1B34B

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
74
Chain Sequence
b'TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMDRYISKMFLRGDSVIVVLRNPLIAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
molecule tags Rna binding protein
source organism Homo sapiens
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
total genus 14
structure length 74
sequence length 93
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34B00
4XQ3A 5GANh 3JB9J 5GAMd 5GAN5 4JRIA 4EMGA 5GAOm 1JBMA 4M75F 4NL2A 4PJOF 3JCMc 4M75C 4F7UF 4PJOC 5GMKj 4M77G 4M78G 3RUXA 2DEQA 2FYKA 2RM4A 2FB7A 3EFSA 3QHSA 4M78F 5LJ3h 3V7RA 3V8KA 4C8QB 4F7UG 5LJ3g 1LOJA 3SWNA 4C92E 5GANd 2QTXA 1H641 3RKXA 2E1HA 1MGQA 5LJ5d 3GIBA 4X9CA 5LJ3j 4C92A 4EMKC 1HXDA 5GAN2 2DTHA 5GANj 1HK9A 5GAN8 4M75G 4PJOG 4MMLA 2E41A 3QO3A 4HA8A 5GMKl 3JB9G 5GAMe 4J5YA 2DZCA 4XTUA 2DTOA 4HT9A 4M7AC 4M78A 4M7DG 4F7UB 3JB9H 4XTXA 3L2ZA 3V7CA 1BIAA 2I2LA 5CAIA 4JLIA 2E10A 1X01A 4QVDA 5DY9A 4XU0A 4N0AC 4XU1A 3JCMe 5GAOl 1YCYA 4C92B 5GAMf 3L1AA 5I21A 1M8VA 3SWNC 1I81A 4C8QF 4RCCA 2DVEA 3JCMg 5LJ5e 2YLCA 1U1SA 5GAOn 3QSUA 2VXFA 5GAN7 3PGGA 2HNIA 1B34A 4M75A 4PJOA 3FIFA 1Y96B 2EWNA 4XTYA 4M7AA 4MMKA 3JCMV 4M75E 4PJOE 4OP0A 2EJFA 4X9DA 4F7UE 4M78D 3INZA 4EMHA 5LJ5f 4M78E 4M7AE 4J6YA 2DTIA 3QUIA 4XTZA 3V8LA 1LNXA 1M5Q1 4M7DB 2ZGWA 3JB9D 2RB6A 4XTVA 3RKWA 5GANe 5GMKi 3JB9F 2Y90A 4M7AD 5GAMg 4C92G 4M7DE 3JCMP 3RESA 1D3BA 4M77A 5GAN6 2RA2A 4C8QD 3RKYA 5GAMj 5GMKm 2DZ9A 3JCMb 3JCMh 2EAYA 4DQ2A 4PJOD 5LJ5h 4N0AA 3FJPA 4M75B 4PJOB 2VXEA 3JCMf 5LJ5g 5LJ3d 3V8JA 2EJ9A 1I4K1 4NOYA 3HFOA 4F7UA 4C92C 3RERA 4M7DC 3V7SA 1D3BB 3EFRA 4A54A 1N9SA 4M78C 5GAOr 1WQWA 4J6WA 4M77F 5GAOq 1LJOA 5LJ5j 2DXUA 3JCMW 4HT8A 4M7DA 4C92F 4V2SA 1TH7A 4M77D 5GAN3 2RD1A 5GAMh 1WQ7A 4Y91A 4M77B 3HSBA 1JRIA 3M4GA 4C92D 5GANg 4C8QC 4M77E 3BDUA 2EJGA 2DJZA 1KQ1A 4XU3A 1Y96A 2JN0A 2K57A 3FB9A 4XU2A 1BIBA 2CGHA 2YHTA 2DXTA 1N9RA 3BW1A 4RCBA 4M7AB 3SB2A 3VU3C 4XTWA 2E65A 4EMKA 3JCMX 4M7AG 4M78B 4JUVA 4QVCA 4EMKB 1WNLA 4M75D 3AHUA 4A53A 4M7DF 4C8QA 3BY7A 2VC8A 4M7AF 3HFNA 3JCMQ 5LJ3e 4NL3A 2E64A 1I5LA 1U1TA 3SWNB 5GMKh 4J6XA 5GAOp 4C8QG 3JCMJ 1I8FA 4M77C 5LJ3f 3RIRA 4C8QE 2DKGA 5GANf 1KQ2A 4PNOA 2YLBA 4WF2A 3JCMd 5GMKe 3BFMA 5GAN4 3JB9I 1WPYA 1B34B 4M7DD 4JRKA
chains in the Genus database with same CATH superfamily
4OGCA 1RLPC 4PJOF 2D1XA 4M75C 3GP8A 1M1FA 3OYKA 3OMGA 2DF6A 2R5AA 3UWNA 2AKKA 1KIKA 2X51A 3CMEQ 7AT1B 2DRKA 2OTLT 2QQ9A 3CC7A 1WGSA 4A4GA 4MMLA 3G71T 2FPFA 4HT9A 2RI2A 2HAXA 1FMWA 4ZGDB 1QMCA 2VASA 4J9CA 4CRIA 5KYUA 3WVDB 2YSQA 2F69A 1YIJQ 3PMTA 1Y7XA 1TSFA 1K8AR 4PJOA 1MMDA 2ENMA 4M78D 2OTJT 5AYFA 1YITA 1GBRA 5A0DA 1KC8R 1PM3A 4J6YA 1UJYA 3VS1A 1FMVA 1VQKT 1LNXA 3JB9D 5GMKi 1YP5A 1D0XA 4C8QD 4JJDA 1ZUKA 3NHNA 4L5GA 1TS9A 1ZHIA 4OB1B 4M75B 3M0TA 1QKWA 4C92C 1K9MC 3V7SA 4BY6C 2YRVA 4NS5A 1YWPA 2O2OA 2YUOA 4JDSA 4Y91A 1M90U 1WHLA 2A37A 2NLUA 2RQWA 3H0HA 1M1KU 5FWBA 1RABB 5CKFA 3M0SA 1YJWT 2JJ9A 1OX8A 1VQLA 2E5QA 3M59A 2H3JA 4DBRA 4WTOB 1UFFA 4Z89A 2CZ1B 2B86A 2FPEA 3CMAA 3CC2A 5CKBA 3M5AA 5LJ3f 3X20B 4LDXA 1ZX6A 3OYNA 2KE9A 1D0YA 3WXMB 2DL4A 4PJLA 1YN8A 2KAFA 4LN2A 2GF7A 5GMKj 2ED0A 4EDUA 1T0JA 3TSZA 2WACA 3VV0A 1ZSZC 2V8IA 3EG9A 3VYGA 3CCLQ 4BI4A 1YJ9T 4J9IA 1ZSGA 3ASKA 4FT4A 1UUEA 3UATA 4OMMA 4P5NA 5J39A 1TU0B 3HHTB 2D0QB 2MMPA 4KULA 1GCQA 3CCJQ 2GBQA 2ZCFB 4B9XA 2KXCA 3QSUA 2K3YA 3PGGA 3TEEA 2HNIA 3CCEQ 4DOVA 1Y96B 3M4YA 4XTYA 4F14A 1QCFA 1WHMA 4ELYC 1B7TA 1G3SA 4AG1C 3CCUT 4ANJA 2M0OA 2GQIA 1AOJA 3CCMT 4A4FA 2LT4A 1VOMA 1OOTA 2QA4T 3CD6A 2FEIA 3M58A 3OMCA 2F5TX 4IUVA 2Z0WA 2VXEA 1PG5B 3HFOA 3NMZC 1S1NA 3QKJA 4AMCA 4C92F 4MZTA 2COWA 5IHIA 3OYCA 1ZSZB 4OB3B 2BUDA 1KQ1A 4K11A 1Z9QA 4Y92A 1RAIB 1HYOA 1QCNA 1IO6A 4JUVA 2AHJB 3I9QA 2HQEA 2QK0A 3IQLA 2LX9A 1I1JA 2E4HA 4RTVA 3QG1A 4C8QE 1YI2T 4R0KA 2DKGA 3LLRA 5KYNA 3CPFA 3MEAA 4M7DD 3LX7A 5CCAA 3MP6A 5IXFA 1O9SA 2EFIA 4EMGA 1K4US 1JBMA 4M75F 1H3HA 2NUTA 2QG9B 3EFSA 1WJQA 4E7JA 4C92E 4OMPA 2CP0A 4A4KA 1E6HA 1M8MA 2XI9A 1K73C 2OTLQ 2HZYA 2X4YA 1B3QA 5D6WA 2BE7D 2YRCA 3CC2Q 2QGFB 4AG2C 2J06A 1LCKA 1UB4A 3CCLA 2LZ6B 2ROTA 1PRMC 3ZBDA 1VQ8Q 1U1SA 1BYMA 4M75A 3FIFA 2EWNA 4QKUA 3I56Q 4M4ZA 3FRNA 2KSSA 2EVRA 3INZA 4D6WA 4KGXB 5D6XA 1NM7A 3CCQQ 3RKWA 2EQUA 4OMOA 2CUBA 2QDLA 3A8HB 3MEUA 3EH1A 5CKDA 1Q86U 4J7IA 4JZ3A 2EKOA 2KBTA 2LTOA 1UEBA 3CXCP 3DLLA 3G4SQ 4DBQA 3CCVQ 1WJSA 4E7ZA 4HCKA 3ZL7C 3VS4A 2RI5A 2F1LA 1GBQA 4R56A 3REBB 4JS4A 4RTUA 1R0CB 1MUZA 1JRIA 1VQKA 3CCSQ 4M77E 4X1VA 4M7AE 5FLXE 2K57A 1TUCA 3TQ7P 2FRWA 3LWHA 3VS3A 2Y4XA 2DMOA 3J81E 3M55A 1QWFA 4CC4B 2VC8A 2C0IA 2XHCA 5FU7C 3CC7Q 3SWNB 5A2QE 1M30A 4IUPA 4M77C 2X4XA 2QEXQ 1KQ2A 2QQSA 4C0DC 3EGXA 2DXCA 2PUKB 4J9DA 4GLKA 2O4XA 4ELZC 3G71A 1OZ2A 2HBPA 1YHQQ 1ABQA 1NYGA 1M3CA 2L0AA 3I56T 4JZ4A 2WSCE 2VVKA 2AK5A 2DL8A 2G3RA 4C8QB 2FL7A 1I5OB 4HVVA 2J6OA 3RKXA 3I55A 3A8OB 1VQPQ 1VUBA 5CO7A 4HCCA 1M4ZA 3VRZA 1SEMA 2DTOA 3JB9H 3OYJA 2W0ZA 4XU0A 1U06A 3E9FA 4OMFB 3L1AA 3T9NA 1QVFP 2ZPHB 2VXFA 1VQ9A 2K5IA 3C4SA 1M90C 3E19A 2MYSA 1N6AA 2KR3A 1U3OA 4BE2A 3C12A 3HRUA 1X75C 2JM9A 4XTVA 2PU9B 4M7AD 1PCXA 1AWJA 3G7ZA 3LW5E 2RA2A 2XMFA 3OA6A 2CREA 4QT7A 3G6EA 5C6SA 2WSEE 2E6NA 4LDVA 2F5KA 3EFRA 2E3HA 4LDUA 4M77F 3BDLA 1YHQA 2KEAA 2OAUA 4C8QC 3MO8A 4ZGEB 4E6RA 2QASA 2PQWA 4XTWA 1LPLA 3NGPA 1QCOA 2HSEB 4M78B 4QVCA 2Y4YA 2O01E 1I5LA 3GOXA 1OULA 2DBKA 2E3IA 3FDRA 2JXBA 2KRNA 3PVQA 1WJRA 3OYAA 2DD5A 5IXBA 1XOVA 2KYBA 2CDTA 1X2QA 4XQ3A 1GXIE 1NJIU 3CC4A 4FCYA 1UGVA 3PE0A 3RUXA 4CC3A 2K3BA 3QJ6A 3I55T 3CEYA 2KT1A 1Q82C 4IIOA 1Q95G 4OMNA 1MGQA 2RO0A 2BIVA 3CPWS 1AZEA 3QO3A 5CKHA 5GMKl 5GAMe 1KSWA 2HCKA 3EG0A 4F7UB 4RTTA 1AWXA 2P0QA 3JRZA 1M8VA 5GAMf 2QEXT 4C5EA 4RCCA 2OJ2A 1VQ6Q 1BI2A 3MJXA 2RH2A 1M2VB 2DJQA 2DVJA 3I35A 2EBPA 3P8DA 2L2PA 1VQNT 4M75E 1Z9ZA 4KH1B 4QVZA 3I55Q 3QUIA 1B07A 3WVEB 2C0OA 2YWWA 1YIJT 2EYXA 1VQ9Q 3RESA 2YXYA 4C5IA 3OYEA 1OX9A 3G6ET 2RMOA 4E2FB 1N5ZA 3QBYA 1N8RU 2JNGA 3M0UA 1FXXA 4J9FA 2EJ9A 3OBWA 4A54A 1OYXA 2DYIA 4KH0B 2PVDB 3OYDA 4E7SA 2RN8A 4M7DA 2L3QA 2XIDA 2KY9A 2RD1A 3NPFA 1W2BA 5GAMh 3OW2P 3VS2A 2OAWA 1NEGA 4JLGA 4RKUE 1CKAA 3CCJT 3MEWA 1S72Q 4MDWA 1A0NB 4M7AG 4II1A 1PWTA 2PVGB 1Q81R 1U1TA 3DLMA 4BDZA 3UPUA 3GF5A 1XTDA 1ZSZA 1IRXA 4JS5A 3PTAA 4PJNA 1UECA 3AT1B 1C6VX 4QQGA 1Y0MA 2PZ1A 4MZMA 5GANh 5GAN5 2DEQA 2DBMA 3OYYA 4M78F 5LJ3h 3E2UA 2LNVA 4RG2A 1YJNA 5DM7R 2KYMA 3LH0A 4OGEA 3VUZA 2V8JA 3TVTA 2GQVA 4OMLA 5GAN8 4FT2A 4OMQA 2P84A 1NPRA 2YDLA 5CKEA 4LD9K 2IPOB 3HL8A 3ME9A 4XTXA 1YI2A 2ZPIB 1KQSS 4FW1A 2L8DA 5D7UA 3OY9A 1JXMA 4M7AA 2EJFA 4PK4A 1AEYA 1ARKA 2GTJA 3CCSA 1WDXA 2RHIA 1HD3A 4C92G 2LQ8A 2YT6A 5HCKA 1YHQT 1GRIA 2O9SA 1WI7A 3PNWC 1AWWA 3UF4A 5LJ5h 3H0IA 1QVGP 3DB4A 3JCMf 2V1QA 2XKOC 4LUDA 1MV0B 2RQUA 3GLXA 2MOXA 1VQ7A 2DXUA 3JCMW 2QA4Q 2JS0A 2KT8A 2CT4A 4C5GA 3H6ZA 4XK8E 3BW1A 4L6V5 3CCUQ 1Q81C 3G71Q 1T3LA 1V76A 2E64A 3CCET 3CPWP 1RUWA 3Q1JA 3JCMJ 3QZ5B 4BI3A 4B6MA 1VQLQ 2QQRA 5FRNA 5GJVB 3L2UA 2PTKA 1VA7A 1Q82U 4LE9A 1KC8C 2QXFA 4NL2A 1JJ2A 1Y57A 3L42A 1JU5C 5J26A 3QHSA 5GANd 1WIEA 4KUDK 1JO8A 1YJ9Q 2E1HA 1TOVA 1UG1A 3R6OA 1HXDA 5GAN2 3OB9A 1KC8U 5I2MA 3QDRB 2DZCA 2RQVA 4M78A 1K8AC 4ZGJB 2MPXC 2DK3A 5A0LA 2LCCA 4C5HA 3M57A 2FZGB 1VQ4T 1I07A 2LNHB 3CC2T 2DL3A 3CBOA 2IIMA 1RI0A 3JCMV 4PJOE 2CH4W 1KK7A 2HBWA 1SRMA 2O9VA 2CZ7B 2E6ZA 2X3XD 3A8LB 1VQ7T 1X27A 2HEQA 2CP6A 2K5FA 5KYXB 4JRQA 4PFOA 5KH6A 2DIGA 1V29B 5HK0A 2EAYA 1VYUA 2YRDA 3CCMA 5LJ3d 2DETA 2H3EB 2L3RA 1N9SA 2D8HA 1Q86C 1WQWA 3X24B 3CCUA 1KD1R 1RLQC 1PD1A 2MI6A 2FVUA 3OS5A 4OVAA 1NYFA 2YUNA 5GANg 2AIRB 1JXOA 3ZFJA 2EJGA 1O75A 3RMSA 1YITT 1R77A 2E65A 3VYHB 1UTIA 4CI0C 3JSCA 3HFNA 5LJ3e 1ZQ1A 4FSSA 4C0DB 3CXCA 2DAQA 3GNFB 5FW9A 2VB6A 3LWIA 4WF2A 3JCMd 1BCOA 5GMKe 4RTZA 1PC0A 1WHJA 4RG8A 1CSKA 1YJ9A 2KMTA 5DLQE 3JB9J 1YJNT 5GAMd 3OW2S 2COZA 1KJWA 1PHTA 3M0RA 2FYKA 3UT1A 1RL2A 1Q86R 4Z88A 3EAEA 2D9TA 2QQBA 1M1GA 1C0MA 4RTXA 1ZBXA 3GIBA 5LJ3j 1NJIC 1RACB 2HSPA 4DBHA 3EFOA 2D0NA 4JJCA 1QVFS 4M7AC 4GLMA 1BIAA 1YITQ 2XG8D 4N0AC 3QPHA 2HKQB 2K4YA 2MCNA 5M9OA 5GAN7 2NUPB 5C0MA 1QQJA 5GJWB 3R6NA 2DA9A 4FU6A 1X6BA 4EMHA 2CKKA 2DE0X 4XTZA 2DM1A 3DB3A 1N8RR 3QZ9B 3JB9F 2XU8A 4FL6A 2LX7A 3A5ZB 1Q7YU 4D8DA 1SF9A 3KFVA 1AZGB 3L2QA 2ECZA 5GAMj 5GMKm 1G83A 2X4WA 3X26B 2J6KA 2FPDA 2CP5A 3FJPA 1Q7YC 2EPDA 3RERA 2EYYA 2DERA 4J9BA 4BD3A 4F16A 2NYSA 2OTJA 1P92A 1VQNA 3O5ZA 3UA6A 2LC4A 2WSFE 5IN1A 5KCHA 4XU2A 5GAOq 1BIBA 2YHTA 1AHJB 1VQ4A 1WZOA 1D1CA 2L5QA 2PVOB 3MKDA 4EMKB 1NE8A 2R58A 1IGQA 4A53A 4HCBA 3HTRA 4BE0A 3OBYA 2OI3A 4L59A 1QVGS 2LQKA 2SRCA 1TTHB 1TUDA 3BFMA 1BU1A 2F2XA 2P4TA 2ESWA 3A8GB 4JRIA 3EGUA 4F7UF 2R5MA 1VQKQ 1MMGA 1OU9A 2BKDN 2KGTA 3HRSA 2JS2A 2ZPBB 2X4JA 2O88A 3LYIA 2F2WA 1MNDA 2LVMA 3LH5A 1FYNA 1HK9A 2DILA 1WXBA 2LCLA 2GNCA 2ZZDA 1SSHA 3M56A 2HD0A 4M7DG 8AT1B 2E10A 4IUTA 5DY9A 3X25B 1QKXA 3VS0A 2EIFA 4EIKA 4FYWB 1RAAB 3OQ5A 1B34A 1WX6A 8ATCB 1YFNA 1ACMB 4LDWA 4X9DA 4F7UE 4OB0B 3CD6Q 3CCJA 1QVPA 1K73R 3OS1A 2JVVA 2RB6A 2CUDA 3A1PA 1T0HA 1MMAA 2KRSA 5J3BA 2IVWA 2K7AA 2ROLA 1X6OA 2O4XB 4DQ2A 1UJ0A 2DEUA 3VS5A 1ABOA 5LJ5g 4NOYA 1D09B 1MMNA 2RQRA 2EGAA 4FYYB 4V2SA 3EHQA 3PIOA 4HXJA 1GCQC 1UGSB 4J9HA 5FU6C 2JTFA 4C92D 1W1FA 5CVIA 5A0GA 1M3BA 4FIBA 1N9RA 3VU3C 4RUGA 3JCMX 2LCSA 1ZLMA 2OX7A 2E5KA 4NL3A 3VUBA 1K8AU 3G6EQ 5CR2A 3RIRA 1VQ4Q 3HKSA 2LP5A 4PJJA 1JB0E 2OTLA 1VQNQ 4FSXA 3MP1A 2ZPEB 2X3WD 1TG0A 2EGEA 3V8KA 3I56A 2CT3A 3CQTA 2MK5A 1VQ6T 3E1SA 1NEBA 2PNIA 4ORZA 4QQDA 3S3OA 4C0GA 2FZKB 5LJ5d 2P4RA 3QIIA 1BI1A 3KXTA 4YTLA 2CZ0B 4Y28E 3EGXB 4PJOG 3MHXA 2MIOA 1AD5A 2EGCA 3NTIA 2P0KA 2M9UA 3QWXX 1FX7A 1D1BA 1X01A 5GAOl 3C95A 4C92B 2YLCA 4GY5A 2KI7A 4JRPA 3JAME 5IT9E 1X43A 1IREB 3VKIA 2EYWA 1GCPA 5LJ5f 4DBFA 5KYUB 2DTIA 3V8LA 2O31A 1Y71A 2CH4A 3CCMQ 1H8KA 3EGDA 3JCMP 3DKMA 5FU7B 3VJPA 1OI1A 1T3SA 3EG9B 2LDMA 5LL6S 2DZ9A 2JTEA 4CC2A 2MWPA 1U5SA 2EYZA 1YIJA 3MCAB 1H3ZA 2CYZB 2K2MA 2CP7A 1G2BA 1WQ7A 3TU4K 1Q7YR 1GFCA 2LMJA 2M1HA 2DXTA 2C06A 2QAZA 1OZ3A 1Y07A 3MP8A 1WNLA 3OYMA 4M7AF 1M2OA 2FO0A 3CCLT 2DFUA 1UGPB 2R57A 4IUUA 5FRMA 1I8FA 1UDLA 2AT1B 1K9MU 1QVFA 3S3NA 1BI3A 3QYGB 3FEOA 2CSQA 1W70A 1FMKA 3N5BB 1VIEA 1XJWB 1ZUYA 1GFDA 3JCMc 2QYZA 2RJDA 3CBPA 5D6YA 1XNIA 3V7RA 1QP3A 2QTXA 1W2BP 3M9QA 1H641 3OW2A 1V1CA 1YWOA 4E7KA 4KBMB 2JOYA 4A63B 5GANj 3KBGA 1OEBA 3TREA 3JB9G 5L8RE 4PLIA 1NZ9A 4J5YA 3SDZA 2ATCB 2KNBB 1X2KA 2AZSA 2KROA 1JEGA 3MPUB 1LVKA 3SWNC 3X28B 2X9HA 3CCQT 2MWOA 2VGMA 2DVEA 2IG0A 4DEXA 1M1KC 1RI9A 2VYTA 4HVUA 5I22A 2SEMA 1BB9A 2RQTA 2B8AA 2JTMA 2KXDA 1SPKA 5GANe 3QXEB 2XK0A 3P8HA 3OYIA 2COYA 1BCMA 3HPWA 2QA4A 3CD6T 2OTJQ 3M0PA 2A7YA 1G5VA 1IHVA 2F2VA 1VIFA 3V8JA 4DEYA 4M7DC 3QJYA 3GBQA 1HJDA 4J9EA 3GNGA 1JQQA 4WCIA 2J7IA 2DYBA 1WYXA 3EHRA 1AWOA 1UE9A 2HQXA 1VQ9T 1CKBA 4AFQC 4FM4B 1K0SA 3SB2A 2JMAA 3CMEA 4BI8B 3M54A 4PJOD 4DA4A 2DX1A 4VUBA 2VKNA 1BI0A 2BZXA 1OV3A 4O6JA 3PMIA 2D8JA 3CBMA 1PRLC 2FZCB 2GCXA 5FROA 4ZN3A 2FRYA 2VUBA 3NTKA 2JM8A 4JJBA 4FYVB 1VQ8A 1E6GA 3OSVA 5ECAA 1DJ7B 2ZPFB 4LUEA 3A8MB 1GL5A 4QW2A 1TXQA 3L2VA 1BK2A 4C92A 4C0ZA 2DTHA 2NWMA 4M75G 4OB2B 2BZ8A 1KD1U 1UGRB 2DO3A 1AT1B 1KHCA 5CAIA 1UGQB 3D7SB 3THKA 3M53A 1ZUUA 1PKSA 4XU1A 1YJWA 1BBZA 5GAOn 3EGDB 2QI2A 3P8BB 2J6FA 4B9WA 4AFZC 2HL3A 3L2WA 2HMAA 5CIUA 4BDYA 3E9GA 4UC4A 5FWCA 1SRLA 2MAMA 4RTYA 4M7DB 3G4ST 3CCVT 1RAHB 1VYTA 2RI3A 2DIQA 2QGGA 1VYVA 2E12A 1M2VA 2EW3A 4XAXB 3JCMh 3OYHA 1TUGB 2NUPA 4N0AA 1PSFA 3HP9A 4PL6A 2CS7A 1LJOA 1M3AA 2DXBA 3EG3A 4RMOA 2CP2A 5GAN3 2EQJA 3G4SA 3CCVA 3H0FA 2M16A 3BDUA 2CGHA 3META 3C94A 2W10A 4PKCC 4KT0E 1VQPA 3C0CA 1KQSA 1KFZA 3JCMQ 5GMKh 4E7LA 3U23A 3URGA 1EFNA 1RAFB 1F1BB 1WXUA 2DNUA 2EQIA 2M0YA 2QTVA 1M27C 1KG1A 2NUTB 1K73U 1M1KR 3H8ZA 2EKHA 1G3YA 4F7UG 5LJ3g 1LOJA 3SWNA 3PIPA 2DL7A 2EYQA 3OS0A 1YI2Q 1RADB 1VQ5A 2LJ3A 4KUIA 2LJ1A 4FYXB 3VS6A 3CCEA 3L2ZA 2K79A 3V7CA 5HK3A 1QVGA 2NUZA 2AKLA 3JCMe 3QYHB 1IHWA 1WHHA 1VQMA 5LJ5e 4D8KA 2RHXA 1OPLA 4MMKA 4OP0A 1VQLT 4MDXA 2DPPB 4N4IA 2XICA 5GAMg 3VS7A 2RHYA 1N8RC 3J7AF 2ZPGB 4DOWA 1VQ7Q 4PFPA 3RKYA 2C0TA 1SHFA 4PJMA 5I2SA 1W6XA 1K76A 4J8OA 1M9SA 2DD4A 1I4K1 1YJWQ 2CP3A 1X6GA 4M78C 3OS2A 3REAB 2K9GA 4IIMA 2FG0A 5EC7A 2EQKA 1PNJA 2DJZA 4XU3A 1EIFA 1JJ2P 1K0XA 2LRQA 1ZA2B 4M75D 4C8QA 2E70A 3S6WA 2KQWA 1QP2A 5KYYA 2GTOA 5CK9A 1WLPB 2XDBA 1FWZA 3PFSA 2YLBA 5GAN4 4J83A 3QDFA 3CC7T 2GGRA 3OYGA 2V1RA 2G6FX 1EX4A 3SEMA 3L2RA 2RM4A 2FB7A 1K9AA 3G1JA 2H8HA 4HCZA 5DLOA 1K9MR 3KUFA 1MNEA 1SKUB 4BACA 1I0CA 2HL5C 1KQSP 4XTUA 6AT1B 3FC3A 3CMAT 5EG2A 2A28A 3CXCS 2LQNA 1KD1C 3FJ5A 3CMET 5CQXA 4PLLA 1YCYA 3LGLA 1WHGA 4QQ6A 4C0FA 2ZAEA 4AFSC 5KYXA 5KYWB 1SSFA 1VQPT 2RJFA 1C1AA 1YCSB 4M78E 2M02A 5IAYA 2AZVA 4M7DE 2I0NA 1D3BA 4M77A 1NLPC 1H92A 1NG2A 4ATOA 4ZNXA 4LNPA 5IH2A 2PUOB 1QLYA 3H41A 1PSEA 1VQMQ 4A4EA 2RHUA 9ATCB 4HT8A 4A4HA 1EZZB 1TH7A 4MZPA 3CMAQ 1XQHA 4BE1A 4M77B 3HSBA 2DL5A 3M4GA 1Q81U 3HRTA 3CCST 1YJNQ 3CCQA 2K2VA 2QEXA 4RCBA 2GFAA 5HKCA 1D0ZA 4Q5WA 4GBQA 4BY6B 3ZEHA 1W4SA 4M7DF 3BY7A 2V8KA 1WFWA 4J7FA 4J6XA 4LD6A 3NTHA 2CSIA 3RDVA 1UHCA 1S72A 3O8VA 3VRYA 1WPYA 2DLPA 1B34B 1QW1A 1MHNA 2KDSA 4X34A 2M51A 1SHGA 5HY6A 3OYBA 4PJOC 4M77G 5I11A 2DRMA 2JZ2A 5I21A 4ZTFA 3OYLA 1MV3A 2JW4A 2KRMA 1JJ2S 1IB8A 4BB7A 1D1AA 3H9NA 5KE3A 3GPLA 1S72T 3EFOB 4E7HA 4KGVB 2E41A 4HA8A 1VQ8T 5L23A 3CCRT 1G3TA 2I2LA 2YUQA 4QVDA 2RHZA 3ER0A 4HKEA 4C8QF 1M90R 1IGUA 2CZ6B 1X69A 1BKBA 2XD0A 3LGFA 1QWEA 2RPNA 3UA7A 4JPBW 2MF2A 4BUGA 2LT1A 2LJ0A 5GAN6 2QDYB 4ZN1A 2RJEA 2QQAA 2RK2A 2YUPA 4ZTJA 1RAEB 2ED1A 5IHNA 2A0FB 4J9GA 4PJOB 3SHWA 2J05A 3SD4A 3M0QA 1D3BB 2LQWA 5GAOr 5KYYB 3OSSC 3PVLA 2RNAA 4CC7A 1VQOA 3RMQA 3BE3A 1E7OA 1TWBA 1Y96A 3FB9A 5KYWA 1HSQA 4EMKA 3ULRB 3AHUA 4E7IA 4KGZB 2JUFA 1Q82R 1UHFA 2K5LA 4C8QG 2K3XA 3CC4Q 4F04B 2L3PA 3S3MA 5GANf 1IXDA 4Z8AA 2VWFA 2RJCA 3RBBB 2KK4A 1YNZA 5AT1B 3CCRA 3EH2A 4JRKA 4ESRA 3F70A 5KCOA 1VQ6A 2VV5A 5GAOm 1NLOC 4HVWA 4ME7A 3I5SA 3FLGA 4M78G 3TSWA 1R0BG 1ZA1B 3MEVA 1OPKA 2JMCA 1OU8A 2BZYA 4TVRA 4X9CA 2RK1A 3CC4T 2VGNA 4EMKC 4N4GA 4LXCA 4KRTA 4F17A 3QWYA 5CQYA 1WXTA 3RNJA 1WA7A 1AVZC 1SG5A 4Z02A 2GFUA 1IZ6A 1N27A 1PKTA 1NPPA 1R8OB 4PFZA 2HDAA 4IUQA 4JLIA 2HKNA 4IKFA 2A08A 1VQ5Q 4OF1A 1I81A 2X35A 4N4HA 3RR6A 3JCMg 2KVQG 3EG2A 4AFUC 2V26A 3EG1A 1VQOT 4R55A 2BTTA 1ZBJA 5FU6B 1J3TA 2EQMA 4RTWA 3SFMA 1W2BS 5KE2A 1M5Q1 2ZGWA 4FW2A 2Y90A 2XDPA 2HQHA 2P0PA 2L89A 3OYFA 1U8RA 3NFCA 2XDDA 4O5VA 4E47A 1WHKA 2L3SA 3JCMb 2JT4A 3A98A 3I5RA 2A36A 1G3WA 1OQKA 1KHIA 2K6DA 4F7UA 1PD0A 4JJNK 4J6WA 1K1ZA 5LJ5j 2A3LA 4LDYA 2FHDA 4M77D 3PT9A 1RAGB 3UDCA 3J80E 1YBYA 3TCJA 2JN0A 1NJIR 1VQMT 4M7AB 4EPCA 5IHKA 2ABLA 3CCRQ 1G8XA 1VQOQ 1NBEB 5GAOp 4PNOA 1VQ5T 4AT1B 3JB9I 2RF0A 4IURA 2D6FA 3JV3A 2BE9B 3CPWA
chains in the Genus database with same CATH topology
1XOVA 3A8GB 4OGCA 4XQ3A 1KG1A 1GXIE 4JRIA 4PJOF 1NJIU 3CC4A 4M75C 4F7UF 1K73U 2R5MA 3GP8A 3RUXA 3QJ6A 1M1FA 3H8ZA 1G3YA 3OYKA 4F7UG 3I55T 2BKDN 3OMGA 1LOJA 3SWNA 3CEYA 3HRSA 5LJ3g 3PIPA 1Q82C 2R5AA 2ZPBB 3UWNA 2X4JA 2EYQA 3LYIA 3OS0A 1MGQA 2RO0A 2LVMA 2BIVA 3CPWS 1VQ5A 2OTLT 1HK9A 2QQ9A 3CC7A 1WGSA 4A4GA 4MMLA 3QO3A 5CKHA 5GMKl 2LCLA 4KUIA 5GAMe 3G71T 2ZZDA 3M56A 4HT9A 2HD0A 3CCEA 4M7DG 4F7UB 2RI2A 3L2ZA 1QVGA 3V7CA 5HK3A 2HAXA 4ZGDB 2E10A 2P0QA 3JRZA 4IUTA 5DY9A 3X25B 3QYHB 4CRIA 3JCMe 1M8VA 5GAMf 3WVDB 2QEXT 2F69A 4C5EA 4RCCA 1VQMA 2EIFA 3PMTA 5LJ5e 1BI2A 2RH2A 1Y7XA 3OQ5A 3P8DA 2RHXA 1B34A 4PJOA 4MMKA 1VQNT 4M75E 4OP0A 4LDWA 4X9DA 1VQLT 4F7UE 4M78D 4OB0B 4MDXA 5AYFA 1YITA 2OTJT 3CCJA 5A0DA 2DPPB 4QVZA 4N4IA 1QVPA 4J6YA 3QUIA 3OS1A 1VQKT 3WVEB 2JVVA 1YIJT 1LNXA 2XICA 3JB9D 2RB6A 5GMKi 5GAMg 3RESA 2RHYA 4C5IA 1N8RC 3J7AF 3OYEA 2ZPGB 3G6ET 4DOWA 5J3BA 4C8QD 2IVWA 3RKYA 5I2SA 4L5GA 1X6OA 2O4XB 4DQ2A 1ZHIA 1N8RU 3QBYA 4J8OA 4OB1B 4M75B 2JNGA 1M9SA 2DD4A 5LJ5g 1FXXA 2EJ9A 3OBWA 1I4K1 4NOYA 4C92C 1K9MC 3V7SA 4BY6C 4A54A 1OYXA 4M78C 2YRVA 3OS2A 2PVDB 3OYDA 4NS5A 4M7DA 4V2SA 2XIDA 3PIOA 2KY9A 2RD1A 4JDSA 1W2BA 1UGSB 5GAMh 5FU6C 4Y91A 1M90U 2EQKA 2NLUA 1M1KU 2JTFA 4C92D 4XU3A 2DJZA 4JLGA 4RKUE 5CKFA 1EIFA 5CVIA 3CCJT 3MEWA 5A0GA 1YJWT 4FIBA 1N9RA 1VQLA 2E5QA 3M59A 2H3JA 3VU3C 4MDWA 3JCMX 4M7AG 2LRQA 4M75D 4II1A 4C8QA 2CZ1B 2E70A 3CMAA 4NL3A 2PVGB 3CC2A 1U1TA 3DLMA 3S6WA 2KQWA 3VUBA 4BDZA 1K8AU 3UPUA 3GF5A 1XTDA 1QP2A 5CKBA 5CR2A 3M5AA 5CK9A 5LJ3f 3RIRA 2XDBA 1FWZA 3X20B 3PFSA 4LDXA 2YLBA 4JS5A 3PTAA 5GAN4 4J83A 3HKSA 3OYNA 4QQGA 1JB0E 3WXMB 4MZMA 5GANh 3CC7T 5GAN5 2OTLA 2KAFA 3OYGA 4FSXA 2GF7A 3MP1A 5GMKj 2ZPEB 4EDUA 3L2RA 2DEQA 2RM4A 3OYYA 2FB7A 4M78F 5LJ3h 2WACA 3V8KA 3VV0A 2V8IA 3I56A 1VQ6T 3E1SA 4RG2A 2LNVA 4HCZA 1YJNA 3VYGA 5DLOA 5DM7R 4QQDA 4BI4A 3LH0A 3S3OA 4OGEA 3KUFA 1YJ9T 4C0GA 5LJ5d 3VUZA 3ASKA 2V8JA 3QIIA 4FT4A 1BI1A 3KXTA 4YTLA 4BACA 2CZ0B 4Y28E 2GQVA 4P5NA 4FT2A 4PJOG 5GAN8 5J39A 3MHXA 1NPRA 5CKEA 4XTUA 4LD9K 3HL8A 3ME9A 3HHTB 3NTIA 2P0KA 2M9UA 4XTXA 5EG2A 3FC3A 3CMAT 1FX7A 2D0QB 2MMPA 4KULA 3CXCS 1KD1C 1X01A 3CMET 1YI2A 5CQXA 5GAOl 2ZPIB 3C95A 4PLLA 1YCYA 3LGLA 4C92B 1KQSS 2ZCFB 2L8DA 4B9XA 2YLCA 4QQ6A 4C0FA 3QSUA 4GY5A 3OY9A 2K3YA 3PGGA 3TEEA 2HNIA 1SSFA 1Y96B 4DOVA 3M4YA 4XTYA 2RJFA 4JRPA 1VQPT 4M7AA 3JAME 5IT9E 2EJFA 1IREB 4ELYC 3VKIA 5LJ5f 1G3SA 4M78E 3CCSA 2RHIA 3CCUT 2DTIA 3V8LA 1Y71A 5IAYA 2M0OA 4M7DE 4C92G 2LQ8A 3JCMP 3CCMT 1D3BA 4M77A 3DKMA 1YHQT 4A4FA 4ATOA 5FU7B 3VJPA 1OI1A 2LT4A 2QA4T 3CD6A 2LDMA 5LL6S 2DZ9A 3M58A 3PNWC 3OMCA 2F5TX 5LJ5h 4IUVA 2VXEA 3DB4A 3JCMf 2PUOB 2XKOC 3HFOA 2MWPA 1PSEA 1YIJA 3MCAB 4A4EA 2RHUA 1H3ZA 3GLXA 3QKJA 1VQ7A 2DXUA 3JCMW 4HT8A 4A4HA 4C92F 2CYZB 4MZTA 1TH7A 4MZPA 3OYCA 1WQ7A 4BE1A 1XQHA 3TU4K 4M77B 3HSBA 3M4GA 2M1HA 4C5GA 1Q81U 3HRTA 4OB3B 2BUDA 3H6ZA 1KQ1A 3CCST 3CCQA 4XK8E 2K2VA 2DXTA 3BW1A 4RCBA 2GFAA 4L6V5 5HKCA 2QEXA 1OZ3A 1Y07A 2C06A 3MP8A 4Q5WA 4BY6B 4JUVA 1Q81C 2AHJB 1WNLA 3ZEHA 1W4SA 2HQEA 3BY7A 3OYMA 4M7DF 4M7AF 2LX9A 3CCLT 2E64A 2V8KA 4J7FA 3CCET 4J6XA 3Q1JA 4LD6A 1UGPB 2R57A 3NTHA 4IUUA 3QZ5B 1I8FA 3JCMJ 3QG1A 4BI3A 4C8QE 1YI2T 5FRMA 2DKGA 1S72A 3O8VA 2QQRA 3LLRA 1K9MU 3CPFA 1QVFA 5FRNA 3S3NA 1BI3A 1WPYA 3MEAA 3QYGB 1B34B 3FEOA 1QW1A 1MHNA 3L2UA 4M7DD 2KDSA 3LX7A 5CCAA 1Q82U 3MP6A 1KC8C 4X34A 2QXFA 1O9SA 3N5BB 1VIEA 2EFIA 4EMGA 1JBMA 4M75F 4NL2A 3JCMc 5HY6A 1JJ2A 3L42A 5J26A 3OYBA 4PJOC 4M77G 2JZ2A 2RJDA 5I21A 3CBPA 3EFSA 1WJQA 3QHSA 1XNIA 5D6YA 3V7RA 3OYLA 4E7JA 1QP3A 4C92E 2QTXA 5GANd 4KUDK 3M9QA 1H641 1JJ2S 4BB7A 2E1HA 4A4KA 3OW2A 2XI9A 4E7KA 1K73C 2X4YA 4KBMB 3R6OA 1HXDA 2JOYA 5KE3A 5GAN2 5D6WA 3GPLA 5GANj 1S72T 4E7HA 3OB9A 1KC8U 3KBGA 5I2MA 3TREA 2E41A 3QDRB 4HA8A 5L8RE 4PLIA 1NZ9A 3JB9G 4J5YA 2DZCA 1VQ8T 3CCRT 1UB4A 4M78A 3SDZA 1K8AC 4ZGJB 3CCLA 1G3TA 2DK3A 2I2LA 5A0LA 4QVDA 2LCCA 2RHZA 3ER0A 3M57A 4C5HA 3ZBDA 4HKEA 1VQ4T 3SWNC 3X28B 4C8QF 3CCQT 2MWOA 3CC2T 2VGMA 2DVEA 3CBOA 1U1SA 2IG0A 1BYMA 1RI0A 1M1KC 4M75A 2VYTA 3FIFA 2EWNA 2CZ6B 3JCMV 4PJOE 2XD0A 1BKBA 3FRNA 2KSSA 3LGFA 3INZA 4D6WA 2CZ7B 2E6ZA 3A8LB 1VQ7T 5D6XA 2B8AA 2JTMA 3RKWA 2EQUA 5GANe 2MF2A 3QXEB 4BUGA 3A8HB 2K5FA 2XK0A 3P8HA 3MEUA 4JRQA 5KH6A 2LT1A 5CKDA 5GAN6 3OYIA 2QDYB 1Q86U 4ZN1A 2DIGA 1V29B 2QQAA 2RJEA 2RK2A 3HPWA 2QA4A 3CD6T 4J7IA 4ZTJA 5HK0A 2EAYA 2EKOA 2LTOA 1UEBA 3DLLA 4PJOB 2A7YA 1WJSA 1G5VA 3CCMA 1VIFA 5LJ3d 3V8JA 3SD4A 4M7DC 3QJYA 1D3BB 2L3RA 1N9SA 5GAOr 1Q86C 1WQWA 2RI5A 3X24B 3CCUA 3OSSC 3GNGA 2MI6A 2FVUA 4R56A 3OS5A 4JS4A 1VQOA 4OVAA 3RMQA 2HQXA 1JRIA 5GANg 1VQ9T 1VQKA 3ZFJA 4M77E 4M7AE 2EJGA 5FLXE 1Y96A 3FB9A 2K57A 1O75A 4FM4B 3RMSA 3LWHA 3SB2A 1YITT 2Y4XA 3J81E 4ZTFA 2E65A 3VYHB 4EMKA 3CMEA 3M55A 4BI8B 3M54A 3AHUA 4PJOD 4DA4A 4CI0C 2VC8A 3JSCA 3HFNA 4E7IA 2XHCA 2JUFA 4VUBA 1ZQ1A 5FU7C 5LJ3e 3SWNB 5A2QE 2K5LA 4C0DB 4IUPA 2DAQA 3CXCA 1BI0A 3GNFB 4C8QG 2K3XA 4M77C 2X4XA 4O6JA 3S3MA 3PMIA 3CBMA 5GANf 2QQSA 1KQ2A 3LWIA 4WF2A 2RJCA 3JCMd 2KK4A 4C0DC 5GMKe 2GCXA 5FROA 4RG8A 4ZN3A 2PUKB 2DXCA 3CCRA 2VUBA 4JRKA 3NTKA 2O4XA 3F70A 4GLKA 4ELZC 2KMTA 3G71A 1YJ9A 1VQ8A 1OZ2A 2HBPA 5DLQE 5KCOA 3JB9J 1YJNT 5GAMd 2VV5A 3OW2S 5GAOm 1VQ6A 3I56T 3OSVA 4ME7A 2WSCE 3FLGA 1DJ7B 4M78G 2FYKA 2ZPFB 2G3RA 4C8QB 3UT1A 1RL2A 3A8MB 3MEVA 3EAEA 2D9TA 2FL7A 2QQBA 4QW2A 3I55A 1M1GA 3RKXA 3A8OB 1ZBXA 3GIBA 4TVRA 1VUBA 3L2VA 4X9CA 2RK1A 5CO7A 5LJ3j 1NJIC 3CC4T 4C92A 4HCCA 2VGNA 4EMKC 4N4GA 4C0ZA 2DTHA 5CQYA 1M4ZA 4M75G 4OB2B 4Z02A 1QVFS 1KD1U 1UGRB 2GFUA 4M7AC 2DO3A 2DTOA 1N27A 1IZ6A 3JB9H 1KHCA 1NPPA 1R8OB 3OYJA 4IUQA 1BIAA 5CAIA 1UGQB 4JLIA 3M53A 4IKFA 2XG8D 4N0AC 4XU0A 4XU1A 3E9FA 3QPHA 4OF1A 3L1AA 4OMFB 3T9NA 2K4YA 1I81A 1YJWA 2X35A 2ZPHB 4N4HA 3JCMg 5GAOn 2KVQG 5M9OA 2QI2A 2VXFA 3P8BB 5GAN7 1VQ9A 2K5IA 4B9WA 3C4SA 1M90C 3E19A 1VQOT 4R55A 1N6AA 3L2WA 5C0MA 5FU6B 5CIUA 4BDYA 2EQMA 3E9GA 4BE2A 4UC4A 2MAMA 3C12A 4FU6A 3HRUA 3SFMA 4EMHA 1W2BS 2CKKA 1X75C 4XTZA 3DB3A 5KE2A 1M5Q1 4M7DB 2ZGWA 3G4ST 3QZ9B 4XTVA 2PU9B 2XU8A 3CCVT 3JB9F 2Y90A 4M7AD 2XDPA 4FL6A 3A5ZB 2RI3A 1Q7YU 2P0PA 2L89A 2DIQA 3G7ZA 3OYFA 1U8RA 3NFCA 2XDDA 4O5VA 4E47A 3L2QA 3LW5E 2RA2A 5GAMj 3OA6A 5GMKm 2X4WA 3JCMb 2E12A 4XAXB 3JCMh 3X26B 5C6SA 3G6EA 2WSEE 3OYHA 4N0AA 3FJPA 1Q7YC 1PSFA 3HP9A 2E6NA 4PL6A 1G3WA 1KHIA 3RERA 4F7UA 4LDVA 2F5KA 3EFRA 4JJNK 4LDUA 2CS7A 4BD3A 4J6WA 4M77F 1LJOA 5LJ5j 3BDLA 2A3LA 2DXBA 1YHQA 4LDYA 2OTJA 2FHDA 4RMOA 4M77D 5GAN3 2EQJA 1P92A 3PT9A 1VQNA 3UDCA 3J80E 3G4SA 3CCVA 2OAUA 2LC4A 1YBYA 4C8QC 2WSFE 2M16A 3BDUA 3MO8A 5IN1A 3TCJA 4ZGEB 2JN0A 5KCHA 4XU2A 5GAOq 1BIBA 2CGHA 1AHJB 2YHTA 4M7AB 1VQMT 1VQ4A 3META 2PQWA 3C94A 4XTWA 4PKCC 2L5QA 4KT0E 4EPCA 1VQPA 2PVOB 4M78B 4QVCA 2Y4YA 1NE8A 2R58A 4EMKB 4A53A 1KQSA 4HCBA 2O01E 3JCMQ 4BE0A 1I5LA 3OBYA 3GOXA 5GMKh 5GAOp 4E7LA 4L59A 3FDRA 3URGA 1QVGS 2LQKA 4PNOA 1VQ5T 1WJRA 3BFMA 3JB9I 4IURA 2D6FA 2P4TA 3OYAA 2DD5A 3CPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQ3 A;  5GAN h;  3JB9 J;  5GAM d;  5GAN 5;  4JRI A;  4EMG A;  5GAO m;  1JBM A;  4M75 F;  4NL2 A;  4PJO F;  3JCM c;  4M75 C;  4F7U F;  4PJO C;  5GMK j;  4M77 G;  4M78 G;  3RUX A;  2DEQ A;  2FYK A;  2RM4 A;  2FB7 A;  3EFS A;  3QHS A;  4M78 F;  5LJ3 h;  3V7R A;  3V8K A;  4C8Q B;  4F7U G;  5LJ3 g;  1LOJ A;  3SWN A;  4C92 E;  5GAN d;  2QTX A;  1H64 1;  3RKX A;  2E1H A;  1MGQ A;  5LJ5 d;  3GIB A;  4X9C A;  5LJ3 j;  4C92 A;  4EMK C;  1HXD A;  5GAN 2;  2DTH A;  5GAN j;  1HK9 A;  5GAN 8;  4M75 G;  4PJO G;  4MML A;  2E41 A;  3QO3 A;  4HA8 A;  5GMK l;  3JB9 G;  5GAM e;  4J5Y A;  2DZC A;  4XTU A;  2DTO A;  4HT9 A;  4M7A C;  4M78 A;  4M7D G;  4F7U B;  3JB9 H;  4XTX A;  3L2Z A;  3V7C A;  1BIA A;  2I2L A;  5CAI A;  4JLI A;  2E10 A;  1X01 A;  4QVD A;  5DY9 A;  4XU0 A;  4N0A C;  4XU1 A;  3JCM e;  5GAO l;  1YCY A;  4C92 B;  5GAM f;  3L1A A;  5I21 A;  1M8V A;  3SWN C;  1I81 A;  4C8Q F;  4RCC A;  2DVE A;  3JCM g;  5LJ5 e;  2YLC A;  1U1S A;  5GAO n;  3QSU A;  2VXF A;  5GAN 7;  3PGG A;  2HNI A;  1B34 A;  4M75 A;  4PJO A;  3FIF A;  1Y96 B;  2EWN A;  4XTY A;  4M7A A;  4MMK A;  3JCM V;  4M75 E;  4PJO E;  4OP0 A;  2EJF A;  4X9D A;  4F7U E;  4M78 D;  3INZ A;  4EMH A;  5LJ5 f;  4M78 E;  4M7A E;  4J6Y A;  2DTI A;  3QUI A;  4XTZ A;  3V8L A;  1LNX A;  1M5Q 1;  4M7D B;  2ZGW A;  3JB9 D;  2RB6 A;  4XTV A;  3RKW A;  5GAN e;  5GMK i;  3JB9 F;  2Y90 A;  4M7A D;  5GAM g;  4C92 G;  4M7D E;  3JCM P;  3RES A;  1D3B A;  4M77 A;  5GAN 6;  2RA2 A;  4C8Q D;  3RKY A;  5GAM j;  5GMK m;  2DZ9 A;  3JCM b;  3JCM h;  2EAY A;  4DQ2 A;  4PJO D;  5LJ5 h;  4N0A A;  3FJP A;  4M75 B;  4PJO B;  2VXE A;  3JCM f;  5LJ5 g;  5LJ3 d;  3V8J A;  2EJ9 A;  1I4K 1;  4NOY A;  3HFO A;  4F7U A;  4C92 C;  3RER A;  4M7D C;  3V7S A;  1D3B B;  3EFR A;  4A54 A;  1N9S A;  4M78 C;  5GAO r;  1WQW A;  4J6W A;  4M77 F;  5GAO q;  1LJO A;  5LJ5 j;  2DXU A;  3JCM W;  4HT8 A;  4M7D A;  4C92 F;  4V2S A;  1TH7 A;  4M77 D;  5GAN 3;  2RD1 A;  5GAM h;  1WQ7 A;  4Y91 A;  4M77 B;  3HSB A;  1JRI A;  3M4G A;  4C92 D;  5GAN g;  4C8Q C;  4M77 E;  3BDU A;  2EJG A;  2DJZ A;  1KQ1 A;  4XU3 A;  1Y96 A;  2JN0 A;  2K57 A;  3FB9 A;  4XU2 A;  1BIB A;  2CGH A;  2YHT A;  2DXT A;  1N9R A;  3BW1 A;  4RCB A;  4M7A B;  3SB2 A;  3VU3 C;  4XTW A;  2E65 A;  4EMK A;  3JCM X;  4M7A G;  4M78 B;  4JUV A;  4QVC A;  4EMK B;  1WNL A;  4M75 D;  3AHU A;  4A53 A;  4M7D F;  4C8Q A;  3BY7 A;  2VC8 A;  4M7A F;  3HFN A;  3JCM Q;  5LJ3 e;  4NL3 A;  2E64 A;  1I5L A;  1U1T A;  3SWN B;  5GMK h;  4J6X A;  5GAO p;  4C8Q G;  3JCM J;  1I8F A;  4M77 C;  5LJ3 f;  3RIR A;  4C8Q E;  2DKG A;  5GAN f;  1KQ2 A;  4PNO A;  2YLB A;  4WF2 A;  3JCM d;  5GMK e;  3BFM A;  5GAN 4;  3JB9 I;  1WPY A;  1B34 B;  4M7D D;  4JRK A; 
#chains in the Genus database with same CATH topology
 4OGC A;  1RLP C;  4PJO F;  2D1X A;  4M75 C;  3GP8 A;  1M1F A;  3OYK A;  3OMG A;  2DF6 A;  2R5A A;  3UWN A;  2AKK A;  1KIK A;  2X51 A;  3CME Q;  7AT1 B;  2DRK A;  2OTL T;  2QQ9 A;  3CC7 A;  1WGS A;  4A4G A;  4MML A;  3G71 T;  2FPF A;  4HT9 A;  2RI2 A;  2HAX A;  1FMW A;  4ZGD B;  1QMC A;  2VAS A;  4J9C A;  4CRI A;  5KYU A;  3WVD B;  2YSQ A;  2F69 A;  1YIJ Q;  3PMT A;  1Y7X A;  1TSF A;  1K8A R;  4PJO A;  1MMD A;  2ENM A;  4M78 D;  2OTJ T;  5AYF A;  1YIT A;  1GBR A;  5A0D A;  1KC8 R;  1PM3 A;  4J6Y A;  1UJY A;  3VS1 A;  1FMV A;  1VQK T;  1LNX A;  3JB9 D;  5GMK i;  1YP5 A;  1D0X A;  4C8Q D;  4JJD A;  1ZUK A;  3NHN A;  4L5G A;  1TS9 A;  1ZHI A;  4OB1 B;  4M75 B;  3M0T A;  1QKW A;  4C92 C;  1K9M C;  3V7S A;  4BY6 C;  2YRV A;  4NS5 A;  1YWP A;  2O2O A;  2YUO A;  4JDS A;  4Y91 A;  1M90 U;  1WHL A;  2A37 A;  2NLU A;  2RQW A;  3H0H A;  1M1K U;  5FWB A;  1RAB B;  5CKF A;  3M0S A;  1YJW T;  2JJ9 A;  1OX8 A;  1VQL A;  2E5Q A;  3M59 A;  2H3J A;  4DBR A;  4WTO B;  1UFF A;  4Z89 A;  2CZ1 B;  2B86 A;  2FPE A;  3CMA A;  3CC2 A;  5CKB A;  3M5A A;  5LJ3 f;  3X20 B;  4LDX A;  1ZX6 A;  3OYN A;  2KE9 A;  1D0Y A;  3WXM B;  2DL4 A;  4PJL A;  1YN8 A;  2KAF A;  4LN2 A;  2GF7 A;  5GMK j;  2ED0 A;  4EDU A;  1T0J A;  3TSZ A;  2WAC A;  3VV0 A;  1ZSZ C;  2V8I A;  3EG9 A;  3VYG A;  3CCL Q;  4BI4 A;  1YJ9 T;  4J9I A;  1ZSG A;  3ASK A;  4FT4 A;  1UUE A;  3UAT A;  4OMM A;  4P5N A;  5J39 A;  1TU0 B;  3HHT B;  2D0Q B;  2MMP A;  4KUL A;  1GCQ A;  3CCJ Q;  2GBQ A;  2ZCF B;  4B9X A;  2KXC A;  3QSU A;  2K3Y A;  3PGG A;  3TEE A;  2HNI A;  3CCE Q;  4DOV A;  1Y96 B;  3M4Y A;  4XTY A;  4F14 A;  1QCF A;  1WHM A;  4ELY C;  1B7T A;  1G3S A;  4AG1 C;  3CCU T;  4ANJ A;  2M0O A;  2GQI A;  1AOJ A;  3CCM T;  4A4F A;  2LT4 A;  1VOM A;  1OOT A;  2QA4 T;  3CD6 A;  2FEI A;  3M58 A;  3OMC A;  2F5T X;  4IUV A;  2Z0W A;  2VXE A;  1PG5 B;  3HFO A;  3NMZ C;  1S1N A;  3QKJ A;  4AMC A;  4C92 F;  4MZT A;  2COW A;  5IHI A;  3OYC A;  1ZSZ B;  4OB3 B;  2BUD A;  1KQ1 A;  4K11 A;  1Z9Q A;  4Y92 A;  1RAI B;  1HYO A;  1QCN A;  1IO6 A;  4JUV A;  2AHJ B;  3I9Q A;  2HQE A;  2QK0 A;  3IQL A;  2LX9 A;  1I1J A;  2E4H A;  4RTV A;  3QG1 A;  4C8Q E;  1YI2 T;  4R0K A;  2DKG A;  3LLR A;  5KYN A;  3CPF A;  3MEA A;  4M7D D;  3LX7 A;  5CCA A;  3MP6 A;  5IXF A;  1O9S A;  2EFI A;  4EMG A;  1K4U S;  1JBM A;  4M75 F;  1H3H A;  2NUT A;  2QG9 B;  3EFS A;  1WJQ A;  4E7J A;  4C92 E;  4OMP A;  2CP0 A;  4A4K A;  1E6H A;  1M8M A;  2XI9 A;  1K73 C;  2OTL Q;  2HZY A;  2X4Y A;  1B3Q A;  5D6W A;  2BE7 D;  2YRC A;  3CC2 Q;  2QGF B;  4AG2 C;  2J06 A;  1LCK A;  1UB4 A;  3CCL A;  2LZ6 B;  2ROT A;  1PRM C;  3ZBD A;  1VQ8 Q;  1U1S A;  1BYM A;  4M75 A;  3FIF A;  2EWN A;  4QKU A;  3I56 Q;  4M4Z A;  3FRN A;  2KSS A;  2EVR A;  3INZ A;  4D6W A;  4KGX B;  5D6X A;  1NM7 A;  3CCQ Q;  3RKW A;  2EQU A;  4OMO A;  2CUB A;  2QDL A;  3A8H B;  3MEU A;  3EH1 A;  5CKD A;  1Q86 U;  4J7I A;  4JZ3 A;  2EKO A;  2KBT A;  2LTO A;  1UEB A;  3CXC P;  3DLL A;  3G4S Q;  4DBQ A;  3CCV Q;  1WJS A;  4E7Z A;  4HCK A;  3ZL7 C;  3VS4 A;  2RI5 A;  2F1L A;  1GBQ A;  4R56 A;  3REB B;  4JS4 A;  4RTU A;  1R0C B;  1MUZ A;  1JRI A;  1VQK A;  3CCS Q;  4M77 E;  4X1V A;  4M7A E;  5FLX E;  2K57 A;  1TUC A;  3TQ7 P;  2FRW A;  3LWH A;  3VS3 A;  2Y4X A;  2DMO A;  3J81 E;  3M55 A;  1QWF A;  4CC4 B;  2VC8 A;  2C0I A;  2XHC A;  5FU7 C;  3CC7 Q;  3SWN B;  5A2Q E;  1M30 A;  4IUP A;  4M77 C;  2X4X A;  2QEX Q;  1KQ2 A;  2QQS A;  4C0D C;  3EGX A;  2DXC A;  2PUK B;  4J9D A;  4GLK A;  2O4X A;  4ELZ C;  3G71 A;  1OZ2 A;  2HBP A;  1YHQ Q;  1ABQ A;  1NYG A;  1M3C A;  2L0A A;  3I56 T;  4JZ4 A;  2WSC E;  2VVK A;  2AK5 A;  2DL8 A;  2G3R A;  4C8Q B;  2FL7 A;  1I5O B;  4HVV A;  2J6O A;  3RKX A;  3I55 A;  3A8O B;  1VQP Q;  1VUB A;  5CO7 A;  4HCC A;  1M4Z A;  3VRZ A;  1SEM A;  2DTO A;  3JB9 H;  3OYJ A;  2W0Z A;  4XU0 A;  1U06 A;  3E9F A;  4OMF B;  3L1A A;  3T9N A;  1QVF P;  2ZPH B;  2VXF A;  1VQ9 A;  2K5I A;  3C4S A;  1M90 C;  3E19 A;  2MYS A;  1N6A A;  2KR3 A;  1U3O A;  4BE2 A;  3C12 A;  3HRU A;  1X75 C;  2JM9 A;  4XTV A;  2PU9 B;  4M7A D;  1PCX A;  1AWJ A;  3G7Z A;  3LW5 E;  2RA2 A;  2XMF A;  3OA6 A;  2CRE A;  4QT7 A;  3G6E A;  5C6S A;  2WSE E;  2E6N A;  4LDV A;  2F5K A;  3EFR A;  2E3H A;  4LDU A;  4M77 F;  3BDL A;  1YHQ A;  2KEA A;  2OAU A;  4C8Q C;  3MO8 A;  4ZGE B;  4E6R A;  2QAS A;  2PQW A;  4XTW A;  1LPL A;  3NGP A;  1QCO A;  2HSE B;  4M78 B;  4QVC A;  2Y4Y A;  2O01 E;  1I5L A;  3GOX A;  1OUL A;  2DBK A;  2E3I A;  3FDR A;  2JXB A;  2KRN A;  3PVQ A;  1WJR A;  3OYA A;  2DD5 A;  5IXB A;  1XOV A;  2KYB A;  2CDT A;  1X2Q A;  4XQ3 A;  1GXI E;  1NJI U;  3CC4 A;  4FCY A;  1UGV A;  3PE0 A;  3RUX A;  4CC3 A;  2K3B A;  3QJ6 A;  3I55 T;  3CEY A;  2KT1 A;  1Q82 C;  4IIO A;  1Q95 G;  4OMN A;  1MGQ A;  2RO0 A;  2BIV A;  3CPW S;  1AZE A;  3QO3 A;  5CKH A;  5GMK l;  5GAM e;  1KSW A;  2HCK A;  3EG0 A;  4F7U B;  4RTT A;  1AWX A;  2P0Q A;  3JRZ A;  1M8V A;  5GAM f;  2QEX T;  4C5E A;  4RCC A;  2OJ2 A;  1VQ6 Q;  1BI2 A;  3MJX A;  2RH2 A;  1M2V B;  2DJQ A;  2DVJ A;  3I35 A;  2EBP A;  3P8D A;  2L2P A;  1VQN T;  4M75 E;  1Z9Z A;  4KH1 B;  4QVZ A;  3I55 Q;  3QUI A;  1B07 A;  3WVE B;  2C0O A;  2YWW A;  1YIJ T;  2EYX A;  1VQ9 Q;  3RES A;  2YXY A;  4C5I A;  3OYE A;  1OX9 A;  3G6E T;  2RMO A;  4E2F B;  1N5Z A;  3QBY A;  1N8R U;  2JNG A;  3M0U A;  1FXX A;  4J9F A;  2EJ9 A;  3OBW A;  4A54 A;  1OYX A;  2DYI A;  4KH0 B;  2PVD B;  3OYD A;  4E7S A;  2RN8 A;  4M7D A;  2L3Q A;  2XID A;  2KY9 A;  2RD1 A;  3NPF A;  1W2B A;  5GAM h;  3OW2 P;  3VS2 A;  2OAW A;  1NEG A;  4JLG A;  4RKU E;  1CKA A;  3CCJ T;  3MEW A;  1S72 Q;  4MDW A;  1A0N B;  4M7A G;  4II1 A;  1PWT A;  2PVG B;  1Q81 R;  1U1T A;  3DLM A;  4BDZ A;  3UPU A;  3GF5 A;  1XTD A;  1ZSZ A;  1IRX A;  4JS5 A;  3PTA A;  4PJN A;  1UEC A;  3AT1 B;  1C6V X;  4QQG A;  1Y0M A;  2PZ1 A;  4MZM A;  5GAN h;  5GAN 5;  2DEQ A;  2DBM A;  3OYY A;  4M78 F;  5LJ3 h;  3E2U A;  2LNV A;  4RG2 A;  1YJN A;  5DM7 R;  2KYM A;  3LH0 A;  4OGE A;  3VUZ A;  2V8J A;  3TVT A;  2GQV A;  4OML A;  5GAN 8;  4FT2 A;  4OMQ A;  2P84 A;  1NPR A;  2YDL A;  5CKE A;  4LD9 K;  2IPO B;  3HL8 A;  3ME9 A;  4XTX A;  1YI2 A;  2ZPI B;  1KQS S;  4FW1 A;  2L8D A;  5D7U A;  3OY9 A;  1JXM A;  4M7A A;  2EJF A;  4PK4 A;  1AEY A;  1ARK A;  2GTJ A;  3CCS A;  1WDX A;  2RHI A;  1HD3 A;  4C92 G;  2LQ8 A;  2YT6 A;  5HCK A;  1YHQ T;  1GRI A;  2O9S A;  1WI7 A;  3PNW C;  1AWW A;  3UF4 A;  5LJ5 h;  3H0I A;  1QVG P;  3DB4 A;  3JCM f;  2V1Q A;  2XKO C;  4LUD A;  1MV0 B;  2RQU A;  3GLX A;  2MOX A;  1VQ7 A;  2DXU A;  3JCM W;  2QA4 Q;  2JS0 A;  2KT8 A;  2CT4 A;  4C5G A;  3H6Z A;  4XK8 E;  3BW1 A;  4L6V 5;  3CCU Q;  1Q81 C;  3G71 Q;  1T3L A;  1V76 A;  2E64 A;  3CCE T;  3CPW P;  1RUW A;  3Q1J A;  3JCM J;  3QZ5 B;  4BI3 A;  4B6M A;  1VQL Q;  2QQR A;  5FRN A;  5GJV B;  3L2U A;  2PTK A;  1VA7 A;  1Q82 U;  4LE9 A;  1KC8 C;  2QXF A;  4NL2 A;  1JJ2 A;  1Y57 A;  3L42 A;  1JU5 C;  5J26 A;  3QHS A;  5GAN d;  1WIE A;  4KUD K;  1JO8 A;  1YJ9 Q;  2E1H A;  1TOV A;  1UG1 A;  3R6O A;  1HXD A;  5GAN 2;  3OB9 A;  1KC8 U;  5I2M A;  3QDR B;  2DZC A;  2RQV A;  4M78 A;  1K8A C;  4ZGJ B;  2MPX C;  2DK3 A;  5A0L A;  2LCC A;  4C5H A;  3M57 A;  2FZG B;  1VQ4 T;  1I07 A;  2LNH B;  3CC2 T;  2DL3 A;  3CBO A;  2IIM A;  1RI0 A;  3JCM V;  4PJO E;  2CH4 W;  1KK7 A;  2HBW A;  1SRM A;  2O9V A;  2CZ7 B;  2E6Z A;  2X3X D;  3A8L B;  1VQ7 T;  1X27 A;  2HEQ A;  2CP6 A;  2K5F A;  5KYX B;  4JRQ A;  4PFO A;  5KH6 A;  2DIG A;  1V29 B;  5HK0 A;  2EAY A;  1VYU A;  2YRD A;  3CCM A;  5LJ3 d;  2DET A;  2H3E B;  2L3R A;  1N9S A;  2D8H A;  1Q86 C;  1WQW A;  3X24 B;  3CCU A;  1KD1 R;  1RLQ C;  1PD1 A;  2MI6 A;  2FVU A;  3OS5 A;  4OVA A;  1NYF A;  2YUN A;  5GAN g;  2AIR B;  1JXO A;  3ZFJ A;  2EJG A;  1O75 A;  3RMS A;  1YIT T;  1R77 A;  2E65 A;  3VYH B;  1UTI A;  4CI0 C;  3JSC A;  3HFN A;  5LJ3 e;  1ZQ1 A;  4FSS A;  4C0D B;  3CXC A;  2DAQ A;  3GNF B;  5FW9 A;  2VB6 A;  3LWI A;  4WF2 A;  3JCM d;  1BCO A;  5GMK e;  4RTZ A;  1PC0 A;  1WHJ A;  4RG8 A;  1CSK A;  1YJ9 A;  2KMT A;  5DLQ E;  3JB9 J;  1YJN T;  5GAM d;  3OW2 S;  2COZ A;  1KJW A;  1PHT A;  3M0R A;  2FYK A;  3UT1 A;  1RL2 A;  1Q86 R;  4Z88 A;  3EAE A;  2D9T A;  2QQB A;  1M1G A;  1C0M A;  4RTX A;  1ZBX A;  3GIB A;  5LJ3 j;  1NJI C;  1RAC B;  2HSP A;  4DBH A;  3EFO A;  2D0N A;  4JJC A;  1QVF S;  4M7A C;  4GLM A;  1BIA A;  1YIT Q;  2XG8 D;  4N0A C;  3QPH A;  2HKQ B;  2K4Y A;  2MCN A;  5M9O A;  5GAN 7;  2NUP B;  5C0M A;  1QQJ A;  5GJW B;  3R6N A;  2DA9 A;  4FU6 A;  1X6B A;  4EMH A;  2CKK A;  2DE0 X;  4XTZ A;  2DM1 A;  3DB3 A;  1N8R R;  3QZ9 B;  3JB9 F;  2XU8 A;  4FL6 A;  2LX7 A;  3A5Z B;  1Q7Y U;  4D8D A;  1SF9 A;  3KFV A;  1AZG B;  3L2Q A;  2ECZ A;  5GAM j;  5GMK m;  1G83 A;  2X4W A;  3X26 B;  2J6K A;  2FPD A;  2CP5 A;  3FJP A;  1Q7Y C;  2EPD A;  3RER A;  2EYY A;  2DER A;  4J9B A;  4BD3 A;  4F16 A;  2NYS A;  2OTJ A;  1P92 A;  1VQN A;  3O5Z A;  3UA6 A;  2LC4 A;  2WSF E;  5IN1 A;  5KCH A;  4XU2 A;  5GAO q;  1BIB A;  2YHT A;  1AHJ B;  1VQ4 A;  1WZO A;  1D1C A;  2L5Q A;  2PVO B;  3MKD A;  4EMK B;  1NE8 A;  2R58 A;  1IGQ A;  4A53 A;  4HCB A;  3HTR A;  4BE0 A;  3OBY A;  2OI3 A;  4L59 A;  1QVG S;  2LQK A;  2SRC A;  1TTH B;  1TUD A;  3BFM A;  1BU1 A;  2F2X A;  2P4T A;  2ESW A;  3A8G B;  4JRI A;  3EGU A;  4F7U F;  2R5M A;  1VQK Q;  1MMG A;  1OU9 A;  2BKD N;  2KGT A;  3HRS A;  2JS2 A;  2ZPB B;  2X4J A;  2O88 A;  3LYI A;  2F2W A;  1MND A;  2LVM A;  3LH5 A;  1FYN A;  1HK9 A;  2DIL A;  1WXB A;  2LCL A;  2GNC A;  2ZZD A;  1SSH A;  3M56 A;  2HD0 A;  4M7D G;  8AT1 B;  2E10 A;  4IUT A;  5DY9 A;  3X25 B;  1QKX A;  3VS0 A;  2EIF A;  4EIK A;  4FYW B;  1RAA B;  3OQ5 A;  1B34 A;  1WX6 A;  8ATC B;  1YFN A;  1ACM B;  4LDW A;  4X9D A;  4F7U E;  4OB0 B;  3CD6 Q;  3CCJ A;  1QVP A;  1K73 R;  3OS1 A;  2JVV A;  2RB6 A;  2CUD A;  3A1P A;  1T0H A;  1MMA A;  2KRS A;  5J3B A;  2IVW A;  2K7A A;  2ROL A;  1X6O A;  2O4X B;  4DQ2 A;  1UJ0 A;  2DEU A;  3VS5 A;  1ABO A;  5LJ5 g;  4NOY A;  1D09 B;  1MMN A;  2RQR A;  2EGA A;  4FYY B;  4V2S A;  3EHQ A;  3PIO A;  4HXJ A;  1GCQ C;  1UGS B;  4J9H A;  5FU6 C;  2JTF A;  4C92 D;  1W1F A;  5CVI A;  5A0G A;  1M3B A;  4FIB A;  1N9R A;  3VU3 C;  4RUG A;  3JCM X;  2LCS A;  1ZLM A;  2OX7 A;  2E5K A;  4NL3 A;  3VUB A;  1K8A U;  3G6E Q;  5CR2 A;  3RIR A;  1VQ4 Q;  3HKS A;  2LP5 A;  4PJJ A;  1JB0 E;  2OTL A;  1VQN Q;  4FSX A;  3MP1 A;  2ZPE B;  2X3W D;  1TG0 A;  2EGE A;  3V8K A;  3I56 A;  2CT3 A;  3CQT A;  2MK5 A;  1VQ6 T;  3E1S A;  1NEB A;  2PNI A;  4ORZ A;  4QQD A;  3S3O A;  4C0G A;  2FZK B;  5LJ5 d;  2P4R A;  3QII A;  1BI1 A;  3KXT A;  4YTL A;  2CZ0 B;  4Y28 E;  3EGX B;  4PJO G;  3MHX A;  2MIO A;  1AD5 A;  2EGC A;  3NTI A;  2P0K A;  2M9U A;  3QWX X;  1FX7 A;  1D1B A;  1X01 A;  5GAO l;  3C95 A;  4C92 B;  2YLC A;  4GY5 A;  2KI7 A;  4JRP A;  3JAM E;  5IT9 E;  1X43 A;  1IRE B;  3VKI A;  2EYW A;  1GCP A;  5LJ5 f;  4DBF A;  5KYU B;  2DTI A;  3V8L A;  2O31 A;  1Y71 A;  2CH4 A;  3CCM Q;  1H8K A;  3EGD A;  3JCM P;  3DKM A;  5FU7 B;  3VJP A;  1OI1 A;  1T3S A;  3EG9 B;  2LDM A;  5LL6 S;  2DZ9 A;  2JTE A;  4CC2 A;  2MWP A;  1U5S A;  2EYZ A;  1YIJ A;  3MCA B;  1H3Z A;  2CYZ B;  2K2M A;  2CP7 A;  1G2B A;  1WQ7 A;  3TU4 K;  1Q7Y R;  1GFC A;  2LMJ A;  2M1H A;  2DXT A;  2C06 A;  2QAZ A;  1OZ3 A;  1Y07 A;  3MP8 A;  1WNL A;  3OYM A;  4M7A F;  1M2O A;  2FO0 A;  3CCL T;  2DFU A;  1UGP B;  2R57 A;  4IUU A;  5FRM A;  1I8F A;  1UDL A;  2AT1 B;  1K9M U;  1QVF A;  3S3N A;  1BI3 A;  3QYG B;  3FEO A;  2CSQ A;  1W70 A;  1FMK A;  3N5B B;  1VIE A;  1XJW B;  1ZUY A;  1GFD A;  3JCM c;  2QYZ A;  2RJD A;  3CBP A;  5D6Y A;  1XNI A;  3V7R A;  1QP3 A;  2QTX A;  1W2B P;  3M9Q A;  1H64 1;  3OW2 A;  1V1C A;  1YWO A;  4E7K A;  4KBM B;  2JOY A;  4A63 B;  5GAN j;  3KBG A;  1OEB A;  3TRE A;  3JB9 G;  5L8R E;  4PLI A;  1NZ9 A;  4J5Y A;  3SDZ A;  2ATC B;  2KNB B;  1X2K A;  2AZS A;  2KRO A;  1JEG A;  3MPU B;  1LVK A;  3SWN C;  3X28 B;  2X9H A;  3CCQ T;  2MWO A;  2VGM A;  2DVE A;  2IG0 A;  4DEX A;  1M1K C;  1RI9 A;  2VYT A;  4HVU A;  5I22 A;  2SEM A;  1BB9 A;  2RQT A;  2B8A A;  2JTM A;  2KXD A;  1SPK A;  5GAN e;  3QXE B;  2XK0 A;  3P8H A;  3OYI A;  2COY A;  1BCM A;  3HPW A;  2QA4 A;  3CD6 T;  2OTJ Q;  3M0P A;  2A7Y A;  1G5V A;  1IHV A;  2F2V A;  1VIF A;  3V8J A;  4DEY A;  4M7D C;  3QJY A;  3GBQ A;  1HJD A;  4J9E A;  3GNG A;  1JQQ A;  4WCI A;  2J7I A;  2DYB A;  1WYX A;  3EHR A;  1AWO A;  1UE9 A;  2HQX A;  1VQ9 T;  1CKB A;  4AFQ C;  4FM4 B;  1K0S A;  3SB2 A;  2JMA A;  3CME A;  4BI8 B;  3M54 A;  4PJO D;  4DA4 A;  2DX1 A;  4VUB A;  2VKN A;  1BI0 A;  2BZX A;  1OV3 A;  4O6J A;  3PMI A;  2D8J A;  3CBM A;  1PRL C;  2FZC B;  2GCX A;  5FRO A;  4ZN3 A;  2FRY A;  2VUB A;  3NTK A;  2JM8 A;  4JJB A;  4FYV B;  1VQ8 A;  1E6G A;  3OSV A;  5ECA A;  1DJ7 B;  2ZPF B;  4LUE A;  3A8M B;  1GL5 A;  4QW2 A;  1TXQ A;  3L2V A;  1BK2 A;  4C92 A;  4C0Z A;  2DTH A;  2NWM A;  4M75 G;  4OB2 B;  2BZ8 A;  1KD1 U;  1UGR B;  2DO3 A;  1AT1 B;  1KHC A;  5CAI A;  1UGQ B;  3D7S B;  3THK A;  3M53 A;  1ZUU A;  1PKS A;  4XU1 A;  1YJW A;  1BBZ A;  5GAO n;  3EGD B;  2QI2 A;  3P8B B;  2J6F A;  4B9W A;  4AFZ C;  2HL3 A;  3L2W A;  2HMA A;  5CIU A;  4BDY A;  3E9G A;  4UC4 A;  5FWC A;  1SRL A;  2MAM A;  4RTY A;  4M7D B;  3G4S T;  3CCV T;  1RAH B;  1VYT A;  2RI3 A;  2DIQ A;  2QGG A;  1VYV A;  2E12 A;  1M2V A;  2EW3 A;  4XAX B;  3JCM h;  3OYH A;  1TUG B;  2NUP A;  4N0A A;  1PSF A;  3HP9 A;  4PL6 A;  2CS7 A;  1LJO A;  1M3A A;  2DXB A;  3EG3 A;  4RMO A;  2CP2 A;  5GAN 3;  2EQJ A;  3G4S A;  3CCV A;  3H0F A;  2M16 A;  3BDU A;  2CGH A;  3MET A;  3C94 A;  2W10 A;  4PKC C;  4KT0 E;  1VQP A;  3C0C A;  1KQS A;  1KFZ A;  3JCM Q;  5GMK h;  4E7L A;  3U23 A;  3URG A;  1EFN A;  1RAF B;  1F1B B;  1WXU A;  2DNU A;  2EQI A;  2M0Y A;  2QTV A;  1M27 C;  1KG1 A;  2NUT B;  1K73 U;  1M1K R;  3H8Z A;  2EKH A;  1G3Y A;  4F7U G;  5LJ3 g;  1LOJ A;  3SWN A;  3PIP A;  2DL7 A;  2EYQ A;  3OS0 A;  1YI2 Q;  1RAD B;  1VQ5 A;  2LJ3 A;  4KUI A;  2LJ1 A;  4FYX B;  3VS6 A;  3CCE A;  3L2Z A;  2K79 A;  3V7C A;  5HK3 A;  1QVG A;  2NUZ A;  2AKL A;  3JCM e;  3QYH B;  1IHW A;  1WHH A;  1VQM A;  5LJ5 e;  4D8K A;  2RHX A;  1OPL A;  4MMK A;  4OP0 A;  1VQL T;  4MDX A;  2DPP B;  4N4I A;  2XIC A;  5GAM g;  3VS7 A;  2RHY A;  1N8R C;  3J7A F;  2ZPG B;  4DOW A;  1VQ7 Q;  4PFP A;  3RKY A;  2C0T A;  1SHF A;  4PJM A;  5I2S A;  1W6X A;  1K76 A;  4J8O A;  1M9S A;  2DD4 A;  1I4K 1;  1YJW Q;  2CP3 A;  1X6G A;  4M78 C;  3OS2 A;  3REA B;  2K9G A;  4IIM A;  2FG0 A;  5EC7 A;  2EQK A;  1PNJ A;  2DJZ A;  4XU3 A;  1EIF A;  1JJ2 P;  1K0X A;  2LRQ A;  1ZA2 B;  4M75 D;  4C8Q A;  2E70 A;  3S6W A;  2KQW A;  1QP2 A;  5KYY A;  2GTO A;  5CK9 A;  1WLP B;  2XDB A;  1FWZ A;  3PFS A;  2YLB A;  5GAN 4;  4J83 A;  3QDF A;  3CC7 T;  2GGR A;  3OYG A;  2V1R A;  2G6F X;  1EX4 A;  3SEM A;  3L2R A;  2RM4 A;  2FB7 A;  1K9A A;  3G1J A;  2H8H A;  4HCZ A;  5DLO A;  1K9M R;  3KUF A;  1MNE A;  1SKU B;  4BAC A;  1I0C A;  2HL5 C;  1KQS P;  4XTU A;  6AT1 B;  3FC3 A;  3CMA T;  5EG2 A;  2A28 A;  3CXC S;  2LQN A;  1KD1 C;  3FJ5 A;  3CME T;  5CQX A;  4PLL A;  1YCY A;  3LGL A;  1WHG A;  4QQ6 A;  4C0F A;  2ZAE A;  4AFS C;  5KYX A;  5KYW B;  1SSF A;  1VQP T;  2RJF A;  1C1A A;  1YCS B;  4M78 E;  2M02 A;  5IAY A;  2AZV A;  4M7D E;  2I0N A;  1D3B A;  4M77 A;  1NLP C;  1H92 A;  1NG2 A;  4ATO A;  4ZNX A;  4LNP A;  5IH2 A;  2PUO B;  1QLY A;  3H41 A;  1PSE A;  1VQM Q;  4A4E A;  2RHU A;  9ATC B;  4HT8 A;  4A4H A;  1EZZ B;  1TH7 A;  4MZP A;  3CMA Q;  1XQH A;  4BE1 A;  4M77 B;  3HSB A;  2DL5 A;  3M4G A;  1Q81 U;  3HRT A;  3CCS T;  1YJN Q;  3CCQ A;  2K2V A;  2QEX A;  4RCB A;  2GFA A;  5HKC A;  1D0Z A;  4Q5W A;  4GBQ A;  4BY6 B;  3ZEH A;  1W4S A;  4M7D F;  3BY7 A;  2V8K A;  1WFW A;  4J7F A;  4J6X A;  4LD6 A;  3NTH A;  2CSI A;  3RDV A;  1UHC A;  1S72 A;  3O8V A;  3VRY A;  1WPY A;  2DLP A;  1B34 B;  1QW1 A;  1MHN A;  2KDS A;  4X34 A;  2M51 A;  1SHG A;  5HY6 A;  3OYB A;  4PJO C;  4M77 G;  5I11 A;  2DRM A;  2JZ2 A;  5I21 A;  4ZTF A;  3OYL A;  1MV3 A;  2JW4 A;  2KRM A;  1JJ2 S;  1IB8 A;  4BB7 A;  1D1A A;  3H9N A;  5KE3 A;  3GPL A;  1S72 T;  3EFO B;  4E7H A;  4KGV B;  2E41 A;  4HA8 A;  1VQ8 T;  5L23 A;  3CCR T;  1G3T A;  2I2L A;  2YUQ A;  4QVD A;  2RHZ A;  3ER0 A;  4HKE A;  4C8Q F;  1M90 R;  1IGU A;  2CZ6 B;  1X69 A;  1BKB A;  2XD0 A;  3LGF A;  1QWE A;  2RPN A;  3UA7 A;  4JPB W;  2MF2 A;  4BUG A;  2LT1 A;  2LJ0 A;  5GAN 6;  2QDY B;  4ZN1 A;  2RJE A;  2QQA A;  2RK2 A;  2YUP A;  4ZTJ A;  1RAE B;  2ED1 A;  5IHN A;  2A0F B;  4J9G A;  4PJO B;  3SHW A;  2J05 A;  3SD4 A;  3M0Q A;  1D3B B;  2LQW A;  5GAO r;  5KYY B;  3OSS C;  3PVL A;  2RNA A;  4CC7 A;  1VQO A;  3RMQ A;  3BE3 A;  1E7O A;  1TWB A;  1Y96 A;  3FB9 A;  5KYW A;  1HSQ A;  4EMK A;  3ULR B;  3AHU A;  4E7I A;  4KGZ B;  2JUF A;  1Q82 R;  1UHF A;  2K5L A;  4C8Q G;  2K3X A;  3CC4 Q;  4F04 B;  2L3P A;  3S3M A;  5GAN f;  1IXD A;  4Z8A A;  2VWF A;  2RJC A;  3RBB B;  2KK4 A;  1YNZ A;  5AT1 B;  3CCR A;  3EH2 A;  4JRK A;  4ESR A;  3F70 A;  5KCO A;  1VQ6 A;  2VV5 A;  5GAO m;  1NLO C;  4HVW A;  4ME7 A;  3I5S A;  3FLG A;  4M78 G;  3TSW A;  1R0B G;  1ZA1 B;  3MEV A;  1OPK A;  2JMC A;  1OU8 A;  2BZY A;  4TVR A;  4X9C A;  2RK1 A;  3CC4 T;  2VGN A;  4EMK C;  4N4G A;  4LXC A;  4KRT A;  4F17 A;  3QWY A;  5CQY A;  1WXT A;  3RNJ A;  1WA7 A;  1AVZ C;  1SG5 A;  4Z02 A;  2GFU A;  1IZ6 A;  1N27 A;  1PKT A;  1NPP A;  1R8O B;  4PFZ A;  2HDA A;  4IUQ A;  4JLI A;  2HKN A;  4IKF A;  2A08 A;  1VQ5 Q;  4OF1 A;  1I81 A;  2X35 A;  4N4H A;  3RR6 A;  3JCM g;  2KVQ G;  3EG2 A;  4AFU C;  2V26 A;  3EG1 A;  1VQO T;  4R55 A;  2BTT A;  1ZBJ A;  5FU6 B;  1J3T A;  2EQM A;  4RTW A;  3SFM A;  1W2B S;  5KE2 A;  1M5Q 1;  2ZGW A;  4FW2 A;  2Y90 A;  2XDP A;  2HQH A;  2P0P A;  2L89 A;  3OYF A;  1U8R A;  3NFC A;  2XDD A;  4O5V A;  4E47 A;  1WHK A;  2L3S A;  3JCM b;  2JT4 A;  3A98 A;  3I5R A;  2A36 A;  1G3W A;  1OQK A;  1KHI A;  2K6D A;  4F7U A;  1PD0 A;  4JJN K;  4J6W A;  1K1Z A;  5LJ5 j;  2A3L A;  4LDY A;  2FHD A;  4M77 D;  3PT9 A;  1RAG B;  3UDC A;  3J80 E;  1YBY A;  3TCJ A;  2JN0 A;  1NJI R;  1VQM T;  4M7A B;  4EPC A;  5IHK A;  2ABL A;  3CCR Q;  1G8X A;  1VQO Q;  1NBE B;  5GAO p;  4PNO A;  1VQ5 T;  4AT1 B;  3JB9 I;  2RF0 A;  4IUR A;  2D6F A;  3JV3 A;  2BE9 B;  3CPW A; 
#chains in the Genus database with same CATH homology
 1XOV A;  3A8G B;  4OGC A;  4XQ3 A;  1KG1 A;  1GXI E;  4JRI A;  4PJO F;  1NJI U;  3CC4 A;  4M75 C;  4F7U F;  1K73 U;  2R5M A;  3GP8 A;  3RUX A;  3QJ6 A;  1M1F A;  3H8Z A;  1G3Y A;  3OYK A;  4F7U G;  3I55 T;  2BKD N;  3OMG A;  1LOJ A;  3SWN A;  3CEY A;  3HRS A;  5LJ3 g;  3PIP A;  1Q82 C;  2R5A A;  2ZPB B;  3UWN A;  2X4J A;  2EYQ A;  3LYI A;  3OS0 A;  1MGQ A;  2RO0 A;  2LVM A;  2BIV A;  3CPW S;  1VQ5 A;  2OTL T;  1HK9 A;  2QQ9 A;  3CC7 A;  1WGS A;  4A4G A;  4MML A;  3QO3 A;  5CKH A;  5GMK l;  2LCL A;  4KUI A;  5GAM e;  3G71 T;  2ZZD A;  3M56 A;  4HT9 A;  2HD0 A;  3CCE A;  4M7D G;  4F7U B;  2RI2 A;  3L2Z A;  1QVG A;  3V7C A;  5HK3 A;  2HAX A;  4ZGD B;  2E10 A;  2P0Q A;  3JRZ A;  4IUT A;  5DY9 A;  3X25 B;  3QYH B;  4CRI A;  3JCM e;  1M8V A;  5GAM f;  3WVD B;  2QEX T;  2F69 A;  4C5E A;  4RCC A;  1VQM A;  2EIF A;  3PMT A;  5LJ5 e;  1BI2 A;  2RH2 A;  1Y7X A;  3OQ5 A;  3P8D A;  2RHX A;  1B34 A;  4PJO A;  4MMK A;  1VQN T;  4M75 E;  4OP0 A;  4LDW A;  4X9D A;  1VQL T;  4F7U E;  4M78 D;  4OB0 B;  4MDX A;  5AYF A;  1YIT A;  2OTJ T;  3CCJ A;  5A0D A;  2DPP B;  4QVZ A;  4N4I A;  1QVP A;  4J6Y A;  3QUI A;  3OS1 A;  1VQK T;  3WVE B;  2JVV A;  1YIJ T;  1LNX A;  2XIC A;  3JB9 D;  2RB6 A;  5GMK i;  5GAM g;  3RES A;  2RHY A;  4C5I A;  1N8R C;  3J7A F;  3OYE A;  2ZPG B;  3G6E T;  4DOW A;  5J3B A;  4C8Q D;  2IVW A;  3RKY A;  5I2S A;  4L5G A;  1X6O A;  2O4X B;  4DQ2 A;  1ZHI A;  1N8R U;  3QBY A;  4J8O A;  4OB1 B;  4M75 B;  2JNG A;  1M9S A;  2DD4 A;  5LJ5 g;  1FXX A;  2EJ9 A;  3OBW A;  1I4K 1;  4NOY A;  4C92 C;  1K9M C;  3V7S A;  4BY6 C;  4A54 A;  1OYX A;  4M78 C;  2YRV A;  3OS2 A;  2PVD B;  3OYD A;  4NS5 A;  4M7D A;  4V2S A;  2XID A;  3PIO A;  2KY9 A;  2RD1 A;  4JDS A;  1W2B A;  1UGS B;  5GAM h;  5FU6 C;  4Y91 A;  1M90 U;  2EQK A;  2NLU A;  1M1K U;  2JTF A;  4C92 D;  4XU3 A;  2DJZ A;  4JLG A;  4RKU E;  5CKF A;  1EIF A;  5CVI A;  3CCJ T;  3MEW A;  5A0G A;  1YJW T;  4FIB A;  1N9R A;  1VQL A;  2E5Q A;  3M59 A;  2H3J A;  3VU3 C;  4MDW A;  3JCM X;  4M7A G;  2LRQ A;  4M75 D;  4II1 A;  4C8Q A;  2CZ1 B;  2E70 A;  3CMA A;  4NL3 A;  2PVG B;  3CC2 A;  1U1T A;  3DLM A;  3S6W A;  2KQW A;  3VUB A;  4BDZ A;  1K8A U;  3UPU A;  3GF5 A;  1XTD A;  1QP2 A;  5CKB A;  5CR2 A;  3M5A A;  5CK9 A;  5LJ3 f;  3RIR A;  2XDB A;  1FWZ A;  3X20 B;  3PFS A;  4LDX A;  2YLB A;  4JS5 A;  3PTA A;  5GAN 4;  4J83 A;  3HKS A;  3OYN A;  4QQG A;  1JB0 E;  3WXM B;  4MZM A;  5GAN h;  3CC7 T;  5GAN 5;  2OTL A;  2KAF A;  3OYG A;  4FSX A;  2GF7 A;  3MP1 A;  5GMK j;  2ZPE B;  4EDU A;  3L2R A;  2DEQ A;  2RM4 A;  3OYY A;  2FB7 A;  4M78 F;  5LJ3 h;  2WAC A;  3V8K A;  3VV0 A;  2V8I A;  3I56 A;  1VQ6 T;  3E1S A;  4RG2 A;  2LNV A;  4HCZ A;  1YJN A;  3VYG A;  5DLO A;  5DM7 R;  4QQD A;  4BI4 A;  3LH0 A;  3S3O A;  4OGE A;  3KUF A;  1YJ9 T;  4C0G A;  5LJ5 d;  3VUZ A;  3ASK A;  2V8J A;  3QII A;  4FT4 A;  1BI1 A;  3KXT A;  4YTL A;  4BAC A;  2CZ0 B;  4Y28 E;  2GQV A;  4P5N A;  4FT2 A;  4PJO G;  5GAN 8;  5J39 A;  3MHX A;  1NPR A;  5CKE A;  4XTU A;  4LD9 K;  3HL8 A;  3ME9 A;  3HHT B;  3NTI A;  2P0K A;  2M9U A;  4XTX A;  5EG2 A;  3FC3 A;  3CMA T;  1FX7 A;  2D0Q B;  2MMP A;  4KUL A;  3CXC S;  1KD1 C;  1X01 A;  3CME T;  1YI2 A;  5CQX A;  5GAO l;  2ZPI B;  3C95 A;  4PLL A;  1YCY A;  3LGL A;  4C92 B;  1KQS S;  2ZCF B;  2L8D A;  4B9X A;  2YLC A;  4QQ6 A;  4C0F A;  3QSU A;  4GY5 A;  3OY9 A;  2K3Y A;  3PGG A;  3TEE A;  2HNI A;  1SSF A;  1Y96 B;  4DOV A;  3M4Y A;  4XTY A;  2RJF A;  4JRP A;  1VQP T;  4M7A A;  3JAM E;  5IT9 E;  2EJF A;  1IRE B;  4ELY C;  3VKI A;  5LJ5 f;  1G3S A;  4M78 E;  3CCS A;  2RHI A;  3CCU T;  2DTI A;  3V8L A;  1Y71 A;  5IAY A;  2M0O A;  4M7D E;  4C92 G;  2LQ8 A;  3JCM P;  3CCM T;  1D3B A;  4M77 A;  3DKM A;  1YHQ T;  4A4F A;  4ATO A;  5FU7 B;  3VJP A;  1OI1 A;  2LT4 A;  2QA4 T;  3CD6 A;  2LDM A;  5LL6 S;  2DZ9 A;  3M58 A;  3PNW C;  3OMC A;  2F5T X;  5LJ5 h;  4IUV A;  2VXE A;  3DB4 A;  3JCM f;  2PUO B;  2XKO C;  3HFO A;  2MWP A;  1PSE A;  1YIJ A;  3MCA B;  4A4E A;  2RHU A;  1H3Z A;  3GLX A;  3QKJ A;  1VQ7 A;  2DXU A;  3JCM W;  4HT8 A;  4A4H A;  4C92 F;  2CYZ B;  4MZT A;  1TH7 A;  4MZP A;  3OYC A;  1WQ7 A;  4BE1 A;  1XQH A;  3TU4 K;  4M77 B;  3HSB A;  3M4G A;  2M1H A;  4C5G A;  1Q81 U;  3HRT A;  4OB3 B;  2BUD A;  3H6Z A;  1KQ1 A;  3CCS T;  3CCQ A;  4XK8 E;  2K2V A;  2DXT A;  3BW1 A;  4RCB A;  2GFA A;  4L6V 5;  5HKC A;  2QEX A;  1OZ3 A;  1Y07 A;  2C06 A;  3MP8 A;  4Q5W A;  4BY6 B;  4JUV A;  1Q81 C;  2AHJ B;  1WNL A;  3ZEH A;  1W4S A;  2HQE A;  3BY7 A;  3OYM A;  4M7D F;  4M7A F;  2LX9 A;  3CCL T;  2E64 A;  2V8K A;  4J7F A;  3CCE T;  4J6X A;  3Q1J A;  4LD6 A;  1UGP B;  2R57 A;  3NTH A;  4IUU A;  3QZ5 B;  1I8F A;  3JCM J;  3QG1 A;  4BI3 A;  4C8Q E;  1YI2 T;  5FRM A;  2DKG A;  1S72 A;  3O8V A;  2QQR A;  3LLR A;  1K9M U;  3CPF A;  1QVF A;  5FRN A;  3S3N A;  1BI3 A;  1WPY A;  3MEA A;  3QYG B;  1B34 B;  3FEO A;  1QW1 A;  1MHN A;  3L2U A;  4M7D D;  2KDS A;  3LX7 A;  5CCA A;  1Q82 U;  3MP6 A;  1KC8 C;  4X34 A;  2QXF A;  1O9S A;  3N5B B;  1VIE A;  2EFI A;  4EMG A;  1JBM A;  4M75 F;  4NL2 A;  3JCM c;  5HY6 A;  1JJ2 A;  3L42 A;  5J26 A;  3OYB A;  4PJO C;  4M77 G;  2JZ2 A;  2RJD A;  5I21 A;  3CBP A;  3EFS A;  1WJQ A;  3QHS A;  1XNI A;  5D6Y A;  3V7R A;  3OYL A;  4E7J A;  1QP3 A;  4C92 E;  2QTX A;  5GAN d;  4KUD K;  3M9Q A;  1H64 1;  1JJ2 S;  4BB7 A;  2E1H A;  4A4K A;  3OW2 A;  2XI9 A;  4E7K A;  1K73 C;  2X4Y A;  4KBM B;  3R6O A;  1HXD A;  2JOY A;  5KE3 A;  5GAN 2;  5D6W A;  3GPL A;  5GAN j;  1S72 T;  4E7H A;  3OB9 A;  1KC8 U;  3KBG A;  5I2M A;  3TRE A;  2E41 A;  3QDR B;  4HA8 A;  5L8R E;  4PLI A;  1NZ9 A;  3JB9 G;  4J5Y A;  2DZC A;  1VQ8 T;  3CCR T;  1UB4 A;  4M78 A;  3SDZ A;  1K8A C;  4ZGJ B;  3CCL A;  1G3T A;  2DK3 A;  2I2L A;  5A0L A;  4QVD A;  2LCC A;  2RHZ A;  3ER0 A;  3M57 A;  4C5H A;  3ZBD A;  4HKE A;  1VQ4 T;  3SWN C;  3X28 B;  4C8Q F;  3CCQ T;  2MWO A;  3CC2 T;  2VGM A;  2DVE A;  3CBO A;  1U1S A;  2IG0 A;  1BYM A;  1RI0 A;  1M1K C;  4M75 A;  2VYT A;  3FIF A;  2EWN A;  2CZ6 B;  3JCM V;  4PJO E;  2XD0 A;  1BKB A;  3FRN A;  2KSS A;  3LGF A;  3INZ A;  4D6W A;  2CZ7 B;  2E6Z A;  3A8L B;  1VQ7 T;  5D6X A;  2B8A A;  2JTM A;  3RKW A;  2EQU A;  5GAN e;  2MF2 A;  3QXE B;  4BUG A;  3A8H B;  2K5F A;  2XK0 A;  3P8H A;  3MEU A;  4JRQ A;  5KH6 A;  2LT1 A;  5CKD A;  5GAN 6;  3OYI A;  2QDY B;  1Q86 U;  4ZN1 A;  2DIG A;  1V29 B;  2QQA A;  2RJE A;  2RK2 A;  3HPW A;  2QA4 A;  3CD6 T;  4J7I A;  4ZTJ A;  5HK0 A;  2EAY A;  2EKO A;  2LTO A;  1UEB A;  3DLL A;  4PJO B;  2A7Y A;  1WJS A;  1G5V A;  3CCM A;  1VIF A;  5LJ3 d;  3V8J A;  3SD4 A;  4M7D C;  3QJY A;  1D3B B;  2L3R A;  1N9S A;  5GAO r;  1Q86 C;  1WQW A;  2RI5 A;  3X24 B;  3CCU A;  3OSS C;  3GNG A;  2MI6 A;  2FVU A;  4R56 A;  3OS5 A;  4JS4 A;  1VQO A;  4OVA A;  3RMQ A;  2HQX A;  1JRI A;  5GAN g;  1VQ9 T;  1VQK A;  3ZFJ A;  4M77 E;  4M7A E;  2EJG A;  5FLX E;  1Y96 A;  3FB9 A;  2K57 A;  1O75 A;  4FM4 B;  3RMS A;  3LWH A;  3SB2 A;  1YIT T;  2Y4X A;  3J81 E;  4ZTF A;  2E65 A;  3VYH B;  4EMK A;  3CME A;  3M55 A;  4BI8 B;  3M54 A;  3AHU A;  4PJO D;  4DA4 A;  4CI0 C;  2VC8 A;  3JSC A;  3HFN A;  4E7I A;  2XHC A;  2JUF A;  4VUB A;  1ZQ1 A;  5FU7 C;  5LJ3 e;  3SWN B;  5A2Q E;  2K5L A;  4C0D B;  4IUP A;  2DAQ A;  3CXC A;  1BI0 A;  3GNF B;  4C8Q G;  2K3X A;  4M77 C;  2X4X A;  4O6J A;  3S3M A;  3PMI A;  3CBM A;  5GAN f;  2QQS A;  1KQ2 A;  3LWI A;  4WF2 A;  2RJC A;  3JCM d;  2KK4 A;  4C0D C;  5GMK e;  2GCX A;  5FRO A;  4RG8 A;  4ZN3 A;  2PUK B;  2DXC A;  3CCR A;  2VUB A;  4JRK A;  3NTK A;  2O4X A;  3F70 A;  4GLK A;  4ELZ C;  2KMT A;  3G71 A;  1YJ9 A;  1VQ8 A;  1OZ2 A;  2HBP A;  5DLQ E;  5KCO A;  3JB9 J;  1YJN T;  5GAM d;  2VV5 A;  3OW2 S;  5GAO m;  1VQ6 A;  3I56 T;  3OSV A;  4ME7 A;  2WSC E;  3FLG A;  1DJ7 B;  4M78 G;  2FYK A;  2ZPF B;  2G3R A;  4C8Q B;  3UT1 A;  1RL2 A;  3A8M B;  3MEV A;  3EAE A;  2D9T A;  2FL7 A;  2QQB A;  4QW2 A;  3I55 A;  1M1G A;  3RKX A;  3A8O B;  1ZBX A;  3GIB A;  4TVR A;  1VUB A;  3L2V A;  4X9C A;  2RK1 A;  5CO7 A;  5LJ3 j;  1NJI C;  3CC4 T;  4C92 A;  4HCC A;  2VGN A;  4EMK C;  4N4G A;  4C0Z A;  2DTH A;  5CQY A;  1M4Z A;  4M75 G;  4OB2 B;  4Z02 A;  1QVF S;  1KD1 U;  1UGR B;  2GFU A;  4M7A C;  2DO3 A;  2DTO A;  1N27 A;  1IZ6 A;  3JB9 H;  1KHC A;  1NPP A;  1R8O B;  3OYJ A;  4IUQ A;  1BIA A;  5CAI A;  1UGQ B;  4JLI A;  3M53 A;  4IKF A;  2XG8 D;  4N0A C;  4XU0 A;  4XU1 A;  3E9F A;  3QPH A;  4OF1 A;  3L1A A;  4OMF B;  3T9N A;  2K4Y A;  1I81 A;  1YJW A;  2X35 A;  2ZPH B;  4N4H A;  3JCM g;  5GAO n;  2KVQ G;  5M9O A;  2QI2 A;  2VXF A;  3P8B B;  5GAN 7;  1VQ9 A;  2K5I A;  4B9W A;  3C4S A;  1M90 C;  3E19 A;  1VQO T;  4R55 A;  1N6A A;  3L2W A;  5C0M A;  5FU6 B;  5CIU A;  4BDY A;  2EQM A;  3E9G A;  4BE2 A;  4UC4 A;  2MAM A;  3C12 A;  4FU6 A;  3HRU A;  3SFM A;  4EMH A;  1W2B S;  2CKK A;  1X75 C;  4XTZ A;  3DB3 A;  5KE2 A;  1M5Q 1;  4M7D B;  2ZGW A;  3G4S T;  3QZ9 B;  4XTV A;  2PU9 B;  2XU8 A;  3CCV T;  3JB9 F;  2Y90 A;  4M7A D;  2XDP A;  4FL6 A;  3A5Z B;  2RI3 A;  1Q7Y U;  2P0P A;  2L89 A;  2DIQ A;  3G7Z A;  3OYF A;  1U8R A;  3NFC A;  2XDD A;  4O5V A;  4E47 A;  3L2Q A;  3LW5 E;  2RA2 A;  5GAM j;  3OA6 A;  5GMK m;  2X4W A;  3JCM b;  2E12 A;  4XAX B;  3JCM h;  3X26 B;  5C6S A;  3G6E A;  2WSE E;  3OYH A;  4N0A A;  3FJP A;  1Q7Y C;  1PSF A;  3HP9 A;  2E6N A;  4PL6 A;  1G3W A;  1KHI A;  3RER A;  4F7U A;  4LDV A;  2F5K A;  3EFR A;  4JJN K;  4LDU A;  2CS7 A;  4BD3 A;  4J6W A;  4M77 F;  1LJO A;  5LJ5 j;  3BDL A;  2A3L A;  2DXB A;  1YHQ A;  4LDY A;  2OTJ A;  2FHD A;  4RMO A;  4M77 D;  5GAN 3;  2EQJ A;  1P92 A;  3PT9 A;  1VQN A;  3UDC A;  3J80 E;  3G4S A;  3CCV A;  2OAU A;  2LC4 A;  1YBY A;  4C8Q C;  2WSF E;  2M16 A;  3BDU A;  3MO8 A;  5IN1 A;  3TCJ A;  4ZGE B;  2JN0 A;  5KCH A;  4XU2 A;  5GAO q;  1BIB A;  2CGH A;  1AHJ B;  2YHT A;  4M7A B;  1VQM T;  1VQ4 A;  3MET A;  2PQW A;  3C94 A;  4XTW A;  4PKC C;  2L5Q A;  4KT0 E;  4EPC A;  1VQP A;  2PVO B;  4M78 B;  4QVC A;  2Y4Y A;  1NE8 A;  2R58 A;  4EMK B;  4A53 A;  1KQS A;  4HCB A;  2O01 E;  3JCM Q;  4BE0 A;  1I5L A;  3OBY A;  3GOX A;  5GMK h;  5GAO p;  4E7L A;  4L59 A;  3FDR A;  3URG A;  1QVG S;  2LQK A;  4PNO A;  1VQ5 T;  1WJR A;  3BFM A;  3JB9 I;  4IUR A;  2D6F A;  2P4T A;  3OYA A;  2DD5 A;  3CPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...