2XK0A

Solution structure of the tudor domain from drosophila polycomblike (pcl)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
b'GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYCOMB PROTEIN PCL
publication title Structure of an Atypical Tudor Domain in the Drosophila Polycomblike Protein
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xk0A00
3UWNA 3E9FA 3GOXA 1OYXA 5CIUA 1WJSA 4NS5A 4A4HA 3OYAA 2DAQA 3LGFA 3P8DA 4C5HA 3OA6A 5FRNA 4QVZA 3M9QA 3FC3A 1MHNA 3MP6A 3OYIA 3OY9A 2GF7A 3ME9A 2YRVA 3MP8A 2IG0A 3C4SA 2QQSA 2E6NA 2X35A 4C5GA 5M9OA 4BE0A 2EKOA 2WACA 4X34A 2MWPA 4C5EA 3OMCA 3E9GA 4E7IA 3S3OA 3OYDA 5D6WA 3MO8A 3FLGA 4B9WA 3MEWA 3MEVA 2MWOA 2R5MA 5IAYA 2DIQA 3OQ5A 4PL6A 1G5VA 3KUFA 5KE2A 2K3XA 2XDPA 2E5QA 4IUTA 1WGSA 1OI1A 2F5KA 2X4XA 4N4GA 2RJDA 3OYJA 3PFSA 3NTIA 3S6WA 2R58A 5KH6A 3S3MA 4BACA 3NTHA 1OZ3A 4QQ6A 4QQGA 2GFAA 2EFIA 2D9TA 3LX7A 4ZTFA 3META 2R5AA 4A4GA 4N4IA 4Z02A 4IUQA 4QW2A 2RI3A 4A4FA 3LLRA 3PMIA 4PLLA 4Q5WA 3ZEHA 4RG2A 2LVMA 2HQEA 3OB9A 1KHCA 5J39A 3ASKA 3F70A 4BDYA 4OVAA 2RJEA 3OS1A 3LYIA 3L2QA 1XNIA 4B9XA 4C5IA 3L2RA 3H8ZA 3LGLA 2RJFA 3QKJA 2M16A 4IUVA 5KCHA 3DLMA 5C0MA 3QJ6A 3OYMA 2M0OA 4IKFA 2PQWA 4IURA 5J26A 3SD4A 5D6YA 4FL6A 2RHIA 2LDMA 1N27A 3H6ZA 3O8VA 3DB3A 1OZ2A 1WJRA 2JZ2A 4E7KA 3OYEA 2B8AA 3QIIA 2RI2A 3QBYA 2X4YA 3OYKA 2RJCA 3MEAA 3Q1JA 4PLIA 2QQRA 4IUUA 4LD6A 2RHUA 3MP1A 3FEOA 4BE2A 1WJQA 3OYFA 3OYLA 2RHYA 4QQDA 2NLUA 2P0KA 2M1HA 2FHDA 2EQUA 1H3ZA 2RI5A 4IUPA 4A4EA 3OYHA 3DB4A 5FROA 2L3RA 2LTOA 2O4XA 4CRIA 2L8DA 3L2WA 4BE1A 5KE3A 2RHXA 2RO0A 3L2VA 1RI0A 4L59A 3P8HA 4E7HA 2GFUA 2EQKA 3LH0A 3OS0A 2EQMA 3MEUA 2R57A 3OYGA 3OYBA 5FRMA 3NTKA 3OMGA 4N4HA 3OYNA 3PNWC 4UC4A 3OS2A 2VYTA 2BKDN 3CEYA 4BDZA 2L89A 3L42A 2K3YA 2O4XB 3OYCA 2XK0A 2RHZA 4ZTJA 4BD3A 3PMTA 2DIGA 4FU6A 2EQJA 2CKKA 5KCOA 3L2UA 2X4WA 5D6XA 5IN1A 4HCZA 4E7JA 4EDUA 4E7LA 3S3NA 1SSFA 2G3RA 3BDLA 2BUDA 5C6SA 3EAEA 4II1A 2HQXA 2JTFA 4GY5A 3UT1A 2BIVA 2LCCA 3FDRA 2LRQA
chains in the Genus database with same CATH superfamily
3P8BB 4RTZA 4OMFB 3VS3A 3CXCS 1PM3A 3CC7Q 1QVPA 2DETA 4XTYA 2EGEA 3M9QA 2EAYA 3VS5A 1K9MU 1O75A 3EG2A 1H641 1QWEA 2WACA 3CMEQ 1PHTA 3GBQA 3HFNA 1BKBA 2XICA 2RNAA 1KC8R 3KUFA 4O5VA 3PVLA 1TXQA 3RBBB 3NGPA 1VQPT 1FX7A 3M54A 2FL7A 3VU3C 1YIJT 2NUPA 1VQ4A 3TSZA 2MMPA 3OW2P 2MYSA 4C92G 3LLRA 2CZ0B 3CCQQ 4OGEA 1UJ0A 3RKWA 3LYIA 4B9XA 2L2PA 5IHKA 2NUPB 2H3EB 2ZAEA 3LWIA 2LT4A 2GQVA 3CCRA 3CMAQ 4D6WA 4M7DF 1VQ4Q 2NWMA 1W4SA 5IT9E 5KYNA 3KBGA 3ER0A 4JRQA 2EYYA 2YLCA 1WDXA 2HBWA 2DVJA 1C6VX 3OYFA 2M51A 1PRMC 1UB4A 2ED0A 1H3ZA 3PT9A 3M58A 1PRLC 3P8HA 2K5IA 3OYBA 1K4US 2JS2A 1VQKT 2K3YA 3LWHA 1MUZA 5CR2A 1BYMA 1QVGA 2DZCA 1VQPA 3SWNA 1CKBA 3JB9D 3HHTB 2KYBA 2LCCA 3FDRA 1NEGA 3E9FA 4LUEA 3OBYA 4NS5A 2DAQA 4C5HA 2LQWA 2MCNA 2JOYA 3SWNB 1ZX6A 3OY9A 1NJIC 3CCMT 3DLLA 3EG1A 3HRTA 1VQPQ 4Z88A 2O9VA 1M9SA 4M7AF 2HEQA 5A0GA 2RQWA 4RG8A 1YIJQ 2DIQA 1ABOA 2VGNA 1AWJA 2M02A 5HK0A 2CP2A 2XDPA 3M0UA 1N8RR 4M77F 1VQ6A 2LCLA 4F17A 1U1SA 4BACA 1ZA2B 4XTWA 1RADB 3AT1B 4RTVA 1Q82R 2CSQA 2DA9A 3INZA 2YUPA 4CC2A 3PMIA 2A7YA 3QPHA 3UDCA 2HD0A 3L2RA 2A28A 1VQ6Q 2F1LA 3D7SB 4K11A 4JS4A 1N5ZA 5CK9A 2B8AA 3QIIA 3I55A 1JJ2P 1M3BA 5GAOn 1M1KC 3CC4A 1K73U 1TS9A 1WX6A 1WQ7A 1UJYA 3EGXA 2V1RA 4R0KA 1QVGP 3SDZA 3A1PA 3LW5E 1VQ8A 1SEMA 2GFUA 4LN2A 3HKSA 3LH0A 1S72A 3FRNA 1JEGA 3JCMe 3M53A 3JCMc 4GBQA 2BKDN 2ATCB 2G6FX 3O5ZA 2L89A 3EGXB 2FO0A 1JXOA 3X25B 3I56T 4JRKA 4J5YA 2EQJA 3MPUB 2JTEA 1C1AA 2D8HA 3S3NA 1VQ8Q 3G4SA 1JXMA 1UHCA 4LDWA 2DKGA 1YJNT 4B6MA 4A63B 4CI0C 3G71T 4E6RA 2D8JA 4M75G 2E65A 2H3JA 3LGFA 4F7UE 4PNOA 2F5TX 1D3BB 1A0NB 3TVTA 3G4SQ 1JQQA 4E7IA 5A2QE 1AD5A 3FLGA 4AFUC 4M7DG 1Y71A 2FZCB 2EYZA 4J7IA 4J9GA 3X26B 5DLQE 2EKHA 3RR6A 4QQ6A 3VRZA 2O9SA 2QEXT 1T0HA 1NPPA 1TUGB 2KT8A 4AFSC 4A53A 2OTLT 2L3QA 1QCFA 2O01E 3CBPA 2YUOA 3ASKA 5LJ3e 1YHQT 5KYXA 3OS1A 3MKDA 4NOYA 2JM9A 4RTXA 5CKHA 2Y4XA 3QKJA 4IUVA 2X9HA 2YWWA 3SD4A 2J06A 3CXCP 4OF1A 1SRLA 1YWPA 5KYXB 1U1TA 2C06A 1MV0B 1VQLA 2KXDA 2E10A 3URGA 3V7CA 3HPWA 1SF9A 2EQUA 2GTJA 3M55A 2DJZA 3I56Q 2BE9B 2PVOB 4NL3A 3L2VA 2KGTA 4L59A 4E7HA 3C0CA 2R57A 3H9NA 4JZ4A 2A37A 1VQLQ 3A98A 1G83A 4HT9A 1VQOA 3M4YA 1YJNQ 4R55A 2JNGA 2W10A 3HSBA 4M7AG 1I5LA 4FYWB 4ZTJA 2HBPA 5I2SA 4JDSA 3KXTA 2MPXC 1M90R 1VQNT 3EHRA 3EGUA 4M77G 4LDYA 2G3RA 3RKYA 2D1XA 2YRCA 4XTXA 5LJ5j 2FPEA 3CC2A 2L3SA 1TUCA 3MP6A 3GF5A 4FYVB 6AT1B 4J6XA 2DL8A 1XTDA 2QTXA 3GP8A 2O88A 2EKOA 2XHCA 4M7DC 2IIMA 4XU2A 3QSUA 4ESRA 3M0PA 4QKUA 1KSWA 2V8KA 2QEXQ 5GMKe 4TVRA 3BW1A 4J9HA 1X43A 2CUBA 2DL7A 2CP0A 4KGXB 2F2XA 5GMKi 2OTLQ 4N4GA 2DXUA 2E41A 3S6WA 1YHQQ 4OB2B 1IHVA 1NG2A 1WHKA 4ELZC 2NUTA 1VQMA 4PJLA 2RI3A 3V8LA 2EW3A 1UFFA 5GANe 1IO6A 2QTVA 5FWCA 4HCKA 1K9MC 2FYKA 2JTMA 3CCVT 2NUTB 4FSXA 1YITT 2KDSA 2FPDA 2KRNA 4LDUA 1AWWA 1K76A 1UGPB 1OPLA 2MK5A 1VQMQ 3VS7A 3REAB 1RACB 1TH7A 3TREA 1D1CA 2SRCA 4O6JA 4E7SA 3CCJA 3I5RA 5FROA 2LTOA 5DY9A 4AG2C 1TU0B 4MZPA 5CO7A 4RTUA 1N9RA 4M7AC 2I0NA 4PK4A 1Y96A 1VQNQ 3OYNA 2JUFA 1VQ7T 4M77C 3UA6A 1ABQA 1SKUB 1K8AR 4C92F 1GBRA 2F69A 1Q7YR 4BI3A 4VUBA 3J81E 5CIUA 4DOWA 3ULRB 4PJJA 4M78F 5GAN2 4M7DD 3TU4K 4X9DA 2F2VA 4J8OA 2EVRA 3QHSA 4M7DA 2E6NA 2QDLA 4EIKA 2E4HA 3JB9H 2FRWA 2XDBA 1M1KR 3E9GA 2HSPA 2KMTA 1M3CA 2RMOA 3EHQA 4C92E 2ZPBB 1NPRA 4FM4B 2QA4A 1FMWA 1ZA1B 3CCEA 2RPNA 4M7DB 3WVDB 1X27A 1UGVA 4DQ2A 3JCMV 2KVQG 2LX9A 2AT1B 4JRIA 1YITQ 1TG0A 2K3BA 3UPUA 1GCPA 1G2BA 3G7ZA 4OMPA 2B86A 2QA4Q 3FB9A 3CCEQ 1QVFA 2KI7A 2EWNA 4RTWA 1E6HA 3CMET 1QW1A 2K9GA 1UECA 4BY6C 3OYEA 3QBYA 1I8FA 1D0ZA 2K57A 2LQKA 3CBOA 2HCKA 1R8OB 1YFNA 1D0YA 2XU8A 4A4KA 1M1GA 3HRUA 2IVWA 1VQ7Q 4M7AD 4KUIA 5HK3A 1NLPC 4M7AA 2HKNA 4OP0A 1KIKA 4M77D 5GMKm 4N4HA 5CAIA 5GAN6 1ZHIA 4PJNA 4M77A 2ZPHB 2XK0A 3A8GB 4M7AB 3VS2A 3H41A 5KCOA 3RMQA 1Z9ZA 1JRIA 2BUDA 1UHFA 5C6SA 3IQLA 1VQ4T 1K73C 4M77B 2BIVA 2ZCFB 3WXMB 2QASA 1U3OA 3QYHB 3V7RA 1OYXA 4LE9A 3FC3A 1IXDA 1OPKA 1ZSGA 4DEYA 3C94A 2HL3A 2PUKB 1B07A 4JZ3A 1KC8U 1WLPB 3CCRT 1PSFA 4LDVA 4BB7A 1TTHB 4PL6A 1G5VA 5KE2A 4IUTA 2X4XA 4Z8AA 2Y90A 4C0ZA 3S3MA 2YRDA 1ZUKA 5LJ5d 1YCSB 2HZYA 4LDXA 5IH2A 2E3HA 2RF0A 4C0DC 1UEBA 2KNBB 3A5ZB 2RQRA 4KH0B 4F7UA 1CSKA 3PIPA 3HP9A 2ESWA 4FW1A 5I2MA 2KSSA 1M30A 1M27C 1X69A 1Q86R 1I81A 4AG1C 3QJ6A 4HA8A 1UTIA 1KD1U 2PQWA 2LDMA 4F7UB 1LJOA 1N27A 2OX7A 4DBHA 1YWOA 1GL5A 4MZTA 2V8IA 1G3TA 2HDAA 1YI2A 1YN8A 4M75F 3RUXA 1BB9A 1RL2A 1VIEA 4BY6B 2PVGB 1H92A 2ABLA 1RLPC 4M78G 5FLXE 1WPYA 3QUIA 1BU1A 1RAIB 5FRMA 3CD6A 4PFZA 1YI2Q 5HCKA 4KUDK 1H8KA 4RMOA 1MMAA 2HSEB 4M75E 3OYCA 2DIGA 1VQ6T 1KQSA 4WF2A 1FYNA 1BI3A 2ZPGB 2FG0A 3EAEA 1KFZA 2X4JA 3UT1A 1PNJA 3BE3A 3CCRQ 1OV3A 1RAAB 4C0FA 3M4GA 2K5FA 4A4HA 1AHJB 4M7DE 3OA6A 1PWTA 1FMVA 2YXYA 5FRNA 2GCXA 1AZGB 1PD1A 2HKQB 5LJ5g 3VJPA 2ZZDA 1W1FA 1QLYA 1D1BA 5M9OA 2WSFE 2DFUA 5LL6S 2A0FB 1Y57A 1N8RU 2ZPFB 3JB9I 4BI8B 1NYFA 3GLXA 3I55T 4E47A 1C0MA 4EMGA 2XIDA 4Z89A 2ECZA 2RM4A 1Q82U 1B34A 3CC4T 1BBZA 2MF2A 1D09B 3H0HA 1M5Q1 2DX1A 2GFAA 2EFIA 1VQ8T 4QW2A 1S72T 4PKCC 1B34B 3QDFA 4DOVA 1KHCA 1EX4A 1JU5C 4YTLA 1Q81U 2EJ9A 5KCHA 4C0DB 3G4ST 4C92C 2C0TA 1D1AA 4WCIA 3PE0A 2AK5A 4C0GA 1QP2A 2M9UA 4IUUA 4M78C 1PCXA 1AVZC 3CBMA 3QJYA 4M7AE 4X1VA 1ZSZC 2RI5A 3CCLT 3DB4A 4HVUA 2L3RA 1DJ7B 3CQTA 3QWYA 2EQMA 1LPLA 4M77E 3RKXA 1VQ5A 2XD0A 2GQIA 2LMJA 2V1QA 1WHLA 5I22A 2NYSA 2YT6A 4LD9K 2CKKA 3JCMJ 3PVQA 4MDWA 4XK8E 4FSSA 4RUGA 2P4TA 3C12A 4F16A 4J83A 3VV0A 4FIBA 2DE0X 3PIOA 3X20B 5GAOr 3I55Q 2F2WA 5ECAA 1GXIE 3CC4Q 2COYA 3KFVA 1YJ9A 5GAMj 2GTOA 3GIBA 2DM1A 3MEVA 2PNIA 4JJDA 1VQLT 1PD0A 3OQ5A 1S72Q 2JMAA 2OTJA 1D3BA 2E5QA 1J3TA 2JN0A 2K2VA 1E7OA 2KT1A 3G6EA 5DM7R 1O9SA 9ATCB 1OZ3A 2DBMA 3M57A 2VVKA 3CCLA 2EIFA 3OB9A 3VYGA 1V29B 4ZGDB 3EFSA 1BI2A 1VQOT 4BDYA 2OTJQ 2L0AA 4C92D 1K73R 4FT2A 5C0MA 5CQYA 5J26A 8ATCB 4C92A 2OAUA 1I5OB 2O31A 4M78D 3CCLQ 3VS1A 4OMLA 3MEAA 4M78A 2QQRA 3NFCA 3VS0A 3CC2T 1VYVA 1M4ZA 2LJ1A 1AEYA 3OYLA 4C92B 1ZSZA 1OEBA 2EGCA 4J9CA 2DJQA 3V7SA 4BE1A 1QCNA 4ATOA 4M78B 4JLGA 1LVKA 3HTRA 2P4RA 1PKTA 1ZSZB 2PUOB 3VYHB 1M90U 1BCOA 2E12A 3QWXX 4HKEA 4PJOF 2MI6A 4DBQA 3EH1A 4BD3A 3PMTA 1ZUUA 4DBRA 2X4WA 2K2MA 4KRTA 3FJ5A 4J9IA 1MNDA 1VQMT 1K9AA 4XU0A 1JO8A 2LRQA 2P84A 1QVFS 1GFDA 2SEMA 3OYAA 3BFMA 2QI2A 3P8DA 4HCBA 2RK2A 3A8MB 4QVZA 1HSQA 1X2QA 3GPLA 2GF7A 1IB8A 3VS4A 2BZ8A 2DNUA 2ROTA 2K79A 5IHIA 1VYUA 3C95A 5EG2A 3M0QA 5GAMf 3M5AA 3OYDA 3JB9F 2KYMA 1K0SA 1VQ9A 1IHWA 2MWOA 1WZOA 4M75C 3I35A 4PFPA 1MMNA 2ED1A 3ZBDA 1OI1A 2RJDA 3CCJT 2J7IA 1VQOQ 2PZ1A 3JV3A 3NTHA 1NZ9A 3H0IA 1BK2A 3META 1VQ9Q 4OMNA 1P92A 2HQEA 1KC8C 4DBFA 1BIBA 5IXFA 3LH5A 3X28B 1RAGB 4C8QF 2HAXA 3CC2Q 4LNPA 1AWXA 2M0OA 1GFCA 3BDUA 1YJWA 2YLBA 1GBQA 1WYXA 2QG9B 2HL5C 4E7KA 2A3LA 1WXTA 2RJCA 3Q1JA 3JCMX 2FVUA 2RHUA 5LJ3j 2QGFB 3UF4A 3M59A 4J9DA 4BE2A 3MHXA 4QQDA 3JCMb 2RA2A 4MDXA 4OMQA 2O4XA 2LJ0A 3SEMA 2L8DA 3QXEB 4CRIA 2LT1A 1KJWA 2A08A 2GBQA 2RO0A 1R0BG 1YJWQ 1ZQ1A 2I2LA 3OSSC 2CZ7B 2BZYA 1YCYA 1KD1C 4ME7A 3OBWA 3CEYA 2QA4T 1MV3A 2O4XB 3CCET 5LJ5h 1NJIR 1OULA 2E1HA 4XQ3A 1FWZA 3QZ9B 4J6WA 5D6XA 1Q7YU 2BE7D 5GJVB 2QXFA 2C0IA 2RB6A 2Z0WA 1NBEB 1SG5A 5GAN4 1OU8A 2FRYA 1EFNA 1RLQC 2BTTA 4JJCA 4J6YA 4PFOA 1M2OA 2E70A 1OQKA 1N9SA 4BUGA 3CCUA 3UATA 4C5GA 1IRXA 4M75D 4RCCA 3CCJQ 4C5EA 3OMCA 3JCMQ 3S3OA 2YDLA 4M75A 2RK1A 3RDVA 1WHMA 2DYBA 1R0CB 5LJ5f 2D6FA 3FIFA 3CCUQ 2PU9B 4M75B 2KRSA 4AFZC 2D0QB 2RQUA 4A4GA 4IUQA 5AT1B 3CPWA 4FYXB 3ZEHA 4ZNXA 3R6OA 2CREA 1KQSS 2M16A 2DBKA 4Y28E 1N8RC 5GAMd 3NHNA 5D6YA 1FXXA 4PJOG 2MIOA 2VB6A 1WI7A 4M78E 2DILA 1Q82C 3H6ZA 1VUBA 3RMSA 2H8HA 8AT1B 4JJNK 3A8HB 5GANj 3RESA 2ENMA 2CH4A 2P0KA 2CS7A 2JT4A 3UA7A 3OYHA 2FB7A 2GGRA 1VIFA 2DPPB 3QG1A 2WSEE 3OS0A 1Q81C 3ZL7C 3JCMP 2X3XD 1R77A 2VYTA 1PSEA 2HNIA 3E1SA 1UGQB 5I11A 1XOVA 3JB9G 2EYXA 1G3WA 3CCSA 3L2UA 4E7JA 2J05A 1KG1A 1RI9A 4XU3A 1Z9QA 5IXBA 2RQTA 4OGCA 3VKIA 2JTFA 5J3BA 2DMOA 2FZKB 3JRZA 1EIFA 4ZGJB 2V8JA 2XI9A 2DTHA 3ME9A 4BE0A 2X35A 2E64A 1BIAA 4X34A 1U06A 1BI0A 1LCKA 4C8QG 3RIRA 1AOJA 4DA4A 2DRKA 1YI2T 1GCQC 3PTAA 5GAMg 1WHGA 1M2VA 3MCAB 3AHUA 1CKAA 1UUEA 3PFSA 3OW2A 1M8VA 1ZUYA 2M0YA 3RERA 3JSCA 3JCMd 4J9EA 2YSQA 2R5AA 1TSFA 1SHGA 3RNJA 2DEUA 2LNVA 1WIEA 1Q86U 1M2VB 3CD6T 4RG2A 5J39A 4ZGEB 2KRMA 2DEQA 3CPFA 2LNHB 1N6AA 4PJOC 3L2QA 1TOVA 2EJGA 1MGQA 3M0TA 4MZMA 5CKBA 3OYMA 5CVIA 1T0JA 1QVFP 2RHIA 2EGAA 4E7ZA 2DZ9A 3O8VA 3CC7A 2LCSA 3REBB 4XTUA 3OYKA 4PLIA 2W0ZA 3JCMW 3MP1A 3N5BB 2RHYA 1X6BA 3VRYA 1UDLA 1HK9A 3L2WA 3QDRB 1M3AA 2VXEA 5KE3A 4WTOB 2OI3A 3E19A 2CP3A 1V76A 3ZFJA 1RAFB 1IREB 5HY6A 3PGGA 1WHHA 4EDUA 3CCQA 1SSFA 4FT4A 2DD5A 5LJ3d 1H3HA 1NEBA 3VUZA 2K7AA 3UWNA 3GOXA 4RTTA 3TSWA 4JJBA 3CMAA 1MHNA 3JCMg 4C8QC 1W6XA 1X6GA 3C4SA 2AKLA 1HD3A 2L5QA 1M90C 2QGGA 3DKMA 4XTVA 3MO8A 1GCQA 2HQHA 3MEWA 4J9BA 3V8KA 2VGMA 1K9MR 3VUBA 1WQWA 2ZGWA 1RAHB 2JM8A 4FCYA 3CD6Q 4XAXB 1WGSA 2K5LA 4XU1A 5KH6A 5KYWA 1KD1R 2CH4W 2AZSA 4PJOD 1QP3A 2QQ9A 3HFOA 2VUBA 1VQ5T 5CKDA 2K6DA 2LVMA 4PJOA 5KYWB 4C5IA 2RJFA 1G3YA 2CP6A 2DXBA 1RABB 1JJ2A 4PJOB 3DB3A 4CC4B 1WJRA 2JZ2A 2BZXA 2RI2A 2YUQA 3EG0A 3HRSA 1YP5A 1HJDA 4N0AC 1QCOA 5I21A 1JBMA 4F04B 1ZLMA 4Y91A 2LJ3A 5GAMe 4A4EA 2CSIA 4OMOA 5LJ3g 1I1JA 5A0LA 1YIJA 1YJ9T 5GAOq 3J7AF 2K4YA 1T3SA 4UC4A 2J6OA 3GNFB 2IPOB 4ZN3A 2KROA 1EZZB 2DD4A 2OTJT 4ANJA 1WHJA 3G6ET 4GLKA 1WXUA 5GANd 1F1BB 2FEIA 4II1A 1KQSP 1T3LA 4C8QD 3NMZC 2CZ1B 1LOJA 4PJMA 4A54A 5GAN7 2WSCE 4P5NA 2EBPA 2KBTA 4C8QA 2QYZA 1U8RA 5GAN3 3OYIA 1KK7A 3BY7A 3MP8A 3NPFA 4ZN1A 2IG0A 2QK0A 4LXCA 1ZBXA 1K8AC 2JXBA 5KYUA 4QVCA 2CUDA 2OAWA 4C8QB 3SFMA 2R5MA 5IAYA 1Q7YC 1VQKA 4KGZB 2JS0A 4AMCA 5GMKl 1VQ5Q 3M0SA 4JUVA 1MMGA 5KYYA 4EMHA 1Q81R 5CCAA 2DERA 3QO3A 1QKWA 4F14A 1QMCA 5KYUB 1SSHA 1U5SA 4Z02A 4EPCA 5L23A 3OYYA 1KHIA 1YBYA 5KYYB 5AYFA 1VQKQ 4IIMA 2P0PA 5GAOl 3CXCA 1XJWB 2ROLA 3CCMA 2C0OA 1B3QA 1VYTA 2E6ZA 4BI4A 3M56A 4ORZA 3GNGA 1AZEA 1MMDA 3EFRA 2PTKA 4F7UF 4AT1B 1YJ9Q 1IGQA 4N0AA 2LZ6B 2VV5A 3MJXA 2XKOC 2QDYB 1YNZA 1TUDA 2NLUA 2M1HA 5GANg 5CKFA 3CCMQ 3U23A 3G6EQ 4HT8A 1UG1A 4RCBA 3R6NA 2YHTA 3OMGA 2LQNA 1WNLA 5LJ5e 1VQ9T 4HCCA 1Y07A 2QQAA 2A36A 3H0FA 5GAOp 4CC3A 4D8DA 2RD1A 3TEEA 4MMLA 4CC7A 1SHFA 3CPWS 3BDLA 4KULA 4EMKC 2E5KA 5GAMh 1QWFA 4GLMA 4V2SA 1KQ1A 3EG9A 2Y4YA 2DVEA 2JMCA 2P0QA 1QQJA 4Y92A 1UGRB 2KE9A 1OX9A 1UGSB 1YJWT 3SHWA 2RH2A 2VXFA 3EG3A 5D6WA 4B9WA 4DEXA 2CT4A 3EG9B 2FPFA 5L8RE 3M0RA 4FW2A 1K0XA 1HYOA 2FZGB 3EH2A 3I56A 2F5KA 1BI1A 2COWA 2MAMA 2R58A 2RN8A 1W2BS 1X6OA 2EQIA 4N4IA 4PJOE 3SB2A 2DL5A 2NUZA 1YJNA 2XG8D 2CGHA 4Q5WA 2DLPA 3G71A 1E6GA 3F70A 2RJEA 1PKSA 3LGLA 2X51A 2LC4A 1WXBA 2DTIA 2KR3A 1M1FA 1IZ6A 3G71Q 1D0XA 1ZBJA 4LUDA 2JW4A 2LP5A 3OSVA 2HMAA 1Q86C 1ACMB 3CCUT 2VWFA 2RHXA 5FU6C 1RI0A 4J7FA 2QEXA 3I5SA 4R56A 2XDDA 2EYQA 3NTKA 2OTLA 1NJIU 4KBMB 1NM7A 4JLIA 4E2FB 1NE8A 2COZA 3G1JA 1YHQA 3JCMh 1NYGA 3OW2S 1PG5B 4JRPA 5IN1A 2ZPIB 3EGDA 2KY9A 2AIRB 4E7LA 2OJ2A 1G3SA 4OB3B 4A4FA 7AT1B 2CP7A 4EMKA 4C8QE 2AHJB 3HL8A 1WJSA 3A8OB 1X01A 3EGDB 4KGVB 3QYGB 1SPKA 2KAFA 4KH1B 4EMKB 1K8AU 1QKXA 4L5GA 1NLOC 4AFQC 1OOTA 5IHNA 2JJ9A 1I4K1 2K3XA 4JS5A 4F7UG 4HVWA 3JCMf 3THKA 4MMKA 2DYIA 3NTIA 2VASA 4M4ZA 1RAEB 1VQNA 2CZ6B 5GAN5 1M1KU 2EJFA 4ZTFA 2CT3A 3X24B 4PLLA 4HXJA 5HKCA 4ELYC 1XNIA 2DTOA 3DLMA 5LJ3h 1WA7A 4X9CA 3TCJA 1HXDA 1VA7A 2AZVA 3CCST 1AWOA 4FL6A 4OB0B 2KEAA 1OZ2A 2CP5A 2PVDB 5FWBA 2X4YA 3VS6A 2QQBA 4XTZA 5FU7C 1OU9A 2CDTA 1Y96B 1PC0A 1WJQA 3E2UA 2FHDA 5CKEA 5GMKj 4J9FA 4IUPA 3WVEB 1UE9A 2RQVA 1W70A 2LQ8A 2GNCA 2EQKA 5FW9A 1TWBA 3OYGA 1WFWA 3OS2A 1G8XA 4RTYA 4BDZA 3L42A 5FU6B 3CCVA 1YITA 5LJ3f 2CYZB 4HCZA 2DF6A 3L1AA 1X2KA 1V1CA 2DXCA 2EPDA 3JB9J 2AKKA 1JB0E 1OX8A 1AT1B 1W2BA 2LX7A 1GRIA 2JVVA 2VC8A 2D0NA 3CCVQ 1M8MA 1Y0MA 1I0CA 3JAME 2ZPEB 2O2OA 3QZ5B 4NL2A 2KXCA 1VOMA 2YRVA 1JJ2S 2QQSA 5CQXA 1MNEA 2MWPA 2QAZA 2L3PA 3I9QA 3A8LB 3CC7T 2J6FA 3TQ7P 1QVGS 2V26A 1KQ2A 2DXTA 1VQ7A 2KQWA 4JPBW 1Y7XA 4HVVA 5GJWB 5GMKh 3OYJA 3OS5A 2MOXA 1RUWA 2DK3A 1IGUA 4QQGA 1I07A 2D9TA 3LX7A 4IIOA 4OB1B 3CCSQ 1X75C 2VKNA 4OMMA 2E3IA 2DL4A 1ARKA 1SRMA 1BCMA 3V8JA 3L2ZA 4OVAA 3CPWP 5GANh 3H8ZA 2X3WD 5DLOA 1K1ZA 5D7UA 4IKFA 1B7TA 4IURA 4RKUE 3CCQT 4KT0E 2XMFA 1FMKA 1XQHA 2EYWA 4LD6A 3EFOA 3FEOA 2YUNA 3T9NA 3CMAT 4D8KA 3FJPA 1S1NA 4QT7A 5GAOm 2DO3A 5FU7B 4L6V5 3EFOB 3MEUA 1LNXA 5GAN8 2KK4A 3PNWC 1W2BP 4FYYB 3J80E 5A0DA 1Q95G 2RHZA 2J6KA 5GANf 4FU6A 2DRMA 4QVDA 5EC7A 3CMEA 3SWNC 2HQXA 2DL3A 4GY5A
chains in the Genus database with same CATH topology
4C8QD 3P8BB 2CZ1B 4VUBA 4BI3A 3J81E 1LOJA 1QVFS 4A54A 4OMFB 5GAN7 5CIUA 3CXCS 2WSCE 4P5NA 4DOWA 3OYAA 1QVPA 3BFMA 4M78F 5GAN2 4M7DD 2QI2A 3P8DA 4XTYA 4HCBA 2RK2A 3A8MB 4QVZA 4C8QA 3M9QA 3TU4K 1U8RA 4X9DA 3GPLA 5GAN3 3OYIA 2GF7A 3BY7A 2EAYA 4J8OA 3MP8A 4ZN1A 2IG0A 3QHSA 4M7DA 2E6NA 1K9MU 1O75A 3JB9H 1H641 2WACA 2XDBA 3E9GA 3C95A 5EG2A 1ZBXA 2KMTA 3HFNA 5GAMf 1K8AC 3M5AA 3OYDA 3JB9F 4QVCA 1VQ9A 1BKBA 2XICA 3SFMA 2MWOA 2R5MA 4C8QB 4M75C 2ZPBB 1NPRA 4C92E 5IAYA 1Q7YC 1VQKA 4FM4B 2QA4A 5GMKl 3KUFA 3CCEA 4O5VA 4M7DB 4JUVA 3WVDB 3ZBDA 1OI1A 4EMHA 2RJDA 5CCAA 3CCJT 1VQPT 4DQ2A 3JCMV 3QO3A 2KVQG 2LX9A 1FX7A 3M54A 3NTHA 2FL7A 1NZ9A 4JRIA 3VU3C 1YIJT 1VQ4A 3META 2MMPA 4Z02A 4EPCA 3OYYA 3UPUA 4C92G 1KHIA 3LLRA 1YBYA 2CZ0B 1P92A 3G7ZA 2HQEA 5AYFA 3FB9A 4OGEA 1KC8C 3RKWA 1BIBA 1QVFA 2P0PA 3LYIA 5GAOl 4B9XA 3CXCA 3X28B 4C8QF 2HAXA 3CCMA 2M0OA 3LWIA 3BDUA 2E6ZA 2LT4A 4BI4A 2GQVA 2EWNA 3M56A 3CCRA 4D6WA 4M7DF 1YJWA 3GNGA 3CMET 2YLBA 1QW1A 1W4SA 3EFRA 5IT9E 4F7UF 3KBGA 3ER0A 4BY6C 2A3LA 3OYEA 4JRQA 4E7KA 3QBYA 1I8FA 4N0AA 2VV5A 2YLCA 2K57A 2RJCA 3Q1JA 2LQKA 3JCMX 2FVUA 2RHUA 3CBOA 5LJ3j 2XKOC 1R8OB 2QDYB 3M59A 2XU8A 4BE2A 4A4KA 1M1GA 3MHXA 3OYFA 4QQDA 3JCMb 3HRUA 2IVWA 2NLUA 2M1HA 2RA2A 4M7AD 4MDXA 1UB4A 4KUIA 5HK3A 5GANg 1H3ZA 5CKFA 3PT9A 2O4XA 3M58A 4CRIA 2L8DA 3QXEB 2LT1A 2RO0A 1ZQ1A 2I2LA 3P8HA 4M7AA 3OSSC 2CZ7B 4OP0A 4M77D 5GMKm 4HT8A 4RCBA 2K5IA 3OYBA 2YHTA 3OMGA 4N4HA 1WNLA 5CAIA 1YCYA 1ZHIA 5GAN6 5LJ5e 1VQ9T 1KD1C 4HCCA 1Y07A 3OBWA 4ME7A 2QQAA 3CEYA 1VQKT 2QA4T 4M77A 2K3YA 3LWHA 2O4XB 5GAOp 3CCET 2ZPHB 5LJ5h 2XK0A 2RD1A 3A8GB 5CR2A 4M7AB 1BYMA 2E1HA 3TEEA 4XQ3A 1FWZA 4MMLA 5KCOA 1QVGA 3QZ9B 4J6WA 5D6XA 1Q7YU 2DZCA 2QXFA 3CPWS 3RMQA 1VQPA 3SWNA 3JB9D 2RB6A 3HHTB 3BDLA 1JRIA 2BUDA 5C6SA 1VQ4T 1K73C 4M77B 2BIVA 2LCCA 3FDRA 5GAN4 2ZCFB 4KULA 3WXMB 3E9FA 4EMKC 3OBYA 5GAMh 3QYHB 3V7RA 1OYXA 4J6YA 4NS5A 2E70A 2DAQA 4C5HA 4V2SA 2JOYA 3FC3A 1KQ1A 3SWNB 2Y4YA 3OY9A 1N9SA 2DVEA 2P0QA 4BUGA 3CCUA 3C94A 2PUKB 3DLLA 3CCMT 4C5GA 1NJIC 1UGRB 4M75D 3HRTA 1KC8U 4RCCA 3CCRT 1PSFA 4C5EA 1UGSB 3OMCA 1YJWT 4LDVA 3JCMQ 4BB7A 2RH2A 3S3OA 1M9SA 2VXFA 5D6WA 4M7AF 4B9WA 5A0GA 4M75A 4RG8A 2RK1A 2DIQA 2VGNA 5L8RE 5HK0A 4PL6A 1G5VA 5KE2A 2XDPA 3I56A 4IUTA 4M77F 2F5KA 5LJ5f 2X4XA 1VQ6A 2D6FA 1BI1A 2R58A 2LCLA 2MAMA 2Y90A 1U1SA 3FIFA 4C0ZA 4BACA 3S3MA 1W2BS 4XTWA 2PU9B 4M75B 5LJ5d 1X6OA 4LDXA 2D0QB 4A4GA 4N4IA 4PJOE 4IUQA 3SB2A 3INZA 3CPWA 1YJNA 3PMIA 2XG8D 2CGHA 4Q5WA 4C0DC 3ZEHA 2A7YA 1UEBA 3A5ZB 4F7UA 3G71A 3PIPA 3F70A 3QPHA 3HP9A 3R6OA 3UDCA 2RJEA 2HD0A 5I2MA 3L2RA 1KQSS 2KSSA 3LGLA 2M16A 4Y28E 2LC4A 1I81A 5GAMd 3QJ6A 4HA8A 2DTIA 1N8RC 1KD1U 2PQWA 5D6YA 1FXXA 4PJOG 2LDMA 4F7UB 1LJOA 1N27A 4M78E 1M1FA 1Q82C 4JS4A 3H6ZA 4MZTA 2V8IA 1VUBA 5CK9A 1G3TA 1IZ6A 2B8AA 3QIIA 3I55A 1YI2A 3RMSA 4JJNK 3A8HB 5GANj 4M75F 3RUXA 3RESA 5GAOn 1M1KC 3CC4A 1K73U 1RL2A 1WQ7A 1VIEA 2P0KA 2CS7A 3OSVA 3OYHA 1Q86C 4BY6B 2FB7A 2PVGB 3CCUT 4M78G 3SDZA 3LW5E 5FLXE 1WPYA 2RHXA 5FU6C 1VIFA 1VQ8A 1RI0A 2DPPB 4J7FA 3QG1A 2GFUA 2WSEE 3HKSA 3LH0A 3QUIA 3OS0A 2QEXA 3FRNA 3JCMP 4R56A 1S72A 1Q81C 5FRMA 2XDDA 2EYQA 3M53A 3NTKA 3JCMe 1NJIU 2OTLA 3JCMc 3CD6A 4KBMB 4KUDK 4JLIA 2VYTA 1PSEA 2BKDN 1NE8A 2HNIA 4RMOA 2L89A 1YHQA 3E1SA 1UGQB 1XOVA 3JCMh 3JB9G 3OW2S 4M75E 3OYCA 3X25B 3I56T 4JRKA 2DIGA 4J5YA 2EQJA 1VQ6T 1G3WA 4JRPA 3CCSA 3L2UA 5IN1A 4E7JA 1KQSA 1KG1A 2ZPIB 4WF2A 2KY9A 4XU3A 1BI3A 4E7LA 3S3NA 3G4SA 1G3SA 2ZPGB 4OGCA 3EAEA 3VKIA 2JTFA 2X4JA 2DKGA 4LDWA 4OB3B 5J3BA 3UT1A 4A4FA 4EMKA 4C8QE 1YJNT 2AHJB 4C0FA 4CI0C 3HL8A 3M4GA 3G71T 2K5FA 4M75G 1WJSA 2E65A 3A8OB 4A4HA 1AHJB 2H3JA 3JRZA 3LGFA 1X01A 1EIFA 4ZGJB 3OA6A 5FRNA 2V8JA 4M7DE 2GCXA 4F7UE 2XI9A 5LJ5g 3QYGB 2DTHA 3VJPA 2ZZDA 3ME9A 4PNOA 2F5TX 4BE0A 2KAFA 1D3BB 2X35A 2WSFE 2E64A 5M9OA 1BIAA 4EMKB 1K8AU 4X34A 5LL6S 4L5GA 4E7IA 1BI0A 5A2QE 4C8QG 1N8RU 2ZPFB 3RIRA 4DA4A 3FLGA 3JB9I 4BI8B 3GLXA 3I55T 1YI2T 4E47A 4EMGA 4M7DG 1I4K1 2XIDA 1Y71A 3PTAA 5GAMg 2RM4A 2K3XA 4JS5A 1B34A 4F7UG 3CC4T 1Q82U 4J7IA 2MF2A 3JCMf 3MCAB 3X26B 3AHUA 4MMKA 3PFSA 5DLQE 3NTIA 3OW2A 1M8VA 1M5Q1 3RERA 3JSCA 1VQNA 2CZ6B 3JCMd 5GAN5 4QQ6A 1M1KU 2GFAA 2EFIA 2EJFA 1VQ8T 4ZTFA 2R5AA 3X24B 2QEXT 4QW2A 1NPPA 1S72T 2LNVA 4PKCC 4PLLA 1B34B 1Q86U 3CD6T 4RG2A 4A53A 4DOVA 5HKCA 2OTLT 5J39A 4ZGEB 2O01E 1KHCA 3CBPA 3ASKA 2DEQA 3CPFA 5LJ3e 4ELYC 1YHQT 1N6AA 4PJOC 4YTLA 3OS1A 3L2QA 4NOYA 1XNIA 1Q81U 2DTOA 5CKHA 2EJGA 2Y4XA 1MGQA 2EJ9A 3QKJA 4IUVA 4MZMA 5CKBA 3DLMA 5LJ3h 5KCHA 3OYMA 4X9CA 3TCJA 4C0DB 5CVIA 1HXDA 3SD4A 3CCST 4FL6A 4OB0B 2RHIA 3G4ST 4OF1A 4C92C 2DZ9A 3O8VA 3CC7A 1OZ2A 1U1TA 2C06A 2PVDB 4XTUA 4C0GA 2X4YA 3OYKA 1VQLA 1QP2A 4PLIA 2QQBA 2M9UA 4IUUA 4XTZA 4M78C 3JCMW 2E10A 5FU7C 3MP1A 3URGA 3CBMA 1Y96B 3QJYA 3V7CA 1WJQA 3N5BB 2RHYA 3HPWA 4M7AE 2FHDA 5CKEA 2EQUA 3M55A 5GMKj 2RI5A 1HK9A 2DJZA 3QDRB 3DB4A 4IUPA 2L3RA 3WVEB 3L2WA 3CCLT 1DJ7B 2VXEA 5KE3A 2PVOB 2LQ8A 4NL3A 3L2VA 4L59A 4E7HA 2EQKA 3E19A 2EQMA 4M77E 3RKXA 2R57A 3OYGA 1VQ5A 3ZFJA 2XD0A 3OS2A 4HT9A 4BDZA 1VQOA 3M4YA 3L42A 1IREB 4R55A 2JNGA 5HY6A 5FU6B 3HSBA 3CCVA 1I5LA 4M7AG 4ZTJA 1YITA 4LD9K 3PGGA 2CKKA 2HBPA 5I2SA 5LJ3f 2CYZB 3JCMJ 4HCZA 4JDSA 3L1AA 4MDWA 4XK8E 4EDUA 3KXTA 3CCQA 2P4TA 1VQNT 4M77G 1SSFA 2DXCA 2G3RA 4FT4A 2DD5A 3C12A 4LDYA 3JB9J 5LJ3d 3RKYA 1JB0E 4XTXA 3VUZA 4J83A 3VV0A 3UWNA 5LJ5j 4FIBA 3GOXA 1W2BA 3PIOA 3CC2A 3X20B 5GAOr 2JVVA 2VC8A 3JAME 3CMAA 1MHNA 2ZPEB 3GF5A 3MP6A 3JCMg 3QZ5B 4C8QC 4NL2A 2YRVA 1GXIE 4J6XA 1JJ2S 1XTDA 3C4SA 2QQSA 2QTXA 3GP8A 2EKOA 2XHCA 1YJ9A 4M7DC 2L5QA 4XU2A 5CQXA 2MWPA 1M90C 3QSUA 3DKMA 5GAMj 3A8LB 4XTVA 3CC7T 3MO8A 3MEWA 3GIBA 1QVGS 3V8KA 3MEVA 1KQ2A 2DXTA 2V8KA 2VGMA 1VQLT 1VQ7A 3OQ5A 3VUBA 5GMKe 1WQWA 2ZGWA 4TVRA 2KQWA 3BW1A 2OTJA 1D3BA 2E5QA 1Y7XA 2JN0A 2K2VA 5GMKi 4XAXB 1WGSA 2K5LA 2DXUA 4N4GA 5GMKh 3OYJA 5DM7R 2E41A 3S6WA 3G6EA 1O9SA 4XU1A 3OS5A 4OB2B 5KH6A 1OZ3A 2DK3A 3M57A 4QQGA 4ELZC 2D9TA 3LX7A 3CCLA 1VQMA 4PJOD 4OB1B 1X75C 2RI3A 3V8LA 1QP3A 2QQ9A 3HFOA 2VUBA 1VQ5T 5CKDA 2EIFA 5GANe 2LVMA 3OB9A 3VYGA 1V29B 4ZGDB 4PJOA 3EFSA 3V8JA 1K9MC 1BI2A 1VQOT 4BDYA 3L2ZA 2FYKA 4OVAA 4C5IA 2JTMA 5GANh 3H8ZA 4C92D 3CCVT 2RJFA 5DLOA 1G3YA 4FT2A 5C0MA 4FSXA 1YITT 2KDSA 5CQYA 4IKFA 4IURA 5J26A 4LDUA 4RKUE 1UGPB 4C92A 2OAUA 2DXBA 3CCQT 1JJ2A 4KT0E 4M78D 4PJOB 3DB3A 1WJRA 2JZ2A 1XQHA 2RI2A 3HRSA 1TH7A 3MEAA 4M78A 4N0AC 3TREA 2QQRA 3NFCA 4LD6A 5I21A 3CC2T 1M4ZA 3FEOA 1JBMA 4O6JA 3OYLA 3T9NA 4C92B 3CCJA 3CMAT 4Y91A 5GAMe 4A4EA 3FJPA 5FROA 2LTOA 5LJ3g 5DY9A 3V7SA 4BE1A 5GAOm 4ATOA 5A0LA 2DO3A 4MZPA 5CO7A 1YIJA 1YJ9T 5GAOq 1N9RA 4M78B 3J7AF 5FU7B 4JLGA 4L6V5 3MEUA 4M7AC 1LNXA 5GAN8 1Y96A 2K4YA 2KK4A 3OYNA 2JUFA 3PNWC 4UC4A 3GNFB 2PUOB 1VQ7T 4ZN3A 3VYHB 1M90U 2E12A 4HKEA 2DD4A 5A0DA 4M77C 2MI6A 4PJOF 3J80E 2OTJT 2RHZA 4BD3A 3PMTA 5GANf 4FU6A 3G6ET 2X4WA 4GLKA 4QVDA 5GANd 3CMEA 3SWNC 4C92F 4II1A 1VQMT 2HQXA 4GY5A 4XU0A 2F69A 2LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UWN A;  3E9F A;  3GOX A;  1OYX A;  5CIU A;  1WJS A;  4NS5 A;  4A4H A;  3OYA A;  2DAQ A;  3LGF A;  3P8D A;  4C5H A;  3OA6 A;  5FRN A;  4QVZ A;  3M9Q A;  3FC3 A;  1MHN A;  3MP6 A;  3OYI A;  3OY9 A;  2GF7 A;  3ME9 A;  2YRV A;  3MP8 A;  2IG0 A;  3C4S A;  2QQS A;  2E6N A;  2X35 A;  4C5G A;  5M9O A;  4BE0 A;  2EKO A;  2WAC A;  4X34 A;  2MWP A;  4C5E A;  3OMC A;  3E9G A;  4E7I A;  3S3O A;  3OYD A;  5D6W A;  3MO8 A;  3FLG A;  4B9W A;  3MEW A;  3MEV A;  2MWO A;  2R5M A;  5IAY A;  2DIQ A;  3OQ5 A;  4PL6 A;  1G5V A;  3KUF A;  5KE2 A;  2K3X A;  2XDP A;  2E5Q A;  4IUT A;  1WGS A;  1OI1 A;  2F5K A;  2X4X A;  4N4G A;  2RJD A;  3OYJ A;  3PFS A;  3NTI A;  3S6W A;  2R58 A;  5KH6 A;  3S3M A;  4BAC A;  3NTH A;  1OZ3 A;  4QQ6 A;  4QQG A;  2GFA A;  2EFI A;  2D9T A;  3LX7 A;  4ZTF A;  3MET A;  2R5A A;  4A4G A;  4N4I A;  4Z02 A;  4IUQ A;  4QW2 A;  2RI3 A;  4A4F A;  3LLR A;  3PMI A;  4PLL A;  4Q5W A;  3ZEH A;  4RG2 A;  2LVM A;  2HQE A;  3OB9 A;  1KHC A;  5J39 A;  3ASK A;  3F70 A;  4BDY A;  4OVA A;  2RJE A;  3OS1 A;  3LYI A;  3L2Q A;  1XNI A;  4B9X A;  4C5I A;  3L2R A;  3H8Z A;  3LGL A;  2RJF A;  3QKJ A;  2M16 A;  4IUV A;  5KCH A;  3DLM A;  5C0M A;  3QJ6 A;  3OYM A;  2M0O A;  4IKF A;  2PQW A;  4IUR A;  5J26 A;  3SD4 A;  5D6Y A;  4FL6 A;  2RHI A;  2LDM A;  1N27 A;  3H6Z A;  3O8V A;  3DB3 A;  1OZ2 A;  1WJR A;  2JZ2 A;  4E7K A;  3OYE A;  2B8A A;  3QII A;  2RI2 A;  3QBY A;  2X4Y A;  3OYK A;  2RJC A;  3MEA A;  3Q1J A;  4PLI A;  2QQR A;  4IUU A;  4LD6 A;  2RHU A;  3MP1 A;  3FEO A;  4BE2 A;  1WJQ A;  3OYF A;  3OYL A;  2RHY A;  4QQD A;  2NLU A;  2P0K A;  2M1H A;  2FHD A;  2EQU A;  1H3Z A;  2RI5 A;  4IUP A;  4A4E A;  3OYH A;  3DB4 A;  5FRO A;  2L3R A;  2LTO A;  2O4X A;  4CRI A;  2L8D A;  3L2W A;  4BE1 A;  5KE3 A;  2RHX A;  2RO0 A;  3L2V A;  1RI0 A;  4L59 A;  3P8H A;  4E7H A;  2GFU A;  2EQK A;  3LH0 A;  3OS0 A;  2EQM A;  3MEU A;  2R57 A;  3OYG A;  3OYB A;  5FRM A;  3NTK A;  3OMG A;  4N4H A;  3OYN A;  3PNW C;  4UC4 A;  3OS2 A;  2VYT A;  2BKD N;  3CEY A;  4BDZ A;  2L89 A;  3L42 A;  2K3Y A;  2O4X B;  3OYC A;  2XK0 A;  2RHZ A;  4ZTJ A;  4BD3 A;  3PMT A;  2DIG A;  4FU6 A;  2EQJ A;  2CKK A;  5KCO A;  3L2U A;  2X4W A;  5D6X A;  5IN1 A;  4HCZ A;  4E7J A;  4EDU A;  4E7L A;  3S3N A;  1SSF A;  2G3R A;  3BDL A;  2BUD A;  5C6S A;  3EAE A;  4II1 A;  2HQX A;  2JTF A;  4GY5 A;  3UT1 A;  2BIV A;  2LCC A;  3FDR A;  2LRQ A; 
#chains in the Genus database with same CATH topology
 3P8B B;  4RTZ A;  4OMF B;  3VS3 A;  3CXC S;  1PM3 A;  3CC7 Q;  1QVP A;  2DET A;  4XTY A;  2EGE A;  3M9Q A;  2EAY A;  3VS5 A;  1K9M U;  1O75 A;  3EG2 A;  1H64 1;  1QWE A;  2WAC A;  3CME Q;  1PHT A;  3GBQ A;  3HFN A;  1BKB A;  2XIC A;  2RNA A;  1KC8 R;  3KUF A;  4O5V A;  3PVL A;  1TXQ A;  3RBB B;  3NGP A;  1VQP T;  1FX7 A;  3M54 A;  2FL7 A;  3VU3 C;  1YIJ T;  2NUP A;  1VQ4 A;  3TSZ A;  2MMP A;  3OW2 P;  2MYS A;  4C92 G;  3LLR A;  2CZ0 B;  3CCQ Q;  4OGE A;  1UJ0 A;  3RKW A;  3LYI A;  4B9X A;  2L2P A;  5IHK A;  2NUP B;  2H3E B;  2ZAE A;  3LWI A;  2LT4 A;  2GQV A;  3CCR A;  3CMA Q;  4D6W A;  4M7D F;  1VQ4 Q;  2NWM A;  1W4S A;  5IT9 E;  5KYN A;  3KBG A;  3ER0 A;  4JRQ A;  2EYY A;  2YLC A;  1WDX A;  2HBW A;  2DVJ A;  1C6V X;  3OYF A;  2M51 A;  1PRM C;  1UB4 A;  2ED0 A;  1H3Z A;  3PT9 A;  3M58 A;  1PRL C;  3P8H A;  2K5I A;  3OYB A;  1K4U S;  2JS2 A;  1VQK T;  2K3Y A;  3LWH A;  1MUZ A;  5CR2 A;  1BYM A;  1QVG A;  2DZC A;  1VQP A;  3SWN A;  1CKB A;  3JB9 D;  3HHT B;  2KYB A;  2LCC A;  3FDR A;  1NEG A;  3E9F A;  4LUE A;  3OBY A;  4NS5 A;  2DAQ A;  4C5H A;  2LQW A;  2MCN A;  2JOY A;  3SWN B;  1ZX6 A;  3OY9 A;  1NJI C;  3CCM T;  3DLL A;  3EG1 A;  3HRT A;  1VQP Q;  4Z88 A;  2O9V A;  1M9S A;  4M7A F;  2HEQ A;  5A0G A;  2RQW A;  4RG8 A;  1YIJ Q;  2DIQ A;  1ABO A;  2VGN A;  1AWJ A;  2M02 A;  5HK0 A;  2CP2 A;  2XDP A;  3M0U A;  1N8R R;  4M77 F;  1VQ6 A;  2LCL A;  4F17 A;  1U1S A;  4BAC A;  1ZA2 B;  4XTW A;  1RAD B;  3AT1 B;  4RTV A;  1Q82 R;  2CSQ A;  2DA9 A;  3INZ A;  2YUP A;  4CC2 A;  3PMI A;  2A7Y A;  3QPH A;  3UDC A;  2HD0 A;  3L2R A;  2A28 A;  1VQ6 Q;  2F1L A;  3D7S B;  4K11 A;  4JS4 A;  1N5Z A;  5CK9 A;  2B8A A;  3QII A;  3I55 A;  1JJ2 P;  1M3B A;  5GAO n;  1M1K C;  3CC4 A;  1K73 U;  1TS9 A;  1WX6 A;  1WQ7 A;  1UJY A;  3EGX A;  2V1R A;  4R0K A;  1QVG P;  3SDZ A;  3A1P A;  3LW5 E;  1VQ8 A;  1SEM A;  2GFU A;  4LN2 A;  3HKS A;  3LH0 A;  1S72 A;  3FRN A;  1JEG A;  3JCM e;  3M53 A;  3JCM c;  4GBQ A;  2BKD N;  2ATC B;  2G6F X;  3O5Z A;  2L89 A;  3EGX B;  2FO0 A;  1JXO A;  3X25 B;  3I56 T;  4JRK A;  4J5Y A;  2EQJ A;  3MPU B;  2JTE A;  1C1A A;  2D8H A;  3S3N A;  1VQ8 Q;  3G4S A;  1JXM A;  1UHC A;  4LDW A;  2DKG A;  1YJN T;  4B6M A;  4A63 B;  4CI0 C;  3G71 T;  4E6R A;  2D8J A;  4M75 G;  2E65 A;  2H3J A;  3LGF A;  4F7U E;  4PNO A;  2F5T X;  1D3B B;  1A0N B;  3TVT A;  3G4S Q;  1JQQ A;  4E7I A;  5A2Q E;  1AD5 A;  3FLG A;  4AFU C;  4M7D G;  1Y71 A;  2FZC B;  2EYZ A;  4J7I A;  4J9G A;  3X26 B;  5DLQ E;  2EKH A;  3RR6 A;  4QQ6 A;  3VRZ A;  2O9S A;  2QEX T;  1T0H A;  1NPP A;  1TUG B;  2KT8 A;  4AFS C;  4A53 A;  2OTL T;  2L3Q A;  1QCF A;  2O01 E;  3CBP A;  2YUO A;  3ASK A;  5LJ3 e;  1YHQ T;  5KYX A;  3OS1 A;  3MKD A;  4NOY A;  2JM9 A;  4RTX A;  5CKH A;  2Y4X A;  3QKJ A;  4IUV A;  2X9H A;  2YWW A;  3SD4 A;  2J06 A;  3CXC P;  4OF1 A;  1SRL A;  1YWP A;  5KYX B;  1U1T A;  2C06 A;  1MV0 B;  1VQL A;  2KXD A;  2E10 A;  3URG A;  3V7C A;  3HPW A;  1SF9 A;  2EQU A;  2GTJ A;  3M55 A;  2DJZ A;  3I56 Q;  2BE9 B;  2PVO B;  4NL3 A;  3L2V A;  2KGT A;  4L59 A;  4E7H A;  3C0C A;  2R57 A;  3H9N A;  4JZ4 A;  2A37 A;  1VQL Q;  3A98 A;  1G83 A;  4HT9 A;  1VQO A;  3M4Y A;  1YJN Q;  4R55 A;  2JNG A;  2W10 A;  3HSB A;  4M7A G;  1I5L A;  4FYW B;  4ZTJ A;  2HBP A;  5I2S A;  4JDS A;  3KXT A;  2MPX C;  1M90 R;  1VQN T;  3EHR A;  3EGU A;  4M77 G;  4LDY A;  2G3R A;  3RKY A;  2D1X A;  2YRC A;  4XTX A;  5LJ5 j;  2FPE A;  3CC2 A;  2L3S A;  1TUC A;  3MP6 A;  3GF5 A;  4FYV B;  6AT1 B;  4J6X A;  2DL8 A;  1XTD A;  2QTX A;  3GP8 A;  2O88 A;  2EKO A;  2XHC A;  4M7D C;  2IIM A;  4XU2 A;  3QSU A;  4ESR A;  3M0P A;  4QKU A;  1KSW A;  2V8K A;  2QEX Q;  5GMK e;  4TVR A;  3BW1 A;  4J9H A;  1X43 A;  2CUB A;  2DL7 A;  2CP0 A;  4KGX B;  2F2X A;  5GMK i;  2OTL Q;  4N4G A;  2DXU A;  2E41 A;  3S6W A;  1YHQ Q;  4OB2 B;  1IHV A;  1NG2 A;  1WHK A;  4ELZ C;  2NUT A;  1VQM A;  4PJL A;  2RI3 A;  3V8L A;  2EW3 A;  1UFF A;  5GAN e;  1IO6 A;  2QTV A;  5FWC A;  4HCK A;  1K9M C;  2FYK A;  2JTM A;  3CCV T;  2NUT B;  4FSX A;  1YIT T;  2KDS A;  2FPD A;  2KRN A;  4LDU A;  1AWW A;  1K76 A;  1UGP B;  1OPL A;  2MK5 A;  1VQM Q;  3VS7 A;  3REA B;  1RAC B;  1TH7 A;  3TRE A;  1D1C A;  2SRC A;  4O6J A;  4E7S A;  3CCJ A;  3I5R A;  5FRO A;  2LTO A;  5DY9 A;  4AG2 C;  1TU0 B;  4MZP A;  5CO7 A;  4RTU A;  1N9R A;  4M7A C;  2I0N A;  4PK4 A;  1Y96 A;  1VQN Q;  3OYN A;  2JUF A;  1VQ7 T;  4M77 C;  3UA6 A;  1ABQ A;  1SKU B;  1K8A R;  4C92 F;  1GBR A;  2F69 A;  1Q7Y R;  4BI3 A;  4VUB A;  3J81 E;  5CIU A;  4DOW A;  3ULR B;  4PJJ A;  4M78 F;  5GAN 2;  4M7D D;  3TU4 K;  4X9D A;  2F2V A;  4J8O A;  2EVR A;  3QHS A;  4M7D A;  2E6N A;  2QDL A;  4EIK A;  2E4H A;  3JB9 H;  2FRW A;  2XDB A;  1M1K R;  3E9G A;  2HSP A;  2KMT A;  1M3C A;  2RMO A;  3EHQ A;  4C92 E;  2ZPB B;  1NPR A;  4FM4 B;  2QA4 A;  1FMW A;  1ZA1 B;  3CCE A;  2RPN A;  4M7D B;  3WVD B;  1X27 A;  1UGV A;  4DQ2 A;  3JCM V;  2KVQ G;  2LX9 A;  2AT1 B;  4JRI A;  1YIT Q;  1TG0 A;  2K3B A;  3UPU A;  1GCP A;  1G2B A;  3G7Z A;  4OMP A;  2B86 A;  2QA4 Q;  3FB9 A;  3CCE Q;  1QVF A;  2KI7 A;  2EWN A;  4RTW A;  1E6H A;  3CME T;  1QW1 A;  2K9G A;  1UEC A;  4BY6 C;  3OYE A;  3QBY A;  1I8F A;  1D0Z A;  2K57 A;  2LQK A;  3CBO A;  2HCK A;  1R8O B;  1YFN A;  1D0Y A;  2XU8 A;  4A4K A;  1M1G A;  3HRU A;  2IVW A;  1VQ7 Q;  4M7A D;  4KUI A;  5HK3 A;  1NLP C;  4M7A A;  2HKN A;  4OP0 A;  1KIK A;  4M77 D;  5GMK m;  4N4H A;  5CAI A;  5GAN 6;  1ZHI A;  4PJN A;  4M77 A;  2ZPH B;  2XK0 A;  3A8G B;  4M7A B;  3VS2 A;  3H41 A;  5KCO A;  3RMQ A;  1Z9Z A;  1JRI A;  2BUD A;  1UHF A;  5C6S A;  3IQL A;  1VQ4 T;  1K73 C;  4M77 B;  2BIV A;  2ZCF B;  3WXM B;  2QAS A;  1U3O A;  3QYH B;  3V7R A;  1OYX A;  4LE9 A;  3FC3 A;  1IXD A;  1OPK A;  1ZSG A;  4DEY A;  3C94 A;  2HL3 A;  2PUK B;  1B07 A;  4JZ3 A;  1KC8 U;  1WLP B;  3CCR T;  1PSF A;  4LDV A;  4BB7 A;  1TTH B;  4PL6 A;  1G5V A;  5KE2 A;  4IUT A;  2X4X A;  4Z8A A;  2Y90 A;  4C0Z A;  3S3M A;  2YRD A;  1ZUK A;  5LJ5 d;  1YCS B;  2HZY A;  4LDX A;  5IH2 A;  2E3H A;  2RF0 A;  4C0D C;  1UEB A;  2KNB B;  3A5Z B;  2RQR A;  4KH0 B;  4F7U A;  1CSK A;  3PIP A;  3HP9 A;  2ESW A;  4FW1 A;  5I2M A;  2KSS A;  1M30 A;  1M27 C;  1X69 A;  1Q86 R;  1I81 A;  4AG1 C;  3QJ6 A;  4HA8 A;  1UTI A;  1KD1 U;  2PQW A;  2LDM A;  4F7U B;  1LJO A;  1N27 A;  2OX7 A;  4DBH A;  1YWO A;  1GL5 A;  4MZT A;  2V8I A;  1G3T A;  2HDA A;  1YI2 A;  1YN8 A;  4M75 F;  3RUX A;  1BB9 A;  1RL2 A;  1VIE A;  4BY6 B;  2PVG B;  1H92 A;  2ABL A;  1RLP C;  4M78 G;  5FLX E;  1WPY A;  3QUI A;  1BU1 A;  1RAI B;  5FRM A;  3CD6 A;  4PFZ A;  1YI2 Q;  5HCK A;  4KUD K;  1H8K A;  4RMO A;  1MMA A;  2HSE B;  4M75 E;  3OYC A;  2DIG A;  1VQ6 T;  1KQS A;  4WF2 A;  1FYN A;  1BI3 A;  2ZPG B;  2FG0 A;  3EAE A;  1KFZ A;  2X4J A;  3UT1 A;  1PNJ A;  3BE3 A;  3CCR Q;  1OV3 A;  1RAA B;  4C0F A;  3M4G A;  2K5F A;  4A4H A;  1AHJ B;  4M7D E;  3OA6 A;  1PWT A;  1FMV A;  2YXY A;  5FRN A;  2GCX A;  1AZG B;  1PD1 A;  2HKQ B;  5LJ5 g;  3VJP A;  2ZZD A;  1W1F A;  1QLY A;  1D1B A;  5M9O A;  2WSF E;  2DFU A;  5LL6 S;  2A0F B;  1Y57 A;  1N8R U;  2ZPF B;  3JB9 I;  4BI8 B;  1NYF A;  3GLX A;  3I55 T;  4E47 A;  1C0M A;  4EMG A;  2XID A;  4Z89 A;  2ECZ A;  2RM4 A;  1Q82 U;  1B34 A;  3CC4 T;  1BBZ A;  2MF2 A;  1D09 B;  3H0H A;  1M5Q 1;  2DX1 A;  2GFA A;  2EFI A;  1VQ8 T;  4QW2 A;  1S72 T;  4PKC C;  1B34 B;  3QDF A;  4DOV A;  1KHC A;  1EX4 A;  1JU5 C;  4YTL A;  1Q81 U;  2EJ9 A;  5KCH A;  4C0D B;  3G4S T;  4C92 C;  2C0T A;  1D1A A;  4WCI A;  3PE0 A;  2AK5 A;  4C0G A;  1QP2 A;  2M9U A;  4IUU A;  4M78 C;  1PCX A;  1AVZ C;  3CBM A;  3QJY A;  4M7A E;  4X1V A;  1ZSZ C;  2RI5 A;  3CCL T;  3DB4 A;  4HVU A;  2L3R A;  1DJ7 B;  3CQT A;  3QWY A;  2EQM A;  1LPL A;  4M77 E;  3RKX A;  1VQ5 A;  2XD0 A;  2GQI A;  2LMJ A;  2V1Q A;  1WHL A;  5I22 A;  2NYS A;  2YT6 A;  4LD9 K;  2CKK A;  3JCM J;  3PVQ A;  4MDW A;  4XK8 E;  4FSS A;  4RUG A;  2P4T A;  3C12 A;  4F16 A;  4J83 A;  3VV0 A;  4FIB A;  2DE0 X;  3PIO A;  3X20 B;  5GAO r;  3I55 Q;  2F2W A;  5ECA A;  1GXI E;  3CC4 Q;  2COY A;  3KFV A;  1YJ9 A;  5GAM j;  2GTO A;  3GIB A;  2DM1 A;  3MEV A;  2PNI A;  4JJD A;  1VQL T;  1PD0 A;  3OQ5 A;  1S72 Q;  2JMA A;  2OTJ A;  1D3B A;  2E5Q A;  1J3T A;  2JN0 A;  2K2V A;  1E7O A;  2KT1 A;  3G6E A;  5DM7 R;  1O9S A;  9ATC B;  1OZ3 A;  2DBM A;  3M57 A;  2VVK A;  3CCL A;  2EIF A;  3OB9 A;  3VYG A;  1V29 B;  4ZGD B;  3EFS A;  1BI2 A;  1VQO T;  4BDY A;  2OTJ Q;  2L0A A;  4C92 D;  1K73 R;  4FT2 A;  5C0M A;  5CQY A;  5J26 A;  8ATC B;  4C92 A;  2OAU A;  1I5O B;  2O31 A;  4M78 D;  3CCL Q;  3VS1 A;  4OML A;  3MEA A;  4M78 A;  2QQR A;  3NFC A;  3VS0 A;  3CC2 T;  1VYV A;  1M4Z A;  2LJ1 A;  1AEY A;  3OYL A;  4C92 B;  1ZSZ A;  1OEB A;  2EGC A;  4J9C A;  2DJQ A;  3V7S A;  4BE1 A;  1QCN A;  4ATO A;  4M78 B;  4JLG A;  1LVK A;  3HTR A;  2P4R A;  1PKT A;  1ZSZ B;  2PUO B;  3VYH B;  1M90 U;  1BCO A;  2E12 A;  3QWX X;  4HKE A;  4PJO F;  2MI6 A;  4DBQ A;  3EH1 A;  4BD3 A;  3PMT A;  1ZUU A;  4DBR A;  2X4W A;  2K2M A;  4KRT A;  3FJ5 A;  4J9I A;  1MND A;  1VQM T;  1K9A A;  4XU0 A;  1JO8 A;  2LRQ A;  2P84 A;  1QVF S;  1GFD A;  2SEM A;  3OYA A;  3BFM A;  2QI2 A;  3P8D A;  4HCB A;  2RK2 A;  3A8M B;  4QVZ A;  1HSQ A;  1X2Q A;  3GPL A;  2GF7 A;  1IB8 A;  3VS4 A;  2BZ8 A;  2DNU A;  2ROT A;  2K79 A;  5IHI A;  1VYU A;  3C95 A;  5EG2 A;  3M0Q A;  5GAM f;  3M5A A;  3OYD A;  3JB9 F;  2KYM A;  1K0S A;  1VQ9 A;  1IHW A;  2MWO A;  1WZO A;  4M75 C;  3I35 A;  4PFP A;  1MMN A;  2ED1 A;  3ZBD A;  1OI1 A;  2RJD A;  3CCJ T;  2J7I A;  1VQO Q;  2PZ1 A;  3JV3 A;  3NTH A;  1NZ9 A;  3H0I A;  1BK2 A;  3MET A;  1VQ9 Q;  4OMN A;  1P92 A;  2HQE A;  1KC8 C;  4DBF A;  1BIB A;  5IXF A;  3LH5 A;  3X28 B;  1RAG B;  4C8Q F;  2HAX A;  3CC2 Q;  4LNP A;  1AWX A;  2M0O A;  1GFC A;  3BDU A;  1YJW A;  2YLB A;  1GBQ A;  1WYX A;  2QG9 B;  2HL5 C;  4E7K A;  2A3L A;  1WXT A;  2RJC A;  3Q1J A;  3JCM X;  2FVU A;  2RHU A;  5LJ3 j;  2QGF B;  3UF4 A;  3M59 A;  4J9D A;  4BE2 A;  3MHX A;  4QQD A;  3JCM b;  2RA2 A;  4MDX A;  4OMQ A;  2O4X A;  2LJ0 A;  3SEM A;  2L8D A;  3QXE B;  4CRI A;  2LT1 A;  1KJW A;  2A08 A;  2GBQ A;  2RO0 A;  1R0B G;  1YJW Q;  1ZQ1 A;  2I2L A;  3OSS C;  2CZ7 B;  2BZY A;  1YCY A;  1KD1 C;  4ME7 A;  3OBW A;  3CEY A;  2QA4 T;  1MV3 A;  2O4X B;  3CCE T;  5LJ5 h;  1NJI R;  1OUL A;  2E1H A;  4XQ3 A;  1FWZ A;  3QZ9 B;  4J6W A;  5D6X A;  1Q7Y U;  2BE7 D;  5GJV B;  2QXF A;  2C0I A;  2RB6 A;  2Z0W A;  1NBE B;  1SG5 A;  5GAN 4;  1OU8 A;  2FRY A;  1EFN A;  1RLQ C;  2BTT A;  4JJC A;  4J6Y A;  4PFO A;  1M2O A;  2E70 A;  1OQK A;  1N9S A;  4BUG A;  3CCU A;  3UAT A;  4C5G A;  1IRX A;  4M75 D;  4RCC A;  3CCJ Q;  4C5E A;  3OMC A;  3JCM Q;  3S3O A;  2YDL A;  4M75 A;  2RK1 A;  3RDV A;  1WHM A;  2DYB A;  1R0C B;  5LJ5 f;  2D6F A;  3FIF A;  3CCU Q;  2PU9 B;  4M75 B;  2KRS A;  4AFZ C;  2D0Q B;  2RQU A;  4A4G A;  4IUQ A;  5AT1 B;  3CPW A;  4FYX B;  3ZEH A;  4ZNX A;  3R6O A;  2CRE A;  1KQS S;  2M16 A;  2DBK A;  4Y28 E;  1N8R C;  5GAM d;  3NHN A;  5D6Y A;  1FXX A;  4PJO G;  2MIO A;  2VB6 A;  1WI7 A;  4M78 E;  2DIL A;  1Q82 C;  3H6Z A;  1VUB A;  3RMS A;  2H8H A;  8AT1 B;  4JJN K;  3A8H B;  5GAN j;  3RES A;  2ENM A;  2CH4 A;  2P0K A;  2CS7 A;  2JT4 A;  3UA7 A;  3OYH A;  2FB7 A;  2GGR A;  1VIF A;  2DPP B;  3QG1 A;  2WSE E;  3OS0 A;  1Q81 C;  3ZL7 C;  3JCM P;  2X3X D;  1R77 A;  2VYT A;  1PSE A;  2HNI A;  3E1S A;  1UGQ B;  5I11 A;  1XOV A;  3JB9 G;  2EYX A;  1G3W A;  3CCS A;  3L2U A;  4E7J A;  2J05 A;  1KG1 A;  1RI9 A;  4XU3 A;  1Z9Q A;  5IXB A;  2RQT A;  4OGC A;  3VKI A;  2JTF A;  5J3B A;  2DMO A;  2FZK B;  3JRZ A;  1EIF A;  4ZGJ B;  2V8J A;  2XI9 A;  2DTH A;  3ME9 A;  4BE0 A;  2X35 A;  2E64 A;  1BIA A;  4X34 A;  1U06 A;  1BI0 A;  1LCK A;  4C8Q G;  3RIR A;  1AOJ A;  4DA4 A;  2DRK A;  1YI2 T;  1GCQ C;  3PTA A;  5GAM g;  1WHG A;  1M2V A;  3MCA B;  3AHU A;  1CKA A;  1UUE A;  3PFS A;  3OW2 A;  1M8V A;  1ZUY A;  2M0Y A;  3RER A;  3JSC A;  3JCM d;  4J9E A;  2YSQ A;  2R5A A;  1TSF A;  1SHG A;  3RNJ A;  2DEU A;  2LNV A;  1WIE A;  1Q86 U;  1M2V B;  3CD6 T;  4RG2 A;  5J39 A;  4ZGE B;  2KRM A;  2DEQ A;  3CPF A;  2LNH B;  1N6A A;  4PJO C;  3L2Q A;  1TOV A;  2EJG A;  1MGQ A;  3M0T A;  4MZM A;  5CKB A;  3OYM A;  5CVI A;  1T0J A;  1QVF P;  2RHI A;  2EGA A;  4E7Z A;  2DZ9 A;  3O8V A;  3CC7 A;  2LCS A;  3REB B;  4XTU A;  3OYK A;  4PLI A;  2W0Z A;  3JCM W;  3MP1 A;  3N5B B;  2RHY A;  1X6B A;  3VRY A;  1UDL A;  1HK9 A;  3L2W A;  3QDR B;  1M3A A;  2VXE A;  5KE3 A;  4WTO B;  2OI3 A;  3E19 A;  2CP3 A;  1V76 A;  3ZFJ A;  1RAF B;  1IRE B;  5HY6 A;  3PGG A;  1WHH A;  4EDU A;  3CCQ A;  1SSF A;  4FT4 A;  2DD5 A;  5LJ3 d;  1H3H A;  1NEB A;  3VUZ A;  2K7A A;  3UWN A;  3GOX A;  4RTT A;  3TSW A;  4JJB A;  3CMA A;  1MHN A;  3JCM g;  4C8Q C;  1W6X A;  1X6G A;  3C4S A;  2AKL A;  1HD3 A;  2L5Q A;  1M90 C;  2QGG A;  3DKM A;  4XTV A;  3MO8 A;  1GCQ A;  2HQH A;  3MEW A;  4J9B A;  3V8K A;  2VGM A;  1K9M R;  3VUB A;  1WQW A;  2ZGW A;  1RAH B;  2JM8 A;  4FCY A;  3CD6 Q;  4XAX B;  1WGS A;  2K5L A;  4XU1 A;  5KH6 A;  5KYW A;  1KD1 R;  2CH4 W;  2AZS A;  4PJO D;  1QP3 A;  2QQ9 A;  3HFO A;  2VUB A;  1VQ5 T;  5CKD A;  2K6D A;  2LVM A;  4PJO A;  5KYW B;  4C5I A;  2RJF A;  1G3Y A;  2CP6 A;  2DXB A;  1RAB B;  1JJ2 A;  4PJO B;  3DB3 A;  4CC4 B;  1WJR A;  2JZ2 A;  2BZX A;  2RI2 A;  2YUQ A;  3EG0 A;  3HRS A;  1YP5 A;  1HJD A;  4N0A C;  1QCO A;  5I21 A;  1JBM A;  4F04 B;  1ZLM A;  4Y91 A;  2LJ3 A;  5GAM e;  4A4E A;  2CSI A;  4OMO A;  5LJ3 g;  1I1J A;  5A0L A;  1YIJ A;  1YJ9 T;  5GAO q;  3J7A F;  2K4Y A;  1T3S A;  4UC4 A;  2J6O A;  3GNF B;  2IPO B;  4ZN3 A;  2KRO A;  1EZZ B;  2DD4 A;  2OTJ T;  4ANJ A;  1WHJ A;  3G6E T;  4GLK A;  1WXU A;  5GAN d;  1F1B B;  2FEI A;  4II1 A;  1KQS P;  1T3L A;  4C8Q D;  3NMZ C;  2CZ1 B;  1LOJ A;  4PJM A;  4A54 A;  5GAN 7;  2WSC E;  4P5N A;  2EBP A;  2KBT A;  4C8Q A;  2QYZ A;  1U8R A;  5GAN 3;  3OYI A;  1KK7 A;  3BY7 A;  3MP8 A;  3NPF A;  4ZN1 A;  2IG0 A;  2QK0 A;  4LXC A;  1ZBX A;  1K8A C;  2JXB A;  5KYU A;  4QVC A;  2CUD A;  2OAW A;  4C8Q B;  3SFM A;  2R5M A;  5IAY A;  1Q7Y C;  1VQK A;  4KGZ B;  2JS0 A;  4AMC A;  5GMK l;  1VQ5 Q;  3M0S A;  4JUV A;  1MMG A;  5KYY A;  4EMH A;  1Q81 R;  5CCA A;  2DER A;  3QO3 A;  1QKW A;  4F14 A;  1QMC A;  5KYU B;  1SSH A;  1U5S A;  4Z02 A;  4EPC A;  5L23 A;  3OYY A;  1KHI A;  1YBY A;  5KYY B;  5AYF A;  1VQK Q;  4IIM A;  2P0P A;  5GAO l;  3CXC A;  1XJW B;  2ROL A;  3CCM A;  2C0O A;  1B3Q A;  1VYT A;  2E6Z A;  4BI4 A;  3M56 A;  4ORZ A;  3GNG A;  1AZE A;  1MMD A;  3EFR A;  2PTK A;  4F7U F;  4AT1 B;  1YJ9 Q;  1IGQ A;  4N0A A;  2LZ6 B;  2VV5 A;  3MJX A;  2XKO C;  2QDY B;  1YNZ A;  1TUD A;  2NLU A;  2M1H A;  5GAN g;  5CKF A;  3CCM Q;  3U23 A;  3G6E Q;  4HT8 A;  1UG1 A;  4RCB A;  3R6N A;  2YHT A;  3OMG A;  2LQN A;  1WNL A;  5LJ5 e;  1VQ9 T;  4HCC A;  1Y07 A;  2QQA A;  2A36 A;  3H0F A;  5GAO p;  4CC3 A;  4D8D A;  2RD1 A;  3TEE A;  4MML A;  4CC7 A;  1SHF A;  3CPW S;  3BDL A;  4KUL A;  4EMK C;  2E5K A;  5GAM h;  1QWF A;  4GLM A;  4V2S A;  1KQ1 A;  3EG9 A;  2Y4Y A;  2DVE A;  2JMC A;  2P0Q A;  1QQJ A;  4Y92 A;  1UGR B;  2KE9 A;  1OX9 A;  1UGS B;  1YJW T;  3SHW A;  2RH2 A;  2VXF A;  3EG3 A;  5D6W A;  4B9W A;  4DEX A;  2CT4 A;  3EG9 B;  2FPF A;  5L8R E;  3M0R A;  4FW2 A;  1K0X A;  1HYO A;  2FZG B;  3EH2 A;  3I56 A;  2F5K A;  1BI1 A;  2COW A;  2MAM A;  2R58 A;  2RN8 A;  1W2B S;  1X6O A;  2EQI A;  4N4I A;  4PJO E;  3SB2 A;  2DL5 A;  2NUZ A;  1YJN A;  2XG8 D;  2CGH A;  4Q5W A;  2DLP A;  3G71 A;  1E6G A;  3F70 A;  2RJE A;  1PKS A;  3LGL A;  2X51 A;  2LC4 A;  1WXB A;  2DTI A;  2KR3 A;  1M1F A;  1IZ6 A;  3G71 Q;  1D0X A;  1ZBJ A;  4LUD A;  2JW4 A;  2LP5 A;  3OSV A;  2HMA A;  1Q86 C;  1ACM B;  3CCU T;  2VWF A;  2RHX A;  5FU6 C;  1RI0 A;  4J7F A;  2QEX A;  3I5S A;  4R56 A;  2XDD A;  2EYQ A;  3NTK A;  2OTL A;  1NJI U;  4KBM B;  1NM7 A;  4JLI A;  4E2F B;  1NE8 A;  2COZ A;  3G1J A;  1YHQ A;  3JCM h;  1NYG A;  3OW2 S;  1PG5 B;  4JRP A;  5IN1 A;  2ZPI B;  3EGD A;  2KY9 A;  2AIR B;  4E7L A;  2OJ2 A;  1G3S A;  4OB3 B;  4A4F A;  7AT1 B;  2CP7 A;  4EMK A;  4C8Q E;  2AHJ B;  3HL8 A;  1WJS A;  3A8O B;  1X01 A;  3EGD B;  4KGV B;  3QYG B;  1SPK A;  2KAF A;  4KH1 B;  4EMK B;  1K8A U;  1QKX A;  4L5G A;  1NLO C;  4AFQ C;  1OOT A;  5IHN A;  2JJ9 A;  1I4K 1;  2K3X A;  4JS5 A;  4F7U G;  4HVW A;  3JCM f;  3THK A;  4MMK A;  2DYI A;  3NTI A;  2VAS A;  4M4Z A;  1RAE B;  1VQN A;  2CZ6 B;  5GAN 5;  1M1K U;  2EJF A;  4ZTF A;  2CT3 A;  3X24 B;  4PLL A;  4HXJ A;  5HKC A;  4ELY C;  1XNI A;  2DTO A;  3DLM A;  5LJ3 h;  1WA7 A;  4X9C A;  3TCJ A;  1HXD A;  1VA7 A;  2AZV A;  3CCS T;  1AWO A;  4FL6 A;  4OB0 B;  2KEA A;  1OZ2 A;  2CP5 A;  2PVD B;  5FWB A;  2X4Y A;  3VS6 A;  2QQB A;  4XTZ A;  5FU7 C;  1OU9 A;  2CDT A;  1Y96 B;  1PC0 A;  1WJQ A;  3E2U A;  2FHD A;  5CKE A;  5GMK j;  4J9F A;  4IUP A;  3WVE B;  1UE9 A;  2RQV A;  1W70 A;  2LQ8 A;  2GNC A;  2EQK A;  5FW9 A;  1TWB A;  3OYG A;  1WFW A;  3OS2 A;  1G8X A;  4RTY A;  4BDZ A;  3L42 A;  5FU6 B;  3CCV A;  1YIT A;  5LJ3 f;  2CYZ B;  4HCZ A;  2DF6 A;  3L1A A;  1X2K A;  1V1C A;  2DXC A;  2EPD A;  3JB9 J;  2AKK A;  1JB0 E;  1OX8 A;  1AT1 B;  1W2B A;  2LX7 A;  1GRI A;  2JVV A;  2VC8 A;  2D0N A;  3CCV Q;  1M8M A;  1Y0M A;  1I0C A;  3JAM E;  2ZPE B;  2O2O A;  3QZ5 B;  4NL2 A;  2KXC A;  1VOM A;  2YRV A;  1JJ2 S;  2QQS A;  5CQX A;  1MNE A;  2MWP A;  2QAZ A;  2L3P A;  3I9Q A;  3A8L B;  3CC7 T;  2J6F A;  3TQ7 P;  1QVG S;  2V26 A;  1KQ2 A;  2DXT A;  1VQ7 A;  2KQW A;  4JPB W;  1Y7X A;  4HVV A;  5GJW B;  5GMK h;  3OYJ A;  3OS5 A;  2MOX A;  1RUW A;  2DK3 A;  1IGU A;  4QQG A;  1I07 A;  2D9T A;  3LX7 A;  4IIO A;  4OB1 B;  3CCS Q;  1X75 C;  2VKN A;  4OMM A;  2E3I A;  2DL4 A;  1ARK A;  1SRM A;  1BCM A;  3V8J A;  3L2Z A;  4OVA A;  3CPW P;  5GAN h;  3H8Z A;  2X3W D;  5DLO A;  1K1Z A;  5D7U A;  4IKF A;  1B7T A;  4IUR A;  4RKU E;  3CCQ T;  4KT0 E;  2XMF A;  1FMK A;  1XQH A;  2EYW A;  4LD6 A;  3EFO A;  3FEO A;  2YUN A;  3T9N A;  3CMA T;  4D8K A;  3FJP A;  1S1N A;  4QT7 A;  5GAO m;  2DO3 A;  5FU7 B;  4L6V 5;  3EFO B;  3MEU A;  1LNX A;  5GAN 8;  2KK4 A;  3PNW C;  1W2B P;  4FYY B;  3J80 E;  5A0D A;  1Q95 G;  2RHZ A;  2J6K A;  5GAN f;  4FU6 A;  2DRM A;  4QVD A;  5EC7 A;  3CME A;  3SWN C;  2HQX A;  2DL3 A;  4GY5 A; 
#chains in the Genus database with same CATH homology
 4C8Q D;  3P8B B;  2CZ1 B;  4VUB A;  4BI3 A;  3J81 E;  1LOJ A;  1QVF S;  4A54 A;  4OMF B;  5GAN 7;  5CIU A;  3CXC S;  2WSC E;  4P5N A;  4DOW A;  3OYA A;  1QVP A;  3BFM A;  4M78 F;  5GAN 2;  4M7D D;  2QI2 A;  3P8D A;  4XTY A;  4HCB A;  2RK2 A;  3A8M B;  4QVZ A;  4C8Q A;  3M9Q A;  3TU4 K;  1U8R A;  4X9D A;  3GPL A;  5GAN 3;  3OYI A;  2GF7 A;  3BY7 A;  2EAY A;  4J8O A;  3MP8 A;  4ZN1 A;  2IG0 A;  3QHS A;  4M7D A;  2E6N A;  1K9M U;  1O75 A;  3JB9 H;  1H64 1;  2WAC A;  2XDB A;  3E9G A;  3C95 A;  5EG2 A;  1ZBX A;  2KMT A;  3HFN A;  5GAM f;  1K8A C;  3M5A A;  3OYD A;  3JB9 F;  4QVC A;  1VQ9 A;  1BKB A;  2XIC A;  3SFM A;  2MWO A;  2R5M A;  4C8Q B;  4M75 C;  2ZPB B;  1NPR A;  4C92 E;  5IAY A;  1Q7Y C;  1VQK A;  4FM4 B;  2QA4 A;  5GMK l;  3KUF A;  3CCE A;  4O5V A;  4M7D B;  4JUV A;  3WVD B;  3ZBD A;  1OI1 A;  4EMH A;  2RJD A;  5CCA A;  3CCJ T;  1VQP T;  4DQ2 A;  3JCM V;  3QO3 A;  2KVQ G;  2LX9 A;  1FX7 A;  3M54 A;  3NTH A;  2FL7 A;  1NZ9 A;  4JRI A;  3VU3 C;  1YIJ T;  1VQ4 A;  3MET A;  2MMP A;  4Z02 A;  4EPC A;  3OYY A;  3UPU A;  4C92 G;  1KHI A;  3LLR A;  1YBY A;  2CZ0 B;  1P92 A;  3G7Z A;  2HQE A;  5AYF A;  3FB9 A;  4OGE A;  1KC8 C;  3RKW A;  1BIB A;  1QVF A;  2P0P A;  3LYI A;  5GAO l;  4B9X A;  3CXC A;  3X28 B;  4C8Q F;  2HAX A;  3CCM A;  2M0O A;  3LWI A;  3BDU A;  2E6Z A;  2LT4 A;  4BI4 A;  2GQV A;  2EWN A;  3M56 A;  3CCR A;  4D6W A;  4M7D F;  1YJW A;  3GNG A;  3CME T;  2YLB A;  1QW1 A;  1W4S A;  3EFR A;  5IT9 E;  4F7U F;  3KBG A;  3ER0 A;  4BY6 C;  2A3L A;  3OYE A;  4JRQ A;  4E7K A;  3QBY A;  1I8F A;  4N0A A;  2VV5 A;  2YLC A;  2K57 A;  2RJC A;  3Q1J A;  2LQK A;  3JCM X;  2FVU A;  2RHU A;  3CBO A;  5LJ3 j;  2XKO C;  1R8O B;  2QDY B;  3M59 A;  2XU8 A;  4BE2 A;  4A4K A;  1M1G A;  3MHX A;  3OYF A;  4QQD A;  3JCM b;  3HRU A;  2IVW A;  2NLU A;  2M1H A;  2RA2 A;  4M7A D;  4MDX A;  1UB4 A;  4KUI A;  5HK3 A;  5GAN g;  1H3Z A;  5CKF A;  3PT9 A;  2O4X A;  3M58 A;  4CRI A;  2L8D A;  3QXE B;  2LT1 A;  2RO0 A;  1ZQ1 A;  2I2L A;  3P8H A;  4M7A A;  3OSS C;  2CZ7 B;  4OP0 A;  4M77 D;  5GMK m;  4HT8 A;  4RCB A;  2K5I A;  3OYB A;  2YHT A;  3OMG A;  4N4H A;  1WNL A;  5CAI A;  1YCY A;  1ZHI A;  5GAN 6;  5LJ5 e;  1VQ9 T;  1KD1 C;  4HCC A;  1Y07 A;  3OBW A;  4ME7 A;  2QQA A;  3CEY A;  1VQK T;  2QA4 T;  4M77 A;  2K3Y A;  3LWH A;  2O4X B;  5GAO p;  3CCE T;  2ZPH B;  5LJ5 h;  2XK0 A;  2RD1 A;  3A8G B;  5CR2 A;  4M7A B;  1BYM A;  2E1H A;  3TEE A;  4XQ3 A;  1FWZ A;  4MML A;  5KCO A;  1QVG A;  3QZ9 B;  4J6W A;  5D6X A;  1Q7Y U;  2DZC A;  2QXF A;  3CPW S;  3RMQ A;  1VQP A;  3SWN A;  3JB9 D;  2RB6 A;  3HHT B;  3BDL A;  1JRI A;  2BUD A;  5C6S A;  1VQ4 T;  1K73 C;  4M77 B;  2BIV A;  2LCC A;  3FDR A;  5GAN 4;  2ZCF B;  4KUL A;  3WXM B;  3E9F A;  4EMK C;  3OBY A;  5GAM h;  3QYH B;  3V7R A;  1OYX A;  4J6Y A;  4NS5 A;  2E70 A;  2DAQ A;  4C5H A;  4V2S A;  2JOY A;  3FC3 A;  1KQ1 A;  3SWN B;  2Y4Y A;  3OY9 A;  1N9S A;  2DVE A;  2P0Q A;  4BUG A;  3CCU A;  3C94 A;  2PUK B;  3DLL A;  3CCM T;  4C5G A;  1NJI C;  1UGR B;  4M75 D;  3HRT A;  1KC8 U;  4RCC A;  3CCR T;  1PSF A;  4C5E A;  1UGS B;  3OMC A;  1YJW T;  4LDV A;  3JCM Q;  4BB7 A;  2RH2 A;  3S3O A;  1M9S A;  2VXF A;  5D6W A;  4M7A F;  4B9W A;  5A0G A;  4M75 A;  4RG8 A;  2RK1 A;  2DIQ A;  2VGN A;  5L8R E;  5HK0 A;  4PL6 A;  1G5V A;  5KE2 A;  2XDP A;  3I56 A;  4IUT A;  4M77 F;  2F5K A;  5LJ5 f;  2X4X A;  1VQ6 A;  2D6F A;  1BI1 A;  2R58 A;  2LCL A;  2MAM A;  2Y90 A;  1U1S A;  3FIF A;  4C0Z A;  4BAC A;  3S3M A;  1W2B S;  4XTW A;  2PU9 B;  4M75 B;  5LJ5 d;  1X6O A;  4LDX A;  2D0Q B;  4A4G A;  4N4I A;  4PJO E;  4IUQ A;  3SB2 A;  3INZ A;  3CPW A;  1YJN A;  3PMI A;  2XG8 D;  2CGH A;  4Q5W A;  4C0D C;  3ZEH A;  2A7Y A;  1UEB A;  3A5Z B;  4F7U A;  3G71 A;  3PIP A;  3F70 A;  3QPH A;  3HP9 A;  3R6O A;  3UDC A;  2RJE A;  2HD0 A;  5I2M A;  3L2R A;  1KQS S;  2KSS A;  3LGL A;  2M16 A;  4Y28 E;  2LC4 A;  1I81 A;  5GAM d;  3QJ6 A;  4HA8 A;  2DTI A;  1N8R C;  1KD1 U;  2PQW A;  5D6Y A;  1FXX A;  4PJO G;  2LDM A;  4F7U B;  1LJO A;  1N27 A;  4M78 E;  1M1F A;  1Q82 C;  4JS4 A;  3H6Z A;  4MZT A;  2V8I A;  1VUB A;  5CK9 A;  1G3T A;  1IZ6 A;  2B8A A;  3QII A;  3I55 A;  1YI2 A;  3RMS A;  4JJN K;  3A8H B;  5GAN j;  4M75 F;  3RUX A;  3RES A;  5GAO n;  1M1K C;  3CC4 A;  1K73 U;  1RL2 A;  1WQ7 A;  1VIE A;  2P0K A;  2CS7 A;  3OSV A;  3OYH A;  1Q86 C;  4BY6 B;  2FB7 A;  2PVG B;  3CCU T;  4M78 G;  3SDZ A;  3LW5 E;  5FLX E;  1WPY A;  2RHX A;  5FU6 C;  1VIF A;  1VQ8 A;  1RI0 A;  2DPP B;  4J7F A;  3QG1 A;  2GFU A;  2WSE E;  3HKS A;  3LH0 A;  3QUI A;  3OS0 A;  2QEX A;  3FRN A;  3JCM P;  4R56 A;  1S72 A;  1Q81 C;  5FRM A;  2XDD A;  2EYQ A;  3M53 A;  3NTK A;  3JCM e;  1NJI U;  2OTL A;  3JCM c;  3CD6 A;  4KBM B;  4KUD K;  4JLI A;  2VYT A;  1PSE A;  2BKD N;  1NE8 A;  2HNI A;  4RMO A;  2L89 A;  1YHQ A;  3E1S A;  1UGQ B;  1XOV A;  3JCM h;  3JB9 G;  3OW2 S;  4M75 E;  3OYC A;  3X25 B;  3I56 T;  4JRK A;  2DIG A;  4J5Y A;  2EQJ A;  1VQ6 T;  1G3W A;  4JRP A;  3CCS A;  3L2U A;  5IN1 A;  4E7J A;  1KQS A;  1KG1 A;  2ZPI B;  4WF2 A;  2KY9 A;  4XU3 A;  1BI3 A;  4E7L A;  3S3N A;  3G4S A;  1G3S A;  2ZPG B;  4OGC A;  3EAE A;  3VKI A;  2JTF A;  2X4J A;  2DKG A;  4LDW A;  4OB3 B;  5J3B A;  3UT1 A;  4A4F A;  4EMK A;  4C8Q E;  1YJN T;  2AHJ B;  4C0F A;  4CI0 C;  3HL8 A;  3M4G A;  3G71 T;  2K5F A;  4M75 G;  1WJS A;  2E65 A;  3A8O B;  4A4H A;  1AHJ B;  2H3J A;  3JRZ A;  3LGF A;  1X01 A;  1EIF A;  4ZGJ B;  3OA6 A;  5FRN A;  2V8J A;  4M7D E;  2GCX A;  4F7U E;  2XI9 A;  5LJ5 g;  3QYG B;  2DTH A;  3VJP A;  2ZZD A;  3ME9 A;  4PNO A;  2F5T X;  4BE0 A;  2KAF A;  1D3B B;  2X35 A;  2WSF E;  2E64 A;  5M9O A;  1BIA A;  4EMK B;  1K8A U;  4X34 A;  5LL6 S;  4L5G A;  4E7I A;  1BI0 A;  5A2Q E;  4C8Q G;  1N8R U;  2ZPF B;  3RIR A;  4DA4 A;  3FLG A;  3JB9 I;  4BI8 B;  3GLX A;  3I55 T;  1YI2 T;  4E47 A;  4EMG A;  4M7D G;  1I4K 1;  2XID A;  1Y71 A;  3PTA A;  5GAM g;  2RM4 A;  2K3X A;  4JS5 A;  1B34 A;  4F7U G;  3CC4 T;  1Q82 U;  4J7I A;  2MF2 A;  3JCM f;  3MCA B;  3X26 B;  3AHU A;  4MMK A;  3PFS A;  5DLQ E;  3NTI A;  3OW2 A;  1M8V A;  1M5Q 1;  3RER A;  3JSC A;  1VQN A;  2CZ6 B;  3JCM d;  5GAN 5;  4QQ6 A;  1M1K U;  2GFA A;  2EFI A;  2EJF A;  1VQ8 T;  4ZTF A;  2R5A A;  3X24 B;  2QEX T;  4QW2 A;  1NPP A;  1S72 T;  2LNV A;  4PKC C;  4PLL A;  1B34 B;  1Q86 U;  3CD6 T;  4RG2 A;  4A53 A;  4DOV A;  5HKC A;  2OTL T;  5J39 A;  4ZGE B;  2O01 E;  1KHC A;  3CBP A;  3ASK A;  2DEQ A;  3CPF A;  5LJ3 e;  4ELY C;  1YHQ T;  1N6A A;  4PJO C;  4YTL A;  3OS1 A;  3L2Q A;  4NOY A;  1XNI A;  1Q81 U;  2DTO A;  5CKH A;  2EJG A;  2Y4X A;  1MGQ A;  2EJ9 A;  3QKJ A;  4IUV A;  4MZM A;  5CKB A;  3DLM A;  5LJ3 h;  5KCH A;  3OYM A;  4X9C A;  3TCJ A;  4C0D B;  5CVI A;  1HXD A;  3SD4 A;  3CCS T;  4FL6 A;  4OB0 B;  2RHI A;  3G4S T;  4OF1 A;  4C92 C;  2DZ9 A;  3O8V A;  3CC7 A;  1OZ2 A;  1U1T A;  2C06 A;  2PVD B;  4XTU A;  4C0G A;  2X4Y A;  3OYK A;  1VQL A;  1QP2 A;  4PLI A;  2QQB A;  2M9U A;  4IUU A;  4XTZ A;  4M78 C;  3JCM W;  2E10 A;  5FU7 C;  3MP1 A;  3URG A;  3CBM A;  1Y96 B;  3QJY A;  3V7C A;  1WJQ A;  3N5B B;  2RHY A;  3HPW A;  4M7A E;  2FHD A;  5CKE A;  2EQU A;  3M55 A;  5GMK j;  2RI5 A;  1HK9 A;  2DJZ A;  3QDR B;  3DB4 A;  4IUP A;  2L3R A;  3WVE B;  3L2W A;  3CCL T;  1DJ7 B;  2VXE A;  5KE3 A;  2PVO B;  2LQ8 A;  4NL3 A;  3L2V A;  4L59 A;  4E7H A;  2EQK A;  3E19 A;  2EQM A;  4M77 E;  3RKX A;  2R57 A;  3OYG A;  1VQ5 A;  3ZFJ A;  2XD0 A;  3OS2 A;  4HT9 A;  4BDZ A;  1VQO A;  3M4Y A;  3L42 A;  1IRE B;  4R55 A;  2JNG A;  5HY6 A;  5FU6 B;  3HSB A;  3CCV A;  1I5L A;  4M7A G;  4ZTJ A;  1YIT A;  4LD9 K;  3PGG A;  2CKK A;  2HBP A;  5I2S A;  5LJ3 f;  2CYZ B;  3JCM J;  4HCZ A;  4JDS A;  3L1A A;  4MDW A;  4XK8 E;  4EDU A;  3KXT A;  3CCQ A;  2P4T A;  1VQN T;  4M77 G;  1SSF A;  2DXC A;  2G3R A;  4FT4 A;  2DD5 A;  3C12 A;  4LDY A;  3JB9 J;  5LJ3 d;  3RKY A;  1JB0 E;  4XTX A;  3VUZ A;  4J83 A;  3VV0 A;  3UWN A;  5LJ5 j;  4FIB A;  3GOX A;  1W2B A;  3PIO A;  3CC2 A;  3X20 B;  5GAO r;  2JVV A;  2VC8 A;  3JAM E;  3CMA A;  1MHN A;  2ZPE B;  3GF5 A;  3MP6 A;  3JCM g;  3QZ5 B;  4C8Q C;  4NL2 A;  2YRV A;  1GXI E;  4J6X A;  1JJ2 S;  1XTD A;  3C4S A;  2QQS A;  2QTX A;  3GP8 A;  2EKO A;  2XHC A;  1YJ9 A;  4M7D C;  2L5Q A;  4XU2 A;  5CQX A;  2MWP A;  1M90 C;  3QSU A;  3DKM A;  5GAM j;  3A8L B;  4XTV A;  3CC7 T;  3MO8 A;  3MEW A;  3GIB A;  1QVG S;  3V8K A;  3MEV A;  1KQ2 A;  2DXT A;  2V8K A;  2VGM A;  1VQL T;  1VQ7 A;  3OQ5 A;  3VUB A;  5GMK e;  1WQW A;  2ZGW A;  4TVR A;  2KQW A;  3BW1 A;  2OTJ A;  1D3B A;  2E5Q A;  1Y7X A;  2JN0 A;  2K2V A;  5GMK i;  4XAX B;  1WGS A;  2K5L A;  2DXU A;  4N4G A;  5GMK h;  3OYJ A;  5DM7 R;  2E41 A;  3S6W A;  3G6E A;  1O9S A;  4XU1 A;  3OS5 A;  4OB2 B;  5KH6 A;  1OZ3 A;  2DK3 A;  3M57 A;  4QQG A;  4ELZ C;  2D9T A;  3LX7 A;  3CCL A;  1VQM A;  4PJO D;  4OB1 B;  1X75 C;  2RI3 A;  3V8L A;  1QP3 A;  2QQ9 A;  3HFO A;  2VUB A;  1VQ5 T;  5CKD A;  2EIF A;  5GAN e;  2LVM A;  3OB9 A;  3VYG A;  1V29 B;  4ZGD B;  4PJO A;  3EFS A;  3V8J A;  1K9M C;  1BI2 A;  1VQO T;  4BDY A;  3L2Z A;  2FYK A;  4OVA A;  4C5I A;  2JTM A;  5GAN h;  3H8Z A;  4C92 D;  3CCV T;  2RJF A;  5DLO A;  1G3Y A;  4FT2 A;  5C0M A;  4FSX A;  1YIT T;  2KDS A;  5CQY A;  4IKF A;  4IUR A;  5J26 A;  4LDU A;  4RKU E;  1UGP B;  4C92 A;  2OAU A;  2DXB A;  3CCQ T;  1JJ2 A;  4KT0 E;  4M78 D;  4PJO B;  3DB3 A;  1WJR A;  2JZ2 A;  1XQH A;  2RI2 A;  3HRS A;  1TH7 A;  3MEA A;  4M78 A;  4N0A C;  3TRE A;  2QQR A;  3NFC A;  4LD6 A;  5I21 A;  3CC2 T;  1M4Z A;  3FEO A;  1JBM A;  4O6J A;  3OYL A;  3T9N A;  4C92 B;  3CCJ A;  3CMA T;  4Y91 A;  5GAM e;  4A4E A;  3FJP A;  5FRO A;  2LTO A;  5LJ3 g;  5DY9 A;  3V7S A;  4BE1 A;  5GAO m;  4ATO A;  5A0L A;  2DO3 A;  4MZP A;  5CO7 A;  1YIJ A;  1YJ9 T;  5GAO q;  1N9R A;  4M78 B;  3J7A F;  5FU7 B;  4JLG A;  4L6V 5;  3MEU A;  4M7A C;  1LNX A;  5GAN 8;  1Y96 A;  2K4Y A;  2KK4 A;  3OYN A;  2JUF A;  3PNW C;  4UC4 A;  3GNF B;  2PUO B;  1VQ7 T;  4ZN3 A;  3VYH B;  1M90 U;  2E12 A;  4HKE A;  2DD4 A;  5A0D A;  4M77 C;  2MI6 A;  4PJO F;  3J80 E;  2OTJ T;  2RHZ A;  4BD3 A;  3PMT A;  5GAN f;  4FU6 A;  3G6E T;  2X4W A;  4GLK A;  4QVD A;  5GAN d;  3CME A;  3SWN C;  4C92 F;  4II1 A;  1VQM T;  2HQX A;  4GY5 A;  4XU0 A;  2F69 A;  2LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...