5GAOp

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
76
Chain Sequence
b'MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSAKGTPLGKILLKGDNITLITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
molecule tags Transcription
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 8
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaop00
5GANd 1YCYA 3FB9A 4NL3A 1HK9A 3V7CA 1WQWA 5LJ5j 4QVCA 2DTOA 4M78C 5GAOn 3QSUA 1N9RA 3JCMX 4M7DE 1N9SA 5GANf 2E64A 4XU1A 5GAN3 3GIBA 5CAIA 1TH7A 4DQ2A 4C92D 5LJ5e 2DKGA 4HA8A 4J6YA 4M75A 3SB2A 3V8JA 5GAMf 3QUIA 4M78G 1Y96A 3JCMW 4EMGA 2RD1A 5GAOm 1X01A 4M7AE 3RUXA 4C92G 4N0AA 2FB7A 4M78B 4PJOG 1I5LA 1KQ1A 4M77G 3JCMb 3JCMh 3JCMg 5GMKh 2E10A 4XU0A 4C8QB 5GAN5 4J6WA 5LJ3h 5LJ3g 2RB6A 2VC8A 3FJPA 4F7UA 1I4K1 2Y90A 4MMKA 2EJFA 3QHSA 1M5Q1 4C92C 3JCMQ 2DEQA 3EFSA 4M77F 5GMKl 1JRIA 4N0AC 3SWNB 3INZA 1LJOA 4PJOD 5GMKm 3BY7A 4QVDA 5GAOq 4M7AF 1WNLA 3EFRA 4NL2A 5GAN2 3PGGA 1I8FA 2EAYA 3JB9I 3JCMP 4JRKA 1BIBA 4C92A 2K57A 3JB9G 4M75D 5GAN7 4XTUA 3JB9J 4M78D 3L2ZA 3JCMV 4XQ3A 1H641 3V7SA 5GAMh 2HNIA 5GAMg 2YLBA 5GAN8 1U1SA 5LJ5g 5LJ5h 2JN0A 4M77E 5GAMj 4HT9A 5GAN6 1LOJA 3HFOA 3JB9F 4PJOE 4PNOA 4XTZA 3V7RA 5GMKi 5GAOp 5GMKe 1BIAA 4C92E 1B34A 4C8QD 4M7AG 2YHTA 2DZCA 2E41A 3QO3A 2E65A 5LJ3d 2DTHA 5LJ3e 5I21A 1M8VA 2EJGA 3L1AA 4C92F 4F7UB 5GAMe 1KQ2A 4M7DC 4PJOA 5GAOr 1WQ7A 4M78E 4EMKC 4X9CA 2FYKA 4M7AA 2E1HA 3M4GA 2YLCA 2EWNA 4V2SA 3BW1A 3SWNA 1U1TA 4JUVA 4XTXA 5DY9A 5LJ3f 4HT8A 4M7DG 4M77B 4XU3A 4RCCA 4A54A 3BFMA 3FIFA 5GANe 3HSBA 1WPYA 4M7DA 4A53A 4Y91A 4C92B 4PJOC 4EMKA 3JCMf 4M7AC 3V8LA 1D3BA 4M75G 3SWNC 4F7UE 2DJZA 3JB9D 4OP0A 3JCMJ 5GANj 3RKWA 1I81A 3AHUA 4XTVA 4EMHA 2VXEA 4XU2A 4RCBA 5GANg 3JCMd 5GANh 4PJOF 4MMLA 4M77C 4XTWA 1B34B 4C8QG 3BDUA 4M7AD 4X9DA 2CGHA 2ZGWA 4NOYA 1MGQA 5GMKj 3RIRA 3RKYA 2I2LA 5GAOl 4PJOB 4M7AB 4M75B 5LJ3j 4J5YA 1JBMA 4M77D 4JLIA 5GAN4 4F7UF 4C8QC 1Y96B 2DXTA 1LNXA 4WF2A 4M7DF 4M77A 3VU3C 2DXUA 2EJ9A 2VXFA 4J6XA 4JRIA 4C8QE 5LJ5f 3JCMc 5LJ5d 4M7DB 2DZ9A 3JB9H 4M7DD 2DVEA 4M78A 5GAMd 2RA2A 3RKXA 4C8QF 4EMKB 4M75F 1D3BB 3RERA 4M78F 2QTXA 2DTIA 4XTYA 3RESA 4C8QA 3HFNA 3JCMe 4F7UG 4M75E 1HXDA 4M75C 2RM4A 3V8KA
chains in the Genus database with same CATH superfamily
1YCYA 3FB9A 1UHFA 3O8VA 2ZPHB 3EH1A 3I5SA 3TCJA 1G3WA 1WXBA 1NJIR 4FW1A 4RKUE 1I1JA 3PNWC 1OX9A 4M75A 5GAMf 1TU0B 3QUIA 2K5IA 2JS0A 2DK3A 4PJMA 3CCQQ 2ZAEA 1GFDA 4R56A 4HCCA 4LN2A 1G3TA 3CPFA 4M78B 2EW3A 3E9FA 2CZ7B 3G4SA 1EFNA 5LJ3g 2BZYA 2QK0A 2EJFA 2OTLQ 1VQ5T 4AFQC 1RAHB 2O88A 2LC4A 3S3MA 5GAOq 1PWTA 7AT1B 2EKOA 3CCSA 1NPRA 4HCKA 4BI8B 1VIFA 3OYIA 5FU7B 1GCQC 4OB2B 3CD6Q 2R5AA 1MMAA 2KSSA 2DIGA 1K4US 2CH4W 2F5TX 3JAME 1AZEA 1YJ9A 2EYYA 4MZPA 1VQPA 3PMTA 2ZPIB 3J7AF 2ABLA 5LL6S 1PSFA 1KC8R 1ABQA 4IUQA 1M90R 2IG0A 1VQLA 2GFUA 2ED1A 4L5GA 2Y4XA 3MP6A 3VV0A 4DBFA 1BCMA 4D8DA 1X27A 3VS7A 4JZ3A 5GANg 1VQOA 3I9QA 3X20B 3RMQA 2DFUA 5D6YA 2ZGWA 2KQWA 3ME9A 3VS4A 2D1XA 1JBMA 2KE9A 2KRSA 1FX7A 2DXTA 3OY9A 2EQUA 3U23A 2LVMA 2LT4A 2EJ9A 3OA6A 5KYWB 2GQIA 1G3YA 5CVIA 2CZ1B 2M02A 1QKWA 3MEWA 2WSEE 3E19A 4QW2A 2VVKA 1ZUKA 2K7AA 2HKNA 4BUGA 3QSUA 5FW9A 1PSEA 1WHKA 1G5VA 4J9BA 3UA6A 3PMIA 3M4YA 3M58A 2RHZA 1YITA 2ROLA 1H92A 3NTHA 1ZSZC 3NGPA 2C06A 1W4SA 4CI0C 2HMAA 1MV3A 2DEQA 2HCKA 2JM9A 4E7KA 4BDYA 3DB4A 1WGSA 4OMNA 2HBWA 2LTOA 1Q82R 2C0TA 1JJ2P 3UWNA 3EFRA 3CC4T 1EX4A 3JB9G 2NLUA 4BI4A 2F1LA 3L42A 2ENMA 6AT1B 2O2OA 4LDYA 2AKLA 1Y07A 2XK0A 5LJ5g 1OX8A 4XTZA 1KHIA 1WZOA 2E70A 2JTFA 2XHCA 2XDBA 1VQKQ 4LDVA 5LJ3e 3PFSA 2DTHA 2RQUA 2CUBA 4PJOA 2XD0A 2QAZA 1VQNQ 3BW1A 1K9MR 2RJDA 5LJ3f 2DMOA 4XAXB 1Y71A 3REAB 1B07A 4M75G 2EGCA 4OP0A 4RTWA 1UJ0A 3M55A 3JCMJ 5IHNA 3TU4K 1JU5C 1PKTA 3UA7A 2EYXA 1ZQ1A 2DPPB 2CGHA 4AMCA 2FG0A 4JZ4A 2XU8A 3M0QA 5FU7C 2D8JA 3PE0A 4C8QC 4FW2A 5D6WA 2FL7A 4JRIA 1JXMA 2MWPA 2QGFB 1W6XA 1QQJA 4N4GA 3RERA 4XTYA 3CCMQ 2PVGB 4OGCA 2MK5A 2R58A 3V7CA 1BBZA 1VUBA 1I0CA 4WTOB 1YIJA 4M7DE 5GANf 2RF0A 1U8RA 1M1GA 2QEXT 2WSCE 1UGRB 4L6V5 4E6RA 3WVDB 4FL6A 4LD6A 1UHCA 3MO8A 5KE2A 1FMKA 1VQ6A 3EHQA 2E10A 1M27C 2LP5A 2E4HA 1D0ZA 2Y90A 2FEIA 3PIOA 2QDLA 4GLKA 3CPWP 4C92A 1VQ9Q 4OMPA 4M78D 1RI9A 2QQBA 3OS0A 3MEVA 4JJCA 2QA4A 1YITQ 1RACB 1VQPT 2HEQA 4HVVA 1B7TA 4DA4A 2AKKA 2KYMA 2AK5A 3CCEQ 2KYBA 2O01E 5I21A 4M7DC 2V1QA 2DX1A 4X9CA 3CCVT 3J80E 1PRMC 3EGUA 3SWNA 2OTLA 1C1AA 3BFMA 4M7DA 2KDSA 4J7IA 1AWOA 3P8HA 4M7AC 2QTVA 5KH6A 1WLPB 2C0IA 4FSSA 1W2BA 1YBYA 3AHUA 4DBRA 2VXEA 3CC2T 3CMAT 3TVTA 4J8OA 5KCOA 1VQ4Q 3OQ5A 3SD4A 2ED0A 1UFFA 2LMJA 3VS2A 4ELYC 2RK1A 3EG9A 4C8QE 3H9NA 1SHFA 1U5SA 3JB9H 2DVEA 3E1SA 2RA2A 1QVPA 2F2XA 1MMGA 5FRNA 1PD1A 5KYNA 3Q1JA 3H41A 2NUPB 3OYAA 1IRXA 4C0FA 2ZPEB 4F17A 3MP1A 4HCZA 4J9DA 4Z8AA 1WHHA 4J6YA 1BI0A 4E7JA 3M0RA 4FYXB 4XK8E 3CCLA 2EKHA 4EMGA 4PJJA 3SHWA 1KJWA 1I5LA 3EG1A 2E12A 4BI3A 1ZHIA 5EG2A 4C8QB 5LJ3h 1YIJT 2NUTA 3JB9J 2ESWA 1M5Q1 3JSCA 2IVWA 4HVUA 2VWFA 4IIMA 1M4ZA 5GAN2 1VQMQ 5HKCA 5GJVB 4OMFB 2B8AA 2CP6A 4LDWA 4J83A 3O5ZA 3RR6A 3OSVA 2M9UA 2YRDA 2AHJB 3LX7A 5GAN6 5KYUA 4N4IA 4C0ZA 4PJOE 2ZPGB 2FRWA 3QYHB 2YHTA 2E65A 2LCCA 1K73C 3FRNA 4ZN1A 1VQ5Q 1MNDA 1M3CA 1I5OB 3HSBA 4IUUA 1GBRA 2EBPA 2FHDA 1Q81R 1VQ9A 2GGRA 1I81A 4CC7A 1UECA 2RQWA 5GANh 3JCMd 1N8RU 1XQHA 4M77C 4M7AD 3MEAA 4JJBA 2O4XA 2KGTA 4PJOB 1GBQA 5LJ3j 3OMGA 2DXBA 4WF2A 2RJFA 4M77A 2QDYB 1OOTA 2PZ1A 4QKUA 1RAIB 3HTRA 4M78F 1RAGB 1YCSB 2DTIA 2DERA 4FU6A 3H8ZA 2E3IA 4E7HA 3LWHA 2DJQA 1H8KA 2OAUA 5GAN3 1YHQQ 1TH7A 3C94A 4OB0B 4OMLA 1YJNA 2J6OA 3PVQA 2KT8A 3TEEA 4C92G 4BE2A 1Q86R 1T3SA 2XICA 2OTJQ 4JDSA 5GJWB 1GRIA 2COWA 1CKBA 1W2BS 3VS5A 1M2VA 1W2BP 4D6WA 3M0SA 2D9TA 1OV3A 1M9SA 4JS5A 2HL5C 3E9GA 4QVDA 3VJPA 1RADB 2A0FB 1WNLA 4NL2A 1PC0A 1QMCA 5L8RE 1R8OB 1BIBA 2B86A 2VASA 3CCST 3JCMV 1PHTA 3CXCS 3OYLA 5LJ5h 3CCLQ 2HQEA 3NFCA 2GFAA 3HFOA 1QLYA 1SEMA 5GAOp 1GXIE 1WXUA 1QCNA 1BI3A 2DZCA 2PVOB 2E5KA 2OX7A 1YI2Q 3QWYA 4M78E 2COYA 1M1KU 1X2KA 2JS2A 4ZTFA 2ATCB 4LE9A 1M3AA 5CQXA 1NJIC 4C92B 3MP8A 5FWCA 3WXMB 3PT9A 1KQSA 2DJZA 3QJ6A 2XG8D 5HK3A 3M59A 3RKWA 2VUBA 2EYZA 3CBOA 3X26B 3CCRA 1OU8A 1JEGA 3G71A 2YDLA 5GMKj 1VQ8Q 3G6ET 2OJ2A 2KXCA 3SFMA 5LJ5f 3CCUQ 5A0DA 3P8BB 2HZYA 3GBQA 4EMKB 2HAXA 2DBKA 1G2BA 5AYFA 4ME7A 1LVKA 1PD0A 2JVVA 5I22A 4NL3A 1OU9A 1H3ZA 1N9RA 1WIEA 2PVDB 1PCXA 2BTTA 1VQLQ 2RHIA 3JV3A 1K0XA 1SSHA 4HKEA 2JOYA 2EQIA 3D7SB 3QKJA 3OYJA 2HQHA 1WHMA 2DL7A 4QQGA 2KNBB 4KBMB 5CIUA 1NE8A 4KT0E 2CP0A 4XU0A 1YI2A 2G3RA 3FJPA 1YJWA 5KYXB 2A08A 4JS4A 4M77F 4Y92A 2L3PA 2P0QA 3UATA 2QA4Q 1I8FA 2YUPA 2K2MA 1KD1U 1O9SA 3VUBA 1KQSS 3GOXA 1VA7A 2ECZA 1VYVA 5GAN8 1YJNQ 3M56A 3I56T 3ZEHA 2ZPBB 2F2WA 5GMKe 1M8VA 1IZ6A 3OBWA 3EFOB 3QBYA 2M0OA 1XJWB 2XDDA 2K3BA 1U3OA 3OS1A 2EWNA 1QCFA 1U1TA 4XTXA 5DY9A 2V8JA 1JJ2A 2L3QA 1SHGA 3FIFA 2W10A 5GANe 1JJ2S 1QVGS 2NUZA 4E7SA 4OMMA 2JW4A 3MEUA 2JTMA 3MJXA 3TQ7P 1YFNA 1YJ9T 2AT1B 5FWBA 1K8AC 1SRMA 4PFZA 5KYYB 3NTIA 3CMEQ 2I0NA 2CT4A 1AWWA 3C4SA 5GAN4 4F7UF 1SSFA 4TVRA 2EQKA 4X1VA 3GP8A 3GNFB 1T3LA 4M7DD 2MI6A 1KD1C 3SEMA 3EGDB 2CREA 4C8QF 4M75F 5IXBA 4IKFA 1NM7A 2RK2A 2BZ8A 2CP3A 3G71T 5LJ5j 2NYSA 5J3BA 5GAOn 1SG5A 3VS1A 2DL3A 3CCQA 1VQOQ 3CCRQ 1W70A 2HQXA 5FLXE 3QXEB 1QCOA 4M78G 3G4SQ 1NYGA 1OPLA 2KI7A 4A63B 4OF1A 2DF6A 1Q7YC 3BE3A 2CYZB 3JB9F 1K8AR 4MMKA 4JRPA 1EZZB 1QW1A 4AFSC 4CC3A 1M2OA 2J6FA 2DO3A 4GBQA 1Q7YU 1ACMB 3C95A 4Y28E 2DRMA 2COZA 2K57A 4XTUA 3LH0A 3L2ZA 3HPWA 1VYTA 2DD4A 4E47A 4PNOA 2FPFA 4C92E 1B34A 4ZN3A 3MHXA 1BKBA 2YRCA 3LLRA 1UEBA 2MF2A 3BDLA 1PG5B 2DXCA 2CH4A 1H3HA 4BY6B 1IHWA 2GQVA 3REBB 4A54A 4LNPA 1WPYA 2EFIA 2L3SA 4FM4B 4C0GA 3V8LA 2LQ8A 4E7IA 3RNJA 1CSKA 1D0YA 3G6EA 1TTHB 4KRTA 3L2UA 1W1FA 1K0SA 5KCHA 2YUOA 4NOYA 2PUOB 2CKKA 4M77D 4BD3A 4EDUA 1GCPA 3OYMA 1ZA1B 2A3LA 2SEMA 4HXJA 3RESA 3JCMe 1RAFB 1IB8A 3M0UA 4M75C 2RM4A 3HL8A 3ULRB 3H0HA 1BYMA 3ER0A 2RI3A 2MIOA 2EYQA 1N9SA 2E64A 4DQ2A 1WJSA 4HVWA 2DKGA 5CKEA 2OTJA 3RBBB 2KMTA 4GLMA 1VQ7A 1X6OA 1E6GA 4D8KA 4PJOG 2LDMA 1QVGP 2CUDA 4E7LA 2QG9B 3LYIA 3CC4A 1WI7A 4UC4A 5GAN5 3VUZA 2QQAA 1I4K1 4F7UA 1ZUUA 2RQRA 3EFSA 4ANJA 1HD3A 3SWNB 3INZA 4PJOD 3I56A 2WSFE 4LD9K 4M7AF 4EIKA 3I55Q 2MMPA 1NEGA 3X28B 1K9MU 3EGXA 1WJRA 2WACA 2K79A 4IIOA 1FMVA 1PRLC 3A5ZB 3CCJQ 5GAMj 8AT1B 1UDLA 3FC3A 1N5ZA 1MNEA 4QQDA 1R0CB 4EPCA 1YJWQ 1E6HA 2RHXA 5A0LA 4RTXA 4OB1B 3P8DA 3EG9B 1AVZC 4RCCA 4J9HA 2XI9A 3CEYA 1IXDA 2LNVA 2RHYA 2EVRA 1K8AU 4RUGA 1ZUYA 2XDPA 1QWFA 3QG1A 1X2QA 2LQKA 4RCBA 3EHRA 3UPUA 4FYVB 4RG8A 4RTTA 4LDXA 5HY6A 4C8QG 1AOJA 4X9DA 1S72T 3M57A 3M53A 2HD0A 3H6ZA 2H3JA 2QEXA 3OBYA 4M7DB 3ZFJA 4M78A 2YXYA 3CCQT 4M4ZA 1M30A 3T9NA 1Q82C 2IIMA 1YHQA 1XNIA 5IN1A 2O9VA 2JNGA 1FXXA 3V8KA 1WQWA 3H0FA 4M78C 3GLXA 1QVFP 1TS9A 3FLGA 4Z02A 5CKFA 2P84A 1VQ6T 4LXCA 2A7YA 3QWXX 5GAOm 1X01A 4HCBA 2FB7A 3CCUT 2F69A 3JCMg 3CPWA 1EIFA 1Q7YR 2JM8A 2KRMA 4K11A 1KFZA 2MYSA 2NUPA 1CKAA 2DILA 1D0XA 4F16A 2KBTA 1Z9QA 1PM3A 3SDZA 1D1AA 1WHGA 2RQVA 2QGGA 2YLBA 5I11A 1KSWA 2F2VA 2KT1A 1ZBJA 2VV5A 2QYZA 3A8OB 3V7RA 3A8LB 2P4TA 2ZCFB 3HRTA 3VRYA 1K73R 3VS6A 1MMNA 4KH1B 3HRUA 1UGQB 4C5GA 2QXFA 2JXBA 4M7DG 3URGA 2LCSA 3QPHA 4C5EA 4PKCC 3AT1B 3OW2P 2OAWA 2DYIA 4B9WA 4JRQA 2O31A 3VRZA 3SWNC 2H8HA 2JUFA 1KC8C 1IO6A 4VUBA 3CMEA 2JT4A 4PFPA 1VQ8A 4KUIA 1ZBXA 3BDUA 2DL4A 3CC7Q 3UT1A 1MGQA 4OMQA 1XTDA 2EGEA 1U06A 2AZVA 3NMZC 3CCVQ 1VQ7Q 1VYUA 3CCMA 3VU3C 2VXFA 4J6XA 1WDXA 1RLPC 1V1CA 3RKXA 2YT6A 1D3BB 1C0MA 4M75E 3WVEB 2K9GA 2M16A 5ECAA 1TUCA 3I35A 3JCMX 1K73U 1Q82U 1YJ9Q 4C0DB 3OYBA 2LNHB 1TUGB 1VQ4T 4J9EA 1B3QA 2JMCA 5I2SA 1UGVA 2XIDA 1SF9A 3JCMW 3ASKA 3OYCA 3QDFA 3IQLA 5KYWA 3PTAA 5J39A 2Z0WA 2RI5A 4RG2A 2DE0X 2G6FX 3G71Q 2FZKB 2X3WD 3CBPA 4N0AC 1OULA 1JQQA 2CP5A 4KGXB 4KUDK 2K6DA 2RPNA 2RO0A 1VOMA 2V8KA 3META 4AFUC 2C0OA 2CT3A 3MKDA 4OB3B 4DEYA 3L2RA 1RAAB 3M9QA 1GFCA 1BIAA 1NYFA 3QO3A 4P5NA 4C92F 2JZ2A 1SPKA 3M5AA 2CP7A 2RJEA 3X25B 1YIJQ 3OYGA 1TXQA 2K3YA 1JO8A 1N6AA 3DLLA 1M3BA 4JPBW 3G6EQ 2RH2A 4Y91A 4DBQA 1MMDA 4AG2C 1VQ4A 4J7FA 4ATOA 1KQSP 3G1JA 3HRSA 3LH5A 2DNUA 4XTVA 4EMHA 1JXOA 4QVZA 4J9GA 2LJ1A 1S1NA 2HL3A 2I2LA 3CQTA 1ABOA 3KBGA 3OMCA 3QIIA 3ZL7C 2L5QA 3CBMA 1ZSGA 2J06A 3HKSA 2CZ6B 4A4KA 4PJLA 5LJ5d 1IHVA 1YN8A 3OS5A 2DEUA 2QTXA 2OI3A 2VGMA 2OTLT 3HFNA 1QKXA 2FPEA 5L23A 1VQNA 5LJ5e 4WCIA 2P0PA 1ZA2B 4ZGEB 1FWZA 5IAYA 3I56Q 2LJ0A 1HSQA 1TOVA 5FU6B 4CC4B 5GMKl 5CO7A 2KR3A 3S3NA 4A4EA 1J3TA 3FJ5A 3KFVA 3R6NA 1QP2A 1NLOC 2BUDA 3GPLA 4Q5WA 2XMFA 3KUFA 3GF5A 1Y0MA 1A0NB 1NEBA 4C5HA 2X3XD 4HT9A 3PIPA 4BDZA 1X69A 3CC7A 2R57A 4QT7A 2YUNA 1KQ2A 3CMAQ 3CC2Q 2QI2A 2KAFA 1SKUB 1GCQA 2YWWA 3FEOA 2CZ0B 1VQKA 3CMET 3N5BB 4XU3A 1WFWA 2KVQG 1KIKA 1YITT 2YUQA 2X9HA 4LUDA 3CCET 1I07A 5DLOA 4MMLA 1K1ZA 3TSWA 1Z9ZA 1GL5A 1NLPC 4FT4A 3OYNA 4CRIA 5GAOl 1Q81C 1M1KR 2K5FA 4M75B 2NWMA 2D0NA 1NBEB 1Y96B 3A1PA 2DXUA 1HJDA 1SRLA 4F04B 5A0GA 2D0QB 5CKDA 4C5IA 2HDAA 5IH2A 3EH2A 3VS3A 5A2QE 1Y57A 1ARKA 4QVCA 1P92A 2DTOA 2KXDA 4MDXA 3S3OA 1NPPA 3MPUB 2IPOB 2X4XA 1V76A 1VIEA 5CAIA 1V29B 2MAMA 4C92D 4NS5A 1S72Q 2CSQA 2K4YA 1VQMT 1KC8U 5IHKA 2JJ9A 3CXCP 3PVLA 1VQKT 2EPDA 2J05A 2A28A 2GCXA 3JCMb 3JCMh 4ZTJA 8ATCB 2EQMA 1NG2A 3OB9A 3QHSA 2FZGB 3EG2A 3TREA 3EG0A 2FPDA 1LJOA 3VYGA 5GMKm 3BY7A 4PLLA 1O75A 1M90U 4DOVA 2LX9A 4ZGJB 5EC7A 2DIQA 2MPXC 4MZTA 1AEYA 4ELZC 2BE7D 2CS7A 2HNIA 2BE9B 2M0YA 4A4FA 1LOJA 1YP5A 2GTOA 5M9OA 4M7AG 5LJ3d 2E41A 2NUTB 2LZ6B 4KGVB 4KULA 3OYHA 5GAOr 1YWOA 2FYKA 1UGSB 2LRQA 4JUVA 2LCLA 2GF7A 1M8MA 4M77B 4ORZA 1PKSA 2YSQA 2RN8A 2KY9A 4PJOC 5FU6C 5C6SA 2KRNA 1OZ3A 4R55A 4GY5A 4AFZC 2VYTA 1RABB 2LQNA 1KK7A 4XU2A 4XTWA 4IUTA 1RUWA 1Q95G 3C0CA 3I5RA 2D6FA 5CQYA 1OYXA 3RKYA 2E5QA 2LJ3A 2QEXQ 3QDRB 1ZSZB 5IT9E 1AWJA 5CK9A 1LNXA 1T0HA 2P4RA 1Q81U 2CDTA 2P0KA 3NHNA 2L8DA 5D6XA 4B6MA 1G3SA 5GANd 1OQKA 1WYXA 4FCYA 1M1KC 1OPKA 1VQ5A 1G83A 1QWEA 1QVFS 1QP3A 4XU1A 1NJIU 4HA8A 2L3RA 3SB2A 3F70A 3A98A 3EGXB 3HP9A 4FT2A 3I55T 1VQ7T 2DBMA 3RUXA 4N0AA 1KQ1A 2M1HA 1NZ9A 4IURA 1ZX6A 1BI1A 1YI2T 2RI2A 1QVFA 3OW2S 4M75D 3C12A 4ZGDB 2EYWA 2Y4YA 4Z88A 1H641 5GAMh 2SRCA 4F14A 1Q86C 4OGEA 1XOVA 4E7ZA 1UE9A 1UTIA 2RHUA 1M2VB 3L1AA 2PUKB 3J81E 2K2VA 3CC4Q 4M7AA 4V2SA 5J26A 3QYGB 2DYBA 2M51A 2EIFA 2HSEB 3CCEA 5AT1B 4KH0B 2RNAA 3CCLT 1N27A 4A53A 1TG0A 4YTLA 2A37A 3FDRA 2VGNA 3JB9D 4Z89A 2R5MA 1T0JA 3R6OA 1LCKA 2K3XA 3NTKA 5CKBA 1R0BG 5KE3A 1UB4A 3CCVA 1BB9A 4A4HA 4PL6A 4L59A 1OZ2A 2L0AA 5D7UA 1WJQA 3RIRA 4JLGA 1WHJA 3NPFA 1X6GA 4JLIA 2DA9A 2VB6A 5FROA 1VQ6Q 4C0DC 1K9MC 1VQLT 1RL2A 2FZCB 2X4JA 1BI2A 4F7UG 3JCMP 5KYXA 2JMAA 1BCOA 2GTJA 4JJDA 1VQ8T 3MCAB 3KXTA 1G8XA 3LGLA 3OYKA 4N4HA 1OI1A 1AT1B 1Y96A 5I2MA 1UUEA 2QA4T 3EAEA 3CD6T 1KD1R 4LDUA 1WA7A 3CXCA 4M77G 5DLQE 2PU9B 2PNIA 3OYEA 2RB6A 3EFOA 1FYNA 4KGZB 2MCNA 2JTEA 2AIRB 1X75C 4J9CA 3M0TA 4PJNA 1YNZA 1E7OA 3PGGA 2EAYA 2MOXA 4JRKA 3S6WA 1QVGA 5GAN7 3JRZA 1R77A 4XQ3A 1M1FA 3V7SA 2DL5A 2XKOC 1U1SA 5CCAA 3TSZA 4M77E 2EQJA 1UG1A 5HCKA 2ZZDA 3LW5E 1X6BA 3THKA 4JJNK 2K5LA 3L2VA 1YJNT 1VQPQ 3JCMf 1D3BA 4RTZA 4F7UE 2LQWA 1MHNA 1K9AA 3ZBDA 1LPLA 1UGPB 2DETA 4PJOF 1Y7XA 1YHQT 3EG3A 1TSFA 2DM1A 1RLQC 1N8RR 1KG1A 4M7DF 2BIVA 1M90C 5HK0A 2OTJT 2J7IA 3JCMc 2X51A 1WHLA 2HSPA 2RJCA 2GBQA 2ZPFB 3X24B 4C8QA 4DBHA 2HBPA 3E2UA 4BACA 3A8HB 2KEAA 3OYDA 1HK9A 2V8IA 2L2PA 3CPWS 1TUDA 2FRYA 5KYYA 3RDVA 3CCSQ 1ZSZA 4O6JA 2PTKA 1OEBA 4DEXA 4R0KA 3OW2A 4DOWA 4FSXA 3M0PA 3OSSC 3LWIA 4PK4A 2KROA 4LUEA 5KYUB 1ZLMA 2X4YA 3EGDA 1N8RC 2H3EB 4II1A 4A4GA 4QQ6A 3JCMQ 1VQNT 2E3HA 1VQOT 4B9XA 1K76A 2V26A 3QJYA 4O5VA 4OVAA 1IGUA 3QZ5B 5CR2A 5IHIA 3CCJA 3G4ST 1TWBA 2QASA 3JB9I 2HKQB 1Q86U 2BKDN 3DKMA 1IREB 5CKHA 4BY6C 5C0MA 2JN0A 1MV0B 3GNGA 1WXTA 2QQSA 1BU1A 2RMOA 1YWPA 2EJGA 5GAMe 2FO0A 2PQWA 1WQ7A 3M4GA 4ZNXA 1AZGB 2D8HA 4RTUA 1AHJB 3G7ZA 4FYWB 3CCMT 3VKIA 2LT1A 3OYYA 1FMWA 2X35A 4J9IA 1BK2A 4FIBA 1B34B 2X4WA 3VYHB 2E6NA 2ROTA 4IUVA 4MZMA 4ESRA 3DLMA 4BE1A 4M7AB 4J5YA 1D1CA 1KHCA 1VQMA 2AZSA 3I55A 2KK4A 2O9SA 3UF4A 2DRKA 4BE0A 4X34A 5GAMd 5IXFA 1RAEB 3H0IA 1D09B 1AWXA 1S72A 1HXDA 2YRVA 3RMSA 4BB7A 2QQRA 2DD5A 2E6ZA 3CMAA 3CC2A 2DVJA 4PFOA 2CSIA 2FVUA 2RQTA 2O4XB 3QZ9B 3CC7T 3GIBA 1DJ7B 1VQ9T 3V8JA 1WX6A 1AD5A 1HYOA 2RD1A 4M7AE 3A8GB 5GMKh 3CCJT 4J6WA 2VC8A 4C92C 4FYYB 3L2QA 5FRMA 1F1BB 4OMOA 1RI0A 1JRIA 1C6VX 2DL8A 2GNCA 1D1BA 4RMOA 1MUZA 4AT1B 3LGFA 3OS2A 2A36A 5GAMg 4J9FA 1JB0E 2L89A 2W0ZA 2EGAA 4CC2A 5DM7R 3OYFA 4PLIA 5GMKi 2MWOA 4MDWA 4RTYA 2V1RA 4C8QD 4RTVA 3M54A 2VKNA 2DLPA 4F7UB 3HHTB 4EMKC 2E1HA 2YLCA 3CCUA 4HT8A 3CD6A 3UDCA 1IGQA 4EMKA 2F5KA 4IUPA 5GANj 2BZXA 1PNJA 4AG1C 1X43A 3A8MB 1YJWT 3CCRT 3VS0A 9ATCB 2DAQA 4E2FB 1UJYA 2DZ9A 3DB3A 2J6KA 2LX7A 2CP2A 3L2WA 2QQ9A
chains in the Genus database with same CATH topology
5GANd 1YCYA 3FB9A 3H8ZA 4E7HA 1WQWA 3O8VA 2ZPHB 3TCJA 3LWHA 1G3WA 1M1KC 4M78C 3GLXA 1VQ5A 4RKUE 1QVFS 2OAUA 3FLGA 1QP3A 3PNWC 4XU1A 4Z02A 5GAN3 5CKFA 1TH7A 3C94A 1VQ6T 4M75A 4HA8A 2A7YA 2L3RA 3SB2A 5GAMf 3F70A 3QUIA 4OB0B 1NJIU 2K5IA 2DK3A 1YJNA 3HP9A 4FT2A 3I55T 3TEEA 1VQ7T 5GAOm 4R56A 1X01A 4HCCA 3RUXA 4C92G 4HCBA 4N0AA 2FB7A 1G3TA 4BE2A 3CPFA 3CCUT 2XICA 4M78B 2F69A 1KQ1A 4JDSA 3E9FA 2CZ7B 3JCMg 3G4SA 3CPWA 2M1HA 1W2BS 1EIFA 1NZ9A 4IURA 5LJ3g 4D6WA 2EJFA 1VQ5T 2D9TA 1M9SA 4JS5A 2LC4A 1BI1A 3S3MA 3E9GA 5GAOq 4QVDA 1YI2T 3VJPA 2RI2A 1QVFA 1WNLA 4NL2A 3OW2S 5L8RE 2EKOA 1R8OB 1BIBA 3CCSA 4M75D 1NPRA 3C12A 2Y4YA 3SDZA 4ZGDB 3CCST 1YIJT 3JCMV 1H641 5GAMh 1VQ9T 4BI8B 1VIFA 2YLBA 3OYLA 3CXCS 5LJ5h 3OYIA 2HQEA 5FU7B 3NFCA 2GFAA 4OB2B 2VV5A 3HFOA 2R5AA 4OGEA 2KSSA 3A8OB 2DIGA 3A8LB 3V7RA 1Q86C 5GAOp 1XOVA 2P4TA 2RHUA 2ZCFB 3HRTA 2PVOB 2DZCA 1BI3A 1GXIE 2F5TX 3L1AA 2PUKB 3JAME 3J81E 4M78E 2K2VA 1YJ9A 4M7AA 4MZPA 1VQPA 4V2SA 5J26A 3PMTA 2ZPIB 1M1KU 3QYGB 3HRUA 1UGQB 3J7AF 4C5GA 2QXFA 5LL6S 1PSFA 2EIFA 3CCEA 3URGA 4ZTFA 4M7DG 3QPHA 4IUQA 4PKCC 4C5EA 2IG0A 5CQXA 3CCLT 1NJIC 1N27A 1VQLA 4A53A 4B9WA 2GFUA 4C92B 3MP8A 4L5GA 2Y4XA 3MP6A 4YTLA 3VV0A 3WXMB 4JRQA 3PT9A 3FDRA 1KQSA 2VGNA 2JUFA 2DJZA 3QJ6A 2XG8D 3SWNC 3JB9D 5HK3A 1KC8C 4VUBA 3M59A 3RKWA 5IN1A 3CMEA 1VQ8A 2R5MA 3R6OA 5KE3A 2VUBA 2K3XA 3NTKA 5CKBA 3X20B 5GANg 1UB4A 4KUIA 3CCVA 1VQOA 3CBOA 1ZBXA 3BDUA 3RMQA 3X26B 3CCRA 5D6YA 3UT1A 2ZGWA 4A4HA 3G71A 2KQWA 4PL6A 1MGQA 1OZ2A 3ME9A 4L59A 1WJQA 3RIRA 5GMKj 1XTDA 4JLGA 3G6ET 1JBMA 1G3SA 4JLIA 1FX7A 2DXTA 3OY9A 2EQUA 2LVMA 3CCMA 2LT4A 3VU3C 2VXFA 2EJ9A 4J6XA 3SFMA 5FROA 5LJ5f 4C0DC 3OA6A 5A0DA 3P8BB 1K9MC 1VQLT 1G3YA 3RKXA 1RL2A 4EMKB 2HAXA 2X4JA 1BI2A 1D3BB 5CVIA 2CZ1B 3L2RA 5AYFA 4ME7A 3MEWA 4F7UG 4M75E 2WSEE 3WVEB 3JCMP 2JVVA 3E19A 4QW2A 4NL3A 2M16A 1VQ8T 4BUGA 3QSUA 1H3ZA 1N9RA 3MCAB 3JCMX 1PSEA 1K73U 1Q82U 1G5VA 4C0DB 3OYBA 1VQ4T 2PVDB 3KXTA 3LGLA 3PMIA 3M4YA 3OYKA 4N4HA 3M58A 1OI1A 2RHZA 5I2MA 1Y96A 5I2SA 1YITA 2RHIA 2QA4T 3EAEA 3JCMW 2XIDA 4HKEA 2JOYA 3ASKA 3OYCA 3CD6T 3OYJA 3QKJA 3PTAA 5J39A 4LDUA 4QQGA 4KBMB 5CIUA 3CXCA 3NTHA 2RI5A 4RG2A 1NE8A 4M77G 4KT0E 5DLQE 2PU9B 3OYEA 4XU0A 1YI2A 2C06A 2G3RA 2RB6A 1W4SA 3FJPA 1YJWA 4CI0C 4JS4A 2DEQA 4M77F 3CBPA 4E7KA 4N0AC 2P0QA 4BDYA 3DB4A 1WGSA 1X75C 2LTOA 4KUDK 3UWNA 2RO0A 3EFRA 3CC4T 3PGGA 1I8FA 2EAYA 2V8KA 3META 4JRKA 3S6WA 1QVGA 3JB9G 2NLUA 4BI4A 5GAN7 3L42A 3JRZA 1O9SA 3VUBA 1KD1U 1KQSS 4XQ3A 1M1FA 3V7SA 4OB3B 3GOXA 2XKOC 1U1SA 4LDYA 1Y07A 2XK0A 5LJ5g 5CCAA 3M56A 5GAN8 4M77E 2EQJA 3ZEHA 3I56T 2ZZDA 3LW5E 1KHIA 2E70A 2JTFA 2ZPBB 2XHCA 4XTZA 3M9QA 2XDBA 5GMKe 1BIAA 3QO3A 4LDVA 5LJ3e 1M8VA 1IZ6A 3PFSA 2DTHA 3OBWA 4P5NA 4C92F 2JZ2A 3QBYA 3M5AA 2M0OA 4JJNK 2XD0A 4PJOA 2RJEA 3X25B 2XDDA 3OS1A 3OYGA 2EWNA 2K5LA 3BW1A 2RJDA 1U1TA 4XTXA 5LJ3f 5DY9A 2K3YA 1N6AA 3L2VA 4XAXB 1Y71A 3DLLA 2V8JA 1JJ2A 3FIFA 5GANe 1YJNT 1JJ2S 2RH2A 4Y91A 1QVGS 3JCMf 1D3BA 4M75G 1VQ4A 4J7FA 4F7UE 3M55A 1MHNA 4OP0A 3JCMJ 4ATOA 3MEUA 3ZBDA 3HRSA 2JTMA 3TU4K 1UGPB 4XTVA 3V8KA 4EMHA 4QVZA 4PJOF 1Y7XA 1YJ9T 1ZQ1A 2DPPB 2CGHA 1YHQT 1K8AC 3NTIA 2XU8A 2I2LA 5FU7C 3KBGA 3C4SA 3OMCA 3QIIA 4F7UF 1SSFA 4C8QC 5GAN4 2BIVA 4M7DF 1KG1A 4TVRA 2EQKA 1M90C 3GP8A 2L5QA 2FL7A 3CBMA 4JRIA 3GNFB 5D6WA 3HKSA 2CZ6B 4A4KA 5HK0A 2OTJT 3JCMc 5LJ5d 2MWPA 4M7DD 2MI6A 3OS5A 1KD1C 4C8QF 4M75F 4N4GA 4IKFA 2RK2A 3RERA 2RJCA 2QTXA 2ZPFB 2VGMA 4XTYA 3X24B 3HFNA 4C8QA 3G71T 2OTLT 2HBPA 2PVGB 4BACA 3A8HB 4OGCA 3OYDA 1HK9A 2R58A 2V8IA 3V7CA 5LJ5j 3CPWS 1VUBA 5J3BA 5GAOn 1VQNA 1YIJA 3CCQA 4M7DE 5GANf 1U8RA 1M1GA 2HQXA 5LJ5e 5FLXE 3QXEB 4FU6A 2QEXT 4O6JA 2WSCE 1UGRB 4M78G 4L6V5 3OW2A 4DOWA 3WVDB 2P0PA 4FL6A 4FSXA 3OSSC 4ZGEB 3LWIA 4LD6A 1FWZA 3MO8A 5KE2A 2X4YA 1N8RC 5IAYA 4OF1A 1VQ6A 2E10A 4II1A 4A4GA 1Q7YC 3JB9F 2CYZB 4QQ6A 4MMKA 2Y90A 3JCMQ 1VQNT 4JRPA 5FU6B 3PIOA 1VQOT 4B9XA 5GMKl 5CAIA 4O5VA 3QJYA 1QW1A 5CO7A 3S3NA 4OVAA 4GLKA 4A4EA 3QZ5B 2DO3A 5CR2A 1Q7YU 3CCJA 3C95A 3G4ST 4Y28E 3JB9I 1QP2A 4C92A 2K57A 1Q86U 2BKDN 2BUDA 1IREB 3DKMA 3LH0A 4M78D 3L2ZA 4XTUA 5CKHA 4Q5WA 3GPLA 2QQBA 3OS0A 3MEVA 4BY6C 3HPWA 3KUFA 3GF5A 5C0MA 2QA4A 2JN0A 4C5HA 2DD4A 3PIPA 4E47A 1VQPT 4HT9A 4PNOA 4BDZA 4DA4A 3CC7A 2R57A 3GNGA 1B34A 4C92E 3MHXA 4ZN3A 1BKBA 2QQSA 3LLRA 2O01E 5I21A 1UEBA 2EJGA 4M7DC 2MF2A 3BDLA 5GAMe 1KQ2A 2PQWA 1WQ7A 2DXCA 4X9CA 3CCVT 2QI2A 2KAFA 3M4GA 3J80E 3SWNA 3FEOA 4BY6B 2CZ0B 1VQKA 2OTLA 3CMET 3N5BB 2GQVA 4XU3A 2KVQG 4A54A 3BFMA 1AHJB 1WPYA 1YITT 4M7DA 2EFIA 2KDSA 4J7IA 3G7ZA 3P8HA 4FM4B 4M7AC 4C0GA 3V8LA 5KH6A 2LQ8A 3CCMT 4E7IA 3VKIA 2LT1A 1YBYA 1W2BA 3CCET 3OYYA 3G6EA 3AHUA 2VXEA 2X35A 4FIBA 5DLOA 3CC2T 3CMAT 4J8OA 3L2UA 4MMLA 1B34B 2X4WA 3VYHB 5KCOA 2E6NA 3OQ5A 4IUVA 5KCHA 4MZMA 4FT4A 4NOYA 2PUOB 3SD4A 4CRIA 5GAOl 3OYNA 1Q81C 3DLMA 2K5FA 4BE1A 2CKKA 4M75B 4M7AB 4J5YA 1KHCA 4M77D 1Y96B 1VQMA 3I55A 4ELYC 2KK4A 2RK1A 2DXUA 4C8QE 3GIBA 4BE0A 4BD3A 4X34A 5A0GA 3JB9H 2DVEA 3E1SA 4EDUA 2RA2A 2D0QB 5GAMd 3OYMA 5CKDA 1QVPA 4C5IA 2A3LA 5FRNA 1S72A 3RESA 3JCMe 5A2QE 1HXDA 2YRVA 4M75C 2RM4A 3HL8A 3RMSA 4BB7A 3Q1JA 2QQRA 2DD5A 2E6ZA 1BYMA 3ER0A 4QVCA 1P92A 2DTOA 3CMAA 3CC2A 4MDXA 2RI3A 3OYAA 4C0FA 2FVUA 3S3OA 1NPPA 2ZPEB 2EYQA 3MP1A 2O4XB 1N9SA 3QZ9B 2E64A 2X4XA 1VIEA 4HCZA 1DJ7B 1V29B 1WJSA 2MAMA 4NS5A 4C92D 4DQ2A 2DKGA 4J6YA 1BI0A 3V8JA 5CKEA 4E7JA 2OTJA 2K4YA 3CCLA 4XK8E 2KMTA 1VQMT 4EMGA 1KC8U 1VQ7A 2RD1A 1X6OA 4M7AE 1VQKT 1I5LA 4PJOG 3A8GB 2LDMA 2E12A 2GCXA 4BI3A 4E7LA 3LYIA 1ZHIA 3JCMh 5GMKh 3JCMb 3CCJT 4ZTJA 5EG2A 3CC4A 4C8QB 4UC4A 5GAN5 4J6WA 5LJ3h 2EQMA 2VC8A 3VUZA 3JB9J 2QQAA 1I4K1 4C92C 4F7UA 3OB9A 3QHSA 1M5Q1 3L2QA 5FRMA 3JSCA 3EFSA 2IVWA 1RI0A 1JRIA 3TREA 3SWNB 3INZA 1LJOA 3VYGA 4PJOD 5GMKm 1M4ZA 3BY7A 3I56A 2WSFE 4PLLA 1O75A 1M90U 4DOVA 2LX9A 4LD9K 4M7AF 2MMPA 5GAN2 5HKCA 4RMOA 4OMFB 2B8AA 3X28B 4ZGJB 3LGFA 1K9MU 4LDWA 2DIQA 4MZTA 1WJRA 2WACA 4J83A 4ELZC 5GAMg 3OS2A 2CS7A 2HNIA 3A5ZB 3OSVA 1JB0E 2L89A 2M9UA 4A4FA 2AHJB 5GAMj 3LX7A 5GAN6 1LOJA 4N4IA 4C0ZA 4PJOE 5DM7R 3OYFA 2ZPGB 4PLIA 5GMKi 3FC3A 2MWOA 4MDWA 4QQDA 3QYHB 4C8QD 2YHTA 5LJ3d 2E41A 5M9OA 2E65A 3M54A 4M7AG 2LCCA 1K73C 4F7UB 4KULA 3OYHA 3FRNA 3HHTB 4EPCA 5GAOr 4EMKC 2FYKA 1UGSB 2E1HA 4ZN1A 2YLCA 3CCUA 2LRQA 2RHXA 4JUVA 4HT8A 5A0LA 2LCLA 2GF7A 4M77B 4OB1B 3P8DA 3UDCA 3CD6A 4RCCA 3HSBA 4IUUA 2XI9A 3CEYA 2KY9A 4PJOC 2LNVA 2FHDA 5FU6C 4EMKA 5C6SA 1OZ3A 4R55A 2F5KA 1VQ9A 4GY5A 4IUPA 2RHYA 1K8AU 2VYTA 5GANj 2XDPA 1I81A 3QG1A 2LQKA 4XU2A 4RCBA 5GANh 3JCMd 3UPUA 1N8RU 1XQHA 3A8MB 4RG8A 1YJWT 4M77C 4XTWA 4IUTA 5HY6A 4C8QG 4LDXA 4M7AD 4X9DA 3CCRT 3MEAA 2O4XA 2D6FA 1S72T 5CQYA 1OYXA 3RKYA 2E5QA 3M57A 4PJOB 3M53A 5LJ3j 3QDRB 3OMGA 5IT9E 2HD0A 5CK9A 2DXBA 1LNXA 4WF2A 2RJFA 2DAQA 4M77A 3H6ZA 3CC7T 1Q81U 2QDYB 2H3JA 2QEXA 3OBYA 4M7DB 2DZ9A 3DB3A 3ZFJA 4M78A 2P0KA 2L8DA 3CCQT 5D6XA 4M78F 2DTIA 3T9NA 1Q82C 3L2WA 1YHQA 1XNIA 2QQ9A 2JNGA 1FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN d;  1YCY A;  3FB9 A;  4NL3 A;  1HK9 A;  3V7C A;  1WQW A;  5LJ5 j;  4QVC A;  2DTO A;  4M78 C;  5GAO n;  3QSU A;  1N9R A;  3JCM X;  4M7D E;  1N9S A;  5GAN f;  2E64 A;  4XU1 A;  5GAN 3;  3GIB A;  5CAI A;  1TH7 A;  4DQ2 A;  4C92 D;  5LJ5 e;  2DKG A;  4HA8 A;  4J6Y A;  4M75 A;  3SB2 A;  3V8J A;  5GAM f;  3QUI A;  4M78 G;  1Y96 A;  3JCM W;  4EMG A;  2RD1 A;  5GAO m;  1X01 A;  4M7A E;  3RUX A;  4C92 G;  4N0A A;  2FB7 A;  4M78 B;  4PJO G;  1I5L A;  1KQ1 A;  4M77 G;  3JCM b;  3JCM h;  3JCM g;  5GMK h;  2E10 A;  4XU0 A;  4C8Q B;  5GAN 5;  4J6W A;  5LJ3 h;  5LJ3 g;  2RB6 A;  2VC8 A;  3FJP A;  4F7U A;  1I4K 1;  2Y90 A;  4MMK A;  2EJF A;  3QHS A;  1M5Q 1;  4C92 C;  3JCM Q;  2DEQ A;  3EFS A;  4M77 F;  5GMK l;  1JRI A;  4N0A C;  3SWN B;  3INZ A;  1LJO A;  4PJO D;  5GMK m;  3BY7 A;  4QVD A;  5GAO q;  4M7A F;  1WNL A;  3EFR A;  4NL2 A;  5GAN 2;  3PGG A;  1I8F A;  2EAY A;  3JB9 I;  3JCM P;  4JRK A;  1BIB A;  4C92 A;  2K57 A;  3JB9 G;  4M75 D;  5GAN 7;  4XTU A;  3JB9 J;  4M78 D;  3L2Z A;  3JCM V;  4XQ3 A;  1H64 1;  3V7S A;  5GAM h;  2HNI A;  5GAM g;  2YLB A;  5GAN 8;  1U1S A;  5LJ5 g;  5LJ5 h;  2JN0 A;  4M77 E;  5GAM j;  4HT9 A;  5GAN 6;  1LOJ A;  3HFO A;  3JB9 F;  4PJO E;  4PNO A;  4XTZ A;  3V7R A;  5GMK i;  5GAO p;  5GMK e;  1BIA A;  4C92 E;  1B34 A;  4C8Q D;  4M7A G;  2YHT A;  2DZC A;  2E41 A;  3QO3 A;  2E65 A;  5LJ3 d;  2DTH A;  5LJ3 e;  5I21 A;  1M8V A;  2EJG A;  3L1A A;  4C92 F;  4F7U B;  5GAM e;  1KQ2 A;  4M7D C;  4PJO A;  5GAO r;  1WQ7 A;  4M78 E;  4EMK C;  4X9C A;  2FYK A;  4M7A A;  2E1H A;  3M4G A;  2YLC A;  2EWN A;  4V2S A;  3BW1 A;  3SWN A;  1U1T A;  4JUV A;  4XTX A;  5DY9 A;  5LJ3 f;  4HT8 A;  4M7D G;  4M77 B;  4XU3 A;  4RCC A;  4A54 A;  3BFM A;  3FIF A;  5GAN e;  3HSB A;  1WPY A;  4M7D A;  4A53 A;  4Y91 A;  4C92 B;  4PJO C;  4EMK A;  3JCM f;  4M7A C;  3V8L A;  1D3B A;  4M75 G;  3SWN C;  4F7U E;  2DJZ A;  3JB9 D;  4OP0 A;  3JCM J;  5GAN j;  3RKW A;  1I81 A;  3AHU A;  4XTV A;  4EMH A;  2VXE A;  4XU2 A;  4RCB A;  5GAN g;  3JCM d;  5GAN h;  4PJO F;  4MML A;  4M77 C;  4XTW A;  1B34 B;  4C8Q G;  3BDU A;  4M7A D;  4X9D A;  2CGH A;  2ZGW A;  4NOY A;  1MGQ A;  5GMK j;  3RIR A;  3RKY A;  2I2L A;  5GAO l;  4PJO B;  4M7A B;  4M75 B;  5LJ3 j;  4J5Y A;  1JBM A;  4M77 D;  4JLI A;  5GAN 4;  4F7U F;  4C8Q C;  1Y96 B;  2DXT A;  1LNX A;  4WF2 A;  4M7D F;  4M77 A;  3VU3 C;  2DXU A;  2EJ9 A;  2VXF A;  4J6X A;  4JRI A;  4C8Q E;  5LJ5 f;  3JCM c;  5LJ5 d;  4M7D B;  2DZ9 A;  3JB9 H;  4M7D D;  2DVE A;  4M78 A;  5GAM d;  2RA2 A;  3RKX A;  4C8Q F;  4EMK B;  4M75 F;  1D3B B;  3RER A;  4M78 F;  2QTX A;  2DTI A;  4XTY A;  3RES A;  4C8Q A;  3HFN A;  3JCM e;  4F7U G;  4M75 E;  1HXD A;  4M75 C;  2RM4 A;  3V8K A; 
#chains in the Genus database with same CATH topology
 1YCY A;  3FB9 A;  1UHF A;  3O8V A;  2ZPH B;  3EH1 A;  3I5S A;  3TCJ A;  1G3W A;  1WXB A;  1NJI R;  4FW1 A;  4RKU E;  1I1J A;  3PNW C;  1OX9 A;  4M75 A;  5GAM f;  1TU0 B;  3QUI A;  2K5I A;  2JS0 A;  2DK3 A;  4PJM A;  3CCQ Q;  2ZAE A;  1GFD A;  4R56 A;  4HCC A;  4LN2 A;  1G3T A;  3CPF A;  4M78 B;  2EW3 A;  3E9F A;  2CZ7 B;  3G4S A;  1EFN A;  5LJ3 g;  2BZY A;  2QK0 A;  2EJF A;  2OTL Q;  1VQ5 T;  4AFQ C;  1RAH B;  2O88 A;  2LC4 A;  3S3M A;  5GAO q;  1PWT A;  7AT1 B;  2EKO A;  3CCS A;  1NPR A;  4HCK A;  4BI8 B;  1VIF A;  3OYI A;  5FU7 B;  1GCQ C;  4OB2 B;  3CD6 Q;  2R5A A;  1MMA A;  2KSS A;  2DIG A;  1K4U S;  2CH4 W;  2F5T X;  3JAM E;  1AZE A;  1YJ9 A;  2EYY A;  4MZP A;  1VQP A;  3PMT A;  2ZPI B;  3J7A F;  2ABL A;  5LL6 S;  1PSF A;  1KC8 R;  1ABQ A;  4IUQ A;  1M90 R;  2IG0 A;  1VQL A;  2GFU A;  2ED1 A;  4L5G A;  2Y4X A;  3MP6 A;  3VV0 A;  4DBF A;  1BCM A;  4D8D A;  1X27 A;  3VS7 A;  4JZ3 A;  5GAN g;  1VQO A;  3I9Q A;  3X20 B;  3RMQ A;  2DFU A;  5D6Y A;  2ZGW A;  2KQW A;  3ME9 A;  3VS4 A;  2D1X A;  1JBM A;  2KE9 A;  2KRS A;  1FX7 A;  2DXT A;  3OY9 A;  2EQU A;  3U23 A;  2LVM A;  2LT4 A;  2EJ9 A;  3OA6 A;  5KYW B;  2GQI A;  1G3Y A;  5CVI A;  2CZ1 B;  2M02 A;  1QKW A;  3MEW A;  2WSE E;  3E19 A;  4QW2 A;  2VVK A;  1ZUK A;  2K7A A;  2HKN A;  4BUG A;  3QSU A;  5FW9 A;  1PSE A;  1WHK A;  1G5V A;  4J9B A;  3UA6 A;  3PMI A;  3M4Y A;  3M58 A;  2RHZ A;  1YIT A;  2ROL A;  1H92 A;  3NTH A;  1ZSZ C;  3NGP A;  2C06 A;  1W4S A;  4CI0 C;  2HMA A;  1MV3 A;  2DEQ A;  2HCK A;  2JM9 A;  4E7K A;  4BDY A;  3DB4 A;  1WGS A;  4OMN A;  2HBW A;  2LTO A;  1Q82 R;  2C0T A;  1JJ2 P;  3UWN A;  3EFR A;  3CC4 T;  1EX4 A;  3JB9 G;  2NLU A;  4BI4 A;  2F1L A;  3L42 A;  2ENM A;  6AT1 B;  2O2O A;  4LDY A;  2AKL A;  1Y07 A;  2XK0 A;  5LJ5 g;  1OX8 A;  4XTZ A;  1KHI A;  1WZO A;  2E70 A;  2JTF A;  2XHC A;  2XDB A;  1VQK Q;  4LDV A;  5LJ3 e;  3PFS A;  2DTH A;  2RQU A;  2CUB A;  4PJO A;  2XD0 A;  2QAZ A;  1VQN Q;  3BW1 A;  1K9M R;  2RJD A;  5LJ3 f;  2DMO A;  4XAX B;  1Y71 A;  3REA B;  1B07 A;  4M75 G;  2EGC A;  4OP0 A;  4RTW A;  1UJ0 A;  3M55 A;  3JCM J;  5IHN A;  3TU4 K;  1JU5 C;  1PKT A;  3UA7 A;  2EYX A;  1ZQ1 A;  2DPP B;  2CGH A;  4AMC A;  2FG0 A;  4JZ4 A;  2XU8 A;  3M0Q A;  5FU7 C;  2D8J A;  3PE0 A;  4C8Q C;  4FW2 A;  5D6W A;  2FL7 A;  4JRI A;  1JXM A;  2MWP A;  2QGF B;  1W6X A;  1QQJ A;  4N4G A;  3RER A;  4XTY A;  3CCM Q;  2PVG B;  4OGC A;  2MK5 A;  2R58 A;  3V7C A;  1BBZ A;  1VUB A;  1I0C A;  4WTO B;  1YIJ A;  4M7D E;  5GAN f;  2RF0 A;  1U8R A;  1M1G A;  2QEX T;  2WSC E;  1UGR B;  4L6V 5;  4E6R A;  3WVD B;  4FL6 A;  4LD6 A;  1UHC A;  3MO8 A;  5KE2 A;  1FMK A;  1VQ6 A;  3EHQ A;  2E10 A;  1M27 C;  2LP5 A;  2E4H A;  1D0Z A;  2Y90 A;  2FEI A;  3PIO A;  2QDL A;  4GLK A;  3CPW P;  4C92 A;  1VQ9 Q;  4OMP A;  4M78 D;  1RI9 A;  2QQB A;  3OS0 A;  3MEV A;  4JJC A;  2QA4 A;  1YIT Q;  1RAC B;  1VQP T;  2HEQ A;  4HVV A;  1B7T A;  4DA4 A;  2AKK A;  2KYM A;  2AK5 A;  3CCE Q;  2KYB A;  2O01 E;  5I21 A;  4M7D C;  2V1Q A;  2DX1 A;  4X9C A;  3CCV T;  3J80 E;  1PRM C;  3EGU A;  3SWN A;  2OTL A;  1C1A A;  3BFM A;  4M7D A;  2KDS A;  4J7I A;  1AWO A;  3P8H A;  4M7A C;  2QTV A;  5KH6 A;  1WLP B;  2C0I A;  4FSS A;  1W2B A;  1YBY A;  3AHU A;  4DBR A;  2VXE A;  3CC2 T;  3CMA T;  3TVT A;  4J8O A;  5KCO A;  1VQ4 Q;  3OQ5 A;  3SD4 A;  2ED0 A;  1UFF A;  2LMJ A;  3VS2 A;  4ELY C;  2RK1 A;  3EG9 A;  4C8Q E;  3H9N A;  1SHF A;  1U5S A;  3JB9 H;  2DVE A;  3E1S A;  2RA2 A;  1QVP A;  2F2X A;  1MMG A;  5FRN A;  1PD1 A;  5KYN A;  3Q1J A;  3H41 A;  2NUP B;  3OYA A;  1IRX A;  4C0F A;  2ZPE B;  4F17 A;  3MP1 A;  4HCZ A;  4J9D A;  4Z8A A;  1WHH A;  4J6Y A;  1BI0 A;  4E7J A;  3M0R A;  4FYX B;  4XK8 E;  3CCL A;  2EKH A;  4EMG A;  4PJJ A;  3SHW A;  1KJW A;  1I5L A;  3EG1 A;  2E12 A;  4BI3 A;  1ZHI A;  5EG2 A;  4C8Q B;  5LJ3 h;  1YIJ T;  2NUT A;  3JB9 J;  2ESW A;  1M5Q 1;  3JSC A;  2IVW A;  4HVU A;  2VWF A;  4IIM A;  1M4Z A;  5GAN 2;  1VQM Q;  5HKC A;  5GJV B;  4OMF B;  2B8A A;  2CP6 A;  4LDW A;  4J83 A;  3O5Z A;  3RR6 A;  3OSV A;  2M9U A;  2YRD A;  2AHJ B;  3LX7 A;  5GAN 6;  5KYU A;  4N4I A;  4C0Z A;  4PJO E;  2ZPG B;  2FRW A;  3QYH B;  2YHT A;  2E65 A;  2LCC A;  1K73 C;  3FRN A;  4ZN1 A;  1VQ5 Q;  1MND A;  1M3C A;  1I5O B;  3HSB A;  4IUU A;  1GBR A;  2EBP A;  2FHD A;  1Q81 R;  1VQ9 A;  2GGR A;  1I81 A;  4CC7 A;  1UEC A;  2RQW A;  5GAN h;  3JCM d;  1N8R U;  1XQH A;  4M77 C;  4M7A D;  3MEA A;  4JJB A;  2O4X A;  2KGT A;  4PJO B;  1GBQ A;  5LJ3 j;  3OMG A;  2DXB A;  4WF2 A;  2RJF A;  4M77 A;  2QDY B;  1OOT A;  2PZ1 A;  4QKU A;  1RAI B;  3HTR A;  4M78 F;  1RAG B;  1YCS B;  2DTI A;  2DER A;  4FU6 A;  3H8Z A;  2E3I A;  4E7H A;  3LWH A;  2DJQ A;  1H8K A;  2OAU A;  5GAN 3;  1YHQ Q;  1TH7 A;  3C94 A;  4OB0 B;  4OML A;  1YJN A;  2J6O A;  3PVQ A;  2KT8 A;  3TEE A;  4C92 G;  4BE2 A;  1Q86 R;  1T3S A;  2XIC A;  2OTJ Q;  4JDS A;  5GJW B;  1GRI A;  2COW A;  1CKB A;  1W2B S;  3VS5 A;  1M2V A;  1W2B P;  4D6W A;  3M0S A;  2D9T A;  1OV3 A;  1M9S A;  4JS5 A;  2HL5 C;  3E9G A;  4QVD A;  3VJP A;  1RAD B;  2A0F B;  1WNL A;  4NL2 A;  1PC0 A;  1QMC A;  5L8R E;  1R8O B;  1BIB A;  2B86 A;  2VAS A;  3CCS T;  3JCM V;  1PHT A;  3CXC S;  3OYL A;  5LJ5 h;  3CCL Q;  2HQE A;  3NFC A;  2GFA A;  3HFO A;  1QLY A;  1SEM A;  5GAO p;  1GXI E;  1WXU A;  1QCN A;  1BI3 A;  2DZC A;  2PVO B;  2E5K A;  2OX7 A;  1YI2 Q;  3QWY A;  4M78 E;  2COY A;  1M1K U;  1X2K A;  2JS2 A;  4ZTF A;  2ATC B;  4LE9 A;  1M3A A;  5CQX A;  1NJI C;  4C92 B;  3MP8 A;  5FWC A;  3WXM B;  3PT9 A;  1KQS A;  2DJZ A;  3QJ6 A;  2XG8 D;  5HK3 A;  3M59 A;  3RKW A;  2VUB A;  2EYZ A;  3CBO A;  3X26 B;  3CCR A;  1OU8 A;  1JEG A;  3G71 A;  2YDL A;  5GMK j;  1VQ8 Q;  3G6E T;  2OJ2 A;  2KXC A;  3SFM A;  5LJ5 f;  3CCU Q;  5A0D A;  3P8B B;  2HZY A;  3GBQ A;  4EMK B;  2HAX A;  2DBK A;  1G2B A;  5AYF A;  4ME7 A;  1LVK A;  1PD0 A;  2JVV A;  5I22 A;  4NL3 A;  1OU9 A;  1H3Z A;  1N9R A;  1WIE A;  2PVD B;  1PCX A;  2BTT A;  1VQL Q;  2RHI A;  3JV3 A;  1K0X A;  1SSH A;  4HKE A;  2JOY A;  2EQI A;  3D7S B;  3QKJ A;  3OYJ A;  2HQH A;  1WHM A;  2DL7 A;  4QQG A;  2KNB B;  4KBM B;  5CIU A;  1NE8 A;  4KT0 E;  2CP0 A;  4XU0 A;  1YI2 A;  2G3R A;  3FJP A;  1YJW A;  5KYX B;  2A08 A;  4JS4 A;  4M77 F;  4Y92 A;  2L3P A;  2P0Q A;  3UAT A;  2QA4 Q;  1I8F A;  2YUP A;  2K2M A;  1KD1 U;  1O9S A;  3VUB A;  1KQS S;  3GOX A;  1VA7 A;  2ECZ A;  1VYV A;  5GAN 8;  1YJN Q;  3M56 A;  3I56 T;  3ZEH A;  2ZPB B;  2F2W A;  5GMK e;  1M8V A;  1IZ6 A;  3OBW A;  3EFO B;  3QBY A;  2M0O A;  1XJW B;  2XDD A;  2K3B A;  1U3O A;  3OS1 A;  2EWN A;  1QCF A;  1U1T A;  4XTX A;  5DY9 A;  2V8J A;  1JJ2 A;  2L3Q A;  1SHG A;  3FIF A;  2W10 A;  5GAN e;  1JJ2 S;  1QVG S;  2NUZ A;  4E7S A;  4OMM A;  2JW4 A;  3MEU A;  2JTM A;  3MJX A;  3TQ7 P;  1YFN A;  1YJ9 T;  2AT1 B;  5FWB A;  1K8A C;  1SRM A;  4PFZ A;  5KYY B;  3NTI A;  3CME Q;  2I0N A;  2CT4 A;  1AWW A;  3C4S A;  5GAN 4;  4F7U F;  1SSF A;  4TVR A;  2EQK A;  4X1V A;  3GP8 A;  3GNF B;  1T3L A;  4M7D D;  2MI6 A;  1KD1 C;  3SEM A;  3EGD B;  2CRE A;  4C8Q F;  4M75 F;  5IXB A;  4IKF A;  1NM7 A;  2RK2 A;  2BZ8 A;  2CP3 A;  3G71 T;  5LJ5 j;  2NYS A;  5J3B A;  5GAO n;  1SG5 A;  3VS1 A;  2DL3 A;  3CCQ A;  1VQO Q;  3CCR Q;  1W70 A;  2HQX A;  5FLX E;  3QXE B;  1QCO A;  4M78 G;  3G4S Q;  1NYG A;  1OPL A;  2KI7 A;  4A63 B;  4OF1 A;  2DF6 A;  1Q7Y C;  3BE3 A;  2CYZ B;  3JB9 F;  1K8A R;  4MMK A;  4JRP A;  1EZZ B;  1QW1 A;  4AFS C;  4CC3 A;  1M2O A;  2J6F A;  2DO3 A;  4GBQ A;  1Q7Y U;  1ACM B;  3C95 A;  4Y28 E;  2DRM A;  2COZ A;  2K57 A;  4XTU A;  3LH0 A;  3L2Z A;  3HPW A;  1VYT A;  2DD4 A;  4E47 A;  4PNO A;  2FPF A;  4C92 E;  1B34 A;  4ZN3 A;  3MHX A;  1BKB A;  2YRC A;  3LLR A;  1UEB A;  2MF2 A;  3BDL A;  1PG5 B;  2DXC A;  2CH4 A;  1H3H A;  4BY6 B;  1IHW A;  2GQV A;  3REB B;  4A54 A;  4LNP A;  1WPY A;  2EFI A;  2L3S A;  4FM4 B;  4C0G A;  3V8L A;  2LQ8 A;  4E7I A;  3RNJ A;  1CSK A;  1D0Y A;  3G6E A;  1TTH B;  4KRT A;  3L2U A;  1W1F A;  1K0S A;  5KCH A;  2YUO A;  4NOY A;  2PUO B;  2CKK A;  4M77 D;  4BD3 A;  4EDU A;  1GCP A;  3OYM A;  1ZA1 B;  2A3L A;  2SEM A;  4HXJ A;  3RES A;  3JCM e;  1RAF B;  1IB8 A;  3M0U A;  4M75 C;  2RM4 A;  3HL8 A;  3ULR B;  3H0H A;  1BYM A;  3ER0 A;  2RI3 A;  2MIO A;  2EYQ A;  1N9S A;  2E64 A;  4DQ2 A;  1WJS A;  4HVW A;  2DKG A;  5CKE A;  2OTJ A;  3RBB B;  2KMT A;  4GLM A;  1VQ7 A;  1X6O A;  1E6G A;  4D8K A;  4PJO G;  2LDM A;  1QVG P;  2CUD A;  4E7L A;  2QG9 B;  3LYI A;  3CC4 A;  1WI7 A;  4UC4 A;  5GAN 5;  3VUZ A;  2QQA A;  1I4K 1;  4F7U A;  1ZUU A;  2RQR A;  3EFS A;  4ANJ A;  1HD3 A;  3SWN B;  3INZ A;  4PJO D;  3I56 A;  2WSF E;  4LD9 K;  4M7A F;  4EIK A;  3I55 Q;  2MMP A;  1NEG A;  3X28 B;  1K9M U;  3EGX A;  1WJR A;  2WAC A;  2K79 A;  4IIO A;  1FMV A;  1PRL C;  3A5Z B;  3CCJ Q;  5GAM j;  8AT1 B;  1UDL A;  3FC3 A;  1N5Z A;  1MNE A;  4QQD A;  1R0C B;  4EPC A;  1YJW Q;  1E6H A;  2RHX A;  5A0L A;  4RTX A;  4OB1 B;  3P8D A;  3EG9 B;  1AVZ C;  4RCC A;  4J9H A;  2XI9 A;  3CEY A;  1IXD A;  2LNV A;  2RHY A;  2EVR A;  1K8A U;  4RUG A;  1ZUY A;  2XDP A;  1QWF A;  3QG1 A;  1X2Q A;  2LQK A;  4RCB A;  3EHR A;  3UPU A;  4FYV B;  4RG8 A;  4RTT A;  4LDX A;  5HY6 A;  4C8Q G;  1AOJ A;  4X9D A;  1S72 T;  3M57 A;  3M53 A;  2HD0 A;  3H6Z A;  2H3J A;  2QEX A;  3OBY A;  4M7D B;  3ZFJ A;  4M78 A;  2YXY A;  3CCQ T;  4M4Z A;  1M30 A;  3T9N A;  1Q82 C;  2IIM A;  1YHQ A;  1XNI A;  5IN1 A;  2O9V A;  2JNG A;  1FXX A;  3V8K A;  1WQW A;  3H0F A;  4M78 C;  3GLX A;  1QVF P;  1TS9 A;  3FLG A;  4Z02 A;  5CKF A;  2P84 A;  1VQ6 T;  4LXC A;  2A7Y A;  3QWX X;  5GAO m;  1X01 A;  4HCB A;  2FB7 A;  3CCU T;  2F69 A;  3JCM g;  3CPW A;  1EIF A;  1Q7Y R;  2JM8 A;  2KRM A;  4K11 A;  1KFZ A;  2MYS A;  2NUP A;  1CKA A;  2DIL A;  1D0X A;  4F16 A;  2KBT A;  1Z9Q A;  1PM3 A;  3SDZ A;  1D1A A;  1WHG A;  2RQV A;  2QGG A;  2YLB A;  5I11 A;  1KSW A;  2F2V A;  2KT1 A;  1ZBJ A;  2VV5 A;  2QYZ A;  3A8O B;  3V7R A;  3A8L B;  2P4T A;  2ZCF B;  3HRT A;  3VRY A;  1K73 R;  3VS6 A;  1MMN A;  4KH1 B;  3HRU A;  1UGQ B;  4C5G A;  2QXF A;  2JXB A;  4M7D G;  3URG A;  2LCS A;  3QPH A;  4C5E A;  4PKC C;  3AT1 B;  3OW2 P;  2OAW A;  2DYI A;  4B9W A;  4JRQ A;  2O31 A;  3VRZ A;  3SWN C;  2H8H A;  2JUF A;  1KC8 C;  1IO6 A;  4VUB A;  3CME A;  2JT4 A;  4PFP A;  1VQ8 A;  4KUI A;  1ZBX A;  3BDU A;  2DL4 A;  3CC7 Q;  3UT1 A;  1MGQ A;  4OMQ A;  1XTD A;  2EGE A;  1U06 A;  2AZV A;  3NMZ C;  3CCV Q;  1VQ7 Q;  1VYU A;  3CCM A;  3VU3 C;  2VXF A;  4J6X A;  1WDX A;  1RLP C;  1V1C A;  3RKX A;  2YT6 A;  1D3B B;  1C0M A;  4M75 E;  3WVE B;  2K9G A;  2M16 A;  5ECA A;  1TUC A;  3I35 A;  3JCM X;  1K73 U;  1Q82 U;  1YJ9 Q;  4C0D B;  3OYB A;  2LNH B;  1TUG B;  1VQ4 T;  4J9E A;  1B3Q A;  2JMC A;  5I2S A;  1UGV A;  2XID A;  1SF9 A;  3JCM W;  3ASK A;  3OYC A;  3QDF A;  3IQL A;  5KYW A;  3PTA A;  5J39 A;  2Z0W A;  2RI5 A;  4RG2 A;  2DE0 X;  2G6F X;  3G71 Q;  2FZK B;  2X3W D;  3CBP A;  4N0A C;  1OUL A;  1JQQ A;  2CP5 A;  4KGX B;  4KUD K;  2K6D A;  2RPN A;  2RO0 A;  1VOM A;  2V8K A;  3MET A;  4AFU C;  2C0O A;  2CT3 A;  3MKD A;  4OB3 B;  4DEY A;  3L2R A;  1RAA B;  3M9Q A;  1GFC A;  1BIA A;  1NYF A;  3QO3 A;  4P5N A;  4C92 F;  2JZ2 A;  1SPK A;  3M5A A;  2CP7 A;  2RJE A;  3X25 B;  1YIJ Q;  3OYG A;  1TXQ A;  2K3Y A;  1JO8 A;  1N6A A;  3DLL A;  1M3B A;  4JPB W;  3G6E Q;  2RH2 A;  4Y91 A;  4DBQ A;  1MMD A;  4AG2 C;  1VQ4 A;  4J7F A;  4ATO A;  1KQS P;  3G1J A;  3HRS A;  3LH5 A;  2DNU A;  4XTV A;  4EMH A;  1JXO A;  4QVZ A;  4J9G A;  2LJ1 A;  1S1N A;  2HL3 A;  2I2L A;  3CQT A;  1ABO A;  3KBG A;  3OMC A;  3QII A;  3ZL7 C;  2L5Q A;  3CBM A;  1ZSG A;  2J06 A;  3HKS A;  2CZ6 B;  4A4K A;  4PJL A;  5LJ5 d;  1IHV A;  1YN8 A;  3OS5 A;  2DEU A;  2QTX A;  2OI3 A;  2VGM A;  2OTL T;  3HFN A;  1QKX A;  2FPE A;  5L23 A;  1VQN A;  5LJ5 e;  4WCI A;  2P0P A;  1ZA2 B;  4ZGE B;  1FWZ A;  5IAY A;  3I56 Q;  2LJ0 A;  1HSQ A;  1TOV A;  5FU6 B;  4CC4 B;  5GMK l;  5CO7 A;  2KR3 A;  3S3N A;  4A4E A;  1J3T A;  3FJ5 A;  3KFV A;  3R6N A;  1QP2 A;  1NLO C;  2BUD A;  3GPL A;  4Q5W A;  2XMF A;  3KUF A;  3GF5 A;  1Y0M A;  1A0N B;  1NEB A;  4C5H A;  2X3X D;  4HT9 A;  3PIP A;  4BDZ A;  1X69 A;  3CC7 A;  2R57 A;  4QT7 A;  2YUN A;  1KQ2 A;  3CMA Q;  3CC2 Q;  2QI2 A;  2KAF A;  1SKU B;  1GCQ A;  2YWW A;  3FEO A;  2CZ0 B;  1VQK A;  3CME T;  3N5B B;  4XU3 A;  1WFW A;  2KVQ G;  1KIK A;  1YIT T;  2YUQ A;  2X9H A;  4LUD A;  3CCE T;  1I07 A;  5DLO A;  4MML A;  1K1Z A;  3TSW A;  1Z9Z A;  1GL5 A;  1NLP C;  4FT4 A;  3OYN A;  4CRI A;  5GAO l;  1Q81 C;  1M1K R;  2K5F A;  4M75 B;  2NWM A;  2D0N A;  1NBE B;  1Y96 B;  3A1P A;  2DXU A;  1HJD A;  1SRL A;  4F04 B;  5A0G A;  2D0Q B;  5CKD A;  4C5I A;  2HDA A;  5IH2 A;  3EH2 A;  3VS3 A;  5A2Q E;  1Y57 A;  1ARK A;  4QVC A;  1P92 A;  2DTO A;  2KXD A;  4MDX A;  3S3O A;  1NPP A;  3MPU B;  2IPO B;  2X4X A;  1V76 A;  1VIE A;  5CAI A;  1V29 B;  2MAM A;  4C92 D;  4NS5 A;  1S72 Q;  2CSQ A;  2K4Y A;  1VQM T;  1KC8 U;  5IHK A;  2JJ9 A;  3CXC P;  3PVL A;  1VQK T;  2EPD A;  2J05 A;  2A28 A;  2GCX A;  3JCM b;  3JCM h;  4ZTJ A;  8ATC B;  2EQM A;  1NG2 A;  3OB9 A;  3QHS A;  2FZG B;  3EG2 A;  3TRE A;  3EG0 A;  2FPD A;  1LJO A;  3VYG A;  5GMK m;  3BY7 A;  4PLL A;  1O75 A;  1M90 U;  4DOV A;  2LX9 A;  4ZGJ B;  5EC7 A;  2DIQ A;  2MPX C;  4MZT A;  1AEY A;  4ELZ C;  2BE7 D;  2CS7 A;  2HNI A;  2BE9 B;  2M0Y A;  4A4F A;  1LOJ A;  1YP5 A;  2GTO A;  5M9O A;  4M7A G;  5LJ3 d;  2E41 A;  2NUT B;  2LZ6 B;  4KGV B;  4KUL A;  3OYH A;  5GAO r;  1YWO A;  2FYK A;  1UGS B;  2LRQ A;  4JUV A;  2LCL A;  2GF7 A;  1M8M A;  4M77 B;  4ORZ A;  1PKS A;  2YSQ A;  2RN8 A;  2KY9 A;  4PJO C;  5FU6 C;  5C6S A;  2KRN A;  1OZ3 A;  4R55 A;  4GY5 A;  4AFZ C;  2VYT A;  1RAB B;  2LQN A;  1KK7 A;  4XU2 A;  4XTW A;  4IUT A;  1RUW A;  1Q95 G;  3C0C A;  3I5R A;  2D6F A;  5CQY A;  1OYX A;  3RKY A;  2E5Q A;  2LJ3 A;  2QEX Q;  3QDR B;  1ZSZ B;  5IT9 E;  1AWJ A;  5CK9 A;  1LNX A;  1T0H A;  2P4R A;  1Q81 U;  2CDT A;  2P0K A;  3NHN A;  2L8D A;  5D6X A;  4B6M A;  1G3S A;  5GAN d;  1OQK A;  1WYX A;  4FCY A;  1M1K C;  1OPK A;  1VQ5 A;  1G83 A;  1QWE A;  1QVF S;  1QP3 A;  4XU1 A;  1NJI U;  4HA8 A;  2L3R A;  3SB2 A;  3F70 A;  3A98 A;  3EGX B;  3HP9 A;  4FT2 A;  3I55 T;  1VQ7 T;  2DBM A;  3RUX A;  4N0A A;  1KQ1 A;  2M1H A;  1NZ9 A;  4IUR A;  1ZX6 A;  1BI1 A;  1YI2 T;  2RI2 A;  1QVF A;  3OW2 S;  4M75 D;  3C12 A;  4ZGD B;  2EYW A;  2Y4Y A;  4Z88 A;  1H64 1;  5GAM h;  2SRC A;  4F14 A;  1Q86 C;  4OGE A;  1XOV A;  4E7Z A;  1UE9 A;  1UTI A;  2RHU A;  1M2V B;  3L1A A;  2PUK B;  3J81 E;  2K2V A;  3CC4 Q;  4M7A A;  4V2S A;  5J26 A;  3QYG B;  2DYB A;  2M51 A;  2EIF A;  2HSE B;  3CCE A;  5AT1 B;  4KH0 B;  2RNA A;  3CCL T;  1N27 A;  4A53 A;  1TG0 A;  4YTL A;  2A37 A;  3FDR A;  2VGN A;  3JB9 D;  4Z89 A;  2R5M A;  1T0J A;  3R6O A;  1LCK A;  2K3X A;  3NTK A;  5CKB A;  1R0B G;  5KE3 A;  1UB4 A;  3CCV A;  1BB9 A;  4A4H A;  4PL6 A;  4L59 A;  1OZ2 A;  2L0A A;  5D7U A;  1WJQ A;  3RIR A;  4JLG A;  1WHJ A;  3NPF A;  1X6G A;  4JLI A;  2DA9 A;  2VB6 A;  5FRO A;  1VQ6 Q;  4C0D C;  1K9M C;  1VQL T;  1RL2 A;  2FZC B;  2X4J A;  1BI2 A;  4F7U G;  3JCM P;  5KYX A;  2JMA A;  1BCO A;  2GTJ A;  4JJD A;  1VQ8 T;  3MCA B;  3KXT A;  1G8X A;  3LGL A;  3OYK A;  4N4H A;  1OI1 A;  1AT1 B;  1Y96 A;  5I2M A;  1UUE A;  2QA4 T;  3EAE A;  3CD6 T;  1KD1 R;  4LDU A;  1WA7 A;  3CXC A;  4M77 G;  5DLQ E;  2PU9 B;  2PNI A;  3OYE A;  2RB6 A;  3EFO A;  1FYN A;  4KGZ B;  2MCN A;  2JTE A;  2AIR B;  1X75 C;  4J9C A;  3M0T A;  4PJN A;  1YNZ A;  1E7O A;  3PGG A;  2EAY A;  2MOX A;  4JRK A;  3S6W A;  1QVG A;  5GAN 7;  3JRZ A;  1R77 A;  4XQ3 A;  1M1F A;  3V7S A;  2DL5 A;  2XKO C;  1U1S A;  5CCA A;  3TSZ A;  4M77 E;  2EQJ A;  1UG1 A;  5HCK A;  2ZZD A;  3LW5 E;  1X6B A;  3THK A;  4JJN K;  2K5L A;  3L2V A;  1YJN T;  1VQP Q;  3JCM f;  1D3B A;  4RTZ A;  4F7U E;  2LQW A;  1MHN A;  1K9A A;  3ZBD A;  1LPL A;  1UGP B;  2DET A;  4PJO F;  1Y7X A;  1YHQ T;  3EG3 A;  1TSF A;  2DM1 A;  1RLQ C;  1N8R R;  1KG1 A;  4M7D F;  2BIV A;  1M90 C;  5HK0 A;  2OTJ T;  2J7I A;  3JCM c;  2X51 A;  1WHL A;  2HSP A;  2RJC A;  2GBQ A;  2ZPF B;  3X24 B;  4C8Q A;  4DBH A;  2HBP A;  3E2U A;  4BAC A;  3A8H B;  2KEA A;  3OYD A;  1HK9 A;  2V8I A;  2L2P A;  3CPW S;  1TUD A;  2FRY A;  5KYY A;  3RDV A;  3CCS Q;  1ZSZ A;  4O6J A;  2PTK A;  1OEB A;  4DEX A;  4R0K A;  3OW2 A;  4DOW A;  4FSX A;  3M0P A;  3OSS C;  3LWI A;  4PK4 A;  2KRO A;  4LUE A;  5KYU B;  1ZLM A;  2X4Y A;  3EGD A;  1N8R C;  2H3E B;  4II1 A;  4A4G A;  4QQ6 A;  3JCM Q;  1VQN T;  2E3H A;  1VQO T;  4B9X A;  1K76 A;  2V26 A;  3QJY A;  4O5V A;  4OVA A;  1IGU A;  3QZ5 B;  5CR2 A;  5IHI A;  3CCJ A;  3G4S T;  1TWB A;  2QAS A;  3JB9 I;  2HKQ B;  1Q86 U;  2BKD N;  3DKM A;  1IRE B;  5CKH A;  4BY6 C;  5C0M A;  2JN0 A;  1MV0 B;  3GNG A;  1WXT A;  2QQS A;  1BU1 A;  2RMO A;  1YWP A;  2EJG A;  5GAM e;  2FO0 A;  2PQW A;  1WQ7 A;  3M4G A;  4ZNX A;  1AZG B;  2D8H A;  4RTU A;  1AHJ B;  3G7Z A;  4FYW B;  3CCM T;  3VKI A;  2LT1 A;  3OYY A;  1FMW A;  2X35 A;  4J9I A;  1BK2 A;  4FIB A;  1B34 B;  2X4W A;  3VYH B;  2E6N A;  2ROT A;  4IUV A;  4MZM A;  4ESR A;  3DLM A;  4BE1 A;  4M7A B;  4J5Y A;  1D1C A;  1KHC A;  1VQM A;  2AZS A;  3I55 A;  2KK4 A;  2O9S A;  3UF4 A;  2DRK A;  4BE0 A;  4X34 A;  5GAM d;  5IXF A;  1RAE B;  3H0I A;  1D09 B;  1AWX A;  1S72 A;  1HXD A;  2YRV A;  3RMS A;  4BB7 A;  2QQR A;  2DD5 A;  2E6Z A;  3CMA A;  3CC2 A;  2DVJ A;  4PFO A;  2CSI A;  2FVU A;  2RQT A;  2O4X B;  3QZ9 B;  3CC7 T;  3GIB A;  1DJ7 B;  1VQ9 T;  3V8J A;  1WX6 A;  1AD5 A;  1HYO A;  2RD1 A;  4M7A E;  3A8G B;  5GMK h;  3CCJ T;  4J6W A;  2VC8 A;  4C92 C;  4FYY B;  3L2Q A;  5FRM A;  1F1B B;  4OMO A;  1RI0 A;  1JRI A;  1C6V X;  2DL8 A;  2GNC A;  1D1B A;  4RMO A;  1MUZ A;  4AT1 B;  3LGF A;  3OS2 A;  2A36 A;  5GAM g;  4J9F A;  1JB0 E;  2L89 A;  2W0Z A;  2EGA A;  4CC2 A;  5DM7 R;  3OYF A;  4PLI A;  5GMK i;  2MWO A;  4MDW A;  4RTY A;  2V1R A;  4C8Q D;  4RTV A;  3M54 A;  2VKN A;  2DLP A;  4F7U B;  3HHT B;  4EMK C;  2E1H A;  2YLC A;  3CCU A;  4HT8 A;  3CD6 A;  3UDC A;  1IGQ A;  4EMK A;  2F5K A;  4IUP A;  5GAN j;  2BZX A;  1PNJ A;  4AG1 C;  1X43 A;  3A8M B;  1YJW T;  3CCR T;  3VS0 A;  9ATC B;  2DAQ A;  4E2F B;  1UJY A;  2DZ9 A;  3DB3 A;  2J6K A;  2LX7 A;  2CP2 A;  3L2W A;  2QQ9 A; 
#chains in the Genus database with same CATH homology
 5GAN d;  1YCY A;  3FB9 A;  3H8Z A;  4E7H A;  1WQW A;  3O8V A;  2ZPH B;  3TCJ A;  3LWH A;  1G3W A;  1M1K C;  4M78 C;  3GLX A;  1VQ5 A;  4RKU E;  1QVF S;  2OAU A;  3FLG A;  1QP3 A;  3PNW C;  4XU1 A;  4Z02 A;  5GAN 3;  5CKF A;  1TH7 A;  3C94 A;  1VQ6 T;  4M75 A;  4HA8 A;  2A7Y A;  2L3R A;  3SB2 A;  5GAM f;  3F70 A;  3QUI A;  4OB0 B;  1NJI U;  2K5I A;  2DK3 A;  1YJN A;  3HP9 A;  4FT2 A;  3I55 T;  3TEE A;  1VQ7 T;  5GAO m;  4R56 A;  1X01 A;  4HCC A;  3RUX A;  4C92 G;  4HCB A;  4N0A A;  2FB7 A;  1G3T A;  4BE2 A;  3CPF A;  3CCU T;  2XIC A;  4M78 B;  2F69 A;  1KQ1 A;  4JDS A;  3E9F A;  2CZ7 B;  3JCM g;  3G4S A;  3CPW A;  2M1H A;  1W2B S;  1EIF A;  1NZ9 A;  4IUR A;  5LJ3 g;  4D6W A;  2EJF A;  1VQ5 T;  2D9T A;  1M9S A;  4JS5 A;  2LC4 A;  1BI1 A;  3S3M A;  3E9G A;  5GAO q;  4QVD A;  1YI2 T;  3VJP A;  2RI2 A;  1QVF A;  1WNL A;  4NL2 A;  3OW2 S;  5L8R E;  2EKO A;  1R8O B;  1BIB A;  3CCS A;  4M75 D;  1NPR A;  3C12 A;  2Y4Y A;  3SDZ A;  4ZGD B;  3CCS T;  1YIJ T;  3JCM V;  1H64 1;  5GAM h;  1VQ9 T;  4BI8 B;  1VIF A;  2YLB A;  3OYL A;  3CXC S;  5LJ5 h;  3OYI A;  2HQE A;  5FU7 B;  3NFC A;  2GFA A;  4OB2 B;  2VV5 A;  3HFO A;  2R5A A;  4OGE A;  2KSS A;  3A8O B;  2DIG A;  3A8L B;  3V7R A;  1Q86 C;  5GAO p;  1XOV A;  2P4T A;  2RHU A;  2ZCF B;  3HRT A;  2PVO B;  2DZC A;  1BI3 A;  1GXI E;  2F5T X;  3L1A A;  2PUK B;  3JAM E;  3J81 E;  4M78 E;  2K2V A;  1YJ9 A;  4M7A A;  4MZP A;  1VQP A;  4V2S A;  5J26 A;  3PMT A;  2ZPI B;  1M1K U;  3QYG B;  3HRU A;  1UGQ B;  3J7A F;  4C5G A;  2QXF A;  5LL6 S;  1PSF A;  2EIF A;  3CCE A;  3URG A;  4ZTF A;  4M7D G;  3QPH A;  4IUQ A;  4PKC C;  4C5E A;  2IG0 A;  5CQX A;  3CCL T;  1NJI C;  1N27 A;  1VQL A;  4A53 A;  4B9W A;  2GFU A;  4C92 B;  3MP8 A;  4L5G A;  2Y4X A;  3MP6 A;  4YTL A;  3VV0 A;  3WXM B;  4JRQ A;  3PT9 A;  3FDR A;  1KQS A;  2VGN A;  2JUF A;  2DJZ A;  3QJ6 A;  2XG8 D;  3SWN C;  3JB9 D;  5HK3 A;  1KC8 C;  4VUB A;  3M59 A;  3RKW A;  5IN1 A;  3CME A;  1VQ8 A;  2R5M A;  3R6O A;  5KE3 A;  2VUB A;  2K3X A;  3NTK A;  5CKB A;  3X20 B;  5GAN g;  1UB4 A;  4KUI A;  3CCV A;  1VQO A;  3CBO A;  1ZBX A;  3BDU A;  3RMQ A;  3X26 B;  3CCR A;  5D6Y A;  3UT1 A;  2ZGW A;  4A4H A;  3G71 A;  2KQW A;  4PL6 A;  1MGQ A;  1OZ2 A;  3ME9 A;  4L59 A;  1WJQ A;  3RIR A;  5GMK j;  1XTD A;  4JLG A;  3G6E T;  1JBM A;  1G3S A;  4JLI A;  1FX7 A;  2DXT A;  3OY9 A;  2EQU A;  2LVM A;  3CCM A;  2LT4 A;  3VU3 C;  2VXF A;  2EJ9 A;  4J6X A;  3SFM A;  5FRO A;  5LJ5 f;  4C0D C;  3OA6 A;  5A0D A;  3P8B B;  1K9M C;  1VQL T;  1G3Y A;  3RKX A;  1RL2 A;  4EMK B;  2HAX A;  2X4J A;  1BI2 A;  1D3B B;  5CVI A;  2CZ1 B;  3L2R A;  5AYF A;  4ME7 A;  3MEW A;  4F7U G;  4M75 E;  2WSE E;  3WVE B;  3JCM P;  2JVV A;  3E19 A;  4QW2 A;  4NL3 A;  2M16 A;  1VQ8 T;  4BUG A;  3QSU A;  1H3Z A;  1N9R A;  3MCA B;  3JCM X;  1PSE A;  1K73 U;  1Q82 U;  1G5V A;  4C0D B;  3OYB A;  1VQ4 T;  2PVD B;  3KXT A;  3LGL A;  3PMI A;  3M4Y A;  3OYK A;  4N4H A;  3M58 A;  1OI1 A;  2RHZ A;  5I2M A;  1Y96 A;  5I2S A;  1YIT A;  2RHI A;  2QA4 T;  3EAE A;  3JCM W;  2XID A;  4HKE A;  2JOY A;  3ASK A;  3OYC A;  3CD6 T;  3OYJ A;  3QKJ A;  3PTA A;  5J39 A;  4LDU A;  4QQG A;  4KBM B;  5CIU A;  3CXC A;  3NTH A;  2RI5 A;  4RG2 A;  1NE8 A;  4M77 G;  4KT0 E;  5DLQ E;  2PU9 B;  3OYE A;  4XU0 A;  1YI2 A;  2C06 A;  2G3R A;  2RB6 A;  1W4S A;  3FJP A;  1YJW A;  4CI0 C;  4JS4 A;  2DEQ A;  4M77 F;  3CBP A;  4E7K A;  4N0A C;  2P0Q A;  4BDY A;  3DB4 A;  1WGS A;  1X75 C;  2LTO A;  4KUD K;  3UWN A;  2RO0 A;  3EFR A;  3CC4 T;  3PGG A;  1I8F A;  2EAY A;  2V8K A;  3MET A;  4JRK A;  3S6W A;  1QVG A;  3JB9 G;  2NLU A;  4BI4 A;  5GAN 7;  3L42 A;  3JRZ A;  1O9S A;  3VUB A;  1KD1 U;  1KQS S;  4XQ3 A;  1M1F A;  3V7S A;  4OB3 B;  3GOX A;  2XKO C;  1U1S A;  4LDY A;  1Y07 A;  2XK0 A;  5LJ5 g;  5CCA A;  3M56 A;  5GAN 8;  4M77 E;  2EQJ A;  3ZEH A;  3I56 T;  2ZZD A;  3LW5 E;  1KHI A;  2E70 A;  2JTF A;  2ZPB B;  2XHC A;  4XTZ A;  3M9Q A;  2XDB A;  5GMK e;  1BIA A;  3QO3 A;  4LDV A;  5LJ3 e;  1M8V A;  1IZ6 A;  3PFS A;  2DTH A;  3OBW A;  4P5N A;  4C92 F;  2JZ2 A;  3QBY A;  3M5A A;  2M0O A;  4JJN K;  2XD0 A;  4PJO A;  2RJE A;  3X25 B;  2XDD A;  3OS1 A;  3OYG A;  2EWN A;  2K5L A;  3BW1 A;  2RJD A;  1U1T A;  4XTX A;  5LJ3 f;  5DY9 A;  2K3Y A;  1N6A A;  3L2V A;  4XAX B;  1Y71 A;  3DLL A;  2V8J A;  1JJ2 A;  3FIF A;  5GAN e;  1YJN T;  1JJ2 S;  2RH2 A;  4Y91 A;  1QVG S;  3JCM f;  1D3B A;  4M75 G;  1VQ4 A;  4J7F A;  4F7U E;  3M55 A;  1MHN A;  4OP0 A;  3JCM J;  4ATO A;  3MEU A;  3ZBD A;  3HRS A;  2JTM A;  3TU4 K;  1UGP B;  4XTV A;  3V8K A;  4EMH A;  4QVZ A;  4PJO F;  1Y7X A;  1YJ9 T;  1ZQ1 A;  2DPP B;  2CGH A;  1YHQ T;  1K8A C;  3NTI A;  2XU8 A;  2I2L A;  5FU7 C;  3KBG A;  3C4S A;  3OMC A;  3QII A;  4F7U F;  1SSF A;  4C8Q C;  5GAN 4;  2BIV A;  4M7D F;  1KG1 A;  4TVR A;  2EQK A;  1M90 C;  3GP8 A;  2L5Q A;  2FL7 A;  3CBM A;  4JRI A;  3GNF B;  5D6W A;  3HKS A;  2CZ6 B;  4A4K A;  5HK0 A;  2OTJ T;  3JCM c;  5LJ5 d;  2MWP A;  4M7D D;  2MI6 A;  3OS5 A;  1KD1 C;  4C8Q F;  4M75 F;  4N4G A;  4IKF A;  2RK2 A;  3RER A;  2RJC A;  2QTX A;  2ZPF B;  2VGM A;  4XTY A;  3X24 B;  3HFN A;  4C8Q A;  3G71 T;  2OTL T;  2HBP A;  2PVG B;  4BAC A;  3A8H B;  4OGC A;  3OYD A;  1HK9 A;  2R58 A;  2V8I A;  3V7C A;  5LJ5 j;  3CPW S;  1VUB A;  5J3B A;  5GAO n;  1VQN A;  1YIJ A;  3CCQ A;  4M7D E;  5GAN f;  1U8R A;  1M1G A;  2HQX A;  5LJ5 e;  5FLX E;  3QXE B;  4FU6 A;  2QEX T;  4O6J A;  2WSC E;  1UGR B;  4M78 G;  4L6V 5;  3OW2 A;  4DOW A;  3WVD B;  2P0P A;  4FL6 A;  4FSX A;  3OSS C;  4ZGE B;  3LWI A;  4LD6 A;  1FWZ A;  3MO8 A;  5KE2 A;  2X4Y A;  1N8R C;  5IAY A;  4OF1 A;  1VQ6 A;  2E10 A;  4II1 A;  4A4G A;  1Q7Y C;  3JB9 F;  2CYZ B;  4QQ6 A;  4MMK A;  2Y90 A;  3JCM Q;  1VQN T;  4JRP A;  5FU6 B;  3PIO A;  1VQO T;  4B9X A;  5GMK l;  5CAI A;  4O5V A;  3QJY A;  1QW1 A;  5CO7 A;  3S3N A;  4OVA A;  4GLK A;  4A4E A;  3QZ5 B;  2DO3 A;  5CR2 A;  1Q7Y U;  3CCJ A;  3C95 A;  3G4S T;  4Y28 E;  3JB9 I;  1QP2 A;  4C92 A;  2K57 A;  1Q86 U;  2BKD N;  2BUD A;  1IRE B;  3DKM A;  3LH0 A;  4M78 D;  3L2Z A;  4XTU A;  5CKH A;  4Q5W A;  3GPL A;  2QQB A;  3OS0 A;  3MEV A;  4BY6 C;  3HPW A;  3KUF A;  3GF5 A;  5C0M A;  2QA4 A;  2JN0 A;  4C5H A;  2DD4 A;  3PIP A;  4E47 A;  1VQP T;  4HT9 A;  4PNO A;  4BDZ A;  4DA4 A;  3CC7 A;  2R57 A;  3GNG A;  1B34 A;  4C92 E;  3MHX A;  4ZN3 A;  1BKB A;  2QQS A;  3LLR A;  2O01 E;  5I21 A;  1UEB A;  2EJG A;  4M7D C;  2MF2 A;  3BDL A;  5GAM e;  1KQ2 A;  2PQW A;  1WQ7 A;  2DXC A;  4X9C A;  3CCV T;  2QI2 A;  2KAF A;  3M4G A;  3J80 E;  3SWN A;  3FEO A;  4BY6 B;  2CZ0 B;  1VQK A;  2OTL A;  3CME T;  3N5B B;  2GQV A;  4XU3 A;  2KVQ G;  4A54 A;  3BFM A;  1AHJ B;  1WPY A;  1YIT T;  4M7D A;  2EFI A;  2KDS A;  4J7I A;  3G7Z A;  3P8H A;  4FM4 B;  4M7A C;  4C0G A;  3V8L A;  5KH6 A;  2LQ8 A;  3CCM T;  4E7I A;  3VKI A;  2LT1 A;  1YBY A;  1W2B A;  3CCE T;  3OYY A;  3G6E A;  3AHU A;  2VXE A;  2X35 A;  4FIB A;  5DLO A;  3CC2 T;  3CMA T;  4J8O A;  3L2U A;  4MML A;  1B34 B;  2X4W A;  3VYH B;  5KCO A;  2E6N A;  3OQ5 A;  4IUV A;  5KCH A;  4MZM A;  4FT4 A;  4NOY A;  2PUO B;  3SD4 A;  4CRI A;  5GAO l;  3OYN A;  1Q81 C;  3DLM A;  2K5F A;  4BE1 A;  2CKK A;  4M75 B;  4M7A B;  4J5Y A;  1KHC A;  4M77 D;  1Y96 B;  1VQM A;  3I55 A;  4ELY C;  2KK4 A;  2RK1 A;  2DXU A;  4C8Q E;  3GIB A;  4BE0 A;  4BD3 A;  4X34 A;  5A0G A;  3JB9 H;  2DVE A;  3E1S A;  4EDU A;  2RA2 A;  2D0Q B;  5GAM d;  3OYM A;  5CKD A;  1QVP A;  4C5I A;  2A3L A;  5FRN A;  1S72 A;  3RES A;  3JCM e;  5A2Q E;  1HXD A;  2YRV A;  4M75 C;  2RM4 A;  3HL8 A;  3RMS A;  4BB7 A;  3Q1J A;  2QQR A;  2DD5 A;  2E6Z A;  1BYM A;  3ER0 A;  4QVC A;  1P92 A;  2DTO A;  3CMA A;  3CC2 A;  4MDX A;  2RI3 A;  3OYA A;  4C0F A;  2FVU A;  3S3O A;  1NPP A;  2ZPE B;  2EYQ A;  3MP1 A;  2O4X B;  1N9S A;  3QZ9 B;  2E64 A;  2X4X A;  1VIE A;  4HCZ A;  1DJ7 B;  1V29 B;  1WJS A;  2MAM A;  4NS5 A;  4C92 D;  4DQ2 A;  2DKG A;  4J6Y A;  1BI0 A;  3V8J A;  5CKE A;  4E7J A;  2OTJ A;  2K4Y A;  3CCL A;  4XK8 E;  2KMT A;  1VQM T;  4EMG A;  1KC8 U;  1VQ7 A;  2RD1 A;  1X6O A;  4M7A E;  1VQK T;  1I5L A;  4PJO G;  3A8G B;  2LDM A;  2E12 A;  2GCX A;  4BI3 A;  4E7L A;  3LYI A;  1ZHI A;  3JCM h;  5GMK h;  3JCM b;  3CCJ T;  4ZTJ A;  5EG2 A;  3CC4 A;  4C8Q B;  4UC4 A;  5GAN 5;  4J6W A;  5LJ3 h;  2EQM A;  2VC8 A;  3VUZ A;  3JB9 J;  2QQA A;  1I4K 1;  4C92 C;  4F7U A;  3OB9 A;  3QHS A;  1M5Q 1;  3L2Q A;  5FRM A;  3JSC A;  3EFS A;  2IVW A;  1RI0 A;  1JRI A;  3TRE A;  3SWN B;  3INZ A;  1LJO A;  3VYG A;  4PJO D;  5GMK m;  1M4Z A;  3BY7 A;  3I56 A;  2WSF E;  4PLL A;  1O75 A;  1M90 U;  4DOV A;  2LX9 A;  4LD9 K;  4M7A F;  2MMP A;  5GAN 2;  5HKC A;  4RMO A;  4OMF B;  2B8A A;  3X28 B;  4ZGJ B;  3LGF A;  1K9M U;  4LDW A;  2DIQ A;  4MZT A;  1WJR A;  2WAC A;  4J83 A;  4ELZ C;  5GAM g;  3OS2 A;  2CS7 A;  2HNI A;  3A5Z B;  3OSV A;  1JB0 E;  2L89 A;  2M9U A;  4A4F A;  2AHJ B;  5GAM j;  3LX7 A;  5GAN 6;  1LOJ A;  4N4I A;  4C0Z A;  4PJO E;  5DM7 R;  3OYF A;  2ZPG B;  4PLI A;  5GMK i;  3FC3 A;  2MWO A;  4MDW A;  4QQD A;  3QYH B;  4C8Q D;  2YHT A;  5LJ3 d;  2E41 A;  5M9O A;  2E65 A;  3M54 A;  4M7A G;  2LCC A;  1K73 C;  4F7U B;  4KUL A;  3OYH A;  3FRN A;  3HHT B;  4EPC A;  5GAO r;  4EMK C;  2FYK A;  1UGS B;  2E1H A;  4ZN1 A;  2YLC A;  3CCU A;  2LRQ A;  2RHX A;  4JUV A;  4HT8 A;  5A0L A;  2LCL A;  2GF7 A;  4M77 B;  4OB1 B;  3P8D A;  3UDC A;  3CD6 A;  4RCC A;  3HSB A;  4IUU A;  2XI9 A;  3CEY A;  2KY9 A;  4PJO C;  2LNV A;  2FHD A;  5FU6 C;  4EMK A;  5C6S A;  1OZ3 A;  4R55 A;  2F5K A;  1VQ9 A;  4GY5 A;  4IUP A;  2RHY A;  1K8A U;  2VYT A;  5GAN j;  2XDP A;  1I81 A;  3QG1 A;  2LQK A;  4XU2 A;  4RCB A;  5GAN h;  3JCM d;  3UPU A;  1N8R U;  1XQH A;  3A8M B;  4RG8 A;  1YJW T;  4M77 C;  4XTW A;  4IUT A;  5HY6 A;  4C8Q G;  4LDX A;  4M7A D;  4X9D A;  3CCR T;  3MEA A;  2O4X A;  2D6F A;  1S72 T;  5CQY A;  1OYX A;  3RKY A;  2E5Q A;  3M57 A;  4PJO B;  3M53 A;  5LJ3 j;  3QDR B;  3OMG A;  5IT9 E;  2HD0 A;  5CK9 A;  2DXB A;  1LNX A;  4WF2 A;  2RJF A;  2DAQ A;  4M77 A;  3H6Z A;  3CC7 T;  1Q81 U;  2QDY B;  2H3J A;  2QEX A;  3OBY A;  4M7D B;  2DZ9 A;  3DB3 A;  3ZFJ A;  4M78 A;  2P0K A;  2L8D A;  3CCQ T;  5D6X A;  4M78 F;  2DTI A;  3T9N A;  1Q82 C;  3L2W A;  1YHQ A;  1XNI A;  2QQ9 A;  2JNG A;  1FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...