2XK0A

Solution structure of the tudor domain from drosophila polycomblike (pcl)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Atypical Tudor Domain in the Drosophila Polycomblike Protein
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords POLYCOMB PROTEIN PCL
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xk0A00
3S3NA 3F70A 3NTIA 4C5EA 4E7LA 3ZEHA 2LDMA 3E9GA 4E7KA 3L2VA 5IN1A 3P8DA 1MHNA 3S3OA 2EQKA 3OYBA 2QQRA 4LD6A 3H6ZA 2B8AA 3PNWC 3Q1JA 3NTHA 4IKFA 2RJDA 2VYTA 1SSFA 3EAEA 4FL6A 3S3MA 4NS5A 3MP1A 2L89A 3LGLA 4Q5WA 4A4HA 2HQEA 4E7HA 3QKJA 2JZ2A 1OZ3A 3LYIA 4EDUA 2X35A 3MEVA 4N4IA 2X4WA 3FDRA 2RJEA 2M1HA 5IAYA 4Z02A 3CEYA 2LTOA 3C4SA 4UC4A 3OYJA 4E7IA 3OYDA 5J39A 4PLLA 5D6XA 3PFSA 2DAQA 2L3RA 3ME9A 5KE3A 4A4GA 4E7JA 4IUPA 4QQGA 4HCZA 3OS0A 2L8DA 5FRMA 3E9FA 3OMGA 2M16A 5FROA 2DIGA 4BD3A 3OY9A 3GOXA 2G3RA 3OYCA 4QQDA 2DIQA 3QBYA 3QIIA 3PMIA 2LRQA 2MWPA 2RJCA 3SD4A 3OQ5A 2D9TA 2R5AA 3L2QA 3OYLA 1WGSA 4N4GA 3MO8A 4IUUA 2R57A 2RHXA 2RO0A 5C6SA 3P8HA 3OS1A 3OS2A 2K3XA 3ASKA 4QQ6A 2RI2A 3DB4A 4A4EA 2JTFA 1OZ2A 2R58A 4IUQA 3OYKA 2RHYA 4IUTA 4ZTJA 2RHZA 3FC3A 2E6NA 2BIVA 4BACA 3MEWA 2K3YA 2XK0A 2EQMA 4N4HA 2E5QA 4BDZA 1WJQA 3S6WA 3LGFA 5KCOA 3LH0A 3L2WA 2LVMA 5J26A 1WJRA 3M9QA 1RI0A 3NTKA 4FU6A 2IG0A 3MEAA 4C5IA 5KH6A 3OYEA 1WJSA 3BDLA 3LLRA 4QVZA 4B9WA 1OYXA 2RHIA 3QJ6A 4IURA 2EFIA 2RJFA 3UT1A 3FLGA 1OI1A 2M0OA 3DLMA 4PL6A 2BUDA 3L42A 4BE1A 3OYFA 1G5VA 5C0MA 2GFUA 2FHDA 5M9OA 4OVAA 2GF7A 4BE2A 2XDPA 1XNIA 2PQWA 2X4YA 4PLIA 5D6WA 4CRIA 3OB9A 5KE2A 2O4XB 2GFAA 4BE0A 3OMCA 3DB3A 1N27A 4QW2A 3H8ZA 2RHUA 2MWOA 4L59A 3OA6A 2WACA 2O4XA 1KHCA 4B9XA 4IUVA 3KUFA 4C5HA 2QQSA 2NLUA 2RI5A 3OYGA 2X4XA 4BDYA 4ZTFA 3MP6A 3OYAA 1H3ZA 3OYHA 2R5MA 3UWNA 3LX7A 2EKOA 3PMTA 3META 4A4FA 2EQJA 5FRNA 4II1A 2CKKA 3OYIA 2BKDN 3OYNA 5KCHA 3MEUA 3O8VA 3MP8A 4C5GA 2F5KA 2YRVA 2P0KA 4X34A 5D6YA 2RI3A 3L2UA 4GY5A 2EQUA 4RG2A 3L2RA 2LCCA 5CIUA 3OYMA 2HQXA 3FEOA
chains in the Genus database with same CATH superfamily
4XU2A 2JXBA 1M3CA 2LDMA 3A8LB 1PSEA 2E4HA 4XU3A 1VQMQ 3RKXA 3CMEA 1JJ2P 4M78F 4KT0E 4M77G 5GAN7 1GFDA 4VUBA 3LGLA 1BB9A 2LCLA 1VQLA 2JZ2A 2K2MA 2HD0A 3JB9F 3FJPA 3ME9A 4J5YA 1TOVA 2CYZB 5EC7A 2H8HA 2DIGA 5GAMj 2P84A 3HFNA 1CKBA 3LH5A 3CCUA 4KGXB 4XTXA 4M4ZA 2ED1A 1SG5A 2LJ3A 2RO0A 3URGA 5GMKm 2DERA 2A28A 3QJYA 3SWNC 3GP8A 2P4TA 3T9NA 3G71Q 1O75A 3RIRA 4Z88A 1YN8A 3LH0A 4C92G 2FO0A 4ZGEB 1VQMT 3CCRT 2DFUA 1WJRA 4PJOD 3NTKA 3VS6A 3CCEQ 5KH6A 1W6XA 4B9WA 3UT1A 4FYVB 5C0MA 3JB9I 2QASA 2PVGB 1UHFA 4MZMA 1TS9A 4RUGA 2P0QA 1WNLA 4PFZA 2RHUA 2HAXA 1X2QA 2EJGA 4M7DC 2KE9A 3M5AA 2ABLA 3QO3A 1ZHIA 3M58A 1GBQA 3ZBDA 1ARKA 2V1RA 4ANJA 2FZGB 2JS0A 5FRNA 2BKDN 4E47A 1KC8R 4A4KA 3MP8A 2IPOB 3OSVA 3JCMc 1M90C 2L0AA 2E3IA 2GNCA 1QP2A 4OB3B 4FSSA 3C0CA 4ZGDB 4M78A 1NJIU 1NPRA 3RUXA 1QVGS 2NUTA 1X6GA 4PJJA 4IKFA 1M1KR 3JCMP 1OZ3A 4HT9A 3CC2T 1YWOA 2QI2A 1YJWT 1N8RU 4AMCA 1Y96B 1ZSZB 3OW2S 4BY6C 2JT4A 5D6XA 1U1SA 3CPWS 2YSQA 3G6EQ 4IUPA 2XICA 2D0NA 3E9FA 4KBMB 3CPWA 1ZBJA 2LNHB 2M16A 1RABB 1AZEA 4RTUA 4C92B 1WHGA 1D3BA 1YITA 1M27C 4F7UG 3OYLA 2R57A 1M2OA 4PJOC 3HRSA 2COWA 2JM8A 2K79A 1VQLQ 1M30A 2DETA 2PNIA 1IRXA 2RHYA 5LJ5g 2KRMA 2JM9A 2VUBA 1VIFA 5GANj 1C0MA 3CC7Q 2DYIA 3LLRA 6AT1B 4PL6A 2FRWA 3OW2P 1VQOQ 2PQWA 4GLKA 4CRIA 1RAFB 2EYXA 4DBHA 1WQ7A 1VQNA 1TSFA 1WXBA 3J80E 1BI0A 3ULRB 2C0TA 5ECAA 4A54A 4HT8A 4BDYA 4ZTFA 2QEXT 2GQVA 4BI4A 5IHIA 5GAOm 1D3BB 1N9SA 2OAWA 4A4FA 2MIOA 4II1A 2CKKA 3MCAB 5L23A 4XTWA 2RI3A 4WTOB 3TREA 2KR3A 3PIOA 2EAYA 1J3TA 5CIUA 5I2SA 1VQ4T 2QDYB 2RPNA 4J8OA 4E7KA 3CCVA 3H9NA 2EQKA 2RNAA 2E65A 3CCST 1Q81C 1QVPA 4FM4B 3WVDB 1X43A 1VQ7A 1WHHA 3JCMJ 2X51A 2L89A 1BKBA 1W2BP 4M77E 1NPPA 3I55T 1Q86C 1IB8A 3CCSQ 2DL3A 1W4SA 4C8QG 4QQGA 1PCXA 2OTJQ 4BD3A 5HKCA 4DA4A 2G3RA 1YBYA 1Y07A 2DVEA 2D9TA 1RAIB 1IHWA 4F7UF 3BY7A 3R6OA 2QG9B 3BW1A 5CCAA 1SHGA 2R58A 1WHKA 1VQ7Q 2MAMA 2P0PA 2O9VA 1NYFA 3G1JA 1RI0A 1KSWA 1XQHA 5GMKh 2KSSA 2RF0A 3MKDA 1AWXA 4BB7A 3OYEA 1Y96A 1D0XA 3EHRA 4QVZA 4MZTA 1S72Q 1OI1A 1SEMA 5AT1B 2LZ6B 4JRPA 2ZPBB 1OEBA 2XKOC 1BCOA 4M78D 1ZQ1A 3QXEB 2MF2A 3CMAQ 1CKAA 2DXBA 2HMAA 4ESRA 1Y57A 3JCMe 1ZA2B 1QWEA 1WPYA 4IUVA 4C5HA 1VQ6T 2NLUA 2H3EB 2J6KA 1KQSP 2YRCA 2FPDA 5GAOq 1VQNQ 2LQWA 3LX7A 2B86A 3DLLA 1EIFA 1Q82C 3G6ET 1YWPA 2K9GA 5D6YA 3VYGA 2VV5A 1N5ZA 2MPXC 5HCKA 2RQTA 3FEOA 1ZX6A 2V8IA 2FEIA 2HEQA 3H6ZA 2B8AA 2HSPA 2F2WA 1FYNA 1AWWA 5DLQE 1BI2A 2JTMA 2L2PA 4AFZC 3EHQA 3M0UA 3PGGA 3ZFJA 2KBTA 4L5GA 4MZPA 1JRIA 1YP5A 4HCZA 3H0FA 1M90U 1X2KA 2FZCB 2OTLT 2D6FA 1I81A 1VQ6A 2RHXA 1YIJA 2KY9A 1KC8C 1OZ2A 4F7UE 5KYYB 5KYXB 2XK0A 5I21A 1H3HA 2E5QA 3LGFA 2LVMA 5J26A 4FU6A 4M7DG 1MMDA 2IG0A 3M0RA 2DJZA 1D1AA 4PK4A 2QK0A 4M77F 1N9RA 4M7AD 3FLGA 3DLMA 3L42A 4RTTA 1S1NA 5I11A 5GANf 2XMFA 4M78E 4OB2B 1WLPB 1NE8A 1QCOA 2AKKA 2M0YA 4J7IA 4M78C 5A0GA 2DTIA 1K8AC 1W1FA 1CSKA 3H0HA 2DE0X 2VXFA 1H8KA 3OYHA 2W10A 2EVRA 2PTKA 5GAOr 2CZ6B 5LJ3f 3OSSC 5CKFA 3OYNA 3MEUA 5IT9E 3P8BB 5GANe 4RG2A 2KXCA 1UG1A 5GAMe 1M8MA 4M75G 2W0ZA 3SHWA 1VQKT 4F14A 3NTIA 1BBZA 2CT4A 2Y90A 4J9FA 5IN1A 4Z89A 2ROLA 1B34B 1AD5A 3CCMA 1YITQ 2Y4XA 1VQ9A 3G71A 2VGNA 5KYWA 4HCKA 5DY9A 1PNJA 1O9SA 1Y0MA 2KYMA 2O9SA 2CP5A 2HL5C 2YLBA 4OGEA 2DLPA 1UGRB 1B07A 2DRKA 1NLPC 5LJ5j 1UTIA 2L3SA 1KHIA 2FL7A 1Q82U 1R77A 1G3TA 2JUFA 2CGHA 3CCUQ 1JO8A 5FWBA 4AFSC 2WSEE 2V8JA 3NGPA 3BE3A 1Q7YR 2RJCA 3OQ5A 2RA2A 2A36A 5CO7A 1S72A 1RADB 1SRMA 1HYOA 3E1SA 3CD6A 1U1TA 2VWFA 2KGTA 2YWWA 3LWIA 3EG9A 1SSHA 2BIVA 2RM4A 3GNFB 1ACMB 2ED0A 3OW2A 3SWNB 5KYUB 1MV3A 4HCCA 2EFIA 2K7AA 4DEXA 3HHTB 2X3XD 4EPCA 4CC3A 1VQ9T 3QWYA 2FHDA 3NPFA 3GF5A 4BE2A 5GAN6 2EJFA 2ZPGB 5GMKe 2O4XB 2GFAA 5A2QE 1JXOA 1BIAA 1QVFA 1IREB 2HQHA 1VQ7T 1JQQA 1AT1B 2RI5A 3G4ST 3QYHB 2DNUA 1M4ZA 3H0IA 2EKOA 2NUPA 4LN2A 3CCRQ 3CCRA 2QTVA 4EMHA 3JB9G 2CZ1B 2MOXA 2L3PA 2GTOA 4X34A 2L5QA 3L2UA 2EQUA 1TUDA 2QXFA 2DMOA 3F70A 4E7LA 1YIJQ 2CP6A 4LDXA 3UDCA 4J9BA 4R55A 4M7DF 4RG8A 4JJCA 4J9IA 1YITT 3SWNA 2K5LA 1D1CA 4KUIA 1KG1A 1TH7A 3FDRA 5FW9A 5LJ5e 4O5VA 3CCQA 3M53A 3D7SB 3LWHA 3JCMg 2IVWA 3J81E 2LX7A 2F69A 2KDSA 1T3LA 3OS0A 3GLXA 3OYYA 2E3HA 3OY9A 2O2OA 2HKQB 3HP9A 4RTYA 1N8RR 4KH0B 4N4GA 4IUUA 2GCXA 2K3XA 3ASKA 4MMLA 4A4EA 1RUWA 2JTFA 1VQKA 1UGPB 2HBPA 3CQTA 1WX6A 4CC2A 3M59A 4C92A 1VYUA 2O01E 2C06A 4BUGA 1U3OA 3EGDB 2VXEA 8AT1B 1KJWA 2EGAA 4M75E 5CKDA 2QQ9A 3G4SQ 3UA7A 2BUDA 4LDYA 4XTUA 2IIMA 2ZPIB 3EGXA 2XDPA 1VQ9Q 4PLIA 3OB9A 3CCMQ 1HSQA 4CC7A 2KMTA 1IGQA 1I5LA 2O4XA 3G7ZA 5A0DA 2QA4T 2D8HA 3KUFA 4MDXA 1VIEA 2LJ1A 5GAMh 3CC7T 4KRTA 2MMPA 1JB0E 2OX7A 4ATOA 2CH4A 2DTOA 4MDWA 3CCQT 3U23A 3JCMb 3VS5A 3J7AF 2BZXA 2F2XA 3X26B 1VQ4A 3CBMA 3VS1A 2V8KA 1WA7A 2HQXA 3GBQA 4AFQC 4C8QC 3E9GA 1K1ZA 1K73C 1KQ1A 3TSWA 1OPKA 4AFUC 2COZA 2ZPEB 4FT4A 1NJIC 2E41A 4CC4B 2A08A 1IXDA 3A1PA 1QKWA 1MMNA 2JW4A 2ATCB 1OOTA 1FMKA 1U5SA 2X4WA 3FIFA 1YJNT 1K8AR 4RTZA 4C8QB 4PLLA 1T0HA 1UECA 5CVIA 2L8DA 2AHJB 2NUPB 1R0BG 3RKYA 2SRCA 2DXTA 2DEQA 2LP5A 3I35A 3VUBA 3SD4A 3QG1A 4JZ3A 5KYUA 2X4JA 2OJ2A 3CCQQ 4FIBA 1SPKA 2E10A 1WI7A 2RK2A 1WHMA 3BDUA 4E6RA 4C0GA 4C8QF 4FW2A 4A63B 3CC2A 1V1CA 2SEMA 3CC4T 3TSZA 2H3JA 3C94A 3CCLT 1WJSA 2DXCA 4EIKA 1UFFA 4C8QD 3QDRB 4BE1A 1G5VA 2LQNA 3HL8A 1OULA 4OB0B 2X4YA 4OP0A 2ZGWA 3OMCA 5GAOl 3REBB 2CS7A 2J7IA 5GANg 1KK7A 2YT6A 1DJ7B 2QEXQ 1RAEB 3CXCP 3PIPA 1VQ8A 2YHTA 2EGCA 2CT3A 2EPDA 2K5FA 4ELZC 2OAUA 1P92A 4J6YA 1Q82R 2BZ8A 4PFPA 2P0KA 1QCNA 2LCCA 4C92F 2CDTA 1AVZC 4M75A 1T3SA 4M78G 4Y28E 2MYSA 1D1BA 1KIKA 2D0QB 1GRIA 3HRTA 2KK4A 4NS5A 1VQ5T 1UEBA 4A4HA 2EYYA 1I0CA 2PU9B 3QYGB 4J7FA 2EQIA 2DAQA 2L3RA 1PM3A 3OMGA 2RQUA 2J6OA 5IHKA 4QT7A 1A0NB 3I9QA 4BI8B 5GAN5 3I56Q 3CCUT 3V8LA 3P8HA 1NG2A 2ZPFB 3HFOA 3OYKA 4IUTA 1PC0A 1LCKA 1B7TA 1HK9A 2KQWA 4A53A 1M1FA 3QPHA 3CCLA 2JNGA 4C5IA 4RTVA 1BI3A 3CC4Q 3A8MB 2RHIA 4DBRA 5CR2A 4P5NA 4LE9A 2E64A 2FRYA 4XTZA 3JV3A 5HK0A 4BE0A 1Q86R 2RK1A 2DK3A 2CP2A 2CUBA 2WACA 1MNDA 2QAZA 4E7ZA 1UDLA 1YJNQ 1GCQA 3TQ7P 1XJWB 5HK3A 2F5TX 4M7DD 3INZA 1YNZA 3L2RA 5GAN8 4M7AG 1EZZB 3R6NA 1AZGB 2DF6A 3JB9J 1R0CB 2E5KA 4FYWB 2HCKA 1K9AA 5FU6B 3CCVT 3S3MA 2LJ0A 4DBFA 1K73R 1VYTA 1PRLC 1K9MU 2A0FB 2C0OA 3M0SA 1PHTA 5IAYA 3OYJA 1UGQB 1VQ6Q 1X6BA 1AWJA 4E7JA 5CQXA 1M5Q1 4J83A 3VYHB 3WVEB 4DQ2A 2KYBA 3OYCA 2DTHA 5GAMd 3PMIA 2JS2A 4JLGA 1WGSA 4B6MA 2KRNA 1D0YA 4M75D 3EG0A 2DL5A 2YRDA 2OI3A 3E19A 1PD0A 1KFZA 2EBPA 4M7DE 2KT8A 1D09B 1RAHB 1TG0A 3S6WA 3OS5A 4XK8E 5LJ5f 3O5ZA 4AG1C 1JJ2S 2FPFA 3HTRA 4XU0A 3QJ6A 1QVGP 4RCCA 3EGUA 3OYFA 3CMET 1SHFA 3A8HB 2AIRB 2EIFA 4D8DA 3RERA 2DO3A 2L3QA 3V7CA 3G6EA 3GPLA 4HCBA 4LNPA 4QW2A 2PUOB 2DBMA 5D7UA 2DKGA 2E12A 4OMOA 4C92E 2VB6A 1ZUKA 2LCSA 3HSBA 5GJVB 3OYAA 3HRUA 4XAXB 4ZGJB 3KBGA 2HL3A 5LJ5d 1KQSS 2EYQA 5LL6S 3EG3A 2M9UA 3O8VA 3JCMW 4V2SA 1K9MC 2ENMA 3ZEHA 1LOJA 4JJNK 1MHNA 3S3OA 1NEBA 2FVUA 4L6V5 1SSFA 2KRSA 3I5SA 2OTJA 2QGGA 3N5BB 3EH1A 4Q5WA 4OGCA 4FYYB 5KYWB 2FPEA 2PUKB 2X35A 1VA7A 3SEMA 3CCEA 2COYA 1QCFA 1GL5A 1AEYA 4ZN3A 3REAB 5FROA 4PNOA 2J6FA 4GLMA 1WFWA 3JB9D 3JSCA 1VQ5A 1OQKA 1I1JA 4J9CA 2LX9A 3L2QA 2QQAA 2LMJA 1QVFS 3HKSA 1WXTA 4F04B 1M2VA 3V7SA 2OTLA 1I4K1 1RAAB 4NL2A 4QQ6A 2D1XA 1E6GA 1WXUA 1FXXA 3DB4A 1R8OB 1V29B 1GCPA 2D8JA 1K0SA 2YLCA 4IUQA 7AT1B 4HA8A 2RH2A 2DRMA 3EFOA 4J6WA 5KCOA 3M9QA 3KXTA 1YCYA 1H641 4AG2C 2DPPB 1HJDA 1VQPT 4RCBA 2HZYA 1UUEA 4DOVA 2VVKA 3JCMX 3UA6A 5M9OA 2VGMA 3CMEQ 1Q81U 1VOMA 1EX4A 3DB3A 1KD1U 2LQKA 2EKHA 5GAN2 3CCET 1PRMC 4B9XA 2PVDB 1MMAA 2DL7A 5GAN4 4M7AE 2X4XA 1QLYA 3UWNA 5GAN3 1KD1R 2M02A 2ECZA 1UGSB 4WCIA 1U06A 3QWXX 2CP3A 4JRIA 1SRLA 4NOYA 1BYMA 2C0IA 3CC7A 1Z9ZA 2V1QA 3M57A 5I22A 5LJ3d 3NTHA 1GBRA 2VYTA 1NJIR 3CMAT 3MP1A 3CCJA 4EMKC 3A8OB 3LW5E 1BIBA 4EDUA 2RD1A 5FLXE 4D6WA 1MNEA 5A0LA 4E7IA 3I56A 1BCMA 4HVWA 3X24B 3CBOA 3GOXA 4C92C 1YJ9A 3QBYA 1G3SA 1WZOA 2BZYA 1K8AU 3C95A 2DD4A 1XOVA 5EG2A 5LJ5h 3VRZA 1ZSZC 2RQRA 4OMLA 2MK5A 1M8VA 2CUDA 3PVLA 1ZUUA 2MCNA 4ZTJA 1UE9A 1WJQA 3CXCA 3I55Q 3IQLA 1SF9A 4IIOA 4C0ZA 5FWCA 3EGDA 3JCMV 4J9EA 4CI0C 2XI9A 3QHSA 2AZVA 1G83A 1FMVA 4MMKA 4OVAA 1BU1A 3THKA 1Y7XA 4E2FB 3A8GB 1VQ8Q 4X1VA 3RDVA 1JXMA 3X28B 2QEXA 1KQ2A 3CCJT 2QQSA 2CSIA 3M0TA 4EMKB 1H3ZA 1N8RC 1VUBA 3PMTA 1N6AA 4M77C 3QZ9B 2EQJA 4GBQA 4LDVA 4OMNA 3VJPA 4KH1B 5CAIA 3OYIA 2KNBB 2CP0A 2G6FX 2JN0A 2YUNA 1E7OA 1QWFA 1NYGA 1NZ9A 4BY6B 1IZ6A 1VYVA 4C5EA 4X9DA 1Y71A 2RB6A 2J05A 4RTWA 1FX7A 3I5RA 2RJDA 1GFCA 5IXFA 1I5OB 3TCJA 1W2BA 4OMFB 3GNGA 3QDFA 2KI7A 1C1AA 1ZBXA 3G4SA 4KUDK 1IHVA 1MV0B 2LTOA 1YHQT 2ROTA 2HKNA 3PFSA 5KE3A 2J06A 3CCJQ 1OU8A 5FRMA 4HVVA 3V7RA 1VQ5Q 4QVCA 1VQOA 4M7AC 3QSUA 4JPBW 3QIIA 4PJLA 2WSCE 2K5IA 2DZCA 1IO6A 3VS7A 3KFVA 4OMMA 5GANd 3OS1A 1ZA1B 2F2VA 3M55A 3CPWP 1MUZA 3AHUA 1QVGA 3L2ZA 2RHZA 3NMZC 2PZ1A 4BDZA 2A7YA 2DX1A 1ZUYA 2YDLA 2XDDA 1I07A 2QA4A 4JJBA 5DLOA 1AOJA 3ZL7C 4FCYA 5GAMf 5CKHA 1D0ZA 1XNIA 4DEYA 5D6WA 4R0KA 2CREA 2CSQA 2LT1A 4M77D 4M7AF 1K73U 3OA6A 1LPLA 4Y92A 1YHQA 2RN8A 2QYZA 3EFOB 3RMSA 1HXDA 4ZNXA 3OBWA 2LC4A 2OTJT 3MP6A 3FB9A 1VQOT 1WYXA 3M54A 4M77A 3VS2A 4PKCC 2HDAA 1M3AA 1MGQA 4TVRA 2CZ7B 4PJOB 3M56A 3VV0A 4JS4A 1K0XA 3RMQA 1TXQA 4RMOA 1XTDA 1SKUB 2O31A 4KGVB 4LD6A 1YI2Q 2EJ9A 3RKWA 3EAEA 4FSXA 5IH2A 3UPUA 2GGRA 4C92D 4E7HA 3QKJA 3LYIA 2P4RA 4PJOG 4N4IA 2I2LA 4Z02A 2AT1B 3GIBA 4K11A 1M9SA 4J9DA 4OMPA 5J39A 1QMCA 2ESWA 4JDSA 4A4GA 4N0AA 1RACB 4HVUA 1KD1C 3JB9H 2EWNA 3VS0A 3JCMh 4N0AC 2LT4A 2XDBA 2FB7A 9ATCB 1K76A 5C6SA 3PE0A 1VQNT 2KT1A 1M1GA 4QKUA 1OX8A 2DVJA 4QVDA 4O6JA 4ELYC 4M75B 4PJOF 2KVQG 1NM7A 2ZAEA 4F7UB 3QZ5B 2FZKB 2M51A 2XIDA 3L2WA 1ZSGA 4C0DB 3OBYA 4LDUA 1VQPA 2GQIA 3L1AA 1PD1A 5I2MA 1OYXA 4M7DB 3VU3C 2M0OA 1YHQQ 3CCMT 2XG8D 3A5ZB 1T0JA 2CP7A 3MJXA 4F16A 4EMKA 1YJ9Q 1NLOC 4ME7A 2K57A 1WQWA 2I0NA 1Z9QA 3AT1B 3H8ZA 1YJNA 3V8KA 2A37A 4M7DA 4ORZA 4XU1A 1ZLMA 3CBPA 3TU4K 4OF1A 2PVOB 2DYBA 1X69A 1WDXA 1PSFA 1VQMA 5KYXA 3I56T 2DILA 1TUCA 5GAMg 1GCQC 4JUVA 2KEAA 1K9MR 2DZ9A 1C6VX 2QTXA 4YTLA 1TTHB 3A98A 3L2VA 3CCLQ 3P8DA 3VRYA 3Q1JA 2E1HA 2DEUA 4C0FA 1Q86U 3EG9B 2EGEA 4F7UA 2AZSA 2JOYA 3NFCA 3MEVA 3TEEA 5FU7C 1UJYA 2LQ8A 2M1HA 2RJEA 8ATCB 1UHCA 2JJ9A 4M7AA 3NHNA 5GAOn 4XQ3A 2HNIA 1YIJT 2MWPA 3RNJA 4C8QE 2E70A 2R5AA 1IGUA 1LJOA 3MO8A 4J9GA 2X3WD 4PJOA 5CKEA 1B3QA 1H92A 5J3BA 2DBKA 4NL3A 3RBBB 1BK2A 4WF2A 3X25B 4LD9K 2CH4W 4FYXB 1LNXA 1TWBA 3X20B 1QW1A 3WXMB 3FJ5A 3ER0A 3BDLA 2FG0A 2DXUA 3JCMf 2X9HA 4IURA 1X75C 4HKEA 5GMKi 3CPFA 2HSEB 1Q95G 2YUPA 3TVTA 2RQWA 4M77B 5KE2A 3MPUB 2EW3A 1YCSB 5CK9A 5LJ3e 4L59A 2JTEA 2XD0A 2VKNA 3OYGA 1PKSA 1JEGA 4M7AB 4LUDA 1VQ4Q 2XU8A 2KROA 1VQ8T 3SDZA 5GANh 4XTYA 2WSFE 1X6OA 4OB1B 3META 3UATA 4J9HA 3JCMQ 3CCVQ 2YRVA 1PG5B 1UGVA 2NYSA 1NBEB 3OYMA 1MMGA 5KYNA 3S3NA 1S72T 5GMKj 1GXIE 2NUTB 1U8RA 1LVKA 3OYBA 2QQRA 1TU0B 1AHJB 3CMAA 1Q7YU 4RTXA 3MHXA 1Q81R 1ABQA 3CC2Q 2GTJA 2LNVA 2QQBA 4FL6A 5AYFA 1V76A 2MI6A 3CEYA 3C4SA 2BTTA 5CKBA 3OYDA 1YJWQ 2DL4A 3PTAA 3VS4A 4X9CA 2E6ZA 3RR6A 3PVQA 2DIQA 2LRQA 1G3YA 1VQKQ 3M4GA 1KC8U 1YJ9T 1YI2T 2QA4Q 4Y91A 3DKMA 2FYKA 4LDWA 2RI2A 4E7SA 3QUIA 1M90R 1WHJA 3JCMd 1TUGB 2E6NA 4PFOA 3FC3A 4BACA 1KQSA 3MEWA 2K3YA 1G3WA 2VC8A 4JRQA 5GJWB 2DD5A 5LJ3j 1K4US 2NWMA 1OPLA 4KGZB 2XHCA 4JZ4A 3SB2A 3CD6T 2Y4YA 1PWTA 2KAFA 2GFUA 2ZPHB 4D8KA 1FWZA 2GF7A 4EMGA 5LJ3g 1M1KC 2ZZDA 1EFNA 4DOWA 3FRNA 1JBMA 4M75F 1N27A 5IHNA 3JAME 3V8JA 1YJWA 2MWOA 4M78B 3G71T 1KHCA 3EG2A 4FW1A 4C8QA 5GMKl 2CZ0B 1QP3A 2YUQA 1Q7YC 1RL2A 3C12A 2DL8A 4JJDA 4LUEA 3VS3A 2QDLA 1FMWA 1UJ0A 4JRKA 2F1LA 4GY5A 3JRZA 2EYZA 4DBQA 1RAGB 3M0PA 2OTLQ 1I8FA 2A3LA 5IXBA 3H41A 3EGXB 2NUZA 1VQPQ 1B34A 2GBQA 3UF4A 1WHLA 1RI9A 1YFNA 4F17A 1JJ2A 4C0DC 1RLPC 5HY6A 3PNWC 1RLQC 3CXCS 1ABOA 1HD3A 4BI3A 4XTVA 1OX9A 4PJNA 2HQEA 4LXCA 2KXDA 3CC4A 1OU9A 4UC4A 1BI1A 2DM1A 2ZCFB 3I55A 3EH2A 2JVVA 2DA9A 1QVFP 3M4YA 2AKLA 2K6DA 4QQDA 1YI2A 4FT2A 2K3BA 3CCSA 3CD6Q 1X27A 1PKTA 4JLIA 2RMOA 3OS2A 1ZSZA 2JMCA 4ZN1A 2HBWA 1M1KU 3PT9A 2YUOA 3EFRA 1M3BA 1E6HA 4N4HA 2EQMA 3SFMA 3EFSA 1W70A 2BE7D 1OV3A 2EYWA 2JMAA 4RKUE 3MEAA 5FU7B 1JU5C 3EG1A 3BFMA 5LJ3h 1QKXA 2RJFA 2Z0WA 3HPWA 4AT1B 5KYYA 3VKIA 3RESA 1NEGA 2VASA 4J6XA 1AWOA 5L8RE 5CQYA 4KULA 4Z8AA 1VQLT 2YXYA 1W2BS 2QGFB 4HXJA 2RQVA 4M75C 2K2VA 5GAOp 1F1BB 2AK5A 3VUZA 4OMQA 3M0QA 1QQJA 2R5MA 2V26A 4PJMA 2K4YA 4PJOE 1X01A 4IIMA 5FU6C 1UB4A 1WIEA 2BE9B 1G2BA 4R56A 5DM7R 5KCHA 2DJQA 4C5GA 2F5KA 2O88A 4JS5A 1G8XA 1M2VB 3E2UA
chains in the Genus database with same CATH topology
3NTIA 4XU2A 3VV0A 4JS4A 2LDMA 3A8LB 2Y90A 3RMQA 1PSEA 5IN1A 4XU3A 4RMOA 4PJOB 1B34B 1XTDA 4LD6A 3CCMA 2EJ9A 5FU6B 2Y4XA 3RKXA 3CMEA 3CCVT 1VQ9A 4M78F 4KT0E 3EAEA 3RKWA 3G71A 4FSXA 3S3MA 2VGNA 4M77G 5GAN7 5DY9A 4VUBA 1O9SA 3LGLA 3UPUA 4C92D 1K9MU 2LCLA 2YLBA 4E7HA 3QKJA 1VQLA 2JZ2A 3LYIA 4OGEA 4PJOG 1UGRB 4N4IA 2I2LA 5IAYA 3JB9F 2HD0A 1UGQB 4Z02A 3OYJA 5LJ5j 3GIBA 1M9SA 5J39A 1KHIA 3FJPA 2FL7A 3ME9A 1Q82U 4JDSA 4J5YA 4A4GA 2CYZB 4E7JA 1G3TA 4N0AA 1M5Q1 2CGHA 2JUFA 4J83A 5CQXA 2DIGA 3VYHB 3HFNA 2WSEE 3WVEB 2EWNA 4DQ2A 2V8JA 5GAMj 3JCMh 3OYCA 3JB9H 2DTHA 4N0AC 5GAMd 2LT4A 3PMIA 2RJCA 3CCUA 4JLGA 3OQ5A 2RA2A 2XDBA 4XTXA 1WGSA 5CO7A 1S72A 2FB7A 4M75D 2RO0A 3URGA 5C6SA 3E1SA 1VQNT 1M1GA 3CD6A 3E19A 4QVDA 5GMKm 1U1TA 4O6JA 3QJYA 3SWNC 4ELYC 4M75B 4PJOF 3LWIA 3GP8A 2P4TA 2KVQG 4F7UB 4M7DE 3T9NA 1O75A 2BIVA 3RIRA 2RM4A 3QZ5B 3GNFB 3S6WA 3OS5A 3LH0A 4C92G 2XIDA 3L2WA 4XK8E 4C0DB 3OW2A 3SWNB 1VQMT 4ZGEB 3CCRT 4PJOD 1WJRA 5LJ5f 3NTKA 3OBYA 4LDUA 1VQPA 1JJ2S 3L1AA 5I2MA 5KH6A 4B9WA 4XU0A 1OYXA 3UT1A 3QJ6A 3VU3C 2EFIA 4HCCA 4M7DB 4RCCA 2M0OA 3HHTB 4EPCA 2XG8D 3CCMT 3A5ZB 3OYFA 5C0MA 3JB9I 3CMET 1VQ9T 4EMKA 2FHDA 3A8HB 4ME7A 2PVGB 2K57A 2EIFA 3GF5A 4MZMA 4BE2A 1WQWA 5GAN6 3RERA 2DO3A 2EJFA 1WNLA 2P0QA 2ZPGB 2O4XB 3V7CA 5GMKe 3G6EA 2GFAA 5A2QE 3GPLA 4HCBA 4QW2A 3H8ZA 2PUOB 1YJNA 1BIAA 2RHUA 3V8KA 1QVFA 1IREB 2DKGA 1VQ7T 2E12A 2HAXA 4M7DA 2EJGA 4TVRA 4M7DC 3M5AA 3QO3A 4C92E 2RI5A 1ZHIA 3M58A 3G4ST 3QYHB 3HSBA 4XU1A 3OYAA 3CBPA 3HRUA 3ZBDA 4OF1A 1M4ZA 4XAXB 4ZGJB 3KBGA 3TU4K 2PVOB 5LJ5d 1KQSS 1PSFA 2EKOA 2EYQA 5LL6S 1VQMA 3CCRA 3I56T 2M9UA 5FRNA 4EMHA 3JB9G 2BKDN 2CZ1B 4E47A 3O8VA 4A4KA 3MP8A 5GAMg 3JCMW 4X34A 2L5QA 4V2SA 1M90C 3OSVA 3JCMc 4JUVA 3L2UA 2EQUA 2QXFA 1K9MC 1QP2A 2DZ9A 4OB3B 3F70A 4E7LA 3ZEHA 2QTXA 4ZGDB 1LOJA 4M78A 4YTLA 3L2VA 1NJIU 4LDXA 3UDCA 3P8DA 4JJNK 1MHNA 3S3OA 1NPRA 3RUXA 1QVGS 4R55A 4M7DF 2FVUA 3Q1JA 4IKFA 4L6V5 2E1HA 1SSFA 4RG8A 4C0FA 1Q86U 2OTJA 4F7UA 1YITT 3N5BB 3SWNA 2K5LA 3JCMP 4Q5WA 4OGCA 2JOYA 4KUIA 3NFCA 1OZ3A 2PUKB 4HT9A 2X35A 3CC2T 3MEVA 2QI2A 1YJWT 1KG1A 3TEEA 1TH7A 3FDRA 2LQ8A 1Y96B 2M1HA 2RJEA 5FU7C 4O5VA 5LJ5e 3CCQA 3M53A 3LWHA 3OW2S 3JCMg 3CCEA 2IVWA 4BY6C 3J81E 5D6XA 1U1SA 3CPWS 2F69A 2KDSA 4IUPA 3OS0A 3GLXA 2XICA 4M7AA 3E9FA 3OYYA 4KBMB 4ZN3A 5GAOn 3CPWA 2M16A 5FROA 4PNOA 4XQ3A 3JB9D 3OY9A 4C92B 2HNIA 3JSCA 1VQ5A 1D3BA 3HP9A 1YITA 1YIJT 2MWPA 1KD1C 2LX9A 4C8QE 2E70A 2R5AA 3L2QA 4F7UG 3OYLA 2QQAA 1LJOA 4N4GA 3MO8A 4IUUA 1YJ9A 2R57A 1QVFS 3HKSA 2GCXA 3V7SA 4PJOA 2OTLA 5CKEA 1I4K1 2K3XA 3ASKA 3HRSA 4NL2A 4QQ6A 4PJOC 1FXXA 3DB4A 4MMLA 4A4EA 1R8OB 1V29B 2JTFA 5J3BA 1VQKA 2YLCA 1N8RU 4IUQA 4NL3A 2RHYA 1UGPB 2HBPA 4HA8A 5LJ5g 2RH2A 4C92A 3M59A 4WF2A 3X25B 4LD9K 2O01E 4J6WA 5KCOA 2C06A 1LNXA 2VUBA 3X20B 4BUGA 1QW1A 1VIFA 3WXMB 5GANj 2VXEA 3ER0A 3M9QA 3KXTA 1YCYA 1H641 4M75E 3BDLA 3LLRA 2DXUA 2DPPB 3JCMf 4IURA 1VQPT 1X75C 4RCBA 2QQ9A 5CKDA 4PL6A 2BUDA 4HKEA 4LDYA 4XTUA 4DOVA 5GMKi 3CPFA 3JCMX 2ZPIB 5M9OA 2VGMA 2XDPA 2PQWA 4GLKA 4M77B 4PLIA 4CRIA 1Q81U 3OB9A 5KE2A 1WQ7A 2KMTA 1VQNA 3DB3A 5CK9A 5LJ3e 1KD1U 4L59A 2LQKA 5GAN2 1I5LA 2O4XA 3J80E 1BI0A 3G7ZA 5A0DA 3CCET 2QA4T 2XD0A 4B9XA 4A54A 2PVDB 3KUFA 5GAN4 4HT8A 4M7AE 3OYGA 1VIEA 4MDXA 2X4XA 4BDYA 4ZTFA 2QEXT 4M7AB 5GAMh 2GQVA 3CC7T 4BI4A 3UWNA 2MMPA 2XU8A 1VQ8T 3SDZA 5GANh 4XTYA 2WSFE 1JB0E 5GAN3 1X6OA 1D3BB 1N9SA 5GAOm 4OB1B 3META 4A4FA 4ATOA 2DTOA 4II1A 2CKKA 3MCAB 4MDWA 3JCMQ 3JCMb 3CCQT 2YRVA 1UGSB 3J7AF 3X26B 1VQ4A 4XTWA 2RI3A 3TREA 3PIOA 2EAYA 3CBMA 5CIUA 4JRIA 3OYMA 2V8KA 5I2SA 1VQ4T 2HQXA 2QDYB 4NOYA 3S3NA 1BYMA 4C8QC 4J8OA 5GMKj 1S72T 3E9GA 4E7KA 1K73C 1KQ1A 3CC7A 1GXIE 3CCVA 1U8RA 3M57A 2EQKA 3OYBA 2QQRA 5LJ3d 1AHJB 2E65A 3CMAA 3CCST 1Q7YU 2ZPEB 3MHXA 4FT4A 3NTHA 1Q81C 1NJIC 1QVPA 2VYTA 4FM4B 3WVDB 2LNVA 2QQBA 4FL6A 1VQ7A 2E41A 5AYFA 3CMAT 3MP1A 3JCMJ 3CCJA 4EMKC 2L89A 3A8OB 1BKBA 3LW5E 1BIBA 4EDUA 2RD1A 2X4WA 1YJNT 3FIFA 2MI6A 3CEYA 3C4SA 4C8QB 5FLXE 4D6WA 5A0LA 4M77E 5CKBA 3OYDA 4E7IA 1NPPA 3I55T 4PLLA 3PTAA 1Q86C 3I56A 1W4SA 4C8QG 4X9CA 4QQGA 5CVIA 2L8DA 2E6ZA 3X24B 3CBOA 2AHJB 4BD3A 3RKYA 5HKCA 3GOXA 4DA4A 4C92C 2G3RA 2DXTA 1YBYA 1G3SA 2DEQA 2DIQA 3QBYA 2LRQA 1Y07A 2DVEA 3VUBA 1G3YA 3SD4A 3QG1A 2D9TA 1K8AU 3M4GA 2X4JA 3C95A 1KC8U 2DD4A 1YI2T 1YJ9T 1XOVA 5EG2A 4Y91A 4F7UF 5LJ5h 3BY7A 4FIBA 3DKMA 3R6OA 2FYKA 3BW1A 4LDWA 2RI2A 1M8VA 2E10A 3QUIA 2RK2A 3BDUA 5CCAA 3JCMd 2R58A 4ZTJA 3FC3A 2E6NA 4BACA 1KQSA 4C0GA 4C8QF 3MEWA 2K3YA 1G3WA 2MAMA 2VC8A 4JRQA 3CC2A 1WJQA 3CXCA 2P0PA 2DD5A 3CC4T 4C0ZA 5LJ3j 1RI0A 2H3JA 1XQHA 2XHCA 3JCMV 5GMKh 2KSSA 3SB2A 3C94A 3OYEA 3CCLT 4BB7A 1WJSA 2XI9A 4CI0C 1Y96A 2Y4YA 3QHSA 2DXCA 4QVZA 3CD6T 4MZTA 1OI1A 4C8QD 2KAFA 3QDRB 4BE1A 1G5VA 2GFUA 2ZPHB 3HL8A 1FWZA 4MMKA 4OVAA 2GF7A 4EMGA 2ZPBB 4JRPA 2XKOC 5LJ3g 4M78D 4OB0B 1M1KC 2X4YA 2ZZDA 1ZQ1A 4OP0A 4DOWA 3FRNA 2MF2A 3QXEB 2ZGWA 3OMCA 1JBMA 2DXBA 1N27A 4M75F 5GAOl 3JAME 1Y7XA 3V8JA 1YJWA 2MWOA 4M78B 3A8GB 2CS7A 3G71T 1KHCA 3JCMe 5GANg 4C8QA 5GMKl 1DJ7B 2CZ0B 3X28B 1QP3A 2QEXA 1WPYA 1KQ2A 4IUVA 4C5HA 2QQSA 3PIPA 2NLUA 3CCJT 1Q7YC 1VQ6T 1VQ8A 2YHTA 1RL2A 3C12A 4EMKB 1H3ZA 5GAOq 1N8RC 2K5FA 4ELZC 2OAUA 3LX7A 1VUBA 1P92A 3DLLA 1EIFA 1Q82C 3PMTA 4J6YA 1N6AA 4M77C 3QZ9B 2EQJA 4LDVA 5CAIA 3VJPA 3OYIA 3G6ET 2JN0A 4JRKA 2P0KA 5D6YA 3VYGA 4GY5A 2VV5A 3JRZA 2LCCA 1I8FA 1NZ9A 2A3LA 3FEOA 2V8IA 1IZ6A 4BY6B 4C5EA 4C92F 4X9DA 1B34A 1Y71A 4M75A 2RB6A 1JJ2A 4M78G 4Y28E 3H6ZA 2B8AA 4C0DC 1FX7A 5HY6A 3PNWC 2RJDA 3CXCS 2D0QB 3HRTA 4BI3A 3TCJA 2KK4A 4NS5A 4XTVA 1VQ5T 5DLQE 1BI2A 3GNGA 4OMFB 1W2BA 2JTMA 1UEBA 4A4HA 2HQEA 2PU9B 1ZBXA 3G4SA 4KUDK 3QYGB 4J7FA 3CC4A 2LTOA 4UC4A 1YHQT 1BI1A 3PGGA 3ZFJA 3PFSA 2DAQA 2L3RA 5KE3A 4L5GA 4MZPA 2ZCFB 1JRIA 4HCZA 5FRMA 3I55A 2JVVA 3V7RA 3OMGA 4QVCA 1VQOA 1M90U 3M4YA 4M7AC 3QSUA 4QQDA 3QIIA 2WSCE 1YI2A 2K5IA 4FT2A 2OTLT 4BI8B 5GAN5 2D6FA 2DZCA 1I81A 3CCSA 3CCUT 3V8LA 1VQ6A 2RHXA 1YIJA 5GANd 4JLIA 3P8HA 3OS1A 3OS2A 2KY9A 3M55A 4ZN1A 1KC8C 1M1KU 1OZ2A 3AHUA 2ZPFB 4F7UE 3HFOA 3PT9A 1QVGA 3OYKA 4IUTA 3L2ZA 2RHZA 3EFRA 1HK9A 4N4HA 2XK0A 2EQMA 5I21A 2KQWA 4A53A 2E5QA 1M1FA 3QPHA 4BDZA 3LGFA 3SFMA 2LVMA 3EFSA 2A7YA 5J26A 3CCLA 2JNGA 4FU6A 4RKUE 2IG0A 4M7DG 3MEAA 4C5IA 2DJZA 1BI3A 2XDDA 5FU7B 3BFMA 5LJ3h 2QA4A 3A8MB 2RHIA 5DLOA 1N9RA 4M77F 2RJFA 4M7AD 3FLGA 3DLMA 3HPWA 5CR2A 5GAMf 3L42A 5CKHA 4P5NA 3VKIA 5GANf 3RESA 2E64A 4J6XA 5L8RE 5CQYA 4KULA 4XTZA 1XNIA 5D6WA 4M78E 5HK0A 1VQLT 4BE0A 1W2BS 2RK1A 4OB2B 2LT1A 4M77D 4M7AF 1NE8A 2DK3A 4J7IA 3OA6A 1K73U 2WACA 4M78C 4M75C 5A0GA 2DTIA 1YHQA 3RMSA 1HXDA 1K8AC 2K2VA 5GAOp 3VUZA 3OBWA 2LC4A 2VXFA 2OTJT 3MP6A 3FB9A 3OYHA 1VQOT 2R5MA 2K4YA 5GAOr 4PJOE 1X01A 2CZ6B 3OSSC 5LJ3f 3M54A 5FU6C 1UB4A 4M77A 5CKFA 5HK3A 2F5TX 5DM7R 5KCHA 3MEUA 4R56A 3OYNA 4C5GA 2F5KA 4M7DD 3INZA 5IT9E 3P8BB 4PKCC 5GANe 4RG2A 3L2RA 5GAN8 4JS5A 4M7AG 1MGQA 2CZ7B 5GAMe 3M56A 3JB9J 4M75G 1VQKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3N A;  3F70 A;  3NTI A;  4C5E A;  4E7L A;  3ZEH A;  2LDM A;  3E9G A;  4E7K A;  3L2V A;  5IN1 A;  3P8D A;  1MHN A;  3S3O A;  2EQK A;  3OYB A;  2QQR A;  4LD6 A;  3H6Z A;  2B8A A;  3PNW C;  3Q1J A;  3NTH A;  4IKF A;  2RJD A;  2VYT A;  1SSF A;  3EAE A;  4FL6 A;  3S3M A;  4NS5 A;  3MP1 A;  2L89 A;  3LGL A;  4Q5W A;  4A4H A;  2HQE A;  4E7H A;  3QKJ A;  2JZ2 A;  1OZ3 A;  3LYI A;  4EDU A;  2X35 A;  3MEV A;  4N4I A;  2X4W A;  3FDR A;  2RJE A;  2M1H A;  5IAY A;  4Z02 A;  3CEY A;  2LTO A;  3C4S A;  4UC4 A;  3OYJ A;  4E7I A;  3OYD A;  5J39 A;  4PLL A;  5D6X A;  3PFS A;  2DAQ A;  2L3R A;  3ME9 A;  5KE3 A;  4A4G A;  4E7J A;  4IUP A;  4QQG A;  4HCZ A;  3OS0 A;  2L8D A;  5FRM A;  3E9F A;  3OMG A;  2M16 A;  5FRO A;  2DIG A;  4BD3 A;  3OY9 A;  3GOX A;  2G3R A;  3OYC A;  4QQD A;  2DIQ A;  3QBY A;  3QII A;  3PMI A;  2LRQ A;  2MWP A;  2RJC A;  3SD4 A;  3OQ5 A;  2D9T A;  2R5A A;  3L2Q A;  3OYL A;  1WGS A;  4N4G A;  3MO8 A;  4IUU A;  2R57 A;  2RHX A;  2RO0 A;  5C6S A;  3P8H A;  3OS1 A;  3OS2 A;  2K3X A;  3ASK A;  4QQ6 A;  2RI2 A;  3DB4 A;  4A4E A;  2JTF A;  1OZ2 A;  2R58 A;  4IUQ A;  3OYK A;  2RHY A;  4IUT A;  4ZTJ A;  2RHZ A;  3FC3 A;  2E6N A;  2BIV A;  4BAC A;  3MEW A;  2K3Y A;  2XK0 A;  2EQM A;  4N4H A;  2E5Q A;  4BDZ A;  1WJQ A;  3S6W A;  3LGF A;  5KCO A;  3LH0 A;  3L2W A;  2LVM A;  5J26 A;  1WJR A;  3M9Q A;  1RI0 A;  3NTK A;  4FU6 A;  2IG0 A;  3MEA A;  4C5I A;  5KH6 A;  3OYE A;  1WJS A;  3BDL A;  3LLR A;  4QVZ A;  4B9W A;  1OYX A;  2RHI A;  3QJ6 A;  4IUR A;  2EFI A;  2RJF A;  3UT1 A;  3FLG A;  1OI1 A;  2M0O A;  3DLM A;  4PL6 A;  2BUD A;  3L42 A;  4BE1 A;  3OYF A;  1G5V A;  5C0M A;  2GFU A;  2FHD A;  5M9O A;  4OVA A;  2GF7 A;  4BE2 A;  2XDP A;  1XNI A;  2PQW A;  2X4Y A;  4PLI A;  5D6W A;  4CRI A;  3OB9 A;  5KE2 A;  2O4X B;  2GFA A;  4BE0 A;  3OMC A;  3DB3 A;  1N27 A;  4QW2 A;  3H8Z A;  2RHU A;  2MWO A;  4L59 A;  3OA6 A;  2WAC A;  2O4X A;  1KHC A;  4B9X A;  4IUV A;  3KUF A;  4C5H A;  2QQS A;  2NLU A;  2RI5 A;  3OYG A;  2X4X A;  4BDY A;  4ZTF A;  3MP6 A;  3OYA A;  1H3Z A;  3OYH A;  2R5M A;  3UWN A;  3LX7 A;  2EKO A;  3PMT A;  3MET A;  4A4F A;  2EQJ A;  5FRN A;  4II1 A;  2CKK A;  3OYI A;  2BKD N;  3OYN A;  5KCH A;  3MEU A;  3O8V A;  3MP8 A;  4C5G A;  2F5K A;  2YRV A;  2P0K A;  4X34 A;  5D6Y A;  2RI3 A;  3L2U A;  4GY5 A;  2EQU A;  4RG2 A;  3L2R A;  2LCC A;  5CIU A;  3OYM A;  2HQX A;  3FEO A; 
#chains in the Genus database with same CATH topology
 4XU2 A;  2JXB A;  1M3C A;  2LDM A;  3A8L B;  1PSE A;  2E4H A;  4XU3 A;  1VQM Q;  3RKX A;  3CME A;  1JJ2 P;  4M78 F;  4KT0 E;  4M77 G;  5GAN 7;  1GFD A;  4VUB A;  3LGL A;  1BB9 A;  2LCL A;  1VQL A;  2JZ2 A;  2K2M A;  2HD0 A;  3JB9 F;  3FJP A;  3ME9 A;  4J5Y A;  1TOV A;  2CYZ B;  5EC7 A;  2H8H A;  2DIG A;  5GAM j;  2P84 A;  3HFN A;  1CKB A;  3LH5 A;  3CCU A;  4KGX B;  4XTX A;  4M4Z A;  2ED1 A;  1SG5 A;  2LJ3 A;  2RO0 A;  3URG A;  5GMK m;  2DER A;  2A28 A;  3QJY A;  3SWN C;  3GP8 A;  2P4T A;  3T9N A;  3G71 Q;  1O75 A;  3RIR A;  4Z88 A;  1YN8 A;  3LH0 A;  4C92 G;  2FO0 A;  4ZGE B;  1VQM T;  3CCR T;  2DFU A;  1WJR A;  4PJO D;  3NTK A;  3VS6 A;  3CCE Q;  5KH6 A;  1W6X A;  4B9W A;  3UT1 A;  4FYV B;  5C0M A;  3JB9 I;  2QAS A;  2PVG B;  1UHF A;  4MZM A;  1TS9 A;  4RUG A;  2P0Q A;  1WNL A;  4PFZ A;  2RHU A;  2HAX A;  1X2Q A;  2EJG A;  4M7D C;  2KE9 A;  3M5A A;  2ABL A;  3QO3 A;  1ZHI A;  3M58 A;  1GBQ A;  3ZBD A;  1ARK A;  2V1R A;  4ANJ A;  2FZG B;  2JS0 A;  5FRN A;  2BKD N;  4E47 A;  1KC8 R;  4A4K A;  3MP8 A;  2IPO B;  3OSV A;  3JCM c;  1M90 C;  2L0A A;  2E3I A;  2GNC A;  1QP2 A;  4OB3 B;  4FSS A;  3C0C A;  4ZGD B;  4M78 A;  1NJI U;  1NPR A;  3RUX A;  1QVG S;  2NUT A;  1X6G A;  4PJJ A;  4IKF A;  1M1K R;  3JCM P;  1OZ3 A;  4HT9 A;  3CC2 T;  1YWO A;  2QI2 A;  1YJW T;  1N8R U;  4AMC A;  1Y96 B;  1ZSZ B;  3OW2 S;  4BY6 C;  2JT4 A;  5D6X A;  1U1S A;  3CPW S;  2YSQ A;  3G6E Q;  4IUP A;  2XIC A;  2D0N A;  3E9F A;  4KBM B;  3CPW A;  1ZBJ A;  2LNH B;  2M16 A;  1RAB B;  1AZE A;  4RTU A;  4C92 B;  1WHG A;  1D3B A;  1YIT A;  1M27 C;  4F7U G;  3OYL A;  2R57 A;  1M2O A;  4PJO C;  3HRS A;  2COW A;  2JM8 A;  2K79 A;  1VQL Q;  1M30 A;  2DET A;  2PNI A;  1IRX A;  2RHY A;  5LJ5 g;  2KRM A;  2JM9 A;  2VUB A;  1VIF A;  5GAN j;  1C0M A;  3CC7 Q;  2DYI A;  3LLR A;  6AT1 B;  4PL6 A;  2FRW A;  3OW2 P;  1VQO Q;  2PQW A;  4GLK A;  4CRI A;  1RAF B;  2EYX A;  4DBH A;  1WQ7 A;  1VQN A;  1TSF A;  1WXB A;  3J80 E;  1BI0 A;  3ULR B;  2C0T A;  5ECA A;  4A54 A;  4HT8 A;  4BDY A;  4ZTF A;  2QEX T;  2GQV A;  4BI4 A;  5IHI A;  5GAO m;  1D3B B;  1N9S A;  2OAW A;  4A4F A;  2MIO A;  4II1 A;  2CKK A;  3MCA B;  5L23 A;  4XTW A;  2RI3 A;  4WTO B;  3TRE A;  2KR3 A;  3PIO A;  2EAY A;  1J3T A;  5CIU A;  5I2S A;  1VQ4 T;  2QDY B;  2RPN A;  4J8O A;  4E7K A;  3CCV A;  3H9N A;  2EQK A;  2RNA A;  2E65 A;  3CCS T;  1Q81 C;  1QVP A;  4FM4 B;  3WVD B;  1X43 A;  1VQ7 A;  1WHH A;  3JCM J;  2X51 A;  2L89 A;  1BKB A;  1W2B P;  4M77 E;  1NPP A;  3I55 T;  1Q86 C;  1IB8 A;  3CCS Q;  2DL3 A;  1W4S A;  4C8Q G;  4QQG A;  1PCX A;  2OTJ Q;  4BD3 A;  5HKC A;  4DA4 A;  2G3R A;  1YBY A;  1Y07 A;  2DVE A;  2D9T A;  1RAI B;  1IHW A;  4F7U F;  3BY7 A;  3R6O A;  2QG9 B;  3BW1 A;  5CCA A;  1SHG A;  2R58 A;  1WHK A;  1VQ7 Q;  2MAM A;  2P0P A;  2O9V A;  1NYF A;  3G1J A;  1RI0 A;  1KSW A;  1XQH A;  5GMK h;  2KSS A;  2RF0 A;  3MKD A;  1AWX A;  4BB7 A;  3OYE A;  1Y96 A;  1D0X A;  3EHR A;  4QVZ A;  4MZT A;  1S72 Q;  1OI1 A;  1SEM A;  5AT1 B;  2LZ6 B;  4JRP A;  2ZPB B;  1OEB A;  2XKO C;  1BCO A;  4M78 D;  1ZQ1 A;  3QXE B;  2MF2 A;  3CMA Q;  1CKA A;  2DXB A;  2HMA A;  4ESR A;  1Y57 A;  3JCM e;  1ZA2 B;  1QWE A;  1WPY A;  4IUV A;  4C5H A;  1VQ6 T;  2NLU A;  2H3E B;  2J6K A;  1KQS P;  2YRC A;  2FPD A;  5GAO q;  1VQN Q;  2LQW A;  3LX7 A;  2B86 A;  3DLL A;  1EIF A;  1Q82 C;  3G6E T;  1YWP A;  2K9G A;  5D6Y A;  3VYG A;  2VV5 A;  1N5Z A;  2MPX C;  5HCK A;  2RQT A;  3FEO A;  1ZX6 A;  2V8I A;  2FEI A;  2HEQ A;  3H6Z A;  2B8A A;  2HSP A;  2F2W A;  1FYN A;  1AWW A;  5DLQ E;  1BI2 A;  2JTM A;  2L2P A;  4AFZ C;  3EHQ A;  3M0U A;  3PGG A;  3ZFJ A;  2KBT A;  4L5G A;  4MZP A;  1JRI A;  1YP5 A;  4HCZ A;  3H0F A;  1M90 U;  1X2K A;  2FZC B;  2OTL T;  2D6F A;  1I81 A;  1VQ6 A;  2RHX A;  1YIJ A;  2KY9 A;  1KC8 C;  1OZ2 A;  4F7U E;  5KYY B;  5KYX B;  2XK0 A;  5I21 A;  1H3H A;  2E5Q A;  3LGF A;  2LVM A;  5J26 A;  4FU6 A;  4M7D G;  1MMD A;  2IG0 A;  3M0R A;  2DJZ A;  1D1A A;  4PK4 A;  2QK0 A;  4M77 F;  1N9R A;  4M7A D;  3FLG A;  3DLM A;  3L42 A;  4RTT A;  1S1N A;  5I11 A;  5GAN f;  2XMF A;  4M78 E;  4OB2 B;  1WLP B;  1NE8 A;  1QCO A;  2AKK A;  2M0Y A;  4J7I A;  4M78 C;  5A0G A;  2DTI A;  1K8A C;  1W1F A;  1CSK A;  3H0H A;  2DE0 X;  2VXF A;  1H8K A;  3OYH A;  2W10 A;  2EVR A;  2PTK A;  5GAO r;  2CZ6 B;  5LJ3 f;  3OSS C;  5CKF A;  3OYN A;  3MEU A;  5IT9 E;  3P8B B;  5GAN e;  4RG2 A;  2KXC A;  1UG1 A;  5GAM e;  1M8M A;  4M75 G;  2W0Z A;  3SHW A;  1VQK T;  4F14 A;  3NTI A;  1BBZ A;  2CT4 A;  2Y90 A;  4J9F A;  5IN1 A;  4Z89 A;  2ROL A;  1B34 B;  1AD5 A;  3CCM A;  1YIT Q;  2Y4X A;  1VQ9 A;  3G71 A;  2VGN A;  5KYW A;  4HCK A;  5DY9 A;  1PNJ A;  1O9S A;  1Y0M A;  2KYM A;  2O9S A;  2CP5 A;  2HL5 C;  2YLB A;  4OGE A;  2DLP A;  1UGR B;  1B07 A;  2DRK A;  1NLP C;  5LJ5 j;  1UTI A;  2L3S A;  1KHI A;  2FL7 A;  1Q82 U;  1R77 A;  1G3T A;  2JUF A;  2CGH A;  3CCU Q;  1JO8 A;  5FWB A;  4AFS C;  2WSE E;  2V8J A;  3NGP A;  3BE3 A;  1Q7Y R;  2RJC A;  3OQ5 A;  2RA2 A;  2A36 A;  5CO7 A;  1S72 A;  1RAD B;  1SRM A;  1HYO A;  3E1S A;  3CD6 A;  1U1T A;  2VWF A;  2KGT A;  2YWW A;  3LWI A;  3EG9 A;  1SSH A;  2BIV A;  2RM4 A;  3GNF B;  1ACM B;  2ED0 A;  3OW2 A;  3SWN B;  5KYU B;  1MV3 A;  4HCC A;  2EFI A;  2K7A A;  4DEX A;  3HHT B;  2X3X D;  4EPC A;  4CC3 A;  1VQ9 T;  3QWY A;  2FHD A;  3NPF A;  3GF5 A;  4BE2 A;  5GAN 6;  2EJF A;  2ZPG B;  5GMK e;  2O4X B;  2GFA A;  5A2Q E;  1JXO A;  1BIA A;  1QVF A;  1IRE B;  2HQH A;  1VQ7 T;  1JQQ A;  1AT1 B;  2RI5 A;  3G4S T;  3QYH B;  2DNU A;  1M4Z A;  3H0I A;  2EKO A;  2NUP A;  4LN2 A;  3CCR Q;  3CCR A;  2QTV A;  4EMH A;  3JB9 G;  2CZ1 B;  2MOX A;  2L3P A;  2GTO A;  4X34 A;  2L5Q A;  3L2U A;  2EQU A;  1TUD A;  2QXF A;  2DMO A;  3F70 A;  4E7L A;  1YIJ Q;  2CP6 A;  4LDX A;  3UDC A;  4J9B A;  4R55 A;  4M7D F;  4RG8 A;  4JJC A;  4J9I A;  1YIT T;  3SWN A;  2K5L A;  1D1C A;  4KUI A;  1KG1 A;  1TH7 A;  3FDR A;  5FW9 A;  5LJ5 e;  4O5V A;  3CCQ A;  3M53 A;  3D7S B;  3LWH A;  3JCM g;  2IVW A;  3J81 E;  2LX7 A;  2F69 A;  2KDS A;  1T3L A;  3OS0 A;  3GLX A;  3OYY A;  2E3H A;  3OY9 A;  2O2O A;  2HKQ B;  3HP9 A;  4RTY A;  1N8R R;  4KH0 B;  4N4G A;  4IUU A;  2GCX A;  2K3X A;  3ASK A;  4MML A;  4A4E A;  1RUW A;  2JTF A;  1VQK A;  1UGP B;  2HBP A;  3CQT A;  1WX6 A;  4CC2 A;  3M59 A;  4C92 A;  1VYU A;  2O01 E;  2C06 A;  4BUG A;  1U3O A;  3EGD B;  2VXE A;  8AT1 B;  1KJW A;  2EGA A;  4M75 E;  5CKD A;  2QQ9 A;  3G4S Q;  3UA7 A;  2BUD A;  4LDY A;  4XTU A;  2IIM A;  2ZPI B;  3EGX A;  2XDP A;  1VQ9 Q;  4PLI A;  3OB9 A;  3CCM Q;  1HSQ A;  4CC7 A;  2KMT A;  1IGQ A;  1I5L A;  2O4X A;  3G7Z A;  5A0D A;  2QA4 T;  2D8H A;  3KUF A;  4MDX A;  1VIE A;  2LJ1 A;  5GAM h;  3CC7 T;  4KRT A;  2MMP A;  1JB0 E;  2OX7 A;  4ATO A;  2CH4 A;  2DTO A;  4MDW A;  3CCQ T;  3U23 A;  3JCM b;  3VS5 A;  3J7A F;  2BZX A;  2F2X A;  3X26 B;  1VQ4 A;  3CBM A;  3VS1 A;  2V8K A;  1WA7 A;  2HQX A;  3GBQ A;  4AFQ C;  4C8Q C;  3E9G A;  1K1Z A;  1K73 C;  1KQ1 A;  3TSW A;  1OPK A;  4AFU C;  2COZ A;  2ZPE B;  4FT4 A;  1NJI C;  2E41 A;  4CC4 B;  2A08 A;  1IXD A;  3A1P A;  1QKW A;  1MMN A;  2JW4 A;  2ATC B;  1OOT A;  1FMK A;  1U5S A;  2X4W A;  3FIF A;  1YJN T;  1K8A R;  4RTZ A;  4C8Q B;  4PLL A;  1T0H A;  1UEC A;  5CVI A;  2L8D A;  2AHJ B;  2NUP B;  1R0B G;  3RKY A;  2SRC A;  2DXT A;  2DEQ A;  2LP5 A;  3I35 A;  3VUB A;  3SD4 A;  3QG1 A;  4JZ3 A;  5KYU A;  2X4J A;  2OJ2 A;  3CCQ Q;  4FIB A;  1SPK A;  2E10 A;  1WI7 A;  2RK2 A;  1WHM A;  3BDU A;  4E6R A;  4C0G A;  4C8Q F;  4FW2 A;  4A63 B;  3CC2 A;  1V1C A;  2SEM A;  3CC4 T;  3TSZ A;  2H3J A;  3C94 A;  3CCL T;  1WJS A;  2DXC A;  4EIK A;  1UFF A;  4C8Q D;  3QDR B;  4BE1 A;  1G5V A;  2LQN A;  3HL8 A;  1OUL A;  4OB0 B;  2X4Y A;  4OP0 A;  2ZGW A;  3OMC A;  5GAO l;  3REB B;  2CS7 A;  2J7I A;  5GAN g;  1KK7 A;  2YT6 A;  1DJ7 B;  2QEX Q;  1RAE B;  3CXC P;  3PIP A;  1VQ8 A;  2YHT A;  2EGC A;  2CT3 A;  2EPD A;  2K5F A;  4ELZ C;  2OAU A;  1P92 A;  4J6Y A;  1Q82 R;  2BZ8 A;  4PFP A;  2P0K A;  1QCN A;  2LCC A;  4C92 F;  2CDT A;  1AVZ C;  4M75 A;  1T3S A;  4M78 G;  4Y28 E;  2MYS A;  1D1B A;  1KIK A;  2D0Q B;  1GRI A;  3HRT A;  2KK4 A;  4NS5 A;  1VQ5 T;  1UEB A;  4A4H A;  2EYY A;  1I0C A;  2PU9 B;  3QYG B;  4J7F A;  2EQI A;  2DAQ A;  2L3R A;  1PM3 A;  3OMG A;  2RQU A;  2J6O A;  5IHK A;  4QT7 A;  1A0N B;  3I9Q A;  4BI8 B;  5GAN 5;  3I56 Q;  3CCU T;  3V8L A;  3P8H A;  1NG2 A;  2ZPF B;  3HFO A;  3OYK A;  4IUT A;  1PC0 A;  1LCK A;  1B7T A;  1HK9 A;  2KQW A;  4A53 A;  1M1F A;  3QPH A;  3CCL A;  2JNG A;  4C5I A;  4RTV A;  1BI3 A;  3CC4 Q;  3A8M B;  2RHI A;  4DBR A;  5CR2 A;  4P5N A;  4LE9 A;  2E64 A;  2FRY A;  4XTZ A;  3JV3 A;  5HK0 A;  4BE0 A;  1Q86 R;  2RK1 A;  2DK3 A;  2CP2 A;  2CUB A;  2WAC A;  1MND A;  2QAZ A;  4E7Z A;  1UDL A;  1YJN Q;  1GCQ A;  3TQ7 P;  1XJW B;  5HK3 A;  2F5T X;  4M7D D;  3INZ A;  1YNZ A;  3L2R A;  5GAN 8;  4M7A G;  1EZZ B;  3R6N A;  1AZG B;  2DF6 A;  3JB9 J;  1R0C B;  2E5K A;  4FYW B;  2HCK A;  1K9A A;  5FU6 B;  3CCV T;  3S3M A;  2LJ0 A;  4DBF A;  1K73 R;  1VYT A;  1PRL C;  1K9M U;  2A0F B;  2C0O A;  3M0S A;  1PHT A;  5IAY A;  3OYJ A;  1UGQ B;  1VQ6 Q;  1X6B A;  1AWJ A;  4E7J A;  5CQX A;  1M5Q 1;  4J83 A;  3VYH B;  3WVE B;  4DQ2 A;  2KYB A;  3OYC A;  2DTH A;  5GAM d;  3PMI A;  2JS2 A;  4JLG A;  1WGS A;  4B6M A;  2KRN A;  1D0Y A;  4M75 D;  3EG0 A;  2DL5 A;  2YRD A;  2OI3 A;  3E19 A;  1PD0 A;  1KFZ A;  2EBP A;  4M7D E;  2KT8 A;  1D09 B;  1RAH B;  1TG0 A;  3S6W A;  3OS5 A;  4XK8 E;  5LJ5 f;  3O5Z A;  4AG1 C;  1JJ2 S;  2FPF A;  3HTR A;  4XU0 A;  3QJ6 A;  1QVG P;  4RCC A;  3EGU A;  3OYF A;  3CME T;  1SHF A;  3A8H B;  2AIR B;  2EIF A;  4D8D A;  3RER A;  2DO3 A;  2L3Q A;  3V7C A;  3G6E A;  3GPL A;  4HCB A;  4LNP A;  4QW2 A;  2PUO B;  2DBM A;  5D7U A;  2DKG A;  2E12 A;  4OMO A;  4C92 E;  2VB6 A;  1ZUK A;  2LCS A;  3HSB A;  5GJV B;  3OYA A;  3HRU A;  4XAX B;  4ZGJ B;  3KBG A;  2HL3 A;  5LJ5 d;  1KQS S;  2EYQ A;  5LL6 S;  3EG3 A;  2M9U A;  3O8V A;  3JCM W;  4V2S A;  1K9M C;  2ENM A;  3ZEH A;  1LOJ A;  4JJN K;  1MHN A;  3S3O A;  1NEB A;  2FVU A;  4L6V 5;  1SSF A;  2KRS A;  3I5S A;  2OTJ A;  2QGG A;  3N5B B;  3EH1 A;  4Q5W A;  4OGC A;  4FYY B;  5KYW B;  2FPE A;  2PUK B;  2X35 A;  1VA7 A;  3SEM A;  3CCE A;  2COY A;  1QCF A;  1GL5 A;  1AEY A;  4ZN3 A;  3REA B;  5FRO A;  4PNO A;  2J6F A;  4GLM A;  1WFW A;  3JB9 D;  3JSC A;  1VQ5 A;  1OQK A;  1I1J A;  4J9C A;  2LX9 A;  3L2Q A;  2QQA A;  2LMJ A;  1QVF S;  3HKS A;  1WXT A;  4F04 B;  1M2V A;  3V7S A;  2OTL A;  1I4K 1;  1RAA B;  4NL2 A;  4QQ6 A;  2D1X A;  1E6G A;  1WXU A;  1FXX A;  3DB4 A;  1R8O B;  1V29 B;  1GCP A;  2D8J A;  1K0S A;  2YLC A;  4IUQ A;  7AT1 B;  4HA8 A;  2RH2 A;  2DRM A;  3EFO A;  4J6W A;  5KCO A;  3M9Q A;  3KXT A;  1YCY A;  1H64 1;  4AG2 C;  2DPP B;  1HJD A;  1VQP T;  4RCB A;  2HZY A;  1UUE A;  4DOV A;  2VVK A;  3JCM X;  3UA6 A;  5M9O A;  2VGM A;  3CME Q;  1Q81 U;  1VOM A;  1EX4 A;  3DB3 A;  1KD1 U;  2LQK A;  2EKH A;  5GAN 2;  3CCE T;  1PRM C;  4B9X A;  2PVD B;  1MMA A;  2DL7 A;  5GAN 4;  4M7A E;  2X4X A;  1QLY A;  3UWN A;  5GAN 3;  1KD1 R;  2M02 A;  2ECZ A;  1UGS B;  4WCI A;  1U06 A;  3QWX X;  2CP3 A;  4JRI A;  1SRL A;  4NOY A;  1BYM A;  2C0I A;  3CC7 A;  1Z9Z A;  2V1Q A;  3M57 A;  5I22 A;  5LJ3 d;  3NTH A;  1GBR A;  2VYT A;  1NJI R;  3CMA T;  3MP1 A;  3CCJ A;  4EMK C;  3A8O B;  3LW5 E;  1BIB A;  4EDU A;  2RD1 A;  5FLX E;  4D6W A;  1MNE A;  5A0L A;  4E7I A;  3I56 A;  1BCM A;  4HVW A;  3X24 B;  3CBO A;  3GOX A;  4C92 C;  1YJ9 A;  3QBY A;  1G3S A;  1WZO A;  2BZY A;  1K8A U;  3C95 A;  2DD4 A;  1XOV A;  5EG2 A;  5LJ5 h;  3VRZ A;  1ZSZ C;  2RQR A;  4OML A;  2MK5 A;  1M8V A;  2CUD A;  3PVL A;  1ZUU A;  2MCN A;  4ZTJ A;  1UE9 A;  1WJQ A;  3CXC A;  3I55 Q;  3IQL A;  1SF9 A;  4IIO A;  4C0Z A;  5FWC A;  3EGD A;  3JCM V;  4J9E A;  4CI0 C;  2XI9 A;  3QHS A;  2AZV A;  1G83 A;  1FMV A;  4MMK A;  4OVA A;  1BU1 A;  3THK A;  1Y7X A;  4E2F B;  3A8G B;  1VQ8 Q;  4X1V A;  3RDV A;  1JXM A;  3X28 B;  2QEX A;  1KQ2 A;  3CCJ T;  2QQS A;  2CSI A;  3M0T A;  4EMK B;  1H3Z A;  1N8R C;  1VUB A;  3PMT A;  1N6A A;  4M77 C;  3QZ9 B;  2EQJ A;  4GBQ A;  4LDV A;  4OMN A;  3VJP A;  4KH1 B;  5CAI A;  3OYI A;  2KNB B;  2CP0 A;  2G6F X;  2JN0 A;  2YUN A;  1E7O A;  1QWF A;  1NYG A;  1NZ9 A;  4BY6 B;  1IZ6 A;  1VYV A;  4C5E A;  4X9D A;  1Y71 A;  2RB6 A;  2J05 A;  4RTW A;  1FX7 A;  3I5R A;  2RJD A;  1GFC A;  5IXF A;  1I5O B;  3TCJ A;  1W2B A;  4OMF B;  3GNG A;  3QDF A;  2KI7 A;  1C1A A;  1ZBX A;  3G4S A;  4KUD K;  1IHV A;  1MV0 B;  2LTO A;  1YHQ T;  2ROT A;  2HKN A;  3PFS A;  5KE3 A;  2J06 A;  3CCJ Q;  1OU8 A;  5FRM A;  4HVV A;  3V7R A;  1VQ5 Q;  4QVC A;  1VQO A;  4M7A C;  3QSU A;  4JPB W;  3QII A;  4PJL A;  2WSC E;  2K5I A;  2DZC A;  1IO6 A;  3VS7 A;  3KFV A;  4OMM A;  5GAN d;  3OS1 A;  1ZA1 B;  2F2V A;  3M55 A;  3CPW P;  1MUZ A;  3AHU A;  1QVG A;  3L2Z A;  2RHZ A;  3NMZ C;  2PZ1 A;  4BDZ A;  2A7Y A;  2DX1 A;  1ZUY A;  2YDL A;  2XDD A;  1I07 A;  2QA4 A;  4JJB A;  5DLO A;  1AOJ A;  3ZL7 C;  4FCY A;  5GAM f;  5CKH A;  1D0Z A;  1XNI A;  4DEY A;  5D6W A;  4R0K A;  2CRE A;  2CSQ A;  2LT1 A;  4M77 D;  4M7A F;  1K73 U;  3OA6 A;  1LPL A;  4Y92 A;  1YHQ A;  2RN8 A;  2QYZ A;  3EFO B;  3RMS A;  1HXD A;  4ZNX A;  3OBW A;  2LC4 A;  2OTJ T;  3MP6 A;  3FB9 A;  1VQO T;  1WYX A;  3M54 A;  4M77 A;  3VS2 A;  4PKC C;  2HDA A;  1M3A A;  1MGQ A;  4TVR A;  2CZ7 B;  4PJO B;  3M56 A;  3VV0 A;  4JS4 A;  1K0X A;  3RMQ A;  1TXQ A;  4RMO A;  1XTD A;  1SKU B;  2O31 A;  4KGV B;  4LD6 A;  1YI2 Q;  2EJ9 A;  3RKW A;  3EAE A;  4FSX A;  5IH2 A;  3UPU A;  2GGR A;  4C92 D;  4E7H A;  3QKJ A;  3LYI A;  2P4R A;  4PJO G;  4N4I A;  2I2L A;  4Z02 A;  2AT1 B;  3GIB A;  4K11 A;  1M9S A;  4J9D A;  4OMP A;  5J39 A;  1QMC A;  2ESW A;  4JDS A;  4A4G A;  4N0A A;  1RAC B;  4HVU A;  1KD1 C;  3JB9 H;  2EWN A;  3VS0 A;  3JCM h;  4N0A C;  2LT4 A;  2XDB A;  2FB7 A;  9ATC B;  1K76 A;  5C6S A;  3PE0 A;  1VQN T;  2KT1 A;  1M1G A;  4QKU A;  1OX8 A;  2DVJ A;  4QVD A;  4O6J A;  4ELY C;  4M75 B;  4PJO F;  2KVQ G;  1NM7 A;  2ZAE A;  4F7U B;  3QZ5 B;  2FZK B;  2M51 A;  2XID A;  3L2W A;  1ZSG A;  4C0D B;  3OBY A;  4LDU A;  1VQP A;  2GQI A;  3L1A A;  1PD1 A;  5I2M A;  1OYX A;  4M7D B;  3VU3 C;  2M0O A;  1YHQ Q;  3CCM T;  2XG8 D;  3A5Z B;  1T0J A;  2CP7 A;  3MJX A;  4F16 A;  4EMK A;  1YJ9 Q;  1NLO C;  4ME7 A;  2K57 A;  1WQW A;  2I0N A;  1Z9Q A;  3AT1 B;  3H8Z A;  1YJN A;  3V8K A;  2A37 A;  4M7D A;  4ORZ A;  4XU1 A;  1ZLM A;  3CBP A;  3TU4 K;  4OF1 A;  2PVO B;  2DYB A;  1X69 A;  1WDX A;  1PSF A;  1VQM A;  5KYX A;  3I56 T;  2DIL A;  1TUC A;  5GAM g;  1GCQ C;  4JUV A;  2KEA A;  1K9M R;  2DZ9 A;  1C6V X;  2QTX A;  4YTL A;  1TTH B;  3A98 A;  3L2V A;  3CCL Q;  3P8D A;  3VRY A;  3Q1J A;  2E1H A;  2DEU A;  4C0F A;  1Q86 U;  3EG9 B;  2EGE A;  4F7U A;  2AZS A;  2JOY A;  3NFC A;  3MEV A;  3TEE A;  5FU7 C;  1UJY A;  2LQ8 A;  2M1H A;  2RJE A;  8ATC B;  1UHC A;  2JJ9 A;  4M7A A;  3NHN A;  5GAO n;  4XQ3 A;  2HNI A;  1YIJ T;  2MWP A;  3RNJ A;  4C8Q E;  2E70 A;  2R5A A;  1IGU A;  1LJO A;  3MO8 A;  4J9G A;  2X3W D;  4PJO A;  5CKE A;  1B3Q A;  1H92 A;  5J3B A;  2DBK A;  4NL3 A;  3RBB B;  1BK2 A;  4WF2 A;  3X25 B;  4LD9 K;  2CH4 W;  4FYX B;  1LNX A;  1TWB A;  3X20 B;  1QW1 A;  3WXM B;  3FJ5 A;  3ER0 A;  3BDL A;  2FG0 A;  2DXU A;  3JCM f;  2X9H A;  4IUR A;  1X75 C;  4HKE A;  5GMK i;  3CPF A;  2HSE B;  1Q95 G;  2YUP A;  3TVT A;  2RQW A;  4M77 B;  5KE2 A;  3MPU B;  2EW3 A;  1YCS B;  5CK9 A;  5LJ3 e;  4L59 A;  2JTE A;  2XD0 A;  2VKN A;  3OYG A;  1PKS A;  1JEG A;  4M7A B;  4LUD A;  1VQ4 Q;  2XU8 A;  2KRO A;  1VQ8 T;  3SDZ A;  5GAN h;  4XTY A;  2WSF E;  1X6O A;  4OB1 B;  3MET A;  3UAT A;  4J9H A;  3JCM Q;  3CCV Q;  2YRV A;  1PG5 B;  1UGV A;  2NYS A;  1NBE B;  3OYM A;  1MMG A;  5KYN A;  3S3N A;  1S72 T;  5GMK j;  1GXI E;  2NUT B;  1U8R A;  1LVK A;  3OYB A;  2QQR A;  1TU0 B;  1AHJ B;  3CMA A;  1Q7Y U;  4RTX A;  3MHX A;  1Q81 R;  1ABQ A;  3CC2 Q;  2GTJ A;  2LNV A;  2QQB A;  4FL6 A;  5AYF A;  1V76 A;  2MI6 A;  3CEY A;  3C4S A;  2BTT A;  5CKB A;  3OYD A;  1YJW Q;  2DL4 A;  3PTA A;  3VS4 A;  4X9C A;  2E6Z A;  3RR6 A;  3PVQ A;  2DIQ A;  2LRQ A;  1G3Y A;  1VQK Q;  3M4G A;  1KC8 U;  1YJ9 T;  1YI2 T;  2QA4 Q;  4Y91 A;  3DKM A;  2FYK A;  4LDW A;  2RI2 A;  4E7S A;  3QUI A;  1M90 R;  1WHJ A;  3JCM d;  1TUG B;  2E6N A;  4PFO A;  3FC3 A;  4BAC A;  1KQS A;  3MEW A;  2K3Y A;  1G3W A;  2VC8 A;  4JRQ A;  5GJW B;  2DD5 A;  5LJ3 j;  1K4U S;  2NWM A;  1OPL A;  4KGZ B;  2XHC A;  4JZ4 A;  3SB2 A;  3CD6 T;  2Y4Y A;  1PWT A;  2KAF A;  2GFU A;  2ZPH B;  4D8K A;  1FWZ A;  2GF7 A;  4EMG A;  5LJ3 g;  1M1K C;  2ZZD A;  1EFN A;  4DOW A;  3FRN A;  1JBM A;  4M75 F;  1N27 A;  5IHN A;  3JAM E;  3V8J A;  1YJW A;  2MWO A;  4M78 B;  3G71 T;  1KHC A;  3EG2 A;  4FW1 A;  4C8Q A;  5GMK l;  2CZ0 B;  1QP3 A;  2YUQ A;  1Q7Y C;  1RL2 A;  3C12 A;  2DL8 A;  4JJD A;  4LUE A;  3VS3 A;  2QDL A;  1FMW A;  1UJ0 A;  4JRK A;  2F1L A;  4GY5 A;  3JRZ A;  2EYZ A;  4DBQ A;  1RAG B;  3M0P A;  2OTL Q;  1I8F A;  2A3L A;  5IXB A;  3H41 A;  3EGX B;  2NUZ A;  1VQP Q;  1B34 A;  2GBQ A;  3UF4 A;  1WHL A;  1RI9 A;  1YFN A;  4F17 A;  1JJ2 A;  4C0D C;  1RLP C;  5HY6 A;  3PNW C;  1RLQ C;  3CXC S;  1ABO A;  1HD3 A;  4BI3 A;  4XTV A;  1OX9 A;  4PJN A;  2HQE A;  4LXC A;  2KXD A;  3CC4 A;  1OU9 A;  4UC4 A;  1BI1 A;  2DM1 A;  2ZCF B;  3I55 A;  3EH2 A;  2JVV A;  2DA9 A;  1QVF P;  3M4Y A;  2AKL A;  2K6D A;  4QQD A;  1YI2 A;  4FT2 A;  2K3B A;  3CCS A;  3CD6 Q;  1X27 A;  1PKT A;  4JLI A;  2RMO A;  3OS2 A;  1ZSZ A;  2JMC A;  4ZN1 A;  2HBW A;  1M1K U;  3PT9 A;  2YUO A;  3EFR A;  1M3B A;  1E6H A;  4N4H A;  2EQM A;  3SFM A;  3EFS A;  1W70 A;  2BE7 D;  1OV3 A;  2EYW A;  2JMA A;  4RKU E;  3MEA A;  5FU7 B;  1JU5 C;  3EG1 A;  3BFM A;  5LJ3 h;  1QKX A;  2RJF A;  2Z0W A;  3HPW A;  4AT1 B;  5KYY A;  3VKI A;  3RES A;  1NEG A;  2VAS A;  4J6X A;  1AWO A;  5L8R E;  5CQY A;  4KUL A;  4Z8A A;  1VQL T;  2YXY A;  1W2B S;  2QGF B;  4HXJ A;  2RQV A;  4M75 C;  2K2V A;  5GAO p;  1F1B B;  2AK5 A;  3VUZ A;  4OMQ A;  3M0Q A;  1QQJ A;  2R5M A;  2V26 A;  4PJM A;  2K4Y A;  4PJO E;  1X01 A;  4IIM A;  5FU6 C;  1UB4 A;  1WIE A;  2BE9 B;  1G2B A;  4R56 A;  5DM7 R;  5KCH A;  2DJQ A;  4C5G A;  2F5K A;  2O88 A;  4JS5 A;  1G8X A;  1M2V B;  3E2U A; 
#chains in the Genus database with same CATH homology
 3NTI A;  4XU2 A;  3VV0 A;  4JS4 A;  2LDM A;  3A8L B;  2Y90 A;  3RMQ A;  1PSE A;  5IN1 A;  4XU3 A;  4RMO A;  4PJO B;  1B34 B;  1XTD A;  4LD6 A;  3CCM A;  2EJ9 A;  5FU6 B;  2Y4X A;  3RKX A;  3CME A;  3CCV T;  1VQ9 A;  4M78 F;  4KT0 E;  3EAE A;  3RKW A;  3G71 A;  4FSX A;  3S3M A;  2VGN A;  4M77 G;  5GAN 7;  5DY9 A;  4VUB A;  1O9S A;  3LGL A;  3UPU A;  4C92 D;  1K9M U;  2LCL A;  2YLB A;  4E7H A;  3QKJ A;  1VQL A;  2JZ2 A;  3LYI A;  4OGE A;  4PJO G;  1UGR B;  4N4I A;  2I2L A;  5IAY A;  3JB9 F;  2HD0 A;  1UGQ B;  4Z02 A;  3OYJ A;  5LJ5 j;  3GIB A;  1M9S A;  5J39 A;  1KHI A;  3FJP A;  2FL7 A;  3ME9 A;  1Q82 U;  4JDS A;  4J5Y A;  4A4G A;  2CYZ B;  4E7J A;  1G3T A;  4N0A A;  1M5Q 1;  2CGH A;  2JUF A;  4J83 A;  5CQX A;  2DIG A;  3VYH B;  3HFN A;  2WSE E;  3WVE B;  2EWN A;  4DQ2 A;  2V8J A;  5GAM j;  3JCM h;  3OYC A;  3JB9 H;  2DTH A;  4N0A C;  5GAM d;  2LT4 A;  3PMI A;  2RJC A;  3CCU A;  4JLG A;  3OQ5 A;  2RA2 A;  2XDB A;  4XTX A;  1WGS A;  5CO7 A;  1S72 A;  2FB7 A;  4M75 D;  2RO0 A;  3URG A;  5C6S A;  3E1S A;  1VQN T;  1M1G A;  3CD6 A;  3E19 A;  4QVD A;  5GMK m;  1U1T A;  4O6J A;  3QJY A;  3SWN C;  4ELY C;  4M75 B;  4PJO F;  3LWI A;  3GP8 A;  2P4T A;  2KVQ G;  4F7U B;  4M7D E;  3T9N A;  1O75 A;  2BIV A;  3RIR A;  2RM4 A;  3QZ5 B;  3GNF B;  3S6W A;  3OS5 A;  3LH0 A;  4C92 G;  2XID A;  3L2W A;  4XK8 E;  4C0D B;  3OW2 A;  3SWN B;  1VQM T;  4ZGE B;  3CCR T;  4PJO D;  1WJR A;  5LJ5 f;  3NTK A;  3OBY A;  4LDU A;  1VQP A;  1JJ2 S;  3L1A A;  5I2M A;  5KH6 A;  4B9W A;  4XU0 A;  1OYX A;  3UT1 A;  3QJ6 A;  3VU3 C;  2EFI A;  4HCC A;  4M7D B;  4RCC A;  2M0O A;  3HHT B;  4EPC A;  2XG8 D;  3CCM T;  3A5Z B;  3OYF A;  5C0M A;  3JB9 I;  3CME T;  1VQ9 T;  4EMK A;  2FHD A;  3A8H B;  4ME7 A;  2PVG B;  2K57 A;  2EIF A;  3GF5 A;  4MZM A;  4BE2 A;  1WQW A;  5GAN 6;  3RER A;  2DO3 A;  2EJF A;  1WNL A;  2P0Q A;  2ZPG B;  2O4X B;  3V7C A;  5GMK e;  3G6E A;  2GFA A;  5A2Q E;  3GPL A;  4HCB A;  4QW2 A;  3H8Z A;  2PUO B;  1YJN A;  1BIA A;  2RHU A;  3V8K A;  1QVF A;  1IRE B;  2DKG A;  1VQ7 T;  2E12 A;  2HAX A;  4M7D A;  2EJG A;  4TVR A;  4M7D C;  3M5A A;  3QO3 A;  4C92 E;  2RI5 A;  1ZHI A;  3M58 A;  3G4S T;  3QYH B;  3HSB A;  4XU1 A;  3OYA A;  3CBP A;  3HRU A;  3ZBD A;  4OF1 A;  1M4Z A;  4XAX B;  4ZGJ B;  3KBG A;  3TU4 K;  2PVO B;  5LJ5 d;  1KQS S;  1PSF A;  2EKO A;  2EYQ A;  5LL6 S;  1VQM A;  3CCR A;  3I56 T;  2M9U A;  5FRN A;  4EMH A;  3JB9 G;  2BKD N;  2CZ1 B;  4E47 A;  3O8V A;  4A4K A;  3MP8 A;  5GAM g;  3JCM W;  4X34 A;  2L5Q A;  4V2S A;  1M90 C;  3OSV A;  3JCM c;  4JUV A;  3L2U A;  2EQU A;  2QXF A;  1K9M C;  1QP2 A;  2DZ9 A;  4OB3 B;  3F70 A;  4E7L A;  3ZEH A;  2QTX A;  4ZGD B;  1LOJ A;  4M78 A;  4YTL A;  3L2V A;  1NJI U;  4LDX A;  3UDC A;  3P8D A;  4JJN K;  1MHN A;  3S3O A;  1NPR A;  3RUX A;  1QVG S;  4R55 A;  4M7D F;  2FVU A;  3Q1J A;  4IKF A;  4L6V 5;  2E1H A;  1SSF A;  4RG8 A;  4C0F A;  1Q86 U;  2OTJ A;  4F7U A;  1YIT T;  3N5B B;  3SWN A;  2K5L A;  3JCM P;  4Q5W A;  4OGC A;  2JOY A;  4KUI A;  3NFC A;  1OZ3 A;  2PUK B;  4HT9 A;  2X35 A;  3CC2 T;  3MEV A;  2QI2 A;  1YJW T;  1KG1 A;  3TEE A;  1TH7 A;  3FDR A;  2LQ8 A;  1Y96 B;  2M1H A;  2RJE A;  5FU7 C;  4O5V A;  5LJ5 e;  3CCQ A;  3M53 A;  3LWH A;  3OW2 S;  3JCM g;  3CCE A;  2IVW A;  4BY6 C;  3J81 E;  5D6X A;  1U1S A;  3CPW S;  2F69 A;  2KDS A;  4IUP A;  3OS0 A;  3GLX A;  2XIC A;  4M7A A;  3E9F A;  3OYY A;  4KBM B;  4ZN3 A;  5GAO n;  3CPW A;  2M16 A;  5FRO A;  4PNO A;  4XQ3 A;  3JB9 D;  3OY9 A;  4C92 B;  2HNI A;  3JSC A;  1VQ5 A;  1D3B A;  3HP9 A;  1YIT A;  1YIJ T;  2MWP A;  1KD1 C;  2LX9 A;  4C8Q E;  2E70 A;  2R5A A;  3L2Q A;  4F7U G;  3OYL A;  2QQA A;  1LJO A;  4N4G A;  3MO8 A;  4IUU A;  1YJ9 A;  2R57 A;  1QVF S;  3HKS A;  2GCX A;  3V7S A;  4PJO A;  2OTL A;  5CKE A;  1I4K 1;  2K3X A;  3ASK A;  3HRS A;  4NL2 A;  4QQ6 A;  4PJO C;  1FXX A;  3DB4 A;  4MML A;  4A4E A;  1R8O B;  1V29 B;  2JTF A;  5J3B A;  1VQK A;  2YLC A;  1N8R U;  4IUQ A;  4NL3 A;  2RHY A;  1UGP B;  2HBP A;  4HA8 A;  5LJ5 g;  2RH2 A;  4C92 A;  3M59 A;  4WF2 A;  3X25 B;  4LD9 K;  2O01 E;  4J6W A;  5KCO A;  2C06 A;  1LNX A;  2VUB A;  3X20 B;  4BUG A;  1QW1 A;  1VIF A;  3WXM B;  5GAN j;  2VXE A;  3ER0 A;  3M9Q A;  3KXT A;  1YCY A;  1H64 1;  4M75 E;  3BDL A;  3LLR A;  2DXU A;  2DPP B;  3JCM f;  4IUR A;  1VQP T;  1X75 C;  4RCB A;  2QQ9 A;  5CKD A;  4PL6 A;  2BUD A;  4HKE A;  4LDY A;  4XTU A;  4DOV A;  5GMK i;  3CPF A;  3JCM X;  2ZPI B;  5M9O A;  2VGM A;  2XDP A;  2PQW A;  4GLK A;  4M77 B;  4PLI A;  4CRI A;  1Q81 U;  3OB9 A;  5KE2 A;  1WQ7 A;  2KMT A;  1VQN A;  3DB3 A;  5CK9 A;  5LJ3 e;  1KD1 U;  4L59 A;  2LQK A;  5GAN 2;  1I5L A;  2O4X A;  3J80 E;  1BI0 A;  3G7Z A;  5A0D A;  3CCE T;  2QA4 T;  2XD0 A;  4B9X A;  4A54 A;  2PVD B;  3KUF A;  5GAN 4;  4HT8 A;  4M7A E;  3OYG A;  1VIE A;  4MDX A;  2X4X A;  4BDY A;  4ZTF A;  2QEX T;  4M7A B;  5GAM h;  2GQV A;  3CC7 T;  4BI4 A;  3UWN A;  2MMP A;  2XU8 A;  1VQ8 T;  3SDZ A;  5GAN h;  4XTY A;  2WSF E;  1JB0 E;  5GAN 3;  1X6O A;  1D3B B;  1N9S A;  5GAO m;  4OB1 B;  3MET A;  4A4F A;  4ATO A;  2DTO A;  4II1 A;  2CKK A;  3MCA B;  4MDW A;  3JCM Q;  3JCM b;  3CCQ T;  2YRV A;  1UGS B;  3J7A F;  3X26 B;  1VQ4 A;  4XTW A;  2RI3 A;  3TRE A;  3PIO A;  2EAY A;  3CBM A;  5CIU A;  4JRI A;  3OYM A;  2V8K A;  5I2S A;  1VQ4 T;  2HQX A;  2QDY B;  4NOY A;  3S3N A;  1BYM A;  4C8Q C;  4J8O A;  5GMK j;  1S72 T;  3E9G A;  4E7K A;  1K73 C;  1KQ1 A;  3CC7 A;  1GXI E;  3CCV A;  1U8R A;  3M57 A;  2EQK A;  3OYB A;  2QQR A;  5LJ3 d;  1AHJ B;  2E65 A;  3CMA A;  3CCS T;  1Q7Y U;  2ZPE B;  3MHX A;  4FT4 A;  3NTH A;  1Q81 C;  1NJI C;  1QVP A;  2VYT A;  4FM4 B;  3WVD B;  2LNV A;  2QQB A;  4FL6 A;  1VQ7 A;  2E41 A;  5AYF A;  3CMA T;  3MP1 A;  3JCM J;  3CCJ A;  4EMK C;  2L89 A;  3A8O B;  1BKB A;  3LW5 E;  1BIB A;  4EDU A;  2RD1 A;  2X4W A;  1YJN T;  3FIF A;  2MI6 A;  3CEY A;  3C4S A;  4C8Q B;  5FLX E;  4D6W A;  5A0L A;  4M77 E;  5CKB A;  3OYD A;  4E7I A;  1NPP A;  3I55 T;  4PLL A;  3PTA A;  1Q86 C;  3I56 A;  1W4S A;  4C8Q G;  4X9C A;  4QQG A;  5CVI A;  2L8D A;  2E6Z A;  3X24 B;  3CBO A;  2AHJ B;  4BD3 A;  3RKY A;  5HKC A;  3GOX A;  4DA4 A;  4C92 C;  2G3R A;  2DXT A;  1YBY A;  1G3S A;  2DEQ A;  2DIQ A;  3QBY A;  2LRQ A;  1Y07 A;  2DVE A;  3VUB A;  1G3Y A;  3SD4 A;  3QG1 A;  2D9T A;  1K8A U;  3M4G A;  2X4J A;  3C95 A;  1KC8 U;  2DD4 A;  1YI2 T;  1YJ9 T;  1XOV A;  5EG2 A;  4Y91 A;  4F7U F;  5LJ5 h;  3BY7 A;  4FIB A;  3DKM A;  3R6O A;  2FYK A;  3BW1 A;  4LDW A;  2RI2 A;  1M8V A;  2E10 A;  3QUI A;  2RK2 A;  3BDU A;  5CCA A;  3JCM d;  2R58 A;  4ZTJ A;  3FC3 A;  2E6N A;  4BAC A;  1KQS A;  4C0G A;  4C8Q F;  3MEW A;  2K3Y A;  1G3W A;  2MAM A;  2VC8 A;  4JRQ A;  3CC2 A;  1WJQ A;  3CXC A;  2P0P A;  2DD5 A;  3CC4 T;  4C0Z A;  5LJ3 j;  1RI0 A;  2H3J A;  1XQH A;  2XHC A;  3JCM V;  5GMK h;  2KSS A;  3SB2 A;  3C94 A;  3OYE A;  3CCL T;  4BB7 A;  1WJS A;  2XI9 A;  4CI0 C;  1Y96 A;  2Y4Y A;  3QHS A;  2DXC A;  4QVZ A;  3CD6 T;  4MZT A;  1OI1 A;  4C8Q D;  2KAF A;  3QDR B;  4BE1 A;  1G5V A;  2GFU A;  2ZPH B;  3HL8 A;  1FWZ A;  4MMK A;  4OVA A;  2GF7 A;  4EMG A;  2ZPB B;  4JRP A;  2XKO C;  5LJ3 g;  4M78 D;  4OB0 B;  1M1K C;  2X4Y A;  2ZZD A;  1ZQ1 A;  4OP0 A;  4DOW A;  3FRN A;  2MF2 A;  3QXE B;  2ZGW A;  3OMC A;  1JBM A;  2DXB A;  1N27 A;  4M75 F;  5GAO l;  3JAM E;  1Y7X A;  3V8J A;  1YJW A;  2MWO A;  4M78 B;  3A8G B;  2CS7 A;  3G71 T;  1KHC A;  3JCM e;  5GAN g;  4C8Q A;  5GMK l;  1DJ7 B;  2CZ0 B;  3X28 B;  1QP3 A;  2QEX A;  1WPY A;  1KQ2 A;  4IUV A;  4C5H A;  2QQS A;  3PIP A;  2NLU A;  3CCJ T;  1Q7Y C;  1VQ6 T;  1VQ8 A;  2YHT A;  1RL2 A;  3C12 A;  4EMK B;  1H3Z A;  5GAO q;  1N8R C;  2K5F A;  4ELZ C;  2OAU A;  3LX7 A;  1VUB A;  1P92 A;  3DLL A;  1EIF A;  1Q82 C;  3PMT A;  4J6Y A;  1N6A A;  4M77 C;  3QZ9 B;  2EQJ A;  4LDV A;  5CAI A;  3VJP A;  3OYI A;  3G6E T;  2JN0 A;  4JRK A;  2P0K A;  5D6Y A;  3VYG A;  4GY5 A;  2VV5 A;  3JRZ A;  2LCC A;  1I8F A;  1NZ9 A;  2A3L A;  3FEO A;  2V8I A;  1IZ6 A;  4BY6 B;  4C5E A;  4C92 F;  4X9D A;  1B34 A;  1Y71 A;  4M75 A;  2RB6 A;  1JJ2 A;  4M78 G;  4Y28 E;  3H6Z A;  2B8A A;  4C0D C;  1FX7 A;  5HY6 A;  3PNW C;  2RJD A;  3CXC S;  2D0Q B;  3HRT A;  4BI3 A;  3TCJ A;  2KK4 A;  4NS5 A;  4XTV A;  1VQ5 T;  5DLQ E;  1BI2 A;  3GNG A;  4OMF B;  1W2B A;  2JTM A;  1UEB A;  4A4H A;  2HQE A;  2PU9 B;  1ZBX A;  3G4S A;  4KUD K;  3QYG B;  4J7F A;  3CC4 A;  2LTO A;  4UC4 A;  1YHQ T;  1BI1 A;  3PGG A;  3ZFJ A;  3PFS A;  2DAQ A;  2L3R A;  5KE3 A;  4L5G A;  4MZP A;  2ZCF B;  1JRI A;  4HCZ A;  5FRM A;  3I55 A;  2JVV A;  3V7R A;  3OMG A;  4QVC A;  1VQO A;  1M90 U;  3M4Y A;  4M7A C;  3QSU A;  4QQD A;  3QII A;  2WSC E;  1YI2 A;  2K5I A;  4FT2 A;  2OTL T;  4BI8 B;  5GAN 5;  2D6F A;  2DZC A;  1I81 A;  3CCS A;  3CCU T;  3V8L A;  1VQ6 A;  2RHX A;  1YIJ A;  5GAN d;  4JLI A;  3P8H A;  3OS1 A;  3OS2 A;  2KY9 A;  3M55 A;  4ZN1 A;  1KC8 C;  1M1K U;  1OZ2 A;  3AHU A;  2ZPF B;  4F7U E;  3HFO A;  3PT9 A;  1QVG A;  3OYK A;  4IUT A;  3L2Z A;  2RHZ A;  3EFR A;  1HK9 A;  4N4H A;  2XK0 A;  2EQM A;  5I21 A;  2KQW A;  4A53 A;  2E5Q A;  1M1F A;  3QPH A;  4BDZ A;  3LGF A;  3SFM A;  2LVM A;  3EFS A;  2A7Y A;  5J26 A;  3CCL A;  2JNG A;  4FU6 A;  4RKU E;  2IG0 A;  4M7D G;  3MEA A;  4C5I A;  2DJZ A;  1BI3 A;  2XDD A;  5FU7 B;  3BFM A;  5LJ3 h;  2QA4 A;  3A8M B;  2RHI A;  5DLO A;  1N9R A;  4M77 F;  2RJF A;  4M7A D;  3FLG A;  3DLM A;  3HPW A;  5CR2 A;  5GAM f;  3L42 A;  5CKH A;  4P5N A;  3VKI A;  5GAN f;  3RES A;  2E64 A;  4J6X A;  5L8R E;  5CQY A;  4KUL A;  4XTZ A;  1XNI A;  5D6W A;  4M78 E;  5HK0 A;  1VQL T;  4BE0 A;  1W2B S;  2RK1 A;  4OB2 B;  2LT1 A;  4M77 D;  4M7A F;  1NE8 A;  2DK3 A;  4J7I A;  3OA6 A;  1K73 U;  2WAC A;  4M78 C;  4M75 C;  5A0G A;  2DTI A;  1YHQ A;  3RMS A;  1HXD A;  1K8A C;  2K2V A;  5GAO p;  3VUZ A;  3OBW A;  2LC4 A;  2VXF A;  2OTJ T;  3MP6 A;  3FB9 A;  3OYH A;  1VQO T;  2R5M A;  2K4Y A;  5GAO r;  4PJO E;  1X01 A;  2CZ6 B;  3OSS C;  5LJ3 f;  3M54 A;  5FU6 C;  1UB4 A;  4M77 A;  5CKF A;  5HK3 A;  2F5T X;  5DM7 R;  5KCH A;  3MEU A;  4R56 A;  3OYN A;  4C5G A;  2F5K A;  4M7D D;  3INZ A;  5IT9 E;  3P8B B;  4PKC C;  5GAN e;  4RG2 A;  3L2R A;  5GAN 8;  4JS5 A;  4M7A G;  1MGQ A;  2CZ7 B;  5GAM e;  3M56 A;  3JB9 J;  4M75 G;  1VQK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...