3LWHA

Crystal structure of cren7-dsdna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwhA00
2JTMA 3KXTA 4R55A 4R56A 3LWHA 3LWIA
chains in the Genus database with same CATH superfamily
3NPFA 4DBFA 1OULA 3QPHA 2DETA 2KYMA 4FSXA 3OW2P 2LNHB 1SEMA 4QT7A 1I1JA 2HKQB 3OYJA 2YLCA 5KCOA 2C0TA 2DBMA 2LDMA 1M3BA 3HL8A 1M2VB 4E7JA 1UEBA 2DD4A 1RLQC 1B7TA 2EKOA 2CSQA 1UGSB 2EYQA 4MMKA 1H641 3CXCS 1NBEB 4ESRA 2CZ1B 2XICA 4HA8A 3CBMA 4RUGA 1N6AA 1VQPA 2Y4YA 1PHTA 5GAOm 3GOXA 3HP9A 1QKWA 2X4XA 5IXBA 1VQPT 2FO0A 2DEUA 2K5FA 2DIQA 2DLPA 2P84A 4M77A 1C1AA 3A8HB 1D1AA 3X25B 4PKCC 5HY6A 4Z88A 1I81A 3CCMA 1WHKA 1VIFA 5GJWB 3CCMT 3JCMP 1IHWA 1PWTA 2G6FX 3CMAQ 1X2KA 3JCMW 1YHQQ 1OV3A 2Y4XA 4PK4A 4OMNA 4FYXB 1DJ7B 1YNZA 1TUDA 4HXJA 1WXUA 1CKBA 2DA9A 4M7AB 3EG9B 2ESWA 2HBWA 4M78A 2QK0A 2F69A 3C95A 1EFNA 2WSFE 3S3MA 4RTTA 3HRUA 4BACA 1ZUKA 2DIGA 1JEGA 4ZGEB 1X01A 4J83A 4J9BA 1B3QA 1FXXA 2F5TX 1M90U 3QKJA 2FEIA 2YUQA 3M0SA 2HQHA 1AWOA 1VQOQ 2NUPA 1WHMA 2P0PA 1KIKA 1G83A 3M4YA 3VS0A 5GAOp 1WJQA 2VV5A 1JJ2A 3QZ5B 5LJ3h 1N9RA 2DK3A 2E64A 2DL8A 4Q5WA 4XK8E 3GNFB 2KI7A 5GJVB 2VGNA 4QW2A 4JRQA 4EIKA 2ZPEB 4QQDA 2K9GA 4X1VA 4JLGA 4PJOE 2MCNA 1SSFA 3SD4A 1UUEA 1Y96A 4PL6A 2EYWA 2VWFA 1YFNA 3BY7A 3THKA 5KYUB 4DA4A 1WPYA 4ANJA 2OTJQ 1N9SA 1OI1A 3M57A 1IGQA 2E41A 3OBWA 1VQ4A 4JUVA 4RG2A 2NUTA 3GIBA 1VQKQ 4F7UB 2BIVA 1VQ4T 1K8AR 4DOVA 2LQKA 2XIDA 3CC4Q 5J26A 1KQ1A 4F14A 2P0QA 4M75A 2LCCA 4A4FA 5KYNA 2L89A 4OMPA 1G5VA 2VXFA 3CMEA 5J39A 4KT0E 1OZ3A 2P4RA 3CMET 1OU8A 2MMPA 4VUBA 4BDYA 1KD1U 1Q82C 4A4HA 2ZPIB 3VYHB 1OX8A 2FVUA 3X20B 3H9NA 1WLPB 5KYWB 2J7IA 1H92A 1CSKA 4J9CA 3OB9A 1WYXA 2PNIA 4C5EA 3CQTA 4BE1A 1N8RU 3E9GA 2RD1A 2COZA 1MMAA 5LJ3f 1QP3A 2OTLA 1TH7A 3QSUA 1UB4A 3CCRQ 2OTLT 1QVPA 2L3RA 2JJ9A 3LX7A 1U8RA 3L2RA 3LH5A 3MP8A 2PUOB 3Q1JA 4WF2A 3RBBB 2DZCA 5GANh 1BIBA 5LJ5g 2P4TA 1ZSZC 4C8QA 1BU1A 2K79A 3JB9H 3CC2A 4B9XA 2X4WA 5LL6S 2V1RA 4MMLA 1SHGA 3R6NA 1LJOA 2CP2A 4ZN1A 3CPWP 2QXFA 4OF1A 1B34B 3REAB 2WSEE 3CCVQ 1RAFB 5CKBA 3VUZA 1Q7YR 3QIIA 1KC8R 1RADB 1WJRA 3EG2A 3R6OA 3PIPA 1BK2A 2D8JA 2F2VA 4C92F 2RMOA 1YI2A 2KXDA 2DXCA 4N4HA 4LNPA 2EIFA 1YI2T 2KE9A 5L8RE 1TUCA 4NS5A 2KT1A 1ZHIA 3M58A 2XG8D 2RJDA 1VQ8A 1PRLC 2QG9B 2LTOA 1VQ8T 3M59A 2GGRA 3GBQA 3OYLA 1O9SA 3G7ZA 1G3SA 1X6GA 1YJNA 2RNAA 4KRTA 1PCXA 1YJNT 2XU8A 1VQNA 1G8XA 2F2WA 4JRKA 1QCNA 3EGDB 3OW2A 1VQNT 4PLLA 1PD0A 1X6BA 2BE7D 2JXBA 4C92G 4M7DC 6AT1B 3P8BB 1LCKA 1YIJQ 1QLYA 1K76A 4EDUA 2EBPA 1IRXA 2HSEB 3URGA 2BKDN 3EGXB 5KE3A 1WJSA 1Z9ZA 5LJ5j 3QUIA 3JSCA 2AT1B 2YRVA 1VQ6Q 4ZN3A 5GANf 4PJMA 5CIUA 1BI1A 1V1CA 3VYGA 1E7OA 2A08A 2ZPGB 1PD1A 1YWPA 1VYUA 1TTHB 5EC7A 1ZLMA 1G3TA 2NUZA 3ASKA 1RI9A 2DYBA 1K9AA 3FIFA 4PJOA 2PVDB 5GAN4 4A4GA 1GCPA 4E7ZA 2DD5A 2YDLA 2L3PA 3EFOB 4JLIA 4IURA 2M9UA 2CDTA 4J9EA 4RKUE 3QXEB 1E6GA 3MEWA 5GAOq 1PKSA 1NYGA 1TOVA 4M7AE 1OPLA 2KVQG 4CC4B 4BB7A 3SWNA 5D6YA 4LXCA 2KSSA 1Y07A 2K7AA 3M0PA 1LNXA 4L59A 1KQSP 3RESA 3E19A 2YUOA 3RR6A 2V26A 1K8AU 2AKLA 2GTOA 2VVKA 4GY5A 2KEAA 5ECAA 5AT1B 1F1BB 1QW1A 1ZSZB 2LNVA 2RA2A 1NYFA 5IHNA 4QQGA 1BYMA 1JJ2P 2O88A 2KRMA 3P8HA 3PMTA 1RAHB 1MUZA 1M1FA 2RHIA 1ABQA 1KHCA 3RNJA 2VGMA 3MJXA 2YRDA 2D0NA 2D9TA 3SEMA 5GAMh 1D1CA 1MGQA 2AKKA 2A7YA 3L2UA 4KUDK 2BUDA 2RPNA 2EQKA 3CCEQ 1YJWA 3EAEA 4IUQA 3NMZC 1MV0B 3OA6A 3OY9A 1WHJA 2QA4A 1YJWT 3NHNA 1K0XA 2QA4T 2DILA 2ATCB 2O9SA 4EPCA 1TS9A 8AT1B 4YTLA 2JVVA 2W0ZA 3G4SA 4F7UE 3SHWA 3SB2A 3G4ST 1UGPB 2CT4A 2V8KA 3CCUA 4XU2A 1OU9A 3OW2S 5I2MA 1G3WA 3A98A 4M78E 3CCUT 3TU4K 5CQXA 5GMKl 3G71Q 1KSWA 1XNIA 4Z02A 4C0FA 4BE2A 2RQRA 2VYTA 4BUGA 4DEXA 4M7DB 3AHUA 3HTRA 2V8JA 3S3OA 1Q7YU 4A54A 1K9MC 1RACB 4IIMA 1KC8U 2XI9A 1SRLA 3VS6A 2QGGA 1D0ZA 2GQIA 3CCLA 4E47A 1BI3A 1Q81R 2KXCA 2X4YA 2CP3A 3CCLT 3J81E 4C92D 1GCQA 2RN8A 2IG0A 4HT9A 2HEQA 1NZ9A 5FU6C 3EFRA 4IUUA 5FROA 3CD6A 2I0NA 5LJ5e 3UA7A 5GAMf 1OX9A 3MP6A 3CD6T 1S72Q 3JCMc 4JZ3A 1RLPC 1M2VA 1WXTA 4B6MA 1R8OB 1VIEA 4FW1A 3A8MB 1FYNA 5L23A 2HL5C 4FYYB 2ABLA 2DRMA 3G6EA 1VQ4Q 2EYZA 3G6ET 3A8GB 4PFPA 1UGRB 2K6DA 1Q95G 2RI3A 2VXEA 4FU6A 4NL2A 2FPDA 4OB0B 2QASA 3SDZA 4AFSC 4OMOA 1XJWB 2HSPA 2LJ3A 2JS2A 2AZSA 2E3IA 1NM7A 3U23A 3JAME 3OMGA 3CPWA 3LGLA 2E1HA 2FYKA 5GAN3 2JN0A 2O4XB 2NLUA 4PFOA 1FWZA 1X75C 2HD0A 4PFZA 2XDDA 1WDXA 2PVGB 5IN1A 5HK3A 4JRPA 1HSQA 3FRNA 1AWXA 1Y7XA 4M77F 4AFZC 2K57A 2VASA 5CR2A 1HK9A 4DBHA 4DEYA 5CQYA 1CKAA 1SG5A 2XKOC 2ROTA 2OTLQ 3J80E 1M5Q1 4M7AA 3CCQA 3EG9A 3PFSA 1WXBA 4ELZC 4BY6C 4B9WA 3ME9A 4C5GA 5GMKj 3CCQT 2JW4A 1VQ9Q 2LC4A 2L3QA 2QEXA 2M1HA 3QJYA 3QDRB 1AZGB 4RCCA 2QEXT 2D6FA 5GAOl 3FJ5A 4PNOA 5CK9A 4M78F 3H0HA 4C8QE 2DJZA 2KMTA 4DBQA 2PTKA 4C0GA 4M77G 2AK5A 2XD0A 1JB0E 2MI6A 2EQUA 2DPPB 3VU3C 3OS0A 2JUFA 1PC0A 4JPBW 2DKGA 1K73C 2C0IA 2E65A 2L5QA 5A0LA 3L2VA 4HT8A 2GFAA 4RTXA 1M8VA 1YI2Q 1NJIU 2BZYA 1GBRA 2LP5A 1QWFA 4ME7A 1VQMA 2LCSA 3C94A 3QHSA 2FG0A 4J9HA 5KYUA 1VQMT 3PE0A 1SHFA 3V8LA 2QTXA 1VQ8Q 3QJ6A 3OS5A 4M78G 1K4US 2D1XA 4KGZB 4FSSA 1FX7A 3GPLA 3VS4A 3PNWC 4F7UA 1YJNQ 5FU6B 2JOYA 2KRSA 3BW1A 2FL7A 2LVMA 2GF7A 1BI0A 4AG1C 1KK7A 1NE8A 3L1AA 3VKIA 4P5NA 2B8AA 2NYSA 3FC3A 1KQSA 3OYGA 1UHCA 2C06A 2X3XD 4M75F 1H8KA 1I5OB 3EFSA 1I4K1 1D1BA 5C0MA 2QQBA 2QGFB 5CVIA 3RERA 2HCKA 5KYWA 2RQUA 2JTMA 2LX7A 3AT1B 1VQ7A 2MYSA 1HD3A 2K3YA 3DB3A 3NTIA 1VQ7T 1AEYA 1UGQB 1O75A 3M0RA 1Q82R 2LQNA 1Q81U 2DNUA 2PUKB 3FDRA 2AIRB 3NTKA 1IREB 2K3XA 1IHVA 3A5ZB 4XTVA 3CCSA 1MHNA 3CCST 2JM9A 2GBQA 1C6VX 4M75G 5CCAA 3WXMB 1YITA 1EIFA 2AHJB 1ZUYA 3OYIA 1YITT 4BY6B 4ZTJA 2DXUA 4JJCA 4QVCA 1B34A 1M30A 2XK0A 5FLXE 2EGEA 1GFCA 1M3AA 4JJBA 2GFUA 4A53A 4EMKC 1W2BA 4BI3A 1A0NB 4C8QF 1QVGP 1LPLA 4E7LA 2SRCA 3UWNA 1UGVA 2JT4A 4IUTA 4OGEA 2HZYA 3VS7A 3OMCA 3RKXA 5GMKe 4AG2C 2A36A 1W1FA 5EG2A 1I0CA 4N4GA 5C6SA 2R5AA 2GCXA 2CZ0B 2CP6A 3RMSA 2MIOA 4DOWA 1VYVA 4HVWA 2KGTA 3M54A 3RMQA 4RCBA 3NTHA 2CH4A 2ECZA 3OYYA 1YJWQ 1E6HA 4NOYA 3OYHA 1JRIA 2C0OA 2QA4Q 4M77D 3G1JA 3PIOA 3VRYA 4C8QG 2CS7A 3HFNA 2M51A 2E5KA 2EVRA 2QDYB 2QTVA 3EGDA 2QAZA 3HPWA 5FW9A 1W4SA 4KULA 3VUBA 1OPKA 1WX6A 2FRWA 3NGPA 3G4SQ 3FJPA 4XU1A 5D6WA 1M27C 1I8FA 2OAWA 2EYYA 3E9FA 3GP8A 5GAN2 3KBGA 1WI7A 3EGXA 3LLRA 3OYAA 2X35A 2K2MA 3CC2T 1Q86R 4N0AC 3RKWA 3OYEA 1KQSS 4ZGDB 2ZPFB 1MMGA 4M78D 4FT4A 2DMOA 3MEUA 2DX1A 2KQWA 3OBYA 1PKTA 4DQ2A 3L2WA 1SF9A 3HRTA 3OYFA 5KE2A 2F5KA 3MPUB 1JJ2S 2KBTA 2LT1A 4KH0B 5CKHA 3UT1A 1EZZB 3EFOA 3VS3A 2RQTA 2KYBA 4II1A 2MWOA 1QQJA 4AMCA 4KH1B 5GMKh 3M4GA 1UTIA 3I35A 4J9GA 3MO8A 4PJOF 3I55A 2DTHA 1YN8A 4OMQA 3CD6Q 3CPFA 4HKEA 2J6KA 4C92C 2DEQA 5IHKA 3I55T 1D3BB 3JV3A 3MKDA 3DKMA 2FZCB 2P0KA 3MHXA 2F2XA 1QCFA 2R57A 2E12A 1R0BG 3RIRA 3G6EQ 1NLPC 2X3WD 1D0XA 2O9VA 1ZSZA 3TSZA 1Q86C 1NPRA 2FPEA 4FW2A 3CMAA 1J3TA 4FM4B 3CMAT 4JRIA 1TSFA 4RTZA 2K2VA 4XTYA 3ZEHA 4EMKB 2CP0A 1ZA1B 5FRMA 5DY9A 1Z9QA 4C5IA 3O8VA 4E7KA 5HCKA 4PJOG 4M75D 3L2ZA 1YJ9Q 1YBYA 2YRCA 4J5YA 4JJDA 1W6XA 3VS2A 4D6WA 2GNCA 2IIMA 1W70A 4LDVA 4XTXA 1NG2A 2PZ1A 2IPOB 5IAYA 1Q82U 1ABOA 3BE3A 2DXBA 1NLOC 2EPDA 4XAXB 4E6RA 1I07A 4MZMA 4GLMA 4LUEA 4XTUA 1KFZA 1IXDA 3H8ZA 4J6WA 2QYZA 1YCSB 2RJEA 5LJ3g 3CCQQ 2H3JA 4A4KA 3HKSA 3CBOA 2VC8A 4UC4A 4F17A 2RHUA 5AYFA 4M7DA 1IZ6A 1N27A 2EJ9A 2ZGWA 2OTJA 1FMWA 2KT8A 1M1KR 2V1QA 4IUPA 3ZFJA 2OTJT 4LUDA 2O01E 2J06A 3CBPA 4C8QD 3V8KA 1VQPQ 2LCLA 1HJDA 1Y57A 2E5QA 1K9MR 4WCIA 3EH1A 1PG5B 2YLBA 2KNBB 1WIEA 2KAFA 3CCMQ 3META 1YCYA 2H3EB 2ZCFB 2EGAA 5GAOn 2FRYA 4A4EA 4Z8AA 4FYWB 2CSIA 4K11A 1TWBA 5KYYB 4FL6A 5FU7C 1KG1A 3ER0A 2QQRA 4C92B 4OVAA 2BZ8A 1W2BP 1XOVA 1WZOA 5LJ3j 2JMAA 2L2PA 3M5AA 2JTEA 2HNIA 3X24B 2RB6A 4JDSA 1M1KC 1N5ZA 3H0IA 3JRZA 2BTTA 1SKUB 3CCRA 3O5ZA 4C0ZA 3M56A 1Q86U 1JBMA 1S1NA 2O4XA 3CCRT 1QVGA 1AT1B 2BZXA 1VQ7Q 5GANg 2LJ0A 1PM3A 2YSQA 4L5GA 5GAN8 3QWYA 4J6YA 4ATOA 3SFMA 2DL5A 4ZGJB 1RAGB 3L42A 2X51A 2DE0X 4XTZA 5GAN6 5LJ5d 4OP0A 1SRMA 4J9DA 4RTYA 1JU5C 2EJGA 4V2SA 1MV3A 4PJOD 1G3YA 1YITQ 2OX7A 1KJWA 4LDXA 4M7AF 3JCMg 1ZUUA 4OMFB 2XDBA 1B07A 3OYCA 3HSBA 2RO0A 2I2LA 5GAN5 4DBRA 4OMLA 5IH2A 4J7FA 2MF2A 5A2QE 4FYVB 4ZTFA 1U1SA 2HDAA 4RTVA 2HMAA 4GLKA 3BFMA 4CRIA 3CMEQ 3TREA 4CC3A 4CC7A 1H3HA 5GMKi 4J7IA 5GAN7 2QDLA 3LWHA 2HBPA 4Y28E 4JZ4A 3V7CA 4GBQA 1M90C 4D8KA 3CC7A 4BI8B 4JS4A 2RK1A 1AWWA 3QBYA 1YIJA 3CC7T 2W10A 1EX4A 1ZX6A 5CKFA 1K73R 2XHCA 4M7AG 1AD5A 1MNEA 1VQLA 2DVEA 2QI2A 2L3SA 1YIJT 5HK0A 5GANj 1X6OA 2A3LA 2VB6A 1VQLT 4X34A 5CAIA 2X9HA 1ZA2B 2KK4A 1VQ6A 1TXQA 1VUBA 1AZEA 1VQ6T 3PVLA 3RKYA 3WVDB 3MP1A 1V76A 3P8DA 2K3BA 1AOJA 4IUVA 1UJ0A 3VJPA 3JB9D 1OZ2A 2KDSA 4FCYA 1BCOA 2RHXA 4M77C 4F7UF 4HCZA 2DYIA 1M9SA 3H6ZA 4KGVB 5FU7B 2CP5A 3UF4A 3MEVA 3ULRB 5LJ5h 1WA7A 1LOJA 1VA7A 2JS0A 3CC2Q 3M0TA 1U06A 4OB1B 4XQ3A 2A28A 5A0GA 4CI0C 2RK2A 4ORZA 4PJLA 2FHDA 4OGCA 1M1KU 1QWEA 2DBKA 2DO3A 1RABB 2X4JA 2LX9A 3E1SA 1FMKA 1QVGS 5I21A 1UG1A 4R55A 4M78C 5LJ3d 2D8HA 1U1TA 2F1LA 1Y0MA 2EAYA 1IO6A 5LJ3e 4Z89A 1K9MU 3IQLA 3FLGA 1X43A 4F7UG 1KD1C 4MZTA 3VS1A 1U3OA 4XTWA 2B86A 2RF0A 2CKKA 2CZ6B 2RQWA 3QG1A 3I55Q 4PLIA 2PQWA 2O2OA 2HKNA 2EW3A 2HL3A 3VS5A 5DM7R 1N8RC 5GAMg 2CUDA 4AFQC 2DAQA 2KY9A 4QKUA 1JO8A 1QVFP 4MDXA 4D8DA 2HQXA 2AZVA 1VQNQ 3INZA 4EMGA 1ACMB 3CCEA 2CT3A 4M4ZA 2ENMA 4L6V5 1M8MA 3WVEB 5DLOA 1WQWA 3GLXA 3CCET 4C5HA 4RTUA 2DZ9A 2H8HA 3KXTA 2Z0WA 4MZPA 2MK5A 3DB4A 3X28B 1RAIB 4ELYC 2QQSA 4F16A 2E3HA 3EG1A 3I56A 3DLMA 4J8OA 3PGGA 5LJ5f 1BI2A 4LD9K 3I56T 3QWXX 5D6XA 3CPWS 5J3BA 2A0FB 7AT1B 1SSHA 1UFFA 3A8OB 4LE9A 3G71A 1WGSA 3EHQA 2R5MA 4M75C 4EMHA 3G71T 1IB8A 3M0UA 5I22A 2QQAA 4LD6A 4E7HA 4OB3B 2GQVA 2RM4A 2DFUA 3H0FA 2NWMA 2MPXC 1M2OA 4X9DA 1AVZC 4C92E 3JCMQ 1VQ5A 2LMJA 3M53A 1X69A 3TCJA 3L2QA 2DF6A 3QYGB 4RMOA 1VQ5T 2LZ6B 3GNGA 4QVZA 3HRSA 1X27A 3QO3A 1BBZA 5FWBA 3V7SA 5GANd 5HKCA 3EG3A 2MOXA 4M7AD 4M77B 5GAMj 2LQ8A 4JS5A 5GANe 3JCMV 4QVDA 2DRKA 4M7DE 3QZ9B 2KROA 2OI3A 1S72A 1BKBA 3C12A 4Y91A 4XU0A 3OYNA 2YUPA 1S72T 1XTDA 4LDUA 3CCJA 3TEEA 2FB7A 3FEOA 5KCHA 3CXCP 2DL7A 3UATA 2EWNA 3CCJT 4E2FB 4R0KA 2HQEA 3VV0A 4C8QC 3OYDA 4M78B 1K73U 3JCMd 3DLLA 2XDPA 1D3BA 2RHZA 2JMCA 2L0AA 3PVQA 3JCMe 3OSSC 1HYOA 2D0QB 2E6ZA 2DTOA 1V29B 3TSWA 1BB9A 1M4ZA 2EQMA 3LYIA 1D09B 2NUPB 2RI5A 2J6OA 3OYKA 4FIBA 4BE0A 5IT9E 1PSFA 3OS1A 1X2QA 2E70A 1M1GA 4TVRA 4QQ6A 3CCUQ 2ZAEA 2JM8A 5M9OA 1LVKA 1WQ7A 1JQQA 1BIAA 4EMKA 2V8IA 1UJYA 3I5SA 2DM1A 1UHFA 3J7AF 2ZZDA 2Y90A 3PMIA 4OMMA 5I11A 1VQ9A 1Y96B 2M0OA 2EKHA 1K8AC 1VQ9T 2DTIA 1VYTA 2RI2A 3UA6A 4CC2A 3UDCA 4E7IA 1GFDA 3CCLQ 3OSVA 2NUTB 2LT4A 1T0HA 2RH2A 4XU3A 4M75B 2A37A 1I5LA 4HVUA 4OB2B 3S6WA 2WSCE 3JCMb 2EFIA 3V8JA 2KRNA 1H3ZA 1TG0A 3HFOA 1TU0B 1WFWA 2OJ2A 2E6NA 9ATCB 4AT1B 1QP2A 2ED1A 2LRQA 3JCMh 4O6JA 4LDYA 2ZPHB 3JCMJ 4PJOC 2J05A 2YT6A 2FPFA 4WTOB 3A1PA 2M0YA 3JCMX 1YHQA 4N0AA 4M7DF 1PSEA 3D7SB 1W2BS 1MNDA 4HCCA 2OAUA 1YHQT 2R58A 5GAOr 3REBB 2CYZB 5D7UA 4O5VA 2ROLA 3SWNC 1RI0A 1UECA 3I9QA 3OQ5A 3X26B 5FRNA 3CC7Q 3GF5A 1TUGB 1T3LA 5GAMd 2PVOB 2YWWA 1Q7YC 2VKNA 1VQLQ 2E10A 2M16A 5GAMe 3HHTB 1KC8C 3M55A 4C8QB 5KYYA 2FZGB 2JTFA 1VQOA 3PT9A 1K1ZA 2HAXA 2COWA 1G2BA 2ED0A 1RAEB 4RTWA 4C92A 1VQOT 2RJFA 1GL5A 1MMDA 2XMFA 3JB9F 4M7DG 2DERA 3JB9J 2DXTA 4HCKA 3ZL7C 2RHYA 1ARKA 1XQHA 1JXOA 4J9FA 2EYXA 2QEXQ 2CZ7B 3RDVA 2EQJA 1R0CB 3C4SA 3OYMA 1QVFA 4PJNA 1NPPA 3JB9I 1WNLA 4LN2A 4ZNXA 3PTAA 3EG0A 1FMVA 1ZBJA 3TQ7P 3JCMf 3FB9A 2YHTA 4IKFA 3S3NA 1ZSGA 5CO7A 2DJQA 4N4IA 5CKEA 1P92A 5I2SA 3KFVA 1VQKA 3JB9G 2YUNA 1UE9A 1VQKT 3CC4A 2EJFA 2CREA 5A0DA 3CC4T 2RJCA 1U5SA 1T3SA 4C0DC 1VQMQ 3LH0A 3BDUA 3A8LB 2L8DA 3M0QA 1GXIE 2K4YA 4R56A 5KYXA 3LGFA 1C0MA 1OOTA 2LJ1A 1NJIR 3ZBDA 1Y71A 4RG8A 2GTJA 2BE9B 1SPKA 4M77E 1QKXA 3OYBA 2RQVA 5KH6A 3E2UA 1GCQC 8ATCB 1ZQ1A 2E4HA 4NL3A 4HCBA 4LDWA 1GBQA 2J6FA 4PJOB 1RUWA 1PNJA 1RL2A 1NEBA 4J9IA 4BD3A 2K5LA 3BDLA 4J6XA 5FWCA 3UPUA 3I56Q 3EGUA 4KUIA 1YWOA 1PRMC 2EQIA 3SWNB 2MWPA 1OEBA 3CXCA 3N5BB 2MAMA 1M90R 4HVVA 3QDFA 2CGHA 3CCVA 1RAAB 3M9QA 3C0CA 1QCOA 3NFCA 2QQ9A 3CCVT 2DL4A 1NJIC 2G3RA 2KR3A 2COYA 3CCSQ 2WACA 2PU9B 2YXYA 1M3CA 1NEGA 2K5IA 3MEAA 3LW5E 1QMCA 5GMKm 3F70A 3H41A 1VQ5Q 4A63B 4BDZA 2DVJA 1KQ2A 2CH4W 5KYXB 1OYXA 4E7SA 2CUBA 2O31A 1QVFS 1WHHA 2FZKB 3TVTA 3I5RA 2DL3A 4M7AC 1WHLA 5CKDA 1WHGA 2IVWA 5IXFA 2CP7A 4M7DD 1AWJA 5IHIA 3CCJQ 4BI4A 3LWIA 4X9CA 1AHJB 1KHIA 1R77A 3MCAB 1VOMA 3RUXA 3KUFA 2VUBA 4IIOA 1JXMA 1YP5A 4M75E 3VRZA 4AFUC 3V7RA 4KBMB 4KGXB 2ZPBB 3T9NA 1KD1R 1GRIA 4C0DB 1BCMA 3OS2A 1ZBXA 1YJ9A 1Q81C 3EHRA 1T0JA 1YJ9T 3CEYA 2M02A 2SEMA 1D0YA 1N8RR 4JJNK 1IGUA 5DLQE 3QYHB 4Y92A 1HXDA 2JNGA 4PJJA 1UDLA 3EH2A 4FT2A 2JZ2A 1K0SA 4F04B 2EGCA 4MDWA 1OQKA 1MMNA 2LQWA
chains in the Genus database with same CATH topology
5GAMj 2JVVA 2LQ8A 3QPHA 3G4SA 4JS5A 5GANe 4F7UE 3JCMV 4QVDA 4FSXA 3SB2A 4M7DE 1Q86C 1NPRA 3G4ST 1UGPB 3QZ9B 3OYJA 2V8KA 1S72A 3CMAA 4XU2A 3CCUA 1BKBA 2YLCA 3C12A 4Y91A 4XU0A 5KCOA 5I2MA 3OYNA 3OW2S 4FM4B 1G3WA 3CCUT 4M78E 1S72T 3CMAT 4JRIA 2LDMA 3HL8A 4E7JA 5CQXA 1XTDA 4LDUA 2K2VA 5GMKl 3CCJA 3TU4K 4XTYA 1UEBA 2FB7A 3TEEA 3ZEHA 1XNIA 3FEOA 4Z02A 4C0FA 2DD4A 5KCHA 5DY9A 4C5IA 2VYTA 4BE2A 4BUGA 3O8VA 2EWNA 2EKOA 3CCJT 4E7KA 4PJOG 4M7DB 3AHUA 1UGSB 2HQEA 3VV0A 2EYQA 4M75D 4C8QC 4MMKA 1H641 3L2ZA 3CXCS 1YBYA 4J5YA 2V8JA 3S3OA 4D6WA 1Q7YU 3OYDA 4A54A 1K9MC 2CZ1B 4M78B 4LDVA 1K73U 2XICA 4XTXA 4HA8A 2XI9A 3CBMA 1KC8U 3JCMd 1N6AA 3DLLA 2XDPA 1D3BA 2RHZA 1VQPA 5IAYA 2Y4YA 1Q82U 2DXBA 4XAXB 3JCMe 5GAOm 3GOXA 3CCLA 3HP9A 3OSSC 4E47A 2X4XA 1BI3A 4MZMA 2D0QB 2E6ZA 1VQPT 2K5FA 2X4YA 2DIQA 4XTUA 2DTOA 3H8ZA 3CCLT 1V29B 4J6WA 3J81E 4M77A 4C92D 3A8HB 1M4ZA 2EQMA 2IG0A 3LYIA 3X25B 4PKCC 2RJEA 5LJ3g 4HT9A 2RI5A 5HY6A 1I81A 1NZ9A 3OYKA 4FIBA 3CCMA 4BE0A 5FU6C 5IT9E 1VIFA 2H3JA 1PSFA 3EFRA 4IUUA 5FROA 3OS1A 3CD6A 4A4KA 3HKSA 5LJ5e 3CCMT 2E70A 3JCMP 1M1GA 5GAMf 4TVRA 3MP6A 3CD6T 4QQ6A 3CBOA 3JCMc 5M9OA 3JCMW 1WQ7A 2VC8A 1BIAA 1R8OB 4EMKA 1VIEA 2Y4XA 4UC4A 3A8MB 2RHUA 5AYFA 2V8IA 1DJ7B 3G6EA 4M7DA 1IZ6A 1N27A 3G6ET 3J7AF 2ZZDA 3A8GB 2EJ9A 2Y90A 3PMIA 1UGRB 4M7AB 1VQ9A 1Y96B 2ZGWA 2M0OA 2RI3A 4M78A 1K8AC 2VXEA 2OTJA 4FU6A 2F69A 4NL2A 3C95A 1VQ9T 4IUPA 2DTIA 4OB0B 2WSFE 3ZFJA 3S3MA 3HRUA 4BACA 2RI2A 3SDZA 2OTJT 2O01E 3UDCA 3CBPA 2DIGA 4C8QD 4ZGEB 1X01A 4E7IA 4J83A 3V8KA 1FXXA 2F5TX 2LCLA 3JAME 3OMGA 1M90U 3QKJA 3CPWA 3OSVA 3LGLA 2E1HA 2FYKA 5GAN3 2JN0A 2P0PA 2E5QA 2LT4A 2O4XB 2NLUA 2RH2A 2YLBA 3M4YA 1FWZA 5GAOp 1X75C 2HD0A 4XU3A 1WJQA 2VV5A 4M75B 2XDDA 1I5LA 2PVGB 5IN1A 5HK3A 4JRPA 1JJ2A 2KAFA 3QZ5B 5LJ3h 4OB2B 3S6WA 3META 1N9RA 1YCYA 2DK3A 2WSCE 5GAOn 2ZCFB 3JCMb 3FRNA 1Y7XA 2EFIA 4M77F 3V8JA 1H3ZA 2E64A 4Q5WA 3HFOA 4A4EA 4XK8E 2K57A 5CR2A 3GNFB 1HK9A 2VGNA 4QW2A 2E6NA 5CQYA 4FL6A 4JRQA 2ZPEB 4QQDA 1QP2A 2LRQA 2XKOC 5FU7C 3JCMh 4O6JA 4JLGA 3J80E 4PJOE 1KG1A 1M5Q1 3ER0A 4LDYA 3CCQA 4M7AA 3PFSA 1SSFA 2QQRA 1Y96A 2ZPHB 3SD4A 4C92B 4ELZC 4BY6C 3JCMJ 4PJOC 4B9WA 3ME9A 4PL6A 4C5GA 3BY7A 4OVAA 5GMKj 3CCQT 1XOVA 2LC4A 5LJ3j 4DA4A 1WPYA 3M5AA 3JCMX 2HNIA 2QEXA 2M1HA 3QJYA 1N9SA 1OI1A 4N0AA 2RB6A 3M57A 1PSEA 3QDRB 3X24B 4M7DF 2E41A 1W2BS 4HCCA 4JDSA 1M1KC 2OAUA 4RCCA 2QEXT 1YHQT 2D6FA 2R58A 3JRZA 3OBWA 4JUVA 4RG2A 5GAOl 1VQ4A 3GIBA 3CCRA 4PNOA 5CK9A 5GAOr 4M78F 4F7UB 2CYZB 3M56A 4C0ZA 4O5VA 2BIVA 1JBMA 2O4XA 1VQ4T 1Q86U 4C8QE 2DJZA 3SWNC 4DOVA 3CCRT 2LQKA 2XIDA 2KMTA 1RI0A 3OQ5A 3X26B 5FRNA 5J26A 1KQ1A 2P0QA 4M75A 2LCCA 4A4FA 4C0GA 1QVGA 4M77G 2L89A 3GF5A 5GANg 2XD0A 1G5VA 1JB0E 2MI6A 2EQUA 2VXFA 5GAMd 2PVOB 2DPPB 3CMEA 3VU3C 1Q7YC 5J39A 4L5GA 5GAN8 3OS0A 2JUFA 2E10A 2DKGA 4J6YA 1OZ3A 4KT0E 2M16A 1K73C 5GAMe 3CMET 4ATOA 3HHTB 1KC8C 2MMPA 2E65A 2L5QA 3M55A 4C8QB 3SFMA 5A0LA 4VUBA 3L2VA 2JTFA 4HT8A 2GFAA 1M8VA 4BDYA 1VQOA 1KD1U 1Q82C 3PT9A 4ZGJB 2HAXA 1NJIU 4A4HA 2ZPIB 3L42A 3VYHB 2FVUA 4C92A 3X20B 1VQOT 4ME7A 2RJFA 1VQMA 4XTZA 3JB9F 4M7DG 5GAN6 5LJ5d 3C94A 3OB9A 3QHSA 4OP0A 2DXTA 3JB9J 1VQMT 3V8LA 2RHYA 2QTXA 4C5EA 3QJ6A 1XQHA 4BE1A 3OS5A 1N8RU 4M78G 2EJGA 4V2SA 4PJOD 1G3YA 3E9GA 2RD1A 1FX7A 3GPLA 4M7AF 2CZ7B 4LDXA 2EQJA 5LJ3f 3JCMg 3PNWC 4OMFB 1QP3A 3C4SA 4F7UA 3OYCA 2XDBA 5FU6B 2OTLA 1TH7A 2RO0A 3OYMA 1QVFA 2I2LA 5GAN5 2JOYA 3QSUA 3BW1A 2FL7A 1UB4A 2LVMA 2GF7A 4J7FA 2OTLT 2MF2A 5A2QE 1NPPA 3JB9I 1QVPA 1WNLA 4ZTFA 2L3RA 1BI0A 3LX7A 3PTAA 1U1SA 1U8RA 1NE8A 3L2RA 3L1AA 3VKIA 3MP8A 2PUOB 4P5NA 3Q1JA 2B8AA 4WF2A 3JCMf 3FB9A 2DZCA 2YHTA 4IKFA 5GANh 1BIBA 5LJ5g 5CO7A 2P4TA 3FC3A 3S3NA 4GLKA 4N4IA 3BFMA 4C8QA 4CRIA 1KQSA 5CKEA 3CC2A 4B9XA 3JB9H 1P92A 2X4WA 5LL6S 5I2SA 3TREA 1VQKA 3OYGA 3JB9G 2C06A 4MMLA 4M75F 5GMKi 3EFSA 4J7IA 1I4K1 1LJOA 4ZN1A 5GAN7 5FRMA 5C0MA 2HBPA 2QQBA 2QXFA 5CVIA 2EJFA 4OF1A 3LWHA 1VQKT 4Y28E 1B34B 3RERA 2WSEE 3V7CA 2JTMA 5CKBA 1M90C 3CC7A 3VUZA 5A0DA 4BI8B 4JS4A 3CC4T 2RJCA 1VQ7A 2RK1A 3QBYA 2K3YA 4C0DC 1YIJA 3CC7T 3DB3A 3NTIA 5CKFA 2XHCA 3LH0A 1VQ7T 4M7AG 3QIIA 1VQLA 1WJRA 3BDUA 2DVEA 2QI2A 1YIJT 3A8LB 2L8DA 1UGQB 3R6OA 5HK0A 5GANj 1X6OA 1O75A 2A3LA 3PIPA 1VQLT 1GXIE 4X34A 5CAIA 2K4YA 4C92F 4R56A 2KK4A 1Q81U 1VQ6A 1YI2A 3LGFA 2DXCA 4N4HA 1VUBA 2PUKB 3FDRA 3NTKA 2EIFA 3ZBDA 1VQ6T 1YI2T 1IREB 1Y71A 3RKYA 2K3XA 5L8RE 3WVDB 3A5ZB 4NS5A 3MP1A 4RG8A 4XTVA 1ZHIA 3M58A 3P8DA 2XG8D 3CCSA 4M77E 4IUVA 2RJDA 1VQ8A 3VJPA 1MHNA 3JB9D 1OZ2A 2KDSA 2RHXA 4M77C 3OYBA 3CCST 5KH6A 2LTOA 4F7UF 4HCZA 4M75G 5CCAA 1VQ8T 1ZQ1A 1M9SA 3WXMB 3H6ZA 1EIFA 3M59A 1YITA 5FU7B 2AHJB 4NL3A 4HCBA 4LDWA 3OYLA 3OYIA 1O9SA 3G7ZA 1G3SA 1YITT 1YJNA 3MEVA 4BY6B 4PJOB 5LJ5h 4ZTJA 1LOJA 2DXUA 4QVCA 1RL2A 1YJNT 1B34A 2XU8A 1VQNA 4OB1B 4XQ3A 2XK0A 4BD3A 2K5LA 3BDLA 5FLXE 5A0GA 4CI0C 1YHQA 2RK2A 4J6XA 2GFUA 4JRKA 4A53A 3OW2A 4EMKC 3UPUA 1VQNT 1W2BA 4PLLA 4BI3A 2FHDA 4C8QF 4OGCA 4C92G 1M1KU 4M7DC 4KUIA 4E7LA 2DO3A 3UWNA 3P8BB 2X4JA 2LX9A 3E1SA 4IUTA 4OGEA 1QVGS 4EDUA 5I21A 3SWNB 2MWPA 4R55A 4M78C 3OMCA 3URGA 2BKDN 5KE3A 3CXCA 3RKXA 1WJSA 3N5BB 2MAMA 5LJ3d 5LJ5j 1U1TA 3QUIA 3JSCA 5GMKe 2YRVA 2CGHA 3CCVA 4ZN3A 2EAYA 5GANf 3M9QA 5LJ3e 5CIUA 5EG2A 1BI1A 1K9MU 3NFCA 4N4GA 3FLGA 2QQ9A 5C6SA 4F7UG 2R5AA 3VYGA 4MZTA 3CCVT 2GCXA 1KD1C 2CZ0B 1NJIC 3RMSA 2ZPGB 4DOWA 4XTWA 2G3RA 3M54A 3CC4A 3RMQA 2CKKA 2WACA 2CZ6B 2PU9B 4RCBA 1G3TA 3QG1A 2K5IA 4PLIA 2PQWA 3ASKA 3LW5E 3MEAA 3NTHA 3OYYA 5GMKm 3F70A 4NOYA 3FIFA 5DM7R 3OYHA 4PJOA 1JRIA 2PVDB 5GAN4 4BDZA 4A4GA 5GAMg 1N8RC 1KQ2A 4M77D 2DD5A 3PIOA 2DAQA 2KY9A 4C8QG 2CS7A 3HFNA 4JLIA 2QDYB 1OYXA 4MDXA 4IURA 3HPWA 2HQXA 1W4SA 4KULA 2M9UA 3INZA 4RKUE 3VUBA 4EMGA 3QXEB 3MEWA 5GAOq 3FJPA 3CCEA 1QVFS 4L6V5 4XU1A 5D6WA 4M7AE 2KVQG 3WVEB 5DLOA 1WQWA 3GLXA 1I8FA 3CCET 4C5HA 4BB7A 3E9FA 3GP8A 4M7AC 3SWNA 3KBGA 5GAN2 2DZ9A 5CKDA 3KXTA 5D6YA 2KSSA 1Y07A 4L59A 1LNXA 3LLRA 3OYAA 2X35A 4MZPA 2IVWA 3RESA 4M7DD 3E19A 3DB4A 3X28B 3CC2T 4BI4A 3LWIA 4ELYC 2QQSA 1K8AU 4X9CA 4N0AC 3RKWA 1AHJB 3OYEA 1KHIA 1KQSS 4GY5A 4ZGDB 3I56A 2ZPFB 3MCAB 3DLMA 3RUXA 1QW1A 3PGGA 4J8OA 4M78D 3KUFA 5LJ5f 1BI2A 4LD9K 4FT4A 2LNVA 2RA2A 3I56T 3MEUA 5D6XA 3CPWS 2KQWA 3OBYA 5J3BA 2VUBA 4DQ2A 3HSBA 3L2WA 4YTLA 4QQGA 1BYMA 3HRTA 4M75E 3A8OB 3G71A 1WGSA 3OYFA 2R5MA 3P8HA 3PMTA 4M75C 5KE2A 4EMHA 2F5KA 3V7RA 4KBMB 3G71T 1M1FA 4EMKB 1JJ2S 2RHIA 2ZPBB 2LT1A 1KHCA 5CKHA 3T9NA 3UT1A 2VGMA 4C0DB 2QQAA 4LD6A 1ZBXA 3OS2A 4E7HA 1YJ9A 1Q81C 2D9TA 4II1A 5GAMh 2MWOA 4OB3B 1MGQA 1YJ9T 2GQVA 2RM4A 5GMKh 3CEYA 2A7YA 3M4GA 3L2UA 4KUDK 2BUDA 3MO8A 2EQKA 4X9DA 4PJOF 4C92E 3I55A 2DTHA 3CPFA 4HKEA 3EAEA 3JCMQ 4IUQA 4C92C 1YJWA 2DEQA 1VQ5A 3I55T 3M53A 3OA6A 4JJNK 1D3BB 3TCJA 3OY9A 3L2QA 2QA4A 1YJWT 5DLQE 3QYGB 3QYHB 3DKMA 4RMOA 1HXDA 2JNGA 1VQ5T 2P0KA 3GNGA 3MHXA 4FT2A 2JZ2A 4QVZA 3HRSA 2QA4T 2R57A 3QO3A 3V7SA 5GANd 4MDWA 2E12A 5HKCA 4EPCA 4M7AD 3RIRA 4M77B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTM A;  3KXT A;  4R55 A;  4R56 A;  3LWH A;  3LWI A; 
#chains in the Genus database with same CATH topology
 3NPF A;  4DBF A;  1OUL A;  3QPH A;  2DET A;  2KYM A;  4FSX A;  3OW2 P;  2LNH B;  1SEM A;  4QT7 A;  1I1J A;  2HKQ B;  3OYJ A;  2YLC A;  5KCO A;  2C0T A;  2DBM A;  2LDM A;  1M3B A;  3HL8 A;  1M2V B;  4E7J A;  1UEB A;  2DD4 A;  1RLQ C;  1B7T A;  2EKO A;  2CSQ A;  1UGS B;  2EYQ A;  4MMK A;  1H64 1;  3CXC S;  1NBE B;  4ESR A;  2CZ1 B;  2XIC A;  4HA8 A;  3CBM A;  4RUG A;  1N6A A;  1VQP A;  2Y4Y A;  1PHT A;  5GAO m;  3GOX A;  3HP9 A;  1QKW A;  2X4X A;  5IXB A;  1VQP T;  2FO0 A;  2DEU A;  2K5F A;  2DIQ A;  2DLP A;  2P84 A;  4M77 A;  1C1A A;  3A8H B;  1D1A A;  3X25 B;  4PKC C;  5HY6 A;  4Z88 A;  1I81 A;  3CCM A;  1WHK A;  1VIF A;  5GJW B;  3CCM T;  3JCM P;  1IHW A;  1PWT A;  2G6F X;  3CMA Q;  1X2K A;  3JCM W;  1YHQ Q;  1OV3 A;  2Y4X A;  4PK4 A;  4OMN A;  4FYX B;  1DJ7 B;  1YNZ A;  1TUD A;  4HXJ A;  1WXU A;  1CKB A;  2DA9 A;  4M7A B;  3EG9 B;  2ESW A;  2HBW A;  4M78 A;  2QK0 A;  2F69 A;  3C95 A;  1EFN A;  2WSF E;  3S3M A;  4RTT A;  3HRU A;  4BAC A;  1ZUK A;  2DIG A;  1JEG A;  4ZGE B;  1X01 A;  4J83 A;  4J9B A;  1B3Q A;  1FXX A;  2F5T X;  1M90 U;  3QKJ A;  2FEI A;  2YUQ A;  3M0S A;  2HQH A;  1AWO A;  1VQO Q;  2NUP A;  1WHM A;  2P0P A;  1KIK A;  1G83 A;  3M4Y A;  3VS0 A;  5GAO p;  1WJQ A;  2VV5 A;  1JJ2 A;  3QZ5 B;  5LJ3 h;  1N9R A;  2DK3 A;  2E64 A;  2DL8 A;  4Q5W A;  4XK8 E;  3GNF B;  2KI7 A;  5GJV B;  2VGN A;  4QW2 A;  4JRQ A;  4EIK A;  2ZPE B;  4QQD A;  2K9G A;  4X1V A;  4JLG A;  4PJO E;  2MCN A;  1SSF A;  3SD4 A;  1UUE A;  1Y96 A;  4PL6 A;  2EYW A;  2VWF A;  1YFN A;  3BY7 A;  3THK A;  5KYU B;  4DA4 A;  1WPY A;  4ANJ A;  2OTJ Q;  1N9S A;  1OI1 A;  3M57 A;  1IGQ A;  2E41 A;  3OBW A;  1VQ4 A;  4JUV A;  4RG2 A;  2NUT A;  3GIB A;  1VQK Q;  4F7U B;  2BIV A;  1VQ4 T;  1K8A R;  4DOV A;  2LQK A;  2XID A;  3CC4 Q;  5J26 A;  1KQ1 A;  4F14 A;  2P0Q A;  4M75 A;  2LCC A;  4A4F A;  5KYN A;  2L89 A;  4OMP A;  1G5V A;  2VXF A;  3CME A;  5J39 A;  4KT0 E;  1OZ3 A;  2P4R A;  3CME T;  1OU8 A;  2MMP A;  4VUB A;  4BDY A;  1KD1 U;  1Q82 C;  4A4H A;  2ZPI B;  3VYH B;  1OX8 A;  2FVU A;  3X20 B;  3H9N A;  1WLP B;  5KYW B;  2J7I A;  1H92 A;  1CSK A;  4J9C A;  3OB9 A;  1WYX A;  2PNI A;  4C5E A;  3CQT A;  4BE1 A;  1N8R U;  3E9G A;  2RD1 A;  2COZ A;  1MMA A;  5LJ3 f;  1QP3 A;  2OTL A;  1TH7 A;  3QSU A;  1UB4 A;  3CCR Q;  2OTL T;  1QVP A;  2L3R A;  2JJ9 A;  3LX7 A;  1U8R A;  3L2R A;  3LH5 A;  3MP8 A;  2PUO B;  3Q1J A;  4WF2 A;  3RBB B;  2DZC A;  5GAN h;  1BIB A;  5LJ5 g;  2P4T A;  1ZSZ C;  4C8Q A;  1BU1 A;  2K79 A;  3JB9 H;  3CC2 A;  4B9X A;  2X4W A;  5LL6 S;  2V1R A;  4MML A;  1SHG A;  3R6N A;  1LJO A;  2CP2 A;  4ZN1 A;  3CPW P;  2QXF A;  4OF1 A;  1B34 B;  3REA B;  2WSE E;  3CCV Q;  1RAF B;  5CKB A;  3VUZ A;  1Q7Y R;  3QII A;  1KC8 R;  1RAD B;  1WJR A;  3EG2 A;  3R6O A;  3PIP A;  1BK2 A;  2D8J A;  2F2V A;  4C92 F;  2RMO A;  1YI2 A;  2KXD A;  2DXC A;  4N4H A;  4LNP A;  2EIF A;  1YI2 T;  2KE9 A;  5L8R E;  1TUC A;  4NS5 A;  2KT1 A;  1ZHI A;  3M58 A;  2XG8 D;  2RJD A;  1VQ8 A;  1PRL C;  2QG9 B;  2LTO A;  1VQ8 T;  3M59 A;  2GGR A;  3GBQ A;  3OYL A;  1O9S A;  3G7Z A;  1G3S A;  1X6G A;  1YJN A;  2RNA A;  4KRT A;  1PCX A;  1YJN T;  2XU8 A;  1VQN A;  1G8X A;  2F2W A;  4JRK A;  1QCN A;  3EGD B;  3OW2 A;  1VQN T;  4PLL A;  1PD0 A;  1X6B A;  2BE7 D;  2JXB A;  4C92 G;  4M7D C;  6AT1 B;  3P8B B;  1LCK A;  1YIJ Q;  1QLY A;  1K76 A;  4EDU A;  2EBP A;  1IRX A;  2HSE B;  3URG A;  2BKD N;  3EGX B;  5KE3 A;  1WJS A;  1Z9Z A;  5LJ5 j;  3QUI A;  3JSC A;  2AT1 B;  2YRV A;  1VQ6 Q;  4ZN3 A;  5GAN f;  4PJM A;  5CIU A;  1BI1 A;  1V1C A;  3VYG A;  1E7O A;  2A08 A;  2ZPG B;  1PD1 A;  1YWP A;  1VYU A;  1TTH B;  5EC7 A;  1ZLM A;  1G3T A;  2NUZ A;  3ASK A;  1RI9 A;  2DYB A;  1K9A A;  3FIF A;  4PJO A;  2PVD B;  5GAN 4;  4A4G A;  1GCP A;  4E7Z A;  2DD5 A;  2YDL A;  2L3P A;  3EFO B;  4JLI A;  4IUR A;  2M9U A;  2CDT A;  4J9E A;  4RKU E;  3QXE B;  1E6G A;  3MEW A;  5GAO q;  1PKS A;  1NYG A;  1TOV A;  4M7A E;  1OPL A;  2KVQ G;  4CC4 B;  4BB7 A;  3SWN A;  5D6Y A;  4LXC A;  2KSS A;  1Y07 A;  2K7A A;  3M0P A;  1LNX A;  4L59 A;  1KQS P;  3RES A;  3E19 A;  2YUO A;  3RR6 A;  2V26 A;  1K8A U;  2AKL A;  2GTO A;  2VVK A;  4GY5 A;  2KEA A;  5ECA A;  5AT1 B;  1F1B B;  1QW1 A;  1ZSZ B;  2LNV A;  2RA2 A;  1NYF A;  5IHN A;  4QQG A;  1BYM A;  1JJ2 P;  2O88 A;  2KRM A;  3P8H A;  3PMT A;  1RAH B;  1MUZ A;  1M1F A;  2RHI A;  1ABQ A;  1KHC A;  3RNJ A;  2VGM A;  3MJX A;  2YRD A;  2D0N A;  2D9T A;  3SEM A;  5GAM h;  1D1C A;  1MGQ A;  2AKK A;  2A7Y A;  3L2U A;  4KUD K;  2BUD A;  2RPN A;  2EQK A;  3CCE Q;  1YJW A;  3EAE A;  4IUQ A;  3NMZ C;  1MV0 B;  3OA6 A;  3OY9 A;  1WHJ A;  2QA4 A;  1YJW T;  3NHN A;  1K0X A;  2QA4 T;  2DIL A;  2ATC B;  2O9S A;  4EPC A;  1TS9 A;  8AT1 B;  4YTL A;  2JVV A;  2W0Z A;  3G4S A;  4F7U E;  3SHW A;  3SB2 A;  3G4S T;  1UGP B;  2CT4 A;  2V8K A;  3CCU A;  4XU2 A;  1OU9 A;  3OW2 S;  5I2M A;  1G3W A;  3A98 A;  4M78 E;  3CCU T;  3TU4 K;  5CQX A;  5GMK l;  3G71 Q;  1KSW A;  1XNI A;  4Z02 A;  4C0F A;  4BE2 A;  2RQR A;  2VYT A;  4BUG A;  4DEX A;  4M7D B;  3AHU A;  3HTR A;  2V8J A;  3S3O A;  1Q7Y U;  4A54 A;  1K9M C;  1RAC B;  4IIM A;  1KC8 U;  2XI9 A;  1SRL A;  3VS6 A;  2QGG A;  1D0Z A;  2GQI A;  3CCL A;  4E47 A;  1BI3 A;  1Q81 R;  2KXC A;  2X4Y A;  2CP3 A;  3CCL T;  3J81 E;  4C92 D;  1GCQ A;  2RN8 A;  2IG0 A;  4HT9 A;  2HEQ A;  1NZ9 A;  5FU6 C;  3EFR A;  4IUU A;  5FRO A;  3CD6 A;  2I0N A;  5LJ5 e;  3UA7 A;  5GAM f;  1OX9 A;  3MP6 A;  3CD6 T;  1S72 Q;  3JCM c;  4JZ3 A;  1RLP C;  1M2V A;  1WXT A;  4B6M A;  1R8O B;  1VIE A;  4FW1 A;  3A8M B;  1FYN A;  5L23 A;  2HL5 C;  4FYY B;  2ABL A;  2DRM A;  3G6E A;  1VQ4 Q;  2EYZ A;  3G6E T;  3A8G B;  4PFP A;  1UGR B;  2K6D A;  1Q95 G;  2RI3 A;  2VXE A;  4FU6 A;  4NL2 A;  2FPD A;  4OB0 B;  2QAS A;  3SDZ A;  4AFS C;  4OMO A;  1XJW B;  2HSP A;  2LJ3 A;  2JS2 A;  2AZS A;  2E3I A;  1NM7 A;  3U23 A;  3JAM E;  3OMG A;  3CPW A;  3LGL A;  2E1H A;  2FYK A;  5GAN 3;  2JN0 A;  2O4X B;  2NLU A;  4PFO A;  1FWZ A;  1X75 C;  2HD0 A;  4PFZ A;  2XDD A;  1WDX A;  2PVG B;  5IN1 A;  5HK3 A;  4JRP A;  1HSQ A;  3FRN A;  1AWX A;  1Y7X A;  4M77 F;  4AFZ C;  2K57 A;  2VAS A;  5CR2 A;  1HK9 A;  4DBH A;  4DEY A;  5CQY A;  1CKA A;  1SG5 A;  2XKO C;  2ROT A;  2OTL Q;  3J80 E;  1M5Q 1;  4M7A A;  3CCQ A;  3EG9 A;  3PFS A;  1WXB A;  4ELZ C;  4BY6 C;  4B9W A;  3ME9 A;  4C5G A;  5GMK j;  3CCQ T;  2JW4 A;  1VQ9 Q;  2LC4 A;  2L3Q A;  2QEX A;  2M1H A;  3QJY A;  3QDR B;  1AZG B;  4RCC A;  2QEX T;  2D6F A;  5GAO l;  3FJ5 A;  4PNO A;  5CK9 A;  4M78 F;  3H0H A;  4C8Q E;  2DJZ A;  2KMT A;  4DBQ A;  2PTK A;  4C0G A;  4M77 G;  2AK5 A;  2XD0 A;  1JB0 E;  2MI6 A;  2EQU A;  2DPP B;  3VU3 C;  3OS0 A;  2JUF A;  1PC0 A;  4JPB W;  2DKG A;  1K73 C;  2C0I A;  2E65 A;  2L5Q A;  5A0L A;  3L2V A;  4HT8 A;  2GFA A;  4RTX A;  1M8V A;  1YI2 Q;  1NJI U;  2BZY A;  1GBR A;  2LP5 A;  1QWF A;  4ME7 A;  1VQM A;  2LCS A;  3C94 A;  3QHS A;  2FG0 A;  4J9H A;  5KYU A;  1VQM T;  3PE0 A;  1SHF A;  3V8L A;  2QTX A;  1VQ8 Q;  3QJ6 A;  3OS5 A;  4M78 G;  1K4U S;  2D1X A;  4KGZ B;  4FSS A;  1FX7 A;  3GPL A;  3VS4 A;  3PNW C;  4F7U A;  1YJN Q;  5FU6 B;  2JOY A;  2KRS A;  3BW1 A;  2FL7 A;  2LVM A;  2GF7 A;  1BI0 A;  4AG1 C;  1KK7 A;  1NE8 A;  3L1A A;  3VKI A;  4P5N A;  2B8A A;  2NYS A;  3FC3 A;  1KQS A;  3OYG A;  1UHC A;  2C06 A;  2X3X D;  4M75 F;  1H8K A;  1I5O B;  3EFS A;  1I4K 1;  1D1B A;  5C0M A;  2QQB A;  2QGF B;  5CVI A;  3RER A;  2HCK A;  5KYW A;  2RQU A;  2JTM A;  2LX7 A;  3AT1 B;  1VQ7 A;  2MYS A;  1HD3 A;  2K3Y A;  3DB3 A;  3NTI A;  1VQ7 T;  1AEY A;  1UGQ B;  1O75 A;  3M0R A;  1Q82 R;  2LQN A;  1Q81 U;  2DNU A;  2PUK B;  3FDR A;  2AIR B;  3NTK A;  1IRE B;  2K3X A;  1IHV A;  3A5Z B;  4XTV A;  3CCS A;  1MHN A;  3CCS T;  2JM9 A;  2GBQ A;  1C6V X;  4M75 G;  5CCA A;  3WXM B;  1YIT A;  1EIF A;  2AHJ B;  1ZUY A;  3OYI A;  1YIT T;  4BY6 B;  4ZTJ A;  2DXU A;  4JJC A;  4QVC A;  1B34 A;  1M30 A;  2XK0 A;  5FLX E;  2EGE A;  1GFC A;  1M3A A;  4JJB A;  2GFU A;  4A53 A;  4EMK C;  1W2B A;  4BI3 A;  1A0N B;  4C8Q F;  1QVG P;  1LPL A;  4E7L A;  2SRC A;  3UWN A;  1UGV A;  2JT4 A;  4IUT A;  4OGE A;  2HZY A;  3VS7 A;  3OMC A;  3RKX A;  5GMK e;  4AG2 C;  2A36 A;  1W1F A;  5EG2 A;  1I0C A;  4N4G A;  5C6S A;  2R5A A;  2GCX A;  2CZ0 B;  2CP6 A;  3RMS A;  2MIO A;  4DOW A;  1VYV A;  4HVW A;  2KGT A;  3M54 A;  3RMQ A;  4RCB A;  3NTH A;  2CH4 A;  2ECZ A;  3OYY A;  1YJW Q;  1E6H A;  4NOY A;  3OYH A;  1JRI A;  2C0O A;  2QA4 Q;  4M77 D;  3G1J A;  3PIO A;  3VRY A;  4C8Q G;  2CS7 A;  3HFN A;  2M51 A;  2E5K A;  2EVR A;  2QDY B;  2QTV A;  3EGD A;  2QAZ A;  3HPW A;  5FW9 A;  1W4S A;  4KUL A;  3VUB A;  1OPK A;  1WX6 A;  2FRW A;  3NGP A;  3G4S Q;  3FJP A;  4XU1 A;  5D6W A;  1M27 C;  1I8F A;  2OAW A;  2EYY A;  3E9F A;  3GP8 A;  5GAN 2;  3KBG A;  1WI7 A;  3EGX A;  3LLR A;  3OYA A;  2X35 A;  2K2M A;  3CC2 T;  1Q86 R;  4N0A C;  3RKW A;  3OYE A;  1KQS S;  4ZGD B;  2ZPF B;  1MMG A;  4M78 D;  4FT4 A;  2DMO A;  3MEU A;  2DX1 A;  2KQW A;  3OBY A;  1PKT A;  4DQ2 A;  3L2W A;  1SF9 A;  3HRT A;  3OYF A;  5KE2 A;  2F5K A;  3MPU B;  1JJ2 S;  2KBT A;  2LT1 A;  4KH0 B;  5CKH A;  3UT1 A;  1EZZ B;  3EFO A;  3VS3 A;  2RQT A;  2KYB A;  4II1 A;  2MWO A;  1QQJ A;  4AMC A;  4KH1 B;  5GMK h;  3M4G A;  1UTI A;  3I35 A;  4J9G A;  3MO8 A;  4PJO F;  3I55 A;  2DTH A;  1YN8 A;  4OMQ A;  3CD6 Q;  3CPF A;  4HKE A;  2J6K A;  4C92 C;  2DEQ A;  5IHK A;  3I55 T;  1D3B B;  3JV3 A;  3MKD A;  3DKM A;  2FZC B;  2P0K A;  3MHX A;  2F2X A;  1QCF A;  2R57 A;  2E12 A;  1R0B G;  3RIR A;  3G6E Q;  1NLP C;  2X3W D;  1D0X A;  2O9V A;  1ZSZ A;  3TSZ A;  1Q86 C;  1NPR A;  2FPE A;  4FW2 A;  3CMA A;  1J3T A;  4FM4 B;  3CMA T;  4JRI A;  1TSF A;  4RTZ A;  2K2V A;  4XTY A;  3ZEH A;  4EMK B;  2CP0 A;  1ZA1 B;  5FRM A;  5DY9 A;  1Z9Q A;  4C5I A;  3O8V A;  4E7K A;  5HCK A;  4PJO G;  4M75 D;  3L2Z A;  1YJ9 Q;  1YBY A;  2YRC A;  4J5Y A;  4JJD A;  1W6X A;  3VS2 A;  4D6W A;  2GNC A;  2IIM A;  1W70 A;  4LDV A;  4XTX A;  1NG2 A;  2PZ1 A;  2IPO B;  5IAY A;  1Q82 U;  1ABO A;  3BE3 A;  2DXB A;  1NLO C;  2EPD A;  4XAX B;  4E6R A;  1I07 A;  4MZM A;  4GLM A;  4LUE A;  4XTU A;  1KFZ A;  1IXD A;  3H8Z A;  4J6W A;  2QYZ A;  1YCS B;  2RJE A;  5LJ3 g;  3CCQ Q;  2H3J A;  4A4K A;  3HKS A;  3CBO A;  2VC8 A;  4UC4 A;  4F17 A;  2RHU A;  5AYF A;  4M7D A;  1IZ6 A;  1N27 A;  2EJ9 A;  2ZGW A;  2OTJ A;  1FMW A;  2KT8 A;  1M1K R;  2V1Q A;  4IUP A;  3ZFJ A;  2OTJ T;  4LUD A;  2O01 E;  2J06 A;  3CBP A;  4C8Q D;  3V8K A;  1VQP Q;  2LCL A;  1HJD A;  1Y57 A;  2E5Q A;  1K9M R;  4WCI A;  3EH1 A;  1PG5 B;  2YLB A;  2KNB B;  1WIE A;  2KAF A;  3CCM Q;  3MET A;  1YCY A;  2H3E B;  2ZCF B;  2EGA A;  5GAO n;  2FRY A;  4A4E A;  4Z8A A;  4FYW B;  2CSI A;  4K11 A;  1TWB A;  5KYY B;  4FL6 A;  5FU7 C;  1KG1 A;  3ER0 A;  2QQR A;  4C92 B;  4OVA A;  2BZ8 A;  1W2B P;  1XOV A;  1WZO A;  5LJ3 j;  2JMA A;  2L2P A;  3M5A A;  2JTE A;  2HNI A;  3X24 B;  2RB6 A;  4JDS A;  1M1K C;  1N5Z A;  3H0I A;  3JRZ A;  2BTT A;  1SKU B;  3CCR A;  3O5Z A;  4C0Z A;  3M56 A;  1Q86 U;  1JBM A;  1S1N A;  2O4X A;  3CCR T;  1QVG A;  1AT1 B;  2BZX A;  1VQ7 Q;  5GAN g;  2LJ0 A;  1PM3 A;  2YSQ A;  4L5G A;  5GAN 8;  3QWY A;  4J6Y A;  4ATO A;  3SFM A;  2DL5 A;  4ZGJ B;  1RAG B;  3L42 A;  2X51 A;  2DE0 X;  4XTZ A;  5GAN 6;  5LJ5 d;  4OP0 A;  1SRM A;  4J9D A;  4RTY A;  1JU5 C;  2EJG A;  4V2S A;  1MV3 A;  4PJO D;  1G3Y A;  1YIT Q;  2OX7 A;  1KJW A;  4LDX A;  4M7A F;  3JCM g;  1ZUU A;  4OMF B;  2XDB A;  1B07 A;  3OYC A;  3HSB A;  2RO0 A;  2I2L A;  5GAN 5;  4DBR A;  4OML A;  5IH2 A;  4J7F A;  2MF2 A;  5A2Q E;  4FYV B;  4ZTF A;  1U1S A;  2HDA A;  4RTV A;  2HMA A;  4GLK A;  3BFM A;  4CRI A;  3CME Q;  3TRE A;  4CC3 A;  4CC7 A;  1H3H A;  5GMK i;  4J7I A;  5GAN 7;  2QDL A;  3LWH A;  2HBP A;  4Y28 E;  4JZ4 A;  3V7C A;  4GBQ A;  1M90 C;  4D8K A;  3CC7 A;  4BI8 B;  4JS4 A;  2RK1 A;  1AWW A;  3QBY A;  1YIJ A;  3CC7 T;  2W10 A;  1EX4 A;  1ZX6 A;  5CKF A;  1K73 R;  2XHC A;  4M7A G;  1AD5 A;  1MNE A;  1VQL A;  2DVE A;  2QI2 A;  2L3S A;  1YIJ T;  5HK0 A;  5GAN j;  1X6O A;  2A3L A;  2VB6 A;  1VQL T;  4X34 A;  5CAI A;  2X9H A;  1ZA2 B;  2KK4 A;  1VQ6 A;  1TXQ A;  1VUB A;  1AZE A;  1VQ6 T;  3PVL A;  3RKY A;  3WVD B;  3MP1 A;  1V76 A;  3P8D A;  2K3B A;  1AOJ A;  4IUV A;  1UJ0 A;  3VJP A;  3JB9 D;  1OZ2 A;  2KDS A;  4FCY A;  1BCO A;  2RHX A;  4M77 C;  4F7U F;  4HCZ A;  2DYI A;  1M9S A;  3H6Z A;  4KGV B;  5FU7 B;  2CP5 A;  3UF4 A;  3MEV A;  3ULR B;  5LJ5 h;  1WA7 A;  1LOJ A;  1VA7 A;  2JS0 A;  3CC2 Q;  3M0T A;  1U06 A;  4OB1 B;  4XQ3 A;  2A28 A;  5A0G A;  4CI0 C;  2RK2 A;  4ORZ A;  4PJL A;  2FHD A;  4OGC A;  1M1K U;  1QWE A;  2DBK A;  2DO3 A;  1RAB B;  2X4J A;  2LX9 A;  3E1S A;  1FMK A;  1QVG S;  5I21 A;  1UG1 A;  4R55 A;  4M78 C;  5LJ3 d;  2D8H A;  1U1T A;  2F1L A;  1Y0M A;  2EAY A;  1IO6 A;  5LJ3 e;  4Z89 A;  1K9M U;  3IQL A;  3FLG A;  1X43 A;  4F7U G;  1KD1 C;  4MZT A;  3VS1 A;  1U3O A;  4XTW A;  2B86 A;  2RF0 A;  2CKK A;  2CZ6 B;  2RQW A;  3QG1 A;  3I55 Q;  4PLI A;  2PQW A;  2O2O A;  2HKN A;  2EW3 A;  2HL3 A;  3VS5 A;  5DM7 R;  1N8R C;  5GAM g;  2CUD A;  4AFQ C;  2DAQ A;  2KY9 A;  4QKU A;  1JO8 A;  1QVF P;  4MDX A;  4D8D A;  2HQX A;  2AZV A;  1VQN Q;  3INZ A;  4EMG A;  1ACM B;  3CCE A;  2CT3 A;  4M4Z A;  2ENM A;  4L6V 5;  1M8M A;  3WVE B;  5DLO A;  1WQW A;  3GLX A;  3CCE T;  4C5H A;  4RTU A;  2DZ9 A;  2H8H A;  3KXT A;  2Z0W A;  4MZP A;  2MK5 A;  3DB4 A;  3X28 B;  1RAI B;  4ELY C;  2QQS A;  4F16 A;  2E3H A;  3EG1 A;  3I56 A;  3DLM A;  4J8O A;  3PGG A;  5LJ5 f;  1BI2 A;  4LD9 K;  3I56 T;  3QWX X;  5D6X A;  3CPW S;  5J3B A;  2A0F B;  7AT1 B;  1SSH A;  1UFF A;  3A8O B;  4LE9 A;  3G71 A;  1WGS A;  3EHQ A;  2R5M A;  4M75 C;  4EMH A;  3G71 T;  1IB8 A;  3M0U A;  5I22 A;  2QQA A;  4LD6 A;  4E7H A;  4OB3 B;  2GQV A;  2RM4 A;  2DFU A;  3H0F A;  2NWM A;  2MPX C;  1M2O A;  4X9D A;  1AVZ C;  4C92 E;  3JCM Q;  1VQ5 A;  2LMJ A;  3M53 A;  1X69 A;  3TCJ A;  3L2Q A;  2DF6 A;  3QYG B;  4RMO A;  1VQ5 T;  2LZ6 B;  3GNG A;  4QVZ A;  3HRS A;  1X27 A;  3QO3 A;  1BBZ A;  5FWB A;  3V7S A;  5GAN d;  5HKC A;  3EG3 A;  2MOX A;  4M7A D;  4M77 B;  5GAM j;  2LQ8 A;  4JS5 A;  5GAN e;  3JCM V;  4QVD A;  2DRK A;  4M7D E;  3QZ9 B;  2KRO A;  2OI3 A;  1S72 A;  1BKB A;  3C12 A;  4Y91 A;  4XU0 A;  3OYN A;  2YUP A;  1S72 T;  1XTD A;  4LDU A;  3CCJ A;  3TEE A;  2FB7 A;  3FEO A;  5KCH A;  3CXC P;  2DL7 A;  3UAT A;  2EWN A;  3CCJ T;  4E2F B;  4R0K A;  2HQE A;  3VV0 A;  4C8Q C;  3OYD A;  4M78 B;  1K73 U;  3JCM d;  3DLL A;  2XDP A;  1D3B A;  2RHZ A;  2JMC A;  2L0A A;  3PVQ A;  3JCM e;  3OSS C;  1HYO A;  2D0Q B;  2E6Z A;  2DTO A;  1V29 B;  3TSW A;  1BB9 A;  1M4Z A;  2EQM A;  3LYI A;  1D09 B;  2NUP B;  2RI5 A;  2J6O A;  3OYK A;  4FIB A;  4BE0 A;  5IT9 E;  1PSF A;  3OS1 A;  1X2Q A;  2E70 A;  1M1G A;  4TVR A;  4QQ6 A;  3CCU Q;  2ZAE A;  2JM8 A;  5M9O A;  1LVK A;  1WQ7 A;  1JQQ A;  1BIA A;  4EMK A;  2V8I A;  1UJY A;  3I5S A;  2DM1 A;  1UHF A;  3J7A F;  2ZZD A;  2Y90 A;  3PMI A;  4OMM A;  5I11 A;  1VQ9 A;  1Y96 B;  2M0O A;  2EKH A;  1K8A C;  1VQ9 T;  2DTI A;  1VYT A;  2RI2 A;  3UA6 A;  4CC2 A;  3UDC A;  4E7I A;  1GFD A;  3CCL Q;  3OSV A;  2NUT B;  2LT4 A;  1T0H A;  2RH2 A;  4XU3 A;  4M75 B;  2A37 A;  1I5L A;  4HVU A;  4OB2 B;  3S6W A;  2WSC E;  3JCM b;  2EFI A;  3V8J A;  2KRN A;  1H3Z A;  1TG0 A;  3HFO A;  1TU0 B;  1WFW A;  2OJ2 A;  2E6N A;  9ATC B;  4AT1 B;  1QP2 A;  2ED1 A;  2LRQ A;  3JCM h;  4O6J A;  4LDY A;  2ZPH B;  3JCM J;  4PJO C;  2J05 A;  2YT6 A;  2FPF A;  4WTO B;  3A1P A;  2M0Y A;  3JCM X;  1YHQ A;  4N0A A;  4M7D F;  1PSE A;  3D7S B;  1W2B S;  1MND A;  4HCC A;  2OAU A;  1YHQ T;  2R58 A;  5GAO r;  3REB B;  2CYZ B;  5D7U A;  4O5V A;  2ROL A;  3SWN C;  1RI0 A;  1UEC A;  3I9Q A;  3OQ5 A;  3X26 B;  5FRN A;  3CC7 Q;  3GF5 A;  1TUG B;  1T3L A;  5GAM d;  2PVO B;  2YWW A;  1Q7Y C;  2VKN A;  1VQL Q;  2E10 A;  2M16 A;  5GAM e;  3HHT B;  1KC8 C;  3M55 A;  4C8Q B;  5KYY A;  2FZG B;  2JTF A;  1VQO A;  3PT9 A;  1K1Z A;  2HAX A;  2COW A;  1G2B A;  2ED0 A;  1RAE B;  4RTW A;  4C92 A;  1VQO T;  2RJF A;  1GL5 A;  1MMD A;  2XMF A;  3JB9 F;  4M7D G;  2DER A;  3JB9 J;  2DXT A;  4HCK A;  3ZL7 C;  2RHY A;  1ARK A;  1XQH A;  1JXO A;  4J9F A;  2EYX A;  2QEX Q;  2CZ7 B;  3RDV A;  2EQJ A;  1R0C B;  3C4S A;  3OYM A;  1QVF A;  4PJN A;  1NPP A;  3JB9 I;  1WNL A;  4LN2 A;  4ZNX A;  3PTA A;  3EG0 A;  1FMV A;  1ZBJ A;  3TQ7 P;  3JCM f;  3FB9 A;  2YHT A;  4IKF A;  3S3N A;  1ZSG A;  5CO7 A;  2DJQ A;  4N4I A;  5CKE A;  1P92 A;  5I2S A;  3KFV A;  1VQK A;  3JB9 G;  2YUN A;  1UE9 A;  1VQK T;  3CC4 A;  2EJF A;  2CRE A;  5A0D A;  3CC4 T;  2RJC A;  1U5S A;  1T3S A;  4C0D C;  1VQM Q;  3LH0 A;  3BDU A;  3A8L B;  2L8D A;  3M0Q A;  1GXI E;  2K4Y A;  4R56 A;  5KYX A;  3LGF A;  1C0M A;  1OOT A;  2LJ1 A;  1NJI R;  3ZBD A;  1Y71 A;  4RG8 A;  2GTJ A;  2BE9 B;  1SPK A;  4M77 E;  1QKX A;  3OYB A;  2RQV A;  5KH6 A;  3E2U A;  1GCQ C;  8ATC B;  1ZQ1 A;  2E4H A;  4NL3 A;  4HCB A;  4LDW A;  1GBQ A;  2J6F A;  4PJO B;  1RUW A;  1PNJ A;  1RL2 A;  1NEB A;  4J9I A;  4BD3 A;  2K5L A;  3BDL A;  4J6X A;  5FWC A;  3UPU A;  3I56 Q;  3EGU A;  4KUI A;  1YWO A;  1PRM C;  2EQI A;  3SWN B;  2MWP A;  1OEB A;  3CXC A;  3N5B B;  2MAM A;  1M90 R;  4HVV A;  3QDF A;  2CGH A;  3CCV A;  1RAA B;  3M9Q A;  3C0C A;  1QCO A;  3NFC A;  2QQ9 A;  3CCV T;  2DL4 A;  1NJI C;  2G3R A;  2KR3 A;  2COY A;  3CCS Q;  2WAC A;  2PU9 B;  2YXY A;  1M3C A;  1NEG A;  2K5I A;  3MEA A;  3LW5 E;  1QMC A;  5GMK m;  3F70 A;  3H41 A;  1VQ5 Q;  4A63 B;  4BDZ A;  2DVJ A;  1KQ2 A;  2CH4 W;  5KYX B;  1OYX A;  4E7S A;  2CUB A;  2O31 A;  1QVF S;  1WHH A;  2FZK B;  3TVT A;  3I5R A;  2DL3 A;  4M7A C;  1WHL A;  5CKD A;  1WHG A;  2IVW A;  5IXF A;  2CP7 A;  4M7D D;  1AWJ A;  5IHI A;  3CCJ Q;  4BI4 A;  3LWI A;  4X9C A;  1AHJ B;  1KHI A;  1R77 A;  3MCA B;  1VOM A;  3RUX A;  3KUF A;  2VUB A;  4IIO A;  1JXM A;  1YP5 A;  4M75 E;  3VRZ A;  4AFU C;  3V7R A;  4KBM B;  4KGX B;  2ZPB B;  3T9N A;  1KD1 R;  1GRI A;  4C0D B;  1BCM A;  3OS2 A;  1ZBX A;  1YJ9 A;  1Q81 C;  3EHR A;  1T0J A;  1YJ9 T;  3CEY A;  2M02 A;  2SEM A;  1D0Y A;  1N8R R;  4JJN K;  1IGU A;  5DLQ E;  3QYH B;  4Y92 A;  1HXD A;  2JNG A;  4PJJ A;  1UDL A;  3EH2 A;  4FT2 A;  2JZ2 A;  1K0S A;  4F04 B;  2EGC A;  4MDW A;  1OQK A;  1MMN A;  2LQW A; 
#chains in the Genus database with same CATH homology
 5GAM j;  2JVV A;  2LQ8 A;  3QPH A;  3G4S A;  4JS5 A;  5GAN e;  4F7U E;  3JCM V;  4QVD A;  4FSX A;  3SB2 A;  4M7D E;  1Q86 C;  1NPR A;  3G4S T;  1UGP B;  3QZ9 B;  3OYJ A;  2V8K A;  1S72 A;  3CMA A;  4XU2 A;  3CCU A;  1BKB A;  2YLC A;  3C12 A;  4Y91 A;  4XU0 A;  5KCO A;  5I2M A;  3OYN A;  3OW2 S;  4FM4 B;  1G3W A;  3CCU T;  4M78 E;  1S72 T;  3CMA T;  4JRI A;  2LDM A;  3HL8 A;  4E7J A;  5CQX A;  1XTD A;  4LDU A;  2K2V A;  5GMK l;  3CCJ A;  3TU4 K;  4XTY A;  1UEB A;  2FB7 A;  3TEE A;  3ZEH A;  1XNI A;  3FEO A;  4Z02 A;  4C0F A;  2DD4 A;  5KCH A;  5DY9 A;  4C5I A;  2VYT A;  4BE2 A;  4BUG A;  3O8V A;  2EWN A;  2EKO A;  3CCJ T;  4E7K A;  4PJO G;  4M7D B;  3AHU A;  1UGS B;  2HQE A;  3VV0 A;  2EYQ A;  4M75 D;  4C8Q C;  4MMK A;  1H64 1;  3L2Z A;  3CXC S;  1YBY A;  4J5Y A;  2V8J A;  3S3O A;  4D6W A;  1Q7Y U;  3OYD A;  4A54 A;  1K9M C;  2CZ1 B;  4M78 B;  4LDV A;  1K73 U;  2XIC A;  4XTX A;  4HA8 A;  2XI9 A;  3CBM A;  1KC8 U;  3JCM d;  1N6A A;  3DLL A;  2XDP A;  1D3B A;  2RHZ A;  1VQP A;  5IAY A;  2Y4Y A;  1Q82 U;  2DXB A;  4XAX B;  3JCM e;  5GAO m;  3GOX A;  3CCL A;  3HP9 A;  3OSS C;  4E47 A;  2X4X A;  1BI3 A;  4MZM A;  2D0Q B;  2E6Z A;  1VQP T;  2K5F A;  2X4Y A;  2DIQ A;  4XTU A;  2DTO A;  3H8Z A;  3CCL T;  1V29 B;  4J6W A;  3J81 E;  4M77 A;  4C92 D;  3A8H B;  1M4Z A;  2EQM A;  2IG0 A;  3LYI A;  3X25 B;  4PKC C;  2RJE A;  5LJ3 g;  4HT9 A;  2RI5 A;  5HY6 A;  1I81 A;  1NZ9 A;  3OYK A;  4FIB A;  3CCM A;  4BE0 A;  5FU6 C;  5IT9 E;  1VIF A;  2H3J A;  1PSF A;  3EFR A;  4IUU A;  5FRO A;  3OS1 A;  3CD6 A;  4A4K A;  3HKS A;  5LJ5 e;  3CCM T;  2E70 A;  3JCM P;  1M1G A;  5GAM f;  4TVR A;  3MP6 A;  3CD6 T;  4QQ6 A;  3CBO A;  3JCM c;  5M9O A;  3JCM W;  1WQ7 A;  2VC8 A;  1BIA A;  1R8O B;  4EMK A;  1VIE A;  2Y4X A;  4UC4 A;  3A8M B;  2RHU A;  5AYF A;  2V8I A;  1DJ7 B;  3G6E A;  4M7D A;  1IZ6 A;  1N27 A;  3G6E T;  3J7A F;  2ZZD A;  3A8G B;  2EJ9 A;  2Y90 A;  3PMI A;  1UGR B;  4M7A B;  1VQ9 A;  1Y96 B;  2ZGW A;  2M0O A;  2RI3 A;  4M78 A;  1K8A C;  2VXE A;  2OTJ A;  4FU6 A;  2F69 A;  4NL2 A;  3C95 A;  1VQ9 T;  4IUP A;  2DTI A;  4OB0 B;  2WSF E;  3ZFJ A;  3S3M A;  3HRU A;  4BAC A;  2RI2 A;  3SDZ A;  2OTJ T;  2O01 E;  3UDC A;  3CBP A;  2DIG A;  4C8Q D;  4ZGE B;  1X01 A;  4E7I A;  4J83 A;  3V8K A;  1FXX A;  2F5T X;  2LCL A;  3JAM E;  3OMG A;  1M90 U;  3QKJ A;  3CPW A;  3OSV A;  3LGL A;  2E1H A;  2FYK A;  5GAN 3;  2JN0 A;  2P0P A;  2E5Q A;  2LT4 A;  2O4X B;  2NLU A;  2RH2 A;  2YLB A;  3M4Y A;  1FWZ A;  5GAO p;  1X75 C;  2HD0 A;  4XU3 A;  1WJQ A;  2VV5 A;  4M75 B;  2XDD A;  1I5L A;  2PVG B;  5IN1 A;  5HK3 A;  4JRP A;  1JJ2 A;  2KAF A;  3QZ5 B;  5LJ3 h;  4OB2 B;  3S6W A;  3MET A;  1N9R A;  1YCY A;  2DK3 A;  2WSC E;  5GAO n;  2ZCF B;  3JCM b;  3FRN A;  1Y7X A;  2EFI A;  4M77 F;  3V8J A;  1H3Z A;  2E64 A;  4Q5W A;  3HFO A;  4A4E A;  4XK8 E;  2K57 A;  5CR2 A;  3GNF B;  1HK9 A;  2VGN A;  4QW2 A;  2E6N A;  5CQY A;  4FL6 A;  4JRQ A;  2ZPE B;  4QQD A;  1QP2 A;  2LRQ A;  2XKO C;  5FU7 C;  3JCM h;  4O6J A;  4JLG A;  3J80 E;  4PJO E;  1KG1 A;  1M5Q 1;  3ER0 A;  4LDY A;  3CCQ A;  4M7A A;  3PFS A;  1SSF A;  2QQR A;  1Y96 A;  2ZPH B;  3SD4 A;  4C92 B;  4ELZ C;  4BY6 C;  3JCM J;  4PJO C;  4B9W A;  3ME9 A;  4PL6 A;  4C5G A;  3BY7 A;  4OVA A;  5GMK j;  3CCQ T;  1XOV A;  2LC4 A;  5LJ3 j;  4DA4 A;  1WPY A;  3M5A A;  3JCM X;  2HNI A;  2QEX A;  2M1H A;  3QJY A;  1N9S A;  1OI1 A;  4N0A A;  2RB6 A;  3M57 A;  1PSE A;  3QDR B;  3X24 B;  4M7D F;  2E41 A;  1W2B S;  4HCC A;  4JDS A;  1M1K C;  2OAU A;  4RCC A;  2QEX T;  1YHQ T;  2D6F A;  2R58 A;  3JRZ A;  3OBW A;  4JUV A;  4RG2 A;  5GAO l;  1VQ4 A;  3GIB A;  3CCR A;  4PNO A;  5CK9 A;  5GAO r;  4M78 F;  4F7U B;  2CYZ B;  3M56 A;  4C0Z A;  4O5V A;  2BIV A;  1JBM A;  2O4X A;  1VQ4 T;  1Q86 U;  4C8Q E;  2DJZ A;  3SWN C;  4DOV A;  3CCR T;  2LQK A;  2XID A;  2KMT A;  1RI0 A;  3OQ5 A;  3X26 B;  5FRN A;  5J26 A;  1KQ1 A;  2P0Q A;  4M75 A;  2LCC A;  4A4F A;  4C0G A;  1QVG A;  4M77 G;  2L89 A;  3GF5 A;  5GAN g;  2XD0 A;  1G5V A;  1JB0 E;  2MI6 A;  2EQU A;  2VXF A;  5GAM d;  2PVO B;  2DPP B;  3CME A;  3VU3 C;  1Q7Y C;  5J39 A;  4L5G A;  5GAN 8;  3OS0 A;  2JUF A;  2E10 A;  2DKG A;  4J6Y A;  1OZ3 A;  4KT0 E;  2M16 A;  1K73 C;  5GAM e;  3CME T;  4ATO A;  3HHT B;  1KC8 C;  2MMP A;  2E65 A;  2L5Q A;  3M55 A;  4C8Q B;  3SFM A;  5A0L A;  4VUB A;  3L2V A;  2JTF A;  4HT8 A;  2GFA A;  1M8V A;  4BDY A;  1VQO A;  1KD1 U;  1Q82 C;  3PT9 A;  4ZGJ B;  2HAX A;  1NJI U;  4A4H A;  2ZPI B;  3L42 A;  3VYH B;  2FVU A;  4C92 A;  3X20 B;  1VQO T;  4ME7 A;  2RJF A;  1VQM A;  4XTZ A;  3JB9 F;  4M7D G;  5GAN 6;  5LJ5 d;  3C94 A;  3OB9 A;  3QHS A;  4OP0 A;  2DXT A;  3JB9 J;  1VQM T;  3V8L A;  2RHY A;  2QTX A;  4C5E A;  3QJ6 A;  1XQH A;  4BE1 A;  3OS5 A;  1N8R U;  4M78 G;  2EJG A;  4V2S A;  4PJO D;  1G3Y A;  3E9G A;  2RD1 A;  1FX7 A;  3GPL A;  4M7A F;  2CZ7 B;  4LDX A;  2EQJ A;  5LJ3 f;  3JCM g;  3PNW C;  4OMF B;  1QP3 A;  3C4S A;  4F7U A;  3OYC A;  2XDB A;  5FU6 B;  2OTL A;  1TH7 A;  2RO0 A;  3OYM A;  1QVF A;  2I2L A;  5GAN 5;  2JOY A;  3QSU A;  3BW1 A;  2FL7 A;  1UB4 A;  2LVM A;  2GF7 A;  4J7F A;  2OTL T;  2MF2 A;  5A2Q E;  1NPP A;  3JB9 I;  1QVP A;  1WNL A;  4ZTF A;  2L3R A;  1BI0 A;  3LX7 A;  3PTA A;  1U1S A;  1U8R A;  1NE8 A;  3L2R A;  3L1A A;  3VKI A;  3MP8 A;  2PUO B;  4P5N A;  3Q1J A;  2B8A A;  4WF2 A;  3JCM f;  3FB9 A;  2DZC A;  2YHT A;  4IKF A;  5GAN h;  1BIB A;  5LJ5 g;  5CO7 A;  2P4T A;  3FC3 A;  3S3N A;  4GLK A;  4N4I A;  3BFM A;  4C8Q A;  4CRI A;  1KQS A;  5CKE A;  3CC2 A;  4B9X A;  3JB9 H;  1P92 A;  2X4W A;  5LL6 S;  5I2S A;  3TRE A;  1VQK A;  3OYG A;  3JB9 G;  2C06 A;  4MML A;  4M75 F;  5GMK i;  3EFS A;  4J7I A;  1I4K 1;  1LJO A;  4ZN1 A;  5GAN 7;  5FRM A;  5C0M A;  2HBP A;  2QQB A;  2QXF A;  5CVI A;  2EJF A;  4OF1 A;  3LWH A;  1VQK T;  4Y28 E;  1B34 B;  3RER A;  2WSE E;  3V7C A;  2JTM A;  5CKB A;  1M90 C;  3CC7 A;  3VUZ A;  5A0D A;  4BI8 B;  4JS4 A;  3CC4 T;  2RJC A;  1VQ7 A;  2RK1 A;  3QBY A;  2K3Y A;  4C0D C;  1YIJ A;  3CC7 T;  3DB3 A;  3NTI A;  5CKF A;  2XHC A;  3LH0 A;  1VQ7 T;  4M7A G;  3QII A;  1VQL A;  1WJR A;  3BDU A;  2DVE A;  2QI2 A;  1YIJ T;  3A8L B;  2L8D A;  1UGQ B;  3R6O A;  5HK0 A;  5GAN j;  1X6O A;  1O75 A;  2A3L A;  3PIP A;  1VQL T;  1GXI E;  4X34 A;  5CAI A;  2K4Y A;  4C92 F;  4R56 A;  2KK4 A;  1Q81 U;  1VQ6 A;  1YI2 A;  3LGF A;  2DXC A;  4N4H A;  1VUB A;  2PUK B;  3FDR A;  3NTK A;  2EIF A;  3ZBD A;  1VQ6 T;  1YI2 T;  1IRE B;  1Y71 A;  3RKY A;  2K3X A;  5L8R E;  3WVD B;  3A5Z B;  4NS5 A;  3MP1 A;  4RG8 A;  4XTV A;  1ZHI A;  3M58 A;  3P8D A;  2XG8 D;  3CCS A;  4M77 E;  4IUV A;  2RJD A;  1VQ8 A;  3VJP A;  1MHN A;  3JB9 D;  1OZ2 A;  2KDS A;  2RHX A;  4M77 C;  3OYB A;  3CCS T;  5KH6 A;  2LTO A;  4F7U F;  4HCZ A;  4M75 G;  5CCA A;  1VQ8 T;  1ZQ1 A;  1M9S A;  3WXM B;  3H6Z A;  1EIF A;  3M59 A;  1YIT A;  5FU7 B;  2AHJ B;  4NL3 A;  4HCB A;  4LDW A;  3OYL A;  3OYI A;  1O9S A;  3G7Z A;  1G3S A;  1YIT T;  1YJN A;  3MEV A;  4BY6 B;  4PJO B;  5LJ5 h;  4ZTJ A;  1LOJ A;  2DXU A;  4QVC A;  1RL2 A;  1YJN T;  1B34 A;  2XU8 A;  1VQN A;  4OB1 B;  4XQ3 A;  2XK0 A;  4BD3 A;  2K5L A;  3BDL A;  5FLX E;  5A0G A;  4CI0 C;  1YHQ A;  2RK2 A;  4J6X A;  2GFU A;  4JRK A;  4A53 A;  3OW2 A;  4EMK C;  3UPU A;  1VQN T;  1W2B A;  4PLL A;  4BI3 A;  2FHD A;  4C8Q F;  4OGC A;  4C92 G;  1M1K U;  4M7D C;  4KUI A;  4E7L A;  2DO3 A;  3UWN A;  3P8B B;  2X4J A;  2LX9 A;  3E1S A;  4IUT A;  4OGE A;  1QVG S;  4EDU A;  5I21 A;  3SWN B;  2MWP A;  4R55 A;  4M78 C;  3OMC A;  3URG A;  2BKD N;  5KE3 A;  3CXC A;  3RKX A;  1WJS A;  3N5B B;  2MAM A;  5LJ3 d;  5LJ5 j;  1U1T A;  3QUI A;  3JSC A;  5GMK e;  2YRV A;  2CGH A;  3CCV A;  4ZN3 A;  2EAY A;  5GAN f;  3M9Q A;  5LJ3 e;  5CIU A;  5EG2 A;  1BI1 A;  1K9M U;  3NFC A;  4N4G A;  3FLG A;  2QQ9 A;  5C6S A;  4F7U G;  2R5A A;  3VYG A;  4MZT A;  3CCV T;  2GCX A;  1KD1 C;  2CZ0 B;  1NJI C;  3RMS A;  2ZPG B;  4DOW A;  4XTW A;  2G3R A;  3M54 A;  3CC4 A;  3RMQ A;  2CKK A;  2WAC A;  2CZ6 B;  2PU9 B;  4RCB A;  1G3T A;  3QG1 A;  2K5I A;  4PLI A;  2PQW A;  3ASK A;  3LW5 E;  3MEA A;  3NTH A;  3OYY A;  5GMK m;  3F70 A;  4NOY A;  3FIF A;  5DM7 R;  3OYH A;  4PJO A;  1JRI A;  2PVD B;  5GAN 4;  4BDZ A;  4A4G A;  5GAM g;  1N8R C;  1KQ2 A;  4M77 D;  2DD5 A;  3PIO A;  2DAQ A;  2KY9 A;  4C8Q G;  2CS7 A;  3HFN A;  4JLI A;  2QDY B;  1OYX A;  4MDX A;  4IUR A;  3HPW A;  2HQX A;  1W4S A;  4KUL A;  2M9U A;  3INZ A;  4RKU E;  3VUB A;  4EMG A;  3QXE B;  3MEW A;  5GAO q;  3FJP A;  3CCE A;  1QVF S;  4L6V 5;  4XU1 A;  5D6W A;  4M7A E;  2KVQ G;  3WVE B;  5DLO A;  1WQW A;  3GLX A;  1I8F A;  3CCE T;  4C5H A;  4BB7 A;  3E9F A;  3GP8 A;  4M7A C;  3SWN A;  3KBG A;  5GAN 2;  2DZ9 A;  5CKD A;  3KXT A;  5D6Y A;  2KSS A;  1Y07 A;  4L59 A;  1LNX A;  3LLR A;  3OYA A;  2X35 A;  4MZP A;  2IVW A;  3RES A;  4M7D D;  3E19 A;  3DB4 A;  3X28 B;  3CC2 T;  4BI4 A;  3LWI A;  4ELY C;  2QQS A;  1K8A U;  4X9C A;  4N0A C;  3RKW A;  1AHJ B;  3OYE A;  1KHI A;  1KQS S;  4GY5 A;  4ZGD B;  3I56 A;  2ZPF B;  3MCA B;  3DLM A;  3RUX A;  1QW1 A;  3PGG A;  4J8O A;  4M78 D;  3KUF A;  5LJ5 f;  1BI2 A;  4LD9 K;  4FT4 A;  2LNV A;  2RA2 A;  3I56 T;  3MEU A;  5D6X A;  3CPW S;  2KQW A;  3OBY A;  5J3B A;  2VUB A;  4DQ2 A;  3HSB A;  3L2W A;  4YTL A;  4QQG A;  1BYM A;  3HRT A;  4M75 E;  3A8O B;  3G71 A;  1WGS A;  3OYF A;  2R5M A;  3P8H A;  3PMT A;  4M75 C;  5KE2 A;  4EMH A;  2F5K A;  3V7R A;  4KBM B;  3G71 T;  1M1F A;  4EMK B;  1JJ2 S;  2RHI A;  2ZPB B;  2LT1 A;  1KHC A;  5CKH A;  3T9N A;  3UT1 A;  2VGM A;  4C0D B;  2QQA A;  4LD6 A;  1ZBX A;  3OS2 A;  4E7H A;  1YJ9 A;  1Q81 C;  2D9T A;  4II1 A;  5GAM h;  2MWO A;  4OB3 B;  1MGQ A;  1YJ9 T;  2GQV A;  2RM4 A;  5GMK h;  3CEY A;  2A7Y A;  3M4G A;  3L2U A;  4KUD K;  2BUD A;  3MO8 A;  2EQK A;  4X9D A;  4PJO F;  4C92 E;  3I55 A;  2DTH A;  3CPF A;  4HKE A;  3EAE A;  3JCM Q;  4IUQ A;  4C92 C;  1YJW A;  2DEQ A;  1VQ5 A;  3I55 T;  3M53 A;  3OA6 A;  4JJN K;  1D3B B;  3TCJ A;  3OY9 A;  3L2Q A;  2QA4 A;  1YJW T;  5DLQ E;  3QYG B;  3QYH B;  3DKM A;  4RMO A;  1HXD A;  2JNG A;  1VQ5 T;  2P0K A;  3GNG A;  3MHX A;  4FT2 A;  2JZ2 A;  4QVZ A;  3HRS A;  2QA4 T;  2R57 A;  3QO3 A;  3V7S A;  5GAN d;  4MDW A;  2E12 A;  5HKC A;  4EPC A;  4M7A D;  3RIR A;  4M77 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...