1B34B

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
74
Chain Sequence
TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMDRYISKMFLRGDSVIVVLRNPLIAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 74
sequence length 93
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34B00
2HNIA 4PJOA 1D3BA 5LJ3f 4C8QA 4C8QG 5GANh 4M7DE 4JRKA 5GAOn 1D3BB 3V7CA 4M77C 5GANe 4J6XA 1YCYA 4C92D 5GAOq 5LJ5h 5GANj 4M78F 2Y90A 5GAN7 5LJ5d 1X01A 5GMKm 5GAN4 4M7AD 2RM4A 2ZGWA 4NL2A 3JCMW 3QO3A 2FYKA 4MMKA 3V8JA 4XTVA 4F7UF 5GAOp 5LJ5e 3JB9D 4XTUA 4M78B 5LJ5j 3PGGA 4M75D 5GAOl 3JCMJ 1B34A 2DKGA 4M77G 4M77A 4C8QC 3JCMd 3JCMP 4M78E 3JCMQ 2E64A 4JUVA 3AHUA 4EMGA 3HFOA 4JRIA 3SWNC 1WPYA 4XTWA 4C92G 3HSBA 4PJOD 3EFRA 4XU3A 5DY9A 4C8QF 4NL3A 2DZ9A 4M7AA 4M7AG 4RCCA 4HT8A 1I8FA 3JCMg 2E1HA 5GAMd 4A53A 1I4K1 3JB9G 1Y96A 3FB9A 3JCMf 4C8QB 1KQ2A 4M75A 1WQWA 4M75G 3SWNA 3V7RA 2EJGA 3JCMX 2EJFA 5GAN8 4C8QE 3BDUA 1BIBA 4MMLA 5GAN2 5LJ3h 3GIBA 2CGHA 3RESA 3BW1A 1WQ7A 4JLIA 4PNOA 1H641 1JRIA 3RIRA 4PJOG 4C92C 4M77F 3JCMh 3VU3C 4QVDA 5GAMg 2E65A 4NOYA 2E10A 4M7AC 5LJ3e 1LOJA 1N9SA 1N9RA 5GAMf 1JBMA 4M78D 1TH7A 2DJZA 5LJ3j 5GAN3 4XTYA 5I21A 5GMKi 2RA2A 3JB9J 4X9CA 1B34B 4M77B 1U1SA 4M75C 4M7AF 4M77E 4C92A 4QVCA 3QSUA 3QUIA 3L1AA 5GAN6 2VC8A 5GAMh 5GANd 4N0AA 3RKXA 4M7DD 4OP0A 3HFNA 3JCMb 4M75F 3V7SA 3L2ZA 4M7AB 4PJOC 4C92E 1LNXA 3M4GA 2DZCA 1WNLA 4M7AE 2YHTA 3SB2A 1Y96B 1M5Q1 2I2LA 4J6WA 4M75B 3SWNB 4EMKA 1HK9A 2RD1A 3BY7A 4PJOF 4F7UG 1U1TA 3JCMV 4F7UA 5GANg 4M75E 4XU0A 5GANf 2JN0A 3JB9H 4XQ3A 4A54A 4XU1A 1M8VA 2VXFA 4M7DA 4N0AC 4M7DG 2FB7A 4PJOB 5LJ5g 5GAOr 5GAOm 3RKYA 4XTZA 3JCMe 2DTOA 2DXUA 4PJOE 4C92F 4HT9A 3RUXA 4M77D 3INZA 1I81A 4M78C 4HA8A 4X9DA 2DTHA 2DEQA 2DTIA 1HXDA 3RERA 5GAN5 4EMKC 4WF2A 3BFMA 3FJPA 3JB9F 4C92B 4DQ2A 4M7DC 3EFSA 5GAMj 3FIFA 5GMKl 4J6YA 1BIAA 2VXEA 3QHSA 3JCMc 2RB6A 2EWNA 3RKWA 3V8KA 2DXTA 5GAMe 2EAYA 2EJ9A 4M78G 4M78A 1KQ1A 4XU2A 3V8LA 4C8QD 5CAIA 5GMKh 5LJ3d 1MGQA 1I5LA 4XTXA 4Y91A 2E41A 2YLCA 4RCBA 3JB9I 5GMKe 5GMKj 4EMKB 4M7DF 4EMHA 4F7UB 2QTXA 4F7UE 5LJ5f 2DVEA 4J5YA 2YLBA 2K57A 5LJ3g 4M7DB 1LJOA 4V2SA
chains in the Genus database with same CATH superfamily
2K6DA 1U8RA 4FSXA 1K8AU 4JRKA 4B9XA 4DBQA 4J9CA 3M0UA 4KT0E 4QT7A 5IXFA 4IIOA 1IREB 2B86A 5GAN7 3GNGA 4MMKA 1Q81R 3KBGA 4XTVA 3NGPA 4F17A 2MOXA 4M75D 3HKSA 1G8XA 3JSCA 2W0ZA 4BE0A 2AK5A 4L59A 1VQKQ 1TTHB 1YJWQ 4GLMA 4NL3A 2GF7A 3CC7T 1WXBA 1YJNA 5GAMd 1M3BA 1BK2A 2D0QB 1AEYA 5GJVB 4C8QE 5GAN2 4MMLA 2QQAA 2YRDA 3CCQA 2CP2A 2LVMA 4PJOA 5KYUA 2BIVA 3PMTA 4DOWA 1C0MA 3M0TA 3OMCA 1ZA1B 2O01E 4MZPA 2M0YA 1ABOA 3OYKA 4C0GA 2GNCA 3CCEQ 4QVCA 2YRCA 3L1AA 3VUBA 3HFNA 1UECA 1YIJQ 6AT1B 1N5ZA 4JZ4A 2AZVA 1ZX6A 4PFOA 2AIRB 1KIKA 3OS5A 3DLMA 1V1CA 3EHRA 4CRIA 2HMAA 4XU1A 3RDVA 1MNEA 1P92A 1RAGB 2KT8A 1VQNA 3RKYA 3A5ZB 4KGXB 2XICA 2DYBA 2RNAA 5C6SA 1GCQA 2K3BA 4OMPA 4HA8A 1M90R 3M58A 4QQDA 4KUDK 4FYWB 1AZGB 3NTIA 2E6ZA 4ZGJB 1G2BA 2O9VA 4M7DC 1UFFA 4PJNA 5GAMj 1VQMA 3C4SA 3VS6A 3DB4A 1M27C 2HL5C 4B6MA 1I5OB 5FRMA 1K1ZA 4C5IA 4FIBA 3I56T 2CREA 2JM8A 5CK9A 4FW2A 4C8QA 3ZBDA 3QIIA 3EG3A 3WVEB 4JPBW 3PIPA 1SF9A 3QWYA 3UATA 1TOVA 1G3WA 1WXUA 1T0HA 2FYKA 2CP0A 2JT4A 3JB9D 3MEWA 2BZXA 2LQ8A 3CCVT 1NJIR 3H8ZA 2H3JA 3G6EQ 5DM7R 4FT4A 3QKJA 4XTWA 3HSBA 1SRMA 2JTFA 2DZ9A 3GF5A 1O9SA 2DL4A 3EGXA 1TU0B 2LNHB 1VQOT 3CCLA 1I4K1 2CKKA 4ZTJA 2E3HA 5GAN8 1AZEA 1VOMA 1PG5B 3OSVA 2HL3A 8ATCB 1BCOA 2FHDA 2DJZA 4KULA 5FW9A 2OTLT 3ZL7C 1T0JA 1WGSA 2QGGA 1PKTA 4OB2B 4BB7A 3JCMb 2EBPA 1WHHA 2L5QA 2CDTA 1YI2T 1MNDA 2I2LA 4J7FA 2FG0A 2IVWA 2LQWA 4CI0C 1TUGB 4XQ3A 3EFOB 2QQ9A 2LRQA 2OX7A 1XQHA 3CPWS 3EGDB 3RUXA 4EDUA 4M77D 1GXIE 2RHZA 1VQ8Q 3PVLA 3VS2A 1FMVA 1XJWB 3CMAQ 4AMCA 2KSSA 4DQ2A 4N4GA 3RKWA 4XU2A 5GMKh 2X9HA 4IIMA 1Q7YC 4EMKB 4RUGA 3EAEA 1MMAA 2L3QA 2L89A 2K5LA 5KYNA 2DD4A 1NM7A 4EPCA 2K57A 2W10A 1KHIA 4C5HA 1JJ2P 4O6JA 1K0SA 4FCYA 2D9TA 1ZLMA 3V7CA 1M1KU 1C1AA 4BY6C 2F5KA 1ZBXA 1GFCA 3CD6Q 1QVGS 2CUDA 1EIFA 4AT1B 1M9SA 3WVDB 3TEEA 1BU1A 3M4YA 1VQ9A 4JRIA 1V76A 4C92G 4DEYA 4PJOD 1RI9A 2ED0A 3ZEHA 1Q86R 3CCUQ 3JAME 4M7AG 3EG2A 4RCCA 4PJMA 5CKHA 3OYGA 2E1HA 3M0SA 1HYOA 4EIKA 3L2RA 3SWNA 1YJWA 1YNZA 2EJFA 1IO6A 3GOXA 4E7JA 1VQKT 4HXJA 2EYWA 5KYXB 1GCPA 2P4TA 2JOYA 1N9SA 5GAMf 1N8RC 1M8MA 2HSPA 3LW5E 5GMKi 1PNJA 1B34B 3OQ5A 4PLIA 2M02A 2O4XB 3CCJT 3REAB 1CKAA 4B9WA 2KDSA 2VGNA 1Y0MA 4XK8E 4M7AB 1BCMA 1SHFA 3CCEA 4J9HA 1RAEB 2XI9A 3QXEB 5ECAA 4JJNK 1YIJA 1KK7A 2M51A 3QYGB 1YJ9T 4JS5A 1KQSP 4R0KA 3FDRA 4EMKC 2V8KA 4NS5A 1B07A 1OZ2A 1K8AR 2EAYA 4C8QD 3NMZC 3I55Q 4J9EA 5LJ3d 5IN1A 2RQWA 4Y91A 4RTVA 3L2WA 4RCBA 3A8OB 2P0QA 4EMHA 2EGEA 1VQLQ 2DVEA 4MZMA 2OJ2A 2K7AA 5M9OA 4OGEA 3VS5A 2L3RA 2ZPIB 1X2KA 3S6WA 1QVFS 1G3SA 1K9MU 4RG2A 3CMEQ 4NL2A 1PHTA 2Y4YA 4RTZA 1TUDA 1YHQA 3M0QA 1WI7A 2RHUA 1Y57A 4C0DB 1XTDA 2NUPB 3NTHA 2J06A 4OMMA 4A53A 1CKBA 1YITQ 3CCST 2EYZA 1EZZB 2OTJT 4A4HA 2FPFA 3G6ET 2FVUA 3RESA 3X24B 3BW1A 4C92C 2FRWA 2A08A 2EQMA 2P0KA 1KD1U 3OYYA 3QYHB 4M7AC 3CC4Q 3SFMA 5LJ3j 1ABQA 3G4ST 4LE9A 4C5GA 1YJNQ 1DJ7B 3LGLA 3OSSC 1AWXA 3QJ6A 2AKLA 3MP1A 1RUWA 3VKIA 1U3OA 3CCQQ 2SRCA 1UG1A 2DYIA 2AZSA 2FPDA 2RD1A 2M9UA 4OVAA 3C12A 1U06A 4HVVA 2DXUA 4C92F 4M78C 1KQSA 4GY5A 4ORZA 3VRZA 4BDZA 1AWJA 2HBPA 1M2VA 1W2BA 1JXOA 2QAZA 1W1FA 2E4HA 2DPPB 3M9QA 3G7ZA 2R5AA 4FW1A 2OI3A 4XAXB 1VQ5T 1VQ8T 1D0XA 2CH4A 2DL3A 3M56A 3CMAT 2QTXA 1OQKA 4E47A 4LUDA 1NLPC 1Q81C 1LJOA 2WSCE 2CT4A 1CSKA 3PMIA 2RQRA 2DJQA 3LYIA 3JV3A 3C94A 3LH0A 2RPNA 4M78F 2QASA 4CC2A 3CC2Q 3SD4A 3A98A 4FL6A 5HK0A 1I0CA 2RJDA 3X28B 4HCZA 1X6BA 4E7LA 1EX4A 3CD6T 1WLPB 3LWIA 2LQKA 2HD0A 2NYSA 1D1BA 3M57A 1WQ7A 2V8JA 5GAMg 4MZTA 3CCUT 4ZGEB 1TG0A 1UB4A 5IHNA 1MMGA 3UA7A 1UEBA 1RAFB 2F2XA 4M77E 1G5VA 1KJWA 1WX6A 2VC8A 1IZ6A 5GAMh 5GANd 3RNJA 5KH6A 4M75F 3OY9A 1FWZA 1M90C 1M5Q1 4J9DA 3QJYA 5L8RE 1HK9A 4X1VA 1TS9A 1IGQA 4HVUA 3OYLA 2VXFA 3NPFA 3EG9A 4K11A 1BYMA 4XTZA 4CC4B 4BI4A 1FMWA 2F1LA 4X9DA 2DTIA 2VVKA 1NE8A 2ZZDA 4E7ZA 2MMPA 2GFAA 2RI2A 4PFZA 4Z89A 5AYFA 5A0GA 2E41A 1RABB 2LT1A 4Y92A 1HD3A 1LCKA 2YUPA 1E6HA 2O31A 1D3BA 5LJ3f 3I55T 4M7DE 3CQTA 3FRNA 1NJIC 1BBZA 1AWOA 3PFSA 2L2PA 3WXMB 2F2VA 4JRQA 4A4KA 3CBPA 5GANj 1MHNA 2KE9A 4P5NA 1VQLT 2QA4Q 1SKUB 4OB1B 3DLLA 2HQHA 2BZYA 5KYYB 5LJ5j 4M77A 3JCMd 2G3RA 5J3BA 4E7HA 2LJ1A 3AHUA 2KY9A 2B8AA 2RJEA 1PM3A 2PTKA 1X27A 3CMET 2A7YA 4RTYA 1KC8U 4JJCA 4JJBA 1D1CA 3SHWA 3MEUA 4X34A 3D7SB 4KUIA 1VQ9Q 1YITA 3VYGA 5KYWA 5KYUB 1MUZA 1PWTA 1W70A 4KRTA 1SPKA 3CC4A 1QCNA 3OMGA 2KROA 3CXCP 3URGA 1YN8A 2CS7A 1UGVA 2HEQA 1Y96B 4ATOA 1YJNT 1SSHA 1OPKA 3CEYA 4M4ZA 2DXCA 5D6WA 4M7DA 4RKUE 3CCQT 2COZA 2JMCA 5HKCA 3I35A 1M4ZA 4HT9A 2DEQA 4J83A 3EGUA 5GAN5 3OS1A 1JO8A 2CSQA 2JXBA 2YSQA 4ESRA 4J6YA 3IQLA 1BIAA 2EKHA 2EQUA 5FRNA 3UWNA 4IKFA 1I5LA 3PIOA 4J8OA 1OI1A 2GQIA 2GQVA 5DLQE 1K9MR 2IG0A 1QP2A 2JMAA 2EGAA 5CR2A 2ZCFB 1S72A 4UC4A 2RHIA 1WHKA 1VQNT 4YTLA 3OYNA 1ZQ1A 3MP8A 2DA9A 3LGFA 1Q86C 2DLPA 2KK4A 2VUBA 2XD0A 3THKA 3CPWP 4BE1A 1OX8A 3REBB 5CIUA 1VQMT 3CC2A 2A37A 4GLKA 1KD1R 3TREA 1NBEB 1VYVA 4AG1C 3VYHB 3KUFA 3META 3M0PA 3AT1B 1WQWA 4FU6A 2EJGA 1PKSA 1AT1B 2VASA 4E7KA 2AT1B 2GTOA 1PRLC 5I2MA 1YHQQ 2LP5A 2K3YA 2C0IA 3RBBB 1LOJA 2L0AA 4BDYA 3H0FA 4O5VA 1VQPQ 4XTYA 4HCKA 3MP6A 3QBYA 1K76A 4BY6B 1N8RU 3Q1JA 1QVGP 5GAN6 3GP8A 1Q82R 5A2QE 3V7SA 3CXCA 4J9GA 4KGVB 2DBMA 1KFZA 4RMOA 3KFVA 1MV3A 3CCLT 1U5SA 2F5TX 3BY7A 4PJOF 4F7UG 1U1TA 5GANf 1M2OA 5IT9E 2EQKA 4ELYC 1YBYA 1K8AC 4RTUA 4IUVA 2MYSA 2DTHA 1KSWA 1PSEA 9ATCB 3BFMA 3FJPA 2EYYA 1S1NA 4RG8A 2KYBA 2LJ3A 5CKDA 2K3XA 3QDRB 3SDZA 4D8DA 3X25B 2K2MA 4F7UB 4PLLA 2E3IA 1YP5A 3HHTB 3M53A 5LJ3g 2DL8A 1QWEA 3UF4A 4IUPA 3P8BB 1TXQA 2GCXA 4TVRA 2HSEB 1H3ZA 1WHGA 2KXDA 1XNIA 4F14A 2R58A 2ZGWA 1OULA 2DD5A 3X26B 4OF1A 2YXYA 5GAOl 1G3TA 5IH2A 2QA4A 5C0MA 2X4WA 2J6FA 1RLQC 3QZ9B 5DY9A 4C8QF 3OYAA 1VQ7A 4FYVB 3CBOA 4Z88A 3L42A 1UJYA 3JCMf 1UUEA 2ZPFB 2D8JA 3QWXX 1ZSZB 2X3WD 1UGSB 3VUZA 1M1GA 3EFOA 4PFPA 3RIRA 3P8HA 5J39A 4ZNXA 2PZ1A 3EGDA 3MJXA 2RK1A 3HP9A 5AT1B 3ER0A 2CP6A 2A3LA 1QVFP 1U1SA 4R55A 3OYIA 2CZ1B 1MV0B 2F2WA 4M7DD 2NUTA 3FLGA 1VQ9T 2KR3A 4C92E 2RF0A 3G71A 1X75C 1WFWA 4M7AE 3EHQA 3SB2A 3LX7A 3L2UA 4LD6A 4J6WA 5IXBA 3OYFA 4EMKA 3PT9A 4ZN3A 1RI0A 4QQGA 1YJWT 3JB9H 3OBWA 4N0AC 2RK2A 4GBQA 3MCAB 2QEXA 1NLOC 2CH4W 1WA7A 3MEVA 4N4IA 5KE2A 4C92B 3TVTA 3OW2P 3EFSA 2M1HA 3NFCA 5GAMe 5CAIA 4M78G 1FX7A 4RTXA 1RAHB 1N27A 2LX9A 3LH5A 1I1JA 3OYDA 3CCET 2DFUA 5L23A 4KBMB 3H6ZA 2KGTA 2YLBA 3JCMP 2XDDA 1YIJT 3QPHA 5A0DA 3NTKA 3MKDA 4Q5WA 1Q81U 2ZPEB 1UGRB 3QDFA 1YCYA 4FM4B 5GAOq 2J6KA 2QK0A 3MPUB 5KYXA 1KC8R 1X01A 2C06A 2GTJA 2YUOA 3V8JA 4F7UF 5CKEA 4M78B 1K73U 3JCMJ 1B34A 2DKGA 4OGCA 2FL7A 1ZSZC 1OOTA 2O4XA 4C0ZA 3SWNC 1VQ4A 1WPYA 2MIOA 1Z9ZA 1YWPA 1X43A 5KCOA 4M7AA 1YWOA 2RI3A 2KYMA 2FRYA 3G1JA 1I8FA 1JJ2A 2DEUA 4M75G 3VS7A 2KI7A 2KRNA 1ARKA 2ATCB 3H9NA 1QQJA 2E10A 5EC7A 2E5QA 5KE3A 5KCHA 2O2OA 2RHXA 4AFUC 1VQPA 4IURA 2ROLA 4AG2C 1YHQT 2VB6A 2PNIA 1GFDA 2JVVA 4DBRA 1LNXA 1BI2A 1WNLA 2KMTA 4BACA 2CYZB 4M75B 2RQUA 4AFQC 2Y4XA 3E2UA 1H8KA 2CSIA 5GANg 3JCMV 2DK3A 4A54A 2LT4A 4WTOB 1IRXA 5LJ5g 4JDSA 2E5KA 1YFNA 1N6AA 3PNWC 2EIFA 2YUNA 4D6WA 1E7OA 2FZKB 3FEOA 3OW2A 2EQJA 2RB6A 3CC7Q 1KQ1A 1BKBA 2RQTA 4AFSC 1M2VB 2A36A 5GMKj 2XMFA 4KH1B 5A0LA 4LN2A 2EVRA 3CCRA 2NUPA 4PJJA 2H8HA 4MDWA 2HNIA 2JZ2A 2H3EB 2ZAEA 4PK4A 1Z9QA 1ZSGA 5J26A 4LNPA 1KQSS 1WHLA 1QKXA 4BI3A 1NJIU 3M0RA 1NPRA 5IHIA 4A4GA 2EKOA 1BB9A 4IUTA 4J7IA 2J7IA 1W2BS 3CCMA 2X4YA 3M5AA 2F69A 2E64A 2X4JA 1S72Q 1SSFA 3H0HA 3GBQA 4XU3A 3VS1A 1B7TA 1A0NB 2V1QA 3JCMg 2I0NA 1G83A 3JB9G 4OMQA 3OYEA 2XHCA 2HKNA 2R5MA 1IHVA 2LTOA 2E70A 4HT8A 3JCMh 2RMOA 4OB3B 1N9RA 1D0YA 2Z0WA 1YCSB 4ZN1A 4M75C 1W6XA 2KAFA 3CBMA 1C6VX 2KRMA 3E1SA 1R0CB 1VQ6A 3L2ZA 4QQ6A 1VYTA 1GBRA 2DMOA 3A8GB 2KEAA 2O88A 1R0BG 5IHKA 3GNFB 2YUQA 3NHNA 1Q95G 4ELZC 3VRYA 4L6V5 2YWWA 3L2VA 4HCBA 3A8LB 3I9QA 3CCVQ 2JUFA 1K9MC 2NWMA 4WF2A 2LX7A 1UGQB 1PCXA 2MK5A 3M55A 1X6GA 3A8HB 3V8KA 3OYJA 5LJ5d 2IIMA 2WACA 2DRMA 3N5BB 2EPDA 1QCFA 1GL5A 2HQEA 2VGMA 3S3OA 1WIEA 2XIDA 5CO7A 4LDXA 2QDYB 1NPPA 2ED1A 2OTLQ 1D3BB 4A63B 1VUBA 4C92D 4LUEA 2YT6A 4ME7A 1KD1C 5GAN4 5D6YA 4M7AD 4FYXB 1AWWA 2XK0A 1M1KR 1UTIA 1AOJA 2PVGB 1OU9A 1YI2Q 5HK3A 3QZ5B 3R6OA 2L8DA 3EFRA 2QDLA 3TSWA 1WHJA 3H0IA 3I5SA 1G3YA 5HCKA 1WYXA 4FYYB 3OYBA 1Q82C 1JRIA 3TU4K 1QMCA 4PJOG 4A4EA 5LJ3e 1M3AA 4M78D 1TH7A 2DETA 1VQ7Q 2DE0X 3EH1A 2X3XD 4E7SA 5KYWB 1NYGA 1M1FA 3A8MB 3E19A 3H41A 2VWFA 4DBHA 2IPOB 2D1XA 1HSQA 1K9AA 1K4US 1PSFA 4OB0B 1WXTA 2C0OA 2ZPGB 2ESWA 2BTTA 4XU0A 3UT1A 4PJOB 2FB7A 1X6OA 2DX1A 2XG8D 2EGCA 2DTOA 1YITT 3G71Q 3A1PA 1RACB 2RN8A 3JB9F 1QP3A 4II1A 2HQXA 3CC4T 5KYYA 2J6OA 2FO0A 1BI3A 2BKDN 1MGQA 4XTXA 1WDXA 2LMJA 2QEXQ 3LLRA 2NLUA 3CC7A 1VIEA 2LNVA 4OMNA 1K73R 1UJ0A 2WSFE 1VYUA 3C0CA 3E9GA 4C8QG 2DL7A 2KT1A 4M77C 4J6XA 3EG1A 4IUUA 3CCJQ 1NEBA 4JRPA 4XTUA 3X20B 4JS4A 4ZTFA 2BE9B 2PVOB 2KNBB 2MF2A 2NUZA 2ROTA 3HFOA 2XKOC 3ASKA 2RHYA 1Q7YU 4FSSA 1WHMA 1SRLA 4LDUA 2K5FA 2RJCA 4BI8B 1YJ9Q 4JJDA 1Y96A 4C8QB 1OX9A 1T3SA 2CZ0B 3OA6A 1S72T 2E6NA 1H641 4M77F 1AVZC 1VQ4Q 2RQVA 4D8KA 5GAN3 5I21A 2QTVA 4ANJA 1QVPA 1WJRA 3UPUA 5CVIA 2K9GA 5LL6S 3O8VA 3CC2T 4DEXA 4PJOC 3EGXB 3MHXA 3HRUA 5CCAA 4Z8AA 3I56A 4WCIA 2ZPHB 1T3LA 1O75A 2HDAA 4L5GA 2VYTA 3UA6A 2GBQA 2M0OA 4E2FB 3RERA 1MMNA 4JLGA 4C0FA 1VA7A 1VIFA 2VKNA 5GMKl 2DAQA 1QLYA 3CCVA 3JCMc 3PTAA 2EJ9A 3TCJA 1D1AA 3CXCS 2MWPA 2YLCA 1GCQC 3CCSQ 3BE3A 4M7DF 2E12A 2VV5A 2OTJQ 3QG1A 1VQOA 1KC8C 4F7UE 4OMLA 2PUKB 1BI1A 5LJ5f 1NG2A 2JM9A 4QW2A 3G4SQ 1PD1A 5GJWB 5GAOn 1QWFA 1QW1A 2DM1A 5GANe 1SHGA 1H92A 2DF6A 2QQBA 2K5IA 2OTLA 3QO3A 3LWHA 5GAOp 5LJ5e 3TQ7P 3CCRQ 1FMKA 4C8QC 4F16A 2HAXA 4RTWA 3JCMQ 1H3HA 2K79A 4OMOA 5CQXA 1ZBJA 3O5ZA 1TUCA 1YI2A 4Y28E 1X69A 1UDLA 2DVJA 1J3TA 1UE9A 3CCMQ 2FZGB 5LJ3h 1AHJB 3OBYA 2C0TA 4J9IA 3I5RA 2LCCA 3M59A 3U23A 3CPWA 2FEIA 2RA2A 2XDPA 2DRKA 2G6FX 1JQQA 1IB8A 1VQ5Q 1ACMB 3QUIA 4N0AA 2QA4T 2MWOA 1PD0A 2ZPBB 2DZCA 2V8IA 2NUTB 2MCNA 2EQIA 2YHTA 1QCOA 1VQ7T 4QKUA 3TSZA 3SWNB 4F7UA 2BZ8A 3UDCA 2LZ6B 3OS0A 2DERA 1KHCA 3SEMA 2SEMA 3HRTA 2DXBA 4PKCC 2PUOB 3JCMe 1WJSA 1VQ6Q 1JXMA 1I81A 3MO8A 1Y71A 1HXDA 1ZUYA 2ENMA 3J80E 1QVGA 2JS2A 2JTEA 2VXEA 3JCMW 2EWNA 3V8LA 2CZ6B 3S3NA 2CP5A 4CC3A 3G71T 1F1BB 3S3MA 4DBFA 1RL2A 1UHCA 2CZ7B 1QKWA 3ULRB 2LQNA 3MEAA 2FPEA 1R77A 1ZSZA 1VQKA 2JS0A 1JB0E 4AFZC 2QEXT 1RAIB 1V29B 2Y90A 3OS2A 2RM4A 5D6XA 4LDYA 2EYXA 2V26A 3L2QA 4M78E 1M30A 3CCJA 1D0ZA 4JUVA 5D7UA 2CUBA 3CPFA 2D6FA 4LDWA 3J81E 3V7RA 3C95A 2HZYA 1BIBA 2DBKA 1YJ9A 3F70A 2CGHA 4R56A 2QG9B 1HJDA 5HY6A 4NOYA 3RR6A 3HL8A 2HKQB 4HKEA 1UGPB 4C92A 2CP3A 2KBTA 1D09B 2YDLA 2RJFA 3GLXA 1W2BP 1VQ4T 2LCSA 1W4SA 2LJ0A 1JJ2S 1ZUUA 1IHWA 2OAWA 4M75E 2DNUA 1PC0A 1RLPC 2MAMA 1M8VA 1OZ3A 1MMDA 1I07A 1OYXA 4HVWA 3PVQA 4BD3A 2O9SA 2DO3A 1QVFA 3VS0A 3DB3A 2LCLA 2DIQA 2QXFA 3R6NA 3FIFA 3QHSA 3VS3A 1ZHIA 4M78A 2QQRA 1VQPT 1BI0A 1TSFA 3OYMA 1M90U 1SEMA 1E6GA 2LDMA 2EYQA 1SG5A 1WJQA 2EFIA 4MDXA 3CCSA 5FWBA 1M1KC 4LXCA 5GANh 2OTJA 3HRSA 5CQYA 3G6EA 1Q7YR 5LJ5h 3G4SA 1M3CA 3VV0A 5GMKm 5CKBA 3GPLA 5FLXE 1LPLA 3OW2S 1RAAB 3VS4A 2D0NA 2P0PA 1NYFA 4RTTA 2QYZA 4FT2A 2HCKA 3CCRT 2AKKA 3DKMA 3FB9A 1KQ2A 4M75A 3ME9A 3VJPA 1Q82U 2MI6A 1JBMA 5FU7B 2X35A 3JB9J 3OB9A 2DIGA 2DILA 1AD5A 3HTRA 4M7AF 3CCMT 3RKXA 4DOVA 2D8HA 1VQ5A 3M4GA 4OMFB 1N8RR 1VQ8A 1OEBA 5I11A 2BUDA 1ZUKA 3OYHA 2XDBA 3CMAA 2FZCB 2GFUA 1WZOA 2L3SA 1VQNQ 2RO0A 2QQSA 5GAOr 2M16A 5GAOm 2X51A 2R57A 2XU8A 1ZA2B 7AT1B 1TWBA 4F04B 1VQMQ 3RMSA 2LC4A 2RI5A 2P4RA 3I56Q 3PE0A 1K73C 3P8DA 4C0DC 4C5EA 3KXTA 3JB9I 1VQ6T 2KVQG 1GBQA 4DA4A 3CD6A 2A28A 5FROA 4J5YA 2DL5A 1RADB 3FJ5A 3EG9B 4JZ3A 1B3QA 4E7IA 2JTMA 4V2SA 3M54A 4LDVA 5I22A 5FU6B 5EG2A 8AT1B 1X2QA 1JU5C 1Y7XA 1GRIA 3CCUA 1FXXA 2QGFB 5FWCA 2RH2A 5DLOA 2MPXC 2PVDB 1VQOQ 2PQWA 3EH2A 4PL6A 3PGGA 2K4YA 2WSEE 4M77G 4J9BA 2K2VA 3T9NA 3CCLQ 4EMGA 1Y07A 2J05A 2QI2A 4J9FA 4E6RA 1EFNA 2L3PA 5FU7C 3JCMX 4N4HA 3BDUA 4Z02A 3J7AF 3FC3A 4A4FA 3GIBA 5I2SA 2P84A 4PNOA 4JLIA 1NZ9A 4CC7A 3OYCA 2ECZA 3VU3C 4QVDA 2E65A 2JNGA 1Q86U 1KG1A 2JW4A 2COYA 5CKFA 4X9CA 2KQWA 4M77B 4HCCA 3EG0A 2HBWA 3QSUA 2KRSA 1NEGA 2A0FB 2BE7D 4OP0A 2ABLA 4VUBA 1FYNA 4KGZB 5IAYA 4KH0B 3HPWA 2YRVA 2V1RA 3ZFJA 1OV3A 4LD9K 2KXCA 1K0XA 1R8OB 2JN0A 2EW3A 4PJLA 3I55A 4M7DG 3E9FA 4PJOE 1OPLA 1UHFA 1IXDA 3INZA 2CT3A 1XOVA 2PU9B 4IUQA 2COWA 1VQLA 4QVZA 3RMQA 2AHJB 3JRZA 1JEGA 3BDLA 2GGRA 4ZGDB 2JJ9A 1IGUA 2DXTA 4BUGA 1PRMC 5FU6C 1OU8A 2CP7A 2X4XA 4BE2A 5GMKe 3CMEA 2OAUA 1LVKA 4M7DB
chains in the Genus database with same CATH topology
3PMIA 3QPHA 5A0DA 1U8RA 4FSXA 4QW2A 3NTKA 3LYIA 4Q5WA 4JRKA 1K8AU 3C94A 3LH0A 4B9XA 5GAOn 1Q81U 2ZPEB 1QW1A 4KT0E 1UGRB 5GANe 1IREB 1YCYA 4FM4B 5GAOq 2QQBA 4M78F 5GAN7 2C06A 2K5IA 2OTLA 1X01A 3GNGA 3QO3A 4MMKA 3V8JA 3KBGA 4XTVA 4F7UF 5GAOp 3LWHA 5LJ5e 5CKEA 3SD4A 4M78B 1K73U 4M75D 3HKSA 3JCMJ 1B34A 2DKGA 4FL6A 4OGCA 3JSCA 4C8QC 2FL7A 2HAXA 3JCMQ 5HK0A 4BE0A 5CQXA 4L59A 2O4XA 4C0ZA 3SWNC 1N8RC 1VQ4A 2RJDA 3X28B 4HCZA 1WPYA 4E7LA 4NL3A 5KCOA 2GF7A 1YI2A 3CC7T 3CD6T 4M7AA 2RI3A 4Y28E 1YJNA 1I8FA 5GAMd 1JJ2A 2D0QB 4M75G 3LWIA 4C8QE 5GAN2 4MMLA 2LQKA 2QQAA 2HD0A 5LJ3h 1AHJB 3CCQA 3OBYA 3M57A 1WQ7A 2LVMA 2V8JA 4PJOA 2LCCA 3M59A 2BIVA 3PMTA 4MZTA 5GAMg 4ZGEB 3CCUT 2E10A 3CPWA 4DOWA 1UB4A 3OMCA 2E5QA 2O01E 2RA2A 4MZPA 2XDPA 5KE3A 1UEBA 3OYKA 4C0GA 5KCHA 4M77E 4QVCA 1G5VA 3QUIA 2RHXA 3L1AA 3VUBA 2VC8A 5GAMh 1IZ6A 4IURA 5GANd 1VQPA 4N0AA 2QA4T 5KH6A 3HFNA 1YHQT 2MWOA 2JVVA 4M75F 3OY9A 2ZPBB 1LNXA 1BI2A 2DZCA 2V8IA 1WNLA 2KMTA 2YHTA 1VQ7T 1FWZA 4BACA 1M90C 1M5Q1 2CYZB 1Q82U 4M75B 3SWNB 3QJYA 5L8RE 1HK9A 2Y4XA 4F7UA 5GANg 3OS5A 3JCMV 3DLMA 3UDCA 3OS0A 1KHCA 4CRIA 3OYLA 2DK3A 4XU1A 4A54A 2LT4A 2VXFA 3HRTA 1P92A 2DXBA 5LJ5g 4JDSA 4PKCC 1VQNA 2PUOB 3RKYA 3A5ZB 4XTZA 3JCMe 1BYMA 1N6AA 2XICA 1WJSA 3PNWC 4BI4A 2EIFA 5C6SA 4D6WA 1I81A 3MO8A 4HA8A 1Y71A 4X9DA 2DTIA 3M58A 1HXDA 4QQDA 4KUDK 3FEOA 1NE8A 2ZZDA 3J80E 3NTIA 1QVGA 2MMPA 2E6ZA 2GFAA 4ZGJB 3OW2A 2VXEA 2EQJA 2RB6A 2EWNA 3JCMW 4M7DC 2RI2A 5GAMj 1VQMA 1KQ1A 3V8LA 3C4SA 1BKBA 2CZ6B 5AYFA 3S3NA 5A0GA 2E41A 3DB4A 3G71T 5GMKj 5FRMA 3S3MA 5A0LA 1RL2A 4C5IA 2CZ7B 2LT1A 3CCRA 4FIBA 4M7DB 3I56T 4MDWA 3MEAA 2HNIA 5CK9A 1D3BA 5LJ3f 2JZ2A 4C8QA 3I55T 4M7DE 3ZBDA 3QIIA 3FRNA 1NJIC 1VQKA 3PFSA 3WXMB 1JB0E 4JRQA 3WVEB 1Q81C 5J26A 4A4KA 3PIPA 2QEXT 1KQSS 3CBPA 5GANj 1V29B 4BI3A 1NJIU 2Y90A 1MHNA 1G3WA 1NPRA 4P5NA 3OS2A 1VQLT 2RM4A 4OB1B 5D6XA 4A4GA 2FYKA 2EKOA 4LDYA 3DLLA 3JB9D 3L2QA 4IUTA 4J7IA 5LJ5j 3MEWA 1W2BS 4M77A 3CCMA 2X4YA 3JCMd 2LQ8A 3CCVT 2G3RA 4M78E 3M5AA 5J3BA 2F69A 3CCJA 4E7HA 2E64A 4JUVA 3AHUA 2X4JA 3H8ZA 1SSFA 2KY9A 2H3JA 5DM7R 2B8AA 4FT4A 2RJEA 3QKJA 4XTWA 3HSBA 4XU3A 2JTFA 2DZ9A 3GF5A 2A7YA 3CMET 3CPFA 1O9SA 1KC8U 2D6FA 3CCLA 1VQOT 3JCMg 4LDWA 1I4K1 3JB9G 3OYEA 2CKKA 4ZTJA 3J81E 3V7RA 3C95A 3MEUA 5GAN8 1BIBA 2XHCA 2R5MA 1YJ9A 3F70A 2LTOA 2CGHA 4X34A 2E70A 3OSVA 4R56A 4KUIA 4HT8A 3JCMh 5HY6A 1YITA 3VYGA 4OB3B 4NOYA 1N9RA 2FHDA 3HL8A 4HKEA 2DJZA 4KULA 2OTLT 1UGPB 4ZN1A 4M75C 1WGSA 2KAFA 3CBMA 4C92A 3CC4A 3OMGA 4OB2B 4BB7A 3E1SA 2RJFA 3URGA 3JCMb 3GLXA 3L2ZA 4QQ6A 1VQ6A 1VQ4T 2L5QA 3A8GB 2CS7A 1W4SA 1YI2T 1JJ2S 1Y96B 4ATOA 1YJNT 2I2LA 4J7FA 3GNFB 2IVWA 4M75E 4CI0C 3CEYA 2MAMA 4XQ3A 2DXCA 1M8VA 1OZ3A 4ELZC 5D6WA 4M7DA 4RKUE 2QQ9A 1OYXA 3CCQT 2LRQA 4L6V5 4BD3A 1YIJT 1XQHA 3CPWS 2DO3A 3RUXA 1M4ZA 4EDUA 4M77D 5HKCA 3L2VA 4HCBA 2RHZA 3A8LB 1QVFA 1GXIE 2DEQA 2JUFA 1K9MC 4J83A 5GAN5 3DB3A 3OS1A 4WF2A 2LCLA 2KSSA 4DQ2A 2DIQA 2QXFA 1UGQB 3FIFA 4J6YA 1BIAA 3M55A 3QHSA 4N4GA 3A8HB 3RKWA 3V8KA 1ZHIA 2EQUA 4M78A 4XU2A 2QQRA 3UWNA 1BI0A 5GMKh 5LJ5f 5LJ5d 1VQPT 4IKFA 5FRNA 1I5LA 3PIOA 2WACA 4J8OA 1OI1A 2GQVA 1Q7YC 5DLQE 3OYMA 3N5BB 2IG0A 1QP2A 4EMKB 1M90U 2LDMA 3EAEA 2EYQA 2L89A 2HQEA 5CR2A 2K5LA 1WJQA 2VGMA 3S3OA 2EFIA 4MDXA 2DD4A 2XIDA 5CO7A 4LDXA 4EPCA 2K57A 1KHIA 2QDYB 4C5HA 3CCSA 1NPPA 1M1KC 4O6JA 5GANh 2ZCFB 3HRSA 3OYCA 1S72A 5CQYA 4UC4A 2OTJA 2RHIA 3G6EA 1D3BB 2D9TA 1VQNT 1M1KU 3V7CA 4YTLA 3OYNA 1ZQ1A 3MP8A 1VUBA 4BY6C 4C92D 2F5KA 1ZBXA 5LJ5h 4ME7A 3LGFA 3G4SA 3VV0A 5D6YA 5GMKm 5GAN4 2KK4A 2VUBA 5CKBA 3GPLA 1Q86C 1QVGS 2XD0A 5FLXE 2XK0A 1EIFA 3OW2S 4BE1A 2PVGB 1M9SA 5CIUA 3WVDB 5HK3A 3TEEA 3M4YA 1VQMT 3QZ5B 3CC2A 1VQ9A 2P0PA 4JRIA 3R6OA 4C92G 4PJOD 2L8DA 3EFRA 4GLKA 3ZEHA 3TREA 3JAME 4M7AG 4RCCA 3VYHB 3KUFA 5CKHA 3META 2E1HA 3OYGA 4FT2A 3CCRT 3DKMA 3FB9A 1KQ2A 4M75A 1WQWA 1G3YA 4FU6A 3SWNA 2EJGA 3L2RA 2EJFA 1YJWA 4E7KA 3ME9A 3OYBA 3GOXA 4E7JA 1Q82C 1VQKT 5I2MA 1JRIA 3TU4K 4PJOG 4A4EA 3VJPA 2P4TA 2JOYA 2K3YA 5LJ3e 1LOJA 1N9SA 5GAMf 4BDYA 2MI6A 1JBMA 4M78D 1TH7A 2X35A 4O5VA 5FU7B 4XTYA 3LW5E 5GMKi 3JB9J 3OB9A 2DIGA 1B34B 1M1FA 3MP6A 3OQ5A 3A8MB 3E19A 3QBYA 4BY6B 1N8RU 3Q1JA 4M7AF 4PLIA 3CCMT 5GAN6 3GP8A 2O4XB 3CCJT 1PSFA 3RKXA 4B9WA 4OB0B 2KDSA 4DOVA 5A2QE 2VGNA 4XK8E 3V7SA 4M7AB 3CXCA 3M4GA 4OMFB 3CCEA 1VQ5A 1VQ8A 3OYHA 2BUDA 2XDBA 3CMAA 2XI9A 2ZPGB 4RMOA 2GFUA 3CCLT 3QXEB 2F5TX 3BY7A 4PJOF 4F7UG 1U1TA 4JJNK 4XU0A 1YIJA 5GANf 3UT1A 5IT9E 2EQKA 4ELYC 2RO0A 1YBYA 3QYGB 4PJOB 2FB7A 1K8AC 1YJ9T 1X6OA 2QQSA 2XG8D 2M16A 5GAOm 5GAOr 4JS5A 2DTOA 4IUVA 2R57A 2XU8A 3FDRA 1YITT 2DTHA 1PSEA 3RMSA 4EMKC 3BFMA 3FJPA 2V8KA 2LC4A 3JB9F 4RG8A 1QP3A 4II1A 2RI5A 5CKDA 2K3XA 2HQXA 3QDRB 4NS5A 1K73C 4M7AD 1OZ2A 3SDZA 3CC4T 2EAYA 4C8QD 3P8DA 4C0DC 1BI3A 2BKDN 1MGQA 5LJ3d 5IN1A 4XTXA 4C5EA 4Y91A 3KXTA 3JB9I 3L2WA 4RCBA 3X25B 1VQ6T 2KVQG 3A8OB 4DA4A 3LLRA 2P0QA 2NLUA 3CC7A 3CD6A 4EMHA 4F7UB 1VIEA 4PLLA 5FROA 2DVEA 4J5YA 2LNVA 3HHTB 4MZMA 5M9OA 3M53A 5LJ3g 4OGEA 4V2SA 4E7IA 2JTMA 2L3RA 2WSFE 2ZPIB 3E9GA 3M54A 4LDVA 4IUPA 5FU6B 4C8QG 5EG2A 3S6WA 3P8BB 2GCXA 1Y7XA 4TVRA 4M77C 1QVFS 4J6XA 3OYJA 1FXXA 3CCUA 1H3ZA 1G3SA 1K9MU 4IUUA 1XNIA 4RG2A 2R58A 2RH2A 5DLOA 2PVDB 2ZGWA 4NL2A 2DD5A 2PQWA 3X26B 4JRPA 4XTUA 4OF1A 2Y4YA 4PL6A 3PGGA 3X20B 5GAOl 2K4YA 3JCMP 2WSEE 4M77G 4JS4A 2K2VA 2PVOB 1G3TA 4ZTFA 2MF2A 3T9NA 2QA4A 5C0MA 2X4WA 4EMGA 1YHQA 3HFOA 2XKOC 1Y07A 3ASKA 2RHYA 3QZ9B 1Q7YU 2QI2A 5DY9A 4C8QF 3OYAA 2RHUA 4LDUA 2K5FA 4C0DB 1XTDA 2RJCA 1VQ7A 3CBOA 3NTHA 4BI8B 5FU7C 4A53A 3L42A 1Y96A 3JCMf 4C8QB 3JCMX 4N4HA 2ZPFB 1KD1C 3CCST 2CZ0B 3BDUA 3OA6A 4Z02A 3J7AF 2OTJT 3FC3A 1UGSB 3VUZA 1S72T 4A4HA 4A4FA 1M1GA 3G6ET 3GIBA 2FVUA 3RESA 3X24B 5I2SA 3BW1A 4JLIA 1NZ9A 2E6NA 1H641 4PNOA 3RIRA 4C92C 2EQMA 3P8HA 4M77F 3VU3C 4QVDA 2E65A 2P0KA 2JNGA 5J39A 3OYYA 3QYHB 1Q86U 1KD1U 4M7AC 3SFMA 5LJ3j 5GAN3 3G4ST 2RK1A 3HP9A 5I21A 4C5GA 1KG1A 3ER0A 5CKFA 4X9CA 2KQWA 2A3LA 1DJ7B 4M77B 1U1SA 3LGLA 3OSSC 4R55A 3OYIA 1QVPA 4HCCA 1WJRA 3UPUA 3QSUA 5CVIA 3QJ6A 3MP1A 2CZ1B 5LL6S 4M7DD 3O8VA 4OP0A 3FLGA 3CC2T 1VQ9T 3VKIA 4VUBA 4PJOC 4C92E 5IAYA 3MHXA 3G71A 1X75C 3HPWA 4M7AE 2YRVA 3HRUA 3SB2A 3ZFJA 3LX7A 5CCAA 4LD6A 4J6WA 3OYFA 3L2UA 4LD9K 4EMKA 3PT9A 2RD1A 4ZN3A 3I56A 1RI0A 2ZPHB 4QQGA 1YJWT 1R8OB 2JN0A 3JB9H 3OBWA 3I55A 1O75A 2M9UA 4N0AC 4M7DG 4OVAA 2RK2A 3C12A 3E9FA 4L5GA 3MCAB 4PJOE 2DXUA 2QEXA 4C92F 2VYTA 3INZA 4M78C 2PU9B 1XOVA 4IUQA 1KQSA 3MEVA 4GY5A 1VQLA 4N4IA 2M0OA 4QVZA 3RMQA 5KE2A 4JLGA 4C0FA 4BDZA 3RERA 1VIFA 2AHJB 4C92B 3JRZA 3EFSA 2M1HA 5GMKl 3BDLA 2DAQA 3NFCA 2HBPA 4ZGDB 3CCVA 3JCMc 5GAMe 3PTAA 2DXTA 4BUGA 2EJ9A 3TCJA 4M78G 5CAIA 1FX7A 1W2BA 3G7ZA 2DPPB 3M9QA 5FU6C 3CXCS 1N27A 2LX9A 2MWPA 2R5AA 2X4XA 2YLCA 4HT9A 4BE2A 4XAXB 5GMKe 3OYDA 1VQ5T 3CMEA 1VQ8T 3CCET 3M56A 4M7DF 2E12A 2VV5A 3CMAT 2OAUA 2QTXA 3QG1A 1VQOA 4KBMB 3H6ZA 4E47A 4F7UE 1KC8C 2PUKB 2YLBA 1BI1A 2XDDA 1LJOA 2WSCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  4PJO A;  1D3B A;  5LJ3 f;  4C8Q A;  4C8Q G;  5GAN h;  4M7D E;  4JRK A;  5GAO n;  1D3B B;  3V7C A;  4M77 C;  5GAN e;  4J6X A;  1YCY A;  4C92 D;  5GAO q;  5LJ5 h;  5GAN j;  4M78 F;  2Y90 A;  5GAN 7;  5LJ5 d;  1X01 A;  5GMK m;  5GAN 4;  4M7A D;  2RM4 A;  2ZGW A;  4NL2 A;  3JCM W;  3QO3 A;  2FYK A;  4MMK A;  3V8J A;  4XTV A;  4F7U F;  5GAO p;  5LJ5 e;  3JB9 D;  4XTU A;  4M78 B;  5LJ5 j;  3PGG A;  4M75 D;  5GAO l;  3JCM J;  1B34 A;  2DKG A;  4M77 G;  4M77 A;  4C8Q C;  3JCM d;  3JCM P;  4M78 E;  3JCM Q;  2E64 A;  4JUV A;  3AHU A;  4EMG A;  3HFO A;  4JRI A;  3SWN C;  1WPY A;  4XTW A;  4C92 G;  3HSB A;  4PJO D;  3EFR A;  4XU3 A;  5DY9 A;  4C8Q F;  4NL3 A;  2DZ9 A;  4M7A A;  4M7A G;  4RCC A;  4HT8 A;  1I8F A;  3JCM g;  2E1H A;  5GAM d;  4A53 A;  1I4K 1;  3JB9 G;  1Y96 A;  3FB9 A;  3JCM f;  4C8Q B;  1KQ2 A;  4M75 A;  1WQW A;  4M75 G;  3SWN A;  3V7R A;  2EJG A;  3JCM X;  2EJF A;  5GAN 8;  4C8Q E;  3BDU A;  1BIB A;  4MML A;  5GAN 2;  5LJ3 h;  3GIB A;  2CGH A;  3RES A;  3BW1 A;  1WQ7 A;  4JLI A;  4PNO A;  1H64 1;  1JRI A;  3RIR A;  4PJO G;  4C92 C;  4M77 F;  3JCM h;  3VU3 C;  4QVD A;  5GAM g;  2E65 A;  4NOY A;  2E10 A;  4M7A C;  5LJ3 e;  1LOJ A;  1N9S A;  1N9R A;  5GAM f;  1JBM A;  4M78 D;  1TH7 A;  2DJZ A;  5LJ3 j;  5GAN 3;  4XTY A;  5I21 A;  5GMK i;  2RA2 A;  3JB9 J;  4X9C A;  1B34 B;  4M77 B;  1U1S A;  4M75 C;  4M7A F;  4M77 E;  4C92 A;  4QVC A;  3QSU A;  3QUI A;  3L1A A;  5GAN 6;  2VC8 A;  5GAM h;  5GAN d;  4N0A A;  3RKX A;  4M7D D;  4OP0 A;  3HFN A;  3JCM b;  4M75 F;  3V7S A;  3L2Z A;  4M7A B;  4PJO C;  4C92 E;  1LNX A;  3M4G A;  2DZC A;  1WNL A;  4M7A E;  2YHT A;  3SB2 A;  1Y96 B;  1M5Q 1;  2I2L A;  4J6W A;  4M75 B;  3SWN B;  4EMK A;  1HK9 A;  2RD1 A;  3BY7 A;  4PJO F;  4F7U G;  1U1T A;  3JCM V;  4F7U A;  5GAN g;  4M75 E;  4XU0 A;  5GAN f;  2JN0 A;  3JB9 H;  4XQ3 A;  4A54 A;  4XU1 A;  1M8V A;  2VXF A;  4M7D A;  4N0A C;  4M7D G;  2FB7 A;  4PJO B;  5LJ5 g;  5GAO r;  5GAO m;  3RKY A;  4XTZ A;  3JCM e;  2DTO A;  2DXU A;  4PJO E;  4C92 F;  4HT9 A;  3RUX A;  4M77 D;  3INZ A;  1I81 A;  4M78 C;  4HA8 A;  4X9D A;  2DTH A;  2DEQ A;  2DTI A;  1HXD A;  3RER A;  5GAN 5;  4EMK C;  4WF2 A;  3BFM A;  3FJP A;  3JB9 F;  4C92 B;  4DQ2 A;  4M7D C;  3EFS A;  5GAM j;  3FIF A;  5GMK l;  4J6Y A;  1BIA A;  2VXE A;  3QHS A;  3JCM c;  2RB6 A;  2EWN A;  3RKW A;  3V8K A;  2DXT A;  5GAM e;  2EAY A;  2EJ9 A;  4M78 G;  4M78 A;  1KQ1 A;  4XU2 A;  3V8L A;  4C8Q D;  5CAI A;  5GMK h;  5LJ3 d;  1MGQ A;  1I5L A;  4XTX A;  4Y91 A;  2E41 A;  2YLC A;  4RCB A;  3JB9 I;  5GMK e;  5GMK j;  4EMK B;  4M7D F;  4EMH A;  4F7U B;  2QTX A;  4F7U E;  5LJ5 f;  2DVE A;  4J5Y A;  2YLB A;  2K57 A;  5LJ3 g;  4M7D B;  1LJO A;  4V2S A; 
#chains in the Genus database with same CATH topology
 2K6D A;  1U8R A;  4FSX A;  1K8A U;  4JRK A;  4B9X A;  4DBQ A;  4J9C A;  3M0U A;  4KT0 E;  4QT7 A;  5IXF A;  4IIO A;  1IRE B;  2B86 A;  5GAN 7;  3GNG A;  4MMK A;  1Q81 R;  3KBG A;  4XTV A;  3NGP A;  4F17 A;  2MOX A;  4M75 D;  3HKS A;  1G8X A;  3JSC A;  2W0Z A;  4BE0 A;  2AK5 A;  4L59 A;  1VQK Q;  1TTH B;  1YJW Q;  4GLM A;  4NL3 A;  2GF7 A;  3CC7 T;  1WXB A;  1YJN A;  5GAM d;  1M3B A;  1BK2 A;  2D0Q B;  1AEY A;  5GJV B;  4C8Q E;  5GAN 2;  4MML A;  2QQA A;  2YRD A;  3CCQ A;  2CP2 A;  2LVM A;  4PJO A;  5KYU A;  2BIV A;  3PMT A;  4DOW A;  1C0M A;  3M0T A;  3OMC A;  1ZA1 B;  2O01 E;  4MZP A;  2M0Y A;  1ABO A;  3OYK A;  4C0G A;  2GNC A;  3CCE Q;  4QVC A;  2YRC A;  3L1A A;  3VUB A;  3HFN A;  1UEC A;  1YIJ Q;  6AT1 B;  1N5Z A;  4JZ4 A;  2AZV A;  1ZX6 A;  4PFO A;  2AIR B;  1KIK A;  3OS5 A;  3DLM A;  1V1C A;  3EHR A;  4CRI A;  2HMA A;  4XU1 A;  3RDV A;  1MNE A;  1P92 A;  1RAG B;  2KT8 A;  1VQN A;  3RKY A;  3A5Z B;  4KGX B;  2XIC A;  2DYB A;  2RNA A;  5C6S A;  1GCQ A;  2K3B A;  4OMP A;  4HA8 A;  1M90 R;  3M58 A;  4QQD A;  4KUD K;  4FYW B;  1AZG B;  3NTI A;  2E6Z A;  4ZGJ B;  1G2B A;  2O9V A;  4M7D C;  1UFF A;  4PJN A;  5GAM j;  1VQM A;  3C4S A;  3VS6 A;  3DB4 A;  1M27 C;  2HL5 C;  4B6M A;  1I5O B;  5FRM A;  1K1Z A;  4C5I A;  4FIB A;  3I56 T;  2CRE A;  2JM8 A;  5CK9 A;  4FW2 A;  4C8Q A;  3ZBD A;  3QII A;  3EG3 A;  3WVE B;  4JPB W;  3PIP A;  1SF9 A;  3QWY A;  3UAT A;  1TOV A;  1G3W A;  1WXU A;  1T0H A;  2FYK A;  2CP0 A;  2JT4 A;  3JB9 D;  3MEW A;  2BZX A;  2LQ8 A;  3CCV T;  1NJI R;  3H8Z A;  2H3J A;  3G6E Q;  5DM7 R;  4FT4 A;  3QKJ A;  4XTW A;  3HSB A;  1SRM A;  2JTF A;  2DZ9 A;  3GF5 A;  1O9S A;  2DL4 A;  3EGX A;  1TU0 B;  2LNH B;  1VQO T;  3CCL A;  1I4K 1;  2CKK A;  4ZTJ A;  2E3H A;  5GAN 8;  1AZE A;  1VOM A;  1PG5 B;  3OSV A;  2HL3 A;  8ATC B;  1BCO A;  2FHD A;  2DJZ A;  4KUL A;  5FW9 A;  2OTL T;  3ZL7 C;  1T0J A;  1WGS A;  2QGG A;  1PKT A;  4OB2 B;  4BB7 A;  3JCM b;  2EBP A;  1WHH A;  2L5Q A;  2CDT A;  1YI2 T;  1MND A;  2I2L A;  4J7F A;  2FG0 A;  2IVW A;  2LQW A;  4CI0 C;  1TUG B;  4XQ3 A;  3EFO B;  2QQ9 A;  2LRQ A;  2OX7 A;  1XQH A;  3CPW S;  3EGD B;  3RUX A;  4EDU A;  4M77 D;  1GXI E;  2RHZ A;  1VQ8 Q;  3PVL A;  3VS2 A;  1FMV A;  1XJW B;  3CMA Q;  4AMC A;  2KSS A;  4DQ2 A;  4N4G A;  3RKW A;  4XU2 A;  5GMK h;  2X9H A;  4IIM A;  1Q7Y C;  4EMK B;  4RUG A;  3EAE A;  1MMA A;  2L3Q A;  2L89 A;  2K5L A;  5KYN A;  2DD4 A;  1NM7 A;  4EPC A;  2K57 A;  2W10 A;  1KHI A;  4C5H A;  1JJ2 P;  4O6J A;  1K0S A;  4FCY A;  2D9T A;  1ZLM A;  3V7C A;  1M1K U;  1C1A A;  4BY6 C;  2F5K A;  1ZBX A;  1GFC A;  3CD6 Q;  1QVG S;  2CUD A;  1EIF A;  4AT1 B;  1M9S A;  3WVD B;  3TEE A;  1BU1 A;  3M4Y A;  1VQ9 A;  4JRI A;  1V76 A;  4C92 G;  4DEY A;  4PJO D;  1RI9 A;  2ED0 A;  3ZEH A;  1Q86 R;  3CCU Q;  3JAM E;  4M7A G;  3EG2 A;  4RCC A;  4PJM A;  5CKH A;  3OYG A;  2E1H A;  3M0S A;  1HYO A;  4EIK A;  3L2R A;  3SWN A;  1YJW A;  1YNZ A;  2EJF A;  1IO6 A;  3GOX A;  4E7J A;  1VQK T;  4HXJ A;  2EYW A;  5KYX B;  1GCP A;  2P4T A;  2JOY A;  1N9S A;  5GAM f;  1N8R C;  1M8M A;  2HSP A;  3LW5 E;  5GMK i;  1PNJ A;  1B34 B;  3OQ5 A;  4PLI A;  2M02 A;  2O4X B;  3CCJ T;  3REA B;  1CKA A;  4B9W A;  2KDS A;  2VGN A;  1Y0M A;  4XK8 E;  4M7A B;  1BCM A;  1SHF A;  3CCE A;  4J9H A;  1RAE B;  2XI9 A;  3QXE B;  5ECA A;  4JJN K;  1YIJ A;  1KK7 A;  2M51 A;  3QYG B;  1YJ9 T;  4JS5 A;  1KQS P;  4R0K A;  3FDR A;  4EMK C;  2V8K A;  4NS5 A;  1B07 A;  1OZ2 A;  1K8A R;  2EAY A;  4C8Q D;  3NMZ C;  3I55 Q;  4J9E A;  5LJ3 d;  5IN1 A;  2RQW A;  4Y91 A;  4RTV A;  3L2W A;  4RCB A;  3A8O B;  2P0Q A;  4EMH A;  2EGE A;  1VQL Q;  2DVE A;  4MZM A;  2OJ2 A;  2K7A A;  5M9O A;  4OGE A;  3VS5 A;  2L3R A;  2ZPI B;  1X2K A;  3S6W A;  1QVF S;  1G3S A;  1K9M U;  4RG2 A;  3CME Q;  4NL2 A;  1PHT A;  2Y4Y A;  4RTZ A;  1TUD A;  1YHQ A;  3M0Q A;  1WI7 A;  2RHU A;  1Y57 A;  4C0D B;  1XTD A;  2NUP B;  3NTH A;  2J06 A;  4OMM A;  4A53 A;  1CKB A;  1YIT Q;  3CCS T;  2EYZ A;  1EZZ B;  2OTJ T;  4A4H A;  2FPF A;  3G6E T;  2FVU A;  3RES A;  3X24 B;  3BW1 A;  4C92 C;  2FRW A;  2A08 A;  2EQM A;  2P0K A;  1KD1 U;  3OYY A;  3QYH B;  4M7A C;  3CC4 Q;  3SFM A;  5LJ3 j;  1ABQ A;  3G4S T;  4LE9 A;  4C5G A;  1YJN Q;  1DJ7 B;  3LGL A;  3OSS C;  1AWX A;  3QJ6 A;  2AKL A;  3MP1 A;  1RUW A;  3VKI A;  1U3O A;  3CCQ Q;  2SRC A;  1UG1 A;  2DYI A;  2AZS A;  2FPD A;  2RD1 A;  2M9U A;  4OVA A;  3C12 A;  1U06 A;  4HVV A;  2DXU A;  4C92 F;  4M78 C;  1KQS A;  4GY5 A;  4ORZ A;  3VRZ A;  4BDZ A;  1AWJ A;  2HBP A;  1M2V A;  1W2B A;  1JXO A;  2QAZ A;  1W1F A;  2E4H A;  2DPP B;  3M9Q A;  3G7Z A;  2R5A A;  4FW1 A;  2OI3 A;  4XAX B;  1VQ5 T;  1VQ8 T;  1D0X A;  2CH4 A;  2DL3 A;  3M56 A;  3CMA T;  2QTX A;  1OQK A;  4E47 A;  4LUD A;  1NLP C;  1Q81 C;  1LJO A;  2WSC E;  2CT4 A;  1CSK A;  3PMI A;  2RQR A;  2DJQ A;  3LYI A;  3JV3 A;  3C94 A;  3LH0 A;  2RPN A;  4M78 F;  2QAS A;  4CC2 A;  3CC2 Q;  3SD4 A;  3A98 A;  4FL6 A;  5HK0 A;  1I0C A;  2RJD A;  3X28 B;  4HCZ A;  1X6B A;  4E7L A;  1EX4 A;  3CD6 T;  1WLP B;  3LWI A;  2LQK A;  2HD0 A;  2NYS A;  1D1B A;  3M57 A;  1WQ7 A;  2V8J A;  5GAM g;  4MZT A;  3CCU T;  4ZGE B;  1TG0 A;  1UB4 A;  5IHN A;  1MMG A;  3UA7 A;  1UEB A;  1RAF B;  2F2X A;  4M77 E;  1G5V A;  1KJW A;  1WX6 A;  2VC8 A;  1IZ6 A;  5GAM h;  5GAN d;  3RNJ A;  5KH6 A;  4M75 F;  3OY9 A;  1FWZ A;  1M90 C;  1M5Q 1;  4J9D A;  3QJY A;  5L8R E;  1HK9 A;  4X1V A;  1TS9 A;  1IGQ A;  4HVU A;  3OYL A;  2VXF A;  3NPF A;  3EG9 A;  4K11 A;  1BYM A;  4XTZ A;  4CC4 B;  4BI4 A;  1FMW A;  2F1L A;  4X9D A;  2DTI A;  2VVK A;  1NE8 A;  2ZZD A;  4E7Z A;  2MMP A;  2GFA A;  2RI2 A;  4PFZ A;  4Z89 A;  5AYF A;  5A0G A;  2E41 A;  1RAB B;  2LT1 A;  4Y92 A;  1HD3 A;  1LCK A;  2YUP A;  1E6H A;  2O31 A;  1D3B A;  5LJ3 f;  3I55 T;  4M7D E;  3CQT A;  3FRN A;  1NJI C;  1BBZ A;  1AWO A;  3PFS A;  2L2P A;  3WXM B;  2F2V A;  4JRQ A;  4A4K A;  3CBP A;  5GAN j;  1MHN A;  2KE9 A;  4P5N A;  1VQL T;  2QA4 Q;  1SKU B;  4OB1 B;  3DLL A;  2HQH A;  2BZY A;  5KYY B;  5LJ5 j;  4M77 A;  3JCM d;  2G3R A;  5J3B A;  4E7H A;  2LJ1 A;  3AHU A;  2KY9 A;  2B8A A;  2RJE A;  1PM3 A;  2PTK A;  1X27 A;  3CME T;  2A7Y A;  4RTY A;  1KC8 U;  4JJC A;  4JJB A;  1D1C A;  3SHW A;  3MEU A;  4X34 A;  3D7S B;  4KUI A;  1VQ9 Q;  1YIT A;  3VYG A;  5KYW A;  5KYU B;  1MUZ A;  1PWT A;  1W70 A;  4KRT A;  1SPK A;  3CC4 A;  1QCN A;  3OMG A;  2KRO A;  3CXC P;  3URG A;  1YN8 A;  2CS7 A;  1UGV A;  2HEQ A;  1Y96 B;  4ATO A;  1YJN T;  1SSH A;  1OPK A;  3CEY A;  4M4Z A;  2DXC A;  5D6W A;  4M7D A;  4RKU E;  3CCQ T;  2COZ A;  2JMC A;  5HKC A;  3I35 A;  1M4Z A;  4HT9 A;  2DEQ A;  4J83 A;  3EGU A;  5GAN 5;  3OS1 A;  1JO8 A;  2CSQ A;  2JXB A;  2YSQ A;  4ESR A;  4J6Y A;  3IQL A;  1BIA A;  2EKH A;  2EQU A;  5FRN A;  3UWN A;  4IKF A;  1I5L A;  3PIO A;  4J8O A;  1OI1 A;  2GQI A;  2GQV A;  5DLQ E;  1K9M R;  2IG0 A;  1QP2 A;  2JMA A;  2EGA A;  5CR2 A;  2ZCF B;  1S72 A;  4UC4 A;  2RHI A;  1WHK A;  1VQN T;  4YTL A;  3OYN A;  1ZQ1 A;  3MP8 A;  2DA9 A;  3LGF A;  1Q86 C;  2DLP A;  2KK4 A;  2VUB A;  2XD0 A;  3THK A;  3CPW P;  4BE1 A;  1OX8 A;  3REB B;  5CIU A;  1VQM T;  3CC2 A;  2A37 A;  4GLK A;  1KD1 R;  3TRE A;  1NBE B;  1VYV A;  4AG1 C;  3VYH B;  3KUF A;  3MET A;  3M0P A;  3AT1 B;  1WQW A;  4FU6 A;  2EJG A;  1PKS A;  1AT1 B;  2VAS A;  4E7K A;  2AT1 B;  2GTO A;  1PRL C;  5I2M A;  1YHQ Q;  2LP5 A;  2K3Y A;  2C0I A;  3RBB B;  1LOJ A;  2L0A A;  4BDY A;  3H0F A;  4O5V A;  1VQP Q;  4XTY A;  4HCK A;  3MP6 A;  3QBY A;  1K76 A;  4BY6 B;  1N8R U;  3Q1J A;  1QVG P;  5GAN 6;  3GP8 A;  1Q82 R;  5A2Q E;  3V7S A;  3CXC A;  4J9G A;  4KGV B;  2DBM A;  1KFZ A;  4RMO A;  3KFV A;  1MV3 A;  3CCL T;  1U5S A;  2F5T X;  3BY7 A;  4PJO F;  4F7U G;  1U1T A;  5GAN f;  1M2O A;  5IT9 E;  2EQK A;  4ELY C;  1YBY A;  1K8A C;  4RTU A;  4IUV A;  2MYS A;  2DTH A;  1KSW A;  1PSE A;  9ATC B;  3BFM A;  3FJP A;  2EYY A;  1S1N A;  4RG8 A;  2KYB A;  2LJ3 A;  5CKD A;  2K3X A;  3QDR B;  3SDZ A;  4D8D A;  3X25 B;  2K2M A;  4F7U B;  4PLL A;  2E3I A;  1YP5 A;  3HHT B;  3M53 A;  5LJ3 g;  2DL8 A;  1QWE A;  3UF4 A;  4IUP A;  3P8B B;  1TXQ A;  2GCX A;  4TVR A;  2HSE B;  1H3Z A;  1WHG A;  2KXD A;  1XNI A;  4F14 A;  2R58 A;  2ZGW A;  1OUL A;  2DD5 A;  3X26 B;  4OF1 A;  2YXY A;  5GAO l;  1G3T A;  5IH2 A;  2QA4 A;  5C0M A;  2X4W A;  2J6F A;  1RLQ C;  3QZ9 B;  5DY9 A;  4C8Q F;  3OYA A;  1VQ7 A;  4FYV B;  3CBO A;  4Z88 A;  3L42 A;  1UJY A;  3JCM f;  1UUE A;  2ZPF B;  2D8J A;  3QWX X;  1ZSZ B;  2X3W D;  1UGS B;  3VUZ A;  1M1G A;  3EFO A;  4PFP A;  3RIR A;  3P8H A;  5J39 A;  4ZNX A;  2PZ1 A;  3EGD A;  3MJX A;  2RK1 A;  3HP9 A;  5AT1 B;  3ER0 A;  2CP6 A;  2A3L A;  1QVF P;  1U1S A;  4R55 A;  3OYI A;  2CZ1 B;  1MV0 B;  2F2W A;  4M7D D;  2NUT A;  3FLG A;  1VQ9 T;  2KR3 A;  4C92 E;  2RF0 A;  3G71 A;  1X75 C;  1WFW A;  4M7A E;  3EHQ A;  3SB2 A;  3LX7 A;  3L2U A;  4LD6 A;  4J6W A;  5IXB A;  3OYF A;  4EMK A;  3PT9 A;  4ZN3 A;  1RI0 A;  4QQG A;  1YJW T;  3JB9 H;  3OBW A;  4N0A C;  2RK2 A;  4GBQ A;  3MCA B;  2QEX A;  1NLO C;  2CH4 W;  1WA7 A;  3MEV A;  4N4I A;  5KE2 A;  4C92 B;  3TVT A;  3OW2 P;  3EFS A;  2M1H A;  3NFC A;  5GAM e;  5CAI A;  4M78 G;  1FX7 A;  4RTX A;  1RAH B;  1N27 A;  2LX9 A;  3LH5 A;  1I1J A;  3OYD A;  3CCE T;  2DFU A;  5L23 A;  4KBM B;  3H6Z A;  2KGT A;  2YLB A;  3JCM P;  2XDD A;  1YIJ T;  3QPH A;  5A0D A;  3NTK A;  3MKD A;  4Q5W A;  1Q81 U;  2ZPE B;  1UGR B;  3QDF A;  1YCY A;  4FM4 B;  5GAO q;  2J6K A;  2QK0 A;  3MPU B;  5KYX A;  1KC8 R;  1X01 A;  2C06 A;  2GTJ A;  2YUO A;  3V8J A;  4F7U F;  5CKE A;  4M78 B;  1K73 U;  3JCM J;  1B34 A;  2DKG A;  4OGC A;  2FL7 A;  1ZSZ C;  1OOT A;  2O4X A;  4C0Z A;  3SWN C;  1VQ4 A;  1WPY A;  2MIO A;  1Z9Z A;  1YWP A;  1X43 A;  5KCO A;  4M7A A;  1YWO A;  2RI3 A;  2KYM A;  2FRY A;  3G1J A;  1I8F A;  1JJ2 A;  2DEU A;  4M75 G;  3VS7 A;  2KI7 A;  2KRN A;  1ARK A;  2ATC B;  3H9N A;  1QQJ A;  2E10 A;  5EC7 A;  2E5Q A;  5KE3 A;  5KCH A;  2O2O A;  2RHX A;  4AFU C;  1VQP A;  4IUR A;  2ROL A;  4AG2 C;  1YHQ T;  2VB6 A;  2PNI A;  1GFD A;  2JVV A;  4DBR A;  1LNX A;  1BI2 A;  1WNL A;  2KMT A;  4BAC A;  2CYZ B;  4M75 B;  2RQU A;  4AFQ C;  2Y4X A;  3E2U A;  1H8K A;  2CSI A;  5GAN g;  3JCM V;  2DK3 A;  4A54 A;  2LT4 A;  4WTO B;  1IRX A;  5LJ5 g;  4JDS A;  2E5K A;  1YFN A;  1N6A A;  3PNW C;  2EIF A;  2YUN A;  4D6W A;  1E7O A;  2FZK B;  3FEO A;  3OW2 A;  2EQJ A;  2RB6 A;  3CC7 Q;  1KQ1 A;  1BKB A;  2RQT A;  4AFS C;  1M2V B;  2A36 A;  5GMK j;  2XMF A;  4KH1 B;  5A0L A;  4LN2 A;  2EVR A;  3CCR A;  2NUP A;  4PJJ A;  2H8H A;  4MDW A;  2HNI A;  2JZ2 A;  2H3E B;  2ZAE A;  4PK4 A;  1Z9Q A;  1ZSG A;  5J26 A;  4LNP A;  1KQS S;  1WHL A;  1QKX A;  4BI3 A;  1NJI U;  3M0R A;  1NPR A;  5IHI A;  4A4G A;  2EKO A;  1BB9 A;  4IUT A;  4J7I A;  2J7I A;  1W2B S;  3CCM A;  2X4Y A;  3M5A A;  2F69 A;  2E64 A;  2X4J A;  1S72 Q;  1SSF A;  3H0H A;  3GBQ A;  4XU3 A;  3VS1 A;  1B7T A;  1A0N B;  2V1Q A;  3JCM g;  2I0N A;  1G83 A;  3JB9 G;  4OMQ A;  3OYE A;  2XHC A;  2HKN A;  2R5M A;  1IHV A;  2LTO A;  2E70 A;  4HT8 A;  3JCM h;  2RMO A;  4OB3 B;  1N9R A;  1D0Y A;  2Z0W A;  1YCS B;  4ZN1 A;  4M75 C;  1W6X A;  2KAF A;  3CBM A;  1C6V X;  2KRM A;  3E1S A;  1R0C B;  1VQ6 A;  3L2Z A;  4QQ6 A;  1VYT A;  1GBR A;  2DMO A;  3A8G B;  2KEA A;  2O88 A;  1R0B G;  5IHK A;  3GNF B;  2YUQ A;  3NHN A;  1Q95 G;  4ELZ C;  3VRY A;  4L6V 5;  2YWW A;  3L2V A;  4HCB A;  3A8L B;  3I9Q A;  3CCV Q;  2JUF A;  1K9M C;  2NWM A;  4WF2 A;  2LX7 A;  1UGQ B;  1PCX A;  2MK5 A;  3M55 A;  1X6G A;  3A8H B;  3V8K A;  3OYJ A;  5LJ5 d;  2IIM A;  2WAC A;  2DRM A;  3N5B B;  2EPD A;  1QCF A;  1GL5 A;  2HQE A;  2VGM A;  3S3O A;  1WIE A;  2XID A;  5CO7 A;  4LDX A;  2QDY B;  1NPP A;  2ED1 A;  2OTL Q;  1D3B B;  4A63 B;  1VUB A;  4C92 D;  4LUE A;  2YT6 A;  4ME7 A;  1KD1 C;  5GAN 4;  5D6Y A;  4M7A D;  4FYX B;  1AWW A;  2XK0 A;  1M1K R;  1UTI A;  1AOJ A;  2PVG B;  1OU9 A;  1YI2 Q;  5HK3 A;  3QZ5 B;  3R6O A;  2L8D A;  3EFR A;  2QDL A;  3TSW A;  1WHJ A;  3H0I A;  3I5S A;  1G3Y A;  5HCK A;  1WYX A;  4FYY B;  3OYB A;  1Q82 C;  1JRI A;  3TU4 K;  1QMC A;  4PJO G;  4A4E A;  5LJ3 e;  1M3A A;  4M78 D;  1TH7 A;  2DET A;  1VQ7 Q;  2DE0 X;  3EH1 A;  2X3X D;  4E7S A;  5KYW B;  1NYG A;  1M1F A;  3A8M B;  3E19 A;  3H41 A;  2VWF A;  4DBH A;  2IPO B;  2D1X A;  1HSQ A;  1K9A A;  1K4U S;  1PSF A;  4OB0 B;  1WXT A;  2C0O A;  2ZPG B;  2ESW A;  2BTT A;  4XU0 A;  3UT1 A;  4PJO B;  2FB7 A;  1X6O A;  2DX1 A;  2XG8 D;  2EGC A;  2DTO A;  1YIT T;  3G71 Q;  3A1P A;  1RAC B;  2RN8 A;  3JB9 F;  1QP3 A;  4II1 A;  2HQX A;  3CC4 T;  5KYY A;  2J6O A;  2FO0 A;  1BI3 A;  2BKD N;  1MGQ A;  4XTX A;  1WDX A;  2LMJ A;  2QEX Q;  3LLR A;  2NLU A;  3CC7 A;  1VIE A;  2LNV A;  4OMN A;  1K73 R;  1UJ0 A;  2WSF E;  1VYU A;  3C0C A;  3E9G A;  4C8Q G;  2DL7 A;  2KT1 A;  4M77 C;  4J6X A;  3EG1 A;  4IUU A;  3CCJ Q;  1NEB A;  4JRP A;  4XTU A;  3X20 B;  4JS4 A;  4ZTF A;  2BE9 B;  2PVO B;  2KNB B;  2MF2 A;  2NUZ A;  2ROT A;  3HFO A;  2XKO C;  3ASK A;  2RHY A;  1Q7Y U;  4FSS A;  1WHM A;  1SRL A;  4LDU A;  2K5F A;  2RJC A;  4BI8 B;  1YJ9 Q;  4JJD A;  1Y96 A;  4C8Q B;  1OX9 A;  1T3S A;  2CZ0 B;  3OA6 A;  1S72 T;  2E6N A;  1H64 1;  4M77 F;  1AVZ C;  1VQ4 Q;  2RQV A;  4D8K A;  5GAN 3;  5I21 A;  2QTV A;  4ANJ A;  1QVP A;  1WJR A;  3UPU A;  5CVI A;  2K9G A;  5LL6 S;  3O8V A;  3CC2 T;  4DEX A;  4PJO C;  3EGX B;  3MHX A;  3HRU A;  5CCA A;  4Z8A A;  3I56 A;  4WCI A;  2ZPH B;  1T3L A;  1O75 A;  2HDA A;  4L5G A;  2VYT A;  3UA6 A;  2GBQ A;  2M0O A;  4E2F B;  3RER A;  1MMN A;  4JLG A;  4C0F A;  1VA7 A;  1VIF A;  2VKN A;  5GMK l;  2DAQ A;  1QLY A;  3CCV A;  3JCM c;  3PTA A;  2EJ9 A;  3TCJ A;  1D1A A;  3CXC S;  2MWP A;  2YLC A;  1GCQ C;  3CCS Q;  3BE3 A;  4M7D F;  2E12 A;  2VV5 A;  2OTJ Q;  3QG1 A;  1VQO A;  1KC8 C;  4F7U E;  4OML A;  2PUK B;  1BI1 A;  5LJ5 f;  1NG2 A;  2JM9 A;  4QW2 A;  3G4S Q;  1PD1 A;  5GJW B;  5GAO n;  1QWF A;  1QW1 A;  2DM1 A;  5GAN e;  1SHG A;  1H92 A;  2DF6 A;  2QQB A;  2K5I A;  2OTL A;  3QO3 A;  3LWH A;  5GAO p;  5LJ5 e;  3TQ7 P;  3CCR Q;  1FMK A;  4C8Q C;  4F16 A;  2HAX A;  4RTW A;  3JCM Q;  1H3H A;  2K79 A;  4OMO A;  5CQX A;  1ZBJ A;  3O5Z A;  1TUC A;  1YI2 A;  4Y28 E;  1X69 A;  1UDL A;  2DVJ A;  1J3T A;  1UE9 A;  3CCM Q;  2FZG B;  5LJ3 h;  1AHJ B;  3OBY A;  2C0T A;  4J9I A;  3I5R A;  2LCC A;  3M59 A;  3U23 A;  3CPW A;  2FEI A;  2RA2 A;  2XDP A;  2DRK A;  2G6F X;  1JQQ A;  1IB8 A;  1VQ5 Q;  1ACM B;  3QUI A;  4N0A A;  2QA4 T;  2MWO A;  1PD0 A;  2ZPB B;  2DZC A;  2V8I A;  2NUT B;  2MCN A;  2EQI A;  2YHT A;  1QCO A;  1VQ7 T;  4QKU A;  3TSZ A;  3SWN B;  4F7U A;  2BZ8 A;  3UDC A;  2LZ6 B;  3OS0 A;  2DER A;  1KHC A;  3SEM A;  2SEM A;  3HRT A;  2DXB A;  4PKC C;  2PUO B;  3JCM e;  1WJS A;  1VQ6 Q;  1JXM A;  1I81 A;  3MO8 A;  1Y71 A;  1HXD A;  1ZUY A;  2ENM A;  3J80 E;  1QVG A;  2JS2 A;  2JTE A;  2VXE A;  3JCM W;  2EWN A;  3V8L A;  2CZ6 B;  3S3N A;  2CP5 A;  4CC3 A;  3G71 T;  1F1B B;  3S3M A;  4DBF A;  1RL2 A;  1UHC A;  2CZ7 B;  1QKW A;  3ULR B;  2LQN A;  3MEA A;  2FPE A;  1R77 A;  1ZSZ A;  1VQK A;  2JS0 A;  1JB0 E;  4AFZ C;  2QEX T;  1RAI B;  1V29 B;  2Y90 A;  3OS2 A;  2RM4 A;  5D6X A;  4LDY A;  2EYX A;  2V26 A;  3L2Q A;  4M78 E;  1M30 A;  3CCJ A;  1D0Z A;  4JUV A;  5D7U A;  2CUB A;  3CPF A;  2D6F A;  4LDW A;  3J81 E;  3V7R A;  3C95 A;  2HZY A;  1BIB A;  2DBK A;  1YJ9 A;  3F70 A;  2CGH A;  4R56 A;  2QG9 B;  1HJD A;  5HY6 A;  4NOY A;  3RR6 A;  3HL8 A;  2HKQ B;  4HKE A;  1UGP B;  4C92 A;  2CP3 A;  2KBT A;  1D09 B;  2YDL A;  2RJF A;  3GLX A;  1W2B P;  1VQ4 T;  2LCS A;  1W4S A;  2LJ0 A;  1JJ2 S;  1ZUU A;  1IHW A;  2OAW A;  4M75 E;  2DNU A;  1PC0 A;  1RLP C;  2MAM A;  1M8V A;  1OZ3 A;  1MMD A;  1I07 A;  1OYX A;  4HVW A;  3PVQ A;  4BD3 A;  2O9S A;  2DO3 A;  1QVF A;  3VS0 A;  3DB3 A;  2LCL A;  2DIQ A;  2QXF A;  3R6N A;  3FIF A;  3QHS A;  3VS3 A;  1ZHI A;  4M78 A;  2QQR A;  1VQP T;  1BI0 A;  1TSF A;  3OYM A;  1M90 U;  1SEM A;  1E6G A;  2LDM A;  2EYQ A;  1SG5 A;  1WJQ A;  2EFI A;  4MDX A;  3CCS A;  5FWB A;  1M1K C;  4LXC A;  5GAN h;  2OTJ A;  3HRS A;  5CQY A;  3G6E A;  1Q7Y R;  5LJ5 h;  3G4S A;  1M3C A;  3VV0 A;  5GMK m;  5CKB A;  3GPL A;  5FLX E;  1LPL A;  3OW2 S;  1RAA B;  3VS4 A;  2D0N A;  2P0P A;  1NYF A;  4RTT A;  2QYZ A;  4FT2 A;  2HCK A;  3CCR T;  2AKK A;  3DKM A;  3FB9 A;  1KQ2 A;  4M75 A;  3ME9 A;  3VJP A;  1Q82 U;  2MI6 A;  1JBM A;  5FU7 B;  2X35 A;  3JB9 J;  3OB9 A;  2DIG A;  2DIL A;  1AD5 A;  3HTR A;  4M7A F;  3CCM T;  3RKX A;  4DOV A;  2D8H A;  1VQ5 A;  3M4G A;  4OMF B;  1N8R R;  1VQ8 A;  1OEB A;  5I11 A;  2BUD A;  1ZUK A;  3OYH A;  2XDB A;  3CMA A;  2FZC B;  2GFU A;  1WZO A;  2L3S A;  1VQN Q;  2RO0 A;  2QQS A;  5GAO r;  2M16 A;  5GAO m;  2X51 A;  2R57 A;  2XU8 A;  1ZA2 B;  7AT1 B;  1TWB A;  4F04 B;  1VQM Q;  3RMS A;  2LC4 A;  2RI5 A;  2P4R A;  3I56 Q;  3PE0 A;  1K73 C;  3P8D A;  4C0D C;  4C5E A;  3KXT A;  3JB9 I;  1VQ6 T;  2KVQ G;  1GBQ A;  4DA4 A;  3CD6 A;  2A28 A;  5FRO A;  4J5Y A;  2DL5 A;  1RAD B;  3FJ5 A;  3EG9 B;  4JZ3 A;  1B3Q A;  4E7I A;  2JTM A;  4V2S A;  3M54 A;  4LDV A;  5I22 A;  5FU6 B;  5EG2 A;  8AT1 B;  1X2Q A;  1JU5 C;  1Y7X A;  1GRI A;  3CCU A;  1FXX A;  2QGF B;  5FWC A;  2RH2 A;  5DLO A;  2MPX C;  2PVD B;  1VQO Q;  2PQW A;  3EH2 A;  4PL6 A;  3PGG A;  2K4Y A;  2WSE E;  4M77 G;  4J9B A;  2K2V A;  3T9N A;  3CCL Q;  4EMG A;  1Y07 A;  2J05 A;  2QI2 A;  4J9F A;  4E6R A;  1EFN A;  2L3P A;  5FU7 C;  3JCM X;  4N4H A;  3BDU A;  4Z02 A;  3J7A F;  3FC3 A;  4A4F A;  3GIB A;  5I2S A;  2P84 A;  4PNO A;  4JLI A;  1NZ9 A;  4CC7 A;  3OYC A;  2ECZ A;  3VU3 C;  4QVD A;  2E65 A;  2JNG A;  1Q86 U;  1KG1 A;  2JW4 A;  2COY A;  5CKF A;  4X9C A;  2KQW A;  4M77 B;  4HCC A;  3EG0 A;  2HBW A;  3QSU A;  2KRS A;  1NEG A;  2A0F B;  2BE7 D;  4OP0 A;  2ABL A;  4VUB A;  1FYN A;  4KGZ B;  5IAY A;  4KH0 B;  3HPW A;  2YRV A;  2V1R A;  3ZFJ A;  1OV3 A;  4LD9 K;  2KXC A;  1K0X A;  1R8O B;  2JN0 A;  2EW3 A;  4PJL A;  3I55 A;  4M7D G;  3E9F A;  4PJO E;  1OPL A;  1UHF A;  1IXD A;  3INZ A;  2CT3 A;  1XOV A;  2PU9 B;  4IUQ A;  2COW A;  1VQL A;  4QVZ A;  3RMQ A;  2AHJ B;  3JRZ A;  1JEG A;  3BDL A;  2GGR A;  4ZGD B;  2JJ9 A;  1IGU A;  2DXT A;  4BUG A;  1PRM C;  5FU6 C;  1OU8 A;  2CP7 A;  2X4X A;  4BE2 A;  5GMK e;  3CME A;  2OAU A;  1LVK A;  4M7D B; 
#chains in the Genus database with same CATH homology
 3PMI A;  3QPH A;  5A0D A;  1U8R A;  4FSX A;  4QW2 A;  3NTK A;  3LYI A;  4Q5W A;  4JRK A;  1K8A U;  3C94 A;  3LH0 A;  4B9X A;  5GAO n;  1Q81 U;  2ZPE B;  1QW1 A;  4KT0 E;  1UGR B;  5GAN e;  1IRE B;  1YCY A;  4FM4 B;  5GAO q;  2QQB A;  4M78 F;  5GAN 7;  2C06 A;  2K5I A;  2OTL A;  1X01 A;  3GNG A;  3QO3 A;  4MMK A;  3V8J A;  3KBG A;  4XTV A;  4F7U F;  5GAO p;  3LWH A;  5LJ5 e;  5CKE A;  3SD4 A;  4M78 B;  1K73 U;  4M75 D;  3HKS A;  3JCM J;  1B34 A;  2DKG A;  4FL6 A;  4OGC A;  3JSC A;  4C8Q C;  2FL7 A;  2HAX A;  3JCM Q;  5HK0 A;  4BE0 A;  5CQX A;  4L59 A;  2O4X A;  4C0Z A;  3SWN C;  1N8R C;  1VQ4 A;  2RJD A;  3X28 B;  4HCZ A;  1WPY A;  4E7L A;  4NL3 A;  5KCO A;  2GF7 A;  1YI2 A;  3CC7 T;  3CD6 T;  4M7A A;  2RI3 A;  4Y28 E;  1YJN A;  1I8F A;  5GAM d;  1JJ2 A;  2D0Q B;  4M75 G;  3LWI A;  4C8Q E;  5GAN 2;  4MML A;  2LQK A;  2QQA A;  2HD0 A;  5LJ3 h;  1AHJ B;  3CCQ A;  3OBY A;  3M57 A;  1WQ7 A;  2LVM A;  2V8J A;  4PJO A;  2LCC A;  3M59 A;  2BIV A;  3PMT A;  4MZT A;  5GAM g;  4ZGE B;  3CCU T;  2E10 A;  3CPW A;  4DOW A;  1UB4 A;  3OMC A;  2E5Q A;  2O01 E;  2RA2 A;  4MZP A;  2XDP A;  5KE3 A;  1UEB A;  3OYK A;  4C0G A;  5KCH A;  4M77 E;  4QVC A;  1G5V A;  3QUI A;  2RHX A;  3L1A A;  3VUB A;  2VC8 A;  5GAM h;  1IZ6 A;  4IUR A;  5GAN d;  1VQP A;  4N0A A;  2QA4 T;  5KH6 A;  3HFN A;  1YHQ T;  2MWO A;  2JVV A;  4M75 F;  3OY9 A;  2ZPB B;  1LNX A;  1BI2 A;  2DZC A;  2V8I A;  1WNL A;  2KMT A;  2YHT A;  1VQ7 T;  1FWZ A;  4BAC A;  1M90 C;  1M5Q 1;  2CYZ B;  1Q82 U;  4M75 B;  3SWN B;  3QJY A;  5L8R E;  1HK9 A;  2Y4X A;  4F7U A;  5GAN g;  3OS5 A;  3JCM V;  3DLM A;  3UDC A;  3OS0 A;  1KHC A;  4CRI A;  3OYL A;  2DK3 A;  4XU1 A;  4A54 A;  2LT4 A;  2VXF A;  3HRT A;  1P92 A;  2DXB A;  5LJ5 g;  4JDS A;  4PKC C;  1VQN A;  2PUO B;  3RKY A;  3A5Z B;  4XTZ A;  3JCM e;  1BYM A;  1N6A A;  2XIC A;  1WJS A;  3PNW C;  4BI4 A;  2EIF A;  5C6S A;  4D6W A;  1I81 A;  3MO8 A;  4HA8 A;  1Y71 A;  4X9D A;  2DTI A;  3M58 A;  1HXD A;  4QQD A;  4KUD K;  3FEO A;  1NE8 A;  2ZZD A;  3J80 E;  3NTI A;  1QVG A;  2MMP A;  2E6Z A;  2GFA A;  4ZGJ B;  3OW2 A;  2VXE A;  2EQJ A;  2RB6 A;  2EWN A;  3JCM W;  4M7D C;  2RI2 A;  5GAM j;  1VQM A;  1KQ1 A;  3V8L A;  3C4S A;  1BKB A;  2CZ6 B;  5AYF A;  3S3N A;  5A0G A;  2E41 A;  3DB4 A;  3G71 T;  5GMK j;  5FRM A;  3S3M A;  5A0L A;  1RL2 A;  4C5I A;  2CZ7 B;  2LT1 A;  3CCR A;  4FIB A;  4M7D B;  3I56 T;  4MDW A;  3MEA A;  2HNI A;  5CK9 A;  1D3B A;  5LJ3 f;  2JZ2 A;  4C8Q A;  3I55 T;  4M7D E;  3ZBD A;  3QII A;  3FRN A;  1NJI C;  1VQK A;  3PFS A;  3WXM B;  1JB0 E;  4JRQ A;  3WVE B;  1Q81 C;  5J26 A;  4A4K A;  3PIP A;  2QEX T;  1KQS S;  3CBP A;  5GAN j;  1V29 B;  4BI3 A;  1NJI U;  2Y90 A;  1MHN A;  1G3W A;  1NPR A;  4P5N A;  3OS2 A;  1VQL T;  2RM4 A;  4OB1 B;  5D6X A;  4A4G A;  2FYK A;  2EKO A;  4LDY A;  3DLL A;  3JB9 D;  3L2Q A;  4IUT A;  4J7I A;  5LJ5 j;  3MEW A;  1W2B S;  4M77 A;  3CCM A;  2X4Y A;  3JCM d;  2LQ8 A;  3CCV T;  2G3R A;  4M78 E;  3M5A A;  5J3B A;  2F69 A;  3CCJ A;  4E7H A;  2E64 A;  4JUV A;  3AHU A;  2X4J A;  3H8Z A;  1SSF A;  2KY9 A;  2H3J A;  5DM7 R;  2B8A A;  4FT4 A;  2RJE A;  3QKJ A;  4XTW A;  3HSB A;  4XU3 A;  2JTF A;  2DZ9 A;  3GF5 A;  2A7Y A;  3CME T;  3CPF A;  1O9S A;  1KC8 U;  2D6F A;  3CCL A;  1VQO T;  3JCM g;  4LDW A;  1I4K 1;  3JB9 G;  3OYE A;  2CKK A;  4ZTJ A;  3J81 E;  3V7R A;  3C95 A;  3MEU A;  5GAN 8;  1BIB A;  2XHC A;  2R5M A;  1YJ9 A;  3F70 A;  2LTO A;  2CGH A;  4X34 A;  2E70 A;  3OSV A;  4R56 A;  4KUI A;  4HT8 A;  3JCM h;  5HY6 A;  1YIT A;  3VYG A;  4OB3 B;  4NOY A;  1N9R A;  2FHD A;  3HL8 A;  4HKE A;  2DJZ A;  4KUL A;  2OTL T;  1UGP B;  4ZN1 A;  4M75 C;  1WGS A;  2KAF A;  3CBM A;  4C92 A;  3CC4 A;  3OMG A;  4OB2 B;  4BB7 A;  3E1S A;  2RJF A;  3URG A;  3JCM b;  3GLX A;  3L2Z A;  4QQ6 A;  1VQ6 A;  1VQ4 T;  2L5Q A;  3A8G B;  2CS7 A;  1W4S A;  1YI2 T;  1JJ2 S;  1Y96 B;  4ATO A;  1YJN T;  2I2L A;  4J7F A;  3GNF B;  2IVW A;  4M75 E;  4CI0 C;  3CEY A;  2MAM A;  4XQ3 A;  2DXC A;  1M8V A;  1OZ3 A;  4ELZ C;  5D6W A;  4M7D A;  4RKU E;  2QQ9 A;  1OYX A;  3CCQ T;  2LRQ A;  4L6V 5;  4BD3 A;  1YIJ T;  1XQH A;  3CPW S;  2DO3 A;  3RUX A;  1M4Z A;  4EDU A;  4M77 D;  5HKC A;  3L2V A;  4HCB A;  2RHZ A;  3A8L B;  1QVF A;  1GXI E;  2DEQ A;  2JUF A;  1K9M C;  4J83 A;  5GAN 5;  3DB3 A;  3OS1 A;  4WF2 A;  2LCL A;  2KSS A;  4DQ2 A;  2DIQ A;  2QXF A;  1UGQ B;  3FIF A;  4J6Y A;  1BIA A;  3M55 A;  3QHS A;  4N4G A;  3A8H B;  3RKW A;  3V8K A;  1ZHI A;  2EQU A;  4M78 A;  4XU2 A;  2QQR A;  3UWN A;  1BI0 A;  5GMK h;  5LJ5 f;  5LJ5 d;  1VQP T;  4IKF A;  5FRN A;  1I5L A;  3PIO A;  2WAC A;  4J8O A;  1OI1 A;  2GQV A;  1Q7Y C;  5DLQ E;  3OYM A;  3N5B B;  2IG0 A;  1QP2 A;  4EMK B;  1M90 U;  2LDM A;  3EAE A;  2EYQ A;  2L89 A;  2HQE A;  5CR2 A;  2K5L A;  1WJQ A;  2VGM A;  3S3O A;  2EFI A;  4MDX A;  2DD4 A;  2XID A;  5CO7 A;  4LDX A;  4EPC A;  2K57 A;  1KHI A;  2QDY B;  4C5H A;  3CCS A;  1NPP A;  1M1K C;  4O6J A;  5GAN h;  2ZCF B;  3HRS A;  3OYC A;  1S72 A;  5CQY A;  4UC4 A;  2OTJ A;  2RHI A;  3G6E A;  1D3B B;  2D9T A;  1VQN T;  1M1K U;  3V7C A;  4YTL A;  3OYN A;  1ZQ1 A;  3MP8 A;  1VUB A;  4BY6 C;  4C92 D;  2F5K A;  1ZBX A;  5LJ5 h;  4ME7 A;  3LGF A;  3G4S A;  3VV0 A;  5D6Y A;  5GMK m;  5GAN 4;  2KK4 A;  2VUB A;  5CKB A;  3GPL A;  1Q86 C;  1QVG S;  2XD0 A;  5FLX E;  2XK0 A;  1EIF A;  3OW2 S;  4BE1 A;  2PVG B;  1M9S A;  5CIU A;  3WVD B;  5HK3 A;  3TEE A;  3M4Y A;  1VQM T;  3QZ5 B;  3CC2 A;  1VQ9 A;  2P0P A;  4JRI A;  3R6O A;  4C92 G;  4PJO D;  2L8D A;  3EFR A;  4GLK A;  3ZEH A;  3TRE A;  3JAM E;  4M7A G;  4RCC A;  3VYH B;  3KUF A;  5CKH A;  3MET A;  2E1H A;  3OYG A;  4FT2 A;  3CCR T;  3DKM A;  3FB9 A;  1KQ2 A;  4M75 A;  1WQW A;  1G3Y A;  4FU6 A;  3SWN A;  2EJG A;  3L2R A;  2EJF A;  1YJW A;  4E7K A;  3ME9 A;  3OYB A;  3GOX A;  4E7J A;  1Q82 C;  1VQK T;  5I2M A;  1JRI A;  3TU4 K;  4PJO G;  4A4E A;  3VJP A;  2P4T A;  2JOY A;  2K3Y A;  5LJ3 e;  1LOJ A;  1N9S A;  5GAM f;  4BDY A;  2MI6 A;  1JBM A;  4M78 D;  1TH7 A;  2X35 A;  4O5V A;  5FU7 B;  4XTY A;  3LW5 E;  5GMK i;  3JB9 J;  3OB9 A;  2DIG A;  1B34 B;  1M1F A;  3MP6 A;  3OQ5 A;  3A8M B;  3E19 A;  3QBY A;  4BY6 B;  1N8R U;  3Q1J A;  4M7A F;  4PLI A;  3CCM T;  5GAN 6;  3GP8 A;  2O4X B;  3CCJ T;  1PSF A;  3RKX A;  4B9W A;  4OB0 B;  2KDS A;  4DOV A;  5A2Q E;  2VGN A;  4XK8 E;  3V7S A;  4M7A B;  3CXC A;  3M4G A;  4OMF B;  3CCE A;  1VQ5 A;  1VQ8 A;  3OYH A;  2BUD A;  2XDB A;  3CMA A;  2XI9 A;  2ZPG B;  4RMO A;  2GFU A;  3CCL T;  3QXE B;  2F5T X;  3BY7 A;  4PJO F;  4F7U G;  1U1T A;  4JJN K;  4XU0 A;  1YIJ A;  5GAN f;  3UT1 A;  5IT9 E;  2EQK A;  4ELY C;  2RO0 A;  1YBY A;  3QYG B;  4PJO B;  2FB7 A;  1K8A C;  1YJ9 T;  1X6O A;  2QQS A;  2XG8 D;  2M16 A;  5GAO m;  5GAO r;  4JS5 A;  2DTO A;  4IUV A;  2R57 A;  2XU8 A;  3FDR A;  1YIT T;  2DTH A;  1PSE A;  3RMS A;  4EMK C;  3BFM A;  3FJP A;  2V8K A;  2LC4 A;  3JB9 F;  4RG8 A;  1QP3 A;  4II1 A;  2RI5 A;  5CKD A;  2K3X A;  2HQX A;  3QDR B;  4NS5 A;  1K73 C;  4M7A D;  1OZ2 A;  3SDZ A;  3CC4 T;  2EAY A;  4C8Q D;  3P8D A;  4C0D C;  1BI3 A;  2BKD N;  1MGQ A;  5LJ3 d;  5IN1 A;  4XTX A;  4C5E A;  4Y91 A;  3KXT A;  3JB9 I;  3L2W A;  4RCB A;  3X25 B;  1VQ6 T;  2KVQ G;  3A8O B;  4DA4 A;  3LLR A;  2P0Q A;  2NLU A;  3CC7 A;  3CD6 A;  4EMH A;  4F7U B;  1VIE A;  4PLL A;  5FRO A;  2DVE A;  4J5Y A;  2LNV A;  3HHT B;  4MZM A;  5M9O A;  3M53 A;  5LJ3 g;  4OGE A;  4V2S A;  4E7I A;  2JTM A;  2L3R A;  2WSF E;  2ZPI B;  3E9G A;  3M54 A;  4LDV A;  4IUP A;  5FU6 B;  4C8Q G;  5EG2 A;  3S6W A;  3P8B B;  2GCX A;  1Y7X A;  4TVR A;  4M77 C;  1QVF S;  4J6X A;  3OYJ A;  1FXX A;  3CCU A;  1H3Z A;  1G3S A;  1K9M U;  4IUU A;  1XNI A;  4RG2 A;  2R58 A;  2RH2 A;  5DLO A;  2PVD B;  2ZGW A;  4NL2 A;  2DD5 A;  2PQW A;  3X26 B;  4JRP A;  4XTU A;  4OF1 A;  2Y4Y A;  4PL6 A;  3PGG A;  3X20 B;  5GAO l;  2K4Y A;  3JCM P;  2WSE E;  4M77 G;  4JS4 A;  2K2V A;  2PVO B;  1G3T A;  4ZTF A;  2MF2 A;  3T9N A;  2QA4 A;  5C0M A;  2X4W A;  4EMG A;  1YHQ A;  3HFO A;  2XKO C;  1Y07 A;  3ASK A;  2RHY A;  3QZ9 B;  1Q7Y U;  2QI2 A;  5DY9 A;  4C8Q F;  3OYA A;  2RHU A;  4LDU A;  2K5F A;  4C0D B;  1XTD A;  2RJC A;  1VQ7 A;  3CBO A;  3NTH A;  4BI8 B;  5FU7 C;  4A53 A;  3L42 A;  1Y96 A;  3JCM f;  4C8Q B;  3JCM X;  4N4H A;  2ZPF B;  1KD1 C;  3CCS T;  2CZ0 B;  3BDU A;  3OA6 A;  4Z02 A;  3J7A F;  2OTJ T;  3FC3 A;  1UGS B;  3VUZ A;  1S72 T;  4A4H A;  4A4F A;  1M1G A;  3G6E T;  3GIB A;  2FVU A;  3RES A;  3X24 B;  5I2S A;  3BW1 A;  4JLI A;  1NZ9 A;  2E6N A;  1H64 1;  4PNO A;  3RIR A;  4C92 C;  2EQM A;  3P8H A;  4M77 F;  3VU3 C;  4QVD A;  2E65 A;  2P0K A;  2JNG A;  5J39 A;  3OYY A;  3QYH B;  1Q86 U;  1KD1 U;  4M7A C;  3SFM A;  5LJ3 j;  5GAN 3;  3G4S T;  2RK1 A;  3HP9 A;  5I21 A;  4C5G A;  1KG1 A;  3ER0 A;  5CKF A;  4X9C A;  2KQW A;  2A3L A;  1DJ7 B;  4M77 B;  1U1S A;  3LGL A;  3OSS C;  4R55 A;  3OYI A;  1QVP A;  4HCC A;  1WJR A;  3UPU A;  3QSU A;  5CVI A;  3QJ6 A;  3MP1 A;  2CZ1 B;  5LL6 S;  4M7D D;  3O8V A;  4OP0 A;  3FLG A;  3CC2 T;  1VQ9 T;  3VKI A;  4VUB A;  4PJO C;  4C92 E;  5IAY A;  3MHX A;  3G71 A;  1X75 C;  3HPW A;  4M7A E;  2YRV A;  3HRU A;  3SB2 A;  3ZFJ A;  3LX7 A;  5CCA A;  4LD6 A;  4J6W A;  3OYF A;  3L2U A;  4LD9 K;  4EMK A;  3PT9 A;  2RD1 A;  4ZN3 A;  3I56 A;  1RI0 A;  2ZPH B;  4QQG A;  1YJW T;  1R8O B;  2JN0 A;  3JB9 H;  3OBW A;  3I55 A;  1O75 A;  2M9U A;  4N0A C;  4M7D G;  4OVA A;  2RK2 A;  3C12 A;  3E9F A;  4L5G A;  3MCA B;  4PJO E;  2DXU A;  2QEX A;  4C92 F;  2VYT A;  3INZ A;  4M78 C;  2PU9 B;  1XOV A;  4IUQ A;  1KQS A;  3MEV A;  4GY5 A;  1VQL A;  4N4I A;  2M0O A;  4QVZ A;  3RMQ A;  5KE2 A;  4JLG A;  4C0F A;  4BDZ A;  3RER A;  1VIF A;  2AHJ B;  4C92 B;  3JRZ A;  3EFS A;  2M1H A;  5GMK l;  3BDL A;  2DAQ A;  3NFC A;  2HBP A;  4ZGD B;  3CCV A;  3JCM c;  5GAM e;  3PTA A;  2DXT A;  4BUG A;  2EJ9 A;  3TCJ A;  4M78 G;  5CAI A;  1FX7 A;  1W2B A;  3G7Z A;  2DPP B;  3M9Q A;  5FU6 C;  3CXC S;  1N27 A;  2LX9 A;  2MWP A;  2R5A A;  2X4X A;  2YLC A;  4HT9 A;  4BE2 A;  4XAX B;  5GMK e;  3OYD A;  1VQ5 T;  3CME A;  1VQ8 T;  3CCE T;  3M56 A;  4M7D F;  2E12 A;  2VV5 A;  3CMA T;  2OAU A;  2QTX A;  3QG1 A;  1VQO A;  4KBM B;  3H6Z A;  4E47 A;  4F7U E;  1KC8 C;  2PUK B;  2YLB A;  1BI1 A;  2XDD A;  1LJO A;  2WSC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...