2DA9A

Solution structure of the third sh3 domain of sh3-domain kinase binding protein 1 (regulator of ubiquitous kinase, ruk)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GSSGSSGDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords SH3-domain kinase binding protein 1
publication title Solution structure of the third SH3 domain of SH3-domain kinase binding protein 1 (Regulator of ubiquitous kinase, Ruk)
rcsb
source organism Mus musculus
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2da9A00
2L3PA 4FSSA 1ABQA 1ARKA 4J9IA 1JXOA 2DILA 2A37A 2K79A 3QWXX 2D1XA 1SEMA 2PZ1A 3M0TA 4AFSC 4RUGA 1UECA 2O2OA 1JEGA 1ZSGA 1K0SA 2A28A 2HBWA 1W1FA 4ESRA 3NHNA 3UF4A 1AWXA 1HJDA 4HCKA 4F17A 1BK2A 2O31A 2XMFA 1MV0B 2YSQA 3I5RA 4LN2A 3TSWA 1UTIA 2EYZA 1T0JA 2J7IA 1WXBA 2O9SA 2C0TA 2DX1A 2O9VA 4QT7A 1NYFA 2YDLA 1K4US 4OMLA 1QWFA 2KRSA 2W10A 2I0NA 2EKHA 2LX7A 3NMZC 4AFQC 1Z9QA 1YN8A 1ZLMA 3U23A 1I1JA 2HEQA 1Z9ZA 1X2KA 1WLPB 3EG0A 2EGEA 2KXCA 3ULRB 3H0HA 1WXTA 1X6GA 4X1VA 4JJBA 1CSKA 2LNHB 2EGCA 1GBQA 2F2VA 1U5SA 1OPKA 4J9EA 1K1ZA 1M3CA 2K9GA 2JM8A 1JO8A 2DRKA 3NGPA 1AEYA 3O5ZA 3M0SA 2BZ8A 2FG0A 1T3LA 1EFNA 2KEAA 2MOXA 1V1CA 3M0UA 2CUBA 1M3AA 3VS5A 1JQQA 2DA9A 3VS4A 2DJQA 2G6FX 2DMOA 3VS0A 1TG0A 1WX6A 2ED0A 2KR3A 1H8KA 3ZL7C 1LCKA 1OPLA 1QCFA 3GBQA 3I35A 2RPNA 1A0NB 2FO0A 2LZ6B 1NYGA 1UJ0A 3SEMA 2GQIA 1S1NA 2YUPA 5FW9A 1RLQC 1G83A 1H3HA 1ZUUA 2DVJA 1GCQA 1PKTA 2PTKA 2B86A 4J9DA 1ABOA 4HVVA 4J9FA 1BB9A 3REBB 1Y57A 2M0YA 1JU5C 1IO6A 2LMJA 1KFZA 1NG2A 2GTJA 4Y92A 5ECAA 2YUQA 4ORZA 1UDLA 1UHCA 2OI3A 1GCPA 2LJ3A 3UATA 3UA6A 5IHNA 2L3QA 4GLMA 2CT4A 3VS1A 1HD3A 3H0FA 1GCQC 1SHFA 2CH4W 2RN8A 3EGUA 2E5KA 1W6XA 2EPDA 2KRMA 2VKNA 1PWTA 2FRYA 1GFCA 3H0IA 2K2MA 1AD5A 3PVLA 3JV3A 1YNZA 1WYXA 2DYBA 2GGRA 3VS6A 1NM7A 2L0AA 2LQWA 1GBRA 1AWOA 3R6NA 1PKSA 2JMAA 1K76A 1B3QA 2OAWA 3SHWA 3EG1A 4D8DA 3EG2A 2JM9A 1AWWA 1U06A 2VVKA 2HSPA 2KBTA 1M8MA 2FPFA 3TVTA 5IXBA 1NLOC 1FMKA 3I5SA 2F2XA 2EVRA 4Z89A 5HCKA 4OMQA 2GNCA 3RNJA 1UUEA 3A98A 1B07A 1E6GA 3QWYA 1RLPC 1SHGA 2J6FA 1AOJA 2DNUA 2X3WD 1PRMC 1PHTA 1I07A 2AZVA 4HVUA 1Y0MA 2EW3A 2EYXA 2CUDA 2QDLA 2D8HA 4AFUC 4AG1C 1M27C 2J6OA 2A36A 1AVZC 2W0ZA 3IQLA 2CSQA 4RTTA 2BTTA 1WDXA 2JS2A 1TUDA 4R0KA 4J9HA 2DE0X 3C0CA 1GL5A 2ROLA 3LH5A 2DBKA 1GRIA 3EHQA 4LUEA 1SPKA 3UA7A 2NUZA 3NPFA 1YCSB 2CH4A 2P4RA 2DM1A 1K9AA 4OMMA 1BBZA 4DEXA 1WXUA 1VYTA 1AZGB 4GBQA 2RQTA 1X27A 2VWFA 1NEBA 2KT8A 1WI7A 4M4ZA 5IHIA 2ABLA 2AK5A 2HCKA 2JS0A 3FJ5A 1ZUKA 4Z88A 2V1QA 2JT4A 1W70A 2BZXA 4KRTA 5FWBA 1GFDA 1OEBA 4RTYA 5IH2A 4LNPA 4LUDA 5IHKA 1PNJA 2YUNA 1CKAA 2JW4A 3TSZA 2K3BA 3RBBB 1X2QA 3H41A 4DEYA 1TUCA 2IIMA 2CDTA 2YUOA 1N5ZA 2EGAA 2J06A 4WCIA 4J9CA 1X69A 2K7AA 5GJVB 1X43A 2ED1A 1BU1A 2FPEA 4HXJA 4A63B 1WIEA 2AKLA 1OOTA 1KSWA 2LJ1A 1OV3A 2FEIA 4EIKA 2MIOA 2KT1A 4AFZC 3VS3A 3VRZA 4CC4B 1QKWA 2DL8A 2RMOA 1H92A 1QWEA 2O88A 2DL3A 1VYVA 5I11A 2CT3A 3I9QA 4CC2A 1UHFA 2SEMA 2KXDA 1VA7A 2CREA 2C0OA 1T0HA 2JXBA 4JZ3A 3KFVA 2RQWA 3REAB 2DLPA 2LCSA 1ZX6A 4RTXA 4LE9A 4J9GA 2KROA 2HDAA 2BZYA 4RTUA 3VS2A 2OJ2A 5FWCA 2V1RA 2X3XD 2FRWA 2EYWA 4RTZA 4IIOA 1E7OA 4HVWA 1U3OA 2KGTA 2EBPA 1FYNA 1RI9A 1SRMA 4CC3A 4J9BA 1RUWA 1SRLA 1KIKA 2L3SA 1YWPA 4Z8AA 2AKKA 2DL7A 2J05A 1M30A 4D8KA 5EC7A 3VS7A 1QKXA 2ESWA 2RNAA 1WFWA 3PE0A 4CC7A 4JJCA 1UE9A 1UG1A 2M51A 2NWMA 1HSQA 1QLYA 1X6BA 4K11A 1NEGA 2FPDA 1XOVA 3EHRA 4IIMA 4F16A 2KNBB 1UFFA 4E6RA 2RF0A 2JTEA 4RTVA 4OMPA 3THKA 1MV3A 2A08A 2KYMA 4ZNXA 2GTOA 1M3BA 2D0NA 3M0PA 1PRLC 1AWJA 1ZBJA 2C0IA 2LQNA 1NLPC 1WA7A 2DL5A 2KE9A 2J6KA 2GBQA 2EQIA 2KYBA 1E6HA 2H8HA 3PVQA 1JXMA 2MCNA 1G2BA 4JPBW 2K6DA 1I0CA 1UGVA 3VRYA 2ENMA 5I22A 2LJ0A 2DBMA 3M0RA 1MUZA 2RQRA 4OMOA 2JMCA 4JJDA 4OMNA 2L2PA 4AG2C 1T3SA 2F2WA 2LP5A 2PNIA 3EG3A 1K0XA 1VYUA 1KJWA 2D8JA 5L23A 1ZUYA 4F14A 5IXFA 4RTWA 2ECZA 1CKBA 2KRNA 1YWOA 2EYYA 2YT6A 1YP5A 2ROTA 1SSHA 2AZSA 2SRCA 3CQTA 5GJWB 2RQVA 3M0QA 1J3TA 1UJYA 1AZEA 4JZ4A 2DL4A 2CSIA 2RQUA 2DRMA 2DF6A
chains in the Genus database with same CATH superfamily
4FSSA 4J5YA 2KAFA 3EGDA 3UPUA 3M55A 2DILA 1LPLA 1M9SA 2IG0A 4PL6A 1VQ4A 1Q82R 3G4SA 3CC4A 2EJGA 1OU8A 1ZHIA 3G71T 1NJIU 2XMFA 3I55Q 2DIGA 3QPHA 4N4GA 2C0TA 2GCXA 2O9VA 1NYFA 2YDLA 4JRKA 4C8QA 1D1BA 4PJNA 4C0FA 1RL2A 1Q81R 2KRSA 4FT4A 4M7DB 1VQ8Q 4M75G 3OYIA 2AIRB 2RHIA 4C92E 4PJOC 3RIRA 1ZLMA 2XHCA 2CKKA 3LX7A 2LRQA 1KQSA 1VQKT 1Z9ZA 1HYOA 1X2KA 8AT1B 4F7UG 3EG0A 4BDYA 1LNXA 3BFMA 5L8RE 1CSKA 3E19A 2QASA 2LNHB 3JCMX 2EGCA 2F2VA 1QVGS 4DOVA 1OPKA 4J9EA 3ZEHA 2K9GA 1M3CA 2JM8A 1JO8A 2FB7A 5LJ3g 1S72T 2FG0A 1EFNA 3MPUB 5GAN5 4B9WA 1M90R 3M0UA 3HFNA 4XQ3A 3VS4A 2DJQA 3X25B 3EFRA 2OTLQ 1VQ9A 3WVEB 1H8KA 1LCKA 1QCFA 2V8IA 1B7TA 2ATCB 3A8MB 2DETA 2FO0A 4E7LA 1N8RU 3SEMA 5FROA 2PUKB 3PTAA 1VQLQ 3NTHA 2OX7A 3OS1A 1R8OB 2P0QA 2PTKA 3F70A 3EH1A 4HVVA 4J9FA 3REBB 2K57A 3GF5A 3HRTA 3OB9A 1Q7YU 3GPLA 1FMVA 4F7UE 2JJ9A 2RA2A 3L2VA 1GCPA 2LJ3A 4PFPA 3SDZA 1RAFB 1YIJT 5IHNA 2L3QA 2CT4A 1F1BB 1HD3A 1H3ZA 3CCRT 2RN8A 3EGUA 2LC4A 4QKUA 2VKNA 2M16A 3C12A 3WXMB 3PVLA 2ZPBB 3OYDA 5HY6A 3JV3A 2DYBA 4OB0B 3CCMQ 3M56A 3A8GB 1KQ1A 1M1KU 2L0AA 1TUGB 5GAN4 2AHJB 3G6EA 4BY6B 2XDPA 4RMOA 2JMAA 5KYNA 1MGQA 2DYIA 4NL3A 3FB9A 4Z02A 3SHWA 3QJYA 3EG2A 4M77C 2QA4A 3HRUA 2KBTA 1M8MA 3TVTA 2DPPB 3QDFA 3EG9B 5GMKj 5GAN6 1NLOC 1LOJA 2F2XA 3HP9A 3RNJA 1B07A 4PJOG 4HCBA 3QWYA 1AOJA 2J6FA 2HNIA 4QVCA 1PHTA 1VQMT 1G3SA 1I07A 3D7SB 3M57A 2AZVA 1WHMA 2EW3A 2EYXA 5CAIA 2EFIA 1AVZC 3HFOA 1OQKA 1JJ2P 2CZ6B 1TUDA 5DM7R 4NOYA 3JCMJ 4FSXA 3OBWA 4B6MA 3M53A 1OZ3A 4DA4A 1RAIB 4J9HA 2XK0A 1M2OA 4DBRA 3DLMA 4C8QB 4LUEA 2IVWA 4M75F 1KC8R 2NUZA 3OA6A 3NPFA 1OU9A 3LWHA 3DB3A 4MDWA 4OMMA 3L42A 3CMET 4OP0A 1VYTA 4M75D 4ZGDB 2RQTA 1X27A 2RK1A 4F7UF 1XJWB 5FLXE 2KT8A 2DEUA 3PGGA 2BZXA 2M0OA 3CBOA 4LDXA 5FWBA 1I81A 1GFDA 3CCQA 4DBHA 4RTYA 5KYYB 5IHKA 2XIDA 5GAMf 2VGNA 4ME7A 4C5EA 5GAMd 1W2BA 3TSZA 2K3BA 1YITA 1TH7A 2D6FA 1C1AA 2JNGA 2DXUA 1Q82U 2VYTA 2KVQG 4DBFA 3S6WA 3OW2P 2LNVA 1WQ7A 2RH2A 5GJVB 1VQLT 2OAUA 3ME9A 2ED1A 1BU1A 2FPEA 3V8JA 3GLXA 1WIEA 2AKLA 4L59A 1Q86U 9ATCB 4II1A 4BI8B 2OTJQ 1IRXA 2LJ1A 4EPCA 1VIFA 3GIBA 1OV3A 4RKUE 3CCUA 1IREB 1VQ5Q 4CC4B 4MZMA 3CCET 1Q81U 1KQSS 5I11A 3TU4K 3I9QA 4CC2A 1UHFA 1QP2A 2LVMA 3DLLA 2HQEA 5LJ3j 4N4IA 5DY9A 2C0OA 1T0HA 4XTWA 3CCJQ 3RR6A 3I55A 4M75A 3MP1A 3CC2T 2F5KA 2XICA 3CPFA 1EIFA 1VQ6T 3J7AF 4RTUA 1VQ8A 1R0CB 3VS2A 3M58A 4F7UA 1BI1A 5FRNA 1KD1C 2E1HA 3GNFB 4KT0E 2HBPA 2X3XD 2FRWA 3CCVQ 2PU9B 4RTZA 5GAN8 3P8DA 1E7OA 3SD4A 3JCMc 1YHQQ 4L5GA 3JCMP 3VYHB 1VQOQ 3A5ZB 4F04B 4E7KA 4JUVA 2L3SA 4IURA 1YJ9A 2AKKA 2VASA 2DL7A 1NJIR 2QTVA 1M30A 2LTOA 2LT1A 3QDRB 5EC7A 2RNAA 4PLLA 3VUZA 3DKMA 1UE9A 2VXFA 1UG1A 1YJWA 5IN1A 4MDXA 2M51A 3QUIA 3M5AA 1HSQA 5CVIA 3VKIA 3MP8A 1X6BA 4K11A 1XOVA 2QYZA 1WNLA 2OTLA 1DJ7B 2O4XA 5GMKm 1Y07A 2D0NA 3M0PA 5LJ5g 1ZBJA 4PJOD 2LQNA 2VGMA 4MZPA 1NLPC 1B34A 1ZSZC 2EQIA 2H8HA 4HA8A 5GANg 4PFOA 1JXMA 1G8XA 1G2BA 2L89A 2ENMA 2X4XA 4OMNA 4JJDA 6AT1B 2QI2A 2Y90A 4IUUA 2HZYA 4QVZA 2KI7A 1KJWA 2D8JA 3FRNA 2QEXT 2BIVA 1CKBA 4OGCA 4C0DC 2PUOB 3CXCP 3M0QA 3DB4A 4Q5WA 4BI3A 1UJYA 2DL4A 3CCMA 3MCAB 2CSIA 2RQUA 1VQPT 1SF9A 1KG1A 2CP2A 1BKBA 2A37A 2RI2A 5CKEA 1Q7YR 2E6NA 3QG1A 4RUGA 1MHNA 5CK9A 3ZFJA 1K0SA 1ZA2B 4PJOA 1VQNT 2A28A 1VQ7T 2JTMA 2G3RA 2X51A 1WJRA 3LYIA 1VQ5T 3BDUA 1AWXA 4HCKA 4BE1A 2RHYA 4XTVA 1K8AC 1MV0B 2YSQA 3TSWA 1HXDA 1T0JA 1WXBA 3L2RA 1ACMB 2MYSA 2O9SA 1M5Q1 3P8HA 2DX1A 3JB9F 3CMAQ 1KC8U 3CCJT 1D1AA 1M1KR 1MNEA 2M02A 2JOYA 1S72Q 3EH2A 3OYCA 2QXFA 5I2MA 3BW1A 1ZA1B 4M75B 2HEQA 1K9MR 3HPWA 3H0HA 1TSFA 1W2BS 3CCVT 1VQ4T 2DJZA 3I56T 4FYYB 2HL3A 1IXDA 4F7UB 4M77D 2CGHA 2RJEA 1K73R 4MMLA 1Q81C 3O5ZA 3M0SA 2BZ8A 1T3LA 3KBGA 3CC7A 2KEAA 4XU2A 4PLIA 2X4WA 4OGEA 3S3MA 1V1CA 5FU6C 2CUBA 3VS5A 3L2UA 1WX6A 2BUDA 3GBQA 3I35A 4FU6A 4EMKC 1A0NB 2RJFA 2GF7A 2ZGWA 3H9NA 1NYGA 2EQKA 1S1NA 2YUPA 2LCLA 1YIJQ 1G83A 3OYKA 4OMFB 3RKYA 2JUFA 2B86A 2R58A 2K5LA 1ABOA 3X26B 1BB9A 3URGA 2M0YA 2YRVA 2RK2A 1JU5C 3CCLA 2DXBA 2O4XB 1M90C 1X01A 4EMHA 2LMJA 1KFZA 2QAZA 2GFUA 2NUTA 4ORZA 1B34B 2P0PA 1RAGB 3UATA 4C5IA 2JZ2A 2MI6A 4GLMA 3VS1A 2EQUA 1IGQA 2CYZB 1SHFA 4A4FA 1BYMA 2E5KA 3H0IA 2KRMA 1GFCA 1AD5A 4J6XA 2GGRA 1EX4A 2LQWA 4PNOA 4MMKA 3OYHA 1I4K1 4B9XA 5I2SA 2QGFB 5D6WA 2V8KA 5LJ5j 1PKSA 3PIOA 1VQMQ 3CD6T 2QQAA 4KGZB 1Q86R 2K5FA 5GMKl 1IZ6A 4XTXA 2HSPA 3SWNB 1YHQA 3M4GA 3A8OB 5IXBA 1VQOA 1M2VB 5GANj 3PT9A 5GAOr 1FMKA 5CKBA 5KYUA 2CP6A 1TOVA 4KBMB 1WHLA 2M9UA 4M7DC 4OMQA 1UUEA 1N9SA 1OYXA 3SFMA 1N6AA 3J81E 1PRMC 3ASKA 3QZ9B 3TCJA 2CP0A 3X24B 3CMEQ 4HVUA 4AG1C 2CUDA 1YI2Q 1G3YA 4N0AC 3PMIA 1SSFA 3CMAT 1M27C 5A0LA 4KGVB 2W0ZA 5GAOm 2CSQA 4AMCA 1WDXA 2EJFA 2XI9A 2KMTA 4R0KA 2P4TA 3C94A 2EWNA 1GL5A 2ROLA 5AYFA 2DBKA 4QQDA 3FIFA 3G1JA 4C0ZA 1YCSB 1Q95G 2DM1A 3OYNA 2RI3A 4ZTFA 1WXUA 2ZPEB 5J3BA 2MWPA 2DXCA 1AZGB 4GBQA 3OYFA 2DD5A 7AT1B 3CBPA 1KHCA 3EFSA 2EQMA 2Y4YA 5IHIA 1ZUKA 3QJ6A 2JT4A 1WPYA 1YCYA 5IH2A 4FL6A 3A8LB 4M75E 1PG5B 1JJ2A 5KYXA 3CCEQ 4PJLA 1CKAA 4XU1A 4IUTA 3RBBB 3G71A 1TUCA 3FJPA 3RMSA 1WQWA 3MO8A 2YUOA 2EGAA 5CCAA 3A1PA 4WCIA 2K7AA 4E7HA 3CC2Q 4A63B 1QW1A 1KSWA 1O9SA 3L2WA 1VQ6Q 3CPWP 3H6ZA 2FEIA 4LDWA 4AFZC 3VRZA 1QKWA 4DQ2A 1MMDA 2DL8A 1QWEA 1YJNT 1VYVA 2GQVA 2JTFA 2VC8A 3G7ZA 1VQKA 4IUVA 3JCMW 2HKNA 5FU7C 2JXBA 2H3JA 4JZ3A 4BY6C 1WHHA 3V7CA 1K9MU 2DLPA 2LCSA 4IUPA 4OB1B 1VIEA 2NUTB 3OW2A 4J9GA 2BZYA 2X4YA 2OJ2A 1S72A 1V29B 1UB4A 1TWBA 1K73U 2PVGB 3EGDB 4M7DG 2K5IA 1D0YA 3RMQA 4IIOA 2NLUA 2QQBA 3QKJA 4ZN1A 3JB9I 1I8FA 2EBPA 1RI9A 3NTIA 4CC3A 1RUWA 1UGRB 4PK4A 2J05A 2NUPA 3OY9A 2QG9B 2KK4A 5A0DA 3H8ZA 1QKXA 2ESWA 3JB9H 3VYGA 1ZSZA 3V8KA 4KUIA 2VV5A 1QLYA 3FEOA 1RAHB 3CEYA 3BY7A 1W4SA 4IIMA 1FXXA 4F16A 2KNBB 4E6RA 4L6V5 2V8JA 5KYUB 2BE9B 3RDVA 1BIAA 1YI2T 1D0XA 1I5LA 3QO3A 1OI1A 1PRLC 4PJJA 4WF2A 1YIJA 5KCOA 1SKUB 2KE9A 2LQKA 4X9CA 5LJ5h 2QEXQ 1NJIC 4O6JA 3CCRA 3PVQA 3EAEA 2CP3A 1M8VA 4PKCC 2MCNA 3X28B 4PJOE 2O01E 5GANh 1VQPQ 3M0RA 1MUZA 2RQRA 2L2PA 5CR2A 1YBYA 2DFUA 2F2WA 2KQWA 3MJXA 1YJWT 2YLBA 5LJ5e 2K4YA 2QQ9A 4RTWA 5D6YA 1VQNQ 2YXYA 1VQ7Q 2WACA 3GOXA 2KRNA 2EYYA 2YT6A 2ROTA 1QVFP 1SSHA 5GJWB 2RQVA 1J3TA 5GANe 1AZEA 1MMGA 3OMGA 2DF6A 5HCKA 2L3PA 1UEBA 4J9IA 4PJMA 1BI2A 1JXOA 2EIFA 1VQMA 2E41A 2DZCA 5GAOl 3L2QA 1M1GA 3HKSA 1KHIA 3QBYA 1SEMA 2FZGB 2PZ1A 2CP7A 1UECA 2O2OA 1JEGA 1ZSGA 3OS2A 4M77G 3E1SA 5I21A 1FMWA 1W1FA 4FYVB 3UF4A 1HJDA 2EAYA 4E47A 1N8RC 2O31A 4LN2A 4RCCA 5CQXA 1VQ4Q 4M78C 4XTZA 3I56Q 1MNDA 1VUBA 1K4US 2L3RA 4OMLA 3CXCA 1Y71A 3CMEA 1QWFA 2RHXA 5GAMj 2I0NA 3NFCA 4JRIA 2LX7A 1Q7YC 3KXTA 3NMZC 1YN8A 3JCMg 3QZ5B 1NPRA 2YRDA 2NYSA 3OYMA 4PFZA 1JJ2S 2KXCA 3ULRB 4ELYC 1G3TA 1UGPB 2XDDA 4HCCA 2P0KA 3VU3C 1IB8A 1GBQA 2E3HA 3E2UA 4PJOF 1I5OB 1Y7XA 2DRKA 3NGPA 4M7AC 1M1KC 1VQLA 1XQHA 4M7DD 3SB2A 2DA9A 2G6FX 2LT4A 4M77E 2QQSA 3M59A 4D6WA 2ED0A 2ZPIB 2KR3A 1D3BA 2FZCB 1OPLA 5KYWA 3MEUA 1WHGA 2RPNA 4LD9K 3CCEA 2MK5A 4X34A 2GQIA 2A3LA 1ZSZB 3MP6A 4FIBA 4MZTA 5GMKh 2E5QA 1ZUUA 2DVJA 3OYEA 1PKTA 1VQ9Q 4J9DA 3INZA 2RD1A 3CCST 4FW1A 4BACA 1QQJA 3CC2A 5IAYA 1X6OA 1IO6A 1U1SA 2FZKB 5A2QE 1VQ6A 3VV0A 2GTJA 1BIBA 1IHWA 2YUQA 3LGLA 3LWIA 1UDLA 2OI3A 4C92C 3CD6Q 2I2LA 5GMKe 4RG8A 2DVEA 5A0GA 4A54A 2X4JA 1GCQC 2IPOB 2CH4W 4FYWB 3TREA 1W6XA 2EPDA 2FRYA 2K2MA 4OF1A 3L2ZA 3HHTB 1WYXA 1NM7A 1WJSA 3QYGB 3JCMb 4CRIA 2BKDN 3OYAA 5C6SA 2P84A 1YFNA 1K76A 4E7SA 2COYA 1TTHB 2DZ9A 4D8DA 3LH0A 2VVKA 1PSFA 4M78G 2E6ZA 5GAN7 2C06A 4E7ZA 3I5SA 3G6EQ 1FWZA 2EVRA 4Z89A 3JRZA 2GNCA 1WZOA 1Q82C 1E6GA 1RLPC 2R5MA 2DNUA 3OYYA 4M77F 4QW2A 4IKFA 2QGGA 1Y0MA 2D8HA 4AFUC 2LQ8A 4KUDK 1Q86C 4BDZA 3ER0A 2FHDA 4NS5A 3IQLA 4DBQA 1KK7A 1QMCA 3G4ST 3CC4T 2A0FB 4RTTA 3QIIA 2JS2A 2K3YA 2MWOA 2PVOB 3PFSA 1NE8A 1C0MA 2DE0X 4ATOA 1TS9A 3OQ5A 2FYKA 5CKHA 4ZN3A 3EHQA 1QVGP 4M7AG 2MF2A 1SPKA 3UA7A 2CH4A 2P4RA 4OB3B 5LJ3h 2QEXA 1X75C 1GXIE 1BBZA 1O75A 3M54A 4DEXA 4XU3A 4NL2A 2F5TX 2VWFA 1M1FA 1NEBA 1UGSB 3PMTA 4BD3A 1WI7A 4M4ZA 4N4HA 3V7RA 5LJ5f 2ZPGB 4AT1B 5LJ5d 3FJ5A 1VQPA 4Z88A 4XK8E 1W70A 4M78E 5CIUA 2DAQA 3QHSA 2KY9A 3FLGA 4JDSA 2R57A 5GAOn 4FW2A 2ZAEA 2EQJA 4EDUA 5LJ3e 5GANf 2COZA 5GANd 1YJNQ 2PQWA 1VQNA 2JW4A 3QSUA 2OTJA 1VQ7A 1WHJA 4WTOB 2IIMA 1VQ5A 2CS7A 2CDTA 1N5ZA 2E4HA 3CCQQ 1IGUA 1LVKA 3BE3A 2XDBA 4C92G 1RAAB 1X43A 2M1HA 5KH6A 3CXCS 4M77A 3HL8A 1OOTA 4QQ6A 5KYWB 1PD1A 4A4GA 4LD6A 2B8AA 2RO0A 3CCJA 1YITQ 1VQ9T 1N27A 4EIKA 4E7IA 1K8AR 4QVDA 2O88A 5M9OA 5J39A 2DL3A 2CT3A 3QYHB 2KXDA 5CKDA 2COWA 3HSBA 2CREA 2YHTA 2Z0WA 2RQWA 3REAB 3X20B 1PC0A 1ZBXA 3CCVA 3CCUQ 4HKEA 3I56A 4LE9A 1U8RA 2KROA 3A8HB 3SWNC 2CZ1B 1BI0A 4OB2B 1NPPA 4J8OA 3FDRA 5FWCA 2V1RA 2D9TA 1SG5A 4C5GA 3CPWA 2RM4A 3OS0A 2YRCA 2EYWA 2DEQA 1LJOA 1RADB 3NTKA 1U3OA 2EYQA 2VUBA 2VXEA 3LGFA 1FYNA 1BCMA 4PJOB 1SRMA 1R77A 4J9BA 1SRLA 3QXEB 1YWPA 1BCOA 2YLCA 3VS7A 3G6ET 3PE0A 1WFWA 4M78F 4JJCA 4BE0A 2NWMA 4OVAA 1OULA 3EHRA 1QVPA 5KYYA 1QCNA 4A4KA 4M78D 2QA4T 5GAN2 5DLQE 1YJ9Q 2RF0A 2JTEA 5GAOq 4OMPA 2KYMA 2A08A 4ZNXA 2GTOA 3CBMA 1AWJA 1YJWQ 3C4SA 4V2SA 3V7SA 2QK0A 5KCHA 4UC4A 1PCXA 3LW5E 5CKFA 1PM3A 2J6KA 2GBQA 2EJ9A 4DOWA 4BI4A 5HK3A 2LDMA 3M4YA 5GAMg 2RI5A 4HCZA 4RCBA 2L8DA 2K6DA 1KC8C 1UGVA 1KD1U 4XTYA 4M7AF 4KGXB 2DBMA 4OMOA 1T3SA 3CD6A 4J7IA 2LCCA 2L5QA 4M7AD 1K0XA 1HK9A 1VYUA 1V76A 2E3IA 2HD0A 4GLKA 5L23A 4F14A 5IXFA 2JVVA 3EGXA 2E12A 4J83A 1YP5A 2SRCA 3RERA 3CQTA 2E70A 3RKXA 4JZ4A 3PNWC 3FC3A 4JS5A 1QP3A 1ABQA 2DK3A 1ARKA 4M78A 2QQRA 2XKOC 4HT8A 3CCQT 4J6WA 2K79A 3QWXX 2D1XA 1KQSP 3M0TA 3MHXA 4AFSC 3TQ7P 1D09B 3CMAA 2HBWA 4C92F 1YITT 3T9NA 5FU7B 3E9GA 3OSSC 2F69A 4ESRA 3NHNA 4ELZC 1RACB 5AT1B 4XU0A 4F17A 1G3WA 1BK2A 1RAEB 4J6YA 3I5RA 4C92D 1UTIA 2EYZA 4M77B 2J7IA 2RJDA 3AHUA 4QT7A 1QVFA 4JRPA 5CQYA 1TXQA 3OYJA 3S3NA 2W10A 2EKHA 3CCUT 3LLRA 2E64A 4FCYA 4M7AA 4AFQC 4FT2A 1Z9QA 3U23A 3JCMV 1I1JA 4GY5A 5FRMA 1WLPB 2EGEA 2BE7D 3MEAA 2Y4XA 3JCMh 1IHVA 3I55T 3WVDB 1WXTA 3OYBA 1X6GA 4X1VA 3MKDA 4C8QC 4JJBA 3RKWA 3EFOA 2WSFE 1U5SA 1VQ8T 2RB6A 1K1ZA 4YTLA 1AEYA 5LJ3f 3RESA 5LJ3d 2MOXA 3CCSQ 2LX9A 3VJPA 1M3AA 1JQQA 3JCMe 2DMOA 3VS0A 3OYLA 3HTRA 1TG0A 3Q1JA 3M9QA 3ZL7C 2DTIA 2H3EB 4C5HA 1R0BG 2MAMA 2LZ6B 4C92A 1YJNA 1UJ0A 2ZZDA 1YJ9T 4M7DE 5KE3A 5J26A 1K8AU 3CC7Q 5FW9A 2DIQA 5HKCA 1RLQC 1OX9A 1H3HA 4LXCA 3N5BB 1GCQA 1RABB 3OYGA 5D7UA 1Y57A 3JAME 3ZBDA 2KSSA 2OTLT 1NG2A 1RI0A 4Y92A 2X35A 2ZPFB 5ECAA 4ZGEB 4XTUA 5GMKi 2HMAA 2HL5C 1AHJB 1UHCA 5D6XA 1FX7A 3CPWS 4KH1B 3UDCA 2CP5A 4R56A 4A53A 3UA6A 2HAXA 1QCOA 3CCLQ 1U1TA 3H0FA 2E10A 2RHUA 1C6VX 5KYXB 2QTXA 4ANJA 1PWTA 5DLOA 2K2VA 1KQ2A 3JSCA 3JB9G 4LDUA 1YNZA 3VS6A 4E2FB 5KE2A 1Y96A 1GBRA 1AWOA 3R6NA 4LDYA 1B3QA 3EGXB 2OAWA 1ZQ1A 3EG1A 2DERA 2JM9A 1AWWA 1U06A 4IUQA 2DXTA 2FPFA 3G4SQ 3CC4Q 2HKQB 1YI2A 3AT1B 2FL7A 3OS5A 5CO7A 2MMPA 4M78B 3CCMT 3C95A 3A98A 2WSCE 1SHGA 3V8LA 2X3WD 5LL6S 2WSEE 4ZGJB 1M90U 2AT1B 1WHKA 1OX8A 2DO3A 1H641 2QDLA 4EMKA 1P92A 2J6OA 1OZ2A 2A36A 5GAN3 4M7DF 4C8QG 2DTHA 2BTTA 1W2BP 1JB0E 3C0CA 4JLGA 3LH5A 1GRIA 3VUBA 2E65A 3R6OA 1JRIA 4BE2A 2RJCA 1K9AA 2K3XA 1K9MC 4M7AB 1XNIA 2NUPB 1BI3A 4HT9A 2DTOA 4C0GA 2ABLA 2AK5A 2EKOA 2HCKA 2JS0A 3HRSA 2V1QA 3P8BB 4KRTA 3E9FA 1D0ZA 2PVDB 1OEBA 4E7JA 1K73C 4LNPA 3BDLA 3O8VA 2GFAA 4LUDA 1MMNA 1PNJA 4O5VA 2YUNA 3EFOB 3OW2S 3OSVA 1X2QA 3H41A 4TVRA 4DEYA 3PIPA 1QVGA 2J06A 3GP8A 1NZ9A 2ZCFB 4J9CA 4P5NA 4R55A 1X69A 3CC7T 1QVFS 1UGQB 4HXJA 4JS4A 4VUBA 4C8QE 1WGSA 4Y91A 4C0DB 1N8RR 4C92B 3G71Q 1KD1R 2MIOA 2KT1A 3SWNA 3VS3A 1M2VA 2RMOA 1H92A 4M7DA 2HQHA 2DD4A 1VOMA 3GNGA 2SEMA 8ATCB 1TU0B 3TEEA 1VA7A 2XG8D 2XU8A 2ZPHB 1PD0A 4X9DA 3KFVA 4N0AA 1M4ZA 1ZX6A 3S3OA 4RTXA 3CCLT 1WJQA 2V26A 4ZTJA 2OTJT 2VB6A 4FYXB 2HDAA 2QDYB 1VQKQ 4RG2A 2D0QB 4XAXB 4A4HA 2YWWA 1AT1B 2RHZA 4JJNK 3MEVA 4CI0C 2QA4Q 4KULA 2DKGA 4HVWA 2KGTA 4M75C 2CZ7B 2KDSA 3JB9D 1KIKA 1Y96B 4Z8AA 4BB7A 3KUFA 3JCMf 4D8KA 3JCMd 4CC7A 4LDVA 5EG2A 3L1AA 3MEWA 1D1CA 2CZ0B 3OMCA 2JN0A 3META 3CCSA 4KH0B 1XTDA 1NEGA 2FPDA 2A7YA 1UFFA 2HQXA 1YHQT 4QQGA 4RTVA 1VQOT 3THKA 1MV3A 1JBMA 2HSEB 1M3BA 1MMAA 5HK0A 5FU6B 4Y28E 2C0IA 4JLIA 1WA7A 2X9HA 2DL5A 2R5AA 3JB9J 4C8QF 4EMKB 2KYBA 1E6HA 4JRQA 4EMGA 3RUXA 2F1LA 4JPBW 1I0CA 4C8QD 3VRYA 5GAMh 2XD0A 1NBEB 5I22A 2LJ0A 4A4EA 3JCMQ 2JMCA 3UT1A 4AG2C 3OBYA 4FM4B 5C0MA 3CCRQ 2LP5A 2PNIA 3EG3A 1G5VA 1PSEA 1EZZB 1ZUYA 2MPXC 1D3BB 2ECZA 5GAOp 3UWNA 1YWOA 4BUGA 2AZSA 1N9RA 2FVUA 3EG9A 5IT9E 5GAMe 4M7AE 4J7FA 3J80E 2DRMA
chains in the Genus database with same CATH topology
2L3PA 4FSSA 1ABQA 1ARKA 4J9IA 1JXOA 2DILA 2A37A 2K79A 3QWXX 2D1XA 1SEMA 2PZ1A 3M0TA 4AFSC 4RUGA 1UECA 2O2OA 1JEGA 1ZSGA 1K0SA 2A28A 2HBWA 1W1FA 4ESRA 3NHNA 3UF4A 1AWXA 1HJDA 4HCKA 4F17A 1BK2A 2O31A 2XMFA 1MV0B 2YSQA 3I5RA 4LN2A 3TSWA 1UTIA 2EYZA 1T0JA 2J7IA 1WXBA 2O9SA 2C0TA 2DX1A 2O9VA 4QT7A 1NYFA 2YDLA 1K4US 4OMLA 1QWFA 2KRSA 2W10A 2I0NA 2EKHA 2LX7A 3NMZC 4AFQC 1Z9QA 1YN8A 1ZLMA 3U23A 1I1JA 2HEQA 1Z9ZA 1X2KA 1WLPB 3EG0A 2EGEA 2KXCA 3ULRB 3H0HA 1WXTA 1X6GA 4X1VA 4JJBA 1CSKA 2LNHB 2EGCA 1GBQA 2F2VA 1U5SA 1OPKA 4J9EA 1K1ZA 1M3CA 2K9GA 2JM8A 1JO8A 2DRKA 3NGPA 1AEYA 3O5ZA 3M0SA 2BZ8A 2FG0A 1T3LA 1EFNA 2KEAA 2MOXA 1V1CA 3M0UA 2CUBA 1M3AA 3VS5A 1JQQA 2DA9A 3VS4A 2DJQA 2G6FX 2DMOA 3VS0A 1TG0A 1WX6A 2ED0A 2KR3A 1H8KA 3ZL7C 1LCKA 1OPLA 1QCFA 3GBQA 3I35A 2RPNA 1A0NB 2FO0A 2LZ6B 1NYGA 1UJ0A 3SEMA 2GQIA 1S1NA 2YUPA 5FW9A 1RLQC 1G83A 1H3HA 1ZUUA 2DVJA 1GCQA 1PKTA 2PTKA 2B86A 4J9DA 1ABOA 4HVVA 4J9FA 1BB9A 3REBB 1Y57A 2M0YA 1JU5C 1IO6A 2LMJA 1KFZA 1NG2A 2GTJA 4Y92A 5ECAA 2YUQA 4ORZA 1UDLA 1UHCA 2OI3A 1GCPA 2LJ3A 3UATA 3UA6A 5IHNA 2L3QA 4GLMA 2CT4A 3VS1A 1HD3A 3H0FA 1GCQC 1SHFA 2CH4W 2RN8A 3EGUA 2E5KA 1W6XA 2EPDA 2KRMA 2VKNA 1PWTA 2FRYA 1GFCA 3H0IA 2K2MA 1AD5A 3PVLA 3JV3A 1YNZA 1WYXA 2DYBA 2GGRA 3VS6A 1NM7A 2L0AA 2LQWA 1GBRA 1AWOA 3R6NA 1PKSA 2JMAA 1K76A 1B3QA 2OAWA 3SHWA 3EG1A 4D8DA 3EG2A 2JM9A 1AWWA 1U06A 2VVKA 2HSPA 2KBTA 1M8MA 2FPFA 3TVTA 5IXBA 1NLOC 1FMKA 3I5SA 2F2XA 2EVRA 4Z89A 5HCKA 4OMQA 2GNCA 3RNJA 1UUEA 3A98A 1B07A 1E6GA 3QWYA 1RLPC 1SHGA 2J6FA 1AOJA 2DNUA 2X3WD 1PRMC 1PHTA 1I07A 2AZVA 4HVUA 1Y0MA 2EW3A 2EYXA 2CUDA 2QDLA 2D8HA 4AFUC 4AG1C 1M27C 2J6OA 2A36A 1AVZC 2W0ZA 3IQLA 2CSQA 4RTTA 2BTTA 1WDXA 2JS2A 1TUDA 4R0KA 4J9HA 2DE0X 3C0CA 1GL5A 2ROLA 3LH5A 2DBKA 1GRIA 3EHQA 4LUEA 1SPKA 3UA7A 2NUZA 3NPFA 1YCSB 2CH4A 2P4RA 2DM1A 1K9AA 4OMMA 1BBZA 4DEXA 1WXUA 1VYTA 1AZGB 4GBQA 2RQTA 1X27A 2VWFA 1NEBA 2KT8A 1WI7A 4M4ZA 5IHIA 2ABLA 2AK5A 2HCKA 2JS0A 3FJ5A 1ZUKA 4Z88A 2V1QA 2JT4A 1W70A 2BZXA 4KRTA 5FWBA 1GFDA 1OEBA 4RTYA 5IH2A 4LNPA 4LUDA 5IHKA 1PNJA 2YUNA 1CKAA 2JW4A 3TSZA 2K3BA 3RBBB 1X2QA 3H41A 4DEYA 1TUCA 2IIMA 2CDTA 2YUOA 1N5ZA 2EGAA 2J06A 4WCIA 4J9CA 1X69A 2K7AA 5GJVB 1X43A 2ED1A 1BU1A 2FPEA 4HXJA 4A63B 1WIEA 2AKLA 1OOTA 1KSWA 2LJ1A 1OV3A 2FEIA 4EIKA 2MIOA 2KT1A 4AFZC 3VS3A 3VRZA 4CC4B 1QKWA 2DL8A 2RMOA 1H92A 1QWEA 2O88A 2DL3A 1VYVA 5I11A 2CT3A 3I9QA 4CC2A 1UHFA 2SEMA 2KXDA 1VA7A 2CREA 2C0OA 1T0HA 2JXBA 4JZ3A 3KFVA 2RQWA 3REAB 2DLPA 2LCSA 1ZX6A 4RTXA 4LE9A 4J9GA 2KROA 2HDAA 2BZYA 4RTUA 3VS2A 2OJ2A 5FWCA 2V1RA 2X3XD 2FRWA 2EYWA 4RTZA 4IIOA 1E7OA 4HVWA 1U3OA 2KGTA 2EBPA 1FYNA 1RI9A 1SRMA 4CC3A 4J9BA 1RUWA 1SRLA 1KIKA 2L3SA 1YWPA 4Z8AA 2AKKA 2DL7A 2J05A 1M30A 4D8KA 5EC7A 3VS7A 1QKXA 2ESWA 2RNAA 1WFWA 3PE0A 4CC7A 4JJCA 1UE9A 1UG1A 2M51A 2NWMA 1HSQA 1QLYA 1X6BA 4K11A 1NEGA 2FPDA 1XOVA 3EHRA 4IIMA 4F16A 2KNBB 1UFFA 4E6RA 2RF0A 2JTEA 4RTVA 4OMPA 3THKA 1MV3A 2A08A 2KYMA 4ZNXA 2GTOA 1M3BA 2D0NA 3M0PA 1PRLC 1AWJA 1ZBJA 2C0IA 2LQNA 1NLPC 1WA7A 2DL5A 2KE9A 2J6KA 2GBQA 2EQIA 2KYBA 1E6HA 2H8HA 3PVQA 1JXMA 2MCNA 1G2BA 4JPBW 2K6DA 1I0CA 1UGVA 3VRYA 2ENMA 5I22A 2LJ0A 2DBMA 3M0RA 1MUZA 2RQRA 4OMOA 2JMCA 4JJDA 4OMNA 2L2PA 4AG2C 1T3SA 2F2WA 2LP5A 2PNIA 3EG3A 1K0XA 1VYUA 1KJWA 2D8JA 5L23A 1ZUYA 4F14A 5IXFA 4RTWA 2ECZA 1CKBA 2KRNA 1YWOA 2EYYA 2YT6A 1YP5A 2ROTA 1SSHA 2AZSA 2SRCA 3CQTA 5GJWB 2RQVA 3M0QA 1J3TA 1UJYA 1AZEA 4JZ4A 2DL4A 2CSIA 2RQUA 2DRMA 2DF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3P A;  4FSS A;  1ABQ A;  1ARK A;  4J9I A;  1JXO A;  2DIL A;  2A37 A;  2K79 A;  3QWX X;  2D1X A;  1SEM A;  2PZ1 A;  3M0T A;  4AFS C;  4RUG A;  1UEC A;  2O2O A;  1JEG A;  1ZSG A;  1K0S A;  2A28 A;  2HBW A;  1W1F A;  4ESR A;  3NHN A;  3UF4 A;  1AWX A;  1HJD A;  4HCK A;  4F17 A;  1BK2 A;  2O31 A;  2XMF A;  1MV0 B;  2YSQ A;  3I5R A;  4LN2 A;  3TSW A;  1UTI A;  2EYZ A;  1T0J A;  2J7I A;  1WXB A;  2O9S A;  2C0T A;  2DX1 A;  2O9V A;  4QT7 A;  1NYF A;  2YDL A;  1K4U S;  4OML A;  1QWF A;  2KRS A;  2W10 A;  2I0N A;  2EKH A;  2LX7 A;  3NMZ C;  4AFQ C;  1Z9Q A;  1YN8 A;  1ZLM A;  3U23 A;  1I1J A;  2HEQ A;  1Z9Z A;  1X2K A;  1WLP B;  3EG0 A;  2EGE A;  2KXC A;  3ULR B;  3H0H A;  1WXT A;  1X6G A;  4X1V A;  4JJB A;  1CSK A;  2LNH B;  2EGC A;  1GBQ A;  2F2V A;  1U5S A;  1OPK A;  4J9E A;  1K1Z A;  1M3C A;  2K9G A;  2JM8 A;  1JO8 A;  2DRK A;  3NGP A;  1AEY A;  3O5Z A;  3M0S A;  2BZ8 A;  2FG0 A;  1T3L A;  1EFN A;  2KEA A;  2MOX A;  1V1C A;  3M0U A;  2CUB A;  1M3A A;  3VS5 A;  1JQQ A;  2DA9 A;  3VS4 A;  2DJQ A;  2G6F X;  2DMO A;  3VS0 A;  1TG0 A;  1WX6 A;  2ED0 A;  2KR3 A;  1H8K A;  3ZL7 C;  1LCK A;  1OPL A;  1QCF A;  3GBQ A;  3I35 A;  2RPN A;  1A0N B;  2FO0 A;  2LZ6 B;  1NYG A;  1UJ0 A;  3SEM A;  2GQI A;  1S1N A;  2YUP A;  5FW9 A;  1RLQ C;  1G83 A;  1H3H A;  1ZUU A;  2DVJ A;  1GCQ A;  1PKT A;  2PTK A;  2B86 A;  4J9D A;  1ABO A;  4HVV A;  4J9F A;  1BB9 A;  3REB B;  1Y57 A;  2M0Y A;  1JU5 C;  1IO6 A;  2LMJ A;  1KFZ A;  1NG2 A;  2GTJ A;  4Y92 A;  5ECA A;  2YUQ A;  4ORZ A;  1UDL A;  1UHC A;  2OI3 A;  1GCP A;  2LJ3 A;  3UAT A;  3UA6 A;  5IHN A;  2L3Q A;  4GLM A;  2CT4 A;  3VS1 A;  1HD3 A;  3H0F A;  1GCQ C;  1SHF A;  2CH4 W;  2RN8 A;  3EGU A;  2E5K A;  1W6X A;  2EPD A;  2KRM A;  2VKN A;  1PWT A;  2FRY A;  1GFC A;  3H0I A;  2K2M A;  1AD5 A;  3PVL A;  3JV3 A;  1YNZ A;  1WYX A;  2DYB A;  2GGR A;  3VS6 A;  1NM7 A;  2L0A A;  2LQW A;  1GBR A;  1AWO A;  3R6N A;  1PKS A;  2JMA A;  1K76 A;  1B3Q A;  2OAW A;  3SHW A;  3EG1 A;  4D8D A;  3EG2 A;  2JM9 A;  1AWW A;  1U06 A;  2VVK A;  2HSP A;  2KBT A;  1M8M A;  2FPF A;  3TVT A;  5IXB A;  1NLO C;  1FMK A;  3I5S A;  2F2X A;  2EVR A;  4Z89 A;  5HCK A;  4OMQ A;  2GNC A;  3RNJ A;  1UUE A;  3A98 A;  1B07 A;  1E6G A;  3QWY A;  1RLP C;  1SHG A;  2J6F A;  1AOJ A;  2DNU A;  2X3W D;  1PRM C;  1PHT A;  1I07 A;  2AZV A;  4HVU A;  1Y0M A;  2EW3 A;  2EYX A;  2CUD A;  2QDL A;  2D8H A;  4AFU C;  4AG1 C;  1M27 C;  2J6O A;  2A36 A;  1AVZ C;  2W0Z A;  3IQL A;  2CSQ A;  4RTT A;  2BTT A;  1WDX A;  2JS2 A;  1TUD A;  4R0K A;  4J9H A;  2DE0 X;  3C0C A;  1GL5 A;  2ROL A;  3LH5 A;  2DBK A;  1GRI A;  3EHQ A;  4LUE A;  1SPK A;  3UA7 A;  2NUZ A;  3NPF A;  1YCS B;  2CH4 A;  2P4R A;  2DM1 A;  1K9A A;  4OMM A;  1BBZ A;  4DEX A;  1WXU A;  1VYT A;  1AZG B;  4GBQ A;  2RQT A;  1X27 A;  2VWF A;  1NEB A;  2KT8 A;  1WI7 A;  4M4Z A;  5IHI A;  2ABL A;  2AK5 A;  2HCK A;  2JS0 A;  3FJ5 A;  1ZUK A;  4Z88 A;  2V1Q A;  2JT4 A;  1W70 A;  2BZX A;  4KRT A;  5FWB A;  1GFD A;  1OEB A;  4RTY A;  5IH2 A;  4LNP A;  4LUD A;  5IHK A;  1PNJ A;  2YUN A;  1CKA A;  2JW4 A;  3TSZ A;  2K3B A;  3RBB B;  1X2Q A;  3H41 A;  4DEY A;  1TUC A;  2IIM A;  2CDT A;  2YUO A;  1N5Z A;  2EGA A;  2J06 A;  4WCI A;  4J9C A;  1X69 A;  2K7A A;  5GJV B;  1X43 A;  2ED1 A;  1BU1 A;  2FPE A;  4HXJ A;  4A63 B;  1WIE A;  2AKL A;  1OOT A;  1KSW A;  2LJ1 A;  1OV3 A;  2FEI A;  4EIK A;  2MIO A;  2KT1 A;  4AFZ C;  3VS3 A;  3VRZ A;  4CC4 B;  1QKW A;  2DL8 A;  2RMO A;  1H92 A;  1QWE A;  2O88 A;  2DL3 A;  1VYV A;  5I11 A;  2CT3 A;  3I9Q A;  4CC2 A;  1UHF A;  2SEM A;  2KXD A;  1VA7 A;  2CRE A;  2C0O A;  1T0H A;  2JXB A;  4JZ3 A;  3KFV A;  2RQW A;  3REA B;  2DLP A;  2LCS A;  1ZX6 A;  4RTX A;  4LE9 A;  4J9G A;  2KRO A;  2HDA A;  2BZY A;  4RTU A;  3VS2 A;  2OJ2 A;  5FWC A;  2V1R A;  2X3X D;  2FRW A;  2EYW A;  4RTZ A;  4IIO A;  1E7O A;  4HVW A;  1U3O A;  2KGT A;  2EBP A;  1FYN A;  1RI9 A;  1SRM A;  4CC3 A;  4J9B A;  1RUW A;  1SRL A;  1KIK A;  2L3S A;  1YWP A;  4Z8A A;  2AKK A;  2DL7 A;  2J05 A;  1M30 A;  4D8K A;  5EC7 A;  3VS7 A;  1QKX A;  2ESW A;  2RNA A;  1WFW A;  3PE0 A;  4CC7 A;  4JJC A;  1UE9 A;  1UG1 A;  2M51 A;  2NWM A;  1HSQ A;  1QLY A;  1X6B A;  4K11 A;  1NEG A;  2FPD A;  1XOV A;  3EHR A;  4IIM A;  4F16 A;  2KNB B;  1UFF A;  4E6R A;  2RF0 A;  2JTE A;  4RTV A;  4OMP A;  3THK A;  1MV3 A;  2A08 A;  2KYM A;  4ZNX A;  2GTO A;  1M3B A;  2D0N A;  3M0P A;  1PRL C;  1AWJ A;  1ZBJ A;  2C0I A;  2LQN A;  1NLP C;  1WA7 A;  2DL5 A;  2KE9 A;  2J6K A;  2GBQ A;  2EQI A;  2KYB A;  1E6H A;  2H8H A;  3PVQ A;  1JXM A;  2MCN A;  1G2B A;  4JPB W;  2K6D A;  1I0C A;  1UGV A;  3VRY A;  2ENM A;  5I22 A;  2LJ0 A;  2DBM A;  3M0R A;  1MUZ A;  2RQR A;  4OMO A;  2JMC A;  4JJD A;  4OMN A;  2L2P A;  4AG2 C;  1T3S A;  2F2W A;  2LP5 A;  2PNI A;  3EG3 A;  1K0X A;  1VYU A;  1KJW A;  2D8J A;  5L23 A;  1ZUY A;  4F14 A;  5IXF A;  4RTW A;  2ECZ A;  1CKB A;  2KRN A;  1YWO A;  2EYY A;  2YT6 A;  1YP5 A;  2ROT A;  1SSH A;  2AZS A;  2SRC A;  3CQT A;  5GJW B;  2RQV A;  3M0Q A;  1J3T A;  1UJY A;  1AZE A;  4JZ4 A;  2DL4 A;  2CSI A;  2RQU A;  2DRM A;  2DF6 A; 
#chains in the Genus database with same CATH topology
 4FSS A;  4J5Y A;  2KAF A;  3EGD A;  3UPU A;  3M55 A;  2DIL A;  1LPL A;  1M9S A;  2IG0 A;  4PL6 A;  1VQ4 A;  1Q82 R;  3G4S A;  3CC4 A;  2EJG A;  1OU8 A;  1ZHI A;  3G71 T;  1NJI U;  2XMF A;  3I55 Q;  2DIG A;  3QPH A;  4N4G A;  2C0T A;  2GCX A;  2O9V A;  1NYF A;  2YDL A;  4JRK A;  4C8Q A;  1D1B A;  4PJN A;  4C0F A;  1RL2 A;  1Q81 R;  2KRS A;  4FT4 A;  4M7D B;  1VQ8 Q;  4M75 G;  3OYI A;  2AIR B;  2RHI A;  4C92 E;  4PJO C;  3RIR A;  1ZLM A;  2XHC A;  2CKK A;  3LX7 A;  2LRQ A;  1KQS A;  1VQK T;  1Z9Z A;  1HYO A;  1X2K A;  8AT1 B;  4F7U G;  3EG0 A;  4BDY A;  1LNX A;  3BFM A;  5L8R E;  1CSK A;  3E19 A;  2QAS A;  2LNH B;  3JCM X;  2EGC A;  2F2V A;  1QVG S;  4DOV A;  1OPK A;  4J9E A;  3ZEH A;  2K9G A;  1M3C A;  2JM8 A;  1JO8 A;  2FB7 A;  5LJ3 g;  1S72 T;  2FG0 A;  1EFN A;  3MPU B;  5GAN 5;  4B9W A;  1M90 R;  3M0U A;  3HFN A;  4XQ3 A;  3VS4 A;  2DJQ A;  3X25 B;  3EFR A;  2OTL Q;  1VQ9 A;  3WVE B;  1H8K A;  1LCK A;  1QCF A;  2V8I A;  1B7T A;  2ATC B;  3A8M B;  2DET A;  2FO0 A;  4E7L A;  1N8R U;  3SEM A;  5FRO A;  2PUK B;  3PTA A;  1VQL Q;  3NTH A;  2OX7 A;  3OS1 A;  1R8O B;  2P0Q A;  2PTK A;  3F70 A;  3EH1 A;  4HVV A;  4J9F A;  3REB B;  2K57 A;  3GF5 A;  3HRT A;  3OB9 A;  1Q7Y U;  3GPL A;  1FMV A;  4F7U E;  2JJ9 A;  2RA2 A;  3L2V A;  1GCP A;  2LJ3 A;  4PFP A;  3SDZ A;  1RAF B;  1YIJ T;  5IHN A;  2L3Q A;  2CT4 A;  1F1B B;  1HD3 A;  1H3Z A;  3CCR T;  2RN8 A;  3EGU A;  2LC4 A;  4QKU A;  2VKN A;  2M16 A;  3C12 A;  3WXM B;  3PVL A;  2ZPB B;  3OYD A;  5HY6 A;  3JV3 A;  2DYB A;  4OB0 B;  3CCM Q;  3M56 A;  3A8G B;  1KQ1 A;  1M1K U;  2L0A A;  1TUG B;  5GAN 4;  2AHJ B;  3G6E A;  4BY6 B;  2XDP A;  4RMO A;  2JMA A;  5KYN A;  1MGQ A;  2DYI A;  4NL3 A;  3FB9 A;  4Z02 A;  3SHW A;  3QJY A;  3EG2 A;  4M77 C;  2QA4 A;  3HRU A;  2KBT A;  1M8M A;  3TVT A;  2DPP B;  3QDF A;  3EG9 B;  5GMK j;  5GAN 6;  1NLO C;  1LOJ A;  2F2X A;  3HP9 A;  3RNJ A;  1B07 A;  4PJO G;  4HCB A;  3QWY A;  1AOJ A;  2J6F A;  2HNI A;  4QVC A;  1PHT A;  1VQM T;  1G3S A;  1I07 A;  3D7S B;  3M57 A;  2AZV A;  1WHM A;  2EW3 A;  2EYX A;  5CAI A;  2EFI A;  1AVZ C;  3HFO A;  1OQK A;  1JJ2 P;  2CZ6 B;  1TUD A;  5DM7 R;  4NOY A;  3JCM J;  4FSX A;  3OBW A;  4B6M A;  3M53 A;  1OZ3 A;  4DA4 A;  1RAI B;  4J9H A;  2XK0 A;  1M2O A;  4DBR A;  3DLM A;  4C8Q B;  4LUE A;  2IVW A;  4M75 F;  1KC8 R;  2NUZ A;  3OA6 A;  3NPF A;  1OU9 A;  3LWH A;  3DB3 A;  4MDW A;  4OMM A;  3L42 A;  3CME T;  4OP0 A;  1VYT A;  4M75 D;  4ZGD B;  2RQT A;  1X27 A;  2RK1 A;  4F7U F;  1XJW B;  5FLX E;  2KT8 A;  2DEU A;  3PGG A;  2BZX A;  2M0O A;  3CBO A;  4LDX A;  5FWB A;  1I81 A;  1GFD A;  3CCQ A;  4DBH A;  4RTY A;  5KYY B;  5IHK A;  2XID A;  5GAM f;  2VGN A;  4ME7 A;  4C5E A;  5GAM d;  1W2B A;  3TSZ A;  2K3B A;  1YIT A;  1TH7 A;  2D6F A;  1C1A A;  2JNG A;  2DXU A;  1Q82 U;  2VYT A;  2KVQ G;  4DBF A;  3S6W A;  3OW2 P;  2LNV A;  1WQ7 A;  2RH2 A;  5GJV B;  1VQL T;  2OAU A;  3ME9 A;  2ED1 A;  1BU1 A;  2FPE A;  3V8J A;  3GLX A;  1WIE A;  2AKL A;  4L59 A;  1Q86 U;  9ATC B;  4II1 A;  4BI8 B;  2OTJ Q;  1IRX A;  2LJ1 A;  4EPC A;  1VIF A;  3GIB A;  1OV3 A;  4RKU E;  3CCU A;  1IRE B;  1VQ5 Q;  4CC4 B;  4MZM A;  3CCE T;  1Q81 U;  1KQS S;  5I11 A;  3TU4 K;  3I9Q A;  4CC2 A;  1UHF A;  1QP2 A;  2LVM A;  3DLL A;  2HQE A;  5LJ3 j;  4N4I A;  5DY9 A;  2C0O A;  1T0H A;  4XTW A;  3CCJ Q;  3RR6 A;  3I55 A;  4M75 A;  3MP1 A;  3CC2 T;  2F5K A;  2XIC A;  3CPF A;  1EIF A;  1VQ6 T;  3J7A F;  4RTU A;  1VQ8 A;  1R0C B;  3VS2 A;  3M58 A;  4F7U A;  1BI1 A;  5FRN A;  1KD1 C;  2E1H A;  3GNF B;  4KT0 E;  2HBP A;  2X3X D;  2FRW A;  3CCV Q;  2PU9 B;  4RTZ A;  5GAN 8;  3P8D A;  1E7O A;  3SD4 A;  3JCM c;  1YHQ Q;  4L5G A;  3JCM P;  3VYH B;  1VQO Q;  3A5Z B;  4F04 B;  4E7K A;  4JUV A;  2L3S A;  4IUR A;  1YJ9 A;  2AKK A;  2VAS A;  2DL7 A;  1NJI R;  2QTV A;  1M30 A;  2LTO A;  2LT1 A;  3QDR B;  5EC7 A;  2RNA A;  4PLL A;  3VUZ A;  3DKM A;  1UE9 A;  2VXF A;  1UG1 A;  1YJW A;  5IN1 A;  4MDX A;  2M51 A;  3QUI A;  3M5A A;  1HSQ A;  5CVI A;  3VKI A;  3MP8 A;  1X6B A;  4K11 A;  1XOV A;  2QYZ A;  1WNL A;  2OTL A;  1DJ7 B;  2O4X A;  5GMK m;  1Y07 A;  2D0N A;  3M0P A;  5LJ5 g;  1ZBJ A;  4PJO D;  2LQN A;  2VGM A;  4MZP A;  1NLP C;  1B34 A;  1ZSZ C;  2EQI A;  2H8H A;  4HA8 A;  5GAN g;  4PFO A;  1JXM A;  1G8X A;  1G2B A;  2L89 A;  2ENM A;  2X4X A;  4OMN A;  4JJD A;  6AT1 B;  2QI2 A;  2Y90 A;  4IUU A;  2HZY A;  4QVZ A;  2KI7 A;  1KJW A;  2D8J A;  3FRN A;  2QEX T;  2BIV A;  1CKB A;  4OGC A;  4C0D C;  2PUO B;  3CXC P;  3M0Q A;  3DB4 A;  4Q5W A;  4BI3 A;  1UJY A;  2DL4 A;  3CCM A;  3MCA B;  2CSI A;  2RQU A;  1VQP T;  1SF9 A;  1KG1 A;  2CP2 A;  1BKB A;  2A37 A;  2RI2 A;  5CKE A;  1Q7Y R;  2E6N A;  3QG1 A;  4RUG A;  1MHN A;  5CK9 A;  3ZFJ A;  1K0S A;  1ZA2 B;  4PJO A;  1VQN T;  2A28 A;  1VQ7 T;  2JTM A;  2G3R A;  2X51 A;  1WJR A;  3LYI A;  1VQ5 T;  3BDU A;  1AWX A;  4HCK A;  4BE1 A;  2RHY A;  4XTV A;  1K8A C;  1MV0 B;  2YSQ A;  3TSW A;  1HXD A;  1T0J A;  1WXB A;  3L2R A;  1ACM B;  2MYS A;  2O9S A;  1M5Q 1;  3P8H A;  2DX1 A;  3JB9 F;  3CMA Q;  1KC8 U;  3CCJ T;  1D1A A;  1M1K R;  1MNE A;  2M02 A;  2JOY A;  1S72 Q;  3EH2 A;  3OYC A;  2QXF A;  5I2M A;  3BW1 A;  1ZA1 B;  4M75 B;  2HEQ A;  1K9M R;  3HPW A;  3H0H A;  1TSF A;  1W2B S;  3CCV T;  1VQ4 T;  2DJZ A;  3I56 T;  4FYY B;  2HL3 A;  1IXD A;  4F7U B;  4M77 D;  2CGH A;  2RJE A;  1K73 R;  4MML A;  1Q81 C;  3O5Z A;  3M0S A;  2BZ8 A;  1T3L A;  3KBG A;  3CC7 A;  2KEA A;  4XU2 A;  4PLI A;  2X4W A;  4OGE A;  3S3M A;  1V1C A;  5FU6 C;  2CUB A;  3VS5 A;  3L2U A;  1WX6 A;  2BUD A;  3GBQ A;  3I35 A;  4FU6 A;  4EMK C;  1A0N B;  2RJF A;  2GF7 A;  2ZGW A;  3H9N A;  1NYG A;  2EQK A;  1S1N A;  2YUP A;  2LCL A;  1YIJ Q;  1G83 A;  3OYK A;  4OMF B;  3RKY A;  2JUF A;  2B86 A;  2R58 A;  2K5L A;  1ABO A;  3X26 B;  1BB9 A;  3URG A;  2M0Y A;  2YRV A;  2RK2 A;  1JU5 C;  3CCL A;  2DXB A;  2O4X B;  1M90 C;  1X01 A;  4EMH A;  2LMJ A;  1KFZ A;  2QAZ A;  2GFU A;  2NUT A;  4ORZ A;  1B34 B;  2P0P A;  1RAG B;  3UAT A;  4C5I A;  2JZ2 A;  2MI6 A;  4GLM A;  3VS1 A;  2EQU A;  1IGQ A;  2CYZ B;  1SHF A;  4A4F A;  1BYM A;  2E5K A;  3H0I A;  2KRM A;  1GFC A;  1AD5 A;  4J6X A;  2GGR A;  1EX4 A;  2LQW A;  4PNO A;  4MMK A;  3OYH A;  1I4K 1;  4B9X A;  5I2S A;  2QGF B;  5D6W A;  2V8K A;  5LJ5 j;  1PKS A;  3PIO A;  1VQM Q;  3CD6 T;  2QQA A;  4KGZ B;  1Q86 R;  2K5F A;  5GMK l;  1IZ6 A;  4XTX A;  2HSP A;  3SWN B;  1YHQ A;  3M4G A;  3A8O B;  5IXB A;  1VQO A;  1M2V B;  5GAN j;  3PT9 A;  5GAO r;  1FMK A;  5CKB A;  5KYU A;  2CP6 A;  1TOV A;  4KBM B;  1WHL A;  2M9U A;  4M7D C;  4OMQ A;  1UUE A;  1N9S A;  1OYX A;  3SFM A;  1N6A A;  3J81 E;  1PRM C;  3ASK A;  3QZ9 B;  3TCJ A;  2CP0 A;  3X24 B;  3CME Q;  4HVU A;  4AG1 C;  2CUD A;  1YI2 Q;  1G3Y A;  4N0A C;  3PMI A;  1SSF A;  3CMA T;  1M27 C;  5A0L A;  4KGV B;  2W0Z A;  5GAO m;  2CSQ A;  4AMC A;  1WDX A;  2EJF A;  2XI9 A;  2KMT A;  4R0K A;  2P4T A;  3C94 A;  2EWN A;  1GL5 A;  2ROL A;  5AYF A;  2DBK A;  4QQD A;  3FIF A;  3G1J A;  4C0Z A;  1YCS B;  1Q95 G;  2DM1 A;  3OYN A;  2RI3 A;  4ZTF A;  1WXU A;  2ZPE B;  5J3B A;  2MWP A;  2DXC A;  1AZG B;  4GBQ A;  3OYF A;  2DD5 A;  7AT1 B;  3CBP A;  1KHC A;  3EFS A;  2EQM A;  2Y4Y A;  5IHI A;  1ZUK A;  3QJ6 A;  2JT4 A;  1WPY A;  1YCY A;  5IH2 A;  4FL6 A;  3A8L B;  4M75 E;  1PG5 B;  1JJ2 A;  5KYX A;  3CCE Q;  4PJL A;  1CKA A;  4XU1 A;  4IUT A;  3RBB B;  3G71 A;  1TUC A;  3FJP A;  3RMS A;  1WQW A;  3MO8 A;  2YUO A;  2EGA A;  5CCA A;  3A1P A;  4WCI A;  2K7A A;  4E7H A;  3CC2 Q;  4A63 B;  1QW1 A;  1KSW A;  1O9S A;  3L2W A;  1VQ6 Q;  3CPW P;  3H6Z A;  2FEI A;  4LDW A;  4AFZ C;  3VRZ A;  1QKW A;  4DQ2 A;  1MMD A;  2DL8 A;  1QWE A;  1YJN T;  1VYV A;  2GQV A;  2JTF A;  2VC8 A;  3G7Z A;  1VQK A;  4IUV A;  3JCM W;  2HKN A;  5FU7 C;  2JXB A;  2H3J A;  4JZ3 A;  4BY6 C;  1WHH A;  3V7C A;  1K9M U;  2DLP A;  2LCS A;  4IUP A;  4OB1 B;  1VIE A;  2NUT B;  3OW2 A;  4J9G A;  2BZY A;  2X4Y A;  2OJ2 A;  1S72 A;  1V29 B;  1UB4 A;  1TWB A;  1K73 U;  2PVG B;  3EGD B;  4M7D G;  2K5I A;  1D0Y A;  3RMQ A;  4IIO A;  2NLU A;  2QQB A;  3QKJ A;  4ZN1 A;  3JB9 I;  1I8F A;  2EBP A;  1RI9 A;  3NTI A;  4CC3 A;  1RUW A;  1UGR B;  4PK4 A;  2J05 A;  2NUP A;  3OY9 A;  2QG9 B;  2KK4 A;  5A0D A;  3H8Z A;  1QKX A;  2ESW A;  3JB9 H;  3VYG A;  1ZSZ A;  3V8K A;  4KUI A;  2VV5 A;  1QLY A;  3FEO A;  1RAH B;  3CEY A;  3BY7 A;  1W4S A;  4IIM A;  1FXX A;  4F16 A;  2KNB B;  4E6R A;  4L6V 5;  2V8J A;  5KYU B;  2BE9 B;  3RDV A;  1BIA A;  1YI2 T;  1D0X A;  1I5L A;  3QO3 A;  1OI1 A;  1PRL C;  4PJJ A;  4WF2 A;  1YIJ A;  5KCO A;  1SKU B;  2KE9 A;  2LQK A;  4X9C A;  5LJ5 h;  2QEX Q;  1NJI C;  4O6J A;  3CCR A;  3PVQ A;  3EAE A;  2CP3 A;  1M8V A;  4PKC C;  2MCN A;  3X28 B;  4PJO E;  2O01 E;  5GAN h;  1VQP Q;  3M0R A;  1MUZ A;  2RQR A;  2L2P A;  5CR2 A;  1YBY A;  2DFU A;  2F2W A;  2KQW A;  3MJX A;  1YJW T;  2YLB A;  5LJ5 e;  2K4Y A;  2QQ9 A;  4RTW A;  5D6Y A;  1VQN Q;  2YXY A;  1VQ7 Q;  2WAC A;  3GOX A;  2KRN A;  2EYY A;  2YT6 A;  2ROT A;  1QVF P;  1SSH A;  5GJW B;  2RQV A;  1J3T A;  5GAN e;  1AZE A;  1MMG A;  3OMG A;  2DF6 A;  5HCK A;  2L3P A;  1UEB A;  4J9I A;  4PJM A;  1BI2 A;  1JXO A;  2EIF A;  1VQM A;  2E41 A;  2DZC A;  5GAO l;  3L2Q A;  1M1G A;  3HKS A;  1KHI A;  3QBY A;  1SEM A;  2FZG B;  2PZ1 A;  2CP7 A;  1UEC A;  2O2O A;  1JEG A;  1ZSG A;  3OS2 A;  4M77 G;  3E1S A;  5I21 A;  1FMW A;  1W1F A;  4FYV B;  3UF4 A;  1HJD A;  2EAY A;  4E47 A;  1N8R C;  2O31 A;  4LN2 A;  4RCC A;  5CQX A;  1VQ4 Q;  4M78 C;  4XTZ A;  3I56 Q;  1MND A;  1VUB A;  1K4U S;  2L3R A;  4OML A;  3CXC A;  1Y71 A;  3CME A;  1QWF A;  2RHX A;  5GAM j;  2I0N A;  3NFC A;  4JRI A;  2LX7 A;  1Q7Y C;  3KXT A;  3NMZ C;  1YN8 A;  3JCM g;  3QZ5 B;  1NPR A;  2YRD A;  2NYS A;  3OYM A;  4PFZ A;  1JJ2 S;  2KXC A;  3ULR B;  4ELY C;  1G3T A;  1UGP B;  2XDD A;  4HCC A;  2P0K A;  3VU3 C;  1IB8 A;  1GBQ A;  2E3H A;  3E2U A;  4PJO F;  1I5O B;  1Y7X A;  2DRK A;  3NGP A;  4M7A C;  1M1K C;  1VQL A;  1XQH A;  4M7D D;  3SB2 A;  2DA9 A;  2G6F X;  2LT4 A;  4M77 E;  2QQS A;  3M59 A;  4D6W A;  2ED0 A;  2ZPI B;  2KR3 A;  1D3B A;  2FZC B;  1OPL A;  5KYW A;  3MEU A;  1WHG A;  2RPN A;  4LD9 K;  3CCE A;  2MK5 A;  4X34 A;  2GQI A;  2A3L A;  1ZSZ B;  3MP6 A;  4FIB A;  4MZT A;  5GMK h;  2E5Q A;  1ZUU A;  2DVJ A;  3OYE A;  1PKT A;  1VQ9 Q;  4J9D A;  3INZ A;  2RD1 A;  3CCS T;  4FW1 A;  4BAC A;  1QQJ A;  3CC2 A;  5IAY A;  1X6O A;  1IO6 A;  1U1S A;  2FZK B;  5A2Q E;  1VQ6 A;  3VV0 A;  2GTJ A;  1BIB A;  1IHW A;  2YUQ A;  3LGL A;  3LWI A;  1UDL A;  2OI3 A;  4C92 C;  3CD6 Q;  2I2L A;  5GMK e;  4RG8 A;  2DVE A;  5A0G A;  4A54 A;  2X4J A;  1GCQ C;  2IPO B;  2CH4 W;  4FYW B;  3TRE A;  1W6X A;  2EPD A;  2FRY A;  2K2M A;  4OF1 A;  3L2Z A;  3HHT B;  1WYX A;  1NM7 A;  1WJS A;  3QYG B;  3JCM b;  4CRI A;  2BKD N;  3OYA A;  5C6S A;  2P84 A;  1YFN A;  1K76 A;  4E7S A;  2COY A;  1TTH B;  2DZ9 A;  4D8D A;  3LH0 A;  2VVK A;  1PSF A;  4M78 G;  2E6Z A;  5GAN 7;  2C06 A;  4E7Z A;  3I5S A;  3G6E Q;  1FWZ A;  2EVR A;  4Z89 A;  3JRZ A;  2GNC A;  1WZO A;  1Q82 C;  1E6G A;  1RLP C;  2R5M A;  2DNU A;  3OYY A;  4M77 F;  4QW2 A;  4IKF A;  2QGG A;  1Y0M A;  2D8H A;  4AFU C;  2LQ8 A;  4KUD K;  1Q86 C;  4BDZ A;  3ER0 A;  2FHD A;  4NS5 A;  3IQL A;  4DBQ A;  1KK7 A;  1QMC A;  3G4S T;  3CC4 T;  2A0F B;  4RTT A;  3QII A;  2JS2 A;  2K3Y A;  2MWO A;  2PVO B;  3PFS A;  1NE8 A;  1C0M A;  2DE0 X;  4ATO A;  1TS9 A;  3OQ5 A;  2FYK A;  5CKH A;  4ZN3 A;  3EHQ A;  1QVG P;  4M7A G;  2MF2 A;  1SPK A;  3UA7 A;  2CH4 A;  2P4R A;  4OB3 B;  5LJ3 h;  2QEX A;  1X75 C;  1GXI E;  1BBZ A;  1O75 A;  3M54 A;  4DEX A;  4XU3 A;  4NL2 A;  2F5T X;  2VWF A;  1M1F A;  1NEB A;  1UGS B;  3PMT A;  4BD3 A;  1WI7 A;  4M4Z A;  4N4H A;  3V7R A;  5LJ5 f;  2ZPG B;  4AT1 B;  5LJ5 d;  3FJ5 A;  1VQP A;  4Z88 A;  4XK8 E;  1W70 A;  4M78 E;  5CIU A;  2DAQ A;  3QHS A;  2KY9 A;  3FLG A;  4JDS A;  2R57 A;  5GAO n;  4FW2 A;  2ZAE A;  2EQJ A;  4EDU A;  5LJ3 e;  5GAN f;  2COZ A;  5GAN d;  1YJN Q;  2PQW A;  1VQN A;  2JW4 A;  3QSU A;  2OTJ A;  1VQ7 A;  1WHJ A;  4WTO B;  2IIM A;  1VQ5 A;  2CS7 A;  2CDT A;  1N5Z A;  2E4H A;  3CCQ Q;  1IGU A;  1LVK A;  3BE3 A;  2XDB A;  4C92 G;  1RAA B;  1X43 A;  2M1H A;  5KH6 A;  3CXC S;  4M77 A;  3HL8 A;  1OOT A;  4QQ6 A;  5KYW B;  1PD1 A;  4A4G A;  4LD6 A;  2B8A A;  2RO0 A;  3CCJ A;  1YIT Q;  1VQ9 T;  1N27 A;  4EIK A;  4E7I A;  1K8A R;  4QVD A;  2O88 A;  5M9O A;  5J39 A;  2DL3 A;  2CT3 A;  3QYH B;  2KXD A;  5CKD A;  2COW A;  3HSB A;  2CRE A;  2YHT A;  2Z0W A;  2RQW A;  3REA B;  3X20 B;  1PC0 A;  1ZBX A;  3CCV A;  3CCU Q;  4HKE A;  3I56 A;  4LE9 A;  1U8R A;  2KRO A;  3A8H B;  3SWN C;  2CZ1 B;  1BI0 A;  4OB2 B;  1NPP A;  4J8O A;  3FDR A;  5FWC A;  2V1R A;  2D9T A;  1SG5 A;  4C5G A;  3CPW A;  2RM4 A;  3OS0 A;  2YRC A;  2EYW A;  2DEQ A;  1LJO A;  1RAD B;  3NTK A;  1U3O A;  2EYQ A;  2VUB A;  2VXE A;  3LGF A;  1FYN A;  1BCM A;  4PJO B;  1SRM A;  1R77 A;  4J9B A;  1SRL A;  3QXE B;  1YWP A;  1BCO A;  2YLC A;  3VS7 A;  3G6E T;  3PE0 A;  1WFW A;  4M78 F;  4JJC A;  4BE0 A;  2NWM A;  4OVA A;  1OUL A;  3EHR A;  1QVP A;  5KYY A;  1QCN A;  4A4K A;  4M78 D;  2QA4 T;  5GAN 2;  5DLQ E;  1YJ9 Q;  2RF0 A;  2JTE A;  5GAO q;  4OMP A;  2KYM A;  2A08 A;  4ZNX A;  2GTO A;  3CBM A;  1AWJ A;  1YJW Q;  3C4S A;  4V2S A;  3V7S A;  2QK0 A;  5KCH A;  4UC4 A;  1PCX A;  3LW5 E;  5CKF A;  1PM3 A;  2J6K A;  2GBQ A;  2EJ9 A;  4DOW A;  4BI4 A;  5HK3 A;  2LDM A;  3M4Y A;  5GAM g;  2RI5 A;  4HCZ A;  4RCB A;  2L8D A;  2K6D A;  1KC8 C;  1UGV A;  1KD1 U;  4XTY A;  4M7A F;  4KGX B;  2DBM A;  4OMO A;  1T3S A;  3CD6 A;  4J7I A;  2LCC A;  2L5Q A;  4M7A D;  1K0X A;  1HK9 A;  1VYU A;  1V76 A;  2E3I A;  2HD0 A;  4GLK A;  5L23 A;  4F14 A;  5IXF A;  2JVV A;  3EGX A;  2E12 A;  4J83 A;  1YP5 A;  2SRC A;  3RER A;  3CQT A;  2E70 A;  3RKX A;  4JZ4 A;  3PNW C;  3FC3 A;  4JS5 A;  1QP3 A;  1ABQ A;  2DK3 A;  1ARK A;  4M78 A;  2QQR A;  2XKO C;  4HT8 A;  3CCQ T;  4J6W A;  2K79 A;  3QWX X;  2D1X A;  1KQS P;  3M0T A;  3MHX A;  4AFS C;  3TQ7 P;  1D09 B;  3CMA A;  2HBW A;  4C92 F;  1YIT T;  3T9N A;  5FU7 B;  3E9G A;  3OSS C;  2F69 A;  4ESR A;  3NHN A;  4ELZ C;  1RAC B;  5AT1 B;  4XU0 A;  4F17 A;  1G3W A;  1BK2 A;  1RAE B;  4J6Y A;  3I5R A;  4C92 D;  1UTI A;  2EYZ A;  4M77 B;  2J7I A;  2RJD A;  3AHU A;  4QT7 A;  1QVF A;  4JRP A;  5CQY A;  1TXQ A;  3OYJ A;  3S3N A;  2W10 A;  2EKH A;  3CCU T;  3LLR A;  2E64 A;  4FCY A;  4M7A A;  4AFQ C;  4FT2 A;  1Z9Q A;  3U23 A;  3JCM V;  1I1J A;  4GY5 A;  5FRM A;  1WLP B;  2EGE A;  2BE7 D;  3MEA A;  2Y4X A;  3JCM h;  1IHV A;  3I55 T;  3WVD B;  1WXT A;  3OYB A;  1X6G A;  4X1V A;  3MKD A;  4C8Q C;  4JJB A;  3RKW A;  3EFO A;  2WSF E;  1U5S A;  1VQ8 T;  2RB6 A;  1K1Z A;  4YTL A;  1AEY A;  5LJ3 f;  3RES A;  5LJ3 d;  2MOX A;  3CCS Q;  2LX9 A;  3VJP A;  1M3A A;  1JQQ A;  3JCM e;  2DMO A;  3VS0 A;  3OYL A;  3HTR A;  1TG0 A;  3Q1J A;  3M9Q A;  3ZL7 C;  2DTI A;  2H3E B;  4C5H A;  1R0B G;  2MAM A;  2LZ6 B;  4C92 A;  1YJN A;  1UJ0 A;  2ZZD A;  1YJ9 T;  4M7D E;  5KE3 A;  5J26 A;  1K8A U;  3CC7 Q;  5FW9 A;  2DIQ A;  5HKC A;  1RLQ C;  1OX9 A;  1H3H A;  4LXC A;  3N5B B;  1GCQ A;  1RAB B;  3OYG A;  5D7U A;  1Y57 A;  3JAM E;  3ZBD A;  2KSS A;  2OTL T;  1NG2 A;  1RI0 A;  4Y92 A;  2X35 A;  2ZPF B;  5ECA A;  4ZGE B;  4XTU A;  5GMK i;  2HMA A;  2HL5 C;  1AHJ B;  1UHC A;  5D6X A;  1FX7 A;  3CPW S;  4KH1 B;  3UDC A;  2CP5 A;  4R56 A;  4A53 A;  3UA6 A;  2HAX A;  1QCO A;  3CCL Q;  1U1T A;  3H0F A;  2E10 A;  2RHU A;  1C6V X;  5KYX B;  2QTX A;  4ANJ A;  1PWT A;  5DLO A;  2K2V A;  1KQ2 A;  3JSC A;  3JB9 G;  4LDU A;  1YNZ A;  3VS6 A;  4E2F B;  5KE2 A;  1Y96 A;  1GBR A;  1AWO A;  3R6N A;  4LDY A;  1B3Q A;  3EGX B;  2OAW A;  1ZQ1 A;  3EG1 A;  2DER A;  2JM9 A;  1AWW A;  1U06 A;  4IUQ A;  2DXT A;  2FPF A;  3G4S Q;  3CC4 Q;  2HKQ B;  1YI2 A;  3AT1 B;  2FL7 A;  3OS5 A;  5CO7 A;  2MMP A;  4M78 B;  3CCM T;  3C95 A;  3A98 A;  2WSC E;  1SHG A;  3V8L A;  2X3W D;  5LL6 S;  2WSE E;  4ZGJ B;  1M90 U;  2AT1 B;  1WHK A;  1OX8 A;  2DO3 A;  1H64 1;  2QDL A;  4EMK A;  1P92 A;  2J6O A;  1OZ2 A;  2A36 A;  5GAN 3;  4M7D F;  4C8Q G;  2DTH A;  2BTT A;  1W2B P;  1JB0 E;  3C0C A;  4JLG A;  3LH5 A;  1GRI A;  3VUB A;  2E65 A;  3R6O A;  1JRI A;  4BE2 A;  2RJC A;  1K9A A;  2K3X A;  1K9M C;  4M7A B;  1XNI A;  2NUP B;  1BI3 A;  4HT9 A;  2DTO A;  4C0G A;  2ABL A;  2AK5 A;  2EKO A;  2HCK A;  2JS0 A;  3HRS A;  2V1Q A;  3P8B B;  4KRT A;  3E9F A;  1D0Z A;  2PVD B;  1OEB A;  4E7J A;  1K73 C;  4LNP A;  3BDL A;  3O8V A;  2GFA A;  4LUD A;  1MMN A;  1PNJ A;  4O5V A;  2YUN A;  3EFO B;  3OW2 S;  3OSV A;  1X2Q A;  3H41 A;  4TVR A;  4DEY A;  3PIP A;  1QVG A;  2J06 A;  3GP8 A;  1NZ9 A;  2ZCF B;  4J9C A;  4P5N A;  4R55 A;  1X69 A;  3CC7 T;  1QVF S;  1UGQ B;  4HXJ A;  4JS4 A;  4VUB A;  4C8Q E;  1WGS A;  4Y91 A;  4C0D B;  1N8R R;  4C92 B;  3G71 Q;  1KD1 R;  2MIO A;  2KT1 A;  3SWN A;  3VS3 A;  1M2V A;  2RMO A;  1H92 A;  4M7D A;  2HQH A;  2DD4 A;  1VOM A;  3GNG A;  2SEM A;  8ATC B;  1TU0 B;  3TEE A;  1VA7 A;  2XG8 D;  2XU8 A;  2ZPH B;  1PD0 A;  4X9D A;  3KFV A;  4N0A A;  1M4Z A;  1ZX6 A;  3S3O A;  4RTX A;  3CCL T;  1WJQ A;  2V26 A;  4ZTJ A;  2OTJ T;  2VB6 A;  4FYX B;  2HDA A;  2QDY B;  1VQK Q;  4RG2 A;  2D0Q B;  4XAX B;  4A4H A;  2YWW A;  1AT1 B;  2RHZ A;  4JJN K;  3MEV A;  4CI0 C;  2QA4 Q;  4KUL A;  2DKG A;  4HVW A;  2KGT A;  4M75 C;  2CZ7 B;  2KDS A;  3JB9 D;  1KIK A;  1Y96 B;  4Z8A A;  4BB7 A;  3KUF A;  3JCM f;  4D8K A;  3JCM d;  4CC7 A;  4LDV A;  5EG2 A;  3L1A A;  3MEW A;  1D1C A;  2CZ0 B;  3OMC A;  2JN0 A;  3MET A;  3CCS A;  4KH0 B;  1XTD A;  1NEG A;  2FPD A;  2A7Y A;  1UFF A;  2HQX A;  1YHQ T;  4QQG A;  4RTV A;  1VQO T;  3THK A;  1MV3 A;  1JBM A;  2HSE B;  1M3B A;  1MMA A;  5HK0 A;  5FU6 B;  4Y28 E;  2C0I A;  4JLI A;  1WA7 A;  2X9H A;  2DL5 A;  2R5A A;  3JB9 J;  4C8Q F;  4EMK B;  2KYB A;  1E6H A;  4JRQ A;  4EMG A;  3RUX A;  2F1L A;  4JPB W;  1I0C A;  4C8Q D;  3VRY A;  5GAM h;  2XD0 A;  1NBE B;  5I22 A;  2LJ0 A;  4A4E A;  3JCM Q;  2JMC A;  3UT1 A;  4AG2 C;  3OBY A;  4FM4 B;  5C0M A;  3CCR Q;  2LP5 A;  2PNI A;  3EG3 A;  1G5V A;  1PSE A;  1EZZ B;  1ZUY A;  2MPX C;  1D3B B;  2ECZ A;  5GAO p;  3UWN A;  1YWO A;  4BUG A;  2AZS A;  1N9R A;  2FVU A;  3EG9 A;  5IT9 E;  5GAM e;  4M7A E;  4J7F A;  3J80 E;  2DRM A; 
#chains in the Genus database with same CATH homology
 2L3P A;  4FSS A;  1ABQ A;  1ARK A;  4J9I A;  1JXO A;  2DIL A;  2A37 A;  2K79 A;  3QWX X;  2D1X A;  1SEM A;  2PZ1 A;  3M0T A;  4AFS C;  4RUG A;  1UEC A;  2O2O A;  1JEG A;  1ZSG A;  1K0S A;  2A28 A;  2HBW A;  1W1F A;  4ESR A;  3NHN A;  3UF4 A;  1AWX A;  1HJD A;  4HCK A;  4F17 A;  1BK2 A;  2O31 A;  2XMF A;  1MV0 B;  2YSQ A;  3I5R A;  4LN2 A;  3TSW A;  1UTI A;  2EYZ A;  1T0J A;  2J7I A;  1WXB A;  2O9S A;  2C0T A;  2DX1 A;  2O9V A;  4QT7 A;  1NYF A;  2YDL A;  1K4U S;  4OML A;  1QWF A;  2KRS A;  2W10 A;  2I0N A;  2EKH A;  2LX7 A;  3NMZ C;  4AFQ C;  1Z9Q A;  1YN8 A;  1ZLM A;  3U23 A;  1I1J A;  2HEQ A;  1Z9Z A;  1X2K A;  1WLP B;  3EG0 A;  2EGE A;  2KXC A;  3ULR B;  3H0H A;  1WXT A;  1X6G A;  4X1V A;  4JJB A;  1CSK A;  2LNH B;  2EGC A;  1GBQ A;  2F2V A;  1U5S A;  1OPK A;  4J9E A;  1K1Z A;  1M3C A;  2K9G A;  2JM8 A;  1JO8 A;  2DRK A;  3NGP A;  1AEY A;  3O5Z A;  3M0S A;  2BZ8 A;  2FG0 A;  1T3L A;  1EFN A;  2KEA A;  2MOX A;  1V1C A;  3M0U A;  2CUB A;  1M3A A;  3VS5 A;  1JQQ A;  2DA9 A;  3VS4 A;  2DJQ A;  2G6F X;  2DMO A;  3VS0 A;  1TG0 A;  1WX6 A;  2ED0 A;  2KR3 A;  1H8K A;  3ZL7 C;  1LCK A;  1OPL A;  1QCF A;  3GBQ A;  3I35 A;  2RPN A;  1A0N B;  2FO0 A;  2LZ6 B;  1NYG A;  1UJ0 A;  3SEM A;  2GQI A;  1S1N A;  2YUP A;  5FW9 A;  1RLQ C;  1G83 A;  1H3H A;  1ZUU A;  2DVJ A;  1GCQ A;  1PKT A;  2PTK A;  2B86 A;  4J9D A;  1ABO A;  4HVV A;  4J9F A;  1BB9 A;  3REB B;  1Y57 A;  2M0Y A;  1JU5 C;  1IO6 A;  2LMJ A;  1KFZ A;  1NG2 A;  2GTJ A;  4Y92 A;  5ECA A;  2YUQ A;  4ORZ A;  1UDL A;  1UHC A;  2OI3 A;  1GCP A;  2LJ3 A;  3UAT A;  3UA6 A;  5IHN A;  2L3Q A;  4GLM A;  2CT4 A;  3VS1 A;  1HD3 A;  3H0F A;  1GCQ C;  1SHF A;  2CH4 W;  2RN8 A;  3EGU A;  2E5K A;  1W6X A;  2EPD A;  2KRM A;  2VKN A;  1PWT A;  2FRY A;  1GFC A;  3H0I A;  2K2M A;  1AD5 A;  3PVL A;  3JV3 A;  1YNZ A;  1WYX A;  2DYB A;  2GGR A;  3VS6 A;  1NM7 A;  2L0A A;  2LQW A;  1GBR A;  1AWO A;  3R6N A;  1PKS A;  2JMA A;  1K76 A;  1B3Q A;  2OAW A;  3SHW A;  3EG1 A;  4D8D A;  3EG2 A;  2JM9 A;  1AWW A;  1U06 A;  2VVK A;  2HSP A;  2KBT A;  1M8M A;  2FPF A;  3TVT A;  5IXB A;  1NLO C;  1FMK A;  3I5S A;  2F2X A;  2EVR A;  4Z89 A;  5HCK A;  4OMQ A;  2GNC A;  3RNJ A;  1UUE A;  3A98 A;  1B07 A;  1E6G A;  3QWY A;  1RLP C;  1SHG A;  2J6F A;  1AOJ A;  2DNU A;  2X3W D;  1PRM C;  1PHT A;  1I07 A;  2AZV A;  4HVU A;  1Y0M A;  2EW3 A;  2EYX A;  2CUD A;  2QDL A;  2D8H A;  4AFU C;  4AG1 C;  1M27 C;  2J6O A;  2A36 A;  1AVZ C;  2W0Z A;  3IQL A;  2CSQ A;  4RTT A;  2BTT A;  1WDX A;  2JS2 A;  1TUD A;  4R0K A;  4J9H A;  2DE0 X;  3C0C A;  1GL5 A;  2ROL A;  3LH5 A;  2DBK A;  1GRI A;  3EHQ A;  4LUE A;  1SPK A;  3UA7 A;  2NUZ A;  3NPF A;  1YCS B;  2CH4 A;  2P4R A;  2DM1 A;  1K9A A;  4OMM A;  1BBZ A;  4DEX A;  1WXU A;  1VYT A;  1AZG B;  4GBQ A;  2RQT A;  1X27 A;  2VWF A;  1NEB A;  2KT8 A;  1WI7 A;  4M4Z A;  5IHI A;  2ABL A;  2AK5 A;  2HCK A;  2JS0 A;  3FJ5 A;  1ZUK A;  4Z88 A;  2V1Q A;  2JT4 A;  1W70 A;  2BZX A;  4KRT A;  5FWB A;  1GFD A;  1OEB A;  4RTY A;  5IH2 A;  4LNP A;  4LUD A;  5IHK A;  1PNJ A;  2YUN A;  1CKA A;  2JW4 A;  3TSZ A;  2K3B A;  3RBB B;  1X2Q A;  3H41 A;  4DEY A;  1TUC A;  2IIM A;  2CDT A;  2YUO A;  1N5Z A;  2EGA A;  2J06 A;  4WCI A;  4J9C A;  1X69 A;  2K7A A;  5GJV B;  1X43 A;  2ED1 A;  1BU1 A;  2FPE A;  4HXJ A;  4A63 B;  1WIE A;  2AKL A;  1OOT A;  1KSW A;  2LJ1 A;  1OV3 A;  2FEI A;  4EIK A;  2MIO A;  2KT1 A;  4AFZ C;  3VS3 A;  3VRZ A;  4CC4 B;  1QKW A;  2DL8 A;  2RMO A;  1H92 A;  1QWE A;  2O88 A;  2DL3 A;  1VYV A;  5I11 A;  2CT3 A;  3I9Q A;  4CC2 A;  1UHF A;  2SEM A;  2KXD A;  1VA7 A;  2CRE A;  2C0O A;  1T0H A;  2JXB A;  4JZ3 A;  3KFV A;  2RQW A;  3REA B;  2DLP A;  2LCS A;  1ZX6 A;  4RTX A;  4LE9 A;  4J9G A;  2KRO A;  2HDA A;  2BZY A;  4RTU A;  3VS2 A;  2OJ2 A;  5FWC A;  2V1R A;  2X3X D;  2FRW A;  2EYW A;  4RTZ A;  4IIO A;  1E7O A;  4HVW A;  1U3O A;  2KGT A;  2EBP A;  1FYN A;  1RI9 A;  1SRM A;  4CC3 A;  4J9B A;  1RUW A;  1SRL A;  1KIK A;  2L3S A;  1YWP A;  4Z8A A;  2AKK A;  2DL7 A;  2J05 A;  1M30 A;  4D8K A;  5EC7 A;  3VS7 A;  1QKX A;  2ESW A;  2RNA A;  1WFW A;  3PE0 A;  4CC7 A;  4JJC A;  1UE9 A;  1UG1 A;  2M51 A;  2NWM A;  1HSQ A;  1QLY A;  1X6B A;  4K11 A;  1NEG A;  2FPD A;  1XOV A;  3EHR A;  4IIM A;  4F16 A;  2KNB B;  1UFF A;  4E6R A;  2RF0 A;  2JTE A;  4RTV A;  4OMP A;  3THK A;  1MV3 A;  2A08 A;  2KYM A;  4ZNX A;  2GTO A;  1M3B A;  2D0N A;  3M0P A;  1PRL C;  1AWJ A;  1ZBJ A;  2C0I A;  2LQN A;  1NLP C;  1WA7 A;  2DL5 A;  2KE9 A;  2J6K A;  2GBQ A;  2EQI A;  2KYB A;  1E6H A;  2H8H A;  3PVQ A;  1JXM A;  2MCN A;  1G2B A;  4JPB W;  2K6D A;  1I0C A;  1UGV A;  3VRY A;  2ENM A;  5I22 A;  2LJ0 A;  2DBM A;  3M0R A;  1MUZ A;  2RQR A;  4OMO A;  2JMC A;  4JJD A;  4OMN A;  2L2P A;  4AG2 C;  1T3S A;  2F2W A;  2LP5 A;  2PNI A;  3EG3 A;  1K0X A;  1VYU A;  1KJW A;  2D8J A;  5L23 A;  1ZUY A;  4F14 A;  5IXF A;  4RTW A;  2ECZ A;  1CKB A;  2KRN A;  1YWO A;  2EYY A;  2YT6 A;  1YP5 A;  2ROT A;  1SSH A;  2AZS A;  2SRC A;  3CQT A;  5GJW B;  2RQV A;  3M0Q A;  1J3T A;  1UJY A;  1AZE A;  4JZ4 A;  2DL4 A;  2CSI A;  2RQU A;  2DRM A;  2DF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...