1DJ7B

Crystal structure of ferredoxin thioredoxin reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN THIOREDOXIN REDUCTASE: CATALYTIC CHAIN
molecule tags Electron transport
source organism Synechocystis sp.
publication title Redox signaling in chloroplasts: cleavage of disulfides by an iron-sulfur cluster.
pubmed doi rcsb
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1dj7B00
2CZ7B 2PVGB 2AHJB 4OB3B 2ZPEB 3WVDB 2PVOB 1PSEA 2ZPGB 2DXCA 2ZZDA 1IREB 3WVEB 2ZCFB 4ZGJB 1DJ7B 2CYZB 3X25B 1QP2A 1GXIE 1QP3A 4KT0E 2D0QB 1UGPB 3QYHB 1UGQB 2PUOB 2ZPIB 3A8HB 4OB2B 1V29B 2PVDB 3X24B 3HHTB 3A8GB 2PU9B 1PSFA 4FM4B 2DXBA 4L6V5 2WSCE 2CZ6B 1UGSB 3A8LB 3QZ5B 2DD5A 1UGRB 2DD4A 2ZPBB 1JB0E 4OB1B 3VYHB 3QYGB 2DPPB 4ZGDB 2QDYB 2WSFE 2ZPFB 2ZPHB 4XK8E 3X20B 4ZGEB 3A8MB 3QXEB 1AHJB 3A8OB 5L8RE 2CZ0B 3VYGA 3X28B 2O01E 4Y28E 3LW5E 3QZ9B 4RKUE 3X26B 2PUKB 4OB0B 2WSEE 2CZ1B
chains in the Genus database with same CATH superfamily
1U1TA 2XI9A 1M90C 2QK0A 1TG0A 2RH2A 3BY7A 3S6WA 3V7CA 2V8KA 1Q7YR 1WXUA 2FL7A 4A63B 2I0NA 4F7UE 1GCQA 3NGPA 2L3QA 4D8DA 4KUIA 1ZUKA 4J7IA 3L2VA 3UPUA 3V7SA 3VUBA 3OW2S 1Q81C 3EH1A 3WVEB 5GAN8 2A0FB 3REAB 2HQEA 3OYCA 2DFUA 3JAME 3PT9A 3IQLA 1VUBA 2ZPBB 2KI7A 1FMWA 1V76A 4LUEA 3V8KA 4O5VA 2LNHB 3EH2A 4FIBA 4JJBA 4ANJA 1D1BA 4ZTJA 8AT1B 2NLUA 4ORZA 4R56A 2EPDA 1NJIC 1WYXA 5FLXE 2GCXA 2HNIA 1N8RR 4M77B 4F14A 1VQPQ 5ECAA 1NPRA 4C92C 3JRZA 4M75C 3JCMJ 3C4SA 4VUBA 4KGVB 1U3OA 2QI2A 1LCKA 2CDTA 2X35A 4FW2A 1KJWA 2EJFA 3CCSA 3M4GA 3BDUA 4XU0A 2CP7A 2FO0A 3L2ZA 1CSKA 2YDLA 1M3CA 1X2QA 2JTEA 3HPWA 2QTXA 1YJWQ 3C94A 2CT3A 2D6FA 2FZKB 2HQHA 1BIAA 4RTYA 4E6RA 2CH4A 2EYQA 1TU0B 3OBWA 2QGFB 1W2BP 2J05A 4LD6A 1VQKA 3MEVA 3TEEA 5KYXB 2HDAA 4NL2A 2QTVA 4CC3A 4HCKA 3LH5A 5CVIA 4C5EA 4A4GA 5KYUB 1EX4A 2O9SA 3RESA 1LOJA 3MEUA 3A1PA 2R57A 2XU8A 2ZPFB 4J9HA 4BUGA 5GMKl 4WTOB 1WHGA 4ZGEB 3CQTA 1RACB 2CP5A 2FPDA 5GAOr 3QBYA 1Y07A 2QDLA 2E12A 2DXCA 3CBOA 5D7UA 4E7HA 1M90U 1G3SA 2A37A 4R0KA 5LJ5j 4M7DA 1DJ7B 3M0RA 1QWFA 3RUXA 3JCMe 2JS0A 1RL2A 3UDCA 1OV3A 2OTJA 1BI1A 5LJ3g 1SSHA 4EMHA 3LGFA 2KYMA 1GCPA 3H0HA 1KHIA 2CUBA 2V1QA 4D8KA 3EFRA 1Q7YC 4L59A 1YBYA 3DLMA 5KCHA 1KQSP 3URGA 4LD9K 1IREB 1YN8A 1Y96B 4C92D 2LMJA 4PFOA 3LGLA 3H0IA 5A0GA 3VRYA 2DM1A 4XTUA 4PJLA 1WX6A 1VYVA 2J6OA 2QAZA 4QVDA 3CCRT 3QXEB 3CBMA 5I22A 4E7ZA 1SEMA 1VQKQ 2P4RA 2W0ZA 4N0AC 3L2RA 2A7YA 4PJOA 3CCVT 3R6NA 4J7FA 1WFWA 1SHGA 3UA6A 3CCUA 1ZA1B 5LJ3j 3F70A 4JLGA 1ZA2B 5IN1A 3L42A 1VA7A 2LRQA 4E47A 3D7SB 4J9BA 3CMEQ 3HFOA 2L2PA 1RAEB 1JXOA 2DTHA 2YLBA 2ZPEB 2V26A 3CCET 3FRNA 3S3OA 3CD6T 2RPNA 3CBPA 1QVFA 1JJ2S 5IHKA 2XD0A 4M78E 1M27C 3JB9G 2DL8A 2E1HA 1K73R 3I56A 4B6MA 3SEMA 2QXFA 1YWPA 1Q95G 3I55A 4C5GA 5HY6A 1VQMT 1YFNA 5KYYA 3ULRB 4JJDA 4NL3A 2E41A 3FDRA 3KXTA 2MK5A 4M7AA 1QVFP 3PGGA 3EGDB 4PJJA 2ZPIB 1S72A 1VQLT 1B07A 4KH0B 1MHNA 3HP9A 2DBMA 4CC7A 2KVQG 3VS1A 2XK0A 2CP3A 2K4YA 2LQWA 1EZZB 4QW2A 3JB9I 2RQTA 4OMOA 1B34A 3CD6A 2LZ6B 2ED1A 1Y0MA 3M0SA 1KC8U 2YWWA 2K3BA 1O75A 2EKHA 3AHUA 4J9IA 1X01A 2JN0A 3RKWA 1VIFA 2KXDA 4XK8E 2KE9A 3OB9A 1M3AA 2X4WA 3FJ5A 3EG0A 4JUVA 4XTZA 4F17A 3S3MA 5GAN7 4FYVB 4FL6A 4MZTA 5D6YA 3OYJA 1VQLA 2VXFA 1K1ZA 2QGGA 2HSEB 3ASKA 3A8HB 2CSIA 2E10A 3OYAA 4HVWA 7AT1B 4M7AB 5GANd 4UC4A 2BTTA 1AOJA 3FC3A 3FB9A 3RBBB 1S72Q 1D0ZA 1UHCA 3CC7T 4A4HA 2EJ9A 1UGQB 2K57A 2J7IA 1NPPA 1TH7A 4M75A 3L2QA 3M55A 5GJWB 3QIIA 2M51A 2FZGB 3FIFA 1N8RC 3PIOA 2HBWA 4Y92A 2NUTB 4B9WA 3MP1A 5FW9A 4ZN1A 5LJ5g 3OYGA 5CQYA 3CCVA 2Y4YA 4C0DB 2CP2A 1K0SA 4M7DC 3QSUA 1YP5A 1M3BA 4RTZA 4II1A 2F2WA 2DLPA 2IPOB 3CPWS 3MO8A 1D09B 3EG9B 2JM8A 2LX7A 3P8BB 4E2FB 3CCLA 1BYMA 4XTXA 1JO8A 3M0QA 2MAMA 2D8JA 2DXUA 2E6ZA 4OMLA 4KT0E 1VQ9T 3MEAA 4JLIA 1IHVA 4EMGA 2JTFA 1QCOA 1I0CA 3ZFJA 3CCLQ 4HT9A 2EFIA 5DY9A 3J81E 5HK0A 1G8XA 3P8HA 1VQOA 1TOVA 3WXMB 5FU6B 3CCST 1KG1A 2RQWA 1MUZA 4FCYA 1QVGA 1JEGA 5GMKm 3MPUB 4C8QG 1AD5A 1B7TA 3JCMg 4PJOC 3HRSA 3OS2A 3CCVQ 3CMET 1LPLA 2ENMA 2QA4A 4C92E 3P8DA 4C8QB 1M2OA 1R0CB 2R5AA 2LJ3A 2QYZA 4IURA 1OPKA 2KRNA 2DMOA 1VQ8Q 2RI5A 1OX9A 2MCNA 2CZ0B 1VQ9A 2YRDA 3H6ZA 1SG5A 4FT4A 5GAMe 3DB3A 3ZBDA 4KGZB 5GANf 2EQUA 3M53A 5C6SA 2QEXA 1QMCA 4M7AF 1NEGA 2BIVA 2D8HA 1FXXA 3A8MB 4PJMA 1MV0B 2BUDA 3MEWA 3JCMX 2H8HA 4JZ4A 1WPYA 2MYSA 4HT8A 4C92F 2COZA 5GAOl 1PSFA 1VQPA 1YITT 4FSSA 3G71A 3M59A 2ROTA 2DE0X 4XU1A 1O9SA 4YTLA 4M75G 2RK1A 2V1RA 5I11A 2NYSA 2KR3A 2X4XA 1OOTA 2CZ1B 1R77A 2M0YA 3CC7A 1I07A 2PUOB 1YJ9T 3MP6A 3X24B 2ABLA 3HL8A 1ZSZB 3JCMQ 2P0PA 2DD4A 2LT1A 3GF5A 5DLQE 3OSSC 3A8OB 1WIEA 2L5QA 4RMOA 1S72T 4CRIA 3CXCS 1Z9QA 2PQWA 2KT1A 2MIOA 4FW1A 3A98A 2V8IA 1VQ6Q 3FJPA 2BE9B 3OS0A 3A8GB 3G4ST 1UJ0A 1NYFA 4FM4B 4C0FA 3LX7A 1NZ9A 1XQHA 3HSBA 3CMAQ 3R6OA 3M56A 4IUQA 4WF2A 4TVRA 2FZCB 1QW1A 4RKUE 3X26B 4GLMA 5GAOq 5LJ3e 3M58A 4E7SA 2E70A 3G71Q 4OVAA 3VS0A 1JJ2A 1T3LA 3V7RA 5GMKj 1HXDA 1YCSB 1TUGB 4X34A 1U8RA 2DZCA 3ZEHA 5GAMh 1H641 2X51A 3EG2A 1SSFA 2A36A 1G3TA 3PMTA 4XTYA 3CCUT 4NS5A 3MCAB 3I9QA 4RG8A 2BKDN 4M7AG 4LDXA 1WJQA 3G4SA 1M2VA 3H8ZA 4CC2A 2EQMA 4ZGJB 2XG8D 3META 4N0AA 1VQ9Q 2GFAA 5HKCA 2PU9B 1U5SA 1X75C 1YCYA 4P5NA 4FU6A 2DJQA 5I2MA 1WZOA 2I2LA 1KSWA 1M90R 4M77G 5FU7C 4M77A 2K5IA 1GL5A 2M02A 1VQ7T 3NFCA 4JPBW 1VQ6A 2MWOA 4E7JA 4D6WA 2DL5A 1K9MC 1NLPC 3QYHB 1D1CA 5FRMA 2RHIA 2DL3A 2ATCB 5GAN6 2EVRA 2YRCA 3EGDA 1Y7XA 3JCMW 5GAN3 3NMZC 4HCZA 2HD0A 4PJOD 2GTJA 3H41A 2G3RA 2MMPA 2EQIA 2JZ2A 2RA2A 2LQ8A 2HAXA 5FU7B 2DVJA 4A4KA 1PM3A 1Q81U 4C0GA 3GIBA 2KYBA 3CCMA 3I56Q 1BBZA 3VS6A 4BDYA 1FMKA 2LJ0A 1VQNT 4PJNA 2DKGA 1H8KA 2AZVA 4BE0A 2ROLA 1VQKT 2MWPA 3JCMf 2QQBA 2KQWA 1JQQA 2RI3A 5FRNA 1KD1R 2DA9A 3EG3A 2O31A 3CCEA 1K9AA 3QUIA 2YSQA 1NJIU 4RCBA 2VGNA 1RAGB 4OP0A 3QO3A 2LJ1A 4GY5A 4RTWA 5LL6S 4J6WA 1WHJA 2PUKB 5IT9E 1YNZA 1K73U 2KT8A 4EIKA 3CD6Q 1PD1A 1AWOA 2OTJQ 4PLLA 2GF7A 1UEBA 2YT6A 2EQJA 3OY9A 3JCMh 4AMCA 1U1SA 4RTUA 1QVFS 2NUZA 2XKOC 3OBYA 5GAMd 2DIQA 4LDWA 2QQSA 1YJNT 1OX8A 1KQ1A 4KGXB 3RDVA 4BD3A 4FYXB 4MDWA 1NE8A 4J5YA 2RB6A 2LDMA 4AT1B 1UGPB 3KBGA 3ME9A 1Q82U 2DRMA 2VGMA 2ECZA 2FPFA 4JRPA 1C1AA 1IZ6A 1OZ3A 3OYHA 1XNIA 3BW1A 3VYHB 1YJ9Q 2HL5C 1MMAA 4JRIA 2ZAEA 1HYOA 2XDPA 3BFMA 4OMMA 4E7IA 2LNVA 2OTJT 2HMAA 3EFOB 1M1KC 5GMKi 4XTVA 4FYYB 2ZPGB 2K6DA 1YHQA 2DEQA 2A08A 2YUOA 4J83A 3MJXA 2RHUA 1V29B 3EHRA 1M1GA 2E65A 2RQVA 2CP6A 2OTLT 1YITQ 2YUQA 3SFMA 3RIRA 2K2VA 3LLRA 1I5OB 2DILA 5J3BA 5KE2A 4BE2A 5DLOA 2GBQA 4LXCA 4JRQA 1GBRA 2JTMA 4QT7A 3JV3A 4JS4A 1UECA 2HZYA 3JSCA 3EGUA 3JCMd 5D6XA 3PTAA 1RAHB 1RADB 3PE0A 1KIKA 3I5RA 2X4YA 2KEAA 2OJ2A 4DEXA 2DBKA 1TS9A 3NPFA 4DEYA 4KBMB 3C12A 3CC4T 2JXBA 4EPCA 1ZSZC 1YIJA 1AEYA 4C0ZA 5L23A 1QVGS 4OMNA 3SWNC 4DA4A 1HSQA 4RG2A 4XTWA 1H92A 2D0QB 2L3PA 2RHZA 2BE7D 4M75B 1ZSZA 4M77F 4ZTFA 3J80E 1I8FA 3I35A 1NG2A 2PZ1A 3CMEA 2QA4T 1M1KU 3E19A 2OTLA 3EHQA 5KYNA 3JB9J 3QZ9B 3CMAA 1I1JA 3HRUA 3CCQA 1K73C 4LNPA 2P0QA 1D3BB 4C8QE 4PFPA 4RCCA 2YXYA 1Y96A 2RJFA 3G1JA 3MHXA 2JUFA 2KDSA 2DERA 1JB0E 2K2MA 5I21A 4M78C 3CCQQ 1WXTA 4F7UA 1PHTA 1BK2A 1LVKA 1MMNA 3CXCA 3THKA 3FLGA 1X6GA 2YUNA 1YJWT 1JBMA 1HD3A 5IAYA 1OPLA 3OYIA 1UG1A 1VQ4A 4AG2C 1G83A 4C5HA 1IHWA 2GQIA 3L2UA 1UDLA 1YJNA 5LJ5f 5LJ5h 4EMKA 3O8VA 4N4GA 4A53A 4PJOF 3OYNA 3OYDA 1MMGA 1X69A 3VYGA 2JS2A 1QKXA 2COYA 3WVDB 1ZX6A 3HTRA 2VASA 4M78B 3EGXB 1AZEA 4HA8A 2JOYA 4IUTA 1ZBJA 4J6XA 4DQ2A 1H3ZA 5M9OA 2ESWA 2DYBA 3CEYA 2RK2A 1SRLA 2RHXA 1YI2Q 2KK4A 2LQKA 2JT4A 3T9NA 4M77D 2O4XA 4JJCA 2WACA 2WSCE 1E7OA 4J9FA 5KYXA 1SPKA 1X6BA 4Z02A 3CCRA 3CCJT 4BY6B 4ZGDB 4X1VA 3VV0A 1NEBA 4K11A 1KHCA 1BIBA 3CCJA 2AK5A 1WA7A 3VS2A 2K7AA 2PVGB 3MKDA 5GANj 2EKOA 4HCBA 2NWMA 3OS5A 2EW3A 4AFUC 3GNGA 2FPEA 3HHTB 1PRMC 1UGSB 1XOVA 1K0XA 4XU3A 1T0HA 2KSSA 4MZMA 4V2SA 1VQOQ 3OMCA 2DIGA 2C0OA 4PJOG 1VQ5A 3C0CA 4RTVA 1N8RU 5EC7A 1W6XA 3CMAT 1V1CA 4RTTA 5FU6C 3NTHA 5LJ3h 1FX7A 1G3WA 5LJ3f 5CQXA 4OF1A 3J7AF 4PNOA 1H3HA 1OU8A 3GBQA 4IKFA 2HCKA 3GP8A 1OU9A 5FROA 2F1LA 3GLXA 4M75D 4DBQA 4O6JA 3SHWA 5HCKA 1GXIE 3DB4A 5KH6A 1VQ7Q 2C0IA 3M0PA 2P0KA 2LCCA 4XQ3A 2DXBA 3CCJQ 2QEXT 4MMLA 1IGQA 1UGRB 1WLPB 1B34B 4OB1B 2K5FA 2MI6A 2IG0A 2QQ9A 4AG1C 2K3YA 5GAN2 2FG0A 2OX7A 2VKNA 4ME7A 2L0AA 1VQ8T 5HK3A 3QJYA 4E7KA 1NM7A 4PJOE 1KQSS 2DX1A 1E6HA 3M5AA 4ELZC 4MZPA 1WHLA 2DTOA 1GRIA 4AFZC 5CIUA 3JCMP 4M78G 3M0UA 3HRTA 4X9DA 3TU4K 3CXCP 2SRCA 1VQPT 1SRMA 1PSEA 3TSZA 2P4TA 4B9XA 4F7UF 1YJWA 3I55Q 1K4US 2LQNA 3DKMA 5KYWA 2NUPB 1Q81R 4JDSA 3E2UA 4LDUA 1S1NA 4BACA 3GNFB 2H3EB 1YJ9A 3RMSA 2FVUA 1WJRA 4OB0B 1WI7A 2EYYA 2FRWA 1M8VA 2R58A 1FMVA 4OMPA 4FT2A 1K8AC 4QQGA 1M4ZA 1YI2T 1WJSA 2CZ6B 1BCOA 2DD5A 2CT4A 3PVLA 1OYXA 2NUTA 4BI8B 4C8QD 4BDZA 3L1AA 1R8OB 2LT4A 1WXBA 2VYTA 1E6GA 1GBQA 3QWYA 5IXBA 2WSEE 4C92B 4LE9A 3OW2A 1ABOA 2RF0A 2LX9A 1N27A 1M9SA 4X9CA 2OAUA 1VQ5Q 1W2BA 4PKCC 3CC4A 2CUDA 2JMCA 2C0TA 4IUUA 2H3JA 4CI0C 2EIFA 1QQJA 5AYFA 1FYNA 5LJ5d 1BU1A 2KROA 2BZYA 3CC2Q 5CK9A 3QWXX 3OW2P 1NLOC 3SDZA 1N5ZA 3BE3A 2CYZB 3H0FA 1QP2A 3UATA 3VS4A 3JB9D 3Q1JA 4EMKC 3CC2T 2A28A 1VQNA 2DAQA 4A54A 4DBRA 1J3TA 4KUDK 3HFNA 3EFOA 3CCMT 3QYGB 2WSFE 1M5Q1 2DXTA 1BI2A 2EYWA 2DO3A 5GAOn 1QCNA 4HCCA 4PK4A 2OTLQ 1D0XA 1AWWA 4Y28E 2RHYA 5LJ3d 4MDXA 3CCUQ 2ZCFB 2KNBB 2JMAA 2L8DA 5GAOm 1CKBA 4FSXA 2L89A 3REBB 2JNGA 1VOMA 1M8MA 1RABB 2K3XA 4M77E 2RMOA 4EDUA 1WDXA 2CKKA 8ATCB 4DBHA 4F7UB 3JCMc 2OI3A 2QEXQ 3RERA 4Z8AA 4Q5WA 5GANg 1VQ4Q 2E3IA 3CC2A 5CCAA 4M7DE 3CCMQ 4JJNK 3OYMA 2E64A 3VRZA 1Q82C 1Q86R 1ACMB 2B8AA 3I5SA 1AZGB 2IIMA 2EGCA 1I4K1 1IGUA 2Z0WA 5CKDA 1K9MR 5GAMg 3ZL7C 1P92A 3TVTA 2DF6A 3QJ6A 3OYKA 3UT1A 3NTIA 2EQKA 4R55A 1RI9A 1LNXA 5KYUA 4XU2A 2JW4A 2K9GA 1D0YA 1AT1B 4J9GA 2AKLA 4M7DF 2J6KA 2K5LA 1X27A 4IUVA 1NJIR 1UJYA 2MOXA 2XICA 3E9FA 1K8AR 2RQUA 3EG1A 4OGCA 2D1XA 2Y90A 2QQAA 2QASA 1YI2A 3PMIA 3AT1B 1I5LA 2FRYA 3JB9F 2QA4Q 4QQ6A 2XMFA 2GTOA 2P84A 2O2OA 1PRLC 1ARKA 2DZ9A 4M4ZA 1XJWB 1WGSA 1JRIA 1PD0A 2E5KA 4KH1B 1QCFA 4BB7A 1D1AA 5AT1B 2EAYA 1RAIB 2AIRB 2M16A 4JS5A 1GFCA 4M77C 4OB3B 1EIFA 3H9NA 4M75E 2QQRA 1RI0A 3L2WA 1Y57A 1M2VB 1ZLMA 2DYIA 4AFQC 4M78A 3QZ5B 2COWA 1QWEA 1YJNQ 1Y71A 2LTOA 1KC8R 2F5KA 1HJDA 1BB9A 1LJOA 2YUPA 3PNWC 2G6FX 1RUWA 5J39A 1U06A 4DOWA 4A4EA 2HQXA 1ZUUA 4MMKA 3CC7Q 3EG9A 3OA6A 2J6FA 1M1FA 3UA7A 1YITA 5GJVB 1PKTA 3OMGA 3OYYA 1Q7YU 4N4IA 2RJEA 4Z89A 2RM4A 4QQDA 2DJZA 3OYBA 1BI3A 4L6V5 4E7LA 4LUDA 2B86A 3G6EA 1UB4A 3PIPA 2HEQA 3NTKA 3VJPA 5GAMj 1TXQA 2VUBA 2RJDA 2KXCA 1KFZA 1WHHA 4HVUA 3CPFA 2VV5A 3E9GA 2F5TX 4DBFA 1JJ2P 5CAIA 3X20B 3BDLA 3X28B 4M7AC 2O4XB 1YIJQ 4JZ3A 4NOYA 3LWHA 1W2BS 1BI0A 1WHMA 4KRTA 1MMDA 1QVPA 3TREA 2D0NA 3KUFA 2ZGWA 1VIEA 5CKBA 1F1BB 1TSFA 2RD1A 3CPWA 3OYFA 4C0DC 2EJGA 1NBEB 1IXDA 1TWBA 4M7DB 5FWBA 2F2VA 2CZ7B 3OS1A 1RLQC 5J26A 2PVOB 1G2BA 4WCIA 1AWXA 4LDVA 1VQOT 1GCQC 3CCSQ 4M7AE 3M57A 1KQSA 3NHNA 2X4JA 3A8LB 2HKQB 3CPWP 1KD1C 4OMFB 1MGQA 2R5MA 2NUPA 1AHJB 3E1SA 3JB9H 6AT1B 4M78F 2XIDA 4CC4B 5KCOA 4QKUA 2HL3A 1XTDA 5A0DA 1UGVA 4GBQA 1Q86U 3INZA 4J6YA 1VQMQ 1ZSGA 2M1HA 4Z88A 1VYUA 2M0OA 3RR6A 4BI4A 2KMTA 1WHKA 2JJ9A 2EYZA 1T3SA 1RAAB 2C06A 3VS7A 2YLCA 4EMKB 2RO0A 3SB2A 4M75F 1K9MU 1MV3A 2CS7A 1YHQQ 3CCQT 2V8JA 4FYWB 5A2QE 2AT1B 1N6AA 4J9CA 5GMKe 1C6VX 1PKSA 5GAOp 5KYYB 4PLIA 3EGXA 2SEMA 2L3RA 3GOXA 2AZSA 2QG9B 3U23A 3TCJA 4PL6A 2FYKA 4C8QA 1YHQT 2EWNA 2F69A 3V8LA 1KK7A 2JM9A 5KYWB 1W1FA 3RNJA 4BI3A 1M1KR 2D9TA 4F7UG 4M7DD 3SWNB 2FHDA 1QVGP 3M0TA 1OQKA 1VQNQ 2KRMA 5CKEA 5D6WA 5GAN5 3LH0A 1Q82R 1Q86C 5GAMf 2DVEA 4BY6C 2HSPA 1AVZC 2BZ8A 4ELYC 2KBTA 3OQ5A 1UHFA 1MNDA 2Y4XA 3OYLA 4JRKA 4M7DG 2VC8A 1UFFA 3RKYA 2ED0A 4ZN3A 2KAFA 4J8OA 2EGAA 5L8RE 1OZ2A 1UE9A 3LWIA 1OI1A 2DEUA 2HKNA 4OMQA 1B3QA 5CKHA 5A0LA 1N9RA 3CCRQ 2RNAA 2JVVA 5CO7A 3G4SQ 1I81A 4OGEA 5DM7R 2L3SA 2AKKA 3VS5A 3CCLT 4KULA 1WQ7A 3CC4Q 2HBPA 3JCMb 1KD1U 2IVWA 1NYGA 3EAEA 2EGEA 2EYXA 3C95A 3RKXA 3LW5E 5CKFA 2LC4A 1QKWA 2LP5A 2O88A 1W4SA 3G6ET 5CR2A 3HKSA 3ER0A 3V8JA 1W70A 3I55T 4HKEA 2DRKA 2X3WD 4J9EA 1TTHB 1ABQA 1G3YA 2A3LA 3QDFA 2XDDA 2X9HA 5LJ5e 2DK3A 2M9UA 9ATCB 3EFSA 1PWTA 1AWJA 1VYTA 4C92A 3QPHA 1VQ8A 4HVVA 2AHJB 1FWZA 3VKIA 1KC8C 1X2KA 3X25B 2VXEA 1M30A 2KRSA 1JU5C 2GFUA 2OAWA 1G5VA 2CGHA 3RMQA 1QLYA 1SHFA 2LCSA 2MPXC 2CH4W 1RLPC 4LDYA 4C5IA 1KQ2A 1IRXA 4F04B 3LYIA 5GMKh 4RUGA 2XDBA 1PC0A 3A5ZB 3QDRB 2XHCA 2E5QA 1K76A 1D3BA 2RQRA 2K79A 1T0JA 5EG2A 1PCXA 1UTIA 1SF9A 2PVDB 1WQWA 4IIMA 4ATOA 4BE1A 1PNJA 2QDYB 2GNCA 2ZPHB 2KY9A 2LVMA 4QVZA 2CREA 4N4HA 1IO6A 4PJOB 4F16A 2GGRA 4PFZA 1RAFB 1YWOA 2LCLA 3M4YA 1MNEA 3KFVA 1PG5B 3M54A 1VQ5T 4LN2A 4C8QC 3PVQA 4OB2B 2VVKA 3SWNA 2DL4A 2EBPA 4RTXA 3VS3A 2RI2A 2VB6A 1WNLA 1ZUYA 2PNIA 5KE3A 5IHNA 4M7AD 3GPLA 2J06A 2O01E 1BCMA 1EFNA 2RN8A 2O9VA 2ZZDA 3MP8A 3VUZA 1VQ6T 3G6EQ 3DLLA 5GANh 2VWFA 3G7ZA 4C8QF 1VQMA 1SKUB 2DPPB 1OEBA 3I56T 1ZQ1A 4GLKA 3SD4A 3OYEA 3QHSA 2KGTA 2MF2A 1HK9A 5GANe 1A0NB 1VQ4T 1X6OA 3N5BB 1X43A 4L5GA 2FB7A 1QP3A 1OULA 3TSWA 1TUCA 1K8AU 4QVCA 4Y91A 2X3XD 3VU3C 1ZBXA 1N9SA 2YRVA 1C0MA 4A4FA 2F2XA 2DNUA 3QKJA 1Z9ZA 3QG1A 3CCEQ 4IIOA 2CP0A 3JCMV 2DL7A 1ZHIA 4M78D 4HXJA 4AFSC 2PTKA 3M9QA 1R0BG 1TUDA 2FEIA 2BZXA 2RJCA 5IH2A 3FEOA 1VQ7A 1UUEA 4C92G 3O5ZA 5GAN4 2W10A 3G71T 2YHTA 3S3NA 1IB8A 2E3HA 4XAXB 2CSQA 3UWNA 5IXFA 4IUPA 4ESRA 3OSVA 2DETA 1JXMA 2DTIA 2E6NA 1BKBA 5I2SA 1VQLQ 4DOVA 4ZNXA 2E4HA 1YIJT 3PFSA 1CKAA 5FWCA 5C0MA 3TQ7P 5IHIA 3UF4A 1GFDA 4J9DA 2GQVA
chains in the Genus database with same CATH topology
3WVDB 1U1TA 2XI9A 4M78B 3G6EA 1M90C 1UB4A 4FT4A 3PIPA 3NTKA 4HA8A 2JOYA 3VJPA 4IUTA 5GAMe 2RH2A 3DB3A 3BY7A 3S6WA 3V7CA 1QVGS 5GAMj 2VUBA 3ZBDA 2V8KA 5GANf 2RJDA 4J6XA 4DQ2A 2FL7A 1H3ZA 2EQUA 4F7UE 3CPFA 3M53A 5C6SA 2QEXA 5M9OA 2VV5A 4M7AF 3E9GA 2F5TX 2BIVA 4KUIA 5CAIA 3X20B 1FXXA 3A8MB 3CEYA 2RK2A 3BDLA 4J7IA 3X28B 2RHXA 3L2VA 3UPUA 4M7AC 2O4XB 2KK4A 2LQKA 4NOYA 3V7SA 3VUBA 3LWHA 1W2BS 3OW2S 1Q81C 1BI0A 3WVEB 1QVPA 5GAN8 3T9NA 2BUDA 3MEWA 3TREA 3JCMX 4M77D 2HQEA 3OYCA 1WPYA 2O4XA 3KUFA 4HT8A 2ZGWA 3JAME 3PT9A 4C92F 5GAOl 1VIEA 1PSFA 2WACA 1VQPA 1YITT 2WSCE 5CKBA 3G71A 2RD1A 3CPWA 3OYFA 3M59A 4Z02A 3CCRA 3CCJT 4BY6B 1VUBA 2ZPBB 4XU1A 1O9SA 4YTLA 4M75G 2RK1A 4ZGDB 4C0DC 2EJGA 3VV0A 4M7DB 1KHCA 1BIBA 3CCJA 3V8KA 4O5VA 2X4XA 2CZ1B 2CZ7B 2PVGB 4FIBA 3OS1A 2EKOA 5J26A 2PVOB 3CC7A 5GANj 4HCBA 3OS5A 4ZTJA 4LDVA 2NLUA 4R56A 1VQOT 2PUOB 1YJ9T 3GNGA 3MP6A 3X24B 1NJIC 3HHTB 5FLXE 3HL8A 2GCXA 4M7AE 3M57A 2HNIA 4M77B 3JCMQ 1KQSA 1UGSB 2X4JA 3A8LB 1XOVA 2P0PA 2DD4A 2LT1A 4XU3A 1NPRA 4C92C 3GF5A 5DLQE 3JRZA 4M75C 3JCMJ 1KD1C 2KSSA 4MZMA 3C4SA 4OMFB 1MGQA 2R5MA 2QI2A 3OMCA 4VUBA 4V2SA 2DIGA 3OSSC 1AHJB 3A8OB 3E1SA 3JB9H 2L5QA 4PJOG 1VQ5A 4RMOA 2X35A 1S72T 4M78F 4CRIA 1N8RU 3CXCS 2XIDA 2PQWA 2EJFA 5KCOA 3CCSA 3CMAT 1XTDA 5A0DA 2V8IA 3BDUA 3FJPA 3M4GA 5FU6C 1Q86U 4XU0A 3NTHA 3OS0A 3A8GB 3L2ZA 1FX7A 1G3WA 5LJ3f 3INZA 4J6YA 5LJ3h 4FM4B 3G4ST 4C0FA 3LX7A 1NZ9A 2M1HA 1XQHA 3HPWA 5CQXA 4OF1A 3J7AF 2M0OA 3HSBA 2QTXA 3R6OA 4PNOA 3M56A 4BI4A 4IKFA 3C94A 2KMTA 4IUQA 4WF2A 4TVRA 2D6FA 2C06A 3GP8A 2YLCA 4EMKB 1QW1A 2RO0A 3SB2A 5FROA 4M75F 4RKUE 1BIAA 3X26B 1K9MU 2CS7A 3GLXA 4M75D 5GAOq 5LJ3e 3M58A 4O6JA 2EYQA 2E70A 3CCQT 2V8JA 4OVAA 3OBWA 1JJ2A 5A2QE 1GXIE 3DB4A 3V7RA 5GMKj 5KH6A 1HXDA 4LD6A 1N6AA 2P0KA 5GMKe 3MEVA 3TEEA 1VQKA 4NL2A 2LCCA 4X34A 4XQ3A 5GAOp 5CVIA 2DZCA 3ZEHA 2DXBA 5GAMh 1U8RA 4C5EA 4PLIA 4A4GA 2QEXT 3GOXA 2L3RA 4MMLA 1UGRB 3RESA 1LOJA 1H641 1B34B 1SSFA 4OB1B 3MEUA 2K5FA 1G3TA 2MI6A 3PMTA 2IG0A 4XTYA 3CCUT 2R57A 2XU8A 2ZPFB 4BUGA 4NS5A 5GMKl 3MCAB 3TCJA 4ZGEB 2QQ9A 2K3YA 4RG8A 4PL6A 2BKDN 2FYKA 5GAOr 4LDXA 4M7AG 1WJQA 1Y07A 3QBYA 5GAN2 3G4SA 2E12A 4C8QA 2EWNA 2F69A 2DXCA 3CBOA 3H8ZA 4ME7A 3V8LA 4E7HA 1YHQT 1M90U 1G3SA 2EQMA 5LJ5j 4M7DA 4ZGJB 1DJ7B 1VQ8T 2XG8D 5HK3A 3META 4N0AA 3QJYA 4E7KA 3RUXA 3JCMe 2GFAA 5HKCA 2PU9B 1X75C 4PJOE 1RL2A 4BI3A 1KQSS 1YCYA 3UDCA 4P5NA 2D9TA 3M5AA 4FU6A 4ELZC 4F7UG 3SWNB 4M7DD 2FHDA 5I2MA 2OTJA 1BI1A 4MZPA 2I2LA 5LJ3g 2DTOA 4EMHA 3LGFA 5CIUA 4M77G 5FU7C 1KHIA 5CKEA 3JCMP 4M78G 5D6WA 4M77A 2K5IA 3EFRA 5GAN5 1VQ7T 3NFCA 1VQ6A 3LH0A 1Q7YC 2MWOA 1Q86C 3HRTA 4L59A 1YBYA 4E7JA 4X9DA 2DVEA 4BY6C 4D6WA 5GAMf 3TU4K 1VQPT 3DLMA 5KCHA 4ELYC 3URGA 1PSEA 3OQ5A 4LD9K 1IREB 2Y4XA 1Y96B 4C92D 1K9MC 2P4TA 3OYLA 4B9XA 4F7UF 3LGLA 3QYHB 4JRKA 1YJWA 5FRMA 4M7DG 2RHIA 2VC8A 5A0GA 3RKYA 5GAN6 4XTUA 4ZN3A 1Y7XA 3DKMA 2KAFA 4J8OA 4JDSA 4LDUA 4QVDA 3JCMW 3CCRT 4BACA 3QXEB 5GAN3 4HCZA 2HD0A 3GNFB 5L8RE 3CBMA 1OZ2A 1YJ9A 4PJOD 3RMSA 2FVUA 2G3RA 2MMPA 3LWIA 1OI1A 1WJRA 2JZ2A 4N0AC 4OB0B 2RA2A 2LQ8A 2HAXA 5FU7B 1M8VA 3L2RA 2A7YA 2R58A 4A4KA 4PJOA 3CCVT 5A0LA 5CKHA 1Q81U 1N9RA 4C0GA 3GIBA 4FT2A 1K8AC 4QQGA 1M4ZA 2JVVA 4J7FA 5CO7A 1YI2T 1I81A 3CCMA 4OGEA 5DM7R 1WJSA 3CCUA 2CZ6B 5LJ3j 2DD5A 3CCLT 4BDYA 4KULA 1WQ7A 3F70A 1OYXA 2HBPA 1VQNT 4BI8B 4JLGA 4C8QD 3JCMb 3L1AA 5IN1A 3L42A 4BDZA 1KD1U 2DKGA 1R8OB 2IVWA 2LT4A 3EAEA 4BE0A 2LRQA 3C95A 2VYTA 3RKXA 4E47A 3LW5E 5CKFA 1VQKT 2MWPA 3HFOA 2LC4A 2DTHA 2WSEE 4C92B 2YLBA 3OW2A 2ZPEB 2QQBA 3JCMf 3CCET 2KQWA 2RI3A 3FRNA 3S3OA 5FRNA 3CD6T 3CBPA 1W4SA 2LX9A 1N27A 3G6ET 1QVFA 1M9SA 4X9CA 5CR2A 1JJ2S 2XD0A 2OAUA 3HKSA 3ER0A 4M78E 4PKCC 3V8JA 1W2BA 3CCEA 3CC4A 3I55T 3JB9G 4HKEA 3QUIA 4IUUA 2E1HA 2H3JA 4CI0C 1G3YA 3I56A 2A3LA 1NJIU 2EIFA 4RCBA 2VGNA 2XDDA 5AYFA 5LJ5d 2QXFA 5LJ5e 4OP0A 2DK3A 3I55A 3QO3A 4C5GA 4GY5A 2M9UA 5HY6A 1VQMT 5LL6S 5CK9A 3EFSA 4J6WA 4C92A 4NL3A 2E41A 3QPHA 3FDRA 1VQ8A 2PUKB 5IT9E 2AHJB 3SDZA 3KXTA 1K73U 1FWZA 3VKIA 1KC8C 4M7AA 2CYZB 3PGGA 3X25B 1QP2A 2VXEA 3JB9D 3Q1JA 4EMKC 3CC2T 2ZPIB 1S72A 1VQLT 2GFUA 4PLLA 2GF7A 1G5VA 2CGHA 1MHNA 1UEBA 3RMQA 3HP9A 1VQNA 2DAQA 4A54A 2EQJA 3OY9A 3JCMh 4KUDK 1U1SA 3HFNA 2KVQG 4LDYA 4C5IA 3CCMT 1QVFS 2XKOC 2XK0A 3OBYA 2WSFE 3QYGB 1M5Q1 2DXTA 1BI2A 2K4YA 1KQ2A 2DO3A 5GAMd 5GAOn 4HCCA 3LYIA 5GMKh 2DIQA 2XDBA 3A5ZB 4LDWA 4QW2A 2QQSA 4Y28E 3QDRB 3JB9I 1B34A 2XHCA 1YJNT 3CD6A 2E5QA 2RHYA 5LJ3d 1D3BA 4MDXA 1KQ1A 1KC8U 4BD3A 4MDWA 2ZCFB 1NE8A 5EG2A 2RB6A 2LDMA 4J5YA 1UGPB 2L8DA 3KBGA 5GAOm 1O75A 2PVDB 3AHUA 1WQWA 3ME9A 4FSXA 2L89A 4ATOA 1Q82U 2VGMA 4BE1A 2JNGA 1X01A 4JRPA 2JN0A 1IZ6A 1OZ3A 3OYHA 1XNIA 2K3XA 3BW1A 4M77E 3RKWA 3VYHB 2QDYB 1VIFA 2ZPHB 4JRIA 4XK8E 2KY9A 4EDUA 2LVMA 3OB9A 2CKKA 2X4WA 2XDPA 4JUVA 4F7UB 3BFMA 4QVZA 3JCMc 2LNVA 4E7IA 2OTJT 4N4HA 3RERA 1M1KC 4PJOB 4XTZA 3S3MA 5GMKi 5GAN7 4Q5WA 5GANg 2LCLA 4XTVA 2ZPGB 3M4YA 4FL6A 4MZTA 5D6YA 3OYJA 1VQLA 3CC2A 3M54A 2DEQA 2VXFA 1YHQA 4J83A 1VQ5T 4C8QC 3ASKA 2RHUA 4OB2B 3A8HB 5CCAA 1V29B 4JJNK 4M7DE 3OYMA 3SWNA 2E10A 2E64A 3OYAA 1M1GA 2E65A 1Q82C 2OTLT 4M7AB 2RI2A 2B8AA 5GANd 4UC4A 3SFMA 1WNLA 3RIRA 2K2VA 3LLRA 1I4K1 5CKDA 5J3BA 3FC3A 5GAMg 5KE3A 3FB9A 5KE2A 4M7AD 1P92A 3GPLA 2O01E 4BE2A 5DLOA 4JRQA 3CC7T 4A4HA 2EJ9A 2JTMA 2ZZDA 3MP8A 3QJ6A 3VUZA 3OYKA 4JS4A 1VQ6T 3JSCA 1UGQB 2K57A 3NTIA 3UT1A 2EQKA 4R55A 1LNXA 1NPPA 1TH7A 4M75A 5GANh 3DLLA 4XU2A 3JCMd 5D6XA 3PTAA 3L2QA 3G7ZA 4C8QF 1VQMA 3M55A 4M7DF 2X4YA 2DPPB 2K5LA 3QIIA 1I5LA 4IUVA 3I56T 3FIFA 1ZQ1A 2XICA 3E9FA 1N8RC 3PIOA 4GLKA 4KBMB 3SD4A 3C12A 4OGCA 4EPCA 3CC4T 2Y90A 4B9WA 3MP1A 3OYEA 3QHSA 5GANe 2MF2A 1HK9A 4ZN1A 2QQAA 4C0ZA 5LJ5g 3OYGA 1YI2A 3PMIA 1VQ4T 3SWNC 1X6OA 3N5BB 4L5GA 4DA4A 4RG2A 5CQYA 3JB9F 2FB7A 4XTWA 1QP3A 2D0QB 2RHZA 4M75B 2Y4YA 4QQ6A 3CCVA 4M77F 4C0DB 4ZTFA 3J80E 1I8FA 1K8AU 4QVCA 3QSUA 4Y91A 4M7DC 3VU3C 1ZBXA 4II1A 2DZ9A 1N9SA 2YRVA 3CMEA 1WGSA 1JRIA 3MO8A 3CPWS 2QA4T 1M1KU 3E19A 2OTLA 4BB7A 3P8BB 4A4FA 3CCLA 3JB9J 1BYMA 3QZ9B 3QKJA 2EAYA 3CMAA 3HRUA 3QG1A 4XTXA 2MAMA 3CCQA 2M16A 4JS5A 4M77C 4OB3B 1K73C 1EIFA 3JCMV 1ZHIA 2DXUA 4M78D 2E6ZA 2P0QA 4M75E 2QQRA 1RI0A 1D3BB 3M9QA 4KT0E 4C8QE 3L2WA 1VQ9T 3MEAA 4RCCA 1Y96A 2RJFA 4JLIA 2RJCA 4EMGA 4M78A 3MHXA 3QZ5B 2JTFA 3ZFJA 2JUFA 2KDSA 3FEOA 4HT9A 1JB0E 2EFIA 5DY9A 4C92G 1VQ7A 5I21A 1Y71A 2LTOA 5GAN4 2F5KA 3J81E 5HK0A 4M78C 3G71T 2YHTA 1LJOA 4F7UA 3PNWC 3P8HA 3S3NA 1VQOA 3WXMB 5FU6B 3CXCA 4XAXB 5J39A 3UWNA 3CCST 3FLGA 1KG1A 4IUPA 3OSVA 1QVGA 1YJWT 1JBMA 2DTIA 2E6NA 5IAYA 5GMKm 3OYIA 1BKBA 4DOWA 4A4EA 5I2SA 1VQ4A 4C8QG 4DOVA 2HQXA 4C5HA 1YIJT 3L2UA 3PFSA 4MMKA 3JCMg 1YJNA 4PJOC 3HRSA 5LJ5f 5LJ5h 4EMKA 3OS2A 5C0MA 3CMET 2QA4A 3OA6A 1M1FA 3O8VA 4C92E 3P8DA 4N4GA 4A53A 4PJOF 4C8QB 3OYNA 1YITA 2R5AA 3OMGA 3OYYA 4IURA 3OYDA 2RJEA 4N4IA 1Q7YU 2RI5A 2RM4A 4QQDA 2CZ0B 3VYGA 2DJZA 1VQ9A 3H6ZA 3OYBA 1BI3A 2GQVA 1YIJA 4L6V5 4E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ7 B;  2PVG B;  2AHJ B;  4OB3 B;  2ZPE B;  3WVD B;  2PVO B;  1PSE A;  2ZPG B;  2DXC A;  2ZZD A;  1IRE B;  3WVE B;  2ZCF B;  4ZGJ B;  1DJ7 B;  2CYZ B;  3X25 B;  1QP2 A;  1GXI E;  1QP3 A;  4KT0 E;  2D0Q B;  1UGP B;  3QYH B;  1UGQ B;  2PUO B;  2ZPI B;  3A8H B;  4OB2 B;  1V29 B;  2PVD B;  3X24 B;  3HHT B;  3A8G B;  2PU9 B;  1PSF A;  4FM4 B;  2DXB A;  4L6V 5;  2WSC E;  2CZ6 B;  1UGS B;  3A8L B;  3QZ5 B;  2DD5 A;  1UGR B;  2DD4 A;  2ZPB B;  1JB0 E;  4OB1 B;  3VYH B;  3QYG B;  2DPP B;  4ZGD B;  2QDY B;  2WSF E;  2ZPF B;  2ZPH B;  4XK8 E;  3X20 B;  4ZGE B;  3A8M B;  3QXE B;  1AHJ B;  3A8O B;  5L8R E;  2CZ0 B;  3VYG A;  3X28 B;  2O01 E;  4Y28 E;  3LW5 E;  3QZ9 B;  4RKU E;  3X26 B;  2PUK B;  4OB0 B;  2WSE E;  2CZ1 B; 
#chains in the Genus database with same CATH topology
 1U1T A;  2XI9 A;  1M90 C;  2QK0 A;  1TG0 A;  2RH2 A;  3BY7 A;  3S6W A;  3V7C A;  2V8K A;  1Q7Y R;  1WXU A;  2FL7 A;  4A63 B;  2I0N A;  4F7U E;  1GCQ A;  3NGP A;  2L3Q A;  4D8D A;  4KUI A;  1ZUK A;  4J7I A;  3L2V A;  3UPU A;  3V7S A;  3VUB A;  3OW2 S;  1Q81 C;  3EH1 A;  3WVE B;  5GAN 8;  2A0F B;  3REA B;  2HQE A;  3OYC A;  2DFU A;  3JAM E;  3PT9 A;  3IQL A;  1VUB A;  2ZPB B;  2KI7 A;  1FMW A;  1V76 A;  4LUE A;  3V8K A;  4O5V A;  2LNH B;  3EH2 A;  4FIB A;  4JJB A;  4ANJ A;  1D1B A;  4ZTJ A;  8AT1 B;  2NLU A;  4ORZ A;  4R56 A;  2EPD A;  1NJI C;  1WYX A;  5FLX E;  2GCX A;  2HNI A;  1N8R R;  4M77 B;  4F14 A;  1VQP Q;  5ECA A;  1NPR A;  4C92 C;  3JRZ A;  4M75 C;  3JCM J;  3C4S A;  4VUB A;  4KGV B;  1U3O A;  2QI2 A;  1LCK A;  2CDT A;  2X35 A;  4FW2 A;  1KJW A;  2EJF A;  3CCS A;  3M4G A;  3BDU A;  4XU0 A;  2CP7 A;  2FO0 A;  3L2Z A;  1CSK A;  2YDL A;  1M3C A;  1X2Q A;  2JTE A;  3HPW A;  2QTX A;  1YJW Q;  3C94 A;  2CT3 A;  2D6F A;  2FZK B;  2HQH A;  1BIA A;  4RTY A;  4E6R A;  2CH4 A;  2EYQ A;  1TU0 B;  3OBW A;  2QGF B;  1W2B P;  2J05 A;  4LD6 A;  1VQK A;  3MEV A;  3TEE A;  5KYX B;  2HDA A;  4NL2 A;  2QTV A;  4CC3 A;  4HCK A;  3LH5 A;  5CVI A;  4C5E A;  4A4G A;  5KYU B;  1EX4 A;  2O9S A;  3RES A;  1LOJ A;  3MEU A;  3A1P A;  2R57 A;  2XU8 A;  2ZPF B;  4J9H A;  4BUG A;  5GMK l;  4WTO B;  1WHG A;  4ZGE B;  3CQT A;  1RAC B;  2CP5 A;  2FPD A;  5GAO r;  3QBY A;  1Y07 A;  2QDL A;  2E12 A;  2DXC A;  3CBO A;  5D7U A;  4E7H A;  1M90 U;  1G3S A;  2A37 A;  4R0K A;  5LJ5 j;  4M7D A;  1DJ7 B;  3M0R A;  1QWF A;  3RUX A;  3JCM e;  2JS0 A;  1RL2 A;  3UDC A;  1OV3 A;  2OTJ A;  1BI1 A;  5LJ3 g;  1SSH A;  4EMH A;  3LGF A;  2KYM A;  1GCP A;  3H0H A;  1KHI A;  2CUB A;  2V1Q A;  4D8K A;  3EFR A;  1Q7Y C;  4L59 A;  1YBY A;  3DLM A;  5KCH A;  1KQS P;  3URG A;  4LD9 K;  1IRE B;  1YN8 A;  1Y96 B;  4C92 D;  2LMJ A;  4PFO A;  3LGL A;  3H0I A;  5A0G A;  3VRY A;  2DM1 A;  4XTU A;  4PJL A;  1WX6 A;  1VYV A;  2J6O A;  2QAZ A;  4QVD A;  3CCR T;  3QXE B;  3CBM A;  5I22 A;  4E7Z A;  1SEM A;  1VQK Q;  2P4R A;  2W0Z A;  4N0A C;  3L2R A;  2A7Y A;  4PJO A;  3CCV T;  3R6N A;  4J7F A;  1WFW A;  1SHG A;  3UA6 A;  3CCU A;  1ZA1 B;  5LJ3 j;  3F70 A;  4JLG A;  1ZA2 B;  5IN1 A;  3L42 A;  1VA7 A;  2LRQ A;  4E47 A;  3D7S B;  4J9B A;  3CME Q;  3HFO A;  2L2P A;  1RAE B;  1JXO A;  2DTH A;  2YLB A;  2ZPE B;  2V26 A;  3CCE T;  3FRN A;  3S3O A;  3CD6 T;  2RPN A;  3CBP A;  1QVF A;  1JJ2 S;  5IHK A;  2XD0 A;  4M78 E;  1M27 C;  3JB9 G;  2DL8 A;  2E1H A;  1K73 R;  3I56 A;  4B6M A;  3SEM A;  2QXF A;  1YWP A;  1Q95 G;  3I55 A;  4C5G A;  5HY6 A;  1VQM T;  1YFN A;  5KYY A;  3ULR B;  4JJD A;  4NL3 A;  2E41 A;  3FDR A;  3KXT A;  2MK5 A;  4M7A A;  1QVF P;  3PGG A;  3EGD B;  4PJJ A;  2ZPI B;  1S72 A;  1VQL T;  1B07 A;  4KH0 B;  1MHN A;  3HP9 A;  2DBM A;  4CC7 A;  2KVQ G;  3VS1 A;  2XK0 A;  2CP3 A;  2K4Y A;  2LQW A;  1EZZ B;  4QW2 A;  3JB9 I;  2RQT A;  4OMO A;  1B34 A;  3CD6 A;  2LZ6 B;  2ED1 A;  1Y0M A;  3M0S A;  1KC8 U;  2YWW A;  2K3B A;  1O75 A;  2EKH A;  3AHU A;  4J9I A;  1X01 A;  2JN0 A;  3RKW A;  1VIF A;  2KXD A;  4XK8 E;  2KE9 A;  3OB9 A;  1M3A A;  2X4W A;  3FJ5 A;  3EG0 A;  4JUV A;  4XTZ A;  4F17 A;  3S3M A;  5GAN 7;  4FYV B;  4FL6 A;  4MZT A;  5D6Y A;  3OYJ A;  1VQL A;  2VXF A;  1K1Z A;  2QGG A;  2HSE B;  3ASK A;  3A8H B;  2CSI A;  2E10 A;  3OYA A;  4HVW A;  7AT1 B;  4M7A B;  5GAN d;  4UC4 A;  2BTT A;  1AOJ A;  3FC3 A;  3FB9 A;  3RBB B;  1S72 Q;  1D0Z A;  1UHC A;  3CC7 T;  4A4H A;  2EJ9 A;  1UGQ B;  2K57 A;  2J7I A;  1NPP A;  1TH7 A;  4M75 A;  3L2Q A;  3M55 A;  5GJW B;  3QII A;  2M51 A;  2FZG B;  3FIF A;  1N8R C;  3PIO A;  2HBW A;  4Y92 A;  2NUT B;  4B9W A;  3MP1 A;  5FW9 A;  4ZN1 A;  5LJ5 g;  3OYG A;  5CQY A;  3CCV A;  2Y4Y A;  4C0D B;  2CP2 A;  1K0S A;  4M7D C;  3QSU A;  1YP5 A;  1M3B A;  4RTZ A;  4II1 A;  2F2W A;  2DLP A;  2IPO B;  3CPW S;  3MO8 A;  1D09 B;  3EG9 B;  2JM8 A;  2LX7 A;  3P8B B;  4E2F B;  3CCL A;  1BYM A;  4XTX A;  1JO8 A;  3M0Q A;  2MAM A;  2D8J A;  2DXU A;  2E6Z A;  4OML A;  4KT0 E;  1VQ9 T;  3MEA A;  4JLI A;  1IHV A;  4EMG A;  2JTF A;  1QCO A;  1I0C A;  3ZFJ A;  3CCL Q;  4HT9 A;  2EFI A;  5DY9 A;  3J81 E;  5HK0 A;  1G8X A;  3P8H A;  1VQO A;  1TOV A;  3WXM B;  5FU6 B;  3CCS T;  1KG1 A;  2RQW A;  1MUZ A;  4FCY A;  1QVG A;  1JEG A;  5GMK m;  3MPU B;  4C8Q G;  1AD5 A;  1B7T A;  3JCM g;  4PJO C;  3HRS A;  3OS2 A;  3CCV Q;  3CME T;  1LPL A;  2ENM A;  2QA4 A;  4C92 E;  3P8D A;  4C8Q B;  1M2O A;  1R0C B;  2R5A A;  2LJ3 A;  2QYZ A;  4IUR A;  1OPK A;  2KRN A;  2DMO A;  1VQ8 Q;  2RI5 A;  1OX9 A;  2MCN A;  2CZ0 B;  1VQ9 A;  2YRD A;  3H6Z A;  1SG5 A;  4FT4 A;  5GAM e;  3DB3 A;  3ZBD A;  4KGZ B;  5GAN f;  2EQU A;  3M53 A;  5C6S A;  2QEX A;  1QMC A;  4M7A F;  1NEG A;  2BIV A;  2D8H A;  1FXX A;  3A8M B;  4PJM A;  1MV0 B;  2BUD A;  3MEW A;  3JCM X;  2H8H A;  4JZ4 A;  1WPY A;  2MYS A;  4HT8 A;  4C92 F;  2COZ A;  5GAO l;  1PSF A;  1VQP A;  1YIT T;  4FSS A;  3G71 A;  3M59 A;  2ROT A;  2DE0 X;  4XU1 A;  1O9S A;  4YTL A;  4M75 G;  2RK1 A;  2V1R A;  5I11 A;  2NYS A;  2KR3 A;  2X4X A;  1OOT A;  2CZ1 B;  1R77 A;  2M0Y A;  3CC7 A;  1I07 A;  2PUO B;  1YJ9 T;  3MP6 A;  3X24 B;  2ABL A;  3HL8 A;  1ZSZ B;  3JCM Q;  2P0P A;  2DD4 A;  2LT1 A;  3GF5 A;  5DLQ E;  3OSS C;  3A8O B;  1WIE A;  2L5Q A;  4RMO A;  1S72 T;  4CRI A;  3CXC S;  1Z9Q A;  2PQW A;  2KT1 A;  2MIO A;  4FW1 A;  3A98 A;  2V8I A;  1VQ6 Q;  3FJP A;  2BE9 B;  3OS0 A;  3A8G B;  3G4S T;  1UJ0 A;  1NYF A;  4FM4 B;  4C0F A;  3LX7 A;  1NZ9 A;  1XQH A;  3HSB A;  3CMA Q;  3R6O A;  3M56 A;  4IUQ A;  4WF2 A;  4TVR A;  2FZC B;  1QW1 A;  4RKU E;  3X26 B;  4GLM A;  5GAO q;  5LJ3 e;  3M58 A;  4E7S A;  2E70 A;  3G71 Q;  4OVA A;  3VS0 A;  1JJ2 A;  1T3L A;  3V7R A;  5GMK j;  1HXD A;  1YCS B;  1TUG B;  4X34 A;  1U8R A;  2DZC A;  3ZEH A;  5GAM h;  1H64 1;  2X51 A;  3EG2 A;  1SSF A;  2A36 A;  1G3T A;  3PMT A;  4XTY A;  3CCU T;  4NS5 A;  3MCA B;  3I9Q A;  4RG8 A;  2BKD N;  4M7A G;  4LDX A;  1WJQ A;  3G4S A;  1M2V A;  3H8Z A;  4CC2 A;  2EQM A;  4ZGJ B;  2XG8 D;  3MET A;  4N0A A;  1VQ9 Q;  2GFA A;  5HKC A;  2PU9 B;  1U5S A;  1X75 C;  1YCY A;  4P5N A;  4FU6 A;  2DJQ A;  5I2M A;  1WZO A;  2I2L A;  1KSW A;  1M90 R;  4M77 G;  5FU7 C;  4M77 A;  2K5I A;  1GL5 A;  2M02 A;  1VQ7 T;  3NFC A;  4JPB W;  1VQ6 A;  2MWO A;  4E7J A;  4D6W A;  2DL5 A;  1K9M C;  1NLP C;  3QYH B;  1D1C A;  5FRM A;  2RHI A;  2DL3 A;  2ATC B;  5GAN 6;  2EVR A;  2YRC A;  3EGD A;  1Y7X A;  3JCM W;  5GAN 3;  3NMZ C;  4HCZ A;  2HD0 A;  4PJO D;  2GTJ A;  3H41 A;  2G3R A;  2MMP A;  2EQI A;  2JZ2 A;  2RA2 A;  2LQ8 A;  2HAX A;  5FU7 B;  2DVJ A;  4A4K A;  1PM3 A;  1Q81 U;  4C0G A;  3GIB A;  2KYB A;  3CCM A;  3I56 Q;  1BBZ A;  3VS6 A;  4BDY A;  1FMK A;  2LJ0 A;  1VQN T;  4PJN A;  2DKG A;  1H8K A;  2AZV A;  4BE0 A;  2ROL A;  1VQK T;  2MWP A;  3JCM f;  2QQB A;  2KQW A;  1JQQ A;  2RI3 A;  5FRN A;  1KD1 R;  2DA9 A;  3EG3 A;  2O31 A;  3CCE A;  1K9A A;  3QUI A;  2YSQ A;  1NJI U;  4RCB A;  2VGN A;  1RAG B;  4OP0 A;  3QO3 A;  2LJ1 A;  4GY5 A;  4RTW A;  5LL6 S;  4J6W A;  1WHJ A;  2PUK B;  5IT9 E;  1YNZ A;  1K73 U;  2KT8 A;  4EIK A;  3CD6 Q;  1PD1 A;  1AWO A;  2OTJ Q;  4PLL A;  2GF7 A;  1UEB A;  2YT6 A;  2EQJ A;  3OY9 A;  3JCM h;  4AMC A;  1U1S A;  4RTU A;  1QVF S;  2NUZ A;  2XKO C;  3OBY A;  5GAM d;  2DIQ A;  4LDW A;  2QQS A;  1YJN T;  1OX8 A;  1KQ1 A;  4KGX B;  3RDV A;  4BD3 A;  4FYX B;  4MDW A;  1NE8 A;  4J5Y A;  2RB6 A;  2LDM A;  4AT1 B;  1UGP B;  3KBG A;  3ME9 A;  1Q82 U;  2DRM A;  2VGM A;  2ECZ A;  2FPF A;  4JRP A;  1C1A A;  1IZ6 A;  1OZ3 A;  3OYH A;  1XNI A;  3BW1 A;  3VYH B;  1YJ9 Q;  2HL5 C;  1MMA A;  4JRI A;  2ZAE A;  1HYO A;  2XDP A;  3BFM A;  4OMM A;  4E7I A;  2LNV A;  2OTJ T;  2HMA A;  3EFO B;  1M1K C;  5GMK i;  4XTV A;  4FYY B;  2ZPG B;  2K6D A;  1YHQ A;  2DEQ A;  2A08 A;  2YUO A;  4J83 A;  3MJX A;  2RHU A;  1V29 B;  3EHR A;  1M1G A;  2E65 A;  2RQV A;  2CP6 A;  2OTL T;  1YIT Q;  2YUQ A;  3SFM A;  3RIR A;  2K2V A;  3LLR A;  1I5O B;  2DIL A;  5J3B A;  5KE2 A;  4BE2 A;  5DLO A;  2GBQ A;  4LXC A;  4JRQ A;  1GBR A;  2JTM A;  4QT7 A;  3JV3 A;  4JS4 A;  1UEC A;  2HZY A;  3JSC A;  3EGU A;  3JCM d;  5D6X A;  3PTA A;  1RAH B;  1RAD B;  3PE0 A;  1KIK A;  3I5R A;  2X4Y A;  2KEA A;  2OJ2 A;  4DEX A;  2DBK A;  1TS9 A;  3NPF A;  4DEY A;  4KBM B;  3C12 A;  3CC4 T;  2JXB A;  4EPC A;  1ZSZ C;  1YIJ A;  1AEY A;  4C0Z A;  5L23 A;  1QVG S;  4OMN A;  3SWN C;  4DA4 A;  1HSQ A;  4RG2 A;  4XTW A;  1H92 A;  2D0Q B;  2L3P A;  2RHZ A;  2BE7 D;  4M75 B;  1ZSZ A;  4M77 F;  4ZTF A;  3J80 E;  1I8F A;  3I35 A;  1NG2 A;  2PZ1 A;  3CME A;  2QA4 T;  1M1K U;  3E19 A;  2OTL A;  3EHQ A;  5KYN A;  3JB9 J;  3QZ9 B;  3CMA A;  1I1J A;  3HRU A;  3CCQ A;  1K73 C;  4LNP A;  2P0Q A;  1D3B B;  4C8Q E;  4PFP A;  4RCC A;  2YXY A;  1Y96 A;  2RJF A;  3G1J A;  3MHX A;  2JUF A;  2KDS A;  2DER A;  1JB0 E;  2K2M A;  5I21 A;  4M78 C;  3CCQ Q;  1WXT A;  4F7U A;  1PHT A;  1BK2 A;  1LVK A;  1MMN A;  3CXC A;  3THK A;  3FLG A;  1X6G A;  2YUN A;  1YJW T;  1JBM A;  1HD3 A;  5IAY A;  1OPL A;  3OYI A;  1UG1 A;  1VQ4 A;  4AG2 C;  1G83 A;  4C5H A;  1IHW A;  2GQI A;  3L2U A;  1UDL A;  1YJN A;  5LJ5 f;  5LJ5 h;  4EMK A;  3O8V A;  4N4G A;  4A53 A;  4PJO F;  3OYN A;  3OYD A;  1MMG A;  1X69 A;  3VYG A;  2JS2 A;  1QKX A;  2COY A;  3WVD B;  1ZX6 A;  3HTR A;  2VAS A;  4M78 B;  3EGX B;  1AZE A;  4HA8 A;  2JOY A;  4IUT A;  1ZBJ A;  4J6X A;  4DQ2 A;  1H3Z A;  5M9O A;  2ESW A;  2DYB A;  3CEY A;  2RK2 A;  1SRL A;  2RHX A;  1YI2 Q;  2KK4 A;  2LQK A;  2JT4 A;  3T9N A;  4M77 D;  2O4X A;  4JJC A;  2WAC A;  2WSC E;  1E7O A;  4J9F A;  5KYX A;  1SPK A;  1X6B A;  4Z02 A;  3CCR A;  3CCJ T;  4BY6 B;  4ZGD B;  4X1V A;  3VV0 A;  1NEB A;  4K11 A;  1KHC A;  1BIB A;  3CCJ A;  2AK5 A;  1WA7 A;  3VS2 A;  2K7A A;  2PVG B;  3MKD A;  5GAN j;  2EKO A;  4HCB A;  2NWM A;  3OS5 A;  2EW3 A;  4AFU C;  3GNG A;  2FPE A;  3HHT B;  1PRM C;  1UGS B;  1XOV A;  1K0X A;  4XU3 A;  1T0H A;  2KSS A;  4MZM A;  4V2S A;  1VQO Q;  3OMC A;  2DIG A;  2C0O A;  4PJO G;  1VQ5 A;  3C0C A;  4RTV A;  1N8R U;  5EC7 A;  1W6X A;  3CMA T;  1V1C A;  4RTT A;  5FU6 C;  3NTH A;  5LJ3 h;  1FX7 A;  1G3W A;  5LJ3 f;  5CQX A;  4OF1 A;  3J7A F;  4PNO A;  1H3H A;  1OU8 A;  3GBQ A;  4IKF A;  2HCK A;  3GP8 A;  1OU9 A;  5FRO A;  2F1L A;  3GLX A;  4M75 D;  4DBQ A;  4O6J A;  3SHW A;  5HCK A;  1GXI E;  3DB4 A;  5KH6 A;  1VQ7 Q;  2C0I A;  3M0P A;  2P0K A;  2LCC A;  4XQ3 A;  2DXB A;  3CCJ Q;  2QEX T;  4MML A;  1IGQ A;  1UGR B;  1WLP B;  1B34 B;  4OB1 B;  2K5F A;  2MI6 A;  2IG0 A;  2QQ9 A;  4AG1 C;  2K3Y A;  5GAN 2;  2FG0 A;  2OX7 A;  2VKN A;  4ME7 A;  2L0A A;  1VQ8 T;  5HK3 A;  3QJY A;  4E7K A;  1NM7 A;  4PJO E;  1KQS S;  2DX1 A;  1E6H A;  3M5A A;  4ELZ C;  4MZP A;  1WHL A;  2DTO A;  1GRI A;  4AFZ C;  5CIU A;  3JCM P;  4M78 G;  3M0U A;  3HRT A;  4X9D A;  3TU4 K;  3CXC P;  2SRC A;  1VQP T;  1SRM A;  1PSE A;  3TSZ A;  2P4T A;  4B9X A;  4F7U F;  1YJW A;  3I55 Q;  1K4U S;  2LQN A;  3DKM A;  5KYW A;  2NUP B;  1Q81 R;  4JDS A;  3E2U A;  4LDU A;  1S1N A;  4BAC A;  3GNF B;  2H3E B;  1YJ9 A;  3RMS A;  2FVU A;  1WJR A;  4OB0 B;  1WI7 A;  2EYY A;  2FRW A;  1M8V A;  2R58 A;  1FMV A;  4OMP A;  4FT2 A;  1K8A C;  4QQG A;  1M4Z A;  1YI2 T;  1WJS A;  2CZ6 B;  1BCO A;  2DD5 A;  2CT4 A;  3PVL A;  1OYX A;  2NUT A;  4BI8 B;  4C8Q D;  4BDZ A;  3L1A A;  1R8O B;  2LT4 A;  1WXB A;  2VYT A;  1E6G A;  1GBQ A;  3QWY A;  5IXB A;  2WSE E;  4C92 B;  4LE9 A;  3OW2 A;  1ABO A;  2RF0 A;  2LX9 A;  1N27 A;  1M9S A;  4X9C A;  2OAU A;  1VQ5 Q;  1W2B A;  4PKC C;  3CC4 A;  2CUD A;  2JMC A;  2C0T A;  4IUU A;  2H3J A;  4CI0 C;  2EIF A;  1QQJ A;  5AYF A;  1FYN A;  5LJ5 d;  1BU1 A;  2KRO A;  2BZY A;  3CC2 Q;  5CK9 A;  3QWX X;  3OW2 P;  1NLO C;  3SDZ A;  1N5Z A;  3BE3 A;  2CYZ B;  3H0F A;  1QP2 A;  3UAT A;  3VS4 A;  3JB9 D;  3Q1J A;  4EMK C;  3CC2 T;  2A28 A;  1VQN A;  2DAQ A;  4A54 A;  4DBR A;  1J3T A;  4KUD K;  3HFN A;  3EFO A;  3CCM T;  3QYG B;  2WSF E;  1M5Q 1;  2DXT A;  1BI2 A;  2EYW A;  2DO3 A;  5GAO n;  1QCN A;  4HCC A;  4PK4 A;  2OTL Q;  1D0X A;  1AWW A;  4Y28 E;  2RHY A;  5LJ3 d;  4MDX A;  3CCU Q;  2ZCF B;  2KNB B;  2JMA A;  2L8D A;  5GAO m;  1CKB A;  4FSX A;  2L89 A;  3REB B;  2JNG A;  1VOM A;  1M8M A;  1RAB B;  2K3X A;  4M77 E;  2RMO A;  4EDU A;  1WDX A;  2CKK A;  8ATC B;  4DBH A;  4F7U B;  3JCM c;  2OI3 A;  2QEX Q;  3RER A;  4Z8A A;  4Q5W A;  5GAN g;  1VQ4 Q;  2E3I A;  3CC2 A;  5CCA A;  4M7D E;  3CCM Q;  4JJN K;  3OYM A;  2E64 A;  3VRZ A;  1Q82 C;  1Q86 R;  1ACM B;  2B8A A;  3I5S A;  1AZG B;  2IIM A;  2EGC A;  1I4K 1;  1IGU A;  2Z0W A;  5CKD A;  1K9M R;  5GAM g;  3ZL7 C;  1P92 A;  3TVT A;  2DF6 A;  3QJ6 A;  3OYK A;  3UT1 A;  3NTI A;  2EQK A;  4R55 A;  1RI9 A;  1LNX A;  5KYU A;  4XU2 A;  2JW4 A;  2K9G A;  1D0Y A;  1AT1 B;  4J9G A;  2AKL A;  4M7D F;  2J6K A;  2K5L A;  1X27 A;  4IUV A;  1NJI R;  1UJY A;  2MOX A;  2XIC A;  3E9F A;  1K8A R;  2RQU A;  3EG1 A;  4OGC A;  2D1X A;  2Y90 A;  2QQA A;  2QAS A;  1YI2 A;  3PMI A;  3AT1 B;  1I5L A;  2FRY A;  3JB9 F;  2QA4 Q;  4QQ6 A;  2XMF A;  2GTO A;  2P84 A;  2O2O A;  1PRL C;  1ARK A;  2DZ9 A;  4M4Z A;  1XJW B;  1WGS A;  1JRI A;  1PD0 A;  2E5K A;  4KH1 B;  1QCF A;  4BB7 A;  1D1A A;  5AT1 B;  2EAY A;  1RAI B;  2AIR B;  2M16 A;  4JS5 A;  1GFC A;  4M77 C;  4OB3 B;  1EIF A;  3H9N A;  4M75 E;  2QQR A;  1RI0 A;  3L2W A;  1Y57 A;  1M2V B;  1ZLM A;  2DYI A;  4AFQ C;  4M78 A;  3QZ5 B;  2COW A;  1QWE A;  1YJN Q;  1Y71 A;  2LTO A;  1KC8 R;  2F5K A;  1HJD A;  1BB9 A;  1LJO A;  2YUP A;  3PNW C;  2G6F X;  1RUW A;  5J39 A;  1U06 A;  4DOW A;  4A4E A;  2HQX A;  1ZUU A;  4MMK A;  3CC7 Q;  3EG9 A;  3OA6 A;  2J6F A;  1M1F A;  3UA7 A;  1YIT A;  5GJV B;  1PKT A;  3OMG A;  3OYY A;  1Q7Y U;  4N4I A;  2RJE A;  4Z89 A;  2RM4 A;  4QQD A;  2DJZ A;  3OYB A;  1BI3 A;  4L6V 5;  4E7L A;  4LUD A;  2B86 A;  3G6E A;  1UB4 A;  3PIP A;  2HEQ A;  3NTK A;  3VJP A;  5GAM j;  1TXQ A;  2VUB A;  2RJD A;  2KXC A;  1KFZ A;  1WHH A;  4HVU A;  3CPF A;  2VV5 A;  3E9G A;  2F5T X;  4DBF A;  1JJ2 P;  5CAI A;  3X20 B;  3BDL A;  3X28 B;  4M7A C;  2O4X B;  1YIJ Q;  4JZ3 A;  4NOY A;  3LWH A;  1W2B S;  1BI0 A;  1WHM A;  4KRT A;  1MMD A;  1QVP A;  3TRE A;  2D0N A;  3KUF A;  2ZGW A;  1VIE A;  5CKB A;  1F1B B;  1TSF A;  2RD1 A;  3CPW A;  3OYF A;  4C0D C;  2EJG A;  1NBE B;  1IXD A;  1TWB A;  4M7D B;  5FWB A;  2F2V A;  2CZ7 B;  3OS1 A;  1RLQ C;  5J26 A;  2PVO B;  1G2B A;  4WCI A;  1AWX A;  4LDV A;  1VQO T;  1GCQ C;  3CCS Q;  4M7A E;  3M57 A;  1KQS A;  3NHN A;  2X4J A;  3A8L B;  2HKQ B;  3CPW P;  1KD1 C;  4OMF B;  1MGQ A;  2R5M A;  2NUP A;  1AHJ B;  3E1S A;  3JB9 H;  6AT1 B;  4M78 F;  2XID A;  4CC4 B;  5KCO A;  4QKU A;  2HL3 A;  1XTD A;  5A0D A;  1UGV A;  4GBQ A;  1Q86 U;  3INZ A;  4J6Y A;  1VQM Q;  1ZSG A;  2M1H A;  4Z88 A;  1VYU A;  2M0O A;  3RR6 A;  4BI4 A;  2KMT A;  1WHK A;  2JJ9 A;  2EYZ A;  1T3S A;  1RAA B;  2C06 A;  3VS7 A;  2YLC A;  4EMK B;  2RO0 A;  3SB2 A;  4M75 F;  1K9M U;  1MV3 A;  2CS7 A;  1YHQ Q;  3CCQ T;  2V8J A;  4FYW B;  5A2Q E;  2AT1 B;  1N6A A;  4J9C A;  5GMK e;  1C6V X;  1PKS A;  5GAO p;  5KYY B;  4PLI A;  3EGX A;  2SEM A;  2L3R A;  3GOX A;  2AZS A;  2QG9 B;  3U23 A;  3TCJ A;  4PL6 A;  2FYK A;  4C8Q A;  1YHQ T;  2EWN A;  2F69 A;  3V8L A;  1KK7 A;  2JM9 A;  5KYW B;  1W1F A;  3RNJ A;  4BI3 A;  1M1K R;  2D9T A;  4F7U G;  4M7D D;  3SWN B;  2FHD A;  1QVG P;  3M0T A;  1OQK A;  1VQN Q;  2KRM A;  5CKE A;  5D6W A;  5GAN 5;  3LH0 A;  1Q82 R;  1Q86 C;  5GAM f;  2DVE A;  4BY6 C;  2HSP A;  1AVZ C;  2BZ8 A;  4ELY C;  2KBT A;  3OQ5 A;  1UHF A;  1MND A;  2Y4X A;  3OYL A;  4JRK A;  4M7D G;  2VC8 A;  1UFF A;  3RKY A;  2ED0 A;  4ZN3 A;  2KAF A;  4J8O A;  2EGA A;  5L8R E;  1OZ2 A;  1UE9 A;  3LWI A;  1OI1 A;  2DEU A;  2HKN A;  4OMQ A;  1B3Q A;  5CKH A;  5A0L A;  1N9R A;  3CCR Q;  2RNA A;  2JVV A;  5CO7 A;  3G4S Q;  1I81 A;  4OGE A;  5DM7 R;  2L3S A;  2AKK A;  3VS5 A;  3CCL T;  4KUL A;  1WQ7 A;  3CC4 Q;  2HBP A;  3JCM b;  1KD1 U;  2IVW A;  1NYG A;  3EAE A;  2EGE A;  2EYX A;  3C95 A;  3RKX A;  3LW5 E;  5CKF A;  2LC4 A;  1QKW A;  2LP5 A;  2O88 A;  1W4S A;  3G6E T;  5CR2 A;  3HKS A;  3ER0 A;  3V8J A;  1W70 A;  3I55 T;  4HKE A;  2DRK A;  2X3W D;  4J9E A;  1TTH B;  1ABQ A;  1G3Y A;  2A3L A;  3QDF A;  2XDD A;  2X9H A;  5LJ5 e;  2DK3 A;  2M9U A;  9ATC B;  3EFS A;  1PWT A;  1AWJ A;  1VYT A;  4C92 A;  3QPH A;  1VQ8 A;  4HVV A;  2AHJ B;  1FWZ A;  3VKI A;  1KC8 C;  1X2K A;  3X25 B;  2VXE A;  1M30 A;  2KRS A;  1JU5 C;  2GFU A;  2OAW A;  1G5V A;  2CGH A;  3RMQ A;  1QLY A;  1SHF A;  2LCS A;  2MPX C;  2CH4 W;  1RLP C;  4LDY A;  4C5I A;  1KQ2 A;  1IRX A;  4F04 B;  3LYI A;  5GMK h;  4RUG A;  2XDB A;  1PC0 A;  3A5Z B;  3QDR B;  2XHC A;  2E5Q A;  1K76 A;  1D3B A;  2RQR A;  2K79 A;  1T0J A;  5EG2 A;  1PCX A;  1UTI A;  1SF9 A;  2PVD B;  1WQW A;  4IIM A;  4ATO A;  4BE1 A;  1PNJ A;  2QDY B;  2GNC A;  2ZPH B;  2KY9 A;  2LVM A;  4QVZ A;  2CRE A;  4N4H A;  1IO6 A;  4PJO B;  4F16 A;  2GGR A;  4PFZ A;  1RAF B;  1YWO A;  2LCL A;  3M4Y A;  1MNE A;  3KFV A;  1PG5 B;  3M54 A;  1VQ5 T;  4LN2 A;  4C8Q C;  3PVQ A;  4OB2 B;  2VVK A;  3SWN A;  2DL4 A;  2EBP A;  4RTX A;  3VS3 A;  2RI2 A;  2VB6 A;  1WNL A;  1ZUY A;  2PNI A;  5KE3 A;  5IHN A;  4M7A D;  3GPL A;  2J06 A;  2O01 E;  1BCM A;  1EFN A;  2RN8 A;  2O9V A;  2ZZD A;  3MP8 A;  3VUZ A;  1VQ6 T;  3G6E Q;  3DLL A;  5GAN h;  2VWF A;  3G7Z A;  4C8Q F;  1VQM A;  1SKU B;  2DPP B;  1OEB A;  3I56 T;  1ZQ1 A;  4GLK A;  3SD4 A;  3OYE A;  3QHS A;  2KGT A;  2MF2 A;  1HK9 A;  5GAN e;  1A0N B;  1VQ4 T;  1X6O A;  3N5B B;  1X43 A;  4L5G A;  2FB7 A;  1QP3 A;  1OUL A;  3TSW A;  1TUC A;  1K8A U;  4QVC A;  4Y91 A;  2X3X D;  3VU3 C;  1ZBX A;  1N9S A;  2YRV A;  1C0M A;  4A4F A;  2F2X A;  2DNU A;  3QKJ A;  1Z9Z A;  3QG1 A;  3CCE Q;  4IIO A;  2CP0 A;  3JCM V;  2DL7 A;  1ZHI A;  4M78 D;  4HXJ A;  4AFS C;  2PTK A;  3M9Q A;  1R0B G;  1TUD A;  2FEI A;  2BZX A;  2RJC A;  5IH2 A;  3FEO A;  1VQ7 A;  1UUE A;  4C92 G;  3O5Z A;  5GAN 4;  2W10 A;  3G71 T;  2YHT A;  3S3N A;  1IB8 A;  2E3H A;  4XAX B;  2CSQ A;  3UWN A;  5IXF A;  4IUP A;  4ESR A;  3OSV A;  2DET A;  1JXM A;  2DTI A;  2E6N A;  1BKB A;  5I2S A;  1VQL Q;  4DOV A;  4ZNX A;  2E4H A;  1YIJ T;  3PFS A;  1CKA A;  5FWC A;  5C0M A;  3TQ7 P;  5IHI A;  3UF4 A;  1GFD A;  4J9D A;  2GQV A; 
#chains in the Genus database with same CATH homology
 3WVD B;  1U1T A;  2XI9 A;  4M78 B;  3G6E A;  1M90 C;  1UB4 A;  4FT4 A;  3PIP A;  3NTK A;  4HA8 A;  2JOY A;  3VJP A;  4IUT A;  5GAM e;  2RH2 A;  3DB3 A;  3BY7 A;  3S6W A;  3V7C A;  1QVG S;  5GAM j;  2VUB A;  3ZBD A;  2V8K A;  5GAN f;  2RJD A;  4J6X A;  4DQ2 A;  2FL7 A;  1H3Z A;  2EQU A;  4F7U E;  3CPF A;  3M53 A;  5C6S A;  2QEX A;  5M9O A;  2VV5 A;  4M7A F;  3E9G A;  2F5T X;  2BIV A;  4KUI A;  5CAI A;  3X20 B;  1FXX A;  3A8M B;  3CEY A;  2RK2 A;  3BDL A;  4J7I A;  3X28 B;  2RHX A;  3L2V A;  3UPU A;  4M7A C;  2O4X B;  2KK4 A;  2LQK A;  4NOY A;  3V7S A;  3VUB A;  3LWH A;  1W2B S;  3OW2 S;  1Q81 C;  1BI0 A;  3WVE B;  1QVP A;  5GAN 8;  3T9N A;  2BUD A;  3MEW A;  3TRE A;  3JCM X;  4M77 D;  2HQE A;  3OYC A;  1WPY A;  2O4X A;  3KUF A;  4HT8 A;  2ZGW A;  3JAM E;  3PT9 A;  4C92 F;  5GAO l;  1VIE A;  1PSF A;  2WAC A;  1VQP A;  1YIT T;  2WSC E;  5CKB A;  3G71 A;  2RD1 A;  3CPW A;  3OYF A;  3M59 A;  4Z02 A;  3CCR A;  3CCJ T;  4BY6 B;  1VUB A;  2ZPB B;  4XU1 A;  1O9S A;  4YTL A;  4M75 G;  2RK1 A;  4ZGD B;  4C0D C;  2EJG A;  3VV0 A;  4M7D B;  1KHC A;  1BIB A;  3CCJ A;  3V8K A;  4O5V A;  2X4X A;  2CZ1 B;  2CZ7 B;  2PVG B;  4FIB A;  3OS1 A;  2EKO A;  5J26 A;  2PVO B;  3CC7 A;  5GAN j;  4HCB A;  3OS5 A;  4ZTJ A;  4LDV A;  2NLU A;  4R56 A;  1VQO T;  2PUO B;  1YJ9 T;  3GNG A;  3MP6 A;  3X24 B;  1NJI C;  3HHT B;  5FLX E;  3HL8 A;  2GCX A;  4M7A E;  3M57 A;  2HNI A;  4M77 B;  3JCM Q;  1KQS A;  1UGS B;  2X4J A;  3A8L B;  1XOV A;  2P0P A;  2DD4 A;  2LT1 A;  4XU3 A;  1NPR A;  4C92 C;  3GF5 A;  5DLQ E;  3JRZ A;  4M75 C;  3JCM J;  1KD1 C;  2KSS A;  4MZM A;  3C4S A;  4OMF B;  1MGQ A;  2R5M A;  2QI2 A;  3OMC A;  4VUB A;  4V2S A;  2DIG A;  3OSS C;  1AHJ B;  3A8O B;  3E1S A;  3JB9 H;  2L5Q A;  4PJO G;  1VQ5 A;  4RMO A;  2X35 A;  1S72 T;  4M78 F;  4CRI A;  1N8R U;  3CXC S;  2XID A;  2PQW A;  2EJF A;  5KCO A;  3CCS A;  3CMA T;  1XTD A;  5A0D A;  2V8I A;  3BDU A;  3FJP A;  3M4G A;  5FU6 C;  1Q86 U;  4XU0 A;  3NTH A;  3OS0 A;  3A8G B;  3L2Z A;  1FX7 A;  1G3W A;  5LJ3 f;  3INZ A;  4J6Y A;  5LJ3 h;  4FM4 B;  3G4S T;  4C0F A;  3LX7 A;  1NZ9 A;  2M1H A;  1XQH A;  3HPW A;  5CQX A;  4OF1 A;  3J7A F;  2M0O A;  3HSB A;  2QTX A;  3R6O A;  4PNO A;  3M56 A;  4BI4 A;  4IKF A;  3C94 A;  2KMT A;  4IUQ A;  4WF2 A;  4TVR A;  2D6F A;  2C06 A;  3GP8 A;  2YLC A;  4EMK B;  1QW1 A;  2RO0 A;  3SB2 A;  5FRO A;  4M75 F;  4RKU E;  1BIA A;  3X26 B;  1K9M U;  2CS7 A;  3GLX A;  4M75 D;  5GAO q;  5LJ3 e;  3M58 A;  4O6J A;  2EYQ A;  2E70 A;  3CCQ T;  2V8J A;  4OVA A;  3OBW A;  1JJ2 A;  5A2Q E;  1GXI E;  3DB4 A;  3V7R A;  5GMK j;  5KH6 A;  1HXD A;  4LD6 A;  1N6A A;  2P0K A;  5GMK e;  3MEV A;  3TEE A;  1VQK A;  4NL2 A;  2LCC A;  4X34 A;  4XQ3 A;  5GAO p;  5CVI A;  2DZC A;  3ZEH A;  2DXB A;  5GAM h;  1U8R A;  4C5E A;  4PLI A;  4A4G A;  2QEX T;  3GOX A;  2L3R A;  4MML A;  1UGR B;  3RES A;  1LOJ A;  1H64 1;  1B34 B;  1SSF A;  4OB1 B;  3MEU A;  2K5F A;  1G3T A;  2MI6 A;  3PMT A;  2IG0 A;  4XTY A;  3CCU T;  2R57 A;  2XU8 A;  2ZPF B;  4BUG A;  4NS5 A;  5GMK l;  3MCA B;  3TCJ A;  4ZGE B;  2QQ9 A;  2K3Y A;  4RG8 A;  4PL6 A;  2BKD N;  2FYK A;  5GAO r;  4LDX A;  4M7A G;  1WJQ A;  1Y07 A;  3QBY A;  5GAN 2;  3G4S A;  2E12 A;  4C8Q A;  2EWN A;  2F69 A;  2DXC A;  3CBO A;  3H8Z A;  4ME7 A;  3V8L A;  4E7H A;  1YHQ T;  1M90 U;  1G3S A;  2EQM A;  5LJ5 j;  4M7D A;  4ZGJ B;  1DJ7 B;  1VQ8 T;  2XG8 D;  5HK3 A;  3MET A;  4N0A A;  3QJY A;  4E7K A;  3RUX A;  3JCM e;  2GFA A;  5HKC A;  2PU9 B;  1X75 C;  4PJO E;  1RL2 A;  4BI3 A;  1KQS S;  1YCY A;  3UDC A;  4P5N A;  2D9T A;  3M5A A;  4FU6 A;  4ELZ C;  4F7U G;  3SWN B;  4M7D D;  2FHD A;  5I2M A;  2OTJ A;  1BI1 A;  4MZP A;  2I2L A;  5LJ3 g;  2DTO A;  4EMH A;  3LGF A;  5CIU A;  4M77 G;  5FU7 C;  1KHI A;  5CKE A;  3JCM P;  4M78 G;  5D6W A;  4M77 A;  2K5I A;  3EFR A;  5GAN 5;  1VQ7 T;  3NFC A;  1VQ6 A;  3LH0 A;  1Q7Y C;  2MWO A;  1Q86 C;  3HRT A;  4L59 A;  1YBY A;  4E7J A;  4X9D A;  2DVE A;  4BY6 C;  4D6W A;  5GAM f;  3TU4 K;  1VQP T;  3DLM A;  5KCH A;  4ELY C;  3URG A;  1PSE A;  3OQ5 A;  4LD9 K;  1IRE B;  2Y4X A;  1Y96 B;  4C92 D;  1K9M C;  2P4T A;  3OYL A;  4B9X A;  4F7U F;  3LGL A;  3QYH B;  4JRK A;  1YJW A;  5FRM A;  4M7D G;  2RHI A;  2VC8 A;  5A0G A;  3RKY A;  5GAN 6;  4XTU A;  4ZN3 A;  1Y7X A;  3DKM A;  2KAF A;  4J8O A;  4JDS A;  4LDU A;  4QVD A;  3JCM W;  3CCR T;  4BAC A;  3QXE B;  5GAN 3;  4HCZ A;  2HD0 A;  3GNF B;  5L8R E;  3CBM A;  1OZ2 A;  1YJ9 A;  4PJO D;  3RMS A;  2FVU A;  2G3R A;  2MMP A;  3LWI A;  1OI1 A;  1WJR A;  2JZ2 A;  4N0A C;  4OB0 B;  2RA2 A;  2LQ8 A;  2HAX A;  5FU7 B;  1M8V A;  3L2R A;  2A7Y A;  2R58 A;  4A4K A;  4PJO A;  3CCV T;  5A0L A;  5CKH A;  1Q81 U;  1N9R A;  4C0G A;  3GIB A;  4FT2 A;  1K8A C;  4QQG A;  1M4Z A;  2JVV A;  4J7F A;  5CO7 A;  1YI2 T;  1I81 A;  3CCM A;  4OGE A;  5DM7 R;  1WJS A;  3CCU A;  2CZ6 B;  5LJ3 j;  2DD5 A;  3CCL T;  4BDY A;  4KUL A;  1WQ7 A;  3F70 A;  1OYX A;  2HBP A;  1VQN T;  4BI8 B;  4JLG A;  4C8Q D;  3JCM b;  3L1A A;  5IN1 A;  3L42 A;  4BDZ A;  1KD1 U;  2DKG A;  1R8O B;  2IVW A;  2LT4 A;  3EAE A;  4BE0 A;  2LRQ A;  3C95 A;  2VYT A;  3RKX A;  4E47 A;  3LW5 E;  5CKF A;  1VQK T;  2MWP A;  3HFO A;  2LC4 A;  2DTH A;  2WSE E;  4C92 B;  2YLB A;  3OW2 A;  2ZPE B;  2QQB A;  3JCM f;  3CCE T;  2KQW A;  2RI3 A;  3FRN A;  3S3O A;  5FRN A;  3CD6 T;  3CBP A;  1W4S A;  2LX9 A;  1N27 A;  3G6E T;  1QVF A;  1M9S A;  4X9C A;  5CR2 A;  1JJ2 S;  2XD0 A;  2OAU A;  3HKS A;  3ER0 A;  4M78 E;  4PKC C;  3V8J A;  1W2B A;  3CCE A;  3CC4 A;  3I55 T;  3JB9 G;  4HKE A;  3QUI A;  4IUU A;  2E1H A;  2H3J A;  4CI0 C;  1G3Y A;  3I56 A;  2A3L A;  1NJI U;  2EIF A;  4RCB A;  2VGN A;  2XDD A;  5AYF A;  5LJ5 d;  2QXF A;  5LJ5 e;  4OP0 A;  2DK3 A;  3I55 A;  3QO3 A;  4C5G A;  4GY5 A;  2M9U A;  5HY6 A;  1VQM T;  5LL6 S;  5CK9 A;  3EFS A;  4J6W A;  4C92 A;  4NL3 A;  2E41 A;  3QPH A;  3FDR A;  1VQ8 A;  2PUK B;  5IT9 E;  2AHJ B;  3SDZ A;  3KXT A;  1K73 U;  1FWZ A;  3VKI A;  1KC8 C;  4M7A A;  2CYZ B;  3PGG A;  3X25 B;  1QP2 A;  2VXE A;  3JB9 D;  3Q1J A;  4EMK C;  3CC2 T;  2ZPI B;  1S72 A;  1VQL T;  2GFU A;  4PLL A;  2GF7 A;  1G5V A;  2CGH A;  1MHN A;  1UEB A;  3RMQ A;  3HP9 A;  1VQN A;  2DAQ A;  4A54 A;  2EQJ A;  3OY9 A;  3JCM h;  4KUD K;  1U1S A;  3HFN A;  2KVQ G;  4LDY A;  4C5I A;  3CCM T;  1QVF S;  2XKO C;  2XK0 A;  3OBY A;  2WSF E;  3QYG B;  1M5Q 1;  2DXT A;  1BI2 A;  2K4Y A;  1KQ2 A;  2DO3 A;  5GAM d;  5GAO n;  4HCC A;  3LYI A;  5GMK h;  2DIQ A;  2XDB A;  3A5Z B;  4LDW A;  4QW2 A;  2QQS A;  4Y28 E;  3QDR B;  3JB9 I;  1B34 A;  2XHC A;  1YJN T;  3CD6 A;  2E5Q A;  2RHY A;  5LJ3 d;  1D3B A;  4MDX A;  1KQ1 A;  1KC8 U;  4BD3 A;  4MDW A;  2ZCF B;  1NE8 A;  5EG2 A;  2RB6 A;  2LDM A;  4J5Y A;  1UGP B;  2L8D A;  3KBG A;  5GAO m;  1O75 A;  2PVD B;  3AHU A;  1WQW A;  3ME9 A;  4FSX A;  2L89 A;  4ATO A;  1Q82 U;  2VGM A;  4BE1 A;  2JNG A;  1X01 A;  4JRP A;  2JN0 A;  1IZ6 A;  1OZ3 A;  3OYH A;  1XNI A;  2K3X A;  3BW1 A;  4M77 E;  3RKW A;  3VYH B;  2QDY B;  1VIF A;  2ZPH B;  4JRI A;  4XK8 E;  2KY9 A;  4EDU A;  2LVM A;  3OB9 A;  2CKK A;  2X4W A;  2XDP A;  4JUV A;  4F7U B;  3BFM A;  4QVZ A;  3JCM c;  2LNV A;  4E7I A;  2OTJ T;  4N4H A;  3RER A;  1M1K C;  4PJO B;  4XTZ A;  3S3M A;  5GMK i;  5GAN 7;  4Q5W A;  5GAN g;  2LCL A;  4XTV A;  2ZPG B;  3M4Y A;  4FL6 A;  4MZT A;  5D6Y A;  3OYJ A;  1VQL A;  3CC2 A;  3M54 A;  2DEQ A;  2VXF A;  1YHQ A;  4J83 A;  1VQ5 T;  4C8Q C;  3ASK A;  2RHU A;  4OB2 B;  3A8H B;  5CCA A;  1V29 B;  4JJN K;  4M7D E;  3OYM A;  3SWN A;  2E10 A;  2E64 A;  3OYA A;  1M1G A;  2E65 A;  1Q82 C;  2OTL T;  4M7A B;  2RI2 A;  2B8A A;  5GAN d;  4UC4 A;  3SFM A;  1WNL A;  3RIR A;  2K2V A;  3LLR A;  1I4K 1;  5CKD A;  5J3B A;  3FC3 A;  5GAM g;  5KE3 A;  3FB9 A;  5KE2 A;  4M7A D;  1P92 A;  3GPL A;  2O01 E;  4BE2 A;  5DLO A;  4JRQ A;  3CC7 T;  4A4H A;  2EJ9 A;  2JTM A;  2ZZD A;  3MP8 A;  3QJ6 A;  3VUZ A;  3OYK A;  4JS4 A;  1VQ6 T;  3JSC A;  1UGQ B;  2K57 A;  3NTI A;  3UT1 A;  2EQK A;  4R55 A;  1LNX A;  1NPP A;  1TH7 A;  4M75 A;  5GAN h;  3DLL A;  4XU2 A;  3JCM d;  5D6X A;  3PTA A;  3L2Q A;  3G7Z A;  4C8Q F;  1VQM A;  3M55 A;  4M7D F;  2X4Y A;  2DPP B;  2K5L A;  3QII A;  1I5L A;  4IUV A;  3I56 T;  3FIF A;  1ZQ1 A;  2XIC A;  3E9F A;  1N8R C;  3PIO A;  4GLK A;  4KBM B;  3SD4 A;  3C12 A;  4OGC A;  4EPC A;  3CC4 T;  2Y90 A;  4B9W A;  3MP1 A;  3OYE A;  3QHS A;  5GAN e;  2MF2 A;  1HK9 A;  4ZN1 A;  2QQA A;  4C0Z A;  5LJ5 g;  3OYG A;  1YI2 A;  3PMI A;  1VQ4 T;  3SWN C;  1X6O A;  3N5B B;  4L5G A;  4DA4 A;  4RG2 A;  5CQY A;  3JB9 F;  2FB7 A;  4XTW A;  1QP3 A;  2D0Q B;  2RHZ A;  4M75 B;  2Y4Y A;  4QQ6 A;  3CCV A;  4M77 F;  4C0D B;  4ZTF A;  3J80 E;  1I8F A;  1K8A U;  4QVC A;  3QSU A;  4Y91 A;  4M7D C;  3VU3 C;  1ZBX A;  4II1 A;  2DZ9 A;  1N9S A;  2YRV A;  3CME A;  1WGS A;  1JRI A;  3MO8 A;  3CPW S;  2QA4 T;  1M1K U;  3E19 A;  2OTL A;  4BB7 A;  3P8B B;  4A4F A;  3CCL A;  3JB9 J;  1BYM A;  3QZ9 B;  3QKJ A;  2EAY A;  3CMA A;  3HRU A;  3QG1 A;  4XTX A;  2MAM A;  3CCQ A;  2M16 A;  4JS5 A;  4M77 C;  4OB3 B;  1K73 C;  1EIF A;  3JCM V;  1ZHI A;  2DXU A;  4M78 D;  2E6Z A;  2P0Q A;  4M75 E;  2QQR A;  1RI0 A;  1D3B B;  3M9Q A;  4KT0 E;  4C8Q E;  3L2W A;  1VQ9 T;  3MEA A;  4RCC A;  1Y96 A;  2RJF A;  4JLI A;  2RJC A;  4EMG A;  4M78 A;  3MHX A;  3QZ5 B;  2JTF A;  3ZFJ A;  2JUF A;  2KDS A;  3FEO A;  4HT9 A;  1JB0 E;  2EFI A;  5DY9 A;  4C92 G;  1VQ7 A;  5I21 A;  1Y71 A;  2LTO A;  5GAN 4;  2F5K A;  3J81 E;  5HK0 A;  4M78 C;  3G71 T;  2YHT A;  1LJO A;  4F7U A;  3PNW C;  3P8H A;  3S3N A;  1VQO A;  3WXM B;  5FU6 B;  3CXC A;  4XAX B;  5J39 A;  3UWN A;  3CCS T;  3FLG A;  1KG1 A;  4IUP A;  3OSV A;  1QVG A;  1YJW T;  1JBM A;  2DTI A;  2E6N A;  5IAY A;  5GMK m;  3OYI A;  1BKB A;  4DOW A;  4A4E A;  5I2S A;  1VQ4 A;  4C8Q G;  4DOV A;  2HQX A;  4C5H A;  1YIJ T;  3L2U A;  3PFS A;  4MMK A;  3JCM g;  1YJN A;  4PJO C;  3HRS A;  5LJ5 f;  5LJ5 h;  4EMK A;  3OS2 A;  5C0M A;  3CME T;  2QA4 A;  3OA6 A;  1M1F A;  3O8V A;  4C92 E;  3P8D A;  4N4G A;  4A53 A;  4PJO F;  4C8Q B;  3OYN A;  1YIT A;  2R5A A;  3OMG A;  3OYY A;  4IUR A;  3OYD A;  2RJE A;  4N4I A;  1Q7Y U;  2RI5 A;  2RM4 A;  4QQD A;  2CZ0 B;  3VYG A;  2DJZ A;  1VQ9 A;  3H6Z A;  3OYB A;  1BI3 A;  2GQV A;  1YIJ A;  4L6V 5;  4E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...