4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
3EFRA 5GMKi 4F7UA 5GAN6 2E10A 4X9DA 4XTWA 3JCMX 3GIBA 3JCMg 2Y90A 3JCMP 5GAOl 2VC8A 3QUIA 4XU3A 4X9CA 1HXDA 3L1AA 3L2ZA 4M78F 4V2SA 4M7DE 1M8VA 4N0AC 1WPYA 3VU3C 5LJ3e 4M77C 4XTVA 3RIRA 3JB9J 4M7DG 1WQ7A 5GAOm 4PJOG 1HK9A 2DXUA 3FJPA 4RCBA 5I21A 1KQ1A 2DXTA 5GAOn 3QHSA 4M75F 5GAMh 3JCMc 3SWNA 1D3BA 4M7AF 2EJFA 4C92G 5GMKm 5GMKh 5GAOq 2QTXA 4F7UB 4C8QF 4QVDA 3BY7A 2E41A 2EWNA 5GAMf 1Y96A 4Y91A 5LJ3j 3SWNB 4M75C 2RM4A 2EJ9A 1TH7A 5GMKl 5LJ5h 1WNLA 5GAMj 4M7DF 2RD1A 4JRKA 5GANj 4M7DB 4C92A 1X01A 4C8QC 3HFOA 5LJ3g 5GMKj 3BDUA 4M75G 5GAMd 5GANd 3V7SA 4XTZA 3RKXA 1H641 3HFNA 4M75E 5GANg 3QO3A 4XU1A 4C8QG 4M7AE 4JLIA 1N9RA 3JB9D 4EMKC 5LJ5d 4PNOA 4OP0A 4C8QE 5GANe 5GAMe 2RA2A 2JN0A 4M77D 4NL2A 4M78C 1I5LA 2ZGWA 3INZA 5GMKe 4PJOA 4DQ2A 4EMGA 4MMLA 4M77A 3V7RA 4N0AA 3JCMV 5LJ5f 4XTUA 1LOJA 4XU2A 4EMHA 1B34A 3FB9A 2YHTA 4M78G 4A54A 3JCMd 1YCYA 3M4GA 3V8LA 4M78E 2YLCA 3RERA 1I4K1 4EMKB 5GAN4 2DZCA 1B34B 4M78B 5LJ5e 2FB7A 5GANh 4PJOE 5GAN2 4XTYA 2EJGA 1LJOA 4XU0A 4F7UF 3HSBA 4C92C 1JRIA 4NOYA 3PGGA 2EAYA 2DEQA 3JB9I 3JB9F 4M75B 5GANf 3JCMf 3BFMA 2RB6A 4M78D 4J6XA 1I81A 4HA8A 2I2LA 4J6WA 4PJOC 4M7DC 4M78A 4C8QB 2CGHA 4M77E 3V8KA 5LJ5j 1BIBA 4C92E 3JCMh 4M7AB 4EMKA 1U1SA 3RKYA 4WF2A 4C92D 5GAN7 4A53A 4F7UG 4M7AD 5GAMg 3RUXA 5LJ5g 4C92B 4M7DA 1I8FA 1N9SA 2DJZA 5DY9A 4C8QD 2YLBA 4M7AA 3SB2A 3V7CA 4M77G 4M7DD 5CAIA 4M77B 2E1HA 2DKGA 4C8QA 3JB9H 2FYKA 2DZ9A 4PJOF 4M75D 4J6YA 3V8JA 3RKWA 5GAN8 4PJOB 5LJ3d 3JCMW 1WQWA 2DVEA 4M75A 3JCMJ 1U1TA 2HNIA 4HT8A 3JCMb 2VXFA 1KQ2A 4M7AC 4HT9A 4M7AG 4C92F 5GAOr 3BW1A 5LJ3h 4QVCA 4XQ3A 3EFSA 2DTIA 5GAN5 1LNXA 3FIFA 5LJ3f 2K57A 3SWNC 4M77F 3JCMQ 4NL3A 3QSUA 4MMKA 1BIAA 1MGQA 4XTXA 1JBMA 4F7UE 2DTOA 2VXEA 5GAN3 4J5YA 4JUVA 4RCCA 3AHUA 1M5Q1 3RESA 5GAOp 2DTHA 3JB9G 4JRIA 1Y96B 1D3BB 3JCMe 2E65A 2E64A 4PJOD
chains in the Genus database with same CATH superfamily
2RMOA 1BYMA 2O9SA 1WFWA 4KH1B 2E5KA 1KD1U 2DIQA 1UB4A 2R58A 1M3CA 2NUZA 1KQ1A 1LPLA 1WHHA 4BACA 5GMKm 1ABOA 4C8QF 1YJNT 2CP6A 5LJ5h 1FMVA 3E9FA 1JQQA 2C0OA 2CREA 2X4XA 3GPLA 4OB2B 3VV0A 2DFUA 1K9MU 2JN0A 2LDMA 2LQNA 1FXXA 2MI6A 3A8GB 2M0OA 2FO0A 1NEBA 3OYAA 1KQSS 1P92A 5FLXE 3CC4Q 2VB6A 3L2UA 3C12A 2DZCA 3HSBA 1KQSP 2YWWA 2DK3A 4FSSA 2MYSA 1B7TA 1TXQA 3JCMf 4J6XA 4M7DC 2EW3A 2R57A 4M77E 3NTIA 2DNUA 1KFZA 3DB3A 4JLGA 4WF2A 1JJ2A 1QLYA 3X26B 4M7AA 2VGMA 3VRYA 1FMKA 1VIFA 2DZ9A 4M75D 1GL5A 4DBFA 4J9BA 1N5ZA 1VQNQ 1KQ2A 2HD0A 3PMIA 4AFUC 2RQUA 5J3BA 1MMNA 3RMSA 4R0KA 1YIJQ 2D1XA 3CC7T 4F7UE 1YJWA 4JUVA 1RLQC 3UA7A 1VQ5Q 2XDPA 3OW2S 3OS1A 2HAXA 2MPXC 1KHCA 2FL7A 3REAB 3CC7A 4RKUE 2P84A 1PKTA 2E5QA 4RTWA 2COYA 2YXYA 2E3HA 2K5FA 3OYHA 2EQKA 2QGFB 5KYNA 3CCJQ 3SWNA 2D9TA 1EX4A 4L6V5 2J7IA 4PKCC 3CQTA 4ORZA 4M75C 4M7DF 3L42A 2X4WA 2VUBA 1GCQC 2CP2A 1X2QA 4M75G 2RK2A 5GANg 2JMCA 5LL6S 2RHZA 1Q81R 4HVUA 4AG2C 5GANe 2HQHA 4EMGA 4M77A 1GFCA 1ZX6A 4EMHA 1K1ZA 1JO8A 1QP2A 1YCYA 1Q7YC 3VS1A 1E6HA 2VVKA 2EKOA 1MV0B 1VYUA 1UDLA 4CC2A 2OX7A 3REBB 2DILA 4J9IA 4P5NA 2WSEE 1K0SA 2RB6A 4RTXA 4DOWA 4LDYA 4HA8A 2GGRA 4FIBA 2M16A 2QA4Q 2ZPIB 2H3EB 3LGFA 5I2SA 1VA7A 4RTVA 2QASA 3HTRA 2RI5A 4PJOB 1YP5A 5J39A 2CT3A 5AYFA 2NLUA 2KE9A 3VUZA 5D6YA 2GCXA 2ED0A 2HSPA 3EFSA 3OYKA 3M5AA 4F17A 5HK3A 1OU8A 1X6BA 1YIJA 4MMKA 1UE9A 2BKDN 2YRVA 1HSQA 3CCET 1MGQA 2MIOA 3CXCS 2HKNA 3M53A 1M5Q1 3RESA 1W4SA 3R6NA 2QTVA 1KC8U 2DERA 3X25B 1HD3A 2DLPA 5CKEA 3J80E 1ACMB 2OI3A 3EH1A 3JCMP 3QDRB 3PFSA 1FX7A 3VS7A 1YJ9Q 2K3XA 2PUOB 4ZTJA 4C5EA 2KT8A 1M27C 2GFAA 4PJOG 2EIFA 1HK9A 2AZVA 1C6VX 2M9UA 4FSXA 2PUKB 4EDUA 2EJFA 1BU1A 2O01E 1R0BG 3MKDA 4KUDK 3G4SQ 2JM9A 3BDUA 4E7LA 3V7SA 1YJWT 3PIOA 2CUBA 1G83A 4EIKA 2OTJT 3MEUA 2DEUA 2LJ0A 1X2KA 4WTOB 1T3LA 1RLPC 2FZCB 4E7HA 3FDRA 1OZ3A 2P0KA 1IZ6A 2A08A 2DXBA 2OTJA 1K8AU 3OYJA 1S1NA 1ZUKA 2DMOA 2XDBA 4NS5A 4JJBA 4PJOE 2YDLA 2XI9A 3LH5A 2MWPA 1I81A 1WDXA 1M1KR 1R8OB 1M1GA 3GF5A 1G5VA 5IT9E 1U1SA 2OTLA 3QYGB 3KBGA 3OYEA 1YWPA 2VWFA 4BE2A 4LD6A 4MZTA 4K11A 3V7CA 1K73C 3UPUA 4C8QA 2FYKA 1EFNA 1BI2A 1PHTA 4PK4A 3RBBB 3CPWP 3JCMW 1WQWA 3GIBA 1GFDA 2K6DA 2QGGA 1CKBA 1WA7A 2LX9A 3SWNC 3VS4A 3ZL7C 3H8ZA 1H3ZA 1SRMA 1YJ9A 1DJ7B 2P4RA 3CC2A 2AK5A 2DTOA 4RCCA 1AWWA 2C0TA 2LQ8A 3GLXA 2PU9B 8ATCB 3TSZA 1TUGB 1VQNA 3MP6A 3OBYA 1Q81C 3M55A 4X9DA 1G3TA 2DAQA 2D0NA 2COWA 3PTAA 5A0DA 1M1FA 2DPPB 2EQMA 2KNBB 3OMCA 5I21A 1QCNA 2M1HA 1N27A 4BB7A 1PRLC 5GMKh 2KRSA 2KYMA 3SEMA 4BY6B 2F2WA 2NUTA 5LJ3j 2RI2A 2EJ9A 3CCUQ 1IREB 2QQBA 4ZN1A 3VYGA 4C8QC 1IGUA 3X28B 1UGSB 3EFOA 1KC8R 2GF7A 4BY6C 4JLIA 1U3OA 2B86A 4OMFB 4PNOA 3I55Q 1N8RU 3NHNA 3A5ZB 2XKOC 4DA4A 3UA6A 2RQVA 2QEXT 4FW1A 1KD1C 1UJYA 4M78E 5KCHA 1NBEB 4BDZA 2IG0A 2KAFA 1B34B 1MMAA 2A3LA 4B9XA 1B3QA 2EAYA 1MUZA 4QT7A 3AT1B 1G3YA 3DLMA 3CPFA 1RABB 1H3HA 7AT1B 2RJDA 4IURA 2D8HA 3OB9A 3VS2A 3FEOA 2A28A 4HCKA 3OYYA 1D1AA 3G1JA 1UHFA 4KULA 4ZGEB 2YLBA 3MEVA 3ZEHA 3X24B 1WJRA 1YITQ 2GQVA 1K9MC 2EGAA 2L8DA 1WHMA 5LJ3h 2KMTA 4XQ3A 2DRKA 4QVZA 2LQKA 1ZBXA 3DLLA 3VYHB 2CH4W 2K4YA 1JJ2S 1VQKA 4J9CA 3VKIA 3PIPA 3WXMB 1ZUUA 3JCMe 4PL6A 4IUUA 3LGLA 2IPOB 2AZSA 3CCMQ 2H3JA 5KCOA 5KYWB 2L3QA 3DKMA 2HDAA 3H0IA 1NEGA 4E2FB 1WYXA 4LDXA 2QK0A 3VU3C 2V8IA 4M77C 2XHCA 1VIEA 3ASKA 1X75C 1W1FA 4QQ6A 4KGZB 1Q86R 2LNHB 4LDUA 1YNZA 4BI3A 2BZYA 3EH2A 5GAOq 1KIKA 4JS5A 2CP7A 3SWNB 3CCUA 2DL7A 3CMAA 1GCQA 4OVAA 1VQ8A 3HFOA 4PFZA 4HCZA 5GANd 5IXFA 2O88A 2O4XB 4HVVA 2CT4A 4MZPA 3JB9D 3RMQA 1YJWQ 5L23A 4CC3A 3O5ZA 3M0UA 2ABLA 1I5LA 3CXCA 1VQ8T 3HRTA 1Y0MA 4MMLA 4OMOA 1IB8A 3JCMV 3M0TA 3CCRA 3HL8A 1VQ7T 1XJWB 2ATCB 1WJSA 3QWYA 2XD0A 2KSSA 2EJGA 4F7UF 1J3TA 8AT1B 1UHCA 1VQPT 2KI7A 1IXDA 1LVKA 3V8KA 1BIBA 4EPCA 1AWXA 2CS7A 1H8KA 2FHDA 1I8FA 4M4ZA 1Z9ZA 1QWEA 1OULA 4OF1A 3TSWA 2M02A 4C5GA 4FT2A 1IHWA 1VQ6Q 4KRTA 4ZGJB 4OB0B 3CMEA 3SFMA 1X43A 1Q82R 3M59A 3VS3A 1Q7YU 2JS2A 3JCMQ 2P0QA 3TREA 2AHJB 2YRCA 4KGVB 3VUBA 1C0MA 1UGQB 2FPDA 1ABQA 2A0FB 5I2MA 3VJPA 1YJNA 2KQWA 2J6KA 1SSFA 2AKKA 3OSSC 4JRQA 1UJ0A 1H92A 4X9CA 1VQ8Q 2RJEA 1WPYA 1YHQT 2QA4A 2EQUA 4HCBA 3J81E 2KT1A 5IXBA 3VS6A 2EYXA 1UG1A 1M9SA 4OB1B 2DBKA 1Z9QA 3BY7A 1XQHA 4Y91A 4ZTFA 1YJNQ 2DYBA 2KRNA 5GAMd 1H641 4FYYB 4C0GA 1RAGB 5FU6C 2X3WD 4HKEA 4M7AE 3OA6A 1N9RA 1KC8C 3M9QA 3RNJA 4OB3B 1G3WA 1QQJA 3INZA 2LNVA 2X35A 2OTLQ 6AT1B 4O6JA 3G6EQ 3NTHA 1N8RC 3RR6A 5FWBA 4XU2A 4ELZC 4MZMA 1SEMA 3M4GA 1EIFA 2XDDA 3KFVA 1I4K1 4DBRA 1W6XA 5GAN4 5CQXA 3VS5A 2IIMA 3MHXA 5GAN2 3EG0A 2JXBA 4XU0A 2HCKA 4GY5A 2DEQA 5GANf 2ZPHB 4M78A 4PFOA 4IUQA 3FLGA 3EGXA 3LWHA 3JCMh 2LJ1A 1IGQA 1RACB 2YUPA 1W2BA 3G4SA 2NWMA 4AMCA 1WIEA 3RKWA 1V1CA 2HNIA 1M8MA 4IUVA 3F70A 3R6OA 5D6XA 5KYYA 1AWJA 2LT1A 1N6AA 2R5AA 3HRSA 3M0PA 2LQWA 2RH2A 3AHUA 1PD0A 1VQ4T 2JVVA 2L3SA 1PC0A 2FZKB 2DA9A 1Y57A 1AZEA 4F7UA 2W0ZA 3E19A 3H6ZA 3QBYA 4F16A 2LP5A 2VASA 4RUGA 2HQXA 4AT1B 1NPRA 3KXTA 1K73U 1M3BA 1RAFB 2OAUA 2D0QB 2P4TA 4PJMA 1I1JA 2KRMA 2CKKA 1M1KU 2RHYA 4RMOA 1YFNA 2WSFE 2OJ2A 2KYBA 2LCSA 4JRKA 5FU7C 3I5SA 1D1CA 2DVJA 2DF6A 2EYWA 4OP0A 3QJ6A 1SRLA 2RA2A 2KEAA 3U23A 1Q81U 1G3SA 4B6MA 1OEBA 5LJ5f 1SKUB 1LOJA 4N4IA 4LE9A 4M78G 2EYYA 2BZ8A 5DLOA 3RERA 2LMJA 2KDSA 3QIIA 2EVRA 5A2QE 5LJ5e 1OX9A 1FYNA 2GTOA 5FRMA 5DLQE 3EAEA 5CCAA 2LT4A 2RHIA 1SPKA 1Y71A 2MCNA 2RQRA 2HL5C 5HCKA 1D0YA 5CR2A 2DJZA 3P8DA 1AT1B 3MP1A 2Y4XA 4PJOF 1U1TA 1WI7A 2DXCA 3C4SA 2A37A 2X51A 3QSUA 4LUEA 4C0DB 5A0GA 1TS9A 1YITT 1FWZA 1S72A 1Y7XA 1UEBA 3PT9A 4E7SA 3NFCA 4JRIA 2B8AA 1K9AA 1W2BP 5DM7R 2JW4A 5GAN6 1YITA 4A63B 3S3MA 3JCMg 2KVQG 4BE1A 2XG8D 3GP8A 3OW2A 1HXDA 4M78F 1M2VA 1M8VA 4DBQA 4M7DG 1WQ7A 1ZLMA 4M75F 2X4YA 3WVEB 2JTFA 1QP3A 3QDFA 3FJ5A 3CCEQ 4OMLA 3OYGA 2RQTA 1TU0B 3H0HA 5GANj 4M7DB 1VQLQ 2K5IA 3O8VA 2QQAA 2BTTA 3OYCA 5KYWA 5I11A 2J6OA 3C94A 4OMMA 4C8QE 2RHXA 2FRYA 5GAMe 1CKAA 2QYZA 1PRMC 1VQLT 1U06A 2QDYB 1RAHB 2YHTA 2OTLT 4L59A 1BKBA 1B07A 3PVQA 5CK9A 1TOVA 1AD5A 2DD4A 1JU5C 1Y07A 3CMEQ 3OBWA 2RJFA 1BI0A 5GJWB 3JB9F 4M78D 3OYBA 2RI3A 4FU6A 3SDZA 2I2LA 5FU7B 1U8RA 4C92E 2JS0A 2YUNA 2GBQA 4AFZC 1FMWA 4C8QD 2KGTA 2LVMA 1QVGP 1K0XA 3N5BB 3HHTB 5HK0A 1YWOA 4J83A 3CCQT 1SG5A 1F1BB 3A8LB 2L2PA 3QZ5B 3SHWA 1S72Q 2EFIA 4PJLA 3E2UA 2DL8A 2LJ3A 1M90R 3JCMX 3OYLA 2BE9B 2LCLA 2XICA 3I56T 2KR3A 1QMCA 2VC8A 1M90U 3M58A 4A4EA 3CCVT 3M54A 1NJIU 4XTVA 3JB9J 1Q95G 3FJPA 4RCBA 2RHUA 2KROA 3I56A 3G6EA 4VUBA 1D3BA 3GBQA 3GNFB 3CCEA 4KUIA 3CCVA 1QKWA 1Y96A 2CSQA 2QEXA 5GAMj 2L5QA 1NJIR 4IKFA 4F04B 3A8OB 3G6ET 5LJ3g 3OYMA 1M2VB 2L0AA 1AEYA 2R5MA 1S72T 1PSFA 5LJ5d 4KBMB 3CCLQ 4HXJA 2NUPA 2ZPEB 1M3AA 3V7RA 2KY9A 4XTUA 1NYFA 4LD9K 3V8LA 1PWTA 1I0CA 4J9FA 3A1PA 1YBYA 3CCJT 3OSVA 1VQ6A 3QWXX 1NG2A 2E6ZA 4J6WA 3CCQQ 1BK2A 2J6FA 1PG5B 4FCYA 2RPNA 3CD6A 5IHIA 3NTKA 1I5OB 2L3PA 1X69A 4D8DA 4J6YA 1Q82U 2DE0X 5IN1A 3TCJA 1PSEA 3NGPA 4HVWA 2K57A 1ZSZA 4M77F 1GXIE 1WGSA 2LZ6B 3TEEA 4XTXA 1WXTA 3H41A 2OTJQ 1TTHB 5CKHA 2YT6A 1M30A 2YSQA 2XK0A 1RADB 1UGRB 2X4JA 3BDLA 5GMKi 2QAZA 5FW9A 1I07A 3J7AF 2QEXQ 3CMAT 2K79A 2JMAA 2XIDA 3CCLT 2G6FX 1VQ4Q 1VYTA 3KUFA 4MDXA 3ME9A 1YI2Q 5GAOm 3OY9A 1KQSA 3DB4A 1O75A 1NM7A 4OMNA 1JXMA 2D6FA 1JB0E 1YJ9T 2K2MA 2EWNA 1YHQQ 5HKCA 3CCRT 1VQ7A 1WHKA 2CYZB 2GQIA 1BCOA 4O5VA 4E7IA 2SEMA 5AT1B 2YRDA 4UC4A 4XU1A 1IO6A 2DX1A 4LDVA 1XNIA 2V1QA 2LX7A 2ROTA 4CC7A 1HYOA 2ROLA 3HKSA 2YUOA 3L2QA 3L2RA 1KG1A 2MOXA 3I55T 1JXOA 4BI8B 2MMPA 2RN8A 1UGVA 3OYDA 1OQKA 1U5SA 1ZBJA 5IAYA 4BD3A 2ZPBB 1M1KC 4ZN3A 4DEYA 1YCSB 4PJOC 3I55A 4E7JA 1R0CB 3MEAA 3CBMA 5FROA 3TVTA 2P0PA 4M7DD 5CAIA 2KXDA 2BZXA 3MEWA 1QVFS 1RI0A 2DVEA 4HT8A 4J7FA 5KE2A 5GAN5 4GLKA 1V29B 4OMQA 1UECA 4A4HA 2HBWA 2GTJA 1E7OA 1SHGA 5KH6A 5GAOp 1VQKQ 2HBPA 3QYHB 4AFSC 1OI1A 4PJJA 1WX6A 2EYQA 2Y90A 2KK4A 5KYUB 1QCOA 4XU3A 2HQEA 4M7DE 4N0AC 5EG2A 5KE3A 5LJ3e 5HY6A 2X9HA 1C1AA 2WACA 2RJCA 3Q1JA 2DXTA 2H8HA 3QHSA 4J9HA 4FYWB 1QVGS 4XAXB 2QTXA 2E41A 2F2XA 5CIUA 3UF4A 5GMKl 4D8KA 2K3YA 2COZA 4XTZA 5D6WA 4C8QG 2CZ1B 2JNGA 2RO0A 1WHJA 4E6RA 2EGCA 1UTIA 3MP8A 2CSIA 4NL2A 1D0ZA 3A8HB 1BI1A 4LN2A 2HZYA 3THKA 1VUBA 1QW1A 3LWIA 1NPPA 1G8XA 2FB7A 2LCCA 3URGA 2F2VA 4NOYA 2WSCE 3PGGA 4M75B 4Z88A 3TU4K 1WXUA 4RTYA 1MNEA 4PFPA 4R56A 1KJWA 1VOMA 1OYXA 4A53A 4IIOA 1D09B 3RUXA 3ZBDA 3ZFJA 4M77B 4BE0A 3CC7Q 4QKUA 2K7AA 5GAN8 3OS5A 3PE0A 3CEYA 4C92F 4QVCA 3RDVA 1VQ9T 1KSWA 5LJ3f 2RNAA 1GBQA 2O4XA 2PQWA 3CBOA 1BIAA 1NLPC 2DETA 4J5YA 3CCVQ 1X27A 2E64A 1VQMQ 4E7KA 2ESWA 1WXBA 3OS0A 3EGDA 1AVZC 2ZCFB 1UGPB 4V2SA 4RG2A 4ZGDB 2AIRB 1NYGA 3CMET 3EGDB 3QJYA 2IVWA 3JRZA 2FPFA 1K4US 2DL4A 2JUFA 3PMTA 3FRNA 1PNJA 1WNLA 1K8AR 2CP5A 1VQMA 2QI2A 3NMZC 2Z0WA 1QKXA 5GJVB 3GNGA 1ZQ1A 4OMPA 3S3NA 2EQJA 1TG0A 2DD5A 2YUQA 2I0NA 1YHQA 1QWFA 2QG9B 4A54A 3HPWA 1M90C 3C0CA 2A36A 4BDYA 1NJIC 3OMGA 1HJDA 2FRWA 4FM4B 4Y28E 2K9GA 4A4GA 1O9SA 1JRIA 2CH4A 3M4YA 4LUDA 1YIJT 3MO8A 3JV3A 5A0LA 2MF2A 3I56Q 4DEXA 3OYIA 4Z8AA 2DIGA 2O31A 1PM3A 1W70A 3FC3A 5GAN7 3S6WA 1N9SA 1WHGA 4J9DA 4Y92A 1T0HA 2X3XD 3JCMJ 4N4GA 4HT9A 3MPUB 2K3BA 5GAOr 4E7ZA 4Z02A 4JJNK 4F14A 1YI2A 1ZA1B 2QXFA 3JAME 4JDSA 2PZ1A 1Q86U 2CDTA 1TWBA 1MMDA 2FPEA 2F69A 4QQDA 2HL3A 3H9NA 1YI2T 2E65A 4FYXB 5KYXA 2BUDA 4J7IA 2Y4YA 2EPDA 4KH0B 2ZZDA 1ZHIA 2ENMA 3EFOB 2LRQA 3L1AA 2EGEA 3RIRA 3MJXA 3TQ7P 3UT1A 2C06A 2DXUA 2L89A 1QVFP 5FWCA 5GAMh 4CC4B 1BI3A 2JJ9A 1Q82C 1CSKA 4Z89A 5ECAA 2RM4A 1TH7A 4QQGA 2GFUA 4C92A 4IUPA 3RKXA 3PNWC 2PVGB 1QCFA 5IHNA 3LX7A 2D8JA 3SD4A 4D6WA 4GBQA 4M78C 1AZGB 1BBZA 1XTDA 4MDWA 3OYFA 3JCMd 1B34A 1W2BS 1ARKA 3QXEB 2CZ7B 3LW5E 3ULRB 3CC2Q 3CCSQ 1JJ2P 3EG3A 3EGXB 4FYVB 1ZSZB 4PLIA 1QVFA 4M78B 4ELYC 1OPKA 3VS0A 2DO3A 3T9NA 4A4KA 3EGUA 2CZ0B 3CC2T 2RF0A 4X34A 2E6NA 3CCQA 2O9VA 3UATA 1QVPA 3A8MB 4C8QB 1VQMT 9ATCB 1ZSZC 1QVGA 2E70A 4EMKA 3CPWA 2LC4A 1VQNT 5GAMg 1T0JA 1K73R 4ZNXA 4CRIA 1OU9A 2MWOA 5J26A 1A0NB 3JB9H 2NUTB 4OGCA 1M2OA 2GNCA 2CP3A 3ER0A 4LNPA 3BW1A 4QW2A 1LNXA 4AFQC 3QZ9B 3QG1A 1XOVA 1WLPB 1X6GA 5FRNA 3A98A 1JBMA 2A7YA 1GCPA 4JRPA 2MK5A 4JZ4A 1Y96B 2ZPGB 3P8HA 3EFRA 1TUCA 3E9GA 3CXCP 1VQ7Q 1PD1A 3QUIA 2K2VA 4PJNA 3CBPA 3L2ZA 3LYIA 1VQOQ 2CZ6B 4JS4A 4B9WA 2PTKA 3X20B 1NLOC 5CVIA 4F7UB 2QDLA 2E3IA 1OX8A 5GAMf 2F5TX 2ECZA 2RK1A 3M56A 2J05A 1OZ2A 3IQLA 1LCKA 3PVLA 3C95A 1X01A 2AKLA 1WHLA 1IRXA 5IH2A 3OQ5A 3H0FA 1E6GA 3QO3A 2JZ2A 4RTUA 3CCJA 3OW2P 3I35A 2E12A 5KYXB 4N4HA 1RAEB 3L2VA 3G71T 2ZGWA 5C0MA 5CKDA 2ZAEA 4ME7A 5IHKA 2CP0A 1D0XA 4R55A 2MAMA 2YLCA 2HMAA 3G71A 2ZPFB 5GANh 1VYVA 2EQIA 2NUPB 4C92C 5D7UA 3LH0A 2BE7D 3JB9I 1SSHA 4OGEA 1OV3A 3BFMA 3CCMA 4C0FA 1G2BA 2CGHA 1MMGA 1MHNA 1JEGA 4RG8A 1Q7YR 4M7AD 4C92B 1OPLA 1VQLA 1AOJA 2DKGA 2E1HA 2JT4A 3CC4A 4JJCA 4BUGA 2DBMA 2PVOB 4J8OA 2HKQB 3CCST 4HCCA 2DTIA 3FIFA 2V26A 1RI9A 3OYNA 2VKNA 2VGNA 2QQ9A 4JPBW 4A4FA 2VXEA 4KT0E 3BE3A 3L2WA 1NE8A 1D3BB 2G3RA 3CMAQ 4XTWA 3GOXA 1X6OA 2M51A 2LTOA 3M0RA 2JTEA 1VQPQ 1D1BA 2HSEB 1VQ5T 2DL3A 2HEQA 4XK8E 5CO7A 2CUDA 2FVUA 4ESRA 2FG0A 3JCMc 3NPFA 4M7AF 4C92G 1PKSA 1VQ5A 1NZ9A 2AT1B 4FT4A 4C5IA 1WZOA 3EG1A 3I9QA 4J9GA 2RD1A 3D7SB 1SHFA 1KHIA 2L3RA 3HFNA 3META 4M75E 1VQPA 4CI0C 1AHJB 4M77D 4PJOA 5GMKe 3QPHA 4DQ2A 1RUWA 2JOYA 3CCRQ 1SF9A 4GLMA 1YN8A 3FB9A 1ZUYA 1KK7A 2ED1A 4DOVA 4YTLA 4E47A 3G71Q 4LDWA 2FZGB 4PLLA 2DRMA 3CPWS 1MNDA 1LJOA 4Q5WA 5C6SA 1EZZB 2DM1A 1MV3A 1UFFA 2F1LA 4ATOA 2VYTA 4RTZA 1GRIA 2VV5A 1VQ9Q 5I22A 2SRCA 2V8KA 2XMFA 4M7AB 3M0SA 4C92D 2O2OA 4F7UG 5FU6B 2OAWA 4M7DA 4M77G 1ZSGA 2M0YA 5CQYA 1RAAB 4C0DC 2K5LA 3EG2A 2V8JA 4M75A 4M7AC 2VXFA 1BB9A 2QA4T 4M7AG 4X1VA 2DYIA 2E4HA 4NL3A 1VQ6T 1TSFA 1KD1R 5GAN3 4C5HA 2DL5A 3P8BB 2DTHA 3JB9G 5L8RE 2KBTA 3CD6T 3CCMT 4PJOD 2E10A 2PNIA 4RTTA 3G7ZA 4DBHA 3S3OA 4JJDA 2NYSA 1WJQA 5GAOl 3QKJA 1V76A 1K8AC 3LLRA 1RAIB 2EKHA 5GAOn 1VQKT 3CC4T 4J9EA 5M9OA 4IIMA 4QVDA 2W10A 2XU8A 3CCSA 2QQSA 3E1SA 1K76A 2C0IA 3HP9A 4WCIA 5GMKj 3OS2A 4C0ZA 1Q86C 4LXCA 4II1A 5KYUA 1ZA2B 4EMKC 2J06A 5KYYB 3CCLA 3M0QA 4N0AA 3G4ST 2RQWA 3CCUT 2KXCA 1N8RR 2BIVA 2JTMA 2QQRA 4EMKB 3WVDB 3VRZA 5CKFA 1BCMA 1PCXA 3UWNA 2EBPA 4XTYA 2FEIA 4TVRA 1RL2A 2EYZA 4L5GA 3EHQA 2PVDB 1VQ9A 1TUDA 5LJ5j 1VQ4A 1IHVA 3RKYA 2F5KA 2JM8A 4AG1C 3CD6Q 4FL6A 5LJ5g 4IUTA 5DY9A 1R77A 3SB2A 2DJQA 3I5RA 3HRUA 4ANJA 3JSCA 3V8JA 5LJ3d 3JCMb 1M4ZA 3UDCA 4JZ3A 4KGXB 4FW2A 2V1RA 1T3SA 1GBRA 1AWOA 1VQOA 3EHRA 3M57A 4BI4A 1UUEA 5EC7A 1OOTA 3MCAB 3EG9B 1VQOT 5CKBA 1K9MR 3EG9A
chains in the Genus database with same CATH topology
3LGLA 3JCMX 3OYLA 1BYMA 2BUDA 2LCLA 2Y4YA 2XICA 4J7IA 3I56T 2H3JA 5KCOA 2VC8A 3DKMA 2ZZDA 1KD1U 1ZHIA 1M90U 3M58A 4A4EA 3L1AA 2LRQA 2DIQA 1UB4A 2R58A 4LDXA 3CCVT 3VU3C 2V8IA 3M54A 4M77C 4XTVA 2XHCA 1VIEA 3ASKA 3RIRA 3JB9J 1NJIU 3UT1A 2C06A 1X75C 2DXUA 3FJPA 4QQ6A 1KQ1A 2L89A 4RCBA 5GAMh 2RHUA 3I56A 3G6EA 1BI3A 4VUBA 1D3BA 4LDUA 4BI3A 4BACA 5GMKm 1Q82C 3GNFB 5GAOq 4KUIA 3CCEA 4C8QF 3CCVA 4JS5A 1YJNT 1Y96A 3SWNB 2QEXA 2RM4A 1TH7A 3CCUA 5LJ5h 3CMAA 3E9FA 5GAMj 4OVAA 2L5QA 4QQGA 2GFUA 4C92A 4IKFA 3A8OB 3HFOA 5LJ3g 3G6ET 1VQ8A 4IUPA 4HCZA 5GANd 3OYMA 3RKXA 2X4XA 3GPLA 3PNWC 4OB2B 2O4XB 2PVGB 2R5MA 3VV0A 3LX7A 1S72T 3SD4A 4MZPA 3JB9D 3RMQA 1PSFA 5LJ5d 1K9MU 2JN0A 4KBMB 2LDMA 4M78C 4D6WA 3CXCA 1I5LA 1VQ8T 1XTDA 1FXXA 2ZPEB 3HRTA 4MDWA 4MMLA 3V7RA 2MI6A 2KY9A 3A8GB 2M0OA 3JCMV 3HL8A 4XTUA 3OYFA 3CCRA 3JCMd 1B34A 1W2BS 3QXEB 4LD9K 2CZ7B 3LW5E 3V8LA 3OYAA 1KQSS 1YBYA 1P92A 5FLXE 1WJSA 3L2UA 3C12A 2DZCA 4PLIA 1QVFA 4M78B 2XD0A 4ELYC 2KSSA 2EJGA 3CCJT 4F7UF 3HSBA 2DO3A 3OSVA 2DK3A 3T9NA 1VQ6A 3CCST 3JCMf 4A4KA 4J6XA 1VQPT 2CZ0B 3CC2T 2E6ZA 4J6WA 4X34A 2E6NA 4M7DC 3CCQA 4C8QB 1QVPA 3A8MB 2R57A 4M77E 3V8KA 3NTIA 1BIBA 4EPCA 1VQMT 1QVGA 2E70A 2CS7A 3DB3A 4EMKA 3CPWA 4JLGA 2FHDA 4WF2A 2LC4A 1JJ2A 1VQNT 3CD6A 5GAMg 1I8FA 4CRIA 3NTKA 3X26B 2MWOA 4M7AA 2VGMA 4OF1A 5J26A 3JB9H 1VIFA 4OGCA 4C5GA 2DZ9A 4M75D 4J6YA 4FT2A 1Q82U 4ZGJB 1KQ2A 3ER0A 2HD0A 4OB0B 3PMIA 3CMEA 5IN1A 3BW1A 4QW2A 3SFMA 3TCJA 3M59A 1PSEA 1LNXA 1Q7YU 5J3BA 3QZ9B 2K57A 3QG1A 1XOVA 4M77F 3JCMQ 2P0QA 3RMSA 1GXIE 1WGSA 3TEEA 5FRNA 4XTXA 3CC7T 1JBMA 3TREA 4F7UE 2AHJB 1YJWA 3VUBA 4JUVA 2A7YA 5CKHA 1UGQB 2XDPA 4JRPA 3OW2S 3OS1A 2HAXA 2XK0A 1KHCA 2FL7A 1Y96B 2ZPGB 2X4JA 1UGRB 5I2MA 3P8HA 3BDLA 3VJPA 3EFRA 5GMKi 1YJNA 3CC7A 2KQWA 3E9GA 3J7AF 1SSFA 4RKUE 3CMAT 3OSSC 4JRQA 2E5QA 2K2VA 3QUIA 2XIDA 3CBPA 4X9CA 3CCLT 2RJEA 3L2ZA 3LYIA 4HCCA 1WPYA 3KUFA 1YHQT 2QA4A 4MDXA 3ME9A 2EQUA 5GAOm 3OY9A 3J81E 1KQSA 2CZ6B 2K5FA 4JS4A 4HCBA 3DB4A 1O75A 2EQKA 4B9WA 3OYHA 3X20B 3SWNA 2D9TA 2D6FA 5CVIA 1JB0E 1M9SA 4OB1B 4F7UB 1YJ9T 4L6V5 4PKCC 3BY7A 2EWNA 1XQHA 4Y91A 5GAMf 4ZTFA 2F5TX 5HKCA 2RK1A 4M75C 3CCRT 1VQ7A 3M56A 2CYZB 1OZ2A 4M7DF 3L42A 4O5VA 2X4WA 2VUBA 3C95A 1X01A 4E7IA 5GAMd 4M75G 2RK2A 3OQ5A 1H641 4UC4A 5LL6S 5GANg 4C0GA 5FU6C 3QO3A 4HKEA 4XU1A 2JZ2A 4M7AE 2RHZA 3OA6A 1N9RA 3CCJA 3M9QA 1KC8C 4LDVA 2E12A 5GANe 4N4HA 1XNIA 1G3WA 4OB3B 3L2VA 3G71T 2ZGWA 3INZA 5C0MA 2LNVA 4EMGA 2X35A 5CKDA 4M77A 4ME7A 4O6JA 3HKSA 3NTHA 1N8RC 4EMHA 4XU2A 3L2QA 4R55A 4ELZC 1QP2A 1YCYA 4MZMA 3M4GA 1Q7YC 1EIFA 2XDDA 2MAMA 3L2RA 2YLCA 1I4K1 2EKOA 1KG1A 3G71A 5GAN4 5CQXA 2ZPFB 3I55T 3MHXA 5GANh 5GAN2 4BI8B 4XU0A 2MMPA 4P5NA 4GY5A 3OYDA 4C92C 2DEQA 3LH0A 5IAYA 2WSEE 2ZPBB 4BD3A 4OGEA 5GANf 4ZN3A 3JB9I 3BFMA 2RB6A 4DOWA 3CCMA 4C0FA 4LDYA 4HA8A 4PJOC 3I55A 2ZPHB 4M78A 4FIBA 4IUQA 2CGHA 3FLGA 3LWHA 2M16A 3JCMh 1MHNA 2ZPIB 4RG8A 3LGFA 4E7JA 4M7AD 3MEAA 4C92B 1W2BA 3CBMA 5FROA 5I2SA 1VQLA 3G4SA 2P0PA 4M7DD 5CAIA 2DKGA 2E1HA 2RI5A 4PJOB 3CC4A 3RKWA 3MEWA 5J39A 1RI0A 5AYFA 1QVFS 2NLUA 4BUGA 2DVEA 4HT8A 2HNIA 5D6YA 3VUZA 2PVOB 4J8OA 2GCXA 4J7FA 4IUVA 3F70A 3R6OA 5D6XA 3EFSA 5KE2A 2DTIA 5GAN5 3OYKA 4GLKA 2LT1A 3FIFA 3M5AA 1V29B 1N6AA 5HK3A 2R5AA 3HRSA 4A4HA 1YIJA 4MMKA 2BKDN 2YRVA 3OYNA 3CCET 1MGQA 3CXCS 2VGNA 3M53A 2QQ9A 4A4FA 2RH2A 2VXEA 4KT0E 5KH6A 3AHUA 1M5Q1 3RESA 1W4SA 5GAOp 1VQ4T 2JVVA 3L2WA 1NE8A 1KC8U 3X25B 1D3BB 2HBPA 2G3RA 3QYHB 5CKEA 3J80E 4F7UA 1OI1A 4XTWA 3GOXA 2EYQA 1X6OA 3JCMP 2Y90A 2KK4A 2LTOA 3E19A 3QDRB 4PL6A 3PFSA 1FX7A 3H6ZA 4XU3A 3QBYA 4ZTJA 2HQEA 4M7DE 2HQXA 1VQ5T 2K3XA 2PUOB 4N0AC 4XK8E 5CO7A 5EG2A 4C5EA 5KE3A 5HY6A 2GFAA 1NPRA 5LJ3e 3KXTA 4PJOG 2EIFA 1HK9A 2WACA 2RJCA 1K73U 2FVUA 3Q1JA 2DXTA 2M9UA 2OAUA 3QHSA 4FSXA 3JCMc 2D0QB 2P4TA 2PUKB 4EDUA 4M7AF 2EJFA 4C92G 4XAXB 1QVGS 2QTXA 2CKKA 1M1KU 1VQ5A 1NZ9A 2E41A 2RHYA 4FT4A 4C5IA 4RMOA 2WSFE 5CIUA 2O01E 5GMKl 2RD1A 4JRKA 4KUDK 5FU7C 2K3YA 3BDUA 4E7LA 3V7SA 4XTZA 1YJWT 1KHIA 2L3RA 3HFNA 3META 4M75E 5D6WA 1VQPA 3PIOA 4C8QG 4CI0C 2CZ1B 2JNGA 2RO0A 2OTJT 4OP0A 3QJ6A 2RA2A 1AHJB 3MEUA 4M77D 3MP8A 1G3SA 4NL2A 1Q81U 4PJOA 5GMKe 3QPHA 4DQ2A 3A8HB 1BI1A 2JOYA 4E7HA 3FDRA 1OZ3A 5LJ5f 2P0KA 1IZ6A 1LOJA 4N4IA 3FB9A 4M78G 2DXBA 1VUBA 5DLOA 2OTJA 1QW1A 1K8AU 3OYJA 3LWIA 3RERA 4DOVA 4YTLA 1NPPA 4E47A 2XDBA 4LDWA 4PLLA 2KDSA 3QIIA 5A2QE 4NS5A 5LJ5e 2FB7A 3CPWS 2LCCA 4PJOE 3URGA 5FRMA 1LJOA 4Q5WA 5DLQE 2XI9A 4NOYA 2WSCE 3EAEA 3PGGA 5C6SA 5CCAA 4M75B 2LT4A 2MWPA 4ATOA 3TU4K 1I81A 2VYTA 2VV5A 1R8OB 2RHIA 1Y71A 4R56A 1M1GA 3GF5A 1G5VA 5IT9E 2V8KA 1OYXA 4M7AB 1U1SA 2OTLA 4C92D 3QYGB 4A53A 3KBGA 4F7UG 5FU6B 3OYEA 3RUXA 4M7DA 5CR2A 2DJZA 3P8DA 4LD6A 3ZBDA 4BE2A 3MP1A 4MZTA 2Y4XA 3V7CA 3ZFJA 4M77G 5CQYA 1K73C 4M77B 4BE0A 4C0DC 4C8QA 3UPUA 2FYKA 2K5LA 1BI2A 4PJOF 5GAN8 2V8JA 3JCMW 1WQWA 3OS5A 4M75A 3GIBA 1U1TA 4M7AC 3CEYA 2VXFA 2QA4T 4C92F 4M7AG 4QVCA 1VQ9T 2DXCA 2LX9A 3C4SA 5LJ3f 3SWNC 3QSUA 3H8ZA 4NL3A 1VQ6T 1H3ZA 2O4XA 4C0DB 5A0GA 2PQWA 3CBOA 1YJ9A 1BIAA 1DJ7B 1YITT 3CC2A 1FWZA 2DTOA 5GAN3 4J5YA 4C5HA 4RCCA 2LQ8A 1S72A 1Y7XA 2PU9B 2DTHA 3GLXA 3P8BB 5L8RE 3JB9G 1UEBA 3PT9A 3NFCA 4JRIA 2B8AA 1VQNA 3CD6T 2E64A 3MP6A 5DM7R 3OBYA 3CCMT 1Q81C 4PJOD 5GAN6 2E10A 3M55A 4X9DA 4E7KA 1YITA 3G7ZA 1G3TA 3S3OA 3S3MA 3JCMg 1WJQA 2KVQG 2DAQA 2XG8D 3OS0A 4BE1A 3GP8A 5GAOl 3OW2A 2ZCFB 1UGPB 3PTAA 3QKJA 1HXDA 4V2SA 4M78F 4RG2A 4ZGDB 1K8AC 1M8VA 5A0DA 1M1FA 3LLRA 3CMET 4M7DG 1WQ7A 2DPPB 2EQMA 3QJYA 3OMCA 5I21A 5GAOn 1VQKT 2M1HA 1N27A 2IVWA 4M75F 3JRZA 4BB7A 3CC4T 2X4YA 3WVEB 5M9OA 2JTFA 5GMKh 1QP3A 2JUFA 4QVDA 4BY6B 3PMTA 2XU8A 3FRNA 5LJ3j 2RI2A 3CCSA 3OYGA 1M1KC 2EJ9A 2QQSA 3E1SA 1WNLA 1IREB 2QQBA 4ZN1A 5GANj 3HP9A 2QI2A 1VQMA 4M7DB 3VYGA 4C8QC 5GMKj 3OS2A 4C0ZA 2K5IA 3O8VA 2QQAA 3X28B 1UGSB 3OYCA 1Q86C 3GNGA 4II1A 2GF7A 1ZQ1A 3C94A 4BY6C 4JLIA 4OMFB 4EMKC 3S3NA 4PNOA 2EQJA 2RHXA 2DD5A 4C8QE 5GAMe 1N8RU 3CCLA 3A5ZB 1YHQA 2XKOC 4DA4A 1VQLT 4N0AA 3G4ST 2QEXT 2QDYB 3CCUT 4A54A 3HPWA 2YHTA 1KD1C 1M90C 2OTLT 2BIVA 4M78E 5KCHA 2JTMA 2QQRA 4BDYA 4EMKB 4L59A 1BKBA 3OMGA 3WVDB 5CKFA 4BDZA 1NJIC 2IG0A 2KAFA 3UWNA 4FM4B 1B34B 4Y28E 5CK9A 2DD4A 4XTYA 1Y07A 4A4GA 1O9SA 4IUUA 3OBWA 1JRIA 2A3LA 4TVRA 4B9XA 1RL2A 2EAYA 2RJFA 3M4YA 1BI0A 1YIJT 3JB9F 3MO8A 4L5GA 4M78D 2MF2A 5A0LA 3OYBA 1G3YA 3DLMA 3CPFA 2RI3A 4FU6A 3SDZA 2I2LA 2PVDB 1VQ9A 5FU7B 3OYIA 1U8RA 5LJ5j 2DIGA 2RJDA 4IURA 3OB9A 4C92E 1VQ4A 3FC3A 3RKYA 3FEOA 2F5KA 5GAN7 3OYYA 4FL6A 5LJ5g 3S6WA 4IUTA 1N9SA 4KULA 5DY9A 2YLBA 4C8QD 4ZGEB 3MEVA 3SB2A 3ZEHA 3X24B 3HRUA 2LVMA 1WJRA 3JSCA 3V8JA 2GQVA 1K9MC 3N5BB 3HHTB 5HK0A 2L8DA 5LJ3d 1VQ7T 3JCMJ 3JCMb 4N4GA 4HT9A 1M4ZA 4J83A 5GAOr 5LJ3h 3UDCA 2KMTA 4XQ3A 3CCQT 4QVZA 4Z02A 4JJNK 2LQKA 1ZBXA 1VQOA 2QXFA 1YI2A 3M57A 3A8LB 4BI4A 3JAME 3DLLA 3QZ5B 3VYHB 4JDSA 2K4YA 1Q86U 1JJ2S 5CKBA 2EFIA 1VQKA 3PIPA 3VKIA 3MCAB 2F69A 3WXMB 4QQDA 1VQOT 1YI2T 3JCMe 2E65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFR A;  5GMK i;  4F7U A;  5GAN 6;  2E10 A;  4X9D A;  4XTW A;  3JCM X;  3GIB A;  3JCM g;  2Y90 A;  3JCM P;  5GAO l;  2VC8 A;  3QUI A;  4XU3 A;  4X9C A;  1HXD A;  3L1A A;  3L2Z A;  4M78 F;  4V2S A;  4M7D E;  1M8V A;  4N0A C;  1WPY A;  3VU3 C;  5LJ3 e;  4M77 C;  4XTV A;  3RIR A;  3JB9 J;  4M7D G;  1WQ7 A;  5GAO m;  4PJO G;  1HK9 A;  2DXU A;  3FJP A;  4RCB A;  5I21 A;  1KQ1 A;  2DXT A;  5GAO n;  3QHS A;  4M75 F;  5GAM h;  3JCM c;  3SWN A;  1D3B A;  4M7A F;  2EJF A;  4C92 G;  5GMK m;  5GMK h;  5GAO q;  2QTX A;  4F7U B;  4C8Q F;  4QVD A;  3BY7 A;  2E41 A;  2EWN A;  5GAM f;  1Y96 A;  4Y91 A;  5LJ3 j;  3SWN B;  4M75 C;  2RM4 A;  2EJ9 A;  1TH7 A;  5GMK l;  5LJ5 h;  1WNL A;  5GAM j;  4M7D F;  2RD1 A;  4JRK A;  5GAN j;  4M7D B;  4C92 A;  1X01 A;  4C8Q C;  3HFO A;  5LJ3 g;  5GMK j;  3BDU A;  4M75 G;  5GAM d;  5GAN d;  3V7S A;  4XTZ A;  3RKX A;  1H64 1;  3HFN A;  4M75 E;  5GAN g;  3QO3 A;  4XU1 A;  4C8Q G;  4M7A E;  4JLI A;  1N9R A;  3JB9 D;  4EMK C;  5LJ5 d;  4PNO A;  4OP0 A;  4C8Q E;  5GAN e;  5GAM e;  2RA2 A;  2JN0 A;  4M77 D;  4NL2 A;  4M78 C;  1I5L A;  2ZGW A;  3INZ A;  5GMK e;  4PJO A;  4DQ2 A;  4EMG A;  4MML A;  4M77 A;  3V7R A;  4N0A A;  3JCM V;  5LJ5 f;  4XTU A;  1LOJ A;  4XU2 A;  4EMH A;  1B34 A;  3FB9 A;  2YHT A;  4M78 G;  4A54 A;  3JCM d;  1YCY A;  3M4G A;  3V8L A;  4M78 E;  2YLC A;  3RER A;  1I4K 1;  4EMK B;  5GAN 4;  2DZC A;  1B34 B;  4M78 B;  5LJ5 e;  2FB7 A;  5GAN h;  4PJO E;  5GAN 2;  4XTY A;  2EJG A;  1LJO A;  4XU0 A;  4F7U F;  3HSB A;  4C92 C;  1JRI A;  4NOY A;  3PGG A;  2EAY A;  2DEQ A;  3JB9 I;  3JB9 F;  4M75 B;  5GAN f;  3JCM f;  3BFM A;  2RB6 A;  4M78 D;  4J6X A;  1I81 A;  4HA8 A;  2I2L A;  4J6W A;  4PJO C;  4M7D C;  4M78 A;  4C8Q B;  2CGH A;  4M77 E;  3V8K A;  5LJ5 j;  1BIB A;  4C92 E;  3JCM h;  4M7A B;  4EMK A;  1U1S A;  3RKY A;  4WF2 A;  4C92 D;  5GAN 7;  4A53 A;  4F7U G;  4M7A D;  5GAM g;  3RUX A;  5LJ5 g;  4C92 B;  4M7D A;  1I8F A;  1N9S A;  2DJZ A;  5DY9 A;  4C8Q D;  2YLB A;  4M7A A;  3SB2 A;  3V7C A;  4M77 G;  4M7D D;  5CAI A;  4M77 B;  2E1H A;  2DKG A;  4C8Q A;  3JB9 H;  2FYK A;  2DZ9 A;  4PJO F;  4M75 D;  4J6Y A;  3V8J A;  3RKW A;  5GAN 8;  4PJO B;  5LJ3 d;  3JCM W;  1WQW A;  2DVE A;  4M75 A;  3JCM J;  1U1T A;  2HNI A;  4HT8 A;  3JCM b;  2VXF A;  1KQ2 A;  4M7A C;  4HT9 A;  4M7A G;  4C92 F;  5GAO r;  3BW1 A;  5LJ3 h;  4QVC A;  4XQ3 A;  3EFS A;  2DTI A;  5GAN 5;  1LNX A;  3FIF A;  5LJ3 f;  2K57 A;  3SWN C;  4M77 F;  3JCM Q;  4NL3 A;  3QSU A;  4MMK A;  1BIA A;  1MGQ A;  4XTX A;  1JBM A;  4F7U E;  2DTO A;  2VXE A;  5GAN 3;  4J5Y A;  4JUV A;  4RCC A;  3AHU A;  1M5Q 1;  3RES A;  5GAO p;  2DTH A;  3JB9 G;  4JRI A;  1Y96 B;  1D3B B;  3JCM e;  2E65 A;  2E64 A;  4PJO D; 
#chains in the Genus database with same CATH topology
 2RMO A;  1BYM A;  2O9S A;  1WFW A;  4KH1 B;  2E5K A;  1KD1 U;  2DIQ A;  1UB4 A;  2R58 A;  1M3C A;  2NUZ A;  1KQ1 A;  1LPL A;  1WHH A;  4BAC A;  5GMK m;  1ABO A;  4C8Q F;  1YJN T;  2CP6 A;  5LJ5 h;  1FMV A;  3E9F A;  1JQQ A;  2C0O A;  2CRE A;  2X4X A;  3GPL A;  4OB2 B;  3VV0 A;  2DFU A;  1K9M U;  2JN0 A;  2LDM A;  2LQN A;  1FXX A;  2MI6 A;  3A8G B;  2M0O A;  2FO0 A;  1NEB A;  3OYA A;  1KQS S;  1P92 A;  5FLX E;  3CC4 Q;  2VB6 A;  3L2U A;  3C12 A;  2DZC A;  3HSB A;  1KQS P;  2YWW A;  2DK3 A;  4FSS A;  2MYS A;  1B7T A;  1TXQ A;  3JCM f;  4J6X A;  4M7D C;  2EW3 A;  2R57 A;  4M77 E;  3NTI A;  2DNU A;  1KFZ A;  3DB3 A;  4JLG A;  4WF2 A;  1JJ2 A;  1QLY A;  3X26 B;  4M7A A;  2VGM A;  3VRY A;  1FMK A;  1VIF A;  2DZ9 A;  4M75 D;  1GL5 A;  4DBF A;  4J9B A;  1N5Z A;  1VQN Q;  1KQ2 A;  2HD0 A;  3PMI A;  4AFU C;  2RQU A;  5J3B A;  1MMN A;  3RMS A;  4R0K A;  1YIJ Q;  2D1X A;  3CC7 T;  4F7U E;  1YJW A;  4JUV A;  1RLQ C;  3UA7 A;  1VQ5 Q;  2XDP A;  3OW2 S;  3OS1 A;  2HAX A;  2MPX C;  1KHC A;  2FL7 A;  3REA B;  3CC7 A;  4RKU E;  2P84 A;  1PKT A;  2E5Q A;  4RTW A;  2COY A;  2YXY A;  2E3H A;  2K5F A;  3OYH A;  2EQK A;  2QGF B;  5KYN A;  3CCJ Q;  3SWN A;  2D9T A;  1EX4 A;  4L6V 5;  2J7I A;  4PKC C;  3CQT A;  4ORZ A;  4M75 C;  4M7D F;  3L42 A;  2X4W A;  2VUB A;  1GCQ C;  2CP2 A;  1X2Q A;  4M75 G;  2RK2 A;  5GAN g;  2JMC A;  5LL6 S;  2RHZ A;  1Q81 R;  4HVU A;  4AG2 C;  5GAN e;  2HQH A;  4EMG A;  4M77 A;  1GFC A;  1ZX6 A;  4EMH A;  1K1Z A;  1JO8 A;  1QP2 A;  1YCY A;  1Q7Y C;  3VS1 A;  1E6H A;  2VVK A;  2EKO A;  1MV0 B;  1VYU A;  1UDL A;  4CC2 A;  2OX7 A;  3REB B;  2DIL A;  4J9I A;  4P5N A;  2WSE E;  1K0S A;  2RB6 A;  4RTX A;  4DOW A;  4LDY A;  4HA8 A;  2GGR A;  4FIB A;  2M16 A;  2QA4 Q;  2ZPI B;  2H3E B;  3LGF A;  5I2S A;  1VA7 A;  4RTV A;  2QAS A;  3HTR A;  2RI5 A;  4PJO B;  1YP5 A;  5J39 A;  2CT3 A;  5AYF A;  2NLU A;  2KE9 A;  3VUZ A;  5D6Y A;  2GCX A;  2ED0 A;  2HSP A;  3EFS A;  3OYK A;  3M5A A;  4F17 A;  5HK3 A;  1OU8 A;  1X6B A;  1YIJ A;  4MMK A;  1UE9 A;  2BKD N;  2YRV A;  1HSQ A;  3CCE T;  1MGQ A;  2MIO A;  3CXC S;  2HKN A;  3M53 A;  1M5Q 1;  3RES A;  1W4S A;  3R6N A;  2QTV A;  1KC8 U;  2DER A;  3X25 B;  1HD3 A;  2DLP A;  5CKE A;  3J80 E;  1ACM B;  2OI3 A;  3EH1 A;  3JCM P;  3QDR B;  3PFS A;  1FX7 A;  3VS7 A;  1YJ9 Q;  2K3X A;  2PUO B;  4ZTJ A;  4C5E A;  2KT8 A;  1M27 C;  2GFA A;  4PJO G;  2EIF A;  1HK9 A;  2AZV A;  1C6V X;  2M9U A;  4FSX A;  2PUK B;  4EDU A;  2EJF A;  1BU1 A;  2O01 E;  1R0B G;  3MKD A;  4KUD K;  3G4S Q;  2JM9 A;  3BDU A;  4E7L A;  3V7S A;  1YJW T;  3PIO A;  2CUB A;  1G83 A;  4EIK A;  2OTJ T;  3MEU A;  2DEU A;  2LJ0 A;  1X2K A;  4WTO B;  1T3L A;  1RLP C;  2FZC B;  4E7H A;  3FDR A;  1OZ3 A;  2P0K A;  1IZ6 A;  2A08 A;  2DXB A;  2OTJ A;  1K8A U;  3OYJ A;  1S1N A;  1ZUK A;  2DMO A;  2XDB A;  4NS5 A;  4JJB A;  4PJO E;  2YDL A;  2XI9 A;  3LH5 A;  2MWP A;  1I81 A;  1WDX A;  1M1K R;  1R8O B;  1M1G A;  3GF5 A;  1G5V A;  5IT9 E;  1U1S A;  2OTL A;  3QYG B;  3KBG A;  3OYE A;  1YWP A;  2VWF A;  4BE2 A;  4LD6 A;  4MZT A;  4K11 A;  3V7C A;  1K73 C;  3UPU A;  4C8Q A;  2FYK A;  1EFN A;  1BI2 A;  1PHT A;  4PK4 A;  3RBB B;  3CPW P;  3JCM W;  1WQW A;  3GIB A;  1GFD A;  2K6D A;  2QGG A;  1CKB A;  1WA7 A;  2LX9 A;  3SWN C;  3VS4 A;  3ZL7 C;  3H8Z A;  1H3Z A;  1SRM A;  1YJ9 A;  1DJ7 B;  2P4R A;  3CC2 A;  2AK5 A;  2DTO A;  4RCC A;  1AWW A;  2C0T A;  2LQ8 A;  3GLX A;  2PU9 B;  8ATC B;  3TSZ A;  1TUG B;  1VQN A;  3MP6 A;  3OBY A;  1Q81 C;  3M55 A;  4X9D A;  1G3T A;  2DAQ A;  2D0N A;  2COW A;  3PTA A;  5A0D A;  1M1F A;  2DPP B;  2EQM A;  2KNB B;  3OMC A;  5I21 A;  1QCN A;  2M1H A;  1N27 A;  4BB7 A;  1PRL C;  5GMK h;  2KRS A;  2KYM A;  3SEM A;  4BY6 B;  2F2W A;  2NUT A;  5LJ3 j;  2RI2 A;  2EJ9 A;  3CCU Q;  1IRE B;  2QQB A;  4ZN1 A;  3VYG A;  4C8Q C;  1IGU A;  3X28 B;  1UGS B;  3EFO A;  1KC8 R;  2GF7 A;  4BY6 C;  4JLI A;  1U3O A;  2B86 A;  4OMF B;  4PNO A;  3I55 Q;  1N8R U;  3NHN A;  3A5Z B;  2XKO C;  4DA4 A;  3UA6 A;  2RQV A;  2QEX T;  4FW1 A;  1KD1 C;  1UJY A;  4M78 E;  5KCH A;  1NBE B;  4BDZ A;  2IG0 A;  2KAF A;  1B34 B;  1MMA A;  2A3L A;  4B9X A;  1B3Q A;  2EAY A;  1MUZ A;  4QT7 A;  3AT1 B;  1G3Y A;  3DLM A;  3CPF A;  1RAB B;  1H3H A;  7AT1 B;  2RJD A;  4IUR A;  2D8H A;  3OB9 A;  3VS2 A;  3FEO A;  2A28 A;  4HCK A;  3OYY A;  1D1A A;  3G1J A;  1UHF A;  4KUL A;  4ZGE B;  2YLB A;  3MEV A;  3ZEH A;  3X24 B;  1WJR A;  1YIT Q;  2GQV A;  1K9M C;  2EGA A;  2L8D A;  1WHM A;  5LJ3 h;  2KMT A;  4XQ3 A;  2DRK A;  4QVZ A;  2LQK A;  1ZBX A;  3DLL A;  3VYH B;  2CH4 W;  2K4Y A;  1JJ2 S;  1VQK A;  4J9C A;  3VKI A;  3PIP A;  3WXM B;  1ZUU A;  3JCM e;  4PL6 A;  4IUU A;  3LGL A;  2IPO B;  2AZS A;  3CCM Q;  2H3J A;  5KCO A;  5KYW B;  2L3Q A;  3DKM A;  2HDA A;  3H0I A;  1NEG A;  4E2F B;  1WYX A;  4LDX A;  2QK0 A;  3VU3 C;  2V8I A;  4M77 C;  2XHC A;  1VIE A;  3ASK A;  1X75 C;  1W1F A;  4QQ6 A;  4KGZ B;  1Q86 R;  2LNH B;  4LDU A;  1YNZ A;  4BI3 A;  2BZY A;  3EH2 A;  5GAO q;  1KIK A;  4JS5 A;  2CP7 A;  3SWN B;  3CCU A;  2DL7 A;  3CMA A;  1GCQ A;  4OVA A;  1VQ8 A;  3HFO A;  4PFZ A;  4HCZ A;  5GAN d;  5IXF A;  2O88 A;  2O4X B;  4HVV A;  2CT4 A;  4MZP A;  3JB9 D;  3RMQ A;  1YJW Q;  5L23 A;  4CC3 A;  3O5Z A;  3M0U A;  2ABL A;  1I5L A;  3CXC A;  1VQ8 T;  3HRT A;  1Y0M A;  4MML A;  4OMO A;  1IB8 A;  3JCM V;  3M0T A;  3CCR A;  3HL8 A;  1VQ7 T;  1XJW B;  2ATC B;  1WJS A;  3QWY A;  2XD0 A;  2KSS A;  2EJG A;  4F7U F;  1J3T A;  8AT1 B;  1UHC A;  1VQP T;  2KI7 A;  1IXD A;  1LVK A;  3V8K A;  1BIB A;  4EPC A;  1AWX A;  2CS7 A;  1H8K A;  2FHD A;  1I8F A;  4M4Z A;  1Z9Z A;  1QWE A;  1OUL A;  4OF1 A;  3TSW A;  2M02 A;  4C5G A;  4FT2 A;  1IHW A;  1VQ6 Q;  4KRT A;  4ZGJ B;  4OB0 B;  3CME A;  3SFM A;  1X43 A;  1Q82 R;  3M59 A;  3VS3 A;  1Q7Y U;  2JS2 A;  3JCM Q;  2P0Q A;  3TRE A;  2AHJ B;  2YRC A;  4KGV B;  3VUB A;  1C0M A;  1UGQ B;  2FPD A;  1ABQ A;  2A0F B;  5I2M A;  3VJP A;  1YJN A;  2KQW A;  2J6K A;  1SSF A;  2AKK A;  3OSS C;  4JRQ A;  1UJ0 A;  1H92 A;  4X9C A;  1VQ8 Q;  2RJE A;  1WPY A;  1YHQ T;  2QA4 A;  2EQU A;  4HCB A;  3J81 E;  2KT1 A;  5IXB A;  3VS6 A;  2EYX A;  1UG1 A;  1M9S A;  4OB1 B;  2DBK A;  1Z9Q A;  3BY7 A;  1XQH A;  4Y91 A;  4ZTF A;  1YJN Q;  2DYB A;  2KRN A;  5GAM d;  1H64 1;  4FYY B;  4C0G A;  1RAG B;  5FU6 C;  2X3W D;  4HKE A;  4M7A E;  3OA6 A;  1N9R A;  1KC8 C;  3M9Q A;  3RNJ A;  4OB3 B;  1G3W A;  1QQJ A;  3INZ A;  2LNV A;  2X35 A;  2OTL Q;  6AT1 B;  4O6J A;  3G6E Q;  3NTH A;  1N8R C;  3RR6 A;  5FWB A;  4XU2 A;  4ELZ C;  4MZM A;  1SEM A;  3M4G A;  1EIF A;  2XDD A;  3KFV A;  1I4K 1;  4DBR A;  1W6X A;  5GAN 4;  5CQX A;  3VS5 A;  2IIM A;  3MHX A;  5GAN 2;  3EG0 A;  2JXB A;  4XU0 A;  2HCK A;  4GY5 A;  2DEQ A;  5GAN f;  2ZPH B;  4M78 A;  4PFO A;  4IUQ A;  3FLG A;  3EGX A;  3LWH A;  3JCM h;  2LJ1 A;  1IGQ A;  1RAC B;  2YUP A;  1W2B A;  3G4S A;  2NWM A;  4AMC A;  1WIE A;  3RKW A;  1V1C A;  2HNI A;  1M8M A;  4IUV A;  3F70 A;  3R6O A;  5D6X A;  5KYY A;  1AWJ A;  2LT1 A;  1N6A A;  2R5A A;  3HRS A;  3M0P A;  2LQW A;  2RH2 A;  3AHU A;  1PD0 A;  1VQ4 T;  2JVV A;  2L3S A;  1PC0 A;  2FZK B;  2DA9 A;  1Y57 A;  1AZE A;  4F7U A;  2W0Z A;  3E19 A;  3H6Z A;  3QBY A;  4F16 A;  2LP5 A;  2VAS A;  4RUG A;  2HQX A;  4AT1 B;  1NPR A;  3KXT A;  1K73 U;  1M3B A;  1RAF B;  2OAU A;  2D0Q B;  2P4T A;  4PJM A;  1I1J A;  2KRM A;  2CKK A;  1M1K U;  2RHY A;  4RMO A;  1YFN A;  2WSF E;  2OJ2 A;  2KYB A;  2LCS A;  4JRK A;  5FU7 C;  3I5S A;  1D1C A;  2DVJ A;  2DF6 A;  2EYW A;  4OP0 A;  3QJ6 A;  1SRL A;  2RA2 A;  2KEA A;  3U23 A;  1Q81 U;  1G3S A;  4B6M A;  1OEB A;  5LJ5 f;  1SKU B;  1LOJ A;  4N4I A;  4LE9 A;  4M78 G;  2EYY A;  2BZ8 A;  5DLO A;  3RER A;  2LMJ A;  2KDS A;  3QII A;  2EVR A;  5A2Q E;  5LJ5 e;  1OX9 A;  1FYN A;  2GTO A;  5FRM A;  5DLQ E;  3EAE A;  5CCA A;  2LT4 A;  2RHI A;  1SPK A;  1Y71 A;  2MCN A;  2RQR A;  2HL5 C;  5HCK A;  1D0Y A;  5CR2 A;  2DJZ A;  3P8D A;  1AT1 B;  3MP1 A;  2Y4X A;  4PJO F;  1U1T A;  1WI7 A;  2DXC A;  3C4S A;  2A37 A;  2X51 A;  3QSU A;  4LUE A;  4C0D B;  5A0G A;  1TS9 A;  1YIT T;  1FWZ A;  1S72 A;  1Y7X A;  1UEB A;  3PT9 A;  4E7S A;  3NFC A;  4JRI A;  2B8A A;  1K9A A;  1W2B P;  5DM7 R;  2JW4 A;  5GAN 6;  1YIT A;  4A63 B;  3S3M A;  3JCM g;  2KVQ G;  4BE1 A;  2XG8 D;  3GP8 A;  3OW2 A;  1HXD A;  4M78 F;  1M2V A;  1M8V A;  4DBQ A;  4M7D G;  1WQ7 A;  1ZLM A;  4M75 F;  2X4Y A;  3WVE B;  2JTF A;  1QP3 A;  3QDF A;  3FJ5 A;  3CCE Q;  4OML A;  3OYG A;  2RQT A;  1TU0 B;  3H0H A;  5GAN j;  4M7D B;  1VQL Q;  2K5I A;  3O8V A;  2QQA A;  2BTT A;  3OYC A;  5KYW A;  5I11 A;  2J6O A;  3C94 A;  4OMM A;  4C8Q E;  2RHX A;  2FRY A;  5GAM e;  1CKA A;  2QYZ A;  1PRM C;  1VQL T;  1U06 A;  2QDY B;  1RAH B;  2YHT A;  2OTL T;  4L59 A;  1BKB A;  1B07 A;  3PVQ A;  5CK9 A;  1TOV A;  1AD5 A;  2DD4 A;  1JU5 C;  1Y07 A;  3CME Q;  3OBW A;  2RJF A;  1BI0 A;  5GJW B;  3JB9 F;  4M78 D;  3OYB A;  2RI3 A;  4FU6 A;  3SDZ A;  2I2L A;  5FU7 B;  1U8R A;  4C92 E;  2JS0 A;  2YUN A;  2GBQ A;  4AFZ C;  1FMW A;  4C8Q D;  2KGT A;  2LVM A;  1QVG P;  1K0X A;  3N5B B;  3HHT B;  5HK0 A;  1YWO A;  4J83 A;  3CCQ T;  1SG5 A;  1F1B B;  3A8L B;  2L2P A;  3QZ5 B;  3SHW A;  1S72 Q;  2EFI A;  4PJL A;  3E2U A;  2DL8 A;  2LJ3 A;  1M90 R;  3JCM X;  3OYL A;  2BE9 B;  2LCL A;  2XIC A;  3I56 T;  2KR3 A;  1QMC A;  2VC8 A;  1M90 U;  3M58 A;  4A4E A;  3CCV T;  3M54 A;  1NJI U;  4XTV A;  3JB9 J;  1Q95 G;  3FJP A;  4RCB A;  2RHU A;  2KRO A;  3I56 A;  3G6E A;  4VUB A;  1D3B A;  3GBQ A;  3GNF B;  3CCE A;  4KUI A;  3CCV A;  1QKW A;  1Y96 A;  2CSQ A;  2QEX A;  5GAM j;  2L5Q A;  1NJI R;  4IKF A;  4F04 B;  3A8O B;  3G6E T;  5LJ3 g;  3OYM A;  1M2V B;  2L0A A;  1AEY A;  2R5M A;  1S72 T;  1PSF A;  5LJ5 d;  4KBM B;  3CCL Q;  4HXJ A;  2NUP A;  2ZPE B;  1M3A A;  3V7R A;  2KY9 A;  4XTU A;  1NYF A;  4LD9 K;  3V8L A;  1PWT A;  1I0C A;  4J9F A;  3A1P A;  1YBY A;  3CCJ T;  3OSV A;  1VQ6 A;  3QWX X;  1NG2 A;  2E6Z A;  4J6W A;  3CCQ Q;  1BK2 A;  2J6F A;  1PG5 B;  4FCY A;  2RPN A;  3CD6 A;  5IHI A;  3NTK A;  1I5O B;  2L3P A;  1X69 A;  4D8D A;  4J6Y A;  1Q82 U;  2DE0 X;  5IN1 A;  3TCJ A;  1PSE A;  3NGP A;  4HVW A;  2K57 A;  1ZSZ A;  4M77 F;  1GXI E;  1WGS A;  2LZ6 B;  3TEE A;  4XTX A;  1WXT A;  3H41 A;  2OTJ Q;  1TTH B;  5CKH A;  2YT6 A;  1M30 A;  2YSQ A;  2XK0 A;  1RAD B;  1UGR B;  2X4J A;  3BDL A;  5GMK i;  2QAZ A;  5FW9 A;  1I07 A;  3J7A F;  2QEX Q;  3CMA T;  2K79 A;  2JMA A;  2XID A;  3CCL T;  2G6F X;  1VQ4 Q;  1VYT A;  3KUF A;  4MDX A;  3ME9 A;  1YI2 Q;  5GAO m;  3OY9 A;  1KQS A;  3DB4 A;  1O75 A;  1NM7 A;  4OMN A;  1JXM A;  2D6F A;  1JB0 E;  1YJ9 T;  2K2M A;  2EWN A;  1YHQ Q;  5HKC A;  3CCR T;  1VQ7 A;  1WHK A;  2CYZ B;  2GQI A;  1BCO A;  4O5V A;  4E7I A;  2SEM A;  5AT1 B;  2YRD A;  4UC4 A;  4XU1 A;  1IO6 A;  2DX1 A;  4LDV A;  1XNI A;  2V1Q A;  2LX7 A;  2ROT A;  4CC7 A;  1HYO A;  2ROL A;  3HKS A;  2YUO A;  3L2Q A;  3L2R A;  1KG1 A;  2MOX A;  3I55 T;  1JXO A;  4BI8 B;  2MMP A;  2RN8 A;  1UGV A;  3OYD A;  1OQK A;  1U5S A;  1ZBJ A;  5IAY A;  4BD3 A;  2ZPB B;  1M1K C;  4ZN3 A;  4DEY A;  1YCS B;  4PJO C;  3I55 A;  4E7J A;  1R0C B;  3MEA A;  3CBM A;  5FRO A;  3TVT A;  2P0P A;  4M7D D;  5CAI A;  2KXD A;  2BZX A;  3MEW A;  1QVF S;  1RI0 A;  2DVE A;  4HT8 A;  4J7F A;  5KE2 A;  5GAN 5;  4GLK A;  1V29 B;  4OMQ A;  1UEC A;  4A4H A;  2HBW A;  2GTJ A;  1E7O A;  1SHG A;  5KH6 A;  5GAO p;  1VQK Q;  2HBP A;  3QYH B;  4AFS C;  1OI1 A;  4PJJ A;  1WX6 A;  2EYQ A;  2Y90 A;  2KK4 A;  5KYU B;  1QCO A;  4XU3 A;  2HQE A;  4M7D E;  4N0A C;  5EG2 A;  5KE3 A;  5LJ3 e;  5HY6 A;  2X9H A;  1C1A A;  2WAC A;  2RJC A;  3Q1J A;  2DXT A;  2H8H A;  3QHS A;  4J9H A;  4FYW B;  1QVG S;  4XAX B;  2QTX A;  2E41 A;  2F2X A;  5CIU A;  3UF4 A;  5GMK l;  4D8K A;  2K3Y A;  2COZ A;  4XTZ A;  5D6W A;  4C8Q G;  2CZ1 B;  2JNG A;  2RO0 A;  1WHJ A;  4E6R A;  2EGC A;  1UTI A;  3MP8 A;  2CSI A;  4NL2 A;  1D0Z A;  3A8H B;  1BI1 A;  4LN2 A;  2HZY A;  3THK A;  1VUB A;  1QW1 A;  3LWI A;  1NPP A;  1G8X A;  2FB7 A;  2LCC A;  3URG A;  2F2V A;  4NOY A;  2WSC E;  3PGG A;  4M75 B;  4Z88 A;  3TU4 K;  1WXU A;  4RTY A;  1MNE A;  4PFP A;  4R56 A;  1KJW A;  1VOM A;  1OYX A;  4A53 A;  4IIO A;  1D09 B;  3RUX A;  3ZBD A;  3ZFJ A;  4M77 B;  4BE0 A;  3CC7 Q;  4QKU A;  2K7A A;  5GAN 8;  3OS5 A;  3PE0 A;  3CEY A;  4C92 F;  4QVC A;  3RDV A;  1VQ9 T;  1KSW A;  5LJ3 f;  2RNA A;  1GBQ A;  2O4X A;  2PQW A;  3CBO A;  1BIA A;  1NLP C;  2DET A;  4J5Y A;  3CCV Q;  1X27 A;  2E64 A;  1VQM Q;  4E7K A;  2ESW A;  1WXB A;  3OS0 A;  3EGD A;  1AVZ C;  2ZCF B;  1UGP B;  4V2S A;  4RG2 A;  4ZGD B;  2AIR B;  1NYG A;  3CME T;  3EGD B;  3QJY A;  2IVW A;  3JRZ A;  2FPF A;  1K4U S;  2DL4 A;  2JUF A;  3PMT A;  3FRN A;  1PNJ A;  1WNL A;  1K8A R;  2CP5 A;  1VQM A;  2QI2 A;  3NMZ C;  2Z0W A;  1QKX A;  5GJV B;  3GNG A;  1ZQ1 A;  4OMP A;  3S3N A;  2EQJ A;  1TG0 A;  2DD5 A;  2YUQ A;  2I0N A;  1YHQ A;  1QWF A;  2QG9 B;  4A54 A;  3HPW A;  1M90 C;  3C0C A;  2A36 A;  4BDY A;  1NJI C;  3OMG A;  1HJD A;  2FRW A;  4FM4 B;  4Y28 E;  2K9G A;  4A4G A;  1O9S A;  1JRI A;  2CH4 A;  3M4Y A;  4LUD A;  1YIJ T;  3MO8 A;  3JV3 A;  5A0L A;  2MF2 A;  3I56 Q;  4DEX A;  3OYI A;  4Z8A A;  2DIG A;  2O31 A;  1PM3 A;  1W70 A;  3FC3 A;  5GAN 7;  3S6W A;  1N9S A;  1WHG A;  4J9D A;  4Y92 A;  1T0H A;  2X3X D;  3JCM J;  4N4G A;  4HT9 A;  3MPU B;  2K3B A;  5GAO r;  4E7Z A;  4Z02 A;  4JJN K;  4F14 A;  1YI2 A;  1ZA1 B;  2QXF A;  3JAM E;  4JDS A;  2PZ1 A;  1Q86 U;  2CDT A;  1TWB A;  1MMD A;  2FPE A;  2F69 A;  4QQD A;  2HL3 A;  3H9N A;  1YI2 T;  2E65 A;  4FYX B;  5KYX A;  2BUD A;  4J7I A;  2Y4Y A;  2EPD A;  4KH0 B;  2ZZD A;  1ZHI A;  2ENM A;  3EFO B;  2LRQ A;  3L1A A;  2EGE A;  3RIR A;  3MJX A;  3TQ7 P;  3UT1 A;  2C06 A;  2DXU A;  2L89 A;  1QVF P;  5FWC A;  5GAM h;  4CC4 B;  1BI3 A;  2JJ9 A;  1Q82 C;  1CSK A;  4Z89 A;  5ECA A;  2RM4 A;  1TH7 A;  4QQG A;  2GFU A;  4C92 A;  4IUP A;  3RKX A;  3PNW C;  2PVG B;  1QCF A;  5IHN A;  3LX7 A;  2D8J A;  3SD4 A;  4D6W A;  4GBQ A;  4M78 C;  1AZG B;  1BBZ A;  1XTD A;  4MDW A;  3OYF A;  3JCM d;  1B34 A;  1W2B S;  1ARK A;  3QXE B;  2CZ7 B;  3LW5 E;  3ULR B;  3CC2 Q;  3CCS Q;  1JJ2 P;  3EG3 A;  3EGX B;  4FYV B;  1ZSZ B;  4PLI A;  1QVF A;  4M78 B;  4ELY C;  1OPK A;  3VS0 A;  2DO3 A;  3T9N A;  4A4K A;  3EGU A;  2CZ0 B;  3CC2 T;  2RF0 A;  4X34 A;  2E6N A;  3CCQ A;  2O9V A;  3UAT A;  1QVP A;  3A8M B;  4C8Q B;  1VQM T;  9ATC B;  1ZSZ C;  1QVG A;  2E70 A;  4EMK A;  3CPW A;  2LC4 A;  1VQN T;  5GAM g;  1T0J A;  1K73 R;  4ZNX A;  4CRI A;  1OU9 A;  2MWO A;  5J26 A;  1A0N B;  3JB9 H;  2NUT B;  4OGC A;  1M2O A;  2GNC A;  2CP3 A;  3ER0 A;  4LNP A;  3BW1 A;  4QW2 A;  1LNX A;  4AFQ C;  3QZ9 B;  3QG1 A;  1XOV A;  1WLP B;  1X6G A;  5FRN A;  3A98 A;  1JBM A;  2A7Y A;  1GCP A;  4JRP A;  2MK5 A;  4JZ4 A;  1Y96 B;  2ZPG B;  3P8H A;  3EFR A;  1TUC A;  3E9G A;  3CXC P;  1VQ7 Q;  1PD1 A;  3QUI A;  2K2V A;  4PJN A;  3CBP A;  3L2Z A;  3LYI A;  1VQO Q;  2CZ6 B;  4JS4 A;  4B9W A;  2PTK A;  3X20 B;  1NLO C;  5CVI A;  4F7U B;  2QDL A;  2E3I A;  1OX8 A;  5GAM f;  2F5T X;  2ECZ A;  2RK1 A;  3M56 A;  2J05 A;  1OZ2 A;  3IQL A;  1LCK A;  3PVL A;  3C95 A;  1X01 A;  2AKL A;  1WHL A;  1IRX A;  5IH2 A;  3OQ5 A;  3H0F A;  1E6G A;  3QO3 A;  2JZ2 A;  4RTU A;  3CCJ A;  3OW2 P;  3I35 A;  2E12 A;  5KYX B;  4N4H A;  1RAE B;  3L2V A;  3G71 T;  2ZGW A;  5C0M A;  5CKD A;  2ZAE A;  4ME7 A;  5IHK A;  2CP0 A;  1D0X A;  4R55 A;  2MAM A;  2YLC A;  2HMA A;  3G71 A;  2ZPF B;  5GAN h;  1VYV A;  2EQI A;  2NUP B;  4C92 C;  5D7U A;  3LH0 A;  2BE7 D;  3JB9 I;  1SSH A;  4OGE A;  1OV3 A;  3BFM A;  3CCM A;  4C0F A;  1G2B A;  2CGH A;  1MMG A;  1MHN A;  1JEG A;  4RG8 A;  1Q7Y R;  4M7A D;  4C92 B;  1OPL A;  1VQL A;  1AOJ A;  2DKG A;  2E1H A;  2JT4 A;  3CC4 A;  4JJC A;  4BUG A;  2DBM A;  2PVO B;  4J8O A;  2HKQ B;  3CCS T;  4HCC A;  2DTI A;  3FIF A;  2V26 A;  1RI9 A;  3OYN A;  2VKN A;  2VGN A;  2QQ9 A;  4JPB W;  4A4F A;  2VXE A;  4KT0 E;  3BE3 A;  3L2W A;  1NE8 A;  1D3B B;  2G3R A;  3CMA Q;  4XTW A;  3GOX A;  1X6O A;  2M51 A;  2LTO A;  3M0R A;  2JTE A;  1VQP Q;  1D1B A;  2HSE B;  1VQ5 T;  2DL3 A;  2HEQ A;  4XK8 E;  5CO7 A;  2CUD A;  2FVU A;  4ESR A;  2FG0 A;  3JCM c;  3NPF A;  4M7A F;  4C92 G;  1PKS A;  1VQ5 A;  1NZ9 A;  2AT1 B;  4FT4 A;  4C5I A;  1WZO A;  3EG1 A;  3I9Q A;  4J9G A;  2RD1 A;  3D7S B;  1SHF A;  1KHI A;  2L3R A;  3HFN A;  3MET A;  4M75 E;  1VQP A;  4CI0 C;  1AHJ B;  4M77 D;  4PJO A;  5GMK e;  3QPH A;  4DQ2 A;  1RUW A;  2JOY A;  3CCR Q;  1SF9 A;  4GLM A;  1YN8 A;  3FB9 A;  1ZUY A;  1KK7 A;  2ED1 A;  4DOV A;  4YTL A;  4E47 A;  3G71 Q;  4LDW A;  2FZG B;  4PLL A;  2DRM A;  3CPW S;  1MND A;  1LJO A;  4Q5W A;  5C6S A;  1EZZ B;  2DM1 A;  1MV3 A;  1UFF A;  2F1L A;  4ATO A;  2VYT A;  4RTZ A;  1GRI A;  2VV5 A;  1VQ9 Q;  5I22 A;  2SRC A;  2V8K A;  2XMF A;  4M7A B;  3M0S A;  4C92 D;  2O2O A;  4F7U G;  5FU6 B;  2OAW A;  4M7D A;  4M77 G;  1ZSG A;  2M0Y A;  5CQY A;  1RAA B;  4C0D C;  2K5L A;  3EG2 A;  2V8J A;  4M75 A;  4M7A C;  2VXF A;  1BB9 A;  2QA4 T;  4M7A G;  4X1V A;  2DYI A;  2E4H A;  4NL3 A;  1VQ6 T;  1TSF A;  1KD1 R;  5GAN 3;  4C5H A;  2DL5 A;  3P8B B;  2DTH A;  3JB9 G;  5L8R E;  2KBT A;  3CD6 T;  3CCM T;  4PJO D;  2E10 A;  2PNI A;  4RTT A;  3G7Z A;  4DBH A;  3S3O A;  4JJD A;  2NYS A;  1WJQ A;  5GAO l;  3QKJ A;  1V76 A;  1K8A C;  3LLR A;  1RAI B;  2EKH A;  5GAO n;  1VQK T;  3CC4 T;  4J9E A;  5M9O A;  4IIM A;  4QVD A;  2W10 A;  2XU8 A;  3CCS A;  2QQS A;  3E1S A;  1K76 A;  2C0I A;  3HP9 A;  4WCI A;  5GMK j;  3OS2 A;  4C0Z A;  1Q86 C;  4LXC A;  4II1 A;  5KYU A;  1ZA2 B;  4EMK C;  2J06 A;  5KYY B;  3CCL A;  3M0Q A;  4N0A A;  3G4S T;  2RQW A;  3CCU T;  2KXC A;  1N8R R;  2BIV A;  2JTM A;  2QQR A;  4EMK B;  3WVD B;  3VRZ A;  5CKF A;  1BCM A;  1PCX A;  3UWN A;  2EBP A;  4XTY A;  2FEI A;  4TVR A;  1RL2 A;  2EYZ A;  4L5G A;  3EHQ A;  2PVD B;  1VQ9 A;  1TUD A;  5LJ5 j;  1VQ4 A;  1IHV A;  3RKY A;  2F5K A;  2JM8 A;  4AG1 C;  3CD6 Q;  4FL6 A;  5LJ5 g;  4IUT A;  5DY9 A;  1R77 A;  3SB2 A;  2DJQ A;  3I5R A;  3HRU A;  4ANJ A;  3JSC A;  3V8J A;  5LJ3 d;  3JCM b;  1M4Z A;  3UDC A;  4JZ3 A;  4KGX B;  4FW2 A;  2V1R A;  1T3S A;  1GBR A;  1AWO A;  1VQO A;  3EHR A;  3M57 A;  4BI4 A;  1UUE A;  5EC7 A;  1OOT A;  3MCA B;  3EG9 B;  1VQO T;  5CKB A;  1K9M R;  3EG9 A; 
#chains in the Genus database with same CATH homology
 3LGL A;  3JCM X;  3OYL A;  1BYM A;  2BUD A;  2LCL A;  2Y4Y A;  2XIC A;  4J7I A;  3I56 T;  2H3J A;  5KCO A;  2VC8 A;  3DKM A;  2ZZD A;  1KD1 U;  1ZHI A;  1M90 U;  3M58 A;  4A4E A;  3L1A A;  2LRQ A;  2DIQ A;  1UB4 A;  2R58 A;  4LDX A;  3CCV T;  3VU3 C;  2V8I A;  3M54 A;  4M77 C;  4XTV A;  2XHC A;  1VIE A;  3ASK A;  3RIR A;  3JB9 J;  1NJI U;  3UT1 A;  2C06 A;  1X75 C;  2DXU A;  3FJP A;  4QQ6 A;  1KQ1 A;  2L89 A;  4RCB A;  5GAM h;  2RHU A;  3I56 A;  3G6E A;  1BI3 A;  4VUB A;  1D3B A;  4LDU A;  4BI3 A;  4BAC A;  5GMK m;  1Q82 C;  3GNF B;  5GAO q;  4KUI A;  3CCE A;  4C8Q F;  3CCV A;  4JS5 A;  1YJN T;  1Y96 A;  3SWN B;  2QEX A;  2RM4 A;  1TH7 A;  3CCU A;  5LJ5 h;  3CMA A;  3E9F A;  5GAM j;  4OVA A;  2L5Q A;  4QQG A;  2GFU A;  4C92 A;  4IKF A;  3A8O B;  3HFO A;  5LJ3 g;  3G6E T;  1VQ8 A;  4IUP A;  4HCZ A;  5GAN d;  3OYM A;  3RKX A;  2X4X A;  3GPL A;  3PNW C;  4OB2 B;  2O4X B;  2PVG B;  2R5M A;  3VV0 A;  3LX7 A;  1S72 T;  3SD4 A;  4MZP A;  3JB9 D;  3RMQ A;  1PSF A;  5LJ5 d;  1K9M U;  2JN0 A;  4KBM B;  2LDM A;  4M78 C;  4D6W A;  3CXC A;  1I5L A;  1VQ8 T;  1XTD A;  1FXX A;  2ZPE B;  3HRT A;  4MDW A;  4MML A;  3V7R A;  2MI6 A;  2KY9 A;  3A8G B;  2M0O A;  3JCM V;  3HL8 A;  4XTU A;  3OYF A;  3CCR A;  3JCM d;  1B34 A;  1W2B S;  3QXE B;  4LD9 K;  2CZ7 B;  3LW5 E;  3V8L A;  3OYA A;  1KQS S;  1YBY A;  1P92 A;  5FLX E;  1WJS A;  3L2U A;  3C12 A;  2DZC A;  4PLI A;  1QVF A;  4M78 B;  2XD0 A;  4ELY C;  2KSS A;  2EJG A;  3CCJ T;  4F7U F;  3HSB A;  2DO3 A;  3OSV A;  2DK3 A;  3T9N A;  1VQ6 A;  3CCS T;  3JCM f;  4A4K A;  4J6X A;  1VQP T;  2CZ0 B;  3CC2 T;  2E6Z A;  4J6W A;  4X34 A;  2E6N A;  4M7D C;  3CCQ A;  4C8Q B;  1QVP A;  3A8M B;  2R57 A;  4M77 E;  3V8K A;  3NTI A;  1BIB A;  4EPC A;  1VQM T;  1QVG A;  2E70 A;  2CS7 A;  3DB3 A;  4EMK A;  3CPW A;  4JLG A;  2FHD A;  4WF2 A;  2LC4 A;  1JJ2 A;  1VQN T;  3CD6 A;  5GAM g;  1I8F A;  4CRI A;  3NTK A;  3X26 B;  2MWO A;  4M7A A;  2VGM A;  4OF1 A;  5J26 A;  3JB9 H;  1VIF A;  4OGC A;  4C5G A;  2DZ9 A;  4M75 D;  4J6Y A;  4FT2 A;  1Q82 U;  4ZGJ B;  1KQ2 A;  3ER0 A;  2HD0 A;  4OB0 B;  3PMI A;  3CME A;  5IN1 A;  3BW1 A;  4QW2 A;  3SFM A;  3TCJ A;  3M59 A;  1PSE A;  1LNX A;  1Q7Y U;  5J3B A;  3QZ9 B;  2K57 A;  3QG1 A;  1XOV A;  4M77 F;  3JCM Q;  2P0Q A;  3RMS A;  1GXI E;  1WGS A;  3TEE A;  5FRN A;  4XTX A;  3CC7 T;  1JBM A;  3TRE A;  4F7U E;  2AHJ B;  1YJW A;  3VUB A;  4JUV A;  2A7Y A;  5CKH A;  1UGQ B;  2XDP A;  4JRP A;  3OW2 S;  3OS1 A;  2HAX A;  2XK0 A;  1KHC A;  2FL7 A;  1Y96 B;  2ZPG B;  2X4J A;  1UGR B;  5I2M A;  3P8H A;  3BDL A;  3VJP A;  3EFR A;  5GMK i;  1YJN A;  3CC7 A;  2KQW A;  3E9G A;  3J7A F;  1SSF A;  4RKU E;  3CMA T;  3OSS C;  4JRQ A;  2E5Q A;  2K2V A;  3QUI A;  2XID A;  3CBP A;  4X9C A;  3CCL T;  2RJE A;  3L2Z A;  3LYI A;  4HCC A;  1WPY A;  3KUF A;  1YHQ T;  2QA4 A;  4MDX A;  3ME9 A;  2EQU A;  5GAO m;  3OY9 A;  3J81 E;  1KQS A;  2CZ6 B;  2K5F A;  4JS4 A;  4HCB A;  3DB4 A;  1O75 A;  2EQK A;  4B9W A;  3OYH A;  3X20 B;  3SWN A;  2D9T A;  2D6F A;  5CVI A;  1JB0 E;  1M9S A;  4OB1 B;  4F7U B;  1YJ9 T;  4L6V 5;  4PKC C;  3BY7 A;  2EWN A;  1XQH A;  4Y91 A;  5GAM f;  4ZTF A;  2F5T X;  5HKC A;  2RK1 A;  4M75 C;  3CCR T;  1VQ7 A;  3M56 A;  2CYZ B;  1OZ2 A;  4M7D F;  3L42 A;  4O5V A;  2X4W A;  2VUB A;  3C95 A;  1X01 A;  4E7I A;  5GAM d;  4M75 G;  2RK2 A;  3OQ5 A;  1H64 1;  4UC4 A;  5LL6 S;  5GAN g;  4C0G A;  5FU6 C;  3QO3 A;  4HKE A;  4XU1 A;  2JZ2 A;  4M7A E;  2RHZ A;  3OA6 A;  1N9R A;  3CCJ A;  3M9Q A;  1KC8 C;  4LDV A;  2E12 A;  5GAN e;  4N4H A;  1XNI A;  1G3W A;  4OB3 B;  3L2V A;  3G71 T;  2ZGW A;  3INZ A;  5C0M A;  2LNV A;  4EMG A;  2X35 A;  5CKD A;  4M77 A;  4ME7 A;  4O6J A;  3HKS A;  3NTH A;  1N8R C;  4EMH A;  4XU2 A;  3L2Q A;  4R55 A;  4ELZ C;  1QP2 A;  1YCY A;  4MZM A;  3M4G A;  1Q7Y C;  1EIF A;  2XDD A;  2MAM A;  3L2R A;  2YLC A;  1I4K 1;  2EKO A;  1KG1 A;  3G71 A;  5GAN 4;  5CQX A;  2ZPF B;  3I55 T;  3MHX A;  5GAN h;  5GAN 2;  4BI8 B;  4XU0 A;  2MMP A;  4P5N A;  4GY5 A;  3OYD A;  4C92 C;  2DEQ A;  3LH0 A;  5IAY A;  2WSE E;  2ZPB B;  4BD3 A;  4OGE A;  5GAN f;  4ZN3 A;  3JB9 I;  3BFM A;  2RB6 A;  4DOW A;  3CCM A;  4C0F A;  4LDY A;  4HA8 A;  4PJO C;  3I55 A;  2ZPH B;  4M78 A;  4FIB A;  4IUQ A;  2CGH A;  3FLG A;  3LWH A;  2M16 A;  3JCM h;  1MHN A;  2ZPI B;  4RG8 A;  3LGF A;  4E7J A;  4M7A D;  3MEA A;  4C92 B;  1W2B A;  3CBM A;  5FRO A;  5I2S A;  1VQL A;  3G4S A;  2P0P A;  4M7D D;  5CAI A;  2DKG A;  2E1H A;  2RI5 A;  4PJO B;  3CC4 A;  3RKW A;  3MEW A;  5J39 A;  1RI0 A;  5AYF A;  1QVF S;  2NLU A;  4BUG A;  2DVE A;  4HT8 A;  2HNI A;  5D6Y A;  3VUZ A;  2PVO B;  4J8O A;  2GCX A;  4J7F A;  4IUV A;  3F70 A;  3R6O A;  5D6X A;  3EFS A;  5KE2 A;  2DTI A;  5GAN 5;  3OYK A;  4GLK A;  2LT1 A;  3FIF A;  3M5A A;  1V29 B;  1N6A A;  5HK3 A;  2R5A A;  3HRS A;  4A4H A;  1YIJ A;  4MMK A;  2BKD N;  2YRV A;  3OYN A;  3CCE T;  1MGQ A;  3CXC S;  2VGN A;  3M53 A;  2QQ9 A;  4A4F A;  2RH2 A;  2VXE A;  4KT0 E;  5KH6 A;  3AHU A;  1M5Q 1;  3RES A;  1W4S A;  5GAO p;  1VQ4 T;  2JVV A;  3L2W A;  1NE8 A;  1KC8 U;  3X25 B;  1D3B B;  2HBP A;  2G3R A;  3QYH B;  5CKE A;  3J80 E;  4F7U A;  1OI1 A;  4XTW A;  3GOX A;  2EYQ A;  1X6O A;  3JCM P;  2Y90 A;  2KK4 A;  2LTO A;  3E19 A;  3QDR B;  4PL6 A;  3PFS A;  1FX7 A;  3H6Z A;  4XU3 A;  3QBY A;  4ZTJ A;  2HQE A;  4M7D E;  2HQX A;  1VQ5 T;  2K3X A;  2PUO B;  4N0A C;  4XK8 E;  5CO7 A;  5EG2 A;  4C5E A;  5KE3 A;  5HY6 A;  2GFA A;  1NPR A;  5LJ3 e;  3KXT A;  4PJO G;  2EIF A;  1HK9 A;  2WAC A;  2RJC A;  1K73 U;  2FVU A;  3Q1J A;  2DXT A;  2M9U A;  2OAU A;  3QHS A;  4FSX A;  3JCM c;  2D0Q B;  2P4T A;  2PUK B;  4EDU A;  4M7A F;  2EJF A;  4C92 G;  4XAX B;  1QVG S;  2QTX A;  2CKK A;  1M1K U;  1VQ5 A;  1NZ9 A;  2E41 A;  2RHY A;  4FT4 A;  4C5I A;  4RMO A;  2WSF E;  5CIU A;  2O01 E;  5GMK l;  2RD1 A;  4JRK A;  4KUD K;  5FU7 C;  2K3Y A;  3BDU A;  4E7L A;  3V7S A;  4XTZ A;  1YJW T;  1KHI A;  2L3R A;  3HFN A;  3MET A;  4M75 E;  5D6W A;  1VQP A;  3PIO A;  4C8Q G;  4CI0 C;  2CZ1 B;  2JNG A;  2RO0 A;  2OTJ T;  4OP0 A;  3QJ6 A;  2RA2 A;  1AHJ B;  3MEU A;  4M77 D;  3MP8 A;  1G3S A;  4NL2 A;  1Q81 U;  4PJO A;  5GMK e;  3QPH A;  4DQ2 A;  3A8H B;  1BI1 A;  2JOY A;  4E7H A;  3FDR A;  1OZ3 A;  5LJ5 f;  2P0K A;  1IZ6 A;  1LOJ A;  4N4I A;  3FB9 A;  4M78 G;  2DXB A;  1VUB A;  5DLO A;  2OTJ A;  1QW1 A;  1K8A U;  3OYJ A;  3LWI A;  3RER A;  4DOV A;  4YTL A;  1NPP A;  4E47 A;  2XDB A;  4LDW A;  4PLL A;  2KDS A;  3QII A;  5A2Q E;  4NS5 A;  5LJ5 e;  2FB7 A;  3CPW S;  2LCC A;  4PJO E;  3URG A;  5FRM A;  1LJO A;  4Q5W A;  5DLQ E;  2XI9 A;  4NOY A;  2WSC E;  3EAE A;  3PGG A;  5C6S A;  5CCA A;  4M75 B;  2LT4 A;  2MWP A;  4ATO A;  3TU4 K;  1I81 A;  2VYT A;  2VV5 A;  1R8O B;  2RHI A;  1Y71 A;  4R56 A;  1M1G A;  3GF5 A;  1G5V A;  5IT9 E;  2V8K A;  1OYX A;  4M7A B;  1U1S A;  2OTL A;  4C92 D;  3QYG B;  4A53 A;  3KBG A;  4F7U G;  5FU6 B;  3OYE A;  3RUX A;  4M7D A;  5CR2 A;  2DJZ A;  3P8D A;  4LD6 A;  3ZBD A;  4BE2 A;  3MP1 A;  4MZT A;  2Y4X A;  3V7C A;  3ZFJ A;  4M77 G;  5CQY A;  1K73 C;  4M77 B;  4BE0 A;  4C0D C;  4C8Q A;  3UPU A;  2FYK A;  2K5L A;  1BI2 A;  4PJO F;  5GAN 8;  2V8J A;  3JCM W;  1WQW A;  3OS5 A;  4M75 A;  3GIB A;  1U1T A;  4M7A C;  3CEY A;  2VXF A;  2QA4 T;  4C92 F;  4M7A G;  4QVC A;  1VQ9 T;  2DXC A;  2LX9 A;  3C4S A;  5LJ3 f;  3SWN C;  3QSU A;  3H8Z A;  4NL3 A;  1VQ6 T;  1H3Z A;  2O4X A;  4C0D B;  5A0G A;  2PQW A;  3CBO A;  1YJ9 A;  1BIA A;  1DJ7 B;  1YIT T;  3CC2 A;  1FWZ A;  2DTO A;  5GAN 3;  4J5Y A;  4C5H A;  4RCC A;  2LQ8 A;  1S72 A;  1Y7X A;  2PU9 B;  2DTH A;  3GLX A;  3P8B B;  5L8R E;  3JB9 G;  1UEB A;  3PT9 A;  3NFC A;  4JRI A;  2B8A A;  1VQN A;  3CD6 T;  2E64 A;  3MP6 A;  5DM7 R;  3OBY A;  3CCM T;  1Q81 C;  4PJO D;  5GAN 6;  2E10 A;  3M55 A;  4X9D A;  4E7K A;  1YIT A;  3G7Z A;  1G3T A;  3S3O A;  3S3M A;  3JCM g;  1WJQ A;  2KVQ G;  2DAQ A;  2XG8 D;  3OS0 A;  4BE1 A;  3GP8 A;  5GAO l;  3OW2 A;  2ZCF B;  1UGP B;  3PTA A;  3QKJ A;  1HXD A;  4V2S A;  4M78 F;  4RG2 A;  4ZGD B;  1K8A C;  1M8V A;  5A0D A;  1M1F A;  3LLR A;  3CME T;  4M7D G;  1WQ7 A;  2DPP B;  2EQM A;  3QJY A;  3OMC A;  5I21 A;  5GAO n;  1VQK T;  2M1H A;  1N27 A;  2IVW A;  4M75 F;  3JRZ A;  4BB7 A;  3CC4 T;  2X4Y A;  3WVE B;  5M9O A;  2JTF A;  5GMK h;  1QP3 A;  2JUF A;  4QVD A;  4BY6 B;  3PMT A;  2XU8 A;  3FRN A;  5LJ3 j;  2RI2 A;  3CCS A;  3OYG A;  1M1K C;  2EJ9 A;  2QQS A;  3E1S A;  1WNL A;  1IRE B;  2QQB A;  4ZN1 A;  5GAN j;  3HP9 A;  2QI2 A;  1VQM A;  4M7D B;  3VYG A;  4C8Q C;  5GMK j;  3OS2 A;  4C0Z A;  2K5I A;  3O8V A;  2QQA A;  3X28 B;  1UGS B;  3OYC A;  1Q86 C;  3GNG A;  4II1 A;  2GF7 A;  1ZQ1 A;  3C94 A;  4BY6 C;  4JLI A;  4OMF B;  4EMK C;  3S3N A;  4PNO A;  2EQJ A;  2RHX A;  2DD5 A;  4C8Q E;  5GAM e;  1N8R U;  3CCL A;  3A5Z B;  1YHQ A;  2XKO C;  4DA4 A;  1VQL T;  4N0A A;  3G4S T;  2QEX T;  2QDY B;  3CCU T;  4A54 A;  3HPW A;  2YHT A;  1KD1 C;  1M90 C;  2OTL T;  2BIV A;  4M78 E;  5KCH A;  2JTM A;  2QQR A;  4BDY A;  4EMK B;  4L59 A;  1BKB A;  3OMG A;  3WVD B;  5CKF A;  4BDZ A;  1NJI C;  2IG0 A;  2KAF A;  3UWN A;  4FM4 B;  1B34 B;  4Y28 E;  5CK9 A;  2DD4 A;  4XTY A;  1Y07 A;  4A4G A;  1O9S A;  4IUU A;  3OBW A;  1JRI A;  2A3L A;  4TVR A;  4B9X A;  1RL2 A;  2EAY A;  2RJF A;  3M4Y A;  1BI0 A;  1YIJ T;  3JB9 F;  3MO8 A;  4L5G A;  4M78 D;  2MF2 A;  5A0L A;  3OYB A;  1G3Y A;  3DLM A;  3CPF A;  2RI3 A;  4FU6 A;  3SDZ A;  2I2L A;  2PVD B;  1VQ9 A;  5FU7 B;  3OYI A;  1U8R A;  5LJ5 j;  2DIG A;  2RJD A;  4IUR A;  3OB9 A;  4C92 E;  1VQ4 A;  3FC3 A;  3RKY A;  3FEO A;  2F5K A;  5GAN 7;  3OYY A;  4FL6 A;  5LJ5 g;  3S6W A;  4IUT A;  1N9S A;  4KUL A;  5DY9 A;  2YLB A;  4C8Q D;  4ZGE B;  3MEV A;  3SB2 A;  3ZEH A;  3X24 B;  3HRU A;  2LVM A;  1WJR A;  3JSC A;  3V8J A;  2GQV A;  1K9M C;  3N5B B;  3HHT B;  5HK0 A;  2L8D A;  5LJ3 d;  1VQ7 T;  3JCM J;  3JCM b;  4N4G A;  4HT9 A;  1M4Z A;  4J83 A;  5GAO r;  5LJ3 h;  3UDC A;  2KMT A;  4XQ3 A;  3CCQ T;  4QVZ A;  4Z02 A;  4JJN K;  2LQK A;  1ZBX A;  1VQO A;  2QXF A;  1YI2 A;  3M57 A;  3A8L B;  4BI4 A;  3JAM E;  3DLL A;  3QZ5 B;  3VYH B;  4JDS A;  2K4Y A;  1Q86 U;  1JJ2 S;  5CKB A;  2EFI A;  1VQK A;  3PIP A;  3VKI A;  3MCA B;  2F69 A;  3WXM B;  4QQD A;  1VQO T;  1YI2 T;  3JCM e;  2E65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...