4X34A

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k381ack382me2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
b'NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
molecule tags Transcription/transcription inhibitor
source organism Homo sapiens
publication title An Acetyl-Methyl Switch Drives a Conformational Change in p53.
pubmed doi rcsb
total genus 29
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x34A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x34A01
3MP8A 4A4HA 2LDMA 1Q86C 3J81E 3CCUT 1M1GA 2QEXA 3P8HA 2MI6A 3CPFA 3PIPA 4YTLA 2E6ZA 2GF7A 3LH0A 1KC8U 3OYKA 1WJQA 3QIIA 3MEAA 4PLIA 4QQ6A 3OYGA 2M16A 4C5IA 2VYTA 2EQUA 2IG0A 1K9MC 1SSFA 3CCRT 2LRQA 3ASKA 3CCVT 3OS1A 4C5HA 2L3RA 3H8ZA 1YI2T 1Q82C 4GY5A 3MEVA 3DB3A 2XK0A 3I56A 1YJNT 2BUDA 3CCST 2RHYA 4IKFA 5IN1A 3PNWC 3CXCA 3CCLA 2O4XB 2HQEA 2LCLA 2RJCA 1RL2A 5FROA 2XHCA 4E7HA 5J26A 3E9FA 3CMET 3MEUA 4PL6A 3G71T 3CCET 5IT9E 3OS2A 2EQJA 3OW2S 3L2VA 1Q81C 4A4GA 1N8RC 3FDRA 2LQ8A 2K3YA 3DLMA 3OYIA 2RI5A 2LCCA 3OS0A 3FEOA 4IUQA 3CCEA 4IUUA 3ZEHA 5KE2A 1YBYA 3CMEA 3A5ZB 1N27A 4C5GA 1MHNA 4B9WA 5DLQE 2NLUA 1VQKT 1NZ9A 1YI2A 3OYAA 3CXCS 4BD3A 2LTOA 4BACA 3OYHA 3GOXA 3PMTA 5CIUA 4X34A 1JJ2S 1KQSA 3OYEA 2M1HA 1K9MU 1W2BA 3PIOA 2JVVA 1NPRA 1VQKA 3OMGA 2JOYA 2X4YA 1VQNA 1Q81U 1N8RU 1NJIU 5KCOA 3CCQA 3CMAA 2B8AA 3J80E 2HQXA 3NTKA 2R5MA 2X4WA 3CC4A 2OTJA 3OYDA 3PMIA 1K73U 5DM7R 4BE0A 2RJDA 1WJRA 2F5KA 4N4HA 1G5VA 3F70A 1KC8C 1EIFA 4IUVA 4UC4A 4A4EA 4II1A 2XDPA 1OZ3A 3NTIA 1S72T 1VQ7A 1VQ9A 3CCJA 2OTLA 3CCUA 1QVFA 4IUPA 1KQSS 3CCSA 2KDSA 2X35A 3C4SA 2KVQG 1WGSA 1W2BS 2G3RA 2CKKA 3OYYA 1S72A 2GFAA 5C0MA 3CCMT 1K8AC 5FLXE 3OYJA 2EQMA 1QVFS 3CPWA 3OYFA 3CC2T 3CCQT 2RJFA 3LGLA 2R58A 2RJEA 3L2RA 3CEYA 1VQOA 1VQ8T 3CCMA 2E5QA 1Q86U 3FC3A 4BDYA 4EDUA 3FLGA 1VQLA 1VQ6T 3MP6A 4L59A 4E7IA 4ZN3A 3S3MA 2PQWA 3CC2A 3OMCA 4FL6A 4BDZA 3CD6A 2K3XA 1NPPA 2RI3A 3UWNA 1YJ9T 1OI1A 3BDLA 1VQ7T 1IZ6A 3OY9A 2WACA 2QA4T 1OZ2A 2MWOA 5HY6A 3MO8A 4NS5A 1YJ9A 5D6YA 3UT1A 2MWPA 5KE3A 3H6ZA 4PLLA 2E70A 2P0KA 1VQ4A 2DO3A 1VQPA 3CCRA 1WJSA 4QVZA 3OYNA 3OW2A 5C6SA 1H3ZA 3QKJA 3LGFA 2D9TA 5J39A 1NJIC 5FRNA 2M0OA 3Q1JA 2O4XA 4A4FA 2BKDN 4C5EA 3QBYA 4QW2A 4E7JA 4Z02A 1KHIA 3KBGA 2BIVA 3OQ5A 3M9QA 2E6NA 4BE2A 3CD6T 2RO0A 3E9GA 2YRVA 4E7KA 3O8VA 3DLLA 1VQ5A 1UEBA 2JZ2A 4QQDA 2DIQA 2RHZA 4QQGA 3TREA 2X4XA 5D6XA 3L2WA 5M9OA 1QVGA 2EIFA 1M1KC 1BKBA 3QJ6A 2OTLT 1VQ4T 4E7LA 3LX7A 2GFUA 3META 1JJ2A 3EAEA 1XTDA 3DB4A 2R5AA 4CRIA 5D6WA 2LVMA 4ZTFA 4OVAA 3S3OA 3OA6A 1XNIA 2QQSA 1M90U 3G6EA 1K8AU 3CC4T 2OTJT 5LL6S 1Q7YC 3KUFA 3S3NA 1OYXA 4BE1A 4IURA 1Q82U 2JUFA 2QA4A 1YJWA 1RI0A 3P8BB 1X6OA 1YITT 1VQ5T 3PFSA 5FRMA 1QVGS 3SD4A 2FHDA 3NTHA 4N4GA 4RG2A 3G6ET 1YIJA 2EFIA 3OYLA 4IUTA 1YHQT 3J7AF 2JNGA 1KD1U 1VQNT 3MP1A 3JAME 1YJWT 4ZN1A 3CMAT 2EQKA 3ER0A 3L2UA 2L89A 3G71A 4Q5WA 1YIJT 3CC7T 2R57A 4HCZA 3L2QA 1VQMT 4TVRA 1M90C 3I55A 2RHUA 1YHQA 3OYCA 5A2QE 3CPWS 4FU6A 5IAYA 2RHXA 2DIGA 3CCJT 1M1KU 1YJNA 1K73C 1VQMA 3CC7A 3S6WA 3OB9A 3I55T 2JTFA 1VQPT 2QEXT 1KHCA 3P8DA 3LYIA 3L42A 4B9XA 4N4IA 3G4ST 2DAQA 2RI2A 3LLRA 1VQ9T 1YITA 1VQOT 3ME9A 3OYMA 3OYBA 2EKOA 1Q7YU 3MEWA 1VQLT 1VQ6A 3CCVA 2RHIA 5J3BA 4LD6A 4ZTJA 3HKSA 5KH6A 5KCHA 3G4SA 3I56T 1VQ8A 2L8DA 2QQRA 3CCLT 1KD1C
chains in the Genus database with same CATH superfamily
1VQNQ 4X9CA 2RK1A 2C0TA 3EGXB 2V8IA 4BY6B 1M1GA 4B6MA 2DBMA 2QEXA 4EMKA 1WHHA 4LNPA 4PNOA 4M75D 1JQQA 3OYKA 4QQ6A 1WHJA 3OYGA 1NLPC 2VYTA 2RK2A 1X27A 4AMCA 5LJ5g 1G3WA 3PT9A 2D0NA 3FRNA 1SSFA 3URGA 3CCRT 2KRMA 2FG0A 1YI2T 3E1SA 4GY5A 1I07A 1PSFA 3I9QA 3MEVA 2CP6A 2HEQA 1ABOA 2AZVA 1V29B 2PVDB 2NUTA 5FWCA 1YJNT 3VYHB 4IKFA 3VS7A 3QHSA 4PJOF 3V7SA 1D3BB 4BY6C 1SRMA 2LT4A 2JJ9A 2XHCA 5J26A 4R56A 3D7SB 3E9FA 2CP7A 3CMET 2EJGA 1VQMQ 4PJLA 4FT4A 1OULA 4KUIA 2KK4A 2V26A 3VS0A 3EH1A 1UJ0A 1UGQB 1GL5A 3NFCA 8ATCB 4M78E 5KE2A 1YBYA 3CMEA 3OSSC 3M56A 4C5GA 1ZX6A 2NLUA 1D0XA 4X9DA 2HL3A 2F69A 1YI2A 4A63B 4XTXA 2E1HA 1OPKA 3LW5E 1VQ8Q 4M4ZA 4Y28E 4M7AA 2XIDA 2K5IA 2ATCB 2J6KA 1YWOA 1AD5A 4C8QG 5GAN6 2COYA 4C0FA 3PIOA 1NPRA 3VS5A 3OMGA 4QKUA 2O88A 3PE0A 2QXFA 1NJIU 1VQ5Q 4KGXB 1R0BG 1RABB 4Z8AA 2EGCA 4XU2A 4C92G 1Y7XA 2R5MA 3EFSA 4JDSA 3OYDA 2ZZDA 3GPLA 1Q81R 2FPDA 1SF9A 2YT6A 2NUTB 3F70A 3T9NA 1VA7A 1FXXA 4J9BA 2FPFA 4IUVA 2LT1A 1JRIA 4MMLA 2KSSA 4M75E 3NTIA 4FW1A 4C0GA 4DQ2A 1S72T 4KRTA 2KDSA 1V1CA 4JUVA 1X69A 1VUBA 2P84A 3OYYA 3M54A 1B34A 2GFAA 1LCKA 1X6BA 2HKNA 3X25B 2EGAA 4ATOA 1Y07A 2F2WA 1KFZA 2EVRA 1QVFS 1ZSZC 4M7AG 1JXOA 5GAN3 2RJFA 4F04B 2YUNA 2R58A 2D1XA 1VQOA 4BDYA 1WQWA 3FLGA 1VQLA 4E7IA 2P4TA 4ZN3A 3S3MA 5L8RE 3OW2P 3C94A 4D8KA 3OMCA 3TSWA 1M3CA 1W70A 3CD6A 4XTVA 5DLOA 1I8FA 4M75C 4PJJA 1I0CA 3N5BB 2VGNA 2DMOA 3EGDA 2MWOA 5HY6A 4EMGA 1PD1A 2MF2A 5D6YA 4XAXB 5KE3A 3X28B 2KROA 2YXYA 4RUGA 3JCMe 2E70A 2VGMA 2P0KA 2LJ1A 4E47A 3CCRA 2DFUA 5C6SA 4BI4A 1RUWA 1WX6A 1QVGP 4M77F 4MZTA 2CREA 5GAMd 2W10A 1U06A 4E7JA 1KHIA 3VS6A 4HCKA 2LX9A 4RTXA 3X20B 5LJ5e 1IHVA 2JS2A 3M9QA 2YDLA 4C92A 4M7DD 2DL3A 1P92A 1SPKA 2E4HA 2ZCFB 2MMPA 5IHIA 5GMKi 4PFOA 3O8VA 1TUCA 1VOMA 1Y71A 1WHMA 1UFFA 1EFNA 2LQNA 1NEGA 4LDUA 1IGUA 4C0ZA 3H0IA 4HA8A 2YUOA 1JEGA 1D1AA 4FSXA 1M1KC 2BZ8A 1UUEA 2PVOB 3ZL7C 1MNEA 2LZ6B 1VQ7Q 4E7LA 4O6JA 1BYMA 2ROTA 3CMEQ 4IIMA 1XTDA 1OX9A 3DB4A 1OU8A 2R5AA 3HRSA 4PJOB 4C92D 4ZTFA 3S3OA 2LMJA 2CP3A 1TU0B 4FW2A 4AG2C 5LL6S 2ZPGB 4F7UF 3FJ5A 1IREB 2ZPBB 5CKFA 1E6HA 1YJNQ 2LX7A 4DEYA 3QYGB 1X6OA 2VASA 2BZXA 5GAMj 2A28A 3CPWP 3VRZA 3VV0A 1YITT 1T0HA 4M78D 3NTHA 4N4GA 1UDLA 3SWNA 1QCNA 2EFIA 4RTZA 3CMAQ 4NOYA 2KAFA 4C92C 2BTTA 4Z88A 1KD1U 1RAGB 4ME7A 3JAME 3RKYA 4BUGA 1U1SA 2CZ1B 2SEMA 3CMAT 2FEIA 3ER0A 4GLMA 4MDWA 4M78B 2HMAA 3RKXA 2L89A 1YIJT 2DD4A 4HCZA 2ABLA 1FYNA 2CT3A 1M90C 3I55A 1B7TA 1G3YA 2HZYA 3HRTA 1OEBA 1YHQA 1LOJA 3OYCA 2XMFA 2ED1A 4FU6A 4OB2B 5IHKA 3CPWS 3CCSQ 2GCXA 2GQIA 2HDAA 3VRYA 4JJDA 2ZPHB 1K1ZA 4L5GA 1S72Q 4RCCA 5GAOq 1GFCA 1MV3A 1EX4A 5GAMg 2DVJA 2CP2A 5LJ3d 2DAQA 2RI2A 1VQ9T 4OF1A 2W0ZA 1U3OA 5GAMe 4XQ3A 4QVCA 3MEWA 1VQLT 3CCVA 2LCSA 5J3BA 2E3IA 1AEYA 3CCQQ 1MMNA 4J8OA 1PHTA 2Y90A 2HCKA 2DPPB 2K6DA 3EG0A 3G4SA 1W6XA 3V8KA 2ECZA 5GAOp 4LUDA 3EFOB 1O75A 4RTTA 2YUQA 3HSBA 3UDCA 2JS0A 5GANh 4GBQA 5CKDA 3CQTA 4KULA 2EAYA 2MPXC 5CK9A 1WYXA 1BI2A 3EG1A 2X3WD 1WA7A 4OGCA 3MP8A 2K4YA 2CZ7B 2LDMA 1Q86C 2PTKA 4J5YA 1BU1A 1QWFA 1NEBA 4X1VA 3SFMA 4JJCA 2QA4Q 2EJ9A 3CPFA 3KFVA 2SRCA 1OQKA 3M0SA 4M7AB 2O01E 1PKSA 3LH0A 3SB2A 2M51A 1WJQA 1DJ7B 4PLIA 4JRPA 4JZ4A 2FO0A 3H0FA 3QPHA 3A8HB 1MMAA 1ZA1B 4FYXB 4RTUA 4C5IA 5I22A 1K9MC 2LRQA 5KYUA 4CI0C 4C5HA 2L3RA 2QGFB 2O31A 2KT1A 1LNXA 3HL8A 3DB3A 3EHQA 2XK0A 3I56A 1BIBA 1SG5A 2DZ9A 2DM1A 2BUDA 2COZA 2VB6A 4MMKA 2JM8A 5IN1A 2V8JA 3PTAA 4JS4A 3CXCA 1QKWA 3CCLA 4KH0B 2O4XB 1Q7YR 2LCLA 2KY9A 2FZGB 2KNBB 1UHFA 5FROA 4E7HA 2QQAA 1VQKQ 3MEUA 5IT9E 2EYQA 3OW2S 1ZUKA 4J9GA 1BB9A 3CCMQ 4ORZA 2J6OA 4EMKB 4OP0A 3DLMA 5KYWA 4HCBA 3OYIA 3CC4Q 2OTJQ 3RUXA 3FEOA 1M1KR 2CUBA 4M7DA 1R77A 2DL7A 3CCEA 1IXDA 2AT1B 1WHKA 3TCJA 1RLPC 1N27A 3I5SA 4B9WA 5DLQE 3QUIA 1VQKT 3PGGA 1TSFA 3OYAA 3CXCS 2OTLQ 4BD3A 1YP5A 1YN8A 2LTOA 2HAXA 4JS5A 4BACA 1RAFB 2RA2A 5GAMh 3OYHA 3PMTA 2F2XA 2VUBA 1QVFP 4X34A 5LJ3g 3ULRB 3O5ZA 4CC7A 2H3JA 1TXQA 1Y57A 5GAMf 5AYFA 1UGPB 4VUBA 1W2BA 2JVVA 1VQKA 2OAUA 2LJ3A 2IPOB 2YRCA 2B86A 3TEEA 1KK7A 1VQPQ 2JW4A 2PU9B 1D3BA 4RCBA 1N8RU 3REBB 2LNVA 4M75A 3CBMA 3J80E 3INZA 2NYSA 3LWHA 1G3TA 2DTHA 2HL5C 3PMIA 3MCAB 5DM7R 4P5NA 2DXUA 3VS4A 1G3SA 1Z9QA 4E2FB 2O2OA 5GANg 4M7DF 2M0YA 2CDTA 1G5VA 1Y0MA 5GMKl 1EIFA 2LNHB 4A4EA 2RN8A 1OZ3A 2XDPA 4ZGEB 1VQ9A 1YI2Q 2L3QA 2OTLA 3CCUA 4IUPA 2X35A 4M7DE 3JB9D 2RPNA 1KSWA 1W2BS 4AG1C 4JJBA 4KH1B 4PK4A 2EBPA 3JCMg 1S72A 3MPUB 2DILA 5C0MA 3CCMT 3VS2A 1PWTA 3QO3A 1Q95G 2DD5A 4J6XA 1I5LA 4ELYC 4FYWB 3EHRA 3JCMh 4DEXA 3FB9A 3A8LB 3CCQT 2E41A 4M7DC 5CQYA 3A98A 2AK5A 1Q86U 1VQ6T 1I4K1 1ZLMA 4L59A 5GAN8 2E5KA 3CC2A 5GAOr 3I5RA 3M0RA 1SSHA 5IHNA 3SEMA 3VYGA 5LJ5f 4JRQA 1VQ7T 1IZ6A 4KGZB 4GLKA 1IHWA 2ED0A 2DTIA 2HBPA 4JLGA 3LH5A 1MMGA 1D1BA 2FRYA 2M9UA 1YJ9A 4QVDA 2DL5A 1GFDA 3UT1A 2WSFE 4M7AC 4PLLA 1GBQA 2OJ2A 2A36A 1I81A 2QAZA 3A8MB 2XDDA 4F7UE 4QVZA 4OMLA 1VQOQ 3JCMW 5EC7A 3LGFA 5KYXA 2CYZB 1VYTA 5GMKh 4N0AC 3SHWA 5CCAA 4A4FA 4C5EA 1U5SA 1M2OA 1PM3A 3JCMb 4QW2A 1JJ2P 3RESA 2EYZA 3OQ5A 2E6NA 4BE2A 1GCQA 1X2QA 4M77A 4C0DB 1OOTA 2RO0A 2QGGA 4MZMA 3CCLQ 5GANd 2MOXA 1QVPA 1PNJA 1VQ5A 1UEBA 2D8HA 1YITQ 4QQGA 3TREA 2PZ1A 3UA6A 3GNFB 2EIFA 3DKMA 2OAWA 1VQ4T 2QASA 1OPLA 4V2SA 5GAN2 1M1FA 3G71Q 2GFUA 3META 2JN0A 1R0CB 4DBQA 3G1JA 3EAEA 2P0QA 1Y96A 4CRIA 4M77E 1HD3A 5D6WA 2V1QA 4R0KA 5I2SA 3G6EA 1K8AU 3GBQA 2CS7A 5LJ3j 2KEAA 4JLIA 3KUFA 2GNCA 4BE1A 4IURA 1Q82U 3LWIA 2G6FX 5HK3A 2DETA 2K5LA 4F7UA 1WXTA 4RG2A 5FU6B 1YIJA 2IIMA 5CO7A 2E65A 2K7AA 1AT1B 2JNGA 1VQNT 4HT9A 3TVTA 1BIAA 3C95A 4MZPA 3L2UA 2CSQA 5HK0A 3G71A 5GAOn 4Q5WA 2L5QA 5CVIA 2C0IA 4M7AD 3L2QA 1CSKA 1VQMT 5GJVB 4TVRA 4AFZC 3EG9B 1Q82R 2DA9A 1JB0E 1KIKA 1FMKA 2FZKB 3MHXA 1K76A 2HD0A 2RHXA 2DIGA 5GANf 3OBWA 1M8VA 1M1KU 1YJNA 3M0TA 1WLPB 4WTOB 3CC7A 2D8JA 3S6WA 1QQJA 3I55T 1VQPT 1KHCA 1S1NA 1SKUB 3V7RA 2X4JA 4B9XA 2JMAA 1WXBA 3ME9A 3OYBA 1D09B 3JCMd 2IVWA 2XDBA 1Q7YU 5LJ3f 2AIRB 1KQ1A 4MDXA 2V8KA 2ZPEB 1KQ2A 4OGEA 1D0YA 1C1AA 1B3QA 5KCHA 3M4GA 4J6WA 4LDWA 4OB3B 4NL2A 1H8KA 4M7DG 2D0QB 1TUGB 3GF5A 1BCOA 1PCXA 3JV3A 4N0AA 3NHNA 3R6OA 3HRUA 1KD1C 3CCJQ 4AFUC 2DK3A 2FZCB 5GMKj 4FYYB 3QDFA 3QZ9B 3CCUT 3UF4A 4HCCA 3P8HA 2HBWA 5KYUB 2MI6A 3A8GB 4M77D 3JCMf 3PIPA 2GF7A 1KC8U 5FWBA 3QIIA 5IXFA 1BBZA 2EWNA 2FPEA 2JTMA 2JMCA 2M16A 2CP0A 2DX1A 3G4SQ 3ASKA 3QZ5B 1G8XA 4AFSC 3CCVT 3HTRA 5FU6C 3H8ZA 1M90R 2E10A 3HFNA 4M78F 2BE9B 1MGQA 4OMFB 1RAIB 1N9RA 1M2VB 2AZSA 1AVZC 3M58A 1SHGA 3QXEB 3CCST 2YHTA 2E3HA 1JO8A 1X2KA 1NG2A 3THKA 5IXBA 2DZCA 1T3LA 1QKXA 2RJCA 4OMPA 5HCKA 4PL6A 2DXCA 2BZYA 1QLYA 3CCET 2ENMA 5CKEA 3V8LA 4FT2A 4IIOA 3L2VA 1KG1A 1Q81C 2DE0X 1N8RC 3FDRA 2LQ8A 2K3YA 2LC4A 2EGEA 2DBKA 3ZBDA 3OS0A 4EPCA 4A54A 2ZAEA 2J05A 4PJOD 4IUQA 4IUUA 4RTYA 3ZEHA 1QW1A 5GANe 3A5ZB 5CQXA 5KYNA 1MHNA 4RKUE 2JT4A 1NZ9A 2XKOC 3M4YA 3AHUA 1WI7A 3SWNC 3SWNB 4M77G 4XTZA 1IO6A 3U23A 3GOXA 1SHFA 4ZNXA 1G2BA 3RR6A 3OSVA 5CIUA 4DBHA 2X3XD 3EGUA 2FL7A 1JJ2S 4AFQC 4J9DA 2KE9A 2C0OA 1X01A 1K9MU 2EYWA 4Y92A 2QYZA 3M53A 1D1CA 2JOYA 1VQNA 3BDUA 2LJ0A 5KCOA 1PG5B 2QEXQ 2HQXA 4C92B 4RG8A 1AWXA 3CC4A 2OTJA 2CGHA 1ZSZA 1K73U 1PC0A 1F1BB 4FIBA 3VS3A 1AWWA 4JPBW 1RADB 2RB6A 4BE0A 2PNIA 2RJDA 2A3LA 4HT8A 1AWJA 1WPYA 4N4HA 3CCEQ 1VIEA 1B34B 4HKEA 1M3AA 1KC8C 4II1A 4C8QB 4BI3A 2RQUA 4J9CA 5EG2A 1VQ7A 3CBOA 1YCYA 5GANj 3CCSA 3A1PA 4J9IA 3EFOA 5A0LA 1YWPA 2G3RA 4EMKC 1M30A 5ECAA 2CKKA 2I2LA 2L0AA 4F7UG 1QWEA 3QWXX 1K8AC 1HXDA 3OYJA 4WF2A 2E12A 3C12A 2EQMA 4EIKA 1WFWA 2KRNA 2QTXA 5A0GA 2DERA 5LJ3h 2H8HA 3OYFA 3CC2T 3RBBB 1K0SA 2YLBA 2DRKA 1VQ4Q 3L2RA 3CEYA 2GQVA 4F16A 2COWA 3FC3A 4EDUA 2QQBA 2RQVA 4LDXA 4XU1A 3L2ZA 3MP6A 3R6NA 4DA4A 2PQWA 1LVKA 3WVEB 4FL6A 1JU5C 3CCUQ 1N9SA 2K3XA 3VKIA 1NPPA 2RI3A 2KXCA 1K4US 1YJ9T 1W4SA 3BDLA 1R8OB 1LJOA 4ESRA 2DKGA 2A08A 5AT1B 1TG0A 2DTOA 4M78C 2DF6A 1MNDA 2QA4T 2JM9A 1KQSP 4E6RA 2DJZA 1PSEA 4J7FA 1UGRB 2CUDA 3H6ZA 4K11A 4M7AE 2DEUA 3QWYA 1VQPA 4PJOE 4LXCA 3OW2A 1H3ZA 5I2MA 3VU3C 1QP3A 2D9TA 3JCMV 5A0DA 5J39A 1NJIC 3VUZA 5FRNA 3Q1JA 1PRLC 2I0NA 3REAB 1WZOA 1UGSB 5FW9A 2VWFA 2FB7A 3KBGA 3HPWA 2EQIA 3I56Q 3JCMJ 2EKHA 3CD6T 4M75G 2XICA 2KGTA 3V8JA 1VQ9Q 2ZPFB 4J7IA 4A4KA 2QDLA 2YRVA 4E7KA 5GAN4 2JZ2A 4KGVB 2KT8A 2DYBA 4QQDA 2DIQA 4JRIA 3M0PA 1GBRA 1Z9ZA 2F5TX 1VQ6Q 1UGVA 4F17A 2V1RA 1HYOA 2X4XA 2CSIA 2Y4XA 3L2WA 5KYYB 4J6YA 1J3TA 1QVGA 1RAEB 1EZZB 3RDVA 2CZ6B 2GTOA 5LJ5j 2QI2A 2OTLT 2HKQB 2YSQA 4XK8E 3LX7A 3JB9H 3HFOA 1ZSZB 1WHGA 1CKBA 4E7SA 2X9HA 4M75F 3M55A 4LDVA 3A8OB 3I35A 3OA6A 1XNIA 2QQSA 1AZEA 3CC4T 2OTJT 3NMZC 1Q7YC 6AT1B 4HVWA 3C0CA 1IGQA 3G7ZA 2QA4A 1IB8A 2HNIA 1AWOA 3GP8A 3P8BB 4FSSA 2YRDA 1ZBXA 3PFSA 5FRMA 1QVGS 1U8RA 4XTWA 2GGRA 1CKAA 4HVVA 3EH2A 4IUTA 2EYXA 1YHQT 1VQLQ 1M2VA 1YJ9Q 2XD0A 3CC2Q 5CKBA 1WDXA 2NWMA 2EQKA 1GRIA 4J83A 3JB9F 3HP9A 2MIOA 4Z89A 2MK5A 2R57A 1FMVA 1SEMA 3H41A 1ZUUA 2VVKA 2CT4A 3QYHB 1SRLA 5I21A 1IRXA 1FMWA 1K9MR 4RMOA 5IAYA 2NUPA 3CCJT 3X26B 1VQMA 2JTFA 3JCMc 2KBTA 1BI1A 3L42A 1M3BA 7AT1B 5LJ5h 4C8QD 4N4IA 2FVUA 3LLRA 1LPLA 1NYFA 1VQOT 1GCPA 2EKOA 4ZGJB 2A37A 1N5ZA 2RHIA 1TTHB 4LD6A 1U1TA 1G83A 4FYVB 3HKSA 2LQWA 3EGDB 1UG1A 4D6WA 2KR3A 3OS5A 1VQ8A 1ABQA 9ATCB 2AKLA 4A53A 1B07A 2F2VA 1HK9A 3VJPA 3M57A 1RLQC 5GAN5 3JB9J 2YWWA 2Y4YA 1ZSGA 1ZUYA 3EG9A 4A4HA 3G6EQ 3V7CA 4LD9K 3J81E 2DJQA 3JCMQ 3CXCP 4PJOC 1K8AR 2GBQA 2RH2A 4J9FA 5KYWB 4C92E 1NM7A 1NLOC 1VYUA 3MKDA 3FJPA 1WHLA 4YTLA 1BI3A 3E2UA 2CP5A 2E6ZA 1NE8A 2J6FA 2DXTA 4HVUA 3MEAA 4NL3A 2HSPA 3QDRB 2CH4A 4D8DA 1UJYA 2YLCA 4OMMA 4C8QE 2EQUA 1NBEB 2IG0A 4KT0E 3OS1A 3EG2A 4OMOA 5GMKe 3GIBA 1Q82C 1TOVA 4DOVA 2X51A 3M59A 3RERA 2KRSA 3BFMA 1WQ7A 2AHJB 2J06A 2RHYA 3M5AA 1MMDA 3PNWC 2J7IA 4XTUA 1AHJB 1D0ZA 2HQEA 1W1FA 1TUDA 2QTVA 3PVQA 4QT7A 4M7DB 1HJDA 3WXMB 4C8QC 3GLXA 1RL2A 5FU7B 3TSZA 2DVEA 2D6FA 4DOWA 3M0UA 3G71T 3OS2A 1W2BP 2EQJA 3SDZA 1WXUA 1RI9A 4A4GA 4M77B 2DYIA 2GTJA 4M77C 2BE7D 2RI5A 2LCCA 4ELZC 1ZHIA 2HQHA 2K57A 3UA7A 3CD6Q 4Y91A 4FCYA 2JTEA 4CC2A 5KYYA 2E64A 3CCVQ 5L23A 5HKCA 2HSEB 5I11A 2C06A 4PFZA 4PJOG 3EFRA 2VXEA 1TH7A 3TU4K 2EJFA 2FYKA 2OI3A 1Y96B 2RNAA 2K9GA 4LN2A 5FU7C 1KQSA 3NGPA 3OYEA 2M1HA 3HHTB 5KYXB 2CZ0B 2NUPB 2RD1A 5CR2A 3CCRQ 2K5FA 2X4YA 1YIJQ 1Q81U 2ZGWA 2LP5A 3CCQA 1RACB 3QSUA 3RNJA 3CMAA 2B8AA 1A0NB 3RMQA 2RQWA 3NTKA 2X4WA 1JBMA 1N8RR 1FX7A 1QMCA 2KYMA 3OBYA 2A7YA 5GMKm 3QJYA 1WJRA 2F5KA 3EGXA 3JB9I 2MYSA 4F7UB 2CH4W 1ARKA 1E7OA 4UC4A 1KC8R 4J9EA 3CCJA 1QVFA 2ROLA 2Z0WA 2O9SA 1KQSS 1M9SA 1H92A 3C4SA 2KVQG 1WGSA 2H3EB 2RQTA 1MUZA 1M5Q1 1BCMA 1UB4A 1OX8A 1MV0B 3FIFA 2K2MA 2KI7A 5D7UA 3JCMP 3CBPA 5FLXE 1H3HA 4C92F 3L1AA 1M27C 2QDYB 2K2VA 2OX7A 5LJ5d 3CPWA 5LJ3e 5IH2A 3LGLA 2LQKA 2RJEA 4BB7A 1H641 2RQRA 4PJNA 1X43A 1VQ8T 3CCMA 2E5QA 4OMQA 4CC3A 2O9VA 1WNLA 1AZGB 3BE3A 1Q86R 3JCMX 1N6AA 3VUBA 4BDZA 2JXBA 1TWBA 1AOJA 4DBRA 1YCSB 3UWNA 1RAAB 2DL8A 2KXDA 4O5VA 1OI1A 5CAIA 4C8QA 1ZQ1A 3GNGA 2AKKA 3OY9A 4JJNK 1E6GA 2XI9A 2KYBA 3WVDB 1M8MA 1RAHB 2WACA 4M78A 4RTWA 1OZ2A 4F14A 1M4ZA 1UHCA 2YUPA 2FRWA 3MO8A 3IQLA 4NS5A 1OV3A 3CC7Q 1PKTA 2MWPA 2VC8A 4PKCC 1VQ4A 2DO3A 1GCQC 1WJSA 2K79A 2A0FB 1C6VX 1GXIE 4ZGDB 3OYNA 4HXJA 1UTIA 3QKJA 4RTVA 1YHQQ 3TQ7P 2M0OA 2O4XA 2BKDN 2EW3A 3QBYA 2DL4A 4Z02A 2BIVA 3BW1A 3VS1A 1K73R 5DY9A 4DBFA 4C8QF 4C0DC 1JXMA 1XQHA 1BI0A 4WCIA 3AT1B 1K0XA 2XG8D 3E9GA 4OB0B 3UPUA 4JRKA 3UATA 3DLLA 5GJWB 2RHZA 3RIRA 1V76A 2L2PA 2DNUA 1NJIR 2KQWA 5D6XA 4R55A 3JSCA 5M9OA 1KD1R 2F1LA 1VIFA 1PRMC 1BKBA 4LDYA 3QJ6A 3PVLA 4BI8B 4OMNA 1C0MA 3QG1A 2VXFA 1JJ2A 2ZPIB 2MAMA 2DRMA 1QCFA 2RMOA 2P4RA 2LVMA 3JB9G 4OVAA 3I55Q 3X24B 1NYGA 2XU8A 1M90U 2ESWA 1PD0A 3S3NA 1OYXA 2WSEE 4M78G 2WSCE 2JUFA 2L3PA 1YJWA 1RI0A 2RM4A 4M7AF 1X6GA 1VQ5T 3H9NA 2P0PA 3SD4A 2FHDA 1KJWA 3G6ET 4AT1B 2EYYA 1T3SA 4E7ZA 1YNZA 3OYLA 1OU9A 2QG9B 5GAN7 4XU0A 3J7AF 1XJWB 2DLPA 4XU3A 4LE9A 3MP1A 1X75C 1ZBJA 1YJWT 4FM4B 4ZN1A 1O9SA 2PUKB 3E19A 2RF0A 4JZ3A 3CC7T 2QQ9A 4J9HA 2NUZA 4PFPA 4L6V5 1WIEA 1BK2A 2RHUA 4OB1B 3BY7A 4LUEA 5A2QE 3M0QA 1ACMB 1HSQA 1I5OB 4XTYA 3RMSA 1I1JA 3MJXA 1K9AA 1TS9A 4CC4B 3H0HA 1K73C 1YJWQ 5CKHA 3KXTA 3NPFA 3OB9A 1FWZA 2QEXT 2QK0A 3P8DA 3LYIA 1QP2A 2DXBA 1YFNA 1QCOA 3G4ST 2M02A 1YITA 3OYMA 2PUOB 2DEQA 2EPDA 1VQ6A 4PJOA 4EMHA 1UECA 1ZA2B 4ZTJA 3JRZA 5KH6A 2PVGB 3EG3A 3I56T 4KUDK 1VYVA 4KBMB 2VV5A 1XOVA 3RKWA 2VKNA 5GAOm 2L8DA 2QQRA 1UE9A 5GAOl 4ANJA 3CCLT 2L3SA 3ZFJA 4M75B 2K3BA 2MCNA 4PJMA 2KMTA 8AT1B 1T0JA
chains in the Genus database with same CATH topology
3MP8A 2DK3A 4A4HA 3V7CA 2K4YA 4LD9K 2CZ7B 4X9CA 2LDMA 2RK1A 5GMKj 1Q86C 4J5YA 2V8IA 3QZ9B 3J81E 4BY6B 3CCUT 1M1GA 4HCCA 3P8HA 2QEXA 3JCMQ 4EMKA 4PJOC 3SFMA 2RH2A 2MI6A 2EJ9A 3CPFA 4PNOA 4C92E 4M75D 3A8GB 3FJPA 4M77D 4M7AB 3JCMf 3PIPA 4YTLA 1BI3A 2O01E 2E6ZA 2GF7A 1NE8A 3LH0A 2DXTA 1KC8U 3OYKA 3SB2A 1WJQA 3QIIA 1DJ7B 3MEAA 4PLIA 4NL3A 4JRPA 4QQ6A 3QDRB 2EWNA 2JTMA 3OYGA 2M16A 3QPHA 3A8HB 4C5IA 2VYTA 2RK2A 2YLCA 4C8QE 3CPWS 2EQUA 5LJ5g 1G3WA 2IG0A 1K9MC 3PT9A 3FRNA 3URGA 1SSFA 3CCRT 2LRQA 4KT0E 3ASKA 3QZ5B 3OS1A 3CCVT 4CI0C 4C5HA 5GMKe 5FU6C 3GIBA 2L3RA 3H8ZA 1YI2T 1Q82C 1LNXA 3E1SA 4GY5A 1PSFA 2E10A 3HFNA 4M78F 4DOVA 1MGQA 3HL8A 3MEVA 3DB3A 3M59A 4OMFB 3RERA 2XK0A 3BFMA 3I56A 1N9RA 1WQ7A 1BIBA 1V29B 2PVDB 3M58A 2DZ9A 2AHJB 3QXEB 1YJNT 2BUDA 3CCST 2RHYA 3M5AA 2YHTA 4MMKA 5IN1A 3VYHB 2V8JA 4IKFA 3PTAA 3QHSA 3PNWC 4JS4A 4PJOF 3V7SA 3CXCA 1D3BB 4XTUA 1AHJB 3CCLA 2O4XB 2HQEA 4BY6C 4M7DB 2LT4A 2DZCA 2LCLA 2KY9A 3WXMB 4C8QC 2RJCA 1RL2A 3GLXA 5FU7B 5FROA 2XHCA 4E7HA 5J26A 2QQAA 4R56A 2DVEA 3E9FA 4DOWA 2D6FA 3CMET 2EJGA 3MEUA 4PL6A 3G71T 2DXCA 3CCET 4FT4A 5IT9E 5CKEA 3V8LA 2EYQA 3OS2A 4FT2A 2EQJA 3SDZA 3OW2S 4KUIA 3L2VA 1KG1A 1Q81C 4A4GA 1N8RC 4M77B 3FDRA 2LQ8A 2K3YA 2KK4A 4M77C 2LC4A 4OP0A 4EMKB 3DLMA 4HCBA 3OYIA 2RI5A 2LCCA 3ZBDA 4ELZC 3RUXA 3OS0A 1ZHIA 4EPCA 3FEOA 1UGQB 4A54A 2K57A 4M7DA 4PJOD 4IUQA 3NFCA 4M78E 4IUUA 4Y91A 3ZEHA 3CCEA 3TCJA 1YBYA 1QW1A 5KE2A 3CMEA 5GANe 3A5ZB 3OSSC 2E64A 5CQXA 1N27A 3M56A 4C5GA 1MHNA 4B9WA 5HKCA 2NLUA 4RKUE 3QUIA 5DLQE 1VQKT 1NZ9A 2XKOC 4X9DA 3M4YA 2C06A 2F69A 3PGGA 1YI2A 3AHUA 3SWNC 3OYAA 4PJOG 4M77G 3EFRA 4XTZA 3SWNB 4BD3A 2VXEA 3CXCS 2LTOA 4XTXA 2HAXA 2E1HA 4JS5A 4BACA 1TH7A 3LW5E 4M7DF 2RA2A 3TU4K 5GAMh 2EJFA 3PMTA 3OYHA 3GOXA 2FYKA 2VUBA 4Y28E 3OSVA 1Y96B 5CIUA 4M7AA 2XIDA 4X34A 5LJ3g 2K5IA 2FL7A 1JJ2S 2H3JA 1KQSA 5FU7C 4C8QG 5GAN6 1X01A 3OYEA 2M1HA 5GAMf 3HHTB 5AYFA 4C0FA 1UGPB 1K9MU 4VUBA 2CZ0B 3PIOA 1W2BA 2JVVA 1NPRA 2OAUA 1VQKA 2RD1A 3TEEA 3M53A 3OMGA 2JOYA 5CR2A 2K5FA 1D3BA 2PU9B 2X4YA 4RCBA 1VQNA 1Q81U 2QXFA 2ZGWA 3BDUA 1N8RU 5KCOA 1NJIU 3CCQA 3QSUA 3CMAA 2B8AA 2LNVA 4M75A 3CBMA 4XU2A 3J80E 2HQXA 4C92G 4C92B 3RMQA 3INZA 1Y7XA 2R5MA 2X4WA 3EFSA 3NTKA 4JDSA 2CGHA 1G3TA 1JBMA 4RG8A 3LWHA 1FX7A 2DTHA 2ZZDA 3MCAB 3PMIA 5DM7R 4FIBA 3OYDA 3OBYA 2A7YA 2DXUA 4P5NA 3GPLA 2RB6A 4BE0A 5GMKm 1G3SA 2RJDA 1WJRA 2F5KA 2A3LA 3QJYA 5GANg 3JB9I 1WPYA 4N4HA 4HT8A 1G5VA 5GMKl 3F70A 1VIEA 1B34B 4HKEA 3T9NA 4F7UB 1KC8C 1FXXA 1EIFA 4IUVA 2LT1A 4UC4A 1JRIA 4MMLA 4A4EA 2KSSA 4II1A 4C8QB 2XDPA 1OZ3A 3NTIA 4M75E 5EG2A 4BI3A 4C0GA 4DQ2A 4ZGEB 1S72T 1VQ7A 1VQ9A 3CBOA 3CCJA 1YCYA 2OTLA 3CCUA 1QVFA 5GANj 4IUPA 1KQSS 3CCSA 2KDSA 1M9SA 2X35A 3C4SA 4M7DE 2KVQG 4JUVA 3JB9D 1WGSA 5A0LA 1W2BS 2G3RA 1VUBA 4EMKC 1M5Q1 1UB4A 2CKKA 2I2LA 3M54A 3FIFA 3OYYA 1B34A 3JCMg 4F7UG 1S72A 2GFAA 5C0MA 3CCMT 3JCMP 1K8AC 3X25B 1HXDA 3CBPA 5FLXE 3OYJA 4WF2A 2E12A 3C12A 1Y07A 2EQMA 4ATOA 4C92F 3L1AA 3QO3A 1QVFS 2DD5A 2QDYB 2K2VA 4J6XA 1I5LA 5LJ5d 4M7AG 2QTXA 5A0GA 5LJ3h 3CPWA 4ELYC 3OYFA 5GAN3 3JCMh 3CC2T 3FB9A 3A8LB 3CCQT 2YLBA 2RJFA 5LJ3e 2E41A 3LGLA 2LQKA 2R58A 2RJEA 4BB7A 1H641 3L2RA 3CEYA 2GQVA 4M7DC 1VQOA 5CQYA 1VQ8T 3CCMA 2E5QA 3FC3A 4BDYA 1Q86U 4EDUA 1WQWA 2QQBA 3FLGA 4LDXA 4XU1A 1VQLA 1I4K1 2P4TA 3L2ZA 3MP6A 4L59A 4E7IA 1VQ6T 4ZN3A 4DA4A 3S3MA 1WNLA 2PQWA 5L8RE 5GAN8 3C94A 3CC2A 5GAOr 3OMCA 3JCMX 1N6AA 3WVEB 4FL6A 3VUBA 4BDZA 3VYGA 1N9SA 3CD6A 2K3XA 3VKIA 1NPPA 2RI3A 4XTVA 3UWNA 5DLOA 5LJ5f 1I8FA 4M75C 1W4SA 4O5VA 4JRQA 1YJ9T 1OI1A 1R8OB 3BDLA 5CAIA 4C8QA 1VQ7T 1ZQ1A 3GNGA 1IZ6A 3OY9A 4JJNK 1LJOA 3N5BB 2DKGA 2XI9A 2VGNA 4GLKA 2DTIA 2DTOA 3WVDB 2HBPA 4M78C 2WACA 4M78A 2QA4T 1OZ2A 4JLGA 2MWOA 2DJZA 1PSEA 5HY6A 1M4ZA 2M9UA 4EMGA 3MO8A 4NS5A 2MF2A 4J7FA 4QVDA 5D6YA 1YJ9A 3UT1A 4XAXB 2MWPA 1UGRB 5KE3A 2WSFE 4M7AC 3X28B 3H6ZA 4PLLA 3JCMe 2E70A 2VC8A 4M7AE 4PKCC 1I81A 2VGMA 2P0KA 1VQ4A 2DO3A 1VQPA 4PJOE 1WJSA 3A8MB 4E47A 4F7UE 2XDDA 3CCRA 3JB9F 4QVZA 1GXIE 4ZGDB 3OYNA 3JCMW 5C6SA 4BI4A 3OW2A 3QKJA 5I2MA 1H3ZA 3VU3C 1QP3A 3LGFA 2D9TA 3JCMV 5A0DA 5J39A 1NJIC 2CYZB 2M0OA 3VUZA 5FRNA 5GMKh 3Q1JA 2O4XA 4N0AC 4M77F 5CCAA 3CC4A 4MZTA 4A4FA 2BKDN 1UGSB 4C5EA 5GAMd 3QBYA 3JCMb 4QW2A 2FB7A 4E7JA 4Z02A 1KHIA 3RESA 2LX9A 3KBGA 2BIVA 3HPWA 3X20B 5LJ5e 3BW1A 5DY9A 3OQ5A 3JCMJ 3M9QA 2E6NA 4C92A 4BE2A 3CD6T 4M7DD 4M75G 4C8QF 4C0DC 2XICA 4C0DB 4M77A 1P92A 3V8JA 2ZCFB 2MMPA 1XQHA 1BI0A 2ZPFB 5GMKi 4J7IA 4A4KA 2RO0A 4MZMA 2XG8D 5GANd 3E9GA 4OB0B 2YRVA 1QVPA 3UPUA 5GAN4 4JRKA 3O8VA 3DLLA 4E7KA 1UEBA 2JZ2A 1VQ5A 4QQDA 2DIQA 2RHZA 4JRIA 4QQGA 3RIRA 3TREA 1Y71A 2F5TX 2X4XA 2KQWA 4LDUA 2Y4XA 5D6XA 4R55A 3JSCA 4C0ZA 3L2WA 4J6YA 5M9OA 3GNFB 4HA8A 1QVGA 1VIFA 2EIFA 1M1KC 4FSXA 1BKBA 4LDYA 2CZ6B 3QJ6A 5LJ5j 4BI8B 3DKMA 2PVOB 2QI2A 2OTLT 1VQ4T 4V2SA 4XK8E 4E7LA 3LX7A 3QG1A 4O6JA 3JB9H 5GAN2 1M1FA 2VXFA 2GFUA 3META 2JN0A 2ZPIB 3HFOA 2MAMA 1JJ2A 1BYMA 3EAEA 1XTDA 3DB4A 2P0QA 2R5AA 3HRSA 1Y96A 4CRIA 4M77E 4M75F 3M55A 4LDVA 5D6WA 2LVMA 3A8OB 3JB9G 4C92D 4ZTFA 4PJOB 4OVAA 3S3OA 3X24B 3OA6A 5I2SA 1XNIA 2XU8A 2QQSA 1M90U 3G6EA 1K8AU 2CS7A 5LJ3j 3CC4T 2OTJT 4JLIA 3KUFA 5LL6S 2ZPGB 4F7UF 3S3NA 1Q7YC 1OYXA 2WSEE 4M78G 4BE1A 4IURA 2WSCE 1IREB 2JUFA 2ZPBB 3G7ZA 5CKFA 3LWIA 2QA4A 1Q82U 1YJWA 1RI0A 2HNIA 2RM4A 3GP8A 5HK3A 3P8BB 3QYGB 1X6OA 4M7AF 1ZBXA 5GAMj 3VV0A 3PFSA 1YITT 1VQ5T 2K5LA 2P0PA 4F7UA 1QVGS 4M78D 3SD4A 5FRMA 2FHDA 3NTHA 4N4GA 4RG2A 5FU6B 3G6ET 3SWNA 4XTWA 1YIJA 1U8RA 2EFIA 5CO7A 2E65A 3OYLA 4IUTA 4NOYA 5GAN7 1YHQT 2KAFA 4XU0A 4C92C 3J7AF 2JNGA 2XD0A 4XU3A 1KD1U 3MP1A 4ME7A 3JAME 1VQNT 4HT9A 1X75C 3RKYA 1YJWT 1BIAA 1U1SA 2CZ1B 4FM4B 5CKBA 4BUGA 4ZN1A 1O9SA 2PUKB 3C95A 2EQKA 3ER0A 4MDWA 4MZPA 3CMAT 4M78B 3L2UA 4J83A 3RKXA 3HP9A 2L89A 3E19A 5HK0A 5GAOn 3G71A 4Q5WA 1YIJT 2L5QA 3CC7T 5CVIA 2QQ9A 2R57A 2DD4A 4M7AD 4HCZA 3L2QA 1VQMT 4TVRA 1M90C 3QYHB 4L6V5 3I55A 1G3YA 2RHUA 3HRTA 1JB0E 5I21A 1YHQA 1LOJA 3OYCA 4OB1B 3BY7A 3MHXA 5A2QE 4RMOA 2HD0A 4FU6A 4OB2B 5IAYA 2RHXA 2DIGA 2GCXA 4XTYA 3OBWA 5GANf 3RMSA 3CCJT 1M8VA 1M1KU 3X26B 1YJNA 2ZPHB 1K73C 1VQMA 5CKHA 3CC7A 3KXTA 3S6WA 3OB9A 4L5GA 2JTFA 3JCMc 3I55T 1FWZA 2QEXT 1VQPT 4RCCA 1KHCA 3P8DA 5GAOq 1BI1A 3LYIA 3L42A 1QP2A 2DXBA 3V7RA 5GAMg 2X4JA 4B9XA 5LJ5h 4C8QD 4N4IA 5LJ3d 2DAQA 2FVUA 3G4ST 2RI2A 3LLRA 1VQ9T 1YITA 4OF1A 3ME9A 3OYMA 1VQOT 2PUOB 5GAMe 2DEQA 3OYBA 4XQ3A 3JCMd 2EKOA 2IVWA 4QVCA 1Q7YU 4ZGJB 2XDBA 3MEWA 5LJ3f 1VQLT 1VQ6A 4PJOA 2RHIA 4EMHA 1KQ1A 3CCVA 5J3BA 4MDXA 2V8KA 4LD6A 1U1TA 4J8OA 2ZPEB 1KQ2A 4OGEA 4ZTJA 2Y90A 3HKSA 3JRZA 2DPPB 2PVGB 5KH6A 5KCHA 3M4GA 3G4SA 3V8KA 4J6WA 4LDWA 3I56T 2OTJA 5GAOp 4KUDK 4D6WA 4NL2A 3OS5A 1O75A 2VV5A 4KBMB 4OB3B 1VQ8A 4M7DG 1XOVA 2D0QB 3RKWA 3HSBA 3GF5A 3UDCA 4A53A 5GAOm 2L8DA 2QQRA 1HK9A 3VJPA 3M57A 5GANh 1K73U 5GAOl 5CKDA 5GAN5 4KULA 4N0AA 3ZFJA 4M75B 3CCLT 3JB9J 2Y4YA 3R6OA 2EAYA 3HRUA 5CK9A 1KD1C 1BI2A 2KMTA 4OGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP8 A;  4A4H A;  2LDM A;  1Q86 C;  3J81 E;  3CCU T;  1M1G A;  2QEX A;  3P8H A;  2MI6 A;  3CPF A;  3PIP A;  4YTL A;  2E6Z A;  2GF7 A;  3LH0 A;  1KC8 U;  3OYK A;  1WJQ A;  3QII A;  3MEA A;  4PLI A;  4QQ6 A;  3OYG A;  2M16 A;  4C5I A;  2VYT A;  2EQU A;  2IG0 A;  1K9M C;  1SSF A;  3CCR T;  2LRQ A;  3ASK A;  3CCV T;  3OS1 A;  4C5H A;  2L3R A;  3H8Z A;  1YI2 T;  1Q82 C;  4GY5 A;  3MEV A;  3DB3 A;  2XK0 A;  3I56 A;  1YJN T;  2BUD A;  3CCS T;  2RHY A;  4IKF A;  5IN1 A;  3PNW C;  3CXC A;  3CCL A;  2O4X B;  2HQE A;  2LCL A;  2RJC A;  1RL2 A;  5FRO A;  2XHC A;  4E7H A;  5J26 A;  3E9F A;  3CME T;  3MEU A;  4PL6 A;  3G71 T;  3CCE T;  5IT9 E;  3OS2 A;  2EQJ A;  3OW2 S;  3L2V A;  1Q81 C;  4A4G A;  1N8R C;  3FDR A;  2LQ8 A;  2K3Y A;  3DLM A;  3OYI A;  2RI5 A;  2LCC A;  3OS0 A;  3FEO A;  4IUQ A;  3CCE A;  4IUU A;  3ZEH A;  5KE2 A;  1YBY A;  3CME A;  3A5Z B;  1N27 A;  4C5G A;  1MHN A;  4B9W A;  5DLQ E;  2NLU A;  1VQK T;  1NZ9 A;  1YI2 A;  3OYA A;  3CXC S;  4BD3 A;  2LTO A;  4BAC A;  3OYH A;  3GOX A;  3PMT A;  5CIU A;  4X34 A;  1JJ2 S;  1KQS A;  3OYE A;  2M1H A;  1K9M U;  1W2B A;  3PIO A;  2JVV A;  1NPR A;  1VQK A;  3OMG A;  2JOY A;  2X4Y A;  1VQN A;  1Q81 U;  1N8R U;  1NJI U;  5KCO A;  3CCQ A;  3CMA A;  2B8A A;  3J80 E;  2HQX A;  3NTK A;  2R5M A;  2X4W A;  3CC4 A;  2OTJ A;  3OYD A;  3PMI A;  1K73 U;  5DM7 R;  4BE0 A;  2RJD A;  1WJR A;  2F5K A;  4N4H A;  1G5V A;  3F70 A;  1KC8 C;  1EIF A;  4IUV A;  4UC4 A;  4A4E A;  4II1 A;  2XDP A;  1OZ3 A;  3NTI A;  1S72 T;  1VQ7 A;  1VQ9 A;  3CCJ A;  2OTL A;  3CCU A;  1QVF A;  4IUP A;  1KQS S;  3CCS A;  2KDS A;  2X35 A;  3C4S A;  2KVQ G;  1WGS A;  1W2B S;  2G3R A;  2CKK A;  3OYY A;  1S72 A;  2GFA A;  5C0M A;  3CCM T;  1K8A C;  5FLX E;  3OYJ A;  2EQM A;  1QVF S;  3CPW A;  3OYF A;  3CC2 T;  3CCQ T;  2RJF A;  3LGL A;  2R58 A;  2RJE A;  3L2R A;  3CEY A;  1VQO A;  1VQ8 T;  3CCM A;  2E5Q A;  1Q86 U;  3FC3 A;  4BDY A;  4EDU A;  3FLG A;  1VQL A;  1VQ6 T;  3MP6 A;  4L59 A;  4E7I A;  4ZN3 A;  3S3M A;  2PQW A;  3CC2 A;  3OMC A;  4FL6 A;  4BDZ A;  3CD6 A;  2K3X A;  1NPP A;  2RI3 A;  3UWN A;  1YJ9 T;  1OI1 A;  3BDL A;  1VQ7 T;  1IZ6 A;  3OY9 A;  2WAC A;  2QA4 T;  1OZ2 A;  2MWO A;  5HY6 A;  3MO8 A;  4NS5 A;  1YJ9 A;  5D6Y A;  3UT1 A;  2MWP A;  5KE3 A;  3H6Z A;  4PLL A;  2E70 A;  2P0K A;  1VQ4 A;  2DO3 A;  1VQP A;  3CCR A;  1WJS A;  4QVZ A;  3OYN A;  3OW2 A;  5C6S A;  1H3Z A;  3QKJ A;  3LGF A;  2D9T A;  5J39 A;  1NJI C;  5FRN A;  2M0O A;  3Q1J A;  2O4X A;  4A4F A;  2BKD N;  4C5E A;  3QBY A;  4QW2 A;  4E7J A;  4Z02 A;  1KHI A;  3KBG A;  2BIV A;  3OQ5 A;  3M9Q A;  2E6N A;  4BE2 A;  3CD6 T;  2RO0 A;  3E9G A;  2YRV A;  4E7K A;  3O8V A;  3DLL A;  1VQ5 A;  1UEB A;  2JZ2 A;  4QQD A;  2DIQ A;  2RHZ A;  4QQG A;  3TRE A;  2X4X A;  5D6X A;  3L2W A;  5M9O A;  1QVG A;  2EIF A;  1M1K C;  1BKB A;  3QJ6 A;  2OTL T;  1VQ4 T;  4E7L A;  3LX7 A;  2GFU A;  3MET A;  1JJ2 A;  3EAE A;  1XTD A;  3DB4 A;  2R5A A;  4CRI A;  5D6W A;  2LVM A;  4ZTF A;  4OVA A;  3S3O A;  3OA6 A;  1XNI A;  2QQS A;  1M90 U;  3G6E A;  1K8A U;  3CC4 T;  2OTJ T;  5LL6 S;  1Q7Y C;  3KUF A;  3S3N A;  1OYX A;  4BE1 A;  4IUR A;  1Q82 U;  2JUF A;  2QA4 A;  1YJW A;  1RI0 A;  3P8B B;  1X6O A;  1YIT T;  1VQ5 T;  3PFS A;  5FRM A;  1QVG S;  3SD4 A;  2FHD A;  3NTH A;  4N4G A;  4RG2 A;  3G6E T;  1YIJ A;  2EFI A;  3OYL A;  4IUT A;  1YHQ T;  3J7A F;  2JNG A;  1KD1 U;  1VQN T;  3MP1 A;  3JAM E;  1YJW T;  4ZN1 A;  3CMA T;  2EQK A;  3ER0 A;  3L2U A;  2L89 A;  3G71 A;  4Q5W A;  1YIJ T;  3CC7 T;  2R57 A;  4HCZ A;  3L2Q A;  1VQM T;  4TVR A;  1M90 C;  3I55 A;  2RHU A;  1YHQ A;  3OYC A;  5A2Q E;  3CPW S;  4FU6 A;  5IAY A;  2RHX A;  2DIG A;  3CCJ T;  1M1K U;  1YJN A;  1K73 C;  1VQM A;  3CC7 A;  3S6W A;  3OB9 A;  3I55 T;  2JTF A;  1VQP T;  2QEX T;  1KHC A;  3P8D A;  3LYI A;  3L42 A;  4B9X A;  4N4I A;  3G4S T;  2DAQ A;  2RI2 A;  3LLR A;  1VQ9 T;  1YIT A;  1VQO T;  3ME9 A;  3OYM A;  3OYB A;  2EKO A;  1Q7Y U;  3MEW A;  1VQL T;  1VQ6 A;  3CCV A;  2RHI A;  5J3B A;  4LD6 A;  4ZTJ A;  3HKS A;  5KH6 A;  5KCH A;  3G4S A;  3I56 T;  1VQ8 A;  2L8D A;  2QQR A;  3CCL T;  1KD1 C; 
#chains in the Genus database with same CATH topology
 1VQN Q;  4X9C A;  2RK1 A;  2C0T A;  3EGX B;  2V8I A;  4BY6 B;  1M1G A;  4B6M A;  2DBM A;  2QEX A;  4EMK A;  1WHH A;  4LNP A;  4PNO A;  4M75 D;  1JQQ A;  3OYK A;  4QQ6 A;  1WHJ A;  3OYG A;  1NLP C;  2VYT A;  2RK2 A;  1X27 A;  4AMC A;  5LJ5 g;  1G3W A;  3PT9 A;  2D0N A;  3FRN A;  1SSF A;  3URG A;  3CCR T;  2KRM A;  2FG0 A;  1YI2 T;  3E1S A;  4GY5 A;  1I07 A;  1PSF A;  3I9Q A;  3MEV A;  2CP6 A;  2HEQ A;  1ABO A;  2AZV A;  1V29 B;  2PVD B;  2NUT A;  5FWC A;  1YJN T;  3VYH B;  4IKF A;  3VS7 A;  3QHS A;  4PJO F;  3V7S A;  1D3B B;  4BY6 C;  1SRM A;  2LT4 A;  2JJ9 A;  2XHC A;  5J26 A;  4R56 A;  3D7S B;  3E9F A;  2CP7 A;  3CME T;  2EJG A;  1VQM Q;  4PJL A;  4FT4 A;  1OUL A;  4KUI A;  2KK4 A;  2V26 A;  3VS0 A;  3EH1 A;  1UJ0 A;  1UGQ B;  1GL5 A;  3NFC A;  8ATC B;  4M78 E;  5KE2 A;  1YBY A;  3CME A;  3OSS C;  3M56 A;  4C5G A;  1ZX6 A;  2NLU A;  1D0X A;  4X9D A;  2HL3 A;  2F69 A;  1YI2 A;  4A63 B;  4XTX A;  2E1H A;  1OPK A;  3LW5 E;  1VQ8 Q;  4M4Z A;  4Y28 E;  4M7A A;  2XID A;  2K5I A;  2ATC B;  2J6K A;  1YWO A;  1AD5 A;  4C8Q G;  5GAN 6;  2COY A;  4C0F A;  3PIO A;  1NPR A;  3VS5 A;  3OMG A;  4QKU A;  2O88 A;  3PE0 A;  2QXF A;  1NJI U;  1VQ5 Q;  4KGX B;  1R0B G;  1RAB B;  4Z8A A;  2EGC A;  4XU2 A;  4C92 G;  1Y7X A;  2R5M A;  3EFS A;  4JDS A;  3OYD A;  2ZZD A;  3GPL A;  1Q81 R;  2FPD A;  1SF9 A;  2YT6 A;  2NUT B;  3F70 A;  3T9N A;  1VA7 A;  1FXX A;  4J9B A;  2FPF A;  4IUV A;  2LT1 A;  1JRI A;  4MML A;  2KSS A;  4M75 E;  3NTI A;  4FW1 A;  4C0G A;  4DQ2 A;  1S72 T;  4KRT A;  2KDS A;  1V1C A;  4JUV A;  1X69 A;  1VUB A;  2P84 A;  3OYY A;  3M54 A;  1B34 A;  2GFA A;  1LCK A;  1X6B A;  2HKN A;  3X25 B;  2EGA A;  4ATO A;  1Y07 A;  2F2W A;  1KFZ A;  2EVR A;  1QVF S;  1ZSZ C;  4M7A G;  1JXO A;  5GAN 3;  2RJF A;  4F04 B;  2YUN A;  2R58 A;  2D1X A;  1VQO A;  4BDY A;  1WQW A;  3FLG A;  1VQL A;  4E7I A;  2P4T A;  4ZN3 A;  3S3M A;  5L8R E;  3OW2 P;  3C94 A;  4D8K A;  3OMC A;  3TSW A;  1M3C A;  1W70 A;  3CD6 A;  4XTV A;  5DLO A;  1I8F A;  4M75 C;  4PJJ A;  1I0C A;  3N5B B;  2VGN A;  2DMO A;  3EGD A;  2MWO A;  5HY6 A;  4EMG A;  1PD1 A;  2MF2 A;  5D6Y A;  4XAX B;  5KE3 A;  3X28 B;  2KRO A;  2YXY A;  4RUG A;  3JCM e;  2E70 A;  2VGM A;  2P0K A;  2LJ1 A;  4E47 A;  3CCR A;  2DFU A;  5C6S A;  4BI4 A;  1RUW A;  1WX6 A;  1QVG P;  4M77 F;  4MZT A;  2CRE A;  5GAM d;  2W10 A;  1U06 A;  4E7J A;  1KHI A;  3VS6 A;  4HCK A;  2LX9 A;  4RTX A;  3X20 B;  5LJ5 e;  1IHV A;  2JS2 A;  3M9Q A;  2YDL A;  4C92 A;  4M7D D;  2DL3 A;  1P92 A;  1SPK A;  2E4H A;  2ZCF B;  2MMP A;  5IHI A;  5GMK i;  4PFO A;  3O8V A;  1TUC A;  1VOM A;  1Y71 A;  1WHM A;  1UFF A;  1EFN A;  2LQN A;  1NEG A;  4LDU A;  1IGU A;  4C0Z A;  3H0I A;  4HA8 A;  2YUO A;  1JEG A;  1D1A A;  4FSX A;  1M1K C;  2BZ8 A;  1UUE A;  2PVO B;  3ZL7 C;  1MNE A;  2LZ6 B;  1VQ7 Q;  4E7L A;  4O6J A;  1BYM A;  2ROT A;  3CME Q;  4IIM A;  1XTD A;  1OX9 A;  3DB4 A;  1OU8 A;  2R5A A;  3HRS A;  4PJO B;  4C92 D;  4ZTF A;  3S3O A;  2LMJ A;  2CP3 A;  1TU0 B;  4FW2 A;  4AG2 C;  5LL6 S;  2ZPG B;  4F7U F;  3FJ5 A;  1IRE B;  2ZPB B;  5CKF A;  1E6H A;  1YJN Q;  2LX7 A;  4DEY A;  3QYG B;  1X6O A;  2VAS A;  2BZX A;  5GAM j;  2A28 A;  3CPW P;  3VRZ A;  3VV0 A;  1YIT T;  1T0H A;  4M78 D;  3NTH A;  4N4G A;  1UDL A;  3SWN A;  1QCN A;  2EFI A;  4RTZ A;  3CMA Q;  4NOY A;  2KAF A;  4C92 C;  2BTT A;  4Z88 A;  1KD1 U;  1RAG B;  4ME7 A;  3JAM E;  3RKY A;  4BUG A;  1U1S A;  2CZ1 B;  2SEM A;  3CMA T;  2FEI A;  3ER0 A;  4GLM A;  4MDW A;  4M78 B;  2HMA A;  3RKX A;  2L89 A;  1YIJ T;  2DD4 A;  4HCZ A;  2ABL A;  1FYN A;  2CT3 A;  1M90 C;  3I55 A;  1B7T A;  1G3Y A;  2HZY A;  3HRT A;  1OEB A;  1YHQ A;  1LOJ A;  3OYC A;  2XMF A;  2ED1 A;  4FU6 A;  4OB2 B;  5IHK A;  3CPW S;  3CCS Q;  2GCX A;  2GQI A;  2HDA A;  3VRY A;  4JJD A;  2ZPH B;  1K1Z A;  4L5G A;  1S72 Q;  4RCC A;  5GAO q;  1GFC A;  1MV3 A;  1EX4 A;  5GAM g;  2DVJ A;  2CP2 A;  5LJ3 d;  2DAQ A;  2RI2 A;  1VQ9 T;  4OF1 A;  2W0Z A;  1U3O A;  5GAM e;  4XQ3 A;  4QVC A;  3MEW A;  1VQL T;  3CCV A;  2LCS A;  5J3B A;  2E3I A;  1AEY A;  3CCQ Q;  1MMN A;  4J8O A;  1PHT A;  2Y90 A;  2HCK A;  2DPP B;  2K6D A;  3EG0 A;  3G4S A;  1W6X A;  3V8K A;  2ECZ A;  5GAO p;  4LUD A;  3EFO B;  1O75 A;  4RTT A;  2YUQ A;  3HSB A;  3UDC A;  2JS0 A;  5GAN h;  4GBQ A;  5CKD A;  3CQT A;  4KUL A;  2EAY A;  2MPX C;  5CK9 A;  1WYX A;  1BI2 A;  3EG1 A;  2X3W D;  1WA7 A;  4OGC A;  3MP8 A;  2K4Y A;  2CZ7 B;  2LDM A;  1Q86 C;  2PTK A;  4J5Y A;  1BU1 A;  1QWF A;  1NEB A;  4X1V A;  3SFM A;  4JJC A;  2QA4 Q;  2EJ9 A;  3CPF A;  3KFV A;  2SRC A;  1OQK A;  3M0S A;  4M7A B;  2O01 E;  1PKS A;  3LH0 A;  3SB2 A;  2M51 A;  1WJQ A;  1DJ7 B;  4PLI A;  4JRP A;  4JZ4 A;  2FO0 A;  3H0F A;  3QPH A;  3A8H B;  1MMA A;  1ZA1 B;  4FYX B;  4RTU A;  4C5I A;  5I22 A;  1K9M C;  2LRQ A;  5KYU A;  4CI0 C;  4C5H A;  2L3R A;  2QGF B;  2O31 A;  2KT1 A;  1LNX A;  3HL8 A;  3DB3 A;  3EHQ A;  2XK0 A;  3I56 A;  1BIB A;  1SG5 A;  2DZ9 A;  2DM1 A;  2BUD A;  2COZ A;  2VB6 A;  4MMK A;  2JM8 A;  5IN1 A;  2V8J A;  3PTA A;  4JS4 A;  3CXC A;  1QKW A;  3CCL A;  4KH0 B;  2O4X B;  1Q7Y R;  2LCL A;  2KY9 A;  2FZG B;  2KNB B;  1UHF A;  5FRO A;  4E7H A;  2QQA A;  1VQK Q;  3MEU A;  5IT9 E;  2EYQ A;  3OW2 S;  1ZUK A;  4J9G A;  1BB9 A;  3CCM Q;  4ORZ A;  2J6O A;  4EMK B;  4OP0 A;  3DLM A;  5KYW A;  4HCB A;  3OYI A;  3CC4 Q;  2OTJ Q;  3RUX A;  3FEO A;  1M1K R;  2CUB A;  4M7D A;  1R77 A;  2DL7 A;  3CCE A;  1IXD A;  2AT1 B;  1WHK A;  3TCJ A;  1RLP C;  1N27 A;  3I5S A;  4B9W A;  5DLQ E;  3QUI A;  1VQK T;  3PGG A;  1TSF A;  3OYA A;  3CXC S;  2OTL Q;  4BD3 A;  1YP5 A;  1YN8 A;  2LTO A;  2HAX A;  4JS5 A;  4BAC A;  1RAF B;  2RA2 A;  5GAM h;  3OYH A;  3PMT A;  2F2X A;  2VUB A;  1QVF P;  4X34 A;  5LJ3 g;  3ULR B;  3O5Z A;  4CC7 A;  2H3J A;  1TXQ A;  1Y57 A;  5GAM f;  5AYF A;  1UGP B;  4VUB A;  1W2B A;  2JVV A;  1VQK A;  2OAU A;  2LJ3 A;  2IPO B;  2YRC A;  2B86 A;  3TEE A;  1KK7 A;  1VQP Q;  2JW4 A;  2PU9 B;  1D3B A;  4RCB A;  1N8R U;  3REB B;  2LNV A;  4M75 A;  3CBM A;  3J80 E;  3INZ A;  2NYS A;  3LWH A;  1G3T A;  2DTH A;  2HL5 C;  3PMI A;  3MCA B;  5DM7 R;  4P5N A;  2DXU A;  3VS4 A;  1G3S A;  1Z9Q A;  4E2F B;  2O2O A;  5GAN g;  4M7D F;  2M0Y A;  2CDT A;  1G5V A;  1Y0M A;  5GMK l;  1EIF A;  2LNH B;  4A4E A;  2RN8 A;  1OZ3 A;  2XDP A;  4ZGE B;  1VQ9 A;  1YI2 Q;  2L3Q A;  2OTL A;  3CCU A;  4IUP A;  2X35 A;  4M7D E;  3JB9 D;  2RPN A;  1KSW A;  1W2B S;  4AG1 C;  4JJB A;  4KH1 B;  4PK4 A;  2EBP A;  3JCM g;  1S72 A;  3MPU B;  2DIL A;  5C0M A;  3CCM T;  3VS2 A;  1PWT A;  3QO3 A;  1Q95 G;  2DD5 A;  4J6X A;  1I5L A;  4ELY C;  4FYW B;  3EHR A;  3JCM h;  4DEX A;  3FB9 A;  3A8L B;  3CCQ T;  2E41 A;  4M7D C;  5CQY A;  3A98 A;  2AK5 A;  1Q86 U;  1VQ6 T;  1I4K 1;  1ZLM A;  4L59 A;  5GAN 8;  2E5K A;  3CC2 A;  5GAO r;  3I5R A;  3M0R A;  1SSH A;  5IHN A;  3SEM A;  3VYG A;  5LJ5 f;  4JRQ A;  1VQ7 T;  1IZ6 A;  4KGZ B;  4GLK A;  1IHW A;  2ED0 A;  2DTI A;  2HBP A;  4JLG A;  3LH5 A;  1MMG A;  1D1B A;  2FRY A;  2M9U A;  1YJ9 A;  4QVD A;  2DL5 A;  1GFD A;  3UT1 A;  2WSF E;  4M7A C;  4PLL A;  1GBQ A;  2OJ2 A;  2A36 A;  1I81 A;  2QAZ A;  3A8M B;  2XDD A;  4F7U E;  4QVZ A;  4OML A;  1VQO Q;  3JCM W;  5EC7 A;  3LGF A;  5KYX A;  2CYZ B;  1VYT A;  5GMK h;  4N0A C;  3SHW A;  5CCA A;  4A4F A;  4C5E A;  1U5S A;  1M2O A;  1PM3 A;  3JCM b;  4QW2 A;  1JJ2 P;  3RES A;  2EYZ A;  3OQ5 A;  2E6N A;  4BE2 A;  1GCQ A;  1X2Q A;  4M77 A;  4C0D B;  1OOT A;  2RO0 A;  2QGG A;  4MZM A;  3CCL Q;  5GAN d;  2MOX A;  1QVP A;  1PNJ A;  1VQ5 A;  1UEB A;  2D8H A;  1YIT Q;  4QQG A;  3TRE A;  2PZ1 A;  3UA6 A;  3GNF B;  2EIF A;  3DKM A;  2OAW A;  1VQ4 T;  2QAS A;  1OPL A;  4V2S A;  5GAN 2;  1M1F A;  3G71 Q;  2GFU A;  3MET A;  2JN0 A;  1R0C B;  4DBQ A;  3G1J A;  3EAE A;  2P0Q A;  1Y96 A;  4CRI A;  4M77 E;  1HD3 A;  5D6W A;  2V1Q A;  4R0K A;  5I2S A;  3G6E A;  1K8A U;  3GBQ A;  2CS7 A;  5LJ3 j;  2KEA A;  4JLI A;  3KUF A;  2GNC A;  4BE1 A;  4IUR A;  1Q82 U;  3LWI A;  2G6F X;  5HK3 A;  2DET A;  2K5L A;  4F7U A;  1WXT A;  4RG2 A;  5FU6 B;  1YIJ A;  2IIM A;  5CO7 A;  2E65 A;  2K7A A;  1AT1 B;  2JNG A;  1VQN T;  4HT9 A;  3TVT A;  1BIA A;  3C95 A;  4MZP A;  3L2U A;  2CSQ A;  5HK0 A;  3G71 A;  5GAO n;  4Q5W A;  2L5Q A;  5CVI A;  2C0I A;  4M7A D;  3L2Q A;  1CSK A;  1VQM T;  5GJV B;  4TVR A;  4AFZ C;  3EG9 B;  1Q82 R;  2DA9 A;  1JB0 E;  1KIK A;  1FMK A;  2FZK B;  3MHX A;  1K76 A;  2HD0 A;  2RHX A;  2DIG A;  5GAN f;  3OBW A;  1M8V A;  1M1K U;  1YJN A;  3M0T A;  1WLP B;  4WTO B;  3CC7 A;  2D8J A;  3S6W A;  1QQJ A;  3I55 T;  1VQP T;  1KHC A;  1S1N A;  1SKU B;  3V7R A;  2X4J A;  4B9X A;  2JMA A;  1WXB A;  3ME9 A;  3OYB A;  1D09 B;  3JCM d;  2IVW A;  2XDB A;  1Q7Y U;  5LJ3 f;  2AIR B;  1KQ1 A;  4MDX A;  2V8K A;  2ZPE B;  1KQ2 A;  4OGE A;  1D0Y A;  1C1A A;  1B3Q A;  5KCH A;  3M4G A;  4J6W A;  4LDW A;  4OB3 B;  4NL2 A;  1H8K A;  4M7D G;  2D0Q B;  1TUG B;  3GF5 A;  1BCO A;  1PCX A;  3JV3 A;  4N0A A;  3NHN A;  3R6O A;  3HRU A;  1KD1 C;  3CCJ Q;  4AFU C;  2DK3 A;  2FZC B;  5GMK j;  4FYY B;  3QDF A;  3QZ9 B;  3CCU T;  3UF4 A;  4HCC A;  3P8H A;  2HBW A;  5KYU B;  2MI6 A;  3A8G B;  4M77 D;  3JCM f;  3PIP A;  2GF7 A;  1KC8 U;  5FWB A;  3QII A;  5IXF A;  1BBZ A;  2EWN A;  2FPE A;  2JTM A;  2JMC A;  2M16 A;  2CP0 A;  2DX1 A;  3G4S Q;  3ASK A;  3QZ5 B;  1G8X A;  4AFS C;  3CCV T;  3HTR A;  5FU6 C;  3H8Z A;  1M90 R;  2E10 A;  3HFN A;  4M78 F;  2BE9 B;  1MGQ A;  4OMF B;  1RAI B;  1N9R A;  1M2V B;  2AZS A;  1AVZ C;  3M58 A;  1SHG A;  3QXE B;  3CCS T;  2YHT A;  2E3H A;  1JO8 A;  1X2K A;  1NG2 A;  3THK A;  5IXB A;  2DZC A;  1T3L A;  1QKX A;  2RJC A;  4OMP A;  5HCK A;  4PL6 A;  2DXC A;  2BZY A;  1QLY A;  3CCE T;  2ENM A;  5CKE A;  3V8L A;  4FT2 A;  4IIO A;  3L2V A;  1KG1 A;  1Q81 C;  2DE0 X;  1N8R C;  3FDR A;  2LQ8 A;  2K3Y A;  2LC4 A;  2EGE A;  2DBK A;  3ZBD A;  3OS0 A;  4EPC A;  4A54 A;  2ZAE A;  2J05 A;  4PJO D;  4IUQ A;  4IUU A;  4RTY A;  3ZEH A;  1QW1 A;  5GAN e;  3A5Z B;  5CQX A;  5KYN A;  1MHN A;  4RKU E;  2JT4 A;  1NZ9 A;  2XKO C;  3M4Y A;  3AHU A;  1WI7 A;  3SWN C;  3SWN B;  4M77 G;  4XTZ A;  1IO6 A;  3U23 A;  3GOX A;  1SHF A;  4ZNX A;  1G2B A;  3RR6 A;  3OSV A;  5CIU A;  4DBH A;  2X3X D;  3EGU A;  2FL7 A;  1JJ2 S;  4AFQ C;  4J9D A;  2KE9 A;  2C0O A;  1X01 A;  1K9M U;  2EYW A;  4Y92 A;  2QYZ A;  3M53 A;  1D1C A;  2JOY A;  1VQN A;  3BDU A;  2LJ0 A;  5KCO A;  1PG5 B;  2QEX Q;  2HQX A;  4C92 B;  4RG8 A;  1AWX A;  3CC4 A;  2OTJ A;  2CGH A;  1ZSZ A;  1K73 U;  1PC0 A;  1F1B B;  4FIB A;  3VS3 A;  1AWW A;  4JPB W;  1RAD B;  2RB6 A;  4BE0 A;  2PNI A;  2RJD A;  2A3L A;  4HT8 A;  1AWJ A;  1WPY A;  4N4H A;  3CCE Q;  1VIE A;  1B34 B;  4HKE A;  1M3A A;  1KC8 C;  4II1 A;  4C8Q B;  4BI3 A;  2RQU A;  4J9C A;  5EG2 A;  1VQ7 A;  3CBO A;  1YCY A;  5GAN j;  3CCS A;  3A1P A;  4J9I A;  3EFO A;  5A0L A;  1YWP A;  2G3R A;  4EMK C;  1M30 A;  5ECA A;  2CKK A;  2I2L A;  2L0A A;  4F7U G;  1QWE A;  3QWX X;  1K8A C;  1HXD A;  3OYJ A;  4WF2 A;  2E12 A;  3C12 A;  2EQM A;  4EIK A;  1WFW A;  2KRN A;  2QTX A;  5A0G A;  2DER A;  5LJ3 h;  2H8H A;  3OYF A;  3CC2 T;  3RBB B;  1K0S A;  2YLB A;  2DRK A;  1VQ4 Q;  3L2R A;  3CEY A;  2GQV A;  4F16 A;  2COW A;  3FC3 A;  4EDU A;  2QQB A;  2RQV A;  4LDX A;  4XU1 A;  3L2Z A;  3MP6 A;  3R6N A;  4DA4 A;  2PQW A;  1LVK A;  3WVE B;  4FL6 A;  1JU5 C;  3CCU Q;  1N9S A;  2K3X A;  3VKI A;  1NPP A;  2RI3 A;  2KXC A;  1K4U S;  1YJ9 T;  1W4S A;  3BDL A;  1R8O B;  1LJO A;  4ESR A;  2DKG A;  2A08 A;  5AT1 B;  1TG0 A;  2DTO A;  4M78 C;  2DF6 A;  1MND A;  2QA4 T;  2JM9 A;  1KQS P;  4E6R A;  2DJZ A;  1PSE A;  4J7F A;  1UGR B;  2CUD A;  3H6Z A;  4K11 A;  4M7A E;  2DEU A;  3QWY A;  1VQP A;  4PJO E;  4LXC A;  3OW2 A;  1H3Z A;  5I2M A;  3VU3 C;  1QP3 A;  2D9T A;  3JCM V;  5A0D A;  5J39 A;  1NJI C;  3VUZ A;  5FRN A;  3Q1J A;  1PRL C;  2I0N A;  3REA B;  1WZO A;  1UGS B;  5FW9 A;  2VWF A;  2FB7 A;  3KBG A;  3HPW A;  2EQI A;  3I56 Q;  3JCM J;  2EKH A;  3CD6 T;  4M75 G;  2XIC A;  2KGT A;  3V8J A;  1VQ9 Q;  2ZPF B;  4J7I A;  4A4K A;  2QDL A;  2YRV A;  4E7K A;  5GAN 4;  2JZ2 A;  4KGV B;  2KT8 A;  2DYB A;  4QQD A;  2DIQ A;  4JRI A;  3M0P A;  1GBR A;  1Z9Z A;  2F5T X;  1VQ6 Q;  1UGV A;  4F17 A;  2V1R A;  1HYO A;  2X4X A;  2CSI A;  2Y4X A;  3L2W A;  5KYY B;  4J6Y A;  1J3T A;  1QVG A;  1RAE B;  1EZZ B;  3RDV A;  2CZ6 B;  2GTO A;  5LJ5 j;  2QI2 A;  2OTL T;  2HKQ B;  2YSQ A;  4XK8 E;  3LX7 A;  3JB9 H;  3HFO A;  1ZSZ B;  1WHG A;  1CKB A;  4E7S A;  2X9H A;  4M75 F;  3M55 A;  4LDV A;  3A8O B;  3I35 A;  3OA6 A;  1XNI A;  2QQS A;  1AZE A;  3CC4 T;  2OTJ T;  3NMZ C;  1Q7Y C;  6AT1 B;  4HVW A;  3C0C A;  1IGQ A;  3G7Z A;  2QA4 A;  1IB8 A;  2HNI A;  1AWO A;  3GP8 A;  3P8B B;  4FSS A;  2YRD A;  1ZBX A;  3PFS A;  5FRM A;  1QVG S;  1U8R A;  4XTW A;  2GGR A;  1CKA A;  4HVV A;  3EH2 A;  4IUT A;  2EYX A;  1YHQ T;  1VQL Q;  1M2V A;  1YJ9 Q;  2XD0 A;  3CC2 Q;  5CKB A;  1WDX A;  2NWM A;  2EQK A;  1GRI A;  4J83 A;  3JB9 F;  3HP9 A;  2MIO A;  4Z89 A;  2MK5 A;  2R57 A;  1FMV A;  1SEM A;  3H41 A;  1ZUU A;  2VVK A;  2CT4 A;  3QYH B;  1SRL A;  5I21 A;  1IRX A;  1FMW A;  1K9M R;  4RMO A;  5IAY A;  2NUP A;  3CCJ T;  3X26 B;  1VQM A;  2JTF A;  3JCM c;  2KBT A;  1BI1 A;  3L42 A;  1M3B A;  7AT1 B;  5LJ5 h;  4C8Q D;  4N4I A;  2FVU A;  3LLR A;  1LPL A;  1NYF A;  1VQO T;  1GCP A;  2EKO A;  4ZGJ B;  2A37 A;  1N5Z A;  2RHI A;  1TTH B;  4LD6 A;  1U1T A;  1G83 A;  4FYV B;  3HKS A;  2LQW A;  3EGD B;  1UG1 A;  4D6W A;  2KR3 A;  3OS5 A;  1VQ8 A;  1ABQ A;  9ATC B;  2AKL A;  4A53 A;  1B07 A;  2F2V A;  1HK9 A;  3VJP A;  3M57 A;  1RLQ C;  5GAN 5;  3JB9 J;  2YWW A;  2Y4Y A;  1ZSG A;  1ZUY A;  3EG9 A;  4A4H A;  3G6E Q;  3V7C A;  4LD9 K;  3J81 E;  2DJQ A;  3JCM Q;  3CXC P;  4PJO C;  1K8A R;  2GBQ A;  2RH2 A;  4J9F A;  5KYW B;  4C92 E;  1NM7 A;  1NLO C;  1VYU A;  3MKD A;  3FJP A;  1WHL A;  4YTL A;  1BI3 A;  3E2U A;  2CP5 A;  2E6Z A;  1NE8 A;  2J6F A;  2DXT A;  4HVU A;  3MEA A;  4NL3 A;  2HSP A;  3QDR B;  2CH4 A;  4D8D A;  1UJY A;  2YLC A;  4OMM A;  4C8Q E;  2EQU A;  1NBE B;  2IG0 A;  4KT0 E;  3OS1 A;  3EG2 A;  4OMO A;  5GMK e;  3GIB A;  1Q82 C;  1TOV A;  4DOV A;  2X51 A;  3M59 A;  3RER A;  2KRS A;  3BFM A;  1WQ7 A;  2AHJ B;  2J06 A;  2RHY A;  3M5A A;  1MMD A;  3PNW C;  2J7I A;  4XTU A;  1AHJ B;  1D0Z A;  2HQE A;  1W1F A;  1TUD A;  2QTV A;  3PVQ A;  4QT7 A;  4M7D B;  1HJD A;  3WXM B;  4C8Q C;  3GLX A;  1RL2 A;  5FU7 B;  3TSZ A;  2DVE A;  2D6F A;  4DOW A;  3M0U A;  3G71 T;  3OS2 A;  1W2B P;  2EQJ A;  3SDZ A;  1WXU A;  1RI9 A;  4A4G A;  4M77 B;  2DYI A;  2GTJ A;  4M77 C;  2BE7 D;  2RI5 A;  2LCC A;  4ELZ C;  1ZHI A;  2HQH A;  2K57 A;  3UA7 A;  3CD6 Q;  4Y91 A;  4FCY A;  2JTE A;  4CC2 A;  5KYY A;  2E64 A;  3CCV Q;  5L23 A;  5HKC A;  2HSE B;  5I11 A;  2C06 A;  4PFZ A;  4PJO G;  3EFR A;  2VXE A;  1TH7 A;  3TU4 K;  2EJF A;  2FYK A;  2OI3 A;  1Y96 B;  2RNA A;  2K9G A;  4LN2 A;  5FU7 C;  1KQS A;  3NGP A;  3OYE A;  2M1H A;  3HHT B;  5KYX B;  2CZ0 B;  2NUP B;  2RD1 A;  5CR2 A;  3CCR Q;  2K5F A;  2X4Y A;  1YIJ Q;  1Q81 U;  2ZGW A;  2LP5 A;  3CCQ A;  1RAC B;  3QSU A;  3RNJ A;  3CMA A;  2B8A A;  1A0N B;  3RMQ A;  2RQW A;  3NTK A;  2X4W A;  1JBM A;  1N8R R;  1FX7 A;  1QMC A;  2KYM A;  3OBY A;  2A7Y A;  5GMK m;  3QJY A;  1WJR A;  2F5K A;  3EGX A;  3JB9 I;  2MYS A;  4F7U B;  2CH4 W;  1ARK A;  1E7O A;  4UC4 A;  1KC8 R;  4J9E A;  3CCJ A;  1QVF A;  2ROL A;  2Z0W A;  2O9S A;  1KQS S;  1M9S A;  1H92 A;  3C4S A;  2KVQ G;  1WGS A;  2H3E B;  2RQT A;  1MUZ A;  1M5Q 1;  1BCM A;  1UB4 A;  1OX8 A;  1MV0 B;  3FIF A;  2K2M A;  2KI7 A;  5D7U A;  3JCM P;  3CBP A;  5FLX E;  1H3H A;  4C92 F;  3L1A A;  1M27 C;  2QDY B;  2K2V A;  2OX7 A;  5LJ5 d;  3CPW A;  5LJ3 e;  5IH2 A;  3LGL A;  2LQK A;  2RJE A;  4BB7 A;  1H64 1;  2RQR A;  4PJN A;  1X43 A;  1VQ8 T;  3CCM A;  2E5Q A;  4OMQ A;  4CC3 A;  2O9V A;  1WNL A;  1AZG B;  3BE3 A;  1Q86 R;  3JCM X;  1N6A A;  3VUB A;  4BDZ A;  2JXB A;  1TWB A;  1AOJ A;  4DBR A;  1YCS B;  3UWN A;  1RAA B;  2DL8 A;  2KXD A;  4O5V A;  1OI1 A;  5CAI A;  4C8Q A;  1ZQ1 A;  3GNG A;  2AKK A;  3OY9 A;  4JJN K;  1E6G A;  2XI9 A;  2KYB A;  3WVD B;  1M8M A;  1RAH B;  2WAC A;  4M78 A;  4RTW A;  1OZ2 A;  4F14 A;  1M4Z A;  1UHC A;  2YUP A;  2FRW A;  3MO8 A;  3IQL A;  4NS5 A;  1OV3 A;  3CC7 Q;  1PKT A;  2MWP A;  2VC8 A;  4PKC C;  1VQ4 A;  2DO3 A;  1GCQ C;  1WJS A;  2K79 A;  2A0F B;  1C6V X;  1GXI E;  4ZGD B;  3OYN A;  4HXJ A;  1UTI A;  3QKJ A;  4RTV A;  1YHQ Q;  3TQ7 P;  2M0O A;  2O4X A;  2BKD N;  2EW3 A;  3QBY A;  2DL4 A;  4Z02 A;  2BIV A;  3BW1 A;  3VS1 A;  1K73 R;  5DY9 A;  4DBF A;  4C8Q F;  4C0D C;  1JXM A;  1XQH A;  1BI0 A;  4WCI A;  3AT1 B;  1K0X A;  2XG8 D;  3E9G A;  4OB0 B;  3UPU A;  4JRK A;  3UAT A;  3DLL A;  5GJW B;  2RHZ A;  3RIR A;  1V76 A;  2L2P A;  2DNU A;  1NJI R;  2KQW A;  5D6X A;  4R55 A;  3JSC A;  5M9O A;  1KD1 R;  2F1L A;  1VIF A;  1PRM C;  1BKB A;  4LDY A;  3QJ6 A;  3PVL A;  4BI8 B;  4OMN A;  1C0M A;  3QG1 A;  2VXF A;  1JJ2 A;  2ZPI B;  2MAM A;  2DRM A;  1QCF A;  2RMO A;  2P4R A;  2LVM A;  3JB9 G;  4OVA A;  3I55 Q;  3X24 B;  1NYG A;  2XU8 A;  1M90 U;  2ESW A;  1PD0 A;  3S3N A;  1OYX A;  2WSE E;  4M78 G;  2WSC E;  2JUF A;  2L3P A;  1YJW A;  1RI0 A;  2RM4 A;  4M7A F;  1X6G A;  1VQ5 T;  3H9N A;  2P0P A;  3SD4 A;  2FHD A;  1KJW A;  3G6E T;  4AT1 B;  2EYY A;  1T3S A;  4E7Z A;  1YNZ A;  3OYL A;  1OU9 A;  2QG9 B;  5GAN 7;  4XU0 A;  3J7A F;  1XJW B;  2DLP A;  4XU3 A;  4LE9 A;  3MP1 A;  1X75 C;  1ZBJ A;  1YJW T;  4FM4 B;  4ZN1 A;  1O9S A;  2PUK B;  3E19 A;  2RF0 A;  4JZ3 A;  3CC7 T;  2QQ9 A;  4J9H A;  2NUZ A;  4PFP A;  4L6V 5;  1WIE A;  1BK2 A;  2RHU A;  4OB1 B;  3BY7 A;  4LUE A;  5A2Q E;  3M0Q A;  1ACM B;  1HSQ A;  1I5O B;  4XTY A;  3RMS A;  1I1J A;  3MJX A;  1K9A A;  1TS9 A;  4CC4 B;  3H0H A;  1K73 C;  1YJW Q;  5CKH A;  3KXT A;  3NPF A;  3OB9 A;  1FWZ A;  2QEX T;  2QK0 A;  3P8D A;  3LYI A;  1QP2 A;  2DXB A;  1YFN A;  1QCO A;  3G4S T;  2M02 A;  1YIT A;  3OYM A;  2PUO B;  2DEQ A;  2EPD A;  1VQ6 A;  4PJO A;  4EMH A;  1UEC A;  1ZA2 B;  4ZTJ A;  3JRZ A;  5KH6 A;  2PVG B;  3EG3 A;  3I56 T;  4KUD K;  1VYV A;  4KBM B;  2VV5 A;  1XOV A;  3RKW A;  2VKN A;  5GAO m;  2L8D A;  2QQR A;  1UE9 A;  5GAO l;  4ANJ A;  3CCL T;  2L3S A;  3ZFJ A;  4M75 B;  2K3B A;  2MCN A;  4PJM A;  2KMT A;  8AT1 B;  1T0J A; 
#chains in the Genus database with same CATH homology
 3MP8 A;  2DK3 A;  4A4H A;  3V7C A;  2K4Y A;  4LD9 K;  2CZ7 B;  4X9C A;  2LDM A;  2RK1 A;  5GMK j;  1Q86 C;  4J5Y A;  2V8I A;  3QZ9 B;  3J81 E;  4BY6 B;  3CCU T;  1M1G A;  4HCC A;  3P8H A;  2QEX A;  3JCM Q;  4EMK A;  4PJO C;  3SFM A;  2RH2 A;  2MI6 A;  2EJ9 A;  3CPF A;  4PNO A;  4C92 E;  4M75 D;  3A8G B;  3FJP A;  4M77 D;  4M7A B;  3JCM f;  3PIP A;  4YTL A;  1BI3 A;  2O01 E;  2E6Z A;  2GF7 A;  1NE8 A;  3LH0 A;  2DXT A;  1KC8 U;  3OYK A;  3SB2 A;  1WJQ A;  3QII A;  1DJ7 B;  3MEA A;  4PLI A;  4NL3 A;  4JRP A;  4QQ6 A;  3QDR B;  2EWN A;  2JTM A;  3OYG A;  2M16 A;  3QPH A;  3A8H B;  4C5I A;  2VYT A;  2RK2 A;  2YLC A;  4C8Q E;  3CPW S;  2EQU A;  5LJ5 g;  1G3W A;  2IG0 A;  1K9M C;  3PT9 A;  3FRN A;  3URG A;  1SSF A;  3CCR T;  2LRQ A;  4KT0 E;  3ASK A;  3QZ5 B;  3OS1 A;  3CCV T;  4CI0 C;  4C5H A;  5GMK e;  5FU6 C;  3GIB A;  2L3R A;  3H8Z A;  1YI2 T;  1Q82 C;  1LNX A;  3E1S A;  4GY5 A;  1PSF A;  2E10 A;  3HFN A;  4M78 F;  4DOV A;  1MGQ A;  3HL8 A;  3MEV A;  3DB3 A;  3M59 A;  4OMF B;  3RER A;  2XK0 A;  3BFM A;  3I56 A;  1N9R A;  1WQ7 A;  1BIB A;  1V29 B;  2PVD B;  3M58 A;  2DZ9 A;  2AHJ B;  3QXE B;  1YJN T;  2BUD A;  3CCS T;  2RHY A;  3M5A A;  2YHT A;  4MMK A;  5IN1 A;  3VYH B;  2V8J A;  4IKF A;  3PTA A;  3QHS A;  3PNW C;  4JS4 A;  4PJO F;  3V7S A;  3CXC A;  1D3B B;  4XTU A;  1AHJ B;  3CCL A;  2O4X B;  2HQE A;  4BY6 C;  4M7D B;  2LT4 A;  2DZC A;  2LCL A;  2KY9 A;  3WXM B;  4C8Q C;  2RJC A;  1RL2 A;  3GLX A;  5FU7 B;  5FRO A;  2XHC A;  4E7H A;  5J26 A;  2QQA A;  4R56 A;  2DVE A;  3E9F A;  4DOW A;  2D6F A;  3CME T;  2EJG A;  3MEU A;  4PL6 A;  3G71 T;  2DXC A;  3CCE T;  4FT4 A;  5IT9 E;  5CKE A;  3V8L A;  2EYQ A;  3OS2 A;  4FT2 A;  2EQJ A;  3SDZ A;  3OW2 S;  4KUI A;  3L2V A;  1KG1 A;  1Q81 C;  4A4G A;  1N8R C;  4M77 B;  3FDR A;  2LQ8 A;  2K3Y A;  2KK4 A;  4M77 C;  2LC4 A;  4OP0 A;  4EMK B;  3DLM A;  4HCB A;  3OYI A;  2RI5 A;  2LCC A;  3ZBD A;  4ELZ C;  3RUX A;  3OS0 A;  1ZHI A;  4EPC A;  3FEO A;  1UGQ B;  4A54 A;  2K57 A;  4M7D A;  4PJO D;  4IUQ A;  3NFC A;  4M78 E;  4IUU A;  4Y91 A;  3ZEH A;  3CCE A;  3TCJ A;  1YBY A;  1QW1 A;  5KE2 A;  3CME A;  5GAN e;  3A5Z B;  3OSS C;  2E64 A;  5CQX A;  1N27 A;  3M56 A;  4C5G A;  1MHN A;  4B9W A;  5HKC A;  2NLU A;  4RKU E;  3QUI A;  5DLQ E;  1VQK T;  1NZ9 A;  2XKO C;  4X9D A;  3M4Y A;  2C06 A;  2F69 A;  3PGG A;  1YI2 A;  3AHU A;  3SWN C;  3OYA A;  4PJO G;  4M77 G;  3EFR A;  4XTZ A;  3SWN B;  4BD3 A;  2VXE A;  3CXC S;  2LTO A;  4XTX A;  2HAX A;  2E1H A;  4JS5 A;  4BAC A;  1TH7 A;  3LW5 E;  4M7D F;  2RA2 A;  3TU4 K;  5GAM h;  2EJF A;  3PMT A;  3OYH A;  3GOX A;  2FYK A;  2VUB A;  4Y28 E;  3OSV A;  1Y96 B;  5CIU A;  4M7A A;  2XID A;  4X34 A;  5LJ3 g;  2K5I A;  2FL7 A;  1JJ2 S;  2H3J A;  1KQS A;  5FU7 C;  4C8Q G;  5GAN 6;  1X01 A;  3OYE A;  2M1H A;  5GAM f;  3HHT B;  5AYF A;  4C0F A;  1UGP B;  1K9M U;  4VUB A;  2CZ0 B;  3PIO A;  1W2B A;  2JVV A;  1NPR A;  2OAU A;  1VQK A;  2RD1 A;  3TEE A;  3M53 A;  3OMG A;  2JOY A;  5CR2 A;  2K5F A;  1D3B A;  2PU9 B;  2X4Y A;  4RCB A;  1VQN A;  1Q81 U;  2QXF A;  2ZGW A;  3BDU A;  1N8R U;  5KCO A;  1NJI U;  3CCQ A;  3QSU A;  3CMA A;  2B8A A;  2LNV A;  4M75 A;  3CBM A;  4XU2 A;  3J80 E;  2HQX A;  4C92 G;  4C92 B;  3RMQ A;  3INZ A;  1Y7X A;  2R5M A;  2X4W A;  3EFS A;  3NTK A;  4JDS A;  2CGH A;  1G3T A;  1JBM A;  4RG8 A;  3LWH A;  1FX7 A;  2DTH A;  2ZZD A;  3MCA B;  3PMI A;  5DM7 R;  4FIB A;  3OYD A;  3OBY A;  2A7Y A;  2DXU A;  4P5N A;  3GPL A;  2RB6 A;  4BE0 A;  5GMK m;  1G3S A;  2RJD A;  1WJR A;  2F5K A;  2A3L A;  3QJY A;  5GAN g;  3JB9 I;  1WPY A;  4N4H A;  4HT8 A;  1G5V A;  5GMK l;  3F70 A;  1VIE A;  1B34 B;  4HKE A;  3T9N A;  4F7U B;  1KC8 C;  1FXX A;  1EIF A;  4IUV A;  2LT1 A;  4UC4 A;  1JRI A;  4MML A;  4A4E A;  2KSS A;  4II1 A;  4C8Q B;  2XDP A;  1OZ3 A;  3NTI A;  4M75 E;  5EG2 A;  4BI3 A;  4C0G A;  4DQ2 A;  4ZGE B;  1S72 T;  1VQ7 A;  1VQ9 A;  3CBO A;  3CCJ A;  1YCY A;  2OTL A;  3CCU A;  1QVF A;  5GAN j;  4IUP A;  1KQS S;  3CCS A;  2KDS A;  1M9S A;  2X35 A;  3C4S A;  4M7D E;  2KVQ G;  4JUV A;  3JB9 D;  1WGS A;  5A0L A;  1W2B S;  2G3R A;  1VUB A;  4EMK C;  1M5Q 1;  1UB4 A;  2CKK A;  2I2L A;  3M54 A;  3FIF A;  3OYY A;  1B34 A;  3JCM g;  4F7U G;  1S72 A;  2GFA A;  5C0M A;  3CCM T;  3JCM P;  1K8A C;  3X25 B;  1HXD A;  3CBP A;  5FLX E;  3OYJ A;  4WF2 A;  2E12 A;  3C12 A;  1Y07 A;  2EQM A;  4ATO A;  4C92 F;  3L1A A;  3QO3 A;  1QVF S;  2DD5 A;  2QDY B;  2K2V A;  4J6X A;  1I5L A;  5LJ5 d;  4M7A G;  2QTX A;  5A0G A;  5LJ3 h;  3CPW A;  4ELY C;  3OYF A;  5GAN 3;  3JCM h;  3CC2 T;  3FB9 A;  3A8L B;  3CCQ T;  2YLB A;  2RJF A;  5LJ3 e;  2E41 A;  3LGL A;  2LQK A;  2R58 A;  2RJE A;  4BB7 A;  1H64 1;  3L2R A;  3CEY A;  2GQV A;  4M7D C;  1VQO A;  5CQY A;  1VQ8 T;  3CCM A;  2E5Q A;  3FC3 A;  4BDY A;  1Q86 U;  4EDU A;  1WQW A;  2QQB A;  3FLG A;  4LDX A;  4XU1 A;  1VQL A;  1I4K 1;  2P4T A;  3L2Z A;  3MP6 A;  4L59 A;  4E7I A;  1VQ6 T;  4ZN3 A;  4DA4 A;  3S3M A;  1WNL A;  2PQW A;  5L8R E;  5GAN 8;  3C94 A;  3CC2 A;  5GAO r;  3OMC A;  3JCM X;  1N6A A;  3WVE B;  4FL6 A;  3VUB A;  4BDZ A;  3VYG A;  1N9S A;  3CD6 A;  2K3X A;  3VKI A;  1NPP A;  2RI3 A;  4XTV A;  3UWN A;  5DLO A;  5LJ5 f;  1I8F A;  4M75 C;  1W4S A;  4O5V A;  4JRQ A;  1YJ9 T;  1OI1 A;  1R8O B;  3BDL A;  5CAI A;  4C8Q A;  1VQ7 T;  1ZQ1 A;  3GNG A;  1IZ6 A;  3OY9 A;  4JJN K;  1LJO A;  3N5B B;  2DKG A;  2XI9 A;  2VGN A;  4GLK A;  2DTI A;  2DTO A;  3WVD B;  2HBP A;  4M78 C;  2WAC A;  4M78 A;  2QA4 T;  1OZ2 A;  4JLG A;  2MWO A;  2DJZ A;  1PSE A;  5HY6 A;  1M4Z A;  2M9U A;  4EMG A;  3MO8 A;  4NS5 A;  2MF2 A;  4J7F A;  4QVD A;  5D6Y A;  1YJ9 A;  3UT1 A;  4XAX B;  2MWP A;  1UGR B;  5KE3 A;  2WSF E;  4M7A C;  3X28 B;  3H6Z A;  4PLL A;  3JCM e;  2E70 A;  2VC8 A;  4M7A E;  4PKC C;  1I81 A;  2VGM A;  2P0K A;  1VQ4 A;  2DO3 A;  1VQP A;  4PJO E;  1WJS A;  3A8M B;  4E47 A;  4F7U E;  2XDD A;  3CCR A;  3JB9 F;  4QVZ A;  1GXI E;  4ZGD B;  3OYN A;  3JCM W;  5C6S A;  4BI4 A;  3OW2 A;  3QKJ A;  5I2M A;  1H3Z A;  3VU3 C;  1QP3 A;  3LGF A;  2D9T A;  3JCM V;  5A0D A;  5J39 A;  1NJI C;  2CYZ B;  2M0O A;  3VUZ A;  5FRN A;  5GMK h;  3Q1J A;  2O4X A;  4N0A C;  4M77 F;  5CCA A;  3CC4 A;  4MZT A;  4A4F A;  2BKD N;  1UGS B;  4C5E A;  5GAM d;  3QBY A;  3JCM b;  4QW2 A;  2FB7 A;  4E7J A;  4Z02 A;  1KHI A;  3RES A;  2LX9 A;  3KBG A;  2BIV A;  3HPW A;  3X20 B;  5LJ5 e;  3BW1 A;  5DY9 A;  3OQ5 A;  3JCM J;  3M9Q A;  2E6N A;  4C92 A;  4BE2 A;  3CD6 T;  4M7D D;  4M75 G;  4C8Q F;  4C0D C;  2XIC A;  4C0D B;  4M77 A;  1P92 A;  3V8J A;  2ZCF B;  2MMP A;  1XQH A;  1BI0 A;  2ZPF B;  5GMK i;  4J7I A;  4A4K A;  2RO0 A;  4MZM A;  2XG8 D;  5GAN d;  3E9G A;  4OB0 B;  2YRV A;  1QVP A;  3UPU A;  5GAN 4;  4JRK A;  3O8V A;  3DLL A;  4E7K A;  1UEB A;  2JZ2 A;  1VQ5 A;  4QQD A;  2DIQ A;  2RHZ A;  4JRI A;  4QQG A;  3RIR A;  3TRE A;  1Y71 A;  2F5T X;  2X4X A;  2KQW A;  4LDU A;  2Y4X A;  5D6X A;  4R55 A;  3JSC A;  4C0Z A;  3L2W A;  4J6Y A;  5M9O A;  3GNF B;  4HA8 A;  1QVG A;  1VIF A;  2EIF A;  1M1K C;  4FSX A;  1BKB A;  4LDY A;  2CZ6 B;  3QJ6 A;  5LJ5 j;  4BI8 B;  3DKM A;  2PVO B;  2QI2 A;  2OTL T;  1VQ4 T;  4V2S A;  4XK8 E;  4E7L A;  3LX7 A;  3QG1 A;  4O6J A;  3JB9 H;  5GAN 2;  1M1F A;  2VXF A;  2GFU A;  3MET A;  2JN0 A;  2ZPI B;  3HFO A;  2MAM A;  1JJ2 A;  1BYM A;  3EAE A;  1XTD A;  3DB4 A;  2P0Q A;  2R5A A;  3HRS A;  1Y96 A;  4CRI A;  4M77 E;  4M75 F;  3M55 A;  4LDV A;  5D6W A;  2LVM A;  3A8O B;  3JB9 G;  4C92 D;  4ZTF A;  4PJO B;  4OVA A;  3S3O A;  3X24 B;  3OA6 A;  5I2S A;  1XNI A;  2XU8 A;  2QQS A;  1M90 U;  3G6E A;  1K8A U;  2CS7 A;  5LJ3 j;  3CC4 T;  2OTJ T;  4JLI A;  3KUF A;  5LL6 S;  2ZPG B;  4F7U F;  3S3N A;  1Q7Y C;  1OYX A;  2WSE E;  4M78 G;  4BE1 A;  4IUR A;  2WSC E;  1IRE B;  2JUF A;  2ZPB B;  3G7Z A;  5CKF A;  3LWI A;  2QA4 A;  1Q82 U;  1YJW A;  1RI0 A;  2HNI A;  2RM4 A;  3GP8 A;  5HK3 A;  3P8B B;  3QYG B;  1X6O A;  4M7A F;  1ZBX A;  5GAM j;  3VV0 A;  3PFS A;  1YIT T;  1VQ5 T;  2K5L A;  2P0P A;  4F7U A;  1QVG S;  4M78 D;  3SD4 A;  5FRM A;  2FHD A;  3NTH A;  4N4G A;  4RG2 A;  5FU6 B;  3G6E T;  3SWN A;  4XTW A;  1YIJ A;  1U8R A;  2EFI A;  5CO7 A;  2E65 A;  3OYL A;  4IUT A;  4NOY A;  5GAN 7;  1YHQ T;  2KAF A;  4XU0 A;  4C92 C;  3J7A F;  2JNG A;  2XD0 A;  4XU3 A;  1KD1 U;  3MP1 A;  4ME7 A;  3JAM E;  1VQN T;  4HT9 A;  1X75 C;  3RKY A;  1YJW T;  1BIA A;  1U1S A;  2CZ1 B;  4FM4 B;  5CKB A;  4BUG A;  4ZN1 A;  1O9S A;  2PUK B;  3C95 A;  2EQK A;  3ER0 A;  4MDW A;  4MZP A;  3CMA T;  4M78 B;  3L2U A;  4J83 A;  3RKX A;  3HP9 A;  2L89 A;  3E19 A;  5HK0 A;  5GAO n;  3G71 A;  4Q5W A;  1YIJ T;  2L5Q A;  3CC7 T;  5CVI A;  2QQ9 A;  2R57 A;  2DD4 A;  4M7A D;  4HCZ A;  3L2Q A;  1VQM T;  4TVR A;  1M90 C;  3QYH B;  4L6V 5;  3I55 A;  1G3Y A;  2RHU A;  3HRT A;  1JB0 E;  5I21 A;  1YHQ A;  1LOJ A;  3OYC A;  4OB1 B;  3BY7 A;  3MHX A;  5A2Q E;  4RMO A;  2HD0 A;  4FU6 A;  4OB2 B;  5IAY A;  2RHX A;  2DIG A;  2GCX A;  4XTY A;  3OBW A;  5GAN f;  3RMS A;  3CCJ T;  1M8V A;  1M1K U;  3X26 B;  1YJN A;  2ZPH B;  1K73 C;  1VQM A;  5CKH A;  3CC7 A;  3KXT A;  3S6W A;  3OB9 A;  4L5G A;  2JTF A;  3JCM c;  3I55 T;  1FWZ A;  2QEX T;  1VQP T;  4RCC A;  1KHC A;  3P8D A;  5GAO q;  1BI1 A;  3LYI A;  3L42 A;  1QP2 A;  2DXB A;  3V7R A;  5GAM g;  2X4J A;  4B9X A;  5LJ5 h;  4C8Q D;  4N4I A;  5LJ3 d;  2DAQ A;  2FVU A;  3G4S T;  2RI2 A;  3LLR A;  1VQ9 T;  1YIT A;  4OF1 A;  3ME9 A;  3OYM A;  1VQO T;  2PUO B;  5GAM e;  2DEQ A;  3OYB A;  4XQ3 A;  3JCM d;  2EKO A;  2IVW A;  4QVC A;  1Q7Y U;  4ZGJ B;  2XDB A;  3MEW A;  5LJ3 f;  1VQL T;  1VQ6 A;  4PJO A;  2RHI A;  4EMH A;  1KQ1 A;  3CCV A;  5J3B A;  4MDX A;  2V8K A;  4LD6 A;  1U1T A;  4J8O A;  2ZPE B;  1KQ2 A;  4OGE A;  4ZTJ A;  2Y90 A;  3HKS A;  3JRZ A;  2DPP B;  2PVG B;  5KH6 A;  5KCH A;  3M4G A;  3G4S A;  3V8K A;  4J6W A;  4LDW A;  3I56 T;  2OTJ A;  5GAO p;  4KUD K;  4D6W A;  4NL2 A;  3OS5 A;  1O75 A;  2VV5 A;  4KBM B;  4OB3 B;  1VQ8 A;  4M7D G;  1XOV A;  2D0Q B;  3RKW A;  3HSB A;  3GF5 A;  3UDC A;  4A53 A;  5GAO m;  2L8D A;  2QQR A;  1HK9 A;  3VJP A;  3M57 A;  5GAN h;  1K73 U;  5GAO l;  5CKD A;  5GAN 5;  4KUL A;  4N0A A;  3ZFJ A;  4M75 B;  3CCL T;  3JB9 J;  2Y4Y A;  3R6O A;  2EAY A;  3HRU A;  5CK9 A;  1KD1 C;  1BI2 A;  2KMT A;  4OGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...