1DJ7B

Crystal structure of ferredoxin thioredoxin reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN THIOREDOXIN REDUCTASE: CATALYTIC CHAIN
publication title Redox signaling in chloroplasts: cleavage of disulfides by an iron-sulfur cluster.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1dj7B00
1QP2A 1GXIE 1IREB 1PSEA 3LW5E 2WSFE 4L6V5 2WSEE 2DPPB 2AHJB 2CZ6B 4FM4B 2CZ7B 2ZPBB 4ZGEB 2ZZDA 2PVOB 4OB0B 3A8LB 4KT0E 2D0QB 4OB1B 2DXBA 1V29B 2ZPFB 4ZGJB 2ZPEB 3X28B 1UGPB 3HHTB 3X20B 2PUOB 4RKUE 3A8GB 1AHJB 2PVDB 2PUKB 1UGSB 1JB0E 4OB3B 3WVDB 2ZCFB 3VYHB 1UGQB 2CZ0B 3QYHB 2O01E 2PVGB 2ZPIB 5L8RE 2QDYB 1PSFA 2DXCA 2ZPGB 3X26B 4OB2B 4XK8E 4Y28E 1DJ7B 2DD5A 3X24B 2DD4A 3VYGA 3X25B 2WSCE 3QXEB 4ZGDB 3A8HB 2PU9B 3QZ5B 2CZ1B 1UGRB 1QP3A 3A8OB 2CYZB 2ZPHB 3QZ9B 3WVEB 3A8MB 3QYGB
chains in the Genus database with same CATH superfamily
1UDLA 1IHVA 4RTVA 1VQNQ 1PSEA 2HKQB 2CH4A 4L6V5 2DNUA 1EZZB 1WXUA 3P8HA 2CZ6B 4FM4B 1Y96B 2OTJA 1K8AU 1MV3A 2DEQA 2ZZDA 1G3SA 2EQIA 2RHZA 3GP8A 1SG5A 4N4HA 3I55Q 5HCKA 2K3YA 2GNCA 4PJOB 2QA4Q 2EYYA 2ZPEB 4LD9K 1U3OA 2LZ6B 5DLOA 1K9MU 3V7SA 3CC2Q 5GMKj 2DTHA 1TWBA 3E9FA 1C0MA 4DBQA 4NS5A 3H9NA 3CCLA 5EG2A 3EG1A 2P0PA 2MK5A 5GJVB 3A8GB 4M78F 4ZN1A 1KHIA 1T0JA 3CCMA 1VQNT 1YJWA 1UJ0A 1VQLQ 2CP6A 1Z9QA 4ESRA 3JB9F 1FYNA 1OX8A 1WGSA 5KYYA 2OI3A 3FJ5A 2CP3A 2OAUA 1PSFA 1KIKA 3I55T 2YWWA 1NEGA 1I5LA 5GAOl 5FU6B 2BE7D 4OB2B 2QA4T 2O2OA 3M59A 4PJOF 1JQQA 1T3LA 1WI7A 2LC4A 3JCMd 2ECZA 3I56Q 4NL2A 2RQRA 4A54A 5CO7A 4EMKC 3VS4A 1GFCA 1QKWA 3CXCP 2WSCE 2VKNA 3M56A 1W6XA 3OY9A 1GRIA 2FO0A 4QW2A 3LWIA 4HT8A 4V2SA 1RABB 4C8QD 3NPFA 3RMSA 2FL7A 1RI9A 2KBTA 1UGRB 1YFNA 2OJ2A 2V26A 4JLIA 1JO8A 2YRVA 1R0BG 1VQLT 5GAN3 3QZ9B 3C4SA 1Y07A 1ZBXA 3H41A 1WLPB 1M27C 4IKFA 1Q7YC 4BI3A 1HD3A 2Y90A 3HRSA 2JTMA 2C0TA 2L5QA 3FJPA 2P0KA 2ROTA 4XTUA 2E10A 3ULRB 1K8AR 1YNZA 2FPDA 2DIQA 2GFAA 3I56T 3REAB 4J6XA 2R5AA 1VIEA 3JCMJ 5GAOq 3QIIA 2DVJA 4C8QG 4KGXB 2MF2A 2M51A 1K9MR 4M75B 3SWNC 1UHCA 2F5TX 3QKJA 1VQ9T 1MHNA 1WFWA 1IZ6A 3E19A 3REBB 2HQEA 1G8XA 2OTLQ 2DBMA 3SB2A 3M9QA 3CC7A 1UGQB 2CSIA 4A53A 2HNIA 3EGUA 3R6NA 4M78C 5LL6S 2E5KA 4C92A 3C12A 1PG5B 2YUOA 2LMJA 4OMPA 1D1AA 3G4SA 1M90U 2NUPA 3RBBB 1WNLA 4M7DD 3C95A 4C92E 4KGZB 2GCXA 3F70A 3JCMX 2KAFA 4PFPA 1ARKA 2E3HA 1WHLA 1AWWA 1M9SA 1VQ6Q 2X4JA 2JOYA 2YUQA 4FSSA 1RLPC 4PLLA 2JM8A 4XTVA 4R55A 3PTAA 1YI2A 2KNBB 2VB6A 2JN0A 2DYIA 1WQ7A 3UPUA 1SKUB 1QP3A 3BW1A 4HCCA 4KH1B 4FIBA 3CCJQ 3L2VA 1VQ5Q 1VQKA 1BKBA 2OTLT 3G71T 3GNFB 2EGEA 1AWJA 2YLCA 4O5VA 2LJ3A 4C5GA 3LW5E 3V7CA 1D3BA 3MJXA 3GBQA 3CMEQ 3BDUA 2HL5C 4M7DG 1QVPA 4C0GA 4JJBA 1S72A 1KQ2A 3SDZA 1YHQA 1RAFB 2D0QB 3P8BB 4XAXB 2O9VA 1N27A 1N5ZA 3E1SA 4IUUA 1VQ6T 1WZOA 1ZSZA 2E5QA 3BDLA 4F7UA 4J6WA 2MAMA 5GAMj 4BI4A 4M7AG 2DL8A 5KYXA 2RM4A 2RQTA 3CCJT 3OYGA 1VQ5T 2LQNA 2E6NA 4QQDA 4R56A 4E7KA 3S3MA 2LJ0A 1OU8A 3A1PA 2GQIA 2M0YA 2BIVA 3FDRA 2QEXA 1UECA 1TUCA 4HCZA 1PNJA 1YCYA 2MMPA 2DO3A 1LJOA 4MZPA 1YN8A 2J05A 1YJWQ 3QDRB 2DA9A 2GF7A 3CCEQ 2FZGB 1VIFA 3J81E 2DERA 1UFFA 1H3ZA 2ZPGB 4RTWA 4AFSC 1WHGA 1I07A 3PGGA 4M77A 2HKNA 1M1KR 1M90R 5LJ5f 3NGPA 4PLIA 1G83A 2F2WA 4OMLA 2DYBA 1B07A 1WQWA 1VQMT 2RJFA 4NL3A 1M30A 2QG9B 2FYKA 2V8KA 3A8OB 2CYZB 4L5GA 5C0MA 2JMCA 2DF6A 1NJIU 3QYGB 5KE3A 3S3OA 3QWXX 4PNOA 2AKLA 1ZHIA 4AFUC 1E6HA 3MP6A 3CCET 3G7ZA 2D0NA 2KYMA 2XI9A 2O4XA 2GGRA 3A5ZB 3VV0A 5GMKl 1XJWB 1QVGP 5I22A 1WXBA 5A0GA 3MKDA 3G6EA 1Q81U 4AG2C 2DXBA 4HVWA 1OZ3A 4OGCA 2H3JA 3M0SA 5CVIA 5FW9A 4JZ3A 2E4HA 2HCKA 4HXJA 1FMVA 2MYSA 1O9SA 2RO0A 4EMKA 1IO6A 1SSFA 2COWA 3X20B 2W10A 1YIJA 2LT1A 3PIOA 1IRXA 1PHTA 4BDYA 1Y71A 1TH7A 3Q1JA 4PJLA 2K5LA 2G6FX 1JB0E 4Z89A 2JMAA 2KQWA 4D8DA 3OMGA 2DEUA 1PKTA 4GY5A 2X3WD 1BI1A 1N6AA 2RPNA 2QDYB 4AFQC 1OV3A 2DK3A 3ZL7C 1ABQA 1EFNA 5GAOr 1M2VB 2RH2A 2VXEA 2RQUA 4DBFA 1K8AC 4TVRA 2DJQA 2F2VA 3V7RA 2X4WA 1Q82U 5IXBA 1KD1U 3QWYA 4BY6B 3AHUA 1KQSS 2DD4A 2QQSA 5CKFA 2BZXA 2KEAA 3M57A 3BY7A 1K9MC 3QZ5B 4LDVA 1OQKA 2AZVA 4GLKA 2JTFA 1T3SA 2VASA 2ZPHB 5LJ3h 2L89A 2FPEA 3JCMg 1NJIR 1YI2Q 1K0SA 2NLUA 1BI3A 5KYNA 1OPLA 4C8QB 4CC3A 1O75A 2RQWA 5GAMf 1VQKQ 1OEBA 1T0HA 3LYIA 2MPXC 1VQOA 2DL7A 1JXOA 2R5MA 1WJRA 2VXFA 1MNDA 4BACA 1U1TA 2I2LA 4FL6A 4ANJA 1NLOC 4E7JA 3CPWP 2F2XA 2ATCB 2EQKA 1PD0A 1AOJA 3LH0A 4M77F 1JJ2S 1S72Q 2DILA 1G3TA 4M78E 1Y96A 1YJ9A 5IAYA 2P4TA 1D1CA 1KQSP 1RAIB 2M9UA 3CBMA 4ZTJA 1WXTA 4LXCA 2DZCA 3OSSC 4PJOA 4ZN3A 3FEOA 4RG8A 2FG0A 5GAN8 1N8RU 2E12A 1D1BA 4JJDA 3CCQQ 1SSHA 1VQ4Q 3H0HA 2GBQA 1RLQC 4BE0A 2KXCA 1KC8U 3TU4K 5A2QE 2AIRB 2YRDA 4WCIA 4F14A 2R58A 5KYWB 4GLMA 2E6ZA 3VU3C 1MMDA 3D7SB 2EJ9A 4MZTA 1X6GA 4PKCC 1CSKA 1AZEA 4XK8E 4II1A 1Q82R 5I21A 4PL6A 1TS9A 2RN8A 4CC7A 1VQPA 1A0NB 1JJ2P 1C6VX 2HL3A 4WTOB 1B34B 3JCMe 4AFZC 2X4YA 2CUDA 4M7DB 2RD1A 3CBPA 5KYUA 2DL5A 5LJ3d 4HKEA 1ACMB 2D8JA 4IIMA 3GOXA 2E41A 3CCQT 1VQ4T 2A36A 4Z8AA 3PNWC 1ZSZC 1ZUUA 4B9XA 4IUVA 1F1BB 1WDXA 1QVFS 3JB9I 4J83A 2GFUA 3JCMh 4JJCA 3CXCA 2JT4A 3C0CA 2JXBA 1D09B 2KROA 1BIAA 2YDLA 5FWBA 1WHKA 4ZTFA 3CD6Q 2A0FB 5GAOn 1CKBA 1ZBJA 2AZSA 1M1KC 4LN2A 1I1JA 2QQRA 3HL8A 4Y91A 1M90C 1WHHA 2A08A 2ZGWA 4JJNK 2DXTA 2L3PA 3NTKA 2PTKA 1D0YA 1PC0A 2RI3A 4BY6C 2IG0A 4MZMA 1WIEA 4C92G 2L3SA 4M77C 1AHJB 1E7OA 5D6XA 3HRTA 2YLBA 2DAQA 2FZCB 2XD0A 1X2KA 3UDCA 3OS5A 1ZSGA 2LTOA 1TXQA 4M75A 5CKHA 1ZX6A 5J3BA 1RL2A 2DTOA 4QVZA 2ABLA 1OI1A 3CC4A 4ORZA 1KC8R 1GCQC 2VUBA 2DL3A 1QVFP 2M0OA 1YJNA 3CD6T 4X9CA 2J06A 4JRPA 1M2OA 3EGDB 1LOJA 2CUBA 4XU3A 1TTHB 3HPWA 1FMKA 1KG1A 2RA2A 3DKMA 3G1JA 4RCBA 2YUPA 3QDFA 2EYXA 1JBMA 4OMQA 2ESWA 4RG2A 8ATCB 1WYXA 1FXXA 3UF4A 3GPLA 2FHDA 3M5AA 1UG1A 3I5SA 2MWPA 1M1GA 4OMNA 3QBYA 2A7YA 2XKOC 1W2BS 1GXIE 3CC2T 4EDUA 4RTYA 2QYZA 3VS5A 3SFMA 2YRCA 5I2SA 4XTXA 4F7UG 1M3BA 2RMOA 2LT4A 3NMZC 5AT1B 4DBHA 4VUBA 3KXTA 2EGCA 3FIFA 3VKIA 4J6YA 3L2QA 4Z02A 2F1LA 4A4EA 4FSXA 2C06A 2RNAA 2DBKA 2X4XA 5GMKi 5DM7R 7AT1B 4X34A 3RR6A 1OU9A 4F17A 5GAN6 4RCCA 3TEEA 4AG1C 2EPDA 3PE0A 3CCUA 2PUOB 3SHWA 2VGMA 3CCRA 1YWOA 2PVDB 5IN1A 2KRMA 1JU5C 3PMIA 3OYLA 2EJGA 1UGSB 3H0IA 2XK0A 1NJIC 5FU7B 4MDWA 4IURA 3JCMW 1W2BP 2D8HA 1VYUA 2O01E 4WF2A 1MNEA 4CRIA 3CCVA 4E47A 1KK7A 1WA7A 3PIPA 4JRIA 2GTOA 4R0KA 4C0DC 1K9AA 4KGVB 5IT9E 5L23A 1WHJA 1NE8A 2EQJA 2CP2A 4XTZA 2RK1A 1LNXA 2ZAEA 4ZGDB 1JEGA 3A8HB 5IH2A 1GBRA 2AT1B 2LX9A 3CCSA 2C0IA 2V1RA 1VQPQ 1I81A 1N9SA 3M0UA 2DLPA 4C0FA 4FT4A 3OYDA 4ZNXA 1QP2A 5I11A 1VQ7A 3EFRA 4J7IA 2LDMA 4RTZA 2AHJB 4M75F 1VQ8A 2CZ7B 1YITA 4J9HA 5FWCA 1K76A 4PJOC 2IVWA 4OB0B 2NUTB 2E3IA 2COYA 2K5IA 1RAAB 4N0AA 2SEMA 3VS0A 4JRQA 4M7AD 1G2BA 2CT4A 1Q82C 3EFOA 1KD1C 1VUBA 1I5OB 1OULA 2QDLA 2EGAA 1KFZA 3V8JA 1X27A 5KE2A 1Q86U 3OS0A 2G3RA 2EYZA 5D6WA 4DOWA 4J8OA 4FYYB 1QVGA 4LUEA 1SRMA 2EWNA 4A4FA 4ATOA 2OTJQ 3WVDB 4LDWA 4EMGA 1PRMC 4M78D 2JZ2A 5FU6C 4HA8A 3L2RA 1UUEA 1UJYA 1X2QA 2KK4A 5M9OA 3JB9D 1CKAA 4IUQA 4F7UE 4A4GA 2RJCA 3DB4A 3PFSA 4HVVA 5D7UA 1X75C 2HMAA 3DLLA 5HKCA 2YSQA 3MEWA 3CCLQ 5GANg 2QGFB 3CMET 4KRTA 1GFDA 3OB9A 1M2VA 2J7IA 3CCMQ 2O31A 2BUDA 2QTXA 2V8JA 1U8RA 1SPKA 1SEMA 1BCMA 2R57A 2OTJT 1NEBA 3CMAA 4M78G 4ELYC 4N4IA 1JXMA 2KT8A 1NZ9A 1N8RC 3JB9G 3KBGA 2P84A 2KGTA 3EG3A 4QQ6A 5LJ5g 4M77E 4PJNA 1OOTA 1KC8C 1QMCA 3RDVA 1VYTA 1GCQA 1QW1A 5LJ3g 2KY9A 2FPFA 3CCLT 1PKSA 2EKOA 4C8QA 3T9NA 2NWMA 2RHYA 4M75C 1EIFA 3QUIA 3CCMT 1QKXA 1YJWT 3THKA 4E7LA 2IPOB 2RI5A 2K4YA 3DLMA 3CEYA 1Q86R 3ZEHA 4RUGA 3TQ7P 5GMKh 3H0FA 3O5ZA 5GAN5 2BE9B 2E65A 2VC8A 3CPWA 2CP7A 1QCNA 4F04B 2V8IA 5GAN2 2L2PA 2XHCA 2BTTA 3OYYA 1ZUKA 3META 3OYCA 2LCCA 2K3BA 1D3BB 1MUZA 4A4HA 2D1XA 2EKHA 2EJFA 1VQNA 1H8KA 4QKUA 3OMCA 2DE0X 2A28A 2QASA 4CC4B 5IHKA 2Z0WA 2LRQA 1DJ7B 2J6KA 2RHXA 1IXDA 2DD5A 3X24B 1ZUYA 3RNJA 6AT1B 5KYWA 2KDSA 3VYGA 3I55A 1HXDA 3MPUB 4BE2A 2EIFA 3EGXA 2QA4A 5GANh 4XQ3A 1E6GA 3HRUA 3FB9A 3E9GA 2KXDA 1HSQA 3OYMA 2HBWA 3EFSA 3CC7Q 1NG2A 2QXFA 3JAME 3I5RA 4C5IA 2SRCA 3RERA 5IXFA 3RMQA 5LJ3e 1B34A 3KUFA 4C5EA 2CS7A 3M55A 1NPRA 3RESA 3OW2A 1K4US 3VJPA 4M7DA 3G4SQ 1M8MA 3OS2A 3JCMQ 2DX1A 1XTDA 1AD5A 1VQLA 2XDBA 4ZGEB 3HKSA 4BB7A 2HZYA 4RMOA 5LJ5h 2CT3A 3HTRA 3OYNA 3IQLA 1VQ8Q 2J6OA 2FRYA 5D6YA 3OYEA 1YITQ 5CCAA 1V29B 3L42A 2MIOA 3LX7A 1Q95G 2V1QA 1IGQA 4FT2A 2D9TA 3UT1A 3I56A 1LVKA 3QJ6A 3CC7T 2JJ9A 2KRSA 3JCMf 2EFIA 2RJEA 2QI2A 4E2FB 2B86A 2M16A 3MP8A 1UHFA 4A63B 1Q81R 4P5NA 4EMHA 2RHIA 3G4ST 1K1ZA 4OP0A 3M0TA 2MOXA 1YHQQ 2HSPA 4Q5WA 5CKBA 2PVGB 2ZPIB 2RQVA 3UATA 2F69A 1VQ9A 3MCAB 4RTTA 1M8VA 1M5Q1 2QTVA 3X26B 3EAEA 2ED0A 1GL5A 1VA7A 2YT6A 2VV5A 1YI2T 2VVKA 4Y28E 5CR2A 5IHNA 4C8QF 5GANd 1VQKT 4PJOE 3VS1A 3E2UA 3MEVA 2JUFA 4J7FA 5DLQE 1XQHA 1FX7A 4EMKB 1OYXA 2CZ1B 4UC4A 2QEXQ 3EGDA 5GAOm 1QVFA 4N0AC 4OMMA 4J9IA 1S72T 2ED1A 1KD1R 1YHQT 1VOMA 1ZA1B 2I0NA 2WSFE 4M4ZA 3V8KA 2FZKB 2DPPB 1R0CB 3ER0A 5LJ5d 3M0RA 3MP1A 1RAGB 2A37A 1Y0MA 2OTLA 3G71A 3JRZA 1X6OA 2K7AA 2FVUA 5GAN7 2JW4A 1H641 2HBPA 1KSWA 2DFUA 5FRMA 2ZPFB 4FYWB 4ZGJB 4C92D 4J9CA 1V76A 2NUZA 2QGGA 4IIOA 1ZA2B 2DXUA 1D0XA 3M58A 2QEXT 1RUWA 4MMKA 2RJDA 4M7AB 4F16A 1R77A 2CP5A 1U5SA 1WHMA 1K73U 2XMFA 3SWNB 1VQ6A 1BK2A 2PUKB 5DY9A 3RKYA 1RAEB 5GAMh 2P4RA 1C1AA 2EQUA 1WJSA 1ZLMA 4KUDK 3CCJA 3G6EQ 1VQ5A 3CQTA 1NLPC 4B9WA 4N4GA 2AKKA 4M7DF 3OBWA 2Y4XA 2CKKA 3PVLA 2KI7A 2DETA 4M78B 5KCHA 1YIJQ 3LGFA 4L59A 1N8RR 3OQ5A 1M3AA 1IHWA 1HJDA 4KUIA 2F5KA 4LE9A 4PFOA 2RK2A 4RTUA 4D8KA 4M7AF 1UB4A 1W2BA 1Q86C 1ZQ1A 3RIRA 4M75E 3TSZA 2YUNA 1BBZA 2XU8A 1TU0B 2OAWA 1QLYA 3P8DA 3QJYA 4LD6A 4C8QC 3A8MB 3V8LA 3CXCS 2EVRA 4DEXA 3MEUA 3RKXA 3TCJA 3G6ET 4QVDA 4BD3A 1VQMA 3EG9B 2KT1A 3J7AF 5GJWB 1IB8A 1QCOA 4J9EA 3GF5A 2KR3A 5CIUA 9ATCB 1YIJT 1UE9A 3AT1B 4OMOA 1UTIA 2XDDA 3R6OA 2COZA 3CCEA 3INZA 3UA7A 4EPCA 1OZ2A 1XOVA 1UGPB 3FLGA 4M77D 1RACB 2NUTA 1NBEB 2ENMA 5GAMd 2HSEB 4RKUE 5HK3A 2QQAA 1W4SA 1K73R 2RHUA 4FCYA 3I35A 2DTIA 2CP0A 5KYUB 4XU2A 4A4KA 5GANj 3L1AA 1VQOQ 3NTHA 1XNIA 2ZCFB 3LGLA 3URGA 1IGUA 1BIBA 4HT9A 1SF9A 1QWEA 2HQHA 3M53A 1BB9A 2OX7A 1SHFA 1B3QA 4PJMA 4E7HA 1D0ZA 1KJWA 4C0ZA 3EHQA 2KVQG 5KCOA 1YJ9Q 1AZGB 3HP9A 1H92A 1G3WA 3VS7A 4M77G 1X01A 4XU0A 4AT1B 2HEQA 1VQ9Q 5LJ5j 3J80E 3M0PA 4M7DC 4QQGA 4GBQA 3QXEB 3EG0A 5LJ3j 4XTYA 2PQWA 4J9DA 2X3XD 1FMWA 4FW2A 4CI0C 1VQOT 1MGQA 3WVEB 4HCBA 1Q81C 1IREB 3QHSA 4FYVB 1B7TA 4M7AC 2KMTA 3PT9A 1M3CA 1U06A 4ME7A 2LCLA 2CGHA 2QK0A 1YJ9T 1X6BA 2X35A 1WX6A 1U1SA 3A8LB 4QVCA 3OYFA 3ZBDA 1JRIA 2P0QA 1BCOA 3L2WA 3I9QA 1TOVA 1KQ1A 3G71Q 2BZYA 2XDPA 2H3EB 2Y4YA 1N9RA 2K2MA 2GTJA 2LX7A 3GNGA 1M4ZA 3PMTA 5GMKm 4BUGA 3OS1A 4DA4A 3EH1A 5KYYB 2K3XA 2BKDN 4IUPA 1M1KU 1BI0A 2LNVA 2KSSA 2EBPA 4BDZA 2JS0A 3LWHA 4OGEA 2M02A 2LCSA 1PD1A 4FU6A 3VYHB 2K2VA 2XIDA 2ROLA 4DBRA 1TSFA 4DEYA 4RTXA 2AK5A 5L8RE 3OYBA 2DXCA 1VQPT 2JVVA 2HD0A 2QQ9A 3JCMV 1AEYA 4J9GA 3SEMA 1MMGA 5IHIA 2X9HA 3OYHA 1GBQA 3VS6A 2EW3A 2K79A 4EIKA 4JRKA 2YHTA 5FROA 1OX9A 3FRNA 1NM7A 3CBOA 3A98A 3M4YA 4PJJA 1LPLA 4JLGA 2LJ1A 3LH5A 2DRMA 3VUZA 2GQVA 2LQKA 3CC4Q 5EC7A 1MV0B 1YJNQ 2E70A 2CDTA 2CSQA 5KH6A 4LDXA 2BZ8A 2M1HA 4PJOD 4HVUA 2KRNA 3CCQA 1VQ4A 1VQMQ 2PVOB 2LNHB 4DOVA 3EH2A 3QPHA 5GANf 3M54A 1RADB 2FRWA 4J5YA 3X28B 4IUTA 3JCMb 1QVGS 1SRLA 4YTLA 5FLXE 3HHTB 2E1HA 3UWNA 2PZ1A 2MCNA 1M1FA 3OSVA 1K0XA 2DVEA 4LDUA 1GCPA 3JCMc 3M4GA 1W1FA 3WXMB 3CC4T 4KBMB 3JCMP 2JTEA 1NYFA 5FU7C 4C92B 5I2MA 1YJNT 5GMKe 1Q7YU 2MI6A 5HY6A 4PJOG 3VRZA 1UEBA 2RF0A 2QAZA 2NUPB 4LNPA 1HK9A 4XTWA 5CKEA 2E64A 3OYJA 5LJ3f 3VUBA 4C8QE 3EG2A 2DMOA 4JPBW 4JDSA 2EQMA 3VS3A 2K5FA 1NPPA 2DM1A 2VYTA 3CCUQ 2VWFA 2CREA 2LQ8A 3HFNA 8AT1B 3ZFJA 3CCRQ 3EFOB 4OF1A 3DB3A 3OYKA 3CD6A 5C6SA 3L2ZA 3N5BB 4E7SA 2LQWA 1SHGA 5GANe 1KQSA 4C92F 2QQBA 1K73C 1BU1A 4OMFB 4B6MA 2LP5A 3ASKA 4E6RA 4HCKA 3CCVQ 3U23A 4AMCA 4LUDA 3RUXA 5AYFA 5A0LA 2WSEE 3BFMA 5CAIA 1ZSZB 3QSUA 4F7UB 1AT1B 3O8VA 2ZPBB 2MWOA 5A0DA 1PWTA 2A3LA 3HSBA 1YWPA 1UGVA 5KYXB 1YBYA 5LJ5e 3CC2A 4M75D 1TUDA 3VS2A 3C94A 3CCUT 3GIBA 3H6ZA 4D6WA 3CCRT 2KYBA 2LVMA 1PCXA 3SD4A 3QO3A 3S6WA 2L0AA 1J3TA 3CCSQ 2EAYA 3OYIA 2DL4A 3EHRA 2XICA 1Y57A 1S1NA 4PFZA 3CPWS 5J26A 1JJ2A 2PNIA 4QT7A 5FRNA 1VQ7Q 1G5VA 4MDXA 3GLXA 3CCVT 4M7DE 1X69A 2B8AA 3M0QA 4JUVA 3UA6A 1H3HA 2DRKA 1LCKA 1V1CA 1Q7YR 4OB3B 4JZ4A 2K57A 2L3QA 4M77B 3JB9J 3QG1A 4XU1A 1WJQA 2CZ0B 1TG0A 4FW1A 4F7UF 4M7AA 4M75G 3QYHB 3JV3A 4KULA 3SWNA 1RI0A 4LDYA 5GAMg 4FYXB 5HK0A 4M7AE 4MMLA 2O88A 1RAHB 3CCST 2DKGA 1EX4A 3MHXA 3TSWA 1PRLC 2EYWA 2DJZA 2DZ9A 1PM3A 2WACA 2HAXA 2X51A 3X25B 1QWFA 3OA6A 3JSCA 1VQ7T 3OYAA 1ABOA 2K6DA 4BI8B 5GAOp 4M78A 1VQ8T 2O4XB 1AVZC 1MMAA 1QCFA 1YITT 4DQ2A 3OW2S 2O9SA 1MMNA 3FC3A 2C0OA 1YCSB 3KFVA 1X43A 4C92C 3RKWA 5J39A 3L2UA 2IIMA 4Z88A 4KT0E 2NYSA 4OB1B 3EG9A 4E7IA 2XG8D 4OVAA 2L3RA 4NOYA 5CKDA 3JB9H 4ELZC 4BE1A 3CPFA 2KE9A 1HYOA 1AWOA 4O6JA 5CQXA 3CMAQ 1OPKA 4K11A 2HDAA 1NYGA 3EGXB 1Y7XA 2JM9A 4JS5A 4J9BA 3NTIA 4CC2A 1KHCA 1QQJA 2J6FA 3S3NA 5GAN4 5GAMe 3OW2P 3NHNA 4KH0B 1VYVA 2H8HA 2JS2A 3HFOA 2W0ZA 1I4K1 2VGNA 3NFCA 1BI2A 1BYMA 2JNGA 3H8ZA 2K9GA 5CK9A 1R8OB 2CH4W 2FB7A 5CQYA 1TUGB 3MEAA 2DIGA 4E7ZA 1Z9ZA 4X9DA 4X1VA 3VRYA 1I8FA 3OBYA 4Y92A 2L8DA 5ECAA 3CMAT 4J9FA 2RI2A 3PVQA 3ME9A 4C0DB 3BE3A 4PK4A 1FWZA 2D6FA 1WPYA 3TREA 1YP5A 2PU9B 1P92A 4C5HA 3TVTA 4JS4A 1W70A 2HQXA 2EYQA 3LLRA 2YXYA 1I0CA 2RB6A 1G3YA 3CMEA 1AWXA 2FEIA 3MO8A
chains in the Genus database with same CATH topology
3JCMg 4HCBA 1Q81C 1IREB 3QHSA 1NZ9A 1PSEA 1BI3A 2NLUA 1N8RC 4M7AC 3JB9G 2KMTA 4L6V5 3KBGA 4C8QB 1O75A 3PT9A 3P8HA 4QQ6A 5LJ5g 4M77E 2CZ6B 4FM4B 4ME7A 5GAMf 1Y96B 1VQOA 3LYIA 2LCLA 2CGHA 1KC8C 2OTJA 1YJ9T 2R5MA 1WJRA 2VXFA 1K8AU 2X35A 2DEQA 2ZZDA 1G3SA 1U1TA 1QW1A 2I2LA 4FL6A 5LJ3g 4BACA 1U1SA 2RHZA 3A8LB 4QVCA 3GP8A 4E7JA 2KY9A 3OYFA 4N4HA 3CCLT 2EQKA 2K3YA 2EKOA 3ZBDA 1JRIA 3LH0A 2P0QA 4C8QA 4M77F 3L2WA 4PJOB 3T9NA 2RHYA 1JJ2S 4M75C 1KQ1A 1G3TA 2ZPEB 4M78E 2XDPA 4LD9K 1Y96A 1YJ9A 1EIFA 3QUIA 5IAYA 5DLOA 3CCMT 2Y4YA 1K9MU 1N9RA 3V7SA 5GMKj 1YJWT 2DTHA 4E7LA 2P4TA 3E9FA 3GNGA 2RI5A 1M4ZA 2M9UA 3PMTA 2K4YA 4NS5A 3CBMA 3CEYA 3DLMA 5GMKm 4ZTJA 3CCLA 4BUGA 1M90C 3OS1A 5EG2A 4DA4A 3ZEHA 2K3XA 2DZCA 2P0PA 2BKDN 3OSSC 3A8GB 4IUPA 1M1KU 1BI0A 2LNVA 5GMKh 4PJOA 2KSSA 4M78F 4ZN1A 4ZN3A 4BDZA 1KHIA 5GAN5 3FEOA 3CCMA 1VQNT 4RG8A 2E65A 1YJWA 2VC8A 3LWHA 5GAN8 4OGEA 2E12A 3CPWA 1N8RU 4FU6A 3VYHB 2K2VA 2XIDA 3JB9F 2V8IA 5GAN2 4BE0A 2XHCA 1KC8U 3TU4K 3OYYA 1WGSA 3META 5A2QE 3OYCA 2LCCA 5L8RE 1D3BB 2R58A 3OYBA 2OAUA 1PSFA 2DXCA 4A4HA 1VQPT 2E6ZA 2EJFA 3VU3C 1VQNA 3I55T 1I5LA 2JVVA 2EJ9A 2HD0A 2QQ9A 4MZTA 3JCMV 5FU6B 5GAOl 4PKCC 4OB2B 2QA4T 3OMCA 3M59A 4PJOF 4XK8E 4II1A 2LRQA 2LC4A 5I21A 1DJ7B 3JCMd 4NL2A 3OYHA 2RHXA 4PL6A 2DD5A 4A54A 5CO7A 3X24B 4EMKC 1VQPA 2KDSA 3VYGA 3I55A 2WSCE 4JRKA 2YHTA 1HXDA 3M56A 1B34B 3JCMe 5FROA 3OY9A 4BE2A 2EIFA 3FRNA 2X4YA 5GANh 2QA4A 3CBOA 4QW2A 3LWIA 4HT8A 4V2SA 4M7DB 2RD1A 3CBPA 3HRUA 4XQ3A 4C8QD 3FB9A 2FL7A 3M4YA 3RMSA 1UGRB 5LJ3d 4HKEA 3E9GA 4JLIA 2YRVA 4JLGA 3OYMA 3EFSA 1VQLT 5GAN3 3VUZA 2GQVA 3QZ9B 2E41A 3GOXA 3CCQT 2QXFA 2LQKA 1VQ4T 3JAME 3C4SA 1ZBXA 1Y07A 4C5IA 3PNWC 3RERA 3RMQA 5LJ3e 1Q7YC 4IKFA 1B34A 2E70A 4B9XA 3KUFA 4IUVA 4C5EA 4BI3A 2CS7A 3M55A 5KH6A 1NPRA 3RESA 3OW2A 2M1HA 3JB9I 2Y90A 3HRSA 4J83A 3VJPA 4LDXA 2GFUA 2JTMA 4M7DA 3JCMh 4PJOD 2L5QA 3FJPA 3OS2A 2P0KA 3CXCA 3JCMQ 1XTDA 1VQLA 4XTUA 2XDBA 4ZGEB 3HKSA 4BB7A 2E10A 3CCQA 1VQ4A 4RMOA 5LJ5h 2PVOB 1BIAA 2DIQA 2GFAA 4DOVA 3QPHA 3OYNA 3I56T 4ZTFA 5GANf 5GAOn 3M54A 5D6YA 1M1KC 3OYEA 2QQRA 3HL8A 4J6XA 2R5AA 1V29B 1VIEA 3L42A 4Y91A 4J5YA 5CCAA 5GAOq 3JCMJ 3LX7A 3QIIA 3X28B 2ZGWA 4JJNK 4IUTA 3JCMb 4C8QG 2MF2A 1QVGS 4FT2A 2DXTA 4YTLA 5FLXE 2D9TA 3UT1A 3HHTB 4M75B 2E1HA 3SWNC 3UWNA 2F5TX 3NTKA 1M1FA 3OSVA 3I56A 2RI3A 2DVEA 4LDUA 3QJ6A 4BY6C 3JCMc 3CC7T 2IG0A 3M4GA 4MZMA 3WXMB 3CC4T 4C92G 4KBMB 3JCMf 4M77C 3JCMP 3QKJA 1AHJB 5D6XA 5FU7C 4C92B 2EFIA 3HRTA 2YLBA 2RJEA 2QI2A 5I2MA 5GMKe 1VQ9T 1YJNT 1Q7YU 1Q82C 2MI6A 2DAQA 2M16A 5HY6A 1MHNA 4PJOG 3MP8A 1IZ6A 2XD0A 3E19A 1UEBA 4P5NA 3UDCA 4EMHA 2HQEA 2RHIA 3OS5A 3G4ST 1HK9A 2LTOA 4M75A 3SB2A 5CKHA 4XTWA 3M9QA 4OP0A 5CKEA 5J3BA 3CC7A 1RL2A 1UGQB 2DTOA 2E64A 4A53A 4QVZA 3OYJA 1OI1A 4Q5WA 3CC4A 5LJ3f 5CKBA 2PVGB 3VUBA 2ZPIB 2HNIA 4C8QE 2VUBA 4M78C 2M0OA 2F69A 5LL6S 1YJNA 1VQ9A 4C92A 3CD6T 3C12A 3MCAB 4X9CA 4JDSA 2EQMA 1M5Q1 1M8VA 2K5FA 1NPPA 3EAEA 3X26B 1M90U 3G4SA 4JRPA 2VV5A 1YI2T 4M7DD 1WNLA 1LOJA 4XU3A 3C95A 4Y28E 4C92E 3HPWA 5CR2A 2VYTA 2GCXA 3F70A 3JCMX 1KG1A 2LQ8A 3HFNA 2KAFA 4C8QF 3ZFJA 2RA2A 3DKMA 5GANd 1VQKT 4RCBA 4OF1A 4PJOE 3DB3A 3OYKA 3CD6A 1M9SA 2X4JA 3MEVA 2JUFA 5C6SA 1JBMA 4J7FA 2JOYA 3L2ZA 5DLQE 3N5BB 1XQHA 1FX7A 4PLLA 4RG2A 4XTVA 4EMKB 4R55A 1OYXA 2CZ1B 5GANe 3PTAA 1YI2A 4UC4A 1KQSA 2JN0A 1WQ7A 4C92F 1FXXA 5GAOm 3UPUA 4N0AC 3GPLA 2FHDA 1QVFA 3M5AA 1QP3A 3BW1A 4HCCA 2QQBA 4FIBA 1K73C 3L2VA 2MWPA 1M1GA 4OMFB 1VQKA 1BKBA 3ASKA 1S72T 2OTLT 3G71T 3QBYA 3GNFB 2YLCA 2A7YA 2XKOC 4O5VA 1W2BS 1YHQT 1GXIE 3CC2T 4EDUA 4C5GA 3RUXA 3LW5E 2WSFE 5AYFA 5A0LA 3V8KA 2WSEE 3V7CA 3SFMA 1D3BA 2DPPB 5I2SA 4XTXA 3BFMA 3ER0A 5LJ5d 4F7UG 5CAIA 3QSUA 2LT4A 3BDUA 3MP1A 4F7UB 3O8VA 2ZPBB 4M7DG 2MWOA 1QVPA 4C0GA 4VUBA 5A0DA 3KXTA 2A3LA 1S72A 3G71A 2OTLA 3JRZA 1X6OA 1KQ2A 3HSBA 3FIFA 3VKIA 4J6YA 3L2QA 3SDZA 4Z02A 5GAN7 1YBYA 2FVUA 5LJ5e 1YHQA 3CC2A 4M75D 4A4EA 3CCUT 1H641 2HBPA 3C94A 4FSXA 2D0QB 2C06A 3GIBA 3H6ZA 2X4XA 3P8BB 4XAXB 4D6WA 5GMKi 5DM7R 3CCRT 2LVMA 1N27A 4X34A 3SD4A 3QO3A 3E1SA 4IUUA 3S6WA 2ZPFB 4ZGJB 5FRMA 1VQ6T 2EAYA 3OYIA 4C92D 2E5QA 3BDLA 4F7UA 5GAN6 4J6WA 4RCCA 2XICA 3TEEA 2MAMA 3M58A 2DXUA 2QEXT 5GAMj 4BI4A 4M7AG 3CPWS 3CCUA 5J26A 2PUOB 2RM4A 2VGMA 2RJDA 4MMKA 3CCJT 4M7AB 1JJ2A 3OYGA 5FRNA 3CCRA 1K73U 1VQ5T 2E6NA 1G5VA 4QQDA 4MDXA 3GLXA 3SWNB 2PVDB 2PUKB 4R56A 3CCVT 4E7KA 1VQ6A 4JUVA 2B8AA 5DY9A 5IN1A 3PMIA 3RKYA 3OYLA 3S3MA 2EJGA 5GAMh 1UGSB 4OB3B 2BIVA 2K57A 2XK0A 3FDRA 2EQUA 4M77B 3JB9J 1NJIC 2QEXA 5FU7B 4HCZA 1WJSA 1YCYA 3QG1A 1WJQA 2DO3A 2MMPA 4MDWA 4XU1A 4IURA 5LJ3h 2CZ0B 3CCJA 3JCMW 4KUDK 4F7UF 1VQ5A 4M7AA 4M75G 3QYHB 2O01E 1LJOA 4WF2A 4MZPA 4B9WA 4KULA 4CRIA 4N4GA 3CCVA 4M7DF 3QDRB 3OBWA 2Y4XA 3SWNA 2GF7A 4E47A 1VIFA 2CKKA 3J81E 3PIPA 1RI0A 4JRIA 4LDYA 5GAMg 1H3ZA 2ZPGB 4M7DE 5HK0A 4M7AE 4MMLA 4C0DC 3CCST 3PGGA 4M77A 2DKGA 4M78B 5KCHA 5IT9E 3MHXA 1NE8A 5LJ5f 2EQJA 2DJZA 3LGFA 2DZ9A 4L59A 4PLIA 3OQ5A 2WACA 4XTZA 2HAXA 3X25B 2RK1A 1LNXA 3OA6A 3JSCA 4KUIA 2F5KA 4ZGDB 2RK2A 3A8HB 1WQWA 1VQ7T 1VQMT 4M7AF 3OYAA 1UB4A 1W2BA 2LX9A 3CCSA 2RJFA 4BI8B 5GAOp 1Q86C 1ZQ1A 4M78A 3RIRA 4M75E 4NL3A 1VQ8T 2O4XB 2FYKA 1I81A 2V8KA 2XU8A 3A8OB 1YITT 4DQ2A 3OW2S 2CYZB 3P8DA 3QJYA 4L5GA 1N9SA 4LD6A 5C0MA 4C8QC 3FC3A 3A8MB 1NJIU 3QYGB 3V8LA 4FT4A 4C0FA 5KE3A 3MEUA 3OYDA 3RKXA 3TCJA 3CXCS 3S3OA 1QP2A 3G6ET 4PNOA 4QVDA 4BD3A 1VQMA 1VQ7A 3EFRA 1ZHIA 4J7IA 2LDMA 3J7AF 3MP6A 3CCET 3G7ZA 2AHJB 4M75F 1VQ8A 3CCEA 2CZ7B 4C92C 2XI9A 2O4XA 1YITA 3A5ZB 3VV0A 5GMKl 5A0GA 3RKWA 3GF5A 4PJOC 2IVWA 4OB0B 5J39A 3L2UA 3G6EA 5CIUA 2K5IA 4KT0E 1YIJT 4N0AA 1Q81U 4OB1B 4JRQA 4M7AD 2DXBA 4E7IA 2XDDA 3R6OA 1OZ3A 2XG8D 4OVAA 3INZA 4OGCA 2H3JA 2L3RA 1OZ2A 1XOVA 4NOYA 5CVIA 4EPCA 1VUBA 5CKDA 1KD1C 4ELZC 3JB9H 1UGPB 4BE1A 3CPFA 4O6JA 1O9SA 5CQXA 2RO0A 3V8JA 4EMKA 1SSFA 3FLGA 5KE2A 4M77D 1Q86U 3OS0A 3X20B 1YIJA 2LT1A 2G3RA 5D6WA 4DOWA 3PIOA 4J8OA 5GAMd 1Y7XA 5HK3A 4RKUE 4JS5A 1QVGA 2QQAA 1W4SA 2EWNA 4BDYA 1Y71A 2RHUA 1TH7A 2DTIA 3NTIA 3Q1JA 4A4FA 2K5LA 1KHCA 4XU2A 4ATOA 4A4KA 5GANj 3L1AA 1JB0E 3S3NA 5GAN4 5GAMe 2KQWA 1XNIA 3NTHA 3WVDB 2ZCFB 3LGLA 3OMGA 3HFOA 4LDWA 3URGA 1I4K1 2VGNA 3NFCA 1BI2A 1BIBA 4GY5A 4M78D 4EMGA 1BYMA 4HT9A 2JNGA 3H8ZA 2JZ2A 3M53A 1BI1A 1N6AA 5FU6C 4HA8A 3L2RA 5CK9A 2QDYB 1R8OB 4E7HA 2FB7A 5CQYA 2DK3A 2KK4A 5M9OA 5GAOr 3JB9D 3MEAA 2DIGA 2RH2A 2VXEA 4IUQA 4C0ZA 4F7UE 4X9DA 2KVQG 4A4GA 2RJCA 4TVRA 5KCOA 3V7RA 3DB4A 3PFSA 1K8AC 2X4WA 1Q82U 1X75C 3DLLA 1I8FA 3HP9A 1KD1U 3OBYA 5HKCA 4BY6B 3AHUA 2L8DA 1G3WA 4M77G 1X01A 4XU0A 3MEWA 5LJ5j 3CMAT 2RI2A 5GANg 1KQSS 3ME9A 4C0DB 3J80E 1FWZA 4M7DC 2DD4A 3CMET 4QQGA 2QQSA 5CKFA 2D6FA 3M57A 1WPYA 3TREA 3OB9A 3BY7A 3QXEB 1K9MC 2PU9B 1P92A 4C5HA 3QZ5B 5LJ3j 4LDVA 4XTYA 2PQWA 4JS4A 2HQXA 2BUDA 2EYQA 2QTXA 2V8JA 3LLRA 1U8RA 4GLKA 4CI0C 1VQOT 1MGQA 2R57A 2OTJT 3CMAA 4M78G 2RB6A 3MO8A 2JTFA 2ZPHB 3WVEB 1G3YA 3CMEA 4ELYC 4N4IA 2L89A 1QVFS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QP2 A;  1GXI E;  1IRE B;  1PSE A;  3LW5 E;  2WSF E;  4L6V 5;  2WSE E;  2DPP B;  2AHJ B;  2CZ6 B;  4FM4 B;  2CZ7 B;  2ZPB B;  4ZGE B;  2ZZD A;  2PVO B;  4OB0 B;  3A8L B;  4KT0 E;  2D0Q B;  4OB1 B;  2DXB A;  1V29 B;  2ZPF B;  4ZGJ B;  2ZPE B;  3X28 B;  1UGP B;  3HHT B;  3X20 B;  2PUO B;  4RKU E;  3A8G B;  1AHJ B;  2PVD B;  2PUK B;  1UGS B;  1JB0 E;  4OB3 B;  3WVD B;  2ZCF B;  3VYH B;  1UGQ B;  2CZ0 B;  3QYH B;  2O01 E;  2PVG B;  2ZPI B;  5L8R E;  2QDY B;  1PSF A;  2DXC A;  2ZPG B;  3X26 B;  4OB2 B;  4XK8 E;  4Y28 E;  1DJ7 B;  2DD5 A;  3X24 B;  2DD4 A;  3VYG A;  3X25 B;  2WSC E;  3QXE B;  4ZGD B;  3A8H B;  2PU9 B;  3QZ5 B;  2CZ1 B;  1UGR B;  1QP3 A;  3A8O B;  2CYZ B;  2ZPH B;  3QZ9 B;  3WVE B;  3A8M B;  3QYG B; 
#chains in the Genus database with same CATH topology
 1UDL A;  1IHV A;  4RTV A;  1VQN Q;  1PSE A;  2HKQ B;  2CH4 A;  4L6V 5;  2DNU A;  1EZZ B;  1WXU A;  3P8H A;  2CZ6 B;  4FM4 B;  1Y96 B;  2OTJ A;  1K8A U;  1MV3 A;  2DEQ A;  2ZZD A;  1G3S A;  2EQI A;  2RHZ A;  3GP8 A;  1SG5 A;  4N4H A;  3I55 Q;  5HCK A;  2K3Y A;  2GNC A;  4PJO B;  2QA4 Q;  2EYY A;  2ZPE B;  4LD9 K;  1U3O A;  2LZ6 B;  5DLO A;  1K9M U;  3V7S A;  3CC2 Q;  5GMK j;  2DTH A;  1TWB A;  3E9F A;  1C0M A;  4DBQ A;  4NS5 A;  3H9N A;  3CCL A;  5EG2 A;  3EG1 A;  2P0P A;  2MK5 A;  5GJV B;  3A8G B;  4M78 F;  4ZN1 A;  1KHI A;  1T0J A;  3CCM A;  1VQN T;  1YJW A;  1UJ0 A;  1VQL Q;  2CP6 A;  1Z9Q A;  4ESR A;  3JB9 F;  1FYN A;  1OX8 A;  1WGS A;  5KYY A;  2OI3 A;  3FJ5 A;  2CP3 A;  2OAU A;  1PSF A;  1KIK A;  3I55 T;  2YWW A;  1NEG A;  1I5L A;  5GAO l;  5FU6 B;  2BE7 D;  4OB2 B;  2QA4 T;  2O2O A;  3M59 A;  4PJO F;  1JQQ A;  1T3L A;  1WI7 A;  2LC4 A;  3JCM d;  2ECZ A;  3I56 Q;  4NL2 A;  2RQR A;  4A54 A;  5CO7 A;  4EMK C;  3VS4 A;  1GFC A;  1QKW A;  3CXC P;  2WSC E;  2VKN A;  3M56 A;  1W6X A;  3OY9 A;  1GRI A;  2FO0 A;  4QW2 A;  3LWI A;  4HT8 A;  4V2S A;  1RAB B;  4C8Q D;  3NPF A;  3RMS A;  2FL7 A;  1RI9 A;  2KBT A;  1UGR B;  1YFN A;  2OJ2 A;  2V26 A;  4JLI A;  1JO8 A;  2YRV A;  1R0B G;  1VQL T;  5GAN 3;  3QZ9 B;  3C4S A;  1Y07 A;  1ZBX A;  3H41 A;  1WLP B;  1M27 C;  4IKF A;  1Q7Y C;  4BI3 A;  1HD3 A;  2Y90 A;  3HRS A;  2JTM A;  2C0T A;  2L5Q A;  3FJP A;  2P0K A;  2ROT A;  4XTU A;  2E10 A;  3ULR B;  1K8A R;  1YNZ A;  2FPD A;  2DIQ A;  2GFA A;  3I56 T;  3REA B;  4J6X A;  2R5A A;  1VIE A;  3JCM J;  5GAO q;  3QII A;  2DVJ A;  4C8Q G;  4KGX B;  2MF2 A;  2M51 A;  1K9M R;  4M75 B;  3SWN C;  1UHC A;  2F5T X;  3QKJ A;  1VQ9 T;  1MHN A;  1WFW A;  1IZ6 A;  3E19 A;  3REB B;  2HQE A;  1G8X A;  2OTL Q;  2DBM A;  3SB2 A;  3M9Q A;  3CC7 A;  1UGQ B;  2CSI A;  4A53 A;  2HNI A;  3EGU A;  3R6N A;  4M78 C;  5LL6 S;  2E5K A;  4C92 A;  3C12 A;  1PG5 B;  2YUO A;  2LMJ A;  4OMP A;  1D1A A;  3G4S A;  1M90 U;  2NUP A;  3RBB B;  1WNL A;  4M7D D;  3C95 A;  4C92 E;  4KGZ B;  2GCX A;  3F70 A;  3JCM X;  2KAF A;  4PFP A;  1ARK A;  2E3H A;  1WHL A;  1AWW A;  1M9S A;  1VQ6 Q;  2X4J A;  2JOY A;  2YUQ A;  4FSS A;  1RLP C;  4PLL A;  2JM8 A;  4XTV A;  4R55 A;  3PTA A;  1YI2 A;  2KNB B;  2VB6 A;  2JN0 A;  2DYI A;  1WQ7 A;  3UPU A;  1SKU B;  1QP3 A;  3BW1 A;  4HCC A;  4KH1 B;  4FIB A;  3CCJ Q;  3L2V A;  1VQ5 Q;  1VQK A;  1BKB A;  2OTL T;  3G71 T;  3GNF B;  2EGE A;  1AWJ A;  2YLC A;  4O5V A;  2LJ3 A;  4C5G A;  3LW5 E;  3V7C A;  1D3B A;  3MJX A;  3GBQ A;  3CME Q;  3BDU A;  2HL5 C;  4M7D G;  1QVP A;  4C0G A;  4JJB A;  1S72 A;  1KQ2 A;  3SDZ A;  1YHQ A;  1RAF B;  2D0Q B;  3P8B B;  4XAX B;  2O9V A;  1N27 A;  1N5Z A;  3E1S A;  4IUU A;  1VQ6 T;  1WZO A;  1ZSZ A;  2E5Q A;  3BDL A;  4F7U A;  4J6W A;  2MAM A;  5GAM j;  4BI4 A;  4M7A G;  2DL8 A;  5KYX A;  2RM4 A;  2RQT A;  3CCJ T;  3OYG A;  1VQ5 T;  2LQN A;  2E6N A;  4QQD A;  4R56 A;  4E7K A;  3S3M A;  2LJ0 A;  1OU8 A;  3A1P A;  2GQI A;  2M0Y A;  2BIV A;  3FDR A;  2QEX A;  1UEC A;  1TUC A;  4HCZ A;  1PNJ A;  1YCY A;  2MMP A;  2DO3 A;  1LJO A;  4MZP A;  1YN8 A;  2J05 A;  1YJW Q;  3QDR B;  2DA9 A;  2GF7 A;  3CCE Q;  2FZG B;  1VIF A;  3J81 E;  2DER A;  1UFF A;  1H3Z A;  2ZPG B;  4RTW A;  4AFS C;  1WHG A;  1I07 A;  3PGG A;  4M77 A;  2HKN A;  1M1K R;  1M90 R;  5LJ5 f;  3NGP A;  4PLI A;  1G83 A;  2F2W A;  4OML A;  2DYB A;  1B07 A;  1WQW A;  1VQM T;  2RJF A;  4NL3 A;  1M30 A;  2QG9 B;  2FYK A;  2V8K A;  3A8O B;  2CYZ B;  4L5G A;  5C0M A;  2JMC A;  2DF6 A;  1NJI U;  3QYG B;  5KE3 A;  3S3O A;  3QWX X;  4PNO A;  2AKL A;  1ZHI A;  4AFU C;  1E6H A;  3MP6 A;  3CCE T;  3G7Z A;  2D0N A;  2KYM A;  2XI9 A;  2O4X A;  2GGR A;  3A5Z B;  3VV0 A;  5GMK l;  1XJW B;  1QVG P;  5I22 A;  1WXB A;  5A0G A;  3MKD A;  3G6E A;  1Q81 U;  4AG2 C;  2DXB A;  4HVW A;  1OZ3 A;  4OGC A;  2H3J A;  3M0S A;  5CVI A;  5FW9 A;  4JZ3 A;  2E4H A;  2HCK A;  4HXJ A;  1FMV A;  2MYS A;  1O9S A;  2RO0 A;  4EMK A;  1IO6 A;  1SSF A;  2COW A;  3X20 B;  2W10 A;  1YIJ A;  2LT1 A;  3PIO A;  1IRX A;  1PHT A;  4BDY A;  1Y71 A;  1TH7 A;  3Q1J A;  4PJL A;  2K5L A;  2G6F X;  1JB0 E;  4Z89 A;  2JMA A;  2KQW A;  4D8D A;  3OMG A;  2DEU A;  1PKT A;  4GY5 A;  2X3W D;  1BI1 A;  1N6A A;  2RPN A;  2QDY B;  4AFQ C;  1OV3 A;  2DK3 A;  3ZL7 C;  1ABQ A;  1EFN A;  5GAO r;  1M2V B;  2RH2 A;  2VXE A;  2RQU A;  4DBF A;  1K8A C;  4TVR A;  2DJQ A;  2F2V A;  3V7R A;  2X4W A;  1Q82 U;  5IXB A;  1KD1 U;  3QWY A;  4BY6 B;  3AHU A;  1KQS S;  2DD4 A;  2QQS A;  5CKF A;  2BZX A;  2KEA A;  3M57 A;  3BY7 A;  1K9M C;  3QZ5 B;  4LDV A;  1OQK A;  2AZV A;  4GLK A;  2JTF A;  1T3S A;  2VAS A;  2ZPH B;  5LJ3 h;  2L89 A;  2FPE A;  3JCM g;  1NJI R;  1YI2 Q;  1K0S A;  2NLU A;  1BI3 A;  5KYN A;  1OPL A;  4C8Q B;  4CC3 A;  1O75 A;  2RQW A;  5GAM f;  1VQK Q;  1OEB A;  1T0H A;  3LYI A;  2MPX C;  1VQO A;  2DL7 A;  1JXO A;  2R5M A;  1WJR A;  2VXF A;  1MND A;  4BAC A;  1U1T A;  2I2L A;  4FL6 A;  4ANJ A;  1NLO C;  4E7J A;  3CPW P;  2F2X A;  2ATC B;  2EQK A;  1PD0 A;  1AOJ A;  3LH0 A;  4M77 F;  1JJ2 S;  1S72 Q;  2DIL A;  1G3T A;  4M78 E;  1Y96 A;  1YJ9 A;  5IAY A;  2P4T A;  1D1C A;  1KQS P;  1RAI B;  2M9U A;  3CBM A;  4ZTJ A;  1WXT A;  4LXC A;  2DZC A;  3OSS C;  4PJO A;  4ZN3 A;  3FEO A;  4RG8 A;  2FG0 A;  5GAN 8;  1N8R U;  2E12 A;  1D1B A;  4JJD A;  3CCQ Q;  1SSH A;  1VQ4 Q;  3H0H A;  2GBQ A;  1RLQ C;  4BE0 A;  2KXC A;  1KC8 U;  3TU4 K;  5A2Q E;  2AIR B;  2YRD A;  4WCI A;  4F14 A;  2R58 A;  5KYW B;  4GLM A;  2E6Z A;  3VU3 C;  1MMD A;  3D7S B;  2EJ9 A;  4MZT A;  1X6G A;  4PKC C;  1CSK A;  1AZE A;  4XK8 E;  4II1 A;  1Q82 R;  5I21 A;  4PL6 A;  1TS9 A;  2RN8 A;  4CC7 A;  1VQP A;  1A0N B;  1JJ2 P;  1C6V X;  2HL3 A;  4WTO B;  1B34 B;  3JCM e;  4AFZ C;  2X4Y A;  2CUD A;  4M7D B;  2RD1 A;  3CBP A;  5KYU A;  2DL5 A;  5LJ3 d;  4HKE A;  1ACM B;  2D8J A;  4IIM A;  3GOX A;  2E41 A;  3CCQ T;  1VQ4 T;  2A36 A;  4Z8A A;  3PNW C;  1ZSZ C;  1ZUU A;  4B9X A;  4IUV A;  1F1B B;  1WDX A;  1QVF S;  3JB9 I;  4J83 A;  2GFU A;  3JCM h;  4JJC A;  3CXC A;  2JT4 A;  3C0C A;  2JXB A;  1D09 B;  2KRO A;  1BIA A;  2YDL A;  5FWB A;  1WHK A;  4ZTF A;  3CD6 Q;  2A0F B;  5GAO n;  1CKB A;  1ZBJ A;  2AZS A;  1M1K C;  4LN2 A;  1I1J A;  2QQR A;  3HL8 A;  4Y91 A;  1M90 C;  1WHH A;  2A08 A;  2ZGW A;  4JJN K;  2DXT A;  2L3P A;  3NTK A;  2PTK A;  1D0Y A;  1PC0 A;  2RI3 A;  4BY6 C;  2IG0 A;  4MZM A;  1WIE A;  4C92 G;  2L3S A;  4M77 C;  1AHJ B;  1E7O A;  5D6X A;  3HRT A;  2YLB A;  2DAQ A;  2FZC B;  2XD0 A;  1X2K A;  3UDC A;  3OS5 A;  1ZSG A;  2LTO A;  1TXQ A;  4M75 A;  5CKH A;  1ZX6 A;  5J3B A;  1RL2 A;  2DTO A;  4QVZ A;  2ABL A;  1OI1 A;  3CC4 A;  4ORZ A;  1KC8 R;  1GCQ C;  2VUB A;  2DL3 A;  1QVF P;  2M0O A;  1YJN A;  3CD6 T;  4X9C A;  2J06 A;  4JRP A;  1M2O A;  3EGD B;  1LOJ A;  2CUB A;  4XU3 A;  1TTH B;  3HPW A;  1FMK A;  1KG1 A;  2RA2 A;  3DKM A;  3G1J A;  4RCB A;  2YUP A;  3QDF A;  2EYX A;  1JBM A;  4OMQ A;  2ESW A;  4RG2 A;  8ATC B;  1WYX A;  1FXX A;  3UF4 A;  3GPL A;  2FHD A;  3M5A A;  1UG1 A;  3I5S A;  2MWP A;  1M1G A;  4OMN A;  3QBY A;  2A7Y A;  2XKO C;  1W2B S;  1GXI E;  3CC2 T;  4EDU A;  4RTY A;  2QYZ A;  3VS5 A;  3SFM A;  2YRC A;  5I2S A;  4XTX A;  4F7U G;  1M3B A;  2RMO A;  2LT4 A;  3NMZ C;  5AT1 B;  4DBH A;  4VUB A;  3KXT A;  2EGC A;  3FIF A;  3VKI A;  4J6Y A;  3L2Q A;  4Z02 A;  2F1L A;  4A4E A;  4FSX A;  2C06 A;  2RNA A;  2DBK A;  2X4X A;  5GMK i;  5DM7 R;  7AT1 B;  4X34 A;  3RR6 A;  1OU9 A;  4F17 A;  5GAN 6;  4RCC A;  3TEE A;  4AG1 C;  2EPD A;  3PE0 A;  3CCU A;  2PUO B;  3SHW A;  2VGM A;  3CCR A;  1YWO A;  2PVD B;  5IN1 A;  2KRM A;  1JU5 C;  3PMI A;  3OYL A;  2EJG A;  1UGS B;  3H0I A;  2XK0 A;  1NJI C;  5FU7 B;  4MDW A;  4IUR A;  3JCM W;  1W2B P;  2D8H A;  1VYU A;  2O01 E;  4WF2 A;  1MNE A;  4CRI A;  3CCV A;  4E47 A;  1KK7 A;  1WA7 A;  3PIP A;  4JRI A;  2GTO A;  4R0K A;  4C0D C;  1K9A A;  4KGV B;  5IT9 E;  5L23 A;  1WHJ A;  1NE8 A;  2EQJ A;  2CP2 A;  4XTZ A;  2RK1 A;  1LNX A;  2ZAE A;  4ZGD B;  1JEG A;  3A8H B;  5IH2 A;  1GBR A;  2AT1 B;  2LX9 A;  3CCS A;  2C0I A;  2V1R A;  1VQP Q;  1I81 A;  1N9S A;  3M0U A;  2DLP A;  4C0F A;  4FT4 A;  3OYD A;  4ZNX A;  1QP2 A;  5I11 A;  1VQ7 A;  3EFR A;  4J7I A;  2LDM A;  4RTZ A;  2AHJ B;  4M75 F;  1VQ8 A;  2CZ7 B;  1YIT A;  4J9H A;  5FWC A;  1K76 A;  4PJO C;  2IVW A;  4OB0 B;  2NUT B;  2E3I A;  2COY A;  2K5I A;  1RAA B;  4N0A A;  2SEM A;  3VS0 A;  4JRQ A;  4M7A D;  1G2B A;  2CT4 A;  1Q82 C;  3EFO A;  1KD1 C;  1VUB A;  1I5O B;  1OUL A;  2QDL A;  2EGA A;  1KFZ A;  3V8J A;  1X27 A;  5KE2 A;  1Q86 U;  3OS0 A;  2G3R A;  2EYZ A;  5D6W A;  4DOW A;  4J8O A;  4FYY B;  1QVG A;  4LUE A;  1SRM A;  2EWN A;  4A4F A;  4ATO A;  2OTJ Q;  3WVD B;  4LDW A;  4EMG A;  1PRM C;  4M78 D;  2JZ2 A;  5FU6 C;  4HA8 A;  3L2R A;  1UUE A;  1UJY A;  1X2Q A;  2KK4 A;  5M9O A;  3JB9 D;  1CKA A;  4IUQ A;  4F7U E;  4A4G A;  2RJC A;  3DB4 A;  3PFS A;  4HVV A;  5D7U A;  1X75 C;  2HMA A;  3DLL A;  5HKC A;  2YSQ A;  3MEW A;  3CCL Q;  5GAN g;  2QGF B;  3CME T;  4KRT A;  1GFD A;  3OB9 A;  1M2V A;  2J7I A;  3CCM Q;  2O31 A;  2BUD A;  2QTX A;  2V8J A;  1U8R A;  1SPK A;  1SEM A;  1BCM A;  2R57 A;  2OTJ T;  1NEB A;  3CMA A;  4M78 G;  4ELY C;  4N4I A;  1JXM A;  2KT8 A;  1NZ9 A;  1N8R C;  3JB9 G;  3KBG A;  2P84 A;  2KGT A;  3EG3 A;  4QQ6 A;  5LJ5 g;  4M77 E;  4PJN A;  1OOT A;  1KC8 C;  1QMC A;  3RDV A;  1VYT A;  1GCQ A;  1QW1 A;  5LJ3 g;  2KY9 A;  2FPF A;  3CCL T;  1PKS A;  2EKO A;  4C8Q A;  3T9N A;  2NWM A;  2RHY A;  4M75 C;  1EIF A;  3QUI A;  3CCM T;  1QKX A;  1YJW T;  3THK A;  4E7L A;  2IPO B;  2RI5 A;  2K4Y A;  3DLM A;  3CEY A;  1Q86 R;  3ZEH A;  4RUG A;  3TQ7 P;  5GMK h;  3H0F A;  3O5Z A;  5GAN 5;  2BE9 B;  2E65 A;  2VC8 A;  3CPW A;  2CP7 A;  1QCN A;  4F04 B;  2V8I A;  5GAN 2;  2L2P A;  2XHC A;  2BTT A;  3OYY A;  1ZUK A;  3MET A;  3OYC A;  2LCC A;  2K3B A;  1D3B B;  1MUZ A;  4A4H A;  2D1X A;  2EKH A;  2EJF A;  1VQN A;  1H8K A;  4QKU A;  3OMC A;  2DE0 X;  2A28 A;  2QAS A;  4CC4 B;  5IHK A;  2Z0W A;  2LRQ A;  1DJ7 B;  2J6K A;  2RHX A;  1IXD A;  2DD5 A;  3X24 B;  1ZUY A;  3RNJ A;  6AT1 B;  5KYW A;  2KDS A;  3VYG A;  3I55 A;  1HXD A;  3MPU B;  4BE2 A;  2EIF A;  3EGX A;  2QA4 A;  5GAN h;  4XQ3 A;  1E6G A;  3HRU A;  3FB9 A;  3E9G A;  2KXD A;  1HSQ A;  3OYM A;  2HBW A;  3EFS A;  3CC7 Q;  1NG2 A;  2QXF A;  3JAM E;  3I5R A;  4C5I A;  2SRC A;  3RER A;  5IXF A;  3RMQ A;  5LJ3 e;  1B34 A;  3KUF A;  4C5E A;  2CS7 A;  3M55 A;  1NPR A;  3RES A;  3OW2 A;  1K4U S;  3VJP A;  4M7D A;  3G4S Q;  1M8M A;  3OS2 A;  3JCM Q;  2DX1 A;  1XTD A;  1AD5 A;  1VQL A;  2XDB A;  4ZGE B;  3HKS A;  4BB7 A;  2HZY A;  4RMO A;  5LJ5 h;  2CT3 A;  3HTR A;  3OYN A;  3IQL A;  1VQ8 Q;  2J6O A;  2FRY A;  5D6Y A;  3OYE A;  1YIT Q;  5CCA A;  1V29 B;  3L42 A;  2MIO A;  3LX7 A;  1Q95 G;  2V1Q A;  1IGQ A;  4FT2 A;  2D9T A;  3UT1 A;  3I56 A;  1LVK A;  3QJ6 A;  3CC7 T;  2JJ9 A;  2KRS A;  3JCM f;  2EFI A;  2RJE A;  2QI2 A;  4E2F B;  2B86 A;  2M16 A;  3MP8 A;  1UHF A;  4A63 B;  1Q81 R;  4P5N A;  4EMH A;  2RHI A;  3G4S T;  1K1Z A;  4OP0 A;  3M0T A;  2MOX A;  1YHQ Q;  2HSP A;  4Q5W A;  5CKB A;  2PVG B;  2ZPI B;  2RQV A;  3UAT A;  2F69 A;  1VQ9 A;  3MCA B;  4RTT A;  1M8V A;  1M5Q 1;  2QTV A;  3X26 B;  3EAE A;  2ED0 A;  1GL5 A;  1VA7 A;  2YT6 A;  2VV5 A;  1YI2 T;  2VVK A;  4Y28 E;  5CR2 A;  5IHN A;  4C8Q F;  5GAN d;  1VQK T;  4PJO E;  3VS1 A;  3E2U A;  3MEV A;  2JUF A;  4J7F A;  5DLQ E;  1XQH A;  1FX7 A;  4EMK B;  1OYX A;  2CZ1 B;  4UC4 A;  2QEX Q;  3EGD A;  5GAO m;  1QVF A;  4N0A C;  4OMM A;  4J9I A;  1S72 T;  2ED1 A;  1KD1 R;  1YHQ T;  1VOM A;  1ZA1 B;  2I0N A;  2WSF E;  4M4Z A;  3V8K A;  2FZK B;  2DPP B;  1R0C B;  3ER0 A;  5LJ5 d;  3M0R A;  3MP1 A;  1RAG B;  2A37 A;  1Y0M A;  2OTL A;  3G71 A;  3JRZ A;  1X6O A;  2K7A A;  2FVU A;  5GAN 7;  2JW4 A;  1H64 1;  2HBP A;  1KSW A;  2DFU A;  5FRM A;  2ZPF B;  4FYW B;  4ZGJ B;  4C92 D;  4J9C A;  1V76 A;  2NUZ A;  2QGG A;  4IIO A;  1ZA2 B;  2DXU A;  1D0X A;  3M58 A;  2QEX T;  1RUW A;  4MMK A;  2RJD A;  4M7A B;  4F16 A;  1R77 A;  2CP5 A;  1U5S A;  1WHM A;  1K73 U;  2XMF A;  3SWN B;  1VQ6 A;  1BK2 A;  2PUK B;  5DY9 A;  3RKY A;  1RAE B;  5GAM h;  2P4R A;  1C1A A;  2EQU A;  1WJS A;  1ZLM A;  4KUD K;  3CCJ A;  3G6E Q;  1VQ5 A;  3CQT A;  1NLP C;  4B9W A;  4N4G A;  2AKK A;  4M7D F;  3OBW A;  2Y4X A;  2CKK A;  3PVL A;  2KI7 A;  2DET A;  4M78 B;  5KCH A;  1YIJ Q;  3LGF A;  4L59 A;  1N8R R;  3OQ5 A;  1M3A A;  1IHW A;  1HJD A;  4KUI A;  2F5K A;  4LE9 A;  4PFO A;  2RK2 A;  4RTU A;  4D8K A;  4M7A F;  1UB4 A;  1W2B A;  1Q86 C;  1ZQ1 A;  3RIR A;  4M75 E;  3TSZ A;  2YUN A;  1BBZ A;  2XU8 A;  1TU0 B;  2OAW A;  1QLY A;  3P8D A;  3QJY A;  4LD6 A;  4C8Q C;  3A8M B;  3V8L A;  3CXC S;  2EVR A;  4DEX A;  3MEU A;  3RKX A;  3TCJ A;  3G6E T;  4QVD A;  4BD3 A;  1VQM A;  3EG9 B;  2KT1 A;  3J7A F;  5GJW B;  1IB8 A;  1QCO A;  4J9E A;  3GF5 A;  2KR3 A;  5CIU A;  9ATC B;  1YIJ T;  1UE9 A;  3AT1 B;  4OMO A;  1UTI A;  2XDD A;  3R6O A;  2COZ A;  3CCE A;  3INZ A;  3UA7 A;  4EPC A;  1OZ2 A;  1XOV A;  1UGP B;  3FLG A;  4M77 D;  1RAC B;  2NUT A;  1NBE B;  2ENM A;  5GAM d;  2HSE B;  4RKU E;  5HK3 A;  2QQA A;  1W4S A;  1K73 R;  2RHU A;  4FCY A;  3I35 A;  2DTI A;  2CP0 A;  5KYU B;  4XU2 A;  4A4K A;  5GAN j;  3L1A A;  1VQO Q;  3NTH A;  1XNI A;  2ZCF B;  3LGL A;  3URG A;  1IGU A;  1BIB A;  4HT9 A;  1SF9 A;  1QWE A;  2HQH A;  3M53 A;  1BB9 A;  2OX7 A;  1SHF A;  1B3Q A;  4PJM A;  4E7H A;  1D0Z A;  1KJW A;  4C0Z A;  3EHQ A;  2KVQ G;  5KCO A;  1YJ9 Q;  1AZG B;  3HP9 A;  1H92 A;  1G3W A;  3VS7 A;  4M77 G;  1X01 A;  4XU0 A;  4AT1 B;  2HEQ A;  1VQ9 Q;  5LJ5 j;  3J80 E;  3M0P A;  4M7D C;  4QQG A;  4GBQ A;  3QXE B;  3EG0 A;  5LJ3 j;  4XTY A;  2PQW A;  4J9D A;  2X3X D;  1FMW A;  4FW2 A;  4CI0 C;  1VQO T;  1MGQ A;  3WVE B;  4HCB A;  1Q81 C;  1IRE B;  3QHS A;  4FYV B;  1B7T A;  4M7A C;  2KMT A;  3PT9 A;  1M3C A;  1U06 A;  4ME7 A;  2LCL A;  2CGH A;  2QK0 A;  1YJ9 T;  1X6B A;  2X35 A;  1WX6 A;  1U1S A;  3A8L B;  4QVC A;  3OYF A;  3ZBD A;  1JRI A;  2P0Q A;  1BCO A;  3L2W A;  3I9Q A;  1TOV A;  1KQ1 A;  3G71 Q;  2BZY A;  2XDP A;  2H3E B;  2Y4Y A;  1N9R A;  2K2M A;  2GTJ A;  2LX7 A;  3GNG A;  1M4Z A;  3PMT A;  5GMK m;  4BUG A;  3OS1 A;  4DA4 A;  3EH1 A;  5KYY B;  2K3X A;  2BKD N;  4IUP A;  1M1K U;  1BI0 A;  2LNV A;  2KSS A;  2EBP A;  4BDZ A;  2JS0 A;  3LWH A;  4OGE A;  2M02 A;  2LCS A;  1PD1 A;  4FU6 A;  3VYH B;  2K2V A;  2XID A;  2ROL A;  4DBR A;  1TSF A;  4DEY A;  4RTX A;  2AK5 A;  5L8R E;  3OYB A;  2DXC A;  1VQP T;  2JVV A;  2HD0 A;  2QQ9 A;  3JCM V;  1AEY A;  4J9G A;  3SEM A;  1MMG A;  5IHI A;  2X9H A;  3OYH A;  1GBQ A;  3VS6 A;  2EW3 A;  2K79 A;  4EIK A;  4JRK A;  2YHT A;  5FRO A;  1OX9 A;  3FRN A;  1NM7 A;  3CBO A;  3A98 A;  3M4Y A;  4PJJ A;  1LPL A;  4JLG A;  2LJ1 A;  3LH5 A;  2DRM A;  3VUZ A;  2GQV A;  2LQK A;  3CC4 Q;  5EC7 A;  1MV0 B;  1YJN Q;  2E70 A;  2CDT A;  2CSQ A;  5KH6 A;  4LDX A;  2BZ8 A;  2M1H A;  4PJO D;  4HVU A;  2KRN A;  3CCQ A;  1VQ4 A;  1VQM Q;  2PVO B;  2LNH B;  4DOV A;  3EH2 A;  3QPH A;  5GAN f;  3M54 A;  1RAD B;  2FRW A;  4J5Y A;  3X28 B;  4IUT A;  3JCM b;  1QVG S;  1SRL A;  4YTL A;  5FLX E;  3HHT B;  2E1H A;  3UWN A;  2PZ1 A;  2MCN A;  1M1F A;  3OSV A;  1K0X A;  2DVE A;  4LDU A;  1GCP A;  3JCM c;  3M4G A;  1W1F A;  3WXM B;  3CC4 T;  4KBM B;  3JCM P;  2JTE A;  1NYF A;  5FU7 C;  4C92 B;  5I2M A;  1YJN T;  5GMK e;  1Q7Y U;  2MI6 A;  5HY6 A;  4PJO G;  3VRZ A;  1UEB A;  2RF0 A;  2QAZ A;  2NUP B;  4LNP A;  1HK9 A;  4XTW A;  5CKE A;  2E64 A;  3OYJ A;  5LJ3 f;  3VUB A;  4C8Q E;  3EG2 A;  2DMO A;  4JPB W;  4JDS A;  2EQM A;  3VS3 A;  2K5F A;  1NPP A;  2DM1 A;  2VYT A;  3CCU Q;  2VWF A;  2CRE A;  2LQ8 A;  3HFN A;  8AT1 B;  3ZFJ A;  3CCR Q;  3EFO B;  4OF1 A;  3DB3 A;  3OYK A;  3CD6 A;  5C6S A;  3L2Z A;  3N5B B;  4E7S A;  2LQW A;  1SHG A;  5GAN e;  1KQS A;  4C92 F;  2QQB A;  1K73 C;  1BU1 A;  4OMF B;  4B6M A;  2LP5 A;  3ASK A;  4E6R A;  4HCK A;  3CCV Q;  3U23 A;  4AMC A;  4LUD A;  3RUX A;  5AYF A;  5A0L A;  2WSE E;  3BFM A;  5CAI A;  1ZSZ B;  3QSU A;  4F7U B;  1AT1 B;  3O8V A;  2ZPB B;  2MWO A;  5A0D A;  1PWT A;  2A3L A;  3HSB A;  1YWP A;  1UGV A;  5KYX B;  1YBY A;  5LJ5 e;  3CC2 A;  4M75 D;  1TUD A;  3VS2 A;  3C94 A;  3CCU T;  3GIB A;  3H6Z A;  4D6W A;  3CCR T;  2KYB A;  2LVM A;  1PCX A;  3SD4 A;  3QO3 A;  3S6W A;  2L0A A;  1J3T A;  3CCS Q;  2EAY A;  3OYI A;  2DL4 A;  3EHR A;  2XIC A;  1Y57 A;  1S1N A;  4PFZ A;  3CPW S;  5J26 A;  1JJ2 A;  2PNI A;  4QT7 A;  5FRN A;  1VQ7 Q;  1G5V A;  4MDX A;  3GLX A;  3CCV T;  4M7D E;  1X69 A;  2B8A A;  3M0Q A;  4JUV A;  3UA6 A;  1H3H A;  2DRK A;  1LCK A;  1V1C A;  1Q7Y R;  4OB3 B;  4JZ4 A;  2K57 A;  2L3Q A;  4M77 B;  3JB9 J;  3QG1 A;  4XU1 A;  1WJQ A;  2CZ0 B;  1TG0 A;  4FW1 A;  4F7U F;  4M7A A;  4M75 G;  3QYH B;  3JV3 A;  4KUL A;  3SWN A;  1RI0 A;  4LDY A;  5GAM g;  4FYX B;  5HK0 A;  4M7A E;  4MML A;  2O88 A;  1RAH B;  3CCS T;  2DKG A;  1EX4 A;  3MHX A;  3TSW A;  1PRL C;  2EYW A;  2DJZ A;  2DZ9 A;  1PM3 A;  2WAC A;  2HAX A;  2X51 A;  3X25 B;  1QWF A;  3OA6 A;  3JSC A;  1VQ7 T;  3OYA A;  1ABO A;  2K6D A;  4BI8 B;  5GAO p;  4M78 A;  1VQ8 T;  2O4X B;  1AVZ C;  1MMA A;  1QCF A;  1YIT T;  4DQ2 A;  3OW2 S;  2O9S A;  1MMN A;  3FC3 A;  2C0O A;  1YCS B;  3KFV A;  1X43 A;  4C92 C;  3RKW A;  5J39 A;  3L2U A;  2IIM A;  4Z88 A;  4KT0 E;  2NYS A;  4OB1 B;  3EG9 A;  4E7I A;  2XG8 D;  4OVA A;  2L3R A;  4NOY A;  5CKD A;  3JB9 H;  4ELZ C;  4BE1 A;  3CPF A;  2KE9 A;  1HYO A;  1AWO A;  4O6J A;  5CQX A;  3CMA Q;  1OPK A;  4K11 A;  2HDA A;  1NYG A;  3EGX B;  1Y7X A;  2JM9 A;  4JS5 A;  4J9B A;  3NTI A;  4CC2 A;  1KHC A;  1QQJ A;  2J6F A;  3S3N A;  5GAN 4;  5GAM e;  3OW2 P;  3NHN A;  4KH0 B;  1VYV A;  2H8H A;  2JS2 A;  3HFO A;  2W0Z A;  1I4K 1;  2VGN A;  3NFC A;  1BI2 A;  1BYM A;  2JNG A;  3H8Z A;  2K9G A;  5CK9 A;  1R8O B;  2CH4 W;  2FB7 A;  5CQY A;  1TUG B;  3MEA A;  2DIG A;  4E7Z A;  1Z9Z A;  4X9D A;  4X1V A;  3VRY A;  1I8F A;  3OBY A;  4Y92 A;  2L8D A;  5ECA A;  3CMA T;  4J9F A;  2RI2 A;  3PVQ A;  3ME9 A;  4C0D B;  3BE3 A;  4PK4 A;  1FWZ A;  2D6F A;  1WPY A;  3TRE A;  1YP5 A;  2PU9 B;  1P92 A;  4C5H A;  3TVT A;  4JS4 A;  1W70 A;  2HQX A;  2EYQ A;  3LLR A;  2YXY A;  1I0C A;  2RB6 A;  1G3Y A;  3CME A;  1AWX A;  2FEI A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 3JCM g;  4HCB A;  1Q81 C;  1IRE B;  3QHS A;  1NZ9 A;  1PSE A;  1BI3 A;  2NLU A;  1N8R C;  4M7A C;  3JB9 G;  2KMT A;  4L6V 5;  3KBG A;  4C8Q B;  1O75 A;  3PT9 A;  3P8H A;  4QQ6 A;  5LJ5 g;  4M77 E;  2CZ6 B;  4FM4 B;  4ME7 A;  5GAM f;  1Y96 B;  1VQO A;  3LYI A;  2LCL A;  2CGH A;  1KC8 C;  2OTJ A;  1YJ9 T;  2R5M A;  1WJR A;  2VXF A;  1K8A U;  2X35 A;  2DEQ A;  2ZZD A;  1G3S A;  1U1T A;  1QW1 A;  2I2L A;  4FL6 A;  5LJ3 g;  4BAC A;  1U1S A;  2RHZ A;  3A8L B;  4QVC A;  3GP8 A;  4E7J A;  2KY9 A;  3OYF A;  4N4H A;  3CCL T;  2EQK A;  2K3Y A;  2EKO A;  3ZBD A;  1JRI A;  3LH0 A;  2P0Q A;  4C8Q A;  4M77 F;  3L2W A;  4PJO B;  3T9N A;  2RHY A;  1JJ2 S;  4M75 C;  1KQ1 A;  1G3T A;  2ZPE B;  4M78 E;  2XDP A;  4LD9 K;  1Y96 A;  1YJ9 A;  1EIF A;  3QUI A;  5IAY A;  5DLO A;  3CCM T;  2Y4Y A;  1K9M U;  1N9R A;  3V7S A;  5GMK j;  1YJW T;  2DTH A;  4E7L A;  2P4T A;  3E9F A;  3GNG A;  2RI5 A;  1M4Z A;  2M9U A;  3PMT A;  2K4Y A;  4NS5 A;  3CBM A;  3CEY A;  3DLM A;  5GMK m;  4ZTJ A;  3CCL A;  4BUG A;  1M90 C;  3OS1 A;  5EG2 A;  4DA4 A;  3ZEH A;  2K3X A;  2DZC A;  2P0P A;  2BKD N;  3OSS C;  3A8G B;  4IUP A;  1M1K U;  1BI0 A;  2LNV A;  5GMK h;  4PJO A;  2KSS A;  4M78 F;  4ZN1 A;  4ZN3 A;  4BDZ A;  1KHI A;  5GAN 5;  3FEO A;  3CCM A;  1VQN T;  4RG8 A;  2E65 A;  1YJW A;  2VC8 A;  3LWH A;  5GAN 8;  4OGE A;  2E12 A;  3CPW A;  1N8R U;  4FU6 A;  3VYH B;  2K2V A;  2XID A;  3JB9 F;  2V8I A;  5GAN 2;  4BE0 A;  2XHC A;  1KC8 U;  3TU4 K;  3OYY A;  1WGS A;  3MET A;  5A2Q E;  3OYC A;  2LCC A;  5L8R E;  1D3B B;  2R58 A;  3OYB A;  2OAU A;  1PSF A;  2DXC A;  4A4H A;  1VQP T;  2E6Z A;  2EJF A;  3VU3 C;  1VQN A;  3I55 T;  1I5L A;  2JVV A;  2EJ9 A;  2HD0 A;  2QQ9 A;  4MZT A;  3JCM V;  5FU6 B;  5GAO l;  4PKC C;  4OB2 B;  2QA4 T;  3OMC A;  3M59 A;  4PJO F;  4XK8 E;  4II1 A;  2LRQ A;  2LC4 A;  5I21 A;  1DJ7 B;  3JCM d;  4NL2 A;  3OYH A;  2RHX A;  4PL6 A;  2DD5 A;  4A54 A;  5CO7 A;  3X24 B;  4EMK C;  1VQP A;  2KDS A;  3VYG A;  3I55 A;  2WSC E;  4JRK A;  2YHT A;  1HXD A;  3M56 A;  1B34 B;  3JCM e;  5FRO A;  3OY9 A;  4BE2 A;  2EIF A;  3FRN A;  2X4Y A;  5GAN h;  2QA4 A;  3CBO A;  4QW2 A;  3LWI A;  4HT8 A;  4V2S A;  4M7D B;  2RD1 A;  3CBP A;  3HRU A;  4XQ3 A;  4C8Q D;  3FB9 A;  2FL7 A;  3M4Y A;  3RMS A;  1UGR B;  5LJ3 d;  4HKE A;  3E9G A;  4JLI A;  2YRV A;  4JLG A;  3OYM A;  3EFS A;  1VQL T;  5GAN 3;  3VUZ A;  2GQV A;  3QZ9 B;  2E41 A;  3GOX A;  3CCQ T;  2QXF A;  2LQK A;  1VQ4 T;  3JAM E;  3C4S A;  1ZBX A;  1Y07 A;  4C5I A;  3PNW C;  3RER A;  3RMQ A;  5LJ3 e;  1Q7Y C;  4IKF A;  1B34 A;  2E70 A;  4B9X A;  3KUF A;  4IUV A;  4C5E A;  4BI3 A;  2CS7 A;  3M55 A;  5KH6 A;  1NPR A;  3RES A;  3OW2 A;  2M1H A;  3JB9 I;  2Y90 A;  3HRS A;  4J83 A;  3VJP A;  4LDX A;  2GFU A;  2JTM A;  4M7D A;  3JCM h;  4PJO D;  2L5Q A;  3FJP A;  3OS2 A;  2P0K A;  3CXC A;  3JCM Q;  1XTD A;  1VQL A;  4XTU A;  2XDB A;  4ZGE B;  3HKS A;  4BB7 A;  2E10 A;  3CCQ A;  1VQ4 A;  4RMO A;  5LJ5 h;  2PVO B;  1BIA A;  2DIQ A;  2GFA A;  4DOV A;  3QPH A;  3OYN A;  3I56 T;  4ZTF A;  5GAN f;  5GAO n;  3M54 A;  5D6Y A;  1M1K C;  3OYE A;  2QQR A;  3HL8 A;  4J6X A;  2R5A A;  1V29 B;  1VIE A;  3L42 A;  4Y91 A;  4J5Y A;  5CCA A;  5GAO q;  3JCM J;  3LX7 A;  3QII A;  3X28 B;  2ZGW A;  4JJN K;  4IUT A;  3JCM b;  4C8Q G;  2MF2 A;  1QVG S;  4FT2 A;  2DXT A;  4YTL A;  5FLX E;  2D9T A;  3UT1 A;  3HHT B;  4M75 B;  2E1H A;  3SWN C;  3UWN A;  2F5T X;  3NTK A;  1M1F A;  3OSV A;  3I56 A;  2RI3 A;  2DVE A;  4LDU A;  3QJ6 A;  4BY6 C;  3JCM c;  3CC7 T;  2IG0 A;  3M4G A;  4MZM A;  3WXM B;  3CC4 T;  4C92 G;  4KBM B;  3JCM f;  4M77 C;  3JCM P;  3QKJ A;  1AHJ B;  5D6X A;  5FU7 C;  4C92 B;  2EFI A;  3HRT A;  2YLB A;  2RJE A;  2QI2 A;  5I2M A;  5GMK e;  1VQ9 T;  1YJN T;  1Q7Y U;  1Q82 C;  2MI6 A;  2DAQ A;  2M16 A;  5HY6 A;  1MHN A;  4PJO G;  3MP8 A;  1IZ6 A;  2XD0 A;  3E19 A;  1UEB A;  4P5N A;  3UDC A;  4EMH A;  2HQE A;  2RHI A;  3OS5 A;  3G4S T;  1HK9 A;  2LTO A;  4M75 A;  3SB2 A;  5CKH A;  4XTW A;  3M9Q A;  4OP0 A;  5CKE A;  5J3B A;  3CC7 A;  1RL2 A;  1UGQ B;  2DTO A;  2E64 A;  4A53 A;  4QVZ A;  3OYJ A;  1OI1 A;  4Q5W A;  3CC4 A;  5LJ3 f;  5CKB A;  2PVG B;  3VUB A;  2ZPI B;  2HNI A;  4C8Q E;  2VUB A;  4M78 C;  2M0O A;  2F69 A;  5LL6 S;  1YJN A;  1VQ9 A;  4C92 A;  3CD6 T;  3C12 A;  3MCA B;  4X9C A;  4JDS A;  2EQM A;  1M5Q 1;  1M8V A;  2K5F A;  1NPP A;  3EAE A;  3X26 B;  1M90 U;  3G4S A;  4JRP A;  2VV5 A;  1YI2 T;  4M7D D;  1WNL A;  1LOJ A;  4XU3 A;  3C95 A;  4Y28 E;  4C92 E;  3HPW A;  5CR2 A;  2VYT A;  2GCX A;  3F70 A;  3JCM X;  1KG1 A;  2LQ8 A;  3HFN A;  2KAF A;  4C8Q F;  3ZFJ A;  2RA2 A;  3DKM A;  5GAN d;  1VQK T;  4RCB A;  4OF1 A;  4PJO E;  3DB3 A;  3OYK A;  3CD6 A;  1M9S A;  2X4J A;  3MEV A;  2JUF A;  5C6S A;  1JBM A;  4J7F A;  2JOY A;  3L2Z A;  5DLQ E;  3N5B B;  1XQH A;  1FX7 A;  4PLL A;  4RG2 A;  4XTV A;  4EMK B;  4R55 A;  1OYX A;  2CZ1 B;  5GAN e;  3PTA A;  1YI2 A;  4UC4 A;  1KQS A;  2JN0 A;  1WQ7 A;  4C92 F;  1FXX A;  5GAO m;  3UPU A;  4N0A C;  3GPL A;  2FHD A;  1QVF A;  3M5A A;  1QP3 A;  3BW1 A;  4HCC A;  2QQB A;  4FIB A;  1K73 C;  3L2V A;  2MWP A;  1M1G A;  4OMF B;  1VQK A;  1BKB A;  3ASK A;  1S72 T;  2OTL T;  3G71 T;  3QBY A;  3GNF B;  2YLC A;  2A7Y A;  2XKO C;  4O5V A;  1W2B S;  1YHQ T;  1GXI E;  3CC2 T;  4EDU A;  4C5G A;  3RUX A;  3LW5 E;  2WSF E;  5AYF A;  5A0L A;  3V8K A;  2WSE E;  3V7C A;  3SFM A;  1D3B A;  2DPP B;  5I2S A;  4XTX A;  3BFM A;  3ER0 A;  5LJ5 d;  4F7U G;  5CAI A;  3QSU A;  2LT4 A;  3BDU A;  3MP1 A;  4F7U B;  3O8V A;  2ZPB B;  4M7D G;  2MWO A;  1QVP A;  4C0G A;  4VUB A;  5A0D A;  3KXT A;  2A3L A;  1S72 A;  3G71 A;  2OTL A;  3JRZ A;  1X6O A;  1KQ2 A;  3HSB A;  3FIF A;  3VKI A;  4J6Y A;  3L2Q A;  3SDZ A;  4Z02 A;  5GAN 7;  1YBY A;  2FVU A;  5LJ5 e;  1YHQ A;  3CC2 A;  4M75 D;  4A4E A;  3CCU T;  1H64 1;  2HBP A;  3C94 A;  4FSX A;  2D0Q B;  2C06 A;  3GIB A;  3H6Z A;  2X4X A;  3P8B B;  4XAX B;  4D6W A;  5GMK i;  5DM7 R;  3CCR T;  2LVM A;  1N27 A;  4X34 A;  3SD4 A;  3QO3 A;  3E1S A;  4IUU A;  3S6W A;  2ZPF B;  4ZGJ B;  5FRM A;  1VQ6 T;  2EAY A;  3OYI A;  4C92 D;  2E5Q A;  3BDL A;  4F7U A;  5GAN 6;  4J6W A;  4RCC A;  2XIC A;  3TEE A;  2MAM A;  3M58 A;  2DXU A;  2QEX T;  5GAM j;  4BI4 A;  4M7A G;  3CPW S;  3CCU A;  5J26 A;  2PUO B;  2RM4 A;  2VGM A;  2RJD A;  4MMK A;  3CCJ T;  4M7A B;  1JJ2 A;  3OYG A;  5FRN A;  3CCR A;  1K73 U;  1VQ5 T;  2E6N A;  1G5V A;  4QQD A;  4MDX A;  3GLX A;  3SWN B;  2PVD B;  2PUK B;  4R56 A;  3CCV T;  4E7K A;  1VQ6 A;  4JUV A;  2B8A A;  5DY9 A;  5IN1 A;  3PMI A;  3RKY A;  3OYL A;  3S3M A;  2EJG A;  5GAM h;  1UGS B;  4OB3 B;  2BIV A;  2K57 A;  2XK0 A;  3FDR A;  2EQU A;  4M77 B;  3JB9 J;  1NJI C;  2QEX A;  5FU7 B;  4HCZ A;  1WJS A;  1YCY A;  3QG1 A;  1WJQ A;  2DO3 A;  2MMP A;  4MDW A;  4XU1 A;  4IUR A;  5LJ3 h;  2CZ0 B;  3CCJ A;  3JCM W;  4KUD K;  4F7U F;  1VQ5 A;  4M7A A;  4M75 G;  3QYH B;  2O01 E;  1LJO A;  4WF2 A;  4MZP A;  4B9W A;  4KUL A;  4CRI A;  4N4G A;  3CCV A;  4M7D F;  3QDR B;  3OBW A;  2Y4X A;  3SWN A;  2GF7 A;  4E47 A;  1VIF A;  2CKK A;  3J81 E;  3PIP A;  1RI0 A;  4JRI A;  4LDY A;  5GAM g;  1H3Z A;  2ZPG B;  4M7D E;  5HK0 A;  4M7A E;  4MML A;  4C0D C;  3CCS T;  3PGG A;  4M77 A;  2DKG A;  4M78 B;  5KCH A;  5IT9 E;  3MHX A;  1NE8 A;  5LJ5 f;  2EQJ A;  2DJZ A;  3LGF A;  2DZ9 A;  4L59 A;  4PLI A;  3OQ5 A;  2WAC A;  4XTZ A;  2HAX A;  3X25 B;  2RK1 A;  1LNX A;  3OA6 A;  3JSC A;  4KUI A;  2F5K A;  4ZGD B;  2RK2 A;  3A8H B;  1WQW A;  1VQ7 T;  1VQM T;  4M7A F;  3OYA A;  1UB4 A;  1W2B A;  2LX9 A;  3CCS A;  2RJF A;  4BI8 B;  5GAO p;  1Q86 C;  1ZQ1 A;  4M78 A;  3RIR A;  4M75 E;  4NL3 A;  1VQ8 T;  2O4X B;  2FYK A;  1I81 A;  2V8K A;  2XU8 A;  3A8O B;  1YIT T;  4DQ2 A;  3OW2 S;  2CYZ B;  3P8D A;  3QJY A;  4L5G A;  1N9S A;  4LD6 A;  5C0M A;  4C8Q C;  3FC3 A;  3A8M B;  1NJI U;  3QYG B;  3V8L A;  4FT4 A;  4C0F A;  5KE3 A;  3MEU A;  3OYD A;  3RKX A;  3TCJ A;  3CXC S;  3S3O A;  1QP2 A;  3G6E T;  4PNO A;  4QVD A;  4BD3 A;  1VQM A;  1VQ7 A;  3EFR A;  1ZHI A;  4J7I A;  2LDM A;  3J7A F;  3MP6 A;  3CCE T;  3G7Z A;  2AHJ B;  4M75 F;  1VQ8 A;  3CCE A;  2CZ7 B;  4C92 C;  2XI9 A;  2O4X A;  1YIT A;  3A5Z B;  3VV0 A;  5GMK l;  5A0G A;  3RKW A;  3GF5 A;  4PJO C;  2IVW A;  4OB0 B;  5J39 A;  3L2U A;  3G6E A;  5CIU A;  2K5I A;  4KT0 E;  1YIJ T;  4N0A A;  1Q81 U;  4OB1 B;  4JRQ A;  4M7A D;  2DXB A;  4E7I A;  2XDD A;  3R6O A;  1OZ3 A;  2XG8 D;  4OVA A;  3INZ A;  4OGC A;  2H3J A;  2L3R A;  1OZ2 A;  1XOV A;  4NOY A;  5CVI A;  4EPC A;  1VUB A;  5CKD A;  1KD1 C;  4ELZ C;  3JB9 H;  1UGP B;  4BE1 A;  3CPF A;  4O6J A;  1O9S A;  5CQX A;  2RO0 A;  3V8J A;  4EMK A;  1SSF A;  3FLG A;  5KE2 A;  4M77 D;  1Q86 U;  3OS0 A;  3X20 B;  1YIJ A;  2LT1 A;  2G3R A;  5D6W A;  4DOW A;  3PIO A;  4J8O A;  5GAM d;  1Y7X A;  5HK3 A;  4RKU E;  4JS5 A;  1QVG A;  2QQA A;  1W4S A;  2EWN A;  4BDY A;  1Y71 A;  2RHU A;  1TH7 A;  2DTI A;  3NTI A;  3Q1J A;  4A4F A;  2K5L A;  1KHC A;  4XU2 A;  4ATO A;  4A4K A;  5GAN j;  3L1A A;  1JB0 E;  3S3N A;  5GAN 4;  5GAM e;  2KQW A;  1XNI A;  3NTH A;  3WVD B;  2ZCF B;  3LGL A;  3OMG A;  3HFO A;  4LDW A;  3URG A;  1I4K 1;  2VGN A;  3NFC A;  1BI2 A;  1BIB A;  4GY5 A;  4M78 D;  4EMG A;  1BYM A;  4HT9 A;  2JNG A;  3H8Z A;  2JZ2 A;  3M53 A;  1BI1 A;  1N6A A;  5FU6 C;  4HA8 A;  3L2R A;  5CK9 A;  2QDY B;  1R8O B;  4E7H A;  2FB7 A;  5CQY A;  2DK3 A;  2KK4 A;  5M9O A;  5GAO r;  3JB9 D;  3MEA A;  2DIG A;  2RH2 A;  2VXE A;  4IUQ A;  4C0Z A;  4F7U E;  4X9D A;  2KVQ G;  4A4G A;  2RJC A;  4TVR A;  5KCO A;  3V7R A;  3DB4 A;  3PFS A;  1K8A C;  2X4W A;  1Q82 U;  1X75 C;  3DLL A;  1I8F A;  3HP9 A;  1KD1 U;  3OBY A;  5HKC A;  4BY6 B;  3AHU A;  2L8D A;  1G3W A;  4M77 G;  1X01 A;  4XU0 A;  3MEW A;  5LJ5 j;  3CMA T;  2RI2 A;  5GAN g;  1KQS S;  3ME9 A;  4C0D B;  3J80 E;  1FWZ A;  4M7D C;  2DD4 A;  3CME T;  4QQG A;  2QQS A;  5CKF A;  2D6F A;  3M57 A;  1WPY A;  3TRE A;  3OB9 A;  3BY7 A;  3QXE B;  1K9M C;  2PU9 B;  1P92 A;  4C5H A;  3QZ5 B;  5LJ3 j;  4LDV A;  4XTY A;  2PQW A;  4JS4 A;  2HQX A;  2BUD A;  2EYQ A;  2QTX A;  2V8J A;  3LLR A;  1U8R A;  4GLK A;  4CI0 C;  1VQO T;  1MGQ A;  2R57 A;  2OTJ T;  3CMA A;  4M78 G;  2RB6 A;  3MO8 A;  2JTF A;  2ZPH B;  3WVE B;  1G3Y A;  3CME A;  4ELY C;  4N4I A;  2L89 A;  1QVF S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...