4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
5GAOl 4M75C 4XTUA 3INZA 4XTYA 5I21A 3M4GA 4A54A 4HT8A 5GAOq 1LOJA 2E1HA 2DKGA 4C8QA 4RCCA 5GAMg 1I81A 4JLIA 1LNXA 3V7RA 4QVDA 2VXFA 5LJ3j 3RKYA 5LJ3d 4N0AA 2E10A 3L2ZA 4C8QC 2EAYA 2DEQA 2ZGWA 1JRIA 1B34A 3JCMQ 4M75E 5GANh 4M78A 5GAN7 3JB9G 3JCMh 3JCMV 4PNOA 4PJOD 5GAMe 3QUIA 4M7AD 3JCMW 3SB2A 4C8QF 5GAN8 5GANf 4J6XA 3JCMJ 4N0AC 4NL3A 3QO3A 3JCMf 4C8QB 5LJ5f 3RIRA 5GAOr 5GAN3 1Y96A 4M75G 1HXDA 5GANe 4XTVA 2DTOA 4M78C 1N9RA 1WQWA 3JB9F 4J5YA 5LJ5e 3JCMe 3JCMX 3QHSA 1X01A 1JBMA 3V8KA 4X9DA 4C8QE 4C92D 1H641 3V7CA 4OP0A 3RKXA 1B34B 3BDUA 4M75F 4M78B 3SWNB 1BIBA 2DTIA 4M75B 4F7UE 4JUVA 4C92C 1BIAA 2CGHA 4C8QG 1KQ1A 4F7UA 5GAOp 3JB9I 3JCMc 3JCMb 5GANg 3JB9J 4EMKA 1U1SA 2DZCA 5LJ5g 4M78E 3JCMg 3QSUA 2RA2A 4WF2A 1HK9A 1WQ7A 4F7UG 4PJOA 3FB9A 4M7AA 5GAMd 4HT9A 1N9SA 3JCMP 2DJZA 2RB6A 3PGGA 3EFRA 1M5Q1 3GIBA 5GAN4 2DTHA 4EMKC 4JRKA 4M78G 4MMKA 4PJOG 5GAOn 3HFNA 1I5LA 3VU3C 4J6WA 4M7DD 4M77D 4XU2A 5LJ3h 4Y91A 4F7UF 1U1TA 4NL2A 4C92E 4M7AC 2I2LA 1M8VA 4F7UB 2QTXA 4C92A 2YLBA 1LJOA 5LJ3f 4NOYA 4EMKB 2EWNA 2EJFA 2YHTA 4M78F 4PJOF 5GAN6 2DXTA 4M7DC 1I8FA 2YLCA 4JRIA 4A53A 4PJOB 4M7AB 4QVCA 4C92G 5GMKj 2E65A 5LJ3e 3JB9D 2DVEA 2K57A 4J6YA 4PJOC 2DZ9A 4EMGA 2VC8A 3HSBA 1TH7A 3V8JA 4XTWA 3RKWA 4XTXA 1Y96B 2RM4A 4M75D 4PJOE 2E64A 4M7AE 4C92F 5GAMj 1WPYA 3BW1A 4C92B 4DQ2A 3JB9H 2FB7A 1D3BA 4M7DE 4M77E 2HNIA 5LJ3g 5GMKh 5GAN2 5GANj 4M7AG 4M7DA 5GANd 4M77A 5LJ5j 3BFMA 3AHUA 5GMKm 5LJ5d 3JCMd 4XU0A 2EJ9A 4XU3A 4XU1A 2JN0A 2VXEA 3EFSA 4C8QD 2EJGA 2Y90A 4M7DG 4M77G 3RERA 5DY9A 3L1AA 4HA8A 1WNLA 5GMKe 5GAMh 4M7AF 5GAN5 3HFOA 4M77C 3RUXA 3V7SA 4MMLA 5GAOm 5GAMf 1YCYA 2FYKA 1MGQA 1D3BB 4M7DF 4EMHA 4M77F 4RCBA 2DXUA 4XQ3A 4M78D 3SWNA 5LJ5h 4M75A 5GMKi 5GMKl 4M77B 4X9CA 1KQ2A 4M7DB 3BY7A 3FJPA 3V8LA 4V2SA 3FIFA 1I4K1 4XTZA 3RESA 2E41A 2RD1A 5CAIA 3SWNC
chains in the Genus database with same CATH superfamily
4XTUA 2HCKA 2P4TA 3NTKA 1AWJA 2EGCA 2CT3A 2P0KA 1K9MU 2E1HA 3M57A 5CKFA 5FRNA 1FMWA 2DM1A 1Z9ZA 2EQIA 1I1JA 1Q82U 2RQRA 5DLQE 5M9OA 2F2VA 2QQRA 2L3PA 2ZPBB 4XK8E 4M7AD 1MMNA 3JCMW 2LT4A 3THKA 1TUCA 4M78C 1YJNA 1JEGA 2RQVA 1ZSGA 2DPPB 2K9GA 4M78B 4ZGEB 2MMPA 2QGGA 4F14A 1XQHA 3JCMg 3QSUA 3EG0A 4HCBA 3HL8A 2QYZA 3REAB 5KYUB 4IURA 3BDLA 1Q7YC 3VS1A 2EWNA 1R77A 1ZHIA 4DBQA 3CCST 4LD9K 3QWXX 2L2PA 2RK1A 3I55Q 4PJOE 1QW1A 2J6FA 4BI3A 2D6FA 4E7HA 4R55A 4M7DA 3CMEA 2F69A 2P0PA 1H3HA 1BI3A 1Q7YU 2FL7A 1EZZB 5KCOA 1SHFA 2RN8A 2LCCA 1N8RC 4J9BA 1GCPA 3A8HB 4J9CA 2DK3A 4L5GA 3FC3A 2H8HA 4Z8AA 4KUDK 1VQLA 5I22A 3CPWS 4ESRA 4A54A 2HQHA 2NUTB 3KBGA 1NM7A 2CH4A 1VQ6A 3M4YA 2DD5A 1YITT 3QG1A 2EAYA 1JRIA 3OYKA 3JB9G 1ZSZA 3MP1A 3L2QA 3OS0A 3I55T 3QO3A 4E6RA 2K3YA 2LTOA 3MKDA 4XTVA 3JCMX 3QHSA 4C92D 1I0CA 1ZUUA 1YFNA 1O75A 1RI0A 1EX4A 2DTIA 5CKDA 4KT0E 2QQBA 1PM3A 3ZFJA 4EMKA 2HKNA 4PL6A 1LPLA 2K5FA 4TVRA 1PNJA 4FW2A 3X24B 3G71Q 3M58A 3LW5E 2LCSA 1PSEA 5GAN4 2RHIA 3MP8A 2FHDA 2E3IA 5KE3A 3MP6A 2DNUA 5GJWB 1WJQA 2XHCA 1NYGA 4YTLA 1I8FA 3CCMA 2HSPA 1SRMA 4J6YA 2CSIA 4A63B 2YDLA 3OW2S 1TH7A 1QVFP 3RKWA 3H0IA 4A4FA 1YJ9A 4AT1B 3GNGA 1OPLA 3CCLQ 2HNIA 2ATCB 2PNIA 3TEEA 3C94A 3BFMA 3EGDA 3QIIA 2G3RA 4XU3A 1JB0E 3A98A 3CCSA 1OOTA 1KFZA 4WCIA 5GAMf 1P92A 1T3LA 3TU4K 2MI6A 1OZ3A 4Y92A 1Q86R 1HJDA 3EGXB 4FSSA 4DOVA 1MMDA 4PKCC 2MPXC 1WXTA 1I5OB 4PJJA 4HXJA 4J9DA 5HCKA 3CMAQ 4C0ZA 5A2QE 3CCQT 4N0AA 2E10A 2HBPA 4AMCA 1B34A 4M75E 3OYEA 3JCMh 1VQ8Q 3ASKA 3OB9A 3CCVQ 1VQKT 2OAWA 3UPUA 1VIEA 3QYHB 3RNJA 5A0DA 1UDLA 2DTOA 3CC4T 4LN2A 3VS5A 3JCMe 3CXCP 4HVWA 3E9GA 1IHVA 1H641 4OP0A 1AWWA 1M1GA 1K9MR 2CKKA 1YITA 1JU5C 3J81E 4P5NA 2R5MA 1PRMC 1RUWA 3LYIA 1AD5A 2XDDA 4OMPA 2DZCA 1Q82R 1IHWA 3I55A 3CPWA 1WXUA 1SKUB 2DTHA 3TREA 4MMKA 1TS9A 1IREB 1KD1C 3CCRQ 2CP3A 4BE1A 4M78F 4PJOF 1AWOA 4IUQA 4A53A 2K6DA 1ZBXA 1YWOA 2EPDA 1F1BB 4M7AE 2KQWA 4QT7A 3H41A 4JS5A 1D3BA 1U3OA 2D8HA 1VQ8T 3NGPA 2X4XA 3CCVT 4GBQA 3CC7Q 2XDPA 2E12A 2HD0A 1RABB 2VXEA 2DL4A 4C8QD 4JJBA 1KD1U 2V1RA 2H3JA 3FEOA 5GAOm 2AT1B 2LNVA 1GCQC 3MEUA 3OBWA 2RHXA 4M7DB 5D6YA 1KQ2A 3RMQA 1VQ7Q 1I4K1 3HP9A 2KT8A 1MV0B 1ARKA 2IPOB 3M4GA 2WSFE 2EQJA 1QKXA 1UGVA 4HVVA 5GAMg 2DBMA 4CC2A 2JUFA 3OYBA 3CCRT 4L59A 4RTYA 1ZX6A 2BTTA 4B9XA 1KQSP 2Y4XA 1YJWQ 4B9WA 2HL3A 2VV5A 2CS7A 2JJ9A 1MV3A 1NLOC 4M75G 4L6V5 1NJIR 3FLGA 3UATA 4EIKA 3V8KA 4AG2C 2LZ6B 3M59A 1HYOA 4PFOA 3CCQA 3CC7T 1GL5A 2QTVA 1BK2A 1ZSZB 1BYMA 4F7UE 3L2RA 4C92C 2R57A 3TSZA 3JV3A 2FPEA 4QQGA 1U8RA 2RA2A 5FU7C 1VQKA 4PJOA 2RJDA 1D1BA 2W10A 1N8RR 1EIFA 2RNAA 4EMKC 2PVOB 5I11A 4O5VA 3KUFA 1YIJQ 2FEIA 1JXMA 2A08A 2I2LA 1M8VA 1JJ2A 4N4GA 3OMGA 4EMKB 2COWA 3F70A 2CP0A 2E6NA 2DVEA 4A4KA 3EGUA 3PIPA 3D7SB 1X2QA 2ZZDA 1H8KA 1J3TA 1S72Q 2LT1A 2E5QA 1OQKA 3A8LB 3QXEB 2PTKA 4OF1A 3I5RA 2JZ2A 2LQWA 1YJWT 2HAXA 3PTAA 4M7AG 1BI0A 5GMKm 2JN0A 4GY5A 3RERA 4HA8A 3M0SA 2GQVA 4KULA 2KBTA 2MOXA 2XIDA 4M77F 3SWNA 5HY6A 4CC3A 2VYTA 5I2SA 2K3XA 2KYBA 1U5SA 2J7IA 3EGDB 3EH1A 1VQ8A 5CIUA 3CCVA 3EH2A 3UF4A 4RMOA 3CXCS 1Z9QA 2LVMA 2R5AA 1B7TA 1LVKA 4F17A 1YIJT 2K7AA 2BE7D 4QQ6A 3NMZC 2J6KA 4NS5A 4QVDA 1YI2T 2ABLA 4JZ3A 4A4HA 3RKYA 5LJ3d 2FRYA 2D8JA 1M27C 1Y0MA 3R6NA 3QUIA 1QCOA 4OGCA 1NYFA 2LC4A 1K8AC 3C95A 4N0AC 1S72T 4Z02A 1AEYA 3OSSC 1RL2A 2X3XD 5CO7A 2EQMA 1SF9A 2RQWA 2PU9B 4X9DA 1SSFA 3CCRA 1B34B 2P0QA 5IXFA 2KY9A 2QDYB 3H8ZA 5GAOp 2VB6A 1ABQA 1HK9A 2JTMA 3UA7A 4F7UG 2B8AA 1VQLQ 5GAOn 4BE2A 4OMQA 2O4XA 4J6WA 1WZOA 2GFAA 3CBPA 3CC7A 4WTOB 3M9QA 1IZ6A 3OYMA 4JZ4A 2YLCA 3IQLA 1RADB 2NUZA 4KBMB 4RTXA 1VYTA 1VQNT 1OZ2A 2V8KA 1AT1B 2LRQA 4DBRA 1QKWA 1N27A 1K1ZA 2DETA 5GAN2 3MHXA 3QPHA 4M77A 3AHUA 5LJ5d 3QJ6A 1PHTA 2EJGA 2YRVA 1KK7A 1WNLA 5IXBA 5GAMh 2XMFA 5GAN5 4OMMA 1QVFA 1PD0A 1FMVA 1NLPC 1D3BB 1T0HA 1KQSS 4DEYA 2DXUA 4M75A 4X9CA 1Q86U 4AFUC 3BY7A 2ROLA 4RTVA 1UGPB 2MAMA 1YJWA 4LDYA 1WLPB 2LCLA 2KRSA 1RAEB 2X9HA 1T0JA 5I21A 3INZA 5IT9E 1R0CB 2DKGA 3OY9A 1E6GA 1X6GA 1KD1R 2COYA 2M0OA 1UE9A 2HDAA 3JCMQ 3CBMA 4RTZA 3VS4A 4AFSC 1QLYA 2EKHA 2KNBB 1UTIA 3CCUQ 1KHIA 1YIJA 2ZPGB 4C8QE 3AT1B 4IUTA 3CCSQ 1YI2A 1ZUKA 3M0RA 4FL6A 2DAQA 1X6BA 3S3MA 4C5EA 2EYYA 2RMOA 4GLMA 3LH0A 4WF2A 1S72A 4M7AA 4BY6C 1SPKA 4FU6A 3EFRA 1M5Q1 3CXCA 1G83A 2JS0A 2A7YA 1M1KR 4PJOC 4NL2A 4BY6B 1K4US 4A4EA 2NWMA 2DLPA 4BACA 3HRTA 1CKAA 1GBQA 2P84A 2ZCFB 4PJOB 3QKJA 3OYYA 1UGSB 1JJ2P 1PCXA 2KMTA 1GXIE 3VS6A 4B6MA 2X35A 4KGZB 5LL6S 3HSBA 4J83A 2GCXA 4KRTA 4C92F 5GAMj 1WPYA 3LGLA 2DL8A 1SRLA 2CYZB 3TSWA 2BKDN 4PK4A 2GF7A 4OB1B 1YITQ 3CCUT 4E7KA 4MDXA 2J6OA 4JJDA 2ROTA 1VQNA 2HQEA 3J80E 2AZSA 1ACMB 3OMCA 2HKQB 1Q81C 2KGTA 1UG1A 1NJIC 2DRKA 1QVGP 3MEVA 3OBYA 2E41A 4RUGA 3SWNC 3HTRA 1SG5A 1H92A 2V26A 3SD4A 2A37A 1CKBA 4RCCA 1GCQA 2XG8D 5A0GA 1WJSA 3S3NA 2GBQA 2KT1A 1WX6A 1ZLMA 4FYWB 4OB0B 1VQPT 2ESWA 3DB3A 3QBYA 3VKIA 1NPPA 1Q81U 2RO0A 1NJIU 1MMAA 1BBZA 4EDUA 2B86A 4J9EA 1KIKA 4CRIA 2JW4A 2ZPEB 1MNDA 2CP6A 3MJXA 1KQSA 2JMAA 1A0NB 2CGHA 4C8QG 1KQ1A 2A3LA 1BB9A 3I9QA 1OI1A 3S3OA 5CKBA 1N8RU 4HT9A 1N9SA 1VQ4T 3HPWA 3GIBA 1RACB 1I5LA 1K0XA 4XU2A 1WHHA 2F5TX 4C92A 3PIOA 1LJOA 3C0CA 2KI7A 3JRZA 2RQUA 2FZGB 2KAFA 1DJ7B 2D0NA 1Q95G 3SHWA 2QQAA 2VC8A 4FCYA 2CZ0B 1MHNA 2O4XB 1Y96B 4XTXA 1VQ5T 3EAEA 4FT4A 2CDTA 3A8GB 1PC0A 3QZ5B 2DEUA 1ZQ1A 2KEAA 5HK0A 4ZNXA 2RF0A 2KYMA 4ZGDB 1FMKA 5GANd 4E47A 1VYUA 1K8AR 4HCCA 4PJMA 2EJ9A 4XU1A 2EW3A 3CCQQ 4RTTA 4J9HA 3LWIA 4M77C 1YWPA 5KCHA 1ZA1B 1M1FA 1QCFA 1W1FA 2OJ2A 2M9UA 3OYJA 3A5ZB 4RCBA 2LX7A 4IUPA 1AOJA 1VQKQ 3EG3A 4M77B 3E1SA 5D6WA 3CC4Q 1Y07A 4Q5WA 2QEXQ 2XKOC 2GNCA 2DERA 5ECAA 4Z89A 1IRXA 4M75C 4PLIA 2W0ZA 4J9GA 3CCUA 2CT4A 5GAOq 2DVJA 2K3BA 1H3ZA 1YCSB 2VXFA 2LJ1A 1NZ9A 4J7FA 2ED1A 2XDBA 2OI3A 1M90C 4PNOA 3CCEQ 1WHJA 3G4ST 4C8QF 1AHJB 1QVPA 3RIRA 4ELYC 1N9RA 1WQWA 1K9AA 2JTFA 4FYYB 3JB9F 2YRDA 2LJ3A 2KK4A 4QW2A 1JJ2S 4J8OA 1VQPA 2BIVA 1IGQA 1N5ZA 4K11A 1WXBA 2GFUA 3OS1A 3OYHA 2IVWA 4JS4A 5IH2A 2L89A 5KE2A 4OMFB 3HFNA 2C0OA 1G5VA 1PRLC 2QEXT 4M7AC 2LDMA 4CI0C 2L3RA 3UA6A 2K79A 1U06A 4Y28E 3PE0A 4M7AB 2E65A 3X25B 2K57A 5CKEA 2VGMA 1WI7A 1VQ4A 2IIMA 3CQTA 5J39A 5KYXA 4J7IA 1WHMA 3X26B 2FPFA 3CCET 4R0KA 3UT1A 1CSKA 1W2BP 2C0IA 2NYSA 2IG0A 1E6HA 3NTHA 2AIRB 2SRCA 4JPBW 2ZPHB 3L1AA 5GJVB 4X1VA 1RLPC 1VQ5A 2QQ9A 1MGQA 3CC2T 1PWTA 3L2VA 5LJ5h 2J06A 2DF6A 2VUBA 3PMTA 2DO3A 4ELZC 4IIOA 1SEMA 1X69A 2CP5A 5FRMA 2VVKA 1IB8A 4ZN1A 2E5KA 2VGNA 4C8QA 3GBQA 2F5KA 5LJ3j 1C1AA 2EYWA 1OX8A 4QVZA 4MZMA 5GAN7 2O2OA 5GAN8 1M1KC 1M8MA 1VA7A 4PJNA 1HXDA 2QGFB 2EVRA 4E7IA 2OTJT 3FJ5A 4LDUA 3JCMb 1IXDA 3G6ET 3G4SA 2E6ZA 2RI5A 3FB9A 2X4JA 4OB3B 5EG2A 2X3WD 1M1KU 2HL5C 1Q81R 1GBRA 1M2OA 1WIEA 2QTXA 6AT1B 2HBWA 2MCNA 5IHKA 1YHQT 4HKEA 1QVFS 3M55A 3BW1A 3WVDB 4C92B 3GP8A 3I56T 3CC4A 3MPUB 2QEXA 4M7DE 3CEYA 2HEQA 3KFVA 5AYFA 5FU7B 5LJ5j 3Q1JA 3VS2A 5A0LA 3UWNA 1PD1A 3EFSA 1YI2Q 2JM9A 4O6JA 2M0YA 4EPCA 3KXTA 2GQIA 2YUPA 2FRWA 4M78D 5GMKi 1R8OB 1K76A 3CCEA 1OX9A 2DJQA 3C4SA 3LGFA 2DL3A 4J9IA 3OYFA 3EG9A 3M0PA 2BZYA 1BU1A 3P8BB 1VQ9Q 3VRYA 4JLIA 1BCMA 2HQXA 1QVGA 3OA6A 2MYSA 1BI2A 2BE9B 4J6XA 3N5BB 4C0DC 2JT4A 4M75F 1BIBA 1T3SA 4C0DB 2DL5A 2QAZA 4FSXA 2KE9A 3JB9I 2EQUA 1VQNQ 3JCMc 4FYXB 2LQ8A 2Y4YA 2DXCA 2KVQG 4KH0B 3BE3A 4OMLA 1PKSA 2PVGB 2OTJA 1M30A 2E70A 1R0BG 1QP3A 2LX9A 1AZEA 4C5GA 5LJ3f 2WSEE 4UC4A 1SHGA 2D1XA 4FT2A 1D09B 4PJLA 4PFPA 3G6EA 1VQ9T 4BE0A 4OGEA 4EMGA 3WXMB 3V8JA 2YSQA 4JRQA 1MMGA 1KG1A 1LCKA 5CK9A 3C12A 5D7UA 4N4HA 3OS2A 1Y57A 1M90R 1Y7XA 1K8AU 3HHTB 3JCMd 4M7DG 4II1A 4M7AF 1M3BA 1TSFA 3PNWC 2LQKA 3QWYA 5CCAA 1KC8C 5KYXB 2ZAEA 2ECZA 1YCYA 4DBFA 4EMHA 3FJPA 2V8JA 3CCJQ 1OULA 5J26A 2KDSA 2DFUA 2CSQA 2RD1A 4LE9A 4FIBA 1M3CA 5CQXA 1HD3A 1YP5A 3VS3A 1LOJA 1RAFB 5CR2A 1I81A 3HKSA 1GFDA 3RR6A 3V7RA 3DLLA 3EHQA 5FROA 2CREA 4D8DA 2DA9A 4C8QC 1KC8U 4BDYA 2ZGWA 2JOYA 1GFCA 3M0UA 5FWBA 5GAMe 1WFWA 3EHRA 2KRMA 5IHIA 3MEWA 2JNGA 4C8QB 5LJ5f 3QDRB 2VWFA 5KH6A 1NE8A 1O9SA 3OYIA 1D1CA 1X01A 3I35A 3P8DA 3M5AA 8AT1B 3ME9A 2RJFA 1TUGB 4RTWA 3OYGA 2QDLA 1V1CA 2PQWA 3ZL7C 1UHFA 4QKUA 2K2MA 2SEMA 2QA4T 2RPNA 4C5IA 4PLLA 4FYVB 2QASA 3CCJT 4F7UF 1RLQC 1U1TA 2RH2A 5GAN6 1UJ0A 2QG9B 3MO8A 1BI1A 1NEGA 1OYXA 1RAAB 3OW2P 3OYAA 3M53A 1FWZA 1G3YA 3CPFA 1M3AA 4QQDA 2YUNA 5FLXE 5LJ3g 5GANj 2O88A 2DYIA 4XU0A 1G8XA 3A1PA 1VQ9A 2K5IA 1VQPQ 2FYKA 2F2WA 7AT1B 1HSQA 2RK2A 4ME7A 4IIMA 3VS7A 1W2BA 3RESA 4BD3A 2K4YA 4ATOA 2X4YA 2LMJA 4CC7A 1VIFA 2D9TA 4M4ZA 2A0FB 3O8VA 4KGXB 1NG2A 1UB4A 3CCMT 1YBYA 2DE0X 4BUGA 3CBOA 2DEQA 3EG9B 1VQ4Q 3OYNA 3JCMV 1YJ9T 2JS2A 1XJWB 2KXCA 5GAOr 1V76A 4KGVB 3VV0A 5DLOA 2EQKA 2PUOB 2JXBA 4RG2A 2MF2A 4JRPA 2A36A 2AHJB 3QYGB 3RKXA 4AG1C 3L2UA 1UFFA 3SWNB 4LDWA 2RJCA 4F7UA 1VQ5Q 1UECA 5KYWA 3LWHA 2XU8A 1G3TA 2ENMA 1QMCA 4M78E 3ZEHA 5LJ5g 1M4ZA 2MWOA 3LH5A 2EIFA 4LXCA 1NPRA 4LD6A 2CUDA 2WACA 2QK0A 3HRSA 2NLUA 5CKHA 3PT9A 4M7DD 2RHUA 4OB2B 3GF5A 4NOYA 1I07A 4HCKA 1VUBA 2CZ1B 3NPFA 5KYNA 2L0AA 2O9VA 2YUQA 4LDXA 2DMOA 2QA4A 4XAXB 2V8IA 2HZYA 2AZVA 4DQ2A 3CCJA 3JB9H 5L23A 3X28B 4D6WA 4MZTA 4RKUE 1TTHB 4BI8B 4ORZA 1RAIB 2O9SA 1JXOA 3OSVA 3T9NA 3J7AF 2KRNA 3META 3R6OA 5L8RE 3G4SQ 2NUPA 4XQ3A 4BDZA 2VASA 5DM7R 3SDZA 3G1JA 4X34A 2GGRA 3V8LA 4V2SA 3MEAA 3SFMA 2MIOA 1NEBA 3OYDA 2BUDA 4IUUA 2JVVA 1BKBA 2VKNA 3DLMA 1C6VX 1MUZA 4ZN3A 1AVZC 2CZ6B 4C5HA 2DBKA 5GANf 5IAYA 4AFZC 2O01E 2ZPFB 1K73C 3VYHB 4E7ZA 1JBMA 2OX7A 3PFSA 4RTUA 2YWWA 1KSWA 2RJEA 4LUDA 4M75B 1B3QA 2CZ7B 1IGUA 2DD4A 1EFNA 1U1SA 2QQSA 1JO8A 2FZKB 1KC8R 2RI2A 5GAMd 2DILA 3LLRA 2RB6A 3PGGA 4PFZA 2KXDA 1VOMA 4JRKA 4M78G 4PJOG 4E7SA 5LJ3h 1TXQA 2PVDB 3E2UA 1Y71A 1K73U 1PG5B 2EGEA 2YLBA 2EJFA 2V1QA 2DXTA 1WHKA 5LJ3e 3CC2Q 1S1NA 2C06A 2GTJA 3M0TA 2DIQA 4JLGA 1PSFA 2X51A 1V29B 2RM4A 2OTLQ 2PZ1A 4OMNA 2LJ0A 2FB7A 1M90U 3G71T 4M77E 4BB7A 3JSCA 3HRUA 3L42A 2Y90A 1G2BA 2CP2A 1OU8A 3DB4A 2AKKA 2P4RA 3VYGA 2K5LA 3VRZA 4KH1B 4DEXA 1G3WA 1BCOA 1YNZA 2M1HA 4D8KA 3CD6Q 2EKOA 1X27A 2KSSA 5FW9A 1GRIA 1QVGS 4OVAA 1D0XA 2DYBA 5CAIA 2OTJQ 1D1AA 3CCLT 2RHZA 3O5ZA 3X20B 3VUBA 3EG1A 4GLKA 3NFCA 3G6EQ 3ZBDA 2JTEA 4RG8A 3A8MB 1FXXA 1QCNA 1RAHB 2H3EB 3LX7A 2X4WA 5C6SA 3GNFB 3E19A 5GAN3 2OTLT 3I5SA 4J5YA 5LJ5e 5HK3A 1OV3A 2F2XA 3OYLA 3V7CA 1WHLA 3M56A 2G6FX 4ZTJA 2O31A 1YHQQ 3OYCA 3QJYA 1TOVA 3CMAT 1WYXA 2RI3A 5GANg 1XOVA 1OEBA 1TG0A 4J9FA 2KROA 3I56Q 3REBB 2CP7A 3URGA 1TU0B 3CD6T 2M51A 4IUVA 5C0MA 4HCZA 3P8HA 1X2KA 2I0NA 4F7UB 5KYWB 4KUIA 2DRMA 2YHTA 4M7DC 3NTIA 4JRIA 1UGRB 1MNEA 3PVQA 2YUOA 3JB9D 1WGSA 2EGAA 4C0FA 2ED0A 3WVEB 2L5QA 4XTWA 2ZPIB 4FM4B 1M2VA 3L2WA 3TQ7P 2EFIA 2E64A 5KYYA 1ABOA 1SSHA 1VQOQ 3EFOA 1VQMQ 3M0QA 3VUZA 3M54A 1G3SA 2HSEB 2QI2A 4ZGJB 4M77G 5DY9A 1D0YA 2EBPA 3GLXA 3OW2A 3HFOA 3RUXA 1Q7YR 3H0HA 1AWXA 4A4GA 1X75C 1E7OA 1W4SA 4CC4B 2E3HA 3G71A 2DIGA 4R56A 1ZSZC 4DA4A 4XTYA 4HT8A 1M9SA 1TUDA 3PVLA 5IN1A 2NUPB 4F16A 2M02A 4LUEA 2FG0A 3L2ZA 4C0GA 1D0ZA 4M78A 1JQQA 1WDXA 4PJOD 1XNIA 3H9NA 3JCMJ 2DX1A 3S6WA 2FVUA 1VQ7T 3CCLA 2QXFA 2L3SA 1UEBA 1VQOT 1VQMT 1FYNA 3VJPA 4LNPA 3BDUA 3EG2A 5KYUA 1ZA2B 4E7LA 2K2VA 3RMSA 1BIAA 3CC2A 4ZTFA 4JJCA 4OMOA 4N4IA 3JCMP 2DJZA 2OTLA 3ER0A 4F04B 3GOXA 2OAUA 4BI4A 1UJYA 1YJNQ 2FZCB 4C92E 4DBHA 3JAME 2JM8A 3H6ZA 8ATCB 2LP5A 3CMAA 4QVCA 2DZ9A 9ATCB 2Z0WA 3TVTA 2J05A 2D0QB 1N6AA 2E4HA 3CD6A 1KHCA 2AK5A 4E2FB 1WHGA 2COZA 2A28A 3DKMA 2FPDA 5GMKh 1W2BS 1WJRA 1UUEA 1QWFA 2DL7A 1QP2A 1K73R 4MDWA 5GMKe 1WA7A 2NUTA 2AKLA 2MK5A 4MZPA 1ZUYA 1RAGB 3OQ5A 2EYZA 1UHCA 3FIFA 1PKTA 1YN8A 2RQTA 3CMEQ 5GAOl 2EYXA 2F1LA 2YRCA 1KJWA 3TCJA 1YJNT 4E7JA 1LNXA 1K0SA 1OPKA 1OU9A 1YHQA 2YT6A 4VUBA 5CQYA 2QA4Q 4JJNK 5GANh 2YXYA 3E9FA 3VS0A 3SB2A 3I56A 4NL3A 3JCMf 2RHYA 4DOWA 4IKFA 1Y96A 3CPWP 5GANe 1B07A 2BZXA 1XTDA 1IO6A 1VQ6Q 2EYQA 3FRNA 3H0FA 3MCAB 3U23A 2LNHB 4JUVA 2PUKB 3QDFA 1Q86C 3NHNA 1ZBJA 3PMIA 3JB9J 3QZ9B 4JDSA 2XK0A 3RBBB 2XICA 1WQ7A 3FDRA 2DXBA 2LQNA 1W70A 3ULRB 1NBEB 1TWBA 1VYVA 5CVIA 1VQ7A 2MWPA 1VQOA 2WSCE 3VU3C 1VQMA 2CUBA 4M77D 2GTOA 4Y91A 1QQJA 3GPLA 3CMET 3A8OB 2CH4W 2M16A 4Z88A 1AZGB 4C92G 5GMKj 2XI9A 2XD0A 4AFQC 4M75D 3G7ZA 4LDVA 5I2MA 1W6XA 5D6XA 1X6OA 5FWCA 5EC7A 1UGQB 4HVUA 5FU6C 1K9MC 2KR3A 2L8DA 2BZ8A 1VQLT 1X43A 2JMCA 4ANJA 2FO0A 2C0TA 5FU6B 5AT1B 1M2VB 3CCMQ 3EGXA 1Q82C 2HMAA 1C0MA 5HKCA 5KYYB 1VQ6T 3V7SA 3OS5A 4MMLA 3RDVA 3EFOB 2L3QA 2R58A 1QWEA 4M7DF 3SEMA 3UDCA 5IHNA 1YJ9Q 1FX7A 5GMKl 5J3BA 1RI9A 4XTZA 4FW1A
chains in the Genus database with same CATH topology
4RMOA 4XTUA 2P4TA 3NTKA 3CXCS 4ZN1A 2VGNA 3OYDA 2LVMA 2P0KA 2R5AA 1K9MU 2BUDA 2E1HA 3M57A 5CKFA 4C8QA 1YIJT 5FRNA 4QQ6A 4IUUA 4NS5A 2JVVA 4QVDA 2F5KA 1YI2T 5LJ3j 1BKBA 4A4HA 1Q82U 3DLMA 3RKYA 5LJ3d 5DLQE 4QVZA 5M9OA 2QQRA 4MZMA 5GAN7 2ZPBB 4ZN3A 2CZ6B 4XK8E 3CCLA 2D6FA 3QUIA 4M7AD 4OGCA 3JCMW 5GAN8 4C5HA 2LC4A 5GANf 5IAYA 1M1KC 1K8AC 2LT4A 3C95A 4N0AC 1U8RA 4Z02A 1S72T 3OSSC 2O01E 1RL2A 1HXDA 2ZPFB 1K73C 4M78C 4PJOA 5CO7A 2EQMA 1YJNA 3VYHB 4E7IA 2PU9B 1JBMA 2OTJT 4X9DA 3PFSA 2DPPB 1SSFA 3CCRA 1B34B 2P0QA 4M78B 4ZGEB 2RJEA 4M75B 4LDUA 2CZ7B 2KY9A 2MMPA 2QDYB 3H8ZA 5GAOp 1XQHA 2DD4A 3JCMb 1U1SA 3G6ET 3JCMg 3G4SA 2QQSA 3QSUA 2E6ZA 1HK9A 2JTMA 4F7UG 2RI2A 2RI5A 3FB9A 5GAMd 4HCBA 2X4JA 3LLRA 2B8AA 2RB6A 3HL8A 3PGGA 4OB3B 5EG2A 4JRKA 4M78G 4PJOG 5GAOn 4BE2A 1M1KU 2O4XA 4J6WA 5LJ3h 2PVDB 2GFAA 4IURA 3BDLA 1Y71A 3CBPA 3CC7A 1Q7YC 1K73U 2QTXA 2YLBA 3M9QA 1IZ6A 2EWNA 2EJFA 3OYMA 1ZHIA 2DXTA 2YLCA 5LJ3e 3CCST 2C06A 4LD9K 2DIQA 4JLGA 2RK1A 1YHQT 1PSFA 4HKEA 1V29B 4KBMB 2RM4A 3M55A 1QVFS 4PJOE 1VQNT 1OZ2A 2V8KA 1QW1A 3BW1A 2LRQA 3WVDB 4C92B 3GP8A 3I56T 3CC4A 1N27A 2FB7A 4BI3A 2QEXA 4E7HA 4R55A 3CEYA 4M77E 5AYFA 3MHXA 5GAN2 3QPHA 4BB7A 3G71T 4M7DA 5FU7B 4M77A 5LJ5j 3JSCA 2F69A 3Q1JA 3HRUA 3CMEA 5LJ5d 3L42A 5A0LA 3AHUA 3UWNA 2P0PA 3EFSA 3QJ6A 2EJGA 2Y90A 2YRVA 1BI3A 1WNLA 3DB4A 5GAMh 1Q7YU 2FL7A 4O6JA 3VYGA 2K5LA 5KCOA 5GAN5 1QVFA 4EPCA 3KXTA 1G3WA 2LCCA 1N8RC 2M1HA 1D3BB 2EKOA 1KQSS 2DXUA 4M78D 3A8HB 4M75A 2DK3A 4X9CA 5GMKi 1Q86U 3BY7A 1R8OB 2KSSA 3CCEA 4L5GA 3FC3A 1UGPB 3C4SA 2MAMA 3LGFA 1YJWA 1QVGS 4LDYA 4OVAA 1VQLA 2LCLA 4KUDK 5CAIA 3CPWS 3OYFA 5I21A 3INZA 5IT9E 4A54A 3CCLT 3KBGA 2RHZA 2DKGA 3P8BB 3X20B 3OY9A 3VUBA 1VQ6A 3M4YA 4JLIA 4GLKA 3NFCA 2DD5A 3ZBDA 1YITT 4RG8A 2M0OA 3A8MB 1FXXA 3QG1A 2EAYA 3JCMQ 1JRIA 2HQXA 1QVGA 3OYKA 3CBMA 3JB9G 3OA6A 3LX7A 1BI2A 3MP1A 2X4WA 3N5BB 4J6XA 3OS0A 3L2QA 3I55T 3QO3A 2K3YA 3GNFB 3E19A 5C6SA 2LTOA 5GAN3 4XTVA 2OTLT 4J5YA 5LJ5e 4C0DC 3JCMX 3QHSA 1KHIA 5HK3A 1YIJA 2ZPGB 4C8QE 4C92D 3OYLA 4IUTA 3V7CA 1YI2A 3M56A 4M75F 4ZTJA 1O75A 1BIBA 1RI0A 2DTIA 4FL6A 4C0DB 5CKDA 3OYCA 4FSXA 4KT0E 3QJYA 3CMAT 2DAQA 2QQBA 2EQUA 3JB9I 3JCMc 2RI3A 5GANg 4C5EA 3S3MA 1XOVA 3ZFJA 4EMKA 4PL6A 2K5FA 3LH0A 4WF2A 1S72A 4TVRA 2LQ8A 3URGA 2Y4YA 2DXCA 3X24B 4BY6C 4M7AA 4FU6A 2KVQG 3M58A 3LW5E 3CD6T 1PSEA 3EFRA 4M7DE 1M5Q1 5GAN4 3CXCA 2RHIA 4IUVA 2A7YA 2PVGB 5C0MA 2OTJA 4HCZA 3P8HA 4PJOC 3MP8A 2E70A 2FHDA 4NL2A 4BY6B 1QP3A 4A4EA 2LX9A 4F7UB 5KE3A 3MP6A 4BACA 4C5GA 3HRTA 4KUIA 1WJQA 2XHCA 5LJ3f 2WSEE 2YHTA 1M90U 4UC4A 2ZCFB 4YTLA 4M7DC 3NTIA 1I8FA 4FT2A 4JRIA 3CCMA 1UGRB 3OYYA 1UGSB 3QKJA 3JB9D 1WGSA 4PJOB 3G6EA 4C0FA 4J6YA 1VQ9T 3WVEB 2KMTA 2L5QA 4OGEA 4EMGA 4BE0A 1GXIE 3WXMB 3HSBA 2X35A 3OW2S 1TH7A 5LL6S 4J83A 2ZPIB 4FM4B 4XTWA 3RKWA 3V8JA 2GCXA 3L2WA 4JRQA 2EFIA 2E64A 4A4FA 1YJ9A 1VQ7T 4C92F 1KG1A 5GAMj 5CK9A 1WPYA 3GNGA 3C12A 3LGLA 4N4HA 3OS2A 2HNIA 2CYZB 3TEEA 1Y7XA 1K8AU 3C94A 3HHTB 3BFMA 2BKDN 3VUZA 3L2VA 3JCMd 3M54A 1G3SA 2G3RA 3QIIA 4XU3A 1JB0E 2GF7A 2QI2A 4ZGJB 3CCSA 4M7DG 4II1A 4M77G 4OB1B 5DY9A 3CCUT 4E7KA 3OW2A 3GLXA 4M7AF 3PNWC 5CCAA 3HFOA 2LQKA 3RUXA 1KC8C 4MDXA 5GAMf 1YCYA 1VQNA 1P92A 2HQEA 3J80E 4EMHA 3TU4K 2MI6A 1OZ3A 4A4GA 3OMCA 1Q81C 1X75C 1NJIC 1W4SA 3FJPA 2V8JA 3G71A 5J26A 3MEVA 2DIGA 2KDSA 3OBYA 2E41A 4R56A 2RD1A 4FIBA 3SWNC 4DOVA 4PKCC 4XTYA 4DA4A 5CQXA 4HT8A 1M9SA 1LOJA 3SD4A 5IN1A 4RCCA 5CR2A 2XG8D 1I81A 5A0GA 3HKSA 3V7RA 4C0ZA 5A2QE 3DLLA 1WJSA 3CCQT 3S3NA 5FROA 4N0AA 2E10A 2HBPA 3L2ZA 4OB0B 4C8QC 4C0GA 4BDYA 1KC8U 2ZGWA 1VQPT 1B34A 4M75E 3OYEA 2JOYA 4M78A 3DB3A 3JCMh 3QBYA 4PJOD 5GAMe 1XNIA 3ASKA 3JCMJ 3OB9A 3MEWA 3VKIA 2JNGA 1NPPA 1VQKT 4C8QB 5LJ5f 1Q81U 2RO0A 3QDRB 3UPUA 1NJIU 3S6WA 1VIEA 2FVUA 1NE8A 3QYHB 1O9SA 2DTOA 2QXFA 4EDUA 5A0DA 5KH6A 1UEBA 3JCMe 3OYIA 1VQOT 1X01A 3E9GA 1VQMT 3P8DA 3M5AA 1H641 3VJPA 4OP0A 4CRIA 1M1GA 2ZPEB 3BDUA 2CKKA 1YITA 4E7LA 2K2VA 3J81E 4P5NA 3ME9A 2R5MA 2RJFA 3RMSA 1KQSA 3OYGA 1BIAA 2CGHA 3LYIA 1KQ1A 4C8QG 2A3LA 4ZTFA 3CC2A 2PQWA 2XDDA 1OI1A 2DZCA 3S3OA 5CKBA 3I55A 2QA4T 4C5IA 1N8RU 4HT9A 1N9SA 4N4IA 3CPWA 3JCMP 2DJZA 1VQ4T 2OTLA 3ER0A 3HPWA 3GIBA 4PLLA 2DTHA 3GOXA 1I5LA 2OAUA 4MMKA 3TREA 4BI4A 3CCJT 1IREB 4XU2A 4F7UF 1U1TA 4C92E 1KD1C 2F5TX 4C92A 2RH2A 3JAME 3PIOA 1LJOA 3H6ZA 4BE1A 4M78F 4PJOF 5GAN6 3CMAA 4IUQA 4A53A 3MO8A 3JRZA 4QVCA 1BI1A 1ZBXA 1OYXA 2DZ9A 2KAFA 1DJ7B 2QQAA 2VC8A 3OYAA 2CZ0B 3M53A 2D0QB 1N6AA 2O4XB 1MHNA 1Y96B 4XTXA 1FWZA 1VQ5T 3EAEA 1G3YA 4FT4A 1KHCA 3A8GB 3CD6A 4M7AE 2KQWA 3CPFA 4QQDA 3QZ5B 4JS5A 1ZQ1A 5HK0A 1D3BA 3DKMA 5FLXE 1VQ8T 5LJ3g 4ZGDB 5GMKh 5GANj 2X4XA 3CCVT 5GANd 1W2BS 4E47A 1WJRA 2XDPA 2E12A 2HD0A 4XU0A 2EJ9A 4HCCA 4XU1A 2VXEA 1QP2A 4C8QD 1KD1U 2H3JA 1VQ9A 4MDWA 5GMKe 3FEOA 3LWIA 2K5IA 4M77C 5KCHA 1M1FA 5GAOm 2LNVA 2M9UA 2FYKA 3OYJA 4MZPA 3MEUA 3A5ZB 4RCBA 3OBWA 2RHXA 4IUPA 4M7DB 2RK2A 4M77B 3OQ5A 5D6YA 1KQ2A 3RMQA 3E1SA 4ME7A 5D6WA 1Y07A 1W2BA 3FIFA 4Q5WA 1I4K1 3RESA 2XKOC 3HP9A 4BD3A 2K4YA 5GAOl 4M75C 4ATOA 2X4YA 4PLIA 3M4GA 2WSFE 2EQJA 3CCUA 5GAOq 1VIFA 2D9TA 3TCJA 1YJNT 4E7JA 3O8VA 5GAMg 1H3ZA 1UB4A 1LNXA 2JUFA 3OYBA 3CCRT 4L59A 2VXFA 3CCMT 1YBYA 1YHQA 5CQYA 4VUBA 4JJNK 4BUGA 3CBOA 4B9XA 1NZ9A 2DEQA 4J7FA 5GANh 2Y4XA 2XDBA 3OYNA 3E9FA 3JCMV 4PNOA 1M90C 3G4ST 3SB2A 1AHJB 4C8QF 3I56A 1YJ9T 4B9WA 2VV5A 4NL3A 2CS7A 3JCMf 1QVPA 2RHYA 4DOWA 3RIRA 5GAOr 4IKFA 1Y96A 4M75G 4ELYC 4L6V5 5GANe 3VV0A 1N9RA 1WQWA 2EQKA 2JTFA 2PUOB 5DLOA 1XTDA 3JB9F 3FLGA 4RG2A 2MF2A 4JRPA 3V8KA 3M59A 2AHJB 3QYGB 3CC4T 3RKXA 2EYQA 2KK4A 3FRNA 4QW2A 3CCQA 3MCAB 3CC7T 3L2UA 3SWNB 4LDWA 1BYMA 1JJ2S 4F7UE 4JUVA 3L2RA 2PUKB 4J8OA 2RJCA 4C92C 1VQPA 4F7UA 2BIVA 2R57A 1Q86C 3LWHA 3PMIA 3JB9J 3QZ9B 2XU8A 1G3TA 3ZEHA 5LJ5g 4M78E 4JDSA 1M4ZA 2XK0A 4QQGA 2XICA 2GFUA 2RA2A 1WQ7A 3FDRA 2MWOA 5FU7C 2EIFA 2DXBA 3OS1A 1VQKA 1NPRA 2RJDA 3OYHA 4LD6A 5CVIA 2IVWA 1VQ7A 4JS4A 1EIFA 2MWPA 2WACA 4EMKC 1VQOA 2L89A 2PVOB 5KE2A 2WSCE 3HFNA 3KUFA 3HRSA 2NLUA 4O5VA 3PT9A 4OMFB 5CKHA 3VU3C 1VQMA 4M77D 4M7DD 1G5VA 4Y91A 2QEXT 2RHUA 3GPLA 4OB2B 4M7AC 2I2LA 2LDMA 4CI0C 1M8VA 1JJ2A 4N4GA 3OMGA 2L3RA 3A8OB 4EMKB 3GF5A 3F70A 4NOYA 3CMET 4Y28E 1VUBA 2CZ1B 2M16A 4M7AB 4C92G 5GMKj 2E65A 3X25B 2E6NA 2DVEA 4A4KA 2K57A 3PIPA 2XI9A 4LDXA 2XD0A 2ZZDA 2QA4A 5CKEA 2VGMA 2LT1A 2E5QA 4XAXB 2V8IA 4M75D 3G7ZA 4LDVA 1VQ4A 5I2MA 5J39A 3A8LB 3QXEB 4J7IA 5D6XA 1X6OA 4OF1A 4DQ2A 3CCJA 3JB9H 3X26B 2JZ2A 1UGQB 3CCET 5FU6C 3UT1A 1K9MC 1YJWT 2HAXA 3X28B 2L8DA 2IG0A 3PTAA 1VQLT 4M7AG 1BI0A 5GMKm 4D6WA 4MZTA 4RKUE 3NTHA 2JN0A 2ZPHB 5FU6B 1Q82C 4GY5A 4BI8B 3RERA 3L1AA 4HA8A 5HKCA 3OSVA 3T9NA 1VQ6T 3V7SA 3OS5A 4MMLA 3J7AF 2GQVA 4KULA 3META 2R58A 2QQ9A 3R6OA 1VQ5A 1MGQA 5L8RE 3CC2T 4M7DF 2XIDA 4M77F 3UDCA 3SWNA 4XQ3A 5LJ5h 5HY6A 1FX7A 5DM7R 5GMKl 4BDZA 2VUBA 3PMTA 5J3BA 2VYTA 2DO3A 2K3XA 4X34A 3SDZA 4ELZC 5I2SA 3V8LA 4V2SA 1VQ8A 5FRMA 4XTZA 5CIUA 3MEAA 3CCVA 3SFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO l;  4M75 C;  4XTU A;  3INZ A;  4XTY A;  5I21 A;  3M4G A;  4A54 A;  4HT8 A;  5GAO q;  1LOJ A;  2E1H A;  2DKG A;  4C8Q A;  4RCC A;  5GAM g;  1I81 A;  4JLI A;  1LNX A;  3V7R A;  4QVD A;  2VXF A;  5LJ3 j;  3RKY A;  5LJ3 d;  4N0A A;  2E10 A;  3L2Z A;  4C8Q C;  2EAY A;  2DEQ A;  2ZGW A;  1JRI A;  1B34 A;  3JCM Q;  4M75 E;  5GAN h;  4M78 A;  5GAN 7;  3JB9 G;  3JCM h;  3JCM V;  4PNO A;  4PJO D;  5GAM e;  3QUI A;  4M7A D;  3JCM W;  3SB2 A;  4C8Q F;  5GAN 8;  5GAN f;  4J6X A;  3JCM J;  4N0A C;  4NL3 A;  3QO3 A;  3JCM f;  4C8Q B;  5LJ5 f;  3RIR A;  5GAO r;  5GAN 3;  1Y96 A;  4M75 G;  1HXD A;  5GAN e;  4XTV A;  2DTO A;  4M78 C;  1N9R A;  1WQW A;  3JB9 F;  4J5Y A;  5LJ5 e;  3JCM e;  3JCM X;  3QHS A;  1X01 A;  1JBM A;  3V8K A;  4X9D A;  4C8Q E;  4C92 D;  1H64 1;  3V7C A;  4OP0 A;  3RKX A;  1B34 B;  3BDU A;  4M75 F;  4M78 B;  3SWN B;  1BIB A;  2DTI A;  4M75 B;  4F7U E;  4JUV A;  4C92 C;  1BIA A;  2CGH A;  4C8Q G;  1KQ1 A;  4F7U A;  5GAO p;  3JB9 I;  3JCM c;  3JCM b;  5GAN g;  3JB9 J;  4EMK A;  1U1S A;  2DZC A;  5LJ5 g;  4M78 E;  3JCM g;  3QSU A;  2RA2 A;  4WF2 A;  1HK9 A;  1WQ7 A;  4F7U G;  4PJO A;  3FB9 A;  4M7A A;  5GAM d;  4HT9 A;  1N9S A;  3JCM P;  2DJZ A;  2RB6 A;  3PGG A;  3EFR A;  1M5Q 1;  3GIB A;  5GAN 4;  2DTH A;  4EMK C;  4JRK A;  4M78 G;  4MMK A;  4PJO G;  5GAO n;  3HFN A;  1I5L A;  3VU3 C;  4J6W A;  4M7D D;  4M77 D;  4XU2 A;  5LJ3 h;  4Y91 A;  4F7U F;  1U1T A;  4NL2 A;  4C92 E;  4M7A C;  2I2L A;  1M8V A;  4F7U B;  2QTX A;  4C92 A;  2YLB A;  1LJO A;  5LJ3 f;  4NOY A;  4EMK B;  2EWN A;  2EJF A;  2YHT A;  4M78 F;  4PJO F;  5GAN 6;  2DXT A;  4M7D C;  1I8F A;  2YLC A;  4JRI A;  4A53 A;  4PJO B;  4M7A B;  4QVC A;  4C92 G;  5GMK j;  2E65 A;  5LJ3 e;  3JB9 D;  2DVE A;  2K57 A;  4J6Y A;  4PJO C;  2DZ9 A;  4EMG A;  2VC8 A;  3HSB A;  1TH7 A;  3V8J A;  4XTW A;  3RKW A;  4XTX A;  1Y96 B;  2RM4 A;  4M75 D;  4PJO E;  2E64 A;  4M7A E;  4C92 F;  5GAM j;  1WPY A;  3BW1 A;  4C92 B;  4DQ2 A;  3JB9 H;  2FB7 A;  1D3B A;  4M7D E;  4M77 E;  2HNI A;  5LJ3 g;  5GMK h;  5GAN 2;  5GAN j;  4M7A G;  4M7D A;  5GAN d;  4M77 A;  5LJ5 j;  3BFM A;  3AHU A;  5GMK m;  5LJ5 d;  3JCM d;  4XU0 A;  2EJ9 A;  4XU3 A;  4XU1 A;  2JN0 A;  2VXE A;  3EFS A;  4C8Q D;  2EJG A;  2Y90 A;  4M7D G;  4M77 G;  3RER A;  5DY9 A;  3L1A A;  4HA8 A;  1WNL A;  5GMK e;  5GAM h;  4M7A F;  5GAN 5;  3HFO A;  4M77 C;  3RUX A;  3V7S A;  4MML A;  5GAO m;  5GAM f;  1YCY A;  2FYK A;  1MGQ A;  1D3B B;  4M7D F;  4EMH A;  4M77 F;  4RCB A;  2DXU A;  4XQ3 A;  4M78 D;  3SWN A;  5LJ5 h;  4M75 A;  5GMK i;  5GMK l;  4M77 B;  4X9C A;  1KQ2 A;  4M7D B;  3BY7 A;  3FJP A;  3V8L A;  4V2S A;  3FIF A;  1I4K 1;  4XTZ A;  3RES A;  2E41 A;  2RD1 A;  5CAI A;  3SWN C; 
#chains in the Genus database with same CATH topology
 4XTU A;  2HCK A;  2P4T A;  3NTK A;  1AWJ A;  2EGC A;  2CT3 A;  2P0K A;  1K9M U;  2E1H A;  3M57 A;  5CKF A;  5FRN A;  1FMW A;  2DM1 A;  1Z9Z A;  2EQI A;  1I1J A;  1Q82 U;  2RQR A;  5DLQ E;  5M9O A;  2F2V A;  2QQR A;  2L3P A;  2ZPB B;  4XK8 E;  4M7A D;  1MMN A;  3JCM W;  2LT4 A;  3THK A;  1TUC A;  4M78 C;  1YJN A;  1JEG A;  2RQV A;  1ZSG A;  2DPP B;  2K9G A;  4M78 B;  4ZGE B;  2MMP A;  2QGG A;  4F14 A;  1XQH A;  3JCM g;  3QSU A;  3EG0 A;  4HCB A;  3HL8 A;  2QYZ A;  3REA B;  5KYU B;  4IUR A;  3BDL A;  1Q7Y C;  3VS1 A;  2EWN A;  1R77 A;  1ZHI A;  4DBQ A;  3CCS T;  4LD9 K;  3QWX X;  2L2P A;  2RK1 A;  3I55 Q;  4PJO E;  1QW1 A;  2J6F A;  4BI3 A;  2D6F A;  4E7H A;  4R55 A;  4M7D A;  3CME A;  2F69 A;  2P0P A;  1H3H A;  1BI3 A;  1Q7Y U;  2FL7 A;  1EZZ B;  5KCO A;  1SHF A;  2RN8 A;  2LCC A;  1N8R C;  4J9B A;  1GCP A;  3A8H B;  4J9C A;  2DK3 A;  4L5G A;  3FC3 A;  2H8H A;  4Z8A A;  4KUD K;  1VQL A;  5I22 A;  3CPW S;  4ESR A;  4A54 A;  2HQH A;  2NUT B;  3KBG A;  1NM7 A;  2CH4 A;  1VQ6 A;  3M4Y A;  2DD5 A;  1YIT T;  3QG1 A;  2EAY A;  1JRI A;  3OYK A;  3JB9 G;  1ZSZ A;  3MP1 A;  3L2Q A;  3OS0 A;  3I55 T;  3QO3 A;  4E6R A;  2K3Y A;  2LTO A;  3MKD A;  4XTV A;  3JCM X;  3QHS A;  4C92 D;  1I0C A;  1ZUU A;  1YFN A;  1O75 A;  1RI0 A;  1EX4 A;  2DTI A;  5CKD A;  4KT0 E;  2QQB A;  1PM3 A;  3ZFJ A;  4EMK A;  2HKN A;  4PL6 A;  1LPL A;  2K5F A;  4TVR A;  1PNJ A;  4FW2 A;  3X24 B;  3G71 Q;  3M58 A;  3LW5 E;  2LCS A;  1PSE A;  5GAN 4;  2RHI A;  3MP8 A;  2FHD A;  2E3I A;  5KE3 A;  3MP6 A;  2DNU A;  5GJW B;  1WJQ A;  2XHC A;  1NYG A;  4YTL A;  1I8F A;  3CCM A;  2HSP A;  1SRM A;  4J6Y A;  2CSI A;  4A63 B;  2YDL A;  3OW2 S;  1TH7 A;  1QVF P;  3RKW A;  3H0I A;  4A4F A;  1YJ9 A;  4AT1 B;  3GNG A;  1OPL A;  3CCL Q;  2HNI A;  2ATC B;  2PNI A;  3TEE A;  3C94 A;  3BFM A;  3EGD A;  3QII A;  2G3R A;  4XU3 A;  1JB0 E;  3A98 A;  3CCS A;  1OOT A;  1KFZ A;  4WCI A;  5GAM f;  1P92 A;  1T3L A;  3TU4 K;  2MI6 A;  1OZ3 A;  4Y92 A;  1Q86 R;  1HJD A;  3EGX B;  4FSS A;  4DOV A;  1MMD A;  4PKC C;  2MPX C;  1WXT A;  1I5O B;  4PJJ A;  4HXJ A;  4J9D A;  5HCK A;  3CMA Q;  4C0Z A;  5A2Q E;  3CCQ T;  4N0A A;  2E10 A;  2HBP A;  4AMC A;  1B34 A;  4M75 E;  3OYE A;  3JCM h;  1VQ8 Q;  3ASK A;  3OB9 A;  3CCV Q;  1VQK T;  2OAW A;  3UPU A;  1VIE A;  3QYH B;  3RNJ A;  5A0D A;  1UDL A;  2DTO A;  3CC4 T;  4LN2 A;  3VS5 A;  3JCM e;  3CXC P;  4HVW A;  3E9G A;  1IHV A;  1H64 1;  4OP0 A;  1AWW A;  1M1G A;  1K9M R;  2CKK A;  1YIT A;  1JU5 C;  3J81 E;  4P5N A;  2R5M A;  1PRM C;  1RUW A;  3LYI A;  1AD5 A;  2XDD A;  4OMP A;  2DZC A;  1Q82 R;  1IHW A;  3I55 A;  3CPW A;  1WXU A;  1SKU B;  2DTH A;  3TRE A;  4MMK A;  1TS9 A;  1IRE B;  1KD1 C;  3CCR Q;  2CP3 A;  4BE1 A;  4M78 F;  4PJO F;  1AWO A;  4IUQ A;  4A53 A;  2K6D A;  1ZBX A;  1YWO A;  2EPD A;  1F1B B;  4M7A E;  2KQW A;  4QT7 A;  3H41 A;  4JS5 A;  1D3B A;  1U3O A;  2D8H A;  1VQ8 T;  3NGP A;  2X4X A;  3CCV T;  4GBQ A;  3CC7 Q;  2XDP A;  2E12 A;  2HD0 A;  1RAB B;  2VXE A;  2DL4 A;  4C8Q D;  4JJB A;  1KD1 U;  2V1R A;  2H3J A;  3FEO A;  5GAO m;  2AT1 B;  2LNV A;  1GCQ C;  3MEU A;  3OBW A;  2RHX A;  4M7D B;  5D6Y A;  1KQ2 A;  3RMQ A;  1VQ7 Q;  1I4K 1;  3HP9 A;  2KT8 A;  1MV0 B;  1ARK A;  2IPO B;  3M4G A;  2WSF E;  2EQJ A;  1QKX A;  1UGV A;  4HVV A;  5GAM g;  2DBM A;  4CC2 A;  2JUF A;  3OYB A;  3CCR T;  4L59 A;  4RTY A;  1ZX6 A;  2BTT A;  4B9X A;  1KQS P;  2Y4X A;  1YJW Q;  4B9W A;  2HL3 A;  2VV5 A;  2CS7 A;  2JJ9 A;  1MV3 A;  1NLO C;  4M75 G;  4L6V 5;  1NJI R;  3FLG A;  3UAT A;  4EIK A;  3V8K A;  4AG2 C;  2LZ6 B;  3M59 A;  1HYO A;  4PFO A;  3CCQ A;  3CC7 T;  1GL5 A;  2QTV A;  1BK2 A;  1ZSZ B;  1BYM A;  4F7U E;  3L2R A;  4C92 C;  2R57 A;  3TSZ A;  3JV3 A;  2FPE A;  4QQG A;  1U8R A;  2RA2 A;  5FU7 C;  1VQK A;  4PJO A;  2RJD A;  1D1B A;  2W10 A;  1N8R R;  1EIF A;  2RNA A;  4EMK C;  2PVO B;  5I11 A;  4O5V A;  3KUF A;  1YIJ Q;  2FEI A;  1JXM A;  2A08 A;  2I2L A;  1M8V A;  1JJ2 A;  4N4G A;  3OMG A;  4EMK B;  2COW A;  3F70 A;  2CP0 A;  2E6N A;  2DVE A;  4A4K A;  3EGU A;  3PIP A;  3D7S B;  1X2Q A;  2ZZD A;  1H8K A;  1J3T A;  1S72 Q;  2LT1 A;  2E5Q A;  1OQK A;  3A8L B;  3QXE B;  2PTK A;  4OF1 A;  3I5R A;  2JZ2 A;  2LQW A;  1YJW T;  2HAX A;  3PTA A;  4M7A G;  1BI0 A;  5GMK m;  2JN0 A;  4GY5 A;  3RER A;  4HA8 A;  3M0S A;  2GQV A;  4KUL A;  2KBT A;  2MOX A;  2XID A;  4M77 F;  3SWN A;  5HY6 A;  4CC3 A;  2VYT A;  5I2S A;  2K3X A;  2KYB A;  1U5S A;  2J7I A;  3EGD B;  3EH1 A;  1VQ8 A;  5CIU A;  3CCV A;  3EH2 A;  3UF4 A;  4RMO A;  3CXC S;  1Z9Q A;  2LVM A;  2R5A A;  1B7T A;  1LVK A;  4F17 A;  1YIJ T;  2K7A A;  2BE7 D;  4QQ6 A;  3NMZ C;  2J6K A;  4NS5 A;  4QVD A;  1YI2 T;  2ABL A;  4JZ3 A;  4A4H A;  3RKY A;  5LJ3 d;  2FRY A;  2D8J A;  1M27 C;  1Y0M A;  3R6N A;  3QUI A;  1QCO A;  4OGC A;  1NYF A;  2LC4 A;  1K8A C;  3C95 A;  4N0A C;  1S72 T;  4Z02 A;  1AEY A;  3OSS C;  1RL2 A;  2X3X D;  5CO7 A;  2EQM A;  1SF9 A;  2RQW A;  2PU9 B;  4X9D A;  1SSF A;  3CCR A;  1B34 B;  2P0Q A;  5IXF A;  2KY9 A;  2QDY B;  3H8Z A;  5GAO p;  2VB6 A;  1ABQ A;  1HK9 A;  2JTM A;  3UA7 A;  4F7U G;  2B8A A;  1VQL Q;  5GAO n;  4BE2 A;  4OMQ A;  2O4X A;  4J6W A;  1WZO A;  2GFA A;  3CBP A;  3CC7 A;  4WTO B;  3M9Q A;  1IZ6 A;  3OYM A;  4JZ4 A;  2YLC A;  3IQL A;  1RAD B;  2NUZ A;  4KBM B;  4RTX A;  1VYT A;  1VQN T;  1OZ2 A;  2V8K A;  1AT1 B;  2LRQ A;  4DBR A;  1QKW A;  1N27 A;  1K1Z A;  2DET A;  5GAN 2;  3MHX A;  3QPH A;  4M77 A;  3AHU A;  5LJ5 d;  3QJ6 A;  1PHT A;  2EJG A;  2YRV A;  1KK7 A;  1WNL A;  5IXB A;  5GAM h;  2XMF A;  5GAN 5;  4OMM A;  1QVF A;  1PD0 A;  1FMV A;  1NLP C;  1D3B B;  1T0H A;  1KQS S;  4DEY A;  2DXU A;  4M75 A;  4X9C A;  1Q86 U;  4AFU C;  3BY7 A;  2ROL A;  4RTV A;  1UGP B;  2MAM A;  1YJW A;  4LDY A;  1WLP B;  2LCL A;  2KRS A;  1RAE B;  2X9H A;  1T0J A;  5I21 A;  3INZ A;  5IT9 E;  1R0C B;  2DKG A;  3OY9 A;  1E6G A;  1X6G A;  1KD1 R;  2COY A;  2M0O A;  1UE9 A;  2HDA A;  3JCM Q;  3CBM A;  4RTZ A;  3VS4 A;  4AFS C;  1QLY A;  2EKH A;  2KNB B;  1UTI A;  3CCU Q;  1KHI A;  1YIJ A;  2ZPG B;  4C8Q E;  3AT1 B;  4IUT A;  3CCS Q;  1YI2 A;  1ZUK A;  3M0R A;  4FL6 A;  2DAQ A;  1X6B A;  3S3M A;  4C5E A;  2EYY A;  2RMO A;  4GLM A;  3LH0 A;  4WF2 A;  1S72 A;  4M7A A;  4BY6 C;  1SPK A;  4FU6 A;  3EFR A;  1M5Q 1;  3CXC A;  1G83 A;  2JS0 A;  2A7Y A;  1M1K R;  4PJO C;  4NL2 A;  4BY6 B;  1K4U S;  4A4E A;  2NWM A;  2DLP A;  4BAC A;  3HRT A;  1CKA A;  1GBQ A;  2P84 A;  2ZCF B;  4PJO B;  3QKJ A;  3OYY A;  1UGS B;  1JJ2 P;  1PCX A;  2KMT A;  1GXI E;  3VS6 A;  4B6M A;  2X35 A;  4KGZ B;  5LL6 S;  3HSB A;  4J83 A;  2GCX A;  4KRT A;  4C92 F;  5GAM j;  1WPY A;  3LGL A;  2DL8 A;  1SRL A;  2CYZ B;  3TSW A;  2BKD N;  4PK4 A;  2GF7 A;  4OB1 B;  1YIT Q;  3CCU T;  4E7K A;  4MDX A;  2J6O A;  4JJD A;  2ROT A;  1VQN A;  2HQE A;  3J80 E;  2AZS A;  1ACM B;  3OMC A;  2HKQ B;  1Q81 C;  2KGT A;  1UG1 A;  1NJI C;  2DRK A;  1QVG P;  3MEV A;  3OBY A;  2E41 A;  4RUG A;  3SWN C;  3HTR A;  1SG5 A;  1H92 A;  2V26 A;  3SD4 A;  2A37 A;  1CKB A;  4RCC A;  1GCQ A;  2XG8 D;  5A0G A;  1WJS A;  3S3N A;  2GBQ A;  2KT1 A;  1WX6 A;  1ZLM A;  4FYW B;  4OB0 B;  1VQP T;  2ESW A;  3DB3 A;  3QBY A;  3VKI A;  1NPP A;  1Q81 U;  2RO0 A;  1NJI U;  1MMA A;  1BBZ A;  4EDU A;  2B86 A;  4J9E A;  1KIK A;  4CRI A;  2JW4 A;  2ZPE B;  1MND A;  2CP6 A;  3MJX A;  1KQS A;  2JMA A;  1A0N B;  2CGH A;  4C8Q G;  1KQ1 A;  2A3L A;  1BB9 A;  3I9Q A;  1OI1 A;  3S3O A;  5CKB A;  1N8R U;  4HT9 A;  1N9S A;  1VQ4 T;  3HPW A;  3GIB A;  1RAC B;  1I5L A;  1K0X A;  4XU2 A;  1WHH A;  2F5T X;  4C92 A;  3PIO A;  1LJO A;  3C0C A;  2KI7 A;  3JRZ A;  2RQU A;  2FZG B;  2KAF A;  1DJ7 B;  2D0N A;  1Q95 G;  3SHW A;  2QQA A;  2VC8 A;  4FCY A;  2CZ0 B;  1MHN A;  2O4X B;  1Y96 B;  4XTX A;  1VQ5 T;  3EAE A;  4FT4 A;  2CDT A;  3A8G B;  1PC0 A;  3QZ5 B;  2DEU A;  1ZQ1 A;  2KEA A;  5HK0 A;  4ZNX A;  2RF0 A;  2KYM A;  4ZGD B;  1FMK A;  5GAN d;  4E47 A;  1VYU A;  1K8A R;  4HCC A;  4PJM A;  2EJ9 A;  4XU1 A;  2EW3 A;  3CCQ Q;  4RTT A;  4J9H A;  3LWI A;  4M77 C;  1YWP A;  5KCH A;  1ZA1 B;  1M1F A;  1QCF A;  1W1F A;  2OJ2 A;  2M9U A;  3OYJ A;  3A5Z B;  4RCB A;  2LX7 A;  4IUP A;  1AOJ A;  1VQK Q;  3EG3 A;  4M77 B;  3E1S A;  5D6W A;  3CC4 Q;  1Y07 A;  4Q5W A;  2QEX Q;  2XKO C;  2GNC A;  2DER A;  5ECA A;  4Z89 A;  1IRX A;  4M75 C;  4PLI A;  2W0Z A;  4J9G A;  3CCU A;  2CT4 A;  5GAO q;  2DVJ A;  2K3B A;  1H3Z A;  1YCS B;  2VXF A;  2LJ1 A;  1NZ9 A;  4J7F A;  2ED1 A;  2XDB A;  2OI3 A;  1M90 C;  4PNO A;  3CCE Q;  1WHJ A;  3G4S T;  4C8Q F;  1AHJ B;  1QVP A;  3RIR A;  4ELY C;  1N9R A;  1WQW A;  1K9A A;  2JTF A;  4FYY B;  3JB9 F;  2YRD A;  2LJ3 A;  2KK4 A;  4QW2 A;  1JJ2 S;  4J8O A;  1VQP A;  2BIV A;  1IGQ A;  1N5Z A;  4K11 A;  1WXB A;  2GFU A;  3OS1 A;  3OYH A;  2IVW A;  4JS4 A;  5IH2 A;  2L89 A;  5KE2 A;  4OMF B;  3HFN A;  2C0O A;  1G5V A;  1PRL C;  2QEX T;  4M7A C;  2LDM A;  4CI0 C;  2L3R A;  3UA6 A;  2K79 A;  1U06 A;  4Y28 E;  3PE0 A;  4M7A B;  2E65 A;  3X25 B;  2K57 A;  5CKE A;  2VGM A;  1WI7 A;  1VQ4 A;  2IIM A;  3CQT A;  5J39 A;  5KYX A;  4J7I A;  1WHM A;  3X26 B;  2FPF A;  3CCE T;  4R0K A;  3UT1 A;  1CSK A;  1W2B P;  2C0I A;  2NYS A;  2IG0 A;  1E6H A;  3NTH A;  2AIR B;  2SRC A;  4JPB W;  2ZPH B;  3L1A A;  5GJV B;  4X1V A;  1RLP C;  1VQ5 A;  2QQ9 A;  1MGQ A;  3CC2 T;  1PWT A;  3L2V A;  5LJ5 h;  2J06 A;  2DF6 A;  2VUB A;  3PMT A;  2DO3 A;  4ELZ C;  4IIO A;  1SEM A;  1X69 A;  2CP5 A;  5FRM A;  2VVK A;  1IB8 A;  4ZN1 A;  2E5K A;  2VGN A;  4C8Q A;  3GBQ A;  2F5K A;  5LJ3 j;  1C1A A;  2EYW A;  1OX8 A;  4QVZ A;  4MZM A;  5GAN 7;  2O2O A;  5GAN 8;  1M1K C;  1M8M A;  1VA7 A;  4PJN A;  1HXD A;  2QGF B;  2EVR A;  4E7I A;  2OTJ T;  3FJ5 A;  4LDU A;  3JCM b;  1IXD A;  3G6E T;  3G4S A;  2E6Z A;  2RI5 A;  3FB9 A;  2X4J A;  4OB3 B;  5EG2 A;  2X3W D;  1M1K U;  2HL5 C;  1Q81 R;  1GBR A;  1M2O A;  1WIE A;  2QTX A;  6AT1 B;  2HBW A;  2MCN A;  5IHK A;  1YHQ T;  4HKE A;  1QVF S;  3M55 A;  3BW1 A;  3WVD B;  4C92 B;  3GP8 A;  3I56 T;  3CC4 A;  3MPU B;  2QEX A;  4M7D E;  3CEY A;  2HEQ A;  3KFV A;  5AYF A;  5FU7 B;  5LJ5 j;  3Q1J A;  3VS2 A;  5A0L A;  3UWN A;  1PD1 A;  3EFS A;  1YI2 Q;  2JM9 A;  4O6J A;  2M0Y A;  4EPC A;  3KXT A;  2GQI A;  2YUP A;  2FRW A;  4M78 D;  5GMK i;  1R8O B;  1K76 A;  3CCE A;  1OX9 A;  2DJQ A;  3C4S A;  3LGF A;  2DL3 A;  4J9I A;  3OYF A;  3EG9 A;  3M0P A;  2BZY A;  1BU1 A;  3P8B B;  1VQ9 Q;  3VRY A;  4JLI A;  1BCM A;  2HQX A;  1QVG A;  3OA6 A;  2MYS A;  1BI2 A;  2BE9 B;  4J6X A;  3N5B B;  4C0D C;  2JT4 A;  4M75 F;  1BIB A;  1T3S A;  4C0D B;  2DL5 A;  2QAZ A;  4FSX A;  2KE9 A;  3JB9 I;  2EQU A;  1VQN Q;  3JCM c;  4FYX B;  2LQ8 A;  2Y4Y A;  2DXC A;  2KVQ G;  4KH0 B;  3BE3 A;  4OML A;  1PKS A;  2PVG B;  2OTJ A;  1M30 A;  2E70 A;  1R0B G;  1QP3 A;  2LX9 A;  1AZE A;  4C5G A;  5LJ3 f;  2WSE E;  4UC4 A;  1SHG A;  2D1X A;  4FT2 A;  1D09 B;  4PJL A;  4PFP A;  3G6E A;  1VQ9 T;  4BE0 A;  4OGE A;  4EMG A;  3WXM B;  3V8J A;  2YSQ A;  4JRQ A;  1MMG A;  1KG1 A;  1LCK A;  5CK9 A;  3C12 A;  5D7U A;  4N4H A;  3OS2 A;  1Y57 A;  1M90 R;  1Y7X A;  1K8A U;  3HHT B;  3JCM d;  4M7D G;  4II1 A;  4M7A F;  1M3B A;  1TSF A;  3PNW C;  2LQK A;  3QWY A;  5CCA A;  1KC8 C;  5KYX B;  2ZAE A;  2ECZ A;  1YCY A;  4DBF A;  4EMH A;  3FJP A;  2V8J A;  3CCJ Q;  1OUL A;  5J26 A;  2KDS A;  2DFU A;  2CSQ A;  2RD1 A;  4LE9 A;  4FIB A;  1M3C A;  5CQX A;  1HD3 A;  1YP5 A;  3VS3 A;  1LOJ A;  1RAF B;  5CR2 A;  1I81 A;  3HKS A;  1GFD A;  3RR6 A;  3V7R A;  3DLL A;  3EHQ A;  5FRO A;  2CRE A;  4D8D A;  2DA9 A;  4C8Q C;  1KC8 U;  4BDY A;  2ZGW A;  2JOY A;  1GFC A;  3M0U A;  5FWB A;  5GAM e;  1WFW A;  3EHR A;  2KRM A;  5IHI A;  3MEW A;  2JNG A;  4C8Q B;  5LJ5 f;  3QDR B;  2VWF A;  5KH6 A;  1NE8 A;  1O9S A;  3OYI A;  1D1C A;  1X01 A;  3I35 A;  3P8D A;  3M5A A;  8AT1 B;  3ME9 A;  2RJF A;  1TUG B;  4RTW A;  3OYG A;  2QDL A;  1V1C A;  2PQW A;  3ZL7 C;  1UHF A;  4QKU A;  2K2M A;  2SEM A;  2QA4 T;  2RPN A;  4C5I A;  4PLL A;  4FYV B;  2QAS A;  3CCJ T;  4F7U F;  1RLQ C;  1U1T A;  2RH2 A;  5GAN 6;  1UJ0 A;  2QG9 B;  3MO8 A;  1BI1 A;  1NEG A;  1OYX A;  1RAA B;  3OW2 P;  3OYA A;  3M53 A;  1FWZ A;  1G3Y A;  3CPF A;  1M3A A;  4QQD A;  2YUN A;  5FLX E;  5LJ3 g;  5GAN j;  2O88 A;  2DYI A;  4XU0 A;  1G8X A;  3A1P A;  1VQ9 A;  2K5I A;  1VQP Q;  2FYK A;  2F2W A;  7AT1 B;  1HSQ A;  2RK2 A;  4ME7 A;  4IIM A;  3VS7 A;  1W2B A;  3RES A;  4BD3 A;  2K4Y A;  4ATO A;  2X4Y A;  2LMJ A;  4CC7 A;  1VIF A;  2D9T A;  4M4Z A;  2A0F B;  3O8V A;  4KGX B;  1NG2 A;  1UB4 A;  3CCM T;  1YBY A;  2DE0 X;  4BUG A;  3CBO A;  2DEQ A;  3EG9 B;  1VQ4 Q;  3OYN A;  3JCM V;  1YJ9 T;  2JS2 A;  1XJW B;  2KXC A;  5GAO r;  1V76 A;  4KGV B;  3VV0 A;  5DLO A;  2EQK A;  2PUO B;  2JXB A;  4RG2 A;  2MF2 A;  4JRP A;  2A36 A;  2AHJ B;  3QYG B;  3RKX A;  4AG1 C;  3L2U A;  1UFF A;  3SWN B;  4LDW A;  2RJC A;  4F7U A;  1VQ5 Q;  1UEC A;  5KYW A;  3LWH A;  2XU8 A;  1G3T A;  2ENM A;  1QMC A;  4M78 E;  3ZEH A;  5LJ5 g;  1M4Z A;  2MWO A;  3LH5 A;  2EIF A;  4LXC A;  1NPR A;  4LD6 A;  2CUD A;  2WAC A;  2QK0 A;  3HRS A;  2NLU A;  5CKH A;  3PT9 A;  4M7D D;  2RHU A;  4OB2 B;  3GF5 A;  4NOY A;  1I07 A;  4HCK A;  1VUB A;  2CZ1 B;  3NPF A;  5KYN A;  2L0A A;  2O9V A;  2YUQ A;  4LDX A;  2DMO A;  2QA4 A;  4XAX B;  2V8I A;  2HZY A;  2AZV A;  4DQ2 A;  3CCJ A;  3JB9 H;  5L23 A;  3X28 B;  4D6W A;  4MZT A;  4RKU E;  1TTH B;  4BI8 B;  4ORZ A;  1RAI B;  2O9S A;  1JXO A;  3OSV A;  3T9N A;  3J7A F;  2KRN A;  3MET A;  3R6O A;  5L8R E;  3G4S Q;  2NUP A;  4XQ3 A;  4BDZ A;  2VAS A;  5DM7 R;  3SDZ A;  3G1J A;  4X34 A;  2GGR A;  3V8L A;  4V2S A;  3MEA A;  3SFM A;  2MIO A;  1NEB A;  3OYD A;  2BUD A;  4IUU A;  2JVV A;  1BKB A;  2VKN A;  3DLM A;  1C6V X;  1MUZ A;  4ZN3 A;  1AVZ C;  2CZ6 B;  4C5H A;  2DBK A;  5GAN f;  5IAY A;  4AFZ C;  2O01 E;  2ZPF B;  1K73 C;  3VYH B;  4E7Z A;  1JBM A;  2OX7 A;  3PFS A;  4RTU A;  2YWW A;  1KSW A;  2RJE A;  4LUD A;  4M75 B;  1B3Q A;  2CZ7 B;  1IGU A;  2DD4 A;  1EFN A;  1U1S A;  2QQS A;  1JO8 A;  2FZK B;  1KC8 R;  2RI2 A;  5GAM d;  2DIL A;  3LLR A;  2RB6 A;  3PGG A;  4PFZ A;  2KXD A;  1VOM A;  4JRK A;  4M78 G;  4PJO G;  4E7S A;  5LJ3 h;  1TXQ A;  2PVD B;  3E2U A;  1Y71 A;  1K73 U;  1PG5 B;  2EGE A;  2YLB A;  2EJF A;  2V1Q A;  2DXT A;  1WHK A;  5LJ3 e;  3CC2 Q;  1S1N A;  2C06 A;  2GTJ A;  3M0T A;  2DIQ A;  4JLG A;  1PSF A;  2X51 A;  1V29 B;  2RM4 A;  2OTL Q;  2PZ1 A;  4OMN A;  2LJ0 A;  2FB7 A;  1M90 U;  3G71 T;  4M77 E;  4BB7 A;  3JSC A;  3HRU A;  3L42 A;  2Y90 A;  1G2B A;  2CP2 A;  1OU8 A;  3DB4 A;  2AKK A;  2P4R A;  3VYG A;  2K5L A;  3VRZ A;  4KH1 B;  4DEX A;  1G3W A;  1BCO A;  1YNZ A;  2M1H A;  4D8K A;  3CD6 Q;  2EKO A;  1X27 A;  2KSS A;  5FW9 A;  1GRI A;  1QVG S;  4OVA A;  1D0X A;  2DYB A;  5CAI A;  2OTJ Q;  1D1A A;  3CCL T;  2RHZ A;  3O5Z A;  3X20 B;  3VUB A;  3EG1 A;  4GLK A;  3NFC A;  3G6E Q;  3ZBD A;  2JTE A;  4RG8 A;  3A8M B;  1FXX A;  1QCN A;  1RAH B;  2H3E B;  3LX7 A;  2X4W A;  5C6S A;  3GNF B;  3E19 A;  5GAN 3;  2OTL T;  3I5S A;  4J5Y A;  5LJ5 e;  5HK3 A;  1OV3 A;  2F2X A;  3OYL A;  3V7C A;  1WHL A;  3M56 A;  2G6F X;  4ZTJ A;  2O31 A;  1YHQ Q;  3OYC A;  3QJY A;  1TOV A;  3CMA T;  1WYX A;  2RI3 A;  5GAN g;  1XOV A;  1OEB A;  1TG0 A;  4J9F A;  2KRO A;  3I56 Q;  3REB B;  2CP7 A;  3URG A;  1TU0 B;  3CD6 T;  2M51 A;  4IUV A;  5C0M A;  4HCZ A;  3P8H A;  1X2K A;  2I0N A;  4F7U B;  5KYW B;  4KUI A;  2DRM A;  2YHT A;  4M7D C;  3NTI A;  4JRI A;  1UGR B;  1MNE A;  3PVQ A;  2YUO A;  3JB9 D;  1WGS A;  2EGA A;  4C0F A;  2ED0 A;  3WVE B;  2L5Q A;  4XTW A;  2ZPI B;  4FM4 B;  1M2V A;  3L2W A;  3TQ7 P;  2EFI A;  2E64 A;  5KYY A;  1ABO A;  1SSH A;  1VQO Q;  3EFO A;  1VQM Q;  3M0Q A;  3VUZ A;  3M54 A;  1G3S A;  2HSE B;  2QI2 A;  4ZGJ B;  4M77 G;  5DY9 A;  1D0Y A;  2EBP A;  3GLX A;  3OW2 A;  3HFO A;  3RUX A;  1Q7Y R;  3H0H A;  1AWX A;  4A4G A;  1X75 C;  1E7O A;  1W4S A;  4CC4 B;  2E3H A;  3G71 A;  2DIG A;  4R56 A;  1ZSZ C;  4DA4 A;  4XTY A;  4HT8 A;  1M9S A;  1TUD A;  3PVL A;  5IN1 A;  2NUP B;  4F16 A;  2M02 A;  4LUE A;  2FG0 A;  3L2Z A;  4C0G A;  1D0Z A;  4M78 A;  1JQQ A;  1WDX A;  4PJO D;  1XNI A;  3H9N A;  3JCM J;  2DX1 A;  3S6W A;  2FVU A;  1VQ7 T;  3CCL A;  2QXF A;  2L3S A;  1UEB A;  1VQO T;  1VQM T;  1FYN A;  3VJP A;  4LNP A;  3BDU A;  3EG2 A;  5KYU A;  1ZA2 B;  4E7L A;  2K2V A;  3RMS A;  1BIA A;  3CC2 A;  4ZTF A;  4JJC A;  4OMO A;  4N4I A;  3JCM P;  2DJZ A;  2OTL A;  3ER0 A;  4F04 B;  3GOX A;  2OAU A;  4BI4 A;  1UJY A;  1YJN Q;  2FZC B;  4C92 E;  4DBH A;  3JAM E;  2JM8 A;  3H6Z A;  8ATC B;  2LP5 A;  3CMA A;  4QVC A;  2DZ9 A;  9ATC B;  2Z0W A;  3TVT A;  2J05 A;  2D0Q B;  1N6A A;  2E4H A;  3CD6 A;  1KHC A;  2AK5 A;  4E2F B;  1WHG A;  2COZ A;  2A28 A;  3DKM A;  2FPD A;  5GMK h;  1W2B S;  1WJR A;  1UUE A;  1QWF A;  2DL7 A;  1QP2 A;  1K73 R;  4MDW A;  5GMK e;  1WA7 A;  2NUT A;  2AKL A;  2MK5 A;  4MZP A;  1ZUY A;  1RAG B;  3OQ5 A;  2EYZ A;  1UHC A;  3FIF A;  1PKT A;  1YN8 A;  2RQT A;  3CME Q;  5GAO l;  2EYX A;  2F1L A;  2YRC A;  1KJW A;  3TCJ A;  1YJN T;  4E7J A;  1LNX A;  1K0S A;  1OPK A;  1OU9 A;  1YHQ A;  2YT6 A;  4VUB A;  5CQY A;  2QA4 Q;  4JJN K;  5GAN h;  2YXY A;  3E9F A;  3VS0 A;  3SB2 A;  3I56 A;  4NL3 A;  3JCM f;  2RHY A;  4DOW A;  4IKF A;  1Y96 A;  3CPW P;  5GAN e;  1B07 A;  2BZX A;  1XTD A;  1IO6 A;  1VQ6 Q;  2EYQ A;  3FRN A;  3H0F A;  3MCA B;  3U23 A;  2LNH B;  4JUV A;  2PUK B;  3QDF A;  1Q86 C;  3NHN A;  1ZBJ A;  3PMI A;  3JB9 J;  3QZ9 B;  4JDS A;  2XK0 A;  3RBB B;  2XIC A;  1WQ7 A;  3FDR A;  2DXB A;  2LQN A;  1W70 A;  3ULR B;  1NBE B;  1TWB A;  1VYV A;  5CVI A;  1VQ7 A;  2MWP A;  1VQO A;  2WSC E;  3VU3 C;  1VQM A;  2CUB A;  4M77 D;  2GTO A;  4Y91 A;  1QQJ A;  3GPL A;  3CME T;  3A8O B;  2CH4 W;  2M16 A;  4Z88 A;  1AZG B;  4C92 G;  5GMK j;  2XI9 A;  2XD0 A;  4AFQ C;  4M75 D;  3G7Z A;  4LDV A;  5I2M A;  1W6X A;  5D6X A;  1X6O A;  5FWC A;  5EC7 A;  1UGQ B;  4HVU A;  5FU6 C;  1K9M C;  2KR3 A;  2L8D A;  2BZ8 A;  1VQL T;  1X43 A;  2JMC A;  4ANJ A;  2FO0 A;  2C0T A;  5FU6 B;  5AT1 B;  1M2V B;  3CCM Q;  3EGX A;  1Q82 C;  2HMA A;  1C0M A;  5HKC A;  5KYY B;  1VQ6 T;  3V7S A;  3OS5 A;  4MML A;  3RDV A;  3EFO B;  2L3Q A;  2R58 A;  1QWE A;  4M7D F;  3SEM A;  3UDC A;  5IHN A;  1YJ9 Q;  1FX7 A;  5GMK l;  5J3B A;  1RI9 A;  4XTZ A;  4FW1 A; 
#chains in the Genus database with same CATH homology
 4RMO A;  4XTU A;  2P4T A;  3NTK A;  3CXC S;  4ZN1 A;  2VGN A;  3OYD A;  2LVM A;  2P0K A;  2R5A A;  1K9M U;  2BUD A;  2E1H A;  3M57 A;  5CKF A;  4C8Q A;  1YIJ T;  5FRN A;  4QQ6 A;  4IUU A;  4NS5 A;  2JVV A;  4QVD A;  2F5K A;  1YI2 T;  5LJ3 j;  1BKB A;  4A4H A;  1Q82 U;  3DLM A;  3RKY A;  5LJ3 d;  5DLQ E;  4QVZ A;  5M9O A;  2QQR A;  4MZM A;  5GAN 7;  2ZPB B;  4ZN3 A;  2CZ6 B;  4XK8 E;  3CCL A;  2D6F A;  3QUI A;  4M7A D;  4OGC A;  3JCM W;  5GAN 8;  4C5H A;  2LC4 A;  5GAN f;  5IAY A;  1M1K C;  1K8A C;  2LT4 A;  3C95 A;  4N0A C;  1U8R A;  4Z02 A;  1S72 T;  3OSS C;  2O01 E;  1RL2 A;  1HXD A;  2ZPF B;  1K73 C;  4M78 C;  4PJO A;  5CO7 A;  2EQM A;  1YJN A;  3VYH B;  4E7I A;  2PU9 B;  1JBM A;  2OTJ T;  4X9D A;  3PFS A;  2DPP B;  1SSF A;  3CCR A;  1B34 B;  2P0Q A;  4M78 B;  4ZGE B;  2RJE A;  4M75 B;  4LDU A;  2CZ7 B;  2KY9 A;  2MMP A;  2QDY B;  3H8Z A;  5GAO p;  1XQH A;  2DD4 A;  3JCM b;  1U1S A;  3G6E T;  3JCM g;  3G4S A;  2QQS A;  3QSU A;  2E6Z A;  1HK9 A;  2JTM A;  4F7U G;  2RI2 A;  2RI5 A;  3FB9 A;  5GAM d;  4HCB A;  2X4J A;  3LLR A;  2B8A A;  2RB6 A;  3HL8 A;  3PGG A;  4OB3 B;  5EG2 A;  4JRK A;  4M78 G;  4PJO G;  5GAO n;  4BE2 A;  1M1K U;  2O4X A;  4J6W A;  5LJ3 h;  2PVD B;  2GFA A;  4IUR A;  3BDL A;  1Y71 A;  3CBP A;  3CC7 A;  1Q7Y C;  1K73 U;  2QTX A;  2YLB A;  3M9Q A;  1IZ6 A;  2EWN A;  2EJF A;  3OYM A;  1ZHI A;  2DXT A;  2YLC A;  5LJ3 e;  3CCS T;  2C06 A;  4LD9 K;  2DIQ A;  4JLG A;  2RK1 A;  1YHQ T;  1PSF A;  4HKE A;  1V29 B;  4KBM B;  2RM4 A;  3M55 A;  1QVF S;  4PJO E;  1VQN T;  1OZ2 A;  2V8K A;  1QW1 A;  3BW1 A;  2LRQ A;  3WVD B;  4C92 B;  3GP8 A;  3I56 T;  3CC4 A;  1N27 A;  2FB7 A;  4BI3 A;  2QEX A;  4E7H A;  4R55 A;  3CEY A;  4M77 E;  5AYF A;  3MHX A;  5GAN 2;  3QPH A;  4BB7 A;  3G71 T;  4M7D A;  5FU7 B;  4M77 A;  5LJ5 j;  3JSC A;  2F69 A;  3Q1J A;  3HRU A;  3CME A;  5LJ5 d;  3L42 A;  5A0L A;  3AHU A;  3UWN A;  2P0P A;  3EFS A;  3QJ6 A;  2EJG A;  2Y90 A;  2YRV A;  1BI3 A;  1WNL A;  3DB4 A;  5GAM h;  1Q7Y U;  2FL7 A;  4O6J A;  3VYG A;  2K5L A;  5KCO A;  5GAN 5;  1QVF A;  4EPC A;  3KXT A;  1G3W A;  2LCC A;  1N8R C;  2M1H A;  1D3B B;  2EKO A;  1KQS S;  2DXU A;  4M78 D;  3A8H B;  4M75 A;  2DK3 A;  4X9C A;  5GMK i;  1Q86 U;  3BY7 A;  1R8O B;  2KSS A;  3CCE A;  4L5G A;  3FC3 A;  1UGP B;  3C4S A;  2MAM A;  3LGF A;  1YJW A;  1QVG S;  4LDY A;  4OVA A;  1VQL A;  2LCL A;  4KUD K;  5CAI A;  3CPW S;  3OYF A;  5I21 A;  3INZ A;  5IT9 E;  4A54 A;  3CCL T;  3KBG A;  2RHZ A;  2DKG A;  3P8B B;  3X20 B;  3OY9 A;  3VUB A;  1VQ6 A;  3M4Y A;  4JLI A;  4GLK A;  3NFC A;  2DD5 A;  3ZBD A;  1YIT T;  4RG8 A;  2M0O A;  3A8M B;  1FXX A;  3QG1 A;  2EAY A;  3JCM Q;  1JRI A;  2HQX A;  1QVG A;  3OYK A;  3CBM A;  3JB9 G;  3OA6 A;  3LX7 A;  1BI2 A;  3MP1 A;  2X4W A;  3N5B B;  4J6X A;  3OS0 A;  3L2Q A;  3I55 T;  3QO3 A;  2K3Y A;  3GNF B;  3E19 A;  5C6S A;  2LTO A;  5GAN 3;  4XTV A;  2OTL T;  4J5Y A;  5LJ5 e;  4C0D C;  3JCM X;  3QHS A;  1KHI A;  5HK3 A;  1YIJ A;  2ZPG B;  4C8Q E;  4C92 D;  3OYL A;  4IUT A;  3V7C A;  1YI2 A;  3M56 A;  4M75 F;  4ZTJ A;  1O75 A;  1BIB A;  1RI0 A;  2DTI A;  4FL6 A;  4C0D B;  5CKD A;  3OYC A;  4FSX A;  4KT0 E;  3QJY A;  3CMA T;  2DAQ A;  2QQB A;  2EQU A;  3JB9 I;  3JCM c;  2RI3 A;  5GAN g;  4C5E A;  3S3M A;  1XOV A;  3ZFJ A;  4EMK A;  4PL6 A;  2K5F A;  3LH0 A;  4WF2 A;  1S72 A;  4TVR A;  2LQ8 A;  3URG A;  2Y4Y A;  2DXC A;  3X24 B;  4BY6 C;  4M7A A;  4FU6 A;  2KVQ G;  3M58 A;  3LW5 E;  3CD6 T;  1PSE A;  3EFR A;  4M7D E;  1M5Q 1;  5GAN 4;  3CXC A;  2RHI A;  4IUV A;  2A7Y A;  2PVG B;  5C0M A;  2OTJ A;  4HCZ A;  3P8H A;  4PJO C;  3MP8 A;  2E70 A;  2FHD A;  4NL2 A;  4BY6 B;  1QP3 A;  4A4E A;  2LX9 A;  4F7U B;  5KE3 A;  3MP6 A;  4BAC A;  4C5G A;  3HRT A;  4KUI A;  1WJQ A;  2XHC A;  5LJ3 f;  2WSE E;  2YHT A;  1M90 U;  4UC4 A;  2ZCF B;  4YTL A;  4M7D C;  3NTI A;  1I8F A;  4FT2 A;  4JRI A;  3CCM A;  1UGR B;  3OYY A;  1UGS B;  3QKJ A;  3JB9 D;  1WGS A;  4PJO B;  3G6E A;  4C0F A;  4J6Y A;  1VQ9 T;  3WVE B;  2KMT A;  2L5Q A;  4OGE A;  4EMG A;  4BE0 A;  1GXI E;  3WXM B;  3HSB A;  2X35 A;  3OW2 S;  1TH7 A;  5LL6 S;  4J83 A;  2ZPI B;  4FM4 B;  4XTW A;  3RKW A;  3V8J A;  2GCX A;  3L2W A;  4JRQ A;  2EFI A;  2E64 A;  4A4F A;  1YJ9 A;  1VQ7 T;  4C92 F;  1KG1 A;  5GAM j;  5CK9 A;  1WPY A;  3GNG A;  3C12 A;  3LGL A;  4N4H A;  3OS2 A;  2HNI A;  2CYZ B;  3TEE A;  1Y7X A;  1K8A U;  3C94 A;  3HHT B;  3BFM A;  2BKD N;  3VUZ A;  3L2V A;  3JCM d;  3M54 A;  1G3S A;  2G3R A;  3QII A;  4XU3 A;  1JB0 E;  2GF7 A;  2QI2 A;  4ZGJ B;  3CCS A;  4M7D G;  4II1 A;  4M77 G;  4OB1 B;  5DY9 A;  3CCU T;  4E7K A;  3OW2 A;  3GLX A;  4M7A F;  3PNW C;  5CCA A;  3HFO A;  2LQK A;  3RUX A;  1KC8 C;  4MDX A;  5GAM f;  1YCY A;  1VQN A;  1P92 A;  2HQE A;  3J80 E;  4EMH A;  3TU4 K;  2MI6 A;  1OZ3 A;  4A4G A;  3OMC A;  1Q81 C;  1X75 C;  1NJI C;  1W4S A;  3FJP A;  2V8J A;  3G71 A;  5J26 A;  3MEV A;  2DIG A;  2KDS A;  3OBY A;  2E41 A;  4R56 A;  2RD1 A;  4FIB A;  3SWN C;  4DOV A;  4PKC C;  4XTY A;  4DA4 A;  5CQX A;  4HT8 A;  1M9S A;  1LOJ A;  3SD4 A;  5IN1 A;  4RCC A;  5CR2 A;  2XG8 D;  1I81 A;  5A0G A;  3HKS A;  3V7R A;  4C0Z A;  5A2Q E;  3DLL A;  1WJS A;  3CCQ T;  3S3N A;  5FRO A;  4N0A A;  2E10 A;  2HBP A;  3L2Z A;  4OB0 B;  4C8Q C;  4C0G A;  4BDY A;  1KC8 U;  2ZGW A;  1VQP T;  1B34 A;  4M75 E;  3OYE A;  2JOY A;  4M78 A;  3DB3 A;  3JCM h;  3QBY A;  4PJO D;  5GAM e;  1XNI A;  3ASK A;  3JCM J;  3OB9 A;  3MEW A;  3VKI A;  2JNG A;  1NPP A;  1VQK T;  4C8Q B;  5LJ5 f;  1Q81 U;  2RO0 A;  3QDR B;  3UPU A;  1NJI U;  3S6W A;  1VIE A;  2FVU A;  1NE8 A;  3QYH B;  1O9S A;  2DTO A;  2QXF A;  4EDU A;  5A0D A;  5KH6 A;  1UEB A;  3JCM e;  3OYI A;  1VQO T;  1X01 A;  3E9G A;  1VQM T;  3P8D A;  3M5A A;  1H64 1;  3VJP A;  4OP0 A;  4CRI A;  1M1G A;  2ZPE B;  3BDU A;  2CKK A;  1YIT A;  4E7L A;  2K2V A;  3J81 E;  4P5N A;  3ME9 A;  2R5M A;  2RJF A;  3RMS A;  1KQS A;  3OYG A;  1BIA A;  2CGH A;  3LYI A;  1KQ1 A;  4C8Q G;  2A3L A;  4ZTF A;  3CC2 A;  2PQW A;  2XDD A;  1OI1 A;  2DZC A;  3S3O A;  5CKB A;  3I55 A;  2QA4 T;  4C5I A;  1N8R U;  4HT9 A;  1N9S A;  4N4I A;  3CPW A;  3JCM P;  2DJZ A;  1VQ4 T;  2OTL A;  3ER0 A;  3HPW A;  3GIB A;  4PLL A;  2DTH A;  3GOX A;  1I5L A;  2OAU A;  4MMK A;  3TRE A;  4BI4 A;  3CCJ T;  1IRE B;  4XU2 A;  4F7U F;  1U1T A;  4C92 E;  1KD1 C;  2F5T X;  4C92 A;  2RH2 A;  3JAM E;  3PIO A;  1LJO A;  3H6Z A;  4BE1 A;  4M78 F;  4PJO F;  5GAN 6;  3CMA A;  4IUQ A;  4A53 A;  3MO8 A;  3JRZ A;  4QVC A;  1BI1 A;  1ZBX A;  1OYX A;  2DZ9 A;  2KAF A;  1DJ7 B;  2QQA A;  2VC8 A;  3OYA A;  2CZ0 B;  3M53 A;  2D0Q B;  1N6A A;  2O4X B;  1MHN A;  1Y96 B;  4XTX A;  1FWZ A;  1VQ5 T;  3EAE A;  1G3Y A;  4FT4 A;  1KHC A;  3A8G B;  3CD6 A;  4M7A E;  2KQW A;  3CPF A;  4QQD A;  3QZ5 B;  4JS5 A;  1ZQ1 A;  5HK0 A;  1D3B A;  3DKM A;  5FLX E;  1VQ8 T;  5LJ3 g;  4ZGD B;  5GMK h;  5GAN j;  2X4X A;  3CCV T;  5GAN d;  1W2B S;  4E47 A;  1WJR A;  2XDP A;  2E12 A;  2HD0 A;  4XU0 A;  2EJ9 A;  4HCC A;  4XU1 A;  2VXE A;  1QP2 A;  4C8Q D;  1KD1 U;  2H3J A;  1VQ9 A;  4MDW A;  5GMK e;  3FEO A;  3LWI A;  2K5I A;  4M77 C;  5KCH A;  1M1F A;  5GAO m;  2LNV A;  2M9U A;  2FYK A;  3OYJ A;  4MZP A;  3MEU A;  3A5Z B;  4RCB A;  3OBW A;  2RHX A;  4IUP A;  4M7D B;  2RK2 A;  4M77 B;  3OQ5 A;  5D6Y A;  1KQ2 A;  3RMQ A;  3E1S A;  4ME7 A;  5D6W A;  1Y07 A;  1W2B A;  3FIF A;  4Q5W A;  1I4K 1;  3RES A;  2XKO C;  3HP9 A;  4BD3 A;  2K4Y A;  5GAO l;  4M75 C;  4ATO A;  2X4Y A;  4PLI A;  3M4G A;  2WSF E;  2EQJ A;  3CCU A;  5GAO q;  1VIF A;  2D9T A;  3TCJ A;  1YJN T;  4E7J A;  3O8V A;  5GAM g;  1H3Z A;  1UB4 A;  1LNX A;  2JUF A;  3OYB A;  3CCR T;  4L59 A;  2VXF A;  3CCM T;  1YBY A;  1YHQ A;  5CQY A;  4VUB A;  4JJN K;  4BUG A;  3CBO A;  4B9X A;  1NZ9 A;  2DEQ A;  4J7F A;  5GAN h;  2Y4X A;  2XDB A;  3OYN A;  3E9F A;  3JCM V;  4PNO A;  1M90 C;  3G4S T;  3SB2 A;  1AHJ B;  4C8Q F;  3I56 A;  1YJ9 T;  4B9W A;  2VV5 A;  4NL3 A;  2CS7 A;  3JCM f;  1QVP A;  2RHY A;  4DOW A;  3RIR A;  5GAO r;  4IKF A;  1Y96 A;  4M75 G;  4ELY C;  4L6V 5;  5GAN e;  3VV0 A;  1N9R A;  1WQW A;  2EQK A;  2JTF A;  2PUO B;  5DLO A;  1XTD A;  3JB9 F;  3FLG A;  4RG2 A;  2MF2 A;  4JRP A;  3V8K A;  3M59 A;  2AHJ B;  3QYG B;  3CC4 T;  3RKX A;  2EYQ A;  2KK4 A;  3FRN A;  4QW2 A;  3CCQ A;  3MCA B;  3CC7 T;  3L2U A;  3SWN B;  4LDW A;  1BYM A;  1JJ2 S;  4F7U E;  4JUV A;  3L2R A;  2PUK B;  4J8O A;  2RJC A;  4C92 C;  1VQP A;  4F7U A;  2BIV A;  2R57 A;  1Q86 C;  3LWH A;  3PMI A;  3JB9 J;  3QZ9 B;  2XU8 A;  1G3T A;  3ZEH A;  5LJ5 g;  4M78 E;  4JDS A;  1M4Z A;  2XK0 A;  4QQG A;  2XIC A;  2GFU A;  2RA2 A;  1WQ7 A;  3FDR A;  2MWO A;  5FU7 C;  2EIF A;  2DXB A;  3OS1 A;  1VQK A;  1NPR A;  2RJD A;  3OYH A;  4LD6 A;  5CVI A;  2IVW A;  1VQ7 A;  4JS4 A;  1EIF A;  2MWP A;  2WAC A;  4EMK C;  1VQO A;  2L89 A;  2PVO B;  5KE2 A;  2WSC E;  3HFN A;  3KUF A;  3HRS A;  2NLU A;  4O5V A;  3PT9 A;  4OMF B;  5CKH A;  3VU3 C;  1VQM A;  4M77 D;  4M7D D;  1G5V A;  4Y91 A;  2QEX T;  2RHU A;  3GPL A;  4OB2 B;  4M7A C;  2I2L A;  2LDM A;  4CI0 C;  1M8V A;  1JJ2 A;  4N4G A;  3OMG A;  2L3R A;  3A8O B;  4EMK B;  3GF5 A;  3F70 A;  4NOY A;  3CME T;  4Y28 E;  1VUB A;  2CZ1 B;  2M16 A;  4M7A B;  4C92 G;  5GMK j;  2E65 A;  3X25 B;  2E6N A;  2DVE A;  4A4K A;  2K57 A;  3PIP A;  2XI9 A;  4LDX A;  2XD0 A;  2ZZD A;  2QA4 A;  5CKE A;  2VGM A;  2LT1 A;  2E5Q A;  4XAX B;  2V8I A;  4M75 D;  3G7Z A;  4LDV A;  1VQ4 A;  5I2M A;  5J39 A;  3A8L B;  3QXE B;  4J7I A;  5D6X A;  1X6O A;  4OF1 A;  4DQ2 A;  3CCJ A;  3JB9 H;  3X26 B;  2JZ2 A;  1UGQ B;  3CCE T;  5FU6 C;  3UT1 A;  1K9M C;  1YJW T;  2HAX A;  3X28 B;  2L8D A;  2IG0 A;  3PTA A;  1VQL T;  4M7A G;  1BI0 A;  5GMK m;  4D6W A;  4MZT A;  4RKU E;  3NTH A;  2JN0 A;  2ZPH B;  5FU6 B;  1Q82 C;  4GY5 A;  4BI8 B;  3RER A;  3L1A A;  4HA8 A;  5HKC A;  3OSV A;  3T9N A;  1VQ6 T;  3V7S A;  3OS5 A;  4MML A;  3J7A F;  2GQV A;  4KUL A;  3MET A;  2R58 A;  2QQ9 A;  3R6O A;  1VQ5 A;  1MGQ A;  5L8R E;  3CC2 T;  4M7D F;  2XID A;  4M77 F;  3UDC A;  3SWN A;  4XQ3 A;  5LJ5 h;  5HY6 A;  1FX7 A;  5DM7 R;  5GMK l;  4BDZ A;  2VUB A;  3PMT A;  5J3B A;  2VYT A;  2DO3 A;  2K3X A;  4X34 A;  3SDZ A;  4ELZ C;  5I2S A;  3V8L A;  4V2S A;  1VQ8 A;  5FRM A;  4XTZ A;  5CIU A;  3MEA A;  3CCV A;  3SFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...