4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
4M75C 4XU3A 3L1AA 4C92A 5GAN5 3JCMb 5GAMj 4M7DF 1LJOA 4M75A 5LJ5h 1BIAA 4EMGA 5GAMd 3QO3A 3JCMg 2E1HA 2DKGA 5LJ3f 3V7SA 3V8KA 4A54A 2K57A 4C8QF 3SWNB 5GAOl 4PJOC 1WPYA 4F7UA 3JCMQ 5GMKh 3JB9H 5GAOn 4PJOA 5GAMg 1I5LA 1BIBA 2YLBA 4NL2A 4C92B 2E10A 4Y91A 4M75B 1X01A 4WF2A 5LJ3d 5I21A 4NL3A 1N9RA 2EAYA 4M78E 4XTVA 2VXEA 5LJ5e 2DTOA 3V7CA 4OP0A 4M7AE 4C92C 4M77G 4F7UB 5LJ3g 4J6XA 5GAOq 4PJOB 5DY9A 4EMHA 4C92D 1WQWA 4M77F 5GMKe 2QTXA 4M75D 3V8LA 4RCCA 5GMKi 4M78C 3SWNA 2E64A 4V2SA 1M5Q1 4J6WA 4N0AC 2Y90A 3JCMd 3SB2A 1HK9A 4M78A 4QVDA 5GANf 4PJOD 3HFOA 5GAOr 4M7AA 4M7AC 3FJPA 4JLIA 4XTXA 1D3BA 3VU3C 4M7DE 1YCYA 4XU1A 1KQ1A 4M75G 5GAN3 5GANj 3HSBA 2RD1A 3FIFA 5CAIA 5GAN8 4XTUA 4C8QE 5LJ5f 2CGHA 4HA8A 3BDUA 3BY7A 4M78B 4XQ3A 3JCMh 4EMKC 4F7UG 2EWNA 4MMLA 4M7AB 2FB7A 3JB9I 5LJ5j 3RESA 1D3BB 5GANg 2FYKA 2EJFA 2DZCA 3RKYA 5GMKl 5GAN4 2I2LA 1I4K1 5GAMh 3JB9F 4X9CA 4HT9A 4M7DC 5GMKj 4XU2A 4C8QC 4M78D 3JB9G 2E41A 4M7AD 3BFMA 4C8QA 1U1TA 4EMKB 3JCMe 4XTZA 4M77E 2DXUA 2VXFA 5LJ3h 3JCMX 3JB9J 3JCMV 1N9SA 2DTIA 3JCMW 2E65A 4J5YA 1H641 5GAMe 1I81A 3QSUA 4M7DB 3GIBA 2DXTA 3L2ZA 4N0AA 2HNIA 2RA2A 4C8QB 2YLCA 4C92G 4JRIA 3RKWA 5GAN7 4M7AG 5GAOm 1KQ2A 3EFRA 2RM4A 3QUIA 4M77C 2DTHA 4X9DA 2RB6A 2ZGWA 3V8JA 4C92F 5LJ3e 5GANd 4M75F 4M7AF 4M77A 4PNOA 2DZ9A 3JCMJ 1LOJA 4PJOG 3AHUA 1TH7A 2EJ9A 2YHTA 4C8QD 4EMKA 1LNXA 4F7UF 4A53A 3EFSA 4DQ2A 5LJ5d 1M8VA 4QVCA 4PJOF 1MGQA 4JRKA 3PGGA 4JUVA 4RCBA 3V7RA 3JCMP 5GANh 4M7DA 4M77B 4XTWA 2DEQA 4MMKA 2JN0A 5LJ5g 3FB9A 3HFNA 3RIRA 4C8QG 1WNLA 1Y96A 3RUXA 4XTYA 4M77D 3INZA 4M78G 4NOYA 5GANe 3JCMc 5LJ3j 4M78F 1I8FA 1Y96B 4XU0A 4HT8A 2EJGA 5GAN2 4C92E 1B34A 2DVEA 4M7DD 2DJZA 4M75E 3M4GA 3RERA 4J6YA 5GMKm 3JCMf 1WQ7A 1U1SA 5GAOp 4F7UE 5GAN6 3SWNC 1JRIA 4PJOE 1JBMA 1B34B 5GAMf 2VC8A 4M7DG 3RKXA 3QHSA 3BW1A 3JB9D 1HXDA
chains in the Genus database with same CATH superfamily
4M75C 2JVVA 2ZPBB 1BIAA 2ZPIB 5M9OA 3I56T 2MF2A 2DYBA 4PJOC 1WHKA 5GAMg 1N8RU 3QIIA 1NJIC 2XK0A 3CPWP 2O4XB 2MMPA 4M7AE 1YFNA 3EGXB 2DERA 2DILA 4M75D 1XJWB 4BI8B 2E64A 4V2SA 2AHJB 4M78A 4PJOD 1MMGA 1NE8A 3WXMB 1LPLA 2E5QA 3SFMA 2LNHB 4BB7A 5HK0A 1AEYA 2RJDA 4BACA 3TVTA 5KCHA 1VQ9Q 1BYMA 1YHQT 1GCQC 2DNUA 5GAN4 2A7YA 3CCUT 1QWFA 3MP6A 2COWA 2E41A 2X3XD 2MCNA 1MMDA 1WXUA 1WJSA 5LJ3h 3JB9J 3CCVA 2QAZA 2DTIA 2EGAA 4OMLA 1G8XA 1OYXA 5GJWB 2RHZA 4E7KA 5FU7B 3UDCA 3OQ5A 4KH1B 2RB6A 2KY9A 3FJ5A 4PJOG 4LD6A 4DQ2A 3G4SQ 1YJWT 2OTLA 2D0QB 4MMKA 2CP3A 3ZFJA 5I11A 3FRNA 1IB8A 2FL7A 3QPHA 2V8KA 5HCKA 5FWCA 3CMET 2X35A 1IREB 3I5RA 3MJXA 3QWYA 3UWNA 5IHNA 4M75E 2ZPGB 4C5IA 3CCEQ 1WQ7A 2RQTA 3I55Q 5A0GA 2COZA 4PJOE 1Q81R 4JJBA 1B34B 1Q7YU 3BW1A 1AWJA 2CUDA 3L1AA 2SRCA 1ZBJA 2J06A 1QMCA 2JZ2A 5AYFA 1I5OB 1YITT 3LGFA 3M4YA 1ARKA 5DY9A 1Q81C 3A5ZB 4KRTA 1JXMA 2FVUA 1AVZC 3LGLA 1VYTA 2EQIA 1ZUYA 2O4XA 1GBQA 1M30A 1K9MR 3VS3A 1JXOA 2FB7A 1SF9A 5KYUB 2MI6A 5GAMh 2A37A 2QEXT 3MP1A 2J6FA 2EW3A 2EKOA 1YJ9A 2KMTA 4XTZA 2B86A 1PG5B 4QT7A 2DXCA 1HD3A 5FWBA 2HNIA 1EIFA 3CD6Q 4EIKA 3EFRA 4GY5A 4M7AF 1OPKA 1IHWA 1PKTA 1VOMA 4HCZA 2FO0A 3CMAQ 2X4XA 4JUVA 2YWWA 5CK9A 2C0IA 3FB9A 3FC3A 2RH2A 2QDLA 3LW5E 5AT1B 2A0FB 3GF5A 3OYLA 2E3HA 1M2VB 4BI4A 4PL6A 1RACB 4RKUE 3M0RA 2ROLA 5GANe 3CC4A 1QCNA 2CREA 4FW2A 2DJZA 3RERA 1NZ9A 5IXBA 4HXJA 2K2MA 1ZA2B 3N5BB 1SHGA 5CIUA 1VQLQ 1YJNQ 4KUDK 3CCSA 3H6ZA 1BK2A 4MDXA 3OYIA 2HCKA 1MNEA 2M51A 1X6BA 4OB2B 2EAYA 2H3EB 4AFSC 4HCCA 2LJ1A 2BUDA 4Z8AA 4BE1A 3VRZA 2DL3A 3META 4J9GA 2CZ0B 5GAOr 4JLIA 1AZEA 4A4FA 1OV3A 5GAN8 5CAIA 1X43A 2KE9A 2JXBA 2JW4A 4IUUA 4F7UG 1T0HA 2EWNA 4LE9A 4M7DC 2K7AA 3CCSQ 3CBOA 1GL5A 3CCMT 2FZGB 2K4YA 2CZ7B 1UGQB 1QLYA 2E65A 1VYUA 1H641 4C5GA 1V1CA 4ZGEB 4N0AA 4JRQA 1NLPC 3UPUA 3OYGA 4AFZC 4F14A 4JS4A 2DTHA 1VQ5Q 2HKNA 4IURA 4F17A 1WLPB 3A8LB 2EGCA 2VASA 4NS5A 4AG1C 2XDPA 4C0ZA 2FZKB 3GP8A 3OMGA 1KC8R 4JRKA 4FYVB 5J39A 2E5KA 2L3QA 3MPUB 5CR2A 3HFNA 4OGEA 4C8QG 3M55A 2PVOB 1SSHA 1BI0A 3EG1A 2MYSA 3WVEB 3QDRB 1SEMA 3PNWC 3PIOA 5GJVB 3VKIA 2P0KA 3CCJA 2D8JA 2D1XA 1O75A 4D8DA 1PHTA 1Q95G 4M7DG 3OB9A 4BDZA 4XU3A 3HRTA 3HRSA 3V8KA 4A54A 1R8OB 2YLBA 4C92B 3M0PA 1X01A 2A28A 5LJ3d 3G1JA 5LJ5e 2KBTA 4F7UB 1B3QA 3LLRA 2QTXA 2RK2A 3VS7A 1GXIE 1TXQA 1KJWA 3GNGA 4B9XA 1G2BA 4F04B 3X24B 4M7DE 2RD1A 3FIFA 3CCJQ 2EPDA 2CGHA 2RQRA 2IPOB 2VYTA 2BZ8A 5GANg 2MK5A 2GNCA 3CCVT 3CCUQ 1M8MA 1VYVA 3GPLA 4ELYC 3TU4K 1S72T 1Y71A 1YIJT 3OBWA 5KYXA 2GF7A 4C8QB 2Z0WA 1RAFB 3M59A 1TTHB 3L2QA 1R0BG 4X9DA 3V8JA 5KYYA 2O31A 2OTLT 1RUWA 1BCMA 4X1VA 3AHUA 1YJWQ 3X28B 4L59A 3QWXX 1WIEA 3ZBDA 1MGQA 1BBZA 4C5EA 1D0XA 2VV5A 3M53A 1VQNT 4A4EA 2J6KA 1G5VA 1JEGA 2BE7D 3C0CA 1SHFA 3CMEQ 1WYXA 2MIOA 4JDSA 4NOYA 1VUBA 4JRPA 1Q82C 1VQ8Q 2DRMA 3EGDB 1WI7A 1I8FA 1Y96B 2EIFA 2RJEA 3LH5A 4LUDA 2HQXA 2RI2A 2G6FX 2DA9A 1RI9A 3OYYA 5KE2A 2GGRA 2H8HA 2MAMA 1QVFS 4JJDA 3JB9D 3I35A 1TUDA 2IIMA 2L8DA 5GAMd 3OSVA 2LMJA 3PIPA 2DLPA 1QVFP 4FSXA 4MZMA 1BI1A 1PRMC 1VQMA 2HL5C 2RF0A 1B07A 1N9RA 4XTVA 3V7CA 3TEEA 1OU9A 2QK0A 4N4GA 2JUFA 2QQBA 2YDLA 2DBMA 5FU6B 2ESWA 3JCMd 5IN1A 2DL5A 1AT1B 3CCRA 4QVDA 3BDLA 3HFOA 2F69A 1H8KA 1KQ1A 2ZCFB 3VV0A 1ZHIA 2LQ8A 2EQMA 4EPCA 4M78B 2V8JA 3JB9G 1YJ9T 3AT1B 2DFUA 1NPRA 2RHYA 2QEXQ 2X4JA 5HK3A 4LDUA 2RMOA 1M3AA 2JM8A 1PM3A 5A0LA 4GLKA 3JCMX 3UF4A 3OSSC 4QQ6A 2QGGA 4DBQA 3CPFA 3CCLA 3G71A 1XQHA 2BE9B 4WTOB 2DK3A 1VQPA 4RG2A 3GLXA 2F2XA 5C0MA 3EFSA 2O9SA 5I2MA 4O6JA 5GANh 2NYSA 4A4HA 4E2FB 4KGVB 5LJ5g 3C94A 3G6EA 2M16A 2RHUA 1UE9A 1MUZA 2GTOA 1LVKA 1ABOA 3REAB 2D8HA 1K8AR 2RHXA 1VIFA 3QZ9B 3GOXA 2WSFE 4M4ZA 2R5AA 1MMNA 4J6YA 5HKCA 1YI2Q 1UTIA 3JCMf 2VKNA 5L23A 2KT1A 1V29B 2CP0A 3ULRB 1Q86R 2DJQA 3ASKA 1UJ0A 2CP5A 3NHNA 3JCMb 1VQPQ 1K8AC 1NG2A 1BKBA 3CC2T 2CDTA 1X6OA 1VQOT 4RTXA 1UG1A 4Y91A 2DVJA 2V8IA 4FL6A 1G3WA 3URGA 2QYZA 2DTOA 3NGPA 5IT9E 1QW1A 2DE0X 5D6YA 1B7TA 3EHRA 4EMHA 1Q86C 3OW2S 4QQDA 1VQ9A 3NTKA 3VYHB 2ZPEB 1K0SA 2KGTA 4N0AC 1OU8A 2O2OA 3QXEB 2DYIA 3L2VA 3OW2P 3CCQT 4OMPA 4E7JA 1G3YA 3HSBA 1RL2A 3CPWS 3M5AA 2LZ6B 2K5IA 4AFQC 1ZSZA 4D8KA 1KFZA 4XAXB 2L5QA 1Y57A 5LJ5j 1KD1R 1ABQA 2FEIA 1C0MA 1Y0MA 3QYHB 4XU2A 2DMOA 1VQ4T 2BIVA 1TUCA 2KNBB 3H9NA 1JU5C 1N9SA 2YUPA 3JCMW 4PJLA 3G4SA 4CRIA 5KYNA 1ZUUA 2C0TA 4KUIA 3X25B 1M3CA 3WVDB 1E6HA 1M3BA 2FRWA 4ELZC 1M1FA 3REBB 1IGUA 4DOVA 2FRYA 2IVWA 2KROA 3PVQA 2ED0A 5DM7R 3PFSA 2W0ZA 4UC4A 2M0YA 1CKBA 1RABB 3CCEA 8AT1B 2CH4W 2K2VA 3I55A 1VQKT 4AT1B 2EFIA 1U8RA 3H8ZA 1KG1A 2LX7A 3EGUA 5HY6A 5GMKm 1BU1A 4Y28E 1EZZB 4LNPA 5GAMj 1LCKA 5LJ5h 1PNJA 2CP7A 2LCLA 3CQTA 3JB9H 5GAOn 4Z02A 1WA7A 2FPFA 1M1KR 3OYMA 4ZGJB 4OB1B 1RAIB 2ZPHB 4J9CA 2EYZA 2PTKA 3CC7T 1WDXA 4JLGA 2KRNA 2NLUA 4LDVA 1IGQA 4M77F 5GMKe 1PCXA 3S3OA 3FLGA 4FYXB 2PU9B 5FRNA 4OB0B 4KBMB 1P92A 2K3YA 2KAFA 1V76A 2LNVA 3BY7A 1QKXA 1VQ6T 1M1KC 3RKYA 4ZN1A 4CI0C 3CD6A 2QA4Q 1M90U 1MV3A 1S72Q 1CSKA 3BFMA 3SD4A 3KFVA 2P4TA 3CMAA 1WX6A 2PVGB 4DBHA 2DEUA 2WSCE 5KE3A 3LX7A 4QKUA 1K73U 4M77A 4PNOA 1G3SA 4WCIA 2YHTA 1LNXA 1M8VA 3CBMA 3O5ZA 1VQNQ 4IUPA 2YUOA 4PJNA 1TU0B 1WNLA 2X3WD 3RUXA 2GTJA 3CBPA 2CT4A 1WHJA 4E7HA 1VQLA 4FT2A 1YJNA 1C1AA 4B9WA 1UB4A 1K9MC 2M02A 2CUBA 2X4YA 2KR3A 3M4GA 2GCXA 2L3PA 5GAOp 1T0JA 1WFWA 3QJ6A 2J6OA 3OMCA 4C92C 4ATOA 2M0OA 1ZA1B 3EAEA 1W1FA 4ME7A 2CP2A 3QJYA 1TOVA 2RJFA 3OYEA 3EG9B 3QO3A 2XHCA 3E9FA 4KT0E 1WPYA 2HD0A 4FSSA 4PKCC 4DEYA 4L5GA 2E4HA 2HEQA 1D1CA 4PFOA 3CCRT 2LQNA 3NPFA 4C92D 1WQWA 3V8LA 4DA4A 3I9QA 3MEVA 3F70A 2L0AA 3EH2A 1WJRA 4M7AA 1D3BA 1QVPA 3OS0A 1WZOA 1YP5A 2L89A 1KQSA 2OTJQ 5CKEA 2D6FA 1FX7A 4HVUA 1I4K1 2P0PA 4C8QC 1QWEA 1VQ5A 2Y4XA 4EMKB 3PMTA 4QVZA 4RMOA 2ZAEA 2JNGA 3ME9A 4C92G 1YNZA 4MZTA 4OGCA 5GAN7 3IQLA 1M4ZA 2OAWA 2XI9A 4CC3A 4M75F 5KYXB 2E6NA 1TH7A 1WXTA 4C8QD 1SSFA 5I22A 5EC7A 4QQGA 1PC0A 4PJOF 4RTWA 5KYYB 2KYMA 2RNAA 1QKWA 4PJJA 2YRVA 1AHJB 4J7IA 3VS6A 3RIRA 3HL8A 4PK4A 1AWXA 4FT4A 5IH2A 3DB4A 1N8RR 1KQSP 1ZUKA 2LTOA 3KBGA 3JCMc 1K76A 1MMAA 4LDXA 1UFFA 3HRUA 4C92E 4M7DD 3VS4A 2PUKB 3LH0A 2JS0A 3M0TA 4RG8A 4F7UE 5IXFA 3MKDA 5KH6A 3RKXA 1HXDA 4C0FA 1LJOA 3NMZC 2OAUA 4M75A 1N8RC 3SEMA 2E1HA 2CP6A 3TREA 4J7FA 2HSPA 4PJOA 1RAGB 4OB3B 5FU6C 1VQ9T 1TUGB 2LDMA 4OP0A 1VQ7T 1KC8C 2QDYB 2LC4A 1NJIU 2BZXA 1YHQA 2AIRB 2DL4A 2QQAA 3A8GB 3EG9A 1X75C 4M78C 3E1SA 2Y90A 3CCQQ 3CCUA 1HK9A 3I56Q 3QG1A 1QCOA 4HVVA 3MHXA 4DOWA 2X51A 2RJCA 2GQVA 4BD3A 4C8QE 1PSFA 3BDUA 2X9HA 3A8OB 4XQ3A 1XOVA 1ZSGA 5GMKl 3E9GA 4X9CA 2WACA 3G4ST 5GMKj 5CQYA 4M78D 1S1NA 8ATCB 4J9IA 3PTAA 2RO0A 4DBFA 1GFCA 1YJWA 2J05A 4J5YA 3L2ZA 2X4WA 3O8VA 4E6RA 3JAME 1YHQQ 2R58A 3CMEA 4EMKA 3HHTB 5LJ5d 3OS2A 4BY6B 4RCBA 1Q7YR 3PGGA 1VQ8A 3CCET 3TSZA 1J3TA 5FRMA 2JN0A 1NYFA 3LWHA 4FCYA 2XICA 3GNFB 1HYOA 1VQKQ 2AKKA 4M78G 3RMQA 2CZ6B 1OX8A 3TQ7P 1IO6A 3EH1A 1UDLA 1OPLA 1Q7YC 3M56A 1SRLA 2EGEA 2RQUA 2DM1A 2JTEA 2RN8A 4J8OA 4E7IA 1SRMA 1YITA 4FYWB 4BUGA 5LJ3f 3J81E 1AWOA 3R6OA 5GMKh 1JQQA 3PMIA 1I5LA 1UGPB 4M78E 1BCOA 3CC7Q 5IHKA 4LD9K 2HQHA 4ZTJA 2AZSA 3MCAB 1E7OA 3S3MA 1M5Q1 2QEXA 1Q81U 3UT1A 1UJYA 1UUEA 3A8MB 4FM4B 2FHDA 4J9BA 3VUZA 5GAN3 5GANj 2EQUA 1M9SA 4XTUA 9ATCB 5LJ5f 2VGNA 4MDWA 2LT1A 3CD6T 3JCMQ 4MMLA 3JB9I 3RESA 2HBPA 4HT9A 1YITQ 1NYGA 2DL8A 1RAAB 1ZSZB 4BE0A 2C06A 3OBYA 4J83A 3JCMe 2QTVA 1D0ZA 1HSQA 4OVAA 2VXFA 1OULA 1A0NB 1I1JA 2FG0A 4JRIA 1RAHB 1PSEA 3THKA 1KQ2A 2HDAA 3MO8A 1RI0A 3QYGB 2DZ9A 2OJ2A 1PD1A 2LT4A 3ZEHA 3CXCA 1YWOA 1CKAA 1I07A 4E7ZA 4XTWA 3LYIA 5EG2A 1N27A 1YJNT 2EQJA 2XU8A 2JJ9A 3G7ZA 1YI2A 1QVGA 7AT1B 3MEWA 4JJCA 5DLQE 1D1BA 3H41A 3VRYA 5J3BA 2WSEE 3BE3A 4QW2A 5A2QE 1W2BA 1UGSB 4AMCA 1JBMA 5GAMf 2EYWA 4M7AC 3CC4T 4M7DF 2V1QA 5KCOA 4E7LA 3SWNB 4A63B 3H0HA 3FEOA 2DD4A 5I21A 4C0DB 2VXEA 3GBQA 2NUTA 4ORZA 2CSQA 2DX1A 4J6XA 2XDDA 2LRQA 2KT8A 3CCST 1WHMA 5CKHA 1U06A 5LL6S 2P84A 1OZ3A 2K3BA 3A8HB 2RQWA 2EVRA 2E12A 4OMMA 2Y4YA 2VVKA 2C0OA 2RHIA 2RK1A 5CKBA 1GFDA 1SG5A 1K1ZA 1X2KA 2CT3A 2EKHA 1W2BP 1FMKA 2QGFB 3L2UA 1FXXA 1U1TA 3JRZA 4HVWA 2OX7A 2LCCA 2DAQA 4J9EA 3OYKA 2M9UA 4FYYB 2EYXA 4M7AG 4OMOA 3NTHA 4J9HA 3SHWA 2AT1B 3EHQA 1NEBA 5DLOA 4Z89A 1MV0B 1RLPC 1UHCA 2NUPA 2FPEA 1UHFA 3OYAA 2DL7A 4PLLA 4BDYA 3CCMQ 4M77B 4OMQA 1FMWA 3RNJA 3M0QA 1UECA 2A3LA 5FW9A 2G3RA 1YCSB 2K5FA 4LN2A 1W6XA 1H3ZA 2DD5A 3M0UA 4HT8A 1SKUB 1N5ZA 1KD1C 4N4IA 1K0XA 1WGSA 4LDWA 3VUBA 3DKMA 1KC8U 2P0QA 2YRCA 4IIMA 3JCMg 5IHIA 4HCBA 2RI3A 3CCJT 1BIBA 4NL2A 2IG0A 4Y92A 1VQ7Q 2J7IA 5KYWA 3T9NA 1E6GA 4AG2C 2VB6A 1X27A 1M1GA 2XMFA 2QI2A 3SWNA 2BTTA 2CS7A 3A98A 3SB2A 1ZBXA 4KH0B 1R77A 1FWZA 3X26B 2QA4A 2XDBA 4M75G 4HKEA 1S72A 4J9DA 4HA8A 5CO7A 3RBBB 4EMKC 2JMCA 2KXDA 1YIJA 2ABLA 4M7AB 1D3BB 2F5KA 3Q1JA 3VS2A 2DZCA 3JB9F 4E47A 2NWMA 2MWOA 2V26A 1XTDA 3RMSA 2DXUA 3JCMV 3OY9A 2FZCB 2HBWA 1UGRB 5CCAA 3QSUA 1EX4A 1I81A 2CSIA 5CKFA 4R0KA 4EDUA 2DXTA 1VQNA 4JS5A 1NPPA 3OYHA 1VQ8T 3L2RA 2KK4A 1H92A 2SEMA 3CCVQ 1ZLMA 3OYCA 4IKFA 1BI2A 2KSSA 2QQRA 1TSFA 1NEGA 4MZPA 2MWPA 2LJ0A 2PVDB 2LQWA 2LP5A 1OI1A 1YIJQ 4IUTA 4ZN3A 4A4GA 2AZVA 1D1AA 1OQKA 4A4KA 2HQEA 2OTLQ 5CVIA 2JOYA 3DLLA 4PFZA 1VA7A 2LVMA 1Q82U 4PLIA 1K4US 4D6WA 3HTRA 3HPWA 1JJ2A 2ZZDA 1JRIA 4Z88A 1NM7A 3TCJA 2KEAA 3H0FA 1OEBA 4XK8E 1TS9A 4C5HA 3EGXA 2E10A 4M75B 4JJNK 1Z9ZA 1IRXA 5GAOq 4BI3A 4PJOB 4KGZB 2OTJA 2KDSA 4OMFB 1VIEA 4CC4B 5J26A 4E7SA 3U23A 1VQMT 2JS2A 4LDYA 3FJPA 3OYNA 1DJ7B 2YUNA 2LCSA 1JJ2S 3JCMh 4LXCA 1GBRA 1QP3A 3PE0A 2KI7A 1JJ2P 1T3LA 2D9TA 2I0NA 4L6V5 2NUZA 1OZ2A 2W10A 4F16A 1Y07A 2RPNA 3M57A 3GIBA 2EBPA 4RTUA 2JT4A 4BY6C 5GAOm 2RM4A 2K6DA 2QASA 5GANd 2PZ1A 2ZGWA 5C6SA 1YJ9Q 4JPBW 3E19A 1LOJA 2KVQG 3KUFA 1YI2T 2F1LA 2FPDA 1D09B 1XNIA 4OF1A 4Q5WA 3CCLT 4KGXB 2H3JA 2K3XA 3MP8A 3G71T 4RTTA 2XD0A 2DIGA 1VQPT 1BB9A 2BKDN 4XTYA 2COYA 5D7UA 1PKSA 3EFOB 2V1RA 2KRMA 4II1A 3OS1A 1NBEB 3OYFA 1B34A 3C4SA 1UEBA 3CC2A 3OYBA 3G6ET 1KIKA 1VQOA 1AD5A 1PWTA 2DO3A 1KHCA 2GBQA 3EG3A 3JSCA 3LWIA 1I0CA 3TSWA 1KQSS 3CC4Q 1Y7XA 4JZ3A 3OYDA 1WJQA 3C95A 1WHHA 2O9VA 2DKGA 3DLMA 3DB3A 4B6MA 1JB0E 2ED1A 2JM9A 1ACMB 2HMAA 3EG0A 3CCQA 4WF2A 4NL3A 1K8AU 3I56A 1N6AA 3SDZA 2EYYA 2R57A 3P8BB 1MHNA 4IUVA 1KSWA 4RCCA 1W70A 1G3TA 3PT9A 4J6WA 3RDVA 2KYBA 1Q86U 5GANf 1AWWA 4DBRA 1VQ4A 2QG9B 3S6WA 3VU3C 4ESRA 3CC2Q 5KYUA 1AZGB 1U3OA 1ZSZC 1VQOQ 2HKQB 3NTIA 3EG2A 1ZX6A 3A1PA 2OI3A 2AK5A 1PD0A 2DXBA 4HCKA 1YBYA 3VS1A 3VJPA 2ATCB 3H0IA 1KK7A 4N4HA 2QXFA 4FIBA 4R55A 2MPXC 3RKWA 1QP2A 2M1HA 3VYGA 4RTVA 5LJ3e 2L2PA 2HZYA 3R6NA 2F2WA 2QQ9A 3JCMJ 1VQKA 1GCQA 4K11A 4X34A 3V7RA 5D6XA 3KXTA 1VQ4Q 1AOJA 4FW1A 1M2VA 1KD1U 1QCFA 2PUOB 2GFAA 2LQKA 1PRLC 4P5NA 4GBQA 2RQVA 3L42A 3OYJA 2YXYA 4R56A 1M2OA 2EJGA 5GAN2 2XG8D 2KXCA 2L3RA 2VUBA 2GQIA 3SWNC 2B8AA 3I55T 3QKJA 2E3IA 1R0CB 2I2LA 2MOXA 3QHSA 3CC7A 3EFOA 2AKLA 3JV3A 4C0DC 2CKKA 5GAN5 4EMGA 3V7SA 4TVRA 2KRSA 3M0SA 5CQXA 1M90R 4JZ4A 1D0YA 4IUQA 2ENMA 3M54A 1VQ6A 3J7AF 2QA4T 5IAYA 5GMKi 5FLXE 2DBKA 2NUTB 1RAEB 1ZQ1A 4XTXA 2R5MA 3HP9A 1QVFA 1YCYA 2JTMA 4XU1A 1K73R 4PJMA 1JO8A 1C6VX 1Q82R 1FYNA 1TG0A 4ZGDB 2YT6A 3MEUA 1M90C 4ZNXA 4CC2A 2FYKA 2RI5A 1Z9QA 3QZ5B 3D7SB 1M1KU 1YWPA 1WXBA 1F1BB 1TWBA 2CH4A 2KQWA 3UATA 5GAMe 4M7DB 1K73C 4O5VA 2DRKA 2RA2A 2BZYA 4OMNA 2A36A 4M77C 4C92F 1VQ6Q 3C12A 4IIOA 1GRIA 4RUGA 4F7UF 4A53A 3S3NA 2E70A 3JCMP 3CMAT 2DEQA 2DPPB 2ECZA 2NUPB 1KHIA 2F5TX 5A0DA 3OA6A 1U5SA 1M27C 2CYZB 4M77D 3ZL7C 3VS0A 1YN8A 2K79A 1WHGA 1X2QA 3M9QA 2VGMA 2DVEA 4RTYA 5FROA 3OS5A 1K9MU 1T3SA 5GAN6 3I5SA 3FDRA 5I2SA 2VC8A 1IHVA 3ER0A 1VQLT 2LX9A 4C92A 3M58A 1EFNA 1W4SA 2QQSA 2K5LA 1UGVA 1OX9A 1QQJA 4C8QF 2CZ1B 2K57A 5GAOl 4YTLA 4F7UA 1O9SA 1X6GA 2OTJT 1FMVA 2O88A 1RADB 2XKOC 1RLQC 4M77G 3RR6A 2HSEB 3P8HA 5LJ3g 1NLOC 5FU7C 5KYWB 2EYQA 2E6ZA 1VQMQ 4PFPA 3MEAA 4RTZA 2YSQA 1MNDA 3CXCS 4FU6A 5CKDA 2JTFA 2K9GA 2L3SA 2EJFA 3CXCP 4C0GA 3CCRQ 2YRDA 2YUQA 2ZPFB 2DETA 1QVGS 4M7AD 4C8QA 4CC7A 2XIDA 4M77E 2PQWA 3HKSA 2P4RA 3UA6A 2D0NA 4BE2A 1QVGP 3J80E 3OW2A 2O01E 3VS5A 6AT1B 2YLCA 3CCMA 1X69A 2HAXA 3QUIA 4DEXA 5L8RE 2DF6A 1W2BS 1VQ5T 2F2VA 1H3HA 3PVLA 1IXDA 2EJ9A 3CPWA 2A08A 4KULA 3E2UA 4QVCA 2GFUA 2PNIA 4LUEA 2ROTA 3NFCA 3CCLQ 4M7DA 1BI3A 3UA7A 3G71Q 1WHLA 3QDFA 3P8DA 4GLMA 3EGDA 5ECAA 1Y96A 2HL3A 4J9FA 1HJDA 3QBYA 2LJ3A 3X20B 3INZA 4VUBA 5LJ3j 1GCPA 4M78F 4XU0A 3CEYA 1NJIR 3G6EQ 4AFUC 2VWFA 4ZTFA 2DIQA 1U1SA 1SPKA 5D6WA 3L2WA 1OOTA 2JMAA 1G83A 1IZ6A 4ANJA 1VQ7A 2EQKA 1K9AA
chains in the Genus database with same CATH topology
4M75C 2JVVA 4C0FA 1LJOA 4M75A 2OAUA 4XK8E 1N8RC 2ZPBB 1BIAA 2L8DA 2ZPIB 3OSVA 5M9OA 5GAMd 2E1HA 3TREA 3PIPA 3I56T 2MF2A 4FSXA 4MZMA 4PJOC 1BI1A 4J7FA 4C5HA 1VQMA 4PJOA 5GAMg 1N8RU 3QIIA 1NJIC 2E10A 4M75B 2XK0A 4OB3B 5FU6C 1VQ9T 1N9RA 4XTVA 4JJNK 2O4XB 2MMPA 2LDMA 3TEEA 4OP0A 3V7CA 1VQ7T 4M7AE 1KC8C 2QDYB 2LC4A 4N4GA 4BI3A 5GAOq 1NJIU 4PJOB 2JUFA 2OTJA 2KDSA 1YHQA 4M75D 2QQBA 4OMFB 1VIEA 3A8GB 2QQAA 1X75C 4M78C 5FU6B 4BI8B 2E64A 4V2SA 3E1SA 3JCMd 2Y90A 5IN1A 5J26A 2AHJB 1HK9A 4M78A 4QVDA 3BDLA 3CCRA 3CCUA 1VQMT 4PJOD 3HFOA 4LDYA 3QG1A 1NE8A 3WXMB 3FJPA 2F69A 2E5QA 3MHXA 3OYNA 4DOWA 1KQ1A 2ZCFB 3SFMA 3VV0A 2RJCA 2GQVA 4BD3A 4BB7A 1DJ7B 4C8QE 1ZHIA 2RJDA 5HK0A 2LQ8A 4BACA 2EQMA 1PSFA 4EPCA 1JJ2S 3BDUA 4M78B 3JCMh 2V8JA 3A8OB 4XQ3A 5KCHA 1XOVA 3JB9G 1YHQT 1YJ9T 1BYMA 1QP3A 1NPRA 5GMKl 2RHYA 5GAN4 2X4JA 3E9GA 4LDUA 2WACA 4X9CA 5HK3A 3G4ST 2A7YA 5GMKj 5CQYA 3CCUT 4M78D 2D9TA 3MP6A 2E41A 5A0LA 4L6V5 4GLKA 3PTAA 2RO0A 1OZ2A 1WJSA 5LJ3h 3JCMX 3JB9J 3CCVA 2DTIA 1YJWA 1Y07A 3M57A 4J5YA 3OSSC 4QQ6A 3GIBA 3L2ZA 2X4WA 3CPFA 1OYXA 3CCLA 4BY6C 2RHZA 3G71A 5GAOm 1XQHA 4E7KA 5FU7B 3UDCA 3OQ5A 2RM4A 3O8VA 2RB6A 2DK3A 2ZGWA 5C6SA 5GANd 2KY9A 3JAME 1VQPA 3E19A 2R58A 4RG2A 3GLXA 1LOJA 3CMEA 4PJOG 2KVQG 5C0MA 4EMKA 4LD6A 3KUFA 3EFSA 3HHTB 4DQ2A 5LJ5d 3OS2A 1YJWT 5I2MA 4RCBA 4BY6B 3PGGA 1YI2T 1VQ8A 3CCET 4O6JA 5GANh 2OTLA 1XNIA 4OF1A 4Q5WA 2D0QB 4MMKA 4A4HA 2JN0A 5LJ5g 3C94A 3CCLT 5FRMA 2H3JA 2M16A 2K3XA 3MP8A 2RHUA 3ZFJA 3FRNA 3G6EA 3LWHA 2FL7A 3G71T 2XICA 3QPHA 3GNFB 2V8KA 2XD0A 2DIGA 1VQPT 2BKDN 4XTYA 3CMET 2X35A 4M78G 1IREB 3OS1A 2RHXA 4II1A 3TCJA 3RMQA 2CZ6B 1VIFA 3QZ9B 3UWNA 3OYFA 2WSFE 1B34A 3GOXA 3C4SA 1UEBA 2R5AA 4M75E 3CC2A 3OYBA 2ZPGB 3G6ET 1Q7YC 4J6YA 4C5IA 5HKCA 1VQOA 3JCMf 1WQ7A 3M56A 1V29B 1KHCA 2DO3A 5A0GA 3JSCA 3LWIA 4PJOE 1B34B 3ASKA 1Q7YU 1KQSS 3BW1A 1Y7XA 4E7IA 4J8OA 1YITA 3OYDA 1WJQA 3C95A 3L1AA 3JCMb 4BUGA 1K8AC 2DKGA 5LJ3f 3J81E 3DLMA 1BKBA 3DB3A 3CC2T 3R6OA 1JB0E 1X6OA 5GMKh 1VQOT 2JZ2A 3PMIA 1I5LA 3CCQA 1UGPB 4WF2A 5AYFA 4Y91A 4NL3A 2V8IA 1K8AU 4FL6A 4M78E 3I56A 1G3WA 3URGA 2DTOA 1N6AA 5IT9E 4LD9K 1QW1A 3LGFA 1YITT 3SDZA 3M4YA 4ZTJA 5D6YA 5DY9A 4EMHA 1Q81C 1Q86C 3A5ZB 2R57A 3OW2S 3HSBA 3MCAB 4QQDA 3P8BB 1VQ9A 1MHNA 4IUVA 4RCCA 3NTKA 3VYHB 2ZPEB 2FVUA 1G3TA 3PT9A 1M5Q1 3LGLA 4J6WA 4N0AC 3S3MA 2QEXA 1Q86U 5GANf 1Q81U 3QXEB 3UT1A 3L2VA 1VQ4A 3CCQT 3S6WA 4E7JA 3VU3C 1G3YA 3VUZA 3A8MB 4FM4B 2FHDA 1RL2A 2O4XA 3M5AA 5GAN3 3CPWS 2EQUA 2K5IA 5GANj 1M9SA 4XTUA 3NTIA 5LJ5f 2VGNA 4MDWA 2LT1A 3CD6T 3JCMQ 4XAXB 2L5QA 4MMLA 2FB7A 3JB9I 5LJ5j 3RESA 2DXBA 2HBPA 4HT9A 2MI6A 5GAMh 1YBYA 2QEXT 3MP1A 3QYHB 4XU2A 4BE0A 2C06A 3VJPA 1VQ4T 2BIVA 2EKOA 1YJ9A 3OBYA 4J83A 2KMTA 3JCMe 4XTZA 4OVAA 2VXFA 4N4HA 1N9SA 2QXFA 4FIBA 3JCMW 3G4SA 4R55A 2DXCA 4CRIA 2HNIA 4JRIA 3RKWA 1QP2A 2M1HA 4KUIA 1EIFA 1PSEA 3VYGA 3X25B 3WVDB 1KQ2A 3EFRA 4GY5A 3MO8A 4ELZC 4M7AF 5LJ3e 1RI0A 1M1FA 3QYGB 4DOVA 2DZ9A 2IVWA 2QQ9A 3JCMJ 2LT4A 1VQKA 3ZEHA 4HCZA 3CXCA 2X4XA 4X34A 4JUVA 3V7RA 5D6XA 3KXTA 5DM7R 5CK9A 3PFSA 4XTWA 1KD1U 3LYIA 5EG2A 1N27A 3FB9A 4UC4A 2RH2A 2PUOB 3FC3A 2EQJA 1YJNT 2GFAA 2XU8A 3LW5E 2LQKA 3GF5A 3G7ZA 3CCEA 3OYLA 1YI2A 1QVGA 2K2VA 4BI4A 4PL6A 3I55A 1VQKT 4RKUE 5GANe 3MEWA 2EFIA 1U8RA 3H8ZA 4P5NA 1KG1A 3CC4A 3L42A 3OYJA 5DLQE 4R56A 2EJGA 5GAN2 2XG8D 2DJZA 2L3RA 3RERA 5HY6A 1NZ9A 5J3BA 5GMKm 3N5BB 2WSEE 2VUBA 4Y28E 3SWNC 4QW2A 5CIUA 2B8AA 5A2QE 1W2BA 1UGSB 1JBMA 5GAMf 3I55T 3QKJA 3QHSA 2I2LA 4M7AC 3CC7A 4KUDK 4C0DC 2CKKA 5GAN5 3CC4T 5GAMj 4M7DF 5LJ5h 3CCSA 4EMGA 5KCOA 3H6ZA 4E7LA 3V7SA 2LCLA 3SWNB 4MDXA 3JB9H 5GAOn 3OYIA 3FEOA 4TVRA 4OB2B 2DD4A 5I21A 4Z02A 5CQXA 4C0DB 2EAYA 3OYMA 2VXEA 4ZGJB 4OB1B 4IUQA 4HCCA 2ZPHB 2BUDA 3CC7T 3M54A 4J6XA 4JLGA 1VQ6A 2XDDA 2LRQA 3J7AF 2NLUA 4LDVA 4M77F 5GMKe 3CCST 2QA4T 5IAYA 3S3OA 3FLGA 4BE1A 5CKHA 5GMKi 5FLXE 5LL6S 2PU9B 5FRNA 4OB0B 4KBMB 3META 1OZ3A 1ZQ1A 2CZ0B 5GAOr 3A8HB 4JLIA 4XTXA 2E12A 2R5MA 3HP9A 1QVFA 1YCYA 2JTMA 4XU1A 2Y4YA 4A4FA 5GAN8 5CAIA 1P92A 2K3YA 2KAFA 2LNVA 3BY7A 4ZGDB 4IUUA 3MEUA 4F7UG 2RHIA 2RK1A 2EWNA 5CKBA 1M1KC 1M90C 1VQ6T 2FYKA 3RKYA 4ZN1A 2RI5A 4M7DC 4CI0C 3CD6A 3QZ5B 1M90U 1M1KU 3CBOA 3L2UA 3BFMA 3CCMT 1FXXA 1U1TA 3JRZA 3SD4A 2K4YA 2CZ7B 2LCCA 2DAQA 1UGQB 2KQWA 3OYKA 2E65A 1H641 2P4TA 4C5GA 5GAMe 3CMAA 4M7DB 4ZGEB 2M9UA 1K73C 4N0AA 2PVGB 4O5VA 4JRQA 3UPUA 2RA2A 3OYGA 4M7AG 2WSCE 4JS4A 3NTHA 5KE3A 3LX7A 4M77C 2DTHA 4C92F 1K73U 4IURA 4M77A 3C12A 4PNOA 5DLOA 1G3SA 3A8LB 2YHTA 4NS5A 2XDPA 4C0ZA 1LNXA 4F7UF 4A53A 1M8VA 3OYAA 3CBMA 3OMGA 3GP8A 3S3NA 4JRKA 4PLLA 2E70A 4BDYA 3JCMP 4IUPA 3CMAT 5J39A 4M77B 5CR2A 2DEQA 2DPPB 3HFNA 4OGEA 1KHIA 2F5TX 4C8QG 1WNLA 5A0DA 3OA6A 2A3LA 2G3RA 2K5FA 3M55A 3RUXA 3CBPA 2CYZB 4M77D 4E7HA 1H3ZA 1VQLA 2PVOB 4FT2A 1YJNA 1BI0A 3M9QA 2DD5A 4B9WA 1UB4A 1K9MC 4HT8A 3WVEB 2VGMA 3QDRB 2DVEA 2X4YA 3PNWC 3M4GA 3PIOA 3VKIA 1KD1C 2GCXA 5FROA 3OS5A 1K9MU 2P0KA 3CCJA 4N4IA 5GAOp 1O75A 5GAN6 3FDRA 1WGSA 4LDWA 3VUBA 3DKMA 5I2SA 3QJ6A 1KC8U 2VC8A 2P0QA 3ER0A 3OMCA 4C92C 4ATOA 1VQLT 3OB9A 4M7DG 4BDZA 2M0OA 2LX9A 3EAEA 4XU3A 4C92A 3M58A 4ME7A 1W4SA 2QQSA 3QJYA 2K5LA 2RJFA 3HRTA 3OYEA 3QO3A 3HRSA 2CZ1B 3JCMg 2XHCA 3V8KA 4A54A 4C8QF 2K57A 3E9FA 1R8OB 5GAOl 4HCBA 2RI3A 1WPYA 4KT0E 2HD0A 4YTLA 4F7UA 1O9SA 3CCJT 1BIBA 2YLBA 4NL2A 2IG0A 4PKCC 4C92B 2OTJT 1X01A 5LJ3d 4L5GA 2XKOC 5LJ5e 3T9NA 4M77G 4F7UB 3CCRT 3P8HA 5LJ3g 4C92D 1WQWA 3LLRA 5FU7C 1M1GA 2QTXA 2RK2A 3V8LA 2QI2A 1GXIE 4DA4A 2EYQA 3MEVA 2E6ZA 3F70A 3GNGA 3SWNA 3SB2A 2CS7A 4B9XA 1ZBXA 3MEAA 1WJRA 1FWZA 4M7AA 3X26B 1D3BA 2QA4A 3X24B 2XDBA 1QVPA 4M7DE 4M75G 4HKEA 3OS0A 1S72A 1KQSA 2L89A 2RD1A 3FIFA 3CXCS 4FU6A 2CGHA 4HA8A 5CKEA 5CO7A 4EMKC 5CKDA 1YIJA 2JTFA 4M7AB 2D6FA 2VYTA 1D3BB 2F5KA 3Q1JA 5GANg 2EJFA 2DZCA 3JB9F 1FX7A 4E47A 3CCVT 1I4K1 4C0GA 2P0PA 3GPLA 2ZPFB 4C8QC 1QVGS 2MWOA 1VQ5A 4ELYC 1XTDA 2Y4XA 3RMSA 4C8QA 3TU4K 4M7AD 4EMKB 2XIDA 3PMTA 4M77E 2DXUA 4QVZA 1S72T 2PQWA 4RMOA 3JCMV 3HKSA 3OY9A 1Y71A 2JNGA 1UGRB 5CCAA 3QSUA 4EDUA 1I81A 5CKFA 4BE2A 3ME9A 3OBWA 3J80E 3OW2A 2DXTA 2O01E 1YIJT 1VQNA 2GF7A 4C8QB 2YLCA 3CCMA 4C92G 4OGCA 4MZTA 5GAN7 3M59A 4JS5A 1M4ZA 2XI9A 2HAXA 1NPPA 3QUIA 3OYHA 3L2QA 1VQ8T 4X9DA 3V8JA 3L2RA 2OTLT 4M75F 5L8RE 1W2BS 1VQ5T 2KK4A 2E6NA 3AHUA 1TH7A 2EJ9A 4C8QD 3OYCA 1SSFA 4KULA 3CPWA 1BI2A 3X28B 4L59A 4IKFA 4QQGA 2KSSA 3ZBDA 4QVCA 4PJOF 1MGQA 2GFUA 2QQRA 4C5EA 3NFCA 4MZPA 4M7DA 2VV5A 3M53A 2MWPA 1BI3A 1VQNT 2YRVA 1AHJB 2PVDB 4J7IA 3RIRA 4A4EA 3HL8A 3P8DA 1G5VA 1OI1A 1Y96A 3QBYA 4FT4A 4IUTA 4ZN3A 3DB4A 4A4GA 3X20B 3INZA 4JDSA 4NOYA 1VUBA 2LTOA 3KBGA 3JCMc 4A4KA 4VUBA 2HQEA 4JRPA 5LJ3j 1Q82C 4M78F 4LDXA 1I8FA 1Y96B 4XU0A 3CEYA 2JOYA 5CVIA 3DLLA 2EIFA 2RJEA 3HRUA 4C92E 4M7DD 2HQXA 2RI2A 2LVMA 2PUKB 1Q82U 4PLIA 4ZTFA 2DIQA 4D6WA 3LH0A 1U1SA 3HPWA 5D6WA 4RG8A 3OYYA 3L2WA 4F7UE 1JJ2A 5KE2A 2ZZDA 1JRIA 1IZ6A 2MAMA 1QVFS 5KH6A 1VQ7A 3RKXA 2EQKA 3JB9D 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  4XU3 A;  3L1A A;  4C92 A;  5GAN 5;  3JCM b;  5GAM j;  4M7D F;  1LJO A;  4M75 A;  5LJ5 h;  1BIA A;  4EMG A;  5GAM d;  3QO3 A;  3JCM g;  2E1H A;  2DKG A;  5LJ3 f;  3V7S A;  3V8K A;  4A54 A;  2K57 A;  4C8Q F;  3SWN B;  5GAO l;  4PJO C;  1WPY A;  4F7U A;  3JCM Q;  5GMK h;  3JB9 H;  5GAO n;  4PJO A;  5GAM g;  1I5L A;  1BIB A;  2YLB A;  4NL2 A;  4C92 B;  2E10 A;  4Y91 A;  4M75 B;  1X01 A;  4WF2 A;  5LJ3 d;  5I21 A;  4NL3 A;  1N9R A;  2EAY A;  4M78 E;  4XTV A;  2VXE A;  5LJ5 e;  2DTO A;  3V7C A;  4OP0 A;  4M7A E;  4C92 C;  4M77 G;  4F7U B;  5LJ3 g;  4J6X A;  5GAO q;  4PJO B;  5DY9 A;  4EMH A;  4C92 D;  1WQW A;  4M77 F;  5GMK e;  2QTX A;  4M75 D;  3V8L A;  4RCC A;  5GMK i;  4M78 C;  3SWN A;  2E64 A;  4V2S A;  1M5Q 1;  4J6W A;  4N0A C;  2Y90 A;  3JCM d;  3SB2 A;  1HK9 A;  4M78 A;  4QVD A;  5GAN f;  4PJO D;  3HFO A;  5GAO r;  4M7A A;  4M7A C;  3FJP A;  4JLI A;  4XTX A;  1D3B A;  3VU3 C;  4M7D E;  1YCY A;  4XU1 A;  1KQ1 A;  4M75 G;  5GAN 3;  5GAN j;  3HSB A;  2RD1 A;  3FIF A;  5CAI A;  5GAN 8;  4XTU A;  4C8Q E;  5LJ5 f;  2CGH A;  4HA8 A;  3BDU A;  3BY7 A;  4M78 B;  4XQ3 A;  3JCM h;  4EMK C;  4F7U G;  2EWN A;  4MML A;  4M7A B;  2FB7 A;  3JB9 I;  5LJ5 j;  3RES A;  1D3B B;  5GAN g;  2FYK A;  2EJF A;  2DZC A;  3RKY A;  5GMK l;  5GAN 4;  2I2L A;  1I4K 1;  5GAM h;  3JB9 F;  4X9C A;  4HT9 A;  4M7D C;  5GMK j;  4XU2 A;  4C8Q C;  4M78 D;  3JB9 G;  2E41 A;  4M7A D;  3BFM A;  4C8Q A;  1U1T A;  4EMK B;  3JCM e;  4XTZ A;  4M77 E;  2DXU A;  2VXF A;  5LJ3 h;  3JCM X;  3JB9 J;  3JCM V;  1N9S A;  2DTI A;  3JCM W;  2E65 A;  4J5Y A;  1H64 1;  5GAM e;  1I81 A;  3QSU A;  4M7D B;  3GIB A;  2DXT A;  3L2Z A;  4N0A A;  2HNI A;  2RA2 A;  4C8Q B;  2YLC A;  4C92 G;  4JRI A;  3RKW A;  5GAN 7;  4M7A G;  5GAO m;  1KQ2 A;  3EFR A;  2RM4 A;  3QUI A;  4M77 C;  2DTH A;  4X9D A;  2RB6 A;  2ZGW A;  3V8J A;  4C92 F;  5LJ3 e;  5GAN d;  4M75 F;  4M7A F;  4M77 A;  4PNO A;  2DZ9 A;  3JCM J;  1LOJ A;  4PJO G;  3AHU A;  1TH7 A;  2EJ9 A;  2YHT A;  4C8Q D;  4EMK A;  1LNX A;  4F7U F;  4A53 A;  3EFS A;  4DQ2 A;  5LJ5 d;  1M8V A;  4QVC A;  4PJO F;  1MGQ A;  4JRK A;  3PGG A;  4JUV A;  4RCB A;  3V7R A;  3JCM P;  5GAN h;  4M7D A;  4M77 B;  4XTW A;  2DEQ A;  4MMK A;  2JN0 A;  5LJ5 g;  3FB9 A;  3HFN A;  3RIR A;  4C8Q G;  1WNL A;  1Y96 A;  3RUX A;  4XTY A;  4M77 D;  3INZ A;  4M78 G;  4NOY A;  5GAN e;  3JCM c;  5LJ3 j;  4M78 F;  1I8F A;  1Y96 B;  4XU0 A;  4HT8 A;  2EJG A;  5GAN 2;  4C92 E;  1B34 A;  2DVE A;  4M7D D;  2DJZ A;  4M75 E;  3M4G A;  3RER A;  4J6Y A;  5GMK m;  3JCM f;  1WQ7 A;  1U1S A;  5GAO p;  4F7U E;  5GAN 6;  3SWN C;  1JRI A;  4PJO E;  1JBM A;  1B34 B;  5GAM f;  2VC8 A;  4M7D G;  3RKX A;  3QHS A;  3BW1 A;  3JB9 D;  1HXD A; 
#chains in the Genus database with same CATH topology
 4M75 C;  2JVV A;  2ZPB B;  1BIA A;  2ZPI B;  5M9O A;  3I56 T;  2MF2 A;  2DYB A;  4PJO C;  1WHK A;  5GAM g;  1N8R U;  3QII A;  1NJI C;  2XK0 A;  3CPW P;  2O4X B;  2MMP A;  4M7A E;  1YFN A;  3EGX B;  2DER A;  2DIL A;  4M75 D;  1XJW B;  4BI8 B;  2E64 A;  4V2S A;  2AHJ B;  4M78 A;  4PJO D;  1MMG A;  1NE8 A;  3WXM B;  1LPL A;  2E5Q A;  3SFM A;  2LNH B;  4BB7 A;  5HK0 A;  1AEY A;  2RJD A;  4BAC A;  3TVT A;  5KCH A;  1VQ9 Q;  1BYM A;  1YHQ T;  1GCQ C;  2DNU A;  5GAN 4;  2A7Y A;  3CCU T;  1QWF A;  3MP6 A;  2COW A;  2E41 A;  2X3X D;  2MCN A;  1MMD A;  1WXU A;  1WJS A;  5LJ3 h;  3JB9 J;  3CCV A;  2QAZ A;  2DTI A;  2EGA A;  4OML A;  1G8X A;  1OYX A;  5GJW B;  2RHZ A;  4E7K A;  5FU7 B;  3UDC A;  3OQ5 A;  4KH1 B;  2RB6 A;  2KY9 A;  3FJ5 A;  4PJO G;  4LD6 A;  4DQ2 A;  3G4S Q;  1YJW T;  2OTL A;  2D0Q B;  4MMK A;  2CP3 A;  3ZFJ A;  5I11 A;  3FRN A;  1IB8 A;  2FL7 A;  3QPH A;  2V8K A;  5HCK A;  5FWC A;  3CME T;  2X35 A;  1IRE B;  3I5R A;  3MJX A;  3QWY A;  3UWN A;  5IHN A;  4M75 E;  2ZPG B;  4C5I A;  3CCE Q;  1WQ7 A;  2RQT A;  3I55 Q;  5A0G A;  2COZ A;  4PJO E;  1Q81 R;  4JJB A;  1B34 B;  1Q7Y U;  3BW1 A;  1AWJ A;  2CUD A;  3L1A A;  2SRC A;  1ZBJ A;  2J06 A;  1QMC A;  2JZ2 A;  5AYF A;  1I5O B;  1YIT T;  3LGF A;  3M4Y A;  1ARK A;  5DY9 A;  1Q81 C;  3A5Z B;  4KRT A;  1JXM A;  2FVU A;  1AVZ C;  3LGL A;  1VYT A;  2EQI A;  1ZUY A;  2O4X A;  1GBQ A;  1M30 A;  1K9M R;  3VS3 A;  1JXO A;  2FB7 A;  1SF9 A;  5KYU B;  2MI6 A;  5GAM h;  2A37 A;  2QEX T;  3MP1 A;  2J6F A;  2EW3 A;  2EKO A;  1YJ9 A;  2KMT A;  4XTZ A;  2B86 A;  1PG5 B;  4QT7 A;  2DXC A;  1HD3 A;  5FWB A;  2HNI A;  1EIF A;  3CD6 Q;  4EIK A;  3EFR A;  4GY5 A;  4M7A F;  1OPK A;  1IHW A;  1PKT A;  1VOM A;  4HCZ A;  2FO0 A;  3CMA Q;  2X4X A;  4JUV A;  2YWW A;  5CK9 A;  2C0I A;  3FB9 A;  3FC3 A;  2RH2 A;  2QDL A;  3LW5 E;  5AT1 B;  2A0F B;  3GF5 A;  3OYL A;  2E3H A;  1M2V B;  4BI4 A;  4PL6 A;  1RAC B;  4RKU E;  3M0R A;  2ROL A;  5GAN e;  3CC4 A;  1QCN A;  2CRE A;  4FW2 A;  2DJZ A;  3RER A;  1NZ9 A;  5IXB A;  4HXJ A;  2K2M A;  1ZA2 B;  3N5B B;  1SHG A;  5CIU A;  1VQL Q;  1YJN Q;  4KUD K;  3CCS A;  3H6Z A;  1BK2 A;  4MDX A;  3OYI A;  2HCK A;  1MNE A;  2M51 A;  1X6B A;  4OB2 B;  2EAY A;  2H3E B;  4AFS C;  4HCC A;  2LJ1 A;  2BUD A;  4Z8A A;  4BE1 A;  3VRZ A;  2DL3 A;  3MET A;  4J9G A;  2CZ0 B;  5GAO r;  4JLI A;  1AZE A;  4A4F A;  1OV3 A;  5GAN 8;  5CAI A;  1X43 A;  2KE9 A;  2JXB A;  2JW4 A;  4IUU A;  4F7U G;  1T0H A;  2EWN A;  4LE9 A;  4M7D C;  2K7A A;  3CCS Q;  3CBO A;  1GL5 A;  3CCM T;  2FZG B;  2K4Y A;  2CZ7 B;  1UGQ B;  1QLY A;  2E65 A;  1VYU A;  1H64 1;  4C5G A;  1V1C A;  4ZGE B;  4N0A A;  4JRQ A;  1NLP C;  3UPU A;  3OYG A;  4AFZ C;  4F14 A;  4JS4 A;  2DTH A;  1VQ5 Q;  2HKN A;  4IUR A;  4F17 A;  1WLP B;  3A8L B;  2EGC A;  2VAS A;  4NS5 A;  4AG1 C;  2XDP A;  4C0Z A;  2FZK B;  3GP8 A;  3OMG A;  1KC8 R;  4JRK A;  4FYV B;  5J39 A;  2E5K A;  2L3Q A;  3MPU B;  5CR2 A;  3HFN A;  4OGE A;  4C8Q G;  3M55 A;  2PVO B;  1SSH A;  1BI0 A;  3EG1 A;  2MYS A;  3WVE B;  3QDR B;  1SEM A;  3PNW C;  3PIO A;  5GJV B;  3VKI A;  2P0K A;  3CCJ A;  2D8J A;  2D1X A;  1O75 A;  4D8D A;  1PHT A;  1Q95 G;  4M7D G;  3OB9 A;  4BDZ A;  4XU3 A;  3HRT A;  3HRS A;  3V8K A;  4A54 A;  1R8O B;  2YLB A;  4C92 B;  3M0P A;  1X01 A;  2A28 A;  5LJ3 d;  3G1J A;  5LJ5 e;  2KBT A;  4F7U B;  1B3Q A;  3LLR A;  2QTX A;  2RK2 A;  3VS7 A;  1GXI E;  1TXQ A;  1KJW A;  3GNG A;  4B9X A;  1G2B A;  4F04 B;  3X24 B;  4M7D E;  2RD1 A;  3FIF A;  3CCJ Q;  2EPD A;  2CGH A;  2RQR A;  2IPO B;  2VYT A;  2BZ8 A;  5GAN g;  2MK5 A;  2GNC A;  3CCV T;  3CCU Q;  1M8M A;  1VYV A;  3GPL A;  4ELY C;  3TU4 K;  1S72 T;  1Y71 A;  1YIJ T;  3OBW A;  5KYX A;  2GF7 A;  4C8Q B;  2Z0W A;  1RAF B;  3M59 A;  1TTH B;  3L2Q A;  1R0B G;  4X9D A;  3V8J A;  5KYY A;  2O31 A;  2OTL T;  1RUW A;  1BCM A;  4X1V A;  3AHU A;  1YJW Q;  3X28 B;  4L59 A;  3QWX X;  1WIE A;  3ZBD A;  1MGQ A;  1BBZ A;  4C5E A;  1D0X A;  2VV5 A;  3M53 A;  1VQN T;  4A4E A;  2J6K A;  1G5V A;  1JEG A;  2BE7 D;  3C0C A;  1SHF A;  3CME Q;  1WYX A;  2MIO A;  4JDS A;  4NOY A;  1VUB A;  4JRP A;  1Q82 C;  1VQ8 Q;  2DRM A;  3EGD B;  1WI7 A;  1I8F A;  1Y96 B;  2EIF A;  2RJE A;  3LH5 A;  4LUD A;  2HQX A;  2RI2 A;  2G6F X;  2DA9 A;  1RI9 A;  3OYY A;  5KE2 A;  2GGR A;  2H8H A;  2MAM A;  1QVF S;  4JJD A;  3JB9 D;  3I35 A;  1TUD A;  2IIM A;  2L8D A;  5GAM d;  3OSV A;  2LMJ A;  3PIP A;  2DLP A;  1QVF P;  4FSX A;  4MZM A;  1BI1 A;  1PRM C;  1VQM A;  2HL5 C;  2RF0 A;  1B07 A;  1N9R A;  4XTV A;  3V7C A;  3TEE A;  1OU9 A;  2QK0 A;  4N4G A;  2JUF A;  2QQB A;  2YDL A;  2DBM A;  5FU6 B;  2ESW A;  3JCM d;  5IN1 A;  2DL5 A;  1AT1 B;  3CCR A;  4QVD A;  3BDL A;  3HFO A;  2F69 A;  1H8K A;  1KQ1 A;  2ZCF B;  3VV0 A;  1ZHI A;  2LQ8 A;  2EQM A;  4EPC A;  4M78 B;  2V8J A;  3JB9 G;  1YJ9 T;  3AT1 B;  2DFU A;  1NPR A;  2RHY A;  2QEX Q;  2X4J A;  5HK3 A;  4LDU A;  2RMO A;  1M3A A;  2JM8 A;  1PM3 A;  5A0L A;  4GLK A;  3JCM X;  3UF4 A;  3OSS C;  4QQ6 A;  2QGG A;  4DBQ A;  3CPF A;  3CCL A;  3G71 A;  1XQH A;  2BE9 B;  4WTO B;  2DK3 A;  1VQP A;  4RG2 A;  3GLX A;  2F2X A;  5C0M A;  3EFS A;  2O9S A;  5I2M A;  4O6J A;  5GAN h;  2NYS A;  4A4H A;  4E2F B;  4KGV B;  5LJ5 g;  3C94 A;  3G6E A;  2M16 A;  2RHU A;  1UE9 A;  1MUZ A;  2GTO A;  1LVK A;  1ABO A;  3REA B;  2D8H A;  1K8A R;  2RHX A;  1VIF A;  3QZ9 B;  3GOX A;  2WSF E;  4M4Z A;  2R5A A;  1MMN A;  4J6Y A;  5HKC A;  1YI2 Q;  1UTI A;  3JCM f;  2VKN A;  5L23 A;  2KT1 A;  1V29 B;  2CP0 A;  3ULR B;  1Q86 R;  2DJQ A;  3ASK A;  1UJ0 A;  2CP5 A;  3NHN A;  3JCM b;  1VQP Q;  1K8A C;  1NG2 A;  1BKB A;  3CC2 T;  2CDT A;  1X6O A;  1VQO T;  4RTX A;  1UG1 A;  4Y91 A;  2DVJ A;  2V8I A;  4FL6 A;  1G3W A;  3URG A;  2QYZ A;  2DTO A;  3NGP A;  5IT9 E;  1QW1 A;  2DE0 X;  5D6Y A;  1B7T A;  3EHR A;  4EMH A;  1Q86 C;  3OW2 S;  4QQD A;  1VQ9 A;  3NTK A;  3VYH B;  2ZPE B;  1K0S A;  2KGT A;  4N0A C;  1OU8 A;  2O2O A;  3QXE B;  2DYI A;  3L2V A;  3OW2 P;  3CCQ T;  4OMP A;  4E7J A;  1G3Y A;  3HSB A;  1RL2 A;  3CPW S;  3M5A A;  2LZ6 B;  2K5I A;  4AFQ C;  1ZSZ A;  4D8K A;  1KFZ A;  4XAX B;  2L5Q A;  1Y57 A;  5LJ5 j;  1KD1 R;  1ABQ A;  2FEI A;  1C0M A;  1Y0M A;  3QYH B;  4XU2 A;  2DMO A;  1VQ4 T;  2BIV A;  1TUC A;  2KNB B;  3H9N A;  1JU5 C;  1N9S A;  2YUP A;  3JCM W;  4PJL A;  3G4S A;  4CRI A;  5KYN A;  1ZUU A;  2C0T A;  4KUI A;  3X25 B;  1M3C A;  3WVD B;  1E6H A;  1M3B A;  2FRW A;  4ELZ C;  1M1F A;  3REB B;  1IGU A;  4DOV A;  2FRY A;  2IVW A;  2KRO A;  3PVQ A;  2ED0 A;  5DM7 R;  3PFS A;  2W0Z A;  4UC4 A;  2M0Y A;  1CKB A;  1RAB B;  3CCE A;  8AT1 B;  2CH4 W;  2K2V A;  3I55 A;  1VQK T;  4AT1 B;  2EFI A;  1U8R A;  3H8Z A;  1KG1 A;  2LX7 A;  3EGU A;  5HY6 A;  5GMK m;  1BU1 A;  4Y28 E;  1EZZ B;  4LNP A;  5GAM j;  1LCK A;  5LJ5 h;  1PNJ A;  2CP7 A;  2LCL A;  3CQT A;  3JB9 H;  5GAO n;  4Z02 A;  1WA7 A;  2FPF A;  1M1K R;  3OYM A;  4ZGJ B;  4OB1 B;  1RAI B;  2ZPH B;  4J9C A;  2EYZ A;  2PTK A;  3CC7 T;  1WDX A;  4JLG A;  2KRN A;  2NLU A;  4LDV A;  1IGQ A;  4M77 F;  5GMK e;  1PCX A;  3S3O A;  3FLG A;  4FYX B;  2PU9 B;  5FRN A;  4OB0 B;  4KBM B;  1P92 A;  2K3Y A;  2KAF A;  1V76 A;  2LNV A;  3BY7 A;  1QKX A;  1VQ6 T;  1M1K C;  3RKY A;  4ZN1 A;  4CI0 C;  3CD6 A;  2QA4 Q;  1M90 U;  1MV3 A;  1S72 Q;  1CSK A;  3BFM A;  3SD4 A;  3KFV A;  2P4T A;  3CMA A;  1WX6 A;  2PVG B;  4DBH A;  2DEU A;  2WSC E;  5KE3 A;  3LX7 A;  4QKU A;  1K73 U;  4M77 A;  4PNO A;  1G3S A;  4WCI A;  2YHT A;  1LNX A;  1M8V A;  3CBM A;  3O5Z A;  1VQN Q;  4IUP A;  2YUO A;  4PJN A;  1TU0 B;  1WNL A;  2X3W D;  3RUX A;  2GTJ A;  3CBP A;  2CT4 A;  1WHJ A;  4E7H A;  1VQL A;  4FT2 A;  1YJN A;  1C1A A;  4B9W A;  1UB4 A;  1K9M C;  2M02 A;  2CUB A;  2X4Y A;  2KR3 A;  3M4G A;  2GCX A;  2L3P A;  5GAO p;  1T0J A;  1WFW A;  3QJ6 A;  2J6O A;  3OMC A;  4C92 C;  4ATO A;  2M0O A;  1ZA1 B;  3EAE A;  1W1F A;  4ME7 A;  2CP2 A;  3QJY A;  1TOV A;  2RJF A;  3OYE A;  3EG9 B;  3QO3 A;  2XHC A;  3E9F A;  4KT0 E;  1WPY A;  2HD0 A;  4FSS A;  4PKC C;  4DEY A;  4L5G A;  2E4H A;  2HEQ A;  1D1C A;  4PFO A;  3CCR T;  2LQN A;  3NPF A;  4C92 D;  1WQW A;  3V8L A;  4DA4 A;  3I9Q A;  3MEV A;  3F70 A;  2L0A A;  3EH2 A;  1WJR A;  4M7A A;  1D3B A;  1QVP A;  3OS0 A;  1WZO A;  1YP5 A;  2L89 A;  1KQS A;  2OTJ Q;  5CKE A;  2D6F A;  1FX7 A;  4HVU A;  1I4K 1;  2P0P A;  4C8Q C;  1QWE A;  1VQ5 A;  2Y4X A;  4EMK B;  3PMT A;  4QVZ A;  4RMO A;  2ZAE A;  2JNG A;  3ME9 A;  4C92 G;  1YNZ A;  4MZT A;  4OGC A;  5GAN 7;  3IQL A;  1M4Z A;  2OAW A;  2XI9 A;  4CC3 A;  4M75 F;  5KYX B;  2E6N A;  1TH7 A;  1WXT A;  4C8Q D;  1SSF A;  5I22 A;  5EC7 A;  4QQG A;  1PC0 A;  4PJO F;  4RTW A;  5KYY B;  2KYM A;  2RNA A;  1QKW A;  4PJJ A;  2YRV A;  1AHJ B;  4J7I A;  3VS6 A;  3RIR A;  3HL8 A;  4PK4 A;  1AWX A;  4FT4 A;  5IH2 A;  3DB4 A;  1N8R R;  1KQS P;  1ZUK A;  2LTO A;  3KBG A;  3JCM c;  1K76 A;  1MMA A;  4LDX A;  1UFF A;  3HRU A;  4C92 E;  4M7D D;  3VS4 A;  2PUK B;  3LH0 A;  2JS0 A;  3M0T A;  4RG8 A;  4F7U E;  5IXF A;  3MKD A;  5KH6 A;  3RKX A;  1HXD A;  4C0F A;  1LJO A;  3NMZ C;  2OAU A;  4M75 A;  1N8R C;  3SEM A;  2E1H A;  2CP6 A;  3TRE A;  4J7F A;  2HSP A;  4PJO A;  1RAG B;  4OB3 B;  5FU6 C;  1VQ9 T;  1TUG B;  2LDM A;  4OP0 A;  1VQ7 T;  1KC8 C;  2QDY B;  2LC4 A;  1NJI U;  2BZX A;  1YHQ A;  2AIR B;  2DL4 A;  2QQA A;  3A8G B;  3EG9 A;  1X75 C;  4M78 C;  3E1S A;  2Y90 A;  3CCQ Q;  3CCU A;  1HK9 A;  3I56 Q;  3QG1 A;  1QCO A;  4HVV A;  3MHX A;  4DOW A;  2X51 A;  2RJC A;  2GQV A;  4BD3 A;  4C8Q E;  1PSF A;  3BDU A;  2X9H A;  3A8O B;  4XQ3 A;  1XOV A;  1ZSG A;  5GMK l;  3E9G A;  4X9C A;  2WAC A;  3G4S T;  5GMK j;  5CQY A;  4M78 D;  1S1N A;  8ATC B;  4J9I A;  3PTA A;  2RO0 A;  4DBF A;  1GFC A;  1YJW A;  2J05 A;  4J5Y A;  3L2Z A;  2X4W A;  3O8V A;  4E6R A;  3JAM E;  1YHQ Q;  2R58 A;  3CME A;  4EMK A;  3HHT B;  5LJ5 d;  3OS2 A;  4BY6 B;  4RCB A;  1Q7Y R;  3PGG A;  1VQ8 A;  3CCE T;  3TSZ A;  1J3T A;  5FRM A;  2JN0 A;  1NYF A;  3LWH A;  4FCY A;  2XIC A;  3GNF B;  1HYO A;  1VQK Q;  2AKK A;  4M78 G;  3RMQ A;  2CZ6 B;  1OX8 A;  3TQ7 P;  1IO6 A;  3EH1 A;  1UDL A;  1OPL A;  1Q7Y C;  3M56 A;  1SRL A;  2EGE A;  2RQU A;  2DM1 A;  2JTE A;  2RN8 A;  4J8O A;  4E7I A;  1SRM A;  1YIT A;  4FYW B;  4BUG A;  5LJ3 f;  3J81 E;  1AWO A;  3R6O A;  5GMK h;  1JQQ A;  3PMI A;  1I5L A;  1UGP B;  4M78 E;  1BCO A;  3CC7 Q;  5IHK A;  4LD9 K;  2HQH A;  4ZTJ A;  2AZS A;  3MCA B;  1E7O A;  3S3M A;  1M5Q 1;  2QEX A;  1Q81 U;  3UT1 A;  1UJY A;  1UUE A;  3A8M B;  4FM4 B;  2FHD A;  4J9B A;  3VUZ A;  5GAN 3;  5GAN j;  2EQU A;  1M9S A;  4XTU A;  9ATC B;  5LJ5 f;  2VGN A;  4MDW A;  2LT1 A;  3CD6 T;  3JCM Q;  4MML A;  3JB9 I;  3RES A;  2HBP A;  4HT9 A;  1YIT Q;  1NYG A;  2DL8 A;  1RAA B;  1ZSZ B;  4BE0 A;  2C06 A;  3OBY A;  4J83 A;  3JCM e;  2QTV A;  1D0Z A;  1HSQ A;  4OVA A;  2VXF A;  1OUL A;  1A0N B;  1I1J A;  2FG0 A;  4JRI A;  1RAH B;  1PSE A;  3THK A;  1KQ2 A;  2HDA A;  3MO8 A;  1RI0 A;  3QYG B;  2DZ9 A;  2OJ2 A;  1PD1 A;  2LT4 A;  3ZEH A;  3CXC A;  1YWO A;  1CKA A;  1I07 A;  4E7Z A;  4XTW A;  3LYI A;  5EG2 A;  1N27 A;  1YJN T;  2EQJ A;  2XU8 A;  2JJ9 A;  3G7Z A;  1YI2 A;  1QVG A;  7AT1 B;  3MEW A;  4JJC A;  5DLQ E;  1D1B A;  3H41 A;  3VRY A;  5J3B A;  2WSE E;  3BE3 A;  4QW2 A;  5A2Q E;  1W2B A;  1UGS B;  4AMC A;  1JBM A;  5GAM f;  2EYW A;  4M7A C;  3CC4 T;  4M7D F;  2V1Q A;  5KCO A;  4E7L A;  3SWN B;  4A63 B;  3H0H A;  3FEO A;  2DD4 A;  5I21 A;  4C0D B;  2VXE A;  3GBQ A;  2NUT A;  4ORZ A;  2CSQ A;  2DX1 A;  4J6X A;  2XDD A;  2LRQ A;  2KT8 A;  3CCS T;  1WHM A;  5CKH A;  1U06 A;  5LL6 S;  2P84 A;  1OZ3 A;  2K3B A;  3A8H B;  2RQW A;  2EVR A;  2E12 A;  4OMM A;  2Y4Y A;  2VVK A;  2C0O A;  2RHI A;  2RK1 A;  5CKB A;  1GFD A;  1SG5 A;  1K1Z A;  1X2K A;  2CT3 A;  2EKH A;  1W2B P;  1FMK A;  2QGF B;  3L2U A;  1FXX A;  1U1T A;  3JRZ A;  4HVW A;  2OX7 A;  2LCC A;  2DAQ A;  4J9E A;  3OYK A;  2M9U A;  4FYY B;  2EYX A;  4M7A G;  4OMO A;  3NTH A;  4J9H A;  3SHW A;  2AT1 B;  3EHQ A;  1NEB A;  5DLO A;  4Z89 A;  1MV0 B;  1RLP C;  1UHC A;  2NUP A;  2FPE A;  1UHF A;  3OYA A;  2DL7 A;  4PLL A;  4BDY A;  3CCM Q;  4M77 B;  4OMQ A;  1FMW A;  3RNJ A;  3M0Q A;  1UEC A;  2A3L A;  5FW9 A;  2G3R A;  1YCS B;  2K5F A;  4LN2 A;  1W6X A;  1H3Z A;  2DD5 A;  3M0U A;  4HT8 A;  1SKU B;  1N5Z A;  1KD1 C;  4N4I A;  1K0X A;  1WGS A;  4LDW A;  3VUB A;  3DKM A;  1KC8 U;  2P0Q A;  2YRC A;  4IIM A;  3JCM g;  5IHI A;  4HCB A;  2RI3 A;  3CCJ T;  1BIB A;  4NL2 A;  2IG0 A;  4Y92 A;  1VQ7 Q;  2J7I A;  5KYW A;  3T9N A;  1E6G A;  4AG2 C;  2VB6 A;  1X27 A;  1M1G A;  2XMF A;  2QI2 A;  3SWN A;  2BTT A;  2CS7 A;  3A98 A;  3SB2 A;  1ZBX A;  4KH0 B;  1R77 A;  1FWZ A;  3X26 B;  2QA4 A;  2XDB A;  4M75 G;  4HKE A;  1S72 A;  4J9D A;  4HA8 A;  5CO7 A;  3RBB B;  4EMK C;  2JMC A;  2KXD A;  1YIJ A;  2ABL A;  4M7A B;  1D3B B;  2F5K A;  3Q1J A;  3VS2 A;  2DZC A;  3JB9 F;  4E47 A;  2NWM A;  2MWO A;  2V26 A;  1XTD A;  3RMS A;  2DXU A;  3JCM V;  3OY9 A;  2FZC B;  2HBW A;  1UGR B;  5CCA A;  3QSU A;  1EX4 A;  1I81 A;  2CSI A;  5CKF A;  4R0K A;  4EDU A;  2DXT A;  1VQN A;  4JS5 A;  1NPP A;  3OYH A;  1VQ8 T;  3L2R A;  2KK4 A;  1H92 A;  2SEM A;  3CCV Q;  1ZLM A;  3OYC A;  4IKF A;  1BI2 A;  2KSS A;  2QQR A;  1TSF A;  1NEG A;  4MZP A;  2MWP A;  2LJ0 A;  2PVD B;  2LQW A;  2LP5 A;  1OI1 A;  1YIJ Q;  4IUT A;  4ZN3 A;  4A4G A;  2AZV A;  1D1A A;  1OQK A;  4A4K A;  2HQE A;  2OTL Q;  5CVI A;  2JOY A;  3DLL A;  4PFZ A;  1VA7 A;  2LVM A;  1Q82 U;  4PLI A;  1K4U S;  4D6W A;  3HTR A;  3HPW A;  1JJ2 A;  2ZZD A;  1JRI A;  4Z88 A;  1NM7 A;  3TCJ A;  2KEA A;  3H0F A;  1OEB A;  4XK8 E;  1TS9 A;  4C5H A;  3EGX A;  2E10 A;  4M75 B;  4JJN K;  1Z9Z A;  1IRX A;  5GAO q;  4BI3 A;  4PJO B;  4KGZ B;  2OTJ A;  2KDS A;  4OMF B;  1VIE A;  4CC4 B;  5J26 A;  4E7S A;  3U23 A;  1VQM T;  2JS2 A;  4LDY A;  3FJP A;  3OYN A;  1DJ7 B;  2YUN A;  2LCS A;  1JJ2 S;  3JCM h;  4LXC A;  1GBR A;  1QP3 A;  3PE0 A;  2KI7 A;  1JJ2 P;  1T3L A;  2D9T A;  2I0N A;  4L6V 5;  2NUZ A;  1OZ2 A;  2W10 A;  4F16 A;  1Y07 A;  2RPN A;  3M57 A;  3GIB A;  2EBP A;  4RTU A;  2JT4 A;  4BY6 C;  5GAO m;  2RM4 A;  2K6D A;  2QAS A;  5GAN d;  2PZ1 A;  2ZGW A;  5C6S A;  1YJ9 Q;  4JPB W;  3E19 A;  1LOJ A;  2KVQ G;  3KUF A;  1YI2 T;  2F1L A;  2FPD A;  1D09 B;  1XNI A;  4OF1 A;  4Q5W A;  3CCL T;  4KGX B;  2H3J A;  2K3X A;  3MP8 A;  3G71 T;  4RTT A;  2XD0 A;  2DIG A;  1VQP T;  1BB9 A;  2BKD N;  4XTY A;  2COY A;  5D7U A;  1PKS A;  3EFO B;  2V1R A;  2KRM A;  4II1 A;  3OS1 A;  1NBE B;  3OYF A;  1B34 A;  3C4S A;  1UEB A;  3CC2 A;  3OYB A;  3G6E T;  1KIK A;  1VQO A;  1AD5 A;  1PWT A;  2DO3 A;  1KHC A;  2GBQ A;  3EG3 A;  3JSC A;  3LWI A;  1I0C A;  3TSW A;  1KQS S;  3CC4 Q;  1Y7X A;  4JZ3 A;  3OYD A;  1WJQ A;  3C95 A;  1WHH A;  2O9V A;  2DKG A;  3DLM A;  3DB3 A;  4B6M A;  1JB0 E;  2ED1 A;  2JM9 A;  1ACM B;  2HMA A;  3EG0 A;  3CCQ A;  4WF2 A;  4NL3 A;  1K8A U;  3I56 A;  1N6A A;  3SDZ A;  2EYY A;  2R57 A;  3P8B B;  1MHN A;  4IUV A;  1KSW A;  4RCC A;  1W70 A;  1G3T A;  3PT9 A;  4J6W A;  3RDV A;  2KYB A;  1Q86 U;  5GAN f;  1AWW A;  4DBR A;  1VQ4 A;  2QG9 B;  3S6W A;  3VU3 C;  4ESR A;  3CC2 Q;  5KYU A;  1AZG B;  1U3O A;  1ZSZ C;  1VQO Q;  2HKQ B;  3NTI A;  3EG2 A;  1ZX6 A;  3A1P A;  2OI3 A;  2AK5 A;  1PD0 A;  2DXB A;  4HCK A;  1YBY A;  3VS1 A;  3VJP A;  2ATC B;  3H0I A;  1KK7 A;  4N4H A;  2QXF A;  4FIB A;  4R55 A;  2MPX C;  3RKW A;  1QP2 A;  2M1H A;  3VYG A;  4RTV A;  5LJ3 e;  2L2P A;  2HZY A;  3R6N A;  2F2W A;  2QQ9 A;  3JCM J;  1VQK A;  1GCQ A;  4K11 A;  4X34 A;  3V7R A;  5D6X A;  3KXT A;  1VQ4 Q;  1AOJ A;  4FW1 A;  1M2V A;  1KD1 U;  1QCF A;  2PUO B;  2GFA A;  2LQK A;  1PRL C;  4P5N A;  4GBQ A;  2RQV A;  3L42 A;  3OYJ A;  2YXY A;  4R56 A;  1M2O A;  2EJG A;  5GAN 2;  2XG8 D;  2KXC A;  2L3R A;  2VUB A;  2GQI A;  3SWN C;  2B8A A;  3I55 T;  3QKJ A;  2E3I A;  1R0C B;  2I2L A;  2MOX A;  3QHS A;  3CC7 A;  3EFO A;  2AKL A;  3JV3 A;  4C0D C;  2CKK A;  5GAN 5;  4EMG A;  3V7S A;  4TVR A;  2KRS A;  3M0S A;  5CQX A;  1M90 R;  4JZ4 A;  1D0Y A;  4IUQ A;  2ENM A;  3M54 A;  1VQ6 A;  3J7A F;  2QA4 T;  5IAY A;  5GMK i;  5FLX E;  2DBK A;  2NUT B;  1RAE B;  1ZQ1 A;  4XTX A;  2R5M A;  3HP9 A;  1QVF A;  1YCY A;  2JTM A;  4XU1 A;  1K73 R;  4PJM A;  1JO8 A;  1C6V X;  1Q82 R;  1FYN A;  1TG0 A;  4ZGD B;  2YT6 A;  3MEU A;  1M90 C;  4ZNX A;  4CC2 A;  2FYK A;  2RI5 A;  1Z9Q A;  3QZ5 B;  3D7S B;  1M1K U;  1YWP A;  1WXB A;  1F1B B;  1TWB A;  2CH4 A;  2KQW A;  3UAT A;  5GAM e;  4M7D B;  1K73 C;  4O5V A;  2DRK A;  2RA2 A;  2BZY A;  4OMN A;  2A36 A;  4M77 C;  4C92 F;  1VQ6 Q;  3C12 A;  4IIO A;  1GRI A;  4RUG A;  4F7U F;  4A53 A;  3S3N A;  2E70 A;  3JCM P;  3CMA T;  2DEQ A;  2DPP B;  2ECZ A;  2NUP B;  1KHI A;  2F5T X;  5A0D A;  3OA6 A;  1U5S A;  1M27 C;  2CYZ B;  4M77 D;  3ZL7 C;  3VS0 A;  1YN8 A;  2K79 A;  1WHG A;  1X2Q A;  3M9Q A;  2VGM A;  2DVE A;  4RTY A;  5FRO A;  3OS5 A;  1K9M U;  1T3S A;  5GAN 6;  3I5S A;  3FDR A;  5I2S A;  2VC8 A;  1IHV A;  3ER0 A;  1VQL T;  2LX9 A;  4C92 A;  3M58 A;  1EFN A;  1W4S A;  2QQS A;  2K5L A;  1UGV A;  1OX9 A;  1QQJ A;  4C8Q F;  2CZ1 B;  2K57 A;  5GAO l;  4YTL A;  4F7U A;  1O9S A;  1X6G A;  2OTJ T;  1FMV A;  2O88 A;  1RAD B;  2XKO C;  1RLQ C;  4M77 G;  3RR6 A;  2HSE B;  3P8H A;  5LJ3 g;  1NLO C;  5FU7 C;  5KYW B;  2EYQ A;  2E6Z A;  1VQM Q;  4PFP A;  3MEA A;  4RTZ A;  2YSQ A;  1MND A;  3CXC S;  4FU6 A;  5CKD A;  2JTF A;  2K9G A;  2L3S A;  2EJF A;  3CXC P;  4C0G A;  3CCR Q;  2YRD A;  2YUQ A;  2ZPF B;  2DET A;  1QVG S;  4M7A D;  4C8Q A;  4CC7 A;  2XID A;  4M77 E;  2PQW A;  3HKS A;  2P4R A;  3UA6 A;  2D0N A;  4BE2 A;  1QVG P;  3J80 E;  3OW2 A;  2O01 E;  3VS5 A;  6AT1 B;  2YLC A;  3CCM A;  1X69 A;  2HAX A;  3QUI A;  4DEX A;  5L8R E;  2DF6 A;  1W2B S;  1VQ5 T;  2F2V A;  1H3H A;  3PVL A;  1IXD A;  2EJ9 A;  3CPW A;  2A08 A;  4KUL A;  3E2U A;  4QVC A;  2GFU A;  2PNI A;  4LUE A;  2ROT A;  3NFC A;  3CCL Q;  4M7D A;  1BI3 A;  3UA7 A;  3G71 Q;  1WHL A;  3QDF A;  3P8D A;  4GLM A;  3EGD A;  5ECA A;  1Y96 A;  2HL3 A;  4J9F A;  1HJD A;  3QBY A;  2LJ3 A;  3X20 B;  3INZ A;  4VUB A;  5LJ3 j;  1GCP A;  4M78 F;  4XU0 A;  3CEY A;  1NJI R;  3G6E Q;  4AFU C;  2VWF A;  4ZTF A;  2DIQ A;  1U1S A;  1SPK A;  5D6W A;  3L2W A;  1OOT A;  2JMA A;  1G83 A;  1IZ6 A;  4ANJ A;  1VQ7 A;  2EQK A;  1K9A A; 
#chains in the Genus database with same CATH homology
 4M75 C;  2JVV A;  4C0F A;  1LJO A;  4M75 A;  2OAU A;  4XK8 E;  1N8R C;  2ZPB B;  1BIA A;  2L8D A;  2ZPI B;  3OSV A;  5M9O A;  5GAM d;  2E1H A;  3TRE A;  3PIP A;  3I56 T;  2MF2 A;  4FSX A;  4MZM A;  4PJO C;  1BI1 A;  4J7F A;  4C5H A;  1VQM A;  4PJO A;  5GAM g;  1N8R U;  3QII A;  1NJI C;  2E10 A;  4M75 B;  2XK0 A;  4OB3 B;  5FU6 C;  1VQ9 T;  1N9R A;  4XTV A;  4JJN K;  2O4X B;  2MMP A;  2LDM A;  3TEE A;  4OP0 A;  3V7C A;  1VQ7 T;  4M7A E;  1KC8 C;  2QDY B;  2LC4 A;  4N4G A;  4BI3 A;  5GAO q;  1NJI U;  4PJO B;  2JUF A;  2OTJ A;  2KDS A;  1YHQ A;  4M75 D;  2QQB A;  4OMF B;  1VIE A;  3A8G B;  2QQA A;  1X75 C;  4M78 C;  5FU6 B;  4BI8 B;  2E64 A;  4V2S A;  3E1S A;  3JCM d;  2Y90 A;  5IN1 A;  5J26 A;  2AHJ B;  1HK9 A;  4M78 A;  4QVD A;  3BDL A;  3CCR A;  3CCU A;  1VQM T;  4PJO D;  3HFO A;  4LDY A;  3QG1 A;  1NE8 A;  3WXM B;  3FJP A;  2F69 A;  2E5Q A;  3MHX A;  3OYN A;  4DOW A;  1KQ1 A;  2ZCF B;  3SFM A;  3VV0 A;  2RJC A;  2GQV A;  4BD3 A;  4BB7 A;  1DJ7 B;  4C8Q E;  1ZHI A;  2RJD A;  5HK0 A;  2LQ8 A;  4BAC A;  2EQM A;  1PSF A;  4EPC A;  1JJ2 S;  3BDU A;  4M78 B;  3JCM h;  2V8J A;  3A8O B;  4XQ3 A;  5KCH A;  1XOV A;  3JB9 G;  1YHQ T;  1YJ9 T;  1BYM A;  1QP3 A;  1NPR A;  5GMK l;  2RHY A;  5GAN 4;  2X4J A;  3E9G A;  4LDU A;  2WAC A;  4X9C A;  5HK3 A;  3G4S T;  2A7Y A;  5GMK j;  5CQY A;  3CCU T;  4M78 D;  2D9T A;  3MP6 A;  2E41 A;  5A0L A;  4L6V 5;  4GLK A;  3PTA A;  2RO0 A;  1OZ2 A;  1WJS A;  5LJ3 h;  3JCM X;  3JB9 J;  3CCV A;  2DTI A;  1YJW A;  1Y07 A;  3M57 A;  4J5Y A;  3OSS C;  4QQ6 A;  3GIB A;  3L2Z A;  2X4W A;  3CPF A;  1OYX A;  3CCL A;  4BY6 C;  2RHZ A;  3G71 A;  5GAO m;  1XQH A;  4E7K A;  5FU7 B;  3UDC A;  3OQ5 A;  2RM4 A;  3O8V A;  2RB6 A;  2DK3 A;  2ZGW A;  5C6S A;  5GAN d;  2KY9 A;  3JAM E;  1VQP A;  3E19 A;  2R58 A;  4RG2 A;  3GLX A;  1LOJ A;  3CME A;  4PJO G;  2KVQ G;  5C0M A;  4EMK A;  4LD6 A;  3KUF A;  3EFS A;  3HHT B;  4DQ2 A;  5LJ5 d;  3OS2 A;  1YJW T;  5I2M A;  4RCB A;  4BY6 B;  3PGG A;  1YI2 T;  1VQ8 A;  3CCE T;  4O6J A;  5GAN h;  2OTL A;  1XNI A;  4OF1 A;  4Q5W A;  2D0Q B;  4MMK A;  4A4H A;  2JN0 A;  5LJ5 g;  3C94 A;  3CCL T;  5FRM A;  2H3J A;  2M16 A;  2K3X A;  3MP8 A;  2RHU A;  3ZFJ A;  3FRN A;  3G6E A;  3LWH A;  2FL7 A;  3G71 T;  2XIC A;  3QPH A;  3GNF B;  2V8K A;  2XD0 A;  2DIG A;  1VQP T;  2BKD N;  4XTY A;  3CME T;  2X35 A;  4M78 G;  1IRE B;  3OS1 A;  2RHX A;  4II1 A;  3TCJ A;  3RMQ A;  2CZ6 B;  1VIF A;  3QZ9 B;  3UWN A;  3OYF A;  2WSF E;  1B34 A;  3GOX A;  3C4S A;  1UEB A;  2R5A A;  4M75 E;  3CC2 A;  3OYB A;  2ZPG B;  3G6E T;  1Q7Y C;  4J6Y A;  4C5I A;  5HKC A;  1VQO A;  3JCM f;  1WQ7 A;  3M56 A;  1V29 B;  1KHC A;  2DO3 A;  5A0G A;  3JSC A;  3LWI A;  4PJO E;  1B34 B;  3ASK A;  1Q7Y U;  1KQS S;  3BW1 A;  1Y7X A;  4E7I A;  4J8O A;  1YIT A;  3OYD A;  1WJQ A;  3C95 A;  3L1A A;  3JCM b;  4BUG A;  1K8A C;  2DKG A;  5LJ3 f;  3J81 E;  3DLM A;  1BKB A;  3DB3 A;  3CC2 T;  3R6O A;  1JB0 E;  1X6O A;  5GMK h;  1VQO T;  2JZ2 A;  3PMI A;  1I5L A;  3CCQ A;  1UGP B;  4WF2 A;  5AYF A;  4Y91 A;  4NL3 A;  2V8I A;  1K8A U;  4FL6 A;  4M78 E;  3I56 A;  1G3W A;  3URG A;  2DTO A;  1N6A A;  5IT9 E;  4LD9 K;  1QW1 A;  3LGF A;  1YIT T;  3SDZ A;  3M4Y A;  4ZTJ A;  5D6Y A;  5DY9 A;  4EMH A;  1Q81 C;  1Q86 C;  3A5Z B;  2R57 A;  3OW2 S;  3HSB A;  3MCA B;  4QQD A;  3P8B B;  1VQ9 A;  1MHN A;  4IUV A;  4RCC A;  3NTK A;  3VYH B;  2ZPE B;  2FVU A;  1G3T A;  3PT9 A;  1M5Q 1;  3LGL A;  4J6W A;  4N0A C;  3S3M A;  2QEX A;  1Q86 U;  5GAN f;  1Q81 U;  3QXE B;  3UT1 A;  3L2V A;  1VQ4 A;  3CCQ T;  3S6W A;  4E7J A;  3VU3 C;  1G3Y A;  3VUZ A;  3A8M B;  4FM4 B;  2FHD A;  1RL2 A;  2O4X A;  3M5A A;  5GAN 3;  3CPW S;  2EQU A;  2K5I A;  5GAN j;  1M9S A;  4XTU A;  3NTI A;  5LJ5 f;  2VGN A;  4MDW A;  2LT1 A;  3CD6 T;  3JCM Q;  4XAX B;  2L5Q A;  4MML A;  2FB7 A;  3JB9 I;  5LJ5 j;  3RES A;  2DXB A;  2HBP A;  4HT9 A;  2MI6 A;  5GAM h;  1YBY A;  2QEX T;  3MP1 A;  3QYH B;  4XU2 A;  4BE0 A;  2C06 A;  3VJP A;  1VQ4 T;  2BIV A;  2EKO A;  1YJ9 A;  3OBY A;  4J83 A;  2KMT A;  3JCM e;  4XTZ A;  4OVA A;  2VXF A;  4N4H A;  1N9S A;  2QXF A;  4FIB A;  3JCM W;  3G4S A;  4R55 A;  2DXC A;  4CRI A;  2HNI A;  4JRI A;  3RKW A;  1QP2 A;  2M1H A;  4KUI A;  1EIF A;  1PSE A;  3VYG A;  3X25 B;  3WVD B;  1KQ2 A;  3EFR A;  4GY5 A;  3MO8 A;  4ELZ C;  4M7A F;  5LJ3 e;  1RI0 A;  1M1F A;  3QYG B;  4DOV A;  2DZ9 A;  2IVW A;  2QQ9 A;  3JCM J;  2LT4 A;  1VQK A;  3ZEH A;  4HCZ A;  3CXC A;  2X4X A;  4X34 A;  4JUV A;  3V7R A;  5D6X A;  3KXT A;  5DM7 R;  5CK9 A;  3PFS A;  4XTW A;  1KD1 U;  3LYI A;  5EG2 A;  1N27 A;  3FB9 A;  4UC4 A;  2RH2 A;  2PUO B;  3FC3 A;  2EQJ A;  1YJN T;  2GFA A;  2XU8 A;  3LW5 E;  2LQK A;  3GF5 A;  3G7Z A;  3CCE A;  3OYL A;  1YI2 A;  1QVG A;  2K2V A;  4BI4 A;  4PL6 A;  3I55 A;  1VQK T;  4RKU E;  5GAN e;  3MEW A;  2EFI A;  1U8R A;  3H8Z A;  4P5N A;  1KG1 A;  3CC4 A;  3L42 A;  3OYJ A;  5DLQ E;  4R56 A;  2EJG A;  5GAN 2;  2XG8 D;  2DJZ A;  2L3R A;  3RER A;  5HY6 A;  1NZ9 A;  5J3B A;  5GMK m;  3N5B B;  2WSE E;  2VUB A;  4Y28 E;  3SWN C;  4QW2 A;  5CIU A;  2B8A A;  5A2Q E;  1W2B A;  1UGS B;  1JBM A;  5GAM f;  3I55 T;  3QKJ A;  3QHS A;  2I2L A;  4M7A C;  3CC7 A;  4KUD K;  4C0D C;  2CKK A;  5GAN 5;  3CC4 T;  5GAM j;  4M7D F;  5LJ5 h;  3CCS A;  4EMG A;  5KCO A;  3H6Z A;  4E7L A;  3V7S A;  2LCL A;  3SWN B;  4MDX A;  3JB9 H;  5GAO n;  3OYI A;  3FEO A;  4TVR A;  4OB2 B;  2DD4 A;  5I21 A;  4Z02 A;  5CQX A;  4C0D B;  2EAY A;  3OYM A;  2VXE A;  4ZGJ B;  4OB1 B;  4IUQ A;  4HCC A;  2ZPH B;  2BUD A;  3CC7 T;  3M54 A;  4J6X A;  4JLG A;  1VQ6 A;  2XDD A;  2LRQ A;  3J7A F;  2NLU A;  4LDV A;  4M77 F;  5GMK e;  3CCS T;  2QA4 T;  5IAY A;  3S3O A;  3FLG A;  4BE1 A;  5CKH A;  5GMK i;  5FLX E;  5LL6 S;  2PU9 B;  5FRN A;  4OB0 B;  4KBM B;  3MET A;  1OZ3 A;  1ZQ1 A;  2CZ0 B;  5GAO r;  3A8H B;  4JLI A;  4XTX A;  2E12 A;  2R5M A;  3HP9 A;  1QVF A;  1YCY A;  2JTM A;  4XU1 A;  2Y4Y A;  4A4F A;  5GAN 8;  5CAI A;  1P92 A;  2K3Y A;  2KAF A;  2LNV A;  3BY7 A;  4ZGD B;  4IUU A;  3MEU A;  4F7U G;  2RHI A;  2RK1 A;  2EWN A;  5CKB A;  1M1K C;  1M90 C;  1VQ6 T;  2FYK A;  3RKY A;  4ZN1 A;  2RI5 A;  4M7D C;  4CI0 C;  3CD6 A;  3QZ5 B;  1M90 U;  1M1K U;  3CBO A;  3L2U A;  3BFM A;  3CCM T;  1FXX A;  1U1T A;  3JRZ A;  3SD4 A;  2K4Y A;  2CZ7 B;  2LCC A;  2DAQ A;  1UGQ B;  2KQW A;  3OYK A;  2E65 A;  1H64 1;  2P4T A;  4C5G A;  5GAM e;  3CMA A;  4M7D B;  4ZGE B;  2M9U A;  1K73 C;  4N0A A;  2PVG B;  4O5V A;  4JRQ A;  3UPU A;  2RA2 A;  3OYG A;  4M7A G;  2WSC E;  4JS4 A;  3NTH A;  5KE3 A;  3LX7 A;  4M77 C;  2DTH A;  4C92 F;  1K73 U;  4IUR A;  4M77 A;  3C12 A;  4PNO A;  5DLO A;  1G3S A;  3A8L B;  2YHT A;  4NS5 A;  2XDP A;  4C0Z A;  1LNX A;  4F7U F;  4A53 A;  1M8V A;  3OYA A;  3CBM A;  3OMG A;  3GP8 A;  3S3N A;  4JRK A;  4PLL A;  2E70 A;  4BDY A;  3JCM P;  4IUP A;  3CMA T;  5J39 A;  4M77 B;  5CR2 A;  2DEQ A;  2DPP B;  3HFN A;  4OGE A;  1KHI A;  2F5T X;  4C8Q G;  1WNL A;  5A0D A;  3OA6 A;  2A3L A;  2G3R A;  2K5F A;  3M55 A;  3RUX A;  3CBP A;  2CYZ B;  4M77 D;  4E7H A;  1H3Z A;  1VQL A;  2PVO B;  4FT2 A;  1YJN A;  1BI0 A;  3M9Q A;  2DD5 A;  4B9W A;  1UB4 A;  1K9M C;  4HT8 A;  3WVE B;  2VGM A;  3QDR B;  2DVE A;  2X4Y A;  3PNW C;  3M4G A;  3PIO A;  3VKI A;  1KD1 C;  2GCX A;  5FRO A;  3OS5 A;  1K9M U;  2P0K A;  3CCJ A;  4N4I A;  5GAO p;  1O75 A;  5GAN 6;  3FDR A;  1WGS A;  4LDW A;  3VUB A;  3DKM A;  5I2S A;  3QJ6 A;  1KC8 U;  2VC8 A;  2P0Q A;  3ER0 A;  3OMC A;  4C92 C;  4ATO A;  1VQL T;  3OB9 A;  4M7D G;  4BDZ A;  2M0O A;  2LX9 A;  3EAE A;  4XU3 A;  4C92 A;  3M58 A;  4ME7 A;  1W4S A;  2QQS A;  3QJY A;  2K5L A;  2RJF A;  3HRT A;  3OYE A;  3QO3 A;  3HRS A;  2CZ1 B;  3JCM g;  2XHC A;  3V8K A;  4A54 A;  4C8Q F;  2K57 A;  3E9F A;  1R8O B;  5GAO l;  4HCB A;  2RI3 A;  1WPY A;  4KT0 E;  2HD0 A;  4YTL A;  4F7U A;  1O9S A;  3CCJ T;  1BIB A;  2YLB A;  4NL2 A;  2IG0 A;  4PKC C;  4C92 B;  2OTJ T;  1X01 A;  5LJ3 d;  4L5G A;  2XKO C;  5LJ5 e;  3T9N A;  4M77 G;  4F7U B;  3CCR T;  3P8H A;  5LJ3 g;  4C92 D;  1WQW A;  3LLR A;  5FU7 C;  1M1G A;  2QTX A;  2RK2 A;  3V8L A;  2QI2 A;  1GXI E;  4DA4 A;  2EYQ A;  3MEV A;  2E6Z A;  3F70 A;  3GNG A;  3SWN A;  3SB2 A;  2CS7 A;  4B9X A;  1ZBX A;  3MEA A;  1WJR A;  1FWZ A;  4M7A A;  3X26 B;  1D3B A;  2QA4 A;  3X24 B;  2XDB A;  1QVP A;  4M7D E;  4M75 G;  4HKE A;  3OS0 A;  1S72 A;  1KQS A;  2L89 A;  2RD1 A;  3FIF A;  3CXC S;  4FU6 A;  2CGH A;  4HA8 A;  5CKE A;  5CO7 A;  4EMK C;  5CKD A;  1YIJ A;  2JTF A;  4M7A B;  2D6F A;  2VYT A;  1D3B B;  2F5K A;  3Q1J A;  5GAN g;  2EJF A;  2DZC A;  3JB9 F;  1FX7 A;  4E47 A;  3CCV T;  1I4K 1;  4C0G A;  2P0P A;  3GPL A;  2ZPF B;  4C8Q C;  1QVG S;  2MWO A;  1VQ5 A;  4ELY C;  1XTD A;  2Y4X A;  3RMS A;  4C8Q A;  3TU4 K;  4M7A D;  4EMK B;  2XID A;  3PMT A;  4M77 E;  2DXU A;  4QVZ A;  1S72 T;  2PQW A;  4RMO A;  3JCM V;  3HKS A;  3OY9 A;  1Y71 A;  2JNG A;  1UGR B;  5CCA A;  3QSU A;  4EDU A;  1I81 A;  5CKF A;  4BE2 A;  3ME9 A;  3OBW A;  3J80 E;  3OW2 A;  2DXT A;  2O01 E;  1YIJ T;  1VQN A;  2GF7 A;  4C8Q B;  2YLC A;  3CCM A;  4C92 G;  4OGC A;  4MZT A;  5GAN 7;  3M59 A;  4JS5 A;  1M4Z A;  2XI9 A;  2HAX A;  1NPP A;  3QUI A;  3OYH A;  3L2Q A;  1VQ8 T;  4X9D A;  3V8J A;  3L2R A;  2OTL T;  4M75 F;  5L8R E;  1W2B S;  1VQ5 T;  2KK4 A;  2E6N A;  3AHU A;  1TH7 A;  2EJ9 A;  4C8Q D;  3OYC A;  1SSF A;  4KUL A;  3CPW A;  1BI2 A;  3X28 B;  4L59 A;  4IKF A;  4QQG A;  2KSS A;  3ZBD A;  4QVC A;  4PJO F;  1MGQ A;  2GFU A;  2QQR A;  4C5E A;  3NFC A;  4MZP A;  4M7D A;  2VV5 A;  3M53 A;  2MWP A;  1BI3 A;  1VQN T;  2YRV A;  1AHJ B;  2PVD B;  4J7I A;  3RIR A;  4A4E A;  3HL8 A;  3P8D A;  1G5V A;  1OI1 A;  1Y96 A;  3QBY A;  4FT4 A;  4IUT A;  4ZN3 A;  3DB4 A;  4A4G A;  3X20 B;  3INZ A;  4JDS A;  4NOY A;  1VUB A;  2LTO A;  3KBG A;  3JCM c;  4A4K A;  4VUB A;  2HQE A;  4JRP A;  5LJ3 j;  1Q82 C;  4M78 F;  4LDX A;  1I8F A;  1Y96 B;  4XU0 A;  3CEY A;  2JOY A;  5CVI A;  3DLL A;  2EIF A;  2RJE A;  3HRU A;  4C92 E;  4M7D D;  2HQX A;  2RI2 A;  2LVM A;  2PUK B;  1Q82 U;  4PLI A;  4ZTF A;  2DIQ A;  4D6W A;  3LH0 A;  1U1S A;  3HPW A;  5D6W A;  4RG8 A;  3OYY A;  3L2W A;  4F7U E;  1JJ2 A;  5KE2 A;  2ZZD A;  1JRI A;  1IZ6 A;  2MAM A;  1QVF S;  5KH6 A;  1VQ7 A;  3RKX A;  2EQK A;  3JB9 D;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...