2XK0A

Solution structure of the tudor domain from drosophila polycomblike (pcl)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords POLYCOMB PROTEIN PCL
publication title Structure of an Atypical Tudor Domain in the Drosophila Polycomblike Protein
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xk0A00
3LGFA 3OQ5A 3OYAA 4LD6A 1MHNA 1WJQA 3OYKA 3FC3A 3L2UA 4BDYA 3KUFA 2RHYA 4BE2A 3NTHA 4A4EA 2E5QA 3C4SA 2F5KA 2JTFA 3ASKA 1N27A 3NTIA 1WJRA 2EFIA 4E7LA 2B8AA 2X35A 3ME9A 5KH6A 3QBYA 4E7IA 4FU6A 3MP1A 4NS5A 2P0KA 2MWOA 4B9WA 3QIIA 2X4WA 1H3ZA 4QVZA 4IURA 2G3RA 2L3RA 4C5GA 3H6ZA 3BDLA 3LLRA 2RI3A 2K3XA 4EDUA 4QW2A 2R5AA 3LH0A 3QJ6A 4RG2A 2JZ2A 2R58A 3L42A 4A4HA 4E7KA 3OS0A 3F70A 2BKDN 4C5HA 3OS1A 2FHDA 3OYEA 5KE3A 4IUQA 2YRVA 3LYIA 2L89A 2DIGA 2BUDA 2LTOA 2M16A 3GOXA 3O8VA 3MEVA 2EQMA 3SD4A 2LDMA 3PMTA 4HCZA 4IKFA 3OYNA 2RJEA 4L59A 3OMGA 3MEAA 1G5VA 3S3NA 3EAEA 3DB4A 2XDPA 4UC4A 5KE2A 2HQXA 4QQGA 3OB9A 2O4XB 4BACA 4GY5A 2LVMA 3MEUA 3PFSA 4QQ6A 4ZTFA 4II1A 3DLMA 5D6YA 2LCCA 5IAYA 5FRMA 2BIVA 2NLUA 2D9TA 2VYTA 3OYFA 4PL6A 3PNWC 2RI5A 3MEWA 2GFAA 3Q1JA 2CKKA 2QQSA 2R5MA 3P8DA 4A4FA 3OA6A 2RJDA 1RI0A 2RHXA 3PMIA 4A4GA 3QKJA 2R57A 2XK0A 2EQKA 3OYDA 4QQDA 2O4XA 4PLIA 5FROA 1XNIA 1OI1A 3OY9A 3FDRA 3OYIA 2GF7A 2M1HA 2WACA 3OYCA 1OZ2A 5D6XA 3OYMA 2L8DA 4IUPA 4E7JA 3LX7A 2PQWA 2GFUA 3OYHA 5FRNA 3H8ZA 4FL6A 5D6WA 5C0MA 5C6SA 2MWPA 5J39A 3S3MA 1WJSA 3NTKA 2IG0A 2HQEA 3P8HA 5J26A 3L2WA 3UWNA 3LGLA 1OYXA 2EKOA 2RHIA 1SSFA 2RJCA 3M9QA 2LRQA 5CIUA 3E9FA 4X34A 4E7HA 2EQUA 5KCOA 3S3OA 2RO0A 4Q5WA 4BE0A 4Z02A 1OZ3A 3OYJA 3OS2A 3L2RA 2E6NA 1KHCA 3L2QA 2EQJA 2RHZA 4BD3A 3OYGA 4N4HA 3OYBA 3DB3A 2QQRA 4N4GA 4B9XA 3OYLA 2K3YA 5KCHA 3L2VA 1WGSA 3FLGA 3FEOA 3E9GA 2X4XA 3META 4BDZA 3MP6A 4PLLA 4IUVA 3S6WA 4IUTA 3MO8A 4IUUA 3MP8A 4C5IA 3UT1A 4BE1A 2X4YA 4OVAA 4ZTJA 5IN1A 2RI2A 2RHUA 4CRIA 2M0OA 3OMCA 2DIQA 3ZEHA 4C5EA 5M9OA 2DAQA 3CEYA 2RJFA 4N4IA
chains in the Genus database with same CATH superfamily
2AZVA 2RA2A 1WJQA 2YUOA 4M77C 4OB1B 4F04B 2QEXT 3UPUA 1NPRA 4HKEA 3C4SA 4F7UB 1M90R 1WHKA 2RD1A 2ED1A 4P5NA 1V1CA 3UDCA 3NTIA 2C0IA 3ME9A 4HVWA 3MP1A 4J5YA 1ZUUA 1YCYA 1S72Q 5CKHA 3CCQQ 4F7UF 5FU6B 5IT9E 4KUIA 2QXFA 2X9HA 2K57A 4PJLA 2DTIA 3PE0A 3CC7T 2RJEA 5GANd 1TTHB 5GMKe 3MEUA 3JB9D 2DXUA 2JNGA 3DLMA 5KYUB 5D7UA 4PJOA 3VS6A 4BI4A 4RUGA 2VGMA 1Y96A 2O31A 2XDDA 2EQKA 3PIOA 3M54A 4C92F 3CCMT 3X28B 4RTXA 1SEMA 2L8DA 5D6WA 1YHQQ 1VIEA 1U1SA 1Q86U 1BYMA 1JU5C 1ABQA 2M51A 1KQSS 3E9FA 4PFOA 1M8MA 4E7HA 1UHFA 2V1RA 2CZ1B 2CYZB 3HFNA 3BE3A 2DYIA 4LNPA 1KHCA 4Z8AA 4N4HA 2QQRA 3DKMA 2XD0A 5KCHA 2CZ7B 2EYQA 3G4ST 1I4K1 1NJIU 1OX8A 2GNCA 4ZTJA 1VQ5Q 3QG1A 2XKOC 4C5EA 1VQ7A 4CC4B 2LCSA 1MHNA 2VWFA 3FC3A 2YLCA 2JTFA 4EMKA 3VRZA 5HCKA 1IXDA 3TREA 3LH5A 1RUWA 4XU1A 2X4WA 3ULRB 3JCMc 4M7DD 2YUPA 4QW2A 3ER0A 3RERA 4HA8A 4ZN3A 4WF2A 2DVEA 4R0KA 3GOXA 1QKWA 1M1KC 2XMFA 3OYNA 1VQKQ 1B7TA 1M3BA 3S3NA 4Z88A 2FB7A 3U23A 4JZ3A 2X3XD 2CP5A 2D9TA 2RQVA 1B34B 3M0QA 1PD1A 2LT1A 2D0QB 2LP5A 4OF1A 1C6VX 2KNBB 2E6ZA 2Z0WA 4M77A 2PVOB 3HTRA 4RTYA 2YHTA 2F1LA 3HRTA 3TCJA 1YP5A 4J9FA 4GLMA 1X01A 2VASA 1K8AC 1TWBA 1YIJT 1M1FA 3LX7A 2LC4A 3H8ZA 2DERA 4FL6A 3REBB 3WXMB 3JCMX 4Y91A 1AHJB 1SHGA 4LDWA 3UWNA 3CCRQ 1VQ6T 4J7IA 5I11A 4X34A 4F7UE 2DNUA 1UTIA 3QJYA 2CSQA 2JM8A 1UGSB 4C8QC 5GAN2 2HCKA 2HQHA 2KVQG 4E47A 2ZAEA 2KRMA 2X4XA 2JW4A 3META 1OPKA 2DBMA 3A5ZB 2YUNA 3ZEHA 3X25B 3HL8A 5FWCA 3EHRA 1WFWA 1W2BS 4M75D 2MK5A 2HMAA 1OU9A 1RAFB 2V8IA 2EAYA 2F5KA 1VQ7Q 1PWTA 3CCJA 1N8RR 5KYXB 4C92C 1V76A 1JO8A 5KH6A 3CCLA 3CPFA 3QWXX 4A53A 5GMKj 2ZPEB 2DTHA 1X43A 3SB2A 1C0MA 3CCQT 3LLRA 1FMVA 2PVDB 5GAOp 1MV0B 3C94A 1WHHA 3HHTB 3SWNC 2CP6A 5AYFA 3M0SA 4A63B 4KBMB 2LDMA 2QDYB 2K3BA 4L59A 2QTXA 2HQXA 4QQGA 3OB9A 2O4XB 1NZ9A 1YWOA 4X9CA 3PFSA 1YJ9T 1Q7YC 4ZGDB 1R8OB 1Y71A 3CC2A 1N9RA 3OYFA 1VA7A 1X6OA 2L3SA 3VU3C 2QI2A 5LJ3g 3QWYA 4BY6C 2RHXA 5DLQE 1KD1U 4JUVA 3IQLA 4X1VA 4PLIA 4RTWA 1K9AA 3CCUA 3RR6A 1OI1A 5GANj 3OYIA 1MMAA 1G83A 1WIEA 3G71T 1YBYA 2KXCA 4EIKA 1YHQT 4PNOA 4J9DA 2X4JA 4FYWB 5I2MA 1OULA 1TOVA 1WXTA 1KIKA 3R6OA 2MIOA 4KRTA 5GANg 3I56A 2COYA 2OTJT 5FLXE 2GQVA 4XAXB 1Z9ZA 2EIFA 4B9XA 4M78F 2EJ9A 4M7AD 1SRLA 2CDTA 2LQKA 2COWA 1K9MC 4R56A 2DKGA 3OW2P 2M9UA 1KC8C 4MMKA 2K5FA 4LN2A 1JJ2S 2NUZA 4J9GA 2FPFA 4M77G 3CXCA 2A37A 3M58A 1E7OA 2K2VA 1BK2A 1VQOQ 1MNDA 2J6FA 2DA9A 2A28A 4EMKB 4MZPA 1H3ZA 3HRSA 1AZGB 3H6ZA 3CCJQ 5CKDA 3G4SA 1ZLMA 3RUXA 4C0FA 1U8RA 3CCLQ 1K73C 4A4HA 2BKDN 4F7UA 2SRCA 2DMOA 2ZPFB 1N9SA 2YRVA 1KG1A 2KBTA 2FL7A 1Q82C 3PMTA 3RNJA 4XTVA 2Y4XA 4WTOB 1QWEA 1VQ4T 3PGGA 1ZSZC 4ME7A 1VUBA 4QQ6A 2OTLT 1LNXA 3MCAB 5IHNA 5J3BA 4DBRA 1VQ8Q 1QVFS 1NBEB 3FJ5A 3CCSA 1AOJA 5GAN4 1R0BG 4KULA 1ZA1B 2XK0A 3CC2Q 4QQDA 5FROA 2GCXA 2P84A 3VV0A 5GAOm 3QYHB 2GF7A 2WACA 1OV3A 5GAMd 4M77B 2GFUA 4DEYA 2A08A 3FB9A 1RLPC 2XI9A 3P8HA 2EYXA 3KXTA 4HVVA 3TSZA 1Q81C 1XJWB 5GAN8 4BD3A 3SWNA 1F1BB 1M2OA 3FLGA 3EGDA 1IRXA 1I5LA 3MP6A 3I56Q 5GMKm 4BE1A 1H92A 3VRYA 3OBWA 5M9OA 1QWFA 1W1FA 4J7FA 2QA4T 3CEYA 1UHCA 3LGFA 2K79A 3R6NA 4HCCA 1AD5A 1U3OA 1VQPT 2HKQB 3URGA 4XTWA 3JB9F 2I0NA 3N5BB 2NUTB 2KEAA 2ESWA 2B8AA 1LOJA 5A0DA 2EYWA 2QYZA 2P0KA 3JCMP 1K0SA 4QVZA 1D1AA 2K4YA 2F2XA 1YI2T 3PIPA 1T3LA 2RI3A 1AEYA 4BI8B 1GBQA 2R58A 2QGGA 1D0YA 2LNVA 2DIGA 4J9BA 2E10A 1VQLA 4M78C 4E6RA 3EAEA 3AT1B 1ZUYA 1FYNA 1SSHA 5LJ3h 2DRKA 1GRIA 1M90U 2HZYA 3TU4K 4PJOD 4OB2B 3MEWA 2LZ6B 4J6WA 2RJDA 1PRLC 3GLXA 2PUKB 3JCMb 3CCSQ 4FM4B 3I35A 2ROLA 5CKFA 2A0FB 1TUDA 3OYMA 2P0PA 3CMEA 1PCXA 4AFQC 2J7IA 2QGFB 5GANh 5LJ5d 1NG2A 3CBOA 4M4ZA 5CCAA 1GL5A 3VS3A 1SG5A 1UFFA 1VYTA 1VIFA 4B6MA 2MAMA 4OMFB 2KRSA 4C0DC 4OB3B 4C8QG 3L2VA 1UG1A 2ED0A 3INZA 4M7DF 2EW3A 1W70A 2JOYA 2X4YA 3G6ET 1MMDA 2BTTA 3M0PA 3CC4Q 2EYZA 4O5VA 2VKNA 3E2UA 5CK9A 4FCYA 2LQ8A 3CD6T 5A0LA 3QZ5B 2RK2A 2EYYA 2EJFA 3EG3A 4C92G 2J6KA 1M5Q1 4JPBW 3VS2A 4F17A 2OTJA 1Y07A 2DE0X 1BIAA 4JRIA 2XICA 2DX1A 1NLOC 1NLPC 2GBQA 3LH0A 2E65A 1IGQA 3RMSA 5KYXA 1V29B 3PVLA 4E2FB 2KGTA 3MEVA 1YCSB 1H641 4M77E 3VS7A 2YXYA 2BE7D 4RCCA 2CZ6B 2O9SA 5GAN6 5LJ3d 1ZBJA 1QCNA 1VOMA 2NYSA 3REAB 2VB6A 2M02A 5D6YA 3M4GA 1G3TA 2NLUA 1VQLQ 2VYTA 3MHXA 3M5AA 2RI5A 2CSIA 2GFAA 3KFVA 3MJXA 1YITA 2RQTA 2CS7A 2YWWA 3OA6A 1A0NB 3EGUA 3EGXB 2P4RA 2YT6A 3OSVA 4YTLA 2H3JA 1RAEB 1YJWA 4C8QF 1VQ9A 2O4XA 3H0HA 3A8HB 5FW9A 2JN0A 3GF5A 1PC0A 3EG1A 4RTTA 2JS0A 3NGPA 1ZHIA 5FRNA 2LJ1A 1AVZC 4M75F 1D0ZA 3M53A 4C92B 2OTLA 1M8VA 2EQUA 3S3OA 4Q5WA 3CMEQ 2D8JA 4PJMA 1VQMA 2IPOB 2CUDA 1JEGA 3JCMe 2JMCA 5GJWB 4NL2A 4BDZA 3SWNB 5GAMj 3FIFA 4FIBA 1M4ZA 3BDUA 2X51A 4AFUC 3EGDB 1UGPB 1ABOA 1T3SA 3X24B 3QPHA 3SFMA 1SHFA 4N4IA 1M1GA 3J80E 1E6GA 2M0YA 1T0JA 3CMAA 1RAAB 3L2UA 1M30A 4BDYA 2MMPA 5CVIA 5GAMg 2G6FX 4A4EA 4FW2A 3TSWA 4JS4A 5GANe 1YJNT 4A54A 3OBYA 3GPLA 2QDLA 4LDYA 4BY6B 3CCEA 1GFDA 2EGAA 3AHUA 4XU3A 3BDLA 4MZTA 3QHSA 2ZGWA 2R5AA 1VYVA 1OQKA 2RH2A 2XG8D 4C5HA 1K1ZA 1AWWA 3ZL7C 3CCVA 3UATA 3CPWS 2M16A 1VQNT 1Q86C 1KHIA 2LQNA 4M7DC 1WXBA 1S1NA 2C0OA 3DB4A 4PFPA 1X6GA 2V1QA 4AFSC 1N8RU 5FRMA 4DEXA 3JCMW 4M7AF 1YFNA 1NJIC 4FSSA 2D0NA 2EQIA 1Y57A 1YITQ 6AT1B 3G1JA 1YJWQ 2HL5C 2ZPBB 1VQ9Q 1WJSA 2PUOB 1UUEA 2WSEE 2HBPA 1WHJA 1OYXA 4HCBA 3M9QA 2W0ZA 2HD0A 4GBQA 5FU7C 2DF6A 5KYWB 2DEQA 3CXCS 4F14A 3OYLA 1WA7A 4IUTA 4DA4A 3MP8A 4C5IA 4KH1B 3KBGA 5IN1A 1VQMQ 2RI2A 3OMCA 1SRMA 2DIQA 5LJ5j 5GAOq 1WZOA 2RJFA 4J6XA 2O01E 3CC4T 1ZSZB 2XHCA 2PU9B 1JXMA 5LJ5g 1GXIE 3CMAQ 2LJ0A 1I81A 4C8QE 1PKTA 3EFRA 3NPFA 3V7SA 3HPWA 1M9SA 4M75C 4J9IA 4MMLA 2QK0A 2KROA 3G7ZA 4EDUA 2VC8A 4E7KA 2EGCA 3OS0A 3RESA 3OS1A 2LX9A 4OGCA 2NUTA 3SHWA 5KE3A 3CCEQ 1UB4A 4IIOA 2LTOA 1M1KR 2RM4A 1PHTA 1M3CA 4XTXA 4M78G 2CH4W 2DEUA 2FG0A 2YDLA 2IIMA 3L2ZA 3C95A 4C92E 4J9HA 5HKCA 2V26A 1S72T 3I55A 2DL4A 2EBPA 1TU0B 2ATCB 3PNWC 2CGHA 1I07A 3Q1JA 3LW5E 2DJQA 1TSFA 3PMIA 2DBKA 3GNGA 2R57A 1D1BA 3OSSC 3RMQA 2B86A 4JS5A 1RAHB 2QEXA 3VJPA 5LJ3j 1K8AR 4HVUA 1JRIA 4QVDA 2HDAA 5J26A 1D09B 2EKOA 3GIBA 5CIUA 4ESRA 4CC7A 5CKEA 1CKBA 2AIRB 3L2RA 3L2QA 3OYGA 4JLIA 4N4GA 2WSCE 2GGRA 2OAUA 4PLLA 3CC7A 4V2SA 1JQQA 4IUUA 1KQ1A 3A8MB 3OW2A 4AFZC 5GAMh 4FW1A 2SEMA 3JCMV 1KJWA 4M78B 5DLOA 2DXBA 2HKNA 1G2BA 4LD6A 2YRDA 1MMGA 4M7AC 1BIBA 2E5KA 4HT8A 8ATCB 3NTHA 3I5SA 2FO0A 1RAGB 2GTJA 3BFMA 1IO6A 1WJRA 1O75A 3QBYA 4LUEA 4XU2A 4PJOF 1YWPA 3SEMA 5IXFA 1KD1C 3CCMA 1VQ5T 2RQWA 2DTOA 1HXDA 2JZ2A 3EG2A 5HK3A 2L0AA 7AT1B 2EQMA 1M3AA 1JBMA 1G3SA 2QQBA 2LCLA 1BB9A 4UC4A 2KI7A 4GY5A 1Q7YR 3RKYA 2KQWA 4C0DB 2LCCA 2MF2A 2JMAA 5GAOn 1WHGA 2CKKA 4DOVA 2DO3A 3QKJA 3E19A 3I55Q 2EKHA 3JB9G 3FDRA 2KDSA 1VQKT 1QVGS 4C8QA 4OMPA 3MKDA 3UF4A 5C0MA 4J9CA 4LDUA 2HQEA 1R0CB 3L2WA 4WCIA 2PZ1A 3EGXA 2KK4A 4C0GA 5KCOA 3QSUA 1N6AA 2D8HA 1G3WA 2K5LA 2H3EB 3OYBA 4KGVB 3DB3A 2RF0A 1W4SA 4OMLA 3EG0A 4C92A 2QASA 1K9MR 1NYFA 5DY9A 1KC8R 3CCUQ 3OYAA 3CCRT 3CC7Q 5LJ5h 4FYVB 1AWJA 5GAN3 1K0XA 2E5QA 2MOXA 2DYBA 2CP7A 2QTVA 2ZPIB 3LWHA 4L5GA 1T0HA 4E7IA 1IZ6A 4IIMA 3QYGB 4FSXA 3QIIA 2FPDA 4O6JA 4ANJA 2KYMA 3QXEB 1RI9A 1EZZB 1HSQA 1U5SA 2AKKA 2E3HA 2FRWA 2MPXC 1W2BP 1YIJA 3A98A 1K73R 3JCMf 1M2VB 1QVPA 2A3LA 2L89A 1WPYA 1PSEA 1VQ6A 1BBZA 4EMHA 1Q82R 2CP3A 1OEBA 1VQ7T 4DQ2A 1I1JA 5GAMe 3MPUB 4M7DG 3BY7A 4EPCA 4BACA 5CO7A 3L1AA 4J83A 5IAYA 2BIVA 1SPKA 2ZCFB 3TVTA 5FWBA 5I2SA 3V8JA 2CUBA 4TVRA 5GANf 4ELYC 1R77A 2F5TX 2DD4A 2E41A 4M7AA 2RNAA 3G4SQ 1HD3A 4XQ3A 4PJOC 5D6XA 2O88A 4LE9A 1TXQA 3JRZA 4M78E 4MDWA 2HSEB 3NTKA 3NHNA 4D8DA 4JRPA 2RHIA 3EH1A 2RO0A 5GJVB 1S72A 1Q81R 3CCQA 2HEQA 2E3IA 3P8BB 2CT3A 1GBRA 1X6BA 1OOTA 3LWIA 2IVWA 2YRCA 2DILA 2D6FA 5IH2A 4Y92A 1CKAA 2V8JA 1B07A 4M7DB 1QMCA 5KYWA 4J6YA 2KT8A 1YJ9A 2YSQA 1RADB 3THKA 4XU0A 1NPPA 1M90C 2CH4A 1G3YA 3JV3A 4R55A 1KFZA 4D8KA 2EFIA 2X35A 4OMNA 2MWOA 4XK8E 2KMTA 1WQWA 1QLYA 4C5GA 1ZSZA 1JJ2P 4M75G 4RG2A 3G71A 2NUPB 3F70A 3JCMQ 4EMKC 4RG8A 5L23A 3CBMA 1YHQA 2JT4A 4GLKA 3O8VA 3MEAA 2QG9B 1VQOT 2KXDA 5KE2A 1YIJQ 1QVFA 1H8KA 3VUBA 5FU7B 4HCKA 5LJ5e 3UA6A 2CT4A 2GQIA 1BI2A 5GAN5 1VQ6Q 3V7RA 1PD0A 2I2LA 4PL6A 3CCJT 3A8GB 3P8DA 2XU8A 3CCLT 1EIFA 2E64A 3PT9A 2EWNA 3VS4A 2KT1A 4JRQA 2OI3A 1U1TA 1IREB 2DRMA 3JSCA 4CC2A 2PQWA 3OYHA 1QVFP 5C6SA 4C8QB 1TH7A 4ORZA 1VQ8T 1UGRB 4JJNK 2KAFA 2HL3A 2KR3A 1AWOA 1UJ0A 4M75B 4D6WA 3VYGA 3JCMd 4M77D 1WQ7A 3CC2T 1MGQA 4Y28E 1YN8A 2YLBA 3I5RA 4C0ZA 2M0OA 1GFCA 4XTZA 3FRNA 3PTAA 1PG5B 1BI1A 1VQKA 1VQ4A 1MUZA 3OQ5A 3JAME 3CCUT 3T9NA 4DBQA 4OMOA 4M7AG 4QKUA 2J6OA 3V8KA 1Y7XA 2KY9A 3ASKA 4KH0B 5LJ3e 1YJ9Q 1N5ZA 4CC3A 2RQUA 4OGEA 5HY6A 1BKBA 3M55A 3EH2A 4M78A 3I56T 2G3RA 1PKSA 4JZ4A 3ZBDA 1XTDA 4JLGA 2OJ2A 1SF9A 3J81E 3PVQA 4DOWA 2BUDA 1ZSGA 4LD9K 2RPNA 2HNIA 4IKFA 1LCKA 2ECZA 3CCRA 1IB8A 3G71Q 2XDPA 5L8RE 1NEBA 4OMQA 3I9QA 2JJ9A 2QAZA 2HAXA 2L5QA 2F2VA 2DPPB 3TEEA 1GCQC 2ABLA 4LDXA 2QQSA 3A8LB 4AG2C 1X27A 2CP2A 3BW1A 2OTJQ 2OX7A 4NL3A 2AKLA 2QA4A 3HRUA 4MDXA 2DETA 3H9NA 1LJOA 1VQPA 3H0IA 1OZ2A 4M7AB 2H8HA 4RTZA 2J06A 4M7DE 2RQRA 1WHMA 1LPLA 2CP0A 1ZBXA 1M1KU 1H3HA 5GMKi 1P92A 3OW2S 2RK1A 2W10A 2BZYA 1D3BB 4JJCA 3GP8A 4BE0A 4J9EA 4Z02A 3OYJA 1YI2A 5I21A 1UDLA 2MCNA 5IHIA 4RKUE 3JCMJ 1QCOA 4PJNA 3CCST 2XIDA 2A7YA 3UT1A 1TS9A 4BB7A 1XOVA 5KYYB 2RN8A 3X26B 1BI0A 4A4KA 1FWZA 4ZGEB 1TUGB 1K8AU 3VS1A 3OYKA 3CBPA 4KT0E 4RCBA 4KGZB 3EFSA 1N8RC 2ZZDA 1VQ4Q 3VS0A 5CQYA 5IHKA 5GAOl 2OTLQ 1WLPB 4FU6A 2HBWA 5EG2A 4B9WA 4RTUA 4FYXB 1YNZA 1MMNA 4HT9A 2VVKA 2E12A 3VUZA 4PJJA 1IHWA 3O5ZA 5DM7R 3A8OB 3RKWA 1WHLA 1IGUA 2ROTA 4DBHA 3SD4A 3OS5A 1Q86R 2LT4A 1I8FA 4LXCA 3EFOB 5IXBA 5GMKl 3NMZC 1WX6A 2BZ8A 1X75C 1M2VA 1TUCA 4F16A 2R5MA 2FRYA 4A4FA 3G6EA 2DL8A 4M75E 1K76A 1NJIR 3QDRB 1ACMB 2DZCA 2O9VA 2EVRA 5FU6C 2VXFA 1UE9A 3OY9A 2E1HA 2JM9A 2Y4YA 2WSFE 4J8OA 2ENMA 2FPEA 4C8QD 3CD6A 4E7JA 4PJOG 3CCVQ 4LUDA 2QA4Q 5EC7A 1LVKA 2EGEA 2BE9B 1VQOA 2QQ9A 4X9DA 3VKIA 1AWXA 1QQJA 1VQLT 2LJ3A 1VQPQ 1ZUKA 3OS2A 1Q7YU 4FT2A 2L3PA 1BCMA 5GAMf 3A1PA 2AZSA 1Y0MA 1WGSA 2EJGA 3E9GA 1X69A 2JTEA 2GTOA 4HXJA 2COZA 4IUVA 1RAIB 2MYSA 4OP0A 1YI2Q 3HSBA 5I22A 1OX9A 2AT1B 4C92D 1UGVA 1KQSA 2DAQA 2L2PA 3CQTA 3QUIA 1W6XA 1KK7A 3X20B 3KUFA 4NOYA 2RHYA 3VS5A 4BE2A 2FYKA 3FJPA 1GCQA 3CMET 1VQ8A 2FEIA 2C0TA 2A36A 3SDZA 3TQ7P 2CREA 1UECA 1HK9A 2F69A 2HSPA 4M7DA 4IURA 2L3RA 3C0CA 1HJDA 2P0QA 1KQSP 3JCMg 2ZPHB 3ZFJA 3CPWA 2FZGB 3L42A 4PJOB 9ATCB 5HK0A 2FHDA 2DVJA 4OB0B 1AZEA 3LYIA 1K9MU 1NM7A 5A2QE 2VV5A 1Y96B 3H0FA 4HCZA 4AMCA 1KC8U 4M7AE 2RMOA 1I0CA 1XQHA 4ZTFA 4II1A 2LNHB 1UGQB 3EG9A 3M0UA 2NUPA 1FXXA 2DL5A 3D7SB 3M4YA 1D0XA 4JDSA 3WVEB 3CPWP 3JB9H 1KQ2A 4VUBA 1SKUB 3NFCA 2K9GA 2AK5A 8AT1B 2M1HA 2KRNA 1K73U 3G6EQ 2JS2A 4ELZC 3M57A 1BU1A 3S3MA 2FZKB 1YJNA 1MV3A 1Q82U 2LRQA 1I5OB 3CD6Q 2DXTA 2PVGB 2CZ0B 2E6NA 1JB0E 1J3TA 4PFZA 2VXEA 5AT1B 1IHVA 5LJ5f 1TG0A 2DM1A 3M59A 1YITT 2JVVA 4OVAA 1VQNA 1KSWA 4XTYA 1YJWT 2FVUA 1VQ9T 3S6WA 1QW1A 4E7SA 2XDBA 1UEBA 4JJDA 2QEXQ 4M75A 1RABB 5CR2A 3M0TA 3CXCP 4JJBA 4E7LA 1B3QA 1O9SA 1Q81U 1WNLA 2JTMA 5GAN7 4JRKA 1KD1R 1VQMT 2K3XA 2VUBA 1W2BA 3QJ6A 3QZ9B 2JUFA 4N0AC 1QCFA 3DLLA 4FYYB 4BUGA 1GCPA 3OYEA 4IUQA 5LL6S 3GBQA 3M0RA 2DXCA 5ECAA 5KYUA 1BI3A 4KUDK 4ZNXA 3CMAT 2E70A 1Q95G 3RBBB 2V8KA 2ZPGB 1WI7A 1FMWA 4PKCC 2X3WD 2LMJA 2EPDA 2K6DA 2PNIA 1MNEA 4M77F 1OU8A 4RTVA 1ZX6A 2DZ9A 1G8XA 3HKSA 1UJYA 1FX7A 5LJ3f 3CCET 1E6HA 1Z9QA 4AT1B 2LX7A 1CSKA 3OYDA 3CCMQ 4E7ZA 3CC4A 4FT4A 2DL3A 5GAOr 1NYGA 4IUPA 1QKXA 3CCVT 1PSFA 5J39A 2MWPA 1DJ7B 1M27C 1SSFA 1ARKA 2P4TA 4ZGJB 3HP9A 2AHJB 2DLPA 1VYUA 3RKXA 1X2QA 3V8LA 1OZ3A 1WXUA 2LQWA 2DD5A 2EQJA 4Z89A 4QVCA 1YJNQ 3H41A 3HFOA 2K5IA 3FEOA 3QO3A 1OPLA 3MO8A 1BCOA 4CI0C 5CKBA 2RHUA 3GNFB 1D3BA 2KYBA 4ZN1A 4PJOE 4RMOA 5GMKh 2DJZA 1ZQ1A 4EMGA 5KYNA 2F2WA 3C12A 1VQNQ 4OMMA 1QP2A 3WVDB 4DBFA 1N27A 2KSSA 3JB9J 2DK3A 3RIRA 1K4US 4NS5A 3JCMh 1PM3A 5KYYA 2KE9A 4LDVA 3JB9I 3UA7A 4M78D 4MZMA 2D1XA 1JJ2A 2RB6A 2QQAA 1X2KA 2BZXA 3E1SA 4K11A 1C1AA 3EHQA 1D1CA 2JXBA 1G5VA 3OMGA 1ZA2B 4XTUA 5CQXA 4QT7A 1FMKA 2LVMA 3V7CA 1B34A 2YUQA 2MI6A 1RACB 4F7UG 3J7AF 2L3QA 2DL7A 1NEGA 3EG9B 4BI3A 1RL2A 3M56A 1RI0A 4A4GA 5CAIA 1QVGA 3EFOA 1XNIA 4AG1C 4PK4A 5A0GA 2J05A 3OYCA 1EX4A 3QDFA 1PNJA 2K7AA 1RLQC 2IG0A 1PRMC 1AT1B 3LGLA 2OAWA 2RJCA 2PTKA 1WYXA 2VGNA 1WDXA 2E4HA 2K2MA 4KGXB 1EFNA 2DFUA 1VQ5A 1QP3A 2RHZA 4N0AA 4ATOA 1JXOA 3VYHB 1U06A 1HYOA 2K3YA 1QVGP 3I55T 1NE8A 2O2OA 2Y90A 3RDVA 4CRIA 2NWMA 3OYYA 2FZCB 4L6V5 2C06A
chains in the Genus database with same CATH topology
3LGFA 4A4KA 2DXBA 1FWZA 4LD6A 4ZGEB 2RA2A 1WJQA 3OYKA 4M77C 3CBPA 4KT0E 4OB1B 2QEXT 1K8AU 3UPUA 4M7AC 1VQPT 1BIBA 1NPRA 4HT8A 4RCBA 4HKEA 3NTHA 3URGA 4XTWA 3C4SA 4F7UB 3EFSA 3JB9F 1N8RC 3N5BB 2RD1A 2ZZDA 3BFMA 4P5NA 3UDCA 3NTIA 1WJRA 5CQYA 5GAOl 2B8AA 3ME9A 1LOJA 5A0DA 1O75A 3QBYA 4XU2A 4FU6A 3MP1A 5EG2A 4J5YA 4PJOF 2P0KA 3JCMP 4B9WA 1YCYA 4QVZA 5CKHA 2K4YA 1KD1C 1YI2T 3CCMA 1VQ5T 4F7UF 5FU6B 2RI3A 3PIPA 4HT9A 2E12A 3VUZA 2DTOA 4KUIA 2QXFA 5IT9E 1HXDA 2JZ2A 2R58A 4BI8B 5DM7R 2K57A 3A8OB 3RKWA 2DTIA 2LNVA 5HK3A 3CC7T 2DIGA 3SD4A 2EQMA 3OS5A 2LT4A 2E10A 1VQLA 2RJEA 4M78C 1JBMA 1G3SA 1I8FA 5GANd 2QQBA 3EAEA 2LCLA 4UC4A 5GMKe 4GY5A 3MEUA 3JB9D 2DXUA 5GMKl 3RKYA 2JNGA 3DLMA 5LJ3h 2KQWA 4C0DB 1M90U 2LCCA 2MF2A 1X75C 4PJOA 3TU4K 4PJOD 4OB2B 3MEWA 5GAOn 4BI4A 2CKKA 4J6WA 2R5MA 4A4FA 3G6EA 4M75E 4DOVA 2RJDA 2VGMA 1Y96A 3GLXA 2DO3A 3QDRB 2DZCA 3QKJA 3E19A 2PUKB 2XDDA 3JCMb 2EQKA 5FU6C 3PIOA 3M54A 4C92F 3CCMT 4FM4B 2VXFA 3JB9G 3OY9A 2E1HA 3FDRA 2KDSA 2Y4YA 2WSFE 3X28B 1VQKT 4J8OA 1QVGS 5CKFA 4C8QA 3OYMA 2L8DA 4C8QD 4E7JA 3CD6A 2P0PA 3CMEA 4PJOG 5D6WA 5C0MA 5GANh 5LJ5d 1VIEA 1U1SA 3CBOA 2HQEA 4LDUA 1VQOA 1Q86U 2QQ9A 4X9DA 3VKIA 3L2WA 1BYMA 5CCAA 1KQSS 3E9FA 2KK4A 1VQLT 4C0GA 4E7HA 5KCOA 3QSUA 1N6AA 1G3WA 2CZ1B 2CYZB 3HFNA 1VIFA 3OS2A 1Q7YU 2MAMA 4FT2A 2K5LA 1KHCA 4OMFB 5GAMf 4C0DC 4N4HA 3OYBA 3DB3A 2QQRA 3DKMA 4OB3B 4C8QG 3L2VA 3INZA 5KCHA 2XD0A 1WGSA 4M7DF 2CZ7B 2EJGA 3E9GA 1W4SA 2EYQA 3G4ST 4IUVA 1I4K1 1NJIU 2JOYA 4OP0A 4ZTJA 2X4YA 4C92A 3G6ET 3HSBA 4C92D 3QG1A 2XKOC 4C5EA 1KQSA 2DAQA 1VQ7A 5DY9A 3QUIA 3OYAA 3CCRT 4O5VA 1MHNA 3X20B 3FC3A 5LJ5h 3KUFA 4NOYA 5CK9A 2RHYA 4BE2A 2FYKA 5GAN3 2LQ8A 3FJPA 3CD6T 2E5QA 5A0LA 3CMET 1VQ8A 2YLCA 3QZ5B 2RK2A 2JTFA 3SDZA 2EJFA 4EMKA 4C92G 2ZPIB 3LWHA 4L5GA 1M5Q1 4E7IA 1IZ6A 2OTJA 3QYGB 1Y07A 4FSXA 1HK9A 2F69A 3TREA 3QIIA 4XU1A 1BIAA 2X4WA 2XICA 4JRIA 4O6JA 4IURA 3JCMc 4M7DA 4M7DD 2L3RA 3QXEB 2P0QA 4QW2A 3JCMg 2ZPHB 3ER0A 2E65A 3LH0A 3ZFJA 3CPWA 1YIJA 3L42A 3RERA 4HA8A 4PJOB 3JCMf 5HK0A 2FHDA 3RMSA 1QVPA 4ZN3A 4WF2A 4OB0B 1V29B 3LYIA 2A3LA 2DVEA 2L89A 1K9MU 3GOXA 1WPYA 5A2QE 3MEVA 1M1KC 2VV5A 1H641 1PSEA 1Y96B 4HCZA 1KC8U 4M77E 4EMHA 3OYNA 1VQ6A 4M7AE 1VQ7T 4RCCA 4DQ2A 5GAMe 3S3NA 2CZ6B 5GAN6 1XQHA 3BY7A 5LJ3d 4EPCA 4M7DG 4BACA 2FB7A 4ZTFA 5CO7A 3L1AA 4J83A 4II1A 1KC8C 1UGQB 5D6YA 5IAYA 3M4GA 1G3TA 2BIVA 2NLUA 1FXXA 2D9TA 2VYTA 3MHXA 2ZCFB 3M5AA 1B34B 2RI5A 3M4YA 2GFAA 2LT1A 2D0QB 5I2SA 4OF1A 3V8JA 1YITA 2CS7A 3OA6A 2E6ZA 4JDSA 3WVEB 3OSVA 3JB9H 4YTLA 2H3JA 1KQ2A 4TVRA 4VUBA 5GANf 4ELYC 1YJWA 2F5TX 4C8QF 4M77A 3NFCA 2PVOB 2DD4A 1VQ9A 2E41A 4M7AA 2O4XA 2YHTA 3HRTA 3TCJA 3A8HB 2JN0A 2M1HA 1X01A 3GF5A 4XQ3A 1K73U 1K8AC 4PJOC 5D6XA 1YIJT 4ELZC 1M1FA 3LX7A 3M57A 1ZHIA 5FRNA 2LC4A 3H8ZA 3JRZA 4M78E 4FL6A 4MDWA 4M75F 3WXMB 3JCMX 3S3MA 3NTKA 4Y91A 1AHJB 1YJNA 3M53A 4LDWA 4C92B 3UWNA 1Q82U 4JRPA 2RHIA 1VQ6T 2LRQA 4J7IA 2OTLA 4X34A 1M8VA 2EQUA 3S3OA 2RO0A 4Q5WA 4F7UE 3QJYA 2DXTA 2PVGB 2CZ0B 1S72A 3CCQA 2E6NA 1VQMA 1UGSB 4C8QC 3JCMe 1JB0E 5GAN2 2VXEA 3P8BB 2KVQG 4E47A 3LWIA 4PJOE 2X4XA 4NL2A 3META 4BDZA 3SWNB 5LJ5f 5GAMj 3FIFA 4FIBA 1M4ZA 2IVWA 3A5ZB 3BDUA 3M59A 1YITT 2JVVA 2D6FA 4OVAA 1VQNA 1UGPB 4XTYA 2V8JA 3X24B 3ZEHA 3QPHA 3SFMA 1YJWT 2FVUA 3X25B 3HL8A 1VQ9T 4M7DB 4N4IA 1QW1A 3S6WA 2XDBA 1M1GA 3J80E 1UEBA 4J6YA 1YJ9A 3CMAA 3L2UA 4M75A 4BDYA 1W2BS 2MMPA 4M75D 4XU0A 5CVIA 5GAMg 4A4EA 2V8IA 1NPPA 2EAYA 5CR2A 1M90C 2F5KA 1G3YA 3CCJA 4JS4A 4C92C 5GANe 4R55A 1YJNT 2EFIA 4E7LA 2X35A 3CCLA 4A54A 5KH6A 3OBYA 3GPLA 3CPFA 4LDYA 1O9SA 4BY6B 2MWOA 4XK8E 1Q81U 1WNLA 4A53A 2JTMA 5GAN7 3CCEA 2KMTA 4XU3A 2ZPEB 5GMKj 1WQWA 2DTHA 4JRKA 3AHUA 3SB2A 4C5GA 3CCQT 3LLRA 3BDLA 4MZTA 1VQMT 2K3XA 2PVDB 5GAOp 4HCCA 3QHSA 2VUBA 4M75G 2ZGWA 1W2BA 2R5AA 3QJ6A 3C94A 3QZ9B 2JUFA 4RG2A 3G71A 3HHTB 2RH2A 4N0AC 3SWNC 2XG8D 3F70A 3JCMQ 3DLLA 4C5HA 4EMKC 4RG8A 4BUGA 5AYFA 3OYEA 3CCVA 4IUQA 3CBMA 1YHQA 3CPWS 2M16A 4GLKA 1VQNT 3O8VA 1Q86C 4KBMB 5LL6S 2LDMA 2QDYB 1KHIA 4M7DC 4L59A 2DXCA 3MEAA 2QTXA 3DB4A 1VQOT 5KE2A 1BI3A 2HQXA 4QQGA 4KUDK 3OB9A 2O4XB 1NZ9A 4X9CA 3VUBA 1QVFA 3PFSA 5FU7B 1YJ9T 3CMAT 2E70A 1Q7YC 4ZGDB 5LJ5e 1R8OB 2V8KA 1Y71A 2ZPGB 1BI2A 5GAN5 1N8RU 4PKCC 3V7RA 5J39A 3JCMW 2I2LA 1N9RA 3OYFA 3CC2A 4PL6A 5FRMA 3CCJT 1X6OA 3A8GB 4M77F 2QI2A 3P8DA 3VU3C 5LJ3g 2XU8A 3CCLT 1NJIC 4M7AF 4BY6C 2DZ9A 1EIFA 2RHXA 3HKSA 2E64A 3PT9A 5DLQE 5LJ3f 1FX7A 1KD1U 2EWNA 3CCET 4JUVA 3OYDA 4PLIA 3CCUA 1OI1A 3CC4A 4JRQA 5GANj 1U1TA 4FT4A 3OYIA 1IREB 5GAOr 3G71T 3JSCA 1YBYA 4IUPA 2PQWA 3OYHA 3CCVT 1PSFA 5C6SA 2MWPA 1DJ7B 2ZPBB 4C8QB 1WJSA 2PUOB 4PNOA 2WSEE 1YHQT 2HBPA 1TH7A 2X4JA 1VQ8T 1OYXA 5I2MA 4HCBA 1SSFA 3M9QA 2P4TA 1UGRB 3HP9A 2AHJB 4ZGJB 4JJNK 3RKXA 2KAFA 3R6OA 5GANg 2HD0A 3V8LA 5FU7C 3I56A 1OZ3A 2OTJT 5FLXE 2DD5A 2EQJA 2GQVA 4XAXB 4M75B 4D6WA 3VYGA 4QVCA 2DEQA 3JCMd 2EIFA 3HFOA 2K5IA 4B9XA 3OYLA 3CXCS 4M78F 4M77D 1WQ7A 3FEOA 3CC2T 2EJ9A 4M7AD 1MGQA 3QO3A 4Y28E 4IUTA 3MO8A 4DA4A 2LQKA 3MP8A 4C5IA 3KBGA 2YLBA 4C0ZA 5IN1A 4CI0C 5CKBA 2RI2A 2RHUA 3GNFB 4R56A 1K9MC 2M0OA 3OMCA 2DIQA 2DKGA 5LJ5j 5GAOq 1D3BA 2M9UA 3FRNA 4XTZA 4MMKA 2RJFA 1BI1A 4ZN1A 4RMOA 4J6XA 3PTAA 1VQ4A 2O01E 1VQKA 2K5FA 3OQ5A 5GMKh 3JAME 3CCUT 2DJZA 1JJ2S 1ZQ1A 3T9NA 4EMGA 3CC4T 3C12A 2XHCA 4M77G 3CXCA 4M7AG 1QP2A 3WVDB 2PU9B 3M58A 3V8KA 2K2VA 1Y7XA 2KY9A 3ASKA 1N27A 2KSSA 3JB9J 5LJ5g 5LJ3e 1GXIE 2DK3A 3RIRA 1I81A 4C8QE 4NS5A 3JCMh 4OGEA 3EFRA 4EMKB 5HY6A 4MZPA 3V7SA 4LDVA 1BKBA 3M55A 3JB9I 4M78A 3I56T 1H3ZA 2G3RA 3HPWA 1M9SA 4M78D 3HRSA 4M75C 4MZMA 3H6ZA 1JJ2A 4MMLA 5CKDA 3G4SA 2RB6A 3G7ZA 3ZBDA 2QQAA 4EDUA 3E1SA 3RUXA 1XTDA 4C0FA 1U8RA 2VC8A 4A4HA 1K73C 4E7KA 3OS0A 2BKDN 4F7UA 3RESA 3OS1A 4JLGA 2ZPFB 2LX9A 1N9SA 4OGCA 5KE3A 2YRVA 3J81E 1UB4A 1KG1A 4DOWA 2BUDA 2LTOA 4LD9K 2FL7A 2HNIA 1Q82C 3PMTA 4IKFA 3CCRA 4XTVA 2RM4A 1G5VA 3OMGA 2Y4XA 4XTUA 5CQXA 2XDPA 5L8RE 4XTXA 1VQ4T 4M78G 3PGGA 4ME7A 1VUBA 2LVMA 4QQ6A 3L2ZA 2OTLT 1LNXA 3C95A 1B34A 3MCAB 3V7CA 4C92E 5J3BA 5HKCA 2MI6A 1QVFS 1S72T 2HAXA 3I55A 3CCSA 2L5QA 2DPPB 4F7UG 5GAN4 3TEEA 3J7AF 3PNWC 2CGHA 3Q1JA 4LDXA 2QQSA 3A8LB 3LW5E 4KULA 4BI3A 3BW1A 1RL2A 3M56A 1RI0A 4NL3A 3PMIA 4A4GA 3GNGA 2QA4A 2R57A 5CAIA 2XK0A 3HRUA 1QVGA 4MDXA 3OSSC 3RMQA 4QQDA 4JS5A 5FROA 1XNIA 2GCXA 3VV0A 5GAOm 2QEXA 3VJPA 3QYHB 5A0GA 2GF7A 1LJOA 2WACA 5LJ3j 5GAMd 3OYCA 4M77B 1VQPA 1JRIA 1OZ2A 4M7AB 4QVDA 2GFUA 4M7DE 3FB9A 5J26A 1ZBXA 2IG0A 2XI9A 3P8HA 1M1KU 5GMKi 1P92A 3LGLA 2EKOA 3GIBA 2RJCA 5CIUA 3OW2S 2RK1A 3KXTA 1D3BB 2VGNA 5CKEA 3GP8A 4BE0A 4Z02A 1Q81C 3OYJA 1YI2A 5I21A 3L2RA 1VQ5A 5GAN8 1QP3A 3L2QA 3OYGA 2RHZA 4N0AA 3SWNA 4BD3A 4ATOA 4JLIA 4RKUE 4N4GA 3VYHB 3JCMJ 2WSCE 2K3YA 3FLGA 3I55T 1NE8A 2XIDA 2OAUA 3CCST 1I5LA 3MP6A 4PLLA 3CC7A 4V2SA 2A7YA 4IUUA 3UT1A 5GMKm 1KQ1A 2Y90A 4BE1A 3A8MB 3OBWA 4CRIA 5M9OA 3OW2A 4BB7A 1XOVA 5GAMh 4J7FA 2QA4T 3OYYA 4L6V5 3JCMV 3CEYA 2C06A 4M78B 3X26B 1BI0A 5DLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGF A;  3OQ5 A;  3OYA A;  4LD6 A;  1MHN A;  1WJQ A;  3OYK A;  3FC3 A;  3L2U A;  4BDY A;  3KUF A;  2RHY A;  4BE2 A;  3NTH A;  4A4E A;  2E5Q A;  3C4S A;  2F5K A;  2JTF A;  3ASK A;  1N27 A;  3NTI A;  1WJR A;  2EFI A;  4E7L A;  2B8A A;  2X35 A;  3ME9 A;  5KH6 A;  3QBY A;  4E7I A;  4FU6 A;  3MP1 A;  4NS5 A;  2P0K A;  2MWO A;  4B9W A;  3QII A;  2X4W A;  1H3Z A;  4QVZ A;  4IUR A;  2G3R A;  2L3R A;  4C5G A;  3H6Z A;  3BDL A;  3LLR A;  2RI3 A;  2K3X A;  4EDU A;  4QW2 A;  2R5A A;  3LH0 A;  3QJ6 A;  4RG2 A;  2JZ2 A;  2R58 A;  3L42 A;  4A4H A;  4E7K A;  3OS0 A;  3F70 A;  2BKD N;  4C5H A;  3OS1 A;  2FHD A;  3OYE A;  5KE3 A;  4IUQ A;  2YRV A;  3LYI A;  2L89 A;  2DIG A;  2BUD A;  2LTO A;  2M16 A;  3GOX A;  3O8V A;  3MEV A;  2EQM A;  3SD4 A;  2LDM A;  3PMT A;  4HCZ A;  4IKF A;  3OYN A;  2RJE A;  4L59 A;  3OMG A;  3MEA A;  1G5V A;  3S3N A;  3EAE A;  3DB4 A;  2XDP A;  4UC4 A;  5KE2 A;  2HQX A;  4QQG A;  3OB9 A;  2O4X B;  4BAC A;  4GY5 A;  2LVM A;  3MEU A;  3PFS A;  4QQ6 A;  4ZTF A;  4II1 A;  3DLM A;  5D6Y A;  2LCC A;  5IAY A;  5FRM A;  2BIV A;  2NLU A;  2D9T A;  2VYT A;  3OYF A;  4PL6 A;  3PNW C;  2RI5 A;  3MEW A;  2GFA A;  3Q1J A;  2CKK A;  2QQS A;  2R5M A;  3P8D A;  4A4F A;  3OA6 A;  2RJD A;  1RI0 A;  2RHX A;  3PMI A;  4A4G A;  3QKJ A;  2R57 A;  2XK0 A;  2EQK A;  3OYD A;  4QQD A;  2O4X A;  4PLI A;  5FRO A;  1XNI A;  1OI1 A;  3OY9 A;  3FDR A;  3OYI A;  2GF7 A;  2M1H A;  2WAC A;  3OYC A;  1OZ2 A;  5D6X A;  3OYM A;  2L8D A;  4IUP A;  4E7J A;  3LX7 A;  2PQW A;  2GFU A;  3OYH A;  5FRN A;  3H8Z A;  4FL6 A;  5D6W A;  5C0M A;  5C6S A;  2MWP A;  5J39 A;  3S3M A;  1WJS A;  3NTK A;  2IG0 A;  2HQE A;  3P8H A;  5J26 A;  3L2W A;  3UWN A;  3LGL A;  1OYX A;  2EKO A;  2RHI A;  1SSF A;  2RJC A;  3M9Q A;  2LRQ A;  5CIU A;  3E9F A;  4X34 A;  4E7H A;  2EQU A;  5KCO A;  3S3O A;  2RO0 A;  4Q5W A;  4BE0 A;  4Z02 A;  1OZ3 A;  3OYJ A;  3OS2 A;  3L2R A;  2E6N A;  1KHC A;  3L2Q A;  2EQJ A;  2RHZ A;  4BD3 A;  3OYG A;  4N4H A;  3OYB A;  3DB3 A;  2QQR A;  4N4G A;  4B9X A;  3OYL A;  2K3Y A;  5KCH A;  3L2V A;  1WGS A;  3FLG A;  3FEO A;  3E9G A;  2X4X A;  3MET A;  4BDZ A;  3MP6 A;  4PLL A;  4IUV A;  3S6W A;  4IUT A;  3MO8 A;  4IUU A;  3MP8 A;  4C5I A;  3UT1 A;  4BE1 A;  2X4Y A;  4OVA A;  4ZTJ A;  5IN1 A;  2RI2 A;  2RHU A;  4CRI A;  2M0O A;  3OMC A;  2DIQ A;  3ZEH A;  4C5E A;  5M9O A;  2DAQ A;  3CEY A;  2RJF A;  4N4I A; 
#chains in the Genus database with same CATH topology
 2AZV A;  2RA2 A;  1WJQ A;  2YUO A;  4M77 C;  4OB1 B;  4F04 B;  2QEX T;  3UPU A;  1NPR A;  4HKE A;  3C4S A;  4F7U B;  1M90 R;  1WHK A;  2RD1 A;  2ED1 A;  4P5N A;  1V1C A;  3UDC A;  3NTI A;  2C0I A;  3ME9 A;  4HVW A;  3MP1 A;  4J5Y A;  1ZUU A;  1YCY A;  1S72 Q;  5CKH A;  3CCQ Q;  4F7U F;  5FU6 B;  5IT9 E;  4KUI A;  2QXF A;  2X9H A;  2K57 A;  4PJL A;  2DTI A;  3PE0 A;  3CC7 T;  2RJE A;  5GAN d;  1TTH B;  5GMK e;  3MEU A;  3JB9 D;  2DXU A;  2JNG A;  3DLM A;  5KYU B;  5D7U A;  4PJO A;  3VS6 A;  4BI4 A;  4RUG A;  2VGM A;  1Y96 A;  2O31 A;  2XDD A;  2EQK A;  3PIO A;  3M54 A;  4C92 F;  3CCM T;  3X28 B;  4RTX A;  1SEM A;  2L8D A;  5D6W A;  1YHQ Q;  1VIE A;  1U1S A;  1Q86 U;  1BYM A;  1JU5 C;  1ABQ A;  2M51 A;  1KQS S;  3E9F A;  4PFO A;  1M8M A;  4E7H A;  1UHF A;  2V1R A;  2CZ1 B;  2CYZ B;  3HFN A;  3BE3 A;  2DYI A;  4LNP A;  1KHC A;  4Z8A A;  4N4H A;  2QQR A;  3DKM A;  2XD0 A;  5KCH A;  2CZ7 B;  2EYQ A;  3G4S T;  1I4K 1;  1NJI U;  1OX8 A;  2GNC A;  4ZTJ A;  1VQ5 Q;  3QG1 A;  2XKO C;  4C5E A;  1VQ7 A;  4CC4 B;  2LCS A;  1MHN A;  2VWF A;  3FC3 A;  2YLC A;  2JTF A;  4EMK A;  3VRZ A;  5HCK A;  1IXD A;  3TRE A;  3LH5 A;  1RUW A;  4XU1 A;  2X4W A;  3ULR B;  3JCM c;  4M7D D;  2YUP A;  4QW2 A;  3ER0 A;  3RER A;  4HA8 A;  4ZN3 A;  4WF2 A;  2DVE A;  4R0K A;  3GOX A;  1QKW A;  1M1K C;  2XMF A;  3OYN A;  1VQK Q;  1B7T A;  1M3B A;  3S3N A;  4Z88 A;  2FB7 A;  3U23 A;  4JZ3 A;  2X3X D;  2CP5 A;  2D9T A;  2RQV A;  1B34 B;  3M0Q A;  1PD1 A;  2LT1 A;  2D0Q B;  2LP5 A;  4OF1 A;  1C6V X;  2KNB B;  2E6Z A;  2Z0W A;  4M77 A;  2PVO B;  3HTR A;  4RTY A;  2YHT A;  2F1L A;  3HRT A;  3TCJ A;  1YP5 A;  4J9F A;  4GLM A;  1X01 A;  2VAS A;  1K8A C;  1TWB A;  1YIJ T;  1M1F A;  3LX7 A;  2LC4 A;  3H8Z A;  2DER A;  4FL6 A;  3REB B;  3WXM B;  3JCM X;  4Y91 A;  1AHJ B;  1SHG A;  4LDW A;  3UWN A;  3CCR Q;  1VQ6 T;  4J7I A;  5I11 A;  4X34 A;  4F7U E;  2DNU A;  1UTI A;  3QJY A;  2CSQ A;  2JM8 A;  1UGS B;  4C8Q C;  5GAN 2;  2HCK A;  2HQH A;  2KVQ G;  4E47 A;  2ZAE A;  2KRM A;  2X4X A;  2JW4 A;  3MET A;  1OPK A;  2DBM A;  3A5Z B;  2YUN A;  3ZEH A;  3X25 B;  3HL8 A;  5FWC A;  3EHR A;  1WFW A;  1W2B S;  4M75 D;  2MK5 A;  2HMA A;  1OU9 A;  1RAF B;  2V8I A;  2EAY A;  2F5K A;  1VQ7 Q;  1PWT A;  3CCJ A;  1N8R R;  5KYX B;  4C92 C;  1V76 A;  1JO8 A;  5KH6 A;  3CCL A;  3CPF A;  3QWX X;  4A53 A;  5GMK j;  2ZPE B;  2DTH A;  1X43 A;  3SB2 A;  1C0M A;  3CCQ T;  3LLR A;  1FMV A;  2PVD B;  5GAO p;  1MV0 B;  3C94 A;  1WHH A;  3HHT B;  3SWN C;  2CP6 A;  5AYF A;  3M0S A;  4A63 B;  4KBM B;  2LDM A;  2QDY B;  2K3B A;  4L59 A;  2QTX A;  2HQX A;  4QQG A;  3OB9 A;  2O4X B;  1NZ9 A;  1YWO A;  4X9C A;  3PFS A;  1YJ9 T;  1Q7Y C;  4ZGD B;  1R8O B;  1Y71 A;  3CC2 A;  1N9R A;  3OYF A;  1VA7 A;  1X6O A;  2L3S A;  3VU3 C;  2QI2 A;  5LJ3 g;  3QWY A;  4BY6 C;  2RHX A;  5DLQ E;  1KD1 U;  4JUV A;  3IQL A;  4X1V A;  4PLI A;  4RTW A;  1K9A A;  3CCU A;  3RR6 A;  1OI1 A;  5GAN j;  3OYI A;  1MMA A;  1G83 A;  1WIE A;  3G71 T;  1YBY A;  2KXC A;  4EIK A;  1YHQ T;  4PNO A;  4J9D A;  2X4J A;  4FYW B;  5I2M A;  1OUL A;  1TOV A;  1WXT A;  1KIK A;  3R6O A;  2MIO A;  4KRT A;  5GAN g;  3I56 A;  2COY A;  2OTJ T;  5FLX E;  2GQV A;  4XAX B;  1Z9Z A;  2EIF A;  4B9X A;  4M78 F;  2EJ9 A;  4M7A D;  1SRL A;  2CDT A;  2LQK A;  2COW A;  1K9M C;  4R56 A;  2DKG A;  3OW2 P;  2M9U A;  1KC8 C;  4MMK A;  2K5F A;  4LN2 A;  1JJ2 S;  2NUZ A;  4J9G A;  2FPF A;  4M77 G;  3CXC A;  2A37 A;  3M58 A;  1E7O A;  2K2V A;  1BK2 A;  1VQO Q;  1MND A;  2J6F A;  2DA9 A;  2A28 A;  4EMK B;  4MZP A;  1H3Z A;  3HRS A;  1AZG B;  3H6Z A;  3CCJ Q;  5CKD A;  3G4S A;  1ZLM A;  3RUX A;  4C0F A;  1U8R A;  3CCL Q;  1K73 C;  4A4H A;  2BKD N;  4F7U A;  2SRC A;  2DMO A;  2ZPF B;  1N9S A;  2YRV A;  1KG1 A;  2KBT A;  2FL7 A;  1Q82 C;  3PMT A;  3RNJ A;  4XTV A;  2Y4X A;  4WTO B;  1QWE A;  1VQ4 T;  3PGG A;  1ZSZ C;  4ME7 A;  1VUB A;  4QQ6 A;  2OTL T;  1LNX A;  3MCA B;  5IHN A;  5J3B A;  4DBR A;  1VQ8 Q;  1QVF S;  1NBE B;  3FJ5 A;  3CCS A;  1AOJ A;  5GAN 4;  1R0B G;  4KUL A;  1ZA1 B;  2XK0 A;  3CC2 Q;  4QQD A;  5FRO A;  2GCX A;  2P84 A;  3VV0 A;  5GAO m;  3QYH B;  2GF7 A;  2WAC A;  1OV3 A;  5GAM d;  4M77 B;  2GFU A;  4DEY A;  2A08 A;  3FB9 A;  1RLP C;  2XI9 A;  3P8H A;  2EYX A;  3KXT A;  4HVV A;  3TSZ A;  1Q81 C;  1XJW B;  5GAN 8;  4BD3 A;  3SWN A;  1F1B B;  1M2O A;  3FLG A;  3EGD A;  1IRX A;  1I5L A;  3MP6 A;  3I56 Q;  5GMK m;  4BE1 A;  1H92 A;  3VRY A;  3OBW A;  5M9O A;  1QWF A;  1W1F A;  4J7F A;  2QA4 T;  3CEY A;  1UHC A;  3LGF A;  2K79 A;  3R6N A;  4HCC A;  1AD5 A;  1U3O A;  1VQP T;  2HKQ B;  3URG A;  4XTW A;  3JB9 F;  2I0N A;  3N5B B;  2NUT B;  2KEA A;  2ESW A;  2B8A A;  1LOJ A;  5A0D A;  2EYW A;  2QYZ A;  2P0K A;  3JCM P;  1K0S A;  4QVZ A;  1D1A A;  2K4Y A;  2F2X A;  1YI2 T;  3PIP A;  1T3L A;  2RI3 A;  1AEY A;  4BI8 B;  1GBQ A;  2R58 A;  2QGG A;  1D0Y A;  2LNV A;  2DIG A;  4J9B A;  2E10 A;  1VQL A;  4M78 C;  4E6R A;  3EAE A;  3AT1 B;  1ZUY A;  1FYN A;  1SSH A;  5LJ3 h;  2DRK A;  1GRI A;  1M90 U;  2HZY A;  3TU4 K;  4PJO D;  4OB2 B;  3MEW A;  2LZ6 B;  4J6W A;  2RJD A;  1PRL C;  3GLX A;  2PUK B;  3JCM b;  3CCS Q;  4FM4 B;  3I35 A;  2ROL A;  5CKF A;  2A0F B;  1TUD A;  3OYM A;  2P0P A;  3CME A;  1PCX A;  4AFQ C;  2J7I A;  2QGF B;  5GAN h;  5LJ5 d;  1NG2 A;  3CBO A;  4M4Z A;  5CCA A;  1GL5 A;  3VS3 A;  1SG5 A;  1UFF A;  1VYT A;  1VIF A;  4B6M A;  2MAM A;  4OMF B;  2KRS A;  4C0D C;  4OB3 B;  4C8Q G;  3L2V A;  1UG1 A;  2ED0 A;  3INZ A;  4M7D F;  2EW3 A;  1W70 A;  2JOY A;  2X4Y A;  3G6E T;  1MMD A;  2BTT A;  3M0P A;  3CC4 Q;  2EYZ A;  4O5V A;  2VKN A;  3E2U A;  5CK9 A;  4FCY A;  2LQ8 A;  3CD6 T;  5A0L A;  3QZ5 B;  2RK2 A;  2EYY A;  2EJF A;  3EG3 A;  4C92 G;  2J6K A;  1M5Q 1;  4JPB W;  3VS2 A;  4F17 A;  2OTJ A;  1Y07 A;  2DE0 X;  1BIA A;  4JRI A;  2XIC A;  2DX1 A;  1NLO C;  1NLP C;  2GBQ A;  3LH0 A;  2E65 A;  1IGQ A;  3RMS A;  5KYX A;  1V29 B;  3PVL A;  4E2F B;  2KGT A;  3MEV A;  1YCS B;  1H64 1;  4M77 E;  3VS7 A;  2YXY A;  2BE7 D;  4RCC A;  2CZ6 B;  2O9S A;  5GAN 6;  5LJ3 d;  1ZBJ A;  1QCN A;  1VOM A;  2NYS A;  3REA B;  2VB6 A;  2M02 A;  5D6Y A;  3M4G A;  1G3T A;  2NLU A;  1VQL Q;  2VYT A;  3MHX A;  3M5A A;  2RI5 A;  2CSI A;  2GFA A;  3KFV A;  3MJX A;  1YIT A;  2RQT A;  2CS7 A;  2YWW A;  3OA6 A;  1A0N B;  3EGU A;  3EGX B;  2P4R A;  2YT6 A;  3OSV A;  4YTL A;  2H3J A;  1RAE B;  1YJW A;  4C8Q F;  1VQ9 A;  2O4X A;  3H0H A;  3A8H B;  5FW9 A;  2JN0 A;  3GF5 A;  1PC0 A;  3EG1 A;  4RTT A;  2JS0 A;  3NGP A;  1ZHI A;  5FRN A;  2LJ1 A;  1AVZ C;  4M75 F;  1D0Z A;  3M53 A;  4C92 B;  2OTL A;  1M8V A;  2EQU A;  3S3O A;  4Q5W A;  3CME Q;  2D8J A;  4PJM A;  1VQM A;  2IPO B;  2CUD A;  1JEG A;  3JCM e;  2JMC A;  5GJW B;  4NL2 A;  4BDZ A;  3SWN B;  5GAM j;  3FIF A;  4FIB A;  1M4Z A;  3BDU A;  2X51 A;  4AFU C;  3EGD B;  1UGP B;  1ABO A;  1T3S A;  3X24 B;  3QPH A;  3SFM A;  1SHF A;  4N4I A;  1M1G A;  3J80 E;  1E6G A;  2M0Y A;  1T0J A;  3CMA A;  1RAA B;  3L2U A;  1M30 A;  4BDY A;  2MMP A;  5CVI A;  5GAM g;  2G6F X;  4A4E A;  4FW2 A;  3TSW A;  4JS4 A;  5GAN e;  1YJN T;  4A54 A;  3OBY A;  3GPL A;  2QDL A;  4LDY A;  4BY6 B;  3CCE A;  1GFD A;  2EGA A;  3AHU A;  4XU3 A;  3BDL A;  4MZT A;  3QHS A;  2ZGW A;  2R5A A;  1VYV A;  1OQK A;  2RH2 A;  2XG8 D;  4C5H A;  1K1Z A;  1AWW A;  3ZL7 C;  3CCV A;  3UAT A;  3CPW S;  2M16 A;  1VQN T;  1Q86 C;  1KHI A;  2LQN A;  4M7D C;  1WXB A;  1S1N A;  2C0O A;  3DB4 A;  4PFP A;  1X6G A;  2V1Q A;  4AFS C;  1N8R U;  5FRM A;  4DEX A;  3JCM W;  4M7A F;  1YFN A;  1NJI C;  4FSS A;  2D0N A;  2EQI A;  1Y57 A;  1YIT Q;  6AT1 B;  3G1J A;  1YJW Q;  2HL5 C;  2ZPB B;  1VQ9 Q;  1WJS A;  2PUO B;  1UUE A;  2WSE E;  2HBP A;  1WHJ A;  1OYX A;  4HCB A;  3M9Q A;  2W0Z A;  2HD0 A;  4GBQ A;  5FU7 C;  2DF6 A;  5KYW B;  2DEQ A;  3CXC S;  4F14 A;  3OYL A;  1WA7 A;  4IUT A;  4DA4 A;  3MP8 A;  4C5I A;  4KH1 B;  3KBG A;  5IN1 A;  1VQM Q;  2RI2 A;  3OMC A;  1SRM A;  2DIQ A;  5LJ5 j;  5GAO q;  1WZO A;  2RJF A;  4J6X A;  2O01 E;  3CC4 T;  1ZSZ B;  2XHC A;  2PU9 B;  1JXM A;  5LJ5 g;  1GXI E;  3CMA Q;  2LJ0 A;  1I81 A;  4C8Q E;  1PKT A;  3EFR A;  3NPF A;  3V7S A;  3HPW A;  1M9S A;  4M75 C;  4J9I A;  4MML A;  2QK0 A;  2KRO A;  3G7Z A;  4EDU A;  2VC8 A;  4E7K A;  2EGC A;  3OS0 A;  3RES A;  3OS1 A;  2LX9 A;  4OGC A;  2NUT A;  3SHW A;  5KE3 A;  3CCE Q;  1UB4 A;  4IIO A;  2LTO A;  1M1K R;  2RM4 A;  1PHT A;  1M3C A;  4XTX A;  4M78 G;  2CH4 W;  2DEU A;  2FG0 A;  2YDL A;  2IIM A;  3L2Z A;  3C95 A;  4C92 E;  4J9H A;  5HKC A;  2V26 A;  1S72 T;  3I55 A;  2DL4 A;  2EBP A;  1TU0 B;  2ATC B;  3PNW C;  2CGH A;  1I07 A;  3Q1J A;  3LW5 E;  2DJQ A;  1TSF A;  3PMI A;  2DBK A;  3GNG A;  2R57 A;  1D1B A;  3OSS C;  3RMQ A;  2B86 A;  4JS5 A;  1RAH B;  2QEX A;  3VJP A;  5LJ3 j;  1K8A R;  4HVU A;  1JRI A;  4QVD A;  2HDA A;  5J26 A;  1D09 B;  2EKO A;  3GIB A;  5CIU A;  4ESR A;  4CC7 A;  5CKE A;  1CKB A;  2AIR B;  3L2R A;  3L2Q A;  3OYG A;  4JLI A;  4N4G A;  2WSC E;  2GGR A;  2OAU A;  4PLL A;  3CC7 A;  4V2S A;  1JQQ A;  4IUU A;  1KQ1 A;  3A8M B;  3OW2 A;  4AFZ C;  5GAM h;  4FW1 A;  2SEM A;  3JCM V;  1KJW A;  4M78 B;  5DLO A;  2DXB A;  2HKN A;  1G2B A;  4LD6 A;  2YRD A;  1MMG A;  4M7A C;  1BIB A;  2E5K A;  4HT8 A;  8ATC B;  3NTH A;  3I5S A;  2FO0 A;  1RAG B;  2GTJ A;  3BFM A;  1IO6 A;  1WJR A;  1O75 A;  3QBY A;  4LUE A;  4XU2 A;  4PJO F;  1YWP A;  3SEM A;  5IXF A;  1KD1 C;  3CCM A;  1VQ5 T;  2RQW A;  2DTO A;  1HXD A;  2JZ2 A;  3EG2 A;  5HK3 A;  2L0A A;  7AT1 B;  2EQM A;  1M3A A;  1JBM A;  1G3S A;  2QQB A;  2LCL A;  1BB9 A;  4UC4 A;  2KI7 A;  4GY5 A;  1Q7Y R;  3RKY A;  2KQW A;  4C0D B;  2LCC A;  2MF2 A;  2JMA A;  5GAO n;  1WHG A;  2CKK A;  4DOV A;  2DO3 A;  3QKJ A;  3E19 A;  3I55 Q;  2EKH A;  3JB9 G;  3FDR A;  2KDS A;  1VQK T;  1QVG S;  4C8Q A;  4OMP A;  3MKD A;  3UF4 A;  5C0M A;  4J9C A;  4LDU A;  2HQE A;  1R0C B;  3L2W A;  4WCI A;  2PZ1 A;  3EGX A;  2KK4 A;  4C0G A;  5KCO A;  3QSU A;  1N6A A;  2D8H A;  1G3W A;  2K5L A;  2H3E B;  3OYB A;  4KGV B;  3DB3 A;  2RF0 A;  1W4S A;  4OML A;  3EG0 A;  4C92 A;  2QAS A;  1K9M R;  1NYF A;  5DY9 A;  1KC8 R;  3CCU Q;  3OYA A;  3CCR T;  3CC7 Q;  5LJ5 h;  4FYV B;  1AWJ A;  5GAN 3;  1K0X A;  2E5Q A;  2MOX A;  2DYB A;  2CP7 A;  2QTV A;  2ZPI B;  3LWH A;  4L5G A;  1T0H A;  4E7I A;  1IZ6 A;  4IIM A;  3QYG B;  4FSX A;  3QII A;  2FPD A;  4O6J A;  4ANJ A;  2KYM A;  3QXE B;  1RI9 A;  1EZZ B;  1HSQ A;  1U5S A;  2AKK A;  2E3H A;  2FRW A;  2MPX C;  1W2B P;  1YIJ A;  3A98 A;  1K73 R;  3JCM f;  1M2V B;  1QVP A;  2A3L A;  2L89 A;  1WPY A;  1PSE A;  1VQ6 A;  1BBZ A;  4EMH A;  1Q82 R;  2CP3 A;  1OEB A;  1VQ7 T;  4DQ2 A;  1I1J A;  5GAM e;  3MPU B;  4M7D G;  3BY7 A;  4EPC A;  4BAC A;  5CO7 A;  3L1A A;  4J83 A;  5IAY A;  2BIV A;  1SPK A;  2ZCF B;  3TVT A;  5FWB A;  5I2S A;  3V8J A;  2CUB A;  4TVR A;  5GAN f;  4ELY C;  1R77 A;  2F5T X;  2DD4 A;  2E41 A;  4M7A A;  2RNA A;  3G4S Q;  1HD3 A;  4XQ3 A;  4PJO C;  5D6X A;  2O88 A;  4LE9 A;  1TXQ A;  3JRZ A;  4M78 E;  4MDW A;  2HSE B;  3NTK A;  3NHN A;  4D8D A;  4JRP A;  2RHI A;  3EH1 A;  2RO0 A;  5GJV B;  1S72 A;  1Q81 R;  3CCQ A;  2HEQ A;  2E3I A;  3P8B B;  2CT3 A;  1GBR A;  1X6B A;  1OOT A;  3LWI A;  2IVW A;  2YRC A;  2DIL A;  2D6F A;  5IH2 A;  4Y92 A;  1CKA A;  2V8J A;  1B07 A;  4M7D B;  1QMC A;  5KYW A;  4J6Y A;  2KT8 A;  1YJ9 A;  2YSQ A;  1RAD B;  3THK A;  4XU0 A;  1NPP A;  1M90 C;  2CH4 A;  1G3Y A;  3JV3 A;  4R55 A;  1KFZ A;  4D8K A;  2EFI A;  2X35 A;  4OMN A;  2MWO A;  4XK8 E;  2KMT A;  1WQW A;  1QLY A;  4C5G A;  1ZSZ A;  1JJ2 P;  4M75 G;  4RG2 A;  3G71 A;  2NUP B;  3F70 A;  3JCM Q;  4EMK C;  4RG8 A;  5L23 A;  3CBM A;  1YHQ A;  2JT4 A;  4GLK A;  3O8V A;  3MEA A;  2QG9 B;  1VQO T;  2KXD A;  5KE2 A;  1YIJ Q;  1QVF A;  1H8K A;  3VUB A;  5FU7 B;  4HCK A;  5LJ5 e;  3UA6 A;  2CT4 A;  2GQI A;  1BI2 A;  5GAN 5;  1VQ6 Q;  3V7R A;  1PD0 A;  2I2L A;  4PL6 A;  3CCJ T;  3A8G B;  3P8D A;  2XU8 A;  3CCL T;  1EIF A;  2E64 A;  3PT9 A;  2EWN A;  3VS4 A;  2KT1 A;  4JRQ A;  2OI3 A;  1U1T A;  1IRE B;  2DRM A;  3JSC A;  4CC2 A;  2PQW A;  3OYH A;  1QVF P;  5C6S A;  4C8Q B;  1TH7 A;  4ORZ A;  1VQ8 T;  1UGR B;  4JJN K;  2KAF A;  2HL3 A;  2KR3 A;  1AWO A;  1UJ0 A;  4M75 B;  4D6W A;  3VYG A;  3JCM d;  4M77 D;  1WQ7 A;  3CC2 T;  1MGQ A;  4Y28 E;  1YN8 A;  2YLB A;  3I5R A;  4C0Z A;  2M0O A;  1GFC A;  4XTZ A;  3FRN A;  3PTA A;  1PG5 B;  1BI1 A;  1VQK A;  1VQ4 A;  1MUZ A;  3OQ5 A;  3JAM E;  3CCU T;  3T9N A;  4DBQ A;  4OMO A;  4M7A G;  4QKU A;  2J6O A;  3V8K A;  1Y7X A;  2KY9 A;  3ASK A;  4KH0 B;  5LJ3 e;  1YJ9 Q;  1N5Z A;  4CC3 A;  2RQU A;  4OGE A;  5HY6 A;  1BKB A;  3M55 A;  3EH2 A;  4M78 A;  3I56 T;  2G3R A;  1PKS A;  4JZ4 A;  3ZBD A;  1XTD A;  4JLG A;  2OJ2 A;  1SF9 A;  3J81 E;  3PVQ A;  4DOW A;  2BUD A;  1ZSG A;  4LD9 K;  2RPN A;  2HNI A;  4IKF A;  1LCK A;  2ECZ A;  3CCR A;  1IB8 A;  3G71 Q;  2XDP A;  5L8R E;  1NEB A;  4OMQ A;  3I9Q A;  2JJ9 A;  2QAZ A;  2HAX A;  2L5Q A;  2F2V A;  2DPP B;  3TEE A;  1GCQ C;  2ABL A;  4LDX A;  2QQS A;  3A8L B;  4AG2 C;  1X27 A;  2CP2 A;  3BW1 A;  2OTJ Q;  2OX7 A;  4NL3 A;  2AKL A;  2QA4 A;  3HRU A;  4MDX A;  2DET A;  3H9N A;  1LJO A;  1VQP A;  3H0I A;  1OZ2 A;  4M7A B;  2H8H A;  4RTZ A;  2J06 A;  4M7D E;  2RQR A;  1WHM A;  1LPL A;  2CP0 A;  1ZBX A;  1M1K U;  1H3H A;  5GMK i;  1P92 A;  3OW2 S;  2RK1 A;  2W10 A;  2BZY A;  1D3B B;  4JJC A;  3GP8 A;  4BE0 A;  4J9E A;  4Z02 A;  3OYJ A;  1YI2 A;  5I21 A;  1UDL A;  2MCN A;  5IHI A;  4RKU E;  3JCM J;  1QCO A;  4PJN A;  3CCS T;  2XID A;  2A7Y A;  3UT1 A;  1TS9 A;  4BB7 A;  1XOV A;  5KYY B;  2RN8 A;  3X26 B;  1BI0 A;  4A4K A;  1FWZ A;  4ZGE B;  1TUG B;  1K8A U;  3VS1 A;  3OYK A;  3CBP A;  4KT0 E;  4RCB A;  4KGZ B;  3EFS A;  1N8R C;  2ZZD A;  1VQ4 Q;  3VS0 A;  5CQY A;  5IHK A;  5GAO l;  2OTL Q;  1WLP B;  4FU6 A;  2HBW A;  5EG2 A;  4B9W A;  4RTU A;  4FYX B;  1YNZ A;  1MMN A;  4HT9 A;  2VVK A;  2E12 A;  3VUZ A;  4PJJ A;  1IHW A;  3O5Z A;  5DM7 R;  3A8O B;  3RKW A;  1WHL A;  1IGU A;  2ROT A;  4DBH A;  3SD4 A;  3OS5 A;  1Q86 R;  2LT4 A;  1I8F A;  4LXC A;  3EFO B;  5IXB A;  5GMK l;  3NMZ C;  1WX6 A;  2BZ8 A;  1X75 C;  1M2V A;  1TUC A;  4F16 A;  2R5M A;  2FRY A;  4A4F A;  3G6E A;  2DL8 A;  4M75 E;  1K76 A;  1NJI R;  3QDR B;  1ACM B;  2DZC A;  2O9V A;  2EVR A;  5FU6 C;  2VXF A;  1UE9 A;  3OY9 A;  2E1H A;  2JM9 A;  2Y4Y A;  2WSF E;  4J8O A;  2ENM A;  2FPE A;  4C8Q D;  3CD6 A;  4E7J A;  4PJO G;  3CCV Q;  4LUD A;  2QA4 Q;  5EC7 A;  1LVK A;  2EGE A;  2BE9 B;  1VQO A;  2QQ9 A;  4X9D A;  3VKI A;  1AWX A;  1QQJ A;  1VQL T;  2LJ3 A;  1VQP Q;  1ZUK A;  3OS2 A;  1Q7Y U;  4FT2 A;  2L3P A;  1BCM A;  5GAM f;  3A1P A;  2AZS A;  1Y0M A;  1WGS A;  2EJG A;  3E9G A;  1X69 A;  2JTE A;  2GTO A;  4HXJ A;  2COZ A;  4IUV A;  1RAI B;  2MYS A;  4OP0 A;  1YI2 Q;  3HSB A;  5I22 A;  1OX9 A;  2AT1 B;  4C92 D;  1UGV A;  1KQS A;  2DAQ A;  2L2P A;  3CQT A;  3QUI A;  1W6X A;  1KK7 A;  3X20 B;  3KUF A;  4NOY A;  2RHY A;  3VS5 A;  4BE2 A;  2FYK A;  3FJP A;  1GCQ A;  3CME T;  1VQ8 A;  2FEI A;  2C0T A;  2A36 A;  3SDZ A;  3TQ7 P;  2CRE A;  1UEC A;  1HK9 A;  2F69 A;  2HSP A;  4M7D A;  4IUR A;  2L3R A;  3C0C A;  1HJD A;  2P0Q A;  1KQS P;  3JCM g;  2ZPH B;  3ZFJ A;  3CPW A;  2FZG B;  3L42 A;  4PJO B;  9ATC B;  5HK0 A;  2FHD A;  2DVJ A;  4OB0 B;  1AZE A;  3LYI A;  1K9M U;  1NM7 A;  5A2Q E;  2VV5 A;  1Y96 B;  3H0F A;  4HCZ A;  4AMC A;  1KC8 U;  4M7A E;  2RMO A;  1I0C A;  1XQH A;  4ZTF A;  4II1 A;  2LNH B;  1UGQ B;  3EG9 A;  3M0U A;  2NUP A;  1FXX A;  2DL5 A;  3D7S B;  3M4Y A;  1D0X A;  4JDS A;  3WVE B;  3CPW P;  3JB9 H;  1KQ2 A;  4VUB A;  1SKU B;  3NFC A;  2K9G A;  2AK5 A;  8AT1 B;  2M1H A;  2KRN A;  1K73 U;  3G6E Q;  2JS2 A;  4ELZ C;  3M57 A;  1BU1 A;  3S3M A;  2FZK B;  1YJN A;  1MV3 A;  1Q82 U;  2LRQ A;  1I5O B;  3CD6 Q;  2DXT A;  2PVG B;  2CZ0 B;  2E6N A;  1JB0 E;  1J3T A;  4PFZ A;  2VXE A;  5AT1 B;  1IHV A;  5LJ5 f;  1TG0 A;  2DM1 A;  3M59 A;  1YIT T;  2JVV A;  4OVA A;  1VQN A;  1KSW A;  4XTY A;  1YJW T;  2FVU A;  1VQ9 T;  3S6W A;  1QW1 A;  4E7S A;  2XDB A;  1UEB A;  4JJD A;  2QEX Q;  4M75 A;  1RAB B;  5CR2 A;  3M0T A;  3CXC P;  4JJB A;  4E7L A;  1B3Q A;  1O9S A;  1Q81 U;  1WNL A;  2JTM A;  5GAN 7;  4JRK A;  1KD1 R;  1VQM T;  2K3X A;  2VUB A;  1W2B A;  3QJ6 A;  3QZ9 B;  2JUF A;  4N0A C;  1QCF A;  3DLL A;  4FYY B;  4BUG A;  1GCP A;  3OYE A;  4IUQ A;  5LL6 S;  3GBQ A;  3M0R A;  2DXC A;  5ECA A;  5KYU A;  1BI3 A;  4KUD K;  4ZNX A;  3CMA T;  2E70 A;  1Q95 G;  3RBB B;  2V8K A;  2ZPG B;  1WI7 A;  1FMW A;  4PKC C;  2X3W D;  2LMJ A;  2EPD A;  2K6D A;  2PNI A;  1MNE A;  4M77 F;  1OU8 A;  4RTV A;  1ZX6 A;  2DZ9 A;  1G8X A;  3HKS A;  1UJY A;  1FX7 A;  5LJ3 f;  3CCE T;  1E6H A;  1Z9Q A;  4AT1 B;  2LX7 A;  1CSK A;  3OYD A;  3CCM Q;  4E7Z A;  3CC4 A;  4FT4 A;  2DL3 A;  5GAO r;  1NYG A;  4IUP A;  1QKX A;  3CCV T;  1PSF A;  5J39 A;  2MWP A;  1DJ7 B;  1M27 C;  1SSF A;  1ARK A;  2P4T A;  4ZGJ B;  3HP9 A;  2AHJ B;  2DLP A;  1VYU A;  3RKX A;  1X2Q A;  3V8L A;  1OZ3 A;  1WXU A;  2LQW A;  2DD5 A;  2EQJ A;  4Z89 A;  4QVC A;  1YJN Q;  3H41 A;  3HFO A;  2K5I A;  3FEO A;  3QO3 A;  1OPL A;  3MO8 A;  1BCO A;  4CI0 C;  5CKB A;  2RHU A;  3GNF B;  1D3B A;  2KYB A;  4ZN1 A;  4PJO E;  4RMO A;  5GMK h;  2DJZ A;  1ZQ1 A;  4EMG A;  5KYN A;  2F2W A;  3C12 A;  1VQN Q;  4OMM A;  1QP2 A;  3WVD B;  4DBF A;  1N27 A;  2KSS A;  3JB9 J;  2DK3 A;  3RIR A;  1K4U S;  4NS5 A;  3JCM h;  1PM3 A;  5KYY A;  2KE9 A;  4LDV A;  3JB9 I;  3UA7 A;  4M78 D;  4MZM A;  2D1X A;  1JJ2 A;  2RB6 A;  2QQA A;  1X2K A;  2BZX A;  3E1S A;  4K11 A;  1C1A A;  3EHQ A;  1D1C A;  2JXB A;  1G5V A;  3OMG A;  1ZA2 B;  4XTU A;  5CQX A;  4QT7 A;  1FMK A;  2LVM A;  3V7C A;  1B34 A;  2YUQ A;  2MI6 A;  1RAC B;  4F7U G;  3J7A F;  2L3Q A;  2DL7 A;  1NEG A;  3EG9 B;  4BI3 A;  1RL2 A;  3M56 A;  1RI0 A;  4A4G A;  5CAI A;  1QVG A;  3EFO A;  1XNI A;  4AG1 C;  4PK4 A;  5A0G A;  2J05 A;  3OYC A;  1EX4 A;  3QDF A;  1PNJ A;  2K7A A;  1RLQ C;  2IG0 A;  1PRM C;  1AT1 B;  3LGL A;  2OAW A;  2RJC A;  2PTK A;  1WYX A;  2VGN A;  1WDX A;  2E4H A;  2K2M A;  4KGX B;  1EFN A;  2DFU A;  1VQ5 A;  1QP3 A;  2RHZ A;  4N0A A;  4ATO A;  1JXO A;  3VYH B;  1U06 A;  1HYO A;  2K3Y A;  1QVG P;  3I55 T;  1NE8 A;  2O2O A;  2Y90 A;  3RDV A;  4CRI A;  2NWM A;  3OYY A;  2FZC B;  4L6V 5;  2C06 A; 
#chains in the Genus database with same CATH homology
 3LGF A;  4A4K A;  2DXB A;  1FWZ A;  4LD6 A;  4ZGE B;  2RA2 A;  1WJQ A;  3OYK A;  4M77 C;  3CBP A;  4KT0 E;  4OB1 B;  2QEX T;  1K8A U;  3UPU A;  4M7A C;  1VQP T;  1BIB A;  1NPR A;  4HT8 A;  4RCB A;  4HKE A;  3NTH A;  3URG A;  4XTW A;  3C4S A;  4F7U B;  3EFS A;  3JB9 F;  1N8R C;  3N5B B;  2RD1 A;  2ZZD A;  3BFM A;  4P5N A;  3UDC A;  3NTI A;  1WJR A;  5CQY A;  5GAO l;  2B8A A;  3ME9 A;  1LOJ A;  5A0D A;  1O75 A;  3QBY A;  4XU2 A;  4FU6 A;  3MP1 A;  5EG2 A;  4J5Y A;  4PJO F;  2P0K A;  3JCM P;  4B9W A;  1YCY A;  4QVZ A;  5CKH A;  2K4Y A;  1KD1 C;  1YI2 T;  3CCM A;  1VQ5 T;  4F7U F;  5FU6 B;  2RI3 A;  3PIP A;  4HT9 A;  2E12 A;  3VUZ A;  2DTO A;  4KUI A;  2QXF A;  5IT9 E;  1HXD A;  2JZ2 A;  2R58 A;  4BI8 B;  5DM7 R;  2K57 A;  3A8O B;  3RKW A;  2DTI A;  2LNV A;  5HK3 A;  3CC7 T;  2DIG A;  3SD4 A;  2EQM A;  3OS5 A;  2LT4 A;  2E10 A;  1VQL A;  2RJE A;  4M78 C;  1JBM A;  1G3S A;  1I8F A;  5GAN d;  2QQB A;  3EAE A;  2LCL A;  4UC4 A;  5GMK e;  4GY5 A;  3MEU A;  3JB9 D;  2DXU A;  5GMK l;  3RKY A;  2JNG A;  3DLM A;  5LJ3 h;  2KQW A;  4C0D B;  1M90 U;  2LCC A;  2MF2 A;  1X75 C;  4PJO A;  3TU4 K;  4PJO D;  4OB2 B;  3MEW A;  5GAO n;  4BI4 A;  2CKK A;  4J6W A;  2R5M A;  4A4F A;  3G6E A;  4M75 E;  4DOV A;  2RJD A;  2VGM A;  1Y96 A;  3GLX A;  2DO3 A;  3QDR B;  2DZC A;  3QKJ A;  3E19 A;  2PUK B;  2XDD A;  3JCM b;  2EQK A;  5FU6 C;  3PIO A;  3M54 A;  4C92 F;  3CCM T;  4FM4 B;  2VXF A;  3JB9 G;  3OY9 A;  2E1H A;  3FDR A;  2KDS A;  2Y4Y A;  2WSF E;  3X28 B;  1VQK T;  4J8O A;  1QVG S;  5CKF A;  4C8Q A;  3OYM A;  2L8D A;  4C8Q D;  4E7J A;  3CD6 A;  2P0P A;  3CME A;  4PJO G;  5D6W A;  5C0M A;  5GAN h;  5LJ5 d;  1VIE A;  1U1S A;  3CBO A;  2HQE A;  4LDU A;  1VQO A;  1Q86 U;  2QQ9 A;  4X9D A;  3VKI A;  3L2W A;  1BYM A;  5CCA A;  1KQS S;  3E9F A;  2KK4 A;  1VQL T;  4C0G A;  4E7H A;  5KCO A;  3QSU A;  1N6A A;  1G3W A;  2CZ1 B;  2CYZ B;  3HFN A;  1VIF A;  3OS2 A;  1Q7Y U;  2MAM A;  4FT2 A;  2K5L A;  1KHC A;  4OMF B;  5GAM f;  4C0D C;  4N4H A;  3OYB A;  3DB3 A;  2QQR A;  3DKM A;  4OB3 B;  4C8Q G;  3L2V A;  3INZ A;  5KCH A;  2XD0 A;  1WGS A;  4M7D F;  2CZ7 B;  2EJG A;  3E9G A;  1W4S A;  2EYQ A;  3G4S T;  4IUV A;  1I4K 1;  1NJI U;  2JOY A;  4OP0 A;  4ZTJ A;  2X4Y A;  4C92 A;  3G6E T;  3HSB A;  4C92 D;  3QG1 A;  2XKO C;  4C5E A;  1KQS A;  2DAQ A;  1VQ7 A;  5DY9 A;  3QUI A;  3OYA A;  3CCR T;  4O5V A;  1MHN A;  3X20 B;  3FC3 A;  5LJ5 h;  3KUF A;  4NOY A;  5CK9 A;  2RHY A;  4BE2 A;  2FYK A;  5GAN 3;  2LQ8 A;  3FJP A;  3CD6 T;  2E5Q A;  5A0L A;  3CME T;  1VQ8 A;  2YLC A;  3QZ5 B;  2RK2 A;  2JTF A;  3SDZ A;  2EJF A;  4EMK A;  4C92 G;  2ZPI B;  3LWH A;  4L5G A;  1M5Q 1;  4E7I A;  1IZ6 A;  2OTJ A;  3QYG B;  1Y07 A;  4FSX A;  1HK9 A;  2F69 A;  3TRE A;  3QII A;  4XU1 A;  1BIA A;  2X4W A;  2XIC A;  4JRI A;  4O6J A;  4IUR A;  3JCM c;  4M7D A;  4M7D D;  2L3R A;  3QXE B;  2P0Q A;  4QW2 A;  3JCM g;  2ZPH B;  3ER0 A;  2E65 A;  3LH0 A;  3ZFJ A;  3CPW A;  1YIJ A;  3L42 A;  3RER A;  4HA8 A;  4PJO B;  3JCM f;  5HK0 A;  2FHD A;  3RMS A;  1QVP A;  4ZN3 A;  4WF2 A;  4OB0 B;  1V29 B;  3LYI A;  2A3L A;  2DVE A;  2L89 A;  1K9M U;  3GOX A;  1WPY A;  5A2Q E;  3MEV A;  1M1K C;  2VV5 A;  1H64 1;  1PSE A;  1Y96 B;  4HCZ A;  1KC8 U;  4M77 E;  4EMH A;  3OYN A;  1VQ6 A;  4M7A E;  1VQ7 T;  4RCC A;  4DQ2 A;  5GAM e;  3S3N A;  2CZ6 B;  5GAN 6;  1XQH A;  3BY7 A;  5LJ3 d;  4EPC A;  4M7D G;  4BAC A;  2FB7 A;  4ZTF A;  5CO7 A;  3L1A A;  4J83 A;  4II1 A;  1KC8 C;  1UGQ B;  5D6Y A;  5IAY A;  3M4G A;  1G3T A;  2BIV A;  2NLU A;  1FXX A;  2D9T A;  2VYT A;  3MHX A;  2ZCF B;  3M5A A;  1B34 B;  2RI5 A;  3M4Y A;  2GFA A;  2LT1 A;  2D0Q B;  5I2S A;  4OF1 A;  3V8J A;  1YIT A;  2CS7 A;  3OA6 A;  2E6Z A;  4JDS A;  3WVE B;  3OSV A;  3JB9 H;  4YTL A;  2H3J A;  1KQ2 A;  4TVR A;  4VUB A;  5GAN f;  4ELY C;  1YJW A;  2F5T X;  4C8Q F;  4M77 A;  3NFC A;  2PVO B;  2DD4 A;  1VQ9 A;  2E41 A;  4M7A A;  2O4X A;  2YHT A;  3HRT A;  3TCJ A;  3A8H B;  2JN0 A;  2M1H A;  1X01 A;  3GF5 A;  4XQ3 A;  1K73 U;  1K8A C;  4PJO C;  5D6X A;  1YIJ T;  4ELZ C;  1M1F A;  3LX7 A;  3M57 A;  1ZHI A;  5FRN A;  2LC4 A;  3H8Z A;  3JRZ A;  4M78 E;  4FL6 A;  4MDW A;  4M75 F;  3WXM B;  3JCM X;  3S3M A;  3NTK A;  4Y91 A;  1AHJ B;  1YJN A;  3M53 A;  4LDW A;  4C92 B;  3UWN A;  1Q82 U;  4JRP A;  2RHI A;  1VQ6 T;  2LRQ A;  4J7I A;  2OTL A;  4X34 A;  1M8V A;  2EQU A;  3S3O A;  2RO0 A;  4Q5W A;  4F7U E;  3QJY A;  2DXT A;  2PVG B;  2CZ0 B;  1S72 A;  3CCQ A;  2E6N A;  1VQM A;  1UGS B;  4C8Q C;  3JCM e;  1JB0 E;  5GAN 2;  2VXE A;  3P8B B;  2KVQ G;  4E47 A;  3LWI A;  4PJO E;  2X4X A;  4NL2 A;  3MET A;  4BDZ A;  3SWN B;  5LJ5 f;  5GAM j;  3FIF A;  4FIB A;  1M4Z A;  2IVW A;  3A5Z B;  3BDU A;  3M59 A;  1YIT T;  2JVV A;  2D6F A;  4OVA A;  1VQN A;  1UGP B;  4XTY A;  2V8J A;  3X24 B;  3ZEH A;  3QPH A;  3SFM A;  1YJW T;  2FVU A;  3X25 B;  3HL8 A;  1VQ9 T;  4M7D B;  4N4I A;  1QW1 A;  3S6W A;  2XDB A;  1M1G A;  3J80 E;  1UEB A;  4J6Y A;  1YJ9 A;  3CMA A;  3L2U A;  4M75 A;  4BDY A;  1W2B S;  2MMP A;  4M75 D;  4XU0 A;  5CVI A;  5GAM g;  4A4E A;  2V8I A;  1NPP A;  2EAY A;  5CR2 A;  1M90 C;  2F5K A;  1G3Y A;  3CCJ A;  4JS4 A;  4C92 C;  5GAN e;  4R55 A;  1YJN T;  2EFI A;  4E7L A;  2X35 A;  3CCL A;  4A54 A;  5KH6 A;  3OBY A;  3GPL A;  3CPF A;  4LDY A;  1O9S A;  4BY6 B;  2MWO A;  4XK8 E;  1Q81 U;  1WNL A;  4A53 A;  2JTM A;  5GAN 7;  3CCE A;  2KMT A;  4XU3 A;  2ZPE B;  5GMK j;  1WQW A;  2DTH A;  4JRK A;  3AHU A;  3SB2 A;  4C5G A;  3CCQ T;  3LLR A;  3BDL A;  4MZT A;  1VQM T;  2K3X A;  2PVD B;  5GAO p;  4HCC A;  3QHS A;  2VUB A;  4M75 G;  2ZGW A;  1W2B A;  2R5A A;  3QJ6 A;  3C94 A;  3QZ9 B;  2JUF A;  4RG2 A;  3G71 A;  3HHT B;  2RH2 A;  4N0A C;  3SWN C;  2XG8 D;  3F70 A;  3JCM Q;  3DLL A;  4C5H A;  4EMK C;  4RG8 A;  4BUG A;  5AYF A;  3OYE A;  3CCV A;  4IUQ A;  3CBM A;  1YHQ A;  3CPW S;  2M16 A;  4GLK A;  1VQN T;  3O8V A;  1Q86 C;  4KBM B;  5LL6 S;  2LDM A;  2QDY B;  1KHI A;  4M7D C;  4L59 A;  2DXC A;  3MEA A;  2QTX A;  3DB4 A;  1VQO T;  5KE2 A;  1BI3 A;  2HQX A;  4QQG A;  4KUD K;  3OB9 A;  2O4X B;  1NZ9 A;  4X9C A;  3VUB A;  1QVF A;  3PFS A;  5FU7 B;  1YJ9 T;  3CMA T;  2E70 A;  1Q7Y C;  4ZGD B;  5LJ5 e;  1R8O B;  2V8K A;  1Y71 A;  2ZPG B;  1BI2 A;  5GAN 5;  1N8R U;  4PKC C;  3V7R A;  5J39 A;  3JCM W;  2I2L A;  1N9R A;  3OYF A;  3CC2 A;  4PL6 A;  5FRM A;  3CCJ T;  1X6O A;  3A8G B;  4M77 F;  2QI2 A;  3P8D A;  3VU3 C;  5LJ3 g;  2XU8 A;  3CCL T;  1NJI C;  4M7A F;  4BY6 C;  2DZ9 A;  1EIF A;  2RHX A;  3HKS A;  2E64 A;  3PT9 A;  5DLQ E;  5LJ3 f;  1FX7 A;  1KD1 U;  2EWN A;  3CCE T;  4JUV A;  3OYD A;  4PLI A;  3CCU A;  1OI1 A;  3CC4 A;  4JRQ A;  5GAN j;  1U1T A;  4FT4 A;  3OYI A;  1IRE B;  5GAO r;  3G71 T;  3JSC A;  1YBY A;  4IUP A;  2PQW A;  3OYH A;  3CCV T;  1PSF A;  5C6S A;  2MWP A;  1DJ7 B;  2ZPB B;  4C8Q B;  1WJS A;  2PUO B;  4PNO A;  2WSE E;  1YHQ T;  2HBP A;  1TH7 A;  2X4J A;  1VQ8 T;  1OYX A;  5I2M A;  4HCB A;  1SSF A;  3M9Q A;  2P4T A;  1UGR B;  3HP9 A;  2AHJ B;  4ZGJ B;  4JJN K;  3RKX A;  2KAF A;  3R6O A;  5GAN g;  2HD0 A;  3V8L A;  5FU7 C;  3I56 A;  1OZ3 A;  2OTJ T;  5FLX E;  2DD5 A;  2EQJ A;  2GQV A;  4XAX B;  4M75 B;  4D6W A;  3VYG A;  4QVC A;  2DEQ A;  3JCM d;  2EIF A;  3HFO A;  2K5I A;  4B9X A;  3OYL A;  3CXC S;  4M78 F;  4M77 D;  1WQ7 A;  3FEO A;  3CC2 T;  2EJ9 A;  4M7A D;  1MGQ A;  3QO3 A;  4Y28 E;  4IUT A;  3MO8 A;  4DA4 A;  2LQK A;  3MP8 A;  4C5I A;  3KBG A;  2YLB A;  4C0Z A;  5IN1 A;  4CI0 C;  5CKB A;  2RI2 A;  2RHU A;  3GNF B;  4R56 A;  1K9M C;  2M0O A;  3OMC A;  2DIQ A;  2DKG A;  5LJ5 j;  5GAO q;  1D3B A;  2M9U A;  3FRN A;  4XTZ A;  4MMK A;  2RJF A;  1BI1 A;  4ZN1 A;  4RMO A;  4J6X A;  3PTA A;  1VQ4 A;  2O01 E;  1VQK A;  2K5F A;  3OQ5 A;  5GMK h;  3JAM E;  3CCU T;  2DJZ A;  1JJ2 S;  1ZQ1 A;  3T9N A;  4EMG A;  3CC4 T;  3C12 A;  2XHC A;  4M77 G;  3CXC A;  4M7A G;  1QP2 A;  3WVD B;  2PU9 B;  3M58 A;  3V8K A;  2K2V A;  1Y7X A;  2KY9 A;  3ASK A;  1N27 A;  2KSS A;  3JB9 J;  5LJ5 g;  5LJ3 e;  1GXI E;  2DK3 A;  3RIR A;  1I81 A;  4C8Q E;  4NS5 A;  3JCM h;  4OGE A;  3EFR A;  4EMK B;  5HY6 A;  4MZP A;  3V7S A;  4LDV A;  1BKB A;  3M55 A;  3JB9 I;  4M78 A;  3I56 T;  1H3Z A;  2G3R A;  3HPW A;  1M9S A;  4M78 D;  3HRS A;  4M75 C;  4MZM A;  3H6Z A;  1JJ2 A;  4MML A;  5CKD A;  3G4S A;  2RB6 A;  3G7Z A;  3ZBD A;  2QQA A;  4EDU A;  3E1S A;  3RUX A;  1XTD A;  4C0F A;  1U8R A;  2VC8 A;  4A4H A;  1K73 C;  4E7K A;  3OS0 A;  2BKD N;  4F7U A;  3RES A;  3OS1 A;  4JLG A;  2ZPF B;  2LX9 A;  1N9S A;  4OGC A;  5KE3 A;  2YRV A;  3J81 E;  1UB4 A;  1KG1 A;  4DOW A;  2BUD A;  2LTO A;  4LD9 K;  2FL7 A;  2HNI A;  1Q82 C;  3PMT A;  4IKF A;  3CCR A;  4XTV A;  2RM4 A;  1G5V A;  3OMG A;  2Y4X A;  4XTU A;  5CQX A;  2XDP A;  5L8R E;  4XTX A;  1VQ4 T;  4M78 G;  3PGG A;  4ME7 A;  1VUB A;  2LVM A;  4QQ6 A;  3L2Z A;  2OTL T;  1LNX A;  3C95 A;  1B34 A;  3MCA B;  3V7C A;  4C92 E;  5J3B A;  5HKC A;  2MI6 A;  1QVF S;  1S72 T;  2HAX A;  3I55 A;  3CCS A;  2L5Q A;  2DPP B;  4F7U G;  5GAN 4;  3TEE A;  3J7A F;  3PNW C;  2CGH A;  3Q1J A;  4LDX A;  2QQS A;  3A8L B;  3LW5 E;  4KUL A;  4BI3 A;  3BW1 A;  1RL2 A;  3M56 A;  1RI0 A;  4NL3 A;  3PMI A;  4A4G A;  3GNG A;  2QA4 A;  2R57 A;  5CAI A;  2XK0 A;  3HRU A;  1QVG A;  4MDX A;  3OSS C;  3RMQ A;  4QQD A;  4JS5 A;  5FRO A;  1XNI A;  2GCX A;  3VV0 A;  5GAO m;  2QEX A;  3VJP A;  3QYH B;  5A0G A;  2GF7 A;  1LJO A;  2WAC A;  5LJ3 j;  5GAM d;  3OYC A;  4M77 B;  1VQP A;  1JRI A;  1OZ2 A;  4M7A B;  4QVD A;  2GFU A;  4M7D E;  3FB9 A;  5J26 A;  1ZBX A;  2IG0 A;  2XI9 A;  3P8H A;  1M1K U;  5GMK i;  1P92 A;  3LGL A;  2EKO A;  3GIB A;  2RJC A;  5CIU A;  3OW2 S;  2RK1 A;  3KXT A;  1D3B B;  2VGN A;  5CKE A;  3GP8 A;  4BE0 A;  4Z02 A;  1Q81 C;  3OYJ A;  1YI2 A;  5I21 A;  3L2R A;  1VQ5 A;  5GAN 8;  1QP3 A;  3L2Q A;  3OYG A;  2RHZ A;  4N0A A;  3SWN A;  4BD3 A;  4ATO A;  4JLI A;  4RKU E;  4N4G A;  3VYH B;  3JCM J;  2WSC E;  2K3Y A;  3FLG A;  3I55 T;  1NE8 A;  2XID A;  2OAU A;  3CCS T;  1I5L A;  3MP6 A;  4PLL A;  3CC7 A;  4V2S A;  2A7Y A;  4IUU A;  3UT1 A;  5GMK m;  1KQ1 A;  2Y90 A;  4BE1 A;  3A8M B;  3OBW A;  4CRI A;  5M9O A;  3OW2 A;  4BB7 A;  1XOV A;  5GAM h;  4J7F A;  2QA4 T;  3OYY A;  4L6V 5;  3JCM V;  3CEY A;  2C06 A;  4M78 B;  3X26 B;  1BI0 A;  5DLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...