2XK0A

Solution structure of the tudor domain from drosophila polycomblike (pcl)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYCOMB PROTEIN PCL
publication title Structure of an Atypical Tudor Domain in the Drosophila Polycomblike Protein
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xk0A00
2RHUA 2BKDN 2LTOA 4E7LA 3MP8A 4A4HA 2R5AA 5D6WA 4C5GA 2O4XA 3LYIA 3PMIA 3FDRA 3CEYA 1WJSA 2LVMA 3MEUA 2R5MA 4IUTA 2BIVA 3OYIA 4BE2A 2P0KA 3OYMA 4BE0A 2JZ2A 1OZ3A 2RHIA 4N4GA 3KUFA 3UT1A 3NTKA 2EKOA 2RI3A 3MEVA 3S3OA 3OYFA 4PL6A 4A4GA 2VYTA 2L89A 3OB9A 4N4HA 3PFSA 3OYCA 3MEWA 3OQ5A 4QVZA 5J39A 3GOXA 3P8HA 4A4EA 3META 2QQSA 3OYAA 2HQEA 5IAYA 4E7KA 4X34A 2GFAA 2D9TA 5FRNA 5KCHA 3OYLA 4EDUA 3H6ZA 2X4XA 3Q1JA 3OMGA 1OYXA 4IURA 4A4FA 3M9QA 4BD3A 4QQGA 3LX7A 4IUQA 2EQMA 2M0OA 2RJEA 1N27A 3DLMA 3ZEHA 4FL6A 3QBYA 2DIQA 3OYHA 3OY9A 3OS0A 2EQKA 2GF7A 5C6SA 3P8DA 3OYDA 2IG0A 4BDYA 4RG2A 2DIGA 2RO0A 1XNIA 1SSFA 3BDLA 3DB4A 2K3XA 3QJ6A 2PQWA 2EQUA 2WACA 2G3RA 3MEAA 4QQDA 4II1A 4PLLA 3O8VA 1MHNA 3SD4A 3OYEA 3LGFA 5M9OA 2M1HA 5D6XA 3S3NA 3LGLA 3C4SA 2O4XB 2RHXA 1OZ2A 4B9XA 4C5HA 5KE3A 2E6NA 3OS2A 2JTFA 2RJFA 2RJCA 2X35A 5IN1A 2NLUA 4IUUA 3ME9A 3E9FA 3PMTA 4B9WA 4GY5A 5FROA 1WJRA 2K3YA 4C5EA 3ASKA 1OI1A 2QQRA 3MP6A 4HCZA 3L2QA 2GFUA 2MWOA 4QW2A 1WGSA 1WJQA 2L3RA 3FEOA 4Z02A 3L2VA 4BDZA 5CIUA 4BE1A 4FU6A 4IKFA 3OS1A 3S3MA 2L8DA 1G5VA 2R57A 5J26A 2RJDA 2LRQA 2RHZA 3L42A 3UWNA 3OYBA 2CKKA 5D6YA 3QKJA 5FRMA 2R58A 3EAEA 4L59A 2B8AA 3L2WA 2HQXA 2FHDA 2XK0A 3NTIA 4NS5A 3OYKA 3OYJA 4Q5WA 2E5QA 3QIIA 3S6WA 3OYNA 4ZTJA 1H3ZA 2X4WA 2M16A 4E7HA 4E7IA 3OYGA 2MWPA 3MP1A 2EQJA 4LD6A 2RI2A 2X4YA 3L2RA 3L2UA 3OMCA 3PNWC 3E9GA 3H8ZA 5C0MA 3FC3A 3LLRA 2XDPA 1KHCA 3DB3A 4ZTFA 4PLIA 4C5IA 3NTHA 5KH6A 3F70A 2RHYA 2RI5A 4BACA 4IUVA 3LH0A 4N4IA 3FLGA 2DAQA 2YRVA 2F5KA 4IUPA 4UC4A 1RI0A 2BUDA 4E7JA 2LCCA 4QQ6A 5KCOA 3MO8A 4OVAA 5KE2A 3OA6A 2LDMA 4CRIA 2EFIA
chains in the Genus database with same CATH superfamily
4LDYA 2BKDN 3RKWA 5D6WA 2YXYA 2QASA 2LVMA 2R5MA 2JJ9A 5LJ3j 3JSCA 1MMDA 2V1QA 1SPKA 1KD1R 1FXXA 3VS1A 1YJ9A 2PNIA 2K6DA 4JRIA 1V76A 5GMKe 3OYAA 4HA8A 3PTAA 2LNVA 3PIOA 4M7DE 2COZA 2MI6A 4OMNA 2HSEB 1OYXA 1I8FA 4A4FA 2KEAA 3SWNB 2HNIA 4QQGA 1QKWA 2DL4A 1U8RA 3GP8A 1WHGA 1IRXA 5CKHA 2CYZB 4O5VA 4RG2A 2DVEA 2K3XA 1G3SA 2VGNA 4J5YA 2EQUA 4ANJA 4XU1A 1MHNA 2K57A 3OYEA 3CC2A 2ED1A 1OU9A 2QAZA 3C4SA 1QVFP 3INZA 4FYWB 1KD1U 4M78C 3ZL7C 2RF0A 2JTEA 3EG3A 4MDWA 4FYVB 2FRYA 3I56T 2OTJT 4A4KA 1NEBA 4E7KA 2D8JA 3QPHA 3CCUT 1WGSA 1WJQA 2OJ2A 2D0NA 1AOJA 1ZLMA 2CH4W 2F69A 3OS1A 4JS4A 1FYNA 1LOJA 2CKKA 1TU0B 4AFSC 3NTIA 3BY7A 3QIIA 2LQ8A 1G3YA 3E9GA 3LLRA 2DX1A 2SEMA 3DB3A 5GAN2 4PKCC 2PZ1A 1N9RA 3D7SB 3ZFJA 3C94A 3M56A 2JW4A 2FZGB 1BI0A 5KE2A 4M75C 4HCBA 1Q81U 1XJWB 4Y92A 2HCKA 3HFNA 2CS7A 2DRMA 1HYOA 1Z9ZA 2R5AA 4C5GA 2FPEA 1QKXA 4BY6B 1YJNQ 3CMAQ 4ZNXA 3I5SA 5DY9A 2AHJB 1TG0A 1R77A 2L89A 3JCMJ 4N4HA 1NPPA 2JOYA 1D3BB 5J39A 1BCMA 1GXIE 3CC4Q 1N8RR 5FRNA 3NGPA 3CCVQ 2X4XA 2XD0A 1M3CA 4J9FA 4PJOB 2FPDA 4RKUE 5CQYA 5FU7C 1QVGS 3ZEHA 3QBYA 2XDDA 5LJ3e 2FYKA 2KT8A 2CZ1B 1PNJA 3VYHB 1JJ2P 4KGVB 4OB1B 3NFCA 1YNZA 4J9IA 5AT1B 4KRTA 1UFFA 1YI2T 2L3PA 1M1FA 1PM3A 5KYXA 4X9DA 2RHXA 4EPCA 4HKEA 1SSHA 1PKSA 2L0AA 4DOWA 5KYNA 5GANd 4C5EA 3L2QA 5GAMg 2C0IA 1N8RU 3CCEQ 3CMET 2XDBA 2VASA 5J26A 2ZPIB 2HBWA 1TOVA 1K76A 1ZUUA 2XK0A 3OYJA 1OV3A 4EMHA 1WDXA 3L2RA 5LJ5j 1TTHB 3H8ZA 1Y7XA 3NTHA 2AKKA 5GAMd 4OMFB 3LWHA 1IHWA 1D1BA 4PFZA 1KHIA 2KBTA 3CQTA 2HKNA 2RD1A 4RTVA 2QTVA 2VXFA 1C6VX 3MO8A 2ATCB 4C92C 1K4US 2A37A 2DXBA 2RHUA 1FMVA 1W2BP 4A4HA 1ZHIA 1YHQA 1A0NB 4OMQA 2JZ2A 3MKDA 5CK9A 2J6OA 3VU3C 2LMJA 3V8LA 2MCNA 3PFSA 3RNJA 3FJ5A 3TSZA 3CD6T 2DETA 4J9GA 2KYMA 1NZ9A 1QWFA 2CREA 4EDUA 2RQUA 4FCYA 2L3SA 1TWBA 3JCMd 2I0NA 3CBOA 3RMSA 2NUTA 4OMMA 2XKOC 2EQKA 3P8DA 2LT4A 1R0CB 3GPLA 4M7AE 1VYVA 2OI3A 3U23A 3J81E 4CC4B 2QDLA 1I4K1 4DBRA 2VXEA 2RJCA 3QO3A 1H641 1KFZA 4B9WA 3CC7T 3CC4A 3M4GA 1X27A 1AWJA 1ZUYA 4LDVA 3G4SQ 4FIBA 3CCST 2GQVA 1EZZB 4BE1A 1WA7A 5GAOm 5DLQE 2CT4A 2NWMA 1B34A 2O9VA 1WQWA 1UTIA 2ABLA 2DFUA 2E5QA 4J9CA 1TH7A 2Z0WA 2EVRA 4F7UA 4ORZA 2A08A 1U1SA 4J9DA 5GAOn 1VQOT 2H3EB 2RI5A 3OYYA 3GIBA 3M0TA 3DLLA 1VQMT 4DBQA 2DILA 1VQKA 5GAN5 2VWFA 5KYXB 3CCEA 3QYHB 3NPFA 2CZ7B 4M78E 5GANh 1VOMA 3MEUA 3EG1A 4Z89A 2JUFA 1IGUA 2V8JA 5LJ5e 1Y96A 2CDTA 1W1FA 4XTVA 4M77C 2MPXC 3OQ5A 1WI7A 1U06A 5KYYA 1VQNT 4PJJA 2M0YA 4HVVA 1Q95G 4OGEA 3G6EA 5GAMh 4ATOA 1EIFA 2M0OA 4PJMA 1RACB 4C0FA 1O75A 1HD3A 1XNIA 2LX9A 4M75E 3VS6A 4C92D 3EFOA 3QYGB 1D1CA 2FEIA 3OS2A 1MMGA 3PIPA 2HL5C 2A3LA 1KQ2A 5IN1A 3SB2A 4XTUA 2DD4A 3CPFA 3QDRB 3TU4K 2QGGA 1OI1A 1GCQA 3FB9A 1YITT 1VQ5A 4YTLA 3LH5A 5CCAA 5IXBA 1VQ9T 2HKQB 3L42A 3OBWA 5GMKm 3CCRT 3I56Q 2QA4A 2OTJQ 1AD5A 3CCUQ 2E64A 2HQXA 3JCMh 3OYKA 3M58A 1TUGB 3CPWS 4ZTJA 3CPWP 3VS2A 3PVLA 2LQWA 1NM7A 1YIJT 3CBMA 1YBYA 3G71T 2NUTB 4L6V5 2EYZA 1DJ7B 3F70A 2RB6A 2LT1A 3A5ZB 2DAQA 1Y57A 1IB8A 2LCCA 3BE3A 4OVAA 3AT1B 2X9HA 1FX7A 3G7ZA 4N0AC 2YSQA 1AEYA 3X25B 3OS5A 2QDYB 4C92F 1UJYA 2CUDA 1SG5A 1YCYA 2EPDA 5CO7A 3OYIA 1U1TA 2DXUA 8ATCB 1AZGB 3KUFA 4MZMA 3GNFB 1UGSB 3H0FA 2RI3A 3MEVA 4KH0B 2XI9A 3X24B 2VYTA 3JCMX 1T3LA 5GAN3 2Y4XA 2QEXT 2I2LA 2Y4YA 3RUXA 1B34B 2DPPB 4PJOD 1LVKA 2FRWA 3T9NA 4C8QA 2QTXA 3H41A 3RMQA 1HXDA 4F7UB 4XTXA 4C0DC 2QGFB 2FPFA 3P8BB 3JCMc 4KGXB 4RCCA 5IHKA 1AWOA 1GBQA 5GAOp 1V29B 2PUKB 5DM7R 4RTXA 3OSVA 3BDUA 3QSUA 2PTKA 1E6HA 1KC8R 2KROA 4DA4A 4MZTA 3J7AF 2J06A 2KRSA 5KE3A 2X4JA 3ME9A 4KH1B 2CZ0B 4MZPA 1WNLA 1YI2Q 3I9QA 3CCJA 1Y96B 3CCLA 2QQRA 2GFUA 2ZPGB 3QWXX 1VYTA 2KGTA 3VS3A 2X3WD 4M77D 2YRDA 5KYYB 1WXUA 2LJ3A 3OYBA 4EMKC 1RL2A 4PJOF 3CMEQ 3TCJA 4AFQC 5I2MA 2M02A 1VQ6T 2BE7D 3M5AA 5A0DA 2RHYA 1RI0A 3M57A 5I21A 1VQ8T 2DXTA 2KE9A 1PD0A 3EFOB 5KCOA 3L1AA 1TS9A 1TUDA 2QI2A 2D1XA 3SEMA 4C92G 1GCPA 2KR3A 2ENMA 3FDRA 3I56A 2RN8A 2OTJA 2OTLT 4M4ZA 3CCUA 1OZ3A 2L5QA 2X51A 2K4YA 3JB9J 3VS7A 1F1BB 4WCIA 3MEWA 3VS4A 1KIKA 1AT1B 2E6ZA 3OW2A 1S72T 2K2MA 4M77F 3I5RA 3H6ZA 1ZX6A 1ZUKA 3CD6Q 4JLGA 3RR6A 3SFMA 2L2PA 5FU6C 1YCSB 2D6FA 1M1GA 5GAN4 1IXDA 1OPKA 4XTZA 3MEAA 1Z9QA 4JDSA 4D8KA 5D6XA 3A8OB 1H92A 2JTFA 2NLUA 4ELZC 2W0ZA 4CC7A 2P0PA 1VQMA 1Q7YU 3JCMb 4M7DA 3JB9I 4FYXB 1ZA1B 2K5LA 3MP6A 1BI1A 1NJIR 4QW2A 1AWWA 4RTZA 2L3QA 4J9HA 3CC7Q 2DKGA 2RHZA 2FVUA 4NOYA 1QP3A 2ESWA 4C8QB 1G83A 2AT1B 1QLYA 4PJOG 1NPRA 3CCSQ 3VS5A 4JLIA 1CKBA 3V7RA 1WPYA 1Q81R 4JJNK 3O5ZA 1FMWA 1KHCA 4JPBW 4N4IA 1PWTA 2K79A 4DEYA 2DE0X 4X9CA 4LD9K 1VQOQ 1X69A 4ELYC 3CXCA 3I35A 2ZCFB 1VQMQ 2DERA 3PMIA 1NJIU 2LJ1A 4BE2A 4C0ZA 2P0KA 1M3BA 3BFMA 3S3OA 3CMEA 2RQVA 2F1LA 1N6AA 3C95A 5HY6A 4TVRA 4D6WA 2AKLA 2QQSA 2HQEA 4M77G 2VKNA 4BI8B 1MV0B 1UB4A 3MJXA 1NLOC 3CCMA 1X6OA 3V8JA 2XICA 3ZBDA 3N5BB 1B7TA 3CCQA 5EC7A 1LNXA 1VQNQ 4FL6A 2GCXA 2J7IA 4GLMA 3OY9A 1QMCA 1OULA 1YJ9T 3DB4A 2KQWA 2QG9B 3VJPA 2ZPEB 4QQDA 3H0HA 2HAXA 1PG5B 2WSEE 2DEQA 2ECZA 1Q82U 1NG2A 1ZBXA 3M55A 3VKIA 4OMOA 1QVGP 2K3YA 2MMPA 1PD1A 3THKA 3CD6A 1ZSZA 4GLKA 3OW2S 4AFZC 2KY9A 2RJDA 1GL5A 4L59A 9ATCB 5A2QE 2EKHA 1YITQ 2C0TA 1WXBA 1YFNA 4E2FB 1M2VA 1M5Q1 1T3SA 3KFVA 5LJ5g 2SRCA 1VQ9Q 3M0PA 3CCRQ 4PLIA 4XK8E 2PUOB 1JEGA 3TSWA 2LNHB 4JZ4A 4E7JA 1YIJQ 2DXCA 4OF1A 3SWNC 3G71Q 3OA6A 2EFIA 1D0ZA 4V2SA 1K8AC 1I1JA 2CP2A 3EGDA 3SDZA 3CC7A 1Y0MA 1M1KC 5KYUA 2KSSA 1IREB 3WXMB 4IUTA 2XIDA 3QWYA 4M7DB 3HL8A 4GBQA 3CCSA 3VRZA 2RMOA 1QVPA 1R0BG 4PFOA 5GANj 2DEUA 2DJZA 1K73C 2DTIA 1X43A 1BB9A 2HEQA 3OYCA 4FW1A 2V8IA 4E7SA 1VYUA 2QEXQ 1KC8C 1U3OA 1LPLA 4IUQA 1VQOA 1O9SA 2MYSA 1UE9A 2LX7A 2KK4A 4RUGA 2RK1A 4E7ZA 2IG0A 5GAMj 1SSFA 3CXCS 1OPLA 4R56A 2PQWA 4PJNA 4HCCA 2PVGB 3TVTA 4BI3A 2F2WA 1OZ2A 4OGCA 3JCMW 1YN8A 2LQKA 1UDLA 3AHUA 2KI7A 4GY5A 2QYZA 1VQ7T 3G1JA 4HCZA 4J6WA 4KULA 1E7OA 3LWIA 1YJNA 2YUOA 2HSPA 3UWNA 3CMAA 4ME7A 1K9MR 4BY6C 1RAFB 4NS5A 2FHDA 5LJ3f 1ABOA 5IXFA 4E7HA 1WX6A 1R8OB 2F2XA 2OAUA 2HMAA 4JRKA 4M7AA 2J6KA 1I81A 3OMCA 1VQPT 4XU0A 3CCVA 2AZVA 4KGZB 3FLGA 3A8HB 1Q86U 1WLPB 2CH4A 1KQSA 1YJWT 2KXDA 3M53A 2RNAA 5KYWA 1VQ6Q 3QXEB 5D7UA 4DBFA 4PJOC 3QHSA 4LE9A 4A53A 2YUNA 3JB9H 4CC3A 1IHVA 5DLOA 1UHCA 1VQ8Q 3OYMA 1PRLC 3GLXA 1M30A 4N4GA 4NL2A 3HFOA 2ZPBB 3QDFA 1K9MU 3J80E 1ZSZB 5FWBA 1M90U 1VQ9A 3CCRA 2OTLQ 1KD1C 1PSFA 4A4EA 4K11A 4OMPA 4JJDA 2V8KA 4XTWA 3OYLA 2HQHA 1YIJA 2BTTA 1M2VB 3Q1JA 3V7CA 2K5FA 3OMGA 3G71A 1QCNA 1YHQT 1S72Q 1WHLA 4RTYA 3OYDA 1PCXA 2JXBA 5C6SA 4M78A 4HT9A 5HK3A 2YUPA 5GANe 2ZPHB 4ZGEB 1YWOA 1JRIA 3CBPA 3EGDB 2M1HA 4KUDK 5KYUB 2E70A 2VV5A 1LJOA 1WYXA 2QQAA 1G2BA 4NL3A 1K1ZA 1ACMB 4C8QD 3DKMA 2L3RA 3REBB 2FG0A 1RADB 3OSSC 5IHNA 4IKFA 1SHGA 1SKUB 2B86A 2BZXA 5GAMe 2C0OA 5D6YA 2GQIA 3M0RA 2DL8A 3JAME 2HDAA 3EFSA 1WHKA 1JXMA 3OYNA 2ROTA 2W10A 2XG8D 2DM1A 2K2VA 2KAFA 4HCKA 4M75A 4LD6A 4J9BA 3EG2A 3CC4T 2DTHA 2M51A 2DYIA 4BACA 4IUVA 2XHCA 1HSQA 4UC4A 2BUDA 2DO3A 2PVOB 3GOXA 1OOTA 3EFRA 1K0XA 3QZ9B 2CP5A 1BKBA 2LP5A 4XTYA 1EX4A 1Y71A 2JS2A 2DYBA 4OMLA 2P4RA 3NTKA 1D0XA 2YLBA 4PL6A 4XU3A 3JCMe 1VQ4T 4DBHA 4C8QF 4QVZA 1BYMA 1BIAA 3G4SA 4J83A 5IAYA 2YUQA 5CAIA 2CP0A 1VQKT 2FL7A 3FJPA 1M8VA 1X01A 4M7AB 1N8RC 3LX7A 2AIRB 4LDWA 1M9SA 4QKUA 1MNEA 3QJYA 4E47A 1C1AA 3VS0A 1KQSS 2CUBA 3M4YA 5GJWB 5CKDA 1VQ8A 1M3AA 4HXJA 2P84A 5KYWB 4FM4B 4RCBA 2G3RA 1BK2A 1N5ZA 2YDLA 5M9OA 4Z88A 2EYQA 2A28A 2OTLA 2KMTA 4B9XA 2E10A 2EYXA 2DJQA 1YJ9Q 5LJ5f 2CT3A 1MNDA 3ER0A 3UDCA 1H3HA 3G6ET 4J9EA 2V1RA 4FSXA 2DL7A 2JMCA 3M0QA 1JXOA 4A63B 4EIKA 2DF6A 2D0QB 2EBPA 4P5NA 1UEBA 3KBGA 2VC8A 5GMKi 2L8DA 1UHFA 1XTDA 4C92E 3QKJA 1BU1A 4BB7A 2JM8A 1UG1A 2EYWA 1H3ZA 5CQXA 1KSWA 1QVFA 2HBPA 4C92A 3E19A 3PNWC 1G3WA 3M59A 4AG2C 2QQ9A 1RI9A 4M78B 5HK0A 4J6XA 2VB6A 4XU2A 3MHXA 4F16A 1VQ5T 4EMGA 2FZCB 4M7DD 1B07A 2QA4T 2EGAA 1AVZC 2H3JA 1OQKA 3CEYA 2MOXA 1K8AU 2NUPA 1JB0E 3EH1A 1NE8A 2KRMA 4C8QG 4LUEA 5FW9A 1NEGA 2NUZA 4MMLA 3R6OA 1W70A 5KCHA 4CI0C 4OP0A 1RAGB 4KBMB 5LJ3g 3C0CA 4AMCA 1VQLT 4M75B 4FW2A 1G8XA 1RABB 1WHHA 3URGA 2OX7A 1D0YA 4AFUC 3OYHA 3M0SA 2DIGA 2RO0A 1V1CA 3I55T 1BCOA 4F17A 1Q7YR 4PJOE 2VVKA 3HP9A 2RQRA 3RKXA 4QT7A 5CR2A 5LJ3d 2RJFA 5IHIA 4FYYB 4IUUA 4E6RA 4C0GA 1E6GA 5A0LA 1ZQ1A 1FWZA 1QCOA 5CIUA 5FU7B 3X26B 2DNUA 1T0HA 1I0CA 4DOVA 2YHTA 3MPUB 1JJ2A 3JCMP 4JRQA 1VQ7Q 2E65A 1BI3A 4Q5WA 2RH2A 5GMKh 2M16A 2CSQA 3MP1A 2O88A 2RA2A 1XQHA 5IH2A 2XDPA 2E4HA 5KH6A 3HRTA 3WVDB 3CCJT 3CCLT 4M77E 4Z8AA 1YWPA 2DK3A 2O2OA 5ECAA 3EHRA 1VQPQ 3A1PA 2LDMA 1WQ7A 4LDXA 3PGGA 4J8OA 4JRPA 2BZYA 2PVDB 2LQNA 2RM4A 3H9NA 5L8RE 1YJWQ 4M77A 1WJSA 3JRZA 5CKBA 1SRLA 4BE0A 4O6JA 5FLXE 5CVIA 2DMOA 4Y28E 4ZN3A 2EKOA 3A98A 2QK0A 1IZ6A 3OB9A 1PRMC 2DVJA 1YI2A 5GAN6 4LUDA 2X3XD 2GFAA 1W6XA 1QVFS 2DA9A 2RPNA 3L2ZA 4C92B 1W2BA 1PKTA 3EGXA 1SHFA 1K0SA 2J6FA 4IIMA 1Y07A 2F5TX 2E3HA 1KJWA 2VUBA 2JMAA 1Q82R 3UA7A 1YHQQ 2WACA 1NYGA 3X20B 3RERA 4PLLA 2MAMA 3M54A 4KT0E 3LGLA 1VA7A 4C5HA 4M7DG 1OU8A 2IIMA 5A0GA 2EIFA 2RQTA 3E9FA 3JCMV 2NUPB 4OB2B 5FROA 2DL5A 1JBMA 3ASKA 1MMNA 4J7IA 3FEOA 3L2VA 2EAYA 2LRQA 2R58A 3EAEA 2JNGA 3A8MB 1TSFA 3NHNA 1GCQC 2EJGA 2DL3A 1ABQA 2E12A 1ARKA 4N0AA 1X75C 4ZTFA 5I11A 4C5IA 1JU5C 2EGCA 3E2UA 2JN0A 2YRVA 3OW2P 4X1VA 3LW5E 5LJ3h 4JS5A 1ZBJA 1I5OB 1X2KA 2XMFA 2KYBA 3HHTB 3OBYA 2EJFA 1AHJB 1H8KA 4FT2A 2EWNA 3C12A 1YP5A 3CC2T 2ZZDA 1TUCA 1VQ7A 1M27C 4ZN1A 1SEMA 2JS0A 3UT1A 5GANg 2YLCA 2GGRA 3EG0A 3TREA 2AZSA 1XOVA 4LN2A 1JJ2S 1AWXA 2MIOA 1WIEA 3PE0A 3META 4M7AD 3H0IA 2LCLA 5GAN8 4JUVA 2O01E 1RAAB 4CC2A 1GRIA 1VQ4Q 3M9QA 1VQPA 1AZEA 5LJ5d 3IQLA 5LL6S 2EQMA 4RTWA 1VQKQ 1YJWA 2DIQA 3JB9D 4C8QC 4RMOA 2GF7A 1WXTA 3BDLA 2CZ6B 2P4TA 2E5KA 4M77B 2A36A 2WSFE 2K7AA 1RAHB 3UF4A 1M8MA 3PMTA 3CCMT 1J3TA 3JV3A 3CCQT 1BIBA 2EJ9A 1KQ1A 1KK7A 2NYSA 2YT6A 2RK2A 2MWOA 5EG2A 4PJLA 4BI4A 4EMKA 2M9UA 4BDZA 2XU8A 1WZOA 3UATA 4KUIA 3PT9A 3S3MA 3G6EQ 1G5VA 1WHJA 3CXCP 2DZ9A 5FRMA 1W2BS 5CKFA 1Q86R 4AG1C 4M7AF 3S6WA 2CGHA 1UUEA 4M78D 3QZ5B 3EGXB 2EQJA 2OAWA 2COWA 1NYFA 1N9SA 3JCMg 3FC3A 4PFPA 3HTRA 3BW1A 4QVCA 2DBMA 1FMKA 3RIRA 1X2QA 2F5KA 4IUPA 2LCSA 4XQ3A 1VQNA 3JB9F 4QQ6A 3X28B 1WFWA 1P92A 4J6YA 4CRIA 4D8DA 1HJDA 1M90R 2ED0A 4E7LA 4F7UF 1S1NA 2O4XA 2EW3A 3EGUA 1MUZA 1VQ5Q 2BIVA 2DRKA 4R0KA 2EQIA 1X6GA 4DQ2A 2K9GA 3CPWA 2J05A 2CP3A 1PHTA 2QA4Q 8AT1B 2E41A 2CP6A 3EG9A 4M75D 1QCFA 4WTOB 1Q7YC 2HZYA 1SF9A 2KRNA 4BD3A 3V8KA 2RJEA 2AK5A 2HL3A 4M78F 1YITA 1D09B 3NMZC 3R6NA 3OS0A 5I22A 4BDYA 1VQLQ 4F7UE 4LDUA 1K9AA 3JCMQ 2FZKB 1UGVA 1VIFA 3SD4A 3LGFA 1QP2A 1I07A 1WHMA 6AT1B 5I2SA 2E6NA 2DLPA 3I55Q 1TXQA 3KXTA 3GNGA 2D8HA 3HRUA 2GTJA 1VQ4A 4Z02A 4C0DB 1MV3A 2DD5A 2WSCE 2QXFA 1QWEA 1NJIC 5LJ5h 1UGRB 4OB0B 4M7AG 2Y90A 4M7DC 1SRMA 4M75F 3VYGA 2FO0A 2X4WA 2MWPA 5HKCA 2JM9A 4DEXA 3L2UA 3HPWA 4HVUA 1EFNA 1MMAA 2PU9B 1ZA2B 4LXCA 4OB3B 4ZGJB 2QEXA 2KVQG 4QVDA 5J3BA 1Q81C 1KG1A 2IVWA 3JB9G 4PK4A 1BI2A 5L23A 4F04B 4RG8A 4F7UG 1YJNT 3CMAT 2LTOA 3SHWA 5GAOl 3CCJQ 3CCLQ 3LYIA 2EGEA 2RQWA 3VUBA 4B6MA 1CKAA 2K5IA 2FB7A 3RKYA 4XAXB 4EMKB 1IGQA 2GTOA 3VUZA 1OX8A 3CCVT 3ULRB 2YWWA 3MCAB 5AYFA 2GBQA 3UA6A 3M0UA 3P8HA 3EHQA 1U5SA 2V26A 1Q82C 2BE9B 4LNPA 5GAOq 4JJCA 5CKEA 4M78G 3TEEA 3DLMA 1MGQA 3REAB 1GFDA 2KNBB 4MDXA 5HCKA 3VV0A 2O31A 2JTMA 1LCKA 5GAOr 5GJVB 3S3NA 2O4XB 4HVWA 2ZPFB 2CSIA 4AT1B 2X35A 1UECA 3CCET 1VQ6A 1UJ0A 1NBEB 4Y91A 1D1AA 1WJRA 2BZ8A 1KQSP 1PC0A 1I5LA 1B3QA 2E1HA 1RAIB 2EYYA 4PNOA 3GBQA 2A7YA 3EG9B 1VIEA 2IPOB 4J7FA 2E3IA 3QG1A 2COYA 1ZSGA 4A54A 1RLPC 3WVEB 4M75G 5FU6B 2DBKA 3L2WA 1VQLA 4RTUA 1C0MA 3HRSA 4JJBA 1T0JA 1ZSZC 1M4ZA 3OYGA 3SWNA 2KT1A 2RI2A 1GFCA 1VUBA 5GANf 1CSKA 4C8QE 3I55A 2YRCA 3V7SA 3LH0A 2GNCA 2VGMA 2O9SA 5GMKj 3TQ7P 1JQQA 4MMKA 1K8AR 1M1KR 1S72A 2C06A 2DZCA 4IIOA 5GMKl 3MP8A 4F14A 2H8HA 4FSSA 2F2VA 4R55A 2CP7A 4BUGA 3VRYA 1UGQB 1K73R 2JT4A 2RHIA 4ESRA 5GAMf 3HSBA 3OYFA 4A4GA 3CC2Q 2A0FB 2K3BA 2P0QA 2QQBA 4X34A 2LC4A 2D9TA 3HKSA 4IURA 1W4SA 1OX9A 4VUBA 3A8GB 1N27A 1NLPC 1M1KU 4L5GA 4RTTA 1GBRA 3GF5A 1HK9A 1QW1A 3QJ6A 4FT4A 4II1A 3O8VA 1K73U 3FRNA 1RUWA 3G4ST 1M2OA 3RBBB 2LZ6B 2MK5A 1QQJA 2ZGWA 1Q86C 2JVVA 3A8LB 3RESA 3UPUA 3JCMf 3FIFA 3PVQA 1BBZA 2KXCA 2MF2A 5FWCA 4JZ3A 1X6BA 1KC8U 2DTOA 7AT1B 3QUIA 1OEBA 4FU6A 2R57A 3CCMQ 1D3BA 3CCQQ 2KDSA 2B8AA 3EH2A 2HD0A 4ZGDB 5GAN7 1K9MC 1IO6A 4E7IA 1M90C 4HT8A 4M7DF 2ROLA 1RAEB 4PJOA 2X4YA 5IT9E 1JO8A 5C0MA 2ZAEA 1UGPB 1PSEA 3E1SA 2LJ0A 4WF2A 1QVGA 3RDVA 2G6FX 1RLQC 1G3TA 4M7AC
chains in the Genus database with same CATH topology
4N0AC 4A53A 3OBYA 2EJFA 4LDYA 1AHJB 2BKDN 3RKWA 3X25B 3JB9H 3OS5A 4FT2A 5D6WA 2QDYB 2EWNA 4C92F 3C12A 5DLOA 3CC2T 1YCYA 2LVMA 5CO7A 1U1TA 2R5MA 3OYIA 2ZZDA 5LJ3j 3OYMA 3JSCA 1VQ7A 2DXUA 4ZN1A 3GLXA 4N4GA 3UT1A 3KUFA 4EMKA 5GANg 4MZMA 3GNFB 3HFOA 1UGSB 2YLCA 2ZPBB 4NL2A 1K9MU 3TREA 1FXXA 2RI3A 3MEVA 3J80E 2XI9A 1XOVA 2VYTA 3X24B 3JCMX 1YJ9A 1M90U 1JJ2S 5GAN3 1VQ9A 2Y4XA 3CCRA 2QEXT 4JRIA 1KD1C 2I2LA 1PSFA 2Y4YA 3RUXA 4A4EA 1B34B 3META 2DPPB 5GMKe 4HA8A 3OYAA 2LCLA 3PTAA 2LNVA 3PIOA 4M7DE 4PJOD 2V8KA 5GAN8 4JUVA 4XTWA 3T9NA 4C8QA 2O01E 3OYLA 2MI6A 1YIJA 4V2SA 3V7CA 2QTXA 3Q1JA 2K5FA 1OYXA 1I8FA 1HXDA 3OMGA 3M9QA 4XTXA 3RMQA 3SWNB 2HNIA 4A4FA 4QQGA 4C0DC 5LJ5d 1VQPA 5LL6S 2EQMA 3P8BB 1YHQT 1U8RA 3GP8A 3JCMc 4RCCA 5CKHA 1YJWA 2CYZB 2DIQA 3JB9D 1KG1A 4C8QC 4RMOA 5GAOp 2GF7A 3OYDA 5C6SA 4O5VA 4HT9A 1V29B 4M78A 4RG2A 2PUKB 5HK3A 2DVEA 5DM7R 3BDLA 5GANe 2ZPHB 2K3XA 1G3SA 2VGNA 3BDUA 3OSVA 2CZ6B 4J5YA 3QSUA 2EQUA 2P4TA 4ZGEB 1JRIA 4XU1A 1MHNA 2K57A 3CBPA 3OYEA 3CC2A 2M1HA 4KUDK 3C4SA 4DA4A 4MZTA 3J7AF 2E70A 4M77B 3INZA 5KE3A 2WSFE 1KD1U 2VV5A 2X4JA 4M78C 3ME9A 4MZPA 1LJOA 2CZ0B 3PMTA 1WNLA 3CCMT 2QQAA 4MDWA 4NL3A 3I56T 3CCJA 3CCQT 1BIBA 2EJ9A 2OTJT 1Y96B 3CCLA 4A4KA 1KQ1A 2QQRA 5EG2A 3QPHA 2GFUA 2MWOA 2RK2A 1WGSA 1WJQA 2L3RA 2M9UA 2ZPGB 3DKMA 4BI4A 2XU8A 4BDZA 4KUIA 3OSSC 2F69A 4JS4A 3PT9A 3OS1A 4M77D 3S3MA 4IKFA 1G5VA 2DZ9A 5GAMe 3OYBA 1LOJA 2CKKA 5D6YA 5FRMA 1W2BS 5CKFA 3JAME 3NTIA 3BY7A 3EFSA 1RL2A 4EMKC 4PJOF 4M7AF 3QIIA 2CGHA 3S6WA 4M78D 2LQ8A 3OYNA 1G3YA 3QZ5B 2XG8D 2K2VA 2KAFA 3TCJA 2EQJA 4M75A 4LD6A 1N9SA 5I2MA 3JCMg 3FC3A 1VQ6T 3E9GA 3LLRA 3CC4T 3DB3A 2DTHA 3BW1A 5GAN2 4QVCA 3M5AA 5A0DA 2RHYA 4BACA 4IUVA 2XHCA 4PKCC 1N9RA 3RIRA 3ZFJA 2F5KA 3C94A 3M56A 1RI0A 4IUPA 4UC4A 2BUDA 2DO3A 2PVOB 3M57A 4XQ3A 5I21A 1VQ8T 1VQNA 2DXTA 4QQ6A 3X28B 3JB9F 5KCOA 1BI0A 5KE2A 3L1AA 4M75C 1P92A 1Q81U 4J6YA 3GOXA 4CRIA 4HCBA 2QI2A 3EFRA 3HFNA 2CS7A 4E7LA 4C92G 3QZ9B 2R5AA 4F7UF 1BKBA 4C5GA 2O4XA 4XTYA 3FDRA 3I56A 1Y71A 2BIVA 2OTLT 4BY6B 2OTJA 4DQ2A 3CCUA 1OZ3A 3CPWA 2L5QA 3NTKA 2K4YA 5DY9A 3JB9J 2YLBA 2AHJB 4PL6A 4XU3A 2L89A 3JCMJ 4N4HA 3JCMe 1NPPA 3QHSA 1VQ4T 2E41A 3MEWA 2JOYA 1D3BB 4QVZA 4C8QF 5J39A 4M75D 1BYMA 1BIAA 3G4SA 4J83A 5IAYA 1GXIE 2E6ZA 5CAIA 3OW2A 1S72T 1VQKT 5FRNA 2FL7A 4M77F 3FJPA 1Q7YC 1M8VA 3H6ZA 1X01A 2X4XA 2XD0A 4BD3A 4M7AB 1N8RC 3V8KA 3LX7A 4RKUE 5CQYA 4LDWA 1M9SA 5FU7C 4JLGA 4PJOB 2RJEA 3QJYA 4E47A 3SFMA 3ZEHA 1QVGS 1KQSS 4M78F 3QBYA 2XDDA 5LJ3e 1YITA 2FYKA 3M4YA 5CKDA 1VQ8A 3OS0A 4BDYA 5FU6C 2CZ1B 3VYHB 2D6FA 4F7UE 4LDUA 1M1GA 4OB1B 3JCMQ 5GAN4 3NFCA 4FM4B 4RCBA 2G3RA 3MEAA 4XTZA 1YI2T 1VIFA 4JDSA 4C8QD 3SD4A 1M1FA 3LGFA 1QP2A 5M9OA 5D6XA 2EYQA 4X9DA 2RHXA 2KMTA 3A8OB 4B9XA 2E10A 2E6NA 5I2SA 2OTLA 2JTFA 4EPCA 5LJ5f 4HKEA 3KXTA 2NLUA 4ELZC 3GNGA 3ER0A 3UDCA 3G6ET 4FSXA 2P0PA 1VQMA 1Q7YU 3HRUA 3JCMb 4DOWA 5GANd 4M7DA 3JB9I 4C5EA 2K5LA 3MP6A 1BI1A 1VQ4A 3L2QA 4Z02A 4QW2A 2D0QB 4C0DB 5GAMg 1N8RU 4P5NA 2DD5A 1UEBA 2WSCE 3KBGA 2VC8A 5GMKi 2QXFA 3CMET 2XDBA 2L8DA 2DKGA 5J26A 1XTDA 2ZPIB 2RHZA 4C92E 1NJIC 2FVUA 4NOYA 1QP3A 5LJ5h 1UGRB 3QKJA 4C8QB 4OB0B 4BB7A 4M7AG 2Y90A 4PJOG 4M7DC 1NPRA 2XK0A 4M75F 3OYJA 4JLIA 1H3ZA 3VYGA 2X4WA 5CQXA 3V7RA 2MWPA 1WPYA 4EMHA 5HKCA 1QVFA 2HBPA 4C92A 4JJNK 3L2RA 3E19A 5LJ5j 3L2UA 3PNWC 3H8ZA 1Y7XA 1G3WA 1KHCA 2PU9B 3HPWA 3M59A 3NTHA 2QQ9A 4ZGJB 5GAMd 4OB3B 4OMFB 3LWHA 2KVQG 4M78B 4N4IA 4J6XA 5J3BA 2IVWA 4QVDA 5HK0A 2QEXA 1Q81C 4XU2A 3G71A 3JB9G 1KHIA 3MHXA 1BI2A 2RD1A 1VQ5T 2VXFA 3MO8A 4X9CA 4C92C 4M7AD 4LD9K 4EMGA 4RG8A 4F7UG 1YJNT 2DXBA 2RHUA 4ELYC 3CMAT 3CXCA 2LTOA 5GAOl 2QA4T 4A4HA 2ZCFB 1ZHIA 3LYIA 1YHQA 3PMIA 2H3JA 1NJIU 3CEYA 4BE2A 3VUBA 4C0ZA 2P0KA 2JZ2A 1K8AU 2K5IA 5CK9A 1JB0E 2FB7A 4XAXB 3RKYA 3VU3C 3BFMA 4EMKB 1NE8A 3VUZA 3CMEA 3S3OA 3CCVT 3V8LA 3C95A 1N6AA 5HY6A 3MCAB 3PFSA 4TVRA 5AYFA 4C8QG 4D6WA 3P8HA 3CD6T 2QQSA 2HQEA 4MMLA 4M77G 1Q82C 3R6OA 1NZ9A 4BI8B 5KCHA 4EDUA 4CI0C 4OP0A 1UB4A 5GAOq 3CCMA 4KBMB 5LJ3g 1VQLT 1X6OA 4M75B 2XICA 5CKEA 3V8JA 3ZBDA 3N5BB 3CCQA 4M78G 3TEEA 3DLMA 1MGQA 1LNXA 3URGA 4FL6A 2GCXA 3JCMd 3CBOA 3RMSA 2XKOC 4MDXA 3OYHA 3OY9A 2EQKA 3VV0A 3P8DA 2LT4A 2DIGA 2RO0A 3I55T 1YJ9T 3DB4A 3GPLA 4M7AE 2JTMA 4PJOE 2KQWA 3VJPA 2ZPEB 3HP9A 4QQDA 5GAOr 3J81E 3S3NA 3RKXA 1I4K1 2O4XB 2HAXA 5CR2A 2ZPFB 2VXEA 5LJ3d 1VQPT 2RJFA 2RJCA 2X35A 2WSEE 3QO3A 1H641 4IUUA 4C0GA 2DEQA 1Q82U 4B9WA 3CC7T 3CCET 3CC4A 1VQ6A 3M4GA 5A0LA 1ZBXA 3M55A 1ZQ1A 4Y91A 3VKIA 1WJRA 1FWZA 4LDVA 4FIBA 2K3YA 1I5LA 2MMPA 2E1HA 4PNOA 3CCST 5CIUA 2GQVA 2A7YA 4GLKA 3OW2S 5FU7B 3X26B 4BE1A 3CD6A 2KY9A 1VIEA 4DOVA 4J7FA 2RJDA 2YHTA 5GAOm 3QG1A 5DLQE 1JJ2A 4A54A 3JCMP 1B34A 4JRQA 3WVEB 4M75G 2E65A 4L59A 5FU6B 1WQWA 5A2QE 3L2WA 1VQLA 1BI3A 3HRSA 4Q5WA 2E5QA 1TH7A 2RH2A 5GMKh 2M16A 1M5Q1 5LJ5g 1M4ZA 4F7UA 3OYGA 3SWNA 3MP1A 2RI2A 1VUBA 2RA2A 1XQHA 5GANf 1U1SA 2XDPA 5GAOn 4PLIA 4C8QE 1VQOT 5KH6A 4XK8E 3I55A 3HRTA 2RI5A 2PUOB 3V7SA 3OYYA 3LH0A 3WVDB 3CCJT 3GIBA 2VGMA 3CCLT 3DLLA 5GMKj 1VQMT 4M77E 4MMKA 4E7JA 2DK3A 2DXCA 4OF1A 1S72A 2C06A 1VQKA 3SWNC 3OA6A 5GAN5 2LDMA 2DZCA 1WQ7A 4LDXA 2EFIA 3PGGA 4J8OA 4JRPA 3CCEA 3QYHB 1K8AC 5GMKl 3MP8A 2PVDB 3SDZA 1M1KC 3CC7A 2RM4A 2CZ7B 4M78E 5GANh 5L8RE 4M77A 2KSSA 4R55A 1IREB 1WJSA 3MEUA 4IUTA 3WXMB 4BUGA 3JRZA 5CKBA 1UGQB 2XIDA 4BE0A 4O6JA 4M7DB 2JUFA 2RHIA 3HL8A 5FLXE 5CVIA 2V8JA 3CCSA 4Y28E 4ZN3A 5GAMf 3HSBA 2EKOA 1QVPA 5LJ5e 1Y96A 3OYFA 4A4GA 4XTVA 5GANj 1IZ6A 2DJZA 1K73C 3OB9A 2DTIA 4M77C 3OYCA 5GAN6 2P0QA 1YI2A 2QQBA 3OQ5A 4E7KA 4X34A 2LC4A 1VQNT 2GFAA 2D9TA 1QVFS 3CCUT 2V8IA 3HKSA 4OGEA 3G6EA 4IURA 1KC8C 5GAMh 1W4SA 3L2ZA 4C92B 1W2BA 4IUQA 1VQOA 4VUBA 1O9SA 4ATOA 1EIFA 3A8GB 2M0OA 1N27A 1M1KU 1Y07A 2F5TX 4L5GA 2KK4A 2VUBA 4C0FA 2RK1A 2IG0A 1O75A 3GF5A 1XNIA 1SSFA 5GAMj 3CXCS 2LX9A 1HK9A 4R56A 1QW1A 3QJ6A 2PQWA 4FT4A 4M75E 2WACA 2PVGB 4HCCA 3X20B 4C92D 3RERA 3QYGB 4II1A 4PLLA 3O8VA 2MAMA 1K73U 3FRNA 3G4ST 3M54A 4BI3A 4KT0E 3LGLA 3OS2A 3PIPA 1OZ2A 4C5HA 4M7DG 4OGCA 2A3LA 3JCMW 2ZGWA 2LQKA 1KQ2A 5IN1A 5A0GA 2EIFA 3SB2A 4XTUA 1Q86C 2JVVA 3A8LB 3E9FA 3JCMV 3AHUA 3RESA 3UPUA 2DD4A 3JCMf 3FIFA 3CPFA 4GY5A 4OB2B 5FROA 3QDRB 3TU4K 2MF2A 1JBMA 1VQ7T 3ASKA 1OI1A 1KC8U 2DTOA 3FB9A 4HCZA 4J7IA 3FEOA 3L2VA 2EAYA 4J6WA 4F7UB 1YITT 1VQ5A 4KULA 3QUIA 4YTLA 4FU6A 5CCAA 3LWIA 2R57A 1VQ9T 1YJNA 2LRQA 3L42A 3OBWA 3UWNA 5GMKm 1D3BA 4ME7A 3CMAA 3CCRT 2QA4A 4BY6C 2KDSA 2R58A 3EAEA 2B8AA 2JNGA 2E64A 2FHDA 2HQXA 3A8MB 3M58A 4NS5A 5LJ3f 2EJGA 3JCMh 2HD0A 4ZGDB 5GAN7 3OYKA 3CPWS 4ZTJA 1K9MC 4E7HA 4E7IA 1M90C 1R8OB 4HT8A 2OAUA 4M7DD 4M7DF 4JRKA 3CBMA 1YIJT 4M7AA 4PJOA 2X4YA 5IT9E 1YBYA 2E12A 3G71T 1I81A 3OMCA 4N0AA 1X75C 4L6V5 4XU0A 5C0MA 3CCVA 4ZTFA 1DJ7B 4C5IA 3F70A 2RB6A 1UGPB 1PSEA 2LT1A 3E1SA 3A8HB 3FLGA 3A5ZB 1Q86U 2DAQA 2JN0A 2YRVA 4WF2A 1QVGA 1KQSA 1YJWT 2LCCA 3M53A 3LW5E 5LJ3h 4JS5A 1G3TA 4OVAA 3QXEB 4M7AC 4PJOC 3HHTB 1FX7A 3G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHU A;  2BKD N;  2LTO A;  4E7L A;  3MP8 A;  4A4H A;  2R5A A;  5D6W A;  4C5G A;  2O4X A;  3LYI A;  3PMI A;  3FDR A;  3CEY A;  1WJS A;  2LVM A;  3MEU A;  2R5M A;  4IUT A;  2BIV A;  3OYI A;  4BE2 A;  2P0K A;  3OYM A;  4BE0 A;  2JZ2 A;  1OZ3 A;  2RHI A;  4N4G A;  3KUF A;  3UT1 A;  3NTK A;  2EKO A;  2RI3 A;  3MEV A;  3S3O A;  3OYF A;  4PL6 A;  4A4G A;  2VYT A;  2L89 A;  3OB9 A;  4N4H A;  3PFS A;  3OYC A;  3MEW A;  3OQ5 A;  4QVZ A;  5J39 A;  3GOX A;  3P8H A;  4A4E A;  3MET A;  2QQS A;  3OYA A;  2HQE A;  5IAY A;  4E7K A;  4X34 A;  2GFA A;  2D9T A;  5FRN A;  5KCH A;  3OYL A;  4EDU A;  3H6Z A;  2X4X A;  3Q1J A;  3OMG A;  1OYX A;  4IUR A;  4A4F A;  3M9Q A;  4BD3 A;  4QQG A;  3LX7 A;  4IUQ A;  2EQM A;  2M0O A;  2RJE A;  1N27 A;  3DLM A;  3ZEH A;  4FL6 A;  3QBY A;  2DIQ A;  3OYH A;  3OY9 A;  3OS0 A;  2EQK A;  2GF7 A;  5C6S A;  3P8D A;  3OYD A;  2IG0 A;  4BDY A;  4RG2 A;  2DIG A;  2RO0 A;  1XNI A;  1SSF A;  3BDL A;  3DB4 A;  2K3X A;  3QJ6 A;  2PQW A;  2EQU A;  2WAC A;  2G3R A;  3MEA A;  4QQD A;  4II1 A;  4PLL A;  3O8V A;  1MHN A;  3SD4 A;  3OYE A;  3LGF A;  5M9O A;  2M1H A;  5D6X A;  3S3N A;  3LGL A;  3C4S A;  2O4X B;  2RHX A;  1OZ2 A;  4B9X A;  4C5H A;  5KE3 A;  2E6N A;  3OS2 A;  2JTF A;  2RJF A;  2RJC A;  2X35 A;  5IN1 A;  2NLU A;  4IUU A;  3ME9 A;  3E9F A;  3PMT A;  4B9W A;  4GY5 A;  5FRO A;  1WJR A;  2K3Y A;  4C5E A;  3ASK A;  1OI1 A;  2QQR A;  3MP6 A;  4HCZ A;  3L2Q A;  2GFU A;  2MWO A;  4QW2 A;  1WGS A;  1WJQ A;  2L3R A;  3FEO A;  4Z02 A;  3L2V A;  4BDZ A;  5CIU A;  4BE1 A;  4FU6 A;  4IKF A;  3OS1 A;  3S3M A;  2L8D A;  1G5V A;  2R57 A;  5J26 A;  2RJD A;  2LRQ A;  2RHZ A;  3L42 A;  3UWN A;  3OYB A;  2CKK A;  5D6Y A;  3QKJ A;  5FRM A;  2R58 A;  3EAE A;  4L59 A;  2B8A A;  3L2W A;  2HQX A;  2FHD A;  2XK0 A;  3NTI A;  4NS5 A;  3OYK A;  3OYJ A;  4Q5W A;  2E5Q A;  3QII A;  3S6W A;  3OYN A;  4ZTJ A;  1H3Z A;  2X4W A;  2M16 A;  4E7H A;  4E7I A;  3OYG A;  2MWP A;  3MP1 A;  2EQJ A;  4LD6 A;  2RI2 A;  2X4Y A;  3L2R A;  3L2U A;  3OMC A;  3PNW C;  3E9G A;  3H8Z A;  5C0M A;  3FC3 A;  3LLR A;  2XDP A;  1KHC A;  3DB3 A;  4ZTF A;  4PLI A;  4C5I A;  3NTH A;  5KH6 A;  3F70 A;  2RHY A;  2RI5 A;  4BAC A;  4IUV A;  3LH0 A;  4N4I A;  3FLG A;  2DAQ A;  2YRV A;  2F5K A;  4IUP A;  4UC4 A;  1RI0 A;  2BUD A;  4E7J A;  2LCC A;  4QQ6 A;  5KCO A;  3MO8 A;  4OVA A;  5KE2 A;  3OA6 A;  2LDM A;  4CRI A;  2EFI A; 
#chains in the Genus database with same CATH topology
 4LDY A;  2BKD N;  3RKW A;  5D6W A;  2YXY A;  2QAS A;  2LVM A;  2R5M A;  2JJ9 A;  5LJ3 j;  3JSC A;  1MMD A;  2V1Q A;  1SPK A;  1KD1 R;  1FXX A;  3VS1 A;  1YJ9 A;  2PNI A;  2K6D A;  4JRI A;  1V76 A;  5GMK e;  3OYA A;  4HA8 A;  3PTA A;  2LNV A;  3PIO A;  4M7D E;  2COZ A;  2MI6 A;  4OMN A;  2HSE B;  1OYX A;  1I8F A;  4A4F A;  2KEA A;  3SWN B;  2HNI A;  4QQG A;  1QKW A;  2DL4 A;  1U8R A;  3GP8 A;  1WHG A;  1IRX A;  5CKH A;  2CYZ B;  4O5V A;  4RG2 A;  2DVE A;  2K3X A;  1G3S A;  2VGN A;  4J5Y A;  2EQU A;  4ANJ A;  4XU1 A;  1MHN A;  2K57 A;  3OYE A;  3CC2 A;  2ED1 A;  1OU9 A;  2QAZ A;  3C4S A;  1QVF P;  3INZ A;  4FYW B;  1KD1 U;  4M78 C;  3ZL7 C;  2RF0 A;  2JTE A;  3EG3 A;  4MDW A;  4FYV B;  2FRY A;  3I56 T;  2OTJ T;  4A4K A;  1NEB A;  4E7K A;  2D8J A;  3QPH A;  3CCU T;  1WGS A;  1WJQ A;  2OJ2 A;  2D0N A;  1AOJ A;  1ZLM A;  2CH4 W;  2F69 A;  3OS1 A;  4JS4 A;  1FYN A;  1LOJ A;  2CKK A;  1TU0 B;  4AFS C;  3NTI A;  3BY7 A;  3QII A;  2LQ8 A;  1G3Y A;  3E9G A;  3LLR A;  2DX1 A;  2SEM A;  3DB3 A;  5GAN 2;  4PKC C;  2PZ1 A;  1N9R A;  3D7S B;  3ZFJ A;  3C94 A;  3M56 A;  2JW4 A;  2FZG B;  1BI0 A;  5KE2 A;  4M75 C;  4HCB A;  1Q81 U;  1XJW B;  4Y92 A;  2HCK A;  3HFN A;  2CS7 A;  2DRM A;  1HYO A;  1Z9Z A;  2R5A A;  4C5G A;  2FPE A;  1QKX A;  4BY6 B;  1YJN Q;  3CMA Q;  4ZNX A;  3I5S A;  5DY9 A;  2AHJ B;  1TG0 A;  1R77 A;  2L89 A;  3JCM J;  4N4H A;  1NPP A;  2JOY A;  1D3B B;  5J39 A;  1BCM A;  1GXI E;  3CC4 Q;  1N8R R;  5FRN A;  3NGP A;  3CCV Q;  2X4X A;  2XD0 A;  1M3C A;  4J9F A;  4PJO B;  2FPD A;  4RKU E;  5CQY A;  5FU7 C;  1QVG S;  3ZEH A;  3QBY A;  2XDD A;  5LJ3 e;  2FYK A;  2KT8 A;  2CZ1 B;  1PNJ A;  3VYH B;  1JJ2 P;  4KGV B;  4OB1 B;  3NFC A;  1YNZ A;  4J9I A;  5AT1 B;  4KRT A;  1UFF A;  1YI2 T;  2L3P A;  1M1F A;  1PM3 A;  5KYX A;  4X9D A;  2RHX A;  4EPC A;  4HKE A;  1SSH A;  1PKS A;  2L0A A;  4DOW A;  5KYN A;  5GAN d;  4C5E A;  3L2Q A;  5GAM g;  2C0I A;  1N8R U;  3CCE Q;  3CME T;  2XDB A;  2VAS A;  5J26 A;  2ZPI B;  2HBW A;  1TOV A;  1K76 A;  1ZUU A;  2XK0 A;  3OYJ A;  1OV3 A;  4EMH A;  1WDX A;  3L2R A;  5LJ5 j;  1TTH B;  3H8Z A;  1Y7X A;  3NTH A;  2AKK A;  5GAM d;  4OMF B;  3LWH A;  1IHW A;  1D1B A;  4PFZ A;  1KHI A;  2KBT A;  3CQT A;  2HKN A;  2RD1 A;  4RTV A;  2QTV A;  2VXF A;  1C6V X;  3MO8 A;  2ATC B;  4C92 C;  1K4U S;  2A37 A;  2DXB A;  2RHU A;  1FMV A;  1W2B P;  4A4H A;  1ZHI A;  1YHQ A;  1A0N B;  4OMQ A;  2JZ2 A;  3MKD A;  5CK9 A;  2J6O A;  3VU3 C;  2LMJ A;  3V8L A;  2MCN A;  3PFS A;  3RNJ A;  3FJ5 A;  3TSZ A;  3CD6 T;  2DET A;  4J9G A;  2KYM A;  1NZ9 A;  1QWF A;  2CRE A;  4EDU A;  2RQU A;  4FCY A;  2L3S A;  1TWB A;  3JCM d;  2I0N A;  3CBO A;  3RMS A;  2NUT A;  4OMM A;  2XKO C;  2EQK A;  3P8D A;  2LT4 A;  1R0C B;  3GPL A;  4M7A E;  1VYV A;  2OI3 A;  3U23 A;  3J81 E;  4CC4 B;  2QDL A;  1I4K 1;  4DBR A;  2VXE A;  2RJC A;  3QO3 A;  1H64 1;  1KFZ A;  4B9W A;  3CC7 T;  3CC4 A;  3M4G A;  1X27 A;  1AWJ A;  1ZUY A;  4LDV A;  3G4S Q;  4FIB A;  3CCS T;  2GQV A;  1EZZ B;  4BE1 A;  1WA7 A;  5GAO m;  5DLQ E;  2CT4 A;  2NWM A;  1B34 A;  2O9V A;  1WQW A;  1UTI A;  2ABL A;  2DFU A;  2E5Q A;  4J9C A;  1TH7 A;  2Z0W A;  2EVR A;  4F7U A;  4ORZ A;  2A08 A;  1U1S A;  4J9D A;  5GAO n;  1VQO T;  2H3E B;  2RI5 A;  3OYY A;  3GIB A;  3M0T A;  3DLL A;  1VQM T;  4DBQ A;  2DIL A;  1VQK A;  5GAN 5;  2VWF A;  5KYX B;  3CCE A;  3QYH B;  3NPF A;  2CZ7 B;  4M78 E;  5GAN h;  1VOM A;  3MEU A;  3EG1 A;  4Z89 A;  2JUF A;  1IGU A;  2V8J A;  5LJ5 e;  1Y96 A;  2CDT A;  1W1F A;  4XTV A;  4M77 C;  2MPX C;  3OQ5 A;  1WI7 A;  1U06 A;  5KYY A;  1VQN T;  4PJJ A;  2M0Y A;  4HVV A;  1Q95 G;  4OGE A;  3G6E A;  5GAM h;  4ATO A;  1EIF A;  2M0O A;  4PJM A;  1RAC B;  4C0F A;  1O75 A;  1HD3 A;  1XNI A;  2LX9 A;  4M75 E;  3VS6 A;  4C92 D;  3EFO A;  3QYG B;  1D1C A;  2FEI A;  3OS2 A;  1MMG A;  3PIP A;  2HL5 C;  2A3L A;  1KQ2 A;  5IN1 A;  3SB2 A;  4XTU A;  2DD4 A;  3CPF A;  3QDR B;  3TU4 K;  2QGG A;  1OI1 A;  1GCQ A;  3FB9 A;  1YIT T;  1VQ5 A;  4YTL A;  3LH5 A;  5CCA A;  5IXB A;  1VQ9 T;  2HKQ B;  3L42 A;  3OBW A;  5GMK m;  3CCR T;  3I56 Q;  2QA4 A;  2OTJ Q;  1AD5 A;  3CCU Q;  2E64 A;  2HQX A;  3JCM h;  3OYK A;  3M58 A;  1TUG B;  3CPW S;  4ZTJ A;  3CPW P;  3VS2 A;  3PVL A;  2LQW A;  1NM7 A;  1YIJ T;  3CBM A;  1YBY A;  3G71 T;  2NUT B;  4L6V 5;  2EYZ A;  1DJ7 B;  3F70 A;  2RB6 A;  2LT1 A;  3A5Z B;  2DAQ A;  1Y57 A;  1IB8 A;  2LCC A;  3BE3 A;  4OVA A;  3AT1 B;  2X9H A;  1FX7 A;  3G7Z A;  4N0A C;  2YSQ A;  1AEY A;  3X25 B;  3OS5 A;  2QDY B;  4C92 F;  1UJY A;  2CUD A;  1SG5 A;  1YCY A;  2EPD A;  5CO7 A;  3OYI A;  1U1T A;  2DXU A;  8ATC B;  1AZG B;  3KUF A;  4MZM A;  3GNF B;  1UGS B;  3H0F A;  2RI3 A;  3MEV A;  4KH0 B;  2XI9 A;  3X24 B;  2VYT A;  3JCM X;  1T3L A;  5GAN 3;  2Y4X A;  2QEX T;  2I2L A;  2Y4Y A;  3RUX A;  1B34 B;  2DPP B;  4PJO D;  1LVK A;  2FRW A;  3T9N A;  4C8Q A;  2QTX A;  3H41 A;  3RMQ A;  1HXD A;  4F7U B;  4XTX A;  4C0D C;  2QGF B;  2FPF A;  3P8B B;  3JCM c;  4KGX B;  4RCC A;  5IHK A;  1AWO A;  1GBQ A;  5GAO p;  1V29 B;  2PUK B;  5DM7 R;  4RTX A;  3OSV A;  3BDU A;  3QSU A;  2PTK A;  1E6H A;  1KC8 R;  2KRO A;  4DA4 A;  4MZT A;  3J7A F;  2J06 A;  2KRS A;  5KE3 A;  2X4J A;  3ME9 A;  4KH1 B;  2CZ0 B;  4MZP A;  1WNL A;  1YI2 Q;  3I9Q A;  3CCJ A;  1Y96 B;  3CCL A;  2QQR A;  2GFU A;  2ZPG B;  3QWX X;  1VYT A;  2KGT A;  3VS3 A;  2X3W D;  4M77 D;  2YRD A;  5KYY B;  1WXU A;  2LJ3 A;  3OYB A;  4EMK C;  1RL2 A;  4PJO F;  3CME Q;  3TCJ A;  4AFQ C;  5I2M A;  2M02 A;  1VQ6 T;  2BE7 D;  3M5A A;  5A0D A;  2RHY A;  1RI0 A;  3M57 A;  5I21 A;  1VQ8 T;  2DXT A;  2KE9 A;  1PD0 A;  3EFO B;  5KCO A;  3L1A A;  1TS9 A;  1TUD A;  2QI2 A;  2D1X A;  3SEM A;  4C92 G;  1GCP A;  2KR3 A;  2ENM A;  3FDR A;  3I56 A;  2RN8 A;  2OTJ A;  2OTL T;  4M4Z A;  3CCU A;  1OZ3 A;  2L5Q A;  2X51 A;  2K4Y A;  3JB9 J;  3VS7 A;  1F1B B;  4WCI A;  3MEW A;  3VS4 A;  1KIK A;  1AT1 B;  2E6Z A;  3OW2 A;  1S72 T;  2K2M A;  4M77 F;  3I5R A;  3H6Z A;  1ZX6 A;  1ZUK A;  3CD6 Q;  4JLG A;  3RR6 A;  3SFM A;  2L2P A;  5FU6 C;  1YCS B;  2D6F A;  1M1G A;  5GAN 4;  1IXD A;  1OPK A;  4XTZ A;  3MEA A;  1Z9Q A;  4JDS A;  4D8K A;  5D6X A;  3A8O B;  1H92 A;  2JTF A;  2NLU A;  4ELZ C;  2W0Z A;  4CC7 A;  2P0P A;  1VQM A;  1Q7Y U;  3JCM b;  4M7D A;  3JB9 I;  4FYX B;  1ZA1 B;  2K5L A;  3MP6 A;  1BI1 A;  1NJI R;  4QW2 A;  1AWW A;  4RTZ A;  2L3Q A;  4J9H A;  3CC7 Q;  2DKG A;  2RHZ A;  2FVU A;  4NOY A;  1QP3 A;  2ESW A;  4C8Q B;  1G83 A;  2AT1 B;  1QLY A;  4PJO G;  1NPR A;  3CCS Q;  3VS5 A;  4JLI A;  1CKB A;  3V7R A;  1WPY A;  1Q81 R;  4JJN K;  3O5Z A;  1FMW A;  1KHC A;  4JPB W;  4N4I A;  1PWT A;  2K79 A;  4DEY A;  2DE0 X;  4X9C A;  4LD9 K;  1VQO Q;  1X69 A;  4ELY C;  3CXC A;  3I35 A;  2ZCF B;  1VQM Q;  2DER A;  3PMI A;  1NJI U;  2LJ1 A;  4BE2 A;  4C0Z A;  2P0K A;  1M3B A;  3BFM A;  3S3O A;  3CME A;  2RQV A;  2F1L A;  1N6A A;  3C95 A;  5HY6 A;  4TVR A;  4D6W A;  2AKL A;  2QQS A;  2HQE A;  4M77 G;  2VKN A;  4BI8 B;  1MV0 B;  1UB4 A;  3MJX A;  1NLO C;  3CCM A;  1X6O A;  3V8J A;  2XIC A;  3ZBD A;  3N5B B;  1B7T A;  3CCQ A;  5EC7 A;  1LNX A;  1VQN Q;  4FL6 A;  2GCX A;  2J7I A;  4GLM A;  3OY9 A;  1QMC A;  1OUL A;  1YJ9 T;  3DB4 A;  2KQW A;  2QG9 B;  3VJP A;  2ZPE B;  4QQD A;  3H0H A;  2HAX A;  1PG5 B;  2WSE E;  2DEQ A;  2ECZ A;  1Q82 U;  1NG2 A;  1ZBX A;  3M55 A;  3VKI A;  4OMO A;  1QVG P;  2K3Y A;  2MMP A;  1PD1 A;  3THK A;  3CD6 A;  1ZSZ A;  4GLK A;  3OW2 S;  4AFZ C;  2KY9 A;  2RJD A;  1GL5 A;  4L59 A;  9ATC B;  5A2Q E;  2EKH A;  1YIT Q;  2C0T A;  1WXB A;  1YFN A;  4E2F B;  1M2V A;  1M5Q 1;  1T3S A;  3KFV A;  5LJ5 g;  2SRC A;  1VQ9 Q;  3M0P A;  3CCR Q;  4PLI A;  4XK8 E;  2PUO B;  1JEG A;  3TSW A;  2LNH B;  4JZ4 A;  4E7J A;  1YIJ Q;  2DXC A;  4OF1 A;  3SWN C;  3G71 Q;  3OA6 A;  2EFI A;  1D0Z A;  4V2S A;  1K8A C;  1I1J A;  2CP2 A;  3EGD A;  3SDZ A;  3CC7 A;  1Y0M A;  1M1K C;  5KYU A;  2KSS A;  1IRE B;  3WXM B;  4IUT A;  2XID A;  3QWY A;  4M7D B;  3HL8 A;  4GBQ A;  3CCS A;  3VRZ A;  2RMO A;  1QVP A;  1R0B G;  4PFO A;  5GAN j;  2DEU A;  2DJZ A;  1K73 C;  2DTI A;  1X43 A;  1BB9 A;  2HEQ A;  3OYC A;  4FW1 A;  2V8I A;  4E7S A;  1VYU A;  2QEX Q;  1KC8 C;  1U3O A;  1LPL A;  4IUQ A;  1VQO A;  1O9S A;  2MYS A;  1UE9 A;  2LX7 A;  2KK4 A;  4RUG A;  2RK1 A;  4E7Z A;  2IG0 A;  5GAM j;  1SSF A;  3CXC S;  1OPL A;  4R56 A;  2PQW A;  4PJN A;  4HCC A;  2PVG B;  3TVT A;  4BI3 A;  2F2W A;  1OZ2 A;  4OGC A;  3JCM W;  1YN8 A;  2LQK A;  1UDL A;  3AHU A;  2KI7 A;  4GY5 A;  2QYZ A;  1VQ7 T;  3G1J A;  4HCZ A;  4J6W A;  4KUL A;  1E7O A;  3LWI A;  1YJN A;  2YUO A;  2HSP A;  3UWN A;  3CMA A;  4ME7 A;  1K9M R;  4BY6 C;  1RAF B;  4NS5 A;  2FHD A;  5LJ3 f;  1ABO A;  5IXF A;  4E7H A;  1WX6 A;  1R8O B;  2F2X A;  2OAU A;  2HMA A;  4JRK A;  4M7A A;  2J6K A;  1I81 A;  3OMC A;  1VQP T;  4XU0 A;  3CCV A;  2AZV A;  4KGZ B;  3FLG A;  3A8H B;  1Q86 U;  1WLP B;  2CH4 A;  1KQS A;  1YJW T;  2KXD A;  3M53 A;  2RNA A;  5KYW A;  1VQ6 Q;  3QXE B;  5D7U A;  4DBF A;  4PJO C;  3QHS A;  4LE9 A;  4A53 A;  2YUN A;  3JB9 H;  4CC3 A;  1IHV A;  5DLO A;  1UHC A;  1VQ8 Q;  3OYM A;  1PRL C;  3GLX A;  1M30 A;  4N4G A;  4NL2 A;  3HFO A;  2ZPB B;  3QDF A;  1K9M U;  3J80 E;  1ZSZ B;  5FWB A;  1M90 U;  1VQ9 A;  3CCR A;  2OTL Q;  1KD1 C;  1PSF A;  4A4E A;  4K11 A;  4OMP A;  4JJD A;  2V8K A;  4XTW A;  3OYL A;  2HQH A;  1YIJ A;  2BTT A;  1M2V B;  3Q1J A;  3V7C A;  2K5F A;  3OMG A;  3G71 A;  1QCN A;  1YHQ T;  1S72 Q;  1WHL A;  4RTY A;  3OYD A;  1PCX A;  2JXB A;  5C6S A;  4M78 A;  4HT9 A;  5HK3 A;  2YUP A;  5GAN e;  2ZPH B;  4ZGE B;  1YWO A;  1JRI A;  3CBP A;  3EGD B;  2M1H A;  4KUD K;  5KYU B;  2E70 A;  2VV5 A;  1LJO A;  1WYX A;  2QQA A;  1G2B A;  4NL3 A;  1K1Z A;  1ACM B;  4C8Q D;  3DKM A;  2L3R A;  3REB B;  2FG0 A;  1RAD B;  3OSS C;  5IHN A;  4IKF A;  1SHG A;  1SKU B;  2B86 A;  2BZX A;  5GAM e;  2C0O A;  5D6Y A;  2GQI A;  3M0R A;  2DL8 A;  3JAM E;  2HDA A;  3EFS A;  1WHK A;  1JXM A;  3OYN A;  2ROT A;  2W10 A;  2XG8 D;  2DM1 A;  2K2V A;  2KAF A;  4HCK A;  4M75 A;  4LD6 A;  4J9B A;  3EG2 A;  3CC4 T;  2DTH A;  2M51 A;  2DYI A;  4BAC A;  4IUV A;  2XHC A;  1HSQ A;  4UC4 A;  2BUD A;  2DO3 A;  2PVO B;  3GOX A;  1OOT A;  3EFR A;  1K0X A;  3QZ9 B;  2CP5 A;  1BKB A;  2LP5 A;  4XTY A;  1EX4 A;  1Y71 A;  2JS2 A;  2DYB A;  4OML A;  2P4R A;  3NTK A;  1D0X A;  2YLB A;  4PL6 A;  4XU3 A;  3JCM e;  1VQ4 T;  4DBH A;  4C8Q F;  4QVZ A;  1BYM A;  1BIA A;  3G4S A;  4J83 A;  5IAY A;  2YUQ A;  5CAI A;  2CP0 A;  1VQK T;  2FL7 A;  3FJP A;  1M8V A;  1X01 A;  4M7A B;  1N8R C;  3LX7 A;  2AIR B;  4LDW A;  1M9S A;  4QKU A;  1MNE A;  3QJY A;  4E47 A;  1C1A A;  3VS0 A;  1KQS S;  2CUB A;  3M4Y A;  5GJW B;  5CKD A;  1VQ8 A;  1M3A A;  4HXJ A;  2P84 A;  5KYW B;  4FM4 B;  4RCB A;  2G3R A;  1BK2 A;  1N5Z A;  2YDL A;  5M9O A;  4Z88 A;  2EYQ A;  2A28 A;  2OTL A;  2KMT A;  4B9X A;  2E10 A;  2EYX A;  2DJQ A;  1YJ9 Q;  5LJ5 f;  2CT3 A;  1MND A;  3ER0 A;  3UDC A;  1H3H A;  3G6E T;  4J9E A;  2V1R A;  4FSX A;  2DL7 A;  2JMC A;  3M0Q A;  1JXO A;  4A63 B;  4EIK A;  2DF6 A;  2D0Q B;  2EBP A;  4P5N A;  1UEB A;  3KBG A;  2VC8 A;  5GMK i;  2L8D A;  1UHF A;  1XTD A;  4C92 E;  3QKJ A;  1BU1 A;  4BB7 A;  2JM8 A;  1UG1 A;  2EYW A;  1H3Z A;  5CQX A;  1KSW A;  1QVF A;  2HBP A;  4C92 A;  3E19 A;  3PNW C;  1G3W A;  3M59 A;  4AG2 C;  2QQ9 A;  1RI9 A;  4M78 B;  5HK0 A;  4J6X A;  2VB6 A;  4XU2 A;  3MHX A;  4F16 A;  1VQ5 T;  4EMG A;  2FZC B;  4M7D D;  1B07 A;  2QA4 T;  2EGA A;  1AVZ C;  2H3J A;  1OQK A;  3CEY A;  2MOX A;  1K8A U;  2NUP A;  1JB0 E;  3EH1 A;  1NE8 A;  2KRM A;  4C8Q G;  4LUE A;  5FW9 A;  1NEG A;  2NUZ A;  4MML A;  3R6O A;  1W70 A;  5KCH A;  4CI0 C;  4OP0 A;  1RAG B;  4KBM B;  5LJ3 g;  3C0C A;  4AMC A;  1VQL T;  4M75 B;  4FW2 A;  1G8X A;  1RAB B;  1WHH A;  3URG A;  2OX7 A;  1D0Y A;  4AFU C;  3OYH A;  3M0S A;  2DIG A;  2RO0 A;  1V1C A;  3I55 T;  1BCO A;  4F17 A;  1Q7Y R;  4PJO E;  2VVK A;  3HP9 A;  2RQR A;  3RKX A;  4QT7 A;  5CR2 A;  5LJ3 d;  2RJF A;  5IHI A;  4FYY B;  4IUU A;  4E6R A;  4C0G A;  1E6G A;  5A0L A;  1ZQ1 A;  1FWZ A;  1QCO A;  5CIU A;  5FU7 B;  3X26 B;  2DNU A;  1T0H A;  1I0C A;  4DOV A;  2YHT A;  3MPU B;  1JJ2 A;  3JCM P;  4JRQ A;  1VQ7 Q;  2E65 A;  1BI3 A;  4Q5W A;  2RH2 A;  5GMK h;  2M16 A;  2CSQ A;  3MP1 A;  2O88 A;  2RA2 A;  1XQH A;  5IH2 A;  2XDP A;  2E4H A;  5KH6 A;  3HRT A;  3WVD B;  3CCJ T;  3CCL T;  4M77 E;  4Z8A A;  1YWP A;  2DK3 A;  2O2O A;  5ECA A;  3EHR A;  1VQP Q;  3A1P A;  2LDM A;  1WQ7 A;  4LDX A;  3PGG A;  4J8O A;  4JRP A;  2BZY A;  2PVD B;  2LQN A;  2RM4 A;  3H9N A;  5L8R E;  1YJW Q;  4M77 A;  1WJS A;  3JRZ A;  5CKB A;  1SRL A;  4BE0 A;  4O6J A;  5FLX E;  5CVI A;  2DMO A;  4Y28 E;  4ZN3 A;  2EKO A;  3A98 A;  2QK0 A;  1IZ6 A;  3OB9 A;  1PRM C;  2DVJ A;  1YI2 A;  5GAN 6;  4LUD A;  2X3X D;  2GFA A;  1W6X A;  1QVF S;  2DA9 A;  2RPN A;  3L2Z A;  4C92 B;  1W2B A;  1PKT A;  3EGX A;  1SHF A;  1K0S A;  2J6F A;  4IIM A;  1Y07 A;  2F5T X;  2E3H A;  1KJW A;  2VUB A;  2JMA A;  1Q82 R;  3UA7 A;  1YHQ Q;  2WAC A;  1NYG A;  3X20 B;  3RER A;  4PLL A;  2MAM A;  3M54 A;  4KT0 E;  3LGL A;  1VA7 A;  4C5H A;  4M7D G;  1OU8 A;  2IIM A;  5A0G A;  2EIF A;  2RQT A;  3E9F A;  3JCM V;  2NUP B;  4OB2 B;  5FRO A;  2DL5 A;  1JBM A;  3ASK A;  1MMN A;  4J7I A;  3FEO A;  3L2V A;  2EAY A;  2LRQ A;  2R58 A;  3EAE A;  2JNG A;  3A8M B;  1TSF A;  3NHN A;  1GCQ C;  2EJG A;  2DL3 A;  1ABQ A;  2E12 A;  1ARK A;  4N0A A;  1X75 C;  4ZTF A;  5I11 A;  4C5I A;  1JU5 C;  2EGC A;  3E2U A;  2JN0 A;  2YRV A;  3OW2 P;  4X1V A;  3LW5 E;  5LJ3 h;  4JS5 A;  1ZBJ A;  1I5O B;  1X2K A;  2XMF A;  2KYB A;  3HHT B;  3OBY A;  2EJF A;  1AHJ B;  1H8K A;  4FT2 A;  2EWN A;  3C12 A;  1YP5 A;  3CC2 T;  2ZZD A;  1TUC A;  1VQ7 A;  1M27 C;  4ZN1 A;  1SEM A;  2JS0 A;  3UT1 A;  5GAN g;  2YLC A;  2GGR A;  3EG0 A;  3TRE A;  2AZS A;  1XOV A;  4LN2 A;  1JJ2 S;  1AWX A;  2MIO A;  1WIE A;  3PE0 A;  3MET A;  4M7A D;  3H0I A;  2LCL A;  5GAN 8;  4JUV A;  2O01 E;  1RAA B;  4CC2 A;  1GRI A;  1VQ4 Q;  3M9Q A;  1VQP A;  1AZE A;  5LJ5 d;  3IQL A;  5LL6 S;  2EQM A;  4RTW A;  1VQK Q;  1YJW A;  2DIQ A;  3JB9 D;  4C8Q C;  4RMO A;  2GF7 A;  1WXT A;  3BDL A;  2CZ6 B;  2P4T A;  2E5K A;  4M77 B;  2A36 A;  2WSF E;  2K7A A;  1RAH B;  3UF4 A;  1M8M A;  3PMT A;  3CCM T;  1J3T A;  3JV3 A;  3CCQ T;  1BIB A;  2EJ9 A;  1KQ1 A;  1KK7 A;  2NYS A;  2YT6 A;  2RK2 A;  2MWO A;  5EG2 A;  4PJL A;  4BI4 A;  4EMK A;  2M9U A;  4BDZ A;  2XU8 A;  1WZO A;  3UAT A;  4KUI A;  3PT9 A;  3S3M A;  3G6E Q;  1G5V A;  1WHJ A;  3CXC P;  2DZ9 A;  5FRM A;  1W2B S;  5CKF A;  1Q86 R;  4AG1 C;  4M7A F;  3S6W A;  2CGH A;  1UUE A;  4M78 D;  3QZ5 B;  3EGX B;  2EQJ A;  2OAW A;  2COW A;  1NYF A;  1N9S A;  3JCM g;  3FC3 A;  4PFP A;  3HTR A;  3BW1 A;  4QVC A;  2DBM A;  1FMK A;  3RIR A;  1X2Q A;  2F5K A;  4IUP A;  2LCS A;  4XQ3 A;  1VQN A;  3JB9 F;  4QQ6 A;  3X28 B;  1WFW A;  1P92 A;  4J6Y A;  4CRI A;  4D8D A;  1HJD A;  1M90 R;  2ED0 A;  4E7L A;  4F7U F;  1S1N A;  2O4X A;  2EW3 A;  3EGU A;  1MUZ A;  1VQ5 Q;  2BIV A;  2DRK A;  4R0K A;  2EQI A;  1X6G A;  4DQ2 A;  2K9G A;  3CPW A;  2J05 A;  2CP3 A;  1PHT A;  2QA4 Q;  8AT1 B;  2E41 A;  2CP6 A;  3EG9 A;  4M75 D;  1QCF A;  4WTO B;  1Q7Y C;  2HZY A;  1SF9 A;  2KRN A;  4BD3 A;  3V8K A;  2RJE A;  2AK5 A;  2HL3 A;  4M78 F;  1YIT A;  1D09 B;  3NMZ C;  3R6N A;  3OS0 A;  5I22 A;  4BDY A;  1VQL Q;  4F7U E;  4LDU A;  1K9A A;  3JCM Q;  2FZK B;  1UGV A;  1VIF A;  3SD4 A;  3LGF A;  1QP2 A;  1I07 A;  1WHM A;  6AT1 B;  5I2S A;  2E6N A;  2DLP A;  3I55 Q;  1TXQ A;  3KXT A;  3GNG A;  2D8H A;  3HRU A;  2GTJ A;  1VQ4 A;  4Z02 A;  4C0D B;  1MV3 A;  2DD5 A;  2WSC E;  2QXF A;  1QWE A;  1NJI C;  5LJ5 h;  1UGR B;  4OB0 B;  4M7A G;  2Y90 A;  4M7D C;  1SRM A;  4M75 F;  3VYG A;  2FO0 A;  2X4W A;  2MWP A;  5HKC A;  2JM9 A;  4DEX A;  3L2U A;  3HPW A;  4HVU A;  1EFN A;  1MMA A;  2PU9 B;  1ZA2 B;  4LXC A;  4OB3 B;  4ZGJ B;  2QEX A;  2KVQ G;  4QVD A;  5J3B A;  1Q81 C;  1KG1 A;  2IVW A;  3JB9 G;  4PK4 A;  1BI2 A;  5L23 A;  4F04 B;  4RG8 A;  4F7U G;  1YJN T;  3CMA T;  2LTO A;  3SHW A;  5GAO l;  3CCJ Q;  3CCL Q;  3LYI A;  2EGE A;  2RQW A;  3VUB A;  4B6M A;  1CKA A;  2K5I A;  2FB7 A;  3RKY A;  4XAX B;  4EMK B;  1IGQ A;  2GTO A;  3VUZ A;  1OX8 A;  3CCV T;  3ULR B;  2YWW A;  3MCA B;  5AYF A;  2GBQ A;  3UA6 A;  3M0U A;  3P8H A;  3EHQ A;  1U5S A;  2V26 A;  1Q82 C;  2BE9 B;  4LNP A;  5GAO q;  4JJC A;  5CKE A;  4M78 G;  3TEE A;  3DLM A;  1MGQ A;  3REA B;  1GFD A;  2KNB B;  4MDX A;  5HCK A;  3VV0 A;  2O31 A;  2JTM A;  1LCK A;  5GAO r;  5GJV B;  3S3N A;  2O4X B;  4HVW A;  2ZPF B;  2CSI A;  4AT1 B;  2X35 A;  1UEC A;  3CCE T;  1VQ6 A;  1UJ0 A;  1NBE B;  4Y91 A;  1D1A A;  1WJR A;  2BZ8 A;  1KQS P;  1PC0 A;  1I5L A;  1B3Q A;  2E1H A;  1RAI B;  2EYY A;  4PNO A;  3GBQ A;  2A7Y A;  3EG9 B;  1VIE A;  2IPO B;  4J7F A;  2E3I A;  3QG1 A;  2COY A;  1ZSG A;  4A54 A;  1RLP C;  3WVE B;  4M75 G;  5FU6 B;  2DBK A;  3L2W A;  1VQL A;  4RTU A;  1C0M A;  3HRS A;  4JJB A;  1T0J A;  1ZSZ C;  1M4Z A;  3OYG A;  3SWN A;  2KT1 A;  2RI2 A;  1GFC A;  1VUB A;  5GAN f;  1CSK A;  4C8Q E;  3I55 A;  2YRC A;  3V7S A;  3LH0 A;  2GNC A;  2VGM A;  2O9S A;  5GMK j;  3TQ7 P;  1JQQ A;  4MMK A;  1K8A R;  1M1K R;  1S72 A;  2C06 A;  2DZC A;  4IIO A;  5GMK l;  3MP8 A;  4F14 A;  2H8H A;  4FSS A;  2F2V A;  4R55 A;  2CP7 A;  4BUG A;  3VRY A;  1UGQ B;  1K73 R;  2JT4 A;  2RHI A;  4ESR A;  5GAM f;  3HSB A;  3OYF A;  4A4G A;  3CC2 Q;  2A0F B;  2K3B A;  2P0Q A;  2QQB A;  4X34 A;  2LC4 A;  2D9T A;  3HKS A;  4IUR A;  1W4S A;  1OX9 A;  4VUB A;  3A8G B;  1N27 A;  1NLP C;  1M1K U;  4L5G A;  4RTT A;  1GBR A;  3GF5 A;  1HK9 A;  1QW1 A;  3QJ6 A;  4FT4 A;  4II1 A;  3O8V A;  1K73 U;  3FRN A;  1RUW A;  3G4S T;  1M2O A;  3RBB B;  2LZ6 B;  2MK5 A;  1QQJ A;  2ZGW A;  1Q86 C;  2JVV A;  3A8L B;  3RES A;  3UPU A;  3JCM f;  3FIF A;  3PVQ A;  1BBZ A;  2KXC A;  2MF2 A;  5FWC A;  4JZ3 A;  1X6B A;  1KC8 U;  2DTO A;  7AT1 B;  3QUI A;  1OEB A;  4FU6 A;  2R57 A;  3CCM Q;  1D3B A;  3CCQ Q;  2KDS A;  2B8A A;  3EH2 A;  2HD0 A;  4ZGD B;  5GAN 7;  1K9M C;  1IO6 A;  4E7I A;  1M90 C;  4HT8 A;  4M7D F;  2ROL A;  1RAE B;  4PJO A;  2X4Y A;  5IT9 E;  1JO8 A;  5C0M A;  2ZAE A;  1UGP B;  1PSE A;  3E1S A;  2LJ0 A;  4WF2 A;  1QVG A;  3RDV A;  2G6F X;  1RLQ C;  1G3T A;  4M7A C; 
#chains in the Genus database with same CATH homology
 4N0A C;  4A53 A;  3OBY A;  2EJF A;  4LDY A;  1AHJ B;  2BKD N;  3RKW A;  3X25 B;  3JB9 H;  3OS5 A;  4FT2 A;  5D6W A;  2QDY B;  2EWN A;  4C92 F;  3C12 A;  5DLO A;  3CC2 T;  1YCY A;  2LVM A;  5CO7 A;  1U1T A;  2R5M A;  3OYI A;  2ZZD A;  5LJ3 j;  3OYM A;  3JSC A;  1VQ7 A;  2DXU A;  4ZN1 A;  3GLX A;  4N4G A;  3UT1 A;  3KUF A;  4EMK A;  5GAN g;  4MZM A;  3GNF B;  3HFO A;  1UGS B;  2YLC A;  2ZPB B;  4NL2 A;  1K9M U;  3TRE A;  1FXX A;  2RI3 A;  3MEV A;  3J80 E;  2XI9 A;  1XOV A;  2VYT A;  3X24 B;  3JCM X;  1YJ9 A;  1M90 U;  1JJ2 S;  5GAN 3;  1VQ9 A;  2Y4X A;  3CCR A;  2QEX T;  4JRI A;  1KD1 C;  2I2L A;  1PSF A;  2Y4Y A;  3RUX A;  4A4E A;  1B34 B;  3MET A;  2DPP B;  5GMK e;  4HA8 A;  3OYA A;  2LCL A;  3PTA A;  2LNV A;  3PIO A;  4M7D E;  4PJO D;  2V8K A;  5GAN 8;  4JUV A;  4XTW A;  3T9N A;  4C8Q A;  2O01 E;  3OYL A;  2MI6 A;  1YIJ A;  4V2S A;  3V7C A;  2QTX A;  3Q1J A;  2K5F A;  1OYX A;  1I8F A;  1HXD A;  3OMG A;  3M9Q A;  4XTX A;  3RMQ A;  3SWN B;  2HNI A;  4A4F A;  4QQG A;  4C0D C;  5LJ5 d;  1VQP A;  5LL6 S;  2EQM A;  3P8B B;  1YHQ T;  1U8R A;  3GP8 A;  3JCM c;  4RCC A;  5CKH A;  1YJW A;  2CYZ B;  2DIQ A;  3JB9 D;  1KG1 A;  4C8Q C;  4RMO A;  5GAO p;  2GF7 A;  3OYD A;  5C6S A;  4O5V A;  4HT9 A;  1V29 B;  4M78 A;  4RG2 A;  2PUK B;  5HK3 A;  2DVE A;  5DM7 R;  3BDL A;  5GAN e;  2ZPH B;  2K3X A;  1G3S A;  2VGN A;  3BDU A;  3OSV A;  2CZ6 B;  4J5Y A;  3QSU A;  2EQU A;  2P4T A;  4ZGE B;  1JRI A;  4XU1 A;  1MHN A;  2K57 A;  3CBP A;  3OYE A;  3CC2 A;  2M1H A;  4KUD K;  3C4S A;  4DA4 A;  4MZT A;  3J7A F;  2E70 A;  4M77 B;  3INZ A;  5KE3 A;  2WSF E;  1KD1 U;  2VV5 A;  2X4J A;  4M78 C;  3ME9 A;  4MZP A;  1LJO A;  2CZ0 B;  3PMT A;  1WNL A;  3CCM T;  2QQA A;  4MDW A;  4NL3 A;  3I56 T;  3CCJ A;  3CCQ T;  1BIB A;  2EJ9 A;  2OTJ T;  1Y96 B;  3CCL A;  4A4K A;  1KQ1 A;  2QQR A;  5EG2 A;  3QPH A;  2GFU A;  2MWO A;  2RK2 A;  1WGS A;  1WJQ A;  2L3R A;  2M9U A;  2ZPG B;  3DKM A;  4BI4 A;  2XU8 A;  4BDZ A;  4KUI A;  3OSS C;  2F69 A;  4JS4 A;  3PT9 A;  3OS1 A;  4M77 D;  3S3M A;  4IKF A;  1G5V A;  2DZ9 A;  5GAM e;  3OYB A;  1LOJ A;  2CKK A;  5D6Y A;  5FRM A;  1W2B S;  5CKF A;  3JAM E;  3NTI A;  3BY7 A;  3EFS A;  1RL2 A;  4EMK C;  4PJO F;  4M7A F;  3QII A;  2CGH A;  3S6W A;  4M78 D;  2LQ8 A;  3OYN A;  1G3Y A;  3QZ5 B;  2XG8 D;  2K2V A;  2KAF A;  3TCJ A;  2EQJ A;  4M75 A;  4LD6 A;  1N9S A;  5I2M A;  3JCM g;  3FC3 A;  1VQ6 T;  3E9G A;  3LLR A;  3CC4 T;  3DB3 A;  2DTH A;  3BW1 A;  5GAN 2;  4QVC A;  3M5A A;  5A0D A;  2RHY A;  4BAC A;  4IUV A;  2XHC A;  4PKC C;  1N9R A;  3RIR A;  3ZFJ A;  2F5K A;  3C94 A;  3M56 A;  1RI0 A;  4IUP A;  4UC4 A;  2BUD A;  2DO3 A;  2PVO B;  3M57 A;  4XQ3 A;  5I21 A;  1VQ8 T;  1VQN A;  2DXT A;  4QQ6 A;  3X28 B;  3JB9 F;  5KCO A;  1BI0 A;  5KE2 A;  3L1A A;  4M75 C;  1P92 A;  1Q81 U;  4J6Y A;  3GOX A;  4CRI A;  4HCB A;  2QI2 A;  3EFR A;  3HFN A;  2CS7 A;  4E7L A;  4C92 G;  3QZ9 B;  2R5A A;  4F7U F;  1BKB A;  4C5G A;  2O4X A;  4XTY A;  3FDR A;  3I56 A;  1Y71 A;  2BIV A;  2OTL T;  4BY6 B;  2OTJ A;  4DQ2 A;  3CCU A;  1OZ3 A;  3CPW A;  2L5Q A;  3NTK A;  2K4Y A;  5DY9 A;  3JB9 J;  2YLB A;  2AHJ B;  4PL6 A;  4XU3 A;  2L89 A;  3JCM J;  4N4H A;  3JCM e;  1NPP A;  3QHS A;  1VQ4 T;  2E41 A;  3MEW A;  2JOY A;  1D3B B;  4QVZ A;  4C8Q F;  5J39 A;  4M75 D;  1BYM A;  1BIA A;  3G4S A;  4J83 A;  5IAY A;  1GXI E;  2E6Z A;  5CAI A;  3OW2 A;  1S72 T;  1VQK T;  5FRN A;  2FL7 A;  4M77 F;  3FJP A;  1Q7Y C;  1M8V A;  3H6Z A;  1X01 A;  2X4X A;  2XD0 A;  4BD3 A;  4M7A B;  1N8R C;  3V8K A;  3LX7 A;  4RKU E;  5CQY A;  4LDW A;  1M9S A;  5FU7 C;  4JLG A;  4PJO B;  2RJE A;  3QJY A;  4E47 A;  3SFM A;  3ZEH A;  1QVG S;  1KQS S;  4M78 F;  3QBY A;  2XDD A;  5LJ3 e;  1YIT A;  2FYK A;  3M4Y A;  5CKD A;  1VQ8 A;  3OS0 A;  4BDY A;  5FU6 C;  2CZ1 B;  3VYH B;  2D6F A;  4F7U E;  4LDU A;  1M1G A;  4OB1 B;  3JCM Q;  5GAN 4;  3NFC A;  4FM4 B;  4RCB A;  2G3R A;  3MEA A;  4XTZ A;  1YI2 T;  1VIF A;  4JDS A;  4C8Q D;  3SD4 A;  1M1F A;  3LGF A;  1QP2 A;  5M9O A;  5D6X A;  2EYQ A;  4X9D A;  2RHX A;  2KMT A;  3A8O B;  4B9X A;  2E10 A;  2E6N A;  5I2S A;  2OTL A;  2JTF A;  4EPC A;  5LJ5 f;  4HKE A;  3KXT A;  2NLU A;  4ELZ C;  3GNG A;  3ER0 A;  3UDC A;  3G6E T;  4FSX A;  2P0P A;  1VQM A;  1Q7Y U;  3HRU A;  3JCM b;  4DOW A;  5GAN d;  4M7D A;  3JB9 I;  4C5E A;  2K5L A;  3MP6 A;  1BI1 A;  1VQ4 A;  3L2Q A;  4Z02 A;  4QW2 A;  2D0Q B;  4C0D B;  5GAM g;  1N8R U;  4P5N A;  2DD5 A;  1UEB A;  2WSC E;  3KBG A;  2VC8 A;  5GMK i;  2QXF A;  3CME T;  2XDB A;  2L8D A;  2DKG A;  5J26 A;  1XTD A;  2ZPI B;  2RHZ A;  4C92 E;  1NJI C;  2FVU A;  4NOY A;  1QP3 A;  5LJ5 h;  1UGR B;  3QKJ A;  4C8Q B;  4OB0 B;  4BB7 A;  4M7A G;  2Y90 A;  4PJO G;  4M7D C;  1NPR A;  2XK0 A;  4M75 F;  3OYJ A;  4JLI A;  1H3Z A;  3VYG A;  2X4W A;  5CQX A;  3V7R A;  2MWP A;  1WPY A;  4EMH A;  5HKC A;  1QVF A;  2HBP A;  4C92 A;  4JJN K;  3L2R A;  3E19 A;  5LJ5 j;  3L2U A;  3PNW C;  3H8Z A;  1Y7X A;  1G3W A;  1KHC A;  2PU9 B;  3HPW A;  3M59 A;  3NTH A;  2QQ9 A;  4ZGJ B;  5GAM d;  4OB3 B;  4OMF B;  3LWH A;  2KVQ G;  4M78 B;  4N4I A;  4J6X A;  5J3B A;  2IVW A;  4QVD A;  5HK0 A;  2QEX A;  1Q81 C;  4XU2 A;  3G71 A;  3JB9 G;  1KHI A;  3MHX A;  1BI2 A;  2RD1 A;  1VQ5 T;  2VXF A;  3MO8 A;  4X9C A;  4C92 C;  4M7A D;  4LD9 K;  4EMG A;  4RG8 A;  4F7U G;  1YJN T;  2DXB A;  2RHU A;  4ELY C;  3CMA T;  3CXC A;  2LTO A;  5GAO l;  2QA4 T;  4A4H A;  2ZCF B;  1ZHI A;  3LYI A;  1YHQ A;  3PMI A;  2H3J A;  1NJI U;  3CEY A;  4BE2 A;  3VUB A;  4C0Z A;  2P0K A;  2JZ2 A;  1K8A U;  2K5I A;  5CK9 A;  1JB0 E;  2FB7 A;  4XAX B;  3RKY A;  3VU3 C;  3BFM A;  4EMK B;  1NE8 A;  3VUZ A;  3CME A;  3S3O A;  3CCV T;  3V8L A;  3C95 A;  1N6A A;  5HY6 A;  3MCA B;  3PFS A;  4TVR A;  5AYF A;  4C8Q G;  4D6W A;  3P8H A;  3CD6 T;  2QQS A;  2HQE A;  4MML A;  4M77 G;  1Q82 C;  3R6O A;  1NZ9 A;  4BI8 B;  5KCH A;  4EDU A;  4CI0 C;  4OP0 A;  1UB4 A;  5GAO q;  3CCM A;  4KBM B;  5LJ3 g;  1VQL T;  1X6O A;  4M75 B;  2XIC A;  5CKE A;  3V8J A;  3ZBD A;  3N5B B;  3CCQ A;  4M78 G;  3TEE A;  3DLM A;  1MGQ A;  1LNX A;  3URG A;  4FL6 A;  2GCX A;  3JCM d;  3CBO A;  3RMS A;  2XKO C;  4MDX A;  3OYH A;  3OY9 A;  2EQK A;  3VV0 A;  3P8D A;  2LT4 A;  2DIG A;  2RO0 A;  3I55 T;  1YJ9 T;  3DB4 A;  3GPL A;  4M7A E;  2JTM A;  4PJO E;  2KQW A;  3VJP A;  2ZPE B;  3HP9 A;  4QQD A;  5GAO r;  3J81 E;  3S3N A;  3RKX A;  1I4K 1;  2O4X B;  2HAX A;  5CR2 A;  2ZPF B;  2VXE A;  5LJ3 d;  1VQP T;  2RJF A;  2RJC A;  2X35 A;  2WSE E;  3QO3 A;  1H64 1;  4IUU A;  4C0G A;  2DEQ A;  1Q82 U;  4B9W A;  3CC7 T;  3CCE T;  3CC4 A;  1VQ6 A;  3M4G A;  5A0L A;  1ZBX A;  3M55 A;  1ZQ1 A;  4Y91 A;  3VKI A;  1WJR A;  1FWZ A;  4LDV A;  4FIB A;  2K3Y A;  1I5L A;  2MMP A;  2E1H A;  4PNO A;  3CCS T;  5CIU A;  2GQV A;  2A7Y A;  4GLK A;  3OW2 S;  5FU7 B;  3X26 B;  4BE1 A;  3CD6 A;  2KY9 A;  1VIE A;  4DOV A;  4J7F A;  2RJD A;  2YHT A;  5GAO m;  3QG1 A;  5DLQ E;  1JJ2 A;  4A54 A;  3JCM P;  1B34 A;  4JRQ A;  3WVE B;  4M75 G;  2E65 A;  4L59 A;  5FU6 B;  1WQW A;  5A2Q E;  3L2W A;  1VQL A;  1BI3 A;  3HRS A;  4Q5W A;  2E5Q A;  1TH7 A;  2RH2 A;  5GMK h;  2M16 A;  1M5Q 1;  5LJ5 g;  1M4Z A;  4F7U A;  3OYG A;  3SWN A;  3MP1 A;  2RI2 A;  1VUB A;  2RA2 A;  1XQH A;  5GAN f;  1U1S A;  2XDP A;  5GAO n;  4PLI A;  4C8Q E;  1VQO T;  5KH6 A;  4XK8 E;  3I55 A;  3HRT A;  2RI5 A;  2PUO B;  3V7S A;  3OYY A;  3LH0 A;  3WVD B;  3CCJ T;  3GIB A;  2VGM A;  3CCL T;  3DLL A;  5GMK j;  1VQM T;  4M77 E;  4MMK A;  4E7J A;  2DK3 A;  2DXC A;  4OF1 A;  1S72 A;  2C06 A;  1VQK A;  3SWN C;  3OA6 A;  5GAN 5;  2LDM A;  2DZC A;  1WQ7 A;  4LDX A;  2EFI A;  3PGG A;  4J8O A;  4JRP A;  3CCE A;  3QYH B;  1K8A C;  5GMK l;  3MP8 A;  2PVD B;  3SDZ A;  1M1K C;  3CC7 A;  2RM4 A;  2CZ7 B;  4M78 E;  5GAN h;  5L8R E;  4M77 A;  2KSS A;  4R55 A;  1IRE B;  1WJS A;  3MEU A;  4IUT A;  3WXM B;  4BUG A;  3JRZ A;  5CKB A;  1UGQ B;  2XID A;  4BE0 A;  4O6J A;  4M7D B;  2JUF A;  2RHI A;  3HL8 A;  5FLX E;  5CVI A;  2V8J A;  3CCS A;  4Y28 E;  4ZN3 A;  5GAM f;  3HSB A;  2EKO A;  1QVP A;  5LJ5 e;  1Y96 A;  3OYF A;  4A4G A;  4XTV A;  5GAN j;  1IZ6 A;  2DJZ A;  1K73 C;  3OB9 A;  2DTI A;  4M77 C;  3OYC A;  5GAN 6;  2P0Q A;  1YI2 A;  2QQB A;  3OQ5 A;  4E7K A;  4X34 A;  2LC4 A;  1VQN T;  2GFA A;  2D9T A;  1QVF S;  3CCU T;  2V8I A;  3HKS A;  4OGE A;  3G6E A;  4IUR A;  1KC8 C;  5GAM h;  1W4S A;  3L2Z A;  4C92 B;  1W2B A;  4IUQ A;  1VQO A;  4VUB A;  1O9S A;  4ATO A;  1EIF A;  3A8G B;  2M0O A;  1N27 A;  1M1K U;  1Y07 A;  2F5T X;  4L5G A;  2KK4 A;  2VUB A;  4C0F A;  2RK1 A;  2IG0 A;  1O75 A;  3GF5 A;  1XNI A;  1SSF A;  5GAM j;  3CXC S;  2LX9 A;  1HK9 A;  4R56 A;  1QW1 A;  3QJ6 A;  2PQW A;  4FT4 A;  4M75 E;  2WAC A;  2PVG B;  4HCC A;  3X20 B;  4C92 D;  3RER A;  3QYG B;  4II1 A;  4PLL A;  3O8V A;  2MAM A;  1K73 U;  3FRN A;  3G4S T;  3M54 A;  4BI3 A;  4KT0 E;  3LGL A;  3OS2 A;  3PIP A;  1OZ2 A;  4C5H A;  4M7D G;  4OGC A;  2A3L A;  3JCM W;  2ZGW A;  2LQK A;  1KQ2 A;  5IN1 A;  5A0G A;  2EIF A;  3SB2 A;  4XTU A;  1Q86 C;  2JVV A;  3A8L B;  3E9F A;  3JCM V;  3AHU A;  3RES A;  3UPU A;  2DD4 A;  3JCM f;  3FIF A;  3CPF A;  4GY5 A;  4OB2 B;  5FRO A;  3QDR B;  3TU4 K;  2MF2 A;  1JBM A;  1VQ7 T;  3ASK A;  1OI1 A;  1KC8 U;  2DTO A;  3FB9 A;  4HCZ A;  4J7I A;  3FEO A;  3L2V A;  2EAY A;  4J6W A;  4F7U B;  1YIT T;  1VQ5 A;  4KUL A;  3QUI A;  4YTL A;  4FU6 A;  5CCA A;  3LWI A;  2R57 A;  1VQ9 T;  1YJN A;  2LRQ A;  3L42 A;  3OBW A;  3UWN A;  5GMK m;  1D3B A;  4ME7 A;  3CMA A;  3CCR T;  2QA4 A;  4BY6 C;  2KDS A;  2R58 A;  3EAE A;  2B8A A;  2JNG A;  2E64 A;  2FHD A;  2HQX A;  3A8M B;  3M58 A;  4NS5 A;  5LJ3 f;  2EJG A;  3JCM h;  2HD0 A;  4ZGD B;  5GAN 7;  3OYK A;  3CPW S;  4ZTJ A;  1K9M C;  4E7H A;  4E7I A;  1M90 C;  1R8O B;  4HT8 A;  2OAU A;  4M7D D;  4M7D F;  4JRK A;  3CBM A;  1YIJ T;  4M7A A;  4PJO A;  2X4Y A;  5IT9 E;  1YBY A;  2E12 A;  3G71 T;  1I81 A;  3OMC A;  4N0A A;  1X75 C;  4L6V 5;  4XU0 A;  5C0M A;  3CCV A;  4ZTF A;  1DJ7 B;  4C5I A;  3F70 A;  2RB6 A;  1UGP B;  1PSE A;  2LT1 A;  3E1S A;  3A8H B;  3FLG A;  3A5Z B;  1Q86 U;  2DAQ A;  2JN0 A;  2YRV A;  4WF2 A;  1QVG A;  1KQS A;  1YJW T;  2LCC A;  3M53 A;  3LW5 E;  5LJ3 h;  4JS5 A;  1G3T A;  4OVA A;  3QXE B;  4M7A C;  4PJO C;  3HHT B;  1FX7 A;  3G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...