2XK0A

Solution structure of the tudor domain from drosophila polycomblike (pcl)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYCOMB PROTEIN PCL
publication title Structure of an Atypical Tudor Domain in the Drosophila Polycomblike Protein
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xk0A00
3S6WA 5KCHA 3PMIA 3OB9A 1OZ3A 5C6SA 3L2RA 3LLRA 3BDLA 4IUVA 2HQEA 2PQWA 1N27A 3L2WA 4EDUA 3PNWC 1OI1A 2RI5A 4NS5A 4PLLA 2RJFA 3OYNA 2M1HA 3MO8A 3MP1A 3OQ5A 3MEAA 2LCCA 2M16A 3FC3A 2RHIA 3H6ZA 2RJDA 5IN1A 2NLUA 3M9QA 4HCZA 1OZ2A 2B8AA 2R5AA 2RI2A 3FDRA 3Q1JA 2X4WA 4IUUA 4QQDA 4A4HA 1OYXA 3SD4A 3OY9A 3GOXA 4II1A 3PMTA 2EKOA 2BUDA 2GFUA 2GF7A 2BIVA 4A4GA 2E5QA 2LTOA 5CIUA 3OYDA 2P0KA 2E6NA 5KCOA 4N4IA 4ZTJA 2MWPA 5M9OA 2K3YA 1H3ZA 2O4XB 3KUFA 2M0OA 5J26A 4BE0A 2DAQA 4CRIA 2RHYA 4E7LA 2EQUA 3QIIA 4PLIA 4E7KA 3O8VA 4E7IA 4C5EA 4FU6A 2XDPA 3OYBA 3MEWA 3OA6A 2X4YA 1XNIA 4BDYA 4E7HA 5D6WA 3FLGA 1MHNA 4RG2A 3OS0A 4GY5A 5KE3A 3QBYA 4E7JA 3P8HA 3OYLA 1SSFA 2EFIA 3DB3A 4N4HA 2CKKA 4QVZA 5D6XA 2L3RA 2R58A 3OYAA 3OYKA 4BDZA 2BKDN 2R57A 3L2UA 1WJQA 3DB4A 3S3NA 4OVAA 3LYIA 2RJEA 4BD3A 3DLMA 5C0MA 5KH6A 2L8DA 5FROA 4A4EA 3ME9A 2EQJA 2EQKA 4QW2A 4IUTA 2K3XA 2O4XA 4ZTFA 4LD6A 4Q5WA 2QQSA 2GFAA 3E9GA 3L2QA 3OS2A 3OS1A 3C4SA 3OYMA 2YRVA 3OYJA 5IAYA 1KHCA 2RO0A 3QKJA 4IKFA 2F5KA 2RHXA 3E9FA 3LGFA 4BACA 2RJCA 3LH0A 2EQMA 2G3RA 3F70A 3MP8A 2VYTA 4PL6A 2X4XA 2MWOA 3QJ6A 5D6YA 3S3MA 1G5VA 4C5HA 4IURA 2QQRA 1WJSA 4BE2A 3FEOA 3L2VA 3NTIA 2D9TA 3L42A 3OYGA 5FRNA 3OYCA 2HQXA 4L59A 2RI3A 2RHUA 2LVMA 3UT1A 3ZEHA 4X34A 2RHZA 1WGSA 3UWNA 2L89A 3NTKA 4B9WA 3S3OA 2DIQA 2DIGA 5J39A 3OMCA 3OYHA 3META 4Z02A 4UC4A 3H8ZA 3OMGA 2LDMA 3PFSA 2WACA 2R5MA 5FRMA 3CEYA 4BE1A 2JTFA 3LGLA 4C5GA 2XK0A 4C5IA 2LRQA 3EAEA 3MEVA 3MEUA 3MP6A 4QQ6A 3LX7A 5KE2A 3P8DA 4IUPA 4IUQA 2JZ2A 3OYEA 3OYIA 4B9XA 4N4GA 3ASKA 3NTHA 1RI0A 4FL6A 2FHDA 3OYFA 1WJRA 4QQGA 4A4FA 2X35A 2IG0A
chains in the Genus database with same CATH superfamily
5CVIA 2RQVA 2GTJA 3PMIA 3RIRA 1OZ3A 3NPFA 3LLRA 4OB2B 1F1BB 3C12A 4RTZA 5GAOr 4M77B 2A28A 2PUKB 5GAMd 3VS6A 2RH2A 1B07A 4HCZA 3FDRA 3JRZA 2L2PA 3VRYA 1A0NB 2YUQA 2P0KA 1K8AC 1JEGA 3UPUA 3I9QA 1OX8A 4HCKA 5DLQE 2YLCA 4HVVA 4C5EA 2JS0A 4FU6A 2I0NA 3X20B 4EMKC 4M7AF 3RBBB 3OS0A 3OBWA 1SSHA 2YUNA 4BDZA 1VQ6A 1D3BA 1I1JA 1EIFA 2PVDB 1VQ4T 1O9SA 3OW2S 3DLMA 3X28B 4A4EA 1UFFA 2B86A 1JXMA 4HKEA 1K8AR 4Q5WA 5LL6S 1YBYA 3M0UA 1Z9QA 1WHKA 2YRVA 4X1VA 1K73U 4IIMA 1T0JA 1IB8A 1JB0E 3CCRA 3QUIA 1OEBA 3EFOB 4HCCA 1PC0A 3VS7A 4DEYA 4WCIA 2ZPFB 2JMCA 1E7OA 4N0AA 3L42A 3OYGA 4PKCC 1KG1A 2HBPA 2RHUA 4ZNXA 1M1FA 2EGAA 1X6OA 4JRPA 3C94A 1M90C 2E41A 3QHSA 3CEYA 5CO7A 5IHNA 1TOVA 2SRCA 1AHJB 4C8QF 1IGUA 1VQOQ 3QG1A 4M78F 2LT1A 1VQ6T 1P92A 3AT1B 2VGNA 1QMCA 1M4ZA 1KC8C 1IXDA 3M0PA 3SWNB 2F2WA 1VQPA 1G2BA 1NPRA 3LH5A 2EQIA 1SRLA 5LJ5f 1TU0B 2VXFA 4RTXA 1W6XA 3V8KA 2L3QA 2H3JA 3H6ZA 3CCRT 3VS3A 2RJDA 1M90R 3VS1A 1X6BA 4F7UE 4E7LA 5GAN2 2KNBB 4M7DD 1YCYA 2GFUA 4PJOC 1VOMA 2ZCFB 2HD0A 1KC8R 2VUBA 4MZMA 4C0DB 1TTHB 3R6OA 3M59A 4CC4B 3OYBA 4FW1A 4XTWA 3FLGA 1ZLMA 1OULA 4RG2A 1NEGA 1LJOA 2K5FA 5GMKe 1X27A 3OYAA 1D0XA 1HJDA 5DM7R 3H9NA 4WTOB 3CPWP 3JCMd 2A37A 2K7AA 2EQKA 3QZ5B 3E9GA 5KYUB 3P8BB 2E12A 4NL2A 3OYMA 1D1CA 2DXTA 1VQ4Q 1PSFA 1PRMC 1WFWA 2K3BA 3JSCA 1XQHA 1SF9A 1OOTA 4RTYA 2CP0A 1IRXA 3NTIA 4X9CA 1VQMA 4L59A 5FWBA 2RHZA 3NTKA 1VYTA 1QP2A 3OMCA 5LJ5j 4HVUA 3OMGA 3REBB 3BDUA 4C5GA 5LJ3f 1RAFB 5A0LA 2W10A 4OP0A 3CBOA 3OYFA 1RACB 2KMTA 2IG0A 3EFSA 2JJ9A 1RAGB 3EFRA 2AK5A 3VS2A 5IHKA 3OQ5A 2AKLA 1UTIA 2HBWA 3U23A 1YI2A 1VQ6Q 3H0HA 1JJ2P 2EWNA 1YNZA 2YWWA 1K9MC 4D6WA 2LQNA 3ULRB 1NLOC 2ENMA 2GF7A 1RL2A 2BIVA 2HDAA 2FPFA 3H0IA 5I2MA 2E3HA 3CCRQ 1BCMA 2MK5A 1SHFA 1FWZA 4M77A 3OSVA 1Q81U 2E6ZA 1R8OB 2E10A 1QVFS 4LDXA 2HZYA 2CT3A 3CCUA 4N4HA 1C1AA 2L3RA 4GBQA 2QA4A 3EG3A 1K9MR 2KVQG 3JB9J 5C0MA 3CCLA 5GJVB 1R0BG 2QI2A 1BKBA 2GFAA 2ZGWA 3L2QA 1YI2T 1ZUUA 1VQ9A 4RMOA 2JM9A 2CP6A 2F1LA 1W2BP 2EW3A 2EPDA 1Q82U 1JO8A 2G3RA 4J9CA 2C0IA 1JU5C 3QJ6A 2XU8A 3EG0A 2JNGA 4M4ZA 3CCSA 1QCNA 4F17A 2LT4A 2OI3A 4MDWA 1NBEB 3VUZA 2PVOB 4FT4A 2EVRA 1CSKA 1M27C 2YUPA 1DJ7B 2DRKA 1ZBXA 5J3BA 2BTTA 1YITA 1PHTA 3EFOA 4J8OA 1WHMA 2QA4T 1H92A 2K5LA 2M02A 5GANe 4ZGJB 2HNIA 5FLXE 4EDUA 3EGXB 3CCMA 1GCPA 1T3SA 3CCLT 3PGGA 3UDCA 2DM1A 2DA9A 1FX7A 2Y4XA 1KD1C 3MEAA 3CC7A 2RA2A 1HK9A 2RHIA 2B8AA 3FIFA 2CT4A 2FVUA 2QASA 3CCST 4PJOD 3M57A 3SWNA 4M7DF 1H3ZA 4DOVA 4ELZC 1BI2A 1BI0A 4E6RA 5GAMe 2EYQA 3QSUA 5ECAA 4CC3A 1VQ8A 1SHGA 3VYHB 3I55A 4M7DB 5GMKm 1YITT 1SG5A 1K4US 2CKKA 5D6XA 4BB7A 3CCMT 1WZOA 3CCVA 3H41A 2NYSA 3ME9A 3RUXA 3VUBA 1N8RC 2V26A 3CC7T 2ATCB 1VIFA 4GLMA 1EX4A 2OAUA 3VRZA 2H3EB 1WHJA 5D6YA 2OTJA 2K5IA 2W0ZA 2DXBA 1YI2Q 2D9TA 3SFMA 3HRSA 1VQ5A 1TSFA 4ATOA 4HVWA 3VU3C 4E2FB 4RTUA 4AFQC 5KYUA 3G1JA 4Z02A 3M5AA 2LDMA 2V8KA 3I55T 1GCQC 3HRTA 2XK0A 3CXCP 3EAEA 1K73C 2LQWA 3CPFA 4IUPA 3JV3A 3RERA 4LUDA 1YCSB 2FHDA 5D7UA 1ZA1B 1RABB 3OW2P 3CCVT 1H3HA 4DBRA 5KCHA 1UEBA 4PJOG 4M75D 4IUVA 2HQEA 2JMAA 5FWCA 1RLPC 1TG0A 2QA4Q 2KSSA 2D6FA 3M4GA 4DOWA 2EIFA 5GAN4 1ARKA 1G3YA 5A0GA 2OTJT 5LJ5d 1K73R 1I5LA 3CCLQ 2DLPA 2KI7A 2F2XA 4P5NA 3TQ7P 4CC7A 2CSQA 1VQ9Q 2JUFA 5KCOA 2MWPA 4C8QE 5M9OA 3CCEA 1VQ5T 3KUFA 4M78E 2DAQA 2EQUA 2KRSA 2WSCE 4FW2A 2FO0A 1XNIA 2KBTA 3JCMQ 2RK1A 1V29B 3CCSQ 1WPYA 1QWEA 2D0QB 3OYLA 1IHWA 4FYYB 1YJWA 3L2UA 2RB6A 2A08A 2VASA 2EGEA 1RUWA 3UA7A 3QO3A 2HL3A 2KRMA 3CC4T 2NUTB 3PTAA 1MMGA 1YITQ 5GAOn 2VC8A 1KHCA 3CCMQ 1NE8A 2KR3A 3JB9G 2RJCA 2CP3A 1TH7A 2EYZA 1G5VA 3JCMe 3CBMA 3VS0A 3RMSA 3VJPA 3CC7Q 2D8HA 4LD9K 2P4RA 3CCET 3OYCA 5FRNA 3M56A 4J9EA 2PU9B 2DIQA 2AIRB 4IIOA 3JAME 2RM4A 1N6AA 4C5IA 1RAEB 3QXEB 3HL8A 4KGZB 3OYEA 2CUBA 2CP2A 4C92C 2V8JA 2YUOA 1MMAA 5CKFA 1K0XA 3T9NA 5FU7C 5LJ3d 1LCKA 4F04B 3I55Q 2ZAEA 3M0TA 3SB2A 5GAN7 2JXBA 2M1HA 4WF2A 3HTRA 3HFNA 3THKA 2CREA 1NEBA 2QG9B 3CCVQ 2AT1B 1B34B 1K1ZA 2FRYA 4IUUA 1ZSZC 1MNEA 2EKOA 3GIBA 2LMJA 2FG0A 4Z8AA 4M77F 1KQSA 3EGXA 2GQIA 2FPDA 2JS2A 4L6V5 3J80E 3EG2A 5KYXB 2RHYA 1RAAB 4RCBA 1M3BA 3URGA 4E7SA 1VQ7A 2OTJQ 4ME7A 2A0FB 1KQ2A 1UJYA 3QBYA 4PJOB 4J9IA 1VQ5Q 4PJNA 1PM3A 1GBRA 5GMKi 1AZGB 1M1GA 2COWA 4J7IA 2XD0A 2EQJA 3EGUA 4FCYA 1B7TA 2P0PA 4LD6A 3GLXA 4LE9A 3EH2A 3RR6A 1Y96B 1Q81C 4RTVA 4M7DA 4IKFA 4BACA 4E7ZA 3OSSC 4OMLA 3WXMB 2FPEA 1SEMA 2DYIA 1X69A 1NLPC 4IURA 1PKTA 3CC4Q 3A5ZB 1AEYA 2E4HA 2VXEA 3X24B 4HA8A 3UWNA 1VQ7T 2A3LA 5GANg 2XMFA 1MGQA 2JTFA 1QVFP 2Z0WA 1Q95G 1WIEA 3HKSA 4KH0B 4RG8A 2CGHA 1Q81R 3CCEQ 3VS4A 1YHQA 1YN8A 1WJRA 4L5GA 2JN0A 3CPWA 2O9VA 5C6SA 1K9AA 2VGMA 3FJ5A 3G4SA 4CI0C 1AT1B 1IZ6A 2MCNA 2QEXA 4NS5A 1AWJA 1KK7A 1FMVA 3LW5E 4M75F 1VQKA 5I2SA 2AKKA 3M9QA 4A4HA 1GBQA 1S1NA 2X4WA 4OMPA 1M2OA 2HKNA 5GAMg 4R55A 1G3WA 4M75B 1CKAA 1QVGP 1Q82R 2K57A 3ZL7C 4ZTJA 1OV3A 4C0GA 2M0YA 1W1FA 2MMPA 3QZ9B 2PVGB 1JQQA 4KGXB 1G83A 2JW4A 1WI7A 5KE3A 2ROLA 3BW1A 1YHQT 5CKDA 1LVKA 3A8HB 4JUVA 4XQ3A 2E3IA 2L8DA 3RDVA 2QEXT 2J6KA 2WSEE 1AWOA 1NM7A 1IO6A 4BI3A 2K6DA 1VQKT 3V7RA 2OJ2A 1JBMA 1WQWA 1JJ2A 2PZ1A 1MMNA 3MJXA 1IGQA 4FSXA 1VQPT 3UT1A 3CCQA 2KYBA 3KBGA 4B9WA 3OYHA 2KT1A 2NUTA 4PK4A 4AG2C 5A2QE 1H8KA 3I56A 2DZ9A 2ROTA 4EMHA 2P4TA 2XHCA 3MEVA 4XK8E 3HRUA 3LX7A 3OYIA 2MOXA 4C92E 4C92D 1RADB 4M7AC 1VA7A 3I35A 1VQ7Q 3CD6A 2QTXA 1Z9ZA 1UGRB 2L3PA 5L8RE 1U8RA 2EJFA 4ZN3A 3FC3A 5IN1A 2R5AA 1W2BA 2EBPA 4FIBA 2BE7D 1FMWA 1VUBA 1X2QA 1UGQB 4F7UG 2AHJB 5KYNA 1BIAA 5CIUA 1FYNA 2QDLA 3QYHB 1ABQA 2K3YA 1E6GA 4J9HA 5L23A 3N5BB 3QIIA 4PLIA 5GMKl 1WYXA 3JCMb 2LC4A 2JTEA 1ZBJA 3V8JA 1GFDA 1MHNA 5LJ5e 1B34A 1WQ7A 2EFIA 2RQUA 2EJ9A 4FYVB 1VQMT 4CC2A 4OMOA 4C8QC 5KYXA 2K3XA 4M78C 1WXUA 2YT6A 1YHQQ 1AD5A 3OS2A 3JCMg 5CR2A 1Q86U 1GRIA 2ZZDA 3UF4A 3JCMJ 1FXXA 2LNVA 1BBZA 3G71A 4PJOA 2QXFA 4DBFA 2QEXQ 3FEOA 4C92G 3SHWA 1T0HA 1VQKQ 2QK0A 2P0QA 2V8IA 1WGSA 1X01A 2DL5A 3LGLA 1WA7A 4AT1B 1QW1A 1Y96A 5LJ3j 2DILA 1VQPQ 2X9HA 4B9XA 4J9GA 4QQGA 4OMMA 2A7YA 9ATCB 1KQSS 1Y0MA 5GAOm 1X2KA 1N27A 2CSIA 4NL3A 2OX7A 3PNWC 4J9DA 1PCXA 2VB6A 3L2ZA 4XTUA 4A63B 1C0MA 2GCXA 2L5QA 2IVWA 1HXDA 2VKNA 2DE0X 2NLUA 1PRLC 3G71T 1YP5A 3I5SA 4OB1B 3CCUT 3PMTA 1AWWA 1WNLA 1RAHB 4A4KA 2DXUA 1LOJA 2DBMA 1FMKA 2D0NA 2YHTA 1NPPA 2O4XB 1M90U 5GMKh 2DVJA 2DVEA 1SRMA 4KUDK 1Y07A 3O5ZA 1VQ9T 3MKDA 3WVDB 3G6EA 3GPLA 3X26B 3CXCA 4LDVA 3EG9B 2R58A 2R57A 4D8DA 5EG2A 2CZ7B 3A8GB 1BB9A 2CZ6B 4DEXA 2VVKA 4M75A 2LX7A 5CQYA 5HKCA 1SPKA 1QVPA 2DTOA 3TSZA 2BZXA 2DJQA 2J6FA 4QW2A 1BIBA 3M58A 2ZPBB 2DTHA 3GNFB 3OS1A 4J6WA 4M77E 4F7UB 4HCBA 2OTLA 2LX9A 2O9SA 2DRMA 1WHGA 1VQMQ 2GBQA 4PL6A 5GAN5 1MV3A 5IHIA 4BE2A 2QQBA 4BUGA 2COZA 4FYWB 3NHNA 1D0YA 3G6ET 4OMNA 5CKBA 2DXCA 3JCMV 3TVTA 3DLLA 4QQ6A 2XIDA 4JZ3A 4EPCA 2LP5A 3QJYA 3NTHA 4KT0E 2KEAA 3VV0A 1M8VA 3UA6A 3MPUB 4M7AE 4M7AD 3RMQA 3VYGA 2AZSA 1YIJA 1Y57A 4J5YA 2JT4A 2X3WD 1BU1A 3EH1A 1VQ8T 2OTLT 3JB9D 3RKWA 4C92B 5IH2A 3CC2A 1MV0B 4QQDA 1WHHA 1PKSA 2DJZA 2DERA 2KE9A 3QYGB 2QDYB 2FZKB 3BE3A 2QGFB 3SDZA 3LWHA 4OMQA 2CP7A 1QKWA 1D0ZA 2M0OA 2GQVA 3FRNA 3G71Q 2HCKA 1D1BA 2NWMA 3PIPA 3MEWA 2X4YA 1AWXA 3CCUQ 2DL7A 1BYMA 1WX6A 1I5OB 3M4YA 1ZSZB 2MYSA 5GAOq 1JJ2S 4Y91A 3P8HA 2CZ0B 2DEUA 1S72A 3DB3A 3CCJA 2ECZA 3ZFJA 2DZCA 4VUBA 2RD1A 3LYIA 3TEEA 3TCJA 1YIJT 2MIOA 4R56A 2KGTA 3M0RA 2MAMA 4C8QD 2DETA 1H641 2BZYA 4M78D 5AYFA 2MI6A 4F14A 2ABLA 4AFZC 2NUZA 3C0CA 3CC2T 4V2SA 2F5KA 2E5KA 3HFOA 1OU9A 2LCLA 2K79A 4KULA 1M1KU 3I5RA 3S3MA 2X3XD 7AT1B 1IREB 1WJSA 2JTMA 3HP9A 3M54A 1UGSB 3HSBA 2LVMA 1GXIE 2LNHB 4M7AG 2L89A 3S3OA 4EMKB 2DIGA 2QQ9A 3CBPA 1VIEA 5GANh 2LRQA 3JCMc 4M7DC 1VYVA 3TU4K 3P8DA 1YJ9A 1BK2A 1S72T 3CCJT 5DY9A 4AG1C 1AVZC 2DD4A 3VKIA 2D8JA 3G6EQ 3L2RA 2XICA 2DL8A 2RI5A 4PLLA 3OYNA 1KHIA 2H8HA 3VS5A 1MUZA 2RMOA 3E19A 1YJWT 5GAMh 2CH4W 3C95A 4PJJA 4AFSC 2E5QA 4XU1A 5LJ5g 3CMEA 1VQ8Q 2OTLQ 4N0AC 5J26A 2O31A 2QTVA 1OU8A 1GCQA 4E7IA 2ZPHB 4J83A 2V1RA 4C8QG 1NYGA 2P84A 1NYFA 2PTKA 4M78G 1QVFA 2YLBA 2DL3A 2EAYA 4GY5A 1YJ9T 1RLQC 2QAZA 4E7JA 4J7FA 1QCOA 2DPPB 2O01E 3EHQA 3OYKA 1G3TA 4OMFB 1RI9A 3S3NA 2ZPIB 2LCSA 4BD3A 1LPLA 4XAXB 2X51A 5KH6A 2I2LA 3L1AA 1KD1U 2O4XA 3DKMA 5AT1B 5CAIA 1Q7YU 4PJOF 2KXDA 4B6MA 3LGFA 4J6YA 3A98A 4FM4B 1W70A 3EG9A 1YIJQ 2X4XA 2MWOA 4C5HA 2DNUA 3CMET 1I07A 1QVGA 2FEIA 1N9RA 2LJ0A 4JJCA 4JRIA 2HL5C 2KXCA 2L0AA 4MMKA 1QLYA 3NGPA 3CC2Q 2DD5A 1PWTA 1U5SA 3META 3H8ZA 3OS5A 2WACA 4X9DA 2YDLA 2ESWA 4XU3A 4F7UA 2JOYA 3PVLA 1Q86C 4MZTA 1VQNA 4AMCA 1PNJA 3ASKA 1RI0A 4FL6A 4J9FA 5CKEA 2E1HA 1QWFA 5FU6C 1ACMB 2YXYA 1N8RU 3UATA 4DQ2A 2KAFA 3CQTA 2K4YA 2KRNA 1NJIU 1KIKA 2XI9A 2C0TA 2D1XA 5LJ3g 1S72Q 3CCJQ 3NFCA 4XTYA 2M16A 2J05A 2GNCA 4PJLA 1VQLA 1OZ2A 3CXCS 3Q1JA 1W4SA 5KYWB 4LDYA 3GOXA 4PJMA 4M7AB 1Q86R 3A8MB 4II1A 4KGVB 1Q82C 1GL5A 3RKXA 3JB9F 3M0SA 4A4GA 2E6NA 4N4IA 1MNDA 4JZ4A 5GAN8 1ZHIA 3ER0A 4PFOA 1U1TA 2OAWA 1TUDA 2M9UA 1MMDA 1HD3A 4E47A 5DLOA 1AZEA 2DK3A 1YJWQ 1Y71A 4E7HA 2KT8A 4QKUA 5D6WA 1ZSGA 4XU0A 2ZPGB 1X43A 4KBMB 4LXCA 5HY6A 1VQNT 4C92A 3INZA 1N9SA 1KFZA 1T3LA 4OGEA 4QVZA 1PG5B 2HSPA 2E70A 3QDFA 3V7CA 5A0DA 2HAXA 1KQSP 4ELYC 5CCAA 1YWPA 2COYA 3RESA 2L3SA 1D1AA 1YJNA 3RNJA 4IUTA 4ZTFA 1YJ9Q 2E65A 4BY6C 1E6HA 3C4SA 1VQLT 1UHFA 3JCMh 3M55A 3BY7A 3V7SA 2GGRA 2BE9B 1ZSZA 2AZVA 3F70A 1IHVA 2FZGB 2C06A 1QQJA 4J6XA 2KY9A 2MF2A 2X4JA 4Y28E 1ZX6A 4C8QB 2M51A 5IXBA 2HKQB 4M78B 8AT1B 2HEQA 2DBKA 2FYKA 3G4ST 2K2VA 4FYXB 5I22A 5GMKj 4M77C 3KFVA 2PUOB 3CMEQ 4M7DE 5KE2A 2RK2A 2O88A 2JZ2A 4DBHA 2EKHA 2KK4A 1HSQA 5GAOl 2CYZB 4A4FA 1XOVA 1YJNT 5KYYB 3JB9H 2JVVA 4O6JA 3QPHA 1OQKA 2RJFA 3HHTB 4EMKA 1O75A 4MMLA 2IIMA 1WLPB 6AT1B 3PIOA 2RI2A 1BI1A 3SD4A 2KDSA 4JJBA 1X75C 1WHLA 2A36A 1ZUKA 4J9BA 2FZCB 2FB7A 2DTIA 5IXFA 3OA6A 3IQLA 2MPXC 4BDYA 3J7AF 4OB3B 1SSFA 4XTXA 4LDUA 1WDXA 2YSQA 1WJQA 3QDRB 8ATCB 3CCQT 4MDXA 2EYXA 1D09B 1VQNQ 3QWXX 4PNOA 2XKOC 1UE9A 3I56T 2XG8D 4ORZA 5GANf 4XTZA 1I0CA 3X25B 4BI8B 4JRQA 4Y92A 1QP3A 4HT8A 4M7DG 2DYBA 2F69A 2QQRA 1R0CB 3CD6T 1UGVA 4M75C 1M8MA 4ZGEB 1KSWA 1VQLQ 3ZEHA 1EZZB 1GFCA 4X34A 4ANJA 3SWNC 3EGDB 3QWYA 4UC4A 2LJ3A 2R5MA 3RKYA 2DL4A 4JPBW 1UG1A 3M0QA 1K76A 4LUEA 4ZGDB 2ED1A 4N4GA 4BI4A 3D7SB 1WXBA 3G4SQ 1M9SA 1K8AU 2X35A 5GAMf 3JB9I 1M1KC 2O2OA 2DFUA 2FRWA 3PVQA 4MZPA 3PT9A 4C0DC 3CMAA 4QVDA 1TS9A 1OPKA 3OY9A 1J3TA 1YJNQ 5I21A 1AOJA 2F5TX 4ZN1A 1OX9A 2J06A 2JM8A 3E1SA 4D8KA 1ZA2B 1OPLA 1KJWA 3OYDA 3TSWA 3FJPA 1M1KR 4CRIA 4OB0B 3A8OB 4OGCA 3O8VA 2XDPA 1UJ0A 2NUPB 1PD1A 4LDWA 4RCCA 2DF6A 2CDTA 2VV5A 3EG1A 2G6FX 5GJWB 3R6NA 3GF5A 5EC7A 5GANj 1ABOA 2CS7A 5KYWA 1M2VB 2HQHA 4M7AA 1KQ1A 5LJ3e 4QT7A 4OVAA 2RNAA 1QKXA 1QVGS 2Y4YA 5FROA 1TUGB 4NOYA 2DO3A 2PNIA 3M53A 4FT2A 5GAN6 4AFUC 2RN8A 2C0OA 3CMAT 5HCKA 2ED0A 4DA4A 1ZUYA 5IAYA 1I8FA 2RO0A 4C0FA 1KC8U 2VYTA 3CCQQ 3WVEB 2DX1A 4EMGA 2J6OA 3OW2A 1UDLA 5GAMj 1RAIB 5I11A 3I56Q 2HQXA 4F7UF 1JXOA 3GBQA 3JCMW 2K9GA 1Q7YC 1QCFA 1ZQ1A 4M77D 1U1SA 4F16A 2CP5A 3CD6Q 4IUQA 3G7ZA 1B3QA 4PFPA 2QYZA 4PJOE 2RQRA 4A53A 2V1QA 4BE1A 4XU2A 4C8QA 3S6WA 3AHUA 5GAN3 1CKBA 4KRTA 3OB9A 4M78A 4EIKA 4QVCA 3BDLA 3CPWS 3L2WA 1OI1A 3MO8A 3MP1A 4PFZA 2EYWA 3NMZC 1KD1R 1M5Q1 1NZ9A 3H0FA 5FW9A 2CUDA 1Q7YR 3L2VA 1OYXA 1M3CA 1D3BB 3JCMP 1UB4A 2BUDA 4HXJA 4RTWA 1YWOA 2RQTA 4C0ZA 1WXTA 2LTOA 4JS4A 1TXQA 4ESRA 3GP8A 5LJ5h 2KYMA 1TWBA 5KYYA 4BE0A 1R77A 4XTVA 3EHRA 4RUGA 4C92F 4E7KA 1NJIC 1JRIA 1I4K1 4JJNK 3MHXA 2J7IA 2K2MA 4JDSA 2SEMA 1EFNA 3JCMf 1V1CA 2QQAA 3LWIA 2DKGA 5FU7B 1HYOA 3DB4A 4DBQA 2EYYA 3BFMA 4Z88A 2QQSA 2GTOA 4JRKA 4JLGA 2YRDA 1BI3A 2LJ1A 5HK0A 1N8RR 1NJIR 3QKJA 4O5VA 1XTDA 1I81A 4K11A 3LH0A 2LQKA 3MP8A 4M77G 5HK3A 2DEQA 2HMAA 4FSSA 3CMAQ 2LQ8A 4M75E 5CQXA 4LNPA 2RI3A 3V8LA 2BZ8A 3CC4A 1UGPB 4GLKA 3MEUA 3MP6A 1K9MU 2QGGA 1UHCA 3E2UA 1N5ZA 4JS5A 5IT9E 1YFNA 1UECA 5CK9A 1XJWB 2CZ1B 1K0SA 2PQWA 3EGDA 3A8LB 5LJ3h 2LCCA 2CH4A 2Y90A 2WSFE 1NG2A 2KQWA 2XDDA 2KROA 5FU6B 2DMOA 1W2BS 2YRCA 1PSEA 1VQOA 2ZPEB 3KXTA 4KH1B 4RTTA 3TREA 1BCOA 2F2VA 2RF0A 3FB9A 2EJGA 1C6VX 5CKHA 4JLIA 3HPWA 3SEMA 2HSEB 2BKDN 1PD0A 3MCAB 3JCMX 2RJEA 5GAOp 3ZBDA 3OBYA 1X6GA 1VYUA 4M75G 1SKUB 1UUEA 4KUIA 3REAB 3OYJA 2NUPA 4A54A 3J81E 1U06A 2RHXA 3E9FA 2EQMA 1M3AA 2EGCA 1U3OA 4HT9A 1G8XA 1M2VA 4JJDA 1Y7XA 4OF1A 3OYYA 2RPNA 1VQOT 5GANd 4BY6B 1G3SA 2IPOB 2XDBA 5J39A 2RQWA 3GNGA 5FRMA 1M30A 3PFSA 2E64A 4Z89A 2FL7A 1V76A 4LN2A 4RKUE 3PE0A 4YTLA 4R0KA 3A1PA 4TVRA 1TUCA 1LNXA 2VWFA 2LZ6B 1VQ4A
chains in the Genus database with same CATH topology
2A7YA 5CVIA 5KCHA 1XOVA 3PMIA 1YJNT 3RIRA 1KQSS 1UEBA 1OZ3A 4PJOG 3JB9H 2JVVA 3LLRA 4M75D 4O6JA 4OB2B 4IUVA 2HQEA 5GAOm 1N27A 3C12A 3QPHA 4NL3A 3PNWC 5GAOr 4M77B 2RJFA 3HHTB 4EMKA 3L2ZA 4XTUA 1O75A 4MMLA 2GCXA 2PUKB 2L5QA 5GAMd 2KSSA 2IVWA 2D6FA 3M4GA 4DOWA 3PIOA 1HXDA 2RH2A 2NLUA 4HCZA 2EIFA 3FDRA 3G71T 2RI2A 1BI1A 3CD6T 5GAN4 3SD4A 4OB1B 2KDSA 1G3YA 3CCUT 5A0GA 3JRZA 5LJ5d 1I5LA 1X75C 2OTJT 3PMTA 1WNLA 4P5NA 4A4KA 2DXUA 1LOJA 2JUFA 2P0KA 5KCOA 1K8AC 2MWPA 4C8QE 5M9OA 3CCEA 3UPUA 1VQ5T 2YHTA 1NPPA 2O4XB 3KUFA 4M78E 1M90U 2DAQA 2FB7A 5GMKh 2DVEA 2EQUA 5DLQE 2WSCE 2YLCA 4C5EA 4KUDK 2DTIA 1Y07A 4FU6A 3OA6A 1XNIA 1VQ9T 4BDYA 3X20B 3JCMQ 4EMKC 4M7AF 3WVDB 3G6EA 3GPLA 2RK1A 1V29B 3X26B 1WPYA 3OS0A 3CXCA 2D0QB 3OBWA 4LDVA 3J7AF 3OYLA 4OB3B 1SSFA 1YJWA 4XTXA 4BDZA 2R58A 1VQ6A 4LDUA 1D3BA 2R57A 1EIFA 2PVDB 5EG2A 1WJQA 2CZ7B 2CZ6B 3A8GB 3QDRB 3L2UA 1VQ4T 2RB6A 4M75A 1O9SA 5CQYA 5HKCA 3OW2S 3DLMA 2DTOA 1QVPA 3X28B 3QO3A 4A4EA 3CCQT 4MDXA 4QW2A 4HKEA 1BIBA 3M58A 3CC4T 4Q5WA 5LL6S 1YBYA 4PNOA 3PTAA 2XKOC 2DTHA 2ZPBB 3GNFB 3OS1A 5GAOn 3I56T 4J6WA 2YRVA 4M77E 2XG8D 4F7UB 4HCBA 1K73U 2VC8A 2OTLA 1KHCA 5GANf 2LX9A 1NE8A 1JB0E 4XTZA 3CCRA 3JB9G 2RJCA 3QUIA 3X25B 4BI8B 1TH7A 4HCCA 4JRQA 4PL6A 1QP3A 5GAN5 2ZPFB 1G5VA 4HT8A 4M7DG 2F69A 2QQRA 3JCMe 4BE2A 2QQBA 3CBMA 4N0AA 3RMSA 3VJPA 4LD9K 3L42A 3OYGA 4BUGA 3CCET 4M75C 4ZGEB 3OYCA 4PKCC 5FRNA 1KG1A 2HBPA 3M56A 2RHUA 3ZEHA 1M1FA 1X6OA 4X34A 4JRPA 3SWNC 2PU9B 2DIQA 3C94A 4UC4A 1M90C 2E41A 2R5MA 3QHSA 3G6ET 3CEYA 3RKYA 3JAME 2RM4A 5CKBA 1N6AA 2DXCA 5CO7A 3JCMV 4C5IA 3DLLA 4QQ6A 2XIDA 4C8QF 1AHJB 4EPCA 3QXEB 4ZGDB 3HL8A 3QG1A 4M78F 2LT1A 3OYEA 4BI4A 4N4GA 1P92A 3QJYA 3NTHA 2VGNA 4KT0E 4C92C 2V8JA 3VV0A 1M8VA 1M4ZA 1KC8C 1M9SA 1K8AU 2X35A 5GAMf 5CKFA 3JB9I 1M1KC 4M7AE 3T9NA 3SWNB 4M7AD 5FU7C 5LJ3d 1VQPA 3RMQA 3VYGA 3SB2A 5GAN7 1NPRA 1YIJA 5LJ5f 4J5YA 4MZPA 2M1HA 4WF2A 3PT9A 4C0DC 2VXFA 3HFNA 3CMAA 3V8KA 1VQ8T 2H3JA 2OTLT 4QVDA 3JB9D 3H6ZA 3CCRT 3RKWA 2RJDA 4C92B 1B34B 4F7UE 4E7LA 4QQDA 3CC2A 4IUUA 5GAN2 3OY9A 4M7DD 1YCYA 2F5TX 5I21A 2DJZA 4ZN1A 2EKOA 2GFUA 3GIBA 3QYGB 2QDYB 4PJOC 3E1SA 2ZCFB 4M77F 3OYDA 3SDZA 1KQSA 2HD0A 3LWHA 2VUBA 4L6V5 3J80E 3FJPA 4MZMA 4C0DB 2M0OA 4A4FA 2GQVA 4CRIA 2RHYA 4OB0B 3A8OB 3R6OA 4OGCA 3FRNA 3O8VA 4RCBA 3URGA 3M59A 3OYBA 2XDPA 3PIPA 3MEWA 2X4YA 1VQ7A 4LDWA 4RCCA 4ME7A 1BYMA 4XTWA 2VV5A 3FLGA 1KQ2A 3M4YA 4RG2A 5GAOq 1JJ2S 3QBYA 4Y91A 3P8HA 3GF5A 5GANj 4PJOB 2CZ0B 1LJOA 2K5FA 5GMKe 2CS7A 1S72A 3DB3A 3OYAA 3CCJA 4M7AA 3ZFJA 1KQ1A 2DZCA 4VUBA 5LJ3e 2RD1A 4OVAA 5GMKi 1M1GA 3LYIA 4J7IA 5DM7R 3TEEA 1QVGS 2Y4YA 3TCJA 1YIJT 5FROA 2XD0A 4NOYA 3JCMd 2EQJA 2EQKA 4R56A 4C8QD 2MAMA 2DO3A 2P0PA 4LD6A 1H641 3QZ5B 3E9GA 3M53A 4M78D 3GLXA 3P8BB 4FT2A 5GAN6 3CMAT 4DA4A 5AYFA 2MI6A 2E12A 4NL2A 3OYMA 2DXTA 1Y96B 5IAYA 1Q81C 1I8FA 3CC2T 2RO0A 4M7DA 1PSFA 4IKFA 4V2SA 2F5KA 4BACA 3JSCA 3OSSC 4C0FA 3WXMB 1XQHA 3HFOA 1KC8U 2LCLA 2VYTA 4KULA 3WVEB 1M1KU 3S3MA 4EMGA 1IREB 4IURA 1WJSA 2JTMA 3HP9A 3M54A 3OW2A 3A5ZB 1UGSB 3NTIA 4X9CA 5GAMj 2VXEA 1VQMA 3HSBA 2HQXA 4L59A 3X24B 2LVMA 4F7UF 4HA8A 1GXIE 2RHZA 3UWNA 4M7AG 2L89A 3NTKA 3JCMW 3S3OA 4EMKB 1QP2A 2DIGA 3OMCA 2QQ9A 3CBPA 5LJ5j 1VQ7T 2A3LA 5GANg 1VIEA 3OMGA 5GANh 3BDUA 1MGQA 1Q7YC 2JTFA 4C5GA 5LJ3f 1ZQ1A 4M77D 2LRQA 1U1SA 3HKSA 3JCMc 4RG8A 4M7DC 5A0LA 3TU4K 2CGHA 3P8DA 3G7ZA 4IUQA 1YJ9A 1S72T 3CCJT 1YHQA 4PJOE 4OP0A 5DY9A 4A53A 3CBOA 3OYFA 2KMTA 1WJRA 2DD4A 3VKIA 4BE1A 2IG0A 3EFSA 4XU2A 4C8QA 3S6WA 4L5GA 3AHUA 5GAN3 2JN0A 3CPWA 3OB9A 4M78A 5C6SA 3L2RA 4QVCA 3BDLA 2VGMA 3CPWS 3G4SA 3EFRA 4CI0C 2XICA 3L2WA 1IZ6A 1OI1A 2RI5A 4NS5A 4PLLA 2QEXA 3OYNA 1KHIA 3MO8A 3MP1A 3OQ5A 1YI2A 1M5Q1 1NZ9A 3LW5E 4M75F 1VQKA 5I2SA 3M9QA 2EWNA 4A4HA 3L2VA 2X4WA 1OYXA 3E19A 1YJWT 5GAMg 4R55A 1K9MC 1D3BB 5GAMh 4D6WA 3JCMP 1UB4A 2BUDA 3C95A 1G3WA 4M75B 2GF7A 1RL2A 2BIVA 2K57A 2E5QA 2LTOA 4C0ZA 4JS4A 1VQ6T 4XU1A 5LJ5g 3GP8A 3CMEA 5I2MA 4ZTJA 5LJ5h 4C0GA 4N0AC 4BE0A 5J26A 4XTVA 4C92F 1FWZA 2MMPA 3QZ9B 4E7KA 4E7IA 2ZPHB 2PVGB 4J83A 1NJIC 1JRIA 1I4K1 3OSVA 4M77A 4C8QG 4JJNK 1Q81U 3MHXA 2E6ZA 4M78G 1R8OB 1QVFA 2YLBA 4JDSA 2E10A 3JCMf 2EAYA 4GY5A 1YJ9T 5KE3A 4E7JA 2QQAA 1QVFS 3BW1A 4J7FA 2DPPB 5CKDA 1YHQT 4LDXA 3LWIA 2O01E 3CCUA 3A8HB 4N4HA 2DKGA 4JUVA 3OYKA 2L3RA 1G3TA 5FU7B 2QA4A 3DB4A 4OMFB 3S3NA 4XQ3A 2KVQG 2ZPIB 3JB9J 4BD3A 3BFMA 5C0MA 4XAXB 5KH6A 2L8DA 2I2LA 3L1AA 1KD1U 3CCLA 2QEXT 2O4XA 3DKMA 2QI2A 2QQSA 1BKBA 2GFAA 5CAIA 1Q7YU 4JRKA 2WSEE 2ZGWA 1BI3A 4JLGA 4PJOF 5HK0A 3L2QA 1YI2T 1VQ9A 4BI3A 4RMOA 1VQKT 3V7RA 1JBMA 3QKJA 1WQWA 4O5VA 1XTDA 1JJ2A 3LGFA 1I81A 4J6YA 3LH0A 1Q82U 2LQKA 2G3RA 4FM4B 3MP8A 4M77G 5HK3A 2X4XA 2MWOA 3QJ6A 2DEQA 2XU8A 4C5HA 2JNGA 4FSXA 3CCSA 3CMET 2LT4A 1QVGA 2LQ8A 4M75E 5CQXA 1N9RA 1VQPT 4MDWA 4JRIA 2RI3A 3UT1A 3CCQA 3V8LA 3VUZA 4MMKA 2DD5A 2PVOB 3CC4A 3KBGA 4FT4A 4B9WA 3OYHA 1UGPB 3META 4GLKA 3H8ZA 5A2QE 3OS5A 2WACA 4X9DA 3I56A 1DJ7B 2DZ9A 4XU3A 4F7UA 4EMHA 2JOYA 1ZBXA 2P4TA 2XHCA 3MEVA 5J3BA 1Q86C 3MEUA 3MP6A 4MZTA 4XK8E 1K9MU 3HRUA 3LX7A 1VQNA 1YITA 3OYIA 3ASKA 4J8OA 4C92E 1RI0A 4FL6A 4C92D 2QA4T 5CKEA 2E1HA 5FU6C 2K5LA 4JS5A 5GANe 4ZGJB 5IT9E 2HNIA 5FLXE 4EDUA 3CCMA 4M7AC 3CD6A 2QTXA 5CK9A 1N8RU 2CZ1B 4DQ2A 2KAFA 3CCLT 1UGRB 3PGGA 3UDCA 2K4YA 2PQWA 1NJIU 5L8RE 2XI9A 1U8RA 5LJ3g 1FX7A 2Y4XA 1KD1C 3A8LB 5LJ3h 2EJFA 3MEAA 3CC7A 2LCCA 4ZN3A 3NFCA 4XTYA 2M16A 2RA2A 2Y90A 1HK9A 2WSFE 3FC3A 2KQWA 1VQLA 2RHIA 2XDDA 5IN1A 1OZ2A 2B8AA 2R5AA 3FIFA 3Q1JA 1W4SA 5FU6B 3CXCS 1W2BA 4FIBA 4LDYA 3GOXA 1W2BS 4M7AB 2FVUA 1VUBA 3A8MB 4II1A 1Q82C 1UGQB 3RKXA 3CCST 3JB9F 4F7UG 2AHJB 3M57A 4PJOD 1BIAA 4A4GA 5CIUA 2E6NA 4N4IA 3SWNA 3QYHB 1PSEA 1VQOA 2K3YA 2ZPEB 3KXTA 4M7DF 1H3ZA 5GAN8 4DOVA 1ZHIA 4ELZC 3ER0A 1BI2A 3N5BB 1U1TA 1BI0A 3QIIA 4PLIA 2M9UA 5GAMe 5GMKl 4E47A 5DLOA 2EYQA 3QSUA 2DK3A 3JCMb 2LC4A 3TREA 1Y71A 4E7HA 3V8JA 1VQ8A 3VYHB 3FB9A 5D6WA 3I55A 4XU0A 4M7DB 1MHNA 2EJGA 2ZPGB 4KBMB 5HY6A 5LJ5e 1VQNT 4C92A 5GMKm 1B34A 1WQ7A 4JLIA 3INZA 1N9SA 5CKHA 1YITT 4OGEA 2EFIA 3HPWA 4QVZA 2CKKA 5D6XA 4BB7A 2E70A 2BKDN 2EJ9A 3CCMT 3V7CA 5A0DA 2HAXA 3MCAB 3CCVA 3JCMX 2RJEA 4ELYC 5CCAA 1VQMT 5GAOp 3ZBDA 3RESA 1YJNA 3ME9A 3OBYA 4C8QC 3RUXA 4IUTA 2K3XA 3VUBA 4ZTFA 1N8RC 4M78C 4M75G 2E65A 3CC7T 4BY6C 3OS2A 3JCMg 5CR2A 3C4SA 1VQLT 3JCMh 4KUIA 3M55A 1Q86U 3OYJA 1VIFA 2ZZDA 4A54A 3BY7A 3J81E 3JCMJ 3V7SA 1FXXA 2RHXA 3E9FA 2LNVA 2EQMA 2OAUA 3G71A 4PJOA 3F70A 4HT9A 2QXFA 2C06A 5D6YA 2OTJA 2K5IA 4J6XA 2KY9A 2MF2A 2X4JA 4Y28E 1Y7XA 4C8QB 4OF1A 2DXBA 3FEOA 3OYYA 4C92G 2D9TA 4M78B 1VQOT 3SFMA 3HRSA 5GANd 4BY6B 2FYKA 2P0QA 3G4ST 2V8IA 1VQ5A 1WGSA 1G3SA 4ATOA 1X01A 2XDBA 3VU3C 5J39A 2K2VA 4Z02A 3GNGA 5FRMA 3M5AA 2LDMA 3PFSA 2V8KA 3I55T 2E64A 3HRTA 3LGLA 5GMKj 2XK0A 1QW1A 2FL7A 4M77C 4RKUE 1Y96A 3EAEA 1K73C 2PUOB 3CPFA 4YTLA 4M7DE 5LJ3j 5KE2A 2RK2A 4IUPA 2JZ2A 3RERA 2KK4A 4B9XA 4TVRA 1LNXA 5GAOl 2FHDA 3CCVT 4QQGA 2CYZB 1VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6W A;  5KCH A;  3PMI A;  3OB9 A;  1OZ3 A;  5C6S A;  3L2R A;  3LLR A;  3BDL A;  4IUV A;  2HQE A;  2PQW A;  1N27 A;  3L2W A;  4EDU A;  3PNW C;  1OI1 A;  2RI5 A;  4NS5 A;  4PLL A;  2RJF A;  3OYN A;  2M1H A;  3MO8 A;  3MP1 A;  3OQ5 A;  3MEA A;  2LCC A;  2M16 A;  3FC3 A;  2RHI A;  3H6Z A;  2RJD A;  5IN1 A;  2NLU A;  3M9Q A;  4HCZ A;  1OZ2 A;  2B8A A;  2R5A A;  2RI2 A;  3FDR A;  3Q1J A;  2X4W A;  4IUU A;  4QQD A;  4A4H A;  1OYX A;  3SD4 A;  3OY9 A;  3GOX A;  4II1 A;  3PMT A;  2EKO A;  2BUD A;  2GFU A;  2GF7 A;  2BIV A;  4A4G A;  2E5Q A;  2LTO A;  5CIU A;  3OYD A;  2P0K A;  2E6N A;  5KCO A;  4N4I A;  4ZTJ A;  2MWP A;  5M9O A;  2K3Y A;  1H3Z A;  2O4X B;  3KUF A;  2M0O A;  5J26 A;  4BE0 A;  2DAQ A;  4CRI A;  2RHY A;  4E7L A;  2EQU A;  3QII A;  4PLI A;  4E7K A;  3O8V A;  4E7I A;  4C5E A;  4FU6 A;  2XDP A;  3OYB A;  3MEW A;  3OA6 A;  2X4Y A;  1XNI A;  4BDY A;  4E7H A;  5D6W A;  3FLG A;  1MHN A;  4RG2 A;  3OS0 A;  4GY5 A;  5KE3 A;  3QBY A;  4E7J A;  3P8H A;  3OYL A;  1SSF A;  2EFI A;  3DB3 A;  4N4H A;  2CKK A;  4QVZ A;  5D6X A;  2L3R A;  2R58 A;  3OYA A;  3OYK A;  4BDZ A;  2BKD N;  2R57 A;  3L2U A;  1WJQ A;  3DB4 A;  3S3N A;  4OVA A;  3LYI A;  2RJE A;  4BD3 A;  3DLM A;  5C0M A;  5KH6 A;  2L8D A;  5FRO A;  4A4E A;  3ME9 A;  2EQJ A;  2EQK A;  4QW2 A;  4IUT A;  2K3X A;  2O4X A;  4ZTF A;  4LD6 A;  4Q5W A;  2QQS A;  2GFA A;  3E9G A;  3L2Q A;  3OS2 A;  3OS1 A;  3C4S A;  3OYM A;  2YRV A;  3OYJ A;  5IAY A;  1KHC A;  2RO0 A;  3QKJ A;  4IKF A;  2F5K A;  2RHX A;  3E9F A;  3LGF A;  4BAC A;  2RJC A;  3LH0 A;  2EQM A;  2G3R A;  3F70 A;  3MP8 A;  2VYT A;  4PL6 A;  2X4X A;  2MWO A;  3QJ6 A;  5D6Y A;  3S3M A;  1G5V A;  4C5H A;  4IUR A;  2QQR A;  1WJS A;  4BE2 A;  3FEO A;  3L2V A;  3NTI A;  2D9T A;  3L42 A;  3OYG A;  5FRN A;  3OYC A;  2HQX A;  4L59 A;  2RI3 A;  2RHU A;  2LVM A;  3UT1 A;  3ZEH A;  4X34 A;  2RHZ A;  1WGS A;  3UWN A;  2L89 A;  3NTK A;  4B9W A;  3S3O A;  2DIQ A;  2DIG A;  5J39 A;  3OMC A;  3OYH A;  3MET A;  4Z02 A;  4UC4 A;  3H8Z A;  3OMG A;  2LDM A;  3PFS A;  2WAC A;  2R5M A;  5FRM A;  3CEY A;  4BE1 A;  2JTF A;  3LGL A;  4C5G A;  2XK0 A;  4C5I A;  2LRQ A;  3EAE A;  3MEV A;  3MEU A;  3MP6 A;  4QQ6 A;  3LX7 A;  5KE2 A;  3P8D A;  4IUP A;  4IUQ A;  2JZ2 A;  3OYE A;  3OYI A;  4B9X A;  4N4G A;  3ASK A;  3NTH A;  1RI0 A;  4FL6 A;  2FHD A;  3OYF A;  1WJR A;  4QQG A;  4A4F A;  2X35 A;  2IG0 A; 
#chains in the Genus database with same CATH topology
 5CVI A;  2RQV A;  2GTJ A;  3PMI A;  3RIR A;  1OZ3 A;  3NPF A;  3LLR A;  4OB2 B;  1F1B B;  3C12 A;  4RTZ A;  5GAO r;  4M77 B;  2A28 A;  2PUK B;  5GAM d;  3VS6 A;  2RH2 A;  1B07 A;  4HCZ A;  3FDR A;  3JRZ A;  2L2P A;  3VRY A;  1A0N B;  2YUQ A;  2P0K A;  1K8A C;  1JEG A;  3UPU A;  3I9Q A;  1OX8 A;  4HCK A;  5DLQ E;  2YLC A;  4HVV A;  4C5E A;  2JS0 A;  4FU6 A;  2I0N A;  3X20 B;  4EMK C;  4M7A F;  3RBB B;  3OS0 A;  3OBW A;  1SSH A;  2YUN A;  4BDZ A;  1VQ6 A;  1D3B A;  1I1J A;  1EIF A;  2PVD B;  1VQ4 T;  1O9S A;  3OW2 S;  3DLM A;  3X28 B;  4A4E A;  1UFF A;  2B86 A;  1JXM A;  4HKE A;  1K8A R;  4Q5W A;  5LL6 S;  1YBY A;  3M0U A;  1Z9Q A;  1WHK A;  2YRV A;  4X1V A;  1K73 U;  4IIM A;  1T0J A;  1IB8 A;  1JB0 E;  3CCR A;  3QUI A;  1OEB A;  3EFO B;  4HCC A;  1PC0 A;  3VS7 A;  4DEY A;  4WCI A;  2ZPF B;  2JMC A;  1E7O A;  4N0A A;  3L42 A;  3OYG A;  4PKC C;  1KG1 A;  2HBP A;  2RHU A;  4ZNX A;  1M1F A;  2EGA A;  1X6O A;  4JRP A;  3C94 A;  1M90 C;  2E41 A;  3QHS A;  3CEY A;  5CO7 A;  5IHN A;  1TOV A;  2SRC A;  1AHJ B;  4C8Q F;  1IGU A;  1VQO Q;  3QG1 A;  4M78 F;  2LT1 A;  1VQ6 T;  1P92 A;  3AT1 B;  2VGN A;  1QMC A;  1M4Z A;  1KC8 C;  1IXD A;  3M0P A;  3SWN B;  2F2W A;  1VQP A;  1G2B A;  1NPR A;  3LH5 A;  2EQI A;  1SRL A;  5LJ5 f;  1TU0 B;  2VXF A;  4RTX A;  1W6X A;  3V8K A;  2L3Q A;  2H3J A;  3H6Z A;  3CCR T;  3VS3 A;  2RJD A;  1M90 R;  3VS1 A;  1X6B A;  4F7U E;  4E7L A;  5GAN 2;  2KNB B;  4M7D D;  1YCY A;  2GFU A;  4PJO C;  1VOM A;  2ZCF B;  2HD0 A;  1KC8 R;  2VUB A;  4MZM A;  4C0D B;  1TTH B;  3R6O A;  3M59 A;  4CC4 B;  3OYB A;  4FW1 A;  4XTW A;  3FLG A;  1ZLM A;  1OUL A;  4RG2 A;  1NEG A;  1LJO A;  2K5F A;  5GMK e;  1X27 A;  3OYA A;  1D0X A;  1HJD A;  5DM7 R;  3H9N A;  4WTO B;  3CPW P;  3JCM d;  2A37 A;  2K7A A;  2EQK A;  3QZ5 B;  3E9G A;  5KYU B;  3P8B B;  2E12 A;  4NL2 A;  3OYM A;  1D1C A;  2DXT A;  1VQ4 Q;  1PSF A;  1PRM C;  1WFW A;  2K3B A;  3JSC A;  1XQH A;  1SF9 A;  1OOT A;  4RTY A;  2CP0 A;  1IRX A;  3NTI A;  4X9C A;  1VQM A;  4L59 A;  5FWB A;  2RHZ A;  3NTK A;  1VYT A;  1QP2 A;  3OMC A;  5LJ5 j;  4HVU A;  3OMG A;  3REB B;  3BDU A;  4C5G A;  5LJ3 f;  1RAF B;  5A0L A;  2W10 A;  4OP0 A;  3CBO A;  3OYF A;  1RAC B;  2KMT A;  2IG0 A;  3EFS A;  2JJ9 A;  1RAG B;  3EFR A;  2AK5 A;  3VS2 A;  5IHK A;  3OQ5 A;  2AKL A;  1UTI A;  2HBW A;  3U23 A;  1YI2 A;  1VQ6 Q;  3H0H A;  1JJ2 P;  2EWN A;  1YNZ A;  2YWW A;  1K9M C;  4D6W A;  2LQN A;  3ULR B;  1NLO C;  2ENM A;  2GF7 A;  1RL2 A;  2BIV A;  2HDA A;  2FPF A;  3H0I A;  5I2M A;  2E3H A;  3CCR Q;  1BCM A;  2MK5 A;  1SHF A;  1FWZ A;  4M77 A;  3OSV A;  1Q81 U;  2E6Z A;  1R8O B;  2E10 A;  1QVF S;  4LDX A;  2HZY A;  2CT3 A;  3CCU A;  4N4H A;  1C1A A;  2L3R A;  4GBQ A;  2QA4 A;  3EG3 A;  1K9M R;  2KVQ G;  3JB9 J;  5C0M A;  3CCL A;  5GJV B;  1R0B G;  2QI2 A;  1BKB A;  2GFA A;  2ZGW A;  3L2Q A;  1YI2 T;  1ZUU A;  1VQ9 A;  4RMO A;  2JM9 A;  2CP6 A;  2F1L A;  1W2B P;  2EW3 A;  2EPD A;  1Q82 U;  1JO8 A;  2G3R A;  4J9C A;  2C0I A;  1JU5 C;  3QJ6 A;  2XU8 A;  3EG0 A;  2JNG A;  4M4Z A;  3CCS A;  1QCN A;  4F17 A;  2LT4 A;  2OI3 A;  4MDW A;  1NBE B;  3VUZ A;  2PVO B;  4FT4 A;  2EVR A;  1CSK A;  1M27 C;  2YUP A;  1DJ7 B;  2DRK A;  1ZBX A;  5J3B A;  2BTT A;  1YIT A;  1PHT A;  3EFO A;  4J8O A;  1WHM A;  2QA4 T;  1H92 A;  2K5L A;  2M02 A;  5GAN e;  4ZGJ B;  2HNI A;  5FLX E;  4EDU A;  3EGX B;  3CCM A;  1GCP A;  1T3S A;  3CCL T;  3PGG A;  3UDC A;  2DM1 A;  2DA9 A;  1FX7 A;  2Y4X A;  1KD1 C;  3MEA A;  3CC7 A;  2RA2 A;  1HK9 A;  2RHI A;  2B8A A;  3FIF A;  2CT4 A;  2FVU A;  2QAS A;  3CCS T;  4PJO D;  3M57 A;  3SWN A;  4M7D F;  1H3Z A;  4DOV A;  4ELZ C;  1BI2 A;  1BI0 A;  4E6R A;  5GAM e;  2EYQ A;  3QSU A;  5ECA A;  4CC3 A;  1VQ8 A;  1SHG A;  3VYH B;  3I55 A;  4M7D B;  5GMK m;  1YIT T;  1SG5 A;  1K4U S;  2CKK A;  5D6X A;  4BB7 A;  3CCM T;  1WZO A;  3CCV A;  3H41 A;  2NYS A;  3ME9 A;  3RUX A;  3VUB A;  1N8R C;  2V26 A;  3CC7 T;  2ATC B;  1VIF A;  4GLM A;  1EX4 A;  2OAU A;  3VRZ A;  2H3E B;  1WHJ A;  5D6Y A;  2OTJ A;  2K5I A;  2W0Z A;  2DXB A;  1YI2 Q;  2D9T A;  3SFM A;  3HRS A;  1VQ5 A;  1TSF A;  4ATO A;  4HVW A;  3VU3 C;  4E2F B;  4RTU A;  4AFQ C;  5KYU A;  3G1J A;  4Z02 A;  3M5A A;  2LDM A;  2V8K A;  3I55 T;  1GCQ C;  3HRT A;  2XK0 A;  3CXC P;  3EAE A;  1K73 C;  2LQW A;  3CPF A;  4IUP A;  3JV3 A;  3RER A;  4LUD A;  1YCS B;  2FHD A;  5D7U A;  1ZA1 B;  1RAB B;  3OW2 P;  3CCV T;  1H3H A;  4DBR A;  5KCH A;  1UEB A;  4PJO G;  4M75 D;  4IUV A;  2HQE A;  2JMA A;  5FWC A;  1RLP C;  1TG0 A;  2QA4 Q;  2KSS A;  2D6F A;  3M4G A;  4DOW A;  2EIF A;  5GAN 4;  1ARK A;  1G3Y A;  5A0G A;  2OTJ T;  5LJ5 d;  1K73 R;  1I5L A;  3CCL Q;  2DLP A;  2KI7 A;  2F2X A;  4P5N A;  3TQ7 P;  4CC7 A;  2CSQ A;  1VQ9 Q;  2JUF A;  5KCO A;  2MWP A;  4C8Q E;  5M9O A;  3CCE A;  1VQ5 T;  3KUF A;  4M78 E;  2DAQ A;  2EQU A;  2KRS A;  2WSC E;  4FW2 A;  2FO0 A;  1XNI A;  2KBT A;  3JCM Q;  2RK1 A;  1V29 B;  3CCS Q;  1WPY A;  1QWE A;  2D0Q B;  3OYL A;  1IHW A;  4FYY B;  1YJW A;  3L2U A;  2RB6 A;  2A08 A;  2VAS A;  2EGE A;  1RUW A;  3UA7 A;  3QO3 A;  2HL3 A;  2KRM A;  3CC4 T;  2NUT B;  3PTA A;  1MMG A;  1YIT Q;  5GAO n;  2VC8 A;  1KHC A;  3CCM Q;  1NE8 A;  2KR3 A;  3JB9 G;  2RJC A;  2CP3 A;  1TH7 A;  2EYZ A;  1G5V A;  3JCM e;  3CBM A;  3VS0 A;  3RMS A;  3VJP A;  3CC7 Q;  2D8H A;  4LD9 K;  2P4R A;  3CCE T;  3OYC A;  5FRN A;  3M56 A;  4J9E A;  2PU9 B;  2DIQ A;  2AIR B;  4IIO A;  3JAM E;  2RM4 A;  1N6A A;  4C5I A;  1RAE B;  3QXE B;  3HL8 A;  4KGZ B;  3OYE A;  2CUB A;  2CP2 A;  4C92 C;  2V8J A;  2YUO A;  1MMA A;  5CKF A;  1K0X A;  3T9N A;  5FU7 C;  5LJ3 d;  1LCK A;  4F04 B;  3I55 Q;  2ZAE A;  3M0T A;  3SB2 A;  5GAN 7;  2JXB A;  2M1H A;  4WF2 A;  3HTR A;  3HFN A;  3THK A;  2CRE A;  1NEB A;  2QG9 B;  3CCV Q;  2AT1 B;  1B34 B;  1K1Z A;  2FRY A;  4IUU A;  1ZSZ C;  1MNE A;  2EKO A;  3GIB A;  2LMJ A;  2FG0 A;  4Z8A A;  4M77 F;  1KQS A;  3EGX A;  2GQI A;  2FPD A;  2JS2 A;  4L6V 5;  3J80 E;  3EG2 A;  5KYX B;  2RHY A;  1RAA B;  4RCB A;  1M3B A;  3URG A;  4E7S A;  1VQ7 A;  2OTJ Q;  4ME7 A;  2A0F B;  1KQ2 A;  1UJY A;  3QBY A;  4PJO B;  4J9I A;  1VQ5 Q;  4PJN A;  1PM3 A;  1GBR A;  5GMK i;  1AZG B;  1M1G A;  2COW A;  4J7I A;  2XD0 A;  2EQJ A;  3EGU A;  4FCY A;  1B7T A;  2P0P A;  4LD6 A;  3GLX A;  4LE9 A;  3EH2 A;  3RR6 A;  1Y96 B;  1Q81 C;  4RTV A;  4M7D A;  4IKF A;  4BAC A;  4E7Z A;  3OSS C;  4OML A;  3WXM B;  2FPE A;  1SEM A;  2DYI A;  1X69 A;  1NLP C;  4IUR A;  1PKT A;  3CC4 Q;  3A5Z B;  1AEY A;  2E4H A;  2VXE A;  3X24 B;  4HA8 A;  3UWN A;  1VQ7 T;  2A3L A;  5GAN g;  2XMF A;  1MGQ A;  2JTF A;  1QVF P;  2Z0W A;  1Q95 G;  1WIE A;  3HKS A;  4KH0 B;  4RG8 A;  2CGH A;  1Q81 R;  3CCE Q;  3VS4 A;  1YHQ A;  1YN8 A;  1WJR A;  4L5G A;  2JN0 A;  3CPW A;  2O9V A;  5C6S A;  1K9A A;  2VGM A;  3FJ5 A;  3G4S A;  4CI0 C;  1AT1 B;  1IZ6 A;  2MCN A;  2QEX A;  4NS5 A;  1AWJ A;  1KK7 A;  1FMV A;  3LW5 E;  4M75 F;  1VQK A;  5I2S A;  2AKK A;  3M9Q A;  4A4H A;  1GBQ A;  1S1N A;  2X4W A;  4OMP A;  1M2O A;  2HKN A;  5GAM g;  4R55 A;  1G3W A;  4M75 B;  1CKA A;  1QVG P;  1Q82 R;  2K57 A;  3ZL7 C;  4ZTJ A;  1OV3 A;  4C0G A;  2M0Y A;  1W1F A;  2MMP A;  3QZ9 B;  2PVG B;  1JQQ A;  4KGX B;  1G83 A;  2JW4 A;  1WI7 A;  5KE3 A;  2ROL A;  3BW1 A;  1YHQ T;  5CKD A;  1LVK A;  3A8H B;  4JUV A;  4XQ3 A;  2E3I A;  2L8D A;  3RDV A;  2QEX T;  2J6K A;  2WSE E;  1AWO A;  1NM7 A;  1IO6 A;  4BI3 A;  2K6D A;  1VQK T;  3V7R A;  2OJ2 A;  1JBM A;  1WQW A;  1JJ2 A;  2PZ1 A;  1MMN A;  3MJX A;  1IGQ A;  4FSX A;  1VQP T;  3UT1 A;  3CCQ A;  2KYB A;  3KBG A;  4B9W A;  3OYH A;  2KT1 A;  2NUT A;  4PK4 A;  4AG2 C;  5A2Q E;  1H8K A;  3I56 A;  2DZ9 A;  2ROT A;  4EMH A;  2P4T A;  2XHC A;  3MEV A;  4XK8 E;  3HRU A;  3LX7 A;  3OYI A;  2MOX A;  4C92 E;  4C92 D;  1RAD B;  4M7A C;  1VA7 A;  3I35 A;  1VQ7 Q;  3CD6 A;  2QTX A;  1Z9Z A;  1UGR B;  2L3P A;  5L8R E;  1U8R A;  2EJF A;  4ZN3 A;  3FC3 A;  5IN1 A;  2R5A A;  1W2B A;  2EBP A;  4FIB A;  2BE7 D;  1FMW A;  1VUB A;  1X2Q A;  1UGQ B;  4F7U G;  2AHJ B;  5KYN A;  1BIA A;  5CIU A;  1FYN A;  2QDL A;  3QYH B;  1ABQ A;  2K3Y A;  1E6G A;  4J9H A;  5L23 A;  3N5B B;  3QII A;  4PLI A;  5GMK l;  1WYX A;  3JCM b;  2LC4 A;  2JTE A;  1ZBJ A;  3V8J A;  1GFD A;  1MHN A;  5LJ5 e;  1B34 A;  1WQ7 A;  2EFI A;  2RQU A;  2EJ9 A;  4FYV B;  1VQM T;  4CC2 A;  4OMO A;  4C8Q C;  5KYX A;  2K3X A;  4M78 C;  1WXU A;  2YT6 A;  1YHQ Q;  1AD5 A;  3OS2 A;  3JCM g;  5CR2 A;  1Q86 U;  1GRI A;  2ZZD A;  3UF4 A;  3JCM J;  1FXX A;  2LNV A;  1BBZ A;  3G71 A;  4PJO A;  2QXF A;  4DBF A;  2QEX Q;  3FEO A;  4C92 G;  3SHW A;  1T0H A;  1VQK Q;  2QK0 A;  2P0Q A;  2V8I A;  1WGS A;  1X01 A;  2DL5 A;  3LGL A;  1WA7 A;  4AT1 B;  1QW1 A;  1Y96 A;  5LJ3 j;  2DIL A;  1VQP Q;  2X9H A;  4B9X A;  4J9G A;  4QQG A;  4OMM A;  2A7Y A;  9ATC B;  1KQS S;  1Y0M A;  5GAO m;  1X2K A;  1N27 A;  2CSI A;  4NL3 A;  2OX7 A;  3PNW C;  4J9D A;  1PCX A;  2VB6 A;  3L2Z A;  4XTU A;  4A63 B;  1C0M A;  2GCX A;  2L5Q A;  2IVW A;  1HXD A;  2VKN A;  2DE0 X;  2NLU A;  1PRL C;  3G71 T;  1YP5 A;  3I5S A;  4OB1 B;  3CCU T;  3PMT A;  1AWW A;  1WNL A;  1RAH B;  4A4K A;  2DXU A;  1LOJ A;  2DBM A;  1FMK A;  2D0N A;  2YHT A;  1NPP A;  2O4X B;  1M90 U;  5GMK h;  2DVJ A;  2DVE A;  1SRM A;  4KUD K;  1Y07 A;  3O5Z A;  1VQ9 T;  3MKD A;  3WVD B;  3G6E A;  3GPL A;  3X26 B;  3CXC A;  4LDV A;  3EG9 B;  2R58 A;  2R57 A;  4D8D A;  5EG2 A;  2CZ7 B;  3A8G B;  1BB9 A;  2CZ6 B;  4DEX A;  2VVK A;  4M75 A;  2LX7 A;  5CQY A;  5HKC A;  1SPK A;  1QVP A;  2DTO A;  3TSZ A;  2BZX A;  2DJQ A;  2J6F A;  4QW2 A;  1BIB A;  3M58 A;  2ZPB B;  2DTH A;  3GNF B;  3OS1 A;  4J6W A;  4M77 E;  4F7U B;  4HCB A;  2OTL A;  2LX9 A;  2O9S A;  2DRM A;  1WHG A;  1VQM Q;  2GBQ A;  4PL6 A;  5GAN 5;  1MV3 A;  5IHI A;  4BE2 A;  2QQB A;  4BUG A;  2COZ A;  4FYW B;  3NHN A;  1D0Y A;  3G6E T;  4OMN A;  5CKB A;  2DXC A;  3JCM V;  3TVT A;  3DLL A;  4QQ6 A;  2XID A;  4JZ3 A;  4EPC A;  2LP5 A;  3QJY A;  3NTH A;  4KT0 E;  2KEA A;  3VV0 A;  1M8V A;  3UA6 A;  3MPU B;  4M7A E;  4M7A D;  3RMQ A;  3VYG A;  2AZS A;  1YIJ A;  1Y57 A;  4J5Y A;  2JT4 A;  2X3W D;  1BU1 A;  3EH1 A;  1VQ8 T;  2OTL T;  3JB9 D;  3RKW A;  4C92 B;  5IH2 A;  3CC2 A;  1MV0 B;  4QQD A;  1WHH A;  1PKS A;  2DJZ A;  2DER A;  2KE9 A;  3QYG B;  2QDY B;  2FZK B;  3BE3 A;  2QGF B;  3SDZ A;  3LWH A;  4OMQ A;  2CP7 A;  1QKW A;  1D0Z A;  2M0O A;  2GQV A;  3FRN A;  3G71 Q;  2HCK A;  1D1B A;  2NWM A;  3PIP A;  3MEW A;  2X4Y A;  1AWX A;  3CCU Q;  2DL7 A;  1BYM A;  1WX6 A;  1I5O B;  3M4Y A;  1ZSZ B;  2MYS A;  5GAO q;  1JJ2 S;  4Y91 A;  3P8H A;  2CZ0 B;  2DEU A;  1S72 A;  3DB3 A;  3CCJ A;  2ECZ A;  3ZFJ A;  2DZC A;  4VUB A;  2RD1 A;  3LYI A;  3TEE A;  3TCJ A;  1YIJ T;  2MIO A;  4R56 A;  2KGT A;  3M0R A;  2MAM A;  4C8Q D;  2DET A;  1H64 1;  2BZY A;  4M78 D;  5AYF A;  2MI6 A;  4F14 A;  2ABL A;  4AFZ C;  2NUZ A;  3C0C A;  3CC2 T;  4V2S A;  2F5K A;  2E5K A;  3HFO A;  1OU9 A;  2LCL A;  2K79 A;  4KUL A;  1M1K U;  3I5R A;  3S3M A;  2X3X D;  7AT1 B;  1IRE B;  1WJS A;  2JTM A;  3HP9 A;  3M54 A;  1UGS B;  3HSB A;  2LVM A;  1GXI E;  2LNH B;  4M7A G;  2L89 A;  3S3O A;  4EMK B;  2DIG A;  2QQ9 A;  3CBP A;  1VIE A;  5GAN h;  2LRQ A;  3JCM c;  4M7D C;  1VYV A;  3TU4 K;  3P8D A;  1YJ9 A;  1BK2 A;  1S72 T;  3CCJ T;  5DY9 A;  4AG1 C;  1AVZ C;  2DD4 A;  3VKI A;  2D8J A;  3G6E Q;  3L2R A;  2XIC A;  2DL8 A;  2RI5 A;  4PLL A;  3OYN A;  1KHI A;  2H8H A;  3VS5 A;  1MUZ A;  2RMO A;  3E19 A;  1YJW T;  5GAM h;  2CH4 W;  3C95 A;  4PJJ A;  4AFS C;  2E5Q A;  4XU1 A;  5LJ5 g;  3CME A;  1VQ8 Q;  2OTL Q;  4N0A C;  5J26 A;  2O31 A;  2QTV A;  1OU8 A;  1GCQ A;  4E7I A;  2ZPH B;  4J83 A;  2V1R A;  4C8Q G;  1NYG A;  2P84 A;  1NYF A;  2PTK A;  4M78 G;  1QVF A;  2YLB A;  2DL3 A;  2EAY A;  4GY5 A;  1YJ9 T;  1RLQ C;  2QAZ A;  4E7J A;  4J7F A;  1QCO A;  2DPP B;  2O01 E;  3EHQ A;  3OYK A;  1G3T A;  4OMF B;  1RI9 A;  3S3N A;  2ZPI B;  2LCS A;  4BD3 A;  1LPL A;  4XAX B;  2X51 A;  5KH6 A;  2I2L A;  3L1A A;  1KD1 U;  2O4X A;  3DKM A;  5AT1 B;  5CAI A;  1Q7Y U;  4PJO F;  2KXD A;  4B6M A;  3LGF A;  4J6Y A;  3A98 A;  4FM4 B;  1W70 A;  3EG9 A;  1YIJ Q;  2X4X A;  2MWO A;  4C5H A;  2DNU A;  3CME T;  1I07 A;  1QVG A;  2FEI A;  1N9R A;  2LJ0 A;  4JJC A;  4JRI A;  2HL5 C;  2KXC A;  2L0A A;  4MMK A;  1QLY A;  3NGP A;  3CC2 Q;  2DD5 A;  1PWT A;  1U5S A;  3MET A;  3H8Z A;  3OS5 A;  2WAC A;  4X9D A;  2YDL A;  2ESW A;  4XU3 A;  4F7U A;  2JOY A;  3PVL A;  1Q86 C;  4MZT A;  1VQN A;  4AMC A;  1PNJ A;  3ASK A;  1RI0 A;  4FL6 A;  4J9F A;  5CKE A;  2E1H A;  1QWF A;  5FU6 C;  1ACM B;  2YXY A;  1N8R U;  3UAT A;  4DQ2 A;  2KAF A;  3CQT A;  2K4Y A;  2KRN A;  1NJI U;  1KIK A;  2XI9 A;  2C0T A;  2D1X A;  5LJ3 g;  1S72 Q;  3CCJ Q;  3NFC A;  4XTY A;  2M16 A;  2J05 A;  2GNC A;  4PJL A;  1VQL A;  1OZ2 A;  3CXC S;  3Q1J A;  1W4S A;  5KYW B;  4LDY A;  3GOX A;  4PJM A;  4M7A B;  1Q86 R;  3A8M B;  4II1 A;  4KGV B;  1Q82 C;  1GL5 A;  3RKX A;  3JB9 F;  3M0S A;  4A4G A;  2E6N A;  4N4I A;  1MND A;  4JZ4 A;  5GAN 8;  1ZHI A;  3ER0 A;  4PFO A;  1U1T A;  2OAW A;  1TUD A;  2M9U A;  1MMD A;  1HD3 A;  4E47 A;  5DLO A;  1AZE A;  2DK3 A;  1YJW Q;  1Y71 A;  4E7H A;  2KT8 A;  4QKU A;  5D6W A;  1ZSG A;  4XU0 A;  2ZPG B;  1X43 A;  4KBM B;  4LXC A;  5HY6 A;  1VQN T;  4C92 A;  3INZ A;  1N9S A;  1KFZ A;  1T3L A;  4OGE A;  4QVZ A;  1PG5 B;  2HSP A;  2E70 A;  3QDF A;  3V7C A;  5A0D A;  2HAX A;  1KQS P;  4ELY C;  5CCA A;  1YWP A;  2COY A;  3RES A;  2L3S A;  1D1A A;  1YJN A;  3RNJ A;  4IUT A;  4ZTF A;  1YJ9 Q;  2E65 A;  4BY6 C;  1E6H A;  3C4S A;  1VQL T;  1UHF A;  3JCM h;  3M55 A;  3BY7 A;  3V7S A;  2GGR A;  2BE9 B;  1ZSZ A;  2AZV A;  3F70 A;  1IHV A;  2FZG B;  2C06 A;  1QQJ A;  4J6X A;  2KY9 A;  2MF2 A;  2X4J A;  4Y28 E;  1ZX6 A;  4C8Q B;  2M51 A;  5IXB A;  2HKQ B;  4M78 B;  8AT1 B;  2HEQ A;  2DBK A;  2FYK A;  3G4S T;  2K2V A;  4FYX B;  5I22 A;  5GMK j;  4M77 C;  3KFV A;  2PUO B;  3CME Q;  4M7D E;  5KE2 A;  2RK2 A;  2O88 A;  2JZ2 A;  4DBH A;  2EKH A;  2KK4 A;  1HSQ A;  5GAO l;  2CYZ B;  4A4F A;  1XOV A;  1YJN T;  5KYY B;  3JB9 H;  2JVV A;  4O6J A;  3QPH A;  1OQK A;  2RJF A;  3HHT B;  4EMK A;  1O75 A;  4MML A;  2IIM A;  1WLP B;  6AT1 B;  3PIO A;  2RI2 A;  1BI1 A;  3SD4 A;  2KDS A;  4JJB A;  1X75 C;  1WHL A;  2A36 A;  1ZUK A;  4J9B A;  2FZC B;  2FB7 A;  2DTI A;  5IXF A;  3OA6 A;  3IQL A;  2MPX C;  4BDY A;  3J7A F;  4OB3 B;  1SSF A;  4XTX A;  4LDU A;  1WDX A;  2YSQ A;  1WJQ A;  3QDR B;  8ATC B;  3CCQ T;  4MDX A;  2EYX A;  1D09 B;  1VQN Q;  3QWX X;  4PNO A;  2XKO C;  1UE9 A;  3I56 T;  2XG8 D;  4ORZ A;  5GAN f;  4XTZ A;  1I0C A;  3X25 B;  4BI8 B;  4JRQ A;  4Y92 A;  1QP3 A;  4HT8 A;  4M7D G;  2DYB A;  2F69 A;  2QQR A;  1R0C B;  3CD6 T;  1UGV A;  4M75 C;  1M8M A;  4ZGE B;  1KSW A;  1VQL Q;  3ZEH A;  1EZZ B;  1GFC A;  4X34 A;  4ANJ A;  3SWN C;  3EGD B;  3QWY A;  4UC4 A;  2LJ3 A;  2R5M A;  3RKY A;  2DL4 A;  4JPB W;  1UG1 A;  3M0Q A;  1K76 A;  4LUE A;  4ZGD B;  2ED1 A;  4N4G A;  4BI4 A;  3D7S B;  1WXB A;  3G4S Q;  1M9S A;  1K8A U;  2X35 A;  5GAM f;  3JB9 I;  1M1K C;  2O2O A;  2DFU A;  2FRW A;  3PVQ A;  4MZP A;  3PT9 A;  4C0D C;  3CMA A;  4QVD A;  1TS9 A;  1OPK A;  3OY9 A;  1J3T A;  1YJN Q;  5I21 A;  1AOJ A;  2F5T X;  4ZN1 A;  1OX9 A;  2J06 A;  2JM8 A;  3E1S A;  4D8K A;  1ZA2 B;  1OPL A;  1KJW A;  3OYD A;  3TSW A;  3FJP A;  1M1K R;  4CRI A;  4OB0 B;  3A8O B;  4OGC A;  3O8V A;  2XDP A;  1UJ0 A;  2NUP B;  1PD1 A;  4LDW A;  4RCC A;  2DF6 A;  2CDT A;  2VV5 A;  3EG1 A;  2G6F X;  5GJW B;  3R6N A;  3GF5 A;  5EC7 A;  5GAN j;  1ABO A;  2CS7 A;  5KYW A;  1M2V B;  2HQH A;  4M7A A;  1KQ1 A;  5LJ3 e;  4QT7 A;  4OVA A;  2RNA A;  1QKX A;  1QVG S;  2Y4Y A;  5FRO A;  1TUG B;  4NOY A;  2DO3 A;  2PNI A;  3M53 A;  4FT2 A;  5GAN 6;  4AFU C;  2RN8 A;  2C0O A;  3CMA T;  5HCK A;  2ED0 A;  4DA4 A;  1ZUY A;  5IAY A;  1I8F A;  2RO0 A;  4C0F A;  1KC8 U;  2VYT A;  3CCQ Q;  3WVE B;  2DX1 A;  4EMG A;  2J6O A;  3OW2 A;  1UDL A;  5GAM j;  1RAI B;  5I11 A;  3I56 Q;  2HQX A;  4F7U F;  1JXO A;  3GBQ A;  3JCM W;  2K9G A;  1Q7Y C;  1QCF A;  1ZQ1 A;  4M77 D;  1U1S A;  4F16 A;  2CP5 A;  3CD6 Q;  4IUQ A;  3G7Z A;  1B3Q A;  4PFP A;  2QYZ A;  4PJO E;  2RQR A;  4A53 A;  2V1Q A;  4BE1 A;  4XU2 A;  4C8Q A;  3S6W A;  3AHU A;  5GAN 3;  1CKB A;  4KRT A;  3OB9 A;  4M78 A;  4EIK A;  4QVC A;  3BDL A;  3CPW S;  3L2W A;  1OI1 A;  3MO8 A;  3MP1 A;  4PFZ A;  2EYW A;  3NMZ C;  1KD1 R;  1M5Q 1;  1NZ9 A;  3H0F A;  5FW9 A;  2CUD A;  1Q7Y R;  3L2V A;  1OYX A;  1M3C A;  1D3B B;  3JCM P;  1UB4 A;  2BUD A;  4HXJ A;  4RTW A;  1YWO A;  2RQT A;  4C0Z A;  1WXT A;  2LTO A;  4JS4 A;  1TXQ A;  4ESR A;  3GP8 A;  5LJ5 h;  2KYM A;  1TWB A;  5KYY A;  4BE0 A;  1R77 A;  4XTV A;  3EHR A;  4RUG A;  4C92 F;  4E7K A;  1NJI C;  1JRI A;  1I4K 1;  4JJN K;  3MHX A;  2J7I A;  2K2M A;  4JDS A;  2SEM A;  1EFN A;  3JCM f;  1V1C A;  2QQA A;  3LWI A;  2DKG A;  5FU7 B;  1HYO A;  3DB4 A;  4DBQ A;  2EYY A;  3BFM A;  4Z88 A;  2QQS A;  2GTO A;  4JRK A;  4JLG A;  2YRD A;  1BI3 A;  2LJ1 A;  5HK0 A;  1N8R R;  1NJI R;  3QKJ A;  4O5V A;  1XTD A;  1I81 A;  4K11 A;  3LH0 A;  2LQK A;  3MP8 A;  4M77 G;  5HK3 A;  2DEQ A;  2HMA A;  4FSS A;  3CMA Q;  2LQ8 A;  4M75 E;  5CQX A;  4LNP A;  2RI3 A;  3V8L A;  2BZ8 A;  3CC4 A;  1UGP B;  4GLK A;  3MEU A;  3MP6 A;  1K9M U;  2QGG A;  1UHC A;  3E2U A;  1N5Z A;  4JS5 A;  5IT9 E;  1YFN A;  1UEC A;  5CK9 A;  1XJW B;  2CZ1 B;  1K0S A;  2PQW A;  3EGD A;  3A8L B;  5LJ3 h;  2LCC A;  2CH4 A;  2Y90 A;  2WSF E;  1NG2 A;  2KQW A;  2XDD A;  2KRO A;  5FU6 B;  2DMO A;  1W2B S;  2YRC A;  1PSE A;  1VQO A;  2ZPE B;  3KXT A;  4KH1 B;  4RTT A;  3TRE A;  1BCO A;  2F2V A;  2RF0 A;  3FB9 A;  2EJG A;  1C6V X;  5CKH A;  4JLI A;  3HPW A;  3SEM A;  2HSE B;  2BKD N;  1PD0 A;  3MCA B;  3JCM X;  2RJE A;  5GAO p;  3ZBD A;  3OBY A;  1X6G A;  1VYU A;  4M75 G;  1SKU B;  1UUE A;  4KUI A;  3REA B;  3OYJ A;  2NUP A;  4A54 A;  3J81 E;  1U06 A;  2RHX A;  3E9F A;  2EQM A;  1M3A A;  2EGC A;  1U3O A;  4HT9 A;  1G8X A;  1M2V A;  4JJD A;  1Y7X A;  4OF1 A;  3OYY A;  2RPN A;  1VQO T;  5GAN d;  4BY6 B;  1G3S A;  2IPO B;  2XDB A;  5J39 A;  2RQW A;  3GNG A;  5FRM A;  1M30 A;  3PFS A;  2E64 A;  4Z89 A;  2FL7 A;  1V76 A;  4LN2 A;  4RKU E;  3PE0 A;  4YTL A;  4R0K A;  3A1P A;  4TVR A;  1TUC A;  1LNX A;  2VWF A;  2LZ6 B;  1VQ4 A; 
#chains in the Genus database with same CATH homology
 2A7Y A;  5CVI A;  5KCH A;  1XOV A;  3PMI A;  1YJN T;  3RIR A;  1KQS S;  1UEB A;  1OZ3 A;  4PJO G;  3JB9 H;  2JVV A;  3LLR A;  4M75 D;  4O6J A;  4OB2 B;  4IUV A;  2HQE A;  5GAO m;  1N27 A;  3C12 A;  3QPH A;  4NL3 A;  3PNW C;  5GAO r;  4M77 B;  2RJF A;  3HHT B;  4EMK A;  3L2Z A;  4XTU A;  1O75 A;  4MML A;  2GCX A;  2PUK B;  2L5Q A;  5GAM d;  2KSS A;  2IVW A;  2D6F A;  3M4G A;  4DOW A;  3PIO A;  1HXD A;  2RH2 A;  2NLU A;  4HCZ A;  2EIF A;  3FDR A;  3G71 T;  2RI2 A;  1BI1 A;  3CD6 T;  5GAN 4;  3SD4 A;  4OB1 B;  2KDS A;  1G3Y A;  3CCU T;  5A0G A;  3JRZ A;  5LJ5 d;  1I5L A;  1X75 C;  2OTJ T;  3PMT A;  1WNL A;  4P5N A;  4A4K A;  2DXU A;  1LOJ A;  2JUF A;  2P0K A;  5KCO A;  1K8A C;  2MWP A;  4C8Q E;  5M9O A;  3CCE A;  3UPU A;  1VQ5 T;  2YHT A;  1NPP A;  2O4X B;  3KUF A;  4M78 E;  1M90 U;  2DAQ A;  2FB7 A;  5GMK h;  2DVE A;  2EQU A;  5DLQ E;  2WSC E;  2YLC A;  4C5E A;  4KUD K;  2DTI A;  1Y07 A;  4FU6 A;  3OA6 A;  1XNI A;  1VQ9 T;  4BDY A;  3X20 B;  3JCM Q;  4EMK C;  4M7A F;  3WVD B;  3G6E A;  3GPL A;  2RK1 A;  1V29 B;  3X26 B;  1WPY A;  3OS0 A;  3CXC A;  2D0Q B;  3OBW A;  4LDV A;  3J7A F;  3OYL A;  4OB3 B;  1SSF A;  1YJW A;  4XTX A;  4BDZ A;  2R58 A;  1VQ6 A;  4LDU A;  1D3B A;  2R57 A;  1EIF A;  2PVD B;  5EG2 A;  1WJQ A;  2CZ7 B;  2CZ6 B;  3A8G B;  3QDR B;  3L2U A;  1VQ4 T;  2RB6 A;  4M75 A;  1O9S A;  5CQY A;  5HKC A;  3OW2 S;  3DLM A;  2DTO A;  1QVP A;  3X28 B;  3QO3 A;  4A4E A;  3CCQ T;  4MDX A;  4QW2 A;  4HKE A;  1BIB A;  3M58 A;  3CC4 T;  4Q5W A;  5LL6 S;  1YBY A;  4PNO A;  3PTA A;  2XKO C;  2DTH A;  2ZPB B;  3GNF B;  3OS1 A;  5GAO n;  3I56 T;  4J6W A;  2YRV A;  4M77 E;  2XG8 D;  4F7U B;  4HCB A;  1K73 U;  2VC8 A;  2OTL A;  1KHC A;  5GAN f;  2LX9 A;  1NE8 A;  1JB0 E;  4XTZ A;  3CCR A;  3JB9 G;  2RJC A;  3QUI A;  3X25 B;  4BI8 B;  1TH7 A;  4HCC A;  4JRQ A;  4PL6 A;  1QP3 A;  5GAN 5;  2ZPF B;  1G5V A;  4HT8 A;  4M7D G;  2F69 A;  2QQR A;  3JCM e;  4BE2 A;  2QQB A;  3CBM A;  4N0A A;  3RMS A;  3VJP A;  4LD9 K;  3L42 A;  3OYG A;  4BUG A;  3CCE T;  4M75 C;  4ZGE B;  3OYC A;  4PKC C;  5FRN A;  1KG1 A;  2HBP A;  3M56 A;  2RHU A;  3ZEH A;  1M1F A;  1X6O A;  4X34 A;  4JRP A;  3SWN C;  2PU9 B;  2DIQ A;  3C94 A;  4UC4 A;  1M90 C;  2E41 A;  2R5M A;  3QHS A;  3G6E T;  3CEY A;  3RKY A;  3JAM E;  2RM4 A;  5CKB A;  1N6A A;  2DXC A;  5CO7 A;  3JCM V;  4C5I A;  3DLL A;  4QQ6 A;  2XID A;  4C8Q F;  1AHJ B;  4EPC A;  3QXE B;  4ZGD B;  3HL8 A;  3QG1 A;  4M78 F;  2LT1 A;  3OYE A;  4BI4 A;  4N4G A;  1P92 A;  3QJY A;  3NTH A;  2VGN A;  4KT0 E;  4C92 C;  2V8J A;  3VV0 A;  1M8V A;  1M4Z A;  1KC8 C;  1M9S A;  1K8A U;  2X35 A;  5GAM f;  5CKF A;  3JB9 I;  1M1K C;  4M7A E;  3T9N A;  3SWN B;  4M7A D;  5FU7 C;  5LJ3 d;  1VQP A;  3RMQ A;  3VYG A;  3SB2 A;  5GAN 7;  1NPR A;  1YIJ A;  5LJ5 f;  4J5Y A;  4MZP A;  2M1H A;  4WF2 A;  3PT9 A;  4C0D C;  2VXF A;  3HFN A;  3CMA A;  3V8K A;  1VQ8 T;  2H3J A;  2OTL T;  4QVD A;  3JB9 D;  3H6Z A;  3CCR T;  3RKW A;  2RJD A;  4C92 B;  1B34 B;  4F7U E;  4E7L A;  4QQD A;  3CC2 A;  4IUU A;  5GAN 2;  3OY9 A;  4M7D D;  1YCY A;  2F5T X;  5I21 A;  2DJZ A;  4ZN1 A;  2EKO A;  2GFU A;  3GIB A;  3QYG B;  2QDY B;  4PJO C;  3E1S A;  2ZCF B;  4M77 F;  3OYD A;  3SDZ A;  1KQS A;  2HD0 A;  3LWH A;  2VUB A;  4L6V 5;  3J80 E;  3FJP A;  4MZM A;  4C0D B;  2M0O A;  4A4F A;  2GQV A;  4CRI A;  2RHY A;  4OB0 B;  3A8O B;  3R6O A;  4OGC A;  3FRN A;  3O8V A;  4RCB A;  3URG A;  3M59 A;  3OYB A;  2XDP A;  3PIP A;  3MEW A;  2X4Y A;  1VQ7 A;  4LDW A;  4RCC A;  4ME7 A;  1BYM A;  4XTW A;  2VV5 A;  3FLG A;  1KQ2 A;  3M4Y A;  4RG2 A;  5GAO q;  1JJ2 S;  3QBY A;  4Y91 A;  3P8H A;  3GF5 A;  5GAN j;  4PJO B;  2CZ0 B;  1LJO A;  2K5F A;  5GMK e;  2CS7 A;  1S72 A;  3DB3 A;  3OYA A;  3CCJ A;  4M7A A;  3ZFJ A;  1KQ1 A;  2DZC A;  4VUB A;  5LJ3 e;  2RD1 A;  4OVA A;  5GMK i;  1M1G A;  3LYI A;  4J7I A;  5DM7 R;  3TEE A;  1QVG S;  2Y4Y A;  3TCJ A;  1YIJ T;  5FRO A;  2XD0 A;  4NOY A;  3JCM d;  2EQJ A;  2EQK A;  4R56 A;  4C8Q D;  2MAM A;  2DO3 A;  2P0P A;  4LD6 A;  1H64 1;  3QZ5 B;  3E9G A;  3M53 A;  4M78 D;  3GLX A;  3P8B B;  4FT2 A;  5GAN 6;  3CMA T;  4DA4 A;  5AYF A;  2MI6 A;  2E12 A;  4NL2 A;  3OYM A;  2DXT A;  1Y96 B;  5IAY A;  1Q81 C;  1I8F A;  3CC2 T;  2RO0 A;  4M7D A;  1PSF A;  4IKF A;  4V2S A;  2F5K A;  4BAC A;  3JSC A;  3OSS C;  4C0F A;  3WXM B;  1XQH A;  3HFO A;  1KC8 U;  2LCL A;  2VYT A;  4KUL A;  3WVE B;  1M1K U;  3S3M A;  4EMG A;  1IRE B;  4IUR A;  1WJS A;  2JTM A;  3HP9 A;  3M54 A;  3OW2 A;  3A5Z B;  1UGS B;  3NTI A;  4X9C A;  5GAM j;  2VXE A;  1VQM A;  3HSB A;  2HQX A;  4L59 A;  3X24 B;  2LVM A;  4F7U F;  4HA8 A;  1GXI E;  2RHZ A;  3UWN A;  4M7A G;  2L89 A;  3NTK A;  3JCM W;  3S3O A;  4EMK B;  1QP2 A;  2DIG A;  3OMC A;  2QQ9 A;  3CBP A;  5LJ5 j;  1VQ7 T;  2A3L A;  5GAN g;  1VIE A;  3OMG A;  5GAN h;  3BDU A;  1MGQ A;  1Q7Y C;  2JTF A;  4C5G A;  5LJ3 f;  1ZQ1 A;  4M77 D;  2LRQ A;  1U1S A;  3HKS A;  3JCM c;  4RG8 A;  4M7D C;  5A0L A;  3TU4 K;  2CGH A;  3P8D A;  3G7Z A;  4IUQ A;  1YJ9 A;  1S72 T;  3CCJ T;  1YHQ A;  4PJO E;  4OP0 A;  5DY9 A;  4A53 A;  3CBO A;  3OYF A;  2KMT A;  1WJR A;  2DD4 A;  3VKI A;  4BE1 A;  2IG0 A;  3EFS A;  4XU2 A;  4C8Q A;  3S6W A;  4L5G A;  3AHU A;  5GAN 3;  2JN0 A;  3CPW A;  3OB9 A;  4M78 A;  5C6S A;  3L2R A;  4QVC A;  3BDL A;  2VGM A;  3CPW S;  3G4S A;  3EFR A;  4CI0 C;  2XIC A;  3L2W A;  1IZ6 A;  1OI1 A;  2RI5 A;  4NS5 A;  4PLL A;  2QEX A;  3OYN A;  1KHI A;  3MO8 A;  3MP1 A;  3OQ5 A;  1YI2 A;  1M5Q 1;  1NZ9 A;  3LW5 E;  4M75 F;  1VQK A;  5I2S A;  3M9Q A;  2EWN A;  4A4H A;  3L2V A;  2X4W A;  1OYX A;  3E19 A;  1YJW T;  5GAM g;  4R55 A;  1K9M C;  1D3B B;  5GAM h;  4D6W A;  3JCM P;  1UB4 A;  2BUD A;  3C95 A;  1G3W A;  4M75 B;  2GF7 A;  1RL2 A;  2BIV A;  2K57 A;  2E5Q A;  2LTO A;  4C0Z A;  4JS4 A;  1VQ6 T;  4XU1 A;  5LJ5 g;  3GP8 A;  3CME A;  5I2M A;  4ZTJ A;  5LJ5 h;  4C0G A;  4N0A C;  4BE0 A;  5J26 A;  4XTV A;  4C92 F;  1FWZ A;  2MMP A;  3QZ9 B;  4E7K A;  4E7I A;  2ZPH B;  2PVG B;  4J83 A;  1NJI C;  1JRI A;  1I4K 1;  3OSV A;  4M77 A;  4C8Q G;  4JJN K;  1Q81 U;  3MHX A;  2E6Z A;  4M78 G;  1R8O B;  1QVF A;  2YLB A;  4JDS A;  2E10 A;  3JCM f;  2EAY A;  4GY5 A;  1YJ9 T;  5KE3 A;  4E7J A;  2QQA A;  1QVF S;  3BW1 A;  4J7F A;  2DPP B;  5CKD A;  1YHQ T;  4LDX A;  3LWI A;  2O01 E;  3CCU A;  3A8H B;  4N4H A;  2DKG A;  4JUV A;  3OYK A;  2L3R A;  1G3T A;  5FU7 B;  2QA4 A;  3DB4 A;  4OMF B;  3S3N A;  4XQ3 A;  2KVQ G;  2ZPI B;  3JB9 J;  4BD3 A;  3BFM A;  5C0M A;  4XAX B;  5KH6 A;  2L8D A;  2I2L A;  3L1A A;  1KD1 U;  3CCL A;  2QEX T;  2O4X A;  3DKM A;  2QI2 A;  2QQS A;  1BKB A;  2GFA A;  5CAI A;  1Q7Y U;  4JRK A;  2WSE E;  2ZGW A;  1BI3 A;  4JLG A;  4PJO F;  5HK0 A;  3L2Q A;  1YI2 T;  1VQ9 A;  4BI3 A;  4RMO A;  1VQK T;  3V7R A;  1JBM A;  3QKJ A;  1WQW A;  4O5V A;  1XTD A;  1JJ2 A;  3LGF A;  1I81 A;  4J6Y A;  3LH0 A;  1Q82 U;  2LQK A;  2G3R A;  4FM4 B;  3MP8 A;  4M77 G;  5HK3 A;  2X4X A;  2MWO A;  3QJ6 A;  2DEQ A;  2XU8 A;  4C5H A;  2JNG A;  4FSX A;  3CCS A;  3CME T;  2LT4 A;  1QVG A;  2LQ8 A;  4M75 E;  5CQX A;  1N9R A;  1VQP T;  4MDW A;  4JRI A;  2RI3 A;  3UT1 A;  3CCQ A;  3V8L A;  3VUZ A;  4MMK A;  2DD5 A;  2PVO B;  3CC4 A;  3KBG A;  4FT4 A;  4B9W A;  3OYH A;  1UGP B;  3MET A;  4GLK A;  3H8Z A;  5A2Q E;  3OS5 A;  2WAC A;  4X9D A;  3I56 A;  1DJ7 B;  2DZ9 A;  4XU3 A;  4F7U A;  4EMH A;  2JOY A;  1ZBX A;  2P4T A;  2XHC A;  3MEV A;  5J3B A;  1Q86 C;  3MEU A;  3MP6 A;  4MZT A;  4XK8 E;  1K9M U;  3HRU A;  3LX7 A;  1VQN A;  1YIT A;  3OYI A;  3ASK A;  4J8O A;  4C92 E;  1RI0 A;  4FL6 A;  4C92 D;  2QA4 T;  5CKE A;  2E1H A;  5FU6 C;  2K5L A;  4JS5 A;  5GAN e;  4ZGJ B;  5IT9 E;  2HNI A;  5FLX E;  4EDU A;  3CCM A;  4M7A C;  3CD6 A;  2QTX A;  5CK9 A;  1N8R U;  2CZ1 B;  4DQ2 A;  2KAF A;  3CCL T;  1UGR B;  3PGG A;  3UDC A;  2K4Y A;  2PQW A;  1NJI U;  5L8R E;  2XI9 A;  1U8R A;  5LJ3 g;  1FX7 A;  2Y4X A;  1KD1 C;  3A8L B;  5LJ3 h;  2EJF A;  3MEA A;  3CC7 A;  2LCC A;  4ZN3 A;  3NFC A;  4XTY A;  2M16 A;  2RA2 A;  2Y90 A;  1HK9 A;  2WSF E;  3FC3 A;  2KQW A;  1VQL A;  2RHI A;  2XDD A;  5IN1 A;  1OZ2 A;  2B8A A;  2R5A A;  3FIF A;  3Q1J A;  1W4S A;  5FU6 B;  3CXC S;  1W2B A;  4FIB A;  4LDY A;  3GOX A;  1W2B S;  4M7A B;  2FVU A;  1VUB A;  3A8M B;  4II1 A;  1Q82 C;  1UGQ B;  3RKX A;  3CCS T;  3JB9 F;  4F7U G;  2AHJ B;  3M57 A;  4PJO D;  1BIA A;  4A4G A;  5CIU A;  2E6N A;  4N4I A;  3SWN A;  3QYH B;  1PSE A;  1VQO A;  2K3Y A;  2ZPE B;  3KXT A;  4M7D F;  1H3Z A;  5GAN 8;  4DOV A;  1ZHI A;  4ELZ C;  3ER0 A;  1BI2 A;  3N5B B;  1U1T A;  1BI0 A;  3QII A;  4PLI A;  2M9U A;  5GAM e;  5GMK l;  4E47 A;  5DLO A;  2EYQ A;  3QSU A;  2DK3 A;  3JCM b;  2LC4 A;  3TRE A;  1Y71 A;  4E7H A;  3V8J A;  1VQ8 A;  3VYH B;  3FB9 A;  5D6W A;  3I55 A;  4XU0 A;  4M7D B;  1MHN A;  2EJG A;  2ZPG B;  4KBM B;  5HY6 A;  5LJ5 e;  1VQN T;  4C92 A;  5GMK m;  1B34 A;  1WQ7 A;  4JLI A;  3INZ A;  1N9S A;  5CKH A;  1YIT T;  4OGE A;  2EFI A;  3HPW A;  4QVZ A;  2CKK A;  5D6X A;  4BB7 A;  2E70 A;  2BKD N;  2EJ9 A;  3CCM T;  3V7C A;  5A0D A;  2HAX A;  3MCA B;  3CCV A;  3JCM X;  2RJE A;  4ELY C;  5CCA A;  1VQM T;  5GAO p;  3ZBD A;  3RES A;  1YJN A;  3ME9 A;  3OBY A;  4C8Q C;  3RUX A;  4IUT A;  2K3X A;  3VUB A;  4ZTF A;  1N8R C;  4M78 C;  4M75 G;  2E65 A;  3CC7 T;  4BY6 C;  3OS2 A;  3JCM g;  5CR2 A;  3C4S A;  1VQL T;  3JCM h;  4KUI A;  3M55 A;  1Q86 U;  3OYJ A;  1VIF A;  2ZZD A;  4A54 A;  3BY7 A;  3J81 E;  3JCM J;  3V7S A;  1FXX A;  2RHX A;  3E9F A;  2LNV A;  2EQM A;  2OAU A;  3G71 A;  4PJO A;  3F70 A;  4HT9 A;  2QXF A;  2C06 A;  5D6Y A;  2OTJ A;  2K5I A;  4J6X A;  2KY9 A;  2MF2 A;  2X4J A;  4Y28 E;  1Y7X A;  4C8Q B;  4OF1 A;  2DXB A;  3FEO A;  3OYY A;  4C92 G;  2D9T A;  4M78 B;  1VQO T;  3SFM A;  3HRS A;  5GAN d;  4BY6 B;  2FYK A;  2P0Q A;  3G4S T;  2V8I A;  1VQ5 A;  1WGS A;  1G3S A;  4ATO A;  1X01 A;  2XDB A;  3VU3 C;  5J39 A;  2K2V A;  4Z02 A;  3GNG A;  5FRM A;  3M5A A;  2LDM A;  3PFS A;  2V8K A;  3I55 T;  2E64 A;  3HRT A;  3LGL A;  5GMK j;  2XK0 A;  1QW1 A;  2FL7 A;  4M77 C;  4RKU E;  1Y96 A;  3EAE A;  1K73 C;  2PUO B;  3CPF A;  4YTL A;  4M7D E;  5LJ3 j;  5KE2 A;  2RK2 A;  4IUP A;  2JZ2 A;  3RER A;  2KK4 A;  4B9X A;  4TVR A;  1LNX A;  5GAO l;  2FHD A;  3CCV T;  4QQG A;  2CYZ B;  1VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...