2DA9A

Solution structure of the third sh3 domain of sh3-domain kinase binding protein 1 (regulator of ubiquitous kinase, ruk)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GSSGSSGDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-domain kinase binding protein 1
publication title Solution structure of the third SH3 domain of SH3-domain kinase binding protein 1 (Regulator of ubiquitous kinase, Ruk)
rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2da9A00
2RNAA 1ZUYA 1UJ0A 4J9FA 2MIOA 1UDLA 2O9VA 4J9BA 4GLMA 4JZ4A 1VYTA 4HVUA 3RBBB 5FW9A 1MV0B 1SSHA 2X3WD 2G6FX 4HCKA 4AG1C 2EYZA 1K0XA 2M0YA 1KSWA 2M51A 5FWCA 4FSSA 1UGVA 1GFDA 2J06A 2SRCA 2DJQA 1X27A 1V1CA 2DRMA 2KT1A 3M0UA 2ROLA 4F16A 2KR3A 2L2PA 5IXFA 2W10A 4J9GA 5IHIA 2VVKA 2YUQA 3U23A 4R0KA 5GJWB 4OMNA 1W1FA 3EG2A 4J9CA 2AZVA 3M0PA 2KYMA 1ZSGA 2RQUA 2SEMA 4QT7A 1S1NA 1NYFA 2B86A 5ECAA 3EHQA 4OMLA 1ARKA 1OPLA 2ED1A 4GBQA 2RQRA 3I5RA 4RTWA 2CDTA 3QWXX 5I22A 1X6GA 1LCKA 1VA7A 3CQTA 3A98A 1ZUUA 5IXBA 1E7OA 2LX7A 1G2BA 2LJ3A 1K1ZA 2X3XD 1AZEA 2V1QA 1PRLC 1M3CA 3C0CA 1PHTA 1YN8A 1B07A 3VS4A 2O9SA 2J7IA 2L3QA 2DX1A 1XOVA 4RTTA 1PKSA 2I0NA 2DL5A 2DILA 3PVQA 1E6GA 1UG1A 2HBWA 1YP5A 3EHRA 1SEMA 2J05A 2CT4A 2F2VA 1KJWA 4AFSC 2EGEA 3H41A 1I1JA 1QKXA 3M0RA 1U5SA 2D0NA 2KRMA 5EC7A 4HVVA 2K7AA 2JMCA 3ULRB 2DRKA 1HD3A 2A08A 1GBQA 3VS2A 1G83A 2FO0A 1N5ZA 2AZSA 1ABOA 1E6HA 1WI7A 4Y92A 4EIKA 1GL5A 2GTOA 1NEBA 4CC7A 2BZXA 2XMFA 2DL7A 3VS7A 2L3SA 3NMZC 1X43A 4WCIA 1X2KA 1A0NB 2C0TA 3KFVA 1H8KA 4D8DA 2YSQA 2JM9A 1OEBA 1PRMC 1RUWA 1I07A 1K0SA 1WX6A 2GTJA 5FWBA 2L0AA 1PNJA 4JJDA 1FYNA 3VRZA 1B3QA 3REAB 1WIEA 1X6BA 1GFCA 2EQIA 2LNHB 2EW3A 2IIMA 1ABQA 2DBMA 2JS0A 1PWTA 2CSIA 2RQWA 2FRYA 2KBTA 2MOXA 3O5ZA 2RQVA 4OMPA 1TUDA 3UF4A 3I35A 1J3TA 1WXUA 1OPKA 1X2QA 3PE0A 2DVJA 1K9AA 2ENMA 1MV3A 2HDAA 1QLYA 2H8HA 1WDXA 2DA9A 1M3AA 2KEAA 1SHFA 3TSZA 1NG2A 1UHFA 1I0CA 3VS6A 1H3HA 4JJBA 2K3BA 2NUZA 2EBPA 1MUZA 4AFUC 2C0IA 4IIOA 1X69A 5I11A 1M30A 4RTZA 2EPDA 2JM8A 4JJCA 1NLPC 4J9EA 2EVRA 1NYGA 3I9QA 2EGCA 2LCSA 4DEXA 1M3BA 4DEYA 5IHKA 1W70A 1EFNA 1U06A 2GQIA 2KXDA 4CC2A 4CC4B 1VYUA 1AD5A 3EG3A 2KGTA 1NLOC 2DL3A 2DLPA 1YCSB 2LJ0A 2K79A 1H92A 1UTIA 5HCKA 1JXOA 2CT3A 2RMOA 1VYVA 2GNCA 2E5KA 2YT6A 2D8JA 3EG1A 2O2OA 1CKBA 1QKWA 4RTUA 2KNBB 3UA7A 4F14A 1AWXA 1RLPC 3VS5A 2A36A 1WXTA 4RTVA 1QCFA 3SHWA 1GRIA 3TVTA 1TUCA 1W6XA 2EYYA 4J9DA 3VS1A 2JT4A 1AVZC 1JXMA 2NWMA 2J6OA 2L3PA 2CSQA 1JEGA 3THKA 3NGPA 4KRTA 3SEMA 1AZGB 2QDLA 4LN2A 1AWOA 3NPFA 2J6FA 2DM1A 2CUBA 2LP5A 1KIKA 2CH4W 1JQQA 1GCQC 1OV3A 2P4RA 1HJDA 3R6NA 2OAWA 3REBB 1BK2A 2DMOA 1ZUKA 2BZ8A 1RI9A 4D8KA 4RUGA 2ED0A 2FPFA 1Y57A 3M0SA 2RQTA 1T0HA 2F2XA 2VWFA 1WYXA 1K4US 4ESRA 2J6KA 2EKHA 3UA6A 2EYXA 3ZL7C 1M27C 1BB9A 1WXBA 2ESWA 2DE0X 2ECZA 3LH5A 2HSPA 2PZ1A 1JO8A 1CKAA 4J9IA 2KXCA 1UFFA 2FEIA 1QWEA 4LUEA 4HXJA 1ZX6A 4ORZA 2MCNA 1WA7A 1AWJA 2LQNA 4OMQA 2DL8A 2K6DA 2KYBA 2K2MA 2FPEA 2YUPA 2VKNA 2GBQA 1AWWA 4AG2C 2HCKA 1AOJA 1NM7A 3H0HA 2JTEA 2CH4A 5IH2A 2GGRA 3QWYA 1GBRA 1WFWA 4LNPA 4X1VA 2JS2A 1YWPA 1T3SA 2HEQA 3H0FA 1BU1A 4LUDA 3VRYA 2FPDA 1IO6A 2DNUA 4AFQC 1UE9A 1AEYA 1GCQA 1KFZA 4Z8AA 2LMJA 2K9GA 1CSKA 4K11A 2AKLA 2AK5A 2CREA 2OJ2A 2AKKA 1SRLA 1U3OA 1NEGA 2JW4A 4RTXA 1YNZA 2F2WA 4Z88A 3FJ5A 2YUOA 2BZYA 2D8HA 1SPKA 1WLPB 2DL4A 4Z89A 2O88A 4OMOA 2OI3A 1ZBJA 4LE9A 2LZ6B 2C0OA 2A37A 4E6RA 3M0QA 1BBZA 1OOTA 2LJ1A 2KT8A 3UATA 1UJYA 2ROTA 2PNIA 2A28A 3TSWA 3H0IA 4HVWA 1FMKA 2LQWA 3RNJA 3JV3A 4CC3A 2W0ZA 1UHCA 3I5SA 1PKTA 3VS3A 5IHNA 4ZNXA 2RN8A 2PTKA 4A63B 1M8MA 5L23A 2RPNA 1HSQA 2CUDA 3IQLA 3EGUA 5GJVB 4IIMA 1K76A 2EYWA 2EGAA 2FG0A 1Z9ZA 4RTYA 2DBKA 4J9HA 2KROA 2KRNA 2O31A 1JU5C 1TG0A 2KRSA 1SRMA 1YWOA 2V1RA 3PVLA 2YUNA 1GCPA 1RLQC 1UECA 2YDLA 1T0JA 2JMAA 4M4ZA 4AFZC 3VS0A 1ZLMA 2D1XA 2RF0A 4JPBW 4F17A 4JZ3A 4OMMA 3EG0A 2BTTA 1QWFA 2DF6A 1Z9QA 1SHGA 2ABLA 1UUEA 3NHNA 1Y0MA 2FRWA 2KE9A 3M0TA 1T3LA 2DYBA 3GBQA 2JXBA
chains in the Genus database with same CATH superfamily
1VQNA 1ZSZA 1ZUYA 3A8LB 1UDLA 4J9BA 1Q7YC 1VYTA 5FW9A 2DFUA 2EJFA 4Z02A 4E7JA 2NLUA 3CCLQ 1KSWA 3EG9B 4BE0A 1GFDA 3G71T 3QKJA 1X27A 2DRMA 3OBWA 4DBFA 3CC4Q 2DYIA 3FB9A 4IUVA 2KT1A 4PJLA 2ROLA 1JBMA 2KR3A 3I55T 1VQ4T 2ZCFB 2L2PA 5IXFA 5IHIA 2VVKA 2L89A 2YUQA 1ACMB 1M2VB 4M75B 4N0AC 4OMNA 2K57A 5IN1A 3PTAA 1D1CA 1IREB 2O01E 1IRXA 2L5QA 4QT7A 4DBHA 4NL3A 4M77G 2E70A 1RI0A 2QGFB 3CMAT 2A3LA 3CXCP 3I5RA 1UEBA 3CBMA 3ZEHA 5IXBA 1E7OA 2LX7A 4PLLA 2XI9A 1QW1A 1TOVA 2X4XA 1VQKT 2X3XD 2V1QA 1PRLC 4PJMA 3PNWC 1I4K1 2O9SA 5CKFA 3PIOA 4M7AD 1QCOA 3CMEQ 5D7UA 1WHHA 4LDYA 3RERA 3JB9F 3PVQA 4ANJA 3I56A 1O75A 3X25B 1VQ6A 3EHRA 1UGRB 1QP2A 5J3BA 3A8MB 4M77C 4GY5A 1KJWA 3A8OB 4AFSC 1YI2A 3KBGA 5CIUA 1I1JA 3M58A 4M78B 3KUFA 3J81E 4D6WA 2A08A 3MJXA 5GANj 1G83A 3L2WA 1Q86C 5LJ5d 2MWOA 4NOYA 3HKSA 4X34A 2XK0A 4Y92A 3OS1A 3GNGA 1Y07A 3HRUA 3QHSA 4ME7A 4CC7A 2DL7A 2L3SA 3NMZC 3E19A 4WCIA 2QTVA 4IKFA 4XTUA 3CD6Q 3FRNA 2JTMA 4A4GA 5CKHA 3G4SA 1OX8A 3CBPA 1M5Q1 4C0FA 2F1LA 1WHKA 1OEBA 1PRMC 1RAIB 3OA6A 1K0SA 3MEVA 4J6XA 4M75D 2K5FA 1WX6A 2JN0A 2L0AA 1PSEA 2VGNA 1OU8A 1X6BA 1BIBA 2X51A 4JRKA 1YCYA 2LNHB 5D6YA 2P0KA 2IIMA 1ABQA 2JS0A 2IPOB 1YJWT 1PWTA 3V7RA 2DETA 1MNDA 4C92F 1YITQ 2KBTA 2KMTA 3OYGA 3UF4A 2LT4A 3PE0A 5FRMA 5L8RE 1M8VA 2ENMA 1MMGA 2RJDA 3G6EA 4C8QA 1JRIA 3P8BB 3N5BB 1QLYA 2H8HA 1WDXA 3QIIA 3QDFA 1VQ9Q 1PG5B 1VQLA 2NUPA 4BI4A 2EQMA 3M56A 2NUZA 4EMKC 4DOVA 1I5OB 2RJEA 2V8KA 4RTZA 1KQ1A 1Q82C 3VYHB 4JJCA 1NLPC 4OVAA 2PVGB 5IHKA 4PKCC 3JCMd 2GQIA 2COZA 1VYUA 3EG3A 2E12A 1V29B 1G5VA 3CXCS 2LJ0A 1MNEA 3EFSA 2RI5A 5HCKA 4FW1A 4JRIA 3UWNA 5C0MA 1D1BA 4ZN1A 2HSEB 1M1KU 2DVEA 4AT1B 5LJ3g 1Q81R 1QKWA 1EZZB 1PSFA 4RTUA 1YI2T 3UA7A 5HK0A 1AWXA 1RLPC 4QQ6A 3SHWA 5CCAA 3TVTA 1W6XA 1O9SA 4J9DA 2RK2A 2DXCA 1S72Q 2EYQA 2J6OA 4C5GA 1YIJT 5KYYB 3NGPA 4KRTA 3SEMA 3A8HB 4HT9A 5DY9A 3M59A 2J6FA 2HNIA 4F7UE 1KIKA 1VOMA 1F1BB 3GLXA 3R6NA 4LD9K 5GMKi 3CCUT 2MYSA 3FEOA 2EKOA 3V7CA 4O6JA 2RQTA 1T0HA 1WYXA 5CQXA 4II1A 2EKHA 2WSFE 1Q81U 3ZL7C 1BB9A 2HSPA 1ZSZB 2P84A 3OMCA 2KXCA 3J7AF 1VIEA 4HXJA 1ZX6A 4ORZA 4OB1B 2MCNA 2LQNA 3L2ZA 2DL8A 3RKXA 2K2MA 4KUDK 2RHIA 2M1HA 3RDVA 2Y90A 3OYDA 2QGGA 4AG2C 2HZYA 3ZBDA 1NM7A 2FVUA 2DZ9A 3G6ET 1K8AR 3MPUB 2QK0A 1N8RC 2RHXA 2ZPHB 2QQAA 2FPDA 1VQLT 2RI2A 2DNUA 5C6SA 4FT2A 1AEYA 1WGSA 3L1AA 4Z8AA 3OYYA 3QSUA 2K9GA 5I21A 3OY9A 3CCLA 1CSKA 2AK5A 2KI7A 1P92A 4HKEA 4MDWA 1HYOA 4OB3B 1ZQ1A 3CC4A 4M78F 4NS5A 3MP1A 4Z88A 3FJ5A 2YUOA 4O5VA 1OI1A 2D8HA 3A1PA 2DL4A 3CCMQ 4MZMA 2MK5A 3M9QA 2DPPB 4LE9A 2LZ6B 2A37A 3EGDA 3JSCA 2V26A 1BBZA 1OOTA 2LJ1A 2KT8A 3NTKA 2XDBA 1VQ8A 1K8AU 2COWA 1FMKA 3X24B 2LQWA 4CC3A 2W0ZA 1TUGB 5IHNA 4ZNXA 1QVFS 2RN8A 2PTKA 4PJOA 4A63B 1M90R 5IAYA 3IQLA 3QPHA 1VIFA 1K76A 2EGAA 3QDRB 4RTYA 4J9HA 4M7DA 4BY6B 3CMEA 5LJ5g 1FMWA 1IGUA 1LNXA 1T0JA 1XTDA 4BDYA 3P8DA 2D0QB 4KULA 1NJIC 2LRQA 2YLBA 2X4WA 1TTHB 2JOYA 1ZLMA 4JPBW 4JZ3A 2E3IA 4OMMA 3J80E 2BTTA 3S3NA 3JCMc 3NHNA 4F7UF 2FRWA 1T3LA 4M7DG 2CKKA 1VQPQ 2O9VA 3CC7T 4XTWA 5FU6C 3HFNA 4HVUA 2COYA 2H3JA 1SSHA 1M90U 2G6FX 1FXXA 1TWBA 2M51A 5GAMh 4FSSA 3OYIA 2DJQA 3L2VA 3HSBA 3QJ6A 1D3BA 4JS4A 3M0UA 3CD6A 1KQ2A 3M5AA 3URGA 1YJNQ 3VJPA 4R0KA 2FZGB 1HK9A 1W1FA 1KD1R 2AZVA 3M4GA 4M7DC 3C94A 3BFMA 2VUBA 5KYUA 3CCSQ 1S1NA 2B86A 2KK4A 5ECAA 4C8QB 3DB3A 4OMLA 2Y4YA 1BI0A 2DXBA 1FX7A 3Q1JA 2NUPB 2QYZA 1BYMA 4GBQA 5KYWA 3M4YA 2DXTA 2CDTA 5I22A 1SSFA 1X6GA 3LYIA 2OTJQ 2RK1A 2DIGA 2X9HA 2LJ3A 1RABB 2ZGWA 4C0DB 1FMVA 2DEQA 1R0BG 4X9CA 1YN8A 1VQ8T 1RACB 5CVIA 2DX1A 1XOVA 4LD6A 3JCMV 2WSEE 1VQ9A 2I0NA 2O4XA 2DL5A 3FLGA 4BI8B 2HBWA 2E10A 4C5IA 3NTIA 3CCEQ 1SEMA 1KD1U 4E7HA 5DM7R 2PU9B 2E4HA 2RB6A 1B34A 2C06A 2EGEA 4M7AB 3H41A 3M0RA 2D0NA 4ZTFA 2P4TA 2KRMA 1D1AA 2H3EB 3VUBA 3G1JA 2DRKA 1D0YA 4AMCA 1VQ7Q 5FU7C 5KE2A 1E6HA 1U1SA 4PLIA 2DTOA 4ZGDB 3JCMJ 1GL5A 2XDDA 4L59A 1Y7XA 5FRNA 4J6YA 4A4FA 1X2KA 4FW2A 1A0NB 2E6ZA 2QEXQ 2VV5A 5GAN2 5CK9A 5A0GA 1RUWA 3RMQA 3OS2A 1S72A 3OYBA 1VQMT 1YHQQ 2K3YA 4C92E 2LQKA 3RMSA 1B3QA 2NYSA 2GCXA 4C8QD 2LX9A 4M77A 3OS5A 4C0ZA 2DBMA 4E7KA 2HQHA 1ZHIA 2KVQG 4A4HA 3OYMA 1TXQA 4XU1A 4HCZA 2FL7A 2MOXA 3O5ZA 2RQVA 1TUDA 2PUKB 1WXUA 4LDVA 2XU8A 3EH2A 1K9AA 1DJ7B 4QQGA 2PUOB 2K4YA 8ATCB 3MEWA 1M3AA 2DXUA 5I2SA 4E2FB 1I0CA 2RM4A 3VS6A 1H3HA 1SKUB 2HBPA 2MF2A 1K9MR 1MUZA 4AFUC 2DAQA 1QQJA 5GAN7 3CPWA 1K73R 4MDXA 3E9FA 1G3YA 1RL2A 4J9EA 2LCSA 1M3BA 1W70A 1VQ5A 2QQSA 2KXDA 5GAOn 4CC2A 4CC4B 1AD5A 4IUUA 1QCNA 4J5YA 1YCSB 4NL2A 2K79A 2YLCA 1H92A 2CGHA 1D0XA 1YJ9T 2IG0A 3EGDB 3TCJA 3QUIA 5FU6B 2YT6A 3CCJQ 4DOWA 2BE9B 4F14A 3JCMQ 2A36A 3JCMX 4RTVA 3HHTB 5A0LA 2DD5A 2CZ0B 1TUCA 4PJOB 1K9MU 4J7FA 4M75E 1JXMA 5IT9E 2CSQA 1AZGB 4LN2A 4RCBA 1K73U 1UB4A 2LQ8A 3QYHB 3LGLA 4EMKA 1KC8C 2CH4W 1GCQC 2P4RA 4FM4B 1HJDA 2OAWA 4ZTJA 4JUVA 3REBB 2HAXA 1BK2A 3SWNC 1VQNT 2DMOA 1GXIE 2BZ8A 5D6XA 4JDSA 4D8KA 1WHGA 4RUGA 1XQHA 2FPFA 3QYGB 3M0SA 3OYNA 1S72T 2F2XA 2VWFA 4FCYA 2YRCA 4KUIA 3G71Q 2VGMA 1WXBA 5GAN3 2DE0X 3M53A 3BW1A 3EFOA 3LH5A 5KYNA 3OMGA 9ATCB 1VQOQ 1CKAA 3I55Q 1UFFA 1VQ4Q 2OX7A 5AT1B 4BDZA 4XTVA 2WSCE 4FYYB 2FZKB 3JB9G 3MEUA 2MPXC 1PM3A 2CZ1B 3MEAA 1Y96A 2K6DA 5A2QE 3C12A 2FPEA 2YUPA 3S3MA 2VKNA 2VXEA 2GBQA 5LJ3j 1D3BB 1M1KR 4F04B 1WJSA 3H0HA 2JTEA 2CH4A 4CI0C 3QWYA 5GMKj 5GAMf 3CCVA 2RH2A 4ZGEB 1JB0E 1YWPA 4M78E 5GAMe 1VQPA 2HEQA 1NZ9A 2E6NA 3BDUA 4JLGA 4A4KA 1M1GA 1XNIA 1KFZA 5KYUB 4V2SA 2AKLA 2OJ2A 4M7AF 1VQKQ 4QVZA 6AT1B 2F5KA 2JW4A 4RTXA 2M0OA 5GMKl 3PFSA 3AHUA 2F2WA 1VQ5T 1Q7YU 5KYWB 2VB6A 3VV0A 3RUXA 4Z89A 1YJNA 3I56T 3CCQA 1C1AA 1WJQA 5CQYA 2ATCB 2K3XA 3AT1B 1VQ6T 4EDUA 4PJOD 3T9NA 4LXCA 2OTLQ 5I2MA 3OYHA 5J39A 4E6RA 3M0QA 2QQ9A 5CKDA 3QZ9B 2PNIA 1N27A 3OYCA 4HVWA 3VU3C 2QI2A 3UT1A 5GAOl 2O4XB 4M7DD 4HCBA 3SDZA 3VS3A 2OTJA 3M55A 1M8MA 2BKDN 4A4EA 4C92G 1IXDA 1C6VX 3V7SA 1B34B 4EMGA 1M90C 3EGUA 3PIPA 2CP5A 4PFZA 4YTLA 2KROA 1RAHB 2KRSA 2V1RA 3O8VA 4QVDA 3CPWP 1Q86R 4XU2A 2YDLA 4M75F 1ZA2B 5AYFA 3G4ST 3JB9J 4AFZC 3CCEA 3VS0A 2RF0A 1X6OA 1QWFA 2DF6A 2LTOA 3CCRA 1Y0MA 2XKOC 2KE9A 4UC4A 2DYBA 4RG8A 1V76A 2XHCA 2EIFA 1UGPB 2MIOA 1YJWQ 2DKGA 2JUFA 4C92C 4GLMA 3LH0A 1VQ7A 2K5LA 2XICA 1Y71A 3RBBB 1MV0B 2X3WD 4L6V5 3OYLA 2M0YA 2VASA 5FWCA 2F69A 3META 1UGVA 5GANf 1LVKA 5GANe 4M77B 3S6WA 1KG1A 3CCVT 3TEEA 4F16A 2D9TA 3OQ5A 4X9DA 1Q86U 4IURA 1VUBA 2AIRB 1MMAA 4IUPA 2GQVA 3M0PA 2KYMA 1YHQA 1QVGP 2VYTA 2SEMA 3L2RA 1OPLA 1G8XA 3E1SA 3QZ5B 5GAMd 2FB7A 5LJ5j 1LOJA 2ED1A 4BACA 2X35A 2P0PA 2RQRA 2XG8D 3UPUA 1YJNT 3CCQT 4J7IA 1Q82R 1VA7A 2GF7A 3A98A 1JJ2A 1X75C 4RMOA 4E7LA 3CEYA 2E65A 3X28B 1B07A 2Y4XA 3VS4A 3JCMW 2DJZA 2J7IA 1M1FA 2Z0WA 4RTTA 5LJ3f 1IHWA 4FIBA 5LJ3e 1E6GA 4PK4A 4QVCA 3DLLA 4BI3A 1NBEB 2OTJT 5GMKe 4XTZA 2CT4A 2F2VA 1YIJQ 3X20B 2BE7D 4MMKA 1B7TA 2YHTA 4ZGJB 2BIVA 3SB2A 1QKXA 1U5SA 5CKBA 5EC7A 4M78A 4PJJA 2K7AA 4FU6A 3ULRB 3CCUQ 1HD3A 2CP3A 4HCCA 1N6AA 3LLRA 2FO0A 1Q82U 1WI7A 3CCJA 2LC4A 4LDUA 2I2LA 4XU0A 3CCRT 4EIKA 4EMKB 5A0DA 2CZ7B 5FROA 2BZXA 2PQWA 2XMFA 1X43A 5DLOA 4M78G 2C0TA 3KFVA 2KDSA 1H8KA 2YSQA 4PFPA 4M77D 1SG5A 2RHUA 3CPWS 2FHDA 3A8GB 4MZPA 2EWNA 4XK8E 1H3ZA 1C0MA 1OZ3A 1H641 1I07A 3JAME 2DIQA 3HTRA 4FYXB 4Y28E 2GTJA 5FWBA 4XQ3A 3EFOB 4QKUA 1PNJA 2ZZDA 3LX7A 4KH1B 3VRZA 3REAB 3G6EQ 1WIEA 4FSXA 4DBRA 1GFCA 3OSVA 3KXTA 2EW3A 3PT9A 5D6WA 1VQLQ 4HA8A 3H6ZA 2CSIA 5CO7A 1Y96B 4OGCA 4Y91A 3PMTA 2FRYA 1R0CB 1W2BA 1BIAA 4OMPA 2RJCA 3I35A 1UGQB 1BI2A 4M78C 2E64A 3CCLT 2K5IA 3CC2Q 3G71A 5GANd 2DVJA 3CC4T 4R55A 3CBOA 1VQOA 4F7UA 1MV3A 3I55A 1VQ4A 2HDAA 2DA9A 2KEAA 3TSZA 1UHFA 2EQKA 4JJBA 1YITA 2C0IA 4IIOA 2QXFA 3LWHA 5I11A 1M30A 1NPPA 2EPDA 2HD0A 2JM8A 2QA4Q 1RAFB 3RESA 3I9QA 4F7UG 2NUTA 4DEXA 4DEYA 5HKCA 1U06A 4B9XA 5DLQE 2KGTA 5EG2A 3PMIA 2L3RA 1NLOC 2DL3A 2DLPA 1WNLA 2ZPFB 3OYKA 4JRQA 1UTIA 2EQUA 1VYVA 2DZCA 1VQKA 4KBMB 1IGQA 3VS5A 2E3HA 5CAIA 3PGGA 3CMET 4E7IA 3EAEA 4ATOA 3OYFA 3OW2A 3HFOA 4QW2A 3VS1A 2JT4A 1AVZC 3JB9D 2OTLA 1RAEB 3CCJT 3THKA 2QDLA 2DK3A 4WF2A 1AWOA 3NPFA 2DM1A 2CUBA 4C8QE 1FWZA 3V8KA 1JJ2P 2QQBA 1ZUKA 3CC7Q 2DTHA 2RI3A 1QVPA 2ED0A 4OB0B 1QP3A 4ESRA 5GANh 1MHNA 4DA4A 5KH6A 3MKDA 3UA6A 1M27C 2ESWA 1R8OB 2LVMA 1ZBXA 2DERA 1OQKA 1JO8A 4XU3A 2JVVA 2FEIA 5LL6S 3CD6T 1QWEA 1TSFA 1HXDA 1WA7A 4OMQA 1MMNA 2D6FA 4PFOA 4B6MA 2K2VA 2R5MA 3F70A 1QVFA 3RIRA 4GLKA 5IH2A 1U1TA 4M7AE 5GAOq 1M1KC 1VQOT 1YJWA 2E5QA 1NJIU 1TU0B 3MCAB 1BCOA 3JCMP 2QTXA 4IUQA 4AFQC 1GCQA 1YITT 4KT0E 2RJFA 5GAMg 2GFAA 1AT1B 1WZOA 3SWNA 4KGZB 1TH7A 4K11A 4OP0A 2CREA 1SRLA 4C92D 1NEGA 5LJ3h 1VQ8Q 3MO8A 2RA2A 3JCMf 1G3WA 4MZTA 3JCMe 1NE8A 5GMKh 2BZYA 1SPKA 1WLPB 1VQ9T 1SF9A 3H8ZA 4OMOA 3RR6A 2OI3A 1WPYA 4C5EA 1NPRA 1ZBJA 3HP9A 4FYVB 2C0OA 1IZ6A 1ZSZC 3RKYA 3UATA 3OBYA 1UJYA 3LWIA 4J8OA 2ROTA 3CPFA 2A28A 3TSWA 2HMAA 3H0IA 4RG2A 2CP0A 1Q81C 1W2BP 2JZ2A 2YRDA 5CR2A 3CCMA 3JCMb 4J83A 5L23A 2DD4A 2OTLT 4JRPA 2LDMA 3QG1A 1EX4A 5GMKm 1OU9A 2EYWA 4M7DB 1Z9ZA 4Q5WA 2O31A 2AT1B 1TG0A 4BE2A 1YWOA 1QVGA 4JLIA 2RHZA 2YUNA 1KHIA 1UECA 4E7SA 3OYJA 3LW5E 3OS0A 3UDCA 1TS9A 3P8HA 4M4ZA 4A53A 1WHLA 1IB8A 1YIJA 4F17A 2M02A 1VQMQ 3L2UA 3EH1A 1Z9QA 2A7YA 5KCOA 1SHGA 4C8QF 1R77A 4ELYC 5KCHA 5GAOm 1WHJA 2ZAEA 3GBQA 2JXBA 2QG9B 2WACA 2RNAA 5GAOr 3CCUA 1JJ2S 1UJ0A 4J9FA 1Q7YR 1QMCA 1X01A 3L2QA 2QDYB 3TQ7P 3GPLA 2GFUA 2X4YA 3OSSC 4JZ4A 2CP6A 2P0QA 4HCKA 4AG1C 1K0XA 2EYZA 2AHJB 2CS7A 2J06A 2SRCA 3OW2P 3A5ZB 1V1CA 1EIFA 2LNVA 3JRZA 2DO3A 4XAXB 1KQSA 2IVWA 5GAN4 3CMAQ 1UGSB 2W10A 1K8AC 4J9GA 2G3RA 2ZPGB 3INZA 3U23A 5GJWB 5GANg 4PJOE 3EG2A 4J9CA 2MMPA 2ZPBB 4DBQA 1ZSGA 3DB4A 2LCCA 2RQUA 2YXYA 3HPWA 4BB7A 4BY6C 1NYFA 3S3OA 3LGFA 3EHQA 5FU7B 4F7UB 2PVDB 3H9NA 1ARKA 3C4SA 4M7DE 2RO0A 3VUZA 3R6OA 4PNOA 4IUTA 4PJNA 2LT1A 4RTWA 7AT1B 3QWXX 3FJPA 1YJ9Q 1LCKA 5J26A 3CQTA 1ZUUA 2X4JA 1BKBA 3CC2A 3CCSA 2EJGA 4C92A 1G2BA 2NUTB 3GIBA 1K1ZA 4C8QG 1AZEA 1M3CA 3C0CA 1PHTA 1W4SA 4XTYA 2L3QA 2KSSA 1PKSA 4M78D 3VKIA 3X26B 5LJ5h 1M9SA 2DILA 3CCMT 1UG1A 1QVFP 3MP6A 1YP5A 2J05A 5KYXA 1N9SA 2QA4A 3ASKA 4R56A 1G3SA 4M7AA 2KQWA 2VXFA 3L42A 3E9GA 4HVVA 1W2BS 3V8LA 2JMCA 1VQNQ 3EFRA 4EMHA 1GBQA 3VS2A 2QASA 4OB2B 3EGXA 3QJYA 3RKWA 5M9OA 3MP8A 4C8QC 1N5ZA 2AZSA 1ABOA 3V8JA 3DKMA 3FC3A 1KC8R 2M16A 2GTOA 4BD3A 3JB9H 2BUDA 1NEBA 4M7AG 2JTFA 4N4GA 4RKUE 3VS7A 3VYGA 1WQ7A 2PVOB 1BI3A 4D8DA 2JM9A 2HL3A 2JNGA 2YRVA 4C0DC 3BE3A 4KH0B 2CP7A 3E2UA 1OX9A 4JJDA 1FYNA 3EG9A 1MMDA 3GOXA 2EQIA 3C95A 2QEXA 3CC7A 1VQPT 2RHYA 2F5TX 2RQWA 2HQEA 3JB9I 2CP2A 4KGVB 1M2VA 5KE3A 4M75A 4PL6A 4M7AC 5HK3A 1J3TA 1OPKA 1X2QA 4WTOB 1KC8U 3JCMh 1KD1C 2KAFA 4J6WA 2DEUA 3OW2S 3ER0A 1VQ5Q 3TREA 3OYEA 1OULA 1SHFA 1NG2A 4PJOF 3I56Q 2K3BA 2EBPA 4M75G 2R57A 3NTHA 4EPCA 1I81A 3SWNB 1VQ6Q 1RADB 1X69A 5GAN5 4E47A 3SFMA 3CC2T 2EAYA 3CCST 4M7DF 2EVRA 1NYGA 2MI6A 3WVDB 4TVRA 2EGCA 1YI2Q 1PD0A 1EFNA 4N4HA 5GAN6 4KGXB 1JXOA 5CKEA 2CT3A 2RMOA 2OAUA 2GNCA 2YWWA 2E5KA 1KQSP 2QAZA 2D8JA 2QA4T 3EG1A 3QBYA 2O2OA 1CKBA 3OYAA 2KNBB 3HL8A 1I5LA 1WHMA 3ZFJA 2HKQB 4M77E 1WXTA 1QCFA 4M75C 2MWPA 4OMFB 2R5AA 2MAMA 1GRIA 1Q95G 4P5NA 1D0ZA 3WXMB 3G7ZA 3BDLA 2EYYA 3G4SQ 4FT4A 3WVEB 1LJOA 4CRIA 4DQ2A 3CCET 1U8RA 2NWMA 3GNFB 2L3PA 2CYZB 1JEGA 1LPLA 2E41A 3FIFA 1YFNA 2LP5A 4C5HA 3QXEB 1JQQA 1OV3A 4BE1A 4HT8A 2FZCB 4PJOG 1RI9A 4LDXA 3OB9A 4FYWB 2HL5C 1Y57A 1VQ7T 1M2OA 4L5GA 8AT1B 1K4US 3QO3A 2J6KA 2ZPEB 3CXCA 2EYXA 4ELZC 2RD1A 2ECZA 1KHCA 4FL6A 2PZ1A 2LCLA 4J9IA 3CCVQ 2QQRA 4JJNK 2QEXT 4VUBA 4LUEA 2XDPA 4OF1A 1AWJA 2KYBA 1VQMA 2R58A 1YHQT 4BUGA 1AWWA 2EQJA 2HCKA 4LDWA 1AOJA 2GGRA 3D7SB 3ME9A 1GBRA 1WFWA 4LNPA 1N8RR 4X1VA 4PJOC 3M57A 2JS2A 3TU4K 1WQWA 1T3SA 4RCCA 1WJRA 3H0FA 1BU1A 3MHXA 4LUDA 3VRYA 1IO6A 1RAGB 3CCQQ 2VC8A 1UE9A 4A54A 2V8IA 2LMJA 2E1HA 2HKNA 2DTIA 1QVGS 1K9MC 1M4ZA 2AKKA 1U3OA 2ZPIB 1YNZA 1K73C 4ZN3A 1PD1A 3CMAA 2O88A 3FDRA 1KK7A 1BI1A 3JCMg 4C92B 2XIDA 2EFIA 1BCMA 1AHJB 3BY7A 1N8RU 5HY6A 2A0FB 3HRTA 3RNJA 3JV3A 5GAOp 2B8AA 5LJ3d 1UHCA 3I5SA 4XTXA 5GAN8 2EJ9A 1PKTA 5KYXB 1I8FA 1YJ9A 4E7ZA 4C0GA 5LJ5f 2RPNA 1HSQA 5LJ5e 2XD0A 1KQSS 1D09B 2CUDA 2KY9A 3CCRQ 5GJVB 1OZ2A 4N0AA 5KYYA 3DLMA 2JJ9A 3GF5A 4IIMA 1PCXA 4OGEA 4M77F 2FG0A 1RAAB 2DBKA 4MMLA 3SD4A 1OYXA 2KRNA 3NFCA 1JU5C 1SRMA 3PVLA 1GCPA 1RLQC 3HRSA 1NJIR 2HQXA 1XJWB 3EGXB 2FYKA 2JMAA 1PC0A 2M9UA 1IHVA 2D1XA 1ZA1B 3M54A 5GAMj 1YBYA 1G3TA 2V8JA 4JS5A 5FLXE 3EG0A 4QQDA 2ABLA 1UUEA 3GP8A 1MGQA 3M0TA 2L8DA 4B9WA 2CZ6B 1N9RA 4N4IA
chains in the Genus database with same CATH topology
2RNAA 1ZUYA 1UJ0A 4J9FA 2MIOA 1UDLA 2O9VA 4J9BA 4GLMA 4JZ4A 1VYTA 4HVUA 3RBBB 5FW9A 1MV0B 1SSHA 2X3WD 2G6FX 4HCKA 4AG1C 2EYZA 1K0XA 2M0YA 1KSWA 2M51A 5FWCA 4FSSA 1UGVA 1GFDA 2J06A 2SRCA 2DJQA 1X27A 1V1CA 2DRMA 2KT1A 3M0UA 2ROLA 4F16A 2KR3A 2L2PA 5IXFA 2W10A 4J9GA 5IHIA 2VVKA 2YUQA 3U23A 4R0KA 5GJWB 4OMNA 1W1FA 3EG2A 4J9CA 2AZVA 3M0PA 2KYMA 1ZSGA 2RQUA 2SEMA 4QT7A 1S1NA 1NYFA 2B86A 5ECAA 3EHQA 4OMLA 1ARKA 1OPLA 2ED1A 4GBQA 2RQRA 3I5RA 4RTWA 2CDTA 3QWXX 5I22A 1X6GA 1LCKA 1VA7A 3CQTA 3A98A 1ZUUA 5IXBA 1E7OA 2LX7A 1G2BA 2LJ3A 1K1ZA 2X3XD 1AZEA 2V1QA 1PRLC 1M3CA 3C0CA 1PHTA 1YN8A 1B07A 3VS4A 2O9SA 2J7IA 2L3QA 2DX1A 1XOVA 4RTTA 1PKSA 2I0NA 2DL5A 2DILA 3PVQA 1E6GA 1UG1A 2HBWA 1YP5A 3EHRA 1SEMA 2J05A 2CT4A 2F2VA 1KJWA 4AFSC 2EGEA 3H41A 1I1JA 1QKXA 3M0RA 1U5SA 2D0NA 2KRMA 5EC7A 4HVVA 2K7AA 2JMCA 3ULRB 2DRKA 1HD3A 2A08A 1GBQA 3VS2A 1G83A 2FO0A 1N5ZA 2AZSA 1ABOA 1E6HA 1WI7A 4Y92A 4EIKA 1GL5A 2GTOA 1NEBA 4CC7A 2BZXA 2XMFA 2DL7A 3VS7A 2L3SA 3NMZC 1X43A 4WCIA 1X2KA 1A0NB 2C0TA 3KFVA 1H8KA 4D8DA 2YSQA 2JM9A 1OEBA 1PRMC 1RUWA 1I07A 1K0SA 1WX6A 2GTJA 5FWBA 2L0AA 1PNJA 4JJDA 1FYNA 3VRZA 1B3QA 3REAB 1WIEA 1X6BA 1GFCA 2EQIA 2LNHB 2EW3A 2IIMA 1ABQA 2DBMA 2JS0A 1PWTA 2CSIA 2RQWA 2FRYA 2KBTA 2MOXA 3O5ZA 2RQVA 4OMPA 1TUDA 3UF4A 3I35A 1J3TA 1WXUA 1OPKA 1X2QA 3PE0A 2DVJA 1K9AA 2ENMA 1MV3A 2HDAA 1QLYA 2H8HA 1WDXA 2DA9A 1M3AA 2KEAA 1SHFA 3TSZA 1NG2A 1UHFA 1I0CA 3VS6A 1H3HA 4JJBA 2K3BA 2NUZA 2EBPA 1MUZA 4AFUC 2C0IA 4IIOA 1X69A 5I11A 1M30A 4RTZA 2EPDA 2JM8A 4JJCA 1NLPC 4J9EA 2EVRA 1NYGA 3I9QA 2EGCA 2LCSA 4DEXA 1M3BA 4DEYA 5IHKA 1W70A 1EFNA 1U06A 2GQIA 2KXDA 4CC2A 4CC4B 1VYUA 1AD5A 3EG3A 2KGTA 1NLOC 2DL3A 2DLPA 1YCSB 2LJ0A 2K79A 1H92A 1UTIA 5HCKA 1JXOA 2CT3A 2RMOA 1VYVA 2GNCA 2E5KA 2YT6A 2D8JA 3EG1A 2O2OA 1CKBA 1QKWA 4RTUA 2KNBB 3UA7A 4F14A 1AWXA 1RLPC 3VS5A 2A36A 1WXTA 4RTVA 1QCFA 3SHWA 1GRIA 3TVTA 1TUCA 1W6XA 2EYYA 4J9DA 3VS1A 2JT4A 1AVZC 1JXMA 2NWMA 2J6OA 2L3PA 2CSQA 1JEGA 3THKA 3NGPA 4KRTA 3SEMA 1AZGB 2QDLA 4LN2A 1AWOA 3NPFA 2J6FA 2DM1A 2CUBA 2LP5A 1KIKA 2CH4W 1JQQA 1GCQC 1OV3A 2P4RA 1HJDA 3R6NA 2OAWA 3REBB 1BK2A 2DMOA 1ZUKA 2BZ8A 1RI9A 4D8KA 4RUGA 2ED0A 2FPFA 1Y57A 3M0SA 2RQTA 1T0HA 2F2XA 2VWFA 1WYXA 1K4US 4ESRA 2J6KA 2EKHA 3UA6A 2EYXA 3ZL7C 1M27C 1BB9A 1WXBA 2ESWA 2DE0X 2ECZA 3LH5A 2HSPA 2PZ1A 1JO8A 1CKAA 4J9IA 2KXCA 1UFFA 2FEIA 1QWEA 4LUEA 4HXJA 1ZX6A 4ORZA 2MCNA 1WA7A 1AWJA 2LQNA 4OMQA 2DL8A 2K6DA 2KYBA 2K2MA 2FPEA 2YUPA 2VKNA 2GBQA 1AWWA 4AG2C 2HCKA 1AOJA 1NM7A 3H0HA 2JTEA 2CH4A 5IH2A 2GGRA 3QWYA 1GBRA 1WFWA 4LNPA 4X1VA 2JS2A 1YWPA 1T3SA 2HEQA 3H0FA 1BU1A 4LUDA 3VRYA 2FPDA 1IO6A 2DNUA 4AFQC 1UE9A 1AEYA 1GCQA 1KFZA 4Z8AA 2LMJA 2K9GA 1CSKA 4K11A 2AKLA 2AK5A 2CREA 2OJ2A 2AKKA 1SRLA 1U3OA 1NEGA 2JW4A 4RTXA 1YNZA 2F2WA 4Z88A 3FJ5A 2YUOA 2BZYA 2D8HA 1SPKA 1WLPB 2DL4A 4Z89A 2O88A 4OMOA 2OI3A 1ZBJA 4LE9A 2LZ6B 2C0OA 2A37A 4E6RA 3M0QA 1BBZA 1OOTA 2LJ1A 2KT8A 3UATA 1UJYA 2ROTA 2PNIA 2A28A 3TSWA 3H0IA 4HVWA 1FMKA 2LQWA 3RNJA 3JV3A 4CC3A 2W0ZA 1UHCA 3I5SA 1PKTA 3VS3A 5IHNA 4ZNXA 2RN8A 2PTKA 4A63B 1M8MA 5L23A 2RPNA 1HSQA 2CUDA 3IQLA 3EGUA 5GJVB 4IIMA 1K76A 2EYWA 2EGAA 2FG0A 1Z9ZA 4RTYA 2DBKA 4J9HA 2KROA 2KRNA 2O31A 1JU5C 1TG0A 2KRSA 1SRMA 1YWOA 2V1RA 3PVLA 2YUNA 1GCPA 1RLQC 1UECA 2YDLA 1T0JA 2JMAA 4M4ZA 4AFZC 3VS0A 1ZLMA 2D1XA 2RF0A 4JPBW 4F17A 4JZ3A 4OMMA 3EG0A 2BTTA 1QWFA 2DF6A 1Z9QA 1SHGA 2ABLA 1UUEA 3NHNA 1Y0MA 2FRWA 2KE9A 3M0TA 1T3LA 2DYBA 3GBQA 2JXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNA A;  1ZUY A;  1UJ0 A;  4J9F A;  2MIO A;  1UDL A;  2O9V A;  4J9B A;  4GLM A;  4JZ4 A;  1VYT A;  4HVU A;  3RBB B;  5FW9 A;  1MV0 B;  1SSH A;  2X3W D;  2G6F X;  4HCK A;  4AG1 C;  2EYZ A;  1K0X A;  2M0Y A;  1KSW A;  2M51 A;  5FWC A;  4FSS A;  1UGV A;  1GFD A;  2J06 A;  2SRC A;  2DJQ A;  1X27 A;  1V1C A;  2DRM A;  2KT1 A;  3M0U A;  2ROL A;  4F16 A;  2KR3 A;  2L2P A;  5IXF A;  2W10 A;  4J9G A;  5IHI A;  2VVK A;  2YUQ A;  3U23 A;  4R0K A;  5GJW B;  4OMN A;  1W1F A;  3EG2 A;  4J9C A;  2AZV A;  3M0P A;  2KYM A;  1ZSG A;  2RQU A;  2SEM A;  4QT7 A;  1S1N A;  1NYF A;  2B86 A;  5ECA A;  3EHQ A;  4OML A;  1ARK A;  1OPL A;  2ED1 A;  4GBQ A;  2RQR A;  3I5R A;  4RTW A;  2CDT A;  3QWX X;  5I22 A;  1X6G A;  1LCK A;  1VA7 A;  3CQT A;  3A98 A;  1ZUU A;  5IXB A;  1E7O A;  2LX7 A;  1G2B A;  2LJ3 A;  1K1Z A;  2X3X D;  1AZE A;  2V1Q A;  1PRL C;  1M3C A;  3C0C A;  1PHT A;  1YN8 A;  1B07 A;  3VS4 A;  2O9S A;  2J7I A;  2L3Q A;  2DX1 A;  1XOV A;  4RTT A;  1PKS A;  2I0N A;  2DL5 A;  2DIL A;  3PVQ A;  1E6G A;  1UG1 A;  2HBW A;  1YP5 A;  3EHR A;  1SEM A;  2J05 A;  2CT4 A;  2F2V A;  1KJW A;  4AFS C;  2EGE A;  3H41 A;  1I1J A;  1QKX A;  3M0R A;  1U5S A;  2D0N A;  2KRM A;  5EC7 A;  4HVV A;  2K7A A;  2JMC A;  3ULR B;  2DRK A;  1HD3 A;  2A08 A;  1GBQ A;  3VS2 A;  1G83 A;  2FO0 A;  1N5Z A;  2AZS A;  1ABO A;  1E6H A;  1WI7 A;  4Y92 A;  4EIK A;  1GL5 A;  2GTO A;  1NEB A;  4CC7 A;  2BZX A;  2XMF A;  2DL7 A;  3VS7 A;  2L3S A;  3NMZ C;  1X43 A;  4WCI A;  1X2K A;  1A0N B;  2C0T A;  3KFV A;  1H8K A;  4D8D A;  2YSQ A;  2JM9 A;  1OEB A;  1PRM C;  1RUW A;  1I07 A;  1K0S A;  1WX6 A;  2GTJ A;  5FWB A;  2L0A A;  1PNJ A;  4JJD A;  1FYN A;  3VRZ A;  1B3Q A;  3REA B;  1WIE A;  1X6B A;  1GFC A;  2EQI A;  2LNH B;  2EW3 A;  2IIM A;  1ABQ A;  2DBM A;  2JS0 A;  1PWT A;  2CSI A;  2RQW A;  2FRY A;  2KBT A;  2MOX A;  3O5Z A;  2RQV A;  4OMP A;  1TUD A;  3UF4 A;  3I35 A;  1J3T A;  1WXU A;  1OPK A;  1X2Q A;  3PE0 A;  2DVJ A;  1K9A A;  2ENM A;  1MV3 A;  2HDA A;  1QLY A;  2H8H A;  1WDX A;  2DA9 A;  1M3A A;  2KEA A;  1SHF A;  3TSZ A;  1NG2 A;  1UHF A;  1I0C A;  3VS6 A;  1H3H A;  4JJB A;  2K3B A;  2NUZ A;  2EBP A;  1MUZ A;  4AFU C;  2C0I A;  4IIO A;  1X69 A;  5I11 A;  1M30 A;  4RTZ A;  2EPD A;  2JM8 A;  4JJC A;  1NLP C;  4J9E A;  2EVR A;  1NYG A;  3I9Q A;  2EGC A;  2LCS A;  4DEX A;  1M3B A;  4DEY A;  5IHK A;  1W70 A;  1EFN A;  1U06 A;  2GQI A;  2KXD A;  4CC2 A;  4CC4 B;  1VYU A;  1AD5 A;  3EG3 A;  2KGT A;  1NLO C;  2DL3 A;  2DLP A;  1YCS B;  2LJ0 A;  2K79 A;  1H92 A;  1UTI A;  5HCK A;  1JXO A;  2CT3 A;  2RMO A;  1VYV A;  2GNC A;  2E5K A;  2YT6 A;  2D8J A;  3EG1 A;  2O2O A;  1CKB A;  1QKW A;  4RTU A;  2KNB B;  3UA7 A;  4F14 A;  1AWX A;  1RLP C;  3VS5 A;  2A36 A;  1WXT A;  4RTV A;  1QCF A;  3SHW A;  1GRI A;  3TVT A;  1TUC A;  1W6X A;  2EYY A;  4J9D A;  3VS1 A;  2JT4 A;  1AVZ C;  1JXM A;  2NWM A;  2J6O A;  2L3P A;  2CSQ A;  1JEG A;  3THK A;  3NGP A;  4KRT A;  3SEM A;  1AZG B;  2QDL A;  4LN2 A;  1AWO A;  3NPF A;  2J6F A;  2DM1 A;  2CUB A;  2LP5 A;  1KIK A;  2CH4 W;  1JQQ A;  1GCQ C;  1OV3 A;  2P4R A;  1HJD A;  3R6N A;  2OAW A;  3REB B;  1BK2 A;  2DMO A;  1ZUK A;  2BZ8 A;  1RI9 A;  4D8K A;  4RUG A;  2ED0 A;  2FPF A;  1Y57 A;  3M0S A;  2RQT A;  1T0H A;  2F2X A;  2VWF A;  1WYX A;  1K4U S;  4ESR A;  2J6K A;  2EKH A;  3UA6 A;  2EYX A;  3ZL7 C;  1M27 C;  1BB9 A;  1WXB A;  2ESW A;  2DE0 X;  2ECZ A;  3LH5 A;  2HSP A;  2PZ1 A;  1JO8 A;  1CKA A;  4J9I A;  2KXC A;  1UFF A;  2FEI A;  1QWE A;  4LUE A;  4HXJ A;  1ZX6 A;  4ORZ A;  2MCN A;  1WA7 A;  1AWJ A;  2LQN A;  4OMQ A;  2DL8 A;  2K6D A;  2KYB A;  2K2M A;  2FPE A;  2YUP A;  2VKN A;  2GBQ A;  1AWW A;  4AG2 C;  2HCK A;  1AOJ A;  1NM7 A;  3H0H A;  2JTE A;  2CH4 A;  5IH2 A;  2GGR A;  3QWY A;  1GBR A;  1WFW A;  4LNP A;  4X1V A;  2JS2 A;  1YWP A;  1T3S A;  2HEQ A;  3H0F A;  1BU1 A;  4LUD A;  3VRY A;  2FPD A;  1IO6 A;  2DNU A;  4AFQ C;  1UE9 A;  1AEY A;  1GCQ A;  1KFZ A;  4Z8A A;  2LMJ A;  2K9G A;  1CSK A;  4K11 A;  2AKL A;  2AK5 A;  2CRE A;  2OJ2 A;  2AKK A;  1SRL A;  1U3O A;  1NEG A;  2JW4 A;  4RTX A;  1YNZ A;  2F2W A;  4Z88 A;  3FJ5 A;  2YUO A;  2BZY A;  2D8H A;  1SPK A;  1WLP B;  2DL4 A;  4Z89 A;  2O88 A;  4OMO A;  2OI3 A;  1ZBJ A;  4LE9 A;  2LZ6 B;  2C0O A;  2A37 A;  4E6R A;  3M0Q A;  1BBZ A;  1OOT A;  2LJ1 A;  2KT8 A;  3UAT A;  1UJY A;  2ROT A;  2PNI A;  2A28 A;  3TSW A;  3H0I A;  4HVW A;  1FMK A;  2LQW A;  3RNJ A;  3JV3 A;  4CC3 A;  2W0Z A;  1UHC A;  3I5S A;  1PKT A;  3VS3 A;  5IHN A;  4ZNX A;  2RN8 A;  2PTK A;  4A63 B;  1M8M A;  5L23 A;  2RPN A;  1HSQ A;  2CUD A;  3IQL A;  3EGU A;  5GJV B;  4IIM A;  1K76 A;  2EYW A;  2EGA A;  2FG0 A;  1Z9Z A;  4RTY A;  2DBK A;  4J9H A;  2KRO A;  2KRN A;  2O31 A;  1JU5 C;  1TG0 A;  2KRS A;  1SRM A;  1YWO A;  2V1R A;  3PVL A;  2YUN A;  1GCP A;  1RLQ C;  1UEC A;  2YDL A;  1T0J A;  2JMA A;  4M4Z A;  4AFZ C;  3VS0 A;  1ZLM A;  2D1X A;  2RF0 A;  4JPB W;  4F17 A;  4JZ3 A;  4OMM A;  3EG0 A;  2BTT A;  1QWF A;  2DF6 A;  1Z9Q A;  1SHG A;  2ABL A;  1UUE A;  3NHN A;  1Y0M A;  2FRW A;  2KE9 A;  3M0T A;  1T3L A;  2DYB A;  3GBQ A;  2JXB A; 
#chains in the Genus database with same CATH topology
 1VQN A;  1ZSZ A;  1ZUY A;  3A8L B;  1UDL A;  4J9B A;  1Q7Y C;  1VYT A;  5FW9 A;  2DFU A;  2EJF A;  4Z02 A;  4E7J A;  2NLU A;  3CCL Q;  1KSW A;  3EG9 B;  4BE0 A;  1GFD A;  3G71 T;  3QKJ A;  1X27 A;  2DRM A;  3OBW A;  4DBF A;  3CC4 Q;  2DYI A;  3FB9 A;  4IUV A;  2KT1 A;  4PJL A;  2ROL A;  1JBM A;  2KR3 A;  3I55 T;  1VQ4 T;  2ZCF B;  2L2P A;  5IXF A;  5IHI A;  2VVK A;  2L89 A;  2YUQ A;  1ACM B;  1M2V B;  4M75 B;  4N0A C;  4OMN A;  2K57 A;  5IN1 A;  3PTA A;  1D1C A;  1IRE B;  2O01 E;  1IRX A;  2L5Q A;  4QT7 A;  4DBH A;  4NL3 A;  4M77 G;  2E70 A;  1RI0 A;  2QGF B;  3CMA T;  2A3L A;  3CXC P;  3I5R A;  1UEB A;  3CBM A;  3ZEH A;  5IXB A;  1E7O A;  2LX7 A;  4PLL A;  2XI9 A;  1QW1 A;  1TOV A;  2X4X A;  1VQK T;  2X3X D;  2V1Q A;  1PRL C;  4PJM A;  3PNW C;  1I4K 1;  2O9S A;  5CKF A;  3PIO A;  4M7A D;  1QCO A;  3CME Q;  5D7U A;  1WHH A;  4LDY A;  3RER A;  3JB9 F;  3PVQ A;  4ANJ A;  3I56 A;  1O75 A;  3X25 B;  1VQ6 A;  3EHR A;  1UGR B;  1QP2 A;  5J3B A;  3A8M B;  4M77 C;  4GY5 A;  1KJW A;  3A8O B;  4AFS C;  1YI2 A;  3KBG A;  5CIU A;  1I1J A;  3M58 A;  4M78 B;  3KUF A;  3J81 E;  4D6W A;  2A08 A;  3MJX A;  5GAN j;  1G83 A;  3L2W A;  1Q86 C;  5LJ5 d;  2MWO A;  4NOY A;  3HKS A;  4X34 A;  2XK0 A;  4Y92 A;  3OS1 A;  3GNG A;  1Y07 A;  3HRU A;  3QHS A;  4ME7 A;  4CC7 A;  2DL7 A;  2L3S A;  3NMZ C;  3E19 A;  4WCI A;  2QTV A;  4IKF A;  4XTU A;  3CD6 Q;  3FRN A;  2JTM A;  4A4G A;  5CKH A;  3G4S A;  1OX8 A;  3CBP A;  1M5Q 1;  4C0F A;  2F1L A;  1WHK A;  1OEB A;  1PRM C;  1RAI B;  3OA6 A;  1K0S A;  3MEV A;  4J6X A;  4M75 D;  2K5F A;  1WX6 A;  2JN0 A;  2L0A A;  1PSE A;  2VGN A;  1OU8 A;  1X6B A;  1BIB A;  2X51 A;  4JRK A;  1YCY A;  2LNH B;  5D6Y A;  2P0K A;  2IIM A;  1ABQ A;  2JS0 A;  2IPO B;  1YJW T;  1PWT A;  3V7R A;  2DET A;  1MND A;  4C92 F;  1YIT Q;  2KBT A;  2KMT A;  3OYG A;  3UF4 A;  2LT4 A;  3PE0 A;  5FRM A;  5L8R E;  1M8V A;  2ENM A;  1MMG A;  2RJD A;  3G6E A;  4C8Q A;  1JRI A;  3P8B B;  3N5B B;  1QLY A;  2H8H A;  1WDX A;  3QII A;  3QDF A;  1VQ9 Q;  1PG5 B;  1VQL A;  2NUP A;  4BI4 A;  2EQM A;  3M56 A;  2NUZ A;  4EMK C;  4DOV A;  1I5O B;  2RJE A;  2V8K A;  4RTZ A;  1KQ1 A;  1Q82 C;  3VYH B;  4JJC A;  1NLP C;  4OVA A;  2PVG B;  5IHK A;  4PKC C;  3JCM d;  2GQI A;  2COZ A;  1VYU A;  3EG3 A;  2E12 A;  1V29 B;  1G5V A;  3CXC S;  2LJ0 A;  1MNE A;  3EFS A;  2RI5 A;  5HCK A;  4FW1 A;  4JRI A;  3UWN A;  5C0M A;  1D1B A;  4ZN1 A;  2HSE B;  1M1K U;  2DVE A;  4AT1 B;  5LJ3 g;  1Q81 R;  1QKW A;  1EZZ B;  1PSF A;  4RTU A;  1YI2 T;  3UA7 A;  5HK0 A;  1AWX A;  1RLP C;  4QQ6 A;  3SHW A;  5CCA A;  3TVT A;  1W6X A;  1O9S A;  4J9D A;  2RK2 A;  2DXC A;  1S72 Q;  2EYQ A;  2J6O A;  4C5G A;  1YIJ T;  5KYY B;  3NGP A;  4KRT A;  3SEM A;  3A8H B;  4HT9 A;  5DY9 A;  3M59 A;  2J6F A;  2HNI A;  4F7U E;  1KIK A;  1VOM A;  1F1B B;  3GLX A;  3R6N A;  4LD9 K;  5GMK i;  3CCU T;  2MYS A;  3FEO A;  2EKO A;  3V7C A;  4O6J A;  2RQT A;  1T0H A;  1WYX A;  5CQX A;  4II1 A;  2EKH A;  2WSF E;  1Q81 U;  3ZL7 C;  1BB9 A;  2HSP A;  1ZSZ B;  2P84 A;  3OMC A;  2KXC A;  3J7A F;  1VIE A;  4HXJ A;  1ZX6 A;  4ORZ A;  4OB1 B;  2MCN A;  2LQN A;  3L2Z A;  2DL8 A;  3RKX A;  2K2M A;  4KUD K;  2RHI A;  2M1H A;  3RDV A;  2Y90 A;  3OYD A;  2QGG A;  4AG2 C;  2HZY A;  3ZBD A;  1NM7 A;  2FVU A;  2DZ9 A;  3G6E T;  1K8A R;  3MPU B;  2QK0 A;  1N8R C;  2RHX A;  2ZPH B;  2QQA A;  2FPD A;  1VQL T;  2RI2 A;  2DNU A;  5C6S A;  4FT2 A;  1AEY A;  1WGS A;  3L1A A;  4Z8A A;  3OYY A;  3QSU A;  2K9G A;  5I21 A;  3OY9 A;  3CCL A;  1CSK A;  2AK5 A;  2KI7 A;  1P92 A;  4HKE A;  4MDW A;  1HYO A;  4OB3 B;  1ZQ1 A;  3CC4 A;  4M78 F;  4NS5 A;  3MP1 A;  4Z88 A;  3FJ5 A;  2YUO A;  4O5V A;  1OI1 A;  2D8H A;  3A1P A;  2DL4 A;  3CCM Q;  4MZM A;  2MK5 A;  3M9Q A;  2DPP B;  4LE9 A;  2LZ6 B;  2A37 A;  3EGD A;  3JSC A;  2V26 A;  1BBZ A;  1OOT A;  2LJ1 A;  2KT8 A;  3NTK A;  2XDB A;  1VQ8 A;  1K8A U;  2COW A;  1FMK A;  3X24 B;  2LQW A;  4CC3 A;  2W0Z A;  1TUG B;  5IHN A;  4ZNX A;  1QVF S;  2RN8 A;  2PTK A;  4PJO A;  4A63 B;  1M90 R;  5IAY A;  3IQL A;  3QPH A;  1VIF A;  1K76 A;  2EGA A;  3QDR B;  4RTY A;  4J9H A;  4M7D A;  4BY6 B;  3CME A;  5LJ5 g;  1FMW A;  1IGU A;  1LNX A;  1T0J A;  1XTD A;  4BDY A;  3P8D A;  2D0Q B;  4KUL A;  1NJI C;  2LRQ A;  2YLB A;  2X4W A;  1TTH B;  2JOY A;  1ZLM A;  4JPB W;  4JZ3 A;  2E3I A;  4OMM A;  3J80 E;  2BTT A;  3S3N A;  3JCM c;  3NHN A;  4F7U F;  2FRW A;  1T3L A;  4M7D G;  2CKK A;  1VQP Q;  2O9V A;  3CC7 T;  4XTW A;  5FU6 C;  3HFN A;  4HVU A;  2COY A;  2H3J A;  1SSH A;  1M90 U;  2G6F X;  1FXX A;  1TWB A;  2M51 A;  5GAM h;  4FSS A;  3OYI A;  2DJQ A;  3L2V A;  3HSB A;  3QJ6 A;  1D3B A;  4JS4 A;  3M0U A;  3CD6 A;  1KQ2 A;  3M5A A;  3URG A;  1YJN Q;  3VJP A;  4R0K A;  2FZG B;  1HK9 A;  1W1F A;  1KD1 R;  2AZV A;  3M4G A;  4M7D C;  3C94 A;  3BFM A;  2VUB A;  5KYU A;  3CCS Q;  1S1N A;  2B86 A;  2KK4 A;  5ECA A;  4C8Q B;  3DB3 A;  4OML A;  2Y4Y A;  1BI0 A;  2DXB A;  1FX7 A;  3Q1J A;  2NUP B;  2QYZ A;  1BYM A;  4GBQ A;  5KYW A;  3M4Y A;  2DXT A;  2CDT A;  5I22 A;  1SSF A;  1X6G A;  3LYI A;  2OTJ Q;  2RK1 A;  2DIG A;  2X9H A;  2LJ3 A;  1RAB B;  2ZGW A;  4C0D B;  1FMV A;  2DEQ A;  1R0B G;  4X9C A;  1YN8 A;  1VQ8 T;  1RAC B;  5CVI A;  2DX1 A;  1XOV A;  4LD6 A;  3JCM V;  2WSE E;  1VQ9 A;  2I0N A;  2O4X A;  2DL5 A;  3FLG A;  4BI8 B;  2HBW A;  2E10 A;  4C5I A;  3NTI A;  3CCE Q;  1SEM A;  1KD1 U;  4E7H A;  5DM7 R;  2PU9 B;  2E4H A;  2RB6 A;  1B34 A;  2C06 A;  2EGE A;  4M7A B;  3H41 A;  3M0R A;  2D0N A;  4ZTF A;  2P4T A;  2KRM A;  1D1A A;  2H3E B;  3VUB A;  3G1J A;  2DRK A;  1D0Y A;  4AMC A;  1VQ7 Q;  5FU7 C;  5KE2 A;  1E6H A;  1U1S A;  4PLI A;  2DTO A;  4ZGD B;  3JCM J;  1GL5 A;  2XDD A;  4L59 A;  1Y7X A;  5FRN A;  4J6Y A;  4A4F A;  1X2K A;  4FW2 A;  1A0N B;  2E6Z A;  2QEX Q;  2VV5 A;  5GAN 2;  5CK9 A;  5A0G A;  1RUW A;  3RMQ A;  3OS2 A;  1S72 A;  3OYB A;  1VQM T;  1YHQ Q;  2K3Y A;  4C92 E;  2LQK A;  3RMS A;  1B3Q A;  2NYS A;  2GCX A;  4C8Q D;  2LX9 A;  4M77 A;  3OS5 A;  4C0Z A;  2DBM A;  4E7K A;  2HQH A;  1ZHI A;  2KVQ G;  4A4H A;  3OYM A;  1TXQ A;  4XU1 A;  4HCZ A;  2FL7 A;  2MOX A;  3O5Z A;  2RQV A;  1TUD A;  2PUK B;  1WXU A;  4LDV A;  2XU8 A;  3EH2 A;  1K9A A;  1DJ7 B;  4QQG A;  2PUO B;  2K4Y A;  8ATC B;  3MEW A;  1M3A A;  2DXU A;  5I2S A;  4E2F B;  1I0C A;  2RM4 A;  3VS6 A;  1H3H A;  1SKU B;  2HBP A;  2MF2 A;  1K9M R;  1MUZ A;  4AFU C;  2DAQ A;  1QQJ A;  5GAN 7;  3CPW A;  1K73 R;  4MDX A;  3E9F A;  1G3Y A;  1RL2 A;  4J9E A;  2LCS A;  1M3B A;  1W70 A;  1VQ5 A;  2QQS A;  2KXD A;  5GAO n;  4CC2 A;  4CC4 B;  1AD5 A;  4IUU A;  1QCN A;  4J5Y A;  1YCS B;  4NL2 A;  2K79 A;  2YLC A;  1H92 A;  2CGH A;  1D0X A;  1YJ9 T;  2IG0 A;  3EGD B;  3TCJ A;  3QUI A;  5FU6 B;  2YT6 A;  3CCJ Q;  4DOW A;  2BE9 B;  4F14 A;  3JCM Q;  2A36 A;  3JCM X;  4RTV A;  3HHT B;  5A0L A;  2DD5 A;  2CZ0 B;  1TUC A;  4PJO B;  1K9M U;  4J7F A;  4M75 E;  1JXM A;  5IT9 E;  2CSQ A;  1AZG B;  4LN2 A;  4RCB A;  1K73 U;  1UB4 A;  2LQ8 A;  3QYH B;  3LGL A;  4EMK A;  1KC8 C;  2CH4 W;  1GCQ C;  2P4R A;  4FM4 B;  1HJD A;  2OAW A;  4ZTJ A;  4JUV A;  3REB B;  2HAX A;  1BK2 A;  3SWN C;  1VQN T;  2DMO A;  1GXI E;  2BZ8 A;  5D6X A;  4JDS A;  4D8K A;  1WHG A;  4RUG A;  1XQH A;  2FPF A;  3QYG B;  3M0S A;  3OYN A;  1S72 T;  2F2X A;  2VWF A;  4FCY A;  2YRC A;  4KUI A;  3G71 Q;  2VGM A;  1WXB A;  5GAN 3;  2DE0 X;  3M53 A;  3BW1 A;  3EFO A;  3LH5 A;  5KYN A;  3OMG A;  9ATC B;  1VQO Q;  1CKA A;  3I55 Q;  1UFF A;  1VQ4 Q;  2OX7 A;  5AT1 B;  4BDZ A;  4XTV A;  2WSC E;  4FYY B;  2FZK B;  3JB9 G;  3MEU A;  2MPX C;  1PM3 A;  2CZ1 B;  3MEA A;  1Y96 A;  2K6D A;  5A2Q E;  3C12 A;  2FPE A;  2YUP A;  3S3M A;  2VKN A;  2VXE A;  2GBQ A;  5LJ3 j;  1D3B B;  1M1K R;  4F04 B;  1WJS A;  3H0H A;  2JTE A;  2CH4 A;  4CI0 C;  3QWY A;  5GMK j;  5GAM f;  3CCV A;  2RH2 A;  4ZGE B;  1JB0 E;  1YWP A;  4M78 E;  5GAM e;  1VQP A;  2HEQ A;  1NZ9 A;  2E6N A;  3BDU A;  4JLG A;  4A4K A;  1M1G A;  1XNI A;  1KFZ A;  5KYU B;  4V2S A;  2AKL A;  2OJ2 A;  4M7A F;  1VQK Q;  4QVZ A;  6AT1 B;  2F5K A;  2JW4 A;  4RTX A;  2M0O A;  5GMK l;  3PFS A;  3AHU A;  2F2W A;  1VQ5 T;  1Q7Y U;  5KYW B;  2VB6 A;  3VV0 A;  3RUX A;  4Z89 A;  1YJN A;  3I56 T;  3CCQ A;  1C1A A;  1WJQ A;  5CQY A;  2ATC B;  2K3X A;  3AT1 B;  1VQ6 T;  4EDU A;  4PJO D;  3T9N A;  4LXC A;  2OTL Q;  5I2M A;  3OYH A;  5J39 A;  4E6R A;  3M0Q A;  2QQ9 A;  5CKD A;  3QZ9 B;  2PNI A;  1N27 A;  3OYC A;  4HVW A;  3VU3 C;  2QI2 A;  3UT1 A;  5GAO l;  2O4X B;  4M7D D;  4HCB A;  3SDZ A;  3VS3 A;  2OTJ A;  3M55 A;  1M8M A;  2BKD N;  4A4E A;  4C92 G;  1IXD A;  1C6V X;  3V7S A;  1B34 B;  4EMG A;  1M90 C;  3EGU A;  3PIP A;  2CP5 A;  4PFZ A;  4YTL A;  2KRO A;  1RAH B;  2KRS A;  2V1R A;  3O8V A;  4QVD A;  3CPW P;  1Q86 R;  4XU2 A;  2YDL A;  4M75 F;  1ZA2 B;  5AYF A;  3G4S T;  3JB9 J;  4AFZ C;  3CCE A;  3VS0 A;  2RF0 A;  1X6O A;  1QWF A;  2DF6 A;  2LTO A;  3CCR A;  1Y0M A;  2XKO C;  2KE9 A;  4UC4 A;  2DYB A;  4RG8 A;  1V76 A;  2XHC A;  2EIF A;  1UGP B;  2MIO A;  1YJW Q;  2DKG A;  2JUF A;  4C92 C;  4GLM A;  3LH0 A;  1VQ7 A;  2K5L A;  2XIC A;  1Y71 A;  3RBB B;  1MV0 B;  2X3W D;  4L6V 5;  3OYL A;  2M0Y A;  2VAS A;  5FWC A;  2F69 A;  3MET A;  1UGV A;  5GAN f;  1LVK A;  5GAN e;  4M77 B;  3S6W A;  1KG1 A;  3CCV T;  3TEE A;  4F16 A;  2D9T A;  3OQ5 A;  4X9D A;  1Q86 U;  4IUR A;  1VUB A;  2AIR B;  1MMA A;  4IUP A;  2GQV A;  3M0P A;  2KYM A;  1YHQ A;  1QVG P;  2VYT A;  2SEM A;  3L2R A;  1OPL A;  1G8X A;  3E1S A;  3QZ5 B;  5GAM d;  2FB7 A;  5LJ5 j;  1LOJ A;  2ED1 A;  4BAC A;  2X35 A;  2P0P A;  2RQR A;  2XG8 D;  3UPU A;  1YJN T;  3CCQ T;  4J7I A;  1Q82 R;  1VA7 A;  2GF7 A;  3A98 A;  1JJ2 A;  1X75 C;  4RMO A;  4E7L A;  3CEY A;  2E65 A;  3X28 B;  1B07 A;  2Y4X A;  3VS4 A;  3JCM W;  2DJZ A;  2J7I A;  1M1F A;  2Z0W A;  4RTT A;  5LJ3 f;  1IHW A;  4FIB A;  5LJ3 e;  1E6G A;  4PK4 A;  4QVC A;  3DLL A;  4BI3 A;  1NBE B;  2OTJ T;  5GMK e;  4XTZ A;  2CT4 A;  2F2V A;  1YIJ Q;  3X20 B;  2BE7 D;  4MMK A;  1B7T A;  2YHT A;  4ZGJ B;  2BIV A;  3SB2 A;  1QKX A;  1U5S A;  5CKB A;  5EC7 A;  4M78 A;  4PJJ A;  2K7A A;  4FU6 A;  3ULR B;  3CCU Q;  1HD3 A;  2CP3 A;  4HCC A;  1N6A A;  3LLR A;  2FO0 A;  1Q82 U;  1WI7 A;  3CCJ A;  2LC4 A;  4LDU A;  2I2L A;  4XU0 A;  3CCR T;  4EIK A;  4EMK B;  5A0D A;  2CZ7 B;  5FRO A;  2BZX A;  2PQW A;  2XMF A;  1X43 A;  5DLO A;  4M78 G;  2C0T A;  3KFV A;  2KDS A;  1H8K A;  2YSQ A;  4PFP A;  4M77 D;  1SG5 A;  2RHU A;  3CPW S;  2FHD A;  3A8G B;  4MZP A;  2EWN A;  4XK8 E;  1H3Z A;  1C0M A;  1OZ3 A;  1H64 1;  1I07 A;  3JAM E;  2DIQ A;  3HTR A;  4FYX B;  4Y28 E;  2GTJ A;  5FWB A;  4XQ3 A;  3EFO B;  4QKU A;  1PNJ A;  2ZZD A;  3LX7 A;  4KH1 B;  3VRZ A;  3REA B;  3G6E Q;  1WIE A;  4FSX A;  4DBR A;  1GFC A;  3OSV A;  3KXT A;  2EW3 A;  3PT9 A;  5D6W A;  1VQL Q;  4HA8 A;  3H6Z A;  2CSI A;  5CO7 A;  1Y96 B;  4OGC A;  4Y91 A;  3PMT A;  2FRY A;  1R0C B;  1W2B A;  1BIA A;  4OMP A;  2RJC A;  3I35 A;  1UGQ B;  1BI2 A;  4M78 C;  2E64 A;  3CCL T;  2K5I A;  3CC2 Q;  3G71 A;  5GAN d;  2DVJ A;  3CC4 T;  4R55 A;  3CBO A;  1VQO A;  4F7U A;  1MV3 A;  3I55 A;  1VQ4 A;  2HDA A;  2DA9 A;  2KEA A;  3TSZ A;  1UHF A;  2EQK A;  4JJB A;  1YIT A;  2C0I A;  4IIO A;  2QXF A;  3LWH A;  5I11 A;  1M30 A;  1NPP A;  2EPD A;  2HD0 A;  2JM8 A;  2QA4 Q;  1RAF B;  3RES A;  3I9Q A;  4F7U G;  2NUT A;  4DEX A;  4DEY A;  5HKC A;  1U06 A;  4B9X A;  5DLQ E;  2KGT A;  5EG2 A;  3PMI A;  2L3R A;  1NLO C;  2DL3 A;  2DLP A;  1WNL A;  2ZPF B;  3OYK A;  4JRQ A;  1UTI A;  2EQU A;  1VYV A;  2DZC A;  1VQK A;  4KBM B;  1IGQ A;  3VS5 A;  2E3H A;  5CAI A;  3PGG A;  3CME T;  4E7I A;  3EAE A;  4ATO A;  3OYF A;  3OW2 A;  3HFO A;  4QW2 A;  3VS1 A;  2JT4 A;  1AVZ C;  3JB9 D;  2OTL A;  1RAE B;  3CCJ T;  3THK A;  2QDL A;  2DK3 A;  4WF2 A;  1AWO A;  3NPF A;  2DM1 A;  2CUB A;  4C8Q E;  1FWZ A;  3V8K A;  1JJ2 P;  2QQB A;  1ZUK A;  3CC7 Q;  2DTH A;  2RI3 A;  1QVP A;  2ED0 A;  4OB0 B;  1QP3 A;  4ESR A;  5GAN h;  1MHN A;  4DA4 A;  5KH6 A;  3MKD A;  3UA6 A;  1M27 C;  2ESW A;  1R8O B;  2LVM A;  1ZBX A;  2DER A;  1OQK A;  1JO8 A;  4XU3 A;  2JVV A;  2FEI A;  5LL6 S;  3CD6 T;  1QWE A;  1TSF A;  1HXD A;  1WA7 A;  4OMQ A;  1MMN A;  2D6F A;  4PFO A;  4B6M A;  2K2V A;  2R5M A;  3F70 A;  1QVF A;  3RIR A;  4GLK A;  5IH2 A;  1U1T A;  4M7A E;  5GAO q;  1M1K C;  1VQO T;  1YJW A;  2E5Q A;  1NJI U;  1TU0 B;  3MCA B;  1BCO A;  3JCM P;  2QTX A;  4IUQ A;  4AFQ C;  1GCQ A;  1YIT T;  4KT0 E;  2RJF A;  5GAM g;  2GFA A;  1AT1 B;  1WZO A;  3SWN A;  4KGZ B;  1TH7 A;  4K11 A;  4OP0 A;  2CRE A;  1SRL A;  4C92 D;  1NEG A;  5LJ3 h;  1VQ8 Q;  3MO8 A;  2RA2 A;  3JCM f;  1G3W A;  4MZT A;  3JCM e;  1NE8 A;  5GMK h;  2BZY A;  1SPK A;  1WLP B;  1VQ9 T;  1SF9 A;  3H8Z A;  4OMO A;  3RR6 A;  2OI3 A;  1WPY A;  4C5E A;  1NPR A;  1ZBJ A;  3HP9 A;  4FYV B;  2C0O A;  1IZ6 A;  1ZSZ C;  3RKY A;  3UAT A;  3OBY A;  1UJY A;  3LWI A;  4J8O A;  2ROT A;  3CPF A;  2A28 A;  3TSW A;  2HMA A;  3H0I A;  4RG2 A;  2CP0 A;  1Q81 C;  1W2B P;  2JZ2 A;  2YRD A;  5CR2 A;  3CCM A;  3JCM b;  4J83 A;  5L23 A;  2DD4 A;  2OTL T;  4JRP A;  2LDM A;  3QG1 A;  1EX4 A;  5GMK m;  1OU9 A;  2EYW A;  4M7D B;  1Z9Z A;  4Q5W A;  2O31 A;  2AT1 B;  1TG0 A;  4BE2 A;  1YWO A;  1QVG A;  4JLI A;  2RHZ A;  2YUN A;  1KHI A;  1UEC A;  4E7S A;  3OYJ A;  3LW5 E;  3OS0 A;  3UDC A;  1TS9 A;  3P8H A;  4M4Z A;  4A53 A;  1WHL A;  1IB8 A;  1YIJ A;  4F17 A;  2M02 A;  1VQM Q;  3L2U A;  3EH1 A;  1Z9Q A;  2A7Y A;  5KCO A;  1SHG A;  4C8Q F;  1R77 A;  4ELY C;  5KCH A;  5GAO m;  1WHJ A;  2ZAE A;  3GBQ A;  2JXB A;  2QG9 B;  2WAC A;  2RNA A;  5GAO r;  3CCU A;  1JJ2 S;  1UJ0 A;  4J9F A;  1Q7Y R;  1QMC A;  1X01 A;  3L2Q A;  2QDY B;  3TQ7 P;  3GPL A;  2GFU A;  2X4Y A;  3OSS C;  4JZ4 A;  2CP6 A;  2P0Q A;  4HCK A;  4AG1 C;  1K0X A;  2EYZ A;  2AHJ B;  2CS7 A;  2J06 A;  2SRC A;  3OW2 P;  3A5Z B;  1V1C A;  1EIF A;  2LNV A;  3JRZ A;  2DO3 A;  4XAX B;  1KQS A;  2IVW A;  5GAN 4;  3CMA Q;  1UGS B;  2W10 A;  1K8A C;  4J9G A;  2G3R A;  2ZPG B;  3INZ A;  3U23 A;  5GJW B;  5GAN g;  4PJO E;  3EG2 A;  4J9C A;  2MMP A;  2ZPB B;  4DBQ A;  1ZSG A;  3DB4 A;  2LCC A;  2RQU A;  2YXY A;  3HPW A;  4BB7 A;  4BY6 C;  1NYF A;  3S3O A;  3LGF A;  3EHQ A;  5FU7 B;  4F7U B;  2PVD B;  3H9N A;  1ARK A;  3C4S A;  4M7D E;  2RO0 A;  3VUZ A;  3R6O A;  4PNO A;  4IUT A;  4PJN A;  2LT1 A;  4RTW A;  7AT1 B;  3QWX X;  3FJP A;  1YJ9 Q;  1LCK A;  5J26 A;  3CQT A;  1ZUU A;  2X4J A;  1BKB A;  3CC2 A;  3CCS A;  2EJG A;  4C92 A;  1G2B A;  2NUT B;  3GIB A;  1K1Z A;  4C8Q G;  1AZE A;  1M3C A;  3C0C A;  1PHT A;  1W4S A;  4XTY A;  2L3Q A;  2KSS A;  1PKS A;  4M78 D;  3VKI A;  3X26 B;  5LJ5 h;  1M9S A;  2DIL A;  3CCM T;  1UG1 A;  1QVF P;  3MP6 A;  1YP5 A;  2J05 A;  5KYX A;  1N9S A;  2QA4 A;  3ASK A;  4R56 A;  1G3S A;  4M7A A;  2KQW A;  2VXF A;  3L42 A;  3E9G A;  4HVV A;  1W2B S;  3V8L A;  2JMC A;  1VQN Q;  3EFR A;  4EMH A;  1GBQ A;  3VS2 A;  2QAS A;  4OB2 B;  3EGX A;  3QJY A;  3RKW A;  5M9O A;  3MP8 A;  4C8Q C;  1N5Z A;  2AZS A;  1ABO A;  3V8J A;  3DKM A;  3FC3 A;  1KC8 R;  2M16 A;  2GTO A;  4BD3 A;  3JB9 H;  2BUD A;  1NEB A;  4M7A G;  2JTF A;  4N4G A;  4RKU E;  3VS7 A;  3VYG A;  1WQ7 A;  2PVO B;  1BI3 A;  4D8D A;  2JM9 A;  2HL3 A;  2JNG A;  2YRV A;  4C0D C;  3BE3 A;  4KH0 B;  2CP7 A;  3E2U A;  1OX9 A;  4JJD A;  1FYN A;  3EG9 A;  1MMD A;  3GOX A;  2EQI A;  3C95 A;  2QEX A;  3CC7 A;  1VQP T;  2RHY A;  2F5T X;  2RQW A;  2HQE A;  3JB9 I;  2CP2 A;  4KGV B;  1M2V A;  5KE3 A;  4M75 A;  4PL6 A;  4M7A C;  5HK3 A;  1J3T A;  1OPK A;  1X2Q A;  4WTO B;  1KC8 U;  3JCM h;  1KD1 C;  2KAF A;  4J6W A;  2DEU A;  3OW2 S;  3ER0 A;  1VQ5 Q;  3TRE A;  3OYE A;  1OUL A;  1SHF A;  1NG2 A;  4PJO F;  3I56 Q;  2K3B A;  2EBP A;  4M75 G;  2R57 A;  3NTH A;  4EPC A;  1I81 A;  3SWN B;  1VQ6 Q;  1RAD B;  1X69 A;  5GAN 5;  4E47 A;  3SFM A;  3CC2 T;  2EAY A;  3CCS T;  4M7D F;  2EVR A;  1NYG A;  2MI6 A;  3WVD B;  4TVR A;  2EGC A;  1YI2 Q;  1PD0 A;  1EFN A;  4N4H A;  5GAN 6;  4KGX B;  1JXO A;  5CKE A;  2CT3 A;  2RMO A;  2OAU A;  2GNC A;  2YWW A;  2E5K A;  1KQS P;  2QAZ A;  2D8J A;  2QA4 T;  3EG1 A;  3QBY A;  2O2O A;  1CKB A;  3OYA A;  2KNB B;  3HL8 A;  1I5L A;  1WHM A;  3ZFJ A;  2HKQ B;  4M77 E;  1WXT A;  1QCF A;  4M75 C;  2MWP A;  4OMF B;  2R5A A;  2MAM A;  1GRI A;  1Q95 G;  4P5N A;  1D0Z A;  3WXM B;  3G7Z A;  3BDL A;  2EYY A;  3G4S Q;  4FT4 A;  3WVE B;  1LJO A;  4CRI A;  4DQ2 A;  3CCE T;  1U8R A;  2NWM A;  3GNF B;  2L3P A;  2CYZ B;  1JEG A;  1LPL A;  2E41 A;  3FIF A;  1YFN A;  2LP5 A;  4C5H A;  3QXE B;  1JQQ A;  1OV3 A;  4BE1 A;  4HT8 A;  2FZC B;  4PJO G;  1RI9 A;  4LDX A;  3OB9 A;  4FYW B;  2HL5 C;  1Y57 A;  1VQ7 T;  1M2O A;  4L5G A;  8AT1 B;  1K4U S;  3QO3 A;  2J6K A;  2ZPE B;  3CXC A;  2EYX A;  4ELZ C;  2RD1 A;  2ECZ A;  1KHC A;  4FL6 A;  2PZ1 A;  2LCL A;  4J9I A;  3CCV Q;  2QQR A;  4JJN K;  2QEX T;  4VUB A;  4LUE A;  2XDP A;  4OF1 A;  1AWJ A;  2KYB A;  1VQM A;  2R58 A;  1YHQ T;  4BUG A;  1AWW A;  2EQJ A;  2HCK A;  4LDW A;  1AOJ A;  2GGR A;  3D7S B;  3ME9 A;  1GBR A;  1WFW A;  4LNP A;  1N8R R;  4X1V A;  4PJO C;  3M57 A;  2JS2 A;  3TU4 K;  1WQW A;  1T3S A;  4RCC A;  1WJR A;  3H0F A;  1BU1 A;  3MHX A;  4LUD A;  3VRY A;  1IO6 A;  1RAG B;  3CCQ Q;  2VC8 A;  1UE9 A;  4A54 A;  2V8I A;  2LMJ A;  2E1H A;  2HKN A;  2DTI A;  1QVG S;  1K9M C;  1M4Z A;  2AKK A;  1U3O A;  2ZPI B;  1YNZ A;  1K73 C;  4ZN3 A;  1PD1 A;  3CMA A;  2O88 A;  3FDR A;  1KK7 A;  1BI1 A;  3JCM g;  4C92 B;  2XID A;  2EFI A;  1BCM A;  1AHJ B;  3BY7 A;  1N8R U;  5HY6 A;  2A0F B;  3HRT A;  3RNJ A;  3JV3 A;  5GAO p;  2B8A A;  5LJ3 d;  1UHC A;  3I5S A;  4XTX A;  5GAN 8;  2EJ9 A;  1PKT A;  5KYX B;  1I8F A;  1YJ9 A;  4E7Z A;  4C0G A;  5LJ5 f;  2RPN A;  1HSQ A;  5LJ5 e;  2XD0 A;  1KQS S;  1D09 B;  2CUD A;  2KY9 A;  3CCR Q;  5GJV B;  1OZ2 A;  4N0A A;  5KYY A;  3DLM A;  2JJ9 A;  3GF5 A;  4IIM A;  1PCX A;  4OGE A;  4M77 F;  2FG0 A;  1RAA B;  2DBK A;  4MML A;  3SD4 A;  1OYX A;  2KRN A;  3NFC A;  1JU5 C;  1SRM A;  3PVL A;  1GCP A;  1RLQ C;  3HRS A;  1NJI R;  2HQX A;  1XJW B;  3EGX B;  2FYK A;  2JMA A;  1PC0 A;  2M9U A;  1IHV A;  2D1X A;  1ZA1 B;  3M54 A;  5GAM j;  1YBY A;  1G3T A;  2V8J A;  4JS5 A;  5FLX E;  3EG0 A;  4QQD A;  2ABL A;  1UUE A;  3GP8 A;  1MGQ A;  3M0T A;  2L8D A;  4B9W A;  2CZ6 B;  1N9R A;  4N4I A; 
#chains in the Genus database with same CATH homology
 2RNA A;  1ZUY A;  1UJ0 A;  4J9F A;  2MIO A;  1UDL A;  2O9V A;  4J9B A;  4GLM A;  4JZ4 A;  1VYT A;  4HVU A;  3RBB B;  5FW9 A;  1MV0 B;  1SSH A;  2X3W D;  2G6F X;  4HCK A;  4AG1 C;  2EYZ A;  1K0X A;  2M0Y A;  1KSW A;  2M51 A;  5FWC A;  4FSS A;  1UGV A;  1GFD A;  2J06 A;  2SRC A;  2DJQ A;  1X27 A;  1V1C A;  2DRM A;  2KT1 A;  3M0U A;  2ROL A;  4F16 A;  2KR3 A;  2L2P A;  5IXF A;  2W10 A;  4J9G A;  5IHI A;  2VVK A;  2YUQ A;  3U23 A;  4R0K A;  5GJW B;  4OMN A;  1W1F A;  3EG2 A;  4J9C A;  2AZV A;  3M0P A;  2KYM A;  1ZSG A;  2RQU A;  2SEM A;  4QT7 A;  1S1N A;  1NYF A;  2B86 A;  5ECA A;  3EHQ A;  4OML A;  1ARK A;  1OPL A;  2ED1 A;  4GBQ A;  2RQR A;  3I5R A;  4RTW A;  2CDT A;  3QWX X;  5I22 A;  1X6G A;  1LCK A;  1VA7 A;  3CQT A;  3A98 A;  1ZUU A;  5IXB A;  1E7O A;  2LX7 A;  1G2B A;  2LJ3 A;  1K1Z A;  2X3X D;  1AZE A;  2V1Q A;  1PRL C;  1M3C A;  3C0C A;  1PHT A;  1YN8 A;  1B07 A;  3VS4 A;  2O9S A;  2J7I A;  2L3Q A;  2DX1 A;  1XOV A;  4RTT A;  1PKS A;  2I0N A;  2DL5 A;  2DIL A;  3PVQ A;  1E6G A;  1UG1 A;  2HBW A;  1YP5 A;  3EHR A;  1SEM A;  2J05 A;  2CT4 A;  2F2V A;  1KJW A;  4AFS C;  2EGE A;  3H41 A;  1I1J A;  1QKX A;  3M0R A;  1U5S A;  2D0N A;  2KRM A;  5EC7 A;  4HVV A;  2K7A A;  2JMC A;  3ULR B;  2DRK A;  1HD3 A;  2A08 A;  1GBQ A;  3VS2 A;  1G83 A;  2FO0 A;  1N5Z A;  2AZS A;  1ABO A;  1E6H A;  1WI7 A;  4Y92 A;  4EIK A;  1GL5 A;  2GTO A;  1NEB A;  4CC7 A;  2BZX A;  2XMF A;  2DL7 A;  3VS7 A;  2L3S A;  3NMZ C;  1X43 A;  4WCI A;  1X2K A;  1A0N B;  2C0T A;  3KFV A;  1H8K A;  4D8D A;  2YSQ A;  2JM9 A;  1OEB A;  1PRM C;  1RUW A;  1I07 A;  1K0S A;  1WX6 A;  2GTJ A;  5FWB A;  2L0A A;  1PNJ A;  4JJD A;  1FYN A;  3VRZ A;  1B3Q A;  3REA B;  1WIE A;  1X6B A;  1GFC A;  2EQI A;  2LNH B;  2EW3 A;  2IIM A;  1ABQ A;  2DBM A;  2JS0 A;  1PWT A;  2CSI A;  2RQW A;  2FRY A;  2KBT A;  2MOX A;  3O5Z A;  2RQV A;  4OMP A;  1TUD A;  3UF4 A;  3I35 A;  1J3T A;  1WXU A;  1OPK A;  1X2Q A;  3PE0 A;  2DVJ A;  1K9A A;  2ENM A;  1MV3 A;  2HDA A;  1QLY A;  2H8H A;  1WDX A;  2DA9 A;  1M3A A;  2KEA A;  1SHF A;  3TSZ A;  1NG2 A;  1UHF A;  1I0C A;  3VS6 A;  1H3H A;  4JJB A;  2K3B A;  2NUZ A;  2EBP A;  1MUZ A;  4AFU C;  2C0I A;  4IIO A;  1X69 A;  5I11 A;  1M30 A;  4RTZ A;  2EPD A;  2JM8 A;  4JJC A;  1NLP C;  4J9E A;  2EVR A;  1NYG A;  3I9Q A;  2EGC A;  2LCS A;  4DEX A;  1M3B A;  4DEY A;  5IHK A;  1W70 A;  1EFN A;  1U06 A;  2GQI A;  2KXD A;  4CC2 A;  4CC4 B;  1VYU A;  1AD5 A;  3EG3 A;  2KGT A;  1NLO C;  2DL3 A;  2DLP A;  1YCS B;  2LJ0 A;  2K79 A;  1H92 A;  1UTI A;  5HCK A;  1JXO A;  2CT3 A;  2RMO A;  1VYV A;  2GNC A;  2E5K A;  2YT6 A;  2D8J A;  3EG1 A;  2O2O A;  1CKB A;  1QKW A;  4RTU A;  2KNB B;  3UA7 A;  4F14 A;  1AWX A;  1RLP C;  3VS5 A;  2A36 A;  1WXT A;  4RTV A;  1QCF A;  3SHW A;  1GRI A;  3TVT A;  1TUC A;  1W6X A;  2EYY A;  4J9D A;  3VS1 A;  2JT4 A;  1AVZ C;  1JXM A;  2NWM A;  2J6O A;  2L3P A;  2CSQ A;  1JEG A;  3THK A;  3NGP A;  4KRT A;  3SEM A;  1AZG B;  2QDL A;  4LN2 A;  1AWO A;  3NPF A;  2J6F A;  2DM1 A;  2CUB A;  2LP5 A;  1KIK A;  2CH4 W;  1JQQ A;  1GCQ C;  1OV3 A;  2P4R A;  1HJD A;  3R6N A;  2OAW A;  3REB B;  1BK2 A;  2DMO A;  1ZUK A;  2BZ8 A;  1RI9 A;  4D8K A;  4RUG A;  2ED0 A;  2FPF A;  1Y57 A;  3M0S A;  2RQT A;  1T0H A;  2F2X A;  2VWF A;  1WYX A;  1K4U S;  4ESR A;  2J6K A;  2EKH A;  3UA6 A;  2EYX A;  3ZL7 C;  1M27 C;  1BB9 A;  1WXB A;  2ESW A;  2DE0 X;  2ECZ A;  3LH5 A;  2HSP A;  2PZ1 A;  1JO8 A;  1CKA A;  4J9I A;  2KXC A;  1UFF A;  2FEI A;  1QWE A;  4LUE A;  4HXJ A;  1ZX6 A;  4ORZ A;  2MCN A;  1WA7 A;  1AWJ A;  2LQN A;  4OMQ A;  2DL8 A;  2K6D A;  2KYB A;  2K2M A;  2FPE A;  2YUP A;  2VKN A;  2GBQ A;  1AWW A;  4AG2 C;  2HCK A;  1AOJ A;  1NM7 A;  3H0H A;  2JTE A;  2CH4 A;  5IH2 A;  2GGR A;  3QWY A;  1GBR A;  1WFW A;  4LNP A;  4X1V A;  2JS2 A;  1YWP A;  1T3S A;  2HEQ A;  3H0F A;  1BU1 A;  4LUD A;  3VRY A;  2FPD A;  1IO6 A;  2DNU A;  4AFQ C;  1UE9 A;  1AEY A;  1GCQ A;  1KFZ A;  4Z8A A;  2LMJ A;  2K9G A;  1CSK A;  4K11 A;  2AKL A;  2AK5 A;  2CRE A;  2OJ2 A;  2AKK A;  1SRL A;  1U3O A;  1NEG A;  2JW4 A;  4RTX A;  1YNZ A;  2F2W A;  4Z88 A;  3FJ5 A;  2YUO A;  2BZY A;  2D8H A;  1SPK A;  1WLP B;  2DL4 A;  4Z89 A;  2O88 A;  4OMO A;  2OI3 A;  1ZBJ A;  4LE9 A;  2LZ6 B;  2C0O A;  2A37 A;  4E6R A;  3M0Q A;  1BBZ A;  1OOT A;  2LJ1 A;  2KT8 A;  3UAT A;  1UJY A;  2ROT A;  2PNI A;  2A28 A;  3TSW A;  3H0I A;  4HVW A;  1FMK A;  2LQW A;  3RNJ A;  3JV3 A;  4CC3 A;  2W0Z A;  1UHC A;  3I5S A;  1PKT A;  3VS3 A;  5IHN A;  4ZNX A;  2RN8 A;  2PTK A;  4A63 B;  1M8M A;  5L23 A;  2RPN A;  1HSQ A;  2CUD A;  3IQL A;  3EGU A;  5GJV B;  4IIM A;  1K76 A;  2EYW A;  2EGA A;  2FG0 A;  1Z9Z A;  4RTY A;  2DBK A;  4J9H A;  2KRO A;  2KRN A;  2O31 A;  1JU5 C;  1TG0 A;  2KRS A;  1SRM A;  1YWO A;  2V1R A;  3PVL A;  2YUN A;  1GCP A;  1RLQ C;  1UEC A;  2YDL A;  1T0J A;  2JMA A;  4M4Z A;  4AFZ C;  3VS0 A;  1ZLM A;  2D1X A;  2RF0 A;  4JPB W;  4F17 A;  4JZ3 A;  4OMM A;  3EG0 A;  2BTT A;  1QWF A;  2DF6 A;  1Z9Q A;  1SHG A;  2ABL A;  1UUE A;  3NHN A;  1Y0M A;  2FRW A;  2KE9 A;  3M0T A;  1T3L A;  2DYB A;  3GBQ A;  2JXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...