5GAOp

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
76
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSAKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 76
sequence length 83
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaop00
1HXDA 3V7RA 3JCMc 4M7DE 4EMGA 5LJ3h 4M77C 4C92E 1N9RA 2E10A 1WPYA 3BDUA 1JBMA 4M77F 4C8QC 4M77A 4M77B 2E41A 2DKGA 2YHTA 4A53A 3V8KA 2E1HA 4M78G 1KQ1A 3V8LA 4C8QA 1M5Q1 2FYKA 5GAMf 3JB9I 4J6YA 4A54A 1M8VA 1HK9A 4XU2A 3JCMf 1KQ2A 4JLIA 4M7DG 4WF2A 5GAMh 2E65A 5GMKj 2JN0A 4XTZA 2DTIA 4N0AC 4C92G 5GAN7 2QTXA 3FJPA 4M77E 3SB2A 4RCBA 3JCMb 4M77D 4HT8A 3SWNC 4J6XA 4M75C 1LOJA 2Y90A 1WQ7A 4N0AA 3RIRA 4C8QE 4XTWA 5GMKe 2DZCA 5GAOn 3SWNB 4M75F 3SWNA 4EMKC 5LJ3g 5LJ3e 4M75B 4M75A 4XU0A 3JCMX 4HA8A 5LJ5f 1X01A 4JRKA 4NL2A 5DY9A 4EMKB 4EMKA 5GAN2 2E64A 3FIFA 5LJ5h 3M4GA 2EJFA 3HFNA 5GANf 5GAMj 1Y96B 4M77G 1WQWA 3V7CA 4MMLA 2RM4A 5GANh 4NL3A 4C8QG 4MMKA 4M7AF 2RB6A 5GAMd 4M75E 4M7AB 5GAN5 3JB9F 2FB7A 4M75D 3JCMd 5GAMg 2DVEA 5GMKi 4PJOC 2DXUA 5I21A 5GAN3 3FB9A 4PJOF 3JCMh 4PJOB 4PJOA 3RKWA 1WNLA 2CGHA 3L1AA 3QUIA 3L2ZA 5LJ5j 3JCMV 5GMKl 5GAOp 2YLBA 4M7AD 3JCMJ 4M75G 5GAOr 3JB9J 3JB9D 5LJ5d 5GANj 1I4K1 2EAYA 2ZGWA 3HFOA 5LJ5g 1N9SA 1BIBA 3GIBA 4HT9A 4PJOE 5GAN4 2DTHA 1B34B 1B34A 4J6WA 5GANd 4PJOD 4M78F 3RUXA 5GANg 1Y96A 4M78B 3JCMW 4M7AC 4F7UF 3INZA 5GAN8 4XTVA 2DEQA 4F7UB 4F7UA 4C92C 3RERA 3RKYA 1U1TA 4XTUA 1U1SA 3BFMA 2RD1A 3JB9G 3EFRA 4M7AA 4XU1A 4C92F 4QVDA 4X9DA 4C92B 3QHSA 5GAMe 3V7SA 3JCMg 1YCYA 3JCMe 3JB9H 4XQ3A 4PJOG 5GAOl 3QSUA 4J5YA 2YLCA 2VXFA 4M78D 5LJ3f 2VXEA 5GMKm 3BW1A 3RESA 4F7UE 2HNIA 2K57A 5CAIA 1D3BB 1D3BA 2DZ9A 4M7AE 3VU3C 4M7DD 3QO3A 4X9CA 4XU3A 1I8FA 1I5LA 4C92D 4EMHA 3EFSA 4QVCA 1LJOA 4NOYA 3RKXA 5LJ5e 4M78C 4Y91A 3AHUA 4XTYA 3HSBA 4C8QF 3JCMQ 4JRIA 5GAOq 2DXTA 4C8QB 1LNXA 4RCCA 1JRIA 2DJZA 3PGGA 4M78A 2VC8A 4OP0A 5GANe 4F7UG 4M7DC 1MGQA 5GAN6 4M7DF 4JUVA 4M7AG 4M7DA 4M7DB 2DTOA 2EJ9A 2I2LA 3V8JA 2EJGA 3JCMP 5LJ3j 5GAOm 4C92A 1TH7A 2RA2A 4DQ2A 1I81A 1BIAA 5LJ3d 4M78E 1H641 3BY7A 4PNOA 4C8QD 4XTXA 4V2SA 2EWNA 5GMKh
chains in the Genus database with same CATH superfamily
4RTVA 2EIFA 1VQNA 1NPPA 4C92E 4AT1B 1S1NA 1YCSB 1JBMA 1PRLC 3VS4A 1KC8C 3E9GA 1ZSZB 4F14A 1YWPA 1RLQC 2HZYA 3I56A 4E2FB 3M0RA 2GQVA 2K5FA 4C92G 3SB2A 1YITT 3CBPA 5M9OA 3LWIA 4AFSC 2DO3A 1Y0MA 1EFNA 3LW5E 1UFFA 4JS5A 1O75A 4DBHA 2E64A 3DKMA 2RJEA 3QWYA 4KGVB 2EJFA 1OPKA 3LX7A 4M75E 3SDZA 3A8MB 1NYGA 2NYSA 5GAMg 2EQUA 4CC7A 1LVKA 2KR3A 1BB9A 2QI2A 5HY6A 1WJSA 3RBBB 3QUIA 3SHWA 3CC2A 4L5GA 2IG0A 2RJCA 2YWWA 4M75G 2DD5A 2ROLA 2LX7A 2DTHA 4PJOD 1S72Q 1Q7YC 2KXCA 3FC3A 2ZZDA 4XTVA 3BFMA 2J6FA 3EFRA 4J7FA 2GTOA 2DL4A 3G4SQ 5KYUB 3LLRA 1VQKQ 3TVTA 3MP8A 4M7AE 5I2MA 5A0GA 2CH4W 3X20B 3QO3A 2M16A 4F16A 2F5KA 3MEUA 4ELZC 2FPEA 5IH2A 5I11A 3VS1A 4M7AG 1RAHB 5CKEA 1KD1R 3PFSA 3M59A 4C92A 3H8ZA 4C0FA 4PNOA 1P92A 4XTXA 2PUKB 2RHIA 1X75C 1ZQ1A 1FMWA 1YHQQ 1W1FA 2KRSA 4QKUA 3CMAT 2GFUA 2QDLA 1YIJA 1WLPB 2XMFA 2RQTA 1N27A 3A8HB 1G3YA 3CC4A 5DM7R 4ANJA 2A37A 1GCQC 4JRPA 3JCMf 2RK2A 2JS0A 1RADB 2QQAA 4N0AC 3I55T 2QTXA 3SWNC 3EG2A 1JU5C 1IB8A 1LOJA 3L42A 4M75F 4E7LA 4M75A 4HA8A 1SPKA 5CR2A 1OOTA 2V8JA 1VIEA 1NBEB 1VQ8A 2RHYA 2CP0A 3OYCA 2DNUA 1YJWA 2OJ2A 3ER0A 1Q82U 1G3WA 1OEBA 3JCMh 4RTXA 4AG1C 1MUZA 1M1FA 4PFPA 1MV3A 4RTWA 2DERA 3I9QA 4OMLA 1JJ2A 4Z88A 1V29B 3GIBA 2XDBA 4E7JA 1M90R 3CCQT 1UHCA 2O01E 4C5EA 4F7UB 3RERA 1EIFA 1M30A 4C0DB 4M7AA 1SG5A 3V7SA 1JB0E 4CC4B 3VUBA 2YLCA 3I5SA 2CZ7B 2EYQA 3BW1A 1WX6A 1MMNA 3M0SA 4C92D 2CSQA 2D9TA 2XICA 1VOMA 1M1KR 1T3LA 2GBQA 3QZ5B 1CKAA 3MP1A 2ZPBB 3RMQA 5GAOq 4GBQA 2DJZA 1MGQA 1RAIB 2CP3A 3CCMA 1E6GA 1XTDA 2VB6A 2HCKA 1GCPA 2J6KA 3G6EA 3CC7Q 5LJ3d 2QQRA 3BY7A 4DBRA 2BZ8A 1TXQA 4A4KA 1U3OA 1WHJA 2YUNA 4BI8B 1TS9A 2YHTA 2DD4A 2LMJA 3GLXA 1M5Q1 4FU6A 2X4XA 2ZPEB 1VQ4A 3O8VA 3MP6A 4OMPA 4M77E 2MPXC 2O88A 2KBTA 2CP5A 4IUPA 3QYHB 2ED1A 2YUPA 5L23A 1YN8A 1NEGA 2A36A 3BDLA 2BUDA 3CXCA 1R8OB 4M77G 1QVGA 5AYFA 5GANh 3ZFJA 5GAMd 1ZSZA 2FB7A 5KYXB 1M27C 3OYMA 4LD9K 2W10A 2A28A 3FB9A 1HD3A 2X4JA 4IUUA 2ED0A 1W6XA 1PD0A 1BK2A 4M7AD 1EZZB 3LWHA 4D8KA 1LPLA 4AFZC 1B34B 1VYVA 1VIFA 4K11A 4DBFA 5KYYA 1VQLQ 3OMGA 4FT4A 4BDZA 3NHNA 3CPWS 2K3XA 4OB2B 1IZ6A 4CC3A 1VUBA 3JCMg 2M1HA 2LTOA 3TSZA 3REAB 2LJ0A 3JB9H 5L8RE 3S3MA 3M4YA 1FX7A 2PTKA 1K1ZA 2RI2A 5CQYA 1BYMA 1M1GA 5FROA 2YXYA 2JTEA 2KEAA 1LJOA 4DA4A 3CPWP 2CT4A 1ZSGA 2BKDN 3X25B 1UHFA 1QMCA 1AWXA 3CCVA 5LL6S 2DL8A 3JCMc 4FM4B 1O9SA 1OV3A 4LE9A 2RH2A 2MWOA 3BDUA 4M77F 5CVIA 4M77A 3OYHA 2E70A 2K2MA 2AIRB 3JB9I 2Y4XA 5IHIA 4XAXB 5GJWB 3CD6T 4HVWA 3DLLA 4OB1B 3CCLT 3TQ7P 1QCOA 1UGSB 2JNGA 1VQNT 2DLPA 3HRTA 2LRQA 2CREA 1OYXA 3CCSQ 1WQ7A 2DZCA 2VV5A 2EVRA 2KK4A 2E4HA 1H3ZA 5LJ5h 2V26A 2K4YA 3I56T 2YUOA 4JS4A 1RI0A 1AT1B 4J9CA 2RMOA 4OMQA 4BY6B 5GAN3 4Z89A 2PNIA 1QCNA 2F5TX 3L2ZA 1JO8A 2OAUA 3Q1JA 3UF4A 5GAOp 1PRMC 3JB9J 1GRIA 3H6ZA 1WIEA 2RO0A 4II1A 2CDTA 2HBPA 5GANg 3M57A 4E7KA 4LXCA 3OS5A 3CC2T 4YTLA 2BZXA 3JCMe 5I2SA 4LDUA 1IREB 2WSEE 4J5YA 5LJ3f 4LDXA 3MEVA 4KGXB 4EMHA 3G71A 1VQPQ 2QG9B 3AHUA 1AWWA 1ZUKA 4C8QF 4CC2A 4M7DC 1VQMQ 1Q81U 2A3LA 1K9MU 2QQ9A 1IXDA 5IXFA 2B8AA 3QYGB 2LP5A 1U06A 1GBQA 4MZMA 2LNVA 3QKJA 2LZ6B 2P0PA 4B9XA 1KD1U 5LJ3h 3DB3A 1G8XA 3GBQA 4X34A 5KCHA 3UA6A 1VYUA 2MMPA 3OW2S 1NJIC 2H3JA 2YSQA 4C8QC 3EH2A 1TUDA 1BCMA 4BUGA 5GAMf 3QG1A 3WVEB 5A0LA 4MDXA 2H3EB 3M0TA 3OYKA 1X2KA 2NUPB 3CCUQ 5IHNA 2DA9A 2G3RA 3L2VA 1ABOA 4IKFA 4EDUA 3CCJA 1N8RC 4OMNA 1TWBA 3CCRQ 1YIJT 1YI2Q 1W2BS 3MEAA 4M75B 3CC4T 3O5ZA 2KT8A 3OW2P 2D8HA 1UUEA 3SEMA 1EX4A 1VQ5A 2MIOA 5HK0A 3URGA 1CSKA 1JXOA 3GPLA 1K73C 1Q7YR 2KROA 1FMKA 2A0FB 1MMDA 3TEEA 2ZPGB 1VQ8T 4JJDA 2KNBB 2DK3A 2ZGWA 5LJ5g 2R58A 1WA7A 3ZBDA 4LN2A 1YJWT 2LQKA 1V1CA 3RUXA 2LJ3A 3LH0A 1I5OB 1C0MA 2YUQA 2DYBA 1KK7A 3CMEQ 3QSUA 1ZA1B 2KYMA 4IURA 2K7AA 2QGFB 1YFNA 2E6NA 2KGTA 4XU3A 1I8FA 2WSFE 3OBYA 2QEXQ 5HKCA 2AT1B 2EQJA 4B9WA 3QJ6A 1XJWB 3EFOA 4PJLA 1H3HA 1RABB 2EKOA 2EJ9A 2COYA 2HSPA 5LJ3j 3JCMP 1F1BB 1Q95G 2EYXA 4D8DA 2WACA 4E7HA 4JZ3A 2K3YA 3ZEHA 2XKOC 3E9FA 2GF7A 1KQSA 2CZ0B 2KXDA 3CQTA 1KHCA 1MV0B 3OYNA 2QQBA 1YJ9Q 3CCMQ 1VYTA 1RAGB 3OS0A 2GTJA 2M0OA 3G6ET 2F1LA 1ZX6A 2DL5A 3FJPA 1BBZA 2K9GA 5FWCA 5KYNA 4N4IA 2FRWA 3CD6A 1QKWA 2RPNA 2RK1A 5LJ3g 3JCMX 1M3BA 1TU0B 2EPDA 1IO6A 2V1QA 2KYBA 4R0KA 5GAMj 2KRMA 1JQQA 5EC7A 4AG2C 1NYFA 2QASA 1VQ4T 1VQOA 2HDAA 4HCBA 3R6OA 2C06A 1X43A 2CS7A 4PJOC 2OTLA 3ASKA 4OF1A 2QAZA 4GLKA 4FW2A 4AMCA 1T3SA 1YITQ 2PUOB 2D6FA 1XNIA 5EG2A 4C0GA 2XG8D 1RAAB 2ZPHB 4JJNK 1ZUYA 2K5LA 4OMFB 4FSSA 1BIBA 2KSSA 2COWA 5GANd 1PM3A 2IPOB 3IQLA 5KYYB 2DEQA 1SHGA 2LNHB 4OGCA 4ZGEB 2RJDA 3QPHA 2PU9B 2O2OA 1PG5B 4O6JA 1QP2A 3HRSA 4X9CA 1JJ2S 2CP6A 3QBYA 1MHNA 5A2QE 2XU8A 1YWOA 4FIBA 3S6WA 4J9GA 1JRIA 1PCXA 5CKDA 5KCOA 1Y71A 1AWOA 1BU1A 4HCCA 1VQ7A 2K3BA 3M9QA 1D09B 5GAOm 3PVLA 4LDYA 1N8RU 1SEMA 4V2SA 4A4HA 3UDCA 1Q81R 2GQIA 3OYGA 3QXEB 1K9MR 1K76A 4M77B 1K8AU 3M53A 5IAYA 1ZLMA 5CQXA 2DVJA 2FEIA 2HQXA 2ROTA 2E65A 1GCQA 3NFCA 5GAN7 3CCVT 4RCBA 5CK9A 1H92A 2CZ6B 4N0AA 4L6V5 1KSWA 3M0QA 3SWNA 5LJ3e 3VS6A 4NL2A 2X3WD 5CCAA 1FYNA 1WI7A 5FW9A 4E7SA 3CMAQ 3H41A 3EGUA 3PNWC 4QQDA 3HKSA 5FRMA 3NTHA 2JVVA 4LUDA 1AZGB 3J7AF 2DXUA 3M54A 3GNGA 2NUPA 2X9HA 5A0DA 4TVRA 3I55Q 3X26B 2DX1A 1QVFA 3TSWA 5LJ5d 2E5KA 2HQEA 1UGPB 1M9SA 4Z02A 3CXCS 2FO0A 2MK5A 4M78F 1QVGS 2KI7A 1G5VA 1VQ9T 4C92C 1PKSA 1U1SA 2R57A 4QVDA 4PL6A 5GAMe 2H8HA 1KJWA 4XQ3A 1NZ9A 1B7TA 1K0SA 5FU6B 4WTOB 1VQ6A 1KHIA 1OPLA 4C5HA 5FRNA 1TUCA 1MMAA 2EYYA 4M78C 4XTYA 4JRIA 2JUFA 4C8QB 1LNXA 3OS2A 3CXCP 3CCQQ 2D1XA 1QVGP 3CCEA 2K79A 2RA2A 4DQ2A 1BIAA 3G71T 4AFQC 2RHZA 2RNAA 5C0MA 1BCOA 4VUBA 2RJFA 3ULRB 2CP2A 1N9RA 4BI4A 5ECAA 2OI3A 4JZ4A 1KC8U 2D8JA 1ACMB 4A54A 1KQ2A 1AWJA 2I0NA 3GP8A 5KE3A 1M2OA 2JS2A 2EYWA 2Y90A 1Y57A 5GAOn 4EMKC 5CKHA 2NLUA 2KMTA 4RG2A 2NUZA 5KYWB 1J3TA 1ABQA 5FU7C 2DPPB 5GANf 1Y96B 4M75D 3CCJT 1Z9QA 5I21A 4E7ZA 3LGFA 4DEYA 2FPDA 3ME9A 4C5IA 1YJNA 4ELYC 3GF5A 2P4RA 1ARKA 3WXMB 1AHJB 2HBWA 1KIKA 2EBPA 2LX9A 4XK8E 1Q7YU 1AOJA 2JTFA 1VQ5T 2XI9A 2EYZA 2DXCA 3META 2MWPA 5DLOA 3OB9A 4KT0E 2K6DA 4HCKA 5GAOl 3OA6A 1PKTA 3FJ5A 2AKKA 2HNIA 5CAIA 3HP9A 1OU9A 1AZEA 2VKNA 4FSXA 4BE0A 4HCZA 2AZVA 5D6XA 2F2XA 2RN8A 1YBYA 5KH6A 2GCXA 4AFUC 1UJYA 3WVDB 4BB7A 3EFOB 3L2WA 4JJBA 1W2BA 4J9FA 4ME7A 1HSQA 1TH7A 1NJIR 4J9EA 3A8OB 3VS2A 4FW1A 4ZNXA 5GMKh 1BI3A 1CKBA 1PNJA 4M7DE 1X27A 2LCSA 2P0KA 2FRYA 2HQHA 3MJXA 3VYHB 1WHHA 2FYKA 1S72A 1N8RR 3OYDA 4M7DG 2J05A 2DTIA 1FXXA 3I35A 2MYSA 4C8QE 3VYGA 1K8AR 1C1AA 3G4SA 2V8KA 4Q5WA 5LJ5f 4B6MA 5GAN2 4EIKA 1VQKA 2OTJT 1WQWA 1QWEA 1UECA 4MMLA 3C95A 2X4YA 4C8QG 1OULA 3VRYA 3F70A 2DVEA 4F17A 2O4XA 3CD6Q 1M90C 1UJ0A 3CCLQ 2BZYA 2SEMA 2F69A 4ZGDB 1VQNQ 2X35A 3OYLA 1UB4A 1FWZA 5GAOr 5GANj 2EAYA 4JDSA 2LDMA 2NUTA 1C6VX 2MOXA 3OYBA 1VQOT 2X51A 4HT9A 1GL5A 1YHQA 3LH5A 3I56Q 3OYFA 2QXFA 2OTLT 2HMAA 4PJJA 1SF9A 2F2WA 4HKEA 4R56A 2DIQA 4FYXB 1Z9ZA 5HK3A 3OS1A 1M1KC 4IUQA 3JB9G 2LC4A 1I1JA 4RTTA 1YCYA 3E1SA 1VQ9A 4BE2A 1RACB 2EFIA 2VXFA 2DF6A 4EPCA 1WDXA 1WGSA 2DZ9A 2DL3A 1WFWA 2ZPFB 2P0QA 5D6WA 3JCMQ 3EG9A 2DXTA 4OP0A 4KRTA 1FMVA 4M7DF 3OYEA 2FVUA 4JUVA 4M7DA 2E6ZA 3CC2Q 2D0NA 1I81A 2ABLA 2M02A 1H641 2XIDA 2DBMA 1VA7A 1MMGA 1TSFA 4BD3A 4BDYA 3VRZA 2MI6A 2W0ZA 1N6AA 2RI5A 4OGEA 1ZA2B 2CSIA 1VQ7T 4C8QA 1KQ1A 2LQNA 4D6WA 1M8VA 2EGCA 4XTZA 2O9VA 3VS7A 2HAXA 4HT8A 1ZBJA 4M77D 4F04B 4C5GA 1TUGB 2FHDA 3THKA 1X6GA 1D1CA 2CKKA 4FYVB 3SWNB 1KC8R 1KQSS 2P84A 2LCCA 2PVGB 2JW4A 3VS3A 3FIFA 3UA7A 2DIGA 2VASA 4NL3A 1D0XA 1QLYA 3P8BB 3JB9F 1WYXA 3D7SB 3EG0A 1SRMA 5LJ5j 2JMAA 3OSSC 1YIJQ 2L3SA 2L3PA 3CC7A 2L3QA 5KYWA 1X2QA 1KQSP 4MZPA 2PQWA 3CC4Q 5IHKA 4E6RA 4PJOE 2HKQB 3RMSA 1Y96A 4M78B 3MEWA 4C0DC 1E6HA 4C0ZA 2PZ1A 3RKYA 7AT1B 1BKBA 2RD1A 2YT6A 4XU1A 3VV0A 3EGXB 2WSCE 3JSCA 4PJOG 1UDLA 3LYIA 2QK0A 5CKBA 1RLPC 5AT1B 4ZTFA 1SKUB 4PFZA 4M7DD 1VQ8Q 1W2BP 3DLMA 2O31A 4QVCA 4KH0B 1RL2A 1YJWQ 1G3SA 2V8IA 1U8RA 5GANe 1X6BA 1WZOA 1TG0A 2ESWA 2BIVA 4A63B 1UGQB 2KE9A 1KG1A 1VQ6T 2LT1A 4C8QD 1SHFA 1YNZA 2QGGA 3FDRA 3V7RA 5D6YA 4QVZA 2YRDA 2E12A 3CCET 2QA4T 2YRVA 2J6OA 2D0QB 1VQLA 2HKNA 4XU2A 4JRQA 1MNDA 1SSHA 2DXBA 4Z8AA 1X69A 1N5ZA 4RKUE 2EQKA 4FL6A 1GFCA 2MAMA 2L2PA 5GMKe 1Y07A 2EW3A 4JRKA 2GNCA 3LGLA 3AT1B 4J9BA 3V7CA 1NE8A 1OI1A 4IIMA 2R5AA 2OTJA 3G6EQ 1Q82C 4RMOA 4PJOF 4PJOA 1M3CA 2CGHA 1JEGA 3L1AA 3S3OA 1RAFB 3A5ZB 3HL8A 5KE2A 3JCMJ 3FRNA 3MKDA 4J9HA 3HRUA 2Z0WA 4DBQA 3RR6A 3INZA 4QQ6A 1VQ4Q 3X28B 1X6OA 1YJNT 1OU8A 1R0CB 4QQGA 5GMKm 2KAFA 3RESA 1I07A 3G7ZA 2AK5A 1BI2A 3CCSA 1QVFS 1AEYA 4PJNA 3P8HA 1WHMA 4NOYA 3RKXA 5LJ5e 4Y91A 1UGRB 1DJ7B 1XOVA 2KQWA 2LCLA 2JZ2A 2COZA 2E3HA 1M4ZA 1T0JA 3REBB 3FEOA 3OSVA 1Q86C 2QDYB 4M78E 2PVDB 5DY9A 3CBMA 2DMOA 1NJIU 2YDLA 1QVFP 2EQIA 4KUIA 1UTIA 2E41A 2FPFA 3VS5A 3MHXA 2IVWA 4M78G 3V8LA 3BE3A 1HK9A 3PT9A 1GXIE 3CPFA 2JN0A 2R5MA 3MO8A 1M2VB 4PFOA 5FWBA 2FL7A 1X01A 3CBOA 1IHWA 1S72T 1JJ2P 2ECZA 2ATCB 4BY6C 1VQPA 4NS5A 5GMKi 2ENMA 2J7IA 1UEBA 2JXBA 2O4XB 4PK4A 1VQMA 3H9NA 3HTRA 1D0YA 3CCVQ 3G4ST 1K73U 5IXBA 4GLMA 1VQKT 2HD0A 4P5NA 1UG1A 3G1JA 3M58A 4FYWB 4HVUA 1I4K1 3L2UA 2NUTB 4RUGA 2QYZA 1SRLA 4WCIA 4N4HA 4CI0C 1IRXA 2XDDA 4OB3B 2E5QA 2HEQA 2LVMA 2X4WA 4C92F 2QTVA 3OYJA 9ATCB 2JTMA 3CCUA 4OVAA 1TTHB 4J9IA 3JV3A 3H0IA 1YHQT 1PSFA 3CCRA 1YI2A 3M5AA 1QW1A 3C0CA 3HPWA 3EG9B 4RCCA 4M78A 1VQ9Q 5GAN6 4HVVA 2VVKA 4M7DB 2DRKA 1LCKA 2DFUA 4ZN3A 1PC0A 2AKLA 2OX7A 3EGXA 3RDVA 1B3QA 2EKHA 3QDFA 1QKXA 1R0BG 4BI3A 2B86A 3EHQA 5CO7A 4LD6A 2DEUA 4N4GA 5DLQE 4QT7A 2E1HA 2DILA 4J6YA 2ZPIB 2RQWA 2KY9A 2QA4A 2K5IA 1BI1A 3UATA 2XK0A 1OX9A 4M75C 1WXBA 2FG0A 3NTKA 3CMEA 3G71Q 3X24B 1GFDA 4XU0A 2VUBA 4OB0B 4EMKA 4ZN1A 4FCYA 3UT1A 3M55A 3GOXA 4MMKA 3ZL7C 2QEXA 4M7AF 2RB6A 2VYTA 3DB4A 3OQ5A 1OQKA 4J83A 2M9UA 1UGVA 1GBRA 5GMKl 3HFOA 4UC4A 3J81E 1N9SA 4J6WA 3EGDB 4M7AC 1YJ9A 4M4ZA 4MZTA 3EG1A 4XTUA 1OZ2A 1KFZA 3C94A 3QJYA 3CCJQ 4RTYA 1B07A 4ATOA 2A08A 8AT1B 2KT1A 1Q86U 3CC7T 3VKIA 4M78D 2ZAEA 2RI3A 1D3BA 3VU3C 2XHCA 1I5LA 5IN1A 2F2VA 1VQ5Q 1QWFA 3P8DA 2Y4YA 3OBWA 3PGGA 2FZCB 1Q81C 4RTUA 1K9MC 2JM8A 1G83A 3V8JA 3MCAB 1PSEA 4OMMA 4R55A 4J7IA 1NLPC 3E19A 2RF0A 1G3TA 3L2QA 2EWNA 2C0IA 3MPUB 1HXDA 1YITA 1KD1C 4EMGA 1NEBA 1WPYA 3OYIA 1HYOA 1MNEA 4A53A 1E7OA 3V8KA 3QIIA 3EAEA 1D1AA 1ZUUA 3TCJA 2RHUA 2FZKB 5FLXE 3M0PA 1A0NB 4J6XA 3RIRA 3NMZC 6AT1B 4IIOA 3PE0A 4LUEA 1D0ZA 1NM7A 1OX8A 4FT2A 1VQLT 3M4GA 3UPUA 4ZGJB 1V76A 2AZSA 3HFNA 3KBGA 2EGEA 2HL5C 1ZSZC 2DYIA 3OYAA 1PHTA 2M0YA 5GAN5 4DEXA 3M0UA 1QCFA 4PJOB 4CRIA 2IIMA 1OZ3A 1M2VA 2LT4A 3JCMV 2CUDA 1PWTA 4JJCA 4PKCC 2AHJB 2OTJQ 2CZ1B 2KRNA 2DM1A 2SRCA 3JCMW 2BE9B 4E47A 2KDSA 1K73R 2LQWA 4Y92A 4DOVA 2DJQA 1H8KA 3EH1A 1QQJA 1W70A 1QVPA 3QHSA 1M3AA 2EQMA 4PLIA 3NTIA 5KYUA 2VXEA 2RQVA 4F7UE 1RUWA 2K57A 2OAWA 1AVZC 1UE9A 2LJ1A 2M51A 2JT4A 1PD1A 1VQOQ 2CT3A 3H0FA 4O5VA 4L59A 2C0TA 2OTLQ 3CMAA 4F7UG 4X1VA 2J06A 4BACA 4MDWA 3VS0A 4LNPA 5I22A 2EJGA 4QW2A 3CCST 2L89A 1QP3A 4BE1A 3U23A 2JJ9A 3KUFA 3I55A 2VGMA 3PIPA 2VWFA 2O9SA 4M77C 4KUDK 2L8DA 1WHGA 2E10A 2C0OA 4RTZA 2DRMA 3PVQA 2DKGA 2V1RA 1K0XA 2RHXA 4HXJA 4KULA 2HSEB 4JLIA 2L3RA 2A7YA 5GMKj 1Y7XA 8ATCB 3JCMb 4KGZB 1IGUA 3E2UA 4RG8A 3J80E 3H0HA 1XQHA 1ZHIA 3M56A 3GNFB 2CH4A 1M8MA 1Q82R 1JXMA 3VUZA 2HL3A 3OYYA 3QDRB 3CPWA 1VQ7Q 3KXTA 3JAME 3CCQA 4JPBW 3PMTA 2CYZB 2DE0X 3NGPA 3RKWA 2PVOB 3N5BB 5C6SA 3UWNA 1K9AA 4DOWA 3L2RA 1WJQA 2YLBA 5J39A 2MF2A 1VQPT 3TREA 2RQRA 2JOYA 4FYYB 3KFVA 4ZTJA 1IHVA 2GFAA 4LDVA 1VQMT 4F7UF 5HCKA 4F7UA 1BI0A 4PLLA 1NLOC 2NWMA 5GJVB 4C92B 3SFMA 2BE7D 3C12A 3FLGA 5FU6C 2DL7A 3PMIA 2DBKA 4A4FA 3R6NA 2E3IA 2P4TA 3HSBA 4ORZA 5J3BA 3EGDA 2K2VA 1Q86R 4ESRA 2DAQA 1G2BA 1R77A 3CCUT 4IUTA 1W4SA 1SSFA 2QQSA 3EHRA 3TU4K 3RNJA 3CCRT 1YI2T 2XDPA 4PJMA 4KBMB 2CUBA 2X3XD 1WHKA 3A1PA 4J8OA 1K8AC 2VGNA 4WF2A 2DETA 5GAMh 1K4US 1HJDA 2KVQG 1VQ6Q 4XTWA 4J9DA 1T0HA 3CEYA 1WXUA 1NG2A 2YRCA 5CIUA 4EMKB 1ZBXA 4A4EA 4OMOA 1AD5A 3CCEQ 3OMCA 2QA4Q 5FU7B 3VJPA 2RM4A 3PTAA 3HHTB 4M7AB 4Y28E 2FZGB 3JCMd 3A8LB 5KYXA 2RQUA 1M90U 1IGQA 2EGAA 3CMET 4JLGA 1NPRA 1WNLA 1RAEB 3JB9D 5CKFA 4KH1B 3NPFA 2G6FX 2QEXT 5GAN4 1B34A 2JMCA 5GAN8 1U1TA 1M1KU 4E7IA 2GGRA 3EG3A 2MCNA 4X9DA 5D7UA 1I0CA 2CP7A 1WXTA 3QWXX 1D1BA 2BTTA 1TOVA 1D3BB 1RI9A 3S3NA 5J26A 3C4SA 4A4GA 3OW2A 1YJ9T 3EFSA 3PIOA 3CCMT 1U5SA 1WJRA 2ZCFB 3A98A 2VC8A 3SD4A 2L0AA 1WHLA 2XD0A 4GY5A 2DTOA 1YP5A 4LDWA 2I2LA 2LQ8A 3OY9A 1YJNQ 3T9NA 5IT9E 4IUVA 3QZ9B 2L5QA 3JRZA 3A8GB 3CCLA 2JM9A 3I5RA
chains in the Genus database with same CATH topology
1BI3A 4B9XA 1KD1U 2EIFA 4M7DE 1VQNA 5LJ3h 3DB3A 5KCHA 4X34A 3OW2S 1NPPA 2MMPA 4C92E 4N4GA 1NJIC 5DLQE 2H3JA 1JBMA 4C8QC 2P0KA 1KC8C 3VYHB 2E1HA 3E9GA 2FYKA 4BUGA 5GAMf 1S72A 4J6YA 2ZPIB 3QG1A 3WVEB 5A0LA 3OYDA 3I56A 4MDXA 2KY9A 3OYKA 2QA4A 2K5IA 1BI1A 4M7DG 2GQVA 2K5FA 2G3RA 2DTIA 4C92G 2XK0A 3L2VA 3SB2A 1YITT 3CBPA 1FXXA 4EDUA 5M9OA 3LWIA 4IKFA 4M75C 2DO3A 3CCJA 4C8QE 3VYGA 1N8RC 3LW5E 3NTKA 3CMEA 1YIJT 1W2BS 3MEAA 3X24B 4M75B 4XU0A 2V8KA 3G4SA 4Q5WA 2VUBA 5LJ5f 4OB0B 4JS5A 3CC4T 4EMKA 4ZN1A 1O75A 5GAN2 2E64A 3DKMA 1VQKA 2RJEA 2OTJT 2EJFA 3UT1A 3M55A 1WQWA 3GOXA 4MMLA 3C95A 2X4YA 3LX7A 4C8QG 4MMKA 4M7AF 2QEXA 2RB6A 4M75E 2VYTA 3A8MB 3SDZA 3DB4A 3OQ5A 3F70A 5GAMg 2DVEA 2EQUA 4J83A 1VQ5A 2M9UA 2O4XA 5HK0A 1M90C 3URGA 2QI2A 3GPLA 5HY6A 2F69A 1WJSA 4ZGDB 1K73C 3QUIA 2X35A 3CC2A 3OYLA 1UB4A 4L5GA 1FWZA 3TEEA 5GMKl 2IG0A 2ZPGB 2RJCA 5GAOr 4M75G 1VQ8T 2DD5A 5GANj 2EAYA 2DK3A 2ZGWA 2LDMA 3HFOA 1N9SA 4JDSA 4UC4A 2R58A 5LJ5g 3ZBDA 3J81E 3OYBA 1VQOT 1YJWT 4HT9A 2DTHA 4J6WA 1YHQA 2LQKA 1Q7YC 4PJOD 3RUXA 3OYFA 3FC3A 2QXFA 2OTLT 2ZZDA 1YJ9A 4M7AC 4MZTA 4XTVA 4HKEA 4R56A 2DIQA 5HK3A 4XTUA 3LH0A 3OS1A 1OZ2A 3BFMA 4IUQA 3EFRA 3JB9G 1M1KC 3C94A 4J7FA 2LC4A 3QJYA 1YCYA 4ATOA 3E1SA 1VQ9A 4BE2A 1Q86U 3CC7T 3QSUA 2EFIA 3VKIA 2VXFA 4M78D 3LLRA 2RI3A 4EPCA 4IURA 1D3BA 1WGSA 2DZ9A 3MP8A 3VU3C 5I2MA 5A0GA 4M7AE 3X20B 2E6NA 3QO3A 2ZPFB 1I8FA 2XHCA 4XU3A 1I5LA 2M16A 2WSFE 2F5KA 3MEUA 2P0QA 3OBYA 5IN1A 5HKCA 5D6WA 4ELZC 3JCMQ 2DXTA 2EQJA 3P8DA 2Y4YA 3OBWA 3PGGA 4OP0A 4B9WA 1Q81C 3QJ6A 4M7DF 3OYEA 2FVUA 1K9MC 4JUVA 4M7AG 4M7DA 2EKOA 5CKEA 2EJ9A 1KD1C 3PFSA 3MCAB 1PSEA 3M59A 3V8JA 2E6ZA 5LJ3j 4C92A 3JCMP 3H8ZA 3CCLA 4R55A 4J7IA 4C0FA 1I81A 4E7HA 2WACA 3E19A 1H641 2XIDA 1G3TA 1P92A 4PNOA 4XTXA 3ZEHA 2K3YA 3L2QA 2EWNA 2XKOC 1HXDA 1X75C 1ZQ1A 2GF7A 2RHIA 2CZ0B 3E9FA 4BD3A 4EMGA 4BDYA 2MI6A 1KQSA 1N6AA 2RI5A 1KHCA 4OGEA 3OYNA 2QQBA 1WPYA 2GFUA 3OYIA 1YIJA 3CMAT 4A53A 1N27A 3A8HB 1G3YA 3V8KA 5DM7R 1VQ7T 3QIIA 3CC4A 4C8QA 1KQ1A 3EAEA 4JRPA 4D6WA 1M8VA 3JCMf 3OS0A 3TCJA 2M0OA 3G6ET 2RK2A 2RHUA 2QQAA 4XTZA 4N0AC 5FLXE 3I55T 2QTXA 3FJPA 2HAXA 4HT8A 4M77D 4N4IA 3SWNC 4J6XA 4C5GA 3L42A 1LOJA 2FHDA 3RIRA 3CD6A 2CKKA 2RK1A 4M75F 3SWNB 5LJ3g 4E7LA 4M75A 3JCMX 4HA8A 1KQSS 5CR2A 2LCCA 2PVGB 4FT2A 2V8JA 1VIEA 3FIFA 1VQLT 3M4GA 3UPUA 4ZGJB 3HFNA 5GAMj 2RHYA 3KBGA 1VQ8A 3OYAA 2DIGA 3OYCA 4NL3A 1VQ4T 1VQOA 3P8BB 1YJWA 5GAN5 3JB9F 4HCBA 3R6OA 2C06A 4PJOC 2CS7A 3ER0A 1Q82U 2OTLA 3ASKA 1G3WA 4OF1A 4GLKA 3JCMh 4CRIA 4PJOB 2PUOB 1OZ3A 2D6FA 1XNIA 1M1FA 5EG2A 4C0GA 5LJ5j 2XG8D 2LT4A 3OSSC 3JCMV 2ZPHB 4JJNK 3CC7A 1JJ2A 1V29B 2K5LA 4PKCC 4MZPA 2PQWA 4OMFB 1BIBA 2AHJB 2KSSA 2XDBA 3GIBA 4PJOE 4E7JA 5GANd 2CZ1B 3RMSA 3CCQT 1Y96A 4M78B 2O01E 3MEWA 4C0DC 3JCMW 4C0ZA 4C5EA 4E47A 2DEQA 2KDSA 4F7UB 4DOVA 3RERA 1EIFA 4OGCA 3RKYA 4ZGEB 4C0DB 1BKBA 2RD1A 4M7AA 4XU1A 1QVPA 2RJDA 3VV0A 3QHSA 2EQMA 1JB0E 2WSCE 3JSCA 3QPHA 3V7SA 3VUBA 4PJOG 3LYIA 2PU9B 4PLIA 3NTIA 2YLCA 4O6JA 1QP2A 2CZ7B 2EYQA 2VXEA 3BW1A 3HRSA 5CKBA 4F7UE 4ZTFA 2K57A 4M7DD 4X9CA 1JJ2S 3DLMA 3QBYA 4C92D 2D9TA 1MHNA 2XICA 4QVCA 3QZ5B 5A2QE 3MP1A 1RL2A 2XU8A 4FIBA 2ZPBB 4O5VA 3RMQA 1G3SA 5GAOq 2V8IA 4L59A 3S6WA 1U8RA 1JRIA 2DJZA 5GANe 3CMAA 4F7UG 5CKDA 1MGQA 5KCOA 3CCMA 1Y71A 4BACA 4MDWA 1XTDA 2BIVA 4HCCA 1VQ7A 2EJGA 3M9QA 1UGQB 5GAOm 1KG1A 4QW2A 3CCST 1VQ6T 2L89A 4LDYA 3G6EA 5LJ3d 1N8RU 2LT1A 1QP3A 2QQRA 3BY7A 4C8QD 4BE1A 4V2SA 3FDRA 3KUFA 4A4KA 3I55A 3V7RA 2VGMA 3PIPA 5D6YA 4A4HA 4QVZA 3UDCA 4KUDK 4M77C 4BI8B 2L8DA 3OYGA 3QXEB 2E10A 2E12A 3CCET 2QA4T 4M77B 2DKGA 2YHTA 2DD4A 1K8AU 2RHXA 2YRVA 3M53A 3GLXA 5IAYA 2D0QB 1M5Q1 1VQLA 4FU6A 2X4XA 4JRQA 2ZPEB 4KULA 4XU2A 5CQXA 4JLIA 2HQXA 2L3RA 2A7YA 2E65A 5GMKj 2DXBA 1Y7XA 1VQ4A 3O8VA 3NFCA 5GAN7 3MP6A 3JCMb 4M77E 4RKUE 3CCVT 4RCBA 2EQKA 4FL6A 5CK9A 2CZ6B 4RG8A 3J80E 4N0AA 2MAMA 5GMKe 1Y07A 4L6V5 3SWNA 4IUPA 5LJ3e 1XQHA 3QYHB 1ZHIA 3M56A 3GNFB 4JRKA 4NL2A 5CCAA 3LGLA 3BDLA 2BUDA 3CXCA 3VUZA 1R8OB 3OYYA 4M77G 1QVGA 3V7CA 3PNWC 4QQDA 3QDRB 3CPWA 3HKSA 1NE8A 5AYFA 5GANh 1OI1A 5FRMA 3NTHA 3ZFJA 5GAMd 2JVVA 3KXTA 2FB7A 2R5AA 2OTJA 3JAME 3CCQA 3J7AF 2DXUA 3M54A 3GNGA 3OYMA 1Q82C 4LD9K 3PMTA 3FB9A 1YITA 2CYZB 4RMOA 4PJOF 5A0DA 4PJOA 4TVRA 3RKWA 2PVOB 3N5BB 2CGHA 5C6SA 2X4JA 3L1AA 3S3OA 3UWNA 4IUUA 3X26B 4DOWA 3L2RA 3A5ZB 1WJQA 2YLBA 3HL8A 5KE2A 3JCMJ 4M7AD 1QVFA 3LWHA 5J39A 2MF2A 5LJ5d 3FRNA 2HQEA 1UGPB 1VQPT 1M9SA 3TREA 4Z02A 3HRUA 2JOYA 1B34B 3CXCS 1VIFA 4M78F 4ZTJA 3OMGA 1QVGS 2GFAA 4FT4A 4LDVA 4BDZA 3CPWS 1VQMT 2K3XA 3INZA 4F7UF 4OB2B 1VQ9T 4F7UA 1G5VA 4QQ6A 4C92C 1IZ6A 3X28B 1BI0A 1U1SA 2R57A 4PLLA 1X6OA 4QVDA 4PL6A 1VUBA 4C92B 5GAMe 3SFMA 3JCMg 1YJNT 2M1HA 2LTOA 3JB9H 3C12A 3FLGA 4XQ3A 5L8RE 5FU6C 1NZ9A 4QQGA 5GMKm 3M4YA 1FX7A 2KAFA 3PMIA 3RESA 3S3MA 5FU6B 3G7ZA 2RI2A 5CQYA 1BYMA 1BI2A 1M1GA 5FROA 4A4FA 1KHIA 3CCSA 1QVFS 1VQ6A 4C5HA 3P8HA 5FRNA 1LJOA 4NOYA 3RKXA 5LJ5e 4M78C 4Y91A 2P4TA 4XTYA 3HSBA 4DA4A 1UGRB 4JRIA 2JUFA 4C8QB 1LNXA 1DJ7B 5J3BA 1XOVA 2KQWA 3OS2A 2K2VA 2JZ2A 2LCLA 2DAQA 3CCEA 1M4ZA 3CCUT 4IUTA 1W4SA 1SSFA 2QQSA 2RA2A 3FEOA 4DQ2A 2BKDN 3TU4K 3OSVA 3X25B 1BIAA 1Q86C 2QDYB 4M78E 3CCRT 1YI2T 3G71T 2PVDB 5DY9A 2RHZA 3CCVA 5LL6S 2XDPA 5C0MA 4VUBA 3JCMc 4FM4B 1O9SA 2RJFA 3CBMA 1NJIU 2RH2A 1N9RA 2MWOA 4BI4A 3BDUA 4KBMB 4M77F 4KUIA 5CVIA 4M77A 2E41A 3OYHA 2E70A 1K8AC 4J8OA 1KC8U 3MHXA 2IVWA 4M78G 3V8LA 3JB9I 2Y4XA 4A54A 2VGNA 1HK9A 1KQ2A 4XAXB 3PT9A 4WF2A 3DLLA 3GP8A 5GAMh 3CPFA 3CD6T 1GXIE 2JN0A 4OB1B 3CCLT 5KE3A 2R5MA 1UGSB 2KVQG 2JNGA 1VQNT 3MO8A 3HRTA 2LRQA 1OYXA 2Y90A 1WQ7A 4XTWA 2DZCA 3CEYA 4EMKC 2VV5A 5CKHA 2NLUA 5GAOn 2KK4A 2FL7A 2KMTA 4RG2A 1X01A 3CBOA 5CIUA 4EMKB 1ZBXA 5FU7C 4A4EA 1H3ZA 5LJ5h 1S72T 2DPPB 2K4YA 5GANf 3I56T 1Y96B 3OMCA 5FU7B 3VJPA 2RM4A 4LD6A 4JS4A 4BY6C 1VQPA 3PTAA 1RI0A 3HHTB 4NS5A 4M7AB 4M75D 4Y28E 3JCMd 3A8LB 4BY6B 5GMKi 3CCJT 2O4XB 1UEBA 5I21A 5GAN3 1VQMA 1M90U 3CMET 4JLGA 3LGFA 1NPRA 3G4ST 1K73U 1WNLA 2F5TX 3L2ZA 3ME9A 4C5IA 1YJNA 4ELYC 1VQKT 2HD0A 2OAUA 3GF5A 3Q1JA 4P5NA 5GAOp 3M58A 3JB9J 3JB9D 3H6ZA 5CKFA 3WXMB 1AHJB 1I4K1 3L2UA 2QEXT 2LX9A 5GAN4 1B34A 2RO0A 4II1A 4XK8E 1Q7YU 2JTFA 1VQ5T 2HBPA 5GANg 4N4HA 3M57A 5GAN8 2XI9A 4CI0C 2XDDA 2DXCA 3META 4E7KA 1U1TA 2E5QA 4OB3B 2LVMA 2MWPA 2X4WA 1M1KU 4E7IA 3OS5A 5DLOA 4C92F 3OB9A 4X9DA 4KT0E 4YTLA 3CC2T 3JCMe 3OYJA 5I2SA 4LDUA 5GAOl 2JTMA 1IREB 2WSEE 4J5YA 3OA6A 3CCUA 4OVAA 5LJ3f 4LDXA 3MEVA 2HNIA 5CAIA 1D3BB 3HP9A 1YHQT 3S3NA 5J26A 3C4SA 4A4GA 4FSXA 4BE0A 3OW2A 1PSFA 4HCZA 5D6XA 4EMHA 3CCRA 1YJ9T 1YI2A 1YBYA 3EFSA 3PIOA 3G71A 3CCMT 3AHUA 5KH6A 3M5AA 2GCXA 1QW1A 1WJRA 3HPWA 4C8QF 2ZCFB 4RCCA 4M78A 4M7DC 3WVDB 1Q81U 2VC8A 3SD4A 4BB7A 5GAN6 2A3LA 2XD0A 1K9MU 2QQ9A 4M7DB 2B8AA 4GY5A 2DTOA 3QYGB 3L2WA 2I2LA 4LDWA 4ZN3A 1W2BA 2LQ8A 4ME7A 3OY9A 1TH7A 3T9NA 4MZMA 5IT9E 4IUVA 2LNVA 3QKJA 3QZ9B 3A8OB 2L5QA 3JRZA 4BI3A 3A8GB 5CO7A 2P0PA 2PUKB 5GMKh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXD A;  3V7R A;  3JCM c;  4M7D E;  4EMG A;  5LJ3 h;  4M77 C;  4C92 E;  1N9R A;  2E10 A;  1WPY A;  3BDU A;  1JBM A;  4M77 F;  4C8Q C;  4M77 A;  4M77 B;  2E41 A;  2DKG A;  2YHT A;  4A53 A;  3V8K A;  2E1H A;  4M78 G;  1KQ1 A;  3V8L A;  4C8Q A;  1M5Q 1;  2FYK A;  5GAM f;  3JB9 I;  4J6Y A;  4A54 A;  1M8V A;  1HK9 A;  4XU2 A;  3JCM f;  1KQ2 A;  4JLI A;  4M7D G;  4WF2 A;  5GAM h;  2E65 A;  5GMK j;  2JN0 A;  4XTZ A;  2DTI A;  4N0A C;  4C92 G;  5GAN 7;  2QTX A;  3FJP A;  4M77 E;  3SB2 A;  4RCB A;  3JCM b;  4M77 D;  4HT8 A;  3SWN C;  4J6X A;  4M75 C;  1LOJ A;  2Y90 A;  1WQ7 A;  4N0A A;  3RIR A;  4C8Q E;  4XTW A;  5GMK e;  2DZC A;  5GAO n;  3SWN B;  4M75 F;  3SWN A;  4EMK C;  5LJ3 g;  5LJ3 e;  4M75 B;  4M75 A;  4XU0 A;  3JCM X;  4HA8 A;  5LJ5 f;  1X01 A;  4JRK A;  4NL2 A;  5DY9 A;  4EMK B;  4EMK A;  5GAN 2;  2E64 A;  3FIF A;  5LJ5 h;  3M4G A;  2EJF A;  3HFN A;  5GAN f;  5GAM j;  1Y96 B;  4M77 G;  1WQW A;  3V7C A;  4MML A;  2RM4 A;  5GAN h;  4NL3 A;  4C8Q G;  4MMK A;  4M7A F;  2RB6 A;  5GAM d;  4M75 E;  4M7A B;  5GAN 5;  3JB9 F;  2FB7 A;  4M75 D;  3JCM d;  5GAM g;  2DVE A;  5GMK i;  4PJO C;  2DXU A;  5I21 A;  5GAN 3;  3FB9 A;  4PJO F;  3JCM h;  4PJO B;  4PJO A;  3RKW A;  1WNL A;  2CGH A;  3L1A A;  3QUI A;  3L2Z A;  5LJ5 j;  3JCM V;  5GMK l;  5GAO p;  2YLB A;  4M7A D;  3JCM J;  4M75 G;  5GAO r;  3JB9 J;  3JB9 D;  5LJ5 d;  5GAN j;  1I4K 1;  2EAY A;  2ZGW A;  3HFO A;  5LJ5 g;  1N9S A;  1BIB A;  3GIB A;  4HT9 A;  4PJO E;  5GAN 4;  2DTH A;  1B34 B;  1B34 A;  4J6W A;  5GAN d;  4PJO D;  4M78 F;  3RUX A;  5GAN g;  1Y96 A;  4M78 B;  3JCM W;  4M7A C;  4F7U F;  3INZ A;  5GAN 8;  4XTV A;  2DEQ A;  4F7U B;  4F7U A;  4C92 C;  3RER A;  3RKY A;  1U1T A;  4XTU A;  1U1S A;  3BFM A;  2RD1 A;  3JB9 G;  3EFR A;  4M7A A;  4XU1 A;  4C92 F;  4QVD A;  4X9D A;  4C92 B;  3QHS A;  5GAM e;  3V7S A;  3JCM g;  1YCY A;  3JCM e;  3JB9 H;  4XQ3 A;  4PJO G;  5GAO l;  3QSU A;  4J5Y A;  2YLC A;  2VXF A;  4M78 D;  5LJ3 f;  2VXE A;  5GMK m;  3BW1 A;  3RES A;  4F7U E;  2HNI A;  2K57 A;  5CAI A;  1D3B B;  1D3B A;  2DZ9 A;  4M7A E;  3VU3 C;  4M7D D;  3QO3 A;  4X9C A;  4XU3 A;  1I8F A;  1I5L A;  4C92 D;  4EMH A;  3EFS A;  4QVC A;  1LJO A;  4NOY A;  3RKX A;  5LJ5 e;  4M78 C;  4Y91 A;  3AHU A;  4XTY A;  3HSB A;  4C8Q F;  3JCM Q;  4JRI A;  5GAO q;  2DXT A;  4C8Q B;  1LNX A;  4RCC A;  1JRI A;  2DJZ A;  3PGG A;  4M78 A;  2VC8 A;  4OP0 A;  5GAN e;  4F7U G;  4M7D C;  1MGQ A;  5GAN 6;  4M7D F;  4JUV A;  4M7A G;  4M7D A;  4M7D B;  2DTO A;  2EJ9 A;  2I2L A;  3V8J A;  2EJG A;  3JCM P;  5LJ3 j;  5GAO m;  4C92 A;  1TH7 A;  2RA2 A;  4DQ2 A;  1I81 A;  1BIA A;  5LJ3 d;  4M78 E;  1H64 1;  3BY7 A;  4PNO A;  4C8Q D;  4XTX A;  4V2S A;  2EWN A;  5GMK h; 
#chains in the Genus database with same CATH topology
 4RTV A;  2EIF A;  1VQN A;  1NPP A;  4C92 E;  4AT1 B;  1S1N A;  1YCS B;  1JBM A;  1PRL C;  3VS4 A;  1KC8 C;  3E9G A;  1ZSZ B;  4F14 A;  1YWP A;  1RLQ C;  2HZY A;  3I56 A;  4E2F B;  3M0R A;  2GQV A;  2K5F A;  4C92 G;  3SB2 A;  1YIT T;  3CBP A;  5M9O A;  3LWI A;  4AFS C;  2DO3 A;  1Y0M A;  1EFN A;  3LW5 E;  1UFF A;  4JS5 A;  1O75 A;  4DBH A;  2E64 A;  3DKM A;  2RJE A;  3QWY A;  4KGV B;  2EJF A;  1OPK A;  3LX7 A;  4M75 E;  3SDZ A;  3A8M B;  1NYG A;  2NYS A;  5GAM g;  2EQU A;  4CC7 A;  1LVK A;  2KR3 A;  1BB9 A;  2QI2 A;  5HY6 A;  1WJS A;  3RBB B;  3QUI A;  3SHW A;  3CC2 A;  4L5G A;  2IG0 A;  2RJC A;  2YWW A;  4M75 G;  2DD5 A;  2ROL A;  2LX7 A;  2DTH A;  4PJO D;  1S72 Q;  1Q7Y C;  2KXC A;  3FC3 A;  2ZZD A;  4XTV A;  3BFM A;  2J6F A;  3EFR A;  4J7F A;  2GTO A;  2DL4 A;  3G4S Q;  5KYU B;  3LLR A;  1VQK Q;  3TVT A;  3MP8 A;  4M7A E;  5I2M A;  5A0G A;  2CH4 W;  3X20 B;  3QO3 A;  2M16 A;  4F16 A;  2F5K A;  3MEU A;  4ELZ C;  2FPE A;  5IH2 A;  5I11 A;  3VS1 A;  4M7A G;  1RAH B;  5CKE A;  1KD1 R;  3PFS A;  3M59 A;  4C92 A;  3H8Z A;  4C0F A;  4PNO A;  1P92 A;  4XTX A;  2PUK B;  2RHI A;  1X75 C;  1ZQ1 A;  1FMW A;  1YHQ Q;  1W1F A;  2KRS A;  4QKU A;  3CMA T;  2GFU A;  2QDL A;  1YIJ A;  1WLP B;  2XMF A;  2RQT A;  1N27 A;  3A8H B;  1G3Y A;  3CC4 A;  5DM7 R;  4ANJ A;  2A37 A;  1GCQ C;  4JRP A;  3JCM f;  2RK2 A;  2JS0 A;  1RAD B;  2QQA A;  4N0A C;  3I55 T;  2QTX A;  3SWN C;  3EG2 A;  1JU5 C;  1IB8 A;  1LOJ A;  3L42 A;  4M75 F;  4E7L A;  4M75 A;  4HA8 A;  1SPK A;  5CR2 A;  1OOT A;  2V8J A;  1VIE A;  1NBE B;  1VQ8 A;  2RHY A;  2CP0 A;  3OYC A;  2DNU A;  1YJW A;  2OJ2 A;  3ER0 A;  1Q82 U;  1G3W A;  1OEB A;  3JCM h;  4RTX A;  4AG1 C;  1MUZ A;  1M1F A;  4PFP A;  1MV3 A;  4RTW A;  2DER A;  3I9Q A;  4OML A;  1JJ2 A;  4Z88 A;  1V29 B;  3GIB A;  2XDB A;  4E7J A;  1M90 R;  3CCQ T;  1UHC A;  2O01 E;  4C5E A;  4F7U B;  3RER A;  1EIF A;  1M30 A;  4C0D B;  4M7A A;  1SG5 A;  3V7S A;  1JB0 E;  4CC4 B;  3VUB A;  2YLC A;  3I5S A;  2CZ7 B;  2EYQ A;  3BW1 A;  1WX6 A;  1MMN A;  3M0S A;  4C92 D;  2CSQ A;  2D9T A;  2XIC A;  1VOM A;  1M1K R;  1T3L A;  2GBQ A;  3QZ5 B;  1CKA A;  3MP1 A;  2ZPB B;  3RMQ A;  5GAO q;  4GBQ A;  2DJZ A;  1MGQ A;  1RAI B;  2CP3 A;  3CCM A;  1E6G A;  1XTD A;  2VB6 A;  2HCK A;  1GCP A;  2J6K A;  3G6E A;  3CC7 Q;  5LJ3 d;  2QQR A;  3BY7 A;  4DBR A;  2BZ8 A;  1TXQ A;  4A4K A;  1U3O A;  1WHJ A;  2YUN A;  4BI8 B;  1TS9 A;  2YHT A;  2DD4 A;  2LMJ A;  3GLX A;  1M5Q 1;  4FU6 A;  2X4X A;  2ZPE B;  1VQ4 A;  3O8V A;  3MP6 A;  4OMP A;  4M77 E;  2MPX C;  2O88 A;  2KBT A;  2CP5 A;  4IUP A;  3QYH B;  2ED1 A;  2YUP A;  5L23 A;  1YN8 A;  1NEG A;  2A36 A;  3BDL A;  2BUD A;  3CXC A;  1R8O B;  4M77 G;  1QVG A;  5AYF A;  5GAN h;  3ZFJ A;  5GAM d;  1ZSZ A;  2FB7 A;  5KYX B;  1M27 C;  3OYM A;  4LD9 K;  2W10 A;  2A28 A;  3FB9 A;  1HD3 A;  2X4J A;  4IUU A;  2ED0 A;  1W6X A;  1PD0 A;  1BK2 A;  4M7A D;  1EZZ B;  3LWH A;  4D8K A;  1LPL A;  4AFZ C;  1B34 B;  1VYV A;  1VIF A;  4K11 A;  4DBF A;  5KYY A;  1VQL Q;  3OMG A;  4FT4 A;  4BDZ A;  3NHN A;  3CPW S;  2K3X A;  4OB2 B;  1IZ6 A;  4CC3 A;  1VUB A;  3JCM g;  2M1H A;  2LTO A;  3TSZ A;  3REA B;  2LJ0 A;  3JB9 H;  5L8R E;  3S3M A;  3M4Y A;  1FX7 A;  2PTK A;  1K1Z A;  2RI2 A;  5CQY A;  1BYM A;  1M1G A;  5FRO A;  2YXY A;  2JTE A;  2KEA A;  1LJO A;  4DA4 A;  3CPW P;  2CT4 A;  1ZSG A;  2BKD N;  3X25 B;  1UHF A;  1QMC A;  1AWX A;  3CCV A;  5LL6 S;  2DL8 A;  3JCM c;  4FM4 B;  1O9S A;  1OV3 A;  4LE9 A;  2RH2 A;  2MWO A;  3BDU A;  4M77 F;  5CVI A;  4M77 A;  3OYH A;  2E70 A;  2K2M A;  2AIR B;  3JB9 I;  2Y4X A;  5IHI A;  4XAX B;  5GJW B;  3CD6 T;  4HVW A;  3DLL A;  4OB1 B;  3CCL T;  3TQ7 P;  1QCO A;  1UGS B;  2JNG A;  1VQN T;  2DLP A;  3HRT A;  2LRQ A;  2CRE A;  1OYX A;  3CCS Q;  1WQ7 A;  2DZC A;  2VV5 A;  2EVR A;  2KK4 A;  2E4H A;  1H3Z A;  5LJ5 h;  2V26 A;  2K4Y A;  3I56 T;  2YUO A;  4JS4 A;  1RI0 A;  1AT1 B;  4J9C A;  2RMO A;  4OMQ A;  4BY6 B;  5GAN 3;  4Z89 A;  2PNI A;  1QCN A;  2F5T X;  3L2Z A;  1JO8 A;  2OAU A;  3Q1J A;  3UF4 A;  5GAO p;  1PRM C;  3JB9 J;  1GRI A;  3H6Z A;  1WIE A;  2RO0 A;  4II1 A;  2CDT A;  2HBP A;  5GAN g;  3M57 A;  4E7K A;  4LXC A;  3OS5 A;  3CC2 T;  4YTL A;  2BZX A;  3JCM e;  5I2S A;  4LDU A;  1IRE B;  2WSE E;  4J5Y A;  5LJ3 f;  4LDX A;  3MEV A;  4KGX B;  4EMH A;  3G71 A;  1VQP Q;  2QG9 B;  3AHU A;  1AWW A;  1ZUK A;  4C8Q F;  4CC2 A;  4M7D C;  1VQM Q;  1Q81 U;  2A3L A;  1K9M U;  2QQ9 A;  1IXD A;  5IXF A;  2B8A A;  3QYG B;  2LP5 A;  1U06 A;  1GBQ A;  4MZM A;  2LNV A;  3QKJ A;  2LZ6 B;  2P0P A;  4B9X A;  1KD1 U;  5LJ3 h;  3DB3 A;  1G8X A;  3GBQ A;  4X34 A;  5KCH A;  3UA6 A;  1VYU A;  2MMP A;  3OW2 S;  1NJI C;  2H3J A;  2YSQ A;  4C8Q C;  3EH2 A;  1TUD A;  1BCM A;  4BUG A;  5GAM f;  3QG1 A;  3WVE B;  5A0L A;  4MDX A;  2H3E B;  3M0T A;  3OYK A;  1X2K A;  2NUP B;  3CCU Q;  5IHN A;  2DA9 A;  2G3R A;  3L2V A;  1ABO A;  4IKF A;  4EDU A;  3CCJ A;  1N8R C;  4OMN A;  1TWB A;  3CCR Q;  1YIJ T;  1YI2 Q;  1W2B S;  3MEA A;  4M75 B;  3CC4 T;  3O5Z A;  2KT8 A;  3OW2 P;  2D8H A;  1UUE A;  3SEM A;  1EX4 A;  1VQ5 A;  2MIO A;  5HK0 A;  3URG A;  1CSK A;  1JXO A;  3GPL A;  1K73 C;  1Q7Y R;  2KRO A;  1FMK A;  2A0F B;  1MMD A;  3TEE A;  2ZPG B;  1VQ8 T;  4JJD A;  2KNB B;  2DK3 A;  2ZGW A;  5LJ5 g;  2R58 A;  1WA7 A;  3ZBD A;  4LN2 A;  1YJW T;  2LQK A;  1V1C A;  3RUX A;  2LJ3 A;  3LH0 A;  1I5O B;  1C0M A;  2YUQ A;  2DYB A;  1KK7 A;  3CME Q;  3QSU A;  1ZA1 B;  2KYM A;  4IUR A;  2K7A A;  2QGF B;  1YFN A;  2E6N A;  2KGT A;  4XU3 A;  1I8F A;  2WSF E;  3OBY A;  2QEX Q;  5HKC A;  2AT1 B;  2EQJ A;  4B9W A;  3QJ6 A;  1XJW B;  3EFO A;  4PJL A;  1H3H A;  1RAB B;  2EKO A;  2EJ9 A;  2COY A;  2HSP A;  5LJ3 j;  3JCM P;  1F1B B;  1Q95 G;  2EYX A;  4D8D A;  2WAC A;  4E7H A;  4JZ3 A;  2K3Y A;  3ZEH A;  2XKO C;  3E9F A;  2GF7 A;  1KQS A;  2CZ0 B;  2KXD A;  3CQT A;  1KHC A;  1MV0 B;  3OYN A;  2QQB A;  1YJ9 Q;  3CCM Q;  1VYT A;  1RAG B;  3OS0 A;  2GTJ A;  2M0O A;  3G6E T;  2F1L A;  1ZX6 A;  2DL5 A;  3FJP A;  1BBZ A;  2K9G A;  5FWC A;  5KYN A;  4N4I A;  2FRW A;  3CD6 A;  1QKW A;  2RPN A;  2RK1 A;  5LJ3 g;  3JCM X;  1M3B A;  1TU0 B;  2EPD A;  1IO6 A;  2V1Q A;  2KYB A;  4R0K A;  5GAM j;  2KRM A;  1JQQ A;  5EC7 A;  4AG2 C;  1NYF A;  2QAS A;  1VQ4 T;  1VQO A;  2HDA A;  4HCB A;  3R6O A;  2C06 A;  1X43 A;  2CS7 A;  4PJO C;  2OTL A;  3ASK A;  4OF1 A;  2QAZ A;  4GLK A;  4FW2 A;  4AMC A;  1T3S A;  1YIT Q;  2PUO B;  2D6F A;  1XNI A;  5EG2 A;  4C0G A;  2XG8 D;  1RAA B;  2ZPH B;  4JJN K;  1ZUY A;  2K5L A;  4OMF B;  4FSS A;  1BIB A;  2KSS A;  2COW A;  5GAN d;  1PM3 A;  2IPO B;  3IQL A;  5KYY B;  2DEQ A;  1SHG A;  2LNH B;  4OGC A;  4ZGE B;  2RJD A;  3QPH A;  2PU9 B;  2O2O A;  1PG5 B;  4O6J A;  1QP2 A;  3HRS A;  4X9C A;  1JJ2 S;  2CP6 A;  3QBY A;  1MHN A;  5A2Q E;  2XU8 A;  1YWO A;  4FIB A;  3S6W A;  4J9G A;  1JRI A;  1PCX A;  5CKD A;  5KCO A;  1Y71 A;  1AWO A;  1BU1 A;  4HCC A;  1VQ7 A;  2K3B A;  3M9Q A;  1D09 B;  5GAO m;  3PVL A;  4LDY A;  1N8R U;  1SEM A;  4V2S A;  4A4H A;  3UDC A;  1Q81 R;  2GQI A;  3OYG A;  3QXE B;  1K9M R;  1K76 A;  4M77 B;  1K8A U;  3M53 A;  5IAY A;  1ZLM A;  5CQX A;  2DVJ A;  2FEI A;  2HQX A;  2ROT A;  2E65 A;  1GCQ A;  3NFC A;  5GAN 7;  3CCV T;  4RCB A;  5CK9 A;  1H92 A;  2CZ6 B;  4N0A A;  4L6V 5;  1KSW A;  3M0Q A;  3SWN A;  5LJ3 e;  3VS6 A;  4NL2 A;  2X3W D;  5CCA A;  1FYN A;  1WI7 A;  5FW9 A;  4E7S A;  3CMA Q;  3H41 A;  3EGU A;  3PNW C;  4QQD A;  3HKS A;  5FRM A;  3NTH A;  2JVV A;  4LUD A;  1AZG B;  3J7A F;  2DXU A;  3M54 A;  3GNG A;  2NUP A;  2X9H A;  5A0D A;  4TVR A;  3I55 Q;  3X26 B;  2DX1 A;  1QVF A;  3TSW A;  5LJ5 d;  2E5K A;  2HQE A;  1UGP B;  1M9S A;  4Z02 A;  3CXC S;  2FO0 A;  2MK5 A;  4M78 F;  1QVG S;  2KI7 A;  1G5V A;  1VQ9 T;  4C92 C;  1PKS A;  1U1S A;  2R57 A;  4QVD A;  4PL6 A;  5GAM e;  2H8H A;  1KJW A;  4XQ3 A;  1NZ9 A;  1B7T A;  1K0S A;  5FU6 B;  4WTO B;  1VQ6 A;  1KHI A;  1OPL A;  4C5H A;  5FRN A;  1TUC A;  1MMA A;  2EYY A;  4M78 C;  4XTY A;  4JRI A;  2JUF A;  4C8Q B;  1LNX A;  3OS2 A;  3CXC P;  3CCQ Q;  2D1X A;  1QVG P;  3CCE A;  2K79 A;  2RA2 A;  4DQ2 A;  1BIA A;  3G71 T;  4AFQ C;  2RHZ A;  2RNA A;  5C0M A;  1BCO A;  4VUB A;  2RJF A;  3ULR B;  2CP2 A;  1N9R A;  4BI4 A;  5ECA A;  2OI3 A;  4JZ4 A;  1KC8 U;  2D8J A;  1ACM B;  4A54 A;  1KQ2 A;  1AWJ A;  2I0N A;  3GP8 A;  5KE3 A;  1M2O A;  2JS2 A;  2EYW A;  2Y90 A;  1Y57 A;  5GAO n;  4EMK C;  5CKH A;  2NLU A;  2KMT A;  4RG2 A;  2NUZ A;  5KYW B;  1J3T A;  1ABQ A;  5FU7 C;  2DPP B;  5GAN f;  1Y96 B;  4M75 D;  3CCJ T;  1Z9Q A;  5I21 A;  4E7Z A;  3LGF A;  4DEY A;  2FPD A;  3ME9 A;  4C5I A;  1YJN A;  4ELY C;  3GF5 A;  2P4R A;  1ARK A;  3WXM B;  1AHJ B;  2HBW A;  1KIK A;  2EBP A;  2LX9 A;  4XK8 E;  1Q7Y U;  1AOJ A;  2JTF A;  1VQ5 T;  2XI9 A;  2EYZ A;  2DXC A;  3MET A;  2MWP A;  5DLO A;  3OB9 A;  4KT0 E;  2K6D A;  4HCK A;  5GAO l;  3OA6 A;  1PKT A;  3FJ5 A;  2AKK A;  2HNI A;  5CAI A;  3HP9 A;  1OU9 A;  1AZE A;  2VKN A;  4FSX A;  4BE0 A;  4HCZ A;  2AZV A;  5D6X A;  2F2X A;  2RN8 A;  1YBY A;  5KH6 A;  2GCX A;  4AFU C;  1UJY A;  3WVD B;  4BB7 A;  3EFO B;  3L2W A;  4JJB A;  1W2B A;  4J9F A;  4ME7 A;  1HSQ A;  1TH7 A;  1NJI R;  4J9E A;  3A8O B;  3VS2 A;  4FW1 A;  4ZNX A;  5GMK h;  1BI3 A;  1CKB A;  1PNJ A;  4M7D E;  1X27 A;  2LCS A;  2P0K A;  2FRY A;  2HQH A;  3MJX A;  3VYH B;  1WHH A;  2FYK A;  1S72 A;  1N8R R;  3OYD A;  4M7D G;  2J05 A;  2DTI A;  1FXX A;  3I35 A;  2MYS A;  4C8Q E;  3VYG A;  1K8A R;  1C1A A;  3G4S A;  2V8K A;  4Q5W A;  5LJ5 f;  4B6M A;  5GAN 2;  4EIK A;  1VQK A;  2OTJ T;  1WQW A;  1QWE A;  1UEC A;  4MML A;  3C95 A;  2X4Y A;  4C8Q G;  1OUL A;  3VRY A;  3F70 A;  2DVE A;  4F17 A;  2O4X A;  3CD6 Q;  1M90 C;  1UJ0 A;  3CCL Q;  2BZY A;  2SEM A;  2F69 A;  4ZGD B;  1VQN Q;  2X35 A;  3OYL A;  1UB4 A;  1FWZ A;  5GAO r;  5GAN j;  2EAY A;  4JDS A;  2LDM A;  2NUT A;  1C6V X;  2MOX A;  3OYB A;  1VQO T;  2X51 A;  4HT9 A;  1GL5 A;  1YHQ A;  3LH5 A;  3I56 Q;  3OYF A;  2QXF A;  2OTL T;  2HMA A;  4PJJ A;  1SF9 A;  2F2W A;  4HKE A;  4R56 A;  2DIQ A;  4FYX B;  1Z9Z A;  5HK3 A;  3OS1 A;  1M1K C;  4IUQ A;  3JB9 G;  2LC4 A;  1I1J A;  4RTT A;  1YCY A;  3E1S A;  1VQ9 A;  4BE2 A;  1RAC B;  2EFI A;  2VXF A;  2DF6 A;  4EPC A;  1WDX A;  1WGS A;  2DZ9 A;  2DL3 A;  1WFW A;  2ZPF B;  2P0Q A;  5D6W A;  3JCM Q;  3EG9 A;  2DXT A;  4OP0 A;  4KRT A;  1FMV A;  4M7D F;  3OYE A;  2FVU A;  4JUV A;  4M7D A;  2E6Z A;  3CC2 Q;  2D0N A;  1I81 A;  2ABL A;  2M02 A;  1H64 1;  2XID A;  2DBM A;  1VA7 A;  1MMG A;  1TSF A;  4BD3 A;  4BDY A;  3VRZ A;  2MI6 A;  2W0Z A;  1N6A A;  2RI5 A;  4OGE A;  1ZA2 B;  2CSI A;  1VQ7 T;  4C8Q A;  1KQ1 A;  2LQN A;  4D6W A;  1M8V A;  2EGC A;  4XTZ A;  2O9V A;  3VS7 A;  2HAX A;  4HT8 A;  1ZBJ A;  4M77 D;  4F04 B;  4C5G A;  1TUG B;  2FHD A;  3THK A;  1X6G A;  1D1C A;  2CKK A;  4FYV B;  3SWN B;  1KC8 R;  1KQS S;  2P84 A;  2LCC A;  2PVG B;  2JW4 A;  3VS3 A;  3FIF A;  3UA7 A;  2DIG A;  2VAS A;  4NL3 A;  1D0X A;  1QLY A;  3P8B B;  3JB9 F;  1WYX A;  3D7S B;  3EG0 A;  1SRM A;  5LJ5 j;  2JMA A;  3OSS C;  1YIJ Q;  2L3S A;  2L3P A;  3CC7 A;  2L3Q A;  5KYW A;  1X2Q A;  1KQS P;  4MZP A;  2PQW A;  3CC4 Q;  5IHK A;  4E6R A;  4PJO E;  2HKQ B;  3RMS A;  1Y96 A;  4M78 B;  3MEW A;  4C0D C;  1E6H A;  4C0Z A;  2PZ1 A;  3RKY A;  7AT1 B;  1BKB A;  2RD1 A;  2YT6 A;  4XU1 A;  3VV0 A;  3EGX B;  2WSC E;  3JSC A;  4PJO G;  1UDL A;  3LYI A;  2QK0 A;  5CKB A;  1RLP C;  5AT1 B;  4ZTF A;  1SKU B;  4PFZ A;  4M7D D;  1VQ8 Q;  1W2B P;  3DLM A;  2O31 A;  4QVC A;  4KH0 B;  1RL2 A;  1YJW Q;  1G3S A;  2V8I A;  1U8R A;  5GAN e;  1X6B A;  1WZO A;  1TG0 A;  2ESW A;  2BIV A;  4A63 B;  1UGQ B;  2KE9 A;  1KG1 A;  1VQ6 T;  2LT1 A;  4C8Q D;  1SHF A;  1YNZ A;  2QGG A;  3FDR A;  3V7R A;  5D6Y A;  4QVZ A;  2YRD A;  2E12 A;  3CCE T;  2QA4 T;  2YRV A;  2J6O A;  2D0Q B;  1VQL A;  2HKN A;  4XU2 A;  4JRQ A;  1MND A;  1SSH A;  2DXB A;  4Z8A A;  1X69 A;  1N5Z A;  4RKU E;  2EQK A;  4FL6 A;  1GFC A;  2MAM A;  2L2P A;  5GMK e;  1Y07 A;  2EW3 A;  4JRK A;  2GNC A;  3LGL A;  3AT1 B;  4J9B A;  3V7C A;  1NE8 A;  1OI1 A;  4IIM A;  2R5A A;  2OTJ A;  3G6E Q;  1Q82 C;  4RMO A;  4PJO F;  4PJO A;  1M3C A;  2CGH A;  1JEG A;  3L1A A;  3S3O A;  1RAF B;  3A5Z B;  3HL8 A;  5KE2 A;  3JCM J;  3FRN A;  3MKD A;  4J9H A;  3HRU A;  2Z0W A;  4DBQ A;  3RR6 A;  3INZ A;  4QQ6 A;  1VQ4 Q;  3X28 B;  1X6O A;  1YJN T;  1OU8 A;  1R0C B;  4QQG A;  5GMK m;  2KAF A;  3RES A;  1I07 A;  3G7Z A;  2AK5 A;  1BI2 A;  3CCS A;  1QVF S;  1AEY A;  4PJN A;  3P8H A;  1WHM A;  4NOY A;  3RKX A;  5LJ5 e;  4Y91 A;  1UGR B;  1DJ7 B;  1XOV A;  2KQW A;  2LCL A;  2JZ2 A;  2COZ A;  2E3H A;  1M4Z A;  1T0J A;  3REB B;  3FEO A;  3OSV A;  1Q86 C;  2QDY B;  4M78 E;  2PVD B;  5DY9 A;  3CBM A;  2DMO A;  1NJI U;  2YDL A;  1QVF P;  2EQI A;  4KUI A;  1UTI A;  2E41 A;  2FPF A;  3VS5 A;  3MHX A;  2IVW A;  4M78 G;  3V8L A;  3BE3 A;  1HK9 A;  3PT9 A;  1GXI E;  3CPF A;  2JN0 A;  2R5M A;  3MO8 A;  1M2V B;  4PFO A;  5FWB A;  2FL7 A;  1X01 A;  3CBO A;  1IHW A;  1S72 T;  1JJ2 P;  2ECZ A;  2ATC B;  4BY6 C;  1VQP A;  4NS5 A;  5GMK i;  2ENM A;  2J7I A;  1UEB A;  2JXB A;  2O4X B;  4PK4 A;  1VQM A;  3H9N A;  3HTR A;  1D0Y A;  3CCV Q;  3G4S T;  1K73 U;  5IXB A;  4GLM A;  1VQK T;  2HD0 A;  4P5N A;  1UG1 A;  3G1J A;  3M58 A;  4FYW B;  4HVU A;  1I4K 1;  3L2U A;  2NUT B;  4RUG A;  2QYZ A;  1SRL A;  4WCI A;  4N4H A;  4CI0 C;  1IRX A;  2XDD A;  4OB3 B;  2E5Q A;  2HEQ A;  2LVM A;  2X4W A;  4C92 F;  2QTV A;  3OYJ A;  9ATC B;  2JTM A;  3CCU A;  4OVA A;  1TTH B;  4J9I A;  3JV3 A;  3H0I A;  1YHQ T;  1PSF A;  3CCR A;  1YI2 A;  3M5A A;  1QW1 A;  3C0C A;  3HPW A;  3EG9 B;  4RCC A;  4M78 A;  1VQ9 Q;  5GAN 6;  4HVV A;  2VVK A;  4M7D B;  2DRK A;  1LCK A;  2DFU A;  4ZN3 A;  1PC0 A;  2AKL A;  2OX7 A;  3EGX A;  3RDV A;  1B3Q A;  2EKH A;  3QDF A;  1QKX A;  1R0B G;  4BI3 A;  2B86 A;  3EHQ A;  5CO7 A;  4LD6 A;  2DEU A;  4N4G A;  5DLQ E;  4QT7 A;  2E1H A;  2DIL A;  4J6Y A;  2ZPI B;  2RQW A;  2KY9 A;  2QA4 A;  2K5I A;  1BI1 A;  3UAT A;  2XK0 A;  1OX9 A;  4M75 C;  1WXB A;  2FG0 A;  3NTK A;  3CME A;  3G71 Q;  3X24 B;  1GFD A;  4XU0 A;  2VUB A;  4OB0 B;  4EMK A;  4ZN1 A;  4FCY A;  3UT1 A;  3M55 A;  3GOX A;  4MMK A;  3ZL7 C;  2QEX A;  4M7A F;  2RB6 A;  2VYT A;  3DB4 A;  3OQ5 A;  1OQK A;  4J83 A;  2M9U A;  1UGV A;  1GBR A;  5GMK l;  3HFO A;  4UC4 A;  3J81 E;  1N9S A;  4J6W A;  3EGD B;  4M7A C;  1YJ9 A;  4M4Z A;  4MZT A;  3EG1 A;  4XTU A;  1OZ2 A;  1KFZ A;  3C94 A;  3QJY A;  3CCJ Q;  4RTY A;  1B07 A;  4ATO A;  2A08 A;  8AT1 B;  2KT1 A;  1Q86 U;  3CC7 T;  3VKI A;  4M78 D;  2ZAE A;  2RI3 A;  1D3B A;  3VU3 C;  2XHC A;  1I5L A;  5IN1 A;  2F2V A;  1VQ5 Q;  1QWF A;  3P8D A;  2Y4Y A;  3OBW A;  3PGG A;  2FZC B;  1Q81 C;  4RTU A;  1K9M C;  2JM8 A;  1G83 A;  3V8J A;  3MCA B;  1PSE A;  4OMM A;  4R55 A;  4J7I A;  1NLP C;  3E19 A;  2RF0 A;  1G3T A;  3L2Q A;  2EWN A;  2C0I A;  3MPU B;  1HXD A;  1YIT A;  1KD1 C;  4EMG A;  1NEB A;  1WPY A;  3OYI A;  1HYO A;  1MNE A;  4A53 A;  1E7O A;  3V8K A;  3QII A;  3EAE A;  1D1A A;  1ZUU A;  3TCJ A;  2RHU A;  2FZK B;  5FLX E;  3M0P A;  1A0N B;  4J6X A;  3RIR A;  3NMZ C;  6AT1 B;  4IIO A;  3PE0 A;  4LUE A;  1D0Z A;  1NM7 A;  1OX8 A;  4FT2 A;  1VQL T;  3M4G A;  3UPU A;  4ZGJ B;  1V76 A;  2AZS A;  3HFN A;  3KBG A;  2EGE A;  2HL5 C;  1ZSZ C;  2DYI A;  3OYA A;  1PHT A;  2M0Y A;  5GAN 5;  4DEX A;  3M0U A;  1QCF A;  4PJO B;  4CRI A;  2IIM A;  1OZ3 A;  1M2V A;  2LT4 A;  3JCM V;  2CUD A;  1PWT A;  4JJC A;  4PKC C;  2AHJ B;  2OTJ Q;  2CZ1 B;  2KRN A;  2DM1 A;  2SRC A;  3JCM W;  2BE9 B;  4E47 A;  2KDS A;  1K73 R;  2LQW A;  4Y92 A;  4DOV A;  2DJQ A;  1H8K A;  3EH1 A;  1QQJ A;  1W70 A;  1QVP A;  3QHS A;  1M3A A;  2EQM A;  4PLI A;  3NTI A;  5KYU A;  2VXE A;  2RQV A;  4F7U E;  1RUW A;  2K57 A;  2OAW A;  1AVZ C;  1UE9 A;  2LJ1 A;  2M51 A;  2JT4 A;  1PD1 A;  1VQO Q;  2CT3 A;  3H0F A;  4O5V A;  4L59 A;  2C0T A;  2OTL Q;  3CMA A;  4F7U G;  4X1V A;  2J06 A;  4BAC A;  4MDW A;  3VS0 A;  4LNP A;  5I22 A;  2EJG A;  4QW2 A;  3CCS T;  2L89 A;  1QP3 A;  4BE1 A;  3U23 A;  2JJ9 A;  3KUF A;  3I55 A;  2VGM A;  3PIP A;  2VWF A;  2O9S A;  4M77 C;  4KUD K;  2L8D A;  1WHG A;  2E10 A;  2C0O A;  4RTZ A;  2DRM A;  3PVQ A;  2DKG A;  2V1R A;  1K0X A;  2RHX A;  4HXJ A;  4KUL A;  2HSE B;  4JLI A;  2L3R A;  2A7Y A;  5GMK j;  1Y7X A;  8ATC B;  3JCM b;  4KGZ B;  1IGU A;  3E2U A;  4RG8 A;  3J80 E;  3H0H A;  1XQH A;  1ZHI A;  3M56 A;  3GNF B;  2CH4 A;  1M8M A;  1Q82 R;  1JXM A;  3VUZ A;  2HL3 A;  3OYY A;  3QDR B;  3CPW A;  1VQ7 Q;  3KXT A;  3JAM E;  3CCQ A;  4JPB W;  3PMT A;  2CYZ B;  2DE0 X;  3NGP A;  3RKW A;  2PVO B;  3N5B B;  5C6S A;  3UWN A;  1K9A A;  4DOW A;  3L2R A;  1WJQ A;  2YLB A;  5J39 A;  2MF2 A;  1VQP T;  3TRE A;  2RQR A;  2JOY A;  4FYY B;  3KFV A;  4ZTJ A;  1IHV A;  2GFA A;  4LDV A;  1VQM T;  4F7U F;  5HCK A;  4F7U A;  1BI0 A;  4PLL A;  1NLO C;  2NWM A;  5GJV B;  4C92 B;  3SFM A;  2BE7 D;  3C12 A;  3FLG A;  5FU6 C;  2DL7 A;  3PMI A;  2DBK A;  4A4F A;  3R6N A;  2E3I A;  2P4T A;  3HSB A;  4ORZ A;  5J3B A;  3EGD A;  2K2V A;  1Q86 R;  4ESR A;  2DAQ A;  1G2B A;  1R77 A;  3CCU T;  4IUT A;  1W4S A;  1SSF A;  2QQS A;  3EHR A;  3TU4 K;  3RNJ A;  3CCR T;  1YI2 T;  2XDP A;  4PJM A;  4KBM B;  2CUB A;  2X3X D;  1WHK A;  3A1P A;  4J8O A;  1K8A C;  2VGN A;  4WF2 A;  2DET A;  5GAM h;  1K4U S;  1HJD A;  2KVQ G;  1VQ6 Q;  4XTW A;  4J9D A;  1T0H A;  3CEY A;  1WXU A;  1NG2 A;  2YRC A;  5CIU A;  4EMK B;  1ZBX A;  4A4E A;  4OMO A;  1AD5 A;  3CCE Q;  3OMC A;  2QA4 Q;  5FU7 B;  3VJP A;  2RM4 A;  3PTA A;  3HHT B;  4M7A B;  4Y28 E;  2FZG B;  3JCM d;  3A8L B;  5KYX A;  2RQU A;  1M90 U;  1IGQ A;  2EGA A;  3CME T;  4JLG A;  1NPR A;  1WNL A;  1RAE B;  3JB9 D;  5CKF A;  4KH1 B;  3NPF A;  2G6F X;  2QEX T;  5GAN 4;  1B34 A;  2JMC A;  5GAN 8;  1U1T A;  1M1K U;  4E7I A;  2GGR A;  3EG3 A;  2MCN A;  4X9D A;  5D7U A;  1I0C A;  2CP7 A;  1WXT A;  3QWX X;  1D1B A;  2BTT A;  1TOV A;  1D3B B;  1RI9 A;  3S3N A;  5J26 A;  3C4S A;  4A4G A;  3OW2 A;  1YJ9 T;  3EFS A;  3PIO A;  3CCM T;  1U5S A;  1WJR A;  2ZCF B;  3A98 A;  2VC8 A;  3SD4 A;  2L0A A;  1WHL A;  2XD0 A;  4GY5 A;  2DTO A;  1YP5 A;  4LDW A;  2I2L A;  2LQ8 A;  3OY9 A;  1YJN Q;  3T9N A;  5IT9 E;  4IUV A;  3QZ9 B;  2L5Q A;  3JRZ A;  3A8G B;  3CCL A;  2JM9 A;  3I5R A; 
#chains in the Genus database with same CATH homology
 1BI3 A;  4B9X A;  1KD1 U;  2EIF A;  4M7D E;  1VQN A;  5LJ3 h;  3DB3 A;  5KCH A;  4X34 A;  3OW2 S;  1NPP A;  2MMP A;  4C92 E;  4N4G A;  1NJI C;  5DLQ E;  2H3J A;  1JBM A;  4C8Q C;  2P0K A;  1KC8 C;  3VYH B;  2E1H A;  3E9G A;  2FYK A;  4BUG A;  5GAM f;  1S72 A;  4J6Y A;  2ZPI B;  3QG1 A;  3WVE B;  5A0L A;  3OYD A;  3I56 A;  4MDX A;  2KY9 A;  3OYK A;  2QA4 A;  2K5I A;  1BI1 A;  4M7D G;  2GQV A;  2K5F A;  2G3R A;  2DTI A;  4C92 G;  2XK0 A;  3L2V A;  3SB2 A;  1YIT T;  3CBP A;  1FXX A;  4EDU A;  5M9O A;  3LWI A;  4IKF A;  4M75 C;  2DO3 A;  3CCJ A;  4C8Q E;  3VYG A;  1N8R C;  3LW5 E;  3NTK A;  3CME A;  1YIJ T;  1W2B S;  3MEA A;  3X24 B;  4M75 B;  4XU0 A;  2V8K A;  3G4S A;  4Q5W A;  2VUB A;  5LJ5 f;  4OB0 B;  4JS5 A;  3CC4 T;  4EMK A;  4ZN1 A;  1O75 A;  5GAN 2;  2E64 A;  3DKM A;  1VQK A;  2RJE A;  2OTJ T;  2EJF A;  3UT1 A;  3M55 A;  1WQW A;  3GOX A;  4MML A;  3C95 A;  2X4Y A;  3LX7 A;  4C8Q G;  4MMK A;  4M7A F;  2QEX A;  2RB6 A;  4M75 E;  2VYT A;  3A8M B;  3SDZ A;  3DB4 A;  3OQ5 A;  3F70 A;  5GAM g;  2DVE A;  2EQU A;  4J83 A;  1VQ5 A;  2M9U A;  2O4X A;  5HK0 A;  1M90 C;  3URG A;  2QI2 A;  3GPL A;  5HY6 A;  2F69 A;  1WJS A;  4ZGD B;  1K73 C;  3QUI A;  2X35 A;  3CC2 A;  3OYL A;  1UB4 A;  4L5G A;  1FWZ A;  3TEE A;  5GMK l;  2IG0 A;  2ZPG B;  2RJC A;  5GAO r;  4M75 G;  1VQ8 T;  2DD5 A;  5GAN j;  2EAY A;  2DK3 A;  2ZGW A;  2LDM A;  3HFO A;  1N9S A;  4JDS A;  4UC4 A;  2R58 A;  5LJ5 g;  3ZBD A;  3J81 E;  3OYB A;  1VQO T;  1YJW T;  4HT9 A;  2DTH A;  4J6W A;  1YHQ A;  2LQK A;  1Q7Y C;  4PJO D;  3RUX A;  3OYF A;  3FC3 A;  2QXF A;  2OTL T;  2ZZD A;  1YJ9 A;  4M7A C;  4MZT A;  4XTV A;  4HKE A;  4R56 A;  2DIQ A;  5HK3 A;  4XTU A;  3LH0 A;  3OS1 A;  1OZ2 A;  3BFM A;  4IUQ A;  3EFR A;  3JB9 G;  1M1K C;  3C94 A;  4J7F A;  2LC4 A;  3QJY A;  1YCY A;  4ATO A;  3E1S A;  1VQ9 A;  4BE2 A;  1Q86 U;  3CC7 T;  3QSU A;  2EFI A;  3VKI A;  2VXF A;  4M78 D;  3LLR A;  2RI3 A;  4EPC A;  4IUR A;  1D3B A;  1WGS A;  2DZ9 A;  3MP8 A;  3VU3 C;  5I2M A;  5A0G A;  4M7A E;  3X20 B;  2E6N A;  3QO3 A;  2ZPF B;  1I8F A;  2XHC A;  4XU3 A;  1I5L A;  2M16 A;  2WSF E;  2F5K A;  3MEU A;  2P0Q A;  3OBY A;  5IN1 A;  5HKC A;  5D6W A;  4ELZ C;  3JCM Q;  2DXT A;  2EQJ A;  3P8D A;  2Y4Y A;  3OBW A;  3PGG A;  4OP0 A;  4B9W A;  1Q81 C;  3QJ6 A;  4M7D F;  3OYE A;  2FVU A;  1K9M C;  4JUV A;  4M7A G;  4M7D A;  2EKO A;  5CKE A;  2EJ9 A;  1KD1 C;  3PFS A;  3MCA B;  1PSE A;  3M59 A;  3V8J A;  2E6Z A;  5LJ3 j;  4C92 A;  3JCM P;  3H8Z A;  3CCL A;  4R55 A;  4J7I A;  4C0F A;  1I81 A;  4E7H A;  2WAC A;  3E19 A;  1H64 1;  2XID A;  1G3T A;  1P92 A;  4PNO A;  4XTX A;  3ZEH A;  2K3Y A;  3L2Q A;  2EWN A;  2XKO C;  1HXD A;  1X75 C;  1ZQ1 A;  2GF7 A;  2RHI A;  2CZ0 B;  3E9F A;  4BD3 A;  4EMG A;  4BDY A;  2MI6 A;  1KQS A;  1N6A A;  2RI5 A;  1KHC A;  4OGE A;  3OYN A;  2QQB A;  1WPY A;  2GFU A;  3OYI A;  1YIJ A;  3CMA T;  4A53 A;  1N27 A;  3A8H B;  1G3Y A;  3V8K A;  5DM7 R;  1VQ7 T;  3QII A;  3CC4 A;  4C8Q A;  1KQ1 A;  3EAE A;  4JRP A;  4D6W A;  1M8V A;  3JCM f;  3OS0 A;  3TCJ A;  2M0O A;  3G6E T;  2RK2 A;  2RHU A;  2QQA A;  4XTZ A;  4N0A C;  5FLX E;  3I55 T;  2QTX A;  3FJP A;  2HAX A;  4HT8 A;  4M77 D;  4N4I A;  3SWN C;  4J6X A;  4C5G A;  3L42 A;  1LOJ A;  2FHD A;  3RIR A;  3CD6 A;  2CKK A;  2RK1 A;  4M75 F;  3SWN B;  5LJ3 g;  4E7L A;  4M75 A;  3JCM X;  4HA8 A;  1KQS S;  5CR2 A;  2LCC A;  2PVG B;  4FT2 A;  2V8J A;  1VIE A;  3FIF A;  1VQL T;  3M4G A;  3UPU A;  4ZGJ B;  3HFN A;  5GAM j;  2RHY A;  3KBG A;  1VQ8 A;  3OYA A;  2DIG A;  3OYC A;  4NL3 A;  1VQ4 T;  1VQO A;  3P8B B;  1YJW A;  5GAN 5;  3JB9 F;  4HCB A;  3R6O A;  2C06 A;  4PJO C;  2CS7 A;  3ER0 A;  1Q82 U;  2OTL A;  3ASK A;  1G3W A;  4OF1 A;  4GLK A;  3JCM h;  4CRI A;  4PJO B;  2PUO B;  1OZ3 A;  2D6F A;  1XNI A;  1M1F A;  5EG2 A;  4C0G A;  5LJ5 j;  2XG8 D;  2LT4 A;  3OSS C;  3JCM V;  2ZPH B;  4JJN K;  3CC7 A;  1JJ2 A;  1V29 B;  2K5L A;  4PKC C;  4MZP A;  2PQW A;  4OMF B;  1BIB A;  2AHJ B;  2KSS A;  2XDB A;  3GIB A;  4PJO E;  4E7J A;  5GAN d;  2CZ1 B;  3RMS A;  3CCQ T;  1Y96 A;  4M78 B;  2O01 E;  3MEW A;  4C0D C;  3JCM W;  4C0Z A;  4C5E A;  4E47 A;  2DEQ A;  2KDS A;  4F7U B;  4DOV A;  3RER A;  1EIF A;  4OGC A;  3RKY A;  4ZGE B;  4C0D B;  1BKB A;  2RD1 A;  4M7A A;  4XU1 A;  1QVP A;  2RJD A;  3VV0 A;  3QHS A;  2EQM A;  1JB0 E;  2WSC E;  3JSC A;  3QPH A;  3V7S A;  3VUB A;  4PJO G;  3LYI A;  2PU9 B;  4PLI A;  3NTI A;  2YLC A;  4O6J A;  1QP2 A;  2CZ7 B;  2EYQ A;  2VXE A;  3BW1 A;  3HRS A;  5CKB A;  4F7U E;  4ZTF A;  2K57 A;  4M7D D;  4X9C A;  1JJ2 S;  3DLM A;  3QBY A;  4C92 D;  2D9T A;  1MHN A;  2XIC A;  4QVC A;  3QZ5 B;  5A2Q E;  3MP1 A;  1RL2 A;  2XU8 A;  4FIB A;  2ZPB B;  4O5V A;  3RMQ A;  1G3S A;  5GAO q;  2V8I A;  4L59 A;  3S6W A;  1U8R A;  1JRI A;  2DJZ A;  5GAN e;  3CMA A;  4F7U G;  5CKD A;  1MGQ A;  5KCO A;  3CCM A;  1Y71 A;  4BAC A;  4MDW A;  1XTD A;  2BIV A;  4HCC A;  1VQ7 A;  2EJG A;  3M9Q A;  1UGQ B;  5GAO m;  1KG1 A;  4QW2 A;  3CCS T;  1VQ6 T;  2L89 A;  4LDY A;  3G6E A;  5LJ3 d;  1N8R U;  2LT1 A;  1QP3 A;  2QQR A;  3BY7 A;  4C8Q D;  4BE1 A;  4V2S A;  3FDR A;  3KUF A;  4A4K A;  3I55 A;  3V7R A;  2VGM A;  3PIP A;  5D6Y A;  4A4H A;  4QVZ A;  3UDC A;  4KUD K;  4M77 C;  4BI8 B;  2L8D A;  3OYG A;  3QXE B;  2E10 A;  2E12 A;  3CCE T;  2QA4 T;  4M77 B;  2DKG A;  2YHT A;  2DD4 A;  1K8A U;  2RHX A;  2YRV A;  3M53 A;  3GLX A;  5IAY A;  2D0Q B;  1M5Q 1;  1VQL A;  4FU6 A;  2X4X A;  4JRQ A;  2ZPE B;  4KUL A;  4XU2 A;  5CQX A;  4JLI A;  2HQX A;  2L3R A;  2A7Y A;  2E65 A;  5GMK j;  2DXB A;  1Y7X A;  1VQ4 A;  3O8V A;  3NFC A;  5GAN 7;  3MP6 A;  3JCM b;  4M77 E;  4RKU E;  3CCV T;  4RCB A;  2EQK A;  4FL6 A;  5CK9 A;  2CZ6 B;  4RG8 A;  3J80 E;  4N0A A;  2MAM A;  5GMK e;  1Y07 A;  4L6V 5;  3SWN A;  4IUP A;  5LJ3 e;  1XQH A;  3QYH B;  1ZHI A;  3M56 A;  3GNF B;  4JRK A;  4NL2 A;  5CCA A;  3LGL A;  3BDL A;  2BUD A;  3CXC A;  3VUZ A;  1R8O B;  3OYY A;  4M77 G;  1QVG A;  3V7C A;  3PNW C;  4QQD A;  3QDR B;  3CPW A;  3HKS A;  1NE8 A;  5AYF A;  5GAN h;  1OI1 A;  5FRM A;  3NTH A;  3ZFJ A;  5GAM d;  2JVV A;  3KXT A;  2FB7 A;  2R5A A;  2OTJ A;  3JAM E;  3CCQ A;  3J7A F;  2DXU A;  3M54 A;  3GNG A;  3OYM A;  1Q82 C;  4LD9 K;  3PMT A;  3FB9 A;  1YIT A;  2CYZ B;  4RMO A;  4PJO F;  5A0D A;  4PJO A;  4TVR A;  3RKW A;  2PVO B;  3N5B B;  2CGH A;  5C6S A;  2X4J A;  3L1A A;  3S3O A;  3UWN A;  4IUU A;  3X26 B;  4DOW A;  3L2R A;  3A5Z B;  1WJQ A;  2YLB A;  3HL8 A;  5KE2 A;  3JCM J;  4M7A D;  1QVF A;  3LWH A;  5J39 A;  2MF2 A;  5LJ5 d;  3FRN A;  2HQE A;  1UGP B;  1VQP T;  1M9S A;  3TRE A;  4Z02 A;  3HRU A;  2JOY A;  1B34 B;  3CXC S;  1VIF A;  4M78 F;  4ZTJ A;  3OMG A;  1QVG S;  2GFA A;  4FT4 A;  4LDV A;  4BDZ A;  3CPW S;  1VQM T;  2K3X A;  3INZ A;  4F7U F;  4OB2 B;  1VQ9 T;  4F7U A;  1G5V A;  4QQ6 A;  4C92 C;  1IZ6 A;  3X28 B;  1BI0 A;  1U1S A;  2R57 A;  4PLL A;  1X6O A;  4QVD A;  4PL6 A;  1VUB A;  4C92 B;  5GAM e;  3SFM A;  3JCM g;  1YJN T;  2M1H A;  2LTO A;  3JB9 H;  3C12 A;  3FLG A;  4XQ3 A;  5L8R E;  5FU6 C;  1NZ9 A;  4QQG A;  5GMK m;  3M4Y A;  1FX7 A;  2KAF A;  3PMI A;  3RES A;  3S3M A;  5FU6 B;  3G7Z A;  2RI2 A;  5CQY A;  1BYM A;  1BI2 A;  1M1G A;  5FRO A;  4A4F A;  1KHI A;  3CCS A;  1QVF S;  1VQ6 A;  4C5H A;  3P8H A;  5FRN A;  1LJO A;  4NOY A;  3RKX A;  5LJ5 e;  4M78 C;  4Y91 A;  2P4T A;  4XTY A;  3HSB A;  4DA4 A;  1UGR B;  4JRI A;  2JUF A;  4C8Q B;  1LNX A;  1DJ7 B;  5J3B A;  1XOV A;  2KQW A;  3OS2 A;  2K2V A;  2JZ2 A;  2LCL A;  2DAQ A;  3CCE A;  1M4Z A;  3CCU T;  4IUT A;  1W4S A;  1SSF A;  2QQS A;  2RA2 A;  3FEO A;  4DQ2 A;  2BKD N;  3TU4 K;  3OSV A;  3X25 B;  1BIA A;  1Q86 C;  2QDY B;  4M78 E;  3CCR T;  1YI2 T;  3G71 T;  2PVD B;  5DY9 A;  2RHZ A;  3CCV A;  5LL6 S;  2XDP A;  5C0M A;  4VUB A;  3JCM c;  4FM4 B;  1O9S A;  2RJF A;  3CBM A;  1NJI U;  2RH2 A;  1N9R A;  2MWO A;  4BI4 A;  3BDU A;  4KBM B;  4M77 F;  4KUI A;  5CVI A;  4M77 A;  2E41 A;  3OYH A;  2E70 A;  1K8A C;  4J8O A;  1KC8 U;  3MHX A;  2IVW A;  4M78 G;  3V8L A;  3JB9 I;  2Y4X A;  4A54 A;  2VGN A;  1HK9 A;  1KQ2 A;  4XAX B;  3PT9 A;  4WF2 A;  3DLL A;  3GP8 A;  5GAM h;  3CPF A;  3CD6 T;  1GXI E;  2JN0 A;  4OB1 B;  3CCL T;  5KE3 A;  2R5M A;  1UGS B;  2KVQ G;  2JNG A;  1VQN T;  3MO8 A;  3HRT A;  2LRQ A;  1OYX A;  2Y90 A;  1WQ7 A;  4XTW A;  2DZC A;  3CEY A;  4EMK C;  2VV5 A;  5CKH A;  2NLU A;  5GAO n;  2KK4 A;  2FL7 A;  2KMT A;  4RG2 A;  1X01 A;  3CBO A;  5CIU A;  4EMK B;  1ZBX A;  5FU7 C;  4A4E A;  1H3Z A;  5LJ5 h;  1S72 T;  2DPP B;  2K4Y A;  5GAN f;  3I56 T;  1Y96 B;  3OMC A;  5FU7 B;  3VJP A;  2RM4 A;  4LD6 A;  4JS4 A;  4BY6 C;  1VQP A;  3PTA A;  1RI0 A;  3HHT B;  4NS5 A;  4M7A B;  4M75 D;  4Y28 E;  3JCM d;  3A8L B;  4BY6 B;  5GMK i;  3CCJ T;  2O4X B;  1UEB A;  5I21 A;  5GAN 3;  1VQM A;  1M90 U;  3CME T;  4JLG A;  3LGF A;  1NPR A;  3G4S T;  1K73 U;  1WNL A;  2F5T X;  3L2Z A;  3ME9 A;  4C5I A;  1YJN A;  4ELY C;  1VQK T;  2HD0 A;  2OAU A;  3GF5 A;  3Q1J A;  4P5N A;  5GAO p;  3M58 A;  3JB9 J;  3JB9 D;  3H6Z A;  5CKF A;  3WXM B;  1AHJ B;  1I4K 1;  3L2U A;  2QEX T;  2LX9 A;  5GAN 4;  1B34 A;  2RO0 A;  4II1 A;  4XK8 E;  1Q7Y U;  2JTF A;  1VQ5 T;  2HBP A;  5GAN g;  4N4H A;  3M57 A;  5GAN 8;  2XI9 A;  4CI0 C;  2XDD A;  2DXC A;  3MET A;  4E7K A;  1U1T A;  2E5Q A;  4OB3 B;  2LVM A;  2MWP A;  2X4W A;  1M1K U;  4E7I A;  3OS5 A;  5DLO A;  4C92 F;  3OB9 A;  4X9D A;  4KT0 E;  4YTL A;  3CC2 T;  3JCM e;  3OYJ A;  5I2S A;  4LDU A;  5GAO l;  2JTM A;  1IRE B;  2WSE E;  4J5Y A;  3OA6 A;  3CCU A;  4OVA A;  5LJ3 f;  4LDX A;  3MEV A;  2HNI A;  5CAI A;  1D3B B;  3HP9 A;  1YHQ T;  3S3N A;  5J26 A;  3C4S A;  4A4G A;  4FSX A;  4BE0 A;  3OW2 A;  1PSF A;  4HCZ A;  5D6X A;  4EMH A;  3CCR A;  1YJ9 T;  1YI2 A;  1YBY A;  3EFS A;  3PIO A;  3G71 A;  3CCM T;  3AHU A;  5KH6 A;  3M5A A;  2GCX A;  1QW1 A;  1WJR A;  3HPW A;  4C8Q F;  2ZCF B;  4RCC A;  4M78 A;  4M7D C;  3WVD B;  1Q81 U;  2VC8 A;  3SD4 A;  4BB7 A;  5GAN 6;  2A3L A;  2XD0 A;  1K9M U;  2QQ9 A;  4M7D B;  2B8A A;  4GY5 A;  2DTO A;  3QYG B;  3L2W A;  2I2L A;  4LDW A;  4ZN3 A;  1W2B A;  2LQ8 A;  4ME7 A;  3OY9 A;  1TH7 A;  3T9N A;  4MZM A;  5IT9 E;  4IUV A;  2LNV A;  3QKJ A;  3QZ9 B;  3A8O B;  2L5Q A;  3JRZ A;  4BI3 A;  3A8G B;  5CO7 A;  2P0P A;  2PUK B;  5GMK h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...