1B34B

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
74
Chain Sequence
TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMDRYISKMFLRGDSVIVVLRNPLIAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 74
sequence length 93
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34B00
2RA2A 5LJ3h 5GMKm 4NOYA 5GANg 4M7AG 5I21A 4C8QF 1U1TA 3RESA 4M78E 4JRIA 2E65A 3JB9H 4M77F 4A54A 3HFNA 4M78A 5GAOn 4M75F 4M7AA 4M7DB 4HA8A 5GANh 5GAN6 5GAN4 5GMKe 1MGQA 2I2LA 4N0AC 5GAOr 3JCMb 3QO3A 5GAN8 4M7AD 4C92A 4M78D 4XU2A 2E1HA 5LJ5g 5LJ3e 1BIBA 1KQ1A 1U1SA 3SWNC 3EFRA 3VU3C 4RCBA 2E10A 5GAOp 3JB9D 4PJOC 2JN0A 4XTUA 5LJ3d 4NL3A 4HT9A 4M77C 5LJ5h 4C8QB 2DXTA 4XTXA 4M75C 4JRKA 4C92D 3JCMP 5GANe 5GAMg 4XTVA 3JB9J 4QVDA 1JRIA 2Y90A 3RUXA 3JCMJ 3JCMX 4A53A 4NL2A 3JCMW 5GANd 4XTWA 2VXEA 3EFSA 3INZA 5GAMh 3BY7A 4JUVA 4M78B 4M7AE 3V7SA 3JCMf 5GAOq 1WQWA 4M7DC 2DKGA 2DTIA 3FJPA 4MMLA 3QSUA 1I8FA 5LJ5e 4C92B 4PNOA 1HXDA 4M7AF 4F7UG 4C92E 4M78F 4XU3A 5LJ5d 1LNXA 4J6YA 4QVCA 2DTHA 3JB9F 3V8KA 3QUIA 4XU1A 4J5YA 4PJOG 4OP0A 4X9DA 3JB9I 5GAMe 1Y96A 4C8QC 1WNLA 2DEQA 4M77G 3RERA 1TH7A 1X01A 4JLIA 1D3BA 2CGHA 4M75G 3SWNA 4C92F 2DTOA 4PJOA 5GAMd 1YCYA 4EMKA 4EMHA 1H641 4EMGA 1KQ2A 2QTXA 3SB2A 5LJ3f 5GMKl 5GMKi 2YHTA 2EJGA 3RKWA 4M78C 1I5LA 4PJOD 2DZCA 2VC8A 3RKXA 4M7DG 5GAN5 4M7AB 2K57A 3RIRA 5GANf 1B34A 2DJZA 3V8JA 1N9SA 3PGGA 1WQ7A 2VXFA 4XTYA 4M7DA 2E41A 4V2SA 3RKYA 5CAIA 2DXUA 3HFOA 5GMKj 4RCCA 2DZ9A 1Y96B 2EJFA 4F7UE 2YLCA 4N0AA 4DQ2A 4C8QG 3M4GA 1D3BB 5GAN2 3FB9A 4F7UA 2HNIA 4Y91A 5LJ3j 4EMKB 2ZGWA 5LJ5f 4PJOE 5GAOm 4C8QA 5GAN3 4M77E 1I4K1 3BFMA 4F7UF 4M75E 5GAN7 3L2ZA 4X9CA 3JCMg 4M78G 4M77A 5GANj 1JBMA 1BIAA 4M75A 4PJOF 5GAMf 3L1AA 3AHUA 3JB9G 4M7AC 1B34B 4C8QD 2DVEA 3BDUA 3JCMh 4M7DE 4C92G 3QHSA 4M77D 1HK9A 3FIFA 4M75D 4XU0A 3V7CA 4C92C 4HT8A 1WPYA 2EWNA 2FYKA 2RB6A 4WF2A 2RM4A 4XTZA 4MMKA 3V7RA 1LJOA 2E64A 5LJ5j 3GIBA 1M5Q1 4M7DF 3BW1A 2FB7A 1N9RA 3JCMV 4F7UB 4EMKC 2EAYA 4M7DD 2EJ9A 5DY9A 5GAOl 2RD1A 3SWNB 1LOJA 5LJ3g 3HSBA 4PJOB 5GMKh 4C8QE 3JCMe 3V8LA 5GAMj 4J6XA 3JCMQ 4M77B 3JCMc 4XQ3A 2YLBA 1M8VA 4M75B 4J6WA 3JCMd 1I81A
chains in the Genus database with same CATH superfamily
1VQ8T 2YT6A 3G6ET 3VS1A 1YJWQ 4PKCC 1UGVA 1JXMA 4Y28E 4KT0E 5GAOn 2KI7A 1X6OA 3NHNA 1D1BA 2ZAEA 4RG2A 4Y92A 2QG9B 2YXYA 2LDMA 4QT7A 3GNGA 3EGXB 5GANe 3QBYA 2MWPA 2D6FA 1IGUA 1WHJA 5DM7R 2DKGA 3FJPA 2DYBA 2RN8A 2PTKA 2K2VA 3CCVA 2GNCA 2OTJQ 5I2MA 3CC2Q 2NUZA 2DEQA 2DPPB 1K9MU 3IQLA 2CZ1B 3LWHA 1ZUUA 2X9HA 2K5IA 1SEMA 3BE3A 5KH6A 2OTLA 4RTWA 2COWA 2K57A 1NYFA 1VQPT 2F69A 2KAFA 2HL3A 2QA4A 2DD4A 2EBPA 1Q86U 2R58A 3H9NA 5A2QE 1M1FA 4ZTJA 2WSFE 1PKTA 3G4SQ 3RDVA 1YI2A 2EYZA 3MEWA 3CCJQ 1OZ3A 1PC0A 3BFMA 4HVVA 3I5RA 3OY9A 1R77A 3M5AA 3JB9G 5A0LA 2QQ9A 1G3YA 1FYNA 3EGDA 5KYXB 4HT8A 2HQEA 2DLPA 1AZGB 1VQOT 4AG1C 4EPCA 2DRMA 1WGSA 5GJWB 2PZ1A 2RD1A 1R0BG 3CXCS 3X20B 2MF2A 5GAMj 1JEGA 3JCMc 1MV0B 1VIEA 2PUKB 2DL7A 4KBMB 4JRIA 3CC7T 4F04B 2GFAA 4XK8E 2I0NA 4ORZA 1WJSA 2RK1A 5CKEA 4C0GA 2BTTA 2AT1B 2JW4A 4N0AC 3I55T 2FRWA 1FX7A 5GAOp 4J7FA 1GCPA 2CKKA 5L8RE 4JJDA 4BE1A 1I1JA 3TSZA 2JTFA 2QDLA 1QVFP 2CYZB 3L2RA 1K1ZA 2P84A 2AHJB 3CBOA 1BKBA 2GTOA 3OW2S 1XQHA 4C92E 1NPRA 1Y71A 4MZTA 3M0QA 4LDWA 3SWNA 4F16A 3CMEA 1N8RC 3CCVQ 3BDLA 2X4YA 3MEUA 2RJFA 1MMGA 5CIUA 2H8HA 4DBFA 4A4EA 5CK9A 3SD4A 2RJCA 4ZTFA 3CQTA 4BB7A 4IIOA 2XDDA 3CCSA 1E6GA 2OTLQ 3META 2IVWA 1NLOC 3PVQA 1NJIR 1ZUYA 2V26A 1PRMC 4EMKB 2QA4Q 5M9OA 2F5KA 2L3RA 2RMOA 3AHUA 2XICA 2HD0A 4PFOA 1K8AR 3E9FA 4PJJA 1VQLA 1NZ9A 1YI2Q 3QHSA 1VQ4T 4OB2B 2YRCA 4VUBA 4C92C 2RI5A 2KE9A 3EHQA 1AOJA 3UT1A 5FRMA 3OBWA 4R55A 2JUFA 5KYWB 4M77B 2QQAA 5LJ3h 2EQJA 4HVWA 3CCLA 2HEQA 1D1AA 1VYUA 2E6ZA 2CP2A 4M7AA 1YJNQ 4PL6A 3E1SA 1VQ6A 4HA8A 4FU6A 5GAN4 1JJ2A 3D7SB 2RJEA 4PFZA 1M1KR 3NTIA 1VUBA 4IUUA 4C8QB 4JRKA 2YDLA 3L2VA 4XTVA 2K4YA 3LX7A 4ZGDB 4M78B 5GAOq 5CQYA 1WXBA 1O75A 3M0RA 4D8KA 4F7UG 3OYKA 3GF5A 4KH1B 1WX6A 3NFCA 3CCRQ 4C92F 2GQIA 4M75G 2X4WA 2DL5A 4EMKA 1V76A 1M90U 2JT4A 2LQ8A 1X2QA 5GMKi 2EJGA 2E12A 4PJOD 8ATCB 1YHQT 4M7DG 4BY6C 4PJLA 3KBGA 2D8JA 4RTYA 3WVDB 2LCLA 4LDXA 3CMEQ 1PM3A 3C94A 1W2BP 1D0YA 3QYGB 1D3BB 1GCQC 2DXCA 1K0XA 2X3WD 5GAN3 2YWWA 1I4K1 2P4TA 1WXTA 4M77A 4FW2A 4ELZC 3CCSQ 1WYXA 1H3HA 1OU8A 2LNHB 2ED0A 5CKDA 3FIFA 1Q82R 3OQ5A 4AFQC 2RB6A 2DFUA 1N9RA 1VQLQ 2A08A 5CO7A 4HCZA 3R6NA 3G71A 3WVEB 3KXTA 3I9QA 2C0IA 4HXJA 2KQWA 2FZGB 1WJQA 3EH2A 1PD1A 2KK4A 4QQ6A 4M78A 2CT4A 1V1CA 5FU6B 4A4GA 2COZA 2M02A 3HRTA 3CCLQ 1YP5A 4CC7A 3VS5A 4BUGA 1VQ6Q 5LJ5h 1VYVA 3ZL7C 5AT1B 4B9WA 2BE9B 1AZEA 2DJQA 3BY7A 5I22A 1BYMA 2RPNA 2G6FX 3VS6A 2XIDA 3UATA 3OS0A 2X4JA 2JS2A 1V29B 4JRQA 4DA4A 4XU3A 1LNXA 3NTKA 4PJOG 4OP0A 3GLXA 1GBQA 1MMDA 3QG1A 1M1GA 1X01A 1D3BA 1K73R 1N5ZA 4JZ3A 1I5LA 3CD6T 4KGZB 2M1HA 2M16A 1M3BA 1ZUKA 4QW2A 2R5MA 1WDXA 2DD5A 2YUPA 2KT1A 3CC4A 2DL8A 4RUGA 4L6V5 4F7UE 3M4GA 5GAN2 4JZ4A 3CCET 4M75E 4KH0B 4X9CA 1AHJB 4XAXB 5GAMf 2ZPHB 2GGRA 2J06A 1B34B 4DEYA 1BB9A 2X51A 4M7DE 4OMFB 1QVGS 3CXCA 1YJ9A 4E2FB 1UFFA 1KFZA 1PCXA 3M0TA 2HL5C 1M3CA 3M9QA 5EG2A 1M27C 4RKUE 3DB4A 5CKBA 2NWMA 2BZYA 2O9VA 4E7ZA 3VS3A 3MKDA 1AT1B 4J6WA 3UF4A 4HCCA 2FO0A 1C1AA 2GFUA 1KQSS 3MEAA 1WHHA 1UGPB 1ZSZB 2CUDA 2LX9A 3G71Q 5IH2A 3EG2A 3QO3A 1RAHB 1PRLC 5GAN8 3TSWA 1VQ8A 2GTJA 3VU3C 3G6EA 4RCBA 4M75C 1VOMA 2EFIA 4KULA 3OW2A 1NPPA 4M7DC 5D7UA 2RH2A 2DE0X 2ZPEB 3EHRA 1TU0B 2HDAA 5KE2A 2HSEB 2MI6A 1YWPA 1WIEA 4D6WA 4LUEA 1UTIA 1OPKA 5GMKl 4KUIA 5FROA 4OB1B 1B34A 3V8JA 3PGGA 1G83A 2KSSA 2DILA 5GMKj 1WHLA 2YLCA 1VQ7T 5LL6S 4PJOE 2YSQA 1VQPA 1X6GA 5D6XA 2HKNA 1YITT 2XDBA 1SHGA 3CC4Q 3I56A 2MIOA 3PVLA 2ZCFB 3NMZC 1MV3A 2RJDA 4MZPA 3JCMh 3SEMA 2VVKA 1OX8A 1ZSZA 2A0FB 3QDFA 2CDTA 2XKOC 1DJ7B 1KHCA 1LJOA 4Z8AA 3GIBA 4N4HA 4M7DF 3H0FA 1PNJA 2GCXA 1VQNT 5DY9A 4JJNK 1LOJA 4GBQA 2EKHA 4AFUC 1YJ9Q 3MPUB 2DK3A 4ANJA 4NOYA 1IZ6A 3VRZA 1K9MC 2CP7A 5KCHA 1TUGB 1B3QA 1WHMA 1YIJA 4Z02A 2KRSA 2FZKB 3THKA 3JB9D 4PJOC 2E10A 4C0ZA 3CC7A 2JN0A 5LJ3d 4PJMA 2RHYA 1Q86C 1TXQA 2YUOA 3FRNA 5GAMg 3JCMW 1QP2A 1WXUA 3I55A 1VQ8Q 2PVDB 2RHIA 2NLUA 3EGDB 5IHKA 4C5IA 1X43A 3A1PA 1FMWA 1GXIE 4OMQA 4C92B 4J9FA 2RQRA 2KT8A 2KR3A 4HKEA 2K7AA 3OBYA 1WNLA 2L0AA 2SRCA 4JLIA 2O4XB 3HKSA 1UDLA 1K9AA 1RL2A 4FT2A 4EMHA 1IO6A 2HBPA 3SB2A 2PNIA 1UEBA 1D0XA 5J26A 2HBWA 1W2BA 4FCYA 1VA7A 2QQRA 2HZYA 2L3SA 2MYSA 2O9SA 1VQMT 1N9SA 3I35A 4GY5A 1PSFA 2D0QB 1IGQA 1KC8C 2LCSA 3OB9A 3ZEHA 2JVVA 3MHXA 3C12A 3KUFA 4UC4A 4PJOF 4OMOA 1KD1C 4ZNXA 3BDUA 5L23A 1AVZC 1OOTA 1HK9A 1M2OA 2EGCA 2OJ2A 2ROTA 4DBRA 1VQPQ 2OTJT 5KYNA 1ZA2B 3I56Q 2E64A 1UE9A 1Q7YC 2CP6A 1N8RR 1H92A 4LDVA 3SWNB 4BI8B 2EYWA 2BZXA 1VQ4A 3JCMQ 4O6JA 2LC4A 1NEBA 2QTVA 1MUZA 1QP3A 2L3QA 2HKQB 5GANh 1UB4A 2M9UA 4JPBW 1Q81U 2JM8A 3TEEA 3VYGA 3TREA 4C92A 4Z88A 3M54A 3G4ST 1YIJQ 1UUEA 2LQKA 5FWCA 3CXCP 4ME7A 3OYDA 2O4XA 2CSQA 2RNAA 3JCMX 2DAQA 4BE2A 3GPLA 3INZA 3J7AF 1AWXA 3PTAA 3CC7Q 2DTIA 2KRMA 1KC8U 3VKIA 1U5SA 2K3XA 5LJ5d 1BU1A 1RLQC 3I55Q 4J9GA 1SRLA 2YRVA 3OYIA 5GAMe 3NGPA 4E47A 1QW1A 3CPFA 2D8HA 2WSCE 1KD1U 3E9GA 2QTXA 8AT1B 3OSVA 1SSHA 5IXBA 1AEYA 1Z9ZA 3RKWA 1FXXA 1OPLA 4RTUA 3CMAT 4M7AB 1Q7YU 3PIPA 3PNWC 2Y4XA 5GJVB 3CPWS 2F5TX 3OW2P 3SFMA 1B07A 2ESWA 3X26B 3VS0A 1YHQA 4Y91A 1I5OB 2JMCA 5LJ3j 3OS1A 3OYFA 2RO0A 2QEXT 1VQKT 3GNFB 3L2ZA 3S3MA 2IPOB 1QVFS 3LGLA 3H8ZA 3HRSA 4C8QD 1PG5B 3PMIA 3QDRB 3DLLA 4M75D 2DVJA 4XU0A 1CKBA 1ARKA 2M0YA 2LNVA 1W70A 2KXDA 4M7DD 2E5QA 2PQWA 3AT1B 1GCQA 3SDZA 3CCVT 4O5VA 2EQIA 2MMPA 2ROLA 5I21A 4PLLA 1M90C 1Q95G 2CP0A 1NEGA 2J6FA 3CCMA 1EX4A 1TG0A 5GAN6 2KMTA 2FPEA 1MGQA 3WXMB 3L2UA 1VQ4Q 4C0DC 3I5SA 1JQQA 1N27A 2CZ7B 5KYYB 4JS4A 4QVZA 2L5QA 2RI3A 3JCMP 2JJ9A 3F70A 2DL4A 4QVDA 3OS2A 3VS4A 3E19A 2E6NA 2EIFA 2VXEA 2A36A 4AMCA 5HY6A 1VQ5T 2DTHA 4N4GA 3T9NA 5A0GA 3H0IA 4M77G 1TH7A 2CGHA 2RF0A 2JM9A 3EGUA 1SF9A 2C0OA 1K0SA 1IREB 3HP9A 3EFOA 2VC8A 1AD5A 5GAN5 1YJNT 1IHVA 3C4SA 4FM4B 4V2SA 4XTYA 4LUDA 1XNIA 2QK0A 4MDWA 3CD6A 4C8QG 1ABQA 4Z89A 4FW1A 3CEYA 2QI2A 1M8MA 5I2SA 4BD3A 5GAN7 1QQJA 4M78G 2SEMA 5KE3A 2DVEA 2QGFB 1YHQQ 1U06A 2HSPA 3G7ZA 1VQ9T 2XU8A 3CCEA 2GBQA 2YUQA 3OMCA 5LJ5j 1TOVA 4BDZA 2A7YA 5CR2A 1FWZA 2YUNA 4GLMA 4II1A 1YWOA 1T3LA 3CCRT 2EAYA 2IG0A 5KYYA 3CCQT 1W6XA 4D8DA 3JCMd 5D6WA 1KSWA 1MNDA 3MCAB 4KGXB 3RESA 2E65A 1W4SA 4JJBA 2K6DA 1HSQA 3CMET 2BE7D 4J83A 3J80E 2DL3A 4RG8A 2RHXA 3KFVA 4XU2A 1ZHIA 3RR6A 4Q5WA 1ZBXA 3CCMQ 2DERA 4HT9A 4ESRA 2DXTA 1PWTA 2RQUA 5I11A 1GFDA 1CKAA 3EFSA 3CCUA 5D6YA 2KDSA 2KEAA 2F2XA 2NUPB 3LGFA 2M51A 5FU7B 1G3TA 1VQLT 3JB9F 3QUIA 3JB9I 3FJ5A 2DA9A 3EG1A 1H3ZA 3QJ6A 4FSSA 4A4HA 2FVUA 1QWFA 2LP5A 2DZCA 3R6OA 2RQVA 3RIRA 4IURA 3QIIA 4M7DA 3ZBDA 4KGVB 5CAIA 3CCLT 1MNEA 4CC4B 4JS5A 2DZ9A 2EJFA 2F1LA 3A8GB 4DQ2A 3OYLA 2E3HA 2QASA 1VQ6T 2H3JA 2VGMA 5ECAA 4E6RA 4IUQA 1M9SA 1QCNA 2JXBA 4M77E 2OAWA 5CKHA 1TSFA 1QLYA 1JBMA 3E2UA 3CD6Q 1K8AU 1A0NB 2LQWA 2RI2A 1YITA 1NBEB 1IHWA 1WPYA 1SPKA 4JRPA 2EW3A 2FB7A 4R56A 4EMKC 2LZ6B 2EGEA 5IHNA 2HMAA 4C8QE 1RUWA 1XOVA 4J6XA 3C0CA 3VV0A 4XQ3A 3CCEQ 3EH1A 2L8DA 4E7LA 2PVGB 1VYTA 2HQHA 4YTLA 4M78E 4GLKA 4L5GA 3JB9H 4A54A 1WLPB 3EG9B 2W0ZA 4MZMA 2NUPA 1M1KU 1GFCA 3QWXX 3P8DA 4M77C 4XTXA 4A4KA 2K3YA 2O01E 1HYOA 2KGTA 5GANd 3RMQA 3G1JA 1ZLMA 1WQWA 2M0OA 1ZSGA 1RABB 2CSIA 1C6VX 2GF7A 2LRQA 3A98A 1TUDA 3QSUA 2LX7A 3ULRB 4BACA 2RQTA 2RHUA 4CRIA 3FDRA 1T0JA 3CCUQ 4X9DA 3RMSA 4C8QC 3UA7A 3M55A 2V8KA 3QKJA 1K9MR 4PJOA 1Z9QA 5LJ3f 2JOYA 2L89A 3MO8A 2P0KA 2KY9A 2QYZA 1R0CB 4M78C 3CPWA 3RKXA 4FYXB 1K4US 2HQXA 2W10A 2XD0A 4R0KA 1WA7A 3LLRA 1Q86R 3ME9A 1BI3A 1YNZA 2PVOB 1OZ2A 2CS7A 4LD6A 4DEXA 3LYIA 1VQMA 3RNJA 1T3SA 2BZ8A 3M0SA 1QCOA 2LTOA 2DBKA 1SKUB 3M58A 4A63B 1Q82U 3M4YA 2DO3A 2MCNA 3U23A 3EG9A 4WF2A 1JO8A 3HL8A 4MMKA 4LNPA 2X4XA 2J7IA 1JJ2S 2FL7A 3A5ZB 1ABOA 4C0FA 3X24B 1NE8A 3M59A 2ZPIB 9ATCB 1RADB 2D1XA 2O31A 3NTHA 1YITQ 4F7UF 2FHDA 2DYIA 2MOXA 2LJ1A 4C8QF 1ZBJA 4OMPA 3OYHA 1NYGA 4DOVA 4IUVA 1O9SA 2O88A 1KC8R 4M75F 2DF6A 3VYHB 3X25B 3M57A 5GMKe 4LDYA 1OYXA 1ZQ1A 1U1SA 1Y57A 2KRNA 2NUTA 1OU9A 3MP8A 1KD1R 1UHFA 3OYAA 1JRIA 1N6AA 2ENMA 4LN2A 1KK7A 4HCBA 2XK0A 1VQOA 2JTMA 2EPDA 2RQWA 4JUVA 4M4ZA 2E5KA 4EIKA 5FU6C 1Q7YR 1PD0A 2BIVA 1I8FA 4IKFA 1JXOA 1S72T 2CREA 4N4IA 4PLIA 4J6YA 2K79A 4XU1A 5KYUA 1HJDA 1SRMA 3RERA 2EYYA 5C6SA 1YJ9T 1Y0MA 3QZ5B 4EMGA 1KQ2A 3S3NA 2KYBA 5CQXA 5EC7A 3PT9A 4OB0B 2OI3A 2PUOB 3G6EQ 4PK4A 1NLPC 2AIRB 2K3BA 2J6KA 4LD9K 2MAMA 4N0AA 4C5EA 1PHTA 1YFNA 3A8LB 3CMAA 3FB9A 3L2QA 5LJ5f 1Q81C 1KHIA 4E7SA 5FWBA 4AFZC 5GANj 1YJWT 2LQNA 4ELYC 2VYTA 1JU5C 1X75C 4C92G 2K5FA 2QEXA 1VQMQ 1G8XA 2LJ3A 1VQKA 4J9DA 4L59A 1IB8A 4E7IA 4HVUA 2H3EB 4F14A 1IXDA 2EJ9A 2CH4A 1OV3A 5LJ3g 1E6HA 4FYVB 2V1QA 2GQVA 1YN8A 2JS0A 1M3AA 1M8VA 4OMMA 2LT1A 2DEUA 2ZPBB 1EFNA 4E7HA 1MHNA 3JAME 4P5NA 4ZGJB 4FT4A 3HFNA 4CI0C 2O2OA 3FLGA 2ED1A 1F1BB 2DIQA 4C5HA 2E3IA 2I2LA 1U8RA 4ZGEB 1NM7A 5GAOr 3TU4K 2DBMA 4M7AD 3ZFJA 5HKCA 2KVQG 1BIBA 1BCMA 3CC2T 1JB0E 3NPFA 4JJCA 1KJWA 4J9CA 4NL3A 3JRZA 3OS5A 5CCAA 5KCOA 2C0TA 1S1NA 1PKSA 3MP1A 3JV3A 2XDPA 3LH5A 3OSSC 3V7SA 1ZSZC 2ABLA 4HCKA 4BY6B 2CH4W 3I56T 1D1CA 1OX9A 2QQBA 3L2WA 2G3RA 1VQOQ 3VRYA 4QQDA 1WI7A 2QXFA 2CUBA 3H41A 3HTRA 5CVIA 3CCJT 3REBB 4AT1B 1VIFA 2DTOA 1M90R 1EZZB 3DB3A 4KRTA 1YCSB 1SHFA 3QWYA 2D0NA 1VQ5A 3UWNA 4IIMA 7AT1B 1I07A 3N5BB 2JZ2A 1TWBA 1WQ7A 2B8AA 1SSFA 1BK2A 1R8OB 3EAEA 3Q1JA 4DBQA 3HFOA 3M53A 4RCCA 1YIJT 2MWOA 1YJNA 1TTHB 2ZGWA 2AKLA 3EGXA 1UECA 1TUCA 2KNBB 3GP8A 2CP5A 2MPXC 2DRKA 2QQSA 3MEVA 3CMAQ 1RAEB 3OMGA 4M77D 4BI4A 4LXCA 3V7CA 5FRNA 2E4HA 1K76A 2RM4A 5DLOA 3CPWP 3V7RA 1OEBA 1UJ0A 1Y07A 1BI2A 1RACB 2EQMA 2QEXQ 3LWIA 2KROA 1RI0A 1VQ9A 1VQKQ 1AWWA 4B6MA 1G3SA 1I81A 2F2VA 4M7AG 3EFOB 1QVGA 2DETA 2COYA 5IAYA 1U1TA 3O8VA 4K11A 3CCRA 3QXEB 3CCQA 4E7KA 4IUTA 5J39A 1M2VB 4M78D 5LJ5g 2E1HA 5LJ3e 4XTUA 1KQSA 2L2PA 2FPFA 3X28B 3LW5E 2EYQA 3RUXA 2P4RA 4A53A 3DLMA 5GAMh 2CZ6B 2LCCA 3JCMf 2VUBA 2L3PA 1QVPA 1HD3A 4PJNA 5KYXA 4KUDK 2AZVA 4C5GA 4PNOA 3OYGA 2OTLT 4J5YA 1KIKA 4WTOB 4B9XA 2AK5A 3PMTA 2QA4T 4J8OA 4FSXA 1WHKA 3S6WA 3OA6A 1C0MA 2JMAA 2KBTA 2YHTA 1KG1A 3L42A 2VB6A 4OMNA 3VS7A 1YI2T 2V8JA 5J3BA 4J9BA 3OYEA 1VQ5Q 1Y96B 4RMOA 3HRUA 4F17A 1M30A 4RTXA 4X34A 5IHIA 5HK0A 2P0QA 1XTDA 6AT1B 3FEOA 4ZN3A 1G3WA 2E70A 2RHZA 4E7JA 3ASKA 3A8HB 2EWNA 4AG2C 4J9IA 1FMKA 1QKXA 3MP6A 2C06A 1N8RU 4F7UB 1M2VA 2ZPFB 3PE0A 2YLBA 1UHCA 4M75B 2R57A 1X69A 1BI1A 5GMKm 1U3OA 1LVKA 2VWFA 2PU9B 3GBQA 3H0HA 2QGGA 3JSCA 3VUZA 4M7DB 2FRYA 1NG2A 1FMVA 2DXBA 1VQ9Q 3JCMb 1W1FA 1KQ1A 2QDYB 3SWNC 1Y7XA 3CCQQ 2KXCA 2EYXA 3PFSA 3GOXA 3JCMJ 1NJIC 4NL2A 1I0CA 4M7AE 5AYFA 4JLGA 2FPDA 4MMLA 2AKKA 5LJ5e 1RLPC 1K8AC 2BKDN 1W2BS 4OB3B 3M56A 3REAB 2CP3A 4QVCA 1Y96A 5IXFA 4LE9A 1YCYA 2VASA 4FYWB 5KYWA 1UGQB 2X3XD 3CCST 2D9TA 1WJRA 1P92A 5GANf 2FEIA 4OGEA 2DJZA 1LCKA 5C0MA 3OYBA 2ATCB 1ZX6A 2FZCB 4ZN1A 3OYJA 3CCMT 4FIBA 4JDSA 4PFPA 4F7UA 2HNIA 4EDUA 1BCOA 1QCFA 1M1KC 5GAOm 1GBRA 4C8QA 3S3OA 2X35A 3JCMg 4M75A 4M7AC 2AZSA 1X27A 4LDUA 2LT4A 3UPUA 4QKUA 1PSEA 2RK2A 3TCJA 5CKFA 4XTZA 2CZ0B 4IUPA 4RTTA 2XG8D 1M5Q1 3CBMA 3JCMV 1NJIU 4PJOB 1D0ZA 3V8LA 1BI0A 2EQUA 1LPLA 2RA2A 2VKNA 1RAFB 3LH0A 1G2BA 4AFSC 1VQ7A 5IT9E 4DOWA 1ZA1B 1YBYA 3TQ7P 3EG0A 3C95A 3SHWA 2J05A 1QKWA 2LJ0A 2A3LA 2MK5A 2QAZA 1OI1A 1X6BA 4MDXA 1WHGA 2Y90A 3URGA 2LMJA 4QQGA 2A28A 2DM1A 5DLQE 3QZ9B 3J81E 2YRDA 2BUDA 2Y4YA 1VQNA 2VV5A 2JTEA 4M7AF 3HPWA 1QVGP 1XJWB 3P8HA 1Q82C 3P8BB 1UGRB 2ZPGB 3VUBA 1H641 1SG5A 2HCKA 1S72A 1KQSP 1AWJA 2OAUA 1TS9A 4OF1A 3OYCA 4J9EA 2DXUA 1QMCA 4FL6A 2NUTB 1X2KA 4NS5A 1GRIA 1H8KA 4BDYA 2OX7A 2DMOA 4ATOA 3M0PA 2A37A 3A8MB 2Z0WA 1OULA 1OQKA 4OMLA 3L1AA 5HK3A 2DNUA 3G71T 3QYHB 2R5AA 1RI9A 2ZZDA 3UA6A 3CCUT 3BW1A 5KYUB 1YJWA 3PIOA 4RTVA 3VS2A 1QVFA 1EIFA 3HSBA 3JCMe 4RTZA 1D09B 3OYNA 2K5LA 5GANg 1K73C 3M0UA 4M77F 5HCKA 3CBPA 4J9HA 2XMFA 4OGCA 3OYMA 2JNGA 2EKOA 2V8IA 1MMAA 1Q81R 4CC3A 1BBZA 3FC3A 3EFRA 5IN1A 1JJ2P 1VQ7Q 2WACA 4FYYB 1RAIB 4C92D 3JB9J 2ECZA 2OTJA 1WFWA 4XTWA 2DX1A 2KYMA 3ER0A 2FG0A 2B86A 3CC2A 2IIMA 1GL5A 3VJPA 1QWEA 3EG3A 1HXDA 4M78F 1B7TA 4TVRA 3V8KA 2HAXA 2VGNA 2EGAA 4OVAA 2XI9A 2LVMA 1VQNQ 2F2WA 3O5ZA 4J7IA 5GAMd 1UJYA 3QPHA 3CC4T 3QJYA 4DBHA 2CT3A 1CSKA 2K9GA 1ACMB 1RAAB 4CC2A 3UDCA 1WZOA 3A8OB 3G4SA 3CCJA 2VXFA 5FU7C 2E41A 3DKMA 3RKYA 1S72Q 1IRXA 2EQKA 2V1RA 2J6OA 2NYSA 1MMNA 4WCIA 1K73U 5A0DA 2XHCA 1RAGB 5FW9A 2EVRA 1J3TA 1E7OA 1BIAA 1M4ZA 2WSEE 4X1VA 3MJXA 3H6ZA 2FYKA 2DIGA 3RBBB 1G5VA 4C0DB 2K2MA 3OYYA 4BE0A 5FLXE 5GAOl 1UG1A 4A4FA 5GMKh 3HHTB 1AWOA 2P0PA 4BI3A 1UGSB 1T0HA 3TVTA
chains in the Genus database with same CATH topology
2GFUA 1KQSS 4M7AG 3MCAB 1VQ8T 1QVGA 3MEAA 5IAYA 3G6ET 1U1TA 3RESA 4PKCC 2E65A 1W4SA 4Y28E 3O8VA 3CCRA 1UGPB 4KT0E 5GAOn 1NJIU 2LX9A 3QXEB 3CCQA 3CMET 4E7KA 4IUTA 4J83A 3J80E 1X6OA 4RG8A 2RHXA 3QO3A 4RG2A 5GAN8 5J39A 4M78D 4XU2A 2E1HA 5LJ5g 5LJ3e 1VQ8A 4V2SA 3VU3C 3G6EA 1ZHIA 4RCBA 4Q5WA 4XTUA 1KQSA 1ZBXA 2LDMA 4HT9A 3GNGA 2DXTA 3X28B 4M75C 5GANe 3LW5E 2EYQA 3QBYA 3RUXA 2MWPA 4A53A 2D6FA 2EFIA 4KULA 3OW2A 3DLMA 3EFSA 1NPPA 5GAMh 2CZ6B 2LCCA 3CCUA 3JCMf 5D6YA 2KDSA 2VUBA 4M7DC 5DM7R 2DKGA 2RH2A 3FJPA 1QVPA 4KUDK 3LGFA 4C5GA 2K2VA 4PNOA 3OYGA 5FU7B 3CCVA 2ZPEB 1G3TA 2OTLT 1VQLT 5I2MA 3JB9F 3QUIA 3JB9I 4J5YA 5KE2A 4B9XA 2DEQA 2DPPB 2MI6A 1K9MU 2CZ1B 3PMTA 3LWHA 2QA4T 4J8OA 4D6WA 4FSXA 3S6WA 2K5IA 1H3ZA 3OA6A 3QJ6A 5GMKl 1KG1A 4A4HA 2YHTA 3L42A 5KH6A 4KUIA 2FVUA 5FROA 2OTLA 2DZCA 3R6OA 4OB1B 2K57A 4IURA 3RIRA 1YI2T 1B34A 3QIIA 3CCJT 1VQPT 2F69A 2V8JA 3V8JA 3PGGA 5J3BA 2KAFA 4M7DA 3ZBDA 2QA4A 3OYEA 2DD4A 2KSSA 5CAIA 3CCLT 1Q86U 2R58A 5GMKj 4JS5A 2DZ9A 1Y96B 2EJFA 5A2QE 2YLCA 3A8GB 1M1FA 4DQ2A 4ZTJA 3OYLA 1VQ7T 4RMOA 1VQ6T 2WSFE 5LL6S 2H3JA 4PJOE 3HRUA 2VGMA 1YI2A 3MEWA 5FRMA 4IUQA 1M9SA 1VQPA 5D6XA 1YITT 1OZ3A 4X34A 4M77E 5CKHA 3BFMA 2XDBA 5HK0A 2P0QA 1XTDA 3OY9A 3M5AA 3I56A 2ZCFB 1JBMA 3JB9G 3FEOA 4ZN3A 1G3WA 2E70A 5A0LA 1K8AU 2RHZA 2RJDA 2QQ9A 4MZPA 4E7JA 1G3YA 2RI2A 3ASKA 3JCMh 3A8HB 4HT8A 1YITA 2HQEA 1WPYA 2EWNA 2XKOC 4JRPA 1DJ7B 1VQOT 1KHCA 1LJOA 3MP6A 2C06A 4EPCA 3GIBA 4N4HA 4M7DF 1N8RU 2FB7A 4F7UB 4R56A 1WGSA 2GCXA 4EMKC 1VQNT 5DY9A 2RD1A 4JJNK 1LOJA 3CXCS 4C8QE 3X20B 2MF2A 1XOVA 5GAMj 2ZPFB 4J6XA 3VV0A 3JCMc 4XQ3A 2YLBA 4M75B 2R57A 2L8DA 1VIEA 4E7LA 2PVGB 1BI1A 2DK3A 2PUKB 4NOYA 1IZ6A 5GMKm 1K9MC 4KBMB 4M78E 4YTLA 4GLKA 4JRIA 4L5GA 5KCHA 1YIJA 3CC7T 2GFAA 2PU9B 4Z02A 4XK8E 3JB9H 3JSCA 4A54A 3VUZA 4M7DB 4C0GA 1WJSA 2RK1A 5CKEA 4HCCA 2DXBA 4N0AC 4MZMA 3JCMb 1M1KU 3I55T 1KQ1A 2QDYB 3SWNC 3JB9D 3P8DA 4PJOC 2E10A 1FX7A 5GAOp 4C0ZA 3CC7A 2JN0A 5LJ3d 1Y7XA 4J7FA 4M77C 2RHYA 1Q86C 4XTXA 4A4KA 2K3YA 2CKKA 3FRNA 3PFSA 5L8RE 5GAMg 3GOXA 2O01E 3JCMJ 1NJIC 4BE1A 4NL2A 3JCMW 2JTFA 1QP2A 3RMQA 5GANd 3I55A 2PVDB 2RHIA 4M7AE 5AYFA 1WQWA 2CYZB 2M0OA 3L2RA 2GF7A 2LRQA 2NLUA 4JLGA 4MMLA 4C5IA 2AHJB 3CBOA 3QSUA 1GXIE 5LJ5e 1BKBA 1I81A 3OW2S 1XQHA 4C92B 2BKDN 4BACA 1W2BS 4OB3B 4C92E 1K8AC 3M56A 2RHUA 1NPRA 4CRIA 4QVCA 3FDRA 1Y71A 4X9DA 4HKEA 3RMSA 1Y96A 3OBYA 4C8QC 1WNLA 3M55A 4MZTA 2V8KA 3QKJA 4JLIA 4LDWA 3SWNA 2O4XB 3HKSA 4PJOA 1YCYA 4FT2A 1RL2A 4EMHA 3CMEA 2HBPA 3SB2A 5LJ3f 1N8RC 1UGQB 2JOYA 3BDLA 1UEBA 2L89A 3MO8A 2X4YA 2P0KA 3MEUA 3CCST 2KY9A 4M78C 3CPWA 2D9TA 1WJRA 3RKXA 5J26A 1P92A 1W2BA 2RJFA 5CIUA 2QQRA 5GANf 4OGEA 2DJZA 1VQMT 4A4EA 1N9SA 2HQXA 4GY5A 5C0MA 5CK9A 3OYBA 2XD0A 3SD4A 2RJCA 1PSFA 2D0QB 4ZTFA 3LLRA 4BB7A 3ME9A 1BI3A 2XDDA 3CCSA 1KC8C 3OB9A 3ZEHA 4ZN1A 2PVOB 1OZ2A 2CS7A 3META 3OYJA 2IVWA 4FIBA 4JDSA 4LD6A 2JVVA 3CCMT 4F7UA 2HNIA 3MHXA 3C12A 4EMKB 4EDUA 3LYIA 3KUFA 1VQMA 1M1KC 5GAOm 4UC4A 4C8QA 3S3OA 2X35A 5M9OA 2LTOA 2F5KA 2L3RA 3JCMg 4M75A 4PJOF 2XICA 3AHUA 4M7AC 2HD0A 1KD1C 3E9FA 1VQLA 1NZ9A 4LDUA 2LT4A 3BDUA 3UPUA 3M58A 3QHSA 1VQ4T 4OB2B 1HK9A 1PSEA 3M4YA 2DO3A 2RK2A 4VUBA 1Q82U 4C92C 3TCJA 2OTJT 5CKFA 4WF2A 4XTZA 2CZ0B 3HL8A 4IUPA 4MMKA 2E64A 2RI5A 1Q7YC 2XG8D 1M5Q1 3CBMA 2X4XA 3JCMV 1JJ2S 1VQ6A 2FL7A 3A5ZB 3UT1A 3OBWA 4LDVA 3SWNB 4BI8B 3X24B 4C0FA 1NE8A 2JUFA 4R55A 4PJOB 3V8LA 3M59A 2ZPIB 1VQ4A 1BI0A 3JCMQ 2EQUA 3NTHA 4M77B 4F7UF 2QQAA 2FHDA 4O6JA 2RA2A 2EQJA 5LJ3h 3LH0A 2LC4A 3CCLA 4C8QF 2E6ZA 3OYHA 4DOVA 4IUVA 1O9SA 4M7AA 1VQ7A 4PL6A 4M75F 1QP3A 3E1SA 4HA8A 5GANh 3VYHB 4FU6A 3X25B 1UB4A 3M57A 5GMKe 4DOWA 5GAN4 2M9UA 4LDYA 1JJ2A 1Q81U 3TEEA 2RJEA 3VYGA 3TREA 4C92A 1OYXA 1ZQ1A 1VUBA 3NTIA 1YBYA 3M54A 1U1SA 3G4ST 4IUUA 2LQKA 3MP8A 3C95A 4C8QB 2A3LA 4JRKA 3L2VA 4XTVA 1OI1A 3OYAA 1JRIA 4ME7A 1N6AA 2O4XA 2Y90A 3OYDA 3URGA 4MDXA 4QQGA 2DAQA 3JCMX 4BE2A 4HCBA 3GPLA 2XK0A 2K4YA 1VQOA 3INZA 3LX7A 2JTMA 3J7AF 4ZGDB 5DLQE 4JUVA 3QZ9B 4M78B 3J81E 5GAOq 3PTAA 5FU6C 5CQYA 2DTIA 2BUDA 2Y4YA 1KC8U 1VQNA 2BIVA 2VV5A 3VKIA 1I8FA 1O75A 4IKFA 4M7AF 4F7UG 1S72T 3HPWA 2K3XA 4N4IA 5LJ5d 3GF5A 4J6YA 4PLIA 3OYKA 4XU1A 3P8HA 2YRVA 3OYIA 1Q82C 5GAMe 3P8BB 3NFCA 4E47A 1UGRB 1QW1A 4C92F 3RERA 4M75G 3CPFA 2X4WA 5C6SA 1YJ9T 2WSCE 1KD1U 3QZ5B 2ZPGB 3VUBA 4EMKA 1M90U 1H641 3E9GA 4EMGA 1KQ2A 2QTXA 3S3NA 3OSVA 2LQ8A 5GMKi 2EJGA 2E12A 5CQXA 1S72A 3RKWA 3PT9A 1FXXA 4OB0B 4PJOD 3CMAT 1YHQT 4M7DG 4M7AB 4BY6C 2PUOB 3KBGA 1Q7YU 3WVDB 2OAUA 3PIPA 2LCLA 3PNWC 2Y4XA 4OF1A 4LDXA 3CPWS 3OYCA 2DXUA 2F5TX 3C94A 3SFMA 4LD9K 2MAMA 4N0AA 3X26B 3QYGB 4C5EA 4OVAA 4FL6A 1D3BB 3A8LB 3CMAA 1YHQA 3FB9A 3L2QA 4Y91A 5LJ3j 4NS5A 5LJ5f 3OS1A 3OYFA 2DXCA 2RO0A 2QEXT 4BDYA 1Q81C 5GAN3 1VQKT 4ATOA 1I4K1 1KHIA 3A8MB 3GNFB 2P4TA 3L2ZA 3S3MA 4M77A 1QVFS 5GANj 4ELZC 3LGLA 1YJWT 3L1AA 3H8ZA 5HK3A 4ELYC 3HRSA 2VYTA 4C8QD 3G71T 1X75C 3QYHB 5CKDA 5IT9E 4C92G 3PMIA 3QDRB 2K5FA 2QEXA 3DLLA 3FIFA 4M75D 4XU0A 3OQ5A 1VQKA 2R5AA 2RB6A 4L59A 2ZZDA 4E7IA 3OYMA 3CCUT 3BW1A 1N9RA 3PIOA 1YJWA 2LNVA 4M7DD 2EJ9A 4HCZA 5CO7A 1EIFA 2E5QA 1QVFA 5LJ3g 3HSBA 3G71A 2PQWA 3WVEB 3JCMe 3KXTA 3SDZA 3CCVT 2GQVA 3OYNA 4O5VA 1M8VA 2K5LA 2LT1A 2KQWA 2MMPA 2ZPBB 5GANg 1WJQA 4QQ6A 2KK4A 5I21A 1K73C 4PLLA 4E7HA 1MHNA 3JAME 4P5NA 4ZGJB 4FT4A 1M90C 4M77F 3HFNA 4M78A 4CI0C 3CCMA 3CBPA 5FU6B 5GAN6 4OGCA 2KMTA 3FLGA 1MGQA 2DIQA 2EKOA 2JNGA 2I2LA 3WXMB 4A4GA 4C5HA 4ZGEB 3L2UA 2V8IA 3TU4K 5GAOr 4C0DC 3HRTA 4M7AD 3ZFJA 5HKCA 2KVQG 1N27A 2CZ7B 3FC3A 1BIBA 3EFRA 3CC2T 4JS4A 1JB0E 5IN1A 4QVZA 2L5QA 4NL3A 3JRZA 2RI3A 2WACA 4BUGA 3OS5A 5LJ5h 5CCAA 4C92D 5KCOA 3JCMP 3F70A 3JB9J 4QVDA 3OS2A 4B9WA 3E19A 2E6NA 2OTJA 2EIFA 2VXEA 4XTWA 3MP1A 2XDPA 3OSSC 1U8RA 3BY7A 3ER0A 3V7SA 1BYMA 3CC2A 2XIDA 4BY6B 3OS0A 3VJPA 3I56T 2X4JA 1HXDA 1V29B 4JRQA 2QQBA 4M78F 4XU3A 3L2WA 5HY6A 4DA4A 1LNXA 2G3RA 1VQ5T 2DTHA 4N4GA 3NTKA 4QQDA 4TVRA 4PJOG 2QXFA 3V8KA 4OP0A 3GLXA 3T9NA 2HAXA 5A0GA 2VGNA 4M77G 2XI9A 1M1GA 1TH7A 1X01A 1D3BA 2CGHA 2LVMA 3QG1A 1VIFA 2DTOA 4J7IA 5CVIA 5GAMd 3QPHA 3CC4T 3QJYA 3DB3A 1IREB 3HP9A 1I5LA 3CD6T 1VQ5A 2M1HA 2VC8A 3UWNA 2M16A 5GAN5 3UDCA 1YJNT 3N5BB 4QW2A 2R5MA 2JZ2A 3A8OB 3G4SA 3C4SA 3CCJA 2DD5A 4FM4B 1WQ7A 2B8AA 2VXFA 4XTYA 1SSFA 2E41A 3DKMA 5FU7C 3RKYA 1XNIA 3CC4A 1R8OB 3EAEA 3Q1JA 3HFOA 3M53A 4L6V5 2EQKA 4MDWA 4RCCA 1YIJT 4F7UE 3CD6A 4C8QG 3M4GA 2MWOA 5GAN2 1YJNA 2ZGWA 3CEYA 2QI2A 1K73U 5A0DA 3CCET 2XHCA 4M75E 4BD3A 5I2SA 4X9CA 5GAN7 1AHJB 4XAXB 4M78G 5KE3A 3GP8A 1BIAA 5GAMf 2ZPHB 2QQSA 3MEVA 1B34B 2DVEA 1M4ZA 2WSEE 4M7DE 3OMGA 4M77D 4BI4A 3G7ZA 3H6ZA 4OMFB 1VQ9T 1QVGS 3V7CA 5FRNA 3CXCA 2XU8A 1YJ9A 2FYKA 3CCEA 2RM4A 2DIGA 5DLOA 3V7RA 3OMCA 5LJ5j 4BDZA 1G5VA 2A7YA 3M9QA 1FWZA 5EG2A 4C0DB 5CR2A 3OYYA 4II1A 1Y07A 4RKUE 3CCRT 4BE0A 5FLXE 2EAYA 2IG0A 3DB4A 5GAOl 5CKBA 3CCQT 4A4FA 1BI2A 2EQMA 5GMKh 3HHTB 3LWIA 2P0PA 4BI3A 1RI0A 1UGSB 1VQ9A 4J6WA 3JCMd 5D6WA 1G3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RA2 A;  5LJ3 h;  5GMK m;  4NOY A;  5GAN g;  4M7A G;  5I21 A;  4C8Q F;  1U1T A;  3RES A;  4M78 E;  4JRI A;  2E65 A;  3JB9 H;  4M77 F;  4A54 A;  3HFN A;  4M78 A;  5GAO n;  4M75 F;  4M7A A;  4M7D B;  4HA8 A;  5GAN h;  5GAN 6;  5GAN 4;  5GMK e;  1MGQ A;  2I2L A;  4N0A C;  5GAO r;  3JCM b;  3QO3 A;  5GAN 8;  4M7A D;  4C92 A;  4M78 D;  4XU2 A;  2E1H A;  5LJ5 g;  5LJ3 e;  1BIB A;  1KQ1 A;  1U1S A;  3SWN C;  3EFR A;  3VU3 C;  4RCB A;  2E10 A;  5GAO p;  3JB9 D;  4PJO C;  2JN0 A;  4XTU A;  5LJ3 d;  4NL3 A;  4HT9 A;  4M77 C;  5LJ5 h;  4C8Q B;  2DXT A;  4XTX A;  4M75 C;  4JRK A;  4C92 D;  3JCM P;  5GAN e;  5GAM g;  4XTV A;  3JB9 J;  4QVD A;  1JRI A;  2Y90 A;  3RUX A;  3JCM J;  3JCM X;  4A53 A;  4NL2 A;  3JCM W;  5GAN d;  4XTW A;  2VXE A;  3EFS A;  3INZ A;  5GAM h;  3BY7 A;  4JUV A;  4M78 B;  4M7A E;  3V7S A;  3JCM f;  5GAO q;  1WQW A;  4M7D C;  2DKG A;  2DTI A;  3FJP A;  4MML A;  3QSU A;  1I8F A;  5LJ5 e;  4C92 B;  4PNO A;  1HXD A;  4M7A F;  4F7U G;  4C92 E;  4M78 F;  4XU3 A;  5LJ5 d;  1LNX A;  4J6Y A;  4QVC A;  2DTH A;  3JB9 F;  3V8K A;  3QUI A;  4XU1 A;  4J5Y A;  4PJO G;  4OP0 A;  4X9D A;  3JB9 I;  5GAM e;  1Y96 A;  4C8Q C;  1WNL A;  2DEQ A;  4M77 G;  3RER A;  1TH7 A;  1X01 A;  4JLI A;  1D3B A;  2CGH A;  4M75 G;  3SWN A;  4C92 F;  2DTO A;  4PJO A;  5GAM d;  1YCY A;  4EMK A;  4EMH A;  1H64 1;  4EMG A;  1KQ2 A;  2QTX A;  3SB2 A;  5LJ3 f;  5GMK l;  5GMK i;  2YHT A;  2EJG A;  3RKW A;  4M78 C;  1I5L A;  4PJO D;  2DZC A;  2VC8 A;  3RKX A;  4M7D G;  5GAN 5;  4M7A B;  2K57 A;  3RIR A;  5GAN f;  1B34 A;  2DJZ A;  3V8J A;  1N9S A;  3PGG A;  1WQ7 A;  2VXF A;  4XTY A;  4M7D A;  2E41 A;  4V2S A;  3RKY A;  5CAI A;  2DXU A;  3HFO A;  5GMK j;  4RCC A;  2DZ9 A;  1Y96 B;  2EJF A;  4F7U E;  2YLC A;  4N0A A;  4DQ2 A;  4C8Q G;  3M4G A;  1D3B B;  5GAN 2;  3FB9 A;  4F7U A;  2HNI A;  4Y91 A;  5LJ3 j;  4EMK B;  2ZGW A;  5LJ5 f;  4PJO E;  5GAO m;  4C8Q A;  5GAN 3;  4M77 E;  1I4K 1;  3BFM A;  4F7U F;  4M75 E;  5GAN 7;  3L2Z A;  4X9C A;  3JCM g;  4M78 G;  4M77 A;  5GAN j;  1JBM A;  1BIA A;  4M75 A;  4PJO F;  5GAM f;  3L1A A;  3AHU A;  3JB9 G;  4M7A C;  1B34 B;  4C8Q D;  2DVE A;  3BDU A;  3JCM h;  4M7D E;  4C92 G;  3QHS A;  4M77 D;  1HK9 A;  3FIF A;  4M75 D;  4XU0 A;  3V7C A;  4C92 C;  4HT8 A;  1WPY A;  2EWN A;  2FYK A;  2RB6 A;  4WF2 A;  2RM4 A;  4XTZ A;  4MMK A;  3V7R A;  1LJO A;  2E64 A;  5LJ5 j;  3GIB A;  1M5Q 1;  4M7D F;  3BW1 A;  2FB7 A;  1N9R A;  3JCM V;  4F7U B;  4EMK C;  2EAY A;  4M7D D;  2EJ9 A;  5DY9 A;  5GAO l;  2RD1 A;  3SWN B;  1LOJ A;  5LJ3 g;  3HSB A;  4PJO B;  5GMK h;  4C8Q E;  3JCM e;  3V8L A;  5GAM j;  4J6X A;  3JCM Q;  4M77 B;  3JCM c;  4XQ3 A;  2YLB A;  1M8V A;  4M75 B;  4J6W A;  3JCM d;  1I81 A; 
#chains in the Genus database with same CATH topology
 1VQ8 T;  2YT6 A;  3G6E T;  3VS1 A;  1YJW Q;  4PKC C;  1UGV A;  1JXM A;  4Y28 E;  4KT0 E;  5GAO n;  2KI7 A;  1X6O A;  3NHN A;  1D1B A;  2ZAE A;  4RG2 A;  4Y92 A;  2QG9 B;  2YXY A;  2LDM A;  4QT7 A;  3GNG A;  3EGX B;  5GAN e;  3QBY A;  2MWP A;  2D6F A;  1IGU A;  1WHJ A;  5DM7 R;  2DKG A;  3FJP A;  2DYB A;  2RN8 A;  2PTK A;  2K2V A;  3CCV A;  2GNC A;  2OTJ Q;  5I2M A;  3CC2 Q;  2NUZ A;  2DEQ A;  2DPP B;  1K9M U;  3IQL A;  2CZ1 B;  3LWH A;  1ZUU A;  2X9H A;  2K5I A;  1SEM A;  3BE3 A;  5KH6 A;  2OTL A;  4RTW A;  2COW A;  2K57 A;  1NYF A;  1VQP T;  2F69 A;  2KAF A;  2HL3 A;  2QA4 A;  2DD4 A;  2EBP A;  1Q86 U;  2R58 A;  3H9N A;  5A2Q E;  1M1F A;  4ZTJ A;  2WSF E;  1PKT A;  3G4S Q;  3RDV A;  1YI2 A;  2EYZ A;  3MEW A;  3CCJ Q;  1OZ3 A;  1PC0 A;  3BFM A;  4HVV A;  3I5R A;  3OY9 A;  1R77 A;  3M5A A;  3JB9 G;  5A0L A;  2QQ9 A;  1G3Y A;  1FYN A;  3EGD A;  5KYX B;  4HT8 A;  2HQE A;  2DLP A;  1AZG B;  1VQO T;  4AG1 C;  4EPC A;  2DRM A;  1WGS A;  5GJW B;  2PZ1 A;  2RD1 A;  1R0B G;  3CXC S;  3X20 B;  2MF2 A;  5GAM j;  1JEG A;  3JCM c;  1MV0 B;  1VIE A;  2PUK B;  2DL7 A;  4KBM B;  4JRI A;  3CC7 T;  4F04 B;  2GFA A;  4XK8 E;  2I0N A;  4ORZ A;  1WJS A;  2RK1 A;  5CKE A;  4C0G A;  2BTT A;  2AT1 B;  2JW4 A;  4N0A C;  3I55 T;  2FRW A;  1FX7 A;  5GAO p;  4J7F A;  1GCP A;  2CKK A;  5L8R E;  4JJD A;  4BE1 A;  1I1J A;  3TSZ A;  2JTF A;  2QDL A;  1QVF P;  2CYZ B;  3L2R A;  1K1Z A;  2P84 A;  2AHJ B;  3CBO A;  1BKB A;  2GTO A;  3OW2 S;  1XQH A;  4C92 E;  1NPR A;  1Y71 A;  4MZT A;  3M0Q A;  4LDW A;  3SWN A;  4F16 A;  3CME A;  1N8R C;  3CCV Q;  3BDL A;  2X4Y A;  3MEU A;  2RJF A;  1MMG A;  5CIU A;  2H8H A;  4DBF A;  4A4E A;  5CK9 A;  3SD4 A;  2RJC A;  4ZTF A;  3CQT A;  4BB7 A;  4IIO A;  2XDD A;  3CCS A;  1E6G A;  2OTL Q;  3MET A;  2IVW A;  1NLO C;  3PVQ A;  1NJI R;  1ZUY A;  2V26 A;  1PRM C;  4EMK B;  2QA4 Q;  5M9O A;  2F5K A;  2L3R A;  2RMO A;  3AHU A;  2XIC A;  2HD0 A;  4PFO A;  1K8A R;  3E9F A;  4PJJ A;  1VQL A;  1NZ9 A;  1YI2 Q;  3QHS A;  1VQ4 T;  4OB2 B;  2YRC A;  4VUB A;  4C92 C;  2RI5 A;  2KE9 A;  3EHQ A;  1AOJ A;  3UT1 A;  5FRM A;  3OBW A;  4R55 A;  2JUF A;  5KYW B;  4M77 B;  2QQA A;  5LJ3 h;  2EQJ A;  4HVW A;  3CCL A;  2HEQ A;  1D1A A;  1VYU A;  2E6Z A;  2CP2 A;  4M7A A;  1YJN Q;  4PL6 A;  3E1S A;  1VQ6 A;  4HA8 A;  4FU6 A;  5GAN 4;  1JJ2 A;  3D7S B;  2RJE A;  4PFZ A;  1M1K R;  3NTI A;  1VUB A;  4IUU A;  4C8Q B;  4JRK A;  2YDL A;  3L2V A;  4XTV A;  2K4Y A;  3LX7 A;  4ZGD B;  4M78 B;  5GAO q;  5CQY A;  1WXB A;  1O75 A;  3M0R A;  4D8K A;  4F7U G;  3OYK A;  3GF5 A;  4KH1 B;  1WX6 A;  3NFC A;  3CCR Q;  4C92 F;  2GQI A;  4M75 G;  2X4W A;  2DL5 A;  4EMK A;  1V76 A;  1M90 U;  2JT4 A;  2LQ8 A;  1X2Q A;  5GMK i;  2EJG A;  2E12 A;  4PJO D;  8ATC B;  1YHQ T;  4M7D G;  4BY6 C;  4PJL A;  3KBG A;  2D8J A;  4RTY A;  3WVD B;  2LCL A;  4LDX A;  3CME Q;  1PM3 A;  3C94 A;  1W2B P;  1D0Y A;  3QYG B;  1D3B B;  1GCQ C;  2DXC A;  1K0X A;  2X3W D;  5GAN 3;  2YWW A;  1I4K 1;  2P4T A;  1WXT A;  4M77 A;  4FW2 A;  4ELZ C;  3CCS Q;  1WYX A;  1H3H A;  1OU8 A;  2LNH B;  2ED0 A;  5CKD A;  3FIF A;  1Q82 R;  3OQ5 A;  4AFQ C;  2RB6 A;  2DFU A;  1N9R A;  1VQL Q;  2A08 A;  5CO7 A;  4HCZ A;  3R6N A;  3G71 A;  3WVE B;  3KXT A;  3I9Q A;  2C0I A;  4HXJ A;  2KQW A;  2FZG B;  1WJQ A;  3EH2 A;  1PD1 A;  2KK4 A;  4QQ6 A;  4M78 A;  2CT4 A;  1V1C A;  5FU6 B;  4A4G A;  2COZ A;  2M02 A;  3HRT A;  3CCL Q;  1YP5 A;  4CC7 A;  3VS5 A;  4BUG A;  1VQ6 Q;  5LJ5 h;  1VYV A;  3ZL7 C;  5AT1 B;  4B9W A;  2BE9 B;  1AZE A;  2DJQ A;  3BY7 A;  5I22 A;  1BYM A;  2RPN A;  2G6F X;  3VS6 A;  2XID A;  3UAT A;  3OS0 A;  2X4J A;  2JS2 A;  1V29 B;  4JRQ A;  4DA4 A;  4XU3 A;  1LNX A;  3NTK A;  4PJO G;  4OP0 A;  3GLX A;  1GBQ A;  1MMD A;  3QG1 A;  1M1G A;  1X01 A;  1D3B A;  1K73 R;  1N5Z A;  4JZ3 A;  1I5L A;  3CD6 T;  4KGZ B;  2M1H A;  2M16 A;  1M3B A;  1ZUK A;  4QW2 A;  2R5M A;  1WDX A;  2DD5 A;  2YUP A;  2KT1 A;  3CC4 A;  2DL8 A;  4RUG A;  4L6V 5;  4F7U E;  3M4G A;  5GAN 2;  4JZ4 A;  3CCE T;  4M75 E;  4KH0 B;  4X9C A;  1AHJ B;  4XAX B;  5GAM f;  2ZPH B;  2GGR A;  2J06 A;  1B34 B;  4DEY A;  1BB9 A;  2X51 A;  4M7D E;  4OMF B;  1QVG S;  3CXC A;  1YJ9 A;  4E2F B;  1UFF A;  1KFZ A;  1PCX A;  3M0T A;  2HL5 C;  1M3C A;  3M9Q A;  5EG2 A;  1M27 C;  4RKU E;  3DB4 A;  5CKB A;  2NWM A;  2BZY A;  2O9V A;  4E7Z A;  3VS3 A;  3MKD A;  1AT1 B;  4J6W A;  3UF4 A;  4HCC A;  2FO0 A;  1C1A A;  2GFU A;  1KQS S;  3MEA A;  1WHH A;  1UGP B;  1ZSZ B;  2CUD A;  2LX9 A;  3G71 Q;  5IH2 A;  3EG2 A;  3QO3 A;  1RAH B;  1PRL C;  5GAN 8;  3TSW A;  1VQ8 A;  2GTJ A;  3VU3 C;  3G6E A;  4RCB A;  4M75 C;  1VOM A;  2EFI A;  4KUL A;  3OW2 A;  1NPP A;  4M7D C;  5D7U A;  2RH2 A;  2DE0 X;  2ZPE B;  3EHR A;  1TU0 B;  2HDA A;  5KE2 A;  2HSE B;  2MI6 A;  1YWP A;  1WIE A;  4D6W A;  4LUE A;  1UTI A;  1OPK A;  5GMK l;  4KUI A;  5FRO A;  4OB1 B;  1B34 A;  3V8J A;  3PGG A;  1G83 A;  2KSS A;  2DIL A;  5GMK j;  1WHL A;  2YLC A;  1VQ7 T;  5LL6 S;  4PJO E;  2YSQ A;  1VQP A;  1X6G A;  5D6X A;  2HKN A;  1YIT T;  2XDB A;  1SHG A;  3CC4 Q;  3I56 A;  2MIO A;  3PVL A;  2ZCF B;  3NMZ C;  1MV3 A;  2RJD A;  4MZP A;  3JCM h;  3SEM A;  2VVK A;  1OX8 A;  1ZSZ A;  2A0F B;  3QDF A;  2CDT A;  2XKO C;  1DJ7 B;  1KHC A;  1LJO A;  4Z8A A;  3GIB A;  4N4H A;  4M7D F;  3H0F A;  1PNJ A;  2GCX A;  1VQN T;  5DY9 A;  4JJN K;  1LOJ A;  4GBQ A;  2EKH A;  4AFU C;  1YJ9 Q;  3MPU B;  2DK3 A;  4ANJ A;  4NOY A;  1IZ6 A;  3VRZ A;  1K9M C;  2CP7 A;  5KCH A;  1TUG B;  1B3Q A;  1WHM A;  1YIJ A;  4Z02 A;  2KRS A;  2FZK B;  3THK A;  3JB9 D;  4PJO C;  2E10 A;  4C0Z A;  3CC7 A;  2JN0 A;  5LJ3 d;  4PJM A;  2RHY A;  1Q86 C;  1TXQ A;  2YUO A;  3FRN A;  5GAM g;  3JCM W;  1QP2 A;  1WXU A;  3I55 A;  1VQ8 Q;  2PVD B;  2RHI A;  2NLU A;  3EGD B;  5IHK A;  4C5I A;  1X43 A;  3A1P A;  1FMW A;  1GXI E;  4OMQ A;  4C92 B;  4J9F A;  2RQR A;  2KT8 A;  2KR3 A;  4HKE A;  2K7A A;  3OBY A;  1WNL A;  2L0A A;  2SRC A;  4JLI A;  2O4X B;  3HKS A;  1UDL A;  1K9A A;  1RL2 A;  4FT2 A;  4EMH A;  1IO6 A;  2HBP A;  3SB2 A;  2PNI A;  1UEB A;  1D0X A;  5J26 A;  2HBW A;  1W2B A;  4FCY A;  1VA7 A;  2QQR A;  2HZY A;  2L3S A;  2MYS A;  2O9S A;  1VQM T;  1N9S A;  3I35 A;  4GY5 A;  1PSF A;  2D0Q B;  1IGQ A;  1KC8 C;  2LCS A;  3OB9 A;  3ZEH A;  2JVV A;  3MHX A;  3C12 A;  3KUF A;  4UC4 A;  4PJO F;  4OMO A;  1KD1 C;  4ZNX A;  3BDU A;  5L23 A;  1AVZ C;  1OOT A;  1HK9 A;  1M2O A;  2EGC A;  2OJ2 A;  2ROT A;  4DBR A;  1VQP Q;  2OTJ T;  5KYN A;  1ZA2 B;  3I56 Q;  2E64 A;  1UE9 A;  1Q7Y C;  2CP6 A;  1N8R R;  1H92 A;  4LDV A;  3SWN B;  4BI8 B;  2EYW A;  2BZX A;  1VQ4 A;  3JCM Q;  4O6J A;  2LC4 A;  1NEB A;  2QTV A;  1MUZ A;  1QP3 A;  2L3Q A;  2HKQ B;  5GAN h;  1UB4 A;  2M9U A;  4JPB W;  1Q81 U;  2JM8 A;  3TEE A;  3VYG A;  3TRE A;  4C92 A;  4Z88 A;  3M54 A;  3G4S T;  1YIJ Q;  1UUE A;  2LQK A;  5FWC A;  3CXC P;  4ME7 A;  3OYD A;  2O4X A;  2CSQ A;  2RNA A;  3JCM X;  2DAQ A;  4BE2 A;  3GPL A;  3INZ A;  3J7A F;  1AWX A;  3PTA A;  3CC7 Q;  2DTI A;  2KRM A;  1KC8 U;  3VKI A;  1U5S A;  2K3X A;  5LJ5 d;  1BU1 A;  1RLQ C;  3I55 Q;  4J9G A;  1SRL A;  2YRV A;  3OYI A;  5GAM e;  3NGP A;  4E47 A;  1QW1 A;  3CPF A;  2D8H A;  2WSC E;  1KD1 U;  3E9G A;  2QTX A;  8AT1 B;  3OSV A;  1SSH A;  5IXB A;  1AEY A;  1Z9Z A;  3RKW A;  1FXX A;  1OPL A;  4RTU A;  3CMA T;  4M7A B;  1Q7Y U;  3PIP A;  3PNW C;  2Y4X A;  5GJV B;  3CPW S;  2F5T X;  3OW2 P;  3SFM A;  1B07 A;  2ESW A;  3X26 B;  3VS0 A;  1YHQ A;  4Y91 A;  1I5O B;  2JMC A;  5LJ3 j;  3OS1 A;  3OYF A;  2RO0 A;  2QEX T;  1VQK T;  3GNF B;  3L2Z A;  3S3M A;  2IPO B;  1QVF S;  3LGL A;  3H8Z A;  3HRS A;  4C8Q D;  1PG5 B;  3PMI A;  3QDR B;  3DLL A;  4M75 D;  2DVJ A;  4XU0 A;  1CKB A;  1ARK A;  2M0Y A;  2LNV A;  1W70 A;  2KXD A;  4M7D D;  2E5Q A;  2PQW A;  3AT1 B;  1GCQ A;  3SDZ A;  3CCV T;  4O5V A;  2EQI A;  2MMP A;  2ROL A;  5I21 A;  4PLL A;  1M90 C;  1Q95 G;  2CP0 A;  1NEG A;  2J6F A;  3CCM A;  1EX4 A;  1TG0 A;  5GAN 6;  2KMT A;  2FPE A;  1MGQ A;  3WXM B;  3L2U A;  1VQ4 Q;  4C0D C;  3I5S A;  1JQQ A;  1N27 A;  2CZ7 B;  5KYY B;  4JS4 A;  4QVZ A;  2L5Q A;  2RI3 A;  3JCM P;  2JJ9 A;  3F70 A;  2DL4 A;  4QVD A;  3OS2 A;  3VS4 A;  3E19 A;  2E6N A;  2EIF A;  2VXE A;  2A36 A;  4AMC A;  5HY6 A;  1VQ5 T;  2DTH A;  4N4G A;  3T9N A;  5A0G A;  3H0I A;  4M77 G;  1TH7 A;  2CGH A;  2RF0 A;  2JM9 A;  3EGU A;  1SF9 A;  2C0O A;  1K0S A;  1IRE B;  3HP9 A;  3EFO A;  2VC8 A;  1AD5 A;  5GAN 5;  1YJN T;  1IHV A;  3C4S A;  4FM4 B;  4V2S A;  4XTY A;  4LUD A;  1XNI A;  2QK0 A;  4MDW A;  3CD6 A;  4C8Q G;  1ABQ A;  4Z89 A;  4FW1 A;  3CEY A;  2QI2 A;  1M8M A;  5I2S A;  4BD3 A;  5GAN 7;  1QQJ A;  4M78 G;  2SEM A;  5KE3 A;  2DVE A;  2QGF B;  1YHQ Q;  1U06 A;  2HSP A;  3G7Z A;  1VQ9 T;  2XU8 A;  3CCE A;  2GBQ A;  2YUQ A;  3OMC A;  5LJ5 j;  1TOV A;  4BDZ A;  2A7Y A;  5CR2 A;  1FWZ A;  2YUN A;  4GLM A;  4II1 A;  1YWO A;  1T3L A;  3CCR T;  2EAY A;  2IG0 A;  5KYY A;  3CCQ T;  1W6X A;  4D8D A;  3JCM d;  5D6W A;  1KSW A;  1MND A;  3MCA B;  4KGX B;  3RES A;  2E65 A;  1W4S A;  4JJB A;  2K6D A;  1HSQ A;  3CME T;  2BE7 D;  4J83 A;  3J80 E;  2DL3 A;  4RG8 A;  2RHX A;  3KFV A;  4XU2 A;  1ZHI A;  3RR6 A;  4Q5W A;  1ZBX A;  3CCM Q;  2DER A;  4HT9 A;  4ESR A;  2DXT A;  1PWT A;  2RQU A;  5I11 A;  1GFD A;  1CKA A;  3EFS A;  3CCU A;  5D6Y A;  2KDS A;  2KEA A;  2F2X A;  2NUP B;  3LGF A;  2M51 A;  5FU7 B;  1G3T A;  1VQL T;  3JB9 F;  3QUI A;  3JB9 I;  3FJ5 A;  2DA9 A;  3EG1 A;  1H3Z A;  3QJ6 A;  4FSS A;  4A4H A;  2FVU A;  1QWF A;  2LP5 A;  2DZC A;  3R6O A;  2RQV A;  3RIR A;  4IUR A;  3QII A;  4M7D A;  3ZBD A;  4KGV B;  5CAI A;  3CCL T;  1MNE A;  4CC4 B;  4JS5 A;  2DZ9 A;  2EJF A;  2F1L A;  3A8G B;  4DQ2 A;  3OYL A;  2E3H A;  2QAS A;  1VQ6 T;  2H3J A;  2VGM A;  5ECA A;  4E6R A;  4IUQ A;  1M9S A;  1QCN A;  2JXB A;  4M77 E;  2OAW A;  5CKH A;  1TSF A;  1QLY A;  1JBM A;  3E2U A;  3CD6 Q;  1K8A U;  1A0N B;  2LQW A;  2RI2 A;  1YIT A;  1NBE B;  1IHW A;  1WPY A;  1SPK A;  4JRP A;  2EW3 A;  2FB7 A;  4R56 A;  4EMK C;  2LZ6 B;  2EGE A;  5IHN A;  2HMA A;  4C8Q E;  1RUW A;  1XOV A;  4J6X A;  3C0C A;  3VV0 A;  4XQ3 A;  3CCE Q;  3EH1 A;  2L8D A;  4E7L A;  2PVG B;  1VYT A;  2HQH A;  4YTL A;  4M78 E;  4GLK A;  4L5G A;  3JB9 H;  4A54 A;  1WLP B;  3EG9 B;  2W0Z A;  4MZM A;  2NUP A;  1M1K U;  1GFC A;  3QWX X;  3P8D A;  4M77 C;  4XTX A;  4A4K A;  2K3Y A;  2O01 E;  1HYO A;  2KGT A;  5GAN d;  3RMQ A;  3G1J A;  1ZLM A;  1WQW A;  2M0O A;  1ZSG A;  1RAB B;  2CSI A;  1C6V X;  2GF7 A;  2LRQ A;  3A98 A;  1TUD A;  3QSU A;  2LX7 A;  3ULR B;  4BAC A;  2RQT A;  2RHU A;  4CRI A;  3FDR A;  1T0J A;  3CCU Q;  4X9D A;  3RMS A;  4C8Q C;  3UA7 A;  3M55 A;  2V8K A;  3QKJ A;  1K9M R;  4PJO A;  1Z9Q A;  5LJ3 f;  2JOY A;  2L89 A;  3MO8 A;  2P0K A;  2KY9 A;  2QYZ A;  1R0C B;  4M78 C;  3CPW A;  3RKX A;  4FYX B;  1K4U S;  2HQX A;  2W10 A;  2XD0 A;  4R0K A;  1WA7 A;  3LLR A;  1Q86 R;  3ME9 A;  1BI3 A;  1YNZ A;  2PVO B;  1OZ2 A;  2CS7 A;  4LD6 A;  4DEX A;  3LYI A;  1VQM A;  3RNJ A;  1T3S A;  2BZ8 A;  3M0S A;  1QCO A;  2LTO A;  2DBK A;  1SKU B;  3M58 A;  4A63 B;  1Q82 U;  3M4Y A;  2DO3 A;  2MCN A;  3U23 A;  3EG9 A;  4WF2 A;  1JO8 A;  3HL8 A;  4MMK A;  4LNP A;  2X4X A;  2J7I A;  1JJ2 S;  2FL7 A;  3A5Z B;  1ABO A;  4C0F A;  3X24 B;  1NE8 A;  3M59 A;  2ZPI B;  9ATC B;  1RAD B;  2D1X A;  2O31 A;  3NTH A;  1YIT Q;  4F7U F;  2FHD A;  2DYI A;  2MOX A;  2LJ1 A;  4C8Q F;  1ZBJ A;  4OMP A;  3OYH A;  1NYG A;  4DOV A;  4IUV A;  1O9S A;  2O88 A;  1KC8 R;  4M75 F;  2DF6 A;  3VYH B;  3X25 B;  3M57 A;  5GMK e;  4LDY A;  1OYX A;  1ZQ1 A;  1U1S A;  1Y57 A;  2KRN A;  2NUT A;  1OU9 A;  3MP8 A;  1KD1 R;  1UHF A;  3OYA A;  1JRI A;  1N6A A;  2ENM A;  4LN2 A;  1KK7 A;  4HCB A;  2XK0 A;  1VQO A;  2JTM A;  2EPD A;  2RQW A;  4JUV A;  4M4Z A;  2E5K A;  4EIK A;  5FU6 C;  1Q7Y R;  1PD0 A;  2BIV A;  1I8F A;  4IKF A;  1JXO A;  1S72 T;  2CRE A;  4N4I A;  4PLI A;  4J6Y A;  2K79 A;  4XU1 A;  5KYU A;  1HJD A;  1SRM A;  3RER A;  2EYY A;  5C6S A;  1YJ9 T;  1Y0M A;  3QZ5 B;  4EMG A;  1KQ2 A;  3S3N A;  2KYB A;  5CQX A;  5EC7 A;  3PT9 A;  4OB0 B;  2OI3 A;  2PUO B;  3G6E Q;  4PK4 A;  1NLP C;  2AIR B;  2K3B A;  2J6K A;  4LD9 K;  2MAM A;  4N0A A;  4C5E A;  1PHT A;  1YFN A;  3A8L B;  3CMA A;  3FB9 A;  3L2Q A;  5LJ5 f;  1Q81 C;  1KHI A;  4E7S A;  5FWB A;  4AFZ C;  5GAN j;  1YJW T;  2LQN A;  4ELY C;  2VYT A;  1JU5 C;  1X75 C;  4C92 G;  2K5F A;  2QEX A;  1VQM Q;  1G8X A;  2LJ3 A;  1VQK A;  4J9D A;  4L59 A;  1IB8 A;  4E7I A;  4HVU A;  2H3E B;  4F14 A;  1IXD A;  2EJ9 A;  2CH4 A;  1OV3 A;  5LJ3 g;  1E6H A;  4FYV B;  2V1Q A;  2GQV A;  1YN8 A;  2JS0 A;  1M3A A;  1M8V A;  4OMM A;  2LT1 A;  2DEU A;  2ZPB B;  1EFN A;  4E7H A;  1MHN A;  3JAM E;  4P5N A;  4ZGJ B;  4FT4 A;  3HFN A;  4CI0 C;  2O2O A;  3FLG A;  2ED1 A;  1F1B B;  2DIQ A;  4C5H A;  2E3I A;  2I2L A;  1U8R A;  4ZGE B;  1NM7 A;  5GAO r;  3TU4 K;  2DBM A;  4M7A D;  3ZFJ A;  5HKC A;  2KVQ G;  1BIB A;  1BCM A;  3CC2 T;  1JB0 E;  3NPF A;  4JJC A;  1KJW A;  4J9C A;  4NL3 A;  3JRZ A;  3OS5 A;  5CCA A;  5KCO A;  2C0T A;  1S1N A;  1PKS A;  3MP1 A;  3JV3 A;  2XDP A;  3LH5 A;  3OSS C;  3V7S A;  1ZSZ C;  2ABL A;  4HCK A;  4BY6 B;  2CH4 W;  3I56 T;  1D1C A;  1OX9 A;  2QQB A;  3L2W A;  2G3R A;  1VQO Q;  3VRY A;  4QQD A;  1WI7 A;  2QXF A;  2CUB A;  3H41 A;  3HTR A;  5CVI A;  3CCJ T;  3REB B;  4AT1 B;  1VIF A;  2DTO A;  1M90 R;  1EZZ B;  3DB3 A;  4KRT A;  1YCS B;  1SHF A;  3QWY A;  2D0N A;  1VQ5 A;  3UWN A;  4IIM A;  7AT1 B;  1I07 A;  3N5B B;  2JZ2 A;  1TWB A;  1WQ7 A;  2B8A A;  1SSF A;  1BK2 A;  1R8O B;  3EAE A;  3Q1J A;  4DBQ A;  3HFO A;  3M53 A;  4RCC A;  1YIJ T;  2MWO A;  1YJN A;  1TTH B;  2ZGW A;  2AKL A;  3EGX A;  1UEC A;  1TUC A;  2KNB B;  3GP8 A;  2CP5 A;  2MPX C;  2DRK A;  2QQS A;  3MEV A;  3CMA Q;  1RAE B;  3OMG A;  4M77 D;  4BI4 A;  4LXC A;  3V7C A;  5FRN A;  2E4H A;  1K76 A;  2RM4 A;  5DLO A;  3CPW P;  3V7R A;  1OEB A;  1UJ0 A;  1Y07 A;  1BI2 A;  1RAC B;  2EQM A;  2QEX Q;  3LWI A;  2KRO A;  1RI0 A;  1VQ9 A;  1VQK Q;  1AWW A;  4B6M A;  1G3S A;  1I81 A;  2F2V A;  4M7A G;  3EFO B;  1QVG A;  2DET A;  2COY A;  5IAY A;  1U1T A;  3O8V A;  4K11 A;  3CCR A;  3QXE B;  3CCQ A;  4E7K A;  4IUT A;  5J39 A;  1M2V B;  4M78 D;  5LJ5 g;  2E1H A;  5LJ3 e;  4XTU A;  1KQS A;  2L2P A;  2FPF A;  3X28 B;  3LW5 E;  2EYQ A;  3RUX A;  2P4R A;  4A53 A;  3DLM A;  5GAM h;  2CZ6 B;  2LCC A;  3JCM f;  2VUB A;  2L3P A;  1QVP A;  1HD3 A;  4PJN A;  5KYX A;  4KUD K;  2AZV A;  4C5G A;  4PNO A;  3OYG A;  2OTL T;  4J5Y A;  1KIK A;  4WTO B;  4B9X A;  2AK5 A;  3PMT A;  2QA4 T;  4J8O A;  4FSX A;  1WHK A;  3S6W A;  3OA6 A;  1C0M A;  2JMA A;  2KBT A;  2YHT A;  1KG1 A;  3L42 A;  2VB6 A;  4OMN A;  3VS7 A;  1YI2 T;  2V8J A;  5J3B A;  4J9B A;  3OYE A;  1VQ5 Q;  1Y96 B;  4RMO A;  3HRU A;  4F17 A;  1M30 A;  4RTX A;  4X34 A;  5IHI A;  5HK0 A;  2P0Q A;  1XTD A;  6AT1 B;  3FEO A;  4ZN3 A;  1G3W A;  2E70 A;  2RHZ A;  4E7J A;  3ASK A;  3A8H B;  2EWN A;  4AG2 C;  4J9I A;  1FMK A;  1QKX A;  3MP6 A;  2C06 A;  1N8R U;  4F7U B;  1M2V A;  2ZPF B;  3PE0 A;  2YLB A;  1UHC A;  4M75 B;  2R57 A;  1X69 A;  1BI1 A;  5GMK m;  1U3O A;  1LVK A;  2VWF A;  2PU9 B;  3GBQ A;  3H0H A;  2QGG A;  3JSC A;  3VUZ A;  4M7D B;  2FRY A;  1NG2 A;  1FMV A;  2DXB A;  1VQ9 Q;  3JCM b;  1W1F A;  1KQ1 A;  2QDY B;  3SWN C;  1Y7X A;  3CCQ Q;  2KXC A;  2EYX A;  3PFS A;  3GOX A;  3JCM J;  1NJI C;  4NL2 A;  1I0C A;  4M7A E;  5AYF A;  4JLG A;  2FPD A;  4MML A;  2AKK A;  5LJ5 e;  1RLP C;  1K8A C;  2BKD N;  1W2B S;  4OB3 B;  3M56 A;  3REA B;  2CP3 A;  4QVC A;  1Y96 A;  5IXF A;  4LE9 A;  1YCY A;  2VAS A;  4FYW B;  5KYW A;  1UGQ B;  2X3X D;  3CCS T;  2D9T A;  1WJR A;  1P92 A;  5GAN f;  2FEI A;  4OGE A;  2DJZ A;  1LCK A;  5C0M A;  3OYB A;  2ATC B;  1ZX6 A;  2FZC B;  4ZN1 A;  3OYJ A;  3CCM T;  4FIB A;  4JDS A;  4PFP A;  4F7U A;  2HNI A;  4EDU A;  1BCO A;  1QCF A;  1M1K C;  5GAO m;  1GBR A;  4C8Q A;  3S3O A;  2X35 A;  3JCM g;  4M75 A;  4M7A C;  2AZS A;  1X27 A;  4LDU A;  2LT4 A;  3UPU A;  4QKU A;  1PSE A;  2RK2 A;  3TCJ A;  5CKF A;  4XTZ A;  2CZ0 B;  4IUP A;  4RTT A;  2XG8 D;  1M5Q 1;  3CBM A;  3JCM V;  1NJI U;  4PJO B;  1D0Z A;  3V8L A;  1BI0 A;  2EQU A;  1LPL A;  2RA2 A;  2VKN A;  1RAF B;  3LH0 A;  1G2B A;  4AFS C;  1VQ7 A;  5IT9 E;  4DOW A;  1ZA1 B;  1YBY A;  3TQ7 P;  3EG0 A;  3C95 A;  3SHW A;  2J05 A;  1QKW A;  2LJ0 A;  2A3L A;  2MK5 A;  2QAZ A;  1OI1 A;  1X6B A;  4MDX A;  1WHG A;  2Y90 A;  3URG A;  2LMJ A;  4QQG A;  2A28 A;  2DM1 A;  5DLQ E;  3QZ9 B;  3J81 E;  2YRD A;  2BUD A;  2Y4Y A;  1VQN A;  2VV5 A;  2JTE A;  4M7A F;  3HPW A;  1QVG P;  1XJW B;  3P8H A;  1Q82 C;  3P8B B;  1UGR B;  2ZPG B;  3VUB A;  1H64 1;  1SG5 A;  2HCK A;  1S72 A;  1KQS P;  1AWJ A;  2OAU A;  1TS9 A;  4OF1 A;  3OYC A;  4J9E A;  2DXU A;  1QMC A;  4FL6 A;  2NUT B;  1X2K A;  4NS5 A;  1GRI A;  1H8K A;  4BDY A;  2OX7 A;  2DMO A;  4ATO A;  3M0P A;  2A37 A;  3A8M B;  2Z0W A;  1OUL A;  1OQK A;  4OML A;  3L1A A;  5HK3 A;  2DNU A;  3G71 T;  3QYH B;  2R5A A;  1RI9 A;  2ZZD A;  3UA6 A;  3CCU T;  3BW1 A;  5KYU B;  1YJW A;  3PIO A;  4RTV A;  3VS2 A;  1QVF A;  1EIF A;  3HSB A;  3JCM e;  4RTZ A;  1D09 B;  3OYN A;  2K5L A;  5GAN g;  1K73 C;  3M0U A;  4M77 F;  5HCK A;  3CBP A;  4J9H A;  2XMF A;  4OGC A;  3OYM A;  2JNG A;  2EKO A;  2V8I A;  1MMA A;  1Q81 R;  4CC3 A;  1BBZ A;  3FC3 A;  3EFR A;  5IN1 A;  1JJ2 P;  1VQ7 Q;  2WAC A;  4FYY B;  1RAI B;  4C92 D;  3JB9 J;  2ECZ A;  2OTJ A;  1WFW A;  4XTW A;  2DX1 A;  2KYM A;  3ER0 A;  2FG0 A;  2B86 A;  3CC2 A;  2IIM A;  1GL5 A;  3VJP A;  1QWE A;  3EG3 A;  1HXD A;  4M78 F;  1B7T A;  4TVR A;  3V8K A;  2HAX A;  2VGN A;  2EGA A;  4OVA A;  2XI9 A;  2LVM A;  1VQN Q;  2F2W A;  3O5Z A;  4J7I A;  5GAM d;  1UJY A;  3QPH A;  3CC4 T;  3QJY A;  4DBH A;  2CT3 A;  1CSK A;  2K9G A;  1ACM B;  1RAA B;  4CC2 A;  3UDC A;  1WZO A;  3A8O B;  3G4S A;  3CCJ A;  2VXF A;  5FU7 C;  2E41 A;  3DKM A;  3RKY A;  1S72 Q;  1IRX A;  2EQK A;  2V1R A;  2J6O A;  2NYS A;  1MMN A;  4WCI A;  1K73 U;  5A0D A;  2XHC A;  1RAG B;  5FW9 A;  2EVR A;  1J3T A;  1E7O A;  1BIA A;  1M4Z A;  2WSE E;  4X1V A;  3MJX A;  3H6Z A;  2FYK A;  2DIG A;  3RBB B;  1G5V A;  4C0D B;  2K2M A;  3OYY A;  4BE0 A;  5FLX E;  5GAO l;  1UG1 A;  4A4F A;  5GMK h;  3HHT B;  1AWO A;  2P0P A;  4BI3 A;  1UGS B;  1T0H A;  3TVT A; 
#chains in the Genus database with same CATH homology
 2GFU A;  1KQS S;  4M7A G;  3MCA B;  1VQ8 T;  1QVG A;  3MEA A;  5IAY A;  3G6E T;  1U1T A;  3RES A;  4PKC C;  2E65 A;  1W4S A;  4Y28 E;  3O8V A;  3CCR A;  1UGP B;  4KT0 E;  5GAO n;  1NJI U;  2LX9 A;  3QXE B;  3CCQ A;  3CME T;  4E7K A;  4IUT A;  4J83 A;  3J80 E;  1X6O A;  4RG8 A;  2RHX A;  3QO3 A;  4RG2 A;  5GAN 8;  5J39 A;  4M78 D;  4XU2 A;  2E1H A;  5LJ5 g;  5LJ3 e;  1VQ8 A;  4V2S A;  3VU3 C;  3G6E A;  1ZHI A;  4RCB A;  4Q5W A;  4XTU A;  1KQS A;  1ZBX A;  2LDM A;  4HT9 A;  3GNG A;  2DXT A;  3X28 B;  4M75 C;  5GAN e;  3LW5 E;  2EYQ A;  3QBY A;  3RUX A;  2MWP A;  4A53 A;  2D6F A;  2EFI A;  4KUL A;  3OW2 A;  3DLM A;  3EFS A;  1NPP A;  5GAM h;  2CZ6 B;  2LCC A;  3CCU A;  3JCM f;  5D6Y A;  2KDS A;  2VUB A;  4M7D C;  5DM7 R;  2DKG A;  2RH2 A;  3FJP A;  1QVP A;  4KUD K;  3LGF A;  4C5G A;  2K2V A;  4PNO A;  3OYG A;  5FU7 B;  3CCV A;  2ZPE B;  1G3T A;  2OTL T;  1VQL T;  5I2M A;  3JB9 F;  3QUI A;  3JB9 I;  4J5Y A;  5KE2 A;  4B9X A;  2DEQ A;  2DPP B;  2MI6 A;  1K9M U;  2CZ1 B;  3PMT A;  3LWH A;  2QA4 T;  4J8O A;  4D6W A;  4FSX A;  3S6W A;  2K5I A;  1H3Z A;  3OA6 A;  3QJ6 A;  5GMK l;  1KG1 A;  4A4H A;  2YHT A;  3L42 A;  5KH6 A;  4KUI A;  2FVU A;  5FRO A;  2OTL A;  2DZC A;  3R6O A;  4OB1 B;  2K57 A;  4IUR A;  3RIR A;  1YI2 T;  1B34 A;  3QII A;  3CCJ T;  1VQP T;  2F69 A;  2V8J A;  3V8J A;  3PGG A;  5J3B A;  2KAF A;  4M7D A;  3ZBD A;  2QA4 A;  3OYE A;  2DD4 A;  2KSS A;  5CAI A;  3CCL T;  1Q86 U;  2R58 A;  5GMK j;  4JS5 A;  2DZ9 A;  1Y96 B;  2EJF A;  5A2Q E;  2YLC A;  3A8G B;  1M1F A;  4DQ2 A;  4ZTJ A;  3OYL A;  1VQ7 T;  4RMO A;  1VQ6 T;  2WSF E;  5LL6 S;  2H3J A;  4PJO E;  3HRU A;  2VGM A;  1YI2 A;  3MEW A;  5FRM A;  4IUQ A;  1M9S A;  1VQP A;  5D6X A;  1YIT T;  1OZ3 A;  4X34 A;  4M77 E;  5CKH A;  3BFM A;  2XDB A;  5HK0 A;  2P0Q A;  1XTD A;  3OY9 A;  3M5A A;  3I56 A;  2ZCF B;  1JBM A;  3JB9 G;  3FEO A;  4ZN3 A;  1G3W A;  2E70 A;  5A0L A;  1K8A U;  2RHZ A;  2RJD A;  2QQ9 A;  4MZP A;  4E7J A;  1G3Y A;  2RI2 A;  3ASK A;  3JCM h;  3A8H B;  4HT8 A;  1YIT A;  2HQE A;  1WPY A;  2EWN A;  2XKO C;  4JRP A;  1DJ7 B;  1VQO T;  1KHC A;  1LJO A;  3MP6 A;  2C06 A;  4EPC A;  3GIB A;  4N4H A;  4M7D F;  1N8R U;  2FB7 A;  4F7U B;  4R56 A;  1WGS A;  2GCX A;  4EMK C;  1VQN T;  5DY9 A;  2RD1 A;  4JJN K;  1LOJ A;  3CXC S;  4C8Q E;  3X20 B;  2MF2 A;  1XOV A;  5GAM j;  2ZPF B;  4J6X A;  3VV0 A;  3JCM c;  4XQ3 A;  2YLB A;  4M75 B;  2R57 A;  2L8D A;  1VIE A;  4E7L A;  2PVG B;  1BI1 A;  2DK3 A;  2PUK B;  4NOY A;  1IZ6 A;  5GMK m;  1K9M C;  4KBM B;  4M78 E;  4YTL A;  4GLK A;  4JRI A;  4L5G A;  5KCH A;  1YIJ A;  3CC7 T;  2GFA A;  2PU9 B;  4Z02 A;  4XK8 E;  3JB9 H;  3JSC A;  4A54 A;  3VUZ A;  4M7D B;  4C0G A;  1WJS A;  2RK1 A;  5CKE A;  4HCC A;  2DXB A;  4N0A C;  4MZM A;  3JCM b;  1M1K U;  3I55 T;  1KQ1 A;  2QDY B;  3SWN C;  3JB9 D;  3P8D A;  4PJO C;  2E10 A;  1FX7 A;  5GAO p;  4C0Z A;  3CC7 A;  2JN0 A;  5LJ3 d;  1Y7X A;  4J7F A;  4M77 C;  2RHY A;  1Q86 C;  4XTX A;  4A4K A;  2K3Y A;  2CKK A;  3FRN A;  3PFS A;  5L8R E;  5GAM g;  3GOX A;  2O01 E;  3JCM J;  1NJI C;  4BE1 A;  4NL2 A;  3JCM W;  2JTF A;  1QP2 A;  3RMQ A;  5GAN d;  3I55 A;  2PVD B;  2RHI A;  4M7A E;  5AYF A;  1WQW A;  2CYZ B;  2M0O A;  3L2R A;  2GF7 A;  2LRQ A;  2NLU A;  4JLG A;  4MML A;  4C5I A;  2AHJ B;  3CBO A;  3QSU A;  1GXI E;  5LJ5 e;  1BKB A;  1I81 A;  3OW2 S;  1XQH A;  4C92 B;  2BKD N;  4BAC A;  1W2B S;  4OB3 B;  4C92 E;  1K8A C;  3M56 A;  2RHU A;  1NPR A;  4CRI A;  4QVC A;  3FDR A;  1Y71 A;  4X9D A;  4HKE A;  3RMS A;  1Y96 A;  3OBY A;  4C8Q C;  1WNL A;  3M55 A;  4MZT A;  2V8K A;  3QKJ A;  4JLI A;  4LDW A;  3SWN A;  2O4X B;  3HKS A;  4PJO A;  1YCY A;  4FT2 A;  1RL2 A;  4EMH A;  3CME A;  2HBP A;  3SB2 A;  5LJ3 f;  1N8R C;  1UGQ B;  2JOY A;  3BDL A;  1UEB A;  2L89 A;  3MO8 A;  2X4Y A;  2P0K A;  3MEU A;  3CCS T;  2KY9 A;  4M78 C;  3CPW A;  2D9T A;  1WJR A;  3RKX A;  5J26 A;  1P92 A;  1W2B A;  2RJF A;  5CIU A;  2QQR A;  5GAN f;  4OGE A;  2DJZ A;  1VQM T;  4A4E A;  1N9S A;  2HQX A;  4GY5 A;  5C0M A;  5CK9 A;  3OYB A;  2XD0 A;  3SD4 A;  2RJC A;  1PSF A;  2D0Q B;  4ZTF A;  3LLR A;  4BB7 A;  3ME9 A;  1BI3 A;  2XDD A;  3CCS A;  1KC8 C;  3OB9 A;  3ZEH A;  4ZN1 A;  2PVO B;  1OZ2 A;  2CS7 A;  3MET A;  3OYJ A;  2IVW A;  4FIB A;  4JDS A;  4LD6 A;  2JVV A;  3CCM T;  4F7U A;  2HNI A;  3MHX A;  3C12 A;  4EMK B;  4EDU A;  3LYI A;  3KUF A;  1VQM A;  1M1K C;  5GAO m;  4UC4 A;  4C8Q A;  3S3O A;  2X35 A;  5M9O A;  2LTO A;  2F5K A;  2L3R A;  3JCM g;  4M75 A;  4PJO F;  2XIC A;  3AHU A;  4M7A C;  2HD0 A;  1KD1 C;  3E9F A;  1VQL A;  1NZ9 A;  4LDU A;  2LT4 A;  3BDU A;  3UPU A;  3M58 A;  3QHS A;  1VQ4 T;  4OB2 B;  1HK9 A;  1PSE A;  3M4Y A;  2DO3 A;  2RK2 A;  4VUB A;  1Q82 U;  4C92 C;  3TCJ A;  2OTJ T;  5CKF A;  4WF2 A;  4XTZ A;  2CZ0 B;  3HL8 A;  4IUP A;  4MMK A;  2E64 A;  2RI5 A;  1Q7Y C;  2XG8 D;  1M5Q 1;  3CBM A;  2X4X A;  3JCM V;  1JJ2 S;  1VQ6 A;  2FL7 A;  3A5Z B;  3UT1 A;  3OBW A;  4LDV A;  3SWN B;  4BI8 B;  3X24 B;  4C0F A;  1NE8 A;  2JUF A;  4R55 A;  4PJO B;  3V8L A;  3M59 A;  2ZPI B;  1VQ4 A;  1BI0 A;  3JCM Q;  2EQU A;  3NTH A;  4M77 B;  4F7U F;  2QQA A;  2FHD A;  4O6J A;  2RA2 A;  2EQJ A;  5LJ3 h;  3LH0 A;  2LC4 A;  3CCL A;  4C8Q F;  2E6Z A;  3OYH A;  4DOV A;  4IUV A;  1O9S A;  4M7A A;  1VQ7 A;  4PL6 A;  4M75 F;  1QP3 A;  3E1S A;  4HA8 A;  5GAN h;  3VYH B;  4FU6 A;  3X25 B;  1UB4 A;  3M57 A;  5GMK e;  4DOW A;  5GAN 4;  2M9U A;  4LDY A;  1JJ2 A;  1Q81 U;  3TEE A;  2RJE A;  3VYG A;  3TRE A;  4C92 A;  1OYX A;  1ZQ1 A;  1VUB A;  3NTI A;  1YBY A;  3M54 A;  1U1S A;  3G4S T;  4IUU A;  2LQK A;  3MP8 A;  3C95 A;  4C8Q B;  2A3L A;  4JRK A;  3L2V A;  4XTV A;  1OI1 A;  3OYA A;  1JRI A;  4ME7 A;  1N6A A;  2O4X A;  2Y90 A;  3OYD A;  3URG A;  4MDX A;  4QQG A;  2DAQ A;  3JCM X;  4BE2 A;  4HCB A;  3GPL A;  2XK0 A;  2K4Y A;  1VQO A;  3INZ A;  3LX7 A;  2JTM A;  3J7A F;  4ZGD B;  5DLQ E;  4JUV A;  3QZ9 B;  4M78 B;  3J81 E;  5GAO q;  3PTA A;  5FU6 C;  5CQY A;  2DTI A;  2BUD A;  2Y4Y A;  1KC8 U;  1VQN A;  2BIV A;  2VV5 A;  3VKI A;  1I8F A;  1O75 A;  4IKF A;  4M7A F;  4F7U G;  1S72 T;  3HPW A;  2K3X A;  4N4I A;  5LJ5 d;  3GF5 A;  4J6Y A;  4PLI A;  3OYK A;  4XU1 A;  3P8H A;  2YRV A;  3OYI A;  1Q82 C;  5GAM e;  3P8B B;  3NFC A;  4E47 A;  1UGR B;  1QW1 A;  4C92 F;  3RER A;  4M75 G;  3CPF A;  2X4W A;  5C6S A;  1YJ9 T;  2WSC E;  1KD1 U;  3QZ5 B;  2ZPG B;  3VUB A;  4EMK A;  1M90 U;  1H64 1;  3E9G A;  4EMG A;  1KQ2 A;  2QTX A;  3S3N A;  3OSV A;  2LQ8 A;  5GMK i;  2EJG A;  2E12 A;  5CQX A;  1S72 A;  3RKW A;  3PT9 A;  1FXX A;  4OB0 B;  4PJO D;  3CMA T;  1YHQ T;  4M7D G;  4M7A B;  4BY6 C;  2PUO B;  3KBG A;  1Q7Y U;  3WVD B;  2OAU A;  3PIP A;  2LCL A;  3PNW C;  2Y4X A;  4OF1 A;  4LDX A;  3CPW S;  3OYC A;  2DXU A;  2F5T X;  3C94 A;  3SFM A;  4LD9 K;  2MAM A;  4N0A A;  3X26 B;  3QYG B;  4C5E A;  4OVA A;  4FL6 A;  1D3B B;  3A8L B;  3CMA A;  1YHQ A;  3FB9 A;  3L2Q A;  4Y91 A;  5LJ3 j;  4NS5 A;  5LJ5 f;  3OS1 A;  3OYF A;  2DXC A;  2RO0 A;  2QEX T;  4BDY A;  1Q81 C;  5GAN 3;  1VQK T;  4ATO A;  1I4K 1;  1KHI A;  3A8M B;  3GNF B;  2P4T A;  3L2Z A;  3S3M A;  4M77 A;  1QVF S;  5GAN j;  4ELZ C;  3LGL A;  1YJW T;  3L1A A;  3H8Z A;  5HK3 A;  4ELY C;  3HRS A;  2VYT A;  4C8Q D;  3G71 T;  1X75 C;  3QYH B;  5CKD A;  5IT9 E;  4C92 G;  3PMI A;  3QDR B;  2K5F A;  2QEX A;  3DLL A;  3FIF A;  4M75 D;  4XU0 A;  3OQ5 A;  1VQK A;  2R5A A;  2RB6 A;  4L59 A;  2ZZD A;  4E7I A;  3OYM A;  3CCU T;  3BW1 A;  1N9R A;  3PIO A;  1YJW A;  2LNV A;  4M7D D;  2EJ9 A;  4HCZ A;  5CO7 A;  1EIF A;  2E5Q A;  1QVF A;  5LJ3 g;  3HSB A;  3G71 A;  2PQW A;  3WVE B;  3JCM e;  3KXT A;  3SDZ A;  3CCV T;  2GQV A;  3OYN A;  4O5V A;  1M8V A;  2K5L A;  2LT1 A;  2KQW A;  2MMP A;  2ZPB B;  5GAN g;  1WJQ A;  4QQ6 A;  2KK4 A;  5I21 A;  1K73 C;  4PLL A;  4E7H A;  1MHN A;  3JAM E;  4P5N A;  4ZGJ B;  4FT4 A;  1M90 C;  4M77 F;  3HFN A;  4M78 A;  4CI0 C;  3CCM A;  3CBP A;  5FU6 B;  5GAN 6;  4OGC A;  2KMT A;  3FLG A;  1MGQ A;  2DIQ A;  2EKO A;  2JNG A;  2I2L A;  3WXM B;  4A4G A;  4C5H A;  4ZGE B;  3L2U A;  2V8I A;  3TU4 K;  5GAO r;  4C0D C;  3HRT A;  4M7A D;  3ZFJ A;  5HKC A;  2KVQ G;  1N27 A;  2CZ7 B;  3FC3 A;  1BIB A;  3EFR A;  3CC2 T;  4JS4 A;  1JB0 E;  5IN1 A;  4QVZ A;  2L5Q A;  4NL3 A;  3JRZ A;  2RI3 A;  2WAC A;  4BUG A;  3OS5 A;  5LJ5 h;  5CCA A;  4C92 D;  5KCO A;  3JCM P;  3F70 A;  3JB9 J;  4QVD A;  3OS2 A;  4B9W A;  3E19 A;  2E6N A;  2OTJ A;  2EIF A;  2VXE A;  4XTW A;  3MP1 A;  2XDP A;  3OSS C;  1U8R A;  3BY7 A;  3ER0 A;  3V7S A;  1BYM A;  3CC2 A;  2XID A;  4BY6 B;  3OS0 A;  3VJP A;  3I56 T;  2X4J A;  1HXD A;  1V29 B;  4JRQ A;  2QQB A;  4M78 F;  4XU3 A;  3L2W A;  5HY6 A;  4DA4 A;  1LNX A;  2G3R A;  1VQ5 T;  2DTH A;  4N4G A;  3NTK A;  4QQD A;  4TVR A;  4PJO G;  2QXF A;  3V8K A;  4OP0 A;  3GLX A;  3T9N A;  2HAX A;  5A0G A;  2VGN A;  4M77 G;  2XI9 A;  1M1G A;  1TH7 A;  1X01 A;  1D3B A;  2CGH A;  2LVM A;  3QG1 A;  1VIF A;  2DTO A;  4J7I A;  5CVI A;  5GAM d;  3QPH A;  3CC4 T;  3QJY A;  3DB3 A;  1IRE B;  3HP9 A;  1I5L A;  3CD6 T;  1VQ5 A;  2M1H A;  2VC8 A;  3UWN A;  2M16 A;  5GAN 5;  3UDC A;  1YJN T;  3N5B B;  4QW2 A;  2R5M A;  2JZ2 A;  3A8O B;  3G4S A;  3C4S A;  3CCJ A;  2DD5 A;  4FM4 B;  1WQ7 A;  2B8A A;  2VXF A;  4XTY A;  1SSF A;  2E41 A;  3DKM A;  5FU7 C;  3RKY A;  1XNI A;  3CC4 A;  1R8O B;  3EAE A;  3Q1J A;  3HFO A;  3M53 A;  4L6V 5;  2EQK A;  4MDW A;  4RCC A;  1YIJ T;  4F7U E;  3CD6 A;  4C8Q G;  3M4G A;  2MWO A;  5GAN 2;  1YJN A;  2ZGW A;  3CEY A;  2QI2 A;  1K73 U;  5A0D A;  3CCE T;  2XHC A;  4M75 E;  4BD3 A;  5I2S A;  4X9C A;  5GAN 7;  1AHJ B;  4XAX B;  4M78 G;  5KE3 A;  3GP8 A;  1BIA A;  5GAM f;  2ZPH B;  2QQS A;  3MEV A;  1B34 B;  2DVE A;  1M4Z A;  2WSE E;  4M7D E;  3OMG A;  4M77 D;  4BI4 A;  3G7Z A;  3H6Z A;  4OMF B;  1VQ9 T;  1QVG S;  3V7C A;  5FRN A;  3CXC A;  2XU8 A;  1YJ9 A;  2FYK A;  3CCE A;  2RM4 A;  2DIG A;  5DLO A;  3V7R A;  3OMC A;  5LJ5 j;  4BDZ A;  1G5V A;  2A7Y A;  3M9Q A;  1FWZ A;  5EG2 A;  4C0D B;  5CR2 A;  3OYY A;  4II1 A;  1Y07 A;  4RKU E;  3CCR T;  4BE0 A;  5FLX E;  2EAY A;  2IG0 A;  3DB4 A;  5GAO l;  5CKB A;  3CCQ T;  4A4F A;  1BI2 A;  2EQM A;  5GMK h;  3HHT B;  3LWI A;  2P0P A;  4BI3 A;  1RI0 A;  1UGS B;  1VQ9 A;  4J6W A;  3JCM d;  5D6W A;  1G3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...