5GMKj

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 9
structure length 69
sequence length 75
chains with identical sequence x
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkj00
3JCMP 2DXUA 5GAN2 3V7SA 3RESA 3JB9H 4M7AB 2YHTA 1WNLA 1BIAA 2VXEA 4M7DA 2DEQA 2FYKA 4XTZA 4M7AG 4PJOB 5LJ5j 3PGGA 4XTVA 4PJOG 4M7DC 2FB7A 2DXTA 5GANh 4C92A 3RERA 4F7UA 4NL3A 3AHUA 5GMKl 3JCMh 2EJFA 1B34B 4C92C 4WF2A 4XU2A 4C8QB 4J5YA 4C8QG 5GMKe 5LJ3g 3RKYA 5GAN3 1LNXA 2EWNA 4M78E 5GAMg 4M7DE 5GAOq 4QVDA 4X9CA 2Y90A 4M75A 2ZGWA 4M78D 5GAN7 4HA8A 4M7DD 4J6YA 4M77E 4M75C 4EMKB 3JCMX 1JBMA 4C92E 1M8VA 5GMKi 4F7UE 4M77D 2E65A 3BY7A 4C92D 1U1SA 1D3BB 4M7DF 2DZCA 3JCMc 5GMKj 5GAN5 4V2SA 5GANg 4C92F 3SB2A 4F7UF 3JCMg 4M7AA 4M75E 2EAYA 2I2LA 5GANe 5LJ3f 3JB9G 4PJOA 4M7AC 4M75D 2DKGA 1TH7A 4M78A 4J6XA 4XTYA 5GAMf 4PJOC 4M78C 4A53A 4M77A 4EMHA 3HFNA 1H641 4M75F 1B34A 4M77C 4C8QA 3JCMW 1LOJA 4XQ3A 1I4K1 3L1AA 3BFMA 3FJPA 5LJ3d 4M7AE 4QVCA 5GAMd 3EFSA 4JLIA 5GANf 4M7AD 5GAOm 4PJOE 3V7RA 3JCMf 5DY9A 5LJ3e 3JB9I 4MMLA 2DTIA 1JRIA 5GAN6 3JB9J 1WQWA 1Y96B 2CGHA 4NOYA 3RKXA 5GAMe 2YLBA 4M7AF 5GAOp 1I8FA 5LJ5h 4PJOF 4C8QE 4M78F 1U1TA 3RKWA 4C8QD 5GANd 1HXDA 1HK9A 4NL2A 1N9RA 4RCBA 4XU3A 3QSUA 4M77F 3JCMd 4HT9A 4N0AA 2VXFA 5LJ3j 4N0AC 1LJOA 4PJOD 5GAMj 4RCCA 3QUIA 4C92B 3JCMe 3RIRA 2EJ9A 4A54A 1N9SA 4MMKA 1MGQA 2DVEA 3V8KA 3GIBA 3V8JA 2RA2A 3JCMQ 3FIFA 5LJ5g 3BW1A 4C8QC 3JB9D 5GANj 5GMKh 5GAN8 3M4GA 5GAOl 2EJGA 4J6WA 3RUXA 3SWNB 3V7CA 2DJZA 1I81A 3QO3A 4OP0A 3VU3C 4DQ2A 4EMKA 3QHSA 3JB9F 5GAOr 3JCMV 4EMKC 4XTXA 3BDUA 1D3BA 2VC8A 1I5LA 1YCYA 1WQ7A 2DTOA 3JCMb 2E64A 1BIBA 4X9DA 4XU1A 4M78B 2HNIA 4XTUA 4M7DB 4M78G 5LJ5f 4C8QF 4M7DG 2JN0A 5CAIA 2RB6A 4PNOA 4XU0A 2RD1A 4M77B 1KQ2A 5GAN4 1KQ1A 3EFRA 3HSBA 4M77G 4F7UB 5GMKm 4XTWA 4C92G 4F7UG 2DTHA 2YLCA 4Y91A 4JRIA 3V8LA 2DZ9A 4JUVA 4HT8A 2E10A 3HFOA 4JRKA 3FB9A 2RM4A 5LJ5d 5GAOn 4M75B 3SWNA 4M75G 5LJ5e 2E1HA 1WPYA 3L2ZA 3SWNC 5GAMh 1X01A 3JCMJ 5LJ3h 1M5Q1 1Y96A 2QTXA 3INZA 5I21A 2K57A 4EMGA 2E41A
chains in the Genus database with same CATH superfamily
2KI7A 1D1BA 1AD5A 2B8AA 1I07A 1BIAA 3JAME 3VS4A 2J6OA 1KHCA 2F1LA 3ZL7C 1B34B 3SD4A 1QVGA 3OS0A 4C8QG 5GMKe 2KAFA 2EWNA 2IG0A 2HSPA 1M8VA 5GJWB 2ZCFB 1YIJT 1YCSB 5GMKj 3CD6T 5GJVB 3G7ZA 1VIFA 1FX7A 2M1HA 4QQDA 3NGPA 4M75D 3MCAB 4PJOC 3QDRB 1ZSZC 2EBPA 4A53A 2X4XA 4D8KA 4M75F 1WJQA 1ABOA 1WJSA 4C0ZA 1KC8U 2PUOB 5CIUA 5GAMd 4QQGA 1VQ8T 3J80E 3JB9I 4MMLA 1JRIA 1QKWA 3OYDA 1C0MA 4NOYA 4C8QE 4M78F 1M90R 2LJ0A 2VXFA 2O4XA 1YWOA 4D8DA 1LJOA 4FT4A 3L2RA 2ZPGB 1H3ZA 4PJJA 2CP7A 5A2QE 1TOVA 4IUVA 2D6FA 1RLPC 3C0CA 1NJIU 1Q86R 2YUQA 2K5IA 9ATCB 4FSSA 1UGPB 1OULA 2VV5A 2LCCA 3DLMA 4E2FB 3CCRA 4EMKC 3CC7A 1VQ6T 3OYHA 4M78B 4PLLA 1VQ7A 2X51A 1RAHB 3EFRA 2P0PA 2E3HA 5CKHA 1K73R 1WA7A 4F7UG 2C06A 1WIEA 1X2QA 2P0QA 1M8MA 2XMFA 1B07A 3CCSQ 1WPYA 2HCKA 2HKNA 5LJ3h 1E6HA 2QYZA 3VV0A 3GP8A 3RESA 4FYVB 1VQNQ 2EQIA 2HZYA 4PJOB 3PGGA 2RQUA 3CCQA 1T0HA 2YXYA 1PD0A 3OYEA 3G4ST 2RQRA 3VS5A 3CCMT 3M0TA 3MP8A 1AT1B 1RAAB 4ZNXA 5KYWB 2CT3A 4X9CA 4RTVA 2XDBA 2JTMA 4F7UE 1TUGB 5M9OA 5J26A 1D3BB 1MNEA 1UG1A 4C0GA 1KQSS 1OU9A 4M7AA 4FW2A 3OYCA 1R77A 3O8VA 2CZ0B 3BFMA 5LJ3d 3M0SA 4JJCA 5I22A 2OTLA 2HEQA 2BKDN 3EFOB 1VQ7Q 2YUOA 3JRZA 3JB9J 1JJ2S 2E4HA 5CR2A 3CBPA 3LLRA 4HT9A 3OYBA 2KRNA 2FVUA 3M55A 3JCMe 2LZ6B 1W1FA 2HDAA 2NUTB 1NEGA 3V8JA 1WJRA 2M0OA 5DLOA 4KGXB 3RUXA 2LQWA 1ZQ1A 2FRYA 2HQEA 1BI2A 3MKDA 3THKA 2CSQA 3EGXB 5KYYA 1NBEB 4OB1B 1YJWA 1T0JA 3OS5A 3ER0A 1B7TA 4E7ZA 4PNOA 4XU0A 5GAN4 3CCJT 2WSFE 1Q82C 2LRQA 1FWZA 2V26A 4YTLA 2K3YA 3HFOA 2V1QA 4B9WA 4HXJA 2W10A 1X6OA 5KH6A 1OZ3A 4MZTA 5LJ5e 1YI2T 2ZPIB 4EMGA 1WX6A 3LW5E 2DYBA 2EGAA 2OTLQ 2C0IA 2DBKA 2EFIA 2O88A 4M7DA 2RJCA 5LJ5j 3CXCS 2LT4A 1G8XA 3R6OA 1KD1U 4PFZA 3CMET 2VVKA 2KXDA 2QEXQ 3H6ZA 4KRTA 4LDXA 1IGUA 2AT1B 3G1JA 1B3QA 5FLXE 3C4SA 1MMAA 5IH2A 5GANe 2O4XB 1QVFS 4M7AC 1N8RU 2RMOA 3OBYA 3REAB 3OYLA 3A8LB 1OYXA 5CKBA 2KE9A 4JLIA 1J3TA 5DY9A 2K2VA 2A08A 5GAMe 4E7LA 3GPLA 3UATA 2PVOB 4KGVB 1ARKA 4J9EA 4M77F 4LDWA 4LD6A 1QCFA 5GAMj 5IXFA 3CC4T 3RIRA 2RI3A 2PUKB 3I55A 4M4ZA 3M53A 1OI1A 1FYNA 3P8DA 3LWIA 3I5SA 4OGEA 3TREA 2EJGA 2D1XA 3OYMA 2OTJQ 1OQKA 2JNGA 2D8JA 1PCXA 2C0TA 2VC8A 3MPUB 1RAFB 1KG1A 2E3IA 3E9FA 1JQQA 2RHYA 1KQ2A 4M77B 2VGMA 3OMGA 2GGRA 1V76A 5C6SA 3ASKA 2KROA 2DZ9A 2NWMA 3VKIA 1VQLA 2Z0WA 1BB9A 1Q7YC 3CCET 4OMNA 4PL6A 1UJ0A 1R8OB 2XKOC 1RAIB 1Q82R 2PZ1A 4JJBA 2G6FX 3SHWA 4L6V5 4M7AB 1R0CB 4M7DC 1PNJA 1VQ4A 1V29B 2F5TX 1M3AA 5CQYA 5CK9A 1G2BA 1YITT 2I0NA 5HCKA 3WXMB 3I55Q 2HL5C 3CCVT 2DZCA 3M0PA 4KH1B 2SEMA 1UTIA 1K1ZA 3QYGB 2W0ZA 1RI0A 1U06A 4HCZA 2NUPA 4N4IA 6AT1B 2X9HA 1JXMA 2XU8A 2K4YA 1KC8C 2EPDA 3CC2A 5EG2A 5GAOm 2GQIA 2GFAA 2XI9A 5LJ3e 2LQKA 1M1KU 1WQWA 4E7JA 1Q81U 1X6GA 4J9IA 1I8FA 5KYYB 1HK9A 2QDYB 1NPRA 1VQLQ 4J9DA 4Y92A 5LJ3j 3VS7A 1QVPA 4MDXA 3QUIA 4LDUA 2M02A 3BDLA 1YJNT 4A54A 3FIFA 2COYA 3I35A 1KSWA 4OMFB 5FRNA 2E6NA 3EG0A 3AT1B 1FMVA 1G5VA 3O5ZA 3FDRA 1OZ2A 4F17A 1AWWA 3CPWA 2AKKA 2JMAA 4XU1A 4M7DB 2V8IA 4C0DC 1TUCA 4GY5A 2RF0A 3PT9A 2RD1A 5CAIA 2EQJA 4ZN1A 3CCLT 4C92G 1PD1A 5CCAA 1SF9A 4K11A 2F2XA 2LCLA 1IO6A 4JRKA 2J05A 5GAOn 3VRYA 1SRMA 2AK5A 5D6XA 1T3SA 3P8BB 1D1CA 1UGQB 1M5Q1 1OPKA 3QZ5B 3H0HA 2MIOA 1MMNA 1Z9QA 4FW1A 3NTHA 3QJ6A 2CS7A 1WLPB 2DXTA 1Q7YR 1K9MC 1UECA 2RO0A 3OYKA 4GLKA 4II1A 1IREB 4M75A 2ZGWA 5CKFA 5GAN7 2DK3A 3JCMX 4C92E 2JUFA 2KYMA 3P8HA 1VQMT 4V2SA 4C5HA 1HJDA 2JT4A 3G6ET 2DX1A 2DL5A 2A3LA 3ME9A 1GRIA 4M78A 5KCOA 5CQXA 3CCUA 4PFOA 3L1AA 3OW2P 1X6BA 1PWTA 4QVCA 3HPWA 1SPKA 3JCMf 2DTIA 1GCPA 2YLBA 2ENMA 2DVJA 1YJ9T 2Y4YA 1KC8R 3GLXA 3VS0A 1MMGA 3LX7A 2DBMA 4A63B 2L0AA 1M90C 4LDYA 1YIJA 1HYOA 1W2BP 3CD6A 4QQ6A 4DBRA 5KYWA 1LPLA 4J6WA 5EC7A 3V7CA 5KYUA 1I81A 3GNFB 1PM3A 2JTEA 1D3BA 3OYAA 1LCKA 2EVRA 5LJ5f 3OS2A 1VQ8A 1VQOT 5IHKA 3VS3A 2KDSA 4KBMB 3EFOA 2QA4T 4ZGJB 1M4ZA 3CCUQ 3T9NA 2VWFA 1M3BA 1Y07A 3OY9A 2F2WA 3GOXA 1KHIA 4MDWA 4QKUA 5GAN2 3OB9A 1K4US 2XDPA 2JTFA 3NHNA 3E1SA 2DJQA 3G71T 1UE9A 2GQVA 2QAZA 3QPHA 4J9GA 5GANh 2NUPB 2YUNA 4IURA 4QVDA 1VQ6A 5DM7R 4J6YA 4AMCA 4E7KA 4M75C 4OF1A 3BY7A 1K9MR 2KXCA 4IUPA 4RG2A 2LX7A 3MEAA 2GF7A 1SEMA 1RADB 4J6XA 5GAMf 3M0UA 4PFPA 1N8RC 2L2PA 4M78C 3TCJA 2P84A 4EMHA 2DIQA 2QG9B 4BI4A 1NLPC 3NTKA 2RK2A 1TG0A 1VQ8Q 3H0IA 2MK5A 5GAN6 2X35A 3G4SA 4C8QD 5GANd 3CCMA 3QKJA 3E9GA 1KQSA 4ZGDB 1P92A 3TSZA 3MEWA 4DA4A 2DFUA 4A4EA 2H3JA 3CMAQ 2LJ1A 3CQTA 1KJWA 5AYFA 4X1VA 2GBQA 1NLOC 2XG8D 1VQ6Q 1GCQA 2X3WD 1PRLC 1AVZC 4M78G 2ROTA 2JN0A 3F70A 4ZTJA 2DETA 1K0XA 2LDMA 2NUZA 3A8GB 5GMKm 2YLCA 3RBBB 4JRIA 1NYFA 1GL5A 3EG9A 1RI9A 4M75B 1PRMC 3UWNA 3VUZA 3FC3A 2L3SA 1RL2A 1RABB 3L2QA 3M59A 2PVGB 3JB9H 3S6WA 2RHXA 4DBFA 4JDSA 4PJOG 2OAUA 4ESRA 3QDFA 3M58A 3G4SQ 2E5KA 1AEYA 4XU2A 2D0NA 1AWJA 2A0FB 4M78E 2EYQA 1IXDA 4C5GA 3CCJA 4EPCA 3EGDA 4O5VA 1QMCA 4F7UF 4E7HA 1VQ9T 5LJ3f 4AFQC 2EYZA 2BIVA 1ZLMA 3CXCA 2ZAEA 4M77A 1M1FA 3HFNA 4AFZC 2ECZA 1YI2A 2CP0A 1I4K1 1RAEB 2HD0A 2DO3A 2XIDA 1FMKA 1K9AA 4PJOE 2VGNA 1YBYA 4QVZA 2FPFA 5KYUB 5FW9A 1ZA2B 1EFNA 2CGHA 1N8RR 1EZZB 1M1KC 1F1BB 3HP9A 1UGRB 5D6YA 1Q81C 2L8DA 2LC4A 2KEAA 3NMZC 4NL2A 3A1PA 4GLMA 2MAMA 3S3MA 3CMEA 2EIFA 3EG1A 1QVFA 5J3BA 3CCRQ 5CKEA 1ZBXA 1H3HA 3CC7Q 2EYXA 2VKNA 2CYZB 4C5EA 3CCST 4RTWA 3EHQA 4OP0A 2FZCB 4XAXB 1S1NA 1X43A 2RQTA 3DB3A 1FMWA 5A0DA 2LVMA 1JXOA 3A8HB 3C12A 2OAWA 4RTZA 1GCQC 4IKFA 3MJXA 3A5ZB 4FL6A 2DTHA 3OW2S 3FB9A 2V1RA 1CSKA 3R6NA 2E1HA 2AIRB 2WSCE 4J9CA 3CC4A 3OYJA 3CCQQ 1VUBA 5D7UA 4RTYA 1UFFA 2YHTA 5CVIA 2JOYA 3PIOA 2DD5A 3LH5A 1SSHA 4QT7A 5IN1A 4OMPA 3TVTA 1W2BS 3JV3A 2CZ1B 1BU1A 4FYXB 3UF4A 1Q86U 4OGCA 4MZPA 1PKTA 2VASA 3OSSC 3JCMg 3U23A 1M30A 4XTYA 1XJWB 5LL6S 3UA7A 2JXBA 2ED0A 3CCEA 5A0GA 4M77C 3VUBA 4JRPA 4OMQA 2QK0A 1PSEA 1QWFA 2EKHA 2ZZDA 4EDUA 3GNGA 1K8AC 1NPPA 1VQ5T 2J6FA 4GBQA 1U3OA 1YITA 2JS0A 2DEUA 3CC4Q 1M1KR 2FO0A 2X4WA 1YJWQ 3TQ7P 3CCVA 1Q81R 1IB8A 4AG1C 5LJ5g 5GANj 3EG9B 3HL8A 2HMAA 3HKSA 1WI7A 1PKSA 4E7SA 1TTHB 2CH4A 1I5LA 2M0YA 2VUBA 1PSFA 2E70A 2L3PA 1WXTA 4M77G 3N5BB 3KUFA 4PJMA 2K79A 2E12A 1ZSGA 1VQKT 2LCSA 5I11A 2QEXT 2RHUA 2QGFB 5J39A 3CCEQ 5I2MA 4F04B 1YJNA 2DD4A 2CUDA 3OYYA 3OQ5A 3EGDB 3V7SA 2QDLA 2FZGB 1WHMA 1QQJA 4D6WA 4M7AG 5KCHA 4C5IA 4NL3A 1VYUA 2QTVA 4A4HA 4LE9A 1YITQ 5GAMg 2K2MA 4M77E 1ZUYA 4CI0C 5GMKi 4BD3A 2DERA 1G3YA 4OVAA 3ZFJA 5IXBA 3CCLA 1BI3A 1UGSB 3H9NA 2NYSA 2J7IA 4ANJA 4AFUC 3JB9G 2JMCA 3M57A 2DKGA 4JLGA 1UDLA 2ESWA 1BYMA 5FWCA 4M7AE 2L3QA 4JJDA 3X25B 4JS5A 2OTJT 1SSFA 4LDVA 4KT0E 4Z8AA 3QIIA 4JZ3A 4ELYC 3QSUA 2RHIA 1D0ZA 5DLQE 1D1AA 4RCCA 1NM7A 4OMMA 1YJNQ 3X28B 1WHJA 2DL7A 2KK4A 3ULRB 4MMKA 4J83A 4LUDA 1K8AR 1VQMA 1UEBA 2YT6A 3G6EA 1YHQT 3BW1A 3MEVA 3M4GA 4KULA 2FHDA 2DJZA 4IUQA 4F14A 4RUGA 2V8JA 2DMOA 1WXUA 4ATOA 4JRQA 1W70A 4XTUA 5D6WA 4M7DG 1KQ1A 1LVKA 4IIOA 3CCLQ 1YJ9A 3V8LA 2O9SA 3PMIA 1NJIC 1WHKA 1D0XA 2MI6A 5GAMh 1X01A 1X2KA 1OU8A 2IVWA 1VQ4Q 3EAEA 4ZTFA 1WFWA 3S3NA 1M9SA 3OS1A 3PE0A 2COWA 2X3XD 1NZ9A 5LJ3g 1C1AA 1QP3A 4M7DE 3D7SB 1AZEA 4EIKA 3JSCA 1VQOA 1A0NB 5AT1B 4C92D 1ZHIA 2A7YA 3TU4K 1WHLA 3G6EQ 2KY9A 4C92F 1BKBA 2JVVA 3CC2Q 4FYWB 2QA4A 3UA6A 1VYVA 4OB0B 2O01E 3L2WA 1VQPT 1QVGP 4C8QA 4A4FA 1YWPA 4FM4B 5IT9E 1JEGA 4E47A 3EFSA 1QWEA 3M56A 1WYXA 1SHFA 3M54A 2H8HA 3G71A 3TSWA 2EGEA 2KRMA 3VJPA 1YJ9Q 1UHCA 5GAOp 4A4GA 1KQSP 2YRDA 4RG8A 2HAXA 1NEBA 2WACA 1GFCA 3X26B 2LNHB 4Q5WA 4C92B 1WXBA 1AWXA 2DVEA 1M2OA 2GNCA 2RA2A 1UJYA 1TU0B 2EYWA 5GAOl 1Y0MA 3JCMV 3A98A 3CBMA 1E7OA 1S72T 3HRSA 1RUWA 1G3SA 4OB3B 2KNBB 1VQOQ 2F2VA 5KYXA 3MP6A 4BY6B 2DPPB 2HBWA 1G3WA 3IQLA 1ZA1B 3KFVA 2QA4Q 2JJ9A 1ZUUA 3INZA 4NS5A 1MUZA 4Z89A 2QQRA 3EG2A 3I56T 1QW1A 4OMLA 3HHTB 1WNLA 2MF2A 4JJNK 3QBYA 1SHGA 4CC7A 3G71Q 1NJIR 2KSSA 5L8RE 4J8OA 4F7UA 2MYSA 3Q1JA 5GAN3 2KT1A 1LNXA 4X34A 2K5FA 1BCMA 4Z02A 3PVLA 3EGUA 3FEOA 4J9HA 1U1SA 3H8ZA 3L42A 1I5OB 1W4SA 1RACB 3SB2A 4JS4A 2EAYA 3MO8A 1Q95G 3CXCP 1MV3A 1TH7A 2M51A 2MWPA 4WTOB 1H641 3JCMW 5GANf 1N27A 1KD1C 4IUUA 3PFSA 2RNAA 1ACMB 3OYIA 3RKXA 3RDVA 2KRSA 1YIJQ 2RI2A 3CD6Q 5HK3A 2EKOA 4DBQA 3MEUA 1NYGA 2BE9B 3RNJA 1OEBA 4CRIA 4AG2C 1N9SA 3HRUA 2CREA 4PLIA 4N4HA 2NLUA 1Q7YU 3C94A 3KBGA 1VQ9A 1WGSA 3QHSA 3URGA 1MV0B 1I0CA 2HQXA 2OX7A 2DL3A 4KGZB 2QXFA 5IAYA 2HNIA 3DLLA 5FU6B 4C8QF 2KQWA 1CKAA 1MNDA 2FRWA 2FZKB 3VYHB 3REBB 1XOVA 2HQHA 4LN2A 4M75G 1M3CA 2OI3A 2QQ9A 3PVQA 3JCMJ 5I21A 4Y28E 3JCMb 2DXUA 1OPLA 1JJ2A 2XK0A 3ZEHA 1OOTA 1ZUKA 2D9TA 3QZ9B 2MPXC 2EGCA 3CCSA 1BI1A 3VS2A 2FB7A 2GTJA 4HVWA 2EJFA 4C8QB 4KUDK 3OW2A 2O2OA 1VQNA 2PTKA 4M78D 2H3EB 2D0QB 1C6VX 3SFMA 2RJDA 3WVDB 4ORZA 2FG0A 1V1CA 1JB0E 4M75E 1VQ9Q 3DB4A 2ABLA 5KE3A 3VS1A 1O9SA 2BUDA 1U5SA 1N6AA 3CCMQ 3CMAT 1W2BA 2HBPA 5FRMA 5HKCA 3CEYA 2AZSA 4PJOD 1XQHA 1Y96B 1D09B 2EQMA 2J06A 1W6XA 4PJOF 2QQBA 5I2SA 4LXCA 4N0AA 2MOXA 2CDTA 2F5KA 1E6GA 2IIMA 2ROLA 2KGTA 4OMOA 1KD1R 3CPFA 2MWOA 5KYXB 4HKEA 2CT4A 3JCMQ 1X27A 1H8KA 2BZ8A 2KBTA 1AWOA 5HK0A 2DM1A 2RPNA 2LMJA 5GAOr 4P5NA 3SDZA 1GBQA 2FL7A 4WCIA 4X9DA 1ZSZB 1N5ZA 2R57A 1K9MU 2DE0X 4F7UB 1QVGS 2RQVA 1ABQA 5KE2A 4Y91A 1VQ5A 4HT8A 3SWNA 4J9BA 5A0LA 2KR3A 4HCCA 4N4GA 3GBQA 1QCNA 2AKLA 3RMSA 1BI0A 1TUDA 3E2UA 1VQNT 3M0QA 2FYKA 4XTZA 4E6RA 1IRXA 1OV3A 4DOVA 4FSXA 3RR6A 3CCJQ 5GMKl 4LD9K 2R5AA 4AFSC 2BZYA 4WF2A 2FPDA 3J81E 1HD3A 2Y90A 4HA8A 3WVEB 2ZPFB 4XK8E 4EMKB 2E5QA 2EYYA 1YI2Q 1O75A 1G83A 3JCMc 5CKDA 3S3OA 2JM9A 4E7IA 2VB6A 5L23A 1K0SA 1VQKA 2CKKA 2QEXA 3L2UA 4BB7A 2F69A 4JZ4A 4CC2A 3CCRT 3X24B 1M90U 2LQ8A 2CH4W 2O9VA 4HCKA 3GF5A 4J7IA 2ZPEB 4DEYA 3CC7T 4L5GA 1VQ7T 3CMEQ 2COZA 1AOJA 4BE1A 3V7RA 2DLPA 2HKQB 1VQ5Q 2YSQA 3RKWA 2XHCA 3E19A 4XU3A 2PQWA 2BZXA 2P4TA 1OX8A 4N0AC 1ZBJA 1DJ7B 3GIBA 3VS6A 2DNUA 1Y71A 2KMTA 5GAN8 4DOWA 1K73U 3ZBDA 3CCQT 1M1GA 4JPBW 2FEIA 3BDUA 1JU5C 3J7AF 2DTOA 2RI5A 2DYIA 1VYTA 2DXBA 2IPOB 2LTOA 2OTJA 2RB6A 3HSBA 1Z9ZA 3OA6A 5FWBA 1PHTA 4J9FA 1VQKQ 2RHZA 3UPUA 1WDXA 2KT8A 1TSFA 1K76A 5ECAA 4AT1B 3EG3A 3SWNC 3LH0A 1VOMA 2RJFA 2K57A 2K5LA 3SEMA 2OTLT 3CPWP 2CSIA 1X75C 1YHQA 3I5RA 1YNZA 2RN8A 3PNWC 1QLYA 4R56A 2XICA 4C92A 2QQSA 3RERA 1PG5B 3H41A 3MP1A 5GAOq 3NPFA 2RK1A 1KK7A 2DF6A 4M77D 2E65A 5GANg 1VIEA 4B6MA 3M9QA 2I2LA 1GFDA 4LNPA 1YJWT 2EQKA 1YN8A 2AHJB 2C0OA 1LOJA 1GXIE 2ATCB 3LYIA 3LGLA 4M7AD 4RTXA 2D8HA 2L5QA 1EIFA 2LX9A 7AT1B 4M7AF 1JO8A 5FU7C 1M2VA 2J6KA 3CCVQ 1U1TA 1ZX6A 2CP2A 3VYGA 2QGGA 3EHRA 3PTAA 1X69A 2GFUA 3NFCA 3M4YA 5FROA 2KYBA 2VYTA 1XTDA 2EW3A 1UB4A 4ZN3A 1MGQA 2R5MA 3V8KA 1FXXA 2DRMA 1U8RA 1YHQQ 2B86A 3JB9D 4R55A 5GMKh 4RKUE 3SWNB 1R0BG 3OYNA 1XNIA 1NE8A 3JB9F 1TS9A 1Y7XA 1VQPA 1WQ7A 2ZPBB 2DRKA 2BE7D 4ME7A 4KH0B 5IHIA 4BI3A 2E6ZA 2EQUA 1BCOA 2AZVA 2XD0A 2A37A 2YWWA 1NG2A 1Y57A 4XTWA 1YFNA 4BE0A 4RMOA 2GTOA 4DEXA 2RM4A 2ZPHB 2K9GA 3FJ5A 3QG1A 2MCNA 2JM8A 2P0KA 2R58A 2DIGA 3H0FA 3A8OB 4BUGA 3OYFA 1IHVA 2JZ2A 2LP5A 2VXEA 3FRNA 4HCBA 4Z88A 1TWBA 4BI8B 3AHUA 4C92C 4IIMA 4LUEA 2P4RA 2A36A 1WZOA 1QCOA 4J5YA 1S72A 1SG5A 1WHGA 2LJ3A 2RQWA 4M7DD 4DBHA 1M27C 5FU7B 2DILA 4R0KA 2QQAA 3I55T 4M7DF 1WHHA 1UHFA 8AT1B 2CZ7B 2X4JA 4PJNA 4ZGEB 2YDLA 3CBOA 1QKXA 3HTRA 1KIKA 1H92A 3QYHB 3MHXA 1VQPQ 3A8MB 1B34A 4BE2A 4XQ3A 3FJPA 4BY6C 2V8KA 4FT2A 4J7FA 3I56A 2A28A 4FYYB 3EH1A 2M9UA 2WSEE 1HSQA 4KUIA 2OJ2A 3PMTA 4L59A 1VQMQ 2RH2A 1HXDA 1N9RA 3KXTA 1VQLT 3TEEA 2HSEB 1T3LA 2LQNA 5C0MA 1KFZA 3QWYA 2CP5A 2M16A 4RTTA 3OMCA 4RTUA 2KVQG 3VU3C 3PIPA 2ED1A 1VQ4T 2K3XA 1YCYA 1S72Q 1EX4A 2L3RA 3X20B 1CKBA 1TXQA 1BBZA 3UDCA 1D0YA 1SRLA 1Q82U 2PU9B 4HVVA 5KYNA 1YP5A 2K3BA 4JUVA 3EH2A 5IHNA 2SRCA 5CO7A 4A4KA 4TVRA 3FLGA 2CUBA 2YRCA 4ELZC 1AZGB 1RAGB 1IGQA 1SKUB 3L2ZA 1Y96A 2QTXA 3OBWA 1JJ2P 2E41A 2JW4A 2QI2A 3JCMP 3I56Q 1AHJB 4BDYA 3CC2T 3UT1A 4OB2B 2DEQA 3QXEB 4XTVA 2DA9A 3M0RA 4FU6A 3QWXX 4IUTA 2O31A 4MZMA 3VRZA 3JCMh 4UC4A 3C95A 3RKYA 2DL4A 2LT1A 1JBMA 1K8AU 3NTIA 1M2VB 3BE3A 5GAN5 4O6JA 1RLQC 3L2VA 2DXCA 2FPEA 1UUEA 5HY6A 2MMPA 4C0DB 4PJOA 1OX9A 1ZSZA 4PK4A 2G3RA 5FU6C 1VA7A 2CP6A 2PVDB 3META 1BK2A 4F16A 2BTTA 3M5AA 2K6DA 2QASA 3OSVA 2K7AA 5LJ5h 2GCXA 3CPWS 4RCBA 1Q86C 4C0FA 3HRTA 3JCMd 2X4YA 2CZ6B 2DL8A 1IHWA 4PKCC 4HVUA 3I9QA 2EJ9A 2PNIA 4FIBA 2CP3A 1IZ6A 4C8QC 3LWHA 4PJLA 4BDZA 2YRVA 1I1JA 3QO3A 4DQ2A 4EMKA 4B9XA 1K73C 4XTXA 2DAQA 3QJYA 1MHNA 3CMAA 2E64A 1UGVA 1BIBA 8ATCB 1QVFP 4BACA 3LGFA 3RMQA 4VUBA 2LNVA 2NUTA 4CC3A 1MMDA 2Y4XA 2E10A 5LJ5d 2L89A 2HL3A 4FCYA 4CC4B 2RJEA 2YUPA 3CCUT 2JS2A 3DKMA 1QP2A 3OYGA 1GBRA 1G3TA 2XDDA 1PC0A 4QW2A 3EGXA
chains in the Genus database with same CATH topology
3OYYA 3OQ5A 2B8AA 3RMSA 3V7SA 1BI0A 3NTHA 3QJ6A 1VQNT 1BIAA 2CS7A 3JAME 2FYKA 4XTZA 4D6WA 5KCHA 4M7AG 1KHCA 4DOVA 4FSXA 2DXTA 4C5IA 3OYJA 4NL3A 5GMKl 1K9MC 4LD9K 2R5AA 1B34B 2RO0A 3OYKA 4WF2A 3SD4A 1QVGA 3OS0A 4A4HA 4C8QG 5GMKe 4GLKA 2KAFA 4II1A 3J81E 2EWNA 5GAMg 1IREB 2Y90A 4M75A 2ZGWA 5CKFA 4HA8A 2IG0A 5GAN7 2DK3A 2ZPFB 3WVEB 4XK8E 4M77E 4EMKB 3JCMX 1M8VA 4C92E 4CI0C 5GMKi 2JUFA 4BD3A 1G3YA 4OVAA 2E5QA 3ZFJA 3P8HA 1O75A 2ZCFB 1YIJT 3JCMc 5GMKj 5CKDA 4C5HA 1VQMT 3CCLA 3S3OA 3CD6T 4V2SA 1BI3A 1UGSB 3G6ET 3G7ZA 1VIFA 4E7IA 1FX7A 2A3LA 3ME9A 1VQKA 2M1HA 3JB9G 2CKKA 4QQDA 5KCOA 3M57A 2DKGA 4M75D 4M78A 4JLGA 3L2UA 2QEXA 4BB7A 2F69A 3MCAB 4PJOC 5CQXA 3CCUA 3QDRB 1BYMA 3CCRT 3X24B 1M90U 2LQ8A 4A53A 2X4XA 4M75F 1WJQA 3GF5A 4J7IA 1WJSA 3L1AA 4C0ZA 2ZPEB 1KC8U 3CC7T 2PUOB 4M7AE 5CIUA 4QVCA 4L5GA 5GAMd 3HPWA 1VQ7T 4QQGA 3X25B 4JS5A 4BE1A 1VQ8T 3V7RA 3JCMf 3J80E 2OTJT 3JB9I 1SSFA 2DTIA 1JRIA 4LDVA 4MMLA 3OYDA 4NOYA 4KT0E 2YLBA 3QIIA 1YJ9T 4C8QE 4M78F 2Y4YA 4ELYC 3RKWA 2XHCA 3E19A 4XU3A 3QSUA 2RHIA 2PQWA 2VXFA 2P4TA 3GLXA 2O4XA 4N0AC 1LJOA 4FT4A 5DLQE 3L2RA 4RCCA 2ZPGB 1H3ZA 3LX7A 3X28B 2KK4A 1DJ7B 4MMKA 5A2QE 1M90C 4IUVA 4J83A 4LDYA 1YIJA 2D6FA 1VQMA 3GIBA 1UEBA 3CD6A 4QQ6A 1NJIU 3G6EA 1YHQT 3BW1A 3MEVA 1Y71A 2KMTA 5GAN8 2K5IA 3M4GA 4J6WA 4KULA 2FHDA 3V7CA 1UGPB 4DOWA 2DJZA 1I81A 3GNFB 2VV5A 1K73U 4IUQA 3ZBDA 1M1GA 3CCQT 2LCCA 3DLMA 3CCRA 4EMKC 2V8JA 1D3BA 3BDUA 3J7AF 3OYAA 2DTOA 2RI5A 2DXBA 4JRQA 3CC7A 1VQ6T 4ATOA 2LTOA 4M78B 4PLLA 4XTUA 3OYHA 1VQ7A 5D6WA 5LJ5f 4M7DG 3OS2A 1VQ8A 1VQOT 2OTJA 2RB6A 1KQ1A 3EFRA 3HSBA 2P0PA 5CKHA 3OA6A 4F7UG 1YJ9A 3V8LA 2C06A 2KDSA 2RHZA 3UPUA 2P0QA 4KBMB 2QA4T 3PMIA 4ZGJB 1M4ZA 1NJIC 3T9NA 2MI6A 3OY9A 1WPYA 1Y07A 3SWNC 1X01A 3LH0A 5LJ3h 3GOXA 2RJFA 1KHIA 2K57A 2IVWA 3VV0A 2K5LA 4MDWA 3GP8A 3EAEA 2OTLT 5GAN2 3OB9A 3RESA 2XDPA 2JTFA 1X75C 4ZTFA 1YHQA 3PNWC 4PJOB 4R56A 3S3NA 3E1SA 3PGGA 3G71T 2XICA 2GQVA 5GANh 3QPHA 4C92A 2QQSA 3RERA 3CCQA 1M9SA 3OS1A 3G4ST 3MP1A 3OYEA 3CCMT 1NZ9A 5LJ3g 3MP8A 1QP3A 4IURA 4M7DE 5GAOq 4QVDA 4X9CA 1VQ6A 2XDBA 2JTMA 5DM7R 4J6YA 2RK1A 4E7KA 4M75C 3JSCA 1VQOA 4F7UE 4M77D 4OF1A 2E65A 3BY7A 4C92D 1ZHIA 5J26A 1D3BB 2A7YA 5M9OA 3TU4K 4C0GA 1KQSS 5GANg 4IUPA 1VIEA 2KY9A 4RG2A 1BKBA 4C92F 3MEAA 4M7AA 2JVVA 3M9QA 2I2LA 2GF7A 2QA4A 4J6XA 5GAMf 3OYCA 1N8RC 4M78C 3TCJA 4EMHA 4OB0B 2O01E 2DIQA 2EQKA 3O8VA 3L2WA 2AHJB 1YJWT 1VQPT 4C8QA 4BI4A 1LOJA 2CZ0B 4A4FA 3BFMA 5LJ3d 1GXIE 4FM4B 2OTLA 3LYIA 5IT9E 2BKDN 4E47A 3EFSA 3LGLA 2RK2A 3NTKA 4M7AD 3JRZA 3M56A 2L5QA 3M54A 1EIFA 5GAN6 3JB9J 3G71A 2LX9A 4M7AF 3VJPA 5FU7C 5GAOp 1JJ2S 4A4GA 1U1TA 2X35A 3G4SA 4C8QD 5CR2A 5GANd 3CCMA 3QKJA 3CBPA 3LLRA 3E9GA 4RG8A 3VYGA 1KQSA 2HAXA 4HT9A 3PTAA 2WACA 3OYBA 4ZGDB 3X26B 2GFUA 3NFCA 1P92A 2FVUA 3M55A 3M4YA 5FROA 3MEWA 4Q5WA 4C92B 3JCMe 2VYTA 1XTDA 4DA4A 1UB4A 4ZN3A 1MGQA 2DVEA 2R5MA 3V8KA 1FXXA 2H3JA 4A4EA 3V8JA 2RA2A 1WJRA 1U8RA 2M0OA 5DLOA 3JB9D 4R55A 5GMKh 4RKUE 5GAOl 3RUXA 3SWNB 1ZQ1A 5AYFA 3OYNA 1XNIA 1NE8A 2HQEA 3JB9F 1BI2A 3JCMV 3CBMA 1Y7XA 1VQPA 1YJWA 4OB1B 1WQ7A 1S72T 2XG8D 2ZPBB 3HRSA 4ME7A 1G3SA 3OS5A 3ER0A 4OB3B 4M78G 4BI3A 2JN0A 3F70A 2E6ZA 2EQUA 4PNOA 4XU0A 4ZTJA 5GAN4 3CCJT 2LDMA 2WSFE 3A8GB 2LRQA 3MP6A 2DPPB 4XTWA 4BY6B 5GMKm 1FWZA 4YTLA 4BE0A 1G3WA 4RMOA 2YLCA 4JRIA 2K3YA 3HFOA 2RM4A 2ZPHB 4B9WA 3QG1A 5KH6A 1X6OA 4M75B 1OZ3A 4MZTA 5LJ5e 2P0KA 3UWNA 2R58A 2DIGA 3INZA 3VUZA 4NS5A 3FC3A 1RL2A 2ZPIB 4EMGA 1YI2T 3LW5E 2QQRA 3A8OB 3L2QA 3M59A 2PVGB 4BUGA 3I56T 1QW1A 3JB9H 3OYFA 3S6WA 2RHXA 3HHTB 1WNLA 2EFIA 2JZ2A 2MF2A 2VXEA 3FRNA 4JJNK 2RJCA 4M7DA 5LJ5j 3QBYA 4HCBA 4JDSA 3CXCS 4PJOG 2LT4A 2KSSA 2OAUA 4J8OA 5L8RE 4F7UA 4BI8B 3AHUA 3M58A 4C92C 3R6OA 4XU2A 4J5YA 1KD1U 1S72A 3Q1JA 5GAN3 1LNXA 4M78E 4X34A 2K5FA 3CMET 2EYQA 4Z02A 4M7DD 3H6ZA 3FEOA 4C5GA 5FU7B 4LDXA 2QQAA 1U1SA 3I55T 3CCJA 3H8ZA 3L42A 4M7DF 2CZ7B 1W4SA 2X4JA 4EPCA 4O5VA 4ZGEB 3CBOA 5FLXE 3SB2A 3C4SA 4F7UF 4JS4A 4E7HA 2EAYA 5GANe 1VQ9T 5LJ3f 3MO8A 2O4XB 1QVFS 4M7AC 2MWPA 1TH7A 1N8RU 2BIVA 3OBYA 3CXCA 3QYHB 3MHXA 4M77A 1M1FA 3A8MB 3HFNA 1H641 1B34A 1YI2A 4BE2A 3JCMW 3OYLA 4XQ3A 1I4K1 3FJPA 4BY6C 3A8LB 2V8KA 2HD0A 1OYXA 4FT2A 4J7FA 5CKBA 3I56A 2DO3A 2XIDA 4JLIA 1N27A 5GANf 1KD1C 4PJOE 2VGNA 4IUUA 1YBYA 4QVZA 2K2VA 3PFSA 5DY9A 2M9UA 5GAMe 2CGHA 3OYIA 2WSEE 3RKXA 4E7LA 1M1KC 3HP9A 1UGRB 5D6YA 1Q81C 4KUIA 3PMTA 2L8DA 2RI2A 4L59A 3GPLA 2RH2A 1HXDA 2LC4A 2PVOB 1N9RA 4NL2A 3KXTA 4M77F 4LDWA 4LD6A 2MAMA 3S3MA 1VQLT 3TEEA 3CMEA 5HK3A 2EIFA 2EKOA 5GAMj 3CC4T 1QVFA 3MEUA 3RIRA 2RI3A 5J3BA 5C0MA 4CRIA 5CKEA 1N9SA 2PUKB 3I55A 3HRUA 1ZBXA 3M53A 1OI1A 4PLIA 4N4HA 2NLUA 3P8DA 2M16A 3LWIA 2CYZB 3TREA 4OGEA 2EJGA 3OMCA 3C94A 3KBGA 4C5EA 3CCST 1Q7YU 1VQ9A 3OYMA 2KVQG 4OP0A 3VU3C 3PIPA 1WGSA 3QHSA 2JNGA 3URGA 2HQXA 4XAXB 3DB3A 1VQ4T 2VC8A 2K3XA 1YCYA 5A0DA 2QXFA 1KG1A 2LVMA 3A8HB 2L3RA 5IAYA 3C12A 2HNIA 3E9FA 3X20B 3DLLA 3UDCA 2RHYA 5FU6B 4C8QF 2KQWA 1KQ2A 1Q82U 2PU9B 2VGMA 4M77B 3OMGA 4IKFA 3A5ZB 5C6SA 3ASKA 4FL6A 2DTHA 3OW2S 2DZ9A 4JUVA 5CO7A 3FB9A 4A4KA 3VYHB 4TVRA 3FLGA 1XOVA 3VKIA 1VQLA 4ELZC 4M75G 2QQ9A 2E1HA 3L2ZA 3JCMJ 2WSCE 1Q7YC 3CC4A 3CCET 4PL6A 5I21A 1R8OB 1VUBA 1Y96A 2QTXA 2XKOC 3OBWA 4Y28E 3JCMb 2E41A 2QI2A 3JCMP 2DXUA 1AHJB 1JJ2A 4L6V5 4BDYA 2XK0A 3ZEHA 3CC2T 4M7AB 2YHTA 3UT1A 2D9TA 4OB2B 2DEQA 3QZ9B 3QXEB 4XTVA 2JOYA 5CVIA 3PIOA 3CCSA 1BI1A 4FU6A 2FB7A 2DD5A 4IUTA 4M7DC 4MZMA 3JCMh 2EJFA 5IN1A 4C8QB 4KUDK 1VQ4A 1W2BS 4UC4A 1V29B 2F5TX 3C95A 5CQYA 5CK9A 3RKYA 3OW2A 1VQNA 1YITT 2CZ1B 2LT1A 4M78D 2D0QB 1JBMA 1K8AU 3WXMB 3SFMA 3NTIA 3CCVT 2DZCA 2RJDA 5GAN5 1Q86U 4O6JA 4OGCA 4MZPA 3L2VA 2DXCA 3WVDB 5HY6A 2MMPA 3JCMg 3OSSC 1JB0E 4M75E 4C0DB 3DB4A 1Q82C 3QYGB 4PJOA 4XTYA 1RI0A 5LL6S 4HCZA 5KE3A 2G3RA 3CCEA 5A0GA 5FU6C 4N4IA 1O9SA 2BUDA 4M77C 3VUBA 4JRPA 1N6AA 3CMAT 2XU8A 1PSEA 1W2BA 2K4YA 2HBPA 2PVDB 3META 1KC8C 5FRMA 5HKCA 3CC2A 3CEYA 5EG2A 5GAOm 2GFAA 2XI9A 4PJOD 5LJ3e 2LQKA 2ZZDA 1XQHA 1M1KU 4EDUA 1WQWA 1Y96B 4E7JA 1Q81U 3M5AA 2EQMA 3GNGA 1I8FA 3OSVA 5LJ5h 4PJOF 1K8AC 1NPPA 2GCXA 1VQ5T 2QQBA 3CPWS 5I2SA 1HK9A 4RCBA 2QDYB 1Q86C 1NPRA 4C0FA 3HRTA 3JCMd 2X4YA 4N0AA 2F5KA 5LJ3j 1YITA 2CZ6B 1QVPA 4MDXA 3CPFA 4PKCC 3QUIA 4LDUA 3BDLA 2MWOA 1YJNT 2EJ9A 2X4WA 4A54A 3CCVA 4BACA 4HKEA 4FIBA 3JCMQ 3FIFA 1IZ6A 4OMFB 4C8QC 5LJ5g 5FRNA 5GANj 2E6NA 3LWHA 3HL8A 4BDZA 2YRVA 2XD0A 5HK0A 3HKSA 3QO3A 4DQ2A 4EMKA 1G5VA 4B9XA 3FDRA 1OZ2A 5GAOr 1K73C 4P5NA 4XTXA 3SDZA 1I5LA 2DAQA 3QJYA 1MHNA 3CMAA 2FL7A 3CPWA 2E64A 2VUBA 1BIBA 4X9DA 4XU1A 1PSFA 4M7DB 2V8IA 2E70A 2R57A 4GY5A 3LGFA 3PT9A 3RMQA 2RD1A 4C0DC 4VUBA 2LNVA 5CAIA 1K9MU 2EQJA 4ZN1A 4M77G 4F7UB 3N5BB 1QVGS 3CCLT 4C92G 3KUFA 5KE2A 5CCAA 4Y91A 1VQ5A 4HT8A 2Y4XA 2E10A 2LCLA 4JRKA 2E12A 5LJ5d 1VQKT 2L89A 5GAOn 2QEXT 2RHUA 5D6XA 3SWNA 5J39A 3CCUT 2RJEA 3P8BB 5A0LA 3DKMA 1QP2A 3OYGA 5I2MA 1UGQB 1G3TA 1M5Q1 4N4GA 2XDDA 1YJNA 4HCCA 2DD4A 4QW2A 5GAMh 3QZ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM P;  2DXU A;  5GAN 2;  3V7S A;  3RES A;  3JB9 H;  4M7A B;  2YHT A;  1WNL A;  1BIA A;  2VXE A;  4M7D A;  2DEQ A;  2FYK A;  4XTZ A;  4M7A G;  4PJO B;  5LJ5 j;  3PGG A;  4XTV A;  4PJO G;  4M7D C;  2FB7 A;  2DXT A;  5GAN h;  4C92 A;  3RER A;  4F7U A;  4NL3 A;  3AHU A;  5GMK l;  3JCM h;  2EJF A;  1B34 B;  4C92 C;  4WF2 A;  4XU2 A;  4C8Q B;  4J5Y A;  4C8Q G;  5GMK e;  5LJ3 g;  3RKY A;  5GAN 3;  1LNX A;  2EWN A;  4M78 E;  5GAM g;  4M7D E;  5GAO q;  4QVD A;  4X9C A;  2Y90 A;  4M75 A;  2ZGW A;  4M78 D;  5GAN 7;  4HA8 A;  4M7D D;  4J6Y A;  4M77 E;  4M75 C;  4EMK B;  3JCM X;  1JBM A;  4C92 E;  1M8V A;  5GMK i;  4F7U E;  4M77 D;  2E65 A;  3BY7 A;  4C92 D;  1U1S A;  1D3B B;  4M7D F;  2DZC A;  3JCM c;  5GMK j;  5GAN 5;  4V2S A;  5GAN g;  4C92 F;  3SB2 A;  4F7U F;  3JCM g;  4M7A A;  4M75 E;  2EAY A;  2I2L A;  5GAN e;  5LJ3 f;  3JB9 G;  4PJO A;  4M7A C;  4M75 D;  2DKG A;  1TH7 A;  4M78 A;  4J6X A;  4XTY A;  5GAM f;  4PJO C;  4M78 C;  4A53 A;  4M77 A;  4EMH A;  3HFN A;  1H64 1;  4M75 F;  1B34 A;  4M77 C;  4C8Q A;  3JCM W;  1LOJ A;  4XQ3 A;  1I4K 1;  3L1A A;  3BFM A;  3FJP A;  5LJ3 d;  4M7A E;  4QVC A;  5GAM d;  3EFS A;  4JLI A;  5GAN f;  4M7A D;  5GAO m;  4PJO E;  3V7R A;  3JCM f;  5DY9 A;  5LJ3 e;  3JB9 I;  4MML A;  2DTI A;  1JRI A;  5GAN 6;  3JB9 J;  1WQW A;  1Y96 B;  2CGH A;  4NOY A;  3RKX A;  5GAM e;  2YLB A;  4M7A F;  5GAO p;  1I8F A;  5LJ5 h;  4PJO F;  4C8Q E;  4M78 F;  1U1T A;  3RKW A;  4C8Q D;  5GAN d;  1HXD A;  1HK9 A;  4NL2 A;  1N9R A;  4RCB A;  4XU3 A;  3QSU A;  4M77 F;  3JCM d;  4HT9 A;  4N0A A;  2VXF A;  5LJ3 j;  4N0A C;  1LJO A;  4PJO D;  5GAM j;  4RCC A;  3QUI A;  4C92 B;  3JCM e;  3RIR A;  2EJ9 A;  4A54 A;  1N9S A;  4MMK A;  1MGQ A;  2DVE A;  3V8K A;  3GIB A;  3V8J A;  2RA2 A;  3JCM Q;  3FIF A;  5LJ5 g;  3BW1 A;  4C8Q C;  3JB9 D;  5GAN j;  5GMK h;  5GAN 8;  3M4G A;  5GAO l;  2EJG A;  4J6W A;  3RUX A;  3SWN B;  3V7C A;  2DJZ A;  1I81 A;  3QO3 A;  4OP0 A;  3VU3 C;  4DQ2 A;  4EMK A;  3QHS A;  3JB9 F;  5GAO r;  3JCM V;  4EMK C;  4XTX A;  3BDU A;  1D3B A;  2VC8 A;  1I5L A;  1YCY A;  1WQ7 A;  2DTO A;  3JCM b;  2E64 A;  1BIB A;  4X9D A;  4XU1 A;  4M78 B;  2HNI A;  4XTU A;  4M7D B;  4M78 G;  5LJ5 f;  4C8Q F;  4M7D G;  2JN0 A;  5CAI A;  2RB6 A;  4PNO A;  4XU0 A;  2RD1 A;  4M77 B;  1KQ2 A;  5GAN 4;  1KQ1 A;  3EFR A;  3HSB A;  4M77 G;  4F7U B;  5GMK m;  4XTW A;  4C92 G;  4F7U G;  2DTH A;  2YLC A;  4Y91 A;  4JRI A;  3V8L A;  2DZ9 A;  4JUV A;  4HT8 A;  2E10 A;  3HFO A;  4JRK A;  3FB9 A;  2RM4 A;  5LJ5 d;  5GAO n;  4M75 B;  3SWN A;  4M75 G;  5LJ5 e;  2E1H A;  1WPY A;  3L2Z A;  3SWN C;  5GAM h;  1X01 A;  3JCM J;  5LJ3 h;  1M5Q 1;  1Y96 A;  2QTX A;  3INZ A;  5I21 A;  2K57 A;  4EMG A;  2E41 A; 
#chains in the Genus database with same CATH topology
 2KI7 A;  1D1B A;  1AD5 A;  2B8A A;  1I07 A;  1BIA A;  3JAM E;  3VS4 A;  2J6O A;  1KHC A;  2F1L A;  3ZL7 C;  1B34 B;  3SD4 A;  1QVG A;  3OS0 A;  4C8Q G;  5GMK e;  2KAF A;  2EWN A;  2IG0 A;  2HSP A;  1M8V A;  5GJW B;  2ZCF B;  1YIJ T;  1YCS B;  5GMK j;  3CD6 T;  5GJV B;  3G7Z A;  1VIF A;  1FX7 A;  2M1H A;  4QQD A;  3NGP A;  4M75 D;  3MCA B;  4PJO C;  3QDR B;  1ZSZ C;  2EBP A;  4A53 A;  2X4X A;  4D8K A;  4M75 F;  1WJQ A;  1ABO A;  1WJS A;  4C0Z A;  1KC8 U;  2PUO B;  5CIU A;  5GAM d;  4QQG A;  1VQ8 T;  3J80 E;  3JB9 I;  4MML A;  1JRI A;  1QKW A;  3OYD A;  1C0M A;  4NOY A;  4C8Q E;  4M78 F;  1M90 R;  2LJ0 A;  2VXF A;  2O4X A;  1YWO A;  4D8D A;  1LJO A;  4FT4 A;  3L2R A;  2ZPG B;  1H3Z A;  4PJJ A;  2CP7 A;  5A2Q E;  1TOV A;  4IUV A;  2D6F A;  1RLP C;  3C0C A;  1NJI U;  1Q86 R;  2YUQ A;  2K5I A;  9ATC B;  4FSS A;  1UGP B;  1OUL A;  2VV5 A;  2LCC A;  3DLM A;  4E2F B;  3CCR A;  4EMK C;  3CC7 A;  1VQ6 T;  3OYH A;  4M78 B;  4PLL A;  1VQ7 A;  2X51 A;  1RAH B;  3EFR A;  2P0P A;  2E3H A;  5CKH A;  1K73 R;  1WA7 A;  4F7U G;  2C06 A;  1WIE A;  1X2Q A;  2P0Q A;  1M8M A;  2XMF A;  1B07 A;  3CCS Q;  1WPY A;  2HCK A;  2HKN A;  5LJ3 h;  1E6H A;  2QYZ A;  3VV0 A;  3GP8 A;  3RES A;  4FYV B;  1VQN Q;  2EQI A;  2HZY A;  4PJO B;  3PGG A;  2RQU A;  3CCQ A;  1T0H A;  2YXY A;  1PD0 A;  3OYE A;  3G4S T;  2RQR A;  3VS5 A;  3CCM T;  3M0T A;  3MP8 A;  1AT1 B;  1RAA B;  4ZNX A;  5KYW B;  2CT3 A;  4X9C A;  4RTV A;  2XDB A;  2JTM A;  4F7U E;  1TUG B;  5M9O A;  5J26 A;  1D3B B;  1MNE A;  1UG1 A;  4C0G A;  1KQS S;  1OU9 A;  4M7A A;  4FW2 A;  3OYC A;  1R77 A;  3O8V A;  2CZ0 B;  3BFM A;  5LJ3 d;  3M0S A;  4JJC A;  5I22 A;  2OTL A;  2HEQ A;  2BKD N;  3EFO B;  1VQ7 Q;  2YUO A;  3JRZ A;  3JB9 J;  1JJ2 S;  2E4H A;  5CR2 A;  3CBP A;  3LLR A;  4HT9 A;  3OYB A;  2KRN A;  2FVU A;  3M55 A;  3JCM e;  2LZ6 B;  1W1F A;  2HDA A;  2NUT B;  1NEG A;  3V8J A;  1WJR A;  2M0O A;  5DLO A;  4KGX B;  3RUX A;  2LQW A;  1ZQ1 A;  2FRY A;  2HQE A;  1BI2 A;  3MKD A;  3THK A;  2CSQ A;  3EGX B;  5KYY A;  1NBE B;  4OB1 B;  1YJW A;  1T0J A;  3OS5 A;  3ER0 A;  1B7T A;  4E7Z A;  4PNO A;  4XU0 A;  5GAN 4;  3CCJ T;  2WSF E;  1Q82 C;  2LRQ A;  1FWZ A;  2V26 A;  4YTL A;  2K3Y A;  3HFO A;  2V1Q A;  4B9W A;  4HXJ A;  2W10 A;  1X6O A;  5KH6 A;  1OZ3 A;  4MZT A;  5LJ5 e;  1YI2 T;  2ZPI B;  4EMG A;  1WX6 A;  3LW5 E;  2DYB A;  2EGA A;  2OTL Q;  2C0I A;  2DBK A;  2EFI A;  2O88 A;  4M7D A;  2RJC A;  5LJ5 j;  3CXC S;  2LT4 A;  1G8X A;  3R6O A;  1KD1 U;  4PFZ A;  3CME T;  2VVK A;  2KXD A;  2QEX Q;  3H6Z A;  4KRT A;  4LDX A;  1IGU A;  2AT1 B;  3G1J A;  1B3Q A;  5FLX E;  3C4S A;  1MMA A;  5IH2 A;  5GAN e;  2O4X B;  1QVF S;  4M7A C;  1N8R U;  2RMO A;  3OBY A;  3REA B;  3OYL A;  3A8L B;  1OYX A;  5CKB A;  2KE9 A;  4JLI A;  1J3T A;  5DY9 A;  2K2V A;  2A08 A;  5GAM e;  4E7L A;  3GPL A;  3UAT A;  2PVO B;  4KGV B;  1ARK A;  4J9E A;  4M77 F;  4LDW A;  4LD6 A;  1QCF A;  5GAM j;  5IXF A;  3CC4 T;  3RIR A;  2RI3 A;  2PUK B;  3I55 A;  4M4Z A;  3M53 A;  1OI1 A;  1FYN A;  3P8D A;  3LWI A;  3I5S A;  4OGE A;  3TRE A;  2EJG A;  2D1X A;  3OYM A;  2OTJ Q;  1OQK A;  2JNG A;  2D8J A;  1PCX A;  2C0T A;  2VC8 A;  3MPU B;  1RAF B;  1KG1 A;  2E3I A;  3E9F A;  1JQQ A;  2RHY A;  1KQ2 A;  4M77 B;  2VGM A;  3OMG A;  2GGR A;  1V76 A;  5C6S A;  3ASK A;  2KRO A;  2DZ9 A;  2NWM A;  3VKI A;  1VQL A;  2Z0W A;  1BB9 A;  1Q7Y C;  3CCE T;  4OMN A;  4PL6 A;  1UJ0 A;  1R8O B;  2XKO C;  1RAI B;  1Q82 R;  2PZ1 A;  4JJB A;  2G6F X;  3SHW A;  4L6V 5;  4M7A B;  1R0C B;  4M7D C;  1PNJ A;  1VQ4 A;  1V29 B;  2F5T X;  1M3A A;  5CQY A;  5CK9 A;  1G2B A;  1YIT T;  2I0N A;  5HCK A;  3WXM B;  3I55 Q;  2HL5 C;  3CCV T;  2DZC A;  3M0P A;  4KH1 B;  2SEM A;  1UTI A;  1K1Z A;  3QYG B;  2W0Z A;  1RI0 A;  1U06 A;  4HCZ A;  2NUP A;  4N4I A;  6AT1 B;  2X9H A;  1JXM A;  2XU8 A;  2K4Y A;  1KC8 C;  2EPD A;  3CC2 A;  5EG2 A;  5GAO m;  2GQI A;  2GFA A;  2XI9 A;  5LJ3 e;  2LQK A;  1M1K U;  1WQW A;  4E7J A;  1Q81 U;  1X6G A;  4J9I A;  1I8F A;  5KYY B;  1HK9 A;  2QDY B;  1NPR A;  1VQL Q;  4J9D A;  4Y92 A;  5LJ3 j;  3VS7 A;  1QVP A;  4MDX A;  3QUI A;  4LDU A;  2M02 A;  3BDL A;  1YJN T;  4A54 A;  3FIF A;  2COY A;  3I35 A;  1KSW A;  4OMF B;  5FRN A;  2E6N A;  3EG0 A;  3AT1 B;  1FMV A;  1G5V A;  3O5Z A;  3FDR A;  1OZ2 A;  4F17 A;  1AWW A;  3CPW A;  2AKK A;  2JMA A;  4XU1 A;  4M7D B;  2V8I A;  4C0D C;  1TUC A;  4GY5 A;  2RF0 A;  3PT9 A;  2RD1 A;  5CAI A;  2EQJ A;  4ZN1 A;  3CCL T;  4C92 G;  1PD1 A;  5CCA A;  1SF9 A;  4K11 A;  2F2X A;  2LCL A;  1IO6 A;  4JRK A;  2J05 A;  5GAO n;  3VRY A;  1SRM A;  2AK5 A;  5D6X A;  1T3S A;  3P8B B;  1D1C A;  1UGQ B;  1M5Q 1;  1OPK A;  3QZ5 B;  3H0H A;  2MIO A;  1MMN A;  1Z9Q A;  4FW1 A;  3NTH A;  3QJ6 A;  2CS7 A;  1WLP B;  2DXT A;  1Q7Y R;  1K9M C;  1UEC A;  2RO0 A;  3OYK A;  4GLK A;  4II1 A;  1IRE B;  4M75 A;  2ZGW A;  5CKF A;  5GAN 7;  2DK3 A;  3JCM X;  4C92 E;  2JUF A;  2KYM A;  3P8H A;  1VQM T;  4V2S A;  4C5H A;  1HJD A;  2JT4 A;  3G6E T;  2DX1 A;  2DL5 A;  2A3L A;  3ME9 A;  1GRI A;  4M78 A;  5KCO A;  5CQX A;  3CCU A;  4PFO A;  3L1A A;  3OW2 P;  1X6B A;  1PWT A;  4QVC A;  3HPW A;  1SPK A;  3JCM f;  2DTI A;  1GCP A;  2YLB A;  2ENM A;  2DVJ A;  1YJ9 T;  2Y4Y A;  1KC8 R;  3GLX A;  3VS0 A;  1MMG A;  3LX7 A;  2DBM A;  4A63 B;  2L0A A;  1M90 C;  4LDY A;  1YIJ A;  1HYO A;  1W2B P;  3CD6 A;  4QQ6 A;  4DBR A;  5KYW A;  1LPL A;  4J6W A;  5EC7 A;  3V7C A;  5KYU A;  1I81 A;  3GNF B;  1PM3 A;  2JTE A;  1D3B A;  3OYA A;  1LCK A;  2EVR A;  5LJ5 f;  3OS2 A;  1VQ8 A;  1VQO T;  5IHK A;  3VS3 A;  2KDS A;  4KBM B;  3EFO A;  2QA4 T;  4ZGJ B;  1M4Z A;  3CCU Q;  3T9N A;  2VWF A;  1M3B A;  1Y07 A;  3OY9 A;  2F2W A;  3GOX A;  1KHI A;  4MDW A;  4QKU A;  5GAN 2;  3OB9 A;  1K4U S;  2XDP A;  2JTF A;  3NHN A;  3E1S A;  2DJQ A;  3G71 T;  1UE9 A;  2GQV A;  2QAZ A;  3QPH A;  4J9G A;  5GAN h;  2NUP B;  2YUN A;  4IUR A;  4QVD A;  1VQ6 A;  5DM7 R;  4J6Y A;  4AMC A;  4E7K A;  4M75 C;  4OF1 A;  3BY7 A;  1K9M R;  2KXC A;  4IUP A;  4RG2 A;  2LX7 A;  3MEA A;  2GF7 A;  1SEM A;  1RAD B;  4J6X A;  5GAM f;  3M0U A;  4PFP A;  1N8R C;  2L2P A;  4M78 C;  3TCJ A;  2P84 A;  4EMH A;  2DIQ A;  2QG9 B;  4BI4 A;  1NLP C;  3NTK A;  2RK2 A;  1TG0 A;  1VQ8 Q;  3H0I A;  2MK5 A;  5GAN 6;  2X35 A;  3G4S A;  4C8Q D;  5GAN d;  3CCM A;  3QKJ A;  3E9G A;  1KQS A;  4ZGD B;  1P92 A;  3TSZ A;  3MEW A;  4DA4 A;  2DFU A;  4A4E A;  2H3J A;  3CMA Q;  2LJ1 A;  3CQT A;  1KJW A;  5AYF A;  4X1V A;  2GBQ A;  1NLO C;  2XG8 D;  1VQ6 Q;  1GCQ A;  2X3W D;  1PRL C;  1AVZ C;  4M78 G;  2ROT A;  2JN0 A;  3F70 A;  4ZTJ A;  2DET A;  1K0X A;  2LDM A;  2NUZ A;  3A8G B;  5GMK m;  2YLC A;  3RBB B;  4JRI A;  1NYF A;  1GL5 A;  3EG9 A;  1RI9 A;  4M75 B;  1PRM C;  3UWN A;  3VUZ A;  3FC3 A;  2L3S A;  1RL2 A;  1RAB B;  3L2Q A;  3M59 A;  2PVG B;  3JB9 H;  3S6W A;  2RHX A;  4DBF A;  4JDS A;  4PJO G;  2OAU A;  4ESR A;  3QDF A;  3M58 A;  3G4S Q;  2E5K A;  1AEY A;  4XU2 A;  2D0N A;  1AWJ A;  2A0F B;  4M78 E;  2EYQ A;  1IXD A;  4C5G A;  3CCJ A;  4EPC A;  3EGD A;  4O5V A;  1QMC A;  4F7U F;  4E7H A;  1VQ9 T;  5LJ3 f;  4AFQ C;  2EYZ A;  2BIV A;  1ZLM A;  3CXC A;  2ZAE A;  4M77 A;  1M1F A;  3HFN A;  4AFZ C;  2ECZ A;  1YI2 A;  2CP0 A;  1I4K 1;  1RAE B;  2HD0 A;  2DO3 A;  2XID A;  1FMK A;  1K9A A;  4PJO E;  2VGN A;  1YBY A;  4QVZ A;  2FPF A;  5KYU B;  5FW9 A;  1ZA2 B;  1EFN A;  2CGH A;  1N8R R;  1EZZ B;  1M1K C;  1F1B B;  3HP9 A;  1UGR B;  5D6Y A;  1Q81 C;  2L8D A;  2LC4 A;  2KEA A;  3NMZ C;  4NL2 A;  3A1P A;  4GLM A;  2MAM A;  3S3M A;  3CME A;  2EIF A;  3EG1 A;  1QVF A;  5J3B A;  3CCR Q;  5CKE A;  1ZBX A;  1H3H A;  3CC7 Q;  2EYX A;  2VKN A;  2CYZ B;  4C5E A;  3CCS T;  4RTW A;  3EHQ A;  4OP0 A;  2FZC B;  4XAX B;  1S1N A;  1X43 A;  2RQT A;  3DB3 A;  1FMW A;  5A0D A;  2LVM A;  1JXO A;  3A8H B;  3C12 A;  2OAW A;  4RTZ A;  1GCQ C;  4IKF A;  3MJX A;  3A5Z B;  4FL6 A;  2DTH A;  3OW2 S;  3FB9 A;  2V1R A;  1CSK A;  3R6N A;  2E1H A;  2AIR B;  2WSC E;  4J9C A;  3CC4 A;  3OYJ A;  3CCQ Q;  1VUB A;  5D7U A;  4RTY A;  1UFF A;  2YHT A;  5CVI A;  2JOY A;  3PIO A;  2DD5 A;  3LH5 A;  1SSH A;  4QT7 A;  5IN1 A;  4OMP A;  3TVT A;  1W2B S;  3JV3 A;  2CZ1 B;  1BU1 A;  4FYX B;  3UF4 A;  1Q86 U;  4OGC A;  4MZP A;  1PKT A;  2VAS A;  3OSS C;  3JCM g;  3U23 A;  1M30 A;  4XTY A;  1XJW B;  5LL6 S;  3UA7 A;  2JXB A;  2ED0 A;  3CCE A;  5A0G A;  4M77 C;  3VUB A;  4JRP A;  4OMQ A;  2QK0 A;  1PSE A;  1QWF A;  2EKH A;  2ZZD A;  4EDU A;  3GNG A;  1K8A C;  1NPP A;  1VQ5 T;  2J6F A;  4GBQ A;  1U3O A;  1YIT A;  2JS0 A;  2DEU A;  3CC4 Q;  1M1K R;  2FO0 A;  2X4W A;  1YJW Q;  3TQ7 P;  3CCV A;  1Q81 R;  1IB8 A;  4AG1 C;  5LJ5 g;  5GAN j;  3EG9 B;  3HL8 A;  2HMA A;  3HKS A;  1WI7 A;  1PKS A;  4E7S A;  1TTH B;  2CH4 A;  1I5L A;  2M0Y A;  2VUB A;  1PSF A;  2E70 A;  2L3P A;  1WXT A;  4M77 G;  3N5B B;  3KUF A;  4PJM A;  2K79 A;  2E12 A;  1ZSG A;  1VQK T;  2LCS A;  5I11 A;  2QEX T;  2RHU A;  2QGF B;  5J39 A;  3CCE Q;  5I2M A;  4F04 B;  1YJN A;  2DD4 A;  2CUD A;  3OYY A;  3OQ5 A;  3EGD B;  3V7S A;  2QDL A;  2FZG B;  1WHM A;  1QQJ A;  4D6W A;  4M7A G;  5KCH A;  4C5I A;  4NL3 A;  1VYU A;  2QTV A;  4A4H A;  4LE9 A;  1YIT Q;  5GAM g;  2K2M A;  4M77 E;  1ZUY A;  4CI0 C;  5GMK i;  4BD3 A;  2DER A;  1G3Y A;  4OVA A;  3ZFJ A;  5IXB A;  3CCL A;  1BI3 A;  1UGS B;  3H9N A;  2NYS A;  2J7I A;  4ANJ A;  4AFU C;  3JB9 G;  2JMC A;  3M57 A;  2DKG A;  4JLG A;  1UDL A;  2ESW A;  1BYM A;  5FWC A;  4M7A E;  2L3Q A;  4JJD A;  3X25 B;  4JS5 A;  2OTJ T;  1SSF A;  4LDV A;  4KT0 E;  4Z8A A;  3QII A;  4JZ3 A;  4ELY C;  3QSU A;  2RHI A;  1D0Z A;  5DLQ E;  1D1A A;  4RCC A;  1NM7 A;  4OMM A;  1YJN Q;  3X28 B;  1WHJ A;  2DL7 A;  2KK4 A;  3ULR B;  4MMK A;  4J83 A;  4LUD A;  1K8A R;  1VQM A;  1UEB A;  2YT6 A;  3G6E A;  1YHQ T;  3BW1 A;  3MEV A;  3M4G A;  4KUL A;  2FHD A;  2DJZ A;  4IUQ A;  4F14 A;  4RUG A;  2V8J A;  2DMO A;  1WXU A;  4ATO A;  4JRQ A;  1W70 A;  4XTU A;  5D6W A;  4M7D G;  1KQ1 A;  1LVK A;  4IIO A;  3CCL Q;  1YJ9 A;  3V8L A;  2O9S A;  3PMI A;  1NJI C;  1WHK A;  1D0X A;  2MI6 A;  5GAM h;  1X01 A;  1X2K A;  1OU8 A;  2IVW A;  1VQ4 Q;  3EAE A;  4ZTF A;  1WFW A;  3S3N A;  1M9S A;  3OS1 A;  3PE0 A;  2COW A;  2X3X D;  1NZ9 A;  5LJ3 g;  1C1A A;  1QP3 A;  4M7D E;  3D7S B;  1AZE A;  4EIK A;  3JSC A;  1VQO A;  1A0N B;  5AT1 B;  4C92 D;  1ZHI A;  2A7Y A;  3TU4 K;  1WHL A;  3G6E Q;  2KY9 A;  4C92 F;  1BKB A;  2JVV A;  3CC2 Q;  4FYW B;  2QA4 A;  3UA6 A;  1VYV A;  4OB0 B;  2O01 E;  3L2W A;  1VQP T;  1QVG P;  4C8Q A;  4A4F A;  1YWP A;  4FM4 B;  5IT9 E;  1JEG A;  4E47 A;  3EFS A;  1QWE A;  3M56 A;  1WYX A;  1SHF A;  3M54 A;  2H8H A;  3G71 A;  3TSW A;  2EGE A;  2KRM A;  3VJP A;  1YJ9 Q;  1UHC A;  5GAO p;  4A4G A;  1KQS P;  2YRD A;  4RG8 A;  2HAX A;  1NEB A;  2WAC A;  1GFC A;  3X26 B;  2LNH B;  4Q5W A;  4C92 B;  1WXB A;  1AWX A;  2DVE A;  1M2O A;  2GNC A;  2RA2 A;  1UJY A;  1TU0 B;  2EYW A;  5GAO l;  1Y0M A;  3JCM V;  3A98 A;  3CBM A;  1E7O A;  1S72 T;  3HRS A;  1RUW A;  1G3S A;  4OB3 B;  2KNB B;  1VQO Q;  2F2V A;  5KYX A;  3MP6 A;  4BY6 B;  2DPP B;  2HBW A;  1G3W A;  3IQL A;  1ZA1 B;  3KFV A;  2QA4 Q;  2JJ9 A;  1ZUU A;  3INZ A;  4NS5 A;  1MUZ A;  4Z89 A;  2QQR A;  3EG2 A;  3I56 T;  1QW1 A;  4OML A;  3HHT B;  1WNL A;  2MF2 A;  4JJN K;  3QBY A;  1SHG A;  4CC7 A;  3G71 Q;  1NJI R;  2KSS A;  5L8R E;  4J8O A;  4F7U A;  2MYS A;  3Q1J A;  5GAN 3;  2KT1 A;  1LNX A;  4X34 A;  2K5F A;  1BCM A;  4Z02 A;  3PVL A;  3EGU A;  3FEO A;  4J9H A;  1U1S A;  3H8Z A;  3L42 A;  1I5O B;  1W4S A;  1RAC B;  3SB2 A;  4JS4 A;  2EAY A;  3MO8 A;  1Q95 G;  3CXC P;  1MV3 A;  1TH7 A;  2M51 A;  2MWP A;  4WTO B;  1H64 1;  3JCM W;  5GAN f;  1N27 A;  1KD1 C;  4IUU A;  3PFS A;  2RNA A;  1ACM B;  3OYI A;  3RKX A;  3RDV A;  2KRS A;  1YIJ Q;  2RI2 A;  3CD6 Q;  5HK3 A;  2EKO A;  4DBQ A;  3MEU A;  1NYG A;  2BE9 B;  3RNJ A;  1OEB A;  4CRI A;  4AG2 C;  1N9S A;  3HRU A;  2CRE A;  4PLI A;  4N4H A;  2NLU A;  1Q7Y U;  3C94 A;  3KBG A;  1VQ9 A;  1WGS A;  3QHS A;  3URG A;  1MV0 B;  1I0C A;  2HQX A;  2OX7 A;  2DL3 A;  4KGZ B;  2QXF A;  5IAY A;  2HNI A;  3DLL A;  5FU6 B;  4C8Q F;  2KQW A;  1CKA A;  1MND A;  2FRW A;  2FZK B;  3VYH B;  3REB B;  1XOV A;  2HQH A;  4LN2 A;  4M75 G;  1M3C A;  2OI3 A;  2QQ9 A;  3PVQ A;  3JCM J;  5I21 A;  4Y28 E;  3JCM b;  2DXU A;  1OPL A;  1JJ2 A;  2XK0 A;  3ZEH A;  1OOT A;  1ZUK A;  2D9T A;  3QZ9 B;  2MPX C;  2EGC A;  3CCS A;  1BI1 A;  3VS2 A;  2FB7 A;  2GTJ A;  4HVW A;  2EJF A;  4C8Q B;  4KUD K;  3OW2 A;  2O2O A;  1VQN A;  2PTK A;  4M78 D;  2H3E B;  2D0Q B;  1C6V X;  3SFM A;  2RJD A;  3WVD B;  4ORZ A;  2FG0 A;  1V1C A;  1JB0 E;  4M75 E;  1VQ9 Q;  3DB4 A;  2ABL A;  5KE3 A;  3VS1 A;  1O9S A;  2BUD A;  1U5S A;  1N6A A;  3CCM Q;  3CMA T;  1W2B A;  2HBP A;  5FRM A;  5HKC A;  3CEY A;  2AZS A;  4PJO D;  1XQH A;  1Y96 B;  1D09 B;  2EQM A;  2J06 A;  1W6X A;  4PJO F;  2QQB A;  5I2S A;  4LXC A;  4N0A A;  2MOX A;  2CDT A;  2F5K A;  1E6G A;  2IIM A;  2ROL A;  2KGT A;  4OMO A;  1KD1 R;  3CPF A;  2MWO A;  5KYX B;  4HKE A;  2CT4 A;  3JCM Q;  1X27 A;  1H8K A;  2BZ8 A;  2KBT A;  1AWO A;  5HK0 A;  2DM1 A;  2RPN A;  2LMJ A;  5GAO r;  4P5N A;  3SDZ A;  1GBQ A;  2FL7 A;  4WCI A;  4X9D A;  1ZSZ B;  1N5Z A;  2R57 A;  1K9M U;  2DE0 X;  4F7U B;  1QVG S;  2RQV A;  1ABQ A;  5KE2 A;  4Y91 A;  1VQ5 A;  4HT8 A;  3SWN A;  4J9B A;  5A0L A;  2KR3 A;  4HCC A;  4N4G A;  3GBQ A;  1QCN A;  2AKL A;  3RMS A;  1BI0 A;  1TUD A;  3E2U A;  1VQN T;  3M0Q A;  2FYK A;  4XTZ A;  4E6R A;  1IRX A;  1OV3 A;  4DOV A;  4FSX A;  3RR6 A;  3CCJ Q;  5GMK l;  4LD9 K;  2R5A A;  4AFS C;  2BZY A;  4WF2 A;  2FPD A;  3J81 E;  1HD3 A;  2Y90 A;  4HA8 A;  3WVE B;  2ZPF B;  4XK8 E;  4EMK B;  2E5Q A;  2EYY A;  1YI2 Q;  1O75 A;  1G83 A;  3JCM c;  5CKD A;  3S3O A;  2JM9 A;  4E7I A;  2VB6 A;  5L23 A;  1K0S A;  1VQK A;  2CKK A;  2QEX A;  3L2U A;  4BB7 A;  2F69 A;  4JZ4 A;  4CC2 A;  3CCR T;  3X24 B;  1M90 U;  2LQ8 A;  2CH4 W;  2O9V A;  4HCK A;  3GF5 A;  4J7I A;  2ZPE B;  4DEY A;  3CC7 T;  4L5G A;  1VQ7 T;  3CME Q;  2COZ A;  1AOJ A;  4BE1 A;  3V7R A;  2DLP A;  2HKQ B;  1VQ5 Q;  2YSQ A;  3RKW A;  2XHC A;  3E19 A;  4XU3 A;  2PQW A;  2BZX A;  2P4T A;  1OX8 A;  4N0A C;  1ZBJ A;  1DJ7 B;  3GIB A;  3VS6 A;  2DNU A;  1Y71 A;  2KMT A;  5GAN 8;  4DOW A;  1K73 U;  3ZBD A;  3CCQ T;  1M1G A;  4JPB W;  2FEI A;  3BDU A;  1JU5 C;  3J7A F;  2DTO A;  2RI5 A;  2DYI A;  1VYT A;  2DXB A;  2IPO B;  2LTO A;  2OTJ A;  2RB6 A;  3HSB A;  1Z9Z A;  3OA6 A;  5FWB A;  1PHT A;  4J9F A;  1VQK Q;  2RHZ A;  3UPU A;  1WDX A;  2KT8 A;  1TSF A;  1K76 A;  5ECA A;  4AT1 B;  3EG3 A;  3SWN C;  3LH0 A;  1VOM A;  2RJF A;  2K57 A;  2K5L A;  3SEM A;  2OTL T;  3CPW P;  2CSI A;  1X75 C;  1YHQ A;  3I5R A;  1YNZ A;  2RN8 A;  3PNW C;  1QLY A;  4R56 A;  2XIC A;  4C92 A;  2QQS A;  3RER A;  1PG5 B;  3H41 A;  3MP1 A;  5GAO q;  3NPF A;  2RK1 A;  1KK7 A;  2DF6 A;  4M77 D;  2E65 A;  5GAN g;  1VIE A;  4B6M A;  3M9Q A;  2I2L A;  1GFD A;  4LNP A;  1YJW T;  2EQK A;  1YN8 A;  2AHJ B;  2C0O A;  1LOJ A;  1GXI E;  2ATC B;  3LYI A;  3LGL A;  4M7A D;  4RTX A;  2D8H A;  2L5Q A;  1EIF A;  2LX9 A;  7AT1 B;  4M7A F;  1JO8 A;  5FU7 C;  1M2V A;  2J6K A;  3CCV Q;  1U1T A;  1ZX6 A;  2CP2 A;  3VYG A;  2QGG A;  3EHR A;  3PTA A;  1X69 A;  2GFU A;  3NFC A;  3M4Y A;  5FRO A;  2KYB A;  2VYT A;  1XTD A;  2EW3 A;  1UB4 A;  4ZN3 A;  1MGQ A;  2R5M A;  3V8K A;  1FXX A;  2DRM A;  1U8R A;  1YHQ Q;  2B86 A;  3JB9 D;  4R55 A;  5GMK h;  4RKU E;  3SWN B;  1R0B G;  3OYN A;  1XNI A;  1NE8 A;  3JB9 F;  1TS9 A;  1Y7X A;  1VQP A;  1WQ7 A;  2ZPB B;  2DRK A;  2BE7 D;  4ME7 A;  4KH0 B;  5IHI A;  4BI3 A;  2E6Z A;  2EQU A;  1BCO A;  2AZV A;  2XD0 A;  2A37 A;  2YWW A;  1NG2 A;  1Y57 A;  4XTW A;  1YFN A;  4BE0 A;  4RMO A;  2GTO A;  4DEX A;  2RM4 A;  2ZPH B;  2K9G A;  3FJ5 A;  3QG1 A;  2MCN A;  2JM8 A;  2P0K A;  2R58 A;  2DIG A;  3H0F A;  3A8O B;  4BUG A;  3OYF A;  1IHV A;  2JZ2 A;  2LP5 A;  2VXE A;  3FRN A;  4HCB A;  4Z88 A;  1TWB A;  4BI8 B;  3AHU A;  4C92 C;  4IIM A;  4LUE A;  2P4R A;  2A36 A;  1WZO A;  1QCO A;  4J5Y A;  1S72 A;  1SG5 A;  1WHG A;  2LJ3 A;  2RQW A;  4M7D D;  4DBH A;  1M27 C;  5FU7 B;  2DIL A;  4R0K A;  2QQA A;  3I55 T;  4M7D F;  1WHH A;  1UHF A;  8AT1 B;  2CZ7 B;  2X4J A;  4PJN A;  4ZGE B;  2YDL A;  3CBO A;  1QKX A;  3HTR A;  1KIK A;  1H92 A;  3QYH B;  3MHX A;  1VQP Q;  3A8M B;  1B34 A;  4BE2 A;  4XQ3 A;  3FJP A;  4BY6 C;  2V8K A;  4FT2 A;  4J7F A;  3I56 A;  2A28 A;  4FYY B;  3EH1 A;  2M9U A;  2WSE E;  1HSQ A;  4KUI A;  2OJ2 A;  3PMT A;  4L59 A;  1VQM Q;  2RH2 A;  1HXD A;  1N9R A;  3KXT A;  1VQL T;  3TEE A;  2HSE B;  1T3L A;  2LQN A;  5C0M A;  1KFZ A;  3QWY A;  2CP5 A;  2M16 A;  4RTT A;  3OMC A;  4RTU A;  2KVQ G;  3VU3 C;  3PIP A;  2ED1 A;  1VQ4 T;  2K3X A;  1YCY A;  1S72 Q;  1EX4 A;  2L3R A;  3X20 B;  1CKB A;  1TXQ A;  1BBZ A;  3UDC A;  1D0Y A;  1SRL A;  1Q82 U;  2PU9 B;  4HVV A;  5KYN A;  1YP5 A;  2K3B A;  4JUV A;  3EH2 A;  5IHN A;  2SRC A;  5CO7 A;  4A4K A;  4TVR A;  3FLG A;  2CUB A;  2YRC A;  4ELZ C;  1AZG B;  1RAG B;  1IGQ A;  1SKU B;  3L2Z A;  1Y96 A;  2QTX A;  3OBW A;  1JJ2 P;  2E41 A;  2JW4 A;  2QI2 A;  3JCM P;  3I56 Q;  1AHJ B;  4BDY A;  3CC2 T;  3UT1 A;  4OB2 B;  2DEQ A;  3QXE B;  4XTV A;  2DA9 A;  3M0R A;  4FU6 A;  3QWX X;  4IUT A;  2O31 A;  4MZM A;  3VRZ A;  3JCM h;  4UC4 A;  3C95 A;  3RKY A;  2DL4 A;  2LT1 A;  1JBM A;  1K8A U;  3NTI A;  1M2V B;  3BE3 A;  5GAN 5;  4O6J A;  1RLQ C;  3L2V A;  2DXC A;  2FPE A;  1UUE A;  5HY6 A;  2MMP A;  4C0D B;  4PJO A;  1OX9 A;  1ZSZ A;  4PK4 A;  2G3R A;  5FU6 C;  1VA7 A;  2CP6 A;  2PVD B;  3MET A;  1BK2 A;  4F16 A;  2BTT A;  3M5A A;  2K6D A;  2QAS A;  3OSV A;  2K7A A;  5LJ5 h;  2GCX A;  3CPW S;  4RCB A;  1Q86 C;  4C0F A;  3HRT A;  3JCM d;  2X4Y A;  2CZ6 B;  2DL8 A;  1IHW A;  4PKC C;  4HVU A;  3I9Q A;  2EJ9 A;  2PNI A;  4FIB A;  2CP3 A;  1IZ6 A;  4C8Q C;  3LWH A;  4PJL A;  4BDZ A;  2YRV A;  1I1J A;  3QO3 A;  4DQ2 A;  4EMK A;  4B9X A;  1K73 C;  4XTX A;  2DAQ A;  3QJY A;  1MHN A;  3CMA A;  2E64 A;  1UGV A;  1BIB A;  8ATC B;  1QVF P;  4BAC A;  3LGF A;  3RMQ A;  4VUB A;  2LNV A;  2NUT A;  4CC3 A;  1MMD A;  2Y4X A;  2E10 A;  5LJ5 d;  2L89 A;  2HL3 A;  4FCY A;  4CC4 B;  2RJE A;  2YUP A;  3CCU T;  2JS2 A;  3DKM A;  1QP2 A;  3OYG A;  1GBR A;  1G3T A;  2XDD A;  1PC0 A;  4QW2 A;  3EGX A; 
#chains in the Genus database with same CATH homology
 3OYY A;  3OQ5 A;  2B8A A;  3RMS A;  3V7S A;  1BI0 A;  3NTH A;  3QJ6 A;  1VQN T;  1BIA A;  2CS7 A;  3JAM E;  2FYK A;  4XTZ A;  4D6W A;  5KCH A;  4M7A G;  1KHC A;  4DOV A;  4FSX A;  2DXT A;  4C5I A;  3OYJ A;  4NL3 A;  5GMK l;  1K9M C;  4LD9 K;  2R5A A;  1B34 B;  2RO0 A;  3OYK A;  4WF2 A;  3SD4 A;  1QVG A;  3OS0 A;  4A4H A;  4C8Q G;  5GMK e;  4GLK A;  2KAF A;  4II1 A;  3J81 E;  2EWN A;  5GAM g;  1IRE B;  2Y90 A;  4M75 A;  2ZGW A;  5CKF A;  4HA8 A;  2IG0 A;  5GAN 7;  2DK3 A;  2ZPF B;  3WVE B;  4XK8 E;  4M77 E;  4EMK B;  3JCM X;  1M8V A;  4C92 E;  4CI0 C;  5GMK i;  2JUF A;  4BD3 A;  1G3Y A;  4OVA A;  2E5Q A;  3ZFJ A;  3P8H A;  1O75 A;  2ZCF B;  1YIJ T;  3JCM c;  5GMK j;  5CKD A;  4C5H A;  1VQM T;  3CCL A;  3S3O A;  3CD6 T;  4V2S A;  1BI3 A;  1UGS B;  3G6E T;  3G7Z A;  1VIF A;  4E7I A;  1FX7 A;  2A3L A;  3ME9 A;  1VQK A;  2M1H A;  3JB9 G;  2CKK A;  4QQD A;  5KCO A;  3M57 A;  2DKG A;  4M75 D;  4M78 A;  4JLG A;  3L2U A;  2QEX A;  4BB7 A;  2F69 A;  3MCA B;  4PJO C;  5CQX A;  3CCU A;  3QDR B;  1BYM A;  3CCR T;  3X24 B;  1M90 U;  2LQ8 A;  4A53 A;  2X4X A;  4M75 F;  1WJQ A;  3GF5 A;  4J7I A;  1WJS A;  3L1A A;  4C0Z A;  2ZPE B;  1KC8 U;  3CC7 T;  2PUO B;  4M7A E;  5CIU A;  4QVC A;  4L5G A;  5GAM d;  3HPW A;  1VQ7 T;  4QQG A;  3X25 B;  4JS5 A;  4BE1 A;  1VQ8 T;  3V7R A;  3JCM f;  3J80 E;  2OTJ T;  3JB9 I;  1SSF A;  2DTI A;  1JRI A;  4LDV A;  4MML A;  3OYD A;  4NOY A;  4KT0 E;  2YLB A;  3QII A;  1YJ9 T;  4C8Q E;  4M78 F;  2Y4Y A;  4ELY C;  3RKW A;  2XHC A;  3E19 A;  4XU3 A;  3QSU A;  2RHI A;  2PQW A;  2VXF A;  2P4T A;  3GLX A;  2O4X A;  4N0A C;  1LJO A;  4FT4 A;  5DLQ E;  3L2R A;  4RCC A;  2ZPG B;  1H3Z A;  3LX7 A;  3X28 B;  2KK4 A;  1DJ7 B;  4MMK A;  5A2Q E;  1M90 C;  4IUV A;  4J83 A;  4LDY A;  1YIJ A;  2D6F A;  1VQM A;  3GIB A;  1UEB A;  3CD6 A;  4QQ6 A;  1NJI U;  3G6E A;  1YHQ T;  3BW1 A;  3MEV A;  1Y71 A;  2KMT A;  5GAN 8;  2K5I A;  3M4G A;  4J6W A;  4KUL A;  2FHD A;  3V7C A;  1UGP B;  4DOW A;  2DJZ A;  1I81 A;  3GNF B;  2VV5 A;  1K73 U;  4IUQ A;  3ZBD A;  1M1G A;  3CCQ T;  2LCC A;  3DLM A;  3CCR A;  4EMK C;  2V8J A;  1D3B A;  3BDU A;  3J7A F;  3OYA A;  2DTO A;  2RI5 A;  2DXB A;  4JRQ A;  3CC7 A;  1VQ6 T;  4ATO A;  2LTO A;  4M78 B;  4PLL A;  4XTU A;  3OYH A;  1VQ7 A;  5D6W A;  5LJ5 f;  4M7D G;  3OS2 A;  1VQ8 A;  1VQO T;  2OTJ A;  2RB6 A;  1KQ1 A;  3EFR A;  3HSB A;  2P0P A;  5CKH A;  3OA6 A;  4F7U G;  1YJ9 A;  3V8L A;  2C06 A;  2KDS A;  2RHZ A;  3UPU A;  2P0Q A;  4KBM B;  2QA4 T;  3PMI A;  4ZGJ B;  1M4Z A;  1NJI C;  3T9N A;  2MI6 A;  3OY9 A;  1WPY A;  1Y07 A;  3SWN C;  1X01 A;  3LH0 A;  5LJ3 h;  3GOX A;  2RJF A;  1KHI A;  2K57 A;  2IVW A;  3VV0 A;  2K5L A;  4MDW A;  3GP8 A;  3EAE A;  2OTL T;  5GAN 2;  3OB9 A;  3RES A;  2XDP A;  2JTF A;  1X75 C;  4ZTF A;  1YHQ A;  3PNW C;  4PJO B;  4R56 A;  3S3N A;  3E1S A;  3PGG A;  3G71 T;  2XIC A;  2GQV A;  5GAN h;  3QPH A;  4C92 A;  2QQS A;  3RER A;  3CCQ A;  1M9S A;  3OS1 A;  3G4S T;  3MP1 A;  3OYE A;  3CCM T;  1NZ9 A;  5LJ3 g;  3MP8 A;  1QP3 A;  4IUR A;  4M7D E;  5GAO q;  4QVD A;  4X9C A;  1VQ6 A;  2XDB A;  2JTM A;  5DM7 R;  4J6Y A;  2RK1 A;  4E7K A;  4M75 C;  3JSC A;  1VQO A;  4F7U E;  4M77 D;  4OF1 A;  2E65 A;  3BY7 A;  4C92 D;  1ZHI A;  5J26 A;  1D3B B;  2A7Y A;  5M9O A;  3TU4 K;  4C0G A;  1KQS S;  5GAN g;  4IUP A;  1VIE A;  2KY9 A;  4RG2 A;  1BKB A;  4C92 F;  3MEA A;  4M7A A;  2JVV A;  3M9Q A;  2I2L A;  2GF7 A;  2QA4 A;  4J6X A;  5GAM f;  3OYC A;  1N8R C;  4M78 C;  3TCJ A;  4EMH A;  4OB0 B;  2O01 E;  2DIQ A;  2EQK A;  3O8V A;  3L2W A;  2AHJ B;  1YJW T;  1VQP T;  4C8Q A;  4BI4 A;  1LOJ A;  2CZ0 B;  4A4F A;  3BFM A;  5LJ3 d;  1GXI E;  4FM4 B;  2OTL A;  3LYI A;  5IT9 E;  2BKD N;  4E47 A;  3EFS A;  3LGL A;  2RK2 A;  3NTK A;  4M7A D;  3JRZ A;  3M56 A;  2L5Q A;  3M54 A;  1EIF A;  5GAN 6;  3JB9 J;  3G71 A;  2LX9 A;  4M7A F;  3VJP A;  5FU7 C;  5GAO p;  1JJ2 S;  4A4G A;  1U1T A;  2X35 A;  3G4S A;  4C8Q D;  5CR2 A;  5GAN d;  3CCM A;  3QKJ A;  3CBP A;  3LLR A;  3E9G A;  4RG8 A;  3VYG A;  1KQS A;  2HAX A;  4HT9 A;  3PTA A;  2WAC A;  3OYB A;  4ZGD B;  3X26 B;  2GFU A;  3NFC A;  1P92 A;  2FVU A;  3M55 A;  3M4Y A;  5FRO A;  3MEW A;  4Q5W A;  4C92 B;  3JCM e;  2VYT A;  1XTD A;  4DA4 A;  1UB4 A;  4ZN3 A;  1MGQ A;  2DVE A;  2R5M A;  3V8K A;  1FXX A;  2H3J A;  4A4E A;  3V8J A;  2RA2 A;  1WJR A;  1U8R A;  2M0O A;  5DLO A;  3JB9 D;  4R55 A;  5GMK h;  4RKU E;  5GAO l;  3RUX A;  3SWN B;  1ZQ1 A;  5AYF A;  3OYN A;  1XNI A;  1NE8 A;  2HQE A;  3JB9 F;  1BI2 A;  3JCM V;  3CBM A;  1Y7X A;  1VQP A;  1YJW A;  4OB1 B;  1WQ7 A;  1S72 T;  2XG8 D;  2ZPB B;  3HRS A;  4ME7 A;  1G3S A;  3OS5 A;  3ER0 A;  4OB3 B;  4M78 G;  4BI3 A;  2JN0 A;  3F70 A;  2E6Z A;  2EQU A;  4PNO A;  4XU0 A;  4ZTJ A;  5GAN 4;  3CCJ T;  2LDM A;  2WSF E;  3A8G B;  2LRQ A;  3MP6 A;  2DPP B;  4XTW A;  4BY6 B;  5GMK m;  1FWZ A;  4YTL A;  4BE0 A;  1G3W A;  4RMO A;  2YLC A;  4JRI A;  2K3Y A;  3HFO A;  2RM4 A;  2ZPH B;  4B9W A;  3QG1 A;  5KH6 A;  1X6O A;  4M75 B;  1OZ3 A;  4MZT A;  5LJ5 e;  2P0K A;  3UWN A;  2R58 A;  2DIG A;  3INZ A;  3VUZ A;  4NS5 A;  3FC3 A;  1RL2 A;  2ZPI B;  4EMG A;  1YI2 T;  3LW5 E;  2QQR A;  3A8O B;  3L2Q A;  3M59 A;  2PVG B;  4BUG A;  3I56 T;  1QW1 A;  3JB9 H;  3OYF A;  3S6W A;  2RHX A;  3HHT B;  1WNL A;  2EFI A;  2JZ2 A;  2MF2 A;  2VXE A;  3FRN A;  4JJN K;  2RJC A;  4M7D A;  5LJ5 j;  3QBY A;  4HCB A;  4JDS A;  3CXC S;  4PJO G;  2LT4 A;  2KSS A;  2OAU A;  4J8O A;  5L8R E;  4F7U A;  4BI8 B;  3AHU A;  3M58 A;  4C92 C;  3R6O A;  4XU2 A;  4J5Y A;  1KD1 U;  1S72 A;  3Q1J A;  5GAN 3;  1LNX A;  4M78 E;  4X34 A;  2K5F A;  3CME T;  2EYQ A;  4Z02 A;  4M7D D;  3H6Z A;  3FEO A;  4C5G A;  5FU7 B;  4LDX A;  2QQA A;  1U1S A;  3I55 T;  3CCJ A;  3H8Z A;  3L42 A;  4M7D F;  2CZ7 B;  1W4S A;  2X4J A;  4EPC A;  4O5V A;  4ZGE B;  3CBO A;  5FLX E;  3SB2 A;  3C4S A;  4F7U F;  4JS4 A;  4E7H A;  2EAY A;  5GAN e;  1VQ9 T;  5LJ3 f;  3MO8 A;  2O4X B;  1QVF S;  4M7A C;  2MWP A;  1TH7 A;  1N8R U;  2BIV A;  3OBY A;  3CXC A;  3QYH B;  3MHX A;  4M77 A;  1M1F A;  3A8M B;  3HFN A;  1H64 1;  1B34 A;  1YI2 A;  4BE2 A;  3JCM W;  3OYL A;  4XQ3 A;  1I4K 1;  3FJP A;  4BY6 C;  3A8L B;  2V8K A;  2HD0 A;  1OYX A;  4FT2 A;  4J7F A;  5CKB A;  3I56 A;  2DO3 A;  2XID A;  4JLI A;  1N27 A;  5GAN f;  1KD1 C;  4PJO E;  2VGN A;  4IUU A;  1YBY A;  4QVZ A;  2K2V A;  3PFS A;  5DY9 A;  2M9U A;  5GAM e;  2CGH A;  3OYI A;  2WSE E;  3RKX A;  4E7L A;  1M1K C;  3HP9 A;  1UGR B;  5D6Y A;  1Q81 C;  4KUI A;  3PMT A;  2L8D A;  2RI2 A;  4L59 A;  3GPL A;  2RH2 A;  1HXD A;  2LC4 A;  2PVO B;  1N9R A;  4NL2 A;  3KXT A;  4M77 F;  4LDW A;  4LD6 A;  2MAM A;  3S3M A;  1VQL T;  3TEE A;  3CME A;  5HK3 A;  2EIF A;  2EKO A;  5GAM j;  3CC4 T;  1QVF A;  3MEU A;  3RIR A;  2RI3 A;  5J3B A;  5C0M A;  4CRI A;  5CKE A;  1N9S A;  2PUK B;  3I55 A;  3HRU A;  1ZBX A;  3M53 A;  1OI1 A;  4PLI A;  4N4H A;  2NLU A;  3P8D A;  2M16 A;  3LWI A;  2CYZ B;  3TRE A;  4OGE A;  2EJG A;  3OMC A;  3C94 A;  3KBG A;  4C5E A;  3CCS T;  1Q7Y U;  1VQ9 A;  3OYM A;  2KVQ G;  4OP0 A;  3VU3 C;  3PIP A;  1WGS A;  3QHS A;  2JNG A;  3URG A;  2HQX A;  4XAX B;  3DB3 A;  1VQ4 T;  2VC8 A;  2K3X A;  1YCY A;  5A0D A;  2QXF A;  1KG1 A;  2LVM A;  3A8H B;  2L3R A;  5IAY A;  3C12 A;  2HNI A;  3E9F A;  3X20 B;  3DLL A;  3UDC A;  2RHY A;  5FU6 B;  4C8Q F;  2KQW A;  1KQ2 A;  1Q82 U;  2PU9 B;  2VGM A;  4M77 B;  3OMG A;  4IKF A;  3A5Z B;  5C6S A;  3ASK A;  4FL6 A;  2DTH A;  3OW2 S;  2DZ9 A;  4JUV A;  5CO7 A;  3FB9 A;  4A4K A;  3VYH B;  4TVR A;  3FLG A;  1XOV A;  3VKI A;  1VQL A;  4ELZ C;  4M75 G;  2QQ9 A;  2E1H A;  3L2Z A;  3JCM J;  2WSC E;  1Q7Y C;  3CC4 A;  3CCE T;  4PL6 A;  5I21 A;  1R8O B;  1VUB A;  1Y96 A;  2QTX A;  2XKO C;  3OBW A;  4Y28 E;  3JCM b;  2E41 A;  2QI2 A;  3JCM P;  2DXU A;  1AHJ B;  1JJ2 A;  4L6V 5;  4BDY A;  2XK0 A;  3ZEH A;  3CC2 T;  4M7A B;  2YHT A;  3UT1 A;  2D9T A;  4OB2 B;  2DEQ A;  3QZ9 B;  3QXE B;  4XTV A;  2JOY A;  5CVI A;  3PIO A;  3CCS A;  1BI1 A;  4FU6 A;  2FB7 A;  2DD5 A;  4IUT A;  4M7D C;  4MZM A;  3JCM h;  2EJF A;  5IN1 A;  4C8Q B;  4KUD K;  1VQ4 A;  1W2B S;  4UC4 A;  1V29 B;  2F5T X;  3C95 A;  5CQY A;  5CK9 A;  3RKY A;  3OW2 A;  1VQN A;  1YIT T;  2CZ1 B;  2LT1 A;  4M78 D;  2D0Q B;  1JBM A;  1K8A U;  3WXM B;  3SFM A;  3NTI A;  3CCV T;  2DZC A;  2RJD A;  5GAN 5;  1Q86 U;  4O6J A;  4OGC A;  4MZP A;  3L2V A;  2DXC A;  3WVD B;  5HY6 A;  2MMP A;  3JCM g;  3OSS C;  1JB0 E;  4M75 E;  4C0D B;  3DB4 A;  1Q82 C;  3QYG B;  4PJO A;  4XTY A;  1RI0 A;  5LL6 S;  4HCZ A;  5KE3 A;  2G3R A;  3CCE A;  5A0G A;  5FU6 C;  4N4I A;  1O9S A;  2BUD A;  4M77 C;  3VUB A;  4JRP A;  1N6A A;  3CMA T;  2XU8 A;  1PSE A;  1W2B A;  2K4Y A;  2HBP A;  2PVD B;  3MET A;  1KC8 C;  5FRM A;  5HKC A;  3CC2 A;  3CEY A;  5EG2 A;  5GAO m;  2GFA A;  2XI9 A;  4PJO D;  5LJ3 e;  2LQK A;  2ZZD A;  1XQH A;  1M1K U;  4EDU A;  1WQW A;  1Y96 B;  4E7J A;  1Q81 U;  3M5A A;  2EQM A;  3GNG A;  1I8F A;  3OSV A;  5LJ5 h;  4PJO F;  1K8A C;  1NPP A;  2GCX A;  1VQ5 T;  2QQB A;  3CPW S;  5I2S A;  1HK9 A;  4RCB A;  2QDY B;  1Q86 C;  1NPR A;  4C0F A;  3HRT A;  3JCM d;  2X4Y A;  4N0A A;  2F5K A;  5LJ3 j;  1YIT A;  2CZ6 B;  1QVP A;  4MDX A;  3CPF A;  4PKC C;  3QUI A;  4LDU A;  3BDL A;  2MWO A;  1YJN T;  2EJ9 A;  2X4W A;  4A54 A;  3CCV A;  4BAC A;  4HKE A;  4FIB A;  3JCM Q;  3FIF A;  1IZ6 A;  4OMF B;  4C8Q C;  5LJ5 g;  5FRN A;  5GAN j;  2E6N A;  3LWH A;  3HL8 A;  4BDZ A;  2YRV A;  2XD0 A;  5HK0 A;  3HKS A;  3QO3 A;  4DQ2 A;  4EMK A;  1G5V A;  4B9X A;  3FDR A;  1OZ2 A;  5GAO r;  1K73 C;  4P5N A;  4XTX A;  3SDZ A;  1I5L A;  2DAQ A;  3QJY A;  1MHN A;  3CMA A;  2FL7 A;  3CPW A;  2E64 A;  2VUB A;  1BIB A;  4X9D A;  4XU1 A;  1PSF A;  4M7D B;  2V8I A;  2E70 A;  2R57 A;  4GY5 A;  3LGF A;  3PT9 A;  3RMQ A;  2RD1 A;  4C0D C;  4VUB A;  2LNV A;  5CAI A;  1K9M U;  2EQJ A;  4ZN1 A;  4M77 G;  4F7U B;  3N5B B;  1QVG S;  3CCL T;  4C92 G;  3KUF A;  5KE2 A;  5CCA A;  4Y91 A;  1VQ5 A;  4HT8 A;  2Y4X A;  2E10 A;  2LCL A;  4JRK A;  2E12 A;  5LJ5 d;  1VQK T;  2L89 A;  5GAO n;  2QEX T;  2RHU A;  5D6X A;  3SWN A;  5J39 A;  3CCU T;  2RJE A;  3P8B B;  5A0L A;  3DKM A;  1QP2 A;  3OYG A;  5I2M A;  1UGQ B;  1G3T A;  1M5Q 1;  4N4G A;  2XDD A;  1YJN A;  4HCC A;  2DD4 A;  4QW2 A;  5GAM h;  3QZ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...