5GMKj

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 9
structure length 69
sequence length 75
chains with identical sequence x
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkj00
4JRIA 4M78G 4M77D 4RCCA 2RD1A 1HK9A 3JCMV 1HXDA 5GMKh 5LJ5e 3JCMe 4NL2A 3RIRA 2DJZA 2EJFA 4C8QB 2DVEA 5LJ3d 3HFNA 4QVDA 4XU1A 5GAN3 3GIBA 4HA8A 4J6XA 4PJOB 3JCMf 4C92E 5GANh 4C8QF 3PGGA 4OP0A 2CGHA 4J5YA 1LJOA 4F7UF 4A53A 1TH7A 2YLCA 3BFMA 4C92A 5GAN7 5GAN4 4C92F 3JCMb 3HSBA 4M78A 4RCBA 3EFSA 5GAMh 5GAOr 3JB9D 4X9CA 2EWNA 1Y96B 4C8QA 3V7SA 2HNIA 4M78E 4V2SA 3RUXA 1U1TA 3V7CA 1LNXA 3SWNB 3JCMh 4C92B 4HT8A 4C8QE 4JRKA 4J6YA 4M7AE 2QTXA 5LJ3h 1JBMA 3RERA 4NOYA 2VXFA 4HT9A 3JCMJ 4J6WA 2Y90A 3JCMc 4M77B 2RA2A 2E64A 3FIFA 4M78C 5LJ5f 4M7AA 4C92G 4M77G 5GMKi 3JCMd 2DXUA 4XQ3A 2ZGWA 1H641 4XU3A 5GAMd 5GAOq 5GAOl 3INZA 3HFOA 2DZCA 3QHSA 4PJOF 4M75F 3JB9F 3BY7A 3L1AA 4N0AA 4F7UG 1WQWA 1M5Q1 3JCMW 4PJOC 4M7DA 4M7DG 1D3BB 3RESA 5GAMe 4NL3A 3QO3A 1X01A 4C92D 1YCYA 4Y91A 3V8JA 4M7AG 4M7DE 4M78D 4XTXA 3JB9H 3M4GA 5LJ3g 3QSUA 4M75D 1KQ1A 5LJ3e 4M75B 2DXTA 4XTUA 1I81A 2DTOA 4XTZA 3RKYA 4PJOG 3SWNA 4XTWA 4C8QD 5GAN2 4M75G 5GMKj 1JRIA 2DTIA 2E10A 2FB7A 3JB9G 4EMKC 3AHUA 4JLIA 3RKWA 3JCMX 4M78B 5LJ3f 1WQ7A 5GMKl 5LJ5g 5GMKe 4PJOD 4M77F 2EAYA 5GANf 4MMKA 4M7AD 2K57A 3QUIA 4M75C 4X9DA 1I8FA 1WNLA 4M75E 3BW1A 4C92C 4M7DF 3SWNC 4M77E 2RM4A 4DQ2A 5I21A 5GAN5 5GAOn 3RKXA 4EMKA 1B34A 4WF2A 4M75A 1MGQA 5GAMj 5LJ5d 4M77A 5GANg 5GAN6 1U1SA 1LOJA 4PNOA 2E41A 2FYKA 1BIAA 4XU2A 4M7DD 2EJ9A 3V8LA 3JCMQ 3L2ZA 5LJ3j 1D3BA 2RB6A 2DTHA 4JUVA 3V7RA 3JB9J 1B34B 3EFRA 4EMGA 5CAIA 3BDUA 1I4K1 5GAN8 1I5LA 1BIBA 4XU0A 2DEQA 2E65A 2YLBA 2YHTA 2JN0A 2VC8A 1N9RA 3FB9A 4M77C 4EMHA 5GANd 2DZ9A 1KQ2A 5GAMf 5LJ5j 3JCMP 4XTYA 4XTVA 5DY9A 1N9SA 4C8QC 1M8VA 2DKGA 4A54A 4M7AB 4N0AC 3VU3C 4PJOA 4M78F 3FJPA 3SB2A 5GANe 4M7DC 1WPYA 4MMLA 5GAOm 2I2LA 5GMKm 4F7UA 5GAMg 2VXEA 4M7DB 4QVCA 4EMKB 4PJOE 5GAOp 3JB9I 4C8QG 2E1HA 4F7UB 5LJ5h 5GANj 1Y96A 4M7AC 2EJGA 3JCMg 4F7UE 3V8KA 4M7AF
chains in the Genus database with same CATH superfamily
1MMDA 3JCMV 2EIFA 2RD1A 4EIKA 5AYFA 1OU8A 1D1CA 4CC3A 1GBRA 1AWWA 4BE2A 2NYSA 1T0JA 4DBRA 1SHFA 5CCAA 4FT2A 3WVEB 4QQ6A 1BI3A 2GBQA 2VWFA 2QEXQ 2RI3A 1PWTA 2JTFA 3RUXA 5LL6S 2A28A 3C4SA 3SWNB 5I11A 4BACA 4OMQA 3G4SA 2AKKA 3CCEQ 2F69A 2P0KA 1SEMA 3M0PA 3I35A 5KE3A 3INZA 1KIKA 3OW2A 4HCZA 2CSIA 2F5KA 2HDAA 5C6SA 1MHNA 3CCRT 4BDYA 2L89A 4M7DG 1D3BB 3Q1JA 2QA4A 1YHQA 3O5ZA 3EG3A 1IREB 2JUFA 4M78D 2QQSA 1M30A 4PFPA 1W4SA 3OA6A 4M75B 5GAN2 1I81A 3SWNA 3LX7A 2I0NA 1I07A 2JXBA 2EQIA 2CZ6B 5I2MA 2FHDA 3X28B 4DOVA 4M78B 2DJQA 3S3MA 1S72T 1SKUB 3IQLA 4M75C 2J6KA 2DFUA 2K6DA 5D7UA 1MGQA 1WJSA 2VGNA 1AEYA 3CD6T 4Z02A 3HP9A 2J7IA 4LD6A 1D09B 3EFRA 1HSQA 3DB4A 3CCLT 2VV5A 3OYLA 3E1SA 1ZHIA 2YRDA 1M27C 4C5IA 4L5GA 3EAEA 2XMFA 2K3XA 5DM7R 2BKDN 2ZAEA 1B3QA 4II1A 1UEBA 3CPWP 4F7UA 2JS0A 4A63B 1Y96A 5C0MA 3VKIA 5M9OA 1HXDA 1UG1A 2DL5A 3OB9A 1NPPA 4DEXA 5LJ3d 4ZTFA 3CXCP 4C5EA 2Y4YA 4TVRA 2JTMA 1T0HA 3M0TA 3HSBA 2ED1A 2EWNA 4MZPA 1FXXA 1PM3A 4J9HA 2DBKA 2HL3A 3JSCA 2QTXA 1NYFA 5EC7A 1PRLC 3CCUA 1NJIU 3VS7A 2M9UA 4M78C 2OTJT 4BE0A 1YJNA 1FMVA 4KUIA 3RBBB 3L42A 4AFZC 3VS2A 1ACMB 4M75F 2PZ1A 1I5OB 3HPWA 2FZGB 4HXJA 2RHYA 1BK2A 2KSSA 3C94A 4DBHA 2DTIA 2MPXC 1D0XA 3LGFA 4ATOA 2ROTA 4RG2A 3VS3A 1NZ9A 3TREA 1Q81C 3EG9B 4DQ2A 4M77E 2RQRA 4C0FA 1NYGA 2O31A 4OMMA 2YUOA 1A0NB 3H0HA 4KBMB 3PIPA 1VQ4T 4C0ZA 3OYFA 1QP3A 3L2ZA 2DTHA 4BY6B 3VUZA 1I5LA 2EQMA 3QJYA 1VQMQ 3ASKA 2A7YA 2JN0A 1XJWB 3QWXX 3OYDA 1KQ2A 2L3RA 1YIJT 1BU1A 3A8HB 1WXUA 1KK7A 2QDYB 4MZTA 1UGRB 5GAOm 1Q82R 2I2LA 2JW4A 3CCUT 2A36A 2CP5A 2PVDB 5IHKA 5GAOp 3JB9I 4FYVB 3WXMB 4F7UB 2LRQA 3OW2S 4M75D 1GBQA 4NL2A 1AWOA 2BZYA 2GF7A 1QKXA 1VQNT 3EGDA 3HFNA 4QVDA 5CKHA 4PJOB 3JCMf 1ZA2B 4KGZB 2QDLA 1EZZB 4IUQA 1YIJQ 2O4XB 4A53A 1GCQA 5FRMA 1OOTA 1QCOA 4C92F 3CC4A 4RKUE 2K79A 3QG1A 1PC0A 3G6EA 1M1KU 1IHWA 2DMOA 1Y07A 4M78E 3DLMA 2LP5A 1OZ2A 5L23A 1RI9A 3L2UA 3OMGA 2LTOA 3H0IA 1EFNA 1PHTA 1P92A 2COWA 2RHUA 1PRMC 1KC8C 4XAXB 4PJOF 2RN8A 3OYIA 2RMOA 2KR3A 2RH2A 3SHWA 3RESA 3MEAA 3CCLA 3CCUQ 1PD1A 2MIOA 1K9AA 3CMAT 1PD0A 3A8OB 1TUDA 1AWJA 3JB9G 2CZ1B 3MKDA 4AG2C 4JLIA 2YT6A 4PKCC 1K9MU 1BI1A 2DETA 1O75A 3OS1A 1ZUYA 3CCSA 3HRSA 1PCXA 3HRUA 5CK9A 2RJEA 4PNOA 1KQSA 3OSVA 4IUUA 3X20B 2GTJA 1NE8A 3CCJA 1D0YA 2HSEB 4XU0A 4C5GA 1EX4A 1RLQC 1Q82U 1SG5A 3VS0A 2B8AA 1G5VA 2WACA 1ZQ1A 2X35A 4LN2A 1QVGP 1K9MR 3VRZA 5KYWB 2BTTA 1UE9A 2HAXA 3CD6A 2KAFA 3KFVA 4BUGA 4C8QB 4M77D 4Z88A 2DL7A 4FU6A 3GP8A 2IPOB 2IVWA 2K2VA 5FWBA 1VQ6T 1U5SA 5CKFA 4FW2A 4J5YA 2KXCA 2GQIA 3EGUA 4FIBA 5GAMh 1MUZA 1NBEB 1JU5C 3MO8A 2K4YA 2L5QA 1VQLT 2VGMA 4M7AE 4BI4A 2QA4T 1YHQT 4ZN1A 1Q7YC 3CMEA 3HTRA 2LQWA 3E19A 4A4FA 3P8BB 2JMAA 2XU8A 2FEIA 3VRYA 3BY7A 2K5IA 3ZFJA 4PJOC 2O88A 3A98A 4M7DA 4A4HA 1SF9A 2FRWA 3TSWA 2X4XA 2L3PA 2R5MA 2RNAA 2BE7D 3META 3OYYA 2E10A 2LT4A 3RKWA 1ZSGA 3OBYA 1ZSZA 4JLGA 2SRCA 3VYGA 3CMEQ 2JT4A 3CCVT 1BYMA 4CI0C 2E6ZA 4KUDK 2DA9A 5HK3A 1X69A 4BE1A 2EKHA 2RQVA 4J9IA 3MCAB 1JXMA 2DO3A 4IKFA 3V7RA 2MI6A 3JB9J 4LDYA 1Q7YR 2ESWA 2AKLA 1KSWA 2E65A 2L0AA 4FSXA 3CXCS 4EMHA 2B86A 2WSCE 8AT1B 3VU3C 5FRNA 2DRKA 3OYCA 3SB2A 1VQMT 4M7DC 2CZ7B 3NPFA 4AMCA 3A8GB 3A5ZB 2BE9B 1N6AA 4FCYA 1Z9QA 4PLLA 4HVUA 5A0GA 2KE9A 2DM1A 4ESRA 1SPKA 1OPLA 2CP3A 2DJZA 4J8OA 2F2WA 3QJ6A 4OMLA 3QYHB 2HL5C 3I55T 1VQKT 1MNDA 2CGHA 2D0QB 3CEYA 5DLOA 4M78A 1UGPB 3FDRA 4RTXA 2LNHB 4HKEA 1D1AA 3KXTA 4J6YA 1KD1U 3JCMc 4M77G 2DXUA 4XQ3A 2KQWA 1YITT 1VQ8T 2DERA 2KY9A 4CC7A 4F7UG 4FYWB 1M5Q1 4KGVB 5IT9E 5IXFA 4J9BA 1T3LA 2D9TA 3QSUA 1UHFA 2DXTA 4XTUA 4XTZA 1UB4A 2FB7A 5J26A 3R6NA 2DPPB 1JEGA 4IUTA 3P8DA 3CCEA 2F2VA 2LQKA 1VQ6Q 5GAOn 2GQVA 4QW2A 1UGQB 1RL2A 4ZN3A 3EFOA 1M2OA 4IUVA 4RTTA 5GAN8 4AFUC 5I22A 3I56Q 2DD5A 2EYZA 2F1LA 2K5LA 1JQQA 2CSQA 2L8DA 4AFQC 1M1KC 4F16A 1YJNT 4RTWA 2ZPBB 2KT8A 5FROA 2M0OA 4JZ3A 1V1CA 2K9GA 2QYZA 3RMQA 1N27A 1NEGA 1M2VA 2KYMA 1J3TA 2E12A 3EGXA 3GIBA 2BIVA 4HA8A 3G71Q 5ECAA 3UT1A 5GAN7 3CD6Q 1TSFA 3M59A 2DYIA 1Y96B 1G8XA 2HQXA 2KXDA 2MMPA 4E7ZA 3LWHA 1K73C 3M56A 4HCBA 4HT8A 4C8QE 5CKBA 1I1JA 2DL3A 2C06A 2E6NA 2RQWA 2Y90A 2DF6A 1NM7A 4AG1C 3VYHB 1ZBXA 5CKEA 2D0NA 4ZGDB 3CPFA 1HYOA 5GAMd 5EG2A 1FYNA 3KUFA 2LDMA 2ZCFB 2PVOB 4ZTJA 1WXBA 3CCRQ 5IH2A 2EQJA 1VQLQ 1JJ2P 2CZ0B 4RTZA 3G71T 2JJ9A 1QVGA 2D8HA 3CCJT 4FYYB 2RJCA 1KG1A 1XNIA 2GFAA 2RQUA 2ZPHB 1UJ0A 1S1NA 2ABLA 1AT1B 2RM4A 1JXOA 2E3HA 2EGEA 2LVMA 3R6OA 4N4HA 2GFUA 1B7TA 2HKNA 3QIIA 1OU9A 4QVZA 3TU4K 3KBGA 2MOXA 1BI2A 3HL8A 2MCNA 1VQ9Q 4OGEA 1Y71A 3OYMA 1BB9A 1RAGB 2FPDA 1Q86U 2LX7A 1KJWA 2CH4A 1D1BA 3CMAA 3THKA 1N9SA 3NFCA 1YWOA 3NGPA 5GMKm 5GAMg 4M7DB 4R55A 2JVVA 3CQTA 2RHXA 4D8KA 5HCKA 4FL6A 3JCMe 4RCCA 1VQ9A 1HK9A 2M16A 2QQBA 1YJWT 3H6ZA 2XHCA 1YP5A 1G3WA 2DYBA 5GANh 4BD3A 1U06A 1VQ4A 4DBFA 1NJIC 2KK4A 5GAN4 2V8JA 1NLPC 4XK8E 1TOVA 3FEOA 4X9CA 1U1TA 5HKCA 3M58A 2G6FX 2AHJB 3OMCA 2LMJA 1RLPC 4RG8A 2RHZA 1F1BB 5CVIA 2VYTA 2ZGWA 2KVQG 3GBQA 4NS5A 2VUBA 5GAOq 2OTLT 5GAOl 3HFOA 1WI7A 2NUPB 1YJWA 3FC3A 3CBPA 2LX9A 4NL3A 3PMTA 2DXCA 3V8JA 1YIJA 3LWIA 3JB9H 5LJ3g 9ATCB 1ZSZC 4CC4B 4IUPA 3HRTA 3CCMQ 3AHUA 5FU6C 4RTVA 4PJOD 1QVFA 4Y92A 4D6WA 4F04B 3QUIA 3M55A 4X9DA 2EYWA 3LH5A 2QGFB 5I21A 2KRSA 1RADB 2H3JA 1VQ4Q 1XQHA 1G83A 4JZ4A 3QBYA 4LDUA 3TSZA 5J39A 1AHJB 2RK1A 1YI2Q 2KROA 4OB1B 1OI1A 5CIUA 5GAMf 4WCIA 5I2SA 2MAMA 1FMKA 4P5NA 3UA7A 4N0AC 3CCVA 3FJPA 4ZNXA 4IURA 4MMLA 3G71A 2YWWA 1M2VB 2CUDA 3H41A 2R57A 1M3BA 4C8QG 2E1HA 4ELZC 3LLRA 2QAZA 5KH6A 4JJBA 4KT0E 4KULA 4BB7A 1ZUKA 3PGGA 3RR6A 4OGCA 1LJOA 1U8RA 3PVLA 2EVRA 2OTLA 4FSSA 4E7HA 1PKSA 3CXCA 5FW9A 3D7SB 4JJCA 3EH2A 3V7CA 3OYGA 4JRKA 3L2WA 2KRNA 1MNEA 3LYIA 3ULRB 2CS7A 1OZ3A 3EFOB 4HT9A 2DXBA 5LJ5f 1W2BP 2HSPA 2HD0A 2J05A 2AK5A 2X3WD 1H641 4XU3A 4X1VA 4FYXB 1E6HA 2CYZB 3QDRB 3RDVA 1VQ6A 3RNJA 4E7KA 3JB9F 5CQXA 5KYUA 3CC2Q 5GAMe 4L6V5 4PFOA 2RHIA 4C92D 3OYKA 1YCYA 5A0DA 3JAME 1OPKA 3FJ5A 1UDLA 4A4KA 4C8QD 2BZXA 2DE0X 3MP6A 1YFNA 3OYBA 3MEVA 1KC8U 3I55Q 1VQKQ 5CQYA 2O9SA 1WHMA 2NUTB 1Q86R 3OY9A 1YJWQ 1JJ2A 1RABB 3DLLA 3G4ST 1G3SA 1G3YA 1KQSS 1VQNQ 4QKUA 2EW3A 2QGGA 2R5AA 3P8HA 4WF2A 2BUDA 1RAEB 4ZGJB 2YUQA 1IHVA 1UFFA 2DLPA 3PT9A 3URGA 2MWPA 4XU2A 2L3QA 1BIAA 4M7DD 4D8DA 1QVFP 2YXYA 2ZPFB 3V8LA 5LJ3j 3MP8A 1GL5A 4KGXB 2FL7A 1LVKA 3S6WA 1O9SA 1KQSP 1VIFA 4XTYA 4XTVA 3G4SQ 2LZ6B 5CR2A 3UA6A 3FRNA 3M54A 2HKQB 2K3YA 1VQ7T 4E6RA 3PTAA 1TUGB 2E4HA 4PJOE 5KYYA 1VQOQ 1ZBJA 5GANj 4M7AC 1R8OB 4B9XA 3JB9D 3MEUA 1IRXA 4Q5WA 1YBYA 4FT4A 1QWFA 4C8QF 1YITA 4BY6C 1TH7A 4C92A 1WHGA 4C8QA 1OEBA 4OMPA 3JCMh 4GLMA 3ME9A 1JBMA 4NOYA 1OQKA 5FLXE 4M77B 1KC8R 4C92G 2O4XA 1VQ5Q 1GXIE 1WA7A 2NWMA 4PJLA 1UHCA 4JRQA 4FW1A 4Z8AA 2CUBA 4RTUA 3VS4A 2DL4A 1ARKA 1X27A 3SFMA 3RKYA 4MDWA 4PJOG 4O6JA 4M75G 1VQPA 2FRYA 1R0CB 3QDFA 2QTVA 1WQ7A 4M77F 5GANf 1YNZA 1M90U 1DJ7B 4E7IA 1MMAA 3X25B 5GAN5 3PVQA 3RKXA 4PJJA 1UTIA 1VQ8A 1LOJA 2VVKA 2RB6A 2M1HA 3SEMA 2HQHA 1VQNA 4EDUA 3EH1A 4M77C 3A1PA 1N9RA 2XICA 3X24B 3JCMP 4JRPA 2P0QA 2E3IA 1GCPA 2GCXA 1QCFA 2H3EB 1Q81U 3OQ5A 1FMWA 1Y0MA 1WJQA 5LJ5e 3M5AA 3PNWC 2LJ0A 4RUGA 4J6XA 4DBQA 4J9DA 5IXBA 4LDVA 5A2QE 2FZCB 2LJ1A 4J7IA 1S72Q 1KD1R 3TVTA 1IXDA 2RI5A 2QI2A 3CMET 4LDWA 4AT1B 2XDDA 2NUZA 2EYXA 8ATCB 4OB3B 3WVDB 2A08A 4CC2A 4C92B 1IO6A 2D6FA 2CT3A 2KT1A 2P4RA 3FIFA 4PJMA 4JS5A 3OSSC 4GBQA 1C6VX 1N8RR 2COZA 2A0FB 4C0GA 2D1XA 4PL6A 3L1AA 4JJNK 4Y28E 1VYUA 3M4YA 4OVAA 5KYXB 2LT1A 4Y91A 1N8RC 2X4YA 1WIEA 4N4IA 5GJWB 2J6OA 2CP7A 4J83A 3G6EQ 3EG9A 2GNCA 2OTJA 3C95A 5LJ3f 2DNUA 2CT4A 2CP2A 3JRZA 4M4ZA 4N4GA 3VS5A 3CCQQ 3BW1A 3SWNC 4FM4B 4IIMA 1ZLMA 1GFDA 2KI7A 3NTHA 1Y57A 1QCNA 3E9GA 2D8JA 4OB2B 5IHNA 2EQKA 2V1QA 1TUCA 5CAIA 4R0KA 1HD3A 2FZKB 1VQOA 2JMCA 2VC8A 3OYEA 1YJ9T 3TQ7P 3C0CA 5DY9A 2Z0WA 1FX7A 4A54A 4M7AB 2QG9B 4HCKA 1B07A 1VQOT 2WSFE 1W2BA 5KYUB 3DB3A 5HY6A 1LPLA 2A3LA 2V8KA 4JRIA 1Q95G 1JJ2S 5GMKh 1Q82C 3A8LB 3RIRA 1LCKA 1K73U 4KH1B 1Y7XA 3LGLA 4C92E 1X2QA 5FWCA 2XK0A 2X9HA 4F7UF 2W10A 3BFMA 1VOMA 3EFSA 1I0CA 3M0RA 3QYGB 3X26B 1WHKA 4E47A 2QASA 3BE3A 4UC4A 3VS1A 2C0OA 3MP1A 1YITQ 1OULA 3OYHA 3JCMJ 2DL8A 2K5FA 3LW5E 2K3BA 2O01E 5GMKi 3M0UA 3CBMA 1ZUUA 1K8AR 4F17A 2J06A 1SSFA 2PU9B 3QHSA 1YN8A 1M1GA 1K0XA 4J9CA 4HVVA 2DIGA 4DEYA 1YJ9A 7AT1B 1AWXA 1Q7YU 1OX8A 4LD9K 1JRIA 1AZEA 2RJDA 2CP0A 4QT7A 3EHRA 2RQTA 1BCMA 1RUWA 2OTLQ 5IAYA 2JM8A 2K7AA 2HMAA 2KYBA 4EMKA 1B34A 3QWYA 1IB8A 4KH0B 2L2PA 3T9NA 2PQWA 1M3CA 2ECZA 1U1SA 2LJ3A 2LCLA 3M0QA 4WTOB 2EJ9A 3PMIA 3F70A 1D3BA 1SRLA 3GF5A 4K11A 2OI3A 1OYXA 3FB9A 3SDZA 3I56T 3G6ET 3CC7Q 2DIQA 1M8VA 3O8VA 2X4WA 1WHHA 2SEMA 2QK0A 2KNBB 2DRMA 1WZOA 2EGCA 5LJ5h 2XDBA 3I55A 1VQKA 4M78G 3ZEHA 1G3TA 3A8MB 2FVUA 3EG0A 2X4JA 2HCKA 4C0DB 2X3XD 3NTKA 1VYTA 2C0IA 3VS6A 1NEBA 1V76A 1XTDA 1UJYA 4LE9A 1ABOA 2V26A 2RK2A 2MK5A 4ME7A 1LNXA 3TEEA 3E9FA 3OS2A 2PVGB 1QVPA 4RMOA 3GPLA 5FU6B 2EYYA 3FLGA 3M53A 2JM9A 1ZSZB 2NUTA 2OTJQ 1K4US 2YUNA 2MF2A 3QZ5B 2LC4A 4M7AG 2AZSA 3M4GA 4HVWA 4Z89A 2HQEA 3J81E 5L8RE 2AZVA 2NLUA 2XIDA 4E7JA 3HHTB 2QEXA 4OMFB 2OAUA 5GJVB 2LCSA 1WGSA 5LJ5g 2EKOA 2EAYA 2OAWA 4J9GA 2CDTA 4M7DF 2GGRA 3H0FA 1NG2A 4M77A 3OBWA 1T3SA 2J6FA 3BDLA 2EFIA 2QQRA 2IG0A 1UECA 3QZ9B 3OS5A 3MPUB 1VQ5A 1B34B 1QVFS 2COYA 3OS0A 1SRMA 1VQ7A 3QXEB 2DEQA 2H8HA 2YLBA 1K0SA 1RI0A 1S72A 4JS4A 4F14A 5GANe 2EYQA 2CH4W 2YRCA 1WHLA 1WJRA 2VXEA 3ZBDA 1VQPQ 2FO0A 1U3OA 3JCMg 4YTLA 1H92A 3TCJA 2R58A 5D6YA 5KYYB 3I5SA 3QPHA 2XG8D 3CCVQ 4XU1A 3CCQA 1TG0A 2JNGA 3LH0A 3EGDB 3SD4A 1FWZA 1VQ9T 1PSEA 2YLCA 3ER0A 1QQJA 2FPEA 3JCMb 4RCBA 1IGQA 2ZZDA 2KEAA 4B9WA 1M3AA 1W1FA 1EIFA 2LCCA 3CCSQ 1X6BA 3CCQT 3L2RA 2RJFA 4PK4A 2QEXT 2YRVA 4PJNA 4QQDA 2HBPA 1TWBA 5IN1A 4E7SA 2DZCA 2DILA 4N0AA 4RTYA 3CCST 4BI3A 5KCOA 1BCOA 3REBB 3UDCA 3CCET 1MV3A 1KQ1A 2DTOA 1IZ6A 4XTWA 2DAQA 1VQ5T 4LXCA 5GMKl 3CC2A 1JO8A 3EG1A 4MMKA 4M7AD 1PNJA 2KBTA 2ZPEB 4M75E 1VYVA 1TXQA 1OX9A 2O2OA 1RAIB 1TU0B 2P4TA 5GAMj 2LQ8A 1YJNQ 4J9FA 1RAFB 2FYKA 4VUBA 2HZYA 3H9NA 4AFSC 1K8AU 3I5RA 2HBWA 1UGVA 1W6XA 1SHGA 4EMGA 1UGSB 3BDUA 1CKBA 3REAB 4C0DC 1YWPA 4A4EA 3J80E 3RMSA 5GANd 1TS9A 5LJ5j 2AT1B 2VKNA 1IGUA 1YJ9Q 1MV0B 4QVCA 1BBZA 4JPBW 1X2KA 3CC4Q 1WLPB 2O9VA 2EJFA 1VQ8Q 2W0ZA 1WHJA 2FPFA 3M9QA 1M9SA 3E2UA 2V1RA 2ROLA 4ANJA 3CCRA 1ABQA 4O5VA 3VV0A 5A0LA 3J7AF 1VQMA 1PG5B 1M1FA 5GAOr 1X75C 3C12A 3OYAA 4OF1A 1M4ZA 2Y4XA 3MHXA 5LJ3h 3RERA 1WYXA 1RAHB 1C0MA 2VXFA 4MZMA 4ZGEB 4M7AA 4HCCA 4OB0B 5AT1B 1C1AA 1X6OA 2G3RA 2XI9A 2L3SA 1WXTA 3ZL7C 1RAAB 4L59A 1H3HA 3VUBA 3QO3A 1MMNA 1X01A 2EQUA 1NLOC 4M7DE 4XTXA 5LJ3e 4EMKC 1K76A 4LUEA 3JCMX 1QP2A 4LUDA 1JB0E 5GMKe 3CC7A 3GNGA 2X51A 1M1KR 2F2XA 1W2BS 1AOJA 4M75A 3UATA 2QA4Q 1YHQQ 2PTKA 1VQPT 3JCMQ 3OYJA 1ZX6A 2HEQA 2GTOA 2QQAA 1K9MC 3MJXA 3VJPA 2RI2A 2P0PA 3S3OA 1VQLA 2YSQA 4GLKA 1WX6A 1X6GA 4PJOA 1OV3A 2RPNA 2VASA 2ZPGB 4DA4A 2CKKA 3S3NA 4PFZA 2M02A 2DK3A 4EMKB 1VQ7Q 2VB6A 3HKSA 6AT1B 3GLXA 2OX7A 1GFCA 3I56A 5GAN3 1D0ZA 3UF4A 1M8MA 1YI2T 2QQ9A 2EGAA 2F5TX 2YDLA 2KGTA 3M57A 3PFSA 1Q81R 3PIOA 1TTHB 4ELYC 4ORZA 2HNIA 2NUPA 3NMZC 2XD0A 1BKBA 4MDXA 2CREA 4J6WA 3CPWA 3CC2T 1R0BG 3L2QA 1H3ZA 3CCMT 1SSHA 2CP6A 1VIEA 4OMOA 2DVJA 2MWOA 1PSFA 5KE2A 3H8ZA 2E5KA 1QWEA 2IIMA 2DEUA 4A4GA 1K1ZA 1NPRA 2JS2A 3OW2P 5FU7C 4QQGA 2KRMA 4OMNA 2M51A 1UUEA 3JV3A 1N8RU 2EPDA 4C92C 1CSKA 3UPUA 4C5HA 1PKTA 5GANg 3CCLQ 5GAN6 2MYSA 4LNPA 1QLYA 2ENMA 1V29B 1KFZA 1BIBA 1RACB 2XKOC 2KDSA 2YHTA 1WDXA 1W70A 1QKWA 2DZ9A 5DLQE 3CC7T 1G2BA 4C8QC 2AIRB 1Z9ZA 2DKGA 3UWNA 1VUBA 4KRTA 4M78F 1WPYA 2XDPA 1QW1A 1VA7A 2M0YA 5FU7B 3EG2A 1MMGA 2EJGA 3JCMW 4F7UE 3V8KA 4M7AF 5HK0A 2E70A 4J9EA 3QKJA 4B6MA 2DBMA 4JJDA 5IHIA 2DVEA 4BDZA 3CBOA 2DD4A 2EBPA 2C0TA 1YCSB 1KHIA 4OP0A 2A37A 1N5ZA 4LDXA 2BZ8A 3U23A 2DX1A 4E7LA 1QMCA 5KYNA 3CCMA 1H8KA 2FG0A 3V7SA 4V2SA 5KCHA 5KYWA 4JDSA 2PNIA 3EHQA 1GCQC 5D6XA 5KYXA 2RA2A 2E64A 4X34A 3I9QA 3CCJQ 3L2VA 3JCMd 1WFWA 2KMTA 2E5QA 4EPCA 2ED0A 2V8IA 1M90R 2P84A 3CMAQ 1WQWA 4GY5A 4CRIA 2PUOB 3DKMA 1CKAA 1YI2A 1KD1C 1K8AC 1NJIR 1QVGS 4E2FB 2JZ2A 3GNFB 3CPWS 1Q86C 1K73R 3G7ZA 3CC4T 2LNVA 3MEWA 1X43A 5GMKj 1R77A 2QXFA 3G1JA 4PLIA 3N5BB 4IIOA 2JOYA 3NTIA 2YUPA 2ZPIB 1KHCA 2K57A 1HJDA 1XOVA 1WNLA 1I8FA 1AVZC 1E7OA 3EGXB 2PUKB 2LQNA 3PE0A 5LJ5d 1BI0A 2OJ2A 2E41A 2WSEE 4JUVA 4J7FA 5CKDA 1E6GA 1I4K1 2RO0A 1ZA1B 3OYNA 3GOXA 1M90C 3AT1B 2JTEA 2RF0A 2ATCB 4R56A 1AZGB 4DOWA 3NHNA 5J3BA 5CO7A 2K2MA 3M0SA 5D6WA 4BI8B 1AD5A 1GRIA
chains in the Genus database with same CATH topology
3JCMV 3TCJA 2EIFA 2RD1A 2R58A 5D6YA 2DJZA 5AYFA 3QPHA 2XG8D 4J8OA 4Q5WA 1YBYA 3QJ6A 4BE2A 4FT4A 4XU1A 3CCQA 2JNGA 3LH0A 3QYHB 5CCAA 4C8QF 3I55T 3SD4A 4FT2A 4BY6C 2CGHA 1YITA 1FWZA 1VQKT 1VQ9T 3WVEB 1TH7A 4QQ6A 1PSEA 2YLCA 2D0QB 3ER0A 4C92A 3CEYA 5DLOA 3JCMb 1BI3A 4M78A 1UGPB 4RCBA 3FDRA 3JB9D 2ZZDA 4C8QA 4B9WA 2RI3A 2JTFA 3RUXA 1EIFA 5LL6S 2LCCA 3C4SA 3SWNB 3JCMh 4HKEA 4BACA 3G4SA 3KXTA 3CCQT 2F69A 4J6YA 3L2RA 3ME9A 1JBMA 2P0KA 4NOYA 5FLXE 1KD1U 2RJFA 3JCMc 4M77B 2QEXT 2YRVA 4C92G 2O4XA 4M77G 2DXUA 4QQDA 4XQ3A 2HBPA 2KQWA 5KE3A 1GXIE 1YITT 1VQ8T 3INZA 5IN1A 2DZCA 4IKFA 3OW2A 4HCZA 2F5KA 2KY9A 4N0AA 1MHNA 4F7UG 5C6SA 1M5Q1 3CCRT 4JRQA 2L89A 3CCST 4BDYA 4M7DG 1D3BB 3Q1JA 4BI3A 5KCOA 2QA4A 5IT9E 1YHQA 3UDCA 1IREB 2JUFA 4M78D 2QQSA 3CCET 1W4SA 2D9TA 3OA6A 3SFMA 3QSUA 1KQ1A 4M75B 2DXTA 4XTUA 1I81A 2DTOA 4MDWA 4XTZA 4PJOG 3RKYA 1IZ6A 1UB4A 4O6JA 4M75G 4XTWA 3SWNA 2DAQA 2FB7A 3LX7A 1VQPA 2CZ6B 5J26A 1VQ5T 5I2MA 2DPPB 2FHDA 3X28B 4DOVA 4M78B 1WQ7A 5GMKl 3CC2A 4IUTA 3P8DA 3CCEA 4M77F 3S3MA 5GANf 1S72T 4MMKA 1M90U 4M7AD 4M75C 2ZPEB 4M75E 1DJ7B 4E7IA 2LQKA 3X25B 5GAN5 5GAOn 2GQVA 3RKXA 2P4TA 1MGQA 2LQ8A 1UGQB 4QW2A 1WJSA 1RL2A 2VGNA 5GAMj 1VQ8A 4ZN3A 1LOJA 3CD6T 2FYKA 4VUBA 4Z02A 1K8AU 3HP9A 2RB6A 4IUVA 4LD6A 3EFRA 2M1HA 1UGSB 4EMGA 3BDUA 3DB4A 5GAN8 3CCLT 2VV5A 4C0DC 2DD5A 3OYLA 3E1SA 1ZHIA 4C5IA 1VQNA 4EDUA 4A4EA 2K5LA 3J80E 4M77C 3RMSA 1N9RA 2XICA 3X24B 5GANd 4L5GA 3EAEA 2L8DA 5LJ5j 2K3XA 5DM7R 3JCMP 4JRPA 2P0QA 2BKDN 2GCXA 1M1KC 4II1A 1UEBA 1Q81U 2XDBA 1YJNT 3OQ5A 4F7UA 2ZPBB 4QVCA 1Y96A 1WJQA 5FROA 2M0OA 5C0MA 3VKIA 5LJ5e 5M9OA 1HXDA 3RMQA 3OB9A 1N27A 2EJFA 3M5AA 1NPPA 3PNWC 5LJ3d 4ZTFA 2E12A 4C5EA 3M9QA 1M9SA 2BIVA 4HA8A 4J6XA 5A2QE 3GIBA 4LDVA 4J7IA 2Y4YA 4TVRA 3CCRA 2RI5A 4O5VA 2JTMA 3UT1A 2QI2A 3VV0A 5A0LA 5GAN7 4LDWA 3CMET 3HSBA 3J7AF 1VQMA 1M1FA 2XDDA 3M59A 5GAOr 1X75C 2EWNA 4MZPA 1Y96B 4OB3B 1FXXA 3C12A 3WVDB 3OYAA 2HQXA 2MMPA 3LWHA 4OF1A 1K73C 3M56A 4C92B 4HT8A 4C8QE 1M4ZA 2Y4XA 3JSCA 5CKBA 4HCBA 3MHXA 2QTXA 2D6FA 5LJ3h 3RERA 2C06A 1VQKA 2E6NA 4MZMA 2VXFA 4ZGEB 2Y90A 3CCUA 1NJIU 2M9UA 3FIFA 4M78C 4M7AA 4HCCA 4OB0B 3VYHB 1ZBXA 5CKEA 4JS5A 2OTJT 4BE0A 1YJNA 3OSSC 4KUIA 4ZGDB 3CPFA 3L42A 1KC8U 1X6OA 5GAMd 2G3RA 2XI9A 5EG2A 4C0GA 4PL6A 4M75F 3KUFA 2LDMA 4L59A 3L1AA 4JJNK 3HPWA 4Y28E 2ZCFB 3VUBA 2PVOB 3M4YA 4ZTJA 2RHYA 2KSSA 1X01A 3QO3A 4OVAA 2LT1A 4Y91A 2EQUA 1N8RC 2X4YA 4XTXA 4M7DE 2EQJA 4N4IA 5LJ3e 3C94A 2CZ0B 2DTIA 4EMKC 3G71T 4J83A 1QVGA 3CCJT 2RJCA 2OTJA 3C95A 1QP2A 3JCMX 1KG1A 1XNIA 5LJ3f 3LGFA 1JB0E 2GFAA 5GMKe 2ZPHB 3CC7A 4ATOA 3JRZA 3GNGA 4N4GA 4RG2A 1NZ9A 3BW1A 3TREA 1Q81C 3SWNC 4M77E 2RM4A 4DQ2A 4FM4B 4C0FA 1W2BS 3NTHA 2LVMA 4M75A 3R6OA 2GFUA 4N4HA 3QIIA 3E9GA 4QVZA 3TU4K 3KBGA 4KBMB 3PIPA 1VQ4T 1BI2A 3HL8A 4C0ZA 4OB2B 3OYFA 3JCMQ 1QP3A 2EQKA 3L2ZA 4OGEA 3OYJA 2DTHA 4BY6B 1Y71A 3OYMA 5CAIA 3VUZA 2QQAA 1I5LA 2EQMA 3QJYA 1VQOA 1K9MC 3VJPA 1Q86U 3ASKA 2A7YA 2RI2A 2JN0A 2P0PA 2VC8A 3OYEA 3OYDA 1YJ9T 1KQ2A 2L3RA 3S3OA 1VQLA 3CMAA 1YIJT 5DY9A 4GLKA 1N9SA 1FX7A 3NFCA 4M7AB 4A54A 3A8HB 4PJOA 1VQOT 2QDYB 2ZPGB 1UGRB 4MZTA 5GAOm 2I2LA 4DA4A 2CKKA 2WSFE 5GMKm 3CCUT 3S3NA 5GAMg 2PVDB 4R55A 2DK3A 4EMKB 1W2BA 4M7DB 5GAOp 3JB9I 2JVVA 3HKSA 3WXMB 4F7UB 2LRQA 3DB3A 2RHXA 5HY6A 4M75D 3OW2S 2A3LA 3GLXA 2V8KA 4JRIA 4FL6A 3JCMe 4RCCA 1JJ2S 1HK9A 5GMKh 1VQ9A 2M16A 1Q82C 3A8LB 4NL2A 3RIRA 2QQBA 1YJWT 2GF7A 3H6ZA 1K73U 3I56A 2XHCA 1VQNT 1Y7XA 3HFNA 4QVDA 5GAN3 5CKHA 4PJOB 1G3WA 3LGLA 3JCMf 4C92E 5GANh 2QQ9A 4BD3A 2F5TX 1YI2T 1VQ4A 2XK0A 4IUQA 4F7UF 1NJIC 2O4XB 4A53A 3BFMA 5FRMA 2KK4A 3M57A 3PFSA 5GAN4 4C92F 2V8JA 3CC4A 4RKUE 4XK8E 3PIOA 3EFSA 3QG1A 3FEOA 4X9CA 3QYGB 3X26B 4ELYC 3G6EA 1M1KU 1Y07A 2HNIA 4M78E 1U1TA 5HKCA 2XD0A 3DLMA 3M58A 4E47A 1OZ2A 4UC4A 1BKBA 2AHJB 4MDXA 3OMCA 3MP1A 3L2UA 4RG8A 4J6WA 3OYHA 2K5FA 3CPWA 2RHZA 3JCMJ 3OMGA 3CC2T 2LTOA 3LW5E 5CVIA 2VYTA 2O01E 3L2QA 5GMKi 3CBMA 1H3ZA 1P92A 2ZGWA 2RHUA 3CCMT 2KVQG 4NS5A 1VIEA 1KC8C 2VUBA 5GAOq 2OTLT 5GAOl 3HFOA 4XAXB 2MWOA 1SSFA 2PU9B 3QHSA 4PJOF 1PSFA 1M1GA 3OYIA 5KE2A 2RH2A 3H8ZA 1YJWA 3FC3A 3CBPA 3RESA 2DIGA 2LX9A 3MEAA 4NL3A 3CCLA 3PMTA 1YJ9A 2DXCA 3V8JA 1YIJA 3A8OB 3LWIA 3CMAT 3JB9H 5LJ3g 1Q7YU 4A4GA 1NPRA 3JB9G 2CZ1B 1JRIA 3HRTA 4IUPA 2RJDA 4LD9K 3AHUA 4JLIA 5FU7C 5FU6C 4QQGA 4PKCC 4PJOD 1QVFA 4D6WA 5IAYA 1VQPT 3QUIA 1N8RU 3M55A 4X9DA 4C92C 1K9MU 1BI1A 5I21A 2H3JA 1O75A 3OS1A 4EMKA 1B34A 3UPUA 3CCSA 3HRSA 4C5HA 1XQHA 3T9NA 2PQWA 3HRUA 5GANg 5GAN6 1U1SA 2LCLA 3QBYA 2RJEA 4PNOA 4LDUA 5CK9A 1KQSA 5J39A 2EJ9A 3OSVA 3PMIA 4IUUA 3F70A 3X20B 1D3BA 1NE8A 1AHJB 3CCJA 2RK1A 1V29B 1BIBA 2XKOC 4XU0A 4C5GA 3GF5A 1Q82U 2KDSA 1OYXA 2YHTA 4OB1B 3FB9A 1OI1A 5CIUA 2B8AA 2DZ9A 3SDZA 3I56T 5DLQE 5GAMf 5I2SA 3G6ET 3CC7T 1G5VA 2WACA 1ZQ1A 2MAMA 2X35A 4C8QC 4P5NA 2DIQA 1M8VA 2DKGA 3UWNA 1VUBA 4N0AC 3O8VA 4M78F 3FJPA 3CCVA 2X4WA 1WPYA 2XDPA 4IURA 4MMLA 3G71A 1QW1A 5FU7B 2R57A 2HAXA 4C8QG 2E1HA 5LJ5h 4E7JA 3CD6A 2KAFA 2EJGA 3I55A 4ELZC 4BUGA 3V8KA 4C8QB 4F7UE 5HK0A 3JCMW 4M78G 2E70A 3LLRA 3QKJA 4M77D 4M7AF 4FU6A 3ZEHA 1G3TA 3A8MB 5KH6A 3GP8A 2FVUA 2IVWA 2X4JA 2DVEA 2K2VA 4KT0E 4KULA 4C0DB 4BDZA 3CBOA 2DD4A 4BB7A 3NTKA 1VQ6T 1KHIA 3PGGA 4OP0A 5CKFA 4OGCA 4J5YA 1LJOA 4LDXA 1XTDA 1U8RA 2OTLA 4E7LA 4E7HA 4FIBA 5GAMh 3CXCA 3CCMA 2RK2A 3MO8A 3V7SA 2K4YA 4V2SA 5KCHA 4ME7A 3V7CA 1LNXA 2L5QA 3OYGA 1VQLT 4JDSA 4JRKA 2VGMA 3LYIA 3L2WA 1QVGS 4M7AE 2CS7A 3TEEA 3E9FA 4BI4A 2PVGB 3OS2A 2QA4T 1OZ3A 5D6XA 1QVPA 4ZN1A 2DXBA 1YHQT 4RMOA 4HT9A 2RA2A 2E64A 4X34A 5LJ5f 1Q7YC 2HD0A 3GPLA 3CMEA 3L2VA 5FU6B 3JCMd 3E19A 4A4FA 2KMTA 3FLGA 1H641 2E5QA 3M53A 3P8BB 4XU3A 4EPCA 2XU8A 2CYZB 2V8IA 3QDRB 1VQ6A 4E7KA 3JB9F 5CQXA 3BY7A 2K5IA 3ZFJA 1WQWA 4PJOC 4GY5A 4CRIA 2PUOB 4M7DA 3DKMA 1YI2A 4A4HA 1KD1C 5GAMe 1K8AC 2MF2A 2X4XA 4L6V5 2RHIA 4C92D 3OYKA 3QZ5B 1YCYA 2LC4A 2JZ2A 3GNFB 5A0DA 3JAME 3CPWS 1Q86C 3M4GA 4M7AG 3G7ZA 2R5MA 2HQEA 3J81E 3CC4T 2LNVA 3META 5L8RE 4A4KA 2NLUA 3MEWA 4C8QD 5GAN2 3OYYA 3MP6A 2E10A 2XIDA 5GMKj 3MEVA 3HHTB 3OYBA 2LT4A 2QXFA 3RKWA 2QEXA 4OMFB 3N5BB 4PLIA 5CQYA 2OAUA 3OBYA 4JLGA 2JOYA 3VYGA 3NTIA 3CCVT 3OY9A 1WGSA 1BYMA 5LJ5g 2EKOA 2EAYA 2ZPIB 1KHCA 1JJ2A 3DLLA 4CI0C 3G4ST 1G3SA 2K57A 1XOVA 2E6ZA 1I8FA 1WNLA 1G3YA 1KQSS 4KUDK 4M7DF 2R5AA 2PUKB 5HK3A 3P8HA 4WF2A 2BUDA 4ZGJB 5LJ5d 4BE1A 4M77A 1BI0A 3OBWA 3PT9A 3BDLA 3URGA 2MWPA 2EFIA 2E41A 2QQRA 1BIAA 3MCAB 4XU2A 4M7DD 2IG0A 2DO3A 2WSEE 3OS5A 2ZPFB 3QZ9B 3V8LA 5LJ3j 3MP8A 3V7RA 2MI6A 4JUVA 3JB9J 1VQ5A 1B34B 4J7FA 4LDYA 5CKDA 3OS0A 1QVFS 2FL7A 1I4K1 2RO0A 3QXEB 3OYNA 3S6WA 3GOXA 1VQ7A 2DEQA 2E65A 2YLBA 4FSXA 1O9SA 3CXCS 1M90C 1VIFA 4EMHA 1RI0A 1S72A 4XTYA 4XTVA 2WSCE 4JS4A 3VU3C 5FRNA 5CR2A 3FRNA 5GANe 2EYQA 3M54A 2K3YA 3SB2A 2CZ7B 4R56A 3OYCA 1VQMT 4DOWA 1VQ7T 4M7DC 3PTAA 3A8GB 3A5ZB 1WJRA 1N6AA 2VXEA 5CO7A 5J3BA 3ZBDA 4PJOE 4PLLA 5A0GA 5D6WA 4BI8B 5GANj 1R8OB 4M7AC 4B9XA 3JCMg 4YTLA 3MEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRI A;  4M78 G;  4M77 D;  4RCC A;  2RD1 A;  1HK9 A;  3JCM V;  1HXD A;  5GMK h;  5LJ5 e;  3JCM e;  4NL2 A;  3RIR A;  2DJZ A;  2EJF A;  4C8Q B;  2DVE A;  5LJ3 d;  3HFN A;  4QVD A;  4XU1 A;  5GAN 3;  3GIB A;  4HA8 A;  4J6X A;  4PJO B;  3JCM f;  4C92 E;  5GAN h;  4C8Q F;  3PGG A;  4OP0 A;  2CGH A;  4J5Y A;  1LJO A;  4F7U F;  4A53 A;  1TH7 A;  2YLC A;  3BFM A;  4C92 A;  5GAN 7;  5GAN 4;  4C92 F;  3JCM b;  3HSB A;  4M78 A;  4RCB A;  3EFS A;  5GAM h;  5GAO r;  3JB9 D;  4X9C A;  2EWN A;  1Y96 B;  4C8Q A;  3V7S A;  2HNI A;  4M78 E;  4V2S A;  3RUX A;  1U1T A;  3V7C A;  1LNX A;  3SWN B;  3JCM h;  4C92 B;  4HT8 A;  4C8Q E;  4JRK A;  4J6Y A;  4M7A E;  2QTX A;  5LJ3 h;  1JBM A;  3RER A;  4NOY A;  2VXF A;  4HT9 A;  3JCM J;  4J6W A;  2Y90 A;  3JCM c;  4M77 B;  2RA2 A;  2E64 A;  3FIF A;  4M78 C;  5LJ5 f;  4M7A A;  4C92 G;  4M77 G;  5GMK i;  3JCM d;  2DXU A;  4XQ3 A;  2ZGW A;  1H64 1;  4XU3 A;  5GAM d;  5GAO q;  5GAO l;  3INZ A;  3HFO A;  2DZC A;  3QHS A;  4PJO F;  4M75 F;  3JB9 F;  3BY7 A;  3L1A A;  4N0A A;  4F7U G;  1WQW A;  1M5Q 1;  3JCM W;  4PJO C;  4M7D A;  4M7D G;  1D3B B;  3RES A;  5GAM e;  4NL3 A;  3QO3 A;  1X01 A;  4C92 D;  1YCY A;  4Y91 A;  3V8J A;  4M7A G;  4M7D E;  4M78 D;  4XTX A;  3JB9 H;  3M4G A;  5LJ3 g;  3QSU A;  4M75 D;  1KQ1 A;  5LJ3 e;  4M75 B;  2DXT A;  4XTU A;  1I81 A;  2DTO A;  4XTZ A;  3RKY A;  4PJO G;  3SWN A;  4XTW A;  4C8Q D;  5GAN 2;  4M75 G;  5GMK j;  1JRI A;  2DTI A;  2E10 A;  2FB7 A;  3JB9 G;  4EMK C;  3AHU A;  4JLI A;  3RKW A;  3JCM X;  4M78 B;  5LJ3 f;  1WQ7 A;  5GMK l;  5LJ5 g;  5GMK e;  4PJO D;  4M77 F;  2EAY A;  5GAN f;  4MMK A;  4M7A D;  2K57 A;  3QUI A;  4M75 C;  4X9D A;  1I8F A;  1WNL A;  4M75 E;  3BW1 A;  4C92 C;  4M7D F;  3SWN C;  4M77 E;  2RM4 A;  4DQ2 A;  5I21 A;  5GAN 5;  5GAO n;  3RKX A;  4EMK A;  1B34 A;  4WF2 A;  4M75 A;  1MGQ A;  5GAM j;  5LJ5 d;  4M77 A;  5GAN g;  5GAN 6;  1U1S A;  1LOJ A;  4PNO A;  2E41 A;  2FYK A;  1BIA A;  4XU2 A;  4M7D D;  2EJ9 A;  3V8L A;  3JCM Q;  3L2Z A;  5LJ3 j;  1D3B A;  2RB6 A;  2DTH A;  4JUV A;  3V7R A;  3JB9 J;  1B34 B;  3EFR A;  4EMG A;  5CAI A;  3BDU A;  1I4K 1;  5GAN 8;  1I5L A;  1BIB A;  4XU0 A;  2DEQ A;  2E65 A;  2YLB A;  2YHT A;  2JN0 A;  2VC8 A;  1N9R A;  3FB9 A;  4M77 C;  4EMH A;  5GAN d;  2DZ9 A;  1KQ2 A;  5GAM f;  5LJ5 j;  3JCM P;  4XTY A;  4XTV A;  5DY9 A;  1N9S A;  4C8Q C;  1M8V A;  2DKG A;  4A54 A;  4M7A B;  4N0A C;  3VU3 C;  4PJO A;  4M78 F;  3FJP A;  3SB2 A;  5GAN e;  4M7D C;  1WPY A;  4MML A;  5GAO m;  2I2L A;  5GMK m;  4F7U A;  5GAM g;  2VXE A;  4M7D B;  4QVC A;  4EMK B;  4PJO E;  5GAO p;  3JB9 I;  4C8Q G;  2E1H A;  4F7U B;  5LJ5 h;  5GAN j;  1Y96 A;  4M7A C;  2EJG A;  3JCM g;  4F7U E;  3V8K A;  4M7A F; 
#chains in the Genus database with same CATH topology
 1MMD A;  3JCM V;  2EIF A;  2RD1 A;  4EIK A;  5AYF A;  1OU8 A;  1D1C A;  4CC3 A;  1GBR A;  1AWW A;  4BE2 A;  2NYS A;  1T0J A;  4DBR A;  1SHF A;  5CCA A;  4FT2 A;  3WVE B;  4QQ6 A;  1BI3 A;  2GBQ A;  2VWF A;  2QEX Q;  2RI3 A;  1PWT A;  2JTF A;  3RUX A;  5LL6 S;  2A28 A;  3C4S A;  3SWN B;  5I11 A;  4BAC A;  4OMQ A;  3G4S A;  2AKK A;  3CCE Q;  2F69 A;  2P0K A;  1SEM A;  3M0P A;  3I35 A;  5KE3 A;  3INZ A;  1KIK A;  3OW2 A;  4HCZ A;  2CSI A;  2F5K A;  2HDA A;  5C6S A;  1MHN A;  3CCR T;  4BDY A;  2L89 A;  4M7D G;  1D3B B;  3Q1J A;  2QA4 A;  1YHQ A;  3O5Z A;  3EG3 A;  1IRE B;  2JUF A;  4M78 D;  2QQS A;  1M30 A;  4PFP A;  1W4S A;  3OA6 A;  4M75 B;  5GAN 2;  1I81 A;  3SWN A;  3LX7 A;  2I0N A;  1I07 A;  2JXB A;  2EQI A;  2CZ6 B;  5I2M A;  2FHD A;  3X28 B;  4DOV A;  4M78 B;  2DJQ A;  3S3M A;  1S72 T;  1SKU B;  3IQL A;  4M75 C;  2J6K A;  2DFU A;  2K6D A;  5D7U A;  1MGQ A;  1WJS A;  2VGN A;  1AEY A;  3CD6 T;  4Z02 A;  3HP9 A;  2J7I A;  4LD6 A;  1D09 B;  3EFR A;  1HSQ A;  3DB4 A;  3CCL T;  2VV5 A;  3OYL A;  3E1S A;  1ZHI A;  2YRD A;  1M27 C;  4C5I A;  4L5G A;  3EAE A;  2XMF A;  2K3X A;  5DM7 R;  2BKD N;  2ZAE A;  1B3Q A;  4II1 A;  1UEB A;  3CPW P;  4F7U A;  2JS0 A;  4A63 B;  1Y96 A;  5C0M A;  3VKI A;  5M9O A;  1HXD A;  1UG1 A;  2DL5 A;  3OB9 A;  1NPP A;  4DEX A;  5LJ3 d;  4ZTF A;  3CXC P;  4C5E A;  2Y4Y A;  4TVR A;  2JTM A;  1T0H A;  3M0T A;  3HSB A;  2ED1 A;  2EWN A;  4MZP A;  1FXX A;  1PM3 A;  4J9H A;  2DBK A;  2HL3 A;  3JSC A;  2QTX A;  1NYF A;  5EC7 A;  1PRL C;  3CCU A;  1NJI U;  3VS7 A;  2M9U A;  4M78 C;  2OTJ T;  4BE0 A;  1YJN A;  1FMV A;  4KUI A;  3RBB B;  3L42 A;  4AFZ C;  3VS2 A;  1ACM B;  4M75 F;  2PZ1 A;  1I5O B;  3HPW A;  2FZG B;  4HXJ A;  2RHY A;  1BK2 A;  2KSS A;  3C94 A;  4DBH A;  2DTI A;  2MPX C;  1D0X A;  3LGF A;  4ATO A;  2ROT A;  4RG2 A;  3VS3 A;  1NZ9 A;  3TRE A;  1Q81 C;  3EG9 B;  4DQ2 A;  4M77 E;  2RQR A;  4C0F A;  1NYG A;  2O31 A;  4OMM A;  2YUO A;  1A0N B;  3H0H A;  4KBM B;  3PIP A;  1VQ4 T;  4C0Z A;  3OYF A;  1QP3 A;  3L2Z A;  2DTH A;  4BY6 B;  3VUZ A;  1I5L A;  2EQM A;  3QJY A;  1VQM Q;  3ASK A;  2A7Y A;  2JN0 A;  1XJW B;  3QWX X;  3OYD A;  1KQ2 A;  2L3R A;  1YIJ T;  1BU1 A;  3A8H B;  1WXU A;  1KK7 A;  2QDY B;  4MZT A;  1UGR B;  5GAO m;  1Q82 R;  2I2L A;  2JW4 A;  3CCU T;  2A36 A;  2CP5 A;  2PVD B;  5IHK A;  5GAO p;  3JB9 I;  4FYV B;  3WXM B;  4F7U B;  2LRQ A;  3OW2 S;  4M75 D;  1GBQ A;  4NL2 A;  1AWO A;  2BZY A;  2GF7 A;  1QKX A;  1VQN T;  3EGD A;  3HFN A;  4QVD A;  5CKH A;  4PJO B;  3JCM f;  1ZA2 B;  4KGZ B;  2QDL A;  1EZZ B;  4IUQ A;  1YIJ Q;  2O4X B;  4A53 A;  1GCQ A;  5FRM A;  1OOT A;  1QCO A;  4C92 F;  3CC4 A;  4RKU E;  2K79 A;  3QG1 A;  1PC0 A;  3G6E A;  1M1K U;  1IHW A;  2DMO A;  1Y07 A;  4M78 E;  3DLM A;  2LP5 A;  1OZ2 A;  5L23 A;  1RI9 A;  3L2U A;  3OMG A;  2LTO A;  3H0I A;  1EFN A;  1PHT A;  1P92 A;  2COW A;  2RHU A;  1PRM C;  1KC8 C;  4XAX B;  4PJO F;  2RN8 A;  3OYI A;  2RMO A;  2KR3 A;  2RH2 A;  3SHW A;  3RES A;  3MEA A;  3CCL A;  3CCU Q;  1PD1 A;  2MIO A;  1K9A A;  3CMA T;  1PD0 A;  3A8O B;  1TUD A;  1AWJ A;  3JB9 G;  2CZ1 B;  3MKD A;  4AG2 C;  4JLI A;  2YT6 A;  4PKC C;  1K9M U;  1BI1 A;  2DET A;  1O75 A;  3OS1 A;  1ZUY A;  3CCS A;  3HRS A;  1PCX A;  3HRU A;  5CK9 A;  2RJE A;  4PNO A;  1KQS A;  3OSV A;  4IUU A;  3X20 B;  2GTJ A;  1NE8 A;  3CCJ A;  1D0Y A;  2HSE B;  4XU0 A;  4C5G A;  1EX4 A;  1RLQ C;  1Q82 U;  1SG5 A;  3VS0 A;  2B8A A;  1G5V A;  2WAC A;  1ZQ1 A;  2X35 A;  4LN2 A;  1QVG P;  1K9M R;  3VRZ A;  5KYW B;  2BTT A;  1UE9 A;  2HAX A;  3CD6 A;  2KAF A;  3KFV A;  4BUG A;  4C8Q B;  4M77 D;  4Z88 A;  2DL7 A;  4FU6 A;  3GP8 A;  2IPO B;  2IVW A;  2K2V A;  5FWB A;  1VQ6 T;  1U5S A;  5CKF A;  4FW2 A;  4J5Y A;  2KXC A;  2GQI A;  3EGU A;  4FIB A;  5GAM h;  1MUZ A;  1NBE B;  1JU5 C;  3MO8 A;  2K4Y A;  2L5Q A;  1VQL T;  2VGM A;  4M7A E;  4BI4 A;  2QA4 T;  1YHQ T;  4ZN1 A;  1Q7Y C;  3CME A;  3HTR A;  2LQW A;  3E19 A;  4A4F A;  3P8B B;  2JMA A;  2XU8 A;  2FEI A;  3VRY A;  3BY7 A;  2K5I A;  3ZFJ A;  4PJO C;  2O88 A;  3A98 A;  4M7D A;  4A4H A;  1SF9 A;  2FRW A;  3TSW A;  2X4X A;  2L3P A;  2R5M A;  2RNA A;  2BE7 D;  3MET A;  3OYY A;  2E10 A;  2LT4 A;  3RKW A;  1ZSG A;  3OBY A;  1ZSZ A;  4JLG A;  2SRC A;  3VYG A;  3CME Q;  2JT4 A;  3CCV T;  1BYM A;  4CI0 C;  2E6Z A;  4KUD K;  2DA9 A;  5HK3 A;  1X69 A;  4BE1 A;  2EKH A;  2RQV A;  4J9I A;  3MCA B;  1JXM A;  2DO3 A;  4IKF A;  3V7R A;  2MI6 A;  3JB9 J;  4LDY A;  1Q7Y R;  2ESW A;  2AKL A;  1KSW A;  2E65 A;  2L0A A;  4FSX A;  3CXC S;  4EMH A;  2B86 A;  2WSC E;  8AT1 B;  3VU3 C;  5FRN A;  2DRK A;  3OYC A;  3SB2 A;  1VQM T;  4M7D C;  2CZ7 B;  3NPF A;  4AMC A;  3A8G B;  3A5Z B;  2BE9 B;  1N6A A;  4FCY A;  1Z9Q A;  4PLL A;  4HVU A;  5A0G A;  2KE9 A;  2DM1 A;  4ESR A;  1SPK A;  1OPL A;  2CP3 A;  2DJZ A;  4J8O A;  2F2W A;  3QJ6 A;  4OML A;  3QYH B;  2HL5 C;  3I55 T;  1VQK T;  1MND A;  2CGH A;  2D0Q B;  3CEY A;  5DLO A;  4M78 A;  1UGP B;  3FDR A;  4RTX A;  2LNH B;  4HKE A;  1D1A A;  3KXT A;  4J6Y A;  1KD1 U;  3JCM c;  4M77 G;  2DXU A;  4XQ3 A;  2KQW A;  1YIT T;  1VQ8 T;  2DER A;  2KY9 A;  4CC7 A;  4F7U G;  4FYW B;  1M5Q 1;  4KGV B;  5IT9 E;  5IXF A;  4J9B A;  1T3L A;  2D9T A;  3QSU A;  1UHF A;  2DXT A;  4XTU A;  4XTZ A;  1UB4 A;  2FB7 A;  5J26 A;  3R6N A;  2DPP B;  1JEG A;  4IUT A;  3P8D A;  3CCE A;  2F2V A;  2LQK A;  1VQ6 Q;  5GAO n;  2GQV A;  4QW2 A;  1UGQ B;  1RL2 A;  4ZN3 A;  3EFO A;  1M2O A;  4IUV A;  4RTT A;  5GAN 8;  4AFU C;  5I22 A;  3I56 Q;  2DD5 A;  2EYZ A;  2F1L A;  2K5L A;  1JQQ A;  2CSQ A;  2L8D A;  4AFQ C;  1M1K C;  4F16 A;  1YJN T;  4RTW A;  2ZPB B;  2KT8 A;  5FRO A;  2M0O A;  4JZ3 A;  1V1C A;  2K9G A;  2QYZ A;  3RMQ A;  1N27 A;  1NEG A;  1M2V A;  2KYM A;  1J3T A;  2E12 A;  3EGX A;  3GIB A;  2BIV A;  4HA8 A;  3G71 Q;  5ECA A;  3UT1 A;  5GAN 7;  3CD6 Q;  1TSF A;  3M59 A;  2DYI A;  1Y96 B;  1G8X A;  2HQX A;  2KXD A;  2MMP A;  4E7Z A;  3LWH A;  1K73 C;  3M56 A;  4HCB A;  4HT8 A;  4C8Q E;  5CKB A;  1I1J A;  2DL3 A;  2C06 A;  2E6N A;  2RQW A;  2Y90 A;  2DF6 A;  1NM7 A;  4AG1 C;  3VYH B;  1ZBX A;  5CKE A;  2D0N A;  4ZGD B;  3CPF A;  1HYO A;  5GAM d;  5EG2 A;  1FYN A;  3KUF A;  2LDM A;  2ZCF B;  2PVO B;  4ZTJ A;  1WXB A;  3CCR Q;  5IH2 A;  2EQJ A;  1VQL Q;  1JJ2 P;  2CZ0 B;  4RTZ A;  3G71 T;  2JJ9 A;  1QVG A;  2D8H A;  3CCJ T;  4FYY B;  2RJC A;  1KG1 A;  1XNI A;  2GFA A;  2RQU A;  2ZPH B;  1UJ0 A;  1S1N A;  2ABL A;  1AT1 B;  2RM4 A;  1JXO A;  2E3H A;  2EGE A;  2LVM A;  3R6O A;  4N4H A;  2GFU A;  1B7T A;  2HKN A;  3QII A;  1OU9 A;  4QVZ A;  3TU4 K;  3KBG A;  2MOX A;  1BI2 A;  3HL8 A;  2MCN A;  1VQ9 Q;  4OGE A;  1Y71 A;  3OYM A;  1BB9 A;  1RAG B;  2FPD A;  1Q86 U;  2LX7 A;  1KJW A;  2CH4 A;  1D1B A;  3CMA A;  3THK A;  1N9S A;  3NFC A;  1YWO A;  3NGP A;  5GMK m;  5GAM g;  4M7D B;  4R55 A;  2JVV A;  3CQT A;  2RHX A;  4D8K A;  5HCK A;  4FL6 A;  3JCM e;  4RCC A;  1VQ9 A;  1HK9 A;  2M16 A;  2QQB A;  1YJW T;  3H6Z A;  2XHC A;  1YP5 A;  1G3W A;  2DYB A;  5GAN h;  4BD3 A;  1U06 A;  1VQ4 A;  4DBF A;  1NJI C;  2KK4 A;  5GAN 4;  2V8J A;  1NLP C;  4XK8 E;  1TOV A;  3FEO A;  4X9C A;  1U1T A;  5HKC A;  3M58 A;  2G6F X;  2AHJ B;  3OMC A;  2LMJ A;  1RLP C;  4RG8 A;  2RHZ A;  1F1B B;  5CVI A;  2VYT A;  2ZGW A;  2KVQ G;  3GBQ A;  4NS5 A;  2VUB A;  5GAO q;  2OTL T;  5GAO l;  3HFO A;  1WI7 A;  2NUP B;  1YJW A;  3FC3 A;  3CBP A;  2LX9 A;  4NL3 A;  3PMT A;  2DXC A;  3V8J A;  1YIJ A;  3LWI A;  3JB9 H;  5LJ3 g;  9ATC B;  1ZSZ C;  4CC4 B;  4IUP A;  3HRT A;  3CCM Q;  3AHU A;  5FU6 C;  4RTV A;  4PJO D;  1QVF A;  4Y92 A;  4D6W A;  4F04 B;  3QUI A;  3M55 A;  4X9D A;  2EYW A;  3LH5 A;  2QGF B;  5I21 A;  2KRS A;  1RAD B;  2H3J A;  1VQ4 Q;  1XQH A;  1G83 A;  4JZ4 A;  3QBY A;  4LDU A;  3TSZ A;  5J39 A;  1AHJ B;  2RK1 A;  1YI2 Q;  2KRO A;  4OB1 B;  1OI1 A;  5CIU A;  5GAM f;  4WCI A;  5I2S A;  2MAM A;  1FMK A;  4P5N A;  3UA7 A;  4N0A C;  3CCV A;  3FJP A;  4ZNX A;  4IUR A;  4MML A;  3G71 A;  2YWW A;  1M2V B;  2CUD A;  3H41 A;  2R57 A;  1M3B A;  4C8Q G;  2E1H A;  4ELZ C;  3LLR A;  2QAZ A;  5KH6 A;  4JJB A;  4KT0 E;  4KUL A;  4BB7 A;  1ZUK A;  3PGG A;  3RR6 A;  4OGC A;  1LJO A;  1U8R A;  3PVL A;  2EVR A;  2OTL A;  4FSS A;  4E7H A;  1PKS A;  3CXC A;  5FW9 A;  3D7S B;  4JJC A;  3EH2 A;  3V7C A;  3OYG A;  4JRK A;  3L2W A;  2KRN A;  1MNE A;  3LYI A;  3ULR B;  2CS7 A;  1OZ3 A;  3EFO B;  4HT9 A;  2DXB A;  5LJ5 f;  1W2B P;  2HSP A;  2HD0 A;  2J05 A;  2AK5 A;  2X3W D;  1H64 1;  4XU3 A;  4X1V A;  4FYX B;  1E6H A;  2CYZ B;  3QDR B;  3RDV A;  1VQ6 A;  3RNJ A;  4E7K A;  3JB9 F;  5CQX A;  5KYU A;  3CC2 Q;  5GAM e;  4L6V 5;  4PFO A;  2RHI A;  4C92 D;  3OYK A;  1YCY A;  5A0D A;  3JAM E;  1OPK A;  3FJ5 A;  1UDL A;  4A4K A;  4C8Q D;  2BZX A;  2DE0 X;  3MP6 A;  1YFN A;  3OYB A;  3MEV A;  1KC8 U;  3I55 Q;  1VQK Q;  5CQY A;  2O9S A;  1WHM A;  2NUT B;  1Q86 R;  3OY9 A;  1YJW Q;  1JJ2 A;  1RAB B;  3DLL A;  3G4S T;  1G3S A;  1G3Y A;  1KQS S;  1VQN Q;  4QKU A;  2EW3 A;  2QGG A;  2R5A A;  3P8H A;  4WF2 A;  2BUD A;  1RAE B;  4ZGJ B;  2YUQ A;  1IHV A;  1UFF A;  2DLP A;  3PT9 A;  3URG A;  2MWP A;  4XU2 A;  2L3Q A;  1BIA A;  4M7D D;  4D8D A;  1QVF P;  2YXY A;  2ZPF B;  3V8L A;  5LJ3 j;  3MP8 A;  1GL5 A;  4KGX B;  2FL7 A;  1LVK A;  3S6W A;  1O9S A;  1KQS P;  1VIF A;  4XTY A;  4XTV A;  3G4S Q;  2LZ6 B;  5CR2 A;  3UA6 A;  3FRN A;  3M54 A;  2HKQ B;  2K3Y A;  1VQ7 T;  4E6R A;  3PTA A;  1TUG B;  2E4H A;  4PJO E;  5KYY A;  1VQO Q;  1ZBJ A;  5GAN j;  4M7A C;  1R8O B;  4B9X A;  3JB9 D;  3MEU A;  1IRX A;  4Q5W A;  1YBY A;  4FT4 A;  1QWF A;  4C8Q F;  1YIT A;  4BY6 C;  1TH7 A;  4C92 A;  1WHG A;  4C8Q A;  1OEB A;  4OMP A;  3JCM h;  4GLM A;  3ME9 A;  1JBM A;  4NOY A;  1OQK A;  5FLX E;  4M77 B;  1KC8 R;  4C92 G;  2O4X A;  1VQ5 Q;  1GXI E;  1WA7 A;  2NWM A;  4PJL A;  1UHC A;  4JRQ A;  4FW1 A;  4Z8A A;  2CUB A;  4RTU A;  3VS4 A;  2DL4 A;  1ARK A;  1X27 A;  3SFM A;  3RKY A;  4MDW A;  4PJO G;  4O6J A;  4M75 G;  1VQP A;  2FRY A;  1R0C B;  3QDF A;  2QTV A;  1WQ7 A;  4M77 F;  5GAN f;  1YNZ A;  1M90 U;  1DJ7 B;  4E7I A;  1MMA A;  3X25 B;  5GAN 5;  3PVQ A;  3RKX A;  4PJJ A;  1UTI A;  1VQ8 A;  1LOJ A;  2VVK A;  2RB6 A;  2M1H A;  3SEM A;  2HQH A;  1VQN A;  4EDU A;  3EH1 A;  4M77 C;  3A1P A;  1N9R A;  2XIC A;  3X24 B;  3JCM P;  4JRP A;  2P0Q A;  2E3I A;  1GCP A;  2GCX A;  1QCF A;  2H3E B;  1Q81 U;  3OQ5 A;  1FMW A;  1Y0M A;  1WJQ A;  5LJ5 e;  3M5A A;  3PNW C;  2LJ0 A;  4RUG A;  4J6X A;  4DBQ A;  4J9D A;  5IXB A;  4LDV A;  5A2Q E;  2FZC B;  2LJ1 A;  4J7I A;  1S72 Q;  1KD1 R;  3TVT A;  1IXD A;  2RI5 A;  2QI2 A;  3CME T;  4LDW A;  4AT1 B;  2XDD A;  2NUZ A;  2EYX A;  8ATC B;  4OB3 B;  3WVD B;  2A08 A;  4CC2 A;  4C92 B;  1IO6 A;  2D6F A;  2CT3 A;  2KT1 A;  2P4R A;  3FIF A;  4PJM A;  4JS5 A;  3OSS C;  4GBQ A;  1C6V X;  1N8R R;  2COZ A;  2A0F B;  4C0G A;  2D1X A;  4PL6 A;  3L1A A;  4JJN K;  4Y28 E;  1VYU A;  3M4Y A;  4OVA A;  5KYX B;  2LT1 A;  4Y91 A;  1N8R C;  2X4Y A;  1WIE A;  4N4I A;  5GJW B;  2J6O A;  2CP7 A;  4J83 A;  3G6E Q;  3EG9 A;  2GNC A;  2OTJ A;  3C95 A;  5LJ3 f;  2DNU A;  2CT4 A;  2CP2 A;  3JRZ A;  4M4Z A;  4N4G A;  3VS5 A;  3CCQ Q;  3BW1 A;  3SWN C;  4FM4 B;  4IIM A;  1ZLM A;  1GFD A;  2KI7 A;  3NTH A;  1Y57 A;  1QCN A;  3E9G A;  2D8J A;  4OB2 B;  5IHN A;  2EQK A;  2V1Q A;  1TUC A;  5CAI A;  4R0K A;  1HD3 A;  2FZK B;  1VQO A;  2JMC A;  2VC8 A;  3OYE A;  1YJ9 T;  3TQ7 P;  3C0C A;  5DY9 A;  2Z0W A;  1FX7 A;  4A54 A;  4M7A B;  2QG9 B;  4HCK A;  1B07 A;  1VQO T;  2WSF E;  1W2B A;  5KYU B;  3DB3 A;  5HY6 A;  1LPL A;  2A3L A;  2V8K A;  4JRI A;  1Q95 G;  1JJ2 S;  5GMK h;  1Q82 C;  3A8L B;  3RIR A;  1LCK A;  1K73 U;  4KH1 B;  1Y7X A;  3LGL A;  4C92 E;  1X2Q A;  5FWC A;  2XK0 A;  2X9H A;  4F7U F;  2W10 A;  3BFM A;  1VOM A;  3EFS A;  1I0C A;  3M0R A;  3QYG B;  3X26 B;  1WHK A;  4E47 A;  2QAS A;  3BE3 A;  4UC4 A;  3VS1 A;  2C0O A;  3MP1 A;  1YIT Q;  1OUL A;  3OYH A;  3JCM J;  2DL8 A;  2K5F A;  3LW5 E;  2K3B A;  2O01 E;  5GMK i;  3M0U A;  3CBM A;  1ZUU A;  1K8A R;  4F17 A;  2J06 A;  1SSF A;  2PU9 B;  3QHS A;  1YN8 A;  1M1G A;  1K0X A;  4J9C A;  4HVV A;  2DIG A;  4DEY A;  1YJ9 A;  7AT1 B;  1AWX A;  1Q7Y U;  1OX8 A;  4LD9 K;  1JRI A;  1AZE A;  2RJD A;  2CP0 A;  4QT7 A;  3EHR A;  2RQT A;  1BCM A;  1RUW A;  2OTL Q;  5IAY A;  2JM8 A;  2K7A A;  2HMA A;  2KYB A;  4EMK A;  1B34 A;  3QWY A;  1IB8 A;  4KH0 B;  2L2P A;  3T9N A;  2PQW A;  1M3C A;  2ECZ A;  1U1S A;  2LJ3 A;  2LCL A;  3M0Q A;  4WTO B;  2EJ9 A;  3PMI A;  3F70 A;  1D3B A;  1SRL A;  3GF5 A;  4K11 A;  2OI3 A;  1OYX A;  3FB9 A;  3SDZ A;  3I56 T;  3G6E T;  3CC7 Q;  2DIQ A;  1M8V A;  3O8V A;  2X4W A;  1WHH A;  2SEM A;  2QK0 A;  2KNB B;  2DRM A;  1WZO A;  2EGC A;  5LJ5 h;  2XDB A;  3I55 A;  1VQK A;  4M78 G;  3ZEH A;  1G3T A;  3A8M B;  2FVU A;  3EG0 A;  2X4J A;  2HCK A;  4C0D B;  2X3X D;  3NTK A;  1VYT A;  2C0I A;  3VS6 A;  1NEB A;  1V76 A;  1XTD A;  1UJY A;  4LE9 A;  1ABO A;  2V26 A;  2RK2 A;  2MK5 A;  4ME7 A;  1LNX A;  3TEE A;  3E9F A;  3OS2 A;  2PVG B;  1QVP A;  4RMO A;  3GPL A;  5FU6 B;  2EYY A;  3FLG A;  3M53 A;  2JM9 A;  1ZSZ B;  2NUT A;  2OTJ Q;  1K4U S;  2YUN A;  2MF2 A;  3QZ5 B;  2LC4 A;  4M7A G;  2AZS A;  3M4G A;  4HVW A;  4Z89 A;  2HQE A;  3J81 E;  5L8R E;  2AZV A;  2NLU A;  2XID A;  4E7J A;  3HHT B;  2QEX A;  4OMF B;  2OAU A;  5GJV B;  2LCS A;  1WGS A;  5LJ5 g;  2EKO A;  2EAY A;  2OAW A;  4J9G A;  2CDT A;  4M7D F;  2GGR A;  3H0F A;  1NG2 A;  4M77 A;  3OBW A;  1T3S A;  2J6F A;  3BDL A;  2EFI A;  2QQR A;  2IG0 A;  1UEC A;  3QZ9 B;  3OS5 A;  3MPU B;  1VQ5 A;  1B34 B;  1QVF S;  2COY A;  3OS0 A;  1SRM A;  1VQ7 A;  3QXE B;  2DEQ A;  2H8H A;  2YLB A;  1K0S A;  1RI0 A;  1S72 A;  4JS4 A;  4F14 A;  5GAN e;  2EYQ A;  2CH4 W;  2YRC A;  1WHL A;  1WJR A;  2VXE A;  3ZBD A;  1VQP Q;  2FO0 A;  1U3O A;  3JCM g;  4YTL A;  1H92 A;  3TCJ A;  2R58 A;  5D6Y A;  5KYY B;  3I5S A;  3QPH A;  2XG8 D;  3CCV Q;  4XU1 A;  3CCQ A;  1TG0 A;  2JNG A;  3LH0 A;  3EGD B;  3SD4 A;  1FWZ A;  1VQ9 T;  1PSE A;  2YLC A;  3ER0 A;  1QQJ A;  2FPE A;  3JCM b;  4RCB A;  1IGQ A;  2ZZD A;  2KEA A;  4B9W A;  1M3A A;  1W1F A;  1EIF A;  2LCC A;  3CCS Q;  1X6B A;  3CCQ T;  3L2R A;  2RJF A;  4PK4 A;  2QEX T;  2YRV A;  4PJN A;  4QQD A;  2HBP A;  1TWB A;  5IN1 A;  4E7S A;  2DZC A;  2DIL A;  4N0A A;  4RTY A;  3CCS T;  4BI3 A;  5KCO A;  1BCO A;  3REB B;  3UDC A;  3CCE T;  1MV3 A;  1KQ1 A;  2DTO A;  1IZ6 A;  4XTW A;  2DAQ A;  1VQ5 T;  4LXC A;  5GMK l;  3CC2 A;  1JO8 A;  3EG1 A;  4MMK A;  4M7A D;  1PNJ A;  2KBT A;  2ZPE B;  4M75 E;  1VYV A;  1TXQ A;  1OX9 A;  2O2O A;  1RAI B;  1TU0 B;  2P4T A;  5GAM j;  2LQ8 A;  1YJN Q;  4J9F A;  1RAF B;  2FYK A;  4VUB A;  2HZY A;  3H9N A;  4AFS C;  1K8A U;  3I5R A;  2HBW A;  1UGV A;  1W6X A;  1SHG A;  4EMG A;  1UGS B;  3BDU A;  1CKB A;  3REA B;  4C0D C;  1YWP A;  4A4E A;  3J80 E;  3RMS A;  5GAN d;  1TS9 A;  5LJ5 j;  2AT1 B;  2VKN A;  1IGU A;  1YJ9 Q;  1MV0 B;  4QVC A;  1BBZ A;  4JPB W;  1X2K A;  3CC4 Q;  1WLP B;  2O9V A;  2EJF A;  1VQ8 Q;  2W0Z A;  1WHJ A;  2FPF A;  3M9Q A;  1M9S A;  3E2U A;  2V1R A;  2ROL A;  4ANJ A;  3CCR A;  1ABQ A;  4O5V A;  3VV0 A;  5A0L A;  3J7A F;  1VQM A;  1PG5 B;  1M1F A;  5GAO r;  1X75 C;  3C12 A;  3OYA A;  4OF1 A;  1M4Z A;  2Y4X A;  3MHX A;  5LJ3 h;  3RER A;  1WYX A;  1RAH B;  1C0M A;  2VXF A;  4MZM A;  4ZGE B;  4M7A A;  4HCC A;  4OB0 B;  5AT1 B;  1C1A A;  1X6O A;  2G3R A;  2XI9 A;  2L3S A;  1WXT A;  3ZL7 C;  1RAA B;  4L59 A;  1H3H A;  3VUB A;  3QO3 A;  1MMN A;  1X01 A;  2EQU A;  1NLO C;  4M7D E;  4XTX A;  5LJ3 e;  4EMK C;  1K76 A;  4LUE A;  3JCM X;  1QP2 A;  4LUD A;  1JB0 E;  5GMK e;  3CC7 A;  3GNG A;  2X51 A;  1M1K R;  2F2X A;  1W2B S;  1AOJ A;  4M75 A;  3UAT A;  2QA4 Q;  1YHQ Q;  2PTK A;  1VQP T;  3JCM Q;  3OYJ A;  1ZX6 A;  2HEQ A;  2GTO A;  2QQA A;  1K9M C;  3MJX A;  3VJP A;  2RI2 A;  2P0P A;  3S3O A;  1VQL A;  2YSQ A;  4GLK A;  1WX6 A;  1X6G A;  4PJO A;  1OV3 A;  2RPN A;  2VAS A;  2ZPG B;  4DA4 A;  2CKK A;  3S3N A;  4PFZ A;  2M02 A;  2DK3 A;  4EMK B;  1VQ7 Q;  2VB6 A;  3HKS A;  6AT1 B;  3GLX A;  2OX7 A;  1GFC A;  3I56 A;  5GAN 3;  1D0Z A;  3UF4 A;  1M8M A;  1YI2 T;  2QQ9 A;  2EGA A;  2F5T X;  2YDL A;  2KGT A;  3M57 A;  3PFS A;  1Q81 R;  3PIO A;  1TTH B;  4ELY C;  4ORZ A;  2HNI A;  2NUP A;  3NMZ C;  2XD0 A;  1BKB A;  4MDX A;  2CRE A;  4J6W A;  3CPW A;  3CC2 T;  1R0B G;  3L2Q A;  1H3Z A;  3CCM T;  1SSH A;  2CP6 A;  1VIE A;  4OMO A;  2DVJ A;  2MWO A;  1PSF A;  5KE2 A;  3H8Z A;  2E5K A;  1QWE A;  2IIM A;  2DEU A;  4A4G A;  1K1Z A;  1NPR A;  2JS2 A;  3OW2 P;  5FU7 C;  4QQG A;  2KRM A;  4OMN A;  2M51 A;  1UUE A;  3JV3 A;  1N8R U;  2EPD A;  4C92 C;  1CSK A;  3UPU A;  4C5H A;  1PKT A;  5GAN g;  3CCL Q;  5GAN 6;  2MYS A;  4LNP A;  1QLY A;  2ENM A;  1V29 B;  1KFZ A;  1BIB A;  1RAC B;  2XKO C;  2KDS A;  2YHT A;  1WDX A;  1W70 A;  1QKW A;  2DZ9 A;  5DLQ E;  3CC7 T;  1G2B A;  4C8Q C;  2AIR B;  1Z9Z A;  2DKG A;  3UWN A;  1VUB A;  4KRT A;  4M78 F;  1WPY A;  2XDP A;  1QW1 A;  1VA7 A;  2M0Y A;  5FU7 B;  3EG2 A;  1MMG A;  2EJG A;  3JCM W;  4F7U E;  3V8K A;  4M7A F;  5HK0 A;  2E70 A;  4J9E A;  3QKJ A;  4B6M A;  2DBM A;  4JJD A;  5IHI A;  2DVE A;  4BDZ A;  3CBO A;  2DD4 A;  2EBP A;  2C0T A;  1YCS B;  1KHI A;  4OP0 A;  2A37 A;  1N5Z A;  4LDX A;  2BZ8 A;  3U23 A;  2DX1 A;  4E7L A;  1QMC A;  5KYN A;  3CCM A;  1H8K A;  2FG0 A;  3V7S A;  4V2S A;  5KCH A;  5KYW A;  4JDS A;  2PNI A;  3EHQ A;  1GCQ C;  5D6X A;  5KYX A;  2RA2 A;  2E64 A;  4X34 A;  3I9Q A;  3CCJ Q;  3L2V A;  3JCM d;  1WFW A;  2KMT A;  2E5Q A;  4EPC A;  2ED0 A;  2V8I A;  1M90 R;  2P84 A;  3CMA Q;  1WQW A;  4GY5 A;  4CRI A;  2PUO B;  3DKM A;  1CKA A;  1YI2 A;  1KD1 C;  1K8A C;  1NJI R;  1QVG S;  4E2F B;  2JZ2 A;  3GNF B;  3CPW S;  1Q86 C;  1K73 R;  3G7Z A;  3CC4 T;  2LNV A;  3MEW A;  1X43 A;  5GMK j;  1R77 A;  2QXF A;  3G1J A;  4PLI A;  3N5B B;  4IIO A;  2JOY A;  3NTI A;  2YUP A;  2ZPI B;  1KHC A;  2K57 A;  1HJD A;  1XOV A;  1WNL A;  1I8F A;  1AVZ C;  1E7O A;  3EGX B;  2PUK B;  2LQN A;  3PE0 A;  5LJ5 d;  1BI0 A;  2OJ2 A;  2E41 A;  2WSE E;  4JUV A;  4J7F A;  5CKD A;  1E6G A;  1I4K 1;  2RO0 A;  1ZA1 B;  3OYN A;  3GOX A;  1M90 C;  3AT1 B;  2JTE A;  2RF0 A;  2ATC B;  4R56 A;  1AZG B;  4DOW A;  3NHN A;  5J3B A;  5CO7 A;  2K2M A;  3M0S A;  5D6W A;  4BI8 B;  1AD5 A;  1GRI A; 
#chains in the Genus database with same CATH homology
 3JCM V;  3TCJ A;  2EIF A;  2RD1 A;  2R58 A;  5D6Y A;  2DJZ A;  5AYF A;  3QPH A;  2XG8 D;  4J8O A;  4Q5W A;  1YBY A;  3QJ6 A;  4BE2 A;  4FT4 A;  4XU1 A;  3CCQ A;  2JNG A;  3LH0 A;  3QYH B;  5CCA A;  4C8Q F;  3I55 T;  3SD4 A;  4FT2 A;  4BY6 C;  2CGH A;  1YIT A;  1FWZ A;  1VQK T;  1VQ9 T;  3WVE B;  1TH7 A;  4QQ6 A;  1PSE A;  2YLC A;  2D0Q B;  3ER0 A;  4C92 A;  3CEY A;  5DLO A;  3JCM b;  1BI3 A;  4M78 A;  1UGP B;  4RCB A;  3FDR A;  3JB9 D;  2ZZD A;  4C8Q A;  4B9W A;  2RI3 A;  2JTF A;  3RUX A;  1EIF A;  5LL6 S;  2LCC A;  3C4S A;  3SWN B;  3JCM h;  4HKE A;  4BAC A;  3G4S A;  3KXT A;  3CCQ T;  2F69 A;  4J6Y A;  3L2R A;  3ME9 A;  1JBM A;  2P0K A;  4NOY A;  5FLX E;  1KD1 U;  2RJF A;  3JCM c;  4M77 B;  2QEX T;  2YRV A;  4C92 G;  2O4X A;  4M77 G;  2DXU A;  4QQD A;  4XQ3 A;  2HBP A;  2KQW A;  5KE3 A;  1GXI E;  1YIT T;  1VQ8 T;  3INZ A;  5IN1 A;  2DZC A;  4IKF A;  3OW2 A;  4HCZ A;  2F5K A;  2KY9 A;  4N0A A;  1MHN A;  4F7U G;  5C6S A;  1M5Q 1;  3CCR T;  4JRQ A;  2L89 A;  3CCS T;  4BDY A;  4M7D G;  1D3B B;  3Q1J A;  4BI3 A;  5KCO A;  2QA4 A;  5IT9 E;  1YHQ A;  3UDC A;  1IRE B;  2JUF A;  4M78 D;  2QQS A;  3CCE T;  1W4S A;  2D9T A;  3OA6 A;  3SFM A;  3QSU A;  1KQ1 A;  4M75 B;  2DXT A;  4XTU A;  1I81 A;  2DTO A;  4MDW A;  4XTZ A;  4PJO G;  3RKY A;  1IZ6 A;  1UB4 A;  4O6J A;  4M75 G;  4XTW A;  3SWN A;  2DAQ A;  2FB7 A;  3LX7 A;  1VQP A;  2CZ6 B;  5J26 A;  1VQ5 T;  5I2M A;  2DPP B;  2FHD A;  3X28 B;  4DOV A;  4M78 B;  1WQ7 A;  5GMK l;  3CC2 A;  4IUT A;  3P8D A;  3CCE A;  4M77 F;  3S3M A;  5GAN f;  1S72 T;  4MMK A;  1M90 U;  4M7A D;  4M75 C;  2ZPE B;  4M75 E;  1DJ7 B;  4E7I A;  2LQK A;  3X25 B;  5GAN 5;  5GAO n;  2GQV A;  3RKX A;  2P4T A;  1MGQ A;  2LQ8 A;  1UGQ B;  4QW2 A;  1WJS A;  1RL2 A;  2VGN A;  5GAM j;  1VQ8 A;  4ZN3 A;  1LOJ A;  3CD6 T;  2FYK A;  4VUB A;  4Z02 A;  1K8A U;  3HP9 A;  2RB6 A;  4IUV A;  4LD6 A;  3EFR A;  2M1H A;  1UGS B;  4EMG A;  3BDU A;  3DB4 A;  5GAN 8;  3CCL T;  2VV5 A;  4C0D C;  2DD5 A;  3OYL A;  3E1S A;  1ZHI A;  4C5I A;  1VQN A;  4EDU A;  4A4E A;  2K5L A;  3J80 E;  4M77 C;  3RMS A;  1N9R A;  2XIC A;  3X24 B;  5GAN d;  4L5G A;  3EAE A;  2L8D A;  5LJ5 j;  2K3X A;  5DM7 R;  3JCM P;  4JRP A;  2P0Q A;  2BKD N;  2GCX A;  1M1K C;  4II1 A;  1UEB A;  1Q81 U;  2XDB A;  1YJN T;  3OQ5 A;  4F7U A;  2ZPB B;  4QVC A;  1Y96 A;  1WJQ A;  5FRO A;  2M0O A;  5C0M A;  3VKI A;  5LJ5 e;  5M9O A;  1HXD A;  3RMQ A;  3OB9 A;  1N27 A;  2EJF A;  3M5A A;  1NPP A;  3PNW C;  5LJ3 d;  4ZTF A;  2E12 A;  4C5E A;  3M9Q A;  1M9S A;  2BIV A;  4HA8 A;  4J6X A;  5A2Q E;  3GIB A;  4LDV A;  4J7I A;  2Y4Y A;  4TVR A;  3CCR A;  2RI5 A;  4O5V A;  2JTM A;  3UT1 A;  2QI2 A;  3VV0 A;  5A0L A;  5GAN 7;  4LDW A;  3CME T;  3HSB A;  3J7A F;  1VQM A;  1M1F A;  2XDD A;  3M59 A;  5GAO r;  1X75 C;  2EWN A;  4MZP A;  1Y96 B;  4OB3 B;  1FXX A;  3C12 A;  3WVD B;  3OYA A;  2HQX A;  2MMP A;  3LWH A;  4OF1 A;  1K73 C;  3M56 A;  4C92 B;  4HT8 A;  4C8Q E;  1M4Z A;  2Y4X A;  3JSC A;  5CKB A;  4HCB A;  3MHX A;  2QTX A;  2D6F A;  5LJ3 h;  3RER A;  2C06 A;  1VQK A;  2E6N A;  4MZM A;  2VXF A;  4ZGE B;  2Y90 A;  3CCU A;  1NJI U;  2M9U A;  3FIF A;  4M78 C;  4M7A A;  4HCC A;  4OB0 B;  3VYH B;  1ZBX A;  5CKE A;  4JS5 A;  2OTJ T;  4BE0 A;  1YJN A;  3OSS C;  4KUI A;  4ZGD B;  3CPF A;  3L42 A;  1KC8 U;  1X6O A;  5GAM d;  2G3R A;  2XI9 A;  5EG2 A;  4C0G A;  4PL6 A;  4M75 F;  3KUF A;  2LDM A;  4L59 A;  3L1A A;  4JJN K;  3HPW A;  4Y28 E;  2ZCF B;  3VUB A;  2PVO B;  3M4Y A;  4ZTJ A;  2RHY A;  2KSS A;  1X01 A;  3QO3 A;  4OVA A;  2LT1 A;  4Y91 A;  2EQU A;  1N8R C;  2X4Y A;  4XTX A;  4M7D E;  2EQJ A;  4N4I A;  5LJ3 e;  3C94 A;  2CZ0 B;  2DTI A;  4EMK C;  3G71 T;  4J83 A;  1QVG A;  3CCJ T;  2RJC A;  2OTJ A;  3C95 A;  1QP2 A;  3JCM X;  1KG1 A;  1XNI A;  5LJ3 f;  3LGF A;  1JB0 E;  2GFA A;  5GMK e;  2ZPH B;  3CC7 A;  4ATO A;  3JRZ A;  3GNG A;  4N4G A;  4RG2 A;  1NZ9 A;  3BW1 A;  3TRE A;  1Q81 C;  3SWN C;  4M77 E;  2RM4 A;  4DQ2 A;  4FM4 B;  4C0F A;  1W2B S;  3NTH A;  2LVM A;  4M75 A;  3R6O A;  2GFU A;  4N4H A;  3QII A;  3E9G A;  4QVZ A;  3TU4 K;  3KBG A;  4KBM B;  3PIP A;  1VQ4 T;  1BI2 A;  3HL8 A;  4C0Z A;  4OB2 B;  3OYF A;  3JCM Q;  1QP3 A;  2EQK A;  3L2Z A;  4OGE A;  3OYJ A;  2DTH A;  4BY6 B;  1Y71 A;  3OYM A;  5CAI A;  3VUZ A;  2QQA A;  1I5L A;  2EQM A;  3QJY A;  1VQO A;  1K9M C;  3VJP A;  1Q86 U;  3ASK A;  2A7Y A;  2RI2 A;  2JN0 A;  2P0P A;  2VC8 A;  3OYE A;  3OYD A;  1YJ9 T;  1KQ2 A;  2L3R A;  3S3O A;  1VQL A;  3CMA A;  1YIJ T;  5DY9 A;  4GLK A;  1N9S A;  1FX7 A;  3NFC A;  4M7A B;  4A54 A;  3A8H B;  4PJO A;  1VQO T;  2QDY B;  2ZPG B;  1UGR B;  4MZT A;  5GAO m;  2I2L A;  4DA4 A;  2CKK A;  2WSF E;  5GMK m;  3CCU T;  3S3N A;  5GAM g;  2PVD B;  4R55 A;  2DK3 A;  4EMK B;  1W2B A;  4M7D B;  5GAO p;  3JB9 I;  2JVV A;  3HKS A;  3WXM B;  4F7U B;  2LRQ A;  3DB3 A;  2RHX A;  5HY6 A;  4M75 D;  3OW2 S;  2A3L A;  3GLX A;  2V8K A;  4JRI A;  4FL6 A;  3JCM e;  4RCC A;  1JJ2 S;  1HK9 A;  5GMK h;  1VQ9 A;  2M16 A;  1Q82 C;  3A8L B;  4NL2 A;  3RIR A;  2QQB A;  1YJW T;  2GF7 A;  3H6Z A;  1K73 U;  3I56 A;  2XHC A;  1VQN T;  1Y7X A;  3HFN A;  4QVD A;  5GAN 3;  5CKH A;  4PJO B;  1G3W A;  3LGL A;  3JCM f;  4C92 E;  5GAN h;  2QQ9 A;  4BD3 A;  2F5T X;  1YI2 T;  1VQ4 A;  2XK0 A;  4IUQ A;  4F7U F;  1NJI C;  2O4X B;  4A53 A;  3BFM A;  5FRM A;  2KK4 A;  3M57 A;  3PFS A;  5GAN 4;  4C92 F;  2V8J A;  3CC4 A;  4RKU E;  4XK8 E;  3PIO A;  3EFS A;  3QG1 A;  3FEO A;  4X9C A;  3QYG B;  3X26 B;  4ELY C;  3G6E A;  1M1K U;  1Y07 A;  2HNI A;  4M78 E;  1U1T A;  5HKC A;  2XD0 A;  3DLM A;  3M58 A;  4E47 A;  1OZ2 A;  4UC4 A;  1BKB A;  2AHJ B;  4MDX A;  3OMC A;  3MP1 A;  3L2U A;  4RG8 A;  4J6W A;  3OYH A;  2K5F A;  3CPW A;  2RHZ A;  3JCM J;  3OMG A;  3CC2 T;  2LTO A;  3LW5 E;  5CVI A;  2VYT A;  2O01 E;  3L2Q A;  5GMK i;  3CBM A;  1H3Z A;  1P92 A;  2ZGW A;  2RHU A;  3CCM T;  2KVQ G;  4NS5 A;  1VIE A;  1KC8 C;  2VUB A;  5GAO q;  2OTL T;  5GAO l;  3HFO A;  4XAX B;  2MWO A;  1SSF A;  2PU9 B;  3QHS A;  4PJO F;  1PSF A;  1M1G A;  3OYI A;  5KE2 A;  2RH2 A;  3H8Z A;  1YJW A;  3FC3 A;  3CBP A;  3RES A;  2DIG A;  2LX9 A;  3MEA A;  4NL3 A;  3CCL A;  3PMT A;  1YJ9 A;  2DXC A;  3V8J A;  1YIJ A;  3A8O B;  3LWI A;  3CMA T;  3JB9 H;  5LJ3 g;  1Q7Y U;  4A4G A;  1NPR A;  3JB9 G;  2CZ1 B;  1JRI A;  3HRT A;  4IUP A;  2RJD A;  4LD9 K;  3AHU A;  4JLI A;  5FU7 C;  5FU6 C;  4QQG A;  4PKC C;  4PJO D;  1QVF A;  4D6W A;  5IAY A;  1VQP T;  3QUI A;  1N8R U;  3M55 A;  4X9D A;  4C92 C;  1K9M U;  1BI1 A;  5I21 A;  2H3J A;  1O75 A;  3OS1 A;  4EMK A;  1B34 A;  3UPU A;  3CCS A;  3HRS A;  4C5H A;  1XQH A;  3T9N A;  2PQW A;  3HRU A;  5GAN g;  5GAN 6;  1U1S A;  2LCL A;  3QBY A;  2RJE A;  4PNO A;  4LDU A;  5CK9 A;  1KQS A;  5J39 A;  2EJ9 A;  3OSV A;  3PMI A;  4IUU A;  3F70 A;  3X20 B;  1D3B A;  1NE8 A;  1AHJ B;  3CCJ A;  2RK1 A;  1V29 B;  1BIB A;  2XKO C;  4XU0 A;  4C5G A;  3GF5 A;  1Q82 U;  2KDS A;  1OYX A;  2YHT A;  4OB1 B;  3FB9 A;  1OI1 A;  5CIU A;  2B8A A;  2DZ9 A;  3SDZ A;  3I56 T;  5DLQ E;  5GAM f;  5I2S A;  3G6E T;  3CC7 T;  1G5V A;  2WAC A;  1ZQ1 A;  2MAM A;  2X35 A;  4C8Q C;  4P5N A;  2DIQ A;  1M8V A;  2DKG A;  3UWN A;  1VUB A;  4N0A C;  3O8V A;  4M78 F;  3FJP A;  3CCV A;  2X4W A;  1WPY A;  2XDP A;  4IUR A;  4MML A;  3G71 A;  1QW1 A;  5FU7 B;  2R57 A;  2HAX A;  4C8Q G;  2E1H A;  5LJ5 h;  4E7J A;  3CD6 A;  2KAF A;  2EJG A;  3I55 A;  4ELZ C;  4BUG A;  3V8K A;  4C8Q B;  4F7U E;  5HK0 A;  3JCM W;  4M78 G;  2E70 A;  3LLR A;  3QKJ A;  4M77 D;  4M7A F;  4FU6 A;  3ZEH A;  1G3T A;  3A8M B;  5KH6 A;  3GP8 A;  2FVU A;  2IVW A;  2X4J A;  2DVE A;  2K2V A;  4KT0 E;  4KUL A;  4C0D B;  4BDZ A;  3CBO A;  2DD4 A;  4BB7 A;  3NTK A;  1VQ6 T;  1KHI A;  3PGG A;  4OP0 A;  5CKF A;  4OGC A;  4J5Y A;  1LJO A;  4LDX A;  1XTD A;  1U8R A;  2OTL A;  4E7L A;  4E7H A;  4FIB A;  5GAM h;  3CXC A;  3CCM A;  2RK2 A;  3MO8 A;  3V7S A;  2K4Y A;  4V2S A;  5KCH A;  4ME7 A;  3V7C A;  1LNX A;  2L5Q A;  3OYG A;  1VQL T;  4JDS A;  4JRK A;  2VGM A;  3LYI A;  3L2W A;  1QVG S;  4M7A E;  2CS7 A;  3TEE A;  3E9F A;  4BI4 A;  2PVG B;  3OS2 A;  2QA4 T;  1OZ3 A;  5D6X A;  1QVP A;  4ZN1 A;  2DXB A;  1YHQ T;  4RMO A;  4HT9 A;  2RA2 A;  2E64 A;  4X34 A;  5LJ5 f;  1Q7Y C;  2HD0 A;  3GPL A;  3CME A;  3L2V A;  5FU6 B;  3JCM d;  3E19 A;  4A4F A;  2KMT A;  3FLG A;  1H64 1;  2E5Q A;  3M53 A;  3P8B B;  4XU3 A;  4EPC A;  2XU8 A;  2CYZ B;  2V8I A;  3QDR B;  1VQ6 A;  4E7K A;  3JB9 F;  5CQX A;  3BY7 A;  2K5I A;  3ZFJ A;  1WQW A;  4PJO C;  4GY5 A;  4CRI A;  2PUO B;  4M7D A;  3DKM A;  1YI2 A;  4A4H A;  1KD1 C;  5GAM e;  1K8A C;  2MF2 A;  2X4X A;  4L6V 5;  2RHI A;  4C92 D;  3OYK A;  3QZ5 B;  1YCY A;  2LC4 A;  2JZ2 A;  3GNF B;  5A0D A;  3JAM E;  3CPW S;  1Q86 C;  3M4G A;  4M7A G;  3G7Z A;  2R5M A;  2HQE A;  3J81 E;  3CC4 T;  2LNV A;  3MET A;  5L8R E;  4A4K A;  2NLU A;  3MEW A;  4C8Q D;  5GAN 2;  3OYY A;  3MP6 A;  2E10 A;  2XID A;  5GMK j;  3MEV A;  3HHT B;  3OYB A;  2LT4 A;  2QXF A;  3RKW A;  2QEX A;  4OMF B;  3N5B B;  4PLI A;  5CQY A;  2OAU A;  3OBY A;  4JLG A;  2JOY A;  3VYG A;  3NTI A;  3CCV T;  3OY9 A;  1WGS A;  1BYM A;  5LJ5 g;  2EKO A;  2EAY A;  2ZPI B;  1KHC A;  1JJ2 A;  3DLL A;  4CI0 C;  3G4S T;  1G3S A;  2K57 A;  1XOV A;  2E6Z A;  1I8F A;  1WNL A;  1G3Y A;  1KQS S;  4KUD K;  4M7D F;  2R5A A;  2PUK B;  5HK3 A;  3P8H A;  4WF2 A;  2BUD A;  4ZGJ B;  5LJ5 d;  4BE1 A;  4M77 A;  1BI0 A;  3OBW A;  3PT9 A;  3BDL A;  3URG A;  2MWP A;  2EFI A;  2E41 A;  2QQR A;  1BIA A;  3MCA B;  4XU2 A;  4M7D D;  2IG0 A;  2DO3 A;  2WSE E;  3OS5 A;  2ZPF B;  3QZ9 B;  3V8L A;  5LJ3 j;  3MP8 A;  3V7R A;  2MI6 A;  4JUV A;  3JB9 J;  1VQ5 A;  1B34 B;  4J7F A;  4LDY A;  5CKD A;  3OS0 A;  1QVF S;  2FL7 A;  1I4K 1;  2RO0 A;  3QXE B;  3OYN A;  3S6W A;  3GOX A;  1VQ7 A;  2DEQ A;  2E65 A;  2YLB A;  4FSX A;  1O9S A;  3CXC S;  1M90 C;  1VIF A;  4EMH A;  1RI0 A;  1S72 A;  4XTY A;  4XTV A;  2WSC E;  4JS4 A;  3VU3 C;  5FRN A;  5CR2 A;  3FRN A;  5GAN e;  2EYQ A;  3M54 A;  2K3Y A;  3SB2 A;  2CZ7 B;  4R56 A;  3OYC A;  1VQM T;  4DOW A;  1VQ7 T;  4M7D C;  3PTA A;  3A8G B;  3A5Z B;  1WJR A;  1N6A A;  2VXE A;  5CO7 A;  5J3B A;  3ZBD A;  4PJO E;  4PLL A;  5A0G A;  5D6W A;  4BI8 B;  5GAN j;  1R8O B;  4M7A C;  4B9X A;  3JCM g;  4YTL A;  3MEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...