1DJ7B

Crystal structure of ferredoxin thioredoxin reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox signaling in chloroplasts: cleavage of disulfides by an iron-sulfur cluster.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords FERREDOXIN THIOREDOXIN REDUCTASE: CATALYTIC CHAIN
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1dj7B00
4FM4B 2D0QB 3X25B 1UGPB 2PUOB 2WSEE 1PSFA 2ZZDA 4L6V5 1JB0E 3QZ9B 3X26B 3X24B 4OB1B 3QZ5B 2DD4A 3A8MB 1IREB 2CYZB 2WSFE 2ZPIB 2O01E 3HHTB 2ZPFB 2PVDB 4ZGJB 1UGQB 2PVOB 2PUKB 3QYGB 2DXBA 1PSEA 1UGRB 4OB0B 3WVEB 2CZ6B 4ZGEB 2DXCA 4KT0E 4OB3B 5L8RE 2DPPB 3A8HB 2ZPEB 3A8GB 1UGSB 2PU9B 2ZPBB 4RKUE 4Y28E 3X20B 2QDYB 4OB2B 2PVGB 3WVDB 4ZGDB 3QXEB 2AHJB 2CZ7B 3QYHB 3VYHB 4XK8E 2ZPHB 3X28B 2DD5A 1GXIE 3VYGA 1AHJB 1QP3A 3LW5E 2ZCFB 3A8LB 2ZPGB 1DJ7B 3A8OB 1QP2A 1V29B 2CZ1B 2CZ0B 2WSCE
chains in the Genus database with same CATH superfamily
1M5Q1 1R8OB 2YSQA 1CSKA 2HQHA 1W2BP 1PWTA 4LUDA 5FU6B 3OS2A 2VUBA 1V76A 2FZKB 1IZ6A 2YRVA 4M77G 4M75A 2D0NA 3M0TA 2ZPBB 4M78C 3MP8A 3G6ET 2QQSA 1RABB 4PJOC 4FW2A 2JXBA 3FJPA 5I2MA 4ZTJA 1OPLA 1Y0MA 2D0QB 2A3LA 2K5FA 4PJJA 2H3EB 3TQ7P 4A4HA 3CMAT 3GNFB 2CREA 3RBBB 2WACA 1I1JA 2GTJA 1MMGA 2VB6A 2K7AA 1M3AA 2CS7A 3HRUA 4MDWA 1LPLA 1RAGB 2D6FA 5FLXE 4E7KA 4PJOD 2E65A 1Q7YC 2E41A 1ACMB 3OA6A 1EIFA 5IH2A 2BE9B 1NLOC 3RMSA 1NBEB 1XOVA 3CQTA 3INZA 3SWNA 4ZGJB 4M78G 2PUKB 3E9GA 4J83A 2JN0A 1QCFA 1TS9A 2DE0X 5IN1A 1WHMA 5GJVB 2FPFA 2LX9A 2O9VA 1N5ZA 3C95A 1VQLA 3M0UA 2K3XA 2HNIA 1G3TA 4AFUC 1FX7A 2X3WD 3ZBDA 4JZ4A 3CD6A 5GANj 3P8HA 4NS5A 4IIMA 4GBQA 2RA2A 1RAHB 2QA4Q 3CPFA 2AHJB 2XIDA 1YI2Q 1E7OA 2KDSA 1G3WA 8ATCB 3G7ZA 2ZPGB 1BB9A 1CKBA 4R56A 4WCIA 1G5VA 3L2VA 1C1AA 5GAMd 5LJ5h 5GAMf 1D0ZA 3HL8A 1NEBA 4NOYA 1OZ3A 1UGQB 1VYTA 3OYJA 5I2SA 1KQSS 4BY6C 2M02A 4LD9K 2GBQA 1K8AC 2K2VA 1XJWB 4PK4A 2L3PA 1UB4A 2HAXA 1TU0B 4FSSA 3QO3A 3L42A 4C8QA 1K9MC 3RMQA 4J5YA 1Q81U 1KHCA 2DXBA 3RIRA 1B34A 3AT1B 3MCAB 2Y4XA 3CCEQ 3QSUA 3NFCA 2HCKA 2FHDA 4Y91A 5HK0A 2RB6A 2RHUA 3ZEHA 1NZ9A 1C0MA 2XD0A 1OYXA 2K3BA 2DRMA 3BDLA 2Y90A 1Q82R 1WA7A 2MWOA 3EGUA 1J3TA 2C06A 2X9HA 2W10A 4MMLA 4OB2B 2KXCA 1X6OA 4EMKA 2CP3A 4J9FA 3SFMA 3DLLA 1SRLA 2RHXA 2PTKA 4C8QE 2DZ9A 3A98A 1I81A 3LWHA 2RQWA 2O88A 1MUZA 3REBB 1JXMA 2X4YA 3MEAA 1GBRA 3J80E 1N9SA 2D8JA 4F7UA 3SEMA 4V2SA 1D09B 1M1KR 2IIMA 5GAOq 3FB9A 2KBTA 3I56Q 2CH4A 5EG2A 3NTHA 1PG5B 4C92F 4J6WA 2CP6A 2EYQA 8AT1B 3HFOA 3JB9G 1EX4A 1BIBA 1NJIC 3CCST 5GAN3 2EW3A 2RI2A 2E70A 4A4EA 3CCUQ 5GMKh 2OTJQ 2PZ1A 2NUTB 4O6JA 2LJ0A 3CCUT 3FRNA 4LXCA 4XTUA 4ZN3A 3CPWP 4C0GA 1QP3A 3A8LB 4C5HA 5KYYA 1H3HA 2QQ9A 2QTVA 1K4US 4HVVA 3JB9H 4O5VA 3E1SA 4LN2A 1KD1U 4J8OA 3QDFA 1IREB 1YITT 5HCKA 2MIOA 4P5NA 1NLPC 5AT1B 4M78D 2OTJT 3MP6A 5CR2A 1QMCA 5DLOA 1PKTA 2FG0A 5I22A 1N9RA 4M7DA 4R55A 2KK4A 3JCMh 3EFOA 3CCQA 2RO0A 1UHCA 1BYMA 5LJ5g 3PNWC 3HKSA 1X27A 4OVAA 2DA9A 3I55A 2LQKA 4JDSA 4OP0A 1QVGA 1MV3A 1KC8R 2F5TX 4Y28E 1EZZB 3OMCA 4DBQA 2ATCB 2K57A 2IPOB 3JCMd 2X4XA 4BB7A 4WF2A 2X51A 1SRMA 2QQRA 5CQYA 5GANd 4AFQC 4QQ6A 2V8KA 1F1BB 4ANJA 3M59A 2RHIA 3NTIA 1BI3A 5CK9A 4KGXB 3O5ZA 2AKLA 1X75C 1ZBXA 2CT4A 1YITA 2YLCA 1IGUA 3OSVA 3GNGA 5GAMe 2B86A 3TCJA 4F17A 5D7UA 4QVCA 1YIJQ 1RI0A 1SKUB 2LX7A 4XU3A 3F70A 3OYYA 2CSIA 4RTZA 3HSBA 4BY6B 5FW9A 1Q95G 2JNGA 4KH1B 2NWMA 1RACB 3CCUA 2EGCA 2CKKA 5GJWB 2YT6A 4E7ZA 4BE2A 1W2BS 3WVDB 4C8QB 4GLMA 3H41A 1R0BG 3EFSA 2LJ3A 3H6ZA 2DM1A 3X24B 5KYXA 1SSFA 3CPWA 2LMJA 2LQWA 5GMKi 1SF9A 4M77F 1X43A 2JTEA 3BY7A 1KQ2A 3CMEQ 1QWEA 2L8DA 4RTTA 2CT3A 3VUZA 3FEOA 2P0PA 2JVVA 3GOXA 5LJ3e 2LT1A 5EC7A 4R0KA 4RCCA 4EMHA 3EGXB 5FWCA 1OEBA 3JCMJ 4PJOG 3OYAA 5LJ5f 1ARKA 1VQ8Q 3I35A 2WSFE 1TTHB 1SEMA 2EVRA 2ZPFB 2MMPA 4M78B 3CCRQ 2E4HA 1RAEB 1KD1C 5A0LA 1UE9A 2K9GA 4ZGEB 1W2BA 4PJOB 5IXFA 2KYMA 3RDVA 4VUBA 2K3YA 3M0SA 2HL3A 3UDCA 3JCMc 1K8AR 3L2RA 2ZCFB 2A7YA 4YTLA 2DAQA 2LQ8A 4A53A 3JRZA 2DFUA 1YBYA 1BI1A 1Y57A 2QQBA 4M75G 3L2QA 2DJZA 2RF0A 3G4ST 4J7FA 2EJGA 2KYBA 1VQ4T 2BUDA 4ELYC 1NJIU 1Y7XA 3LLRA 2K79A 1KQ1A 3FLGA 4N4IA 5GAOr 3OYDA 4L59A 3OYHA 1YIJT 1NM7A 3I56A 4LUEA 1VQ6T 4GY5A 2EBPA 2L3RA 4M77C 2OTLA 1W4SA 2VVKA 4IUPA 5CKHA 3REAB 2DL8A 1S1NA 4IUUA 5KYYB 3JSCA 1WGSA 2E6ZA 1N6AA 1K9MU 2PU9B 3RKYA 1K8AU 4M7AD 1SG5A 1WPYA 2VGMA 3EG1A 2FPEA 4F7UG 2BZYA 3CC4Q 2EYYA 4LD6A 2F69A 4LDUA 1YJ9Q 1AOJA 2K5IA 4A4KA 4BUGA 1RLPC 1YI2A 3G71T 1FWZA 4OMMA 3CC4T 1KJWA 4FIBA 4D6WA 4DEYA 1ZX6A 1W6XA 3OYMA 1VQ5A 2QYZA 2O2OA 4JS5A 1VQ7T 1FMKA 1Y07A 2LCCA 4HCBA 3QKJA 4M75E 2LNHB 3VU3C 1C6VX 3V8LA 1M27C 4X9CA 2IVWA 3Q1JA 3QDRB 4BI8B 4M7DF 1YHQQ 3CPWS 2RK2A 1JQQA 2A37A 1X69A 4XU1A 2VYTA 1MNEA 3M4YA 1PKSA 2ZAEA 3FJ5A 2DL3A 3QG1A 1QKWA 1JRIA 4LDYA 1TH7A 2QQAA 1WZOA 1DJ7B 2YRDA 2V1RA 1NYFA 4FL6A 3UPUA 1VQ8A 5I11A 3SWNC 3TSZA 3G71Q 1Q82U 1KK7A 3SHWA 2JMAA 2MWPA 3G4SQ 3H0FA 4FU6A 2K5LA 3M0RA 1E6HA 1X2KA 4E47A 3UT1A 3GLXA 3PGGA 1K76A 3NMZC 2CSQA 2J6OA 4Z88A 3EG9B 3E9FA 5D6WA 1S72Q 2EGAA 2QA4A 1WHKA 3NTKA 2AIRB 1WHJA 1D1CA 2GCXA 2MF2A 2PNIA 4HXJA 4DEXA 3CCSA 4FYVB 2O9SA 1PSEA 2HSPA 1OPKA 4C8QC 2DXCA 5L8RE 1TUDA 2QDLA 4C5IA 2KE9A 3M57A 2RQUA 1GXIE 5DY9A 3VS1A 2RH2A 1ZBJA 3AHUA 4KUDK 2COWA 1TG0A 3QWXX 3HPWA 3G71A 3CCVT 1BCMA 2NUZA 1YJNQ 1PD1A 1I07A 2ZZDA 2YUNA 2BZXA 2FPDA 3QZ5B 4J6YA 1LOJA 3MJXA 1VQ8T 3QJYA 2ROTA 2EJFA 2RI3A 1OI1A 4ORZA 1VQ7Q 4M75C 3UF4A 4E7JA 5KYXB 4M78A 1B07A 1CKAA 4XTYA 3BE3A 2ESWA 3EG0A 4RTVA 3PE0A 1QVPA 2E6NA 2XI9A 1ZSZA 2FL7A 2A36A 1EFNA 3QJ6A 4A54A 3EGDB 1AD5A 4J6XA 1PNJA 2E5QA 3MPUB 3OW2A 2Z0WA 3TVTA 4E7LA 1PRMC 1JO8A 5KYWB 1WJSA 2DL4A 1VQ9A 2RI5A 2FZGB 3OS1A 1KFZA 2RN8A 2HDAA 2J05A 4CRIA 1AEYA 4RG8A 4JJNK 4JJDA 2K2MA 2G3RA 3X20B 4AFZC 1QVGS 4AFSC 3OW2S 1Q86R 4PKCC 2QASA 3G1JA 2QK0A 3VJPA 1KSWA 3QBYA 2M0YA 4JJCA 1N8RU 3C4SA 5KCHA 2HKQB 1MNDA 4PJOE 2QTXA 3EG2A 2XKOC 1AWOA 2X4JA 1B7TA 3LGLA 1I4K1 5L23A 1K0XA 2H8HA 3QYGB 3GBQA 2MPXC 2DMOA 1UGSB 1MMAA 2MI6A 2EQUA 1K9MR 4DOWA 1QLYA 3OY9A 4M77A 5J39A 2JM8A 5GMKm 2L3QA 1ZSZC 3CCRA 2XDBA 1WLPB 1D1BA 1UGPB 2EJ9A 3EGXA 4L6V5 4OB1B 2F2WA 2PVDB 4BACA 3H0IA 1RADB 5GAN2 3JCMW 2GNCA 1AT1B 3J7AF 2KROA 4CC3A 2DRKA 1OOTA 3SB2A 4J9HA 4XAXB 1UGVA 3CCSQ 4KBMB 1GL5A 2JTMA 2EKHA 1U3OA 4FSXA 2JMCA 4M7DG 2R5AA 5GAN6 2J6FA 3E2UA 3V8KA 3CEYA 3HP9A 3CD6Q 3QPHA 4BI4A 1GFDA 2YUQA 5C6SA 4J9IA 5LJ3f 4MDXA 1O75A 3CMEA 2CGHA 1FXXA 1M1KU 5CKDA 2CP2A 2B8AA 2VXFA 5CQXA 4E2FB 2KRSA 4RTXA 1Y96B 2CUDA 5GANf 3PIOA 1IO6A 2ROLA 1B3QA 2P4RA 4C5EA 2DO3A 1IHVA 3V7CA 1RAIB 3RNJA 1MGQA 4N4GA 3HHTB 1Z9QA 1VQKT 3KXTA 4A4FA 4KT0E 1U8RA 1OZ2A 2LJ1A 1NG2A 4RKUE 3L2ZA 5CKFA 5LJ3j 4DBFA 4AG1C 4OMLA 1I8FA 1ZUYA 1UJ0A 2YLBA 2OTLQ 3E19A 4ELZC 3X25B 3L1AA 1Q82C 2LT4A 1N27A 1WYXA 4QW2A 3SD4A 3ASKA 5GMKl 1IRXA 1YITQ 1UEBA 3GPLA 1Q86U 2LZ6B 3C12A 3ULRB 4MZMA 3TSWA 3CC7Q 1QVFS 2GGRA 4ZGDB 5LJ5j 4HA8A 3U23A 5CO7A 1R0CB 3CCMT 2E3IA 4IIOA 5M9OA 4AT1B 2DNUA 4M75F 2BKDN 1ABQA 2ZPIB 1P92A 3M56A 3CBMA 3S3MA 2RHYA 4N4HA 2H3JA 3VS0A 1KC8U 3EGDA 4EMKC 4ZN1A 1I5OB 3RERA 3VS5A 1KD1R 5FU7B 3OYNA 4B6MA 4C8QD 2YHTA 1M1GA 3ER0A 4OMQA 2V8IA 4PL6A 4PJOF 3CCMQ 2EYXA 1ZLMA 2L5QA 4JRIA 3BDUA 2BZ8A 2LP5A 3RUXA 3JCMV 1WI7A 2L0AA 3FDRA 4J7IA 2VGNA 3P8DA 4EIKA 4C0FA 4BE1A 1GRIA 3CCJQ 2OAUA 3M9QA 5LJ3d 6AT1B 3CCJA 2O01E 1X6GA 4J9BA 1UHFA 1H3ZA 2LRQA 5CVIA 3I9QA 4OMNA 4BD3A 3R6NA 4PLIA 2EQKA 3S3OA 1UECA 2KMTA 3VS2A 3VRYA 2CH4W 1HJDA 2NUPB 2EQJA 1YN8A 3TREA 2CYZB 1KHIA 4LDWA 3DLMA 2LCLA 3J81E 3M5AA 2YRCA 4OGEA 4FT2A 3CCLT 2FEIA 1WIEA 1K73U 5A0GA 2HMAA 4RTYA 2JZ2A 1G2BA 1TSFA 4FYXB 1WXBA 4MZTA 3EHRA 2C0IA 3I5SA 5FRMA 2XICA 2D1XA 2E12A 3MEVA 4KUIA 3JB9F 2I0NA 4M7DD 2QG9B 2NUTA 5LJ5d 4OMPA 2C0TA 2VV5A 2CUBA 1MHNA 1JJ2A 3JB9I 3EFOB 1UDLA 4EPCA 5DM7R 3CCEA 1G83A 2PQWA 2W0ZA 5GAOl 1QP2A 3M0QA 2DERA 1I5LA 1KQSP 1JEGA 4D8KA 1N8RC 3BFMA 3QZ9B 2R5MA 2G6FX 2FO0A 2OTLT 1R77A 2IG0A 5IT9E 1UFFA 2GFUA 5KYUB 3JCMb 2BIVA 1Z9ZA 2M51A 3EHQA 2DTOA 2HBPA 2Y4YA 1K1ZA 2GQIA 2HSEB 3EAEA 4JRPA 3CCJT 4HT9A 1NE8A 1WHHA 3D7SB 4M7AF 1WQWA 2KR3A 2DVJA 3FIFA 2O4XA 1VQOT 5C0MA 5IHNA 1M9SA 4IUTA 1VQMT 4JRKA 1E6GA 3RR6A 3MKDA 4C0ZA 3CC7A 3EH1A 1TWBA 1VQOQ 2DZCA 3OYCA 4X9DA 2KEAA 4DBRA 5IAYA 2DTHA 2I2LA 4II1A 5GMKj 4Z89A 2RJEA 4QVDA 4C92A 1SPKA 2VWFA 4RTUA 3G6EA 1IXDA 1M8MA 2HQXA 1LNXA 4XU2A 1YJWT 3WXMB 2K4YA 2FZCB 2ZPHB 2KSSA 1VQPQ 2M0OA 2JT4A 4M7DC 4CC2A 2WSCE 1VIEA 1BK2A 4Y92A 1WX6A 2J6KA 3VUBA 1FMVA 4C92C 1VQ5T 2DVEA 2HKNA 4E6RA 1BBZA 3KUFA 1UJYA 2DILA 2L3SA 4IURA 2V8JA 5FU7C 4M7AC 1UG1A 3M0PA 3UWNA 3PTAA 3META 2JS2A 2M1HA 5FU6C 5LJ3g 4BI3A 1ZQ1A 2F1LA 5LL6S 5GANg 2RK1A 2KT1A 1VQ5Q 1AZGB 1RAAB 3OYFA 1QVFP 1LCKA 4M77D 3FC3A 1NEGA 4LDXA 2ABLA 1YJWQ 4HVUA 4Q5WA 2MAMA 3I55T 3CMET 3HRTA 4A4GA 1G3SA 1V29B 1YWPA 4QT7A 4M7AE 3PVQA 3P8BB 2C0OA 7AT1B 5FROA 1SHFA 3JCMe 4JUVA 4JJBA 2HD0A 1Q86C 4RTWA 1PRLC 3CBPA 5KYUA 3TEEA 4CI0C 3LGFA 2QDYB 3THKA 4LDVA 4X1VA 4J9CA 3OYIA 1QWFA 3CCQT 3OYGA 1HYOA 4BE0A 1PSFA 1TXQA 2LTOA 1BU1A 4PJNA 2DEUA 1WJRA 2KY9A 2RNAA 2CZ6B 3CC2Q 4FT4A 3OBWA 2DBMA 3PVLA 3ME9A 5GAOn 3X28B 1O9SA 1BIAA 3ZL7C 5GAOp 3C94A 1H92A 2PUOB 2YXYA 2LNVA 3OYKA 3MO8A 2EGEA 3JCMQ 2V1QA 4PLLA 3OB9A 4DQ2A 1SHGA 2DD4A 4F16A 3NPFA 5GAN8 3OS0A 1WHLA 2XMFA 3WVEB 2BE7D 2P0KA 4OB3B 2DPPB 4PJOA 3MHXA 5LJ5e 3CCVQ 1KQSA 3O8VA 1TUGB 3CCQQ 1KG1A 3UATA 2QEXQ 1WXUA 3KBGA 1VQPA 3OS5A 1AWXA 4ATOA 1MMNA 4M77E 2DYIA 1M90U 1VYUA 1OU8A 3PIPA 4F7UF 3PFSA 1VQ9T 4QKUA 1WFWA 5CIUA 4J9GA 1YP5A 3OYEA 2FRWA 2HBWA 1LVKA 2J06A 4XTVA 5ECAA 2HL5C 1T3SA 2DXTA 2NLUA 1WNLA 2J7IA 1YHQA 4E7IA 2RJDA 2JM9A 1VOMA 3LH5A 4AG2C 3S6WA 2V26A 1ZA1B 5I21A 1VQ4A 3LH0A 3VS7A 3JAME 3M55A 1ZHIA 3G6EQ 2DIQA 2O4XB 2JJ9A 4RG2A 1YIJA 1M3BA 1VQ6A 2X4WA 4CC7A 5IXBA 4HCZA 1MMDA 1X01A 1QKXA 1VQNQ 1JJ2P 1XNIA 1VYVA 1PM3A 4F14A 4MZPA 3I5RA 1IGQA 1Q81C 2YDLA 2KAFA 1U5SA 3DKMA 2CZ7B 2LCSA 2ED0A 1V1CA 3OBYA 4C92B 1BI0A 2JUFA 3OQ5A 1TUCA 3KFVA 2KRMA 4DA4A 5KE3A 1PHTA 1UTIA 4X34A 3SWNB 1UGRB 2VKNA 5A0DA 4D8DA 3A8HB 3A8GB 3VV0A 4J9DA 2RPNA 3LYIA 3VYHB 4XU0A 2RQTA 2VC8A 3A8OB 5HKCA 2OJ2A 3M4GA 2BTTA 4XTWA 1JB0E 1TOVA 3PT9A 4IUVA 2KI7A 1I0CA 2DIGA 1QCNA 3MEWA 1HSQA 4XTZA 1AVZC 4M7AA 2MK5A 1XQHA 5CCAA 1S72T 1K0SA 3JCMf 3CC2T 1JJ2S 4JRQA 4IUQA 3CMAA 2YWWA 5KE2A 3TU4K 4DOVA 1VQKA 1OU9A 1M2VB 1YFNA 1VQLT 4A63B 2OI3A 4C0DB 4EMGA 2MOXA 4GLKA 1D1AA 3OMGA 5GAN5 2A0FB 1PCXA 3MEUA 1Q7YR 2DD5A 4PFZA 1YJNT 1H641 4RCBA 5GAOm 2DTIA 2FYKA 4HKEA 1N8RR 2GQVA 3A8MB 2CZ0B 4NL3A 1VIFA 1AWJA 3BW1A 4N0AA 2DLPA 4M77B 4ZTFA 1KC8C 3M58A 4JZ3A 4HT8A 4OB0B 9ATCB 1B34B 1Q81R 3QXEB 2R57A 3LW5E 3C0CA 2RQVA 4UC4A 2RJCA 2P84A 2XG8D 4AMCA 2EYZA 2LQNA 1U1TA 1ABOA 1VQLQ 2A08A 2LC4A 1K9AA 4M78E 3CCVA 1W70A 3T9NA 2EYWA 2ECZA 3HRSA 1VQMA 1HD3A 2D8HA 1NJIR 1RAFB 3SDZA 2OAWA 2AZSA 5CKBA 3EH2A 1YJ9T 5FWBA 1T0JA 3EFRA 1NPPA 2EIFA 1ZUKA 3CXCS 2JS0A 1Y96A 2DBKA 2YUPA 2FRYA 3DB4A 5CAIA 4M7DE 1D0XA 2QGGA 1PD0A 4M7DB 4HVWA 2A28A 3VS4A 1AHJB 3GP8A 2RJFA 4J9EA 4PNOA 3JV3A 2EQMA 3L2WA 1WQ7A 4Z8AA 4B9XA 3G4SA 1XTDA 2RM4A 4OGCA 5KH6A 1YNZA 3CC4A 1M1KC 1GCQC 2M9UA 2AKKA 3QIIA 4M7AB 3DB3A 3CXCP 3QWYA 3I56T 1A0NB 3QYHB 4LE9A 1K73R 3IQLA 1D0YA 2XDDA 4HCCA 3MP1A 1OX9A 3H8ZA 4OMOA 1M2VA 2WSEE 5D6YA 1GBQA 2HQEA 2EAYA 4FW1A 3CCLA 5FRNA 3R6OA 4FCYA 1M30A 2F2VA 2XK0A 4PFOA 2X35A 3RKWA 2CZ1B 4KRTA 3S3NA 1BCOA 3PMTA 4JLGA 4FM4B 2RMOA 1WHGA 2O31A 3A5ZB 1VQ6Q 1IHWA 1OULA 2HEQA 2PVOB 1VQ7A 1MV0B 4M75B 1FYNA 5GMKe 3A1PA 1VQ4Q 4M75D 1YJ9A 3NGPA 1OQKA 2GTOA 4C92E 2EWNA 2QXFA 3VRZA 1VA7A 1U06A 2CP7A 4JLIA 2DL5A 1G8XA 1D3BB 2RQRA 1BKBA 2QA4T 5GAN4 2VASA 4K11A 1YCSB 4PFPA 3QUIA 3VS6A 2JOYA 3CCRT 1QVFA 3NHNA 2DL7A 1RI9A 1T0HA 4ESRA 4E7HA 1YJWA 4C0DC 2X3XD 3X26B 1JU5C 1RLQC 3LWIA 3M53A 1ZSGA 2F2XA 2QGFB 3PMIA 5DLQE 5GANh 4PJMA 1M90R 3CC7T 4KULA 4BDZA 2DJQA 3V7SA 3GIBA 2PVGB 1YHQT 1Q7YU 4XK8E 2DETA 1QCOA 1GCPA 1VQ9Q 2ED1A 3M54A 4C8QG 3HTRA 3JCMX 2E64A 4RUGA 3OSSC 2L89A 3HFNA 2ZGWA 2EKOA 2KT8A 2NUPA 2RHZA 1GCQA 1RL2A 4FYYB 4EDUA 2EPDA 2KVQG 5GAN7 4Z02A 2E10A 2GFAA 4KGVB 4M78F 4TVRA 4JS4A 2XHCA 2NYSA 3CCMA 1IB8A 1VQNT 3QHSA 5IHIA 4C92D 4QQDA 5D6XA 1AZEA 4QVZA 2D9TA 1KIKA 4LNPA 2ENMA 3I55Q 5CKEA 2EFIA 3OW2P 2SRCA 2JW4A 4FYWB 1QVGP 2COYA 2QI2A 3JB9D 1HXDA 2VXEA 1GFCA 3H0HA 3VS3A 1VQKQ 2AK5A 3RESA 2OX7A 4IKFA 3CXCA 1WXTA 5GANe 2P4TA 1H8KA 1G3YA 2E3HA 5KYNA 3GF5A 4PJLA 1S72A 2L2PA 4N0AC 4WTOB 3CC2A 1D3BA 5J26A 2RD1A 3H9NA 5GAMg 1M4ZA 4ME7A 3EG9A 5IHKA 1JBMA 4M4ZA 2P0QA 1M90C 1PC0A 1RUWA 5HY6A 2JTFA 2LVMA 2EQIA 2QEXT 5KYWA 1VQNA 1AWWA 2DKGA 2OTJA 3URGA 3LX7A 1X2QA 1FMWA 5KCOA 1YJNA 3V7RA 2F5KA 3RKXA 3L2UA 2DK3A 4CC4B 1NPRA 1UUEA 1VUBA 1Y71A 2E1HA 1HK9A 2AT1B 2DXUA 1VQPT 5GAMh 4JPBW 1M8VA 3OYLA 1ZA2B 2KNBB 3V8JA 4B9WA 4OF1A 4BDYA 1VQMQ 3JCMP 2K6DA 2XU8A 4HCKA 4C8QF 1WJQA 4M7AG 1YWOA 4ZNXA 3EG3A 1K73C 4KGZB 4E7SA 2SEMA 3N5BB 4QQGA 1YI2T 4RMOA 2DF6A 2LDMA 2ZPEB 4OMFB 3VKIA 5J3BA 3VYGA 1WDXA 4XTXA 2MCNA 2CP0A 4L5GA 2FVUA 2QEXA 2DYBA 1NYGA 3JB9J 4EMKB 2QAZA 2DX1A 4F04B 4C5GA 1YCYA 5LJ3h 1JXOA 3ZFJA 2CP5A 3UA6A 2YUOA 5AYFA 1M1FA 2FB7A 1OV3A 1OX8A 1ZSZB 2E5KA 1T3LA 4KH0B 1QQJA 2M16A 3CBOA 1M2OA 1LJOA 1ZUUA 2KQWA 2COZA 1X6BA 2CDTA 5GAMj 4NL2A 1BI2A 3CMAQ 1QW1A 3JCMg 1M3CA 3UA7A 2XDPA 3CCET 2MYSA 4DBHA 2KXDA 5HK3A 2AZVA 3CD6T 2R58A 1SSHA 2DEQA 4MMKA 4F7UE 1VQOA 3CCLQ 4C92G 1U1SA 2KRNA 1W1FA 3OYBA 2HZYA 4XQ3A 4F7UB 2GF7A 2KGTA 5A2QE
chains in the Genus database with same CATH topology
1VIFA 1W4SA 1M5Q1 1R8OB 3TREA 3BW1A 4IUPA 4N0AA 5CKHA 4M77B 5FU6B 3OS2A 2CYZB 2VUBA 4ZTFA 1KC8C 4IUUA 1KHIA 3M58A 1IZ6A 4LDWA 3DLMA 3JSCA 1WGSA 2YRVA 2LCLA 4OB0B 3M5AA 4OGEA 3J81E 4HT8A 4M77G 2E6ZA 1B34B 1N6AA 4M75A 1K9MU 2PU9B 2ZPBB 4M78C 4FT2A 3CCLT 3RKYA 3MP8A 3G6ET 1K73U 1K8AU 3QXEB 2QQSA 2R57A 5A0GA 4M7AD 4PJOC 1WPYA 3FJPA 2JZ2A 2VGMA 3LW5E 5I2MA 4F7UG 4ZTJA 4LD6A 4UC4A 2F69A 4LDUA 2RJCA 4MZTA 2XG8D 1U1TA 2K5IA 2D0QB 4A4KA 4BUGA 5FRMA 2A3LA 2XICA 2K5FA 2E12A 1YI2A 3MEVA 3CMAT 4A4HA 2LC4A 4M78E 4KUIA 1FWZA 3GNFB 3G71T 3CCVA 3T9NA 3CC4T 3JB9F 4M7DD 3A8MB 2WACA 5LJ5d 3HRSA 4FIBA 1VQMA 4D6WA 2VV5A 1MHNA 3SDZA 3OYMA 1VQ5A 1JJ2A 3JB9I 2CS7A 3HRUA 4MDWA 4EPCA 5DM7R 3CCEA 1VQ7T 4JS5A 2PQWA 2D6FA 5FLXE 5GAOl 4E7KA 4PJOD 1Y07A 2E65A 2LCCA 5CKBA 1YJ9T 2E41A 3QKJA 1Q7YC 4HCBA 3OA6A 4M75E 1QP2A 3EFRA 1NPPA 1EIFA 3VU3C 1I5LA 1N8RC 3BFMA 2EIFA 3QZ9B 3RMSA 3V8LA 4X9CA 3CXCS 2R5MA 1XOVA 2IVWA 2OTLT 3Q1JA 1Y96A 2IG0A 3INZA 3QDRB 3SWNA 4BI8B 4ZGJB 4M78G 4M7DF 2PUKB 3DB4A 3E9GA 4J83A 5CAIA 3CPWS 2JN0A 5IT9E 4M7DE 2RK2A 2GFUA 3JCMb 4XU1A 2BIVA 2VYTA 3M4YA 5IN1A 4M7DB 2LX9A 3QG1A 1AHJB 1JRIA 2DTOA 3GP8A 4LDYA 1TH7A 2QQAA 3C95A 2HBPA 1DJ7B 2RJFA 2Y4YA 1VQLA 4PNOA 4JRPA 3EAEA 2K3XA 4FL6A 2EQMA 2HNIA 3L2WA 3CCJT 1NE8A 1WQ7A 3UPUA 1VQ8A 4HT9A 4B9XA 1G3TA 3G4SA 3SWNC 1FX7A 1Q82U 3ZBDA 1XTDA 3CD6A 4M7AF 1WQWA 2RM4A 3P8HA 4OGCA 5GANj 4NS5A 5KH6A 2MWPA 4FU6A 2RA2A 3FIFA 2O4XA 1VQOT 5C0MA 2K5LA 1M1KC 3CC4A 2M9UA 1M9SA 3CPFA 3QIIA 4M7AB 4IUTA 3DB3A 1VQMT 4JRKA 4E47A 3I56T 3UT1A 3QYHB 2AHJB 2XIDA 3GLXA 4C0ZA 3CC7A 3PGGA 2KDSA 1G3WA 2XDDA 2DZCA 3E9FA 5D6WA 3G7ZA 4X9DA 3OYCA 4HCCA 2ZPGB 3MP1A 5IAYA 2QA4A 2DTHA 3H8ZA 3NTKA 1VQ6T 4R56A 2I2LA 2WSEE 3L2VA 1G5VA 5GAMd 5LJ5h 5GAMf 2MF2A 2GCXA 3HL8A 5D6YA 4II1A 4NOYA 5GMKj 2RJEA 2HQEA 1OZ3A 4QVDA 2EAYA 3CCSA 3CCLA 1UGQB 4C92A 5FRNA 3G6EA 1PSEA 3OYJA 3R6OA 4C8QC 2DXCA 5L8RE 5I2SA 1KQSS 4BY6C 2HQXA 1LNXA 4XU2A 4C5IA 4LD9K 1YJWT 3WXMB 3M57A 1K8AC 2K4YA 2K2VA 2XK0A 2ZPHB 2KSSA 5DY9A 1GXIE 2RH2A 2M0OA 4M7DC 3AHUA 4KUDK 2X35A 3RKWA 2CZ1B 3HPWA 3G71A 3PMTA 3CCVT 2WSCE 1VIEA 1UB4A 4JLGA 3S3NA 2HAXA 4FM4B 2ZZDA 3VUBA 3A5ZB 3QO3A 3QZ5B 3L42A 4C92C 4C8QA 1VQ5T 2DVEA 4J6YA 1K9MC 3RMQA 1LOJA 4J5YA 1VQ8T 3KUFA 3QJYA 2PVOB 1Q81U 1KHCA 2DXBA 1VQ7A 3RIRA 1B34A 4M75B 5GMKe 2EJFA 2RI3A 3MCAB 4M75D 1OI1A 1YJ9A 2Y4XA 4M75C 3QSUA 3NFCA 4E7JA 4IURA 4M78A 2V8JA 5FU7C 2EWNA 4C92E 4M7AC 2FHDA 2QXFA 4XTYA 4Y91A 5HK0A 2RB6A 2RHUA 3UWNA 4JLIA 3ZEHA 3META 3PTAA 1NZ9A 2M1HA 5FU6C 2XD0A 5LJ3g 4BI3A 1ZQ1A 1QVPA 1OYXA 2E6NA 2XI9A 1D3BB 2FL7A 5LL6S 1BKBA 3BDLA 2Y90A 2QA4T 5GANg 3QJ6A 2RK1A 4A54A 5GAN4 2MWOA 3OYFA 4J6XA 2C06A 4M77D 3FC3A 2E5QA 3OW2A 4MMLA 3QUIA 4LDXA 4OB2B 3I55T 4Q5WA 1X6OA 2MAMA 4EMKA 4E7LA 3SFMA 3CMET 2JOYA 3DLLA 3CCRT 1QVFA 3HRTA 1WJSA 2RHXA 4A4GA 4C8QE 1YJWA 2DZ9A 4E7HA 1I81A 1G3SA 1V29B 1VQ9A 3LWHA 2RI5A 4C0DC 3OS1A 4M7AE 3P8BB 2X4YA 5FROA 3X26B 3JCMe 4JUVA 3MEAA 3J80E 1N9SA 4CRIA 2HD0A 4F7UA 1Q86C 3LWIA 3M53A 4RG8A 4JJNK 4V2SA 5DLQE 3PMIA 2G3RA 5GANh 5GAOq 3CBPA 3TEEA 4CI0C 3CC7T 3FB9A 4KULA 3X20B 4BDZA 1QVGS 3LGFA 2QDYB 3V7SA 2PVGB 4LDVA 3GIBA 3OW2S 5EG2A 1YHQT 3NTHA 4XK8E 1Q7YU 4C92F 4J6WA 4PKCC 2EYQA 3OYIA 3HFOA 3JB9G 3VJPA 3CCQT 3QBYA 1BIBA 1NJIC 1N8RU 3OYGA 3C4SA 5KCHA 3M54A 4C8QG 4BE0A 3JCMX 1PSFA 5GAN3 3CCST 4PJOE 2E64A 2QTXA 2RI2A 2E70A 2LTOA 2XKOC 2X4JA 3OSSC 4A4EA 2L89A 1I4K1 3LGLA 3HFNA 3QYGB 2ZGWA 1WJRA 2KY9A 5GMKh 2CZ6B 2EKOA 4FT4A 1UGSB 2MI6A 3OBWA 2EQUA 4DOWA 2RHZA 3ME9A 4O6JA 5GAOn 3OY9A 3CCUT 3FRNA 3X28B 1O9SA 4XTUA 1BIAA 4ZN3A 1RL2A 1QP3A 4M77A 4C0GA 4EDUA 5J39A 5GMKm 5GAOp 3A8LB 3C94A 4C5HA 2PUOB 2QQ9A 2KVQG 5GAN7 2LNVA 3CCRA 2XDBA 3OYKA 4O5VA 3JB9H 3MO8A 4Z02A 1UGPB 2E10A 2EJ9A 2GFAA 3JCMQ 3E1SA 4L6V5 3OB9A 4M78F 4PLLA 4TVRA 4J8OA 1KD1U 4OB1B 4DQ2A 4JS4A 2DD4A 2XHCA 1IREB 1YITT 5GAN8 3OS0A 3CCMA 2PVDB 4BACA 4NL3A 3WVEB 5GAN2 3JCMW 4P5NA 2P0KA 4OB3B 2DPPB 4PJOA 1VQNT 4M78D 3J7AF 2OTJT 3QHSA 3MHXA 3SB2A 5LJ5e 4C92D 4QQDA 4XAXB 5D6XA 1KQSA 3MP6A 4QVZA 2D9TA 3O8VA 4KBMB 5CR2A 2JTMA 1KG1A 5CKEA 5DLOA 4FSXA 2EFIA 4M7DG 1N9RA 4M7DA 4R55A 2R5AA 5GAN6 2KK4A 3JCMh 3KBGA 1VQPA 3V8KA 3CCQA 2RO0A 3OS5A 3CEYA 1BYMA 5LJ5g 2QI2A 3HP9A 3PNWC 3QPHA 4BI4A 3JB9D 1HXDA 3HKSA 4OVAA 2VXEA 4ATOA 4M77E 5C6SA 3I55A 2LQKA 4JDSA 4OP0A 5LJ3f 1O75A 3CMEA 1QVGA 4MDXA 3RESA 2CGHA 1FXXA 1M90U 4IKFA 3CXCA 1M1KU 5GANe 2F5TX 4Y28E 3OMCA 2B8AA 2VXFA 2P4TA 5CQXA 4F7UF 5CKDA 3PIPA 2K57A 3PFSA 1VQ9T 3JCMd 1G3YA 2X4XA 5CIUA 4BB7A 1Y96B 4WF2A 3GF5A 5GANf 3PIOA 3OYEA 1S72A 5CQYA 2QQRA 4N0AC 5GANd 4QQ6A 2V8KA 3CC2A 1D3BA 5J26A 4C5EA 4XTVA 2DO3A 2RD1A 3V7CA 3M59A 2RHIA 5GAMg 1M4ZA 1MGQA 1BI3A 3HHTB 3NTIA 4ME7A 1JBMA 4N4GA 2DXTA 5CK9A 1VQKT 2P0QA 2NLUA 3KXTA 1WNLA 4A4FA 1YHQA 1X75C 4KT0E 1ZBXA 4E7IA 1U8RA 1YITA 1M90C 1OZ2A 2YLCA 2RJDA 4RKUE 3L2ZA 5HY6A 2JTFA 2LVMA 3OSVA 5CKFA 3GNGA 3S6WA 5GAMe 2QEXT 5I21A 3TCJA 5LJ3j 1VQ4A 1VQNA 4QVCA 3LH0A 1RI0A 1I8FA 2DKGA 2YLBA 3URGA 3LX7A 3JAME 3E19A 1ZHIA 3M55A 2OTJA 4ELZC 2DIQA 5KCOA 2O4XB 1YJNA 3V7RA 4XU3A 3X25B 2F5KA 3F70A 4RG2A 3L1AA 2DK3A 3RKXA 3L2UA 1YIJA 1Q82C 1NPRA 1VUBA 1Y71A 3OYYA 1VQ6A 2E1HA 2X4WA 4HCZA 1HK9A 1X01A 2LT4A 1N27A 1XNIA 3HSBA 4BY6B 4MZPA 2DXUA 4QW2A 3SD4A 1VQPT 2JNGA 5GAMh 3ASKA 5GMKl 1M8VA 1Q81C 3OYLA 3CCUA 2CKKA 1UEBA 3GPLA 4BE2A 1W2BS 1Q86U 3V8JA 3WVDB 4B9WA 2KAFA 4OF1A 4C8QB 3DKMA 3C12A 2CZ7B 4BDYA 4MZMA 3JCMP 1QVFS 2XU8A 3EFSA 3H6ZA 3OBYA 4ZGDB 4C92B 5LJ5j 4HA8A 1BI0A 4C8QF 5CO7A 2JUFA 1WJQA 3OQ5A 3CCMT 5M9OA 4M7AG 4M75F 4DA4A 3X24B 2BKDN 1K73C 5KE3A 2ZPIB 3N5BB 1SSFA 3CPWA 4QQGA 5GMKi 4X34A 3SWNB 1YI2T 1P92A 1UGRB 3CBMA 3M56A 4M77F 5A0DA 4RMOA 2LDMA 3BY7A 3S3MA 1KQ2A 3A8HB 2ZPEB 3A8GB 3VV0A 4OMFB 3VKIA 2RHYA 2L8DA 4N4HA 3LYIA 5J3BA 2H3JA 4XU0A 3VYHB 1KC8U 3VUZA 3VYGA 3FEOA 4XTXA 4EMKC 2P0PA 2VC8A 4ZN1A 3A8OB 2JVVA 3RERA 5HKCA 3GOXA 5LJ3e 2LT1A 4L5GA 2FVUA 3M4GA 2QEXA 5FU7B 3OYNA 4RCCA 4EMHA 4C8QD 3JB9J 2YHTA 4XTWA 4EMKB 1M1GA 1JB0E 3ER0A 2V8IA 4PL6A 4PJOF 3JCMJ 4PJOG 3OYAA 5LJ5f 3PT9A 2L5QA 4IUVA 2WSFE 4JRIA 2ZPFB 3BDUA 2DIGA 2MMPA 4M78B 4C5GA 1YCYA 1KD1C 3RUXA 5LJ3h 5A0LA 3ZFJA 4ZGEB 2OTLA 3JCMV 1W2BA 4PJOB 3MEWA 4XTZA 5AYFA 4M7AA 4VUBA 1M1FA 2K3YA 1XQHA 2FB7A 5CCAA 1S72T 3FDRA 4J7IA 3JCMf 3UDCA 2VGNA 3P8DA 3JCMc 3CC2T 3L2RA 4JRQA 2ZCFB 4IUQA 1JJ2S 2M16A 4C0FA 3CMAA 2A7YA 4YTLA 4BE1A 3CBOA 2DAQA 1LJOA 2KQWA 2LQ8A 4A53A 5KE2A 5GAMj 2OAUA 3M9QA 4NL2A 3JRZA 5LJ3d 4DOVA 3TU4K 1VQKA 1YBYA 1BI1A 1BI2A 1VQLT 2QQBA 4C0DB 4EMGA 1QW1A 4M75G 3JCMg 3L2QA 3CCJA 2O01E 2DJZA 2XDPA 4GLKA 3CCET 3G4ST 4J7FA 2EJGA 1H3ZA 2LRQA 5CVIA 5HK3A 3OMGA 5GAN5 3CD6T 2R58A 1VQ4T 2BUDA 2DEQA 4ELYC 1NJIU 1Y7XA 3MEUA 4BD3A 4MMKA 3LLRA 4F7UE 1KQ1A 1VQOA 3FLGA 1U1SA 4PLIA 4C92G 2EQKA 2DD5A 3S3OA 2KMTA 1YJNT 4N4IA 5GAOr 1H641 3OYDA 4L59A 4RCBA 3OYBA 4F7UB 4XQ3A 5GAOm 3OYHA 1YIJT 3I56A 2DTIA 2FYKA 2GF7A 4GY5A 4HKEA 2GQVA 2CZ0B 2L3RA 2EQJA 5A2QE 4M77C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM4 B;  2D0Q B;  3X25 B;  1UGP B;  2PUO B;  2WSE E;  1PSF A;  2ZZD A;  4L6V 5;  1JB0 E;  3QZ9 B;  3X26 B;  3X24 B;  4OB1 B;  3QZ5 B;  2DD4 A;  3A8M B;  1IRE B;  2CYZ B;  2WSF E;  2ZPI B;  2O01 E;  3HHT B;  2ZPF B;  2PVD B;  4ZGJ B;  1UGQ B;  2PVO B;  2PUK B;  3QYG B;  2DXB A;  1PSE A;  1UGR B;  4OB0 B;  3WVE B;  2CZ6 B;  4ZGE B;  2DXC A;  4KT0 E;  4OB3 B;  5L8R E;  2DPP B;  3A8H B;  2ZPE B;  3A8G B;  1UGS B;  2PU9 B;  2ZPB B;  4RKU E;  4Y28 E;  3X20 B;  2QDY B;  4OB2 B;  2PVG B;  3WVD B;  4ZGD B;  3QXE B;  2AHJ B;  2CZ7 B;  3QYH B;  3VYH B;  4XK8 E;  2ZPH B;  3X28 B;  2DD5 A;  1GXI E;  3VYG A;  1AHJ B;  1QP3 A;  3LW5 E;  2ZCF B;  3A8L B;  2ZPG B;  1DJ7 B;  3A8O B;  1QP2 A;  1V29 B;  2CZ1 B;  2CZ0 B;  2WSC E; 
#chains in the Genus database with same CATH topology
 1M5Q 1;  1R8O B;  2YSQ A;  1CSK A;  2HQH A;  1W2B P;  1PWT A;  4LUD A;  5FU6 B;  3OS2 A;  2VUB A;  1V76 A;  2FZK B;  1IZ6 A;  2YRV A;  4M77 G;  4M75 A;  2D0N A;  3M0T A;  2ZPB B;  4M78 C;  3MP8 A;  3G6E T;  2QQS A;  1RAB B;  4PJO C;  4FW2 A;  2JXB A;  3FJP A;  5I2M A;  4ZTJ A;  1OPL A;  1Y0M A;  2D0Q B;  2A3L A;  2K5F A;  4PJJ A;  2H3E B;  3TQ7 P;  4A4H A;  3CMA T;  3GNF B;  2CRE A;  3RBB B;  2WAC A;  1I1J A;  2GTJ A;  1MMG A;  2VB6 A;  2K7A A;  1M3A A;  2CS7 A;  3HRU A;  4MDW A;  1LPL A;  1RAG B;  2D6F A;  5FLX E;  4E7K A;  4PJO D;  2E65 A;  1Q7Y C;  2E41 A;  1ACM B;  3OA6 A;  1EIF A;  5IH2 A;  2BE9 B;  1NLO C;  3RMS A;  1NBE B;  1XOV A;  3CQT A;  3INZ A;  3SWN A;  4ZGJ B;  4M78 G;  2PUK B;  3E9G A;  4J83 A;  2JN0 A;  1QCF A;  1TS9 A;  2DE0 X;  5IN1 A;  1WHM A;  5GJV B;  2FPF A;  2LX9 A;  2O9V A;  1N5Z A;  3C95 A;  1VQL A;  3M0U A;  2K3X A;  2HNI A;  1G3T A;  4AFU C;  1FX7 A;  2X3W D;  3ZBD A;  4JZ4 A;  3CD6 A;  5GAN j;  3P8H A;  4NS5 A;  4IIM A;  4GBQ A;  2RA2 A;  1RAH B;  2QA4 Q;  3CPF A;  2AHJ B;  2XID A;  1YI2 Q;  1E7O A;  2KDS A;  1G3W A;  8ATC B;  3G7Z A;  2ZPG B;  1BB9 A;  1CKB A;  4R56 A;  4WCI A;  1G5V A;  3L2V A;  1C1A A;  5GAM d;  5LJ5 h;  5GAM f;  1D0Z A;  3HL8 A;  1NEB A;  4NOY A;  1OZ3 A;  1UGQ B;  1VYT A;  3OYJ A;  5I2S A;  1KQS S;  4BY6 C;  2M02 A;  4LD9 K;  2GBQ A;  1K8A C;  2K2V A;  1XJW B;  4PK4 A;  2L3P A;  1UB4 A;  2HAX A;  1TU0 B;  4FSS A;  3QO3 A;  3L42 A;  4C8Q A;  1K9M C;  3RMQ A;  4J5Y A;  1Q81 U;  1KHC A;  2DXB A;  3RIR A;  1B34 A;  3AT1 B;  3MCA B;  2Y4X A;  3CCE Q;  3QSU A;  3NFC A;  2HCK A;  2FHD A;  4Y91 A;  5HK0 A;  2RB6 A;  2RHU A;  3ZEH A;  1NZ9 A;  1C0M A;  2XD0 A;  1OYX A;  2K3B A;  2DRM A;  3BDL A;  2Y90 A;  1Q82 R;  1WA7 A;  2MWO A;  3EGU A;  1J3T A;  2C06 A;  2X9H A;  2W10 A;  4MML A;  4OB2 B;  2KXC A;  1X6O A;  4EMK A;  2CP3 A;  4J9F A;  3SFM A;  3DLL A;  1SRL A;  2RHX A;  2PTK A;  4C8Q E;  2DZ9 A;  3A98 A;  1I81 A;  3LWH A;  2RQW A;  2O88 A;  1MUZ A;  3REB B;  1JXM A;  2X4Y A;  3MEA A;  1GBR A;  3J80 E;  1N9S A;  2D8J A;  4F7U A;  3SEM A;  4V2S A;  1D09 B;  1M1K R;  2IIM A;  5GAO q;  3FB9 A;  2KBT A;  3I56 Q;  2CH4 A;  5EG2 A;  3NTH A;  1PG5 B;  4C92 F;  4J6W A;  2CP6 A;  2EYQ A;  8AT1 B;  3HFO A;  3JB9 G;  1EX4 A;  1BIB A;  1NJI C;  3CCS T;  5GAN 3;  2EW3 A;  2RI2 A;  2E70 A;  4A4E A;  3CCU Q;  5GMK h;  2OTJ Q;  2PZ1 A;  2NUT B;  4O6J A;  2LJ0 A;  3CCU T;  3FRN A;  4LXC A;  4XTU A;  4ZN3 A;  3CPW P;  4C0G A;  1QP3 A;  3A8L B;  4C5H A;  5KYY A;  1H3H A;  2QQ9 A;  2QTV A;  1K4U S;  4HVV A;  3JB9 H;  4O5V A;  3E1S A;  4LN2 A;  1KD1 U;  4J8O A;  3QDF A;  1IRE B;  1YIT T;  5HCK A;  2MIO A;  4P5N A;  1NLP C;  5AT1 B;  4M78 D;  2OTJ T;  3MP6 A;  5CR2 A;  1QMC A;  5DLO A;  1PKT A;  2FG0 A;  5I22 A;  1N9R A;  4M7D A;  4R55 A;  2KK4 A;  3JCM h;  3EFO A;  3CCQ A;  2RO0 A;  1UHC A;  1BYM A;  5LJ5 g;  3PNW C;  3HKS A;  1X27 A;  4OVA A;  2DA9 A;  3I55 A;  2LQK A;  4JDS A;  4OP0 A;  1QVG A;  1MV3 A;  1KC8 R;  2F5T X;  4Y28 E;  1EZZ B;  3OMC A;  4DBQ A;  2ATC B;  2K57 A;  2IPO B;  3JCM d;  2X4X A;  4BB7 A;  4WF2 A;  2X51 A;  1SRM A;  2QQR A;  5CQY A;  5GAN d;  4AFQ C;  4QQ6 A;  2V8K A;  1F1B B;  4ANJ A;  3M59 A;  2RHI A;  3NTI A;  1BI3 A;  5CK9 A;  4KGX B;  3O5Z A;  2AKL A;  1X75 C;  1ZBX A;  2CT4 A;  1YIT A;  2YLC A;  1IGU A;  3OSV A;  3GNG A;  5GAM e;  2B86 A;  3TCJ A;  4F17 A;  5D7U A;  4QVC A;  1YIJ Q;  1RI0 A;  1SKU B;  2LX7 A;  4XU3 A;  3F70 A;  3OYY A;  2CSI A;  4RTZ A;  3HSB A;  4BY6 B;  5FW9 A;  1Q95 G;  2JNG A;  4KH1 B;  2NWM A;  1RAC B;  3CCU A;  2EGC A;  2CKK A;  5GJW B;  2YT6 A;  4E7Z A;  4BE2 A;  1W2B S;  3WVD B;  4C8Q B;  4GLM A;  3H41 A;  1R0B G;  3EFS A;  2LJ3 A;  3H6Z A;  2DM1 A;  3X24 B;  5KYX A;  1SSF A;  3CPW A;  2LMJ A;  2LQW A;  5GMK i;  1SF9 A;  4M77 F;  1X43 A;  2JTE A;  3BY7 A;  1KQ2 A;  3CME Q;  1QWE A;  2L8D A;  4RTT A;  2CT3 A;  3VUZ A;  3FEO A;  2P0P A;  2JVV A;  3GOX A;  5LJ3 e;  2LT1 A;  5EC7 A;  4R0K A;  4RCC A;  4EMH A;  3EGX B;  5FWC A;  1OEB A;  3JCM J;  4PJO G;  3OYA A;  5LJ5 f;  1ARK A;  1VQ8 Q;  3I35 A;  2WSF E;  1TTH B;  1SEM A;  2EVR A;  2ZPF B;  2MMP A;  4M78 B;  3CCR Q;  2E4H A;  1RAE B;  1KD1 C;  5A0L A;  1UE9 A;  2K9G A;  4ZGE B;  1W2B A;  4PJO B;  5IXF A;  2KYM A;  3RDV A;  4VUB A;  2K3Y A;  3M0S A;  2HL3 A;  3UDC A;  3JCM c;  1K8A R;  3L2R A;  2ZCF B;  2A7Y A;  4YTL A;  2DAQ A;  2LQ8 A;  4A53 A;  3JRZ A;  2DFU A;  1YBY A;  1BI1 A;  1Y57 A;  2QQB A;  4M75 G;  3L2Q A;  2DJZ A;  2RF0 A;  3G4S T;  4J7F A;  2EJG A;  2KYB A;  1VQ4 T;  2BUD A;  4ELY C;  1NJI U;  1Y7X A;  3LLR A;  2K79 A;  1KQ1 A;  3FLG A;  4N4I A;  5GAO r;  3OYD A;  4L59 A;  3OYH A;  1YIJ T;  1NM7 A;  3I56 A;  4LUE A;  1VQ6 T;  4GY5 A;  2EBP A;  2L3R A;  4M77 C;  2OTL A;  1W4S A;  2VVK A;  4IUP A;  5CKH A;  3REA B;  2DL8 A;  1S1N A;  4IUU A;  5KYY B;  3JSC A;  1WGS A;  2E6Z A;  1N6A A;  1K9M U;  2PU9 B;  3RKY A;  1K8A U;  4M7A D;  1SG5 A;  1WPY A;  2VGM A;  3EG1 A;  2FPE A;  4F7U G;  2BZY A;  3CC4 Q;  2EYY A;  4LD6 A;  2F69 A;  4LDU A;  1YJ9 Q;  1AOJ A;  2K5I A;  4A4K A;  4BUG A;  1RLP C;  1YI2 A;  3G71 T;  1FWZ A;  4OMM A;  3CC4 T;  1KJW A;  4FIB A;  4D6W A;  4DEY A;  1ZX6 A;  1W6X A;  3OYM A;  1VQ5 A;  2QYZ A;  2O2O A;  4JS5 A;  1VQ7 T;  1FMK A;  1Y07 A;  2LCC A;  4HCB A;  3QKJ A;  4M75 E;  2LNH B;  3VU3 C;  1C6V X;  3V8L A;  1M27 C;  4X9C A;  2IVW A;  3Q1J A;  3QDR B;  4BI8 B;  4M7D F;  1YHQ Q;  3CPW S;  2RK2 A;  1JQQ A;  2A37 A;  1X69 A;  4XU1 A;  2VYT A;  1MNE A;  3M4Y A;  1PKS A;  2ZAE A;  3FJ5 A;  2DL3 A;  3QG1 A;  1QKW A;  1JRI A;  4LDY A;  1TH7 A;  2QQA A;  1WZO A;  1DJ7 B;  2YRD A;  2V1R A;  1NYF A;  4FL6 A;  3UPU A;  1VQ8 A;  5I11 A;  3SWN C;  3TSZ A;  3G71 Q;  1Q82 U;  1KK7 A;  3SHW A;  2JMA A;  2MWP A;  3G4S Q;  3H0F A;  4FU6 A;  2K5L A;  3M0R A;  1E6H A;  1X2K A;  4E47 A;  3UT1 A;  3GLX A;  3PGG A;  1K76 A;  3NMZ C;  2CSQ A;  2J6O A;  4Z88 A;  3EG9 B;  3E9F A;  5D6W A;  1S72 Q;  2EGA A;  2QA4 A;  1WHK A;  3NTK A;  2AIR B;  1WHJ A;  1D1C A;  2GCX A;  2MF2 A;  2PNI A;  4HXJ A;  4DEX A;  3CCS A;  4FYV B;  2O9S A;  1PSE A;  2HSP A;  1OPK A;  4C8Q C;  2DXC A;  5L8R E;  1TUD A;  2QDL A;  4C5I A;  2KE9 A;  3M57 A;  2RQU A;  1GXI E;  5DY9 A;  3VS1 A;  2RH2 A;  1ZBJ A;  3AHU A;  4KUD K;  2COW A;  1TG0 A;  3QWX X;  3HPW A;  3G71 A;  3CCV T;  1BCM A;  2NUZ A;  1YJN Q;  1PD1 A;  1I07 A;  2ZZD A;  2YUN A;  2BZX A;  2FPD A;  3QZ5 B;  4J6Y A;  1LOJ A;  3MJX A;  1VQ8 T;  3QJY A;  2ROT A;  2EJF A;  2RI3 A;  1OI1 A;  4ORZ A;  1VQ7 Q;  4M75 C;  3UF4 A;  4E7J A;  5KYX B;  4M78 A;  1B07 A;  1CKA A;  4XTY A;  3BE3 A;  2ESW A;  3EG0 A;  4RTV A;  3PE0 A;  1QVP A;  2E6N A;  2XI9 A;  1ZSZ A;  2FL7 A;  2A36 A;  1EFN A;  3QJ6 A;  4A54 A;  3EGD B;  1AD5 A;  4J6X A;  1PNJ A;  2E5Q A;  3MPU B;  3OW2 A;  2Z0W A;  3TVT A;  4E7L A;  1PRM C;  1JO8 A;  5KYW B;  1WJS A;  2DL4 A;  1VQ9 A;  2RI5 A;  2FZG B;  3OS1 A;  1KFZ A;  2RN8 A;  2HDA A;  2J05 A;  4CRI A;  1AEY A;  4RG8 A;  4JJN K;  4JJD A;  2K2M A;  2G3R A;  3X20 B;  4AFZ C;  1QVG S;  4AFS C;  3OW2 S;  1Q86 R;  4PKC C;  2QAS A;  3G1J A;  2QK0 A;  3VJP A;  1KSW A;  3QBY A;  2M0Y A;  4JJC A;  1N8R U;  3C4S A;  5KCH A;  2HKQ B;  1MND A;  4PJO E;  2QTX A;  3EG2 A;  2XKO C;  1AWO A;  2X4J A;  1B7T A;  3LGL A;  1I4K 1;  5L23 A;  1K0X A;  2H8H A;  3QYG B;  3GBQ A;  2MPX C;  2DMO A;  1UGS B;  1MMA A;  2MI6 A;  2EQU A;  1K9M R;  4DOW A;  1QLY A;  3OY9 A;  4M77 A;  5J39 A;  2JM8 A;  5GMK m;  2L3Q A;  1ZSZ C;  3CCR A;  2XDB A;  1WLP B;  1D1B A;  1UGP B;  2EJ9 A;  3EGX A;  4L6V 5;  4OB1 B;  2F2W A;  2PVD B;  4BAC A;  3H0I A;  1RAD B;  5GAN 2;  3JCM W;  2GNC A;  1AT1 B;  3J7A F;  2KRO A;  4CC3 A;  2DRK A;  1OOT A;  3SB2 A;  4J9H A;  4XAX B;  1UGV A;  3CCS Q;  4KBM B;  1GL5 A;  2JTM A;  2EKH A;  1U3O A;  4FSX A;  2JMC A;  4M7D G;  2R5A A;  5GAN 6;  2J6F A;  3E2U A;  3V8K A;  3CEY A;  3HP9 A;  3CD6 Q;  3QPH A;  4BI4 A;  1GFD A;  2YUQ A;  5C6S A;  4J9I A;  5LJ3 f;  4MDX A;  1O75 A;  3CME A;  2CGH A;  1FXX A;  1M1K U;  5CKD A;  2CP2 A;  2B8A A;  2VXF A;  5CQX A;  4E2F B;  2KRS A;  4RTX A;  1Y96 B;  2CUD A;  5GAN f;  3PIO A;  1IO6 A;  2ROL A;  1B3Q A;  2P4R A;  4C5E A;  2DO3 A;  1IHV A;  3V7C A;  1RAI B;  3RNJ A;  1MGQ A;  4N4G A;  3HHT B;  1Z9Q A;  1VQK T;  3KXT A;  4A4F A;  4KT0 E;  1U8R A;  1OZ2 A;  2LJ1 A;  1NG2 A;  4RKU E;  3L2Z A;  5CKF A;  5LJ3 j;  4DBF A;  4AG1 C;  4OML A;  1I8F A;  1ZUY A;  1UJ0 A;  2YLB A;  2OTL Q;  3E19 A;  4ELZ C;  3X25 B;  3L1A A;  1Q82 C;  2LT4 A;  1N27 A;  1WYX A;  4QW2 A;  3SD4 A;  3ASK A;  5GMK l;  1IRX A;  1YIT Q;  1UEB A;  3GPL A;  1Q86 U;  2LZ6 B;  3C12 A;  3ULR B;  4MZM A;  3TSW A;  3CC7 Q;  1QVF S;  2GGR A;  4ZGD B;  5LJ5 j;  4HA8 A;  3U23 A;  5CO7 A;  1R0C B;  3CCM T;  2E3I A;  4IIO A;  5M9O A;  4AT1 B;  2DNU A;  4M75 F;  2BKD N;  1ABQ A;  2ZPI B;  1P92 A;  3M56 A;  3CBM A;  3S3M A;  2RHY A;  4N4H A;  2H3J A;  3VS0 A;  1KC8 U;  3EGD A;  4EMK C;  4ZN1 A;  1I5O B;  3RER A;  3VS5 A;  1KD1 R;  5FU7 B;  3OYN A;  4B6M A;  4C8Q D;  2YHT A;  1M1G A;  3ER0 A;  4OMQ A;  2V8I A;  4PL6 A;  4PJO F;  3CCM Q;  2EYX A;  1ZLM A;  2L5Q A;  4JRI A;  3BDU A;  2BZ8 A;  2LP5 A;  3RUX A;  3JCM V;  1WI7 A;  2L0A A;  3FDR A;  4J7I A;  2VGN A;  3P8D A;  4EIK A;  4C0F A;  4BE1 A;  1GRI A;  3CCJ Q;  2OAU A;  3M9Q A;  5LJ3 d;  6AT1 B;  3CCJ A;  2O01 E;  1X6G A;  4J9B A;  1UHF A;  1H3Z A;  2LRQ A;  5CVI A;  3I9Q A;  4OMN A;  4BD3 A;  3R6N A;  4PLI A;  2EQK A;  3S3O A;  1UEC A;  2KMT A;  3VS2 A;  3VRY A;  2CH4 W;  1HJD A;  2NUP B;  2EQJ A;  1YN8 A;  3TRE A;  2CYZ B;  1KHI A;  4LDW A;  3DLM A;  2LCL A;  3J81 E;  3M5A A;  2YRC A;  4OGE A;  4FT2 A;  3CCL T;  2FEI A;  1WIE A;  1K73 U;  5A0G A;  2HMA A;  4RTY A;  2JZ2 A;  1G2B A;  1TSF A;  4FYX B;  1WXB A;  4MZT A;  3EHR A;  2C0I A;  3I5S A;  5FRM A;  2XIC A;  2D1X A;  2E12 A;  3MEV A;  4KUI A;  3JB9 F;  2I0N A;  4M7D D;  2QG9 B;  2NUT A;  5LJ5 d;  4OMP A;  2C0T A;  2VV5 A;  2CUB A;  1MHN A;  1JJ2 A;  3JB9 I;  3EFO B;  1UDL A;  4EPC A;  5DM7 R;  3CCE A;  1G83 A;  2PQW A;  2W0Z A;  5GAO l;  1QP2 A;  3M0Q A;  2DER A;  1I5L A;  1KQS P;  1JEG A;  4D8K A;  1N8R C;  3BFM A;  3QZ9 B;  2R5M A;  2G6F X;  2FO0 A;  2OTL T;  1R77 A;  2IG0 A;  5IT9 E;  1UFF A;  2GFU A;  5KYU B;  3JCM b;  2BIV A;  1Z9Z A;  2M51 A;  3EHQ A;  2DTO A;  2HBP A;  2Y4Y A;  1K1Z A;  2GQI A;  2HSE B;  3EAE A;  4JRP A;  3CCJ T;  4HT9 A;  1NE8 A;  1WHH A;  3D7S B;  4M7A F;  1WQW A;  2KR3 A;  2DVJ A;  3FIF A;  2O4X A;  1VQO T;  5C0M A;  5IHN A;  1M9S A;  4IUT A;  1VQM T;  4JRK A;  1E6G A;  3RR6 A;  3MKD A;  4C0Z A;  3CC7 A;  3EH1 A;  1TWB A;  1VQO Q;  2DZC A;  3OYC A;  4X9D A;  2KEA A;  4DBR A;  5IAY A;  2DTH A;  2I2L A;  4II1 A;  5GMK j;  4Z89 A;  2RJE A;  4QVD A;  4C92 A;  1SPK A;  2VWF A;  4RTU A;  3G6E A;  1IXD A;  1M8M A;  2HQX A;  1LNX A;  4XU2 A;  1YJW T;  3WXM B;  2K4Y A;  2FZC B;  2ZPH B;  2KSS A;  1VQP Q;  2M0O A;  2JT4 A;  4M7D C;  4CC2 A;  2WSC E;  1VIE A;  1BK2 A;  4Y92 A;  1WX6 A;  2J6K A;  3VUB A;  1FMV A;  4C92 C;  1VQ5 T;  2DVE A;  2HKN A;  4E6R A;  1BBZ A;  3KUF A;  1UJY A;  2DIL A;  2L3S A;  4IUR A;  2V8J A;  5FU7 C;  4M7A C;  1UG1 A;  3M0P A;  3UWN A;  3PTA A;  3MET A;  2JS2 A;  2M1H A;  5FU6 C;  5LJ3 g;  4BI3 A;  1ZQ1 A;  2F1L A;  5LL6 S;  5GAN g;  2RK1 A;  2KT1 A;  1VQ5 Q;  1AZG B;  1RAA B;  3OYF A;  1QVF P;  1LCK A;  4M77 D;  3FC3 A;  1NEG A;  4LDX A;  2ABL A;  1YJW Q;  4HVU A;  4Q5W A;  2MAM A;  3I55 T;  3CME T;  3HRT A;  4A4G A;  1G3S A;  1V29 B;  1YWP A;  4QT7 A;  4M7A E;  3PVQ A;  3P8B B;  2C0O A;  7AT1 B;  5FRO A;  1SHF A;  3JCM e;  4JUV A;  4JJB A;  2HD0 A;  1Q86 C;  4RTW A;  1PRL C;  3CBP A;  5KYU A;  3TEE A;  4CI0 C;  3LGF A;  2QDY B;  3THK A;  4LDV A;  4X1V A;  4J9C A;  3OYI A;  1QWF A;  3CCQ T;  3OYG A;  1HYO A;  4BE0 A;  1PSF A;  1TXQ A;  2LTO A;  1BU1 A;  4PJN A;  2DEU A;  1WJR A;  2KY9 A;  2RNA A;  2CZ6 B;  3CC2 Q;  4FT4 A;  3OBW A;  2DBM A;  3PVL A;  3ME9 A;  5GAO n;  3X28 B;  1O9S A;  1BIA A;  3ZL7 C;  5GAO p;  3C94 A;  1H92 A;  2PUO B;  2YXY A;  2LNV A;  3OYK A;  3MO8 A;  2EGE A;  3JCM Q;  2V1Q A;  4PLL A;  3OB9 A;  4DQ2 A;  1SHG A;  2DD4 A;  4F16 A;  3NPF A;  5GAN 8;  3OS0 A;  1WHL A;  2XMF A;  3WVE B;  2BE7 D;  2P0K A;  4OB3 B;  2DPP B;  4PJO A;  3MHX A;  5LJ5 e;  3CCV Q;  1KQS A;  3O8V A;  1TUG B;  3CCQ Q;  1KG1 A;  3UAT A;  2QEX Q;  1WXU A;  3KBG A;  1VQP A;  3OS5 A;  1AWX A;  4ATO A;  1MMN A;  4M77 E;  2DYI A;  1M90 U;  1VYU A;  1OU8 A;  3PIP A;  4F7U F;  3PFS A;  1VQ9 T;  4QKU A;  1WFW A;  5CIU A;  4J9G A;  1YP5 A;  3OYE A;  2FRW A;  2HBW A;  1LVK A;  2J06 A;  4XTV A;  5ECA A;  2HL5 C;  1T3S A;  2DXT A;  2NLU A;  1WNL A;  2J7I A;  1YHQ A;  4E7I A;  2RJD A;  2JM9 A;  1VOM A;  3LH5 A;  4AG2 C;  3S6W A;  2V26 A;  1ZA1 B;  5I21 A;  1VQ4 A;  3LH0 A;  3VS7 A;  3JAM E;  3M55 A;  1ZHI A;  3G6E Q;  2DIQ A;  2O4X B;  2JJ9 A;  4RG2 A;  1YIJ A;  1M3B A;  1VQ6 A;  2X4W A;  4CC7 A;  5IXB A;  4HCZ A;  1MMD A;  1X01 A;  1QKX A;  1VQN Q;  1JJ2 P;  1XNI A;  1VYV A;  1PM3 A;  4F14 A;  4MZP A;  3I5R A;  1IGQ A;  1Q81 C;  2YDL A;  2KAF A;  1U5S A;  3DKM A;  2CZ7 B;  2LCS A;  2ED0 A;  1V1C A;  3OBY A;  4C92 B;  1BI0 A;  2JUF A;  3OQ5 A;  1TUC A;  3KFV A;  2KRM A;  4DA4 A;  5KE3 A;  1PHT A;  1UTI A;  4X34 A;  3SWN B;  1UGR B;  2VKN A;  5A0D A;  4D8D A;  3A8H B;  3A8G B;  3VV0 A;  4J9D A;  2RPN A;  3LYI A;  3VYH B;  4XU0 A;  2RQT A;  2VC8 A;  3A8O B;  5HKC A;  2OJ2 A;  3M4G A;  2BTT A;  4XTW A;  1JB0 E;  1TOV A;  3PT9 A;  4IUV A;  2KI7 A;  1I0C A;  2DIG A;  1QCN A;  3MEW A;  1HSQ A;  4XTZ A;  1AVZ C;  4M7A A;  2MK5 A;  1XQH A;  5CCA A;  1S72 T;  1K0S A;  3JCM f;  3CC2 T;  1JJ2 S;  4JRQ A;  4IUQ A;  3CMA A;  2YWW A;  5KE2 A;  3TU4 K;  4DOV A;  1VQK A;  1OU9 A;  1M2V B;  1YFN A;  1VQL T;  4A63 B;  2OI3 A;  4C0D B;  4EMG A;  2MOX A;  4GLK A;  1D1A A;  3OMG A;  5GAN 5;  2A0F B;  1PCX A;  3MEU A;  1Q7Y R;  2DD5 A;  4PFZ A;  1YJN T;  1H64 1;  4RCB A;  5GAO m;  2DTI A;  2FYK A;  4HKE A;  1N8R R;  2GQV A;  3A8M B;  2CZ0 B;  4NL3 A;  1VIF A;  1AWJ A;  3BW1 A;  4N0A A;  2DLP A;  4M77 B;  4ZTF A;  1KC8 C;  3M58 A;  4JZ3 A;  4HT8 A;  4OB0 B;  9ATC B;  1B34 B;  1Q81 R;  3QXE B;  2R57 A;  3LW5 E;  3C0C A;  2RQV A;  4UC4 A;  2RJC A;  2P84 A;  2XG8 D;  4AMC A;  2EYZ A;  2LQN A;  1U1T A;  1ABO A;  1VQL Q;  2A08 A;  2LC4 A;  1K9A A;  4M78 E;  3CCV A;  1W70 A;  3T9N A;  2EYW A;  2ECZ A;  3HRS A;  1VQM A;  1HD3 A;  2D8H A;  1NJI R;  1RAF B;  3SDZ A;  2OAW A;  2AZS A;  5CKB A;  3EH2 A;  1YJ9 T;  5FWB A;  1T0J A;  3EFR A;  1NPP A;  2EIF A;  1ZUK A;  3CXC S;  2JS0 A;  1Y96 A;  2DBK A;  2YUP A;  2FRY A;  3DB4 A;  5CAI A;  4M7D E;  1D0X A;  2QGG A;  1PD0 A;  4M7D B;  4HVW A;  2A28 A;  3VS4 A;  1AHJ B;  3GP8 A;  2RJF A;  4J9E A;  4PNO A;  3JV3 A;  2EQM A;  3L2W A;  1WQ7 A;  4Z8A A;  4B9X A;  3G4S A;  1XTD A;  2RM4 A;  4OGC A;  5KH6 A;  1YNZ A;  3CC4 A;  1M1K C;  1GCQ C;  2M9U A;  2AKK A;  3QII A;  4M7A B;  3DB3 A;  3CXC P;  3QWY A;  3I56 T;  1A0N B;  3QYH B;  4LE9 A;  1K73 R;  3IQL A;  1D0Y A;  2XDD A;  4HCC A;  3MP1 A;  1OX9 A;  3H8Z A;  4OMO A;  1M2V A;  2WSE E;  5D6Y A;  1GBQ A;  2HQE A;  2EAY A;  4FW1 A;  3CCL A;  5FRN A;  3R6O A;  4FCY A;  1M30 A;  2F2V A;  2XK0 A;  4PFO A;  2X35 A;  3RKW A;  2CZ1 B;  4KRT A;  3S3N A;  1BCO A;  3PMT A;  4JLG A;  4FM4 B;  2RMO A;  1WHG A;  2O31 A;  3A5Z B;  1VQ6 Q;  1IHW A;  1OUL A;  2HEQ A;  2PVO B;  1VQ7 A;  1MV0 B;  4M75 B;  1FYN A;  5GMK e;  3A1P A;  1VQ4 Q;  4M75 D;  1YJ9 A;  3NGP A;  1OQK A;  2GTO A;  4C92 E;  2EWN A;  2QXF A;  3VRZ A;  1VA7 A;  1U06 A;  2CP7 A;  4JLI A;  2DL5 A;  1G8X A;  1D3B B;  2RQR A;  1BKB A;  2QA4 T;  5GAN 4;  2VAS A;  4K11 A;  1YCS B;  4PFP A;  3QUI A;  3VS6 A;  2JOY A;  3CCR T;  1QVF A;  3NHN A;  2DL7 A;  1RI9 A;  1T0H A;  4ESR A;  4E7H A;  1YJW A;  4C0D C;  2X3X D;  3X26 B;  1JU5 C;  1RLQ C;  3LWI A;  3M53 A;  1ZSG A;  2F2X A;  2QGF B;  3PMI A;  5DLQ E;  5GAN h;  4PJM A;  1M90 R;  3CC7 T;  4KUL A;  4BDZ A;  2DJQ A;  3V7S A;  3GIB A;  2PVG B;  1YHQ T;  1Q7Y U;  4XK8 E;  2DET A;  1QCO A;  1GCP A;  1VQ9 Q;  2ED1 A;  3M54 A;  4C8Q G;  3HTR A;  3JCM X;  2E64 A;  4RUG A;  3OSS C;  2L89 A;  3HFN A;  2ZGW A;  2EKO A;  2KT8 A;  2NUP A;  2RHZ A;  1GCQ A;  1RL2 A;  4FYY B;  4EDU A;  2EPD A;  2KVQ G;  5GAN 7;  4Z02 A;  2E10 A;  2GFA A;  4KGV B;  4M78 F;  4TVR A;  4JS4 A;  2XHC A;  2NYS A;  3CCM A;  1IB8 A;  1VQN T;  3QHS A;  5IHI A;  4C92 D;  4QQD A;  5D6X A;  1AZE A;  4QVZ A;  2D9T A;  1KIK A;  4LNP A;  2ENM A;  3I55 Q;  5CKE A;  2EFI A;  3OW2 P;  2SRC A;  2JW4 A;  4FYW B;  1QVG P;  2COY A;  2QI2 A;  3JB9 D;  1HXD A;  2VXE A;  1GFC A;  3H0H A;  3VS3 A;  1VQK Q;  2AK5 A;  3RES A;  2OX7 A;  4IKF A;  3CXC A;  1WXT A;  5GAN e;  2P4T A;  1H8K A;  1G3Y A;  2E3H A;  5KYN A;  3GF5 A;  4PJL A;  1S72 A;  2L2P A;  4N0A C;  4WTO B;  3CC2 A;  1D3B A;  5J26 A;  2RD1 A;  3H9N A;  5GAM g;  1M4Z A;  4ME7 A;  3EG9 A;  5IHK A;  1JBM A;  4M4Z A;  2P0Q A;  1M90 C;  1PC0 A;  1RUW A;  5HY6 A;  2JTF A;  2LVM A;  2EQI A;  2QEX T;  5KYW A;  1VQN A;  1AWW A;  2DKG A;  2OTJ A;  3URG A;  3LX7 A;  1X2Q A;  1FMW A;  5KCO A;  1YJN A;  3V7R A;  2F5K A;  3RKX A;  3L2U A;  2DK3 A;  4CC4 B;  1NPR A;  1UUE A;  1VUB A;  1Y71 A;  2E1H A;  1HK9 A;  2AT1 B;  2DXU A;  1VQP T;  5GAM h;  4JPB W;  1M8V A;  3OYL A;  1ZA2 B;  2KNB B;  3V8J A;  4B9W A;  4OF1 A;  4BDY A;  1VQM Q;  3JCM P;  2K6D A;  2XU8 A;  4HCK A;  4C8Q F;  1WJQ A;  4M7A G;  1YWO A;  4ZNX A;  3EG3 A;  1K73 C;  4KGZ B;  4E7S A;  2SEM A;  3N5B B;  4QQG A;  1YI2 T;  4RMO A;  2DF6 A;  2LDM A;  2ZPE B;  4OMF B;  3VKI A;  5J3B A;  3VYG A;  1WDX A;  4XTX A;  2MCN A;  2CP0 A;  4L5G A;  2FVU A;  2QEX A;  2DYB A;  1NYG A;  3JB9 J;  4EMK B;  2QAZ A;  2DX1 A;  4F04 B;  4C5G A;  1YCY A;  5LJ3 h;  1JXO A;  3ZFJ A;  2CP5 A;  3UA6 A;  2YUO A;  5AYF A;  1M1F A;  2FB7 A;  1OV3 A;  1OX8 A;  1ZSZ B;  2E5K A;  1T3L A;  4KH0 B;  1QQJ A;  2M16 A;  3CBO A;  1M2O A;  1LJO A;  1ZUU A;  2KQW A;  2COZ A;  1X6B A;  2CDT A;  5GAM j;  4NL2 A;  1BI2 A;  3CMA Q;  1QW1 A;  3JCM g;  1M3C A;  3UA7 A;  2XDP A;  3CCE T;  2MYS A;  4DBH A;  2KXD A;  5HK3 A;  2AZV A;  3CD6 T;  2R58 A;  1SSH A;  2DEQ A;  4MMK A;  4F7U E;  1VQO A;  3CCL Q;  4C92 G;  1U1S A;  2KRN A;  1W1F A;  3OYB A;  2HZY A;  4XQ3 A;  4F7U B;  2GF7 A;  2KGT A;  5A2Q E; 
#chains in the Genus database with same CATH homology
 1VIF A;  1W4S A;  1M5Q 1;  1R8O B;  3TRE A;  3BW1 A;  4IUP A;  4N0A A;  5CKH A;  4M77 B;  5FU6 B;  3OS2 A;  2CYZ B;  2VUB A;  4ZTF A;  1KC8 C;  4IUU A;  1KHI A;  3M58 A;  1IZ6 A;  4LDW A;  3DLM A;  3JSC A;  1WGS A;  2YRV A;  2LCL A;  4OB0 B;  3M5A A;  4OGE A;  3J81 E;  4HT8 A;  4M77 G;  2E6Z A;  1B34 B;  1N6A A;  4M75 A;  1K9M U;  2PU9 B;  2ZPB B;  4M78 C;  4FT2 A;  3CCL T;  3RKY A;  3MP8 A;  3G6E T;  1K73 U;  1K8A U;  3QXE B;  2QQS A;  2R57 A;  5A0G A;  4M7A D;  4PJO C;  1WPY A;  3FJP A;  2JZ2 A;  2VGM A;  3LW5 E;  5I2M A;  4F7U G;  4ZTJ A;  4LD6 A;  4UC4 A;  2F69 A;  4LDU A;  2RJC A;  4MZT A;  2XG8 D;  1U1T A;  2K5I A;  2D0Q B;  4A4K A;  4BUG A;  5FRM A;  2A3L A;  2XIC A;  2K5F A;  2E12 A;  1YI2 A;  3MEV A;  3CMA T;  4A4H A;  2LC4 A;  4M78 E;  4KUI A;  1FWZ A;  3GNF B;  3G71 T;  3CCV A;  3T9N A;  3CC4 T;  3JB9 F;  4M7D D;  3A8M B;  2WAC A;  5LJ5 d;  3HRS A;  4FIB A;  1VQM A;  4D6W A;  2VV5 A;  1MHN A;  3SDZ A;  3OYM A;  1VQ5 A;  1JJ2 A;  3JB9 I;  2CS7 A;  3HRU A;  4MDW A;  4EPC A;  5DM7 R;  3CCE A;  1VQ7 T;  4JS5 A;  2PQW A;  2D6F A;  5FLX E;  5GAO l;  4E7K A;  4PJO D;  1Y07 A;  2E65 A;  2LCC A;  5CKB A;  1YJ9 T;  2E41 A;  3QKJ A;  1Q7Y C;  4HCB A;  3OA6 A;  4M75 E;  1QP2 A;  3EFR A;  1NPP A;  1EIF A;  3VU3 C;  1I5L A;  1N8R C;  3BFM A;  2EIF A;  3QZ9 B;  3RMS A;  3V8L A;  4X9C A;  3CXC S;  2R5M A;  1XOV A;  2IVW A;  2OTL T;  3Q1J A;  1Y96 A;  2IG0 A;  3INZ A;  3QDR B;  3SWN A;  4BI8 B;  4ZGJ B;  4M78 G;  4M7D F;  2PUK B;  3DB4 A;  3E9G A;  4J83 A;  5CAI A;  3CPW S;  2JN0 A;  5IT9 E;  4M7D E;  2RK2 A;  2GFU A;  3JCM b;  4XU1 A;  2BIV A;  2VYT A;  3M4Y A;  5IN1 A;  4M7D B;  2LX9 A;  3QG1 A;  1AHJ B;  1JRI A;  2DTO A;  3GP8 A;  4LDY A;  1TH7 A;  2QQA A;  3C95 A;  2HBP A;  1DJ7 B;  2RJF A;  2Y4Y A;  1VQL A;  4PNO A;  4JRP A;  3EAE A;  2K3X A;  4FL6 A;  2EQM A;  2HNI A;  3L2W A;  3CCJ T;  1NE8 A;  1WQ7 A;  3UPU A;  1VQ8 A;  4HT9 A;  4B9X A;  1G3T A;  3G4S A;  3SWN C;  1FX7 A;  1Q82 U;  3ZBD A;  1XTD A;  3CD6 A;  4M7A F;  1WQW A;  2RM4 A;  3P8H A;  4OGC A;  5GAN j;  4NS5 A;  5KH6 A;  2MWP A;  4FU6 A;  2RA2 A;  3FIF A;  2O4X A;  1VQO T;  5C0M A;  2K5L A;  1M1K C;  3CC4 A;  2M9U A;  1M9S A;  3CPF A;  3QII A;  4M7A B;  4IUT A;  3DB3 A;  1VQM T;  4JRK A;  4E47 A;  3I56 T;  3UT1 A;  3QYH B;  2AHJ B;  2XID A;  3GLX A;  4C0Z A;  3CC7 A;  3PGG A;  2KDS A;  1G3W A;  2XDD A;  2DZC A;  3E9F A;  5D6W A;  3G7Z A;  4X9D A;  3OYC A;  4HCC A;  2ZPG B;  3MP1 A;  5IAY A;  2QA4 A;  2DTH A;  3H8Z A;  3NTK A;  1VQ6 T;  4R56 A;  2I2L A;  2WSE E;  3L2V A;  1G5V A;  5GAM d;  5LJ5 h;  5GAM f;  2MF2 A;  2GCX A;  3HL8 A;  5D6Y A;  4II1 A;  4NOY A;  5GMK j;  2RJE A;  2HQE A;  1OZ3 A;  4QVD A;  2EAY A;  3CCS A;  3CCL A;  1UGQ B;  4C92 A;  5FRN A;  3G6E A;  1PSE A;  3OYJ A;  3R6O A;  4C8Q C;  2DXC A;  5L8R E;  5I2S A;  1KQS S;  4BY6 C;  2HQX A;  1LNX A;  4XU2 A;  4C5I A;  4LD9 K;  1YJW T;  3WXM B;  3M57 A;  1K8A C;  2K4Y A;  2K2V A;  2XK0 A;  2ZPH B;  2KSS A;  5DY9 A;  1GXI E;  2RH2 A;  2M0O A;  4M7D C;  3AHU A;  4KUD K;  2X35 A;  3RKW A;  2CZ1 B;  3HPW A;  3G71 A;  3PMT A;  3CCV T;  2WSC E;  1VIE A;  1UB4 A;  4JLG A;  3S3N A;  2HAX A;  4FM4 B;  2ZZD A;  3VUB A;  3A5Z B;  3QO3 A;  3QZ5 B;  3L42 A;  4C92 C;  4C8Q A;  1VQ5 T;  2DVE A;  4J6Y A;  1K9M C;  3RMQ A;  1LOJ A;  4J5Y A;  1VQ8 T;  3KUF A;  3QJY A;  2PVO B;  1Q81 U;  1KHC A;  2DXB A;  1VQ7 A;  3RIR A;  1B34 A;  4M75 B;  5GMK e;  2EJF A;  2RI3 A;  3MCA B;  4M75 D;  1OI1 A;  1YJ9 A;  2Y4X A;  4M75 C;  3QSU A;  3NFC A;  4E7J A;  4IUR A;  4M78 A;  2V8J A;  5FU7 C;  2EWN A;  4C92 E;  4M7A C;  2FHD A;  2QXF A;  4XTY A;  4Y91 A;  5HK0 A;  2RB6 A;  2RHU A;  3UWN A;  4JLI A;  3ZEH A;  3MET A;  3PTA A;  1NZ9 A;  2M1H A;  5FU6 C;  2XD0 A;  5LJ3 g;  4BI3 A;  1ZQ1 A;  1QVP A;  1OYX A;  2E6N A;  2XI9 A;  1D3B B;  2FL7 A;  5LL6 S;  1BKB A;  3BDL A;  2Y90 A;  2QA4 T;  5GAN g;  3QJ6 A;  2RK1 A;  4A54 A;  5GAN 4;  2MWO A;  3OYF A;  4J6X A;  2C06 A;  4M77 D;  3FC3 A;  2E5Q A;  3OW2 A;  4MML A;  3QUI A;  4LDX A;  4OB2 B;  3I55 T;  4Q5W A;  1X6O A;  2MAM A;  4EMK A;  4E7L A;  3SFM A;  3CME T;  2JOY A;  3DLL A;  3CCR T;  1QVF A;  3HRT A;  1WJS A;  2RHX A;  4A4G A;  4C8Q E;  1YJW A;  2DZ9 A;  4E7H A;  1I81 A;  1G3S A;  1V29 B;  1VQ9 A;  3LWH A;  2RI5 A;  4C0D C;  3OS1 A;  4M7A E;  3P8B B;  2X4Y A;  5FRO A;  3X26 B;  3JCM e;  4JUV A;  3MEA A;  3J80 E;  1N9S A;  4CRI A;  2HD0 A;  4F7U A;  1Q86 C;  3LWI A;  3M53 A;  4RG8 A;  4JJN K;  4V2S A;  5DLQ E;  3PMI A;  2G3R A;  5GAN h;  5GAO q;  3CBP A;  3TEE A;  4CI0 C;  3CC7 T;  3FB9 A;  4KUL A;  3X20 B;  4BDZ A;  1QVG S;  3LGF A;  2QDY B;  3V7S A;  2PVG B;  4LDV A;  3GIB A;  3OW2 S;  5EG2 A;  1YHQ T;  3NTH A;  4XK8 E;  1Q7Y U;  4C92 F;  4J6W A;  4PKC C;  2EYQ A;  3OYI A;  3HFO A;  3JB9 G;  3VJP A;  3CCQ T;  3QBY A;  1BIB A;  1NJI C;  1N8R U;  3OYG A;  3C4S A;  5KCH A;  3M54 A;  4C8Q G;  4BE0 A;  3JCM X;  1PSF A;  5GAN 3;  3CCS T;  4PJO E;  2E64 A;  2QTX A;  2RI2 A;  2E70 A;  2LTO A;  2XKO C;  2X4J A;  3OSS C;  4A4E A;  2L89 A;  1I4K 1;  3LGL A;  3HFN A;  3QYG B;  2ZGW A;  1WJR A;  2KY9 A;  5GMK h;  2CZ6 B;  2EKO A;  4FT4 A;  1UGS B;  2MI6 A;  3OBW A;  2EQU A;  4DOW A;  2RHZ A;  3ME9 A;  4O6J A;  5GAO n;  3OY9 A;  3CCU T;  3FRN A;  3X28 B;  1O9S A;  4XTU A;  1BIA A;  4ZN3 A;  1RL2 A;  1QP3 A;  4M77 A;  4C0G A;  4EDU A;  5J39 A;  5GMK m;  5GAO p;  3A8L B;  3C94 A;  4C5H A;  2PUO B;  2QQ9 A;  2KVQ G;  5GAN 7;  2LNV A;  3CCR A;  2XDB A;  3OYK A;  4O5V A;  3JB9 H;  3MO8 A;  4Z02 A;  1UGP B;  2E10 A;  2EJ9 A;  2GFA A;  3JCM Q;  3E1S A;  4L6V 5;  3OB9 A;  4M78 F;  4PLL A;  4TVR A;  4J8O A;  1KD1 U;  4OB1 B;  4DQ2 A;  4JS4 A;  2DD4 A;  2XHC A;  1IRE B;  1YIT T;  5GAN 8;  3OS0 A;  3CCM A;  2PVD B;  4BAC A;  4NL3 A;  3WVE B;  5GAN 2;  3JCM W;  4P5N A;  2P0K A;  4OB3 B;  2DPP B;  4PJO A;  1VQN T;  4M78 D;  3J7A F;  2OTJ T;  3QHS A;  3MHX A;  3SB2 A;  5LJ5 e;  4C92 D;  4QQD A;  4XAX B;  5D6X A;  1KQS A;  3MP6 A;  4QVZ A;  2D9T A;  3O8V A;  4KBM B;  5CR2 A;  2JTM A;  1KG1 A;  5CKE A;  5DLO A;  4FSX A;  2EFI A;  4M7D G;  1N9R A;  4M7D A;  4R55 A;  2R5A A;  5GAN 6;  2KK4 A;  3JCM h;  3KBG A;  1VQP A;  3V8K A;  3CCQ A;  2RO0 A;  3OS5 A;  3CEY A;  1BYM A;  5LJ5 g;  2QI2 A;  3HP9 A;  3PNW C;  3QPH A;  4BI4 A;  3JB9 D;  1HXD A;  3HKS A;  4OVA A;  2VXE A;  4ATO A;  4M77 E;  5C6S A;  3I55 A;  2LQK A;  4JDS A;  4OP0 A;  5LJ3 f;  1O75 A;  3CME A;  1QVG A;  4MDX A;  3RES A;  2CGH A;  1FXX A;  1M90 U;  4IKF A;  3CXC A;  1M1K U;  5GAN e;  2F5T X;  4Y28 E;  3OMC A;  2B8A A;  2VXF A;  2P4T A;  5CQX A;  4F7U F;  5CKD A;  3PIP A;  2K57 A;  3PFS A;  1VQ9 T;  3JCM d;  1G3Y A;  2X4X A;  5CIU A;  4BB7 A;  1Y96 B;  4WF2 A;  3GF5 A;  5GAN f;  3PIO A;  3OYE A;  1S72 A;  5CQY A;  2QQR A;  4N0A C;  5GAN d;  4QQ6 A;  2V8K A;  3CC2 A;  1D3B A;  5J26 A;  4C5E A;  4XTV A;  2DO3 A;  2RD1 A;  3V7C A;  3M59 A;  2RHI A;  5GAM g;  1M4Z A;  1MGQ A;  1BI3 A;  3HHT B;  3NTI A;  4ME7 A;  1JBM A;  4N4G A;  2DXT A;  5CK9 A;  1VQK T;  2P0Q A;  2NLU A;  3KXT A;  1WNL A;  4A4F A;  1YHQ A;  1X75 C;  4KT0 E;  1ZBX A;  4E7I A;  1U8R A;  1YIT A;  1M90 C;  1OZ2 A;  2YLC A;  2RJD A;  4RKU E;  3L2Z A;  5HY6 A;  2JTF A;  2LVM A;  3OSV A;  5CKF A;  3GNG A;  3S6W A;  5GAM e;  2QEX T;  5I21 A;  3TCJ A;  5LJ3 j;  1VQ4 A;  1VQN A;  4QVC A;  3LH0 A;  1RI0 A;  1I8F A;  2DKG A;  2YLB A;  3URG A;  3LX7 A;  3JAM E;  3E19 A;  1ZHI A;  3M55 A;  2OTJ A;  4ELZ C;  2DIQ A;  5KCO A;  2O4X B;  1YJN A;  3V7R A;  4XU3 A;  3X25 B;  2F5K A;  3F70 A;  4RG2 A;  3L1A A;  2DK3 A;  3RKX A;  3L2U A;  1YIJ A;  1Q82 C;  1NPR A;  1VUB A;  1Y71 A;  3OYY A;  1VQ6 A;  2E1H A;  2X4W A;  4HCZ A;  1HK9 A;  1X01 A;  2LT4 A;  1N27 A;  1XNI A;  3HSB A;  4BY6 B;  4MZP A;  2DXU A;  4QW2 A;  3SD4 A;  1VQP T;  2JNG A;  5GAM h;  3ASK A;  5GMK l;  1M8V A;  1Q81 C;  3OYL A;  3CCU A;  2CKK A;  1UEB A;  3GPL A;  4BE2 A;  1W2B S;  1Q86 U;  3V8J A;  3WVD B;  4B9W A;  2KAF A;  4OF1 A;  4C8Q B;  3DKM A;  3C12 A;  2CZ7 B;  4BDY A;  4MZM A;  3JCM P;  1QVF S;  2XU8 A;  3EFS A;  3H6Z A;  3OBY A;  4ZGD B;  4C92 B;  5LJ5 j;  4HA8 A;  1BI0 A;  4C8Q F;  5CO7 A;  2JUF A;  1WJQ A;  3OQ5 A;  3CCM T;  5M9O A;  4M7A G;  4M75 F;  4DA4 A;  3X24 B;  2BKD N;  1K73 C;  5KE3 A;  2ZPI B;  3N5B B;  1SSF A;  3CPW A;  4QQG A;  5GMK i;  4X34 A;  3SWN B;  1YI2 T;  1P92 A;  1UGR B;  3CBM A;  3M56 A;  4M77 F;  5A0D A;  4RMO A;  2LDM A;  3BY7 A;  3S3M A;  1KQ2 A;  3A8H B;  2ZPE B;  3A8G B;  3VV0 A;  4OMF B;  3VKI A;  2RHY A;  2L8D A;  4N4H A;  3LYI A;  5J3B A;  2H3J A;  4XU0 A;  3VYH B;  1KC8 U;  3VUZ A;  3VYG A;  3FEO A;  4XTX A;  4EMK C;  2P0P A;  2VC8 A;  4ZN1 A;  3A8O B;  2JVV A;  3RER A;  5HKC A;  3GOX A;  5LJ3 e;  2LT1 A;  4L5G A;  2FVU A;  3M4G A;  2QEX A;  5FU7 B;  3OYN A;  4RCC A;  4EMH A;  4C8Q D;  3JB9 J;  2YHT A;  4XTW A;  4EMK B;  1M1G A;  1JB0 E;  3ER0 A;  2V8I A;  4PL6 A;  4PJO F;  3JCM J;  4PJO G;  3OYA A;  5LJ5 f;  3PT9 A;  2L5Q A;  4IUV A;  2WSF E;  4JRI A;  2ZPF B;  3BDU A;  2DIG A;  2MMP A;  4M78 B;  4C5G A;  1YCY A;  1KD1 C;  3RUX A;  5LJ3 h;  5A0L A;  3ZFJ A;  4ZGE B;  2OTL A;  3JCM V;  1W2B A;  4PJO B;  3MEW A;  4XTZ A;  5AYF A;  4M7A A;  4VUB A;  1M1F A;  2K3Y A;  1XQH A;  2FB7 A;  5CCA A;  1S72 T;  3FDR A;  4J7I A;  3JCM f;  3UDC A;  2VGN A;  3P8D A;  3JCM c;  3CC2 T;  3L2R A;  4JRQ A;  2ZCF B;  4IUQ A;  1JJ2 S;  2M16 A;  4C0F A;  3CMA A;  2A7Y A;  4YTL A;  4BE1 A;  3CBO A;  2DAQ A;  1LJO A;  2KQW A;  2LQ8 A;  4A53 A;  5KE2 A;  5GAM j;  2OAU A;  3M9Q A;  4NL2 A;  3JRZ A;  5LJ3 d;  4DOV A;  3TU4 K;  1VQK A;  1YBY A;  1BI1 A;  1BI2 A;  1VQL T;  2QQB A;  4C0D B;  4EMG A;  1QW1 A;  4M75 G;  3JCM g;  3L2Q A;  3CCJ A;  2O01 E;  2DJZ A;  2XDP A;  4GLK A;  3CCE T;  3G4S T;  4J7F A;  2EJG A;  1H3Z A;  2LRQ A;  5CVI A;  5HK3 A;  3OMG A;  5GAN 5;  3CD6 T;  2R58 A;  1VQ4 T;  2BUD A;  2DEQ A;  4ELY C;  1NJI U;  1Y7X A;  3MEU A;  4BD3 A;  4MMK A;  3LLR A;  4F7U E;  1KQ1 A;  1VQO A;  3FLG A;  1U1S A;  4PLI A;  4C92 G;  2EQK A;  2DD5 A;  3S3O A;  2KMT A;  1YJN T;  4N4I A;  5GAO r;  1H64 1;  3OYD A;  4L59 A;  4RCB A;  3OYB A;  4F7U B;  4XQ3 A;  5GAO m;  3OYH A;  1YIJ T;  3I56 A;  2DTI A;  2FYK A;  2GF7 A;  4GY5 A;  4HKE A;  2GQV A;  2CZ0 B;  2L3R A;  2EQJ A;  5A2Q E;  4M77 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...