5GAN5

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
75
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 75
sequence length 81
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan500
4J6WA 1N9RA 4NL2A 4C8QF 5LJ5j 2K57A 4M75G 3JCMX 3BY7A 3RKYA 5GAN5 1X01A 4M75F 3AHUA 3FJPA 3JCMh 1D3BA 3FIFA 4C8QE 4A53A 2DTOA 4PJOC 4M78A 3JCMV 4F7UA 4M7DD 2YLCA 5GAOl 4X9DA 3HFNA 2YLBA 4EMKC 4M75E 1LNXA 2VXFA 5LJ3h 2E41A 3V7SA 4MMLA 5GANh 1TH7A 4XTWA 3V7RA 2ZGWA 2RD1A 2DXTA 5GAMd 4C8QC 2EJ9A 4JRKA 4Y91A 1Y96B 4XTYA 4C92A 4J6XA 2EWNA 1BIAA 4JLIA 4M75C 3RKWA 1D3BB 5GMKe 4M78F 1WQWA 4M77G 4M78B 1JBMA 4EMGA 5GANe 4EMHA 5LJ5f 3JB9D 2EJFA 5GAOn 4M77F 1B34A 4M77B 3RKXA 4DQ2A 4M7AG 2E10A 2DJZA 5GAN2 5GAOr 2E64A 4M7AF 5LJ5g 2DEQA 5GAMg 5GMKj 4M7AB 5GAOq 4XU2A 2RB6A 3SWNC 3L2ZA 5GANj 1I81A 3L1AA 4PNOA 2JN0A 4C92F 3V8JA 4HT8A 4XU3A 4C92B 1WPYA 4JRIA 2DZ9A 2HNIA 3M4GA 4XTXA 4J5YA 3JB9J 3JB9H 4M7DA 1KQ1A 1B34B 2QTXA 4OP0A 2YHTA 5GMKi 1N9SA 3JCMe 5LJ5d 4PJOD 4XTVA 4M78G 4F7UG 3JCMQ 3JCMJ 1U1SA 4XTUA 5GAN3 3V7CA 3HSBA 5GAN8 1LJOA 5LJ3e 2VXEA 4F7UF 4PJOA 4F7UB 3BDUA 4X9CA 3RIRA 5GMKm 3HFOA 4EMKA 2RA2A 3JB9I 4C8QD 4M78E 5GANf 4M7DF 5LJ5h 5GAMh 4JUVA 4M7DB 4XU0A 2E1HA 5LJ3j 2VC8A 4M75D 4M77E 4C92G 1U1TA 4HA8A 3JCMP 4C8QA 2FYKA 4J6YA 3JCMW 3EFRA 2DTHA 1M5Q1 3BFMA 5GAN6 2FB7A 5GAN4 3RERA 3QSUA 4M7AE 4M75A 2DVEA 3V8LA 2DKGA 4PJOB 1I4K1 4M78C 3RESA 5GAMe 4C92E 3EFSA 1I8FA 4EMKB 3QUIA 4M77C 4XU1A 5GAOm 3JB9F 5CAIA 4A54A 4RCCA 1JRIA 2DTIA 3JCMb 3V8KA 4QVCA 5GAOp 1I5LA 4M7AC 3JCMf 4XQ3A 3FB9A 3SWNA 3JCMc 4C8QB 5GAMj 1HK9A 4M78D 1YCYA 5GANd 1KQ2A 4HT9A 3INZA 4C92C 1Y96A 3GIBA 4M7DG 4M77D 4M75B 4QVDA 1HXDA 5LJ3f 1LOJA 3JCMg 4F7UE 4WF2A 4NL3A 5I21A 3QHSA 4N0AC 2DZCA 4M7AD 1WNLA 2EAYA 4M77A 5GMKh 1MGQA 1M8VA 5LJ3g 4PJOG 3SB2A 4C92D 5GANg 4M7DE 4MMKA 4NOYA 4M7AA 4V2SA 4PJOF 2E65A 3SWNB 5GAN7 5GMKl 4RCBA 5LJ5e 3PGGA 5DY9A 3JB9G 2Y90A 3JCMd 1H641 2CGHA 3VU3C 1WQ7A 3QO3A 4PJOE 2RM4A 4XTZA 5GAMf 2I2LA 4C8QG 3BW1A 2DXUA 4N0AA 1BIBA 3RUXA 2EJGA 4M7DC 5LJ3d
chains in the Genus database with same CATH superfamily
5LJ5j 3EGUA 1WHHA 3F70A 2XDPA 1X01A 3CD6T 2BIVA 1RAEB 4C8QE 2DBKA 1X69A 2RF0A 2E41A 1VYVA 5GANh 1QCNA 1TH7A 4JDSA 2D6FA 3BDLA 2H3JA 1MHNA 4XTYA 2EWNA 4C0DB 2AKLA 4OMPA 3H0IA 2V8KA 2LQWA 2DYBA 4ZGEB 1ACMB 4HXJA 1ABQA 5A0GA 2KNBB 4WCIA 3JB9H 1KQ1A 4J9CA 5DLOA 2VVKA 2KK4A 2HDAA 3G7ZA 3M59A 3HSBA 3I5SA 3RMQA 2Z0WA 2DFUA 3I55A 4OB0B 3KFVA 4LDUA 2DO3A 5KYUA 4JJCA 1MNEA 2RHYA 4R0KA 2DF6A 2M0OA 3GLXA 2FRYA 2EQIA 4AFUC 3EHRA 2AT1B 4AG2C 1I0CA 1OOTA 5FW9A 4RMOA 1M2VA 1RLPC 1PKTA 2LNVA 4ZN3A 3X24B 4J9IA 3E1SA 2CSQA 2M9UA 2QEXT 3EG3A 5CIUA 1VQ7A 1RL2A 2RI2A 4LDWA 2OTLA 4M7DG 1AZEA 1NEBA 2DE0X 3JCMg 4KBMB 1VIEA 1T0HA 3LGFA 3L2VA 1VQ7Q 2OTLQ 1YWOA 5GAN7 2ZPFB 2A0FB 3E9GA 1YIJT 3QO3A 1VQKT 5D7UA 3J7AF 1K1ZA 3OMGA 4Z88A 1JJ2S 3OYJA 2QA4Q 4F7UA 4LNPA 1WJQA 3OA6A 1QCOA 2RI5A 4MMLA 4C5GA 2COYA 3PVLA 1G3YA 3CC7T 4Y91A 2DX1A 2JNGA 3QWXX 3REAB 1VYUA 1BI2A 1JB0E 3LWIA 3CPWA 5GAMg 3QDFA 3J80E 2DILA 4XU2A 2QEXA 4AFSC 2IPOB 4C92B 5HKCA 2KBTA 1WIEA 2FL7A 1TU0B 1GFDA 2ZPBB 2C0TA 1W2BS 1UECA 3P8BB 1WFWA 2JW4A 4QQ6A 2AHJB 1LPLA 4E7IA 2F2VA 2E6NA 1D1CA 1KSWA 2CH4A 1VQKA 1YBYA 2PQWA 1JQQA 4E47A 5FRMA 2O88A 3GP8A 4BE1A 2VC8A 1MMAA 1Y57A 1M90U 1UB4A 4A4HA 2OJ2A 2KXDA 3RERA 2OI3A 2HSEB 2FZGB 4C5IA 2RQRA 4DBRA 1BU1A 4L5GA 4FW2A 2CDTA 1VQ5T 5GAOm 3V8KA 2LVMA 1SHFA 3QBYA 2A36A 5GAMj 3CCVQ 2GFAA 1SKUB 2VWFA 3OYFA 4M77D 1WDXA 2JS2A 1KC8U 1HXDA 5LJ3f 3FC3A 4M77A 2P0QA 4E7SA 2MAMA 2P4TA 4V2SA 1BBZA 4PFZA 4BY6B 1OX9A 4HVUA 4B9XA 3OYGA 4JZ3A 1U8RA 3ZFJA 4ZTFA 4C8QG 4OB3B 4RTYA 2SEMA 3QG1A 1VQNQ 1NJIR 1OI1A 1WHKA 2K2MA 2NUZA 2YT6A 1X6BA 4D8KA 2X4YA 3JCMh 4PJOC 4LUEA 4M7DD 4Z02A 4PK4A 2YUPA 3FRNA 2DERA 1Y0MA 1Y71A 1WHJA 2VB6A 2MK5A 3LH0A 2Y4XA 1Y96B 4C92A 2RI3A 3EH1A 4M75C 2DM1A 2RJEA 1EFNA 4RG8A 3VS0A 3EGXB 1VQ5A 1PSFA 1NZ9A 2R5AA 3OS0A 2E64A 4EDUA 1BYMA 1WJSA 1I81A 2DZ9A 2LRQA 2HNIA 2CP3A 4J5YA 1LVKA 3DB4A 2COZA 2MCNA 6AT1B 3CBOA 3CCJT 1PCXA 2LCCA 1YP5A 2RHUA 4QKUA 1K9MR 1AD5A 2QQ9A 4RKUE 4JPBW 1ZBXA 2RA2A 5GAMh 2VYTA 4PLIA 2ZPGB 2A3LA 5A2QE 2X3XD 4ZGDB 2DKGA 1SEMA 3IQLA 3ME9A 3M9QA 4XQ3A 1KFZA 2PVOB 1M1GA 1EIFA 2ECZA 3G6EQ 3Q1JA 2BUDA 1G5VA 3CPFA 3M53A 4M7AD 1SHGA 4PL6A 5DLQE 3GBQA 3QPHA 1KQSA 1M1FA 4MMKA 4M7AA 2MPXC 2CP6A 3JB9G 2CZ6B 1NYGA 2QQRA 1G2BA 1Q7YU 3PNWC 2R5MA 2NUTB 2BZXA 2OAWA 2K6DA 1YI2T 3DB3A 4BDYA 1FMKA 3EG1A 3FIFA 3EGXA 4A4GA 2E12A 2K79A 2O9SA 2JT4A 3CCLT 4OMOA 2DEUA 3A1PA 2RK2A 3X25B 1UGVA 2KQWA 4GLMA 2QDLA 2LDMA 3I9QA 3LGLA 4JLIA 1NLPC 2HKQB 2XHCA 9ATCB 3PTAA 4ATOA 3NPFA 1KK7A 3CCRA 1LCKA 2RH2A 3META 4AT1B 3OMCA 1IRXA 3U23A 3OS1A 1TWBA 4QQGA 2A7YA 4FSSA 2GCXA 3OYMA 4JRIA 3CCRQ 1PWTA 2D1XA 1GRIA 3OS5A 1JU5C 4DBFA 4BB7A 3CCMT 5C6SA 5IAYA 2CH4W 1Q95G 1WYXA 2K3YA 1K9MC 1TUDA 1G3TA 2DNUA 2VGNA 4C5EA 1AEYA 3VUBA 5LJ3j 5CR2A 1QVGA 3OYCA 1WX6A 2YSQA 2DL5A 2WSCE 4ESRA 2JTMA 2DVEA 3T9NA 2RHXA 1VQOA 4OMQA 1IGQA 2RJCA 1VQOQ 4HT9A 1M27C 1YJNT 1DJ7B 4PLLA 1M3CA 1D1BA 3QZ5B 2MI6A 2NUTA 1YJWT 5FU6B 2EAYA 2DL8A 1MGQA 2V8JA 3GF5A 2LJ3A 2LZ6B 3GOXA 1VQ6Q 1UHFA 2E5QA 3SWNB 3VKIA 2KT8A 3QJYA 1XOVA 1NM7A 3LYIA 2AZSA 2KRMA 3HRTA 3OW2A 3VRYA 2QASA 4C8QF 1SG5A 4E7ZA 3TEEA 4A53A 8ATCB 3L42A 2JVVA 1UJYA 2QAZA 3NGPA 3V7SA 3CC4T 3V7RA 1RI9A 1YHQT 1U06A 5KYXB 1R0CB 1D3BB 2IVWA 2YUNA 4M78B 3JB9D 4ANJA 1UHCA 3CPWP 5FWBA 3M56A 2QQSA 3BE3A 3UT1A 1BB9A 1YJNA 3FEOA 3M0RA 1K73R 1G83A 3JSCA 2AKKA 2BE7D 2MWPA 5AYFA 1KIKA 1ABOA 4ORZA 1UE9A 4PKCC 4XTVA 1N8RU 1YITQ 1OU9A 1S72Q 4N4GA 1I1JA 1KJWA 3CBPA 4PJMA 4OGCA 2WSEE 2D0NA 2GBQA 4J8OA 1OZ3A 2DK3A 4FT2A 4QQDA 2LC4A 2D8JA 1MNDA 4C0DC 1TOVA 5CKBA 3V8LA 3TSWA 4XU1A 3CC4A 1JRIA 2JS0A 1I5LA 1J3TA 1GXIE 3JCMf 3CCSA 3SWNA 1YHQA 2K5FA 2PUOB 3OYAA 3GIBA 1ZHIA 4HCCA 4N4IA 1QP3A 2DRKA 3CCSQ 4UC4A 3HL8A 2EGCA 2JTEA 3MP1A 2E6ZA 4FYYB 1QWFA 3MHXA 1X2QA 2CUDA 2QXFA 4X34A 1TXQA 3FJ5A 5DY9A 3QYGB 1M1KR 2JJ9A 2DXUA 3TVTA 3CMEA 4C5HA 1Q86R 1TG0A 5KYXA 3A5ZB 3AHUA 3FJPA 1D3BA 5CK9A 1WZOA 4M78A 4RG2A 3CMEQ 2YUOA 2RQVA 2L3PA 1NBEB 1OEBA 2ZCFB 3OYKA 2DXTA 5EC7A 2EJ9A 3I55T 3OBWA 5GMKe 1Z9QA 1G3SA 4E7JA 5GAN2 2JUFA 4QT7A 3R6OA 3PMIA 3R6NA 1UGSB 2KAFA 2KEAA 5IN1A 3HKSA 2EPDA 2KT1A 3PIOA 1VQ7T 2K7AA 1ARKA 2OTLT 4F7UB 5J39A 4OMNA 3JV3A 1JJ2A 2BE9B 2P4RA 4Y92A 5KE3A 2LMJA 3ER0A 1GBRA 4FIBA 1G8XA 1OZ2A 1N8RC 3OY9A 1M5Q1 5GAN4 2FB7A 4DEYA 2W0ZA 1I4K1 3GNGA 3RESA 2RNAA 4RCCA 3EGDB 1CKAA 1MMNA 2F1LA 3HRSA 2B86A 3MPUB 2J6OA 3X26B 5GANd 2R57A 5IHNA 4O5VA 1VUBA 2O2OA 2X4JA 4C92C 2JMAA 4FYWB 4Z8AA 4QVDA 1IHVA 1KQSP 5IT9E 3CCQQ 2I0NA 2OAUA 5I2MA 3ZEHA 4IUTA 1UFFA 2M02A 3UA7A 4HCKA 2X9HA 5CVIA 1QW1A 4PJOE 2I2LA 3RUXA 2K4YA 2RHZA 1N9RA 1X75C 2K57A 2FG0A 5GAN5 1HJDA 1Q86C 4GLKA 1OULA 1Z9ZA 2A28A 4M75E 1K8AR 2L3RA 3JRZA 2ZGWA 2RD1A 3UDCA 1RAIB 2L2PA 1PC0A 1BIAA 5CO7A 2EFIA 3N5BB 1JO8A 2QA4A 4EMHA 2CSIA 1QQJA 1D0ZA 4E2FB 1TUGB 2EKOA 4M77B 2D9TA 2VGMA 4BDZA 2RN8A 2EYQA 5IH2A 1SRMA 2AZVA 1C1AA 4BY6C 2ZPEB 2L0AA 3CCUA 3NHNA 3CCVT 4J9EA 5LJ5d 3CXCS 2EVRA 2OX7A 3CCUQ 1CKBA 1H8KA 4XTUA 1LJOA 2VXEA 3OYIA 1SPKA 3HFOA 3JB9I 1QVGP 4KT0E 2AK5A 4JJNK 3EGDA 3UWNA 1GL5A 4M7DB 1Y7XA 3S6WA 3VUZA 2HD0A 1V29B 1VQNT 3H0HA 5KH6A 2DXCA 3WXMB 2EQJA 1YFNA 3L2WA 5L23A 5GJVB 2DTIA 3URGA 3CC2A 1X6OA 3P8DA 3CC2Q 5HK3A 1AZGB 3M0SA 3TQ7P 4R55A 2QQBA 1VQ9A 4MDWA 4BI8B 3VS3A 2HZYA 2KR3A 4KGVB 4JRPA 1VQ9Q 2FZCB 3CCVA 2HL5C 2GQVA 2GNCA 2X35A 3OW2P 1QVFA 1VQMA 2G3RA 4JJBA 1MUZA 4N4HA 3UA6A 4J6WA 2LX9A 5HY6A 5J3BA 4J9DA 1VQMQ 2CT4A 4RTZA 4X9DA 3H41A 4AMCA 2LT1A 1NJIU 2K3BA 5D6WA 1K8AC 3SDZA 3PIPA 4AFQC 1VQNA 2VASA 2DMOA 5GAOn 2J05A 2IG0A 2QGGA 4ME7A 4J9FA 4DOVA 8AT1B 5GAOr 4M7AB 1YJ9A 2F5KA 2GTJA 1RAHB 2VUBA 3NTKA 4XU3A 2H3EB 2RK1A 3G6ET 1YJ9Q 4M7DA 1X2KA 1VQLA 5D6YA 1SSFA 1GCPA 2CZ7B 3JCMQ 1M8MA 4TVRA 3UPUA 1IREB 2CS7A 1VQLQ 5L8RE 3CPWS 1C6VX 5KYNA 2CZ0B 3G4SQ 1E6HA 1U3OA 3EFRA 1K9MU 4JJDA 3JAME 1PNJA 5HK0A 1NEGA 2LJ0A 1I8FA 1GBQA 3OYYA 3CBMA 3I56Q 2O01E 2A08A 1OV3A 1UTIA 3A8LB 2QG9B 3NFCA 1YNZA 1VYTA 4C8QB 3INZA 4MZTA 3REBB 2RQUA 1S1NA 2F69A 3MP8A 2ZPIB 4N0AC 4XK8E 2ATCB 4ZTJA 1BCOA 5GMKh 1AWJA 1M8VA 1QCFA 4PJOG 3OSSC 3M5AA 2OTJA 3WVDB 4BI4A 2BTTA 1RACB 5A0DA 2CP0A 3CCRT 3G6EA 4DEXA 4RTTA 2KRNA 5ECAA 1BIBA 4O6JA 5FU7B 2OTJQ 2FO0A 2F2XA 4M75G 1WXBA 1RAGB 2KXCA 1KG1A 4CC4B 1EZZB 1YWPA 5CQYA 1WXTA 3C95A 1H3ZA 5GAMd 4MZPA 4JRKA 3VS1A 2RO0A 3I5RA 1MV0B 5GANe 2K3XA 2LQ8A 5FU6C 1XTDA 3M57A 3EG0A 1NJIC 2DEQA 1V76A 3SWNC 3L2ZA 2E70A 4C92F 3C12A 1BCMA 1VQOT 1BKBA 4RTUA 2X4XA 4C0ZA 4PJNA 1MMDA 3V7CA 2ED0A 1JJ2P 1PKSA 1VQ6T 2A37A 4J7FA 4LN2A 2GGRA 4C8QD 4Z89A 1OYXA 4JUVA 2NWMA 1ZQ1A 3DKMA 1UG1A 2E1HA 2PZ1A 5I2SA 1VA7A 4C8QA 4J6YA 3QSUA 4M78C 5KE2A 1JEGA 4JS4A 2AIRB 4Q5WA 3LX7A 7AT1B 1KQ2A 2EYZA 3CCEA 1TTHB 2ZZDA 1XQHA 3CCEQ 1B07A 2EYYA 4KUDK 2BKDN 5GMKl 4RCBA 2M16A 5LJ5e 2FPEA 2WACA 2KMTA 1D09B 3VU3C 3TCJA 2DJQA 4XTZA 2HKNA 3I35A 3MEAA 1T3LA 1ZX6A 2JZ2A 2HQHA 2QI2A 4PJLA 1XJWB 1VQ6A 2KE9A 4HCZA 2DTOA 4KULA 2IIMA 1YITT 2EGEA 1S72T 4F17A 1AHJB 3MEVA 1KQSS 1W1FA 5CKDA 1NPPA 5AT1B 1N27A 4EPCA 1VQ8A 1QWEA 2EW3A 4LD9K 2LTOA 3G71A 4QW2A 2P0KA 5GAOq 4AFZC 4CRIA 1VQ8Q 2DXBA 3NMZC 4J9BA 1N6AA 2F2WA 1D0XA 1RLQC 3G71Q 2ESWA 3VV0A 1Q81R 2F5TX 1N9SA 2JTFA 4IIMA 3CCST 1X27A 1HSQA 2SRCA 4RTVA 1K76A 4X1VA 3TU4K 1K73U 1ZUUA 2KI7A 3OYLA 1O9SA 1WA7A 4A4KA 2RJFA 4E7HA 2PUKB 4BUGA 1W70A 1EX4A 2JM8A 3A8MB 1YITA 4C92E 1S72A 1VQ4A 3QXEB 3SHWA 3CMET 2X3WD 1A0NB 1YN8A 1NYFA 1V1CA 2DAQA 3ASKA 5FROA 1VQ4Q 1VIFA 2QTVA 1HYOA 1LOJA 3PVQA 1XNIA 1T3SA 1WNLA 2DL3A 2NUPB 5CKEA 4PJOF 1QVFP 3PGGA 2NLUA 3MCAB 2NYSA 3RR6A 4ELYC 2DA9A 4HCBA 5LJ3d 2J6FA 4LD6A 3RKYA 4M75F 5D6XA 3S3MA 3M58A 1ZSGA 1PD1A 1Q82R 1FXXA 2ED1A 2DPPB 3PE0A 1M1KU 2DETA 1VQPA 1I07A 3QZ9B 2O9VA 1Q86U 2QDYB 2XU8A 4HKEA 3LWHA 2V26A 3TREA 3FLGA 3CMAQ 1VQPQ 2MIOA 2V1RA 2M1HA 1WHLA 3QKJA 3RKWA 3OW2S 4OMFB 1GCQA 2EQMA 4FCYA 2LCLA 4KH1B 1OPLA 3SFMA 3H6ZA 3VYHB 4D6WA 5LJ5g 1UJ0A 5CCAA 2CP7A 4CI0C 2EIFA 2JN0A 2RMOA 4HT8A 1ZA2B 4DBHA 3EHQA 1B34B 4MZMA 1SSHA 2YHTA 3E19A 1UUEA 2H8HA 3CCQT 1B7TA 5KYWB 1FWZA 4F7UG 5GAN3 1K0XA 4CC2A 3E9FA 3X20B 5M9OA 1QLYA 4RTXA 2XMFA 2YRDA 4HA8A 1WJRA 2YRVA 5CQXA 1QKWA 1K73C 5GAMe 1F1BB 3EFSA 1AOJA 3MP6A 1K9AA 4EMKB 5I11A 4M77C 3X28B 1KD1R 2NUPA 4A54A 3LLRA 3M0UA 2EKHA 1ZSZB 1YCYA 2X4WA 5FRNA 2O4XB 5CKFA 3C4SA 3QHSA 4IUVA 2DZCA 4F16A 2K5LA 1KHCA 1AWWA 2LNHB 1FX7A 3RNJA 1JXMA 2E65A 3EFOB 4EIKA 4J83A 1G3WA 3VYGA 2HCKA 3CXCA 2QA4T 3MO8A 2Y90A 1UEBA 3OYHA 2RM4A 2P84A 4M7DC 3BW1A 4FT4A 2W10A 3CCQA 2KVQG 3CCUT 3M4YA 1BI0A 1OU8A 1WLPB 3JCMV 5EG2A 1Q82C 3GNFB 3D7SB 1TS9A 1W2BA 3OYBA 4FU6A 4OF1A 4M78F 3H8ZA 4L59A 4M77G 4OB1B 2HMAA 1K8AU 1B34A 1M1KC 3EG2A 2M51A 5KYWA 3I55Q 1WGSA 4DA4A 2EYWA 1QKXA 4B6MA 3CD6A 2C0OA 3EG9B 3SEMA 3H9NA 1D1AA 4XAXB 3CC2T 3UATA 4FYVB 4KUIA 3CD6Q 4KH0B 2ENMA 4F04B 3QJ6A 2VKNA 2MYSA 4X9CA 3RIRA 2LJ1A 2YWWA 4EMKA 1VQ9T 4IUQA 3HP9A 5DM7R 3DLLA 5LJ5h 4C92G 2FRWA 2HEQA 1UGRB 2Y4YA 1ZSZA 1SRLA 2HBWA 3VS7A 3L2QA 2O4XA 1VQMT 4AG1C 1X43A 1KD1C 1IXDA 1PRMC 2PTKA 5GAOp 4M7AC 2GFUA 1T0JA 3EFOA 1D0YA 2ZPHB 2C06A 1PD0A 1K0SA 3QWYA 3PFSA 4YTLA 4RTWA 2CUBA 2K9GA 2XIDA 2EBPA 3RBBB 5IXFA 2DRMA 3NTHA 3S3NA 4NOYA 2HSPA 1SF9A 4JZ4A 1NG2A 3MEUA 2HL3A 4FW1A 3MKDA 4JS5A 1RI0A 1YJ9T 2O31A 2K2VA 1RABB 2RQTA 4GY5A 2DBMA 1IGUA 2DD4A 2VV5A 2GQIA 3A8GB 4LDVA 2LCSA 2X51A 2YLCA 4A63B 4J7IA 3TSZA 5GJWB 2FZKB 1VQLT 2QEXQ 4ZNXA 1HD3A 1H92A 4OMLA 4C8QC 3G4ST 2RHIA 3VS6A 4EMGA 1YIJA 3EG9A 4KGXB 3HTRA 3THKA 4DQ2A 4M7AG 2E10A 5C0MA 5GMKj 2MWOA 4IUUA 1YIJQ 3I56T 4KGZB 3V8JA 1VQKQ 4XTXA 3SD4A 3JB9J 3OSVA 5FU7C 4OVAA 3CEYA 1M90R 3G1JA 2FHDA 4MDXA 5LJ3e 4F7UF 3FDRA 4OB2B 3CC7A 1ZA1B 5IXBA 1BI1A 5FWCA 4M78E 2V8IA 3HRUA 2XDDA 3CC7Q 2OTJT 2L8DA 1W4SA 4L6V5 3HPWA 1NPRA 1KC8R 1JXOA 1QMCA 3QUIA 3M0QA 2PU9B 2KRSA 2K5IA 3JCMc 3G4SA 1HK9A 1R77A 1B3QA 4C0GA 1RAFB 4E7LA 1CSKA 2KY9A 3O5ZA 2QYZA 3RDVA 2D8HA 2LP5A 2G6FX 3NTIA 4C92D 2KROA 1WHGA 3I56A 2BZYA 1IB8A 2JXBA 3JCMd 1K4US 4PJJA 2JOYA 1E6GA 1WQ7A 4P5NA 3PMTA 1R8OB 4JLGA 1FMVA 4LXCA 4NL2A 4A4EA 1RADB 2JMCA 1M9SA 1UGQB 1VQ5Q 5GAOl 1PRLC 2VXFA 2J06A 5IHKA 2E5KA 1E7OA 1QVFS 3HHTB 2WSFE 1WQWA 2XD0A 4A4FA 4BACA 3M55A 5A0LA 4M77F 1P92A 2RJDA 1ZUKA 2CKKA 2C0IA 2MMPA 2RB6A 3EH2A 3L2UA 2DD5A 3C0CA 2YRCA 3VS5A 1RUWA 1WPYA 3M4GA 3PT9A 3VRZA 2MOXA 2L3SA 2M0YA 3J81E 4PFPA 2L3QA 1M4ZA 2FVUA 1BK2A 2HQXA 1U1SA 4OGEA 3CCET 1MMGA 1M90C 1IHWA 4LDXA 3BDUA 1QVPA 5KYYB 2LQKA 5GMKm 1R0BG 4BI3A 2D0QB 5LL6S 5GANf 4M7DF 2DL7A 4FM4B 3LH5A 2DL4A 4IKFA 3A8OB 2XI9A 4B9WA 1TSFA 4PJOB 4ZN1A 2HBPA 2RPNA 1BI3A 3OBYA 1OPKA 2KSSA 3LW5E 3CQTA 5CAIA 1KC8C 2P0PA 5KCOA 2KYMA 3CCJA 4KRTA 4K11A 3AT1B 2FPDA 3FB9A 1M30A 1QP2A 1Y96A 4M75B 4D8DA 3CCJQ 1KHIA 3QIIA 4WF2A 4F7UE 1Q7YR 1GCQC 2ROLA 2PVGB 5LJ3g 3CXCP 3OYEA 1IO6A 2HQEA 3E2UA 2MF2A 1W6XA 1VQ8T 3MEWA 1ZLMA 3G71T 1YCSB 1PG5B 3JCMX 3BY7A 4ZGJB 4LE9A 5CKHA 4LUDA 2EQUA 2YLBA 3HFNA 1LNXA 2V1QA 4IUPA 4LDYA 2CZ1B 4XTWA 3EAEA 1W2BP 4E7KA 3VJPA 1MV3A 2XG8D 2XK0A 3OB9A 2CP5A 4J6XA 2XKOC 1C0MA 1UDLA 5LJ5f 2YXYA 1WXUA 3RKXA 2DJZA 2ZAEA 4M7AF 4NS5A 1YI2A 3VS2A 2E3HA 1H3HA 2EQKA 2LX7A 2QQAA 4PNOA 5KYYA 1VQ4T 2CP2A 2J6KA 1AWOA 1PSEA 3P8HA 1WHMA 4GBQA 1YI2Q 4FSXA 1GFCA 2QTXA 3RMSA 3S3OA 4PJOD 3CCLA 4ELZC 4M78G 2L89A 4CC7A 4PJOA 2QK0A 4IURA 5KCHA 4HVWA 3KBGA 3CCLQ 1M3AA 1Q81U 4FL6A 3MJXA 4M75D 4M77E 1U1TA 2EGAA 3JCMW 5HCKA 2DTHA 3H0FA 5J26A 5GAN6 4PFOA 4M75A 3KXTA 4BE2A 4Y28E 4FYXB 3ZL7C 1ZUYA 4JRQA 2HAXA 2QGFB 1TUCA 2DIQA 2J7IA 2R58A 3CCMA 2KYBA 1AWXA 2KDSA 3CMAT 4RUGA 1VQPT 1I5OB 3QDRB 1N5ZA 1U5SA 2L5QA 3GPLA 1Q7YC 1AT1B 4J9GA 3CCMQ 4M7DE 3M0PA 5GANg 3KUFA 1NLOC 4II1A 2DVJA 1H641 2CGHA 2COWA 2LT4A 2ABLA 1FYNA 2CT3A 4N0AA 2DLPA 2EJGA 1M2OA 3WVEB 2DYIA 1PHTA 2EYXA 4WTOB 1RAAB 4HVVA 1FMWA 2BZ8A 1QVGS 4EMKC 2YUQA 5IHIA 2XDBA 5LJ3h 1NE8A 3ULRB 1YJWA 1WI7A 2E3IA 1YJNQ 2PNIA 1PM3A 2KGTA 2DIGA 2YDLA 1ZSZC 1Q82U 3A8HB 3OQ5A 4DOWA 1VOMA 1YJWQ 4E6RA 2GTOA 1JBMA 2EJFA 3OYNA 4QVZA 1N8RR 3ZBDA 5GANj 3L1AA 2ROTA 2JM9A 1OX8A 2GF7A 3CMAA 2XICA 3UF4A 5GMKi 3JCMe 3O8VA 1UGPB 2LQNA 3A98A 3JCMJ 2FPFA 5GAN8 3OYDA 3OS2A 2B8AA 3CC4Q 1AVZC 4C0FA 3QYHB 2E4HA 4XU0A 1YHQQ 5FLXE 4R56A 4F14A 2RQWA 3JCMP 2FYKA 2PVDB 3BFMA 3M0TA 2FEIA 3DLMA 4M7AE 4DBQA 5KYUB 3JB9F 3C94A 3VS4A 4M4ZA 2CREA 4VUBA 3JCMb 1Q81C 4QVCA 4CC3A 1M3BA 4M78D 1M2VB 1OQKA 1KD1U 4NL3A 5I21A 2CYZB 4OMMA 4IIOA 3SB2A 3M54A 3L2RA 4BE0A 4BD3A 1ZBJA 1Y07A 5I22A 5GAMf 1X6GA 4J9HA 4OP0A 1IZ6A 1O75A
chains in the Genus database with same CATH topology
4C8QF 5LJ5j 2K2VA 3F70A 4M75G 2XDPA 4GY5A 1X01A 1KG1A 2DD4A 3CD6T 2BIVA 2VV5A 4C8QE 3TEEA 4A53A 3A8GB 4LDVA 2YLCA 3L42A 2JVVA 5CQYA 3C95A 1H3ZA 4J7IA 2E41A 3V7SA 5GANh 4JDSA 1TH7A 3CC4T 1VQLT 3V7RA 2D6FA 3BDLA 2H3JA 5GAMd 4C8QC 1MHNA 4MZPA 2RHIA 3G4ST 1YHQT 4JRKA 4XTYA 2EWNA 2RO0A 4C0DB 1D3BB 2IVWA 4EMGA 4M78B 5GANe 3JB9D 1YIJA 2K3XA 2LQ8A 5FU6C 4DQ2A 4M7AG 3M56A 2E10A 2QQSA 1XTDA 3M57A 2V8KA 5C0MA 1NJIC 3UT1A 2DEQA 5GMKj 2MWOA 1RI0A 4IUUA 3SWNC 3L2ZA 3I56T 1YJNA 4ZGEB 3FEOA 2E70A 4C92F 3C12A 3V8JA 1VQOT 1BKBA 5A0GA 1VQ9A 4XTXA 3SD4A 3JB9J 3JSCA 2X4XA 3JB9H 4C0ZA 1KQ1A 4OP0A 2MWPA 3OSVA 5FU7C 5AYFA 5DLOA 4PKCC 4XTVA 1N8RU 2KK4A 4OVAA 3CEYA 3G7ZA 3M59A 3V7CA 3HSBA 3RMQA 2FHDA 4MDXA 5LJ3e 4F7UF 3FDRA 4OB2B 1VQ6T 3CC7A 3I55A 4OB0B 1BI1A 4J7FA 4N4GA 4LDUA 2DO3A 2RHYA 3CBPA 4C8QD 4M78E 3OW2A 1OYXA 2V8IA 3HRUA 4JUVA 2XDDA 1ZQ1A 3DKMA 2M0OA 2WSEE 2E1HA 3GLXA 4J8OA 1OZ3A 2DK3A 4OGCA 5I2SA 4FT2A 4QQDA 4J6YA 2L8DA 4C8QA 2OTJT 3QSUA 2LC4A 4RMOA 4C0DC 5CKBA 1W4SA 3V8LA 4M78C 4L6V5 3HPWA 1NPRA 2LNVA 4ZN3A 5KE2A 3X24B 3QUIA 4JS4A 4XU1A 3E1SA 4Q5WA 3CC4A 1JRIA 2PU9B 1I5LA 2M9UA 3LX7A 1GXIE 3JCMf 2QEXT 3CCSA 2K5IA 3SWNA 3JCMc 3G4SA 1HK9A 1YHQA 1KQ2A 2K5FA 2PUOB 5CIUA 4C0GA 3OYAA 1VQ7A 3GIBA 1RL2A 2RI2A 4LDWA 3CCEA 2OTLA 1ZHIA 4M7DG 4HCCA 4N4IA 4E7LA 3JCMg 1QP3A 4KBMB 2KY9A 4UC4A 3HL8A 2ZZDA 3MP1A 1XQHA 1VIEA 3L2VA 3LGFA 2E6ZA 4C92D 3NTIA 3MHXA 5GAN7 3I56A 2ZPFB 2BKDN 2QXFA 3E9GA 2M16A 4RCBA 5GMKl 5LJ5e 1YIJT 4KUDK 4X34A 5DY9A 2WACA 3QYGB 2KMTA 3JCMd 2JOYA 3VU3C 1WQ7A 3QO3A 4P5NA 3TCJA 3PMTA 1VQKT 1R8OB 4XTZA 3MEAA 2DXUA 4JLGA 3CMEA 3OMGA 3J7AF 4NL2A 4A4EA 2JZ2A 4C5HA 2QI2A 1JJ2S 3OYJA 1M9SA 3A5ZB 3AHUA 3FJPA 1UGQB 1VQ6A 1D3BA 4HCZA 2DTOA 4KULA 5CK9A 4M78A 4F7UA 4RG2A 1WJQA 5GAOl 1YITT 1S72T 3OA6A 2RI5A 1AHJB 2VXFA 3MEVA 1KQSS 2ZCFB 4MMLA 3OYKA 4PJOB 5CKDA 2DXTA 1NPPA 4C5GA 2EJ9A 3CC7T 1G3YA 3I55T 3OBWA 4Y91A 1N27A 3HHTB 1QVFS 5GMKe 2JNGA 2WSFE 1WQWA 1G3SA 2XD0A 4A4FA 4M7AD 4E7JA 4EPCA 4BACA 3M55A 1VQ8A 5A0LA 4M77F 1BI2A 4LD9K 1P92A 2LTOA 3G71A 2RJDA 4QW2A 5GAN2 1JB0E 3LWIA 2P0KA 3CPWA 5GAMg 2JUFA 5GAOq 2CKKA 3J80E 4XU2A 2MMPA 2RB6A 3L2UA 2QEXA 3R6OA 2DD5A 4CRIA 2DXBA 4C92B 1N6AA 1WPYA 5HKCA 3M4GA 3PMIA 3PT9A 3J81E 1UGSB 2FL7A 3VV0A 2KAFA 2ZPBB 1M4ZA 2F5TX 1N9SA 2FVUA 2JTFA 1W2BS 3CCST 5IN1A 3P8BB 3HKSA 4QQ6A 2HQXA 3PIOA 1VQ7T 2AHJB 1U1SA 2OTLT 4OGEA 3CCET 4E7IA 3TU4K 1K73U 1M90C 4LDXA 4F7UB 3BDUA 1QVPA 5J39A 2E6NA 2LQKA 5GMKm 3OYLA 1JJ2A 1O9SA 4BI3A 5KE3A 1VQKA 2D0QB 1YBYA 2PQWA 3ER0A 5LL6S 5GANf 4A4KA 4M7DF 4FM4B 4E47A 5FRMA 2RJFA 4FIBA 4E7HA 3GP8A 4BE1A 2VC8A 1M90U 4IKFA 1OZ2A 1UB4A 3A8OB 1N8RC 2PUKB 1M5Q1 4BUGA 4A4HA 2FB7A 2XI9A 4B9WA 5GAN4 3OY9A 3RERA 3A8MB 4C5IA 1I4K1 3GNGA 3RESA 2HBPA 3OBYA 1BI3A 4ZN1A 1YITA 2KSSA 3LW5E 4C92E 4L5GA 1S72A 1VQ4A 1VQ5T 3QXEB 3CMET 5GAOm 5CAIA 1KC8C 4RCCA 2P0PA 5KCOA 3CCJA 3V8KA 2LVMA 3HRSA 3X26B 3QBYA 5GANd 2DAQA 2R57A 3FB9A 5GAMj 4O5VA 3ASKA 2GFAA 5FROA 1QP2A 1VUBA 2X4JA 1Y96A 4C92C 3OYFA 1VIFA 4M77D 4M75B 4QVDA 1KC8U 1HXDA 5LJ3f 1LOJA 1KHIA 3QIIA 4WF2A 4F7UE 1XNIA 1WNLA 5IT9E 3FC3A 2OAUA 4M77A 5I2MA 2P0QA 3ZEHA 2PVGB 2MAMA 4IUTA 5LJ3g 5CKEA 2P4TA 3OYEA 4V2SA 4PJOF 2HQEA 2MF2A 4BY6B 3PGGA 2NLUA 1VQ8T 3OYGA 4B9XA 3MCAB 3MEWA 5CVIA 1QW1A 1U8RA 4PJOE 3G71T 3ZFJA 2I2LA 4C8QG 4ZTFA 4OB3B 3RUXA 3QG1A 4ELYC 4HCBA 2K4YA 5LJ3d 2RHZA 1N9RA 1OI1A 1X75C 2K57A 3JCMX 3BY7A 4LD6A 3RKYA 4ZGJB 5GAN5 4M75F 5D6XA 2X4YA 3M58A 4GLKA 3S3MA 1Q86C 3JCMh 4PJOC 1FXXA 5CKHA 4M7DD 4Z02A 2DPPB 2EQUA 2YLBA 3FRNA 3HFNA 1M1KU 4M75E 1LNXA 1VQPA 2L3RA 3QZ9B 4IUPA 1Y71A 4LDYA 2CZ1B 3JRZA 4XTWA 3EAEA 2ZGWA 2RD1A 1Q86U 4E7KA 2QDYB 3LH0A 3VJPA 2XU8A 3UDCA 4HKEA 2Y4XA 3LWHA 3TREA 2XG8D 3FLGA 1Y96B 2XK0A 3OB9A 4J6XA 4C92A 1BIAA 2RI3A 2XKOC 2M1HA 4M75C 3QKJA 2EFIA 2RJEA 5CO7A 3RKWA 3N5BB 4RG8A 5LJ5f 2QA4A 4EMHA 3OW2S 4OMFB 2EKOA 1PSFA 1NZ9A 2EQMA 4M77B 2D9TA 3RKXA 1VQ5A 2R5AA 2VGMA 3OS0A 2LCLA 2DJZA 4BDZA 2E64A 3VYHB 3SFMA 3H6ZA 4D6WA 5LJ5g 2EYQA 4M7AF 5CCAA 4NS5A 4EDUA 1YI2A 4CI0C 1BYMA 1WJSA 2EIFA 1I81A 2EQKA 2QQAA 2JN0A 4PNOA 4BY6C 2ZPEB 4HT8A 3CCUA 2DZ9A 2LRQA 3CCVT 2HNIA 4J5YA 1VQ4T 3DB4A 1PSEA 3P8HA 3CBOA 4FSXA 3CCJT 1B34B 2LCCA 2QTXA 2YHTA 4MZMA 3RMSA 3S3OA 3E19A 5LJ5d 3CXCS 4PJOD 3CCLA 3CCQT 1FWZA 4M78G 4ELZC 2RHUA 4F7UG 4XTUA 5GAN3 2L89A 1LJOA 2VXEA 3OYIA 4PJOA 2QQ9A 4RKUE 4IURA 5KCHA 3E9FA 3HFOA 1ZBXA 3KBGA 3X20B 5M9OA 2RA2A 3JB9I 4KT0E 4JJNK 1Q81U 4FL6A 3UWNA 5GAMh 4M7DB 2VYTA 1Y7XA 3S6WA 4M75D 4M77E 3VUZA 1U1TA 4HA8A 2HD0A 1V29B 4PLIA 3JCMW 1WJRA 2DTHA 2ZPGB 5J26A 5GAN6 1VQNT 2YRVA 2A3LA 5CQXA 5KH6A 5A2QE 2DXCA 4M75A 3KXTA 4ZGDB 2DKGA 4BE2A 1K73C 4Y28E 5GAMe 3WXMB 3EFSA 3MP6A 2EQJA 4EMKB 3L2WA 3ME9A 4M77C 3X28B 4A54A 2DTIA 3LLRA 3URGA 4JRQA 3CC2A 3M9QA 2HAXA 1X6OA 2DIQA 4XQ3A 1YCYA 2R58A 2PVOB 1M1GA 1EIFA 2X4WA 3CCMA 5FRNA 3P8DA 2O4XB 5CKFA 2KDSA 3CMAT 3Q1JA 1VQPT 2BUDA 5HK3A 3C4SA 3QHSA 1G5VA 2DZCA 2L5QA 3CPFA 3M53A 2QQBA 3QDRB 2K5LA 1KHCA 4IUVA 5DLQE 4PL6A 4R55A 3GPLA 4MDWA 1Q7YC 4BI8B 3QPHA 4M7DE 5GANg 1KQSA 1FX7A 1M1FA 3KUFA 4MMKA 4M7AA 2E65A 4J83A 1G3WA 3VYGA 4II1A 3CXCA 2QA4T 2CZ6B 2Y90A 1UEBA 3MO8A 2QQRA 3OYHA 3CCVA 3JB9G 2GQVA 1H641 2CGHA 2X35A 2LT4A 2R5MA 3PNWC 1VQMA 2G3RA 1Q7YU 1QVFA 2RM4A 4M7DC 3BW1A 4N0AA 2EJGA 4FT4A 4N4HA 1YI2T 4J6WA 3WVEB 2LX9A 5HY6A 3DB3A 3CCQA 5J3BA 2KVQG 3CCUT 3M4YA 4BDYA 1BI0A 3FIFA 3JCMV 5EG2A 4A4GA 1Q82C 4X9DA 2E12A 3GNFB 1QVGS 4EMKC 2XDBA 2LT1A 5LJ3h 1NE8A 3CCLT 5D6WA 1YJWA 1NJIU 1K8AC 3SDZA 3PIPA 2DIGA 2RK2A 3X25B 1VQNA 2KQWA 2LDMA 3OYBA 1W2BA 1Q82U 3LGLA 4JLIA 3A8HB 3OQ5A 4DOWA 4FU6A 4OF1A 2XHCA 3H8ZA 4M78F 4L59A 4M77G 4OB1B 1JBMA 3PTAA 1K8AU 4ATOA 2EJFA 5GAOn 3OYNA 4QVZA 2IG0A 1B34A 1M1KC 3CCRA 2RH2A 4ME7A 3META 3OMCA 4DOVA 5GAOr 4JRPA 4M7AB 1YJ9A 3ZBDA 3OS1A 5GANj 1WGSA 4DA4A 2F5KA 3L1AA 2A7YA 4QQGA 3OYMA 2GCXA 2VUBA 3NTKA 4JRIA 4XU3A 3CD6A 2GF7A 3CMAA 2RK1A 2XICA 3G6ET 4M7DA 5GMKi 4XAXB 3CC2T 3JCMe 3OS5A 3O8VA 1UGPB 1VQLA 5D6YA 1SSFA 4KUIA 2CZ7B 4BB7A 3JCMQ 3CCMT 3JCMJ 4TVRA 5GAN8 3QJ6A 5C6SA 5IAYA 3UPUA 3OYDA 2K3YA 4X9CA 3RIRA 3OS2A 1K9MC 2B8AA 1IREB 1G3TA 2CS7A 4EMKA 2VGNA 4C5EA 5L8RE 4IUQA 1VQ9T 3HP9A 5DM7R 3DLLA 3CPWS 4C0FA 5LJ5h 3QYHB 4XU0A 2CZ0B 3VUBA 5FLXE 4C92G 5LJ3j 5CR2A 4R56A 1QVGA 3OYCA 1UGRB 2Y4YA 3JCMP 2FYKA 3EFRA 2PVDB 2WSCE 3BFMA 3L2QA 1K9MU 3DLMA 4M7AE 2JTMA 3JAME 2DVEA 2O4XA 3T9NA 2RHXA 1VQMT 5HK0A 1VQOA 1I8FA 3OYYA 3JB9F 1KD1C 3C94A 1Q81C 4VUBA 3CBMA 3JCMb 4QVCA 5GAOp 2O01E 2RJCA 4M7AC 2GFUA 3A8LB 4HT9A 3NFCA 4C8QB 4M78D 1YJNT 1DJ7B 4PLLA 3INZA 2ZPHB 4MZTA 2C06A 4YTLA 3PFSA 1KD1U 3QZ5B 4NL3A 2F69A 2MI6A 3MP8A 2CYZB 2ZPIB 4N0AC 5I21A 1YJWT 4XK8E 5FU6B 2EAYA 2XIDA 4ZTJA 5GMKh 1MGQA 2V8JA 1M8VA 3GF5A 4PJOG 3SB2A 3NTHA 3GOXA 3S3NA 3OSSC 3M5AA 3M54A 2E5QA 4NOYA 3SWNB 3VKIA 3L2RA 4BE0A 2OTJA 3QJYA 3WVDB 1XOVA 4BI4A 4BD3A 3LYIA 3MEUA 1Y07A 5A0DA 3CCRT 3HRTA 3G6EA 5GAMf 4JS5A 1BIBA 4O6JA 1IZ6A 1O75A 5FU7B 1YJ9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6W A;  1N9R A;  4NL2 A;  4C8Q F;  5LJ5 j;  2K57 A;  4M75 G;  3JCM X;  3BY7 A;  3RKY A;  5GAN 5;  1X01 A;  4M75 F;  3AHU A;  3FJP A;  3JCM h;  1D3B A;  3FIF A;  4C8Q E;  4A53 A;  2DTO A;  4PJO C;  4M78 A;  3JCM V;  4F7U A;  4M7D D;  2YLC A;  5GAO l;  4X9D A;  3HFN A;  2YLB A;  4EMK C;  4M75 E;  1LNX A;  2VXF A;  5LJ3 h;  2E41 A;  3V7S A;  4MML A;  5GAN h;  1TH7 A;  4XTW A;  3V7R A;  2ZGW A;  2RD1 A;  2DXT A;  5GAM d;  4C8Q C;  2EJ9 A;  4JRK A;  4Y91 A;  1Y96 B;  4XTY A;  4C92 A;  4J6X A;  2EWN A;  1BIA A;  4JLI A;  4M75 C;  3RKW A;  1D3B B;  5GMK e;  4M78 F;  1WQW A;  4M77 G;  4M78 B;  1JBM A;  4EMG A;  5GAN e;  4EMH A;  5LJ5 f;  3JB9 D;  2EJF A;  5GAO n;  4M77 F;  1B34 A;  4M77 B;  3RKX A;  4DQ2 A;  4M7A G;  2E10 A;  2DJZ A;  5GAN 2;  5GAO r;  2E64 A;  4M7A F;  5LJ5 g;  2DEQ A;  5GAM g;  5GMK j;  4M7A B;  5GAO q;  4XU2 A;  2RB6 A;  3SWN C;  3L2Z A;  5GAN j;  1I81 A;  3L1A A;  4PNO A;  2JN0 A;  4C92 F;  3V8J A;  4HT8 A;  4XU3 A;  4C92 B;  1WPY A;  4JRI A;  2DZ9 A;  2HNI A;  3M4G A;  4XTX A;  4J5Y A;  3JB9 J;  3JB9 H;  4M7D A;  1KQ1 A;  1B34 B;  2QTX A;  4OP0 A;  2YHT A;  5GMK i;  1N9S A;  3JCM e;  5LJ5 d;  4PJO D;  4XTV A;  4M78 G;  4F7U G;  3JCM Q;  3JCM J;  1U1S A;  4XTU A;  5GAN 3;  3V7C A;  3HSB A;  5GAN 8;  1LJO A;  5LJ3 e;  2VXE A;  4F7U F;  4PJO A;  4F7U B;  3BDU A;  4X9C A;  3RIR A;  5GMK m;  3HFO A;  4EMK A;  2RA2 A;  3JB9 I;  4C8Q D;  4M78 E;  5GAN f;  4M7D F;  5LJ5 h;  5GAM h;  4JUV A;  4M7D B;  4XU0 A;  2E1H A;  5LJ3 j;  2VC8 A;  4M75 D;  4M77 E;  4C92 G;  1U1T A;  4HA8 A;  3JCM P;  4C8Q A;  2FYK A;  4J6Y A;  3JCM W;  3EFR A;  2DTH A;  1M5Q 1;  3BFM A;  5GAN 6;  2FB7 A;  5GAN 4;  3RER A;  3QSU A;  4M7A E;  4M75 A;  2DVE A;  3V8L A;  2DKG A;  4PJO B;  1I4K 1;  4M78 C;  3RES A;  5GAM e;  4C92 E;  3EFS A;  1I8F A;  4EMK B;  3QUI A;  4M77 C;  4XU1 A;  5GAO m;  3JB9 F;  5CAI A;  4A54 A;  4RCC A;  1JRI A;  2DTI A;  3JCM b;  3V8K A;  4QVC A;  5GAO p;  1I5L A;  4M7A C;  3JCM f;  4XQ3 A;  3FB9 A;  3SWN A;  3JCM c;  4C8Q B;  5GAM j;  1HK9 A;  4M78 D;  1YCY A;  5GAN d;  1KQ2 A;  4HT9 A;  3INZ A;  4C92 C;  1Y96 A;  3GIB A;  4M7D G;  4M77 D;  4M75 B;  4QVD A;  1HXD A;  5LJ3 f;  1LOJ A;  3JCM g;  4F7U E;  4WF2 A;  4NL3 A;  5I21 A;  3QHS A;  4N0A C;  2DZC A;  4M7A D;  1WNL A;  2EAY A;  4M77 A;  5GMK h;  1MGQ A;  1M8V A;  5LJ3 g;  4PJO G;  3SB2 A;  4C92 D;  5GAN g;  4M7D E;  4MMK A;  4NOY A;  4M7A A;  4V2S A;  4PJO F;  2E65 A;  3SWN B;  5GAN 7;  5GMK l;  4RCB A;  5LJ5 e;  3PGG A;  5DY9 A;  3JB9 G;  2Y90 A;  3JCM d;  1H64 1;  2CGH A;  3VU3 C;  1WQ7 A;  3QO3 A;  4PJO E;  2RM4 A;  4XTZ A;  5GAM f;  2I2L A;  4C8Q G;  3BW1 A;  2DXU A;  4N0A A;  1BIB A;  3RUX A;  2EJG A;  4M7D C;  5LJ3 d; 
#chains in the Genus database with same CATH topology
 5LJ5 j;  3EGU A;  1WHH A;  3F70 A;  2XDP A;  1X01 A;  3CD6 T;  2BIV A;  1RAE B;  4C8Q E;  2DBK A;  1X69 A;  2RF0 A;  2E41 A;  1VYV A;  5GAN h;  1QCN A;  1TH7 A;  4JDS A;  2D6F A;  3BDL A;  2H3J A;  1MHN A;  4XTY A;  2EWN A;  4C0D B;  2AKL A;  4OMP A;  3H0I A;  2V8K A;  2LQW A;  2DYB A;  4ZGE B;  1ACM B;  4HXJ A;  1ABQ A;  5A0G A;  2KNB B;  4WCI A;  3JB9 H;  1KQ1 A;  4J9C A;  5DLO A;  2VVK A;  2KK4 A;  2HDA A;  3G7Z A;  3M59 A;  3HSB A;  3I5S A;  3RMQ A;  2Z0W A;  2DFU A;  3I55 A;  4OB0 B;  3KFV A;  4LDU A;  2DO3 A;  5KYU A;  4JJC A;  1MNE A;  2RHY A;  4R0K A;  2DF6 A;  2M0O A;  3GLX A;  2FRY A;  2EQI A;  4AFU C;  3EHR A;  2AT1 B;  4AG2 C;  1I0C A;  1OOT A;  5FW9 A;  4RMO A;  1M2V A;  1RLP C;  1PKT A;  2LNV A;  4ZN3 A;  3X24 B;  4J9I A;  3E1S A;  2CSQ A;  2M9U A;  2QEX T;  3EG3 A;  5CIU A;  1VQ7 A;  1RL2 A;  2RI2 A;  4LDW A;  2OTL A;  4M7D G;  1AZE A;  1NEB A;  2DE0 X;  3JCM g;  4KBM B;  1VIE A;  1T0H A;  3LGF A;  3L2V A;  1VQ7 Q;  2OTL Q;  1YWO A;  5GAN 7;  2ZPF B;  2A0F B;  3E9G A;  1YIJ T;  3QO3 A;  1VQK T;  5D7U A;  3J7A F;  1K1Z A;  3OMG A;  4Z88 A;  1JJ2 S;  3OYJ A;  2QA4 Q;  4F7U A;  4LNP A;  1WJQ A;  3OA6 A;  1QCO A;  2RI5 A;  4MML A;  4C5G A;  2COY A;  3PVL A;  1G3Y A;  3CC7 T;  4Y91 A;  2DX1 A;  2JNG A;  3QWX X;  3REA B;  1VYU A;  1BI2 A;  1JB0 E;  3LWI A;  3CPW A;  5GAM g;  3QDF A;  3J80 E;  2DIL A;  4XU2 A;  2QEX A;  4AFS C;  2IPO B;  4C92 B;  5HKC A;  2KBT A;  1WIE A;  2FL7 A;  1TU0 B;  1GFD A;  2ZPB B;  2C0T A;  1W2B S;  1UEC A;  3P8B B;  1WFW A;  2JW4 A;  4QQ6 A;  2AHJ B;  1LPL A;  4E7I A;  2F2V A;  2E6N A;  1D1C A;  1KSW A;  2CH4 A;  1VQK A;  1YBY A;  2PQW A;  1JQQ A;  4E47 A;  5FRM A;  2O88 A;  3GP8 A;  4BE1 A;  2VC8 A;  1MMA A;  1Y57 A;  1M90 U;  1UB4 A;  4A4H A;  2OJ2 A;  2KXD A;  3RER A;  2OI3 A;  2HSE B;  2FZG B;  4C5I A;  2RQR A;  4DBR A;  1BU1 A;  4L5G A;  4FW2 A;  2CDT A;  1VQ5 T;  5GAO m;  3V8K A;  2LVM A;  1SHF A;  3QBY A;  2A36 A;  5GAM j;  3CCV Q;  2GFA A;  1SKU B;  2VWF A;  3OYF A;  4M77 D;  1WDX A;  2JS2 A;  1KC8 U;  1HXD A;  5LJ3 f;  3FC3 A;  4M77 A;  2P0Q A;  4E7S A;  2MAM A;  2P4T A;  4V2S A;  1BBZ A;  4PFZ A;  4BY6 B;  1OX9 A;  4HVU A;  4B9X A;  3OYG A;  4JZ3 A;  1U8R A;  3ZFJ A;  4ZTF A;  4C8Q G;  4OB3 B;  4RTY A;  2SEM A;  3QG1 A;  1VQN Q;  1NJI R;  1OI1 A;  1WHK A;  2K2M A;  2NUZ A;  2YT6 A;  1X6B A;  4D8K A;  2X4Y A;  3JCM h;  4PJO C;  4LUE A;  4M7D D;  4Z02 A;  4PK4 A;  2YUP A;  3FRN A;  2DER A;  1Y0M A;  1Y71 A;  1WHJ A;  2VB6 A;  2MK5 A;  3LH0 A;  2Y4X A;  1Y96 B;  4C92 A;  2RI3 A;  3EH1 A;  4M75 C;  2DM1 A;  2RJE A;  1EFN A;  4RG8 A;  3VS0 A;  3EGX B;  1VQ5 A;  1PSF A;  1NZ9 A;  2R5A A;  3OS0 A;  2E64 A;  4EDU A;  1BYM A;  1WJS A;  1I81 A;  2DZ9 A;  2LRQ A;  2HNI A;  2CP3 A;  4J5Y A;  1LVK A;  3DB4 A;  2COZ A;  2MCN A;  6AT1 B;  3CBO A;  3CCJ T;  1PCX A;  2LCC A;  1YP5 A;  2RHU A;  4QKU A;  1K9M R;  1AD5 A;  2QQ9 A;  4RKU E;  4JPB W;  1ZBX A;  2RA2 A;  5GAM h;  2VYT A;  4PLI A;  2ZPG B;  2A3L A;  5A2Q E;  2X3X D;  4ZGD B;  2DKG A;  1SEM A;  3IQL A;  3ME9 A;  3M9Q A;  4XQ3 A;  1KFZ A;  2PVO B;  1M1G A;  1EIF A;  2ECZ A;  3G6E Q;  3Q1J A;  2BUD A;  1G5V A;  3CPF A;  3M53 A;  4M7A D;  1SHG A;  4PL6 A;  5DLQ E;  3GBQ A;  3QPH A;  1KQS A;  1M1F A;  4MMK A;  4M7A A;  2MPX C;  2CP6 A;  3JB9 G;  2CZ6 B;  1NYG A;  2QQR A;  1G2B A;  1Q7Y U;  3PNW C;  2R5M A;  2NUT B;  2BZX A;  2OAW A;  2K6D A;  1YI2 T;  3DB3 A;  4BDY A;  1FMK A;  3EG1 A;  3FIF A;  3EGX A;  4A4G A;  2E12 A;  2K79 A;  2O9S A;  2JT4 A;  3CCL T;  4OMO A;  2DEU A;  3A1P A;  2RK2 A;  3X25 B;  1UGV A;  2KQW A;  4GLM A;  2QDL A;  2LDM A;  3I9Q A;  3LGL A;  4JLI A;  1NLP C;  2HKQ B;  2XHC A;  9ATC B;  3PTA A;  4ATO A;  3NPF A;  1KK7 A;  3CCR A;  1LCK A;  2RH2 A;  3MET A;  4AT1 B;  3OMC A;  1IRX A;  3U23 A;  3OS1 A;  1TWB A;  4QQG A;  2A7Y A;  4FSS A;  2GCX A;  3OYM A;  4JRI A;  3CCR Q;  1PWT A;  2D1X A;  1GRI A;  3OS5 A;  1JU5 C;  4DBF A;  4BB7 A;  3CCM T;  5C6S A;  5IAY A;  2CH4 W;  1Q95 G;  1WYX A;  2K3Y A;  1K9M C;  1TUD A;  1G3T A;  2DNU A;  2VGN A;  4C5E A;  1AEY A;  3VUB A;  5LJ3 j;  5CR2 A;  1QVG A;  3OYC A;  1WX6 A;  2YSQ A;  2DL5 A;  2WSC E;  4ESR A;  2JTM A;  2DVE A;  3T9N A;  2RHX A;  1VQO A;  4OMQ A;  1IGQ A;  2RJC A;  1VQO Q;  4HT9 A;  1M27 C;  1YJN T;  1DJ7 B;  4PLL A;  1M3C A;  1D1B A;  3QZ5 B;  2MI6 A;  2NUT A;  1YJW T;  5FU6 B;  2EAY A;  2DL8 A;  1MGQ A;  2V8J A;  3GF5 A;  2LJ3 A;  2LZ6 B;  3GOX A;  1VQ6 Q;  1UHF A;  2E5Q A;  3SWN B;  3VKI A;  2KT8 A;  3QJY A;  1XOV A;  1NM7 A;  3LYI A;  2AZS A;  2KRM A;  3HRT A;  3OW2 A;  3VRY A;  2QAS A;  4C8Q F;  1SG5 A;  4E7Z A;  3TEE A;  4A53 A;  8ATC B;  3L42 A;  2JVV A;  1UJY A;  2QAZ A;  3NGP A;  3V7S A;  3CC4 T;  3V7R A;  1RI9 A;  1YHQ T;  1U06 A;  5KYX B;  1R0C B;  1D3B B;  2IVW A;  2YUN A;  4M78 B;  3JB9 D;  4ANJ A;  1UHC A;  3CPW P;  5FWB A;  3M56 A;  2QQS A;  3BE3 A;  3UT1 A;  1BB9 A;  1YJN A;  3FEO A;  3M0R A;  1K73 R;  1G83 A;  3JSC A;  2AKK A;  2BE7 D;  2MWP A;  5AYF A;  1KIK A;  1ABO A;  4ORZ A;  1UE9 A;  4PKC C;  4XTV A;  1N8R U;  1YIT Q;  1OU9 A;  1S72 Q;  4N4G A;  1I1J A;  1KJW A;  3CBP A;  4PJM A;  4OGC A;  2WSE E;  2D0N A;  2GBQ A;  4J8O A;  1OZ3 A;  2DK3 A;  4FT2 A;  4QQD A;  2LC4 A;  2D8J A;  1MND A;  4C0D C;  1TOV A;  5CKB A;  3V8L A;  3TSW A;  4XU1 A;  3CC4 A;  1JRI A;  2JS0 A;  1I5L A;  1J3T A;  1GXI E;  3JCM f;  3CCS A;  3SWN A;  1YHQ A;  2K5F A;  2PUO B;  3OYA A;  3GIB A;  1ZHI A;  4HCC A;  4N4I A;  1QP3 A;  2DRK A;  3CCS Q;  4UC4 A;  3HL8 A;  2EGC A;  2JTE A;  3MP1 A;  2E6Z A;  4FYY B;  1QWF A;  3MHX A;  1X2Q A;  2CUD A;  2QXF A;  4X34 A;  1TXQ A;  3FJ5 A;  5DY9 A;  3QYG B;  1M1K R;  2JJ9 A;  2DXU A;  3TVT A;  3CME A;  4C5H A;  1Q86 R;  1TG0 A;  5KYX A;  3A5Z B;  3AHU A;  3FJP A;  1D3B A;  5CK9 A;  1WZO A;  4M78 A;  4RG2 A;  3CME Q;  2YUO A;  2RQV A;  2L3P A;  1NBE B;  1OEB A;  2ZCF B;  3OYK A;  2DXT A;  5EC7 A;  2EJ9 A;  3I55 T;  3OBW A;  5GMK e;  1Z9Q A;  1G3S A;  4E7J A;  5GAN 2;  2JUF A;  4QT7 A;  3R6O A;  3PMI A;  3R6N A;  1UGS B;  2KAF A;  2KEA A;  5IN1 A;  3HKS A;  2EPD A;  2KT1 A;  3PIO A;  1VQ7 T;  2K7A A;  1ARK A;  2OTL T;  4F7U B;  5J39 A;  4OMN A;  3JV3 A;  1JJ2 A;  2BE9 B;  2P4R A;  4Y92 A;  5KE3 A;  2LMJ A;  3ER0 A;  1GBR A;  4FIB A;  1G8X A;  1OZ2 A;  1N8R C;  3OY9 A;  1M5Q 1;  5GAN 4;  2FB7 A;  4DEY A;  2W0Z A;  1I4K 1;  3GNG A;  3RES A;  2RNA A;  4RCC A;  3EGD B;  1CKA A;  1MMN A;  2F1L A;  3HRS A;  2B86 A;  3MPU B;  2J6O A;  3X26 B;  5GAN d;  2R57 A;  5IHN A;  4O5V A;  1VUB A;  2O2O A;  2X4J A;  4C92 C;  2JMA A;  4FYW B;  4Z8A A;  4QVD A;  1IHV A;  1KQS P;  5IT9 E;  3CCQ Q;  2I0N A;  2OAU A;  5I2M A;  3ZEH A;  4IUT A;  1UFF A;  2M02 A;  3UA7 A;  4HCK A;  2X9H A;  5CVI A;  1QW1 A;  4PJO E;  2I2L A;  3RUX A;  2K4Y A;  2RHZ A;  1N9R A;  1X75 C;  2K57 A;  2FG0 A;  5GAN 5;  1HJD A;  1Q86 C;  4GLK A;  1OUL A;  1Z9Z A;  2A28 A;  4M75 E;  1K8A R;  2L3R A;  3JRZ A;  2ZGW A;  2RD1 A;  3UDC A;  1RAI B;  2L2P A;  1PC0 A;  1BIA A;  5CO7 A;  2EFI A;  3N5B B;  1JO8 A;  2QA4 A;  4EMH A;  2CSI A;  1QQJ A;  1D0Z A;  4E2F B;  1TUG B;  2EKO A;  4M77 B;  2D9T A;  2VGM A;  4BDZ A;  2RN8 A;  2EYQ A;  5IH2 A;  1SRM A;  2AZV A;  1C1A A;  4BY6 C;  2ZPE B;  2L0A A;  3CCU A;  3NHN A;  3CCV T;  4J9E A;  5LJ5 d;  3CXC S;  2EVR A;  2OX7 A;  3CCU Q;  1CKB A;  1H8K A;  4XTU A;  1LJO A;  2VXE A;  3OYI A;  1SPK A;  3HFO A;  3JB9 I;  1QVG P;  4KT0 E;  2AK5 A;  4JJN K;  3EGD A;  3UWN A;  1GL5 A;  4M7D B;  1Y7X A;  3S6W A;  3VUZ A;  2HD0 A;  1V29 B;  1VQN T;  3H0H A;  5KH6 A;  2DXC A;  3WXM B;  2EQJ A;  1YFN A;  3L2W A;  5L23 A;  5GJV B;  2DTI A;  3URG A;  3CC2 A;  1X6O A;  3P8D A;  3CC2 Q;  5HK3 A;  1AZG B;  3M0S A;  3TQ7 P;  4R55 A;  2QQB A;  1VQ9 A;  4MDW A;  4BI8 B;  3VS3 A;  2HZY A;  2KR3 A;  4KGV B;  4JRP A;  1VQ9 Q;  2FZC B;  3CCV A;  2HL5 C;  2GQV A;  2GNC A;  2X35 A;  3OW2 P;  1QVF A;  1VQM A;  2G3R A;  4JJB A;  1MUZ A;  4N4H A;  3UA6 A;  4J6W A;  2LX9 A;  5HY6 A;  5J3B A;  4J9D A;  1VQM Q;  2CT4 A;  4RTZ A;  4X9D A;  3H41 A;  4AMC A;  2LT1 A;  1NJI U;  2K3B A;  5D6W A;  1K8A C;  3SDZ A;  3PIP A;  4AFQ C;  1VQN A;  2VAS A;  2DMO A;  5GAO n;  2J05 A;  2IG0 A;  2QGG A;  4ME7 A;  4J9F A;  4DOV A;  8AT1 B;  5GAO r;  4M7A B;  1YJ9 A;  2F5K A;  2GTJ A;  1RAH B;  2VUB A;  3NTK A;  4XU3 A;  2H3E B;  2RK1 A;  3G6E T;  1YJ9 Q;  4M7D A;  1X2K A;  1VQL A;  5D6Y A;  1SSF A;  1GCP A;  2CZ7 B;  3JCM Q;  1M8M A;  4TVR A;  3UPU A;  1IRE B;  2CS7 A;  1VQL Q;  5L8R E;  3CPW S;  1C6V X;  5KYN A;  2CZ0 B;  3G4S Q;  1E6H A;  1U3O A;  3EFR A;  1K9M U;  4JJD A;  3JAM E;  1PNJ A;  5HK0 A;  1NEG A;  2LJ0 A;  1I8F A;  1GBQ A;  3OYY A;  3CBM A;  3I56 Q;  2O01 E;  2A08 A;  1OV3 A;  1UTI A;  3A8L B;  2QG9 B;  3NFC A;  1YNZ A;  1VYT A;  4C8Q B;  3INZ A;  4MZT A;  3REB B;  2RQU A;  1S1N A;  2F69 A;  3MP8 A;  2ZPI B;  4N0A C;  4XK8 E;  2ATC B;  4ZTJ A;  1BCO A;  5GMK h;  1AWJ A;  1M8V A;  1QCF A;  4PJO G;  3OSS C;  3M5A A;  2OTJ A;  3WVD B;  4BI4 A;  2BTT A;  1RAC B;  5A0D A;  2CP0 A;  3CCR T;  3G6E A;  4DEX A;  4RTT A;  2KRN A;  5ECA A;  1BIB A;  4O6J A;  5FU7 B;  2OTJ Q;  2FO0 A;  2F2X A;  4M75 G;  1WXB A;  1RAG B;  2KXC A;  1KG1 A;  4CC4 B;  1EZZ B;  1YWP A;  5CQY A;  1WXT A;  3C95 A;  1H3Z A;  5GAM d;  4MZP A;  4JRK A;  3VS1 A;  2RO0 A;  3I5R A;  1MV0 B;  5GAN e;  2K3X A;  2LQ8 A;  5FU6 C;  1XTD A;  3M57 A;  3EG0 A;  1NJI C;  2DEQ A;  1V76 A;  3SWN C;  3L2Z A;  2E70 A;  4C92 F;  3C12 A;  1BCM A;  1VQO T;  1BKB A;  4RTU A;  2X4X A;  4C0Z A;  4PJN A;  1MMD A;  3V7C A;  2ED0 A;  1JJ2 P;  1PKS A;  1VQ6 T;  2A37 A;  4J7F A;  4LN2 A;  2GGR A;  4C8Q D;  4Z89 A;  1OYX A;  4JUV A;  2NWM A;  1ZQ1 A;  3DKM A;  1UG1 A;  2E1H A;  2PZ1 A;  5I2S A;  1VA7 A;  4C8Q A;  4J6Y A;  3QSU A;  4M78 C;  5KE2 A;  1JEG A;  4JS4 A;  2AIR B;  4Q5W A;  3LX7 A;  7AT1 B;  1KQ2 A;  2EYZ A;  3CCE A;  1TTH B;  2ZZD A;  1XQH A;  3CCE Q;  1B07 A;  2EYY A;  4KUD K;  2BKD N;  5GMK l;  4RCB A;  2M16 A;  5LJ5 e;  2FPE A;  2WAC A;  2KMT A;  1D09 B;  3VU3 C;  3TCJ A;  2DJQ A;  4XTZ A;  2HKN A;  3I35 A;  3MEA A;  1T3L A;  1ZX6 A;  2JZ2 A;  2HQH A;  2QI2 A;  4PJL A;  1XJW B;  1VQ6 A;  2KE9 A;  4HCZ A;  2DTO A;  4KUL A;  2IIM A;  1YIT T;  2EGE A;  1S72 T;  4F17 A;  1AHJ B;  3MEV A;  1KQS S;  1W1F A;  5CKD A;  1NPP A;  5AT1 B;  1N27 A;  4EPC A;  1VQ8 A;  1QWE A;  2EW3 A;  4LD9 K;  2LTO A;  3G71 A;  4QW2 A;  2P0K A;  5GAO q;  4AFZ C;  4CRI A;  1VQ8 Q;  2DXB A;  3NMZ C;  4J9B A;  1N6A A;  2F2W A;  1D0X A;  1RLQ C;  3G71 Q;  2ESW A;  3VV0 A;  1Q81 R;  2F5T X;  1N9S A;  2JTF A;  4IIM A;  3CCS T;  1X27 A;  1HSQ A;  2SRC A;  4RTV A;  1K76 A;  4X1V A;  3TU4 K;  1K73 U;  1ZUU A;  2KI7 A;  3OYL A;  1O9S A;  1WA7 A;  4A4K A;  2RJF A;  4E7H A;  2PUK B;  4BUG A;  1W70 A;  1EX4 A;  2JM8 A;  3A8M B;  1YIT A;  4C92 E;  1S72 A;  1VQ4 A;  3QXE B;  3SHW A;  3CME T;  2X3W D;  1A0N B;  1YN8 A;  1NYF A;  1V1C A;  2DAQ A;  3ASK A;  5FRO A;  1VQ4 Q;  1VIF A;  2QTV A;  1HYO A;  1LOJ A;  3PVQ A;  1XNI A;  1T3S A;  1WNL A;  2DL3 A;  2NUP B;  5CKE A;  4PJO F;  1QVF P;  3PGG A;  2NLU A;  3MCA B;  2NYS A;  3RR6 A;  4ELY C;  2DA9 A;  4HCB A;  5LJ3 d;  2J6F A;  4LD6 A;  3RKY A;  4M75 F;  5D6X A;  3S3M A;  3M58 A;  1ZSG A;  1PD1 A;  1Q82 R;  1FXX A;  2ED1 A;  2DPP B;  3PE0 A;  1M1K U;  2DET A;  1VQP A;  1I07 A;  3QZ9 B;  2O9V A;  1Q86 U;  2QDY B;  2XU8 A;  4HKE A;  3LWH A;  2V26 A;  3TRE A;  3FLG A;  3CMA Q;  1VQP Q;  2MIO A;  2V1R A;  2M1H A;  1WHL A;  3QKJ A;  3RKW A;  3OW2 S;  4OMF B;  1GCQ A;  2EQM A;  4FCY A;  2LCL A;  4KH1 B;  1OPL A;  3SFM A;  3H6Z A;  3VYH B;  4D6W A;  5LJ5 g;  1UJ0 A;  5CCA A;  2CP7 A;  4CI0 C;  2EIF A;  2JN0 A;  2RMO A;  4HT8 A;  1ZA2 B;  4DBH A;  3EHQ A;  1B34 B;  4MZM A;  1SSH A;  2YHT A;  3E19 A;  1UUE A;  2H8H A;  3CCQ T;  1B7T A;  5KYW B;  1FWZ A;  4F7U G;  5GAN 3;  1K0X A;  4CC2 A;  3E9F A;  3X20 B;  5M9O A;  1QLY A;  4RTX A;  2XMF A;  2YRD A;  4HA8 A;  1WJR A;  2YRV A;  5CQX A;  1QKW A;  1K73 C;  5GAM e;  1F1B B;  3EFS A;  1AOJ A;  3MP6 A;  1K9A A;  4EMK B;  5I11 A;  4M77 C;  3X28 B;  1KD1 R;  2NUP A;  4A54 A;  3LLR A;  3M0U A;  2EKH A;  1ZSZ B;  1YCY A;  2X4W A;  5FRN A;  2O4X B;  5CKF A;  3C4S A;  3QHS A;  4IUV A;  2DZC A;  4F16 A;  2K5L A;  1KHC A;  1AWW A;  2LNH B;  1FX7 A;  3RNJ A;  1JXM A;  2E65 A;  3EFO B;  4EIK A;  4J83 A;  1G3W A;  3VYG A;  2HCK A;  3CXC A;  2QA4 T;  3MO8 A;  2Y90 A;  1UEB A;  3OYH A;  2RM4 A;  2P84 A;  4M7D C;  3BW1 A;  4FT4 A;  2W10 A;  3CCQ A;  2KVQ G;  3CCU T;  3M4Y A;  1BI0 A;  1OU8 A;  1WLP B;  3JCM V;  5EG2 A;  1Q82 C;  3GNF B;  3D7S B;  1TS9 A;  1W2B A;  3OYB A;  4FU6 A;  4OF1 A;  4M78 F;  3H8Z A;  4L59 A;  4M77 G;  4OB1 B;  2HMA A;  1K8A U;  1B34 A;  1M1K C;  3EG2 A;  2M51 A;  5KYW A;  3I55 Q;  1WGS A;  4DA4 A;  2EYW A;  1QKX A;  4B6M A;  3CD6 A;  2C0O A;  3EG9 B;  3SEM A;  3H9N A;  1D1A A;  4XAX B;  3CC2 T;  3UAT A;  4FYV B;  4KUI A;  3CD6 Q;  4KH0 B;  2ENM A;  4F04 B;  3QJ6 A;  2VKN A;  2MYS A;  4X9C A;  3RIR A;  2LJ1 A;  2YWW A;  4EMK A;  1VQ9 T;  4IUQ A;  3HP9 A;  5DM7 R;  3DLL A;  5LJ5 h;  4C92 G;  2FRW A;  2HEQ A;  1UGR B;  2Y4Y A;  1ZSZ A;  1SRL A;  2HBW A;  3VS7 A;  3L2Q A;  2O4X A;  1VQM T;  4AG1 C;  1X43 A;  1KD1 C;  1IXD A;  1PRM C;  2PTK A;  5GAO p;  4M7A C;  2GFU A;  1T0J A;  3EFO A;  1D0Y A;  2ZPH B;  2C06 A;  1PD0 A;  1K0S A;  3QWY A;  3PFS A;  4YTL A;  4RTW A;  2CUB A;  2K9G A;  2XID A;  2EBP A;  3RBB B;  5IXF A;  2DRM A;  3NTH A;  3S3N A;  4NOY A;  2HSP A;  1SF9 A;  4JZ4 A;  1NG2 A;  3MEU A;  2HL3 A;  4FW1 A;  3MKD A;  4JS5 A;  1RI0 A;  1YJ9 T;  2O31 A;  2K2V A;  1RAB B;  2RQT A;  4GY5 A;  2DBM A;  1IGU A;  2DD4 A;  2VV5 A;  2GQI A;  3A8G B;  4LDV A;  2LCS A;  2X51 A;  2YLC A;  4A63 B;  4J7I A;  3TSZ A;  5GJW B;  2FZK B;  1VQL T;  2QEX Q;  4ZNX A;  1HD3 A;  1H92 A;  4OML A;  4C8Q C;  3G4S T;  2RHI A;  3VS6 A;  4EMG A;  1YIJ A;  3EG9 A;  4KGX B;  3HTR A;  3THK A;  4DQ2 A;  4M7A G;  2E10 A;  5C0M A;  5GMK j;  2MWO A;  4IUU A;  1YIJ Q;  3I56 T;  4KGZ B;  3V8J A;  1VQK Q;  4XTX A;  3SD4 A;  3JB9 J;  3OSV A;  5FU7 C;  4OVA A;  3CEY A;  1M90 R;  3G1J A;  2FHD A;  4MDX A;  5LJ3 e;  4F7U F;  3FDR A;  4OB2 B;  3CC7 A;  1ZA1 B;  5IXB A;  1BI1 A;  5FWC A;  4M78 E;  2V8I A;  3HRU A;  2XDD A;  3CC7 Q;  2OTJ T;  2L8D A;  1W4S A;  4L6V 5;  3HPW A;  1NPR A;  1KC8 R;  1JXO A;  1QMC A;  3QUI A;  3M0Q A;  2PU9 B;  2KRS A;  2K5I A;  3JCM c;  3G4S A;  1HK9 A;  1R77 A;  1B3Q A;  4C0G A;  1RAF B;  4E7L A;  1CSK A;  2KY9 A;  3O5Z A;  2QYZ A;  3RDV A;  2D8H A;  2LP5 A;  2G6F X;  3NTI A;  4C92 D;  2KRO A;  1WHG A;  3I56 A;  2BZY A;  1IB8 A;  2JXB A;  3JCM d;  1K4U S;  4PJJ A;  2JOY A;  1E6G A;  1WQ7 A;  4P5N A;  3PMT A;  1R8O B;  4JLG A;  1FMV A;  4LXC A;  4NL2 A;  4A4E A;  1RAD B;  2JMC A;  1M9S A;  1UGQ B;  1VQ5 Q;  5GAO l;  1PRL C;  2VXF A;  2J06 A;  5IHK A;  2E5K A;  1E7O A;  1QVF S;  3HHT B;  2WSF E;  1WQW A;  2XD0 A;  4A4F A;  4BAC A;  3M55 A;  5A0L A;  4M77 F;  1P92 A;  2RJD A;  1ZUK A;  2CKK A;  2C0I A;  2MMP A;  2RB6 A;  3EH2 A;  3L2U A;  2DD5 A;  3C0C A;  2YRC A;  3VS5 A;  1RUW A;  1WPY A;  3M4G A;  3PT9 A;  3VRZ A;  2MOX A;  2L3S A;  2M0Y A;  3J81 E;  4PFP A;  2L3Q A;  1M4Z A;  2FVU A;  1BK2 A;  2HQX A;  1U1S A;  4OGE A;  3CCE T;  1MMG A;  1M90 C;  1IHW A;  4LDX A;  3BDU A;  1QVP A;  5KYY B;  2LQK A;  5GMK m;  1R0B G;  4BI3 A;  2D0Q B;  5LL6 S;  5GAN f;  4M7D F;  2DL7 A;  4FM4 B;  3LH5 A;  2DL4 A;  4IKF A;  3A8O B;  2XI9 A;  4B9W A;  1TSF A;  4PJO B;  4ZN1 A;  2HBP A;  2RPN A;  1BI3 A;  3OBY A;  1OPK A;  2KSS A;  3LW5 E;  3CQT A;  5CAI A;  1KC8 C;  2P0P A;  5KCO A;  2KYM A;  3CCJ A;  4KRT A;  4K11 A;  3AT1 B;  2FPD A;  3FB9 A;  1M30 A;  1QP2 A;  1Y96 A;  4M75 B;  4D8D A;  3CCJ Q;  1KHI A;  3QII A;  4WF2 A;  4F7U E;  1Q7Y R;  1GCQ C;  2ROL A;  2PVG B;  5LJ3 g;  3CXC P;  3OYE A;  1IO6 A;  2HQE A;  3E2U A;  2MF2 A;  1W6X A;  1VQ8 T;  3MEW A;  1ZLM A;  3G71 T;  1YCS B;  1PG5 B;  3JCM X;  3BY7 A;  4ZGJ B;  4LE9 A;  5CKH A;  4LUD A;  2EQU A;  2YLB A;  3HFN A;  1LNX A;  2V1Q A;  4IUP A;  4LDY A;  2CZ1 B;  4XTW A;  3EAE A;  1W2B P;  4E7K A;  3VJP A;  1MV3 A;  2XG8 D;  2XK0 A;  3OB9 A;  2CP5 A;  4J6X A;  2XKO C;  1C0M A;  1UDL A;  5LJ5 f;  2YXY A;  1WXU A;  3RKX A;  2DJZ A;  2ZAE A;  4M7A F;  4NS5 A;  1YI2 A;  3VS2 A;  2E3H A;  1H3H A;  2EQK A;  2LX7 A;  2QQA A;  4PNO A;  5KYY A;  1VQ4 T;  2CP2 A;  2J6K A;  1AWO A;  1PSE A;  3P8H A;  1WHM A;  4GBQ A;  1YI2 Q;  4FSX A;  1GFC A;  2QTX A;  3RMS A;  3S3O A;  4PJO D;  3CCL A;  4ELZ C;  4M78 G;  2L89 A;  4CC7 A;  4PJO A;  2QK0 A;  4IUR A;  5KCH A;  4HVW A;  3KBG A;  3CCL Q;  1M3A A;  1Q81 U;  4FL6 A;  3MJX A;  4M75 D;  4M77 E;  1U1T A;  2EGA A;  3JCM W;  5HCK A;  2DTH A;  3H0F A;  5J26 A;  5GAN 6;  4PFO A;  4M75 A;  3KXT A;  4BE2 A;  4Y28 E;  4FYX B;  3ZL7 C;  1ZUY A;  4JRQ A;  2HAX A;  2QGF B;  1TUC A;  2DIQ A;  2J7I A;  2R58 A;  3CCM A;  2KYB A;  1AWX A;  2KDS A;  3CMA T;  4RUG A;  1VQP T;  1I5O B;  3QDR B;  1N5Z A;  1U5S A;  2L5Q A;  3GPL A;  1Q7Y C;  1AT1 B;  4J9G A;  3CCM Q;  4M7D E;  3M0P A;  5GAN g;  3KUF A;  1NLO C;  4II1 A;  2DVJ A;  1H64 1;  2CGH A;  2COW A;  2LT4 A;  2ABL A;  1FYN A;  2CT3 A;  4N0A A;  2DLP A;  2EJG A;  1M2O A;  3WVE B;  2DYI A;  1PHT A;  2EYX A;  4WTO B;  1RAA B;  4HVV A;  1FMW A;  2BZ8 A;  1QVG S;  4EMK C;  2YUQ A;  5IHI A;  2XDB A;  5LJ3 h;  1NE8 A;  3ULR B;  1YJW A;  1WI7 A;  2E3I A;  1YJN Q;  2PNI A;  1PM3 A;  2KGT A;  2DIG A;  2YDL A;  1ZSZ C;  1Q82 U;  3A8H B;  3OQ5 A;  4DOW A;  1VOM A;  1YJW Q;  4E6R A;  2GTO A;  1JBM A;  2EJF A;  3OYN A;  4QVZ A;  1N8R R;  3ZBD A;  5GAN j;  3L1A A;  2ROT A;  2JM9 A;  1OX8 A;  2GF7 A;  3CMA A;  2XIC A;  3UF4 A;  5GMK i;  3JCM e;  3O8V A;  1UGP B;  2LQN A;  3A98 A;  3JCM J;  2FPF A;  5GAN 8;  3OYD A;  3OS2 A;  2B8A A;  3CC4 Q;  1AVZ C;  4C0F A;  3QYH B;  2E4H A;  4XU0 A;  1YHQ Q;  5FLX E;  4R56 A;  4F14 A;  2RQW A;  3JCM P;  2FYK A;  2PVD B;  3BFM A;  3M0T A;  2FEI A;  3DLM A;  4M7A E;  4DBQ A;  5KYU B;  3JB9 F;  3C94 A;  3VS4 A;  4M4Z A;  2CRE A;  4VUB A;  3JCM b;  1Q81 C;  4QVC A;  4CC3 A;  1M3B A;  4M78 D;  1M2V B;  1OQK A;  1KD1 U;  4NL3 A;  5I21 A;  2CYZ B;  4OMM A;  4IIO A;  3SB2 A;  3M54 A;  3L2R A;  4BE0 A;  4BD3 A;  1ZBJ A;  1Y07 A;  5I22 A;  5GAM f;  1X6G A;  4J9H A;  4OP0 A;  1IZ6 A;  1O75 A; 
#chains in the Genus database with same CATH homology
 4C8Q F;  5LJ5 j;  2K2V A;  3F70 A;  4M75 G;  2XDP A;  4GY5 A;  1X01 A;  1KG1 A;  2DD4 A;  3CD6 T;  2BIV A;  2VV5 A;  4C8Q E;  3TEE A;  4A53 A;  3A8G B;  4LDV A;  2YLC A;  3L42 A;  2JVV A;  5CQY A;  3C95 A;  1H3Z A;  4J7I A;  2E41 A;  3V7S A;  5GAN h;  4JDS A;  1TH7 A;  3CC4 T;  1VQL T;  3V7R A;  2D6F A;  3BDL A;  2H3J A;  5GAM d;  4C8Q C;  1MHN A;  4MZP A;  2RHI A;  3G4S T;  1YHQ T;  4JRK A;  4XTY A;  2EWN A;  2RO0 A;  4C0D B;  1D3B B;  2IVW A;  4EMG A;  4M78 B;  5GAN e;  3JB9 D;  1YIJ A;  2K3X A;  2LQ8 A;  5FU6 C;  4DQ2 A;  4M7A G;  3M56 A;  2E10 A;  2QQS A;  1XTD A;  3M57 A;  2V8K A;  5C0M A;  1NJI C;  3UT1 A;  2DEQ A;  5GMK j;  2MWO A;  1RI0 A;  4IUU A;  3SWN C;  3L2Z A;  3I56 T;  1YJN A;  4ZGE B;  3FEO A;  2E70 A;  4C92 F;  3C12 A;  3V8J A;  1VQO T;  1BKB A;  5A0G A;  1VQ9 A;  4XTX A;  3SD4 A;  3JB9 J;  3JSC A;  2X4X A;  3JB9 H;  4C0Z A;  1KQ1 A;  4OP0 A;  2MWP A;  3OSV A;  5FU7 C;  5AYF A;  5DLO A;  4PKC C;  4XTV A;  1N8R U;  2KK4 A;  4OVA A;  3CEY A;  3G7Z A;  3M59 A;  3V7C A;  3HSB A;  3RMQ A;  2FHD A;  4MDX A;  5LJ3 e;  4F7U F;  3FDR A;  4OB2 B;  1VQ6 T;  3CC7 A;  3I55 A;  4OB0 B;  1BI1 A;  4J7F A;  4N4G A;  4LDU A;  2DO3 A;  2RHY A;  3CBP A;  4C8Q D;  4M78 E;  3OW2 A;  1OYX A;  2V8I A;  3HRU A;  4JUV A;  2XDD A;  1ZQ1 A;  3DKM A;  2M0O A;  2WSE E;  2E1H A;  3GLX A;  4J8O A;  1OZ3 A;  2DK3 A;  4OGC A;  5I2S A;  4FT2 A;  4QQD A;  4J6Y A;  2L8D A;  4C8Q A;  2OTJ T;  3QSU A;  2LC4 A;  4RMO A;  4C0D C;  5CKB A;  1W4S A;  3V8L A;  4M78 C;  4L6V 5;  3HPW A;  1NPR A;  2LNV A;  4ZN3 A;  5KE2 A;  3X24 B;  3QUI A;  4JS4 A;  4XU1 A;  3E1S A;  4Q5W A;  3CC4 A;  1JRI A;  2PU9 B;  1I5L A;  2M9U A;  3LX7 A;  1GXI E;  3JCM f;  2QEX T;  3CCS A;  2K5I A;  3SWN A;  3JCM c;  3G4S A;  1HK9 A;  1YHQ A;  1KQ2 A;  2K5F A;  2PUO B;  5CIU A;  4C0G A;  3OYA A;  1VQ7 A;  3GIB A;  1RL2 A;  2RI2 A;  4LDW A;  3CCE A;  2OTL A;  1ZHI A;  4M7D G;  4HCC A;  4N4I A;  4E7L A;  3JCM g;  1QP3 A;  4KBM B;  2KY9 A;  4UC4 A;  3HL8 A;  2ZZD A;  3MP1 A;  1XQH A;  1VIE A;  3L2V A;  3LGF A;  2E6Z A;  4C92 D;  3NTI A;  3MHX A;  5GAN 7;  3I56 A;  2ZPF B;  2BKD N;  2QXF A;  3E9G A;  2M16 A;  4RCB A;  5GMK l;  5LJ5 e;  1YIJ T;  4KUD K;  4X34 A;  5DY9 A;  2WAC A;  3QYG B;  2KMT A;  3JCM d;  2JOY A;  3VU3 C;  1WQ7 A;  3QO3 A;  4P5N A;  3TCJ A;  3PMT A;  1VQK T;  1R8O B;  4XTZ A;  3MEA A;  2DXU A;  4JLG A;  3CME A;  3OMG A;  3J7A F;  4NL2 A;  4A4E A;  2JZ2 A;  4C5H A;  2QI2 A;  1JJ2 S;  3OYJ A;  1M9S A;  3A5Z B;  3AHU A;  3FJP A;  1UGQ B;  1VQ6 A;  1D3B A;  4HCZ A;  2DTO A;  4KUL A;  5CK9 A;  4M78 A;  4F7U A;  4RG2 A;  1WJQ A;  5GAO l;  1YIT T;  1S72 T;  3OA6 A;  2RI5 A;  1AHJ B;  2VXF A;  3MEV A;  1KQS S;  2ZCF B;  4MML A;  3OYK A;  4PJO B;  5CKD A;  2DXT A;  1NPP A;  4C5G A;  2EJ9 A;  3CC7 T;  1G3Y A;  3I55 T;  3OBW A;  4Y91 A;  1N27 A;  3HHT B;  1QVF S;  5GMK e;  2JNG A;  2WSF E;  1WQW A;  1G3S A;  2XD0 A;  4A4F A;  4M7A D;  4E7J A;  4EPC A;  4BAC A;  3M55 A;  1VQ8 A;  5A0L A;  4M77 F;  1BI2 A;  4LD9 K;  1P92 A;  2LTO A;  3G71 A;  2RJD A;  4QW2 A;  5GAN 2;  1JB0 E;  3LWI A;  2P0K A;  3CPW A;  5GAM g;  2JUF A;  5GAO q;  2CKK A;  3J80 E;  4XU2 A;  2MMP A;  2RB6 A;  3L2U A;  2QEX A;  3R6O A;  2DD5 A;  4CRI A;  2DXB A;  4C92 B;  1N6A A;  1WPY A;  5HKC A;  3M4G A;  3PMI A;  3PT9 A;  3J81 E;  1UGS B;  2FL7 A;  3VV0 A;  2KAF A;  2ZPB B;  1M4Z A;  2F5T X;  1N9S A;  2FVU A;  2JTF A;  1W2B S;  3CCS T;  5IN1 A;  3P8B B;  3HKS A;  4QQ6 A;  2HQX A;  3PIO A;  1VQ7 T;  2AHJ B;  1U1S A;  2OTL T;  4OGE A;  3CCE T;  4E7I A;  3TU4 K;  1K73 U;  1M90 C;  4LDX A;  4F7U B;  3BDU A;  1QVP A;  5J39 A;  2E6N A;  2LQK A;  5GMK m;  3OYL A;  1JJ2 A;  1O9S A;  4BI3 A;  5KE3 A;  1VQK A;  2D0Q B;  1YBY A;  2PQW A;  3ER0 A;  5LL6 S;  5GAN f;  4A4K A;  4M7D F;  4FM4 B;  4E47 A;  5FRM A;  2RJF A;  4FIB A;  4E7H A;  3GP8 A;  4BE1 A;  2VC8 A;  1M90 U;  4IKF A;  1OZ2 A;  1UB4 A;  3A8O B;  1N8R C;  2PUK B;  1M5Q 1;  4BUG A;  4A4H A;  2FB7 A;  2XI9 A;  4B9W A;  5GAN 4;  3OY9 A;  3RER A;  3A8M B;  4C5I A;  1I4K 1;  3GNG A;  3RES A;  2HBP A;  3OBY A;  1BI3 A;  4ZN1 A;  1YIT A;  2KSS A;  3LW5 E;  4C92 E;  4L5G A;  1S72 A;  1VQ4 A;  1VQ5 T;  3QXE B;  3CME T;  5GAO m;  5CAI A;  1KC8 C;  4RCC A;  2P0P A;  5KCO A;  3CCJ A;  3V8K A;  2LVM A;  3HRS A;  3X26 B;  3QBY A;  5GAN d;  2DAQ A;  2R57 A;  3FB9 A;  5GAM j;  4O5V A;  3ASK A;  2GFA A;  5FRO A;  1QP2 A;  1VUB A;  2X4J A;  1Y96 A;  4C92 C;  3OYF A;  1VIF A;  4M77 D;  4M75 B;  4QVD A;  1KC8 U;  1HXD A;  5LJ3 f;  1LOJ A;  1KHI A;  3QII A;  4WF2 A;  4F7U E;  1XNI A;  1WNL A;  5IT9 E;  3FC3 A;  2OAU A;  4M77 A;  5I2M A;  2P0Q A;  3ZEH A;  2PVG B;  2MAM A;  4IUT A;  5LJ3 g;  5CKE A;  2P4T A;  3OYE A;  4V2S A;  4PJO F;  2HQE A;  2MF2 A;  4BY6 B;  3PGG A;  2NLU A;  1VQ8 T;  3OYG A;  4B9X A;  3MCA B;  3MEW A;  5CVI A;  1QW1 A;  1U8R A;  4PJO E;  3G71 T;  3ZFJ A;  2I2L A;  4C8Q G;  4ZTF A;  4OB3 B;  3RUX A;  3QG1 A;  4ELY C;  4HCB A;  2K4Y A;  5LJ3 d;  2RHZ A;  1N9R A;  1OI1 A;  1X75 C;  2K57 A;  3JCM X;  3BY7 A;  4LD6 A;  3RKY A;  4ZGJ B;  5GAN 5;  4M75 F;  5D6X A;  2X4Y A;  3M58 A;  4GLK A;  3S3M A;  1Q86 C;  3JCM h;  4PJO C;  1FXX A;  5CKH A;  4M7D D;  4Z02 A;  2DPP B;  2EQU A;  2YLB A;  3FRN A;  3HFN A;  1M1K U;  4M75 E;  1LNX A;  1VQP A;  2L3R A;  3QZ9 B;  4IUP A;  1Y71 A;  4LDY A;  2CZ1 B;  3JRZ A;  4XTW A;  3EAE A;  2ZGW A;  2RD1 A;  1Q86 U;  4E7K A;  2QDY B;  3LH0 A;  3VJP A;  2XU8 A;  3UDC A;  4HKE A;  2Y4X A;  3LWH A;  3TRE A;  2XG8 D;  3FLG A;  1Y96 B;  2XK0 A;  3OB9 A;  4J6X A;  4C92 A;  1BIA A;  2RI3 A;  2XKO C;  2M1H A;  4M75 C;  3QKJ A;  2EFI A;  2RJE A;  5CO7 A;  3RKW A;  3N5B B;  4RG8 A;  5LJ5 f;  2QA4 A;  4EMH A;  3OW2 S;  4OMF B;  2EKO A;  1PSF A;  1NZ9 A;  2EQM A;  4M77 B;  2D9T A;  3RKX A;  1VQ5 A;  2R5A A;  2VGM A;  3OS0 A;  2LCL A;  2DJZ A;  4BDZ A;  2E64 A;  3VYH B;  3SFM A;  3H6Z A;  4D6W A;  5LJ5 g;  2EYQ A;  4M7A F;  5CCA A;  4NS5 A;  4EDU A;  1YI2 A;  4CI0 C;  1BYM A;  1WJS A;  2EIF A;  1I81 A;  2EQK A;  2QQA A;  2JN0 A;  4PNO A;  4BY6 C;  2ZPE B;  4HT8 A;  3CCU A;  2DZ9 A;  2LRQ A;  3CCV T;  2HNI A;  4J5Y A;  1VQ4 T;  3DB4 A;  1PSE A;  3P8H A;  3CBO A;  4FSX A;  3CCJ T;  1B34 B;  2LCC A;  2QTX A;  2YHT A;  4MZM A;  3RMS A;  3S3O A;  3E19 A;  5LJ5 d;  3CXC S;  4PJO D;  3CCL A;  3CCQ T;  1FWZ A;  4M78 G;  4ELZ C;  2RHU A;  4F7U G;  4XTU A;  5GAN 3;  2L89 A;  1LJO A;  2VXE A;  3OYI A;  4PJO A;  2QQ9 A;  4RKU E;  4IUR A;  5KCH A;  3E9F A;  3HFO A;  1ZBX A;  3KBG A;  3X20 B;  5M9O A;  2RA2 A;  3JB9 I;  4KT0 E;  4JJN K;  1Q81 U;  4FL6 A;  3UWN A;  5GAM h;  4M7D B;  2VYT A;  1Y7X A;  3S6W A;  4M75 D;  4M77 E;  3VUZ A;  1U1T A;  4HA8 A;  2HD0 A;  1V29 B;  4PLI A;  3JCM W;  1WJR A;  2DTH A;  2ZPG B;  5J26 A;  5GAN 6;  1VQN T;  2YRV A;  2A3L A;  5CQX A;  5KH6 A;  5A2Q E;  2DXC A;  4M75 A;  3KXT A;  4ZGD B;  2DKG A;  4BE2 A;  1K73 C;  4Y28 E;  5GAM e;  3WXM B;  3EFS A;  3MP6 A;  2EQJ A;  4EMK B;  3L2W A;  3ME9 A;  4M77 C;  3X28 B;  4A54 A;  2DTI A;  3LLR A;  3URG A;  4JRQ A;  3CC2 A;  3M9Q A;  2HAX A;  1X6O A;  2DIQ A;  4XQ3 A;  1YCY A;  2R58 A;  2PVO B;  1M1G A;  1EIF A;  2X4W A;  3CCM A;  5FRN A;  3P8D A;  2O4X B;  5CKF A;  2KDS A;  3CMA T;  3Q1J A;  1VQP T;  2BUD A;  5HK3 A;  3C4S A;  3QHS A;  1G5V A;  2DZC A;  2L5Q A;  3CPF A;  3M53 A;  2QQB A;  3QDR B;  2K5L A;  1KHC A;  4IUV A;  5DLQ E;  4PL6 A;  4R55 A;  3GPL A;  4MDW A;  1Q7Y C;  4BI8 B;  3QPH A;  4M7D E;  5GAN g;  1KQS A;  1FX7 A;  1M1F A;  3KUF A;  4MMK A;  4M7A A;  2E65 A;  4J83 A;  1G3W A;  3VYG A;  4II1 A;  3CXC A;  2QA4 T;  2CZ6 B;  2Y90 A;  1UEB A;  3MO8 A;  2QQR A;  3OYH A;  3CCV A;  3JB9 G;  2GQV A;  1H64 1;  2CGH A;  2X35 A;  2LT4 A;  2R5M A;  3PNW C;  1VQM A;  2G3R A;  1Q7Y U;  1QVF A;  2RM4 A;  4M7D C;  3BW1 A;  4N0A A;  2EJG A;  4FT4 A;  4N4H A;  1YI2 T;  4J6W A;  3WVE B;  2LX9 A;  5HY6 A;  3DB3 A;  3CCQ A;  5J3B A;  2KVQ G;  3CCU T;  3M4Y A;  4BDY A;  1BI0 A;  3FIF A;  3JCM V;  5EG2 A;  4A4G A;  1Q82 C;  4X9D A;  2E12 A;  3GNF B;  1QVG S;  4EMK C;  2XDB A;  2LT1 A;  5LJ3 h;  1NE8 A;  3CCL T;  5D6W A;  1YJW A;  1NJI U;  1K8A C;  3SDZ A;  3PIP A;  2DIG A;  2RK2 A;  3X25 B;  1VQN A;  2KQW A;  2LDM A;  3OYB A;  1W2B A;  1Q82 U;  3LGL A;  4JLI A;  3A8H B;  3OQ5 A;  4DOW A;  4FU6 A;  4OF1 A;  2XHC A;  3H8Z A;  4M78 F;  4L59 A;  4M77 G;  4OB1 B;  1JBM A;  3PTA A;  1K8A U;  4ATO A;  2EJF A;  5GAO n;  3OYN A;  4QVZ A;  2IG0 A;  1B34 A;  1M1K C;  3CCR A;  2RH2 A;  4ME7 A;  3MET A;  3OMC A;  4DOV A;  5GAO r;  4JRP A;  4M7A B;  1YJ9 A;  3ZBD A;  3OS1 A;  5GAN j;  1WGS A;  4DA4 A;  2F5K A;  3L1A A;  2A7Y A;  4QQG A;  3OYM A;  2GCX A;  2VUB A;  3NTK A;  4JRI A;  4XU3 A;  3CD6 A;  2GF7 A;  3CMA A;  2RK1 A;  2XIC A;  3G6E T;  4M7D A;  5GMK i;  4XAX B;  3CC2 T;  3JCM e;  3OS5 A;  3O8V A;  1UGP B;  1VQL A;  5D6Y A;  1SSF A;  4KUI A;  2CZ7 B;  4BB7 A;  3JCM Q;  3CCM T;  3JCM J;  4TVR A;  5GAN 8;  3QJ6 A;  5C6S A;  5IAY A;  3UPU A;  3OYD A;  2K3Y A;  4X9C A;  3RIR A;  3OS2 A;  1K9M C;  2B8A A;  1IRE B;  1G3T A;  2CS7 A;  4EMK A;  2VGN A;  4C5E A;  5L8R E;  4IUQ A;  1VQ9 T;  3HP9 A;  5DM7 R;  3DLL A;  3CPW S;  4C0F A;  5LJ5 h;  3QYH B;  4XU0 A;  2CZ0 B;  3VUB A;  5FLX E;  4C92 G;  5LJ3 j;  5CR2 A;  4R56 A;  1QVG A;  3OYC A;  1UGR B;  2Y4Y A;  3JCM P;  2FYK A;  3EFR A;  2PVD B;  2WSC E;  3BFM A;  3L2Q A;  1K9M U;  3DLM A;  4M7A E;  2JTM A;  3JAM E;  2DVE A;  2O4X A;  3T9N A;  2RHX A;  1VQM T;  5HK0 A;  1VQO A;  1I8F A;  3OYY A;  3JB9 F;  1KD1 C;  3C94 A;  1Q81 C;  4VUB A;  3CBM A;  3JCM b;  4QVC A;  5GAO p;  2O01 E;  2RJC A;  4M7A C;  2GFU A;  3A8L B;  4HT9 A;  3NFC A;  4C8Q B;  4M78 D;  1YJN T;  1DJ7 B;  4PLL A;  3INZ A;  2ZPH B;  4MZT A;  2C06 A;  4YTL A;  3PFS A;  1KD1 U;  3QZ5 B;  4NL3 A;  2F69 A;  2MI6 A;  3MP8 A;  2CYZ B;  2ZPI B;  4N0A C;  5I21 A;  1YJW T;  4XK8 E;  5FU6 B;  2EAY A;  2XID A;  4ZTJ A;  5GMK h;  1MGQ A;  2V8J A;  1M8V A;  3GF5 A;  4PJO G;  3SB2 A;  3NTH A;  3GOX A;  3S3N A;  3OSS C;  3M5A A;  3M54 A;  2E5Q A;  4NOY A;  3SWN B;  3VKI A;  3L2R A;  4BE0 A;  2OTJ A;  3QJY A;  3WVD B;  1XOV A;  4BI4 A;  4BD3 A;  3LYI A;  3MEU A;  1Y07 A;  5A0D A;  3CCR T;  3HRT A;  3G6E A;  5GAM f;  4JS5 A;  1BIB A;  4O6J A;  1IZ6 A;  1O75 A;  5FU7 B;  1YJ9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...