1DJ7B

Crystal structure of ferredoxin thioredoxin reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN THIOREDOXIN REDUCTASE: CATALYTIC CHAIN
publication title Redox signaling in chloroplasts: cleavage of disulfides by an iron-sulfur cluster.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1dj7B00
2CZ7B 4KT0E 1DJ7B 3VYHB 1V29B 2ZPBB 4ZGEB 2PUOB 2PVOB 4OB3B 1AHJB 4FM4B 2WSEE 2QDYB 1UGQB 3QXEB 4OB2B 2CYZB 3X25B 4OB1B 1UGPB 2ZPFB 3LW5E 4XK8E 2DXCA 2DXBA 2D0QB 4ZGDB 2ZZDA 2PU9B 2ZPGB 5L8RE 4ZGJB 3A8MB 2PUKB 3X28B 3A8OB 2DPPB 2ZPHB 3HHTB 2CZ1B 1PSFA 1PSEA 3WVDB 2DD4A 4RKUE 3A8LB 3QZ9B 1QP3A 4OB0B 3VYGA 3X20B 2WSFE 2CZ6B 2O01E 4L6V5 4Y28E 3QZ5B 3X24B 1UGRB 1UGSB 2PVGB 2WSCE 2ZCFB 2AHJB 3QYGB 1IREB 3X26B 2PVDB 3A8GB 1QP2A 2CZ0B 2ZPEB 3QYHB 2DD5A 3WVEB 2ZPIB 3A8HB 1GXIE 1JB0E
chains in the Genus database with same CATH superfamily
4BY6C 1VQLQ 1M4ZA 1JJ2P 2JT4A 1YCYA 3C12A 4JJBA 2PUOB 3PVQA 4C5GA 3L42A 4PLIA 5CAIA 2KVQG 1MNDA 2BUDA 1RAFB 2FZKB 2CS7A 4EMKA 1OU9A 3M5AA 3META 1RAAB 4XU1A 1RAEB 2QEXT 3OQ5A 1UECA 3FDRA 4F7UG 3AT1B 2RD1A 2CREA 2F2XA 3EGDA 4AFQC 5GAOr 3OS0A 2RQVA 4PJOD 1UEBA 2ATCB 3MO8A 2QAZA 2GGRA 1KG1A 2ZGWA 1K8AR 5KYWB 2D0NA 1JO8A 1GCPA 2QTXA 4C92B 1N9SA 1G3WA 2L3PA 3CCVQ 2NUTB 2DETA 1VQ7A 2K5IA 4XTYA 5GANg 3BFMA 3OYYA 1AWJA 2XU8A 4J6XA 3JCMV 1Q82R 8ATCB 4OB0B 1R0CB 2J6KA 4PJOC 2AT1B 2DLPA 3CC7T 5FWBA 3S3OA 3FJ5A 1VQKT 5HKCA 1BI2A 4XU0A 1M1KC 2K7AA 2NUPB 1M1KU 2JMCA 4J9HA 4C92E 1E6HA 4M7AB 3MP1A 1RACB 2J6FA 5GAN6 1GBQA 2J7IA 5GAN7 5KYXB 4XTUA 1SPKA 1S72T 1OOTA 2JVVA 1OYXA 1NE8A 1YI2Q 3NPFA 3CCEQ 2RNAA 4AFZC 3OYJA 2ED0A 2K9GA 1SRLA 3CQTA 1GCQC 3VYHB 3EG1A 2HMAA 2ZPBB 4EMGA 2F2VA 4M78D 3BY7A 4J9CA 3J81E 4A4KA 4M7AE 4RCBA 4X1VA 3GIBA 1H3HA 2E4HA 3CCMT 2DFUA 1JEGA 4L59A 1OU8A 4FM4B 2QA4Q 1NLPC 3CCSQ 4F04B 2CYZB 1KSWA 2DXUA 2L3SA 1M90C 1M90U 1Q7YR 2FRYA 2HDAA 2HL5C 3V8LA 4DEYA 5GAOn 2A3LA 2DRMA 4LDUA 2ROTA 3QIIA 5I21A 3G71Q 1Q82U 3I56T 3JB9D 5C0MA 1K0XA 3BDUA 2ZPGB 1WXUA 3I55Q 1YIJQ 1ZX6A 2BIVA 1H92A 3OYIA 4E7SA 3EFOA 2O9SA 3GP8A 1WHJA 4GY5A 4MDWA 1RLQC 5LJ3f 2QYZA 2HD0A 4PJOG 3DLMA 2V26A 4PFZA 1NPPA 3JCMb 1NJIR 1YJ9A 2FRWA 1UTIA 2WSFE 5GMKj 2X4YA 3RIRA 4C0FA 2JXBA 2OTLT 1VQPQ 2DJQA 5GANd 1YNZA 4CC3A 1UJ0A 1Y96B 3M53A 4JPBW 2VUBA 3EG2A 4C8QD 4FT4A 1NYFA 4PJMA 2LC4A 2X4XA 4J9DA 5HCKA 4LDXA 1R0BG 3S3NA 3P8BB 1KD1C 1KD1U 4J83A 4MZPA 2E3IA 2MK5A 4Y92A 3BE3A 3CCQT 1SSHA 3E1SA 4LDYA 4BB7A 2ZPIB 1JB0E 1RABB 3RKXA 2QTVA 4C8QC 3M4GA 2KT1A 2BE9B 4QQDA 1I5LA 3F70A 1YBYA 1GBRA 2HAXA 2GBQA 4JLGA 3CCLT 1C6VX 5AT1B 1VA7A 3RDVA 3QXEB 4M75F 2ABLA 2V1QA 3M55A 3G4SA 3UA6A 2DK3A 4LD6A 2DTIA 5FU7C 3RKWA 4A4EA 4PLLA 4FW1A 2FB7A 5LJ3h 3ZBDA 2K2VA 4QVDA 2F69A 4ZGDB 3RNJA 3OYMA 3DB3A 3MJXA 4N4HA 2JTMA 3RUXA 1UGVA 4LXCA 4LDWA 2GF7A 1X6GA 1SHFA 1Y07A 4CI0C 1D3BB 2FYKA 5IHNA 1H3ZA 4PK4A 3WVDB 4AMCA 2KE9A 4FT2A 4HCCA 3PIPA 2ED1A 2JOYA 3G6EA 2O01E 1D1CA 1SG5A 3QZ5B 3X24B 2VKNA 2AIRB 4C92A 2GNCA 4M77E 4OGCA 3MP8A 4GLKA 2KMTA 2NUTA 1U8RA 2MAMA 5C6SA 4N4GA 4F7UB 2KI7A 1I81A 4Z89A 3KBGA 2AHJB 3V7CA 1TXQA 4B6MA 2RQRA 4XTXA 3KXTA 4N0AA 4HCKA 4C8QG 2GQIA 3HTRA 2DD5A 2NUPA 2RQUA 5LJ3e 1ZSZB 5IHKA 5GANj 4M7DE 3CCVA 3GNGA 1GXIE 2F1LA 4M7AA 2EQKA 3SHWA 5FROA 4QVZA 3M54A 2RF0A 1VQ7T 3H41A 2NWMA 1KIKA 5KYXA 2LMJA 2RHXA 3CCRQ 2JUFA 2FPEA 1QVFP 3JCMJ 2JZ2A 2YUNA 4DOVA 2RJCA 1T0HA 1UGQB 2DL3A 1QQJA 5IXBA 1Q86C 1Q86U 4LUEA 2IIMA 4OF1A 1AEYA 2P0PA 4C5IA 4GLMA 2FO0A 2CP5A 3EHRA 1XNIA 1ZLMA 4BY6B 2CH4W 3MHXA 1AVZC 1XOVA 4CC2A 4FL6A 1TWBA 2DRKA 3G1JA 3M0RA 1YCSB 2R57A 2PU9B 1YI2A 3CCEA 1VQ4A 1PHTA 4M4ZA 2E5QA 1TUGB 2COWA 3TREA 3HP9A 1RAHB 2DTOA 1U06A 2FPFA 2P0KA 3OMCA 3M0QA 3NTHA 1OULA 3VS4A 3ZFJA 1H8KA 3QJYA 3TU4K 2EGEA 3REBB 2Y4XA 4L6V5 4WTOB 2C0TA 4RTXA 3JCMg 2QA4A 3H0HA 1PNJA 3CCSA 4KBMB 3JB9I 2B86A 1LPLA 4BACA 2HSEB 1WHMA 4C92F 2GFUA 2EJGA 4PKCC 2W10A 3CMAQ 1QKXA 5HY6A 3OA6A 3JCMe 3CMEQ 1HYOA 3BW1A 1RI0A 2KYMA 2XIDA 2ZPEB 4ZN1A 4JRPA 4FCYA 1Y96A 2RK1A 2CP3A 4OMPA 2LJ3A 4PJOB 5A0GA 5J3BA 2GTJA 1YITQ 3MEVA 4KT0E 5GMKh 1PWTA 3JCMQ 2FG0A 3UATA 2M02A 2XKOC 1YJ9T 3ME9A 3EGXB 2CT3A 4IUUA 3UWNA 1VQ8A 2L0AA 1ZBXA 1SEMA 4JJNK 2QDYB 4FYYB 4BI8B 3C0CA 1RAGB 1QVGP 4KRTA 4XU3A 1O75A 4PJOE 3ZEHA 1K9MR 1UE9A 1VQMQ 2ZPFB 2JN0A 2EKOA 1M5Q1 1MV3A 3OSVA 2LZ6B 2NUZA 1WHLA 1KFZA 2H3JA 3JV3A 1VQ5Q 1KC8R 2CP6A 2CGHA 3E19A 3NTIA 3P8HA 3CCUA 8AT1B 1O9SA 2DJZA 2CUBA 1PC0A 2DD4A 4RKUE 3HSBA 5GANf 1K0SA 1EFNA 2ESWA 4LUDA 3VU3C 3X20B 3PE0A 5D6YA 5GMKe 2RH2A 4M78B 4ELYC 2RHIA 3CC2A 4RTUA 1K73C 1AZEA 2LRQA 1K73U 2R58A 3RBBB 4KGVB 3CD6Q 2EYWA 2H3EB 2RI2A 4FYVB 1BIAA 3G4ST 3AHUA 3JCMd 2COYA 3QYGB 4OMQA 3H0IA 2EYXA 5KCHA 2DXTA 1K4US 3H0FA 4BI4A 1VQOA 2D9TA 1G3TA 5CVIA 4JJDA 3QDRB 4M78E 4VUBA 5IH2A 2QI2A 2IPOB 4P5NA 2YRCA 4C0DC 1KQSP 2O9VA 2X35A 1QCOA 1XTDA 3A8HB 4RG8A 1H641 3QBYA 3M57A 1NEGA 2L3RA 1Q81C 1OX9A 1Q81U 2PVOB 1G5VA 1M3BA 4JRQA 1BCMA 1TSFA 4D6WA 2KQWA 2LQKA 1ZSZA 3G6ET 1VQNA 3RR6A 3OYDA 2XI9A 4JRIA 1BCOA 3PTAA 1M1KR 4HVVA 2XDPA 1EX4A 1PM3A 2R5MA 4EMHA 3CEYA 3L2ZA 4KULA 2C0OA 1YHQQ 1M1GA 3PNWC 4OB1B 2VVKA 3OYGA 1N6AA 2FZGB 3EG9B 4C8QB 5A0LA 4XK8E 1KQSS 2QQSA 4KUIA 5GANh 2K2MA 3UT1A 2K5LA 1U5SA 4J9IA 5FU6B 3VS0A 3THKA 4NOYA 4EMKC 1Y71A 4D8KA 2E65A 3IQLA 1TUCA 3CCVT 1KQSA 5J26A 1AOJA 1VYUA 4QKUA 5FU7B 2HQXA 1N8RC 2XG8D 1N8RU 2QXFA 2OTJQ 5FRMA 2B8AA 2RJEA 3VS1A 1TOVA 5KCOA 4J9EA 5CKDA 2DAQA 4M77F 1FX7A 2K4YA 3QG1A 4DOWA 4X9DA 5GAN3 1YP5A 1M90R 5CR2A 2KT8A 2KYBA 1ZA1B 1M8MA 2Z0WA 2EKHA 2FL7A 4Z88A 2D8HA 3VKIA 3CBOA 5DM7R 2EWNA 4OMNA 4CRIA 2LT1A 3J80E 4E7KA 1NM7A 2DIGA 1YI2T 3CCET 1VQ4T 1UG1A 1G83A 3QJ6A 5GANe 4M7DF 2LDMA 4JUVA 5A2QE 1WGSA 1YJWA 3QPHA 4M75D 1MMAA 3FLGA 2XMFA 1M3AA 2LQ8A 2CDTA 2DYIA 4E7IA 4PJOA 2KSSA 1NPRA 2SRCA 5GMKm 3CCJA 2QA4T 2QGGA 3CCST 4JDSA 1FMWA 3HFOA 3NHNA 2AZSA 3JCMX 4OP0A 4FSSA 2XK0A 3CMEA 2DVEA 4PJJA 4M75C 3MKDA 1KD1R 2C0IA 4KH1B 1VIEA 4N4IA 3CC7Q 1LNXA 4ATOA 4A53A 1NYGA 1VQKQ 1ZBJA 4MZMA 2DZCA 3EFRA 2BE7D 2FVUA 2OX7A 3M56A 1PKTA 1WYXA 3O5ZA 1GCQA 1K76A 1PSEA 3REAB 3OYCA 4A4GA 1YFNA 1IGUA 2YHTA 1IZ6A 1QKWA 1VQ9A 2OAUA 1S72Q 5FLXE 3TEEA 5CQXA 2LJ1A 4UC4A 1VQ8T 4JZ4A 3SWNA 1WA7A 2YLBA 2JM8A 3GPLA 2CUDA 4LNPA 2DILA 9ATCB 2K3BA 5GAN8 4M78A 2EFIA 4J9GA 3CCMQ 3S6WA 2J6OA 1WIEA 1M27C 1M3CA 3M0UA 2QDLA 3PT9A 2RHUA 2LX7A 3OS2A 4DQ2A 5L23A 1QMCA 1WQWA 3CCUT 2O2OA 4KH0B 1SKUB 1I8FA 2BZYA 2J06A 4OB3B 2LJ0A 2V8IA 1I0CA 3CC2T 3CD6A 2YSQA 3U23A 2RA2A 4M75G 1B3QA 3VV0A 1XJWB 6AT1B 3M0SA 1WFWA 2EJFA 3H6ZA 1BB9A 1WI7A 2EQMA 2EVRA 1VYTA 2MWOA 2OTLQ 4ZTJA 1VQOT 1GFCA 3WXMB 4C5HA 1KK7A 1P92A 3FC3A 4RTZA 1Y57A 4X34A 1IRXA 2DL5A 1I07A 1UHFA 1X6BA 5EC7A 1YWOA 3EG9A 1F1BB 4C0ZA 4A54A 4C8QA 2SEMA 2YUQA 3OY9A 5I2MA 5FRNA 2RB6A 1QWEA 1QVPA 3I5RA 3TSWA 1B34B 2CT4A 2EPDA 2CZ6B 2YRVA 5I11A 4WCIA 3JCMf 1D0YA 1UGRB 1Q86R 1VQNT 1PD1A 2KRNA 3EH2A 3HFNA 5KYYB 2E6NA 1YJNQ 5GAOp 2GFAA 1VQLA 1TG0A 1EZZB 1IHVA 2X3WD 3DLLA 3UA7A 2D1XA 3PGGA 3UF4A 2EIFA 2K79A 3CCLQ 4PFOA 1X6OA 1MMNA 4M78F 2KGTA 5KYWA 1CKAA 3GBQA 2DKGA 4F17A 2RI3A 1TH7A 2RQWA 2CP0A 1DJ7B 1S1NA 2EJ9A 2XICA 3M0TA 4HKEA 2M16A 1QW1A 3L2UA 2Y4YA 2WACA 2K3YA 4IKFA 1W2BS 2D8JA 2XD0A 1WQ7A 2VC8A 3QHSA 2V8KA 4OB2B 4NS5A 3L2RA 5GAN5 3OYAA 2DERA 3JB9F 4KUDK 3QSUA 4F7UE 3M4YA 3LW5E 3NGPA 2IG0A 2ZZDA 4RCCA 3VS6A 2LVMA 5FW9A 4BE1A 4ZGJB 4R56A 2DNUA 1QCFA 1ZSGA 3M59A 3JCMh 1G3YA 1BI0A 1KHIA 3JB9H 3HPWA 2AKLA 1OPLA 1HJDA 4QW2A 1MNEA 3A8LB 2MYSA 1KJWA 7AT1B 1YJWT 1G8XA 1QWFA 1LOJA 3VRYA 1N9RA 1B7TA 2G6FX 1X27A 1AZGB 2YLCA 5CKHA 3CCJT 3CXCS 2WSCE 1K1ZA 2VB6A 2DM1A 3V7SA 1VQ7Q 2X9HA 1D0XA 2LT4A 4EPCA 3A8GB 3CMET 1AWWA 1RUWA 2ECZA 5GAN2 2DF6A 1QP2A 3MEUA 3KUFA 1BKBA 1WJQA 3HKSA 2X51A 2DYBA 1WXTA 2VWFA 2KROA 5IAYA 4DEXA 5LL6S 3S3MA 4MMKA 1D09B 4RTYA 4A63B 4J7FA 4Y91A 4E7LA 4J9FA 5D6WA 3OYHA 1X01A 4E7HA 2MPXC 4QQ6A 4RTTA 2OI3A 1ZUYA 3HRUA 3OW2S 1C0MA 4FW2A 5GAMd 3G71A 4PJLA 3VS5A 1AHJB 1VQ9T 1K73R 3I55A 2KAFA 1YIJA 1VQ6Q 4HCZA 3EG0A 4F14A 3M0PA 2MF2A 4RUGA 2HNIA 1OQKA 3OS5A 2VGNA 3OYKA 1OEBA 2NYSA 4M7AF 4HVWA 3L1AA 1WXBA 2K6DA 2EYQA 2A08A 2HKQB 3BDLA 1VQPA 2Y90A 1T3LA 4BUGA 1CKBA 5I22A 3X28B 2CZ1B 5CKFA 4QVCA 2L89A 2DE0X 3I9QA 2DA9A 5KYUB 1Q81R 2K57A 2ZAEA 1HXDA 1UUEA 2ENMA 1ABOA 4M75B 2E10A 2DX1A 4R0KA 3GLXA 2EAYA 2V1RA 3Q1JA 3R6OA 4MMLA 3MEWA 3CD6T 4RTVA 1YWPA 1PG5B 2EQIA 2KXDA 1J3TA 4E2FB 1EIFA 2A36A 1B34A 4AFSC 1T0JA 3FIFA 1WLPB 1SHGA 4M77C 4M7DD 5DLQE 2CZ0B 3T9NA 1OX8A 4A4FA 3P8DA 3OMGA 3EGUA 5KYYA 3UPUA 1ARKA 1D3BA 3MCAB 3FEOA 1WNLA 2E3HA 5GAOq 3CC4Q 2RPNA 1N8RR 5J39A 3OS1A 2LTOA 4J6YA 1FMKA 4M7DC 2HBPA 2JW4A 2YWWA 1ZUKA 3SD4A 2JTEA 4F7UA 1YJNA 1WDXA 1U3OA 1VQLT 2LX9A 3GNFB 2JS2A 2AZVA 4JRKA 3EHQA 4QQGA 2RHZA 2D0QB 2DIQA 3CPWS 5D7UA 1HK9A 5GAMj 4BDYA 4BDZA 2DBKA 4C5EA 2GQVA 2VV5A 5LJ5d 3A8OB 2ZPHB 5CCAA 3G4SQ 3MP6A 3ASKA 4XAXB 5GJWB 1Z9QA 1KQ1A 2K5FA 1RI9A 5CO7A 3QDFA 4BI3A 5HK3A 1GFDA 1WJRA 1N27A 2BKDN 1BI3A 3A5ZB 1QP3A 4OMLA 3V8KA 3RERA 1IGQA 2FHDA 4DA4A 2F5KA 2KK4A 5IT9E 3L2VA 5GMKl 4M77G 5CKBA 4HCBA 5IN1A 4HVUA 3L2WA 3M9QA 2KY9A 3DB4A 3VUZA 1I1JA 2HQEA 1IREB 2PTKA 4BE2A 2KEAA 2QQRA 2P0QA 3CCRA 1ACMB 2FPDA 4C8QE 2M51A 2E41A 2MCNA 1K9AA 3G6EQ 2DVJA 3URGA 3VJPA 3WVEB 2LNHB 2HZYA 2KR3A 5GAOm 4FIBA 4M7DG 2JM9A 1V29B 1TTHB 1X43A 1BYMA 4ZGEB 3CBMA 4AFUC 1ZUUA 1WHHA 2WSEE 5CIUA 1JJ2S 3I35A 3N5BB 5M9OA 2L8DA 3V7RA 2X4WA 3R6NA 3JCMP 2EW3A 1VOMA 2HEQA 2V8JA 2QEXQ 5D6XA 4F7UF 3OYFA 2AKKA 4LN2A 3M58A 3INZA 1FXXA 1JJ2A 1JRIA 3MEAA 3JRZA 2EYZA 2DL4A 2PQWA 2E70A 4JLIA 2NLUA 2HQHA 2M9UA 3NMZC 1D0ZA 2E12A 2CP7A 2HCKA 2PUKB 1PKSA 2KRSA 3JCMc 1X2QA 1PSFA 3CMAA 5DLOA 3QO3A 2COZA 1Y0MA 2MI6A 1JXOA 3EGXA 3PMIA 4LDVA 1VIFA 3VRZA 2RO0A 3JCMW 2LP5A 2F5TX 3G71T 3VS2A 2MOXA 1VQ6A 2DZ9A 1VQ4Q 4BE0A 3I55T 1YIJT 2L3QA 4IUPA 3OBWA 1Z9ZA 5LJ5j 1YITA 1RAIB 5KYUA 1W1FA 3PIOA 1X2KA 2KXCA 1AWOA 5I2SA 4YTLA 4XQ3A 2QGFB 4M75A 3H8ZA 4B9WA 4FSXA 1BI1A 2IVWA 2EQUA 3ULRB 3SWNC 3QYHB 2YUOA 1VQPT 1K8AC 1LJOA 1K8AU 1UFFA 2K3XA 1SF9A 4ZNXA 5GAMf 1T3SA 3OYEA 5AYFA 1IXDA 4DBFA 1VQMA 3VS3A 4M78C 2L5QA 2RI5A 2QQ9A 3OBYA 4Q5WA 5FWCA 1Q82C 3GF5A 3EH1A 2P4TA 1FMVA 3OYNA 1VQ5A 1RL2A 1NBEB 2MWPA 2RJFA 2RK2A 3DKMA 5ECAA 3X25B 1E6GA 2VXEA 3QKJA 4R55A 1UGPB 2KNBB 3SFMA 3JSCA 1MV0B 3C4SA 4Z02A 1MMGA 4F16A 3I56Q 1V1CA 1VQ8Q 2HSPA 4ZN3A 2E6ZA 5L8RE 1KHCA 1GL5A 3FB9A 2DPPB 2QK0A 4BD3A 3VS7A 2XDDA 1I4K1 4QT7A 2RN8A 2E1HA 4PJOF 1CSKA 3GOXA 1WZOA 4CC4B 2KDSA 3CC4A 2JTFA 2P4RA 3VYGA 2RM4A 2QQBA 4IIMA 2VXFA 2LCCA 1R77A 4J9BA 3HL8A 2D6FA 3LH0A 4FYWB 2FEIA 2E5KA 4EIKA 2RJDA 5KH6A 3ZL7C 2EYYA 1UGSB 2I2LA 3NFCA 4E6RA 1E7OA 3A1PA 2PVGB 3CCUQ 1YJNT 4D8DA 1SSFA 1Q7YC 2A37A 5GAMh 1Q7YU 1W6XA 4DBQA 3TCJA 3CBPA 1Y7XA 4IUVA 5KE3A 1VYVA 3HRSA 1R8OB 1NG2A 5FU6C 4PL6A 2FZCB 4C92D 2HL3A 3CC2Q 3CCQQ 2RQTA 3H9NA 4M78G 1X69A 2QASA 1NZ9A 2A28A 1WPYA 1W2BP 2O4XB 1UDLA 4J8OA 1YHQA 2KRMA 2VASA 3C95A 1NEBA 1D1BA 4HA8A 2AK5A 5GAN4 1NJIC 1NJIU 1HSQA 5GMKi 1VQOQ 2A7YA 4X9CA 2BZ8A 3PVLA 4M77B 4AG2C 1AWXA 4C92C 3SEMA 1LVKA 4OMMA 3PFSA 1ZA2B 1A0NB 5KYNA 5CK9A 4M7AD 2F2WA 3SDZA 3MPUB 3E9FA 5GAMg 4ZTFA 1OZ2A 3JB9G 1U1SA 1FYNA 1MUZA 5LJ5f 5CKEA 3QUIA 2DXCA 2DXBA 4XU2A 3OYBA 2OJ2A 2OTJA 2JS0A 2DTHA 3CCRT 4N0AC 4OGEA 5GAMe 4C0GA 4OVAA 1VQNQ 3NTKA 4M7DB 2YUPA 4O6JA 2JMAA 1UJYA 1I5OB 2W0ZA 2J05A 4M7AC 1QLYA 2YDLA 4C0DB 1IHWA 5A0DA 1IO6A 2QG9B 5LJ3g 1W2BA 4IIOA 2XDBA 1M2VB 1WHGA 3QZ9B 3CXCP 4XTVA 1PRMC 1M8VA 1XQHA 1HD3A 4V2SA 1B07A 4HT9A 4NL2A 2P84A 5EG2A 3JAME 2QEXA 1AD5A 4NL3A 2ZCFB 1W4SA 2DL7A 2X3XD 4DBRA 3C94A 4GBQA 2PVDB 4CC7A 4C8QF 4E7ZA 2MIOA 4HT8A 5KE2A 4EDUA 3V8JA 1UB4A 4JZ3A 1D1AA 3OW2P 4PNOA 1C1AA 2O31A 3O8VA 2CZ7B 3EG3A 1GRIA 3I5SA 4EMKB 5IXFA 3OB9A 3CMAT 2EQJA 4C92G 5DY9A 1PD0A 4JS4A 2RMOA 4E7JA 2DEQA 1OPKA 3CC7A 1V76A 3EGDB 1ZQ1A 5LJ5h 3CXCA 4PFPA 1VQKA 2JJ9A 2EBPA 1VQ6T 2CH4A 2LCSA 1MGQA 3TVTA 3RESA 4J5YA 1QVFS 4II1A 3TSZA 1G3SA 1YITT 1M1FA 4RTWA 1BIBA 3QWXX 2MMPA 1YJWQ 4LD9K 3CPFA 1OV3A 1ZHIA 2DO3A 3HRTA 3UDCA 2OAWA 4L5GA 2CP2A 1S72A 4M7AG 4JS5A 2O88A 4ESRA 2LQWA 3FJPA 1QVFA 3ER0A 3EFSA 4FYXB 4Z8AA 3CCJQ 1LCKA 1UHCA 2LNVA 3HHTB 4J7IA 4MZTA 4AG1C 1M2OA 2QQAA 3L2QA 2KBTA 3OW2A 3FRNA 1JXMA 3LGLA 3JB9J 2EGAA 4IUTA 2M0YA 1VQMT 4TVRA 3CCMA 2ROLA 5LJ5g 3D7SB 1JBMA 4AT1B 1QCNA 1W70A 2BTTA 1M9SA 5LJ3d 2I0NA 1Q95G 1VQ5T 2JNGA 5LJ5e 4FU6A 1RLPC 3QWYA 4DBHA 4PJNA 4ME7A 2GCXA 2RHYA 4OMOA 4ELZC 3X26B 4M77D 3I56A 5HK0A 4ORZA 1VQ9Q 1WHKA 1TS9A 1WJSA 3LX7A 1X75C 2H8HA 1OZ3A 3RKYA 2CSIA 2HBWA 1RADB 4O5VA 2CSQA 4K11A 1MMDA 4KGXB 2XHCA 1MHNA 2PZ1A 5CQYA 3G7ZA 2C06A 4RG2A 1YJ9Q 1FWZA 3CC4T 2OTLA 1NLOC 2EGCA 4IUQA 2X4JA 4E47A 4WF2A 5GJVB 2E64A 4M75E 3LGFA 2LCLA 2VGMA 2O4XA 1IB8A 3SWNB 3A98A 3OYLA 1WX6A 3CPWP 4ANJA 3EFOB 5IHIA 2YXYA 4XTWA 3E9GA 3J7AF 1G2BA 3OSSC 4LE9A 1BBZA 1QVGS 1BU1A 4M77A 3LH5A 3LLRA 2PNIA 1M30A 2A0FB 2HKNA 3CCQA 3LWIA 1PCXA 3A8MB 2LQNA 1JQQA 2VYTA 1PRLC 1QVGA 5GAOl 1OI1A 1AT1B 4B9XA 1YHQT 4IURA 2CKKA 3EAEA 3LWHA 2L2PA 4RMOA 2DEUA 2R5AA 2DBMA 3CCLA 4M7DA 2DL8A 4Y28E 1ZSZC 1KQ2A 4HXJA 1ABQA 2YRDA 3LYIA 1TU0B 3KFVA 4OMFB 2M0OA 1U1TA 3E2UA 1YN8A 4J6WA 3PMTA 4XTZA 2GTOA 1K9MC 1K9MU 1M2VA 1N5ZA 3CPWA 2YT6A 2M1HA 1BK2A 2DMOA 3SB2A 4A4HA 4MDXA 2G3RA 2OTJT 3RMSA 2BZXA 1VUBA 1JU5C 1TUDA 4KGZB 5LJ3j 3RMQA 1SRMA 4JJCA 3TQ7P 1KC8C 1KC8U 3VUBA
chains in the Genus database with same CATH topology
4BY6C 3MEVA 1DJ7B 4KT0E 5GMKh 3OYEA 5AYFA 4HCCA 2EJ9A 2XICA 1M4ZA 4HKEA 3JCMQ 2M16A 1VQMA 4M78C 2L5QA 1QW1A 1YCYA 2XKOC 3C12A 3L2UA 2RI5A 1YJ9T 3ME9A 2PUOB 2QQ9A 2Y4YA 3OBYA 4Q5WA 3GF5A 4IUUA 2WACA 2K3YA 4C5GA 1Q82C 4IKFA 1W2BS 3UWNA 2P4TA 2XD0A 3L42A 4PLIA 1VQ8A 1WQ7A 5CAIA 2VC8A 1ZBXA 3QHSA 2V8KA 2KVQG 4JJNK 2QDYB 4BI8B 4OB2B 3OYNA 1VQ5A 1RL2A 4NS5A 2BUDA 2MWPA 3L2RA 2RJFA 2RK2A 5GAN5 4XU3A 3DKMA 3OYAA 2CS7A 1O75A 3X25B 4EMKA 4PJOE 3ZEHA 2VXEA 3M5AA 3META 4XU1A 3JB9F 3QKJA 2QEXT 3OQ5A 4KUDK 3QSUA 4F7UE 3M4YA 4R55A 1UGPB 2ZPFB 3FDRA 3JSCA 3LW5E 3SFMA 4F7UG 2RD1A 3C4SA 4Z02A 2JN0A 2EKOA 2IG0A 1M5Q1 3OSVA 5GAOr 2ZZDA 3OS0A 4PJOD 4RCCA 1UEBA 3MO8A 4ZN3A 2E6ZA 2LVMA 1KHCA 5L8RE 1KG1A 2H3JA 4BE1A 3FB9A 4ZGJB 2ZGWA 4R56A 2CGHA 2DPPB 3E19A 2QTXA 3M59A 3NTIA 3JCMh 4BD3A 1I4K1 1N9SA 1G3WA 1G3YA 3P8HA 1BI0A 3CCUA 2E1HA 1KHIA 4PJOF 3JB9H 3HPWA 3GOXA 1O9SA 2DJZA 1VQ7A 2K5IA 2DD4A 4RKUE 3HSBA 4QW2A 5GANf 2KDSA 3A8LB 4XTYA 3BFMA 5GANg 3CC4A 3OYYA 2XU8A 1YJWT 2JTFA 4J6XA 3JCMV 3VU3C 1LOJA 3VYGA 2RM4A 4OB0B 3X20B 5D6YA 5GMKe 2QQBA 2RH2A 4M78B 4ELYC 2RHIA 2VXFA 2LCCA 2D6FA 3HL8A 3LH0A 4PJOC 3CC2A 3CC7T 1N9RA 1K73C 2LRQA 1K73U 2RJDA 5KH6A 2R58A 3S3OA 1VQKT 1UGSB 2I2LA 3NFCA 5HKCA 1BI2A 4XU0A 3CCJT 2YLCA 5CKHA 1M1KC 1M1KU 3CXCS 2PVGB 2WSCE 2RI2A 4C92E 1YJNT 1BIAA 3G4ST 3AHUA 3V7SA 3JCMd 3QYGB 1SSFA 4M7AB 3MP1A 1Q7YC 5GAMh 1Q7YU 5KCHA 2DXTA 5GAN6 3TCJA 2LT4A 1Y7XA 3CBPA 4EPCA 4IUVA 4BI4A 5GAN7 3A8GB 5KE3A 3CMET 5GAN2 1VQOA 2D9TA 3HRSA 1R8OB 1G3TA 1QP2A 3MEUA 4XTUA 4PL6A 3KUFA 5FU6C 1BKBA 4C92D 1S72T 1WJQA 5CVIA 2JVVA 3QDRB 4M78E 3HKSA 4VUBA 1OYXA 2QI2A 1NE8A 4P5NA 4M78G 5IAYA 3S3MA 5LL6S 4C0DC 4MMKA 2X35A 1NZ9A 1XTDA 4J7FA 1WPYA 4Y91A 3OYJA 3A8HB 4RG8A 4E7LA 1H641 2O4XB 1YHQA 4J8OA 5D6WA 3OYHA 1X01A 3VYHB 3C95A 2ZPBB 4EMGA 3QBYA 4E7HA 3M57A 4HA8A 4M78D 3BY7A 4QQ6A 5GAN4 3J81E 4A4KA 2L3RA 1NJIC 1NJIU 3HRUA 4RCBA 3OW2S 1Q81C 1Q81U 3GIBA 5GMKi 4M7AE 2PVOB 1G5VA 4JRQA 2A7YA 4X9CA 4D6WA 5GAMd 2KQWA 3G71A 3CCMT 2LQKA 1AHJB 4L59A 4M77B 1VQ9T 4C92C 3I55A 3G6ET 2KAFA 4FM4B 1YIJA 3PFSA 1VQNA 3OYDA 2XI9A 4HCZA 4JRIA 3PTAA 2XDPA 2CYZB 5CK9A 4M7AD 2R5MA 4EMHA 3CEYA 3L2ZA 4KULA 2DXUA 2MF2A 3SDZA 3E9FA 5GAMg 4ZTFA 2HNIA 1M1GA 1M90C 3OS5A 3PNWC 1OZ2A 4OB1B 1M90U 2VGNA 3OYKA 3OYGA 3JB9G 1N6AA 3V8LA 1U1SA 5GAOn 2A3LA 4C8QB 5LJ5f 4LDUA 5CKEA 4XK8E 5A0LA 4M7AF 3QUIA 2DXCA 3L1AA 2DXBA 1KQSS 4XU2A 3OYBA 3QIIA 2OTJA 2QQSA 2DTHA 4KUIA 5I21A 5GANh 4N0AC 4OGEA 3CCRT 3I56T 2EYQA 1Q82U 3BDLA 5GAMe 3UT1A 5C0MA 2K5LA 3JB9D 4C0GA 4OVAA 1VQPA 3BDUA 2Y90A 2ZPGB 3NTKA 4M7DB 2BIVA 4BUGA 5FU6B 3OYIA 4NOYA 4O6JA 3X28B 4EMKC 2CZ1B 5CKFA 4QVCA 3GP8A 2L89A 1Y71A 4GY5A 4MDWA 1KQSA 2E65A 4M7AC 4C0DB 3CCVT 5A0DA 5LJ3f 4PJOG 2HD0A 5LJ3g 1W2BA 3DLMA 1NPPA 3JCMb 5J26A 1YJ9A 2K57A 2XDBA 3QZ9B 5FU7B 2HQXA 1HXDA 4XTVA 1M8VA 1N8RC 2XG8D 1N8RU 2QXFA 2WSFE 5GMKj 5FRMA 1XQHA 2X4YA 3RIRA 2B8AA 4C0FA 2RJEA 2OTLT 4V2SA 4M75B 2E10A 5KCOA 3GLXA 2EAYA 4HT9A 5GANd 3Q1JA 3R6OA 5CKDA 2DAQA 4M77F 1FX7A 1Y96B 3MEWA 4MMLA 4NL2A 2K4YA 3M53A 3QG1A 4DOWA 3CD6T 4X9DA 5GAN3 2VUBA 5EG2A 4C8QD 4FT4A 3JAME 2QEXA 5CR2A 2LC4A 4NL3A 2X4XA 2XDDA 2ZCFB 1EIFA 1W4SA 4LDXA 3C94A 1B34A 2FL7A 3S3NA 3FIFA 3P8BB 2PVDB 4M77C 4C8QF 3VKIA 4M7DD 5DLQE 1KD1C 1KD1U 4HT8A 2CZ0B 4J83A 3T9NA 3CBOA 4MZPA 5KE2A 5DM7R 2EWNA 4EDUA 4A4FA 3V8JA 4CRIA 1UB4A 3CCQT 2LT1A 3P8DA 3OMGA 3J80E 4E7KA 2DIGA 3UPUA 1YI2T 3E1SA 4PNOA 3CCET 4LDYA 1VQ4T 4BB7A 5GANe 3QJ6A 1D3BA 2ZPIB 4M7DF 1JB0E 3O8VA 3MCAB 3RKXA 2CZ7B 2LDMA 4C8QC 4JUVA 4EMKB 3FEOA 3OB9A 5A2QE 2EQJA 3M4GA 3CMAT 1WNLA 1WGSA 4C92G 5DY9A 1YJWA 5GAOq 4JS4A 3QPHA 4M75D 3FLGA 4QQDA 4E7JA 1I5LA 2DEQA 3F70A 5J39A 1YBYA 3OS1A 2LTOA 4J6YA 2HAXA 4M7DC 3CC7A 2HBPA 2LQ8A 1ZQ1A 4JLGA 5LJ5h 3CXCA 3CCLT 4E7IA 4PJOA 1VQKA 2KSSA 1NPRA 5GMKm 3QXEB 3CCJA 2QA4T 4M75F 3SD4A 4F7UA 1VQ6T 3M55A 1MGQA 3CCST 1YJNA 3G4SA 4JDSA 3HFOA 3RESA 2DK3A 4J5YA 4II1A 1QVFS 1G3SA 4LD6A 2DTIA 1YITT 1M1FA 1VQLT 1BIBA 4OP0A 5FU7C 2MMPA 2LX9A 3GNFB 3RKWA 3JCMX 4LD9K 2XK0A 4JRKA 3CPFA 2DVEA 4PLLA 1ZHIA 4A4EA 2DO3A 3CMEA 3HRTA 3UDCA 2FB7A 4M75C 4QQGA 2RHZA 2D0QB 2DIQA 5LJ3h 2K2VA 4L5GA 2F69A 3ZBDA 4QVDA 4ZGDB 1S72A 4M7AG 3OYMA 1VIEA 4N4IA 3CPWS 4JS5A 1LNXA 3DB3A 4ATOA 1HK9A 4A53A 5GAMj 3FJPA 4BDYA 1QVFA 3ER0A 4MZMA 4N4HA 2DZCA 2JTMA 3EFSA 3RUXA 4C5EA 4BDZA 3EFRA 4LDWA 2GF7A 2FVUA 2GQVA 2VV5A 2LNVA 5LJ5d 4CI0C 1Y07A 3A8OB 2ZPHB 3HHTB 5CCAA 3M56A 4J7IA 3MP6A 4MZTA 3ASKA 2QQAA 3L2QA 3OW2A 1D3BB 4XAXB 3FRNA 1KQ1A 2FYKA 1PSEA 2K5FA 3LGLA 3WVDB 3JB9J 1H3ZA 4IUTA 5CO7A 3OYCA 4A4GA 4BI3A 4FT2A 5HK3A 1VQMT 2YHTA 1WJRA 4TVRA 1N27A 3CCMA 2BKDN 1BI3A 3A5ZB 5LJ5g 1QP3A 3V8KA 3PIPA 1JBMA 1IZ6A 2JOYA 1VQ9A 2OAUA 3RERA 2FHDA 4DA4A 3G6EA 2O01E 3TEEA 5FLXE 3QZ5B 5CQXA 3X24B 1M9SA 4UC4A 5LJ3d 2F5KA 1VQ8T 4C92A 3SWNA 4M77E 2KK4A 3MP8A 4OGCA 4GLKA 5IT9E 2KMTA 1U8RA 3L2VA 5GMKl 2MAMA 2YLBA 5C6SA 1VQ5T 2JNGA 4M77G 4N4GA 5CKBA 4F7UB 4HCBA 1I81A 5LJ5e 5IN1A 3L2WA 3GPLA 3M9QA 2KY9A 3DB4A 4FU6A 3VUZA 3KBGA 2AHJB 2HQEA 1IREB 3V7CA 4ME7A 2GCXA 4BE2A 2RHYA 5GAN8 2QQRA 4M78A 2EFIA 4ELZC 2P0QA 4M77D 3X26B 3CCRA 3I56A 4XTXA 3S6WA 4C8QE 3KXTA 5HK0A 2E41A 1WJSA 4N0AA 4C92B 4C8QG 3URGA 3VJPA 2DD5A 3LX7A 1X75C 3PT9A 1OZ3A 2RHUA 3WVEB 5LJ3e 3RKYA 5GAOm 5GANj 4M7DE 4FIBA 3GNGA 4O5VA 4DQ2A 3OS2A 3CCVA 1GXIE 4M7AA 2EQKA 4M7DG 1WQWA 5FROA 2XHCA 3CCUT 1MHNA 1V29B 4QVZA 3M54A 1VQLA 1VQ7T 5CQYA 3G7ZA 2C06A 4RG2A 1I8FA 1FWZA 2RHXA 1BYMA 4ZGEB 3CC4T 2JUFA 3CBMA 2OTLA 3JCMJ 2JZ2A 4OB3B 4IUQA 2V8IA 2X4JA 4DOVA 4E47A 4WF2A 2RJCA 2WSEE 3CC2T 5CIUA 1UGQB 1JJ2S 3CD6A 2E64A 4M75E 2LCLA 2VGMA 3LGFA 2O4XA 1Q86C 3N5BB 3SWNB 2L8DA 5M9OA 3V7RA 1Q86U 3OYLA 2RA2A 2X4WA 4M75G 4OF1A 3JCMP 3VV0A 2P0PA 2V8JA 4C5IA 2EJFA 3H6ZA 5D6XA 4F7UF 3OYFA 1XNIA 2EQMA 3E9GA 4XTWA 4BY6B 3J7AF 3M58A 3MHXA 3INZA 3OSSC 1FXXA 1JJ2A 1XOVA 1QVGS 1JRIA 2MWOA 4M77A 3MEAA 3LLRA 4ZTJA 3JRZA 1VQOT 4FL6A 2PQWA 2E70A 4JLIA 3CCQA 3LWIA 3WXMB 2R57A 2NLUA 2PU9B 1P92A 2M9UA 4C5HA 3FC3A 1YI2A 3CCEA 1VQ4A 4X34A 2E5QA 2E12A 3A8MB 2PUKB 2VYTA 3TREA 3HP9A 3JCMc 2DTOA 1PSFA 1QVGA 2P0KA 3OMCA 3CMAA 5DLOA 3QO3A 5GAOl 3NTHA 4C8QA 1OI1A 4A54A 4C0ZA 4B9XA 3OY9A 1YHQT 5I2MA 4IURA 2CKKA 3EAEA 5FRNA 2MI6A 2RB6A 3LWHA 3PMIA 3ZFJA 1QVPA 4LDVA 4RMOA 1VIFA 2R5AA 3QJYA 1B34B 3TU4K 3CCLA 2RO0A 3JCMW 2CZ6B 2YRVA 2Y4XA 4M7DA 4L6V5 3JCMf 4Y28E 2F5TX 3G71T 3JCMg 1KQ2A 2QA4A 1VQ6A 1UGRB 2DZ9A 3CCSA 4BE0A 1VQNT 3I55T 1YIJT 4KBMB 3LYIA 3JB9I 2M0OA 1U1TA 3OBWA 4IUPA 3HFNA 4OMFB 4BACA 2E6NA 4J6WA 4C92F 2GFAA 2EJGA 2GFUA 3PMTA 4PKCC 4XTZA 5LJ5j 5GAOp 1YITA 1K9MU 1K9MC 3PIOA 3CPWA 5HY6A 3OA6A 3JCMe 5I2SA 4YTLA 3DLLA 2M1HA 4XQ3A 3PGGA 3H8ZA 4M75A 2EIFA 3BW1A 3SB2A 4A4HA 4MDXA 4B9WA 1RI0A 4FSXA 1X6OA 1BI1A 2G3RA 2IVWA 2OTJT 2XIDA 2EQUA 2ZPEB 3RMSA 4ZN1A 4M78F 4JRPA 3SWNC 1VUBA 1Y96A 3QYHB 2RK1A 1VQPT 2DKGA 5A0GA 4PJOB 5J3BA 5LJ3j 3RMQA 1LJOA 2RI3A 1K8AU 1KC8C 2K3XA 1KC8U 1K8AC 5GAMf 1TH7A 3VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ7 B;  4KT0 E;  1DJ7 B;  3VYH B;  1V29 B;  2ZPB B;  4ZGE B;  2PUO B;  2PVO B;  4OB3 B;  1AHJ B;  4FM4 B;  2WSE E;  2QDY B;  1UGQ B;  3QXE B;  4OB2 B;  2CYZ B;  3X25 B;  4OB1 B;  1UGP B;  2ZPF B;  3LW5 E;  4XK8 E;  2DXC A;  2DXB A;  2D0Q B;  4ZGD B;  2ZZD A;  2PU9 B;  2ZPG B;  5L8R E;  4ZGJ B;  3A8M B;  2PUK B;  3X28 B;  3A8O B;  2DPP B;  2ZPH B;  3HHT B;  2CZ1 B;  1PSF A;  1PSE A;  3WVD B;  2DD4 A;  4RKU E;  3A8L B;  3QZ9 B;  1QP3 A;  4OB0 B;  3VYG A;  3X20 B;  2WSF E;  2CZ6 B;  2O01 E;  4L6V 5;  4Y28 E;  3QZ5 B;  3X24 B;  1UGR B;  1UGS B;  2PVG B;  2WSC E;  2ZCF B;  2AHJ B;  3QYG B;  1IRE B;  3X26 B;  2PVD B;  3A8G B;  1QP2 A;  2CZ0 B;  2ZPE B;  3QYH B;  2DD5 A;  3WVE B;  2ZPI B;  3A8H B;  1GXI E;  1JB0 E; 
#chains in the Genus database with same CATH topology
 4BY6 C;  1VQL Q;  1M4Z A;  1JJ2 P;  2JT4 A;  1YCY A;  3C12 A;  4JJB A;  2PUO B;  3PVQ A;  4C5G A;  3L42 A;  4PLI A;  5CAI A;  2KVQ G;  1MND A;  2BUD A;  1RAF B;  2FZK B;  2CS7 A;  4EMK A;  1OU9 A;  3M5A A;  3MET A;  1RAA B;  4XU1 A;  1RAE B;  2QEX T;  3OQ5 A;  1UEC A;  3FDR A;  4F7U G;  3AT1 B;  2RD1 A;  2CRE A;  2F2X A;  3EGD A;  4AFQ C;  5GAO r;  3OS0 A;  2RQV A;  4PJO D;  1UEB A;  2ATC B;  3MO8 A;  2QAZ A;  2GGR A;  1KG1 A;  2ZGW A;  1K8A R;  5KYW B;  2D0N A;  1JO8 A;  1GCP A;  2QTX A;  4C92 B;  1N9S A;  1G3W A;  2L3P A;  3CCV Q;  2NUT B;  2DET A;  1VQ7 A;  2K5I A;  4XTY A;  5GAN g;  3BFM A;  3OYY A;  1AWJ A;  2XU8 A;  4J6X A;  3JCM V;  1Q82 R;  8ATC B;  4OB0 B;  1R0C B;  2J6K A;  4PJO C;  2AT1 B;  2DLP A;  3CC7 T;  5FWB A;  3S3O A;  3FJ5 A;  1VQK T;  5HKC A;  1BI2 A;  4XU0 A;  1M1K C;  2K7A A;  2NUP B;  1M1K U;  2JMC A;  4J9H A;  4C92 E;  1E6H A;  4M7A B;  3MP1 A;  1RAC B;  2J6F A;  5GAN 6;  1GBQ A;  2J7I A;  5GAN 7;  5KYX B;  4XTU A;  1SPK A;  1S72 T;  1OOT A;  2JVV A;  1OYX A;  1NE8 A;  1YI2 Q;  3NPF A;  3CCE Q;  2RNA A;  4AFZ C;  3OYJ A;  2ED0 A;  2K9G A;  1SRL A;  3CQT A;  1GCQ C;  3VYH B;  3EG1 A;  2HMA A;  2ZPB B;  4EMG A;  2F2V A;  4M78 D;  3BY7 A;  4J9C A;  3J81 E;  4A4K A;  4M7A E;  4RCB A;  4X1V A;  3GIB A;  1H3H A;  2E4H A;  3CCM T;  2DFU A;  1JEG A;  4L59 A;  1OU8 A;  4FM4 B;  2QA4 Q;  1NLP C;  3CCS Q;  4F04 B;  2CYZ B;  1KSW A;  2DXU A;  2L3S A;  1M90 C;  1M90 U;  1Q7Y R;  2FRY A;  2HDA A;  2HL5 C;  3V8L A;  4DEY A;  5GAO n;  2A3L A;  2DRM A;  4LDU A;  2ROT A;  3QII A;  5I21 A;  3G71 Q;  1Q82 U;  3I56 T;  3JB9 D;  5C0M A;  1K0X A;  3BDU A;  2ZPG B;  1WXU A;  3I55 Q;  1YIJ Q;  1ZX6 A;  2BIV A;  1H92 A;  3OYI A;  4E7S A;  3EFO A;  2O9S A;  3GP8 A;  1WHJ A;  4GY5 A;  4MDW A;  1RLQ C;  5LJ3 f;  2QYZ A;  2HD0 A;  4PJO G;  3DLM A;  2V26 A;  4PFZ A;  1NPP A;  3JCM b;  1NJI R;  1YJ9 A;  2FRW A;  1UTI A;  2WSF E;  5GMK j;  2X4Y A;  3RIR A;  4C0F A;  2JXB A;  2OTL T;  1VQP Q;  2DJQ A;  5GAN d;  1YNZ A;  4CC3 A;  1UJ0 A;  1Y96 B;  3M53 A;  4JPB W;  2VUB A;  3EG2 A;  4C8Q D;  4FT4 A;  1NYF A;  4PJM A;  2LC4 A;  2X4X A;  4J9D A;  5HCK A;  4LDX A;  1R0B G;  3S3N A;  3P8B B;  1KD1 C;  1KD1 U;  4J83 A;  4MZP A;  2E3I A;  2MK5 A;  4Y92 A;  3BE3 A;  3CCQ T;  1SSH A;  3E1S A;  4LDY A;  4BB7 A;  2ZPI B;  1JB0 E;  1RAB B;  3RKX A;  2QTV A;  4C8Q C;  3M4G A;  2KT1 A;  2BE9 B;  4QQD A;  1I5L A;  3F70 A;  1YBY A;  1GBR A;  2HAX A;  2GBQ A;  4JLG A;  3CCL T;  1C6V X;  5AT1 B;  1VA7 A;  3RDV A;  3QXE B;  4M75 F;  2ABL A;  2V1Q A;  3M55 A;  3G4S A;  3UA6 A;  2DK3 A;  4LD6 A;  2DTI A;  5FU7 C;  3RKW A;  4A4E A;  4PLL A;  4FW1 A;  2FB7 A;  5LJ3 h;  3ZBD A;  2K2V A;  4QVD A;  2F69 A;  4ZGD B;  3RNJ A;  3OYM A;  3DB3 A;  3MJX A;  4N4H A;  2JTM A;  3RUX A;  1UGV A;  4LXC A;  4LDW A;  2GF7 A;  1X6G A;  1SHF A;  1Y07 A;  4CI0 C;  1D3B B;  2FYK A;  5IHN A;  1H3Z A;  4PK4 A;  3WVD B;  4AMC A;  2KE9 A;  4FT2 A;  4HCC A;  3PIP A;  2ED1 A;  2JOY A;  3G6E A;  2O01 E;  1D1C A;  1SG5 A;  3QZ5 B;  3X24 B;  2VKN A;  2AIR B;  4C92 A;  2GNC A;  4M77 E;  4OGC A;  3MP8 A;  4GLK A;  2KMT A;  2NUT A;  1U8R A;  2MAM A;  5C6S A;  4N4G A;  4F7U B;  2KI7 A;  1I81 A;  4Z89 A;  3KBG A;  2AHJ B;  3V7C A;  1TXQ A;  4B6M A;  2RQR A;  4XTX A;  3KXT A;  4N0A A;  4HCK A;  4C8Q G;  2GQI A;  3HTR A;  2DD5 A;  2NUP A;  2RQU A;  5LJ3 e;  1ZSZ B;  5IHK A;  5GAN j;  4M7D E;  3CCV A;  3GNG A;  1GXI E;  2F1L A;  4M7A A;  2EQK A;  3SHW A;  5FRO A;  4QVZ A;  3M54 A;  2RF0 A;  1VQ7 T;  3H41 A;  2NWM A;  1KIK A;  5KYX A;  2LMJ A;  2RHX A;  3CCR Q;  2JUF A;  2FPE A;  1QVF P;  3JCM J;  2JZ2 A;  2YUN A;  4DOV A;  2RJC A;  1T0H A;  1UGQ B;  2DL3 A;  1QQJ A;  5IXB A;  1Q86 C;  1Q86 U;  4LUE A;  2IIM A;  4OF1 A;  1AEY A;  2P0P A;  4C5I A;  4GLM A;  2FO0 A;  2CP5 A;  3EHR A;  1XNI A;  1ZLM A;  4BY6 B;  2CH4 W;  3MHX A;  1AVZ C;  1XOV A;  4CC2 A;  4FL6 A;  1TWB A;  2DRK A;  3G1J A;  3M0R A;  1YCS B;  2R57 A;  2PU9 B;  1YI2 A;  3CCE A;  1VQ4 A;  1PHT A;  4M4Z A;  2E5Q A;  1TUG B;  2COW A;  3TRE A;  3HP9 A;  1RAH B;  2DTO A;  1U06 A;  2FPF A;  2P0K A;  3OMC A;  3M0Q A;  3NTH A;  1OUL A;  3VS4 A;  3ZFJ A;  1H8K A;  3QJY A;  3TU4 K;  2EGE A;  3REB B;  2Y4X A;  4L6V 5;  4WTO B;  2C0T A;  4RTX A;  3JCM g;  2QA4 A;  3H0H A;  1PNJ A;  3CCS A;  4KBM B;  3JB9 I;  2B86 A;  1LPL A;  4BAC A;  2HSE B;  1WHM A;  4C92 F;  2GFU A;  2EJG A;  4PKC C;  2W10 A;  3CMA Q;  1QKX A;  5HY6 A;  3OA6 A;  3JCM e;  3CME Q;  1HYO A;  3BW1 A;  1RI0 A;  2KYM A;  2XID A;  2ZPE B;  4ZN1 A;  4JRP A;  4FCY A;  1Y96 A;  2RK1 A;  2CP3 A;  4OMP A;  2LJ3 A;  4PJO B;  5A0G A;  5J3B A;  2GTJ A;  1YIT Q;  3MEV A;  4KT0 E;  5GMK h;  1PWT A;  3JCM Q;  2FG0 A;  3UAT A;  2M02 A;  2XKO C;  1YJ9 T;  3ME9 A;  3EGX B;  2CT3 A;  4IUU A;  3UWN A;  1VQ8 A;  2L0A A;  1ZBX A;  1SEM A;  4JJN K;  2QDY B;  4FYY B;  4BI8 B;  3C0C A;  1RAG B;  1QVG P;  4KRT A;  4XU3 A;  1O75 A;  4PJO E;  3ZEH A;  1K9M R;  1UE9 A;  1VQM Q;  2ZPF B;  2JN0 A;  2EKO A;  1M5Q 1;  1MV3 A;  3OSV A;  2LZ6 B;  2NUZ A;  1WHL A;  1KFZ A;  2H3J A;  3JV3 A;  1VQ5 Q;  1KC8 R;  2CP6 A;  2CGH A;  3E19 A;  3NTI A;  3P8H A;  3CCU A;  8AT1 B;  1O9S A;  2DJZ A;  2CUB A;  1PC0 A;  2DD4 A;  4RKU E;  3HSB A;  5GAN f;  1K0S A;  1EFN A;  2ESW A;  4LUD A;  3VU3 C;  3X20 B;  3PE0 A;  5D6Y A;  5GMK e;  2RH2 A;  4M78 B;  4ELY C;  2RHI A;  3CC2 A;  4RTU A;  1K73 C;  1AZE A;  2LRQ A;  1K73 U;  2R58 A;  3RBB B;  4KGV B;  3CD6 Q;  2EYW A;  2H3E B;  2RI2 A;  4FYV B;  1BIA A;  3G4S T;  3AHU A;  3JCM d;  2COY A;  3QYG B;  4OMQ A;  3H0I A;  2EYX A;  5KCH A;  2DXT A;  1K4U S;  3H0F A;  4BI4 A;  1VQO A;  2D9T A;  1G3T A;  5CVI A;  4JJD A;  3QDR B;  4M78 E;  4VUB A;  5IH2 A;  2QI2 A;  2IPO B;  4P5N A;  2YRC A;  4C0D C;  1KQS P;  2O9V A;  2X35 A;  1QCO A;  1XTD A;  3A8H B;  4RG8 A;  1H64 1;  3QBY A;  3M57 A;  1NEG A;  2L3R A;  1Q81 C;  1OX9 A;  1Q81 U;  2PVO B;  1G5V A;  1M3B A;  4JRQ A;  1BCM A;  1TSF A;  4D6W A;  2KQW A;  2LQK A;  1ZSZ A;  3G6E T;  1VQN A;  3RR6 A;  3OYD A;  2XI9 A;  4JRI A;  1BCO A;  3PTA A;  1M1K R;  4HVV A;  2XDP A;  1EX4 A;  1PM3 A;  2R5M A;  4EMH A;  3CEY A;  3L2Z A;  4KUL A;  2C0O A;  1YHQ Q;  1M1G A;  3PNW C;  4OB1 B;  2VVK A;  3OYG A;  1N6A A;  2FZG B;  3EG9 B;  4C8Q B;  5A0L A;  4XK8 E;  1KQS S;  2QQS A;  4KUI A;  5GAN h;  2K2M A;  3UT1 A;  2K5L A;  1U5S A;  4J9I A;  5FU6 B;  3VS0 A;  3THK A;  4NOY A;  4EMK C;  1Y71 A;  4D8K A;  2E65 A;  3IQL A;  1TUC A;  3CCV T;  1KQS A;  5J26 A;  1AOJ A;  1VYU A;  4QKU A;  5FU7 B;  2HQX A;  1N8R C;  2XG8 D;  1N8R U;  2QXF A;  2OTJ Q;  5FRM A;  2B8A A;  2RJE A;  3VS1 A;  1TOV A;  5KCO A;  4J9E A;  5CKD A;  2DAQ A;  4M77 F;  1FX7 A;  2K4Y A;  3QG1 A;  4DOW A;  4X9D A;  5GAN 3;  1YP5 A;  1M90 R;  5CR2 A;  2KT8 A;  2KYB A;  1ZA1 B;  1M8M A;  2Z0W A;  2EKH A;  2FL7 A;  4Z88 A;  2D8H A;  3VKI A;  3CBO A;  5DM7 R;  2EWN A;  4OMN A;  4CRI A;  2LT1 A;  3J80 E;  4E7K A;  1NM7 A;  2DIG A;  1YI2 T;  3CCE T;  1VQ4 T;  1UG1 A;  1G83 A;  3QJ6 A;  5GAN e;  4M7D F;  2LDM A;  4JUV A;  5A2Q E;  1WGS A;  1YJW A;  3QPH A;  4M75 D;  1MMA A;  3FLG A;  2XMF A;  1M3A A;  2LQ8 A;  2CDT A;  2DYI A;  4E7I A;  4PJO A;  2KSS A;  1NPR A;  2SRC A;  5GMK m;  3CCJ A;  2QA4 T;  2QGG A;  3CCS T;  4JDS A;  1FMW A;  3HFO A;  3NHN A;  2AZS A;  3JCM X;  4OP0 A;  4FSS A;  2XK0 A;  3CME A;  2DVE A;  4PJJ A;  4M75 C;  3MKD A;  1KD1 R;  2C0I A;  4KH1 B;  1VIE A;  4N4I A;  3CC7 Q;  1LNX A;  4ATO A;  4A53 A;  1NYG A;  1VQK Q;  1ZBJ A;  4MZM A;  2DZC A;  3EFR A;  2BE7 D;  2FVU A;  2OX7 A;  3M56 A;  1PKT A;  1WYX A;  3O5Z A;  1GCQ A;  1K76 A;  1PSE A;  3REA B;  3OYC A;  4A4G A;  1YFN A;  1IGU A;  2YHT A;  1IZ6 A;  1QKW A;  1VQ9 A;  2OAU A;  1S72 Q;  5FLX E;  3TEE A;  5CQX A;  2LJ1 A;  4UC4 A;  1VQ8 T;  4JZ4 A;  3SWN A;  1WA7 A;  2YLB A;  2JM8 A;  3GPL A;  2CUD A;  4LNP A;  2DIL A;  9ATC B;  2K3B A;  5GAN 8;  4M78 A;  2EFI A;  4J9G A;  3CCM Q;  3S6W A;  2J6O A;  1WIE A;  1M27 C;  1M3C A;  3M0U A;  2QDL A;  3PT9 A;  2RHU A;  2LX7 A;  3OS2 A;  4DQ2 A;  5L23 A;  1QMC A;  1WQW A;  3CCU T;  2O2O A;  4KH0 B;  1SKU B;  1I8F A;  2BZY A;  2J06 A;  4OB3 B;  2LJ0 A;  2V8I A;  1I0C A;  3CC2 T;  3CD6 A;  2YSQ A;  3U23 A;  2RA2 A;  4M75 G;  1B3Q A;  3VV0 A;  1XJW B;  6AT1 B;  3M0S A;  1WFW A;  2EJF A;  3H6Z A;  1BB9 A;  1WI7 A;  2EQM A;  2EVR A;  1VYT A;  2MWO A;  2OTL Q;  4ZTJ A;  1VQO T;  1GFC A;  3WXM B;  4C5H A;  1KK7 A;  1P92 A;  3FC3 A;  4RTZ A;  1Y57 A;  4X34 A;  1IRX A;  2DL5 A;  1I07 A;  1UHF A;  1X6B A;  5EC7 A;  1YWO A;  3EG9 A;  1F1B B;  4C0Z A;  4A54 A;  4C8Q A;  2SEM A;  2YUQ A;  3OY9 A;  5I2M A;  5FRN A;  2RB6 A;  1QWE A;  1QVP A;  3I5R A;  3TSW A;  1B34 B;  2CT4 A;  2EPD A;  2CZ6 B;  2YRV A;  5I11 A;  4WCI A;  3JCM f;  1D0Y A;  1UGR B;  1Q86 R;  1VQN T;  1PD1 A;  2KRN A;  3EH2 A;  3HFN A;  5KYY B;  2E6N A;  1YJN Q;  5GAO p;  2GFA A;  1VQL A;  1TG0 A;  1EZZ B;  1IHV A;  2X3W D;  3DLL A;  3UA7 A;  2D1X A;  3PGG A;  3UF4 A;  2EIF A;  2K79 A;  3CCL Q;  4PFO A;  1X6O A;  1MMN A;  4M78 F;  2KGT A;  5KYW A;  1CKA A;  3GBQ A;  2DKG A;  4F17 A;  2RI3 A;  1TH7 A;  2RQW A;  2CP0 A;  1DJ7 B;  1S1N A;  2EJ9 A;  2XIC A;  3M0T A;  4HKE A;  2M16 A;  1QW1 A;  3L2U A;  2Y4Y A;  2WAC A;  2K3Y A;  4IKF A;  1W2B S;  2D8J A;  2XD0 A;  1WQ7 A;  2VC8 A;  3QHS A;  2V8K A;  4OB2 B;  4NS5 A;  3L2R A;  5GAN 5;  3OYA A;  2DER A;  3JB9 F;  4KUD K;  3QSU A;  4F7U E;  3M4Y A;  3LW5 E;  3NGP A;  2IG0 A;  2ZZD A;  4RCC A;  3VS6 A;  2LVM A;  5FW9 A;  4BE1 A;  4ZGJ B;  4R56 A;  2DNU A;  1QCF A;  1ZSG A;  3M59 A;  3JCM h;  1G3Y A;  1BI0 A;  1KHI A;  3JB9 H;  3HPW A;  2AKL A;  1OPL A;  1HJD A;  4QW2 A;  1MNE A;  3A8L B;  2MYS A;  1KJW A;  7AT1 B;  1YJW T;  1G8X A;  1QWF A;  1LOJ A;  3VRY A;  1N9R A;  1B7T A;  2G6F X;  1X27 A;  1AZG B;  2YLC A;  5CKH A;  3CCJ T;  3CXC S;  2WSC E;  1K1Z A;  2VB6 A;  2DM1 A;  3V7S A;  1VQ7 Q;  2X9H A;  1D0X A;  2LT4 A;  4EPC A;  3A8G B;  3CME T;  1AWW A;  1RUW A;  2ECZ A;  5GAN 2;  2DF6 A;  1QP2 A;  3MEU A;  3KUF A;  1BKB A;  1WJQ A;  3HKS A;  2X51 A;  2DYB A;  1WXT A;  2VWF A;  2KRO A;  5IAY A;  4DEX A;  5LL6 S;  3S3M A;  4MMK A;  1D09 B;  4RTY A;  4A63 B;  4J7F A;  4Y91 A;  4E7L A;  4J9F A;  5D6W A;  3OYH A;  1X01 A;  4E7H A;  2MPX C;  4QQ6 A;  4RTT A;  2OI3 A;  1ZUY A;  3HRU A;  3OW2 S;  1C0M A;  4FW2 A;  5GAM d;  3G71 A;  4PJL A;  3VS5 A;  1AHJ B;  1VQ9 T;  1K73 R;  3I55 A;  2KAF A;  1YIJ A;  1VQ6 Q;  4HCZ A;  3EG0 A;  4F14 A;  3M0P A;  2MF2 A;  4RUG A;  2HNI A;  1OQK A;  3OS5 A;  2VGN A;  3OYK A;  1OEB A;  2NYS A;  4M7A F;  4HVW A;  3L1A A;  1WXB A;  2K6D A;  2EYQ A;  2A08 A;  2HKQ B;  3BDL A;  1VQP A;  2Y90 A;  1T3L A;  4BUG A;  1CKB A;  5I22 A;  3X28 B;  2CZ1 B;  5CKF A;  4QVC A;  2L89 A;  2DE0 X;  3I9Q A;  2DA9 A;  5KYU B;  1Q81 R;  2K57 A;  2ZAE A;  1HXD A;  1UUE A;  2ENM A;  1ABO A;  4M75 B;  2E10 A;  2DX1 A;  4R0K A;  3GLX A;  2EAY A;  2V1R A;  3Q1J A;  3R6O A;  4MML A;  3MEW A;  3CD6 T;  4RTV A;  1YWP A;  1PG5 B;  2EQI A;  2KXD A;  1J3T A;  4E2F B;  1EIF A;  2A36 A;  1B34 A;  4AFS C;  1T0J A;  3FIF A;  1WLP B;  1SHG A;  4M77 C;  4M7D D;  5DLQ E;  2CZ0 B;  3T9N A;  1OX8 A;  4A4F A;  3P8D A;  3OMG A;  3EGU A;  5KYY A;  3UPU A;  1ARK A;  1D3B A;  3MCA B;  3FEO A;  1WNL A;  2E3H A;  5GAO q;  3CC4 Q;  2RPN A;  1N8R R;  5J39 A;  3OS1 A;  2LTO A;  4J6Y A;  1FMK A;  4M7D C;  2HBP A;  2JW4 A;  2YWW A;  1ZUK A;  3SD4 A;  2JTE A;  4F7U A;  1YJN A;  1WDX A;  1U3O A;  1VQL T;  2LX9 A;  3GNF B;  2JS2 A;  2AZV A;  4JRK A;  3EHQ A;  4QQG A;  2RHZ A;  2D0Q B;  2DIQ A;  3CPW S;  5D7U A;  1HK9 A;  5GAM j;  4BDY A;  4BDZ A;  2DBK A;  4C5E A;  2GQV A;  2VV5 A;  5LJ5 d;  3A8O B;  2ZPH B;  5CCA A;  3G4S Q;  3MP6 A;  3ASK A;  4XAX B;  5GJW B;  1Z9Q A;  1KQ1 A;  2K5F A;  1RI9 A;  5CO7 A;  3QDF A;  4BI3 A;  5HK3 A;  1GFD A;  1WJR A;  1N27 A;  2BKD N;  1BI3 A;  3A5Z B;  1QP3 A;  4OML A;  3V8K A;  3RER A;  1IGQ A;  2FHD A;  4DA4 A;  2F5K A;  2KK4 A;  5IT9 E;  3L2V A;  5GMK l;  4M77 G;  5CKB A;  4HCB A;  5IN1 A;  4HVU A;  3L2W A;  3M9Q A;  2KY9 A;  3DB4 A;  3VUZ A;  1I1J A;  2HQE A;  1IRE B;  2PTK A;  4BE2 A;  2KEA A;  2QQR A;  2P0Q A;  3CCR A;  1ACM B;  2FPD A;  4C8Q E;  2M51 A;  2E41 A;  2MCN A;  1K9A A;  3G6E Q;  2DVJ A;  3URG A;  3VJP A;  3WVE B;  2LNH B;  2HZY A;  2KR3 A;  5GAO m;  4FIB A;  4M7D G;  2JM9 A;  1V29 B;  1TTH B;  1X43 A;  1BYM A;  4ZGE B;  3CBM A;  4AFU C;  1ZUU A;  1WHH A;  2WSE E;  5CIU A;  1JJ2 S;  3I35 A;  3N5B B;  5M9O A;  2L8D A;  3V7R A;  2X4W A;  3R6N A;  3JCM P;  2EW3 A;  1VOM A;  2HEQ A;  2V8J A;  2QEX Q;  5D6X A;  4F7U F;  3OYF A;  2AKK A;  4LN2 A;  3M58 A;  3INZ A;  1FXX A;  1JJ2 A;  1JRI A;  3MEA A;  3JRZ A;  2EYZ A;  2DL4 A;  2PQW A;  2E70 A;  4JLI A;  2NLU A;  2HQH A;  2M9U A;  3NMZ C;  1D0Z A;  2E12 A;  2CP7 A;  2HCK A;  2PUK B;  1PKS A;  2KRS A;  3JCM c;  1X2Q A;  1PSF A;  3CMA A;  5DLO A;  3QO3 A;  2COZ A;  1Y0M A;  2MI6 A;  1JXO A;  3EGX A;  3PMI A;  4LDV A;  1VIF A;  3VRZ A;  2RO0 A;  3JCM W;  2LP5 A;  2F5T X;  3G71 T;  3VS2 A;  2MOX A;  1VQ6 A;  2DZ9 A;  1VQ4 Q;  4BE0 A;  3I55 T;  1YIJ T;  2L3Q A;  4IUP A;  3OBW A;  1Z9Z A;  5LJ5 j;  1YIT A;  1RAI B;  5KYU A;  1W1F A;  3PIO A;  1X2K A;  2KXC A;  1AWO A;  5I2S A;  4YTL A;  4XQ3 A;  2QGF B;  4M75 A;  3H8Z A;  4B9W A;  4FSX A;  1BI1 A;  2IVW A;  2EQU A;  3ULR B;  3SWN C;  3QYH B;  2YUO A;  1VQP T;  1K8A C;  1LJO A;  1K8A U;  1UFF A;  2K3X A;  1SF9 A;  4ZNX A;  5GAM f;  1T3S A;  3OYE A;  5AYF A;  1IXD A;  4DBF A;  1VQM A;  3VS3 A;  4M78 C;  2L5Q A;  2RI5 A;  2QQ9 A;  3OBY A;  4Q5W A;  5FWC A;  1Q82 C;  3GF5 A;  3EH1 A;  2P4T A;  1FMV A;  3OYN A;  1VQ5 A;  1RL2 A;  1NBE B;  2MWP A;  2RJF A;  2RK2 A;  3DKM A;  5ECA A;  3X25 B;  1E6G A;  2VXE A;  3QKJ A;  4R55 A;  1UGP B;  2KNB B;  3SFM A;  3JSC A;  1MV0 B;  3C4S A;  4Z02 A;  1MMG A;  4F16 A;  3I56 Q;  1V1C A;  1VQ8 Q;  2HSP A;  4ZN3 A;  2E6Z A;  5L8R E;  1KHC A;  1GL5 A;  3FB9 A;  2DPP B;  2QK0 A;  4BD3 A;  3VS7 A;  2XDD A;  1I4K 1;  4QT7 A;  2RN8 A;  2E1H A;  4PJO F;  1CSK A;  3GOX A;  1WZO A;  4CC4 B;  2KDS A;  3CC4 A;  2JTF A;  2P4R A;  3VYG A;  2RM4 A;  2QQB A;  4IIM A;  2VXF A;  2LCC A;  1R77 A;  4J9B A;  3HL8 A;  2D6F A;  3LH0 A;  4FYW B;  2FEI A;  2E5K A;  4EIK A;  2RJD A;  5KH6 A;  3ZL7 C;  2EYY A;  1UGS B;  2I2L A;  3NFC A;  4E6R A;  1E7O A;  3A1P A;  2PVG B;  3CCU Q;  1YJN T;  4D8D A;  1SSF A;  1Q7Y C;  2A37 A;  5GAM h;  1Q7Y U;  1W6X A;  4DBQ A;  3TCJ A;  3CBP A;  1Y7X A;  4IUV A;  5KE3 A;  1VYV A;  3HRS A;  1R8O B;  1NG2 A;  5FU6 C;  4PL6 A;  2FZC B;  4C92 D;  2HL3 A;  3CC2 Q;  3CCQ Q;  2RQT A;  3H9N A;  4M78 G;  1X69 A;  2QAS A;  1NZ9 A;  2A28 A;  1WPY A;  1W2B P;  2O4X B;  1UDL A;  4J8O A;  1YHQ A;  2KRM A;  2VAS A;  3C95 A;  1NEB A;  1D1B A;  4HA8 A;  2AK5 A;  5GAN 4;  1NJI C;  1NJI U;  1HSQ A;  5GMK i;  1VQO Q;  2A7Y A;  4X9C A;  2BZ8 A;  3PVL A;  4M77 B;  4AG2 C;  1AWX A;  4C92 C;  3SEM A;  1LVK A;  4OMM A;  3PFS A;  1ZA2 B;  1A0N B;  5KYN A;  5CK9 A;  4M7A D;  2F2W A;  3SDZ A;  3MPU B;  3E9F A;  5GAM g;  4ZTF A;  1OZ2 A;  3JB9 G;  1U1S A;  1FYN A;  1MUZ A;  5LJ5 f;  5CKE A;  3QUI A;  2DXC A;  2DXB A;  4XU2 A;  3OYB A;  2OJ2 A;  2OTJ A;  2JS0 A;  2DTH A;  3CCR T;  4N0A C;  4OGE A;  5GAM e;  4C0G A;  4OVA A;  1VQN Q;  3NTK A;  4M7D B;  2YUP A;  4O6J A;  2JMA A;  1UJY A;  1I5O B;  2W0Z A;  2J05 A;  4M7A C;  1QLY A;  2YDL A;  4C0D B;  1IHW A;  5A0D A;  1IO6 A;  2QG9 B;  5LJ3 g;  1W2B A;  4IIO A;  2XDB A;  1M2V B;  1WHG A;  3QZ9 B;  3CXC P;  4XTV A;  1PRM C;  1M8V A;  1XQH A;  1HD3 A;  4V2S A;  1B07 A;  4HT9 A;  4NL2 A;  2P84 A;  5EG2 A;  3JAM E;  2QEX A;  1AD5 A;  4NL3 A;  2ZCF B;  1W4S A;  2DL7 A;  2X3X D;  4DBR A;  3C94 A;  4GBQ A;  2PVD B;  4CC7 A;  4C8Q F;  4E7Z A;  2MIO A;  4HT8 A;  5KE2 A;  4EDU A;  3V8J A;  1UB4 A;  4JZ3 A;  1D1A A;  3OW2 P;  4PNO A;  1C1A A;  2O31 A;  3O8V A;  2CZ7 B;  3EG3 A;  1GRI A;  3I5S A;  4EMK B;  5IXF A;  3OB9 A;  3CMA T;  2EQJ A;  4C92 G;  5DY9 A;  1PD0 A;  4JS4 A;  2RMO A;  4E7J A;  2DEQ A;  1OPK A;  3CC7 A;  1V76 A;  3EGD B;  1ZQ1 A;  5LJ5 h;  3CXC A;  4PFP A;  1VQK A;  2JJ9 A;  2EBP A;  1VQ6 T;  2CH4 A;  2LCS A;  1MGQ A;  3TVT A;  3RES A;  4J5Y A;  1QVF S;  4II1 A;  3TSZ A;  1G3S A;  1YIT T;  1M1F A;  4RTW A;  1BIB A;  3QWX X;  2MMP A;  1YJW Q;  4LD9 K;  3CPF A;  1OV3 A;  1ZHI A;  2DO3 A;  3HRT A;  3UDC A;  2OAW A;  4L5G A;  2CP2 A;  1S72 A;  4M7A G;  4JS5 A;  2O88 A;  4ESR A;  2LQW A;  3FJP A;  1QVF A;  3ER0 A;  3EFS A;  4FYX B;  4Z8A A;  3CCJ Q;  1LCK A;  1UHC A;  2LNV A;  3HHT B;  4J7I A;  4MZT A;  4AG1 C;  1M2O A;  2QQA A;  3L2Q A;  2KBT A;  3OW2 A;  3FRN A;  1JXM A;  3LGL A;  3JB9 J;  2EGA A;  4IUT A;  2M0Y A;  1VQM T;  4TVR A;  3CCM A;  2ROL A;  5LJ5 g;  3D7S B;  1JBM A;  4AT1 B;  1QCN A;  1W70 A;  2BTT A;  1M9S A;  5LJ3 d;  2I0N A;  1Q95 G;  1VQ5 T;  2JNG A;  5LJ5 e;  4FU6 A;  1RLP C;  3QWY A;  4DBH A;  4PJN A;  4ME7 A;  2GCX A;  2RHY A;  4OMO A;  4ELZ C;  3X26 B;  4M77 D;  3I56 A;  5HK0 A;  4ORZ A;  1VQ9 Q;  1WHK A;  1TS9 A;  1WJS A;  3LX7 A;  1X75 C;  2H8H A;  1OZ3 A;  3RKY A;  2CSI A;  2HBW A;  1RAD B;  4O5V A;  2CSQ A;  4K11 A;  1MMD A;  4KGX B;  2XHC A;  1MHN A;  2PZ1 A;  5CQY A;  3G7Z A;  2C06 A;  4RG2 A;  1YJ9 Q;  1FWZ A;  3CC4 T;  2OTL A;  1NLO C;  2EGC A;  4IUQ A;  2X4J A;  4E47 A;  4WF2 A;  5GJV B;  2E64 A;  4M75 E;  3LGF A;  2LCL A;  2VGM A;  2O4X A;  1IB8 A;  3SWN B;  3A98 A;  3OYL A;  1WX6 A;  3CPW P;  4ANJ A;  3EFO B;  5IHI A;  2YXY A;  4XTW A;  3E9G A;  3J7A F;  1G2B A;  3OSS C;  4LE9 A;  1BBZ A;  1QVG S;  1BU1 A;  4M77 A;  3LH5 A;  3LLR A;  2PNI A;  1M30 A;  2A0F B;  2HKN A;  3CCQ A;  3LWI A;  1PCX A;  3A8M B;  2LQN A;  1JQQ A;  2VYT A;  1PRL C;  1QVG A;  5GAO l;  1OI1 A;  1AT1 B;  4B9X A;  1YHQ T;  4IUR A;  2CKK A;  3EAE A;  3LWH A;  2L2P A;  4RMO A;  2DEU A;  2R5A A;  2DBM A;  3CCL A;  4M7D A;  2DL8 A;  4Y28 E;  1ZSZ C;  1KQ2 A;  4HXJ A;  1ABQ A;  2YRD A;  3LYI A;  1TU0 B;  3KFV A;  4OMF B;  2M0O A;  1U1T A;  3E2U A;  1YN8 A;  4J6W A;  3PMT A;  4XTZ A;  2GTO A;  1K9M C;  1K9M U;  1M2V A;  1N5Z A;  3CPW A;  2YT6 A;  2M1H A;  1BK2 A;  2DMO A;  3SB2 A;  4A4H A;  4MDX A;  2G3R A;  2OTJ T;  3RMS A;  2BZX A;  1VUB A;  1JU5 C;  1TUD A;  4KGZ B;  5LJ3 j;  3RMQ A;  1SRM A;  4JJC A;  3TQ7 P;  1KC8 C;  1KC8 U;  3VUB A; 
#chains in the Genus database with same CATH homology
 4BY6 C;  3MEV A;  1DJ7 B;  4KT0 E;  5GMK h;  3OYE A;  5AYF A;  4HCC A;  2EJ9 A;  2XIC A;  1M4Z A;  4HKE A;  3JCM Q;  2M16 A;  1VQM A;  4M78 C;  2L5Q A;  1QW1 A;  1YCY A;  2XKO C;  3C12 A;  3L2U A;  2RI5 A;  1YJ9 T;  3ME9 A;  2PUO B;  2QQ9 A;  2Y4Y A;  3OBY A;  4Q5W A;  3GF5 A;  4IUU A;  2WAC A;  2K3Y A;  4C5G A;  1Q82 C;  4IKF A;  1W2B S;  3UWN A;  2P4T A;  2XD0 A;  3L42 A;  4PLI A;  1VQ8 A;  1WQ7 A;  5CAI A;  2VC8 A;  1ZBX A;  3QHS A;  2V8K A;  2KVQ G;  4JJN K;  2QDY B;  4BI8 B;  4OB2 B;  3OYN A;  1VQ5 A;  1RL2 A;  4NS5 A;  2BUD A;  2MWP A;  3L2R A;  2RJF A;  2RK2 A;  5GAN 5;  4XU3 A;  3DKM A;  3OYA A;  2CS7 A;  1O75 A;  3X25 B;  4EMK A;  4PJO E;  3ZEH A;  2VXE A;  3M5A A;  3MET A;  4XU1 A;  3JB9 F;  3QKJ A;  2QEX T;  3OQ5 A;  4KUD K;  3QSU A;  4F7U E;  3M4Y A;  4R55 A;  1UGP B;  2ZPF B;  3FDR A;  3JSC A;  3LW5 E;  3SFM A;  4F7U G;  2RD1 A;  3C4S A;  4Z02 A;  2JN0 A;  2EKO A;  2IG0 A;  1M5Q 1;  3OSV A;  5GAO r;  2ZZD A;  3OS0 A;  4PJO D;  4RCC A;  1UEB A;  3MO8 A;  4ZN3 A;  2E6Z A;  2LVM A;  1KHC A;  5L8R E;  1KG1 A;  2H3J A;  4BE1 A;  3FB9 A;  4ZGJ B;  2ZGW A;  4R56 A;  2CGH A;  2DPP B;  3E19 A;  2QTX A;  3M59 A;  3NTI A;  3JCM h;  4BD3 A;  1I4K 1;  1N9S A;  1G3W A;  1G3Y A;  3P8H A;  1BI0 A;  3CCU A;  2E1H A;  1KHI A;  4PJO F;  3JB9 H;  3HPW A;  3GOX A;  1O9S A;  2DJZ A;  1VQ7 A;  2K5I A;  2DD4 A;  4RKU E;  3HSB A;  4QW2 A;  5GAN f;  2KDS A;  3A8L B;  4XTY A;  3BFM A;  5GAN g;  3CC4 A;  3OYY A;  2XU8 A;  1YJW T;  2JTF A;  4J6X A;  3JCM V;  3VU3 C;  1LOJ A;  3VYG A;  2RM4 A;  4OB0 B;  3X20 B;  5D6Y A;  5GMK e;  2QQB A;  2RH2 A;  4M78 B;  4ELY C;  2RHI A;  2VXF A;  2LCC A;  2D6F A;  3HL8 A;  3LH0 A;  4PJO C;  3CC2 A;  3CC7 T;  1N9R A;  1K73 C;  2LRQ A;  1K73 U;  2RJD A;  5KH6 A;  2R58 A;  3S3O A;  1VQK T;  1UGS B;  2I2L A;  3NFC A;  5HKC A;  1BI2 A;  4XU0 A;  3CCJ T;  2YLC A;  5CKH A;  1M1K C;  1M1K U;  3CXC S;  2PVG B;  2WSC E;  2RI2 A;  4C92 E;  1YJN T;  1BIA A;  3G4S T;  3AHU A;  3V7S A;  3JCM d;  3QYG B;  1SSF A;  4M7A B;  3MP1 A;  1Q7Y C;  5GAM h;  1Q7Y U;  5KCH A;  2DXT A;  5GAN 6;  3TCJ A;  2LT4 A;  1Y7X A;  3CBP A;  4EPC A;  4IUV A;  4BI4 A;  5GAN 7;  3A8G B;  5KE3 A;  3CME T;  5GAN 2;  1VQO A;  2D9T A;  3HRS A;  1R8O B;  1G3T A;  1QP2 A;  3MEU A;  4XTU A;  4PL6 A;  3KUF A;  5FU6 C;  1BKB A;  4C92 D;  1S72 T;  1WJQ A;  5CVI A;  2JVV A;  3QDR B;  4M78 E;  3HKS A;  4VUB A;  1OYX A;  2QI2 A;  1NE8 A;  4P5N A;  4M78 G;  5IAY A;  3S3M A;  5LL6 S;  4C0D C;  4MMK A;  2X35 A;  1NZ9 A;  1XTD A;  4J7F A;  1WPY A;  4Y91 A;  3OYJ A;  3A8H B;  4RG8 A;  4E7L A;  1H64 1;  2O4X B;  1YHQ A;  4J8O A;  5D6W A;  3OYH A;  1X01 A;  3VYH B;  3C95 A;  2ZPB B;  4EMG A;  3QBY A;  4E7H A;  3M57 A;  4HA8 A;  4M78 D;  3BY7 A;  4QQ6 A;  5GAN 4;  3J81 E;  4A4K A;  2L3R A;  1NJI C;  1NJI U;  3HRU A;  4RCB A;  3OW2 S;  1Q81 C;  1Q81 U;  3GIB A;  5GMK i;  4M7A E;  2PVO B;  1G5V A;  4JRQ A;  2A7Y A;  4X9C A;  4D6W A;  5GAM d;  2KQW A;  3G71 A;  3CCM T;  2LQK A;  1AHJ B;  4L59 A;  4M77 B;  1VQ9 T;  4C92 C;  3I55 A;  3G6E T;  2KAF A;  4FM4 B;  1YIJ A;  3PFS A;  1VQN A;  3OYD A;  2XI9 A;  4HCZ A;  4JRI A;  3PTA A;  2XDP A;  2CYZ B;  5CK9 A;  4M7A D;  2R5M A;  4EMH A;  3CEY A;  3L2Z A;  4KUL A;  2DXU A;  2MF2 A;  3SDZ A;  3E9F A;  5GAM g;  4ZTF A;  2HNI A;  1M1G A;  1M90 C;  3OS5 A;  3PNW C;  1OZ2 A;  4OB1 B;  1M90 U;  2VGN A;  3OYK A;  3OYG A;  3JB9 G;  1N6A A;  3V8L A;  1U1S A;  5GAO n;  2A3L A;  4C8Q B;  5LJ5 f;  4LDU A;  5CKE A;  4XK8 E;  5A0L A;  4M7A F;  3QUI A;  2DXC A;  3L1A A;  2DXB A;  1KQS S;  4XU2 A;  3OYB A;  3QII A;  2OTJ A;  2QQS A;  2DTH A;  4KUI A;  5I21 A;  5GAN h;  4N0A C;  4OGE A;  3CCR T;  3I56 T;  2EYQ A;  1Q82 U;  3BDL A;  5GAM e;  3UT1 A;  5C0M A;  2K5L A;  3JB9 D;  4C0G A;  4OVA A;  1VQP A;  3BDU A;  2Y90 A;  2ZPG B;  3NTK A;  4M7D B;  2BIV A;  4BUG A;  5FU6 B;  3OYI A;  4NOY A;  4O6J A;  3X28 B;  4EMK C;  2CZ1 B;  5CKF A;  4QVC A;  3GP8 A;  2L89 A;  1Y71 A;  4GY5 A;  4MDW A;  1KQS A;  2E65 A;  4M7A C;  4C0D B;  3CCV T;  5A0D A;  5LJ3 f;  4PJO G;  2HD0 A;  5LJ3 g;  1W2B A;  3DLM A;  1NPP A;  3JCM b;  5J26 A;  1YJ9 A;  2K57 A;  2XDB A;  3QZ9 B;  5FU7 B;  2HQX A;  1HXD A;  4XTV A;  1M8V A;  1N8R C;  2XG8 D;  1N8R U;  2QXF A;  2WSF E;  5GMK j;  5FRM A;  1XQH A;  2X4Y A;  3RIR A;  2B8A A;  4C0F A;  2RJE A;  2OTL T;  4V2S A;  4M75 B;  2E10 A;  5KCO A;  3GLX A;  2EAY A;  4HT9 A;  5GAN d;  3Q1J A;  3R6O A;  5CKD A;  2DAQ A;  4M77 F;  1FX7 A;  1Y96 B;  3MEW A;  4MML A;  4NL2 A;  2K4Y A;  3M53 A;  3QG1 A;  4DOW A;  3CD6 T;  4X9D A;  5GAN 3;  2VUB A;  5EG2 A;  4C8Q D;  4FT4 A;  3JAM E;  2QEX A;  5CR2 A;  2LC4 A;  4NL3 A;  2X4X A;  2XDD A;  2ZCF B;  1EIF A;  1W4S A;  4LDX A;  3C94 A;  1B34 A;  2FL7 A;  3S3N A;  3FIF A;  3P8B B;  2PVD B;  4M77 C;  4C8Q F;  3VKI A;  4M7D D;  5DLQ E;  1KD1 C;  1KD1 U;  4HT8 A;  2CZ0 B;  4J83 A;  3T9N A;  3CBO A;  4MZP A;  5KE2 A;  5DM7 R;  2EWN A;  4EDU A;  4A4F A;  3V8J A;  4CRI A;  1UB4 A;  3CCQ T;  2LT1 A;  3P8D A;  3OMG A;  3J80 E;  4E7K A;  2DIG A;  3UPU A;  1YI2 T;  3E1S A;  4PNO A;  3CCE T;  4LDY A;  1VQ4 T;  4BB7 A;  5GAN e;  3QJ6 A;  1D3B A;  2ZPI B;  4M7D F;  1JB0 E;  3O8V A;  3MCA B;  3RKX A;  2CZ7 B;  2LDM A;  4C8Q C;  4JUV A;  4EMK B;  3FEO A;  3OB9 A;  5A2Q E;  2EQJ A;  3M4G A;  3CMA T;  1WNL A;  1WGS A;  4C92 G;  5DY9 A;  1YJW A;  5GAO q;  4JS4 A;  3QPH A;  4M75 D;  3FLG A;  4QQD A;  4E7J A;  1I5L A;  2DEQ A;  3F70 A;  5J39 A;  1YBY A;  3OS1 A;  2LTO A;  4J6Y A;  2HAX A;  4M7D C;  3CC7 A;  2HBP A;  2LQ8 A;  1ZQ1 A;  4JLG A;  5LJ5 h;  3CXC A;  3CCL T;  4E7I A;  4PJO A;  1VQK A;  2KSS A;  1NPR A;  5GMK m;  3QXE B;  3CCJ A;  2QA4 T;  4M75 F;  3SD4 A;  4F7U A;  1VQ6 T;  3M55 A;  1MGQ A;  3CCS T;  1YJN A;  3G4S A;  4JDS A;  3HFO A;  3RES A;  2DK3 A;  4J5Y A;  4II1 A;  1QVF S;  1G3S A;  4LD6 A;  2DTI A;  1YIT T;  1M1F A;  1VQL T;  1BIB A;  4OP0 A;  5FU7 C;  2MMP A;  2LX9 A;  3GNF B;  3RKW A;  3JCM X;  4LD9 K;  2XK0 A;  4JRK A;  3CPF A;  2DVE A;  4PLL A;  1ZHI A;  4A4E A;  2DO3 A;  3CME A;  3HRT A;  3UDC A;  2FB7 A;  4M75 C;  4QQG A;  2RHZ A;  2D0Q B;  2DIQ A;  5LJ3 h;  2K2V A;  4L5G A;  2F69 A;  3ZBD A;  4QVD A;  4ZGD B;  1S72 A;  4M7A G;  3OYM A;  1VIE A;  4N4I A;  3CPW S;  4JS5 A;  1LNX A;  3DB3 A;  4ATO A;  1HK9 A;  4A53 A;  5GAM j;  3FJP A;  4BDY A;  1QVF A;  3ER0 A;  4MZM A;  4N4H A;  2DZC A;  2JTM A;  3EFS A;  3RUX A;  4C5E A;  4BDZ A;  3EFR A;  4LDW A;  2GF7 A;  2FVU A;  2GQV A;  2VV5 A;  2LNV A;  5LJ5 d;  4CI0 C;  1Y07 A;  3A8O B;  2ZPH B;  3HHT B;  5CCA A;  3M56 A;  4J7I A;  3MP6 A;  4MZT A;  3ASK A;  2QQA A;  3L2Q A;  3OW2 A;  1D3B B;  4XAX B;  3FRN A;  1KQ1 A;  2FYK A;  1PSE A;  2K5F A;  3LGL A;  3WVD B;  3JB9 J;  1H3Z A;  4IUT A;  5CO7 A;  3OYC A;  4A4G A;  4BI3 A;  4FT2 A;  5HK3 A;  1VQM T;  2YHT A;  1WJR A;  4TVR A;  1N27 A;  3CCM A;  2BKD N;  1BI3 A;  3A5Z B;  5LJ5 g;  1QP3 A;  3V8K A;  3PIP A;  1JBM A;  1IZ6 A;  2JOY A;  1VQ9 A;  2OAU A;  3RER A;  2FHD A;  4DA4 A;  3G6E A;  2O01 E;  3TEE A;  5FLX E;  3QZ5 B;  5CQX A;  3X24 B;  1M9S A;  4UC4 A;  5LJ3 d;  2F5K A;  1VQ8 T;  4C92 A;  3SWN A;  4M77 E;  2KK4 A;  3MP8 A;  4OGC A;  4GLK A;  5IT9 E;  2KMT A;  1U8R A;  3L2V A;  5GMK l;  2MAM A;  2YLB A;  5C6S A;  1VQ5 T;  2JNG A;  4M77 G;  4N4G A;  5CKB A;  4F7U B;  4HCB A;  1I81 A;  5LJ5 e;  5IN1 A;  3L2W A;  3GPL A;  3M9Q A;  2KY9 A;  3DB4 A;  4FU6 A;  3VUZ A;  3KBG A;  2AHJ B;  2HQE A;  1IRE B;  3V7C A;  4ME7 A;  2GCX A;  4BE2 A;  2RHY A;  5GAN 8;  2QQR A;  4M78 A;  2EFI A;  4ELZ C;  2P0Q A;  4M77 D;  3X26 B;  3CCR A;  3I56 A;  4XTX A;  3S6W A;  4C8Q E;  3KXT A;  5HK0 A;  2E41 A;  1WJS A;  4N0A A;  4C92 B;  4C8Q G;  3URG A;  3VJP A;  2DD5 A;  3LX7 A;  1X75 C;  3PT9 A;  1OZ3 A;  2RHU A;  3WVE B;  5LJ3 e;  3RKY A;  5GAO m;  5GAN j;  4M7D E;  4FIB A;  3GNG A;  4O5V A;  4DQ2 A;  3OS2 A;  3CCV A;  1GXI E;  4M7A A;  2EQK A;  4M7D G;  1WQW A;  5FRO A;  2XHC A;  3CCU T;  1MHN A;  1V29 B;  4QVZ A;  3M54 A;  1VQL A;  1VQ7 T;  5CQY A;  3G7Z A;  2C06 A;  4RG2 A;  1I8F A;  1FWZ A;  2RHX A;  1BYM A;  4ZGE B;  3CC4 T;  2JUF A;  3CBM A;  2OTL A;  3JCM J;  2JZ2 A;  4OB3 B;  4IUQ A;  2V8I A;  2X4J A;  4DOV A;  4E47 A;  4WF2 A;  2RJC A;  2WSE E;  3CC2 T;  5CIU A;  1UGQ B;  1JJ2 S;  3CD6 A;  2E64 A;  4M75 E;  2LCL A;  2VGM A;  3LGF A;  2O4X A;  1Q86 C;  3N5B B;  3SWN B;  2L8D A;  5M9O A;  3V7R A;  1Q86 U;  3OYL A;  2RA2 A;  2X4W A;  4M75 G;  4OF1 A;  3JCM P;  3VV0 A;  2P0P A;  2V8J A;  4C5I A;  2EJF A;  3H6Z A;  5D6X A;  4F7U F;  3OYF A;  1XNI A;  2EQM A;  3E9G A;  4XTW A;  4BY6 B;  3J7A F;  3M58 A;  3MHX A;  3INZ A;  3OSS C;  1FXX A;  1JJ2 A;  1XOV A;  1QVG S;  1JRI A;  2MWO A;  4M77 A;  3MEA A;  3LLR A;  4ZTJ A;  3JRZ A;  1VQO T;  4FL6 A;  2PQW A;  2E70 A;  4JLI A;  3CCQ A;  3LWI A;  3WXM B;  2R57 A;  2NLU A;  2PU9 B;  1P92 A;  2M9U A;  4C5H A;  3FC3 A;  1YI2 A;  3CCE A;  1VQ4 A;  4X34 A;  2E5Q A;  2E12 A;  3A8M B;  2PUK B;  2VYT A;  3TRE A;  3HP9 A;  3JCM c;  2DTO A;  1PSF A;  1QVG A;  2P0K A;  3OMC A;  3CMA A;  5DLO A;  3QO3 A;  5GAO l;  3NTH A;  4C8Q A;  1OI1 A;  4A54 A;  4C0Z A;  4B9X A;  3OY9 A;  1YHQ T;  5I2M A;  4IUR A;  2CKK A;  3EAE A;  5FRN A;  2MI6 A;  2RB6 A;  3LWH A;  3PMI A;  3ZFJ A;  1QVP A;  4LDV A;  4RMO A;  1VIF A;  2R5A A;  3QJY A;  1B34 B;  3TU4 K;  3CCL A;  2RO0 A;  3JCM W;  2CZ6 B;  2YRV A;  2Y4X A;  4M7D A;  4L6V 5;  3JCM f;  4Y28 E;  2F5T X;  3G71 T;  3JCM g;  1KQ2 A;  2QA4 A;  1VQ6 A;  1UGR B;  2DZ9 A;  3CCS A;  4BE0 A;  1VQN T;  3I55 T;  1YIJ T;  4KBM B;  3LYI A;  3JB9 I;  2M0O A;  1U1T A;  3OBW A;  4IUP A;  3HFN A;  4OMF B;  4BAC A;  2E6N A;  4J6W A;  4C92 F;  2GFA A;  2EJG A;  2GFU A;  3PMT A;  4PKC C;  4XTZ A;  5LJ5 j;  5GAO p;  1YIT A;  1K9M U;  1K9M C;  3PIO A;  3CPW A;  5HY6 A;  3OA6 A;  3JCM e;  5I2S A;  4YTL A;  3DLL A;  2M1H A;  4XQ3 A;  3PGG A;  3H8Z A;  4M75 A;  2EIF A;  3BW1 A;  3SB2 A;  4A4H A;  4MDX A;  4B9W A;  1RI0 A;  4FSX A;  1X6O A;  1BI1 A;  2G3R A;  2IVW A;  2OTJ T;  2XID A;  2EQU A;  2ZPE B;  3RMS A;  4ZN1 A;  4M78 F;  4JRP A;  3SWN C;  1VUB A;  1Y96 A;  3QYH B;  2RK1 A;  1VQP T;  2DKG A;  5A0G A;  4PJO B;  5J3B A;  5LJ3 j;  3RMQ A;  1LJO A;  2RI3 A;  1K8A U;  1KC8 C;  2K3X A;  1KC8 U;  1K8A C;  5GAM f;  1TH7 A;  3VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...