4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
1BIBA 2DJZA 4WF2A 4XU2A 4PJOD 1N9RA 5GAOq 5GANj 1B34B 4EMHA 3SWNC 5GMKh 2K57A 4M7DG 3M4GA 4C8QC 3L2ZA 1LJOA 4C8QE 4EMKA 2E10A 5LJ5j 5GMKl 4M75F 4X9CA 5GAN5 4N0AA 4M7DB 4XTVA 3JCMJ 4QVCA 4M7AC 4JRKA 5GAMj 3RKYA 5GAOn 3PGGA 4OP0A 2RA2A 3SB2A 2DTIA 4NL3A 4XTUA 2YLCA 2E64A 2CGHA 3JCMc 3RERA 4JLIA 2FB7A 4C92A 4M77F 1B34A 1M5Q1 2DKGA 4EMKB 2YLBA 4J6WA 4C8QD 3JCMg 3HFNA 3V8KA 5GAN8 4M7DE 1M8VA 2E41A 1HXDA 4M78F 4M7DA 3JCMd 3JCMh 4C92G 2JN0A 2E1HA 3JCMW 2DXUA 3EFSA 4X9DA 5GAN4 4NOYA 2RM4A 4M78G 5LJ5e 4C92B 5GAOl 3JB9F 5GMKj 1LOJA 4N0AC 4M78B 4M75A 3JCMf 5GAMe 1TH7A 3FIFA 4M7DD 4F7UF 2EAYA 2FYKA 3JB9J 3BY7A 4M7AF 5LJ3g 2E65A 5GAN7 4C92C 2VC8A 3QUIA 1Y96A 4M75G 1I8FA 4PJOF 4C92E 5GMKm 4M77A 3QHSA 1I81A 4JRIA 4M75B 2DTHA 4HT8A 1U1SA 3JB9H 2VXFA 4M7DC 4M78A 1N9SA 4A53A 4XU0A 3AHUA 4M77G 2HNIA 4M7AD 1LNXA 4MMKA 1Y96B 5GMKe 4C92D 4J6YA 4M77B 1YCYA 3VU3C 3JB9I 4EMKC 4M75E 3HFOA 4PNOA 3V7SA 5GAN6 2EJGA 1KQ1A 3JCMP 4F7UA 4XQ3A 4Y91A 3RESA 2VXEA 2RD1A 4C8QF 4XU3A 5CAIA 3QSUA 2DVEA 1WNLA 5I21A 3HSBA 3JB9G 5GAOm 3RKXA 2Y90A 2DTOA 2DZCA 4JUVA 2ZGWA 1WPYA 3V7CA 4M77E 4C8QG 4PJOA 4F7UG 3BW1A 3V8JA 3V7RA 5LJ3d 5LJ3h 5GAN3 1I5LA 4M7AG 4M75D 4C8QB 1JBMA 4V2SA 4HA8A 4M78C 4RCCA 4M78E 4J5YA 4F7UB 2QTXA 5GANg 4EMGA 4M7AB 2EJ9A 4PJOG 5GAOp 4M7DF 3JCMe 3V8LA 5GANd 5GANh 1X01A 1KQ2A 4RCBA 5LJ5g 5LJ3f 5DY9A 4PJOB 4M77D 1WQWA 2RB6A 5LJ5d 5LJ5h 1D3BB 1HK9A 2EJFA 5GAMg 2I2LA 3SWNA 3RKWA 4F7UE 3JCMb 5GAOr 4M75C 4DQ2A 4XTWA 3BFMA 5GANf 4M78D 4XTXA 4C8QA 5GAMd 5GAMh 3RUXA 4M7AE 3L1AA 4HT9A 4XTZA 3BDUA 4XTYA 4M7AA 4A54A 5LJ5f 4PJOC 4XU1A 1BIAA 4PJOE 4J6XA 3RIRA 3JCMX 1I4K1 1WQ7A 2DXTA 4MMLA 5LJ3e 3JCMV 3JB9D 4M77C 3EFRA 5GAN2 3FB9A 4NL2A 1U1TA 2DEQA 5GAMf 3SWNB 3INZA 4C92F 4QVDA 3QO3A 3FJPA 1D3BA 2DZ9A 3JCMQ 1JRIA 1MGQA 1H641 2YHTA 5LJ3j 3GIBA 5GMKi 2EWNA 5GANe
chains in the Genus database with same CATH superfamily
3FLGA 5A0LA 1G5VA 4ZNXA 2DMOA 2GFAA 3OW2A 4C8QE 2E10A 1YJ9Q 1NEGA 1X6BA 3CMAQ 5IAYA 5GAMj 2F2VA 2K7AA 2YLCA 2CGHA 2JS2A 1IHWA 3ULRB 1WJRA 1YITA 4Z8AA 1QMCA 2JOYA 4C8QD 5LL6S 4IUUA 2K5FA 2PQWA 2YRDA 3DLLA 5DLOA 4FSXA 3TREA 3EFSA 2LVMA 4BDYA 4MDWA 3SHWA 3ZBDA 2KNBB 3S3OA 4C5EA 1GRIA 1RLQC 1Y96A 3L2WA 2JT4A 1EZZB 1I1JA 2B8AA 3VS7A 1AT1B 3M58A 5I2MA 2L2PA 1KK7A 2GF7A 4R55A 4BI8B 1OZ2A 2EJGA 2FO0A 1I0CA 3UT1A 1UHCA 2AIRB 4J9IA 5GJVB 4K11A 3X28B 4M7AG 2KMTA 2ED1A 4J5YA 2JNGA 4F04B 4PJOG 3JV3A 1X01A 1TS9A 2VVKA 3HL8A 1GCPA 3FJ5A 2PVDB 1HK9A 2DL4A 1WHJA 4PK4A 3RMQA 2PU9B 4GLKA 5CQXA 3RDVA 1W2BA 4J6XA 4E2FB 1JB0E 3JB9D 2MMPA 3P8BB 1JQQA 2X3WD 1C6VX 2E12A 1D3BA 3G71A 2YHTA 4E7HA 4ZGJB 1KSWA 1ZSGA 3OBWA 2SEMA 1Y57A 1VQ6Q 3TSWA 3CC2A 4MZPA 2D0QB 2DXCA 3CCVT 4O6JA 1NM7A 1OU8A 1LJOA 2IG0A 1ZLMA 5GMKl 4HCBA 2FZGB 5FU7C 2ED0A 1NJIR 1N8RU 2WSFE 3TVTA 3G4SA 1VQ4A 1VQMA 3CCSA 4AT1B 2YRVA 2E41A 1JXOA 5KYUB 2OTLQ 1Q82U 1HSQA 1VIEA 1NE8A 2DPPB 5IT9E 3KBGA 4WCIA 1YIJT 1K9MC 1BK2A 4OGCA 3MEAA 4J9FA 3QZ5B 3NTIA 3HRSA 1JJ2A 3N5BB 1I8FA 2HMAA 4F17A 2LX7A 3M0RA 1K8AU 3ER0A 1AWJA 1VQ8Q 1LPLA 2YUPA 3A8LB 3KFVA 5D6XA 1WXUA 2HBWA 1WHKA 1EFNA 2JTFA 3QYHB 3HSBA 1NZ9A 2EYYA 5A0DA 2ZGWA 2JJ9A 2MF2A 1E6HA 1FMVA 3L2RA 2AT1B 2KT1A 3CC7T 3CC4T 1ABQA 3OYAA 3CCJA 2O4XB 1BI0A 1YHQT 2CP7A 5CVIA 2LQKA 2QEXT 2VGMA 3JCMb 1VQ5A 3H41A 3PT9A 4BE2A 4IIMA 4M7AE 3RUXA 3OB9A 1VQPT 3GPLA 4PJOE 2RHIA 4E7JA 1Q95G 2I0NA 2K3XA 2MCNA 4OB0B 1MUZA 1RAGB 4M7AD 1S72Q 1WX6A 1SHFA 3CCEQ 3WVEB 4A4FA 4PJOD 1UTIA 1IHVA 5C6SA 5KYWB 1HJDA 5GMKh 2X35A 1PRLC 1M3AA 3L2ZA 2BKDN 5GAN5 2WSEE 2EBPA 3HPWA 4DBQA 3I35A 2DVJA 2AZSA 3OMGA 1QW1A 3LGFA 3V8KA 2ZZDA 2MYSA 1PRMC 1Z9QA 3L2VA 2G3RA 4M78G 5L8RE 1UDLA 5LJ5e 2E6ZA 2XDPA 5GAOl 3J80E 1A0NB 4KH0B 1AD5A 1KHCA 3BE3A 5CO7A 5LJ3g 1OV3A 1ZUUA 4AFUC 5GAN3 2QXFA 2KXCA 4FL6A 3LH5A 1M1KU 3OYMA 3QBYA 1SHGA 4D6WA 1IRXA 4MMKA 3WVDB 4DOVA 1TWBA 4B9WA 3EG2A 1W6XA 1SSHA 2CDTA 4EMKC 5J26A 3P8HA 1FX7A 3EGDB 2O4XA 3X25B 2JZ2A 4JPBW 3REAB 2L3QA 3PVQA 2LJ0A 4F7UB 3H8ZA 2RN8A 3V8LA 2EQIA 4RUGA 3LW5E 1SPKA 3QIIA 3QXEB 1G3YA 4M75C 5KH6A 3CCUT 1OEBA 1R8OB 5GAMd 2RNAA 1YI2T 3BDUA 2QDYB 1KG1A 2RI3A 3MCAB 9ATCB 5KYWA 3LH0A 1XJWB 5GAMf 3INZA 2GBQA 2KYBA 1M90R 3CCVA 1MV0B 1TUGB 3GOXA 4LDVA 4OMOA 2O88A 5FU6B 2K79A 4C0DC 3NMZC 1VOMA 3URGA 1KFZA 4M75F 2PVOB 1PHTA 4XTVA 1VUBA 1NLOC 5GAOn 3SB2A 2DTIA 3F70A 4FU6A 2E64A 4C0ZA 2AZVA 1B34A 1PCXA 2O9VA 2YLBA 1PD1A 3JCMg 4FYXB 2M0YA 1YIJA 2CP0A 3JCMW 3OBYA 1QQJA 1U3OA 1YJNA 1OX8A 4C92B 3S3MA 4C5HA 2VASA 3EHRA 4FW2A 3H0IA 3I5RA 2DE0X 5GAN7 1I07A 2O9SA 2QGGA 3QG1A 3CBOA 2VUBA 2HQXA 4OVAA 1N9SA 3CPFA 4XU0A 2GCXA 3EGDA 3HHTB 4LDYA 4AMCA 1LNXA 1UG1A 4HVUA 1TSFA 4OMMA 2MOXA 1ACMB 2DX1A 3HRTA 3CXCS 1MMGA 3QDRB 4F7UA 3C94A 4L5GA 3CMEA 4XU3A 2DVEA 1YWPA 2H3JA 2DZCA 2XICA 5AT1B 3CC4A 2KROA 3MPUB 5LJ3h 1YHQA 2QK0A 1G83A 4KULA 4ZN1A 2QEXA 1UEBA 3CPWS 2LZ6B 4LN2A 2JW4A 5GANh 3MEWA 2AK5A 3CD6T 5J39A 1WQWA 4QQDA 2AKLA 4B6MA 1VQPA 2I2LA 4DBHA 3BFMA 3EG9A 1BYMA 1AWOA 2EQJA 2J7IA 2JXBA 4F14A 4A54A 4RTUA 4M77C 4E7LA 4MZMA 3SWNB 5IHNA 2IPOB 4D8DA 4FT2A 3A98A 4BDZA 4FIBA 3QWYA 3THKA 1X43A 2P0QA 4NS5A 1NPRA 1FXXA 3UF4A 4D8KA 1QVGA 5EG2A 2F2XA 1Y71A 3UDCA 4NL3A 1R77A 5FU6C 1PSEA 1IZ6A 4C92A 3A1PA 3E9GA 4M77F 5I11A 4N4HA 1VQOT 2E5KA 5IN1A 2CKKA 1H92A 4M78F 4M7DA 5J3BA 2KT8A 4HCZA 3RR6A 5FWBA 1PG5B 1UB4A 1XNIA 2M1HA 1X75C 1QVGP 2E65A 1BCMA 2COZA 4C92C 4A4HA 3M4YA 2BIVA 2CH4A 2HCKA 4M7DC 4A53A 4CC2A 3I55A 4OMPA 4ANJA 3I56Q 2JM8A 1K73U 1TXQA 2RHXA 2RPNA 4PNOA 2C0IA 2K6DA 5CAIA 2HEQA 4E7SA 2ROLA 3C95A 3J7AF 5CK9A 2DAQA 5ECAA 4HA8A 1D1BA 1M3CA 4PFOA 2EJ9A 4M7DF 2DA9A 4YTLA 3CCUA 1T0JA 1YI2A 5LJ5h 1K9AA 4E7KA 2GQVA 1OOTA 3SWNA 2HD0A 4BI4A 1PKTA 1C1AA 1DJ7B 2PVGB 1YITQ 3CCQT 4AFSC 1Q7YC 2WSCE 1RADB 3O8VA 1RABB 1JO8A 4QVDA 1KC8U 1H641 1WI7A 2BUDA 1AVZC 2A08A 2VWFA 4PFZA 1YWOA 1N9RA 1ZSZB 4EMHA 2Z0WA 3SWNC 2GTJA 3SDZA 2KQWA 4LE9A 1K1ZA 1VQNT 2QQAA 4OP0A 1S1NA 5HY6A 3FRNA 1OX9A 2JM9A 2E3HA 2RHUA 3PNWC 3L2QA 3UA7A 1KQSS 1OPLA 1T0HA 2QAZA 3LGLA 4KUDK 2A3LA 1OYXA 2EKOA 3OS2A 5GAMe 4RMOA 1TUCA 2XG8D 1UFFA 2RF0A 4QT7A 1Q82R 1VQ9A 5IH2A 2OTLT 1WYXA 1WA7A 2LX9A 3QUIA 3GNGA 2JMAA 5CIUA 1QVFS 1BCOA 2XDDA 3PFSA 1BI2A 1HYOA 1G3WA 1P92A 3M59A 1GBRA 2X9HA 3CCMA 1YCYA 2G6FX 4QKUA 2ZAEA 1K8AR 1SG5A 5I21A 3G71Q 3OW2P 1NEBA 3CC2Q 1D1CA 3CD6A 1RLPC 3M0TA 1G2BA 4JS5A 3L2UA 2OTJA 1AEYA 4BE0A 1PC0A 2LCSA 2RMOA 5FROA 3EH1A 3NTHA 1W70A 4C8QA 3G4SQ 1VQ4Q 2YDLA 1VQMQ 3CCSQ 2DLPA 3OYKA 1WQ7A 1M1GA 2DXTA 1LVKA 2JTEA 3P8DA 1JRIA 2CREA 4BD3A 1IREB 2QA4T 3EG1A 2DBMA 2NWMA 1MV3A 4AFZC 4IUPA 2PTKA 2M16A 4C8QC 1MMDA 2L8DA 2KDSA 1YP5A 1UGRB 1VQOA 1YJWT 2LQWA 1OQKA 2RA2A 3GP8A 1Q86R 3CCET 3LWHA 1VQ7T 2DKGA 5HCKA 1VQLT 2ROTA 4FW1A 3RNJA 2FG0A 2QQSA 1WJSA 4NOYA 2OAWA 2EKHA 2NLUA 5FLXE 2QDLA 3A8MB 5CKDA 3PIOA 2IIMA 2Y4XA 4RTTA 2DYIA 1Y0MA 3OYCA 1M27C 2DJQA 4M75G 3O5ZA 4E7ZA 3CCRQ 1I81A 1W2BP 4N4GA 4HXJA 1PSFA 2PUKB 1VQ5Q 2COYA 2K3YA 2LRQA 2DL7A 1D09B 3A8GB 8AT1B 4BY6B 3VRYA 5KYXB 2H3EB 2HBPA 2LP5A 3BW1A 1GXIE 5KE2A 1JEGA 2DNUA 2DXBA 3RMSA 1JU5C 4M7AB 5CKFA 4KBMB 4L59A 2E3IA 4J9GA 3CCQA 5DY9A 4OMFB 5EC7A 3I9QA 4PJOB 1WHHA 2EYZA 3RKWA 2A37A 1NBEB 1Q86C 3AT1B 1X27A 3OQ5A 1M2VB 4XTYA 4AFQC 2LNVA 1FMWA 4Z88A 3VYGA 4DOWA 4KGXB 3H0FA 1JJ2P 1T3LA 2QGFB 1ZUKA 2C0OA 2MK5A 2EQUA 2HQHA 2B86A 4PFPA 1VQNA 1EIFA 2J6FA 4ZGDB 2FPFA 1O75A 1NJIC 1VA7A 1EX4A 4Q5WA 4DA4A 1WDXA 4CRIA 1UGQB 2QYZA 2NUTB 3JCMc 1VQKT 2ZPGB 1UHFA 3H6ZA 1WJQA 3OY9A 3FDRA 3G6ET 2DRKA 2KK4A 5I22A 2O2OA 2K2MA 1K9MU 3TQ7P 3MHXA 2D8JA 5FW9A 2DXUA 2DL8A 2PNIA 4J7FA 5GAN4 2W10A 3JSCA 2ENMA 2OTLA 2HKQB 1TH7A 2M02A 3NPFA 4JJDA 4ZGEB 3C4SA 3OYNA 2FYKA 2A0FB 2JTMA 2MI6A 5KYUA 2RHYA 2XD0A 1NYGA 3HKSA 3HRUA 2LJ3A 2NYSA 2GNCA 3M0UA 1U1SA 4B9XA 4M77G 2CUDA 4R0KA 4JJNK 1PM3A 4LD6A 5CCAA 3JB9I 4M75E 1YCSB 2LC4A 3HFOA 1GL5A 1RUWA 4JLGA 2A28A 5IXFA 3CCVQ 2Y90A 3EH2A 3ZEHA 1KD1R 4PJOA 3I5SA 1PNJA 4M75D 4KT0E 3TU4K 5GANg 1NG2A 2D6FA 3CEYA 4PLLA 4HCCA 3NFCA 1M2VA 3NHNA 5KE3A 1K0SA 2CZ1B 2EJFA 2WACA 2ZCFB 5GAMh 2KRSA 3REBB 5HKCA 3GNFB 3UPUA 2LCCA 1KQSA 4PJOC 1YIJQ 2QA4A 1H8KA 3JCMV 4JJCA 1YJNQ 3OSVA 4CI0C 4JZ4A 3EGXB 1E7OA 1YBYA 2FPEA 1D0XA 2KY9A 3TEEA 4M7DG 2X4XA 4J9CA 2VKNA 3M4GA 1YJWA 1QVFA 1B3QA 3CCEA 1VQ7A 2CSIA 1RI9A 1VQLA 2CSQA 3DKMA 4RKUE 4XTUA 1RAHB 2HAXA 2J6OA 3E19A 4J6WA 3OS1A 1NYFA 1WFWA 4HKEA 4J83A 3CMEQ 3NGPA 1WZOA 3CC4Q 3MP6A 1TOVA 4M78B 1KD1C 1U5SA 3X24B 2V26A 1YHQQ 2QEXQ 1PD0A 5CR2A 1MNEA 3A5ZB 4R56A 1OZ3A 2FPDA 1OPKA 2RH2A 2K5LA 4OMQA 3S3NA 4LDXA 1Q81R 1VQPQ 2VXFA 1OU9A 2K5IA 4KGVB 3VS0A 2FL7A 3VS1A 3WXMB 3JCMP 1KQ1A 2FZCB 4UC4A 1GFDA 2C0TA 4J9EA 4J9BA 2DL3A 4JZ3A 4JUVA 3UA6A 1WPYA 4L6V5 1TG0A 2BZXA 4M77E 3I56T 1RAFB 1K73R 4M78E 4J7IA 2OJ2A 3OS0A 4RTWA 4FYWB 2DRMA 4QQGA 3QZ9B 4RCBA 2E5QA 5LJ5g 2QQBA 4II1A 1MMAA 4M77D 2E6NA 1AWXA 3TSZA 4M78D 4XTXA 2EVRA 2CT4A 4IUQA 1UECA 1X69A 4PJJA 4XU1A 1N5ZA 3CC7A 2K3BA 1M90C 3OS5A 1FMKA 3FJPA 3OA6A 2M0OA 1M2OA 2J05A 3MP8A 2DD5A 3E1SA 1KIKA 5KCHA 2DJZA 4GY5A 2F2WA 3S6WA 3QKJA 1M30A 1BBZA 4RTYA 4KH1B 3GBQA 1VQKA 3G6EA 1KC8R 3VYHB 2KE9A 3RKYA 5IHIA 1BI3A 1Q81C 3I55Q 2XMFA 3G7ZA 1M5Q1 1JXMA 2RJDA 4Y92A 2EYQA 4M7DE 3ASKA 2QG9B 4GLMA 4X34A 4QW2A 1QP3A 2L3RA 2KEAA 5KYYB 1X2KA 1WHGA 1SF9A 3CCLT 2EYWA 5L23A 4M7DD 4F7UF 2FEIA 2V1QA 3TCJA 1SKUB 2KRMA 3CCUQ 2LT1A 1BU1A 1YI2Q 2DTHA 2E4HA 1UGVA 1IXDA 1OULA 1YJ9T 3CMAT 2BE7D 2M9UA 2QQRA 5IHKA 3RESA 1G3SA 2IVWA 4XAXB 4DBRA 2EGEA 2JUFA 2X4JA 4C8QG 1UE9A 1R0BG 2V1RA 4ME7A 2XI9A 3M57A 1I5LA 3EFOB 2GTOA 4BI3A 1C0MA 4EMGA 1CSKA 1D1AA 2P0KA 1NPPA 4OGEA 2KI7A 2NUPB 2KBTA 4ORZA 1U06A 1Y07A 1FWZA 2DF6A 1ZX6A 4RTXA 3PTAA 3JCMX 2RHZA 2HL5C 2KVQG 4IUVA 5GAN2 2YXYA 4C92F 2MPXC 4AG2C 3GF5A 4HVVA 1MNDA 2SRCA 3QDFA 3G4ST 1RL2A 1Y7XA 1VQ9Q 4ELZC 3PIPA 3LYIA 2COWA 2OI3A 3LLRA 3DB4A 4Z89A 3RERA 5KYYA 2OX7A 2DIQA 4X1VA 3CCMQ 4E7IA 5GAN8 1AWWA 4IURA 1HXDA 4PKCC 2EFIA 3JCMd 4P5NA 2AHJB 5DM7R 2DFUA 5GMKj 3OYHA 3JCMf 3FIFA 3QYGB 3VS2A 2A36A 1WXBA 3CD6Q 2J6KA 4RTZA 2RQUA 1QCOA 2RK1A 1GFCA 2OTJQ 1KJWA 2EQMA 4WTOB 5GMKm 1VQ6T 2EW3A 4PJMA 2RJCA 5AYFA 3M0QA 3OYJA 1CKAA 2DIGA 3DLMA 3J81E 3SD4A 3VU3C 3M55A 1N8RR 2FHDA 3I56A 3CCRT 3MEUA 2DYBA 4PL6A 2RD1A 3OYFA 2HQEA 2L3PA 5M9OA 1K4US 1WNLA 1WGSA 2D8HA 3OYIA 2FVUA 2NUPA 4PJNA 2ZPBB 1V76A 2HSPA 4RCCA 5GAOp 4C0FA 5FU7B 1Q7YU 1VQOQ 1D3BB 5GAOr 4HVWA 5FWCA 3T9NA 2L89A 1WXTA 4HT9A 3R6OA 1I4K1 1VQ8T 1I5OB 3FB9A 4LDUA 1U1TA 1B07A 5FRNA 2LDMA 4Z02A 2EWNA 4OB1B 2CZ7B 4OF1A 3VUBA 1ZA1B 2XK0A 3A8OB 4N0AA 5D6WA 2ZPFB 1X6OA 2QI2A 4OMNA 4JLIA 1ZSZA 1M3BA 3QJYA 4TVRA 3X26B 2R57A 3GLXA 2ZPHB 3CCLA 1N8RC 2O31A 3PVLA 4N0AC 1Q82C 4ZTFA 2EAYA 2L5QA 1K9MR 1UUEA 1QLYA 4C5IA 4IIOA 1QKXA 4QQ6A 1ZSZC 2L0AA 1S72T 1YJ9A 1ABOA 3CMAA 3CCQQ 3CXCA 4CC4B 4CC3A 1UJ0A 2K9GA 2PUOB 1YNZA 3C0CA 4OB3B 1K8AC 2P0PA 2X4YA 2F1LA 3V7SA 3OSSC 2DERA 2CT3A 1UGPB 4C8QF 3CPWA 2RJFA 5GAOm 3RKXA 3U23A 2EQKA 3CCJQ 2DD4A 1JBMA 1VQNQ 2HZYA 2YUNA 3CXCP 4ATOA 2K4YA 1TTHB 2JVVA 1IO6A 2RQWA 2HL3A 5GAMg 4DQ2A 4XK8E 2D1XA 3L1AA 1M1KR 3CPWP 3RIRA 4LD9K 5LJ3e 3QO3A 5LJ3j 2RQTA 5GMKi 5GANe 1PKSA 2MIOA 1ZQ1A 4A4GA 5CQYA 5GANj 5KYNA 1VYVA 4JRQA 2K57A 1M8MA 4A4KA 1VYUA 1YJNT 5CKEA 3PMTA 3PGGA 3SFMA 3SEMA 1BB9A 1BI1A 2FB7A 4ELYC 3E9FA 4EMKB 2C06A 2LTOA 1QVGS 2BZYA 2KR3A 1FYNA 2V8KA 2GFUA 3OYLA 2RM4A 7AT1B 4A63B 3JB9F 4MZTA 3HTRA 2LT4A 1N6AA 1VQ6A 4CC7A 3M53A 2R58A 2VC8A 2VV5A 4ZN3A 3CMET 2RI2A 1OI1A 4KGZB 4JS4A 4M75B 3MKDA 2EIFA 4HT8A 3LX7A 3A8HB 3CCRA 3IQLA 3OYEA 3CQTA 4J6YA 3ZL7C 1RAIB 1D0YA 1V1CA 2HKNA 1M1KC 4OMLA 2YWWA 2QA4Q 1QKWA 4E47A 1QVPA 2VXEA 4QVZA 3OYDA 1SEMA 3L42A 2DTOA 3M56A 4F7UG 2DEUA 2LMJA 4C0DB 1W4SA 4FT4A 4FYVB 3H9NA 1B7TA 1GCQA 5HK3A 2AKKA 1YJWQ 4FYYB 2V8JA 3JCMe 1Q86U 1VQ7Q 4ZTJA 4RG8A 5D7UA 5KYXA 2XDBA 1K0XA 1VQLQ 2RB6A 3BDLA 1QCFA 5A0GA 1VQ8A 3QJ6A 4XTZA 4M7AA 3QPHA 5GJWB 5A2QE 3EFRA 3FEOA 1GCQC 3VUZA 4FM4B 1WHMA 2QQ9A 4DEXA 3GIBA 3JCMQ 2ECZA 5FRMA 4BY6C 2P4TA 3X20B 1WIEA 1NJIU 4XU2A 5GAOq 1KHIA 1B34B 2CYZB 4EMKA 2LCLA 5LJ5j 4M7AC 3KXTA 2H8HA 2MWPA 2EPDA 2ESWA 4BE1A 3EG3A 2M51A 4AG1C 3CBPA 1W1FA 1YN8A 4EPCA 2XIDA 4RTVA 2GGRA 1M9SA 3QWXX 4C92G 2GQIA 3M54A 2NUTA 3I55T 1LOJA 1MHNA 2JMCA 1S72A 4M75A 1D0ZA 3EGUA 3M0PA 2BE9B 1HD3A 3JB9J 1MMNA 4M7AF 2DETA 1GBQA 4PJOF 3HP9A 3R6NA 3QHSA 1KQSP 1PWTA 3CBMA 3OW2S 1QCNA 2YUOA 2L3SA 4M4ZA 1ZA2B 1BKBA 2BTTA 4BUGA 2XKOC 3MEVA 4M77B 2YRCA 1Z9ZA 2F5TX 4IUTA 3CC7Q 5GAN6 2JS0A 3EAEA 8ATCB 1QVFP 1X6GA 4LUEA 4JJBA 1VYTA 3V7RA 3EG9B 4V2SA 2QTXA 2XHCA 1VQKQ 3G6EQ 3UATA 1AHJB 2VB6A 1CKBA 1AOJA 4KUIA 4F7UE 2W0ZA 4J8OA 2D9TA 3D7SB 3C12A 3LWIA 2EGAA 2X3XD 3VV0A 2X4WA 3AHUA 4MMLA 2KSSA 4NL2A 1RACB 3META 1E6GA 3ZFJA 1U8RA 2DZ9A 1MGQA 3KUFA 3M0SA 1WLPB 2KYMA 1ZBJA 4J9HA 4WF2A 3VS4A 2YT6A 2NUZA 1X2QA 5HK0A 4DBFA 4X9CA 4M7DB 4JRKA 3EGXA 1T3SA 2RQRA 2E70A 3JRZA 2RQVA 1ZBXA 4Y28E 1XQHA 1VQ9T 5CKBA 3ME9A 4C5GA 6AT1B 4F16A 1SRMA 1IGQA 5C0MA 2VYTA 1YITT 1KD1U 3VRZA 4X9DA 1W2BS 3E2UA 4J9DA 3PE0A 1QP2A 2EGCA 2ZPIB 3CCMT 2FRWA 2DO3A 2RO0A 3BY7A 1H3ZA 2RI5A 3MO8A 4C92E 4M77A 1TU0B 2J06A 3DB3A 3JB9H 2KRNA 4M78A 2YUQA 2HNIA 1QWEA 2MAMA 2K2VA 1AZEA 2CP5A 2KGTA 4C92D 4GBQA 5CKHA 2OTJT 1RAEB 3NTKA 2VGNA 4XQ3A 1K73C 5D6YA 2RJEA 4MDXA 5LJ3d 2FRYA 2LNHB 4M78C 2LQ8A 1SSFA 4PJLA 5GANd 1JJ2S 3Q1JA 5LJ3f 2KXDA 4EIKA 1G3TA 2X51A 1R0CB 2CS7A 1RI0A 1M90U 5GANf 1V29B 2ZPEB 2F5KA 4HCKA 1BIAA 2P4RA 1NLPC 4C0GA 2DL5A 4O5VA 1Q7YR 2HDAA 3MJXA 4JDSA 2Y4YA 1F1BB 4E6RA 2R5AA 2BZ8A 1BIBA 1K76A 1RAAB 2P84A 1UGSB 2RK2A 4N4IA 3G71T 2CP2A 1KC8C 4JRPA 1Q81U 4OB2B 1M4ZA 4ESRA 3CC2T 2CP3A 3JCMJ 4QVCA 1YFNA 1XTDA 2CUBA 1M1FA 3OYGA 1LCKA 1J3TA 2DM1A 2CP6A 3HFNA 1M8VA 2EYXA 3JCMh 2DBKA 2R5MA 2JN0A 3M5AA 2E1HA 1VQ4T 5IXBA 1VQMT 1IGUA 3CCST 1N27A 2D0NA 3VS3A 4A4EA 3VJPA 4FSSA 5I2SA 1ZUYA 2MWOA 2DILA 2CZ6B 2YSQA 1IB8A 2LQNA 3VS6A 1H3HA 2CH4W 5KCOA 3PMIA 3OYYA 1UJYA 3VKIA 2A7YA 1QWFA 1ZHIA 2ATCB 4PLIA 4BB7A 1Y96B 5GMKe 2LJ1A 1G8XA 4LUDA 2PZ1A 2QTVA 1WHLA 4Y91A 4EDUA 1SRLA 3QSUA 4LNPA 2KAFA 2V8IA 3JB9G 1AZGB 2HSEB 4VUBA 3V7CA 2QASA 3G1JA 3RBBB 3V8JA 3M9QA 4BACA 3EHQA 4C8QB 4LDWA 4RG2A 2DK3A 4KRTA 3JAME 1KQ2A 4FCYA 1ARKA 3OYBA 2O01E 5LJ5d 3UWNA 3FC3A 3H0HA 4LXCA 3CCJT 3EG0A 4XTWA 2XU8A 5DLQE 3EFOA 3OMCA 1TUDA 3MP1A 4DEYA 5LJ5f 3VS5A 1O9SA 3CCLQ 1VQ5T 1XOVA 2ABLA 2FZKB 2DEQA 1VIFA 4IKFA 2OAUA 2F69A 4JRIA 2CZ0B
chains in the Genus database with same CATH topology
1YBYA 3FLGA 1ZQ1A 5A0LA 4BDZA 4A4GA 5CQYA 1G5VA 5GANj 2KY9A 4FIBA 4JRQA 2P0QA 3TEEA 2K57A 2X4XA 4NS5A 3M4GA 1YJWA 2GFAA 1QVFA 4M7DG 1NPRA 1FXXA 4C8QE 3OW2A 3CCEA 2E10A 4A4KA 1VQ7A 1QVGA 1YJNT 5EG2A 5CKEA 5IAYA 5GAMj 3DKMA 1Y71A 3PMTA 4RKUE 1VQLA 3PGGA 3UDCA 4NL3A 3SFMA 4XTUA 2YLCA 5FU6C 2CGHA 1PSEA 1IZ6A 1BI1A 1WJRA 1YITA 2FB7A 4C92A 2HAXA 3E9GA 4M77F 3E9FA 4ELYC 4EMKB 2C06A 3E19A 4J6WA 2JOYA 2LTOA 4N4HA 4C8QD 3OS1A 1VQOT 1QVGS 5IN1A 5LL6S 2CKKA 4IUUA 4M78F 2K5FA 2V8KA 2PQWA 2GFUA 5J3BA 4HKEA 5DLOA 3OYLA 4FSXA 4HCZA 3TREA 3DLLA 4J83A 3EFSA 2RM4A 2LVMA 3JB9F 5GMKi 4MZTA 3MP6A 4BDYA 1UB4A 2LT4A 4MDWA 1XNIA 2M1HA 4M78B 1KD1C 1N6AA 1X75C 3X24B 3ZBDA 1VQ6A 3M53A 3S3OA 4C5EA 2R58A 3A5ZB 5CR2A 4R56A 1OZ3A 2E65A 4C92C 2VC8A 2VV5A 1Y96A 2RH2A 4ZN3A 2K5LA 3L2WA 3CMET 2RI2A 4A4HA 1OI1A 3M4YA 4JS4A 2BIVA 4M75B 3S3NA 4LDXA 2B8AA 2EIFA 4HT8A 2VXFA 4M7DC 4A53A 2K5IA 3LX7A 3I55A 2FL7A 3A8HB 3M58A 3CCRA 3WXMB 5I2MA 3OYEA 1K73U 4J6YA 1M1KC 2RHXA 2GF7A 4R55A 1VQKT 4BI8B 1OZ2A 4PNOA 3JCMP 2EJGA 1KQ1A 4E47A 1QVPA 2VXEA 5CAIA 4QVZA 3OYDA 3L42A 4UC4A 3UT1A 2DTOA 4JUVA 1WPYA 4L6V5 4M77E 3I56T 3M56A 4F7UG 4C0DB 3X28B 1W4SA 4FT4A 3C95A 3J7AF 4M7AG 2KMTA 5CK9A 2DAQA 5HK3A 4HA8A 4M78E 4J5YA 2JNGA 4J7IA 2EJ9A 4PJOG 3OS0A 2V8JA 3JCMe 4M7DF 4YTLA 1Q86U 4QQGA 1X01A 3QZ9B 4RCBA 2E5QA 4RG8A 5LJ5g 2QQBA 3CCUA 4ZTJA 4II1A 3HL8A 2XDBA 4M77D 1YI2A 2RB6A 5LJ5h 2E6NA 1HK9A 2GQVA 2PVDB 3BDLA 4E7KA 3SWNA 2HD0A 4BI4A 5A0GA 1DJ7B 2PVGB 4M78D 4XTXA 3CCQT 1VQ8A 3RMQA 2PU9B 3QJ6A 4XTZA 4GLKA 4IUQA 1Q7YC 2WSCE 4M7AA 5CQXA 3QPHA 4XU1A 1W2BA 4J6XA 1JB0E 3CC7A 5A2QE 3JB9D 1M90C 3EFRA 3OS5A 2MMPA 3FEOA 3O8VA 3P8BB 4FM4B 3VUZA 4QVDA 2QQ9A 2E12A 3FJPA 1D3BA 3JCMQ 3OA6A 3G71A 2M0OA 1H641 2YHTA 1KC8U 3GIBA 4E7HA 2BUDA 5FRMA 4ZGJB 3MP8A 4BY6C 2DD5A 3E1SA 2P4TA 3OBWA 5KCHA 3X20B 2DJZA 4GY5A 1NJIU 4XU2A 3CC2A 3S6WA 1N9RA 4MZPA 2D0QB 1KHIA 5GAOq 3CC2T 1B34B 3QKJA 4EMHA 2DXCA 2CYZB 3SWNC 3CCVT 4O6JA 3SDZA 4EMKA 2LCLA 1LJOA 1VQKA 2IG0A 5LJ5j 5GMKl 2KQWA 3G6EA 3VYHB 4M7AC 3KXTA 4HCBA 3RKYA 1VQNT 2MWPA 2QQAA 4OP0A 5HY6A 1BI3A 3FRNA 5FU7C 1Q81C 4BE1A 1N8RU 2WSFE 3G7ZA 3G4SA 1M5Q1 1VQ4A 3CBPA 2RHUA 1VQMA 3CCSA 2RJDA 2YRVA 2EYQA 4M7DE 3ASKA 4EPCA 2E41A 2XIDA 3PNWC 4QW2A 4X34A 1M9SA 1QP3A 3L2QA 1Q82U 4C92G 1VIEA 1KQSS 2L3RA 1NE8A 3LGLA 4KUDK 3M54A 2A3LA 1OYXA 2DPPB 5IT9E 3I55T 3KBGA 3CCLT 1YIJT 1K9MC 1LOJA 1MHNA 1S72A 2EKOA 3MEAA 4M75A 4OGCA 5GAMe 4RMOA 3QZ5B 4F7UF 3OS2A 3NTIA 4M7DD 3JB9J 2XG8D 4M7AF 3HRSA 1JJ2A 1VQ9A 3TCJA 2OTLT 2LX9A 3N5BB 3QUIA 1I8FA 4PJOF 3GNGA 3HP9A 3QHSA 2LT1A 5CIUA 1QVFS 3CBMA 2XDDA 3OW2S 1K8AU 2DTHA 3ER0A 3PFSA 1BI2A 1G3WA 1P92A 3M59A 1YJ9T 4BUGA 1BKBA 3CMAT 3A8LB 2XKOC 2M9UA 3CCMA 2QQRA 3MEVA 4M77B 5D6XA 1YCYA 2F5TX 4IUTA 5GAN6 3EAEA 4PJOE 3RESA 1G3SA 2IVWA 4XAXB 2JTFA 3QYHB 5I21A 1NZ9A 3HSBA 5A0DA 2JUFA 2X4JA 2ZGWA 4C8QG 2MF2A 3V7RA 4ME7A 2XI9A 3M57A 1I5LA 3CD6A 3L2RA 4V2SA 4JS5A 2QTXA 4BI3A 4EMGA 3L2UA 3CC7T 3CC4T 2OTJA 2P0KA 2XHCA 3OYAA 3CCJA 1NPPA 2O4XB 4BE0A 1BI0A 4OGEA 1AHJB 1YHQT 5CVIA 2LQKA 2QEXT 5FROA 4KUIA 2VGMA 3JCMb 4F7UE 1VQ5A 3NTHA 4J8OA 3PT9A 4BE2A 4C8QA 1Y07A 4M7AE 3RUXA 2D9TA 3OB9A 1FWZA 3C12A 3LWIA 3PTAA 1VQPT 3GPLA 3VV0A 2X4WA 3AHUA 3JCMX 3OYKA 1WQ7A 1M1GA 2DXTA 2KVQG 2RHIA 2RHZA 4IUVA 4MMLA 4E7JA 5GAN2 2KSSA 2K3XA 4NL2A 4M7DA 4C92F 3META 4OB0B 3ZFJA 3GF5A 2DZ9A 3P8DA 1U8RA 1JRIA 1MGQA 3KUFA 4BD3A 1IREB 4M7AD 2QA4T 3G4ST 1RL2A 3WVEB 1Y7XA 4WF2A 4A4FA 4PJOD 4IUPA 5C6SA 2M16A 5GMKh 2X35A 4ELZC 3PIPA 4C8QC 3L2ZA 5HK0A 2BKDN 3LYIA 4X9CA 5GAN5 4M7DB 2L8DA 2KDSA 4JRKA 2WSEE 1UGRB 1VQOA 2E70A 1YJWT 3JRZA 3LLRA 2RA2A 3HPWA 3GP8A 3DB4A 3RERA 3CCET 3LWHA 1ZBXA 4Y28E 1VQ7T 1XQHA 3OMGA 2DKGA 2DIQA 1VQ9T 5CKBA 3ME9A 4C5GA 1VQLT 1QW1A 3LGFA 5GAN8 3V8KA 4E7IA 4IURA 1HXDA 4PKCC 2EFIA 2ZZDA 3JCMd 5C0MA 2VYTA 1YITT 4P5NA 1KD1U 3L2VA 4X9DA 1W2BS 2G3RA 2QQSA 1WJSA 2AHJB 4M78G 4NOYA 5L8RE 2E6ZA 2XDPA 5LJ5e 2NLUA 5GAOl 5DM7R 5FLXE 3J80E 5CKDA 3A8MB 1QP2A 3PIOA 5GMKj 3OYHA 3JCMf 1KHCA 2Y4XA 3FIFA 2ZPIB 3QYGB 3CCMT 3OYCA 2DO3A 5CO7A 2RO0A 3BY7A 1H3ZA 5LJ3g 2RI5A 2RK1A 3MO8A 5GAN3 2EQMA 4M75G 4C92E 5GMKm 1VQ6T 4M77A 2QXFA 1I81A 4FL6A 4N4GA 1M1KU 2RJCA 3DB3A 3OYMA 5AYFA 3JB9H 4M78A 3QBYA 1PSFA 2PUKB 4D6WA 3OYJA 2HNIA 4MMKA 3WVDB 4DOVA 2MAMA 4B9WA 2K2VA 2DIGA 4C92D 3DLMA 3J81E 2K3YA 2LRQA 5CKHA 2OTJT 3SD4A 3VU3C 3M55A 4EMKC 3NTKA 2FHDA 3I56A 5J26A 3A8GB 3MEUA 2VGNA 3P8HA 4XQ3A 3CCRT 4PL6A 2RD1A 3OYFA 2HQEA 4BY6B 1FX7A 5M9OA 1WNLA 1K73C 1WGSA 5D6YA 3OYIA 2O4XA 2FVUA 3X25B 2HBPA 2RJEA 2JZ2A 4MDXA 3BW1A 1GXIE 5LJ3d 5KE2A 2ZPBB 4RCCA 2DXBA 4M78C 3RMSA 4F7UB 2LQ8A 3H8ZA 4M7AB 5CKFA 5GAOp 1SSFA 4KBMB 3V8LA 4L59A 5GANd 1JJ2S 3Q1JA 3LW5E 5LJ3f 4C0FA 3CCQA 5DY9A 5FU7B 4OMFB 4PJOB 1Q7YU 3QIIA 3QXEB 1G3YA 1G3TA 1D3BB 3RKWA 2CS7A 5GAOr 1RI0A 4M75C 1M90U 3T9NA 5KH6A 3CCUT 2L89A 5GANf 1R8OB 1V29B 2ZPEB 3OQ5A 5GAMd 1Q86C 2F5KA 4HT9A 1YI2T 3BDUA 4XTYA 2QDYB 3R6OA 1KG1A 2LNVA 2RI3A 1BIAA 1I4K1 4C0GA 3MCAB 3VYGA 4DOWA 4O5VA 1VQ8T 3FB9A 3LH0A 1U1TA 4LDUA 5GAMf 3INZA 5FRNA 2LDMA 4JDSA 4Z02A 3CCVA 2EWNA 2Y4YA 2R5AA 4OB1B 2CZ7B 1BIBA 4OF1A 3GOXA 1UGSB 2RK2A 4LDVA 4N4IA 3VUBA 2EQUA 3G71T 5FU6B 4C0DC 1KC8C 1VQNA 2XK0A 4JRPA 1EIFA 4ZGDB 1Q81U 4OB2B 3URGA 3A8OB 1M4ZA 4M75F 2PVOB 4N0AA 5D6WA 4XTVA 1O75A 4QVCA 3JCMJ 1VUBA 2ZPFB 1NJIC 4Q5WA 4DA4A 4CRIA 5GAOn 1UGQB 1XTDA 3SB2A 2DTIA 3F70A 1M1FA 4FU6A 2E64A 1X6OA 2ZPGB 3JCMc 2QI2A 4C0ZA 3OYGA 3H6ZA 1WJQA 4JLIA 3OY9A 3FDRA 3G6ET 1B34A 2KK4A 2YLBA 3QJYA 4TVRA 3X26B 3JCMg 3HFNA 2R57A 1M8VA 3GLXA 2ZPHB 1K9MU 3CCLA 1YIJA 3MHXA 1N8RC 3JCMh 2R5MA 2JN0A 3M5AA 2E1HA 3JCMW 1VQ4T 2DXUA 3OBYA 1VQMT 3CCST 4J7FA 5GAN4 1YJNA 4C92B 3JSCA 3S3MA 4C5HA 1N27A 4A4EA 2OTLA 3VJPA 4N0AC 1Q82C 1TH7A 4ZTFA 5I2SA 2MWOA 4ZGEB 2CZ6B 3C4SA 3OYNA 2EAYA 2FYKA 2L5QA 2JTMA 2MI6A 4C5IA 2RHYA 4QQ6A 5GAN7 2XD0A 3HKSA 1S72T 3HRUA 3QG1A 5KCOA 1YJ9A 3PMIA 3CMAA 3OYYA 3CBOA 2VUBA 3CXCA 2HQXA 4OVAA 3VKIA 1U1SA 2A7YA 2PUOB 1N9SA 3CPFA 4XU0A 4B9XA 1ZHIA 2GCXA 3HHTB 4LDYA 4M77G 1LNXA 4PLIA 4OB3B 4BB7A 1Y96B 4JJNK 5GMKe 1K8AC 4LD6A 2P0PA 5CCAA 2X4YA 3HRTA 3JB9I 3CXCS 4M75E 2LC4A 3QDRB 3HFOA 3V7SA 3OSSC 4F7UA 4Y91A 3C94A 1UGPB 4JLGA 4L5GA 4C8QF 4EDUA 4XU3A 3CMEA 3CPWA 2RJFA 2DVEA 2KAFA 3QSUA 2V8IA 3JB9G 5GAOm 2H3JA 3RKXA 2Y90A 2DZCA 2XICA 4VUBA 2EQKA 3V7CA 3ZEHA 3CC4A 4PJOA 3V8JA 3M9QA 5LJ3h 4BACA 2DD4A 1YHQA 4M75D 4KT0E 4C8QB 1JBMA 4LDWA 3TU4K 4KULA 4ZN1A 2QEXA 5GANg 1UEBA 3CPWS 2D6FA 3CEYA 4PLLA 4RG2A 2DK3A 4HCCA 3NFCA 4ATOA 5GANh 3JAME 2K4YA 1KQ2A 3MEWA 2JVVA 3CD6T 5KE3A 2CZ1B 3OYBA 2O01E 5J39A 1WQWA 4QQDA 5LJ5d 3UWNA 5GAMg 2EJFA 3FC3A 1VQPA 2I2LA 2WACA 4DQ2A 4XK8E 3CCJT 2ZCFB 3BFMA 4XTWA 2XU8A 5DLQE 5GAMh 1BYMA 3L1AA 3OMCA 5HKCA 3MP1A 3GNFB 2EQJA 3UPUA 4A54A 2LCCA 5LJ5f 1KQSA 4PJOC 3RIRA 1O9SA 1VQ5T 4LD9K 5LJ3e 2QA4A 3JCMV 1XOVA 4M77C 4E7LA 2DEQA 4MZMA 3SWNB 1VIFA 3QO3A 3OSVA 4CI0C 4IKFA 5LJ3j 2OAUA 2F69A 4FT2A 4JRIA 2CZ0B 5GANe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIB A;  2DJZ A;  4WF2 A;  4XU2 A;  4PJO D;  1N9R A;  5GAO q;  5GAN j;  1B34 B;  4EMH A;  3SWN C;  5GMK h;  2K57 A;  4M7D G;  3M4G A;  4C8Q C;  3L2Z A;  1LJO A;  4C8Q E;  4EMK A;  2E10 A;  5LJ5 j;  5GMK l;  4M75 F;  4X9C A;  5GAN 5;  4N0A A;  4M7D B;  4XTV A;  3JCM J;  4QVC A;  4M7A C;  4JRK A;  5GAM j;  3RKY A;  5GAO n;  3PGG A;  4OP0 A;  2RA2 A;  3SB2 A;  2DTI A;  4NL3 A;  4XTU A;  2YLC A;  2E64 A;  2CGH A;  3JCM c;  3RER A;  4JLI A;  2FB7 A;  4C92 A;  4M77 F;  1B34 A;  1M5Q 1;  2DKG A;  4EMK B;  2YLB A;  4J6W A;  4C8Q D;  3JCM g;  3HFN A;  3V8K A;  5GAN 8;  4M7D E;  1M8V A;  2E41 A;  1HXD A;  4M78 F;  4M7D A;  3JCM d;  3JCM h;  4C92 G;  2JN0 A;  2E1H A;  3JCM W;  2DXU A;  3EFS A;  4X9D A;  5GAN 4;  4NOY A;  2RM4 A;  4M78 G;  5LJ5 e;  4C92 B;  5GAO l;  3JB9 F;  5GMK j;  1LOJ A;  4N0A C;  4M78 B;  4M75 A;  3JCM f;  5GAM e;  1TH7 A;  3FIF A;  4M7D D;  4F7U F;  2EAY A;  2FYK A;  3JB9 J;  3BY7 A;  4M7A F;  5LJ3 g;  2E65 A;  5GAN 7;  4C92 C;  2VC8 A;  3QUI A;  1Y96 A;  4M75 G;  1I8F A;  4PJO F;  4C92 E;  5GMK m;  4M77 A;  3QHS A;  1I81 A;  4JRI A;  4M75 B;  2DTH A;  4HT8 A;  1U1S A;  3JB9 H;  2VXF A;  4M7D C;  4M78 A;  1N9S A;  4A53 A;  4XU0 A;  3AHU A;  4M77 G;  2HNI A;  4M7A D;  1LNX A;  4MMK A;  1Y96 B;  5GMK e;  4C92 D;  4J6Y A;  4M77 B;  1YCY A;  3VU3 C;  3JB9 I;  4EMK C;  4M75 E;  3HFO A;  4PNO A;  3V7S A;  5GAN 6;  2EJG A;  1KQ1 A;  3JCM P;  4F7U A;  4XQ3 A;  4Y91 A;  3RES A;  2VXE A;  2RD1 A;  4C8Q F;  4XU3 A;  5CAI A;  3QSU A;  2DVE A;  1WNL A;  5I21 A;  3HSB A;  3JB9 G;  5GAO m;  3RKX A;  2Y90 A;  2DTO A;  2DZC A;  4JUV A;  2ZGW A;  1WPY A;  3V7C A;  4M77 E;  4C8Q G;  4PJO A;  4F7U G;  3BW1 A;  3V8J A;  3V7R A;  5LJ3 d;  5LJ3 h;  5GAN 3;  1I5L A;  4M7A G;  4M75 D;  4C8Q B;  1JBM A;  4V2S A;  4HA8 A;  4M78 C;  4RCC A;  4M78 E;  4J5Y A;  4F7U B;  2QTX A;  5GAN g;  4EMG A;  4M7A B;  2EJ9 A;  4PJO G;  5GAO p;  4M7D F;  3JCM e;  3V8L A;  5GAN d;  5GAN h;  1X01 A;  1KQ2 A;  4RCB A;  5LJ5 g;  5LJ3 f;  5DY9 A;  4PJO B;  4M77 D;  1WQW A;  2RB6 A;  5LJ5 d;  5LJ5 h;  1D3B B;  1HK9 A;  2EJF A;  5GAM g;  2I2L A;  3SWN A;  3RKW A;  4F7U E;  3JCM b;  5GAO r;  4M75 C;  4DQ2 A;  4XTW A;  3BFM A;  5GAN f;  4M78 D;  4XTX A;  4C8Q A;  5GAM d;  5GAM h;  3RUX A;  4M7A E;  3L1A A;  4HT9 A;  4XTZ A;  3BDU A;  4XTY A;  4M7A A;  4A54 A;  5LJ5 f;  4PJO C;  4XU1 A;  1BIA A;  4PJO E;  4J6X A;  3RIR A;  3JCM X;  1I4K 1;  1WQ7 A;  2DXT A;  4MML A;  5LJ3 e;  3JCM V;  3JB9 D;  4M77 C;  3EFR A;  5GAN 2;  3FB9 A;  4NL2 A;  1U1T A;  2DEQ A;  5GAM f;  3SWN B;  3INZ A;  4C92 F;  4QVD A;  3QO3 A;  3FJP A;  1D3B A;  2DZ9 A;  3JCM Q;  1JRI A;  1MGQ A;  1H64 1;  2YHT A;  5LJ3 j;  3GIB A;  5GMK i;  2EWN A;  5GAN e; 
#chains in the Genus database with same CATH topology
 3FLG A;  5A0L A;  1G5V A;  4ZNX A;  2DMO A;  2GFA A;  3OW2 A;  4C8Q E;  2E10 A;  1YJ9 Q;  1NEG A;  1X6B A;  3CMA Q;  5IAY A;  5GAM j;  2F2V A;  2K7A A;  2YLC A;  2CGH A;  2JS2 A;  1IHW A;  3ULR B;  1WJR A;  1YIT A;  4Z8A A;  1QMC A;  2JOY A;  4C8Q D;  5LL6 S;  4IUU A;  2K5F A;  2PQW A;  2YRD A;  3DLL A;  5DLO A;  4FSX A;  3TRE A;  3EFS A;  2LVM A;  4BDY A;  4MDW A;  3SHW A;  3ZBD A;  2KNB B;  3S3O A;  4C5E A;  1GRI A;  1RLQ C;  1Y96 A;  3L2W A;  2JT4 A;  1EZZ B;  1I1J A;  2B8A A;  3VS7 A;  1AT1 B;  3M58 A;  5I2M A;  2L2P A;  1KK7 A;  2GF7 A;  4R55 A;  4BI8 B;  1OZ2 A;  2EJG A;  2FO0 A;  1I0C A;  3UT1 A;  1UHC A;  2AIR B;  4J9I A;  5GJV B;  4K11 A;  3X28 B;  4M7A G;  2KMT A;  2ED1 A;  4J5Y A;  2JNG A;  4F04 B;  4PJO G;  3JV3 A;  1X01 A;  1TS9 A;  2VVK A;  3HL8 A;  1GCP A;  3FJ5 A;  2PVD B;  1HK9 A;  2DL4 A;  1WHJ A;  4PK4 A;  3RMQ A;  2PU9 B;  4GLK A;  5CQX A;  3RDV A;  1W2B A;  4J6X A;  4E2F B;  1JB0 E;  3JB9 D;  2MMP A;  3P8B B;  1JQQ A;  2X3W D;  1C6V X;  2E12 A;  1D3B A;  3G71 A;  2YHT A;  4E7H A;  4ZGJ B;  1KSW A;  1ZSG A;  3OBW A;  2SEM A;  1Y57 A;  1VQ6 Q;  3TSW A;  3CC2 A;  4MZP A;  2D0Q B;  2DXC A;  3CCV T;  4O6J A;  1NM7 A;  1OU8 A;  1LJO A;  2IG0 A;  1ZLM A;  5GMK l;  4HCB A;  2FZG B;  5FU7 C;  2ED0 A;  1NJI R;  1N8R U;  2WSF E;  3TVT A;  3G4S A;  1VQ4 A;  1VQM A;  3CCS A;  4AT1 B;  2YRV A;  2E41 A;  1JXO A;  5KYU B;  2OTL Q;  1Q82 U;  1HSQ A;  1VIE A;  1NE8 A;  2DPP B;  5IT9 E;  3KBG A;  4WCI A;  1YIJ T;  1K9M C;  1BK2 A;  4OGC A;  3MEA A;  4J9F A;  3QZ5 B;  3NTI A;  3HRS A;  1JJ2 A;  3N5B B;  1I8F A;  2HMA A;  4F17 A;  2LX7 A;  3M0R A;  1K8A U;  3ER0 A;  1AWJ A;  1VQ8 Q;  1LPL A;  2YUP A;  3A8L B;  3KFV A;  5D6X A;  1WXU A;  2HBW A;  1WHK A;  1EFN A;  2JTF A;  3QYH B;  3HSB A;  1NZ9 A;  2EYY A;  5A0D A;  2ZGW A;  2JJ9 A;  2MF2 A;  1E6H A;  1FMV A;  3L2R A;  2AT1 B;  2KT1 A;  3CC7 T;  3CC4 T;  1ABQ A;  3OYA A;  3CCJ A;  2O4X B;  1BI0 A;  1YHQ T;  2CP7 A;  5CVI A;  2LQK A;  2QEX T;  2VGM A;  3JCM b;  1VQ5 A;  3H41 A;  3PT9 A;  4BE2 A;  4IIM A;  4M7A E;  3RUX A;  3OB9 A;  1VQP T;  3GPL A;  4PJO E;  2RHI A;  4E7J A;  1Q95 G;  2I0N A;  2K3X A;  2MCN A;  4OB0 B;  1MUZ A;  1RAG B;  4M7A D;  1S72 Q;  1WX6 A;  1SHF A;  3CCE Q;  3WVE B;  4A4F A;  4PJO D;  1UTI A;  1IHV A;  5C6S A;  5KYW B;  1HJD A;  5GMK h;  2X35 A;  1PRL C;  1M3A A;  3L2Z A;  2BKD N;  5GAN 5;  2WSE E;  2EBP A;  3HPW A;  4DBQ A;  3I35 A;  2DVJ A;  2AZS A;  3OMG A;  1QW1 A;  3LGF A;  3V8K A;  2ZZD A;  2MYS A;  1PRM C;  1Z9Q A;  3L2V A;  2G3R A;  4M78 G;  5L8R E;  1UDL A;  5LJ5 e;  2E6Z A;  2XDP A;  5GAO l;  3J80 E;  1A0N B;  4KH0 B;  1AD5 A;  1KHC A;  3BE3 A;  5CO7 A;  5LJ3 g;  1OV3 A;  1ZUU A;  4AFU C;  5GAN 3;  2QXF A;  2KXC A;  4FL6 A;  3LH5 A;  1M1K U;  3OYM A;  3QBY A;  1SHG A;  4D6W A;  1IRX A;  4MMK A;  3WVD B;  4DOV A;  1TWB A;  4B9W A;  3EG2 A;  1W6X A;  1SSH A;  2CDT A;  4EMK C;  5J26 A;  3P8H A;  1FX7 A;  3EGD B;  2O4X A;  3X25 B;  2JZ2 A;  4JPB W;  3REA B;  2L3Q A;  3PVQ A;  2LJ0 A;  4F7U B;  3H8Z A;  2RN8 A;  3V8L A;  2EQI A;  4RUG A;  3LW5 E;  1SPK A;  3QII A;  3QXE B;  1G3Y A;  4M75 C;  5KH6 A;  3CCU T;  1OEB A;  1R8O B;  5GAM d;  2RNA A;  1YI2 T;  3BDU A;  2QDY B;  1KG1 A;  2RI3 A;  3MCA B;  9ATC B;  5KYW A;  3LH0 A;  1XJW B;  5GAM f;  3INZ A;  2GBQ A;  2KYB A;  1M90 R;  3CCV A;  1MV0 B;  1TUG B;  3GOX A;  4LDV A;  4OMO A;  2O88 A;  5FU6 B;  2K79 A;  4C0D C;  3NMZ C;  1VOM A;  3URG A;  1KFZ A;  4M75 F;  2PVO B;  1PHT A;  4XTV A;  1VUB A;  1NLO C;  5GAO n;  3SB2 A;  2DTI A;  3F70 A;  4FU6 A;  2E64 A;  4C0Z A;  2AZV A;  1B34 A;  1PCX A;  2O9V A;  2YLB A;  1PD1 A;  3JCM g;  4FYX B;  2M0Y A;  1YIJ A;  2CP0 A;  3JCM W;  3OBY A;  1QQJ A;  1U3O A;  1YJN A;  1OX8 A;  4C92 B;  3S3M A;  4C5H A;  2VAS A;  3EHR A;  4FW2 A;  3H0I A;  3I5R A;  2DE0 X;  5GAN 7;  1I07 A;  2O9S A;  2QGG A;  3QG1 A;  3CBO A;  2VUB A;  2HQX A;  4OVA A;  1N9S A;  3CPF A;  4XU0 A;  2GCX A;  3EGD A;  3HHT B;  4LDY A;  4AMC A;  1LNX A;  1UG1 A;  4HVU A;  1TSF A;  4OMM A;  2MOX A;  1ACM B;  2DX1 A;  3HRT A;  3CXC S;  1MMG A;  3QDR B;  4F7U A;  3C94 A;  4L5G A;  3CME A;  4XU3 A;  2DVE A;  1YWP A;  2H3J A;  2DZC A;  2XIC A;  5AT1 B;  3CC4 A;  2KRO A;  3MPU B;  5LJ3 h;  1YHQ A;  2QK0 A;  1G83 A;  4KUL A;  4ZN1 A;  2QEX A;  1UEB A;  3CPW S;  2LZ6 B;  4LN2 A;  2JW4 A;  5GAN h;  3MEW A;  2AK5 A;  3CD6 T;  5J39 A;  1WQW A;  4QQD A;  2AKL A;  4B6M A;  1VQP A;  2I2L A;  4DBH A;  3BFM A;  3EG9 A;  1BYM A;  1AWO A;  2EQJ A;  2J7I A;  2JXB A;  4F14 A;  4A54 A;  4RTU A;  4M77 C;  4E7L A;  4MZM A;  3SWN B;  5IHN A;  2IPO B;  4D8D A;  4FT2 A;  3A98 A;  4BDZ A;  4FIB A;  3QWY A;  3THK A;  1X43 A;  2P0Q A;  4NS5 A;  1NPR A;  1FXX A;  3UF4 A;  4D8K A;  1QVG A;  5EG2 A;  2F2X A;  1Y71 A;  3UDC A;  4NL3 A;  1R77 A;  5FU6 C;  1PSE A;  1IZ6 A;  4C92 A;  3A1P A;  3E9G A;  4M77 F;  5I11 A;  4N4H A;  1VQO T;  2E5K A;  5IN1 A;  2CKK A;  1H92 A;  4M78 F;  4M7D A;  5J3B A;  2KT8 A;  4HCZ A;  3RR6 A;  5FWB A;  1PG5 B;  1UB4 A;  1XNI A;  2M1H A;  1X75 C;  1QVG P;  2E65 A;  1BCM A;  2COZ A;  4C92 C;  4A4H A;  3M4Y A;  2BIV A;  2CH4 A;  2HCK A;  4M7D C;  4A53 A;  4CC2 A;  3I55 A;  4OMP A;  4ANJ A;  3I56 Q;  2JM8 A;  1K73 U;  1TXQ A;  2RHX A;  2RPN A;  4PNO A;  2C0I A;  2K6D A;  5CAI A;  2HEQ A;  4E7S A;  2ROL A;  3C95 A;  3J7A F;  5CK9 A;  2DAQ A;  5ECA A;  4HA8 A;  1D1B A;  1M3C A;  4PFO A;  2EJ9 A;  4M7D F;  2DA9 A;  4YTL A;  3CCU A;  1T0J A;  1YI2 A;  5LJ5 h;  1K9A A;  4E7K A;  2GQV A;  1OOT A;  3SWN A;  2HD0 A;  4BI4 A;  1PKT A;  1C1A A;  1DJ7 B;  2PVG B;  1YIT Q;  3CCQ T;  4AFS C;  1Q7Y C;  2WSC E;  1RAD B;  3O8V A;  1RAB B;  1JO8 A;  4QVD A;  1KC8 U;  1H64 1;  1WI7 A;  2BUD A;  1AVZ C;  2A08 A;  2VWF A;  4PFZ A;  1YWO A;  1N9R A;  1ZSZ B;  4EMH A;  2Z0W A;  3SWN C;  2GTJ A;  3SDZ A;  2KQW A;  4LE9 A;  1K1Z A;  1VQN T;  2QQA A;  4OP0 A;  1S1N A;  5HY6 A;  3FRN A;  1OX9 A;  2JM9 A;  2E3H A;  2RHU A;  3PNW C;  3L2Q A;  3UA7 A;  1KQS S;  1OPL A;  1T0H A;  2QAZ A;  3LGL A;  4KUD K;  2A3L A;  1OYX A;  2EKO A;  3OS2 A;  5GAM e;  4RMO A;  1TUC A;  2XG8 D;  1UFF A;  2RF0 A;  4QT7 A;  1Q82 R;  1VQ9 A;  5IH2 A;  2OTL T;  1WYX A;  1WA7 A;  2LX9 A;  3QUI A;  3GNG A;  2JMA A;  5CIU A;  1QVF S;  1BCO A;  2XDD A;  3PFS A;  1BI2 A;  1HYO A;  1G3W A;  1P92 A;  3M59 A;  1GBR A;  2X9H A;  3CCM A;  1YCY A;  2G6F X;  4QKU A;  2ZAE A;  1K8A R;  1SG5 A;  5I21 A;  3G71 Q;  3OW2 P;  1NEB A;  3CC2 Q;  1D1C A;  3CD6 A;  1RLP C;  3M0T A;  1G2B A;  4JS5 A;  3L2U A;  2OTJ A;  1AEY A;  4BE0 A;  1PC0 A;  2LCS A;  2RMO A;  5FRO A;  3EH1 A;  3NTH A;  1W70 A;  4C8Q A;  3G4S Q;  1VQ4 Q;  2YDL A;  1VQM Q;  3CCS Q;  2DLP A;  3OYK A;  1WQ7 A;  1M1G A;  2DXT A;  1LVK A;  2JTE A;  3P8D A;  1JRI A;  2CRE A;  4BD3 A;  1IRE B;  2QA4 T;  3EG1 A;  2DBM A;  2NWM A;  1MV3 A;  4AFZ C;  4IUP A;  2PTK A;  2M16 A;  4C8Q C;  1MMD A;  2L8D A;  2KDS A;  1YP5 A;  1UGR B;  1VQO A;  1YJW T;  2LQW A;  1OQK A;  2RA2 A;  3GP8 A;  1Q86 R;  3CCE T;  3LWH A;  1VQ7 T;  2DKG A;  5HCK A;  1VQL T;  2ROT A;  4FW1 A;  3RNJ A;  2FG0 A;  2QQS A;  1WJS A;  4NOY A;  2OAW A;  2EKH A;  2NLU A;  5FLX E;  2QDL A;  3A8M B;  5CKD A;  3PIO A;  2IIM A;  2Y4X A;  4RTT A;  2DYI A;  1Y0M A;  3OYC A;  1M27 C;  2DJQ A;  4M75 G;  3O5Z A;  4E7Z A;  3CCR Q;  1I81 A;  1W2B P;  4N4G A;  4HXJ A;  1PSF A;  2PUK B;  1VQ5 Q;  2COY A;  2K3Y A;  2LRQ A;  2DL7 A;  1D09 B;  3A8G B;  8AT1 B;  4BY6 B;  3VRY A;  5KYX B;  2H3E B;  2HBP A;  2LP5 A;  3BW1 A;  1GXI E;  5KE2 A;  1JEG A;  2DNU A;  2DXB A;  3RMS A;  1JU5 C;  4M7A B;  5CKF A;  4KBM B;  4L59 A;  2E3I A;  4J9G A;  3CCQ A;  5DY9 A;  4OMF B;  5EC7 A;  3I9Q A;  4PJO B;  1WHH A;  2EYZ A;  3RKW A;  2A37 A;  1NBE B;  1Q86 C;  3AT1 B;  1X27 A;  3OQ5 A;  1M2V B;  4XTY A;  4AFQ C;  2LNV A;  1FMW A;  4Z88 A;  3VYG A;  4DOW A;  4KGX B;  3H0F A;  1JJ2 P;  1T3L A;  2QGF B;  1ZUK A;  2C0O A;  2MK5 A;  2EQU A;  2HQH A;  2B86 A;  4PFP A;  1VQN A;  1EIF A;  2J6F A;  4ZGD B;  2FPF A;  1O75 A;  1NJI C;  1VA7 A;  1EX4 A;  4Q5W A;  4DA4 A;  1WDX A;  4CRI A;  1UGQ B;  2QYZ A;  2NUT B;  3JCM c;  1VQK T;  2ZPG B;  1UHF A;  3H6Z A;  1WJQ A;  3OY9 A;  3FDR A;  3G6E T;  2DRK A;  2KK4 A;  5I22 A;  2O2O A;  2K2M A;  1K9M U;  3TQ7 P;  3MHX A;  2D8J A;  5FW9 A;  2DXU A;  2DL8 A;  2PNI A;  4J7F A;  5GAN 4;  2W10 A;  3JSC A;  2ENM A;  2OTL A;  2HKQ B;  1TH7 A;  2M02 A;  3NPF A;  4JJD A;  4ZGE B;  3C4S A;  3OYN A;  2FYK A;  2A0F B;  2JTM A;  2MI6 A;  5KYU A;  2RHY A;  2XD0 A;  1NYG A;  3HKS A;  3HRU A;  2LJ3 A;  2NYS A;  2GNC A;  3M0U A;  1U1S A;  4B9X A;  4M77 G;  2CUD A;  4R0K A;  4JJN K;  1PM3 A;  4LD6 A;  5CCA A;  3JB9 I;  4M75 E;  1YCS B;  2LC4 A;  3HFO A;  1GL5 A;  1RUW A;  4JLG A;  2A28 A;  5IXF A;  3CCV Q;  2Y90 A;  3EH2 A;  3ZEH A;  1KD1 R;  4PJO A;  3I5S A;  1PNJ A;  4M75 D;  4KT0 E;  3TU4 K;  5GAN g;  1NG2 A;  2D6F A;  3CEY A;  4PLL A;  4HCC A;  3NFC A;  1M2V A;  3NHN A;  5KE3 A;  1K0S A;  2CZ1 B;  2EJF A;  2WAC A;  2ZCF B;  5GAM h;  2KRS A;  3REB B;  5HKC A;  3GNF B;  3UPU A;  2LCC A;  1KQS A;  4PJO C;  1YIJ Q;  2QA4 A;  1H8K A;  3JCM V;  4JJC A;  1YJN Q;  3OSV A;  4CI0 C;  4JZ4 A;  3EGX B;  1E7O A;  1YBY A;  2FPE A;  1D0X A;  2KY9 A;  3TEE A;  4M7D G;  2X4X A;  4J9C A;  2VKN A;  3M4G A;  1YJW A;  1QVF A;  1B3Q A;  3CCE A;  1VQ7 A;  2CSI A;  1RI9 A;  1VQL A;  2CSQ A;  3DKM A;  4RKU E;  4XTU A;  1RAH B;  2HAX A;  2J6O A;  3E19 A;  4J6W A;  3OS1 A;  1NYF A;  1WFW A;  4HKE A;  4J83 A;  3CME Q;  3NGP A;  1WZO A;  3CC4 Q;  3MP6 A;  1TOV A;  4M78 B;  1KD1 C;  1U5S A;  3X24 B;  2V26 A;  1YHQ Q;  2QEX Q;  1PD0 A;  5CR2 A;  1MNE A;  3A5Z B;  4R56 A;  1OZ3 A;  2FPD A;  1OPK A;  2RH2 A;  2K5L A;  4OMQ A;  3S3N A;  4LDX A;  1Q81 R;  1VQP Q;  2VXF A;  1OU9 A;  2K5I A;  4KGV B;  3VS0 A;  2FL7 A;  3VS1 A;  3WXM B;  3JCM P;  1KQ1 A;  2FZC B;  4UC4 A;  1GFD A;  2C0T A;  4J9E A;  4J9B A;  2DL3 A;  4JZ3 A;  4JUV A;  3UA6 A;  1WPY A;  4L6V 5;  1TG0 A;  2BZX A;  4M77 E;  3I56 T;  1RAF B;  1K73 R;  4M78 E;  4J7I A;  2OJ2 A;  3OS0 A;  4RTW A;  4FYW B;  2DRM A;  4QQG A;  3QZ9 B;  4RCB A;  2E5Q A;  5LJ5 g;  2QQB A;  4II1 A;  1MMA A;  4M77 D;  2E6N A;  1AWX A;  3TSZ A;  4M78 D;  4XTX A;  2EVR A;  2CT4 A;  4IUQ A;  1UEC A;  1X69 A;  4PJJ A;  4XU1 A;  1N5Z A;  3CC7 A;  2K3B A;  1M90 C;  3OS5 A;  1FMK A;  3FJP A;  3OA6 A;  2M0O A;  1M2O A;  2J05 A;  3MP8 A;  2DD5 A;  3E1S A;  1KIK A;  5KCH A;  2DJZ A;  4GY5 A;  2F2W A;  3S6W A;  3QKJ A;  1M30 A;  1BBZ A;  4RTY A;  4KH1 B;  3GBQ A;  1VQK A;  3G6E A;  1KC8 R;  3VYH B;  2KE9 A;  3RKY A;  5IHI A;  1BI3 A;  1Q81 C;  3I55 Q;  2XMF A;  3G7Z A;  1M5Q 1;  1JXM A;  2RJD A;  4Y92 A;  2EYQ A;  4M7D E;  3ASK A;  2QG9 B;  4GLM A;  4X34 A;  4QW2 A;  1QP3 A;  2L3R A;  2KEA A;  5KYY B;  1X2K A;  1WHG A;  1SF9 A;  3CCL T;  2EYW A;  5L23 A;  4M7D D;  4F7U F;  2FEI A;  2V1Q A;  3TCJ A;  1SKU B;  2KRM A;  3CCU Q;  2LT1 A;  1BU1 A;  1YI2 Q;  2DTH A;  2E4H A;  1UGV A;  1IXD A;  1OUL A;  1YJ9 T;  3CMA T;  2BE7 D;  2M9U A;  2QQR A;  5IHK A;  3RES A;  1G3S A;  2IVW A;  4XAX B;  4DBR A;  2EGE A;  2JUF A;  2X4J A;  4C8Q G;  1UE9 A;  1R0B G;  2V1R A;  4ME7 A;  2XI9 A;  3M57 A;  1I5L A;  3EFO B;  2GTO A;  4BI3 A;  1C0M A;  4EMG A;  1CSK A;  1D1A A;  2P0K A;  1NPP A;  4OGE A;  2KI7 A;  2NUP B;  2KBT A;  4ORZ A;  1U06 A;  1Y07 A;  1FWZ A;  2DF6 A;  1ZX6 A;  4RTX A;  3PTA A;  3JCM X;  2RHZ A;  2HL5 C;  2KVQ G;  4IUV A;  5GAN 2;  2YXY A;  4C92 F;  2MPX C;  4AG2 C;  3GF5 A;  4HVV A;  1MND A;  2SRC A;  3QDF A;  3G4S T;  1RL2 A;  1Y7X A;  1VQ9 Q;  4ELZ C;  3PIP A;  3LYI A;  2COW A;  2OI3 A;  3LLR A;  3DB4 A;  4Z89 A;  3RER A;  5KYY A;  2OX7 A;  2DIQ A;  4X1V A;  3CCM Q;  4E7I A;  5GAN 8;  1AWW A;  4IUR A;  1HXD A;  4PKC C;  2EFI A;  3JCM d;  4P5N A;  2AHJ B;  5DM7 R;  2DFU A;  5GMK j;  3OYH A;  3JCM f;  3FIF A;  3QYG B;  3VS2 A;  2A36 A;  1WXB A;  3CD6 Q;  2J6K A;  4RTZ A;  2RQU A;  1QCO A;  2RK1 A;  1GFC A;  2OTJ Q;  1KJW A;  2EQM A;  4WTO B;  5GMK m;  1VQ6 T;  2EW3 A;  4PJM A;  2RJC A;  5AYF A;  3M0Q A;  3OYJ A;  1CKA A;  2DIG A;  3DLM A;  3J81 E;  3SD4 A;  3VU3 C;  3M55 A;  1N8R R;  2FHD A;  3I56 A;  3CCR T;  3MEU A;  2DYB A;  4PL6 A;  2RD1 A;  3OYF A;  2HQE A;  2L3P A;  5M9O A;  1K4U S;  1WNL A;  1WGS A;  2D8H A;  3OYI A;  2FVU A;  2NUP A;  4PJN A;  2ZPB B;  1V76 A;  2HSP A;  4RCC A;  5GAO p;  4C0F A;  5FU7 B;  1Q7Y U;  1VQO Q;  1D3B B;  5GAO r;  4HVW A;  5FWC A;  3T9N A;  2L89 A;  1WXT A;  4HT9 A;  3R6O A;  1I4K 1;  1VQ8 T;  1I5O B;  3FB9 A;  4LDU A;  1U1T A;  1B07 A;  5FRN A;  2LDM A;  4Z02 A;  2EWN A;  4OB1 B;  2CZ7 B;  4OF1 A;  3VUB A;  1ZA1 B;  2XK0 A;  3A8O B;  4N0A A;  5D6W A;  2ZPF B;  1X6O A;  2QI2 A;  4OMN A;  4JLI A;  1ZSZ A;  1M3B A;  3QJY A;  4TVR A;  3X26 B;  2R57 A;  3GLX A;  2ZPH B;  3CCL A;  1N8R C;  2O31 A;  3PVL A;  4N0A C;  1Q82 C;  4ZTF A;  2EAY A;  2L5Q A;  1K9M R;  1UUE A;  1QLY A;  4C5I A;  4IIO A;  1QKX A;  4QQ6 A;  1ZSZ C;  2L0A A;  1S72 T;  1YJ9 A;  1ABO A;  3CMA A;  3CCQ Q;  3CXC A;  4CC4 B;  4CC3 A;  1UJ0 A;  2K9G A;  2PUO B;  1YNZ A;  3C0C A;  4OB3 B;  1K8A C;  2P0P A;  2X4Y A;  2F1L A;  3V7S A;  3OSS C;  2DER A;  2CT3 A;  1UGP B;  4C8Q F;  3CPW A;  2RJF A;  5GAO m;  3RKX A;  3U23 A;  2EQK A;  3CCJ Q;  2DD4 A;  1JBM A;  1VQN Q;  2HZY A;  2YUN A;  3CXC P;  4ATO A;  2K4Y A;  1TTH B;  2JVV A;  1IO6 A;  2RQW A;  2HL3 A;  5GAM g;  4DQ2 A;  4XK8 E;  2D1X A;  3L1A A;  1M1K R;  3CPW P;  3RIR A;  4LD9 K;  5LJ3 e;  3QO3 A;  5LJ3 j;  2RQT A;  5GMK i;  5GAN e;  1PKS A;  2MIO A;  1ZQ1 A;  4A4G A;  5CQY A;  5GAN j;  5KYN A;  1VYV A;  4JRQ A;  2K57 A;  1M8M A;  4A4K A;  1VYU A;  1YJN T;  5CKE A;  3PMT A;  3PGG A;  3SFM A;  3SEM A;  1BB9 A;  1BI1 A;  2FB7 A;  4ELY C;  3E9F A;  4EMK B;  2C06 A;  2LTO A;  1QVG S;  2BZY A;  2KR3 A;  1FYN A;  2V8K A;  2GFU A;  3OYL A;  2RM4 A;  7AT1 B;  4A63 B;  3JB9 F;  4MZT A;  3HTR A;  2LT4 A;  1N6A A;  1VQ6 A;  4CC7 A;  3M53 A;  2R58 A;  2VC8 A;  2VV5 A;  4ZN3 A;  3CME T;  2RI2 A;  1OI1 A;  4KGZ B;  4JS4 A;  4M75 B;  3MKD A;  2EIF A;  4HT8 A;  3LX7 A;  3A8H B;  3CCR A;  3IQL A;  3OYE A;  3CQT A;  4J6Y A;  3ZL7 C;  1RAI B;  1D0Y A;  1V1C A;  2HKN A;  1M1K C;  4OML A;  2YWW A;  2QA4 Q;  1QKW A;  4E47 A;  1QVP A;  2VXE A;  4QVZ A;  3OYD A;  1SEM A;  3L42 A;  2DTO A;  3M56 A;  4F7U G;  2DEU A;  2LMJ A;  4C0D B;  1W4S A;  4FT4 A;  4FYV B;  3H9N A;  1B7T A;  1GCQ A;  5HK3 A;  2AKK A;  1YJW Q;  4FYY B;  2V8J A;  3JCM e;  1Q86 U;  1VQ7 Q;  4ZTJ A;  4RG8 A;  5D7U A;  5KYX A;  2XDB A;  1K0X A;  1VQL Q;  2RB6 A;  3BDL A;  1QCF A;  5A0G A;  1VQ8 A;  3QJ6 A;  4XTZ A;  4M7A A;  3QPH A;  5GJW B;  5A2Q E;  3EFR A;  3FEO A;  1GCQ C;  3VUZ A;  4FM4 B;  1WHM A;  2QQ9 A;  4DEX A;  3GIB A;  3JCM Q;  2ECZ A;  5FRM A;  4BY6 C;  2P4T A;  3X20 B;  1WIE A;  1NJI U;  4XU2 A;  5GAO q;  1KHI A;  1B34 B;  2CYZ B;  4EMK A;  2LCL A;  5LJ5 j;  4M7A C;  3KXT A;  2H8H A;  2MWP A;  2EPD A;  2ESW A;  4BE1 A;  3EG3 A;  2M51 A;  4AG1 C;  3CBP A;  1W1F A;  1YN8 A;  4EPC A;  2XID A;  4RTV A;  2GGR A;  1M9S A;  3QWX X;  4C92 G;  2GQI A;  3M54 A;  2NUT A;  3I55 T;  1LOJ A;  1MHN A;  2JMC A;  1S72 A;  4M75 A;  1D0Z A;  3EGU A;  3M0P A;  2BE9 B;  1HD3 A;  3JB9 J;  1MMN A;  4M7A F;  2DET A;  1GBQ A;  4PJO F;  3HP9 A;  3R6N A;  3QHS A;  1KQS P;  1PWT A;  3CBM A;  3OW2 S;  1QCN A;  2YUO A;  2L3S A;  4M4Z A;  1ZA2 B;  1BKB A;  2BTT A;  4BUG A;  2XKO C;  3MEV A;  4M77 B;  2YRC A;  1Z9Z A;  2F5T X;  4IUT A;  3CC7 Q;  5GAN 6;  2JS0 A;  3EAE A;  8ATC B;  1QVF P;  1X6G A;  4LUE A;  4JJB A;  1VYT A;  3V7R A;  3EG9 B;  4V2S A;  2QTX A;  2XHC A;  1VQK Q;  3G6E Q;  3UAT A;  1AHJ B;  2VB6 A;  1CKB A;  1AOJ A;  4KUI A;  4F7U E;  2W0Z A;  4J8O A;  2D9T A;  3D7S B;  3C12 A;  3LWI A;  2EGA A;  2X3X D;  3VV0 A;  2X4W A;  3AHU A;  4MML A;  2KSS A;  4NL2 A;  1RAC B;  3MET A;  1E6G A;  3ZFJ A;  1U8R A;  2DZ9 A;  1MGQ A;  3KUF A;  3M0S A;  1WLP B;  2KYM A;  1ZBJ A;  4J9H A;  4WF2 A;  3VS4 A;  2YT6 A;  2NUZ A;  1X2Q A;  5HK0 A;  4DBF A;  4X9C A;  4M7D B;  4JRK A;  3EGX A;  1T3S A;  2RQR A;  2E70 A;  3JRZ A;  2RQV A;  1ZBX A;  4Y28 E;  1XQH A;  1VQ9 T;  5CKB A;  3ME9 A;  4C5G A;  6AT1 B;  4F16 A;  1SRM A;  1IGQ A;  5C0M A;  2VYT A;  1YIT T;  1KD1 U;  3VRZ A;  4X9D A;  1W2B S;  3E2U A;  4J9D A;  3PE0 A;  1QP2 A;  2EGC A;  2ZPI B;  3CCM T;  2FRW A;  2DO3 A;  2RO0 A;  3BY7 A;  1H3Z A;  2RI5 A;  3MO8 A;  4C92 E;  4M77 A;  1TU0 B;  2J06 A;  3DB3 A;  3JB9 H;  2KRN A;  4M78 A;  2YUQ A;  2HNI A;  1QWE A;  2MAM A;  2K2V A;  1AZE A;  2CP5 A;  2KGT A;  4C92 D;  4GBQ A;  5CKH A;  2OTJ T;  1RAE B;  3NTK A;  2VGN A;  4XQ3 A;  1K73 C;  5D6Y A;  2RJE A;  4MDX A;  5LJ3 d;  2FRY A;  2LNH B;  4M78 C;  2LQ8 A;  1SSF A;  4PJL A;  5GAN d;  1JJ2 S;  3Q1J A;  5LJ3 f;  2KXD A;  4EIK A;  1G3T A;  2X51 A;  1R0C B;  2CS7 A;  1RI0 A;  1M90 U;  5GAN f;  1V29 B;  2ZPE B;  2F5K A;  4HCK A;  1BIA A;  2P4R A;  1NLP C;  4C0G A;  2DL5 A;  4O5V A;  1Q7Y R;  2HDA A;  3MJX A;  4JDS A;  2Y4Y A;  1F1B B;  4E6R A;  2R5A A;  2BZ8 A;  1BIB A;  1K76 A;  1RAA B;  2P84 A;  1UGS B;  2RK2 A;  4N4I A;  3G71 T;  2CP2 A;  1KC8 C;  4JRP A;  1Q81 U;  4OB2 B;  1M4Z A;  4ESR A;  3CC2 T;  2CP3 A;  3JCM J;  4QVC A;  1YFN A;  1XTD A;  2CUB A;  1M1F A;  3OYG A;  1LCK A;  1J3T A;  2DM1 A;  2CP6 A;  3HFN A;  1M8V A;  2EYX A;  3JCM h;  2DBK A;  2R5M A;  2JN0 A;  3M5A A;  2E1H A;  1VQ4 T;  5IXB A;  1VQM T;  1IGU A;  3CCS T;  1N27 A;  2D0N A;  3VS3 A;  4A4E A;  3VJP A;  4FSS A;  5I2S A;  1ZUY A;  2MWO A;  2DIL A;  2CZ6 B;  2YSQ A;  1IB8 A;  2LQN A;  3VS6 A;  1H3H A;  2CH4 W;  5KCO A;  3PMI A;  3OYY A;  1UJY A;  3VKI A;  2A7Y A;  1QWF A;  1ZHI A;  2ATC B;  4PLI A;  4BB7 A;  1Y96 B;  5GMK e;  2LJ1 A;  1G8X A;  4LUD A;  2PZ1 A;  2QTV A;  1WHL A;  4Y91 A;  4EDU A;  1SRL A;  3QSU A;  4LNP A;  2KAF A;  2V8I A;  3JB9 G;  1AZG B;  2HSE B;  4VUB A;  3V7C A;  2QAS A;  3G1J A;  3RBB B;  3V8J A;  3M9Q A;  4BAC A;  3EHQ A;  4C8Q B;  4LDW A;  4RG2 A;  2DK3 A;  4KRT A;  3JAM E;  1KQ2 A;  4FCY A;  1ARK A;  3OYB A;  2O01 E;  5LJ5 d;  3UWN A;  3FC3 A;  3H0H A;  4LXC A;  3CCJ T;  3EG0 A;  4XTW A;  2XU8 A;  5DLQ E;  3EFO A;  3OMC A;  1TUD A;  3MP1 A;  4DEY A;  5LJ5 f;  3VS5 A;  1O9S A;  3CCL Q;  1VQ5 T;  1XOV A;  2ABL A;  2FZK B;  2DEQ A;  1VIF A;  4IKF A;  2OAU A;  2F69 A;  4JRI A;  2CZ0 B; 
#chains in the Genus database with same CATH homology
 1YBY A;  3FLG A;  1ZQ1 A;  5A0L A;  4BDZ A;  4A4G A;  5CQY A;  1G5V A;  5GAN j;  2KY9 A;  4FIB A;  4JRQ A;  2P0Q A;  3TEE A;  2K57 A;  2X4X A;  4NS5 A;  3M4G A;  1YJW A;  2GFA A;  1QVF A;  4M7D G;  1NPR A;  1FXX A;  4C8Q E;  3OW2 A;  3CCE A;  2E10 A;  4A4K A;  1VQ7 A;  1QVG A;  1YJN T;  5EG2 A;  5CKE A;  5IAY A;  5GAM j;  3DKM A;  1Y71 A;  3PMT A;  4RKU E;  1VQL A;  3PGG A;  3UDC A;  4NL3 A;  3SFM A;  4XTU A;  2YLC A;  5FU6 C;  2CGH A;  1PSE A;  1IZ6 A;  1BI1 A;  1WJR A;  1YIT A;  2FB7 A;  4C92 A;  2HAX A;  3E9G A;  4M77 F;  3E9F A;  4ELY C;  4EMK B;  2C06 A;  3E19 A;  4J6W A;  2JOY A;  2LTO A;  4N4H A;  4C8Q D;  3OS1 A;  1VQO T;  1QVG S;  5IN1 A;  5LL6 S;  2CKK A;  4IUU A;  4M78 F;  2K5F A;  2V8K A;  2PQW A;  2GFU A;  5J3B A;  4HKE A;  5DLO A;  3OYL A;  4FSX A;  4HCZ A;  3TRE A;  3DLL A;  4J83 A;  3EFS A;  2RM4 A;  2LVM A;  3JB9 F;  5GMK i;  4MZT A;  3MP6 A;  4BDY A;  1UB4 A;  2LT4 A;  4MDW A;  1XNI A;  2M1H A;  4M78 B;  1KD1 C;  1N6A A;  1X75 C;  3X24 B;  3ZBD A;  1VQ6 A;  3M53 A;  3S3O A;  4C5E A;  2R58 A;  3A5Z B;  5CR2 A;  4R56 A;  1OZ3 A;  2E65 A;  4C92 C;  2VC8 A;  2VV5 A;  1Y96 A;  2RH2 A;  4ZN3 A;  2K5L A;  3L2W A;  3CME T;  2RI2 A;  4A4H A;  1OI1 A;  3M4Y A;  4JS4 A;  2BIV A;  4M75 B;  3S3N A;  4LDX A;  2B8A A;  2EIF A;  4HT8 A;  2VXF A;  4M7D C;  4A53 A;  2K5I A;  3LX7 A;  3I55 A;  2FL7 A;  3A8H B;  3M58 A;  3CCR A;  3WXM B;  5I2M A;  3OYE A;  1K73 U;  4J6Y A;  1M1K C;  2RHX A;  2GF7 A;  4R55 A;  1VQK T;  4BI8 B;  1OZ2 A;  4PNO A;  3JCM P;  2EJG A;  1KQ1 A;  4E47 A;  1QVP A;  2VXE A;  5CAI A;  4QVZ A;  3OYD A;  3L42 A;  4UC4 A;  3UT1 A;  2DTO A;  4JUV A;  1WPY A;  4L6V 5;  4M77 E;  3I56 T;  3M56 A;  4F7U G;  4C0D B;  3X28 B;  1W4S A;  4FT4 A;  3C95 A;  3J7A F;  4M7A G;  2KMT A;  5CK9 A;  2DAQ A;  5HK3 A;  4HA8 A;  4M78 E;  4J5Y A;  2JNG A;  4J7I A;  2EJ9 A;  4PJO G;  3OS0 A;  2V8J A;  3JCM e;  4M7D F;  4YTL A;  1Q86 U;  4QQG A;  1X01 A;  3QZ9 B;  4RCB A;  2E5Q A;  4RG8 A;  5LJ5 g;  2QQB A;  3CCU A;  4ZTJ A;  4II1 A;  3HL8 A;  2XDB A;  4M77 D;  1YI2 A;  2RB6 A;  5LJ5 h;  2E6N A;  1HK9 A;  2GQV A;  2PVD B;  3BDL A;  4E7K A;  3SWN A;  2HD0 A;  4BI4 A;  5A0G A;  1DJ7 B;  2PVG B;  4M78 D;  4XTX A;  3CCQ T;  1VQ8 A;  3RMQ A;  2PU9 B;  3QJ6 A;  4XTZ A;  4GLK A;  4IUQ A;  1Q7Y C;  2WSC E;  4M7A A;  5CQX A;  3QPH A;  4XU1 A;  1W2B A;  4J6X A;  1JB0 E;  3CC7 A;  5A2Q E;  3JB9 D;  1M90 C;  3EFR A;  3OS5 A;  2MMP A;  3FEO A;  3O8V A;  3P8B B;  4FM4 B;  3VUZ A;  4QVD A;  2QQ9 A;  2E12 A;  3FJP A;  1D3B A;  3JCM Q;  3OA6 A;  3G71 A;  2M0O A;  1H64 1;  2YHT A;  1KC8 U;  3GIB A;  4E7H A;  2BUD A;  5FRM A;  4ZGJ B;  3MP8 A;  4BY6 C;  2DD5 A;  3E1S A;  2P4T A;  3OBW A;  5KCH A;  3X20 B;  2DJZ A;  4GY5 A;  1NJI U;  4XU2 A;  3CC2 A;  3S6W A;  1N9R A;  4MZP A;  2D0Q B;  1KHI A;  5GAO q;  3CC2 T;  1B34 B;  3QKJ A;  4EMH A;  2DXC A;  2CYZ B;  3SWN C;  3CCV T;  4O6J A;  3SDZ A;  4EMK A;  2LCL A;  1LJO A;  1VQK A;  2IG0 A;  5LJ5 j;  5GMK l;  2KQW A;  3G6E A;  3VYH B;  4M7A C;  3KXT A;  4HCB A;  3RKY A;  1VQN T;  2MWP A;  2QQA A;  4OP0 A;  5HY6 A;  1BI3 A;  3FRN A;  5FU7 C;  1Q81 C;  4BE1 A;  1N8R U;  2WSF E;  3G7Z A;  3G4S A;  1M5Q 1;  1VQ4 A;  3CBP A;  2RHU A;  1VQM A;  3CCS A;  2RJD A;  2YRV A;  2EYQ A;  4M7D E;  3ASK A;  4EPC A;  2E41 A;  2XID A;  3PNW C;  4QW2 A;  4X34 A;  1M9S A;  1QP3 A;  3L2Q A;  1Q82 U;  4C92 G;  1VIE A;  1KQS S;  2L3R A;  1NE8 A;  3LGL A;  4KUD K;  3M54 A;  2A3L A;  1OYX A;  2DPP B;  5IT9 E;  3I55 T;  3KBG A;  3CCL T;  1YIJ T;  1K9M C;  1LOJ A;  1MHN A;  1S72 A;  2EKO A;  3MEA A;  4M75 A;  4OGC A;  5GAM e;  4RMO A;  3QZ5 B;  4F7U F;  3OS2 A;  3NTI A;  4M7D D;  3JB9 J;  2XG8 D;  4M7A F;  3HRS A;  1JJ2 A;  1VQ9 A;  3TCJ A;  2OTL T;  2LX9 A;  3N5B B;  3QUI A;  1I8F A;  4PJO F;  3GNG A;  3HP9 A;  3QHS A;  2LT1 A;  5CIU A;  1QVF S;  3CBM A;  2XDD A;  3OW2 S;  1K8A U;  2DTH A;  3ER0 A;  3PFS A;  1BI2 A;  1G3W A;  1P92 A;  3M59 A;  1YJ9 T;  4BUG A;  1BKB A;  3CMA T;  3A8L B;  2XKO C;  2M9U A;  3CCM A;  2QQR A;  3MEV A;  4M77 B;  5D6X A;  1YCY A;  2F5T X;  4IUT A;  5GAN 6;  3EAE A;  4PJO E;  3RES A;  1G3S A;  2IVW A;  4XAX B;  2JTF A;  3QYH B;  5I21 A;  1NZ9 A;  3HSB A;  5A0D A;  2JUF A;  2X4J A;  2ZGW A;  4C8Q G;  2MF2 A;  3V7R A;  4ME7 A;  2XI9 A;  3M57 A;  1I5L A;  3CD6 A;  3L2R A;  4V2S A;  4JS5 A;  2QTX A;  4BI3 A;  4EMG A;  3L2U A;  3CC7 T;  3CC4 T;  2OTJ A;  2P0K A;  2XHC A;  3OYA A;  3CCJ A;  1NPP A;  2O4X B;  4BE0 A;  1BI0 A;  4OGE A;  1AHJ B;  1YHQ T;  5CVI A;  2LQK A;  2QEX T;  5FRO A;  4KUI A;  2VGM A;  3JCM b;  4F7U E;  1VQ5 A;  3NTH A;  4J8O A;  3PT9 A;  4BE2 A;  4C8Q A;  1Y07 A;  4M7A E;  3RUX A;  2D9T A;  3OB9 A;  1FWZ A;  3C12 A;  3LWI A;  3PTA A;  1VQP T;  3GPL A;  3VV0 A;  2X4W A;  3AHU A;  3JCM X;  3OYK A;  1WQ7 A;  1M1G A;  2DXT A;  2KVQ G;  2RHI A;  2RHZ A;  4IUV A;  4MML A;  4E7J A;  5GAN 2;  2KSS A;  2K3X A;  4NL2 A;  4M7D A;  4C92 F;  3MET A;  4OB0 B;  3ZFJ A;  3GF5 A;  2DZ9 A;  3P8D A;  1U8R A;  1JRI A;  1MGQ A;  3KUF A;  4BD3 A;  1IRE B;  4M7A D;  2QA4 T;  3G4S T;  1RL2 A;  3WVE B;  1Y7X A;  4WF2 A;  4A4F A;  4PJO D;  4IUP A;  5C6S A;  2M16 A;  5GMK h;  2X35 A;  4ELZ C;  3PIP A;  4C8Q C;  3L2Z A;  5HK0 A;  2BKD N;  3LYI A;  4X9C A;  5GAN 5;  4M7D B;  2L8D A;  2KDS A;  4JRK A;  2WSE E;  1UGR B;  1VQO A;  2E70 A;  1YJW T;  3JRZ A;  3LLR A;  2RA2 A;  3HPW A;  3GP8 A;  3DB4 A;  3RER A;  3CCE T;  3LWH A;  1ZBX A;  4Y28 E;  1VQ7 T;  1XQH A;  3OMG A;  2DKG A;  2DIQ A;  1VQ9 T;  5CKB A;  3ME9 A;  4C5G A;  1VQL T;  1QW1 A;  3LGF A;  5GAN 8;  3V8K A;  4E7I A;  4IUR A;  1HXD A;  4PKC C;  2EFI A;  2ZZD A;  3JCM d;  5C0M A;  2VYT A;  1YIT T;  4P5N A;  1KD1 U;  3L2V A;  4X9D A;  1W2B S;  2G3R A;  2QQS A;  1WJS A;  2AHJ B;  4M78 G;  4NOY A;  5L8R E;  2E6Z A;  2XDP A;  5LJ5 e;  2NLU A;  5GAO l;  5DM7 R;  5FLX E;  3J80 E;  5CKD A;  3A8M B;  1QP2 A;  3PIO A;  5GMK j;  3OYH A;  3JCM f;  1KHC A;  2Y4X A;  3FIF A;  2ZPI B;  3QYG B;  3CCM T;  3OYC A;  2DO3 A;  5CO7 A;  2RO0 A;  3BY7 A;  1H3Z A;  5LJ3 g;  2RI5 A;  2RK1 A;  3MO8 A;  5GAN 3;  2EQM A;  4M75 G;  4C92 E;  5GMK m;  1VQ6 T;  4M77 A;  2QXF A;  1I81 A;  4FL6 A;  4N4G A;  1M1K U;  2RJC A;  3DB3 A;  3OYM A;  5AYF A;  3JB9 H;  4M78 A;  3QBY A;  1PSF A;  2PUK B;  4D6W A;  3OYJ A;  2HNI A;  4MMK A;  3WVD B;  4DOV A;  2MAM A;  4B9W A;  2K2V A;  2DIG A;  4C92 D;  3DLM A;  3J81 E;  2K3Y A;  2LRQ A;  5CKH A;  2OTJ T;  3SD4 A;  3VU3 C;  3M55 A;  4EMK C;  3NTK A;  2FHD A;  3I56 A;  5J26 A;  3A8G B;  3MEU A;  2VGN A;  3P8H A;  4XQ3 A;  3CCR T;  4PL6 A;  2RD1 A;  3OYF A;  2HQE A;  4BY6 B;  1FX7 A;  5M9O A;  1WNL A;  1K73 C;  1WGS A;  5D6Y A;  3OYI A;  2O4X A;  2FVU A;  3X25 B;  2HBP A;  2RJE A;  2JZ2 A;  4MDX A;  3BW1 A;  1GXI E;  5LJ3 d;  5KE2 A;  2ZPB B;  4RCC A;  2DXB A;  4M78 C;  3RMS A;  4F7U B;  2LQ8 A;  3H8Z A;  4M7A B;  5CKF A;  5GAO p;  1SSF A;  4KBM B;  3V8L A;  4L59 A;  5GAN d;  1JJ2 S;  3Q1J A;  3LW5 E;  5LJ3 f;  4C0F A;  3CCQ A;  5DY9 A;  5FU7 B;  4OMF B;  4PJO B;  1Q7Y U;  3QII A;  3QXE B;  1G3Y A;  1G3T A;  1D3B B;  3RKW A;  2CS7 A;  5GAO r;  1RI0 A;  4M75 C;  1M90 U;  3T9N A;  5KH6 A;  3CCU T;  2L89 A;  5GAN f;  1R8O B;  1V29 B;  2ZPE B;  3OQ5 A;  5GAM d;  1Q86 C;  2F5K A;  4HT9 A;  1YI2 T;  3BDU A;  4XTY A;  2QDY B;  3R6O A;  1KG1 A;  2LNV A;  2RI3 A;  1BIA A;  1I4K 1;  4C0G A;  3MCA B;  3VYG A;  4DOW A;  4O5V A;  1VQ8 T;  3FB9 A;  3LH0 A;  1U1T A;  4LDU A;  5GAM f;  3INZ A;  5FRN A;  2LDM A;  4JDS A;  4Z02 A;  3CCV A;  2EWN A;  2Y4Y A;  2R5A A;  4OB1 B;  2CZ7 B;  1BIB A;  4OF1 A;  3GOX A;  1UGS B;  2RK2 A;  4LDV A;  4N4I A;  3VUB A;  2EQU A;  3G71 T;  5FU6 B;  4C0D C;  1KC8 C;  1VQN A;  2XK0 A;  4JRP A;  1EIF A;  4ZGD B;  1Q81 U;  4OB2 B;  3URG A;  3A8O B;  1M4Z A;  4M75 F;  2PVO B;  4N0A A;  5D6W A;  4XTV A;  1O75 A;  4QVC A;  3JCM J;  1VUB A;  2ZPF B;  1NJI C;  4Q5W A;  4DA4 A;  4CRI A;  5GAO n;  1UGQ B;  1XTD A;  3SB2 A;  2DTI A;  3F70 A;  1M1F A;  4FU6 A;  2E64 A;  1X6O A;  2ZPG B;  3JCM c;  2QI2 A;  4C0Z A;  3OYG A;  3H6Z A;  1WJQ A;  4JLI A;  3OY9 A;  3FDR A;  3G6E T;  1B34 A;  2KK4 A;  2YLB A;  3QJY A;  4TVR A;  3X26 B;  3JCM g;  3HFN A;  2R57 A;  1M8V A;  3GLX A;  2ZPH B;  1K9M U;  3CCL A;  1YIJ A;  3MHX A;  1N8R C;  3JCM h;  2R5M A;  2JN0 A;  3M5A A;  2E1H A;  3JCM W;  1VQ4 T;  2DXU A;  3OBY A;  1VQM T;  3CCS T;  4J7F A;  5GAN 4;  1YJN A;  4C92 B;  3JSC A;  3S3M A;  4C5H A;  1N27 A;  4A4E A;  2OTL A;  3VJP A;  4N0A C;  1Q82 C;  1TH7 A;  4ZTF A;  5I2S A;  2MWO A;  4ZGE B;  2CZ6 B;  3C4S A;  3OYN A;  2EAY A;  2FYK A;  2L5Q A;  2JTM A;  2MI6 A;  4C5I A;  2RHY A;  4QQ6 A;  5GAN 7;  2XD0 A;  3HKS A;  1S72 T;  3HRU A;  3QG1 A;  5KCO A;  1YJ9 A;  3PMI A;  3CMA A;  3OYY A;  3CBO A;  2VUB A;  3CXC A;  2HQX A;  4OVA A;  3VKI A;  1U1S A;  2A7Y A;  2PUO B;  1N9S A;  3CPF A;  4XU0 A;  4B9X A;  1ZHI A;  2GCX A;  3HHT B;  4LDY A;  4M77 G;  1LNX A;  4PLI A;  4OB3 B;  4BB7 A;  1Y96 B;  4JJN K;  5GMK e;  1K8A C;  4LD6 A;  2P0P A;  5CCA A;  2X4Y A;  3HRT A;  3JB9 I;  3CXC S;  4M75 E;  2LC4 A;  3QDR B;  3HFO A;  3V7S A;  3OSS C;  4F7U A;  4Y91 A;  3C94 A;  1UGP B;  4JLG A;  4L5G A;  4C8Q F;  4EDU A;  4XU3 A;  3CME A;  3CPW A;  2RJF A;  2DVE A;  2KAF A;  3QSU A;  2V8I A;  3JB9 G;  5GAO m;  2H3J A;  3RKX A;  2Y90 A;  2DZC A;  2XIC A;  4VUB A;  2EQK A;  3V7C A;  3ZEH A;  3CC4 A;  4PJO A;  3V8J A;  3M9Q A;  5LJ3 h;  4BAC A;  2DD4 A;  1YHQ A;  4M75 D;  4KT0 E;  4C8Q B;  1JBM A;  4LDW A;  3TU4 K;  4KUL A;  4ZN1 A;  2QEX A;  5GAN g;  1UEB A;  3CPW S;  2D6F A;  3CEY A;  4PLL A;  4RG2 A;  2DK3 A;  4HCC A;  3NFC A;  4ATO A;  5GAN h;  3JAM E;  2K4Y A;  1KQ2 A;  3MEW A;  2JVV A;  3CD6 T;  5KE3 A;  2CZ1 B;  3OYB A;  2O01 E;  5J39 A;  1WQW A;  4QQD A;  5LJ5 d;  3UWN A;  5GAM g;  2EJF A;  3FC3 A;  1VQP A;  2I2L A;  2WAC A;  4DQ2 A;  4XK8 E;  3CCJ T;  2ZCF B;  3BFM A;  4XTW A;  2XU8 A;  5DLQ E;  5GAM h;  1BYM A;  3L1A A;  3OMC A;  5HKC A;  3MP1 A;  3GNF B;  2EQJ A;  3UPU A;  4A54 A;  2LCC A;  5LJ5 f;  1KQS A;  4PJO C;  3RIR A;  1O9S A;  1VQ5 T;  4LD9 K;  5LJ3 e;  2QA4 A;  3JCM V;  1XOV A;  4M77 C;  4E7L A;  2DEQ A;  4MZM A;  3SWN B;  1VIF A;  3QO3 A;  3OSV A;  4CI0 C;  4IKF A;  5LJ3 j;  2OAU A;  2F69 A;  4FT2 A;  4JRI A;  2CZ0 B;  5GAN e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...