2DA9A

Solution structure of the third sh3 domain of sh3-domain kinase binding protein 1 (regulator of ubiquitous kinase, ruk)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-domain kinase binding protein 1
publication title Solution structure of the third SH3 domain of SH3-domain kinase binding protein 1 (Regulator of ubiquitous kinase, Ruk)
rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2da9A00
2B86A 2E5KA 2M51A 2H8HA 1ZSGA 4R0KA 2FEIA 1I07A 4JJCA 4M4ZA 2D8JA 4Z88A 2O2OA 2CT4A 2AZVA 3REAB 1UG1A 1N5ZA 1QLYA 1JO8A 2AKKA 3C0CA 1PNJA 2KT1A 2SEMA 3PVLA 1M3CA 2CH4A 2L2PA 1K1ZA 1T0JA 4OMNA 3H41A 1AZGB 1JQQA 1MV0B 3VS7A 1E7OA 1V1CA 3EG0A 1WX6A 1NEBA 1X2KA 3UA6A 1W70A 2FRYA 3ZL7C 1T3SA 1AVZC 2RN8A 2K2MA 1WIEA 2EGCA 1HJDA 1GCPA 4J9IA 3TVTA 4AFSC 2PTKA 5IHNA 5EC7A 1VYVA 1UHCA 3KFVA 4HVVA 2DM1A 4K11A 1RI9A 4RTZA 1PKTA 2DL7A 2KT8A 1K4US 2CDTA 1TUCA 1A0NB 4IIMA 1CKBA 1OOTA 2JT4A 4RTWA 4HXJA 2EBPA 1GL5A 2C0TA 2L0AA 2FPEA 4OMPA 1AEYA 2C0IA 1EFNA 2EYYA 2DF6A 2KYBA 1LCKA 1QKWA 1CKAA 1IO6A 1HD3A 2PNIA 2J6KA 1ABOA 5FWBA 1SRLA 2RF0A 2O9SA 4RUGA 2DMOA 1UE9A 1WDXA 2HEQA 2C0OA 2GNCA 2J05A 4AFQC 2VVKA 3I5RA 1X69A 3VS4A 4HCKA 1TUDA 2EGEA 4J9FA 3VRYA 2LJ0A 3SEMA 1YCSB 2DJQA 1K76A 1NM7A 2JMAA 4E6RA 5I22A 1AD5A 2DNUA 3VRZA 1XOVA 2LQWA 2DL4A 2JTEA 2L3SA 2O31A 2KXCA 2GTJA 1AWXA 4JZ4A 2KRSA 1M30A 1RUWA 2J6FA 2J7IA 5L23A 2JM8A 1BB9A 2HSPA 3VS0A 3LH5A 2FPFA 2OJ2A 1JEGA 2AZSA 1KIKA 5IXBA 2P4RA 3RBBB 2LP5A 5IXFA 4KRTA 2O9VA 1ARKA 1JU5C 2KXDA 5IHKA 1PWTA 2YSQA 1OV3A 1M3BA 4RTYA 1AWWA 2KYMA 2K79A 1NLPC 4D8KA 2EYWA 1CSKA 2GTOA 1WXBA 4EIKA 1GCQC 2V1QA 1X6BA 4J9DA 1UFFA 1QWFA 4Z8AA 4OMOA 1I1JA 1G83A 3A98A 1UJYA 3M0RA 4J9HA 3GBQA 1W6XA 3EHRA 2EVRA 3VS5A 1SPKA 2XMFA 1GRIA 3SHWA 1B3QA 1WFWA 4F16A 1S1NA 1AWJA 1YP5A 1GCQA 2RQUA 5IHIA 2V1RA 1ZUYA 1SHGA 1QWEA 2F2XA 5ECAA 4Z89A 1GFDA 2DRMA 1SHFA 1WI7A 3I5SA 2F2VA 1J3TA 2GGRA 1HSQA 3M0PA 2A28A 1NLOC 2KROA 3TSWA 2FRWA 1PHTA 1G2BA 3THKA 1Y0MA 1H8KA 2LJ3A 1YWPA 2BZ8A 4X1VA 1MUZA 4LUEA 1E6HA 2D0NA 2A36A 3JV3A 4LUDA 1X27A 3EG1A 3NHNA 2RMOA 2RQTA 2JS0A 2DRKA 2FG0A 2M0YA 1T0HA 2EKHA 4OMLA 1SEMA 4ESRA 1ABQA 3U23A 2NUZA 2ED1A 2K7AA 1YWOA 2LMJA 2A37A 2DLPA 1BK2A 3EHQA 4CC2A 3NPFA 2CUDA 2JS2A 1W1FA 2OI3A 3VS1A 3QWYA 2CUBA 2RQWA 1AZEA 1GBRA 1JXMA 2RQVA 2RNAA 2L3PA 1ZBJA 2HDAA 3TSZA 1OPLA 2ENMA 2EYZA 2KBTA 1PRLC 1BBZA 4ORZA 2RPNA 2KRNA 2W0ZA 4FSSA 2K3BA 4RTVA 1BU1A 1PKSA 1MV3A 2YT6A 1QKXA 2PZ1A 3NGPA 2CSQA 1X43A 2DVJA 4AFZC 2MOXA 1PRMC 2G6FX 3EG3A 3ULRB 2CSIA 4OMMA 2BTTA 4F14A 2DILA 2LNHB 2OAWA 2X3XD 1AOJA 2KEAA 4JZ3A 5FW9A 2KGTA 2K6DA 2YUQA 1RLQC 4A63B 3RNJA 2BZYA 2FO0A 1K0SA 2DL8A 1H3HA 3UF4A 2ESWA 4AFUC 2NWMA 1KFZA 2KR3A 1U06A 1GFCA 2DX1A 2DE0X 3M0QA 1VYTA 2J06A 4F17A 1UJ0A 2YUNA 2FPDA 2J6OA 1QCFA 2L3QA 3I9QA 2MCNA 1FMKA 4J9EA 3NMZC 4JJBA 4WCIA 2LX7A 4CC4B 2DYBA 3VS3A 2VWFA 1M27C 1M3AA 2ABLA 1NEGA 1SRMA 1AWOA 2RQRA 2VKNA 2W10A 1K0XA 3M0TA 1Y57A 2DBMA 1OPKA 1WYXA 5IH2A 1K9AA 2JXBA 2DL5A 3CQTA 2CH4W 2D1XA 3O5ZA 5I11A 4RTTA 4HVWA 3REBB 1Z9QA 2ED0A 2ROTA 2LQNA 4LE9A 1NYFA 2EYXA 1U3OA 1X2QA 1ZUKA 5GJVB 2A08A 2LZ6B 4J9CA 4Y92A 2I0NA 2YUOA 4CC3A 4J9GA 2AKLA 3IQLA 2EGAA 1UDLA 4JJDA 3UA7A 4IIOA 1ZX6A 2X3WD 2DBKA 4JPBW 2HBWA 4OMQA 2EW3A 1OEBA 3PVQA 3EGUA 3H0IA 3VS2A 1VA7A 1H92A 2KE9A 4D8DA 1YNZA 2MIOA 1WXUA 2YDLA 1UECA 4LN2A 2D8HA 1TG0A 3M0SA 4RTXA 1UHFA 2QDLA 1JXOA 2JMCA 2GBQA 5GJWB 2CT3A 4QT7A 3EG2A 1UTIA 2EQIA 4GBQA 1UUEA 1ZLMA 2JW4A 4CC7A 1KSWA 1SSHA 1Z9ZA 1WA7A 1M8MA 2KRMA 3I35A 3VS6A 1WXTA 2CREA 3H0HA 2K9GA 5FWCA 2F2WA 4J9BA 4DEXA 2KNBB 3QWXX 2DA9A 1U5SA 1X6GA 3FJ5A 3R6NA 2EPDA 4AG2C 1NYGA 2AK5A 2ROLA 1NG2A 1ZUUA 1YN8A 5HCKA 4GLMA 1B07A 1UGVA 2ECZA 4HVUA 3UATA 2JM9A 4DEYA 1GBQA 4RTUA 2LJ1A 1E6GA 3M0UA 1I0CA 1T3LA 1VYUA 2HCKA 3PE0A 2O88A 2GQIA 4LNPA 1KJWA 2IIMA 2SRCA 2LCSA 1RLPC 1WLPB 4AG1C 2DL3A 3H0FA 4ZNXA 2YUPA 2BZXA 1FYNA
chains in the Genus database with same CATH superfamily
2K4YA 4J83A 3M54A 2B86A 1BIBA 3QZ5B 2HL3A 2HQXA 2D8JA 4Q5WA 4Z88A 1VQLQ 1VQ9Q 4D6WA 1JO8A 2AKKA 2DVEA 1PNJA 3JCMX 3FLGA 3GLXA 2MPXC 1YCYA 3JCMb 1RL2A 3X24B 4E7LA 1KQSA 1T0JA 1Q95G 2JTFA 4OMNA 3H41A 1AHJB 1JQQA 1MV0B 2DJZA 3M5AA 3FRNA 2ATCB 2MAMA 2IG0A 1V1CA 4A4HA 3MKDA 1KK7A 3SB2A 1W70A 2GFUA 3ZL7C 3JCMh 2RN8A 3CC2Q 3GP8A 3CMAA 1GCPA 3M9QA 3TVTA 1WHLA 4HKEA 3L1AA 2EFIA 5EC7A 1VYVA 1LJOA 2XHCA 1UHCA 4K11A 2PVGB 3CD6Q 1K4US 4F7UE 1TUCA 3E9GA 5CIUA 1CKBA 2EJ9A 3RKXA 3JCMd 3NTKA 2Y4YA 4HXJA 1GL5A 1K73R 2L0AA 5KCHA 3P8DA 4BI4A 1VQLA 2XIDA 2EIFA 1VQ9A 1K73C 1QKWA 1OX8A 1OI1A 4J5YA 5A2QE 1SKUB 3TCJA 2HZYA 1VQMQ 3CCMQ 1HD3A 3WXMB 5CQYA 3EG9A 2O9SA 3HTRA 1WDXA 1LVKA 5J3BA 1NPPA 2P0KA 2XI9A 4EMKA 1MMAA 2C0OA 2GNCA 3X28B 4AFQC 4PJOB 1X69A 2V8JA 5FU6B 1TUDA 1QMCA 3E9FA 5CK9A 3SEMA 1JJ2A 4LXCA 2KI7A 1K76A 4M77G 2OTLA 2A0FB 1NPRA 4E6RA 5I22A 2JTEA 3X20B 2DYIA 2M02A 2L3SA 4BI3A 2KXCA 3A8LB 8ATCB 1VQ4Q 4C8QG 5LJ3h 4JZ4A 1VQ8Q 3LW5E 1Q82U 2J6FA 1P92A 3VS0A 3LH5A 4M77A 2FPFA 4LDVA 3EGDB 1B34B 2YWWA 2LP5A 2DETA 3X25B 2KXDA 3CC4Q 4RKUE 2PVOB 3E1SA 3ER0A 3PMIA 2K79A 3JB9F 3G4SA 4FU6A 4C5HA 3KUFA 2RM4A 4D8KA 3G6EQ 3CCMA 1VQMA 2GCXA 3RKYA 1WXBA 3QJ6A 1GCQC 3OMCA 3QYHB 4Z8AA 1PD0A 1SSFA 1WHKA 4BDYA 1UJYA 3CMEQ 2ZZDA 2EQKA 1W6XA 3EHRA 4OVAA 4C92C 2QK0A 3VS5A 3A1PA 1Q7YU 4QW2A 4IUUA 3SHWA 4A4FA 1V76A 3ZFJA 4PJJA 2O01E 2VASA 1WHJA 2QQ9A 2RQUA 3QDRB 4OB3B 5M9OA 3FIFA 3A8GB 3OS5A 3RUXA 1G5VA 1VQ4A 1QWEA 2F2XA 4II1A 3PIPA 4Z89A 1M1FA 1GFDA 3AHUA 1H641 1QP2A 1M1KU 5D6XA 1HYOA 1J3TA 4XQ3A 2CZ6B 1HSQA 2HMAA 4M78B 4F7UG 2KDSA 2A28A 2HQHA 4JLIA 1NLOC 5IN1A 2VC8A 5C0MA 4JLGA 4ANJA 3M4YA 1UGSB 1MHNA 2E4HA 2MWPA 4LUDA 4PFOA 3CC4A 5C6SA 1K9MU 1WZOA 2RQTA 3BY7A 1N8RU 4AT1B 2JS0A 4C8QD 1MNDA 2PUOB 4F7UA 3G6EA 1T0HA 2EKHA 3S6WA 3U23A 4M7AD 2JZ2A 2HL5C 4O6JA 3C95A 3EHQA 4A54A 2CUDA 3QZ9B 1W1FA 1Q82C 1GBRA 2K57A 2RNAA 2F5KA 3H9NA 2CP7A 1M4ZA 4XTZA 3CBOA 2HDAA 2G3RA 1OPLA 4OGCA 3VV0A 5A0DA 1PRLC 1AT1B 1K8AU 4DBQA 1TSFA 2W0ZA 5GAOm 2QI2A 4HT9A 4J7FA 3V7RA 3OYLA 3S3OA 1PKSA 3OYFA 1RAEB 2EAYA 2AHJB 3CC7T 1YJNQ 4OGEA 1X43A 4PFZA 3I56T 2ZPGB 2QQSA 2G6FX 4PFPA 3ULRB 3OYJA 3M56A 3JCMP 4LDXA 3J81E 3QPHA 2BTTA 2DILA 1Y07A 3QUIA 2LNHB 2R5AA 4KBMB 3DB3A 1RLQC 4OMFB 4A63B 1M2VA 4N0AA 2CKKA 2DKGA 5GMKl 2COYA 3PTAA 5EG2A 4GLKA 4IUQA 4KGVB 1U06A 3QHSA 3CCSQ 1YITQ 1VQ5Q 2DX1A 2J06A 1M1KC 2J6OA 2L3QA 2CP2A 4J9EA 4C0DC 4CC4B 4EPCA 4R56A 1FMVA 1WJQA 5GMKe 1SRMA 1AWOA 2RQRA 3QG1A 1K9MR 2RHXA 2BE7D 2DBMA 1WYXA 3L2VA 1QVFP 1UGRB 2OTJT 2BUDA 2R57A 5CO7A 4HVWA 1K9MC 2ROTA 2LQNA 4E2FB 4JDSA 1U3OA 1X2QA 1TH7A 1FMWA 3OSSC 1C6VX 1WNLA 4J9CA 1MMDA 1OQKA 4Y92A 2I0NA 1VQ6T 2A3LA 3EFSA 1W2BS 2DBKA 4OMQA 2HBWA 3CCLT 1OEBA 3M4GA 4XAXB 3OYBA 1H92A 4D8DA 4KGXB 3VJPA 1WXUA 4C5GA 4M75G 1PSFA 3CCJQ 1TG0A 3M0SA 4RTXA 1UHFA 4PJLA 1K8AC 2JMCA 3LH0A 3CCSA 1WGSA 1QP3A 3HRTA 1QVFS 1BI2A 3HRSA 1KSWA 4PJNA 1SSHA 1TOVA 2MWOA 4LD9K 4XTVA 3QKJA 2QEXT 3JCMV 3LWHA 3L2WA 4QQDA 4DEXA 5FRNA 2KNBB 3QWXX 5FU7B 3R6NA 3FJ5A 1QQJA 2QYZA 2K5IA 2RA2A 2XU8A 3JCMg 4C92F 1YIJT 4C0ZA 2CP0A 1ZSZB 3L42A 4GLMA 3VU3C 1UGVA 2BIVA 4BE2A 3GPLA 1S72A 4HVUA 1VQ7Q 2JM9A 4DEYA 3PGGA 2HNIA 2E6NA 4N4HA 3I55T 3JRZA 3EH1A 5GAMe 2GFAA 3PFSA 1KJWA 4J8OA 5LL6S 3J80E 1YHQT 2DL3A 2YUPA 3LX7A 2QTVA 2MK5A 2D6FA 4R0KA 3BDUA 3M58A 4M4ZA 1YI2T 2O2OA 4LDYA 4JRQA 3JCMJ 3MJXA 2K5LA 2YRVA 3RDVA 2HKQB 3C0CA 2KT1A 5KYWA 3LYIA 2P84A 4FM4B 2O4XB 1R0BG 3VYHB 2X4YA 1AZGB 3A8MB 1D0YA 1KQ1A 4ME7A 2MYSA 1SG5A 1PSEA 2LCCA 1WX6A 1NEBA 1X2KA 4MMKA 3C12A 3PNWC 4M75D 3OYAA 2AIRB 1YJWT 1UEBA 2K2MA 4F04B 2EGCA 4QVDA 4PJOG 1R77A 2AT1B 2C06A 4TVRA 4AFSC 5IHNA 2DD4A 3CEYA 2L8DA 4XTWA 3KFVA 4HVVA 2DD5A 2GF7A 1RI9A 1PCXA 1HK9A 5GAN7 4IIMA 1N9RA 2HAXA 1GXIE 2JT4A 4RTWA 2HSEB 1TS9A 4XTYA 1BCMA 2FPEA 4OMPA 2C0IA 4FT2A 2E64A 3G71Q 4EMKC 1YJNT 2K3YA 4JJNK 2EQMA 5CR2A 2EQUA 3GIBA 1MNEA 3TREA 1W2BA 4C92B 5FWBA 2F69A 5CVIA 3L2QA 3OMGA 2PUKB 2VVKA 3X26B 5LJ5f 1K73U 4MZMA 3CMAQ 2M0OA 2DJQA 2L3RA 2NUPA 4IURA 1QVFA 1G3TA 1AD5A 1XOVA 4C8QE 3SWNA 2O31A 4BACA 1VQKT 1WQ7A 3UT1A 4X9CA 4BI8B 2KRSA 1WHMA 1M30A 1U1SA 4RG2A 4M7AE 5GMKh 3WVEB 1RUWA 4C8QC 2J7IA 2LRQA 1M2OA 2HSPA 3V8JA 2VGNA 4M7AC 4FW2A 5CCAA 2AZSA 1U1TA 4M78G 1Y96A 4KRTA 2RHUA 3G71A 2O9VA 1JU5C 4PJOD 4Y28E 2LQ8A 1Q86R 1IHWA 3S3MA 2KYMA 4Y91A 3OA6A 1NLPC 2BE9B 2DFUA 2FL7A 2X4WA 4EIKA 1ZA1B 1X6BA 4J9DA 1UFFA 1G83A 1PC0A 1VQNT 3GBQA 1VIEA 2EVRA 3EGXB 3CXCS 1SPKA 2OTLQ 4YTLA 1M8VA 4QVZA 4JS5A 1S1NA 2JJ9A 4OF1A 1YP5A 1BKBA 1XNIA 3JB9J 2EYQA 4FSXA 1SHFA 1EZZB 1I81A 4A4GA 3I5SA 2F2VA 2QG9B 2NUTA 3CPWP 2FRWA 4PLIA 3CCQT 1MGQA 5LJ5e 1H8KA 4A53A 4BE0A 3EFOB 1JRIA 2KMTA 1E6HA 3MEAA 1D0XA 3SFMA 2A36A 3FJPA 3NTIA 5J39A 3L2RA 3JB9G 1ACMB 4L5GA 1YJ9T 3MEVA 3OB9A 5KYXA 3HHTB 3G4SQ 1XQHA 5KYYA 2R58A 3VUBA 1NJIR 3PT9A 1XJWB 4OMLA 1SEMA 4ESRA 1ABQA 4IUTA 2K7AA 2A37A 1NJIC 4NL2A 2QDYB 2JS2A 1KHCA 3VS1A 4EMGA 2NLUA 2X4XA 2LNVA 2DEUA 4M78D 2X51A 2YLCA 3CPWS 5KYNA 3TSZA 2VUBA 5GAMd 1KC8R 2KBTA 2YHTA 1BBZA 3RESA 4RMOA 2RPNA 2KRNA 3CC7A 5GAOr 1BU1A 3I56A 3LGFA 1G3YA 1MMGA 2LVMA 4M7AG 1MV3A 4ZN1A 4FYYB 2XD0A 1QKXA 5AT1B 1IREB 2PZ1A 4ZN3A 2DVJA 4N0AC 1V29B 4PL6A 2JNGA 2E10A 3RKWA 4F14A 4BDZA 2RB6A 3AT1B 4C8QA 3ZBDA 2X3XD 2XKOC 3CCRQ 2QA4Q 1AOJA 2KEAA 1X01A 4M7AA 1BYMA 4OB0B 1VQOT 3OSVA 3LWIA 3UF4A 2E70A 1KFZA 2X35A 3QBYA 4X34A 2KR3A 4EDUA 2E3IA 2JTMA 3JSCA 2YUNA 2FPDA 3I9QA 4QKUA 1OZ2A 3NMZC 4JJBA 2LX7A 2DYBA 4L59A 1X75C 2RJCA 1EX4A 1M3AA 1M27C 3JB9D 1D3BB 1JB0E 2W10A 1K0XA 3FC3A 1Y57A 4J6XA 2JXBA 4N4IA 1UGQB 2XDBA 4MDXA 3P8HA 9ATCB 1Z9QA 1VQ6A 4LE9A 3DB4A 5KYUA 2K2VA 2KY9A 2LZ6B 1XTDA 1M90R 1TTHB 4M77F 3CXCA 2YUOA 4CC3A 4J9GA 2K3XA 3IQLA 2EGAA 4JS4A 3CBMA 4JJDA 4IIOA 1PG5B 3ME9A 4CRIA 2X3WD 1HXDA 4M7DE 2XICA 1IGUA 3PVQA 3CCRA 2QA4A 3H0IA 2RHZA 4M75E 2ZPHB 4RG8A 2MMPA 3OYEA 4E7JA 4J6WA 2H3EB 2CZ0B 1UGPB 4M75C 4E7HA 5GJWB 4P5NA 4C5EA 1BIAA 3CCUQ 2EQIA 4GBQA 4BY6C 1UUEA 3JCMW 4HCBA 2A7YA 2JW4A 2QEXA 1C0MA 1VQLT 1RADB 1VQ9T 1Z9ZA 3OYGA 1VQPQ 4BUGA 3VS6A 5GMKj 1YIJA 1I8FA 3H0HA 2K9GA 3N5BB 4XU2A 3CCEQ 2DA9A 3HFOA 1NYGA 1PD1A 2E5QA 5L8RE 5CKHA 4WTOB 2ECZA 2QGFB 3I55A 4RTUA 2LCLA 2LJ1A 1E6GA 5J26A 3M0UA 3TEEA 3CC2T 1EIFA 3OBWA 3EG9B 3CPWA 1TXQA 4B9WA 4LNPA 4EMKB 1OULA 2IIMA 2SRCA 2VGMA 1RAAB 1RLPC 1YI2A 4ZNXA 4OB1B 4F7UF 3C94A 2H8HA 3CD6T 1W2BP 1QCOA 3BFMA 1UG1A 1N5ZA 1QLYA 3CCUA 1C1AA 4ZGDB 2SEMA 1VOMA 1M3CA 2CH4A 5GAMf 2L2PA 2EJGA 1K1ZA 3DLMA 4AMCA 3NTHA 1VQPA 3VS7A 3G4ST 4M77B 1E7OA 1VQMT 3CCMT 4C0GA 3CCVQ 2DZ9A 3QXEB 3OW2P 3UA6A 3CCEA 2FRYA 3PIOA 4PJOE 1AVZC 1WIEA 1TWBA 1S72Q 5LJ5d 5GANf 1IHVA 4XTUA 1HJDA 1OZ3A 2PTKA 4PJOC 5FU6C 1D1CA 3MO8A 2HD0A 4RTZA 5GAMj 2KT8A 2DL7A 4MMLA 3HFNA 4M7DG 4DA4A 1VQ4T 1OU8A 1VQ8T 5GAN8 2DXTA 2C0TA 1ZBXA 3MP6A 1AEYA 4LD6A 2EYYA 4L6V5 2DF6A 2KYBA 1LCKA 3QJYA 1QW1A 1OYXA 1CKAA 5GMKm 5GANj 1IO6A 2E1HA 5CKFA 3OW2S 4HCZA 4M7DA 4BD3A 2L89A 2J6KA 1ABOA 4CI0C 2KQWA 2RF0A 3CC4T 4RUGA 2DMOA 4M75A 5DLQE 4ELYC 2HEQA 2QTXA 3SWNC 2E6ZA 1WJRA 4NOYA 4DBRA 3G6ET 3I5RA 4HCKA 3CCVA 2EGEA 4LDWA 4J9FA 3VRYA 1YCSB 1Q81R 2PU9B 1BCOA 2RK2A 3CMET 5GAN6 4JUVA 3MCAB 4RCCA 1AWXA 2MF2A 4F7UB 1Q81C 2ZPBB 4BE1A 1LNXA 1WJSA 1SF9A 2JM8A 1BB9A 3JCMQ 2DTOA 2LC4A 2FYKA 4C92D 2OJ2A 3SDZA 3FB9A 4QQGA 4M78E 4A4KA 2QAZA 5IXBA 2P4RA 4ZTJA 4LDUA 2QASA 1ARKA 4M78C 5GANe 1OV3A 1M3BA 4QVCA 1MMNA 2EYWA 5GAMg 1WPYA 1CSKA 3OQ5A 2GTOA 4FYVB 3TU4K 1B7TA 2V1QA 4M7DD 3GNFB 3UDCA 2P4TA 1JBMA 4OMOA 1I1JA 4J9HA 4J7IA 2XMFA 2ZPFB 5DM7R 3T9NA 3MHXA 1WFWA 5GANg 5LJ3e 1Q86U 1AWJA 1WHHA 2EQJA 4FYWB 2V1RA 2E41A 2ZPIB 1ZUYA 2KSSA 1M2VB 3SD4A 3UWNA 3F70A 2DRMA 4FW1A 2RI2A 3CCQA 2RI5A 2LX9A 2DXUA 2EWNA 2KROA 4NS5A 1D1AA 4PJOA 4JRKA 2R5MA 2KK4A 4KULA 1Y0MA 3OS2A 2LJ3A 1YWPA 3OY9A 1MUZA 2RI3A 4HCCA 4LUEA 4X9DA 2VV5A 2V8KA 1BI1A 4MZTA 3JV3A 3EAEA 1X27A 3NHNA 3M57A 4XU1A 3R6OA 1RAFB 2FG0A 5CKBA 4IUPA 2RHYA 4E7IA 5HK0A 2NUZA 1YWOA 2DLPA 3OBYA 3VKIA 2OI3A 2ZAEA 3QWYA 2CUBA 2OAUA 2EJFA 4OB2B 4KH1B 3QO3A 1JXMA 3EGDA 1B34A 3EFRA 3CCST 2L3PA 1BI0A 1YITT 1VQ5T 2XDPA 1G3WA 1ZBJA 3OW2A 4DQ2A 1VUBA 2EYZA 4E7ZA 2EKOA 2P0QA 2CP6A 2ZGWA 5GAOq 1NJIU 2WACA 2RJDA 1F1BB 2K3BA 4RTVA 3CXCP 1QVGP 2YT6A 4KUIA 3VYGA 1O75A 2CSQA 2DO3A 4AFZC 1UB4A 2MOXA 1PRMC 5CAIA 3E2UA 4PLLA 3JCMc 5LJ5j 5A0LA 3RR6A 2LQKA 2DXBA 1KC8U 3Q1JA 2Z0WA 2E3HA 4JZ3A 1D1BA 5KH6A 2KGTA 4BB7A 2K6DA 4FYXB 1FXXA 4BY6B 1D0ZA 1PM3A 2YXYA 1Q86C 1K0SA 4UC4A 2DL8A 1H3HA 2DK3A 4JRIA 2ESWA 4AFUC 2NWMA 5AYFA 3EH2A 8AT1B 3D7SB 3LGLA 4B6MA 1GFCA 1YFNA 4M78A 4HT8A 5D6YA 1VYTA 4F17A 1UJ0A 2RK1A 1QCFA 4EMHA 3CCJT 2MCNA 2DIQA 2L5QA 2DTIA 3VS3A 1QVGS 4DBHA 1NEGA 2ABLA 5D7UA 3M0TA 3CC7Q 2KVQG 2DEQA 5IH2A 1OPKA 1K9AA 5HY6A 3CQTA 3I56Q 2RJFA 2CH4W 2D1XA 3O5ZA 2JOYA 2DPPB 4RTTA 5D6WA 2ED0A 1NYFA 2EYXA 1ZUKA 2RJEA 1RAHB 5KYWB 4MDWA 1M9SA 5FU7C 1IB8A 1UDLA 3UA7A 2IPOB 2DERA 1ZX6A 3J7AF 1ZSZC 1VQ7T 2EW3A 3G1JA 1N27A 5GAN5 3M59A 2I2LA 1YNZA 2ZCFB 5GAMh 2E65A 4C0DB 1IXDA 2FZGB 4LN2A 4WF2A 2QDLA 3CPFA 2WSCE 4RCBA 1U8RA 2DZCA 2GBQA 5GAOp 1M90U 3TQ7P 1UTIA 4M78F 2HQEA 5LJ5g 1KD1R 1NZ9A 5GAN3 3BE3A 5GANh 2OTJQ 2KRMA 1KD1C 3FDRA 1N9SA 4XK8E 5FWCA 4XTXA 2F2WA 3JB9I 1KC8C 1X6GA 2ZPEB 4AG2C 2EPDA 2AK5A 1VQ6Q 3MPUB 1QCNA 5CKDA 1NG2A 2WSEE 3CC2A 2OX7A 3UATA 2WSFE 1GBQA 3CCLQ 4ATOA 5GANd 1I0CA 5KCOA 4IKFA 1VYUA 1DJ7B 2HCKA 3PE0A 1W4SA 2GQIA 3META 2QGGA 3CD6A 2LCSA 1LPLA 1WLPB 3OYHA 5ECAA 1FYNA 2LT1A 2E5KA 2M51A 4O5VA 1ZSGA 2FEIA 1I07A 4JJCA 2NUPB 2CT4A 2AZVA 3REAB 2E12A 3SWNB 5LJ3d 2NYSA 4KH0B 2QEXQ 4R55A 3PVLA 3MP1A 3G71T 2DXCA 3P8BB 2OTJA 1YIJQ 2B8AA 4C92E 2M9UA 1I4K1 1OX9A 3EG0A 3FEOA 3A5ZB 2FZKB 3H8ZA 2XDDA 1T3SA 1Y96B 3KBGA 5GAOl 3RIRA 1RI0A 3I55Q 4J9IA 3CCLA 3E19A 3CMAT 1QVGA 1YHQQ 5I2MA 1Y7XA 1M90C 2GQVA 1VQ8A 5GAOn 2DM1A 2QQBA 4C8QF 3KXTA 2XG8D 1PKTA 4DOWA 4E7SA 2CDTA 4PJMA 1A0NB 1YI2Q 3HL8A 2HKNA 1OOTA 4M7AF 3H6ZA 4M7DC 5GMKi 2EBPA 1I5LA 2CZ1B 3QYGB 2JVVA 2CGHA 1EFNA 1ZSZA 4M77D 5FLXE 2HBPA 2V8IA 2F1LA 1IRXA 5KE2A 1ZQ1A 7AT1B 2PNIA 4GY5A 1RACB 3ASKA 4MZPA 1SRLA 5DLOA 3OS1A 2VXEA 1Q82R 2NUTB 1UE9A 1YJWQ 2PVDB 2J05A 1FX7A 3VS4A 3GNGA 2LJ0A 3CMEA 1NE8A 1NM7A 2JMAA 3URGA 2DNUA 3VRZA 2LQWA 2X4JA 3PMTA 5KYXB 2DL4A 2PQWA 2V26A 1R0CB 5KYYB 2OTLT 2GTJA 4JRPA 1YHQA 1TUGB 2O4XA 2M16A 3JCMf 4DOVA 4ZTFA 2RD1A 3C4SA 5L23A 1X6OA 5GAN2 1JEGA 1KIKA 3RBBB 5IXFA 2F5TX 4NL3A 1Q7YR 1Q81U 2VXFA 1R8OB 5IHKA 2VYTA 1PWTA 2YSQA 3MEUA 4KUDK 4DBFA 5LJ5h 3V7CA 4RTYA 1AWWA 1LOJA 1Q7YC 3BW1A 2VB6A 4KGZB 1M1KR 1YJWA 1QWFA 3OYCA 5HKCA 4C92G 3A98A 3M0RA 4N4GA 3M55A 1VQKQ 1GRIA 3OYYA 4C8QB 1B3QA 2COWA 5DY9A 4F16A 2CS7A 3VUZA 1GCQA 2FB7A 5GAN4 5A0GA 1G3SA 3BDLA 5IHIA 4M7AB 2QXFA 1N8RR 1SHGA 4KT0E 3HRUA 4Z02A 3MEWA 4A4EA 4C92A 1WI7A 1N8RC 2GGRA 3M0PA 4HA8A 4PNOA 4VUBA 3GF5A 1YJNA 3TSWA 5CQXA 1PHTA 1G2BA 2RH2A 3THKA 5LJ3f 2BZ8A 4X1VA 3RMQA 3V8LA 2D0NA 2JUFA 3L2ZA 5FRMA 5IAYA 1KQ2A 3EG1A 3M53A 2COZA 4C5IA 2RMOA 2DRKA 1K8AR 2M0YA 1VQNQ 3HPWA 3CCRT 2QA4T 5KE3A 5KYUB 3OS0A 2ED1A 3JCMe 2LMJA 4CC2A 1BK2A 3NPFA 3DKMA 1KQSP 1YITA 1VQ5A 2M1HA 2CP5A 2RQWA 1AZEA 1KHIA 4C0FA 2RQVA 1VQKA 3HKSA 5I21A 3DLLA 2BKDN 3RMSA 5LJ3j 2YLBA 3OYNA 2ENMA 3GOXA 2FZCB 4ORZA 3INZA 3QDFA 1NBEB 4FSSA 4B9XA 3CCQQ 3CBPA 1RAGB 5I2SA 4ZGJB 2H3JA 3A8HB 5IT9E 3NGPA 4IUVA 2D9TA 1YJ9Q 3EG3A 2CSIA 1TU0B 3OYDA 4OMMA 3EGXA 2KAFA 2OAWA 1KQSS 1IGQA 5FW9A 1M5Q1 6AT1B 2YUQA 4XU0A 2LT4A 3RNJA 2Y4XA 2BZYA 4M7DF 2FO0A 1BI3A 3UPUA 1VQNA 3OYMA 3CCJA 2X9HA 4M75F 4ZGEB 1D09B 2IVWA 2DE0X 3M0QA 3A8OB 2FVUA 3QIIA 1FMKA 2XK0A 4XU3A 2D0QB 4WCIA 3V8KA 1ZA2B 3HP9A 2QQAA 3LLRA 3CCUT 2VWFA 3EFOA 1JJ2P 2VKNA 1H3ZA 4E7KA 2FHDA 3RERA 3O8VA 3S3NA 2DL5A 5HK3A 3WVDB 3MP8A 1VQPT 5I11A 1WQWA 4QQ6A 3REBB 1WHGA 1FWZA 2DIGA 3G7ZA 4ELZC 5GJVB 3QSUA 2A08A 3OYKA 3JAME 3CCET 2YRCA 1VQ7A 3OYIA 2AKLA 1YJ9A 2CYZB 5LJ3g 3NFCA 1VQOQ 4JPBW 1RAIB 2QQRA 4PKCC 4PK4A 1QVPA 3EGUA 1I5OB 4FT4A 1VA7A 3VS2A 2KE9A 3L2UA 2MIOA 1IZ6A 2YDLA 1ZHIA 1UECA 2D8HA 1Y71A 1M1GA 4FCYA 1JXOA 4J6YA 1JJ2S 2RO0A 4OP0A 2CT3A 4QT7A 4E47A 3EG2A 4FIBA 1ZLMA 4CC7A 2CP3A 2Y90A 1G8XA 3JB9H 2K5FA 1WA7A 1M8MA 3I35A 2CZ7B 1WXTA 2DAQA 2JN0A 2CREA 2LTOA 2YRDA 2DTHA 4J9BA 1U5SA 4FL6A 2P0PA 4M77E 1RABB 1O9SA 5CKEA 2ROLA 1ZUUA 1YN8A 5HCKA 3HSBA 1B07A 5FROA 3CCVT 2LDMA 4M77C 1KD1U 3V7SA 4PJOF 4M7DB 3ZEHA 1S72T 1T3LA 1YBYA 1KG1A 2RHIA 2O88A 4M75B 1VQOA 4V2SA 1N6AA 1VIFA 1D3BA 1OU9A 4AG1C 2MI6A 3H0FA 2BZXA
chains in the Genus database with same CATH topology
2B86A 2E5KA 2M51A 2H8HA 1ZSGA 4R0KA 2FEIA 1I07A 4JJCA 4M4ZA 2D8JA 4Z88A 2O2OA 2CT4A 2AZVA 3REAB 1UG1A 1N5ZA 1QLYA 1JO8A 2AKKA 3C0CA 1PNJA 2KT1A 2SEMA 3PVLA 1M3CA 2CH4A 2L2PA 1K1ZA 1T0JA 4OMNA 3H41A 1AZGB 1JQQA 1MV0B 3VS7A 1E7OA 1V1CA 3EG0A 1WX6A 1NEBA 1X2KA 3UA6A 1W70A 2FRYA 3ZL7C 1T3SA 1AVZC 2RN8A 2K2MA 1WIEA 2EGCA 1HJDA 1GCPA 4J9IA 3TVTA 4AFSC 2PTKA 5IHNA 5EC7A 1VYVA 1UHCA 3KFVA 4HVVA 2DM1A 4K11A 1RI9A 4RTZA 1PKTA 2DL7A 2KT8A 1K4US 2CDTA 1TUCA 1A0NB 4IIMA 1CKBA 1OOTA 2JT4A 4RTWA 4HXJA 2EBPA 1GL5A 2C0TA 2L0AA 2FPEA 4OMPA 1AEYA 2C0IA 1EFNA 2EYYA 2DF6A 2KYBA 1LCKA 1QKWA 1CKAA 1IO6A 1HD3A 2PNIA 2J6KA 1ABOA 5FWBA 1SRLA 2RF0A 2O9SA 4RUGA 2DMOA 1UE9A 1WDXA 2HEQA 2C0OA 2GNCA 2J05A 4AFQC 2VVKA 3I5RA 1X69A 3VS4A 4HCKA 1TUDA 2EGEA 4J9FA 3VRYA 2LJ0A 3SEMA 1YCSB 2DJQA 1K76A 1NM7A 2JMAA 4E6RA 5I22A 1AD5A 2DNUA 3VRZA 1XOVA 2LQWA 2DL4A 2JTEA 2L3SA 2O31A 2KXCA 2GTJA 1AWXA 4JZ4A 2KRSA 1M30A 1RUWA 2J6FA 2J7IA 5L23A 2JM8A 1BB9A 2HSPA 3VS0A 3LH5A 2FPFA 2OJ2A 1JEGA 2AZSA 1KIKA 5IXBA 2P4RA 3RBBB 2LP5A 5IXFA 4KRTA 2O9VA 1ARKA 1JU5C 2KXDA 5IHKA 1PWTA 2YSQA 1OV3A 1M3BA 4RTYA 1AWWA 2KYMA 2K79A 1NLPC 4D8KA 2EYWA 1CSKA 2GTOA 1WXBA 4EIKA 1GCQC 2V1QA 1X6BA 4J9DA 1UFFA 1QWFA 4Z8AA 4OMOA 1I1JA 1G83A 3A98A 1UJYA 3M0RA 4J9HA 3GBQA 1W6XA 3EHRA 2EVRA 3VS5A 1SPKA 2XMFA 1GRIA 3SHWA 1B3QA 1WFWA 4F16A 1S1NA 1AWJA 1YP5A 1GCQA 2RQUA 5IHIA 2V1RA 1ZUYA 1SHGA 1QWEA 2F2XA 5ECAA 4Z89A 1GFDA 2DRMA 1SHFA 1WI7A 3I5SA 2F2VA 1J3TA 2GGRA 1HSQA 3M0PA 2A28A 1NLOC 2KROA 3TSWA 2FRWA 1PHTA 1G2BA 3THKA 1Y0MA 1H8KA 2LJ3A 1YWPA 2BZ8A 4X1VA 1MUZA 4LUEA 1E6HA 2D0NA 2A36A 3JV3A 4LUDA 1X27A 3EG1A 3NHNA 2RMOA 2RQTA 2JS0A 2DRKA 2FG0A 2M0YA 1T0HA 2EKHA 4OMLA 1SEMA 4ESRA 1ABQA 3U23A 2NUZA 2ED1A 2K7AA 1YWOA 2LMJA 2A37A 2DLPA 1BK2A 3EHQA 4CC2A 3NPFA 2CUDA 2JS2A 1W1FA 2OI3A 3VS1A 3QWYA 2CUBA 2RQWA 1AZEA 1GBRA 1JXMA 2RQVA 2RNAA 2L3PA 1ZBJA 2HDAA 3TSZA 1OPLA 2ENMA 2EYZA 2KBTA 1PRLC 1BBZA 4ORZA 2RPNA 2KRNA 2W0ZA 4FSSA 2K3BA 4RTVA 1BU1A 1PKSA 1MV3A 2YT6A 1QKXA 2PZ1A 3NGPA 2CSQA 1X43A 2DVJA 4AFZC 2MOXA 1PRMC 2G6FX 3EG3A 3ULRB 2CSIA 4OMMA 2BTTA 4F14A 2DILA 2LNHB 2OAWA 2X3XD 1AOJA 2KEAA 4JZ3A 5FW9A 2KGTA 2K6DA 2YUQA 1RLQC 4A63B 3RNJA 2BZYA 2FO0A 1K0SA 2DL8A 1H3HA 3UF4A 2ESWA 4AFUC 2NWMA 1KFZA 2KR3A 1U06A 1GFCA 2DX1A 2DE0X 3M0QA 1VYTA 2J06A 4F17A 1UJ0A 2YUNA 2FPDA 2J6OA 1QCFA 2L3QA 3I9QA 2MCNA 1FMKA 4J9EA 3NMZC 4JJBA 4WCIA 2LX7A 4CC4B 2DYBA 3VS3A 2VWFA 1M27C 1M3AA 2ABLA 1NEGA 1SRMA 1AWOA 2RQRA 2VKNA 2W10A 1K0XA 3M0TA 1Y57A 2DBMA 1OPKA 1WYXA 5IH2A 1K9AA 2JXBA 2DL5A 3CQTA 2CH4W 2D1XA 3O5ZA 5I11A 4RTTA 4HVWA 3REBB 1Z9QA 2ED0A 2ROTA 2LQNA 4LE9A 1NYFA 2EYXA 1U3OA 1X2QA 1ZUKA 5GJVB 2A08A 2LZ6B 4J9CA 4Y92A 2I0NA 2YUOA 4CC3A 4J9GA 2AKLA 3IQLA 2EGAA 1UDLA 4JJDA 3UA7A 4IIOA 1ZX6A 2X3WD 2DBKA 4JPBW 2HBWA 4OMQA 2EW3A 1OEBA 3PVQA 3EGUA 3H0IA 3VS2A 1VA7A 1H92A 2KE9A 4D8DA 1YNZA 2MIOA 1WXUA 2YDLA 1UECA 4LN2A 2D8HA 1TG0A 3M0SA 4RTXA 1UHFA 2QDLA 1JXOA 2JMCA 2GBQA 5GJWB 2CT3A 4QT7A 3EG2A 1UTIA 2EQIA 4GBQA 1UUEA 1ZLMA 2JW4A 4CC7A 1KSWA 1SSHA 1Z9ZA 1WA7A 1M8MA 2KRMA 3I35A 3VS6A 1WXTA 2CREA 3H0HA 2K9GA 5FWCA 2F2WA 4J9BA 4DEXA 2KNBB 3QWXX 2DA9A 1U5SA 1X6GA 3FJ5A 3R6NA 2EPDA 4AG2C 1NYGA 2AK5A 2ROLA 1NG2A 1ZUUA 1YN8A 5HCKA 4GLMA 1B07A 1UGVA 2ECZA 4HVUA 3UATA 2JM9A 4DEYA 1GBQA 4RTUA 2LJ1A 1E6GA 3M0UA 1I0CA 1T3LA 1VYUA 2HCKA 3PE0A 2O88A 2GQIA 4LNPA 1KJWA 2IIMA 2SRCA 2LCSA 1RLPC 1WLPB 4AG1C 2DL3A 3H0FA 4ZNXA 2YUPA 2BZXA 1FYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B86 A;  2E5K A;  2M51 A;  2H8H A;  1ZSG A;  4R0K A;  2FEI A;  1I07 A;  4JJC A;  4M4Z A;  2D8J A;  4Z88 A;  2O2O A;  2CT4 A;  2AZV A;  3REA B;  1UG1 A;  1N5Z A;  1QLY A;  1JO8 A;  2AKK A;  3C0C A;  1PNJ A;  2KT1 A;  2SEM A;  3PVL A;  1M3C A;  2CH4 A;  2L2P A;  1K1Z A;  1T0J A;  4OMN A;  3H41 A;  1AZG B;  1JQQ A;  1MV0 B;  3VS7 A;  1E7O A;  1V1C A;  3EG0 A;  1WX6 A;  1NEB A;  1X2K A;  3UA6 A;  1W70 A;  2FRY A;  3ZL7 C;  1T3S A;  1AVZ C;  2RN8 A;  2K2M A;  1WIE A;  2EGC A;  1HJD A;  1GCP A;  4J9I A;  3TVT A;  4AFS C;  2PTK A;  5IHN A;  5EC7 A;  1VYV A;  1UHC A;  3KFV A;  4HVV A;  2DM1 A;  4K11 A;  1RI9 A;  4RTZ A;  1PKT A;  2DL7 A;  2KT8 A;  1K4U S;  2CDT A;  1TUC A;  1A0N B;  4IIM A;  1CKB A;  1OOT A;  2JT4 A;  4RTW A;  4HXJ A;  2EBP A;  1GL5 A;  2C0T A;  2L0A A;  2FPE A;  4OMP A;  1AEY A;  2C0I A;  1EFN A;  2EYY A;  2DF6 A;  2KYB A;  1LCK A;  1QKW A;  1CKA A;  1IO6 A;  1HD3 A;  2PNI A;  2J6K A;  1ABO A;  5FWB A;  1SRL A;  2RF0 A;  2O9S A;  4RUG A;  2DMO A;  1UE9 A;  1WDX A;  2HEQ A;  2C0O A;  2GNC A;  2J05 A;  4AFQ C;  2VVK A;  3I5R A;  1X69 A;  3VS4 A;  4HCK A;  1TUD A;  2EGE A;  4J9F A;  3VRY A;  2LJ0 A;  3SEM A;  1YCS B;  2DJQ A;  1K76 A;  1NM7 A;  2JMA A;  4E6R A;  5I22 A;  1AD5 A;  2DNU A;  3VRZ A;  1XOV A;  2LQW A;  2DL4 A;  2JTE A;  2L3S A;  2O31 A;  2KXC A;  2GTJ A;  1AWX A;  4JZ4 A;  2KRS A;  1M30 A;  1RUW A;  2J6F A;  2J7I A;  5L23 A;  2JM8 A;  1BB9 A;  2HSP A;  3VS0 A;  3LH5 A;  2FPF A;  2OJ2 A;  1JEG A;  2AZS A;  1KIK A;  5IXB A;  2P4R A;  3RBB B;  2LP5 A;  5IXF A;  4KRT A;  2O9V A;  1ARK A;  1JU5 C;  2KXD A;  5IHK A;  1PWT A;  2YSQ A;  1OV3 A;  1M3B A;  4RTY A;  1AWW A;  2KYM A;  2K79 A;  1NLP C;  4D8K A;  2EYW A;  1CSK A;  2GTO A;  1WXB A;  4EIK A;  1GCQ C;  2V1Q A;  1X6B A;  4J9D A;  1UFF A;  1QWF A;  4Z8A A;  4OMO A;  1I1J A;  1G83 A;  3A98 A;  1UJY A;  3M0R A;  4J9H A;  3GBQ A;  1W6X A;  3EHR A;  2EVR A;  3VS5 A;  1SPK A;  2XMF A;  1GRI A;  3SHW A;  1B3Q A;  1WFW A;  4F16 A;  1S1N A;  1AWJ A;  1YP5 A;  1GCQ A;  2RQU A;  5IHI A;  2V1R A;  1ZUY A;  1SHG A;  1QWE A;  2F2X A;  5ECA A;  4Z89 A;  1GFD A;  2DRM A;  1SHF A;  1WI7 A;  3I5S A;  2F2V A;  1J3T A;  2GGR A;  1HSQ A;  3M0P A;  2A28 A;  1NLO C;  2KRO A;  3TSW A;  2FRW A;  1PHT A;  1G2B A;  3THK A;  1Y0M A;  1H8K A;  2LJ3 A;  1YWP A;  2BZ8 A;  4X1V A;  1MUZ A;  4LUE A;  1E6H A;  2D0N A;  2A36 A;  3JV3 A;  4LUD A;  1X27 A;  3EG1 A;  3NHN A;  2RMO A;  2RQT A;  2JS0 A;  2DRK A;  2FG0 A;  2M0Y A;  1T0H A;  2EKH A;  4OML A;  1SEM A;  4ESR A;  1ABQ A;  3U23 A;  2NUZ A;  2ED1 A;  2K7A A;  1YWO A;  2LMJ A;  2A37 A;  2DLP A;  1BK2 A;  3EHQ A;  4CC2 A;  3NPF A;  2CUD A;  2JS2 A;  1W1F A;  2OI3 A;  3VS1 A;  3QWY A;  2CUB A;  2RQW A;  1AZE A;  1GBR A;  1JXM A;  2RQV A;  2RNA A;  2L3P A;  1ZBJ A;  2HDA A;  3TSZ A;  1OPL A;  2ENM A;  2EYZ A;  2KBT A;  1PRL C;  1BBZ A;  4ORZ A;  2RPN A;  2KRN A;  2W0Z A;  4FSS A;  2K3B A;  4RTV A;  1BU1 A;  1PKS A;  1MV3 A;  2YT6 A;  1QKX A;  2PZ1 A;  3NGP A;  2CSQ A;  1X43 A;  2DVJ A;  4AFZ C;  2MOX A;  1PRM C;  2G6F X;  3EG3 A;  3ULR B;  2CSI A;  4OMM A;  2BTT A;  4F14 A;  2DIL A;  2LNH B;  2OAW A;  2X3X D;  1AOJ A;  2KEA A;  4JZ3 A;  5FW9 A;  2KGT A;  2K6D A;  2YUQ A;  1RLQ C;  4A63 B;  3RNJ A;  2BZY A;  2FO0 A;  1K0S A;  2DL8 A;  1H3H A;  3UF4 A;  2ESW A;  4AFU C;  2NWM A;  1KFZ A;  2KR3 A;  1U06 A;  1GFC A;  2DX1 A;  2DE0 X;  3M0Q A;  1VYT A;  2J06 A;  4F17 A;  1UJ0 A;  2YUN A;  2FPD A;  2J6O A;  1QCF A;  2L3Q A;  3I9Q A;  2MCN A;  1FMK A;  4J9E A;  3NMZ C;  4JJB A;  4WCI A;  2LX7 A;  4CC4 B;  2DYB A;  3VS3 A;  2VWF A;  1M27 C;  1M3A A;  2ABL A;  1NEG A;  1SRM A;  1AWO A;  2RQR A;  2VKN A;  2W10 A;  1K0X A;  3M0T A;  1Y57 A;  2DBM A;  1OPK A;  1WYX A;  5IH2 A;  1K9A A;  2JXB A;  2DL5 A;  3CQT A;  2CH4 W;  2D1X A;  3O5Z A;  5I11 A;  4RTT A;  4HVW A;  3REB B;  1Z9Q A;  2ED0 A;  2ROT A;  2LQN A;  4LE9 A;  1NYF A;  2EYX A;  1U3O A;  1X2Q A;  1ZUK A;  5GJV B;  2A08 A;  2LZ6 B;  4J9C A;  4Y92 A;  2I0N A;  2YUO A;  4CC3 A;  4J9G A;  2AKL A;  3IQL A;  2EGA A;  1UDL A;  4JJD A;  3UA7 A;  4IIO A;  1ZX6 A;  2X3W D;  2DBK A;  4JPB W;  2HBW A;  4OMQ A;  2EW3 A;  1OEB A;  3PVQ A;  3EGU A;  3H0I A;  3VS2 A;  1VA7 A;  1H92 A;  2KE9 A;  4D8D A;  1YNZ A;  2MIO A;  1WXU A;  2YDL A;  1UEC A;  4LN2 A;  2D8H A;  1TG0 A;  3M0S A;  4RTX A;  1UHF A;  2QDL A;  1JXO A;  2JMC A;  2GBQ A;  5GJW B;  2CT3 A;  4QT7 A;  3EG2 A;  1UTI A;  2EQI A;  4GBQ A;  1UUE A;  1ZLM A;  2JW4 A;  4CC7 A;  1KSW A;  1SSH A;  1Z9Z A;  1WA7 A;  1M8M A;  2KRM A;  3I35 A;  3VS6 A;  1WXT A;  2CRE A;  3H0H A;  2K9G A;  5FWC A;  2F2W A;  4J9B A;  4DEX A;  2KNB B;  3QWX X;  2DA9 A;  1U5S A;  1X6G A;  3FJ5 A;  3R6N A;  2EPD A;  4AG2 C;  1NYG A;  2AK5 A;  2ROL A;  1NG2 A;  1ZUU A;  1YN8 A;  5HCK A;  4GLM A;  1B07 A;  1UGV A;  2ECZ A;  4HVU A;  3UAT A;  2JM9 A;  4DEY A;  1GBQ A;  4RTU A;  2LJ1 A;  1E6G A;  3M0U A;  1I0C A;  1T3L A;  1VYU A;  2HCK A;  3PE0 A;  2O88 A;  2GQI A;  4LNP A;  1KJW A;  2IIM A;  2SRC A;  2LCS A;  1RLP C;  1WLP B;  4AG1 C;  2DL3 A;  3H0F A;  4ZNX A;  2YUP A;  2BZX A;  1FYN A; 
#chains in the Genus database with same CATH topology
 2K4Y A;  4J83 A;  3M54 A;  2B86 A;  1BIB A;  3QZ5 B;  2HL3 A;  2HQX A;  2D8J A;  4Q5W A;  4Z88 A;  1VQL Q;  1VQ9 Q;  4D6W A;  1JO8 A;  2AKK A;  2DVE A;  1PNJ A;  3JCM X;  3FLG A;  3GLX A;  2MPX C;  1YCY A;  3JCM b;  1RL2 A;  3X24 B;  4E7L A;  1KQS A;  1T0J A;  1Q95 G;  2JTF A;  4OMN A;  3H41 A;  1AHJ B;  1JQQ A;  1MV0 B;  2DJZ A;  3M5A A;  3FRN A;  2ATC B;  2MAM A;  2IG0 A;  1V1C A;  4A4H A;  3MKD A;  1KK7 A;  3SB2 A;  1W70 A;  2GFU A;  3ZL7 C;  3JCM h;  2RN8 A;  3CC2 Q;  3GP8 A;  3CMA A;  1GCP A;  3M9Q A;  3TVT A;  1WHL A;  4HKE A;  3L1A A;  2EFI A;  5EC7 A;  1VYV A;  1LJO A;  2XHC A;  1UHC A;  4K11 A;  2PVG B;  3CD6 Q;  1K4U S;  4F7U E;  1TUC A;  3E9G A;  5CIU A;  1CKB A;  2EJ9 A;  3RKX A;  3JCM d;  3NTK A;  2Y4Y A;  4HXJ A;  1GL5 A;  1K73 R;  2L0A A;  5KCH A;  3P8D A;  4BI4 A;  1VQL A;  2XID A;  2EIF A;  1VQ9 A;  1K73 C;  1QKW A;  1OX8 A;  1OI1 A;  4J5Y A;  5A2Q E;  1SKU B;  3TCJ A;  2HZY A;  1VQM Q;  3CCM Q;  1HD3 A;  3WXM B;  5CQY A;  3EG9 A;  2O9S A;  3HTR A;  1WDX A;  1LVK A;  5J3B A;  1NPP A;  2P0K A;  2XI9 A;  4EMK A;  1MMA A;  2C0O A;  2GNC A;  3X28 B;  4AFQ C;  4PJO B;  1X69 A;  2V8J A;  5FU6 B;  1TUD A;  1QMC A;  3E9F A;  5CK9 A;  3SEM A;  1JJ2 A;  4LXC A;  2KI7 A;  1K76 A;  4M77 G;  2OTL A;  2A0F B;  1NPR A;  4E6R A;  5I22 A;  2JTE A;  3X20 B;  2DYI A;  2M02 A;  2L3S A;  4BI3 A;  2KXC A;  3A8L B;  8ATC B;  1VQ4 Q;  4C8Q G;  5LJ3 h;  4JZ4 A;  1VQ8 Q;  3LW5 E;  1Q82 U;  2J6F A;  1P92 A;  3VS0 A;  3LH5 A;  4M77 A;  2FPF A;  4LDV A;  3EGD B;  1B34 B;  2YWW A;  2LP5 A;  2DET A;  3X25 B;  2KXD A;  3CC4 Q;  4RKU E;  2PVO B;  3E1S A;  3ER0 A;  3PMI A;  2K79 A;  3JB9 F;  3G4S A;  4FU6 A;  4C5H A;  3KUF A;  2RM4 A;  4D8K A;  3G6E Q;  3CCM A;  1VQM A;  2GCX A;  3RKY A;  1WXB A;  3QJ6 A;  1GCQ C;  3OMC A;  3QYH B;  4Z8A A;  1PD0 A;  1SSF A;  1WHK A;  4BDY A;  1UJY A;  3CME Q;  2ZZD A;  2EQK A;  1W6X A;  3EHR A;  4OVA A;  4C92 C;  2QK0 A;  3VS5 A;  3A1P A;  1Q7Y U;  4QW2 A;  4IUU A;  3SHW A;  4A4F A;  1V76 A;  3ZFJ A;  4PJJ A;  2O01 E;  2VAS A;  1WHJ A;  2QQ9 A;  2RQU A;  3QDR B;  4OB3 B;  5M9O A;  3FIF A;  3A8G B;  3OS5 A;  3RUX A;  1G5V A;  1VQ4 A;  1QWE A;  2F2X A;  4II1 A;  3PIP A;  4Z89 A;  1M1F A;  1GFD A;  3AHU A;  1H64 1;  1QP2 A;  1M1K U;  5D6X A;  1HYO A;  1J3T A;  4XQ3 A;  2CZ6 B;  1HSQ A;  2HMA A;  4M78 B;  4F7U G;  2KDS A;  2A28 A;  2HQH A;  4JLI A;  1NLO C;  5IN1 A;  2VC8 A;  5C0M A;  4JLG A;  4ANJ A;  3M4Y A;  1UGS B;  1MHN A;  2E4H A;  2MWP A;  4LUD A;  4PFO A;  3CC4 A;  5C6S A;  1K9M U;  1WZO A;  2RQT A;  3BY7 A;  1N8R U;  4AT1 B;  2JS0 A;  4C8Q D;  1MND A;  2PUO B;  4F7U A;  3G6E A;  1T0H A;  2EKH A;  3S6W A;  3U23 A;  4M7A D;  2JZ2 A;  2HL5 C;  4O6J A;  3C95 A;  3EHQ A;  4A54 A;  2CUD A;  3QZ9 B;  1W1F A;  1Q82 C;  1GBR A;  2K57 A;  2RNA A;  2F5K A;  3H9N A;  2CP7 A;  1M4Z A;  4XTZ A;  3CBO A;  2HDA A;  2G3R A;  1OPL A;  4OGC A;  3VV0 A;  5A0D A;  1PRL C;  1AT1 B;  1K8A U;  4DBQ A;  1TSF A;  2W0Z A;  5GAO m;  2QI2 A;  4HT9 A;  4J7F A;  3V7R A;  3OYL A;  3S3O A;  1PKS A;  3OYF A;  1RAE B;  2EAY A;  2AHJ B;  3CC7 T;  1YJN Q;  4OGE A;  1X43 A;  4PFZ A;  3I56 T;  2ZPG B;  2QQS A;  2G6F X;  4PFP A;  3ULR B;  3OYJ A;  3M56 A;  3JCM P;  4LDX A;  3J81 E;  3QPH A;  2BTT A;  2DIL A;  1Y07 A;  3QUI A;  2LNH B;  2R5A A;  4KBM B;  3DB3 A;  1RLQ C;  4OMF B;  4A63 B;  1M2V A;  4N0A A;  2CKK A;  2DKG A;  5GMK l;  2COY A;  3PTA A;  5EG2 A;  4GLK A;  4IUQ A;  4KGV B;  1U06 A;  3QHS A;  3CCS Q;  1YIT Q;  1VQ5 Q;  2DX1 A;  2J06 A;  1M1K C;  2J6O A;  2L3Q A;  2CP2 A;  4J9E A;  4C0D C;  4CC4 B;  4EPC A;  4R56 A;  1FMV A;  1WJQ A;  5GMK e;  1SRM A;  1AWO A;  2RQR A;  3QG1 A;  1K9M R;  2RHX A;  2BE7 D;  2DBM A;  1WYX A;  3L2V A;  1QVF P;  1UGR B;  2OTJ T;  2BUD A;  2R57 A;  5CO7 A;  4HVW A;  1K9M C;  2ROT A;  2LQN A;  4E2F B;  4JDS A;  1U3O A;  1X2Q A;  1TH7 A;  1FMW A;  3OSS C;  1C6V X;  1WNL A;  4J9C A;  1MMD A;  1OQK A;  4Y92 A;  2I0N A;  1VQ6 T;  2A3L A;  3EFS A;  1W2B S;  2DBK A;  4OMQ A;  2HBW A;  3CCL T;  1OEB A;  3M4G A;  4XAX B;  3OYB A;  1H92 A;  4D8D A;  4KGX B;  3VJP A;  1WXU A;  4C5G A;  4M75 G;  1PSF A;  3CCJ Q;  1TG0 A;  3M0S A;  4RTX A;  1UHF A;  4PJL A;  1K8A C;  2JMC A;  3LH0 A;  3CCS A;  1WGS A;  1QP3 A;  3HRT A;  1QVF S;  1BI2 A;  3HRS A;  1KSW A;  4PJN A;  1SSH A;  1TOV A;  2MWO A;  4LD9 K;  4XTV A;  3QKJ A;  2QEX T;  3JCM V;  3LWH A;  3L2W A;  4QQD A;  4DEX A;  5FRN A;  2KNB B;  3QWX X;  5FU7 B;  3R6N A;  3FJ5 A;  1QQJ A;  2QYZ A;  2K5I A;  2RA2 A;  2XU8 A;  3JCM g;  4C92 F;  1YIJ T;  4C0Z A;  2CP0 A;  1ZSZ B;  3L42 A;  4GLM A;  3VU3 C;  1UGV A;  2BIV A;  4BE2 A;  3GPL A;  1S72 A;  4HVU A;  1VQ7 Q;  2JM9 A;  4DEY A;  3PGG A;  2HNI A;  2E6N A;  4N4H A;  3I55 T;  3JRZ A;  3EH1 A;  5GAM e;  2GFA A;  3PFS A;  1KJW A;  4J8O A;  5LL6 S;  3J80 E;  1YHQ T;  2DL3 A;  2YUP A;  3LX7 A;  2QTV A;  2MK5 A;  2D6F A;  4R0K A;  3BDU A;  3M58 A;  4M4Z A;  1YI2 T;  2O2O A;  4LDY A;  4JRQ A;  3JCM J;  3MJX A;  2K5L A;  2YRV A;  3RDV A;  2HKQ B;  3C0C A;  2KT1 A;  5KYW A;  3LYI A;  2P84 A;  4FM4 B;  2O4X B;  1R0B G;  3VYH B;  2X4Y A;  1AZG B;  3A8M B;  1D0Y A;  1KQ1 A;  4ME7 A;  2MYS A;  1SG5 A;  1PSE A;  2LCC A;  1WX6 A;  1NEB A;  1X2K A;  4MMK A;  3C12 A;  3PNW C;  4M75 D;  3OYA A;  2AIR B;  1YJW T;  1UEB A;  2K2M A;  4F04 B;  2EGC A;  4QVD A;  4PJO G;  1R77 A;  2AT1 B;  2C06 A;  4TVR A;  4AFS C;  5IHN A;  2DD4 A;  3CEY A;  2L8D A;  4XTW A;  3KFV A;  4HVV A;  2DD5 A;  2GF7 A;  1RI9 A;  1PCX A;  1HK9 A;  5GAN 7;  4IIM A;  1N9R A;  2HAX A;  1GXI E;  2JT4 A;  4RTW A;  2HSE B;  1TS9 A;  4XTY A;  1BCM A;  2FPE A;  4OMP A;  2C0I A;  4FT2 A;  2E64 A;  3G71 Q;  4EMK C;  1YJN T;  2K3Y A;  4JJN K;  2EQM A;  5CR2 A;  2EQU A;  3GIB A;  1MNE A;  3TRE A;  1W2B A;  4C92 B;  5FWB A;  2F69 A;  5CVI A;  3L2Q A;  3OMG A;  2PUK B;  2VVK A;  3X26 B;  5LJ5 f;  1K73 U;  4MZM A;  3CMA Q;  2M0O A;  2DJQ A;  2L3R A;  2NUP A;  4IUR A;  1QVF A;  1G3T A;  1AD5 A;  1XOV A;  4C8Q E;  3SWN A;  2O31 A;  4BAC A;  1VQK T;  1WQ7 A;  3UT1 A;  4X9C A;  4BI8 B;  2KRS A;  1WHM A;  1M30 A;  1U1S A;  4RG2 A;  4M7A E;  5GMK h;  3WVE B;  1RUW A;  4C8Q C;  2J7I A;  2LRQ A;  1M2O A;  2HSP A;  3V8J A;  2VGN A;  4M7A C;  4FW2 A;  5CCA A;  2AZS A;  1U1T A;  4M78 G;  1Y96 A;  4KRT A;  2RHU A;  3G71 A;  2O9V A;  1JU5 C;  4PJO D;  4Y28 E;  2LQ8 A;  1Q86 R;  1IHW A;  3S3M A;  2KYM A;  4Y91 A;  3OA6 A;  1NLP C;  2BE9 B;  2DFU A;  2FL7 A;  2X4W A;  4EIK A;  1ZA1 B;  1X6B A;  4J9D A;  1UFF A;  1G83 A;  1PC0 A;  1VQN T;  3GBQ A;  1VIE A;  2EVR A;  3EGX B;  3CXC S;  1SPK A;  2OTL Q;  4YTL A;  1M8V A;  4QVZ A;  4JS5 A;  1S1N A;  2JJ9 A;  4OF1 A;  1YP5 A;  1BKB A;  1XNI A;  3JB9 J;  2EYQ A;  4FSX A;  1SHF A;  1EZZ B;  1I81 A;  4A4G A;  3I5S A;  2F2V A;  2QG9 B;  2NUT A;  3CPW P;  2FRW A;  4PLI A;  3CCQ T;  1MGQ A;  5LJ5 e;  1H8K A;  4A53 A;  4BE0 A;  3EFO B;  1JRI A;  2KMT A;  1E6H A;  3MEA A;  1D0X A;  3SFM A;  2A36 A;  3FJP A;  3NTI A;  5J39 A;  3L2R A;  3JB9 G;  1ACM B;  4L5G A;  1YJ9 T;  3MEV A;  3OB9 A;  5KYX A;  3HHT B;  3G4S Q;  1XQH A;  5KYY A;  2R58 A;  3VUB A;  1NJI R;  3PT9 A;  1XJW B;  4OML A;  1SEM A;  4ESR A;  1ABQ A;  4IUT A;  2K7A A;  2A37 A;  1NJI C;  4NL2 A;  2QDY B;  2JS2 A;  1KHC A;  3VS1 A;  4EMG A;  2NLU A;  2X4X A;  2LNV A;  2DEU A;  4M78 D;  2X51 A;  2YLC A;  3CPW S;  5KYN A;  3TSZ A;  2VUB A;  5GAM d;  1KC8 R;  2KBT A;  2YHT A;  1BBZ A;  3RES A;  4RMO A;  2RPN A;  2KRN A;  3CC7 A;  5GAO r;  1BU1 A;  3I56 A;  3LGF A;  1G3Y A;  1MMG A;  2LVM A;  4M7A G;  1MV3 A;  4ZN1 A;  4FYY B;  2XD0 A;  1QKX A;  5AT1 B;  1IRE B;  2PZ1 A;  4ZN3 A;  2DVJ A;  4N0A C;  1V29 B;  4PL6 A;  2JNG A;  2E10 A;  3RKW A;  4F14 A;  4BDZ A;  2RB6 A;  3AT1 B;  4C8Q A;  3ZBD A;  2X3X D;  2XKO C;  3CCR Q;  2QA4 Q;  1AOJ A;  2KEA A;  1X01 A;  4M7A A;  1BYM A;  4OB0 B;  1VQO T;  3OSV A;  3LWI A;  3UF4 A;  2E70 A;  1KFZ A;  2X35 A;  3QBY A;  4X34 A;  2KR3 A;  4EDU A;  2E3I A;  2JTM A;  3JSC A;  2YUN A;  2FPD A;  3I9Q A;  4QKU A;  1OZ2 A;  3NMZ C;  4JJB A;  2LX7 A;  2DYB A;  4L59 A;  1X75 C;  2RJC A;  1EX4 A;  1M3A A;  1M27 C;  3JB9 D;  1D3B B;  1JB0 E;  2W10 A;  1K0X A;  3FC3 A;  1Y57 A;  4J6X A;  2JXB A;  4N4I A;  1UGQ B;  2XDB A;  4MDX A;  3P8H A;  9ATC B;  1Z9Q A;  1VQ6 A;  4LE9 A;  3DB4 A;  5KYU A;  2K2V A;  2KY9 A;  2LZ6 B;  1XTD A;  1M90 R;  1TTH B;  4M77 F;  3CXC A;  2YUO A;  4CC3 A;  4J9G A;  2K3X A;  3IQL A;  2EGA A;  4JS4 A;  3CBM A;  4JJD A;  4IIO A;  1PG5 B;  3ME9 A;  4CRI A;  2X3W D;  1HXD A;  4M7D E;  2XIC A;  1IGU A;  3PVQ A;  3CCR A;  2QA4 A;  3H0I A;  2RHZ A;  4M75 E;  2ZPH B;  4RG8 A;  2MMP A;  3OYE A;  4E7J A;  4J6W A;  2H3E B;  2CZ0 B;  1UGP B;  4M75 C;  4E7H A;  5GJW B;  4P5N A;  4C5E A;  1BIA A;  3CCU Q;  2EQI A;  4GBQ A;  4BY6 C;  1UUE A;  3JCM W;  4HCB A;  2A7Y A;  2JW4 A;  2QEX A;  1C0M A;  1VQL T;  1RAD B;  1VQ9 T;  1Z9Z A;  3OYG A;  1VQP Q;  4BUG A;  3VS6 A;  5GMK j;  1YIJ A;  1I8F A;  3H0H A;  2K9G A;  3N5B B;  4XU2 A;  3CCE Q;  2DA9 A;  3HFO A;  1NYG A;  1PD1 A;  2E5Q A;  5L8R E;  5CKH A;  4WTO B;  2ECZ A;  2QGF B;  3I55 A;  4RTU A;  2LCL A;  2LJ1 A;  1E6G A;  5J26 A;  3M0U A;  3TEE A;  3CC2 T;  1EIF A;  3OBW A;  3EG9 B;  3CPW A;  1TXQ A;  4B9W A;  4LNP A;  4EMK B;  1OUL A;  2IIM A;  2SRC A;  2VGM A;  1RAA B;  1RLP C;  1YI2 A;  4ZNX A;  4OB1 B;  4F7U F;  3C94 A;  2H8H A;  3CD6 T;  1W2B P;  1QCO A;  3BFM A;  1UG1 A;  1N5Z A;  1QLY A;  3CCU A;  1C1A A;  4ZGD B;  2SEM A;  1VOM A;  1M3C A;  2CH4 A;  5GAM f;  2L2P A;  2EJG A;  1K1Z A;  3DLM A;  4AMC A;  3NTH A;  1VQP A;  3VS7 A;  3G4S T;  4M77 B;  1E7O A;  1VQM T;  3CCM T;  4C0G A;  3CCV Q;  2DZ9 A;  3QXE B;  3OW2 P;  3UA6 A;  3CCE A;  2FRY A;  3PIO A;  4PJO E;  1AVZ C;  1WIE A;  1TWB A;  1S72 Q;  5LJ5 d;  5GAN f;  1IHV A;  4XTU A;  1HJD A;  1OZ3 A;  2PTK A;  4PJO C;  5FU6 C;  1D1C A;  3MO8 A;  2HD0 A;  4RTZ A;  5GAM j;  2KT8 A;  2DL7 A;  4MML A;  3HFN A;  4M7D G;  4DA4 A;  1VQ4 T;  1OU8 A;  1VQ8 T;  5GAN 8;  2DXT A;  2C0T A;  1ZBX A;  3MP6 A;  1AEY A;  4LD6 A;  2EYY A;  4L6V 5;  2DF6 A;  2KYB A;  1LCK A;  3QJY A;  1QW1 A;  1OYX A;  1CKA A;  5GMK m;  5GAN j;  1IO6 A;  2E1H A;  5CKF A;  3OW2 S;  4HCZ A;  4M7D A;  4BD3 A;  2L89 A;  2J6K A;  1ABO A;  4CI0 C;  2KQW A;  2RF0 A;  3CC4 T;  4RUG A;  2DMO A;  4M75 A;  5DLQ E;  4ELY C;  2HEQ A;  2QTX A;  3SWN C;  2E6Z A;  1WJR A;  4NOY A;  4DBR A;  3G6E T;  3I5R A;  4HCK A;  3CCV A;  2EGE A;  4LDW A;  4J9F A;  3VRY A;  1YCS B;  1Q81 R;  2PU9 B;  1BCO A;  2RK2 A;  3CME T;  5GAN 6;  4JUV A;  3MCA B;  4RCC A;  1AWX A;  2MF2 A;  4F7U B;  1Q81 C;  2ZPB B;  4BE1 A;  1LNX A;  1WJS A;  1SF9 A;  2JM8 A;  1BB9 A;  3JCM Q;  2DTO A;  2LC4 A;  2FYK A;  4C92 D;  2OJ2 A;  3SDZ A;  3FB9 A;  4QQG A;  4M78 E;  4A4K A;  2QAZ A;  5IXB A;  2P4R A;  4ZTJ A;  4LDU A;  2QAS A;  1ARK A;  4M78 C;  5GAN e;  1OV3 A;  1M3B A;  4QVC A;  1MMN A;  2EYW A;  5GAM g;  1WPY A;  1CSK A;  3OQ5 A;  2GTO A;  4FYV B;  3TU4 K;  1B7T A;  2V1Q A;  4M7D D;  3GNF B;  3UDC A;  2P4T A;  1JBM A;  4OMO A;  1I1J A;  4J9H A;  4J7I A;  2XMF A;  2ZPF B;  5DM7 R;  3T9N A;  3MHX A;  1WFW A;  5GAN g;  5LJ3 e;  1Q86 U;  1AWJ A;  1WHH A;  2EQJ A;  4FYW B;  2V1R A;  2E41 A;  2ZPI B;  1ZUY A;  2KSS A;  1M2V B;  3SD4 A;  3UWN A;  3F70 A;  2DRM A;  4FW1 A;  2RI2 A;  3CCQ A;  2RI5 A;  2LX9 A;  2DXU A;  2EWN A;  2KRO A;  4NS5 A;  1D1A A;  4PJO A;  4JRK A;  2R5M A;  2KK4 A;  4KUL A;  1Y0M A;  3OS2 A;  2LJ3 A;  1YWP A;  3OY9 A;  1MUZ A;  2RI3 A;  4HCC A;  4LUE A;  4X9D A;  2VV5 A;  2V8K A;  1BI1 A;  4MZT A;  3JV3 A;  3EAE A;  1X27 A;  3NHN A;  3M57 A;  4XU1 A;  3R6O A;  1RAF B;  2FG0 A;  5CKB A;  4IUP A;  2RHY A;  4E7I A;  5HK0 A;  2NUZ A;  1YWO A;  2DLP A;  3OBY A;  3VKI A;  2OI3 A;  2ZAE A;  3QWY A;  2CUB A;  2OAU A;  2EJF A;  4OB2 B;  4KH1 B;  3QO3 A;  1JXM A;  3EGD A;  1B34 A;  3EFR A;  3CCS T;  2L3P A;  1BI0 A;  1YIT T;  1VQ5 T;  2XDP A;  1G3W A;  1ZBJ A;  3OW2 A;  4DQ2 A;  1VUB A;  2EYZ A;  4E7Z A;  2EKO A;  2P0Q A;  2CP6 A;  2ZGW A;  5GAO q;  1NJI U;  2WAC A;  2RJD A;  1F1B B;  2K3B A;  4RTV A;  3CXC P;  1QVG P;  2YT6 A;  4KUI A;  3VYG A;  1O75 A;  2CSQ A;  2DO3 A;  4AFZ C;  1UB4 A;  2MOX A;  1PRM C;  5CAI A;  3E2U A;  4PLL A;  3JCM c;  5LJ5 j;  5A0L A;  3RR6 A;  2LQK A;  2DXB A;  1KC8 U;  3Q1J A;  2Z0W A;  2E3H A;  4JZ3 A;  1D1B A;  5KH6 A;  2KGT A;  4BB7 A;  2K6D A;  4FYX B;  1FXX A;  4BY6 B;  1D0Z A;  1PM3 A;  2YXY A;  1Q86 C;  1K0S A;  4UC4 A;  2DL8 A;  1H3H A;  2DK3 A;  4JRI A;  2ESW A;  4AFU C;  2NWM A;  5AYF A;  3EH2 A;  8AT1 B;  3D7S B;  3LGL A;  4B6M A;  1GFC A;  1YFN A;  4M78 A;  4HT8 A;  5D6Y A;  1VYT A;  4F17 A;  1UJ0 A;  2RK1 A;  1QCF A;  4EMH A;  3CCJ T;  2MCN A;  2DIQ A;  2L5Q A;  2DTI A;  3VS3 A;  1QVG S;  4DBH A;  1NEG A;  2ABL A;  5D7U A;  3M0T A;  3CC7 Q;  2KVQ G;  2DEQ A;  5IH2 A;  1OPK A;  1K9A A;  5HY6 A;  3CQT A;  3I56 Q;  2RJF A;  2CH4 W;  2D1X A;  3O5Z A;  2JOY A;  2DPP B;  4RTT A;  5D6W A;  2ED0 A;  1NYF A;  2EYX A;  1ZUK A;  2RJE A;  1RAH B;  5KYW B;  4MDW A;  1M9S A;  5FU7 C;  1IB8 A;  1UDL A;  3UA7 A;  2IPO B;  2DER A;  1ZX6 A;  3J7A F;  1ZSZ C;  1VQ7 T;  2EW3 A;  3G1J A;  1N27 A;  5GAN 5;  3M59 A;  2I2L A;  1YNZ A;  2ZCF B;  5GAM h;  2E65 A;  4C0D B;  1IXD A;  2FZG B;  4LN2 A;  4WF2 A;  2QDL A;  3CPF A;  2WSC E;  4RCB A;  1U8R A;  2DZC A;  2GBQ A;  5GAO p;  1M90 U;  3TQ7 P;  1UTI A;  4M78 F;  2HQE A;  5LJ5 g;  1KD1 R;  1NZ9 A;  5GAN 3;  3BE3 A;  5GAN h;  2OTJ Q;  2KRM A;  1KD1 C;  3FDR A;  1N9S A;  4XK8 E;  5FWC A;  4XTX A;  2F2W A;  3JB9 I;  1KC8 C;  1X6G A;  2ZPE B;  4AG2 C;  2EPD A;  2AK5 A;  1VQ6 Q;  3MPU B;  1QCN A;  5CKD A;  1NG2 A;  2WSE E;  3CC2 A;  2OX7 A;  3UAT A;  2WSF E;  1GBQ A;  3CCL Q;  4ATO A;  5GAN d;  1I0C A;  5KCO A;  4IKF A;  1VYU A;  1DJ7 B;  2HCK A;  3PE0 A;  1W4S A;  2GQI A;  3MET A;  2QGG A;  3CD6 A;  2LCS A;  1LPL A;  1WLP B;  3OYH A;  5ECA A;  1FYN A;  2LT1 A;  2E5K A;  2M51 A;  4O5V A;  1ZSG A;  2FEI A;  1I07 A;  4JJC A;  2NUP B;  2CT4 A;  2AZV A;  3REA B;  2E12 A;  3SWN B;  5LJ3 d;  2NYS A;  4KH0 B;  2QEX Q;  4R55 A;  3PVL A;  3MP1 A;  3G71 T;  2DXC A;  3P8B B;  2OTJ A;  1YIJ Q;  2B8A A;  4C92 E;  2M9U A;  1I4K 1;  1OX9 A;  3EG0 A;  3FEO A;  3A5Z B;  2FZK B;  3H8Z A;  2XDD A;  1T3S A;  1Y96 B;  3KBG A;  5GAO l;  3RIR A;  1RI0 A;  3I55 Q;  4J9I A;  3CCL A;  3E19 A;  3CMA T;  1QVG A;  1YHQ Q;  5I2M A;  1Y7X A;  1M90 C;  2GQV A;  1VQ8 A;  5GAO n;  2DM1 A;  2QQB A;  4C8Q F;  3KXT A;  2XG8 D;  1PKT A;  4DOW A;  4E7S A;  2CDT A;  4PJM A;  1A0N B;  1YI2 Q;  3HL8 A;  2HKN A;  1OOT A;  4M7A F;  3H6Z A;  4M7D C;  5GMK i;  2EBP A;  1I5L A;  2CZ1 B;  3QYG B;  2JVV A;  2CGH A;  1EFN A;  1ZSZ A;  4M77 D;  5FLX E;  2HBP A;  2V8I A;  2F1L A;  1IRX A;  5KE2 A;  1ZQ1 A;  7AT1 B;  2PNI A;  4GY5 A;  1RAC B;  3ASK A;  4MZP A;  1SRL A;  5DLO A;  3OS1 A;  2VXE A;  1Q82 R;  2NUT B;  1UE9 A;  1YJW Q;  2PVD B;  2J05 A;  1FX7 A;  3VS4 A;  3GNG A;  2LJ0 A;  3CME A;  1NE8 A;  1NM7 A;  2JMA A;  3URG A;  2DNU A;  3VRZ A;  2LQW A;  2X4J A;  3PMT A;  5KYX B;  2DL4 A;  2PQW A;  2V26 A;  1R0C B;  5KYY B;  2OTL T;  2GTJ A;  4JRP A;  1YHQ A;  1TUG B;  2O4X A;  2M16 A;  3JCM f;  4DOV A;  4ZTF A;  2RD1 A;  3C4S A;  5L23 A;  1X6O A;  5GAN 2;  1JEG A;  1KIK A;  3RBB B;  5IXF A;  2F5T X;  4NL3 A;  1Q7Y R;  1Q81 U;  2VXF A;  1R8O B;  5IHK A;  2VYT A;  1PWT A;  2YSQ A;  3MEU A;  4KUD K;  4DBF A;  5LJ5 h;  3V7C A;  4RTY A;  1AWW A;  1LOJ A;  1Q7Y C;  3BW1 A;  2VB6 A;  4KGZ B;  1M1K R;  1YJW A;  1QWF A;  3OYC A;  5HKC A;  4C92 G;  3A98 A;  3M0R A;  4N4G A;  3M55 A;  1VQK Q;  1GRI A;  3OYY A;  4C8Q B;  1B3Q A;  2COW A;  5DY9 A;  4F16 A;  2CS7 A;  3VUZ A;  1GCQ A;  2FB7 A;  5GAN 4;  5A0G A;  1G3S A;  3BDL A;  5IHI A;  4M7A B;  2QXF A;  1N8R R;  1SHG A;  4KT0 E;  3HRU A;  4Z02 A;  3MEW A;  4A4E A;  4C92 A;  1WI7 A;  1N8R C;  2GGR A;  3M0P A;  4HA8 A;  4PNO A;  4VUB A;  3GF5 A;  1YJN A;  3TSW A;  5CQX A;  1PHT A;  1G2B A;  2RH2 A;  3THK A;  5LJ3 f;  2BZ8 A;  4X1V A;  3RMQ A;  3V8L A;  2D0N A;  2JUF A;  3L2Z A;  5FRM A;  5IAY A;  1KQ2 A;  3EG1 A;  3M53 A;  2COZ A;  4C5I A;  2RMO A;  2DRK A;  1K8A R;  2M0Y A;  1VQN Q;  3HPW A;  3CCR T;  2QA4 T;  5KE3 A;  5KYU B;  3OS0 A;  2ED1 A;  3JCM e;  2LMJ A;  4CC2 A;  1BK2 A;  3NPF A;  3DKM A;  1KQS P;  1YIT A;  1VQ5 A;  2M1H A;  2CP5 A;  2RQW A;  1AZE A;  1KHI A;  4C0F A;  2RQV A;  1VQK A;  3HKS A;  5I21 A;  3DLL A;  2BKD N;  3RMS A;  5LJ3 j;  2YLB A;  3OYN A;  2ENM A;  3GOX A;  2FZC B;  4ORZ A;  3INZ A;  3QDF A;  1NBE B;  4FSS A;  4B9X A;  3CCQ Q;  3CBP A;  1RAG B;  5I2S A;  4ZGJ B;  2H3J A;  3A8H B;  5IT9 E;  3NGP A;  4IUV A;  2D9T A;  1YJ9 Q;  3EG3 A;  2CSI A;  1TU0 B;  3OYD A;  4OMM A;  3EGX A;  2KAF A;  2OAW A;  1KQS S;  1IGQ A;  5FW9 A;  1M5Q 1;  6AT1 B;  2YUQ A;  4XU0 A;  2LT4 A;  3RNJ A;  2Y4X A;  2BZY A;  4M7D F;  2FO0 A;  1BI3 A;  3UPU A;  1VQN A;  3OYM A;  3CCJ A;  2X9H A;  4M75 F;  4ZGE B;  1D09 B;  2IVW A;  2DE0 X;  3M0Q A;  3A8O B;  2FVU A;  3QII A;  1FMK A;  2XK0 A;  4XU3 A;  2D0Q B;  4WCI A;  3V8K A;  1ZA2 B;  3HP9 A;  2QQA A;  3LLR A;  3CCU T;  2VWF A;  3EFO A;  1JJ2 P;  2VKN A;  1H3Z A;  4E7K A;  2FHD A;  3RER A;  3O8V A;  3S3N A;  2DL5 A;  5HK3 A;  3WVD B;  3MP8 A;  1VQP T;  5I11 A;  1WQW A;  4QQ6 A;  3REB B;  1WHG A;  1FWZ A;  2DIG A;  3G7Z A;  4ELZ C;  5GJV B;  3QSU A;  2A08 A;  3OYK A;  3JAM E;  3CCE T;  2YRC A;  1VQ7 A;  3OYI A;  2AKL A;  1YJ9 A;  2CYZ B;  5LJ3 g;  3NFC A;  1VQO Q;  4JPB W;  1RAI B;  2QQR A;  4PKC C;  4PK4 A;  1QVP A;  3EGU A;  1I5O B;  4FT4 A;  1VA7 A;  3VS2 A;  2KE9 A;  3L2U A;  2MIO A;  1IZ6 A;  2YDL A;  1ZHI A;  1UEC A;  2D8H A;  1Y71 A;  1M1G A;  4FCY A;  1JXO A;  4J6Y A;  1JJ2 S;  2RO0 A;  4OP0 A;  2CT3 A;  4QT7 A;  4E47 A;  3EG2 A;  4FIB A;  1ZLM A;  4CC7 A;  2CP3 A;  2Y90 A;  1G8X A;  3JB9 H;  2K5F A;  1WA7 A;  1M8M A;  3I35 A;  2CZ7 B;  1WXT A;  2DAQ A;  2JN0 A;  2CRE A;  2LTO A;  2YRD A;  2DTH A;  4J9B A;  1U5S A;  4FL6 A;  2P0P A;  4M77 E;  1RAB B;  1O9S A;  5CKE A;  2ROL A;  1ZUU A;  1YN8 A;  5HCK A;  3HSB A;  1B07 A;  5FRO A;  3CCV T;  2LDM A;  4M77 C;  1KD1 U;  3V7S A;  4PJO F;  4M7D B;  3ZEH A;  1S72 T;  1T3L A;  1YBY A;  1KG1 A;  2RHI A;  2O88 A;  4M75 B;  1VQO A;  4V2S A;  1N6A A;  1VIF A;  1D3B A;  1OU9 A;  4AG1 C;  2MI6 A;  3H0F A;  2BZX A; 
#chains in the Genus database with same CATH homology
 2B86 A;  2E5K A;  2M51 A;  2H8H A;  1ZSG A;  4R0K A;  2FEI A;  1I07 A;  4JJC A;  4M4Z A;  2D8J A;  4Z88 A;  2O2O A;  2CT4 A;  2AZV A;  3REA B;  1UG1 A;  1N5Z A;  1QLY A;  1JO8 A;  2AKK A;  3C0C A;  1PNJ A;  2KT1 A;  2SEM A;  3PVL A;  1M3C A;  2CH4 A;  2L2P A;  1K1Z A;  1T0J A;  4OMN A;  3H41 A;  1AZG B;  1JQQ A;  1MV0 B;  3VS7 A;  1E7O A;  1V1C A;  3EG0 A;  1WX6 A;  1NEB A;  1X2K A;  3UA6 A;  1W70 A;  2FRY A;  3ZL7 C;  1T3S A;  1AVZ C;  2RN8 A;  2K2M A;  1WIE A;  2EGC A;  1HJD A;  1GCP A;  4J9I A;  3TVT A;  4AFS C;  2PTK A;  5IHN A;  5EC7 A;  1VYV A;  1UHC A;  3KFV A;  4HVV A;  2DM1 A;  4K11 A;  1RI9 A;  4RTZ A;  1PKT A;  2DL7 A;  2KT8 A;  1K4U S;  2CDT A;  1TUC A;  1A0N B;  4IIM A;  1CKB A;  1OOT A;  2JT4 A;  4RTW A;  4HXJ A;  2EBP A;  1GL5 A;  2C0T A;  2L0A A;  2FPE A;  4OMP A;  1AEY A;  2C0I A;  1EFN A;  2EYY A;  2DF6 A;  2KYB A;  1LCK A;  1QKW A;  1CKA A;  1IO6 A;  1HD3 A;  2PNI A;  2J6K A;  1ABO A;  5FWB A;  1SRL A;  2RF0 A;  2O9S A;  4RUG A;  2DMO A;  1UE9 A;  1WDX A;  2HEQ A;  2C0O A;  2GNC A;  2J05 A;  4AFQ C;  2VVK A;  3I5R A;  1X69 A;  3VS4 A;  4HCK A;  1TUD A;  2EGE A;  4J9F A;  3VRY A;  2LJ0 A;  3SEM A;  1YCS B;  2DJQ A;  1K76 A;  1NM7 A;  2JMA A;  4E6R A;  5I22 A;  1AD5 A;  2DNU A;  3VRZ A;  1XOV A;  2LQW A;  2DL4 A;  2JTE A;  2L3S A;  2O31 A;  2KXC A;  2GTJ A;  1AWX A;  4JZ4 A;  2KRS A;  1M30 A;  1RUW A;  2J6F A;  2J7I A;  5L23 A;  2JM8 A;  1BB9 A;  2HSP A;  3VS0 A;  3LH5 A;  2FPF A;  2OJ2 A;  1JEG A;  2AZS A;  1KIK A;  5IXB A;  2P4R A;  3RBB B;  2LP5 A;  5IXF A;  4KRT A;  2O9V A;  1ARK A;  1JU5 C;  2KXD A;  5IHK A;  1PWT A;  2YSQ A;  1OV3 A;  1M3B A;  4RTY A;  1AWW A;  2KYM A;  2K79 A;  1NLP C;  4D8K A;  2EYW A;  1CSK A;  2GTO A;  1WXB A;  4EIK A;  1GCQ C;  2V1Q A;  1X6B A;  4J9D A;  1UFF A;  1QWF A;  4Z8A A;  4OMO A;  1I1J A;  1G83 A;  3A98 A;  1UJY A;  3M0R A;  4J9H A;  3GBQ A;  1W6X A;  3EHR A;  2EVR A;  3VS5 A;  1SPK A;  2XMF A;  1GRI A;  3SHW A;  1B3Q A;  1WFW A;  4F16 A;  1S1N A;  1AWJ A;  1YP5 A;  1GCQ A;  2RQU A;  5IHI A;  2V1R A;  1ZUY A;  1SHG A;  1QWE A;  2F2X A;  5ECA A;  4Z89 A;  1GFD A;  2DRM A;  1SHF A;  1WI7 A;  3I5S A;  2F2V A;  1J3T A;  2GGR A;  1HSQ A;  3M0P A;  2A28 A;  1NLO C;  2KRO A;  3TSW A;  2FRW A;  1PHT A;  1G2B A;  3THK A;  1Y0M A;  1H8K A;  2LJ3 A;  1YWP A;  2BZ8 A;  4X1V A;  1MUZ A;  4LUE A;  1E6H A;  2D0N A;  2A36 A;  3JV3 A;  4LUD A;  1X27 A;  3EG1 A;  3NHN A;  2RMO A;  2RQT A;  2JS0 A;  2DRK A;  2FG0 A;  2M0Y A;  1T0H A;  2EKH A;  4OML A;  1SEM A;  4ESR A;  1ABQ A;  3U23 A;  2NUZ A;  2ED1 A;  2K7A A;  1YWO A;  2LMJ A;  2A37 A;  2DLP A;  1BK2 A;  3EHQ A;  4CC2 A;  3NPF A;  2CUD A;  2JS2 A;  1W1F A;  2OI3 A;  3VS1 A;  3QWY A;  2CUB A;  2RQW A;  1AZE A;  1GBR A;  1JXM A;  2RQV A;  2RNA A;  2L3P A;  1ZBJ A;  2HDA A;  3TSZ A;  1OPL A;  2ENM A;  2EYZ A;  2KBT A;  1PRL C;  1BBZ A;  4ORZ A;  2RPN A;  2KRN A;  2W0Z A;  4FSS A;  2K3B A;  4RTV A;  1BU1 A;  1PKS A;  1MV3 A;  2YT6 A;  1QKX A;  2PZ1 A;  3NGP A;  2CSQ A;  1X43 A;  2DVJ A;  4AFZ C;  2MOX A;  1PRM C;  2G6F X;  3EG3 A;  3ULR B;  2CSI A;  4OMM A;  2BTT A;  4F14 A;  2DIL A;  2LNH B;  2OAW A;  2X3X D;  1AOJ A;  2KEA A;  4JZ3 A;  5FW9 A;  2KGT A;  2K6D A;  2YUQ A;  1RLQ C;  4A63 B;  3RNJ A;  2BZY A;  2FO0 A;  1K0S A;  2DL8 A;  1H3H A;  3UF4 A;  2ESW A;  4AFU C;  2NWM A;  1KFZ A;  2KR3 A;  1U06 A;  1GFC A;  2DX1 A;  2DE0 X;  3M0Q A;  1VYT A;  2J06 A;  4F17 A;  1UJ0 A;  2YUN A;  2FPD A;  2J6O A;  1QCF A;  2L3Q A;  3I9Q A;  2MCN A;  1FMK A;  4J9E A;  3NMZ C;  4JJB A;  4WCI A;  2LX7 A;  4CC4 B;  2DYB A;  3VS3 A;  2VWF A;  1M27 C;  1M3A A;  2ABL A;  1NEG A;  1SRM A;  1AWO A;  2RQR A;  2VKN A;  2W10 A;  1K0X A;  3M0T A;  1Y57 A;  2DBM A;  1OPK A;  1WYX A;  5IH2 A;  1K9A A;  2JXB A;  2DL5 A;  3CQT A;  2CH4 W;  2D1X A;  3O5Z A;  5I11 A;  4RTT A;  4HVW A;  3REB B;  1Z9Q A;  2ED0 A;  2ROT A;  2LQN A;  4LE9 A;  1NYF A;  2EYX A;  1U3O A;  1X2Q A;  1ZUK A;  5GJV B;  2A08 A;  2LZ6 B;  4J9C A;  4Y92 A;  2I0N A;  2YUO A;  4CC3 A;  4J9G A;  2AKL A;  3IQL A;  2EGA A;  1UDL A;  4JJD A;  3UA7 A;  4IIO A;  1ZX6 A;  2X3W D;  2DBK A;  4JPB W;  2HBW A;  4OMQ A;  2EW3 A;  1OEB A;  3PVQ A;  3EGU A;  3H0I A;  3VS2 A;  1VA7 A;  1H92 A;  2KE9 A;  4D8D A;  1YNZ A;  2MIO A;  1WXU A;  2YDL A;  1UEC A;  4LN2 A;  2D8H A;  1TG0 A;  3M0S A;  4RTX A;  1UHF A;  2QDL A;  1JXO A;  2JMC A;  2GBQ A;  5GJW B;  2CT3 A;  4QT7 A;  3EG2 A;  1UTI A;  2EQI A;  4GBQ A;  1UUE A;  1ZLM A;  2JW4 A;  4CC7 A;  1KSW A;  1SSH A;  1Z9Z A;  1WA7 A;  1M8M A;  2KRM A;  3I35 A;  3VS6 A;  1WXT A;  2CRE A;  3H0H A;  2K9G A;  5FWC A;  2F2W A;  4J9B A;  4DEX A;  2KNB B;  3QWX X;  2DA9 A;  1U5S A;  1X6G A;  3FJ5 A;  3R6N A;  2EPD A;  4AG2 C;  1NYG A;  2AK5 A;  2ROL A;  1NG2 A;  1ZUU A;  1YN8 A;  5HCK A;  4GLM A;  1B07 A;  1UGV A;  2ECZ A;  4HVU A;  3UAT A;  2JM9 A;  4DEY A;  1GBQ A;  4RTU A;  2LJ1 A;  1E6G A;  3M0U A;  1I0C A;  1T3L A;  1VYU A;  2HCK A;  3PE0 A;  2O88 A;  2GQI A;  4LNP A;  1KJW A;  2IIM A;  2SRC A;  2LCS A;  1RLP C;  1WLP B;  4AG1 C;  2DL3 A;  3H0F A;  4ZNX A;  2YUP A;  2BZX A;  1FYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...