5GMKj

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
69
Chain Sequence
b'VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 9
structure length 69
sequence length 75
chains with identical sequence x
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkj00
3RESA 3AHUA 4RCCA 5GANh 4PJOG 4M7AC 5GAOl 4PJOB 2E1HA 4JRKA 5LJ5f 1BIBA 4V2SA 5GAOr 5LJ3j 5GAMg 4RCBA 3RIRA 3QHSA 1B34A 2EAYA 3QO3A 4A54A 2E65A 5GMKh 4EMKC 5GAOp 1HXDA 3HSBA 2RA2A 1LNXA 3SWNC 3HFNA 4OP0A 4M7DG 4J5YA 3BFMA 4M78G 1TH7A 3PGGA 4C92A 4M7AB 4M77C 5GMKm 2VC8A 4XTVA 3V8KA 4X9DA 5LJ5e 2JN0A 4M75G 4WF2A 3JCMg 2E41A 4XU0A 4F7UF 3RKWA 1U1SA 3V7RA 4M77D 5GANe 4C8QF 5I21A 4J6YA 4PJOC 4M77F 1D3BA 2RM4A 1N9RA 5GAMf 4NL2A 4JLIA 5GMKi 2DKGA 1N9SA 4PJOD 5LJ5h 5GAN2 4HT8A 2DEQA 2K57A 3JCMc 2DTOA 4XU3A 2DZCA 4NOYA 2CGHA 2RB6A 3JB9G 5LJ3g 1JBMA 1HK9A 1M5Q1 3HFOA 4QVDA 4M75C 3JCMf 3QUIA 4C92G 4DQ2A 5GAMd 3BW1A 3M4GA 1WPYA 4F7UE 2YHTA 4M75D 4M7AF 3GIBA 4XTUA 4C8QE 4M7DB 1Y96B 3BY7A 3FIFA 4M78B 2EJGA 2EJFA 2FB7A 4M77E 1KQ1A 1D3BB 4X9CA 5GANg 3JCMd 3JCMP 4M75B 3FJPA 4PNOA 4JRIA 3BDUA 4MMLA 5GAN5 5GAOm 5GANj 2DTIA 4XTYA 4PJOE 4HT9A 5LJ3f 3FB9A 3JCMV 5GAN6 1LJOA 5GMKl 1I81A 2FYKA 4XU1A 4C92C 4F7UA 1MGQA 3SWNA 3JB9D 4EMGA 5GMKj 4MMKA 3SB2A 4XTWA 4C8QA 3JCMQ 5GAN8 1X01A 1WQWA 1YCYA 4M77A 4C92D 4PJOF 3V7CA 4N0AA 1B34B 3L1AA 1LOJA 4M7DC 5LJ3d 4M7AE 4M78C 1I5LA 4HA8A 1M8VA 2VXEA 1WQ7A 3QSUA 4NL3A 4PJOA 5GAMe 4M7AD 4C92B 4M7DD 4M78D 2EJ9A 2DVEA 4M7DF 4M78F 5LJ5g 2VXFA 3JCMJ 2DJZA 1WNLA 4M75F 3JB9H 5LJ5j 2ZGWA 3EFSA 4J6WA 4XTXA 3RKXA 4F7UG 2E10A 4F7UB 3JCMe 3VU3C 5GAN3 2QTXA 2E64A 4XQ3A 5GAMh 3JB9J 1KQ2A 4Y91A 4C8QG 3JB9I 4XTZA 1I4K1 2DXUA 3RKYA 4EMKA 4M7AA 3V8JA 3JCMb 3JCMW 2HNIA 3RUXA 3JCMh 3JB9F 4M7DE 3V7SA 4M78E 5LJ3e 2EWNA 2DZ9A 3INZA 4C92F 3JCMX 3EFRA 4M75E 4QVCA 5GAMj 5GANf 2RD1A 4C8QC 2I2LA 2DXTA 5GAN4 4M7AG 4J6XA 4JUVA 1U1TA 5CAIA 1JRIA 2YLCA 4N0AC 5LJ5d 4A53A 2YLBA 4C8QD 1BIAA 5LJ3h 3RERA 2Y90A 3L2ZA 5GANd 4EMKB 4M7DA 1Y96A 4M78A 4XU2A 4EMHA 3SWNB 4C8QB 4M75A 5GAOq 1H641 4M77G 4M77B 5GMKe 5GAN7 5DY9A 1I8FA 3V8LA 4C92E 2DTHA 5GAOn
chains in the Genus database with same CATH superfamily
2WACA 4C5IA 3CEYA 2LT4A 4VUBA 1Q86R 3X28B 4PFPA 4A54A 1TUGB 4AG2C 2BTTA 3SWNC 3GP8A 1FYNA 1WHJA 4KULA 2DBKA 3V8KA 1YJWA 2QQBA 3CQTA 3VYGA 1IGQA 1U1SA 3OBWA 1C0MA 4M77D 3TEEA 1UG1A 4PJOC 1N9RA 3A98A 5CCAA 2RI5A 4CC3A 1VUBA 3EGXB 1VQ5T 4FYXB 5LJ3g 1JBMA 2DD4A 1HK9A 4C5HA 3I9QA 3M57A 2DPPB 1Q7YU 4LXCA 1UEBA 1QKXA 3OY9A 1YIJA 2O9VA 2L3RA 1G3WA 2KQWA 3EG9B 3TREA 1PC0A 3FB9A 3KBGA 2HCKA 2M0YA 4A4GA 2B8AA 2CSQA 2VWFA 3SB2A 5GMKj 1PRMC 2QGGA 2DX1A 2A0FB 5FU7C 4M7DC 2LT1A 5GJVB 2HBPA 2YRVA 2EGEA 1HYOA 3OYLA 1V76A 5CK9A 2DJZA 5D7UA 2LX7A 2DYBA 4C0GA 1M27C 1OOTA 2DYIA 3JSCA 3I55Q 2H8HA 2OTLA 1YHQT 2RQVA 3JAME 4XTZA 3NTKA 1AZGB 3JCMW 3I56Q 1KC8U 4M78E 4FL6A 2DF6A 8ATCB 3M58A 3QJ6A 1NBEB 2F5KA 3NGPA 4ZNXA 4IUUA 2GCXA 2AKLA 3X24B 3MEWA 5GAN7 1K9MU 2EQMA 3CMEQ 5DY9A 1I8FA 3HTRA 2P4RA 1EFNA 1VQOA 3LH5A 2LMJA 3CCQQ 5GAMg 3G71A 5GMKh 2X3XD 1I1JA 5CQXA 3ME9A 3MPUB 2YRDA 4C92A 3GLXA 2LCLA 3CCET 5LJ5e 4X9DA 5KYNA 5D6YA 4II1A 4ZGDB 2SRCA 1NLOC 3CCLT 2V8KA 4E7SA 3M0TA 2AIRB 2DILA 2IVWA 2DLPA 2A08A 1S1NA 5KE2A 2DTOA 1NM7A 4D8KA 1UGRB 1M5Q1 1VQ6Q 4M75C 2D0NA 3CCJT 1UJYA 3ZL7C 3GIBA 1JB0E 2EKOA 3CCRT 2EJFA 1Y7XA 4A63B 3EFOA 1VQMA 2PQWA 5GAN6 4BY6B 2HD0A 1FX7A 3CMAT 3SWNA 4EMGA 3PFSA 3G6EA 5I22A 3OYAA 1D1BA 3UDCA 4M78C 4HA8A 1H92A 1X2KA 4PJOA 1YJWQ 2ESWA 3VS4A 1WHHA 4KH1B 1UHFA 4F7UG 3HPWA 5IAYA 4MZPA 4E7IA 2RPNA 2EPDA 1SHGA 3EHRA 3EH1A 3VUBA 3OYIA 1Q81U 4K11A 2DE0X 2OAUA 1FMWA 4LDYA 4DBFA 5KCHA 2O2OA 1YIJQ 1BCOA 2HKQB 2JVVA 3QYGB 1U1TA 5CAIA 2YLCA 1WXBA 2O31A 4JJBA 2V1RA 1ZX6A 1T0JA 1H3HA 4M7DA 1PCXA 2EQKA 4EIKA 1NYGA 2EQJA 5GAOl 4J8OA 3RMQA 1X69A 1VQLT 1B34A 1WJSA 3UPUA 4FU6A 1JO8A 4AFSC 1KSWA 2LNVA 1TH7A 1Y07A 2OTLQ 2PZ1A 2E70A 4RMOA 1ACMB 1IB8A 4XU0A 2XK0A 4JZ3A 5I21A 4KGZB 1K8AR 4OMPA 2RM4A 1YWOA 3JRZA 2ENMA 5KYWB 3CC2T 1BCMA 4KBMB 2RB6A 2D0QB 3GOXA 3MJXA 3KXTA 3CXCA 2KT8A 4E2FB 4RTZA 4EDUA 1QCFA 5FRMA 1Y96B 2OX7A 1R0CB 3BY7A 3VS3A 2GFAA 2HKNA 2JUFA 1TTHB 1IO6A 1U06A 4RG2A 1Q95G 2KGTA 2JTFA 3L2UA 1VQOQ 3HHTB 4E47A 5KYYA 3SDZA 3G71Q 4C0FA 3OB9A 3GPLA 1NG2A 2EYZA 4FIBA 1D1AA 3PT9A 2QYZA 6AT1B 1GFDA 3VU3C 3CC7A 2D6FA 2E64A 2ROLA 3JB9I 2L3SA 1M9SA 1VQ9Q 4EPCA 1JXMA 2MMPA 1NJIC 4DEXA 2O88A 2VB6A 4CRIA 3MP1A 2LRQA 4C8QC 1LVKA 4M7AG 2L3PA 3EG1A 2GBQA 2QEXT 4CC7A 1JJ2S 2A3LA 3NFCA 3L2ZA 4BI8B 4M78A 3OYMA 1BI0A 2B86A 3OYJA 1H641 1YJWT 4M77B 2GQVA 3G6EQ 1OX9A 2DJQA 2QDYB 1CSKA 4RCCA 3VYHB 1Q86C 5IH2A 1PD1A 4DOWA 4ATOA 3FLGA 3RIRA 2EAYA 2YXYA 1ZBJA 1PG5B 3OW2A 1UECA 2R5AA 3GNGA 1TUCA 5CVIA 3CD6A 4IIMA 2LJ1A 2QQSA 4IUQA 4NOYA 3JB9G 1VQ8T 2F2WA 1YJ9A 2DL5A 2RQTA 5DM7R 2CP0A 2YHTA 1R0BG 3CXCS 3CC4A 1VQNT 3M0PA 2EGAA 2RHYA 3EG3A 1ZA1B 4AT1B 2X4YA 4MMLA 4IURA 1NEGA 1QW1A 2K2VA 5CO7A 2K3BA 2FZCB 2K4YA 4PJOF 1M3AA 4NS5A 4ESRA 2DA9A 3JV3A 5CKBA 1WQ7A 3S3NA 2KAFA 2F2XA 4QT7A 5HCKA 1MMDA 5LJ5g 2DAQA 1NYFA 4BE0A 3T9NA 2O9SA 3EG2A 3EH2A 1ZSZA 4YTLA 1KD1U 1PM3A 3L2VA 4C0DC 4J9BA 4LDUA 5GANf 1K73U 3E9FA 5CKDA 1UDLA 1UGSB 2DXTA 2X4WA 1VOMA 4O5VA 2ZZDA 4DBHA 4B6MA 4O6JA 5LJ3h 4E7JA 4JJDA 3DLLA 3M53A 5A0LA 5EC7A 2JS2A 3PIOA 2FRYA 5EG2A 2DL8A 1MV0B 4DA4A 1WYXA 4OMLA 2ECZA 4V2SA 3HL8A 2E65A 1X6GA 1OU8A 1SSHA 5KH6A 3DLMA 2C0IA 2M16A 3CC7Q 4OMMA 1FMKA 1M1GA 2E41A 3I35A 3OW2S 2F1LA 3CBMA 2NUTB 1CKAA 4PLIA 2QA4A 1B7TA 1WI7A 2HMAA 2K57A 1VQMT 2VASA 2O01E 1PWTA 4PFZA 2D8HA 2BKDN 1H3ZA 5KYUB 2M1HA 1AVZC 3M4GA 4BY6C 4RTXA 2MYSA 3VKIA 1I0CA 1WFWA 4KT0E 4RTWA 5FWCA 1O9SA 3JCMP 4E7KA 2MAMA 3FJPA 2V8JA 3UA7A 3UT1A 5GAOm 3G1JA 2K5FA 5IHKA 1PSFA 5LJ3f 4JS5A 3PVLA 2PVDB 1TWBA 1AD5A 1KC8R 3URGA 3VRYA 1QMCA 2QASA 2DXCA 3H41A 4PJMA 3QSUA 2KRMA 4IIOA 1IXDA 2JM9A 1PHTA 2CT3A 1S72A 4M75F 3CD6Q 1R8OB 3JCMe 2XDBA 4QW2A 4E7HA 3H6ZA 4XQ3A 5GAMh 2DXBA 1GBQA 1X6OA 4EMKA 1IZ6A 2V8IA 1W4SA 1YJ9Q 4J9EA 2K79A 3JCMX 3J81E 3CC4Q 2COWA 4Y92A 4HCBA 2YUOA 2VKNA 4A53A 4C5GA 1G83A 3R6NA 1YP5A 4IUPA 3RMSA 3VJPA 4RTVA 2WSCE 1Q82R 4LNPA 3QHSA 1K73C 3KUFA 4ELYC 1X2QA 2DO3A 4M7AB 4XTVA 4FM4B 1PRLC 2K5IA 2KBTA 2RNAA 1QVFS 3O8VA 2E12A 1BI2A 4AFQC 1D3BA 1VQ7A 5GAMf 4JRQA 2CS7A 4PJOD 3PE0A 2RHIA 2COYA 2AZSA 2VV5A 3EHQA 4KRTA 4C92G 2EYYA 3OMCA 2QG9B 4LDVA 2JOYA 4JJNK 2YUPA 2QGFB 2VYTA 1OZ2A 2RH2A 5FWBA 2FB7A 4JRIA 5GAN5 1M2VB 1ARKA 1E7OA 2L3QA 2JM8A 5J26A 3CCVT 5DLQE 4MMKA 4OMQA 4F17A 5KYXB 3VS2A 3ZFJA 4M7DD 2FRWA 2X51A 3QDFA 3GF5A 1M90R 1X75C 4XTXA 4L5GA 2QA4Q 3OYCA 5IT9E 3CCUT 2GF7A 3J80E 4BUGA 1MNDA 1N8RU 2GNCA 4CI0C 3LX7A 1BU1A 2C0TA 2ED1A 4M75E 2X4JA 1RABB 2MK5A 2HDAA 4IUVA 5GAN4 1W2BP 2GQIA 1AZEA 1JEGA 2J7IA 1GXIE 1BIAA 2JT4A 1OYXA 5GANd 4EMKB 5A2QE 4EMHA 1WHGA 2YSQA 3OS0A 2PVOB 4M77G 2AT1B 2L8DA 4M4ZA 1T3LA 5KCOA 2V1QA 4L59A 4FW1A 2LCSA 1VQPT 1SEMA 2RJFA 1BIBA 5GAOr 1M1KR 1W70A 1IHVA 1QVGS 3VS6A 2VVKA 2AKKA 1S72Q 2RA2A 4LD6A 4M7DG 2A37A 3PGGA 2M51A 3UF4A 1V1CA 4C8QF 2R5MA 3CC4T 3AT1B 2BIVA 1VQKA 1QWFA 4PJNA 2BUDA 2FVUA 3M0RA 3N5BB 3MHXA 1MMGA 4JJCA 1EX4A 2WSEE 2AK5A 2P0QA 4E7ZA 4M75D 9ATCB 4PLLA 1D3BB 2QI2A 4OMFB 1VQ4A 2WSFE 4XTYA 4PL6A 5IHNA 1RI9A 1NPPA 3LGFA 5GMKl 4Z89A 1HD3A 2DIQA 1JU5C 4OB1B 5LJ3d 2F2VA 3OYHA 2KR3A 1UGQB 2L2PA 1VQ9A 4BI3A 4M78D 2EBPA 3SEMA 5J3BA 1TSFA 3E9GA 4KH0B 1WNLA 2QQ9A 3JB9H 1AEYA 5LJ5j 3RKXA 1VQ7Q 3LWHA 2JW4A 1C6VX 1I07A 3RKYA 3MEVA 5A0DA 1K76A 3V8JA 2DVJA 2HNIA 4IKFA 1AWWA 1NJIU 1SG5A 3GBQA 1WGSA 2RQRA 3HRTA 4Z88A 2RD1A 3OYBA 1PNJA 4N0AC 2MCNA 1FWZA 3MEUA 2PVGB 4PJLA 4P5NA 2M9UA 2RJCA 4UC4A 3S6WA 2FPEA 1RACB 3V8LA 5IXBA 2RJEA 1N8RC 3P8HA 3AHUA 2CUBA 1UGVA 1Q86U 4QKUA 1RAHB 1YI2A 2HAXA 4DOVA 3EGDA 1Z9ZA 4M78G 4CC2A 2RK2A 2KRSA 2JN0A 4TVRA 4WF2A 3JCMg 2F69A 2FO0A 1OI1A 3OYEA 4JLIA 1W2BA 5LJ5h 4J7IA 3JCMc 2CGHA 3TCJA 2E5QA 3NTIA 3I55T 2KEAA 2AHJB 3SD4A 5IHIA 5GAMd 3BW1A 2G6FX 3M56A 2BZXA 3PMIA 4C8QE 2KSSA 2CZ6B 4OB2B 2Y4YA 2ZPFB 4X9CA 3I56T 1RLQC 4PNOA 1H8KA 4R56A 1KJWA 2EYXA 3F70A 5CQYA 2FYKA 2YT6A 2H3JA 2RK1A 4OGEA 1PKSA 3L1AA 2NLUA 5CKHA 4C92B 1F1BB 4IUTA 3CMET 3PMTA 3JCMJ 2DL3A 2ZGWA 3E19A 2XDDA 5LL6S 1N6AA 2QTXA 3CCQT 1EIFA 1VQKQ 4KUIA 4MZMA 2DNUA 4HCZA 1KHIA 2DRMA 4AFUC 1X43A 2FPDA 3L42A 7AT1B 2HSEB 2E4HA 3OS1A 3V7SA 1QP3A 1EZZB 3EFRA 1OU9A 1VQ4Q 3EFOB 4C8QD 1SHFA 3REAB 2PNIA 1GCQC 2Y90A 2GGRA 2CP6A 1VQ6T 3SWNB 4M75A 2Z0WA 1WJRA 1A0NB 2HL3A 3VRZA 2DTHA 4M7AC 1Q82C 2CP5A 4PJOB 1OPLA 4XAXB 1VQ7T 4JRKA 1GFCA 3TVTA 3M0QA 2BE9B 4N4HA 3S3OA 1LNXA 4J5YA 5AT1B 2EGCA 3QWYA 4D8DA 1VQ5A 5L8RE 1G3TA 4A4FA 2ZPEB 2DK3A 1N9SA 1OPKA 3E1SA 2DEQA 1BI3A 3M55A 2O4XA 2LVMA 2E6ZA 1WLPB 1WPYA 3WVDB 2ZAEA 5FU7B 3LYIA 4M7DB 1WA7A 3FIFA 5CR2A 4FYYB 2IPOB 1YIJT 3WXMB 2LP5A 3VS5A 1MGQA 1KIKA 2DM1A 2MF2A 4XTWA 2CZ0B 1MNEA 2XKOC 3V7CA 1YI2Q 1B34B 1G3YA 1D0YA 5A0GA 2V26A 5FW9A 2G3RA 1D0ZA 2DVEA 1M90C 4A4EA 1PD0A 4BE2A 2L89A 4AFZC 2X35A 2QQRA 5CKFA 2L0AA 2IIMA 4E6RA 1UTIA 3X20B 2RQWA 2C06A 3UATA 2COZA 2J6FA 2RI2A 2OTLT 3E2UA 1UJ0A 4D6WA 2PTKA 2DZ9A 4ZTFA 1NE8A 3DKMA 2K6DA 2QTVA 3M0UA 2EFIA 3QZ9B 4DEYA 2GTOA 5ECAA 3RERA 1QLYA 2ROTA 3FDRA 5KYYB 5GAOq 4C5EA 5M9OA 4B9XA 3M59A 1ZUUA 3MO8A 1W6XA 3VS1A 4J9IA 4QQGA 1M1KC 2HL5C 3CCEA 1SRMA 1VQKT 4RCBA 1M1FA 3CCLA 5GAOp 1VQOT 1ABQA 3G71T 3RKWA 1YITA 1K8AU 5D6XA 1M2OA 4M77F 3RBBB 4Z8AA 4OB0B 2J6KA 2KYBA 4JZ4A 1JXOA 3BDLA 3ER0A 4XU3A 4LDXA 3HP9A 1ZBXA 1GCQA 2BZYA 4QVDA 1LCKA 1SPKA 3QXEB 1ZUYA 3CCRA 2I0NA 4DQ2A 3D7SB 2D8JA 2KY9A 2RMOA 4ZGJB 1Q7YR 3TSZA 2CP2A 1ZQ1A 1MHNA 4M78B 4ZN1A 5GAN3 3CMAA 1VQ9T 4HVVA 4HT9A 3HKSA 4F16A 3H0IA 2EQUA 2NUPA 3OSVA 2PUKB 4WCIA 3PNWC 4C8QA 2KXDA 1WQWA 1YCYA 2CSIA 4GLKA 2JTEA 2LQKA 3LGLA 1M8VA 3OBYA 2CH4A 4JDSA 2DBMA 2EJ9A 3G6ET 4R55A 1VQ5Q 4FYVB 3X25B 1VYUA 2J06A 3OA6A 1OULA 2L5QA 3HRUA 3P8BB 4Y91A 2DL7A 1E6GA 2BE7D 1K4US 2HQXA 4ORZA 1MV3A 1QWEA 2E6NA 2LQ8A 5C6SA 3VS0A 4X1VA 2KE9A 5D6WA 4J6XA 4OMOA 5LJ5d 2CP3A 4ELZC 2MPXC 3A8GB 1WHKA 3PTAA 2DL4A 3EG9A 1M30A 1CKBA 4RTTA 1K9MR 3SFMA 1I5OB 1VYTA 1N27A 4R0KA 4MZTA 1OV3A 1RL2A 3L2WA 1RUWA 1HXDA 4OP0A 2R57A 2VC8A 1WX6A 2KNBB 3CC2A 4HCCA 4F7UF 3IQLA 3LLRA 1ZSZB 3V7RA 8AT1B 1VA7A 2XU8A 1RAEB 2DIGA 4LUEA 3OYKA 5GMKi 1TU0B 4LUDA 1YCSB 3KFVA 4J9GA 1C1AA 4J7FA 3PIPA 2OTJA 1G8XA 4RTUA 1G3SA 3FEOA 4M77E 1ZLMA 5GANg 2FZGB 2Y4XA 1ABOA 1K8AC 2XMFA 3QZ5B 3CCSA 1I81A 2ATCB 4C92C 2MWPA 4N4IA 2YUNA 2VGNA 4XK8E 4J83A 5GAN8 3CCEQ 4AMCA 3A1PA 3CCLQ 1Y57A 3DB4A 1AWOA 4RTYA 5CIUA 3BE3A 5FLXE 1YITQ 1OEBA 4F04B 2M02A 2X3WD 2IG0A 2ZPHB 4ANJA 2KYMA 3CPWP 2PU9B 2QDLA 3C0CA 3CC7T 3CCRQ 4ZN3A 3JCMh 1TS9A 1Q81R 3INZA 2QEXA 4JLGA 3ULRB 3CMAQ 3EGUA 1U8RA 2XIDA 1JRIA 1GRIA 1QKWA 1NEBA 2MI6A 4HVWA 5L23A 2R58A 1RI0A 5GMKe 3UA6A 2C0OA 2CT4A 3Q1JA 2LJ0A 4PK4A 4PJOG 3VUZA 2KK4A 4LD9K 4M77C 1XQHA 2FEIA 1QCNA 2XDPA 1IREB 2JJ9A 1JJ2P 1VQ8A 3EAEA 2QXFA 3UWNA 1DJ7B 2RO0A 1SSFA 2CP7A 1VQNA 1UE9A 3CD6T 3RNJA 3JCMf 1QVPA 3MEAA 2KT1A 4F7UE 3C4SA 4M7AF 4JRPA 3QWXX 2EKHA 1YJ9T 2H3EB 2EJGA 3H0FA 2LNHB 3BDUA 3SHWA 1VQLQ 3JCMV 4ZTJA 2YUQA 2D9TA 4ZGEB 2LC4A 5IN1A 2LCCA 1TUDA 3J7AF 2LJ3A 4J9DA 4F14A 1G2BA 2J05A 3OYDA 3CC2Q 3M4YA 2LTOA 1MMAA 2EYWA 4FYWB 1TG0A 4C0DB 4JS4A 2E10A 4JPBW 3JB9J 3CXCP 2YDLA 4Q5WA 3OYNA 1I4K1 3JCMb 1M3BA 1SF9A 2DETA 2P0KA 5KYWA 3JB9F 3U23A 2FZKB 2OTJQ 2X4XA 2HQEA 1VIEA 3A8LB 1NLPC 4KUDK 3OS2A 4J9HA 5FU6B 1ZUKA 3OYYA 5FRNA 1XTDA 2CYZB 5C0MA 3CCSQ 1Y96A 4XU2A 3L2RA 1WHLA 2K7AA 3LW5E 3EG0A 3DB3A 3MCAB 4J9CA 2K3XA 2LQWA 1YITT 3OMGA 1Q82U 4BI4A 2OAWA 3QO3A 4WTOB 1IGUA 3M9QA 3CPWA 5HK0A 4BDYA 1SRLA 4M75G 2EVRA 3VS7A 2JZ2A 5HKCA 2CUDA 3OYGA 2GTJA 2DMOA 4NL2A 5GAN2 1GBRA 4HXJA 3A8OB 2QEXQ 1D09B 2RQUA 1N5ZA 3CCMA 1MUZA 2QA4T 3CBPA 3QUIA 1Q7YC 1QQJA 1OQKA 1JQQA 1WIEA 2MIOA 3OSSC 1SKUB 3H0HA 4GLMA 4MDWA 3LWIA 3QPHA 3JCMQ 3OW2P 2RN8A 3MP6A 4M77A 2QK0A 2E5KA 1RADB 1LOJA 4M7AE 4OVAA 1I5LA 2VXEA 1IHWA 1X27A 1JJ2A 1FXXA 1M90U 2VXFA 4B9WA 2EYQA 2YRCA 3EFSA 1VQ8Q 4OGCA 2KDSA 1TOVA 3CPFA 5HK3A 2DXUA 1S72T 3WVEB 3X26B 1WXTA 1VQNQ 3C12A 2EIFA 1KD1R 5GJWB 1KC8C 2E3IA 2CDTA 5J39A 4CC4B 1K73R 3G4SA 3ZBDA 2ZPGB 5DLOA 1WHMA 3R6OA 4X34A 1WDXA 1YJNA 2K3YA 1M8MA 2LX9A 5IXFA 2E3HA 1K9MC 2P84A 2FL7A 2XG8D 2NUZA 2CZ7B 2GFUA 5LJ5f 1M1KU 3MP8A 1BK2A 1ZSZC 4M7AD 3TQ7P 4FT2A 2ZPBB 2K5LA 1UGPB 3HSBA 3CBOA 4KGVB 4C0ZA 3BFMA 4QQDA 5HY6A 3CPWS 2OTJT 5GANe 1WXUA 2RI3A 4J6YA 1OZ3A 4ME7A 1XOVA 2DKGA 1WJQA 1T0HA 3CCST 5I2MA 1M3CA 2CKKA 1RAGB 1AHJB 2OI3A 2KXCA 1QCOA 2SEMA 2PUOB 4LDWA 1AWXA 2ZPIB 3G7ZA 1KQSP 2MWOA 3MKDA 3OQ5A 3CCVA 2VGMA 3M5AA 4OB3B 3I5RA 4KGXB 3JCMd 1U3OA 1AT1B 1KHCA 5GANj 1LJOA 1QVFP 2P0PA 4F7UA 1AOJA 3JB9D 2A36A 3H9NA 2NYSA 4N0AA 1O75A 3META 2DRKA 2X9HA 1RAFB 1W2BS 1K1ZA 4NL3A 3EGDB 1BBZA 3M54A 1VQMQ 3CCUA 4A4KA 1J3TA 1D1CA 1NZ9A 2DEUA 1G5VA 1LPLA 2HZYA 4C8QG 2W0ZA 1YN8A 2JMCA 5FROA 2OJ2A 2RHZA 2NUTA 3CCMQ 3RUXA 1Q81C 1M4ZA 2XICA 5LJ3e 4BD3A 2EWNA 4C92F 4QVCA 2F5TX 4JUVA 3A8MB 3I5SA 5CKEA 5KYUA 1YHQA 2LQNA 2ED0A 3C95A 3PVQA 3LH0A 1VQPA 4Y28E 3QG1A 2FG0A 1OX8A 2DD5A 4DBQA 4A4HA 3RESA 1B07A 5GANh 1UB4A 2RHXA 2E1HA 3FJ5A 5LJ3j 3NTHA 2MOXA 2CREA 5I11A 2RJDA 4EMKC 3ASKA 4FCYA 1AWJA 3HFNA 5KE3A 2KI7A 2JS0A 5GMKm 1K9AA 2A28A 3QJYA 3QIIA 1D0XA 3NHNA 1YBYA 3G4SQ 4BB7A 4OMNA 3QKJA 2W10A 1KFZA 4XTUA 1QVGP 4Z02A 2JMAA 3A8HB 3NMZC 1KQ1A 1YJNQ 4M75B 4N4GA 2XD0A 4FW2A 4OF1A 1UFFA 3FC3A 3HRSA 2AZVA 4XU1A 3OYFA 2XI9A 3CCJA 1VQ4T 1XNIA 1IRXA 1HJDA 4FSSA 3A5ZB 4QQ6A 2KROA 2BZ8A 2HEQA 3RDVA 1ZA2B 3P8DA 1UUEA 5GAMe 4M7DF 1Z9QA 4HVUA 2YWWA 4F7UB 4M7AA 3O5ZA 3QYHB 2HSPA 1R77A 3OS5A 4PFOA 1ZHIA 2EQIA 1KQSA 2O4XB 2NWMA 2QAZA 5FU6C 4FT4A 1RAIB 1N8RR 1K0SA 1BI1A 5GAMj 2CZ1B 1QVFA 3CCVQ 1QP2A 3TU4K 2HBWA 1Y71A 4J9FA 2JNGA 2YLBA 4BDZA 2K2MA 3THKA 4HCKA 1RLPC 1GCPA 2FPFA 2K9GA 1RAAB 3L2QA 1M2VA 1PKTA 4C92E 2J6OA 1PSEA 1HSQA 2VUBA 1UHCA 4LE9A 4GBQA 2RHUA 3EGXA 2LZ6B 4GY5A 4QVZA 5KYXA 3CCUQ 4RUGA 3CCMT 1YWPA 3TSWA 4RKUE 1YI2T 4LN2A 3M0SA 1VYVA 2A7YA 5I2SA 3I55A 3C94A 1BKBA 4HT8A 1VQLA 1MMNA 1T3SA 2DZCA 2CH4W 2ABLA 3HFOA 2ZCFB 3I56A 1YHQQ 3GNFB 2DFUA 2RF0A 3S3MA 1Y0MA 3ZEHA 1E6HA 2KRNA 2M0OA 4BACA 1VQPQ 1X6BA 2JXBA 1ZSGA 1VIFA 2DTIA 3QBYA 4PJOE 2EW3A 1BYMA 4MDXA 4E7LA 1X01A 2P4TA 1XJWB 4C92D 3CMEA 1FMVA 3FRNA 2FHDA 1BB9A 3CCQA 4M78F 1NPRA 1KK7A 1V29B 1TXQA 4J6WA 4AG1C 1KQ2A 4HKEA 3G4ST 3H8ZA 1KG1A 1WZOA 2XHCA 2KVQG 2D1XA 1YNZA 2KMTA 1KD1C 3QDRB 1QVGA 1W1FA 4PKCC 1YJNT 2JTMA 4BE1A 1KQSS 4M7DE 1NJIR 2LDMA 2HQHA 1VQ6A 2I2LA 3RR6A 5AYFA 1U5SA 1P92A 3VV0A 1YFNA 2NUPB 3NPFA 4C8QB 1GL5A 3CCJQ 4L6V5 2DERA 4PJJA 4FSXA 3REBB 4RG8A 1B3QA 4DBRA 1K0XA 2QQAA 5GAOn
chains in the Genus database with same CATH topology
2WACA 4C5IA 1Q82C 4M7AC 3CEYA 4XAXB 2LT4A 1VQ7T 1Q82U 4PJOB 4VUBA 4JRKA 4V2SA 4BI4A 3X28B 3HL8A 3QO3A 4A54A 2E65A 4N4HA 3S3OA 3M9QA 1LNXA 3SWNC 3GP8A 3CPWA 5KH6A 4J5YA 5HK0A 4KULA 3DLMA 4BDYA 2M16A 3V8KA 1YJWA 1M1GA 2QQBA 4M75G 3VYGA 2E41A 1U1SA 3OBWA 4M77D 3TEEA 2JZ2A 5L8RE 3OW2S 1VQ5A 3CBMA 1G3TA 5HKCA 4PJOC 4A4FA 1N9RA 4PLIA 2QA4A 2ZPEB 3OYGA 2DK3A 4NL2A 1N9SA 5CCAA 2RI5A 3E1SA 5GAN2 2DEQA 1BI3A 2K57A 1VUBA 3M55A 1VQMT 3A8OB 1VQ5T 2O4XA 2O01E 5LJ3g 1JBMA 2LVMA 2DD4A 1HK9A 2E6ZA 3CCMA 4C5HA 2QA4T 3CBPA 3M57A 3QUIA 1Q7YC 2DPPB 1Q7YU 2BKDN 1H3ZA 2M1HA 3M4GA 1WPYA 3WVDB 4BY6C 1UEBA 3OSSC 5FU7B 3OY9A 3LYIA 1YIJA 2L3RA 1G3WA 3VKIA 2KQWA 4M7DB 3FIFA 4KT0E 3JCMP 3TREA 1O9SA 5CR2A 4E7KA 2MAMA 3FJPA 2V8JA 3UT1A 4MDWA 5GAOm 3LWIA 2K5FA 1PSFA 5LJ3f 3FB9A 1YIJT 3KBGA 3QPHA 3WXMB 4A4GA 4JS5A 2B8AA 1MGQA 3JCMQ 5GMKj 3SB2A 2MF2A 4XTWA 2CZ0B 2PVDB 3MP6A 4M77A 2XKOC 3V7CA 1B34B 5FU7C 1LOJA 4M7DC 3URGA 1G3YA 2LT1A 4OVAA 1I5LA 4M7AE 2VXEA 2HBPA 5A0GA 2YRVA 2DXCA 3QSUA 1JJ2A 2G3RA 3OYLA 2DVEA 1M90C 4A4EA 1FXXA 5CK9A 4BE2A 1M90U 2VXFA 2L89A 2DJZA 4B9WA 1S72A 4C0GA 4M75F 2EYQA 2X35A 3EFSA 1R8OB 2QQRA 3JSCA 5CKFA 3JCMe 2XDBA 4QW2A 4E7HA 3H6ZA 4OGCA 2KDSA 4XQ3A 5GAMh 2OTLA 2DXBA 1YHQT 1X6OA 3JAME 4XTZA 3NTKA 3CPFA 5HK3A 3X20B 2DXUA 1S72T 2C06A 3WVEB 3X26B 1IZ6A 4EMKA 3JCMW 2V8IA 2RI2A 1W4SA 3C12A 2OTLT 2EIFA 1KC8C 1KC8U 4M78E 4D6WA 4FL6A 2DZ9A 4ZTFA 1NE8A 5J39A 3JCMX 3J81E 3M58A 3DKMA 4HCBA 3QJ6A 3G4SA 3ZBDA 2EFIA 3QZ9B 4A53A 2ZPGB 5DLOA 2F5KA 4C5GA 3RERA 3R6OA 4X34A 4IUUA 2GCXA 1YJNA 2K3YA 3X24B 2LX9A 3FDRA 3MEWA 4IUPA 5GAOq 1K9MC 4C5EA 5M9OA 4B9XA 2FL7A 2EQMA 2XG8D 3M59A 5DY9A 3RMSA 1I8FA 3MO8A 5GAN7 1K9MU 3VJPA 4QQGA 1M1KC 1VQOA 2CZ7B 2GFUA 2WSCE 5LJ5f 3MP8A 3CCEA 1M1KU 1VQKT 5GAMg 4RCBA 4M7AD 1M1FA 3QHSA 4FT2A 3G71A 2ZPBB 2K5LA 5GMKh 5GAOp 1K73C 1UGPB 3CCLA 3HSBA 3CBOA 3KUFA 5CQXA 3ME9A 4C0ZA 4ELYC 3BFMA 4QQDA 4C92A 1VQOT 2DO3A 3GLXA 2LCLA 5HY6A 4XTVA 4FM4B 4M7AB 4X9DA 5LJ5e 5D6YA 2K5IA 3CCET 4II1A 4ZGDB 1QVFS 3G71T 3RKWA 3CPWS 3O8VA 3CCLT 2OTJT 2V8KA 5GANe 1YITA 1K8AU 2E12A 1BI2A 2RI3A 4J6YA 5D6XA 4M77F 1OZ3A 4ME7A 1D3BA 1XOVA 4OB0B 1VQ7A 5GAMf 4JRQA 2CS7A 4PJOD 2DKGA 2IVWA 1WJQA 2RHIA 3BDLA 2DTOA 3ER0A 5KE2A 4XU3A 4LDXA 3HP9A 1UGRB 5I2MA 3CCST 1ZBXA 2CKKA 2VV5A 1M5Q1 4QVDA 1AHJB 3QXEB 3CCRA 4M75C 4C92G 4DQ2A 3CCJT 2PUOB 3OMCA 2KY9A 4LDVA 2JOYA 4ZGJB 4LDWA 4JJNK 1ZQ1A 2ZPIB 3G7ZA 3GIBA 2MWOA 2VYTA 1MHNA 1JB0E 1OZ2A 2RH2A 3OQ5A 4M78B 4ZN1A 5GAN3 2EKOA 3CMAA 2EJFA 2FB7A 3CCRT 2VGMA 3CCVA 1Y7XA 3M5AA 4OB3B 3JCMd 4JRIA 5GAN5 1KHCA 5GANj 1VQMA 2PQWA 4HT9A 3HKSA 5GAN6 4BY6B 2HD0A 1LJOA 2EQUA 5J26A 1FX7A 2P0PA 3OSVA 4F7UA 3CCVT 2PUKB 5DLQE 3SWNA 3JB9D 3PNWC 4EMGA 3PFSA 4MMKA 4C8QA 1WQWA 1YCYA 3G6EA 4GLKA 4N0AA 3OYAA 1O75A 3META 3UDCA 4M78C 2LQKA 3LGLA 4HA8A 1W2BS 1M8VA 3OBYA 4JDSA 4NL3A 4PJOA 3ZFJA 4M7DD 2EJ9A 3G6ET 3GF5A 3M54A 4R55A 3CCUA 4A4KA 3X25B 1X75C 1NZ9A 1G5VA 3OA6A 4XTXA 4F7UG 2L5QA 3HRUA 4L5GA 3HPWA 3P8BB 5IAYA 4Y91A 4C8QG 3OYCA 4MZPA 5IT9E 4E7IA 5FROA 3CCUT 2GF7A 2RHZA 3J80E 2HQXA 3VUBA 3RUXA 4BUGA 1Q81C 1N8RU 1M4ZA 3OYIA 1Q81U 2XICA 4CI0C 3LX7A 2E6NA 2OAUA 2LQ8A 4LDYA 5C6SA 4BD3A 2EWNA 5LJ3e 4C92F 5KCHA 4M75E 4QVCA 2F5TX 2X4JA 2JVVA 4IUVA 5GAN4 5D6WA 4J6XA 3QYGB 1U1TA 3A8MB 2YLCA 4JUVA 5CKEA 5CAIA 5LJ5d 1YHQA 4ELZC 1GXIE 1BIAA 3A8GB 3PTAA 1OYXA 4M7DA 5GANd 4EMKB 3C95A 5A2QE 4EMHA 3OS0A 3LH0A 2PVOB 4Y28E 1VQPA 3QG1A 2EQKA 4M77G 2DD5A 2L8DA 4A4HA 3SFMA 5KCOA 4L59A 3RESA 5GANh 1UB4A 1N27A 2EQJA 2E1HA 2RHXA 5GAOl 1VQPT 2RJFA 4J8OA 1BIBA 4MZTA 3RMQA 5GAOr 1RL2A 5LJ3j 3NTHA 3L2WA 4DA4A 1VQLT 1B34A 1WJSA 1QVGS 3UPUA 4FU6A 2RJDA 4EMKC 1HXDA 3ASKA 2RA2A 4LD6A 3HFNA 4OP0A 5KE3A 2R57A 2LNVA 4M7DG 1TH7A 3PGGA 1Y07A 5GMKm 2VC8A 3CC2A 1VQ9T 2E70A 4RMOA 4HCCA 4XU0A 4F7UF 3LLRA 3V7RA 2XK0A 4C8QF 2R5MA 5I21A 3CC4T 2XU8A 2RM4A 2DIGA 2BIVA 3JRZA 3QIIA 3QJYA 3CC2T 3OYKA 5GMKi 1VQKA 2BUDA 2FVUA 3N5BB 4KBMB 4J7FA 2RB6A 3MHXA 2D0QB 3GOXA 3KXTA 1YBYA 3CXCA 4BB7A 2WSEE 4EDUA 3PIPA 3QKJA 2P0QA 2OTJA 4M75D 5FRMA 4XTUA 4PLLA 1G3SA 3FEOA 1Y96B 3BY7A 4M77E 4Z02A 3A8HB 1KQ1A 1D3BB 5GANg 2QI2A 4M75B 4N4GA 4OMFB 1VQ4A 2Y4XA 2WSFE 1K8AC 2XD0A 4XTYA 4PL6A 2GFAA 2JUFA 1NPPA 3QZ5B 4OF1A 3CCSA 3FC3A 3HRSA 3LGFA 5GMKl 1I81A 4XU1A 4C92C 4RG2A 3OYFA 2MWPA 4N4IA 3L2UA 2JTFA 2VGNA 4XK8E 3HHTB 4J83A 2XI9A 4E47A 5GAN8 3CCJA 2DIQA 1XNIA 3SDZA 1VQ4T 4OB1B 4C0FA 3A5ZB 5LJ3d 4QQ6A 3OYHA 3DB4A 3P8DA 1UGQB 1VQ9A 3OB9A 3GPLA 5GAMe 4BI3A 4M78D 5CIUA 4FIBA 3PT9A 4M7DF 5J3BA 3E9GA 5FLXE 1WNLA 2QQ9A 3JB9H 5LJ5j 3RKXA 4F7UB 3LWHA 3VU3C 3CC7A 2D6FA 2E64A 4M7AA 3QYHB 3JB9I 2IG0A 2ZPHB 3OS5A 3RKYA 3MEVA 1ZHIA 5A0DA 1M9SA 2O4XB 1KQSA 3V8JA 2PU9B 2HNIA 3CC7T 5FU6C 4EPCA 4IKFA 2MMPA 3JCMh 4ZN3A 4FT4A 1NJIC 1NJIU 1BI1A 3INZA 2QEXA 4JLGA 4CRIA 5GAMj 2CZ1B 1WGSA 3MP1A 1QVFA 3HRTA 2LRQA 2RD1A 4C8QC 1QP2A 3OYBA 4M7AG 1U8RA 2XIDA 3TU4K 1JRIA 4N0AC 1FWZA 1Y71A 2YLBA 2JNGA 3MEUA 2QEXT 4BDZA 2A3LA 3NFCA 1JJ2S 2PVGB 3L2ZA 4BI8B 4P5NA 4M78A 3OYMA 2MI6A 2M9UA 1BI0A 2R58A 2RJCA 4UC4A 1H641 1RI0A 4M77B 2GQVA 3S6WA 5GMKe 3OYJA 3L2QA 1YJWT 3V8LA 4C92E 2QDYB 2RJEA 3Q1JA 1N8RC 3P8HA 1PSEA 4RCCA 4PJOG 3AHUA 3VUZA 2VUBA 3VYHB 1Q86C 1Q86U 4DOWA 2KK4A 2RHUA 4ATOA 3FLGA 4GY5A 4QVZA 3RIRA 4LD9K 1YI2A 2EAYA 2HAXA 4DOVA 4M78G 3OW2A 3CCMT 4M77C 2RK2A 2R5AA 2JN0A 3GNGA 4RKUE 4TVRA 1XQHA 4WF2A 3JCMg 1YI2T 2F69A 2A7YA 5I2SA 5CVIA 1OI1A 2XDPA 3CD6A 1IREB 3I55A 3OYEA 1VQ8A 3EAEA 3C94A 1BKBA 2QXFA 4JLIA 1W2BA 5LJ5h 4J7IA 2QQSA 1VQLA 3JCMc 3UWNA 4HT8A 1DJ7B 4IUQA 2RO0A 2DZCA 4NOYA 1SSFA 2CGHA 3TCJA 2E5QA 3NTIA 3JB9G 1VQNA 3I55T 1VQ8T 3CD6T 2AHJB 3HFOA 3SD4A 1YJ9A 2ZCFB 3JCMf 5GAMd 1QVPA 5DM7R 3I56A 3GNFB 3MEAA 3BW1A 3CMAT 4F7UE 2YHTA 3M56A 3S3MA 3C4SA 4M7AF 4JRPA 3PMIA 4C8QE 3CXCS 2KSSA 3ZEHA 3CC4A 1VQNT 2CZ6B 2M0OA 4OB2B 1YJ9T 2EJGA 2Y4YA 2RHYA 2ZPFB 4X9CA 4BACA 3I56T 2X4YA 4PNOA 3BDUA 4IURA 4MMLA 1QW1A 1VIFA 2DTIA 3QBYA 4R56A 4PJOE 3JCMV 2K2VA 1BYMA 3F70A 5CO7A 5CQYA 2FYKA 4MDXA 4ZTJA 2D9TA 2H3JA 2RK1A 4ZGEB 2LC4A 4E7LA 4OGEA 5IN1A 1X01A 2K4YA 2LCCA 2P4TA 4PJOF 4C92D 3L1AA 4NS5A 2NLUA 3CMEA 3FRNA 3J7AF 5CKBA 1WQ7A 2FHDA 3S3NA 5CKHA 4C92B 4IUTA 2KAFA 3OYDA 3CCQA 3M4YA 2LTOA 4M78F 3CMET 3PMTA 5LJ5g 3JCMJ 2DAQA 4BE0A 1NPRA 3T9NA 4C0DB 2ZGWA 4JS4A 1V29B 3E19A 4J6WA 2XDDA 2E10A 5LL6S 3JB9J 1N6AA 2QTXA 3CCQT 1KQ2A 1EIFA 4HKEA 3G4ST 3H8ZA 4Q5WA 4KUIA 1KG1A 4MZMA 3OYNA 4YTLA 2XHCA 1I4K1 4HCZA 2KVQG 1KHIA 2KMTA 3JCMb 3QDRB 3L42A 1QVGA 1KD1C 4PKCC 1KD1U 1YJNT 2JTMA 2P0KA 3JB9F 3L2VA 3OS1A 4BE1A 1KQSS 4M7DE 3V7SA 4C0DC 1QP3A 4LDUA 2LDMA 3EFRA 5GANf 3E9FA 2X4XA 1K73U 2HQEA 1VIEA 3A8LB 5CKDA 1VQ6A 1UGSB 2I2LA 2DXTA 4KUDK 3OS2A 5FU6B 2X4WA 3OYYA 2ZZDA 4O5VA 5AYFA 5FRNA 4C8QD 1XTDA 1P92A 4O6JA 5LJ3h 2CYZB 3VV0A 5C0MA 4E7JA 2Y90A 3DLLA 3M53A 1Y96A 4XU2A 3L2RA 3LW5E 1VQ6T 3SWNB 5A0LA 3DB3A 4C8QB 4M75A 4L6V5 3MCAB 1WJRA 4FSXA 3PIOA 2K3XA 4RG8A 5EG2A 1YITT 2DTHA 2QQAA 5GAOn 3OMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RES A;  3AHU A;  4RCC A;  5GAN h;  4PJO G;  4M7A C;  5GAO l;  4PJO B;  2E1H A;  4JRK A;  5LJ5 f;  1BIB A;  4V2S A;  5GAO r;  5LJ3 j;  5GAM g;  4RCB A;  3RIR A;  3QHS A;  1B34 A;  2EAY A;  3QO3 A;  4A54 A;  2E65 A;  5GMK h;  4EMK C;  5GAO p;  1HXD A;  3HSB A;  2RA2 A;  1LNX A;  3SWN C;  3HFN A;  4OP0 A;  4M7D G;  4J5Y A;  3BFM A;  4M78 G;  1TH7 A;  3PGG A;  4C92 A;  4M7A B;  4M77 C;  5GMK m;  2VC8 A;  4XTV A;  3V8K A;  4X9D A;  5LJ5 e;  2JN0 A;  4M75 G;  4WF2 A;  3JCM g;  2E41 A;  4XU0 A;  4F7U F;  3RKW A;  1U1S A;  3V7R A;  4M77 D;  5GAN e;  4C8Q F;  5I21 A;  4J6Y A;  4PJO C;  4M77 F;  1D3B A;  2RM4 A;  1N9R A;  5GAM f;  4NL2 A;  4JLI A;  5GMK i;  2DKG A;  1N9S A;  4PJO D;  5LJ5 h;  5GAN 2;  4HT8 A;  2DEQ A;  2K57 A;  3JCM c;  2DTO A;  4XU3 A;  2DZC A;  4NOY A;  2CGH A;  2RB6 A;  3JB9 G;  5LJ3 g;  1JBM A;  1HK9 A;  1M5Q 1;  3HFO A;  4QVD A;  4M75 C;  3JCM f;  3QUI A;  4C92 G;  4DQ2 A;  5GAM d;  3BW1 A;  3M4G A;  1WPY A;  4F7U E;  2YHT A;  4M75 D;  4M7A F;  3GIB A;  4XTU A;  4C8Q E;  4M7D B;  1Y96 B;  3BY7 A;  3FIF A;  4M78 B;  2EJG A;  2EJF A;  2FB7 A;  4M77 E;  1KQ1 A;  1D3B B;  4X9C A;  5GAN g;  3JCM d;  3JCM P;  4M75 B;  3FJP A;  4PNO A;  4JRI A;  3BDU A;  4MML A;  5GAN 5;  5GAO m;  5GAN j;  2DTI A;  4XTY A;  4PJO E;  4HT9 A;  5LJ3 f;  3FB9 A;  3JCM V;  5GAN 6;  1LJO A;  5GMK l;  1I81 A;  2FYK A;  4XU1 A;  4C92 C;  4F7U A;  1MGQ A;  3SWN A;  3JB9 D;  4EMG A;  5GMK j;  4MMK A;  3SB2 A;  4XTW A;  4C8Q A;  3JCM Q;  5GAN 8;  1X01 A;  1WQW A;  1YCY A;  4M77 A;  4C92 D;  4PJO F;  3V7C A;  4N0A A;  1B34 B;  3L1A A;  1LOJ A;  4M7D C;  5LJ3 d;  4M7A E;  4M78 C;  1I5L A;  4HA8 A;  1M8V A;  2VXE A;  1WQ7 A;  3QSU A;  4NL3 A;  4PJO A;  5GAM e;  4M7A D;  4C92 B;  4M7D D;  4M78 D;  2EJ9 A;  2DVE A;  4M7D F;  4M78 F;  5LJ5 g;  2VXF A;  3JCM J;  2DJZ A;  1WNL A;  4M75 F;  3JB9 H;  5LJ5 j;  2ZGW A;  3EFS A;  4J6W A;  4XTX A;  3RKX A;  4F7U G;  2E10 A;  4F7U B;  3JCM e;  3VU3 C;  5GAN 3;  2QTX A;  2E64 A;  4XQ3 A;  5GAM h;  3JB9 J;  1KQ2 A;  4Y91 A;  4C8Q G;  3JB9 I;  4XTZ A;  1I4K 1;  2DXU A;  3RKY A;  4EMK A;  4M7A A;  3V8J A;  3JCM b;  3JCM W;  2HNI A;  3RUX A;  3JCM h;  3JB9 F;  4M7D E;  3V7S A;  4M78 E;  5LJ3 e;  2EWN A;  2DZ9 A;  3INZ A;  4C92 F;  3JCM X;  3EFR A;  4M75 E;  4QVC A;  5GAM j;  5GAN f;  2RD1 A;  4C8Q C;  2I2L A;  2DXT A;  5GAN 4;  4M7A G;  4J6X A;  4JUV A;  1U1T A;  5CAI A;  1JRI A;  2YLC A;  4N0A C;  5LJ5 d;  4A53 A;  2YLB A;  4C8Q D;  1BIA A;  5LJ3 h;  3RER A;  2Y90 A;  3L2Z A;  5GAN d;  4EMK B;  4M7D A;  1Y96 A;  4M78 A;  4XU2 A;  4EMH A;  3SWN B;  4C8Q B;  4M75 A;  5GAO q;  1H64 1;  4M77 G;  4M77 B;  5GMK e;  5GAN 7;  5DY9 A;  1I8F A;  3V8L A;  4C92 E;  2DTH A;  5GAO n; 
#chains in the Genus database with same CATH topology
 2WAC A;  4C5I A;  3CEY A;  2LT4 A;  4VUB A;  1Q86 R;  3X28 B;  4PFP A;  4A54 A;  1TUG B;  4AG2 C;  2BTT A;  3SWN C;  3GP8 A;  1FYN A;  1WHJ A;  4KUL A;  2DBK A;  3V8K A;  1YJW A;  2QQB A;  3CQT A;  3VYG A;  1IGQ A;  1U1S A;  3OBW A;  1C0M A;  4M77 D;  3TEE A;  1UG1 A;  4PJO C;  1N9R A;  3A98 A;  5CCA A;  2RI5 A;  4CC3 A;  1VUB A;  3EGX B;  1VQ5 T;  4FYX B;  5LJ3 g;  1JBM A;  2DD4 A;  1HK9 A;  4C5H A;  3I9Q A;  3M57 A;  2DPP B;  1Q7Y U;  4LXC A;  1UEB A;  1QKX A;  3OY9 A;  1YIJ A;  2O9V A;  2L3R A;  1G3W A;  2KQW A;  3EG9 B;  3TRE A;  1PC0 A;  3FB9 A;  3KBG A;  2HCK A;  2M0Y A;  4A4G A;  2B8A A;  2CSQ A;  2VWF A;  3SB2 A;  5GMK j;  1PRM C;  2QGG A;  2DX1 A;  2A0F B;  5FU7 C;  4M7D C;  2LT1 A;  5GJV B;  2HBP A;  2YRV A;  2EGE A;  1HYO A;  3OYL A;  1V76 A;  5CK9 A;  2DJZ A;  5D7U A;  2LX7 A;  2DYB A;  4C0G A;  1M27 C;  1OOT A;  2DYI A;  3JSC A;  3I55 Q;  2H8H A;  2OTL A;  1YHQ T;  2RQV A;  3JAM E;  4XTZ A;  3NTK A;  1AZG B;  3JCM W;  3I56 Q;  1KC8 U;  4M78 E;  4FL6 A;  2DF6 A;  8ATC B;  3M58 A;  3QJ6 A;  1NBE B;  2F5K A;  3NGP A;  4ZNX A;  4IUU A;  2GCX A;  2AKL A;  3X24 B;  3MEW A;  5GAN 7;  1K9M U;  2EQM A;  3CME Q;  5DY9 A;  1I8F A;  3HTR A;  2P4R A;  1EFN A;  1VQO A;  3LH5 A;  2LMJ A;  3CCQ Q;  5GAM g;  3G71 A;  5GMK h;  2X3X D;  1I1J A;  5CQX A;  3ME9 A;  3MPU B;  2YRD A;  4C92 A;  3GLX A;  2LCL A;  3CCE T;  5LJ5 e;  4X9D A;  5KYN A;  5D6Y A;  4II1 A;  4ZGD B;  2SRC A;  1NLO C;  3CCL T;  2V8K A;  4E7S A;  3M0T A;  2AIR B;  2DIL A;  2IVW A;  2DLP A;  2A08 A;  1S1N A;  5KE2 A;  2DTO A;  1NM7 A;  4D8K A;  1UGR B;  1M5Q 1;  1VQ6 Q;  4M75 C;  2D0N A;  3CCJ T;  1UJY A;  3ZL7 C;  3GIB A;  1JB0 E;  2EKO A;  3CCR T;  2EJF A;  1Y7X A;  4A63 B;  3EFO A;  1VQM A;  2PQW A;  5GAN 6;  4BY6 B;  2HD0 A;  1FX7 A;  3CMA T;  3SWN A;  4EMG A;  3PFS A;  3G6E A;  5I22 A;  3OYA A;  1D1B A;  3UDC A;  4M78 C;  4HA8 A;  1H92 A;  1X2K A;  4PJO A;  1YJW Q;  2ESW A;  3VS4 A;  1WHH A;  4KH1 B;  1UHF A;  4F7U G;  3HPW A;  5IAY A;  4MZP A;  4E7I A;  2RPN A;  2EPD A;  1SHG A;  3EHR A;  3EH1 A;  3VUB A;  3OYI A;  1Q81 U;  4K11 A;  2DE0 X;  2OAU A;  1FMW A;  4LDY A;  4DBF A;  5KCH A;  2O2O A;  1YIJ Q;  1BCO A;  2HKQ B;  2JVV A;  3QYG B;  1U1T A;  5CAI A;  2YLC A;  1WXB A;  2O31 A;  4JJB A;  2V1R A;  1ZX6 A;  1T0J A;  1H3H A;  4M7D A;  1PCX A;  2EQK A;  4EIK A;  1NYG A;  2EQJ A;  5GAO l;  4J8O A;  3RMQ A;  1X69 A;  1VQL T;  1B34 A;  1WJS A;  3UPU A;  4FU6 A;  1JO8 A;  4AFS C;  1KSW A;  2LNV A;  1TH7 A;  1Y07 A;  2OTL Q;  2PZ1 A;  2E70 A;  4RMO A;  1ACM B;  1IB8 A;  4XU0 A;  2XK0 A;  4JZ3 A;  5I21 A;  4KGZ B;  1K8A R;  4OMP A;  2RM4 A;  1YWO A;  3JRZ A;  2ENM A;  5KYW B;  3CC2 T;  1BCM A;  4KBM B;  2RB6 A;  2D0Q B;  3GOX A;  3MJX A;  3KXT A;  3CXC A;  2KT8 A;  4E2F B;  4RTZ A;  4EDU A;  1QCF A;  5FRM A;  1Y96 B;  2OX7 A;  1R0C B;  3BY7 A;  3VS3 A;  2GFA A;  2HKN A;  2JUF A;  1TTH B;  1IO6 A;  1U06 A;  4RG2 A;  1Q95 G;  2KGT A;  2JTF A;  3L2U A;  1VQO Q;  3HHT B;  4E47 A;  5KYY A;  3SDZ A;  3G71 Q;  4C0F A;  3OB9 A;  3GPL A;  1NG2 A;  2EYZ A;  4FIB A;  1D1A A;  3PT9 A;  2QYZ A;  6AT1 B;  1GFD A;  3VU3 C;  3CC7 A;  2D6F A;  2E64 A;  2ROL A;  3JB9 I;  2L3S A;  1M9S A;  1VQ9 Q;  4EPC A;  1JXM A;  2MMP A;  1NJI C;  4DEX A;  2O88 A;  2VB6 A;  4CRI A;  3MP1 A;  2LRQ A;  4C8Q C;  1LVK A;  4M7A G;  2L3P A;  3EG1 A;  2GBQ A;  2QEX T;  4CC7 A;  1JJ2 S;  2A3L A;  3NFC A;  3L2Z A;  4BI8 B;  4M78 A;  3OYM A;  1BI0 A;  2B86 A;  3OYJ A;  1H64 1;  1YJW T;  4M77 B;  2GQV A;  3G6E Q;  1OX9 A;  2DJQ A;  2QDY B;  1CSK A;  4RCC A;  3VYH B;  1Q86 C;  5IH2 A;  1PD1 A;  4DOW A;  4ATO A;  3FLG A;  3RIR A;  2EAY A;  2YXY A;  1ZBJ A;  1PG5 B;  3OW2 A;  1UEC A;  2R5A A;  3GNG A;  1TUC A;  5CVI A;  3CD6 A;  4IIM A;  2LJ1 A;  2QQS A;  4IUQ A;  4NOY A;  3JB9 G;  1VQ8 T;  2F2W A;  1YJ9 A;  2DL5 A;  2RQT A;  5DM7 R;  2CP0 A;  2YHT A;  1R0B G;  3CXC S;  3CC4 A;  1VQN T;  3M0P A;  2EGA A;  2RHY A;  3EG3 A;  1ZA1 B;  4AT1 B;  2X4Y A;  4MML A;  4IUR A;  1NEG A;  1QW1 A;  2K2V A;  5CO7 A;  2K3B A;  2FZC B;  2K4Y A;  4PJO F;  1M3A A;  4NS5 A;  4ESR A;  2DA9 A;  3JV3 A;  5CKB A;  1WQ7 A;  3S3N A;  2KAF A;  2F2X A;  4QT7 A;  5HCK A;  1MMD A;  5LJ5 g;  2DAQ A;  1NYF A;  4BE0 A;  3T9N A;  2O9S A;  3EG2 A;  3EH2 A;  1ZSZ A;  4YTL A;  1KD1 U;  1PM3 A;  3L2V A;  4C0D C;  4J9B A;  4LDU A;  5GAN f;  1K73 U;  3E9F A;  5CKD A;  1UDL A;  1UGS B;  2DXT A;  2X4W A;  1VOM A;  4O5V A;  2ZZD A;  4DBH A;  4B6M A;  4O6J A;  5LJ3 h;  4E7J A;  4JJD A;  3DLL A;  3M53 A;  5A0L A;  5EC7 A;  2JS2 A;  3PIO A;  2FRY A;  5EG2 A;  2DL8 A;  1MV0 B;  4DA4 A;  1WYX A;  4OML A;  2ECZ A;  4V2S A;  3HL8 A;  2E65 A;  1X6G A;  1OU8 A;  1SSH A;  5KH6 A;  3DLM A;  2C0I A;  2M16 A;  3CC7 Q;  4OMM A;  1FMK A;  1M1G A;  2E41 A;  3I35 A;  3OW2 S;  2F1L A;  3CBM A;  2NUT B;  1CKA A;  4PLI A;  2QA4 A;  1B7T A;  1WI7 A;  2HMA A;  2K57 A;  1VQM T;  2VAS A;  2O01 E;  1PWT A;  4PFZ A;  2D8H A;  2BKD N;  1H3Z A;  5KYU B;  2M1H A;  1AVZ C;  3M4G A;  4BY6 C;  4RTX A;  2MYS A;  3VKI A;  1I0C A;  1WFW A;  4KT0 E;  4RTW A;  5FWC A;  1O9S A;  3JCM P;  4E7K A;  2MAM A;  3FJP A;  2V8J A;  3UA7 A;  3UT1 A;  5GAO m;  3G1J A;  2K5F A;  5IHK A;  1PSF A;  5LJ3 f;  4JS5 A;  3PVL A;  2PVD B;  1TWB A;  1AD5 A;  1KC8 R;  3URG A;  3VRY A;  1QMC A;  2QAS A;  2DXC A;  3H41 A;  4PJM A;  3QSU A;  2KRM A;  4IIO A;  1IXD A;  2JM9 A;  1PHT A;  2CT3 A;  1S72 A;  4M75 F;  3CD6 Q;  1R8O B;  3JCM e;  2XDB A;  4QW2 A;  4E7H A;  3H6Z A;  4XQ3 A;  5GAM h;  2DXB A;  1GBQ A;  1X6O A;  4EMK A;  1IZ6 A;  2V8I A;  1W4S A;  1YJ9 Q;  4J9E A;  2K79 A;  3JCM X;  3J81 E;  3CC4 Q;  2COW A;  4Y92 A;  4HCB A;  2YUO A;  2VKN A;  4A53 A;  4C5G A;  1G83 A;  3R6N A;  1YP5 A;  4IUP A;  3RMS A;  3VJP A;  4RTV A;  2WSC E;  1Q82 R;  4LNP A;  3QHS A;  1K73 C;  3KUF A;  4ELY C;  1X2Q A;  2DO3 A;  4M7A B;  4XTV A;  4FM4 B;  1PRL C;  2K5I A;  2KBT A;  2RNA A;  1QVF S;  3O8V A;  2E12 A;  1BI2 A;  4AFQ C;  1D3B A;  1VQ7 A;  5GAM f;  4JRQ A;  2CS7 A;  4PJO D;  3PE0 A;  2RHI A;  2COY A;  2AZS A;  2VV5 A;  3EHQ A;  4KRT A;  4C92 G;  2EYY A;  3OMC A;  2QG9 B;  4LDV A;  2JOY A;  4JJN K;  2YUP A;  2QGF B;  2VYT A;  1OZ2 A;  2RH2 A;  5FWB A;  2FB7 A;  4JRI A;  5GAN 5;  1M2V B;  1ARK A;  1E7O A;  2L3Q A;  2JM8 A;  5J26 A;  3CCV T;  5DLQ E;  4MMK A;  4OMQ A;  4F17 A;  5KYX B;  3VS2 A;  3ZFJ A;  4M7D D;  2FRW A;  2X51 A;  3QDF A;  3GF5 A;  1M90 R;  1X75 C;  4XTX A;  4L5G A;  2QA4 Q;  3OYC A;  5IT9 E;  3CCU T;  2GF7 A;  3J80 E;  4BUG A;  1MND A;  1N8R U;  2GNC A;  4CI0 C;  3LX7 A;  1BU1 A;  2C0T A;  2ED1 A;  4M75 E;  2X4J A;  1RAB B;  2MK5 A;  2HDA A;  4IUV A;  5GAN 4;  1W2B P;  2GQI A;  1AZE A;  1JEG A;  2J7I A;  1GXI E;  1BIA A;  2JT4 A;  1OYX A;  5GAN d;  4EMK B;  5A2Q E;  4EMH A;  1WHG A;  2YSQ A;  3OS0 A;  2PVO B;  4M77 G;  2AT1 B;  2L8D A;  4M4Z A;  1T3L A;  5KCO A;  2V1Q A;  4L59 A;  4FW1 A;  2LCS A;  1VQP T;  1SEM A;  2RJF A;  1BIB A;  5GAO r;  1M1K R;  1W70 A;  1IHV A;  1QVG S;  3VS6 A;  2VVK A;  2AKK A;  1S72 Q;  2RA2 A;  4LD6 A;  4M7D G;  2A37 A;  3PGG A;  2M51 A;  3UF4 A;  1V1C A;  4C8Q F;  2R5M A;  3CC4 T;  3AT1 B;  2BIV A;  1VQK A;  1QWF A;  4PJN A;  2BUD A;  2FVU A;  3M0R A;  3N5B B;  3MHX A;  1MMG A;  4JJC A;  1EX4 A;  2WSE E;  2AK5 A;  2P0Q A;  4E7Z A;  4M75 D;  9ATC B;  4PLL A;  1D3B B;  2QI2 A;  4OMF B;  1VQ4 A;  2WSF E;  4XTY A;  4PL6 A;  5IHN A;  1RI9 A;  1NPP A;  3LGF A;  5GMK l;  4Z89 A;  1HD3 A;  2DIQ A;  1JU5 C;  4OB1 B;  5LJ3 d;  2F2V A;  3OYH A;  2KR3 A;  1UGQ B;  2L2P A;  1VQ9 A;  4BI3 A;  4M78 D;  2EBP A;  3SEM A;  5J3B A;  1TSF A;  3E9G A;  4KH0 B;  1WNL A;  2QQ9 A;  3JB9 H;  1AEY A;  5LJ5 j;  3RKX A;  1VQ7 Q;  3LWH A;  2JW4 A;  1C6V X;  1I07 A;  3RKY A;  3MEV A;  5A0D A;  1K76 A;  3V8J A;  2DVJ A;  2HNI A;  4IKF A;  1AWW A;  1NJI U;  1SG5 A;  3GBQ A;  1WGS A;  2RQR A;  3HRT A;  4Z88 A;  2RD1 A;  3OYB A;  1PNJ A;  4N0A C;  2MCN A;  1FWZ A;  3MEU A;  2PVG B;  4PJL A;  4P5N A;  2M9U A;  2RJC A;  4UC4 A;  3S6W A;  2FPE A;  1RAC B;  3V8L A;  5IXB A;  2RJE A;  1N8R C;  3P8H A;  3AHU A;  2CUB A;  1UGV A;  1Q86 U;  4QKU A;  1RAH B;  1YI2 A;  2HAX A;  4DOV A;  3EGD A;  1Z9Z A;  4M78 G;  4CC2 A;  2RK2 A;  2KRS A;  2JN0 A;  4TVR A;  4WF2 A;  3JCM g;  2F69 A;  2FO0 A;  1OI1 A;  3OYE A;  4JLI A;  1W2B A;  5LJ5 h;  4J7I A;  3JCM c;  2CGH A;  3TCJ A;  2E5Q A;  3NTI A;  3I55 T;  2KEA A;  2AHJ B;  3SD4 A;  5IHI A;  5GAM d;  3BW1 A;  2G6F X;  3M56 A;  2BZX A;  3PMI A;  4C8Q E;  2KSS A;  2CZ6 B;  4OB2 B;  2Y4Y A;  2ZPF B;  4X9C A;  3I56 T;  1RLQ C;  4PNO A;  1H8K A;  4R56 A;  1KJW A;  2EYX A;  3F70 A;  5CQY A;  2FYK A;  2YT6 A;  2H3J A;  2RK1 A;  4OGE A;  1PKS A;  3L1A A;  2NLU A;  5CKH A;  4C92 B;  1F1B B;  4IUT A;  3CME T;  3PMT A;  3JCM J;  2DL3 A;  2ZGW A;  3E19 A;  2XDD A;  5LL6 S;  1N6A A;  2QTX A;  3CCQ T;  1EIF A;  1VQK Q;  4KUI A;  4MZM A;  2DNU A;  4HCZ A;  1KHI A;  2DRM A;  4AFU C;  1X43 A;  2FPD A;  3L42 A;  7AT1 B;  2HSE B;  2E4H A;  3OS1 A;  3V7S A;  1QP3 A;  1EZZ B;  3EFR A;  1OU9 A;  1VQ4 Q;  3EFO B;  4C8Q D;  1SHF A;  3REA B;  2PNI A;  1GCQ C;  2Y90 A;  2GGR A;  2CP6 A;  1VQ6 T;  3SWN B;  4M75 A;  2Z0W A;  1WJR A;  1A0N B;  2HL3 A;  3VRZ A;  2DTH A;  4M7A C;  1Q82 C;  2CP5 A;  4PJO B;  1OPL A;  4XAX B;  1VQ7 T;  4JRK A;  1GFC A;  3TVT A;  3M0Q A;  2BE9 B;  4N4H A;  3S3O A;  1LNX A;  4J5Y A;  5AT1 B;  2EGC A;  3QWY A;  4D8D A;  1VQ5 A;  5L8R E;  1G3T A;  4A4F A;  2ZPE B;  2DK3 A;  1N9S A;  1OPK A;  3E1S A;  2DEQ A;  1BI3 A;  3M55 A;  2O4X A;  2LVM A;  2E6Z A;  1WLP B;  1WPY A;  3WVD B;  2ZAE A;  5FU7 B;  3LYI A;  4M7D B;  1WA7 A;  3FIF A;  5CR2 A;  4FYY B;  2IPO B;  1YIJ T;  3WXM B;  2LP5 A;  3VS5 A;  1MGQ A;  1KIK A;  2DM1 A;  2MF2 A;  4XTW A;  2CZ0 B;  1MNE A;  2XKO C;  3V7C A;  1YI2 Q;  1B34 B;  1G3Y A;  1D0Y A;  5A0G A;  2V26 A;  5FW9 A;  2G3R A;  1D0Z A;  2DVE A;  1M90 C;  4A4E A;  1PD0 A;  4BE2 A;  2L89 A;  4AFZ C;  2X35 A;  2QQR A;  5CKF A;  2L0A A;  2IIM A;  4E6R A;  1UTI A;  3X20 B;  2RQW A;  2C06 A;  3UAT A;  2COZ A;  2J6F A;  2RI2 A;  2OTL T;  3E2U A;  1UJ0 A;  4D6W A;  2PTK A;  2DZ9 A;  4ZTF A;  1NE8 A;  3DKM A;  2K6D A;  2QTV A;  3M0U A;  2EFI A;  3QZ9 B;  4DEY A;  2GTO A;  5ECA A;  3RER A;  1QLY A;  2ROT A;  3FDR A;  5KYY B;  5GAO q;  4C5E A;  5M9O A;  4B9X A;  3M59 A;  1ZUU A;  3MO8 A;  1W6X A;  3VS1 A;  4J9I A;  4QQG A;  1M1K C;  2HL5 C;  3CCE A;  1SRM A;  1VQK T;  4RCB A;  1M1F A;  3CCL A;  5GAO p;  1VQO T;  1ABQ A;  3G71 T;  3RKW A;  1YIT A;  1K8A U;  5D6X A;  1M2O A;  4M77 F;  3RBB B;  4Z8A A;  4OB0 B;  2J6K A;  2KYB A;  4JZ4 A;  1JXO A;  3BDL A;  3ER0 A;  4XU3 A;  4LDX A;  3HP9 A;  1ZBX A;  1GCQ A;  2BZY A;  4QVD A;  1LCK A;  1SPK A;  3QXE B;  1ZUY A;  3CCR A;  2I0N A;  4DQ2 A;  3D7S B;  2D8J A;  2KY9 A;  2RMO A;  4ZGJ B;  1Q7Y R;  3TSZ A;  2CP2 A;  1ZQ1 A;  1MHN A;  4M78 B;  4ZN1 A;  5GAN 3;  3CMA A;  1VQ9 T;  4HVV A;  4HT9 A;  3HKS A;  4F16 A;  3H0I A;  2EQU A;  2NUP A;  3OSV A;  2PUK B;  4WCI A;  3PNW C;  4C8Q A;  2KXD A;  1WQW A;  1YCY A;  2CSI A;  4GLK A;  2JTE A;  2LQK A;  3LGL A;  1M8V A;  3OBY A;  2CH4 A;  4JDS A;  2DBM A;  2EJ9 A;  3G6E T;  4R55 A;  1VQ5 Q;  4FYV B;  3X25 B;  1VYU A;  2J06 A;  3OA6 A;  1OUL A;  2L5Q A;  3HRU A;  3P8B B;  4Y91 A;  2DL7 A;  1E6G A;  2BE7 D;  1K4U S;  2HQX A;  4ORZ A;  1MV3 A;  1QWE A;  2E6N A;  2LQ8 A;  5C6S A;  3VS0 A;  4X1V A;  2KE9 A;  5D6W A;  4J6X A;  4OMO A;  5LJ5 d;  2CP3 A;  4ELZ C;  2MPX C;  3A8G B;  1WHK A;  3PTA A;  2DL4 A;  3EG9 A;  1M30 A;  1CKB A;  4RTT A;  1K9M R;  3SFM A;  1I5O B;  1VYT A;  1N27 A;  4R0K A;  4MZT A;  1OV3 A;  1RL2 A;  3L2W A;  1RUW A;  1HXD A;  4OP0 A;  2R57 A;  2VC8 A;  1WX6 A;  2KNB B;  3CC2 A;  4HCC A;  4F7U F;  3IQL A;  3LLR A;  1ZSZ B;  3V7R A;  8AT1 B;  1VA7 A;  2XU8 A;  1RAE B;  2DIG A;  4LUE A;  3OYK A;  5GMK i;  1TU0 B;  4LUD A;  1YCS B;  3KFV A;  4J9G A;  1C1A A;  4J7F A;  3PIP A;  2OTJ A;  1G8X A;  4RTU A;  1G3S A;  3FEO A;  4M77 E;  1ZLM A;  5GAN g;  2FZG B;  2Y4X A;  1ABO A;  1K8A C;  2XMF A;  3QZ5 B;  3CCS A;  1I81 A;  2ATC B;  4C92 C;  2MWP A;  4N4I A;  2YUN A;  2VGN A;  4XK8 E;  4J83 A;  5GAN 8;  3CCE Q;  4AMC A;  3A1P A;  3CCL Q;  1Y57 A;  3DB4 A;  1AWO A;  4RTY A;  5CIU A;  3BE3 A;  5FLX E;  1YIT Q;  1OEB A;  4F04 B;  2M02 A;  2X3W D;  2IG0 A;  2ZPH B;  4ANJ A;  2KYM A;  3CPW P;  2PU9 B;  2QDL A;  3C0C A;  3CC7 T;  3CCR Q;  4ZN3 A;  3JCM h;  1TS9 A;  1Q81 R;  3INZ A;  2QEX A;  4JLG A;  3ULR B;  3CMA Q;  3EGU A;  1U8R A;  2XID A;  1JRI A;  1GRI A;  1QKW A;  1NEB A;  2MI6 A;  4HVW A;  5L23 A;  2R58 A;  1RI0 A;  5GMK e;  3UA6 A;  2C0O A;  2CT4 A;  3Q1J A;  2LJ0 A;  4PK4 A;  4PJO G;  3VUZ A;  2KK4 A;  4LD9 K;  4M77 C;  1XQH A;  2FEI A;  1QCN A;  2XDP A;  1IRE B;  2JJ9 A;  1JJ2 P;  1VQ8 A;  3EAE A;  2QXF A;  3UWN A;  1DJ7 B;  2RO0 A;  1SSF A;  2CP7 A;  1VQN A;  1UE9 A;  3CD6 T;  3RNJ A;  3JCM f;  1QVP A;  3MEA A;  2KT1 A;  4F7U E;  3C4S A;  4M7A F;  4JRP A;  3QWX X;  2EKH A;  1YJ9 T;  2H3E B;  2EJG A;  3H0F A;  2LNH B;  3BDU A;  3SHW A;  1VQL Q;  3JCM V;  4ZTJ A;  2YUQ A;  2D9T A;  4ZGE B;  2LC4 A;  5IN1 A;  2LCC A;  1TUD A;  3J7A F;  2LJ3 A;  4J9D A;  4F14 A;  1G2B A;  2J05 A;  3OYD A;  3CC2 Q;  3M4Y A;  2LTO A;  1MMA A;  2EYW A;  4FYW B;  1TG0 A;  4C0D B;  4JS4 A;  2E10 A;  4JPB W;  3JB9 J;  3CXC P;  2YDL A;  4Q5W A;  3OYN A;  1I4K 1;  3JCM b;  1M3B A;  1SF9 A;  2DET A;  2P0K A;  5KYW A;  3JB9 F;  3U23 A;  2FZK B;  2OTJ Q;  2X4X A;  2HQE A;  1VIE A;  3A8L B;  1NLP C;  4KUD K;  3OS2 A;  4J9H A;  5FU6 B;  1ZUK A;  3OYY A;  5FRN A;  1XTD A;  2CYZ B;  5C0M A;  3CCS Q;  1Y96 A;  4XU2 A;  3L2R A;  1WHL A;  2K7A A;  3LW5 E;  3EG0 A;  3DB3 A;  3MCA B;  4J9C A;  2K3X A;  2LQW A;  1YIT T;  3OMG A;  1Q82 U;  4BI4 A;  2OAW A;  3QO3 A;  4WTO B;  1IGU A;  3M9Q A;  3CPW A;  5HK0 A;  4BDY A;  1SRL A;  4M75 G;  2EVR A;  3VS7 A;  2JZ2 A;  5HKC A;  2CUD A;  3OYG A;  2GTJ A;  2DMO A;  4NL2 A;  5GAN 2;  1GBR A;  4HXJ A;  3A8O B;  2QEX Q;  1D09 B;  2RQU A;  1N5Z A;  3CCM A;  1MUZ A;  2QA4 T;  3CBP A;  3QUI A;  1Q7Y C;  1QQJ A;  1OQK A;  1JQQ A;  1WIE A;  2MIO A;  3OSS C;  1SKU B;  3H0H A;  4GLM A;  4MDW A;  3LWI A;  3QPH A;  3JCM Q;  3OW2 P;  2RN8 A;  3MP6 A;  4M77 A;  2QK0 A;  2E5K A;  1RAD B;  1LOJ A;  4M7A E;  4OVA A;  1I5L A;  2VXE A;  1IHW A;  1X27 A;  1JJ2 A;  1FXX A;  1M90 U;  2VXF A;  4B9W A;  2EYQ A;  2YRC A;  3EFS A;  1VQ8 Q;  4OGC A;  2KDS A;  1TOV A;  3CPF A;  5HK3 A;  2DXU A;  1S72 T;  3WVE B;  3X26 B;  1WXT A;  1VQN Q;  3C12 A;  2EIF A;  1KD1 R;  5GJW B;  1KC8 C;  2E3I A;  2CDT A;  5J39 A;  4CC4 B;  1K73 R;  3G4S A;  3ZBD A;  2ZPG B;  5DLO A;  1WHM A;  3R6O A;  4X34 A;  1WDX A;  1YJN A;  2K3Y A;  1M8M A;  2LX9 A;  5IXF A;  2E3H A;  1K9M C;  2P84 A;  2FL7 A;  2XG8 D;  2NUZ A;  2CZ7 B;  2GFU A;  5LJ5 f;  1M1K U;  3MP8 A;  1BK2 A;  1ZSZ C;  4M7A D;  3TQ7 P;  4FT2 A;  2ZPB B;  2K5L A;  1UGP B;  3HSB A;  3CBO A;  4KGV B;  4C0Z A;  3BFM A;  4QQD A;  5HY6 A;  3CPW S;  2OTJ T;  5GAN e;  1WXU A;  2RI3 A;  4J6Y A;  1OZ3 A;  4ME7 A;  1XOV A;  2DKG A;  1WJQ A;  1T0H A;  3CCS T;  5I2M A;  1M3C A;  2CKK A;  1RAG B;  1AHJ B;  2OI3 A;  2KXC A;  1QCO A;  2SEM A;  2PUO B;  4LDW A;  1AWX A;  2ZPI B;  3G7Z A;  1KQS P;  2MWO A;  3MKD A;  3OQ5 A;  3CCV A;  2VGM A;  3M5A A;  4OB3 B;  3I5R A;  4KGX B;  3JCM d;  1U3O A;  1AT1 B;  1KHC A;  5GAN j;  1LJO A;  1QVF P;  2P0P A;  4F7U A;  1AOJ A;  3JB9 D;  2A36 A;  3H9N A;  2NYS A;  4N0A A;  1O75 A;  3MET A;  2DRK A;  2X9H A;  1RAF B;  1W2B S;  1K1Z A;  4NL3 A;  3EGD B;  1BBZ A;  3M54 A;  1VQM Q;  3CCU A;  4A4K A;  1J3T A;  1D1C A;  1NZ9 A;  2DEU A;  1G5V A;  1LPL A;  2HZY A;  4C8Q G;  2W0Z A;  1YN8 A;  2JMC A;  5FRO A;  2OJ2 A;  2RHZ A;  2NUT A;  3CCM Q;  3RUX A;  1Q81 C;  1M4Z A;  2XIC A;  5LJ3 e;  4BD3 A;  2EWN A;  4C92 F;  4QVC A;  2F5T X;  4JUV A;  3A8M B;  3I5S A;  5CKE A;  5KYU A;  1YHQ A;  2LQN A;  2ED0 A;  3C95 A;  3PVQ A;  3LH0 A;  1VQP A;  4Y28 E;  3QG1 A;  2FG0 A;  1OX8 A;  2DD5 A;  4DBQ A;  4A4H A;  3RES A;  1B07 A;  5GAN h;  1UB4 A;  2RHX A;  2E1H A;  3FJ5 A;  5LJ3 j;  3NTH A;  2MOX A;  2CRE A;  5I11 A;  2RJD A;  4EMK C;  3ASK A;  4FCY A;  1AWJ A;  3HFN A;  5KE3 A;  2KI7 A;  2JS0 A;  5GMK m;  1K9A A;  2A28 A;  3QJY A;  3QII A;  1D0X A;  3NHN A;  1YBY A;  3G4S Q;  4BB7 A;  4OMN A;  3QKJ A;  2W10 A;  1KFZ A;  4XTU A;  1QVG P;  4Z02 A;  2JMA A;  3A8H B;  3NMZ C;  1KQ1 A;  1YJN Q;  4M75 B;  4N4G A;  2XD0 A;  4FW2 A;  4OF1 A;  1UFF A;  3FC3 A;  3HRS A;  2AZV A;  4XU1 A;  3OYF A;  2XI9 A;  3CCJ A;  1VQ4 T;  1XNI A;  1IRX A;  1HJD A;  4FSS A;  3A5Z B;  4QQ6 A;  2KRO A;  2BZ8 A;  2HEQ A;  3RDV A;  1ZA2 B;  3P8D A;  1UUE A;  5GAM e;  4M7D F;  1Z9Q A;  4HVU A;  2YWW A;  4F7U B;  4M7A A;  3O5Z A;  3QYH B;  2HSP A;  1R77 A;  3OS5 A;  4PFO A;  1ZHI A;  2EQI A;  1KQS A;  2O4X B;  2NWM A;  2QAZ A;  5FU6 C;  4FT4 A;  1RAI B;  1N8R R;  1K0S A;  1BI1 A;  5GAM j;  2CZ1 B;  1QVF A;  3CCV Q;  1QP2 A;  3TU4 K;  2HBW A;  1Y71 A;  4J9F A;  2JNG A;  2YLB A;  4BDZ A;  2K2M A;  3THK A;  4HCK A;  1RLP C;  1GCP A;  2FPF A;  2K9G A;  1RAA B;  3L2Q A;  1M2V A;  1PKT A;  4C92 E;  2J6O A;  1PSE A;  1HSQ A;  2VUB A;  1UHC A;  4LE9 A;  4GBQ A;  2RHU A;  3EGX A;  2LZ6 B;  4GY5 A;  4QVZ A;  5KYX A;  3CCU Q;  4RUG A;  3CCM T;  1YWP A;  3TSW A;  4RKU E;  1YI2 T;  4LN2 A;  3M0S A;  1VYV A;  2A7Y A;  5I2S A;  3I55 A;  3C94 A;  1BKB A;  4HT8 A;  1VQL A;  1MMN A;  1T3S A;  2DZC A;  2CH4 W;  2ABL A;  3HFO A;  2ZCF B;  3I56 A;  1YHQ Q;  3GNF B;  2DFU A;  2RF0 A;  3S3M A;  1Y0M A;  3ZEH A;  1E6H A;  2KRN A;  2M0O A;  4BAC A;  1VQP Q;  1X6B A;  2JXB A;  1ZSG A;  1VIF A;  2DTI A;  3QBY A;  4PJO E;  2EW3 A;  1BYM A;  4MDX A;  4E7L A;  1X01 A;  2P4T A;  1XJW B;  4C92 D;  3CME A;  1FMV A;  3FRN A;  2FHD A;  1BB9 A;  3CCQ A;  4M78 F;  1NPR A;  1KK7 A;  1V29 B;  1TXQ A;  4J6W A;  4AG1 C;  1KQ2 A;  4HKE A;  3G4S T;  3H8Z A;  1KG1 A;  1WZO A;  2XHC A;  2KVQ G;  2D1X A;  1YNZ A;  2KMT A;  1KD1 C;  3QDR B;  1QVG A;  1W1F A;  4PKC C;  1YJN T;  2JTM A;  4BE1 A;  1KQS S;  4M7D E;  1NJI R;  2LDM A;  2HQH A;  1VQ6 A;  2I2L A;  3RR6 A;  5AYF A;  1U5S A;  1P92 A;  3VV0 A;  1YFN A;  2NUP B;  3NPF A;  4C8Q B;  1GL5 A;  3CCJ Q;  4L6V 5;  2DER A;  4PJJ A;  4FSX A;  3REB B;  4RG8 A;  1B3Q A;  4DBR A;  1K0X A;  2QQA A;  5GAO n; 
#chains in the Genus database with same CATH homology
 2WAC A;  4C5I A;  1Q82 C;  4M7A C;  3CEY A;  4XAX B;  2LT4 A;  1VQ7 T;  1Q82 U;  4PJO B;  4VUB A;  4JRK A;  4V2S A;  4BI4 A;  3X28 B;  3HL8 A;  3QO3 A;  4A54 A;  2E65 A;  4N4H A;  3S3O A;  3M9Q A;  1LNX A;  3SWN C;  3GP8 A;  3CPW A;  5KH6 A;  4J5Y A;  5HK0 A;  4KUL A;  3DLM A;  4BDY A;  2M16 A;  3V8K A;  1YJW A;  1M1G A;  2QQB A;  4M75 G;  3VYG A;  2E41 A;  1U1S A;  3OBW A;  4M77 D;  3TEE A;  2JZ2 A;  5L8R E;  3OW2 S;  1VQ5 A;  3CBM A;  1G3T A;  5HKC A;  4PJO C;  4A4F A;  1N9R A;  4PLI A;  2QA4 A;  2ZPE B;  3OYG A;  2DK3 A;  4NL2 A;  1N9S A;  5CCA A;  2RI5 A;  3E1S A;  5GAN 2;  2DEQ A;  1BI3 A;  2K57 A;  1VUB A;  3M55 A;  1VQM T;  3A8O B;  1VQ5 T;  2O4X A;  2O01 E;  5LJ3 g;  1JBM A;  2LVM A;  2DD4 A;  1HK9 A;  2E6Z A;  3CCM A;  4C5H A;  2QA4 T;  3CBP A;  3M57 A;  3QUI A;  1Q7Y C;  2DPP B;  1Q7Y U;  2BKD N;  1H3Z A;  2M1H A;  3M4G A;  1WPY A;  3WVD B;  4BY6 C;  1UEB A;  3OSS C;  5FU7 B;  3OY9 A;  3LYI A;  1YIJ A;  2L3R A;  1G3W A;  3VKI A;  2KQW A;  4M7D B;  3FIF A;  4KT0 E;  3JCM P;  3TRE A;  1O9S A;  5CR2 A;  4E7K A;  2MAM A;  3FJP A;  2V8J A;  3UT1 A;  4MDW A;  5GAO m;  3LWI A;  2K5F A;  1PSF A;  5LJ3 f;  3FB9 A;  1YIJ T;  3KBG A;  3QPH A;  3WXM B;  4A4G A;  4JS5 A;  2B8A A;  1MGQ A;  3JCM Q;  5GMK j;  3SB2 A;  2MF2 A;  4XTW A;  2CZ0 B;  2PVD B;  3MP6 A;  4M77 A;  2XKO C;  3V7C A;  1B34 B;  5FU7 C;  1LOJ A;  4M7D C;  3URG A;  1G3Y A;  2LT1 A;  4OVA A;  1I5L A;  4M7A E;  2VXE A;  2HBP A;  5A0G A;  2YRV A;  2DXC A;  3QSU A;  1JJ2 A;  2G3R A;  3OYL A;  2DVE A;  1M90 C;  4A4E A;  1FXX A;  5CK9 A;  4BE2 A;  1M90 U;  2VXF A;  2L89 A;  2DJZ A;  4B9W A;  1S72 A;  4C0G A;  4M75 F;  2EYQ A;  2X35 A;  3EFS A;  1R8O B;  2QQR A;  3JSC A;  5CKF A;  3JCM e;  2XDB A;  4QW2 A;  4E7H A;  3H6Z A;  4OGC A;  2KDS A;  4XQ3 A;  5GAM h;  2OTL A;  2DXB A;  1YHQ T;  1X6O A;  3JAM E;  4XTZ A;  3NTK A;  3CPF A;  5HK3 A;  3X20 B;  2DXU A;  1S72 T;  2C06 A;  3WVE B;  3X26 B;  1IZ6 A;  4EMK A;  3JCM W;  2V8I A;  2RI2 A;  1W4S A;  3C12 A;  2OTL T;  2EIF A;  1KC8 C;  1KC8 U;  4M78 E;  4D6W A;  4FL6 A;  2DZ9 A;  4ZTF A;  1NE8 A;  5J39 A;  3JCM X;  3J81 E;  3M58 A;  3DKM A;  4HCB A;  3QJ6 A;  3G4S A;  3ZBD A;  2EFI A;  3QZ9 B;  4A53 A;  2ZPG B;  5DLO A;  2F5K A;  4C5G A;  3RER A;  3R6O A;  4X34 A;  4IUU A;  2GCX A;  1YJN A;  2K3Y A;  3X24 B;  2LX9 A;  3FDR A;  3MEW A;  4IUP A;  5GAO q;  1K9M C;  4C5E A;  5M9O A;  4B9X A;  2FL7 A;  2EQM A;  2XG8 D;  3M59 A;  5DY9 A;  3RMS A;  1I8F A;  3MO8 A;  5GAN 7;  1K9M U;  3VJP A;  4QQG A;  1M1K C;  1VQO A;  2CZ7 B;  2GFU A;  2WSC E;  5LJ5 f;  3MP8 A;  3CCE A;  1M1K U;  1VQK T;  5GAM g;  4RCB A;  4M7A D;  1M1F A;  3QHS A;  4FT2 A;  3G71 A;  2ZPB B;  2K5L A;  5GMK h;  5GAO p;  1K73 C;  1UGP B;  3CCL A;  3HSB A;  3CBO A;  3KUF A;  5CQX A;  3ME9 A;  4C0Z A;  4ELY C;  3BFM A;  4QQD A;  4C92 A;  1VQO T;  2DO3 A;  3GLX A;  2LCL A;  5HY6 A;  4XTV A;  4FM4 B;  4M7A B;  4X9D A;  5LJ5 e;  5D6Y A;  2K5I A;  3CCE T;  4II1 A;  4ZGD B;  1QVF S;  3G71 T;  3RKW A;  3CPW S;  3O8V A;  3CCL T;  2OTJ T;  2V8K A;  5GAN e;  1YIT A;  1K8A U;  2E12 A;  1BI2 A;  2RI3 A;  4J6Y A;  5D6X A;  4M77 F;  1OZ3 A;  4ME7 A;  1D3B A;  1XOV A;  4OB0 B;  1VQ7 A;  5GAM f;  4JRQ A;  2CS7 A;  4PJO D;  2DKG A;  2IVW A;  1WJQ A;  2RHI A;  3BDL A;  2DTO A;  3ER0 A;  5KE2 A;  4XU3 A;  4LDX A;  3HP9 A;  1UGR B;  5I2M A;  3CCS T;  1ZBX A;  2CKK A;  2VV5 A;  1M5Q 1;  4QVD A;  1AHJ B;  3QXE B;  3CCR A;  4M75 C;  4C92 G;  4DQ2 A;  3CCJ T;  2PUO B;  3OMC A;  2KY9 A;  4LDV A;  2JOY A;  4ZGJ B;  4LDW A;  4JJN K;  1ZQ1 A;  2ZPI B;  3G7Z A;  3GIB A;  2MWO A;  2VYT A;  1MHN A;  1JB0 E;  1OZ2 A;  2RH2 A;  3OQ5 A;  4M78 B;  4ZN1 A;  5GAN 3;  2EKO A;  3CMA A;  2EJF A;  2FB7 A;  3CCR T;  2VGM A;  3CCV A;  1Y7X A;  3M5A A;  4OB3 B;  3JCM d;  4JRI A;  5GAN 5;  1KHC A;  5GAN j;  1VQM A;  2PQW A;  4HT9 A;  3HKS A;  5GAN 6;  4BY6 B;  2HD0 A;  1LJO A;  2EQU A;  5J26 A;  1FX7 A;  2P0P A;  3OSV A;  4F7U A;  3CCV T;  2PUK B;  5DLQ E;  3SWN A;  3JB9 D;  3PNW C;  4EMG A;  3PFS A;  4MMK A;  4C8Q A;  1WQW A;  1YCY A;  3G6E A;  4GLK A;  4N0A A;  3OYA A;  1O75 A;  3MET A;  3UDC A;  4M78 C;  2LQK A;  3LGL A;  4HA8 A;  1W2B S;  1M8V A;  3OBY A;  4JDS A;  4NL3 A;  4PJO A;  3ZFJ A;  4M7D D;  2EJ9 A;  3G6E T;  3GF5 A;  3M54 A;  4R55 A;  3CCU A;  4A4K A;  3X25 B;  1X75 C;  1NZ9 A;  1G5V A;  3OA6 A;  4XTX A;  4F7U G;  2L5Q A;  3HRU A;  4L5G A;  3HPW A;  3P8B B;  5IAY A;  4Y91 A;  4C8Q G;  3OYC A;  4MZP A;  5IT9 E;  4E7I A;  5FRO A;  3CCU T;  2GF7 A;  2RHZ A;  3J80 E;  2HQX A;  3VUB A;  3RUX A;  4BUG A;  1Q81 C;  1N8R U;  1M4Z A;  3OYI A;  1Q81 U;  2XIC A;  4CI0 C;  3LX7 A;  2E6N A;  2OAU A;  2LQ8 A;  4LDY A;  5C6S A;  4BD3 A;  2EWN A;  5LJ3 e;  4C92 F;  5KCH A;  4M75 E;  4QVC A;  2F5T X;  2X4J A;  2JVV A;  4IUV A;  5GAN 4;  5D6W A;  4J6X A;  3QYG B;  1U1T A;  3A8M B;  2YLC A;  4JUV A;  5CKE A;  5CAI A;  5LJ5 d;  1YHQ A;  4ELZ C;  1GXI E;  1BIA A;  3A8G B;  3PTA A;  1OYX A;  4M7D A;  5GAN d;  4EMK B;  3C95 A;  5A2Q E;  4EMH A;  3OS0 A;  3LH0 A;  2PVO B;  4Y28 E;  1VQP A;  3QG1 A;  2EQK A;  4M77 G;  2DD5 A;  2L8D A;  4A4H A;  3SFM A;  5KCO A;  4L59 A;  3RES A;  5GAN h;  1UB4 A;  1N27 A;  2EQJ A;  2E1H A;  2RHX A;  5GAO l;  1VQP T;  2RJF A;  4J8O A;  1BIB A;  4MZT A;  3RMQ A;  5GAO r;  1RL2 A;  5LJ3 j;  3NTH A;  3L2W A;  4DA4 A;  1VQL T;  1B34 A;  1WJS A;  1QVG S;  3UPU A;  4FU6 A;  2RJD A;  4EMK C;  1HXD A;  3ASK A;  2RA2 A;  4LD6 A;  3HFN A;  4OP0 A;  5KE3 A;  2R57 A;  2LNV A;  4M7D G;  1TH7 A;  3PGG A;  1Y07 A;  5GMK m;  2VC8 A;  3CC2 A;  1VQ9 T;  2E70 A;  4RMO A;  4HCC A;  4XU0 A;  4F7U F;  3LLR A;  3V7R A;  2XK0 A;  4C8Q F;  2R5M A;  5I21 A;  3CC4 T;  2XU8 A;  2RM4 A;  2DIG A;  2BIV A;  3JRZ A;  3QII A;  3QJY A;  3CC2 T;  3OYK A;  5GMK i;  1VQK A;  2BUD A;  2FVU A;  3N5B B;  4KBM B;  4J7F A;  2RB6 A;  3MHX A;  2D0Q B;  3GOX A;  3KXT A;  1YBY A;  3CXC A;  4BB7 A;  2WSE E;  4EDU A;  3PIP A;  3QKJ A;  2P0Q A;  2OTJ A;  4M75 D;  5FRM A;  4XTU A;  4PLL A;  1G3S A;  3FEO A;  1Y96 B;  3BY7 A;  4M77 E;  4Z02 A;  3A8H B;  1KQ1 A;  1D3B B;  5GAN g;  2QI2 A;  4M75 B;  4N4G A;  4OMF B;  1VQ4 A;  2Y4X A;  2WSF E;  1K8A C;  2XD0 A;  4XTY A;  4PL6 A;  2GFA A;  2JUF A;  1NPP A;  3QZ5 B;  4OF1 A;  3CCS A;  3FC3 A;  3HRS A;  3LGF A;  5GMK l;  1I81 A;  4XU1 A;  4C92 C;  4RG2 A;  3OYF A;  2MWP A;  4N4I A;  3L2U A;  2JTF A;  2VGN A;  4XK8 E;  3HHT B;  4J83 A;  2XI9 A;  4E47 A;  5GAN 8;  3CCJ A;  2DIQ A;  1XNI A;  3SDZ A;  1VQ4 T;  4OB1 B;  4C0F A;  3A5Z B;  5LJ3 d;  4QQ6 A;  3OYH A;  3DB4 A;  3P8D A;  1UGQ B;  1VQ9 A;  3OB9 A;  3GPL A;  5GAM e;  4BI3 A;  4M78 D;  5CIU A;  4FIB A;  3PT9 A;  4M7D F;  5J3B A;  3E9G A;  5FLX E;  1WNL A;  2QQ9 A;  3JB9 H;  5LJ5 j;  3RKX A;  4F7U B;  3LWH A;  3VU3 C;  3CC7 A;  2D6F A;  2E64 A;  4M7A A;  3QYH B;  3JB9 I;  2IG0 A;  2ZPH B;  3OS5 A;  3RKY A;  3MEV A;  1ZHI A;  5A0D A;  1M9S A;  2O4X B;  1KQS A;  3V8J A;  2PU9 B;  2HNI A;  3CC7 T;  5FU6 C;  4EPC A;  4IKF A;  2MMP A;  3JCM h;  4ZN3 A;  4FT4 A;  1NJI C;  1NJI U;  1BI1 A;  3INZ A;  2QEX A;  4JLG A;  4CRI A;  5GAM j;  2CZ1 B;  1WGS A;  3MP1 A;  1QVF A;  3HRT A;  2LRQ A;  2RD1 A;  4C8Q C;  1QP2 A;  3OYB A;  4M7A G;  1U8R A;  2XID A;  3TU4 K;  1JRI A;  4N0A C;  1FWZ A;  1Y71 A;  2YLB A;  2JNG A;  3MEU A;  2QEX T;  4BDZ A;  2A3L A;  3NFC A;  1JJ2 S;  2PVG B;  3L2Z A;  4BI8 B;  4P5N A;  4M78 A;  3OYM A;  2MI6 A;  2M9U A;  1BI0 A;  2R58 A;  2RJC A;  4UC4 A;  1H64 1;  1RI0 A;  4M77 B;  2GQV A;  3S6W A;  5GMK e;  3OYJ A;  3L2Q A;  1YJW T;  3V8L A;  4C92 E;  2QDY B;  2RJE A;  3Q1J A;  1N8R C;  3P8H A;  1PSE A;  4RCC A;  4PJO G;  3AHU A;  3VUZ A;  2VUB A;  3VYH B;  1Q86 C;  1Q86 U;  4DOW A;  2KK4 A;  2RHU A;  4ATO A;  3FLG A;  4GY5 A;  4QVZ A;  3RIR A;  4LD9 K;  1YI2 A;  2EAY A;  2HAX A;  4DOV A;  4M78 G;  3OW2 A;  3CCM T;  4M77 C;  2RK2 A;  2R5A A;  2JN0 A;  3GNG A;  4RKU E;  4TVR A;  1XQH A;  4WF2 A;  3JCM g;  1YI2 T;  2F69 A;  2A7Y A;  5I2S A;  5CVI A;  1OI1 A;  2XDP A;  3CD6 A;  1IRE B;  3I55 A;  3OYE A;  1VQ8 A;  3EAE A;  3C94 A;  1BKB A;  2QXF A;  4JLI A;  1W2B A;  5LJ5 h;  4J7I A;  2QQS A;  1VQL A;  3JCM c;  3UWN A;  4HT8 A;  1DJ7 B;  4IUQ A;  2RO0 A;  2DZC A;  4NOY A;  1SSF A;  2CGH A;  3TCJ A;  2E5Q A;  3NTI A;  3JB9 G;  1VQN A;  3I55 T;  1VQ8 T;  3CD6 T;  2AHJ B;  3HFO A;  3SD4 A;  1YJ9 A;  2ZCF B;  3JCM f;  5GAM d;  1QVP A;  5DM7 R;  3I56 A;  3GNF B;  3MEA A;  3BW1 A;  3CMA T;  4F7U E;  2YHT A;  3M56 A;  3S3M A;  3C4S A;  4M7A F;  4JRP A;  3PMI A;  4C8Q E;  3CXC S;  2KSS A;  3ZEH A;  3CC4 A;  1VQN T;  2CZ6 B;  2M0O A;  4OB2 B;  1YJ9 T;  2EJG A;  2Y4Y A;  2RHY A;  2ZPF B;  4X9C A;  4BAC A;  3I56 T;  2X4Y A;  4PNO A;  3BDU A;  4IUR A;  4MML A;  1QW1 A;  1VIF A;  2DTI A;  3QBY A;  4R56 A;  4PJO E;  3JCM V;  2K2V A;  1BYM A;  3F70 A;  5CO7 A;  5CQY A;  2FYK A;  4MDX A;  4ZTJ A;  2D9T A;  2H3J A;  2RK1 A;  4ZGE B;  2LC4 A;  4E7L A;  4OGE A;  5IN1 A;  1X01 A;  2K4Y A;  2LCC A;  2P4T A;  4PJO F;  4C92 D;  3L1A A;  4NS5 A;  2NLU A;  3CME A;  3FRN A;  3J7A F;  5CKB A;  1WQ7 A;  2FHD A;  3S3N A;  5CKH A;  4C92 B;  4IUT A;  2KAF A;  3OYD A;  3CCQ A;  3M4Y A;  2LTO A;  4M78 F;  3CME T;  3PMT A;  5LJ5 g;  3JCM J;  2DAQ A;  4BE0 A;  1NPR A;  3T9N A;  4C0D B;  2ZGW A;  4JS4 A;  1V29 B;  3E19 A;  4J6W A;  2XDD A;  2E10 A;  5LL6 S;  3JB9 J;  1N6A A;  2QTX A;  3CCQ T;  1KQ2 A;  1EIF A;  4HKE A;  3G4S T;  3H8Z A;  4Q5W A;  4KUI A;  1KG1 A;  4MZM A;  3OYN A;  4YTL A;  2XHC A;  1I4K 1;  4HCZ A;  2KVQ G;  1KHI A;  2KMT A;  3JCM b;  3QDR B;  3L42 A;  1QVG A;  1KD1 C;  4PKC C;  1KD1 U;  1YJN T;  2JTM A;  2P0K A;  3JB9 F;  3L2V A;  3OS1 A;  4BE1 A;  1KQS S;  4M7D E;  3V7S A;  4C0D C;  1QP3 A;  4LDU A;  2LDM A;  3EFR A;  5GAN f;  3E9F A;  2X4X A;  1K73 U;  2HQE A;  1VIE A;  3A8L B;  5CKD A;  1VQ6 A;  1UGS B;  2I2L A;  2DXT A;  4KUD K;  3OS2 A;  5FU6 B;  2X4W A;  3OYY A;  2ZZD A;  4O5V A;  5AYF A;  5FRN A;  4C8Q D;  1XTD A;  1P92 A;  4O6J A;  5LJ3 h;  2CYZ B;  3VV0 A;  5C0M A;  4E7J A;  2Y90 A;  3DLL A;  3M53 A;  1Y96 A;  4XU2 A;  3L2R A;  3LW5 E;  1VQ6 T;  3SWN B;  5A0L A;  3DB3 A;  4C8Q B;  4M75 A;  4L6V 5;  3MCA B;  1WJR A;  4FSX A;  3PIO A;  2K3X A;  4RG8 A;  5EG2 A;  1YIT T;  2DTH A;  2QQA A;  5GAO n;  3OMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...