5GAOp

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
76
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSAKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaop00
3BY7A 5GANh 5GAN4 5GAOp 5LJ5j 3AHUA 1B34B 4M75D 3V8KA 5LJ5h 4EMKA 4A53A 2E1HA 4M77G 4HT9A 4M77E 4EMKB 2EWNA 3RKXA 1I8FA 2K57A 4QVCA 4M7DG 5GANj 4C92C 2DTHA 4XQ3A 4C8QC 4EMHA 4M7AC 2HNIA 5GMKe 4XTWA 4XU1A 3HFNA 1TH7A 3JCMf 5LJ5g 5LJ3j 4J6YA 4V2SA 1HXDA 2DZCA 2ZGWA 4C92F 2E65A 2E10A 3SWNA 5LJ3h 4M77A 3JB9F 4M75C 1KQ1A 3FIFA 5LJ5d 4QVDA 1BIAA 3BW1A 4XU3A 4C8QD 2DTOA 4XTZA 3SWNB 4M7AD 4M7DA 4M75F 4M77B 2DJZA 4M78D 4NL2A 1WQWA 4M75E 4JLIA 3M4GA 3V7SA 1WPYA 3JCMV 4M7DB 4PJOD 1LNXA 5LJ3g 5GAN2 4XTUA 1M8VA 4EMGA 4HA8A 1N9RA 1I4K1 2EAYA 5LJ3d 5GAN6 5GAMj 3JCMW 3JCMP 4MMLA 3JB9H 1Y96A 2DZ9A 2I2LA 5GAMh 5GANg 5LJ5e 5CAIA 4JUVA 5DY9A 1I5LA 1HK9A 4N0AC 4M78C 4XTVA 4C92G 1Y96B 2E64A 4X9DA 2VC8A 4C8QF 4M7AF 3JB9G 2YLBA 4C92E 5GANd 4C8QE 4M7AE 2DKGA 2QTXA 4F7UF 3QSUA 4M78F 4PJOC 2E41A 2DXUA 3FJPA 3PGGA 4XTYA 1WQ7A 4JRIA 4M75G 5GMKj 5GAMg 1U1SA 4PJOF 1D3BA 2VXFA 2DTIA 5GMKh 5LJ3e 3QO3A 3JCMJ 4C92A 4X9CA 4C8QA 3RIRA 5GAMd 3RKYA 1D3BB 4J5YA 3JB9I 1YCYA 4XU0A 1LJOA 4NOYA 4PNOA 3JCMh 4J6WA 4Y91A 2CGHA 4WF2A 5GANf 4RCBA 3FB9A 4M77D 4C92B 4M7AB 3V7CA 4C8QB 5GMKi 5GMKm 5GAOr 4M75A 4EMKC 5GANe 5LJ5f 3BFMA 3VU3C 3JCMc 1KQ2A 1H641 1BIBA 2RM4A 3INZA 4M7DD 2JN0A 1X01A 2VXEA 4JRKA 4M75B 5GMKl 3JCMQ 5GAOl 4RCCA 2RB6A 3QUIA 4NL3A 3JCMg 4C8QG 2Y90A 4M7AG 3EFRA 3V8JA 2EJ9A 3RERA 4F7UG 5GAOn 4M78G 1WNLA 3RESA 2YHTA 4J6XA 3JCMb 2FB7A 1JRIA 4MMKA 4F7UE 5GAMe 4M78E 1M5Q1 3JCMd 5GAN7 3SWNC 4PJOG 4M77C 5LJ3f 5I21A 4HT8A 3GIBA 2RD1A 3EFSA 1MGQA 4PJOE 1LOJA 4M7AA 4M77F 4M7DC 2DEQA 2DXTA 1JBMA 4N0AA 1I81A 4M78A 3V7RA 4F7UA 2YLCA 5GAN3 5GAN5 5GAOq 3HSBA 4OP0A 3SB2A 3QHSA 4DQ2A 5GAOm 4M7DF 2EJFA 4M7DE 3JCMX 4PJOA 4F7UB 2RA2A 4M78B 3V8LA 5GAN8 2FYKA 2DVEA 3BDUA 4XTXA 3JCMe 4PJOB 3RKWA 3L2ZA 4C92D 3JB9J 3L1AA 3RUXA 5GAMf 1B34A 3HFOA 3JB9D 4A54A 1U1TA 1N9SA 2EJGA 4XU2A
chains in the Genus database with same CATH superfamily
1HYOA 5GAOp 2O01E 4BI3A 4L6V5 2DMOA 5CO7A 1GL5A 1TU0B 2K79A 2JTEA 4PFZA 2CH4A 3REBB 5LJ5g 1QCNA 1G8XA 3NTKA 3O8VA 4KULA 4QVDA 3LH5A 2D8HA 2V1QA 1Q86R 3V7SA 3LH0A 3OS5A 1D0XA 3FC3A 3OYKA 1NLOC 2EQKA 2X35A 1KFZA 1JJ2P 5KE3A 2X3WD 4RG2A 5GAMh 2B8AA 5LJ5e 1JO8A 3Q1JA 2DILA 2GFUA 4IKFA 3NHNA 2VC8A 4C8QE 4M7AE 2FG0A 2RJFA 2HQEA 3OS2A 4JRIA 1QMCA 3CQTA 1DJ7B 1KHIA 2P4TA 1YWPA 1YJWQ 2VGMA 2DRKA 1M8MA 3JB9I 1IZ6A 4PNOA 4AG2C 4JJCA 3UWNA 3V7CA 5I11A 2E3HA 3QYGB 2LQ8A 3I35A 3E1SA 1X2KA 1WXBA 4RCCA 3M59A 3EFRA 4CC3A 5FLXE 3NTIA 2I0NA 1OEBA 1KQSA 2LNHB 3DB3A 8ATCB 3L2RA 1M90C 1TUGB 5L23A 4FYXB 2HEQA 1I81A 3V7RA 3L2VA 1VQ4A 4DBQA 5CCAA 1PC0A 2X9HA 4F7UB 1Y57A 2CZ0B 3M0QA 2VASA 3CCSQ 4PJOB 2D8JA 2A08A 4HVUA 1WJSA 2NYSA 3AHUA 1B34B 3CC4Q 2RK1A 2KQWA 4M77E 4EMKB 2FHDA 4DBFA 3L2UA 3RKXA 4LD6A 5IHKA 4XQ3A 1Q81C 5HY6A 4ESRA 1VQMT 2XU8A 5LJ5d 2KE9A 1VQLA 4XU3A 3SWNB 1VQ4T 1BU1A 3KFVA 3T9NA 2XG8D 4BE0A 3VS3A 3DLLA 4GBQA 1G3SA 5CKDA 1I5LA 4LD9K 1PWTA 3NTHA 4B9WA 4X9DA 4C8QF 4M7AF 4RTWA 1VQ7A 4PJOC 2GTOA 2L3RA 2MF2A 3CBMA 1WHLA 4DBHA 2EYQA 1W2BS 3H0IA 2YUOA 2CYZB 1V1CA 2KT8A 1SG5A 3VKIA 2XMFA 4M77D 4EMKC 1VQLT 4ZGJB 3BE3A 1UJ0A 4M7DD 3INZA 4A4KA 4CC2A 5I2MA 3CCRA 3S3NA 3FRNA 4AFQC 3X20B 2KROA 3A8GB 3M9QA 4MMKA 1GFCA 2JT4A 4FW1A 2O4XB 1M2VA 3SWNC 2GBQA 1KD1U 2DRMA 1F1BB 4PJJA 1LOJA 4FM4B 3CCLA 1KHCA 2XK0A 1VIEA 1VQ6A 2YLCA 5DM7R 5GAOq 1VQ7T 4OP0A 5GAOm 2A7YA 1YJNQ 3A1PA 2OTJA 2ATCB 1ZQ1A 3MO8A 1IREB 2XI9A 2HL5C 1X69A 2M02A 1QVFP 2G6FX 2ZPFB 4OMFB 4DOWA 3OB9A 4PJNA 2E1HA 2QK0A 4L5GA 3CCRT 1SRMA 2X4YA 3GNFB 1N8RU 1I8FA 1BI0A 2ECZA 4GLMA 4XU1A 1OX8A 2A36A 2H3JA 1HXDA 5CVIA 1VIFA 2DD4A 3LYIA 1YHQQ 1NJIU 1X6GA 3JAME 3CCLT 1VQ6T 2LP5A 3CPFA 2FPEA 5DLOA 2OTJT 2J05A 5LJ3g 5IXFA 5GAN6 1JEGA 3MJXA 3EH2A 4KH1B 3EFOB 3CCVQ 5CAIA 4A63B 4C92G 4Q5WA 2EKOA 3HPWA 1W6XA 4F7UF 2V8JA 1W70A 1GXIE 1WQ7A 3SEMA 1M9SA 2NLUA 2RQTA 4PJOF 1FX7A 2EQMA 6AT1B 5LJ3e 3CEYA 4X34A 1M4ZA 2CP5A 4FYWB 3CBOA 3OYGA 1BI3A 4LXCA 3QPHA 1MV3A 2QQ9A 2RB6A 2FZGB 3MEWA 3P8DA 5J26A 3V8JA 2HMAA 2WACA 1D1CA 5IAYA 1YJWA 5I21A 1YI2Q 4HT8A 3OS0A 2FPFA 2K5FA 5KYYA 4R55A 1ZSGA 2RQVA 3QWYA 3LWHA 3J7AF 3P8HA 2QAZA 2J6FA 2DVEA 5CK9A 7AT1B 1K4US 4GLKA 3L2QA 2RQUA 2HL3A 3JRZA 1Q95G 3HFOA 4ELYC 4D8DA 1KD1C 1SRLA 1QKWA 1K8AC 1PKSA 2NUTB 2HBWA 2BUDA 2KAFA 3QXEB 4HT9A 2C0TA 2CP6A 4C0DB 3MCAB 2DL3A 3CCSA 5CKHA 2YRCA 1YJWT 1YFNA 2X3XD 1I07A 1KQSP 1FMKA 1VQ9Q 4RTXA 3VYGA 3S3MA 4KGXB 1B3QA 4BD3A 3CC4A 4ATOA 3ER0A 4E7LA 1GRIA 1B07A 5HKCA 1N8RC 2L3QA 3JCMW 5LJ3d 1OYXA 2DPPB 2R5AA 3TSZA 2CT4A 4XAXB 2LQWA 2DKGA 3QSUA 2PU9B 3PMIA 4M75G 5GAMg 4II1A 1ZBXA 3JCMJ 3QZ9B 3CCST 2L0AA 2ENMA 4FSXA 4NOYA 1G2BA 4HVVA 4ANJA 3FB9A 4C92B 1YITQ 5GMKi 4C0ZA 2QTVA 4OMQA 3G4SQ 4C0DC 1BIBA 3CCMQ 4BI8B 1HD3A 4JRKA 2CSQA 2LX7A 3CC4T 3MEAA 4BB7A 1JXMA 5GAOn 1WNLA 4JZ3A 4RUGA 5GAMe 4M78E 2W0ZA 2FZCB 4JZ4A 3EFSA 2DD5A 2CUDA 2ROLA 5FWBA 4F04B 4HVWA 4N0AA 4N4GA 5GAN5 1VQMQ 3CPWS 3QHSA 4DEXA 5GAN8 1CSKA 3TCJA 2MK5A 1VQOQ 4LUDA 4IIMA 4LDVA 4JRPA 4J9IA 1K73C 1U1TA 4Z8AA 3GF5A 4E2FB 3UA6A 1I1JA 2CP3A 4DEYA 2KRMA 2F2XA 5KYXA 1D09B 2DFUA 1YJNA 4OGEA 3LGFA 3OYNA 4E47A 5D6XA 3H0HA 4C92C 1G3TA 1XQHA 2DZCA 2JXBA 3CPWP 3R6OA 3VRYA 1AOJA 2DX1A 4M78D 1TTHB 5FRNA 2W10A 1Q7YR 2RN8A 3VRZA 1UGVA 2MMPA 4ELZC 2DA9A 9ATCB 3G1JA 1YHQA 1QQJA 1IGUA 4RTVA 1D1AA 4RTUA 5AT1B 3OYEA 3OYIA 3FJPA 4C5HA 1Z9ZA 1YJNT 3M0PA 4C0FA 2YT6A 1WHGA 3CD6Q 1RI9A 5D6YA 3OMGA 4UC4A 1RAFB 5GAMd 3LGLA 1ARKA 1MMAA 2DBKA 4J9CA 1PRLC 2LQNA 1WHKA 1JU5C 4FT2A 5FWCA 2O9VA 2CS7A 2A28A 4M75B 1W2BA 3VS7A 3CCRQ 2AKKA 3A8OB 3SD4A 3HRSA 1NBEB 4ZGEB 1PRMC 4FIBA 3QZ5B 1MGQA 2HQXA 3QKJA 1R0CB 1YHQT 2VKNA 3HTRA 1JBMA 4ME7A 3M0TA 3OYYA 1MV0B 3HSBA 3L2WA 3MP1A 3JCMX 2RH2A 1BCOA 1KC8C 1UGSB 4D8KA 1IB8A 3JB9J 2RMOA 1K9MR 2DIQA 5GJWB 5J3BA 1YI2A 1SEMA 2R58A 1Q82C 3CBPA 4MZPA 4IUVA 4PFPA 1QVGA 5CQXA 4EMHA 3QJYA 4XTWA 4C92F 1M3BA 3OY9A 3OW2S 4J9HA 5HK3A 4M75C 1YJ9Q 2DL5A 3TU4K 2KXDA 2DJZA 4NL2A 2RF0A 4M75E 4P5NA 5HCKA 1RLPC 1D0YA 1MMNA 2ED0A 3CC7T 2NUZA 3VUZA 1M8VA 1RAGB 2CP2A 2NUPB 1E6GA 1SHFA 3HP9A 4ZTJA 1MMGA 2KVQG 2RO0A 5GANg 1YI2T 1TUCA 2K5LA 2JMAA 1VQ9A 3URGA 2F1LA 1ZSZA 2V1RA 2YUNA 3EH1A 2MWOA 2NUPA 4C8QA 1AWXA 2EFIA 1X43A 3O5ZA 3H9NA 4MDXA 2ZAEA 1AWOA 2ED1A 5GANe 2JTMA 1KQ2A 1H641 3EG9A 1M1KC 2A3LA 1W1FA 3OBWA 3RESA 1Y07A 2ZZDA 3JCMb 1OOTA 1QCFA 4AT1B 1E6HA 1TSFA 3PTAA 4JS5A 1OU8A 2F69A 5FRMA 4FT4A 2MWPA 1YITA 1VQ9T 3QIIA 2OAWA 3G4SA 3CCMA 2CDTA 2HD0A 2JW4A 3BDUA 1RUWA 2RJCA 2R5MA 3OQ5A 4GY5A 1GBRA 2F2WA 3UF4A 2RQWA 4WCIA 2C0OA 5GANj 3NFCA 1JQQA 1C6VX 2HSPA 5LJ5j 1ACMB 4R56A 1VQMA 3PIOA 1VQOA 1U3OA 3DKMA 4M77A 1KQ1A 4E6RA 2QG9B 4LE9A 4C8QD 1YITT 4M7AD 5KYUA 1AZEA 4M7DA 2M0OA 4M75F 4A4GA 3G4ST 1OZ3A 3CCMT 1NEBA 2K9GA 3I56Q 2JJ9A 1Y0MA 1UE9A 1Y71A 2LX9A 3M56A 3GLXA 2DZ9A 1M3CA 2LCCA 4AMCA 1VQNQ 4Y92A 5I2SA 2EQIA 3JB9G 5GANd 2DETA 2QTXA 2CZ1B 3REAB 2QYZA 3OSSC 1D3BA 3MP6A 2E6ZA 5D7UA 5D6WA 1VQOT 3OYDA 1GCQA 4RCBA 2D0QB 2ZPHB 3BFMA 2HKQB 1FWZA 1RLQC 1VQPQ 2D1XA 3G71A 1BCMA 1NE8A 2D9TA 1UHCA 3VV0A 1ZA2B 3CD6A 4F7UE 2LMJA 5A2QE 2H8HA 2XIDA 4J83A 2AT1B 1WLPB 4PJOE 1WGSA 2LT4A 1M2VB 3PVLA 1R0BG 1KJWA 1SHGA 3DB4A 4JLGA 1UFFA 5C6SA 1QP2A 2LJ1A 4OVAA 1MUZA 3X28B 1AZGB 1O75A 2P0KA 3N5BB 2CP7A 4J9FA 3CPWA 4XU2A 3CCQQ 4YTLA 2M1HA 4A53A 2FZKB 2ZPGB 3G71T 4MZTA 4CI0C 2EWNA 4IIOA 2FPDA 5GMKe 3CD6T 1W2BP 5AYFA 2ABLA 2MCNA 1OU9A 3FIFA 3BW1A 1QVGS 2DNUA 1WPYA 3OBYA 4PJOD 2CT3A 3EG3A 2DERA 2RNAA 2DEUA 3CMET 3EGDA 1U5SA 1YN8A 4HCZA 4EDUA 4Z89A 5GJVB 1HK9A 2A0FB 1YJ9A 3C94A 5KE2A 2XHCA 1WJQA 2PTKA 3PGGA 2GQIA 3MPUB 5GMKj 2PNIA 2C06A 1ZBJA 5KYWA 2FEIA 3M0SA 4OMOA 2Z0WA 1D0ZA 1QVGP 2DM1A 2CH4W 3PFSA 1X75C 1UUEA 2BTTA 1WDXA 3UPUA 2RM4A 3I5SA 1S1NA 3QBYA 4NL3A 2KMTA 1TG0A 1K9MU 5L8RE 4J6XA 2RQRA 2LTOA 3HL8A 2CUBA 2DEQA 1YJ9T 5GAN3 1WHJA 3H0FA 3META 4DQ2A 5KYYB 3ZBDA 3V8LA 4OMLA 2RI5A 2RI2A 4Y28E 2YWWA 3CC7Q 1ZUYA 3JV3A 2RHUA 2EJGA 3QDRB 2GQVA 4DBRA 3CCUQ 3OYBA 2XDDA 2ZCFB 2QI2A 2AHJB 2DVJA 2FL7A 3UDCA 2ZPEB 3RMQA 2K7AA 1MHNA 2E70A 4VUBA 2ZPBB 1TH7A 5LJ3j 4J8OA 4C5GA 2KEAA 4IUTA 5IH2A 1GBQA 4ORZA 3QJ6A 1WQWA 3CC2Q 2P0QA 1WYXA 1LNXA 3L42A 1Q86U 1UEBA 4O6JA 1UGRB 2DF6A 3OW2A 2P4RA 4RG8A 2SRCA 2EVRA 1N9RA 2EKHA 1K0XA 1G83A 2EGEA 3TREA 1KK7A 2E4HA 3G7ZA 2EW3A 1QWFA 2JUFA 5FU6B 3I56A 2VXFA 1VYVA 4OGCA 5CKBA 4AFZC 2KXCA 2GCXA 2Y4YA 3M58A 1M2OA 1VQNA 3QYHB 2HAXA 2EGCA 2JN0A 2KRNA 2M0YA 2XKOC 8AT1B 1NJIC 1IHVA 4C5EA 2XD0A 2DBMA 1PD0A 5IHIA 1QP3A 3OYAA 1JRIA 2EQJA 1M5Q1 3H41A 4RTZA 1OX9A 3I9QA 2PQWA 3OYJA 3VS4A 1UTIA 2DXBA 4M78A 4IUQA 2EGAA 1UHFA 2WSEE 2EJFA 1VQPA 2MAMA 3I56T 1PKTA 2FYKA 2DLPA 2K2MA 4X1VA 2HQHA 3L1AA 1NZ9A 4OB2B 5GAN4 5FU6C 3X26B 1VQNT 2HDAA 4IURA 3A98A 4MZMA 2F5KA 2QEXQ 1HSQA 2ESWA 4FCYA 5KYXB 1BBZA 2EBPA 3JCMf 4ZGDB 1PSFA 2E65A 1SPKA 3JB9F 3LWIA 3FLGA 3CCQA 3EHRA 3C4SA 3M54A 5KH6A 2BE7D 1VQPT 2KSSA 3OYHA 2KNBB 2LCLA 3EGXA 4XTUA 4QW2A 4EMGA 3QG1A 4DOVA 4LDUA 4HA8A 5FROA 3CXCS 2YUPA 1M1GA 5GAMj 2AK5A 2LVMA 2O2OA 2IIMA 5A0DA 4JUVA 2E5QA 4N0AC 3RBBB 5EG2A 3CMAQ 4C92E 1BI1A 2G3RA 3MHXA 3RR6A 2F5TX 1VQ8A 1YIJQ 2K3YA 2HSEB 1TXQA 1Q86C 2RHYA 1AD5A 2QQBA 2KR3A 3GNGA 4HCBA 1K9AA 4WF2A 4DA4A 3FJ5A 3TVTA 3CCQT 3X25B 4RMOA 1IXDA 5CKFA 5GAOl 3JCMQ 3E9GA 5GMKl 2FRWA 3QUIA 1EIFA 3G71Q 4CRIA 3ZFJA 4AG1C 3OYCA 2YHTA 4EPCA 2FB7A 1H8KA 3RMSA 1C1AA 2DXCA 4JJDA 1K8AR 2L8DA 4IUPA 3S3OA 4LDYA 2BZXA 2FRYA 2GF7A 4E7HA 1VQ8T 2JS0A 3ULRB 4KRTA 2D0NA 2KI7A 3HRUA 3QDFA 5IXBA 5KCOA 4C92D 3GPLA 2JVVA 3RUXA 1WIEA 3EG0A 3WVDB 3CMEQ 1WI7A 1VQ5Q 1PSEA 1KSWA 1RADB 3R6NA 2PUKB 1OULA 1X6OA 1C0MA 2OJ2A 4M77G 3CCEQ 2VYTA 1VA7A 2K57A 4QVCA 4M7DG 3LX7A 2YRDA 3SDZA 2OTLQ 2O31A 1BB9A 2V8IA 3CC7A 3H6ZA 1BI2A 4AFUC 3OYLA 1EFNA 4OF1A 5IN1A 1BIAA 3CCUA 3UA7A 3UATA 3GP8A 1K0SA 1V76A 4AFSC 2E3IA 3JCMV 1MNDA 5GAN2 2D6FA 1IO6A 4J9BA 3SFMA 4N4HA 2QDLA 4KUDK 1WFWA 3M53A 4MMLA 1Y96A 2QXFA 1O9SA 2MOXA 4JJBA 4XTVA 4FSSA 1AWWA 1R77A 2JZ2A 2CKKA 2PUOB 3GBQA 1PNJA 3VS5A 1SSFA 5A0LA 2IG0A 2YRVA 3CC2A 1ZSZB 3ASKA 4J7FA 2DTIA 2JM9A 3MP8A 2LC4A 1EZZB 3RIRA 3PT9A 2IPOB 1K1ZA 5GANf 4M7AB 4C8QB 4L59A 5LJ5f 3CCUT 3CCJQ 1OQKA 2EYZA 2DJQA 3EG9B 3EG1A 1XOVA 1XJWB 3OYFA 1K73R 3A5ZB 1XNIA 3OA6A 1JJ2S 1BYMA 2AIRB 3OW2P 2JTFA 2X4WA 4B9XA 4M7AA 5IHNA 2ROTA 4A4FA 4LN2A 2JOYA 2QDYB 2K2VA 2DE0X 1UDLA 2EIFA 3OS1A 2BZ8A 3CC2T 1JB0E 4XTXA 3G6EQ 4E7KA 1H3HA 2COWA 3L2ZA 5CQYA 1J3TA 2XDPA 4MDWA 2DYIA 3BY7A 1N5ZA 4M75D 4WTOB 1LPLA 1ZSZC 1YNZA 2FVUA 2RPNA 3EGUA 1XTDA 4PLLA 2WSFE 3AT1B 4LNPA 4ZN1A 4LUEA 4C8QC 4M7AC 1T3SA 4BE1A 4A4HA 4J6YA 1BKBA 4CC7A 4FU6A 1NPPA 2E6NA 2MYSA 4M77B 2GGRA 3EAEA 3M4GA 2BE9B 3PMTA 1VYTA 1W4SA 5KYUB 3EG2A 4PK4A 4M7DB 3M0UA 2DIGA 2QEXA 3C0CA 4RTTA 2VV5A 4E7JA 1H92A 4HCCA 2JS2A 3I5RA 3NMZC 1AT1B 3HKSA 1U06A 2PVGB 1LCKA 1ZX6A 4BE2A 2YLBA 1E7OA 4OB1B 2DXUA 4XTYA 5EC7A 2P0PA 1RABB 2HCKA 3E19A 3M5AA 2QA4Q 1OV3A 2L89A 1D3BB 1YCYA 3JCMh 2YUQA 1OI1A 2X51A 3PE0A 3CMAA 3E2UA 2O9SA 2VXEA 1VUBA 2M16A 1KC8R 2KGTA 2LDMA 1MMDA 2QEXT 1YIJA 2CZ7B 1I5OB 1T0HA 1PCXA 3OMCA 4M77C 1Q82R 3GIBA 3TEEA 1AEYA 1RL2A 4JDSA 2CREA 1TWBA 1YCSB 3PNWC 4M7DC 1AWJA 4FYYB 3VS2A 1WA7A 4F7UA 1WJRA 4QQDA 3BDLA 2L2PA 2BKDN 5I22A 4J9GA 2EYWA 1T3LA 4M7DE 4PJOA 4KGVB 1IHWA 1UGQB 2LT1A 1R8OB 2K4YA 3KUFA 2A37A 3RKWA 2AZVA 2BIVA 3RNJA 1B34A 2GFAA 4A54A 4PKCC 1NYFA 2MIOA 4EMKA 3CMAT 3U23A 2P84A 1G3YA 4JS4A 2K6DA 1UECA 1YIJT 2HNIA 2JM8A 3M0RA 4BACA 2Y4XA 1GCQC 2HKNA 2E10A 3SWNA 2FO0A 4JRQA 1UB4A 3CMEA 2E5KA 2CSIA 1VQ5A 2YSQA 3HRTA 4FL6A 4N4IA 4F14A 2V26A 3CCEA 2EQUA 1Q7YU 1N27A 4KBMB 3PIPA 4OMNA 1NPRA 2MPXC 2GTJA 2MI6A 2OTLA 2DK3A 4E7ZA 2I2LA 1QVFS 1QKXA 4NS5A 1M1KR 5DY9A 2VUBA 2QQSA 2L3PA 2QASA 3EGDB 2DL8A 3VS1A 1X27A 2DL7A 5A0GA 4A4EA 3CXCA 4C5IA 1WHHA 1D1BA 1U1SA 1ZHIA 2L3SA 1VQ8Q 1RAHB 1U8RA 1K8AU 4BI4A 2J7IA 2NWMA 1NG2A 4XU0A 1RAAB 5KYWB 4Y91A 5GMKm 5GAOr 4ZNXA 3JCMc 1VQ5T 3RDVA 2QGGA 1X01A 2ZPIB 1QWEA 1S72Q 3CCET 2O4XA 2KDSA 4M78G 3PVQA 4XK8E 2KY9A 4OB0B 2OTLT 5LJ3f 1M90R 2RD1A 1YBYA 1WXUA 1JXOA 4QQ6A 3I55Q 4M77F 4PJLA 3GOXA 1UGPB 3CCJA 4M7DF 4BY6B 2QQAA 3THKA 2GNCA 2RHIA 2YDLA 1KIKA 1RI0A 3F70A 1Z9QA 2OX7A 1GCPA 3OSVA 4F16A 4BDZA 1EX4A 3S6WA 5GANh 2DAQA 1VQKQ 5LJ5h 3SHWA 1AHJB 2PVOB 4PJMA 2L5QA 4R0KA 5M9OA 1Q81R 4QT7A 3TSWA 3G6EA 4V2SA 1IGQA 1K76A 1N6AA 3QWXX 4OMPA 2M51A 3VUBA 2DTOA 2K5IA 5CR2A 2LZ6B 2RK2A 3CCJT 3D7SB 3EHQA 3EFOA 4E7SA 4K11A 1UJYA 2RHZA 2DO3A 4OB3B 2VWFA 4BY6C 3J80E 4OMMA 1G3WA 2H3EB 1OPLA 1K73U 2QQRA 1Q7YC 3X24B 3MEVA 4X9CA 3G6ET 2IVWA 1LJOA 2AZSA 1KQSS 1PM3A 4J6WA 2VVKA 5CIUA 4BUGA 4CC4B 1PHTA 2RI3A 3IQLA 1OPKA 4TVRA 3UT1A 2PVDB 4HKEA 1QLYA 4J9EA 1HJDA 1QCOA 1IRXA 4KUIA 4EIKA 2JNGA 2QA4A 1Y7XA 5GAN7 3NPFA 1B7TA 3P8BB 4LDWA 1FMWA 1ZUKA 3C12A 2RHXA 3HHTB 3VS0A 2VB6A 2F2VA 4M78B 1JJ2A 4O5VA 5GAMf 3JB9D 1T0JA 5FU7B 2BZYA 2NUTA 2AKLA 1GFDA 2VGNA 3V8KA 4Z88A 2XICA 2EYXA 2KYBA 3VJPA 1G5VA 3A8HB 4C0GA 4D6WA 3HFNA 2QA4T 2J6OA 3WVEB 3ME9A 1NLPC 1OZ2A 2LNVA 4PL6A 3H8ZA 1K9MC 3M57A 4XTZA 1BK2A 2OAUA 4QQGA 5LL6S 5KYNA 1PD1A 1YP5A 3ZEHA 3WXMB 2LJ3A 3JCMP 2EAYA 2B86A 2M9UA 3EGXB 1SSHA 2WSCE 4KT0E 2J06A 2O88A 4M78C 1SKUB 2KRSA 1NYGA 1KC8U 1P92A 2PZ1A 1UG1A 1I0CA 1M3AA 1NM7A 3NGPA 5KCHA 2E12A 3ZL7C 5FU7C 5DLQE 5GMKh 1ZLMA 1A0NB 2DL4A 1Q82U 4FW2A 2RJEA 3QO3A 4C92A 4Z02A 3RKYA 1MNEA 3JSCA 4J5YA 3JB9H 2CGHA 2CP0A 1RAEB 1VQ4Q 4F17A 3VU3C 4JPBW 4JJNK 2SEMA 1ZA1B 2KYMA 1ZUUA 4QKUA 3TQ7P 3JCMg 4C8QG 1WZOA 4M7AG 1NEGA 3M55A 5HK0A 3M4YA 1ABOA 1VOMA 1WX6A 2LJ0A 2J6KA 1X2QA 2LQKA 1KG1A 3LW5E 1TUDA 1FYNA 1WXTA 2RA2A 1S72A 4PFOA 3JCMe 1QVPA 4J9DA 2C0IA 1LVKA 3CXCP 1H3ZA 1RACB 1TOVA 2X4JA 2X4XA 1VQLQ 3LLRA 1KD1R 3A8MB 4HCKA 3I55A 3DLMA 1QW1A 3A8LB 2CZ6B 1RAIB 2XDBA 4KH0B 1AVZC 2DTHA 2HBPA 3FDRA 2K3BA 1CKAA 4HXJA 3KXTA 1M1KU 2ZGWA 5LJ3h 4RTYA 5CKEA 1FXXA 1VQ7Q 1ABQA 3C95A 4LDXA 1VQKA 4JLIA 2K3XA 2JMCA 4B6MA 2HZYA 1S72T 2R57A 1N8RR 3MEUA 3CCVA 1I4K1 2EYYA 2YXYA 3J81E 1Y96B 2E64A 3I55T 1NJIR 1M30A 1CKBA 4M78F 2E41A 2KT1A 4IUUA 5ECAA 2V8KA 3VYHB 3E9FA 4QVZA 1M90U 1QVFA 2QGFB 2KBTA 1M1FA 5C0MA 3MKDA 4ZTFA 3CCLQ 1VQ6Q 4M75A 1YWOA 1VYUA 4FYVB 3KBGA 1M27C 1WHMA 2OTJQ 1VQKT 1PG5B 2Y90A 1X6BA 2EJ9A 2RJDA 4PLIA 3RERA 2LCSA 4F7UG 5FW9A 3JCMd 3CCVT 4PJOG 5J39A 4RKUE 4KGZB 2COYA 4BDYA 4M4ZA 2DXTA 1FMVA 1TS9A 3VS6A 3SB2A 4E7IA 1SF9A 1Q81U 2DYBA 2OI3A 2EPDA 1V29B 2LRQA 2COZA 3FEOA 3OYMA 4ZN3A 2KK4A 4J7IA 5IT9E 1N9SA
chains in the Genus database with same CATH topology
4PKCC 2GQVA 5GAOp 3GF5A 2O01E 3OYBA 4BI3A 4L6V5 4EMKA 5CO7A 2XDDA 2ZCFB 2QI2A 3CMAT 2AHJB 2FL7A 3UDCA 1G3YA 4JS4A 2ZPEB 1YJNA 4OGEA 3RMQA 3LGFA 3OYNA 1MHNA 4E47A 2E70A 5D6XA 1YIJT 4C92C 2HNIA 4VUBA 2ZPBB 1TH7A 4BACA 1G3TA 2Y4XA 1XQHA 5LJ3j 4J8OA 5LJ5g 2DZCA 4C5GA 2E10A 3SWNA 3NTKA 4JRQA 3O8VA 3R6OA 1UB4A 4IUTA 4KULA 4QVDA 3CMEA 1VQ5A 3HRTA 3QJ6A 4FL6A 4M78D 4N4IA 1WQWA 5FRNA 2P0QA 3LH0A 3OS5A 3V7SA 3FC3A 1LNXA 3L42A 3CCEA 2EQUA 1Q7YU 1N27A 4KBMB 3PIPA 3OYKA 1Q86U 1UEBA 4O6JA 1UGRB 2MMPA 3OW2A 1NPRA 4RG8A 2EQKA 2X35A 1N9RA 4ELZC 2MI6A 2OTLA 2DK3A 5KE3A 2I2LA 4RG2A 5GAMh 2B8AA 5LJ5e 1QVFS 4NS5A 3Q1JA 3TREA 5DY9A 2VUBA 2GFUA 2QQSA 3G7ZA 1YHQA 4IKFA 2VC8A 4C8QE 4M7AE 3OYEA 3OYIA 2RJFA 5A0GA 3FJPA 2HQEA 3OS2A 2JUFA 5FU6B 4A4EA 4JRIA 4C5IA 4C5HA 3I56A 3CXCA 1YJNT 1U1SA 4C0FA 1ZHIA 2VXFA 1DJ7B 1KHIA 5D6YA 3OMGA 2P4TA 1U8RA 4UC4A 4BI4A 4OGCA 5CKBA 1K8AU 2VGMA 5GAMd 3LGLA 3JB9I 4XU0A 1IZ6A 4PNOA 2GCXA 4Y91A 2Y4YA 3M58A 3UWNA 3V7CA 5GMKm 5GAOr 3QYGB 1VQNA 2LQ8A 3QYHB 3JCMc 2HAXA 4FT2A 1VQ5T 2JN0A 1X01A 2CS7A 2ZPIB 4M75B 3E1SA 4RCCA 1W2BA 2XKOC 3M59A 3EFRA 3CCET 2O4XA 4C5EA 1NJIC 2XD0A 5FLXE 2KDSA 3NTIA 4M78G 1QP3A 1KQSA 3A8OB 3SD4A 3OYAA 1JRIA 3HRSA 2EQJA 4XK8E 1M5Q1 3DB3A 2KY9A 4OB0B 4ZGEB 3L2RA 2OTLT 5LJ3f 1M90C 2RD1A 1YBYA 2PQWA 3QZ5B 1MGQA 2HQXA 4FIBA 3OYJA 3QKJA 4QQ6A 2DXBA 4M77F 1YHQT 1JBMA 3GOXA 4ME7A 3OYYA 1I81A 4M78A 3V7RA 4IUQA 3L2VA 1VQ4A 3HSBA 1UGPB 2WSEE 3CCJA 4M7DF 4BY6B 2EJFA 3L2WA 3MP1A 1VQPA 5CCAA 3JCMX 2QQAA 2MAMA 4F7UB 2CZ0B 2RHIA 3I56T 2RH2A 1RI0A 2FYKA 3F70A 4PJOB 1KC8C 1UGSB 3OSVA 3JB9J 4BDZA 3L1AA 1NZ9A 2DIQA 5J3BA 3S6WA 4OB2B 1YI2A 1WJSA 5GANh 5GAN4 2DAQA 5FU6C 3X26B 3AHUA 1B34B 2R58A 1Q82C 1VQNT 1K73C 4IURA 5LJ5h 4MZMA 2RK1A 3CBPA 1AHJB 2KQWA 2F5KA 2PVOB 4MZPA 4M77E 4EMKB 2FHDA 4IUVA 3L2UA 3RKXA 2L5QA 4LD6A 1QVGA 5CQXA 4XQ3A 4EMHA 1Q81C 5M9OA 3QJYA 4XTWA 5HY6A 3G6EA 3JCMf 4ZGDB 4V2SA 4C92F 1PSFA 2E65A 3OY9A 3OW2S 5HK3A 3JB9F 4M75C 1VQMT 2XU8A 1N6AA 3LWIA 3TU4K 5LJ5d 3FLGA 3CCQA 4XU3A 3VUBA 1VQLA 2DTOA 2K5IA 3SWNB 5CR2A 2DJZA 3C4SA 3M54A 4NL2A 5KH6A 2RK2A 4M75E 4P5NA 3CCJT 1VQ4T 1VQPT 3T9NA 2XG8D 2KSSA 4BE0A 3OYHA 3DLLA 3CC7T 2LCLA 4XTUA 4QW2A 3VUZA 4EMGA 1M8VA 3QG1A 4DOVA 4LDUA 4HA8A 5FROA 3CXCS 1G3SA 3HP9A 1M1GA 2DO3A 2RHZA 4OB3B 5GAMj 4ZTJA 2KVQG 2LVMA 5CKDA 2RO0A 5GANg 4BY6C 5A0DA 1YI2T 3J80E 4JUVA 2E5QA 1I5LA 4LD9K 4N0AC 2K5LA 3NTHA 4B9WA 5EG2A 4X9DA 1G3WA 1VQ9A 4C8QF 4M7AF 3URGA 4C92E 1VQ7A 4PJOC 1BI1A 2G3RA 3MHXA 2F5TX 2L3RA 1K73U 2MF2A 3CBMA 1VQ8A 2QQRA 2K3YA 1Q86C 2EYQA 1W2BS 2MWOA 2RHYA 3X24B 1Q7YC 2CYZB 3MEVA 4X9CA 4C8QA 3G6ET 2QQBA 2IVWA 3GNGA 2EFIA 4HCBA 3VKIA 1LJOA 1KQSS 4J6WA 5CIUA 4BUGA 4WF2A 4M77D 2RI3A 4DA4A 4MDXA 4EMKC 3CCQT 3X25B 5GANe 4ZGJB 4RMOA 1VQLT 2JTMA 1KQ2A 1H641 4M7DD 3INZA 4A4KA 4TVRA 3UT1A 1M1KC 2PVDB 4HKEA 5CKFA 5I2MA 3JCMQ 5GAOl 3E9GA 5GMKl 3CCRA 3QUIA 3S3NA 1EIFA 2A3LA 3FRNA 3X20B 4CRIA 3OBWA 4KUIA 3RESA 1Y07A 3ZFJA 3OYCA 2YHTA 2ZZDA 3A8GB 3M9QA 2FB7A 4MMKA 4EPCA 3JCMb 2JNGA 2QA4A 1Y7XA 5GAN7 2O4XB 3SWNC 3RMSA 2DXCA 1KD1U 2L8DA 3P8BB 4LDWA 4IUPA 3PTAA 4JS5A 1LOJA 3S3OA 4FM4B 2F69A 5FRMA 3C12A 2MWPA 4FT4A 1KHCA 2XK0A 1VIEA 2RHXA 1VQ9T 4LDYA 1YITA 1VQ6A 3QIIA 2YLCA 5DM7R 5GAOq 3G4SA 4OP0A 1VQ7T 3HHTB 5GAOm 2A7YA 2GF7A 3CCMA 2OTJA 4E7HA 1VQ8T 1ZQ1A 4M78B 2HD0A 1JJ2A 3BDUA 2RJCA 1IREB 2R5MA 3HRUA 2XI9A 3MO8A 3OQ5A 4GY5A 5KCOA 4C92D 3GPLA 2JVVA 4O5VA 3RUXA 5GAMf 3JB9D 5GANj 3NFCA 5FU7B 3WVDB 2ZPFB 5LJ5j 4OMFB 1PSEA 2VGNA 4DOWA 2PUKB 3V8KA 3OB9A 1X6OA 2E1HA 4R56A 1VQMA 4L5GA 2XICA 4M77G 3CCRT 2X4YA 3GNFB 3PIOA 2VYTA 3VJPA 1I8FA 1BI0A 2K57A 4QVCA 3A8HB 3LX7A 1N8RU 4M7DG 3SDZA 4C0GA 1G5VA 4D6WA 4XU1A 1VQOA 3HFNA 2QA4T 2V8IA 3WVEB 2H3JA 3ME9A 1HXDA 1OZ2A 3H6ZA 3CC7A 2LNVA 1BI2A 3DKMA 4PL6A 3OYLA 4M77A 3H8ZA 5CVIA 1VIFA 2DD4A 1KQ1A 3LYIA 4OF1A 5IN1A 1NJIU 3JAME 1K9MC 1BIAA 4C8QD 3CCLT 3CCUA 3M57A 4XTZA 1YITT 1VQ6T 3GP8A 4M7DA 3CPFA 2M0OA 4M75F 4A4GA 3G4ST 1OZ3A 2OAUA 4QQGA 5DLOA 5LL6S 3CCMT 2OTJT 3JCMV 5LJ3g 5GAN2 3ZEHA 4M7AD 2D6FA 3WXMB 1Y71A 2LX9A 3M56A 3SFMA 4N4HA 4KUDK 3JCMP 2EAYA 5GAN6 3M53A 2M9UA 4MMLA 2WSCE 3GLXA 1Y96A 2DZ9A 4KT0E 2QXFA 2LCCA 5CAIA 1O9SA 4M78C 4XTVA 4C92G 4Q5WA 2EKOA 2CKKA 2JZ2A 2PUOB 3HPWA 5I2SA 5GANd 3JB9G 1KC8U 1P92A 2QTXA 1SSFA 4F7UF 2V8JA 2CZ1B 5A0LA 1GXIE 1WQ7A 2IG0A 2YRVA 1M9SA 3CC2A 5KCHA 2E12A 2NLUA 3OSSC 3ASKA 4PJOF 1D3BA 5FU7C 1FX7A 2EQMA 4J7FA 2DTIA 5DLQE 5GMKh 3MP8A 3MP6A 1Q82U 5LJ3e 2LC4A 2E6ZA 2RJEA 3QO3A 5D6WA 4C92A 1VQOT 4Z02A 3RIRA 3RKYA 3CEYA 4X34A 1M4ZA 3JSCA 3PT9A 4J5YA 3JB9H 3OYDA 2CGHA 5GANf 4RCBA 2D0QB 3CBOA 4M7AB 4C8QB 3OYGA 1BI3A 2ZPHB 4L59A 5LJ5f 3CCUT 3BFMA 3VU3C 4JJNK 1FWZA 3G71A 3QPHA 2QQ9A 2RB6A 3JCMg 4C8QG 4M7AG 3MEWA 3P8DA 5J26A 3V8JA 1XOVA 1NE8A 2D9TA 3OYFA 2WACA 3VV0A 3CD6A 3M55A 4F7UE 5HK0A 3A5ZB 3M4YA 1XNIA 5IAYA 3OA6A 5A2QE 1JJ2S 1BYMA 1YJWA 5I21A 2XIDA 4J83A 4HT8A 3OS0A 4PJOE 1WGSA 2LT4A 2JTFA 2X4WA 2K5FA 4B9XA 4M7AA 2LQKA 1KG1A 4A4FA 2JOYA 3LW5E 2QDYB 2K2VA 4R55A 3DB4A 2EIFA 4JLGA 3OS1A 2RA2A 5C6SA 3CC2T 3LWHA 3J7AF 1QP2A 3P8HA 1JB0E 4OVAA 1S72A 2DVEA 5CK9A 4XTXA 1QVPA 4GLKA 3JCMe 3X28B 3L2QA 4E7KA 2P0KA 1O75A 3L2ZA 3JRZA 5CQYA 2XDPA 3N5BB 1H3ZA 3HFOA 4MDWA 3CPWA 4ELYC 2X4JA 2X4XA 4XU2A 4YTLA 3BY7A 3LLRA 1KD1C 3A8MB 2M1HA 4M75D 3I55A 1K8AC 3DLMA 4A53A 2FVUA 1XTDA 1QW1A 2ZPGB 2WSFE 4PLLA 3G71T 3A8LB 2CZ6B 4MZTA 2BUDA 2KAFA 3QXEB 4HT9A 4ZN1A 4CI0C 2XDBA 2EWNA 4C0DB 2DTHA 4C8QC 4M7AC 2HBPA 3FDRA 3MCAB 5GMKe 3CD6T 3CCSA 5AYFA 4BE1A 4A4HA 5CKHA 3KXTA 1M1KU 4J6YA 1BKBA 1YJWT 2ZGWA 5LJ3h 4FU6A 1NPPA 2E6NA 3FIFA 5CKEA 3BW1A 1FXXA 3VYGA 3S3MA 3C95A 1QVGS 4LDXA 4M77B 3EAEA 1VQKA 4JLIA 3M4GA 4BD3A 2K3XA 3CC4A 3PMTA 4ATOA 1W4SA 1WPYA 3OBYA 4M7DB 3ER0A 4PJOD 1S72T 2DIGA 2QEXA 4E7LA 2VV5A 5HKCA 2R57A 4E7JA 1N8RC 4HCCA 3MEUA 3CCVA 1I4K1 5LJ3d 3CMET 3JCMW 1OYXA 2DPPB 2R5AA 4HCZA 4EDUA 3HKSA 2PVGB 1HK9A 1YJ9A 3J81E 3C94A 1Y96B 2E64A 4XAXB 5KE2A 3I55T 4BE2A 2YLBA 2XHCA 2DKGA 1WJQA 2PU9B 4OB1B 4M78F 3QSUA 2E41A 2DXUA 3PGGA 3PMIA 4IUUA 4XTYA 2P0PA 2V8KA 4M75G 3VYHB 3E19A 4II1A 5GMKj 5GAMg 2C06A 3E9FA 4QVZA 3M5AA 1ZBXA 1M90U 1QVFA 3JCMJ 2L89A 3QZ9B 3CCST 1D3BB 1M1FA 1YCYA 3JCMh 4FSXA 4NOYA 5C0MA 3FB9A 4C92B 4ZTFA 3PFSA 5GMKi 1X75C 1OI1A 4M75A 4C0ZA 3UPUA 3KBGA 4C0DC 2RM4A 1BIBA 3CMAA 4BI8B 1VQKT 2VXEA 4JRKA 3CCLA 3QBYA 4NL3A 3CC4T 1VUBA 3MEAA 2M16A 2KMTA 4BB7A 2Y90A 2EJ9A 2LDMA 2RJDA 4PLIA 3RERA 4F7UG 5GAOn 2QEXT 1WNLA 1YIJA 1K9MU 5L8RE 4J6XA 2CZ7B 5GAMe 4M78E 3JCMd 3CCVT 2LTOA 4PJOG 3OMCA 4M77C 3GIBA 3TEEA 5J39A 1RL2A 4RKUE 3EFSA 4BDYA 2DD5A 4JDSA 3HL8A 3PNWC 4M7DC 2DEQA 1YJ9T 2DXTA 4N0AA 4N4GA 1WJRA 4QQDA 4F7UA 3BDLA 5GAN3 5GAN5 3CPWS 3SB2A 2BKDN 3META 3QHSA 4DQ2A 4E7IA 4M7DE 3ZBDA 4PJOA 1UGQB 3V8LA 1Q81U 2LT1A 5GAN8 1R8OB 2RI5A 2K4YA 2RI2A 3TCJA 3KUFA 4Y28E 1V29B 4LDVA 2LRQA 3RKWA 4JRPA 3FEOA 3OYMA 4ZN3A 2BIVA 2RHUA 1B34A 2KK4A 2GFAA 4J7IA 5IT9E 4A54A 1U1TA 1N9SA 2EJGA 3QDRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY7 A;  5GAN h;  5GAN 4;  5GAO p;  5LJ5 j;  3AHU A;  1B34 B;  4M75 D;  3V8K A;  5LJ5 h;  4EMK A;  4A53 A;  2E1H A;  4M77 G;  4HT9 A;  4M77 E;  4EMK B;  2EWN A;  3RKX A;  1I8F A;  2K57 A;  4QVC A;  4M7D G;  5GAN j;  4C92 C;  2DTH A;  4XQ3 A;  4C8Q C;  4EMH A;  4M7A C;  2HNI A;  5GMK e;  4XTW A;  4XU1 A;  3HFN A;  1TH7 A;  3JCM f;  5LJ5 g;  5LJ3 j;  4J6Y A;  4V2S A;  1HXD A;  2DZC A;  2ZGW A;  4C92 F;  2E65 A;  2E10 A;  3SWN A;  5LJ3 h;  4M77 A;  3JB9 F;  4M75 C;  1KQ1 A;  3FIF A;  5LJ5 d;  4QVD A;  1BIA A;  3BW1 A;  4XU3 A;  4C8Q D;  2DTO A;  4XTZ A;  3SWN B;  4M7A D;  4M7D A;  4M75 F;  4M77 B;  2DJZ A;  4M78 D;  4NL2 A;  1WQW A;  4M75 E;  4JLI A;  3M4G A;  3V7S A;  1WPY A;  3JCM V;  4M7D B;  4PJO D;  1LNX A;  5LJ3 g;  5GAN 2;  4XTU A;  1M8V A;  4EMG A;  4HA8 A;  1N9R A;  1I4K 1;  2EAY A;  5LJ3 d;  5GAN 6;  5GAM j;  3JCM W;  3JCM P;  4MML A;  3JB9 H;  1Y96 A;  2DZ9 A;  2I2L A;  5GAM h;  5GAN g;  5LJ5 e;  5CAI A;  4JUV A;  5DY9 A;  1I5L A;  1HK9 A;  4N0A C;  4M78 C;  4XTV A;  4C92 G;  1Y96 B;  2E64 A;  4X9D A;  2VC8 A;  4C8Q F;  4M7A F;  3JB9 G;  2YLB A;  4C92 E;  5GAN d;  4C8Q E;  4M7A E;  2DKG A;  2QTX A;  4F7U F;  3QSU A;  4M78 F;  4PJO C;  2E41 A;  2DXU A;  3FJP A;  3PGG A;  4XTY A;  1WQ7 A;  4JRI A;  4M75 G;  5GMK j;  5GAM g;  1U1S A;  4PJO F;  1D3B A;  2VXF A;  2DTI A;  5GMK h;  5LJ3 e;  3QO3 A;  3JCM J;  4C92 A;  4X9C A;  4C8Q A;  3RIR A;  5GAM d;  3RKY A;  1D3B B;  4J5Y A;  3JB9 I;  1YCY A;  4XU0 A;  1LJO A;  4NOY A;  4PNO A;  3JCM h;  4J6W A;  4Y91 A;  2CGH A;  4WF2 A;  5GAN f;  4RCB A;  3FB9 A;  4M77 D;  4C92 B;  4M7A B;  3V7C A;  4C8Q B;  5GMK i;  5GMK m;  5GAO r;  4M75 A;  4EMK C;  5GAN e;  5LJ5 f;  3BFM A;  3VU3 C;  3JCM c;  1KQ2 A;  1H64 1;  1BIB A;  2RM4 A;  3INZ A;  4M7D D;  2JN0 A;  1X01 A;  2VXE A;  4JRK A;  4M75 B;  5GMK l;  3JCM Q;  5GAO l;  4RCC A;  2RB6 A;  3QUI A;  4NL3 A;  3JCM g;  4C8Q G;  2Y90 A;  4M7A G;  3EFR A;  3V8J A;  2EJ9 A;  3RER A;  4F7U G;  5GAO n;  4M78 G;  1WNL A;  3RES A;  2YHT A;  4J6X A;  3JCM b;  2FB7 A;  1JRI A;  4MMK A;  4F7U E;  5GAM e;  4M78 E;  1M5Q 1;  3JCM d;  5GAN 7;  3SWN C;  4PJO G;  4M77 C;  5LJ3 f;  5I21 A;  4HT8 A;  3GIB A;  2RD1 A;  3EFS A;  1MGQ A;  4PJO E;  1LOJ A;  4M7A A;  4M77 F;  4M7D C;  2DEQ A;  2DXT A;  1JBM A;  4N0A A;  1I81 A;  4M78 A;  3V7R A;  4F7U A;  2YLC A;  5GAN 3;  5GAN 5;  5GAO q;  3HSB A;  4OP0 A;  3SB2 A;  3QHS A;  4DQ2 A;  5GAO m;  4M7D F;  2EJF A;  4M7D E;  3JCM X;  4PJO A;  4F7U B;  2RA2 A;  4M78 B;  3V8L A;  5GAN 8;  2FYK A;  2DVE A;  3BDU A;  4XTX A;  3JCM e;  4PJO B;  3RKW A;  3L2Z A;  4C92 D;  3JB9 J;  3L1A A;  3RUX A;  5GAM f;  1B34 A;  3HFO A;  3JB9 D;  4A54 A;  1U1T A;  1N9S A;  2EJG A;  4XU2 A; 
#chains in the Genus database with same CATH topology
 1HYO A;  5GAO p;  2O01 E;  4BI3 A;  4L6V 5;  2DMO A;  5CO7 A;  1GL5 A;  1TU0 B;  2K79 A;  2JTE A;  4PFZ A;  2CH4 A;  3REB B;  5LJ5 g;  1QCN A;  1G8X A;  3NTK A;  3O8V A;  4KUL A;  4QVD A;  3LH5 A;  2D8H A;  2V1Q A;  1Q86 R;  3V7S A;  3LH0 A;  3OS5 A;  1D0X A;  3FC3 A;  3OYK A;  1NLO C;  2EQK A;  2X35 A;  1KFZ A;  1JJ2 P;  5KE3 A;  2X3W D;  4RG2 A;  5GAM h;  2B8A A;  5LJ5 e;  1JO8 A;  3Q1J A;  2DIL A;  2GFU A;  4IKF A;  3NHN A;  2VC8 A;  4C8Q E;  4M7A E;  2FG0 A;  2RJF A;  2HQE A;  3OS2 A;  4JRI A;  1QMC A;  3CQT A;  1DJ7 B;  1KHI A;  2P4T A;  1YWP A;  1YJW Q;  2VGM A;  2DRK A;  1M8M A;  3JB9 I;  1IZ6 A;  4PNO A;  4AG2 C;  4JJC A;  3UWN A;  3V7C A;  5I11 A;  2E3H A;  3QYG B;  2LQ8 A;  3I35 A;  3E1S A;  1X2K A;  1WXB A;  4RCC A;  3M59 A;  3EFR A;  4CC3 A;  5FLX E;  3NTI A;  2I0N A;  1OEB A;  1KQS A;  2LNH B;  3DB3 A;  8ATC B;  3L2R A;  1M90 C;  1TUG B;  5L23 A;  4FYX B;  2HEQ A;  1I81 A;  3V7R A;  3L2V A;  1VQ4 A;  4DBQ A;  5CCA A;  1PC0 A;  2X9H A;  4F7U B;  1Y57 A;  2CZ0 B;  3M0Q A;  2VAS A;  3CCS Q;  4PJO B;  2D8J A;  2A08 A;  4HVU A;  1WJS A;  2NYS A;  3AHU A;  1B34 B;  3CC4 Q;  2RK1 A;  2KQW A;  4M77 E;  4EMK B;  2FHD A;  4DBF A;  3L2U A;  3RKX A;  4LD6 A;  5IHK A;  4XQ3 A;  1Q81 C;  5HY6 A;  4ESR A;  1VQM T;  2XU8 A;  5LJ5 d;  2KE9 A;  1VQL A;  4XU3 A;  3SWN B;  1VQ4 T;  1BU1 A;  3KFV A;  3T9N A;  2XG8 D;  4BE0 A;  3VS3 A;  3DLL A;  4GBQ A;  1G3S A;  5CKD A;  1I5L A;  4LD9 K;  1PWT A;  3NTH A;  4B9W A;  4X9D A;  4C8Q F;  4M7A F;  4RTW A;  1VQ7 A;  4PJO C;  2GTO A;  2L3R A;  2MF2 A;  3CBM A;  1WHL A;  4DBH A;  2EYQ A;  1W2B S;  3H0I A;  2YUO A;  2CYZ B;  1V1C A;  2KT8 A;  1SG5 A;  3VKI A;  2XMF A;  4M77 D;  4EMK C;  1VQL T;  4ZGJ B;  3BE3 A;  1UJ0 A;  4M7D D;  3INZ A;  4A4K A;  4CC2 A;  5I2M A;  3CCR A;  3S3N A;  3FRN A;  4AFQ C;  3X20 B;  2KRO A;  3A8G B;  3M9Q A;  4MMK A;  1GFC A;  2JT4 A;  4FW1 A;  2O4X B;  1M2V A;  3SWN C;  2GBQ A;  1KD1 U;  2DRM A;  1F1B B;  4PJJ A;  1LOJ A;  4FM4 B;  3CCL A;  1KHC A;  2XK0 A;  1VIE A;  1VQ6 A;  2YLC A;  5DM7 R;  5GAO q;  1VQ7 T;  4OP0 A;  5GAO m;  2A7Y A;  1YJN Q;  3A1P A;  2OTJ A;  2ATC B;  1ZQ1 A;  3MO8 A;  1IRE B;  2XI9 A;  2HL5 C;  1X69 A;  2M02 A;  1QVF P;  2G6F X;  2ZPF B;  4OMF B;  4DOW A;  3OB9 A;  4PJN A;  2E1H A;  2QK0 A;  4L5G A;  3CCR T;  1SRM A;  2X4Y A;  3GNF B;  1N8R U;  1I8F A;  1BI0 A;  2ECZ A;  4GLM A;  4XU1 A;  1OX8 A;  2A36 A;  2H3J A;  1HXD A;  5CVI A;  1VIF A;  2DD4 A;  3LYI A;  1YHQ Q;  1NJI U;  1X6G A;  3JAM E;  3CCL T;  1VQ6 T;  2LP5 A;  3CPF A;  2FPE A;  5DLO A;  2OTJ T;  2J05 A;  5LJ3 g;  5IXF A;  5GAN 6;  1JEG A;  3MJX A;  3EH2 A;  4KH1 B;  3EFO B;  3CCV Q;  5CAI A;  4A63 B;  4C92 G;  4Q5W A;  2EKO A;  3HPW A;  1W6X A;  4F7U F;  2V8J A;  1W70 A;  1GXI E;  1WQ7 A;  3SEM A;  1M9S A;  2NLU A;  2RQT A;  4PJO F;  1FX7 A;  2EQM A;  6AT1 B;  5LJ3 e;  3CEY A;  4X34 A;  1M4Z A;  2CP5 A;  4FYW B;  3CBO A;  3OYG A;  1BI3 A;  4LXC A;  3QPH A;  1MV3 A;  2QQ9 A;  2RB6 A;  2FZG B;  3MEW A;  3P8D A;  5J26 A;  3V8J A;  2HMA A;  2WAC A;  1D1C A;  5IAY A;  1YJW A;  5I21 A;  1YI2 Q;  4HT8 A;  3OS0 A;  2FPF A;  2K5F A;  5KYY A;  4R55 A;  1ZSG A;  2RQV A;  3QWY A;  3LWH A;  3J7A F;  3P8H A;  2QAZ A;  2J6F A;  2DVE A;  5CK9 A;  7AT1 B;  1K4U S;  4GLK A;  3L2Q A;  2RQU A;  2HL3 A;  3JRZ A;  1Q95 G;  3HFO A;  4ELY C;  4D8D A;  1KD1 C;  1SRL A;  1QKW A;  1K8A C;  1PKS A;  2NUT B;  2HBW A;  2BUD A;  2KAF A;  3QXE B;  4HT9 A;  2C0T A;  2CP6 A;  4C0D B;  3MCA B;  2DL3 A;  3CCS A;  5CKH A;  2YRC A;  1YJW T;  1YFN A;  2X3X D;  1I07 A;  1KQS P;  1FMK A;  1VQ9 Q;  4RTX A;  3VYG A;  3S3M A;  4KGX B;  1B3Q A;  4BD3 A;  3CC4 A;  4ATO A;  3ER0 A;  4E7L A;  1GRI A;  1B07 A;  5HKC A;  1N8R C;  2L3Q A;  3JCM W;  5LJ3 d;  1OYX A;  2DPP B;  2R5A A;  3TSZ A;  2CT4 A;  4XAX B;  2LQW A;  2DKG A;  3QSU A;  2PU9 B;  3PMI A;  4M75 G;  5GAM g;  4II1 A;  1ZBX A;  3JCM J;  3QZ9 B;  3CCS T;  2L0A A;  2ENM A;  4FSX A;  4NOY A;  1G2B A;  4HVV A;  4ANJ A;  3FB9 A;  4C92 B;  1YIT Q;  5GMK i;  4C0Z A;  2QTV A;  4OMQ A;  3G4S Q;  4C0D C;  1BIB A;  3CCM Q;  4BI8 B;  1HD3 A;  4JRK A;  2CSQ A;  2LX7 A;  3CC4 T;  3MEA A;  4BB7 A;  1JXM A;  5GAO n;  1WNL A;  4JZ3 A;  4RUG A;  5GAM e;  4M78 E;  2W0Z A;  2FZC B;  4JZ4 A;  3EFS A;  2DD5 A;  2CUD A;  2ROL A;  5FWB A;  4F04 B;  4HVW A;  4N0A A;  4N4G A;  5GAN 5;  1VQM Q;  3CPW S;  3QHS A;  4DEX A;  5GAN 8;  1CSK A;  3TCJ A;  2MK5 A;  1VQO Q;  4LUD A;  4IIM A;  4LDV A;  4JRP A;  4J9I A;  1K73 C;  1U1T A;  4Z8A A;  3GF5 A;  4E2F B;  3UA6 A;  1I1J A;  2CP3 A;  4DEY A;  2KRM A;  2F2X A;  5KYX A;  1D09 B;  2DFU A;  1YJN A;  4OGE A;  3LGF A;  3OYN A;  4E47 A;  5D6X A;  3H0H A;  4C92 C;  1G3T A;  1XQH A;  2DZC A;  2JXB A;  3CPW P;  3R6O A;  3VRY A;  1AOJ A;  2DX1 A;  4M78 D;  1TTH B;  5FRN A;  2W10 A;  1Q7Y R;  2RN8 A;  3VRZ A;  1UGV A;  2MMP A;  4ELZ C;  2DA9 A;  9ATC B;  3G1J A;  1YHQ A;  1QQJ A;  1IGU A;  4RTV A;  1D1A A;  4RTU A;  5AT1 B;  3OYE A;  3OYI A;  3FJP A;  4C5H A;  1Z9Z A;  1YJN T;  3M0P A;  4C0F A;  2YT6 A;  1WHG A;  3CD6 Q;  1RI9 A;  5D6Y A;  3OMG A;  4UC4 A;  1RAF B;  5GAM d;  3LGL A;  1ARK A;  1MMA A;  2DBK A;  4J9C A;  1PRL C;  2LQN A;  1WHK A;  1JU5 C;  4FT2 A;  5FWC A;  2O9V A;  2CS7 A;  2A28 A;  4M75 B;  1W2B A;  3VS7 A;  3CCR Q;  2AKK A;  3A8O B;  3SD4 A;  3HRS A;  1NBE B;  4ZGE B;  1PRM C;  4FIB A;  3QZ5 B;  1MGQ A;  2HQX A;  3QKJ A;  1R0C B;  1YHQ T;  2VKN A;  3HTR A;  1JBM A;  4ME7 A;  3M0T A;  3OYY A;  1MV0 B;  3HSB A;  3L2W A;  3MP1 A;  3JCM X;  2RH2 A;  1BCO A;  1KC8 C;  1UGS B;  4D8K A;  1IB8 A;  3JB9 J;  2RMO A;  1K9M R;  2DIQ A;  5GJW B;  5J3B A;  1YI2 A;  1SEM A;  2R58 A;  1Q82 C;  3CBP A;  4MZP A;  4IUV A;  4PFP A;  1QVG A;  5CQX A;  4EMH A;  3QJY A;  4XTW A;  4C92 F;  1M3B A;  3OY9 A;  3OW2 S;  4J9H A;  5HK3 A;  4M75 C;  1YJ9 Q;  2DL5 A;  3TU4 K;  2KXD A;  2DJZ A;  4NL2 A;  2RF0 A;  4M75 E;  4P5N A;  5HCK A;  1RLP C;  1D0Y A;  1MMN A;  2ED0 A;  3CC7 T;  2NUZ A;  3VUZ A;  1M8V A;  1RAG B;  2CP2 A;  2NUP B;  1E6G A;  1SHF A;  3HP9 A;  4ZTJ A;  1MMG A;  2KVQ G;  2RO0 A;  5GAN g;  1YI2 T;  1TUC A;  2K5L A;  2JMA A;  1VQ9 A;  3URG A;  2F1L A;  1ZSZ A;  2V1R A;  2YUN A;  3EH1 A;  2MWO A;  2NUP A;  4C8Q A;  1AWX A;  2EFI A;  1X43 A;  3O5Z A;  3H9N A;  4MDX A;  2ZAE A;  1AWO A;  2ED1 A;  5GAN e;  2JTM A;  1KQ2 A;  1H64 1;  3EG9 A;  1M1K C;  2A3L A;  1W1F A;  3OBW A;  3RES A;  1Y07 A;  2ZZD A;  3JCM b;  1OOT A;  1QCF A;  4AT1 B;  1E6H A;  1TSF A;  3PTA A;  4JS5 A;  1OU8 A;  2F69 A;  5FRM A;  4FT4 A;  2MWP A;  1YIT A;  1VQ9 T;  3QII A;  2OAW A;  3G4S A;  3CCM A;  2CDT A;  2HD0 A;  2JW4 A;  3BDU A;  1RUW A;  2RJC A;  2R5M A;  3OQ5 A;  4GY5 A;  1GBR A;  2F2W A;  3UF4 A;  2RQW A;  4WCI A;  2C0O A;  5GAN j;  3NFC A;  1JQQ A;  1C6V X;  2HSP A;  5LJ5 j;  1ACM B;  4R56 A;  1VQM A;  3PIO A;  1VQO A;  1U3O A;  3DKM A;  4M77 A;  1KQ1 A;  4E6R A;  2QG9 B;  4LE9 A;  4C8Q D;  1YIT T;  4M7A D;  5KYU A;  1AZE A;  4M7D A;  2M0O A;  4M75 F;  4A4G A;  3G4S T;  1OZ3 A;  3CCM T;  1NEB A;  2K9G A;  3I56 Q;  2JJ9 A;  1Y0M A;  1UE9 A;  1Y71 A;  2LX9 A;  3M56 A;  3GLX A;  2DZ9 A;  1M3C A;  2LCC A;  4AMC A;  1VQN Q;  4Y92 A;  5I2S A;  2EQI A;  3JB9 G;  5GAN d;  2DET A;  2QTX A;  2CZ1 B;  3REA B;  2QYZ A;  3OSS C;  1D3B A;  3MP6 A;  2E6Z A;  5D7U A;  5D6W A;  1VQO T;  3OYD A;  1GCQ A;  4RCB A;  2D0Q B;  2ZPH B;  3BFM A;  2HKQ B;  1FWZ A;  1RLQ C;  1VQP Q;  2D1X A;  3G71 A;  1BCM A;  1NE8 A;  2D9T A;  1UHC A;  3VV0 A;  1ZA2 B;  3CD6 A;  4F7U E;  2LMJ A;  5A2Q E;  2H8H A;  2XID A;  4J83 A;  2AT1 B;  1WLP B;  4PJO E;  1WGS A;  2LT4 A;  1M2V B;  3PVL A;  1R0B G;  1KJW A;  1SHG A;  3DB4 A;  4JLG A;  1UFF A;  5C6S A;  1QP2 A;  2LJ1 A;  4OVA A;  1MUZ A;  3X28 B;  1AZG B;  1O75 A;  2P0K A;  3N5B B;  2CP7 A;  4J9F A;  3CPW A;  4XU2 A;  3CCQ Q;  4YTL A;  2M1H A;  4A53 A;  2FZK B;  2ZPG B;  3G71 T;  4MZT A;  4CI0 C;  2EWN A;  4IIO A;  2FPD A;  5GMK e;  3CD6 T;  1W2B P;  5AYF A;  2ABL A;  2MCN A;  1OU9 A;  3FIF A;  3BW1 A;  1QVG S;  2DNU A;  1WPY A;  3OBY A;  4PJO D;  2CT3 A;  3EG3 A;  2DER A;  2RNA A;  2DEU A;  3CME T;  3EGD A;  1U5S A;  1YN8 A;  4HCZ A;  4EDU A;  4Z89 A;  5GJV B;  1HK9 A;  2A0F B;  1YJ9 A;  3C94 A;  5KE2 A;  2XHC A;  1WJQ A;  2PTK A;  3PGG A;  2GQI A;  3MPU B;  5GMK j;  2PNI A;  2C06 A;  1ZBJ A;  5KYW A;  2FEI A;  3M0S A;  4OMO A;  2Z0W A;  1D0Z A;  1QVG P;  2DM1 A;  2CH4 W;  3PFS A;  1X75 C;  1UUE A;  2BTT A;  1WDX A;  3UPU A;  2RM4 A;  3I5S A;  1S1N A;  3QBY A;  4NL3 A;  2KMT A;  1TG0 A;  1K9M U;  5L8R E;  4J6X A;  2RQR A;  2LTO A;  3HL8 A;  2CUB A;  2DEQ A;  1YJ9 T;  5GAN 3;  1WHJ A;  3H0F A;  3MET A;  4DQ2 A;  5KYY B;  3ZBD A;  3V8L A;  4OML A;  2RI5 A;  2RI2 A;  4Y28 E;  2YWW A;  3CC7 Q;  1ZUY A;  3JV3 A;  2RHU A;  2EJG A;  3QDR B;  2GQV A;  4DBR A;  3CCU Q;  3OYB A;  2XDD A;  2ZCF B;  2QI2 A;  2AHJ B;  2DVJ A;  2FL7 A;  3UDC A;  2ZPE B;  3RMQ A;  2K7A A;  1MHN A;  2E70 A;  4VUB A;  2ZPB B;  1TH7 A;  5LJ3 j;  4J8O A;  4C5G A;  2KEA A;  4IUT A;  5IH2 A;  1GBQ A;  4ORZ A;  3QJ6 A;  1WQW A;  3CC2 Q;  2P0Q A;  1WYX A;  1LNX A;  3L42 A;  1Q86 U;  1UEB A;  4O6J A;  1UGR B;  2DF6 A;  3OW2 A;  2P4R A;  4RG8 A;  2SRC A;  2EVR A;  1N9R A;  2EKH A;  1K0X A;  1G83 A;  2EGE A;  3TRE A;  1KK7 A;  2E4H A;  3G7Z A;  2EW3 A;  1QWF A;  2JUF A;  5FU6 B;  3I56 A;  2VXF A;  1VYV A;  4OGC A;  5CKB A;  4AFZ C;  2KXC A;  2GCX A;  2Y4Y A;  3M58 A;  1M2O A;  1VQN A;  3QYH B;  2HAX A;  2EGC A;  2JN0 A;  2KRN A;  2M0Y A;  2XKO C;  8AT1 B;  1NJI C;  1IHV A;  4C5E A;  2XD0 A;  2DBM A;  1PD0 A;  5IHI A;  1QP3 A;  3OYA A;  1JRI A;  2EQJ A;  1M5Q 1;  3H41 A;  4RTZ A;  1OX9 A;  3I9Q A;  2PQW A;  3OYJ A;  3VS4 A;  1UTI A;  2DXB A;  4M78 A;  4IUQ A;  2EGA A;  1UHF A;  2WSE E;  2EJF A;  1VQP A;  2MAM A;  3I56 T;  1PKT A;  2FYK A;  2DLP A;  2K2M A;  4X1V A;  2HQH A;  3L1A A;  1NZ9 A;  4OB2 B;  5GAN 4;  5FU6 C;  3X26 B;  1VQN T;  2HDA A;  4IUR A;  3A98 A;  4MZM A;  2F5K A;  2QEX Q;  1HSQ A;  2ESW A;  4FCY A;  5KYX B;  1BBZ A;  2EBP A;  3JCM f;  4ZGD B;  1PSF A;  2E65 A;  1SPK A;  3JB9 F;  3LWI A;  3FLG A;  3CCQ A;  3EHR A;  3C4S A;  3M54 A;  5KH6 A;  2BE7 D;  1VQP T;  2KSS A;  3OYH A;  2KNB B;  2LCL A;  3EGX A;  4XTU A;  4QW2 A;  4EMG A;  3QG1 A;  4DOV A;  4LDU A;  4HA8 A;  5FRO A;  3CXC S;  2YUP A;  1M1G A;  5GAM j;  2AK5 A;  2LVM A;  2O2O A;  2IIM A;  5A0D A;  4JUV A;  2E5Q A;  4N0A C;  3RBB B;  5EG2 A;  3CMA Q;  4C92 E;  1BI1 A;  2G3R A;  3MHX A;  3RR6 A;  2F5T X;  1VQ8 A;  1YIJ Q;  2K3Y A;  2HSE B;  1TXQ A;  1Q86 C;  2RHY A;  1AD5 A;  2QQB A;  2KR3 A;  3GNG A;  4HCB A;  1K9A A;  4WF2 A;  4DA4 A;  3FJ5 A;  3TVT A;  3CCQ T;  3X25 B;  4RMO A;  1IXD A;  5CKF A;  5GAO l;  3JCM Q;  3E9G A;  5GMK l;  2FRW A;  3QUI A;  1EIF A;  3G71 Q;  4CRI A;  3ZFJ A;  4AG1 C;  3OYC A;  2YHT A;  4EPC A;  2FB7 A;  1H8K A;  3RMS A;  1C1A A;  2DXC A;  4JJD A;  1K8A R;  2L8D A;  4IUP A;  3S3O A;  4LDY A;  2BZX A;  2FRY A;  2GF7 A;  4E7H A;  1VQ8 T;  2JS0 A;  3ULR B;  4KRT A;  2D0N A;  2KI7 A;  3HRU A;  3QDF A;  5IXB A;  5KCO A;  4C92 D;  3GPL A;  2JVV A;  3RUX A;  1WIE A;  3EG0 A;  3WVD B;  3CME Q;  1WI7 A;  1VQ5 Q;  1PSE A;  1KSW A;  1RAD B;  3R6N A;  2PUK B;  1OUL A;  1X6O A;  1C0M A;  2OJ2 A;  4M77 G;  3CCE Q;  2VYT A;  1VA7 A;  2K57 A;  4QVC A;  4M7D G;  3LX7 A;  2YRD A;  3SDZ A;  2OTL Q;  2O31 A;  1BB9 A;  2V8I A;  3CC7 A;  3H6Z A;  1BI2 A;  4AFU C;  3OYL A;  1EFN A;  4OF1 A;  5IN1 A;  1BIA A;  3CCU A;  3UA7 A;  3UAT A;  3GP8 A;  1K0S A;  1V76 A;  4AFS C;  2E3I A;  3JCM V;  1MND A;  5GAN 2;  2D6F A;  1IO6 A;  4J9B A;  3SFM A;  4N4H A;  2QDL A;  4KUD K;  1WFW A;  3M53 A;  4MML A;  1Y96 A;  2QXF A;  1O9S A;  2MOX A;  4JJB A;  4XTV A;  4FSS A;  1AWW A;  1R77 A;  2JZ2 A;  2CKK A;  2PUO B;  3GBQ A;  1PNJ A;  3VS5 A;  1SSF A;  5A0L A;  2IG0 A;  2YRV A;  3CC2 A;  1ZSZ B;  3ASK A;  4J7F A;  2DTI A;  2JM9 A;  3MP8 A;  2LC4 A;  1EZZ B;  3RIR A;  3PT9 A;  2IPO B;  1K1Z A;  5GAN f;  4M7A B;  4C8Q B;  4L59 A;  5LJ5 f;  3CCU T;  3CCJ Q;  1OQK A;  2EYZ A;  2DJQ A;  3EG9 B;  3EG1 A;  1XOV A;  1XJW B;  3OYF A;  1K73 R;  3A5Z B;  1XNI A;  3OA6 A;  1JJ2 S;  1BYM A;  2AIR B;  3OW2 P;  2JTF A;  2X4W A;  4B9X A;  4M7A A;  5IHN A;  2ROT A;  4A4F A;  4LN2 A;  2JOY A;  2QDY B;  2K2V A;  2DE0 X;  1UDL A;  2EIF A;  3OS1 A;  2BZ8 A;  3CC2 T;  1JB0 E;  4XTX A;  3G6E Q;  4E7K A;  1H3H A;  2COW A;  3L2Z A;  5CQY A;  1J3T A;  2XDP A;  4MDW A;  2DYI A;  3BY7 A;  1N5Z A;  4M75 D;  4WTO B;  1LPL A;  1ZSZ C;  1YNZ A;  2FVU A;  2RPN A;  3EGU A;  1XTD A;  4PLL A;  2WSF E;  3AT1 B;  4LNP A;  4ZN1 A;  4LUE A;  4C8Q C;  4M7A C;  1T3S A;  4BE1 A;  4A4H A;  4J6Y A;  1BKB A;  4CC7 A;  4FU6 A;  1NPP A;  2E6N A;  2MYS A;  4M77 B;  2GGR A;  3EAE A;  3M4G A;  2BE9 B;  3PMT A;  1VYT A;  1W4S A;  5KYU B;  3EG2 A;  4PK4 A;  4M7D B;  3M0U A;  2DIG A;  2QEX A;  3C0C A;  4RTT A;  2VV5 A;  4E7J A;  1H92 A;  4HCC A;  2JS2 A;  3I5R A;  3NMZ C;  1AT1 B;  3HKS A;  1U06 A;  2PVG B;  1LCK A;  1ZX6 A;  4BE2 A;  2YLB A;  1E7O A;  4OB1 B;  2DXU A;  4XTY A;  5EC7 A;  2P0P A;  1RAB B;  2HCK A;  3E19 A;  3M5A A;  2QA4 Q;  1OV3 A;  2L89 A;  1D3B B;  1YCY A;  3JCM h;  2YUQ A;  1OI1 A;  2X51 A;  3PE0 A;  3CMA A;  3E2U A;  2O9S A;  2VXE A;  1VUB A;  2M16 A;  1KC8 R;  2KGT A;  2LDM A;  1MMD A;  2QEX T;  1YIJ A;  2CZ7 B;  1I5O B;  1T0H A;  1PCX A;  3OMC A;  4M77 C;  1Q82 R;  3GIB A;  3TEE A;  1AEY A;  1RL2 A;  4JDS A;  2CRE A;  1TWB A;  1YCS B;  3PNW C;  4M7D C;  1AWJ A;  4FYY B;  3VS2 A;  1WA7 A;  4F7U A;  1WJR A;  4QQD A;  3BDL A;  2L2P A;  2BKD N;  5I22 A;  4J9G A;  2EYW A;  1T3L A;  4M7D E;  4PJO A;  4KGV B;  1IHW A;  1UGQ B;  2LT1 A;  1R8O B;  2K4Y A;  3KUF A;  2A37 A;  3RKW A;  2AZV A;  2BIV A;  3RNJ A;  1B34 A;  2GFA A;  4A54 A;  4PKC C;  1NYF A;  2MIO A;  4EMK A;  3CMA T;  3U23 A;  2P84 A;  1G3Y A;  4JS4 A;  2K6D A;  1UEC A;  1YIJ T;  2HNI A;  2JM8 A;  3M0R A;  4BAC A;  2Y4X A;  1GCQ C;  2HKN A;  2E10 A;  3SWN A;  2FO0 A;  4JRQ A;  1UB4 A;  3CME A;  2E5K A;  2CSI A;  1VQ5 A;  2YSQ A;  3HRT A;  4FL6 A;  4N4I A;  4F14 A;  2V26 A;  3CCE A;  2EQU A;  1Q7Y U;  1N27 A;  4KBM B;  3PIP A;  4OMN A;  1NPR A;  2MPX C;  2GTJ A;  2MI6 A;  2OTL A;  2DK3 A;  4E7Z A;  2I2L A;  1QVF S;  1QKX A;  4NS5 A;  1M1K R;  5DY9 A;  2VUB A;  2QQS A;  2L3P A;  2QAS A;  3EGD B;  2DL8 A;  3VS1 A;  1X27 A;  2DL7 A;  5A0G A;  4A4E A;  3CXC A;  4C5I A;  1WHH A;  1D1B A;  1U1S A;  1ZHI A;  2L3S A;  1VQ8 Q;  1RAH B;  1U8R A;  1K8A U;  4BI4 A;  2J7I A;  2NWM A;  1NG2 A;  4XU0 A;  1RAA B;  5KYW B;  4Y91 A;  5GMK m;  5GAO r;  4ZNX A;  3JCM c;  1VQ5 T;  3RDV A;  2QGG A;  1X01 A;  2ZPI B;  1QWE A;  1S72 Q;  3CCE T;  2O4X A;  2KDS A;  4M78 G;  3PVQ A;  4XK8 E;  2KY9 A;  4OB0 B;  2OTL T;  5LJ3 f;  1M90 R;  2RD1 A;  1YBY A;  1WXU A;  1JXO A;  4QQ6 A;  3I55 Q;  4M77 F;  4PJL A;  3GOX A;  1UGP B;  3CCJ A;  4M7D F;  4BY6 B;  2QQA A;  3THK A;  2GNC A;  2RHI A;  2YDL A;  1KIK A;  1RI0 A;  3F70 A;  1Z9Q A;  2OX7 A;  1GCP A;  3OSV A;  4F16 A;  4BDZ A;  1EX4 A;  3S6W A;  5GAN h;  2DAQ A;  1VQK Q;  5LJ5 h;  3SHW A;  1AHJ B;  2PVO B;  4PJM A;  2L5Q A;  4R0K A;  5M9O A;  1Q81 R;  4QT7 A;  3TSW A;  3G6E A;  4V2S A;  1IGQ A;  1K76 A;  1N6A A;  3QWX X;  4OMP A;  2M51 A;  3VUB A;  2DTO A;  2K5I A;  5CR2 A;  2LZ6 B;  2RK2 A;  3CCJ T;  3D7S B;  3EHQ A;  3EFO A;  4E7S A;  4K11 A;  1UJY A;  2RHZ A;  2DO3 A;  4OB3 B;  2VWF A;  4BY6 C;  3J80 E;  4OMM A;  1G3W A;  2H3E B;  1OPL A;  1K73 U;  2QQR A;  1Q7Y C;  3X24 B;  3MEV A;  4X9C A;  3G6E T;  2IVW A;  1LJO A;  2AZS A;  1KQS S;  1PM3 A;  4J6W A;  2VVK A;  5CIU A;  4BUG A;  4CC4 B;  1PHT A;  2RI3 A;  3IQL A;  1OPK A;  4TVR A;  3UT1 A;  2PVD B;  4HKE A;  1QLY A;  4J9E A;  1HJD A;  1QCO A;  1IRX A;  4KUI A;  4EIK A;  2JNG A;  2QA4 A;  1Y7X A;  5GAN 7;  3NPF A;  1B7T A;  3P8B B;  4LDW A;  1FMW A;  1ZUK A;  3C12 A;  2RHX A;  3HHT B;  3VS0 A;  2VB6 A;  2F2V A;  4M78 B;  1JJ2 A;  4O5V A;  5GAM f;  3JB9 D;  1T0J A;  5FU7 B;  2BZY A;  2NUT A;  2AKL A;  1GFD A;  2VGN A;  3V8K A;  4Z88 A;  2XIC A;  2EYX A;  2KYB A;  3VJP A;  1G5V A;  3A8H B;  4C0G A;  4D6W A;  3HFN A;  2QA4 T;  2J6O A;  3WVE B;  3ME9 A;  1NLP C;  1OZ2 A;  2LNV A;  4PL6 A;  3H8Z A;  1K9M C;  3M57 A;  4XTZ A;  1BK2 A;  2OAU A;  4QQG A;  5LL6 S;  5KYN A;  1PD1 A;  1YP5 A;  3ZEH A;  3WXM B;  2LJ3 A;  3JCM P;  2EAY A;  2B86 A;  2M9U A;  3EGX B;  1SSH A;  2WSC E;  4KT0 E;  2J06 A;  2O88 A;  4M78 C;  1SKU B;  2KRS A;  1NYG A;  1KC8 U;  1P92 A;  2PZ1 A;  1UG1 A;  1I0C A;  1M3A A;  1NM7 A;  3NGP A;  5KCH A;  2E12 A;  3ZL7 C;  5FU7 C;  5DLQ E;  5GMK h;  1ZLM A;  1A0N B;  2DL4 A;  1Q82 U;  4FW2 A;  2RJE A;  3QO3 A;  4C92 A;  4Z02 A;  3RKY A;  1MNE A;  3JSC A;  4J5Y A;  3JB9 H;  2CGH A;  2CP0 A;  1RAE B;  1VQ4 Q;  4F17 A;  3VU3 C;  4JPB W;  4JJN K;  2SEM A;  1ZA1 B;  2KYM A;  1ZUU A;  4QKU A;  3TQ7 P;  3JCM g;  4C8Q G;  1WZO A;  4M7A G;  1NEG A;  3M55 A;  5HK0 A;  3M4Y A;  1ABO A;  1VOM A;  1WX6 A;  2LJ0 A;  2J6K A;  1X2Q A;  2LQK A;  1KG1 A;  3LW5 E;  1TUD A;  1FYN A;  1WXT A;  2RA2 A;  1S72 A;  4PFO A;  3JCM e;  1QVP A;  4J9D A;  2C0I A;  1LVK A;  3CXC P;  1H3Z A;  1RAC B;  1TOV A;  2X4J A;  2X4X A;  1VQL Q;  3LLR A;  1KD1 R;  3A8M B;  4HCK A;  3I55 A;  3DLM A;  1QW1 A;  3A8L B;  2CZ6 B;  1RAI B;  2XDB A;  4KH0 B;  1AVZ C;  2DTH A;  2HBP A;  3FDR A;  2K3B A;  1CKA A;  4HXJ A;  3KXT A;  1M1K U;  2ZGW A;  5LJ3 h;  4RTY A;  5CKE A;  1FXX A;  1VQ7 Q;  1ABQ A;  3C95 A;  4LDX A;  1VQK A;  4JLI A;  2K3X A;  2JMC A;  4B6M A;  2HZY A;  1S72 T;  2R57 A;  1N8R R;  3MEU A;  3CCV A;  1I4K 1;  2EYY A;  2YXY A;  3J81 E;  1Y96 B;  2E64 A;  3I55 T;  1NJI R;  1M30 A;  1CKB A;  4M78 F;  2E41 A;  2KT1 A;  4IUU A;  5ECA A;  2V8K A;  3VYH B;  3E9F A;  4QVZ A;  1M90 U;  1QVF A;  2QGF B;  2KBT A;  1M1F A;  5C0M A;  3MKD A;  4ZTF A;  3CCL Q;  1VQ6 Q;  4M75 A;  1YWO A;  1VYU A;  4FYV B;  3KBG A;  1M27 C;  1WHM A;  2OTJ Q;  1VQK T;  1PG5 B;  2Y90 A;  1X6B A;  2EJ9 A;  2RJD A;  4PLI A;  3RER A;  2LCS A;  4F7U G;  5FW9 A;  3JCM d;  3CCV T;  4PJO G;  5J39 A;  4RKU E;  4KGZ B;  2COY A;  4BDY A;  4M4Z A;  2DXT A;  1FMV A;  1TS9 A;  3VS6 A;  3SB2 A;  4E7I A;  1SF9 A;  1Q81 U;  2DYB A;  2OI3 A;  2EPD A;  1V29 B;  2LRQ A;  2COZ A;  3FEO A;  3OYM A;  4ZN3 A;  2KK4 A;  4J7I A;  5IT9 E;  1N9S A; 
#chains in the Genus database with same CATH homology
 4PKC C;  2GQV A;  5GAO p;  3GF5 A;  2O01 E;  3OYB A;  4BI3 A;  4L6V 5;  4EMK A;  5CO7 A;  2XDD A;  2ZCF B;  2QI2 A;  3CMA T;  2AHJ B;  2FL7 A;  3UDC A;  1G3Y A;  4JS4 A;  2ZPE B;  1YJN A;  4OGE A;  3RMQ A;  3LGF A;  3OYN A;  1MHN A;  4E47 A;  2E70 A;  5D6X A;  1YIJ T;  4C92 C;  2HNI A;  4VUB A;  2ZPB B;  1TH7 A;  4BAC A;  1G3T A;  2Y4X A;  1XQH A;  5LJ3 j;  4J8O A;  5LJ5 g;  2DZC A;  4C5G A;  2E10 A;  3SWN A;  3NTK A;  4JRQ A;  3O8V A;  3R6O A;  1UB4 A;  4IUT A;  4KUL A;  4QVD A;  3CME A;  1VQ5 A;  3HRT A;  3QJ6 A;  4FL6 A;  4M78 D;  4N4I A;  1WQW A;  5FRN A;  2P0Q A;  3LH0 A;  3OS5 A;  3V7S A;  3FC3 A;  1LNX A;  3L42 A;  3CCE A;  2EQU A;  1Q7Y U;  1N27 A;  4KBM B;  3PIP A;  3OYK A;  1Q86 U;  1UEB A;  4O6J A;  1UGR B;  2MMP A;  3OW2 A;  1NPR A;  4RG8 A;  2EQK A;  2X35 A;  1N9R A;  4ELZ C;  2MI6 A;  2OTL A;  2DK3 A;  5KE3 A;  2I2L A;  4RG2 A;  5GAM h;  2B8A A;  5LJ5 e;  1QVF S;  4NS5 A;  3Q1J A;  3TRE A;  5DY9 A;  2VUB A;  2GFU A;  2QQS A;  3G7Z A;  1YHQ A;  4IKF A;  2VC8 A;  4C8Q E;  4M7A E;  3OYE A;  3OYI A;  2RJF A;  5A0G A;  3FJP A;  2HQE A;  3OS2 A;  2JUF A;  5FU6 B;  4A4E A;  4JRI A;  4C5I A;  4C5H A;  3I56 A;  3CXC A;  1YJN T;  1U1S A;  4C0F A;  1ZHI A;  2VXF A;  1DJ7 B;  1KHI A;  5D6Y A;  3OMG A;  2P4T A;  1U8R A;  4UC4 A;  4BI4 A;  4OGC A;  5CKB A;  1K8A U;  2VGM A;  5GAM d;  3LGL A;  3JB9 I;  4XU0 A;  1IZ6 A;  4PNO A;  2GCX A;  4Y91 A;  2Y4Y A;  3M58 A;  3UWN A;  3V7C A;  5GMK m;  5GAO r;  3QYG B;  1VQN A;  2LQ8 A;  3QYH B;  3JCM c;  2HAX A;  4FT2 A;  1VQ5 T;  2JN0 A;  1X01 A;  2CS7 A;  2ZPI B;  4M75 B;  3E1S A;  4RCC A;  1W2B A;  2XKO C;  3M59 A;  3EFR A;  3CCE T;  2O4X A;  4C5E A;  1NJI C;  2XD0 A;  5FLX E;  2KDS A;  3NTI A;  4M78 G;  1QP3 A;  1KQS A;  3A8O B;  3SD4 A;  3OYA A;  1JRI A;  3HRS A;  2EQJ A;  4XK8 E;  1M5Q 1;  3DB3 A;  2KY9 A;  4OB0 B;  4ZGE B;  3L2R A;  2OTL T;  5LJ3 f;  1M90 C;  2RD1 A;  1YBY A;  2PQW A;  3QZ5 B;  1MGQ A;  2HQX A;  4FIB A;  3OYJ A;  3QKJ A;  4QQ6 A;  2DXB A;  4M77 F;  1YHQ T;  1JBM A;  3GOX A;  4ME7 A;  3OYY A;  1I81 A;  4M78 A;  3V7R A;  4IUQ A;  3L2V A;  1VQ4 A;  3HSB A;  1UGP B;  2WSE E;  3CCJ A;  4M7D F;  4BY6 B;  2EJF A;  3L2W A;  3MP1 A;  1VQP A;  5CCA A;  3JCM X;  2QQA A;  2MAM A;  4F7U B;  2CZ0 B;  2RHI A;  3I56 T;  2RH2 A;  1RI0 A;  2FYK A;  3F70 A;  4PJO B;  1KC8 C;  1UGS B;  3OSV A;  3JB9 J;  4BDZ A;  3L1A A;  1NZ9 A;  2DIQ A;  5J3B A;  3S6W A;  4OB2 B;  1YI2 A;  1WJS A;  5GAN h;  5GAN 4;  2DAQ A;  5FU6 C;  3X26 B;  3AHU A;  1B34 B;  2R58 A;  1Q82 C;  1VQN T;  1K73 C;  4IUR A;  5LJ5 h;  4MZM A;  2RK1 A;  3CBP A;  1AHJ B;  2KQW A;  2F5K A;  2PVO B;  4MZP A;  4M77 E;  4EMK B;  2FHD A;  4IUV A;  3L2U A;  3RKX A;  2L5Q A;  4LD6 A;  1QVG A;  5CQX A;  4XQ3 A;  4EMH A;  1Q81 C;  5M9O A;  3QJY A;  4XTW A;  5HY6 A;  3G6E A;  3JCM f;  4ZGD B;  4V2S A;  4C92 F;  1PSF A;  2E65 A;  3OY9 A;  3OW2 S;  5HK3 A;  3JB9 F;  4M75 C;  1VQM T;  2XU8 A;  1N6A A;  3LWI A;  3TU4 K;  5LJ5 d;  3FLG A;  3CCQ A;  4XU3 A;  3VUB A;  1VQL A;  2DTO A;  2K5I A;  3SWN B;  5CR2 A;  2DJZ A;  3C4S A;  3M54 A;  4NL2 A;  5KH6 A;  2RK2 A;  4M75 E;  4P5N A;  3CCJ T;  1VQ4 T;  1VQP T;  3T9N A;  2XG8 D;  2KSS A;  4BE0 A;  3OYH A;  3DLL A;  3CC7 T;  2LCL A;  4XTU A;  4QW2 A;  3VUZ A;  4EMG A;  1M8V A;  3QG1 A;  4DOV A;  4LDU A;  4HA8 A;  5FRO A;  3CXC S;  1G3S A;  3HP9 A;  1M1G A;  2DO3 A;  2RHZ A;  4OB3 B;  5GAM j;  4ZTJ A;  2KVQ G;  2LVM A;  5CKD A;  2RO0 A;  5GAN g;  4BY6 C;  5A0D A;  1YI2 T;  3J80 E;  4JUV A;  2E5Q A;  1I5L A;  4LD9 K;  4N0A C;  2K5L A;  3NTH A;  4B9W A;  5EG2 A;  4X9D A;  1G3W A;  1VQ9 A;  4C8Q F;  4M7A F;  3URG A;  4C92 E;  1VQ7 A;  4PJO C;  1BI1 A;  2G3R A;  3MHX A;  2F5T X;  2L3R A;  1K73 U;  2MF2 A;  3CBM A;  1VQ8 A;  2QQR A;  2K3Y A;  1Q86 C;  2EYQ A;  1W2B S;  2MWO A;  2RHY A;  3X24 B;  1Q7Y C;  2CYZ B;  3MEV A;  4X9C A;  4C8Q A;  3G6E T;  2QQB A;  2IVW A;  3GNG A;  2EFI A;  4HCB A;  3VKI A;  1LJO A;  1KQS S;  4J6W A;  5CIU A;  4BUG A;  4WF2 A;  4M77 D;  2RI3 A;  4DA4 A;  4MDX A;  4EMK C;  3CCQ T;  3X25 B;  5GAN e;  4ZGJ B;  4RMO A;  1VQL T;  2JTM A;  1KQ2 A;  1H64 1;  4M7D D;  3INZ A;  4A4K A;  4TVR A;  3UT1 A;  1M1K C;  2PVD B;  4HKE A;  5CKF A;  5I2M A;  3JCM Q;  5GAO l;  3E9G A;  5GMK l;  3CCR A;  3QUI A;  3S3N A;  1EIF A;  2A3L A;  3FRN A;  3X20 B;  4CRI A;  3OBW A;  4KUI A;  3RES A;  1Y07 A;  3ZFJ A;  3OYC A;  2YHT A;  2ZZD A;  3A8G B;  3M9Q A;  2FB7 A;  4MMK A;  4EPC A;  3JCM b;  2JNG A;  2QA4 A;  1Y7X A;  5GAN 7;  2O4X B;  3SWN C;  3RMS A;  2DXC A;  1KD1 U;  2L8D A;  3P8B B;  4LDW A;  4IUP A;  3PTA A;  4JS5 A;  1LOJ A;  3S3O A;  4FM4 B;  2F69 A;  5FRM A;  3C12 A;  2MWP A;  4FT4 A;  1KHC A;  2XK0 A;  1VIE A;  2RHX A;  1VQ9 T;  4LDY A;  1YIT A;  1VQ6 A;  3QII A;  2YLC A;  5DM7 R;  5GAO q;  3G4S A;  4OP0 A;  1VQ7 T;  3HHT B;  5GAO m;  2A7Y A;  2GF7 A;  3CCM A;  2OTJ A;  4E7H A;  1VQ8 T;  1ZQ1 A;  4M78 B;  2HD0 A;  1JJ2 A;  3BDU A;  2RJC A;  1IRE B;  2R5M A;  3HRU A;  2XI9 A;  3MO8 A;  3OQ5 A;  4GY5 A;  5KCO A;  4C92 D;  3GPL A;  2JVV A;  4O5V A;  3RUX A;  5GAM f;  3JB9 D;  5GAN j;  3NFC A;  5FU7 B;  3WVD B;  2ZPF B;  5LJ5 j;  4OMF B;  1PSE A;  2VGN A;  4DOW A;  2PUK B;  3V8K A;  3OB9 A;  1X6O A;  2E1H A;  4R56 A;  1VQM A;  4L5G A;  2XIC A;  4M77 G;  3CCR T;  2X4Y A;  3GNF B;  3PIO A;  2VYT A;  3VJP A;  1I8F A;  1BI0 A;  2K57 A;  4QVC A;  3A8H B;  3LX7 A;  1N8R U;  4M7D G;  3SDZ A;  4C0G A;  1G5V A;  4D6W A;  4XU1 A;  1VQO A;  3HFN A;  2QA4 T;  2V8I A;  3WVE B;  2H3J A;  3ME9 A;  1HXD A;  1OZ2 A;  3H6Z A;  3CC7 A;  2LNV A;  1BI2 A;  3DKM A;  4PL6 A;  3OYL A;  4M77 A;  3H8Z A;  5CVI A;  1VIF A;  2DD4 A;  1KQ1 A;  3LYI A;  4OF1 A;  5IN1 A;  1NJI U;  3JAM E;  1K9M C;  1BIA A;  4C8Q D;  3CCL T;  3CCU A;  3M57 A;  4XTZ A;  1YIT T;  1VQ6 T;  3GP8 A;  4M7D A;  3CPF A;  2M0O A;  4M75 F;  4A4G A;  3G4S T;  1OZ3 A;  2OAU A;  4QQG A;  5DLO A;  5LL6 S;  3CCM T;  2OTJ T;  3JCM V;  5LJ3 g;  5GAN 2;  3ZEH A;  4M7A D;  2D6F A;  3WXM B;  1Y71 A;  2LX9 A;  3M56 A;  3SFM A;  4N4H A;  4KUD K;  3JCM P;  2EAY A;  5GAN 6;  3M53 A;  2M9U A;  4MML A;  2WSC E;  3GLX A;  1Y96 A;  2DZ9 A;  4KT0 E;  2QXF A;  2LCC A;  5CAI A;  1O9S A;  4M78 C;  4XTV A;  4C92 G;  4Q5W A;  2EKO A;  2CKK A;  2JZ2 A;  2PUO B;  3HPW A;  5I2S A;  5GAN d;  3JB9 G;  1KC8 U;  1P92 A;  2QTX A;  1SSF A;  4F7U F;  2V8J A;  2CZ1 B;  5A0L A;  1GXI E;  1WQ7 A;  2IG0 A;  2YRV A;  1M9S A;  3CC2 A;  5KCH A;  2E12 A;  2NLU A;  3OSS C;  3ASK A;  4PJO F;  1D3B A;  5FU7 C;  1FX7 A;  2EQM A;  4J7F A;  2DTI A;  5DLQ E;  5GMK h;  3MP8 A;  3MP6 A;  1Q82 U;  5LJ3 e;  2LC4 A;  2E6Z A;  2RJE A;  3QO3 A;  5D6W A;  4C92 A;  1VQO T;  4Z02 A;  3RIR A;  3RKY A;  3CEY A;  4X34 A;  1M4Z A;  3JSC A;  3PT9 A;  4J5Y A;  3JB9 H;  3OYD A;  2CGH A;  5GAN f;  4RCB A;  2D0Q B;  3CBO A;  4M7A B;  4C8Q B;  3OYG A;  1BI3 A;  2ZPH B;  4L59 A;  5LJ5 f;  3CCU T;  3BFM A;  3VU3 C;  4JJN K;  1FWZ A;  3G71 A;  3QPH A;  2QQ9 A;  2RB6 A;  3JCM g;  4C8Q G;  4M7A G;  3MEW A;  3P8D A;  5J26 A;  3V8J A;  1XOV A;  1NE8 A;  2D9T A;  3OYF A;  2WAC A;  3VV0 A;  3CD6 A;  3M55 A;  4F7U E;  5HK0 A;  3A5Z B;  3M4Y A;  1XNI A;  5IAY A;  3OA6 A;  5A2Q E;  1JJ2 S;  1BYM A;  1YJW A;  5I21 A;  2XID A;  4J83 A;  4HT8 A;  3OS0 A;  4PJO E;  1WGS A;  2LT4 A;  2JTF A;  2X4W A;  2K5F A;  4B9X A;  4M7A A;  2LQK A;  1KG1 A;  4A4F A;  2JOY A;  3LW5 E;  2QDY B;  2K2V A;  4R55 A;  3DB4 A;  2EIF A;  4JLG A;  3OS1 A;  2RA2 A;  5C6S A;  3CC2 T;  3LWH A;  3J7A F;  1QP2 A;  3P8H A;  1JB0 E;  4OVA A;  1S72 A;  2DVE A;  5CK9 A;  4XTX A;  1QVP A;  4GLK A;  3JCM e;  3X28 B;  3L2Q A;  4E7K A;  2P0K A;  1O75 A;  3L2Z A;  3JRZ A;  5CQY A;  2XDP A;  3N5B B;  1H3Z A;  3HFO A;  4MDW A;  3CPW A;  4ELY C;  2X4J A;  2X4X A;  4XU2 A;  4YTL A;  3BY7 A;  3LLR A;  1KD1 C;  3A8M B;  2M1H A;  4M75 D;  3I55 A;  1K8A C;  3DLM A;  4A53 A;  2FVU A;  1XTD A;  1QW1 A;  2ZPG B;  2WSF E;  4PLL A;  3G71 T;  3A8L B;  2CZ6 B;  4MZT A;  2BUD A;  2KAF A;  3QXE B;  4HT9 A;  4ZN1 A;  4CI0 C;  2XDB A;  2EWN A;  4C0D B;  2DTH A;  4C8Q C;  4M7A C;  2HBP A;  3FDR A;  3MCA B;  5GMK e;  3CD6 T;  3CCS A;  5AYF A;  4BE1 A;  4A4H A;  5CKH A;  3KXT A;  1M1K U;  4J6Y A;  1BKB A;  1YJW T;  2ZGW A;  5LJ3 h;  4FU6 A;  1NPP A;  2E6N A;  3FIF A;  5CKE A;  3BW1 A;  1FXX A;  3VYG A;  3S3M A;  3C95 A;  1QVG S;  4LDX A;  4M77 B;  3EAE A;  1VQK A;  4JLI A;  3M4G A;  4BD3 A;  2K3X A;  3CC4 A;  3PMT A;  4ATO A;  1W4S A;  1WPY A;  3OBY A;  4M7D B;  3ER0 A;  4PJO D;  1S72 T;  2DIG A;  2QEX A;  4E7L A;  2VV5 A;  5HKC A;  2R57 A;  4E7J A;  1N8R C;  4HCC A;  3MEU A;  3CCV A;  1I4K 1;  5LJ3 d;  3CME T;  3JCM W;  1OYX A;  2DPP B;  2R5A A;  4HCZ A;  4EDU A;  3HKS A;  2PVG B;  1HK9 A;  1YJ9 A;  3J81 E;  3C94 A;  1Y96 B;  2E64 A;  4XAX B;  5KE2 A;  3I55 T;  4BE2 A;  2YLB A;  2XHC A;  2DKG A;  1WJQ A;  2PU9 B;  4OB1 B;  4M78 F;  3QSU A;  2E41 A;  2DXU A;  3PGG A;  3PMI A;  4IUU A;  4XTY A;  2P0P A;  2V8K A;  4M75 G;  3VYH B;  3E19 A;  4II1 A;  5GMK j;  5GAM g;  2C06 A;  3E9F A;  4QVZ A;  3M5A A;  1ZBX A;  1M90 U;  1QVF A;  3JCM J;  2L89 A;  3QZ9 B;  3CCS T;  1D3B B;  1M1F A;  1YCY A;  3JCM h;  4FSX A;  4NOY A;  5C0M A;  3FB9 A;  4C92 B;  4ZTF A;  3PFS A;  5GMK i;  1X75 C;  1OI1 A;  4M75 A;  4C0Z A;  3UPU A;  3KBG A;  4C0D C;  2RM4 A;  1BIB A;  3CMA A;  4BI8 B;  1VQK T;  2VXE A;  4JRK A;  3CCL A;  3QBY A;  4NL3 A;  3CC4 T;  1VUB A;  3MEA A;  2M16 A;  2KMT A;  4BB7 A;  2Y90 A;  2EJ9 A;  2LDM A;  2RJD A;  4PLI A;  3RER A;  4F7U G;  5GAO n;  2QEX T;  1WNL A;  1YIJ A;  1K9M U;  5L8R E;  4J6X A;  2CZ7 B;  5GAM e;  4M78 E;  3JCM d;  3CCV T;  2LTO A;  4PJO G;  3OMC A;  4M77 C;  3GIB A;  3TEE A;  5J39 A;  1RL2 A;  4RKU E;  3EFS A;  4BDY A;  2DD5 A;  4JDS A;  3HL8 A;  3PNW C;  4M7D C;  2DEQ A;  1YJ9 T;  2DXT A;  4N0A A;  4N4G A;  1WJR A;  4QQD A;  4F7U A;  3BDL A;  5GAN 3;  5GAN 5;  3CPW S;  3SB2 A;  2BKD N;  3MET A;  3QHS A;  4DQ2 A;  4E7I A;  4M7D E;  3ZBD A;  4PJO A;  1UGQ B;  3V8L A;  1Q81 U;  2LT1 A;  5GAN 8;  1R8O B;  2RI5 A;  2K4Y A;  2RI2 A;  3TCJ A;  3KUF A;  4Y28 E;  1V29 B;  4LDV A;  2LRQ A;  3RKW A;  4JRP A;  3FEO A;  3OYM A;  4ZN3 A;  2BIV A;  2RHU A;  1B34 A;  2KK4 A;  2GFA A;  4J7I A;  5IT9 E;  4A54 A;  1U1T A;  1N9S A;  2EJG A;  3QDR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...