2RD1A

X-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
TNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative outer membrane lipoprotein
publication title X-Ray structure of the protein Q7CQI7.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Structural genomics, unknown function
total genus 5
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rd1A00
4M75A 4C8QC 1D3BB 1BIAA 4OP0A 3AHUA 4M7DG 3V8KA 5I21A 5GAN3 1Y96B 2RM4A 4A54A 2EAYA 5GAN2 3FJPA 3JCMe 3SWNA 5GAOr 2YLCA 3JCMh 5LJ5g 4M78A 5GAOp 5LJ3d 3L2ZA 4C8QA 4XTZA 4EMKC 1JBMA 2JN0A 4XU0A 3HFOA 4J6XA 4PJOF 4C92G 5LJ5j 5GAMd 4HT9A 5GAOq 4PJOB 3JCMc 3RERA 5LJ3f 2QTXA 4F7UA 2DTIA 5GAMf 1TH7A 4M77F 3RESA 2Y90A 5LJ5h 5GAN5 4M77B 3FIFA 4JRIA 4RCCA 2DVEA 4N0AA 4XTWA 4M7AF 5GMKm 4C92E 3V8JA 3JCMd 4XQ3A 4JRKA 1B34B 4C92C 5GAOm 3JB9F 4M7DA 3VU3C 4NL3A 2DTHA 1WQWA 1LOJA 2DXUA 3INZA 4M75F 4J6WA 3JCMf 4XTYA 4M75B 3JCMP 5GAOn 2CGHA 5GMKj 1N9SA 4JUVA 3EFSA 2DZ9A 3RKXA 1I5LA 2DKGA 3BFMA 2RA2A 1I4K1 4C92A 3SWNB 4XU1A 1WNLA 4XTUA 4M78F 4QVCA 2DXTA 4WF2A 4M7DE 4PJOD 4C8QF 5GMKi 3GIBA 1WQ7A 5GMKh 3RIRA 3SB2A 2E10A 4M77D 5GANg 3HSBA 1KQ2A 2DJZA 4F7UF 2EJGA 2K57A 5GAN6 5LJ5e 4F7UB 3RKYA 3JCMW 5GANj 2FB7A 2EJ9A 4M7AD 2EWNA 2RB6A 4EMKA 4A53A 1BIBA 4M7AB 4PJOE 5GANe 4X9CA 3JB9D 1WPYA 1JRIA 3RUXA 5GANh 4M75D 4HT8A 4M7DF 4PJOC 2YLBA 3JCMV 5DY9A 4M7DB 4M77E 4C8QE 5GAN8 2DEQA 4XTXA 4X9DA 1M8VA 4M77C 4JLIA 1U1TA 4M78D 5LJ3g 2YHTA 1U1SA 4C8QD 4C92F 5LJ5d 2ZGWA 5GAMg 3L1AA 1N9RA 4MMLA 3RKWA 5GMKe 4M78B 5GAMj 4M75E 4PJOG 5GAN4 4C8QB 4QVDA 5LJ5f 3JCMJ 5CAIA 4NOYA 3JB9J 4M75C 3JCMb 2I2LA 4F7UG 2E65A 4XTVA 2EJFA 4M77G 3JB9I 1I8FA 3QUIA 3V7CA 5GAMh 4M78E 3SWNC 3JB9H 4M7AG 3JCMg 4EMGA 1KQ1A 2HNIA 5GMKl 4EMKB 4J5YA 4M78C 1D3BA 4NL2A 4RCBA 4M7DD 5GAOl 1MGQA 3V8LA 1Y96A 3QHSA 2VXEA 2RD1A 4J6YA 3JB9G 4F7UE 1X01A 3V7SA 1H641 4M75G 3JCMQ 3HFNA 4M7AE 3QO3A 4PNOA 4C92D 3BY7A 4V2SA 4N0AC 3EFRA 2DZCA 4M7AC 2FYKA 2E64A 4PJOA 2E1HA 2E41A 4M78G 3PGGA 4Y91A 4XU3A 4C92B 3BDUA 3FB9A 3M4GA 4C8QG 5LJ3j 5GAN7 4M7DC 2VC8A 4XU2A 3V7RA 4M77A 5GANd 1HK9A 4EMHA 5LJ3e 1LNXA 4M7AA 5LJ3h 4DQ2A 5GAMe 1YCYA 2DTOA 1I81A 3BW1A 1B34A 3JCMX 5GANf 3QSUA 1M5Q1 4HA8A 1HXDA 2VXFA 1LJOA 4MMKA
chains in the Genus database with same CATH superfamily
1IRXA 3D7SB 1KIKA 1RL2A 2CZ6B 2ZPFB 4BI3A 1OX9A 2RHZA 2EW3A 1JBMA 1WHHA 5I2SA 1Y57A 5GAOq 2MWPA 5IHKA 1VQ5Q 1VQ4A 2JZ2A 1N8RC 2C0OA 2Y4XA 2AT1B 1NLPC 2RJFA 1NJIC 1MMNA 2MAMA 3EG9A 4ATOA 2PVDB 2X51A 1C6VX 1JU5C 5IAYA 1V76A 4KGXB 1I4K1 3GIBA 3SHWA 1Q81U 3LLRA 5EG2A 3M9QA 4HCBA 4HVWA 3VS5A 4F7UF 2R5MA 4QT7A 2DD5A 2K3XA 2L0AA 3U23A 3VS0A 4FT4A 2GQIA 4M75D 1YJNA 1IGUA 1WX6A 2EGAA 4M7DB 2L5QA 1PHTA 3CMEA 3NHNA 5IH2A 1AZEA 1U1TA 2C06A 3CCEA 4C8QD 1ZHIA 2KI7A 1O75A 4KGZB 2MOXA 2FVUA 3TQ7P 4JRPA 3F70A 1K4US 1Q81R 2KY9A 1ZUKA 3CCVT 2F2VA 2OTJQ 1I8FA 1KJWA 3V7CA 1Q7YC 4JZ3A 3OS2A 2X4WA 2L3PA 1OQKA 1W2BP 2JMCA 4M75G 3C95A 1IO6A 4M7AE 4N0AC 2LC4A 4LDXA 1QWFA 2CS7A 4C8QG 3LWHA 4C0GA 1G2BA 3QWYA 4PJLA 1YIJQ 1HK9A 1EX4A 1ARKA 1SSHA 2BUDA 3DB4A 3KFVA 3PVLA 4HXJA 1ACMB 4UC4A 3URGA 4D8KA 2P4RA 4C8QC 3V8KA 3MEWA 3A8LB 2RN8A 4MZMA 5LJ5g 5FW9A 2B86A 2KEAA 1DJ7B 2LZ6B 2DBKA 2KROA 2RQUA 2DIGA 3QBYA 1M1GA 2RO0A 4X1VA 2PU9B 1BU1A 4N0AA 4CI0C 4M7AF 1BI0A 4C92E 2IG0A 2K9GA 3G7ZA 1S72A 2XKOC 2QEXA 2ECZA 1W6XA 3UF4A 2FO0A 1VQMT 3H6ZA 1KK7A 1UB4A 4RG8A 3SWNB 3OS1A 2K3BA 2DX1A 1KQSS 1PG5B 1D0XA 4J7IA 3WXMB 2E70A 4BI4A 3M0PA 2DJZA 4DA4A 3RKYA 3G71T 3THKA 2FB7A 3CCUA 4MDXA 2YSQA 4BE2A 4PK4A 4M7AB 4PJOE 5GANe 2HBPA 3R6OA 3HRSA 1Z9ZA 5GANh 5D6WA 1Q95G 1WYXA 3TSWA 1X6GA 1M2VB 3G6EA 1SRMA 2CP2A 1KC8C 3CCQA 4C92F 1YITT 3QG1A 2EYZA 1QVFP 1AWOA 3OW2P 4CC4B 2E65A 4OF1A 2V1QA 1YI2Q 1QVGA 3OBYA 1WA7A 3OYAA 2V8KA 1LCKA 3OYFA 2D1XA 3P8DA 1AOJA 2VXEA 1AVZC 2L2PA 1M1FA 1JXMA 4AG2C 1OPLA 2XD0A 4OMLA 4BE0A 3CD6Q 4Y91A 1X2KA 4C92B 2DYIA 5LJ3j 1PM3A 4J9FA 1C0MA 1RAHB 1FMVA 3QYGB 1M5Q1 1YJNT 4ZGEB 2LNVA 1LJOA 1K9AA 3L2RA 3CMET 2XI9A 4C5IA 3CCET 4GY5A 1UDLA 3L2ZA 2EVRA 2MMPA 3OYGA 2AHJB 2HEQA 3GF5A 2YUOA 2QA4T 4PJOB 3OYJA 2E3IA 3A8MB 1TG0A 4M77F 2LCCA 3I56T 3FIFA 3RR6A 2WSFE 2LT1A 3OYNA 2VGNA 1TSFA 3LX7A 4JRKA 3M58A 1YHQA 3PVQA 2EFIA 2DTHA 4BY6B 2D0QB 4KH1B 2KYMA 1JJ2S 1I5LA 1M30A 1WJRA 2LVMA 2BE9B 2K5LA 5AYFA 3CCJQ 2NUPA 3CCLA 2LDMA 2HSEB 1VQKA 2K57A 5LJ5e 2RH2A 1R8OB 1W70A 2EQIA 2BTTA 4FYWB 1BIBA 3HTRA 3PE0A 4A4EA 1N6AA 1QW1A 4QVZA 1OX8A 3TEEA 2RJDA 2SEMA 2ZPBB 1YN8A 4OMNA 3G1JA 1VUBA 1T3LA 5CQYA 1BB9A 1S72T 1G3YA 4NL2A 4M7DD 1K9MC 3S6WA 2HQXA 2ZPIB 2F2XA 2JTMA 1X69A 2KR3A 1BCOA 3HHTB 2O88A 3OQ5A 3VRYA 4OMFB 3FB9A 1OEBA 2RMOA 4XU2A 4AFZC 1VIEA 2O31A 4EMHA 4F04B 1LNXA 2CUBA 5GANf 4DOWA 2CH4A 2K6DA 4C8QE 2EGCA 2E6NA 3G6ET 4OP0A 4M7DG 2KXCA 4EIKA 3J7AF 4PFOA 2FRWA 3ZFJA 3C4SA 5LJ3f 2R57A 2EYYA 2CZ1B 2OAWA 2LJ3A 5I11A 2MYSA 3E9GA 2LMJA 1NYFA 4KRTA 3JCMd 2PZ1A 1WXTA 4M75F 2QTVA 5GMKj 5FWCA 2DZ9A 2CSQA 2DKGA 3QDFA 4QVCA 4C8QF 3VUZA 2A7YA 2YUNA 1OI1A 5CKFA 3SB2A 1YJWQ 3UA7A 1AD5A 2CREA 4A4KA 1HD3A 2VKNA 1HYOA 2EWNA 2KSSA 2LQ8A 1E6GA 2X3WD 3QDRB 3EH2A 4E2FB 3CPWS 3X25B 4B6MA 2EGEA 1BI2A 1IZ6A 1GBRA 3CCMQ 3I5RA 4JS4A 1VQ6A 4JLIA 2D8HA 1RAGB 4B9WA 1WJQA 4CC2A 4C8QB 1ZQ1A 4NOYA 1Z9QA 4C5EA 4PFZA 4AMCA 3A5ZB 1MHNA 4HVUA 1IXDA 4M78C 3EHQA 3FJ5A 3C12A 3CC4A 1NE8A 3VJPA 4PFPA 1VQ8T 3SEMA 1H641 1WGSA 2H3EB 2CZ0B 4OB1B 2JS0A 1PD1A 2D6FA 3OSSC 4X34A 1HJDA 2YUPA 2RHYA 4OMOA 3CCLT 1SF9A 1VQKT 2CUDA 2GQVA 4AT1B 3CBPA 2YT6A 2J6FA 1VQPQ 4IKFA 4FM4B 2DTOA 2A08A 2L3SA 2DA9A 4BD3A 4MMKA 2QEXQ 3M5AA 5GAN3 4F14A 3UA6A 1VQLQ 4Z88A 5CKEA 4M78A 3NTHA 4FYVB 4RMOA 5KE2A 3L2UA 1IB8A 2K3YA 1AWXA 1U3OA 4C0DC 5FLXE 4HCKA 1RACB 2JOYA 3NTKA 2R58A 2CP0A 2LCSA 4J6WA 5GAOn 3E19A 2YDLA 1UHCA 2EIFA 4M4ZA 3IQLA 4PJOD 3FLGA 1QCNA 3CCQQ 5A2QE 1G5VA 2IPOB 2FEIA 3RIRA 2A28A 1CSKA 1SKUB 1KQ2A 3R6NA 4C0FA 3KBGA 1RABB 4JLGA 4Z89A 1D0YA 1X75C 1PRMC 3MKDA 4LDVA 2MIOA 2P0KA 1NYGA 1KQSA 2G3RA 2M0YA 1GBQA 1UUEA 1AWWA 2PUOB 3M53A 5IHNA 2I0NA 1BBZA 1W1FA 4A4FA 1FX7A 4PJOG 3CXCA 4QVDA 5CCAA 4ESRA 3EG2A 1KHIA 3QUIA 1SHFA 5L8RE 1ZUUA 5GMKl 1NBEB 3QHSA 8ATCB 4DBQA 2CSIA 4RKUE 3V7SA 2H8HA 2DAQA 4FT2A 4PNOA 1D0ZA 1NEBA 2X35A 5J26A 3G4SQ 1BI1A 5GAN7 4J9CA 2DEUA 2DK3A 2DMOA 1M4ZA 1T0HA 5KE3A 3OYMA 4JJBA 2KMTA 4GLMA 3NTIA 3EHRA 1YHQQ 1LVKA 1QVGP 1W2BS 3VS4A 3FJPA 3VS7A 1OV3A 5KCHA 5GAOr 5GJWB 2CT4A 1VQMA 4FW1A 7AT1B 1M1KU 4BE1A 3I5SA 4AFSC 2JT4A 4A63B 5GMKm 3G71A 3FDRA 3V8JA 1AWJA 4ZTFA 3MEVA 1WQWA 1I0CA 2OTLT 4LUDA 2VV5A 3OMCA 2EYQA 1W4SA 3REBB 6AT1B 2FZGB 2JNGA 3CMAT 1NLOC 3MO8A 5CIUA 1YITA 3CCRT 5GANg 1M2OA 4QKUA 1M1KR 1VYTA 4HT8A 1D09B 3A98A 4M7DF 2YLBA 1QP3A 2CT3A 1NZ9A 5LJ3g 3LH0A 2P0PA 4LN2A 2M1HA 2ZGWA 1FWZA 3M0QA 1N9RA 3M54A 5GAMj 5GAN4 1VA7A 4RTXA 4XTVA 3CCST 1JEGA 1ZA1B 4M78E 5HK3A 4BDZA 1GL5A 5GAOl 1MGQA 2J06A 1KHCA 3QWXX 4VUBA 4EPCA 3EFRA 1MUZA 2D8JA 3Q1JA 1VQOT 4IUPA 1N8RU 2NWMA 3VUBA 1YI2T 4FU6A 1UGPB 3J81E 3OW2S 2QA4A 1NJIU 2KRSA 1H3HA 2PTKA 2RQTA 4LD9K 1QWEA 3JCMX 5CKBA 3I56A 3OYYA 1HXDA 2VXFA 1PSFA 4O5VA 2QGGA 4OVAA 1WHMA 1RI9A 2GF7A 3CD6T 2VYTA 5FU7C 4Z8AA 3E1SA 2PNIA 4EMKC 2RHUA 1VQ7T 2RQRA 1MV3A 1RLQC 2KAFA 2A37A 3GP8A 3M4YA 2DTIA 5D7UA 1N8RR 4RCCA 2K79A 4LDUA 4XTWA 2FHDA 1QKXA 1NJIR 1M3BA 1TUGB 5GAOm 2F1LA 2QDLA 3UATA 5KYXA 2LQWA 3JCMP 2DVJA 1WIEA 1N9SA 4JJCA 3UT1A 4R0KA 2DXTA 4D6WA 4LXCA 1QLYA 2RI2A 3H8ZA 2GGRA 1Q7YU 3HSBA 1G3WA 2HQEA 4EDUA 4JPBW 4WTOB 2YRDA 5FU6C 4EMKA 3L42A 2CP6A 2EQJA 3LWIA 2F5KA 2ZAEA 3T9NA 3CC4Q 3P8BB 1YWOA 5DY9A 1D1BA 1EIFA 3UPUA 3CBMA 2KYBA 2BZ8A 3A8GB 1NM7A 4KT0E 1K0SA 2QQ9A 2BZXA 4IUTA 5DLOA 4ME7A 2AZVA 3OYEA 2ED1A 1Q7YR 3H0HA 1IHWA 2FG0A 1RAFB 1ABQA 4B9XA 4BACA 3V8LA 1Y96A 2IIMA 2LRQA 4C0DB 5CKHA 1TTHB 3GBQA 2JXBA 1C1AA 2DL7A 2DZCA 3BE3A 2FYKA 1U8RA 2QASA 1X43A 3M4GA 3MJXA 5CKDA 5DM7R 2A36A 5LJ3e 5LJ3h 1AZGB 2QDYB 1E6HA 2A3LA 5KYUB 3C0CA 2E12A 2DJQA 3OB9A 4E7LA 3NFCA 1KD1C 3FRNA 3OMGA 2SRCA 4JRQA 1E7OA 1YJ9T 5FWBA 2YLCA 1Y7XA 4DOVA 4J8OA 1GXIE 3HFOA 4PJOF 3RERA 3CC2T 4IUQA 5AT1B 2QXFA 1UGVA 1WZOA 2DD4A 5FRNA 2K5IA 3I55T 3CPFA 4ZTJA 3CCVQ 4PJNA 1VQ9T 2OX7A 3PTAA 1KC8U 3JCMf 2NUTA 2CGHA 1OU8A 3EFSA 3CC7T 2YRVA 1WI7A 3PNWC 3MP6A 1OU9A 3EFOA 5KCOA 1RAIB 2XK0A 2AK5A 4CC3A 1VQNT 1X2QA 1TOVA 1YP5A 1M90C 2EYXA 4BI8B 1VQ8A 3RMSA 3JV3A 1KC8R 4ANJA 2NLUA 1YJWT 5CVIA 4K11A 4RTYA 2DIQA 3KUFA 5CAIA 1QCFA 1Y07A 3JB9I 1MMDA 2VUBA 3CCMT 1D3BA 1UGQB 3BDLA 1M9SA 3EG9B 1SPKA 2DM1A 3CEYA 2QQRA 2E6ZA 3S3MA 2E1HA 5KYWA 3PGGA 3QPHA 5A0DA 3CXCP 3TSZA 1RADB 1I81A 3G71Q 2GTJA 3ZL7C 4HKEA 1G3SA 3LW5E 2LJ1A 3VS3A 1PC0A 4IIMA 1B07A 1XTDA 1I07A 2ROTA 1H92A 1PWTA 5LJ5j 1PRLC 5GAMd 2E4HA 3X26B 1YITQ 1VQ4Q 2CH4W 4JRIA 2O4XA 1KSWA 4OB3B 3L2WA 4RTWA 2KDSA 2KE9A 4N4HA 2DE0X 4F17A 2XG8D 1YFNA 1U06A 4JUVA 2J6KA 3RNJA 1UGSB 2RJEA 1BKBA 1IGQA 3HRUA 1OOTA 5ECAA 5GMKh 2HD0A 3JSCA 5HY6A 2HQHA 2QQBA 1H8KA 1RUWA 1UTIA 1K9MU 3EAEA 1H3ZA 3O8VA 1K76A 4X9CA 2XICA 1FXXA 2X4JA 4FCYA 1YJNQ 5L23A 2QQAA 5KYXB 2PVGB 1WXUA 3CMEQ 4M78D 3ULRB 1U1SA 2K4YA 1WJSA 3CCEQ 3L1AA 4J9GA 4HCZA 2YXYA 4DEYA 1SRLA 4F7UG 2QA4Q 2OTJA 1ZUYA 2JM9A 2W0ZA 1JQQA 3NPFA 1K1ZA 5FU7B 2D9TA 3I56Q 1TU0B 4Y28E 4EMKB 3EG3A 3OYHA 2K2MA 1K9MR 2RD1A 4HCCA 3N5BB 1QCOA 5CK9A 4RUGA 1P92A 1RAEB 3PT9A 1X27A 2P4TA 3TCJA 4F16A 2KXDA 3ME9A 4M78G 3OSVA 5DLQE 2EKHA 2XMFA 3OYLA 1Q82C 1XNIA 1ZX6A 4OGCA 4C0ZA 1K8AC 4J7FA 4IURA 2FL7A 4C5HA 1Y96B 1WHJA 4OMQA 3G4ST 1QQJA 2OTLA 5FU6B 1FMWA 2CP7A 5GAOp 2X4YA 1NG2A 2HKNA 1JO8A 1O9SA 3GPLA 4F7UA 2MCNA 3CMAA 5GAN5 1EFNA 3CCRA 2VWFA 1WHLA 3L2VA 2DRMA 3RDVA 1S72Q 2CYZB 1QVGS 1LOJA 1PCXA 1XQHA 4XTYA 1Q86C 4A4GA 2C0IA 1X6OA 4E6RA 2RNAA 3DKMA 4RTZA 2PUKB 2RK1A 4OB2B 2M16A 3X24B 3MCAB 3OS5A 2K2VA 4JDSA 3M59A 4ZGDB 1VYVA 3CCUQ 1YNZA 2L3RA 3CCSA 2QGFB 2OAUA 4E7HA 4IUVA 2ABLA 5GAN8 1X6BA 4BB7A 3G6EQ 3OBWA 4OMMA 1FMKA 5KH6A 3LYIA 4OMPA 1VQ5T 2EBPA 3RKWA 1V29B 2KNBB 5IN1A 3JCMJ 3QXEB 1VQOA 2QAZA 1NPPA 2LX7A 2EQKA 1YI2A 2QYZA 3EFOB 4J83A 2DPPB 3JCMg 1UJYA 3PMTA 3EGXA 4BDYA 2XHCA 4FIBA 4KGVB 3E9FA 2F69A 4V2SA 4QQGA 3CD6A 1JXOA 4J9IA 3JRZA 3QZ5B 2IVWA 2HCKA 2H3JA 4J9EA 1ZSGA 1VQ7A 2DL3A 2NUPB 1K73C 4M7AA 1D1AA 2K5FA 3BW1A 4JS5A 3SD4A 2FZCB 2CDTA 1MNEA 3OY9A 4FYYB 1D3BB 1BIAA 4GLKA 2RM4A 3OYCA 2AIRB 2GNCA 2KT1A 4XU0A 4J6XA 4YTLA 1ZLMA 3QKJA 5KYWB 2OTJT 5CQXA 3RESA 4ZN3A 1I1JA 4J9HA 2ZCFB 2E5QA 2MWOA 2JVVA 4KUIA 3MEUA 2MI6A 2EPDA 2GFAA 3VS6A 1VQ8Q 4RG2A 4C92A 1YIJT 3ASKA 2EQMA 2OJ2A 4WF2A 4N4IA 1K73U 2JJ9A 1WHGA 3FC3A 3CCLQ 1VQKQ 4L59A 1SEMA 4JJDA 2FPDA 2O4XB 2GCXA 2E3HA 1UECA 2O9VA 2W10A 2DEQA 1M8VA 4M77C 2HSPA 5LJ5d 3DLMA 2YWWA 4MMLA 1RLPC 3JCMb 5IXBA 1K0XA 2XDPA 5GAMh 2A0FB 2J05A 3H0FA 4ORZA 3JAME 2NYSA 1OZ3A 1JJ2A 1UE9A 2Y4YA 2Z0WA 5IXFA 4FL6A 2LCLA 3M56A 4J6YA 4O6JA 4F7UE 5KYYA 1TUDA 1SSFA 3RMQA 1RAAB 1SHGA 1YJ9A 2E41A 3EGDA 3BDUA 4M77A 2L3QA 5A0LA 3CC2A 4DQ2A 1YCYA 1KG1A 1B34A 1TUCA 4J9BA 3JCMQ 3EH1A 3I55A 1T3SA 3OYKA 1VQ9A 1BI3A 2DRKA 4KBMB 3JCMe 3OS0A 4Y92A 3JCMh 1R0CB 2ED0A 2PVOB 3CC7A 1HSQA 2QQSA 4RTUA 4OB0B 1QVFS 3X20B 4WCIA 4R56A 4E7SA 1VOMA 4ELYC 1ZA2B 2DL8A 2KBTA 3MEAA 3H41A 1EZZB 2LQNA 2K7AA 1VQNA 2ZPGB 1J3TA 4PKCC 2LT4A 2COWA 3GLXA 1A0NB 4M78F 1OPKA 1YJWA 3S3OA 5HK0A 2E10A 3PFSA 2QI2A 4PLIA 2KK4A 2CKKA 5FROA 1UEBA 4F7UB 3QZ9B 1PD0A 4A53A 1N5ZA 4RTTA 2LQKA 2E5KA 1BK2A 3NGPA 1ZBXA 3CCMA 2EQUA 4X9DA 2BE7D 2DETA 5J3BA 3EG0A 3VYGA 2YHTA 3ZBDA 4FSSA 1VQ6Q 2V8IA 2COYA 4E7KA 3EGUA 4M78B 2WSEE 4ELZC 1G8XA 4M75C 3O5ZA 1GRIA 5EC7A 2JM8A 2DF6A 2DO3A 4RCBA 1TWBA 1TXQA 2RHIA 4XAXB 2LNHB 5FRMA 3HFNA 3CCJT 2HAXA 2OTLQ 1M27C 3BY7A 2AZSA 5GJVB 3VS1A 4QQDA 2FRYA 4XU3A 2RQWA 1YCSB 2DXBA 2X4XA 3EG1A 1VQPA 3CMAQ 2GTOA 3CPWA 3CCRQ 2ATCB 4HA8A 3RKXA 2JUFA 3QIIA 4E47A 4LDWA 4M75A 3HKSA 5LL6S 5C0MA 1VQLA 3S3NA 3EGXB 4A54A 4IUUA 5GAN2 4JJNK 1XJWB 4C8QA 4P5NA 4NS5A 2QTXA 4KUDK 1GCPA 2KQWA 2O01E 1TH7A 5GAMf 1UFFA 1Y71A 3REAB 3CXCS 4MZTA 2HDAA 4XK8E 3CCSQ 3VU3C 3KXTA 1MMGA 3WVDB 2RI5A 4LD6A 1NPRA 4XU1A 2LTOA 4QW2A 1VQ4T 1OULA 2RI3A 1SG5A 4AFUC 3GOXA 1VQOQ 2EJGA 2M02A 2LP5A 5GANj 1B3QA 2EJ9A 2AKKA 2JS2A 2DBMA 4TVRA 1NEGA 2DLPA 5D6XA 3JB9D 1JRIA 3UWNA 3OA6A 4RTVA 1CKBA 3H9NA 3JCMV 3P8HA 4M77E 4MDWA 2P84A 2X3XD 5A0GA 4E7IA 1BCMA 2ESWA 5I22A 3CQTA 1VIFA 3NMZC 4FYXB 1VQ7Q 1I5OB 2I2LA 3QYHB 4J9DA 1D1CA 1KD1U 2VASA 2HNIA 3SFMA 3PIOA 3JB9G 3MPUB 2J6OA 1PKTA 1WLPB 5KYNA 1G3TA 3QO3A 3G4SA 4E7JA 1PNJA 3DB3A 2RHXA 1JB0E 5M9OA 4HVVA 1WFWA 3OYBA 4XTUA 4KULA 4A4HA 2ROLA 3AHUA 1KD1R 2XIDA 2M51A 2FZKB 5KYYB 2BZYA 4LUEA 3PIPA 4XTZA 2JN0A 1KQSP 4HT9A 5D6YA 1YBYA 1ZSZC 1VQMQ 1V1CA 2L89A 3EGDB 4AFQC 2FPEA 4II1A 2HMAA 5LJ5h 1GFCA 2HZYA 3CBOA 4M77B 1GCQC 1MNDA 1M90U 1T0JA 5HKCA 2AKLA 5J39A 4KH0B 1B34B 3I9QA 4NL3A 1CKAA 4FW2A 4FSXA 2RA2A 3VV0A 2CP5A 1M8MA 2XDDA 1VQ5A 2O9SA 2RQVA 1VQPT 2EKOA 2WSCE 3JCMW 1TS9A 2KRMA 1W2BA 2QEXT 1ZSZA 1WPYA 2CP3A 2KGTA 1VQLT 2F5TX 2JTFA 1M90R 1GCQA 4L6V5 4JZ4A 1YJ9Q 2DNUA 5GMKe 2XU8A 4M75E 2KT8A 2LJ0A 2DERA 3CCUT 3MP8A 2LX9A 2F2WA 2MPXC 2VGMA 1UJ0A 1N27A 3CC2Q 5I2MA 1U5SA 2HL5C 3PMIA 4J5YA 3ZEHA 1PKSA 1ZBJA 3SDZA 3I55Q 3E2UA 1X01A 1YWPA 4L5GA 1VQ9Q 1FYNA 3DLLA 3CCQT 1M3AA 4QQ6A 4MZPA 3UDCA 3CC7Q 2OI3A 8AT1B 3VS2A 4PJJA 1RI0A 2G6FX 4M7DC 3OYDA 2X9HA 2M0OA 9ATCB 3GNFB 1WHKA 1AEYA 2FPFA 1AT1B 4N4GA 2JMAA 4LE9A 1VQNQ 4ZNXA 2EAYA 2ZPEB 1JJ2P 1BYMA 3TU4K 3VYHB 2DXCA 4CRIA 2JW4A 2ZZDA 2L8DA 1YIJA 1G83A 2CZ7B 3HRTA 1MMAA 2DVEA 2HBWA 4XQ3A 1GFDA 4BUGA 2PQWA 4M7DA 2DXUA 3INZA 4M75B 4ZN1A 3M0RA 4D8DA 1QVFA 5CO7A 3M55A 3BFMA 2ENMA 3OW2A 2MK5A 1UG1A 3MHXA 2RPNA 1WQ7A 1IHVA 3L2QA 4DBHA 5GAN6 4ZGJB 4M7AD 2RB6A 4DBRA 1YHQT 2RF0A 4IIOA 3RUXA 1IREB 3OYIA 3A8OB 2EYWA 1QMCA 4XTXA 2MF2A 2QG9B 5GAMg 2DYBA 1ABOA 1Q82U 5LJ5f 2HKQB 3JB9J 4PJMA 4C5GA 1K8AU 2EJFA 3HP9A 1LPLA 1XOVA 3FEOA 3SWNC 4M7AG 1PSEA 4PL6A 3TVTA 5IHIA 1QKWA 3VKIA 1UGRB 1S1NA 1AHJB 3LH5A 3MP1A 1R77A 2NUTB 4C92D 1QP2A 1QVPA 4M7AC 3M0UA 2R5AA 2V1RA 2VC8A 5GANd 2C0TA 5C6SA 1Q82R 1F1BB 1Q86U 5IT9E 1K8AR 1OYXA 2VB6A 3WVEB 5I21A 4LNPA 2NUZA 1KFZA 3SWNA 2XDBA 4LDYA 2M9UA 2RK2A 2D0NA 2P0QA 5LJ3d 4C92G 2JTEA 3AT1B 3JCMc 2YUQA 3X28B 3J80E 1R0BG 2Y90A 3RBBB 3H0IA 3HL8A 2ZPHB 3ER0A 4CC7A 3CCVA 4OGEA 3A8HB 2KVQG 4C92C 3JB9F 3CPWP 1M2VA 2B8AA 4E7ZA 1Q86R 2DL5A 2V26A 1VYUA 1MV0B 1WNLA 4R55A 3QJYA 5GMKi 3QJ6A 4M77D 4DBFA 3M0SA 5KYUA 2VVKA 5CR2A 1M1KC 2DL4A 1WXBA 3M57A 3HPWA 4PJOC 2V8JA 3VRZA 1B7TA 2QK0A 1WDXA 3CCJA 2GBQA 3I35A 4DEXA 2J7IA 3LGFA 4BY6C 2BKDN 3META 2GFUA 1OZ2A 3A1PA 3TREA 4M77G 3JB9H 3LGLA 4EMGA 1KQ1A 3M0TA 1ZSZB 3GNGA 4Z02A 1VQ6T 1M3CA 5HCKA 2HL3A 2COZA 2O2OA 2BIVA 1Y0MA 2DFUA 4PJOA 2E64A 1UHFA 4M7DE 2WACA 3C94A 2RJCA 4PLLA 3V7RA 2KRNA 1K73R 1Q81C 2DILA 5GAMe 3CC4T 4Q5WA 4GBQA 4AG1C 2YRCA 3QSUA
chains in the Genus database with same CATH topology
2JUFA 3QIIA 4E47A 4LDWA 1RL2A 3HKSA 4M75A 2CZ6B 3M5AA 5LL6S 5C0MA 1VQLA 5GAN3 2ZPFB 3S3NA 4BI3A 4A54A 4IUUA 1XTDA 5GAN2 2RHZA 4JJNK 5CKEA 4M78A 3NTHA 4MMKA 4C8QA 1JBMA 5LJ5j 5GAMd 4RMOA 5I2SA 5KE2A 5GAOq 2MWPA 4P5NA 4NS5A 3L2UA 3X26B 2QTXA 1VQ4A 2K3YA 4KUDK 2JZ2A 2KQWA 2O01E 1TH7A 5GAMf 1N8RC 4C0DC 1Y71A 4JRIA 2O4XA 2Y4XA 5FLXE 3CXCS 4MZTA 4OB3B 3L2WA 2RJFA 1NJIC 2JOYA 2KDSA 3NTKA 4XK8E 2R58A 2MAMA 4N4HA 3VU3C 3KXTA 4ATOA 2PVDB 4J6WA 2XG8D 3WVDB 5GAOn 3E19A 2RI5A 5IAYA 4JUVA 2EIFA 1I4K1 4LD6A 1NPRA 1UGSB 4XU1A 2LTOA 2RJEA 3FLGA 1BKBA 4QW2A 5A2QE 1VQ4T 4PJOD 3GIBA 1G5VA 1Q81U 3HRUA 5GMKh 3LLRA 2RI3A 3RIRA 2HD0A 3JSCA 3M9QA 5EG2A 5HY6A 4HCBA 3GOXA 1KQ2A 4F7UF 4C0FA 2R5MA 2EJGA 2QQBA 3KBGA 5GANj 4JLGA 2EJ9A 2DD5A 2K3XA 1X75C 1K9MU 4TVRA 3EAEA 1H3ZA 5D6XA 3O8VA 3JB9D 4X9CA 2XICA 1JRIA 3UWNA 4FT4A 1FXXA 4M75D 3OA6A 1YJNA 4LDVA 2P0KA 2X4JA 3JCMV 4M7DB 3P8HA 4M77E 2QQAA 4MDWA 2L5QA 1KQSA 5A0GA 3CMEA 2PVGB 2G3RA 4E7IA 2PUOB 1U1TA 3M53A 4M78D 2C06A 3CCEA 1U1SA 4C8QD 2K4YA 1WJSA 1ZHIA 3L1AA 1O75A 4HCZA 4A4FA 1VIFA 2FVUA 1FX7A 4PJOG 3CXCA 4QVDA 4JRPA 3F70A 2I2LA 4F7UG 5CCAA 2OTJA 2KY9A 3CCVT 1KHIA 1I8FA 3QUIA 3QYHB 3V7CA 1Q7YC 5FU7B 5L8RE 1KD1U 2D9TA 2HNIA 4Y28E 3SFMA 4EMKB 5GMKl 3PIOA 3OS2A 2X4WA 3OYHA 3QHSA 2RD1A 3JB9G 4RKUE 4HCCA 3V7SA 3N5BB 5CK9A 4M75G 1P92A 2DAQA 3C95A 3PT9A 2P4TA 4FT2A 1G3TA 3TCJA 4M7AE 3QO3A 4PNOA 3G4SA 4N0AC 2LC4A 2X35A 5J26A 4E7JA 3ME9A 4LDXA 4M78G 1BI1A 3OSVA 2CS7A 5DLQE 4C8QG 4C0GA 5GAN7 3LWHA 3DB3A 2RHXA 1HK9A 1JB0E 5M9OA 3OYLA 1Q82C 2DK3A 5KE3A 1M4ZA 2BUDA 3DB4A 3OYBA 1XNIA 4OGCA 4C0ZA 3OYMA 1K8AC 4XTUA 4KULA 2KMTA 4UC4A 4A4HA 4J7FA 4IURA 3NTIA 3URGA 4C8QC 2FL7A 4C5HA 3AHUA 3V8KA 2XIDA 1W2BS 1Y96B 3G4ST 3MEWA 3FJPA 2OTLA 3A8LB 5KCHA 4MZMA 5FU6B 5LJ5g 5GAOr 5GAOp 2X4YA 3PIPA 4XTZA 2JN0A 1VQMA 1DJ7B 4HT9A 5D6YA 1YBYA 1O9SA 3GPLA 2DIGA 2L89A 3QBYA 4F7UA 1M1GA 2RO0A 4II1A 1M1KU 3CMAA 4BE1A 2PU9B 5LJ5h 5GAN5 3CBOA 4M77B 3CCRA 4N0AA 4CI0C 4M7AF 1BI0A 1M90U 5HKCA 5J39A 5GMKm 3G71A 4C92E 3FDRA 3V8JA 3L2VA 2IG0A 4ZTFA 1B34B 3G7ZA 3MEVA 2XKOC 1S72A 2QEXA 4NL3A 2CYZB 1WQWA 1LOJA 1QVGS 2OTLT 1XQHA 2VV5A 4XTYA 1Q86C 4A4GA 1X6OA 4FSXA 3DKMA 3OMCA 2PUKB 2RK1A 2EYQA 4OB2B 1VQMT 3H6ZA 2RA2A 1UB4A 4RG8A 3SWNB 2M16A 3OS1A 1W4SA 3X24B 3VV0A 1KQSS 3MCAB 3OS5A 2K2VA 4J7IA 2XDDA 2JNGA 4JDSA 3WXMB 3CMAT 2E70A 4BI4A 3M59A 3MO8A 1VQ5A 1VQPT 2EKOA 5CIUA 3CCRT 5GANg 1YITA 2DJZA 2WSCE 4DA4A 4ZGDB 3JCMW 3RKYA 3G71T 3CCUA 2FB7A 4MDXA 4BE2A 2L3RA 1W2BA 2QEXT 4M7AB 4PJOE 5GANe 2HBPA 3CCSA 1WPYA 3R6OA 2OAUA 3HRSA 4E7HA 5GANh 4HT8A 1VQLT 2F5TX 4M7DF 2JTFA 5D6WA 2YLBA 4IUVA 5GAN8 1QP3A 3G6EA 4BB7A 4L6V5 1KC8C 1NZ9A 3OBWA 5LJ3g 3LH0A 2P0PA 5KH6A 3CCQA 2M1HA 4C92F 2ZGWA 3LYIA 1VQ5T 1FWZA 3QG1A 1YITT 1N9RA 1V29B 3M54A 3RKWA 5IN1A 5GMKe 5GAMj 2XU8A 4M75E 5GAN4 3JCMJ 3QXEB 3CCUT 3MP8A 1VQOA 2LX9A 1NPPA 2E65A 2EQKA 4XTVA 1YI2A 4OF1A 2VGMA 4J83A 1N27A 3CCST 5I2MA 1QVGA 2DPPB 4M78E 5HK3A 3OBYA 3JCMg 3OYAA 2V8KA 3PMIA 4J5YA 4BDZA 3ZEHA 1VQ7T 3OYFA 3PMTA 1MGQA 3P8DA 3SDZA 5GAOl 2VXEA 4BDYA 1X01A 2XHCA 4FIBA 1KHCA 4L5GA 3DLLA 1M1FA 3CCQT 3E9FA 2F69A 4QQ6A 4VUBA 4EPCA 4V2SA 4QQGA 2XD0A 4MZPA 3CD6A 3EFRA 4BE0A 3UDCA 3JRZA 3Q1JA 3QZ5B 2IVWA 4IUPA 4Y91A 1VQOT 4C92B 2H3JA 5LJ3j 1N8RU 3VUBA 1YI2T 4FU6A 1RI0A 4M7DC 1UGPB 3J81E 3OYDA 1VQ7A 3OW2S 2QA4A 1NJIU 2M0OA 3GNFB 1K73C 4M7AA 3QYGB 2K5FA 4LD9K 3BW1A 3JCMX 4JS5A 5CKBA 3I56A 4N4GA 1M5Q1 3OYYA 3SD4A 4ZGEB 1HXDA 2VXFA 1LJOA 2LNVA 1PSFA 4O5VA 4OVAA 3OY9A 3L2RA 1D3BB 1BIAA 3CMET 2XI9A 4GLKA 2RM4A 2GF7A 3OYCA 2EAYA 4C5IA 3CD6T 2VYTA 2ZPEB 3CCET 1BYMA 3TU4K 3VYHB 4GY5A 5FU7C 3E1SA 2DXCA 2MMPA 3L2ZA 4EMKC 2RHUA 4XU0A 2AHJB 4J6XA 4YTLA 3GF5A 2ZZDA 4CRIA 3OYGA 2L8DA 2QA4T 1YIJA 4PJOB 3OYJA 2KAFA 3QKJA 2CZ7B 3GP8A 3M4YA 2OTJT 2DTIA 3A8MB 3HRTA 4M77F 5CQXA 3RESA 2LCCA 4ZN3A 3I56T 3FIFA 4RCCA 4LDUA 2DVEA 4XTWA 2FHDA 2WSFE 2LT1A 3OYNA 2VGNA 2E5QA 2ZCFB 3LX7A 4XQ3A 4JRKA 2MWOA 5GAOm 2JVVA 2PQWA 3M58A 4KUIA 4BUGA 1YHQA 3MEUA 4M7DA 2EFIA 2DTHA 2DXUA 2MI6A 3INZA 4BY6B 2D0QB 2GFAA 4M75B 3JCMP 4ZN1A 1JJ2S 1N9SA 1I5LA 4RG2A 1QVFA 5CO7A 3M55A 3BFMA 1WJRA 4C92A 2LVMA 3ASKA 3UT1A 1YIJT 2EQMA 3OW2A 2DXTA 4WF2A 4D6WA 4N4IA 1K73U 2K5LA 5AYFA 3MHXA 1WQ7A 2RI2A 3CCLA 3H8ZA 3FC3A 2LDMA 1K9MC 1Q7YU 3L2QA 1VQKA 3HSBA 1G3WA 2HQEA 4EDUA 2K57A 5GAN6 5LJ5e 4L59A 4ZGJB 4M7AD 2RH2A 1R8OB 5FU6C 2RB6A 4EMKA 1YHQT 3L42A 2O4XB 2GCXA 1BIBA 2EQJA 3LWIA 2F5KA 3RUXA 1IREB 3T9NA 4A4EA 3P8BB 3OYIA 3A8OB 5DY9A 1EIFA 3UPUA 1N6AA 2DEQA 3CBMA 4XTXA 1M8VA 1QW1A 4M77C 4QVZA 3TEEA 3A8GB 4KT0E 2MF2A 2RJDA 2ZPBB 5LJ5d 2QQ9A 5GAMg 3DLMA 4MMLA 4IUTA 1Q82U 5LJ5f 5DLOA 3JB9J 4ME7A 1VUBA 3JCMb 4C5GA 3OYEA 1K8AU 2EJFA 3HP9A 2XDPA 5CQYA 5GAMh 1XOVA 3FEOA 3SWNC 1S72T 1G3YA 4M7AG 1PSEA 3JAME 4PL6A 4NL2A 1OZ3A 4M7DD 1JJ2A 4B9XA 4BACA 2Y4YA 3V8LA 1Y96A 4FL6A 2HQXA 2LCLA 3M56A 4J6YA 4O6JA 3S6WA 2ZPIB 3VKIA 4F7UE 1UGRB 2JTMA 1AHJB 3MP1A 2LRQA 4C0DB 3HHTB 1SSFA 5CKHA 3OQ5A 4C92D 1QP2A 3RMQA 1QVPA 2DZCA 1U8RA 2FYKA 1YJ9A 4M7AC 4OMFB 2R5AA 2E41A 3BDUA 3FB9A 3M4GA 2VC8A 4XU2A 5CKDA 5DM7R 4M77A 1VIEA 5GANd 4EMHA 5A0LA 5LJ3e 1LNXA 3CC2A 5C6SA 5LJ3h 4DQ2A 1YCYA 2QDYB 1KG1A 5GANf 1B34A 2A3LA 4DOWA 1Q86U 5IT9E 2E12A 4C8QE 3JCMQ 3OB9A 1OYXA 2E6NA 3G6ET 3I55A 3OYKA 3NFCA 4E7LA 4OP0A 3WVEB 3FRNA 3OMGA 5I21A 1KD1C 1BI3A 4JRQA 1VQ9A 4M7DG 4KBMB 3JCMe 3SWNA 1YJ9T 3OS0A 2XDBA 4LDYA 2M9UA 3J7AF 2YLCA 1Y7XA 2RK2A 3JCMh 2P0QA 5LJ3d 4DOVA 4J8OA 2PVOB 1GXIE 3CC7A 3HFOA 4PJOF 4C92G 3ZFJA 2QQSA 3JCMc 3C4SA 5LJ3f 3RERA 2R57A 4OB0B 3CC2T 4IUQA 3X20B 1QVFS 3X28B 3J80E 2QXFA 2CZ1B 2Y90A 4R56A 2DD4A 3E9GA 4ELYC 3HL8A 2ZPHB 3ER0A 3CCVA 5FRNA 2K5IA 3I55T 3CPFA 4OGEA 3MEAA 3JCMd 4ZTJA 3A8HB 1VQ9T 2KVQG 4C92C 3JB9F 2B8AA 3PTAA 1KC8U 1VQNA 4M75F 2ZPGB 3JCMf 4PKCC 2LT4A 2CGHA 5GMKj 3EFSA 2DZ9A 3GLXA 3CC7T 2DKGA 4QVCA 1WNLA 4M78F 4R55A 3QJYA 2YRVA 4C8QF 3VUZA 5GMKi 2A7YA 3PNWC 3MP6A 3QJ6A 3S3OA 1YJWA 5HK0A 1OI1A 5CKFA 3SB2A 2E10A 4M77D 3PFSA 2QI2A 4A4KA 4PLIA 5KCOA 2KK4A 2CKKA 5FROA 1UEBA 4F7UB 2XK0A 5CR2A 2EWNA 2KSSA 3QZ9B 2LQ8A 1YJNT 4A53A 1M1KC 1VQNT 3QDRB 2LQKA 3HPWA 3M57A 3CPWS 4PJOC 3X25B 1M90C 2V8JA 1ZBXA 3CCMA 2EQUA 1BI2A 1IZ6A 4X9DA 4BI8B 1VQ8A 4JS4A 3RMSA 5J3BA 4JLIA 3VYGA 2NLUA 1VQ6A 2YHTA 3ZBDA 1YJWT 5CVIA 2V8IA 4B9WA 4E7KA 3CCJA 1WJQA 4M78B 3LGFA 2DIQA 2WSEE 2BKDN 3KUFA 3META 4BY6C 1ZQ1A 4NOYA 4C8QB 4ELZC 5CAIA 2GFUA 4M75C 1OZ2A 4C5EA 1Y07A 3TREA 4M77G 3JB9I 2VUBA 3JB9H 3A5ZB 1MHNA 2DO3A 3LGLA 4EMGA 1KQ1A 4M78C 4RCBA 1D3BA 3CCMT 1UGQB 3C12A 3CC4A 1NE8A 3VJPA 3BDLA 3GNGA 1VQ8T 1M9SA 4Z02A 1VQ6T 1H641 1WGSA 2RHIA 2CZ0B 3CEYA 4XAXB 4OB1B 2QQRA 5FRMA 2E6ZA 2BIVA 3HFNA 3CCJT 2HAXA 2D6FA 3OSSC 3BY7A 4X34A 3S3MA 4PJOA 2E64A 2RHYA 3CCLT 2E1HA 4QQDA 2WACA 3PGGA 4M7DE 4XU3A 1VQKT 3QPHA 5A0DA 3C94A 2DXBA 2GQVA 2RJCA 4PLLA 3V7RA 2X4XA 3CBPA 1VQPA 3CPWA 1Q81C 4IKFA 5GAMe 4FM4B 2DTOA 3CC4T 1I81A 4Q5WA 3QSUA 4HA8A 4BD3A 4HKEA 3RKXA 1G3SA 3LW5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 A;  4C8Q C;  1D3B B;  1BIA A;  4OP0 A;  3AHU A;  4M7D G;  3V8K A;  5I21 A;  5GAN 3;  1Y96 B;  2RM4 A;  4A54 A;  2EAY A;  5GAN 2;  3FJP A;  3JCM e;  3SWN A;  5GAO r;  2YLC A;  3JCM h;  5LJ5 g;  4M78 A;  5GAO p;  5LJ3 d;  3L2Z A;  4C8Q A;  4XTZ A;  4EMK C;  1JBM A;  2JN0 A;  4XU0 A;  3HFO A;  4J6X A;  4PJO F;  4C92 G;  5LJ5 j;  5GAM d;  4HT9 A;  5GAO q;  4PJO B;  3JCM c;  3RER A;  5LJ3 f;  2QTX A;  4F7U A;  2DTI A;  5GAM f;  1TH7 A;  4M77 F;  3RES A;  2Y90 A;  5LJ5 h;  5GAN 5;  4M77 B;  3FIF A;  4JRI A;  4RCC A;  2DVE A;  4N0A A;  4XTW A;  4M7A F;  5GMK m;  4C92 E;  3V8J A;  3JCM d;  4XQ3 A;  4JRK A;  1B34 B;  4C92 C;  5GAO m;  3JB9 F;  4M7D A;  3VU3 C;  4NL3 A;  2DTH A;  1WQW A;  1LOJ A;  2DXU A;  3INZ A;  4M75 F;  4J6W A;  3JCM f;  4XTY A;  4M75 B;  3JCM P;  5GAO n;  2CGH A;  5GMK j;  1N9S A;  4JUV A;  3EFS A;  2DZ9 A;  3RKX A;  1I5L A;  2DKG A;  3BFM A;  2RA2 A;  1I4K 1;  4C92 A;  3SWN B;  4XU1 A;  1WNL A;  4XTU A;  4M78 F;  4QVC A;  2DXT A;  4WF2 A;  4M7D E;  4PJO D;  4C8Q F;  5GMK i;  3GIB A;  1WQ7 A;  5GMK h;  3RIR A;  3SB2 A;  2E10 A;  4M77 D;  5GAN g;  3HSB A;  1KQ2 A;  2DJZ A;  4F7U F;  2EJG A;  2K57 A;  5GAN 6;  5LJ5 e;  4F7U B;  3RKY A;  3JCM W;  5GAN j;  2FB7 A;  2EJ9 A;  4M7A D;  2EWN A;  2RB6 A;  4EMK A;  4A53 A;  1BIB A;  4M7A B;  4PJO E;  5GAN e;  4X9C A;  3JB9 D;  1WPY A;  1JRI A;  3RUX A;  5GAN h;  4M75 D;  4HT8 A;  4M7D F;  4PJO C;  2YLB A;  3JCM V;  5DY9 A;  4M7D B;  4M77 E;  4C8Q E;  5GAN 8;  2DEQ A;  4XTX A;  4X9D A;  1M8V A;  4M77 C;  4JLI A;  1U1T A;  4M78 D;  5LJ3 g;  2YHT A;  1U1S A;  4C8Q D;  4C92 F;  5LJ5 d;  2ZGW A;  5GAM g;  3L1A A;  1N9R A;  4MML A;  3RKW A;  5GMK e;  4M78 B;  5GAM j;  4M75 E;  4PJO G;  5GAN 4;  4C8Q B;  4QVD A;  5LJ5 f;  3JCM J;  5CAI A;  4NOY A;  3JB9 J;  4M75 C;  3JCM b;  2I2L A;  4F7U G;  2E65 A;  4XTV A;  2EJF A;  4M77 G;  3JB9 I;  1I8F A;  3QUI A;  3V7C A;  5GAM h;  4M78 E;  3SWN C;  3JB9 H;  4M7A G;  3JCM g;  4EMG A;  1KQ1 A;  2HNI A;  5GMK l;  4EMK B;  4J5Y A;  4M78 C;  1D3B A;  4NL2 A;  4RCB A;  4M7D D;  5GAO l;  1MGQ A;  3V8L A;  1Y96 A;  3QHS A;  2VXE A;  2RD1 A;  4J6Y A;  3JB9 G;  4F7U E;  1X01 A;  3V7S A;  1H64 1;  4M75 G;  3JCM Q;  3HFN A;  4M7A E;  3QO3 A;  4PNO A;  4C92 D;  3BY7 A;  4V2S A;  4N0A C;  3EFR A;  2DZC A;  4M7A C;  2FYK A;  2E64 A;  4PJO A;  2E1H A;  2E41 A;  4M78 G;  3PGG A;  4Y91 A;  4XU3 A;  4C92 B;  3BDU A;  3FB9 A;  3M4G A;  4C8Q G;  5LJ3 j;  5GAN 7;  4M7D C;  2VC8 A;  4XU2 A;  3V7R A;  4M77 A;  5GAN d;  1HK9 A;  4EMH A;  5LJ3 e;  1LNX A;  4M7A A;  5LJ3 h;  4DQ2 A;  5GAM e;  1YCY A;  2DTO A;  1I81 A;  3BW1 A;  1B34 A;  3JCM X;  5GAN f;  3QSU A;  1M5Q 1;  4HA8 A;  1HXD A;  2VXF A;  1LJO A;  4MMK A; 
#chains in the Genus database with same CATH topology
 1IRX A;  3D7S B;  1KIK A;  1RL2 A;  2CZ6 B;  2ZPF B;  4BI3 A;  1OX9 A;  2RHZ A;  2EW3 A;  1JBM A;  1WHH A;  5I2S A;  1Y57 A;  5GAO q;  2MWP A;  5IHK A;  1VQ5 Q;  1VQ4 A;  2JZ2 A;  1N8R C;  2C0O A;  2Y4X A;  2AT1 B;  1NLP C;  2RJF A;  1NJI C;  1MMN A;  2MAM A;  3EG9 A;  4ATO A;  2PVD B;  2X51 A;  1C6V X;  1JU5 C;  5IAY A;  1V76 A;  4KGX B;  1I4K 1;  3GIB A;  3SHW A;  1Q81 U;  3LLR A;  5EG2 A;  3M9Q A;  4HCB A;  4HVW A;  3VS5 A;  4F7U F;  2R5M A;  4QT7 A;  2DD5 A;  2K3X A;  2L0A A;  3U23 A;  3VS0 A;  4FT4 A;  2GQI A;  4M75 D;  1YJN A;  1IGU A;  1WX6 A;  2EGA A;  4M7D B;  2L5Q A;  1PHT A;  3CME A;  3NHN A;  5IH2 A;  1AZE A;  1U1T A;  2C06 A;  3CCE A;  4C8Q D;  1ZHI A;  2KI7 A;  1O75 A;  4KGZ B;  2MOX A;  2FVU A;  3TQ7 P;  4JRP A;  3F70 A;  1K4U S;  1Q81 R;  2KY9 A;  1ZUK A;  3CCV T;  2F2V A;  2OTJ Q;  1I8F A;  1KJW A;  3V7C A;  1Q7Y C;  4JZ3 A;  3OS2 A;  2X4W A;  2L3P A;  1OQK A;  1W2B P;  2JMC A;  4M75 G;  3C95 A;  1IO6 A;  4M7A E;  4N0A C;  2LC4 A;  4LDX A;  1QWF A;  2CS7 A;  4C8Q G;  3LWH A;  4C0G A;  1G2B A;  3QWY A;  4PJL A;  1YIJ Q;  1HK9 A;  1EX4 A;  1ARK A;  1SSH A;  2BUD A;  3DB4 A;  3KFV A;  3PVL A;  4HXJ A;  1ACM B;  4UC4 A;  3URG A;  4D8K A;  2P4R A;  4C8Q C;  3V8K A;  3MEW A;  3A8L B;  2RN8 A;  4MZM A;  5LJ5 g;  5FW9 A;  2B86 A;  2KEA A;  1DJ7 B;  2LZ6 B;  2DBK A;  2KRO A;  2RQU A;  2DIG A;  3QBY A;  1M1G A;  2RO0 A;  4X1V A;  2PU9 B;  1BU1 A;  4N0A A;  4CI0 C;  4M7A F;  1BI0 A;  4C92 E;  2IG0 A;  2K9G A;  3G7Z A;  1S72 A;  2XKO C;  2QEX A;  2ECZ A;  1W6X A;  3UF4 A;  2FO0 A;  1VQM T;  3H6Z A;  1KK7 A;  1UB4 A;  4RG8 A;  3SWN B;  3OS1 A;  2K3B A;  2DX1 A;  1KQS S;  1PG5 B;  1D0X A;  4J7I A;  3WXM B;  2E70 A;  4BI4 A;  3M0P A;  2DJZ A;  4DA4 A;  3RKY A;  3G71 T;  3THK A;  2FB7 A;  3CCU A;  4MDX A;  2YSQ A;  4BE2 A;  4PK4 A;  4M7A B;  4PJO E;  5GAN e;  2HBP A;  3R6O A;  3HRS A;  1Z9Z A;  5GAN h;  5D6W A;  1Q95 G;  1WYX A;  3TSW A;  1X6G A;  1M2V B;  3G6E A;  1SRM A;  2CP2 A;  1KC8 C;  3CCQ A;  4C92 F;  1YIT T;  3QG1 A;  2EYZ A;  1QVF P;  1AWO A;  3OW2 P;  4CC4 B;  2E65 A;  4OF1 A;  2V1Q A;  1YI2 Q;  1QVG A;  3OBY A;  1WA7 A;  3OYA A;  2V8K A;  1LCK A;  3OYF A;  2D1X A;  3P8D A;  1AOJ A;  2VXE A;  1AVZ C;  2L2P A;  1M1F A;  1JXM A;  4AG2 C;  1OPL A;  2XD0 A;  4OML A;  4BE0 A;  3CD6 Q;  4Y91 A;  1X2K A;  4C92 B;  2DYI A;  5LJ3 j;  1PM3 A;  4J9F A;  1C0M A;  1RAH B;  1FMV A;  3QYG B;  1M5Q 1;  1YJN T;  4ZGE B;  2LNV A;  1LJO A;  1K9A A;  3L2R A;  3CME T;  2XI9 A;  4C5I A;  3CCE T;  4GY5 A;  1UDL A;  3L2Z A;  2EVR A;  2MMP A;  3OYG A;  2AHJ B;  2HEQ A;  3GF5 A;  2YUO A;  2QA4 T;  4PJO B;  3OYJ A;  2E3I A;  3A8M B;  1TG0 A;  4M77 F;  2LCC A;  3I56 T;  3FIF A;  3RR6 A;  2WSF E;  2LT1 A;  3OYN A;  2VGN A;  1TSF A;  3LX7 A;  4JRK A;  3M58 A;  1YHQ A;  3PVQ A;  2EFI A;  2DTH A;  4BY6 B;  2D0Q B;  4KH1 B;  2KYM A;  1JJ2 S;  1I5L A;  1M30 A;  1WJR A;  2LVM A;  2BE9 B;  2K5L A;  5AYF A;  3CCJ Q;  2NUP A;  3CCL A;  2LDM A;  2HSE B;  1VQK A;  2K57 A;  5LJ5 e;  2RH2 A;  1R8O B;  1W70 A;  2EQI A;  2BTT A;  4FYW B;  1BIB A;  3HTR A;  3PE0 A;  4A4E A;  1N6A A;  1QW1 A;  4QVZ A;  1OX8 A;  3TEE A;  2RJD A;  2SEM A;  2ZPB B;  1YN8 A;  4OMN A;  3G1J A;  1VUB A;  1T3L A;  5CQY A;  1BB9 A;  1S72 T;  1G3Y A;  4NL2 A;  4M7D D;  1K9M C;  3S6W A;  2HQX A;  2ZPI B;  2F2X A;  2JTM A;  1X69 A;  2KR3 A;  1BCO A;  3HHT B;  2O88 A;  3OQ5 A;  3VRY A;  4OMF B;  3FB9 A;  1OEB A;  2RMO A;  4XU2 A;  4AFZ C;  1VIE A;  2O31 A;  4EMH A;  4F04 B;  1LNX A;  2CUB A;  5GAN f;  4DOW A;  2CH4 A;  2K6D A;  4C8Q E;  2EGC A;  2E6N A;  3G6E T;  4OP0 A;  4M7D G;  2KXC A;  4EIK A;  3J7A F;  4PFO A;  2FRW A;  3ZFJ A;  3C4S A;  5LJ3 f;  2R57 A;  2EYY A;  2CZ1 B;  2OAW A;  2LJ3 A;  5I11 A;  2MYS A;  3E9G A;  2LMJ A;  1NYF A;  4KRT A;  3JCM d;  2PZ1 A;  1WXT A;  4M75 F;  2QTV A;  5GMK j;  5FWC A;  2DZ9 A;  2CSQ A;  2DKG A;  3QDF A;  4QVC A;  4C8Q F;  3VUZ A;  2A7Y A;  2YUN A;  1OI1 A;  5CKF A;  3SB2 A;  1YJW Q;  3UA7 A;  1AD5 A;  2CRE A;  4A4K A;  1HD3 A;  2VKN A;  1HYO A;  2EWN A;  2KSS A;  2LQ8 A;  1E6G A;  2X3W D;  3QDR B;  3EH2 A;  4E2F B;  3CPW S;  3X25 B;  4B6M A;  2EGE A;  1BI2 A;  1IZ6 A;  1GBR A;  3CCM Q;  3I5R A;  4JS4 A;  1VQ6 A;  4JLI A;  2D8H A;  1RAG B;  4B9W A;  1WJQ A;  4CC2 A;  4C8Q B;  1ZQ1 A;  4NOY A;  1Z9Q A;  4C5E A;  4PFZ A;  4AMC A;  3A5Z B;  1MHN A;  4HVU A;  1IXD A;  4M78 C;  3EHQ A;  3FJ5 A;  3C12 A;  3CC4 A;  1NE8 A;  3VJP A;  4PFP A;  1VQ8 T;  3SEM A;  1H64 1;  1WGS A;  2H3E B;  2CZ0 B;  4OB1 B;  2JS0 A;  1PD1 A;  2D6F A;  3OSS C;  4X34 A;  1HJD A;  2YUP A;  2RHY A;  4OMO A;  3CCL T;  1SF9 A;  1VQK T;  2CUD A;  2GQV A;  4AT1 B;  3CBP A;  2YT6 A;  2J6F A;  1VQP Q;  4IKF A;  4FM4 B;  2DTO A;  2A08 A;  2L3S A;  2DA9 A;  4BD3 A;  4MMK A;  2QEX Q;  3M5A A;  5GAN 3;  4F14 A;  3UA6 A;  1VQL Q;  4Z88 A;  5CKE A;  4M78 A;  3NTH A;  4FYV B;  4RMO A;  5KE2 A;  3L2U A;  1IB8 A;  2K3Y A;  1AWX A;  1U3O A;  4C0D C;  5FLX E;  4HCK A;  1RAC B;  2JOY A;  3NTK A;  2R58 A;  2CP0 A;  2LCS A;  4J6W A;  5GAO n;  3E19 A;  2YDL A;  1UHC A;  2EIF A;  4M4Z A;  3IQL A;  4PJO D;  3FLG A;  1QCN A;  3CCQ Q;  5A2Q E;  1G5V A;  2IPO B;  2FEI A;  3RIR A;  2A28 A;  1CSK A;  1SKU B;  1KQ2 A;  3R6N A;  4C0F A;  3KBG A;  1RAB B;  4JLG A;  4Z89 A;  1D0Y A;  1X75 C;  1PRM C;  3MKD A;  4LDV A;  2MIO A;  2P0K A;  1NYG A;  1KQS A;  2G3R A;  2M0Y A;  1GBQ A;  1UUE A;  1AWW A;  2PUO B;  3M53 A;  5IHN A;  2I0N A;  1BBZ A;  1W1F A;  4A4F A;  1FX7 A;  4PJO G;  3CXC A;  4QVD A;  5CCA A;  4ESR A;  3EG2 A;  1KHI A;  3QUI A;  1SHF A;  5L8R E;  1ZUU A;  5GMK l;  1NBE B;  3QHS A;  8ATC B;  4DBQ A;  2CSI A;  4RKU E;  3V7S A;  2H8H A;  2DAQ A;  4FT2 A;  4PNO A;  1D0Z A;  1NEB A;  2X35 A;  5J26 A;  3G4S Q;  1BI1 A;  5GAN 7;  4J9C A;  2DEU A;  2DK3 A;  2DMO A;  1M4Z A;  1T0H A;  5KE3 A;  3OYM A;  4JJB A;  2KMT A;  4GLM A;  3NTI A;  3EHR A;  1YHQ Q;  1LVK A;  1QVG P;  1W2B S;  3VS4 A;  3FJP A;  3VS7 A;  1OV3 A;  5KCH A;  5GAO r;  5GJW B;  2CT4 A;  1VQM A;  4FW1 A;  7AT1 B;  1M1K U;  4BE1 A;  3I5S A;  4AFS C;  2JT4 A;  4A63 B;  5GMK m;  3G71 A;  3FDR A;  3V8J A;  1AWJ A;  4ZTF A;  3MEV A;  1WQW A;  1I0C A;  2OTL T;  4LUD A;  2VV5 A;  3OMC A;  2EYQ A;  1W4S A;  3REB B;  6AT1 B;  2FZG B;  2JNG A;  3CMA T;  1NLO C;  3MO8 A;  5CIU A;  1YIT A;  3CCR T;  5GAN g;  1M2O A;  4QKU A;  1M1K R;  1VYT A;  4HT8 A;  1D09 B;  3A98 A;  4M7D F;  2YLB A;  1QP3 A;  2CT3 A;  1NZ9 A;  5LJ3 g;  3LH0 A;  2P0P A;  4LN2 A;  2M1H A;  2ZGW A;  1FWZ A;  3M0Q A;  1N9R A;  3M54 A;  5GAM j;  5GAN 4;  1VA7 A;  4RTX A;  4XTV A;  3CCS T;  1JEG A;  1ZA1 B;  4M78 E;  5HK3 A;  4BDZ A;  1GL5 A;  5GAO l;  1MGQ A;  2J06 A;  1KHC A;  3QWX X;  4VUB A;  4EPC A;  3EFR A;  1MUZ A;  2D8J A;  3Q1J A;  1VQO T;  4IUP A;  1N8R U;  2NWM A;  3VUB A;  1YI2 T;  4FU6 A;  1UGP B;  3J81 E;  3OW2 S;  2QA4 A;  1NJI U;  2KRS A;  1H3H A;  2PTK A;  2RQT A;  4LD9 K;  1QWE A;  3JCM X;  5CKB A;  3I56 A;  3OYY A;  1HXD A;  2VXF A;  1PSF A;  4O5V A;  2QGG A;  4OVA A;  1WHM A;  1RI9 A;  2GF7 A;  3CD6 T;  2VYT A;  5FU7 C;  4Z8A A;  3E1S A;  2PNI A;  4EMK C;  2RHU A;  1VQ7 T;  2RQR A;  1MV3 A;  1RLQ C;  2KAF A;  2A37 A;  3GP8 A;  3M4Y A;  2DTI A;  5D7U A;  1N8R R;  4RCC A;  2K79 A;  4LDU A;  4XTW A;  2FHD A;  1QKX A;  1NJI R;  1M3B A;  1TUG B;  5GAO m;  2F1L A;  2QDL A;  3UAT A;  5KYX A;  2LQW A;  3JCM P;  2DVJ A;  1WIE A;  1N9S A;  4JJC A;  3UT1 A;  4R0K A;  2DXT A;  4D6W A;  4LXC A;  1QLY A;  2RI2 A;  3H8Z A;  2GGR A;  1Q7Y U;  3HSB A;  1G3W A;  2HQE A;  4EDU A;  4JPB W;  4WTO B;  2YRD A;  5FU6 C;  4EMK A;  3L42 A;  2CP6 A;  2EQJ A;  3LWI A;  2F5K A;  2ZAE A;  3T9N A;  3CC4 Q;  3P8B B;  1YWO A;  5DY9 A;  1D1B A;  1EIF A;  3UPU A;  3CBM A;  2KYB A;  2BZ8 A;  3A8G B;  1NM7 A;  4KT0 E;  1K0S A;  2QQ9 A;  2BZX A;  4IUT A;  5DLO A;  4ME7 A;  2AZV A;  3OYE A;  2ED1 A;  1Q7Y R;  3H0H A;  1IHW A;  2FG0 A;  1RAF B;  1ABQ A;  4B9X A;  4BAC A;  3V8L A;  1Y96 A;  2IIM A;  2LRQ A;  4C0D B;  5CKH A;  1TTH B;  3GBQ A;  2JXB A;  1C1A A;  2DL7 A;  2DZC A;  3BE3 A;  2FYK A;  1U8R A;  2QAS A;  1X43 A;  3M4G A;  3MJX A;  5CKD A;  5DM7 R;  2A36 A;  5LJ3 e;  5LJ3 h;  1AZG B;  2QDY B;  1E6H A;  2A3L A;  5KYU B;  3C0C A;  2E12 A;  2DJQ A;  3OB9 A;  4E7L A;  3NFC A;  1KD1 C;  3FRN A;  3OMG A;  2SRC A;  4JRQ A;  1E7O A;  1YJ9 T;  5FWB A;  2YLC A;  1Y7X A;  4DOV A;  4J8O A;  1GXI E;  3HFO A;  4PJO F;  3RER A;  3CC2 T;  4IUQ A;  5AT1 B;  2QXF A;  1UGV A;  1WZO A;  2DD4 A;  5FRN A;  2K5I A;  3I55 T;  3CPF A;  4ZTJ A;  3CCV Q;  4PJN A;  1VQ9 T;  2OX7 A;  3PTA A;  1KC8 U;  3JCM f;  2NUT A;  2CGH A;  1OU8 A;  3EFS A;  3CC7 T;  2YRV A;  1WI7 A;  3PNW C;  3MP6 A;  1OU9 A;  3EFO A;  5KCO A;  1RAI B;  2XK0 A;  2AK5 A;  4CC3 A;  1VQN T;  1X2Q A;  1TOV A;  1YP5 A;  1M90 C;  2EYX A;  4BI8 B;  1VQ8 A;  3RMS A;  3JV3 A;  1KC8 R;  4ANJ A;  2NLU A;  1YJW T;  5CVI A;  4K11 A;  4RTY A;  2DIQ A;  3KUF A;  5CAI A;  1QCF A;  1Y07 A;  3JB9 I;  1MMD A;  2VUB A;  3CCM T;  1D3B A;  1UGQ B;  3BDL A;  1M9S A;  3EG9 B;  1SPK A;  2DM1 A;  3CEY A;  2QQR A;  2E6Z A;  3S3M A;  2E1H A;  5KYW A;  3PGG A;  3QPH A;  5A0D A;  3CXC P;  3TSZ A;  1RAD B;  1I81 A;  3G71 Q;  2GTJ A;  3ZL7 C;  4HKE A;  1G3S A;  3LW5 E;  2LJ1 A;  3VS3 A;  1PC0 A;  4IIM A;  1B07 A;  1XTD A;  1I07 A;  2ROT A;  1H92 A;  1PWT A;  5LJ5 j;  1PRL C;  5GAM d;  2E4H A;  3X26 B;  1YIT Q;  1VQ4 Q;  2CH4 W;  4JRI A;  2O4X A;  1KSW A;  4OB3 B;  3L2W A;  4RTW A;  2KDS A;  2KE9 A;  4N4H A;  2DE0 X;  4F17 A;  2XG8 D;  1YFN A;  1U06 A;  4JUV A;  2J6K A;  3RNJ A;  1UGS B;  2RJE A;  1BKB A;  1IGQ A;  3HRU A;  1OOT A;  5ECA A;  5GMK h;  2HD0 A;  3JSC A;  5HY6 A;  2HQH A;  2QQB A;  1H8K A;  1RUW A;  1UTI A;  1K9M U;  3EAE A;  1H3Z A;  3O8V A;  1K76 A;  4X9C A;  2XIC A;  1FXX A;  2X4J A;  4FCY A;  1YJN Q;  5L23 A;  2QQA A;  5KYX B;  2PVG B;  1WXU A;  3CME Q;  4M78 D;  3ULR B;  1U1S A;  2K4Y A;  1WJS A;  3CCE Q;  3L1A A;  4J9G A;  4HCZ A;  2YXY A;  4DEY A;  1SRL A;  4F7U G;  2QA4 Q;  2OTJ A;  1ZUY A;  2JM9 A;  2W0Z A;  1JQQ A;  3NPF A;  1K1Z A;  5FU7 B;  2D9T A;  3I56 Q;  1TU0 B;  4Y28 E;  4EMK B;  3EG3 A;  3OYH A;  2K2M A;  1K9M R;  2RD1 A;  4HCC A;  3N5B B;  1QCO A;  5CK9 A;  4RUG A;  1P92 A;  1RAE B;  3PT9 A;  1X27 A;  2P4T A;  3TCJ A;  4F16 A;  2KXD A;  3ME9 A;  4M78 G;  3OSV A;  5DLQ E;  2EKH A;  2XMF A;  3OYL A;  1Q82 C;  1XNI A;  1ZX6 A;  4OGC A;  4C0Z A;  1K8A C;  4J7F A;  4IUR A;  2FL7 A;  4C5H A;  1Y96 B;  1WHJ A;  4OMQ A;  3G4S T;  1QQJ A;  2OTL A;  5FU6 B;  1FMW A;  2CP7 A;  5GAO p;  2X4Y A;  1NG2 A;  2HKN A;  1JO8 A;  1O9S A;  3GPL A;  4F7U A;  2MCN A;  3CMA A;  5GAN 5;  1EFN A;  3CCR A;  2VWF A;  1WHL A;  3L2V A;  2DRM A;  3RDV A;  1S72 Q;  2CYZ B;  1QVG S;  1LOJ A;  1PCX A;  1XQH A;  4XTY A;  1Q86 C;  4A4G A;  2C0I A;  1X6O A;  4E6R A;  2RNA A;  3DKM A;  4RTZ A;  2PUK B;  2RK1 A;  4OB2 B;  2M16 A;  3X24 B;  3MCA B;  3OS5 A;  2K2V A;  4JDS A;  3M59 A;  4ZGD B;  1VYV A;  3CCU Q;  1YNZ A;  2L3R A;  3CCS A;  2QGF B;  2OAU A;  4E7H A;  4IUV A;  2ABL A;  5GAN 8;  1X6B A;  4BB7 A;  3G6E Q;  3OBW A;  4OMM A;  1FMK A;  5KH6 A;  3LYI A;  4OMP A;  1VQ5 T;  2EBP A;  3RKW A;  1V29 B;  2KNB B;  5IN1 A;  3JCM J;  3QXE B;  1VQO A;  2QAZ A;  1NPP A;  2LX7 A;  2EQK A;  1YI2 A;  2QYZ A;  3EFO B;  4J83 A;  2DPP B;  3JCM g;  1UJY A;  3PMT A;  3EGX A;  4BDY A;  2XHC A;  4FIB A;  4KGV B;  3E9F A;  2F69 A;  4V2S A;  4QQG A;  3CD6 A;  1JXO A;  4J9I A;  3JRZ A;  3QZ5 B;  2IVW A;  2HCK A;  2H3J A;  4J9E A;  1ZSG A;  1VQ7 A;  2DL3 A;  2NUP B;  1K73 C;  4M7A A;  1D1A A;  2K5F A;  3BW1 A;  4JS5 A;  3SD4 A;  2FZC B;  2CDT A;  1MNE A;  3OY9 A;  4FYY B;  1D3B B;  1BIA A;  4GLK A;  2RM4 A;  3OYC A;  2AIR B;  2GNC A;  2KT1 A;  4XU0 A;  4J6X A;  4YTL A;  1ZLM A;  3QKJ A;  5KYW B;  2OTJ T;  5CQX A;  3RES A;  4ZN3 A;  1I1J A;  4J9H A;  2ZCF B;  2E5Q A;  2MWO A;  2JVV A;  4KUI A;  3MEU A;  2MI6 A;  2EPD A;  2GFA A;  3VS6 A;  1VQ8 Q;  4RG2 A;  4C92 A;  1YIJ T;  3ASK A;  2EQM A;  2OJ2 A;  4WF2 A;  4N4I A;  1K73 U;  2JJ9 A;  1WHG A;  3FC3 A;  3CCL Q;  1VQK Q;  4L59 A;  1SEM A;  4JJD A;  2FPD A;  2O4X B;  2GCX A;  2E3H A;  1UEC A;  2O9V A;  2W10 A;  2DEQ A;  1M8V A;  4M77 C;  2HSP A;  5LJ5 d;  3DLM A;  2YWW A;  4MML A;  1RLP C;  3JCM b;  5IXB A;  1K0X A;  2XDP A;  5GAM h;  2A0F B;  2J05 A;  3H0F A;  4ORZ A;  3JAM E;  2NYS A;  1OZ3 A;  1JJ2 A;  1UE9 A;  2Y4Y A;  2Z0W A;  5IXF A;  4FL6 A;  2LCL A;  3M56 A;  4J6Y A;  4O6J A;  4F7U E;  5KYY A;  1TUD A;  1SSF A;  3RMQ A;  1RAA B;  1SHG A;  1YJ9 A;  2E41 A;  3EGD A;  3BDU A;  4M77 A;  2L3Q A;  5A0L A;  3CC2 A;  4DQ2 A;  1YCY A;  1KG1 A;  1B34 A;  1TUC A;  4J9B A;  3JCM Q;  3EH1 A;  3I55 A;  1T3S A;  3OYK A;  1VQ9 A;  1BI3 A;  2DRK A;  4KBM B;  3JCM e;  3OS0 A;  4Y92 A;  3JCM h;  1R0C B;  2ED0 A;  2PVO B;  3CC7 A;  1HSQ A;  2QQS A;  4RTU A;  4OB0 B;  1QVF S;  3X20 B;  4WCI A;  4R56 A;  4E7S A;  1VOM A;  4ELY C;  1ZA2 B;  2DL8 A;  2KBT A;  3MEA A;  3H41 A;  1EZZ B;  2LQN A;  2K7A A;  1VQN A;  2ZPG B;  1J3T A;  4PKC C;  2LT4 A;  2COW A;  3GLX A;  1A0N B;  4M78 F;  1OPK A;  1YJW A;  3S3O A;  5HK0 A;  2E10 A;  3PFS A;  2QI2 A;  4PLI A;  2KK4 A;  2CKK A;  5FRO A;  1UEB A;  4F7U B;  3QZ9 B;  1PD0 A;  4A53 A;  1N5Z A;  4RTT A;  2LQK A;  2E5K A;  1BK2 A;  3NGP A;  1ZBX A;  3CCM A;  2EQU A;  4X9D A;  2BE7 D;  2DET A;  5J3B A;  3EG0 A;  3VYG A;  2YHT A;  3ZBD A;  4FSS A;  1VQ6 Q;  2V8I A;  2COY A;  4E7K A;  3EGU A;  4M78 B;  2WSE E;  4ELZ C;  1G8X A;  4M75 C;  3O5Z A;  1GRI A;  5EC7 A;  2JM8 A;  2DF6 A;  2DO3 A;  4RCB A;  1TWB A;  1TXQ A;  2RHI A;  4XAX B;  2LNH B;  5FRM A;  3HFN A;  3CCJ T;  2HAX A;  2OTL Q;  1M27 C;  3BY7 A;  2AZS A;  5GJV B;  3VS1 A;  4QQD A;  2FRY A;  4XU3 A;  2RQW A;  1YCS B;  2DXB A;  2X4X A;  3EG1 A;  1VQP A;  3CMA Q;  2GTO A;  3CPW A;  3CCR Q;  2ATC B;  4HA8 A;  3RKX A;  2JUF A;  3QII A;  4E47 A;  4LDW A;  4M75 A;  3HKS A;  5LL6 S;  5C0M A;  1VQL A;  3S3N A;  3EGX B;  4A54 A;  4IUU A;  5GAN 2;  4JJN K;  1XJW B;  4C8Q A;  4P5N A;  4NS5 A;  2QTX A;  4KUD K;  1GCP A;  2KQW A;  2O01 E;  1TH7 A;  5GAM f;  1UFF A;  1Y71 A;  3REA B;  3CXC S;  4MZT A;  2HDA A;  4XK8 E;  3CCS Q;  3VU3 C;  3KXT A;  1MMG A;  3WVD B;  2RI5 A;  4LD6 A;  1NPR A;  4XU1 A;  2LTO A;  4QW2 A;  1VQ4 T;  1OUL A;  2RI3 A;  1SG5 A;  4AFU C;  3GOX A;  1VQO Q;  2EJG A;  2M02 A;  2LP5 A;  5GAN j;  1B3Q A;  2EJ9 A;  2AKK A;  2JS2 A;  2DBM A;  4TVR A;  1NEG A;  2DLP A;  5D6X A;  3JB9 D;  1JRI A;  3UWN A;  3OA6 A;  4RTV A;  1CKB A;  3H9N A;  3JCM V;  3P8H A;  4M77 E;  4MDW A;  2P84 A;  2X3X D;  5A0G A;  4E7I A;  1BCM A;  2ESW A;  5I22 A;  3CQT A;  1VIF A;  3NMZ C;  4FYX B;  1VQ7 Q;  1I5O B;  2I2L A;  3QYH B;  4J9D A;  1D1C A;  1KD1 U;  2VAS A;  2HNI A;  3SFM A;  3PIO A;  3JB9 G;  3MPU B;  2J6O A;  1PKT A;  1WLP B;  5KYN A;  1G3T A;  3QO3 A;  3G4S A;  4E7J A;  1PNJ A;  3DB3 A;  2RHX A;  1JB0 E;  5M9O A;  4HVV A;  1WFW A;  3OYB A;  4XTU A;  4KUL A;  4A4H A;  2ROL A;  3AHU A;  1KD1 R;  2XID A;  2M51 A;  2FZK B;  5KYY B;  2BZY A;  4LUE A;  3PIP A;  4XTZ A;  2JN0 A;  1KQS P;  4HT9 A;  5D6Y A;  1YBY A;  1ZSZ C;  1VQM Q;  1V1C A;  2L89 A;  3EGD B;  4AFQ C;  2FPE A;  4II1 A;  2HMA A;  5LJ5 h;  1GFC A;  2HZY A;  3CBO A;  4M77 B;  1GCQ C;  1MND A;  1M90 U;  1T0J A;  5HKC A;  2AKL A;  5J39 A;  4KH0 B;  1B34 B;  3I9Q A;  4NL3 A;  1CKA A;  4FW2 A;  4FSX A;  2RA2 A;  3VV0 A;  2CP5 A;  1M8M A;  2XDD A;  1VQ5 A;  2O9S A;  2RQV A;  1VQP T;  2EKO A;  2WSC E;  3JCM W;  1TS9 A;  2KRM A;  1W2B A;  2QEX T;  1ZSZ A;  1WPY A;  2CP3 A;  2KGT A;  1VQL T;  2F5T X;  2JTF A;  1M90 R;  1GCQ A;  4L6V 5;  4JZ4 A;  1YJ9 Q;  2DNU A;  5GMK e;  2XU8 A;  4M75 E;  2KT8 A;  2LJ0 A;  2DER A;  3CCU T;  3MP8 A;  2LX9 A;  2F2W A;  2MPX C;  2VGM A;  1UJ0 A;  1N27 A;  3CC2 Q;  5I2M A;  1U5S A;  2HL5 C;  3PMI A;  4J5Y A;  3ZEH A;  1PKS A;  1ZBJ A;  3SDZ A;  3I55 Q;  3E2U A;  1X01 A;  1YWP A;  4L5G A;  1VQ9 Q;  1FYN A;  3DLL A;  3CCQ T;  1M3A A;  4QQ6 A;  4MZP A;  3UDC A;  3CC7 Q;  2OI3 A;  8AT1 B;  3VS2 A;  4PJJ A;  1RI0 A;  2G6F X;  4M7D C;  3OYD A;  2X9H A;  2M0O A;  9ATC B;  3GNF B;  1WHK A;  1AEY A;  2FPF A;  1AT1 B;  4N4G A;  2JMA A;  4LE9 A;  1VQN Q;  4ZNX A;  2EAY A;  2ZPE B;  1JJ2 P;  1BYM A;  3TU4 K;  3VYH B;  2DXC A;  4CRI A;  2JW4 A;  2ZZD A;  2L8D A;  1YIJ A;  1G83 A;  2CZ7 B;  3HRT A;  1MMA A;  2DVE A;  2HBW A;  4XQ3 A;  1GFD A;  4BUG A;  2PQW A;  4M7D A;  2DXU A;  3INZ A;  4M75 B;  4ZN1 A;  3M0R A;  4D8D A;  1QVF A;  5CO7 A;  3M55 A;  3BFM A;  2ENM A;  3OW2 A;  2MK5 A;  1UG1 A;  3MHX A;  2RPN A;  1WQ7 A;  1IHV A;  3L2Q A;  4DBH A;  5GAN 6;  4ZGJ B;  4M7A D;  2RB6 A;  4DBR A;  1YHQ T;  2RF0 A;  4IIO A;  3RUX A;  1IRE B;  3OYI A;  3A8O B;  2EYW A;  1QMC A;  4XTX A;  2MF2 A;  2QG9 B;  5GAM g;  2DYB A;  1ABO A;  1Q82 U;  5LJ5 f;  2HKQ B;  3JB9 J;  4PJM A;  4C5G A;  1K8A U;  2EJF A;  3HP9 A;  1LPL A;  1XOV A;  3FEO A;  3SWN C;  4M7A G;  1PSE A;  4PL6 A;  3TVT A;  5IHI A;  1QKW A;  3VKI A;  1UGR B;  1S1N A;  1AHJ B;  3LH5 A;  3MP1 A;  1R77 A;  2NUT B;  4C92 D;  1QP2 A;  1QVP A;  4M7A C;  3M0U A;  2R5A A;  2V1R A;  2VC8 A;  5GAN d;  2C0T A;  5C6S A;  1Q82 R;  1F1B B;  1Q86 U;  5IT9 E;  1K8A R;  1OYX A;  2VB6 A;  3WVE B;  5I21 A;  4LNP A;  2NUZ A;  1KFZ A;  3SWN A;  2XDB A;  4LDY A;  2M9U A;  2RK2 A;  2D0N A;  2P0Q A;  5LJ3 d;  4C92 G;  2JTE A;  3AT1 B;  3JCM c;  2YUQ A;  3X28 B;  3J80 E;  1R0B G;  2Y90 A;  3RBB B;  3H0I A;  3HL8 A;  2ZPH B;  3ER0 A;  4CC7 A;  3CCV A;  4OGE A;  3A8H B;  2KVQ G;  4C92 C;  3JB9 F;  3CPW P;  1M2V A;  2B8A A;  4E7Z A;  1Q86 R;  2DL5 A;  2V26 A;  1VYU A;  1MV0 B;  1WNL A;  4R55 A;  3QJY A;  5GMK i;  3QJ6 A;  4M77 D;  4DBF A;  3M0S A;  5KYU A;  2VVK A;  5CR2 A;  1M1K C;  2DL4 A;  1WXB A;  3M57 A;  3HPW A;  4PJO C;  2V8J A;  3VRZ A;  1B7T A;  2QK0 A;  1WDX A;  3CCJ A;  2GBQ A;  3I35 A;  4DEX A;  2J7I A;  3LGF A;  4BY6 C;  2BKD N;  3MET A;  2GFU A;  1OZ2 A;  3A1P A;  3TRE A;  4M77 G;  3JB9 H;  3LGL A;  4EMG A;  1KQ1 A;  3M0T A;  1ZSZ B;  3GNG A;  4Z02 A;  1VQ6 T;  1M3C A;  5HCK A;  2HL3 A;  2COZ A;  2O2O A;  2BIV A;  1Y0M A;  2DFU A;  4PJO A;  2E64 A;  1UHF A;  4M7D E;  2WAC A;  3C94 A;  2RJC A;  4PLL A;  3V7R A;  2KRN A;  1K73 R;  1Q81 C;  2DIL A;  5GAM e;  3CC4 T;  4Q5W A;  4GBQ A;  4AG1 C;  2YRC A;  3QSU A; 
#chains in the Genus database with same CATH homology
 2JUF A;  3QII A;  4E47 A;  4LDW A;  1RL2 A;  3HKS A;  4M75 A;  2CZ6 B;  3M5A A;  5LL6 S;  5C0M A;  1VQL A;  5GAN 3;  2ZPF B;  3S3N A;  4BI3 A;  4A54 A;  4IUU A;  1XTD A;  5GAN 2;  2RHZ A;  4JJN K;  5CKE A;  4M78 A;  3NTH A;  4MMK A;  4C8Q A;  1JBM A;  5LJ5 j;  5GAM d;  4RMO A;  5I2S A;  5KE2 A;  5GAO q;  2MWP A;  4P5N A;  4NS5 A;  3L2U A;  3X26 B;  2QTX A;  1VQ4 A;  2K3Y A;  4KUD K;  2JZ2 A;  2KQW A;  2O01 E;  1TH7 A;  5GAM f;  1N8R C;  4C0D C;  1Y71 A;  4JRI A;  2O4X A;  2Y4X A;  5FLX E;  3CXC S;  4MZT A;  4OB3 B;  3L2W A;  2RJF A;  1NJI C;  2JOY A;  2KDS A;  3NTK A;  4XK8 E;  2R58 A;  2MAM A;  4N4H A;  3VU3 C;  3KXT A;  4ATO A;  2PVD B;  4J6W A;  2XG8 D;  3WVD B;  5GAO n;  3E19 A;  2RI5 A;  5IAY A;  4JUV A;  2EIF A;  1I4K 1;  4LD6 A;  1NPR A;  1UGS B;  4XU1 A;  2LTO A;  2RJE A;  3FLG A;  1BKB A;  4QW2 A;  5A2Q E;  1VQ4 T;  4PJO D;  3GIB A;  1G5V A;  1Q81 U;  3HRU A;  5GMK h;  3LLR A;  2RI3 A;  3RIR A;  2HD0 A;  3JSC A;  3M9Q A;  5EG2 A;  5HY6 A;  4HCB A;  3GOX A;  1KQ2 A;  4F7U F;  4C0F A;  2R5M A;  2EJG A;  2QQB A;  3KBG A;  5GAN j;  4JLG A;  2EJ9 A;  2DD5 A;  2K3X A;  1X75 C;  1K9M U;  4TVR A;  3EAE A;  1H3Z A;  5D6X A;  3O8V A;  3JB9 D;  4X9C A;  2XIC A;  1JRI A;  3UWN A;  4FT4 A;  1FXX A;  4M75 D;  3OA6 A;  1YJN A;  4LDV A;  2P0K A;  2X4J A;  3JCM V;  4M7D B;  3P8H A;  4M77 E;  2QQA A;  4MDW A;  2L5Q A;  1KQS A;  5A0G A;  3CME A;  2PVG B;  2G3R A;  4E7I A;  2PUO B;  1U1T A;  3M53 A;  4M78 D;  2C06 A;  3CCE A;  1U1S A;  4C8Q D;  2K4Y A;  1WJS A;  1ZHI A;  3L1A A;  1O75 A;  4HCZ A;  4A4F A;  1VIF A;  2FVU A;  1FX7 A;  4PJO G;  3CXC A;  4QVD A;  4JRP A;  3F70 A;  2I2L A;  4F7U G;  5CCA A;  2OTJ A;  2KY9 A;  3CCV T;  1KHI A;  1I8F A;  3QUI A;  3QYH B;  3V7C A;  1Q7Y C;  5FU7 B;  5L8R E;  1KD1 U;  2D9T A;  2HNI A;  4Y28 E;  3SFM A;  4EMK B;  5GMK l;  3PIO A;  3OS2 A;  2X4W A;  3OYH A;  3QHS A;  2RD1 A;  3JB9 G;  4RKU E;  4HCC A;  3V7S A;  3N5B B;  5CK9 A;  4M75 G;  1P92 A;  2DAQ A;  3C95 A;  3PT9 A;  2P4T A;  4FT2 A;  1G3T A;  3TCJ A;  4M7A E;  3QO3 A;  4PNO A;  3G4S A;  4N0A C;  2LC4 A;  2X35 A;  5J26 A;  4E7J A;  3ME9 A;  4LDX A;  4M78 G;  1BI1 A;  3OSV A;  2CS7 A;  5DLQ E;  4C8Q G;  4C0G A;  5GAN 7;  3LWH A;  3DB3 A;  2RHX A;  1HK9 A;  1JB0 E;  5M9O A;  3OYL A;  1Q82 C;  2DK3 A;  5KE3 A;  1M4Z A;  2BUD A;  3DB4 A;  3OYB A;  1XNI A;  4OGC A;  4C0Z A;  3OYM A;  1K8A C;  4XTU A;  4KUL A;  2KMT A;  4UC4 A;  4A4H A;  4J7F A;  4IUR A;  3NTI A;  3URG A;  4C8Q C;  2FL7 A;  4C5H A;  3AHU A;  3V8K A;  2XID A;  1W2B S;  1Y96 B;  3G4S T;  3MEW A;  3FJP A;  2OTL A;  3A8L B;  5KCH A;  4MZM A;  5FU6 B;  5LJ5 g;  5GAO r;  5GAO p;  2X4Y A;  3PIP A;  4XTZ A;  2JN0 A;  1VQM A;  1DJ7 B;  4HT9 A;  5D6Y A;  1YBY A;  1O9S A;  3GPL A;  2DIG A;  2L89 A;  3QBY A;  4F7U A;  1M1G A;  2RO0 A;  4II1 A;  1M1K U;  3CMA A;  4BE1 A;  2PU9 B;  5LJ5 h;  5GAN 5;  3CBO A;  4M77 B;  3CCR A;  4N0A A;  4CI0 C;  4M7A F;  1BI0 A;  1M90 U;  5HKC A;  5J39 A;  5GMK m;  3G71 A;  4C92 E;  3FDR A;  3V8J A;  3L2V A;  2IG0 A;  4ZTF A;  1B34 B;  3G7Z A;  3MEV A;  2XKO C;  1S72 A;  2QEX A;  4NL3 A;  2CYZ B;  1WQW A;  1LOJ A;  1QVG S;  2OTL T;  1XQH A;  2VV5 A;  4XTY A;  1Q86 C;  4A4G A;  1X6O A;  4FSX A;  3DKM A;  3OMC A;  2PUK B;  2RK1 A;  2EYQ A;  4OB2 B;  1VQM T;  3H6Z A;  2RA2 A;  1UB4 A;  4RG8 A;  3SWN B;  2M16 A;  3OS1 A;  1W4S A;  3X24 B;  3VV0 A;  1KQS S;  3MCA B;  3OS5 A;  2K2V A;  4J7I A;  2XDD A;  2JNG A;  4JDS A;  3WXM B;  3CMA T;  2E70 A;  4BI4 A;  3M59 A;  3MO8 A;  1VQ5 A;  1VQP T;  2EKO A;  5CIU A;  3CCR T;  5GAN g;  1YIT A;  2DJZ A;  2WSC E;  4DA4 A;  4ZGD B;  3JCM W;  3RKY A;  3G71 T;  3CCU A;  2FB7 A;  4MDX A;  4BE2 A;  2L3R A;  1W2B A;  2QEX T;  4M7A B;  4PJO E;  5GAN e;  2HBP A;  3CCS A;  1WPY A;  3R6O A;  2OAU A;  3HRS A;  4E7H A;  5GAN h;  4HT8 A;  1VQL T;  2F5T X;  4M7D F;  2JTF A;  5D6W A;  2YLB A;  4IUV A;  5GAN 8;  1QP3 A;  3G6E A;  4BB7 A;  4L6V 5;  1KC8 C;  1NZ9 A;  3OBW A;  5LJ3 g;  3LH0 A;  2P0P A;  5KH6 A;  3CCQ A;  2M1H A;  4C92 F;  2ZGW A;  3LYI A;  1VQ5 T;  1FWZ A;  3QG1 A;  1YIT T;  1N9R A;  1V29 B;  3M54 A;  3RKW A;  5IN1 A;  5GMK e;  5GAM j;  2XU8 A;  4M75 E;  5GAN 4;  3JCM J;  3QXE B;  3CCU T;  3MP8 A;  1VQO A;  2LX9 A;  1NPP A;  2E65 A;  2EQK A;  4XTV A;  1YI2 A;  4OF1 A;  2VGM A;  4J83 A;  1N27 A;  3CCS T;  5I2M A;  1QVG A;  2DPP B;  4M78 E;  5HK3 A;  3OBY A;  3JCM g;  3OYA A;  2V8K A;  3PMI A;  4J5Y A;  4BDZ A;  3ZEH A;  1VQ7 T;  3OYF A;  3PMT A;  1MGQ A;  3P8D A;  3SDZ A;  5GAO l;  2VXE A;  4BDY A;  1X01 A;  2XHC A;  4FIB A;  1KHC A;  4L5G A;  3DLL A;  1M1F A;  3CCQ T;  3E9F A;  2F69 A;  4QQ6 A;  4VUB A;  4EPC A;  4V2S A;  4QQG A;  2XD0 A;  4MZP A;  3CD6 A;  3EFR A;  4BE0 A;  3UDC A;  3JRZ A;  3Q1J A;  3QZ5 B;  2IVW A;  4IUP A;  4Y91 A;  1VQO T;  4C92 B;  2H3J A;  5LJ3 j;  1N8R U;  3VUB A;  1YI2 T;  4FU6 A;  1RI0 A;  4M7D C;  1UGP B;  3J81 E;  3OYD A;  1VQ7 A;  3OW2 S;  2QA4 A;  1NJI U;  2M0O A;  3GNF B;  1K73 C;  4M7A A;  3QYG B;  2K5F A;  4LD9 K;  3BW1 A;  3JCM X;  4JS5 A;  5CKB A;  3I56 A;  4N4G A;  1M5Q 1;  3OYY A;  3SD4 A;  4ZGE B;  1HXD A;  2VXF A;  1LJO A;  2LNV A;  1PSF A;  4O5V A;  4OVA A;  3OY9 A;  3L2R A;  1D3B B;  1BIA A;  3CME T;  2XI9 A;  4GLK A;  2RM4 A;  2GF7 A;  3OYC A;  2EAY A;  4C5I A;  3CD6 T;  2VYT A;  2ZPE B;  3CCE T;  1BYM A;  3TU4 K;  3VYH B;  4GY5 A;  5FU7 C;  3E1S A;  2DXC A;  2MMP A;  3L2Z A;  4EMK C;  2RHU A;  4XU0 A;  2AHJ B;  4J6X A;  4YTL A;  3GF5 A;  2ZZD A;  4CRI A;  3OYG A;  2L8D A;  2QA4 T;  1YIJ A;  4PJO B;  3OYJ A;  2KAF A;  3QKJ A;  2CZ7 B;  3GP8 A;  3M4Y A;  2OTJ T;  2DTI A;  3A8M B;  3HRT A;  4M77 F;  5CQX A;  3RES A;  2LCC A;  4ZN3 A;  3I56 T;  3FIF A;  4RCC A;  4LDU A;  2DVE A;  4XTW A;  2FHD A;  2WSF E;  2LT1 A;  3OYN A;  2VGN A;  2E5Q A;  2ZCF B;  3LX7 A;  4XQ3 A;  4JRK A;  2MWO A;  5GAO m;  2JVV A;  2PQW A;  3M58 A;  4KUI A;  4BUG A;  1YHQ A;  3MEU A;  4M7D A;  2EFI A;  2DTH A;  2DXU A;  2MI6 A;  3INZ A;  4BY6 B;  2D0Q B;  2GFA A;  4M75 B;  3JCM P;  4ZN1 A;  1JJ2 S;  1N9S A;  1I5L A;  4RG2 A;  1QVF A;  5CO7 A;  3M55 A;  3BFM A;  1WJR A;  4C92 A;  2LVM A;  3ASK A;  3UT1 A;  1YIJ T;  2EQM A;  3OW2 A;  2DXT A;  4WF2 A;  4D6W A;  4N4I A;  1K73 U;  2K5L A;  5AYF A;  3MHX A;  1WQ7 A;  2RI2 A;  3CCL A;  3H8Z A;  3FC3 A;  2LDM A;  1K9M C;  1Q7Y U;  3L2Q A;  1VQK A;  3HSB A;  1G3W A;  2HQE A;  4EDU A;  2K57 A;  5GAN 6;  5LJ5 e;  4L59 A;  4ZGJ B;  4M7A D;  2RH2 A;  1R8O B;  5FU6 C;  2RB6 A;  4EMK A;  1YHQ T;  3L42 A;  2O4X B;  2GCX A;  1BIB A;  2EQJ A;  3LWI A;  2F5K A;  3RUX A;  1IRE B;  3T9N A;  4A4E A;  3P8B B;  3OYI A;  3A8O B;  5DY9 A;  1EIF A;  3UPU A;  1N6A A;  2DEQ A;  3CBM A;  4XTX A;  1M8V A;  1QW1 A;  4M77 C;  4QVZ A;  3TEE A;  3A8G B;  4KT0 E;  2MF2 A;  2RJD A;  2ZPB B;  5LJ5 d;  2QQ9 A;  5GAM g;  3DLM A;  4MML A;  4IUT A;  1Q82 U;  5LJ5 f;  5DLO A;  3JB9 J;  4ME7 A;  1VUB A;  3JCM b;  4C5G A;  3OYE A;  1K8A U;  2EJF A;  3HP9 A;  2XDP A;  5CQY A;  5GAM h;  1XOV A;  3FEO A;  3SWN C;  1S72 T;  1G3Y A;  4M7A G;  1PSE A;  3JAM E;  4PL6 A;  4NL2 A;  1OZ3 A;  4M7D D;  1JJ2 A;  4B9X A;  4BAC A;  2Y4Y A;  3V8L A;  1Y96 A;  4FL6 A;  2HQX A;  2LCL A;  3M56 A;  4J6Y A;  4O6J A;  3S6W A;  2ZPI B;  3VKI A;  4F7U E;  1UGR B;  2JTM A;  1AHJ B;  3MP1 A;  2LRQ A;  4C0D B;  3HHT B;  1SSF A;  5CKH A;  3OQ5 A;  4C92 D;  1QP2 A;  3RMQ A;  1QVP A;  2DZC A;  1U8R A;  2FYK A;  1YJ9 A;  4M7A C;  4OMF B;  2R5A A;  2E41 A;  3BDU A;  3FB9 A;  3M4G A;  2VC8 A;  4XU2 A;  5CKD A;  5DM7 R;  4M77 A;  1VIE A;  5GAN d;  4EMH A;  5A0L A;  5LJ3 e;  1LNX A;  3CC2 A;  5C6S A;  5LJ3 h;  4DQ2 A;  1YCY A;  2QDY B;  1KG1 A;  5GAN f;  1B34 A;  2A3L A;  4DOW A;  1Q86 U;  5IT9 E;  2E12 A;  4C8Q E;  3JCM Q;  3OB9 A;  1OYX A;  2E6N A;  3G6E T;  3I55 A;  3OYK A;  3NFC A;  4E7L A;  4OP0 A;  3WVE B;  3FRN A;  3OMG A;  5I21 A;  1KD1 C;  1BI3 A;  4JRQ A;  1VQ9 A;  4M7D G;  4KBM B;  3JCM e;  3SWN A;  1YJ9 T;  3OS0 A;  2XDB A;  4LDY A;  2M9U A;  3J7A F;  2YLC A;  1Y7X A;  2RK2 A;  3JCM h;  2P0Q A;  5LJ3 d;  4DOV A;  4J8O A;  2PVO B;  1GXI E;  3CC7 A;  3HFO A;  4PJO F;  4C92 G;  3ZFJ A;  2QQS A;  3JCM c;  3C4S A;  5LJ3 f;  3RER A;  2R57 A;  4OB0 B;  3CC2 T;  4IUQ A;  3X20 B;  1QVF S;  3X28 B;  3J80 E;  2QXF A;  2CZ1 B;  2Y90 A;  4R56 A;  2DD4 A;  3E9G A;  4ELY C;  3HL8 A;  2ZPH B;  3ER0 A;  3CCV A;  5FRN A;  2K5I A;  3I55 T;  3CPF A;  4OGE A;  3MEA A;  3JCM d;  4ZTJ A;  3A8H B;  1VQ9 T;  2KVQ G;  4C92 C;  3JB9 F;  2B8A A;  3PTA A;  1KC8 U;  1VQN A;  4M75 F;  2ZPG B;  3JCM f;  4PKC C;  2LT4 A;  2CGH A;  5GMK j;  3EFS A;  2DZ9 A;  3GLX A;  3CC7 T;  2DKG A;  4QVC A;  1WNL A;  4M78 F;  4R55 A;  3QJY A;  2YRV A;  4C8Q F;  3VUZ A;  5GMK i;  2A7Y A;  3PNW C;  3MP6 A;  3QJ6 A;  3S3O A;  1YJW A;  5HK0 A;  1OI1 A;  5CKF A;  3SB2 A;  2E10 A;  4M77 D;  3PFS A;  2QI2 A;  4A4K A;  4PLI A;  5KCO A;  2KK4 A;  2CKK A;  5FRO A;  1UEB A;  4F7U B;  2XK0 A;  5CR2 A;  2EWN A;  2KSS A;  3QZ9 B;  2LQ8 A;  1YJN T;  4A53 A;  1M1K C;  1VQN T;  3QDR B;  2LQK A;  3HPW A;  3M57 A;  3CPW S;  4PJO C;  3X25 B;  1M90 C;  2V8J A;  1ZBX A;  3CCM A;  2EQU A;  1BI2 A;  1IZ6 A;  4X9D A;  4BI8 B;  1VQ8 A;  4JS4 A;  3RMS A;  5J3B A;  4JLI A;  3VYG A;  2NLU A;  1VQ6 A;  2YHT A;  3ZBD A;  1YJW T;  5CVI A;  2V8I A;  4B9W A;  4E7K A;  3CCJ A;  1WJQ A;  4M78 B;  3LGF A;  2DIQ A;  2WSE E;  2BKD N;  3KUF A;  3MET A;  4BY6 C;  1ZQ1 A;  4NOY A;  4C8Q B;  4ELZ C;  5CAI A;  2GFU A;  4M75 C;  1OZ2 A;  4C5E A;  1Y07 A;  3TRE A;  4M77 G;  3JB9 I;  2VUB A;  3JB9 H;  3A5Z B;  1MHN A;  2DO3 A;  3LGL A;  4EMG A;  1KQ1 A;  4M78 C;  4RCB A;  1D3B A;  3CCM T;  1UGQ B;  3C12 A;  3CC4 A;  1NE8 A;  3VJP A;  3BDL A;  3GNG A;  1VQ8 T;  1M9S A;  4Z02 A;  1VQ6 T;  1H64 1;  1WGS A;  2RHI A;  2CZ0 B;  3CEY A;  4XAX B;  4OB1 B;  2QQR A;  5FRM A;  2E6Z A;  2BIV A;  3HFN A;  3CCJ T;  2HAX A;  2D6F A;  3OSS C;  3BY7 A;  4X34 A;  3S3M A;  4PJO A;  2E64 A;  2RHY A;  3CCL T;  2E1H A;  4QQD A;  2WAC A;  3PGG A;  4M7D E;  4XU3 A;  1VQK T;  3QPH A;  5A0D A;  3C94 A;  2DXB A;  2GQV A;  2RJC A;  4PLL A;  3V7R A;  2X4X A;  3CBP A;  1VQP A;  3CPW A;  1Q81 C;  4IKF A;  5GAM e;  4FM4 B;  2DTO A;  3CC4 T;  1I81 A;  4Q5W A;  3QSU A;  4HA8 A;  4BD3 A;  4HKE A;  3RKX A;  1G3S A;  3LW5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...