3LWHA

Crystal structure of cren7-dsdna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwhA00
4R56A 3LWIA 3KXTA 2JTMA 4R55A 3LWHA
chains in the Genus database with same CATH superfamily
4M78A 1D0ZA 1NLOC 3SEMA 3D7SB 5AT1B 2RI3A 4J9IA 2DYBA 1M2VB 2HSPA 3HKSA 2K5FA 2KGTA 4XK8E 2DXTA 2JS0A 3DB3A 1X69A 4M78D 2DPPB 3L2WA 2OTLQ 5FWCA 3OYBA 4DBQA 3JCMc 3S3NA 1M90C 1TH7A 3H0HA 1H92A 4HT8A 1GBRA 5LL6S 4PJNA 3A8OB 1RUWA 4HT9A 4FYYB 5IHNA 3THKA 2XI9A 3QDRB 2NLUA 2GFAA 4IUQA 2IIMA 4PK4A 3L2UA 3QWXX 3CCRT 2CP5A 1QCFA 5LJ3e 1TWBA 2L3RA 5CQXA 5GMKe 1VQ5T 1VIFA 2EVRA 4HCZA 2C0TA 3UT1A 2YUNA 3OB9A 2E10A 2KROA 1S72T 3M4YA 2AZSA 2M02A 2HKQB 3CCJA 3CPWP 1YI2T 1TUGB 4F17A 1VQ9T 4M7AF 3REAB 4AFUC 3CC7A 1R8OB 2A36A 1VQLT 2G6FX 1OQKA 1GCPA 2VYTA 3CBOA 2D0NA 5HCKA 3GIBA 3C0CA 2E6ZA 5CQYA 5CCAA 5KCOA 5GAMe 1Y71A 1GBQA 3MEUA 4MMKA 3CXCA 1Q81C 3CMEQ 4R0KA 3RMQA 2NUTA 1K0SA 1I8FA 2RPNA 3QZ5B 2FZGB 4BE2A 1Y96A 1ZQ1A 4EMKA 1Q86C 2CZ1B 4M75E 1QLYA 3DLMA 2PVDB 1RI0A 3OYHA 1F1BB 1VQ4A 2I2LA 2P4TA 3MEAA 4J6WA 5I2SA 3EGDB 3AT1B 4ZGEB 3OYYA 4RCCA 3I55T 2XKOC 2QQAA 2R5AA 4C92E 4E7IA 3CCMA 4KH0B 2PUKB 3E1SA 3CCLT 2F1LA 3JCMh 1PKTA 3JCMd 3SDZA 1BBZA 3JCMf 1X75C 1PG5B 3U23A 2CP7A 5KH6A 4E7LA 1VQ8Q 2DNUA 2X4YA 2FVUA 3WVEB 3V8JA 3I35A 1ZSZC 4CC2A 1K73R 3RDVA 4C0DB 3VS6A 2W0ZA 1I0CA 4NOYA 2L2PA 4A4EA 3OYLA 5FWBA 2R57A 3H6ZA 1IB8A 1OX9A 1U1SA 2KQWA 3OQ5A 4OB3B 4R56A 2RI5A 1T0JA 1AZEA 1D3BB 1ABOA 1ZLMA 2QDYB 5LJ5e 2JT4A 5C6SA 1ZSZB 3OS5A 5J3BA 1QCNA 4Y28E 2VXEA 1MV3A 3ZEHA 3HFNA 4LD6A 2RD1A 2EQUA 2QEXT 1V1CA 2K2VA 4C8QE 2DE0X 1ZUUA 4J5YA 3V7CA 3HHTB 3OW2S 3VRZA 2CYZB 2O01E 3FIFA 3OS1A 2DVJA 1NPRA 4ORZA 1VQ7T 1M1GA 3JCMV 2HQHA 4J9DA 3JCMX 2CZ0B 2HKNA 2RQWA 2HAXA 1CKBA 4N0AA 3OYMA 5A0DA 4FYWB 4OB1B 1D1BA 1Q7YR 1TUCA 2XIDA 1NLPC 3CCST 2LCCA 3GOXA 1YIJQ 2EAYA 5IHIA 2LT1A 4HCKA 1IO6A 4X9DA 3SD4A 5IAYA 2OTLT 4JLGA 4EMKC 1I07A 1V29B 2GF7A 4PJMA 2CH4A 2WSFE 4JZ3A 1PNJA 3RBBB 3CCQQ 5FU6C 1UB4A 1H3HA 2M51A 4DA4A 4DEXA 2C06A 3HFOA 3EFSA 4J7IA 2A7YA 2H3EB 3NMZC 2DTIA 3UF4A 2GTOA 3CQTA 1WQ7A 2DL3A 1R77A 1VQ5A 4D6WA 2F69A 1WNLA 1S72A 1WJSA 2B86A 2ED0A 3MPUB 1SHFA 1YI2A 2O4XB 4LD9K 4ESRA 3GNFB 4XU0A 1KD1C 2PQWA 4EMKB 2EKOA 2E1HA 5FU6B 1VQLA 3G71Q 3H41A 1PD1A 3ULRB 2DTHA 4MDXA 4RTTA 4JZ4A 4Y92A 1YITA 1I4K1 3M0UA 1ZBJA 1LJOA 3PNWC 3H0IA 4A4GA 2QYZA 4RKUE 3JB9I 3OYJA 1LVKA 4LNPA 1I5LA 4XU1A 4L59A 2OI3A 3CMET 3PVLA 1I5OB 1VOMA 2L3PA 2DLPA 3G6EA 1OOTA 2M0YA 1X6GA 3G4SQ 3LX7A 3CD6A 4M7AD 2JJ9A 1YJ9Q 1Y7XA 1HYOA 2NUZA 4QT7A 2V1RA 3QBYA 3R6NA 4LDWA 4Y91A 3VKIA 1Q82U 2DD5A 2ZPGB 4M78F 3LYIA 3A98A 3H9NA 1G5VA 4J9EA 2FB7A 4HA8A 2RJFA 2V8JA 2CUBA 1N9SA 2WSEE 5IN1A 4A4HA 4J9FA 5GJVB 2AT1B 1JRIA 4FW1A 2ROTA 4EDUA 2LRQA 1M90R 2LQKA 5GAN8 4E7KA 4M77C 3M0TA 2LJ3A 3NHNA 2DBMA 2QQBA 1VQ8T 4WCIA 1PSEA 2VC8A 2EYXA 3E19A 1CSKA 1VQOQ 5AYFA 2RH2A 1PSFA 1WDXA 2ZPBB 3NTKA 2QA4T 2E3HA 1UGQB 3L2QA 2QQSA 4XTVA 3CC4Q 3TREA 3A8GB 1K73C 4PLLA 1KFZA 4GLMA 2X51A 1NJIC 2A0FB 3JB9F 4M77B 1OZ3A 1BYMA 1B3QA 1M2VA 1AWJA 3JCMW 1K8AU 1SF9A 2IG0A 3META 2FZCB 3V7SA 1JBMA 2X3XD 1MGQA 1VQ7A 1FXXA 2CS7A 3PFSA 2MAMA 4OF1A 2O88A 2V8IA 2MPXC 1M3CA 3RKYA 1C6VX 2Y4XA 2K9GA 1ABQA 4M77G 2XICA 4M7DG 3CCUQ 1VYVA 1PM3A 1UHCA 2DERA 3CCSA 2RJEA 1RAGB 3FB9A 4QKUA 1Q86R 2M0OA 1XNIA 3SB2A 1AD5A 4PNOA 3QYGB 1VUBA 3KBGA 3HPWA 2EPDA 3E2UA 4K11A 2F2WA 2FYKA 1KSWA 4DQ2A 4O5VA 3C94A 2M9UA 1KHIA 3H0FA 4FIBA 1QCOA 1WXBA 5DM7R 1TTHB 3CCQT 4JRPA 2PZ1A 4M7AE 3LGLA 3OYKA 2L3QA 3F70A 4II1A 3TQ7P 4N4HA 2GTJA 1VQKT 4IUPA 2M1HA 4PJJA 2DZCA 4E47A 1KQ1A 2DL5A 5GAOm 2DXUA 1YCYA 3BDLA 4C5EA 5KYNA 1JXOA 1M8MA 2D1XA 2DILA 4OMLA 2MCNA 2X4JA 1M9SA 4J9CA 1AWOA 3G7ZA 1KQ2A 4PJOC 1ZX6A 3V8LA 2RHIA 5GAN6 3ZFJA 4BY6C 5GAMg 1EFNA 1D0XA 2DEQA 1AEYA 2VGMA 3JCMJ 1N8RU 2VGNA 9ATCB 3OYCA 2HBPA 2PVOB 4KUDK 1KC8R 3Q1JA 2OTJT 1RAIB 2I0NA 4FCYA 3FLGA 1HD3A 3PTAA 1WZOA 2KBTA 2MF2A 1EIFA 4J8OA 4PJOB 1W70A 3CBMA 5GANj 4BY6B 1QVFP 2YLCA 4J6YA 3T9NA 3I9QA 3MP6A 2J6OA 4RTXA 2JZ2A 4GBQA 2GQIA 1VIEA 4IUUA 2HZYA 1GXIE 3GLXA 5GMKl 1HSQA 3I56T 2EYZA 3REBB 4PJOG 3CC2Q 2E41A 4O6JA 1RAHB 4QQGA 4JRQA 3L42A 3HL8A 4C5GA 1O75A 2KSSA 3ME9A 2AHJB 3GP8A 4LDVA 1D3BA 2JM9A 1RL2A 5HY6A 1YWPA 5FRMA 2K6DA 4AMCA 1KJWA 1ZSZA 4L5GA 3RIRA 4XTZA 4FSXA 1WJQA 4KUIA 4AT1B 1SPKA 1WGSA 3EAEA 4F7UB 2QA4A 2ZGWA 3HRUA 2G3RA 2A3LA 1KIKA 1VQMQ 1B07A 2QGGA 2RQRA 1WQWA 1RLPC 1WLPB 4KGXB 3JAME 3VS3A 1Z9QA 1VQPQ 2L89A 4HVVA 5HKCA 2CP2A 4F7UG 3M0RA 1G2BA 4ATOA 1SSHA 1WPYA 1TG0A 1WYXA 1KD1R 1T3SA 3P8DA 3S3MA 1VQ6T 1QMCA 2J7IA 2LCSA 3QXEB 4RTWA 1ZSGA 4XAXB 3CEYA 4F04B 2AKLA 4DEYA 5FU7C 2E12A 3MEWA 1VQNQ 2CSQA 2SRCA 4Q5WA 4RUGA 1OPLA 4OMFB 2CKKA 1M27C 5HK0A 4J9GA 2B8AA 2RF0A 4PFOA 2CT4A 2E4HA 1U06A 4WTOB 1Q81U 1QVGP 1U5SA 3JB9D 5IXBA 3A8HB 5FU7B 2YUOA 1N9RA 3WXMB 3OW2P 1B7TA 5LJ3h 2QGFB 2FPDA 1M8VA 1JEGA 2O4XA 1WHMA 5LJ3f 4E2FB 4BE0A 2J6FA 2F5TX 2JM8A 4FT4A 1MUZA 2EW3A 1BIAA 1UG1A 2BTTA 1N5ZA 4HKEA 2BKDN 1W2BA 3M0SA 2CDTA 4BDZA 4Z89A 2QI2A 3O8VA 3HTRA 3RKXA 2FL7A 1VQKA 4BUGA 4C0GA 2C0IA 4M75C 4J6XA 3OS0A 1YJNQ 3OBWA 3JCMe 4J9HA 3P8BB 2QASA 2EGAA 1AWWA 1JJ2S 1TOVA 2LNHB 4C0DC 1YHQT 2LCLA 1KQSS 4UC4A 5GAMh 3ZL7C 5GAMd 1UE9A 3CMAA 3PMTA 4NS5A 1QWEA 5GAMf 4IUTA 4AG2C 3CCVQ 2QAZA 4C92C 4IIOA 1E6GA 1K9MU 2RNAA 4JPBW 3VUBA 4Z02A 5GANe 2KRMA 4M75B 2QK0A 2VWFA 2DRKA 1UJ0A 2VASA 3A5ZB 1YWOA 2OTJA 4J7FA 4JJNK 1J3TA 2O9SA 4HCCA 2EGEA 3M56A 2J06A 3JRZA 2E70A 1NJIR 2P0KA 4XTYA 4BI8B 2F2VA 4M78E 4F7UF 4C92B 1JB0E 1YP5A 4IIMA 3RESA 4JS5A 1T0HA 4M75G 5IXFA 4LN2A 2D8JA 1AHJB 1YJWT 5CVIA 4A4FA 3VUZA 3CCEA 4DOVA 3QDFA 1KC8C 2DD4A 4IKFA 1FMKA 3I56A 3QWYA 1DJ7B 4N4GA 2KMTA 3N5BB 4OB0B 4C92G 2V8KA 3EG9B 2JN0A 2JUFA 3OMCA 2DO3A 3M4GA 3HSBA 2LTOA 3KFVA 3OBYA 2X9HA 1BCOA 3M9QA 2EYYA 4C8QC 3CC2T 3S3OA 4JLIA 4CC3A 4C0ZA 2CZ7B 2YSQA 3FC3A 1PRLC 5D6XA 2EJGA 5KYYB 3BW1A 1WFWA 4M77A 5LJ5h 5GAOn 5LJ5d 4M7DA 1S1NA 1WXUA 5LJ5f 2VV5A 1WHLA 3M53A 5EC7A 3OYDA 1TSFA 1FYNA 1JJ2A 3CCJQ 4M77D 1M1KR 4JS4A 4RMOA 5I22A 1KQSA 4QQ6A 4C8QB 2LJ1A 2K2MA 3MO8A 1I1JA 1PRMC 5CKFA 3CC7Q 1WHJA 4A54A 2R5MA 4HCBA 1VQ6A 1X01A 2GBQA 5GMKi 3LW5E 5GAN4 2CP0A 1U8RA 4OMPA 2HD0A 2MWPA 3CCRA 2AIRB 1VQPT 2HNIA 2HL3A 3QHSA 3QJ6A 4C8QG 1ZBXA 4CI0C 5I21A 2RJCA 2ENMA 1D1AA 3TSWA 2YXYA 3J80E 1VQ9A 2JNGA 2ZPFB 1UEBA 4R55A 1VQ4Q 1VQNT 2C0OA 2LP5A 1NEBA 2BE9B 4C0FA 2IVWA 2RHZA 1KK7A 2JS2A 2NUPB 4FU6A 3FRNA 4CRIA 4C5HA 2V26A 1Y57A 2QQ9A 3CCMQ 3MKDA 2DIGA 2RMOA 1YBYA 4JJCA 3OYNA 1G8XA 5D7UA 3QO3A 5CKDA 4AFSC 5A0GA 2D8HA 3UPUA 3AHUA 1ACMB 2LX9A 2V1QA 3OSVA 4V2SA 3OYAA 1KHCA 2KRSA 3VS5A 5CAIA 3CPWA 1Y07A 2K57A 1SSFA 2DAQA 3LGFA 4C92F 2X4WA 2Y90A 1NPPA 3I55A 5D6YA 3NFCA 1WIEA 1YHQA 3QJYA 4LDYA 2ABLA 1G83A 4A63B 3CCLA 2L0AA 2MWOA 1E7OA 5J39A 2EKHA 2ED1A 3O5ZA 2KXDA 5CKHA 1OEBA 5KYWB 2EIFA 2LX7A 4PJOA 2XMFA 1PWTA 5IHKA 2LZ6B 2VUBA 3A1PA 3GBQA 2JOYA 3P8HA 3BY7A 4RTVA 2O9VA 1CKAA 2LQWA 2CZ6B 2EFIA 4KULA 3M0PA 3MEVA 2GQVA 4PKCC 4PJOD 1Q82C 4VUBA 3OMGA 4M7DC 1M30A 3M55A 2OAWA 4IURA 2ESWA 3UWNA 2PTKA 4CC4B 1K73U 1IGQA 4QVDA 1YJWA 1AOJA 1A0NB 4JDSA 1SRMA 2YRVA 5GMKm 3ZBDA 3EFRA 2XDBA 4C8QF 3VYGA 1C1AA 3EFOB 1UGRB 2QEXA 2RB6A 1ZHIA 4RTYA 4E6RA 4D8KA 4M7DB 3LH5A 5M9OA 2L8DA 2YUQA 1BI0A 3NGPA 1OZ2A 4LDUA 4F7UA 4FL6A 2JW4A 1UUEA 1OPKA 5FW9A 2FO0A 1QP3A 2KEAA 4ZNXA 4ZTJA 1HJDA 2COWA 1OI1A 2EQIA 4PLIA 1X6BA 4JJBA 2Y4YA 1XTDA 2P4RA 1EX4A 2HMAA 2PU9B 2BIVA 4OMMA 1VQ5Q 3TSZA 1TXQA 3MP1A 2LQNA 4D8DA 4XTWA 5FRNA 5IT9E 1S72Q 1K8AC 3GF5A 2RQVA 3CXCP 2EYQA 1AT1B 1OULA 1YI2Q 3LLRA 1OYXA 1MNEA 1G3SA 1BCMA 1Q7YU 1VQLQ 2OTLA 4BACA 4Z88A 2D0QB 4E7SA 2HDAA 2QQRA 2RM4A 3SWNC 2KYBA 1YIJT 5DLQE 3KUFA 1YITQ 1BI2A 4RG8A 1H641 5CR2A 2EWNA 3PT9A 1M1KC 3TCJA 5LJ3g 4FM4B 1WHKA 2COYA 7AT1B 1QKWA 4M4ZA 2O2OA 2DL4A 4MMLA 2E65A 4GLKA 3SWNB 3G6EQ 1EZZB 3OYGA 3OA6A 3PE0A 4J9BA 5CIUA 2KRNA 2EYWA 2KK4A 3CD6Q 2KAFA 1OX8A 1WI7A 1ARKA 4QVCA 4B9WA 4FYXB 2MK5A 4X34A 3CCLQ 3QYHB 1NBEB 5C0MA 5GJWB 2BZYA 3EG1A 3G71T 4EIKA 3QIIA 3M5AA 2FG0A 2GGRA 4BI3A 1RLQC 4M7AB 1LCKA 1RABB 3E9GA 3CMEA 1M5Q1 2AK5A 2P84A 4Z8AA 1AVZC 3I5SA 1ZA1B 2LDMA 2DM1A 5DLOA 4MZPA 1UDLA 1XQHA 2CREA 2XHCA 2MYSA 1OU8A 4KGVB 2FEIA 4M75A 3RMSA 1H3ZA 4LXCA 4M7AG 2KVQG 2KR3A 4OVAA 4ZGDB 1PC0A 2DRMA 2KXCA 3G4ST 1VA7A 3QSUA 4EMHA 2E3IA 2LC4A 4M77F 4OB2B 1YJ9T 1N8RC 4M75D 4M7DF 2BZ8A 2DTOA 3LWIA 4ZN1A 4C92A 5GANg 2EQKA 1W2BS 1IGUA 3E9FA 4KT0E 4DBFA 4YTLA 1K4US 5GAOr 5KYUA 2FPEA 2PVGB 2BE7D 4C92D 1VQ8A 2MI6A 1VQ7Q 4ZTFA 1BKBA 1TU0B 3OYIA 3UA6A 3EG9A 2JTFA 4XQ3A 1M90U 5L23A 1BK2A 4JRIA 2A28A 3CCSQ 5LJ5g 4QW2A 1X43A 1VQOT 2YDLA 1JXMA 3ASKA 1GCQA 5KYYA 1W1FA 3CC4T 3VV0A 2COZA 3S6WA 2CUDA 2E6NA 1ZA2B 4EMGA 2DVEA 4RG2A 1PHTA 3FEOA 4C8QA 2XDPA 3FJPA 2DX1A 3MJXA 1SEMA 3C12A 3X24B 1N6AA 2A08A 4AFQC 4BD3A 2DFUA 1IHVA 2DJQA 2CSIA 2E5KA 4C8QD 3NPFA 4WF2A 4HVUA 3GPLA 3TEEA 1MMAA 2CT3A 2DETA 3CCUT 3JB9H 1SHGA 2K3XA 2BUDA 3QKJA 1Q86U 3RNJA 2DA9A 2DXCA 1YIJA 1QVPA 2ZPHB 5LJ3d 2ZAEA 1ZUYA 5GMKh 4B6MA 1G3TA 3M54A 2XG8D 2LT4A 1QVFS 3CBPA 5GAOl 3CCQA 2K79A 2JTMA 2NUPA 1OV3A 4DBRA 1E6HA 2LJ0A 2RI2A 1RAAB 4PJOF 3BFMA 1YITT 3TVTA 2WACA 2GFUA 3UDCA 3C95A 2ZPEB 1BI1A 1UECA 2QTVA 2K7AA 4QQDA 1TS9A 2RHUA 2HEQA 1NZ9A 2RO0A 1Q82R 2K3BA 1M1FA 2XDDA 3G6ET 1AZGB 3G71A 1U1TA 1QW1A 2JMAA 4CC7A 4KGZB 2PUOB 2DEUA 1VYTA 3CD6T 1SRLA 3CPFA 3OYEA 3NTIA 5KE2A 3RERA 1Z9ZA 2FPFA 2P0QA 2K4YA 4ZGJB 5CK9A 1K9AA 3L2ZA 3EG3A 4N4IA 2J6KA 5A2QE 4FW2A 2K3YA 3BDUA 2DF6A 2JXBA 3DLLA 4B9XA 2DJZA 5I11A 5KYWA 2ZCFB 1NYFA 1KC8U 2CGHA 5ECAA 4MDWA 2ZZDA 4M78C 1K9MC 5I2MA 5KCHA 2VB6A 2RA2A 3G4SA 4A53A 3V8KA 2QA4Q 3TU4K 2FRYA 2YWWA 5GANh 5KYUB 5GANd 1YJ9A 1LPLA 3LH0A 5GANf 3H8ZA 1D0YA 3LWHA 3DKMA 4GY5A 1GCQC 1HK9A 4DOWA 1YN8A 1YFNA 3NTHA 2YUPA 3FJ5A 3KXTA 4RTZA 3VS0A 3OYFA 1QP2A 4HXJA 3C4SA 4BI4A 2F5KA 2E64A 1X2KA 1V76A 4XTUA 1MNDA 1M3AA 1NE8A 1P92A 3EGXB 3INZA 2D9TA 1K8AR 4OMOA 3EG2A 2K5LA 4M78B 3CPWS 1IREB 3J7AF 1K76A 2RK1A 1QVFA 2ZPIB 3EFOA 1QQJA 3VJPA 1WHGA 5GAOq 2E5QA 1QVGS 3JCMb 3SHWA 2RHYA 5CKEA 1IRXA 1MMNA 1XOVA 5GAOp 1W4SA 1JO8A 4BE1A 6AT1B 3A8MB 3UA7A 4BB7A 4M78G 4KH1B 1U3OA 1ZUKA 2GCXA 5GAN5 1K0XA 1VQOA 4M7DD 4X1VA 2FHDA 3OS2A 2HSEB 1UFFA 2CP3A 2YLBA 1VQMT 2P0PA 4F16A 3L2VA 3CC4A 1AWXA 2AZVA 2L5QA 4LE9A 4PL6A 1MHNA 4EPCA 3V7RA 1UJYA 1TUDA 2RK2A 2HQXA 2KNBB 2HBWA 1KD1U 2WSCE 4HVWA 3JCMQ 1FWZA 1MV0B 4OGEA 4ELYC 3QPHA 4MZTA 2DL8A 4PFPA 4E7JA 3X20B 3MHXA 1VQKQ 3OSSC 2RJDA 3CCUA 2MMPA 4FYVB 2HQEA 2X4XA 3X26B 2DMOA 3X25B 4OGCA 1JQQA 2IPOB 3URGA 3JB9G 2NUTB 3CMAQ 4M75F 1Y96B 5KYXA 2CP6A 3PIOA 8ATCB 1OU9A 1Y0MA 2X3WD 2NWMA 4IUVA 3SWNA 2DZ9A 1G3YA 2VVKA 2YHTA 3X28B 2O31A 4TVRA 4OMQA 1FX7A 3M59A 3HRTA 1YNZA 1N8RR 3PGGA 3FDRA 5GAN7 2OTJQ 5A0LA 1XJWB 3VS1A 2PNIA 1QVGA 4JJDA 1GFDA 1GL5A 2MIOA 4RCBA 2BZXA 3GNGA 3OW2A 4M7AA 2EQMA 3SFMA 3RR6A 8AT1B 4E7HA 2LNVA 4JRKA 2QDLA 1GFCA 1YJNT 4FSSA 2KDSA 3CCEQ 4ME7A 2DL7A 1O9SA 2XD0A 1WA7A 2SEMA 3I56Q 2H3JA 5FROA 5CO7A 3RKWA 3EH2A 5GAN2 2H8HA 1Q95G 1W6XA 3CCVT 1RAEB 3QG1A 4OP0A 4L6V5 5J26A 3RUXA 1NG2A 4PJLA 3MCAB 3VS2A 4BDYA 2XU8A 1X2QA 4NL3A 1GRIA 3L1AA 2HL5C 4PFZA 2DXBA 3VU3C 1QWFA 1LNXA 2YRDA 4M77E 4M7DE 1NJIU 1NEGA 2K5IA 2KI7A 3VS7A 4LUEA 4N0AC 1UGSB 3EG0A 3MP8A 2AKKA 5D6WA 4ZN3A 2J05A 2LMJA 3M57A 4ELZC 1WJRA 1LOJA 3UATA 2KT8A 5HK3A 1RAFB 4KBMB 2JMCA 1JU5C 2VKNA 3CC2A 1B34A 1UGVA 1YCSB 1VQ6Q 1UTIA 1IXDA 1H8KA 1BI3A 3R6OA 1RACB 2OX7A 1IZ6A 1R0BG 2L3SA 1MMDA 1HXDA 3CCRQ 2DK3A 2D6FA 1QKXA 2KE9A 4XU2A 2DKGA 1M3BA 3J81E 1FMWA 3QZ9B 2NYSA 3JSCA 4J83A 1R0CB 1NYGA 2JVVA 1VQ9Q 3IQLA 5DY9A 1WHHA 2KYMA 1BU1A 1C0MA 3JCMP 1VQMA 1IHWA 1W2BP 2YRCA 2KT1A 2VXFA 1Q81R 2A37A 1D1CA 1M1KU 1WX6A 3CCJT 5KE3A 1PD0A 1VQPA 5LJ3j 3CC7T 4A4KA 2YT6A 1NM7A 3PVQA 4FT2A 3I5RA 2EGCA 1D09B 5GMKj 3M58A 2RHXA 2RQUA 1PKSA 2JTEA 4LUDA 3OY9A 1Q7YC 4AG1C 2Z0WA 4F14A 5KYXB 1RADB 4M7AC 1VQNA 3VS4A 1RI9A 5L8RE 3JV3A 3BE3A 2GNCA 1SG5A 2LQ8A 3I55Q 3PIPA 2ROLA 2FZKB 1YHQQ 2W10A 5CKBA 1SKUB 1UGPB 2RN8A 1VYUA 4C5IA 2F2XA 2OAUA 2LVMA 2M16A 4ANJA 5GAMj 1VQ4T 1G3WA 3M0QA 3EGUA 1T3LA 3JB9J 2EJFA 1FMVA 2EBPA 2DBKA 4PJOE 4OMNA 2ATCB 1K9MR 4MZMA 3WVDB 3CMAT 3CCMT 2X35A 4NL2A 1UHFA 4JUVA 3VRYA 4XU3A 4LDXA 4E7ZA 3EGDA 2RQTA 3L2RA 1X27A 1BB9A 2FRWA 3JCMg 4X9CA 3VYHB 3EH1A 2EJ9A 3QUIA 3DB4A 3ER0A 2QG9B 1YJWQ 5EG2A 1YJNA 4RTUA 5GAN3 3EHRA 2DIQA 2XK0A 1I81A 5FLXE 5IH2A 3PMIA 2OJ2A 1M2OA 3HRSA 2QEXQ 4F7UE 3CCVA 3G1JA 1N27A 3EHQA 1BIBA 3HP9A 2MOXA 1X6OA 3CCET 2ECZA 2CH4W 2R58A 3CXCS 1K1ZA 4AFZC 4XTXA 2QTXA 4DBHA 1PCXA 2EQJA 2HCKA 2DYIA 1JJ2P 4P5NA 1KG1A 1KQSP 1MMGA 2QXFA 1M4ZA 1B34B 4QVZA 1WXTA 3EGXA 5LJ5j 2KY9A 3A8LB 4KRTA
chains in the Genus database with same CATH topology
3BDUA 1YBYA 2M0OA 1XNIA 3SB2A 4M78A 3OYNA 3DLLA 4B9XA 2D6FA 3QO3A 2RI3A 2DJZA 5CKDA 4PNOA 5A0GA 3UPUA 3AHUA 2ZCFB 2LX9A 3HKSA 1KC8U 3QYGB 2K5FA 2CGHA 3OSVA 1VUBA 4MDWA 3KBGA 4V2SA 3HPWA 4XK8E 2ZZDA 3OYAA 4M78C 2DXTA 5I2MA 1K9MC 5KCHA 1KHCA 5CAIA 2RA2A 3DB3A 4M78D 3CPWA 1Y07A 2FYKA 3G4SA 2DPPB 2K57A 3V8KA 4A53A 3TU4K 1SSFA 3L2WA 2DAQA 3LGFA 5GANh 4C92F 4DQ2A 5GANd 4O5VA 1YJ9A 2X4WA 3OYBA 3C94A 2M9UA 5GANf 3LH0A 3H8ZA 1KHIA 2Y90A 3DKMA 3LWHA 4GY5A 1HK9A 4FIBA 3JCMc 4DOWA 3S3NA 1NPPA 1TH7A 3I55A 1M90C 3NTHA 5D6YA 3NFCA 4HT8A 1YHQA 5DM7R 3KXTA 3OYFA 1QP2A 3C4SA 3QJYA 4LDYA 4BI4A 5LL6S 3A8OB 3CCQT 2F5KA 4JRPA 4M7AE 3LGLA 3OYKA 2E64A 3CCLA 4XTUA 1NE8A 1P92A 2MWOA 3F70A 4II1A 3INZA 4N4HA 2D9TA 4HT9A 5J39A 2XI9A 2K5LA 4M78B 3CPWS 1VQKT 3QDRB 1IREB 2NLUA 3J7AF 2GFAA 2M1HA 4IUPA 4IUQA 2DZCA 4E47A 1KQ1A 5CKHA 2RK1A 1QVFA 5GAOm 3L2UA 3CCRT 2ZPIB 2EIFA 5LJ3e 2DXUA 3VJPA 4PJOA 1U8RA 2L3RA 5GAOq 2E5QA 2VUBA 1QVGS 3P8HA 2JOYA 5CQXA 3JCMb 1YCYA 2RHYA 5GMKe 1VIFA 3BDLA 3BY7A 5CKEA 4C5EA 4HCZA 1VQ5T 1XOVA 3UT1A 5GAOp 1W4SA 2CZ6B 3OB9A 2E10A 2EFIA 1M9SA 2X4JA 4KULA 3G7ZA 1S72T 1KQ2A 4PJOC 3MEVA 3M4YA 2RHIA 2GQVA 3V8LA 4BE1A 3CCJA 3A8MB 4PKCC 1YI2T 4PJOD 5GAN6 1VQ9T 3ZFJA 4VUBA 4BB7A 4M78G 4BY6C 1Q82C 4M7AF 5GAMg 3OMGA 2GCXA 4M7DC 5GAN5 2DEQA 3M55A 1VQOA 3CC7A 4M7DD 1R8OB 4IURA 3UWNA 2VGMA 1VQLT 2FHDA 3OS2A 1K73U 2VYTA 2YLBA 3CBOA 4QVDA 1VQMT 3JCMJ 2P0PA 1YJWA 1N8RU 3L2VA 3CC4A 2VGNA 4JDSA 3OYCA 3GIBA 2HBPA 2PVOB 4KUDK 2L5QA 2E6ZA 2YRVA 3Q1JA 5CQYA 5CCAA 5KCOA 5GMKm 3ZBDA 1Y71A 3EFRA 3MEUA 4MMKA 4PL6A 3FLGA 5GAMe 1MHNA 3CXCA 1Q81C 4EPCA 4C8QF 3PTAA 3RMQA 2MF2A 3VYGA 1I8FA 3QZ5B 3V7RA 1EIFA 4BE2A 4J8OA 1Y96A 4PJOB 1UGRB 1ZQ1A 2RK2A 4EMKA 1Q82U 1Q86C 3CBMA 2RB6A 2HQXA 1ZHIA 2QEXA 5GANj 4BY6B 2YLCA 4J6YA 2CZ1B 4M75E 3T9NA 4M7DB 3MP6A 3DLMA 2WSCE 2L8DA 2PVDB 1BI0A 1RI0A 1OZ2A 4LDUA 5M9OA 3JCMQ 4F7UA 1FWZA 2JZ2A 4FL6A 3OYHA 1VIEA 4OGEA 2I2LA 1VQ4A 4ELYC 1QP3A 2P4TA 4IUUA 4ZTJA 3MEAA 3QPHA 4J6WA 4MZTA 3GLXA 5I2SA 1GXIE 5GMKl 1OI1A 4E7JA 3X20B 4ZGEB 3I56T 3MHXA 3OSSC 3OYYA 4PJOG 2RJDA 2E41A 4O6JA 4PLIA 4RCCA 3I55T 3CCUA 2XKOC 2QQAA 2MMPA 2HQEA 2R5AA 4QQGA 3L42A 2Y4YA 3HL8A 4C92E 4JRQA 1XTDA 2X4XA 4E7IA 3X26B 3CCMA 2PUKB 4C5GA 2PU9B 3E1SA 2BIVA 1O75A 3X25B 2KSSA 4OGCA 3URGA 3CCLT 3ME9A 2AHJB 3GP8A 3JB9G 3MP1A 4LDVA 1D3BA 4XTWA 5FRNA 1RL2A 3JCMh 4M75F 5IT9E 5HY6A 3JCMd 5FRMA 1Y96B 3SDZA 3GF5A 1K8AC 3JCMf 2EYQA 1X75C 3PIOA 4L5GA 3RIRA 4XTZA 3LLRA 4FSXA 1OYXA 1G3SA 1WJQA 4IUVA 3SWNA 5KH6A 4E7LA 4KUIA 1Q7YU 2DZ9A 1G3YA 1WGSA 3EAEA 4F7UB 2X4YA 2QA4A 2FVUA 3VKIA 3WVEB 3V8JA 2YHTA 2OTLA 3X28B 2ZGWA 4BACA 3HRUA 2G3RA 4TVRA 2A3LA 1FX7A 2D0QB 4C0DB 2QQRA 2RM4A 3SWNC 3M59A 3HRTA 1YIJT 3PGGA 5DLQE 1WQWA 3FDRA 4NOYA 5GAN7 5A0LA 3KUFA 1BI2A 4RG8A 1H641 4A4EA 5CR2A 2EWNA 3OYLA 2R57A 3H6ZA 3JAME 1QVGA 3PT9A 1U1SA 1M1KC 3TCJA 2KQWA 2L89A 3OQ5A 4OB3B 4R56A 5HKCA 4RCBA 2RI5A 3GNGA 4FM4B 5LJ3g 4F7UG 3OW2A 4M7AA 2EQMA 3SFMA 4ATOA 1WPYA 1D3BB 4E7HA 2LNVA 4JRKA 2QDYB 3P8DA 3S3MA 5LJ5e 4MMLA 1VQ6T 2E65A 5C6SA 3QXEB 1YJNT 3OS5A 5J3BA 2KDSA 4Y28E 2VXEA 4XAXB 3ZEHA 3CEYA 4GLKA 3HFNA 4ME7A 3SWNB 4LD6A 3OYGA 3OA6A 2RD1A 1O9SA 2EQUA 5FU7C 2XD0A 2E12A 2H3JA 3MEWA 2QEXT 5FROA 5CIUA 5CO7A 3RKWA 2K2VA 2KK4A 4C8QE 5GAN2 4J5YA 2KAFA 3V7CA 4Q5WA 2XDBA 4OMFB 2CKKA 3HHTB 4QVCA 3CCVT 3OW2S 5HK0A 2CYZB 4B9WA 2B8AA 2O01E 3FIFA 3OS1A 4X34A 3QG1A 1NPRA 4OP0A 3QYHB 4L6V5 1VQ7T 5C0MA 5J26A 3RUXA 3G71T 3MCAB 1M1GA 4BDYA 2XU8A 3QIIA 3JCMV 3M5AA 3JCMX 2CZ0B 2HAXA 4NL3A 4BI3A 3L1AA 4N0AA 4M7AB 3OYMA 2DXBA 1Q81U 3VU3C 5A0DA 3JB9D 1LNXA 4M77E 3A8HB 4OB1B 5FU7B 3E9GA 3CMEA 4M7DE 1M5Q1 1NJIU 1N9RA 2XIDA 3WXMB 2K5IA 3CCST 2LDMA 5DLOA 2LCCA 4N0AC 5LJ3h 3GOXA 4MZPA 1UGSB 1M8VA 2O4XA 3MP8A 1XQHA 5LJ3f 4BE0A 2EAYA 4FT4A 2F5TX 2XHCA 2LT1A 5D6WA 4ZN3A 1BIAA 4HKEA 2BKDN 3M57A 1W2BA 4M75A 4ELZC 4BDZA 3RMSA 1H3ZA 4M7AG 2KVQG 4OVAA 4X9DA 2QI2A 1WJRA 3O8VA 3SD4A 3RKXA 4ZGDB 1LOJA 5IAYA 2OTLT 4JLGA 4EMKC 1V29B 2GF7A 2WSFE 2FL7A 5HK3A 5FU6C 3G4ST 4KBMB 1VQKA 1UB4A 4DA4A 4BUGA 4C0GA 3QSUA 3CC2A 4M75C 4EMHA 1B34A 3HFOA 2C06A 3EFSA 2LC4A 4J6XA 4M77F 4OB2B 1YJ9T 1N8RC 4J7IA 4M75D 3OS0A 2A7YA 4M7DF 3OBWA 1BI3A 3R6OA 3JCMe 2DTIA 1IZ6A 3P8BB 1JJ2S 1WQ7A 2DTOA 3LWIA 1HXDA 4ZN1A 2DK3A 4C0DC 1YHQT 2LCLA 1KQSS 4C92A 4UC4A 4D6WA 5GANg 5LJ5j 4XU2A 2EQKA 2F69A 5GAMh 5GAMd 1W2BS 3CMAA 3PMTA 2DKGA 4NS5A 5GAMf 1WNLA 3J81E 1S72A 1WJSA 4IUTA 3E9FA 3QZ9B 4KT0E 1YI2A 2O4XB 4LD9K 3JSCA 3GNFB 4XU0A 4YTLA 2PQWA 4J83A 4C92C 4EMKB 5GAOr 1KD1C 2JVVA 2EKOA 2PVGB 4C92D 2E1HA 1K9MU 1VQ8A 2MI6A 5FU6B 3VUBA 4Z02A 5DY9A 5GANe 4ZTFA 1VQLA 4M75B 1BKBA 3OYIA 3JCMP 1VQMA 2DTHA 4MDXA 1KD1U 2VXFA 3A5ZB 2OTJA 2JTFA 4XQ3A 1M90U 4J7FA 4JJNK 1YITA 4HCCA 1I4K1 3M56A 4JRIA 1M1KU 3JRZA 2E70A 1LJOA 2P0KA 3PNWC 3CCJT 4XTYA 4BI8B 4M78E 4F7UF 5KE3A 4A4GA 5LJ5g 1VQPA 4QW2A 4C92B 1JB0E 5LJ3j 1VQOT 4RKUE 3CC7T 3RESA 4A4KA 4JS5A 3JB9I 4M75G 3OYJA 4FT2A 5GMKj 3ASKA 1I5LA 1AHJB 3M58A 4XU1A 2RHXA 5CVIA 4L59A 1YJWT 3CC4T 3VV0A 3CMET 4A4FA 3S6WA 3VUZA 3OY9A 3CCEA 2E6NA 4DOVA 1Q7YC 3G6EA 1KC8C 2DD4A 4IKFA 3I56A 4M7AC 1VQNA 1DJ7B 4EMGA 3LX7A 3CD6A 4M7AD 2DVEA 4RG2A 1Y7XA 4N4GA 2KMTA 5L8RE 3N5BB 4OB0B 4C92G 2V8KA 3QBYA 4LDWA 2JN0A 3FEOA 2LQ8A 4Y91A 2XDPA 2DD5A 2JUFA 2ZPGB 2DO3A 3FJPA 3LYIA 3OMCA 4M78F 3M4GA 3PIPA 3HSBA 5CKBA 1UGPB 2LTOA 1VQ5A 1G5VA 4C5IA 3X24B 3C12A 1N6AA 2OAUA 3OBYA 2LVMA 2M16A 2FB7A 4BD3A 5GAMj 1VQ4T 1G3WA 3M9QA 4HA8A 4C8QC 2RJFA 2V8JA 3CC2T 3JB9J 2EJFA 3S3OA 4C8QD 1N9SA 4JLIA 4WF2A 2WSEE 4C0ZA 2CZ7B 3TEEA 5IN1A 3GPLA 4PJOE 3FC3A 4A4HA 5D6XA 3CCUT 2EJGA 3JB9H 4MZMA 3WVDB 3BW1A 4M77A 5LJ5h 5GAOn 5LJ5d 2K3XA 1JRIA 2BUDA 4M7DA 3CMAT 3CCMT 5LJ5f 3QKJA 1Q86U 2VV5A 2DXCA 2X35A 1YIJA 3M53A 1QVPA 2ZPHB 4NL2A 4EDUA 3OYDA 2LRQA 4JUVA 5LJ3d 2LQKA 5GAN8 4E7KA 4M77C 4XU3A 4LDXA 1JJ2A 5GMKh 2QQBA 4M77D 1VQ8T 3L2RA 4RMOA 4JS4A 2VC8A 1PSEA 1KQSA 1G3TA 3M54A 2XG8D 2LT4A 4QQ6A 4C8QB 1QVFS 3CBPA 5GAOl 3E19A 3MO8A 3JCMg 3CCQA 4X9CA 5CKFA 2JTMA 5AYFA 3VYHB 4A54A 2RH2A 1PSFA 3NTKA 2ZPBB 2QA4T 2R5MA 2RI2A 2EJ9A 3QUIA 1UGQB 4HCBA 3DB4A 3ER0A 4PJOF 3L2QA 2QQSA 1VQ6A 1X01A 5GMKi 3BFMA 3LW5E 5EG2A 5GAN4 4XTVA 1YITT 2WACA 2GFUA 3A8GB 3TREA 1YJNA 4PLLA 5GAN3 1K73C 3UDCA 2HD0A 2MWPA 3CCRA 4C8QA 1NJIC 3C95A 2DIQA 1VQPT 2XK0A 1I81A 2HNIA 2ZPEB 3QHSA 3QJ6A 5FLXE 3JB9F 1BI1A 2OTJT 3PMIA 1OZ3A 4M77B 1BYMA 4C8QG 1ZBXA 3JCMW 1K8AU 3HRSA 4QQDA 4CI0C 5I21A 4F7UE 2IG0A 2RHUA 2RJCA 3META 3CCVA 1NZ9A 1N27A 3V7SA 1JBMA 2RO0A 1BIBA 3HP9A 3J80E 1MGQA 1VQ7A 1VQ9A 1X6OA 3CCET 1M1FA 2JNGA 1FXXA 2XDDA 3G6ET 2CS7A 2ZPFB 3G71A 1UEBA 3PFSA 2R58A 4R55A 1U1TA 2MAMA 3CXCS 1QW1A 4XTXA 4OF1A 2QTXA 2V8IA 1VQNT 2PUOB 4C0FA 2EQJA 3RKYA 3CD6T 2IVWA 2Y4XA 2RHZA 4P5NA 4FU6A 3CPFA 3OYEA 1KG1A 3NTIA 5KE2A 3RERA 4M77G 2P0QA 2XICA 3FRNA 2K4YA 4M7DG 4ZGJB 5CK9A 4CRIA 3CCSA 4C5HA 3L2ZA 2QXFA 1M4ZA 1B34B 4N4IA 2QQ9A 2RJEA 4QVZA 5A2QE 2DIGA 3FB9A 2KY9A 3A8LB 2K3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R56 A;  3LWI A;  3KXT A;  2JTM A;  4R55 A;  3LWH A; 
#chains in the Genus database with same CATH topology
 4M78 A;  1D0Z A;  1NLO C;  3SEM A;  3D7S B;  5AT1 B;  2RI3 A;  4J9I A;  2DYB A;  1M2V B;  2HSP A;  3HKS A;  2K5F A;  2KGT A;  4XK8 E;  2DXT A;  2JS0 A;  3DB3 A;  1X69 A;  4M78 D;  2DPP B;  3L2W A;  2OTL Q;  5FWC A;  3OYB A;  4DBQ A;  3JCM c;  3S3N A;  1M90 C;  1TH7 A;  3H0H A;  1H92 A;  4HT8 A;  1GBR A;  5LL6 S;  4PJN A;  3A8O B;  1RUW A;  4HT9 A;  4FYY B;  5IHN A;  3THK A;  2XI9 A;  3QDR B;  2NLU A;  2GFA A;  4IUQ A;  2IIM A;  4PK4 A;  3L2U A;  3QWX X;  3CCR T;  2CP5 A;  1QCF A;  5LJ3 e;  1TWB A;  2L3R A;  5CQX A;  5GMK e;  1VQ5 T;  1VIF A;  2EVR A;  4HCZ A;  2C0T A;  3UT1 A;  2YUN A;  3OB9 A;  2E10 A;  2KRO A;  1S72 T;  3M4Y A;  2AZS A;  2M02 A;  2HKQ B;  3CCJ A;  3CPW P;  1YI2 T;  1TUG B;  4F17 A;  1VQ9 T;  4M7A F;  3REA B;  4AFU C;  3CC7 A;  1R8O B;  2A36 A;  1VQL T;  2G6F X;  1OQK A;  1GCP A;  2VYT A;  3CBO A;  2D0N A;  5HCK A;  3GIB A;  3C0C A;  2E6Z A;  5CQY A;  5CCA A;  5KCO A;  5GAM e;  1Y71 A;  1GBQ A;  3MEU A;  4MMK A;  3CXC A;  1Q81 C;  3CME Q;  4R0K A;  3RMQ A;  2NUT A;  1K0S A;  1I8F A;  2RPN A;  3QZ5 B;  2FZG B;  4BE2 A;  1Y96 A;  1ZQ1 A;  4EMK A;  1Q86 C;  2CZ1 B;  4M75 E;  1QLY A;  3DLM A;  2PVD B;  1RI0 A;  3OYH A;  1F1B B;  1VQ4 A;  2I2L A;  2P4T A;  3MEA A;  4J6W A;  5I2S A;  3EGD B;  3AT1 B;  4ZGE B;  3OYY A;  4RCC A;  3I55 T;  2XKO C;  2QQA A;  2R5A A;  4C92 E;  4E7I A;  3CCM A;  4KH0 B;  2PUK B;  3E1S A;  3CCL T;  2F1L A;  3JCM h;  1PKT A;  3JCM d;  3SDZ A;  1BBZ A;  3JCM f;  1X75 C;  1PG5 B;  3U23 A;  2CP7 A;  5KH6 A;  4E7L A;  1VQ8 Q;  2DNU A;  2X4Y A;  2FVU A;  3WVE B;  3V8J A;  3I35 A;  1ZSZ C;  4CC2 A;  1K73 R;  3RDV A;  4C0D B;  3VS6 A;  2W0Z A;  1I0C A;  4NOY A;  2L2P A;  4A4E A;  3OYL A;  5FWB A;  2R57 A;  3H6Z A;  1IB8 A;  1OX9 A;  1U1S A;  2KQW A;  3OQ5 A;  4OB3 B;  4R56 A;  2RI5 A;  1T0J A;  1AZE A;  1D3B B;  1ABO A;  1ZLM A;  2QDY B;  5LJ5 e;  2JT4 A;  5C6S A;  1ZSZ B;  3OS5 A;  5J3B A;  1QCN A;  4Y28 E;  2VXE A;  1MV3 A;  3ZEH A;  3HFN A;  4LD6 A;  2RD1 A;  2EQU A;  2QEX T;  1V1C A;  2K2V A;  4C8Q E;  2DE0 X;  1ZUU A;  4J5Y A;  3V7C A;  3HHT B;  3OW2 S;  3VRZ A;  2CYZ B;  2O01 E;  3FIF A;  3OS1 A;  2DVJ A;  1NPR A;  4ORZ A;  1VQ7 T;  1M1G A;  3JCM V;  2HQH A;  4J9D A;  3JCM X;  2CZ0 B;  2HKN A;  2RQW A;  2HAX A;  1CKB A;  4N0A A;  3OYM A;  5A0D A;  4FYW B;  4OB1 B;  1D1B A;  1Q7Y R;  1TUC A;  2XID A;  1NLP C;  3CCS T;  2LCC A;  3GOX A;  1YIJ Q;  2EAY A;  5IHI A;  2LT1 A;  4HCK A;  1IO6 A;  4X9D A;  3SD4 A;  5IAY A;  2OTL T;  4JLG A;  4EMK C;  1I07 A;  1V29 B;  2GF7 A;  4PJM A;  2CH4 A;  2WSF E;  4JZ3 A;  1PNJ A;  3RBB B;  3CCQ Q;  5FU6 C;  1UB4 A;  1H3H A;  2M51 A;  4DA4 A;  4DEX A;  2C06 A;  3HFO A;  3EFS A;  4J7I A;  2A7Y A;  2H3E B;  3NMZ C;  2DTI A;  3UF4 A;  2GTO A;  3CQT A;  1WQ7 A;  2DL3 A;  1R77 A;  1VQ5 A;  4D6W A;  2F69 A;  1WNL A;  1S72 A;  1WJS A;  2B86 A;  2ED0 A;  3MPU B;  1SHF A;  1YI2 A;  2O4X B;  4LD9 K;  4ESR A;  3GNF B;  4XU0 A;  1KD1 C;  2PQW A;  4EMK B;  2EKO A;  2E1H A;  5FU6 B;  1VQL A;  3G71 Q;  3H41 A;  1PD1 A;  3ULR B;  2DTH A;  4MDX A;  4RTT A;  4JZ4 A;  4Y92 A;  1YIT A;  1I4K 1;  3M0U A;  1ZBJ A;  1LJO A;  3PNW C;  3H0I A;  4A4G A;  2QYZ A;  4RKU E;  3JB9 I;  3OYJ A;  1LVK A;  4LNP A;  1I5L A;  4XU1 A;  4L59 A;  2OI3 A;  3CME T;  3PVL A;  1I5O B;  1VOM A;  2L3P A;  2DLP A;  3G6E A;  1OOT A;  2M0Y A;  1X6G A;  3G4S Q;  3LX7 A;  3CD6 A;  4M7A D;  2JJ9 A;  1YJ9 Q;  1Y7X A;  1HYO A;  2NUZ A;  4QT7 A;  2V1R A;  3QBY A;  3R6N A;  4LDW A;  4Y91 A;  3VKI A;  1Q82 U;  2DD5 A;  2ZPG B;  4M78 F;  3LYI A;  3A98 A;  3H9N A;  1G5V A;  4J9E A;  2FB7 A;  4HA8 A;  2RJF A;  2V8J A;  2CUB A;  1N9S A;  2WSE E;  5IN1 A;  4A4H A;  4J9F A;  5GJV B;  2AT1 B;  1JRI A;  4FW1 A;  2ROT A;  4EDU A;  2LRQ A;  1M90 R;  2LQK A;  5GAN 8;  4E7K A;  4M77 C;  3M0T A;  2LJ3 A;  3NHN A;  2DBM A;  2QQB A;  1VQ8 T;  4WCI A;  1PSE A;  2VC8 A;  2EYX A;  3E19 A;  1CSK A;  1VQO Q;  5AYF A;  2RH2 A;  1PSF A;  1WDX A;  2ZPB B;  3NTK A;  2QA4 T;  2E3H A;  1UGQ B;  3L2Q A;  2QQS A;  4XTV A;  3CC4 Q;  3TRE A;  3A8G B;  1K73 C;  4PLL A;  1KFZ A;  4GLM A;  2X51 A;  1NJI C;  2A0F B;  3JB9 F;  4M77 B;  1OZ3 A;  1BYM A;  1B3Q A;  1M2V A;  1AWJ A;  3JCM W;  1K8A U;  1SF9 A;  2IG0 A;  3MET A;  2FZC B;  3V7S A;  1JBM A;  2X3X D;  1MGQ A;  1VQ7 A;  1FXX A;  2CS7 A;  3PFS A;  2MAM A;  4OF1 A;  2O88 A;  2V8I A;  2MPX C;  1M3C A;  3RKY A;  1C6V X;  2Y4X A;  2K9G A;  1ABQ A;  4M77 G;  2XIC A;  4M7D G;  3CCU Q;  1VYV A;  1PM3 A;  1UHC A;  2DER A;  3CCS A;  2RJE A;  1RAG B;  3FB9 A;  4QKU A;  1Q86 R;  2M0O A;  1XNI A;  3SB2 A;  1AD5 A;  4PNO A;  3QYG B;  1VUB A;  3KBG A;  3HPW A;  2EPD A;  3E2U A;  4K11 A;  2F2W A;  2FYK A;  1KSW A;  4DQ2 A;  4O5V A;  3C94 A;  2M9U A;  1KHI A;  3H0F A;  4FIB A;  1QCO A;  1WXB A;  5DM7 R;  1TTH B;  3CCQ T;  4JRP A;  2PZ1 A;  4M7A E;  3LGL A;  3OYK A;  2L3Q A;  3F70 A;  4II1 A;  3TQ7 P;  4N4H A;  2GTJ A;  1VQK T;  4IUP A;  2M1H A;  4PJJ A;  2DZC A;  4E47 A;  1KQ1 A;  2DL5 A;  5GAO m;  2DXU A;  1YCY A;  3BDL A;  4C5E A;  5KYN A;  1JXO A;  1M8M A;  2D1X A;  2DIL A;  4OML A;  2MCN A;  2X4J A;  1M9S A;  4J9C A;  1AWO A;  3G7Z A;  1KQ2 A;  4PJO C;  1ZX6 A;  3V8L A;  2RHI A;  5GAN 6;  3ZFJ A;  4BY6 C;  5GAM g;  1EFN A;  1D0X A;  2DEQ A;  1AEY A;  2VGM A;  3JCM J;  1N8R U;  2VGN A;  9ATC B;  3OYC A;  2HBP A;  2PVO B;  4KUD K;  1KC8 R;  3Q1J A;  2OTJ T;  1RAI B;  2I0N A;  4FCY A;  3FLG A;  1HD3 A;  3PTA A;  1WZO A;  2KBT A;  2MF2 A;  1EIF A;  4J8O A;  4PJO B;  1W70 A;  3CBM A;  5GAN j;  4BY6 B;  1QVF P;  2YLC A;  4J6Y A;  3T9N A;  3I9Q A;  3MP6 A;  2J6O A;  4RTX A;  2JZ2 A;  4GBQ A;  2GQI A;  1VIE A;  4IUU A;  2HZY A;  1GXI E;  3GLX A;  5GMK l;  1HSQ A;  3I56 T;  2EYZ A;  3REB B;  4PJO G;  3CC2 Q;  2E41 A;  4O6J A;  1RAH B;  4QQG A;  4JRQ A;  3L42 A;  3HL8 A;  4C5G A;  1O75 A;  2KSS A;  3ME9 A;  2AHJ B;  3GP8 A;  4LDV A;  1D3B A;  2JM9 A;  1RL2 A;  5HY6 A;  1YWP A;  5FRM A;  2K6D A;  4AMC A;  1KJW A;  1ZSZ A;  4L5G A;  3RIR A;  4XTZ A;  4FSX A;  1WJQ A;  4KUI A;  4AT1 B;  1SPK A;  1WGS A;  3EAE A;  4F7U B;  2QA4 A;  2ZGW A;  3HRU A;  2G3R A;  2A3L A;  1KIK A;  1VQM Q;  1B07 A;  2QGG A;  2RQR A;  1WQW A;  1RLP C;  1WLP B;  4KGX B;  3JAM E;  3VS3 A;  1Z9Q A;  1VQP Q;  2L89 A;  4HVV A;  5HKC A;  2CP2 A;  4F7U G;  3M0R A;  1G2B A;  4ATO A;  1SSH A;  1WPY A;  1TG0 A;  1WYX A;  1KD1 R;  1T3S A;  3P8D A;  3S3M A;  1VQ6 T;  1QMC A;  2J7I A;  2LCS A;  3QXE B;  4RTW A;  1ZSG A;  4XAX B;  3CEY A;  4F04 B;  2AKL A;  4DEY A;  5FU7 C;  2E12 A;  3MEW A;  1VQN Q;  2CSQ A;  2SRC A;  4Q5W A;  4RUG A;  1OPL A;  4OMF B;  2CKK A;  1M27 C;  5HK0 A;  4J9G A;  2B8A A;  2RF0 A;  4PFO A;  2CT4 A;  2E4H A;  1U06 A;  4WTO B;  1Q81 U;  1QVG P;  1U5S A;  3JB9 D;  5IXB A;  3A8H B;  5FU7 B;  2YUO A;  1N9R A;  3WXM B;  3OW2 P;  1B7T A;  5LJ3 h;  2QGF B;  2FPD A;  1M8V A;  1JEG A;  2O4X A;  1WHM A;  5LJ3 f;  4E2F B;  4BE0 A;  2J6F A;  2F5T X;  2JM8 A;  4FT4 A;  1MUZ A;  2EW3 A;  1BIA A;  1UG1 A;  2BTT A;  1N5Z A;  4HKE A;  2BKD N;  1W2B A;  3M0S A;  2CDT A;  4BDZ A;  4Z89 A;  2QI2 A;  3O8V A;  3HTR A;  3RKX A;  2FL7 A;  1VQK A;  4BUG A;  4C0G A;  2C0I A;  4M75 C;  4J6X A;  3OS0 A;  1YJN Q;  3OBW A;  3JCM e;  4J9H A;  3P8B B;  2QAS A;  2EGA A;  1AWW A;  1JJ2 S;  1TOV A;  2LNH B;  4C0D C;  1YHQ T;  2LCL A;  1KQS S;  4UC4 A;  5GAM h;  3ZL7 C;  5GAM d;  1UE9 A;  3CMA A;  3PMT A;  4NS5 A;  1QWE A;  5GAM f;  4IUT A;  4AG2 C;  3CCV Q;  2QAZ A;  4C92 C;  4IIO A;  1E6G A;  1K9M U;  2RNA A;  4JPB W;  3VUB A;  4Z02 A;  5GAN e;  2KRM A;  4M75 B;  2QK0 A;  2VWF A;  2DRK A;  1UJ0 A;  2VAS A;  3A5Z B;  1YWO A;  2OTJ A;  4J7F A;  4JJN K;  1J3T A;  2O9S A;  4HCC A;  2EGE A;  3M56 A;  2J06 A;  3JRZ A;  2E70 A;  1NJI R;  2P0K A;  4XTY A;  4BI8 B;  2F2V A;  4M78 E;  4F7U F;  4C92 B;  1JB0 E;  1YP5 A;  4IIM A;  3RES A;  4JS5 A;  1T0H A;  4M75 G;  5IXF A;  4LN2 A;  2D8J A;  1AHJ B;  1YJW T;  5CVI A;  4A4F A;  3VUZ A;  3CCE A;  4DOV A;  3QDF A;  1KC8 C;  2DD4 A;  4IKF A;  1FMK A;  3I56 A;  3QWY A;  1DJ7 B;  4N4G A;  2KMT A;  3N5B B;  4OB0 B;  4C92 G;  2V8K A;  3EG9 B;  2JN0 A;  2JUF A;  3OMC A;  2DO3 A;  3M4G A;  3HSB A;  2LTO A;  3KFV A;  3OBY A;  2X9H A;  1BCO A;  3M9Q A;  2EYY A;  4C8Q C;  3CC2 T;  3S3O A;  4JLI A;  4CC3 A;  4C0Z A;  2CZ7 B;  2YSQ A;  3FC3 A;  1PRL C;  5D6X A;  2EJG A;  5KYY B;  3BW1 A;  1WFW A;  4M77 A;  5LJ5 h;  5GAO n;  5LJ5 d;  4M7D A;  1S1N A;  1WXU A;  5LJ5 f;  2VV5 A;  1WHL A;  3M53 A;  5EC7 A;  3OYD A;  1TSF A;  1FYN A;  1JJ2 A;  3CCJ Q;  4M77 D;  1M1K R;  4JS4 A;  4RMO A;  5I22 A;  1KQS A;  4QQ6 A;  4C8Q B;  2LJ1 A;  2K2M A;  3MO8 A;  1I1J A;  1PRM C;  5CKF A;  3CC7 Q;  1WHJ A;  4A54 A;  2R5M A;  4HCB A;  1VQ6 A;  1X01 A;  2GBQ A;  5GMK i;  3LW5 E;  5GAN 4;  2CP0 A;  1U8R A;  4OMP A;  2HD0 A;  2MWP A;  3CCR A;  2AIR B;  1VQP T;  2HNI A;  2HL3 A;  3QHS A;  3QJ6 A;  4C8Q G;  1ZBX A;  4CI0 C;  5I21 A;  2RJC A;  2ENM A;  1D1A A;  3TSW A;  2YXY A;  3J80 E;  1VQ9 A;  2JNG A;  2ZPF B;  1UEB A;  4R55 A;  1VQ4 Q;  1VQN T;  2C0O A;  2LP5 A;  1NEB A;  2BE9 B;  4C0F A;  2IVW A;  2RHZ A;  1KK7 A;  2JS2 A;  2NUP B;  4FU6 A;  3FRN A;  4CRI A;  4C5H A;  2V26 A;  1Y57 A;  2QQ9 A;  3CCM Q;  3MKD A;  2DIG A;  2RMO A;  1YBY A;  4JJC A;  3OYN A;  1G8X A;  5D7U A;  3QO3 A;  5CKD A;  4AFS C;  5A0G A;  2D8H A;  3UPU A;  3AHU A;  1ACM B;  2LX9 A;  2V1Q A;  3OSV A;  4V2S A;  3OYA A;  1KHC A;  2KRS A;  3VS5 A;  5CAI A;  3CPW A;  1Y07 A;  2K57 A;  1SSF A;  2DAQ A;  3LGF A;  4C92 F;  2X4W A;  2Y90 A;  1NPP A;  3I55 A;  5D6Y A;  3NFC A;  1WIE A;  1YHQ A;  3QJY A;  4LDY A;  2ABL A;  1G83 A;  4A63 B;  3CCL A;  2L0A A;  2MWO A;  1E7O A;  5J39 A;  2EKH A;  2ED1 A;  3O5Z A;  2KXD A;  5CKH A;  1OEB A;  5KYW B;  2EIF A;  2LX7 A;  4PJO A;  2XMF A;  1PWT A;  5IHK A;  2LZ6 B;  2VUB A;  3A1P A;  3GBQ A;  2JOY A;  3P8H A;  3BY7 A;  4RTV A;  2O9V A;  1CKA A;  2LQW A;  2CZ6 B;  2EFI A;  4KUL A;  3M0P A;  3MEV A;  2GQV A;  4PKC C;  4PJO D;  1Q82 C;  4VUB A;  3OMG A;  4M7D C;  1M30 A;  3M55 A;  2OAW A;  4IUR A;  2ESW A;  3UWN A;  2PTK A;  4CC4 B;  1K73 U;  1IGQ A;  4QVD A;  1YJW A;  1AOJ A;  1A0N B;  4JDS A;  1SRM A;  2YRV A;  5GMK m;  3ZBD A;  3EFR A;  2XDB A;  4C8Q F;  3VYG A;  1C1A A;  3EFO B;  1UGR B;  2QEX A;  2RB6 A;  1ZHI A;  4RTY A;  4E6R A;  4D8K A;  4M7D B;  3LH5 A;  5M9O A;  2L8D A;  2YUQ A;  1BI0 A;  3NGP A;  1OZ2 A;  4LDU A;  4F7U A;  4FL6 A;  2JW4 A;  1UUE A;  1OPK A;  5FW9 A;  2FO0 A;  1QP3 A;  2KEA A;  4ZNX A;  4ZTJ A;  1HJD A;  2COW A;  1OI1 A;  2EQI A;  4PLI A;  1X6B A;  4JJB A;  2Y4Y A;  1XTD A;  2P4R A;  1EX4 A;  2HMA A;  2PU9 B;  2BIV A;  4OMM A;  1VQ5 Q;  3TSZ A;  1TXQ A;  3MP1 A;  2LQN A;  4D8D A;  4XTW A;  5FRN A;  5IT9 E;  1S72 Q;  1K8A C;  3GF5 A;  2RQV A;  3CXC P;  2EYQ A;  1AT1 B;  1OUL A;  1YI2 Q;  3LLR A;  1OYX A;  1MNE A;  1G3S A;  1BCM A;  1Q7Y U;  1VQL Q;  2OTL A;  4BAC A;  4Z88 A;  2D0Q B;  4E7S A;  2HDA A;  2QQR A;  2RM4 A;  3SWN C;  2KYB A;  1YIJ T;  5DLQ E;  3KUF A;  1YIT Q;  1BI2 A;  4RG8 A;  1H64 1;  5CR2 A;  2EWN A;  3PT9 A;  1M1K C;  3TCJ A;  5LJ3 g;  4FM4 B;  1WHK A;  2COY A;  7AT1 B;  1QKW A;  4M4Z A;  2O2O A;  2DL4 A;  4MML A;  2E65 A;  4GLK A;  3SWN B;  3G6E Q;  1EZZ B;  3OYG A;  3OA6 A;  3PE0 A;  4J9B A;  5CIU A;  2KRN A;  2EYW A;  2KK4 A;  3CD6 Q;  2KAF A;  1OX8 A;  1WI7 A;  1ARK A;  4QVC A;  4B9W A;  4FYX B;  2MK5 A;  4X34 A;  3CCL Q;  3QYH B;  1NBE B;  5C0M A;  5GJW B;  2BZY A;  3EG1 A;  3G71 T;  4EIK A;  3QII A;  3M5A A;  2FG0 A;  2GGR A;  4BI3 A;  1RLQ C;  4M7A B;  1LCK A;  1RAB B;  3E9G A;  3CME A;  1M5Q 1;  2AK5 A;  2P84 A;  4Z8A A;  1AVZ C;  3I5S A;  1ZA1 B;  2LDM A;  2DM1 A;  5DLO A;  4MZP A;  1UDL A;  1XQH A;  2CRE A;  2XHC A;  2MYS A;  1OU8 A;  4KGV B;  2FEI A;  4M75 A;  3RMS A;  1H3Z A;  4LXC A;  4M7A G;  2KVQ G;  2KR3 A;  4OVA A;  4ZGD B;  1PC0 A;  2DRM A;  2KXC A;  3G4S T;  1VA7 A;  3QSU A;  4EMH A;  2E3I A;  2LC4 A;  4M77 F;  4OB2 B;  1YJ9 T;  1N8R C;  4M75 D;  4M7D F;  2BZ8 A;  2DTO A;  3LWI A;  4ZN1 A;  4C92 A;  5GAN g;  2EQK A;  1W2B S;  1IGU A;  3E9F A;  4KT0 E;  4DBF A;  4YTL A;  1K4U S;  5GAO r;  5KYU A;  2FPE A;  2PVG B;  2BE7 D;  4C92 D;  1VQ8 A;  2MI6 A;  1VQ7 Q;  4ZTF A;  1BKB A;  1TU0 B;  3OYI A;  3UA6 A;  3EG9 A;  2JTF A;  4XQ3 A;  1M90 U;  5L23 A;  1BK2 A;  4JRI A;  2A28 A;  3CCS Q;  5LJ5 g;  4QW2 A;  1X43 A;  1VQO T;  2YDL A;  1JXM A;  3ASK A;  1GCQ A;  5KYY A;  1W1F A;  3CC4 T;  3VV0 A;  2COZ A;  3S6W A;  2CUD A;  2E6N A;  1ZA2 B;  4EMG A;  2DVE A;  4RG2 A;  1PHT A;  3FEO A;  4C8Q A;  2XDP A;  3FJP A;  2DX1 A;  3MJX A;  1SEM A;  3C12 A;  3X24 B;  1N6A A;  2A08 A;  4AFQ C;  4BD3 A;  2DFU A;  1IHV A;  2DJQ A;  2CSI A;  2E5K A;  4C8Q D;  3NPF A;  4WF2 A;  4HVU A;  3GPL A;  3TEE A;  1MMA A;  2CT3 A;  2DET A;  3CCU T;  3JB9 H;  1SHG A;  2K3X A;  2BUD A;  3QKJ A;  1Q86 U;  3RNJ A;  2DA9 A;  2DXC A;  1YIJ A;  1QVP A;  2ZPH B;  5LJ3 d;  2ZAE A;  1ZUY A;  5GMK h;  4B6M A;  1G3T A;  3M54 A;  2XG8 D;  2LT4 A;  1QVF S;  3CBP A;  5GAO l;  3CCQ A;  2K79 A;  2JTM A;  2NUP A;  1OV3 A;  4DBR A;  1E6H A;  2LJ0 A;  2RI2 A;  1RAA B;  4PJO F;  3BFM A;  1YIT T;  3TVT A;  2WAC A;  2GFU A;  3UDC A;  3C95 A;  2ZPE B;  1BI1 A;  1UEC A;  2QTV A;  2K7A A;  4QQD A;  1TS9 A;  2RHU A;  2HEQ A;  1NZ9 A;  2RO0 A;  1Q82 R;  2K3B A;  1M1F A;  2XDD A;  3G6E T;  1AZG B;  3G71 A;  1U1T A;  1QW1 A;  2JMA A;  4CC7 A;  4KGZ B;  2PUO B;  2DEU A;  1VYT A;  3CD6 T;  1SRL A;  3CPF A;  3OYE A;  3NTI A;  5KE2 A;  3RER A;  1Z9Z A;  2FPF A;  2P0Q A;  2K4Y A;  4ZGJ B;  5CK9 A;  1K9A A;  3L2Z A;  3EG3 A;  4N4I A;  2J6K A;  5A2Q E;  4FW2 A;  2K3Y A;  3BDU A;  2DF6 A;  2JXB A;  3DLL A;  4B9X A;  2DJZ A;  5I11 A;  5KYW A;  2ZCF B;  1NYF A;  1KC8 U;  2CGH A;  5ECA A;  4MDW A;  2ZZD A;  4M78 C;  1K9M C;  5I2M A;  5KCH A;  2VB6 A;  2RA2 A;  3G4S A;  4A53 A;  3V8K A;  2QA4 Q;  3TU4 K;  2FRY A;  2YWW A;  5GAN h;  5KYU B;  5GAN d;  1YJ9 A;  1LPL A;  3LH0 A;  5GAN f;  3H8Z A;  1D0Y A;  3LWH A;  3DKM A;  4GY5 A;  1GCQ C;  1HK9 A;  4DOW A;  1YN8 A;  1YFN A;  3NTH A;  2YUP A;  3FJ5 A;  3KXT A;  4RTZ A;  3VS0 A;  3OYF A;  1QP2 A;  4HXJ A;  3C4S A;  4BI4 A;  2F5K A;  2E64 A;  1X2K A;  1V76 A;  4XTU A;  1MND A;  1M3A A;  1NE8 A;  1P92 A;  3EGX B;  3INZ A;  2D9T A;  1K8A R;  4OMO A;  3EG2 A;  2K5L A;  4M78 B;  3CPW S;  1IRE B;  3J7A F;  1K76 A;  2RK1 A;  1QVF A;  2ZPI B;  3EFO A;  1QQJ A;  3VJP A;  1WHG A;  5GAO q;  2E5Q A;  1QVG S;  3JCM b;  3SHW A;  2RHY A;  5CKE A;  1IRX A;  1MMN A;  1XOV A;  5GAO p;  1W4S A;  1JO8 A;  4BE1 A;  6AT1 B;  3A8M B;  3UA7 A;  4BB7 A;  4M78 G;  4KH1 B;  1U3O A;  1ZUK A;  2GCX A;  5GAN 5;  1K0X A;  1VQO A;  4M7D D;  4X1V A;  2FHD A;  3OS2 A;  2HSE B;  1UFF A;  2CP3 A;  2YLB A;  1VQM T;  2P0P A;  4F16 A;  3L2V A;  3CC4 A;  1AWX A;  2AZV A;  2L5Q A;  4LE9 A;  4PL6 A;  1MHN A;  4EPC A;  3V7R A;  1UJY A;  1TUD A;  2RK2 A;  2HQX A;  2KNB B;  2HBW A;  1KD1 U;  2WSC E;  4HVW A;  3JCM Q;  1FWZ A;  1MV0 B;  4OGE A;  4ELY C;  3QPH A;  4MZT A;  2DL8 A;  4PFP A;  4E7J A;  3X20 B;  3MHX A;  1VQK Q;  3OSS C;  2RJD A;  3CCU A;  2MMP A;  4FYV B;  2HQE A;  2X4X A;  3X26 B;  2DMO A;  3X25 B;  4OGC A;  1JQQ A;  2IPO B;  3URG A;  3JB9 G;  2NUT B;  3CMA Q;  4M75 F;  1Y96 B;  5KYX A;  2CP6 A;  3PIO A;  8ATC B;  1OU9 A;  1Y0M A;  2X3W D;  2NWM A;  4IUV A;  3SWN A;  2DZ9 A;  1G3Y A;  2VVK A;  2YHT A;  3X28 B;  2O31 A;  4TVR A;  4OMQ A;  1FX7 A;  3M59 A;  3HRT A;  1YNZ A;  1N8R R;  3PGG A;  3FDR A;  5GAN 7;  2OTJ Q;  5A0L A;  1XJW B;  3VS1 A;  2PNI A;  1QVG A;  4JJD A;  1GFD A;  1GL5 A;  2MIO A;  4RCB A;  2BZX A;  3GNG A;  3OW2 A;  4M7A A;  2EQM A;  3SFM A;  3RR6 A;  8AT1 B;  4E7H A;  2LNV A;  4JRK A;  2QDL A;  1GFC A;  1YJN T;  4FSS A;  2KDS A;  3CCE Q;  4ME7 A;  2DL7 A;  1O9S A;  2XD0 A;  1WA7 A;  2SEM A;  3I56 Q;  2H3J A;  5FRO A;  5CO7 A;  3RKW A;  3EH2 A;  5GAN 2;  2H8H A;  1Q95 G;  1W6X A;  3CCV T;  1RAE B;  3QG1 A;  4OP0 A;  4L6V 5;  5J26 A;  3RUX A;  1NG2 A;  4PJL A;  3MCA B;  3VS2 A;  4BDY A;  2XU8 A;  1X2Q A;  4NL3 A;  1GRI A;  3L1A A;  2HL5 C;  4PFZ A;  2DXB A;  3VU3 C;  1QWF A;  1LNX A;  2YRD A;  4M77 E;  4M7D E;  1NJI U;  1NEG A;  2K5I A;  2KI7 A;  3VS7 A;  4LUE A;  4N0A C;  1UGS B;  3EG0 A;  3MP8 A;  2AKK A;  5D6W A;  4ZN3 A;  2J05 A;  2LMJ A;  3M57 A;  4ELZ C;  1WJR A;  1LOJ A;  3UAT A;  2KT8 A;  5HK3 A;  1RAF B;  4KBM B;  2JMC A;  1JU5 C;  2VKN A;  3CC2 A;  1B34 A;  1UGV A;  1YCS B;  1VQ6 Q;  1UTI A;  1IXD A;  1H8K A;  1BI3 A;  3R6O A;  1RAC B;  2OX7 A;  1IZ6 A;  1R0B G;  2L3S A;  1MMD A;  1HXD A;  3CCR Q;  2DK3 A;  2D6F A;  1QKX A;  2KE9 A;  4XU2 A;  2DKG A;  1M3B A;  3J81 E;  1FMW A;  3QZ9 B;  2NYS A;  3JSC A;  4J83 A;  1R0C B;  1NYG A;  2JVV A;  1VQ9 Q;  3IQL A;  5DY9 A;  1WHH A;  2KYM A;  1BU1 A;  1C0M A;  3JCM P;  1VQM A;  1IHW A;  1W2B P;  2YRC A;  2KT1 A;  2VXF A;  1Q81 R;  2A37 A;  1D1C A;  1M1K U;  1WX6 A;  3CCJ T;  5KE3 A;  1PD0 A;  1VQP A;  5LJ3 j;  3CC7 T;  4A4K A;  2YT6 A;  1NM7 A;  3PVQ A;  4FT2 A;  3I5R A;  2EGC A;  1D09 B;  5GMK j;  3M58 A;  2RHX A;  2RQU A;  1PKS A;  2JTE A;  4LUD A;  3OY9 A;  1Q7Y C;  4AG1 C;  2Z0W A;  4F14 A;  5KYX B;  1RAD B;  4M7A C;  1VQN A;  3VS4 A;  1RI9 A;  5L8R E;  3JV3 A;  3BE3 A;  2GNC A;  1SG5 A;  2LQ8 A;  3I55 Q;  3PIP A;  2ROL A;  2FZK B;  1YHQ Q;  2W10 A;  5CKB A;  1SKU B;  1UGP B;  2RN8 A;  1VYU A;  4C5I A;  2F2X A;  2OAU A;  2LVM A;  2M16 A;  4ANJ A;  5GAM j;  1VQ4 T;  1G3W A;  3M0Q A;  3EGU A;  1T3L A;  3JB9 J;  2EJF A;  1FMV A;  2EBP A;  2DBK A;  4PJO E;  4OMN A;  2ATC B;  1K9M R;  4MZM A;  3WVD B;  3CMA T;  3CCM T;  2X35 A;  4NL2 A;  1UHF A;  4JUV A;  3VRY A;  4XU3 A;  4LDX A;  4E7Z A;  3EGD A;  2RQT A;  3L2R A;  1X27 A;  1BB9 A;  2FRW A;  3JCM g;  4X9C A;  3VYH B;  3EH1 A;  2EJ9 A;  3QUI A;  3DB4 A;  3ER0 A;  2QG9 B;  1YJW Q;  5EG2 A;  1YJN A;  4RTU A;  5GAN 3;  3EHR A;  2DIQ A;  2XK0 A;  1I81 A;  5FLX E;  5IH2 A;  3PMI A;  2OJ2 A;  1M2O A;  3HRS A;  2QEX Q;  4F7U E;  3CCV A;  3G1J A;  1N27 A;  3EHQ A;  1BIB A;  3HP9 A;  2MOX A;  1X6O A;  3CCE T;  2ECZ A;  2CH4 W;  2R58 A;  3CXC S;  1K1Z A;  4AFZ C;  4XTX A;  2QTX A;  4DBH A;  1PCX A;  2EQJ A;  2HCK A;  2DYI A;  1JJ2 P;  4P5N A;  1KG1 A;  1KQS P;  1MMG A;  2QXF A;  1M4Z A;  1B34 B;  4QVZ A;  1WXT A;  3EGX A;  5LJ5 j;  2KY9 A;  3A8L B;  4KRT A; 
#chains in the Genus database with same CATH homology
 3BDU A;  1YBY A;  2M0O A;  1XNI A;  3SB2 A;  4M78 A;  3OYN A;  3DLL A;  4B9X A;  2D6F A;  3QO3 A;  2RI3 A;  2DJZ A;  5CKD A;  4PNO A;  5A0G A;  3UPU A;  3AHU A;  2ZCF B;  2LX9 A;  3HKS A;  1KC8 U;  3QYG B;  2K5F A;  2CGH A;  3OSV A;  1VUB A;  4MDW A;  3KBG A;  4V2S A;  3HPW A;  4XK8 E;  2ZZD A;  3OYA A;  4M78 C;  2DXT A;  5I2M A;  1K9M C;  5KCH A;  1KHC A;  5CAI A;  2RA2 A;  3DB3 A;  4M78 D;  3CPW A;  1Y07 A;  2FYK A;  3G4S A;  2DPP B;  2K57 A;  3V8K A;  4A53 A;  3TU4 K;  1SSF A;  3L2W A;  2DAQ A;  3LGF A;  5GAN h;  4C92 F;  4DQ2 A;  5GAN d;  4O5V A;  1YJ9 A;  2X4W A;  3OYB A;  3C94 A;  2M9U A;  5GAN f;  3LH0 A;  3H8Z A;  1KHI A;  2Y90 A;  3DKM A;  3LWH A;  4GY5 A;  1HK9 A;  4FIB A;  3JCM c;  4DOW A;  3S3N A;  1NPP A;  1TH7 A;  3I55 A;  1M90 C;  3NTH A;  5D6Y A;  3NFC A;  4HT8 A;  1YHQ A;  5DM7 R;  3KXT A;  3OYF A;  1QP2 A;  3C4S A;  3QJY A;  4LDY A;  4BI4 A;  5LL6 S;  3A8O B;  3CCQ T;  2F5K A;  4JRP A;  4M7A E;  3LGL A;  3OYK A;  2E64 A;  3CCL A;  4XTU A;  1NE8 A;  1P92 A;  2MWO A;  3F70 A;  4II1 A;  3INZ A;  4N4H A;  2D9T A;  4HT9 A;  5J39 A;  2XI9 A;  2K5L A;  4M78 B;  3CPW S;  1VQK T;  3QDR B;  1IRE B;  2NLU A;  3J7A F;  2GFA A;  2M1H A;  4IUP A;  4IUQ A;  2DZC A;  4E47 A;  1KQ1 A;  5CKH A;  2RK1 A;  1QVF A;  5GAO m;  3L2U A;  3CCR T;  2ZPI B;  2EIF A;  5LJ3 e;  2DXU A;  3VJP A;  4PJO A;  1U8R A;  2L3R A;  5GAO q;  2E5Q A;  2VUB A;  1QVG S;  3P8H A;  2JOY A;  5CQX A;  3JCM b;  1YCY A;  2RHY A;  5GMK e;  1VIF A;  3BDL A;  3BY7 A;  5CKE A;  4C5E A;  4HCZ A;  1VQ5 T;  1XOV A;  3UT1 A;  5GAO p;  1W4S A;  2CZ6 B;  3OB9 A;  2E10 A;  2EFI A;  1M9S A;  2X4J A;  4KUL A;  3G7Z A;  1S72 T;  1KQ2 A;  4PJO C;  3MEV A;  3M4Y A;  2RHI A;  2GQV A;  3V8L A;  4BE1 A;  3CCJ A;  3A8M B;  4PKC C;  1YI2 T;  4PJO D;  5GAN 6;  1VQ9 T;  3ZFJ A;  4VUB A;  4BB7 A;  4M78 G;  4BY6 C;  1Q82 C;  4M7A F;  5GAM g;  3OMG A;  2GCX A;  4M7D C;  5GAN 5;  2DEQ A;  3M55 A;  1VQO A;  3CC7 A;  4M7D D;  1R8O B;  4IUR A;  3UWN A;  2VGM A;  1VQL T;  2FHD A;  3OS2 A;  1K73 U;  2VYT A;  2YLB A;  3CBO A;  4QVD A;  1VQM T;  3JCM J;  2P0P A;  1YJW A;  1N8R U;  3L2V A;  3CC4 A;  2VGN A;  4JDS A;  3OYC A;  3GIB A;  2HBP A;  2PVO B;  4KUD K;  2L5Q A;  2E6Z A;  2YRV A;  3Q1J A;  5CQY A;  5CCA A;  5KCO A;  5GMK m;  3ZBD A;  1Y71 A;  3EFR A;  3MEU A;  4MMK A;  4PL6 A;  3FLG A;  5GAM e;  1MHN A;  3CXC A;  1Q81 C;  4EPC A;  4C8Q F;  3PTA A;  3RMQ A;  2MF2 A;  3VYG A;  1I8F A;  3QZ5 B;  3V7R A;  1EIF A;  4BE2 A;  4J8O A;  1Y96 A;  4PJO B;  1UGR B;  1ZQ1 A;  2RK2 A;  4EMK A;  1Q82 U;  1Q86 C;  3CBM A;  2RB6 A;  2HQX A;  1ZHI A;  2QEX A;  5GAN j;  4BY6 B;  2YLC A;  4J6Y A;  2CZ1 B;  4M75 E;  3T9N A;  4M7D B;  3MP6 A;  3DLM A;  2WSC E;  2L8D A;  2PVD B;  1BI0 A;  1RI0 A;  1OZ2 A;  4LDU A;  5M9O A;  3JCM Q;  4F7U A;  1FWZ A;  2JZ2 A;  4FL6 A;  3OYH A;  1VIE A;  4OGE A;  2I2L A;  1VQ4 A;  4ELY C;  1QP3 A;  2P4T A;  4IUU A;  4ZTJ A;  3MEA A;  3QPH A;  4J6W A;  4MZT A;  3GLX A;  5I2S A;  1GXI E;  5GMK l;  1OI1 A;  4E7J A;  3X20 B;  4ZGE B;  3I56 T;  3MHX A;  3OSS C;  3OYY A;  4PJO G;  2RJD A;  2E41 A;  4O6J A;  4PLI A;  4RCC A;  3I55 T;  3CCU A;  2XKO C;  2QQA A;  2MMP A;  2HQE A;  2R5A A;  4QQG A;  3L42 A;  2Y4Y A;  3HL8 A;  4C92 E;  4JRQ A;  1XTD A;  2X4X A;  4E7I A;  3X26 B;  3CCM A;  2PUK B;  4C5G A;  2PU9 B;  3E1S A;  2BIV A;  1O75 A;  3X25 B;  2KSS A;  4OGC A;  3URG A;  3CCL T;  3ME9 A;  2AHJ B;  3GP8 A;  3JB9 G;  3MP1 A;  4LDV A;  1D3B A;  4XTW A;  5FRN A;  1RL2 A;  3JCM h;  4M75 F;  5IT9 E;  5HY6 A;  3JCM d;  5FRM A;  1Y96 B;  3SDZ A;  3GF5 A;  1K8A C;  3JCM f;  2EYQ A;  1X75 C;  3PIO A;  4L5G A;  3RIR A;  4XTZ A;  3LLR A;  4FSX A;  1OYX A;  1G3S A;  1WJQ A;  4IUV A;  3SWN A;  5KH6 A;  4E7L A;  4KUI A;  1Q7Y U;  2DZ9 A;  1G3Y A;  1WGS A;  3EAE A;  4F7U B;  2X4Y A;  2QA4 A;  2FVU A;  3VKI A;  3WVE B;  3V8J A;  2YHT A;  2OTL A;  3X28 B;  2ZGW A;  4BAC A;  3HRU A;  2G3R A;  4TVR A;  2A3L A;  1FX7 A;  2D0Q B;  4C0D B;  2QQR A;  2RM4 A;  3SWN C;  3M59 A;  3HRT A;  1YIJ T;  3PGG A;  5DLQ E;  1WQW A;  3FDR A;  4NOY A;  5GAN 7;  5A0L A;  3KUF A;  1BI2 A;  4RG8 A;  1H64 1;  4A4E A;  5CR2 A;  2EWN A;  3OYL A;  2R57 A;  3H6Z A;  3JAM E;  1QVG A;  3PT9 A;  1U1S A;  1M1K C;  3TCJ A;  2KQW A;  2L89 A;  3OQ5 A;  4OB3 B;  4R56 A;  5HKC A;  4RCB A;  2RI5 A;  3GNG A;  4FM4 B;  5LJ3 g;  4F7U G;  3OW2 A;  4M7A A;  2EQM A;  3SFM A;  4ATO A;  1WPY A;  1D3B B;  4E7H A;  2LNV A;  4JRK A;  2QDY B;  3P8D A;  3S3M A;  5LJ5 e;  4MML A;  1VQ6 T;  2E65 A;  5C6S A;  3QXE B;  1YJN T;  3OS5 A;  5J3B A;  2KDS A;  4Y28 E;  2VXE A;  4XAX B;  3ZEH A;  3CEY A;  4GLK A;  3HFN A;  4ME7 A;  3SWN B;  4LD6 A;  3OYG A;  3OA6 A;  2RD1 A;  1O9S A;  2EQU A;  5FU7 C;  2XD0 A;  2E12 A;  2H3J A;  3MEW A;  2QEX T;  5FRO A;  5CIU A;  5CO7 A;  3RKW A;  2K2V A;  2KK4 A;  4C8Q E;  5GAN 2;  4J5Y A;  2KAF A;  3V7C A;  4Q5W A;  2XDB A;  4OMF B;  2CKK A;  3HHT B;  4QVC A;  3CCV T;  3OW2 S;  5HK0 A;  2CYZ B;  4B9W A;  2B8A A;  2O01 E;  3FIF A;  3OS1 A;  4X34 A;  3QG1 A;  1NPR A;  4OP0 A;  3QYH B;  4L6V 5;  1VQ7 T;  5C0M A;  5J26 A;  3RUX A;  3G71 T;  3MCA B;  1M1G A;  4BDY A;  2XU8 A;  3QII A;  3JCM V;  3M5A A;  3JCM X;  2CZ0 B;  2HAX A;  4NL3 A;  4BI3 A;  3L1A A;  4N0A A;  4M7A B;  3OYM A;  2DXB A;  1Q81 U;  3VU3 C;  5A0D A;  3JB9 D;  1LNX A;  4M77 E;  3A8H B;  4OB1 B;  5FU7 B;  3E9G A;  3CME A;  4M7D E;  1M5Q 1;  1NJI U;  1N9R A;  2XID A;  3WXM B;  2K5I A;  3CCS T;  2LDM A;  5DLO A;  2LCC A;  4N0A C;  5LJ3 h;  3GOX A;  4MZP A;  1UGS B;  1M8V A;  2O4X A;  3MP8 A;  1XQH A;  5LJ3 f;  4BE0 A;  2EAY A;  4FT4 A;  2F5T X;  2XHC A;  2LT1 A;  5D6W A;  4ZN3 A;  1BIA A;  4HKE A;  2BKD N;  3M57 A;  1W2B A;  4M75 A;  4ELZ C;  4BDZ A;  3RMS A;  1H3Z A;  4M7A G;  2KVQ G;  4OVA A;  4X9D A;  2QI2 A;  1WJR A;  3O8V A;  3SD4 A;  3RKX A;  4ZGD B;  1LOJ A;  5IAY A;  2OTL T;  4JLG A;  4EMK C;  1V29 B;  2GF7 A;  2WSF E;  2FL7 A;  5HK3 A;  5FU6 C;  3G4S T;  4KBM B;  1VQK A;  1UB4 A;  4DA4 A;  4BUG A;  4C0G A;  3QSU A;  3CC2 A;  4M75 C;  4EMH A;  1B34 A;  3HFO A;  2C06 A;  3EFS A;  2LC4 A;  4J6X A;  4M77 F;  4OB2 B;  1YJ9 T;  1N8R C;  4J7I A;  4M75 D;  3OS0 A;  2A7Y A;  4M7D F;  3OBW A;  1BI3 A;  3R6O A;  3JCM e;  2DTI A;  1IZ6 A;  3P8B B;  1JJ2 S;  1WQ7 A;  2DTO A;  3LWI A;  1HXD A;  4ZN1 A;  2DK3 A;  4C0D C;  1YHQ T;  2LCL A;  1KQS S;  4C92 A;  4UC4 A;  4D6W A;  5GAN g;  5LJ5 j;  4XU2 A;  2EQK A;  2F69 A;  5GAM h;  5GAM d;  1W2B S;  3CMA A;  3PMT A;  2DKG A;  4NS5 A;  5GAM f;  1WNL A;  3J81 E;  1S72 A;  1WJS A;  4IUT A;  3E9F A;  3QZ9 B;  4KT0 E;  1YI2 A;  2O4X B;  4LD9 K;  3JSC A;  3GNF B;  4XU0 A;  4YTL A;  2PQW A;  4J83 A;  4C92 C;  4EMK B;  5GAO r;  1KD1 C;  2JVV A;  2EKO A;  2PVG B;  4C92 D;  2E1H A;  1K9M U;  1VQ8 A;  2MI6 A;  5FU6 B;  3VUB A;  4Z02 A;  5DY9 A;  5GAN e;  4ZTF A;  1VQL A;  4M75 B;  1BKB A;  3OYI A;  3JCM P;  1VQM A;  2DTH A;  4MDX A;  1KD1 U;  2VXF A;  3A5Z B;  2OTJ A;  2JTF A;  4XQ3 A;  1M90 U;  4J7F A;  4JJN K;  1YIT A;  4HCC A;  1I4K 1;  3M56 A;  4JRI A;  1M1K U;  3JRZ A;  2E70 A;  1LJO A;  2P0K A;  3PNW C;  3CCJ T;  4XTY A;  4BI8 B;  4M78 E;  4F7U F;  5KE3 A;  4A4G A;  5LJ5 g;  1VQP A;  4QW2 A;  4C92 B;  1JB0 E;  5LJ3 j;  1VQO T;  4RKU E;  3CC7 T;  3RES A;  4A4K A;  4JS5 A;  3JB9 I;  4M75 G;  3OYJ A;  4FT2 A;  5GMK j;  3ASK A;  1I5L A;  1AHJ B;  3M58 A;  4XU1 A;  2RHX A;  5CVI A;  4L59 A;  1YJW T;  3CC4 T;  3VV0 A;  3CME T;  4A4F A;  3S6W A;  3VUZ A;  3OY9 A;  3CCE A;  2E6N A;  4DOV A;  1Q7Y C;  3G6E A;  1KC8 C;  2DD4 A;  4IKF A;  3I56 A;  4M7A C;  1VQN A;  1DJ7 B;  4EMG A;  3LX7 A;  3CD6 A;  4M7A D;  2DVE A;  4RG2 A;  1Y7X A;  4N4G A;  2KMT A;  5L8R E;  3N5B B;  4OB0 B;  4C92 G;  2V8K A;  3QBY A;  4LDW A;  2JN0 A;  3FEO A;  2LQ8 A;  4Y91 A;  2XDP A;  2DD5 A;  2JUF A;  2ZPG B;  2DO3 A;  3FJP A;  3LYI A;  3OMC A;  4M78 F;  3M4G A;  3PIP A;  3HSB A;  5CKB A;  1UGP B;  2LTO A;  1VQ5 A;  1G5V A;  4C5I A;  3X24 B;  3C12 A;  1N6A A;  2OAU A;  3OBY A;  2LVM A;  2M16 A;  2FB7 A;  4BD3 A;  5GAM j;  1VQ4 T;  1G3W A;  3M9Q A;  4HA8 A;  4C8Q C;  2RJF A;  2V8J A;  3CC2 T;  3JB9 J;  2EJF A;  3S3O A;  4C8Q D;  1N9S A;  4JLI A;  4WF2 A;  2WSE E;  4C0Z A;  2CZ7 B;  3TEE A;  5IN1 A;  3GPL A;  4PJO E;  3FC3 A;  4A4H A;  5D6X A;  3CCU T;  2EJG A;  3JB9 H;  4MZM A;  3WVD B;  3BW1 A;  4M77 A;  5LJ5 h;  5GAO n;  5LJ5 d;  2K3X A;  1JRI A;  2BUD A;  4M7D A;  3CMA T;  3CCM T;  5LJ5 f;  3QKJ A;  1Q86 U;  2VV5 A;  2DXC A;  2X35 A;  1YIJ A;  3M53 A;  1QVP A;  2ZPH B;  4NL2 A;  4EDU A;  3OYD A;  2LRQ A;  4JUV A;  5LJ3 d;  2LQK A;  5GAN 8;  4E7K A;  4M77 C;  4XU3 A;  4LDX A;  1JJ2 A;  5GMK h;  2QQB A;  4M77 D;  1VQ8 T;  3L2R A;  4RMO A;  4JS4 A;  2VC8 A;  1PSE A;  1KQS A;  1G3T A;  3M54 A;  2XG8 D;  2LT4 A;  4QQ6 A;  4C8Q B;  1QVF S;  3CBP A;  5GAO l;  3E19 A;  3MO8 A;  3JCM g;  3CCQ A;  4X9C A;  5CKF A;  2JTM A;  5AYF A;  3VYH B;  4A54 A;  2RH2 A;  1PSF A;  3NTK A;  2ZPB B;  2QA4 T;  2R5M A;  2RI2 A;  2EJ9 A;  3QUI A;  1UGQ B;  4HCB A;  3DB4 A;  3ER0 A;  4PJO F;  3L2Q A;  2QQS A;  1VQ6 A;  1X01 A;  5GMK i;  3BFM A;  3LW5 E;  5EG2 A;  5GAN 4;  4XTV A;  1YIT T;  2WAC A;  2GFU A;  3A8G B;  3TRE A;  1YJN A;  4PLL A;  5GAN 3;  1K73 C;  3UDC A;  2HD0 A;  2MWP A;  3CCR A;  4C8Q A;  1NJI C;  3C95 A;  2DIQ A;  1VQP T;  2XK0 A;  1I81 A;  2HNI A;  2ZPE B;  3QHS A;  3QJ6 A;  5FLX E;  3JB9 F;  1BI1 A;  2OTJ T;  3PMI A;  1OZ3 A;  4M77 B;  1BYM A;  4C8Q G;  1ZBX A;  3JCM W;  1K8A U;  3HRS A;  4QQD A;  4CI0 C;  5I21 A;  4F7U E;  2IG0 A;  2RHU A;  2RJC A;  3MET A;  3CCV A;  1NZ9 A;  1N27 A;  3V7S A;  1JBM A;  2RO0 A;  1BIB A;  3HP9 A;  3J80 E;  1MGQ A;  1VQ7 A;  1VQ9 A;  1X6O A;  3CCE T;  1M1F A;  2JNG A;  1FXX A;  2XDD A;  3G6E T;  2CS7 A;  2ZPF B;  3G71 A;  1UEB A;  3PFS A;  2R58 A;  4R55 A;  1U1T A;  2MAM A;  3CXC S;  1QW1 A;  4XTX A;  4OF1 A;  2QTX A;  2V8I A;  1VQN T;  2PUO B;  4C0F A;  2EQJ A;  3RKY A;  3CD6 T;  2IVW A;  2Y4X A;  2RHZ A;  4P5N A;  4FU6 A;  3CPF A;  3OYE A;  1KG1 A;  3NTI A;  5KE2 A;  3RER A;  4M77 G;  2P0Q A;  2XIC A;  3FRN A;  2K4Y A;  4M7D G;  4ZGJ B;  5CK9 A;  4CRI A;  3CCS A;  4C5H A;  3L2Z A;  2QXF A;  1M4Z A;  1B34 B;  4N4I A;  2QQ9 A;  2RJE A;  4QVZ A;  5A2Q E;  2DIG A;  3FB9 A;  2KY9 A;  3A8L B;  2K3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...