4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
1LNXA 2VXEA 3V7CA 2DKGA 4PJOG 4C8QD 4XU3A 3M4GA 5LJ5e 3JCMQ 5GANh 4XTZA 4NOYA 5LJ3j 3JCMb 4M75F 4QVDA 1JBMA 1Y96A 5GAN6 1KQ1A 1HK9A 1D3BB 5LJ5g 4M7DF 4C8QE 4C92E 3L1AA 4C8QF 4EMKC 1X01A 4F7UA 5LJ3f 3JCMJ 5GAN7 1WNLA 3EFRA 4X9DA 2YLCA 1BIAA 4XTVA 4A53A 5GAOn 4M7AD 3JCMc 4C8QG 4JUVA 4M78D 1MGQA 2RA2A 3HFNA 3SWNA 2HNIA 4C92D 5GAN4 3RERA 1I81A 2EJ9A 2DZCA 5GAMj 4HT8A 2CGHA 4M78A 3QHSA 3JCMf 1LOJA 1M8VA 3SWNC 4M7AF 3L2ZA 1N9RA 4C92F 5DY9A 2DTHA 2DXTA 4M78G 3VU3C 5GAOr 3EFSA 1B34B 5GAMe 4M75A 3BFMA 4M75G 2EWNA 3INZA 2VC8A 4M77E 1B34A 4PJOF 5GANd 3HFOA 5GANj 4F7UF 2E64A 2EJFA 5LJ3h 2DTIA 2EAYA 4MMLA 4J5YA 5GAOm 4EMKB 5GAN8 1H641 4C92B 4M7DG 5GAMg 3JCMg 1U1SA 2DVEA 4PJOD 3SWNB 4M7DD 4XQ3A 3BDUA 3RKWA 5LJ5j 3V8LA 4NL2A 1JRIA 4M77G 4PNOA 1N9SA 4J6WA 4F7UB 5GANg 4PJOE 3RKXA 5GMKj 4QVCA 3JCMW 2JN0A 4HT9A 4M7DE 4M77A 4M7DC 3JCMe 4C8QC 4M78E 4M78C 4A54A 4N0AA 2VXFA 4XTXA 5GAN2 4PJOA 3V7RA 3JCMP 3FIFA 2K57A 4M77C 1U1TA 5GAMf 3JB9F 5GAN5 4WF2A 5CAIA 4M7DA 3BW1A 4Y91A 5GAOq 2Y90A 4J6XA 4XTUA 4F7UE 1Y96B 1D3BA 1I8FA 3JB9G 4C92A 5GANf 3FB9A 4DQ2A 3AHUA 2EJGA 4M7AC 2ZGWA 4M7AB 3RIRA 5I21A 3V8JA 4OP0A 5LJ5d 2E65A 4M7AA 1M5Q1 3HSBA 3RKYA 1YCYA 5LJ3e 3GIBA 3JB9H 4PJOC 3PGGA 4M75C 5GANe 5LJ5h 4M75E 2E41A 3BY7A 4M77B 3JB9I 4XU1A 4HA8A 1WPYA 5GMKl 1KQ2A 5GMKh 1HXDA 2E10A 2DJZA 1WQWA 3JCMh 4EMGA 5GAMh 5GAMd 3RESA 3JCMV 4M75D 3V7SA 4M75B 4N0AC 4XU0A 4X9CA 4EMHA 5GAOl 4RCBA 5LJ3d 4F7UG 2DEQA 3SB2A 2I2LA 2DTOA 5GMKe 4XTWA 4V2SA 2FYKA 3JB9D 4M7AE 2FB7A 4XU2A 4EMKA 3V8KA 2YHTA 4M78F 5LJ5f 5GAN3 2RM4A 4C92C 4C92G 5GMKi 2DZ9A 1I5LA 4J6YA 3RUXA 4M7AG 3JCMX 4JRKA 1I4K1 4MMKA 4C8QB 4C8QA 4M77F 3QSUA 2E1HA 1WQ7A 4NL3A 4XTYA 1LJOA 2QTXA 5LJ3g 2DXUA 2RB6A 5GAOp 3QO3A 1TH7A 1BIBA 3FJPA 4M78B 4M77D 4RCCA 3QUIA 3JCMd 4M7DB 4JRIA 4JLIA 2RD1A 4PJOB 5GMKm 3JB9J 2YLBA
chains in the Genus database with same CATH superfamily
1LNXA 1VIEA 3BDLA 4X1VA 2RI5A 2RHYA 2LJ1A 3EHQA 1WHKA 5FU6B 4A4GA 2LX7A 5D6XA 3NPFA 2BE9B 1BI0A 3JCMJ 2K7AA 4GLMA 2DERA 3MEWA 1VQOQ 2JM8A 1Q7YU 5HK3A 2HNIA 5FW9A 1I81A 1O9SA 2CGHA 3PVLA 4OB2B 3PFSA 1BI1A 4EPCA 3CCEA 3LX7A 4M75G 4GY5A 2VC8A 1B34A 1IGQA 3DB3A 1NE8A 3LLRA 5LJ3h 4J5YA 1YJ9A 1UUEA 1O75A 3A8HB 3HRUA 3QBYA 4IUTA 3UDCA 1ARKA 4J7IA 1MNDA 3CCMT 4LDYA 2RQWA 1A0NB 1TWBA 5J26A 2R5AA 3EG1A 3V7RA 4M77C 2O4XB 3RMSA 4F7UE 2DFUA 1WJQA 2WSFE 3MEVA 1VQ7Q 5CQXA 3M0RA 2EJGA 1OPLA 2NYSA 3CCRT 3FLGA 2K2VA 3VS2A 1M1GA 2DEUA 1UGRB 3L2UA 3CCMA 2QDLA 1IB8A 2PVDB 1LVKA 4RUGA 5KYWA 2P4TA 3PMTA 3FEOA 2RJCA 4CI0C 2FRYA 3JAME 2E10A 4JZ4A 2OAWA 2DJZA 2ZPBB 8AT1B 2HEQA 2K3YA 5DLQE 4X9CA 3A8LB 2DEQA 3H6ZA 3SEMA 1VOMA 1NYFA 1MV0B 4UC4A 3JB9D 2FB7A 2LNHB 1U8RA 1YJWT 4C5GA 2EQUA 4DBFA 1VQ7T 4JRKA 1OZ2A 4M77F 3QSUA 4GBQA 4JJDA 1BCMA 5I11A 3QO3A 1KQSP 1FMWA 2RHIA 2F2VA 5J39A 3CCQQ 3P8HA 1VQMT 3UA7A 1M3CA 2L5QA 1NEGA 2JTEA 1ABQA 4FCYA 5LJ5g 1WHGA 2A08A 2CT4A 1CKAA 1WNLA 4X9DA 4M78D 2EQKA 3M9QA 2X51A 1M1KC 2F5TX 2PNIA 2VUBA 1M8VA 2M9UA 4OMMA 1SRLA 3BFMA 1FWZA 5HY6A 2C0IA 1N5ZA 1VQOT 1G2BA 1M8MA 4QW2A 1G8XA 1SPKA 4RTTA 1GRIA 1X43A 2MCNA 4C0ZA 5A2QE 4R0KA 2QG9B 3OS5A 1CKBA 3V8LA 2DNUA 4M77G 3MJXA 3RKXA 4DEXA 5CVIA 2LMJA 4ZTFA 1UFFA 5AYFA 1NBEB 2I0NA 2COYA 2XIDA 3LWIA 3KUFA 3X28B 2QXFA 3FIFA 4TVRA 5KYUA 2KBTA 3BW1A 4DBQA 2Y90A 2RMOA 1I8FA 4DEYA 4Z88A 3CCQT 3CD6Q 4JJBA 1YCSB 3A1PA 3KXTA 1OQKA 2LVMA 1RAGB 1ZSZA 3GIBA 4IIMA 3JRZA 1KD1R 1WPYA 1HXDA 2XI9A 4GLKA 2RK2A 4XU0A 5GAOl 4F7UG 1E6GA 1YWOA 1VQKQ 1QW1A 1WIEA 3S3OA 2OTLT 3V8KA 3CCVA 3TU4K 1W2BP 1Q82R 4PLIA 3CD6T 2RJDA 3R6NA 3CC2T 3PT9A 4XTYA 3I56Q 1N8RU 1AZEA 3A8MB 3OYDA 5EC7A 1DJ7B 3FJPA 1ZBJA 1GXIE 2DVJA 3C0CA 2Y4YA 1YJNA 4PJOG 3QKJA 3HRSA 1FMKA 1VA7A 5GAN6 4PKCC 3CC4A 1GFCA 2LRQA 1IGUA 5L8RE 4EMKC 3VRZA 4BE0A 2CREA 4A53A 4FT4A 4JUVA 5GAN4 1TG0A 4M7AF 3L2ZA 3QIIA 5KH6A 4M78G 2ZPHB 2O4XA 3EGDA 1UGVA 2NUPA 3HFOA 2JS0A 4AFUC 3MCAB 1MHNA 2DA9A 2EFIA 3OYEA 3RKWA 1E6HA 1HJDA 3CXCS 3CCRA 4OB3B 3GBQA 1NJIU 1N9SA 5M9OA 3ZFJA 1Q86U 4HT9A 4M7DE 1NEBA 2E5QA 1JB0E 3I55T 4OMPA 2XD0A 4N0AA 3JCMP 4J9BA 2VVKA 1G83A 5GAOq 1SEMA 2V8IA 1H92A 4BE1A 1RAIB 2YWWA 4M7AC 2QQAA 2K5LA 4A63B 4E6RA 3OYNA 2DD5A 4F04B 3CCRQ 1KC8C 2M02A 3EGXA 5GAMd 2VGNA 3V7SA 4PL6A 3E9FA 3MEUA 3X24B 3G6EA 4BDZA 1VQ5A 1WA7A 4L5GA 1EX4A 3TEEA 1AWJA 3UPUA 1W6XA 1G5VA 4M78B 3CCUA 3H0IA 2F69A 4KT0E 4C8QD 2RHUA 4JLGA 2ROTA 1OU8A 1VQ5Q 4NOYA 1M90C 4ZN3A 2LZ6B 3META 3VV0A 2HKQB 1TU0B 3M54A 4HCKA 2L3RA 2W10A 2P0PA 4A4HA 4B9XA 3C4SA 1X2KA 2L3QA 4BI3A 2GTJA 2YDLA 1NYGA 2AIRB 5FROA 8ATCB 1YIJA 4HVWA 2AHJB 3H0HA 3NTHA 2KT1A 4M75A 2EKOA 2EIFA 2KSSA 4MMLA 5I2MA 1GCPA 3N5BB 3M0UA 2CKKA 2CS7A 2QEXA 4QQ6A 2XDDA 4KH0B 1Z9QA 5GMKj 3X26B 3JCMW 1MMGA 2SRCA 4M78E 4HXJA 2IPOB 2YUQA 2FEIA 1EZZB 1PNJA 2RQTA 5A0LA 3FB9A 1G3WA 1ZX6A 3VJPA 2QEXT 1H3HA 1WDXA 2L3SA 2RHZA 1ZUUA 4QQDA 1YI2A 4WCIA 4RTWA 4C5EA 1D09B 3UT1A 4M75E 2DMOA 5IT9E 2K3BA 2JUFA 4XU1A 5GMKl 3OYIA 4BB7A 1BKBA 3E2UA 4F14A 2E70A 1WHHA 1XJWB 2X4WA 1QMCA 4J9EA 1BU1A 1OULA 1VQMA 1H8KA 2DTOA 1Y07A 1YIJQ 2LJ3A 4ESRA 1WJRA 1MUZA 1D1CA 1K76A 1Y7XA 2JJ9A 4MMKA 2AK5A 1H3ZA 3DKMA 3M53A 1JU5C 3NGPA 5IHIA 3TQ7P 4E7KA 1YN8A 2DL5A 3M4GA 1QKWA 3CC7Q 5LJ3j 2V1QA 2M51A 1VQ7A 4HCBA 4F7UA 3CCLA 4DOWA 3VUZA 2D1XA 2A0FB 2BZXA 1YBYA 2DRMA 4CC2A 2O31A 1BI2A 2O01E 3VU3C 3CC7A 1NLOC 3OMGA 3EGDB 5D7UA 3I55A 1V29B 4HVVA 3CCJQ 5GANd 2PZ1A 3G6EQ 3LWHA 3CBMA 2CUBA 4JPBW 4EMKB 4PFPA 1AWXA 3OYKA 4VUBA 1VQNT 5C6SA 2QQRA 3EG2A 2DLPA 2YRDA 2CP0A 4Z89A 1VQ4A 3EG0A 3RR6A 4PJOA 3OYAA 2FZKB 2K79A 2K57A 1YITT 2X9HA 3OYCA 2ZPGB 1R0BG 2EYYA 3CCJT 1W4SA 3QXEB 3WVDB 2KT8A 1K73U 2B8AA 3QWXX 4KGZB 2CDTA 3RDVA 5KYYA 4N4GA 5LJ5h 1X6OA 2LP5A 4BACA 2V8JA 2PTKA 3CC2Q 1TUGB 1UEBA 3REAB 3PTAA 4HCZA 2XDPA 4QKUA 2G3RA 1VQ9T 2SEMA 4EMKA 1U06A 2MMPA 3G71A 1SHGA 1Q81C 5KE2A 2K9GA 1I5LA 2HDAA 1D1BA 3D7SB 1TSFA 1ZSZB 2BZYA 2M1HA 2LQNA 1RI9A 3CPWA 1VQNQ 3CPFA 1UGSB 2JMAA 3CC4Q 5GMKm 1N27A 3JB9J 4OGEA 4XU3A 5GANh 1YIJT 1N6AA 3SHWA 2KGTA 4E7SA 3J80E 1YWPA 1KG1A 4K11A 2JZ2A 1X01A 2FPEA 1VQ9Q 5D6YA 1RAFB 3G71Q 2XHCA 1M27C 2KRSA 4JS4A 2OI3A 2KXDA 3M5AA 3VS3A 2E4HA 1UGQB 5I2SA 4PJJA 1QVGA 5CKHA 3QZ5B 1Q95G 3O5ZA 4F7UF 2E64A 2EJFA 2K3XA 2OX7A 2J05A 4J9GA 2QYZA 4FU6A 5ECAA 1KIKA 3QJ6A 1B7TA 2HAXA 2DF6A 4C5IA 3CPWP 1SHFA 4PJOE 3NHNA 2YT6A 4M7DC 3OS2A 1QCOA 5GAN2 4FYVB 1AT1B 4N4IA 1SRMA 1WI7A 4PJNA 3WVEB 2DETA 4BUGA 2J6FA 3OSSC 1D3BA 4ZGJB 3JB9G 3CBOA 4E7ZA 3RBBB 3QJYA 3I56T 3V8JA 3U23A 3MEAA 5LJ5d 1M5Q1 1WHJA 1PWTA 4LN2A 4HA8A 2H3EB 4ATOA 2DD4A 4HVUA 1WGSA 2LX9A 3OY9A 3S6WA 3LW5E 5FU6C 1M4ZA 1IHWA 5GJVB 3CCUT 2ZZDA 2KNBB 3A8OB 3ME9A 1WZOA 2JXBA 1PHTA 2CUDA 4Q5WA 3ZBDA 1BB9A 1C0MA 1OX8A 2CP7A 2OTJT 3JCMX 5FLXE 1I4K1 1ZBXA 5LJ3g 1RAEB 1IXDA 2J6OA 3PNWC 1CSKA 1KD1U 3C94A 3V7CA 2L3PA 1AVZC 1YJWQ 1KQ1A 1SG5A 4Y92A 2VASA 3JV3A 3G4SQ 4AFQC 1ZQ1A 5IXBA 1BIAA 3H41A 5GAOn 5FU7B 1JXMA 3HFNA 4FYXB 4JS5A 1Q86C 2EJ9A 7AT1B 1VQMQ 4CRIA 3KBGA 1HYOA 2K5IA 1K0XA 2O9SA 4LNPA 4PJOF 4R55A 2EYZA 2EAYA 3OSVA 4LUEA 2YXYA 2FRWA 2DK3A 1KJWA 4NL2A 4F7UB 2E6NA 4IUPA 3OYMA 3S3NA 2KYMA 1RAHB 4M78C 1PSEA 1RABB 4RG8A 2LCLA 1RI0A 2QGFB 2F2WA 1G3YA 3AHUA 2E12A 3BE3A 2V26A 1QP3A 2EQMA 2RNAA 2WSCE 2OTLA 3EAEA 2DXCA 5FU7C 3PGGA 3OYHA 2JTFA 2KRNA 3CD6A 4J9CA 5DM7R 2KR3A 1ZSZC 5CQYA 3VKIA 1YJ9Q 1M2VA 2P84A 4ZN1A 3ULRB 3OBWA 3TREA 2CSQA 5CK9A 2JS2A 2AKKA 4V2SA 4YTLA 1XTDA 1VYVA 4E7HA 3CC4T 5A0GA 1GCQA 2A7YA 4OMOA 2KY9A 1RAAB 2DXUA 4OB0B 3HTRA 1K73C 3FJ5A 3QUIA 1GBRA 2DPPB 4C8QG 4MDXA 5GAMj 3JCMQ 4XAXB 2F1LA 2E3HA 3E19A 3J81E 1VUBA 4C92E 2XG8D 2J06A 2KQWA 2Y4XA 3JCMc 1MGQA 1M90R 3GLXA 4C5HA 2K6DA 5IAYA 4OVAA 2X3XD 1Q86R 4M77E 2QEXQ 2QA4A 1NJIR 4L6V5 2HD0A 2DIGA 4RTXA 3LGFA 5EG2A 2R58A 2DXBA 4XQ3A 3BDUA 4AG1C 1WX6A 5CR2A 1S1NA 2RF0A 3QWYA 4IUVA 1HSQA 5FWCA 2A36A 4A54A 2RQUA 3CCST 3EG9B 4O6JA 4M7DA 3FDRA 4OGCA 3PE0A 2HBPA 4PK4A 4ZGDB 4Z8AA 9ATCB 2ED1A 2OJ2A 2IVWA 2MF2A 3OW2S 2G6FX 5I21A 1GL5A 2E65A 1WXBA 2M0OA 1VQ5T 5KCHA 1OZ3A 2P0QA 4M75C 2NUZA 4M77B 3M0TA 1C6VX 2COZA 5GMKh 2OTLQ 1K8AR 1U5SA 2ROLA 1S72A 1J3TA 3SB2A 1X75C 3VYGA 5C0MA 2FYKA 3VRYA 1KC8R 2QDYB 1NPRA 3CXCP 5LJ5f 2XK0A 2V8KA 3RUXA 1QKXA 3THKA 1QWEA 4NL3A 2NUTB 1YITQ 1S72T 1K8AU 4RCCA 3JCMd 1QWFA 2KI7A 3G6ET 3EFOA 1G3TA 4ORZA 2ATCB 3UF4A 4M75F 4QVDA 3JCMb 3CCVT 4BDYA 5LJ3f 3SDZA 4E47A 4C92D 4CC3A 3REBB 5KYYB 3C12A 1VQPT 2AZSA 1UJ0A 2LJ0A 4RKUE 2RQVA 2IIMA 1M9SA 2RK1A 3HP9A 1KK7A 4J83A 4ME7A 1P92A 4C0DC 1NG2A 2CH4W 2EPDA 4PJLA 3VS4A 1W2BS 2CZ0B 6AT1B 5LJ5j 1YNZA 2DO3A 5CKFA 2JM9A 3JCMe 2J7IA 2X3WD 3A8GB 1F1BB 4XTXA 4AG2C 3EFOB 3VS5A 1W2BA 2HKNA 2M0YA 2RO0A 1I0CA 1TXQA 4XTUA 2DM1A 1R0CB 1YHQQ 2EVRA 1PG5B 3HKSA 1VQ8Q 2GQIA 2QQSA 1VQ6A 2HSPA 4ELZC 3S3MA 1YP5A 4LUDA 1T3SA 2YSQA 4FW1A 1QVGP 2L8DA 4XTWA 3I56A 1UGPB 1VIFA 2YHTA 4C0DB 2XMFA 1SSFA 5L23A 1VQ6T 4C8QB 2EGEA 2D0NA 1LJOA 3ASKA 4Z02A 4LDXA 2QA4Q 3OS1A 1VQLT 3OYFA 3P8BB 2LNVA 1PKSA 2DKGA 1OYXA 4BY6C 1YJWA 4C0GA 3FC3A 2X35A 1JBMA 2DX1A 1FXXA 5KE3A 4KULA 5D6WA 2YLCA 1PD1A 4RTZA 1BK2A 3PIOA 1MMNA 1RACB 4IIOA 1XNIA 2MI6A 4F16A 3ZL7C 3SWNC 2MOXA 1QCFA 5GAOr 1M1KR 2WACA 2O88A 2KYBA 2EGCA 3CCLT 1ACMB 2ZPEB 3LH0A 2BKDN 2VYTA 1U1SA 1M30A 2A3LA 5GANg 1D1AA 3QG1A 4DBRA 3X20B 1WJSA 3KFVA 2CSIA 2XKOC 4WF2A 1X6GA 3G7ZA 5FWBA 2MWPA 3CMEA 2FG0A 3UATA 2JOYA 3GNGA 1W70A 1RLQC 2KDSA 2EBPA 3HSBA 2F2XA 3CEYA 2VB6A 2HMAA 3BY7A 1RL2A 1K1ZA 2LDMA 4PLLA 2HSEB 2CP3A 5IN1A 4F17A 4FW2A 1K9MC 4QQGA 3H9NA 1Q81U 3JCMV 1V76A 1WYXA 1JO8A 1Q82C 4RCBA 1N8RR 2LCCA 2GF7A 1Q82U 4KBMB 3NTKA 1GCQC 1YI2T 3G1JA 1K9MU 4C92G 1UDLA 2DZ9A 1VQ4Q 4ZNXA 3EHRA 3GPLA 2E1HA 2X4YA 5GAOp 3OB9A 4J9HA 1BIBA 1Q81R 4KGXB 1JEGA 1VYTA 1VQ9A 4RMOA 2YLBA 2LC4A 3OQ5A 1Y96A 2KAFA 2EGAA 3QDFA 1KQSA 1VQ8A 4C8QF 4KUDK 4D8KA 2CYZB 1OX9A 1LCKA 4AFZC 4AMCA 4CC7A 2PUOB 1M2VB 1FX7A 2EWNA 3INZA 4RTVA 1IZ6A 4BI4A 3CCSA 3M55A 2DL8A 1X69A 5GAOm 2JVVA 4O5VA 3DLLA 1VQPQ 1H641 4C92B 3I5RA 4N4HA 3SWNB 4Y28E 1AHJB 2JW4A 1AD5A 1JRIA 1I5OB 3I9QA 2DILA 2OTJQ 4C8QC 1MV3A 1U3OA 5HK0A 2PUKB 4B9WA 1M90U 1VQNA 1Y96B 3CMAA 5A0DA 2ZGWA 2GBQA 3EH2A 4M7AB 1GBQA 1PRLC 1WXTA 4OP0A 1KFZA 4FYWB 2OTJA 2EYWA 2HL3A 2ENMA 4HKEA 1YITA 4IKFA 4M75B 4EMHA 2GNCA 2VKNA 3I55Q 3CCJA 3H8ZA 3ER0A 2RH2A 4JJCA 2FVUA 2DBMA 2HL5C 2EQIA 4PFZA 2CZ7B 4C92C 2KROA 4M7AG 1MMAA 2R57A 1ZSGA 3VS0A 2M16A 4DBHA 1Z9ZA 1TH7A 4EDUA 5FRMA 5KYNA 4AT1B 1Y57A 2RI2A 4JRIA 2W0ZA 1JJ2S 1TUDA 4DA4A 3Q1JA 3OMCA 3G71T 2HQXA 3EG3A 3R6OA 3LH5A 1K73R 1K4US 1QLYA 2LT4A 2X4JA 4FSSA 2E5KA 2QK0A 2HZYA 3VYHB 1SF9A 3ZEHA 4XTVA 3RERA 3NTIA 3HRTA 2JMCA 2DE0X 3QHSA 1FMVA 2D6FA 1LOJA 1T0HA 2ZPIB 3LGLA 1N9RA 3X25B 5DY9A 2DTHA 2KXCA 4C92F 1B34B 3CCMQ 5CKEA 3L2QA 1IREB 5KYXB 1NLPC 2CH4A 3L2VA 2K2MA 1YHQA 2DTIA 1BBZA 2FL7A 5GAMg 3JCMg 1PKTA 2VV5A 4JZ3A 4A4EA 3CCLQ 3M56A 1WXUA 2EKHA 2KMTA 3T9NA 2VXFA 3C95A 4J9IA 2MK5A 3JB9F 4E2FB 2FHDA 4DQ2A 4A4FA 4FL6A 1NZ9A 1IHVA 1RLPC 5IHNA 4A4KA 1UHFA 2JT4A 4IUUA 3CCEQ 2DL3A 3RKYA 1S72Q 4MZMA 5LJ3e 3JB9H 3OYBA 1Y71A 1KQ2A 2QTVA 2HCKA 3DLMA 2H8HA 2MPXC 1D0XA 3CMAQ 3TSZA 4BD3A 1VQLQ 1TOVA 3GNFB 5I22A 2BTTA 1YJNT 1B3QA 4QVZA 3NFCA 4JJNK 4LD9K 3HHTB 1QVGS 2CT3A 1D0ZA 2RB6A 1AZGB 3M58A 4M7DB 1FYNA 5IH2A 2KRMA 4PJOB 4M7DG 1SKUB 2O2OA 1NM7A 1JQQA 3NMZC 4ZGEB 4JRQA 4XTZA 2DBKA 2DL7A 3MO8A 2YUPA 3L1AA 2NUTA 2AZVA 3EGUA 5GAN7 2YUOA 3M0PA 4B6MA 2OAUA 2DL4A 3VS7A 1ZHIA 2E6ZA 1OEBA 3OYJA 1OI1A 1M2OA 4FSXA 1QP2A 1VYUA 1XOVA 1EFNA 2P4RA 3M0QA 4RTUA 4J8OA 3M4YA 2MYSA 3EG9A 1UJYA 3CMEQ 2HBWA 1Y0MA 5GAN8 1WFWA 1UHCA 1JJ2A 2DVEA 4PJOD 3QYGB 3CMAT 3LYIA 1NJIC 3MPUB 1R77A 2KEAA 1M1KU 1QVFP 2FZCB 4OB1B 1RADB 4M77A 3GF5A 4BI8B 2QI2A 1LPLA 4OMFB 4C0FA 3PMIA 2X4XA 3HPWA 5GAN5 1OU9A 5CAIA 5HCKA 1VQOA 4RTYA 3A5ZB 3CCUQ 1I07A 1AWWA 5DLOA 2GFUA 1WHMA 4AFSC 5LL6S 4D6WA 1YI2Q 4MDWA 1OOTA 1VQ4T 3J7AF 3JB9I 3EH1A 3PVQA 3MP8A 1AOJA 5AT1B 4R56A 2RPNA 1ZLMA 1V1CA 3H0FA 3A98A 2FZGB 1GFDA 3CPWS 2QASA 5KYWB 1K8AC 1ABOA 1MNEA 2FPFA 3I5SA 2YRVA 1WQ7A 3F70A 3L42A 2QTXA 1KQSS 2KVQG 2RJEA 4M77D 1TS9A 2PVGB 4KH1B 5IXFA 3OW2P 1YJNQ 2XU8A 3GP8A 1BYMA 2DYIA 4E7IA 1HK9A 2KK4A 2GTOA 4M7DF 4DOVA 5CIUA 2BIVA 5CO7A 3VS6A 4LDVA 2C0TA 5CKBA 2HQEA 2DZCA 1VQ6Q 3JCMf 1QVPA 3AT1B 2EW3A 2GFAA 1G3SA 3L2WA 3IQLA 3EFSA 5CKDA 2P0KA 3CCVQ 1VQ8T 2RN8A 1VQKA 3G4SA 3MHXA 2DRKA 3E1SA 1QCNA 5J3BA 2VWFA 2JNGA 2YUNA 1I1JA 4QVCA 2JN0A 2PQWA 4QT7A 2DJQA 4KRTA 3UWNA 1VQKT 3G4ST 2V1RA 3FRNA 5GAMf 1YJ9T 2J6KA 2PVOB 4J6XA 1Q7YR 4C92A 5GANf 1KD1C 2R5MA 1OPKA 2AT1B 1IO6A 1ZA2B 2D8HA 5KYXA 1RUWA 4RG2A 1UG1A 1QQJA 2NWMA 3QYHB 3VUBA 2RJFA 2ZPFB 2B86A 2F5KA 3WXMB 1OV3A 5KYUB 1WQWA 3JCMh 5GAMh 3RESA 3OYLA 2LTOA 2I2LA 4CC4B 2QGGA 4XU2A 1PCXA 2QQBA 1QVFS 1K9MR 5GAN3 2LQ8A 2O9VA 4J6YA 1KC8U 2QQ9A 5KCOA 1N8RC 4ANJA 2ED0A 3OBYA 1ZUKA 1E7OA 1PRMC 1KHIA 1JXOA 1QVFA 3CQTA 3OW2A 3OYYA 2A37A 3JSCA 5FRNA 2L2PA 2LT1A 3PIPA 1JJ2P 4MZPA 2EYXA 1D3BB 2K4YA 4LXCA 2E3IA 4C8QE 2YRCA 3L2RA 3EFRA 4PJMA 1BCOA 5IHKA 2CP6A 1BI3A 2QAZA 1K9AA 2MAMA 4M4ZA 2LCSA 1VQLA 1T3LA 4M78A 1D0YA 2DXTA 4JDSA 5GAMe 3EGXB 3OYGA 4LE9A 5GANj 1W1FA 3SD4A 1PM3A 2FPDA 4LDWA 1IRXA 4IURA 1WHLA 1EIFA 4OMQA 3CMET 4J9FA 1VQPA 4PNOA 3URGA 3CCET 2ABLA 2LQWA 1X2QA 3OA6A 2NUPB 1TTHB 1YHQT 2BZ8A 2K5FA 2GCXA 4FT2A 2BUDA 3GOXA 3HL8A 4Y91A 1SSHA 2ESWA 4MZTA 5GJWB 1M1FA 4LDUA 3RIRA 4ZTJA 3QZ9B 4FM4B 4NS5A 1UTIA 1YCYA 4PJOC 2L0AA 5GANe 3OS0A 2EYQA 3DB4A 1Q7YC 2E41A 4J9DA 3CC2A 1UB4A 4ELYC 4EMGA 4PFOA 3TSWA 3SFMA 4M75D 2RI3A 2XICA 1PSFA 2RHXA 1M3AA 1UE9A 2L89A 2ZAEA 4KUIA 2LQKA 1R8OB 4FYYB 1WLPB 4M7AE 3MKDA 1UECA 2FO0A 4P5NA 4M78F 2MWOA 4BE2A 3M0SA 2BE7D 3RMQA 2MIOA 4C8QA 3UA6A 2DIQA 1PD0A 3TCJA 1PC0A 1YFNA 2CP2A 2CP5A 1HD3A 4EIKA 1X27A 2COWA 2H3JA 2RD1A 1AWOA 2VXEA 5LJ5e 4XK8E 4L59A 3E9GA 4LD6A 1C1AA 4JRPA 2HQHA 2QA4T 4M7AD 4E7LA 3SWNA 2RA2A 2IG0A 1ZUYA 4HT8A 2AKLA 4HCCA 3CCSQ 2NLUA 3QPHA 4OMLA 1NPPA 5CCAA 1AEYA 2D0QB 4J7FA 4OF1A 2WSEE 2GQVA 4M7DD 1KHCA 2VGMA 3TVTA 2JTMA 2DYBA 2CZ6B 3CC7T 3MP1A 1TUCA 3M57A 3MP6A 3O8VA 2CZ1B 1XQHA 2XDBA 2C0OA 1U1TA 1X6BA 4FIBA 1K0SA 3CXCA 4BY6B 4X34A 1ZA1B 5HKCA 2D8JA 1M3BA 3RNJA 4OMNA 1MMDA 1T0JA 4M7AA 2RQRA 2EQJA 2A28A 3VS1A 2ZCFB 3QDRB 4N0AC 1B07A 4IUQA 5LJ3d 3CCQA 1KSWA 2GGRA 5GMKe 2KE9A 4D8DA 2PU9B 4E7JA 3CBPA 2RM4A 5GMKi 4WTOB 2C06A 2DAQA 3M59A 2Z0WA 2ECZA 4KGVB 4II1A 2D9TA 3P8DA 4J6WA 3I35A 4JLIA
chains in the Genus database with same CATH topology
1LNXA 4JRQA 4ZGEB 1VIEA 3BDLA 3M4GA 2RI5A 2RHYA 4XTZA 5LJ3j 3JCMb 4M75F 4QVDA 3CCVT 3MO8A 5FU6B 1VQ7A 4BDYA 4A4GA 3L1AA 5D6XA 4HCBA 4F7UA 1BI0A 5LJ3f 3JCMJ 3CCLA 4DOWA 3MEWA 5GAN7 3VUZA 1Q7YU 3SDZA 5HK3A 4E47A 4C92D 2HNIA 2OAUA 1I81A 1O9SA 1ZHIA 1YBYA 2CGHA 2E6ZA 3C12A 3OYJA 1OI1A 4FSXA 3PFSA 4OB2B 1QP2A 1VQPT 1XOVA 1BI2A 2O01E 3VU3C 3CC7A 1BI1A 4EPCA 3CCEA 4J8OA 3M4YA 3LX7A 3OMGA 4M75G 4GY5A 4RKUE 3I55A 1V29B 2VC8A 1B34A 5GANd 3LWHA 3DB3A 1M9SA 1NE8A 2RK1A 3CBMA 3HP9A 3LLRA 5LJ3h 4ME7A 4J5YA 4J83A 4EMKB 1YJ9A 1P92A 5GAN8 4C0DC 1O75A 1JJ2A 3OYKA 4VUBA 1VQNT 2DVEA 3A8HB 4PJOD 5C6SA 3HRUA 3QYGB 1W2BS 1Q82U 3QBYA 4IUTA 2CZ0B 2QQRA 3CMAT 3LYIA 1NJIC 5LJ5j 3UDCA 4J7IA 1M1KU 2DO3A 5CKFA 4OB1B 4LDYA 4M77A 3CCMT 3GF5A 3JCMe 4BI8B 1VQ4A 3A8GB 2QI2A 1VQPA 4OMFB 4C0FA 4IKFA 4XTXA 4PJOA 3PMIA 5J26A 2R5AA 3V7RA 3OYAA 2K57A 1W2BA 4M77C 2X4XA 3HPWA 5GAN5 2O4XB 2RO0A 5CAIA 1VQOA 3RMSA 1YITT 3A5ZB 4XTUA 4F7UE 3OYCA 2ZPGB 1WJQA 2WSFE 3MEVA 2GFUA 5DLOA 3CCJT 5CQXA 1W4SA 2EJGA 1NJIU 5LL6S 3CCRT 3QXEB 4D6WA 3FLGA 2K2VA 3WVDB 1M1GA 1K73U 1UGRB 2B8AA 3L2UA 3CCMA 4MDWA 3HKSA 2PVDB 4N4GA 1VQ4T 5LJ5h 1X6OA 3J7AF 3JB9I 2P4TA 2QQSA 3FEOA 2RJCA 3PMTA 3MP8A 2V8JA 4ELZC 4CI0C 3JAME 4BACA 3S3MA 2E10A 2DJZA 1UEBA 2ZPBB 4R56A 3PTAA 4HCZA 5DLQE 2K3YA 4X9CA 2XDPA 3A8LB 2DEQA 3H6ZA 2L8DA 2G3RA 1VQ9T 4XTWA 3I56A 4UC4A 1UGPB 3JB9D 2FB7A 3CPWS 4EMKA 1VIFA 2MMPA 3G71A 1U8RA 2YHTA 1Q81C 5KE2A 4C0DB 4C5GA 2EQUA 1YJWT 1SSFA 1K8AC 1I5LA 1VQ7T 4JRKA 1VQ6T 2YRVA 1OZ2A 4M77F 4C8QB 3QSUA 1WQ7A 3F70A 3L42A 1LJOA 2M1HA 2QTXA 1KQSS 3QO3A 2KVQG 2RHIA 3ASKA 2RJEA 4Z02A 5J39A 4M77D 3CPWA 4LDXA 3CPFA 1UGSB 3P8HA 1VQMT 3OS1A 1VQLT 3OYFA 3P8BB 2LNVA 2PVGB 2L5QA 1N27A 5GMKm 3JB9J 4OGEA 2DKGA 4XU3A 5GANh 1OYXA 4BY6C 1N6AA 2XU8A 3GP8A 1YIJT 1BYMA 1YJWA 4C0GA 3FC3A 4E7IA 2X35A 1JBMA 5LJ5g 1HK9A 2KK4A 3J80E 1KG1A 1FXXA 5KE3A 2JZ2A 4M7DF 1X01A 4KULA 4DOVA 5D6YA 5CIUA 5D6WA 1WNLA 2BIVA 4X9DA 2YLCA 5CO7A 3PIOA 2XHCA 4M78D 2EQKA 3M9QA 4LDVA 1XNIA 1M1KC 5CKBA 4JS4A 2MI6A 2HQEA 2F5TX 2DZCA 2VUBA 3JCMf 1QVPA 3M5AA 1M8VA 2M9UA 3SWNC 2GFAA 1G3SA 1UGQB 5I2SA 3L2WA 5GAOr 3EFSA 5CKDA 2P0KA 1QVGA 5CKHA 1VQ8T 3BFMA 3QZ5B 1FWZA 2WACA 3CCLT 1VQKA 5HY6A 2E64A 2EJFA 4F7UF 3G4SA 2K3XA 1VQOT 2ZPEB 3LH0A 3MHXA 4FU6A 2BKDN 4QW2A 2VYTA 1U1SA 3QJ6A 4C0ZA 5A2QE 3E1SA 2HAXA 5J3BA 3OS5A 4C5IA 2A3LA 3V8LA 5GANg 4M77G 2JNGA 4PJOE 3RKXA 4QVCA 2JN0A 5CVIA 4M7DC 2PQWA 5AYFA 3OS2A 3QG1A 4ZTFA 3X20B 2XIDA 3UWNA 3LWIA 5GAN2 1WJSA 3KUFA 3X28B 2QXFA 3G4ST 3FIFA 1VQKT 2XKOC 3FRNA 4N4IA 4TVRA 5GAMf 4WF2A 1YJ9T 2PVOB 3BW1A 3WVEB 2Y90A 4BUGA 4J6XA 3OSSC 1D3BA 1I8FA 4ZGJB 3JB9G 4C92A 3CBOA 3G7ZA 5GANf 2R5MA 1KD1C 3CCQT 2MWPA 3CMEA 3KXTA 2JOYA 3QJYA 4RG2A 3GNGA 3I56T 3V8JA 3MEAA 3QYHB 5LJ5d 3VUBA 2KDSA 2LVMA 1M5Q1 2RJFA 2ZPFB 3HSBA 3GIBA 3CEYA 2F5KA 3JRZA 3WXMB 3BY7A 4HA8A 1WPYA 1RL2A 4ATOA 2LDMA 2DD4A 4PLLA 1HXDA 1WGSA 2LX9A 2XI9A 5IN1A 3OY9A 4GLKA 1WQWA 3S6WA 3JCMh 4QQGA 5GAMh 3LW5E 5FU6C 3RESA 3JCMV 2RK2A 1Q81U 1M4ZA 4XU0A 5GAOl 1Q82C 3CCUT 2ZZDA 4RCBA 3OYLA 3A8OB 3ME9A 4F7UG 2LTOA 2I2LA 2LCCA 1QW1A 2GF7A 4Q5WA 4XU2A 2QQBA 3ZBDA 3S3OA 4KBMB 3NTKA 1YI2T 3V8KA 2OTLT 1QVFS 5GAN3 3CCVA 1K9MU 4C92G 2OTJT 2DZ9A 2LQ8A 4J6YA 3TU4K 1KC8U 3JCMX 4PLIA 5FLXE 1I4K1 2RJDA 3CD6T 3GPLA 2QQ9A 1ZBXA 2E1HA 5KCOA 1N8RC 3CC2T 3PT9A 4XTYA 1N8RU 2X4YA 3A8MB 3OBYA 5LJ3g 3OYDA 5GAOp 3OB9A 1DJ7B 1BIBA 1KHIA 3FJPA 1QVFA 1GXIE 3PNWC 3OW2A 3OYYA 4JLIA 1VQ9A 2Y4YA 3JSCA 4RMOA 5FRNA 2YLBA 1KD1U 2LC4A 2LT1A 3C94A 3V7CA 4PJOG 3PIPA 3QKJA 1YJNA 3OQ5A 3HRSA 4MZPA 1Y96A 5GAN6 4PKCC 1KQ1A 2KAFA 1D3BB 2K4YA 1KQSA 1VQ8A 3CC4A 4C8QE 4C8QF 2LRQA 4EMKC 5L8RE 4KUDK 3L2RA 4BE0A 1ZQ1A 3EFRA 1BIAA 4A53A 5GAOn 2CYZB 1BI3A 4FT4A 4JUVA 2MAMA 3HFNA 5FU7B 5GAN4 4JS5A 1Q86C 2EJ9A 1VQLA 4M78A 4CRIA 2PUOB 4M7AF 3KBGA 3L2ZA 3QIIA 5KH6A 2DXTA 2K5IA 4JDSA 4M78G 5GAMe 2ZPHB 2O4XA 2EWNA 1FX7A 3INZA 1IZ6A 3OYGA 4PJOF 4BI4A 4R55A 3HFOA 3CCSA 3M55A 5GANj 3SD4A 5GAOm 2EAYA 2JVVA 3OSVA 4O5VA 3DLLA 1H641 4LDWA 4C92B 4N4HA 4IURA 3MCAB 1MHNA 2EFIA 1EIFA 2DK3A 3SWNB 3OYEA 4Y28E 3RKWA 3CMET 1AHJB 3CXCS 3CCRA 4OB3B 4NL2A 1JRIA 4PNOA 4F7UB 1N9SA 2E6NA 4IUPA 3ZFJA 5M9OA 3OYMA 1Q86U 3URGA 3CCET 4C92F 4HT9A 4M7DE 2E5QA 3S3NA 1JB0E 4C8QC 3I55T 4M78C 3OA6A 2XD0A 1PSEA 4N0AA 1YHQT 5HK0A 2K5FA 2GCXA 2PUKB 4FT2A 3JCMP 4RG8A 4B9WA 2BUDA 3GOXA 2LCLA 1RI0A 3HL8A 1M90U 4Y91A 5GAOq 2V8IA 1VQNA 4BE1A 1Y96B 1G3YA 3CMAA 3AHUA 2E12A 4MZTA 5A0DA 2QQAA 2ZGWA 4M7AC 4M7AB 1QP3A 1M1FA 4LDUA 2EQMA 2K5LA 3RIRA 4ZTJA 3QZ9B 4FM4B 4OP0A 2WSCE 2OTLA 3EAEA 2DXCA 4NS5A 1YCYA 3OYNA 2OTJA 4PJOC 5FU7C 2DD5A 3PGGA 2JTFA 5GANe 3OS0A 2EYQA 3DB4A 3OYHA 2E41A 1Q7YC 3CD6A 5DM7R 4HKEA 5CQYA 1UB4A 3VKIA 1KC8C 4ELYC 3CC2A 4EMGA 5GAMd 1YITA 2VGNA 3SFMA 4M75D 2RI3A 4M75B 4PL6A 3V7SA 2XICA 3OBWA 4EMHA 4ZN1A 3TREA 3CCJA 1PSFA 3E9FA 3H8ZA 3ER0A 2RH2A 2RHXA 4KUIA 2FVUA 2L89A 3MEUA 3X24B 2LQKA 5CK9A 3G6EA 4BDZA 4V2SA 1R8OB 4M7AE 4YTLA 1VQ5A 1XTDA 4L5GA 4BE2A 4P5NA 4M78F 2MWOA 4C92C 2CZ7B 3TEEA 4E7HA 3UPUA 3RMQA 3CC4T 4M7AG 4C8QA 5A0GA 2A7YA 2DIQA 2KY9A 2R57A 1G5VA 2M16A 3TCJA 2DXUA 4OB0B 1TH7A 4EDUA 5FRMA 4M78B 3CCUA 1K73C 3QUIA 2RI2A 4JRIA 2H3JA 1JJ2S 2DPPB 2RD1A 4C8QG 4DA4A 4MDXA 2F69A 5GAMj 3Q1JA 2VXEA 4KT0E 2RHUA 3OMCA 4JLGA 4XAXB 4C8QD 5LJ5e 3JCMQ 3G71T 4XK8E 2HQXA 4NOYA 4L59A 3R6OA 1M90C 3E9GA 4LD6A 3E19A 4ZN3A 4JRPA 3META 3J81E 1VUBA 3VV0A 4C92E 2LT4A 2XG8D 2KQWA 2QA4T 2X4JA 3M54A 2Y4XA 3VYHB 3ZEHA 2L3RA 4XTVA 4M7AD 4E7LA 3JCMc 3SWNA 1MGQA 2RA2A 2P0PA 4A4HA 4B9XA 2IG0A 3C4SA 3NTIA 3HRTA 3RERA 4HT8A 3QHSA 4BI3A 3GLXA 4HCCA 2D6FA 1LOJA 4C5HA 2ZPIB 5FROA 1YIJA 3LGLA 1N9RA 3X25B 2AHJB 2DTHA 2NLUA 3QPHA 5DY9A 3NTHA 1B34B 4OVAA 5IAYA 4M75A 5CKEA 2EKOA 2EIFA 3L2QA 1IREB 4M77E 2QA4A 1NPPA 5CCAA 3L2VA 4L6V5 2KSSA 1YHQA 2HD0A 2DTIA 2DIGA 2FL7A 4MMLA 2D0QB 3LGFA 4J7FA 4OF1A 5GAMg 3JCMg 5I2MA 5EG2A 3N5BB 2WSEE 2CKKA 2GQVA 2CS7A 2R58A 2VV5A 4M7DD 2DXBA 4A4EA 4XQ3A 3BDUA 2QEXA 1KHCA 2VGMA 4QQ6A 2XDDA 2JTMA 5CR2A 2CZ6B 3M56A 3CC7T 5GMKj 4IUVA 3X26B 3JCMW 3MP1A 4M78E 2KMTA 4A54A 3M57A 3T9NA 2VXFA 3C95A 3MP6A 3CCST 2CZ1B 1XQHA 4O6JA 2XDBA 4M7DA 1U1TA 3FDRA 3JB9F 2FHDA 4OGCA 4FIBA 5A0LA 3CXCA 4BY6B 4ZGDB 2HBPA 4X34A 3FB9A 1G3WA 3VJPA 4FL6A 4A4FA 4DQ2A 2QEXT 1NZ9A 5HKCA 2RHZA 2IVWA 2MF2A 3OW2S 4A4KA 5I21A 4QQDA 2E65A 2M0OA 4IUUA 1YI2A 5KCHA 1VQ5T 4M7AA 3RKYA 3JB9H 4MZMA 5LJ3e 1OZ3A 4C5EA 1Y71A 2P0QA 4M75C 3UT1A 4M75E 3OYBA 1VQ6A 5IT9E 4M77B 2JUFA 4XU1A 2EQJA 5GMKl 1KQ2A 5GMKh 3OYIA 4BB7A 2ZCFB 3QDRB 3DLMA 1BKBA 4N0AC 4IUQA 2E70A 1S72A 2X4WA 5LJ3d 3CCQA 4BD3A 1VQMA 3SB2A 3GNFB 2DTOA 1X75C 1Y07A 3VYGA 5GMKe 5C0MA 2FYKA 1YJNT 2QDYB 2PU9B 1NPRA 1WJRA 5LJ5f 3CBPA 2RM4A 5GMKi 4E7JA 2XK0A 2V8KA 4QVZA 3RUXA 1Y7XA 3NFCA 2C06A 2DAQA 4MMKA 4JJNK 4LD9K 3HHTB 1QVGS 3M59A 1H3ZA 4NL3A 1K9MC 3DKMA 3M53A 2RB6A 4II1A 1S72T 1K8AU 3M58A 4RCCA 3JCMd 4M7DB 2D9TA 3P8DA 4E7KA 4J6WA 4PJOB 3G6ET 4M7DG 3O8VA 1G3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNX A;  2VXE A;  3V7C A;  2DKG A;  4PJO G;  4C8Q D;  4XU3 A;  3M4G A;  5LJ5 e;  3JCM Q;  5GAN h;  4XTZ A;  4NOY A;  5LJ3 j;  3JCM b;  4M75 F;  4QVD A;  1JBM A;  1Y96 A;  5GAN 6;  1KQ1 A;  1HK9 A;  1D3B B;  5LJ5 g;  4M7D F;  4C8Q E;  4C92 E;  3L1A A;  4C8Q F;  4EMK C;  1X01 A;  4F7U A;  5LJ3 f;  3JCM J;  5GAN 7;  1WNL A;  3EFR A;  4X9D A;  2YLC A;  1BIA A;  4XTV A;  4A53 A;  5GAO n;  4M7A D;  3JCM c;  4C8Q G;  4JUV A;  4M78 D;  1MGQ A;  2RA2 A;  3HFN A;  3SWN A;  2HNI A;  4C92 D;  5GAN 4;  3RER A;  1I81 A;  2EJ9 A;  2DZC A;  5GAM j;  4HT8 A;  2CGH A;  4M78 A;  3QHS A;  3JCM f;  1LOJ A;  1M8V A;  3SWN C;  4M7A F;  3L2Z A;  1N9R A;  4C92 F;  5DY9 A;  2DTH A;  2DXT A;  4M78 G;  3VU3 C;  5GAO r;  3EFS A;  1B34 B;  5GAM e;  4M75 A;  3BFM A;  4M75 G;  2EWN A;  3INZ A;  2VC8 A;  4M77 E;  1B34 A;  4PJO F;  5GAN d;  3HFO A;  5GAN j;  4F7U F;  2E64 A;  2EJF A;  5LJ3 h;  2DTI A;  2EAY A;  4MML A;  4J5Y A;  5GAO m;  4EMK B;  5GAN 8;  1H64 1;  4C92 B;  4M7D G;  5GAM g;  3JCM g;  1U1S A;  2DVE A;  4PJO D;  3SWN B;  4M7D D;  4XQ3 A;  3BDU A;  3RKW A;  5LJ5 j;  3V8L A;  4NL2 A;  1JRI A;  4M77 G;  4PNO A;  1N9S A;  4J6W A;  4F7U B;  5GAN g;  4PJO E;  3RKX A;  5GMK j;  4QVC A;  3JCM W;  2JN0 A;  4HT9 A;  4M7D E;  4M77 A;  4M7D C;  3JCM e;  4C8Q C;  4M78 E;  4M78 C;  4A54 A;  4N0A A;  2VXF A;  4XTX A;  5GAN 2;  4PJO A;  3V7R A;  3JCM P;  3FIF A;  2K57 A;  4M77 C;  1U1T A;  5GAM f;  3JB9 F;  5GAN 5;  4WF2 A;  5CAI A;  4M7D A;  3BW1 A;  4Y91 A;  5GAO q;  2Y90 A;  4J6X A;  4XTU A;  4F7U E;  1Y96 B;  1D3B A;  1I8F A;  3JB9 G;  4C92 A;  5GAN f;  3FB9 A;  4DQ2 A;  3AHU A;  2EJG A;  4M7A C;  2ZGW A;  4M7A B;  3RIR A;  5I21 A;  3V8J A;  4OP0 A;  5LJ5 d;  2E65 A;  4M7A A;  1M5Q 1;  3HSB A;  3RKY A;  1YCY A;  5LJ3 e;  3GIB A;  3JB9 H;  4PJO C;  3PGG A;  4M75 C;  5GAN e;  5LJ5 h;  4M75 E;  2E41 A;  3BY7 A;  4M77 B;  3JB9 I;  4XU1 A;  4HA8 A;  1WPY A;  5GMK l;  1KQ2 A;  5GMK h;  1HXD A;  2E10 A;  2DJZ A;  1WQW A;  3JCM h;  4EMG A;  5GAM h;  5GAM d;  3RES A;  3JCM V;  4M75 D;  3V7S A;  4M75 B;  4N0A C;  4XU0 A;  4X9C A;  4EMH A;  5GAO l;  4RCB A;  5LJ3 d;  4F7U G;  2DEQ A;  3SB2 A;  2I2L A;  2DTO A;  5GMK e;  4XTW A;  4V2S A;  2FYK A;  3JB9 D;  4M7A E;  2FB7 A;  4XU2 A;  4EMK A;  3V8K A;  2YHT A;  4M78 F;  5LJ5 f;  5GAN 3;  2RM4 A;  4C92 C;  4C92 G;  5GMK i;  2DZ9 A;  1I5L A;  4J6Y A;  3RUX A;  4M7A G;  3JCM X;  4JRK A;  1I4K 1;  4MMK A;  4C8Q B;  4C8Q A;  4M77 F;  3QSU A;  2E1H A;  1WQ7 A;  4NL3 A;  4XTY A;  1LJO A;  2QTX A;  5LJ3 g;  2DXU A;  2RB6 A;  5GAO p;  3QO3 A;  1TH7 A;  1BIB A;  3FJP A;  4M78 B;  4M77 D;  4RCC A;  3QUI A;  3JCM d;  4M7D B;  4JRI A;  4JLI A;  2RD1 A;  4PJO B;  5GMK m;  3JB9 J;  2YLB A; 
#chains in the Genus database with same CATH topology
 1LNX A;  1VIE A;  3BDL A;  4X1V A;  2RI5 A;  2RHY A;  2LJ1 A;  3EHQ A;  1WHK A;  5FU6 B;  4A4G A;  2LX7 A;  5D6X A;  3NPF A;  2BE9 B;  1BI0 A;  3JCM J;  2K7A A;  4GLM A;  2DER A;  3MEW A;  1VQO Q;  2JM8 A;  1Q7Y U;  5HK3 A;  2HNI A;  5FW9 A;  1I81 A;  1O9S A;  2CGH A;  3PVL A;  4OB2 B;  3PFS A;  1BI1 A;  4EPC A;  3CCE A;  3LX7 A;  4M75 G;  4GY5 A;  2VC8 A;  1B34 A;  1IGQ A;  3DB3 A;  1NE8 A;  3LLR A;  5LJ3 h;  4J5Y A;  1YJ9 A;  1UUE A;  1O75 A;  3A8H B;  3HRU A;  3QBY A;  4IUT A;  3UDC A;  1ARK A;  4J7I A;  1MND A;  3CCM T;  4LDY A;  2RQW A;  1A0N B;  1TWB A;  5J26 A;  2R5A A;  3EG1 A;  3V7R A;  4M77 C;  2O4X B;  3RMS A;  4F7U E;  2DFU A;  1WJQ A;  2WSF E;  3MEV A;  1VQ7 Q;  5CQX A;  3M0R A;  2EJG A;  1OPL A;  2NYS A;  3CCR T;  3FLG A;  2K2V A;  3VS2 A;  1M1G A;  2DEU A;  1UGR B;  3L2U A;  3CCM A;  2QDL A;  1IB8 A;  2PVD B;  1LVK A;  4RUG A;  5KYW A;  2P4T A;  3PMT A;  3FEO A;  2RJC A;  4CI0 C;  2FRY A;  3JAM E;  2E10 A;  4JZ4 A;  2OAW A;  2DJZ A;  2ZPB B;  8AT1 B;  2HEQ A;  2K3Y A;  5DLQ E;  4X9C A;  3A8L B;  2DEQ A;  3H6Z A;  3SEM A;  1VOM A;  1NYF A;  1MV0 B;  4UC4 A;  3JB9 D;  2FB7 A;  2LNH B;  1U8R A;  1YJW T;  4C5G A;  2EQU A;  4DBF A;  1VQ7 T;  4JRK A;  1OZ2 A;  4M77 F;  3QSU A;  4GBQ A;  4JJD A;  1BCM A;  5I11 A;  3QO3 A;  1KQS P;  1FMW A;  2RHI A;  2F2V A;  5J39 A;  3CCQ Q;  3P8H A;  1VQM T;  3UA7 A;  1M3C A;  2L5Q A;  1NEG A;  2JTE A;  1ABQ A;  4FCY A;  5LJ5 g;  1WHG A;  2A08 A;  2CT4 A;  1CKA A;  1WNL A;  4X9D A;  4M78 D;  2EQK A;  3M9Q A;  2X51 A;  1M1K C;  2F5T X;  2PNI A;  2VUB A;  1M8V A;  2M9U A;  4OMM A;  1SRL A;  3BFM A;  1FWZ A;  5HY6 A;  2C0I A;  1N5Z A;  1VQO T;  1G2B A;  1M8M A;  4QW2 A;  1G8X A;  1SPK A;  4RTT A;  1GRI A;  1X43 A;  2MCN A;  4C0Z A;  5A2Q E;  4R0K A;  2QG9 B;  3OS5 A;  1CKB A;  3V8L A;  2DNU A;  4M77 G;  3MJX A;  3RKX A;  4DEX A;  5CVI A;  2LMJ A;  4ZTF A;  1UFF A;  5AYF A;  1NBE B;  2I0N A;  2COY A;  2XID A;  3LWI A;  3KUF A;  3X28 B;  2QXF A;  3FIF A;  4TVR A;  5KYU A;  2KBT A;  3BW1 A;  4DBQ A;  2Y90 A;  2RMO A;  1I8F A;  4DEY A;  4Z88 A;  3CCQ T;  3CD6 Q;  4JJB A;  1YCS B;  3A1P A;  3KXT A;  1OQK A;  2LVM A;  1RAG B;  1ZSZ A;  3GIB A;  4IIM A;  3JRZ A;  1KD1 R;  1WPY A;  1HXD A;  2XI9 A;  4GLK A;  2RK2 A;  4XU0 A;  5GAO l;  4F7U G;  1E6G A;  1YWO A;  1VQK Q;  1QW1 A;  1WIE A;  3S3O A;  2OTL T;  3V8K A;  3CCV A;  3TU4 K;  1W2B P;  1Q82 R;  4PLI A;  3CD6 T;  2RJD A;  3R6N A;  3CC2 T;  3PT9 A;  4XTY A;  3I56 Q;  1N8R U;  1AZE A;  3A8M B;  3OYD A;  5EC7 A;  1DJ7 B;  3FJP A;  1ZBJ A;  1GXI E;  2DVJ A;  3C0C A;  2Y4Y A;  1YJN A;  4PJO G;  3QKJ A;  3HRS A;  1FMK A;  1VA7 A;  5GAN 6;  4PKC C;  3CC4 A;  1GFC A;  2LRQ A;  1IGU A;  5L8R E;  4EMK C;  3VRZ A;  4BE0 A;  2CRE A;  4A53 A;  4FT4 A;  4JUV A;  5GAN 4;  1TG0 A;  4M7A F;  3L2Z A;  3QII A;  5KH6 A;  4M78 G;  2ZPH B;  2O4X A;  3EGD A;  1UGV A;  2NUP A;  3HFO A;  2JS0 A;  4AFU C;  3MCA B;  1MHN A;  2DA9 A;  2EFI A;  3OYE A;  3RKW A;  1E6H A;  1HJD A;  3CXC S;  3CCR A;  4OB3 B;  3GBQ A;  1NJI U;  1N9S A;  5M9O A;  3ZFJ A;  1Q86 U;  4HT9 A;  4M7D E;  1NEB A;  2E5Q A;  1JB0 E;  3I55 T;  4OMP A;  2XD0 A;  4N0A A;  3JCM P;  4J9B A;  2VVK A;  1G83 A;  5GAO q;  1SEM A;  2V8I A;  1H92 A;  4BE1 A;  1RAI B;  2YWW A;  4M7A C;  2QQA A;  2K5L A;  4A63 B;  4E6R A;  3OYN A;  2DD5 A;  4F04 B;  3CCR Q;  1KC8 C;  2M02 A;  3EGX A;  5GAM d;  2VGN A;  3V7S A;  4PL6 A;  3E9F A;  3MEU A;  3X24 B;  3G6E A;  4BDZ A;  1VQ5 A;  1WA7 A;  4L5G A;  1EX4 A;  3TEE A;  1AWJ A;  3UPU A;  1W6X A;  1G5V A;  4M78 B;  3CCU A;  3H0I A;  2F69 A;  4KT0 E;  4C8Q D;  2RHU A;  4JLG A;  2ROT A;  1OU8 A;  1VQ5 Q;  4NOY A;  1M90 C;  4ZN3 A;  2LZ6 B;  3MET A;  3VV0 A;  2HKQ B;  1TU0 B;  3M54 A;  4HCK A;  2L3R A;  2W10 A;  2P0P A;  4A4H A;  4B9X A;  3C4S A;  1X2K A;  2L3Q A;  4BI3 A;  2GTJ A;  2YDL A;  1NYG A;  2AIR B;  5FRO A;  8ATC B;  1YIJ A;  4HVW A;  2AHJ B;  3H0H A;  3NTH A;  2KT1 A;  4M75 A;  2EKO A;  2EIF A;  2KSS A;  4MML A;  5I2M A;  1GCP A;  3N5B B;  3M0U A;  2CKK A;  2CS7 A;  2QEX A;  4QQ6 A;  2XDD A;  4KH0 B;  1Z9Q A;  5GMK j;  3X26 B;  3JCM W;  1MMG A;  2SRC A;  4M78 E;  4HXJ A;  2IPO B;  2YUQ A;  2FEI A;  1EZZ B;  1PNJ A;  2RQT A;  5A0L A;  3FB9 A;  1G3W A;  1ZX6 A;  3VJP A;  2QEX T;  1H3H A;  1WDX A;  2L3S A;  2RHZ A;  1ZUU A;  4QQD A;  1YI2 A;  4WCI A;  4RTW A;  4C5E A;  1D09 B;  3UT1 A;  4M75 E;  2DMO A;  5IT9 E;  2K3B A;  2JUF A;  4XU1 A;  5GMK l;  3OYI A;  4BB7 A;  1BKB A;  3E2U A;  4F14 A;  2E70 A;  1WHH A;  1XJW B;  2X4W A;  1QMC A;  4J9E A;  1BU1 A;  1OUL A;  1VQM A;  1H8K A;  2DTO A;  1Y07 A;  1YIJ Q;  2LJ3 A;  4ESR A;  1WJR A;  1MUZ A;  1D1C A;  1K76 A;  1Y7X A;  2JJ9 A;  4MMK A;  2AK5 A;  1H3Z A;  3DKM A;  3M53 A;  1JU5 C;  3NGP A;  5IHI A;  3TQ7 P;  4E7K A;  1YN8 A;  2DL5 A;  3M4G A;  1QKW A;  3CC7 Q;  5LJ3 j;  2V1Q A;  2M51 A;  1VQ7 A;  4HCB A;  4F7U A;  3CCL A;  4DOW A;  3VUZ A;  2D1X A;  2A0F B;  2BZX A;  1YBY A;  2DRM A;  4CC2 A;  2O31 A;  1BI2 A;  2O01 E;  3VU3 C;  3CC7 A;  1NLO C;  3OMG A;  3EGD B;  5D7U A;  3I55 A;  1V29 B;  4HVV A;  3CCJ Q;  5GAN d;  2PZ1 A;  3G6E Q;  3LWH A;  3CBM A;  2CUB A;  4JPB W;  4EMK B;  4PFP A;  1AWX A;  3OYK A;  4VUB A;  1VQN T;  5C6S A;  2QQR A;  3EG2 A;  2DLP A;  2YRD A;  2CP0 A;  4Z89 A;  1VQ4 A;  3EG0 A;  3RR6 A;  4PJO A;  3OYA A;  2FZK B;  2K79 A;  2K57 A;  1YIT T;  2X9H A;  3OYC A;  2ZPG B;  1R0B G;  2EYY A;  3CCJ T;  1W4S A;  3QXE B;  3WVD B;  2KT8 A;  1K73 U;  2B8A A;  3QWX X;  4KGZ B;  2CDT A;  3RDV A;  5KYY A;  4N4G A;  5LJ5 h;  1X6O A;  2LP5 A;  4BAC A;  2V8J A;  2PTK A;  3CC2 Q;  1TUG B;  1UEB A;  3REA B;  3PTA A;  4HCZ A;  2XDP A;  4QKU A;  2G3R A;  1VQ9 T;  2SEM A;  4EMK A;  1U06 A;  2MMP A;  3G71 A;  1SHG A;  1Q81 C;  5KE2 A;  2K9G A;  1I5L A;  2HDA A;  1D1B A;  3D7S B;  1TSF A;  1ZSZ B;  2BZY A;  2M1H A;  2LQN A;  1RI9 A;  3CPW A;  1VQN Q;  3CPF A;  1UGS B;  2JMA A;  3CC4 Q;  5GMK m;  1N27 A;  3JB9 J;  4OGE A;  4XU3 A;  5GAN h;  1YIJ T;  1N6A A;  3SHW A;  2KGT A;  4E7S A;  3J80 E;  1YWP A;  1KG1 A;  4K11 A;  2JZ2 A;  1X01 A;  2FPE A;  1VQ9 Q;  5D6Y A;  1RAF B;  3G71 Q;  2XHC A;  1M27 C;  2KRS A;  4JS4 A;  2OI3 A;  2KXD A;  3M5A A;  3VS3 A;  2E4H A;  1UGQ B;  5I2S A;  4PJJ A;  1QVG A;  5CKH A;  3QZ5 B;  1Q95 G;  3O5Z A;  4F7U F;  2E64 A;  2EJF A;  2K3X A;  2OX7 A;  2J05 A;  4J9G A;  2QYZ A;  4FU6 A;  5ECA A;  1KIK A;  3QJ6 A;  1B7T A;  2HAX A;  2DF6 A;  4C5I A;  3CPW P;  1SHF A;  4PJO E;  3NHN A;  2YT6 A;  4M7D C;  3OS2 A;  1QCO A;  5GAN 2;  4FYV B;  1AT1 B;  4N4I A;  1SRM A;  1WI7 A;  4PJN A;  3WVE B;  2DET A;  4BUG A;  2J6F A;  3OSS C;  1D3B A;  4ZGJ B;  3JB9 G;  3CBO A;  4E7Z A;  3RBB B;  3QJY A;  3I56 T;  3V8J A;  3U23 A;  3MEA A;  5LJ5 d;  1M5Q 1;  1WHJ A;  1PWT A;  4LN2 A;  4HA8 A;  2H3E B;  4ATO A;  2DD4 A;  4HVU A;  1WGS A;  2LX9 A;  3OY9 A;  3S6W A;  3LW5 E;  5FU6 C;  1M4Z A;  1IHW A;  5GJV B;  3CCU T;  2ZZD A;  2KNB B;  3A8O B;  3ME9 A;  1WZO A;  2JXB A;  1PHT A;  2CUD A;  4Q5W A;  3ZBD A;  1BB9 A;  1C0M A;  1OX8 A;  2CP7 A;  2OTJ T;  3JCM X;  5FLX E;  1I4K 1;  1ZBX A;  5LJ3 g;  1RAE B;  1IXD A;  2J6O A;  3PNW C;  1CSK A;  1KD1 U;  3C94 A;  3V7C A;  2L3P A;  1AVZ C;  1YJW Q;  1KQ1 A;  1SG5 A;  4Y92 A;  2VAS A;  3JV3 A;  3G4S Q;  4AFQ C;  1ZQ1 A;  5IXB A;  1BIA A;  3H41 A;  5GAO n;  5FU7 B;  1JXM A;  3HFN A;  4FYX B;  4JS5 A;  1Q86 C;  2EJ9 A;  7AT1 B;  1VQM Q;  4CRI A;  3KBG A;  1HYO A;  2K5I A;  1K0X A;  2O9S A;  4LNP A;  4PJO F;  4R55 A;  2EYZ A;  2EAY A;  3OSV A;  4LUE A;  2YXY A;  2FRW A;  2DK3 A;  1KJW A;  4NL2 A;  4F7U B;  2E6N A;  4IUP A;  3OYM A;  3S3N A;  2KYM A;  1RAH B;  4M78 C;  1PSE A;  1RAB B;  4RG8 A;  2LCL A;  1RI0 A;  2QGF B;  2F2W A;  1G3Y A;  3AHU A;  2E12 A;  3BE3 A;  2V26 A;  1QP3 A;  2EQM A;  2RNA A;  2WSC E;  2OTL A;  3EAE A;  2DXC A;  5FU7 C;  3PGG A;  3OYH A;  2JTF A;  2KRN A;  3CD6 A;  4J9C A;  5DM7 R;  2KR3 A;  1ZSZ C;  5CQY A;  3VKI A;  1YJ9 Q;  1M2V A;  2P84 A;  4ZN1 A;  3ULR B;  3OBW A;  3TRE A;  2CSQ A;  5CK9 A;  2JS2 A;  2AKK A;  4V2S A;  4YTL A;  1XTD A;  1VYV A;  4E7H A;  3CC4 T;  5A0G A;  1GCQ A;  2A7Y A;  4OMO A;  2KY9 A;  1RAA B;  2DXU A;  4OB0 B;  3HTR A;  1K73 C;  3FJ5 A;  3QUI A;  1GBR A;  2DPP B;  4C8Q G;  4MDX A;  5GAM j;  3JCM Q;  4XAX B;  2F1L A;  2E3H A;  3E19 A;  3J81 E;  1VUB A;  4C92 E;  2XG8 D;  2J06 A;  2KQW A;  2Y4X A;  3JCM c;  1MGQ A;  1M90 R;  3GLX A;  4C5H A;  2K6D A;  5IAY A;  4OVA A;  2X3X D;  1Q86 R;  4M77 E;  2QEX Q;  2QA4 A;  1NJI R;  4L6V 5;  2HD0 A;  2DIG A;  4RTX A;  3LGF A;  5EG2 A;  2R58 A;  2DXB A;  4XQ3 A;  3BDU A;  4AG1 C;  1WX6 A;  5CR2 A;  1S1N A;  2RF0 A;  3QWY A;  4IUV A;  1HSQ A;  5FWC A;  2A36 A;  4A54 A;  2RQU A;  3CCS T;  3EG9 B;  4O6J A;  4M7D A;  3FDR A;  4OGC A;  3PE0 A;  2HBP A;  4PK4 A;  4ZGD B;  4Z8A A;  9ATC B;  2ED1 A;  2OJ2 A;  2IVW A;  2MF2 A;  3OW2 S;  2G6F X;  5I21 A;  1GL5 A;  2E65 A;  1WXB A;  2M0O A;  1VQ5 T;  5KCH A;  1OZ3 A;  2P0Q A;  4M75 C;  2NUZ A;  4M77 B;  3M0T A;  1C6V X;  2COZ A;  5GMK h;  2OTL Q;  1K8A R;  1U5S A;  2ROL A;  1S72 A;  1J3T A;  3SB2 A;  1X75 C;  3VYG A;  5C0M A;  2FYK A;  3VRY A;  1KC8 R;  2QDY B;  1NPR A;  3CXC P;  5LJ5 f;  2XK0 A;  2V8K A;  3RUX A;  1QKX A;  3THK A;  1QWE A;  4NL3 A;  2NUT B;  1YIT Q;  1S72 T;  1K8A U;  4RCC A;  3JCM d;  1QWF A;  2KI7 A;  3G6E T;  3EFO A;  1G3T A;  4ORZ A;  2ATC B;  3UF4 A;  4M75 F;  4QVD A;  3JCM b;  3CCV T;  4BDY A;  5LJ3 f;  3SDZ A;  4E47 A;  4C92 D;  4CC3 A;  3REB B;  5KYY B;  3C12 A;  1VQP T;  2AZS A;  1UJ0 A;  2LJ0 A;  4RKU E;  2RQV A;  2IIM A;  1M9S A;  2RK1 A;  3HP9 A;  1KK7 A;  4J83 A;  4ME7 A;  1P92 A;  4C0D C;  1NG2 A;  2CH4 W;  2EPD A;  4PJL A;  3VS4 A;  1W2B S;  2CZ0 B;  6AT1 B;  5LJ5 j;  1YNZ A;  2DO3 A;  5CKF A;  2JM9 A;  3JCM e;  2J7I A;  2X3W D;  3A8G B;  1F1B B;  4XTX A;  4AG2 C;  3EFO B;  3VS5 A;  1W2B A;  2HKN A;  2M0Y A;  2RO0 A;  1I0C A;  1TXQ A;  4XTU A;  2DM1 A;  1R0C B;  1YHQ Q;  2EVR A;  1PG5 B;  3HKS A;  1VQ8 Q;  2GQI A;  2QQS A;  1VQ6 A;  2HSP A;  4ELZ C;  3S3M A;  1YP5 A;  4LUD A;  1T3S A;  2YSQ A;  4FW1 A;  1QVG P;  2L8D A;  4XTW A;  3I56 A;  1UGP B;  1VIF A;  2YHT A;  4C0D B;  2XMF A;  1SSF A;  5L23 A;  1VQ6 T;  4C8Q B;  2EGE A;  2D0N A;  1LJO A;  3ASK A;  4Z02 A;  4LDX A;  2QA4 Q;  3OS1 A;  1VQL T;  3OYF A;  3P8B B;  2LNV A;  1PKS A;  2DKG A;  1OYX A;  4BY6 C;  1YJW A;  4C0G A;  3FC3 A;  2X35 A;  1JBM A;  2DX1 A;  1FXX A;  5KE3 A;  4KUL A;  5D6W A;  2YLC A;  1PD1 A;  4RTZ A;  1BK2 A;  3PIO A;  1MMN A;  1RAC B;  4IIO A;  1XNI A;  2MI6 A;  4F16 A;  3ZL7 C;  3SWN C;  2MOX A;  1QCF A;  5GAO r;  1M1K R;  2WAC A;  2O88 A;  2KYB A;  2EGC A;  3CCL T;  1ACM B;  2ZPE B;  3LH0 A;  2BKD N;  2VYT A;  1U1S A;  1M30 A;  2A3L A;  5GAN g;  1D1A A;  3QG1 A;  4DBR A;  3X20 B;  1WJS A;  3KFV A;  2CSI A;  2XKO C;  4WF2 A;  1X6G A;  3G7Z A;  5FWB A;  2MWP A;  3CME A;  2FG0 A;  3UAT A;  2JOY A;  3GNG A;  1W70 A;  1RLQ C;  2KDS A;  2EBP A;  3HSB A;  2F2X A;  3CEY A;  2VB6 A;  2HMA A;  3BY7 A;  1RL2 A;  1K1Z A;  2LDM A;  4PLL A;  2HSE B;  2CP3 A;  5IN1 A;  4F17 A;  4FW2 A;  1K9M C;  4QQG A;  3H9N A;  1Q81 U;  3JCM V;  1V76 A;  1WYX A;  1JO8 A;  1Q82 C;  4RCB A;  1N8R R;  2LCC A;  2GF7 A;  1Q82 U;  4KBM B;  3NTK A;  1GCQ C;  1YI2 T;  3G1J A;  1K9M U;  4C92 G;  1UDL A;  2DZ9 A;  1VQ4 Q;  4ZNX A;  3EHR A;  3GPL A;  2E1H A;  2X4Y A;  5GAO p;  3OB9 A;  4J9H A;  1BIB A;  1Q81 R;  4KGX B;  1JEG A;  1VYT A;  1VQ9 A;  4RMO A;  2YLB A;  2LC4 A;  3OQ5 A;  1Y96 A;  2KAF A;  2EGA A;  3QDF A;  1KQS A;  1VQ8 A;  4C8Q F;  4KUD K;  4D8K A;  2CYZ B;  1OX9 A;  1LCK A;  4AFZ C;  4AMC A;  4CC7 A;  2PUO B;  1M2V B;  1FX7 A;  2EWN A;  3INZ A;  4RTV A;  1IZ6 A;  4BI4 A;  3CCS A;  3M55 A;  2DL8 A;  1X69 A;  5GAO m;  2JVV A;  4O5V A;  3DLL A;  1VQP Q;  1H64 1;  4C92 B;  3I5R A;  4N4H A;  3SWN B;  4Y28 E;  1AHJ B;  2JW4 A;  1AD5 A;  1JRI A;  1I5O B;  3I9Q A;  2DIL A;  2OTJ Q;  4C8Q C;  1MV3 A;  1U3O A;  5HK0 A;  2PUK B;  4B9W A;  1M90 U;  1VQN A;  1Y96 B;  3CMA A;  5A0D A;  2ZGW A;  2GBQ A;  3EH2 A;  4M7A B;  1GBQ A;  1PRL C;  1WXT A;  4OP0 A;  1KFZ A;  4FYW B;  2OTJ A;  2EYW A;  2HL3 A;  2ENM A;  4HKE A;  1YIT A;  4IKF A;  4M75 B;  4EMH A;  2GNC A;  2VKN A;  3I55 Q;  3CCJ A;  3H8Z A;  3ER0 A;  2RH2 A;  4JJC A;  2FVU A;  2DBM A;  2HL5 C;  2EQI A;  4PFZ A;  2CZ7 B;  4C92 C;  2KRO A;  4M7A G;  1MMA A;  2R57 A;  1ZSG A;  3VS0 A;  2M16 A;  4DBH A;  1Z9Z A;  1TH7 A;  4EDU A;  5FRM A;  5KYN A;  4AT1 B;  1Y57 A;  2RI2 A;  4JRI A;  2W0Z A;  1JJ2 S;  1TUD A;  4DA4 A;  3Q1J A;  3OMC A;  3G71 T;  2HQX A;  3EG3 A;  3R6O A;  3LH5 A;  1K73 R;  1K4U S;  1QLY A;  2LT4 A;  2X4J A;  4FSS A;  2E5K A;  2QK0 A;  2HZY A;  3VYH B;  1SF9 A;  3ZEH A;  4XTV A;  3RER A;  3NTI A;  3HRT A;  2JMC A;  2DE0 X;  3QHS A;  1FMV A;  2D6F A;  1LOJ A;  1T0H A;  2ZPI B;  3LGL A;  1N9R A;  3X25 B;  5DY9 A;  2DTH A;  2KXC A;  4C92 F;  1B34 B;  3CCM Q;  5CKE A;  3L2Q A;  1IRE B;  5KYX B;  1NLP C;  2CH4 A;  3L2V A;  2K2M A;  1YHQ A;  2DTI A;  1BBZ A;  2FL7 A;  5GAM g;  3JCM g;  1PKT A;  2VV5 A;  4JZ3 A;  4A4E A;  3CCL Q;  3M56 A;  1WXU A;  2EKH A;  2KMT A;  3T9N A;  2VXF A;  3C95 A;  4J9I A;  2MK5 A;  3JB9 F;  4E2F B;  2FHD A;  4DQ2 A;  4A4F A;  4FL6 A;  1NZ9 A;  1IHV A;  1RLP C;  5IHN A;  4A4K A;  1UHF A;  2JT4 A;  4IUU A;  3CCE Q;  2DL3 A;  3RKY A;  1S72 Q;  4MZM A;  5LJ3 e;  3JB9 H;  3OYB A;  1Y71 A;  1KQ2 A;  2QTV A;  2HCK A;  3DLM A;  2H8H A;  2MPX C;  1D0X A;  3CMA Q;  3TSZ A;  4BD3 A;  1VQL Q;  1TOV A;  3GNF B;  5I22 A;  2BTT A;  1YJN T;  1B3Q A;  4QVZ A;  3NFC A;  4JJN K;  4LD9 K;  3HHT B;  1QVG S;  2CT3 A;  1D0Z A;  2RB6 A;  1AZG B;  3M58 A;  4M7D B;  1FYN A;  5IH2 A;  2KRM A;  4PJO B;  4M7D G;  1SKU B;  2O2O A;  1NM7 A;  1JQQ A;  3NMZ C;  4ZGE B;  4JRQ A;  4XTZ A;  2DBK A;  2DL7 A;  3MO8 A;  2YUP A;  3L1A A;  2NUT A;  2AZV A;  3EGU A;  5GAN 7;  2YUO A;  3M0P A;  4B6M A;  2OAU A;  2DL4 A;  3VS7 A;  1ZHI A;  2E6Z A;  1OEB A;  3OYJ A;  1OI1 A;  1M2O A;  4FSX A;  1QP2 A;  1VYU A;  1XOV A;  1EFN A;  2P4R A;  3M0Q A;  4RTU A;  4J8O A;  3M4Y A;  2MYS A;  3EG9 A;  1UJY A;  3CME Q;  2HBW A;  1Y0M A;  5GAN 8;  1WFW A;  1UHC A;  1JJ2 A;  2DVE A;  4PJO D;  3QYG B;  3CMA T;  3LYI A;  1NJI C;  3MPU B;  1R77 A;  2KEA A;  1M1K U;  1QVF P;  2FZC B;  4OB1 B;  1RAD B;  4M77 A;  3GF5 A;  4BI8 B;  2QI2 A;  1LPL A;  4OMF B;  4C0F A;  3PMI A;  2X4X A;  3HPW A;  5GAN 5;  1OU9 A;  5CAI A;  5HCK A;  1VQO A;  4RTY A;  3A5Z B;  3CCU Q;  1I07 A;  1AWW A;  5DLO A;  2GFU A;  1WHM A;  4AFS C;  5LL6 S;  4D6W A;  1YI2 Q;  4MDW A;  1OOT A;  1VQ4 T;  3J7A F;  3JB9 I;  3EH1 A;  3PVQ A;  3MP8 A;  1AOJ A;  5AT1 B;  4R56 A;  2RPN A;  1ZLM A;  1V1C A;  3H0F A;  3A98 A;  2FZG B;  1GFD A;  3CPW S;  2QAS A;  5KYW B;  1K8A C;  1ABO A;  1MNE A;  2FPF A;  3I5S A;  2YRV A;  1WQ7 A;  3F70 A;  3L42 A;  2QTX A;  1KQS S;  2KVQ G;  2RJE A;  4M77 D;  1TS9 A;  2PVG B;  4KH1 B;  5IXF A;  3OW2 P;  1YJN Q;  2XU8 A;  3GP8 A;  1BYM A;  2DYI A;  4E7I A;  1HK9 A;  2KK4 A;  2GTO A;  4M7D F;  4DOV A;  5CIU A;  2BIV A;  5CO7 A;  3VS6 A;  4LDV A;  2C0T A;  5CKB A;  2HQE A;  2DZC A;  1VQ6 Q;  3JCM f;  1QVP A;  3AT1 B;  2EW3 A;  2GFA A;  1G3S A;  3L2W A;  3IQL A;  3EFS A;  5CKD A;  2P0K A;  3CCV Q;  1VQ8 T;  2RN8 A;  1VQK A;  3G4S A;  3MHX A;  2DRK A;  3E1S A;  1QCN A;  5J3B A;  2VWF A;  2JNG A;  2YUN A;  1I1J A;  4QVC A;  2JN0 A;  2PQW A;  4QT7 A;  2DJQ A;  4KRT A;  3UWN A;  1VQK T;  3G4S T;  2V1R A;  3FRN A;  5GAM f;  1YJ9 T;  2J6K A;  2PVO B;  4J6X A;  1Q7Y R;  4C92 A;  5GAN f;  1KD1 C;  2R5M A;  1OPK A;  2AT1 B;  1IO6 A;  1ZA2 B;  2D8H A;  5KYX A;  1RUW A;  4RG2 A;  1UG1 A;  1QQJ A;  2NWM A;  3QYH B;  3VUB A;  2RJF A;  2ZPF B;  2B86 A;  2F5K A;  3WXM B;  1OV3 A;  5KYU B;  1WQW A;  3JCM h;  5GAM h;  3RES A;  3OYL A;  2LTO A;  2I2L A;  4CC4 B;  2QGG A;  4XU2 A;  1PCX A;  2QQB A;  1QVF S;  1K9M R;  5GAN 3;  2LQ8 A;  2O9V A;  4J6Y A;  1KC8 U;  2QQ9 A;  5KCO A;  1N8R C;  4ANJ A;  2ED0 A;  3OBY A;  1ZUK A;  1E7O A;  1PRM C;  1KHI A;  1JXO A;  1QVF A;  3CQT A;  3OW2 A;  3OYY A;  2A37 A;  3JSC A;  5FRN A;  2L2P A;  2LT1 A;  3PIP A;  1JJ2 P;  4MZP A;  2EYX A;  1D3B B;  2K4Y A;  4LXC A;  2E3I A;  4C8Q E;  2YRC A;  3L2R A;  3EFR A;  4PJM A;  1BCO A;  5IHK A;  2CP6 A;  1BI3 A;  2QAZ A;  1K9A A;  2MAM A;  4M4Z A;  2LCS A;  1VQL A;  1T3L A;  4M78 A;  1D0Y A;  2DXT A;  4JDS A;  5GAM e;  3EGX B;  3OYG A;  4LE9 A;  5GAN j;  1W1F A;  3SD4 A;  1PM3 A;  2FPD A;  4LDW A;  1IRX A;  4IUR A;  1WHL A;  1EIF A;  4OMQ A;  3CME T;  4J9F A;  1VQP A;  4PNO A;  3URG A;  3CCE T;  2ABL A;  2LQW A;  1X2Q A;  3OA6 A;  2NUP B;  1TTH B;  1YHQ T;  2BZ8 A;  2K5F A;  2GCX A;  4FT2 A;  2BUD A;  3GOX A;  3HL8 A;  4Y91 A;  1SSH A;  2ESW A;  4MZT A;  5GJW B;  1M1F A;  4LDU A;  3RIR A;  4ZTJ A;  3QZ9 B;  4FM4 B;  4NS5 A;  1UTI A;  1YCY A;  4PJO C;  2L0A A;  5GAN e;  3OS0 A;  2EYQ A;  3DB4 A;  1Q7Y C;  2E41 A;  4J9D A;  3CC2 A;  1UB4 A;  4ELY C;  4EMG A;  4PFO A;  3TSW A;  3SFM A;  4M75 D;  2RI3 A;  2XIC A;  1PSF A;  2RHX A;  1M3A A;  1UE9 A;  2L89 A;  2ZAE A;  4KUI A;  2LQK A;  1R8O B;  4FYY B;  1WLP B;  4M7A E;  3MKD A;  1UEC A;  2FO0 A;  4P5N A;  4M78 F;  2MWO A;  4BE2 A;  3M0S A;  2BE7 D;  3RMQ A;  2MIO A;  4C8Q A;  3UA6 A;  2DIQ A;  1PD0 A;  3TCJ A;  1PC0 A;  1YFN A;  2CP2 A;  2CP5 A;  1HD3 A;  4EIK A;  1X27 A;  2COW A;  2H3J A;  2RD1 A;  1AWO A;  2VXE A;  5LJ5 e;  4XK8 E;  4L59 A;  3E9G A;  4LD6 A;  1C1A A;  4JRP A;  2HQH A;  2QA4 T;  4M7A D;  4E7L A;  3SWN A;  2RA2 A;  2IG0 A;  1ZUY A;  4HT8 A;  2AKL A;  4HCC A;  3CCS Q;  2NLU A;  3QPH A;  4OML A;  1NPP A;  5CCA A;  1AEY A;  2D0Q B;  4J7F A;  4OF1 A;  2WSE E;  2GQV A;  4M7D D;  1KHC A;  2VGM A;  3TVT A;  2JTM A;  2DYB A;  2CZ6 B;  3CC7 T;  3MP1 A;  1TUC A;  3M57 A;  3MP6 A;  3O8V A;  2CZ1 B;  1XQH A;  2XDB A;  2C0O A;  1U1T A;  1X6B A;  4FIB A;  1K0S A;  3CXC A;  4BY6 B;  4X34 A;  1ZA1 B;  5HKC A;  2D8J A;  1M3B A;  3RNJ A;  4OMN A;  1MMD A;  1T0J A;  4M7A A;  2RQR A;  2EQJ A;  2A28 A;  3VS1 A;  2ZCF B;  3QDR B;  4N0A C;  1B07 A;  4IUQ A;  5LJ3 d;  3CCQ A;  1KSW A;  2GGR A;  5GMK e;  2KE9 A;  4D8D A;  2PU9 B;  4E7J A;  3CBP A;  2RM4 A;  5GMK i;  4WTO B;  2C06 A;  2DAQ A;  3M59 A;  2Z0W A;  2ECZ A;  4KGV B;  4II1 A;  2D9T A;  3P8D A;  4J6W A;  3I35 A;  4JLI A; 
#chains in the Genus database with same CATH homology
 1LNX A;  4JRQ A;  4ZGE B;  1VIE A;  3BDL A;  3M4G A;  2RI5 A;  2RHY A;  4XTZ A;  5LJ3 j;  3JCM b;  4M75 F;  4QVD A;  3CCV T;  3MO8 A;  5FU6 B;  1VQ7 A;  4BDY A;  4A4G A;  3L1A A;  5D6X A;  4HCB A;  4F7U A;  1BI0 A;  5LJ3 f;  3JCM J;  3CCL A;  4DOW A;  3MEW A;  5GAN 7;  3VUZ A;  1Q7Y U;  3SDZ A;  5HK3 A;  4E47 A;  4C92 D;  2HNI A;  2OAU A;  1I81 A;  1O9S A;  1ZHI A;  1YBY A;  2CGH A;  2E6Z A;  3C12 A;  3OYJ A;  1OI1 A;  4FSX A;  3PFS A;  4OB2 B;  1QP2 A;  1VQP T;  1XOV A;  1BI2 A;  2O01 E;  3VU3 C;  3CC7 A;  1BI1 A;  4EPC A;  3CCE A;  4J8O A;  3M4Y A;  3LX7 A;  3OMG A;  4M75 G;  4GY5 A;  4RKU E;  3I55 A;  1V29 B;  2VC8 A;  1B34 A;  5GAN d;  3LWH A;  3DB3 A;  1M9S A;  1NE8 A;  2RK1 A;  3CBM A;  3HP9 A;  3LLR A;  5LJ3 h;  4ME7 A;  4J5Y A;  4J83 A;  4EMK B;  1YJ9 A;  1P92 A;  5GAN 8;  4C0D C;  1O75 A;  1JJ2 A;  3OYK A;  4VUB A;  1VQN T;  2DVE A;  3A8H B;  4PJO D;  5C6S A;  3HRU A;  3QYG B;  1W2B S;  1Q82 U;  3QBY A;  4IUT A;  2CZ0 B;  2QQR A;  3CMA T;  3LYI A;  1NJI C;  5LJ5 j;  3UDC A;  4J7I A;  1M1K U;  2DO3 A;  5CKF A;  4OB1 B;  4LDY A;  4M77 A;  3CCM T;  3GF5 A;  3JCM e;  4BI8 B;  1VQ4 A;  3A8G B;  2QI2 A;  1VQP A;  4OMF B;  4C0F A;  4IKF A;  4XTX A;  4PJO A;  3PMI A;  5J26 A;  2R5A A;  3V7R A;  3OYA A;  2K57 A;  1W2B A;  4M77 C;  2X4X A;  3HPW A;  5GAN 5;  2O4X B;  2RO0 A;  5CAI A;  1VQO A;  3RMS A;  1YIT T;  3A5Z B;  4XTU A;  4F7U E;  3OYC A;  2ZPG B;  1WJQ A;  2WSF E;  3MEV A;  2GFU A;  5DLO A;  3CCJ T;  5CQX A;  1W4S A;  2EJG A;  1NJI U;  5LL6 S;  3CCR T;  3QXE B;  4D6W A;  3FLG A;  2K2V A;  3WVD B;  1M1G A;  1K73 U;  1UGR B;  2B8A A;  3L2U A;  3CCM A;  4MDW A;  3HKS A;  2PVD B;  4N4G A;  1VQ4 T;  5LJ5 h;  1X6O A;  3J7A F;  3JB9 I;  2P4T A;  2QQS A;  3FEO A;  2RJC A;  3PMT A;  3MP8 A;  2V8J A;  4ELZ C;  4CI0 C;  3JAM E;  4BAC A;  3S3M A;  2E10 A;  2DJZ A;  1UEB A;  2ZPB B;  4R56 A;  3PTA A;  4HCZ A;  5DLQ E;  2K3Y A;  4X9C A;  2XDP A;  3A8L B;  2DEQ A;  3H6Z A;  2L8D A;  2G3R A;  1VQ9 T;  4XTW A;  3I56 A;  4UC4 A;  1UGP B;  3JB9 D;  2FB7 A;  3CPW S;  4EMK A;  1VIF A;  2MMP A;  3G71 A;  1U8R A;  2YHT A;  1Q81 C;  5KE2 A;  4C0D B;  4C5G A;  2EQU A;  1YJW T;  1SSF A;  1K8A C;  1I5L A;  1VQ7 T;  4JRK A;  1VQ6 T;  2YRV A;  1OZ2 A;  4M77 F;  4C8Q B;  3QSU A;  1WQ7 A;  3F70 A;  3L42 A;  1LJO A;  2M1H A;  2QTX A;  1KQS S;  3QO3 A;  2KVQ G;  2RHI A;  3ASK A;  2RJE A;  4Z02 A;  5J39 A;  4M77 D;  3CPW A;  4LDX A;  3CPF A;  1UGS B;  3P8H A;  1VQM T;  3OS1 A;  1VQL T;  3OYF A;  3P8B B;  2LNV A;  2PVG B;  2L5Q A;  1N27 A;  5GMK m;  3JB9 J;  4OGE A;  2DKG A;  4XU3 A;  5GAN h;  1OYX A;  4BY6 C;  1N6A A;  2XU8 A;  3GP8 A;  1YIJ T;  1BYM A;  1YJW A;  4C0G A;  3FC3 A;  4E7I A;  2X35 A;  1JBM A;  5LJ5 g;  1HK9 A;  2KK4 A;  3J80 E;  1KG1 A;  1FXX A;  5KE3 A;  2JZ2 A;  4M7D F;  1X01 A;  4KUL A;  4DOV A;  5D6Y A;  5CIU A;  5D6W A;  1WNL A;  2BIV A;  4X9D A;  2YLC A;  5CO7 A;  3PIO A;  2XHC A;  4M78 D;  2EQK A;  3M9Q A;  4LDV A;  1XNI A;  1M1K C;  5CKB A;  4JS4 A;  2MI6 A;  2HQE A;  2F5T X;  2DZC A;  2VUB A;  3JCM f;  1QVP A;  3M5A A;  1M8V A;  2M9U A;  3SWN C;  2GFA A;  1G3S A;  1UGQ B;  5I2S A;  3L2W A;  5GAO r;  3EFS A;  5CKD A;  2P0K A;  1QVG A;  5CKH A;  1VQ8 T;  3BFM A;  3QZ5 B;  1FWZ A;  2WAC A;  3CCL T;  1VQK A;  5HY6 A;  2E64 A;  2EJF A;  4F7U F;  3G4S A;  2K3X A;  1VQO T;  2ZPE B;  3LH0 A;  3MHX A;  4FU6 A;  2BKD N;  4QW2 A;  2VYT A;  1U1S A;  3QJ6 A;  4C0Z A;  5A2Q E;  3E1S A;  2HAX A;  5J3B A;  3OS5 A;  4C5I A;  2A3L A;  3V8L A;  5GAN g;  4M77 G;  2JNG A;  4PJO E;  3RKX A;  4QVC A;  2JN0 A;  5CVI A;  4M7D C;  2PQW A;  5AYF A;  3OS2 A;  3QG1 A;  4ZTF A;  3X20 B;  2XID A;  3UWN A;  3LWI A;  5GAN 2;  1WJS A;  3KUF A;  3X28 B;  2QXF A;  3G4S T;  3FIF A;  1VQK T;  2XKO C;  3FRN A;  4N4I A;  4TVR A;  5GAM f;  4WF2 A;  1YJ9 T;  2PVO B;  3BW1 A;  3WVE B;  2Y90 A;  4BUG A;  4J6X A;  3OSS C;  1D3B A;  1I8F A;  4ZGJ B;  3JB9 G;  4C92 A;  3CBO A;  3G7Z A;  5GAN f;  2R5M A;  1KD1 C;  3CCQ T;  2MWP A;  3CME A;  3KXT A;  2JOY A;  3QJY A;  4RG2 A;  3GNG A;  3I56 T;  3V8J A;  3MEA A;  3QYH B;  5LJ5 d;  3VUB A;  2KDS A;  2LVM A;  1M5Q 1;  2RJF A;  2ZPF B;  3HSB A;  3GIB A;  3CEY A;  2F5K A;  3JRZ A;  3WXM B;  3BY7 A;  4HA8 A;  1WPY A;  1RL2 A;  4ATO A;  2LDM A;  2DD4 A;  4PLL A;  1HXD A;  1WGS A;  2LX9 A;  2XI9 A;  5IN1 A;  3OY9 A;  4GLK A;  1WQW A;  3S6W A;  3JCM h;  4QQG A;  5GAM h;  3LW5 E;  5FU6 C;  3RES A;  3JCM V;  2RK2 A;  1Q81 U;  1M4Z A;  4XU0 A;  5GAO l;  1Q82 C;  3CCU T;  2ZZD A;  4RCB A;  3OYL A;  3A8O B;  3ME9 A;  4F7U G;  2LTO A;  2I2L A;  2LCC A;  1QW1 A;  2GF7 A;  4Q5W A;  4XU2 A;  2QQB A;  3ZBD A;  3S3O A;  4KBM B;  3NTK A;  1YI2 T;  3V8K A;  2OTL T;  1QVF S;  5GAN 3;  3CCV A;  1K9M U;  4C92 G;  2OTJ T;  2DZ9 A;  2LQ8 A;  4J6Y A;  3TU4 K;  1KC8 U;  3JCM X;  4PLI A;  5FLX E;  1I4K 1;  2RJD A;  3CD6 T;  3GPL A;  2QQ9 A;  1ZBX A;  2E1H A;  5KCO A;  1N8R C;  3CC2 T;  3PT9 A;  4XTY A;  1N8R U;  2X4Y A;  3A8M B;  3OBY A;  5LJ3 g;  3OYD A;  5GAO p;  3OB9 A;  1DJ7 B;  1BIB A;  1KHI A;  3FJP A;  1QVF A;  1GXI E;  3PNW C;  3OW2 A;  3OYY A;  4JLI A;  1VQ9 A;  2Y4Y A;  3JSC A;  4RMO A;  5FRN A;  2YLB A;  1KD1 U;  2LC4 A;  2LT1 A;  3C94 A;  3V7C A;  4PJO G;  3PIP A;  3QKJ A;  1YJN A;  3OQ5 A;  3HRS A;  4MZP A;  1Y96 A;  5GAN 6;  4PKC C;  1KQ1 A;  2KAF A;  1D3B B;  2K4Y A;  1KQS A;  1VQ8 A;  3CC4 A;  4C8Q E;  4C8Q F;  2LRQ A;  4EMK C;  5L8R E;  4KUD K;  3L2R A;  4BE0 A;  1ZQ1 A;  3EFR A;  1BIA A;  4A53 A;  5GAO n;  2CYZ B;  1BI3 A;  4FT4 A;  4JUV A;  2MAM A;  3HFN A;  5FU7 B;  5GAN 4;  4JS5 A;  1Q86 C;  2EJ9 A;  1VQL A;  4M78 A;  4CRI A;  2PUO B;  4M7A F;  3KBG A;  3L2Z A;  3QII A;  5KH6 A;  2DXT A;  2K5I A;  4JDS A;  4M78 G;  5GAM e;  2ZPH B;  2O4X A;  2EWN A;  1FX7 A;  3INZ A;  1IZ6 A;  3OYG A;  4PJO F;  4BI4 A;  4R55 A;  3HFO A;  3CCS A;  3M55 A;  5GAN j;  3SD4 A;  5GAO m;  2EAY A;  2JVV A;  3OSV A;  4O5V A;  3DLL A;  1H64 1;  4LDW A;  4C92 B;  4N4H A;  4IUR A;  3MCA B;  1MHN A;  2EFI A;  1EIF A;  2DK3 A;  3SWN B;  3OYE A;  4Y28 E;  3RKW A;  3CME T;  1AHJ B;  3CXC S;  3CCR A;  4OB3 B;  4NL2 A;  1JRI A;  4PNO A;  4F7U B;  1N9S A;  2E6N A;  4IUP A;  3ZFJ A;  5M9O A;  3OYM A;  1Q86 U;  3URG A;  3CCE T;  4C92 F;  4HT9 A;  4M7D E;  2E5Q A;  3S3N A;  1JB0 E;  4C8Q C;  3I55 T;  4M78 C;  3OA6 A;  2XD0 A;  1PSE A;  4N0A A;  1YHQ T;  5HK0 A;  2K5F A;  2GCX A;  2PUK B;  4FT2 A;  3JCM P;  4RG8 A;  4B9W A;  2BUD A;  3GOX A;  2LCL A;  1RI0 A;  3HL8 A;  1M90 U;  4Y91 A;  5GAO q;  2V8I A;  1VQN A;  4BE1 A;  1Y96 B;  1G3Y A;  3CMA A;  3AHU A;  2E12 A;  4MZT A;  5A0D A;  2QQA A;  2ZGW A;  4M7A C;  4M7A B;  1QP3 A;  1M1F A;  4LDU A;  2EQM A;  2K5L A;  3RIR A;  4ZTJ A;  3QZ9 B;  4FM4 B;  4OP0 A;  2WSC E;  2OTL A;  3EAE A;  2DXC A;  4NS5 A;  1YCY A;  3OYN A;  2OTJ A;  4PJO C;  5FU7 C;  2DD5 A;  3PGG A;  2JTF A;  5GAN e;  3OS0 A;  2EYQ A;  3DB4 A;  3OYH A;  2E41 A;  1Q7Y C;  3CD6 A;  5DM7 R;  4HKE A;  5CQY A;  1UB4 A;  3VKI A;  1KC8 C;  4ELY C;  3CC2 A;  4EMG A;  5GAM d;  1YIT A;  2VGN A;  3SFM A;  4M75 D;  2RI3 A;  4M75 B;  4PL6 A;  3V7S A;  2XIC A;  3OBW A;  4EMH A;  4ZN1 A;  3TRE A;  3CCJ A;  1PSF A;  3E9F A;  3H8Z A;  3ER0 A;  2RH2 A;  2RHX A;  4KUI A;  2FVU A;  2L89 A;  3MEU A;  3X24 B;  2LQK A;  5CK9 A;  3G6E A;  4BDZ A;  4V2S A;  1R8O B;  4M7A E;  4YTL A;  1VQ5 A;  1XTD A;  4L5G A;  4BE2 A;  4P5N A;  4M78 F;  2MWO A;  4C92 C;  2CZ7 B;  3TEE A;  4E7H A;  3UPU A;  3RMQ A;  3CC4 T;  4M7A G;  4C8Q A;  5A0G A;  2A7Y A;  2DIQ A;  2KY9 A;  2R57 A;  1G5V A;  2M16 A;  3TCJ A;  2DXU A;  4OB0 B;  1TH7 A;  4EDU A;  5FRM A;  4M78 B;  3CCU A;  1K73 C;  3QUI A;  2RI2 A;  4JRI A;  2H3J A;  1JJ2 S;  2DPP B;  2RD1 A;  4C8Q G;  4DA4 A;  4MDX A;  2F69 A;  5GAM j;  3Q1J A;  2VXE A;  4KT0 E;  2RHU A;  3OMC A;  4JLG A;  4XAX B;  4C8Q D;  5LJ5 e;  3JCM Q;  3G71 T;  4XK8 E;  2HQX A;  4NOY A;  4L59 A;  3R6O A;  1M90 C;  3E9G A;  4LD6 A;  3E19 A;  4ZN3 A;  4JRP A;  3MET A;  3J81 E;  1VUB A;  3VV0 A;  4C92 E;  2LT4 A;  2XG8 D;  2KQW A;  2QA4 T;  2X4J A;  3M54 A;  2Y4X A;  3VYH B;  3ZEH A;  2L3R A;  4XTV A;  4M7A D;  4E7L A;  3JCM c;  3SWN A;  1MGQ A;  2RA2 A;  2P0P A;  4A4H A;  4B9X A;  2IG0 A;  3C4S A;  3NTI A;  3HRT A;  3RER A;  4HT8 A;  3QHS A;  4BI3 A;  3GLX A;  4HCC A;  2D6F A;  1LOJ A;  4C5H A;  2ZPI B;  5FRO A;  1YIJ A;  3LGL A;  1N9R A;  3X25 B;  2AHJ B;  2DTH A;  2NLU A;  3QPH A;  5DY9 A;  3NTH A;  1B34 B;  4OVA A;  5IAY A;  4M75 A;  5CKE A;  2EKO A;  2EIF A;  3L2Q A;  1IRE B;  4M77 E;  2QA4 A;  1NPP A;  5CCA A;  3L2V A;  4L6V 5;  2KSS A;  1YHQ A;  2HD0 A;  2DTI A;  2DIG A;  2FL7 A;  4MML A;  2D0Q B;  3LGF A;  4J7F A;  4OF1 A;  5GAM g;  3JCM g;  5I2M A;  5EG2 A;  3N5B B;  2WSE E;  2CKK A;  2GQV A;  2CS7 A;  2R58 A;  2VV5 A;  4M7D D;  2DXB A;  4A4E A;  4XQ3 A;  3BDU A;  2QEX A;  1KHC A;  2VGM A;  4QQ6 A;  2XDD A;  2JTM A;  5CR2 A;  2CZ6 B;  3M56 A;  3CC7 T;  5GMK j;  4IUV A;  3X26 B;  3JCM W;  3MP1 A;  4M78 E;  2KMT A;  4A54 A;  3M57 A;  3T9N A;  2VXF A;  3C95 A;  3MP6 A;  3CCS T;  2CZ1 B;  1XQH A;  4O6J A;  2XDB A;  4M7D A;  1U1T A;  3FDR A;  3JB9 F;  2FHD A;  4OGC A;  4FIB A;  5A0L A;  3CXC A;  4BY6 B;  4ZGD B;  2HBP A;  4X34 A;  3FB9 A;  1G3W A;  3VJP A;  4FL6 A;  4A4F A;  4DQ2 A;  2QEX T;  1NZ9 A;  5HKC A;  2RHZ A;  2IVW A;  2MF2 A;  3OW2 S;  4A4K A;  5I21 A;  4QQD A;  2E65 A;  2M0O A;  4IUU A;  1YI2 A;  5KCH A;  1VQ5 T;  4M7A A;  3RKY A;  3JB9 H;  4MZM A;  5LJ3 e;  1OZ3 A;  4C5E A;  1Y71 A;  2P0Q A;  4M75 C;  3UT1 A;  4M75 E;  3OYB A;  1VQ6 A;  5IT9 E;  4M77 B;  2JUF A;  4XU1 A;  2EQJ A;  5GMK l;  1KQ2 A;  5GMK h;  3OYI A;  4BB7 A;  2ZCF B;  3QDR B;  3DLM A;  1BKB A;  4N0A C;  4IUQ A;  2E70 A;  1S72 A;  2X4W A;  5LJ3 d;  3CCQ A;  4BD3 A;  1VQM A;  3SB2 A;  3GNF B;  2DTO A;  1X75 C;  1Y07 A;  3VYG A;  5GMK e;  5C0M A;  2FYK A;  1YJN T;  2QDY B;  2PU9 B;  1NPR A;  1WJR A;  5LJ5 f;  3CBP A;  2RM4 A;  5GMK i;  4E7J A;  2XK0 A;  2V8K A;  4QVZ A;  3RUX A;  1Y7X A;  3NFC A;  2C06 A;  2DAQ A;  4MMK A;  4JJN K;  4LD9 K;  3HHT B;  1QVG S;  3M59 A;  1H3Z A;  4NL3 A;  1K9M C;  3DKM A;  3M53 A;  2RB6 A;  4II1 A;  1S72 T;  1K8A U;  3M58 A;  4RCC A;  3JCM d;  4M7D B;  2D9T A;  3P8D A;  4E7K A;  4J6W A;  4PJO B;  3G6E T;  4M7D G;  3O8V A;  1G3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...