PKS A;  2RHX A;  3P8B B;  1RI9 A;  1D0X A;  1UG1 A;  3CD6 T;  2HBW A;  1AZE A;  2RH2 A;  1BBZ A;  1UHC A;  3THK A;  4M78 B;  5FU6 B;  2W10 A;  4BB7 A;  5LJ3 h;  1BIA A;  2QDL A;  5LJ3 e;  5GAO m;  3M0U A;  3QZ9 B;  3QSU A;  3GLX A;  1ZUY A;  1MMN A;  3CCS A;  2BIV A;  3JRZ A;  4K11 A;  3PTA A;  4HCC A;  2D8J A;  2PVO B;  1VQP A;  3OMC A;  5GAN 6;  2LQ8 A;  1OEB A;  4ORZ A;  1H3H A;  1K8A C;  4FW2 A;  4PK4 A;  5LJ5 f;  4C0G A;  1UGQ B;  4RCC A;  4M78 C;  2RI3 A;  2HCK A;  4FL6 A;  5I21 A;  2ENM A;  5IXF A;  5FU6 C;  4EPC A;  3I56 Q;  4M7A F;  4XU3 A;  2COZ A;  3EFS A;  1YNZ A;  1ZQ1 A;  3OW2 A;  1KIK A;  2ECZ A;  3JB9 H;  4RTZ A;  2EVR A;  5HKC A;  1TUD A;  3HRS A;  1WXU A;  3CPF A;  3JB9 G;  4Y91 A;  4PJO D;  3GP8 A;  1WHM A;  1WI7 A;  2XHC A;  1RAI B;  4R55 A;  2YUP A;  2GGR A;  4OGE A;  2RQW A;  1D1A A;  2YUQ A;  5GAN g;  3R6N A;  2RK2 A;  2V1R A;  4J9G A;  1Q82 R;  2MMP A;  1YHQ A;  2GF7 A;  3H6Z A;  4OF1 A;  4R0K A;  1PD1 A;  2LX9 A;  4HA8 A;  4DBQ A;  2QEX T;  1R77 A;  2F5T X;  1LNX A;  2CSQ A;  2OAW A;  1Q86 R;  5EG2 A;  3CCQ A;  3CC2 A;  2FZG B;  2GQI A;  1KHI A;  4KGX B;  1ZBX A;  1EZZ B;  2PVD B;  3CME T;  2F2V A;  3A8H B;  5FRO A;  4RCB A;  4KBM B;  3M5A A;  1VQL T;  2HL3 A;  5KYY B;  1QWE A;  2E1H A;  4J9D A;  5D7U A;  5GMK j;  1Q82 U;  3L2Q A;  1QW1 A;  2P0K A;  4OMN A;  5CKE A;  2KRM A;  1A0N B;  4Y28 E;  2R58 A;  1U06 A;  1WQ7 A;  2DZC A;  2JS2 A;  1PKT A;  4FIB A;  2L5Q A;  1YJN A;  1EFN A;  3CBP A;  2E41 A;  3LX7 A;  2AZV A;  2X4W A;  4X9D A;  4D8K A;  1Y71 A;  1WNL A;  2DXB A;  4M7A E;  1RAG B;  3S3M A;  4OB3 B;  3TU4 K;  3J80 E;  1VQ4 T;  1JEG A;  1VQ4 A;  1TU0 B;  2KK4 A;  4MZT A;  2LC4 A;  3HFO A;  3C12 A;  2FRY A;  4DBR A;  5LJ3 d;  5LJ5 d;  1TG0 A;  3EGU A;  2CZ1 B;  4Z8A A;  1G3W A;  2EQJ A;  1DJ7 B;  4JRI A;  4LUE A;  3FC3 A;  2XDB A;  1RAA B;  1R0B G;  1VQ8 A;  1BCM A;  3EFR A;  3QYG B;  2OAU A;  4FW1 A;  4OMQ A;  4LXC A;  3CCV Q;  1YI2 Q;  3AHU A;  1Y96 A;  2K5L A;  2JNG A;  2NUP A;  4EMK B;  5HK0 A;  4M7A G;  2C0I A;  3VJP A;  1JJ2 S;  1YCS B;  4ELZ C;  1VQ5 T;  2DZ9 A;  4IUV A;  1KQ1 A;  1X01 A;  1KHC A;  3CCJ T;  1KQS P;  1MV0 B;  2CP6 A;  2LCS A;  4M78 A;  1K9M R;  2CT3 A;  4PKC C;  3RMQ A;  3EAE A;  3MP1 A;  1GCP A;  3OYY A;  2VB6 A;  4M75 D;  3OYN A;  4ATO A;  3MEU A;  1KD1 R;  2LRQ A;  4J9B A;  1MMA A;  3SWN A;  2OTL T;  4OMF B;  4KRT A;  2JT4 A;  5GAN d;  2FZK B;  4RKU E;  2D0Q B;  5GAM e;  4IUT A;  1K9M U;  4RG2 A;  4FYX B;  3TSZ A;  5GAM j;  3EH2 A;  4XTX A;  3CCU T;  1YIJ Q;  4M75 C;  3CME Q;  2ESW A;  2KE9 A;  2HNI A;  3X20 B;  2MOX A;  5CAI A;  3JCM X;  3TSW A;  2JTF A;  4XTV A;  3OY9 A;  2GTJ A;  3FEO A;  5EC7 A;  2DVJ A;  1K9M C;  5CCA A;  4C8Q A;  3JB9 D;  5IN1 A;  2RM4 A;  1RAE B;  1S72 Q;  1NJI R;  4R56 A;  3M0S A;  5GAN 8;  1BCO A;  1OU8 A;  2CP3 A;  2YLC A;  4BY6 C;  1Y57 A;  1UJ0 A;  4PL6 A;  2XDD A;  4ZNX A;  2LDM A;  2I0N A;  1G3S A;  2D8H A;  1YI2 A;  3G7Z A;  2DL8 A;  1QP2 A;  1OUL A;  1MMG A;  3VKI A;  1MNE A;  1ZSZ B;  4CC4 B;  3G6E A;  2X4J A;  2FPF A;  1N6A A;  3JAM E;  4JS4 A;  2RHI A;  3EG9 B;  2JN0 A;  5KYY A;  1SHG A;  3CC7 Q;  1TSF A;  3M55 A;  4M77 C;  4J9E A;  5KCO A;  1YJ9 A;  5GAN 7;  4HVV A;  1KSW A;  4PJO G;  2CGH A;  3ME9 A;  3R6O A;  5LJ5 j;  3CCS T;  2PVG B;  4JJN K;  4M78 G;  2A3L A;  5L23 A;  1LPL A;  2AIR B;  1W2B A;  3QXE B;  5D6W A;  1IO6 A;  2O9V A;  5KE2 A;  2E70 A;  1Q81 C;  1SG5 A;  5GJV B;  2YXY A;  5A0D A;  4E7L A;  1BU1 A;  4MDW A;  3CC2 Q;  2F2W A;  1YFN A;  1Q86 U;  2EIF A;  4LDV A;  4J6W A;  2CP5 A;  1U1T A;  5GAO p;  5GMK l;  5GAN h;  4M77 B;  1VQO T;  2LT1 A;  1ZHI A;  2V8K A;  3CCE Q;  2ABL A;  2KVQ G;  3FLG A;  1GBQ A;  1YIJ A;  3I5R A;  2JUF A;  2DE0 X;  2DVE A;  4M7D E;  5LJ5 h;  1KC8 R;  1GFC A;  1W6X A;  4A4F A;  1R8O B;  2PU9 B;  2DA9 A;  2FO0 A;  3HL8 A;  3WXM B;  2BZY A;  1HK9 A;  1SEM A;  5KYN A;  4KUI A;  2IG0 A;  1QMC A;  1WXT A;  4N4H A;  1AWX A;  3V8J A;  2CT4 A;  4F7U E;  3MJX A;  3QJY A;  2BTT A;  4LDU A;  1G5V A;  5I2M A;  1VQK A;  3UAT A;  3LGF A;  1OX9 A;  2ZPB B;  3PNW C;  2YUO A;  3M54 A;  1AD5 A;  3CPW A;  4MML A;  4HVW A;  1VQ9 T;  1AWJ A;  1M1K U;  3CCM T;  4J6Y A;  2PUO B;  4A53 A;  4JPB W;  3A8G B;  2RMO A;  1IHV A;  1B7T A;  4OP0 A;  4M75 B;  1V76 A;  2EKH A;  4EDU A;  1K8A R;  3VS3 A;  4E6R A;  4B9X A;  2BE7 D;  3OA6 A;  2CDT A;  3JCM V;  2HZY A;  2RO0 A;  1VQK T;  4HT8 A;  3UA6 A;  3L2R A;  3CCM Q;  5FWB A;  3GPL A;  5I22 A;  5A0L A;  3PMI A;  1I1J A;  1RL2 A;  4N4G A;  2YRV A;  3MO8 A;  2Z0W A;  1FMK A;  4KGV B;  4Q5W A;  3TQ7 P;  5KYU B;  3V7S A;  4FSX A;  1TUG B;  1K8A U;  1D09 B;  2LCL A;  3FJP A;  3CMA Q;  2X3W D;  3E9G A;  2WAC A;  5IXB A;  5GMK m;  2LQN A;  2YRD A;  2JZ2 A;  2XU8 A;  2DL4 A;  2DXT A;  4EMK C;  2QK0 A;  3VS7 A;  4JLG A;  1GRI A;  4JRQ A;  4PJL A;  1KD1 C;  1KK7 A;  1OPL A;  2CYZ B;  4IUP A;  1YHQ T;  2KDS A;  6AT1 B;  2DBM A;  2P4T A;  4L6V 5;  2ROL A;  3CCQ T;  3CC2 T;  1HSQ A;  4BUG A;  2EFI A;  1VYV A;  4E7H A;  1VQO A;  1F1B B;  1NM7 A;  2D6F A;  1Y96 B;  2AHJ B;  2KYM A;  3CBO A;  5KYX B;  2NUP B;  3OYH A;  1M2V A;  5DM7 R;  1N8R C;  2E64 A;  1X2K A;  4DQ2 A;  4C92 G;  1LVK A;  5CVI A;  4DEX A;  4XU1 A;  1V29 B;  2DYB A;  2O88 A;  4X34 A;  5AT1 B;  3MP6 A;  3PGG A;  2L0A A;  3DLL A;  2QA4 A;  4E7I A;  2EGC A;  2H3J A;  1ZUK A;  4KGZ B;  2LNH B;  2FZC B;  2DM1 A;  1RI0 A;  4C8Q G;  2JMC A;  2A36 A;  3M56 A;  3P8H A;  2NWM A;  1YJN T;  3ZFJ A;  8AT1 B;  3KUF A;  3OYE A;  2KEA A;  2ED1 A;  1K9A A;  1N8R U;  2BZ8 A;  1ZA2 B;  2C0O A;  1B34 B;  3MEA A;  3QWX X;  1IZ6 A;  2EQM A;  4A4H A;  3CC4 A;  1OI1 A;  4L5G A;  5KE3 A;  1GFD A;  5GAO l;  1QCF A;  4QQ6 A;  4FYW B;  3X26 B;  1FYN A;  4AFQ C;  4C5E A;  3VYH B;  1X6O A;  1G83 A;  1LOJ A;  3S6W A;  2X35 A;  4M75 F;  1T0H A;  1Q7Y C;  2VKN A;  4GLM A;  4TVR A;  2OTJ A;  2NYS A;  3SB2 A;  2P84 A;  2DTO A;  2DIL A;  3ER0 A;  1YJW Q;  3LWI A;  1FMV A;  1OV3 A;  3X24 B;  1BK2 A;  2ZPH B;  5M9O A;  1YIJ T;  4C8Q E;  2YUN A;  5HCK A;  2RHY A;  2OX7 A;  4HVU A;  1ZSG A;  3BE3 A;  4A63 B;  2DK3 A;  1K0X A;  1QWF A;  3MHX A;  3CC7 T;  2DAQ A;  3VS0 A;  1VQ6 T;  4C8Q C;  3HHT B;  2PTK A;  3DB4 A;  3HP9 A;  4A4E A;  2VGM A;  2VVK A;  2FG0 A;  3CQT A;  2HQX A;  3V8L A;  4B9W A;  2QDY B;  1I0C A;  2QQA A;  3JB9 I;  3RES A;  4GBQ A;  4C92 C;  1YP5 A;  1X6B A;  3H0H A;  1VQ6 Q;  2X51 A;  1P92 A;  1K73 R;  1KFZ A;  2P4R A;  3UDC A;  2L3R A;  2HMA A;  3P8D A;  1M1G A;  3SWN C;  4MMK A;  9ATC B;  2DET A;  2QA4 T;  1PG5 B;  2QEX Q;  4ZTJ A;  1VYU A;  3Q1J A;  4M7D D;  2FRW A;  3OYF A;  1IB8 A;  4ZTF A;  2LQK A;  3JB9 J;  1VA7 A;  3QHS A;  3UA7 A;  4EMH A;  1VQ9 Q;  2RJE A;  1WFW A;  4Z02 A;  1H92 A;  5IH2 A;  3D7S B;  3C4S A;  2K7A A;  2QXF A;  3G1J A;  2RJD A;  4PFO A;  1JJ2 P;  1JU5 C;  1IRX A;  1RAH B;  3EG3 A;  2XK0 A;  2CRE A;  2IPO B;  1M27 C;  2O31 A;  4IUQ A;  3EHQ A;  1QVF P;  3JB9 F;  1X2Q A;  1NYG A;  2KNB B;  4D8D A;  4GLK A;  1UHF A;  1UFF A;  2RK1 A;  5DLQ E;  1O75 A;  2HKQ B;  4M77 E;  3L2W A;  3NTI A;  2E5K A;  5IHI A;  3H8Z A;  1G3Y A;  1WJS A;  1S72 T;  1TH7 A;  3PE0 A;  5KCH A;  3GIB A;  4WTO B;  2GFU A;  4QT7 A;  4J9C A;  3RKW A;  1B34 A;  4XU2 A;  2OTJ Q;  2IIM A;  2J7I A;  1X75 C;  4D6W A;  1T3S A;  2M51 A;  5LJ5 g;  1YIT T;  2SEM A;  2KGT A;  4C5I A;  2D9T A;  3M0T A;  2KY9 A;  3CC4 T;  1WHL A;  3OYB A;  5IAY A;  5CKD A;  1NJI C;  3JCM f;  3GNG A;  2MWP A;  4M75 A;  4XK8 E;  5I2S A;  1EX4 A;  1JRI A;  2LCC A;  1E6G A;  3LWH A;  4EIK A;  1SF9 A;  1H8K A;  3OQ5 A;  3M0Q A;  2COY A;  2G3R A;  3V7R A;  1VQ4 Q;  2EYY A;  2KSS A;  1FWZ A;  4XTU A;  1OYX A;  1R0C B;  3ULR B;  4RTX A;  2VAS A;  4J7F A;  3A1P A;  1M8M A;  2FEI A;  2KRO A;  4OMM A;  5LL6 S;  2KRS A;  4NOY A;  5CKB A;  2RJC A;  3OYC A;  3CCJ A;  4RG8 A;  1WLP B;  4J5Y A;  5ECA A;  5CKH A;  3QWY A;  1AVZ C;  4BDY A;  1Z9Q A;  5J39 A;  4JDS A;  4A54 A;  3QUI A;  2OI3 A;  2QGG A;  1MHN A;  5CR2 A;  3OYK A;  3CCR T;  3VS4 A;  3KXT A;  5IHN A;  1Q82 C;  1OZ2 A;  1SKU B;  2EKO A;  2VXF A;  2XG8 D;  3I35 A;  2CZ7 B;  2XID A;  1AEY A;  2E3I A;  4EMG A;  3QPH A;  3M53 A;  1RLP C;  2DL3 A;  4QQG A;  1HYO A;  2J6K A;  2O4X B;  4F16 A;  3X25 B;  5GMK i;  2RQV A;  1UEB A;  3MP8 A;  2J06 A;  4M75 G;  4M7A D;  4J9I A;  4OB0 B;  1M2V B;  1OZ3 A;  1RAC B;  2DO3 A;  2DRM A;  4Z89 A;  3JCM g;  3O5Z A;  1YJW T;  4KH0 B;  3CCU A;  1PC0 A;  1M90 U;  1VIE A;  1AWO A;  2IVW A;  2J6F A;  2I2L A;  2XDP A;  2F5K A;  2DTH A;  4MZP A;  1RAB B;  2O9S A;  3OYI A;  4C92 D;  3EG2 A;  1I81 A;  1ZA1 B;  3FDR A;  1OPK A;  2KXC A;  2A0F B;  2DPP B;  2EAY A;  2L3Q A;  4ME7 A;  2EYX A;  4C0Z A;  3EGD A;  2EQK A;  4E7Z A;  4IKF A;  2LJ0 A;  1TS9 A;  3JCM h;  3OS5 A;  2LJ3 A;  1VQ5 Q;  1VQ7 Q;  3V8K A;  2NLU A;  4J7I A;  3M0P A;  1KQS A;  2NUZ A;  1NEB A;  3V7C A;  2JS0 A;  1WQW A;  5GAM h;  2QQB A;  2K3X A;  2E5Q A;  3OSV A;  2A7Y A;  3INZ A;  1KJW A;  3VRY A;  4DBF A;  3RNJ A;  1JJ2 A;  1OU9 A;  3OBY A;  4OB2 B;  2EGE A;  4M78 F;  3H9N A;  2LP5 A;  3VS1 A;  3OW2 S;  1M2O A;  2L89 A;  2EGA A;  5HY6 A;  2QTX A;  3TRE A;  2Y90 A;  1WHJ A;  4AFU C;  2DEU A;  3KBG A;  5GAN f;  2L3P A;  3E9F A;  3TEE A;  3OB9 A;  3GOX A;  3MCA B;  3URG A;  1PM3 A;  1VYT A;  5DLO A;  3VV0 A;  4C92 A;  3OYD A;  2KI7 A;  3CPW P;  2RN8 A;  3NMZ C;  3EGX B;  3CD6 Q;  3CCL T;  1HJD A;  4BI8 B;  4P5N A;  1AWW A;  1UGP B;  4FYY B;  1KD1 U;  4DOV A;  2GBQ A;  4ZGJ B;  4FM4 B;  5CQX A;  1WA7 A;  8ATC B;  2K4Y A;  4HXJ A;  5GAO r;  1X43 A;  3RKY A;  3CXC P;  2MK5 A;  1BI3 A;  3VUZ A;  4F17 A;  2K6D A;  4XU0 A;  4LDX A;  4OGC A;  2ZPE B;  1QCN A;  3BDU A;  3F70 A;  2QTV A;  2P0P A;  2DL5 A;  4HCB A;  3C94 A;  3OMG A;  4AFS C;  5FLX E;  4PJO B;  1YJ9 Q;  4PFZ A;  1YJN Q;  1PD0 A;  4JLI A;  2XIC A;  1NBE B;  1BB9 A;  3CCE T;  2O2O A;  3CC4 Q;  4M4Z A;  1Q81 R;  3L2V A;  1M1K R;  4M75 E;  3EFO B;  5GAN 5;  2LTO A;  2PNI A;  3A98 A;  4LDY A;  5LJ3 f;  1QLY A;  4FT4 A;  2EW3 A;  3QDF A;  1RAD B;  2HQH A;  1OQK A;  2VXE A;  1PRL C;  2K79 A;  1OX8 A;  3CCU Q;  4UC4 A;  1PSE A;  2D0N A;  2DL7 A;  1EIF A;  3DLM A;  2YHT A;  5FWC A;  3CCQ Q;  3L2Z A;  5GAN 3;  3WVE B;  1M3B A;  2LT4 A;  4IUR A;  3MEV A;  1TTH B;  3LLR A;  2O4X A;  1KC8 U;  2K3B A;  4OB1 B;  2DBK A;  2KBT A;  5GAM d;  1VQ7 T;  3EG9 A;  3FRN A;  1NPP A;  3RMS A;  2DER A;  1W4S A;  3JCM d;  2VWF A;  4PJO E;  1YBY A;  3UWN A;  1VQN A;  1VQN T;  2EJG A;  1UEC A;  3A8L B;  2DIG A;  4CC2 A;  2HL5 C;  4M78 E;  3A8M B;  3LH5 A;  3ZL7 C;  5C6S A;  4AFZ C;  1NJI U;  1OOT A;  2JTE A;  4J9F A;  1T3L A;  3NTK A;  2YWW A;  3BW1 A;  1QKW A;  4X1V A;  2QQS A;  1NEG A;  4AG1 C;  4E7K A;  3FIF A;  4PJO C;  3X28 B;  4N0A C;  3MEW A;  4QVC A;  3H41 A;  3RR6 A;  3OS1 A;  1YWP A;  4BE2 A;  1KG1 A;  1D1C A;  5GJW B;  3CME A;  2HAX A;  4JUV A;  1J3T A;  1BI1 A;  1UE9 A;  1M1K C;  1D1B A;  3REA B;  3QYH B;  4XTZ A;  3QJ6 A;  3VU3 C;  4EMK A;  2NUT B;  3QO3 A;  3M0R A;  5KYW B;  1VOM A;  3TVT A;  2ZCF B;  1WDX A;  4M78 D;  4JZ3 A;  1X6G A;  4IIM A;  2BUD A;  1WIE A;  4JZ4 A;  3RUX A;  1VQ8 Q;  3GBQ A;  3G71 A;  1UJY A;  4HKE A;  2FL7 A;  2A28 A;  1AOJ A;  1M30 A;  1HXD A;  4M77 G;  2C06 A;  4RTT A;  1IGQ A;  2DJZ A;  2X3X D;  4C92 F;  3PFS A;  3NHN A;  1WHG A;  1ARK A;  4BI3 A;  3CCR Q;  1LJO A;  1VQL A;  5LJ3 j;  4II1 A;  4M7A B;  1JB0 E;  2P0Q A;  2M9U A;  2DLP A;  1Q95 G;  4ZGE B;  1AHJ B;  4A4K A;  3QKJ A;  3H0I A;  1XNI A;  5A2Q E;  3A5Z B;  2QQR A;  4KUD K;  1QP3 A;  2H8H A;  4FYV B;  3VRZ A;  1I4K 1;  1AT1 B;  1E6H A;  2JVV A;  2HD0 A;  3JCM c;  2BKD N;  3MET A;  1ZLM A;  3CCM A;  2YT6 A;  3FB9 A;  3G4S A;  3CCJ Q;  3CCE A;  4PNO A;  3I55 T;  4YTL A;  1VQO Q;  2RF0 A;  1IHW A;  3DKM A;  2M1H A;  2DD5 A;  4NL2 A;  3L2U A;  4BDZ A;  2EQI A;  2JJ9 A;  2VV5 A;  1PRM C;  2ED0 A;  2DTI A;  2VUB A;  5FU7 C;  2DNU A;  1GL5 A;  2JOY A;  1K0S A;  2E10 A;  3RIR A;  3EFO A;  1WYX A;  3C95 A;  3CD6 A;  1S72 A;  5HK3 A;  4BE1 A;  2MYS A;  4BAC A;  2XKO C;  4PJM A;  1YIT Q;  1JQQ A;  3JCM b;  1SHF A;  2PZ1 A;  2FB7 A;  2YRC A;  2LVM A;  4DA4 A;  1QVG P;  5FRM A;  4JJB A;  2RJF A;  4QVD A;  5GAN 4;  3PT9 A;  4F7U A;  2OTJ T;  4OML A;  2M0Y A;  2ZZD A;  1CSK A;  1VQM T;  3PVL A;  4BY6 B;  4ZN3 A;  4M7D F;  3GNF B;  4JJC A;  1TWB A;  3MKD A;  2CUB A;  2Y4X A;  3EHR A;  1WGS A;  3J7A F;  3KFV A;  2EJF A;  2KT8 A;  1XTD A;  4QVZ A;  1C6V X;  3HFN A;  5GAN j;  4LD6 A;  3L42 A;  5CQY A;  3LYI A;  4PLL A;  1XJW B;  1MUZ A;  2JW4 A;  4NL3 A;  3UPU A;  1WJR A;  5IHK A;  2W0Z A;  1FXX A;  1JBM A;  1NPR A;  3L1A A;  4M7D A;  2DKG A;  4RTU A;  3EGD B;  4ZN1 A;  3VS6 A;  3BFM A;  2OTL A;  2MWO A;  2YSQ A;  3RKX A;  5DY9 A;  1VQP Q;  2MI6 A;  3C0C A;  4FT2 A;  3EGX A;  1QVG A;  3PVQ A;  1YJW A;  5L8R E;  2H3E B;  3QZ5 B;  3OYG A;  2CP7 A;  5GAO q;  2CKK A;  2MPX C;  2DFU A;  3CCV T;  4JS5 A;  2FVU A;  3UF4 A;  4OMP A;  1YCY A;  5KYW A;  2QEX A;  1K1Z A;  3EH1 A;  3H0F A;  2GCX A;  2CUD A;  2HBP A;  2LMJ A;  2PQW A;  4CI0 C;  1IXD A;  1T0J A;  2A08 A;  5C0M A;  2KT1 A;  4LN2 A;  4C92 B;  1JO8 A;  2NUT A;  2RD1 A;  5I11 A;  2F1L A;  2MAM A;  2HSE B;  2E4H A;  2KYB A;  4F04 B;  1W2B P;  2LZ6 B;  4AMC A;  3G4S T;  3I56 T;  1C1A A;  3DB3 A;  1I5O B;  1ZBJ A;  4C0F A;  3AT1 B;  5D6X A;  1V1C A;  1FX7 A;  1KQ2 A;  1TUC A;  3VYG A;  1D3B B;  1GCQ A;  4M7D G;  1PSF A;  3REB B;  2DJQ A;  2BE9 B;  1SSH A;  2K2M A;  4RTV A;  2CSI A;  3CPW S;  4ELY C;  1D0Z A;  1XOV A;  2GQV A;  1S1N A;  2M0O A;  4J9H A;  1M8V A;  3SFM A;  4L59 A;  2EYQ A;  2A37 A;  3HTR A;  4MDX A;  1JXO A;  1TXQ A;  1ZUU A;  3NGP A;  2RA2 A;  3CXC A;  4PJO A;  2DRK A;  2QI2 A;  4E47 A;  4JRK A;  1Q7Y R;  4CC7 A;  1VQ7 A;  2K5F A;  2JM8 A;  3G6E T;  1VQP T;  1SSF A;  2ZPF B;  2OTL Q;  2EYW A;  3VS2 A;  1X69 A;  2VYT A;  5KYU A;  1H3Z A;  1VIF A;  1VQ6 A;  3M59 A;  1ABO A;  3I55 A;  1WHH A;  1UDL A;  4O6J A;  4NS5 A;  1N5Z A;  1Q81 U;  4KH1 B;  1IRE B;  2DXU A;  3RDV A;  2CH4 A;  3S3N A;  2DIQ A;  4AG2 C;  3M58 A;  3G4S Q;  4GY5 A;  2E65 A;  1RLQ C;  2LQW A;  2OJ2 A;  4N4I A;  4PLI A;  3HRT A;  4M77 A;  3SD4 A;  2RI2 A;  2KMT A;  4C0D B;  3M9Q A;  4LUD A;  3M57 A;  1UTI A;  4LNP A;  2CZ6 B;  2AKK A;  4PFP A;  4B6M A;  2HSP A;  1Y0M A;  3CCR A;  2DMO A;  4X9C A;  1KQS S;  3JCM J;  2E6Z A;  2KQW A;  2ZPI B;  1UB4 A;  2EQU A;  5J3B A;  2E3H A;  4J6X A;  2KR3 A;  4QW2 A;  1G3T A;  1ZSZ C;  2K2V A;  1N8R R;  1YWO A;  4E2F B;  3I5S A;  1UGR B;  2V26 A;  2RQT A;  3E1S A;  3JSC A;  1Z9Z A;  2COW A;  1SRM A;  1MMD A;  3CCS Q;  2V1Q A;  1PWT A;  4RMO A;  1UUE A;  2CZ0 B;  2QA4 Q;  2L8D A;  2RB6 A;  1VQM A;  1NLP C;  1ACM B;  1MND A;  2J6O A;  1KC8 C;  1U1S A;  2HQE A;  3I55 Q;  5CKF A;  2K3Y A;  2X9H A;  4HT9 A;  2ZGW A;  3WVD B;  1D0Y A;  4LDW A;  1BYM A;  1MV3 A;  4LD9 K;  4FSS A;  2DD4 A;  1QQJ A;  1BIB A;  1VQ9 A;  5GMK h;  3M4Y A;  1WHK A;  5GAN e;  3I56 A;  4XTW A;  5FU7 B;  2AK5 A;  2ATC B;  2R57 A;  2E6N A;  1QVP A;  4Z88 A;  5GAM g;  3ASK A;  4C0D C;  5CO7 A;  1WPY A;  4PJO F;  1G2B A;  3PIP A;  3A8O B;  2EPD A;  1NG2 A;  1PNJ A;  2JMA A;  3UT1 A;  3PIO A;  2V8I A;  2RQU A;  2XMF A;  4MZM A;  5KH6 A;  2JXB A;  4LE9 A;  3BY7 A;  3OYA A;  1VQ8 T;  1QCO A;  2DF6 A;  2R5M A;  4VUB A;  2EBP A;  3SWN B;  2HKN A;  2FHD A;  3U23 A;  1QVF A;  3QBY A;  3HKS A;  4O5V A;  5GAN 2;  3SHW A;  3CXC S;  2AT1 B;  4CRI A;  1N27 A;  1NE8 A;  1Q86 C;  4OMO A;  4RTY A;  4AT1 B;  4M77 F;  4C5G A;  2X4Y A;  2QAZ A;  2J05 A;  2L2P A;  3CCL Q;  3LH0 A;  4ANJ A;  5KYX A;  3OYJ A;  1C0M A;  2AZS A;  2QGF B;  2LJ1 A;  2ZPG B;  2F69 A;  4F7U G;  3JV3 A;  2CS7 A;  3JCM e;  2KAF A;  3NFC A;  3VS5 A;  3OYM A;  1B3Q A;  4F7U B;  4C8Q B;  4M7D C;  3ZEH A;  2QYZ A;  2XD0 A;  3G71 T;  1E7O A;  2KRN A;  2JTM A;  1K73 U;  1BI0 A;  1NZ9 A;  1O9S A;  3MPU B;  1M4Z A;  1MGQ A;  2M16 A;  4BI4 A;  1N9R A;  5GAM f;  3QDR B;  2B8A A;  4C5H A;  3HSB A;  1VUB A;  3SDZ A;  1IGU A;  3HPW A;  4FCY A;  1RAF B;  1CKB A;  4F7U F;  1VQN Q;  4ESR A;  4C8Q D;  2CH4 W;  1NLO C;  2VGN A;  2WSC E;  3LW5 E;  2SRC A;  3ZBD A;  4A4G A;  1Q7Y U;  4DBH A;  1VQK Q;  1GCQ C;  3M4G A;  5LJ3 g;  5FW9 A;  1X27 A;  2G6F X;  1NYF A;  1W2B S;  5A0G A;  1JXM A;  2C0T A;  5LJ5 e;  2DEQ A;  1I5L A;  3O8V A;  2LX7 A;  5CIU A;  2AKL A;  1B07 A;  2RQR A;  2YLB A;  2K57 A;  3PMT A;  4XTY A;  2WSF E;  2F2X A;  5GMK e;  3IQL A;  1U8R A;  3QII A;  7AT1 B;  1M3A A;  4M7A A;  2L3S A;  2KXD A;  4BE0 A;  1U3O A; 
#chains in the Genus database with same CATH homology
 2E10 A;  3VKI A;  3NTI A;  3G6E A;  2X4J A;  3H8Z A;  2LNV A;  3RIR A;  1G3Y A;  1WJS A;  3OBW A;  3C95 A;  3S3O A;  3CD6 A;  3OYL A;  1N6A A;  1S72 A;  1S72 T;  1UGS B;  3JAM E;  5HK3 A;  3BDL A;  4XAX B;  4BE1 A;  2V8J A;  2XKO C;  1BI2 A;  1TH7 A;  3CMA A;  3JCM b;  5KCH A;  4JS4 A;  4BAC A;  2RHI A;  3CMA T;  3GIB A;  2GFU A;  3CC7 A;  3RKW A;  1B34 A;  1BKB A;  2FB7 A;  2JN0 A;  4HCZ A;  4XU2 A;  2X4X A;  2E12 A;  2LVM A;  4DA4 A;  2FYK A;  1X75 C;  4D6W A;  3M55 A;  4WF2 A;  5LJ5 g;  1YIT T;  1XQH A;  4M77 C;  3QG1 A;  5FRM A;  3CCL A;  2RJF A;  4QVD A;  4C5I A;  5GAN 4;  3PT9 A;  4F7U A;  2D9T A;  5KCO A;  5GAO n;  2KY9 A;  1YJ9 T;  5GAN 7;  3CC4 T;  1WJQ A;  1YJ9 A;  4BD3 A;  2ZZD A;  4PJO G;  5IAY A;  5CKD A;  3OYB A;  3NTH A;  1NJI C;  2CGH A;  1VQM T;  3JCM f;  3GNG A;  2MWP A;  3ME9 A;  3JCM W;  4BY6 B;  4ZN3 A;  3T9N A;  4M75 A;  4XK8 E;  4M7D F;  5I2S A;  3R6O A;  5LJ5 j;  3GNF B;  3CCS T;  2PVG B;  1VQ5 A;  1I8F A;  3GF5 A;  2PUK B;  1D3B A;  1JRI A;  2LCC A;  2Y4X A;  4M78 G;  2A3L A;  3J81 E;  3LWH A;  4JJN K;  1WGS A;  2RHU A;  3J7A F;  1GXI E;  4C92 E;  1M5Q 1;  2EJF A;  3VUB A;  4C8Q F;  1XTD A;  4J83 A;  4QVZ A;  3HFN A;  3QXE B;  5D6W A;  5GAN j;  1W2B A;  2O01 E;  4LD6 A;  3OQ5 A;  3L42 A;  5CQY A;  2G3R A;  4OVA A;  5KE2 A;  2E70 A;  3CCV A;  1Q81 C;  3LYI A;  3V7R A;  4PLL A;  5A0D A;  4E7L A;  4DOW A;  2KSS A;  1FWZ A;  4MDW A;  3JCM P;  3HRU A;  4XTU A;  5AYF A;  1OYX A;  4NL3 A;  2WSE E;  3UPU A;  1WJR A;  4FU6 A;  2EIF A;  4LDV A;  1Q86 U;  1Y7X A;  1FXX A;  1M1F A;  1Y07 A;  4J7F A;  5CK9 A;  4J6W A;  1JBM A;  1NPR A;  2RI5 A;  5IT9 E;  3L1A A;  4M7D A;  2Y4Y A;  1U1T A;  2DKG A;  5GAO p;  1QVF S;  5GMK l;  3TCJ A;  5J26 A;  1H64 1;  5GAN h;  4M77 B;  4ZN1 A;  1VQO T;  2LT1 A;  1N9S A;  3BFM A;  3OSS C;  1ZHI A;  5LL6 S;  4NOY A;  5CKB A;  2V8K A;  2RJC A;  3OYC A;  2OTL A;  3CCJ A;  2KVQ G;  3FLG A;  4RG8 A;  1YIJ A;  4J5Y A;  4KT0 E;  2MWO A;  3RKX A;  5DY9 A;  2JUF A;  2MI6 A;  2DVE A;  5CKH A;  4FT2 A;  5LJ5 h;  4M7D E;  2K5I A;  4A4F A;  1QVG A;  1R8O B;  4BDY A;  5J39 A;  1YJW A;  4JDS A;  4A54 A;  1M9S A;  3QUI A;  2PU9 B;  2XI9 A;  5L8R E;  2R5A A;  3HL8 A;  3QZ5 B;  3WXM B;  3OYG A;  5FRN A;  1MHN A;  5GAO q;  2CKK A;  1HK9 A;  2MF2 A;  5CR2 A;  3OYK A;  3CCR T;  2VC8 A;  1K73 C;  4KUI A;  3CCV T;  2IG0 A;  3LGL A;  3KXT A;  4JS5 A;  2FVU A;  1Q82 C;  1OZ2 A;  2EKO A;  2VXF A;  4M77 D;  4N4H A;  2XG8 D;  4N0A A;  4XQ3 A;  3V8J A;  1YCY A;  2CZ7 B;  2XID A;  2QEX A;  4F7U E;  4EMG A;  3RER A;  4J8O A;  2GCX A;  3QJY A;  3M53 A;  2RHZ A;  2HBP A;  3CBM A;  3CEY A;  3QPH A;  4LDU A;  5I2M A;  1G5V A;  2PQW A;  1VQK A;  4QQG A;  4CI0 C;  4M7D B;  3LGF A;  4M7A C;  2ZPB B;  2DXC A;  2O4X B;  3PNW C;  3M54 A;  3X25 B;  5GMK i;  5C0M A;  3CPW A;  1UEB A;  3MP8 A;  4MML A;  1VQ9 T;  4C92 B;  4M75 G;  2EJ9 A;  4M7A D;  1M1K U;  4OB0 B;  2RD1 A;  1OZ3 A;  3CCM T;  2EWN A;  2DO3 A;  4C0D C;  3E19 A;  3JCM g;  1YJW T;  3OS2 A;  4J6Y A;  2MAM A;  2PUO B;  4A53 A;  3CCU A;  1M90 U;  4E7J A;  1YIT A;  4KUL A;  3JCM Q;  3G4S T;  1M90 C;  3A8G B;  2GFA A;  1VIE A;  3N5B B;  3I56 T;  5D6Y A;  2IVW A;  2I2L A;  3DB3 A;  2XDP A;  2QQ9 A;  2F5K A;  2DTH A;  4MZP A;  3OS0 A;  4OP0 A;  4JRP A;  4C0F A;  4M75 B;  4ZGD B;  4V2S A;  5D6X A;  3OYI A;  1FX7 A;  4C92 D;  4EDU A;  1KQ2 A;  4QQD A;  3VYG A;  1YI2 T;  1D3B B;  4IUU A;  1I81 A;  3FDR A;  4B9X A;  2DPP B;  1QVG S;  2EAY A;  4M7D G;  1PSF A;  3OA6 A;  4ME7 A;  3JCM V;  4C0Z A;  2EQK A;  2RHX A;  2RO0 A;  3P8B B;  1VQK T;  4HT8 A;  3L2R A;  4IKF A;  3JCM h;  3CPW S;  4ELY C;  3CD6 T;  2RH2 A;  1XOV A;  3GPL A;  3OS5 A;  3V8K A;  2NLU A;  5A0L A;  2GQV A;  3PMI A;  4J7I A;  2M0O A;  4M78 B;  1M8V A;  3SFM A;  4L59 A;  5FU6 B;  1KQS A;  1RL2 A;  2EYQ A;  4N4G A;  4BB7 A;  5LJ3 h;  1BIA A;  2YRV A;  3V7C A;  5LJ3 e;  5GAO m;  4MDX A;  1WQW A;  3MO8 A;  3QZ9 B;  5GAM h;  2QQB A;  3QSU A;  3GLX A;  2K3X A;  2E5Q A;  3OSV A;  4Q5W A;  2A7Y A;  3INZ A;  2RA2 A;  3V7S A;  4FSX A;  3CXC A;  4PJO A;  2QI2 A;  1JJ2 A;  1K8A U;  3CCS A;  3OBY A;  2BIV A;  4OB2 B;  4M78 F;  4E47 A;  4JRK A;  3JRZ A;  2LCL A;  3FJP A;  3OW2 S;  2L89 A;  3E9G A;  1VQ7 A;  2WAC A;  5GMK m;  3PTA A;  5HY6 A;  2QTX A;  3TRE A;  2Y90 A;  4HCC A;  2JZ2 A;  2XU8 A;  2K5F A;  3G6E T;  3KBG A;  2PVO B;  5GAN f;  3OMC A;  1VQP A;  1VQP T;  1SSF A;  3E9F A;  3TEE A;  5GAN 6;  2DXT A;  2ZPF B;  3OB9 A;  2LQ8 A;  4EMK C;  3GOX A;  4JLG A;  3MCA B;  3URG A;  5DLO A;  4JRQ A;  2VYT A;  1H3Z A;  1K8A C;  1VIF A;  3VV0 A;  1KD1 C;  4C92 A;  5LJ5 f;  1VQ6 A;  4C0G A;  1UGQ B;  2CYZ B;  3M59 A;  4RCC A;  4IUP A;  2RI3 A;  4M78 C;  3OYD A;  3I55 A;  2KDS A;  4FL6 A;  1YHQ T;  5I21 A;  4O6J A;  4NS5 A;  1Q81 U;  1IRE B;  2P4T A;  4L6V 5;  2DXU A;  5FU6 C;  3CCL T;  3CCQ T;  2DIQ A;  3S3N A;  3M58 A;  3CC2 T;  4GY5 A;  2E65 A;  4BI8 B;  4EPC A;  4M7A F;  4P5N A;  4BUG A;  2EFI A;  4E7H A;  1VQO A;  2D6F A;  1UGP B;  4N4I A;  1Y96 B;  4PLI A;  3HRT A;  2AHJ B;  2RI2 A;  4M77 A;  2KMT A;  3CBO A;  3EFS A;  4XU3 A;  3SD4 A;  3M9Q A;  4C0D B;  1KD1 U;  4DOV A;  1ZQ1 A;  3OYH A;  3OW2 A;  4ZGJ B;  5DM7 R;  1N8R C;  2E64 A;  4FM4 B;  5CQX A;  3M57 A;  3JB9 H;  4DQ2 A;  4C92 G;  5CVI A;  5HKC A;  2K4Y A;  2CZ6 B;  3HRS A;  5GAO r;  3CPF A;  4XU1 A;  3RKY A;  1V29 B;  3JB9 G;  4Y91 A;  4PJO D;  3GP8 A;  4X34 A;  1BI3 A;  2XHC A;  3VUZ A;  4R55 A;  3MP6 A;  4XU0 A;  4LDX A;  4OGC A;  4OGE A;  3CCR A;  3PGG A;  4X9C A;  1KQS S;  5GAN g;  2ZPE B;  2RK2 A;  3DLL A;  2QA4 A;  4E7I A;  3JCM J;  2H3J A;  2E6Z A;  2KQW A;  2MMP A;  2ZPI B;  1UB4 A;  2P0P A;  2EQU A;  3BDU A;  3F70 A;  2GF7 A;  3H6Z A;  4OF1 A;  5J3B A;  1YHQ A;  2LX9 A;  4HA8 A;  4J6X A;  2QEX T;  4HCB A;  3C94 A;  2F5T X;  1RI0 A;  1LNX A;  4C8Q G;  3OMG A;  4QW2 A;  3M56 A;  5EG2 A;  3P8H A;  1G3T A;  3CCQ A;  5FLX E;  1YJN T;  3CC2 A;  4PJO B;  2K2V A;  3ZFJ A;  3KUF A;  3OYE A;  1KHI A;  1UGR B;  1ZBX A;  2PVD B;  3CME T;  3A8H B;  5FRO A;  1N8R U;  3E1S A;  3JSC A;  4RCB A;  4KBM B;  3M5A A;  1VQL T;  4JLI A;  2XIC A;  1B34 B;  3MEA A;  1IZ6 A;  4RMO A;  2EQM A;  4A4H A;  3CCE T;  3CC4 A;  2E1H A;  1OI1 A;  5GMK j;  2CZ0 B;  2L8D A;  2RB6 A;  4L5G A;  1VQM A;  3L2Q A;  5KE3 A;  1Q82 U;  1QW1 A;  3L2V A;  5GAO l;  4M75 E;  2P0K A;  4QQ6 A;  2OTJ T;  3X26 B;  5GAN 5;  5CKE A;  2LTO A;  4Y28 E;  4LDY A;  2R58 A;  5LJ3 f;  1KC8 C;  1U1S A;  1WQ7 A;  2HQE A;  3VYH B;  2DZC A;  4C5E A;  5CKF A;  1X6O A;  2K3Y A;  4HT9 A;  1LOJ A;  2ZGW A;  4FT4 A;  3WVD B;  4FIB A;  3S6W A;  2X35 A;  4LDW A;  4M75 F;  1BYM A;  4LD9 K;  1Q7Y C;  2L5Q A;  1YJN A;  2DD4 A;  2VXE A;  3CBP A;  2E41 A;  3LX7 A;  1BIB A;  2X4W A;  4X9D A;  1VQ9 A;  5GMK h;  3M4Y A;  5GAN e;  1Y71 A;  4TVR A;  4UC4 A;  1PSE A;  1WNL A;  2DXB A;  1EIF A;  3DLM A;  4XTW A;  2YHT A;  3I56 A;  4M7A E;  3SB2 A;  2OTJ A;  3S3M A;  5FU7 B;  4OB3 B;  2DTO A;  3ER0 A;  3TU4 K;  3L2Z A;  5GAN 3;  3WVE B;  3J80 E;  1VQ4 T;  2R57 A;  2LT4 A;  4IUR A;  2E6N A;  1VQ4 A;  1QVP A;  2KK4 A;  5GAM g;  3LWI A;  3MEV A;  3ASK A;  4MZT A;  2LC4 A;  1WPY A;  3HFO A;  3LLR A;  2O4X A;  5CO7 A;  4PJO F;  3C12 A;  3X24 B;  1KC8 U;  2ZPH B;  5M9O A;  1YIJ T;  4C8Q E;  4OB1 B;  3PIP A;  5LJ3 d;  3A8O B;  5LJ5 d;  2RHY A;  5GAM d;  2CZ1 B;  1VQ7 T;  3FRN A;  1NPP A;  3RMS A;  3UT1 A;  3PIO A;  1W4S A;  3JCM d;  1G3W A;  5FU7 C;  2EQJ A;  4PJO E;  1YBY A;  1DJ7 B;  2V8I A;  3UWN A;  4JRI A;  2DK3 A;  4MZM A;  3FC3 A;  5KH6 A;  1VQN A;  1VQN T;  3MHX A;  2XDB A;  2EJG A;  3BY7 A;  3OYA A;  3A8L B;  3CC7 T;  1VQ8 A;  1VQ8 T;  2DIG A;  3EFR A;  2DAQ A;  4M78 E;  3QYG B;  2OAU A;  3A8M B;  1VQ6 T;  5C6S A;  2R5M A;  4VUB A;  4C8Q C;  1NJI U;  3HHT B;  3NTK A;  3DB4 A;  3HP9 A;  3SWN B;  3AHU A;  3BW1 A;  1Y96 A;  2FHD A;  4A4E A;  2VGM A;  1QVF A;  3QBY A;  2K5L A;  2JNG A;  2QQS A;  4EMK B;  5HK0 A;  4E7K A;  4M7A G;  3FIF A;  4PJO C;  3HKS A;  4O5V A;  3VJP A;  4N0A C;  3X28 B;  5GAN 2;  1JJ2 S;  3MEW A;  4QVC A;  2HQX A;  3CXC S;  3V8L A;  4CRI A;  1N27 A;  3G7Z A;  4ELZ C;  1NE8 A;  3OS1 A;  4B9W A;  2QDY B;  1Q86 C;  1VQ5 T;  2DZ9 A;  4BE2 A;  4IUV A;  2QQA A;  1KQ1 A;  1X01 A;  1KHC A;  4M77 F;  3JB9 I;  4C5G A;  3CCJ T;  1KG1 A;  2X4Y A;  3CME A;  3RES A;  2HAX A;  4JUV A;  4C92 C;  1BI1 A;  4M78 A;  1M1K C;  3QYH B;  3LH0 A;  4XTZ A;  3OYJ A;  3QJ6 A;  3VU3 C;  4PKC C;  4EMK A;  3RMQ A;  3QO3 A;  3EAE A;  3MP1 A;  3OYY A;  2ZPG B;  1P92 A;  4M75 D;  3OYN A;  4ATO A;  2F69 A;  3MEU A;  2ZCF B;  4F7U G;  3UDC A;  2L3R A;  2CS7 A;  3P8D A;  4M78 D;  2KAF A;  3JCM e;  3NFC A;  3OYM A;  1M1G A;  3SWN C;  2BUD A;  4F7U B;  3RUX A;  4C8Q B;  4M7D C;  4MMK A;  3ZEH A;  2LRQ A;  3SWN A;  2QA4 T;  2XD0 A;  3G71 T;  3G71 A;  4HKE A;  2FL7 A;  2OTL T;  1HXD A;  4OMF B;  2JTM A;  4M77 G;  4ZTJ A;  1K73 U;  1BI0 A;  2C06 A;  1NZ9 A;  1O9S A;  2DJZ A;  5GAN d;  1M4Z A;  4RKU E;  3Q1J A;  1MGQ A;  4C92 F;  2D0Q B;  3PFS A;  5GAM e;  2M16 A;  4IUT A;  4BI4 A;  1K9M U;  1N9R A;  4RG2 A;  5GAM f;  4M7D D;  3QDR B;  4BI3 A;  5GAM j;  2B8A A;  4C5H A;  1LJO A;  3HSB A;  1VQL A;  3OYF A;  4XTX A;  1VUB A;  5LJ3 j;  4ZTF A;  4II1 A;  3SDZ A;  3HPW A;  4M7A B;  3CCU T;  1JB0 E;  4F7U F;  4M75 C;  2LQK A;  4C8Q D;  2VGN A;  2WSC E;  3LW5 E;  3QHS A;  3ZBD A;  2P0Q A;  4A4G A;  2M9U A;  4EMH A;  3JB9 J;  2RJE A;  2HNI A;  3X20 B;  4ZGE B;  5CAI A;  3JCM X;  1Q7Y U;  1AHJ B;  3M4G A;  4Z02 A;  4A4K A;  5LJ3 g;  2JTF A;  4XTV A;  3QKJ A;  3OY9 A;  1XNI A;  3FEO A;  5A2Q E;  3A5Z B;  2QQR A;  3C4S A;  4M77 E;  5A0G A;  1QP3 A;  1W2B S;  1K9M C;  5CCA A;  4KUD K;  2QXF A;  4C8Q A;  2RJD A;  2DEQ A;  5LJ5 e;  3JB9 D;  3O8V A;  1I5L A;  1I4K 1;  2RM4 A;  5CIU A;  5IN1 A;  2JVV A;  2HD0 A;  3JCM c;  2BKD N;  3MET A;  2YLB A;  2K57 A;  3CCM A;  4R56 A;  3PMT A;  2XK0 A;  4XTY A;  3FB9 A;  3G4S A;  5GAN 8;  2WSF E;  3CCE A;  4IUQ A;  4PNO A;  5GMK e;  3I55 T;  3JB9 F;  4YTL A;  2YLC A;  4BY6 C;  3DKM A;  2M1H A;  2DD5 A;  4NL2 A;  4PL6 A;  2XDD A;  3L2U A;  1U8R A;  3QII A;  4GLK A;  4BDZ A;  2LDM A;  2VV5 A;  1G3S A;  2RK1 A;  5DLQ E;  4M7A A;  1O75 A;  1YI2 A;  4BE0 A;  2DTI A;  2VUB A;  1QP2 A;  3L2W A;  2JOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...