4X34A

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k381ack382me2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Tumor suppressor p53-binding protein 1
publication title An Acetyl-Methyl Switch Drives a Conformational Change in p53.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x34A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x34A01
5C6SA 3OYGA 1YHQT 3Q1JA 1VQ4A 3LGLA 4FL6A 2O4XA 3L2QA 4IUUA 1K8AC 3FDRA 4C5IA 1OZ2A 3S3MA 4Q5WA 3CCJT 4C5EA 2RHIA 3CCLT 5KCOA 2X4YA 3H6ZA 3LGFA 1VQ4T 2RJEA 1W2BS 2KDSA 1K9MU 4A4GA 2X35A 3M9QA 5C0MA 3UT1A 3LX7A 3OA6A 3CCRT 3LH0A 5IT9E 4BE0A 4NS5A 2QQRA 4PLIA 1QVGA 4L59A 3OYDA 2P0KA 4E7JA 3PIOA 2G3RA 3O8VA 1QVFA 2HQXA 1VQKA 4B9XA 1EIFA 3E9FA 3CC4A 3DLMA 2E5QA 3CD6T 3CCQT 3CC2T 2QEXT 4A4FA 3OW2A 3F70A 3L2VA 3J81E 4IUTA 2LTOA 1KD1C 4IUQA 4ZN3A 3BDLA 2LCLA 5J39A 3MEVA 1VQMT 3LYIA 3G4SA 2RJFA 1VQOA 3CCSA 3A5ZB 3NTIA 1VQ9T 2JOYA 1OZ3A 2L8DA 3CMAA 5DM7R 3JAME 3OYJA 1WJSA 4Z02A 2RO0A 4QQGA 2LRQA 1K9MC 3OB9A 3G4ST 3CXCA 5M9OA 1Q7YU 1JJ2A 4C5HA 4BE1A 3CMAT 3FEOA 5D6XA 2E6ZA 4RG2A 4EDUA 1NJIU 3CXCS 1VQ5A 4E7LA 5J26A 2R5MA 3OQ5A 1BKBA 2R57A 1YI2A 3CCVA 2GFAA 1NPRA 3I55T 4C5GA 1WGSA 1K73C 3CCMA 4N4GA 2L89A 3S6WA 3MEWA 3OYBA 2WACA 1VQ5T 1YJWT 3OMCA 4PL6A 2JUFA 1VQ6T 3OYMA 4TVRA 4FU6A 2JTFA 4X34A 3OS1A 4A4HA 1W2BA 4A4EA 1Q86U 3OYNA 2BIVA 5CIUA 1VQ7T 2GF7A 3I56A 3S3OA 4OVAA 1Q7YC 4E7KA 2BUDA 1M1GA 2LVMA 2RI2A 1KQSS 3L2WA 5KCHA 2LQ8A 4GY5A 3OYHA 1NJIC 3PMTA 2X4WA 3P8DA 2RJDA 1S72A 3S3NA 3OYLA 4BD3A 2M0OA 4IUPA 4QQ6A 3UWNA 2E70A 3FC3A 2JNGA 2YRVA 5IAYA 4E7IA 4II1A 2O4XB 3FLGA 2VYTA 3J80E 4YTLA 3OS2A 5DLQE 2R58A 1VQPA 4BE2A 1K73U 2KVQG 4QVZA 1VQKT 1KC8U 4N4HA 2JZ2A 3CC4T 2IG0A 1Q86C 2RHZA 4IUVA 2DIGA 1VQNA 4BDZA 5IN1A 2EKOA 1SSFA 3NTKA 1VQ8A 2K3YA 1YJ9A 1VQLA 1UEBA 2LDMA 1X6OA 1VQOT 1YBYA 3CCST 1KHIA 2DO3A 4LD6A 2HQEA 5D6WA 3G6EA 1RI0A 2EQJA 2EQUA 3G71A 4ZTFA 2MWPA 1YIJA 3OS0A 2X4XA 2OTJA 5KE3A 1N27A 3OYAA 3CCEA 2EQKA 3CCUA 1WJRA 1N8RC 1Q81U 2OTLA 3ME9A 3G71T 1KHCA 3PMIA 1MHNA 2B8AA 1KC8C 2QQSA 3MEAA 1H3ZA 1IZ6A 1NPPA 3MP1A 2RHUA 5LL6S 2DAQA 1YI2T 3CCVT 2GFUA 3HKSA 3QIIA 3CMEA 1XNIA 2XDPA 3J7AF 1NZ9A 1KQSA 3CCMT 3CPWS 3OYFA 4UC4A 2RI5A 3NTHA 3CCJA 4E7HA 4IURA 1G5VA 3ASKA 1M1KU 3EAEA 1YITA 3CMET 3OYIA 2JVVA 3CCRA 3CC7A 3L2UA 2FHDA 4HCZA 3OMGA 1M90U 3CEYA 4BACA 3I56T 3SD4A 3L42A 2RHXA 4QQDA 5FLXE 3QJ6A 1Q81C 1YITT 3OY9A 3CD6A 3CCQA 3CC2A 2QEXA 3CC7T 5J3BA 1N8RU 3MP8A 4ZN1A 4ZTJA 1S72T 5D6YA 1Q82U 1VQMA 3KUFA 3LLRA 1YJNA 3PIPA 2QA4A 2RI3A 1VQ9A 2NLUA 2MWOA 3ZEHA 1QVGS 2L3RA 2LCCA 2EFIA 4B9WA 1VQPT 2XK0A 3L2RA 1M1KC 1QVFS 2K3XA 2XHCA 3MP6A 3META 3PNWC 1YJNT 3ER0A 3QKJA 1OYXA 2QA4T 3OW2S 3CPFA 1VQNT 1M90C 1OI1A 5KE2A 5FROA 5KH6A 2E6NA 3QBYA 3PFSA 3P8HA 3GOXA 1VQ8T 1K8AU 1YJ9T 3P8BB 1VQLT 4BDYA 3KBGA 3C4SA 3OYCA 3H8ZA 2EIFA 1XTDA 3I55A 3G6ET 2MI6A 4QW2A 2PQWA 1RL2A 1Q82C 5A2QE 1YIJT 5HY6A 5FRMA 2CKKA 5FRNA 3CPWA 3E9GA 2F5KA 2OTJT 4IKFA 1YJWA 2D9TA 3OYYA 1JJ2S 1VQ6A 2DIQA 4CRIA 1YHQA 3CCET 3CCUT 3MO8A 3OYKA 4N4IA 3MEUA 2RJCA 2OTLT 2M16A 3DB3A 3TREA 4PLLA 3OYEA 2M1HA 1VQ7A 2BKDN 3DB4A 3DLLA 1KD1U 2RHYA 3CCLA 1WJQA 2R5AA 2EQMA
chains in the Genus database with same CATH superfamily
1FXXA 3OYGA 3Q1JA 3VS0A 1VQ4A 2OX7A 5CK9A 4MZPA 2YRCA 1VQ9Q 3S3MA 4Q5WA 4C92E 3CCJT 2RHIA 1TOVA 5LJ3g 1C6VX 2KBTA 4HT9A 1M3BA 4F7UF 2YXYA 3LGFA 4FSXA 2RJEA 1VQ4T 2EWNA 3THKA 1UE9A 2BZ8A 1PHTA 1ZA1B 4AMCA 3VS5A 2RA2A 3MKDA 3JB9I 3JCMW 1WQWA 2ABLA 1QVGA 3CMAQ 2K9GA 4HT8A 1ZQ1A 4KH1B 2EYQA 4HCBA 2G3RA 2I2LA 3BW1A 3O8VA 1QVFA 3EGDB 2HQXA 3PVQA 3MHXA 2CH4A 2FVUA 2A7YA 2VC8A 4OMFB 3NMZC 3CC2T 4F17A 1XOVA 3F70A 3OW2A 2K5FA 4IUTA 1UFFA 4ZN3A 2ZCFB 2V1RA 1UJYA 1OX8A 1D09B 3L1AA 4J9FA 1WX6A 1PD0A 2ZPHB 2AT1B 3CCSA 3A5ZB 1VQ9T 1VQ5Q 2V1QA 3CMAA 2K4YA 2K57A 2KMTA 1PD1A 1WJSA 2CP6A 3ZBDA 2RO0A 4J7IA 4PJOF 3JB9J 3ZFJA 2DM1A 4ORZA 2D8JA 1M2VA 1K9MC 3OB9A 4DBQA 5KYXA 1D3BB 3JCMd 2VASA 5M9OA 2AHJB 4GLMA 2DD5A 4HXJA 4LXCA 5GAMg 3CMAT 1I81A 3FEOA 4FW1A 2D1XA 2RNAA 2QXFA 1M8MA 4M77G 2DERA 2E6ZA 2O2OA 4CC3A 1YCSB 1Y96B 4J9EA 3CBPA 1C1AA 4PJOB 4CC4B 1VQ5A 4BUGA 2OI3A 3RKXA 1PRLC 2DL5A 3LH5A 2P0PA 2GFAA 3JCMh 2CT3A 1YN8A 1NPRA 3M59A 2QYZA 5FU7B 1FMWA 2RPNA 4C5GA 3RUXA 3C0CA 1WGSA 4PFPA 3CPWP 1R0BG 3S6WA 4JZ4A 1VQ5T 4M78C 2COYA 7AT1B 1ABOA 2FRWA 1AZEA 4TVRA 1Y0MA 4FU6A 2MMPA 1RUWA 2GNCA 3A8OB 4OB3B 4A4HA 2BZXA 1M5Q1 3QWYA 3TVTA 1Q86U 3VYHB 2GF7A 3S3OA 3H0IA 2CZ1B 1M1GA 2VV5A 2RI2A 1JQQA 3V8KA 4C8QC 1ZUKA 4ANJA 1KD1R 3OYHA 2MK5A 4D6WA 2EGAA 1AT1B 1VQOQ 1WLPB 1NJIC 5HK3A 3PMTA 3HFOA 2VGMA 2X4WA 4EIKA 2DYBA 5CVIA 3UWNA 2E70A 4CI0C 4XU1A 1K76A 2F5TX 5LJ5f 5LJ3h 4ZNXA 2EGEA 2NUZA 6AT1B 2LMJA 5LJ5d 2XKOC 4II1A 2KSSA 3OS2A 3HL8A 2KK4A 2HBPA 2EYYA 2DL3A 4M4ZA 1VQPA 2RQTA 2CH4W 4LDXA 2F2XA 2AK5A 1LVKA 4QVZA 3OBYA 1KC8U 1PCXA 5EG2A 4C0ZA 4C0DB 2RHZA 1OU9A 4IUVA 2DIGA 2JMCA 3VS7A 1OOTA 1YI2Q 3NTKA 2JM8A 2DFUA 1VQ8A 2K3YA 4OP0A 3M5AA 4J8OA 2A08A 4M7AE 1VQOT 3EG1A 1KJWA 1IGQA 1P92A 1ZBXA 5D6WA 5I22A 4PK4A 5CKHA 4AT1B 5GAMd 1U3OA 3VRYA 2K2VA 3PVLA 3UPUA 4F7UG 2MWPA 2NUTB 3VUZA 3OS0A 5GMKe 3M53A 4OB2B 1M3AA 4M7AD 1PKSA 2VKNA 1HK9A 3JV3A 2Y90A 3CCEA 1WA7A 2RQUA 2XIDA 5GAN3 4P5NA 1PSEA 1Q81U 2OTLA 5D7UA 3VKIA 5GAMh 3PMIA 1MHNA 1SHFA 2X3XD 3MEAA 1AEYA 1M2VB 2KI7A 4RMOA 5KYXB 5LL6S 2GGRA 4M75E 1WHJA 2GFUA 3CQTA 1YI2T 2DJQA 2BE9B 4OMOA 1NZ9A 1ZHIA 1KQ2A 4OGCA 2CP2A 3NTHA 3VS4A 2COWA 3ASKA 2KRMA 1GBQA 2O9VA 4M77A 3GBQA 3JCMb 1ACMB 1WI7A 3M0PA 3GNFB 2ESWA 1WHGA 1OPLA 2ZPGB 1ABQA 2GTOA 3CBMA 2F69A 2EW3A 4PJJA 3L42A 2GBQA 2QDLA 4HVWA 4XTVA 4RCCA 5LJ5j 1KK7A 2A36A 2A37A 2E3IA 2DE0X 1E7OA 3AHUA 4MDWA 4PJOC 3OY9A 3RERA 2EPDA 3CCQA 3LWIA 1SRLA 2DXUA 4A54A 2EQIA 1BI3A 4OB0B 4AG1C 3O5ZA 5J3BA 1QKXA 4ZN1A 5FU7C 2VVKA 4RTYA 3VS2A 4AFZC 1VQMA 3BY7A 3LLRA 5AYFA 4RTUA 2H3JA 1VA7A 3BFMA 2LNVA 2MWOA 2IIMA 5GANf 4JUVA 2KAFA 4XTUA 3EGXA 3GP8A 3CCUQ 2XK0A 3FB9A 1M1KC 4M75F 3EFOA 3QUIA 1BIAA 1WXTA 1WPYA 2V8JA 2C0TA 1M90C 1ZBJA 1GL5A 1YHQQ 2E4HA 2E6NA 4GLKA 3QBYA 3PFSA 1PSFA 2FB7A 4EMKC 3GOXA 3OSSC 1MMDA 2V8KA 3SWNA 3KBGA 3JB9D 2LNHB 3H8ZA 1QCNA 1VYTA 1NE8A 2AZSA 1RACB 2E5KA 3A1PA 3G1JA 2EIFA 1G83A 3I55A 2ZAEA 4MZMA 2OAWA 4JRIA 4DEXA 1RL2A 2F2VA 1QVPA 2RD1A 1R0CB 4OB1B 1Q82C 3RBBB 1YIJT 3QJYA 3OS5A 4HCKA 2CKKA 3CCRQ 2F5KA 1N6AA 3REBB 3OYYA 1ZSZA 1JJ2S 2ATCB 3VS1A 2OAUA 4J6XA 2DIQA 1ARKA 1GBRA 1YHQA 3MPUB 3CCUT 2HL5C 2CP7A 2PVDB 2HSPA 2X4JA 1NLPC 2QTXA 3X26B 3JRZA 2DPPB 3E1SA 1FWZA 4PLLA 4M78D 2QEXQ 2EVRA 5GAOl 1C0MA 4OMNA 1KD1U 4AFSC 2EQMA 2K6DA 3FIFA 1YHQT 4C8QE 4FL6A 1NG2A 2DF6A 2QG9B 2EGCA 3HPWA 3FDRA 1IB8A 2O31A 4C8QD 1WHLA 2DVJA 4M7DA 1UECA 2QI2A 1W2BS 2DXTA 4A4GA 3OA6A 3CCRT 3LH0A 3G4SQ 5IT9E 4LN2A 3VJPA 2KNBB 5FU6B 2QQRA 2SRCA 3OYDA 2MOXA 4KGZB 2H8HA 5CO7A 2FO0A 2D0QB 4M77B 2KROA 3HTRA 3RKYA 4HCCA 1SG5A 3E9FA 2VWFA 3DLMA 5GANj 3CC4A 4MZTA 5KYUA 3V7SA 4FYWB 2QEXT 4A4FA 1UG1A 4J9CA 4X1VA 2LX7A 4E7ZA 4PJNA 1I5LA 2LCLA 2KYBA 2QQ9A 3TU4K 1UTIA 3MEVA 2V8IA 4NL3A 3G4SA 2K5IA 3GLXA 3NTIA 1RABB 1B34A 3M56A 4X9CA 4QKUA 1V1CA 3U23A 4J9DA 3TSWA 1IHVA 5DM7R 4C92A 2E12A 3X24B 2DJZA 4Z02A 4B6MA 1SSHA 1JBMA 1SEMA 3G4ST 1VQ7Q 2MYSA 4XAXB 4BI4A 4BE1A 3PT9A 5D6XA 4F16A 3EGXB 1PC0A 2HD0A 1NEGA 2CYZB 2B86A 3AT1B 4EDUA 3EFOB 2L5QA 4HVVA 5J26A 3OQ5A 1BKBA 2KY9A 2MPXC 2XU8A 3CCVA 4J9IA 4BI8B 1K8AR 4PFZA 1G2BA 1RAGB 2YDLA 1VIFA 1K73C 1VIEA 4OMPA 1J3TA 4KUIA 3M54A 4Y91A 3SWNB 2OJ2A 4FCYA 4JZ3A 2FL7A 3NGPA 3OYMA 1UGVA 2K2MA 2LT4A 4D8DA 1KQ1A 1OQKA 4M75G 2KE9A 2YUOA 1M9SA 2DXCA 3V8LA 4ME7A 1HSQA 1BI0A 2ZPIB 4FYXB 1VQ7T 1IGUA 1NYGA 4J6YA 4RTWA 3H9NA 2LJ3A 1ZSZB 4Y28E 1R77A 2BUDA 2FEIA 2QTVA 1KQSS 1T3SA 2LQ8A 2BZYA 3M0RA 3CCSQ 5GMKl 1WFWA 1VQNQ 1PWTA 2X9HA 4PJOD 3OYLA 4M7DF 5I2MA 4QQ6A 4RCBA 3H0HA 4F7UB 2YRVA 5LJ5g 2CP5A 3MCAB 3QWXX 4E7IA 3GF5A 4ZGJB 2HDAA 3FLGA 3J80E 2JM9A 2Z0WA 4XTZA 4LDVA 5DLQE 4FSSA 1U8RA 4WCIA 2R58A 1G3YA 3G6EQ 5IHIA 2PVGB 1WIEA 1K73U 2DILA 2KVQG 4KRTA 1I1JA 1RLPC 4LE9A 2IG0A 2CSQA 3EG3A 1Q86C 1VQNA 1PM3A 2A28A 1Z9ZA 4X9DA 3JCMe 4V2SA 4XU2A 1SSFA 2YHTA 1TXQA 2Y4YA 4J9HA 1VQLA 1UEBA 1GXIE 3CCST 2RN8A 2PUKB 2W0ZA 1VOMA 2HQEA 2DZCA 5DLOA 3CBOA 1CSKA 4JJCA 4C92F 3G6EA 4ZTFA 1WYXA 5HK0A 4K11A 5CQYA 1X75C 2HNIA 1QWEA 5FU6C 2QQAA 1JJ2P 3OYAA 1B34B 1WJRA 3X28B 2AKKA 2L2PA 1WHMA 1NBEB 4M77C 4A4KA 4MMLA 3EG9A 1Q7YR 2P84A 1BI2A 4ATOA 4BI3A 2QQSA 1KC8C 4RTTA 4XTWA 1AOJA 1NPPA 2DXBA 2MCNA 1IRXA 3GPLA 1WZOA 1B07A 2LT1A 3HKSA 2J6OA 4N0AC 2XDPA 2Y4XA 1U06A 5ECAA 5LJ3e 4LUEA 2DL7A 3OYFA 1MGQA 4LDWA 1BBZA 2VUBA 4M7AA 4E47A 2NUPA 4E7HA 1G5VA 1VQPQ 4DA4A 2RM4A 1W2BP 1AWWA 1SRMA 4EMKB 2HBWA 1F1BB 3GNGA 2QA4Q 4HCZA 1G3SA 2CSIA 3JCMc 2JN0A 3OMGA 4BACA 3VYGA 4HKEA 2EBPA 4PFOA 2HAXA 5GAOm 1Q81C 3VS6A 1CKBA 2ZGWA 1VQ8Q 3CD6A 1T0JA 1VYVA 2CZ0B 2EAYA 2EJ9A 2BE7D 4Y92A 1R8OB 5D6YA 4M75A 3C95A 3M58A 3M0SA 5DY9A 3JCMV 2DBMA 2DVEA 2KRNA 2QA4A 5CKBA 3SWNC 1JU5C 5LJ5h 1QVGS 2L3RA 5GANg 3CCEQ 2EFIA 4B9WA 1VQPT 1QVFS 2OTLQ 3MP6A 2DETA 3PNWC 5GAMe 1U1SA 2P4RA 3ER0A 2KQWA 3H0FA 4WF2A 2RK1A 2QA4T 1MMGA 2A3LA 2DBKA 2FPDA 4KBMB 5KYWA 4VUBA 2QQBA 3OW2S 5IHNA 1ZSZC 2J7IA 5CKDA 1OI1A 3EG0A 5KH6A 1VQ6Q 3HSBA 2XI9A 3EH1A 3REAB 1UGPB 4KUDK 3WXMB 4FIBA 1UB4A 1K9AA 1D1CA 1VQ8T 1K8AU 4ELYC 2MAMA 5GMKi 3I5RA 4PJLA 3C4SA 4QT7A 2WSCE 3CCLQ 4M7DG 1XJWB 1A0NB 3QYHB 4QW2A 2PQWA 5A2QE 1TH7A 2PZ1A 5HY6A 3RDVA 1MNDA 1U5SA 1D1AA 5FRNA 2DTHA 2DD4A 3CPWA 1NEBA 1YJWA 1VQ6A 1M3CA 2EYXA 3CCET 2X51A 4M7DC 2PVOB 1Z9QA 4N4IA 4E7SA 2OTLT 2DK3A 2M16A 4J7FA 1AWOA 1SF9A 1NM7A 3CCQQ 3DLLA 1LNXA 3CCLA 2KT1A 1WJQA 3FC3A 4DEYA 1BCOA 5C6SA 2K3BA 3OSVA 3M4GA 3HHTB 1GFCA 1VQMQ 1KQSP 2XDBA 2E41A 1TUCA 2O4XA 1VQKQ 3L2QA 1OZ2A 1TWBA 4M7AF 2HKQB 2DX1A 3CCLT 2CS7A 4RTZA 5KCOA 1V76A 4C92G 3G7ZA 3H6ZA 1QP2A 2L3PA 2YUQA 4C0FA 3FJ5A 2FZCB 1K0XA 2X35A 2ROTA 3M9QA 5C0MA 4JJBA 3M0QA 1H641 4BE0A 5GAN2 2KRSA 4NS5A 1MMNA 1DJ7B 4PLIA 1OEBA 3JCMP 4L59A 4E7JA 2ENMA 4C92C 3PIOA 2ED0A 4GBQA 4FT2A 2JXBA 3ZL7C 1VQKA 2D0NA 3CCQT 2QDYB 2QGGA 3L2VA 2BTTA 5IXFA 2LTOA 4MMKA 1KD1C 2CUBA 3BDLA 5GANd 1ZSGA 2J06A 2DTIA 1QMCA 1CKAA 3I55Q 1I4K1 5GMKm 1NLOC 5J39A 3X20B 4C8QA 1VQMT 1N8RR 2FRYA 3LYIA 4Z8AA 3C12A 2DEQA 3NPFA 1B3QA 1V29B 1KFZA 4PKCC 2J6KA 3JAME 3HFNA 1X6BA 1O9SA 3C94A 1GRIA 3SEMA 1X2KA 2LRQA 3E2UA 5GANh 4M75B 3CCMQ 3QYGB 3HP9A 2P4TA 5IXBA 1WXBA 1Q7YU 4C5HA 3M4YA 2ROLA 1G3WA 1BCMA 2M51A 3CXCS 3RIRA 4M78E 5GMKj 1LOJA 1JRIA 2R5MA 4M77D 2R57A 3I55T 2YUPA 1RAAB 1WDXA 3QPHA 1SKUB 3CCMA 2RF0A 4N4GA 2RB6A 1UGQB 3RMQA 5CKEA 5GAN8 3SFMA 1WHHA 1GCQA 4X34A 4OMQA 3OS1A 2O88A 4FW2A 3I5SA 4A4EA 3CC4Q 5CIUA 1N9RA 3I56A 1YCYA 2HSEB 1U1TA 1UDLA 2HQHA 2E64A 4E7KA 3EGDA 1FMVA 1D0YA 3JB9F 1JXMA 5KCHA 4GY5A 1ZUUA 2LCSA 1X69A 1WNLA 3P8DA 4DOVA 1S72A 1YWOA 3S3NA 2PTKA 2M0OA 2LP5A 1TS9A 4LDYA 5IAYA 1Q95G 1X01A 3RESA 4FYVB 2J6FA 2O4XB 3M0UA 2VYTA 4YTLA 1QVGP 2HKNA 2DEUA 1TG0A 4M78F 2LC4A 1K9MR 4F04B 4BE2A 2FZKB 1QVFP 2W10A 4NOYA 1KSWA 3QDFA 1D3BA 2L3SA 2RH2A 2ZPEB 4N4HA 2GTJA 3CC4T 3UATA 2V26A 3OW2P 2OTJQ 2DRKA 2VXEA 3EFRA 2H3EB 5GAN7 5I11A 2K5LA 2J05A 2JS2A 3EFSA 3CCVQ 3VUBA 4FYYB 4C8QF 5FWBA 5A0LA 1YJ9A 4F14A 2LDMA 1X6GA 3TQ7P 1X6OA 1X27A 2CDTA 2DO3A 1OU8A 4M7AG 4LD6A 1HJDA 3A8LB 4F7UE 4EPCA 2AZVA 1RI0A 1WQ7A 2RK2A 4J83A 2EQUA 2QASA 3SHWA 4DBRA 1I0CA 2OTJA 4BY6B 1Y07A 1N27A 4XQ3A 3WVEB 3ULRB 3VRZA 2EQKA 4XTXA 3UDCA 2C06A 1M4ZA 1N8RC 2CUDA 3QO3A 2P0QA 3ME9A 1YITQ 1KHCA 4DOWA 2HEQA 3LWHA 4NL2A 2B8AA 4XU0A 1IZ6A 1M27C 1AHJB 4M7DD 2RHUA 1H3HA 2DAQA 1GCPA 2EJFA 4XTYA 3CCVT 3QIIA 1EZZB 1NJIR 5IHKA 1HD3A 1M2OA 3EGUA 2YLCA 3CCJA 1YP5A 1FMKA 2XDDA 4L6V5 2LQWA 3UA6A 4PJOE 1YITA 4M75C 3OYIA 2NWMA 2JVVA 3L2UA 1MV3A 2XG8D 2PNIA 3SD4A 2DMOA 2RHXA 3PE0A 1D0XA 4JLGA 2ZPBB 4J9GA 5FLXE 1HXDA 3PTAA 1YITT 1H92A 1H8KA 3M55A 1M30A 3EG2A 1VQLQ 3CC2A 2COZA 4C92D 1UUEA 4E6RA 1N8RU 2EYWA 2DLPA 2RQVA 4DBHA 4JLIA 3MP8A 2KYMA 4ZTJA 1FYNA 4M7DB 3KUFA 5KYNA 3A8GB 2X3WD 1TSFA 2DYIA 4IIOA 1ZA2B 3PIPA 2EJGA 1VQ9A 4A53A 2XMFA 3JCMX 2LQKA 3ZEHA 3KFVA 4QVDA 3N5BB 2FYKA 2NUTA 2JW4A 2HCKA 2WSFE 2K3XA 4IIMA 4OGEA 2XHCA 1TUGB 3QDRB 1YFNA 2L3QA 2DNUA 4Z88A 5FW9A 5A0GA 2FPEA 4JJDA 3CPFA 5KYUB 2HZYA 2E3HA 4L5GA 2VXFA 1VQNT 3JB9G 4J9BA 1I07A 2AIRB 2CGHA 8ATCB 1T0HA 3P8HA 3T9NA 4ELZC 3I35A 3CXCP 3JCMf 5CAIA 3P8BB 1VQLT 2RQWA 3MJXA 3OYCA 4OF1A 2K79A 1ZX6A 1XTDA 2K7AA 3G6ET 1M8VA 4FT4A 4C92B 3URGA 5CKFA 5GAN4 5FRMA 2C0IA 2JTMA 2RQRA 2CREA 1MUZA 4IKFA 2XD0A 4M78G 3OBWA 4CRIA 3INZA 1NYFA 2C0OA 1YNZA 3OYKA 2PUOB 2RJCA 2L0AA 3RR6A 3M57A 3TCJA 3OYEA 1D1BA 3CD6Q 3V7CA 3D7SB 3DB4A 4DBFA 4QQGA 1LPLA 3RKWA 2I0NA 1E6GA 3L2ZA 2FG0A 3RNJA 4KULA 2LX9A 4KGVB 2GQIA 2G6FX 2O9SA 3LGLA 4C8QG 3SB2A 1AVZC 4IUUA 1K8AC 4C5IA 1RI9A 5LJ5e 5HCKA 1BK2A 1UGRB 2D8HA 4C5EA 5LJ3f 1KG1A 3R6OA 2YUNA 4A63B 4R56A 5CR2A 1QLYA 2X4YA 2IPOB 5LJ3d 1FX7A 1JXOA 4JRQA 2KDSA 1K9MU 3UT1A 4BY6C 4LD9K 3LX7A 1N9SA 1M1KR 2FPFA 2DRMA 2E65A 1LJOA 1PNJA 3RMSA 2DZ9A 2P0KA 2ECZA 3UA7A 1M90R 4B9XA 1RLQC 1EIFA 5IH2A 4JRKA 2PU9B 2E5QA 3CD6T 4RUGA 2FZGB 2CT4A 2F1LA 3J81E 4IUQA 4RKUE 3QHSA 2YLBA 1QKWA 5FWCA 2ZPFB 5GAOp 2KXCA 2RJFA 3SDZA 1VQOA 1Q82R 2JOYA 3BE3A 1YJWQ 4AFQC 1OZ3A 3VU3C 2L8DA 2O01E 3A8HB 4AG2C 3OYJA 2DKGA 3TEEA 1XQHA 1G3TA 2YSQA 3IQLA 3CXCA 2AKLA 1JJ2A 4ESRA 1O75A 5GAMf 2EYZA 5GAOr 3HRUA 1GCQC 4LDUA 4RG2A 1VYUA 2CZ6B 1OV3A 4JJNK 1Y7XA 1NJIU 1I5OB 4E7LA 2ZZDA 1QQJA 2RMOA 2DL8A 5L8RE 1AZGB 1YI2A 4PJMA 4JS5A 3JCMJ 4C0GA 2L89A 3MEWA 3OYBA 2WACA 1OX9A 4D8KA 2SEMA 1YJWT 2EKHA 3OMCA 4RG8A 4PL6A 2JUFA 4CC2A 1VQ6T 2JTFA 4XU3A 2D6FA 4LNPA 1TUDA 1PRMC 3FRNA 1W2BA 1HYOA 2GCXA 5GMKh 1IO6A 3EG9B 2BIVA 3OYNA 5LJ3j 1BI1A 4OVAA 5HKCA 1Q7YC 4J5YA 4M75D 5GAOq 2VB6A 1QW1A 8AT1B 2LVMA 5GJWB 3L2WA 1W4SA 4PJOG 1EFNA 1IXDA 1AD5A 4BB7A 3WVDB 1K0SA 4O6JA 2M02A 4M78A 3LW5E 4M7AB 3VS3A 2RJDA 1K4US 2NUPB 1KIKA 4BD3A 2JS0A 1MV0B 1E6HA 4IUPA 4N0AA 3QZ5B 3R6NA 2JT4A 5GANe 2JNGA 1W70A 1W1FA 1SHGA 2E1HA 4JRPA 1QCFA 1RAEB 3JSCA 3EH2A 2HL3A 4E2FB 1OULA 2CP3A 3G71Q 1YIJQ 5I2SA 1AWJA 1VQKT 2JZ2A 1W6XA 5KYYA 4BDZA 1UGSB 5IN1A 1GFDA 1JB0E 2EKOA 5A0DA 2MIOA 1LCKA 1G8XA 5GAMj 1YWPA 1YBYA 1KHIA 3QXEB 1K73R 1BIBA 4M77E 1QP3A 4R55A 1TU0B 1Y57A 2EQJA 1BYMA 3G71A 4EMGA 3CMEQ 1YIJA 2X4XA 4RTVA 2KEAA 1IREB 1S1NA 3PGGA 2M9UA 5KE3A 4KH0B 4FM4B 3I56Q 1ZLMA 5KYWB 1PG5B 3CCUA 3QSUA 1AWXA 3G71T 4WTOB 1M1FA 1T3LA 3HRTA 3CC7Q 2NYSA 1H3ZA 1MMAA 3VV0A 1JEGA 4KT0E 3MP1A 4JPBW 4CC7A 1SPKA 3DKMA 1S72Q 2JJ9A 1QWFA 3JCMQ 1BB9A 2DTOA 3CMEA 4O5VA 1XNIA 2WSEE 3J7AF 1RAFB 1KQSA 2LJ1A 3CCMT 4C0DC 1IHWA 3CPWS 3E19A 4UC4A 2LQNA 2RI5A 2YRDA 1WHKA 4IURA 1D0ZA 3I9QA 3QZ9B 1K1ZA 2CP0A 1M1KU 4F7UA 1RAIB 3EAEA 3CMET 4ZGEB 1YJNQ 2A0FB 3CCRA 3CC7A 4RTXA 2QGFB 2FHDA 2LZ6B 5EC7A 2DL4A 5GAN5 1M90U 3CEYA 3I56T 2HMAA 4J6WA 5GAN6 3KXTA 4QQDA 1Q86R 3QJ6A 4M77F 2XICA 1X2QA 1WXUA 5GAOn 1JO8A 3FJPA 1YJ9Q 2KXDA 2KGTA 2QEXA 1Y71A 3CC7T 4AFUC 4QVCA 1OPKA 2CZ7B 1I8FA 3NFCA 2GQVA 2QK0A 4R0KA 1VUBA 1ZUYA 5CQXA 4KGXB 1S72T 1Q82U 4LUDA 2JTEA 4ZGDB 1RAHB 1YJNA 3QG1A 1X43A 2ED1A 3NHNA 2RI3A 4MDXA 2NLUA 3EHRA 2JMAA 2LCCA 3EHQA 2QAZA 4M78B 3M0TA 2YWWA 1Y96A 1BU1A 9ATCB 3L2RA 4PJOA 5I21A 3META 2E10A 1YJNT 4EMHA 3QKJA 1OYXA 4JS4A 1UJ0A 4Z89A 5KE2A 5FROA 1KC8R 3V7RA 3JB9H 3V8JA 3A98A 4C8QB 1YJ9T 3JCMg 4BDYA 4M7AC 3CCJQ 4M7DE 1EX4A 1RADB 5KYYB 3GIBA 3HRSA 4HA8A 2MI6A 3A8MB 1UHCA 1VQ4Q 4XK8E 2MF2A 1N5ZA 1UHFA 2KT8A 3BDUA 4JDSA 2KR3A 2YT6A 5GJVB 3E9GA 2OTJT 3UF4A 2D9TA 4PNOA 1TTHB 2LJ0A 3H41A 1PKTA 2M0YA 2IVWA 3X25B 3MO8A 4HVUA 4OMMA 5L23A 2DA9A 1B7TA 4EMKA 3MEUA 2F2WA 1MNEA 3DB3A 3TSZA 4OMLA 3TREA 4DQ2A 2M1HA 1VQ7A 3CC2Q 2BKDN 1QCOA 1Q81R 5CCAA 2RHYA 2VGNA 2R5AA 5AT1B
chains in the Genus database with same CATH topology
3FIFA 5C6SA 1FXXA 3L2ZA 3OSVA 3M4GA 4KULA 3OYGA 1YHQT 2LX9A 3HHTB 3Q1JA 4C8QE 1VQ4A 3LGLA 2XDBA 4FL6A 4C8QG 2E41A 2O4XA 5CK9A 3HPWA 1Q82C 4MZPA 3L2QA 3SB2A 4IUUA 1K8AC 3FDRA 4C5IA 1OZ2A 3S3MA 5LJ5e 4M7AF 4Q5WA 1UGRB 4C92E 4C5EA 3CCJT 2RHIA 5LJ3f 1KG1A 3R6OA 2CS7A 5KCOA 4C8QD 5LJ3g 4R56A 3CCLT 5CR2A 4M7DA 4C92G 3G7ZA 2X4YA 5LJ3d 3H6ZA 2QI2A 4HT9A 1QP2A 4F7UF 1FX7A 4C0FA 3LGFA 4FSXA 2RJEA 1VQ4T 4JRQA 1W2BS 2EWNA 2DXTA 2KDSA 4A4GA 2X35A 3M9QA 5C0MA 3UT1A 4BY6C 1K9MU 3LX7A 3OA6A 4LD9K 3CCRT 3LH0A 5IT9E 1H641 1N9SA 2RA2A 3VJPA 4NS5A 5FU6B 5GAN2 3JB9I 4BE0A 3JCMW 1WQWA 2QQRA 1DJ7B 2E65A 4PLIA 3JCMP 1QVGA 4L59A 3OYDA 1LJOA 3RMSA 2DZ9A 1ZQ1A 2P0KA 4E7JA 4HT8A 2EYQA 4C92C 4HCBA 3PIOA 2G3RA 2I2LA 3BW1A 4FT2A 3O8VA 5CO7A 1QVFA 2HQXA 2D0QB 4M77B 1VQKA 4B9XA 3MHXA 1EIFA 3RKYA 2FVUA 2A7YA 3E9FA 4JRKA 3CC4A 3DLMA 2VC8A 5GANj 4HCCA 2PU9B 2E5QA 4MZTA 4OMFB 3V7SA 3CD6T 3CCQT 3CC2T 2QDYB 2QEXT 1XOVA 4A4FA 3F70A 3L2VA 3OW2A 2K5FA 4IUTA 3J81E 2LTOA 4MMKA 1KD1C 4IUQA 4RKUE 3QHSA 3BDLA 2ZCFB 4ZN3A 5GANd 1I5LA 2DTIA 2LCLA 2YLBA 1I4K1 2QQ9A 5GMKm 3TU4K 5J39A 3MEVA 3X20B 4C8QA 2ZPFB 5GAOp 1VQMT 3L1AA 2V8IA 4NL3A 3LYIA 3G4SA 2RJFA 2ZPHB 3SDZA 2K5IA 1VQOA 3GLXA 3CCSA 3A5ZB 3NTIA 3M56A 1B34A 3C12A 1VQ9T 2DEQA 4X9CA 2JOYA 1OZ3A 3VU3C 2L8DA 3CMAA 1V29B 2K4YA 2K57A 2KMTA 4PKCC 5DM7R 3JAME 4C92A 2O01E 2E12A 3A8HB 3HFNA 1O9SA 3X24B 3OYJA 3C94A 1WJSA 2DKGA 3TEEA 2DJZA 3ZBDA 4Z02A 2RO0A 4QQGA 1XQHA 4J7IA 4PJOF 3RKWA 2LRQA 3JB9J 5GANh 3ZFJA 4M75B 3QYGB 1K9MC 1JBMA 1G3TA 3OB9A 3G4ST 1D3BB 3JCMd 3CXCA 3HP9A 2P4TA 5M9OA 2AHJB 4XAXB 4BI4A 1Q7YU 1JJ2A 2DD5A 4C5HA 1O75A 3M4YA 5GAMf 5GAMg 4BE1A 5GAOr 3CMAT 1I81A 3FEOA 3PT9A 5D6XA 2QXFA 2HD0A 3HRUA 4M77G 2E6ZA 2CYZB 1G3WA 4LDUA 4RG2A 1Y96B 2CZ6B 3CBPA 4EDUA 4JJNK 4PJOB 1Y7XA 1NJIU 2L5QA 3CXCS 3RIRA 4M78E 5GMKj 1VQ5A 4E7LA 1LOJA 2ZZDA 1JRIA 5J26A 4BUGA 2R5MA 3RKXA 3OQ5A 1BKBA 2KY9A 4M77D 5L8RE 2R57A 2XU8A 2P0PA 3CCVA 1YI2A 2GFAA 3JCMh 1NPRA 4BI8B 3M59A 5FU7B 3I55T 4C5GA 3RUXA 4JS5A 1VIFA 3JCMJ 1WGSA 3QPHA 1K73C 3CCMA 4C0GA 1VIEA 4N4GA 2L89A 3S6WA 3MEWA 3OYBA 4KUIA 2WACA 3M54A 2RB6A 1UGQB 4Y91A 1VQ5T 1YJWT 3RMQA 4M78C 5CKEA 3SWNB 5GAN8 3OMCA 4RG8A 4PL6A 2JUFA 3SFMA 1VQ6T 2FL7A 3OYMA 4TVRA 4FU6A 2MMPA 2JTFA 4XU3A 4X34A 2LT4A 2D6FA 3OS1A 1KQ1A 3A8OB 4M75G 4OB3B 1M9SA 2DXCA 3FRNA 2GCXA 3V8LA 4ME7A 4A4HA 5GMKh 1W2BA 1M5Q1 4A4EA 1BI0A 2ZPIB 1Q86U 3OYNA 2BIVA 5CIUA 5LJ3j 1VQ7T 3VYHB 2GF7A 1N9RA 3I56A 1BI1A 3S3OA 1YCYA 4J6YA 4OVAA 5HKCA 1U1TA 1Q7YC 4J5YA 4M75D 2E64A 4Y28E 5GAOq 4E7KA 2CZ1B 2BUDA 1QW1A 1M1GA 2VV5A 3JB9F 2LVMA 2RI2A 3V8KA 4C8QC 1KQSS 3L2WA 1W4SA 5KCHA 4PJOG 2LQ8A 4GY5A 3OYHA 4D6WA 4BB7A 3WVDB 4O6JA 1NJIC 5HK3A 3PMTA 3HFOA 2VGMA 4M78A 5GMKl 1WNLA 2X4WA 3LW5E 3P8DA 4M7AB 2RJDA 4DOVA 1S72A 5CVIA 4PJOD 3S3NA 3OYLA 4M7DF 4BD3A 2M0OA 4IUPA 4N0AA 4QQ6A 3QZ5B 5I2MA 4RCBA 3UWNA 2E70A 4CI0C 4XU1A 2F5TX 5GANe 3FC3A 5LJ5f 2JNGA 4F7UB 2YRVA 4LDYA 5IAYA 5LJ5g 3MCAB 5LJ3h 1X01A 5LJ5d 3RESA 4E7IA 3GF5A 2XKOC 4II1A 4ZGJB 2O4XB 2E1HA 3FLGA 2VYTA 2KSSA 3J80E 4JRPA 4YTLA 3OS2A 3HL8A 4M78F 2KK4A 2HBPA 2LC4A 4XTZA 3JSCA 4LDVA 5DLQE 1U8RA 2R58A 1G3YA 4BE2A 1VQPA 2PVGB 1K73U 4LDXA 4NOYA 2KVQG 5I2SA 4QVZA 1D3BA 2RH2A 3OBYA 2ZPEB 4N4HA 1KC8U 2JZ2A 1VQKT 3CC4T 5EG2A 4C0ZA 4C0DB 2IG0A 2RHZA 1Q86C 4IUVA 2DIGA 2VXEA 3EFRA 5GAN7 1VQNA 4BDZA 2K5LA 1UGSB 5IN1A 4X9DA 3JCMe 1JB0E 2EKOA 3EFSA 5A0DA 4V2SA 4XU2A 1SSFA 3NTKA 3VUBA 2YHTA 2Y4YA 4C8QF 5A0LA 1VQ8A 2K3YA 1YJ9A 4OP0A 3M5AA 4J8OA 1VQLA 1UEBA 1GXIE 2LDMA 4M7AE 1X6OA 5GAMj 1VQOT 1YBYA 3CCST 1KHIA 2DO3A 1P92A 2PUKB 3QXEB 4M7AG 4LD6A 1ZBXA 1BIBA 2HQEA 2DZCA 4M77E 5D6WA 5DLOA 1QP3A 3A8LB 3CBOA 4EPCA 4C92F 5CKHA 4F7UE 4R55A 5GAMd 3G6EA 1RI0A 1WQ7A 2EQJA 2RK2A 2K2VA 1BYMA 4J83A 2EQUA 3G71A 4ZTFA 3UPUA 4EMGA 2MWPA 4F7UG 3VUZA 2X4XA 3OS0A 1YIJA 1IREB 3M53A 5HK0A 5GMKe 4OB2B 3PGGA 4M7AD 5CQYA 1X75C 2HNIA 2M9UA 5FU6C 2OTJA 5KE3A 4FM4B 4BY6B 2QQAA 1HK9A 1Y07A 1N27A 3OYAA 4XQ3A 2Y90A 3WVEB 1B34B 3CCEA 2EQKA 4XTXA 3UDCA 2C06A 1M4ZA 1WJRA 2XIDA 3CCUA 5GAN3 4P5NA 1N8RC 3QSUA 1PSEA 3X28B 1Q81U 4M77C 3QO3A 2P0QA 3ME9A 2OTLA 4A4KA 3G71T 4MMLA 1KHCA 3VKIA 4DOWA 5GAMh 3PMIA 1MHNA 1BI2A 1M1FA 4ATOA 3LWHA 4NL2A 2B8AA 4XU0A 3HRTA 4BI3A 2QQSA 1KC8C 3MEAA 4XTWA 1H3ZA 1IZ6A 3VV0A 1AHJB 1NPPA 2DXBA 4KT0E 4RMOA 4M7DD 3GPLA 3MP1A 2RHUA 2LT1A 5LL6S 2DAQA 2EJFA 4XTYA 3DKMA 4M75E 2GFUA 3CCVT 1YI2T 3JCMQ 3HKSA 3QIIA 2DTOA 3CMEA 4O5VA 4N0AC 1XNIA 2WSEE 2XDPA 2Y4XA 3J7AF 1NZ9A 1KQSA 5LJ3e 1ZHIA 1KQ2A 4OGCA 3CCMT 4C0DC 3CPWS 1YIJT 3OYFA 3E19A 4UC4A 2RI5A 2YLCA 1MGQA 3NTHA 2VUBA 4LDWA 4M7AA 4E47A 3CCJA 4E7HA 4IURA 1G5VA 3QZ9B 3ASKA 2XDDA 4L6V5 4M77A 4PJOE 1M1KU 4F7UA 3EAEA 3JCMb 4DA4A 1YITA 2RM4A 4M75C 3CMET 3GNFB 3OYIA 4ZGEB 4EMKB 2JVVA 3CCRA 3CC7A 2ZPGB 3GNGA 3L2UA 2FHDA 3CBMA 4HCZA 2XG8D 5GAN5 1G3SA 2F69A 3JCMc 2JN0A 3OMGA 1M90U 3CEYA 4BACA 3VYGA 4HKEA 3SD4A 3I56T 3L42A 4J6WA 2RHXA 2HAXA 5GAN6 4XTVA 4RCCA 5LJ5j 3KXTA 4JLGA 5GAOm 2ZPBB 4QQDA 5FLXE 3QJ6A 1HXDA 4M77F 3PTAA 3AHUA 2XICA 1Q81C 4MDWA 1YITT 5GAOn 3OY9A 2ZGWA 4PJOC 3RERA 3FJPA 3M55A 3CD6A 3CCQA 3CC2A 2CZ0B 2QEXA 1Y71A 2EAYA 3LWIA 3CC7T 2DXUA 2EJ9A 2CZ7B 4A54A 1I8FA 4C92D 1BI3A 4OB0B 4QVCA 3NFCA 5J3BA 1N8RU 2GQVA 1R8OB 1VUBA 4JLIA 3MP8A 4ZN1A 5FU7C 4ZTJA 5CQXA 1S72T 5D6YA 1Q82U 4M75A 3C95A 3M58A 1VQMA 3BY7A 3KUFA 4ZGDB 4M7DB 3LLRA 5DY9A 3A8GB 1YJNA 3QG1A 5AYFA 3JCMV 3PIPA 2DVEA 2QA4A 2RI3A 5CKBA 4MDXA 2EJGA 2H3JA 1VQ9A 3BFMA 2NLUA 4A53A 3SWNC 2LNVA 3JCMX 3G6ET 2MWOA 1M8VA 2LQKA 3ZEHA 4JUVA 2L3RA 2LCCA 5LJ5h 2KAFA 5GANg 4XTUA 5GANf 1QVGS 3GP8A 4M78B 4QVDA 3N5BB 2EFIA 2FYKA 4B9WA 1Y96A 2WSFE 2XK0A 1VQPT 3L2RA 3FB9A 2K3XA 1M1KC 1QVFS 4PJOA 4M75F 4OGEA 2XHCA 3QUIA 3MP6A 5I21A 3META 3PNWC 3QDRB 5GAMe 1BIAA 1U1SA 2E10A 1YJNT 3ER0A 2KQWA 4EMHA 5A0GA 4WF2A 3QKJA 1OYXA 1WPYA 2A3LA 2RK1A 4KBMB 2QA4T 4VUBA 2QQBA 4JS4A 3CPFA 2V8JA 3OW2S 4L5GA 1VQNT 2VXFA 1M90C 5CKDA 1OI1A 5KE2A 5FROA 5KH6A 3HSBA 2XI9A 3V7RA 3JB9G 1UGPB 3JB9H 3V8JA 4KUDK 2E6NA 4GLKA 3WXMB 2CGHA 3QBYA 4FIBA 3PFSA 1PSFA 2FB7A 3P8HA 3T9NA 1UB4A 4ELZC 4EMKC 3GOXA 4C8QB 1VQ8T 1K8AU 3JCMf 4ELYC 5CAIA 1YJ9T 2MAMA 3OSSC 3P8BB 3JCMg 5GMKi 2V8KA 3SWNA 4BDYA 1VQLT 3KBGA 4M7AC 3JB9D 3C4SA 3OYCA 3H8ZA 4OF1A 4M7DE 2WSCE 1NE8A 3GIBA 2EIFA 1XTDA 3I55A 3CCLA 3HRSA 4M7DG 4HA8A 4MZMA 4FT4A 4C92B 3QYHB 4JRIA 2MI6A 3A8MB 2PQWA 1RL2A 2RD1A 1QVPA 4OB1B 4QW2A 3URGA 5A2QE 1TH7A 2MF2A 4XK8E 5CKFA 5HY6A 3QJYA 2JTMA 3OS5A 2CKKA 3BDUA 5GAN4 5FRMA 4JDSA 5FRNA 2DTHA 2DD4A 3CPWA 3E9GA 2F5KA 1N6AA 4IKFA 2XD0A 2OTJT 1YJWA 2D9TA 4PNOA 3OYYA 1JJ2S 2OAUA 4M78G 4J6XA 3OBWA 2DIQA 1VQ6A 4CRIA 1YHQA 3CCET 3INZA 3X25B 2IVWA 3CCUT 3MO8A 4M7DC 2PVDB 2X4JA 3OYKA 2PVOB 2QTXA 2PUOB 3JRZA 4N4IA 3X26B 4EMKA 2DPPB 3MEUA 2RJCA 2OTLT 2DK3A 2M16A 4J7FA 3E1SA 1FWZA 3DB3A 3TREA 4PLLA 3M57A 4DQ2A 4M78D 3TCJA 2M1HA 3OYEA 1VQ7A 3V7CA 2BKDN 5GAOl 3DB4A 3DLLA 5CCAA 1KD1U 2RHYA 1LNXA 2VGNA 1WJQA 2R5AA 2EQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C6S A;  3OYG A;  1YHQ T;  3Q1J A;  1VQ4 A;  3LGL A;  4FL6 A;  2O4X A;  3L2Q A;  4IUU A;  1K8A C;  3FDR A;  4C5I A;  1OZ2 A;  3S3M A;  4Q5W A;  3CCJ T;  4C5E A;  2RHI A;  3CCL T;  5KCO A;  2X4Y A;  3H6Z A;  3LGF A;  1VQ4 T;  2RJE A;  1W2B S;  2KDS A;  1K9M U;  4A4G A;  2X35 A;  3M9Q A;  5C0M A;  3UT1 A;  3LX7 A;  3OA6 A;  3CCR T;  3LH0 A;  5IT9 E;  4BE0 A;  4NS5 A;  2QQR A;  4PLI A;  1QVG A;  4L59 A;  3OYD A;  2P0K A;  4E7J A;  3PIO A;  2G3R A;  3O8V A;  1QVF A;  2HQX A;  1VQK A;  4B9X A;  1EIF A;  3E9F A;  3CC4 A;  3DLM A;  2E5Q A;  3CD6 T;  3CCQ T;  3CC2 T;  2QEX T;  4A4F A;  3OW2 A;  3F70 A;  3L2V A;  3J81 E;  4IUT A;  2LTO A;  1KD1 C;  4IUQ A;  4ZN3 A;  3BDL A;  2LCL A;  5J39 A;  3MEV A;  1VQM T;  3LYI A;  3G4S A;  2RJF A;  1VQO A;  3CCS A;  3A5Z B;  3NTI A;  1VQ9 T;  2JOY A;  1OZ3 A;  2L8D A;  3CMA A;  5DM7 R;  3JAM E;  3OYJ A;  1WJS A;  4Z02 A;  2RO0 A;  4QQG A;  2LRQ A;  1K9M C;  3OB9 A;  3G4S T;  3CXC A;  5M9O A;  1Q7Y U;  1JJ2 A;  4C5H A;  4BE1 A;  3CMA T;  3FEO A;  5D6X A;  2E6Z A;  4RG2 A;  4EDU A;  1NJI U;  3CXC S;  1VQ5 A;  4E7L A;  5J26 A;  2R5M A;  3OQ5 A;  1BKB A;  2R57 A;  1YI2 A;  3CCV A;  2GFA A;  1NPR A;  3I55 T;  4C5G A;  1WGS A;  1K73 C;  3CCM A;  4N4G A;  2L89 A;  3S6W A;  3MEW A;  3OYB A;  2WAC A;  1VQ5 T;  1YJW T;  3OMC A;  4PL6 A;  2JUF A;  1VQ6 T;  3OYM A;  4TVR A;  4FU6 A;  2JTF A;  4X34 A;  3OS1 A;  4A4H A;  1W2B A;  4A4E A;  1Q86 U;  3OYN A;  2BIV A;  5CIU A;  1VQ7 T;  2GF7 A;  3I56 A;  3S3O A;  4OVA A;  1Q7Y C;  4E7K A;  2BUD A;  1M1G A;  2LVM A;  2RI2 A;  1KQS S;  3L2W A;  5KCH A;  2LQ8 A;  4GY5 A;  3OYH A;  1NJI C;  3PMT A;  2X4W A;  3P8D A;  2RJD A;  1S72 A;  3S3N A;  3OYL A;  4BD3 A;  2M0O A;  4IUP A;  4QQ6 A;  3UWN A;  2E70 A;  3FC3 A;  2JNG A;  2YRV A;  5IAY A;  4E7I A;  4II1 A;  2O4X B;  3FLG A;  2VYT A;  3J80 E;  4YTL A;  3OS2 A;  5DLQ E;  2R58 A;  1VQP A;  4BE2 A;  1K73 U;  2KVQ G;  4QVZ A;  1VQK T;  1KC8 U;  4N4H A;  2JZ2 A;  3CC4 T;  2IG0 A;  1Q86 C;  2RHZ A;  4IUV A;  2DIG A;  1VQN A;  4BDZ A;  5IN1 A;  2EKO A;  1SSF A;  3NTK A;  1VQ8 A;  2K3Y A;  1YJ9 A;  1VQL A;  1UEB A;  2LDM A;  1X6O A;  1VQO T;  1YBY A;  3CCS T;  1KHI A;  2DO3 A;  4LD6 A;  2HQE A;  5D6W A;  3G6E A;  1RI0 A;  2EQJ A;  2EQU A;  3G71 A;  4ZTF A;  2MWP A;  1YIJ A;  3OS0 A;  2X4X A;  2OTJ A;  5KE3 A;  1N27 A;  3OYA A;  3CCE A;  2EQK A;  3CCU A;  1WJR A;  1N8R C;  1Q81 U;  2OTL A;  3ME9 A;  3G71 T;  1KHC A;  3PMI A;  1MHN A;  2B8A A;  1KC8 C;  2QQS A;  3MEA A;  1H3Z A;  1IZ6 A;  1NPP A;  3MP1 A;  2RHU A;  5LL6 S;  2DAQ A;  1YI2 T;  3CCV T;  2GFU A;  3HKS A;  3QII A;  3CME A;  1XNI A;  2XDP A;  3J7A F;  1NZ9 A;  1KQS A;  3CCM T;  3CPW S;  3OYF A;  4UC4 A;  2RI5 A;  3NTH A;  3CCJ A;  4E7H A;  4IUR A;  1G5V A;  3ASK A;  1M1K U;  3EAE A;  1YIT A;  3CME T;  3OYI A;  2JVV A;  3CCR A;  3CC7 A;  3L2U A;  2FHD A;  4HCZ A;  3OMG A;  1M90 U;  3CEY A;  4BAC A;  3I56 T;  3SD4 A;  3L42 A;  2RHX A;  4QQD A;  5FLX E;  3QJ6 A;  1Q81 C;  1YIT T;  3OY9 A;  3CD6 A;  3CCQ A;  3CC2 A;  2QEX A;  3CC7 T;  5J3B A;  1N8R U;  3MP8 A;  4ZN1 A;  4ZTJ A;  1S72 T;  5D6Y A;  1Q82 U;  1VQM A;  3KUF A;  3LLR A;  1YJN A;  3PIP A;  2QA4 A;  2RI3 A;  1VQ9 A;  2NLU A;  2MWO A;  3ZEH A;  1QVG S;  2L3R A;  2LCC A;  2EFI A;  4B9W A;  1VQP T;  2XK0 A;  3L2R A;  1M1K C;  1QVF S;  2K3X A;  2XHC A;  3MP6 A;  3MET A;  3PNW C;  1YJN T;  3ER0 A;  3QKJ A;  1OYX A;  2QA4 T;  3OW2 S;  3CPF A;  1VQN T;  1M90 C;  1OI1 A;  5KE2 A;  5FRO A;  5KH6 A;  2E6N A;  3QBY A;  3PFS A;  3P8H A;  3GOX A;  1VQ8 T;  1K8A U;  1YJ9 T;  3P8B B;  1VQL T;  4BDY A;  3KBG A;  3C4S A;  3OYC A;  3H8Z A;  2EIF A;  1XTD A;  3I55 A;  3G6E T;  2MI6 A;  4QW2 A;  2PQW A;  1RL2 A;  1Q82 C;  5A2Q E;  1YIJ T;  5HY6 A;  5FRM A;  2CKK A;  5FRN A;  3CPW A;  3E9G A;  2F5K A;  2OTJ T;  4IKF A;  1YJW A;  2D9T A;  3OYY A;  1JJ2 S;  1VQ6 A;  2DIQ A;  4CRI A;  1YHQ A;  3CCE T;  3CCU T;  3MO8 A;  3OYK A;  4N4I A;  3MEU A;  2RJC A;  2OTL T;  2M16 A;  3DB3 A;  3TRE A;  4PLL A;  3OYE A;  2M1H A;  1VQ7 A;  2BKD N;  3DB4 A;  3DLL A;  1KD1 U;  2RHY A;  3CCL A;  1WJQ A;  2R5A A;  2EQM A; 
#chains in the Genus database with same CATH topology
 1FXX A;  3OYG A;  3Q1J A;  3VS0 A;  1VQ4 A;  2OX7 A;  5CK9 A;  4MZP A;  2YRC A;  1VQ9 Q;  3S3M A;  4Q5W A;  4C92 E;  3CCJ T;  2RHI A;  1TOV A;  5LJ3 g;  1C6V X;  2KBT A;  4HT9 A;  1M3B A;  4F7U F;  2YXY A;  3LGF A;  4FSX A;  2RJE A;  1VQ4 T;  2EWN A;  3THK A;  1UE9 A;  2BZ8 A;  1PHT A;  1ZA1 B;  4AMC A;  3VS5 A;  2RA2 A;  3MKD A;  3JB9 I;  3JCM W;  1WQW A;  2ABL A;  1QVG A;  3CMA Q;  2K9G A;  4HT8 A;  1ZQ1 A;  4KH1 B;  2EYQ A;  4HCB A;  2G3R A;  2I2L A;  3BW1 A;  3O8V A;  1QVF A;  3EGD B;  2HQX A;  3PVQ A;  3MHX A;  2CH4 A;  2FVU A;  2A7Y A;  2VC8 A;  4OMF B;  3NMZ C;  3CC2 T;  4F17 A;  1XOV A;  3F70 A;  3OW2 A;  2K5F A;  4IUT A;  1UFF A;  4ZN3 A;  2ZCF B;  2V1R A;  1UJY A;  1OX8 A;  1D09 B;  3L1A A;  4J9F A;  1WX6 A;  1PD0 A;  2ZPH B;  2AT1 B;  3CCS A;  3A5Z B;  1VQ9 T;  1VQ5 Q;  2V1Q A;  3CMA A;  2K4Y A;  2K57 A;  2KMT A;  1PD1 A;  1WJS A;  2CP6 A;  3ZBD A;  2RO0 A;  4J7I A;  4PJO F;  3JB9 J;  3ZFJ A;  2DM1 A;  4ORZ A;  2D8J A;  1M2V A;  1K9M C;  3OB9 A;  4DBQ A;  5KYX A;  1D3B B;  3JCM d;  2VAS A;  5M9O A;  2AHJ B;  4GLM A;  2DD5 A;  4HXJ A;  4LXC A;  5GAM g;  3CMA T;  1I81 A;  3FEO A;  4FW1 A;  2D1X A;  2RNA A;  2QXF A;  1M8M A;  4M77 G;  2DER A;  2E6Z A;  2O2O A;  4CC3 A;  1YCS B;  1Y96 B;  4J9E A;  3CBP A;  1C1A A;  4PJO B;  4CC4 B;  1VQ5 A;  4BUG A;  2OI3 A;  3RKX A;  1PRL C;  2DL5 A;  3LH5 A;  2P0P A;  2GFA A;  3JCM h;  2CT3 A;  1YN8 A;  1NPR A;  3M59 A;  2QYZ A;  5FU7 B;  1FMW A;  2RPN A;  4C5G A;  3RUX A;  3C0C A;  1WGS A;  4PFP A;  3CPW P;  1R0B G;  3S6W A;  4JZ4 A;  1VQ5 T;  4M78 C;  2COY A;  7AT1 B;  1ABO A;  2FRW A;  1AZE A;  4TVR A;  1Y0M A;  4FU6 A;  2MMP A;  1RUW A;  2GNC A;  3A8O B;  4OB3 B;  4A4H A;  2BZX A;  1M5Q 1;  3QWY A;  3TVT A;  1Q86 U;  3VYH B;  2GF7 A;  3S3O A;  3H0I A;  2CZ1 B;  1M1G A;  2VV5 A;  2RI2 A;  1JQQ A;  3V8K A;  4C8Q C;  1ZUK A;  4ANJ A;  1KD1 R;  3OYH A;  2MK5 A;  4D6W A;  2EGA A;  1AT1 B;  1VQO Q;  1WLP B;  1NJI C;  5HK3 A;  3PMT A;  3HFO A;  2VGM A;  2X4W A;  4EIK A;  2DYB A;  5CVI A;  3UWN A;  2E70 A;  4CI0 C;  4XU1 A;  1K76 A;  2F5T X;  5LJ5 f;  5LJ3 h;  4ZNX A;  2EGE A;  2NUZ A;  6AT1 B;  2LMJ A;  5LJ5 d;  2XKO C;  4II1 A;  2KSS A;  3OS2 A;  3HL8 A;  2KK4 A;  2HBP A;  2EYY A;  2DL3 A;  4M4Z A;  1VQP A;  2RQT A;  2CH4 W;  4LDX A;  2F2X A;  2AK5 A;  1LVK A;  4QVZ A;  3OBY A;  1KC8 U;  1PCX A;  5EG2 A;  4C0Z A;  4C0D B;  2RHZ A;  1OU9 A;  4IUV A;  2DIG A;  2JMC A;  3VS7 A;  1OOT A;  1YI2 Q;  3NTK A;  2JM8 A;  2DFU A;  1VQ8 A;  2K3Y A;  4OP0 A;  3M5A A;  4J8O A;  2A08 A;  4M7A E;  1VQO T;  3EG1 A;  1KJW A;  1IGQ A;  1P92 A;  1ZBX A;  5D6W A;  5I22 A;  4PK4 A;  5CKH A;  4AT1 B;  5GAM d;  1U3O A;  3VRY A;  2K2V A;  3PVL A;  3UPU A;  4F7U G;  2MWP A;  2NUT B;  3VUZ A;  3OS0 A;  5GMK e;  3M53 A;  4OB2 B;  1M3A A;  4M7A D;  1PKS A;  2VKN A;  1HK9 A;  3JV3 A;  2Y90 A;  3CCE A;  1WA7 A;  2RQU A;  2XID A;  5GAN 3;  4P5N A;  1PSE A;  1Q81 U;  2OTL A;  5D7U A;  3VKI A;  5GAM h;  3PMI A;  1MHN A;  1SHF A;  2X3X D;  3MEA A;  1AEY A;  1M2V B;  2KI7 A;  4RMO A;  5KYX B;  5LL6 S;  2GGR A;  4M75 E;  1WHJ A;  2GFU A;  3CQT A;  1YI2 T;  2DJQ A;  2BE9 B;  4OMO A;  1NZ9 A;  1ZHI A;  1KQ2 A;  4OGC A;  2CP2 A;  3NTH A;  3VS4 A;  2COW A;  3ASK A;  2KRM A;  1GBQ A;  2O9V A;  4M77 A;  3GBQ A;  3JCM b;  1ACM B;  1WI7 A;  3M0P A;  3GNF B;  2ESW A;  1WHG A;  1OPL A;  2ZPG B;  1ABQ A;  2GTO A;  3CBM A;  2F69 A;  2EW3 A;  4PJJ A;  3L42 A;  2GBQ A;  2QDL A;  4HVW A;  4XTV A;  4RCC A;  5LJ5 j;  1KK7 A;  2A36 A;  2A37 A;  2E3I A;  2DE0 X;  1E7O A;  3AHU A;  4MDW A;  4PJO C;  3OY9 A;  3RER A;  2EPD A;  3CCQ A;  3LWI A;  1SRL A;  2DXU A;  4A54 A;  2EQI A;  1BI3 A;  4OB0 B;  4AG1 C;  3O5Z A;  5J3B A;  1QKX A;  4ZN1 A;  5FU7 C;  2VVK A;  4RTY A;  3VS2 A;  4AFZ C;  1VQM A;  3BY7 A;  3LLR A;  5AYF A;  4RTU A;  2H3J A;  1VA7 A;  3BFM A;  2LNV A;  2MWO A;  2IIM A;  5GAN f;  4JUV A;  2KAF A;  4XTU A;  3EGX A;  3GP8 A;  3CCU Q;  2XK0 A;  3FB9 A;  1M1K C;  4M75 F;  3EFO A;  3QUI A;  1BIA A;  1WXT A;  1WPY A;  2V8J A;  2C0T A;  1M90 C;  1ZBJ A;  1GL5 A;  1YHQ Q;  2E4H A;  2E6N A;  4GLK A;  3QBY A;  3PFS A;  1PSF A;  2FB7 A;  4EMK C;  3GOX A;  3OSS C;  1MMD A;  2V8K A;  3SWN A;  3KBG A;  3JB9 D;  2LNH B;  3H8Z A;  1QCN A;  1VYT A;  1NE8 A;  2AZS A;  1RAC B;  2E5K A;  3A1P A;  3G1J A;  2EIF A;  1G83 A;  3I55 A;  2ZAE A;  4MZM A;  2OAW A;  4JRI A;  4DEX A;  1RL2 A;  2F2V A;  1QVP A;  2RD1 A;  1R0C B;  4OB1 B;  1Q82 C;  3RBB B;  1YIJ T;  3QJY A;  3OS5 A;  4HCK A;  2CKK A;  3CCR Q;  2F5K A;  1N6A A;  3REB B;  3OYY A;  1ZSZ A;  1JJ2 S;  2ATC B;  3VS1 A;  2OAU A;  4J6X A;  2DIQ A;  1ARK A;  1GBR A;  1YHQ A;  3MPU B;  3CCU T;  2HL5 C;  2CP7 A;  2PVD B;  2HSP A;  2X4J A;  1NLP C;  2QTX A;  3X26 B;  3JRZ A;  2DPP B;  3E1S A;  1FWZ A;  4PLL A;  4M78 D;  2QEX Q;  2EVR A;  5GAO l;  1C0M A;  4OMN A;  1KD1 U;  4AFS C;  2EQM A;  2K6D A;  3FIF A;  1YHQ T;  4C8Q E;  4FL6 A;  1NG2 A;  2DF6 A;  2QG9 B;  2EGC A;  3HPW A;  3FDR A;  1IB8 A;  2O31 A;  4C8Q D;  1WHL A;  2DVJ A;  4M7D A;  1UEC A;  2QI2 A;  1W2B S;  2DXT A;  4A4G A;  3OA6 A;  3CCR T;  3LH0 A;  3G4S Q;  5IT9 E;  4LN2 A;  3VJP A;  2KNB B;  5FU6 B;  2QQR A;  2SRC A;  3OYD A;  2MOX A;  4KGZ B;  2H8H A;  5CO7 A;  2FO0 A;  2D0Q B;  4M77 B;  2KRO A;  3HTR A;  3RKY A;  4HCC A;  1SG5 A;  3E9F A;  2VWF A;  3DLM A;  5GAN j;  3CC4 A;  4MZT A;  5KYU A;  3V7S A;  4FYW B;  2QEX T;  4A4F A;  1UG1 A;  4J9C A;  4X1V A;  2LX7 A;  4E7Z A;  4PJN A;  1I5L A;  2LCL A;  2KYB A;  2QQ9 A;  3TU4 K;  1UTI A;  3MEV A;  2V8I A;  4NL3 A;  3G4S A;  2K5I A;  3GLX A;  3NTI A;  1RAB B;  1B34 A;  3M56 A;  4X9C A;  4QKU A;  1V1C A;  3U23 A;  4J9D A;  3TSW A;  1IHV A;  5DM7 R;  4C92 A;  2E12 A;  3X24 B;  2DJZ A;  4Z02 A;  4B6M A;  1SSH A;  1JBM A;  1SEM A;  3G4S T;  1VQ7 Q;  2MYS A;  4XAX B;  4BI4 A;  4BE1 A;  3PT9 A;  5D6X A;  4F16 A;  3EGX B;  1PC0 A;  2HD0 A;  1NEG A;  2CYZ B;  2B86 A;  3AT1 B;  4EDU A;  3EFO B;  2L5Q A;  4HVV A;  5J26 A;  3OQ5 A;  1BKB A;  2KY9 A;  2MPX C;  2XU8 A;  3CCV A;  4J9I A;  4BI8 B;  1K8A R;  4PFZ A;  1G2B A;  1RAG B;  2YDL A;  1VIF A;  1K73 C;  1VIE A;  4OMP A;  1J3T A;  4KUI A;  3M54 A;  4Y91 A;  3SWN B;  2OJ2 A;  4FCY A;  4JZ3 A;  2FL7 A;  3NGP A;  3OYM A;  1UGV A;  2K2M A;  2LT4 A;  4D8D A;  1KQ1 A;  1OQK A;  4M75 G;  2KE9 A;  2YUO A;  1M9S A;  2DXC A;  3V8L A;  4ME7 A;  1HSQ A;  1BI0 A;  2ZPI B;  4FYX B;  1VQ7 T;  1IGU A;  1NYG A;  4J6Y A;  4RTW A;  3H9N A;  2LJ3 A;  1ZSZ B;  4Y28 E;  1R77 A;  2BUD A;  2FEI A;  2QTV A;  1KQS S;  1T3S A;  2LQ8 A;  2BZY A;  3M0R A;  3CCS Q;  5GMK l;  1WFW A;  1VQN Q;  1PWT A;  2X9H A;  4PJO D;  3OYL A;  4M7D F;  5I2M A;  4QQ6 A;  4RCB A;  3H0H A;  4F7U B;  2YRV A;  5LJ5 g;  2CP5 A;  3MCA B;  3QWX X;  4E7I A;  3GF5 A;  4ZGJ B;  2HDA A;  3FLG A;  3J80 E;  2JM9 A;  2Z0W A;  4XTZ A;  4LDV A;  5DLQ E;  4FSS A;  1U8R A;  4WCI A;  2R58 A;  1G3Y A;  3G6E Q;  5IHI A;  2PVG B;  1WIE A;  1K73 U;  2DIL A;  2KVQ G;  4KRT A;  1I1J A;  1RLP C;  4LE9 A;  2IG0 A;  2CSQ A;  3EG3 A;  1Q86 C;  1VQN A;  1PM3 A;  2A28 A;  1Z9Z A;  4X9D A;  3JCM e;  4V2S A;  4XU2 A;  1SSF A;  2YHT A;  1TXQ A;  2Y4Y A;  4J9H A;  1VQL A;  1UEB A;  1GXI E;  3CCS T;  2RN8 A;  2PUK B;  2W0Z A;  1VOM A;  2HQE A;  2DZC A;  5DLO A;  3CBO A;  1CSK A;  4JJC A;  4C92 F;  3G6E A;  4ZTF A;  1WYX A;  5HK0 A;  4K11 A;  5CQY A;  1X75 C;  2HNI A;  1QWE A;  5FU6 C;  2QQA A;  1JJ2 P;  3OYA A;  1B34 B;  1WJR A;  3X28 B;  2AKK A;  2L2P A;  1WHM A;  1NBE B;  4M77 C;  4A4K A;  4MML A;  3EG9 A;  1Q7Y R;  2P84 A;  1BI2 A;  4ATO A;  4BI3 A;  2QQS A;  1KC8 C;  4RTT A;  4XTW A;  1AOJ A;  1NPP A;  2DXB A;  2MCN A;  1IRX A;  3GPL A;  1WZO A;  1B07 A;  2LT1 A;  3HKS A;  2J6O A;  4N0A C;  2XDP A;  2Y4X A;  1U06 A;  5ECA A;  5LJ3 e;  4LUE A;  2DL7 A;  3OYF A;  1MGQ A;  4LDW A;  1BBZ A;  2VUB A;  4M7A A;  4E47 A;  2NUP A;  4E7H A;  1G5V A;  1VQP Q;  4DA4 A;  2RM4 A;  1W2B P;  1AWW A;  1SRM A;  4EMK B;  2HBW A;  1F1B B;  3GNG A;  2QA4 Q;  4HCZ A;  1G3S A;  2CSI A;  3JCM c;  2JN0 A;  3OMG A;  4BAC A;  3VYG A;  4HKE A;  2EBP A;  4PFO A;  2HAX A;  5GAO m;  1Q81 C;  3VS6 A;  1CKB A;  2ZGW A;  1VQ8 Q;  3CD6 A;  1T0J A;  1VYV A;  2CZ0 B;  2EAY A;  2EJ9 A;  2BE7 D;  4Y92 A;  1R8O B;  5D6Y A;  4M75 A;  3C95 A;  3M58 A;  3M0S A;  5DY9 A;  3JCM V;  2DBM A;  2DVE A;  2KRN A;  2QA4 A;  5CKB A;  3SWN C;  1JU5 C;  5LJ5 h;  1QVG S;  2L3R A;  5GAN g;  3CCE Q;  2EFI A;  4B9W A;  1VQP T;  1QVF S;  2OTL Q;  3MP6 A;  2DET A;  3PNW C;  5GAM e;  1U1S A;  2P4R A;  3ER0 A;  2KQW A;  3H0F A;  4WF2 A;  2RK1 A;  2QA4 T;  1MMG A;  2A3L A;  2DBK A;  2FPD A;  4KBM B;  5KYW A;  4VUB A;  2QQB A;  3OW2 S;  5IHN A;  1ZSZ C;  2J7I A;  5CKD A;  1OI1 A;  3EG0 A;  5KH6 A;  1VQ6 Q;  3HSB A;  2XI9 A;  3EH1 A;  3REA B;  1UGP B;  4KUD K;  3WXM B;  4FIB A;  1UB4 A;  1K9A A;  1D1C A;  1VQ8 T;  1K8A U;  4ELY C;  2MAM A;  5GMK i;  3I5R A;  4PJL A;  3C4S A;  4QT7 A;  2WSC E;  3CCL Q;  4M7D G;  1XJW B;  1A0N B;  3QYH B;  4QW2 A;  2PQW A;  5A2Q E;  1TH7 A;  2PZ1 A;  5HY6 A;  3RDV A;  1MND A;  1U5S A;  1D1A A;  5FRN A;  2DTH A;  2DD4 A;  3CPW A;  1NEB A;  1YJW A;  1VQ6 A;  1M3C A;  2EYX A;  3CCE T;  2X51 A;  4M7D C;  2PVO B;  1Z9Q A;  4N4I A;  4E7S A;  2OTL T;  2DK3 A;  2M16 A;  4J7F A;  1AWO A;  1SF9 A;  1NM7 A;  3CCQ Q;  3DLL A;  1LNX A;  3CCL A;  2KT1 A;  1WJQ A;  3FC3 A;  4DEY A;  1BCO A;  5C6S A;  2K3B A;  3OSV A;  3M4G A;  3HHT B;  1GFC A;  1VQM Q;  1KQS P;  2XDB A;  2E41 A;  1TUC A;  2O4X A;  1VQK Q;  3L2Q A;  1OZ2 A;  1TWB A;  4M7A F;  2HKQ B;  2DX1 A;  3CCL T;  2CS7 A;  4RTZ A;  5KCO A;  1V76 A;  4C92 G;  3G7Z A;  3H6Z A;  1QP2 A;  2L3P A;  2YUQ A;  4C0F A;  3FJ5 A;  2FZC B;  1K0X A;  2X35 A;  2ROT A;  3M9Q A;  5C0M A;  4JJB A;  3M0Q A;  1H64 1;  4BE0 A;  5GAN 2;  2KRS A;  4NS5 A;  1MMN A;  1DJ7 B;  4PLI A;  1OEB A;  3JCM P;  4L59 A;  4E7J A;  2ENM A;  4C92 C;  3PIO A;  2ED0 A;  4GBQ A;  4FT2 A;  2JXB A;  3ZL7 C;  1VQK A;  2D0N A;  3CCQ T;  2QDY B;  2QGG A;  3L2V A;  2BTT A;  5IXF A;  2LTO A;  4MMK A;  1KD1 C;  2CUB A;  3BDL A;  5GAN d;  1ZSG A;  2J06 A;  2DTI A;  1QMC A;  1CKA A;  3I55 Q;  1I4K 1;  5GMK m;  1NLO C;  5J39 A;  3X20 B;  4C8Q A;  1VQM T;  1N8R R;  2FRY A;  3LYI A;  4Z8A A;  3C12 A;  2DEQ A;  3NPF A;  1B3Q A;  1V29 B;  1KFZ A;  4PKC C;  2J6K A;  3JAM E;  3HFN A;  1X6B A;  1O9S A;  3C94 A;  1GRI A;  3SEM A;  1X2K A;  2LRQ A;  3E2U A;  5GAN h;  4M75 B;  3CCM Q;  3QYG B;  3HP9 A;  2P4T A;  5IXB A;  1WXB A;  1Q7Y U;  4C5H A;  3M4Y A;  2ROL A;  1G3W A;  1BCM A;  2M51 A;  3CXC S;  3RIR A;  4M78 E;  5GMK j;  1LOJ A;  1JRI A;  2R5M A;  4M77 D;  2R57 A;  3I55 T;  2YUP A;  1RAA B;  1WDX A;  3QPH A;  1SKU B;  3CCM A;  2RF0 A;  4N4G A;  2RB6 A;  1UGQ B;  3RMQ A;  5CKE A;  5GAN 8;  3SFM A;  1WHH A;  1GCQ A;  4X34 A;  4OMQ A;  3OS1 A;  2O88 A;  4FW2 A;  3I5S A;  4A4E A;  3CC4 Q;  5CIU A;  1N9R A;  3I56 A;  1YCY A;  2HSE B;  1U1T A;  1UDL A;  2HQH A;  2E64 A;  4E7K A;  3EGD A;  1FMV A;  1D0Y A;  3JB9 F;  1JXM A;  5KCH A;  4GY5 A;  1ZUU A;  2LCS A;  1X69 A;  1WNL A;  3P8D A;  4DOV A;  1S72 A;  1YWO A;  3S3N A;  2PTK A;  2M0O A;  2LP5 A;  1TS9 A;  4LDY A;  5IAY A;  1Q95 G;  1X01 A;  3RES A;  4FYV B;  2J6F A;  2O4X B;  3M0U A;  2VYT A;  4YTL A;  1QVG P;  2HKN A;  2DEU A;  1TG0 A;  4M78 F;  2LC4 A;  1K9M R;  4F04 B;  4BE2 A;  2FZK B;  1QVF P;  2W10 A;  4NOY A;  1KSW A;  3QDF A;  1D3B A;  2L3S A;  2RH2 A;  2ZPE B;  4N4H A;  2GTJ A;  3CC4 T;  3UAT A;  2V26 A;  3OW2 P;  2OTJ Q;  2DRK A;  2VXE A;  3EFR A;  2H3E B;  5GAN 7;  5I11 A;  2K5L A;  2J05 A;  2JS2 A;  3EFS A;  3CCV Q;  3VUB A;  4FYY B;  4C8Q F;  5FWB A;  5A0L A;  1YJ9 A;  4F14 A;  2LDM A;  1X6G A;  3TQ7 P;  1X6O A;  1X27 A;  2CDT A;  2DO3 A;  1OU8 A;  4M7A G;  4LD6 A;  1HJD A;  3A8L B;  4F7U E;  4EPC A;  2AZV A;  1RI0 A;  1WQ7 A;  2RK2 A;  4J83 A;  2EQU A;  2QAS A;  3SHW A;  4DBR A;  1I0C A;  2OTJ A;  4BY6 B;  1Y07 A;  1N27 A;  4XQ3 A;  3WVE B;  3ULR B;  3VRZ A;  2EQK A;  4XTX A;  3UDC A;  2C06 A;  1M4Z A;  1N8R C;  2CUD A;  3QO3 A;  2P0Q A;  3ME9 A;  1YIT Q;  1KHC A;  4DOW A;  2HEQ A;  3LWH A;  4NL2 A;  2B8A A;  4XU0 A;  1IZ6 A;  1M27 C;  1AHJ B;  4M7D D;  2RHU A;  1H3H A;  2DAQ A;  1GCP A;  2EJF A;  4XTY A;  3CCV T;  3QII A;  1EZZ B;  1NJI R;  5IHK A;  1HD3 A;  1M2O A;  3EGU A;  2YLC A;  3CCJ A;  1YP5 A;  1FMK A;  2XDD A;  4L6V 5;  2LQW A;  3UA6 A;  4PJO E;  1YIT A;  4M75 C;  3OYI A;  2NWM A;  2JVV A;  3L2U A;  1MV3 A;  2XG8 D;  2PNI A;  3SD4 A;  2DMO A;  2RHX A;  3PE0 A;  1D0X A;  4JLG A;  2ZPB B;  4J9G A;  5FLX E;  1HXD A;  3PTA A;  1YIT T;  1H92 A;  1H8K A;  3M55 A;  1M30 A;  3EG2 A;  1VQL Q;  3CC2 A;  2COZ A;  4C92 D;  1UUE A;  4E6R A;  1N8R U;  2EYW A;  2DLP A;  2RQV A;  4DBH A;  4JLI A;  3MP8 A;  2KYM A;  4ZTJ A;  1FYN A;  4M7D B;  3KUF A;  5KYN A;  3A8G B;  2X3W D;  1TSF A;  2DYI A;  4IIO A;  1ZA2 B;  3PIP A;  2EJG A;  1VQ9 A;  4A53 A;  2XMF A;  3JCM X;  2LQK A;  3ZEH A;  3KFV A;  4QVD A;  3N5B B;  2FYK A;  2NUT A;  2JW4 A;  2HCK A;  2WSF E;  2K3X A;  4IIM A;  4OGE A;  2XHC A;  1TUG B;  3QDR B;  1YFN A;  2L3Q A;  2DNU A;  4Z88 A;  5FW9 A;  5A0G A;  2FPE A;  4JJD A;  3CPF A;  5KYU B;  2HZY A;  2E3H A;  4L5G A;  2VXF A;  1VQN T;  3JB9 G;  4J9B A;  1I07 A;  2AIR B;  2CGH A;  8ATC B;  1T0H A;  3P8H A;  3T9N A;  4ELZ C;  3I35 A;  3CXC P;  3JCM f;  5CAI A;  3P8B B;  1VQL T;  2RQW A;  3MJX A;  3OYC A;  4OF1 A;  2K79 A;  1ZX6 A;  1XTD A;  2K7A A;  3G6E T;  1M8V A;  4FT4 A;  4C92 B;  3URG A;  5CKF A;  5GAN 4;  5FRM A;  2C0I A;  2JTM A;  2RQR A;  2CRE A;  1MUZ A;  4IKF A;  2XD0 A;  4M78 G;  3OBW A;  4CRI A;  3INZ A;  1NYF A;  2C0O A;  1YNZ A;  3OYK A;  2PUO B;  2RJC A;  2L0A A;  3RR6 A;  3M57 A;  3TCJ A;  3OYE A;  1D1B A;  3CD6 Q;  3V7C A;  3D7S B;  3DB4 A;  4DBF A;  4QQG A;  1LPL A;  3RKW A;  2I0N A;  1E6G A;  3L2Z A;  2FG0 A;  3RNJ A;  4KUL A;  2LX9 A;  4KGV B;  2GQI A;  2G6F X;  2O9S A;  3LGL A;  4C8Q G;  3SB2 A;  1AVZ C;  4IUU A;  1K8A C;  4C5I A;  1RI9 A;  5LJ5 e;  5HCK A;  1BK2 A;  1UGR B;  2D8H A;  4C5E A;  5LJ3 f;  1KG1 A;  3R6O A;  2YUN A;  4A63 B;  4R56 A;  5CR2 A;  1QLY A;  2X4Y A;  2IPO B;  5LJ3 d;  1FX7 A;  1JXO A;  4JRQ A;  2KDS A;  1K9M U;  3UT1 A;  4BY6 C;  4LD9 K;  3LX7 A;  1N9S A;  1M1K R;  2FPF A;  2DRM A;  2E65 A;  1LJO A;  1PNJ A;  3RMS A;  2DZ9 A;  2P0K A;  2ECZ A;  3UA7 A;  1M90 R;  4B9X A;  1RLQ C;  1EIF A;  5IH2 A;  4JRK A;  2PU9 B;  2E5Q A;  3CD6 T;  4RUG A;  2FZG B;  2CT4 A;  2F1L A;  3J81 E;  4IUQ A;  4RKU E;  3QHS A;  2YLB A;  1QKW A;  5FWC A;  2ZPF B;  5GAO p;  2KXC A;  2RJF A;  3SDZ A;  1VQO A;  1Q82 R;  2JOY A;  3BE3 A;  1YJW Q;  4AFQ C;  1OZ3 A;  3VU3 C;  2L8D A;  2O01 E;  3A8H B;  4AG2 C;  3OYJ A;  2DKG A;  3TEE A;  1XQH A;  1G3T A;  2YSQ A;  3IQL A;  3CXC A;  2AKL A;  1JJ2 A;  4ESR A;  1O75 A;  5GAM f;  2EYZ A;  5GAO r;  3HRU A;  1GCQ C;  4LDU A;  4RG2 A;  1VYU A;  2CZ6 B;  1OV3 A;  4JJN K;  1Y7X A;  1NJI U;  1I5O B;  4E7L A;  2ZZD A;  1QQJ A;  2RMO A;  2DL8 A;  5L8R E;  1AZG B;  1YI2 A;  4PJM A;  4JS5 A;  3JCM J;  4C0G A;  2L89 A;  3MEW A;  3OYB A;  2WAC A;  1OX9 A;  4D8K A;  2SEM A;  1YJW T;  2EKH A;  3OMC A;  4RG8 A;  4PL6 A;  2JUF A;  4CC2 A;  1VQ6 T;  2JTF A;  4XU3 A;  2D6F A;  4LNP A;  1TUD A;  1PRM C;  3FRN A;  1W2B A;  1HYO A;  2GCX A;  5GMK h;  1IO6 A;  3EG9 B;  2BIV A;  3OYN A;  5LJ3 j;  1BI1 A;  4OVA A;  5HKC A;  1Q7Y C;  4J5Y A;  4M75 D;  5GAO q;  2VB6 A;  1QW1 A;  8AT1 B;  2LVM A;  5GJW B;  3L2W A;  1W4S A;  4PJO G;  1EFN A;  1IXD A;  1AD5 A;  4BB7 A;  3WVD B;  1K0S A;  4O6J A;  2M02 A;  4M78 A;  3LW5 E;  4M7A B;  3VS3 A;  2RJD A;  1K4U S;  2NUP B;  1KIK A;  4BD3 A;  2JS0 A;  1MV0 B;  1E6H A;  4IUP A;  4N0A A;  3QZ5 B;  3R6N A;  2JT4 A;  5GAN e;  2JNG A;  1W70 A;  1W1F A;  1SHG A;  2E1H A;  4JRP A;  1QCF A;  1RAE B;  3JSC A;  3EH2 A;  2HL3 A;  4E2F B;  1OUL A;  2CP3 A;  3G71 Q;  1YIJ Q;  5I2S A;  1AWJ A;  1VQK T;  2JZ2 A;  1W6X A;  5KYY A;  4BDZ A;  1UGS B;  5IN1 A;  1GFD A;  1JB0 E;  2EKO A;  5A0D A;  2MIO A;  1LCK A;  1G8X A;  5GAM j;  1YWP A;  1YBY A;  1KHI A;  3QXE B;  1K73 R;  1BIB A;  4M77 E;  1QP3 A;  4R55 A;  1TU0 B;  1Y57 A;  2EQJ A;  1BYM A;  3G71 A;  4EMG A;  3CME Q;  1YIJ A;  2X4X A;  4RTV A;  2KEA A;  1IRE B;  1S1N A;  3PGG A;  2M9U A;  5KE3 A;  4KH0 B;  4FM4 B;  3I56 Q;  1ZLM A;  5KYW B;  1PG5 B;  3CCU A;  3QSU A;  1AWX A;  3G71 T;  4WTO B;  1M1F A;  1T3L A;  3HRT A;  3CC7 Q;  2NYS A;  1H3Z A;  1MMA A;  3VV0 A;  1JEG A;  4KT0 E;  3MP1 A;  4JPB W;  4CC7 A;  1SPK A;  3DKM A;  1S72 Q;  2JJ9 A;  1QWF A;  3JCM Q;  1BB9 A;  2DTO A;  3CME A;  4O5V A;  1XNI A;  2WSE E;  3J7A F;  1RAF B;  1KQS A;  2LJ1 A;  3CCM T;  4C0D C;  1IHW A;  3CPW S;  3E19 A;  4UC4 A;  2LQN A;  2RI5 A;  2YRD A;  1WHK A;  4IUR A;  1D0Z A;  3I9Q A;  3QZ9 B;  1K1Z A;  2CP0 A;  1M1K U;  4F7U A;  1RAI B;  3EAE A;  3CME T;  4ZGE B;  1YJN Q;  2A0F B;  3CCR A;  3CC7 A;  4RTX A;  2QGF B;  2FHD A;  2LZ6 B;  5EC7 A;  2DL4 A;  5GAN 5;  1M90 U;  3CEY A;  3I56 T;  2HMA A;  4J6W A;  5GAN 6;  3KXT A;  4QQD A;  1Q86 R;  3QJ6 A;  4M77 F;  2XIC A;  1X2Q A;  1WXU A;  5GAO n;  1JO8 A;  3FJP A;  1YJ9 Q;  2KXD A;  2KGT A;  2QEX A;  1Y71 A;  3CC7 T;  4AFU C;  4QVC A;  1OPK A;  2CZ7 B;  1I8F A;  3NFC A;  2GQV A;  2QK0 A;  4R0K A;  1VUB A;  1ZUY A;  5CQX A;  4KGX B;  1S72 T;  1Q82 U;  4LUD A;  2JTE A;  4ZGD B;  1RAH B;  1YJN A;  3QG1 A;  1X43 A;  2ED1 A;  3NHN A;  2RI3 A;  4MDX A;  2NLU A;  3EHR A;  2JMA A;  2LCC A;  3EHQ A;  2QAZ A;  4M78 B;  3M0T A;  2YWW A;  1Y96 A;  1BU1 A;  9ATC B;  3L2R A;  4PJO A;  5I21 A;  3MET A;  2E10 A;  1YJN T;  4EMH A;  3QKJ A;  1OYX A;  4JS4 A;  1UJ0 A;  4Z89 A;  5KE2 A;  5FRO A;  1KC8 R;  3V7R A;  3JB9 H;  3V8J A;  3A98 A;  4C8Q B;  1YJ9 T;  3JCM g;  4BDY A;  4M7A C;  3CCJ Q;  4M7D E;  1EX4 A;  1RAD B;  5KYY B;  3GIB A;  3HRS A;  4HA8 A;  2MI6 A;  3A8M B;  1UHC A;  1VQ4 Q;  4XK8 E;  2MF2 A;  1N5Z A;  1UHF A;  2KT8 A;  3BDU A;  4JDS A;  2KR3 A;  2YT6 A;  5GJV B;  3E9G A;  2OTJ T;  3UF4 A;  2D9T A;  4PNO A;  1TTH B;  2LJ0 A;  3H41 A;  1PKT A;  2M0Y A;  2IVW A;  3X25 B;  3MO8 A;  4HVU A;  4OMM A;  5L23 A;  2DA9 A;  1B7T A;  4EMK A;  3MEU A;  2F2W A;  1MNE A;  3DB3 A;  3TSZ A;  4OML A;  3TRE A;  4DQ2 A;  2M1H A;  1VQ7 A;  3CC2 Q;  2BKD N;  1QCO A;  1Q81 R;  5CCA A;  2RHY A;  2VGN A;  2R5A A;  5AT1 B; 
#chains in the Genus database with same CATH homology
 3FIF A;  5C6S A;  1FXX A;  3L2Z A;  3OSV A;  3M4G A;  4KUL A;  3OYG A;  1YHQ T;  2LX9 A;  3HHT B;  3Q1J A;  4C8Q E;  1VQ4 A;  3LGL A;  2XDB A;  4FL6 A;  4C8Q G;  2E41 A;  2O4X A;  5CK9 A;  3HPW A;  1Q82 C;  4MZP A;  3L2Q A;  3SB2 A;  4IUU A;  1K8A C;  3FDR A;  4C5I A;  1OZ2 A;  3S3M A;  5LJ5 e;  4M7A F;  4Q5W A;  1UGR B;  4C92 E;  4C5E A;  3CCJ T;  2RHI A;  5LJ3 f;  1KG1 A;  3R6O A;  2CS7 A;  5KCO A;  4C8Q D;  5LJ3 g;  4R56 A;  3CCL T;  5CR2 A;  4M7D A;  4C92 G;  3G7Z A;  2X4Y A;  5LJ3 d;  3H6Z A;  2QI2 A;  4HT9 A;  1QP2 A;  4F7U F;  1FX7 A;  4C0F A;  3LGF A;  4FSX A;  2RJE A;  1VQ4 T;  4JRQ A;  1W2B S;  2EWN A;  2DXT A;  2KDS A;  4A4G A;  2X35 A;  3M9Q A;  5C0M A;  3UT1 A;  4BY6 C;  1K9M U;  3LX7 A;  3OA6 A;  4LD9 K;  3CCR T;  3LH0 A;  5IT9 E;  1H64 1;  1N9S A;  2RA2 A;  3VJP A;  4NS5 A;  5FU6 B;  5GAN 2;  3JB9 I;  4BE0 A;  3JCM W;  1WQW A;  2QQR A;  1DJ7 B;  2E65 A;  4PLI A;  3JCM P;  1QVG A;  4L59 A;  3OYD A;  1LJO A;  3RMS A;  2DZ9 A;  1ZQ1 A;  2P0K A;  4E7J A;  4HT8 A;  2EYQ A;  4C92 C;  4HCB A;  3PIO A;  2G3R A;  2I2L A;  3BW1 A;  4FT2 A;  3O8V A;  5CO7 A;  1QVF A;  2HQX A;  2D0Q B;  4M77 B;  1VQK A;  4B9X A;  3MHX A;  1EIF A;  3RKY A;  2FVU A;  2A7Y A;  3E9F A;  4JRK A;  3CC4 A;  3DLM A;  2VC8 A;  5GAN j;  4HCC A;  2PU9 B;  2E5Q A;  4MZT A;  4OMF B;  3V7S A;  3CD6 T;  3CCQ T;  3CC2 T;  2QDY B;  2QEX T;  1XOV A;  4A4F A;  3F70 A;  3L2V A;  3OW2 A;  2K5F A;  4IUT A;  3J81 E;  2LTO A;  4MMK A;  1KD1 C;  4IUQ A;  4RKU E;  3QHS A;  3BDL A;  2ZCF B;  4ZN3 A;  5GAN d;  1I5L A;  2DTI A;  2LCL A;  2YLB A;  1I4K 1;  2QQ9 A;  5GMK m;  3TU4 K;  5J39 A;  3MEV A;  3X20 B;  4C8Q A;  2ZPF B;  5GAO p;  1VQM T;  3L1A A;  2V8I A;  4NL3 A;  3LYI A;  3G4S A;  2RJF A;  2ZPH B;  3SDZ A;  2K5I A;  1VQO A;  3GLX A;  3CCS A;  3A5Z B;  3NTI A;  3M56 A;  1B34 A;  3C12 A;  1VQ9 T;  2DEQ A;  4X9C A;  2JOY A;  1OZ3 A;  3VU3 C;  2L8D A;  3CMA A;  1V29 B;  2K4Y A;  2K57 A;  2KMT A;  4PKC C;  5DM7 R;  3JAM E;  4C92 A;  2O01 E;  2E12 A;  3A8H B;  3HFN A;  1O9S A;  3X24 B;  3OYJ A;  3C94 A;  1WJS A;  2DKG A;  3TEE A;  2DJZ A;  3ZBD A;  4Z02 A;  2RO0 A;  4QQG A;  1XQH A;  4J7I A;  4PJO F;  3RKW A;  2LRQ A;  3JB9 J;  5GAN h;  3ZFJ A;  4M75 B;  3QYG B;  1K9M C;  1JBM A;  1G3T A;  3OB9 A;  3G4S T;  1D3B B;  3JCM d;  3CXC A;  3HP9 A;  2P4T A;  5M9O A;  2AHJ B;  4XAX B;  4BI4 A;  1Q7Y U;  1JJ2 A;  2DD5 A;  4C5H A;  1O75 A;  3M4Y A;  5GAM f;  5GAM g;  4BE1 A;  5GAO r;  3CMA T;  1I81 A;  3FEO A;  3PT9 A;  5D6X A;  2QXF A;  2HD0 A;  3HRU A;  4M77 G;  2E6Z A;  2CYZ B;  1G3W A;  4LDU A;  4RG2 A;  1Y96 B;  2CZ6 B;  3CBP A;  4EDU A;  4JJN K;  4PJO B;  1Y7X A;  1NJI U;  2L5Q A;  3CXC S;  3RIR A;  4M78 E;  5GMK j;  1VQ5 A;  4E7L A;  1LOJ A;  2ZZD A;  1JRI A;  5J26 A;  4BUG A;  2R5M A;  3RKX A;  3OQ5 A;  1BKB A;  2KY9 A;  4M77 D;  5L8R E;  2R57 A;  2XU8 A;  2P0P A;  3CCV A;  1YI2 A;  2GFA A;  3JCM h;  1NPR A;  4BI8 B;  3M59 A;  5FU7 B;  3I55 T;  4C5G A;  3RUX A;  4JS5 A;  1VIF A;  3JCM J;  1WGS A;  3QPH A;  1K73 C;  3CCM A;  4C0G A;  1VIE A;  4N4G A;  2L89 A;  3S6W A;  3MEW A;  3OYB A;  4KUI A;  2WAC A;  3M54 A;  2RB6 A;  1UGQ B;  4Y91 A;  1VQ5 T;  1YJW T;  3RMQ A;  4M78 C;  5CKE A;  3SWN B;  5GAN 8;  3OMC A;  4RG8 A;  4PL6 A;  2JUF A;  3SFM A;  1VQ6 T;  2FL7 A;  3OYM A;  4TVR A;  4FU6 A;  2MMP A;  2JTF A;  4XU3 A;  4X34 A;  2LT4 A;  2D6F A;  3OS1 A;  1KQ1 A;  3A8O B;  4M75 G;  4OB3 B;  1M9S A;  2DXC A;  3FRN A;  2GCX A;  3V8L A;  4ME7 A;  4A4H A;  5GMK h;  1W2B A;  1M5Q 1;  4A4E A;  1BI0 A;  2ZPI B;  1Q86 U;  3OYN A;  2BIV A;  5CIU A;  5LJ3 j;  1VQ7 T;  3VYH B;  2GF7 A;  1N9R A;  3I56 A;  1BI1 A;  3S3O A;  1YCY A;  4J6Y A;  4OVA A;  5HKC A;  1U1T A;  1Q7Y C;  4J5Y A;  4M75 D;  2E64 A;  4Y28 E;  5GAO q;  4E7K A;  2CZ1 B;  2BUD A;  1QW1 A;  1M1G A;  2VV5 A;  3JB9 F;  2LVM A;  2RI2 A;  3V8K A;  4C8Q C;  1KQS S;  3L2W A;  1W4S A;  5KCH A;  4PJO G;  2LQ8 A;  4GY5 A;  3OYH A;  4D6W A;  4BB7 A;  3WVD B;  4O6J A;  1NJI C;  5HK3 A;  3PMT A;  3HFO A;  2VGM A;  4M78 A;  5GMK l;  1WNL A;  2X4W A;  3LW5 E;  3P8D A;  4M7A B;  2RJD A;  4DOV A;  1S72 A;  5CVI A;  4PJO D;  3S3N A;  3OYL A;  4M7D F;  4BD3 A;  2M0O A;  4IUP A;  4N0A A;  4QQ6 A;  3QZ5 B;  5I2M A;  4RCB A;  3UWN A;  2E70 A;  4CI0 C;  4XU1 A;  2F5T X;  5GAN e;  3FC3 A;  5LJ5 f;  2JNG A;  4F7U B;  2YRV A;  4LDY A;  5IAY A;  5LJ5 g;  3MCA B;  5LJ3 h;  1X01 A;  5LJ5 d;  3RES A;  4E7I A;  3GF5 A;  2XKO C;  4II1 A;  4ZGJ B;  2O4X B;  2E1H A;  3FLG A;  2VYT A;  2KSS A;  3J80 E;  4JRP A;  4YTL A;  3OS2 A;  3HL8 A;  4M78 F;  2KK4 A;  2HBP A;  2LC4 A;  4XTZ A;  3JSC A;  4LDV A;  5DLQ E;  1U8R A;  2R58 A;  1G3Y A;  4BE2 A;  1VQP A;  2PVG B;  1K73 U;  4LDX A;  4NOY A;  2KVQ G;  5I2S A;  4QVZ A;  1D3B A;  2RH2 A;  3OBY A;  2ZPE B;  4N4H A;  1KC8 U;  2JZ2 A;  1VQK T;  3CC4 T;  5EG2 A;  4C0Z A;  4C0D B;  2IG0 A;  2RHZ A;  1Q86 C;  4IUV A;  2DIG A;  2VXE A;  3EFR A;  5GAN 7;  1VQN A;  4BDZ A;  2K5L A;  1UGS B;  5IN1 A;  4X9D A;  3JCM e;  1JB0 E;  2EKO A;  3EFS A;  5A0D A;  4V2S A;  4XU2 A;  1SSF A;  3NTK A;  3VUB A;  2YHT A;  2Y4Y A;  4C8Q F;  5A0L A;  1VQ8 A;  2K3Y A;  1YJ9 A;  4OP0 A;  3M5A A;  4J8O A;  1VQL A;  1UEB A;  1GXI E;  2LDM A;  4M7A E;  1X6O A;  5GAM j;  1VQO T;  1YBY A;  3CCS T;  1KHI A;  2DO3 A;  1P92 A;  2PUK B;  3QXE B;  4M7A G;  4LD6 A;  1ZBX A;  1BIB A;  2HQE A;  2DZC A;  4M77 E;  5D6W A;  5DLO A;  1QP3 A;  3A8L B;  3CBO A;  4EPC A;  4C92 F;  5CKH A;  4F7U E;  4R55 A;  5GAM d;  3G6E A;  1RI0 A;  1WQ7 A;  2EQJ A;  2RK2 A;  2K2V A;  1BYM A;  4J83 A;  2EQU A;  3G71 A;  4ZTF A;  3UPU A;  4EMG A;  2MWP A;  4F7U G;  3VUZ A;  2X4X A;  3OS0 A;  1YIJ A;  1IRE B;  3M53 A;  5HK0 A;  5GMK e;  4OB2 B;  3PGG A;  4M7A D;  5CQY A;  1X75 C;  2HNI A;  2M9U A;  5FU6 C;  2OTJ A;  5KE3 A;  4FM4 B;  4BY6 B;  2QQA A;  1HK9 A;  1Y07 A;  1N27 A;  3OYA A;  4XQ3 A;  2Y90 A;  3WVE B;  1B34 B;  3CCE A;  2EQK A;  4XTX A;  3UDC A;  2C06 A;  1M4Z A;  1WJR A;  2XID A;  3CCU A;  5GAN 3;  4P5N A;  1N8R C;  3QSU A;  1PSE A;  3X28 B;  1Q81 U;  4M77 C;  3QO3 A;  2P0Q A;  3ME9 A;  2OTL A;  4A4K A;  3G71 T;  4MML A;  1KHC A;  3VKI A;  4DOW A;  5GAM h;  3PMI A;  1MHN A;  1BI2 A;  1M1F A;  4ATO A;  3LWH A;  4NL2 A;  2B8A A;  4XU0 A;  3HRT A;  4BI3 A;  2QQS A;  1KC8 C;  3MEA A;  4XTW A;  1H3Z A;  1IZ6 A;  3VV0 A;  1AHJ B;  1NPP A;  2DXB A;  4KT0 E;  4RMO A;  4M7D D;  3GPL A;  3MP1 A;  2RHU A;  2LT1 A;  5LL6 S;  2DAQ A;  2EJF A;  4XTY A;  3DKM A;  4M75 E;  2GFU A;  3CCV T;  1YI2 T;  3JCM Q;  3HKS A;  3QII A;  2DTO A;  3CME A;  4O5V A;  4N0A C;  1XNI A;  2WSE E;  2XDP A;  2Y4X A;  3J7A F;  1NZ9 A;  1KQS A;  5LJ3 e;  1ZHI A;  1KQ2 A;  4OGC A;  3CCM T;  4C0D C;  3CPW S;  1YIJ T;  3OYF A;  3E19 A;  4UC4 A;  2RI5 A;  2YLC A;  1MGQ A;  3NTH A;  2VUB A;  4LDW A;  4M7A A;  4E47 A;  3CCJ A;  4E7H A;  4IUR A;  1G5V A;  3QZ9 B;  3ASK A;  2XDD A;  4L6V 5;  4M77 A;  4PJO E;  1M1K U;  4F7U A;  3EAE A;  3JCM b;  4DA4 A;  1YIT A;  2RM4 A;  4M75 C;  3CME T;  3GNF B;  3OYI A;  4ZGE B;  4EMK B;  2JVV A;  3CCR A;  3CC7 A;  2ZPG B;  3GNG A;  3L2U A;  2FHD A;  3CBM A;  4HCZ A;  2XG8 D;  5GAN 5;  1G3S A;  2F69 A;  3JCM c;  2JN0 A;  3OMG A;  1M90 U;  3CEY A;  4BAC A;  3VYG A;  4HKE A;  3SD4 A;  3I56 T;  3L42 A;  4J6W A;  2RHX A;  2HAX A;  5GAN 6;  4XTV A;  4RCC A;  5LJ5 j;  3KXT A;  4JLG A;  5GAO m;  2ZPB B;  4QQD A;  5FLX E;  3QJ6 A;  1HXD A;  4M77 F;  3PTA A;  3AHU A;  2XIC A;  1Q81 C;  4MDW A;  1YIT T;  5GAO n;  3OY9 A;  2ZGW A;  4PJO C;  3RER A;  3FJP A;  3M55 A;  3CD6 A;  3CCQ A;  3CC2 A;  2CZ0 B;  2QEX A;  1Y71 A;  2EAY A;  3LWI A;  3CC7 T;  2DXU A;  2EJ9 A;  2CZ7 B;  4A54 A;  1I8F A;  4C92 D;  1BI3 A;  4OB0 B;  4QVC A;  3NFC A;  5J3B A;  1N8R U;  2GQV A;  1R8O B;  1VUB A;  4JLI A;  3MP8 A;  4ZN1 A;  5FU7 C;  4ZTJ A;  5CQX A;  1S72 T;  5D6Y A;  1Q82 U;  4M75 A;  3C95 A;  3M58 A;  1VQM A;  3BY7 A;  3KUF A;  4ZGD B;  4M7D B;  3LLR A;  5DY9 A;  3A8G B;  1YJN A;  3QG1 A;  5AYF A;  3JCM V;  3PIP A;  2DVE A;  2QA4 A;  2RI3 A;  5CKB A;  4MDX A;  2EJG A;  2H3J A;  1VQ9 A;  3BFM A;  2NLU A;  4A53 A;  3SWN C;  2LNV A;  3JCM X;  3G6E T;  2MWO A;  1M8V A;  2LQK A;  3ZEH A;  4JUV A;  2L3R A;  2LCC A;  5LJ5 h;  2KAF A;  5GAN g;  4XTU A;  5GAN f;  1QVG S;  3GP8 A;  4M78 B;  4QVD A;  3N5B B;  2EFI A;  2FYK A;  4B9W A;  1Y96 A;  2WSF E;  2XK0 A;  1VQP T;  3L2R A;  3FB9 A;  2K3X A;  1M1K C;  1QVF S;  4PJO A;  4M75 F;  4OGE A;  2XHC A;  3QUI A;  3MP6 A;  5I21 A;  3MET A;  3PNW C;  3QDR B;  5GAM e;  1BIA A;  1U1S A;  2E10 A;  1YJN T;  3ER0 A;  2KQW A;  4EMH A;  5A0G A;  4WF2 A;  3QKJ A;  1OYX A;  1WPY A;  2A3L A;  2RK1 A;  4KBM B;  2QA4 T;  4VUB A;  2QQB A;  4JS4 A;  3CPF A;  2V8J A;  3OW2 S;  4L5G A;  1VQN T;  2VXF A;  1M90 C;  5CKD A;  1OI1 A;  5KE2 A;  5FRO A;  5KH6 A;  3HSB A;  2XI9 A;  3V7R A;  3JB9 G;  1UGP B;  3JB9 H;  3V8J A;  4KUD K;  2E6N A;  4GLK A;  3WXM B;  2CGH A;  3QBY A;  4FIB A;  3PFS A;  1PSF A;  2FB7 A;  3P8H A;  3T9N A;  1UB4 A;  4ELZ C;  4EMK C;  3GOX A;  4C8Q B;  1VQ8 T;  1K8A U;  3JCM f;  4ELY C;  5CAI A;  1YJ9 T;  2MAM A;  3OSS C;  3P8B B;  3JCM g;  5GMK i;  2V8K A;  3SWN A;  4BDY A;  1VQL T;  3KBG A;  4M7A C;  3JB9 D;  3C4S A;  3OYC A;  3H8Z A;  4OF1 A;  4M7D E;  2WSC E;  1NE8 A;  3GIB A;  2EIF A;  1XTD A;  3I55 A;  3CCL A;  3HRS A;  4M7D G;  4HA8 A;  4MZM A;  4FT4 A;  4C92 B;  3QYH B;  4JRI A;  2MI6 A;  3A8M B;  2PQW A;  1RL2 A;  2RD1 A;  1QVP A;  4OB1 B;  4QW2 A;  3URG A;  5A2Q E;  1TH7 A;  2MF2 A;  4XK8 E;  5CKF A;  5HY6 A;  3QJY A;  2JTM A;  3OS5 A;  2CKK A;  3BDU A;  5GAN 4;  5FRM A;  4JDS A;  5FRN A;  2DTH A;  2DD4 A;  3CPW A;  3E9G A;  2F5K A;  1N6A A;  4IKF A;  2XD0 A;  2OTJ T;  1YJW A;  2D9T A;  4PNO A;  3OYY A;  1JJ2 S;  2OAU A;  4M78 G;  4J6X A;  3OBW A;  2DIQ A;  1VQ6 A;  4CRI A;  1YHQ A;  3CCE T;  3INZ A;  3X25 B;  2IVW A;  3CCU T;  3MO8 A;  4M7D C;  2PVD B;  2X4J A;  3OYK A;  2PVO B;  2QTX A;  2PUO B;  3JRZ A;  4N4I A;  3X26 B;  4EMK A;  2DPP B;  3MEU A;  2RJC A;  2OTL T;  2DK3 A;  2M16 A;  4J7F A;  3E1S A;  1FWZ A;  3DB3 A;  3TRE A;  4PLL A;  3M57 A;  4DQ2 A;  4M78 D;  3TCJ A;  2M1H A;  3OYE A;  1VQ7 A;  3V7C A;  2BKD N;  5GAO l;  3DB4 A;  3DLL A;  5CCA A;  1KD1 U;  2RHY A;  1LNX A;  2VGN A;  1WJQ A;  2R5A A;  2EQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...