3LWHA

Crystal structure of cren7-dsdna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwhA00
3LWHA 4R55A 2JTMA 3KXTA 4R56A 3LWIA
chains in the Genus database with same CATH superfamily
3V8KA 1BCMA 2VYTA 3LGLA 2RHYA 1WHJA 4RTWA 3REAB 1NEBA 3MP1A 2QTXA 4KUDK 1MHNA 1OZ3A 1CKAA 1Y71A 1UFFA 2CREA 4J6XA 1VIFA 1YJ9T 3WXMB 3I9QA 2RK2A 2RA2A 4PLLA 4PJOA 4PL6A 5FRMA 1VQ4A 4BI4A 3VKIA 3JCMd 3OBWA 4HA8A 1KQSS 2DXUA 2K79A 2WSFE 1MV3A 4RKUE 4FT2A 3Q1JA 1BB9A 1PG5B 2MYSA 2OX7A 4EPCA 1YWOA 1YHQT 2DIQA 3EGDB 1YNZA 1UGRB 5EG2A 4RG8A 1SRLA 3VS4A 4D6WA 1GRIA 2DXCA 4ORZA 1VQLQ 1EX4A 4M7AA 5FWBA 2YSQA 3CCRQ 1ZLMA 4NOYA 3E19A 4M75A 3RDVA 3LLRA 1WFWA 4JRIA 4CC4B 1G83A 1KD1C 5DLQE 3OSSC 1SG5A 4ELZC 3TU4K 2DETA 3TREA 1ABQA 1N8RC 3OYMA 1U8RA 2E1HA 3OYAA 5DY9A 1IHVA 3EG0A 1ABOA 2YHTA 3CCQT 4C92B 2DLPA 3QDRB 4IURA 3S3OA 2QK0A 1MGQA 2KE9A 2XK0A 5J3BA 4QQDA 4PJOE 9ATCB 4AFZC 2VXEA 5GAN8 5CKHA 2BZXA 4FW2A 4M78A 1PNJA 3QWYA 2XDPA 3VRZA 2AIRB 3CC2A 1JJ2P 4C0ZA 4O6JA 3CMAT 2DERA 2X3XD 1PD1A 2IPOB 2DL8A 2EJ9A 4NS5A 5FW9A 4D8KA 2E3IA 5CVIA 3JCMX 4JUVA 3JCMW 3RIRA 4BACA 2LDMA 4JS5A 4Y28E 2G6FX 1MMNA 5J39A 2LP5A 1K1ZA 1M9SA 2E41A 2Y90A 4R56A 1LNXA 1D1BA 2CSIA 2O01E 1JEGA 2HDAA 1M2VB 2RJCA 4B9WA 2BE9B 4F16A 1VQPQ 4E7HA 2QTVA 4M75E 4DOVA 1OEBA 4C8QB 5FU6C 4BDZA 3JB9I 3KUFA 2YXYA 1X01A 1I07A 5KYYB 2XHCA 3MEWA 1X43A 4XU0A 2V8JA 2DD5A 3OMGA 3HRUA 4MZPA 4F7UE 5C6SA 1UHCA 4OB0B 3PIOA 2DM1A 3CCMQ 1ZUUA 4AFSC 1PRMC 1JJ2A 1C6VX 2CSQA 1NBEB 3O5ZA 4FL6A 3M58A 1BK2A 1ZSGA 2E3HA 3VU3C 1BIAA 3MP6A 2CH4A 2ESWA 4HXJA 3TCJA 3RERA 1MV0B 1JBMA 5IHIA 2D8HA 1WPYA 4M77F 4ME7A 1YJ9Q 5KCOA 4RG2A 1HYOA 1JJ2S 4LDXA 2KAFA 2DFUA 5D6WA 2YT6A 3E1SA 3CEYA 3JSCA 2BZYA 1FX7A 3UA6A 2RNAA 2DL3A 3OYLA 1VQMA 4C92G 3OYIA 1QCNA 3M56A 1HXDA 3OSVA 2DBMA 1TOVA 1YHQQ 3CCEA 4OMLA 3NHNA 2O88A 3VS7A 1YIJA 4XAXB 5IAYA 4L5GA 3J81E 2HKQB 2CZ0B 2WACA 1PCXA 2HKNA 1KSWA 1QVFP 4RTUA 2J6KA 3JCMf 3VS5A 3SWNB 4M7DA 2FO0A 2EBPA 1VA7A 2JNGA 1NYGA 4FYWB 1R0CB 3LYIA 4RTYA 1TU0B 4C5EA 3CCVA 2QGGA 3LH5A 3JCMQ 3EH1A 4XTVA 4LDWA 4J5YA 3PMIA 1FMVA 3FLGA 2LCCA 2B8AA 1WHGA 1G3TA 2E12A 1SSFA 3C95A 3PNWC 3LH0A 3V7RA 2CKKA 2RQRA 1N8RU 4HCBA 5LJ3d 3EG9A 2RJDA 3ULRB 3MJXA 4K11A 1QP2A 2H3EB 3CCQQ 3H6ZA 2RHUA 2OTJA 3V8LA 4C8QG 1WHMA 4C5IA 1Q86C 3A8MB 3CCST 2HCKA 2EQJA 1H641 1YJNT 2FPEA 3VV0A 3CMAQ 4BD3A 1W2BS 2KROA 3A8GB 5LJ3e 1D0XA 2CP5A 4QW2A 1VQ7T 2L2PA 1QVFA 1ZSZB 1IGQA 5L23A 1H3HA 1UB4A 1CKBA 3HKSA 1WQWA 4WF2A 1WJRA 1Y96B 5KH6A 2E64A 2QQRA 3CCUQ 2ABLA 4BUGA 2EQIA 2ECZA 1VQKA 2R57A 2KRNA 2KYMA 1N8RR 2DTOA 1T3LA 2VKNA 2A36A 2X4YA 5GAMg 1ZX6A 1D1AA 4M7AF 4N0AC 2FZCB 3L2QA 2Z0WA 1Y07A 3M5AA 3PFSA 1Q81C 1N5ZA 1I0CA 4M75F 3VUBA 4Y91A 1K73U 3MPUB 5GANg 2JTEA 2M0OA 2YRCA 1T0HA 5LJ5h 1UDLA 1OZ2A 3PIPA 1E7OA 2K4YA 2M1HA 4OMFB 1QCFA 2GF7A 2KY9A 2XD0A 3EH2A 2O4XB 1TH7A 5GAOm 2E6NA 2ZPEB 3AHUA 4JDSA 4HT9A 5C0MA 1UECA 2YLCA 2QQBA 5A2QE 3L2VA 2P0KA 2OAUA 4HVWA 1F1BB 4J9HA 2EAYA 4Z8AA 3NTHA 3QSUA 4M78F 2HD0A 1E6HA 4D8DA 3GBQA 2HL3A 3VRYA 2F2WA 2A08A 3OYCA 4QQ6A 2GTOA 3O8VA 5GAMd 4J9EA 4HT8A 1FMWA 4XK8E 2COYA 1N9RA 4J9CA 2KYBA 2R58A 1K73R 4BDYA 3BDLA 5KE2A 4QQGA 4C8QD 2E10A 4LE9A 2MWPA 1HSQA 1BI0A 4M4ZA 5GANd 1KQ2A 2AZVA 1W6XA 3LGFA 3GOXA 3LW5E 1PRLC 1M8MA 5FU7B 1IHWA 3L2ZA 5GAOn 2RK1A 3HPWA 1B7TA 4N4IA 3WVDB 1FYNA 2WSCE 4M77C 4EIKA 3CCJA 4JZ4A 5GAMe 3H0IA 5FRNA 1VUBA 4C92E 3OW2S 3G6ET 2MAMA 2Y4XA 1S72A 2V1QA 1QP3A 4OMNA 2EYXA 1YCSB 2RQWA 2DZ9A 2JT4A 2DZCA 3HL8A 2EYQA 1IB8A 2GNCA 2NUPB 4E7KA 1YFNA 1NPPA 1NLPC 1B3QA 1X69A 2CUDA 1ZHIA 1M1GA 2QDLA 3OYEA 1NYFA 2L3RA 4RTVA 4Z89A 4OB3B 1DJ7B 2VUBA 3H8ZA 2K6DA 1NLOC 3PVQA 3QYHB 2ZPGB 3DLLA 2LX7A 1KQ1A 4BE1A 3LX7A 3CCSQ 2DVJA 2JMAA 3UATA 1LOJA 2A7YA 1YJNQ 1MUZA 1TUCA 1RLPC 1H3ZA 1WXBA 2NWMA 3G4ST 2I0NA 2NUTA 4FSSA 5LJ5f 4M77D 1VQPA 4FM4B 1VQ7Q 4HCKA 4QVDA 4E47A 5KYNA 2DTHA 2GQVA 2KEAA 2RB6A 2MPXC 1SHGA 1RAAB 2YLBA 3SEMA 4GBQA 1X6OA 3BE3A 4M7AG 2YRVA 4E6RA 1ZA1B 4GY5A 1WHKA 3UF4A 2FEIA 2OI3A 5FU6B 1UG1A 1AZGB 3CCMA 3RKXA 5CO7A 4FU6A 3ZEHA 1YJWA 2P84A 4F14A 3JCMJ 5I21A 3MHXA 4M7DF 1OU9A 2L8DA 3I56A 2RJFA 4ZN1A 1M8VA 4PJOC 3HHTB 2BTTA 1Q81U 3VS3A 3JCMP 2LVMA 1K8AU 3MO8A 2DXBA 4A4KA 3CBPA 1VQ8T 1YJ9A 1PSFA 3MCAB 5CR2A 3G7ZA 3SFMA 2XMFA 2OTLT 3E9GA 4Z02A 2L5QA 3VS1A 2A28A 1M90U 2EGCA 3JB9H 1X75C 4M78G 4EMHA 5GAMj 3EHRA 2QI2A 1BBZA 1M1FA 3CC7T 1Y57A 2RD1A 4MDXA 3M0TA 2YDLA 3MP8A 2V1RA 1QVGP 1Q82C 4OB2B 5IHNA 4M7AC 3PT9A 1JQQA 4JRKA 3CPWP 1M27C 5GANj 2DRMA 4BI3A 1T0JA 3QKJA 4M75C 2RO0A 3MEUA 1Y96A 1I5LA 4PJJA 2IVWA 4HVVA 2MMPA 2FHDA 1EZZB 4J6WA 4BY6C 4A4HA 4J8OA 1ZUKA 1YP5A 2Y4YA 4LDYA 1B34A 1X2KA 2LRQA 3OYFA 1Q81R 2LQKA 5KYWA 1K8AR 3ZFJA 4OMQA 2J6FA 4EMKA 3QJYA 4J9BA 3PVLA 1QWEA 3L1AA 4R0KA 2SEMA 4J9DA 1D3BB 1SRMA 2MWOA 4HCCA 4VUBA 2CYZB 2GFUA 3X25B 2VVKA 4M78C 2DKGA 5D7UA 3DKMA 1KC8U 1AWJA 3E2UA 3GNFB 3CCQA 1AZEA 4J9GA 5GMKh 2JTMA 4KUIA 2A37A 3CPFA 4C5GA 4M7AD 3H0HA 1QVGA 2FYKA 3CPWA 3V7CA 1HK9A 3ZBDA 1UGQB 3P8HA 4PJMA 5CKDA 2DL7A 1UGSB 1D0ZA 1D1CA 2QQAA 4KT0E 1AOJA 4F7UA 2LJ3A 2EKHA 3I5RA 2KQWA 1K9MU 2QG9B 4A53A 3N5BB 1T3SA 4AG1C 3D7SB 5FWCA 1TUGB 2X3WD 4OMOA 2V8IA 2DVEA 1WLPB 4PFPA 4XU3A 4R55A 2EQMA 2KT8A 1KIKA 2BUDA 3RMQA 3JCMh 3BW1A 2XI9A 4WTOB 3CPWS 2KT1A 3CCUA 2C0OA 3FEOA 1UJYA 3OA6A 3H9NA 2NYSA 3REBB 5IXBA 2KI7A 3G4SQ 1PKTA 4M78D 1W4SA 3JCMc 1TUDA 5CKFA 3RKWA 2PU9B 4A4GA 2NLUA 1WXTA 2YUQA 4CRIA 2E6ZA 3GLXA 2JJ9A 3CC4A 3QPHA 3G71A 1G2BA 5IN1A 4M7DG 3EGXB 3HRTA 1K9MR 2O31A 2QEXT 1VQ6A 5GMKl 4E7LA 4JJNK 2VXFA 4LN2A 1K73C 2XICA 1BIBA 1X6BA 3QWXX 4DBQA 2NUPA 3AT1B 3META 3EHQA 1V76A 3OS0A 2RM4A 2M16A 4GLKA 4RMOA 4DQ2A 1VQ8Q 4OMMA 4E7JA 1VQOA 4L6V5 2J6OA 2EGAA 4IUTA 3M4YA 2KDSA 2OTLQ 1U1SA 1GBQA 2M51A 2DEUA 1OV3A 4IUUA 3M59A 1QCOA 1V29B 3CC7Q 4FT4A 3UT1A 1QKWA 2RN8A 1WJQA 3OBYA 3VYGA 4LDUA 4M7DC 3NTKA 1YI2A 2PVDB 3M57A 2PVGB 1BI1A 1Q82U 2AK5A 5LJ3g 2GGRA 2JTFA 6AT1B 1OQKA 2VC8A 1XOVA 1QMCA 2EQUA 1FWZA 2LQNA 1G3YA 5J26A 2LJ1A 3VYHB 2VV5A 3CMET 1BU1A 3L2WA 3FJ5A 2D9TA 4M77B 2QYZA 4KGVB 3JB9F 2KSSA 1AEYA 2C06A 4F17A 3QIIA 2XU8A 1U06A 2D0QB 4DEYA 2EJFA 4XTUA 1XTDA 3FJPA 3LWHA 1RI9A 4KGZB 3OS2A 1TXQA 5I11A 4BI8B 1H92A 2DXTA 5ECAA 3NFCA 4OVAA 2ZPHB 4M7DD 1Q82R 3C0CA 5GAOl 1IO6A 1GCPA 3OYNA 1YJNA 4ZNXA 4LUEA 3RNJA 1VQMT 1VQ9T 3IQLA 7AT1B 1UE9A 4YTLA 3CCET 4OGEA 5LL6S 2JS2A 1YIJT 1ZBXA 4LDVA 1OPLA 2L89A 2VGMA 1WNLA 1YITT 4QKUA 1AWXA 1AVZC 1IREB 2LT4A 4FCYA 4OB1B 1AWOA 2RHIA 3TSZA 2CH4W 2X4WA 2YRDA 2BKDN 1K0XA 1OYXA 2FVUA 2DO3A 1OU8A 4PJOF 3CCVT 2EYWA 3X24B 4WCIA 1QVPA 4PNOA 4LUDA 1N6AA 3EGDA 2RMOA 4II1A 2ZGWA 1JRIA 2RJEA 1WIEA 1I4K1 3GPLA 3GF5A 4X34A 1WJSA 2AZSA 1SF9A 5LJ5e 2FB7A 2E5KA 4C0DC 1D09B 1GCQA 3FIFA 3QHSA 1LCKA 2DNUA 3M0PA 2OTJT 2L0AA 1OOTA 2MCNA 1PKSA 2IIMA 2K3YA 3OMCA 1K4US 2QEXQ 4J7FA 1TSFA 2C0IA 4DBFA 1QVFS 3GIBA 2CZ6B 5GAOr 1K8AC 1QKXA 4CC2A 2LCSA 5I22A 4IUPA 4C92A 2LZ6B 3CBOA 3M54A 1G3WA 1Q7YU 2RHZA 1FXXA 1M90C 4B9XA 4XTZA 1QLYA 4HCZA 2NUZA 5HCKA 4F7UF 4RTXA 3EFOB 2DL5A 4M77G 4UC4A 4M7AB 2K2VA 1VQKT 1WZOA 1RACB 2E70A 1TWBA 5FLXE 1NPRA 4M75B 1UHFA 3A8LB 2COWA 4B6MA 1X2QA 2WSEE 2QQSA 3PE0A 3ZL7C 2KXDA 4NL2A 4J6YA 4BY6B 3A5ZB 1UUEA 2HSEB 1VQLA 2DYBA 2DPPB 2O9VA 4RCBA 3CCRA 2AHJB 2XDDA 3EAEA 3FC3A 2DAQA 4JLIA 2LC4A 1M2VA 3I55T 4KGXB 4RTZA 2JOYA 4C8QA 2XG8D 3OS1A 3CMEQ 2H3JA 4JJCA 1Q7YR 3LWIA 2J7IA 3C4SA 5KYXB 1BYMA 1N27A 4C5HA 4M78B 3A98A 5KYYA 2MIOA 1KC8C 1VYUA 1GFDA 2LNHB 4J9FA 5GAN6 2X9HA 4A4FA 5LJ3j 4XTWA 4PLIA 2C0TA 3EFRA 1X27A 2LX9A 2QDYB 1WX6A 2DF6A 1K9MC 2KVQG 1MMAA 2D1XA 2HQHA 4XTXA 1NEGA 1P92A 1VQMQ 3KBGA 1VQ9Q 1M5Q1 1YN8A 2DIGA 3G4SA 3J80E 4X9CA 1TTHB 1O75A 3QJ6A 1EIFA 2PZ1A 2P0QA 2L3PA 2K7AA 4CC7A 2HZYA 1YIJQ 4PJLA 3A1PA 4PJOG 1YITQ 1PM3A 3CCJT 4HKEA 2W0ZA 1PD0A 2E4HA 1VQ5T 1RI0A 2JM9A 3ME9A 1S72T 2YUPA 3ER0A 1S1NA 3CCVQ 1U3OA 2QA4T 5LJ3f 2FPDA 2RI3A 1ZBJA 8AT1B 4MZTA 3SD4A 1RAHB 4C8QE 1JXOA 5AYFA 2VWFA 2GFAA 4QVCA 4ANJA 5CAIA 2P4TA 1VQNT 4QT7A 4C0FA 2JS0A 2AKKA 4LNPA 3HFOA 3X20B 3S3MA 1WXUA 3SWNA 2HBWA 1WHLA 5CKBA 1KQSP 3BY7A 1RUWA 4DA4A 4MZMA 5CQYA 2HQXA 4ZGDB 4M75G 5GMKi 3A8OB 2OTJQ 1IGUA 1B07A 2KK4A 1VQ8A 3QUIA 2QQ9A 1XJWB 4N4GA 1Y0MA 2K3BA 4ESRA 2YUOA 1KFZA 4HVUA 4C0GA 3JB9D 2OTLA 2EYYA 1KJWA 2EVRA 3VUZA 2LQWA 3BFMA 4FW1A 2DILA 3CC7A 4IIOA 1LJOA 4KULA 3CCLT 3CD6T 4V2SA 4JZ3A 2QASA 3HRSA 3M4GA 4AG2C 1X6GA 1R77A 5CK9A 1QWFA 4MMLA 1SSHA 2ZCFB 1UJ0A 4EMKC 2DJQA 3S3NA 5AT1B 2QAZA 1SHFA 3S6WA 2J06A 1VQKQ 4M7DB 3UPUA 1O9SA 4OP0A 1OULA 4AT1B 1YJWT 2G3RA 2ZPFB 2QXFA 1U5SA 1V1CA 2EPDA 2LQ8A 1C0MA 1ZSZA 2CP2A 2ZAEA 3I56T 3G1JA 2HQEA 1YHQA 4A4EA 1ZA2B 2CP3A 1KQSA 4M77E 4P5NA 4ZGEB 3OYJA 1WDXA 5GJWB 1M30A 2JN0A 3EG9B 2EKOA 4GLMA 3CBMA 1RLQC 4AFUC 4PJOD 3JV3A 3V7SA 1I1JA 1VOMA 2JXBA 1JXMA 5GMKe 3I55Q 4X9DA 2LTOA 3M0SA 3QBYA 1SPKA 2MF2A 1SEMA 3OYHA 3MKDA 4JLGA 1M90R 1BCOA 3M0UA 5IT9E 3NTIA 5GAMf 3P8BB 3TQ7P 1K0SA 4ZN3A 3G6EQ 2DL4A 1GXIE 2O4XA 2K57A 3X26B 1VQ4T 4C92F 1OX9A 2K2MA 2QGFB 3EFOA 5GANf 2XDBA 1G8XA 4M75D 1ZQ1A 3JCMe 3PMTA 2F69A 1KK7A 5FU7C 2R5AA 3OYDA 3E9FA 5M9OA 2RPNA 3PTAA 2RI2A 2X35A 3F70A 3TSWA 3CMAA 1RAFB 4KH1B 4E2FB 2SRCA 4IKFA 4LXCA 1K9AA 1CSKA 2XIDA 2FPFA 1QVGS 3CCJQ 2F2VA 2AT1B 4J7IA 4A54A 4QVZA 1VQ5Q 3QZ9B 2A3LA 1WI7A 4BE0A 1S72Q 5HK0A 2HL5C 3UA7A 3VS6A 1UGPB 1BI3A 1MNDA 1AWWA 4L59A 4EDUA 1KC8R 4E7SA 3ASKA 2QA4Q 4PJNA 3OB9A 2QEXA 3C12A 3EGUA 1QW1A 5KYXA 5IHKA 4C0DB 2V26A 2EWNA 5GAN7 1M1KC 1VQNQ 4C8QF 5CQXA 5I2SA 4J9IA 2DRKA 2CT4A 2CP6A 3OYBA 1RAIB 1PC0A 2GQIA 3DB3A 2F5KA 2MI6A 1HD3A 2GTJA 2KRMA 2K5FA 2KXCA 3R6NA 1WGSA 3CCUT 3RMSA 3CC2T 4IUQA 4M7AE 1Q7YC 4DEXA 2FRWA 1G5VA 2JMCA 4LD9K 3HSBA 5GMKj 3JCMV 2JVVA 2LT1A 1MMGA 3QG1A 2DK3A 2DD4A 4PFOA 3M53A 3CCLQ 1C1AA 3CD6Q 1M3CA 1GFCA 4FIBA 1JB0E 4PFZA 4DOWA 2OJ2A 3M0RA 3OYYA 4CC3A 2M9UA 1Z9QA 3QZ5B 3CC4T 3G71T 3EG3A 1BI2A 3H41A 2RQVA 3X28B 2CP0A 4JRPA 3DLMA 2V8KA 1HJDA 2RQTA 3FDRA 2DYIA 5EC7A 3RR6A 2ROLA 1VQ6T 3KFVA 1YJWQ 5D6YA 1M2OA 2GBQA 2LJ0A 2DEQA 1G3SA 3RESA 3CMEA 1M4ZA 2BIVA 2E5QA 3C94A 4Z88A 3I56Q 1D0YA 2VB6A 3KXTA 3OY9A 4ZTFA 3QDFA 4M78E 4JJBA 1AT1B 2EW3A 1OPKA 1KG1A 1MNEA 3TVTA 5GJVB 1XQHA 2DBKA 3THKA 1PWTA 1M3BA 2W10A 5A0GA 8ATCB 2KNBB 1VQOT 1RABB 3RBBB 3OQ5A 2LCLA 5LJ5g 3L2RA 1W2BP 2ED0A 1IZ6A 2DA9A 1PSEA 1OX8A 1IRXA 4OF1A 1M3AA 4XQ3A 1NZ9A 2CT3A 3JAME 2NUTB 3T9NA 2A0FB 2O9SA 5DM7R 1YI2T 1VQ9A 1ZUYA 1NG2A 1GBRA 1NJIC 2EFIA 5GAN2 5KYUB 5KE3A 2RI5A 3M9QA 1YITA 1VQ4Q 1ACMB 5D6XA 2HAXA 3CCSA 2HEQA 1RL2A 2PQWA 2IG0A 2DTIA 4Y92A 5GMKm 2VGNA 1Y7XA 1KHIA 1GCQC 1VQ7A 2EJGA 3L42A 1I5OB 4CI0C 2RF0A 4N4HA 1KD1U 2K5IA 2PUKB 4ZTJA 5LJ5d 1W2BA 3RKYA 1R8OB 2KRSA 3UWNA 2PVOB 1YWPA 4IIMA 3M0QA 4XU2A 2OAWA 4J83A 4OMPA 4FYXB 4C92C 1VIEA 2PTKA 3V8JA 2HSPA 3HP9A 5CIUA 2BZ8A 2FZGB 2LMJA 1FMKA 1D3BA 1IXDA 2EQKA 4MMKA 5GAN5 1UTIA 5GAOp 2FL7A 2KMTA 2D8JA 2PUOB 1TG0A 3GP8A 2KR3A 1M1KU 2E65A 3VS2A 1NM7A 2HBPA 3FB9A 2KBTA 4PJOB 5IXFA 3L2UA 2K3XA 2J05A 1PHTA 1KD1R 3CC2Q 5I2MA 3SDZA 3OYGA 2XKOC 1RADB 2F5TX 1B34B 1RAEB 4M7DE 3URGA 5HK3A 2ROTA 3SB2A 5LJ3h 2DX1A 5KYWB 2AKLA 1Q95G 4EMKB 2CS7A 4KRTA 4Q5WA 2DJZA 3OW2P 2P4RA 3EFSA 4F04B 2X51A 5GAN3 4MDWA 5FROA 4BE2A 3EG1A 1JO8A 2COZA 1EFNA 4C92D 4C8QC 1LVKA 2KGTA 2CUBA 3CC4Q 3G71Q 3CXCP 1UEBA 2FRYA 5DLOA 1U1TA 3UDCA 4ELYC 1ARKA 5A0LA 3JRZA 1VQ6Q 1M1KR 3U23A 3I55A 5HY6A 3HTRA 3I35A 3OS5A 1VYVA 1R0BG 4NL3A 1TS9A 3H0FA 1XNIA 4RTTA 4F7UB 3QYGB 3NMZC 1SKUB 4N0AA 2ZPBB 3EGXA 3JB9G 2FZKB 1KHCA 2H8HA 1A0NB 2VASA 2I2LA 3HFNA 3G6EA 1VQOQ 3OYKA 2FG0A 2CP7A 2X4XA 2DE0X 4FSXA 1UGVA 4JRQA 1N9SA 2JW4A 4EMGA 3OW2A 2DMOA 2CDTA 2CZ1B 3EG2A 1GL5A 2L3SA 4E7IA 4BB7A 5GAOq 1YI2Q 3QXEB 3BDUA 1H8KA 3CXCA 5IH2A 4FYYB 4A63B 4E7ZA 4JS4A 2JM8A 2P0PA 1NJIU 1VQLT 1K76A 2R5MA 2F2XA 3VJPA 3CCRT 5LJ5j 3J7AF 3JB9J 1VQ5A 4TVRA 4XTYA 5L8RE 3NPFA 3CQTA 3FRNA 4RCCA 2K5LA 3TEEA 3GNGA 3SWNC 2F1LA 2QA4A 2RQUA 3CCEQ 5GANe 3CXCS 3RUXA 3I5SA 3PGGA 1LPLA 2RHXA 3MEVA 2B86A 1WHHA 3MEAA 1VQNA 4KBMB 3JCMb 5GAMh 1YBYA 4DBRA 4FYVB 5CKEA 3DB4A 2HMAA 2EYZA 3WVEB 4RUGA 2BE7D 5CCAA 1W1FA 4KH0B 1YCYA 5A0DA 4AFQC 5GANh 4M77A 2EIFA 1BKBA 1RAGB 2ENMA 2X4JA 5KCHA 2O2OA 1NJIR 3INZA 1Q86U 5HKCA 4PKCC 4IUVA 2YUNA 5GAN4 1I8FA 2EGEA 4LD6A 4JJDA 2ATCB 2M02A 1AHJB 1WA7A 2K9GA 3A8HB 3M55A 1E6GA 3P8DA 2D6FA 2ZZDA 5KYUA 2JZ2A 3CCLA 2ZPIB 2CZ7B 3CD6A 2JUFA 1OI1A 3SHWA 1W70A 1ZSZC 4X1VA 3VS0A 2CGHA 1QQJA 1WYXA 4PK4A 4ATOA 2YWWA 2D0NA 4XU1A 4O5VA 4F7UG 2GCXA 1VQPT 1JU5C 2HNIA 3JCMg 1Z9ZA 4JPBW 2L3QA 1MMDA 3R6OA 2M0YA 2MK5A 1J3TA 1I81A 2ED1A 4ZGJB 1AD5A 1NE8A 1WQ7A 4DBHA 3QO3A 2RH2A 3NGPA 2PNIA 1Q86R 4AMCA 3CCMT 2MOXA 1VYTA 4OGCA 2LNVA
chains in the Genus database with same CATH topology
3OYBA 1BI0A 4YTLA 4OGEA 5LL6S 3CCET 3V8KA 5GANd 1YIJT 1KQ2A 1ZBXA 3DB3A 2F5KA 4LDVA 2MI6A 2L89A 2VGMA 1WNLA 2VYTA 3LGFA 3LGLA 3GOXA 2K5FA 2RHYA 1YITT 3LW5E 5FU7B 1IREB 2LT4A 1WGSA 3L2ZA 4OB1B 3RMSA 5GAOn 2RK1A 3HPWA 2RHIA 3MP1A 2QTXA 3CCUT 3CC2T 4KUDK 4N4IA 2X4WA 3WVDB 2BKDN 4IUQA 4M77C 2WSCE 1OYXA 3CCJA 1Q7YC 4M7AE 2FVUA 5GANg 2DO3A 1MHNA 1OZ3A 1G5VA 5GAMe 4LD9K 1Y71A 5FRNA 1VUBA 4PJOF 5GMKj 3HSBA 3JCMV 4C92E 4J6XA 1VIFA 3CCVT 3G6ET 3OW2S 1YJ9T 3X24B 2MAMA 3WXMB 2Y4XA 2JVVA 1QVPA 1S72A 2LT1A 3QG1A 2DK3A 2DD4A 4PNOA 2RK2A 1QP3A 2RA2A 3M53A 4PLLA 1N6AA 4PJOA 4PL6A 4II1A 2ZGWA 2DZ9A 1JRIA 4FIBA 1JB0E 2DZCA 5FRMA 4DOWA 3HL8A 1VQ4A 2RJEA 4BI4A 2EYQA 3OYYA 2M9UA 3VKIA 3JCMd 3QZ5B 3CC4T 4E7KA 3G71T 3OBWA 1NPPA 1I4K1 4HA8A 3GPLA 1KQSS 2DXUA 1BI2A 3GF5A 3X28B 4X34A 1WJSA 2WSFE 1ZHIA 4JRPA 1M1GA 4FT2A 3DLMA 2V8KA 3Q1JA 4RKUE 2L3RA 5LJ5e 3OYEA 2FB7A 4OB3B 4C0DC 1DJ7B 3FDRA 2VUBA 3QHSA 3FIFA 1VQ6T 3H8ZA 2OTJT 4EPCA 3QYHB 5D6YA 1YHQT 2DIQA 2K3YA 3OMCA 2DEQA 1G3SA 3RESA 3CMEA 1M4ZA 2BIVA 4J7FA 2E5QA 2ZPGB 3C94A 1UGRB 5EG2A 3DLLA 4RG8A 1QVFS 1KQ1A 4D6WA 4BE1A 3KXTA 3GIBA 2CZ6B 3LX7A 3OY9A 2DXCA 4ZTFA 4M78E 5GAOr 1LOJA 2A7YA 1K8AC 4M7AA 1H3ZA 1KG1A 4IUPA 1XQHA 4C92A 3G4ST 4NOYA 3CBOA 3E19A 4M75A 3M54A 1G3WA 5A0GA 4M77D 5LJ5f 1Q7YU 2RHZA 1VQOT 1VQPA 3LLRA 4JRIA 4FM4B 3OQ5A 1FXXA 1M90C 4B9XA 4XTZA 2LCLA 1KD1C 5DLQE 5LJ5g 3OSSC 3L2RA 4HCZA 4ELZC 4QVDA 3TU4K 4E47A 4F7UF 1IZ6A 2DTHA 2GQVA 3TREA 1N8RC 1PSEA 2RB6A 2YLBA 4M77G 3OYMA 1U8RA 2E1HA 3OYAA 5DY9A 4UC4A 4M7AB 2K2VA 4OF1A 1VQKT 4XQ3A 1X6OA 4M7AG 2YRVA 2E70A 2YHTA 3CCQT 1NZ9A 4GY5A 4C92B 5FLXE 3JAME 1NPRA 3T9NA 4M75B 5FU6B 5DM7R 1YI2T 1VQ9A 3A8LB 3QDRB 3CCMA 3RKXA 1NJIC 4IURA 2WSEE 5CO7A 3S3OA 2EFIA 2QQSA 4FU6A 1MGQA 3ZEHA 1YJWA 5GAN2 3JCMJ 5KE3A 4NL2A 5I21A 2RI5A 2XK0A 3MHXA 3M9QA 4J6YA 4QQDA 5J3BA 4BY6B 4M7DF 4PJOE 2VXEA 5GAN8 2L8DA 5CKHA 3I56A 1YITA 3A5ZB 2RJFA 4ZN1A 4M78A 5D6XA 2HAXA 3CCSA 1M8VA 4PJOC 3HHTB 2XDPA 1VQLA 3CC2A 1RL2A 2DPPB 4C0ZA 4O6JA 3CMAT 1Q81U 2PQWA 4RCBA 2IG0A 2LVMA 2DTIA 2AHJB 2XDDA 3EAEA 3CCRA 3JCMP 2EJ9A 4NS5A 3FC3A 2DAQA 5GMKm 3MO8A 1K8AU 4JLIA 2DXBA 2LC4A 2VGNA 5CVIA 4A4KA 1Y7XA 3CBPA 3JCMX 1KHIA 3I55T 1VQ8T 1YJ9A 4JUVA 3JCMW 1PSFA 2JOYA 3MCAB 2XG8D 4C8QA 3OS1A 2H3JA 1VQ7A 3RIRA 3LWIA 5CR2A 2EJGA 3L42A 4BACA 3G7ZA 3C4SA 2LDMA 3SFMA 4CI0C 2OTLT 1BYMA 4JS5A 3E9GA 4N4HA 4Y28E 4Z02A 1N27A 2L5QA 4C5HA 4M78B 1M90U 1KD1U 2K5IA 3JB9H 1X75C 5J39A 1KC8C 2PUKB 4M78G 4EMHA 5GAMj 4ZTJA 1M9SA 2E41A 2QI2A 2Y90A 5LJ5d 1W2BA 3RKYA 4R56A 1M1FA 1LNXA 1R8OB 3CC7T 2RD1A 5GAN6 3UWNA 5LJ3j 4A4FA 4MDXA 2PVOB 2O01E 3MP8A 4XTWA 1Q82C 4OB2B 4M7AC 3PT9A 4JRKA 2RJCA 4PLIA 4B9WA 4XU2A 4M75E 4E7HA 4J83A 4DOVA 5GANj 4C8QB 4BI3A 4C92C 1VIEA 3EFRA 3QKJA 4M75C 5FU6C 2RO0A 3V8JA 4BDZA 3JB9I 2LX9A 2QDYB 3KUFA 3MEUA 3HP9A 1X01A 5CIUA 1Y96A 2XHCA 3MEWA 1I5LA 2IVWA 2MMPA 1D3BA 2FHDA 1K9MC 4XU0A 2V8JA 2DD5A 2EQKA 3OMGA 4MMKA 2KVQG 4J6WA 4BY6C 3HRUA 5GAN5 5GAOp 2FL7A 2KMTA 4A4HA 4J8OA 2PUOB 2Y4YA 4LDYA 4MZPA 4XTXA 4F7UE 1P92A 1B34A 5C6SA 3KBGA 4OB0B 3GP8A 3PIOA 2LRQA 3OYFA 1M5Q1 1M1KU 2DIGA 2LQKA 3G4SA 2E65A 4X9CA 3J80E 1O75A 3QJ6A 3ZFJA 1EIFA 1JJ2A 2P0QA 4EMKA 2HBPA 3QJYA 3FB9A 4PJOB 3L1AA 4FL6A 4PJOG 3L2UA 2K3XA 3M58A 1D3BB 3CCJT 2MWOA 4HCCA 4VUBA 4HKEA 1VQ5T 2CYZB 1RI0A 5I2MA 3SDZA 2GFUA 3VU3C 1BIAA 3ME9A 2XKOC 3MP6A 2F5TX 3X25B 3OYGA 1B34B 4M78C 2DKGA 1S72T 3DKMA 3TCJA 1KC8U 3URGA 3RERA 4M7DE 1JBMA 5HK3A 3ER0A 1WPYA 3GNFB 4M77F 3CCQA 3SB2A 5LJ3h 4ME7A 5GMKh 2QA4T 5LJ3f 2JTMA 2RI3A 4KUIA 4EMKB 5KCOA 2CS7A 4Q5WA 4RG2A 2DJZA 3CPFA 4MZTA 3SD4A 4C5GA 3EFSA 4C8QE 4M7AD 5GAN3 4MDWA 1QVGA 5FROA 4BE2A 5AYFA 1JJ2S 2FYKA 2GFAA 3V7CA 4QVCA 3CPWA 1HK9A 5CAIA 3ZBDA 1UGQB 3P8HA 4C92D 4C8QC 2KAFA 2P4TA 5CKDA 4LDXA 1VQNT 4C0FA 5D6WA 3E1SA 1UGSB 3CEYA 1UEBA 2QQAA 4KT0E 5DLOA 3HFOA 3JSCA 1FX7A 4F7UA 1U1TA 3UDCA 3X20B 4ELYC 3S3MA 3SWNA 2KQWA 1K9MU 5A0LA 5CKBA 3OYLA 4A53A 1VQMA 3N5BB 3BY7A 4C92G 3OYIA 4DA4A 4MZMA 3M56A 3JRZA 2HQXA 5CQYA 1HXDA 3OSVA 4M75G 4ZGDB 3A8OB 5GMKi 2V8IA 3I55A 2DVEA 2KK4A 1VQ8A 5HY6A 3CCEA 3QUIA 2QQ9A 4N4GA 4XU3A 3OS5A 4R55A 2EQMA 1YIJA 4XAXB 5IAYA 4L5GA 3J81E 4C0GA 4NL3A 3JB9D 2OTLA 1XNIA 2CZ0B 2WACA 2BUDA 3RMQA 3JCMh 3BW1A 2XI9A 3CPWS 3CCUA 3VUZA 3FEOA 4F7UB 3OA6A 3BFMA 3JCMf 3SWNB 4M7DA 3QYGB 5FU7C 3CC7A 2JNGA 2ZPBB 4N0AA 3JB9G 3LYIA 1KHCA 1LJOA 4KULA 2I2LA 4C5EA 3CCVA 3HFNA 4M78D 3G6EA 3CCLT 1W4SA 3JCMc 3OYKA 3CD6T 5CKFA 3RKWA 4A4GA 2PU9B 3JCMQ 4V2SA 2NLUA 3HRSA 3M4GA 4XTVA 4LDWA 4J5YA 5CK9A 2X4XA 3PMIA 4FSXA 4MMLA 2ZCFB 4CRIA 1N9SA 5GAN4 4JRQA 4EMKC 3FLGA 2LCCA 2B8AA 4EMGA 3S3NA 1G3TA 2E12A 3OW2A 2E6ZA 3GLXA 1SSFA 3C95A 3PNWC 3LH0A 3S6WA 2CKKA 3V7RA 3QPHA 3G71A 3CC4A 1N8RU 4HCBA 4M7DB 5LJ3d 3UPUA 1O9SA 2CZ1B 2RJDA 4OP0A 5IN1A 4M7DG 1QP2A 4E7IA 1YJWT 3HRTA 2G3RA 4BB7A 3H6ZA 2ZPFB 2QXFA 5GAOq 2LQ8A 3QXEB 3BDUA 3CXCA 2RHUA 2QEXT 1VQ6A 5GMKl 4E7LA 2OTJA 3V8LA 3I56T 4JJNK 2VXFA 2HQEA 1YHQA 4C8QG 4A4EA 4C5IA 1Q86C 1K73C 2XICA 3A8MB 4JS4A 3CCST 2P0PA 1KQSA 4M77E 1BIBA 4P5NA 1NJIU 1VQLT 4ZGEB 3OYJA 2EQJA 1H641 2R5MA 1YJNT 3META 3VJPA 3CCRT 5LJ5j 2JN0A 3J7AF 3VV0A 3OS0A 3JB9J 1VQ5A 4TVRA 2EKOA 3CBMA 4XTYA 2RM4A 5L8RE 4BD3A 4PJOD 1W2BS 2M16A 3FRNA 4GLKA 3A8GB 5LJ3e 4RCCA 2K5LA 4QW2A 3TEEA 3V7SA 1VQ7T 4RMOA 1QVFA 4DQ2A 5GMKe 3GNGA 3SWNC 2QA4A 4E7JA 1UB4A 4X9DA 1VQOA 4L6V5 3HKSA 5GANe 3CXCS 1WQWA 4IUTA 4WF2A 3RUXA 3M4YA 1WJRA 2LTOA 3PGGA 1Y96B 2KDSA 2RHXA 3MEVA 3QBYA 5KH6A 1U1SA 2E64A 2MF2A 3OYHA 2QQRA 3MEAA 1VQNA 4JLGA 4KBMB 3JCMb 4IUUA 3M59A 4BUGA 5GAMh 1YBYA 1VQKA 1V29B 5IT9E 2R57A 3NTIA 4FT4A 5CKEA 3UT1A 5GAMf 3DB4A 3P8BB 3WVEB 1WJQA 2DTOA 3OBYA 3VYGA 4ZN3A 4LDUA 5CCAA 2X4YA 5GAMg 3NTKA 1YI2A 4M7DC 2PVDB 4M7AF 1YCYA 3M57A 2PVGB 4N0AC 5A0DA 1BI1A 1Q82U 1GXIE 2O4XA 2K57A 3X26B 1Y07A 5GANh 3L2QA 1VQ4T 5LJ3g 4M77A 3M5AA 2JTFA 2EIFA 4C92F 3PFSA 1Q81C 1BKBA 2X4JA 5GANf 4M75F 5KCHA 3VUBA 4Y91A 2XDBA 3INZA 1K73U 1Q86U 2VC8A 1XOVA 1ZQ1A 4M75D 5HKCA 3JCMe 2M0OA 2EQUA 2F69A 3PMTA 1FWZA 2R5AA 1G3YA 1I8FA 3E9FA 4IUVA 4PKCC 5J26A 4LD6A 5M9OA 5LJ5h 3OYDA 3PTAA 2RI2A 2X35A 3F70A 1OZ2A 3PIPA 1AHJB 3VYHB 3CMAA 2K4YA 3A8HB 3M55A 2M1HA 4OMFB 3P8DA 2GF7A 2VV5A 3CMET 2D6FA 2KY9A 2XD0A 2ZZDA 4IKFA 3L2WA 2JZ2A 2O4XB 3CCLA 2ZPIB 2CZ7B 2D9TA 1TH7A 3CD6A 4M77B 2JUFA 5GAOm 3JB9F 1OI1A 2E6NA 2XIDA 2ZPEB 2KSSA 3AHUA 4JDSA 4HT9A 2CGHA 5C0MA 2YLCA 1QVGS 2C06A 2QQBA 4ATOA 4J7IA 4A54A 5A2QE 4QVZA 3L2VA 2P0KA 3QZ9B 2A3LA 3QIIA 4XU1A 2XU8A 4O5VA 2OAUA 4F7UG 2GCXA 2D0QB 4BE0A 5HK0A 2EAYA 1VQPT 3NTHA 2EJFA 1UGPB 3QSUA 1BI3A 1XTDA 2HNIA 4XTUA 3JCMg 4M78F 2HD0A 3FJPA 4L59A 4EDUA 3LWHA 3ASKA 3OS2A 4BI8B 3R6OA 2DXTA 3OB9A 2QEXA 1I81A 3C12A 4ZGJB 3NFCA 4OVAA 1QW1A 2ZPHB 3OYCA 4QQ6A 4M7DD 1NE8A 1WQ7A 4C0DB 5GAOl 2EWNA 3QO3A 2RH2A 5GAN7 3O8VA 5GAMd 3OYNA 1YJNA 1M1KC 4HT8A 4XK8E 1N9RA 4C8QF 1VQMT 2R58A 4BDYA 3BDLA 5CQXA 5KE2A 1VQ9T 4QQGA 4C8QD 5I2SA 3CCMT 2E10A 4OGCA 2MWPA 2LNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWH A;  4R55 A;  2JTM A;  3KXT A;  4R56 A;  3LWI A; 
#chains in the Genus database with same CATH topology
 3V8K A;  1BCM A;  2VYT A;  3LGL A;  2RHY A;  1WHJ A;  4RTW A;  3REA B;  1NEB A;  3MP1 A;  2QTX A;  4KUD K;  1MHN A;  1OZ3 A;  1CKA A;  1Y71 A;  1UFF A;  2CRE A;  4J6X A;  1VIF A;  1YJ9 T;  3WXM B;  3I9Q A;  2RK2 A;  2RA2 A;  4PLL A;  4PJO A;  4PL6 A;  5FRM A;  1VQ4 A;  4BI4 A;  3VKI A;  3JCM d;  3OBW A;  4HA8 A;  1KQS S;  2DXU A;  2K79 A;  2WSF E;  1MV3 A;  4RKU E;  4FT2 A;  3Q1J A;  1BB9 A;  1PG5 B;  2MYS A;  2OX7 A;  4EPC A;  1YWO A;  1YHQ T;  2DIQ A;  3EGD B;  1YNZ A;  1UGR B;  5EG2 A;  4RG8 A;  1SRL A;  3VS4 A;  4D6W A;  1GRI A;  2DXC A;  4ORZ A;  1VQL Q;  1EX4 A;  4M7A A;  5FWB A;  2YSQ A;  3CCR Q;  1ZLM A;  4NOY A;  3E19 A;  4M75 A;  3RDV A;  3LLR A;  1WFW A;  4JRI A;  4CC4 B;  1G83 A;  1KD1 C;  5DLQ E;  3OSS C;  1SG5 A;  4ELZ C;  3TU4 K;  2DET A;  3TRE A;  1ABQ A;  1N8R C;  3OYM A;  1U8R A;  2E1H A;  3OYA A;  5DY9 A;  1IHV A;  3EG0 A;  1ABO A;  2YHT A;  3CCQ T;  4C92 B;  2DLP A;  3QDR B;  4IUR A;  3S3O A;  2QK0 A;  1MGQ A;  2KE9 A;  2XK0 A;  5J3B A;  4QQD A;  4PJO E;  9ATC B;  4AFZ C;  2VXE A;  5GAN 8;  5CKH A;  2BZX A;  4FW2 A;  4M78 A;  1PNJ A;  3QWY A;  2XDP A;  3VRZ A;  2AIR B;  3CC2 A;  1JJ2 P;  4C0Z A;  4O6J A;  3CMA T;  2DER A;  2X3X D;  1PD1 A;  2IPO B;  2DL8 A;  2EJ9 A;  4NS5 A;  5FW9 A;  4D8K A;  2E3I A;  5CVI A;  3JCM X;  4JUV A;  3JCM W;  3RIR A;  4BAC A;  2LDM A;  4JS5 A;  4Y28 E;  2G6F X;  1MMN A;  5J39 A;  2LP5 A;  1K1Z A;  1M9S A;  2E41 A;  2Y90 A;  4R56 A;  1LNX A;  1D1B A;  2CSI A;  2O01 E;  1JEG A;  2HDA A;  1M2V B;  2RJC A;  4B9W A;  2BE9 B;  4F16 A;  1VQP Q;  4E7H A;  2QTV A;  4M75 E;  4DOV A;  1OEB A;  4C8Q B;  5FU6 C;  4BDZ A;  3JB9 I;  3KUF A;  2YXY A;  1X01 A;  1I07 A;  5KYY B;  2XHC A;  3MEW A;  1X43 A;  4XU0 A;  2V8J A;  2DD5 A;  3OMG A;  3HRU A;  4MZP A;  4F7U E;  5C6S A;  1UHC A;  4OB0 B;  3PIO A;  2DM1 A;  3CCM Q;  1ZUU A;  4AFS C;  1PRM C;  1JJ2 A;  1C6V X;  2CSQ A;  1NBE B;  3O5Z A;  4FL6 A;  3M58 A;  1BK2 A;  1ZSG A;  2E3H A;  3VU3 C;  1BIA A;  3MP6 A;  2CH4 A;  2ESW A;  4HXJ A;  3TCJ A;  3RER A;  1MV0 B;  1JBM A;  5IHI A;  2D8H A;  1WPY A;  4M77 F;  4ME7 A;  1YJ9 Q;  5KCO A;  4RG2 A;  1HYO A;  1JJ2 S;  4LDX A;  2KAF A;  2DFU A;  5D6W A;  2YT6 A;  3E1S A;  3CEY A;  3JSC A;  2BZY A;  1FX7 A;  3UA6 A;  2RNA A;  2DL3 A;  3OYL A;  1VQM A;  4C92 G;  3OYI A;  1QCN A;  3M56 A;  1HXD A;  3OSV A;  2DBM A;  1TOV A;  1YHQ Q;  3CCE A;  4OML A;  3NHN A;  2O88 A;  3VS7 A;  1YIJ A;  4XAX B;  5IAY A;  4L5G A;  3J81 E;  2HKQ B;  2CZ0 B;  2WAC A;  1PCX A;  2HKN A;  1KSW A;  1QVF P;  4RTU A;  2J6K A;  3JCM f;  3VS5 A;  3SWN B;  4M7D A;  2FO0 A;  2EBP A;  1VA7 A;  2JNG A;  1NYG A;  4FYW B;  1R0C B;  3LYI A;  4RTY A;  1TU0 B;  4C5E A;  3CCV A;  2QGG A;  3LH5 A;  3JCM Q;  3EH1 A;  4XTV A;  4LDW A;  4J5Y A;  3PMI A;  1FMV A;  3FLG A;  2LCC A;  2B8A A;  1WHG A;  1G3T A;  2E12 A;  1SSF A;  3C95 A;  3PNW C;  3LH0 A;  3V7R A;  2CKK A;  2RQR A;  1N8R U;  4HCB A;  5LJ3 d;  3EG9 A;  2RJD A;  3ULR B;  3MJX A;  4K11 A;  1QP2 A;  2H3E B;  3CCQ Q;  3H6Z A;  2RHU A;  2OTJ A;  3V8L A;  4C8Q G;  1WHM A;  4C5I A;  1Q86 C;  3A8M B;  3CCS T;  2HCK A;  2EQJ A;  1H64 1;  1YJN T;  2FPE A;  3VV0 A;  3CMA Q;  4BD3 A;  1W2B S;  2KRO A;  3A8G B;  5LJ3 e;  1D0X A;  2CP5 A;  4QW2 A;  1VQ7 T;  2L2P A;  1QVF A;  1ZSZ B;  1IGQ A;  5L23 A;  1H3H A;  1UB4 A;  1CKB A;  3HKS A;  1WQW A;  4WF2 A;  1WJR A;  1Y96 B;  5KH6 A;  2E64 A;  2QQR A;  3CCU Q;  2ABL A;  4BUG A;  2EQI A;  2ECZ A;  1VQK A;  2R57 A;  2KRN A;  2KYM A;  1N8R R;  2DTO A;  1T3L A;  2VKN A;  2A36 A;  2X4Y A;  5GAM g;  1ZX6 A;  1D1A A;  4M7A F;  4N0A C;  2FZC B;  3L2Q A;  2Z0W A;  1Y07 A;  3M5A A;  3PFS A;  1Q81 C;  1N5Z A;  1I0C A;  4M75 F;  3VUB A;  4Y91 A;  1K73 U;  3MPU B;  5GAN g;  2JTE A;  2M0O A;  2YRC A;  1T0H A;  5LJ5 h;  1UDL A;  1OZ2 A;  3PIP A;  1E7O A;  2K4Y A;  2M1H A;  4OMF B;  1QCF A;  2GF7 A;  2KY9 A;  2XD0 A;  3EH2 A;  2O4X B;  1TH7 A;  5GAO m;  2E6N A;  2ZPE B;  3AHU A;  4JDS A;  4HT9 A;  5C0M A;  1UEC A;  2YLC A;  2QQB A;  5A2Q E;  3L2V A;  2P0K A;  2OAU A;  4HVW A;  1F1B B;  4J9H A;  2EAY A;  4Z8A A;  3NTH A;  3QSU A;  4M78 F;  2HD0 A;  1E6H A;  4D8D A;  3GBQ A;  2HL3 A;  3VRY A;  2F2W A;  2A08 A;  3OYC A;  4QQ6 A;  2GTO A;  3O8V A;  5GAM d;  4J9E A;  4HT8 A;  1FMW A;  4XK8 E;  2COY A;  1N9R A;  4J9C A;  2KYB A;  2R58 A;  1K73 R;  4BDY A;  3BDL A;  5KE2 A;  4QQG A;  4C8Q D;  2E10 A;  4LE9 A;  2MWP A;  1HSQ A;  1BI0 A;  4M4Z A;  5GAN d;  1KQ2 A;  2AZV A;  1W6X A;  3LGF A;  3GOX A;  3LW5 E;  1PRL C;  1M8M A;  5FU7 B;  1IHW A;  3L2Z A;  5GAO n;  2RK1 A;  3HPW A;  1B7T A;  4N4I A;  3WVD B;  1FYN A;  2WSC E;  4M77 C;  4EIK A;  3CCJ A;  4JZ4 A;  5GAM e;  3H0I A;  5FRN A;  1VUB A;  4C92 E;  3OW2 S;  3G6E T;  2MAM A;  2Y4X A;  1S72 A;  2V1Q A;  1QP3 A;  4OMN A;  2EYX A;  1YCS B;  2RQW A;  2DZ9 A;  2JT4 A;  2DZC A;  3HL8 A;  2EYQ A;  1IB8 A;  2GNC A;  2NUP B;  4E7K A;  1YFN A;  1NPP A;  1NLP C;  1B3Q A;  1X69 A;  2CUD A;  1ZHI A;  1M1G A;  2QDL A;  3OYE A;  1NYF A;  2L3R A;  4RTV A;  4Z89 A;  4OB3 B;  1DJ7 B;  2VUB A;  3H8Z A;  2K6D A;  1NLO C;  3PVQ A;  3QYH B;  2ZPG B;  3DLL A;  2LX7 A;  1KQ1 A;  4BE1 A;  3LX7 A;  3CCS Q;  2DVJ A;  2JMA A;  3UAT A;  1LOJ A;  2A7Y A;  1YJN Q;  1MUZ A;  1TUC A;  1RLP C;  1H3Z A;  1WXB A;  2NWM A;  3G4S T;  2I0N A;  2NUT A;  4FSS A;  5LJ5 f;  4M77 D;  1VQP A;  4FM4 B;  1VQ7 Q;  4HCK A;  4QVD A;  4E47 A;  5KYN A;  2DTH A;  2GQV A;  2KEA A;  2RB6 A;  2MPX C;  1SHG A;  1RAA B;  2YLB A;  3SEM A;  4GBQ A;  1X6O A;  3BE3 A;  4M7A G;  2YRV A;  4E6R A;  1ZA1 B;  4GY5 A;  1WHK A;  3UF4 A;  2FEI A;  2OI3 A;  5FU6 B;  1UG1 A;  1AZG B;  3CCM A;  3RKX A;  5CO7 A;  4FU6 A;  3ZEH A;  1YJW A;  2P84 A;  4F14 A;  3JCM J;  5I21 A;  3MHX A;  4M7D F;  1OU9 A;  2L8D A;  3I56 A;  2RJF A;  4ZN1 A;  1M8V A;  4PJO C;  3HHT B;  2BTT A;  1Q81 U;  3VS3 A;  3JCM P;  2LVM A;  1K8A U;  3MO8 A;  2DXB A;  4A4K A;  3CBP A;  1VQ8 T;  1YJ9 A;  1PSF A;  3MCA B;  5CR2 A;  3G7Z A;  3SFM A;  2XMF A;  2OTL T;  3E9G A;  4Z02 A;  2L5Q A;  3VS1 A;  2A28 A;  1M90 U;  2EGC A;  3JB9 H;  1X75 C;  4M78 G;  4EMH A;  5GAM j;  3EHR A;  2QI2 A;  1BBZ A;  1M1F A;  3CC7 T;  1Y57 A;  2RD1 A;  4MDX A;  3M0T A;  2YDL A;  3MP8 A;  2V1R A;  1QVG P;  1Q82 C;  4OB2 B;  5IHN A;  4M7A C;  3PT9 A;  1JQQ A;  4JRK A;  3CPW P;  1M27 C;  5GAN j;  2DRM A;  4BI3 A;  1T0J A;  3QKJ A;  4M75 C;  2RO0 A;  3MEU A;  1Y96 A;  1I5L A;  4PJJ A;  2IVW A;  4HVV A;  2MMP A;  2FHD A;  1EZZ B;  4J6W A;  4BY6 C;  4A4H A;  4J8O A;  1ZUK A;  1YP5 A;  2Y4Y A;  4LDY A;  1B34 A;  1X2K A;  2LRQ A;  3OYF A;  1Q81 R;  2LQK A;  5KYW A;  1K8A R;  3ZFJ A;  4OMQ A;  2J6F A;  4EMK A;  3QJY A;  4J9B A;  3PVL A;  1QWE A;  3L1A A;  4R0K A;  2SEM A;  4J9D A;  1D3B B;  1SRM A;  2MWO A;  4HCC A;  4VUB A;  2CYZ B;  2GFU A;  3X25 B;  2VVK A;  4M78 C;  2DKG A;  5D7U A;  3DKM A;  1KC8 U;  1AWJ A;  3E2U A;  3GNF B;  3CCQ A;  1AZE A;  4J9G A;  5GMK h;  2JTM A;  4KUI A;  2A37 A;  3CPF A;  4C5G A;  4M7A D;  3H0H A;  1QVG A;  2FYK A;  3CPW A;  3V7C A;  1HK9 A;  3ZBD A;  1UGQ B;  3P8H A;  4PJM A;  5CKD A;  2DL7 A;  1UGS B;  1D0Z A;  1D1C A;  2QQA A;  4KT0 E;  1AOJ A;  4F7U A;  2LJ3 A;  2EKH A;  3I5R A;  2KQW A;  1K9M U;  2QG9 B;  4A53 A;  3N5B B;  1T3S A;  4AG1 C;  3D7S B;  5FWC A;  1TUG B;  2X3W D;  4OMO A;  2V8I A;  2DVE A;  1WLP B;  4PFP A;  4XU3 A;  4R55 A;  2EQM A;  2KT8 A;  1KIK A;  2BUD A;  3RMQ A;  3JCM h;  3BW1 A;  2XI9 A;  4WTO B;  3CPW S;  2KT1 A;  3CCU A;  2C0O A;  3FEO A;  1UJY A;  3OA6 A;  3H9N A;  2NYS A;  3REB B;  5IXB A;  2KI7 A;  3G4S Q;  1PKT A;  4M78 D;  1W4S A;  3JCM c;  1TUD A;  5CKF A;  3RKW A;  2PU9 B;  4A4G A;  2NLU A;  1WXT A;  2YUQ A;  4CRI A;  2E6Z A;  3GLX A;  2JJ9 A;  3CC4 A;  3QPH A;  3G71 A;  1G2B A;  5IN1 A;  4M7D G;  3EGX B;  3HRT A;  1K9M R;  2O31 A;  2QEX T;  1VQ6 A;  5GMK l;  4E7L A;  4JJN K;  2VXF A;  4LN2 A;  1K73 C;  2XIC A;  1BIB A;  1X6B A;  3QWX X;  4DBQ A;  2NUP A;  3AT1 B;  3MET A;  3EHQ A;  1V76 A;  3OS0 A;  2RM4 A;  2M16 A;  4GLK A;  4RMO A;  4DQ2 A;  1VQ8 Q;  4OMM A;  4E7J A;  1VQO A;  4L6V 5;  2J6O A;  2EGA A;  4IUT A;  3M4Y A;  2KDS A;  2OTL Q;  1U1S A;  1GBQ A;  2M51 A;  2DEU A;  1OV3 A;  4IUU A;  3M59 A;  1QCO A;  1V29 B;  3CC7 Q;  4FT4 A;  3UT1 A;  1QKW A;  2RN8 A;  1WJQ A;  3OBY A;  3VYG A;  4LDU A;  4M7D C;  3NTK A;  1YI2 A;  2PVD B;  3M57 A;  2PVG B;  1BI1 A;  1Q82 U;  2AK5 A;  5LJ3 g;  2GGR A;  2JTF A;  6AT1 B;  1OQK A;  2VC8 A;  1XOV A;  1QMC A;  2EQU A;  1FWZ A;  2LQN A;  1G3Y A;  5J26 A;  2LJ1 A;  3VYH B;  2VV5 A;  3CME T;  1BU1 A;  3L2W A;  3FJ5 A;  2D9T A;  4M77 B;  2QYZ A;  4KGV B;  3JB9 F;  2KSS A;  1AEY A;  2C06 A;  4F17 A;  3QII A;  2XU8 A;  1U06 A;  2D0Q B;  4DEY A;  2EJF A;  4XTU A;  1XTD A;  3FJP A;  3LWH A;  1RI9 A;  4KGZ B;  3OS2 A;  1TXQ A;  5I11 A;  4BI8 B;  1H92 A;  2DXT A;  5ECA A;  3NFC A;  4OVA A;  2ZPH B;  4M7D D;  1Q82 R;  3C0C A;  5GAO l;  1IO6 A;  1GCP A;  3OYN A;  1YJN A;  4ZNX A;  4LUE A;  3RNJ A;  1VQM T;  1VQ9 T;  3IQL A;  7AT1 B;  1UE9 A;  4YTL A;  3CCE T;  4OGE A;  5LL6 S;  2JS2 A;  1YIJ T;  1ZBX A;  4LDV A;  1OPL A;  2L89 A;  2VGM A;  1WNL A;  1YIT T;  4QKU A;  1AWX A;  1AVZ C;  1IRE B;  2LT4 A;  4FCY A;  4OB1 B;  1AWO A;  2RHI A;  3TSZ A;  2CH4 W;  2X4W A;  2YRD A;  2BKD N;  1K0X A;  1OYX A;  2FVU A;  2DO3 A;  1OU8 A;  4PJO F;  3CCV T;  2EYW A;  3X24 B;  4WCI A;  1QVP A;  4PNO A;  4LUD A;  1N6A A;  3EGD A;  2RMO A;  4II1 A;  2ZGW A;  1JRI A;  2RJE A;  1WIE A;  1I4K 1;  3GPL A;  3GF5 A;  4X34 A;  1WJS A;  2AZS A;  1SF9 A;  5LJ5 e;  2FB7 A;  2E5K A;  4C0D C;  1D09 B;  1GCQ A;  3FIF A;  3QHS A;  1LCK A;  2DNU A;  3M0P A;  2OTJ T;  2L0A A;  1OOT A;  2MCN A;  1PKS A;  2IIM A;  2K3Y A;  3OMC A;  1K4U S;  2QEX Q;  4J7F A;  1TSF A;  2C0I A;  4DBF A;  1QVF S;  3GIB A;  2CZ6 B;  5GAO r;  1K8A C;  1QKX A;  4CC2 A;  2LCS A;  5I22 A;  4IUP A;  4C92 A;  2LZ6 B;  3CBO A;  3M54 A;  1G3W A;  1Q7Y U;  2RHZ A;  1FXX A;  1M90 C;  4B9X A;  4XTZ A;  1QLY A;  4HCZ A;  2NUZ A;  5HCK A;  4F7U F;  4RTX A;  3EFO B;  2DL5 A;  4M77 G;  4UC4 A;  4M7A B;  2K2V A;  1VQK T;  1WZO A;  1RAC B;  2E70 A;  1TWB A;  5FLX E;  1NPR A;  4M75 B;  1UHF A;  3A8L B;  2COW A;  4B6M A;  1X2Q A;  2WSE E;  2QQS A;  3PE0 A;  3ZL7 C;  2KXD A;  4NL2 A;  4J6Y A;  4BY6 B;  3A5Z B;  1UUE A;  2HSE B;  1VQL A;  2DYB A;  2DPP B;  2O9V A;  4RCB A;  3CCR A;  2AHJ B;  2XDD A;  3EAE A;  3FC3 A;  2DAQ A;  4JLI A;  2LC4 A;  1M2V A;  3I55 T;  4KGX B;  4RTZ A;  2JOY A;  4C8Q A;  2XG8 D;  3OS1 A;  3CME Q;  2H3J A;  4JJC A;  1Q7Y R;  3LWI A;  2J7I A;  3C4S A;  5KYX B;  1BYM A;  1N27 A;  4C5H A;  4M78 B;  3A98 A;  5KYY A;  2MIO A;  1KC8 C;  1VYU A;  1GFD A;  2LNH B;  4J9F A;  5GAN 6;  2X9H A;  4A4F A;  5LJ3 j;  4XTW A;  4PLI A;  2C0T A;  3EFR A;  1X27 A;  2LX9 A;  2QDY B;  1WX6 A;  2DF6 A;  1K9M C;  2KVQ G;  1MMA A;  2D1X A;  2HQH A;  4XTX A;  1NEG A;  1P92 A;  1VQM Q;  3KBG A;  1VQ9 Q;  1M5Q 1;  1YN8 A;  2DIG A;  3G4S A;  3J80 E;  4X9C A;  1TTH B;  1O75 A;  3QJ6 A;  1EIF A;  2PZ1 A;  2P0Q A;  2L3P A;  2K7A A;  4CC7 A;  2HZY A;  1YIJ Q;  4PJL A;  3A1P A;  4PJO G;  1YIT Q;  1PM3 A;  3CCJ T;  4HKE A;  2W0Z A;  1PD0 A;  2E4H A;  1VQ5 T;  1RI0 A;  2JM9 A;  3ME9 A;  1S72 T;  2YUP A;  3ER0 A;  1S1N A;  3CCV Q;  1U3O A;  2QA4 T;  5LJ3 f;  2FPD A;  2RI3 A;  1ZBJ A;  8AT1 B;  4MZT A;  3SD4 A;  1RAH B;  4C8Q E;  1JXO A;  5AYF A;  2VWF A;  2GFA A;  4QVC A;  4ANJ A;  5CAI A;  2P4T A;  1VQN T;  4QT7 A;  4C0F A;  2JS0 A;  2AKK A;  4LNP A;  3HFO A;  3X20 B;  3S3M A;  1WXU A;  3SWN A;  2HBW A;  1WHL A;  5CKB A;  1KQS P;  3BY7 A;  1RUW A;  4DA4 A;  4MZM A;  5CQY A;  2HQX A;  4ZGD B;  4M75 G;  5GMK i;  3A8O B;  2OTJ Q;  1IGU A;  1B07 A;  2KK4 A;  1VQ8 A;  3QUI A;  2QQ9 A;  1XJW B;  4N4G A;  1Y0M A;  2K3B A;  4ESR A;  2YUO A;  1KFZ A;  4HVU A;  4C0G A;  3JB9 D;  2OTL A;  2EYY A;  1KJW A;  2EVR A;  3VUZ A;  2LQW A;  3BFM A;  4FW1 A;  2DIL A;  3CC7 A;  4IIO A;  1LJO A;  4KUL A;  3CCL T;  3CD6 T;  4V2S A;  4JZ3 A;  2QAS A;  3HRS A;  3M4G A;  4AG2 C;  1X6G A;  1R77 A;  5CK9 A;  1QWF A;  4MML A;  1SSH A;  2ZCF B;  1UJ0 A;  4EMK C;  2DJQ A;  3S3N A;  5AT1 B;  2QAZ A;  1SHF A;  3S6W A;  2J06 A;  1VQK Q;  4M7D B;  3UPU A;  1O9S A;  4OP0 A;  1OUL A;  4AT1 B;  1YJW T;  2G3R A;  2ZPF B;  2QXF A;  1U5S A;  1V1C A;  2EPD A;  2LQ8 A;  1C0M A;  1ZSZ A;  2CP2 A;  2ZAE A;  3I56 T;  3G1J A;  2HQE A;  1YHQ A;  4A4E A;  1ZA2 B;  2CP3 A;  1KQS A;  4M77 E;  4P5N A;  4ZGE B;  3OYJ A;  1WDX A;  5GJW B;  1M30 A;  2JN0 A;  3EG9 B;  2EKO A;  4GLM A;  3CBM A;  1RLQ C;  4AFU C;  4PJO D;  3JV3 A;  3V7S A;  1I1J A;  1VOM A;  2JXB A;  1JXM A;  5GMK e;  3I55 Q;  4X9D A;  2LTO A;  3M0S A;  3QBY A;  1SPK A;  2MF2 A;  1SEM A;  3OYH A;  3MKD A;  4JLG A;  1M90 R;  1BCO A;  3M0U A;  5IT9 E;  3NTI A;  5GAM f;  3P8B B;  3TQ7 P;  1K0S A;  4ZN3 A;  3G6E Q;  2DL4 A;  1GXI E;  2O4X A;  2K57 A;  3X26 B;  1VQ4 T;  4C92 F;  1OX9 A;  2K2M A;  2QGF B;  3EFO A;  5GAN f;  2XDB A;  1G8X A;  4M75 D;  1ZQ1 A;  3JCM e;  3PMT A;  2F69 A;  1KK7 A;  5FU7 C;  2R5A A;  3OYD A;  3E9F A;  5M9O A;  2RPN A;  3PTA A;  2RI2 A;  2X35 A;  3F70 A;  3TSW A;  3CMA A;  1RAF B;  4KH1 B;  4E2F B;  2SRC A;  4IKF A;  4LXC A;  1K9A A;  1CSK A;  2XID A;  2FPF A;  1QVG S;  3CCJ Q;  2F2V A;  2AT1 B;  4J7I A;  4A54 A;  4QVZ A;  1VQ5 Q;  3QZ9 B;  2A3L A;  1WI7 A;  4BE0 A;  1S72 Q;  5HK0 A;  2HL5 C;  3UA7 A;  3VS6 A;  1UGP B;  1BI3 A;  1MND A;  1AWW A;  4L59 A;  4EDU A;  1KC8 R;  4E7S A;  3ASK A;  2QA4 Q;  4PJN A;  3OB9 A;  2QEX A;  3C12 A;  3EGU A;  1QW1 A;  5KYX A;  5IHK A;  4C0D B;  2V26 A;  2EWN A;  5GAN 7;  1M1K C;  1VQN Q;  4C8Q F;  5CQX A;  5I2S A;  4J9I A;  2DRK A;  2CT4 A;  2CP6 A;  3OYB A;  1RAI B;  1PC0 A;  2GQI A;  3DB3 A;  2F5K A;  2MI6 A;  1HD3 A;  2GTJ A;  2KRM A;  2K5F A;  2KXC A;  3R6N A;  1WGS A;  3CCU T;  3RMS A;  3CC2 T;  4IUQ A;  4M7A E;  1Q7Y C;  4DEX A;  2FRW A;  1G5V A;  2JMC A;  4LD9 K;  3HSB A;  5GMK j;  3JCM V;  2JVV A;  2LT1 A;  1MMG A;  3QG1 A;  2DK3 A;  2DD4 A;  4PFO A;  3M53 A;  3CCL Q;  1C1A A;  3CD6 Q;  1M3C A;  1GFC A;  4FIB A;  1JB0 E;  4PFZ A;  4DOW A;  2OJ2 A;  3M0R A;  3OYY A;  4CC3 A;  2M9U A;  1Z9Q A;  3QZ5 B;  3CC4 T;  3G71 T;  3EG3 A;  1BI2 A;  3H41 A;  2RQV A;  3X28 B;  2CP0 A;  4JRP A;  3DLM A;  2V8K A;  1HJD A;  2RQT A;  3FDR A;  2DYI A;  5EC7 A;  3RR6 A;  2ROL A;  1VQ6 T;  3KFV A;  1YJW Q;  5D6Y A;  1M2O A;  2GBQ A;  2LJ0 A;  2DEQ A;  1G3S A;  3RES A;  3CME A;  1M4Z A;  2BIV A;  2E5Q A;  3C94 A;  4Z88 A;  3I56 Q;  1D0Y A;  2VB6 A;  3KXT A;  3OY9 A;  4ZTF A;  3QDF A;  4M78 E;  4JJB A;  1AT1 B;  2EW3 A;  1OPK A;  1KG1 A;  1MNE A;  3TVT A;  5GJV B;  1XQH A;  2DBK A;  3THK A;  1PWT A;  1M3B A;  2W10 A;  5A0G A;  8ATC B;  2KNB B;  1VQO T;  1RAB B;  3RBB B;  3OQ5 A;  2LCL A;  5LJ5 g;  3L2R A;  1W2B P;  2ED0 A;  1IZ6 A;  2DA9 A;  1PSE A;  1OX8 A;  1IRX A;  4OF1 A;  1M3A A;  4XQ3 A;  1NZ9 A;  2CT3 A;  3JAM E;  2NUT B;  3T9N A;  2A0F B;  2O9S A;  5DM7 R;  1YI2 T;  1VQ9 A;  1ZUY A;  1NG2 A;  1GBR A;  1NJI C;  2EFI A;  5GAN 2;  5KYU B;  5KE3 A;  2RI5 A;  3M9Q A;  1YIT A;  1VQ4 Q;  1ACM B;  5D6X A;  2HAX A;  3CCS A;  2HEQ A;  1RL2 A;  2PQW A;  2IG0 A;  2DTI A;  4Y92 A;  5GMK m;  2VGN A;  1Y7X A;  1KHI A;  1GCQ C;  1VQ7 A;  2EJG A;  3L42 A;  1I5O B;  4CI0 C;  2RF0 A;  4N4H A;  1KD1 U;  2K5I A;  2PUK B;  4ZTJ A;  5LJ5 d;  1W2B A;  3RKY A;  1R8O B;  2KRS A;  3UWN A;  2PVO B;  1YWP A;  4IIM A;  3M0Q A;  4XU2 A;  2OAW A;  4J83 A;  4OMP A;  4FYX B;  4C92 C;  1VIE A;  2PTK A;  3V8J A;  2HSP A;  3HP9 A;  5CIU A;  2BZ8 A;  2FZG B;  2LMJ A;  1FMK A;  1D3B A;  1IXD A;  2EQK A;  4MMK A;  5GAN 5;  1UTI A;  5GAO p;  2FL7 A;  2KMT A;  2D8J A;  2PUO B;  1TG0 A;  3GP8 A;  2KR3 A;  1M1K U;  2E65 A;  3VS2 A;  1NM7 A;  2HBP A;  3FB9 A;  2KBT A;  4PJO B;  5IXF A;  3L2U A;  2K3X A;  2J05 A;  1PHT A;  1KD1 R;  3CC2 Q;  5I2M A;  3SDZ A;  3OYG A;  2XKO C;  1RAD B;  2F5T X;  1B34 B;  1RAE B;  4M7D E;  3URG A;  5HK3 A;  2ROT A;  3SB2 A;  5LJ3 h;  2DX1 A;  5KYW B;  2AKL A;  1Q95 G;  4EMK B;  2CS7 A;  4KRT A;  4Q5W A;  2DJZ A;  3OW2 P;  2P4R A;  3EFS A;  4F04 B;  2X51 A;  5GAN 3;  4MDW A;  5FRO A;  4BE2 A;  3EG1 A;  1JO8 A;  2COZ A;  1EFN A;  4C92 D;  4C8Q C;  1LVK A;  2KGT A;  2CUB A;  3CC4 Q;  3G71 Q;  3CXC P;  1UEB A;  2FRY A;  5DLO A;  1U1T A;  3UDC A;  4ELY C;  1ARK A;  5A0L A;  3JRZ A;  1VQ6 Q;  1M1K R;  3U23 A;  3I55 A;  5HY6 A;  3HTR A;  3I35 A;  3OS5 A;  1VYV A;  1R0B G;  4NL3 A;  1TS9 A;  3H0F A;  1XNI A;  4RTT A;  4F7U B;  3QYG B;  3NMZ C;  1SKU B;  4N0A A;  2ZPB B;  3EGX A;  3JB9 G;  2FZK B;  1KHC A;  2H8H A;  1A0N B;  2VAS A;  2I2L A;  3HFN A;  3G6E A;  1VQO Q;  3OYK A;  2FG0 A;  2CP7 A;  2X4X A;  2DE0 X;  4FSX A;  1UGV A;  4JRQ A;  1N9S A;  2JW4 A;  4EMG A;  3OW2 A;  2DMO A;  2CDT A;  2CZ1 B;  3EG2 A;  1GL5 A;  2L3S A;  4E7I A;  4BB7 A;  5GAO q;  1YI2 Q;  3QXE B;  3BDU A;  1H8K A;  3CXC A;  5IH2 A;  4FYY B;  4A63 B;  4E7Z A;  4JS4 A;  2JM8 A;  2P0P A;  1NJI U;  1VQL T;  1K76 A;  2R5M A;  2F2X A;  3VJP A;  3CCR T;  5LJ5 j;  3J7A F;  3JB9 J;  1VQ5 A;  4TVR A;  4XTY A;  5L8R E;  3NPF A;  3CQT A;  3FRN A;  4RCC A;  2K5L A;  3TEE A;  3GNG A;  3SWN C;  2F1L A;  2QA4 A;  2RQU A;  3CCE Q;  5GAN e;  3CXC S;  3RUX A;  3I5S A;  3PGG A;  1LPL A;  2RHX A;  3MEV A;  2B86 A;  1WHH A;  3MEA A;  1VQN A;  4KBM B;  3JCM b;  5GAM h;  1YBY A;  4DBR A;  4FYV B;  5CKE A;  3DB4 A;  2HMA A;  2EYZ A;  3WVE B;  4RUG A;  2BE7 D;  5CCA A;  1W1F A;  4KH0 B;  1YCY A;  5A0D A;  4AFQ C;  5GAN h;  4M77 A;  2EIF A;  1BKB A;  1RAG B;  2ENM A;  2X4J A;  5KCH A;  2O2O A;  1NJI R;  3INZ A;  1Q86 U;  5HKC A;  4PKC C;  4IUV A;  2YUN A;  5GAN 4;  1I8F A;  2EGE A;  4LD6 A;  4JJD A;  2ATC B;  2M02 A;  1AHJ B;  1WA7 A;  2K9G A;  3A8H B;  3M55 A;  1E6G A;  3P8D A;  2D6F A;  2ZZD A;  5KYU A;  2JZ2 A;  3CCL A;  2ZPI B;  2CZ7 B;  3CD6 A;  2JUF A;  1OI1 A;  3SHW A;  1W70 A;  1ZSZ C;  4X1V A;  3VS0 A;  2CGH A;  1QQJ A;  1WYX A;  4PK4 A;  4ATO A;  2YWW A;  2D0N A;  4XU1 A;  4O5V A;  4F7U G;  2GCX A;  1VQP T;  1JU5 C;  2HNI A;  3JCM g;  1Z9Z A;  4JPB W;  2L3Q A;  1MMD A;  3R6O A;  2M0Y A;  2MK5 A;  1J3T A;  1I81 A;  2ED1 A;  4ZGJ B;  1AD5 A;  1NE8 A;  1WQ7 A;  4DBH A;  3QO3 A;  2RH2 A;  3NGP A;  2PNI A;  1Q86 R;  4AMC A;  3CCM T;  2MOX A;  1VYT A;  4OGC A;  2LNV A; 
#chains in the Genus database with same CATH homology
 3OYB A;  1BI0 A;  4YTL A;  4OGE A;  5LL6 S;  3CCE T;  3V8K A;  5GAN d;  1YIJ T;  1KQ2 A;  1ZBX A;  3DB3 A;  2F5K A;  4LDV A;  2MI6 A;  2L89 A;  2VGM A;  1WNL A;  2VYT A;  3LGF A;  3LGL A;  3GOX A;  2K5F A;  2RHY A;  1YIT T;  3LW5 E;  5FU7 B;  1IRE B;  2LT4 A;  1WGS A;  3L2Z A;  4OB1 B;  3RMS A;  5GAO n;  2RK1 A;  3HPW A;  2RHI A;  3MP1 A;  2QTX A;  3CCU T;  3CC2 T;  4KUD K;  4N4I A;  2X4W A;  3WVD B;  2BKD N;  4IUQ A;  4M77 C;  2WSC E;  1OYX A;  3CCJ A;  1Q7Y C;  4M7A E;  2FVU A;  5GAN g;  2DO3 A;  1MHN A;  1OZ3 A;  1G5V A;  5GAM e;  4LD9 K;  1Y71 A;  5FRN A;  1VUB A;  4PJO F;  5GMK j;  3HSB A;  3JCM V;  4C92 E;  4J6X A;  1VIF A;  3CCV T;  3G6E T;  3OW2 S;  1YJ9 T;  3X24 B;  2MAM A;  3WXM B;  2Y4X A;  2JVV A;  1QVP A;  1S72 A;  2LT1 A;  3QG1 A;  2DK3 A;  2DD4 A;  4PNO A;  2RK2 A;  1QP3 A;  2RA2 A;  3M53 A;  4PLL A;  1N6A A;  4PJO A;  4PL6 A;  4II1 A;  2ZGW A;  2DZ9 A;  1JRI A;  4FIB A;  1JB0 E;  2DZC A;  5FRM A;  4DOW A;  3HL8 A;  1VQ4 A;  2RJE A;  4BI4 A;  2EYQ A;  3OYY A;  2M9U A;  3VKI A;  3JCM d;  3QZ5 B;  3CC4 T;  4E7K A;  3G71 T;  3OBW A;  1NPP A;  1I4K 1;  4HA8 A;  3GPL A;  1KQS S;  2DXU A;  1BI2 A;  3GF5 A;  3X28 B;  4X34 A;  1WJS A;  2WSF E;  1ZHI A;  4JRP A;  1M1G A;  4FT2 A;  3DLM A;  2V8K A;  3Q1J A;  4RKU E;  2L3R A;  5LJ5 e;  3OYE A;  2FB7 A;  4OB3 B;  4C0D C;  1DJ7 B;  3FDR A;  2VUB A;  3QHS A;  3FIF A;  1VQ6 T;  3H8Z A;  2OTJ T;  4EPC A;  3QYH B;  5D6Y A;  1YHQ T;  2DIQ A;  2K3Y A;  3OMC A;  2DEQ A;  1G3S A;  3RES A;  3CME A;  1M4Z A;  2BIV A;  4J7F A;  2E5Q A;  2ZPG B;  3C94 A;  1UGR B;  5EG2 A;  3DLL A;  4RG8 A;  1QVF S;  1KQ1 A;  4D6W A;  4BE1 A;  3KXT A;  3GIB A;  2CZ6 B;  3LX7 A;  3OY9 A;  2DXC A;  4ZTF A;  4M78 E;  5GAO r;  1LOJ A;  2A7Y A;  1K8A C;  4M7A A;  1H3Z A;  1KG1 A;  4IUP A;  1XQH A;  4C92 A;  3G4S T;  4NOY A;  3CBO A;  3E19 A;  4M75 A;  3M54 A;  1G3W A;  5A0G A;  4M77 D;  5LJ5 f;  1Q7Y U;  2RHZ A;  1VQO T;  1VQP A;  3LLR A;  4JRI A;  4FM4 B;  3OQ5 A;  1FXX A;  1M90 C;  4B9X A;  4XTZ A;  2LCL A;  1KD1 C;  5DLQ E;  5LJ5 g;  3OSS C;  3L2R A;  4HCZ A;  4ELZ C;  4QVD A;  3TU4 K;  4E47 A;  4F7U F;  1IZ6 A;  2DTH A;  2GQV A;  3TRE A;  1N8R C;  1PSE A;  2RB6 A;  2YLB A;  4M77 G;  3OYM A;  1U8R A;  2E1H A;  3OYA A;  5DY9 A;  4UC4 A;  4M7A B;  2K2V A;  4OF1 A;  1VQK T;  4XQ3 A;  1X6O A;  4M7A G;  2YRV A;  2E70 A;  2YHT A;  3CCQ T;  1NZ9 A;  4GY5 A;  4C92 B;  5FLX E;  3JAM E;  1NPR A;  3T9N A;  4M75 B;  5FU6 B;  5DM7 R;  1YI2 T;  1VQ9 A;  3A8L B;  3QDR B;  3CCM A;  3RKX A;  1NJI C;  4IUR A;  2WSE E;  5CO7 A;  3S3O A;  2EFI A;  2QQS A;  4FU6 A;  1MGQ A;  3ZEH A;  1YJW A;  5GAN 2;  3JCM J;  5KE3 A;  4NL2 A;  5I21 A;  2RI5 A;  2XK0 A;  3MHX A;  3M9Q A;  4J6Y A;  4QQD A;  5J3B A;  4BY6 B;  4M7D F;  4PJO E;  2VXE A;  5GAN 8;  2L8D A;  5CKH A;  3I56 A;  1YIT A;  3A5Z B;  2RJF A;  4ZN1 A;  4M78 A;  5D6X A;  2HAX A;  3CCS A;  1M8V A;  4PJO C;  3HHT B;  2XDP A;  1VQL A;  3CC2 A;  1RL2 A;  2DPP B;  4C0Z A;  4O6J A;  3CMA T;  1Q81 U;  2PQW A;  4RCB A;  2IG0 A;  2LVM A;  2DTI A;  2AHJ B;  2XDD A;  3EAE A;  3CCR A;  3JCM P;  2EJ9 A;  4NS5 A;  3FC3 A;  2DAQ A;  5GMK m;  3MO8 A;  1K8A U;  4JLI A;  2DXB A;  2LC4 A;  2VGN A;  5CVI A;  4A4K A;  1Y7X A;  3CBP A;  3JCM X;  1KHI A;  3I55 T;  1VQ8 T;  1YJ9 A;  4JUV A;  3JCM W;  1PSF A;  2JOY A;  3MCA B;  2XG8 D;  4C8Q A;  3OS1 A;  2H3J A;  1VQ7 A;  3RIR A;  3LWI A;  5CR2 A;  2EJG A;  3L42 A;  4BAC A;  3G7Z A;  3C4S A;  2LDM A;  3SFM A;  4CI0 C;  2OTL T;  1BYM A;  4JS5 A;  3E9G A;  4N4H A;  4Y28 E;  4Z02 A;  1N27 A;  2L5Q A;  4C5H A;  4M78 B;  1M90 U;  1KD1 U;  2K5I A;  3JB9 H;  1X75 C;  5J39 A;  1KC8 C;  2PUK B;  4M78 G;  4EMH A;  5GAM j;  4ZTJ A;  1M9S A;  2E41 A;  2QI2 A;  2Y90 A;  5LJ5 d;  1W2B A;  3RKY A;  4R56 A;  1M1F A;  1LNX A;  1R8O B;  3CC7 T;  2RD1 A;  5GAN 6;  3UWN A;  5LJ3 j;  4A4F A;  4MDX A;  2PVO B;  2O01 E;  3MP8 A;  4XTW A;  1Q82 C;  4OB2 B;  4M7A C;  3PT9 A;  4JRK A;  2RJC A;  4PLI A;  4B9W A;  4XU2 A;  4M75 E;  4E7H A;  4J83 A;  4DOV A;  5GAN j;  4C8Q B;  4BI3 A;  4C92 C;  1VIE A;  3EFR A;  3QKJ A;  4M75 C;  5FU6 C;  2RO0 A;  3V8J A;  4BDZ A;  3JB9 I;  2LX9 A;  2QDY B;  3KUF A;  3MEU A;  3HP9 A;  1X01 A;  5CIU A;  1Y96 A;  2XHC A;  3MEW A;  1I5L A;  2IVW A;  2MMP A;  1D3B A;  2FHD A;  1K9M C;  4XU0 A;  2V8J A;  2DD5 A;  2EQK A;  3OMG A;  4MMK A;  2KVQ G;  4J6W A;  4BY6 C;  3HRU A;  5GAN 5;  5GAO p;  2FL7 A;  2KMT A;  4A4H A;  4J8O A;  2PUO B;  2Y4Y A;  4LDY A;  4MZP A;  4XTX A;  4F7U E;  1P92 A;  1B34 A;  5C6S A;  3KBG A;  4OB0 B;  3GP8 A;  3PIO A;  2LRQ A;  3OYF A;  1M5Q 1;  1M1K U;  2DIG A;  2LQK A;  3G4S A;  2E65 A;  4X9C A;  3J80 E;  1O75 A;  3QJ6 A;  3ZFJ A;  1EIF A;  1JJ2 A;  2P0Q A;  4EMK A;  2HBP A;  3QJY A;  3FB9 A;  4PJO B;  3L1A A;  4FL6 A;  4PJO G;  3L2U A;  2K3X A;  3M58 A;  1D3B B;  3CCJ T;  2MWO A;  4HCC A;  4VUB A;  4HKE A;  1VQ5 T;  2CYZ B;  1RI0 A;  5I2M A;  3SDZ A;  2GFU A;  3VU3 C;  1BIA A;  3ME9 A;  2XKO C;  3MP6 A;  2F5T X;  3X25 B;  3OYG A;  1B34 B;  4M78 C;  2DKG A;  1S72 T;  3DKM A;  3TCJ A;  1KC8 U;  3URG A;  3RER A;  4M7D E;  1JBM A;  5HK3 A;  3ER0 A;  1WPY A;  3GNF B;  4M77 F;  3CCQ A;  3SB2 A;  5LJ3 h;  4ME7 A;  5GMK h;  2QA4 T;  5LJ3 f;  2JTM A;  2RI3 A;  4KUI A;  4EMK B;  5KCO A;  2CS7 A;  4Q5W A;  4RG2 A;  2DJZ A;  3CPF A;  4MZT A;  3SD4 A;  4C5G A;  3EFS A;  4C8Q E;  4M7A D;  5GAN 3;  4MDW A;  1QVG A;  5FRO A;  4BE2 A;  5AYF A;  1JJ2 S;  2FYK A;  2GFA A;  3V7C A;  4QVC A;  3CPW A;  1HK9 A;  5CAI A;  3ZBD A;  1UGQ B;  3P8H A;  4C92 D;  4C8Q C;  2KAF A;  2P4T A;  5CKD A;  4LDX A;  1VQN T;  4C0F A;  5D6W A;  3E1S A;  1UGS B;  3CEY A;  1UEB A;  2QQA A;  4KT0 E;  5DLO A;  3HFO A;  3JSC A;  1FX7 A;  4F7U A;  1U1T A;  3UDC A;  3X20 B;  4ELY C;  3S3M A;  3SWN A;  2KQW A;  1K9M U;  5A0L A;  5CKB A;  3OYL A;  4A53 A;  1VQM A;  3N5B B;  3BY7 A;  4C92 G;  3OYI A;  4DA4 A;  4MZM A;  3M56 A;  3JRZ A;  2HQX A;  5CQY A;  1HXD A;  3OSV A;  4M75 G;  4ZGD B;  3A8O B;  5GMK i;  2V8I A;  3I55 A;  2DVE A;  2KK4 A;  1VQ8 A;  5HY6 A;  3CCE A;  3QUI A;  2QQ9 A;  4N4G A;  4XU3 A;  3OS5 A;  4R55 A;  2EQM A;  1YIJ A;  4XAX B;  5IAY A;  4L5G A;  3J81 E;  4C0G A;  4NL3 A;  3JB9 D;  2OTL A;  1XNI A;  2CZ0 B;  2WAC A;  2BUD A;  3RMQ A;  3JCM h;  3BW1 A;  2XI9 A;  3CPW S;  3CCU A;  3VUZ A;  3FEO A;  4F7U B;  3OA6 A;  3BFM A;  3JCM f;  3SWN B;  4M7D A;  3QYG B;  5FU7 C;  3CC7 A;  2JNG A;  2ZPB B;  4N0A A;  3JB9 G;  3LYI A;  1KHC A;  1LJO A;  4KUL A;  2I2L A;  4C5E A;  3CCV A;  3HFN A;  4M78 D;  3G6E A;  3CCL T;  1W4S A;  3JCM c;  3OYK A;  3CD6 T;  5CKF A;  3RKW A;  4A4G A;  2PU9 B;  3JCM Q;  4V2S A;  2NLU A;  3HRS A;  3M4G A;  4XTV A;  4LDW A;  4J5Y A;  5CK9 A;  2X4X A;  3PMI A;  4FSX A;  4MML A;  2ZCF B;  4CRI A;  1N9S A;  5GAN 4;  4JRQ A;  4EMK C;  3FLG A;  2LCC A;  2B8A A;  4EMG A;  3S3N A;  1G3T A;  2E12 A;  3OW2 A;  2E6Z A;  3GLX A;  1SSF A;  3C95 A;  3PNW C;  3LH0 A;  3S6W A;  2CKK A;  3V7R A;  3QPH A;  3G71 A;  3CC4 A;  1N8R U;  4HCB A;  4M7D B;  5LJ3 d;  3UPU A;  1O9S A;  2CZ1 B;  2RJD A;  4OP0 A;  5IN1 A;  4M7D G;  1QP2 A;  4E7I A;  1YJW T;  3HRT A;  2G3R A;  4BB7 A;  3H6Z A;  2ZPF B;  2QXF A;  5GAO q;  2LQ8 A;  3QXE B;  3BDU A;  3CXC A;  2RHU A;  2QEX T;  1VQ6 A;  5GMK l;  4E7L A;  2OTJ A;  3V8L A;  3I56 T;  4JJN K;  2VXF A;  2HQE A;  1YHQ A;  4C8Q G;  4A4E A;  4C5I A;  1Q86 C;  1K73 C;  2XIC A;  3A8M B;  4JS4 A;  3CCS T;  2P0P A;  1KQS A;  4M77 E;  1BIB A;  4P5N A;  1NJI U;  1VQL T;  4ZGE B;  3OYJ A;  2EQJ A;  1H64 1;  2R5M A;  1YJN T;  3MET A;  3VJP A;  3CCR T;  5LJ5 j;  2JN0 A;  3J7A F;  3VV0 A;  3OS0 A;  3JB9 J;  1VQ5 A;  4TVR A;  2EKO A;  3CBM A;  4XTY A;  2RM4 A;  5L8R E;  4BD3 A;  4PJO D;  1W2B S;  2M16 A;  3FRN A;  4GLK A;  3A8G B;  5LJ3 e;  4RCC A;  2K5L A;  4QW2 A;  3TEE A;  3V7S A;  1VQ7 T;  4RMO A;  1QVF A;  4DQ2 A;  5GMK e;  3GNG A;  3SWN C;  2QA4 A;  4E7J A;  1UB4 A;  4X9D A;  1VQO A;  4L6V 5;  3HKS A;  5GAN e;  3CXC S;  1WQW A;  4IUT A;  4WF2 A;  3RUX A;  3M4Y A;  1WJR A;  2LTO A;  3PGG A;  1Y96 B;  2KDS A;  2RHX A;  3MEV A;  3QBY A;  5KH6 A;  1U1S A;  2E64 A;  2MF2 A;  3OYH A;  2QQR A;  3MEA A;  1VQN A;  4JLG A;  4KBM B;  3JCM b;  4IUU A;  3M59 A;  4BUG A;  5GAM h;  1YBY A;  1VQK A;  1V29 B;  5IT9 E;  2R57 A;  3NTI A;  4FT4 A;  5CKE A;  3UT1 A;  5GAM f;  3DB4 A;  3P8B B;  3WVE B;  1WJQ A;  2DTO A;  3OBY A;  3VYG A;  4ZN3 A;  4LDU A;  5CCA A;  2X4Y A;  5GAM g;  3NTK A;  1YI2 A;  4M7D C;  2PVD B;  4M7A F;  1YCY A;  3M57 A;  2PVG B;  4N0A C;  5A0D A;  1BI1 A;  1Q82 U;  1GXI E;  2O4X A;  2K57 A;  3X26 B;  1Y07 A;  5GAN h;  3L2Q A;  1VQ4 T;  5LJ3 g;  4M77 A;  3M5A A;  2JTF A;  2EIF A;  4C92 F;  3PFS A;  1Q81 C;  1BKB A;  2X4J A;  5GAN f;  4M75 F;  5KCH A;  3VUB A;  4Y91 A;  2XDB A;  3INZ A;  1K73 U;  1Q86 U;  2VC8 A;  1XOV A;  1ZQ1 A;  4M75 D;  5HKC A;  3JCM e;  2M0O A;  2EQU A;  2F69 A;  3PMT A;  1FWZ A;  2R5A A;  1G3Y A;  1I8F A;  3E9F A;  4IUV A;  4PKC C;  5J26 A;  4LD6 A;  5M9O A;  5LJ5 h;  3OYD A;  3PTA A;  2RI2 A;  2X35 A;  3F70 A;  1OZ2 A;  3PIP A;  1AHJ B;  3VYH B;  3CMA A;  2K4Y A;  3A8H B;  3M55 A;  2M1H A;  4OMF B;  3P8D A;  2GF7 A;  2VV5 A;  3CME T;  2D6F A;  2KY9 A;  2XD0 A;  2ZZD A;  4IKF A;  3L2W A;  2JZ2 A;  2O4X B;  3CCL A;  2ZPI B;  2CZ7 B;  2D9T A;  1TH7 A;  3CD6 A;  4M77 B;  2JUF A;  5GAO m;  3JB9 F;  1OI1 A;  2E6N A;  2XID A;  2ZPE B;  2KSS A;  3AHU A;  4JDS A;  4HT9 A;  2CGH A;  5C0M A;  2YLC A;  1QVG S;  2C06 A;  2QQB A;  4ATO A;  4J7I A;  4A54 A;  5A2Q E;  4QVZ A;  3L2V A;  2P0K A;  3QZ9 B;  2A3L A;  3QII A;  4XU1 A;  2XU8 A;  4O5V A;  2OAU A;  4F7U G;  2GCX A;  2D0Q B;  4BE0 A;  5HK0 A;  2EAY A;  1VQP T;  3NTH A;  2EJF A;  1UGP B;  3QSU A;  1BI3 A;  1XTD A;  2HNI A;  4XTU A;  3JCM g;  4M78 F;  2HD0 A;  3FJP A;  4L59 A;  4EDU A;  3LWH A;  3ASK A;  3OS2 A;  4BI8 B;  3R6O A;  2DXT A;  3OB9 A;  2QEX A;  1I81 A;  3C12 A;  4ZGJ B;  3NFC A;  4OVA A;  1QW1 A;  2ZPH B;  3OYC A;  4QQ6 A;  4M7D D;  1NE8 A;  1WQ7 A;  4C0D B;  5GAO l;  2EWN A;  3QO3 A;  2RH2 A;  5GAN 7;  3O8V A;  5GAM d;  3OYN A;  1YJN A;  1M1K C;  4HT8 A;  4XK8 E;  1N9R A;  4C8Q F;  1VQM T;  2R58 A;  4BDY A;  3BDL A;  5CQX A;  5KE2 A;  1VQ9 T;  4QQG A;  4C8Q D;  5I2S A;  3CCM T;  2E10 A;  4OGC A;  2MWP A;  2LNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...