4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
1H641 2VC8A 1D3BB 2DTHA 2E10A 1Y96A 4F7UF 3QUIA 1KQ1A 4C92E 3V8LA 1WPYA 3VU3C 2YLBA 3JCMb 4M7DD 5LJ3f 1X01A 4HT8A 1U1TA 4M7AA 4PJOD 1N9RA 4RCCA 4XQ3A 2EJFA 4C8QD 3AHUA 2RB6A 3PGGA 2RA2A 3HFOA 5GAMf 5GMKe 3BY7A 4J6WA 5GAOp 4HT9A 1Y96B 3RKXA 4M7AE 4M7AD 1JRIA 2FYKA 3QO3A 4C8QG 4M78E 4PJOB 5GAOn 4XU1A 4M78C 4XTWA 2JN0A 1I5LA 2VXFA 2DTOA 4QVDA 3JCMQ 1B34B 3JCMc 1JBMA 2EAYA 4F7UE 5LJ5e 4J5YA 4Y91A 2E64A 5GAN8 2VXEA 3JB9I 4EMKA 4M7AB 5LJ3g 2DXUA 5GANf 5GANj 3RERA 3JB9H 3QSUA 3JCMd 4NL2A 1LNXA 1BIAA 2QTXA 4C92A 1D3BA 4M7DE 1HXDA 2E41A 1I8FA 4C92C 4PJOE 2ZGWA 4F7UB 5GMKh 3JCMX 4N0AA 4MMKA 4MMLA 3SWNB 5GMKm 3RUXA 5GANg 5GANd 4M7AG 2EJ9A 3EFRA 4N0AC 4PNOA 3RIRA 1I81A 1B34A 1WQWA 3BDUA 1I4K1 2K57A 3M4GA 3RKYA 2DKGA 5LJ5h 3HSBA 4C8QC 4M77D 1LJOA 3V7CA 4PJOA 4EMHA 2HNIA 2DZ9A 3FJPA 4C8QA 2YHTA 4V2SA 4XU2A 3EFSA 1BIBA 1KQ2A 3JCMV 2EJGA 2E65A 5GAN6 4JRKA 5LJ5g 4M75C 3V8KA 4M7DG 1HK9A 1YCYA 4QVCA 2I2LA 4M77F 2FB7A 3V7RA 4A53A 2RD1A 5LJ3h 4M78B 5GMKj 4J6XA 3RESA 4M77A 4JUVA 1WNLA 4C8QE 1TH7A 3L2ZA 4RCBA 5GMKl 5GAMd 5GAOq 5I21A 4J6YA 4M77C 5GAMj 5GAMh 3SB2A 5GAN2 3JB9J 5GANe 5GAOl 2E1HA 3SWNA 2Y90A 1LOJA 3BW1A 4JRIA 4M75G 1N9SA 4M78D 4OP0A 4XTVA 5LJ3d 4C92F 4X9CA 4XTZA 3SWNC 4F7UA 4M7AC 4JLIA 1M5Q1 1WQ7A 4M75E 3FIFA 4M77B 4M78A 4M7DB 5GAOm 4C92G 1U1SA 3RKWA 3BFMA 2RM4A 2DJZA 3JCMW 3JCMJ 2YLCA 1MGQA 5CAIA 4M78F 5GAN3 4C92D 3JCMe 3HFNA 4EMKC 5LJ3j 4XTUA 2EWNA 5GAMg 2DEQA 3L1AA 4DQ2A 5LJ5d 4XU3A 5GAOr 5GAN5 4M77G 4NL3A 2DTIA 3JB9D 4HA8A 3GIBA 2DZCA 2DXTA 4X9DA 4F7UG 3QHSA 5GMKi 3JCMf 2CGHA 4NOYA 5LJ5f 5GAN7 2DVEA 5DY9A 4PJOG 3JCMP 3JB9F 4C8QB 3JCMh 4PJOC 4XTYA 4C92B 4M7DC 4EMGA 1M8VA 4M75F 4M78G 4M7DA 5GAN4 4XTXA 5LJ5j 4EMKB 5LJ3e 4M75B 4M77E 4M75A 3JCMg 4WF2A 4M7DF 3V7SA 3FB9A 3INZA 4PJOF 5GAMe 3JB9G 4XU0A 4C8QF 4M75D 4A54A 5GANh 3V8JA 4M7AF
chains in the Genus database with same CATH superfamily
2DEUA 2COWA 2X4YA 3TCJA 1U1TA 1UE9A 4BI8B 4C5GA 4FM4B 1D09B 4E47A 3FC3A 3CCLA 1AEYA 3J7AF 1PHTA 2L89A 3OBWA 1JRIA 1O9SA 5KYWA 2OTLT 2ZCFB 3JRZA 3OS5A 2A0FB 2H3EB 2OTJQ 1BB9A 3AT1B 4NL2A 3EHRA 1HXDA 1IGQA 2ZGWA 4LN2A 1ZUKA 1OU9A 2K9GA 5GMKm 3CMEA 4YTLA 3S3MA 5FU7B 1GXIE 1G3SA 1PM3A 3I55T 1Q86R 3LWHA 2F5TX 2RN8A 2QQRA 3V7CA 4R55A 5LJ5g 3CCLQ 3QJYA 4OB3B 1YNZA 2V8IA 2QQAA 4ANJA 3V7RA 5A0LA 2RD1A 1K76A 1WGSA 3RESA 3M0RA 1Y7XA 4IKFA 1OOTA 3TSZA 4XTVA 4E6RA 1QVFP 3CCSA 3FIFA 2C0IA 4DOWA 4JZ3A 3TQ7P 3QDRB 5GAOr 2DL4A 1VQMQ 3F70A 1YITA 2QASA 4J9FA 3OYBA 3VS4A 3VS0A 2QYZA 2FG0A 2EKHA 3QYGB 2XK0A 5DY9A 1BCMA 1BKBA 1OU8A 2X4XA 5DM7R 4HXJA 3PIPA 5GAN4 4EMKB 1YCSB 4M75A 1VQ6Q 2RJDA 1Q7YR 3WVDB 2JTMA 4DBQA 1RAGB 1KD1R 4KGXB 2VC8A 3QZ5B 1KQ1A 1OULA 3V8LA 4C92E 4OGEA 4JRPA 5LJ3f 2K2VA 1CKAA 2MIOA 2L8DA 1NLOC 4TVRA 2HQHA 1B7TA 3ASKA 3M57A 2DTOA 2KXDA 4QVDA 1WJRA 3RR6A 1JJ2S 3MJXA 3I9QA 5ECAA 3JCMd 1K4US 2AZVA 2ED1A 1I1JA 2XIDA 3CC2T 1QVFS 2CSQA 4HCZA 2EPDA 1G8XA 4MMKA 4OMQA 3RUXA 4BE2A 1SRMA 1VA7A 1WQWA 1YHQA 2MI6A 3OYLA 2JMCA 3M4GA 4OMPA 3VYGA 4CC2A 2MAMA 3OS0A 2DK3A 1VQ7Q 3CC2Q 1XOVA 2B86A 2JXBA 3DKMA 1OI1A 2K6DA 3CCJQ 2QEXA 1KQ2A 2RQVA 2K7AA 4JRKA 2VUBA 2HZYA 3GOXA 4HVUA 4JRQA 5GMKj 3CCMQ 4M77A 2YSQA 5GAMd 1WHJA 4J6YA 2V1QA 4DEYA 2E1HA 4WTOB 4VUBA 4M7DB 1WQ7A 4C0GA 1PRLC 2PNIA 3SD4A 3JCMJ 3L2UA 4AFSC 3CMAT 2OTLA 2KI7A 1VQLT 1GFDA 4N4HA 2RHYA 2YXYA 4A4HA 2F69A 5I22A 2FEIA 2YT6A 3QKJA 3CCQQ 3OYHA 2CGHA 2G6FX 2CT4A 2RHZA 2PUOB 1KQSP 1YJWA 2A28A 4LD6A 1TG0A 4M7DC 2JNGA 4A63B 1ZSZC 1HYOA 4ZGEB 2VKNA 1KC8C 1T3SA 3OYGA 5GANh 3ZL7C 1T0JA 5KYNA 1EX4A 2RK1A 4HKEA 1N9RA 2ZPGB 4XQ3A 2EJFA 2RA2A 1FWZA 5GAOn 4DBFA 2QEXT 4PFZA 2QG9B 3CCRT 2D9TA 2C0OA 4F7UE 1GCPA 1U8RA 5GANj 4IUPA 1UECA 5A2QE 2FPFA 2WSCE 2KDSA 1D3BA 3OYNA 2DBMA 2E6NA 2FHDA 4HCKA 1YWPA 1N27A 2L3QA 1IRXA 5CKDA 1VQNT 5HY6A 4BUGA 5IHKA 1LCKA 3HRUA 4Y92A 1R8OB 1AVZC 1BIBA 4OB2B 1W2BS 2EYWA 2JW4A 1M90C 3C95A 2RI5A 1KD1C 2L3SA 5IHNA 5I21A 3PVQA 4RTTA 2EFIA 4AT1B 4M7AC 2D6FA 1U06A 5GJVB 3CBPA 3T9NA 2JUFA 5FU6C 2DL3A 3HFNA 2QDLA 4BI4A 4IUQA 5GAN5 4M77G 2KAFA 4X34A 1RADB 3MP8A 1UEBA 3G71Q 1UGSB 2F1LA 5EG2A 5DLQE 4LD9K 3OA6A 1QVGP 3JB9F 5CQYA 2IG0A 2RK2A 3G4SA 1KSWA 1G2BA 3A1PA 2RQTA 4CC7A 3H0IA 3QDFA 2NUTB 3M4YA 3E1SA 1SSFA 1VYVA 2M16A 2YUNA 4M7DD 4D8DA 4IUVA 2L3RA 4BY6B 1Y71A 1VQ9T 4LUEA 2JN0A 1Q82C 4JJNK 2XHCA 3CCVA 4Y91A 5A0DA 2DXBA 2KRSA 1ACMB 1IHWA 3EG1A 2E3IA 3GPLA 5D6YA 1BCOA 3S6WA 1VQ6T 3OYIA 1ZLMA 1QVFA 3D7SB 3RIRA 4CC3A 2FRWA 3EGUA 2CP3A 2EVRA 5LJ5h 1RAAB 4C8QC 1LJOA 3CCJA 4A4GA 2J05A 4JS5A 1QCNA 2GNCA 1K1ZA 4HCBA 4J9DA 1XTDA 4C5EA 2XDDA 5HK3A 3G6EA 3HKSA 2HMAA 2ZPBB 1QLYA 2E3HA 4J9EA 2NUZA 5LJ3d 1ZA2B 4C92F 1TXQA 5IH2A 2AK5A 4X9CA 5I2SA 2LTOA 2LRQA 5IXBA 1BI0A 3UA7A 3RKWA 2KYBA 4RTYA 2IIMA 1BK2A 2GF7A 2LZ6B 3X25B 5LJ5d 1AWOA 2JOYA 3TU4K 1WHKA 3A8GB 1E6HA 1D0XA 1Q7YC 3CCJT 3L42A 2DIGA 2XG8D 1FMVA 3M55A 2DLPA 1VQOQ 1HJDA 1UGVA 3JCMh 4PL6A 3UATA 4KUDK 4BACA 1K73C 4M75B 3FB9A 1TUCA 4PJOF 3PTAA 1A0NB 4ZGJB 1NM7A 1I5OB 4MDWA 3L2QA 1TUGB 2JM9A 2HSEB 5AYFA 4E2FB 1VQ8T 2EYZA 2YRDA 2QGFB 4J6WA 3REAB 1M1KC 3QO3A 2I0NA 1H3HA 4Z02A 1I5LA 2J7IA 2E64A 1AZGB 2DPPB 2LT4A 1AWXA 1RI0A 1YJWQ 3M5AA 3UDCA 3H41A 4R0KA 5GMKh 3CCUT 4N0AA 3SWNB 3LGFA 5GANd 3CCQA 4M7AG 1WHMA 1B34A 5D7UA 1S1NA 1PRMC 4M77D 2OI3A 2ROLA 4ATOA 2EQJA 2O01E 1ZSZA 1WIEA 2DF6A 2A3LA 1ZA1B 5KE3A 1MUZA 1AT1B 2E70A 3A8HB 3MCAB 5GAOq 3CMEQ 4BDZA 3BW1A 1G3WA 1VQOT 2MOXA 5HKCA 2OTJT 1W2BP 2RJEA 4QQDA 2QQSA 2OAUA 3RBBB 2QDYB 3OYJA 1VQOA 1SF9A 2J6KA 3HP9A 2ENMA 3UWNA 2PVGB 2EGCA 1N8RR 2DVEA 2AZSA 2CH4A 4C8QB 2P84A 4QT7A 1WXBA 1WXUA 2VVKA 3IQLA 3CCEQ 1TU0B 2R57A 4J9GA 3A8OB 2QI2A 2XDBA 5LJ3e 4JJBA 4M77E 3RDVA 4FYYB 4WF2A 3G6ET 3E19A 1C0MA 3CPWA 1RACB 1MV3A 2GGRA 4K11A 3QUIA 3CCMA 4QQGA 1S72A 8AT1B 1VQNQ 1HSQA 1GFCA 3P8DA 3BY7A 1WHLA 4C8QG 1R0BG 1XNIA 1RUWA 4XTWA 1KG1A 1LVKA 4J7FA 2AHJB 3OS2A 2DD5A 3OYCA 1MMDA 1EZZB 1JBMA 1D1AA 4L6V5 1YP5A 3I5SA 3CD6T 1K73R 3QWXX 1ABOA 3DB3A 3OSVA 5CKHA 2YUPA 5LL6S 4FCYA 1DJ7B 2V1RA 1I8FA 1M90R 1BBZA 3S3OA 2PU9B 1RAIB 1KQSA 2EJ9A 2K3XA 2GTOA 2CH4W 3MPUB 1Y0MA 1D1CA 2O4XB 2JMAA 3CQTA 1VQ4T 4CRIA 4RUGA 1AOJA 4JDSA 1NEGA 2XD0A 2K3YA 5CIUA 3LW5E 3MO8A 3QIIA 5HCKA 2LX9A 4QVCA 2XI9A 4E7IA 2RHUA 1S72T 1YJ9A 1JXMA 1R77A 4Z8AA 3JB9J 1XQHA 4KRTA 1YWOA 3ME9A 1WA7A 1UHCA 2RO0A 2RM4A 2W10A 2RJCA 3M54A 1TWBA 3OMCA 1JEGA 2X4WA 3MEWA 4Z89A 1Q81R 1B3QA 1RAEB 1UJYA 1WXTA 4KBMB 3ZFJA 1ZX6A 4RMOA 2A7YA 3LX7A 2MWPA 2DXTA 2KNBB 1VQKQ 1IXDA 2L2PA 1YHQT 2LMJA 2LCCA 2BIVA 5CO7A 4RKUE 3OS1A 2M9UA 1RABB 2D0QB 4M7DA 3CCSQ 1ZBXA 2BE7D 2RF0A 2C0TA 4RTUA 4OMLA 1W6XA 3HL8A 3SHWA 1TUDA 1SSHA 2MMPA 3H9NA 1D1BA 5KYYB 2EQKA 1CKBA 2DYIA 2YRVA 1YITQ 4XU1A 3CCVQ 2PQWA 3EG2A 4PKCC 1JXOA 2EAYA 1X75C 2CP2A 2ZPIB 2GFUA 2VXEA 3JB9I 3GBQA 4KUIA 3MHXA 1K0XA 1KHCA 2KQWA 2KR3A 1PG5B 2VV5A 2DERA 3EFRA 2ECZA 1I81A 4ELYC 1HD3A 1E7OA 1K8AC 2KT8A 2EYXA 3GF5A 2KY9A 4OGCA 2V26A 3EGDA 5GJWB 2FO0A 4LUDA 4J9CA 4DOVA 1HK9A 2QQ9A 1RLQC 4PFOA 1LPLA 4A4KA 4BY6C 3HTRA 4ZGDB 2CP5A 4C5HA 5GANe 1X6OA 2IVWA 4JLIA 4M77B 3VRZA 4OMMA 3JCMW 4C92D 1W70A 2DIQA 2LQNA 2D8HA 2JS0A 1K9AA 4MZTA 1P92A 5IXFA 1Q86U 3VS6A 1JQQA 4OMFB 5GAN7 3I55A 3EGDB 1PSFA 3KBGA 3CMET 3NMZC 4ORZA 1M8VA 4M75F 1PD0A 1UJ0A 1UUEA 1K8AU 3WXMB 1SPKA 2O88A 1Q81C 4CC4B 4A54A 1YI2T 2B8AA 3I5RA 1UFFA 4Y28E 5J39A 4PJOD 5FW9A 3TEEA 4EDUA 4HT9A 1M4ZA 2L5QA 4PJOB 1QCFA 3J80E 2WSFE 3VYHB 3L2RA 1NJIC 1NJIU 3O5ZA 1ABQA 1F1BB 1OEBA 3I56A 3CBOA 2YUQA 5KYYA 4M7AB 3QSUA 1KIKA 3JB9H 3EGXB 1TTHB 4D8KA 1RI9A 4JS4A 3ER0A 2D1XA 4F7UB 1QMCA 3CC4A 2EBPA 2VWFA 2ZZDA 3BDUA 2AKKA 2YDLA 1G5VA 1NJIR 5FWCA 1QVGA 1YIJA 3HSBA 3VUZA 4C8QA 3EFSA 1WLPB 3CCVT 4CI0C 2HBWA 3QJ6A 4M7DG 2CREA 1WDXA 4M77F 1MHNA 3ULRB 2VGMA 1VQ5A 6AT1B 4LXCA 4NS5A 2R5AA 2P4TA 4LDWA 5FWBA 5I2MA 2EYQA 2KT1A 1N8RU 3SWNC 2DX1A 1J3TA 4GY5A 2DJZA 4J9BA 1NLPC 2NUPA 1VIFA 1C1AA 4XAXB 2DRKA 4LNPA 2RQUA 4JJCA 2ABLA 2DEQA 2LQ8A 1KJWA 3UF4A 4ESRA 3CD6A 2RJFA 5CK9A 3WVEB 3FEOA 1NE8A 3HPWA 4HVVA 3QHSA 3VS3A 1WFWA 5L8RE 2IPOB 3FJ5A 1QP2A 4PJOG 4AFUC 4F04B 2LDMA 3CXCS 4J9HA 4JZ4A 3CCMT 2O2OA 3LYIA 4XTXA 1MV0B 3I35A 3FDRA 3VRYA 2K2MA 1X6GA 4JJDA 2KROA 3CC4Q 5KYXB 2CYZB 4M7AF 3I55Q 2DTHA 1PCXA 5FU7C 2P0KA 2RB6A 3PGGA 4M7AE 2E4HA 3MEUA 3EH1A 2KXCA 3VS2A 1VOMA 3SEMA 2RQRA 4RTVA 5IHIA 2ATCB 2V8KA 4LDVA 3CXCA 3OYAA 1QWFA 2F2XA 5GAN8 5CVIA 2JTFA 3S3NA 2DL5A 2GQIA 4J7IA 2QTXA 2H3JA 3JSCA 4PK4A 5M9OA 1VQ9Q 5GANg 2OTJA 4N0AC 2EQMA 3C12A 1ZSGA 4QVZA 3H0HA 2K57A 3URGA 3OW2S 3OYMA 2RHXA 2CP7A 2WACA 4OMNA 1GCQC 2X3XD 1VQPQ 3CCRA 3DLLA 1ZHIA 3MP6A 2HAXA 1M30A 2BZYA 2P0QA 2HL5C 5KYUA 5FROA 2QA4T 5GAMj 2Y90A 3CPFA 2JTEA 4ME7A 3EAEA 2E6ZA 2ROTA 2DL8A 3BFMA 1QVGS 3M58A 1RAFB 3E9FA 1M90U 4EMKC 4JPBW 3CCST 1YI2A 2K5FA 3R6OA 1IHVA 2ZPHB 1JO8A 2GQVA 3CD6Q 1VQ4A 3GLXA 1VQMT 4FSSA 1G83A 1VQPA 1I0CA 4EMGA 1G3TA 2J6OA 3NTIA 2PVDB 3JCMg 5GAMe 3JB9G 2EGEA 1VQ9A 5KYWB 4RTXA 1NPRA 1GBQA 3PE0A 3EGXA 2FVUA 4HT8A 4M7AA 1U3OA 1FYNA 3LH0A 4ZN1A 4QQ6A 1Y96B 1ARKA 1UGPB 7AT1B 1VYUA 1IO6A 4ELZC 1W2BA 2VXFA 5CKBA 1VQPT 4GLMA 2A08A 2DJQA 1KK7A 2P4RA 3RERA 3G4ST 1NEBA 2FZKB 2PVOB 4HVWA 4C92A 4II1A 1QQJA 2AT1B 3GNGA 3Q1JA 1T3LA 3JCMX 4X1VA 3CC7A 2LCLA 1YJ9Q 2DE0X 5KCOA 9ATCB 2RMOA 2VYTA 3RKYA 2BZ8A 4PJOA 1MMAA 1X43A 5CQXA 1X27A 2EJGA 3MEAA 3NTHA 3VJPA 3QYHB 2GBQA 3M56A 1M27C 5LJ3h 5KH6A 4M78B 3PVLA 4DEXA 2K5IA 3CPWP 1TH7A 2FL7A 3SWNA 4M78D 1UG1A 4IURA 3UT1A 1WJSA 5GAOm 2KEAA 4AMCA 2YLCA 1AHJB 1VYTA 4AFQC 3NFCA 1WI7A 5GAMg 2BZXA 3L1AA 2L3PA 1FXXA 4KH1B 1K8AR 2DTIA 2CDTA 4N4IA 1VQNA 1X2KA 2M0YA 4C0DC 5GMKi 3JCMf 4O5VA 4FYVB 5IT9E 4PFPA 5I11A 1YITT 4QW2A 4PJOC 1OZ3A 2EW3A 3EFOA 1YIJQ 5IN1A 2HL3A 1UHFA 2DL7A 1VQ8Q 4C8QF 4M75D 3J81E 1D3BB 1OQKA 2X3WD 1JB0E 4JLGA 3L2WA 1D0ZA 4J9IA 3G71A 5GAOp 3CEYA 2FYKA 2QGGA 3FRNA 1MNDA 4M78E 1WZOA 1VQ8A 2LCSA 5LJ5e 4C0ZA 2P0PA 1S72Q 1QWEA 4B9XA 3CC7T 4IUUA 4C92C 2CUBA 1FMKA 1C6VX 2LJ3A 1FMWA 4ZN3A 2DETA 2CS7A 2PTKA 1Q95G 5FRNA 2XKOC 3OQ5A 1ZQ1A 1VQLA 1GCQA 1NPPA 1Z9QA 2HNIA 2DZ9A 3CMAA 2PZ1A 2D8JA 1IB8A 5C0MA 4BD3A 4M75C 4Z88A 1WYXA 2XU8A 1YCYA 2HDAA 2VASA 4C5IA 4N4GA 3L2VA 3L2ZA 2Z0WA 3META 4ZTJA 1ZBJA 4BB7A 4PLLA 4OP0A 3OBYA 2QK0A 4FL6A 2QQBA 1YIJT 3DLMA 4DQ2A 3G7ZA 2KSSA 1SRLA 5DLOA 2ZPEB 4LDYA 3CC4T 1Q86C 4X9DA 2LQKA 1AZEA 4AG2C 3ZBDA 5LJ5f 5CCAA 3OYFA 3M0QA 2MK5A 2QAZA 2F5KA 1MMGA 1YBYA 3G1JA 3E9GA 1G3YA 1EFNA 2CSIA 2NYSA 2JM8A 3FLGA 2DNUA 1BI3A 4P5NA 4F7UF 1N6AA 3VU3C 3JCMb 8ATCB 1IZ6A 2LVMA 3GP8A 3AHUA 1NYGA 3HFOA 5GAMf 5GMKe 1JU5C 3JAME 4M7AD 2JS2A 1B07A 3VUBA 2E12A 1VQ6A 4O6JA 2KMTA 1PKTA 2KGTA 4E7SA 2CKKA 4EMKA 5LJ3g 4UC4A 4DBRA 2R58A 4F17A 5HK0A 1SG5A 1BIAA 2X4JA 2GTJA 4M7DE 3QPHA 2JVVA 1PKSA 3MP1A 3LLRA 5CKEA 3TREA 2HKQB 1OX8A 1KHIA 4BDYA 4IIOA 2DKGA 1JJ2P 3KXTA 4FW1A 4A4FA 4XU2A 2QEXQ 2O9VA 3OW2A 1NZ9A 1H8KA 3OYDA 3QWYA 2I2LA 2KK4A 2LJ1A 1VQKA 2O4XA 2A37A 4AFZC 5GMKl 3CC7Q 2M0OA 4LE9A 3SB2A 1X6BA 1N9SA 2V8JA 4HCCA 2FPDA 2KE9A 4M75E 4M78A 3G71T 1K73U 3H6ZA 2H8HA 3H0FA 2CUDA 2EWNA 3OYEA 4XU3A 1KFZA 1OZ2A 3E2UA 1QKXA 4FT2A 2HQEA 2CZ7B 2K5LA 4NOYA 3N5BB 2LQWA 3OYYA 3UA6A 2J6FA 1SHGA 1K0SA 2DD4A 3MEVA 5LJ5j 3DB4A 1M1FA 2RQWA 2HD0A 3G4SQ 2BUDA 3P8BB 2G3RA 2HCKA 1UDLA 3V8JA 1H641 1Y96A 4FIBA 4B6MA 1VQ5T 4GBQA 1GBRA 2HQXA 2M02A 3A98A 4BI3A 3JCMQ 2BKDN 1B34B 1RLPC 1VQ7T 4RG8A 4J5YA 2DXUA 3OMGA 1SEMA 4OVAA 3GNFB 1PNJA 4LDUA 1K9MR 2DRMA 1KQSS 1O75A 3TVTA 4FT4A 2SEMA 4FSXA 3M0TA 1SHFA 4IUTA 3U23A 3RMSA 4KULA 3LH5A 3CCEA 3FJPA 2CT3A 4GLKA 1M1KU 1R0CB 1YFNA 2XMFA 2DO3A 2FPEA 4RTZA 1VQLQ 1K9MU 4E7HA 1KC8U 5D6XA 2DAQA 1MMNA 2KVQG 4C8QE 2JZ2A 3HHTB 4BE0A 3HRSA 4M77C 2MYSA 5GAOl 3EG9B 1LOJA 1ZUYA 3NHNA 3REBB 1OV3A 4XTZA 5KYUB 3MKDA 1T0HA 3O8VA 2DM1A 3VS1A 1U1SA 1IGUA 1Y57A 2HEQA 1GL5A 2LNHB 2SRCA 3M0PA 4M78F 3R6NA 5GAN3 2EQIA 4XTUA 1V1CA 4KH0B 1KC8R 4KT0E 2EIFA 1W1FA 1PC0A 2XICA 4HA8A 3GIBA 1EIFA 2YRCA 1QP3A 1OX9A 1D0YA 2NUPB 1MNEA 3OYKA 2OTLQ 2RHIA 2ZAEA 1Y07A 1AWJA 2HSPA 4F16A 1VQKT 3V7SA 4XU0A 4E7ZA 1WJQA 4BE1A 4RTWA 1ZUUA 1V76A 1YN8A 4E7JA 2YLBA 5KE2A 4C8QD 2OX7A 3PMTA 1OYXA 1N8RC 1NG2A 4PJNA 2LX7A 1TS9A 2K3BA 5KYXA 3ZEHA 3CC2A 5CR2A 4F14A 3PMIA 5IAYA 5GANf 4RG2A 2WSEE 2BTTA 2OJ2A 2E41A 1UGRB 1VQ4Q 2K79A 2O9SA 2W0ZA 1Z9ZA 2QXFA 1YJNT 1WHHA 2ED0A 1Q82U 2X9HA 3RMQA 4E7LA 2GCXA 4V2SA 2VB6A 3JCMV 3CXCP 1BU1A 5FRMA 2E5KA 3V8KA 2LNVA 1PSEA 2HKNA 1BYMA 1M2VA 4A53A 4MDXA 1TSFA 3M0SA 4J6XA 4JUVA 4Q5WA 5GAMh 1Q82R 2C06A 1Q7YU 1WHGA 2YUOA 1V29B 2KRMA 4D6WA 4F7UA 1KD1U 4R56A 1GRIA 1M5Q1 3EHQA 4PLIA 3UPUA 4FYXB 2OAWA 1QVPA 3HRTA 3JCMe 4NL3A 2LJ0A 2CZ0B 2EQUA 2KBTA 2F2WA 4J8OA 3G6EQ 4QKUA 2X51A 2CZ6B 2X35A 3M9QA 3PIOA 1YI2Q 3JCMP 3EG3A 2NUTA 2DA9A 4ZTFA 2J06A 4M78G 3X28B 2MCNA 4FW2A 1M9SA 2ZPFB 1CSKA 2EYYA 4IIMA 4XK8E 3C4SA 1M1GA 2QTVA 3EG0A 2L0AA 3LGLA 4J83A 1M3AA 3A5ZB 2DMOA 1YJ9T 2D0NA 1YJNQ 4KGZB 2DXCA 2NWMA 1VQMA 4M78C 3CCLT 3OW2P 2MF2A 3JCMc 4MZPA 4WCIA 2QA4Q 4EIKA 5CKFA 2DFUA 4PJLA 1QKWA 1LNXA 1PD1A 4KGVB 4EPCA 2E5QA 2FZGB 4C0FA 1PWTA 4PNOA 1I4K1 5D6WA 1VUBA 3QG1A 1X69A 4OB0B 3VS5A 2RI3A 2YHTA 4DA4A 3CCRQ 4C0DB 2E65A 2Y4XA 2FB7A 3I56T 1WNLA 5J3BA 3X20B 4RCBA 5GAN2 3BDLA 3OSSC 2CP6A 4DBHA 2CZ1B 4C92G 3PT9A 2QA4A 2DVJA 1BI1A 5CAIA 4M4ZA 1UTIA 2COYA 3VKIA 2F2VA 3BE3A 1NBEB 5KCHA 2RNAA 3KFVA 3M0UA 4E7KA 2RH2A 5J26A 1H92A 1M2OA 3A8LB 3LWIA 1M2VB 1YJNA 3M53A 1H3ZA 1NYFA 1QW1A 5FLXE 2ESWA 3CPWS 2COZA 4AG1C 2KRNA 2LT1A 5A0GA 1JJ2A 1VIEA 1SKUB 1RAHB 2A36A 2MPXC 4B9WA 4XTYA 3CMAQ 3QZ9B 4C92B 2JT4A 4OB1B 4OF1A 3QBYA 3X26B 3EH2A 2AKLA 5L23A 2JJ9A 3INZA 3CBMA 1BI2A 2RPNA 1X2QA 2E10A 2NLUA 5EC7A 3PNWC 3CCQT 1U5SA 1UGQB 3CCUA 1WPYA 4PJJA 2DYBA 1X01A 4RCCA 1ZSZB 4A4EA 4L5GA 3RKXA 3RNJA 2CP0A 4OMOA 4FYWB 4MZMA 2GFAA 2HBPA 1XJWB 3X24B 3EFOB 3C0CA 3NTKA 1K9MC 1M8MA 2EGAA 2XDPA 4PJOE 1AWWA 3H8ZA 3VV0A 1Q81U 4MMLA 1TOVA 3THKA 3SDZA 3OY9A 1VQ5Q 3P8HA 1IREB 2M1HA 1OPKA 2FRYA 4EMHA 5C6SA 2YWWA 1N5ZA 2DBKA 2LP5A 5GAN6 2Y4YA 3C94A 3CCUQ 5AT1B 1W4SA 4ZNXA 3OB9A 3A8MB 3EG9A 4FU6A 4JRIA 4M75G 4L59A 4PJMA 2KYMA 2BE9B 1M3BA 2DILA 2R5MA 1AD5A 3NPFA 1FX7A 1MGQA 3I56Q 2M51A 5LJ3j 3CCET 1QCOA 3KUFA 1OPLA 1UB4A 2O31A 3M59A 3JB9D 1I07A 2FZCB 2VGNA 2DZCA 4F7UG 3NGPA 1WX6A 2EKOA 1RL2A 3TSWA 1M1KR 3VS7A 2K4YA 3JV3A 1E6GA 2LC4A 5FU6B 3PFSA 2RI2A 4LDXA 1VQ7A 3SFMA 1M3CA 1YHQQ 4M7DF 1YJWT 3QXEB 2MWOA 2PUKB 2AIRB
chains in the Genus database with same CATH topology
1H641 2DTHA 4ZGJB 1Y96A 5FU7C 4FIBA 3L2QA 4MDWA 2X4YA 1VQ5T 3TCJA 1U1TA 2P0KA 5AYFA 4BI8B 4FM4B 4C5GA 4E47A 3FC3A 1VQ8T 2RB6A 2HQXA 3PGGA 3CCLA 3J7AF 2L89A 4J6WA 4M7AE 3MEUA 1JRIA 3OBWA 3QO3A 1M1KC 1O9SA 4BI3A 4Z02A 1I5LA 2V8KA 2OTLT 2ZCFB 2BKDN 4LDVA 1B34B 3JRZA 3OS5A 3JCMQ 3OYAA 3CXCA 1VQ7T 4RG8A 4J5YA 5GAN8 2E64A 5CVIA 2JTFA 2DXUA 3OMGA 3S3NA 4J7IA 4OVAA 4NL2A 2DPPB 2LT4A 2QTXA 3GNFB 1RI0A 4LDUA 1HXDA 2H3JA 3M5AA 3UDCA 1KQSS 3JSCA 2ZGWA 1O75A 5GMKh 5M9OA 3CCUT 4FT4A 4N0AA 5GANg 3SWNB 3LGFA 5GMKm 5GANd 4FSXA 4YTLA 5FU7B 3CMEA 3CCQA 3S3MA 4N0AC 4M7AG 2EQMA 2OTJA 4IUTA 1G3SA 1GXIE 3C12A 1B34A 4QVZA 3I55T 2K57A 3URGA 3OW2S 3OYMA 3RMSA 4KULA 2RHXA 3LWHA 2F5TX 4M77D 2WACA 2QQRA 3V7CA 3CCEA 3FJPA 4GLKA 3CCRA 4ATOA 1M1KU 2EQJA 2O01E 3DLLA 1ZHIA 4R55A 3MP6A 2DO3A 5LJ5g 2A3LA 5KE3A 1K9MU 4E7HA 3QJYA 4OB3B 2V8IA 2QQAA 1KC8U 2HAXA 3V7RA 2E70A 5D6XA 2DAQA 2RD1A 5A0LA 1WGSA 2P0QA 3A8HB 2KVQG 3MCAB 3RESA 5FROA 4C8QE 5GAOq 2JZ2A 3HHTB 1Y7XA 2QA4T 3HRSA 5GAMj 4M77C 4BE0A 4IKFA 4BDZA 5GAOl 2Y90A 1LOJA 3BW1A 3CPFA 1G3WA 4XTVA 4ME7A 1VQOT 4XTZA 3EAEA 2E6ZA 5HKCA 3CCSA 3FIFA 2OTJT 2RJEA 3O8VA 4QQDA 4DOWA 1U1SA 3BFMA 2QQSA 1QVGS 3M58A 3E9FA 2OAUA 4M78F 5GAN3 1M90U 4EMKC 2QDYB 4XTUA 3OYJA 3QDRB 3CCST 5GAOr 1YI2A 1VQOA 2K5FA 4KT0E 3F70A 2EIFA 1YITA 3R6OA 3OYBA 2XICA 4HA8A 3HP9A 3GIBA 1EIFA 3UWNA 1QP3A 2PVGB 2ZPHB 2GQVA 3QYGB 1VQ4A 2DVEA 2XK0A 3GLXA 5DY9A 1VQMT 4C8QB 1BKBA 3OYKA 2RHIA 1VQPA 2X4XA 4EMGA 5DM7R 1G3TA 1Y07A 2R57A 3A8OB 2QI2A 3NTIA 3PIPA 2XDBA 5GAN4 2PVDB 4EMKB 5LJ3e 4M77E 4M75A 3JCMg 2RJDA 4WF2A 3G6ET 3V7SA 1VQKT 5GAMe 3E19A 3JB9G 4XU0A 3WVDB 2JTMA 1WJQA 4BE1A 3CPWA 1VQ9A 2VC8A 4E7JA 1NPRA 3QZ5B 3QUIA 3CCMA 1KQ1A 4C92E 4QQGA 3V8LA 4OGEA 4JRPA 2YLBA 2FVUA 5LJ3f 2K2VA 4HT8A 5KE2A 4M7AA 1S72A 4C8QD 3LH0A 3PMTA 1OYXA 3P8DA 1N8RC 4ZN1A 3BY7A 2L8DA 4QQ6A 1Y96B 1UGPB 4C8QG 4TVRA 1XNIA 3ASKA 4XTWA 4ELZC 1KG1A 1W2BA 2VXFA 4J7FA 2AHJB 3M57A 2DD5A 2DTOA 3ZEHA 3OS2A 4QVDA 3OYCA 3CC2A 5CKBA 5CR2A 1VQPT 1JBMA 1WJRA 1JJ2S 3PMIA 4L6V5 5IAYA 5GANf 3G4ST 3CD6T 4RG2A 3RERA 2WSEE 3JCMd 3DB3A 3OSVA 5CKHA 5LL6S 2PVOB 4C92A 2E41A 1DJ7B 2XIDA 4II1A 1I8FA 1UGRB 3CC2T 1QVFS 3GNGA 3Q1JA 4HCZA 3S3OA 2PU9B 3JCMX 2QXFA 4MMKA 3CC7A 2LCLA 3RUXA 1KQSA 1YJNT 2EJ9A 2K3XA 4BE2A 1Q82U 5KCOA 1WQWA 3RMQA 2MI6A 1YHQA 3OYLA 3M4GA 2VYTA 2O4XB 3RKYA 3VYGA 4E7LA 2MAMA 3OS0A 2DK3A 1VQ4T 4CRIA 4PJOA 1XOVA 3DKMA 4JDSA 1OI1A 2GCXA 2XD0A 5CQXA 2K3YA 2QEXA 5CIUA 1KQ2A 4V2SA 3LW5E 3MO8A 3JCMV 2EJGA 3MEAA 3NTHA 4JRKA 2VUBA 5FRMA 3V8KA 2LNVA 3VJPA 1PSEA 3QIIA 3M56A 3QYHB 2LX9A 4QVCA 2XI9A 1BYMA 4A53A 3GOXA 4JRQA 2RHUA 4E7IA 5LJ3h 4MDXA 5KH6A 4M78B 5GMKj 4J6XA 1YJ9A 2K5IA 4JUVA 4M77A 1S72T 1TH7A 4Q5WA 5GAMd 2FL7A 4J6YA 5GAMh 2C06A 1Q7YU 3JB9J 1XQHA 2E1HA 3SWNA 4M78D 1V29B 4D6WA 4F7UA 1KD1U 4VUBA 4R56A 1M5Q1 1WQ7A 4IURA 3UT1A 4M7DB 4PLIA 1WJSA 4C0GA 5GAOm 3UPUA 3ME9A 3SD4A 2RO0A 3JCMJ 2RM4A 1QVPA 2RJCA 2YLCA 3HRTA 3M54A 3L2UA 3OMCA 3JCMe 3CMAT 2OTLA 1AHJB 2X4WA 3NFCA 5GAMg 3L1AA 3MEWA 1VQLT 4N4HA 1FXXA 2RHYA 4A4HA 4NL3A 2CZ0B 4KBMB 2F69A 2DTIA 3ZFJA 4RMOA 4N4IA 2EQUA 2A7YA 1VQNA 3LX7A 2MWPA 2DXTA 3QKJA 4J8OA 3OYHA 4C0DC 5GMKi 3JCMf 4O5VA 2CGHA 2CZ6B 2X35A 3M9QA 5IT9E 3PIOA 2RHZA 1YHQT 2PUOB 3JCMP 1YJWA 2LCCA 1YITT 2BIVA 5CO7A 4LD6A 4QW2A 4RKUE 4PJOC 1OZ3A 3OS1A 4ZTFA 2M9UA 4M7DC 2D0QB 2JNGA 4M78G 4M7DA 3X28B 5IN1A 1M9SA 1ZBXA 4ZGEB 2ZPFB 4C8QF 4XK8E 1KC8C 3C4SA 4M75D 1M1GA 3OYGA 5GANh 3LGLA 3HL8A 3J81E 1D3BB 2MMPA 4J83A 1JB0E 4JLGA 3L2WA 3A5ZB 1YJ9T 2RK1A 4HKEA 3G71A 1N9RA 2ZPGB 4XQ3A 2EJFA 3PTAA 2RA2A 2EQKA 5GAOp 1FWZA 3CEYA 2DXCA 2FYKA 2YRVA 3FRNA 4M78E 1VQMA 5GAOn 4XU1A 4M78C 2QEXT 3CCLT 2PQWA 1VQ8A 4PKCC 3CCRT 2D9TA 2MF2A 3JCMc 2EAYA 4F7UE 1X75C 4MZPA 5LJ5e 1U8RA 2ZPIB 4C0ZA 2GFUA 2VXEA 3JB9I 2P0PA 5GANj 4IUPA 4KUIA 5CKFA 5A2QE 3MHXA 1LNXA 2WSCE 2KDSA 4B9XA 1D3BA 3CC7T 4EPCA 3OYNA 4IUUA 4C92C 1KHCA 2E6NA 2FHDA 2KQWA 2E5QA 1N27A 2VV5A 4ZN3A 5CKDA 1VQNT 5HY6A 4C0FA 3EFRA 2CS7A 4PNOA 1I81A 4ELYC 5FRNA 1K8AC 1I4K1 2XKOC 1VUBA 5D6WA 3OQ5A 4BUGA 1ZQ1A 3GF5A 3QG1A 1VQLA 2KY9A 1NPPA 4OB0B 4OGCA 2HNIA 2DZ9A 2RI3A 3HRUA 1R8OB 2YHTA 3CMAA 4DA4A 1BIBA 4OB2B 5C0MA 1W2BS 4BD3A 4C0DB 2E65A 4M75C 4DOVA 1HK9A 2XU8A 1YCYA 2QQ9A 2Y4XA 1M90C 3C95A 2FB7A 2RI5A 1KD1C 4C5IA 3I56T 4A4KA 4N4GA 3L2VA 4BY6C 1WNLA 5J3BA 3L2ZA 4RCBA 3X20B 3META 4ZGDB 4ZTJA 5I21A 5GAN2 2EFIA 3BDLA 4BB7A 4PLLA 3OSSC 4OP0A 3OBYA 4C5HA 5GANe 4M7AC 1X6OA 2D6FA 2IVWA 4FL6A 4JLIA 4M77B 2CZ1B 3CBPA 3T9NA 4C92G 2JUFA 3PT9A 2QA4A 3JCMW 5FU6C 1BI1A 5CAIA 2QQBA 4C92D 1YIJT 3HFNA 2DIQA 3VKIA 3DLMA 4DQ2A 3G7ZA 4BI4A 5KCHA 4IUQA 2KSSA 5GAN5 4M77G 4E7KA 2RH2A 2KAFA 4MZTA 1P92A 5J26A 5DLOA 2ZPEB 3A8LB 4LDYA 3CC4T 4X34A 3LWIA 1YJNA 3MP8A 3M53A 1Q86C 1UEBA 4X9DA 2LQKA 1UGSB 1Q86U 1H3ZA 3ZBDA 1QW1A 5FLXE 5EG2A 5LJ5f 5DLQE 4OMFB 5CCAA 3CPWS 5GAN7 4LD9K 3OA6A 2LT1A 3I55A 3OYFA 5A0GA 1JJ2A 3JB9F 1VIEA 1PSFA 5CQYA 2F5KA 2IG0A 2RK2A 3KBGA 4B9WA 3CMET 4XTYA 3G4SA 3QZ9B 4C92B 1M8VA 4OB1B 4M75F 1YBYA 4OF1A 3E9GA 1G3YA 3QBYA 3X26B 3FLGA 1K8AU 3WXMB 3INZA 3CBMA 1BI2A 1Q81C 4A54A 1YI2T 1BI3A 4P5NA 2B8AA 3M4YA 3E1SA 2E10A 4F7UF 1SSFA 1N6AA 2NLUA 3PNWC 1UGQB 3CCQT 2M16A 3CCUA 1WPYA 3VU3C 4Y28E 3JCMb 4M7DD 5J39A 1X01A 1IZ6A 4IUVA 4PJOD 4RCCA 2LVMA 2L3RA 3TEEA 3GP8A 4A4EA 3AHUA 4BY6B 1Y71A 3HFOA 5GAMf 5GMKe 4EDUA 1VQ9T 4M7AD 3JAME 4L5GA 3RKXA 4HT9A 1M4ZA 2L5QA 4PJOB 3J80E 2WSFE 3VUBA 3VYHB 2JN0A 3L2RA 1NJIC 1Q82C 2E12A 1NJIU 1VQ6A 4JJNK 2XHCA 4MZMA 2GFAA 4O6JA 3CCVA 3I56A 3CBOA 2KMTA 4Y91A 5A0DA 2HBPA 3X24B 2CKKA 4EMKA 2DXBA 4M7AB 4UC4A 5LJ3g 3QSUA 2R58A 3JB9H 5HK0A 3NTKA 1BIAA 2X4JA 1K9MC 4M7DE 3QPHA 3GPLA 2XDPA 5D6YA 4JS4A 4PJOE 3S6WA 3ER0A 1VQ6T 4F7UB 3H8ZA 3VV0A 3OYIA 2JVVA 3MP1A 4MMLA 1Q81U 3LLRA 3CC4A 1QVFA 5CKEA 3TREA 3SDZA 3OY9A 2ZZDA 3RIRA 3BDUA 1KHIA 1G5VA 3P8HA 4BDYA 2DKGA 5LJ5h 1QVGA 4C8QC 3KXTA 1YIJA 3HSBA 1LJOA 1IREB 2M1HA 3VUZA 4EMHA 4C8QA 4A4FA 5C6SA 4XU2A 3EFSA 3CCVT 3CCJA 4CI0C 4A4GA 4JS5A 3OW2A 1NZ9A 4HCBA 5GAN6 3QJ6A 4M7DG 3OYDA 2Y4YA 3C94A 2I2LA 1XTDA 2KK4A 1MHNA 4M77F 4C5EA 2VGMA 1VQ5A 2XDDA 5HK3A 3G6EA 1VQKA 2O4XA 3HKSA 1W4SA 2ZPBB 5GMKl 4NS5A 3OB9A 2R5AA 2M0OA 2P4TA 3A8MB 3SB2A 4LDWA 2EYQA 5I2MA 4FU6A 5LJ3d 4JRIA 4C92F 4M75G 1N9SA 4L59A 2V8JA 5I2SA 4X9CA 3SWNC 1N8RU 2LTOA 4HCCA 4M75E 2LRQA 4M78A 3G71T 1K73U 2R5MA 3H6ZA 4GY5A 1BI0A 3RKWA 1FX7A 2DJZA 1MGQA 1VIFA 5LJ3j 4XAXB 3CCET 2EWNA 2GF7A 2DEQA 2LQ8A 3X25B 5LJ5d 3KUFA 4XU3A 3OYEA 1OZ2A 2JOYA 3CD6A 3TU4K 2RJFA 5CK9A 3A8GB 1UB4A 1Q7YC 3WVEB 3FEOA 3M59A 3CCJT 3JB9D 3L42A 1NE8A 2VGNA 3HPWA 4FT2A 2DZCA 2HQEA 4F7UG 2CZ7B 2DIGA 2XG8D 3QHSA 2K5LA 4NOYA 5L8RE 3N5BB 2EKOA 3M55A 1RL2A 1QP2A 4PJOG 2K4YA 3JCMh 2LDMA 4PL6A 3CXCS 3OYYA 4KUDK 2LC4A 5FU6B 3PFSA 3CCMT 2RI2A 4BACA 4LDXA 1VQ7A 2DD4A 3LYIA 3MEVA 4XTXA 5LJ5j 3FDRA 1K73C 4M75B 3SFMA 3DB4A 4M7DF 1M1FA 2HD0A 3FB9A 4PJOF 2BUDA 1YJWT 3P8BB 2G3RA 3QXEB 2MWOA 2CYZB 2PUKB 3V8JA 4M7AF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H64 1;  2VC8 A;  1D3B B;  2DTH A;  2E10 A;  1Y96 A;  4F7U F;  3QUI A;  1KQ1 A;  4C92 E;  3V8L A;  1WPY A;  3VU3 C;  2YLB A;  3JCM b;  4M7D D;  5LJ3 f;  1X01 A;  4HT8 A;  1U1T A;  4M7A A;  4PJO D;  1N9R A;  4RCC A;  4XQ3 A;  2EJF A;  4C8Q D;  3AHU A;  2RB6 A;  3PGG A;  2RA2 A;  3HFO A;  5GAM f;  5GMK e;  3BY7 A;  4J6W A;  5GAO p;  4HT9 A;  1Y96 B;  3RKX A;  4M7A E;  4M7A D;  1JRI A;  2FYK A;  3QO3 A;  4C8Q G;  4M78 E;  4PJO B;  5GAO n;  4XU1 A;  4M78 C;  4XTW A;  2JN0 A;  1I5L A;  2VXF A;  2DTO A;  4QVD A;  3JCM Q;  1B34 B;  3JCM c;  1JBM A;  2EAY A;  4F7U E;  5LJ5 e;  4J5Y A;  4Y91 A;  2E64 A;  5GAN 8;  2VXE A;  3JB9 I;  4EMK A;  4M7A B;  5LJ3 g;  2DXU A;  5GAN f;  5GAN j;  3RER A;  3JB9 H;  3QSU A;  3JCM d;  4NL2 A;  1LNX A;  1BIA A;  2QTX A;  4C92 A;  1D3B A;  4M7D E;  1HXD A;  2E41 A;  1I8F A;  4C92 C;  4PJO E;  2ZGW A;  4F7U B;  5GMK h;  3JCM X;  4N0A A;  4MMK A;  4MML A;  3SWN B;  5GMK m;  3RUX A;  5GAN g;  5GAN d;  4M7A G;  2EJ9 A;  3EFR A;  4N0A C;  4PNO A;  3RIR A;  1I81 A;  1B34 A;  1WQW A;  3BDU A;  1I4K 1;  2K57 A;  3M4G A;  3RKY A;  2DKG A;  5LJ5 h;  3HSB A;  4C8Q C;  4M77 D;  1LJO A;  3V7C A;  4PJO A;  4EMH A;  2HNI A;  2DZ9 A;  3FJP A;  4C8Q A;  2YHT A;  4V2S A;  4XU2 A;  3EFS A;  1BIB A;  1KQ2 A;  3JCM V;  2EJG A;  2E65 A;  5GAN 6;  4JRK A;  5LJ5 g;  4M75 C;  3V8K A;  4M7D G;  1HK9 A;  1YCY A;  4QVC A;  2I2L A;  4M77 F;  2FB7 A;  3V7R A;  4A53 A;  2RD1 A;  5LJ3 h;  4M78 B;  5GMK j;  4J6X A;  3RES A;  4M77 A;  4JUV A;  1WNL A;  4C8Q E;  1TH7 A;  3L2Z A;  4RCB A;  5GMK l;  5GAM d;  5GAO q;  5I21 A;  4J6Y A;  4M77 C;  5GAM j;  5GAM h;  3SB2 A;  5GAN 2;  3JB9 J;  5GAN e;  5GAO l;  2E1H A;  3SWN A;  2Y90 A;  1LOJ A;  3BW1 A;  4JRI A;  4M75 G;  1N9S A;  4M78 D;  4OP0 A;  4XTV A;  5LJ3 d;  4C92 F;  4X9C A;  4XTZ A;  3SWN C;  4F7U A;  4M7A C;  4JLI A;  1M5Q 1;  1WQ7 A;  4M75 E;  3FIF A;  4M77 B;  4M78 A;  4M7D B;  5GAO m;  4C92 G;  1U1S A;  3RKW A;  3BFM A;  2RM4 A;  2DJZ A;  3JCM W;  3JCM J;  2YLC A;  1MGQ A;  5CAI A;  4M78 F;  5GAN 3;  4C92 D;  3JCM e;  3HFN A;  4EMK C;  5LJ3 j;  4XTU A;  2EWN A;  5GAM g;  2DEQ A;  3L1A A;  4DQ2 A;  5LJ5 d;  4XU3 A;  5GAO r;  5GAN 5;  4M77 G;  4NL3 A;  2DTI A;  3JB9 D;  4HA8 A;  3GIB A;  2DZC A;  2DXT A;  4X9D A;  4F7U G;  3QHS A;  5GMK i;  3JCM f;  2CGH A;  4NOY A;  5LJ5 f;  5GAN 7;  2DVE A;  5DY9 A;  4PJO G;  3JCM P;  3JB9 F;  4C8Q B;  3JCM h;  4PJO C;  4XTY A;  4C92 B;  4M7D C;  4EMG A;  1M8V A;  4M75 F;  4M78 G;  4M7D A;  5GAN 4;  4XTX A;  5LJ5 j;  4EMK B;  5LJ3 e;  4M75 B;  4M77 E;  4M75 A;  3JCM g;  4WF2 A;  4M7D F;  3V7S A;  3FB9 A;  3INZ A;  4PJO F;  5GAM e;  3JB9 G;  4XU0 A;  4C8Q F;  4M75 D;  4A54 A;  5GAN h;  3V8J A;  4M7A F; 
#chains in the Genus database with same CATH topology
 2DEU A;  2COW A;  2X4Y A;  3TCJ A;  1U1T A;  1UE9 A;  4BI8 B;  4C5G A;  4FM4 B;  1D09 B;  4E47 A;  3FC3 A;  3CCL A;  1AEY A;  3J7A F;  1PHT A;  2L89 A;  3OBW A;  1JRI A;  1O9S A;  5KYW A;  2OTL T;  2ZCF B;  3JRZ A;  3OS5 A;  2A0F B;  2H3E B;  2OTJ Q;  1BB9 A;  3AT1 B;  4NL2 A;  3EHR A;  1HXD A;  1IGQ A;  2ZGW A;  4LN2 A;  1ZUK A;  1OU9 A;  2K9G A;  5GMK m;  3CME A;  4YTL A;  3S3M A;  5FU7 B;  1GXI E;  1G3S A;  1PM3 A;  3I55 T;  1Q86 R;  3LWH A;  2F5T X;  2RN8 A;  2QQR A;  3V7C A;  4R55 A;  5LJ5 g;  3CCL Q;  3QJY A;  4OB3 B;  1YNZ A;  2V8I A;  2QQA A;  4ANJ A;  3V7R A;  5A0L A;  2RD1 A;  1K76 A;  1WGS A;  3RES A;  3M0R A;  1Y7X A;  4IKF A;  1OOT A;  3TSZ A;  4XTV A;  4E6R A;  1QVF P;  3CCS A;  3FIF A;  2C0I A;  4DOW A;  4JZ3 A;  3TQ7 P;  3QDR B;  5GAO r;  2DL4 A;  1VQM Q;  3F70 A;  1YIT A;  2QAS A;  4J9F A;  3OYB A;  3VS4 A;  3VS0 A;  2QYZ A;  2FG0 A;  2EKH A;  3QYG B;  2XK0 A;  5DY9 A;  1BCM A;  1BKB A;  1OU8 A;  2X4X A;  5DM7 R;  4HXJ A;  3PIP A;  5GAN 4;  4EMK B;  1YCS B;  4M75 A;  1VQ6 Q;  2RJD A;  1Q7Y R;  3WVD B;  2JTM A;  4DBQ A;  1RAG B;  1KD1 R;  4KGX B;  2VC8 A;  3QZ5 B;  1KQ1 A;  1OUL A;  3V8L A;  4C92 E;  4OGE A;  4JRP A;  5LJ3 f;  2K2V A;  1CKA A;  2MIO A;  2L8D A;  1NLO C;  4TVR A;  2HQH A;  1B7T A;  3ASK A;  3M57 A;  2DTO A;  2KXD A;  4QVD A;  1WJR A;  3RR6 A;  1JJ2 S;  3MJX A;  3I9Q A;  5ECA A;  3JCM d;  1K4U S;  2AZV A;  2ED1 A;  1I1J A;  2XID A;  3CC2 T;  1QVF S;  2CSQ A;  4HCZ A;  2EPD A;  1G8X A;  4MMK A;  4OMQ A;  3RUX A;  4BE2 A;  1SRM A;  1VA7 A;  1WQW A;  1YHQ A;  2MI6 A;  3OYL A;  2JMC A;  3M4G A;  4OMP A;  3VYG A;  4CC2 A;  2MAM A;  3OS0 A;  2DK3 A;  1VQ7 Q;  3CC2 Q;  1XOV A;  2B86 A;  2JXB A;  3DKM A;  1OI1 A;  2K6D A;  3CCJ Q;  2QEX A;  1KQ2 A;  2RQV A;  2K7A A;  4JRK A;  2VUB A;  2HZY A;  3GOX A;  4HVU A;  4JRQ A;  5GMK j;  3CCM Q;  4M77 A;  2YSQ A;  5GAM d;  1WHJ A;  4J6Y A;  2V1Q A;  4DEY A;  2E1H A;  4WTO B;  4VUB A;  4M7D B;  1WQ7 A;  4C0G A;  1PRL C;  2PNI A;  3SD4 A;  3JCM J;  3L2U A;  4AFS C;  3CMA T;  2OTL A;  2KI7 A;  1VQL T;  1GFD A;  4N4H A;  2RHY A;  2YXY A;  4A4H A;  2F69 A;  5I22 A;  2FEI A;  2YT6 A;  3QKJ A;  3CCQ Q;  3OYH A;  2CGH A;  2G6F X;  2CT4 A;  2RHZ A;  2PUO B;  1KQS P;  1YJW A;  2A28 A;  4LD6 A;  1TG0 A;  4M7D C;  2JNG A;  4A63 B;  1ZSZ C;  1HYO A;  4ZGE B;  2VKN A;  1KC8 C;  1T3S A;  3OYG A;  5GAN h;  3ZL7 C;  1T0J A;  5KYN A;  1EX4 A;  2RK1 A;  4HKE A;  1N9R A;  2ZPG B;  4XQ3 A;  2EJF A;  2RA2 A;  1FWZ A;  5GAO n;  4DBF A;  2QEX T;  4PFZ A;  2QG9 B;  3CCR T;  2D9T A;  2C0O A;  4F7U E;  1GCP A;  1U8R A;  5GAN j;  4IUP A;  1UEC A;  5A2Q E;  2FPF A;  2WSC E;  2KDS A;  1D3B A;  3OYN A;  2DBM A;  2E6N A;  2FHD A;  4HCK A;  1YWP A;  1N27 A;  2L3Q A;  1IRX A;  5CKD A;  1VQN T;  5HY6 A;  4BUG A;  5IHK A;  1LCK A;  3HRU A;  4Y92 A;  1R8O B;  1AVZ C;  1BIB A;  4OB2 B;  1W2B S;  2EYW A;  2JW4 A;  1M90 C;  3C95 A;  2RI5 A;  1KD1 C;  2L3S A;  5IHN A;  5I21 A;  3PVQ A;  4RTT A;  2EFI A;  4AT1 B;  4M7A C;  2D6F A;  1U06 A;  5GJV B;  3CBP A;  3T9N A;  2JUF A;  5FU6 C;  2DL3 A;  3HFN A;  2QDL A;  4BI4 A;  4IUQ A;  5GAN 5;  4M77 G;  2KAF A;  4X34 A;  1RAD B;  3MP8 A;  1UEB A;  3G71 Q;  1UGS B;  2F1L A;  5EG2 A;  5DLQ E;  4LD9 K;  3OA6 A;  1QVG P;  3JB9 F;  5CQY A;  2IG0 A;  2RK2 A;  3G4S A;  1KSW A;  1G2B A;  3A1P A;  2RQT A;  4CC7 A;  3H0I A;  3QDF A;  2NUT B;  3M4Y A;  3E1S A;  1SSF A;  1VYV A;  2M16 A;  2YUN A;  4M7D D;  4D8D A;  4IUV A;  2L3R A;  4BY6 B;  1Y71 A;  1VQ9 T;  4LUE A;  2JN0 A;  1Q82 C;  4JJN K;  2XHC A;  3CCV A;  4Y91 A;  5A0D A;  2DXB A;  2KRS A;  1ACM B;  1IHW A;  3EG1 A;  2E3I A;  3GPL A;  5D6Y A;  1BCO A;  3S6W A;  1VQ6 T;  3OYI A;  1ZLM A;  1QVF A;  3D7S B;  3RIR A;  4CC3 A;  2FRW A;  3EGU A;  2CP3 A;  2EVR A;  5LJ5 h;  1RAA B;  4C8Q C;  1LJO A;  3CCJ A;  4A4G A;  2J05 A;  4JS5 A;  1QCN A;  2GNC A;  1K1Z A;  4HCB A;  4J9D A;  1XTD A;  4C5E A;  2XDD A;  5HK3 A;  3G6E A;  3HKS A;  2HMA A;  2ZPB B;  1QLY A;  2E3H A;  4J9E A;  2NUZ A;  5LJ3 d;  1ZA2 B;  4C92 F;  1TXQ A;  5IH2 A;  2AK5 A;  4X9C A;  5I2S A;  2LTO A;  2LRQ A;  5IXB A;  1BI0 A;  3UA7 A;  3RKW A;  2KYB A;  4RTY A;  2IIM A;  1BK2 A;  2GF7 A;  2LZ6 B;  3X25 B;  5LJ5 d;  1AWO A;  2JOY A;  3TU4 K;  1WHK A;  3A8G B;  1E6H A;  1D0X A;  1Q7Y C;  3CCJ T;  3L42 A;  2DIG A;  2XG8 D;  1FMV A;  3M55 A;  2DLP A;  1VQO Q;  1HJD A;  1UGV A;  3JCM h;  4PL6 A;  3UAT A;  4KUD K;  4BAC A;  1K73 C;  4M75 B;  3FB9 A;  1TUC A;  4PJO F;  3PTA A;  1A0N B;  4ZGJ B;  1NM7 A;  1I5O B;  4MDW A;  3L2Q A;  1TUG B;  2JM9 A;  2HSE B;  5AYF A;  4E2F B;  1VQ8 T;  2EYZ A;  2YRD A;  2QGF B;  4J6W A;  3REA B;  1M1K C;  3QO3 A;  2I0N A;  1H3H A;  4Z02 A;  1I5L A;  2J7I A;  2E64 A;  1AZG B;  2DPP B;  2LT4 A;  1AWX A;  1RI0 A;  1YJW Q;  3M5A A;  3UDC A;  3H41 A;  4R0K A;  5GMK h;  3CCU T;  4N0A A;  3SWN B;  3LGF A;  5GAN d;  3CCQ A;  4M7A G;  1WHM A;  1B34 A;  5D7U A;  1S1N A;  1PRM C;  4M77 D;  2OI3 A;  2ROL A;  4ATO A;  2EQJ A;  2O01 E;  1ZSZ A;  1WIE A;  2DF6 A;  2A3L A;  1ZA1 B;  5KE3 A;  1MUZ A;  1AT1 B;  2E70 A;  3A8H B;  3MCA B;  5GAO q;  3CME Q;  4BDZ A;  3BW1 A;  1G3W A;  1VQO T;  2MOX A;  5HKC A;  2OTJ T;  1W2B P;  2RJE A;  4QQD A;  2QQS A;  2OAU A;  3RBB B;  2QDY B;  3OYJ A;  1VQO A;  1SF9 A;  2J6K A;  3HP9 A;  2ENM A;  3UWN A;  2PVG B;  2EGC A;  1N8R R;  2DVE A;  2AZS A;  2CH4 A;  4C8Q B;  2P84 A;  4QT7 A;  1WXB A;  1WXU A;  2VVK A;  3IQL A;  3CCE Q;  1TU0 B;  2R57 A;  4J9G A;  3A8O B;  2QI2 A;  2XDB A;  5LJ3 e;  4JJB A;  4M77 E;  3RDV A;  4FYY B;  4WF2 A;  3G6E T;  3E19 A;  1C0M A;  3CPW A;  1RAC B;  1MV3 A;  2GGR A;  4K11 A;  3QUI A;  3CCM A;  4QQG A;  1S72 A;  8AT1 B;  1VQN Q;  1HSQ A;  1GFC A;  3P8D A;  3BY7 A;  1WHL A;  4C8Q G;  1R0B G;  1XNI A;  1RUW A;  4XTW A;  1KG1 A;  1LVK A;  4J7F A;  2AHJ B;  3OS2 A;  2DD5 A;  3OYC A;  1MMD A;  1EZZ B;  1JBM A;  1D1A A;  4L6V 5;  1YP5 A;  3I5S A;  3CD6 T;  1K73 R;  3QWX X;  1ABO A;  3DB3 A;  3OSV A;  5CKH A;  2YUP A;  5LL6 S;  4FCY A;  1DJ7 B;  2V1R A;  1I8F A;  1M90 R;  1BBZ A;  3S3O A;  2PU9 B;  1RAI B;  1KQS A;  2EJ9 A;  2K3X A;  2GTO A;  2CH4 W;  3MPU B;  1Y0M A;  1D1C A;  2O4X B;  2JMA A;  3CQT A;  1VQ4 T;  4CRI A;  4RUG A;  1AOJ A;  4JDS A;  1NEG A;  2XD0 A;  2K3Y A;  5CIU A;  3LW5 E;  3MO8 A;  3QII A;  5HCK A;  2LX9 A;  4QVC A;  2XI9 A;  4E7I A;  2RHU A;  1S72 T;  1YJ9 A;  1JXM A;  1R77 A;  4Z8A A;  3JB9 J;  1XQH A;  4KRT A;  1YWO A;  3ME9 A;  1WA7 A;  1UHC A;  2RO0 A;  2RM4 A;  2W10 A;  2RJC A;  3M54 A;  1TWB A;  3OMC A;  1JEG A;  2X4W A;  3MEW A;  4Z89 A;  1Q81 R;  1B3Q A;  1RAE B;  1UJY A;  1WXT A;  4KBM B;  3ZFJ A;  1ZX6 A;  4RMO A;  2A7Y A;  3LX7 A;  2MWP A;  2DXT A;  2KNB B;  1VQK Q;  1IXD A;  2L2P A;  1YHQ T;  2LMJ A;  2LCC A;  2BIV A;  5CO7 A;  4RKU E;  3OS1 A;  2M9U A;  1RAB B;  2D0Q B;  4M7D A;  3CCS Q;  1ZBX A;  2BE7 D;  2RF0 A;  2C0T A;  4RTU A;  4OML A;  1W6X A;  3HL8 A;  3SHW A;  1TUD A;  1SSH A;  2MMP A;  3H9N A;  1D1B A;  5KYY B;  2EQK A;  1CKB A;  2DYI A;  2YRV A;  1YIT Q;  4XU1 A;  3CCV Q;  2PQW A;  3EG2 A;  4PKC C;  1JXO A;  2EAY A;  1X75 C;  2CP2 A;  2ZPI B;  2GFU A;  2VXE A;  3JB9 I;  3GBQ A;  4KUI A;  3MHX A;  1K0X A;  1KHC A;  2KQW A;  2KR3 A;  1PG5 B;  2VV5 A;  2DER A;  3EFR A;  2ECZ A;  1I81 A;  4ELY C;  1HD3 A;  1E7O A;  1K8A C;  2KT8 A;  2EYX A;  3GF5 A;  2KY9 A;  4OGC A;  2V26 A;  3EGD A;  5GJW B;  2FO0 A;  4LUD A;  4J9C A;  4DOV A;  1HK9 A;  2QQ9 A;  1RLQ C;  4PFO A;  1LPL A;  4A4K A;  4BY6 C;  3HTR A;  4ZGD B;  2CP5 A;  4C5H A;  5GAN e;  1X6O A;  2IVW A;  4JLI A;  4M77 B;  3VRZ A;  4OMM A;  3JCM W;  4C92 D;  1W70 A;  2DIQ A;  2LQN A;  2D8H A;  2JS0 A;  1K9A A;  4MZT A;  1P92 A;  5IXF A;  1Q86 U;  3VS6 A;  1JQQ A;  4OMF B;  5GAN 7;  3I55 A;  3EGD B;  1PSF A;  3KBG A;  3CME T;  3NMZ C;  4ORZ A;  1M8V A;  4M75 F;  1PD0 A;  1UJ0 A;  1UUE A;  1K8A U;  3WXM B;  1SPK A;  2O88 A;  1Q81 C;  4CC4 B;  4A54 A;  1YI2 T;  2B8A A;  3I5R A;  1UFF A;  4Y28 E;  5J39 A;  4PJO D;  5FW9 A;  3TEE A;  4EDU A;  4HT9 A;  1M4Z A;  2L5Q A;  4PJO B;  1QCF A;  3J80 E;  2WSF E;  3VYH B;  3L2R A;  1NJI C;  1NJI U;  3O5Z A;  1ABQ A;  1F1B B;  1OEB A;  3I56 A;  3CBO A;  2YUQ A;  5KYY A;  4M7A B;  3QSU A;  1KIK A;  3JB9 H;  3EGX B;  1TTH B;  4D8K A;  1RI9 A;  4JS4 A;  3ER0 A;  2D1X A;  4F7U B;  1QMC A;  3CC4 A;  2EBP A;  2VWF A;  2ZZD A;  3BDU A;  2AKK A;  2YDL A;  1G5V A;  1NJI R;  5FWC A;  1QVG A;  1YIJ A;  3HSB A;  3VUZ A;  4C8Q A;  3EFS A;  1WLP B;  3CCV T;  4CI0 C;  2HBW A;  3QJ6 A;  4M7D G;  2CRE A;  1WDX A;  4M77 F;  1MHN A;  3ULR B;  2VGM A;  1VQ5 A;  6AT1 B;  4LXC A;  4NS5 A;  2R5A A;  2P4T A;  4LDW A;  5FWB A;  5I2M A;  2EYQ A;  2KT1 A;  1N8R U;  3SWN C;  2DX1 A;  1J3T A;  4GY5 A;  2DJZ A;  4J9B A;  1NLP C;  2NUP A;  1VIF A;  1C1A A;  4XAX B;  2DRK A;  4LNP A;  2RQU A;  4JJC A;  2ABL A;  2DEQ A;  2LQ8 A;  1KJW A;  3UF4 A;  4ESR A;  3CD6 A;  2RJF A;  5CK9 A;  3WVE B;  3FEO A;  1NE8 A;  3HPW A;  4HVV A;  3QHS A;  3VS3 A;  1WFW A;  5L8R E;  2IPO B;  3FJ5 A;  1QP2 A;  4PJO G;  4AFU C;  4F04 B;  2LDM A;  3CXC S;  4J9H A;  4JZ4 A;  3CCM T;  2O2O A;  3LYI A;  4XTX A;  1MV0 B;  3I35 A;  3FDR A;  3VRY A;  2K2M A;  1X6G A;  4JJD A;  2KRO A;  3CC4 Q;  5KYX B;  2CYZ B;  4M7A F;  3I55 Q;  2DTH A;  1PCX A;  5FU7 C;  2P0K A;  2RB6 A;  3PGG A;  4M7A E;  2E4H A;  3MEU A;  3EH1 A;  2KXC A;  3VS2 A;  1VOM A;  3SEM A;  2RQR A;  4RTV A;  5IHI A;  2ATC B;  2V8K A;  4LDV A;  3CXC A;  3OYA A;  1QWF A;  2F2X A;  5GAN 8;  5CVI A;  2JTF A;  3S3N A;  2DL5 A;  2GQI A;  4J7I A;  2QTX A;  2H3J A;  3JSC A;  4PK4 A;  5M9O A;  1VQ9 Q;  5GAN g;  2OTJ A;  4N0A C;  2EQM A;  3C12 A;  1ZSG A;  4QVZ A;  3H0H A;  2K57 A;  3URG A;  3OW2 S;  3OYM A;  2RHX A;  2CP7 A;  2WAC A;  4OMN A;  1GCQ C;  2X3X D;  1VQP Q;  3CCR A;  3DLL A;  1ZHI A;  3MP6 A;  2HAX A;  1M30 A;  2BZY A;  2P0Q A;  2HL5 C;  5KYU A;  5FRO A;  2QA4 T;  5GAM j;  2Y90 A;  3CPF A;  2JTE A;  4ME7 A;  3EAE A;  2E6Z A;  2ROT A;  2DL8 A;  3BFM A;  1QVG S;  3M58 A;  1RAF B;  3E9F A;  1M90 U;  4EMK C;  4JPB W;  3CCS T;  1YI2 A;  2K5F A;  3R6O A;  1IHV A;  2ZPH B;  1JO8 A;  2GQV A;  3CD6 Q;  1VQ4 A;  3GLX A;  1VQM T;  4FSS A;  1G83 A;  1VQP A;  1I0C A;  4EMG A;  1G3T A;  2J6O A;  3NTI A;  2PVD B;  3JCM g;  5GAM e;  3JB9 G;  2EGE A;  1VQ9 A;  5KYW B;  4RTX A;  1NPR A;  1GBQ A;  3PE0 A;  3EGX A;  2FVU A;  4HT8 A;  4M7A A;  1U3O A;  1FYN A;  3LH0 A;  4ZN1 A;  4QQ6 A;  1Y96 B;  1ARK A;  1UGP B;  7AT1 B;  1VYU A;  1IO6 A;  4ELZ C;  1W2B A;  2VXF A;  5CKB A;  1VQP T;  4GLM A;  2A08 A;  2DJQ A;  1KK7 A;  2P4R A;  3RER A;  3G4S T;  1NEB A;  2FZK B;  2PVO B;  4HVW A;  4C92 A;  4II1 A;  1QQJ A;  2AT1 B;  3GNG A;  3Q1J A;  1T3L A;  3JCM X;  4X1V A;  3CC7 A;  2LCL A;  1YJ9 Q;  2DE0 X;  5KCO A;  9ATC B;  2RMO A;  2VYT A;  3RKY A;  2BZ8 A;  4PJO A;  1MMA A;  1X43 A;  5CQX A;  1X27 A;  2EJG A;  3MEA A;  3NTH A;  3VJP A;  3QYH B;  2GBQ A;  3M56 A;  1M27 C;  5LJ3 h;  5KH6 A;  4M78 B;  3PVL A;  4DEX A;  2K5I A;  3CPW P;  1TH7 A;  2FL7 A;  3SWN A;  4M78 D;  1UG1 A;  4IUR A;  3UT1 A;  1WJS A;  5GAO m;  2KEA A;  4AMC A;  2YLC A;  1AHJ B;  1VYT A;  4AFQ C;  3NFC A;  1WI7 A;  5GAM g;  2BZX A;  3L1A A;  2L3P A;  1FXX A;  4KH1 B;  1K8A R;  2DTI A;  2CDT A;  4N4I A;  1VQN A;  1X2K A;  2M0Y A;  4C0D C;  5GMK i;  3JCM f;  4O5V A;  4FYV B;  5IT9 E;  4PFP A;  5I11 A;  1YIT T;  4QW2 A;  4PJO C;  1OZ3 A;  2EW3 A;  3EFO A;  1YIJ Q;  5IN1 A;  2HL3 A;  1UHF A;  2DL7 A;  1VQ8 Q;  4C8Q F;  4M75 D;  3J81 E;  1D3B B;  1OQK A;  2X3W D;  1JB0 E;  4JLG A;  3L2W A;  1D0Z A;  4J9I A;  3G71 A;  5GAO p;  3CEY A;  2FYK A;  2QGG A;  3FRN A;  1MND A;  4M78 E;  1WZO A;  1VQ8 A;  2LCS A;  5LJ5 e;  4C0Z A;  2P0P A;  1S72 Q;  1QWE A;  4B9X A;  3CC7 T;  4IUU A;  4C92 C;  2CUB A;  1FMK A;  1C6V X;  2LJ3 A;  1FMW A;  4ZN3 A;  2DET A;  2CS7 A;  2PTK A;  1Q95 G;  5FRN A;  2XKO C;  3OQ5 A;  1ZQ1 A;  1VQL A;  1GCQ A;  1NPP A;  1Z9Q A;  2HNI A;  2DZ9 A;  3CMA A;  2PZ1 A;  2D8J A;  1IB8 A;  5C0M A;  4BD3 A;  4M75 C;  4Z88 A;  1WYX A;  2XU8 A;  1YCY A;  2HDA A;  2VAS A;  4C5I A;  4N4G A;  3L2V A;  3L2Z A;  2Z0W A;  3MET A;  4ZTJ A;  1ZBJ A;  4BB7 A;  4PLL A;  4OP0 A;  3OBY A;  2QK0 A;  4FL6 A;  2QQB A;  1YIJ T;  3DLM A;  4DQ2 A;  3G7Z A;  2KSS A;  1SRL A;  5DLO A;  2ZPE B;  4LDY A;  3CC4 T;  1Q86 C;  4X9D A;  2LQK A;  1AZE A;  4AG2 C;  3ZBD A;  5LJ5 f;  5CCA A;  3OYF A;  3M0Q A;  2MK5 A;  2QAZ A;  2F5K A;  1MMG A;  1YBY A;  3G1J A;  3E9G A;  1G3Y A;  1EFN A;  2CSI A;  2NYS A;  2JM8 A;  3FLG A;  2DNU A;  1BI3 A;  4P5N A;  4F7U F;  1N6A A;  3VU3 C;  3JCM b;  8ATC B;  1IZ6 A;  2LVM A;  3GP8 A;  3AHU A;  1NYG A;  3HFO A;  5GAM f;  5GMK e;  1JU5 C;  3JAM E;  4M7A D;  2JS2 A;  1B07 A;  3VUB A;  2E12 A;  1VQ6 A;  4O6J A;  2KMT A;  1PKT A;  2KGT A;  4E7S A;  2CKK A;  4EMK A;  5LJ3 g;  4UC4 A;  4DBR A;  2R58 A;  4F17 A;  5HK0 A;  1SG5 A;  1BIA A;  2X4J A;  2GTJ A;  4M7D E;  3QPH A;  2JVV A;  1PKS A;  3MP1 A;  3LLR A;  5CKE A;  3TRE A;  2HKQ B;  1OX8 A;  1KHI A;  4BDY A;  4IIO A;  2DKG A;  1JJ2 P;  3KXT A;  4FW1 A;  4A4F A;  4XU2 A;  2QEX Q;  2O9V A;  3OW2 A;  1NZ9 A;  1H8K A;  3OYD A;  3QWY A;  2I2L A;  2KK4 A;  2LJ1 A;  1VQK A;  2O4X A;  2A37 A;  4AFZ C;  5GMK l;  3CC7 Q;  2M0O A;  4LE9 A;  3SB2 A;  1X6B A;  1N9S A;  2V8J A;  4HCC A;  2FPD A;  2KE9 A;  4M75 E;  4M78 A;  3G71 T;  1K73 U;  3H6Z A;  2H8H A;  3H0F A;  2CUD A;  2EWN A;  3OYE A;  4XU3 A;  1KFZ A;  1OZ2 A;  3E2U A;  1QKX A;  4FT2 A;  2HQE A;  2CZ7 B;  2K5L A;  4NOY A;  3N5B B;  2LQW A;  3OYY A;  3UA6 A;  2J6F A;  1SHG A;  1K0S A;  2DD4 A;  3MEV A;  5LJ5 j;  3DB4 A;  1M1F A;  2RQW A;  2HD0 A;  3G4S Q;  2BUD A;  3P8B B;  2G3R A;  2HCK A;  1UDL A;  3V8J A;  1H64 1;  1Y96 A;  4FIB A;  4B6M A;  1VQ5 T;  4GBQ A;  1GBR A;  2HQX A;  2M02 A;  3A98 A;  4BI3 A;  3JCM Q;  2BKD N;  1B34 B;  1RLP C;  1VQ7 T;  4RG8 A;  4J5Y A;  2DXU A;  3OMG A;  1SEM A;  4OVA A;  3GNF B;  1PNJ A;  4LDU A;  1K9M R;  2DRM A;  1KQS S;  1O75 A;  3TVT A;  4FT4 A;  2SEM A;  4FSX A;  3M0T A;  1SHF A;  4IUT A;  3U23 A;  3RMS A;  4KUL A;  3LH5 A;  3CCE A;  3FJP A;  2CT3 A;  4GLK A;  1M1K U;  1R0C B;  1YFN A;  2XMF A;  2DO3 A;  2FPE A;  4RTZ A;  1VQL Q;  1K9M U;  4E7H A;  1KC8 U;  5D6X A;  2DAQ A;  1MMN A;  2KVQ G;  4C8Q E;  2JZ2 A;  3HHT B;  4BE0 A;  3HRS A;  4M77 C;  2MYS A;  5GAO l;  3EG9 B;  1LOJ A;  1ZUY A;  3NHN A;  3REB B;  1OV3 A;  4XTZ A;  5KYU B;  3MKD A;  1T0H A;  3O8V A;  2DM1 A;  3VS1 A;  1U1S A;  1IGU A;  1Y57 A;  2HEQ A;  1GL5 A;  2LNH B;  2SRC A;  3M0P A;  4M78 F;  3R6N A;  5GAN 3;  2EQI A;  4XTU A;  1V1C A;  4KH0 B;  1KC8 R;  4KT0 E;  2EIF A;  1W1F A;  1PC0 A;  2XIC A;  4HA8 A;  3GIB A;  1EIF A;  2YRC A;  1QP3 A;  1OX9 A;  1D0Y A;  2NUP B;  1MNE A;  3OYK A;  2OTL Q;  2RHI A;  2ZAE A;  1Y07 A;  1AWJ A;  2HSP A;  4F16 A;  1VQK T;  3V7S A;  4XU0 A;  4E7Z A;  1WJQ A;  4BE1 A;  4RTW A;  1ZUU A;  1V76 A;  1YN8 A;  4E7J A;  2YLB A;  5KE2 A;  4C8Q D;  2OX7 A;  3PMT A;  1OYX A;  1N8R C;  1NG2 A;  4PJN A;  2LX7 A;  1TS9 A;  2K3B A;  5KYX A;  3ZEH A;  3CC2 A;  5CR2 A;  4F14 A;  3PMI A;  5IAY A;  5GAN f;  4RG2 A;  2WSE E;  2BTT A;  2OJ2 A;  2E41 A;  1UGR B;  1VQ4 Q;  2K79 A;  2O9S A;  2W0Z A;  1Z9Z A;  2QXF A;  1YJN T;  1WHH A;  2ED0 A;  1Q82 U;  2X9H A;  3RMQ A;  4E7L A;  2GCX A;  4V2S A;  2VB6 A;  3JCM V;  3CXC P;  1BU1 A;  5FRM A;  2E5K A;  3V8K A;  2LNV A;  1PSE A;  2HKN A;  1BYM A;  1M2V A;  4A53 A;  4MDX A;  1TSF A;  3M0S A;  4J6X A;  4JUV A;  4Q5W A;  5GAM h;  1Q82 R;  2C06 A;  1Q7Y U;  1WHG A;  2YUO A;  1V29 B;  2KRM A;  4D6W A;  4F7U A;  1KD1 U;  4R56 A;  1GRI A;  1M5Q 1;  3EHQ A;  4PLI A;  3UPU A;  4FYX B;  2OAW A;  1QVP A;  3HRT A;  3JCM e;  4NL3 A;  2LJ0 A;  2CZ0 B;  2EQU A;  2KBT A;  2F2W A;  4J8O A;  3G6E Q;  4QKU A;  2X51 A;  2CZ6 B;  2X35 A;  3M9Q A;  3PIO A;  1YI2 Q;  3JCM P;  3EG3 A;  2NUT A;  2DA9 A;  4ZTF A;  2J06 A;  4M78 G;  3X28 B;  2MCN A;  4FW2 A;  1M9S A;  2ZPF B;  1CSK A;  2EYY A;  4IIM A;  4XK8 E;  3C4S A;  1M1G A;  2QTV A;  3EG0 A;  2L0A A;  3LGL A;  4J83 A;  1M3A A;  3A5Z B;  2DMO A;  1YJ9 T;  2D0N A;  1YJN Q;  4KGZ B;  2DXC A;  2NWM A;  1VQM A;  4M78 C;  3CCL T;  3OW2 P;  2MF2 A;  3JCM c;  4MZP A;  4WCI A;  2QA4 Q;  4EIK A;  5CKF A;  2DFU A;  4PJL A;  1QKW A;  1LNX A;  1PD1 A;  4KGV B;  4EPC A;  2E5Q A;  2FZG B;  4C0F A;  1PWT A;  4PNO A;  1I4K 1;  5D6W A;  1VUB A;  3QG1 A;  1X69 A;  4OB0 B;  3VS5 A;  2RI3 A;  2YHT A;  4DA4 A;  3CCR Q;  4C0D B;  2E65 A;  2Y4X A;  2FB7 A;  3I56 T;  1WNL A;  5J3B A;  3X20 B;  4RCB A;  5GAN 2;  3BDL A;  3OSS C;  2CP6 A;  4DBH A;  2CZ1 B;  4C92 G;  3PT9 A;  2QA4 A;  2DVJ A;  1BI1 A;  5CAI A;  4M4Z A;  1UTI A;  2COY A;  3VKI A;  2F2V A;  3BE3 A;  1NBE B;  5KCH A;  2RNA A;  3KFV A;  3M0U A;  4E7K A;  2RH2 A;  5J26 A;  1H92 A;  1M2O A;  3A8L B;  3LWI A;  1M2V B;  1YJN A;  3M53 A;  1H3Z A;  1NYF A;  1QW1 A;  5FLX E;  2ESW A;  3CPW S;  2COZ A;  4AG1 C;  2KRN A;  2LT1 A;  5A0G A;  1JJ2 A;  1VIE A;  1SKU B;  1RAH B;  2A36 A;  2MPX C;  4B9W A;  4XTY A;  3CMA Q;  3QZ9 B;  4C92 B;  2JT4 A;  4OB1 B;  4OF1 A;  3QBY A;  3X26 B;  3EH2 A;  2AKL A;  5L23 A;  2JJ9 A;  3INZ A;  3CBM A;  1BI2 A;  2RPN A;  1X2Q A;  2E10 A;  2NLU A;  5EC7 A;  3PNW C;  3CCQ T;  1U5S A;  1UGQ B;  3CCU A;  1WPY A;  4PJJ A;  2DYB A;  1X01 A;  4RCC A;  1ZSZ B;  4A4E A;  4L5G A;  3RKX A;  3RNJ A;  2CP0 A;  4OMO A;  4FYW B;  4MZM A;  2GFA A;  2HBP A;  1XJW B;  3X24 B;  3EFO B;  3C0C A;  3NTK A;  1K9M C;  1M8M A;  2EGA A;  2XDP A;  4PJO E;  1AWW A;  3H8Z A;  3VV0 A;  1Q81 U;  4MML A;  1TOV A;  3THK A;  3SDZ A;  3OY9 A;  1VQ5 Q;  3P8H A;  1IRE B;  2M1H A;  1OPK A;  2FRY A;  4EMH A;  5C6S A;  2YWW A;  1N5Z A;  2DBK A;  2LP5 A;  5GAN 6;  2Y4Y A;  3C94 A;  3CCU Q;  5AT1 B;  1W4S A;  4ZNX A;  3OB9 A;  3A8M B;  3EG9 A;  4FU6 A;  4JRI A;  4M75 G;  4L59 A;  4PJM A;  2KYM A;  2BE9 B;  1M3B A;  2DIL A;  2R5M A;  1AD5 A;  3NPF A;  1FX7 A;  1MGQ A;  3I56 Q;  2M51 A;  5LJ3 j;  3CCE T;  1QCO A;  3KUF A;  1OPL A;  1UB4 A;  2O31 A;  3M59 A;  3JB9 D;  1I07 A;  2FZC B;  2VGN A;  2DZC A;  4F7U G;  3NGP A;  1WX6 A;  2EKO A;  1RL2 A;  3TSW A;  1M1K R;  3VS7 A;  2K4Y A;  3JV3 A;  1E6G A;  2LC4 A;  5FU6 B;  3PFS A;  2RI2 A;  4LDX A;  1VQ7 A;  3SFM A;  1M3C A;  1YHQ Q;  4M7D F;  1YJW T;  3QXE B;  2MWO A;  2PUK B;  2AIR B; 
#chains in the Genus database with same CATH homology
 1H64 1;  2DTH A;  4ZGJ B;  1Y96 A;  5FU7 C;  4FIB A;  3L2Q A;  4MDW A;  2X4Y A;  1VQ5 T;  3TCJ A;  1U1T A;  2P0K A;  5AYF A;  4BI8 B;  4FM4 B;  4C5G A;  4E47 A;  3FC3 A;  1VQ8 T;  2RB6 A;  2HQX A;  3PGG A;  3CCL A;  3J7A F;  2L89 A;  4J6W A;  4M7A E;  3MEU A;  1JRI A;  3OBW A;  3QO3 A;  1M1K C;  1O9S A;  4BI3 A;  4Z02 A;  1I5L A;  2V8K A;  2OTL T;  2ZCF B;  2BKD N;  4LDV A;  1B34 B;  3JRZ A;  3OS5 A;  3JCM Q;  3OYA A;  3CXC A;  1VQ7 T;  4RG8 A;  4J5Y A;  5GAN 8;  2E64 A;  5CVI A;  2JTF A;  2DXU A;  3OMG A;  3S3N A;  4J7I A;  4OVA A;  4NL2 A;  2DPP B;  2LT4 A;  2QTX A;  3GNF B;  1RI0 A;  4LDU A;  1HXD A;  2H3J A;  3M5A A;  3UDC A;  1KQS S;  3JSC A;  2ZGW A;  1O75 A;  5GMK h;  5M9O A;  3CCU T;  4FT4 A;  4N0A A;  5GAN g;  3SWN B;  3LGF A;  5GMK m;  5GAN d;  4FSX A;  4YTL A;  5FU7 B;  3CME A;  3CCQ A;  3S3M A;  4N0A C;  4M7A G;  2EQM A;  2OTJ A;  4IUT A;  1G3S A;  1GXI E;  3C12 A;  1B34 A;  4QVZ A;  3I55 T;  2K57 A;  3URG A;  3OW2 S;  3OYM A;  3RMS A;  4KUL A;  2RHX A;  3LWH A;  2F5T X;  4M77 D;  2WAC A;  2QQR A;  3V7C A;  3CCE A;  3FJP A;  4GLK A;  3CCR A;  4ATO A;  1M1K U;  2EQJ A;  2O01 E;  3DLL A;  1ZHI A;  4R55 A;  3MP6 A;  2DO3 A;  5LJ5 g;  2A3L A;  5KE3 A;  1K9M U;  4E7H A;  3QJY A;  4OB3 B;  2V8I A;  2QQA A;  1KC8 U;  2HAX A;  3V7R A;  2E70 A;  5D6X A;  2DAQ A;  2RD1 A;  5A0L A;  1WGS A;  2P0Q A;  3A8H B;  2KVQ G;  3MCA B;  3RES A;  5FRO A;  4C8Q E;  5GAO q;  2JZ2 A;  3HHT B;  1Y7X A;  2QA4 T;  3HRS A;  5GAM j;  4M77 C;  4BE0 A;  4IKF A;  4BDZ A;  5GAO l;  2Y90 A;  1LOJ A;  3BW1 A;  3CPF A;  1G3W A;  4XTV A;  4ME7 A;  1VQO T;  4XTZ A;  3EAE A;  2E6Z A;  5HKC A;  3CCS A;  3FIF A;  2OTJ T;  2RJE A;  3O8V A;  4QQD A;  4DOW A;  1U1S A;  3BFM A;  2QQS A;  1QVG S;  3M58 A;  3E9F A;  2OAU A;  4M78 F;  5GAN 3;  1M90 U;  4EMK C;  2QDY B;  4XTU A;  3OYJ A;  3QDR B;  3CCS T;  5GAO r;  1YI2 A;  1VQO A;  2K5F A;  4KT0 E;  3F70 A;  2EIF A;  1YIT A;  3R6O A;  3OYB A;  2XIC A;  4HA8 A;  3HP9 A;  3GIB A;  1EIF A;  3UWN A;  1QP3 A;  2PVG B;  2ZPH B;  2GQV A;  3QYG B;  1VQ4 A;  2DVE A;  2XK0 A;  3GLX A;  5DY9 A;  1VQM T;  4C8Q B;  1BKB A;  3OYK A;  2RHI A;  1VQP A;  2X4X A;  4EMG A;  5DM7 R;  1G3T A;  1Y07 A;  2R57 A;  3A8O B;  2QI2 A;  3NTI A;  3PIP A;  2XDB A;  5GAN 4;  2PVD B;  4EMK B;  5LJ3 e;  4M77 E;  4M75 A;  3JCM g;  2RJD A;  4WF2 A;  3G6E T;  3V7S A;  1VQK T;  5GAM e;  3E19 A;  3JB9 G;  4XU0 A;  3WVD B;  2JTM A;  1WJQ A;  4BE1 A;  3CPW A;  1VQ9 A;  2VC8 A;  4E7J A;  1NPR A;  3QZ5 B;  3QUI A;  3CCM A;  1KQ1 A;  4C92 E;  4QQG A;  3V8L A;  4OGE A;  4JRP A;  2YLB A;  2FVU A;  5LJ3 f;  2K2V A;  4HT8 A;  5KE2 A;  4M7A A;  1S72 A;  4C8Q D;  3LH0 A;  3PMT A;  1OYX A;  3P8D A;  1N8R C;  4ZN1 A;  3BY7 A;  2L8D A;  4QQ6 A;  1Y96 B;  1UGP B;  4C8Q G;  4TVR A;  1XNI A;  3ASK A;  4XTW A;  4ELZ C;  1KG1 A;  1W2B A;  2VXF A;  4J7F A;  2AHJ B;  3M57 A;  2DD5 A;  2DTO A;  3ZEH A;  3OS2 A;  4QVD A;  3OYC A;  3CC2 A;  5CKB A;  5CR2 A;  1VQP T;  1JBM A;  1WJR A;  1JJ2 S;  3PMI A;  4L6V 5;  5IAY A;  5GAN f;  3G4S T;  3CD6 T;  4RG2 A;  3RER A;  2WSE E;  3JCM d;  3DB3 A;  3OSV A;  5CKH A;  5LL6 S;  2PVO B;  4C92 A;  2E41 A;  1DJ7 B;  2XID A;  4II1 A;  1I8F A;  1UGR B;  3CC2 T;  1QVF S;  3GNG A;  3Q1J A;  4HCZ A;  3S3O A;  2PU9 B;  3JCM X;  2QXF A;  4MMK A;  3CC7 A;  2LCL A;  3RUX A;  1KQS A;  1YJN T;  2EJ9 A;  2K3X A;  4BE2 A;  1Q82 U;  5KCO A;  1WQW A;  3RMQ A;  2MI6 A;  1YHQ A;  3OYL A;  3M4G A;  2VYT A;  2O4X B;  3RKY A;  3VYG A;  4E7L A;  2MAM A;  3OS0 A;  2DK3 A;  1VQ4 T;  4CRI A;  4PJO A;  1XOV A;  3DKM A;  4JDS A;  1OI1 A;  2GCX A;  2XD0 A;  5CQX A;  2K3Y A;  2QEX A;  5CIU A;  1KQ2 A;  4V2S A;  3LW5 E;  3MO8 A;  3JCM V;  2EJG A;  3MEA A;  3NTH A;  4JRK A;  2VUB A;  5FRM A;  3V8K A;  2LNV A;  3VJP A;  1PSE A;  3QII A;  3M56 A;  3QYH B;  2LX9 A;  4QVC A;  2XI9 A;  1BYM A;  4A53 A;  3GOX A;  4JRQ A;  2RHU A;  4E7I A;  5LJ3 h;  4MDX A;  5KH6 A;  4M78 B;  5GMK j;  4J6X A;  1YJ9 A;  2K5I A;  4JUV A;  4M77 A;  1S72 T;  1TH7 A;  4Q5W A;  5GAM d;  2FL7 A;  4J6Y A;  5GAM h;  2C06 A;  1Q7Y U;  3JB9 J;  1XQH A;  2E1H A;  3SWN A;  4M78 D;  1V29 B;  4D6W A;  4F7U A;  1KD1 U;  4VUB A;  4R56 A;  1M5Q 1;  1WQ7 A;  4IUR A;  3UT1 A;  4M7D B;  4PLI A;  1WJS A;  4C0G A;  5GAO m;  3UPU A;  3ME9 A;  3SD4 A;  2RO0 A;  3JCM J;  2RM4 A;  1QVP A;  2RJC A;  2YLC A;  3HRT A;  3M54 A;  3L2U A;  3OMC A;  3JCM e;  3CMA T;  2OTL A;  1AHJ B;  2X4W A;  3NFC A;  5GAM g;  3L1A A;  3MEW A;  1VQL T;  4N4H A;  1FXX A;  2RHY A;  4A4H A;  4NL3 A;  2CZ0 B;  4KBM B;  2F69 A;  2DTI A;  3ZFJ A;  4RMO A;  4N4I A;  2EQU A;  2A7Y A;  1VQN A;  3LX7 A;  2MWP A;  2DXT A;  3QKJ A;  4J8O A;  3OYH A;  4C0D C;  5GMK i;  3JCM f;  4O5V A;  2CGH A;  2CZ6 B;  2X35 A;  3M9Q A;  5IT9 E;  3PIO A;  2RHZ A;  1YHQ T;  2PUO B;  3JCM P;  1YJW A;  2LCC A;  1YIT T;  2BIV A;  5CO7 A;  4LD6 A;  4QW2 A;  4RKU E;  4PJO C;  1OZ3 A;  3OS1 A;  4ZTF A;  2M9U A;  4M7D C;  2D0Q B;  2JNG A;  4M78 G;  4M7D A;  3X28 B;  5IN1 A;  1M9S A;  1ZBX A;  4ZGE B;  2ZPF B;  4C8Q F;  4XK8 E;  1KC8 C;  3C4S A;  4M75 D;  1M1G A;  3OYG A;  5GAN h;  3LGL A;  3HL8 A;  3J81 E;  1D3B B;  2MMP A;  4J83 A;  1JB0 E;  4JLG A;  3L2W A;  3A5Z B;  1YJ9 T;  2RK1 A;  4HKE A;  3G71 A;  1N9R A;  2ZPG B;  4XQ3 A;  2EJF A;  3PTA A;  2RA2 A;  2EQK A;  5GAO p;  1FWZ A;  3CEY A;  2DXC A;  2FYK A;  2YRV A;  3FRN A;  4M78 E;  1VQM A;  5GAO n;  4XU1 A;  4M78 C;  2QEX T;  3CCL T;  2PQW A;  1VQ8 A;  4PKC C;  3CCR T;  2D9T A;  2MF2 A;  3JCM c;  2EAY A;  4F7U E;  1X75 C;  4MZP A;  5LJ5 e;  1U8R A;  2ZPI B;  4C0Z A;  2GFU A;  2VXE A;  3JB9 I;  2P0P A;  5GAN j;  4IUP A;  4KUI A;  5CKF A;  5A2Q E;  3MHX A;  1LNX A;  2WSC E;  2KDS A;  4B9X A;  1D3B A;  3CC7 T;  4EPC A;  3OYN A;  4IUU A;  4C92 C;  1KHC A;  2E6N A;  2FHD A;  2KQW A;  2E5Q A;  1N27 A;  2VV5 A;  4ZN3 A;  5CKD A;  1VQN T;  5HY6 A;  4C0F A;  3EFR A;  2CS7 A;  4PNO A;  1I81 A;  4ELY C;  5FRN A;  1K8A C;  1I4K 1;  2XKO C;  1VUB A;  5D6W A;  3OQ5 A;  4BUG A;  1ZQ1 A;  3GF5 A;  3QG1 A;  1VQL A;  2KY9 A;  1NPP A;  4OB0 B;  4OGC A;  2HNI A;  2DZ9 A;  2RI3 A;  3HRU A;  1R8O B;  2YHT A;  3CMA A;  4DA4 A;  1BIB A;  4OB2 B;  5C0M A;  1W2B S;  4BD3 A;  4C0D B;  2E65 A;  4M75 C;  4DOV A;  1HK9 A;  2XU8 A;  1YCY A;  2QQ9 A;  2Y4X A;  1M90 C;  3C95 A;  2FB7 A;  2RI5 A;  1KD1 C;  4C5I A;  3I56 T;  4A4K A;  4N4G A;  3L2V A;  4BY6 C;  1WNL A;  5J3B A;  3L2Z A;  4RCB A;  3X20 B;  3MET A;  4ZGD B;  4ZTJ A;  5I21 A;  5GAN 2;  2EFI A;  3BDL A;  4BB7 A;  4PLL A;  3OSS C;  4OP0 A;  3OBY A;  4C5H A;  5GAN e;  4M7A C;  1X6O A;  2D6F A;  2IVW A;  4FL6 A;  4JLI A;  4M77 B;  2CZ1 B;  3CBP A;  3T9N A;  4C92 G;  2JUF A;  3PT9 A;  2QA4 A;  3JCM W;  5FU6 C;  1BI1 A;  5CAI A;  2QQB A;  4C92 D;  1YIJ T;  3HFN A;  2DIQ A;  3VKI A;  3DLM A;  4DQ2 A;  3G7Z A;  4BI4 A;  5KCH A;  4IUQ A;  2KSS A;  5GAN 5;  4M77 G;  4E7K A;  2RH2 A;  2KAF A;  4MZT A;  1P92 A;  5J26 A;  5DLO A;  2ZPE B;  3A8L B;  4LDY A;  3CC4 T;  4X34 A;  3LWI A;  1YJN A;  3MP8 A;  3M53 A;  1Q86 C;  1UEB A;  4X9D A;  2LQK A;  1UGS B;  1Q86 U;  1H3Z A;  3ZBD A;  1QW1 A;  5FLX E;  5EG2 A;  5LJ5 f;  5DLQ E;  4OMF B;  5CCA A;  3CPW S;  5GAN 7;  4LD9 K;  3OA6 A;  2LT1 A;  3I55 A;  3OYF A;  5A0G A;  1JJ2 A;  3JB9 F;  1VIE A;  1PSF A;  5CQY A;  2F5K A;  2IG0 A;  2RK2 A;  3KBG A;  4B9W A;  3CME T;  4XTY A;  3G4S A;  3QZ9 B;  4C92 B;  1M8V A;  4OB1 B;  4M75 F;  1YBY A;  4OF1 A;  3E9G A;  1G3Y A;  3QBY A;  3X26 B;  3FLG A;  1K8A U;  3WXM B;  3INZ A;  3CBM A;  1BI2 A;  1Q81 C;  4A54 A;  1YI2 T;  1BI3 A;  4P5N A;  2B8A A;  3M4Y A;  3E1S A;  2E10 A;  4F7U F;  1SSF A;  1N6A A;  2NLU A;  3PNW C;  1UGQ B;  3CCQ T;  2M16 A;  3CCU A;  1WPY A;  3VU3 C;  4Y28 E;  3JCM b;  4M7D D;  5J39 A;  1X01 A;  1IZ6 A;  4IUV A;  4PJO D;  4RCC A;  2LVM A;  2L3R A;  3TEE A;  3GP8 A;  4A4E A;  3AHU A;  4BY6 B;  1Y71 A;  3HFO A;  5GAM f;  5GMK e;  4EDU A;  1VQ9 T;  4M7A D;  3JAM E;  4L5G A;  3RKX A;  4HT9 A;  1M4Z A;  2L5Q A;  4PJO B;  3J80 E;  2WSF E;  3VUB A;  3VYH B;  2JN0 A;  3L2R A;  1NJI C;  1Q82 C;  2E12 A;  1NJI U;  1VQ6 A;  4JJN K;  2XHC A;  4MZM A;  2GFA A;  4O6J A;  3CCV A;  3I56 A;  3CBO A;  2KMT A;  4Y91 A;  5A0D A;  2HBP A;  3X24 B;  2CKK A;  4EMK A;  2DXB A;  4M7A B;  4UC4 A;  5LJ3 g;  3QSU A;  2R58 A;  3JB9 H;  5HK0 A;  3NTK A;  1BIA A;  2X4J A;  1K9M C;  4M7D E;  3QPH A;  3GPL A;  2XDP A;  5D6Y A;  4JS4 A;  4PJO E;  3S6W A;  3ER0 A;  1VQ6 T;  4F7U B;  3H8Z A;  3VV0 A;  3OYI A;  2JVV A;  3MP1 A;  4MML A;  1Q81 U;  3LLR A;  3CC4 A;  1QVF A;  5CKE A;  3TRE A;  3SDZ A;  3OY9 A;  2ZZD A;  3RIR A;  3BDU A;  1KHI A;  1G5V A;  3P8H A;  4BDY A;  2DKG A;  5LJ5 h;  1QVG A;  4C8Q C;  3KXT A;  1YIJ A;  3HSB A;  1LJO A;  1IRE B;  2M1H A;  3VUZ A;  4EMH A;  4C8Q A;  4A4F A;  5C6S A;  4XU2 A;  3EFS A;  3CCV T;  3CCJ A;  4CI0 C;  4A4G A;  4JS5 A;  3OW2 A;  1NZ9 A;  4HCB A;  5GAN 6;  3QJ6 A;  4M7D G;  3OYD A;  2Y4Y A;  3C94 A;  2I2L A;  1XTD A;  2KK4 A;  1MHN A;  4M77 F;  4C5E A;  2VGM A;  1VQ5 A;  2XDD A;  5HK3 A;  3G6E A;  1VQK A;  2O4X A;  3HKS A;  1W4S A;  2ZPB B;  5GMK l;  4NS5 A;  3OB9 A;  2R5A A;  2M0O A;  2P4T A;  3A8M B;  3SB2 A;  4LDW A;  2EYQ A;  5I2M A;  4FU6 A;  5LJ3 d;  4JRI A;  4C92 F;  4M75 G;  1N9S A;  4L59 A;  2V8J A;  5I2S A;  4X9C A;  3SWN C;  1N8R U;  2LTO A;  4HCC A;  4M75 E;  2LRQ A;  4M78 A;  3G71 T;  1K73 U;  2R5M A;  3H6Z A;  4GY5 A;  1BI0 A;  3RKW A;  1FX7 A;  2DJZ A;  1MGQ A;  1VIF A;  5LJ3 j;  4XAX B;  3CCE T;  2EWN A;  2GF7 A;  2DEQ A;  2LQ8 A;  3X25 B;  5LJ5 d;  3KUF A;  4XU3 A;  3OYE A;  1OZ2 A;  2JOY A;  3CD6 A;  3TU4 K;  2RJF A;  5CK9 A;  3A8G B;  1UB4 A;  1Q7Y C;  3WVE B;  3FEO A;  3M59 A;  3CCJ T;  3JB9 D;  3L42 A;  1NE8 A;  2VGN A;  3HPW A;  4FT2 A;  2DZC A;  2HQE A;  4F7U G;  2CZ7 B;  2DIG A;  2XG8 D;  3QHS A;  2K5L A;  4NOY A;  5L8R E;  3N5B B;  2EKO A;  3M55 A;  1RL2 A;  1QP2 A;  4PJO G;  2K4Y A;  3JCM h;  2LDM A;  4PL6 A;  3CXC S;  3OYY A;  4KUD K;  2LC4 A;  5FU6 B;  3PFS A;  3CCM T;  2RI2 A;  4BAC A;  4LDX A;  1VQ7 A;  2DD4 A;  3LYI A;  3MEV A;  4XTX A;  5LJ5 j;  3FDR A;  1K73 C;  4M75 B;  3SFM A;  3DB4 A;  4M7D F;  1M1F A;  2HD0 A;  3FB9 A;  4PJO F;  2BUD A;  1YJW T;  3P8B B;  2G3R A;  3QXE B;  2MWO A;  2CYZ B;  2PUK B;  3V8J A;  4M7A F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...