2RD1A

X-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
b'TNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative outer membrane lipoprotein
publication title X-Ray structure of the protein Q7CQI7.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Structural genomics, unknown function
total genus 5
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rd1A00
4M75G 4PJOE 4M75D 4M7AG 4PJOG 4M7AD 4X9CA 3JCMh 4PJOD 2DJZA 5GANf 2K57A 1LJOA 2DEQA 2EJ9A 3L2ZA 3JB9J 4MMLA 4QVDA 5GAMd 3V7CA 5GAOm 5GAMe 4M78E 2DVEA 5LJ5h 4M78G 4NOYA 1JRIA 4M78D 5I21A 3PGGA 3JB9G 2VXFA 1M5Q1 4JRIA 4N0AC 4M75C 4F7UE 5GAN8 5GAN3 2DZCA 3FJPA 4M77F 4C92B 4F7UG 3JB9D 4M7AC 3HFNA 2EWNA 4PJOA 1LNXA 1WNLA 5GMKj 3HSBA 5GMKm 3RKXA 4XU0A 3L1AA 5GAOn 3JCMd 1BIAA 1WQ7A 4XTVA 2HNIA 1I8FA 3EFRA 4J5YA 5GAOl 1H641 2EJGA 4M78A 4XU1A 4M75E 5GANg 2JN0A 4M7AE 4C8QG 4M7DB 2E65A 3V7RA 4A54A 4XTWA 2DTOA 1BIBA 4C8QD 5LJ3j 4XTYA 1TH7A 3SWNB 4F7UA 5LJ5e 4JUVA 3JCMP 4JRKA 4XQ3A 4MMKA 3V8LA 4J6XA 3RKYA 1M8VA 4HT8A 1Y96A 4C92C 2DTIA 5GAOr 5LJ3f 5GMKl 5GANe 1D3BB 3QSUA 1I5LA 1B34B 3JB9I 2EJFA 3V8JA 1I4K1 2DXTA 2VXEA 4C8QC 4N0AA 3HFOA 4M75F 4M75A 4C8QA 4HT9A 2I2LA 4M77B 4RCBA 4M7AA 4M7AF 4PJOF 4EMKB 5GAMj 5GANh 3GIBA 2RB6A 2QTXA 4NL2A 2YLBA 4OP0A 4EMHA 4C92E 5LJ5d 4JLIA 3RESA 4C92G 4M77G 2YLCA 4C92D 3INZA 2Y90A 1I81A 3QHSA 1KQ1A 4Y91A 4M78F 3SB2A 4C8QE 4QVCA 3JCMb 3JCMQ 3JB9F 3JCMW 4DQ2A 5GAN5 2DKGA 4F7UF 1HK9A 5GMKe 5LJ3g 1MGQA 3M4GA 1U1TA 4WF2A 3RKWA 2ZGWA 5GMKi 4PNOA 4M7DG 4XU3A 3VU3C 1KQ2A 4M7DD 2E64A 1Y96B 4M77C 2VC8A 4C92A 4HA8A 5GANd 4EMKC 3BDUA 3JCMc 5GMKh 2CGHA 5LJ5j 3JCMf 1YCYA 1LOJA 5LJ3e 4C8QF 2RM4A 3V8KA 1WPYA 2E10A 4M75B 3EFSA 4M7AB 4XTXA 3QUIA 4PJOB 5LJ5f 5GAMg 3RUXA 4M77E 4M7DC 4XU2A 5LJ3h 3SWNC 4V2SA 5CAIA 3JB9H 4M77D 3SWNA 5GAMf 3JCMJ 4X9DA 4M78B 5GAN2 5DY9A 2RA2A 4RCCA 1JBMA 4A53A 1WQWA 2DZ9A 3QO3A 3V7SA 1D3BA 4EMGA 4F7UB 3JCMX 4M7DE 2E41A 1B34A 2RD1A 4J6WA 2E1HA 3JCMg 5GAOq 1U1SA 2FYKA 4J6YA 3BW1A 4C92F 5GAN4 4M77A 1HXDA 2FB7A 1X01A 3BY7A 5GAMh 4EMKA 5GAOp 1N9SA 3BFMA 4PJOC 4XTUA 1N9RA 5LJ3d 5GAN6 5LJ5g 5GAN7 2EAYA 3JCMV 3AHUA 3FB9A 2DXUA 4XTZA 4C8QB 4NL3A 3RERA 3FIFA 4M7DF 3JCMe 4M78C 5GANj 2DTHA 2YHTA 3RIRA 4M7DA
chains in the Genus database with same CATH superfamily
1VYVA 3QJYA 2EIFA 3L2RA 3FRNA 5AT1B 4DOVA 2RHIA 2BZ8A 2MWPA 2X51A 3VRYA 2CSQA 2D8HA 5LL6S 1BCMA 2GTOA 1UJYA 2EGAA 3CPFA 1WA7A 3EH2A 4HKEA 1JQQA 4M7AC 4IUTA 2QEXT 4A4EA 3CCQT 3KXTA 1RAFB 4JUVA 3GP8A 2YUPA 2R5MA 4ANJA 4A4FA 5IHIA 1M8VA 1VQNA 1PC0A 1V76A 3QKJA 1TWBA 1NEBA 2M51A 2CUDA 2O9SA 1G3WA 3MKDA 3G4ST 2KT8A 4QQGA 4EMHA 1TU0B 1JO8A 3RESA 4FL6A 2Y90A 1I81A 3KFVA 3KBGA 2CT3A 4OMLA 2AZVA 4CRIA 4M7DD 2JJ9A 2FG0A 1JXMA 2KXCA 3CD6Q 4VUBA 2YUQA 5LJ5f 4PJLA 3SDZA 2DILA 3VUZA 1VQLA 3H9NA 3JCMJ 3I35A 1QP2A 2EQUA 5HY6A 3QO3A 4M7DE 2EYWA 2LCCA 3EAEA 4LDVA 1G83A 1VQPA 1UJ0A 1FMKA 1IB8A 2D0QB 3EFOB 1M1KC 1UHFA 3FB9A 3NFCA 2QTVA 3NGPA 2YDLA 2LNHB 4E2FB 3M57A 4BI4A 1F1BB 2BE9B 2YRDA 5KYXB 1PD1A 1Q81R 1SF9A 3J7AF 2RI3A 1KJWA 3RMQA 2J6KA 3CCJT 1NLOC 3DB4A 4JZ3A 3JB9G 4M77F 1AEYA 4DA4A 1ZQ1A 1GCQA 1IGQA 2O88A 2RO0A 5GAOn 2OAWA 2XU8A 3H8ZA 4LN2A 4BE0A 4C8QG 1YJNA 4E7ZA 2X3XD 2LX9A 4F7UA 5C6SA 1C6VX 3MO8A 4RTVA 4RTWA 2EFIA 2VUBA 1VQ8Q 4E7IA 1WXTA 1X69A 4X34A 1WHJA 4PJOF 4IUVA 4J83A 2KEAA 2CZ7B 3M0TA 1VUBA 4MZPA 4JJCA 4R56A 1EX4A 1R8OB 1RAHB 1XJWB 4KRTA 4HVVA 4HVWA 2PQWA 1AD5A 3LGLA 3QYGB 2RN8A 4J7IA 1Q7YC 2GQVA 2DL4A 2NUPB 4M75B 2QDYB 3CCMT 4BDZA 2RHZA 4HCZA 1KC8U 4M77D 1YIJQ 1MV3A 5IH2A 2X4WA 2OTJQ 2O01E 1YITQ 1WQWA 4FYWB 1D3BA 2A37A 1VQ9A 1CKAA 2V8KA 1WHKA 4C0DB 3BY7A 1Y71A 1UECA 4KULA 3X26B 2HQHA 5I22A 4M7DF 1ZSZB 4ZN1A 5GANj 2ECZA 5J3BA 3RIRA 1K8AC 3QBYA 4X9CA 4PJOD 3OYNA 3V7CA 1PRLC 2KE9A 3VS7A 4E7LA 2Z0WA 3CC2T 4JJNK 5CQXA 2KSSA 3REBB 4LD6A 1RAIB 1OX8A 9ATCB 5CVIA 3OYGA 2DA9A 2DL8A 5KYUB 3CBMA 4JDSA 1YNZA 2CS7A 2VGMA 3OSSC 2XDBA 1PCXA 3HP9A 5LJ5d 2HL5C 4XTYA 3CXCP 2AHJB 5CKHA 2RK1A 1M30A 4FYYB 5GANe 2C0TA 2HDAA 3CMAT 3M5AA 3HFOA 4M75A 3CCQA 4FM4B 4F17A 1JXOA 3EG1A 4NL2A 5KYWB 4HXJA 4PK4A 5A0LA 5HK0A 3H0FA 1WHLA 2F2WA 4M78F 1K73C 3CBOA 3LH5A 5CKFA 2COYA 2FPFA 2F69A 1N27A 2DKGA 1SPKA 3OYLA 1G5VA 3VU3C 4C5GA 4M77C 1WDXA 2M0OA 1MV0B 3G4SA 4E7KA 1NM7A 2XIDA 1T3LA 1P92A 1M2VB 1ZSZA 3CCUT 1PHTA 3EFSA 3MEWA 2QQAA 2E6ZA 2K5FA 4AT1B 4RTXA 1QWEA 1X27A 2HQXA 1QVFP 2WACA 4RCCA 1VQMQ 1JB0E 4J9IA 1JJ2P 1ABOA 1TSFA 1K9AA 3LLRA 4PJOC 3A8GB 3CC4T 1M3BA 3C94A 4RG8A 3UATA 1M1KU 2WSEE 3OMGA 1IHVA 3ME9A 2E3HA 1NYGA 1UGQB 2LCLA 2VVKA 1PG5B 5GAMe 1ZSGA 2MYSA 4M78D 3PGGA 3VKIA 2VXFA 1UFFA 2HQEA 3PE0A 3G71Q 4D8DA 1MMNA 1RAGB 4DBFA 4XU0A 1BIAA 2LMJA 2G3RA 2NUTA 1K9MR 5LJ3j 5FU6B 3FEOA 2EW3A 3MP8A 4F04B 1S72A 2CH4W 3PVQA 2JW4A 1VQNT 2VXEA 1VQ4A 4RCBA 1NZ9A 3UF4A 5GANh 4J9HA 1AWOA 1CSKA 1W6XA 1KHCA 4KGVB 4BE1A 2HBWA 3SB2A 2DIGA 3M0RA 4PLLA 3JCMb 4DBHA 1I07A 4ELZC 2EQMA 1UGPB 1Q82R 3RKWA 2ZGWA 4M7DG 1W2BA 1OU9A 4OB2B 3VV0A 1Q86U 1UDLA 1OI1A 3JCMc 3URGA 5LJ3e 2DF6A 4ESRA 3G6EA 2E10A 3VJPA 2QEXQ 1Q7YU 5GAMg 2A08A 2QYZA 4J9CA 2E5QA 1W2BS 2CP7A 2BUDA 2J7IA 1VQLT 2X35A 2DO3A 4E6RA 3S3OA 1VQOA 2OTLT 3CPWA 1A0NB 2GTJA 1U1SA 4II1A 2HL3A 1HXDA 3VYHB 4PJNA 4RMOA 2GQIA 1WI7A 4C0GA 2EAYA 4MZMA 4ZTFA 1VQPT 1W70A 4M78C 3CCVA 3CPWS 1NLPC 2JNGA 3LWHA 2L8DA 1K8AU 1UEBA 2FRYA 3CCLA 2IG0A 3C0CA 3QZ9B 3M54A 4N0AC 4F7UE 2W0ZA 2DZCA 1YJWA 3A8LB 3VS3A 3L1AA 4ZGDB 3OYYA 2PVOB 2FRWA 5IXFA 3V7RA 4D6WA 2L3QA 2ATCB 2PVDB 1E7OA 5D6WA 1YJNT 4J6XA 3RKYA 3CC2A 2PU9B 3ASKA 3ZEHA 4XAXB 3CMEA 2PZ1A 2DXTA 4C8QC 3CC7A 4M75F 3OYAA 4KUDK 3GIBA 4CC2A 1VQKA 3M59A 4KGZB 4JLIA 4N4HA 5KH6A 2CH4A 1SSHA 1K73U 3UA6A 2LQKA 3QWXX 1NBEB 1KQ2A 2E64A 1J3TA 4C92A 3CCJQ 1RI9A 1YCYA 3I56A 2GFAA 3CXCA 2DBKA 1YHQA 1VYTA 1D1CA 3C4SA 1ZX6A 5LJ3h 3SWNC 4V2SA 2EKOA 4O6JA 1GFDA 1RACB 2RF0A 3ULRB 2RQTA 3EHQA 5CK9A 3S6WA 1D0XA 3BE3A 1VQ9T 2FB7A 2AZSA 4EMKA 1N9SA 3CXCS 2ABLA 1ZA1B 5DLQE 1E6HA 3JCMe 3U23A 1M3AA 3HHTB 2J6FA 4M75D 4IIMA 4PJOG 2LJ1A 2DJZA 3PIPA 2EGEA 2QK0A 1LJOA 4E7SA 2EKHA 4IKFA 1KSWA 3REAB 4CC7A 5I21A 1AZGB 1Y07A 4HCBA 4L59A 1KC8R 1ZA2B 4FU6A 4LDXA 4BY6C 1QVFA 2LZ6B 3CCMQ 1OPLA 5KYNA 1WQ7A 2RJEA 1I8FA 2RNAA 4XU1A 4M75E 2BZXA 1Y7XA 1JJ2A 2WSFE 4FYXB 3V8LA 2DYBA 2JUFA 5I2SA 1IGUA 1OOTA 2YXYA 1QVFS 1FMVA 4WTOB 4ZTJA 3M56A 2JM8A 1KG1A 2B86A 2RHXA 2EYYA 5FU7C 3E1SA 1RADB 5FRNA 1Z9ZA 4JS4A 5GJWB 3JCMQ 2K2VA 4A4GA 5GAN5 1D1AA 4ORZA 3QG1A 3KUFA 4CI0C 1PD0A 1LOJA 4J9DA 2RM4A 3V8KA 2QAZA 2KQWA 3F70A 3LH0A 4E7JA 5GJVB 1G3YA 1TUCA 4X9DA 4B6MA 4C0FA 5J26A 2GFUA 1B7TA 2G6FX 1V1CA 4RKUE 4EMGA 4F7UB 3C12A 2MF2A 2EVRA 3MEAA 5AYFA 3CMAQ 2O9VA 4X1VA 1BU1A 5GAN6 2D8JA 5C0MA 5KE3A 2EQIA 2QI2A 1WZOA 3CCEQ 1M3CA 2DETA 2EQKA 3TSWA 1NJIC 3JCMh 3M53A 1QMCA 3VS0A 2OTLA 4FSSA 2K6DA 1OU8A 5GAOm 4M78G 5A2QE 3TSZA 4JRIA 5GAN3 4MDXA 2KI7A 4QQ6A 2LNVA 3FJPA 3TREA 1XOVA 2QQSA 1WNLA 2A36A 3CCUQ 1QW1A 2A28A 2LC4A 3VUBA 1WJQA 1RAEB 4BE2A 4M4ZA 5GAOl 1K0XA 1HSQA 1X6GA 1Q95G 1BIBA 1G3SA 4ZGJB 2PUKB 4J9GA 4XQ3A 1YI2A 1Q81C 1DJ7B 2CP6A 2EBPA 2LT1A 4IUQA 1M90C 2VWFA 1D3BB 2AT1B 1S72T 2ROLA 5FWBA 2NYSA 1GFCA 4C8QA 1H92A 3CC4Q 1WHGA 1VQ4T 2JS2A 1OPKA 2QXFA 1C1AA 4J9FA 1T3SA 2CSIA 4Y91A 5KCOA 2IPOB 4E7HA 1QCFA 2M0YA 2KRNA 3RMSA 4XU3A 2YSQA 3OA6A 4LD9K 1ZBJA 4QKUA 3EGDA 1WYXA 3X25B 5L23A 1ZLMA 5KYYA 4M7AB 1QCNA 1YJ9A 4HCCA 3G6ET 4M7DC 3DKMA 3SWNA 4FW1A 2GF7A 2CDTA 1MMDA 2NWMA 2P4TA 3DLMA 1VYUA 3V7SA 1N6AA 2RD1A 1VQOT 2MI6A 2DL5A 1VQNQ 1AWJA 4JJBA 1YCSB 2F2VA 3RERA 3GF5A 3OW2P 3D7SB 3CCVT 1RI0A 1Q86R 2ROTA 1I5OB 1GCPA 2O4XA 1HJDA 4MMLA 1YWPA 1UB4A 3EGXA 3QXEB 3QYHB 3ZL7C 3CEYA 2P0KA 1Q7YR 2DERA 3CCLT 4Q5WA 2YUOA 3CCST 1BYMA 2DEUA 4FYVB 5GMKj 1N8RC 3HRSA 1ZUYA 1YJWT 1VQ7A 1H3ZA 1TXQA 3EFRA 2EJGA 2I0NA 1M2OA 2A0FB 2YRCA 3JCMP 2V8IA 3N5BB 1VQLQ 1QWFA 2KROA 4MDWA 5KCHA 1I4K1 3CMET 4M7AA 1VQPQ 3CC7T 4C92E 3NTIA 1VQKT 3INZA 5FU6C 3QHSA 4FW2A 3OB9A 4L5GA 2CT4A 3QDFA 5GMKe 1ACMB 2CP3A 2VYTA 1SSFA 1Y96B 1YWOA 2DXBA 3I5SA 5LJ5j 3RBBB 3VYGA 1QVGA 2ZAEA 1SG5A 1WPYA 3RDVA 3I55A 2RJCA 4GBQA 2QQRA 2LQ8A 3I56T 1YHQT 1KQSP 2KXDA 2NUTB 4OMQA 1GRIA 3GOXA 2KT1A 1YJNQ 1MMGA 4BD3A 2DZ9A 1KIKA 3C95A 1QVGS 3BW1A 2PVGB 1UGSB 2QA4A 2P4RA 4XTUA 4Z02A 2KYMA 2X4XA 3AHUA 4OB0B 2D1XA 2X9HA 4NL3A 4PLIA 4M75G 3QIIA 2LCSA 1IREB 4PFZA 3JSCA 3JB9J 2DMOA 1VA7A 1NJIU 5GAMd 2KR3A 2ZPGB 2RQUA 3WXMB 1WGSA 4OVAA 1QKXA 3UPUA 3HSBA 3EGUA 3OS5A 5IXBA 3QWYA 1W1FA 4OMFB 4LXCA 4QT7A 4B9XA 5GANg 2JN0A 3PNWC 4A54A 3E9FA 1KHIA 1PNJA 2L3RA 1HD3A 4HT8A 1Y96A 3GBQA 3NHNA 1NPPA 2DRKA 3M4YA 1Q81U 4J7FA 3JB9I 1VQ9Q 2XICA 2OI3A 3EHRA 1M90U 3J80E 1BBZA 4EDUA 1KD1R 4HT9A 3OS0A 2X4YA 2DLPA 1TG0A 4J9BA 2RB6A 2HSPA 2SRCA 3SD4A 1WHHA 3R6OA 2BIVA 1UUEA 2YLCA 4BI3A 1PKSA 3RNJA 2M9UA 3J81E 1B3QA 5L8RE 3L42A 4DQ2A 3JCMW 1K9MC 2CP0A 1RUWA 1AWXA 4RTYA 4F7UF 4BDYA 1OX9A 3E9GA 3GPLA 1EFNA 1VQ8T 1X43A 2DVJA 1VQ6A 1IXDA 5GMKh 3CCRA 3MCAB 2HAXA 2KK4A 4F16A 2RQWA 3BDLA 2DL3A 2PTKA 2RI5A 4RTUA 1LVKA 2ZPIB 2F2XA 2HBPA 3JB9H 1BI0A 1AT1B 2B8AA 2L3PA 2L3SA 4J6WA 2LX7A 1Q82C 1OULA 2GNCA 2K9GA 1EIFA 5GAN4 1MUZA 2YUNA 3BFMA 1N9RA 2MPXC 4GY5A 4Y28E 3FIFA 3CCQQ 2GGRA 2YHTA 1CKBA 1QQJA 2JMCA 2KRMA 1QLYA 3FC3A 1WFWA 5LJ5h 4BUGA 2JMAA 2DRMA 1M5Q1 4C92B 1VQ5A 2EWNA 3G4SQ 4AFZC 2CZ0B 3ZFJA 4Z8AA 1N8RU 4XTVA 2HNIA 5KE2A 1H641 1PRMC 3G7ZA 2H3JA 5CKBA 1D0YA 1QKWA 4JRKA 3TVTA 2NUZA 3UDCA 2C0IA 1KK7A 5I11A 3CCSA 2HZYA 1YI2T 2EJFA 3VS6A 3OW2A 4M7AF 1OZ2A 4EMKB 2RJFA 2XDDA 3X24B 1KQ1A 3VS2A 3OY9A 4QVCA 4N4GA 3A5ZB 1SEMA 2AIRB 5LJ3g 4WF2A 3A8HB 3OW2S 2IVWA 3OYHA 2GBQA 1WHMA 3M9QA 1SHGA 1XNIA 1O9SA 2XG8D 1BB9A 4BACA 2RJDA 2K7AA 3MEUA 4XTXA 2DK3A 5IHNA 1YP5A 1OZ3A 5FRMA 3NPFA 2KMTA 1YJ9T 1PSEA 4CC4B 1TTHB 2QQ9A 2D0NA 4A4KA 2V8JA 3JCMX 3DB3A 1B07A 4JLGA 1B34A 1TS9A 5GAOq 2VKNA 3OYMA 5CKEA 4AFQC 1S72Q 1GCQC 4M77A 1X01A 1U06A 3P8HA 2D9TA 3PTAA 2FO0A 4J8OA 4LNPA 5IN1A 2XDPA 3PFSA 5D6YA 2RQVA 4M7AD 4Z89A 4BB7A 2EJ9A 4TVRA 1N5ZA 1WXBA 1K4US 3OQ5A 4ELYC 2X3WD 4NOYA 3H0HA 3EG9A 4WCIA 3CD6A 1RAAB 2DM1A 2K3YA 1OV3A 4LUDA 4PJOA 5CCAA 1KQSA 3G6EQ 1ARKA 1K1ZA 2C0OA 2ZPHB 1VQ7T 4OF1A 4DEXA 2QQBA 3OMCA 2AK5A 1U8RA 1QP3A 4M7AE 2FHDA 4CC3A 4XTWA 2M1HA 1TH7A 3MHXA 2KNBB 2FZCB 1QVPA 1VQOQ 4PFOA 1WIEA 3GLXA 1I5LA 2E5KA 2JS0A 4IUUA 1E6GA 3L2VA 2CP2A 3P8BB 3M0QA 3PMIA 1VIEA 5A0GA 2MCNA 3CCVQ 4PL6A 2JTFA 2F1LA 4PJJA 1MGQA 2LVMA 4EIKA 3E2UA 3CCLQ 1UGVA 2DAQA 2BE7D 1YJWQ 2JOYA 1JJ2S 1VOMA 4OB1B 1NG2A 6AT1B 1IRXA 2EPDA 5CAIA 3I55T 4QQDA 3OYDA 5D7UA 1UHCA 4HVUA 1VQ8A 3EG0A 3JCMg 1T0HA 4J6YA 3TQ7P 4FT2A 3CC2Q 3MP6A 3H0IA 1Q82U 1X2KA 3CMEQ 4OGCA 2QA4T 3CC7Q 2CREA 4QW2A 4C8QB 1ZUUA 2AKLA 4JS5A 1MHNA 4ME7A 2HSEB 4DOWA 1UE9A 1M27C 2EYXA 3ER0A 3HRUA 3VS4A 1XQHA 4EPCA 1VQKQ 3QDRB 1TUGB 2CP5A 1RLQC 2O31A 5GANf 1Y0MA 2K5LA 2DEQA 2KBTA 4JRQA 4M75C 4KT0E 2KDSA 3PIOA 3EGDB 5GMKm 5M9OA 1SHFA 5KYYB 1YIJA 3MEVA 4NS5A 2OTJA 4M78A 3JRZA 2RPNA 3I56Q 4AFUC 3A8MB 1YITA 1YHQQ 2E65A 2H3EB 5HKCA 2D6FA 3SWNB 5HK3A 2KYBA 4PFPA 1Y57A 2E4HA 2LQNA 4MMKA 5D6XA 4C0DC 1G3TA 1G2BA 5GMKl 1U5SA 3JV3A 1AHJB 5J39A 3LWIA 3H41A 1AZEA 8ATCB 2QGFB 3PT9A 1ZSZC 4N0AA 5CKDA 3WVEB 2QTXA 3IQLA 2HEQA 3A1PA 1NJIR 2J6OA 2FL7A 5FWCA 2LRQA 1YFNA 2R57A 2AKKA 4F14A 2DFUA 3R6NA 4ZGEB 3M4GA 3OYFA 2MK5A 2O4XB 1PKTA 4PNOA 1AOJA 5EC7A 3EGXB 2L89A 4IIOA 1M1KR 2CGHA 1VQ6T 1ZHIA 2DBMA 3CCRT 4UC4A 3TU4K 4R55A 2DIQA 3VS1A 1M8MA 4XU2A 4BY6B 4DBQA 2LDMA 5GAMf 5DY9A 2Y4XA 2DE0X 1M90R 1YN8A 1JBMA 4A53A 4FSXA 2E41A 1X2QA 1O75A 4OB3B 4L6V5 2FYKA 4C92F 3M55A 1W2BP 3L2QA 2DL7A 4JRPA 2KRSA 3NMZC 1ABQA 2DXUA 2QGGA 2K79A 1GXIE 1M1GA 2NLUA 5CR2A 5FU7B 2VV5A 2COZA 2L2PA 4KBMB 1QCOA 2M02A 2ZZDA 4N4IA 3L2ZA 2K3BA 4QVDA 4YTLA 1I0CA 2XK0A 2FPEA 2XI9A 1UGRB 3I9QA 1JRIA 7AT1B 4F7UG 3CPWP 4A63B 2EGCA 4JZ4A 4FT4A 1VQ5T 5CQYA 1LCKA 1EZZB 2J06A 3LX7A 2OX7A 2RH2A 1VQMA 2YRVA 1ZUKA 2RHYA 3X20B 2CZ1B 1Q86C 2J05A 2BZYA 2E3IA 5LJ3f 2DX1A 2RI2A 3QSUA 3LGFA 1PWTA 4AMCA 3EFOA 2JXBA 2CZ6B 3L2WA 3SEMA 2K3XA 2RHUA 1R0BG 1FX7A 2YLBA 2ENMA 3OYEA 4C92D 5KYXA 1NPRA 1K0SA 2LQWA 3S3MA 1HYOA 2MMPA 1U1TA 3PMTA 2OTLQ 1VIFA 2FZKB 1FWZA 2CUBA 3G71A 5GANd 3SHWA 1N8RR 3BDUA 3HPWA 1NYFA 2VGNA 2FVUA 1H3HA 1IHWA 2A7YA 1W4SA 4OMNA 1K8AR 1FXXA 4M77E 1G8XA 2DJQA 2MWOA 2P0QA 2DYIA 1D1BA 2QDLA 1MMAA 2GCXA 4ATOA 3G1JA 1BI1A 2KGTA 1R0CB 2ED1A 1BI3A 1IO6A 2E1HA 4Z88A 1H8KA 1YI2Q 3OYKA 1SKUB 4XTZA 4A4HA 2XHCA 3M58A 3SFMA 2E70A 2MOXA 2JTMA 2XMFA 3CQTA 2JVVA 4PJOE 2DD5A 3H6ZA 4M7AG 2JT4A 4C5EA 3UT1A 2DD4A 3Q1JA 1ZBXA 1PSFA 2NUPA 2QEXA 4B9WA 4BI8B 3QPHA 2BKDN 3HFNA 3CD6T 1LNXA 4LDWA 2QASA 3ZBDA 3CCET 2ZPBB 3I5RA 3M0SA 1K73R 3HTRA 1YJ9Q 4E47A 2V1QA 4M7DB 2DTOA 5LJ5e 3MP1A 1WJRA 5HCKA 3QZ5B 1RABB 2OAUA 3X28B 1I1JA 1LPLA 4C92C 4DBRA 2ED0A 2XKOC 2DXCA 2YWWA 2L0AA 2LTOA 4IUPA 5GAMj 2LT4A 2VB6A 1C0MA 3OYJA 1U3OA 3OS2A 2RMOA 2PUOB 3JB9F 2P84A 3EG3A 3NTHA 1HK9A 2EYQA 3FLGA 1UTIA 2LJ3A 1OYXA 4HA8A 4EMKC 3JCMf 1OEBA 3EG2A 2EQJA 5KYUA 3OBYA 4C8QF 4OMOA 2KAFA 1KD1C 3LYIA 1SRLA 3RUXA 1X6BA 1GBRA 1VQ7Q 3VRZA 2R58A 1TUDA 2O2OA 3NTKA 1PM3A 5GAN2 5DM7R 1V29B 2K5IA 3OS1A 2L5QA 1AVZC 3JAME 3O8VA 2PNIA 2RQRA 2FZGB 4FCYA 2RK2A 3DLLA 2E6NA 3M0UA 2F5KA 4RUGA 2HMAA 5KYWA 1OQKA 3FJ5A 5LJ3d 3TCJA 5LJ5g 2CKKA 2X4JA 3JCMV 4GLMA 4M7DA 1D09B 4QVZA 1BCOA 2MAMA 1BKBA 3CCJA 1NEGA 4M78E 2LP5A 2C06A 5GAN8 3JB9D 1M2VA 5IAYA 2COWA 2HD0A 1GL5A 2LJ0A 1S1NA 3RKXA 1M1FA 2DNUA 2VASA 1BK2A 1KFZA 1NE8A 3I55Q 3WVDB 3MJXA 2EYZA 1YIJT 3OYIA 3HRTA 4C8QD 2OTJT 1MNEA 2QG9B 1YITT 3PVLA 5FW9A 5ECAA 3MPUB 2DTIA 3THKA 1B34B 1SRMA 1YBYA 1X75C 2CYZB 1T0JA 4M77B 1GBQA 2QA4Q 4KH0B 4OP0A 4Y92A 5CO7A 1D0ZA 4O5VA 3GNFB 2KY9A 4C8QE 1IZ6A 1R77A 2Y4YA 2V26A 3GNGA 4RG2A 2ZCFB 3T9NA 5GMKi 3OYBA 4IURA 2K4YA 2WSCE 2VC8A 4OMMA 4AG1C 3EG9B 4OMPA 3CCMA 3UA7A 5IHKA 2V1RA 4PJOB 3L2UA 3OBWA 2ESWA 4LE9A 5A0DA 4LDUA 2P0PA 5FLXE 3TEEA 4KUIA 2F5TX 3A98A 2RA2A 4AFSC 2YT6A 4C5HA 4MZTA 4J9EA 5GAMh 4HCKA 1WJSA 2MIOA 1WLPB 2JTEA 5GAN7 4GLKA 1FYNA 2HKNA 2ZPFB 1FMWA 4D8KA 4LDYA 3E19A 2A3LA 1UG1A 2HCKA 5DLOA 2DPPB 2K57A 3FDRA 2DVEA 2FPDA 2SEMA 3O5ZA 4P5NA 1RL2A 4RTTA 3OYCA 3P8DA 3HKSA 4K11A 1VQ6Q 3A8OB 3CCRQ 3VS5A 2KVQG 1M9SA 2OJ2A 3JCMd 1VQ4Q 1Z9QA 2E12A 4J5YA 3QJ6A 1BI2A 5IT9E 1VQMT 4JJDA 3CMAA 4LUEA 5GAOr 1JEGA 1RLPC 4JPBW 4R0KA 3V8JA 1K76A 2I2LA 2M16A 1AWWA 5EG2A 3CCEA 4ZNXA 4C92G 2XD0A 4M77G 4OGEA 4PKCC 2FEIA 1M4ZA 4DEYA 2R5AA 4ZN3A 4AG2C 4C5IA 3S3NA 4PJMA 1KQSS 3CCUA 3G71T 3OSVA 5FROA 3META 4KGXB 3QUIA 5I2MA 1KC8C 1VQ5Q 4KH1B 1KD1U 3AT1B 1MNDA 2K2MA 3HL8A 4RTZA 4M78B 1XTDA 1WX6A 2BTTA 3CBPA 2ZPEB 1X6OA 4XK8E 2IIMA 4C0ZA 1K9MU 8AT1B 2W10A 5CIUA 4FIBA 3EH1A 3LW5E 3CC4A 5GAOp 3CCSQ 2H8HA 2JZ2A 2HKQB 1WXUA 2JM9A 1JU5C 1TOVA 2DTHA 3RR6A 3M0PA 1QVGP 3UWNA
chains in the Genus database with same CATH topology
4M75G 5FU7B 2VV5A 3CPWS 2JNGA 3QJYA 3QIIA 4KBMB 3LWHA 2L8DA 1K8AU 2EIFA 1UEBA 1IREB 2ZZDA 3FRNA 4N4IA 3JSCA 4DOVA 3L2ZA 3L2RA 3JB9J 4QVDA 1NJIU 2RHIA 5GAMd 2MWPA 3CCLA 2ZPGB 2XK0A 4YTLA 2XI9A 5LL6S 1UGRB 2IG0A 3WXMB 1JRIA 1WGSA 3CPFA 3QZ9B 4HKEA 4OVAA 3M54A 4N0AC 4F7UE 3UPUA 3S3OA 2DZCA 4F7UG 4M7AC 1YJWA 3A8LB 4IUTA 3HSBA 2QEXT 4A4EA 3CCQT 3OS5A 3L1AA 4FT4A 1VQ5T 4ZGDB 4OMFB 3OYYA 3KXTA 5CQYA 2PVOB 4B9XA 5GANg 3LX7A 2JN0A 2RH2A 3PNWC 3V7RA 2YRVA 2RHYA 4A54A 4D6WA 1VQMA 3E9FA 3X20B 2CZ1B 2PVDB 4JUVA 3GP8A 5D6WA 2R5MA 1YJNT 1KHIA 2L3RA 1Q86C 4J6XA 3RKYA 4A4FA 3CC2A 1M8VA 4HT8A 1Y96A 1VQNA 2PU9B 3ASKA 3ZEHA 5LJ3f 1NPPA 4XAXB 2RI2A 3QSUA 3M4YA 1Q81U 3LGFA 3QKJA 4J7FA 3CMEA 3JB9I 2XICA 1M90U 2DXTA 4C8QC 3J80E 3CC7A 2CZ6B 4EDUA 4M75F 3L2WA 4HT9A 1G3WA 3OS0A 3OYAA 4KUDK 3G4ST 2X4YA 2K3XA 2RHUA 3GIBA 3SD4A 1VQKA 1FX7A 2RB6A 3M59A 2YLBA 4QQGA 4EMHA 3R6OA 4JLIA 2BIVA 3RESA 3OYEA 2YLCA 4FL6A 4N4HA 2Y90A 1I81A 4BI3A 4C92D 2M9UA 5KH6A 3J81E 1NPRA 3KBGA 5L8RE 3L42A 4DQ2A 3JCMW 1K9MC 3S3MA 4F7UF 2MMPA 1K73U 4BDYA 1U1TA 2LQKA 3E9GA 3PMTA 3GPLA 1VIFA 1VQ8T 1FWZA 4CRIA 1KQ2A 3G71A 2E64A 5GANd 1VQ6A 4C92A 4M7DD 3BDUA 3HPWA 5GMKh 3CCRA 1YCYA 3MCAB 2VGNA 2HAXA 2KK4A 2FVUA 3BDLA 4VUBA 2A7YA 1W4SA 5LJ5f 3I56A 2GFAA 2RI5A 1FXXA 4M77E 3CXCA 1YHQA 3C4SA 2ZPIB 2HBPA 5LJ3h 3SWNC 4V2SA 2MWOA 3SDZA 3VUZA 3JB9H 2P0QA 1VQLA 1BI0A 2EKOA 3JCMJ 4O6JA 2GCXA 1QP2A 4ATOA 2EQUA 1BI1A 5HY6A 2B8AA 3QO3A 5CK9A 3S6WA 4M7DE 4J6WA 1BI3A 2E1HA 1Q82C 2LCCA 1EIFA 3EAEA 4LDVA 2FB7A 5GAN4 1VQ9T 1VQPA 4EMKA 3CXCS 1N9SA 3BFMA 3OYKA 1N9RA 2D0QB 1M1KC 4GY5A 4Y28E 3FB9A 5DLQE 4XTZA 3FIFA 2XHCA 3NFCA 4A4HA 3M58A 3JCMe 2YHTA 3SFMA 2E70A 2JTMA 3HHTB 2JVVA 4PJOE 3M57A 2DD5A 3H6ZA 4M75D 4BI4A 4M7AG 4PJOG 4C5EA 2DJZA 3PIPA 1LJOA 3FC3A 3UT1A 5LJ5h 3J7AF 2RI3A 3RMQA 4BUGA 4IKFA 3CCJT 5I21A 2DD4A 3DB4A 3Q1JA 3JB9G 1Y07A 1M5Q1 1ZBXA 4HCBA 1PSFA 4M77F 2QEXA 4B9WA 4L59A 4BI8B 3QPHA 1ZQ1A 2BKDN 3HFNA 4C92B 4DA4A 3CD6T 1VQ5A 2EWNA 1LNXA 4FU6A 4LDWA 4LDXA 4BY6C 3ZBDA 1QVFA 2CZ0B 2RO0A 3ZFJA 5GAOn 1WQ7A 4XTVA 1N8RU 3CCET 2RJEA 2HNIA 1I8FA 2XU8A 2ZPBB 3H8ZA 5KE2A 1H641 4XU1A 4M75E 4E47A 4BE0A 3G7ZA 1Y7XA 2H3JA 5CKBA 4C8QG 1YJNA 1JJ2A 4M7DB 2DTOA 2LX9A 4F7UA 5LJ5e 3MP1A 1WJRA 3QZ5B 4JRKA 2WSFE 3V8LA 2OAUA 5C6SA 2JUFA 5I2SA 3X28B 3MO8A 4C92C 3UDCA 2EFIA 2VUBA 4E7IA 3CCSA 2XKOC 1QVFS 1YI2T 2DXCA 2EJFA 4X34A 2LTOA 4ZTJA 3OW2A 3M56A 4M7AF 4IUPA 4PJOF 1OZ2A 4EMKB 5GAMj 2LT4A 2RJFA 4IUVA 2XDDA 1KG1A 4J83A 2CZ7B 2RHXA 3X24B 5FU7C 1VUBA 4MZPA 4R56A 3OYJA 3E1SA 1KQ1A 3OY9A 5FRNA 1R8OB 3OS2A 4JS4A 4QVCA 3JCMQ 2K2VA 2PUOB 4N4GA 3JB9F 3A5ZB 4A4GA 5GAN5 3NTHA 1HK9A 2EYQA 2PQWA 3FLGA 5LJ3g 3LGLA 3QG1A 4WF2A 3A8HB 3OW2S 2IVWA 3QYGB 3OYHA 3KUFA 1OYXA 3M9QA 4CI0C 4HA8A 4EMKC 1XNIA 4J7IA 3JCMf 1LOJA 1O9SA 2GQVA 1Q7YC 2EQJA 3OBYA 2XG8D 4C8QF 2RM4A 3V8KA 4M75B 2RJDA 4BACA 2KQWA 2KAFA 3MEUA 4XTXA 2QDYB 1KD1C 3F70A 3CCMT 3LYIA 3LH0A 4BDZA 2RHZA 2DK3A 4HCZA 4E7JA 3RUXA 1G3YA 1KC8U 1OZ3A 2R58A 5FRMA 2KMTA 1YJ9T 4M77D 3NTKA 2X4WA 4X9DA 4C0FA 1PSEA 5GAN2 5DM7R 1V29B 2O01E 2QQ9A 2K5IA 5J26A 2L5QA 3OS1A 2GFUA 4A4KA 3JAME 2V8JA 3O8VA 4RKUE 1WQWA 4EMGA 3C12A 3DB3A 1D3BA 4F7UB 3JCMX 4JLGA 1B34A 1VQ9A 2RK2A 2MF2A 5GAOq 3MEAA 3OYMA 3DLLA 2E6NA 5CKEA 5AYFA 2V8KA 4M77A 4C0DB 1X01A 2F5KA 3BY7A 1Y71A 3P8HA 2D9TA 3PTAA 5LJ3d 3TCJA 5GAN6 2CKKA 2X4JA 5LJ5g 4KULA 3JCMV 3X26B 5C0MA 5KE3A 4J8OA 4M7DF 2QI2A 4ZN1A 5GANj 5J3BA 5IN1A 3RIRA 2XDPA 3PFSA 4M7DA 5D6YA 2EQKA 1K8AC 4QVZA 3QBYA 1NJIC 4X9CA 3JCMh 4M7AD 3M53A 2OTLA 4PJOD 2MAMA 4BB7A 2EJ9A 3OYNA 1BKBA 4TVRA 3CCJA 3V7CA 5GAOm 4M78E 3OQ5A 4ELYC 4E7LA 4M78G 5A2QE 4NOYA 2C06A 3CC2T 4JJNK 3CD6A 5CQXA 2KSSA 4LD6A 4JRIA 5GAN3 5GAN8 4MDXA 2K3YA 3JB9D 4QQ6A 2LNVA 3FJPA 3TREA 1XOVA 5IAYA 2HD0A 2QQSA 5CVIA 4PJOA 1WNLA 5CCAA 3OYGA 1QW1A 2LC4A 3RKXA 1KQSA 3CBMA 3VUBA 1WJQA 1M1FA 4JDSA 4BE2A 2CS7A 2ZPHB 5GAOl 1NE8A 1VQ7T 2VGMA 4OF1A 3OSSC 3WVDB 2QQBA 3OMCA 2XDBA 1U8RA 1QP3A 1YIJT 3OYIA 4M7AE 2FHDA 3HRTA 3HP9A 4XTWA 4C8QD 1BIBA 5LJ5d 2OTJT 2M1HA 1TH7A 1G3SA 4XTYA 4ZGJB 2AHJB 2PUKB 5CKHA 2RK1A 3MHXA 1YITT 4XQ3A 1YI2A 1Q81C 1DJ7B 1QVPA 2DTIA 2LT1A 4IUQA 5GANe 1M90C 3GLXA 1D3BB 1I5LA 1B34B 1S72T 3M5AA 3CMAT 3HFOA 4C8QA 1YBYA 1X75C 2CYZB 4FM4B 4M77B 4M75A 4IUUA 3CCQA 4NL2A 4OP0A 3L2VA 1VQ4T 3P8BB 2QXFA 5A0LA 3PMIA 1VIEA 5CO7A 5HK0A 5A0GA 4Y91A 4M78F 4O5VA 5KCOA 3GNFB 2KY9A 4C8QE 4E7HA 4PL6A 1K73C 3CBOA 5CKFA 1IZ6A 2JTFA 2F69A 2Y4YA 1N27A 2DKGA 3RMSA 1MGQA 2LVMA 3OYLA 3GNGA 4RG2A 2ZCFB 3T9NA 5GMKi 4XU3A 4IURA 3VU3C 3OYBA 2K4YA 4C5GA 2WSCE 1G5VA 4M77C 2VC8A 3OA6A 4LD9K 2M0OA 2DAQA 3G4SA 4E7KA 2XIDA 3X25B 3CCMA 1P92A 3CCUT 3EFSA 2JOYA 4M7AB 1JJ2S 4PJOB 1YJ9A 4OB1B 3MEWA 2QQAA 4HCCA 3L2UA 3OBWA 3G6ET 4M7DC 2E6ZA 2K5FA 3DKMA 5CAIA 3I55T 3SWNA 4QQDA 3OYDA 2HQXA 2GF7A 5A0DA 2WACA 4LDUA 2P0PA 5FLXE 3TEEA 4KUIA 2F5TX 2RA2A 1VQ8A 4RCCA 2P4TA 3DLMA 1JB0E 3V7SA 1N6AA 4C5HA 2RD1A 1VQOT 3JCMg 2MI6A 4J6YA 4MZTA 4FT2A 3MP6A 3LLRA 5GAMh 1Q82U 4PJOC 1WJSA 3A8GB 5GAN7 4OGCA 3CC4T 4GLKA 2QA4T 3C94A 4QW2A 4RG8A 4C8QB 2ZPFB 3RERA 4JS5A 1M1KU 1MHNA 4ME7A 4DOWA 3ER0A 3HRUA 4EPCA 3GF5A 1XQHA 2WSEE 3QDRB 3OMGA 4LDYA 3CCVT 3ME9A 1RI0A 3E19A 1UGQB 2A3LA 5GANf 2O4XA 5DLOA 2K5LA 2DPPB 2K57A 2LCLA 2DEQA 4MMLA 1UB4A 3QXEB 3FDRA 3QYHB 3CEYA 5GAMe 2DVEA 2P0KA 4M78D 4P5NA 4JRQA 1RL2A 3PGGA 3VKIA 3CCLT 2VXFA 3OYCA 2HQEA 4Q5WA 4M75C 3P8DA 3CCST 1BYMA 3HKSA 4KT0E 5GMKj 3A8OB 1N8RC 2KDSA 3PIOA 3HRSA 5GMKm 1VQ7A 2KVQG 5M9OA 1M9SA 4XU0A 1YJWT 1H3ZA 3JCMd 1BIAA 1YIJA 2E12A 3MEVA 2G3RA 3EFRA 4J5YA 4NS5A 2OTJA 2EJGA 4M78A 3JRZA 1BI2A 3QJ6A 3A8MB 1YITA 2E65A 5LJ3j 5HKCA 2D6FA 3SWNB 5HK3A 3JCMP 2V8IA 3N5BB 5FU6B 5IT9E 3FEOA 4MMKA 1VQMT 3MP8A 5D6XA 1S72A 3CMAA 4C0DC 1G3TA 5GAOr 5GMKl 1AHJB 5J39A 3LWIA 1VQNT 4MDWA 3PT9A 3V8JA 5KCHA 1I4K1 2VXEA 4N0AA 1VQ4A 3CMET 2I2LA 4RCBA 1NZ9A 3WVEB 5CKDA 4M7AA 5GANh 2M16A 3CC7T 2QTXA 5EG2A 3CCEA 4C92E 4C92G 3NTIA 2XD0A 4M77G 1VQKT 3INZA 5FU6C 3QHSA 2FL7A 1KHCA 4OGEA 4BE1A 2LRQA 3SB2A 2DIGA 4PLLA 3OB9A 4L5GA 4PKCC 3JCMb 2R57A 4ELZC 1M4ZA 2EQMA 4ZGEB 5GMKe 2R5AA 3M4GA 4ZN3A 3OYFA 1UGPB 4C5IA 2O4XB 3RKWA 2ZGWA 4PNOA 4M7DG 2VYTA 1W2BA 1SSFA 4OB2B 1Y96B 3VV0A 3S3NA 1Q86U 2DXBA 2L89A 1OI1A 3JCMc 1KQSS 2CGHA 5LJ5j 3CCUA 1VQOA 3G71T 1VQ6T 1ZHIA 3URGA 3VYGA 5LJ3e 1QVGA 3G6EA 3CCRT 1WPYA 2E10A 3OSVA 4UC4A 3VJPA 1Q7YU 3TU4K 5FROA 3META 5I2MA 3QUIA 4R55A 2DIQA 3I55A 1KC8C 5GAMg 2RJCA 4XU2A 1KD1U 2QQRA 4BY6B 2LQ8A 2LDMA 3I56T 2E5QA 3HL8A 5GAMf 1YHQT 1W2BS 4M78B 1XTDA 2BUDA 5DY9A 2Y4XA 1VQLT 3CBPA 2X35A 2DO3A 3GOXA 1JBMA 2ZPEB 1X6OA 4XK8E 2DZ9A 4A53A 4BD3A 4C0ZA 4FSXA 2OTLT 3C95A 3CPWA 1K9MU 2E41A 1QVGS 1O75A 4OB3B 4L6V5 1U1SA 5CIUA 2FYKA 4II1A 3BW1A 4FIBA 4C92F 3LW5E 3M55A 2PVGB 5GAOp 1HXDA 1UGSB 3VYHB 2QA4A 3CC4A 4RMOA 3L2QA 4XTUA 4Z02A 4JRPA 2X4XA 2EAYA 4MZMA 2JZ2A 4C0GA 4ZTFA 1VQPT 4OB0B 3AHUA 2DXUA 4NL3A 1GXIE 1M1GA 4M78C 3CCVA 2DTHA 2NLUA 5CR2A 4PLIA 3UWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  4PJO E;  4M75 D;  4M7A G;  4PJO G;  4M7A D;  4X9C A;  3JCM h;  4PJO D;  2DJZ A;  5GAN f;  2K57 A;  1LJO A;  2DEQ A;  2EJ9 A;  3L2Z A;  3JB9 J;  4MML A;  4QVD A;  5GAM d;  3V7C A;  5GAO m;  5GAM e;  4M78 E;  2DVE A;  5LJ5 h;  4M78 G;  4NOY A;  1JRI A;  4M78 D;  5I21 A;  3PGG A;  3JB9 G;  2VXF A;  1M5Q 1;  4JRI A;  4N0A C;  4M75 C;  4F7U E;  5GAN 8;  5GAN 3;  2DZC A;  3FJP A;  4M77 F;  4C92 B;  4F7U G;  3JB9 D;  4M7A C;  3HFN A;  2EWN A;  4PJO A;  1LNX A;  1WNL A;  5GMK j;  3HSB A;  5GMK m;  3RKX A;  4XU0 A;  3L1A A;  5GAO n;  3JCM d;  1BIA A;  1WQ7 A;  4XTV A;  2HNI A;  1I8F A;  3EFR A;  4J5Y A;  5GAO l;  1H64 1;  2EJG A;  4M78 A;  4XU1 A;  4M75 E;  5GAN g;  2JN0 A;  4M7A E;  4C8Q G;  4M7D B;  2E65 A;  3V7R A;  4A54 A;  4XTW A;  2DTO A;  1BIB A;  4C8Q D;  5LJ3 j;  4XTY A;  1TH7 A;  3SWN B;  4F7U A;  5LJ5 e;  4JUV A;  3JCM P;  4JRK A;  4XQ3 A;  4MMK A;  3V8L A;  4J6X A;  3RKY A;  1M8V A;  4HT8 A;  1Y96 A;  4C92 C;  2DTI A;  5GAO r;  5LJ3 f;  5GMK l;  5GAN e;  1D3B B;  3QSU A;  1I5L A;  1B34 B;  3JB9 I;  2EJF A;  3V8J A;  1I4K 1;  2DXT A;  2VXE A;  4C8Q C;  4N0A A;  3HFO A;  4M75 F;  4M75 A;  4C8Q A;  4HT9 A;  2I2L A;  4M77 B;  4RCB A;  4M7A A;  4M7A F;  4PJO F;  4EMK B;  5GAM j;  5GAN h;  3GIB A;  2RB6 A;  2QTX A;  4NL2 A;  2YLB A;  4OP0 A;  4EMH A;  4C92 E;  5LJ5 d;  4JLI A;  3RES A;  4C92 G;  4M77 G;  2YLC A;  4C92 D;  3INZ A;  2Y90 A;  1I81 A;  3QHS A;  1KQ1 A;  4Y91 A;  4M78 F;  3SB2 A;  4C8Q E;  4QVC A;  3JCM b;  3JCM Q;  3JB9 F;  3JCM W;  4DQ2 A;  5GAN 5;  2DKG A;  4F7U F;  1HK9 A;  5GMK e;  5LJ3 g;  1MGQ A;  3M4G A;  1U1T A;  4WF2 A;  3RKW A;  2ZGW A;  5GMK i;  4PNO A;  4M7D G;  4XU3 A;  3VU3 C;  1KQ2 A;  4M7D D;  2E64 A;  1Y96 B;  4M77 C;  2VC8 A;  4C92 A;  4HA8 A;  5GAN d;  4EMK C;  3BDU A;  3JCM c;  5GMK h;  2CGH A;  5LJ5 j;  3JCM f;  1YCY A;  1LOJ A;  5LJ3 e;  4C8Q F;  2RM4 A;  3V8K A;  1WPY A;  2E10 A;  4M75 B;  3EFS A;  4M7A B;  4XTX A;  3QUI A;  4PJO B;  5LJ5 f;  5GAM g;  3RUX A;  4M77 E;  4M7D C;  4XU2 A;  5LJ3 h;  3SWN C;  4V2S A;  5CAI A;  3JB9 H;  4M77 D;  3SWN A;  5GAM f;  3JCM J;  4X9D A;  4M78 B;  5GAN 2;  5DY9 A;  2RA2 A;  4RCC A;  1JBM A;  4A53 A;  1WQW A;  2DZ9 A;  3QO3 A;  3V7S A;  1D3B A;  4EMG A;  4F7U B;  3JCM X;  4M7D E;  2E41 A;  1B34 A;  2RD1 A;  4J6W A;  2E1H A;  3JCM g;  5GAO q;  1U1S A;  2FYK A;  4J6Y A;  3BW1 A;  4C92 F;  5GAN 4;  4M77 A;  1HXD A;  2FB7 A;  1X01 A;  3BY7 A;  5GAM h;  4EMK A;  5GAO p;  1N9S A;  3BFM A;  4PJO C;  4XTU A;  1N9R A;  5LJ3 d;  5GAN 6;  5LJ5 g;  5GAN 7;  2EAY A;  3JCM V;  3AHU A;  3FB9 A;  2DXU A;  4XTZ A;  4C8Q B;  4NL3 A;  3RER A;  3FIF A;  4M7D F;  3JCM e;  4M78 C;  5GAN j;  2DTH A;  2YHT A;  3RIR A;  4M7D A; 
#chains in the Genus database with same CATH topology
 1VYV A;  3QJY A;  2EIF A;  3L2R A;  3FRN A;  5AT1 B;  4DOV A;  2RHI A;  2BZ8 A;  2MWP A;  2X51 A;  3VRY A;  2CSQ A;  2D8H A;  5LL6 S;  1BCM A;  2GTO A;  1UJY A;  2EGA A;  3CPF A;  1WA7 A;  3EH2 A;  4HKE A;  1JQQ A;  4M7A C;  4IUT A;  2QEX T;  4A4E A;  3CCQ T;  3KXT A;  1RAF B;  4JUV A;  3GP8 A;  2YUP A;  2R5M A;  4ANJ A;  4A4F A;  5IHI A;  1M8V A;  1VQN A;  1PC0 A;  1V76 A;  3QKJ A;  1TWB A;  1NEB A;  2M51 A;  2CUD A;  2O9S A;  1G3W A;  3MKD A;  3G4S T;  2KT8 A;  4QQG A;  4EMH A;  1TU0 B;  1JO8 A;  3RES A;  4FL6 A;  2Y90 A;  1I81 A;  3KFV A;  3KBG A;  2CT3 A;  4OML A;  2AZV A;  4CRI A;  4M7D D;  2JJ9 A;  2FG0 A;  1JXM A;  2KXC A;  3CD6 Q;  4VUB A;  2YUQ A;  5LJ5 f;  4PJL A;  3SDZ A;  2DIL A;  3VUZ A;  1VQL A;  3H9N A;  3JCM J;  3I35 A;  1QP2 A;  2EQU A;  5HY6 A;  3QO3 A;  4M7D E;  2EYW A;  2LCC A;  3EAE A;  4LDV A;  1G83 A;  1VQP A;  1UJ0 A;  1FMK A;  1IB8 A;  2D0Q B;  3EFO B;  1M1K C;  1UHF A;  3FB9 A;  3NFC A;  2QTV A;  3NGP A;  2YDL A;  2LNH B;  4E2F B;  3M57 A;  4BI4 A;  1F1B B;  2BE9 B;  2YRD A;  5KYX B;  1PD1 A;  1Q81 R;  1SF9 A;  3J7A F;  2RI3 A;  1KJW A;  3RMQ A;  2J6K A;  3CCJ T;  1NLO C;  3DB4 A;  4JZ3 A;  3JB9 G;  4M77 F;  1AEY A;  4DA4 A;  1ZQ1 A;  1GCQ A;  1IGQ A;  2O88 A;  2RO0 A;  5GAO n;  2OAW A;  2XU8 A;  3H8Z A;  4LN2 A;  4BE0 A;  4C8Q G;  1YJN A;  4E7Z A;  2X3X D;  2LX9 A;  4F7U A;  5C6S A;  1C6V X;  3MO8 A;  4RTV A;  4RTW A;  2EFI A;  2VUB A;  1VQ8 Q;  4E7I A;  1WXT A;  1X69 A;  4X34 A;  1WHJ A;  4PJO F;  4IUV A;  4J83 A;  2KEA A;  2CZ7 B;  3M0T A;  1VUB A;  4MZP A;  4JJC A;  4R56 A;  1EX4 A;  1R8O B;  1RAH B;  1XJW B;  4KRT A;  4HVV A;  4HVW A;  2PQW A;  1AD5 A;  3LGL A;  3QYG B;  2RN8 A;  4J7I A;  1Q7Y C;  2GQV A;  2DL4 A;  2NUP B;  4M75 B;  2QDY B;  3CCM T;  4BDZ A;  2RHZ A;  4HCZ A;  1KC8 U;  4M77 D;  1YIJ Q;  1MV3 A;  5IH2 A;  2X4W A;  2OTJ Q;  2O01 E;  1YIT Q;  1WQW A;  4FYW B;  1D3B A;  2A37 A;  1VQ9 A;  1CKA A;  2V8K A;  1WHK A;  4C0D B;  3BY7 A;  1Y71 A;  1UEC A;  4KUL A;  3X26 B;  2HQH A;  5I22 A;  4M7D F;  1ZSZ B;  4ZN1 A;  5GAN j;  2ECZ A;  5J3B A;  3RIR A;  1K8A C;  3QBY A;  4X9C A;  4PJO D;  3OYN A;  3V7C A;  1PRL C;  2KE9 A;  3VS7 A;  4E7L A;  2Z0W A;  3CC2 T;  4JJN K;  5CQX A;  2KSS A;  3REB B;  4LD6 A;  1RAI B;  1OX8 A;  9ATC B;  5CVI A;  3OYG A;  2DA9 A;  2DL8 A;  5KYU B;  3CBM A;  4JDS A;  1YNZ A;  2CS7 A;  2VGM A;  3OSS C;  2XDB A;  1PCX A;  3HP9 A;  5LJ5 d;  2HL5 C;  4XTY A;  3CXC P;  2AHJ B;  5CKH A;  2RK1 A;  1M30 A;  4FYY B;  5GAN e;  2C0T A;  2HDA A;  3CMA T;  3M5A A;  3HFO A;  4M75 A;  3CCQ A;  4FM4 B;  4F17 A;  1JXO A;  3EG1 A;  4NL2 A;  5KYW B;  4HXJ A;  4PK4 A;  5A0L A;  5HK0 A;  3H0F A;  1WHL A;  2F2W A;  4M78 F;  1K73 C;  3CBO A;  3LH5 A;  5CKF A;  2COY A;  2FPF A;  2F69 A;  1N27 A;  2DKG A;  1SPK A;  3OYL A;  1G5V A;  3VU3 C;  4C5G A;  4M77 C;  1WDX A;  2M0O A;  1MV0 B;  3G4S A;  4E7K A;  1NM7 A;  2XID A;  1T3L A;  1P92 A;  1M2V B;  1ZSZ A;  3CCU T;  1PHT A;  3EFS A;  3MEW A;  2QQA A;  2E6Z A;  2K5F A;  4AT1 B;  4RTX A;  1QWE A;  1X27 A;  2HQX A;  1QVF P;  2WAC A;  4RCC A;  1VQM Q;  1JB0 E;  4J9I A;  1JJ2 P;  1ABO A;  1TSF A;  1K9A A;  3LLR A;  4PJO C;  3A8G B;  3CC4 T;  1M3B A;  3C94 A;  4RG8 A;  3UAT A;  1M1K U;  2WSE E;  3OMG A;  1IHV A;  3ME9 A;  2E3H A;  1NYG A;  1UGQ B;  2LCL A;  2VVK A;  1PG5 B;  5GAM e;  1ZSG A;  2MYS A;  4M78 D;  3PGG A;  3VKI A;  2VXF A;  1UFF A;  2HQE A;  3PE0 A;  3G71 Q;  4D8D A;  1MMN A;  1RAG B;  4DBF A;  4XU0 A;  1BIA A;  2LMJ A;  2G3R A;  2NUT A;  1K9M R;  5LJ3 j;  5FU6 B;  3FEO A;  2EW3 A;  3MP8 A;  4F04 B;  1S72 A;  2CH4 W;  3PVQ A;  2JW4 A;  1VQN T;  2VXE A;  1VQ4 A;  4RCB A;  1NZ9 A;  3UF4 A;  5GAN h;  4J9H A;  1AWO A;  1CSK A;  1W6X A;  1KHC A;  4KGV B;  4BE1 A;  2HBW A;  3SB2 A;  2DIG A;  3M0R A;  4PLL A;  3JCM b;  4DBH A;  1I07 A;  4ELZ C;  2EQM A;  1UGP B;  1Q82 R;  3RKW A;  2ZGW A;  4M7D G;  1W2B A;  1OU9 A;  4OB2 B;  3VV0 A;  1Q86 U;  1UDL A;  1OI1 A;  3JCM c;  3URG A;  5LJ3 e;  2DF6 A;  4ESR A;  3G6E A;  2E10 A;  3VJP A;  2QEX Q;  1Q7Y U;  5GAM g;  2A08 A;  2QYZ A;  4J9C A;  2E5Q A;  1W2B S;  2CP7 A;  2BUD A;  2J7I A;  1VQL T;  2X35 A;  2DO3 A;  4E6R A;  3S3O A;  1VQO A;  2OTL T;  3CPW A;  1A0N B;  2GTJ A;  1U1S A;  4II1 A;  2HL3 A;  1HXD A;  3VYH B;  4PJN A;  4RMO A;  2GQI A;  1WI7 A;  4C0G A;  2EAY A;  4MZM A;  4ZTF A;  1VQP T;  1W70 A;  4M78 C;  3CCV A;  3CPW S;  1NLP C;  2JNG A;  3LWH A;  2L8D A;  1K8A U;  1UEB A;  2FRY A;  3CCL A;  2IG0 A;  3C0C A;  3QZ9 B;  3M54 A;  4N0A C;  4F7U E;  2W0Z A;  2DZC A;  1YJW A;  3A8L B;  3VS3 A;  3L1A A;  4ZGD B;  3OYY A;  2PVO B;  2FRW A;  5IXF A;  3V7R A;  4D6W A;  2L3Q A;  2ATC B;  2PVD B;  1E7O A;  5D6W A;  1YJN T;  4J6X A;  3RKY A;  3CC2 A;  2PU9 B;  3ASK A;  3ZEH A;  4XAX B;  3CME A;  2PZ1 A;  2DXT A;  4C8Q C;  3CC7 A;  4M75 F;  3OYA A;  4KUD K;  3GIB A;  4CC2 A;  1VQK A;  3M59 A;  4KGZ B;  4JLI A;  4N4H A;  5KH6 A;  2CH4 A;  1SSH A;  1K73 U;  3UA6 A;  2LQK A;  3QWX X;  1NBE B;  1KQ2 A;  2E64 A;  1J3T A;  4C92 A;  3CCJ Q;  1RI9 A;  1YCY A;  3I56 A;  2GFA A;  3CXC A;  2DBK A;  1YHQ A;  1VYT A;  1D1C A;  3C4S A;  1ZX6 A;  5LJ3 h;  3SWN C;  4V2S A;  2EKO A;  4O6J A;  1GFD A;  1RAC B;  2RF0 A;  3ULR B;  2RQT A;  3EHQ A;  5CK9 A;  3S6W A;  1D0X A;  3BE3 A;  1VQ9 T;  2FB7 A;  2AZS A;  4EMK A;  1N9S A;  3CXC S;  2ABL A;  1ZA1 B;  5DLQ E;  1E6H A;  3JCM e;  3U23 A;  1M3A A;  3HHT B;  2J6F A;  4M75 D;  4IIM A;  4PJO G;  2LJ1 A;  2DJZ A;  3PIP A;  2EGE A;  2QK0 A;  1LJO A;  4E7S A;  2EKH A;  4IKF A;  1KSW A;  3REA B;  4CC7 A;  5I21 A;  1AZG B;  1Y07 A;  4HCB A;  4L59 A;  1KC8 R;  1ZA2 B;  4FU6 A;  4LDX A;  4BY6 C;  1QVF A;  2LZ6 B;  3CCM Q;  1OPL A;  5KYN A;  1WQ7 A;  2RJE A;  1I8F A;  2RNA A;  4XU1 A;  4M75 E;  2BZX A;  1Y7X A;  1JJ2 A;  2WSF E;  4FYX B;  3V8L A;  2DYB A;  2JUF A;  5I2S A;  1IGU A;  1OOT A;  2YXY A;  1QVF S;  1FMV A;  4WTO B;  4ZTJ A;  3M56 A;  2JM8 A;  1KG1 A;  2B86 A;  2RHX A;  2EYY A;  5FU7 C;  3E1S A;  1RAD B;  5FRN A;  1Z9Z A;  4JS4 A;  5GJW B;  3JCM Q;  2K2V A;  4A4G A;  5GAN 5;  1D1A A;  4ORZ A;  3QG1 A;  3KUF A;  4CI0 C;  1PD0 A;  1LOJ A;  4J9D A;  2RM4 A;  3V8K A;  2QAZ A;  2KQW A;  3F70 A;  3LH0 A;  4E7J A;  5GJV B;  1G3Y A;  1TUC A;  4X9D A;  4B6M A;  4C0F A;  5J26 A;  2GFU A;  1B7T A;  2G6F X;  1V1C A;  4RKU E;  4EMG A;  4F7U B;  3C12 A;  2MF2 A;  2EVR A;  3MEA A;  5AYF A;  3CMA Q;  2O9V A;  4X1V A;  1BU1 A;  5GAN 6;  2D8J A;  5C0M A;  5KE3 A;  2EQI A;  2QI2 A;  1WZO A;  3CCE Q;  1M3C A;  2DET A;  2EQK A;  3TSW A;  1NJI C;  3JCM h;  3M53 A;  1QMC A;  3VS0 A;  2OTL A;  4FSS A;  2K6D A;  1OU8 A;  5GAO m;  4M78 G;  5A2Q E;  3TSZ A;  4JRI A;  5GAN 3;  4MDX A;  2KI7 A;  4QQ6 A;  2LNV A;  3FJP A;  3TRE A;  1XOV A;  2QQS A;  1WNL A;  2A36 A;  3CCU Q;  1QW1 A;  2A28 A;  2LC4 A;  3VUB A;  1WJQ A;  1RAE B;  4BE2 A;  4M4Z A;  5GAO l;  1K0X A;  1HSQ A;  1X6G A;  1Q95 G;  1BIB A;  1G3S A;  4ZGJ B;  2PUK B;  4J9G A;  4XQ3 A;  1YI2 A;  1Q81 C;  1DJ7 B;  2CP6 A;  2EBP A;  2LT1 A;  4IUQ A;  1M90 C;  2VWF A;  1D3B B;  2AT1 B;  1S72 T;  2ROL A;  5FWB A;  2NYS A;  1GFC A;  4C8Q A;  1H92 A;  3CC4 Q;  1WHG A;  1VQ4 T;  2JS2 A;  1OPK A;  2QXF A;  1C1A A;  4J9F A;  1T3S A;  2CSI A;  4Y91 A;  5KCO A;  2IPO B;  4E7H A;  1QCF A;  2M0Y A;  2KRN A;  3RMS A;  4XU3 A;  2YSQ A;  3OA6 A;  4LD9 K;  1ZBJ A;  4QKU A;  3EGD A;  1WYX A;  3X25 B;  5L23 A;  1ZLM A;  5KYY A;  4M7A B;  1QCN A;  1YJ9 A;  4HCC A;  3G6E T;  4M7D C;  3DKM A;  3SWN A;  4FW1 A;  2GF7 A;  2CDT A;  1MMD A;  2NWM A;  2P4T A;  3DLM A;  1VYU A;  3V7S A;  1N6A A;  2RD1 A;  1VQO T;  2MI6 A;  2DL5 A;  1VQN Q;  1AWJ A;  4JJB A;  1YCS B;  2F2V A;  3RER A;  3GF5 A;  3OW2 P;  3D7S B;  3CCV T;  1RI0 A;  1Q86 R;  2ROT A;  1I5O B;  1GCP A;  2O4X A;  1HJD A;  4MML A;  1YWP A;  1UB4 A;  3EGX A;  3QXE B;  3QYH B;  3ZL7 C;  3CEY A;  2P0K A;  1Q7Y R;  2DER A;  3CCL T;  4Q5W A;  2YUO A;  3CCS T;  1BYM A;  2DEU A;  4FYV B;  5GMK j;  1N8R C;  3HRS A;  1ZUY A;  1YJW T;  1VQ7 A;  1H3Z A;  1TXQ A;  3EFR A;  2EJG A;  2I0N A;  1M2O A;  2A0F B;  2YRC A;  3JCM P;  2V8I A;  3N5B B;  1VQL Q;  1QWF A;  2KRO A;  4MDW A;  5KCH A;  1I4K 1;  3CME T;  4M7A A;  1VQP Q;  3CC7 T;  4C92 E;  3NTI A;  1VQK T;  3INZ A;  5FU6 C;  3QHS A;  4FW2 A;  3OB9 A;  4L5G A;  2CT4 A;  3QDF A;  5GMK e;  1ACM B;  2CP3 A;  2VYT A;  1SSF A;  1Y96 B;  1YWO A;  2DXB A;  3I5S A;  5LJ5 j;  3RBB B;  3VYG A;  1QVG A;  2ZAE A;  1SG5 A;  1WPY A;  3RDV A;  3I55 A;  2RJC A;  4GBQ A;  2QQR A;  2LQ8 A;  3I56 T;  1YHQ T;  1KQS P;  2KXD A;  2NUT B;  4OMQ A;  1GRI A;  3GOX A;  2KT1 A;  1YJN Q;  1MMG A;  4BD3 A;  2DZ9 A;  1KIK A;  3C95 A;  1QVG S;  3BW1 A;  2PVG B;  1UGS B;  2QA4 A;  2P4R A;  4XTU A;  4Z02 A;  2KYM A;  2X4X A;  3AHU A;  4OB0 B;  2D1X A;  2X9H A;  4NL3 A;  4PLI A;  4M75 G;  3QII A;  2LCS A;  1IRE B;  4PFZ A;  3JSC A;  3JB9 J;  2DMO A;  1VA7 A;  1NJI U;  5GAM d;  2KR3 A;  2ZPG B;  2RQU A;  3WXM B;  1WGS A;  4OVA A;  1QKX A;  3UPU A;  3HSB A;  3EGU A;  3OS5 A;  5IXB A;  3QWY A;  1W1F A;  4OMF B;  4LXC A;  4QT7 A;  4B9X A;  5GAN g;  2JN0 A;  3PNW C;  4A54 A;  3E9F A;  1KHI A;  1PNJ A;  2L3R A;  1HD3 A;  4HT8 A;  1Y96 A;  3GBQ A;  3NHN A;  1NPP A;  2DRK A;  3M4Y A;  1Q81 U;  4J7F A;  3JB9 I;  1VQ9 Q;  2XIC A;  2OI3 A;  3EHR A;  1M90 U;  3J80 E;  1BBZ A;  4EDU A;  1KD1 R;  4HT9 A;  3OS0 A;  2X4Y A;  2DLP A;  1TG0 A;  4J9B A;  2RB6 A;  2HSP A;  2SRC A;  3SD4 A;  1WHH A;  3R6O A;  2BIV A;  1UUE A;  2YLC A;  4BI3 A;  1PKS A;  3RNJ A;  2M9U A;  3J81 E;  1B3Q A;  5L8R E;  3L42 A;  4DQ2 A;  3JCM W;  1K9M C;  2CP0 A;  1RUW A;  1AWX A;  4RTY A;  4F7U F;  4BDY A;  1OX9 A;  3E9G A;  3GPL A;  1EFN A;  1VQ8 T;  1X43 A;  2DVJ A;  1VQ6 A;  1IXD A;  5GMK h;  3CCR A;  3MCA B;  2HAX A;  2KK4 A;  4F16 A;  2RQW A;  3BDL A;  2DL3 A;  2PTK A;  2RI5 A;  4RTU A;  1LVK A;  2ZPI B;  2F2X A;  2HBP A;  3JB9 H;  1BI0 A;  1AT1 B;  2B8A A;  2L3P A;  2L3S A;  4J6W A;  2LX7 A;  1Q82 C;  1OUL A;  2GNC A;  2K9G A;  1EIF A;  5GAN 4;  1MUZ A;  2YUN A;  3BFM A;  1N9R A;  2MPX C;  4GY5 A;  4Y28 E;  3FIF A;  3CCQ Q;  2GGR A;  2YHT A;  1CKB A;  1QQJ A;  2JMC A;  2KRM A;  1QLY A;  3FC3 A;  1WFW A;  5LJ5 h;  4BUG A;  2JMA A;  2DRM A;  1M5Q 1;  4C92 B;  1VQ5 A;  2EWN A;  3G4S Q;  4AFZ C;  2CZ0 B;  3ZFJ A;  4Z8A A;  1N8R U;  4XTV A;  2HNI A;  5KE2 A;  1H64 1;  1PRM C;  3G7Z A;  2H3J A;  5CKB A;  1D0Y A;  1QKW A;  4JRK A;  3TVT A;  2NUZ A;  3UDC A;  2C0I A;  1KK7 A;  5I11 A;  3CCS A;  2HZY A;  1YI2 T;  2EJF A;  3VS6 A;  3OW2 A;  4M7A F;  1OZ2 A;  4EMK B;  2RJF A;  2XDD A;  3X24 B;  1KQ1 A;  3VS2 A;  3OY9 A;  4QVC A;  4N4G A;  3A5Z B;  1SEM A;  2AIR B;  5LJ3 g;  4WF2 A;  3A8H B;  3OW2 S;  2IVW A;  3OYH A;  2GBQ A;  1WHM A;  3M9Q A;  1SHG A;  1XNI A;  1O9S A;  2XG8 D;  1BB9 A;  4BAC A;  2RJD A;  2K7A A;  3MEU A;  4XTX A;  2DK3 A;  5IHN A;  1YP5 A;  1OZ3 A;  5FRM A;  3NPF A;  2KMT A;  1YJ9 T;  1PSE A;  4CC4 B;  1TTH B;  2QQ9 A;  2D0N A;  4A4K A;  2V8J A;  3JCM X;  3DB3 A;  1B07 A;  4JLG A;  1B34 A;  1TS9 A;  5GAO q;  2VKN A;  3OYM A;  5CKE A;  4AFQ C;  1S72 Q;  1GCQ C;  4M77 A;  1X01 A;  1U06 A;  3P8H A;  2D9T A;  3PTA A;  2FO0 A;  4J8O A;  4LNP A;  5IN1 A;  2XDP A;  3PFS A;  5D6Y A;  2RQV A;  4M7A D;  4Z89 A;  4BB7 A;  2EJ9 A;  4TVR A;  1N5Z A;  1WXB A;  1K4U S;  3OQ5 A;  4ELY C;  2X3W D;  4NOY A;  3H0H A;  3EG9 A;  4WCI A;  3CD6 A;  1RAA B;  2DM1 A;  2K3Y A;  1OV3 A;  4LUD A;  4PJO A;  5CCA A;  1KQS A;  3G6E Q;  1ARK A;  1K1Z A;  2C0O A;  2ZPH B;  1VQ7 T;  4OF1 A;  4DEX A;  2QQB A;  3OMC A;  2AK5 A;  1U8R A;  1QP3 A;  4M7A E;  2FHD A;  4CC3 A;  4XTW A;  2M1H A;  1TH7 A;  3MHX A;  2KNB B;  2FZC B;  1QVP A;  1VQO Q;  4PFO A;  1WIE A;  3GLX A;  1I5L A;  2E5K A;  2JS0 A;  4IUU A;  1E6G A;  3L2V A;  2CP2 A;  3P8B B;  3M0Q A;  3PMI A;  1VIE A;  5A0G A;  2MCN A;  3CCV Q;  4PL6 A;  2JTF A;  2F1L A;  4PJJ A;  1MGQ A;  2LVM A;  4EIK A;  3E2U A;  3CCL Q;  1UGV A;  2DAQ A;  2BE7 D;  1YJW Q;  2JOY A;  1JJ2 S;  1VOM A;  4OB1 B;  1NG2 A;  6AT1 B;  1IRX A;  2EPD A;  5CAI A;  3I55 T;  4QQD A;  3OYD A;  5D7U A;  1UHC A;  4HVU A;  1VQ8 A;  3EG0 A;  3JCM g;  1T0H A;  4J6Y A;  3TQ7 P;  4FT2 A;  3CC2 Q;  3MP6 A;  3H0I A;  1Q82 U;  1X2K A;  3CME Q;  4OGC A;  2QA4 T;  3CC7 Q;  2CRE A;  4QW2 A;  4C8Q B;  1ZUU A;  2AKL A;  4JS5 A;  1MHN A;  4ME7 A;  2HSE B;  4DOW A;  1UE9 A;  1M27 C;  2EYX A;  3ER0 A;  3HRU A;  3VS4 A;  1XQH A;  4EPC A;  1VQK Q;  3QDR B;  1TUG B;  2CP5 A;  1RLQ C;  2O31 A;  5GAN f;  1Y0M A;  2K5L A;  2DEQ A;  2KBT A;  4JRQ A;  4M75 C;  4KT0 E;  2KDS A;  3PIO A;  3EGD B;  5GMK m;  5M9O A;  1SHF A;  5KYY B;  1YIJ A;  3MEV A;  4NS5 A;  2OTJ A;  4M78 A;  3JRZ A;  2RPN A;  3I56 Q;  4AFU C;  3A8M B;  1YIT A;  1YHQ Q;  2E65 A;  2H3E B;  5HKC A;  2D6F A;  3SWN B;  5HK3 A;  2KYB A;  4PFP A;  1Y57 A;  2E4H A;  2LQN A;  4MMK A;  5D6X A;  4C0D C;  1G3T A;  1G2B A;  5GMK l;  1U5S A;  3JV3 A;  1AHJ B;  5J39 A;  3LWI A;  3H41 A;  1AZE A;  8ATC B;  2QGF B;  3PT9 A;  1ZSZ C;  4N0A A;  5CKD A;  3WVE B;  2QTX A;  3IQL A;  2HEQ A;  3A1P A;  1NJI R;  2J6O A;  2FL7 A;  5FWC A;  2LRQ A;  1YFN A;  2R57 A;  2AKK A;  4F14 A;  2DFU A;  3R6N A;  4ZGE B;  3M4G A;  3OYF A;  2MK5 A;  2O4X B;  1PKT A;  4PNO A;  1AOJ A;  5EC7 A;  3EGX B;  2L89 A;  4IIO A;  1M1K R;  2CGH A;  1VQ6 T;  1ZHI A;  2DBM A;  3CCR T;  4UC4 A;  3TU4 K;  4R55 A;  2DIQ A;  3VS1 A;  1M8M A;  4XU2 A;  4BY6 B;  4DBQ A;  2LDM A;  5GAM f;  5DY9 A;  2Y4X A;  2DE0 X;  1M90 R;  1YN8 A;  1JBM A;  4A53 A;  4FSX A;  2E41 A;  1X2Q A;  1O75 A;  4OB3 B;  4L6V 5;  2FYK A;  4C92 F;  3M55 A;  1W2B P;  3L2Q A;  2DL7 A;  4JRP A;  2KRS A;  3NMZ C;  1ABQ A;  2DXU A;  2QGG A;  2K79 A;  1GXI E;  1M1G A;  2NLU A;  5CR2 A;  5FU7 B;  2VV5 A;  2COZ A;  2L2P A;  4KBM B;  1QCO A;  2M02 A;  2ZZD A;  4N4I A;  3L2Z A;  2K3B A;  4QVD A;  4YTL A;  1I0C A;  2XK0 A;  2FPE A;  2XI9 A;  1UGR B;  3I9Q A;  1JRI A;  7AT1 B;  4F7U G;  3CPW P;  4A63 B;  2EGC A;  4JZ4 A;  4FT4 A;  1VQ5 T;  5CQY A;  1LCK A;  1EZZ B;  2J06 A;  3LX7 A;  2OX7 A;  2RH2 A;  1VQM A;  2YRV A;  1ZUK A;  2RHY A;  3X20 B;  2CZ1 B;  1Q86 C;  2J05 A;  2BZY A;  2E3I A;  5LJ3 f;  2DX1 A;  2RI2 A;  3QSU A;  3LGF A;  1PWT A;  4AMC A;  3EFO A;  2JXB A;  2CZ6 B;  3L2W A;  3SEM A;  2K3X A;  2RHU A;  1R0B G;  1FX7 A;  2YLB A;  2ENM A;  3OYE A;  4C92 D;  5KYX A;  1NPR A;  1K0S A;  2LQW A;  3S3M A;  1HYO A;  2MMP A;  1U1T A;  3PMT A;  2OTL Q;  1VIF A;  2FZK B;  1FWZ A;  2CUB A;  3G71 A;  5GAN d;  3SHW A;  1N8R R;  3BDU A;  3HPW A;  1NYF A;  2VGN A;  2FVU A;  1H3H A;  1IHW A;  2A7Y A;  1W4S A;  4OMN A;  1K8A R;  1FXX A;  4M77 E;  1G8X A;  2DJQ A;  2MWO A;  2P0Q A;  2DYI A;  1D1B A;  2QDL A;  1MMA A;  2GCX A;  4ATO A;  3G1J A;  1BI1 A;  2KGT A;  1R0C B;  2ED1 A;  1BI3 A;  1IO6 A;  2E1H A;  4Z88 A;  1H8K A;  1YI2 Q;  3OYK A;  1SKU B;  4XTZ A;  4A4H A;  2XHC A;  3M58 A;  3SFM A;  2E70 A;  2MOX A;  2JTM A;  2XMF A;  3CQT A;  2JVV A;  4PJO E;  2DD5 A;  3H6Z A;  4M7A G;  2JT4 A;  4C5E A;  3UT1 A;  2DD4 A;  3Q1J A;  1ZBX A;  1PSF A;  2NUP A;  2QEX A;  4B9W A;  4BI8 B;  3QPH A;  2BKD N;  3HFN A;  3CD6 T;  1LNX A;  4LDW A;  2QAS A;  3ZBD A;  3CCE T;  2ZPB B;  3I5R A;  3M0S A;  1K73 R;  3HTR A;  1YJ9 Q;  4E47 A;  2V1Q A;  4M7D B;  2DTO A;  5LJ5 e;  3MP1 A;  1WJR A;  5HCK A;  3QZ5 B;  1RAB B;  2OAU A;  3X28 B;  1I1J A;  1LPL A;  4C92 C;  4DBR A;  2ED0 A;  2XKO C;  2DXC A;  2YWW A;  2L0A A;  2LTO A;  4IUP A;  5GAM j;  2LT4 A;  2VB6 A;  1C0M A;  3OYJ A;  1U3O A;  3OS2 A;  2RMO A;  2PUO B;  3JB9 F;  2P84 A;  3EG3 A;  3NTH A;  1HK9 A;  2EYQ A;  3FLG A;  1UTI A;  2LJ3 A;  1OYX A;  4HA8 A;  4EMK C;  3JCM f;  1OEB A;  3EG2 A;  2EQJ A;  5KYU A;  3OBY A;  4C8Q F;  4OMO A;  2KAF A;  1KD1 C;  3LYI A;  1SRL A;  3RUX A;  1X6B A;  1GBR A;  1VQ7 Q;  3VRZ A;  2R58 A;  1TUD A;  2O2O A;  3NTK A;  1PM3 A;  5GAN 2;  5DM7 R;  1V29 B;  2K5I A;  3OS1 A;  2L5Q A;  1AVZ C;  3JAM E;  3O8V A;  2PNI A;  2RQR A;  2FZG B;  4FCY A;  2RK2 A;  3DLL A;  2E6N A;  3M0U A;  2F5K A;  4RUG A;  2HMA A;  5KYW A;  1OQK A;  3FJ5 A;  5LJ3 d;  3TCJ A;  5LJ5 g;  2CKK A;  2X4J A;  3JCM V;  4GLM A;  4M7D A;  1D09 B;  4QVZ A;  1BCO A;  2MAM A;  1BKB A;  3CCJ A;  1NEG A;  4M78 E;  2LP5 A;  2C06 A;  5GAN 8;  3JB9 D;  1M2V A;  5IAY A;  2COW A;  2HD0 A;  1GL5 A;  2LJ0 A;  1S1N A;  3RKX A;  1M1F A;  2DNU A;  2VAS A;  1BK2 A;  1KFZ A;  1NE8 A;  3I55 Q;  3WVD B;  3MJX A;  2EYZ A;  1YIJ T;  3OYI A;  3HRT A;  4C8Q D;  2OTJ T;  1MNE A;  2QG9 B;  1YIT T;  3PVL A;  5FW9 A;  5ECA A;  3MPU B;  2DTI A;  3THK A;  1B34 B;  1SRM A;  1YBY A;  1X75 C;  2CYZ B;  1T0J A;  4M77 B;  1GBQ A;  2QA4 Q;  4KH0 B;  4OP0 A;  4Y92 A;  5CO7 A;  1D0Z A;  4O5V A;  3GNF B;  2KY9 A;  4C8Q E;  1IZ6 A;  1R77 A;  2Y4Y A;  2V26 A;  3GNG A;  4RG2 A;  2ZCF B;  3T9N A;  5GMK i;  3OYB A;  4IUR A;  2K4Y A;  2WSC E;  2VC8 A;  4OMM A;  4AG1 C;  3EG9 B;  4OMP A;  3CCM A;  3UA7 A;  5IHK A;  2V1R A;  4PJO B;  3L2U A;  3OBW A;  2ESW A;  4LE9 A;  5A0D A;  4LDU A;  2P0P A;  5FLX E;  3TEE A;  4KUI A;  2F5T X;  3A98 A;  2RA2 A;  4AFS C;  2YT6 A;  4C5H A;  4MZT A;  4J9E A;  5GAM h;  4HCK A;  1WJS A;  2MIO A;  1WLP B;  2JTE A;  5GAN 7;  4GLK A;  1FYN A;  2HKN A;  2ZPF B;  1FMW A;  4D8K A;  4LDY A;  3E19 A;  2A3L A;  1UG1 A;  2HCK A;  5DLO A;  2DPP B;  2K57 A;  3FDR A;  2DVE A;  2FPD A;  2SEM A;  3O5Z A;  4P5N A;  1RL2 A;  4RTT A;  3OYC A;  3P8D A;  3HKS A;  4K11 A;  1VQ6 Q;  3A8O B;  3CCR Q;  3VS5 A;  2KVQ G;  1M9S A;  2OJ2 A;  3JCM d;  1VQ4 Q;  1Z9Q A;  2E12 A;  4J5Y A;  3QJ6 A;  1BI2 A;  5IT9 E;  1VQM T;  4JJD A;  3CMA A;  4LUE A;  5GAO r;  1JEG A;  1RLP C;  4JPB W;  4R0K A;  3V8J A;  1K76 A;  2I2L A;  2M16 A;  1AWW A;  5EG2 A;  3CCE A;  4ZNX A;  4C92 G;  2XD0 A;  4M77 G;  4OGE A;  4PKC C;  2FEI A;  1M4Z A;  4DEY A;  2R5A A;  4ZN3 A;  4AG2 C;  4C5I A;  3S3N A;  4PJM A;  1KQS S;  3CCU A;  3G71 T;  3OSV A;  5FRO A;  3MET A;  4KGX B;  3QUI A;  5I2M A;  1KC8 C;  1VQ5 Q;  4KH1 B;  1KD1 U;  3AT1 B;  1MND A;  2K2M A;  3HL8 A;  4RTZ A;  4M78 B;  1XTD A;  1WX6 A;  2BTT A;  3CBP A;  2ZPE B;  1X6O A;  4XK8 E;  2IIM A;  4C0Z A;  1K9M U;  8AT1 B;  2W10 A;  5CIU A;  4FIB A;  3EH1 A;  3LW5 E;  3CC4 A;  5GAO p;  3CCS Q;  2H8H A;  2JZ2 A;  2HKQ B;  1WXU A;  2JM9 A;  1JU5 C;  1TOV A;  2DTH A;  3RR6 A;  3M0P A;  1QVG P;  3UWN A; 
#chains in the Genus database with same CATH homology
 4M75 G;  5FU7 B;  2VV5 A;  3CPW S;  2JNG A;  3QJY A;  3QII A;  4KBM B;  3LWH A;  2L8D A;  1K8A U;  2EIF A;  1UEB A;  1IRE B;  2ZZD A;  3FRN A;  4N4I A;  3JSC A;  4DOV A;  3L2Z A;  3L2R A;  3JB9 J;  4QVD A;  1NJI U;  2RHI A;  5GAM d;  2MWP A;  3CCL A;  2ZPG B;  2XK0 A;  4YTL A;  2XI9 A;  5LL6 S;  1UGR B;  2IG0 A;  3WXM B;  1JRI A;  1WGS A;  3CPF A;  3QZ9 B;  4HKE A;  4OVA A;  3M54 A;  4N0A C;  4F7U E;  3UPU A;  3S3O A;  2DZC A;  4F7U G;  4M7A C;  1YJW A;  3A8L B;  4IUT A;  3HSB A;  2QEX T;  4A4E A;  3CCQ T;  3OS5 A;  3L1A A;  4FT4 A;  1VQ5 T;  4ZGD B;  4OMF B;  3OYY A;  3KXT A;  5CQY A;  2PVO B;  4B9X A;  5GAN g;  3LX7 A;  2JN0 A;  2RH2 A;  3PNW C;  3V7R A;  2YRV A;  2RHY A;  4A54 A;  4D6W A;  1VQM A;  3E9F A;  3X20 B;  2CZ1 B;  2PVD B;  4JUV A;  3GP8 A;  5D6W A;  2R5M A;  1YJN T;  1KHI A;  2L3R A;  1Q86 C;  4J6X A;  3RKY A;  4A4F A;  3CC2 A;  1M8V A;  4HT8 A;  1Y96 A;  1VQN A;  2PU9 B;  3ASK A;  3ZEH A;  5LJ3 f;  1NPP A;  4XAX B;  2RI2 A;  3QSU A;  3M4Y A;  1Q81 U;  3LGF A;  3QKJ A;  4J7F A;  3CME A;  3JB9 I;  2XIC A;  1M90 U;  2DXT A;  4C8Q C;  3J80 E;  3CC7 A;  2CZ6 B;  4EDU A;  4M75 F;  3L2W A;  4HT9 A;  1G3W A;  3OS0 A;  3OYA A;  4KUD K;  3G4S T;  2X4Y A;  2K3X A;  2RHU A;  3GIB A;  3SD4 A;  1VQK A;  1FX7 A;  2RB6 A;  3M59 A;  2YLB A;  4QQG A;  4EMH A;  3R6O A;  4JLI A;  2BIV A;  3RES A;  3OYE A;  2YLC A;  4FL6 A;  4N4H A;  2Y90 A;  1I81 A;  4BI3 A;  4C92 D;  2M9U A;  5KH6 A;  3J81 E;  1NPR A;  3KBG A;  5L8R E;  3L42 A;  4DQ2 A;  3JCM W;  1K9M C;  3S3M A;  4F7U F;  2MMP A;  1K73 U;  4BDY A;  1U1T A;  2LQK A;  3E9G A;  3PMT A;  3GPL A;  1VIF A;  1VQ8 T;  1FWZ A;  4CRI A;  1KQ2 A;  3G71 A;  2E64 A;  5GAN d;  1VQ6 A;  4C92 A;  4M7D D;  3BDU A;  3HPW A;  5GMK h;  3CCR A;  1YCY A;  3MCA B;  2VGN A;  2HAX A;  2KK4 A;  2FVU A;  3BDL A;  4VUB A;  2A7Y A;  1W4S A;  5LJ5 f;  3I56 A;  2GFA A;  2RI5 A;  1FXX A;  4M77 E;  3CXC A;  1YHQ A;  3C4S A;  2ZPI B;  2HBP A;  5LJ3 h;  3SWN C;  4V2S A;  2MWO A;  3SDZ A;  3VUZ A;  3JB9 H;  2P0Q A;  1VQL A;  1BI0 A;  2EKO A;  3JCM J;  4O6J A;  2GCX A;  1QP2 A;  4ATO A;  2EQU A;  1BI1 A;  5HY6 A;  2B8A A;  3QO3 A;  5CK9 A;  3S6W A;  4M7D E;  4J6W A;  1BI3 A;  2E1H A;  1Q82 C;  2LCC A;  1EIF A;  3EAE A;  4LDV A;  2FB7 A;  5GAN 4;  1VQ9 T;  1VQP A;  4EMK A;  3CXC S;  1N9S A;  3BFM A;  3OYK A;  1N9R A;  2D0Q B;  1M1K C;  4GY5 A;  4Y28 E;  3FB9 A;  5DLQ E;  4XTZ A;  3FIF A;  2XHC A;  3NFC A;  4A4H A;  3M58 A;  3JCM e;  2YHT A;  3SFM A;  2E70 A;  2JTM A;  3HHT B;  2JVV A;  4PJO E;  3M57 A;  2DD5 A;  3H6Z A;  4M75 D;  4BI4 A;  4M7A G;  4PJO G;  4C5E A;  2DJZ A;  3PIP A;  1LJO A;  3FC3 A;  3UT1 A;  5LJ5 h;  3J7A F;  2RI3 A;  3RMQ A;  4BUG A;  4IKF A;  3CCJ T;  5I21 A;  2DD4 A;  3DB4 A;  3Q1J A;  3JB9 G;  1Y07 A;  1M5Q 1;  1ZBX A;  4HCB A;  1PSF A;  4M77 F;  2QEX A;  4B9W A;  4L59 A;  4BI8 B;  3QPH A;  1ZQ1 A;  2BKD N;  3HFN A;  4C92 B;  4DA4 A;  3CD6 T;  1VQ5 A;  2EWN A;  1LNX A;  4FU6 A;  4LDW A;  4LDX A;  4BY6 C;  3ZBD A;  1QVF A;  2CZ0 B;  2RO0 A;  3ZFJ A;  5GAO n;  1WQ7 A;  4XTV A;  1N8R U;  3CCE T;  2RJE A;  2HNI A;  1I8F A;  2XU8 A;  2ZPB B;  3H8Z A;  5KE2 A;  1H64 1;  4XU1 A;  4M75 E;  4E47 A;  4BE0 A;  3G7Z A;  1Y7X A;  2H3J A;  5CKB A;  4C8Q G;  1YJN A;  1JJ2 A;  4M7D B;  2DTO A;  2LX9 A;  4F7U A;  5LJ5 e;  3MP1 A;  1WJR A;  3QZ5 B;  4JRK A;  2WSF E;  3V8L A;  2OAU A;  5C6S A;  2JUF A;  5I2S A;  3X28 B;  3MO8 A;  4C92 C;  3UDC A;  2EFI A;  2VUB A;  4E7I A;  3CCS A;  2XKO C;  1QVF S;  1YI2 T;  2DXC A;  2EJF A;  4X34 A;  2LTO A;  4ZTJ A;  3OW2 A;  3M56 A;  4M7A F;  4IUP A;  4PJO F;  1OZ2 A;  4EMK B;  5GAM j;  2LT4 A;  2RJF A;  4IUV A;  2XDD A;  1KG1 A;  4J83 A;  2CZ7 B;  2RHX A;  3X24 B;  5FU7 C;  1VUB A;  4MZP A;  4R56 A;  3OYJ A;  3E1S A;  1KQ1 A;  3OY9 A;  5FRN A;  1R8O B;  3OS2 A;  4JS4 A;  4QVC A;  3JCM Q;  2K2V A;  2PUO B;  4N4G A;  3JB9 F;  3A5Z B;  4A4G A;  5GAN 5;  3NTH A;  1HK9 A;  2EYQ A;  2PQW A;  3FLG A;  5LJ3 g;  3LGL A;  3QG1 A;  4WF2 A;  3A8H B;  3OW2 S;  2IVW A;  3QYG B;  3OYH A;  3KUF A;  1OYX A;  3M9Q A;  4CI0 C;  4HA8 A;  4EMK C;  1XNI A;  4J7I A;  3JCM f;  1LOJ A;  1O9S A;  2GQV A;  1Q7Y C;  2EQJ A;  3OBY A;  2XG8 D;  4C8Q F;  2RM4 A;  3V8K A;  4M75 B;  2RJD A;  4BAC A;  2KQW A;  2KAF A;  3MEU A;  4XTX A;  2QDY B;  1KD1 C;  3F70 A;  3CCM T;  3LYI A;  3LH0 A;  4BDZ A;  2RHZ A;  2DK3 A;  4HCZ A;  4E7J A;  3RUX A;  1G3Y A;  1KC8 U;  1OZ3 A;  2R58 A;  5FRM A;  2KMT A;  1YJ9 T;  4M77 D;  3NTK A;  2X4W A;  4X9D A;  4C0F A;  1PSE A;  5GAN 2;  5DM7 R;  1V29 B;  2O01 E;  2QQ9 A;  2K5I A;  5J26 A;  2L5Q A;  3OS1 A;  2GFU A;  4A4K A;  3JAM E;  2V8J A;  3O8V A;  4RKU E;  1WQW A;  4EMG A;  3C12 A;  3DB3 A;  1D3B A;  4F7U B;  3JCM X;  4JLG A;  1B34 A;  1VQ9 A;  2RK2 A;  2MF2 A;  5GAO q;  3MEA A;  3OYM A;  3DLL A;  2E6N A;  5CKE A;  5AYF A;  2V8K A;  4M77 A;  4C0D B;  1X01 A;  2F5K A;  3BY7 A;  1Y71 A;  3P8H A;  2D9T A;  3PTA A;  5LJ3 d;  3TCJ A;  5GAN 6;  2CKK A;  2X4J A;  5LJ5 g;  4KUL A;  3JCM V;  3X26 B;  5C0M A;  5KE3 A;  4J8O A;  4M7D F;  2QI2 A;  4ZN1 A;  5GAN j;  5J3B A;  5IN1 A;  3RIR A;  2XDP A;  3PFS A;  4M7D A;  5D6Y A;  2EQK A;  1K8A C;  4QVZ A;  3QBY A;  1NJI C;  4X9C A;  3JCM h;  4M7A D;  3M53 A;  2OTL A;  4PJO D;  2MAM A;  4BB7 A;  2EJ9 A;  3OYN A;  1BKB A;  4TVR A;  3CCJ A;  3V7C A;  5GAO m;  4M78 E;  3OQ5 A;  4ELY C;  4E7L A;  4M78 G;  5A2Q E;  4NOY A;  2C06 A;  3CC2 T;  4JJN K;  3CD6 A;  5CQX A;  2KSS A;  4LD6 A;  4JRI A;  5GAN 3;  5GAN 8;  4MDX A;  2K3Y A;  3JB9 D;  4QQ6 A;  2LNV A;  3FJP A;  3TRE A;  1XOV A;  5IAY A;  2HD0 A;  2QQS A;  5CVI A;  4PJO A;  1WNL A;  5CCA A;  3OYG A;  1QW1 A;  2LC4 A;  3RKX A;  1KQS A;  3CBM A;  3VUB A;  1WJQ A;  1M1F A;  4JDS A;  4BE2 A;  2CS7 A;  2ZPH B;  5GAO l;  1NE8 A;  1VQ7 T;  2VGM A;  4OF1 A;  3OSS C;  3WVD B;  2QQB A;  3OMC A;  2XDB A;  1U8R A;  1QP3 A;  1YIJ T;  3OYI A;  4M7A E;  2FHD A;  3HRT A;  3HP9 A;  4XTW A;  4C8Q D;  1BIB A;  5LJ5 d;  2OTJ T;  2M1H A;  1TH7 A;  1G3S A;  4XTY A;  4ZGJ B;  2AHJ B;  2PUK B;  5CKH A;  2RK1 A;  3MHX A;  1YIT T;  4XQ3 A;  1YI2 A;  1Q81 C;  1DJ7 B;  1QVP A;  2DTI A;  2LT1 A;  4IUQ A;  5GAN e;  1M90 C;  3GLX A;  1D3B B;  1I5L A;  1B34 B;  1S72 T;  3M5A A;  3CMA T;  3HFO A;  4C8Q A;  1YBY A;  1X75 C;  2CYZ B;  4FM4 B;  4M77 B;  4M75 A;  4IUU A;  3CCQ A;  4NL2 A;  4OP0 A;  3L2V A;  1VQ4 T;  3P8B B;  2QXF A;  5A0L A;  3PMI A;  1VIE A;  5CO7 A;  5HK0 A;  5A0G A;  4Y91 A;  4M78 F;  4O5V A;  5KCO A;  3GNF B;  2KY9 A;  4C8Q E;  4E7H A;  4PL6 A;  1K73 C;  3CBO A;  5CKF A;  1IZ6 A;  2JTF A;  2F69 A;  2Y4Y A;  1N27 A;  2DKG A;  3RMS A;  1MGQ A;  2LVM A;  3OYL A;  3GNG A;  4RG2 A;  2ZCF B;  3T9N A;  5GMK i;  4XU3 A;  4IUR A;  3VU3 C;  3OYB A;  2K4Y A;  4C5G A;  2WSC E;  1G5V A;  4M77 C;  2VC8 A;  3OA6 A;  4LD9 K;  2M0O A;  2DAQ A;  3G4S A;  4E7K A;  2XID A;  3X25 B;  3CCM A;  1P92 A;  3CCU T;  3EFS A;  2JOY A;  4M7A B;  1JJ2 S;  4PJO B;  1YJ9 A;  4OB1 B;  3MEW A;  2QQA A;  4HCC A;  3L2U A;  3OBW A;  3G6E T;  4M7D C;  2E6Z A;  2K5F A;  3DKM A;  5CAI A;  3I55 T;  3SWN A;  4QQD A;  3OYD A;  2HQX A;  2GF7 A;  5A0D A;  2WAC A;  4LDU A;  2P0P A;  5FLX E;  3TEE A;  4KUI A;  2F5T X;  2RA2 A;  1VQ8 A;  4RCC A;  2P4T A;  3DLM A;  1JB0 E;  3V7S A;  1N6A A;  4C5H A;  2RD1 A;  1VQO T;  3JCM g;  2MI6 A;  4J6Y A;  4MZT A;  4FT2 A;  3MP6 A;  3LLR A;  5GAM h;  1Q82 U;  4PJO C;  1WJS A;  3A8G B;  5GAN 7;  4OGC A;  3CC4 T;  4GLK A;  2QA4 T;  3C94 A;  4QW2 A;  4RG8 A;  4C8Q B;  2ZPF B;  3RER A;  4JS5 A;  1M1K U;  1MHN A;  4ME7 A;  4DOW A;  3ER0 A;  3HRU A;  4EPC A;  3GF5 A;  1XQH A;  2WSE E;  3QDR B;  3OMG A;  4LDY A;  3CCV T;  3ME9 A;  1RI0 A;  3E19 A;  1UGQ B;  2A3L A;  5GAN f;  2O4X A;  5DLO A;  2K5L A;  2DPP B;  2K57 A;  2LCL A;  2DEQ A;  4MML A;  1UB4 A;  3QXE B;  3FDR A;  3QYH B;  3CEY A;  5GAM e;  2DVE A;  2P0K A;  4M78 D;  4P5N A;  4JRQ A;  1RL2 A;  3PGG A;  3VKI A;  3CCL T;  2VXF A;  3OYC A;  2HQE A;  4Q5W A;  4M75 C;  3P8D A;  3CCS T;  1BYM A;  3HKS A;  4KT0 E;  5GMK j;  3A8O B;  1N8R C;  2KDS A;  3PIO A;  3HRS A;  5GMK m;  1VQ7 A;  2KVQ G;  5M9O A;  1M9S A;  4XU0 A;  1YJW T;  1H3Z A;  3JCM d;  1BIA A;  1YIJ A;  2E12 A;  3MEV A;  2G3R A;  3EFR A;  4J5Y A;  4NS5 A;  2OTJ A;  2EJG A;  4M78 A;  3JRZ A;  1BI2 A;  3QJ6 A;  3A8M B;  1YIT A;  2E65 A;  5LJ3 j;  5HKC A;  2D6F A;  3SWN B;  5HK3 A;  3JCM P;  2V8I A;  3N5B B;  5FU6 B;  5IT9 E;  3FEO A;  4MMK A;  1VQM T;  3MP8 A;  5D6X A;  1S72 A;  3CMA A;  4C0D C;  1G3T A;  5GAO r;  5GMK l;  1AHJ B;  5J39 A;  3LWI A;  1VQN T;  4MDW A;  3PT9 A;  3V8J A;  5KCH A;  1I4K 1;  2VXE A;  4N0A A;  1VQ4 A;  3CME T;  2I2L A;  4RCB A;  1NZ9 A;  3WVE B;  5CKD A;  4M7A A;  5GAN h;  2M16 A;  3CC7 T;  2QTX A;  5EG2 A;  3CCE A;  4C92 E;  4C92 G;  3NTI A;  2XD0 A;  4M77 G;  1VQK T;  3INZ A;  5FU6 C;  3QHS A;  2FL7 A;  1KHC A;  4OGE A;  4BE1 A;  2LRQ A;  3SB2 A;  2DIG A;  4PLL A;  3OB9 A;  4L5G A;  4PKC C;  3JCM b;  2R57 A;  4ELZ C;  1M4Z A;  2EQM A;  4ZGE B;  5GMK e;  2R5A A;  3M4G A;  4ZN3 A;  3OYF A;  1UGP B;  4C5I A;  2O4X B;  3RKW A;  2ZGW A;  4PNO A;  4M7D G;  2VYT A;  1W2B A;  1SSF A;  4OB2 B;  1Y96 B;  3VV0 A;  3S3N A;  1Q86 U;  2DXB A;  2L89 A;  1OI1 A;  3JCM c;  1KQS S;  2CGH A;  5LJ5 j;  3CCU A;  1VQO A;  3G71 T;  1VQ6 T;  1ZHI A;  3URG A;  3VYG A;  5LJ3 e;  1QVG A;  3G6E A;  3CCR T;  1WPY A;  2E10 A;  3OSV A;  4UC4 A;  3VJP A;  1Q7Y U;  3TU4 K;  5FRO A;  3MET A;  5I2M A;  3QUI A;  4R55 A;  2DIQ A;  3I55 A;  1KC8 C;  5GAM g;  2RJC A;  4XU2 A;  1KD1 U;  2QQR A;  4BY6 B;  2LQ8 A;  2LDM A;  3I56 T;  2E5Q A;  3HL8 A;  5GAM f;  1YHQ T;  1W2B S;  4M78 B;  1XTD A;  2BUD A;  5DY9 A;  2Y4X A;  1VQL T;  3CBP A;  2X35 A;  2DO3 A;  3GOX A;  1JBM A;  2ZPE B;  1X6O A;  4XK8 E;  2DZ9 A;  4A53 A;  4BD3 A;  4C0Z A;  4FSX A;  2OTL T;  3C95 A;  3CPW A;  1K9M U;  2E41 A;  1QVG S;  1O75 A;  4OB3 B;  4L6V 5;  1U1S A;  5CIU A;  2FYK A;  4II1 A;  3BW1 A;  4FIB A;  4C92 F;  3LW5 E;  3M55 A;  2PVG B;  5GAO p;  1HXD A;  1UGS B;  3VYH B;  2QA4 A;  3CC4 A;  4RMO A;  3L2Q A;  4XTU A;  4Z02 A;  4JRP A;  2X4X A;  2EAY A;  4MZM A;  2JZ2 A;  4C0G A;  4ZTF A;  1VQP T;  4OB0 B;  3AHU A;  2DXU A;  4NL3 A;  1GXI E;  1M1G A;  4M78 C;  3CCV A;  2DTH A;  2NLU A;  5CR2 A;  4PLI A;  3UWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...