3LWHA

Crystal structure of cren7-dsdna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwhA00
4R56A 2JTMA 3LWIA 3KXTA 4R55A 3LWHA
chains in the Genus database with same CATH superfamily
3JCMb 2KE9A 1RABB 5M9OA 1TUCA 2EYQA 2V8IA 4OMPA 2XDDA 5HK3A 1PRMC 1AZEA 4Z88A 1VIEA 3OYJA 1VQMT 1VQ5T 4JS5A 3CCJT 1NBEB 1VQLA 4XU2A 3MCAB 2L3RA 4XTUA 1OOTA 1VQ6A 4OMFB 1VQLQ 1SHFA 1K73R 2OAUA 1WHLA 2RB6A 3EGDA 3OYLA 2EJ9A 2JS0A 3LWHA 1LPLA 5IXBA 4PFOA 5FRNA 1X27A 2ZAEA 1T3LA 1GFDA 3LH5A 2A0FB 2CUDA 3QWYA 1KD1C 2LRQA 4LUDA 4D8DA 1VQOT 1KHIA 3VU3C 1UHFA 2DM1A 2KSSA 4BDYA 1UEBA 1W2BP 2HNIA 2CSQA 4AFZC 2AT1B 2PNIA 5C6SA 1M3CA 4AFSC 3BDUA 1G2BA 2F2XA 1RL2A 2CH4A 3RMQA 3VS7A 1D1CA 2BZ8A 1YHQT 9ATCB 3MKDA 4X1VA 5CKBA 5GAOq 5HKCA 3PIOA 1M90R 2QGFB 4HCZA 1N6AA 1VQNQ 3VYHB 2K3BA 1YITA 1LOJA 1E6GA 4M7AG 2NLUA 4XTWA 5CK9A 2JXBA 1IHWA 2V1QA 1VQ9Q 1JBMA 2QDLA 4FCYA 2JS2A 4OMLA 1ZBXA 4XAXB 1OV3A 3CCEA 3UATA 1I5LA 2XU8A 2DBMA 1S72T 1VQOA 2YLBA 6AT1B 3LLRA 3CCVA 2VB6A 4QVDA 3CCLQ 1VQMA 2P0QA 3RKYA 3M54A 3QJ6A 4DBQA 1NEBA 2QQRA 1MNDA 3NHNA 5GANg 2RHIA 3J81E 2L3PA 1O9SA 1ZSZB 4KRTA 1S72A 2K2VA 7AT1B 3WVEB 3CBOA 4NS5A 2ZPBB 3O8VA 2RJFA 2L5QA 1NYGA 1BIBA 2KR3A 2YRDA 2GQVA 2L8DA 3RKWA 2AZVA 4M78F 3GLXA 3BFMA 2GCXA 5LJ5h 4M78E 3PTAA 3QIIA 1W70A 1VQ4A 2BUDA 5GAN5 2HSEB 3CC7Q 2K6DA 3HL8A 1Y57A 1QP3A 2P4TA 3JCMP 2MK5A 1YIJQ 4MZTA 4C8QA 4OB3B 5AT1B 3EFOA 1KD1R 2QAZA 2JTEA 2JZ2A 3G71Q 1RADB 4EMKC 1BI3A 4HCBA 5GAN8 1FX7A 3OYDA 1QKWA 3E1SA 2GFUA 4RCCA 1PKSA 1NG2A 3M56A 4C8QE 3EGXB 1UGPB 3META 1D0ZA 2DKGA 4FM4B 5I22A 3CMAT 2HBWA 2FVUA 1YN8A 1VQPQ 1O75A 4D6WA 4DEYA 4XTYA 3QZ5B 2DXCA 2DJQA 2YWWA 5GANh 2DIQA 1ZUUA 3OB9A 3JRZA 4J5YA 2E1HA 2NYSA 1M90C 4KBMB 3CMAA 1Y07A 5LJ3g 4R55A 4GY5A 2DVJA 3PE0A 4WTOB 1Q81R 3L2UA 4F7UE 3RBBB 2F2VA 3CCMQ 4AFUC 5FRMA 1YJWT 2FPDA 2E5QA 5FU7B 1IGQA 4IIOA 3THKA 3QDFA 3VS2A 1H3ZA 3JCMg 1EIFA 2EQKA 4F7UG 2M02A 3CPWP 1JRIA 1M4ZA 4JRKA 1BCMA 1K9MR 4C8QC 4PJMA 1IB8A 1PG5B 1GRIA 3CQTA 5D6XA 4DBHA 3L2ZA 2A28A 1QVGP 2JT4A 2KMTA 2VXEA 3WXMB 1M2VA 1PKTA 2C0TA 3M0PA 1VQ5Q 1NJIR 1WZOA 3CMEA 2A36A 2HKQB 3JCMc 1RAAB 4DQ2A 4ZTJA 4BI4A 1BKBA 3MO8A 4M78C 1VQ4Q 3ZBDA 2ROLA 4C92G 3A8OB 3I56Q 5FU6B 2OJ2A 5GAMg 1XTDA 3MEAA 1GL5A 3MP1A 2RI3A 2WSCE 3NTKA 4QT7A 4ZTFA 1N8RR 2KRMA 2LT1A 2OX7A 5KYWA 1TXQA 2DO3A 4LUEA 2MI6A 4JUVA 2YSQA 4QQDA 1M3AA 1QP2A 1Q82C 3OBYA 4M77E 1QQJA 1RLPC 2ABLA 2AKKA 1AEYA 1R8OB 2NUPB 1KG1A 3RKXA 2V1RA 3D7SB 2RI5A 1FXXA 4E7KA 4M75D 3ER0A 1X2QA 4N4GA 5GANe 5GANj 2EKHA 1M9SA 3X28B 2DYIA 3RR6A 3M4YA 4QQ6A 2CKKA 1G83A 3EFOB 2BIVA 1OYXA 3NTHA 3OS1A 1D1AA 2GTJA 4QVZA 4C5IA 2COZA 1X2KA 2XHCA 3JSCA 3OSSC 2K79A 4DOVA 3EG2A 5GAMf 1WHGA 4JRIA 2L3QA 3DB3A 3M0RA 5ECAA 2OAWA 3A8MB 1U1SA 2QA4Q 1XNIA 1YJNA 2EYXA 4J9DA 4LD6A 1H641 5LJ3d 1NPPA 1QCOA 2BZXA 1HJDA 1OX8A 2QGGA 4C92C 3OMCA 4L6V5 1K73U 3EAEA 5LL6S 4M7AF 3I55Q 1UB4A 2QQ9A 2XI9A 5CO7A 1PSFA 3OYFA 1PHTA 4L5GA 2DXTA 2BZYA 1UG1A 4C0FA 4ESRA 5CQXA 3G6EQ 3CCSA 1IXDA 3EH2A 4M7DA 3TSZA 3HFNA 2QXFA 5CKHA 5FWBA 2CGHA 3G71A 4C8QB 4HA8A 3CPFA 2ZCFB 1VQ7Q 5A0DA 4NL2A 2E3IA 1KQSS 1TU0B 4JZ3A 5GAN6 1VQ8A 2K57A 1SSHA 2I0NA 1G3TA 4A54A 2PVGB 4J9BA 3JAME 1MMNA 5GANf 4KGZB 2DL3A 2CP7A 2CS7A 2COYA 2MWPA 1MMGA 1RUWA 2RQUA 3M0TA 5A0GA 4J6YA 2OTJA 1AT1B 1H8KA 1MNEA 4JS4A 3ZL7C 1OEBA 3CC7A 3PMIA 2MYSA 3G6ET 2FYKA 1IHVA 4X34A 1YWOA 1M90U 1NJIU 3JCMX 4LDXA 3JCMe 2IVWA 1UE9A 1Q86U 3HPWA 1XJWB 1YCSB 2A3LA 1ABQA 2VWFA 2H3JA 1ACMB 3ASKA 4AG2C 3VS5A 1BI0A 2LTOA 2CP3A 4M7AA 2E10A 4A53A 4EIKA 3EG3A 3M0UA 1NYFA 4FYVB 5LJ3h 5FU7C 5IHIA 2C0IA 3L2RA 1KQSA 2O9VA 4M7AE 4ZGJB 3OYHA 2HEQA 4E7ZA 3V8KA 1Y96B 1KFZA 1RACB 1G3WA 3VRZA 2DFUA 3RDVA 1N27A 1K76A 5KYXA 3QG1A 1J3TA 1DJ7B 2ZPHB 3C94A 4P5NA 1ZA2B 2AZSA 3Q1JA 4Y28E 2OTLQ 1BBZA 1MGQA 3JB9D 4GBQA 3RIRA 1SKUB 3CCLT 2DL7A 2DTOA 2KNBB 4ZGDB 2ECZA 4WF2A 3FJ5A 4QW2A 1ZHIA 4M77G 2KRNA 4E7SA 3EHQA 4FT4A 4FIBA 2R5MA 3OA6A 1KC8R 2RHYA 4PL6A 2E6ZA 3PMTA 4M75F 2AKLA 5AYFA 3A8HB 1K73C 2QYZA 3PVQA 1SHGA 4C0DB 2JW4A 3L42A 1BCOA 4OVAA 3CCRA 2WSEE 4LD9K 1FYNA 4OP0A 1WHJA 2ZPIB 3G6EA 5GMKl 1WQ7A 3QYGB 4PJLA 2DBKA 2L0AA 3GIBA 1X69A 2P0KA 2XDPA 1YHQQ 3M53A 1TUDA 4JZ4A 1K8AU 3MEVA 2IG0A 4BE0A 5LJ3f 2KXDA 4Z8AA 4X9DA 1B34B 1PWTA 4GLKA 1UTIA 5HCKA 4HVWA 5GAOl 4MDXA 5GAMj 4N4HA 2X35A 2RA2A 1LCKA 2LT4A 3E19A 1OQKA 3PT9A 4F04B 5CKFA 3LWIA 4JJNK 1LVKA 4XTXA 1RAHB 3VS3A 3CEYA 3CMET 4C5HA 2K3XA 3M59A 1UHCA 2AHJB 5J39A 1TS9A 2JN0A 1N5ZA 5FROA 3BY7A 3TQ7P 2HQXA 2LQ8A 1XQHA 1PC0A 8ATCB 1VQKA 4LDWA 1W6XA 2DZ9A 2EQUA 1KQ2A 4RTUA 2K4YA 3M57A 2KYBA 2RN8A 3LGLA 2IPOB 3CC2A 2ESWA 4O6JA 4RTVA 3VUZA 4JRQA 1Z9QA 4ELZC 3KFVA 3CCJQ 4C5GA 2P0PA 1UFFA 3QDRB 3OSVA 2LNVA 2MIOA 4BUGA 4XU0A 2O88A 1FMVA 2EWNA 2JM9A 3BW1A 4RKUE 5EC7A 2HL5C 4F7UA 3H8ZA 2CP2A 5IT9E 1U06A 2GFAA 1WXUA 2YRVA 4RUGA 2NUTA 1R0BG 2DXBA 4A4KA 2DLPA 1M1KR 1WYXA 2CSIA 3OQ5A 4M78G 1U8RA 3ME9A 2FHDA 2GBQA 2V26A 4KT0E 4M75E 1WHKA 1MUZA 1YITT 2RMOA 1TTHB 1GFCA 1WGSA 4PJOD 3NFCA 2PZ1A 3E9GA 2QK0A 2EJGA 3CBMA 2I2LA 2QTVA 5IN1A 5D6YA 2HSPA 2EQMA 2CREA 4PJJA 1M8VA 3SEMA 5IHKA 4OF1A 4KGVB 1IZ6A 3U23A 3VKIA 4E6RA 2BE9B 2FB7A 2NWMA 2K9GA 3CCMA 2VGMA 2D6FA 3L2WA 1P92A 3UWNA 2BTTA 2CUBA 2K5FA 1QWEA 3P8BB 2MPXC 3GP8A 3RERA 1X75C 1WHMA 2F1LA 4J9FA 2BE7D 5I2SA 5I21A 4J9CA 2VGNA 1ABOA 4M7AD 1WJSA 3C4SA 4LDUA 1V76A 2LDMA 5CR2A 3VS1A 4HKEA 4R56A 2E6NA 2LQKA 2KXCA 4BD3A 4RMOA 4E7LA 2DPPB 3URGA 1WHHA 2DF6A 4FYXB 1GCQC 1I81A 2O9SA 3RUXA 1D09B 4Z02A 2X3WD 2C0OA 1YJ9A 3SHWA 1MMAA 2FZCB 4J9GA 1UGSB 3JB9F 3GNFB 4FYYB 2QI2A 4BACA 1HK9A 2XKOC 5GAN3 3RMSA 4ORZA 4EPCA 1KSWA 2LC4A 2VYTA 3FC3A 5GMKj 4DBRA 5GAOr 1Q81C 5J26A 3QWXX 4E2FB 1VQPT 2LP5A 3S3OA 4B9XA 2MAMA 5KYUB 5KH6A 1KC8U 2NUPA 4IIMA 1RAEB 3CCJA 1NM7A 2B86A 1M8MA 1EX4A 3NGPA 3JCMf 1UUEA 3HRSA 4ATOA 3S3MA 5KYYB 3C12A 3WVDB 3HTRA 1I0CA 1OX9A 1T3SA 4M77B 2FG0A 1X43A 2XD0A 2IIMA 4XK8E 2DRKA 3C95A 5GMKi 1SEMA 1AHJB 5LJ5e 3EHRA 1KK7A 2P4RA 4C0DC 1JJ2S 3A5ZB 1IRXA 1QCNA 1YBYA 3LYIA 3SFMA 1F1BB 3EG9B 2LMJA 3JB9J 2W10A 4II1A 1KHCA 5DM7R 1BI1A 2RF0A 1WDXA 2VVKA 5I11A 4M4ZA 4XTZA 3VJPA 3CC4Q 1PCXA 3OW2A 4O5VA 2RHUA 3KUFA 1V1CA 2NUTB 4RCBA 2QG9B 1TG0A 4BDZA 5A0LA 4UC4A 3DB4A 2YUPA 4KUDK 3EG0A 1M2OA 1YJ9T 5LJ5d 4MMLA 2EKOA 3I55A 1Z9ZA 5FLXE 3MJXA 3G4SQ 1NJIC 4Y92A 3JV3A 1PNJA 1YJNT 4JLIA 4OMOA 3JCMh 1OI1A 1RI0A 3MP6A 1NE8A 3BE3A 4MMKA 4VUBA 2DD4A 2NUZA 4PJOG 1YITQ 1RAGB 1SPKA 1X6BA 4KH1B 3QJYA 3JB9H 1ZBJA 4WCIA 4IUUA 4RG2A 5EG2A 3SWNA 2YT6A 3QKJA 4L59A 3M58A 1Q7YR 2XIDA 2RI2A 1WLPB 1B07A 1BYMA 1Q82U 2FPEA 1VYTA 1VQ5A 5GAMd 1SSFA 4RTWA 3DLLA 4XQ3A 1FMWA 4PJOF 4FSSA 2D9TA 2LCLA 1PSEA 1SRLA 4F7UF 1D1BA 2QDYB 3EG9A 2Z0WA 2YLCA 1G8XA 1K0SA 4PNOA 2QQBA 2KEAA 1RAFB 1Q86C 1I8FA 2QEXT 3OYNA 3OYYA 4FW2A 1VQ8Q 2OTLT 1I4K1 1QW1A 4N0AC 2HAXA 2M9UA 3X26B 4EMKB 3HFOA 4M77A 4C0GA 1UJ0A 3RESA 3F70A 1TSFA 2DE0X 3CCLA 2PVDB 1JU5C 5CAIA 2F2WA 4AG1C 4IUVA 2H8HA 5CVIA 2GF7A 3LW5E 4QQGA 3OMGA 2LCSA 4AT1B 1TOVA 1WJQA 4LDYA 4XTVA 3P8DA 1MV3A 1AZGB 1NPRA 2JUFA 2EVRA 2RQWA 1W1FA 4M77C 2VUBA 3DLMA 3ULRB 3V7RA 2CZ7B 3MEWA 3SWNC 4NOYA 4M7DE 2DTHA 3I35A 3GPLA 2QEXQ 5CCAA 3UF4A 3OBWA 2FZGB 4IURA 1HXDA 3ZFJA 2X4WA 1B3QA 3OYMA 3OYKA 1K9AA 1D3BA 3SB2A 2HCKA 4XU3A 2JTMA 2PU9B 3NMZC 4HVUA 3QBYA 2FO0A 2CZ0B 4MDWA 4M75A 4ZN1A 3OYIA 2RHZA 4CC4B 4CC7A 4HCKA 3CXCA 1FMKA 3V8JA 4PLLA 3R6OA 1Q81U 1M30A 1PRLC 3UA7A 2KQWA 2P84A 1GBQA 5FWCA 2M0OA 3VS4A 2K2MA 3L2QA 4C92A 2DNUA 5GAOm 2XICA 3CCEQ 2MF2A 4X9CA 2QQSA 4B9WA 3UT1A 2J6FA 2OTJQ 3HHTB 4BI3A 2EGEA 2CYZB 3H9NA 2HD0A 2HQEA 5L23A 1YHQA 2O4XB 3CC4A 1VYUA 4HT8A 2EBPA 4C92B 5KYUA 1CKBA 1G3YA 2VASA 5IXFA 4BY6B 4RG8A 2L3SA 3FJPA 4LE9A 2QEXA 4HXJA 4J6WA 2HL3A 3PNWC 5LJ3e 3R6NA 1S1NA 1AWOA 2CP6A 3CCST 2GQIA 2JM8A 3CXCP 1AWWA 4C8QG 4FYWB 4OMQA 3CCQT 4A4FA 1IO6A 3J7AF 1NLPC 2DETA 4CI0C 1JEGA 1WNLA 4A4EA 1N9RA 2LX7A 3CMAQ 1QVFA 1AOJA 3FDRA 2KBTA 1LNXA 1JQQA 1JXMA 4RTXA 3OYGA 1VQPA 4R0KA 3KXTA 2F69A 1QWFA 3CCQA 1VA7A 2LZ6B 3H6ZA 3JCMV 1ZUYA 3JCMW 2O01E 1SG5A 2DA9A 1VQNT 3L1AA 1YJ9Q 4EMGA 3SWNB 4JLGA 5DY9A 2DK3A 3M55A 4IKFA 1G5VA 3CC7T 5GAMe 3X20B 2E5KA 3EGXA 4FU6A 2KY9A 5FW9A 4RTYA 2PQWA 4J83A 3S6WA 3G1JA 1QCFA 4N4IA 1KD1U 1T0HA 4M7DF 1YNZA 2YRCA 5IH2A 5KYXB 3H0HA 1OZ2A 5CQYA 3REBB 2EQIA 4A63B 5D6WA 2X9HA 2FZKB 2PUOB 1JJ2A 1N8RU 4M7DC 1WJRA 2D0NA 2DVEA 1W2BS 3VYGA 4TVRA 1ZX6A 2V8KA 2KI7A 4IUTA 1NLOC 1QVFP 4NL3A 2F5TX 4OB0B 4JJDA 4PJNA 4FL6A 1VQLT 2PVOB 2VXFA 2CZ6B 4BE1A 1WI7A 3OW2S 1S72Q 2E4HA 3CMEQ 1ZSZA 4C92E 3G71T 3CD6A 5KCHA 2G6FX 2A7YA 4M75C 4K11A 3X24B 2PTKA 2E65A 1VQ8T 1N8RC 1UJYA 1G3SA 2DXUA 2HDAA 2YHTA 4M7DD 4CC3A 2KT8A 3H0IA 2MMPA 1OZ3A 2R5AA 5D7UA 3L2VA 1ZSZC 1U3OA 4QVCA 3ZEHA 3JCMQ 3CD6T 4DOWA 2MOXA 3G7ZA 3AHUA 1A0NB 1VQ7T 1W4SA 5DLQE 4MZMA 4AFQC 1Q7YU 4JJBA 1M3BA 3C0CA 2XMFA 1ZQ1A 1OU9A 2KDSA 3VRYA 3HKSA 1W2BA 2YXYA 4J9HA 2KYMA 1YP5A 4OB1B 1KC8C 2RJDA 3HRTA 3CCRQ 1BI2A 2D0QB 3PIPA 1SF9A 3GF5A 2EAYA 2KROA 1YI2T 2JJ9A 4J9EA 2A08A 4M7AB 5HY6A 2ED0A 1M1GA 2LVMA 4JPBW 4RTZA 2DD5A 2HBPA 2RH2A 3RNJA 3I56T 4M77D 1D3BB 2PUKB 1PD0A 1MHNA 3VUBA 1XOVA 1H92A 3OS0A 2RNAA 3TVTA 1YJNQ 1VQ6T 2M0YA 3GNGA 3EFSA 2CZ1B 3I9QA 3CCQQ 2F5KA 3TU4K 3HRUA 1EZZB 2XG8D 1K9MU 5GAN7 4YTLA 2KT1A 5GAMh 1SRMA 1ZUKA 2EPDA 3I5RA 4PJOC 2ROTA 2E41A 3H0FA 5LJ5g 1RAIB 2O4XA 2CP5A 2O31A 1YIJA 2QTXA 3INZA 4AMCA 3A1PA 4DBFA 4QKUA 2RHXA 1YJWQ 1Q7YC 3EH1A 2ZPFB 4EMKA 1D0YA 3M4GA 4M7DG 1TUGB 1B34A 4PKCC 2XK0A 4BE2A 1WXTA 4HT9A 3OYEA 1N9SA 2ZZDA 1QVPA 3TREA 2EGAA 1Y7XA 1AWXA 1BIAA 3LX7A 2CT3A 2AK5A 4JRPA 3SDZA 1GCQA 3BDLA 4DA4A 4OMNA 3QUIA 4M75B 2EW3A 2D8JA 3VS6A 8AT1B 2RQTA 1QKXA 2HZYA 3V8LA 4J6XA 4LN2A 3EFRA 3OY9A 3CXCS 2CT4A 4B6MA 1YI2A 2M16A 2J06A 4M78B 2KVQG 1JJ2P 3EGUA 4RTTA 5GJVB 5GAN2 2X3XD 1YI2Q 3FEOA 4HCCA 1KQ1A 2ZPEB 3CC4T 1EFNA 2YUNA 3GOXA 2LCCA 2KRSA 4C8QF 3PFSA 2DZCA 4A4GA 4FW1A 1CSKA 5KYYA 1B7TA 1UGVA 1E6HA 1K4US 5HK0A 1GXIE 1K8AC 3REAB 2EJFA 3MEUA 2RQRA 1R77A 4M78A 3TCJA 1WA7A 1U5SA 2J7IA 1RI9A 4E7IA 4KH0B 1CKAA 1ZSGA 3QZ9B 1IREB 1V29B 1KIKA 2FRYA 1I1JA 4LXCA 3HSBA 2FPFA 4BI8B 2JMCA 2DYBA 5CIUA 3CCET 5KYWB 1WXBA 2K3YA 2FEIA 1X01A 1M5Q1 2Y90A 1AVZC 5C0MA 1T0JA 1QVFS 3S3NA 4JJCA 1GBRA 2Y4YA 2DTIA 5KYNA 2WSFE 2DL5A 1M1KU 1X6GA 4Q5WA 2ENMA 1VQ9T 2DEUA 5GMKh 1JO8A 2KGTA 1K9MC 3OS5A 2X4JA 1BK2A 4OMMA 4Y91A 1VOMA 5GAOp 2J6OA 2BKDN 3O5ZA 3QSUA 4OGEA 4EDUA 1HSQA 2G3RA 4A4HA 3V7CA 5LJ5f 1YJWA 1YWPA 3CD6Q 1ZA1B 5GMKe 1ZLMA 2H3EB 5IHNA 1I07A 2CDTA 4ZNXA 1HD3A 4D8KA 2K5IA 2QA4A 2QQAA 2RD1A 2GNCA 1M27C 2OI3A 3FIFA 2EQJA 1HYOA 2RJEA 2OTJT 2LJ1A 4EMHA 3JB9I 3TEEA 5GJWB 2LJ0A 1E7OA 1M1FA 2ATCB 2ZPGB 4JDSA 4MZPA 3PGGA 3M0SA 2A37A 1WQWA 3PVLA 1VUBA 2MWOA 3CCVT 1OPKA 3A8LB 3QO3A 3EG1A 4KUIA 1VQMQ 3VS0A 1MMDA 3NTIA 2EYZA 1K0XA 1M1KC 4OB2B 3E9FA 1YFNA 4ZGEB 4XU1A 4N0AA 4F17A 1BU1A 1OU8A 2M1HA 1UDLA 2RM4A 3JB9G 1GCPA 2VC8A 2EYYA 3CCMT 3OYCA 1OPLA 1QLYA 1AD5A 1WFWA 4IUQA 1M2VB 3AT1B 3SD4A 1VQ9A 1KJWA 3JCMd 4M75G 2R58A 2DL8A 3CC2T 1BB9A 2EFIA 2FRWA 3M0QA 3KBGA 2YUQA 1VQ4T 4C0ZA 2VKNA 3OYAA 5LJ5j 1VQOQ 1C1AA 4Z89A 3LGFA 2DILA 2JNGA 2LJ3A 4BY6C 3CCVQ 2DIGA 3CCUA 5KE3A 2GGRA 4J7FA 1Y71A 1QVGA 4M7DB 1AWJA 3MHXA 2E64A 3V7SA 2YUOA 4IUPA 3JCMJ 3TSWA 2JMAA 2LQWA 2QA4T 2W0ZA 4E47A 1K1ZA 4LDVA 1JXOA 1RLQC 2Y4XA 3GBQA 2E3HA 3QXEB 3QPHA 1VQNA 3CC2Q 5GAOn 3H41A 2EGCA 2COWA 3CCSQ 4E7HA 2RK2A 2D8HA 1UGQB 1VQKQ 2E12A 4OGCA 3E2UA 3UDCA 1UECA 1VYVA 2CH4W 2RO0A 1WX6A 2DMOA 3QHSA 4KULA 1VQKT 4ANJA 2HKNA 2K5LA 1C0MA 3IQLA 2DEQA 2QASA 3CBPA 3MPUB 1LJOA 1QVGS 3LH0A 1H3HA 2EYWA 2MCNA 2SEMA 3T9NA 4CC2A 4C92F 4ZN3A 2XDBA 3X25B 1D0XA 2O2OA 1I5OB 4PLIA 5FU6C 2CP0A 2FL7A 1Q82R 5CKEA 1MV0B 4HVVA 4BB7A 1KQSP 2X4XA 5IAYA 1IGUA 3CCUQ 1OULA 3P8HA 1WIEA 3M9QA 5I2MA 2RK1A 2JTFA 2KAFA 3N5BB 2GTOA 5GANd 3FLGA 3OYBA 2EIFA 3CCUT 2JVVA 1U1TA 1TWBA 2WACA 4C8QD 1R0CB 2C06A 2DERA 1JB0E 2DAQA 2RPNA 3CCRT 1UGRB 2D1XA 3QYHB 4C92D 4FT2A 4F14A 2ZGWA 2OTLA 2K7AA 4ELYC 4E7JA 1Y0MA 3OW2P 4J7IA 2DJZA 4F16A 3G4SA 5LJ3j 3UPUA 4PFPA 2VV5A 2L89A 3CPWA 1NEGA 1YCYA 1Y96A 2E70A 1QMCA 2YDLA 5KCOA 5A2QE 5GAN4 3I55T 2AIRB 1NZ9A 1ARKA 1PM3A 3M5AA 4M78D 2RQVA 4FSXA 2SRCA 2X4YA 3G4ST 3I56A 2DX1A 2ED1A 2KK4A 2M51A 2L2PA 2V8JA 4CRIA 1X6OA 4M77F 3NPFA 5J3BA 4LNPA 1PD1A 2LNHB 3MP8A 2DL4A 2HMAA 1Q95G 3I5SA 4PJOB 3A98A 1TH7A 4J8OA 3FB9A 3A8GB 4F7UB 4GLMA 4M7AC 2J6KA 1Q86R 1VQ6Q 2R57A 3UA6A 3FRNA 4V2SA 1K8AR 2B8AA 2X51A 4PK4A 4J9IA 1VIFA 2J05A 5GMKm 2DRMA 2LQNA 4PJOA 2LX9A 5L8RE 5DLOA 3OS2A 5KE2A 4ME7A 2HQHA 3EGDB 3HP9A 4PFZA 4C5EA 1VQ7A 2JOYA 3VV0A 3CPWS 1YIJT 4PJOE 5CKDA 3J80E 1WPYA 4KGXB 1FWZA 1C6VX 2RJCA 4DEXA 3DKMA
chains in the Genus database with same CATH topology
3JCMb 3CC7A 3PMIA 2QDYB 3FEOA 3G6ET 2FYKA 5M9OA 2YLCA 4HCCA 1KQ1A 4X34A 2ZPEB 1M90U 2EYQA 4PNOA 2QQBA 2V8IA 3CC4T 2XDDA 1NJIU 3JCMX 5HK3A 1Q86C 4LDXA 1I8FA 2QEXT 3OYNA 3JCMe 2IVWA 2LCCA 3OYYA 3GOXA 4C8QF 1Q86U 1VIEA 2DZCA 3PFSA 3OYJA 4A4GA 3HPWA 1VQMT 2OTLT 1VQ5T 1I4K1 1QW1A 4N0AC 4JS5A 2A3LA 3CCJT 2HAXA 2M9UA 3X26B 4EMKB 3HFOA 4M77A 1VQLA 4C0GA 5HK0A 4XU2A 1GXIE 2H3JA 3ASKA 3F70A 3MCAB 3RESA 1K8AC 1BI0A 2LTOA 2L3RA 2EJFA 4XTUA 3CCLA 2PVDB 4M7AA 2E10A 4A53A 5CAIA 3MEUA 1VQ6A 4OMFB 4M78A 4IUVA 5FU7C 5LJ3h 3L2RA 1KQSA 5CVIA 3TCJA 2GF7A 2OAUA 2RB6A 3LW5E 4QQGA 3OYLA 2EJ9A 3OMGA 3LWHA 4M7AE 1WJQA 5FRNA 4E7IA 4LDYA 4ZGJB 3OYHA 3P8DA 4XTVA 1NPRA 2JUFA 3QZ9B 4M77C 1IREB 1V29B 2VUBA 3DLMA 3V8KA 3V7RA 1Y96B 2CZ7B 3MEWA 3SWNC 1KD1C 2LRQA 4NOYA 4M7DE 1G3WA 3HSBA 1VQOT 2DTHA 1KHIA 1N27A 3GPLA 3VU3C 5CCAA 4BI8B 3QG1A 3OBWA 5CIUA 1DJ7B 2ZPHB 3C94A 4P5NA 2KSSA 3CCET 4IURA 3Q1JA 4Y28E 2K3YA 1UEBA 4BDYA 1HXDA 3ZFJA 2X4WA 2HNIA 1MGQA 1X01A 3JB9D 3OYMA 1M5Q1 2Y90A 3RIRA 5C6SA 3OYKA 5C0MA 3CCLT 3BDUA 1QVFS 1RL2A 3S3NA 3RMQA 1D3BA 3SB2A 1YHQT 2DTOA 2Y4YA 2DTIA 4XU3A 2WSFE 1M1KU 4ZGDB 5CKBA 5GAOq 5HKCA 3PIOA 2JTMA 2PU9B 4WF2A 4Q5WA 4HCZA 3QBYA 1VQ9T 4QW2A 1ZHIA 2CZ0B 4M77G 5GMKh 1N6AA 4MDWA 1K9MC 3OS5A 3VYHB 4M75A 2X4JA 1YITA 1LOJA 4ZN1A 4FT4A 4FIBA 4M7AG 2R5MA 2NLUA 4XTWA 4Y91A 5CK9A 3OYIA 2RHZA 5GAOp 3OA6A 2RHYA 4PL6A 2E6ZA 2BKDN 3CXCA 1JBMA 3PMTA 4M75F 3CD6A 3V8JA 4PLLA 4OGEA 5AYFA 4EDUA 3QSUA 3R6OA 1ZBXA 1Q81U 3A8HB 4XAXB 2G3RA 1K73C 4A4HA 3CCEA 3V7CA 5LJ5f 2KQWA 4C0DB 1YJWA 3L42A 4OVAA 1I5LA 5GMKe 3CCRA 2WSEE 4LD9K 2M0OA 3L2QA 2XU8A 4OP0A 4C92A 1S72T 2ZPIB 3G6EA 1VQOA 5GAOm 5GMKl 1WQ7A 3QYGB 2YLBA 2XICA 2MF2A 3GIBA 4X9CA 2QQSA 2P0KA 3LLRA 4B9WA 3UT1A 2XDPA 3CCVA 3M53A 4QVDA 1K8AU 3HHTB 1VQMA 4BI3A 2P0QA 3MEVA 3RKYA 2CYZB 3M54A 2IG0A 3QJ6A 5LJ3f 2K5IA 2QA4A 2QQAA 2HD0A 4BE0A 2QQRA 2HQEA 1B34B 2RD1A 4GLKA 4X9DA 5GANg 1YHQA 2RHIA 5GAOl 4MDXA 2O4XB 3J81E 5GAMj 4N4HA 3CC4A 1O9SA 4HT8A 3FIFA 4C92B 1S72A 2X35A 2EQJA 2RA2A 2K2VA 2RJEA 2LT4A 3WVEB 2OTJT 3CBOA 4NS5A 3E19A 2ZPBB 3PT9A 1G3YA 2RJFA 3O8VA 2L5QA 5CKFA 3LWIA 4JJNK 1BIBA 4EMHA 4XTXA 3JB9I 3TEEA 4BY6B 4RG8A 2GQVA 3CEYA 3CMET 4C5HA 1M1FA 3FJPA 2K3XA 2L8DA 3M59A 3RKWA 2ZPGB 3PGGA 2AHJB 3GLXA 3BFMA 4J6WA 4JDSA 2GCXA 4M78F 4MZPA 5J39A 1WQWA 2JN0A 5FROA 3PNWC 5LJ5h 3BY7A 1VUBA 4M78E 3PTAA 2HQXA 2LQ8A 2MWOA 3QIIA 5LJ3e 1VQ4A 3CCVT 1XQHA 2BUDA 5GAN5 3A8LB 1VQKA 3QO3A 4LDWA 2DZ9A 2EQUA 3CCST 4KUIA 1KQ2A 3HL8A 2K4YA 1QP3A 2P4TA 3M57A 3LGLA 4C8QG 3NTIA 1M1KC 4OB2B 3JCMP 3CCQT 3CC2A 3E9FA 4A4FA 3VUZA 4O6JA 4MZTA 4JRQA 3J7AF 4C8QA 4OB3B 4ELZC 4CI0C 4C5GA 2P0PA 1WNLA 4A4EA 2JZ2A 1N9RA 4XU1A 4EMKC 4ZGEB 3QDRB 3OSVA 4N0AA 1BI3A 2LNVA 1QVFA 2M1HA 5GAN8 1FX7A 3OYDA 4BUGA 4XU0A 3FDRA 2RM4A 3E1SA 4HCBA 2EWNA 3JB9G 3BW1A 4RKUE 2GFUA 2VC8A 1LNXA 3CCMT 4RCCA 3M56A 4C8QE 4F7UA 3H8ZA 3OYGA 1VQPA 3OYCA 1UGPB 3META 4IUQA 3SD4A 5IT9E 1VQ9A 2GFAA 3JCMd 2DKGA 3KXTA 2F69A 4FM4B 2YRVA 4M75G 2R58A 3CMAT 3CCQA 3CC2T 2EFIA 2FVUA 3H6ZA 2DXBA 3JCMV 4A4KA 3JCMW 3KBGA 2O01E 1VQ4T 1O75A 4D6WA 4C0ZA 1VQNT 3L1AA 3OYAA 3OQ5A 4EMGA 4M78G 3SWNB 5LJ5j 4JLGA 4XTYA 3QZ5B 5DY9A 2DK3A 1U8RA 3M55A 4IKFA 2DXCA 3LGFA 5GANh 3ME9A 2DIQA 2FHDA 4KT0E 3CC7T 3OB9A 4M75E 1G5VA 5GAMe 2JNGA 3X20B 4BY6C 3JRZA 4J5YA 1YITT 2DIGA 4FU6A 2KY9A 2E1HA 3CCUA 5KE3A 1M90C 4KBMB 1WGSA 4J7FA 4PJOD 3NFCA 1Y71A 1Y07A 5LJ3g 4R55A 3CMAA 2PQWA 4GY5A 1QVGA 4M7DB 4J83A 3S6WA 3E9GA 3MHXA 2EJGA 3CBMA 4N4IA 2I2LA 2E64A 5IN1A 2OTJA 1KD1U 5D6YA 3V7SA 2EQMA 3L2UA 4F7UE 4M7DF 4IUPA 3JCMJ 5FRMA 1YJWT 1M8VA 1OZ2A 5CQYA 2E5QA 5D6WA 2QA4T 4OF1A 4E47A 2PUOB 1IZ6A 2QEXA 3VKIA 1N8RU 1WJRA 4LDVA 1JJ2A 5FU7B 4M7DC 2FB7A 2DVEA 3CCMA 1W2BS 2VGMA 2Y4XA 1H3ZA 3VYGA 4TVRA 3JCMg 2D6FA 3QXEB 2V8KA 3QPHA 3L2WA 1VQNA 1EIFA 2EQKA 5GAOn 4F7UG 4IUTA 1P92A 3UWNA 1JRIA 1M4ZA 4NL3A 2K5FA 4JRKA 2F5TX 4C8QC 4E7HA 3P8BB 2RK2A 4OB0B 3GP8A 3RERA 1X75C 1UGQB 4FL6A 2E12A 2PVOB 1VQLT 4OGCA 2VXFA 2CZ6B 5I2SA 5D6XA 5I21A 4BE1A 3L2ZA 3OW2S 2VGNA 4M7AD 3UDCA 1WJSA 3C4SA 2KMTA 2VXEA 4LDUA 3WXMB 4C92E 3G71T 4R56A 2LDMA 5CR2A 2RO0A 4HKEA 2E6NA 2LQKA 2A7YA 4M75C 4BD3A 5KCHA 4RMOA 4E7LA 3QHSA 4KULA 1VQKT 3X24B 2DPPB 2K5LA 3URGA 1I81A 2E65A 3RUXA 4Z02A 1VQ8T 3CMEA 1N8RC 1G3SA 2DXUA 4DQ2A 3JCMc 4ZTJA 2YHTA 4BI4A 1BKBA 3MO8A 1YJ9A 4M78C 4M7DD 2DEQA 3ZBDA 4C92G 3A8OB 1UGSB 5FU6B 3CBPA 1LJOA 5GAMg 3LH0A 1QVGS 1XTDA 3MEAA 3JB9F 3MP1A 2MMPA 1OZ3A 2R5AA 2RI3A 3GNFB 2WSCE 3L2VA 3NTKA 4ZTFA 4QVCA 3ZEHA 3JCMQ 2QI2A 4DOWA 3T9NA 3G7ZA 4BACA 3AHUA 2LT1A 3CD6T 1HK9A 1VQ7T 1W4SA 4C92F 5DLQE 2XKOC 4ZN3A 5GAN3 4MZMA 2DO3A 4QQDA 2MI6A 4JUVA 3RMSA 3X25B 1Q7YU 2XDBA 4EPCA 4PLIA 1ZQ1A 2LC4A 5FU6C 1QP2A 2VYTA 3FC3A 2FL7A 1Q82C 2KDSA 5GMKj 3OBYA 5CKEA 4BB7A 3HKSA 1W2BA 4M77E 2X4XA 5GAOr 5IAYA 1Q81C 3P8HA 3M9QA 4OB1B 5J26A 5I2MA 1VQPT 2RK1A 1R8OB 3S3OA 1KC8C 4B9XA 2JTFA 1KG1A 2KAFA 3N5BB 2MAMA 5KH6A 2RJDA 1KC8U 3RKXA 5GANd 3HRTA 2RI5A 1BI2A 1FXXA 2D0QB 3FLGA 4M75D 2EIFA 3PIPA 3OYBA 3CCJA 4E7KA 3GF5A 3JCMf 3ER0A 4N4GA 2JVVA 3HRSA 2EAYA 3CCUT 4ATOA 3S3MA 1YI2T 5GANe 3C12A 3WVDB 1U1TA 4M7AB 5GANj 5HY6A 1M9SA 3TU4K 3X28B 1M1GA 2LVMA 2WACA 3M4YA 4QQ6A 2DD5A 2HBPA 2CKKA 2RH2A 4M77B 3I56T 4C8QD 4M77D 2BIVA 2XD0A 1OYXA 4XK8E 3NTHA 3C95A 3OS1A 2C06A 1D3BB 5GMKi 1AHJB 2PUKB 1MHNA 1JB0E 2DAQA 3VUBA 1XOVA 5LJ5e 3CCRT 3OS0A 4C0DC 4QVZA 4C5IA 1JJ2S 1UGRB 3A5ZB 3JSCA 3OSSC 2XHCA 3QYHB 4DOVA 4C92D 1VQ6T 4FT2A 1YBYA 2ZGWA 5GAMf 2OTLA 3LYIA 4JRIA 3GNGA 4ELYC 3DB3A 3EFSA 4E7JA 2CZ1B 4J7IA 2DJZA 3SFMA 3G4SA 5LJ3j 3UPUA 2F5KA 3A8MB 3JB9J 4II1A 1KHCA 1U1SA 3HRUA 2VV5A 1XNIA 2L89A 2XG8D 1BI1A 4F7UF 5DM7R 3CPWA 1YJNA 1K9MU 5GAN7 1YCYA 1Y96A 2E70A 3VJPA 4XTZA 5KCOA 5A2QE 5GAN4 4YTLA 4LD6A 3I55T 5GAMh 4O5VA 3OW2A 1H641 2RHUA 5LJ3d 3KUFA 1NPPA 1NZ9A 4PJOC 4RCBA 4C92C 3M5AA 3OMCA 4BDZA 2E41A 4L6V5 4M78D 4FSXA 1K73U 3EAEA 5LL6S 5LJ5g 2X4YA 2O4XA 3G4ST 4M7AF 3I56A 2KK4A 5A0LA 1UB4A 1YIJA 2QTXA 2V8JA 4CRIA 2QQ9A 1X6OA 4M77F 2XI9A 3DB4A 3INZA 4UC4A 5CO7A 5J3BA 1PSFA 3MP8A 4KUDK 4PJOB 2RHXA 1TH7A 1YJ9T 1Q7YC 5LJ5d 4MMLA 3OYFA 2EKOA 3I55A 4J8OA 4L5GA 2ZPFB 4EMKA 2DXTA 3FB9A 3A8GB 5FLXE 3M4GA 4F7UB 4M7DG 4C0FA 1NJIC 5CQXA 1B34A 4PKCC 4M7AC 3CCSA 2XK0A 4BE2A 1YJNT 4JLIA 2R57A 4M7DA 3FRNA 3JCMh 4V2SA 4HT9A 1OI1A 1RI0A 2B8AA 1N9SA 3OYEA 3HFNA 2ZZDA 2QXFA 1NE8A 1VIFA 3MP6A 4MMKA 4VUBA 2DD4A 5CKHA 5GMKm 2CGHA 3G71A 4PJOG 1QVPA 4HA8A 3TREA 4C8QB 3CPFA 1Y7XA 2ZCFB 3QJYA 1BIAA 5A0DA 3JB9H 4NL2A 4PJOA 3LX7A 1KQSS 2LX9A 4IUUA 4RG2A 5EG2A 3SWNA 5GAN6 3QKJA 5L8RE 5DLOA 3OS2A 1VQ8A 5KE2A 2K57A 4ME7A 3HP9A 4C5EA 4L59A 4JRPA 1G3TA 3M58A 3SDZA 4A54A 2JOYA 2PVGB 3BDLA 3JAME 4DA4A 1VQ7A 3QUIA 4M75B 3VV0A 5GANf 2XIDA 3CPWS 1YIJT 4PJOE 5CKDA 3V8LA 2RI2A 4J6XA 2CS7A 1BYMA 2MWPA 1Q82U 3EFRA 3OY9A 3CXCS 3J80E 1VQ5A 5GAMd 1SSFA 3DLLA 1YI2A 2M16A 4M78B 2KVQG 4XQ3A 4PJOF 1WPYA 2D9TA 2LCLA 1FWZA 5A0GA 4J6YA 1PSEA 2RJCA 5GAN2 3DKMA 4JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R56 A;  2JTM A;  3LWI A;  3KXT A;  4R55 A;  3LWH A; 
#chains in the Genus database with same CATH topology
 3JCM b;  2KE9 A;  1RAB B;  5M9O A;  1TUC A;  2EYQ A;  2V8I A;  4OMP A;  2XDD A;  5HK3 A;  1PRM C;  1AZE A;  4Z88 A;  1VIE A;  3OYJ A;  1VQM T;  1VQ5 T;  4JS5 A;  3CCJ T;  1NBE B;  1VQL A;  4XU2 A;  3MCA B;  2L3R A;  4XTU A;  1OOT A;  1VQ6 A;  4OMF B;  1VQL Q;  1SHF A;  1K73 R;  2OAU A;  1WHL A;  2RB6 A;  3EGD A;  3OYL A;  2EJ9 A;  2JS0 A;  3LWH A;  1LPL A;  5IXB A;  4PFO A;  5FRN A;  1X27 A;  2ZAE A;  1T3L A;  1GFD A;  3LH5 A;  2A0F B;  2CUD A;  3QWY A;  1KD1 C;  2LRQ A;  4LUD A;  4D8D A;  1VQO T;  1KHI A;  3VU3 C;  1UHF A;  2DM1 A;  2KSS A;  4BDY A;  1UEB A;  1W2B P;  2HNI A;  2CSQ A;  4AFZ C;  2AT1 B;  2PNI A;  5C6S A;  1M3C A;  4AFS C;  3BDU A;  1G2B A;  2F2X A;  1RL2 A;  2CH4 A;  3RMQ A;  3VS7 A;  1D1C A;  2BZ8 A;  1YHQ T;  9ATC B;  3MKD A;  4X1V A;  5CKB A;  5GAO q;  5HKC A;  3PIO A;  1M90 R;  2QGF B;  4HCZ A;  1N6A A;  1VQN Q;  3VYH B;  2K3B A;  1YIT A;  1LOJ A;  1E6G A;  4M7A G;  2NLU A;  4XTW A;  5CK9 A;  2JXB A;  1IHW A;  2V1Q A;  1VQ9 Q;  1JBM A;  2QDL A;  4FCY A;  2JS2 A;  4OML A;  1ZBX A;  4XAX B;  1OV3 A;  3CCE A;  3UAT A;  1I5L A;  2XU8 A;  2DBM A;  1S72 T;  1VQO A;  2YLB A;  6AT1 B;  3LLR A;  3CCV A;  2VB6 A;  4QVD A;  3CCL Q;  1VQM A;  2P0Q A;  3RKY A;  3M54 A;  3QJ6 A;  4DBQ A;  1NEB A;  2QQR A;  1MND A;  3NHN A;  5GAN g;  2RHI A;  3J81 E;  2L3P A;  1O9S A;  1ZSZ B;  4KRT A;  1S72 A;  2K2V A;  7AT1 B;  3WVE B;  3CBO A;  4NS5 A;  2ZPB B;  3O8V A;  2RJF A;  2L5Q A;  1NYG A;  1BIB A;  2KR3 A;  2YRD A;  2GQV A;  2L8D A;  3RKW A;  2AZV A;  4M78 F;  3GLX A;  3BFM A;  2GCX A;  5LJ5 h;  4M78 E;  3PTA A;  3QII A;  1W70 A;  1VQ4 A;  2BUD A;  5GAN 5;  2HSE B;  3CC7 Q;  2K6D A;  3HL8 A;  1Y57 A;  1QP3 A;  2P4T A;  3JCM P;  2MK5 A;  1YIJ Q;  4MZT A;  4C8Q A;  4OB3 B;  5AT1 B;  3EFO A;  1KD1 R;  2QAZ A;  2JTE A;  2JZ2 A;  3G71 Q;  1RAD B;  4EMK C;  1BI3 A;  4HCB A;  5GAN 8;  1FX7 A;  3OYD A;  1QKW A;  3E1S A;  2GFU A;  4RCC A;  1PKS A;  1NG2 A;  3M56 A;  4C8Q E;  3EGX B;  1UGP B;  3MET A;  1D0Z A;  2DKG A;  4FM4 B;  5I22 A;  3CMA T;  2HBW A;  2FVU A;  1YN8 A;  1VQP Q;  1O75 A;  4D6W A;  4DEY A;  4XTY A;  3QZ5 B;  2DXC A;  2DJQ A;  2YWW A;  5GAN h;  2DIQ A;  1ZUU A;  3OB9 A;  3JRZ A;  4J5Y A;  2E1H A;  2NYS A;  1M90 C;  4KBM B;  3CMA A;  1Y07 A;  5LJ3 g;  4R55 A;  4GY5 A;  2DVJ A;  3PE0 A;  4WTO B;  1Q81 R;  3L2U A;  4F7U E;  3RBB B;  2F2V A;  3CCM Q;  4AFU C;  5FRM A;  1YJW T;  2FPD A;  2E5Q A;  5FU7 B;  1IGQ A;  4IIO A;  3THK A;  3QDF A;  3VS2 A;  1H3Z A;  3JCM g;  1EIF A;  2EQK A;  4F7U G;  2M02 A;  3CPW P;  1JRI A;  1M4Z A;  4JRK A;  1BCM A;  1K9M R;  4C8Q C;  4PJM A;  1IB8 A;  1PG5 B;  1GRI A;  3CQT A;  5D6X A;  4DBH A;  3L2Z A;  2A28 A;  1QVG P;  2JT4 A;  2KMT A;  2VXE A;  3WXM B;  1M2V A;  1PKT A;  2C0T A;  3M0P A;  1VQ5 Q;  1NJI R;  1WZO A;  3CME A;  2A36 A;  2HKQ B;  3JCM c;  1RAA B;  4DQ2 A;  4ZTJ A;  4BI4 A;  1BKB A;  3MO8 A;  4M78 C;  1VQ4 Q;  3ZBD A;  2ROL A;  4C92 G;  3A8O B;  3I56 Q;  5FU6 B;  2OJ2 A;  5GAM g;  1XTD A;  3MEA A;  1GL5 A;  3MP1 A;  2RI3 A;  2WSC E;  3NTK A;  4QT7 A;  4ZTF A;  1N8R R;  2KRM A;  2LT1 A;  2OX7 A;  5KYW A;  1TXQ A;  2DO3 A;  4LUE A;  2MI6 A;  4JUV A;  2YSQ A;  4QQD A;  1M3A A;  1QP2 A;  1Q82 C;  3OBY A;  4M77 E;  1QQJ A;  1RLP C;  2ABL A;  2AKK A;  1AEY A;  1R8O B;  2NUP B;  1KG1 A;  3RKX A;  2V1R A;  3D7S B;  2RI5 A;  1FXX A;  4E7K A;  4M75 D;  3ER0 A;  1X2Q A;  4N4G A;  5GAN e;  5GAN j;  2EKH A;  1M9S A;  3X28 B;  2DYI A;  3RR6 A;  3M4Y A;  4QQ6 A;  2CKK A;  1G83 A;  3EFO B;  2BIV A;  1OYX A;  3NTH A;  3OS1 A;  1D1A A;  2GTJ A;  4QVZ A;  4C5I A;  2COZ A;  1X2K A;  2XHC A;  3JSC A;  3OSS C;  2K79 A;  4DOV A;  3EG2 A;  5GAM f;  1WHG A;  4JRI A;  2L3Q A;  3DB3 A;  3M0R A;  5ECA A;  2OAW A;  3A8M B;  1U1S A;  2QA4 Q;  1XNI A;  1YJN A;  2EYX A;  4J9D A;  4LD6 A;  1H64 1;  5LJ3 d;  1NPP A;  1QCO A;  2BZX A;  1HJD A;  1OX8 A;  2QGG A;  4C92 C;  3OMC A;  4L6V 5;  1K73 U;  3EAE A;  5LL6 S;  4M7A F;  3I55 Q;  1UB4 A;  2QQ9 A;  2XI9 A;  5CO7 A;  1PSF A;  3OYF A;  1PHT A;  4L5G A;  2DXT A;  2BZY A;  1UG1 A;  4C0F A;  4ESR A;  5CQX A;  3G6E Q;  3CCS A;  1IXD A;  3EH2 A;  4M7D A;  3TSZ A;  3HFN A;  2QXF A;  5CKH A;  5FWB A;  2CGH A;  3G71 A;  4C8Q B;  4HA8 A;  3CPF A;  2ZCF B;  1VQ7 Q;  5A0D A;  4NL2 A;  2E3I A;  1KQS S;  1TU0 B;  4JZ3 A;  5GAN 6;  1VQ8 A;  2K57 A;  1SSH A;  2I0N A;  1G3T A;  4A54 A;  2PVG B;  4J9B A;  3JAM E;  1MMN A;  5GAN f;  4KGZ B;  2DL3 A;  2CP7 A;  2CS7 A;  2COY A;  2MWP A;  1MMG A;  1RUW A;  2RQU A;  3M0T A;  5A0G A;  4J6Y A;  2OTJ A;  1AT1 B;  1H8K A;  1MNE A;  4JS4 A;  3ZL7 C;  1OEB A;  3CC7 A;  3PMI A;  2MYS A;  3G6E T;  2FYK A;  1IHV A;  4X34 A;  1YWO A;  1M90 U;  1NJI U;  3JCM X;  4LDX A;  3JCM e;  2IVW A;  1UE9 A;  1Q86 U;  3HPW A;  1XJW B;  1YCS B;  2A3L A;  1ABQ A;  2VWF A;  2H3J A;  1ACM B;  3ASK A;  4AG2 C;  3VS5 A;  1BI0 A;  2LTO A;  2CP3 A;  4M7A A;  2E10 A;  4A53 A;  4EIK A;  3EG3 A;  3M0U A;  1NYF A;  4FYV B;  5LJ3 h;  5FU7 C;  5IHI A;  2C0I A;  3L2R A;  1KQS A;  2O9V A;  4M7A E;  4ZGJ B;  3OYH A;  2HEQ A;  4E7Z A;  3V8K A;  1Y96 B;  1KFZ A;  1RAC B;  1G3W A;  3VRZ A;  2DFU A;  3RDV A;  1N27 A;  1K76 A;  5KYX A;  3QG1 A;  1J3T A;  1DJ7 B;  2ZPH B;  3C94 A;  4P5N A;  1ZA2 B;  2AZS A;  3Q1J A;  4Y28 E;  2OTL Q;  1BBZ A;  1MGQ A;  3JB9 D;  4GBQ A;  3RIR A;  1SKU B;  3CCL T;  2DL7 A;  2DTO A;  2KNB B;  4ZGD B;  2ECZ A;  4WF2 A;  3FJ5 A;  4QW2 A;  1ZHI A;  4M77 G;  2KRN A;  4E7S A;  3EHQ A;  4FT4 A;  4FIB A;  2R5M A;  3OA6 A;  1KC8 R;  2RHY A;  4PL6 A;  2E6Z A;  3PMT A;  4M75 F;  2AKL A;  5AYF A;  3A8H B;  1K73 C;  2QYZ A;  3PVQ A;  1SHG A;  4C0D B;  2JW4 A;  3L42 A;  1BCO A;  4OVA A;  3CCR A;  2WSE E;  4LD9 K;  1FYN A;  4OP0 A;  1WHJ A;  2ZPI B;  3G6E A;  5GMK l;  1WQ7 A;  3QYG B;  4PJL A;  2DBK A;  2L0A A;  3GIB A;  1X69 A;  2P0K A;  2XDP A;  1YHQ Q;  3M53 A;  1TUD A;  4JZ4 A;  1K8A U;  3MEV A;  2IG0 A;  4BE0 A;  5LJ3 f;  2KXD A;  4Z8A A;  4X9D A;  1B34 B;  1PWT A;  4GLK A;  1UTI A;  5HCK A;  4HVW A;  5GAO l;  4MDX A;  5GAM j;  4N4H A;  2X35 A;  2RA2 A;  1LCK A;  2LT4 A;  3E19 A;  1OQK A;  3PT9 A;  4F04 B;  5CKF A;  3LWI A;  4JJN K;  1LVK A;  4XTX A;  1RAH B;  3VS3 A;  3CEY A;  3CME T;  4C5H A;  2K3X A;  3M59 A;  1UHC A;  2AHJ B;  5J39 A;  1TS9 A;  2JN0 A;  1N5Z A;  5FRO A;  3BY7 A;  3TQ7 P;  2HQX A;  2LQ8 A;  1XQH A;  1PC0 A;  8ATC B;  1VQK A;  4LDW A;  1W6X A;  2DZ9 A;  2EQU A;  1KQ2 A;  4RTU A;  2K4Y A;  3M57 A;  2KYB A;  2RN8 A;  3LGL A;  2IPO B;  3CC2 A;  2ESW A;  4O6J A;  4RTV A;  3VUZ A;  4JRQ A;  1Z9Q A;  4ELZ C;  3KFV A;  3CCJ Q;  4C5G A;  2P0P A;  1UFF A;  3QDR B;  3OSV A;  2LNV A;  2MIO A;  4BUG A;  4XU0 A;  2O88 A;  1FMV A;  2EWN A;  2JM9 A;  3BW1 A;  4RKU E;  5EC7 A;  2HL5 C;  4F7U A;  3H8Z A;  2CP2 A;  5IT9 E;  1U06 A;  2GFA A;  1WXU A;  2YRV A;  4RUG A;  2NUT A;  1R0B G;  2DXB A;  4A4K A;  2DLP A;  1M1K R;  1WYX A;  2CSI A;  3OQ5 A;  4M78 G;  1U8R A;  3ME9 A;  2FHD A;  2GBQ A;  2V26 A;  4KT0 E;  4M75 E;  1WHK A;  1MUZ A;  1YIT T;  2RMO A;  1TTH B;  1GFC A;  1WGS A;  4PJO D;  3NFC A;  2PZ1 A;  3E9G A;  2QK0 A;  2EJG A;  3CBM A;  2I2L A;  2QTV A;  5IN1 A;  5D6Y A;  2HSP A;  2EQM A;  2CRE A;  4PJJ A;  1M8V A;  3SEM A;  5IHK A;  4OF1 A;  4KGV B;  1IZ6 A;  3U23 A;  3VKI A;  4E6R A;  2BE9 B;  2FB7 A;  2NWM A;  2K9G A;  3CCM A;  2VGM A;  2D6F A;  3L2W A;  1P92 A;  3UWN A;  2BTT A;  2CUB A;  2K5F A;  1QWE A;  3P8B B;  2MPX C;  3GP8 A;  3RER A;  1X75 C;  1WHM A;  2F1L A;  4J9F A;  2BE7 D;  5I2S A;  5I21 A;  4J9C A;  2VGN A;  1ABO A;  4M7A D;  1WJS A;  3C4S A;  4LDU A;  1V76 A;  2LDM A;  5CR2 A;  3VS1 A;  4HKE A;  4R56 A;  2E6N A;  2LQK A;  2KXC A;  4BD3 A;  4RMO A;  4E7L A;  2DPP B;  3URG A;  1WHH A;  2DF6 A;  4FYX B;  1GCQ C;  1I81 A;  2O9S A;  3RUX A;  1D09 B;  4Z02 A;  2X3W D;  2C0O A;  1YJ9 A;  3SHW A;  1MMA A;  2FZC B;  4J9G A;  1UGS B;  3JB9 F;  3GNF B;  4FYY B;  2QI2 A;  4BAC A;  1HK9 A;  2XKO C;  5GAN 3;  3RMS A;  4ORZ A;  4EPC A;  1KSW A;  2LC4 A;  2VYT A;  3FC3 A;  5GMK j;  4DBR A;  5GAO r;  1Q81 C;  5J26 A;  3QWX X;  4E2F B;  1VQP T;  2LP5 A;  3S3O A;  4B9X A;  2MAM A;  5KYU B;  5KH6 A;  1KC8 U;  2NUP A;  4IIM A;  1RAE B;  3CCJ A;  1NM7 A;  2B86 A;  1M8M A;  1EX4 A;  3NGP A;  3JCM f;  1UUE A;  3HRS A;  4ATO A;  3S3M A;  5KYY B;  3C12 A;  3WVD B;  3HTR A;  1I0C A;  1OX9 A;  1T3S A;  4M77 B;  2FG0 A;  1X43 A;  2XD0 A;  2IIM A;  4XK8 E;  2DRK A;  3C95 A;  5GMK i;  1SEM A;  1AHJ B;  5LJ5 e;  3EHR A;  1KK7 A;  2P4R A;  4C0D C;  1JJ2 S;  3A5Z B;  1IRX A;  1QCN A;  1YBY A;  3LYI A;  3SFM A;  1F1B B;  3EG9 B;  2LMJ A;  3JB9 J;  2W10 A;  4II1 A;  1KHC A;  5DM7 R;  1BI1 A;  2RF0 A;  1WDX A;  2VVK A;  5I11 A;  4M4Z A;  4XTZ A;  3VJP A;  3CC4 Q;  1PCX A;  3OW2 A;  4O5V A;  2RHU A;  3KUF A;  1V1C A;  2NUT B;  4RCB A;  2QG9 B;  1TG0 A;  4BDZ A;  5A0L A;  4UC4 A;  3DB4 A;  2YUP A;  4KUD K;  3EG0 A;  1M2O A;  1YJ9 T;  5LJ5 d;  4MML A;  2EKO A;  3I55 A;  1Z9Z A;  5FLX E;  3MJX A;  3G4S Q;  1NJI C;  4Y92 A;  3JV3 A;  1PNJ A;  1YJN T;  4JLI A;  4OMO A;  3JCM h;  1OI1 A;  1RI0 A;  3MP6 A;  1NE8 A;  3BE3 A;  4MMK A;  4VUB A;  2DD4 A;  2NUZ A;  4PJO G;  1YIT Q;  1RAG B;  1SPK A;  1X6B A;  4KH1 B;  3QJY A;  3JB9 H;  1ZBJ A;  4WCI A;  4IUU A;  4RG2 A;  5EG2 A;  3SWN A;  2YT6 A;  3QKJ A;  4L59 A;  3M58 A;  1Q7Y R;  2XID A;  2RI2 A;  1WLP B;  1B07 A;  1BYM A;  1Q82 U;  2FPE A;  1VYT A;  1VQ5 A;  5GAM d;  1SSF A;  4RTW A;  3DLL A;  4XQ3 A;  1FMW A;  4PJO F;  4FSS A;  2D9T A;  2LCL A;  1PSE A;  1SRL A;  4F7U F;  1D1B A;  2QDY B;  3EG9 A;  2Z0W A;  2YLC A;  1G8X A;  1K0S A;  4PNO A;  2QQB A;  2KEA A;  1RAF B;  1Q86 C;  1I8F A;  2QEX T;  3OYN A;  3OYY A;  4FW2 A;  1VQ8 Q;  2OTL T;  1I4K 1;  1QW1 A;  4N0A C;  2HAX A;  2M9U A;  3X26 B;  4EMK B;  3HFO A;  4M77 A;  4C0G A;  1UJ0 A;  3RES A;  3F70 A;  1TSF A;  2DE0 X;  3CCL A;  2PVD B;  1JU5 C;  5CAI A;  2F2W A;  4AG1 C;  4IUV A;  2H8H A;  5CVI A;  2GF7 A;  3LW5 E;  4QQG A;  3OMG A;  2LCS A;  4AT1 B;  1TOV A;  1WJQ A;  4LDY A;  4XTV A;  3P8D A;  1MV3 A;  1AZG B;  1NPR A;  2JUF A;  2EVR A;  2RQW A;  1W1F A;  4M77 C;  2VUB A;  3DLM A;  3ULR B;  3V7R A;  2CZ7 B;  3MEW A;  3SWN C;  4NOY A;  4M7D E;  2DTH A;  3I35 A;  3GPL A;  2QEX Q;  5CCA A;  3UF4 A;  3OBW A;  2FZG B;  4IUR A;  1HXD A;  3ZFJ A;  2X4W A;  1B3Q A;  3OYM A;  3OYK A;  1K9A A;  1D3B A;  3SB2 A;  2HCK A;  4XU3 A;  2JTM A;  2PU9 B;  3NMZ C;  4HVU A;  3QBY A;  2FO0 A;  2CZ0 B;  4MDW A;  4M75 A;  4ZN1 A;  3OYI A;  2RHZ A;  4CC4 B;  4CC7 A;  4HCK A;  3CXC A;  1FMK A;  3V8J A;  4PLL A;  3R6O A;  1Q81 U;  1M30 A;  1PRL C;  3UA7 A;  2KQW A;  2P84 A;  1GBQ A;  5FWC A;  2M0O A;  3VS4 A;  2K2M A;  3L2Q A;  4C92 A;  2DNU A;  5GAO m;  2XIC A;  3CCE Q;  2MF2 A;  4X9C A;  2QQS A;  4B9W A;  3UT1 A;  2J6F A;  2OTJ Q;  3HHT B;  4BI3 A;  2EGE A;  2CYZ B;  3H9N A;  2HD0 A;  2HQE A;  5L23 A;  1YHQ A;  2O4X B;  3CC4 A;  1VYU A;  4HT8 A;  2EBP A;  4C92 B;  5KYU A;  1CKB A;  1G3Y A;  2VAS A;  5IXF A;  4BY6 B;  4RG8 A;  2L3S A;  3FJP A;  4LE9 A;  2QEX A;  4HXJ A;  4J6W A;  2HL3 A;  3PNW C;  5LJ3 e;  3R6N A;  1S1N A;  1AWO A;  2CP6 A;  3CCS T;  2GQI A;  2JM8 A;  3CXC P;  1AWW A;  4C8Q G;  4FYW B;  4OMQ A;  3CCQ T;  4A4F A;  1IO6 A;  3J7A F;  1NLP C;  2DET A;  4CI0 C;  1JEG A;  1WNL A;  4A4E A;  1N9R A;  2LX7 A;  3CMA Q;  1QVF A;  1AOJ A;  3FDR A;  2KBT A;  1LNX A;  1JQQ A;  1JXM A;  4RTX A;  3OYG A;  1VQP A;  4R0K A;  3KXT A;  2F69 A;  1QWF A;  3CCQ A;  1VA7 A;  2LZ6 B;  3H6Z A;  3JCM V;  1ZUY A;  3JCM W;  2O01 E;  1SG5 A;  2DA9 A;  1VQN T;  3L1A A;  1YJ9 Q;  4EMG A;  3SWN B;  4JLG A;  5DY9 A;  2DK3 A;  3M55 A;  4IKF A;  1G5V A;  3CC7 T;  5GAM e;  3X20 B;  2E5K A;  3EGX A;  4FU6 A;  2KY9 A;  5FW9 A;  4RTY A;  2PQW A;  4J83 A;  3S6W A;  3G1J A;  1QCF A;  4N4I A;  1KD1 U;  1T0H A;  4M7D F;  1YNZ A;  2YRC A;  5IH2 A;  5KYX B;  3H0H A;  1OZ2 A;  5CQY A;  3REB B;  2EQI A;  4A63 B;  5D6W A;  2X9H A;  2FZK B;  2PUO B;  1JJ2 A;  1N8R U;  4M7D C;  1WJR A;  2D0N A;  2DVE A;  1W2B S;  3VYG A;  4TVR A;  1ZX6 A;  2V8K A;  2KI7 A;  4IUT A;  1NLO C;  1QVF P;  4NL3 A;  2F5T X;  4OB0 B;  4JJD A;  4PJN A;  4FL6 A;  1VQL T;  2PVO B;  2VXF A;  2CZ6 B;  4BE1 A;  1WI7 A;  3OW2 S;  1S72 Q;  2E4H A;  3CME Q;  1ZSZ A;  4C92 E;  3G71 T;  3CD6 A;  5KCH A;  2G6F X;  2A7Y A;  4M75 C;  4K11 A;  3X24 B;  2PTK A;  2E65 A;  1VQ8 T;  1N8R C;  1UJY A;  1G3S A;  2DXU A;  2HDA A;  2YHT A;  4M7D D;  4CC3 A;  2KT8 A;  3H0I A;  2MMP A;  1OZ3 A;  2R5A A;  5D7U A;  3L2V A;  1ZSZ C;  1U3O A;  4QVC A;  3ZEH A;  3JCM Q;  3CD6 T;  4DOW A;  2MOX A;  3G7Z A;  3AHU A;  1A0N B;  1VQ7 T;  1W4S A;  5DLQ E;  4MZM A;  4AFQ C;  1Q7Y U;  4JJB A;  1M3B A;  3C0C A;  2XMF A;  1ZQ1 A;  1OU9 A;  2KDS A;  3VRY A;  3HKS A;  1W2B A;  2YXY A;  4J9H A;  2KYM A;  1YP5 A;  4OB1 B;  1KC8 C;  2RJD A;  3HRT A;  3CCR Q;  1BI2 A;  2D0Q B;  3PIP A;  1SF9 A;  3GF5 A;  2EAY A;  2KRO A;  1YI2 T;  2JJ9 A;  4J9E A;  2A08 A;  4M7A B;  5HY6 A;  2ED0 A;  1M1G A;  2LVM A;  4JPB W;  4RTZ A;  2DD5 A;  2HBP A;  2RH2 A;  3RNJ A;  3I56 T;  4M77 D;  1D3B B;  2PUK B;  1PD0 A;  1MHN A;  3VUB A;  1XOV A;  1H92 A;  3OS0 A;  2RNA A;  3TVT A;  1YJN Q;  1VQ6 T;  2M0Y A;  3GNG A;  3EFS A;  2CZ1 B;  3I9Q A;  3CCQ Q;  2F5K A;  3TU4 K;  3HRU A;  1EZZ B;  2XG8 D;  1K9M U;  5GAN 7;  4YTL A;  2KT1 A;  5GAM h;  1SRM A;  1ZUK A;  2EPD A;  3I5R A;  4PJO C;  2ROT A;  2E41 A;  3H0F A;  5LJ5 g;  1RAI B;  2O4X A;  2CP5 A;  2O31 A;  1YIJ A;  2QTX A;  3INZ A;  4AMC A;  3A1P A;  4DBF A;  4QKU A;  2RHX A;  1YJW Q;  1Q7Y C;  3EH1 A;  2ZPF B;  4EMK A;  1D0Y A;  3M4G A;  4M7D G;  1TUG B;  1B34 A;  4PKC C;  2XK0 A;  4BE2 A;  1WXT A;  4HT9 A;  3OYE A;  1N9S A;  2ZZD A;  1QVP A;  3TRE A;  2EGA A;  1Y7X A;  1AWX A;  1BIA A;  3LX7 A;  2CT3 A;  2AK5 A;  4JRP A;  3SDZ A;  1GCQ A;  3BDL A;  4DA4 A;  4OMN A;  3QUI A;  4M75 B;  2EW3 A;  2D8J A;  3VS6 A;  8AT1 B;  2RQT A;  1QKX A;  2HZY A;  3V8L A;  4J6X A;  4LN2 A;  3EFR A;  3OY9 A;  3CXC S;  2CT4 A;  4B6M A;  1YI2 A;  2M16 A;  2J06 A;  4M78 B;  2KVQ G;  1JJ2 P;  3EGU A;  4RTT A;  5GJV B;  5GAN 2;  2X3X D;  1YI2 Q;  3FEO A;  4HCC A;  1KQ1 A;  2ZPE B;  3CC4 T;  1EFN A;  2YUN A;  3GOX A;  2LCC A;  2KRS A;  4C8Q F;  3PFS A;  2DZC A;  4A4G A;  4FW1 A;  1CSK A;  5KYY A;  1B7T A;  1UGV A;  1E6H A;  1K4U S;  5HK0 A;  1GXI E;  1K8A C;  3REA B;  2EJF A;  3MEU A;  2RQR A;  1R77 A;  4M78 A;  3TCJ A;  1WA7 A;  1U5S A;  2J7I A;  1RI9 A;  4E7I A;  4KH0 B;  1CKA A;  1ZSG A;  3QZ9 B;  1IRE B;  1V29 B;  1KIK A;  2FRY A;  1I1J A;  4LXC A;  3HSB A;  2FPF A;  4BI8 B;  2JMC A;  2DYB A;  5CIU A;  3CCE T;  5KYW B;  1WXB A;  2K3Y A;  2FEI A;  1X01 A;  1M5Q 1;  2Y90 A;  1AVZ C;  5C0M A;  1T0J A;  1QVF S;  3S3N A;  4JJC A;  1GBR A;  2Y4Y A;  2DTI A;  5KYN A;  2WSF E;  2DL5 A;  1M1K U;  1X6G A;  4Q5W A;  2ENM A;  1VQ9 T;  2DEU A;  5GMK h;  1JO8 A;  2KGT A;  1K9M C;  3OS5 A;  2X4J A;  1BK2 A;  4OMM A;  4Y91 A;  1VOM A;  5GAO p;  2J6O A;  2BKD N;  3O5Z A;  3QSU A;  4OGE A;  4EDU A;  1HSQ A;  2G3R A;  4A4H A;  3V7C A;  5LJ5 f;  1YJW A;  1YWP A;  3CD6 Q;  1ZA1 B;  5GMK e;  1ZLM A;  2H3E B;  5IHN A;  1I07 A;  2CDT A;  4ZNX A;  1HD3 A;  4D8K A;  2K5I A;  2QA4 A;  2QQA A;  2RD1 A;  2GNC A;  1M27 C;  2OI3 A;  3FIF A;  2EQJ A;  1HYO A;  2RJE A;  2OTJ T;  2LJ1 A;  4EMH A;  3JB9 I;  3TEE A;  5GJW B;  2LJ0 A;  1E7O A;  1M1F A;  2ATC B;  2ZPG B;  4JDS A;  4MZP A;  3PGG A;  3M0S A;  2A37 A;  1WQW A;  3PVL A;  1VUB A;  2MWO A;  3CCV T;  1OPK A;  3A8L B;  3QO3 A;  3EG1 A;  4KUI A;  1VQM Q;  3VS0 A;  1MMD A;  3NTI A;  2EYZ A;  1K0X A;  1M1K C;  4OB2 B;  3E9F A;  1YFN A;  4ZGE B;  4XU1 A;  4N0A A;  4F17 A;  1BU1 A;  1OU8 A;  2M1H A;  1UDL A;  2RM4 A;  3JB9 G;  1GCP A;  2VC8 A;  2EYY A;  3CCM T;  3OYC A;  1OPL A;  1QLY A;  1AD5 A;  1WFW A;  4IUQ A;  1M2V B;  3AT1 B;  3SD4 A;  1VQ9 A;  1KJW A;  3JCM d;  4M75 G;  2R58 A;  2DL8 A;  3CC2 T;  1BB9 A;  2EFI A;  2FRW A;  3M0Q A;  3KBG A;  2YUQ A;  1VQ4 T;  4C0Z A;  2VKN A;  3OYA A;  5LJ5 j;  1VQO Q;  1C1A A;  4Z89 A;  3LGF A;  2DIL A;  2JNG A;  2LJ3 A;  4BY6 C;  3CCV Q;  2DIG A;  3CCU A;  5KE3 A;  2GGR A;  4J7F A;  1Y71 A;  1QVG A;  4M7D B;  1AWJ A;  3MHX A;  2E64 A;  3V7S A;  2YUO A;  4IUP A;  3JCM J;  3TSW A;  2JMA A;  2LQW A;  2QA4 T;  2W0Z A;  4E47 A;  1K1Z A;  4LDV A;  1JXO A;  1RLQ C;  2Y4X A;  3GBQ A;  2E3H A;  3QXE B;  3QPH A;  1VQN A;  3CC2 Q;  5GAO n;  3H41 A;  2EGC A;  2COW A;  3CCS Q;  4E7H A;  2RK2 A;  2D8H A;  1UGQ B;  1VQK Q;  2E12 A;  4OGC A;  3E2U A;  3UDC A;  1UEC A;  1VYV A;  2CH4 W;  2RO0 A;  1WX6 A;  2DMO A;  3QHS A;  4KUL A;  1VQK T;  4ANJ A;  2HKN A;  2K5L A;  1C0M A;  3IQL A;  2DEQ A;  2QAS A;  3CBP A;  3MPU B;  1LJO A;  1QVG S;  3LH0 A;  1H3H A;  2EYW A;  2MCN A;  2SEM A;  3T9N A;  4CC2 A;  4C92 F;  4ZN3 A;  2XDB A;  3X25 B;  1D0X A;  2O2O A;  1I5O B;  4PLI A;  5FU6 C;  2CP0 A;  2FL7 A;  1Q82 R;  5CKE A;  1MV0 B;  4HVV A;  4BB7 A;  1KQS P;  2X4X A;  5IAY A;  1IGU A;  3CCU Q;  1OUL A;  3P8H A;  1WIE A;  3M9Q A;  5I2M A;  2RK1 A;  2JTF A;  2KAF A;  3N5B B;  2GTO A;  5GAN d;  3FLG A;  3OYB A;  2EIF A;  3CCU T;  2JVV A;  1U1T A;  1TWB A;  2WAC A;  4C8Q D;  1R0C B;  2C06 A;  2DER A;  1JB0 E;  2DAQ A;  2RPN A;  3CCR T;  1UGR B;  2D1X A;  3QYH B;  4C92 D;  4FT2 A;  4F14 A;  2ZGW A;  2OTL A;  2K7A A;  4ELY C;  4E7J A;  1Y0M A;  3OW2 P;  4J7I A;  2DJZ A;  4F16 A;  3G4S A;  5LJ3 j;  3UPU A;  4PFP A;  2VV5 A;  2L89 A;  3CPW A;  1NEG A;  1YCY A;  1Y96 A;  2E70 A;  1QMC A;  2YDL A;  5KCO A;  5A2Q E;  5GAN 4;  3I55 T;  2AIR B;  1NZ9 A;  1ARK A;  1PM3 A;  3M5A A;  4M78 D;  2RQV A;  4FSX A;  2SRC A;  2X4Y A;  3G4S T;  3I56 A;  2DX1 A;  2ED1 A;  2KK4 A;  2M51 A;  2L2P A;  2V8J A;  4CRI A;  1X6O A;  4M77 F;  3NPF A;  5J3B A;  4LNP A;  1PD1 A;  2LNH B;  3MP8 A;  2DL4 A;  2HMA A;  1Q95 G;  3I5S A;  4PJO B;  3A98 A;  1TH7 A;  4J8O A;  3FB9 A;  3A8G B;  4F7U B;  4GLM A;  4M7A C;  2J6K A;  1Q86 R;  1VQ6 Q;  2R57 A;  3UA6 A;  3FRN A;  4V2S A;  1K8A R;  2B8A A;  2X51 A;  4PK4 A;  4J9I A;  1VIF A;  2J05 A;  5GMK m;  2DRM A;  2LQN A;  4PJO A;  2LX9 A;  5L8R E;  5DLO A;  3OS2 A;  5KE2 A;  4ME7 A;  2HQH A;  3EGD B;  3HP9 A;  4PFZ A;  4C5E A;  1VQ7 A;  2JOY A;  3VV0 A;  3CPW S;  1YIJ T;  4PJO E;  5CKD A;  3J80 E;  1WPY A;  4KGX B;  1FWZ A;  1C6V X;  2RJC A;  4DEX A;  3DKM A; 
#chains in the Genus database with same CATH homology
 3JCM b;  3CC7 A;  3PMI A;  2QDY B;  3FEO A;  3G6E T;  2FYK A;  5M9O A;  2YLC A;  4HCC A;  1KQ1 A;  4X34 A;  2ZPE B;  1M90 U;  2EYQ A;  4PNO A;  2QQB A;  2V8I A;  3CC4 T;  2XDD A;  1NJI U;  3JCM X;  5HK3 A;  1Q86 C;  4LDX A;  1I8F A;  2QEX T;  3OYN A;  3JCM e;  2IVW A;  2LCC A;  3OYY A;  3GOX A;  4C8Q F;  1Q86 U;  1VIE A;  2DZC A;  3PFS A;  3OYJ A;  4A4G A;  3HPW A;  1VQM T;  2OTL T;  1VQ5 T;  1I4K 1;  1QW1 A;  4N0A C;  4JS5 A;  2A3L A;  3CCJ T;  2HAX A;  2M9U A;  3X26 B;  4EMK B;  3HFO A;  4M77 A;  1VQL A;  4C0G A;  5HK0 A;  4XU2 A;  1GXI E;  2H3J A;  3ASK A;  3F70 A;  3MCA B;  3RES A;  1K8A C;  1BI0 A;  2LTO A;  2L3R A;  2EJF A;  4XTU A;  3CCL A;  2PVD B;  4M7A A;  2E10 A;  4A53 A;  5CAI A;  3MEU A;  1VQ6 A;  4OMF B;  4M78 A;  4IUV A;  5FU7 C;  5LJ3 h;  3L2R A;  1KQS A;  5CVI A;  3TCJ A;  2GF7 A;  2OAU A;  2RB6 A;  3LW5 E;  4QQG A;  3OYL A;  2EJ9 A;  3OMG A;  3LWH A;  4M7A E;  1WJQ A;  5FRN A;  4E7I A;  4LDY A;  4ZGJ B;  3OYH A;  3P8D A;  4XTV A;  1NPR A;  2JUF A;  3QZ9 B;  4M77 C;  1IRE B;  1V29 B;  2VUB A;  3DLM A;  3V8K A;  3V7R A;  1Y96 B;  2CZ7 B;  3MEW A;  3SWN C;  1KD1 C;  2LRQ A;  4NOY A;  4M7D E;  1G3W A;  3HSB A;  1VQO T;  2DTH A;  1KHI A;  1N27 A;  3GPL A;  3VU3 C;  5CCA A;  4BI8 B;  3QG1 A;  3OBW A;  5CIU A;  1DJ7 B;  2ZPH B;  3C94 A;  4P5N A;  2KSS A;  3CCE T;  4IUR A;  3Q1J A;  4Y28 E;  2K3Y A;  1UEB A;  4BDY A;  1HXD A;  3ZFJ A;  2X4W A;  2HNI A;  1MGQ A;  1X01 A;  3JB9 D;  3OYM A;  1M5Q 1;  2Y90 A;  3RIR A;  5C6S A;  3OYK A;  5C0M A;  3CCL T;  3BDU A;  1QVF S;  1RL2 A;  3S3N A;  3RMQ A;  1D3B A;  3SB2 A;  1YHQ T;  2DTO A;  2Y4Y A;  2DTI A;  4XU3 A;  2WSF E;  1M1K U;  4ZGD B;  5CKB A;  5GAO q;  5HKC A;  3PIO A;  2JTM A;  2PU9 B;  4WF2 A;  4Q5W A;  4HCZ A;  3QBY A;  1VQ9 T;  4QW2 A;  1ZHI A;  2CZ0 B;  4M77 G;  5GMK h;  1N6A A;  4MDW A;  1K9M C;  3OS5 A;  3VYH B;  4M75 A;  2X4J A;  1YIT A;  1LOJ A;  4ZN1 A;  4FT4 A;  4FIB A;  4M7A G;  2R5M A;  2NLU A;  4XTW A;  4Y91 A;  5CK9 A;  3OYI A;  2RHZ A;  5GAO p;  3OA6 A;  2RHY A;  4PL6 A;  2E6Z A;  2BKD N;  3CXC A;  1JBM A;  3PMT A;  4M75 F;  3CD6 A;  3V8J A;  4PLL A;  4OGE A;  5AYF A;  4EDU A;  3QSU A;  3R6O A;  1ZBX A;  1Q81 U;  3A8H B;  4XAX B;  2G3R A;  1K73 C;  4A4H A;  3CCE A;  3V7C A;  5LJ5 f;  2KQW A;  4C0D B;  1YJW A;  3L42 A;  4OVA A;  1I5L A;  5GMK e;  3CCR A;  2WSE E;  4LD9 K;  2M0O A;  3L2Q A;  2XU8 A;  4OP0 A;  4C92 A;  1S72 T;  2ZPI B;  3G6E A;  1VQO A;  5GAO m;  5GMK l;  1WQ7 A;  3QYG B;  2YLB A;  2XIC A;  2MF2 A;  3GIB A;  4X9C A;  2QQS A;  2P0K A;  3LLR A;  4B9W A;  3UT1 A;  2XDP A;  3CCV A;  3M53 A;  4QVD A;  1K8A U;  3HHT B;  1VQM A;  4BI3 A;  2P0Q A;  3MEV A;  3RKY A;  2CYZ B;  3M54 A;  2IG0 A;  3QJ6 A;  5LJ3 f;  2K5I A;  2QA4 A;  2QQA A;  2HD0 A;  4BE0 A;  2QQR A;  2HQE A;  1B34 B;  2RD1 A;  4GLK A;  4X9D A;  5GAN g;  1YHQ A;  2RHI A;  5GAO l;  4MDX A;  2O4X B;  3J81 E;  5GAM j;  4N4H A;  3CC4 A;  1O9S A;  4HT8 A;  3FIF A;  4C92 B;  1S72 A;  2X35 A;  2EQJ A;  2RA2 A;  2K2V A;  2RJE A;  2LT4 A;  3WVE B;  2OTJ T;  3CBO A;  4NS5 A;  3E19 A;  2ZPB B;  3PT9 A;  1G3Y A;  2RJF A;  3O8V A;  2L5Q A;  5CKF A;  3LWI A;  4JJN K;  1BIB A;  4EMH A;  4XTX A;  3JB9 I;  3TEE A;  4BY6 B;  4RG8 A;  2GQV A;  3CEY A;  3CME T;  4C5H A;  1M1F A;  3FJP A;  2K3X A;  2L8D A;  3M59 A;  3RKW A;  2ZPG B;  3PGG A;  2AHJ B;  3GLX A;  3BFM A;  4J6W A;  4JDS A;  2GCX A;  4M78 F;  4MZP A;  5J39 A;  1WQW A;  2JN0 A;  5FRO A;  3PNW C;  5LJ5 h;  3BY7 A;  1VUB A;  4M78 E;  3PTA A;  2HQX A;  2LQ8 A;  2MWO A;  3QII A;  5LJ3 e;  1VQ4 A;  3CCV T;  1XQH A;  2BUD A;  5GAN 5;  3A8L B;  1VQK A;  3QO3 A;  4LDW A;  2DZ9 A;  2EQU A;  3CCS T;  4KUI A;  1KQ2 A;  3HL8 A;  2K4Y A;  1QP3 A;  2P4T A;  3M57 A;  3LGL A;  4C8Q G;  3NTI A;  1M1K C;  4OB2 B;  3JCM P;  3CCQ T;  3CC2 A;  3E9F A;  4A4F A;  3VUZ A;  4O6J A;  4MZT A;  4JRQ A;  3J7A F;  4C8Q A;  4OB3 B;  4ELZ C;  4CI0 C;  4C5G A;  2P0P A;  1WNL A;  4A4E A;  2JZ2 A;  1N9R A;  4XU1 A;  4EMK C;  4ZGE B;  3QDR B;  3OSV A;  4N0A A;  1BI3 A;  2LNV A;  1QVF A;  2M1H A;  5GAN 8;  1FX7 A;  3OYD A;  4BUG A;  4XU0 A;  3FDR A;  2RM4 A;  3E1S A;  4HCB A;  2EWN A;  3JB9 G;  3BW1 A;  4RKU E;  2GFU A;  2VC8 A;  1LNX A;  3CCM T;  4RCC A;  3M56 A;  4C8Q E;  4F7U A;  3H8Z A;  3OYG A;  1VQP A;  3OYC A;  1UGP B;  3MET A;  4IUQ A;  3SD4 A;  5IT9 E;  1VQ9 A;  2GFA A;  3JCM d;  2DKG A;  3KXT A;  2F69 A;  4FM4 B;  2YRV A;  4M75 G;  2R58 A;  3CMA T;  3CCQ A;  3CC2 T;  2EFI A;  2FVU A;  3H6Z A;  2DXB A;  3JCM V;  4A4K A;  3JCM W;  3KBG A;  2O01 E;  1VQ4 T;  1O75 A;  4D6W A;  4C0Z A;  1VQN T;  3L1A A;  3OYA A;  3OQ5 A;  4EMG A;  4M78 G;  3SWN B;  5LJ5 j;  4JLG A;  4XTY A;  3QZ5 B;  5DY9 A;  2DK3 A;  1U8R A;  3M55 A;  4IKF A;  2DXC A;  3LGF A;  5GAN h;  3ME9 A;  2DIQ A;  2FHD A;  4KT0 E;  3CC7 T;  3OB9 A;  4M75 E;  1G5V A;  5GAM e;  2JNG A;  3X20 B;  4BY6 C;  3JRZ A;  4J5Y A;  1YIT T;  2DIG A;  4FU6 A;  2KY9 A;  2E1H A;  3CCU A;  5KE3 A;  1M90 C;  4KBM B;  1WGS A;  4J7F A;  4PJO D;  3NFC A;  1Y71 A;  1Y07 A;  5LJ3 g;  4R55 A;  3CMA A;  2PQW A;  4GY5 A;  1QVG A;  4M7D B;  4J83 A;  3S6W A;  3E9G A;  3MHX A;  2EJG A;  3CBM A;  4N4I A;  2I2L A;  2E64 A;  5IN1 A;  2OTJ A;  1KD1 U;  5D6Y A;  3V7S A;  2EQM A;  3L2U A;  4F7U E;  4M7D F;  4IUP A;  3JCM J;  5FRM A;  1YJW T;  1M8V A;  1OZ2 A;  5CQY A;  2E5Q A;  5D6W A;  2QA4 T;  4OF1 A;  4E47 A;  2PUO B;  1IZ6 A;  2QEX A;  3VKI A;  1N8R U;  1WJR A;  4LDV A;  1JJ2 A;  5FU7 B;  4M7D C;  2FB7 A;  2DVE A;  3CCM A;  1W2B S;  2VGM A;  2Y4X A;  1H3Z A;  3VYG A;  4TVR A;  3JCM g;  2D6F A;  3QXE B;  2V8K A;  3QPH A;  3L2W A;  1VQN A;  1EIF A;  2EQK A;  5GAO n;  4F7U G;  4IUT A;  1P92 A;  3UWN A;  1JRI A;  1M4Z A;  4NL3 A;  2K5F A;  4JRK A;  2F5T X;  4C8Q C;  4E7H A;  3P8B B;  2RK2 A;  4OB0 B;  3GP8 A;  3RER A;  1X75 C;  1UGQ B;  4FL6 A;  2E12 A;  2PVO B;  1VQL T;  4OGC A;  2VXF A;  2CZ6 B;  5I2S A;  5D6X A;  5I21 A;  4BE1 A;  3L2Z A;  3OW2 S;  2VGN A;  4M7A D;  3UDC A;  1WJS A;  3C4S A;  2KMT A;  2VXE A;  4LDU A;  3WXM B;  4C92 E;  3G71 T;  4R56 A;  2LDM A;  5CR2 A;  2RO0 A;  4HKE A;  2E6N A;  2LQK A;  2A7Y A;  4M75 C;  4BD3 A;  5KCH A;  4RMO A;  4E7L A;  3QHS A;  4KUL A;  1VQK T;  3X24 B;  2DPP B;  2K5L A;  3URG A;  1I81 A;  2E65 A;  3RUX A;  4Z02 A;  1VQ8 T;  3CME A;  1N8R C;  1G3S A;  2DXU A;  4DQ2 A;  3JCM c;  4ZTJ A;  2YHT A;  4BI4 A;  1BKB A;  3MO8 A;  1YJ9 A;  4M78 C;  4M7D D;  2DEQ A;  3ZBD A;  4C92 G;  3A8O B;  1UGS B;  5FU6 B;  3CBP A;  1LJO A;  5GAM g;  3LH0 A;  1QVG S;  1XTD A;  3MEA A;  3JB9 F;  3MP1 A;  2MMP A;  1OZ3 A;  2R5A A;  2RI3 A;  3GNF B;  2WSC E;  3L2V A;  3NTK A;  4ZTF A;  4QVC A;  3ZEH A;  3JCM Q;  2QI2 A;  4DOW A;  3T9N A;  3G7Z A;  4BAC A;  3AHU A;  2LT1 A;  3CD6 T;  1HK9 A;  1VQ7 T;  1W4S A;  4C92 F;  5DLQ E;  2XKO C;  4ZN3 A;  5GAN 3;  4MZM A;  2DO3 A;  4QQD A;  2MI6 A;  4JUV A;  3RMS A;  3X25 B;  1Q7Y U;  2XDB A;  4EPC A;  4PLI A;  1ZQ1 A;  2LC4 A;  5FU6 C;  1QP2 A;  2VYT A;  3FC3 A;  2FL7 A;  1Q82 C;  2KDS A;  5GMK j;  3OBY A;  5CKE A;  4BB7 A;  3HKS A;  1W2B A;  4M77 E;  2X4X A;  5GAO r;  5IAY A;  1Q81 C;  3P8H A;  3M9Q A;  4OB1 B;  5J26 A;  5I2M A;  1VQP T;  2RK1 A;  1R8O B;  3S3O A;  1KC8 C;  4B9X A;  2JTF A;  1KG1 A;  2KAF A;  3N5B B;  2MAM A;  5KH6 A;  2RJD A;  1KC8 U;  3RKX A;  5GAN d;  3HRT A;  2RI5 A;  1BI2 A;  1FXX A;  2D0Q B;  3FLG A;  4M75 D;  2EIF A;  3PIP A;  3OYB A;  3CCJ A;  4E7K A;  3GF5 A;  3JCM f;  3ER0 A;  4N4G A;  2JVV A;  3HRS A;  2EAY A;  3CCU T;  4ATO A;  3S3M A;  1YI2 T;  5GAN e;  3C12 A;  3WVD B;  1U1T A;  4M7A B;  5GAN j;  5HY6 A;  1M9S A;  3TU4 K;  3X28 B;  1M1G A;  2LVM A;  2WAC A;  3M4Y A;  4QQ6 A;  2DD5 A;  2HBP A;  2CKK A;  2RH2 A;  4M77 B;  3I56 T;  4C8Q D;  4M77 D;  2BIV A;  2XD0 A;  1OYX A;  4XK8 E;  3NTH A;  3C95 A;  3OS1 A;  2C06 A;  1D3B B;  5GMK i;  1AHJ B;  2PUK B;  1MHN A;  1JB0 E;  2DAQ A;  3VUB A;  1XOV A;  5LJ5 e;  3CCR T;  3OS0 A;  4C0D C;  4QVZ A;  4C5I A;  1JJ2 S;  1UGR B;  3A5Z B;  3JSC A;  3OSS C;  2XHC A;  3QYH B;  4DOV A;  4C92 D;  1VQ6 T;  4FT2 A;  1YBY A;  2ZGW A;  5GAM f;  2OTL A;  3LYI A;  4JRI A;  3GNG A;  4ELY C;  3DB3 A;  3EFS A;  4E7J A;  2CZ1 B;  4J7I A;  2DJZ A;  3SFM A;  3G4S A;  5LJ3 j;  3UPU A;  2F5K A;  3A8M B;  3JB9 J;  4II1 A;  1KHC A;  1U1S A;  3HRU A;  2VV5 A;  1XNI A;  2L89 A;  2XG8 D;  1BI1 A;  4F7U F;  5DM7 R;  3CPW A;  1YJN A;  1K9M U;  5GAN 7;  1YCY A;  1Y96 A;  2E70 A;  3VJP A;  4XTZ A;  5KCO A;  5A2Q E;  5GAN 4;  4YTL A;  4LD6 A;  3I55 T;  5GAM h;  4O5V A;  3OW2 A;  1H64 1;  2RHU A;  5LJ3 d;  3KUF A;  1NPP A;  1NZ9 A;  4PJO C;  4RCB A;  4C92 C;  3M5A A;  3OMC A;  4BDZ A;  2E41 A;  4L6V 5;  4M78 D;  4FSX A;  1K73 U;  3EAE A;  5LL6 S;  5LJ5 g;  2X4Y A;  2O4X A;  3G4S T;  4M7A F;  3I56 A;  2KK4 A;  5A0L A;  1UB4 A;  1YIJ A;  2QTX A;  2V8J A;  4CRI A;  2QQ9 A;  1X6O A;  4M77 F;  2XI9 A;  3DB4 A;  3INZ A;  4UC4 A;  5CO7 A;  5J3B A;  1PSF A;  3MP8 A;  4KUD K;  4PJO B;  2RHX A;  1TH7 A;  1YJ9 T;  1Q7Y C;  5LJ5 d;  4MML A;  3OYF A;  2EKO A;  3I55 A;  4J8O A;  4L5G A;  2ZPF B;  4EMK A;  2DXT A;  3FB9 A;  3A8G B;  5FLX E;  3M4G A;  4F7U B;  4M7D G;  4C0F A;  1NJI C;  5CQX A;  1B34 A;  4PKC C;  4M7A C;  3CCS A;  2XK0 A;  4BE2 A;  1YJN T;  4JLI A;  2R57 A;  4M7D A;  3FRN A;  3JCM h;  4V2S A;  4HT9 A;  1OI1 A;  1RI0 A;  2B8A A;  1N9S A;  3OYE A;  3HFN A;  2ZZD A;  2QXF A;  1NE8 A;  1VIF A;  3MP6 A;  4MMK A;  4VUB A;  2DD4 A;  5CKH A;  5GMK m;  2CGH A;  3G71 A;  4PJO G;  1QVP A;  4HA8 A;  3TRE A;  4C8Q B;  3CPF A;  1Y7X A;  2ZCF B;  3QJY A;  1BIA A;  5A0D A;  3JB9 H;  4NL2 A;  4PJO A;  3LX7 A;  1KQS S;  2LX9 A;  4IUU A;  4RG2 A;  5EG2 A;  3SWN A;  5GAN 6;  3QKJ A;  5L8R E;  5DLO A;  3OS2 A;  1VQ8 A;  5KE2 A;  2K57 A;  4ME7 A;  3HP9 A;  4C5E A;  4L59 A;  4JRP A;  1G3T A;  3M58 A;  3SDZ A;  4A54 A;  2JOY A;  2PVG B;  3BDL A;  3JAM E;  4DA4 A;  1VQ7 A;  3QUI A;  4M75 B;  3VV0 A;  5GAN f;  2XID A;  3CPW S;  1YIJ T;  4PJO E;  5CKD A;  3V8L A;  2RI2 A;  4J6X A;  2CS7 A;  1BYM A;  2MWP A;  1Q82 U;  3EFR A;  3OY9 A;  3CXC S;  3J80 E;  1VQ5 A;  5GAM d;  1SSF A;  3DLL A;  1YI2 A;  2M16 A;  4M78 B;  2KVQ G;  4XQ3 A;  4PJO F;  1WPY A;  2D9T A;  2LCL A;  1FWZ A;  5A0G A;  4J6Y A;  1PSE A;  2RJC A;  5GAN 2;  3DKM A;  4JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...