3LWHA

Crystal structure of cren7-dsdna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwhA00
2JTMA 4R55A 3LWHA 3KXTA 4R56A 3LWIA
chains in the Genus database with same CATH superfamily
4PL6A 3MCAB 1G5VA 3V8LA 5CKBA 2J7IA 4D8KA 3JB9G 3CCRA 2F2XA 2KVQG 5KYYB 1JJ2S 4JRKA 5A0GA 1PM3A 2AKLA 3VS1A 4EMGA 4IUQA 1TUCA 1LCKA 4OMNA 2FZCB 1YI2Q 1S72A 1Q82C 4M78B 1UEBA 2DTIA 3HRTA 4RTUA 5EG2A 4JS5A 5LJ5h 4PJLA 4M75F 2DX1A 5CQXA 2LT1A 4J9DA 1BKBA 2YUPA 1W2BS 3PVQA 4M78C 5C0MA 5IHNA 2ED1A 2CREA 1QVFA 1PCXA 4X1VA 2QQAA 2A3LA 1UJ0A 2C0TA 4GBQA 2YSQA 1LNXA 3SB2A 2PQWA 3CCST 2RJDA 3QZ9B 4KULA 1TWBA 2GNCA 2OTJT 1MMGA 3OB9A 1X6OA 3M0PA 1FMVA 3CCJT 2FHDA 2SRCA 4M75D 1IZ6A 3OSSC 3VYHB 1QKWA 2DXTA 3CBOA 1QLYA 4B6MA 3O5ZA 2CUBA 3CMEQ 3CCVQ 4LXCA 3CPFA 4N0AC 1Q95G 3LX7A 1N27A 3HRSA 3QPHA 4PK4A 1M1KC 1WJSA 2L89A 1JB0E 2EJ9A 2E1HA 2RJEA 2HNIA 5CKHA 1H92A 2LQNA 2PTKA 2WSCE 2FRYA 2DF6A 5FRMA 2EBPA 4B9WA 1V76A 1KC8U 1G3WA 4HCCA 1AZGB 1ZBJA 3EG1A 2C06A 8AT1B 4J9IA 4LDVA 2P0QA 2VUBA 1MMNA 4M77B 2O31A 4R55A 1H3ZA 1HK9A 5I21A 2FEIA 1E7OA 1XTDA 2F2WA 2LCCA 2KY9A 1C1AA 2KT8A 2EIFA 2RF0A 1WYXA 1X6BA 2JS0A 1WHMA 4M77C 2CP6A 1BYMA 3CCLA 3I35A 1UGSB 2ZPFB 3M0SA 4M7AG 1SG5A 4HCBA 3CCEQ 1HSQA 1N8RR 3EG0A 2E6ZA 4ORZA 2QXFA 2ABLA 5GAN8 3CCLQ 3JCMP 2XMFA 1RI9A 4DBQA 4CRIA 1K8AU 3FIFA 4VUBA 3Q1JA 1OX8A 3UDCA 1D1CA 1FWZA 3V7SA 1Y0MA 4HVVA 4DEYA 2RN8A 3LLRA 5KYYA 3CC7A 4OGEA 2DILA 1VQKQ 4J9FA 2OTLT 3OYAA 1Q7YC 1U1TA 4M7DA 2RD1A 2LTOA 4F16A 4J6WA 2HQEA 3CC7Q 3QDFA 4LD9K 1YIJQ 2HL5C 1YNZA 3MHXA 1M30A 2EYWA 1QKXA 4JJBA 1VQOA 3CCMT 4OVAA 1YHQQ 2FVUA 5GAOq 5FW9A 5KH6A 2YUQA 3TCJA 1GL5A 4Y91A 1WHLA 1OEBA 2KK4A 3EHRA 3PIPA 1JQQA 1VQ6A 3WVEB 4GLKA 3HHTB 3I55A 1GXIE 2LP5A 1K4US 4RCCA 2AKKA 3KFVA 2XDDA 1VQPT 2JXBA 4DBFA 1VQ6Q 2CZ0B 4PFZA 2QTVA 1OQKA 1GFCA 2MI6A 5GAOm 1BI1A 2DRMA 1K8AC 4F7UF 3CC4T 2CZ7B 4N0AA 4E6RA 2VKNA 2BIVA 4OB0B 1M4ZA 2KE9A 3OYNA 3MP1A 3VYGA 3T9NA 1SRLA 2F5TX 4QQGA 3E1SA 4RG2A 2QDYB 1C6VX 2ZCFB 4E7SA 5IHKA 5KYXA 2X3XD 1P92A 3BDLA 2OAUA 4FT4A 2DM1A 2ROTA 3F70A 4IURA 5J3BA 3X26B 4JLGA 2DVEA 3PMTA 4AFSC 1GBQA 4C92E 1IRXA 1K9AA 4OMPA 3QIIA 3JCMe 1C0MA 2JTMA 4X34A 1Q81R 1G3YA 2EQMA 4UC4A 2DZ9A 3GNFB 3NTHA 2MMPA 1X43A 3EGXA 3M58A 1WJRA 1Q86U 2NUZA 1FXXA 1KQSP 1AT1B 1RL2A 4M77A 1SSHA 4RTXA 2DZCA 1SSFA 2RMOA 3RR6A 3JB9I 3C4SA 3RERA 1TH7A 1YITA 1OV3A 4J9CA 4OB3B 5HCKA 2DK3A 3E9FA 5GANj 3H9NA 1YP5A 4JPBW 1YITQ 1HJDA 4CC3A 5CKEA 1XJWB 1JO8A 1VQ8T 2B86A 5GMKe 2YLBA 4ZGDB 5GANh 2DKGA 4BY6B 2RHZA 1T3LA 1X27A 5LL6S 1MV3A 4JUVA 4C0DB 2K9GA 4ME7A 1RAEB 2KGTA 2FRWA 2JTFA 4D6WA 1HYOA 4PLIA 1YI2T 1VQNQ 4WCIA 5CAIA 1S1NA 2FPEA 2KROA 3M55A 3JCMg 3N5BB 3RMQA 4BY6C 4IIMA 1JJ2P 4C0DC 4DBHA 3GPLA 2MYSA 2L3QA 3O8VA 3CMAA 2QEXQ 1Y96B 2HKQB 4PKCC 5GAN7 1Y07A 3TREA 2E41A 1EFNA 2E12A 1VOMA 3THKA 5CO7A 5DLOA 5GANf 2HBWA 1MNEA 2FL7A 1YWOA 1ZUKA 1W2BP 2CT4A 2COYA 1UJYA 3S3NA 3EFRA 2G6FX 2JW4A 5LJ3e 3H0IA 2X4JA 1ZBXA 1SEMA 1UGPB 3DB4A 1TXQA 2KXCA 5FU6B 1VQMQ 2DYBA 4C0FA 3HL8A 2DBKA 1QWEA 2A08A 3BY7A 3LYIA 4M75A 3CD6T 5CVIA 2V8JA 2BUDA 3H41A 3CMET 3CC2A 4PJOB 3M4YA 4C8QD 4M7DF 5FU6C 4OMOA 1AHJB 4M78F 4FW2A 2C0IA 2O9VA 5GAOl 3CC2Q 5GAN6 3VS6A 5GJVB 2VVKA 5IXBA 2RQRA 4KBMB 1VQ4A 5FLXE 5D6WA 3MKDA 1TU0B 4O5VA 4F04B 1X75C 2DBMA 3VJPA 4PJOC 2W10A 1N5ZA 3G7ZA 4PFPA 1IGUA 3QO3A 3A1PA 1VQ4Q 5KCHA 4XK8E 3J80E 2DE0X 3G6EA 1OPLA 3SDZA 5GAN3 1M3AA 4AT1B 1TSFA 1TUDA 1ACMB 1PWTA 2EQKA 3MJXA 2J6OA 1M27C 3G6EQ 2ZZDA 2ZPGB 2J06A 1NEBA 4M4ZA 5I11A 2K7AA 4M78D 4C5IA 2G3RA 3TEEA 5LJ3g 1RAAB 1T3SA 2BZXA 4DQ2A 3PNWC 4Z8AA 2H3EB 1T0JA 3TQ7P 3P8DA 1M2VB 3SWNA 2GFAA 1Q86R 3CCET 2NUPB 3JCMd 4J9BA 1VUBA 1BK2A 1LPLA 1UE9A 2ECZA 3MP8A 1X01A 1I1JA 2GBQA 2P4RA 8ATCB 3QG1A 3CCMA 3NFCA 5D6XA 4BB7A 3OYYA 2DNUA 1QVGP 1VQ9T 1KIKA 2EQJA 4B9XA 5IN1A 2K3YA 3RUXA 2QQSA 2AK5A 4KUDK 1HXDA 1QP2A 1VQKT 1I8FA 5FRNA 4DA4A 1PRLC 2L2PA 3V8JA 1YIJT 2K5FA 2MOXA 4J83A 2HZYA 4NOYA 2D9TA 3QJ6A 4M77F 1YHQT 3G1JA 1VIEA 2HEQA 2W0ZA 3M0TA 1UUEA 3PFSA 3UA7A 1PC0A 3OYBA 1RAHB 2R5AA 2XK0A 4YTLA 1IO6A 2LRQA 4J7IA 1TOVA 1WPYA 1WXTA 2MK5A 3X28B 1YJNT 2CT3A 5GAMg 1N9RA 5IHIA 3MEAA 2M16A 5FWBA 1MUZA 2FB7A 1Y57A 1KQSS 4EMKB 2BE9B 4WF2A 2OI3A 2J6KA 4NL3A 4C92G 2VGMA 4JDSA 1XQHA 1Q82U 3UATA 1JU5C 1RACB 4JRQA 1AOJA 2EPDA 3M56A 2KRNA 1SHFA 3VUBA 4PNOA 1E6GA 2MF2A 4EMKC 5LJ5e 1UG1A 2E3IA 3QUIA 2MAMA 4PJOA 4C8QB 1NLPC 2PVOB 1YJWA 1KHCA 2JM8A 4PFOA 3JCMW 2YLCA 4FM4B 2PUKB 2QTXA 2OAWA 2DRKA 5GAOp 1UHFA 3OYLA 2BZ8A 4C5HA 3ZFJA 2RQVA 4AMCA 2RK1A 2QQBA 2VGNA 1U8RA 5L23A 2E4HA 1PNJA 2RHYA 4C8QC 1YJ9A 2CSQA 5FWCA 4JRPA 4F7UA 4RG8A 4FYXB 1WZOA 1BIAA 1GCQC 1YJ9Q 2DEQA 4KUIA 2DMOA 4XAXB 3HFNA 1Z9ZA 3EGUA 3M0RA 1JXMA 2YRVA 2WSEE 1OYXA 1EIFA 5KE2A 1OZ2A 3CCRQ 4QVZA 1JJ2A 1M5Q1 3EH2A 2O4XA 4IUPA 2JVVA 2DTOA 2CP7A 1VIFA 1S72Q 2KR3A 1M1KU 2M0OA 4KH0B 4JZ4A 2LQ8A 3OYDA 1M2VA 1WHGA 3CQTA 2DL3A 3H0HA 3G4SA 3A5ZB 2EYYA 5LJ5g 1OU9A 3VKIA 1WQ7A 2ZPBB 3EG9B 3G4SQ 4N4HA 1K73U 1K0XA 4ZGEB 1NJIR 1GFDA 1KSWA 1QVFS 2HQXA 2A7YA 4IIOA 1SHGA 1NEGA 3OMCA 1OX9A 2OJ2A 4FIBA 2RI5A 4A53A 1NM7A 2DVJA 5GAMd 4DEXA 1OU8A 1VQNT 2YHTA 4ZN3A 1WFWA 2D8JA 2EJGA 5IXFA 2E64A 3OS1A 5DY9A 3OW2P 4IUVA 4NL2A 1ARKA 1MMDA 4P5NA 2XD0A 1ZX6A 1VQLA 1OZ3A 1X69A 4J9EA 4M7DE 2QEXT 4ZTFA 3RDVA 3LH5A 3CD6A 3OA6A 1ZLMA 1BCMA 2BKDN 2YXYA 5I22A 1D0XA 4FL6A 4HT8A 2FG0A 2JMCA 3V7RA 2QI2A 2RO0A 2BZYA 3OYFA 3TU4K 2X35A 2HKNA 4QKUA 5M9OA 3EGDA 1K73C 1MV0B 2VWFA 3JB9D 5A0LA 5KYWB 5J26A 1Q7YU 1VQ5A 1TS9A 2EGEA 3ASKA 4MMKA 3G71T 1QWFA 3JCMb 3CCUA 4E7ZA 2FO0A 4J5YA 2EAYA 5FROA 3FEOA 3NHNA 3CCQT 3FLGA 4OMFB 1JXOA 2CKKA 4C8QA 4EMHA 4Y28E 4CC4B 4FW1A 4LD6A 1A0NB 1Q82R 5GMKm 1GCQA 2VYTA 3CBMA 3UPUA 2P0PA 1QVGS 1G2BA 2AHJB 1OPKA 5CCAA 2Y4YA 2RQUA 1RLQC 4KH1B 1AWXA 2V26A 4BDZA 4HA8A 1RI0A 1IXDA 5GAOr 3VS7A 4BI4A 3JV3A 2R58A 2QA4T 5LJ5d 1VQ7A 2EFIA 2KI7A 1WHKA 4OF1A 2V8KA 1Q81C 2GTOA 3LW5E 1G83A 2HCKA 4ESRA 1VQ9A 3X24B 5AT1B 1K9MR 3SEMA 1VQ7Q 4M78A 4EPCA 2HSEB 1KFZA 1I5LA 2RI2A 1KD1U 2RJCA 1WJQA 1ZSZB 2LCSA 4M77E 5CKFA 3U23A 4ANJA 2IG0A 2ZAEA 4E7HA 2I0NA 9ATCB 4PJOF 3BE3A 1FX7A 3EAEA 2X4WA 1VQOQ 3M4GA 3VRYA 2E10A 3QKJA 2NLUA 2XU8A 2O01E 1R0BG 2K3BA 2LNHB 1D3BB 2H8HA 2B8AA 2KYMA 1M90U 1ZSZC 2DFUA 3I55Q 2K6DA 4JLIA 4J7FA 5A2QE 4Q5WA 2DLPA 1YJNA 3S3MA 4C92B 3I56T 1B3QA 5C6SA 1B07A 4LNPA 4II1A 1W6XA 3OYKA 3JCMV 3CXCS 1ZA2B 4E7IA 5FU7B 2D8HA 3JSCA 3GIBA 3HSBA 2RM4A 3RESA 2JJ9A 2CP0A 1M3CA 3LWHA 4PJOD 4XTUA 1M8MA 4C92C 3MO8A 1NLOC 3PTAA 2ZGWA 1CSKA 4KGXB 2JT4A 1AEYA 3ME9A 1KD1C 2E3HA 5GAOn 2DIGA 1GRIA 3GNGA 1WHJA 4HCKA 5I2SA 3BW1A 3CEYA 3QZ5B 5FU7C 3OS5A 3GP8A 2DXBA 1Z9QA 1PKTA 1CKBA 1N6AA 1Y7XA 2PVDB 2SEMA 3VS0A 4L5GA 1M90C 5KYWA 4O6JA 3OYEA 1JEGA 1FMWA 3CCQA 4FCYA 1SF9A 1QP3A 4RTWA 2K3XA 1PG5B 2K57A 1PD1A 1KC8R 1X6GA 4M75E 3OY9A 1WIEA 4Y92A 4CC2A 1BCOA 1ZUYA 4X9DA 3KUFA 2DL4A 1LOJA 2COWA 2JS2A 2GFUA 2VXFA 4K11A 1YN8A 4XTYA 3OW2S 2KNBB 4LUEA 2KYBA 1JRIA 5GMKl 2RHIA 4QVDA 2E70A 3CCRT 2YWWA 2MPXC 2X4YA 2EVRA 3CCSA 3I9QA 3V7CA 3GBQA 1K8AR 2O88A 1YFNA 1IREB 1K0SA 2OTJA 1AZEA 2FPDA 4DOWA 3CCJA 4JRIA 1D0ZA 4XTXA 1J3TA 3OBYA 2EKOA 2F2VA 3ZBDA 3M57A 3QYGB 4C8QF 4F17A 4M7DG 4J6XA 3A8HB 3HTRA 3EFOB 3CMAQ 1GBRA 2HD0A 2ZPHB 2JMAA 2JNGA 4LDXA 1ZA1B 4XU0A 2A36A 2MWPA 3X25B 2QASA 1G3SA 2LQWA 2GQVA 2LX7A 2DO3A 3FDRA 4A4HA 1FYNA 1YCYA 2V1QA 5GMKj 2ROLA 3PMIA 1B34B 4HVUA 4FYWB 1QVFP 1R0CB 3LWIA 2E65A 4QQDA 5I2MA 1MHNA 3CCVT 1M2OA 1BU1A 3BFMA 1BBZA 1UDLA 2DL5A 3NGPA 2R5MA 4AG2C 2YT6A 4JJNK 2DJQA 3S3OA 4PLLA 4M7AB 4F14A 3RKWA 4IUTA 1PD0A 4OMQA 4E7JA 1IB8A 4R0KA 2GGRA 4OMLA 1NPPA 5GJWB 4A4GA 4EIKA 3RKXA 2KEAA 4OGCA 4M7AC 3QBYA 3JCMJ 1M8VA 2QGGA 3QWYA 1PKSA 1E6HA 1NYGA 3HRUA 5LJ3j 3H0FA 3SD4A 1K76A 1GCPA 3VU3C 3JB9J 5GAMe 4RTZA 4XU3A 2OTLA 1NBEB 1UB4A 2IVWA 2P0KA 4Z88A 5LJ3h 2J05A 3URGA 1H8KA 3C0CA 4M77G 2C0OA 2RNAA 3QWXX 2CS7A 2K79A 3L2VA 3CCLT 4RCBA 5L8RE 3R6OA 1OI1A 3GOXA 2LJ3A 2J6FA 3L42A 2RB6A 3L2WA 3CCMQ 5KYUB 5GMKi 3P8BB 3WVDB 1QCFA 2EYXA 4F7UE 3E2UA 1KHIA 1U1SA 1AWJA 5GAN5 2E5QA 1VQPA 2AZSA 2CGHA 2DXUA 3A8MB 3CC7T 4MMLA 3OYMA 2WACA 3CC4A 2DERA 5LJ3f 4XTZA 3JRZA 2WSFE 2PUOB 3OSVA 2Y90A 4LDWA 1Y96A 2GF7A 2RHUA 1ABQA 3R6NA 4N4IA 2CH4W 1ZSGA 1WNLA 3ULRB 1VQ6T 3I55T 2GQIA 2D0QB 3UF4A 1PHTA 1WXUA 2MWOA 2QQRA 1NJIC 3OYCA 2JTEA 5KE3A 1DJ7B 3PGGA 3PIOA 1U06A 4RUGA 1G8XA 2K4YA 1KQSA 2AZVA 3KBGA 1B34A 2YRCA 3L1AA 5KCOA 4ATOA 4A4FA 2VXEA 2EYQA 3QSUA 2D6FA 1D09B 2NWMA 3CXCP 2RI3A 4R56A 3MEWA 1R77A 3CPWS 3V8KA 3IQLA 1YJWQ 2KXDA 4OB1B 5J39A 2A37A 3GLXA 4M7AA 3A8GB 4M75G 3FRNA 3PE0A 2H3JA 3HP9A 2ED0A 1I81A 2K2MA 1UTIA 1UGVA 4C5EA 4XU2A 3FJPA 3HPWA 5HK3A 2JUFA 3A8LB 1VQ8A 2LNVA 3DLMA 3FB9A 2QYZA 2O2OA 4MZMA 4WTOB 4N4GA 2VV5A 2AT1B 4C92F 3JB9H 1KQ1A 4A63B 2XDBA 1ZHIA 4BI8B 4XU1A 3PT9A 2ATCB 2XDPA 4PJJA 1WXBA 1V1CA 3MEUA 1YI2A 5LJ5j 4IKFA 3E19A 2CUDA 1YITT 4CI0C 2JN0A 4M7DB 2FZKB 2NUPA 3EHQA 4C8QE 4C0ZA 4CC7A 2LJ0A 2K2VA 1U3OA 4OP0A 3NMZC 2EGAA 1W2BA 4ELZC 5EC7A 2KAFA 2HMAA 4KGZB 1N8RC 2LDMA 3TSWA 2KRSA 2JOYA 3TSZA 3MPUB 2XHCA 5KYUA 1IHVA 4XQ3A 4M7DC 4C92D 4FYYB 4GLMA 3M0QA 4BUGA 3A98A 1TG0A 1WHHA 5CIUA 2Y4XA 3JB9F 3C94A 4XTWA 3H6ZA 1K9MC 3NTIA 2KRMA 3FJ5A 3OYGA 2EWNA 3PVLA 4JJDA 4MDWA 4M78E 2YUOA 1VQLQ 2XICA 3CMEA 3CMAT 2NUTB 3INZA 2RQWA 2DD4A 3I5SA 5LJ5f 3CCVA 5CKDA 2CZ1B 3CD6Q 1I0CA 2CYZB 2QDLA 2DEUA 2COZA 1H3HA 4EMKA 5KYXB 3VS5A 1Q81U 2LMJA 4ZTJA 1VQMT 2RHXA 4HKEA 1LVKA 1D1BA 2RJFA 1VQ5Q 3H8ZA 2XG8D 4BI3A 1I4K1 3I5RA 2LX9A 4FSXA 3CCUQ 1UGQB 5CQYA 1Y71A 4A54A 3CC2T 2F1LA 4E47A 4RTTA 1IHWA 2V1RA 7AT1B 2M0YA 4X9CA 3EGXB 4OB2B 4J9HA 1W4SA 4ZN1A 2EJFA 5IT9E 1NZ9A 3OBWA 2EQUA 2HL3A 2HBPA 2DPPB 2E6NA 2D0NA 4PJOG 1ZQ1A 1VQ4T 1QVGA 2FZGB 4BE0A 3RKYA 3CCEA 1F1BB 3FC3A 2IPOB 2LVMA 2V8IA 3G6ET 4BACA 1RUWA 4FU6A 2L3PA 3EFSA 2DXCA 5ECAA 2ENMA 4QT7A 1EZZB 1D0YA 4TVRA 4F7UG 1OOTA 1QQJA 1XNIA 2HAXA 1AWOA 2O9SA 3UA6A 1VQKA 1W1FA 2EQIA 1VQ9Q 3X20B 2HQHA 3JCMX 3TVTA 2F5KA 4E7LA 1EX4A 4KT0E 1V29B 1KC8C 3GF5A 1YIJA 3VRZA 1YHQA 1LJOA 3AHUA 1T0HA 3EG9A 1PRMC 1NE8A 3M0UA 4FT2A 2D1XA 1BI3A 4A4KA 4M7AF 2X3WD 5AYFA 1VYUA 1M1KR 1WX6A 4DBRA 2AIRB 2ESWA 1SRMA 5GAN4 4J9GA 2YRDA 3RBBB 1ABOA 1YJNQ 2EW3A 2P84A 2L3SA 1K73R 3J7AF 1HD3A 3WXMB 2X9HA 4BE2A 3MEVA 3QDRB 1TTHB 3CXCA 4L6V5 2L0AA 5HK0A 4GY5A 1I07A 2NUTA 4M7AD 4M75B 4MZTA 5D6YA 2QG9B 5GANe 1RAGB 2CDTA 2DIQA 4HVWA 1M1FA 3M59A 2XKOC 1YCSB 4M75C 3OYHA 2XIDA 3C95A 3RMSA 5HY6A 4BDYA 2RA2A 1W70A 1UGRB 3LH0A 3CCQQ 1K1ZA 1RABB 4A4EA 3M54A 4RKUE 4KRTA 1Q7YR 3BDUA 1N9SA 3QXEB 1YJWT 5IAYA 2LJ1A 4RTVA 5KYNA 1NPRA 2R57A 2EGCA 4C8QG 4FYVB 3CPWP 4LDYA 3SFMA 2X4XA 3M5AA 1YJ9T 3RNJA 1WQWA 2QAZA 2CP5A 3SWNB 3ZL7C 3JAME 3EG2A 1R8OB 4E2FB 2MCNA 3DLLA 5GANg 3OW2A 1X2QA 3J81E 1BIBA 3VS2A 2LC4A 6AT1B 4QQ6A 2KQWA 2PVGB 2KMTA 2LT4A 4AG1C 2BTTA 3REAB 3SWNC 1S72T 3AT1B 1KQ2A 4JS4A 4J6YA 4L59A 1ZSZA 5DLQE 3CCSQ 1VQNA 3JCMh 4PJNA 2CP2A 4NS5A 2OTJQ 2CSIA 4HXJA 1H641 1AVZC 2M02A 3CCJQ 4HCZA 3KXTA 4M78G 1XOVA 3G4ST 1Q86C 3DB3A 2QEXA 1WGSA 1D3BA 4LDUA 2GTJA 1KD1R 4HT9A 2MIOA 1IGQA 4RMOA 1SPKA 2A28A 2PZ1A 1MMAA 2HDAA 4KGVB 2CH4A 4DOVA 1QCNA 4C92A 1O75A 2EYZA 3L2RA 2QK0A 3VS3A 5GAN2 4RTYA 3L2QA 4XTVA 1BI2A 3M9QA 3ZEHA 4QVCA 1QW1A 1UHCA 1M90R 2FYKA 3JCMf 2KDSA 3EG3A 1VQMA 2DTHA 1RAFB 3G71A 3QJYA 4LUDA 5GMKh 1VQLT 3META 1QMCA 2VASA 4LN2A 3QYHB 1NYFA 1X2KA 2M51A 3G71Q 1CKAA 1ZUUA 2M1HA 4BD3A 1OULA 5CK9A 1PSEA 2BE7D 3REBB 4AFUC 3JCMQ 2GCXA 1RADB 2CP3A 3EH1A 1BI0A 3VS4A 4Z89A 3SHWA 4OMMA 2PU9B 1QCOA 3NPFA 1VQ5T 2CZ6B 3D7SB 4C0GA 4F7UB 2RQTA 1G3TA 2Z0WA 2QA4A 1WDXA 3CCUT 4LE9A 1U5SA 1AWWA 4ZNXA 1NG2A 2YUNA 3OYIA 5IH2A 4FSSA 2VC8A 2QA4Q 1M9SA 5GANd 3NTKA 2X51A 3P8HA 1WA7A 4AFZC 4M7DD 4PJOE 4BE1A 2OTLQ 2QQ9A 2L8DA 2ZPIB 2O4XB 3M53A 2HSPA 1TUGB 2KT1A 2L3RA 3OS0A 4J8OA 1NJIU 1UFFA 3RIRA 2DYIA 4M7AE 2OX7A 2RK2A 2LQKA 3OS2A 3VV0A 3HFOA 3MP6A 2RH2A 2M9UA 1FMKA 1VQ7T 4JZ3A 1B7TA 4MDXA 2I2LA 2L5QA 5DM7R 4Z02A 3I56A 1VQPQ 1KK7A 3L2ZA 2F69A 2K5IA 1SKUB 1YBYA 2KBTA 3OQ5A 1RLPC 3I56Q 3CC4Q 1KJWA 5HKCA 1VQOT 5GAMj 3VUZA 3S6WA 2KSSA 3EFOA 4V2SA 2EKHA 3UT1A 1AD5A 2RPNA 3L2UA 1VA7A 3OMGA 4ELYC 2DL8A 1O9SA 2DA9A 2XI9A 2DL7A 1YWPA 5GAMh 3ER0A 1RAIB 3E9GA 2E5KA 3UWNA 1I5OB 1JBMA 1M1GA 1D1AA 4JJCA 2LZ6B 3EGDB 5CR2A 4MZPA 2DJZA 1WI7A 3QHSA 2ZPEB 2LCLA 4ZGJB 2NYSA 3LGLA 3C12A 4D8DA 2A0FB 2JZ2A 4M77D 2K5LA 4AFQC 2QGFB 1N8RU 3DKMA 1VYVA 2DETA 5GAMf 3JCMc 1VYTA 1UECA 3CPWA 3LGFA 1KG1A 3HKSA 5A0DA 3OYJA 2FPFA 1QVPA 2PNIA 3CBPA 1MGQA 1WLPB 2YDLA 2IIMA 3A8OB 4PJMA 4C5GA 1MNDA 2DAQA 2JM9A 2DD5A 2VB6A 4IUUA 1BB9A 2P4TA 4E7KA 5D7UA 5LJ3d 4EDUA 4QW2A 1K9MU 1M3BA 1VQ8Q 1PSFA
chains in the Genus database with same CATH topology
4PL6A 3MCAB 2LVMA 4M78D 4C5IA 1G5VA 2G3RA 3TEEA 3V8LA 4X9DA 3KUFA 2V8IA 5CKBA 3G6ET 4BACA 5LJ3g 3JB9G 1LOJA 3CCRA 2KVQG 4FU6A 4DQ2A 3EFSA 3PNWC 1JJ2S 2DXCA 4JRKA 5A0GA 4TVRA 4F7UG 4EMGA 3P8DA 2GFUA 2VXFA 4IUQA 3SWNA 1XNIA 2GFAA 4XTYA 1S72A 1Q82C 2HAXA 3OW2S 3CCET 4M78B 3JCMd 1VUBA 1VQKA 3MP8A 3X20B 1UEBA 3JCMX 1X01A 1JRIA 2F5KA 2DTIA 3HRTA 3QG1A 2RHIA 5EG2A 3NFCA 4KT0E 5GMKl 1V29B 5D6XA 4QVDA 5LJ5h 4JS5A 1KC8C 3GF5A 4M75F 2E70A 3CCRT 4BB7A 3OYYA 1YIJA 2X4YA 5CQXA 1VQ9T 3CCSA 2LT1A 3V7CA 1BKBA 1W2BS 2EQJA 4B9XA 5IN1A 1IREB 2K3YA 1YHQA 4M78C 3RUXA 5C0MA 1LJOA 2QQSA 1QVFA 3AHUA 2OTJA 4KUDK 4DOWA 1NE8A 2QQAA 1HXDA 1QP2A 2A3LA 4FT2A 3CCJA 1VQKT 4JRIA 4XTXA 1BI3A 1I8FA 4A4KA 5FRNA 3OBYA 4M7AF 5AYFA 4DA4A 2EKOA 1LNXA 3SB2A 3ZBDA 3M57A 3QYGB 3V8JA 4C8QF 4M7DG 1YIJT 2K5FA 4J6XA 3A8HB 2PQWA 5GAN4 4M7DA 3CCST 2RJDA 3QZ9B 4KULA 2HD0A 2ZPHB 4J83A 2JNGA 4LDXA 4NOYA 2D9TA 3QJ6A 4M77F 1YHQT 2OTJT 3OB9A 1VIEA 1X6OA 3PFSA 4XU0A 3CCJT 3OYBA 2FHDA 2MWPA 3J7AF 2R5AA 2XK0A 3X25B 4YTLA 4M75D 1IZ6A 2LRQA 3OSSC 1G3SA 4J7IA 2DXTA 3VYHB 2GQVA 3CBOA 2DO3A 3FDRA 3WXMB 4A4HA 4BE2A 1WPYA 3MEVA 3QDRB 3X28B 3CXCA 4L6V5 1YJNT 1YCYA 5GMKj 5GAMg 3PMIA 1N9RA 1B34B 3MEAA 2M16A 5HK0A 2FB7A 4GY5A 3CPFA 4N0AC 3LX7A 3LWIA 1N27A 2E65A 4EMKB 1KQSS 4M7AD 3HRSA 4M75B 3QPHA 4QQDA 5I2MA 4MZTA 1MHNA 4WF2A 1WJSA 1M1KC 4NL3A 2L89A 5D6YA 1JB0E 2VGMA 4C92G 2EJ9A 2E1HA 2RJEA 2HNIA 3BFMA 5CKHA 3CCVT 4JDSA 5GANe 1XQHA 1Q82U 4JRQA 3M56A 2WSCE 2R5MA 4PNOA 3VUBA 2DIQA 1M1FA 3M59A 2XKOC 4JJNK 5FRMA 2MF2A 4B9WA 3S3OA 4PLLA 4M7AB 1KC8U 1G3WA 4EMKC 5LJ5e 4HCCA 4M75C 3RKWA 3QUIA 2MAMA 4IUTA 3OYHA 4PJOA 4E7JA 4C8QB 2PVOB 2XIDA 3C95A 3RMSA 1YJWA 1KHCA 2C06A 3JCMW 2YLCA 4LDVA 1NPPA 2PUKB 4FM4B 5HY6A 2P0QA 2QTXA 2VUBA 4BDYA 2RA2A 4M77B 1UGRB 5GAOp 3OYLA 3LH0A 4A4GA 4C5HA 3ZFJA 3RKXA 4R55A 4OGCA 4M7AC 3QBYA 3JCMJ 1M8VA 1H3ZA 1HK9A 2QQBA 2RK1A 2VGNA 5I21A 1U8RA 1XTDA 4A4EA 3M54A 2LCCA 4RKUE 2RHYA 4C8QC 1YJ9A 2KY9A 3BDUA 4JRPA 4F7UA 1N9SA 3HRUA 2EIFA 4RG8A 3QXEB 5LJ3j 1YJWT 3SD4A 5IAYA 3VU3C 4M77C 1BYMA 1BIAA 3JB9J 3CCLA 1NPRA 2DEQA 2R57A 1UGSB 2ZPFB 4M7AG 4KUIA 4HCBA 5GAMe 4XAXB 3HFNA 4XU3A 2E6ZA 2OTLA 4C8QG 2QXFA 5GAN8 2YRVA 3JCMP 1UB4A 2IVWA 4LDYA 2X4XA 3SFMA 2P0KA 2WSEE 1OYXA 3M5AA 1EIFA 5LJ3h 4CRIA 5KE2A 1YJ9T 1K8AU 1OZ2A 3URGA 3FIFA 1WQWA 3Q1JA 4QVZA 4VUBA 4M77G 3SWNB 3UDCA 1JJ2A 1M5Q1 2CS7A 2O4XA 4IUPA 3V7SA 1FWZA 3JAME 2JVVA 3L2VA 3CCLT 4RCBA 1R8OB 5L8RE 2DTOA 3DLLA 3R6OA 1VIFA 5GANg 3LLRA 3OW2A 1OI1A 3GOXA 3CC7A 1M1KU 4OGEA 2M0OA 3J81E 1BIBA 2OTLT 3OYAA 2LC4A 2LQ8A 1U1TA 2RB6A 3L42A 2RD1A 4QQ6A 2KQWA 2PVGB 2KMTA 3OYDA 3L2WA 3G4SA 2LTOA 4J6WA 3A5ZB 2HQEA 2LT4A 5GMKi 3P8BB 5LJ5g 3SWNC 3WVDB 1S72T 1KQ2A 4LD9K 4JS4A 4J6YA 4F7UE 3VKIA 1WQ7A 4L59A 2ZPBB 1KHIA 5DLQE 1U1SA 3MHXA 5GAN5 3JCMh 2E5QA 1VQPA 1VQNA 2CGHA 4N4HA 1K73U 1VQOA 3CCMT 4OVAA 2DXUA 4NS5A 2FVUA 4ZGEB 3A8MB 5GAOq 1H641 3CC7T 4MMLA 3OYMA 1QVFS 5KH6A 2HQXA 3TCJA 4Y91A 4HCZA 3KXTA 2WACA 2KK4A 3CC4A 2A7YA 4M78G 1XOVA 5LJ3f 3PIPA 3G4ST 1Q86C 4XTZA 3DB3A 2QEXA 1VQ6A 3WVEB 1WGSA 4GLKA 1D3BA 3JRZA 3OMCA 3HHTB 4LDUA 4FIBA 2WSFE 2RI5A 2PUOB 3OSVA 4A53A 3I55A 4HT9A 4RCCA 2Y90A 5GAMd 4RMOA 4LDWA 1Y96A 2XDDA 1VQNT 2YHTA 4ZN3A 1VQPT 2GF7A 3OS1A 2EJGA 2E64A 2RHUA 5DY9A 2CZ0B 4IUVA 4DOVA 4NL2A 4C92A 1O75A 2MI6A 4P5NA 5GAOm 4N4IA 3L2RA 1BI1A 1VQLA 2XD0A 1K8AC 5GAN2 4F7UF 1OZ3A 3CC4T 3L2QA 1WNLA 4XTVA 1BI2A 3M9QA 4M7DE 2CZ7B 3ZEHA 4QVCA 2QEXT 1VQ6T 1QW1A 4ZTFA 3I55T 4N0AA 3CD6A 3OA6A 2FYKA 3JCMf 2BIVA 1M4ZA 2BKDN 2KDSA 4OB0B 2D0QB 3OYNA 2MWOA 1VQMA 3MP1A 2DTHA 2QQRA 3VYGA 3OYCA 1NJIC 3T9NA 5KE3A 1DJ7B 3PGGA 3PIOA 3G71A 3QJYA 4FL6A 4HT8A 2F5TX 4QQGA 5GMKh 2K4YA 1KQSA 3V7RA 1VQLT 3E1SA 3KBGA 1B34A 3META 4RG2A 2QDYB 2QI2A 2RO0A 3L1AA 2ZCFB 5KCOA 4ATOA 3QYHB 3OYFA 4A4FA 2VXEA 2EYQA 3TU4K 2X35A 2M1HA 5M9OA 1K73C 4BD3A 1P92A 3BDLA 3JB9D 2OAUA 5A0LA 4FT4A 3QSUA 5J26A 1Q7YU 3F70A 4IURA 5CK9A 3ASKA 4MMKA 1VQ5A 1PSEA 5J3BA 3X26B 4JLGA 2D6FA 2DVEA 3G71T 2RI3A 3PMTA 3MEWA 3JCMb 4R56A 3CCUA 3JCMQ 2GCXA 4C92E 4J5YA 2EAYA 5FROA 3CPWS 3V8KA 3QIIA 5J39A 4OB1B 3JCMe 3GLXA 4M7AA 3A8GB 3FEOA 4M75G 3FRNA 3CCQT 2JTMA 3FLGA 1BI0A 4OMFB 4X34A 1G3YA 2CKKA 2EQMA 2H3JA 3HP9A 4UC4A 2DZ9A 4Y28E 2PU9B 3GNFB 3NTHA 4C8QA 4EMHA 1I81A 2MMPA 1VQ5T 2CZ6B 4LD6A 3M58A 4C0GA 1WJRA 1Q86U 4F7UB 4C5EA 1G3TA 1FXXA 1RL2A 4M77A 5GMKm 4XU2A 2VYTA 2QA4A 3CBMA 3CCUT 3FJPA 2P0PA 3UPUA 1QVGS 2DZCA 3HPWA 2AHJB 5CCAA 1SSFA 2JUFA 2Y4YA 5HK3A 3OYIA 3JB9I 3A8LB 1VQ8A 3C4SA 3RERA 2LNVA 2VC8A 1TH7A 3DLMA 1YITA 1M9SA 5GANd 4HA8A 1RI0A 4BDZA 3NTKA 3FB9A 3P8HA 4OB3B 4MZMA 5GAOr 4BI4A 2DK3A 2VV5A 3E9FA 4N4GA 4C92F 1KQ1A 3JB9H 4BE1A 4M7DD 4PJOE 2QQ9A 5GANj 1ZHIA 2XDBA 2L8DA 2R58A 4BI8B 2ZPIB 2QA4T 4XU1A 5LJ5d 2O4XB 3M53A 5CKEA 3PT9A 1VQ7A 2XDPA 2EFIA 2L3RA 3OS0A 3MEUA 4J8OA 1YI2A 1NJIU 1VQ8T 4OF1A 2V8KA 5LJ5j 3LW5E 1Q81C 3RIRA 4M7AE 1VQ9A 4IKFA 3E19A 2RK2A 3X24B 2LQKA 1YITT 4CI0C 3OS2A 5GMKe 2JN0A 2YLBA 3VV0A 4M7DB 4M78A 3HFOA 4C8QE 4C0ZA 4EPCA 4ZGDB 5GANh 3MP6A 2DKGA 4BY6B 2RHZA 3CCMA 1I5LA 5LL6S 2K2VA 2RI2A 1KD1U 4JUVA 4OP0A 4C0DB 2RJCA 4ME7A 2RH2A 2M9UA 1WJQA 4ELZC 1W2BA 2KAFA 4M77E 5CKFA 2JTFA 4D6WA 1N8RC 1VQ7T 2LDMA 1Q7YC 4MDXA 2IG0A 2I2LA 2JOYA 4PLIA 4E7HA 1YI2T 2L5QA 5DM7R 4Z02A 4PJOF 5CAIA 3EAEA 1FX7A 2XHCA 3I56A 4XQ3A 3M55A 2X4WA 3JCMg 3L2ZA 3M4GA 4C92D 4M7DC 2F69A 2E10A 3N5BB 3QKJA 3RMQA 2NLUA 2XU8A 4BY6C 2O01E 2K5IA 1YBYA 4C0DC 1D3BB 4BUGA 3GPLA 2B8AA 3OQ5A 1M90U 5CIUA 3O8VA 3CMAA 2Y4XA 5HKCA 3JB9F 3C94A 1VQOT 1Y96B 5GAMj 4PKCC 4XTWA 4JLIA 3VUZA 3S6WA 3H6ZA 4J7FA 2KSSA 5A2QE 5GAN7 4V2SA 1Y07A 4Q5WA 3TREA 1YJNA 3S3MA 2E41A 1K9MC 3UT1A 4C92B 2E12A 3I56T 5DLOA 5CO7A 3RKYA 3NTIA 5C6SA 5GANf 3L2UA 3OMGA 3OYGA 4ELYC 2EWNA 4MDWA 2FL7A 1O9SA 4M78E 4II1A 2XI9A 2XICA 3JCMV 3OYKA 3CXCS 3CMEA 5GAMh 5FU7B 4E7IA 3CMAT 3INZA 3HSBA 2DD4A 3JSCA 5LJ5f 2RM4A 3S3NA 3EFRA 3RESA 5CKDA 3CCVA 3GIBA 3ER0A 5LJ3e 3LWHA 4PJOD 2CZ1B 2X4JA 4XTUA 1ZBXA 1UGPB 3DB4A 4C92C 2CYZB 3MO8A 3PTAA 2ZGWA 3E9GA 5FU6B 3UWNA 4C0FA 3HL8A 3ME9A 1KD1C 5GAOn 1JBMA 3BY7A 3LYIA 2DIGA 1M1GA 4EMKA 3GNGA 4M75A 3CD6T 5I2SA 5CVIA 3BW1A 3CEYA 3QZ5B 2V8JA 5FU7C 1Q81U 3OS5A 5CR2A 2BUDA 4MZPA 3GP8A 3CMET 2DJZA 4ZTJA 1VQMT 3CC2A 2RHXA 3QHSA 3M4YA 4PJOB 4C8QD 2DXBA 2ZPEB 4M7DF 2LCLA 4HKEA 4ZGJB 5FU6C 1N6AA 1Y7XA 3C12A 1AHJB 2PVDB 3LGLA 4M78F 2RJFA 4E7LA 5GAOl 2JZ2A 4M77D 5GAN6 2K5LA 2XG8D 3H8ZA 4BI3A 1I4K1 4L5GA 1M90C 1N8RU 2LX9A 4FSXA 4KBMB 3DKMA 4O6JA 1VQ4A 5FLXE 5D6WA 4O5VA 1UGQB 3JCMc 5GAMf 5CQYA 1Y71A 3OYEA 1X75C 3LGFA 3VJPA 4A54A 3CPWA 4PJOC 1KG1A 3CC2T 3G7ZA 3HKSA 4E47A 5A0DA 3CCQA 1GXIE 1QP3A 4X9CA 3QO3A 3OYJA 1QVPA 3CBPA 4OB2B 5KCHA 4XK8E 1MGQA 3J80E 3A8OB 4C5GA 1W4SA 4ZN1A 2EJFA 3SDZA 3G6EA 5IT9E 2DAQA 2K3XA 5GAN3 2DD5A 1NZ9A 4IUUA 3OBWA 2EQUA 2K57A 2HBPA 2P4TA 2DPPB 4E7KA 2E6NA 2EQKA 5LJ3d 4PJOG 1ZQ1A 1VQ4T 1QVGA 4EDUA 4M75E 4QW2A 2ZZDA 3OY9A 1K9MU 4BE0A 2ZPGB 1PSFA 3CCEA 3FC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTM A;  4R55 A;  3LWH A;  3KXT A;  4R56 A;  3LWI A; 
#chains in the Genus database with same CATH topology
 4PL6 A;  3MCA B;  1G5V A;  3V8L A;  5CKB A;  2J7I A;  4D8K A;  3JB9 G;  3CCR A;  2F2X A;  2KVQ G;  5KYY B;  1JJ2 S;  4JRK A;  5A0G A;  1PM3 A;  2AKL A;  3VS1 A;  4EMG A;  4IUQ A;  1TUC A;  1LCK A;  4OMN A;  2FZC B;  1YI2 Q;  1S72 A;  1Q82 C;  4M78 B;  1UEB A;  2DTI A;  3HRT A;  4RTU A;  5EG2 A;  4JS5 A;  5LJ5 h;  4PJL A;  4M75 F;  2DX1 A;  5CQX A;  2LT1 A;  4J9D A;  1BKB A;  2YUP A;  1W2B S;  3PVQ A;  4M78 C;  5C0M A;  5IHN A;  2ED1 A;  2CRE A;  1QVF A;  1PCX A;  4X1V A;  2QQA A;  2A3L A;  1UJ0 A;  2C0T A;  4GBQ A;  2YSQ A;  1LNX A;  3SB2 A;  2PQW A;  3CCS T;  2RJD A;  3QZ9 B;  4KUL A;  1TWB A;  2GNC A;  2OTJ T;  1MMG A;  3OB9 A;  1X6O A;  3M0P A;  1FMV A;  3CCJ T;  2FHD A;  2SRC A;  4M75 D;  1IZ6 A;  3OSS C;  3VYH B;  1QKW A;  2DXT A;  3CBO A;  1QLY A;  4B6M A;  3O5Z A;  2CUB A;  3CME Q;  3CCV Q;  4LXC A;  3CPF A;  4N0A C;  1Q95 G;  3LX7 A;  1N27 A;  3HRS A;  3QPH A;  4PK4 A;  1M1K C;  1WJS A;  2L89 A;  1JB0 E;  2EJ9 A;  2E1H A;  2RJE A;  2HNI A;  5CKH A;  1H92 A;  2LQN A;  2PTK A;  2WSC E;  2FRY A;  2DF6 A;  5FRM A;  2EBP A;  4B9W A;  1V76 A;  1KC8 U;  1G3W A;  4HCC A;  1AZG B;  1ZBJ A;  3EG1 A;  2C06 A;  8AT1 B;  4J9I A;  4LDV A;  2P0Q A;  2VUB A;  1MMN A;  4M77 B;  2O31 A;  4R55 A;  1H3Z A;  1HK9 A;  5I21 A;  2FEI A;  1E7O A;  1XTD A;  2F2W A;  2LCC A;  2KY9 A;  1C1A A;  2KT8 A;  2EIF A;  2RF0 A;  1WYX A;  1X6B A;  2JS0 A;  1WHM A;  4M77 C;  2CP6 A;  1BYM A;  3CCL A;  3I35 A;  1UGS B;  2ZPF B;  3M0S A;  4M7A G;  1SG5 A;  4HCB A;  3CCE Q;  1HSQ A;  1N8R R;  3EG0 A;  2E6Z A;  4ORZ A;  2QXF A;  2ABL A;  5GAN 8;  3CCL Q;  3JCM P;  2XMF A;  1RI9 A;  4DBQ A;  4CRI A;  1K8A U;  3FIF A;  4VUB A;  3Q1J A;  1OX8 A;  3UDC A;  1D1C A;  1FWZ A;  3V7S A;  1Y0M A;  4HVV A;  4DEY A;  2RN8 A;  3LLR A;  5KYY A;  3CC7 A;  4OGE A;  2DIL A;  1VQK Q;  4J9F A;  2OTL T;  3OYA A;  1Q7Y C;  1U1T A;  4M7D A;  2RD1 A;  2LTO A;  4F16 A;  4J6W A;  2HQE A;  3CC7 Q;  3QDF A;  4LD9 K;  1YIJ Q;  2HL5 C;  1YNZ A;  3MHX A;  1M30 A;  2EYW A;  1QKX A;  4JJB A;  1VQO A;  3CCM T;  4OVA A;  1YHQ Q;  2FVU A;  5GAO q;  5FW9 A;  5KH6 A;  2YUQ A;  3TCJ A;  1GL5 A;  4Y91 A;  1WHL A;  1OEB A;  2KK4 A;  3EHR A;  3PIP A;  1JQQ A;  1VQ6 A;  3WVE B;  4GLK A;  3HHT B;  3I55 A;  1GXI E;  2LP5 A;  1K4U S;  4RCC A;  2AKK A;  3KFV A;  2XDD A;  1VQP T;  2JXB A;  4DBF A;  1VQ6 Q;  2CZ0 B;  4PFZ A;  2QTV A;  1OQK A;  1GFC A;  2MI6 A;  5GAO m;  1BI1 A;  2DRM A;  1K8A C;  4F7U F;  3CC4 T;  2CZ7 B;  4N0A A;  4E6R A;  2VKN A;  2BIV A;  4OB0 B;  1M4Z A;  2KE9 A;  3OYN A;  3MP1 A;  3VYG A;  3T9N A;  1SRL A;  2F5T X;  4QQG A;  3E1S A;  4RG2 A;  2QDY B;  1C6V X;  2ZCF B;  4E7S A;  5IHK A;  5KYX A;  2X3X D;  1P92 A;  3BDL A;  2OAU A;  4FT4 A;  2DM1 A;  2ROT A;  3F70 A;  4IUR A;  5J3B A;  3X26 B;  4JLG A;  2DVE A;  3PMT A;  4AFS C;  1GBQ A;  4C92 E;  1IRX A;  1K9A A;  4OMP A;  3QII A;  3JCM e;  1C0M A;  2JTM A;  4X34 A;  1Q81 R;  1G3Y A;  2EQM A;  4UC4 A;  2DZ9 A;  3GNF B;  3NTH A;  2MMP A;  1X43 A;  3EGX A;  3M58 A;  1WJR A;  1Q86 U;  2NUZ A;  1FXX A;  1KQS P;  1AT1 B;  1RL2 A;  4M77 A;  1SSH A;  4RTX A;  2DZC A;  1SSF A;  2RMO A;  3RR6 A;  3JB9 I;  3C4S A;  3RER A;  1TH7 A;  1YIT A;  1OV3 A;  4J9C A;  4OB3 B;  5HCK A;  2DK3 A;  3E9F A;  5GAN j;  3H9N A;  1YP5 A;  4JPB W;  1YIT Q;  1HJD A;  4CC3 A;  5CKE A;  1XJW B;  1JO8 A;  1VQ8 T;  2B86 A;  5GMK e;  2YLB A;  4ZGD B;  5GAN h;  2DKG A;  4BY6 B;  2RHZ A;  1T3L A;  1X27 A;  5LL6 S;  1MV3 A;  4JUV A;  4C0D B;  2K9G A;  4ME7 A;  1RAE B;  2KGT A;  2FRW A;  2JTF A;  4D6W A;  1HYO A;  4PLI A;  1YI2 T;  1VQN Q;  4WCI A;  5CAI A;  1S1N A;  2FPE A;  2KRO A;  3M55 A;  3JCM g;  3N5B B;  3RMQ A;  4BY6 C;  4IIM A;  1JJ2 P;  4C0D C;  4DBH A;  3GPL A;  2MYS A;  2L3Q A;  3O8V A;  3CMA A;  2QEX Q;  1Y96 B;  2HKQ B;  4PKC C;  5GAN 7;  1Y07 A;  3TRE A;  2E41 A;  1EFN A;  2E12 A;  1VOM A;  3THK A;  5CO7 A;  5DLO A;  5GAN f;  2HBW A;  1MNE A;  2FL7 A;  1YWO A;  1ZUK A;  1W2B P;  2CT4 A;  2COY A;  1UJY A;  3S3N A;  3EFR A;  2G6F X;  2JW4 A;  5LJ3 e;  3H0I A;  2X4J A;  1ZBX A;  1SEM A;  1UGP B;  3DB4 A;  1TXQ A;  2KXC A;  5FU6 B;  1VQM Q;  2DYB A;  4C0F A;  3HL8 A;  2DBK A;  1QWE A;  2A08 A;  3BY7 A;  3LYI A;  4M75 A;  3CD6 T;  5CVI A;  2V8J A;  2BUD A;  3H41 A;  3CME T;  3CC2 A;  4PJO B;  3M4Y A;  4C8Q D;  4M7D F;  5FU6 C;  4OMO A;  1AHJ B;  4M78 F;  4FW2 A;  2C0I A;  2O9V A;  5GAO l;  3CC2 Q;  5GAN 6;  3VS6 A;  5GJV B;  2VVK A;  5IXB A;  2RQR A;  4KBM B;  1VQ4 A;  5FLX E;  5D6W A;  3MKD A;  1TU0 B;  4O5V A;  4F04 B;  1X75 C;  2DBM A;  3VJP A;  4PJO C;  2W10 A;  1N5Z A;  3G7Z A;  4PFP A;  1IGU A;  3QO3 A;  3A1P A;  1VQ4 Q;  5KCH A;  4XK8 E;  3J80 E;  2DE0 X;  3G6E A;  1OPL A;  3SDZ A;  5GAN 3;  1M3A A;  4AT1 B;  1TSF A;  1TUD A;  1ACM B;  1PWT A;  2EQK A;  3MJX A;  2J6O A;  1M27 C;  3G6E Q;  2ZZD A;  2ZPG B;  2J06 A;  1NEB A;  4M4Z A;  5I11 A;  2K7A A;  4M78 D;  4C5I A;  2G3R A;  3TEE A;  5LJ3 g;  1RAA B;  1T3S A;  2BZX A;  4DQ2 A;  3PNW C;  4Z8A A;  2H3E B;  1T0J A;  3TQ7 P;  3P8D A;  1M2V B;  3SWN A;  2GFA A;  1Q86 R;  3CCE T;  2NUP B;  3JCM d;  4J9B A;  1VUB A;  1BK2 A;  1LPL A;  1UE9 A;  2ECZ A;  3MP8 A;  1X01 A;  1I1J A;  2GBQ A;  2P4R A;  8ATC B;  3QG1 A;  3CCM A;  3NFC A;  5D6X A;  4BB7 A;  3OYY A;  2DNU A;  1QVG P;  1VQ9 T;  1KIK A;  2EQJ A;  4B9X A;  5IN1 A;  2K3Y A;  3RUX A;  2QQS A;  2AK5 A;  4KUD K;  1HXD A;  1QP2 A;  1VQK T;  1I8F A;  5FRN A;  4DA4 A;  1PRL C;  2L2P A;  3V8J A;  1YIJ T;  2K5F A;  2MOX A;  4J83 A;  2HZY A;  4NOY A;  2D9T A;  3QJ6 A;  4M77 F;  1YHQ T;  3G1J A;  1VIE A;  2HEQ A;  2W0Z A;  3M0T A;  1UUE A;  3PFS A;  3UA7 A;  1PC0 A;  3OYB A;  1RAH B;  2R5A A;  2XK0 A;  4YTL A;  1IO6 A;  2LRQ A;  4J7I A;  1TOV A;  1WPY A;  1WXT A;  2MK5 A;  3X28 B;  1YJN T;  2CT3 A;  5GAM g;  1N9R A;  5IHI A;  3MEA A;  2M16 A;  5FWB A;  1MUZ A;  2FB7 A;  1Y57 A;  1KQS S;  4EMK B;  2BE9 B;  4WF2 A;  2OI3 A;  2J6K A;  4NL3 A;  4C92 G;  2VGM A;  4JDS A;  1XQH A;  1Q82 U;  3UAT A;  1JU5 C;  1RAC B;  4JRQ A;  1AOJ A;  2EPD A;  3M56 A;  2KRN A;  1SHF A;  3VUB A;  4PNO A;  1E6G A;  2MF2 A;  4EMK C;  5LJ5 e;  1UG1 A;  2E3I A;  3QUI A;  2MAM A;  4PJO A;  4C8Q B;  1NLP C;  2PVO B;  1YJW A;  1KHC A;  2JM8 A;  4PFO A;  3JCM W;  2YLC A;  4FM4 B;  2PUK B;  2QTX A;  2OAW A;  2DRK A;  5GAO p;  1UHF A;  3OYL A;  2BZ8 A;  4C5H A;  3ZFJ A;  2RQV A;  4AMC A;  2RK1 A;  2QQB A;  2VGN A;  1U8R A;  5L23 A;  2E4H A;  1PNJ A;  2RHY A;  4C8Q C;  1YJ9 A;  2CSQ A;  5FWC A;  4JRP A;  4F7U A;  4RG8 A;  4FYX B;  1WZO A;  1BIA A;  1GCQ C;  1YJ9 Q;  2DEQ A;  4KUI A;  2DMO A;  4XAX B;  3HFN A;  1Z9Z A;  3EGU A;  3M0R A;  1JXM A;  2YRV A;  2WSE E;  1OYX A;  1EIF A;  5KE2 A;  1OZ2 A;  3CCR Q;  4QVZ A;  1JJ2 A;  1M5Q 1;  3EH2 A;  2O4X A;  4IUP A;  2JVV A;  2DTO A;  2CP7 A;  1VIF A;  1S72 Q;  2KR3 A;  1M1K U;  2M0O A;  4KH0 B;  4JZ4 A;  2LQ8 A;  3OYD A;  1M2V A;  1WHG A;  3CQT A;  2DL3 A;  3H0H A;  3G4S A;  3A5Z B;  2EYY A;  5LJ5 g;  1OU9 A;  3VKI A;  1WQ7 A;  2ZPB B;  3EG9 B;  3G4S Q;  4N4H A;  1K73 U;  1K0X A;  4ZGE B;  1NJI R;  1GFD A;  1KSW A;  1QVF S;  2HQX A;  2A7Y A;  4IIO A;  1SHG A;  1NEG A;  3OMC A;  1OX9 A;  2OJ2 A;  4FIB A;  2RI5 A;  4A53 A;  1NM7 A;  2DVJ A;  5GAM d;  4DEX A;  1OU8 A;  1VQN T;  2YHT A;  4ZN3 A;  1WFW A;  2D8J A;  2EJG A;  5IXF A;  2E64 A;  3OS1 A;  5DY9 A;  3OW2 P;  4IUV A;  4NL2 A;  1ARK A;  1MMD A;  4P5N A;  2XD0 A;  1ZX6 A;  1VQL A;  1OZ3 A;  1X69 A;  4J9E A;  4M7D E;  2QEX T;  4ZTF A;  3RDV A;  3LH5 A;  3CD6 A;  3OA6 A;  1ZLM A;  1BCM A;  2BKD N;  2YXY A;  5I22 A;  1D0X A;  4FL6 A;  4HT8 A;  2FG0 A;  2JMC A;  3V7R A;  2QI2 A;  2RO0 A;  2BZY A;  3OYF A;  3TU4 K;  2X35 A;  2HKN A;  4QKU A;  5M9O A;  3EGD A;  1K73 C;  1MV0 B;  2VWF A;  3JB9 D;  5A0L A;  5KYW B;  5J26 A;  1Q7Y U;  1VQ5 A;  1TS9 A;  2EGE A;  3ASK A;  4MMK A;  3G71 T;  1QWF A;  3JCM b;  3CCU A;  4E7Z A;  2FO0 A;  4J5Y A;  2EAY A;  5FRO A;  3FEO A;  3NHN A;  3CCQ T;  3FLG A;  4OMF B;  1JXO A;  2CKK A;  4C8Q A;  4EMH A;  4Y28 E;  4CC4 B;  4FW1 A;  4LD6 A;  1A0N B;  1Q82 R;  5GMK m;  1GCQ A;  2VYT A;  3CBM A;  3UPU A;  2P0P A;  1QVG S;  1G2B A;  2AHJ B;  1OPK A;  5CCA A;  2Y4Y A;  2RQU A;  1RLQ C;  4KH1 B;  1AWX A;  2V26 A;  4BDZ A;  4HA8 A;  1RI0 A;  1IXD A;  5GAO r;  3VS7 A;  4BI4 A;  3JV3 A;  2R58 A;  2QA4 T;  5LJ5 d;  1VQ7 A;  2EFI A;  2KI7 A;  1WHK A;  4OF1 A;  2V8K A;  1Q81 C;  2GTO A;  3LW5 E;  1G83 A;  2HCK A;  4ESR A;  1VQ9 A;  3X24 B;  5AT1 B;  1K9M R;  3SEM A;  1VQ7 Q;  4M78 A;  4EPC A;  2HSE B;  1KFZ A;  1I5L A;  2RI2 A;  1KD1 U;  2RJC A;  1WJQ A;  1ZSZ B;  2LCS A;  4M77 E;  5CKF A;  3U23 A;  4ANJ A;  2IG0 A;  2ZAE A;  4E7H A;  2I0N A;  9ATC B;  4PJO F;  3BE3 A;  1FX7 A;  3EAE A;  2X4W A;  1VQO Q;  3M4G A;  3VRY A;  2E10 A;  3QKJ A;  2NLU A;  2XU8 A;  2O01 E;  1R0B G;  2K3B A;  2LNH B;  1D3B B;  2H8H A;  2B8A A;  2KYM A;  1M90 U;  1ZSZ C;  2DFU A;  3I55 Q;  2K6D A;  4JLI A;  4J7F A;  5A2Q E;  4Q5W A;  2DLP A;  1YJN A;  3S3M A;  4C92 B;  3I56 T;  1B3Q A;  5C6S A;  1B07 A;  4LNP A;  4II1 A;  1W6X A;  3OYK A;  3JCM V;  3CXC S;  1ZA2 B;  4E7I A;  5FU7 B;  2D8H A;  3JSC A;  3GIB A;  3HSB A;  2RM4 A;  3RES A;  2JJ9 A;  2CP0 A;  1M3C A;  3LWH A;  4PJO D;  4XTU A;  1M8M A;  4C92 C;  3MO8 A;  1NLO C;  3PTA A;  2ZGW A;  1CSK A;  4KGX B;  2JT4 A;  1AEY A;  3ME9 A;  1KD1 C;  2E3H A;  5GAO n;  2DIG A;  1GRI A;  3GNG A;  1WHJ A;  4HCK A;  5I2S A;  3BW1 A;  3CEY A;  3QZ5 B;  5FU7 C;  3OS5 A;  3GP8 A;  2DXB A;  1Z9Q A;  1PKT A;  1CKB A;  1N6A A;  1Y7X A;  2PVD B;  2SEM A;  3VS0 A;  4L5G A;  1M90 C;  5KYW A;  4O6J A;  3OYE A;  1JEG A;  1FMW A;  3CCQ A;  4FCY A;  1SF9 A;  1QP3 A;  4RTW A;  2K3X A;  1PG5 B;  2K57 A;  1PD1 A;  1KC8 R;  1X6G A;  4M75 E;  3OY9 A;  1WIE A;  4Y92 A;  4CC2 A;  1BCO A;  1ZUY A;  4X9D A;  3KUF A;  2DL4 A;  1LOJ A;  2COW A;  2JS2 A;  2GFU A;  2VXF A;  4K11 A;  1YN8 A;  4XTY A;  3OW2 S;  2KNB B;  4LUE A;  2KYB A;  1JRI A;  5GMK l;  2RHI A;  4QVD A;  2E70 A;  3CCR T;  2YWW A;  2MPX C;  2X4Y A;  2EVR A;  3CCS A;  3I9Q A;  3V7C A;  3GBQ A;  1K8A R;  2O88 A;  1YFN A;  1IRE B;  1K0S A;  2OTJ A;  1AZE A;  2FPD A;  4DOW A;  3CCJ A;  4JRI A;  1D0Z A;  4XTX A;  1J3T A;  3OBY A;  2EKO A;  2F2V A;  3ZBD A;  3M57 A;  3QYG B;  4C8Q F;  4F17 A;  4M7D G;  4J6X A;  3A8H B;  3HTR A;  3EFO B;  3CMA Q;  1GBR A;  2HD0 A;  2ZPH B;  2JMA A;  2JNG A;  4LDX A;  1ZA1 B;  4XU0 A;  2A36 A;  2MWP A;  3X25 B;  2QAS A;  1G3S A;  2LQW A;  2GQV A;  2LX7 A;  2DO3 A;  3FDR A;  4A4H A;  1FYN A;  1YCY A;  2V1Q A;  5GMK j;  2ROL A;  3PMI A;  1B34 B;  4HVU A;  4FYW B;  1QVF P;  1R0C B;  3LWI A;  2E65 A;  4QQD A;  5I2M A;  1MHN A;  3CCV T;  1M2O A;  1BU1 A;  3BFM A;  1BBZ A;  1UDL A;  2DL5 A;  3NGP A;  2R5M A;  4AG2 C;  2YT6 A;  4JJN K;  2DJQ A;  3S3O A;  4PLL A;  4M7A B;  4F14 A;  3RKW A;  4IUT A;  1PD0 A;  4OMQ A;  4E7J A;  1IB8 A;  4R0K A;  2GGR A;  4OML A;  1NPP A;  5GJW B;  4A4G A;  4EIK A;  3RKX A;  2KEA A;  4OGC A;  4M7A C;  3QBY A;  3JCM J;  1M8V A;  2QGG A;  3QWY A;  1PKS A;  1E6H A;  1NYG A;  3HRU A;  5LJ3 j;  3H0F A;  3SD4 A;  1K76 A;  1GCP A;  3VU3 C;  3JB9 J;  5GAM e;  4RTZ A;  4XU3 A;  2OTL A;  1NBE B;  1UB4 A;  2IVW A;  2P0K A;  4Z88 A;  5LJ3 h;  2J05 A;  3URG A;  1H8K A;  3C0C A;  4M77 G;  2C0O A;  2RNA A;  3QWX X;  2CS7 A;  2K79 A;  3L2V A;  3CCL T;  4RCB A;  5L8R E;  3R6O A;  1OI1 A;  3GOX A;  2LJ3 A;  2J6F A;  3L42 A;  2RB6 A;  3L2W A;  3CCM Q;  5KYU B;  5GMK i;  3P8B B;  3WVD B;  1QCF A;  2EYX A;  4F7U E;  3E2U A;  1KHI A;  1U1S A;  1AWJ A;  5GAN 5;  2E5Q A;  1VQP A;  2AZS A;  2CGH A;  2DXU A;  3A8M B;  3CC7 T;  4MML A;  3OYM A;  2WAC A;  3CC4 A;  2DER A;  5LJ3 f;  4XTZ A;  3JRZ A;  2WSF E;  2PUO B;  3OSV A;  2Y90 A;  4LDW A;  1Y96 A;  2GF7 A;  2RHU A;  1ABQ A;  3R6N A;  4N4I A;  2CH4 W;  1ZSG A;  1WNL A;  3ULR B;  1VQ6 T;  3I55 T;  2GQI A;  2D0Q B;  3UF4 A;  1PHT A;  1WXU A;  2MWO A;  2QQR A;  1NJI C;  3OYC A;  2JTE A;  5KE3 A;  1DJ7 B;  3PGG A;  3PIO A;  1U06 A;  4RUG A;  1G8X A;  2K4Y A;  1KQS A;  2AZV A;  3KBG A;  1B34 A;  2YRC A;  3L1A A;  5KCO A;  4ATO A;  4A4F A;  2VXE A;  2EYQ A;  3QSU A;  2D6F A;  1D09 B;  2NWM A;  3CXC P;  2RI3 A;  4R56 A;  3MEW A;  1R77 A;  3CPW S;  3V8K A;  3IQL A;  1YJW Q;  2KXD A;  4OB1 B;  5J39 A;  2A37 A;  3GLX A;  4M7A A;  3A8G B;  4M75 G;  3FRN A;  3PE0 A;  2H3J A;  3HP9 A;  2ED0 A;  1I81 A;  2K2M A;  1UTI A;  1UGV A;  4C5E A;  4XU2 A;  3FJP A;  3HPW A;  5HK3 A;  2JUF A;  3A8L B;  1VQ8 A;  2LNV A;  3DLM A;  3FB9 A;  2QYZ A;  2O2O A;  4MZM A;  4WTO B;  4N4G A;  2VV5 A;  2AT1 B;  4C92 F;  3JB9 H;  1KQ1 A;  4A63 B;  2XDB A;  1ZHI A;  4BI8 B;  4XU1 A;  3PT9 A;  2ATC B;  2XDP A;  4PJJ A;  1WXB A;  1V1C A;  3MEU A;  1YI2 A;  5LJ5 j;  4IKF A;  3E19 A;  2CUD A;  1YIT T;  4CI0 C;  2JN0 A;  4M7D B;  2FZK B;  2NUP A;  3EHQ A;  4C8Q E;  4C0Z A;  4CC7 A;  2LJ0 A;  2K2V A;  1U3O A;  4OP0 A;  3NMZ C;  2EGA A;  1W2B A;  4ELZ C;  5EC7 A;  2KAF A;  2HMA A;  4KGZ B;  1N8R C;  2LDM A;  3TSW A;  2KRS A;  2JOY A;  3TSZ A;  3MPU B;  2XHC A;  5KYU A;  1IHV A;  4XQ3 A;  4M7D C;  4C92 D;  4FYY B;  4GLM A;  3M0Q A;  4BUG A;  3A98 A;  1TG0 A;  1WHH A;  5CIU A;  2Y4X A;  3JB9 F;  3C94 A;  4XTW A;  3H6Z A;  1K9M C;  3NTI A;  2KRM A;  3FJ5 A;  3OYG A;  2EWN A;  3PVL A;  4JJD A;  4MDW A;  4M78 E;  2YUO A;  1VQL Q;  2XIC A;  3CME A;  3CMA T;  2NUT B;  3INZ A;  2RQW A;  2DD4 A;  3I5S A;  5LJ5 f;  3CCV A;  5CKD A;  2CZ1 B;  3CD6 Q;  1I0C A;  2CYZ B;  2QDL A;  2DEU A;  2COZ A;  1H3H A;  4EMK A;  5KYX B;  3VS5 A;  1Q81 U;  2LMJ A;  4ZTJ A;  1VQM T;  2RHX A;  4HKE A;  1LVK A;  1D1B A;  2RJF A;  1VQ5 Q;  3H8Z A;  2XG8 D;  4BI3 A;  1I4K 1;  3I5R A;  2LX9 A;  4FSX A;  3CCU Q;  1UGQ B;  5CQY A;  1Y71 A;  4A54 A;  3CC2 T;  2F1L A;  4E47 A;  4RTT A;  1IHW A;  2V1R A;  7AT1 B;  2M0Y A;  4X9C A;  3EGX B;  4OB2 B;  4J9H A;  1W4S A;  4ZN1 A;  2EJF A;  5IT9 E;  1NZ9 A;  3OBW A;  2EQU A;  2HL3 A;  2HBP A;  2DPP B;  2E6N A;  2D0N A;  4PJO G;  1ZQ1 A;  1VQ4 T;  1QVG A;  2FZG B;  4BE0 A;  3RKY A;  3CCE A;  1F1B B;  3FC3 A;  2IPO B;  2LVM A;  2V8I A;  3G6E T;  4BAC A;  1RUW A;  4FU6 A;  2L3P A;  3EFS A;  2DXC A;  5ECA A;  2ENM A;  4QT7 A;  1EZZ B;  1D0Y A;  4TVR A;  4F7U G;  1OOT A;  1QQJ A;  1XNI A;  2HAX A;  1AWO A;  2O9S A;  3UA6 A;  1VQK A;  1W1F A;  2EQI A;  1VQ9 Q;  3X20 B;  2HQH A;  3JCM X;  3TVT A;  2F5K A;  4E7L A;  1EX4 A;  4KT0 E;  1V29 B;  1KC8 C;  3GF5 A;  1YIJ A;  3VRZ A;  1YHQ A;  1LJO A;  3AHU A;  1T0H A;  3EG9 A;  1PRM C;  1NE8 A;  3M0U A;  4FT2 A;  2D1X A;  1BI3 A;  4A4K A;  4M7A F;  2X3W D;  5AYF A;  1VYU A;  1M1K R;  1WX6 A;  4DBR A;  2AIR B;  2ESW A;  1SRM A;  5GAN 4;  4J9G A;  2YRD A;  3RBB B;  1ABO A;  1YJN Q;  2EW3 A;  2P84 A;  2L3S A;  1K73 R;  3J7A F;  1HD3 A;  3WXM B;  2X9H A;  4BE2 A;  3MEV A;  3QDR B;  1TTH B;  3CXC A;  4L6V 5;  2L0A A;  5HK0 A;  4GY5 A;  1I07 A;  2NUT A;  4M7A D;  4M75 B;  4MZT A;  5D6Y A;  2QG9 B;  5GAN e;  1RAG B;  2CDT A;  2DIQ A;  4HVW A;  1M1F A;  3M59 A;  2XKO C;  1YCS B;  4M75 C;  3OYH A;  2XID A;  3C95 A;  3RMS A;  5HY6 A;  4BDY A;  2RA2 A;  1W70 A;  1UGR B;  3LH0 A;  3CCQ Q;  1K1Z A;  1RAB B;  4A4E A;  3M54 A;  4RKU E;  4KRT A;  1Q7Y R;  3BDU A;  1N9S A;  3QXE B;  1YJW T;  5IAY A;  2LJ1 A;  4RTV A;  5KYN A;  1NPR A;  2R57 A;  2EGC A;  4C8Q G;  4FYV B;  3CPW P;  4LDY A;  3SFM A;  2X4X A;  3M5A A;  1YJ9 T;  3RNJ A;  1WQW A;  2QAZ A;  2CP5 A;  3SWN B;  3ZL7 C;  3JAM E;  3EG2 A;  1R8O B;  4E2F B;  2MCN A;  3DLL A;  5GAN g;  3OW2 A;  1X2Q A;  3J81 E;  1BIB A;  3VS2 A;  2LC4 A;  6AT1 B;  4QQ6 A;  2KQW A;  2PVG B;  2KMT A;  2LT4 A;  4AG1 C;  2BTT A;  3REA B;  3SWN C;  1S72 T;  3AT1 B;  1KQ2 A;  4JS4 A;  4J6Y A;  4L59 A;  1ZSZ A;  5DLQ E;  3CCS Q;  1VQN A;  3JCM h;  4PJN A;  2CP2 A;  4NS5 A;  2OTJ Q;  2CSI A;  4HXJ A;  1H64 1;  1AVZ C;  2M02 A;  3CCJ Q;  4HCZ A;  3KXT A;  4M78 G;  1XOV A;  3G4S T;  1Q86 C;  3DB3 A;  2QEX A;  1WGS A;  1D3B A;  4LDU A;  2GTJ A;  1KD1 R;  4HT9 A;  2MIO A;  1IGQ A;  4RMO A;  1SPK A;  2A28 A;  2PZ1 A;  1MMA A;  2HDA A;  4KGV B;  2CH4 A;  4DOV A;  1QCN A;  4C92 A;  1O75 A;  2EYZ A;  3L2R A;  2QK0 A;  3VS3 A;  5GAN 2;  4RTY A;  3L2Q A;  4XTV A;  1BI2 A;  3M9Q A;  3ZEH A;  4QVC A;  1QW1 A;  1UHC A;  1M90 R;  2FYK A;  3JCM f;  2KDS A;  3EG3 A;  1VQM A;  2DTH A;  1RAF B;  3G71 A;  3QJY A;  4LUD A;  5GMK h;  1VQL T;  3MET A;  1QMC A;  2VAS A;  4LN2 A;  3QYH B;  1NYF A;  1X2K A;  2M51 A;  3G71 Q;  1CKA A;  1ZUU A;  2M1H A;  4BD3 A;  1OUL A;  5CK9 A;  1PSE A;  2BE7 D;  3REB B;  4AFU C;  3JCM Q;  2GCX A;  1RAD B;  2CP3 A;  3EH1 A;  1BI0 A;  3VS4 A;  4Z89 A;  3SHW A;  4OMM A;  2PU9 B;  1QCO A;  3NPF A;  1VQ5 T;  2CZ6 B;  3D7S B;  4C0G A;  4F7U B;  2RQT A;  1G3T A;  2Z0W A;  2QA4 A;  1WDX A;  3CCU T;  4LE9 A;  1U5S A;  1AWW A;  4ZNX A;  1NG2 A;  2YUN A;  3OYI A;  5IH2 A;  4FSS A;  2VC8 A;  2QA4 Q;  1M9S A;  5GAN d;  3NTK A;  2X51 A;  3P8H A;  1WA7 A;  4AFZ C;  4M7D D;  4PJO E;  4BE1 A;  2OTL Q;  2QQ9 A;  2L8D A;  2ZPI B;  2O4X B;  3M53 A;  2HSP A;  1TUG B;  2KT1 A;  2L3R A;  3OS0 A;  4J8O A;  1NJI U;  1UFF A;  3RIR A;  2DYI A;  4M7A E;  2OX7 A;  2RK2 A;  2LQK A;  3OS2 A;  3VV0 A;  3HFO A;  3MP6 A;  2RH2 A;  2M9U A;  1FMK A;  1VQ7 T;  4JZ3 A;  1B7T A;  4MDX A;  2I2L A;  2L5Q A;  5DM7 R;  4Z02 A;  3I56 A;  1VQP Q;  1KK7 A;  3L2Z A;  2F69 A;  2K5I A;  1SKU B;  1YBY A;  2KBT A;  3OQ5 A;  1RLP C;  3I56 Q;  3CC4 Q;  1KJW A;  5HKC A;  1VQO T;  5GAM j;  3VUZ A;  3S6W A;  2KSS A;  3EFO A;  4V2S A;  2EKH A;  3UT1 A;  1AD5 A;  2RPN A;  3L2U A;  1VA7 A;  3OMG A;  4ELY C;  2DL8 A;  1O9S A;  2DA9 A;  2XI9 A;  2DL7 A;  1YWP A;  5GAM h;  3ER0 A;  1RAI B;  3E9G A;  2E5K A;  3UWN A;  1I5O B;  1JBM A;  1M1G A;  1D1A A;  4JJC A;  2LZ6 B;  3EGD B;  5CR2 A;  4MZP A;  2DJZ A;  1WI7 A;  3QHS A;  2ZPE B;  2LCL A;  4ZGJ B;  2NYS A;  3LGL A;  3C12 A;  4D8D A;  2A0F B;  2JZ2 A;  4M77 D;  2K5L A;  4AFQ C;  2QGF B;  1N8R U;  3DKM A;  1VYV A;  2DET A;  5GAM f;  3JCM c;  1VYT A;  1UEC A;  3CPW A;  3LGF A;  1KG1 A;  3HKS A;  5A0D A;  3OYJ A;  2FPF A;  1QVP A;  2PNI A;  3CBP A;  1MGQ A;  1WLP B;  2YDL A;  2IIM A;  3A8O B;  4PJM A;  4C5G A;  1MND A;  2DAQ A;  2JM9 A;  2DD5 A;  2VB6 A;  4IUU A;  1BB9 A;  2P4T A;  4E7K A;  5D7U A;  5LJ3 d;  4EDU A;  4QW2 A;  1K9M U;  1M3B A;  1VQ8 Q;  1PSF A; 
#chains in the Genus database with same CATH homology
 4PL6 A;  3MCA B;  2LVM A;  4M78 D;  4C5I A;  1G5V A;  2G3R A;  3TEE A;  3V8L A;  4X9D A;  3KUF A;  2V8I A;  5CKB A;  3G6E T;  4BAC A;  5LJ3 g;  3JB9 G;  1LOJ A;  3CCR A;  2KVQ G;  4FU6 A;  4DQ2 A;  3EFS A;  3PNW C;  1JJ2 S;  2DXC A;  4JRK A;  5A0G A;  4TVR A;  4F7U G;  4EMG A;  3P8D A;  2GFU A;  2VXF A;  4IUQ A;  3SWN A;  1XNI A;  2GFA A;  4XTY A;  1S72 A;  1Q82 C;  2HAX A;  3OW2 S;  3CCE T;  4M78 B;  3JCM d;  1VUB A;  1VQK A;  3MP8 A;  3X20 B;  1UEB A;  3JCM X;  1X01 A;  1JRI A;  2F5K A;  2DTI A;  3HRT A;  3QG1 A;  2RHI A;  5EG2 A;  3NFC A;  4KT0 E;  5GMK l;  1V29 B;  5D6X A;  4QVD A;  5LJ5 h;  4JS5 A;  1KC8 C;  3GF5 A;  4M75 F;  2E70 A;  3CCR T;  4BB7 A;  3OYY A;  1YIJ A;  2X4Y A;  5CQX A;  1VQ9 T;  3CCS A;  2LT1 A;  3V7C A;  1BKB A;  1W2B S;  2EQJ A;  4B9X A;  5IN1 A;  1IRE B;  2K3Y A;  1YHQ A;  4M78 C;  3RUX A;  5C0M A;  1LJO A;  2QQS A;  1QVF A;  3AHU A;  2OTJ A;  4KUD K;  4DOW A;  1NE8 A;  2QQA A;  1HXD A;  1QP2 A;  2A3L A;  4FT2 A;  3CCJ A;  1VQK T;  4JRI A;  4XTX A;  1BI3 A;  1I8F A;  4A4K A;  5FRN A;  3OBY A;  4M7A F;  5AYF A;  4DA4 A;  2EKO A;  1LNX A;  3SB2 A;  3ZBD A;  3M57 A;  3QYG B;  3V8J A;  4C8Q F;  4M7D G;  1YIJ T;  2K5F A;  4J6X A;  3A8H B;  2PQW A;  5GAN 4;  4M7D A;  3CCS T;  2RJD A;  3QZ9 B;  4KUL A;  2HD0 A;  2ZPH B;  4J83 A;  2JNG A;  4LDX A;  4NOY A;  2D9T A;  3QJ6 A;  4M77 F;  1YHQ T;  2OTJ T;  3OB9 A;  1VIE A;  1X6O A;  3PFS A;  4XU0 A;  3CCJ T;  3OYB A;  2FHD A;  2MWP A;  3J7A F;  2R5A A;  2XK0 A;  3X25 B;  4YTL A;  4M75 D;  1IZ6 A;  2LRQ A;  3OSS C;  1G3S A;  4J7I A;  2DXT A;  3VYH B;  2GQV A;  3CBO A;  2DO3 A;  3FDR A;  3WXM B;  4A4H A;  4BE2 A;  1WPY A;  3MEV A;  3QDR B;  3X28 B;  3CXC A;  4L6V 5;  1YJN T;  1YCY A;  5GMK j;  5GAM g;  3PMI A;  1N9R A;  1B34 B;  3MEA A;  2M16 A;  5HK0 A;  2FB7 A;  4GY5 A;  3CPF A;  4N0A C;  3LX7 A;  3LWI A;  1N27 A;  2E65 A;  4EMK B;  1KQS S;  4M7A D;  3HRS A;  4M75 B;  3QPH A;  4QQD A;  5I2M A;  4MZT A;  1MHN A;  4WF2 A;  1WJS A;  1M1K C;  4NL3 A;  2L89 A;  5D6Y A;  1JB0 E;  2VGM A;  4C92 G;  2EJ9 A;  2E1H A;  2RJE A;  2HNI A;  3BFM A;  5CKH A;  3CCV T;  4JDS A;  5GAN e;  1XQH A;  1Q82 U;  4JRQ A;  3M56 A;  2WSC E;  2R5M A;  4PNO A;  3VUB A;  2DIQ A;  1M1F A;  3M59 A;  2XKO C;  4JJN K;  5FRM A;  2MF2 A;  4B9W A;  3S3O A;  4PLL A;  4M7A B;  1KC8 U;  1G3W A;  4EMK C;  5LJ5 e;  4HCC A;  4M75 C;  3RKW A;  3QUI A;  2MAM A;  4IUT A;  3OYH A;  4PJO A;  4E7J A;  4C8Q B;  2PVO B;  2XID A;  3C95 A;  3RMS A;  1YJW A;  1KHC A;  2C06 A;  3JCM W;  2YLC A;  4LDV A;  1NPP A;  2PUK B;  4FM4 B;  5HY6 A;  2P0Q A;  2QTX A;  2VUB A;  4BDY A;  2RA2 A;  4M77 B;  1UGR B;  5GAO p;  3OYL A;  3LH0 A;  4A4G A;  4C5H A;  3ZFJ A;  3RKX A;  4R55 A;  4OGC A;  4M7A C;  3QBY A;  3JCM J;  1M8V A;  1H3Z A;  1HK9 A;  2QQB A;  2RK1 A;  2VGN A;  5I21 A;  1U8R A;  1XTD A;  4A4E A;  3M54 A;  2LCC A;  4RKU E;  2RHY A;  4C8Q C;  1YJ9 A;  2KY9 A;  3BDU A;  4JRP A;  4F7U A;  1N9S A;  3HRU A;  2EIF A;  4RG8 A;  3QXE B;  5LJ3 j;  1YJW T;  3SD4 A;  5IAY A;  3VU3 C;  4M77 C;  1BYM A;  1BIA A;  3JB9 J;  3CCL A;  1NPR A;  2DEQ A;  2R57 A;  1UGS B;  2ZPF B;  4M7A G;  4KUI A;  4HCB A;  5GAM e;  4XAX B;  3HFN A;  4XU3 A;  2E6Z A;  2OTL A;  4C8Q G;  2QXF A;  5GAN 8;  2YRV A;  3JCM P;  1UB4 A;  2IVW A;  4LDY A;  2X4X A;  3SFM A;  2P0K A;  2WSE E;  1OYX A;  3M5A A;  1EIF A;  5LJ3 h;  4CRI A;  5KE2 A;  1YJ9 T;  1K8A U;  1OZ2 A;  3URG A;  3FIF A;  1WQW A;  3Q1J A;  4QVZ A;  4VUB A;  4M77 G;  3SWN B;  3UDC A;  1JJ2 A;  1M5Q 1;  2CS7 A;  2O4X A;  4IUP A;  3V7S A;  1FWZ A;  3JAM E;  2JVV A;  3L2V A;  3CCL T;  4RCB A;  1R8O B;  5L8R E;  2DTO A;  3DLL A;  3R6O A;  1VIF A;  5GAN g;  3LLR A;  3OW2 A;  1OI1 A;  3GOX A;  3CC7 A;  1M1K U;  4OGE A;  2M0O A;  3J81 E;  1BIB A;  2OTL T;  3OYA A;  2LC4 A;  2LQ8 A;  1U1T A;  2RB6 A;  3L42 A;  2RD1 A;  4QQ6 A;  2KQW A;  2PVG B;  2KMT A;  3OYD A;  3L2W A;  3G4S A;  2LTO A;  4J6W A;  3A5Z B;  2HQE A;  2LT4 A;  5GMK i;  3P8B B;  5LJ5 g;  3SWN C;  3WVD B;  1S72 T;  1KQ2 A;  4LD9 K;  4JS4 A;  4J6Y A;  4F7U E;  3VKI A;  1WQ7 A;  4L59 A;  2ZPB B;  1KHI A;  5DLQ E;  1U1S A;  3MHX A;  5GAN 5;  3JCM h;  2E5Q A;  1VQP A;  1VQN A;  2CGH A;  4N4H A;  1K73 U;  1VQO A;  3CCM T;  4OVA A;  2DXU A;  4NS5 A;  2FVU A;  4ZGE B;  3A8M B;  5GAO q;  1H64 1;  3CC7 T;  4MML A;  3OYM A;  1QVF S;  5KH6 A;  2HQX A;  3TCJ A;  4Y91 A;  4HCZ A;  3KXT A;  2WAC A;  2KK4 A;  3CC4 A;  2A7Y A;  4M78 G;  1XOV A;  5LJ3 f;  3PIP A;  3G4S T;  1Q86 C;  4XTZ A;  3DB3 A;  2QEX A;  1VQ6 A;  3WVE B;  1WGS A;  4GLK A;  1D3B A;  3JRZ A;  3OMC A;  3HHT B;  4LDU A;  4FIB A;  2WSF E;  2RI5 A;  2PUO B;  3OSV A;  4A53 A;  3I55 A;  4HT9 A;  4RCC A;  2Y90 A;  5GAM d;  4RMO A;  4LDW A;  1Y96 A;  2XDD A;  1VQN T;  2YHT A;  4ZN3 A;  1VQP T;  2GF7 A;  3OS1 A;  2EJG A;  2E64 A;  2RHU A;  5DY9 A;  2CZ0 B;  4IUV A;  4DOV A;  4NL2 A;  4C92 A;  1O75 A;  2MI6 A;  4P5N A;  5GAO m;  4N4I A;  3L2R A;  1BI1 A;  1VQL A;  2XD0 A;  1K8A C;  5GAN 2;  4F7U F;  1OZ3 A;  3CC4 T;  3L2Q A;  1WNL A;  4XTV A;  1BI2 A;  3M9Q A;  4M7D E;  2CZ7 B;  3ZEH A;  4QVC A;  2QEX T;  1VQ6 T;  1QW1 A;  4ZTF A;  3I55 T;  4N0A A;  3CD6 A;  3OA6 A;  2FYK A;  3JCM f;  2BIV A;  1M4Z A;  2BKD N;  2KDS A;  4OB0 B;  2D0Q B;  3OYN A;  2MWO A;  1VQM A;  3MP1 A;  2DTH A;  2QQR A;  3VYG A;  3OYC A;  1NJI C;  3T9N A;  5KE3 A;  1DJ7 B;  3PGG A;  3PIO A;  3G71 A;  3QJY A;  4FL6 A;  4HT8 A;  2F5T X;  4QQG A;  5GMK h;  2K4Y A;  1KQS A;  3V7R A;  1VQL T;  3E1S A;  3KBG A;  1B34 A;  3MET A;  4RG2 A;  2QDY B;  2QI2 A;  2RO0 A;  3L1A A;  2ZCF B;  5KCO A;  4ATO A;  3QYH B;  3OYF A;  4A4F A;  2VXE A;  2EYQ A;  3TU4 K;  2X35 A;  2M1H A;  5M9O A;  1K73 C;  4BD3 A;  1P92 A;  3BDL A;  3JB9 D;  2OAU A;  5A0L A;  4FT4 A;  3QSU A;  5J26 A;  1Q7Y U;  3F70 A;  4IUR A;  5CK9 A;  3ASK A;  4MMK A;  1VQ5 A;  1PSE A;  5J3B A;  3X26 B;  4JLG A;  2D6F A;  2DVE A;  3G71 T;  2RI3 A;  3PMT A;  3MEW A;  3JCM b;  4R56 A;  3CCU A;  3JCM Q;  2GCX A;  4C92 E;  4J5Y A;  2EAY A;  5FRO A;  3CPW S;  3V8K A;  3QII A;  5J39 A;  4OB1 B;  3JCM e;  3GLX A;  4M7A A;  3A8G B;  3FEO A;  4M75 G;  3FRN A;  3CCQ T;  2JTM A;  3FLG A;  1BI0 A;  4OMF B;  4X34 A;  1G3Y A;  2CKK A;  2EQM A;  2H3J A;  3HP9 A;  4UC4 A;  2DZ9 A;  4Y28 E;  2PU9 B;  3GNF B;  3NTH A;  4C8Q A;  4EMH A;  1I81 A;  2MMP A;  1VQ5 T;  2CZ6 B;  4LD6 A;  3M58 A;  4C0G A;  1WJR A;  1Q86 U;  4F7U B;  4C5E A;  1G3T A;  1FXX A;  1RL2 A;  4M77 A;  5GMK m;  4XU2 A;  2VYT A;  2QA4 A;  3CBM A;  3CCU T;  3FJP A;  2P0P A;  3UPU A;  1QVG S;  2DZC A;  3HPW A;  2AHJ B;  5CCA A;  1SSF A;  2JUF A;  2Y4Y A;  5HK3 A;  3OYI A;  3JB9 I;  3A8L B;  1VQ8 A;  3C4S A;  3RER A;  2LNV A;  2VC8 A;  1TH7 A;  3DLM A;  1YIT A;  1M9S A;  5GAN d;  4HA8 A;  1RI0 A;  4BDZ A;  3NTK A;  3FB9 A;  3P8H A;  4OB3 B;  4MZM A;  5GAO r;  4BI4 A;  2DK3 A;  2VV5 A;  3E9F A;  4N4G A;  4C92 F;  1KQ1 A;  3JB9 H;  4BE1 A;  4M7D D;  4PJO E;  2QQ9 A;  5GAN j;  1ZHI A;  2XDB A;  2L8D A;  2R58 A;  4BI8 B;  2ZPI B;  2QA4 T;  4XU1 A;  5LJ5 d;  2O4X B;  3M53 A;  5CKE A;  3PT9 A;  1VQ7 A;  2XDP A;  2EFI A;  2L3R A;  3OS0 A;  3MEU A;  4J8O A;  1YI2 A;  1NJI U;  1VQ8 T;  4OF1 A;  2V8K A;  5LJ5 j;  3LW5 E;  1Q81 C;  3RIR A;  4M7A E;  1VQ9 A;  4IKF A;  3E19 A;  2RK2 A;  3X24 B;  2LQK A;  1YIT T;  4CI0 C;  3OS2 A;  5GMK e;  2JN0 A;  2YLB A;  3VV0 A;  4M7D B;  4M78 A;  3HFO A;  4C8Q E;  4C0Z A;  4EPC A;  4ZGD B;  5GAN h;  3MP6 A;  2DKG A;  4BY6 B;  2RHZ A;  3CCM A;  1I5L A;  5LL6 S;  2K2V A;  2RI2 A;  1KD1 U;  4JUV A;  4OP0 A;  4C0D B;  2RJC A;  4ME7 A;  2RH2 A;  2M9U A;  1WJQ A;  4ELZ C;  1W2B A;  2KAF A;  4M77 E;  5CKF A;  2JTF A;  4D6W A;  1N8R C;  1VQ7 T;  2LDM A;  1Q7Y C;  4MDX A;  2IG0 A;  2I2L A;  2JOY A;  4PLI A;  4E7H A;  1YI2 T;  2L5Q A;  5DM7 R;  4Z02 A;  4PJO F;  5CAI A;  3EAE A;  1FX7 A;  2XHC A;  3I56 A;  4XQ3 A;  3M55 A;  2X4W A;  3JCM g;  3L2Z A;  3M4G A;  4C92 D;  4M7D C;  2F69 A;  2E10 A;  3N5B B;  3QKJ A;  3RMQ A;  2NLU A;  2XU8 A;  4BY6 C;  2O01 E;  2K5I A;  1YBY A;  4C0D C;  1D3B B;  4BUG A;  3GPL A;  2B8A A;  3OQ5 A;  1M90 U;  5CIU A;  3O8V A;  3CMA A;  2Y4X A;  5HKC A;  3JB9 F;  3C94 A;  1VQO T;  1Y96 B;  5GAM j;  4PKC C;  4XTW A;  4JLI A;  3VUZ A;  3S6W A;  3H6Z A;  4J7F A;  2KSS A;  5A2Q E;  5GAN 7;  4V2S A;  1Y07 A;  4Q5W A;  3TRE A;  1YJN A;  3S3M A;  2E41 A;  1K9M C;  3UT1 A;  4C92 B;  2E12 A;  3I56 T;  5DLO A;  5CO7 A;  3RKY A;  3NTI A;  5C6S A;  5GAN f;  3L2U A;  3OMG A;  3OYG A;  4ELY C;  2EWN A;  4MDW A;  2FL7 A;  1O9S A;  4M78 E;  4II1 A;  2XI9 A;  2XIC A;  3JCM V;  3OYK A;  3CXC S;  3CME A;  5GAM h;  5FU7 B;  4E7I A;  3CMA T;  3INZ A;  3HSB A;  2DD4 A;  3JSC A;  5LJ5 f;  2RM4 A;  3S3N A;  3EFR A;  3RES A;  5CKD A;  3CCV A;  3GIB A;  3ER0 A;  5LJ3 e;  3LWH A;  4PJO D;  2CZ1 B;  2X4J A;  4XTU A;  1ZBX A;  1UGP B;  3DB4 A;  4C92 C;  2CYZ B;  3MO8 A;  3PTA A;  2ZGW A;  3E9G A;  5FU6 B;  3UWN A;  4C0F A;  3HL8 A;  3ME9 A;  1KD1 C;  5GAO n;  1JBM A;  3BY7 A;  3LYI A;  2DIG A;  1M1G A;  4EMK A;  3GNG A;  4M75 A;  3CD6 T;  5I2S A;  5CVI A;  3BW1 A;  3CEY A;  3QZ5 B;  2V8J A;  5FU7 C;  1Q81 U;  3OS5 A;  5CR2 A;  2BUD A;  4MZP A;  3GP8 A;  3CME T;  2DJZ A;  4ZTJ A;  1VQM T;  3CC2 A;  2RHX A;  3QHS A;  3M4Y A;  4PJO B;  4C8Q D;  2DXB A;  2ZPE B;  4M7D F;  2LCL A;  4HKE A;  4ZGJ B;  5FU6 C;  1N6A A;  1Y7X A;  3C12 A;  1AHJ B;  2PVD B;  3LGL A;  4M78 F;  2RJF A;  4E7L A;  5GAO l;  2JZ2 A;  4M77 D;  5GAN 6;  2K5L A;  2XG8 D;  3H8Z A;  4BI3 A;  1I4K 1;  4L5G A;  1M90 C;  1N8R U;  2LX9 A;  4FSX A;  4KBM B;  3DKM A;  4O6J A;  1VQ4 A;  5FLX E;  5D6W A;  4O5V A;  1UGQ B;  3JCM c;  5GAM f;  5CQY A;  1Y71 A;  3OYE A;  1X75 C;  3LGF A;  3VJP A;  4A54 A;  3CPW A;  4PJO C;  1KG1 A;  3CC2 T;  3G7Z A;  3HKS A;  4E47 A;  5A0D A;  3CCQ A;  1GXI E;  1QP3 A;  4X9C A;  3QO3 A;  3OYJ A;  1QVP A;  3CBP A;  4OB2 B;  5KCH A;  4XK8 E;  1MGQ A;  3J80 E;  3A8O B;  4C5G A;  1W4S A;  4ZN1 A;  2EJF A;  3SDZ A;  3G6E A;  5IT9 E;  2DAQ A;  2K3X A;  5GAN 3;  2DD5 A;  1NZ9 A;  4IUU A;  3OBW A;  2EQU A;  2K57 A;  2HBP A;  2P4T A;  2DPP B;  4E7K A;  2E6N A;  2EQK A;  5LJ3 d;  4PJO G;  1ZQ1 A;  1VQ4 T;  1QVG A;  4EDU A;  4M75 E;  4QW2 A;  2ZZD A;  3OY9 A;  1K9M U;  4BE0 A;  2ZPG B;  1PSF A;  3CCE A;  3FC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...