5GAN5

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
75
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 12
structure length 75
sequence length 81
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan500
1MGQA 4X9CA 3JB9H 2RA2A 4J6XA 1JBMA 5LJ3j 2DKGA 4J6WA 5GAOp 4NOYA 3INZA 5GANf 5LJ5j 1X01A 5GAN7 4XTVA 2EJGA 4M7AB 1HK9A 4DQ2A 5GANd 4XU1A 1BIAA 4MMLA 4C8QC 3JB9F 4JUVA 4M7AC 4M7AD 4C92D 3JB9J 5GMKe 2DTIA 2YHTA 4XQ3A 2Y90A 4XU2A 4C8QE 5LJ3d 2DTHA 5GMKl 2RD1A 5LJ5d 5GANe 4PJOC 2DVEA 2YLBA 3JCMW 4M75C 4C8QF 3QO3A 4J5YA 1I5LA 5GAMg 5GAN4 4V2SA 1D3BB 1Y96B 2E41A 5DY9A 3RIRA 3V8KA 5GAOl 2EAYA 2DJZA 1KQ2A 4XU3A 4J6YA 5GAMh 3EFRA 1I4K1 1LNXA 4C92E 3BY7A 2QTXA 1WPYA 2DXTA 4M78C 4M77C 4M78F 3BFMA 2RM4A 4PJOF 2ZGWA 4C8QA 5GAMj 5GAOn 3JB9I 4EMHA 3JB9D 4M77A 4PNOA 3L2ZA 4C92F 3RKXA 2DTOA 4XTUA 4M7DA 4M78E 4EMKA 4PJOE 5GAMf 4EMGA 1KQ1A 1N9SA 4XTXA 4Y91A 4XU0A 5I21A 4M77D 5GAMd 1HXDA 3VU3C 1U1SA 3FJPA 5LJ5e 3JCMf 5GANg 5GMKi 1WNLA 5GAOq 4M7DE 5GMKh 3JCMe 4HT8A 3JCMh 3JCMX 2EJ9A 3BW1A 1BIBA 3FB9A 3JB9G 4C92C 2RB6A 4M75B 4JRIA 4RCBA 3V7SA 5GMKj 5LJ3e 2EJFA 4X9DA 4C8QD 5LJ5h 3GIBA 5GANj 4M78A 4PJOA 3RERA 3JCMV 4C92G 5GAOr 4F7UA 4M7AA 4MMKA 2YLCA 3L1AA 1WQ7A 1B34B 3V7CA 4JRKA 4OP0A 3QSUA 1M5Q1 4PJOB 4M78D 1B34A 3HFNA 2E64A 1LOJA 1WQWA 4F7UB 3SWNA 3RESA 1I8FA 4M75A 5GAOm 5LJ5f 2CGHA 4M7DG 4JLIA 4NL2A 4RCCA 4XTWA 3V8LA 4HT9A 2E65A 4M75G 4N0AA 4C8QG 3QUIA 2VXEA 4WF2A 4M75D 4M77F 4F7UG 2DZ9A 3SB2A 4C92A 2I2LA 4QVCA 4M7DC 4PJOD 4F7UE 4C92B 2DEQA 4QVDA 5GAN5 4M77E 3BDUA 2EWNA 5GAN2 4M77G 4PJOG 2FB7A 4F7UF 1LJOA 4M78G 5CAIA 1H641 2E1HA 3V8JA 3JCMJ 1N9RA 5GANh 2HNIA 3JCMg 4A53A 4EMKC 4XTZA 4M7DF 3JCMQ 3AHUA 3EFSA 3V7RA 4EMKB 3PGGA 4M7DB 2JN0A 4M77B 3QHSA 1YCYA 4M78B 4HA8A 4C8QB 3HFOA 3JCMd 3RKWA 4A54A 1JRIA 2DZCA 3RUXA 3HSBA 2FYKA 4NL3A 3FIFA 3JCMc 5GAMe 5GMKm 3JCMP 4M7AE 4M7DD 4M7AG 1D3BA 1Y96A 1M8VA 2E10A 4XTYA 5GAN3 3SWNC 2VC8A 4M7AF 4M75F 3SWNB 5LJ3g 3JCMb 5LJ5g 4N0AC 3RKYA 5GAN8 2K57A 1I81A 1U1TA 4M75E 1TH7A 5LJ3f 5GAN6 2VXFA 5LJ3h 2DXUA 3M4GA
chains in the Genus database with same CATH superfamily
1RAAB 1MGQA 4X9CA 2RA2A 2FHDA 5LJ3j 1GBQA 2EJGA 2IG0A 1Y57A 4M7AD 3M0PA 3LH0A 1JXOA 4XU2A 4XQ3A 4C8QE 1UE9A 1RLPC 4LUEA 5D7UA 2NUZA 3OYBA 3THKA 1ZSZA 2XDDA 3CEYA 5GAN4 1WGSA 2E41A 1GRIA 3V8KA 2PUKB 1PRLC 3VS1A 4B9XA 3RDVA 2CDTA 5KH6A 2RQUA 5I2SA 2RM4A 4L5GA 3QPHA 5I2MA 1PWTA 3L2ZA 1M90R 2J6OA 1MMAA 2NLUA 3WVDB 1TUGB 1N9SA 2K9GA 3O5ZA 3C94A 1QLYA 3NFCA 3A8GB 1WNLA 1DJ7B 3BW1A 1I1JA 3DB3A 2OJ2A 4RCBA 5GANh 3I56T 3E9GA 4CC4B 1FX7A 1KQSA 1VQ9Q 4ZGEB 4LDUA 3ZFJA 1B34B 1YP5A 2M1HA 1BI0A 4HVVA 2ZPFB 1VQ6T 3SEMA 1I8FA 4J9FA 4M75A 4N4IA 1AOJA 2RO0A 1MUZA 2LQNA 2RNAA 1VQ5A 1WLPB 1U06A 2GGRA 3VUBA 2LCCA 5CK9A 2JTFA 2A36A 2LQKA 3EFSA 3RMQA 4X34A 4C8QB 3TEEA 1QP2A 1WJQA 2X4XA 3H0FA 5KYUB 3L2WA 2PVDB 1X6OA 5CCAA 3CCUT 4JPBW 1AT1B 3IQLA 2LX7A 4DBHA 1VQMQ 3SWNC 4AMCA 5J39A 3CXCP 2LQWA 2R5AA 4A63B 4AFUC 1VIEA 1BI2A 4J6WA 1Q86C 1VQ5T 1TUCA 1IB8A 2BZYA 1VQMA 1X6GA 4JUVA 1Q81U 2IPOB 2EYXA 3NGPA 2DAQA 3HRTA 5GMKl 3CXCA 5LJ5d 1VQ6A 2HDAA 3SHWA 4BI8B 4PFPA 1QQJA 3EH1A 3OSVA 1S72Q 2KBTA 2E5KA 1WPYA 2HL3A 3FDRA 2DM1A 3NHNA 4M77A 2AZSA 2JZ2A 4C0ZA 1GXIE 1G3SA 1AWWA 3MHXA 3MP6A 2AIRB 3GOXA 4FYVB 1MHNA 3JCMf 3PVLA 1KK7A 3GP8A 2QGGA 1YN8A 1SKUB 1XTDA 1K9MU 1TG0A 4OVAA 3OYJA 1P92A 3GIBA 2DEUA 1QWFA 2CT4A 3KUFA 4FIBA 1ZBXA 1GCPA 4JRKA 1QVGS 2QQBA 1B34A 2QI2A 3OB9A 3HTRA 1QMCA 2V8KA 1A0NB 2VXEA 3PFSA 4M75D 4JRQA 4FCYA 2DZ9A 4KGZB 5IT9E 3CD6A 3DLMA 4PJLA 4C5HA 2VYTA 4EIKA 3HP9A 5A0DA 1QW1A 3V8JA 1EX4A 2AK5A 3ASKA 4EMKB 2E3HA 1MV3A 1PHTA 4HA8A 1Q81R 1NG2A 2ATCB 1E6HA 1KC8C 3VRZA 3GNGA 2HBPA 2CZ1B 2RI5A 2XMFA 2ZAEA 3CMEA 4RTXA 4M7AF 3U23A 3RKYA 1PD0A 1Q86R 3M54A 3G71T 4OMNA 1UUEA 3HL8A 3JB9H 2DILA 3CCSQ 1JBMA 3I9QA 4PLIA 5LJ5j 3OSSC 3M0QA 1X2QA 2FRWA 4DQ2A 4JS5A 2CYZB 2YHTA 2K5FA 2L3RA 2JVVA 3OS5A 3QO3A 3QZ9B 2EKOA 4IURA 5HCKA 3CC4T 1Z9ZA 2RQRA 1ZX6A 3M53A 2K2MA 1H8KA 1RI9A 5KCOA 2AHJB 3VYGA 1KHIA 3JB9G 1K9AA 4AG1C 3JB9I 2NUTA 1AZEA 2QEXA 2EIFA 3CCSA 1PD1A 4IIMA 1YHQA 3CC4Q 3P8HA 4A4FA 3EG0A 5GAMf 3CC7T 2DVJA 2QAZA 4FL6A 3HRSA 1Z9QA 3NTHA 5CKFA 4ZN3A 5GANg 4E7IA 4XK8E 3TQ7P 1IZ6A 1KG1A 1QKXA 4O5VA 2P84A 2KT1A 1YI2T 2RB6A 2P0QA 3L2UA 2EYYA 2Y4YA 1VQNT 1G8XA 2RQTA 2YLCA 2LJ3A 3QSUA 3KBGA 4M78D 4QVZA 2FZKB 1G3TA 5FU6B 5CQYA 1PCXA 4RCCA 2ZCFB 2LX9A 1FXXA 1KC8R 2XU8A 4GLKA 1VYUA 3LLRA 2DEQA 1YITT 2NYSA 1GBRA 2EKHA 4PL6A 1IO6A 1M90C 5J26A 2E1HA 1OEBA 1TXQA 1Q81C 4A53A 3CMEQ 3PIOA 2C06A 3H6ZA 1UECA 1M1GA 3OA6A 2RK2A 1YJNQ 4ATOA 4M4ZA 2LZ6B 3SDZA 4RKUE 3QYGB 1K1ZA 3TU4K 3GF5A 1YJ9T 1U8RA 4OMLA 5KE2A 4QQGA 2XI9A 2DERA 4M75F 1NZ9A 1KQSS 5HY6A 3MEWA 5CIUA 3QBYA 4HCBA 1PNJA 2O9SA 5LJ3h 2HQXA 1YJ9Q 1MMNA 2DD4A 2CP6A 2DRMA 3CCEA 3CCMA 2OTLQ 3E2UA 1M1KR 4B9WA 2K4YA 2CS7A 2VASA 2RD1A 1SRMA 2CSIA 1N5ZA 5CKEA 1UEBA 2EYWA 4LD6A 1UFFA 3S3OA 1KQ2A 4LDWA 2X4YA 2XDBA 2JM9A 4C92F 1OV3A 2QG9B 1QVGP 2KK4A 2MAMA 1C6VX 2K5LA 1S72A 2GTJA 4BE2A 2CT3A 5KCHA 3CC2Q 4GBQA 2KXDA 2BUDA 4PJOB 3MPUB 2RMOA 1TTHB 5KYYA 3EG3A 2CUDA 1NYFA 4HCZA 3V8LA 3EHQA 4M75G 2F2XA 3CCRQ 2YDLA 2QEXQ 1K76A 4JDSA 4RTVA 4M77F 2RJCA 2RF0A 4HCCA 5AT1B 4PJOD 1KFZA 1M1FA 2C0TA 2LNHB 3I55Q 1H641 2LT1A 3JCMg 1CKBA 2YRCA 2M9UA 3HHTB 3E1SA 4D6WA 3H0HA 5CKHA 4CRIA 4E47A 1OZ3A 5GAMe 4M7AE 1PSEA 5GAN3 2VC8A 4E2FB 3JCMb 1BYMA 4PLLA 2EQKA 3VUZA 5LJ3f 2CH4A 4Z8AA 2L2PA 3QDFA 4AFSC 2DYBA 3CCLA 2QA4T 3CQTA 5CQXA 4CC3A 4MMLA 4C8QC 1X27A 3CC7Q 3QWYA 3H8ZA 1AEYA 2V8IA 5GANe 4EPCA 3JCMW 4Z89A 2QA4A 4FYXB 4Z02A 5DY9A 2M0OA 2JJ9A 2DLPA 3P8BB 4EDUA 2QXFA 3JB9D 1I5OB 4AFZC 2DTOA 1LCKA 1AZGB 1KQ1A 2K2VA 1VOMA 2W10A 4DEYA 2YRDA 1SF9A 2YUOA 4FYYB 2AKKA 3LWIA 4KUIA 1M1KU 1X6BA 3R6NA 2AZVA 2FG0A 1ABQA 3KFVA 1WHMA 4MDWA 2KAFA 1FMKA 2MWOA 2F2WA 1MMGA 1NPPA 2KNBB 5FROA 3OYLA 1ARKA 4QVDA 2RK1A 1LPLA 5IHIA 2OAWA 4OF1A 1UGRB 1YHQT 4EMKC 3VS2A 2DBKA 4CI0C 4RTUA 1VQOA 4IIOA 2JN0A 1XQHA 2X4JA 1YWOA 1UHCA 3EG2A 3GBQA 3META 4NL3A 5KYXB 1GFCA 4LDXA 3L2QA 1R8OB 4MDXA 5LJ3g 2HSPA 1UG1A 4JZ3A 4LD9K 3JV3A 2KQWA 3E19A 3M0RA 2RHXA 3CBOA 4LN2A 5KYWB 4ZNXA 4R56A 3VKIA 3S3MA 3CC4A 4GY5A 4M7AB 1SG5A 2YUPA 1VQPQ 2EQIA 4J7FA 2DK3A 2DTIA 1RABB 1YJWQ 2EYQA 1OU8A 2ECZA 3R6OA 1ZA1B 4J5YA 1K9MR 4HCKA 2O2OA 4ELYC 1YIJQ 4DOVA 4L6V5 1LNXA 4JJNK 5GAOn 3N5BB 1D09B 3EGDA 4M7DA 2RQVA 4Y91A 3UA6A 3OY9A 1JEGA 4XU0A 2QQSA 3I5RA 2BE9B 1NBEB 2E6NA 3X20B 4TVRA 1M1KC 2KRMA 5HKCA 5GMKj 1ZUUA 3OYMA 1YJNA 1VA7A 1X2KA 1RACB 3GLXA 2DXCA 1W2BS 3VJPA 2ZPIB 1ZLMA 5KE3A 2DBMA 2PU9B 2CUBA 3EGXA 4DA4A 2SRCA 4M77E 3X25B 3JCMJ 2FB7A 2WSEE 3CCQQ 2E12A 1OULA 2J6KA 5KYYB 2X51A 4IUUA 3CC2A 4RTYA 1PC0A 1M3BA 3CCMQ 2OTLA 3CCEQ 1K8AU 1M27C 4OGCA 1HYOA 2RJEA 4C0DB 3HPWA 2EBPA 1NEGA 1AD5A 1SSHA 1VQ7Q 1GL5A 2OX7A 1D3BA 2QEXT 1BB9A 3M0SA 5CKDA 1JJ2S 3GNFB 1U1TA 2JS2A 2V26A 1T0JA 3M4YA 2K3YA 1YNZA 5EC7A 2DIQA 5GANf 2DL8A 4XTVA 1WDXA 3M56A 1NPRA 4KGXB 2FPDA 3JB9J 3G4SQ 1HJDA 2ABLA 2XICA 2D0QB 2RPNA 1JJ2P 4C8QF 1I5LA 2A7YA 1W2BA 2JS0A 1B7TA 4J6YA 4LDYA 5D6WA 3HRUA 5GAOp 2DFUA 2QTXA 4QQ6A 2ZGWA 2PUOB 1IGQA 2HD0A 3OBYA 4M78E 1VIFA 5IXBA 4M77D 5LJ5e 2OTLT 3G7ZA 2BZ8A 2QTVA 4RG8A 5IHNA 3JCMX 1BIBA 4RUGA 4JRIA 4E6RA 1JB0E 2BTTA 1UJ0A 1G3YA 1ACMB 1QKWA 2QGFB 4X1VA 4MMKA 1YITA 2L3PA 1BKBA 3L1AA 1M5Q1 1ABOA 1M2VB 3BDLA 2O4XB 1YIJA 4F7UB 1PKTA 5FW9A 1YJNT 2E70A 1M8MA 2ED0A 3QYHB 3FC3A 1BCOA 4F7UF 1LJOA 2RJFA 3MKDA 2RHYA 4FM4B 4C0GA 5KYNA 4N4HA 3JCMd 3OS2A 1B3QA 2J6FA 5D6YA 1ZA2B 4II1A 4BE1A 4PK4A 1D0YA 4J9EA 3CCST 1M8VA 1V1CA 1QCFA 2MOXA 3PE0A 5LJ5g 1I0CA 4N0AC 1TH7A 4E7SA 1AWJA 1WIEA 5EG2A 2QK0A 3JRZA 3VYHB 3OYFA 4ORZA 1VQOQ 1YI2A 3TVTA 2KE9A 1NYGA 2KVQG 2RJDA 3G6EQ 2P4TA 3OYKA 5L23A 2OI3A 3A8HB 1D3BB 4FYWB 2CP7A 4CC7A 3ME9A 2MCNA 2O88A 2DXTA 1T0HA 2Y4XA 2E3IA 4BDYA 4QQDA 4EMGA 5I21A 1K0XA 1TSFA 4DBFA 1VQOT 1C0MA 4HT8A 1WJRA 4JJBA 2ROTA 2QDLA 5LJ5h 4X9DA 4C8QD 4HVWA 5KYWA 4ZN1A 3JCMV 1WQ7A 1KJWA 2H3JA 2LVMA 1S72T 1RLQC 3LGFA 4AT1B 2DA9A 3QDRB 1K9MC 4F17A 2PVOB 2HEQA 4JS4A 3OYIA 5GAN2 4PJOG 3EG9B 7AT1B 1ZUYA 2HL5C 3G4ST 3L42A 2YRVA 2JTEA 1WHLA 3V7RA 4M7DB 3OYDA 2FEIA 3EGDB 3EG9A 4LNPA 1VUBA 1W1FA 3C0CA 3PMIA 3RUXA 1KD1C 1XJWB 3CCLT 3UT1A 4D8DA 3G4SA 2ESWA 4JJDA 4QKUA 1KC8U 2K57A 2VXFA 3ZBDA 1M4ZA 3M4GA 4PKCC 1M9SA 1ZHIA 2EQUA 2MF2A 1SRLA 2FZGB 4NOYA 1Q86U 3CD6T 2C0OA 4BDZA 2JMAA 2M51A 3JSCA 1XNIA 3LH5A 3QKJA 2KROA 2DNUA 1RAHB 4M75C 3OQ5A 2D0NA 3CCRT 3E9FA 2KYBA 3REAB 2LC4A 3VS3A 1Y71A 4ESRA 3MEVA 1D1BA 4IKFA 2DX1A 5GAMj 5A2QE 1WHKA 2GQVA 4OMQA 3ZL7C 3A8LB 1NJIU 3CC2T 2FL7A 1PSFA 1VYTA 4IUVA 3J7AF 1J3TA 3I56Q 1U1SA 1YI2Q 3G71A 1VQKQ 5GMKh 4BE0A 3C95A 1WA7A 3RERA 2HCKA 4PJMA 2DL4A 2DE0X 2F5TX 2O4XA 2QA4Q 1SSFA 3V7CA 2C0IA 3CMAT 1OZ2A 1U3OA 1EFNA 1VQ7T 2E64A 1LOJA 1WQWA 1VQ8A 1H92A 5GAOm 1UTIA 2COZA 1NM7A 1WFWA 4C8QG 4E7ZA 1K4US 1AVZC 4M77G 1UGSB 2EYZA 5CAIA 1K0SA 2HKNA 2HNIA 4DBQA 1QP3A 1Q7YR 3AHUA 2AT1B 4M78B 3QJ6A 2BKDN 2RHUA 1F1BB 4C0DC 3M0TA 3CPWP 4Y92A 2E4HA 5FWCA 4M7DD 1M30A 3OYHA 4OMFB 4C0FA 4OMOA 2YT6A 4M75E 1Q82C 3QG1A 8ATCB 1RL2A 2DD5A 3I56A 2GFAA 2V1QA 1NJIR 3X26B 3OYYA 2D6FA 3CMET 1GFDA 1N8RR 4C92D 3OS0A 1YHQQ 1TS9A 5GMKe 2ZPHB 2D1XA 5FU7C 4PJOC 3TSWA 2GQIA 1VQ7A 2K5IA 3M57A 3CCQT 5FWBA 3CCJT 4XU3A 4C5IA 1YITQ 1UHFA 3AT1B 4M78F 3BFMA 2COYA 2LNVA 3A8MB 4PNOA 1WHGA 2GBQA 2VB6A 3UPUA 3CCJQ 3MJXA 4BD3A 2K3XA 2X3WD 2ZPBB 3VU3C 3FJPA 3I55A 9ATCB 4WCIA 1MNEA 3NTKA 1XOVA 4J83A 3JCMh 1LVKA 2G3RA 1VQNQ 2R5MA 2XDPA 1Y07A 2GTOA 2COWA 2DL3A 4OP0A 4YTLA 2K79A 3C4SA 1UJYA 1TOVA 1Q7YC 1MNDA 1FYNA 1VQKA 4NL2A 4JLIA 4KULA 2DIGA 4F7UG 4C92B 2LJ1A 1WXTA 3BDUA 2EWNA 3CCVA 2LT4A 4LXCA 3PVQA 2MWPA 2DMOA 1UB4A 2RHIA 3EAEA 4GLMA 2XHCA 2I0NA 3RKWA 2PNIA 3HSBA 1RAEB 4RG2A 4FW1A 5J3BA 2JNGA 2E10A 4B6MA 1VQMT 4DEXA 2ROLA 1UGVA 3KXTA 1C1AA 1WXBA 1WYXA 1QCNA 1NJIC 4A4HA 1GCQA 4KBMB 3UWNA 3LX7A 3INZA 5GAN7 3PMTA 3OS1A 1Q82R 1RAGB 4MZMA 1VQ9T 2B8AA 3JB9F 4OMPA 2DRKA 2FRYA 4C5GA 2DTHA 2DVEA 2NUPA 5KYXA 2A0FB 1YIJT 5DM7R 3MEAA 2DJZA 1WHJA 3LW5E 4F16A 1Q7YU 1ZUKA 1G83A 4LDVA 1R0BG 4M78C 4FSSA 4EMHA 2JM8A 4XAXB 1WHHA 2JT4A 4PJOE 1I07A 4OMMA 2VGNA 1WZOA 4BI3A 4BB7A 5CKBA 5GMKi 3JCMe 1HSQA 3ER0A 4Q5WA 2R58A 1OPLA 3EG1A 1FMWA 2Z0WA 2LCSA 2K6DA 1O9SA 1EZZB 3OYNA 2CP2A 3M58A 4OGEA 3EFOA 4A4EA 5LJ5f 5DLOA 1OPKA 4WTOB 5D6XA 2QDYB 4LUDA 1ZQ1A 1WXUA 4KT0E 3CPWS 2HQHA 2PQWA 2RHZA 2RH2A 1D1CA 2L89A 2RQWA 2JW4A 5IXFA 4XTZA 3JCMQ 4BY6B 3A98A 3QHSA 3MCAB 2KY9A 3HFOA 1ZBJA 2YSQA 1G5VA 3LYIA 2RI3A 1JJ2A 2MI6A 2CP3A 3OW2P 2WACA 1RAFB 3CCUQ 3LGLA 1WI7A 3VS6A 5FLXE 1H3ZA 2GF7A 2H3EB 1AWXA 1NLPC 2DKGA 4M7AA 1T3LA 1HK9A 1QVGA 1U5SA 4XU1A 1VQLQ 2CSQA 2FPEA 2KR3A 1BBZA 3FRNA 3DKMA 3TREA 2CZ7B 5I11A 1R77A 3UA7A 2K3BA 2YUQA 2V8JA 4QW2A 1UGPB 2QQ9A 2JXBA 1KD1U 3I55T 2EAYA 1AWOA 5IAYA 3EFOB 1RUWA 5IHKA 4VUBA 1H3HA 3DB4A 1K8AR 3MP1A 2SEMA 4XTUA 3M0UA 2D9TA 3OBWA 2LRQA 4RTZA 2O01E 2OTJQ 4ELZC 4RTTA 3G6ET 1SPKA 5CO7A 4HXJA 1N8RC 4BI4A 4M75B 4M7AC 2MK5A 2EJFA 3PIPA 2WSCE 4FT4A 4PJOA 4F7UA 1TU0B 1HD3A 1YCSB 2YWWA 1M2OA 2OTJA 2MIOA 3M5AA 3GPLA 2VWFA 3CPFA 1GCQC 3P8DA 2MMPA 2RI2A 1UGQB 2D8HA 3QUIA 1V76A 2L0AA 3VS0A 5DLQE 4J8OA 4IUTA 2FZCB 3RMSA 2CZ6B 5GAN5 5CVIA 4M7DE 4M78G 4MZTA 3VV0A 1N9RA 3O8VA 1K8AC 1JXMA 2X3XD 4D8KA 4ZTFA 1S1NA 3C12A 2VV5A 2MPXC 4M77B 1VQ4T 5ECAA 4OB3B 4E7JA 3JCMc 1IHVA 2HKQB 2GNCA 5I22A 1E6GA 2P0KA 4J9GA 4XTYA 3OMCA 4E7KA 3J81E 5GAN8 3QXEB 1G2BA 1X69A 3A8OB 1M3CA 5GAN6 4O6JA 2JMCA 1N6AA 1Q95G 8AT1B 3QZ5B 2HAXA 3M9QA 3X28B 1K73C 4IUPA 1BIAA 4HKEA 2NUPB 2DYIA 5FU7B 1D1AA 3VS5A 2YLBA 5FU6C 2BE7D 1PG5B 2EGCA 1OI1A 4OB1B 1KIKA 1TWBA 4RTWA 3EFRA 2IIMA 2M16A 5HK0A 3BY7A 3CCUA 2JUFA 2M0YA 4OB0B 1NLOC 4ZGJB 1W70A 2CKKA 1X75C 3OMGA 3MO8A 2F2VA 4A4KA 2X35A 2QASA 1UDLA 1K73R 4PFOA 6AT1B 2O9VA 5AYFA 3OYEA 3CD6Q 4KH0B 2K7AA 4BUGA 2KEAA 2DF6A 2A08A 2KT8A 4KGVB 5A0LA 1QWEA 2E65A 2PVGB 1MV0B 3OW2A 1RADB 3SB2A 3PT9A 4C92A 4QVCA 4F7UE 1O75A 4CC2A 1KD1R 3CBMA 3CCLQ 2RN8A 1T3SA 3FJ5A 2HSEB 1M2VA 2W0ZA 4M7DF 3PGGA 1YCYA 1PKSA 3G6EA 1YFNA 2J06A 2R57A 1JRIA 1V29B 3FLGA 2LP5A 1E7OA 3FIFA 4J9BA 1IXDA 2EQJA 1RI0A 4M7AG 2GCXA 2HMAA 4Z88A 3CC7A 2VKNA 1EIFA 3PNWC 3S6WA 4PFZA 3X24B 1D0ZA 1N27A 2KGTA 2KXCA 5FRNA 4E7HA 5GANd 4JJCA 3TCJA 1B07A 3LWHA 2QQRA 3L2VA 1VQ4Q 2BZXA 2DL7A 2Y90A 3H9NA 1IREB 3UF4A 1QVFA 3UATA 3ULRB 2F69A 3S3NA 5GAMg 4V2SA 1Y96B 2NUTB 2EGAA 4AG2C 4PJJA 4OB2B 4M77C 5GJWB 2ED1A 4PJOF 2VVKA 4R55A 1W6XA 2JTMA 1YJWA 3CCVT 3NPFA 5GAMd 1IGUA 1W2BP 3CMAQ 1ZSZC 1VQ4A 1WX6A 2EJ9A 2ENMA 2KDSA 4DBRA 4Y28E 1VQKT 1MMDA 3V7SA 2B86A 2QYZA 5GANj 4M78A 3CCVQ 4KUDK 2A37A 2CP0A 2HZYA 4F04B 4J9DA 3CCQA 3G71Q 2J7IA 2IVWA 4UC4A 1Y0MA 2KMTA 2CGHA 4JLGA 2MYSA 3SD4A 2F5KA 4J9IA 4MZPA 4FSXA 3JAME 2VUBA 3EGXB 3TSZA 3WXMB 1YJWT 3I35A 1FWZA 1BI1A 4LE9A 1QVPA 3T9NA 1VQ8Q 3Q1JA 4ME7A 3CXCS 5C0MA 2XIDA 5CR2A 1VQLA 3RNJA 3L2RA 4HVUA 2DZCA 1SEMA 2QQAA 1VQ6Q 4C5EA 4BY6C 1NEBA 4ZGDB 2EQMA 3SWNB 4ZTJA 4JZ4A 1I81A 1IHWA 2DXUA 2PZ1A 3VS7A 3EGUA 3CCJA 1X01A 5L8RE 1OYXA 2L8DA 2CREA 1CKAA 2DJQA 4K11A 2ZPEB 2E6ZA 2HBWA 5FRMA 3A1PA 3SFMA 2YXYA 5IN1A 2V1RA 1NE8A 1VQ8T 2OTJT 2O31A 2EPDA 3OYAA 3RIRA 3NTIA 1PM3A 3H0IA 3RR6A 4RMOA 3G1JA 3BE3A 2XG8D 3D7SB 4C92E 4J9CA 2E5QA 3UDCA 3URGA 2EW3A 4EMKA 2NWMA 1VQLT 1VQ5Q 5GAOq 3OYCA 1KHCA 2PTKA 3FB9A 1M3AA 3M59A 2DL5A 2XK0A 1IRXA 2KI7A 1CSKA 5GAOr 1SHGA 1QCOA 1R0CB 1K73U 2X9HA 3HFNA 3PTAA 3SWNA 3RESA 5A0GA 4BACA 3F70A 4HT9A 4N0AA 3QWXX 4R0KA 2FO0A 2L3QA 2I2LA 3CCMT 3CCET 3RBBB 1OX8A 2L3SA 3MEUA 3CPWA 1OX9A 1VYVA 1OQKA 2BIVA 2G6FX 2L5QA 5GJVB 2X4WA 3NMZC 2CH4W 1FMVA 3I5SA 4KH1B 3A5ZB 4ANJA 4FW2A 1M90U 2LDMA 3CCRA 3J80E 1ZSZB 5GMKm 1VQPA 1WJSA 1BI3A 2P0PA 4QT7A 3ZEHA 1ZSGA 2F1LA 1W4SA 2OAUA 2DETA 1RAIB 2EGEA 3DLLA 4J6XA 4DOWA 2XKOC 1BK2A 2LMJA 1BU1A 2LJ0A 1G3WA 4AFQC 2KRSA 1BCMA 1PRMC 1X43A 3WVEB 5IH2A 2EVRA 5LJ3d 2A28A 1KSWA 1N8RU 2HQEA 1Y7XA 4FT2A 2WSFE 5GAOl 2D8JA 5LL6S 5GAMh 3EHRA 2CP5A 3QIIA 1I4K1 1YJ9A 4N4GA 5KYUA 3M55A 4C8QA 4FU6A 4P5NA 1OOTA 1TUDA 3RKXA 3QJYA 2EFIA 1D0XA 1OU9A 1Q82U 4XTXA 5M9OA 1HXDA 2ZZDA 5HK3A 1YWPA 1QVFP 2GFUA 4C92C 5LJ3e 1VQPT 4F14A 2ZPGB 4NS5A 4C92G 4IUQA 2DXBA 1YBYA 2LQ8A 3CBPA 2P4RA 1JO8A 3REBB 1JU5C 1JQQA 2A3LA 2LCLA 3FEOA 2JOYA 4JRPA 4M7DG 4XTWA 3VS4A 3H41A 1QVFS 3HKSA 4E7LA 4WF2A 1VQ9A 1VQNA 4M7DC 2AKLA 2DO3A 3CMAA 3OW2S 2FPFA 2FVUA 2J05A 2H8HA 1KQSP 2YUNA 2KYMA 4L59A 3OYGA 4A54A 3VRYA 4J9HA 2FYKA 4PJNA 2DPPB 2KSSA 3JCMP 4KRTA 1Y96A 1SHFA 2M02A 2KRNA 1AHJB 3EH2A 2CZ0B 2LTOA 2VGMA 4A4GA 5C6SA 3MP8A 2XD0A 4J7IA
chains in the Genus database with same CATH topology
3OS1A 4PKCC 1M9SA 1MGQA 4X9CA 1ZHIA 2RA2A 2QA4T 3CCLA 2EQUA 2FHDA 2MF2A 3QZ5B 3M9QA 5CQXA 4NOYA 3X28B 5LJ3j 1Q86U 2HAXA 2EJGA 2IG0A 3CD6T 4BDZA 1K73C 4IUPA 1BIAA 4HKEA 4MMLA 3JSCA 4C8QC 1XNIA 4M7AD 3LH0A 3QKJA 3H8ZA 4XU2A 4XQ3A 4C8QE 5FU7B 2V8IA 5GANe 4EPCA 3OYBA 2YLBA 3JCMW 4M75C 5FU6C 3OQ5A 2XDDA 3CEYA 2QA4A 5GAN4 3CCRT 3E9FA 1WGSA 4Z02A 2E41A 5DY9A 1OI1A 2LC4A 4OB1B 3V8KA 2M0OA 2PUKB 4B9XA 1Y71A 3EFRA 2M16A 5HK0A 3MEVA 4IKFA 5KH6A 3BY7A 3CCUA 2JUFA 5I2SA 3P8BB 4EDUA 5GAMj 2RM4A 4L5GA 5A2QE 4OB0B 2QXFA 3QPHA 5I2MA 4ZGJB 2CKKA 3JB9D 3L2ZA 1X75C 2GQVA 2DTOA 3A8LB 3OMGA 2NLUA 3WVDB 1NJIU 3CC2T 1KQ1A 1N9SA 1PSFA 2FL7A 2K2VA 3C94A 3MO8A 4IUVA 3J7AF 4A4KA 1U1SA 2X35A 3NFCA 3G71A 3A8GB 3LWIA 4KUIA 1M1KU 1WNLA 5GMKh 1DJ7B 3BW1A 3C95A 4BE0A 3DB3A 4RCBA 5GANh 3RERA 3I56T 3E9GA 1FX7A 5AYFA 1KQSA 3OYEA 2F5TX 4ZGEB 4LDUA 4MDWA 2O4XA 3ZFJA 1SSFA 2KAFA 1B34B 3V7CA 2M1HA 2MWOA 4BUGA 3CMAT 1BI0A 2ZPFB 1OZ2A 1VQ7T 1VQ6T 2E64A 1LOJA 1WQWA 1VQ8A 1I8FA 4M75A 5A0LA 5GAOm 1NPPA 4N4IA 2E65A 2PVGB 3OW2A 5FROA 4C8QG 2RO0A 3SB2A 3PT9A 4C92A 4QVCA 3OYLA 4F7UE 1VQ5A 1O75A 3CBMA 4QVDA 2RK1A 4OF1A 1UGRB 1UGSB 4M77G 5CAIA 1YHQT 3VUBA 2HNIA 2LCCA 4EMKC 1QP3A 5CK9A 2JTFA 4M7DF 1VQOA 2LQKA 4CI0C 3EFSA 3AHUA 3PGGA 3RMQA 2JN0A 1XQHA 1YCYA 2X4JA 4M78B 4X34A 3QJ6A 2BKDN 2RHUA 1QP2A 1WJQA 3TEEA 2X4XA 4C8QB 3G6EA 3L2WA 2R57A 2PVDB 1JRIA 1V29B 3FLGA 4C0DC 3META 1X6OA 4O6JA 4NL3A 3FIFA 2EQJA 4LDXA 1RI0A 5CCAA 3L2QA 3CCUT 4M7DD 1R8OB 4MDXA 3OYHA 4M7AG 2GCXA 4OMFB 4C0FA 3SWNC 5J39A 3CC7A 5LJ3g 1EIFA 3PNWC 3S6WA 4M75E 1Q82C 3X24B 4LD9K 2R5AA 2KQWA 3E19A 3QG1A 1RL2A 1VIEA 1N27A 1BI2A 2DD5A 2RHXA 3CBOA 4J6WA 2GFAA 4R56A 3VKIA 3I56A 3S3MA 3CC4A 1Q86C 5FRNA 3X26B 4E7HA 4GY5A 4M7AB 1VQ5T 5GANd 3OYYA 2D6FA 3TCJA 3CMET 1VQMA 4JUVA 3LWHA 2QQRA 3L2VA 4C92D 1Q81U 3OS0A 4J7FA 2DK3A 5GMKe 2DTIA 2Y90A 2DAQA 2ZPHB 3HRTA 5GMKl 3CXCA 1IREB 2EYQA 5LJ5d 5FU7C 4PJOC 1QVFA 1VQ7A 1VQ6A 3R6OA 2K5IA 4J5YA 3M57A 2F69A 3S3NA 5GAMg 4BI8B 3CCQT 4V2SA 1Y96B 3CCJT 4ELYC 3OSVA 4XU3A 4C5IA 4DOVA 4L6V5 1LNXA 4OB2B 4M77C 4JJNK 1WPYA 5GAOn 3FDRA 3BFMA 3N5BB 4M78F 4PJOF 4R55A 2LNVA 3A8MB 4M77A 4PNOA 2JTMA 1YJWA 3CCVT 4M7DA 3UPUA 2JZ2A 4C0ZA 1GXIE 4Y91A 4BD3A 2K3XA 1G3SA 4XU0A 3OY9A 3MHXA 3MP6A 2QQSA 2ZPBB 5GAMd 3VU3C 3GOXA 3FJPA 2E6NA 1MHNA 3X20B 3I55A 3JCMf 4TVRA 3NTKA 1VQ4A 1XOVA 4J83A 3JCMh 3GP8A 1M1KC 2EJ9A 1XTDA 2G3RA 2KDSA 4Y28E 5HKCA 1K9MU 1VQKT 5GMKj 4OVAA 3V7SA 2R5MA 1P92A 3OYJA 3GIBA 2XDPA 5GANj 4M78A 3OYMA 1Y07A 1YJNA 4KUDK 3KUFA 4FIBA 1ZBXA 4JRKA 1QVGS 4OP0A 2QQBA 3GLXA 4YTLA 1B34A 3CCQA 2DXCA 3C4SA 1W2BS 2QI2A 3VJPA 1Q7YC 2ZPIB 2IVWA 3OB9A 5KE3A 4UC4A 2KMTA 2PU9B 2CGHA 4JLGA 4JLIA 4NL2A 1VQKA 4KULA 3SD4A 2F5KA 4MZPA 2V8KA 2DIGA 4FSXA 2VXEA 3PFSA 4M75D 4F7UG 4JRQA 2DZ9A 5IT9E 3JAME 2VUBA 3CD6A 4DA4A 3DLMA 3WXMB 4C92B 1YJWT 4C5HA 1FWZA 2VYTA 1BI1A 4M77E 3X25B 3BDUA 2EWNA 3JCMJ 3HP9A 2FB7A 2WSEE 5A0DA 3CCVA 1QW1A 2LT4A 2E12A 3V8JA 1QVPA 3T9NA 3Q1JA 4ME7A 3ASKA 4IUUA 3CC2A 2MWPA 4EMKB 3CXCS 5C0MA 1UB4A 2RHIA 3EAEA 2XIDA 5CR2A 1VQLA 2OTLA 3L2RA 4HA8A 1K8AU 2XHCA 3RKWA 2DZCA 4OGCA 3HSBA 4RG2A 2RJEA 2QQAA 3HPWA 4C0DB 1KC8C 3GNGA 5J3BA 4C5EA 1D3BA 2JNGA 4BY6C 2E10A 2HBPA 2CZ1B 2RI5A 2QEXT 4ZGDB 3CMEA 1VQMT 4M7AF 2EQMA 3SWNB 3KXTA 4ZTJA 3RKYA 5CKDA 1JJ2S 3GNFB 1I81A 1U1TA 1NJIC 3M54A 4A4HA 3G71T 2DXUA 3HL8A 3JB9H 3M4YA 2K3YA 4KBMB 1JBMA 3UWNA 3LX7A 3INZA 5GANf 2DIQA 1X01A 3OSSC 3PMTA 4PLIA 4XTVA 5L8RE 5LJ5j 4MZMA 3CCJA 1OYXA 1NPRA 3M56A 2L8DA 4DQ2A 1VQ9T 2B8AA 4JS5A 3JB9F 3JB9J 2ZPEB 2E6ZA 5FRMA 2CYZB 2YHTA 4C5GA 2DTHA 2K5FA 2L3RA 2XICA 3SFMA 2D0QB 5IN1A 2DVEA 2JVVA 1NE8A 3OS5A 3QO3A 4C8QF 1I5LA 1VQ8T 2OTJT 3QZ9B 2A7YA 2EKOA 3OYAA 1W2BA 4IURA 3RIRA 3NTIA 5DM7R 3MEAA 3CC4T 1YIJT 2DJZA 1Q7YU 3LW5E 3M53A 4RMOA 4J6YA 4LDYA 5D6WA 3HRUA 2AHJB 5KCOA 4LDVA 2XG8D 3VYGA 4C92E 5GAOp 1KHIA 2QTXA 4QQ6A 4M78C 3JB9I 3JB9G 2E5QA 2PUOB 2ZGWA 3UDCA 2HD0A 4EMHA 2QEXA 2EIFA 3OBYA 3URGA 3CCSA 4XAXB 1YHQA 4M78E 3P8HA 4A4FA 4EMKA 4PJOE 5GAMf 3CC7T 1N6AA 1VIFA 4M77D 2VGNA 4FL6A 5LJ5e 1VQLT 2OTLT 3G7ZA 3HRSA 3NTHA 4BI3A 5CKFA 4BB7A 4ZN3A 5CKBA 4XK8E 5GANg 4E7IA 5GMKi 5GAOq 3OYCA 1IZ6A 4RG8A 3JCMe 1KHCA 1KG1A 3JCMX 3FB9A 4O5VA 1BIBA 3M59A 1YI2T 2RB6A 2P0QA 2XK0A 3ER0A 4JRIA 4Q5WA 3L2UA 2R58A 2Y4YA 1JB0E 1VQNT 1G3YA 5GAOr 4MMKA 1YITA 2YLCA 1BKBA 1O9SA 3L1AA 1K73U 3OYNA 3QSUA 1M5Q1 3KBGA 4M78D 4QVZA 3HFNA 3BDLA 3M58A 3PTAA 1G3TA 2O4XB 5FU6B 1YIJA 4F7UB 4OGEA 3SWNA 3RESA 4A4EA 5A0GA 5LJ5f 5CQYA 4BACA 4RCCA 5DLOA 3F70A 2ZCFB 4HT9A 4N0AA 5D6XA 2QDYB 2LX9A 1ZQ1A 1FXXA 2XU8A 4GLKA 2I2LA 3CCMT 3CCET 4KT0E 1YJNT 3CPWS 2E70A 2PQWA 2RHZA 3LLRA 2DEQA 3MEUA 3CPWA 1YITT 3QYHB 3FC3A 4PL6A 2RH2A 4F7UF 1M90C 5J26A 1LJOA 2BIVA 3M4GA 2E1HA 2RJFA 1Q81C 2L5QA 2L89A 4A53A 3PIOA 2C06A 2RHYA 4XTZA 3H6ZA 2X4WA 4FM4B 4BY6B 4C0GA 3JCMQ 1M1GA 3OA6A 2RK2A 4ATOA 3QHSA 3MCAB 3A5ZB 4N4HA 2KY9A 3HFOA 3JCMd 3SDZA 3OS2A 4RKUE 3QYGB 1M90U 2LDMA 3TU4K 5D6YA 3CCRA 1G5VA 3GF5A 3LYIA 4II1A 3J80E 4BE1A 5GMKm 2RI3A 1VQPA 1WJSA 1YJ9T 1U8RA 1BI3A 1JJ2A 3CCST 2MI6A 2P0PA 4QQGA 2XI9A 5KE2A 1M8VA 3ZEHA 2WACA 4M75F 1NZ9A 1KQSS 5HY6A 5LJ5g 3MEWA 4N0AC 3LGLA 5CIUA 5FLXE 1H3ZA 1W4SA 2OAUA 1TH7A 3QBYA 4HCBA 5LJ3h 2GF7A 5EG2A 5GAN7 3JRZA 2HQXA 3DLLA 4J6XA 3VYHB 4DOWA 3OYFA 2DKGA 2XKOC 4M7AA 1YI2A 2DD4A 1HK9A 1QVGA 4XU1A 1G3WA 3CCEA 3CCMA 3FRNA 3DKMA 4B9WA 3TREA 2K4YA 2CS7A 2CZ7B 3WVEB 2KVQG 5LJ3d 2RJDA 2P4TA 2RD1A 2V8JA 4QW2A 3OYKA 1N8RU 3A8HB 1UGPB 2QQ9A 2HQEA 1Y7XA 4FT2A 1D3BB 1UEBA 4LD6A 2WSFE 5CKEA 5GAOl 3I55T 2EAYA 1KD1U 3S3OA 1KQ2A 3ME9A 5LL6S 5GAMh 4LDWA 3QIIA 5IAYA 1I4K1 2X4YA 1YJ9A 4N4GA 2DXTA 2XDBA 4VUBA 3M55A 3DB4A 4C8QA 2Y4XA 3MP1A 4FU6A 4P5NA 4C92F 3RKXA 3QJYA 4XTUA 2EFIA 2D9TA 4BDYA 4QQDA 4EMGA 1Q82U 3OBWA 4XTXA 2KK4A 5M9OA 2LRQA 5I21A 2MAMA 2O01E 1HXDA 4ELZC 3G6ET 2ZZDA 1VQOT 2K5LA 5HK3A 1S72A 4HT8A 1WJRA 5CO7A 4BE2A 1N8RC 4BI4A 2GFUA 5KCHA 4C92C 4M75B 4M7AC 5LJ3e 1VQPT 5LJ5h 2EJFA 4X9DA 4C8QD 3PIPA 2WSCE 2ZPGB 4ZN1A 4FT4A 4PJOA 4NS5A 3JCMV 4C92G 4F7UA 2DXBA 4IUQA 1YBYA 2LQ8A 1WQ7A 2H3JA 3CBPA 2OTJA 2BUDA 4PJOB 2LVMA 3M5AA 3GPLA 3CPFA 2A3LA 2LCLA 3FEOA 1S72T 3P8DA 2MMPA 2JOYA 2RI2A 4JRPA 3LGFA 1UGQB 4HCZA 4XTWA 4M7DG 3V8LA 4M75G 1QVFS 3QDRB 3HKSA 4E7LA 3QUIA 4JDSA 4WF2A 1VQ9A 4M77F 2RJCA 1K9MC 4HCCA 1VQNA 4M7DC 2PVOB 5DLQE 4PJOD 2DO3A 4J8OA 4IUTA 3RMSA 2CZ6B 3ZBDA 5GAN5 1M1FA 4JS4A 5CVIA 3CMAA 3OYIA 5GAN2 4M7DE 4PJOG 3OW2S 3G4ST 4M78G 2FVUA 4MZTA 1H641 3L42A 2YRVA 3VV0A 1N9RA 3O8VA 2LT1A 3JCMg 1K8AC 4ZTFA 3V7RA 3C12A 3OYDA 2M9UA 3HHTB 2VV5A 4M7DB 4M77B 3E1SA 5GAN6 1VQ4T 4L59A 4D6WA 3OYGA 1VUBA 4OB3B 4E7JA 5CKHA 4A54A 4CRIA 3PMIA 3RUXA 4E47A 1KD1C 1OZ3A 3CCLT 2FYKA 3JCMc 2DPPB 2KSSA 5GAMe 3JCMP 4M7AE 1PSEA 3UT1A 3G4SA 2P0KA 1Y96A 4XTYA 5GAN3 3OMCA 1AHJB 4E7KA 2VC8A 2CZ0B 2LTOA 2VGMA 3JCMb 4PLLA 2EQKA 3J81E 1KC8U 1BYMA 5GAN8 3QXEB 4A4GA 2K57A 3VUZA 5C6SA 5LJ3f 3MP8A 2XD0A 4J7IA 3A8OB 2VXFA 1M4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGQ A;  4X9C A;  3JB9 H;  2RA2 A;  4J6X A;  1JBM A;  5LJ3 j;  2DKG A;  4J6W A;  5GAO p;  4NOY A;  3INZ A;  5GAN f;  5LJ5 j;  1X01 A;  5GAN 7;  4XTV A;  2EJG A;  4M7A B;  1HK9 A;  4DQ2 A;  5GAN d;  4XU1 A;  1BIA A;  4MML A;  4C8Q C;  3JB9 F;  4JUV A;  4M7A C;  4M7A D;  4C92 D;  3JB9 J;  5GMK e;  2DTI A;  2YHT A;  4XQ3 A;  2Y90 A;  4XU2 A;  4C8Q E;  5LJ3 d;  2DTH A;  5GMK l;  2RD1 A;  5LJ5 d;  5GAN e;  4PJO C;  2DVE A;  2YLB A;  3JCM W;  4M75 C;  4C8Q F;  3QO3 A;  4J5Y A;  1I5L A;  5GAM g;  5GAN 4;  4V2S A;  1D3B B;  1Y96 B;  2E41 A;  5DY9 A;  3RIR A;  3V8K A;  5GAO l;  2EAY A;  2DJZ A;  1KQ2 A;  4XU3 A;  4J6Y A;  5GAM h;  3EFR A;  1I4K 1;  1LNX A;  4C92 E;  3BY7 A;  2QTX A;  1WPY A;  2DXT A;  4M78 C;  4M77 C;  4M78 F;  3BFM A;  2RM4 A;  4PJO F;  2ZGW A;  4C8Q A;  5GAM j;  5GAO n;  3JB9 I;  4EMH A;  3JB9 D;  4M77 A;  4PNO A;  3L2Z A;  4C92 F;  3RKX A;  2DTO A;  4XTU A;  4M7D A;  4M78 E;  4EMK A;  4PJO E;  5GAM f;  4EMG A;  1KQ1 A;  1N9S A;  4XTX A;  4Y91 A;  4XU0 A;  5I21 A;  4M77 D;  5GAM d;  1HXD A;  3VU3 C;  1U1S A;  3FJP A;  5LJ5 e;  3JCM f;  5GAN g;  5GMK i;  1WNL A;  5GAO q;  4M7D E;  5GMK h;  3JCM e;  4HT8 A;  3JCM h;  3JCM X;  2EJ9 A;  3BW1 A;  1BIB A;  3FB9 A;  3JB9 G;  4C92 C;  2RB6 A;  4M75 B;  4JRI A;  4RCB A;  3V7S A;  5GMK j;  5LJ3 e;  2EJF A;  4X9D A;  4C8Q D;  5LJ5 h;  3GIB A;  5GAN j;  4M78 A;  4PJO A;  3RER A;  3JCM V;  4C92 G;  5GAO r;  4F7U A;  4M7A A;  4MMK A;  2YLC A;  3L1A A;  1WQ7 A;  1B34 B;  3V7C A;  4JRK A;  4OP0 A;  3QSU A;  1M5Q 1;  4PJO B;  4M78 D;  1B34 A;  3HFN A;  2E64 A;  1LOJ A;  1WQW A;  4F7U B;  3SWN A;  3RES A;  1I8F A;  4M75 A;  5GAO m;  5LJ5 f;  2CGH A;  4M7D G;  4JLI A;  4NL2 A;  4RCC A;  4XTW A;  3V8L A;  4HT9 A;  2E65 A;  4M75 G;  4N0A A;  4C8Q G;  3QUI A;  2VXE A;  4WF2 A;  4M75 D;  4M77 F;  4F7U G;  2DZ9 A;  3SB2 A;  4C92 A;  2I2L A;  4QVC A;  4M7D C;  4PJO D;  4F7U E;  4C92 B;  2DEQ A;  4QVD A;  5GAN 5;  4M77 E;  3BDU A;  2EWN A;  5GAN 2;  4M77 G;  4PJO G;  2FB7 A;  4F7U F;  1LJO A;  4M78 G;  5CAI A;  1H64 1;  2E1H A;  3V8J A;  3JCM J;  1N9R A;  5GAN h;  2HNI A;  3JCM g;  4A53 A;  4EMK C;  4XTZ A;  4M7D F;  3JCM Q;  3AHU A;  3EFS A;  3V7R A;  4EMK B;  3PGG A;  4M7D B;  2JN0 A;  4M77 B;  3QHS A;  1YCY A;  4M78 B;  4HA8 A;  4C8Q B;  3HFO A;  3JCM d;  3RKW A;  4A54 A;  1JRI A;  2DZC A;  3RUX A;  3HSB A;  2FYK A;  4NL3 A;  3FIF A;  3JCM c;  5GAM e;  5GMK m;  3JCM P;  4M7A E;  4M7D D;  4M7A G;  1D3B A;  1Y96 A;  1M8V A;  2E10 A;  4XTY A;  5GAN 3;  3SWN C;  2VC8 A;  4M7A F;  4M75 F;  3SWN B;  5LJ3 g;  3JCM b;  5LJ5 g;  4N0A C;  3RKY A;  5GAN 8;  2K57 A;  1I81 A;  1U1T A;  4M75 E;  1TH7 A;  5LJ3 f;  5GAN 6;  2VXF A;  5LJ3 h;  2DXU A;  3M4G A; 
#chains in the Genus database with same CATH topology
 1RAA B;  1MGQ A;  4X9C A;  2RA2 A;  2FHD A;  5LJ3 j;  1GBQ A;  2EJG A;  2IG0 A;  1Y57 A;  4M7A D;  3M0P A;  3LH0 A;  1JXO A;  4XU2 A;  4XQ3 A;  4C8Q E;  1UE9 A;  1RLP C;  4LUE A;  5D7U A;  2NUZ A;  3OYB A;  3THK A;  1ZSZ A;  2XDD A;  3CEY A;  5GAN 4;  1WGS A;  2E41 A;  1GRI A;  3V8K A;  2PUK B;  1PRL C;  3VS1 A;  4B9X A;  3RDV A;  2CDT A;  5KH6 A;  2RQU A;  5I2S A;  2RM4 A;  4L5G A;  3QPH A;  5I2M A;  1PWT A;  3L2Z A;  1M90 R;  2J6O A;  1MMA A;  2NLU A;  3WVD B;  1TUG B;  1N9S A;  2K9G A;  3O5Z A;  3C94 A;  1QLY A;  3NFC A;  3A8G B;  1WNL A;  1DJ7 B;  3BW1 A;  1I1J A;  3DB3 A;  2OJ2 A;  4RCB A;  5GAN h;  3I56 T;  3E9G A;  4CC4 B;  1FX7 A;  1KQS A;  1VQ9 Q;  4ZGE B;  4LDU A;  3ZFJ A;  1B34 B;  1YP5 A;  2M1H A;  1BI0 A;  4HVV A;  2ZPF B;  1VQ6 T;  3SEM A;  1I8F A;  4J9F A;  4M75 A;  4N4I A;  1AOJ A;  2RO0 A;  1MUZ A;  2LQN A;  2RNA A;  1VQ5 A;  1WLP B;  1U06 A;  2GGR A;  3VUB A;  2LCC A;  5CK9 A;  2JTF A;  2A36 A;  2LQK A;  3EFS A;  3RMQ A;  4X34 A;  4C8Q B;  3TEE A;  1QP2 A;  1WJQ A;  2X4X A;  3H0F A;  5KYU B;  3L2W A;  2PVD B;  1X6O A;  5CCA A;  3CCU T;  4JPB W;  1AT1 B;  3IQL A;  2LX7 A;  4DBH A;  1VQM Q;  3SWN C;  4AMC A;  5J39 A;  3CXC P;  2LQW A;  2R5A A;  4A63 B;  4AFU C;  1VIE A;  1BI2 A;  4J6W A;  1Q86 C;  1VQ5 T;  1TUC A;  1IB8 A;  2BZY A;  1VQM A;  1X6G A;  4JUV A;  1Q81 U;  2IPO B;  2EYX A;  3NGP A;  2DAQ A;  3HRT A;  5GMK l;  3CXC A;  5LJ5 d;  1VQ6 A;  2HDA A;  3SHW A;  4BI8 B;  4PFP A;  1QQJ A;  3EH1 A;  3OSV A;  1S72 Q;  2KBT A;  2E5K A;  1WPY A;  2HL3 A;  3FDR A;  2DM1 A;  3NHN A;  4M77 A;  2AZS A;  2JZ2 A;  4C0Z A;  1GXI E;  1G3S A;  1AWW A;  3MHX A;  3MP6 A;  2AIR B;  3GOX A;  4FYV B;  1MHN A;  3JCM f;  3PVL A;  1KK7 A;  3GP8 A;  2QGG A;  1YN8 A;  1SKU B;  1XTD A;  1K9M U;  1TG0 A;  4OVA A;  3OYJ A;  1P92 A;  3GIB A;  2DEU A;  1QWF A;  2CT4 A;  3KUF A;  4FIB A;  1ZBX A;  1GCP A;  4JRK A;  1QVG S;  2QQB A;  1B34 A;  2QI2 A;  3OB9 A;  3HTR A;  1QMC A;  2V8K A;  1A0N B;  2VXE A;  3PFS A;  4M75 D;  4JRQ A;  4FCY A;  2DZ9 A;  4KGZ B;  5IT9 E;  3CD6 A;  3DLM A;  4PJL A;  4C5H A;  2VYT A;  4EIK A;  3HP9 A;  5A0D A;  1QW1 A;  3V8J A;  1EX4 A;  2AK5 A;  3ASK A;  4EMK B;  2E3H A;  1MV3 A;  1PHT A;  4HA8 A;  1Q81 R;  1NG2 A;  2ATC B;  1E6H A;  1KC8 C;  3VRZ A;  3GNG A;  2HBP A;  2CZ1 B;  2RI5 A;  2XMF A;  2ZAE A;  3CME A;  4RTX A;  4M7A F;  3U23 A;  3RKY A;  1PD0 A;  1Q86 R;  3M54 A;  3G71 T;  4OMN A;  1UUE A;  3HL8 A;  3JB9 H;  2DIL A;  3CCS Q;  1JBM A;  3I9Q A;  4PLI A;  5LJ5 j;  3OSS C;  3M0Q A;  1X2Q A;  2FRW A;  4DQ2 A;  4JS5 A;  2CYZ B;  2YHT A;  2K5F A;  2L3R A;  2JVV A;  3OS5 A;  3QO3 A;  3QZ9 B;  2EKO A;  4IUR A;  5HCK A;  3CC4 T;  1Z9Z A;  2RQR A;  1ZX6 A;  3M53 A;  2K2M A;  1H8K A;  1RI9 A;  5KCO A;  2AHJ B;  3VYG A;  1KHI A;  3JB9 G;  1K9A A;  4AG1 C;  3JB9 I;  2NUT A;  1AZE A;  2QEX A;  2EIF A;  3CCS A;  1PD1 A;  4IIM A;  1YHQ A;  3CC4 Q;  3P8H A;  4A4F A;  3EG0 A;  5GAM f;  3CC7 T;  2DVJ A;  2QAZ A;  4FL6 A;  3HRS A;  1Z9Q A;  3NTH A;  5CKF A;  4ZN3 A;  5GAN g;  4E7I A;  4XK8 E;  3TQ7 P;  1IZ6 A;  1KG1 A;  1QKX A;  4O5V A;  2P84 A;  2KT1 A;  1YI2 T;  2RB6 A;  2P0Q A;  3L2U A;  2EYY A;  2Y4Y A;  1VQN T;  1G8X A;  2RQT A;  2YLC A;  2LJ3 A;  3QSU A;  3KBG A;  4M78 D;  4QVZ A;  2FZK B;  1G3T A;  5FU6 B;  5CQY A;  1PCX A;  4RCC A;  2ZCF B;  2LX9 A;  1FXX A;  1KC8 R;  2XU8 A;  4GLK A;  1VYU A;  3LLR A;  2DEQ A;  1YIT T;  2NYS A;  1GBR A;  2EKH A;  4PL6 A;  1IO6 A;  1M90 C;  5J26 A;  2E1H A;  1OEB A;  1TXQ A;  1Q81 C;  4A53 A;  3CME Q;  3PIO A;  2C06 A;  3H6Z A;  1UEC A;  1M1G A;  3OA6 A;  2RK2 A;  1YJN Q;  4ATO A;  4M4Z A;  2LZ6 B;  3SDZ A;  4RKU E;  3QYG B;  1K1Z A;  3TU4 K;  3GF5 A;  1YJ9 T;  1U8R A;  4OML A;  5KE2 A;  4QQG A;  2XI9 A;  2DER A;  4M75 F;  1NZ9 A;  1KQS S;  5HY6 A;  3MEW A;  5CIU A;  3QBY A;  4HCB A;  1PNJ A;  2O9S A;  5LJ3 h;  2HQX A;  1YJ9 Q;  1MMN A;  2DD4 A;  2CP6 A;  2DRM A;  3CCE A;  3CCM A;  2OTL Q;  3E2U A;  1M1K R;  4B9W A;  2K4Y A;  2CS7 A;  2VAS A;  2RD1 A;  1SRM A;  2CSI A;  1N5Z A;  5CKE A;  1UEB A;  2EYW A;  4LD6 A;  1UFF A;  3S3O A;  1KQ2 A;  4LDW A;  2X4Y A;  2XDB A;  2JM9 A;  4C92 F;  1OV3 A;  2QG9 B;  1QVG P;  2KK4 A;  2MAM A;  1C6V X;  2K5L A;  1S72 A;  2GTJ A;  4BE2 A;  2CT3 A;  5KCH A;  3CC2 Q;  4GBQ A;  2KXD A;  2BUD A;  4PJO B;  3MPU B;  2RMO A;  1TTH B;  5KYY A;  3EG3 A;  2CUD A;  1NYF A;  4HCZ A;  3V8L A;  3EHQ A;  4M75 G;  2F2X A;  3CCR Q;  2YDL A;  2QEX Q;  1K76 A;  4JDS A;  4RTV A;  4M77 F;  2RJC A;  2RF0 A;  4HCC A;  5AT1 B;  4PJO D;  1KFZ A;  1M1F A;  2C0T A;  2LNH B;  3I55 Q;  1H64 1;  2LT1 A;  3JCM g;  1CKB A;  2YRC A;  2M9U A;  3HHT B;  3E1S A;  4D6W A;  3H0H A;  5CKH A;  4CRI A;  4E47 A;  1OZ3 A;  5GAM e;  4M7A E;  1PSE A;  5GAN 3;  2VC8 A;  4E2F B;  3JCM b;  1BYM A;  4PLL A;  2EQK A;  3VUZ A;  5LJ3 f;  2CH4 A;  4Z8A A;  2L2P A;  3QDF A;  4AFS C;  2DYB A;  3CCL A;  2QA4 T;  3CQT A;  5CQX A;  4CC3 A;  4MML A;  4C8Q C;  1X27 A;  3CC7 Q;  3QWY A;  3H8Z A;  1AEY A;  2V8I A;  5GAN e;  4EPC A;  3JCM W;  4Z89 A;  2QA4 A;  4FYX B;  4Z02 A;  5DY9 A;  2M0O A;  2JJ9 A;  2DLP A;  3P8B B;  4EDU A;  2QXF A;  3JB9 D;  1I5O B;  4AFZ C;  2DTO A;  1LCK A;  1AZG B;  1KQ1 A;  2K2V A;  1VOM A;  2W10 A;  4DEY A;  2YRD A;  1SF9 A;  2YUO A;  4FYY B;  2AKK A;  3LWI A;  4KUI A;  1M1K U;  1X6B A;  3R6N A;  2AZV A;  2FG0 A;  1ABQ A;  3KFV A;  1WHM A;  4MDW A;  2KAF A;  1FMK A;  2MWO A;  2F2W A;  1MMG A;  1NPP A;  2KNB B;  5FRO A;  3OYL A;  1ARK A;  4QVD A;  2RK1 A;  1LPL A;  5IHI A;  2OAW A;  4OF1 A;  1UGR B;  1YHQ T;  4EMK C;  3VS2 A;  2DBK A;  4CI0 C;  4RTU A;  1VQO A;  4IIO A;  2JN0 A;  1XQH A;  2X4J A;  1YWO A;  1UHC A;  3EG2 A;  3GBQ A;  3MET A;  4NL3 A;  5KYX B;  1GFC A;  4LDX A;  3L2Q A;  1R8O B;  4MDX A;  5LJ3 g;  2HSP A;  1UG1 A;  4JZ3 A;  4LD9 K;  3JV3 A;  2KQW A;  3E19 A;  3M0R A;  2RHX A;  3CBO A;  4LN2 A;  5KYW B;  4ZNX A;  4R56 A;  3VKI A;  3S3M A;  3CC4 A;  4GY5 A;  4M7A B;  1SG5 A;  2YUP A;  1VQP Q;  2EQI A;  4J7F A;  2DK3 A;  2DTI A;  1RAB B;  1YJW Q;  2EYQ A;  1OU8 A;  2ECZ A;  3R6O A;  1ZA1 B;  4J5Y A;  1K9M R;  4HCK A;  2O2O A;  4ELY C;  1YIJ Q;  4DOV A;  4L6V 5;  1LNX A;  4JJN K;  5GAO n;  3N5B B;  1D09 B;  3EGD A;  4M7D A;  2RQV A;  4Y91 A;  3UA6 A;  3OY9 A;  1JEG A;  4XU0 A;  2QQS A;  3I5R A;  2BE9 B;  1NBE B;  2E6N A;  3X20 B;  4TVR A;  1M1K C;  2KRM A;  5HKC A;  5GMK j;  1ZUU A;  3OYM A;  1YJN A;  1VA7 A;  1X2K A;  1RAC B;  3GLX A;  2DXC A;  1W2B S;  3VJP A;  2ZPI B;  1ZLM A;  5KE3 A;  2DBM A;  2PU9 B;  2CUB A;  3EGX A;  4DA4 A;  2SRC A;  4M77 E;  3X25 B;  3JCM J;  2FB7 A;  2WSE E;  3CCQ Q;  2E12 A;  1OUL A;  2J6K A;  5KYY B;  2X51 A;  4IUU A;  3CC2 A;  4RTY A;  1PC0 A;  1M3B A;  3CCM Q;  2OTL A;  3CCE Q;  1K8A U;  1M27 C;  4OGC A;  1HYO A;  2RJE A;  4C0D B;  3HPW A;  2EBP A;  1NEG A;  1AD5 A;  1SSH A;  1VQ7 Q;  1GL5 A;  2OX7 A;  1D3B A;  2QEX T;  1BB9 A;  3M0S A;  5CKD A;  1JJ2 S;  3GNF B;  1U1T A;  2JS2 A;  2V26 A;  1T0J A;  3M4Y A;  2K3Y A;  1YNZ A;  5EC7 A;  2DIQ A;  5GAN f;  2DL8 A;  4XTV A;  1WDX A;  3M56 A;  1NPR A;  4KGX B;  2FPD A;  3JB9 J;  3G4S Q;  1HJD A;  2ABL A;  2XIC A;  2D0Q B;  2RPN A;  1JJ2 P;  4C8Q F;  1I5L A;  2A7Y A;  1W2B A;  2JS0 A;  1B7T A;  4J6Y A;  4LDY A;  5D6W A;  3HRU A;  5GAO p;  2DFU A;  2QTX A;  4QQ6 A;  2ZGW A;  2PUO B;  1IGQ A;  2HD0 A;  3OBY A;  4M78 E;  1VIF A;  5IXB A;  4M77 D;  5LJ5 e;  2OTL T;  3G7Z A;  2BZ8 A;  2QTV A;  4RG8 A;  5IHN A;  3JCM X;  1BIB A;  4RUG A;  4JRI A;  4E6R A;  1JB0 E;  2BTT A;  1UJ0 A;  1G3Y A;  1ACM B;  1QKW A;  2QGF B;  4X1V A;  4MMK A;  1YIT A;  2L3P A;  1BKB A;  3L1A A;  1M5Q 1;  1ABO A;  1M2V B;  3BDL A;  2O4X B;  1YIJ A;  4F7U B;  1PKT A;  5FW9 A;  1YJN T;  2E70 A;  1M8M A;  2ED0 A;  3QYH B;  3FC3 A;  1BCO A;  4F7U F;  1LJO A;  2RJF A;  3MKD A;  2RHY A;  4FM4 B;  4C0G A;  5KYN A;  4N4H A;  3JCM d;  3OS2 A;  1B3Q A;  2J6F A;  5D6Y A;  1ZA2 B;  4II1 A;  4BE1 A;  4PK4 A;  1D0Y A;  4J9E A;  3CCS T;  1M8V A;  1V1C A;  1QCF A;  2MOX A;  3PE0 A;  5LJ5 g;  1I0C A;  4N0A C;  1TH7 A;  4E7S A;  1AWJ A;  1WIE A;  5EG2 A;  2QK0 A;  3JRZ A;  3VYH B;  3OYF A;  4ORZ A;  1VQO Q;  1YI2 A;  3TVT A;  2KE9 A;  1NYG A;  2KVQ G;  2RJD A;  3G6E Q;  2P4T A;  3OYK A;  5L23 A;  2OI3 A;  3A8H B;  1D3B B;  4FYW B;  2CP7 A;  4CC7 A;  3ME9 A;  2MCN A;  2O88 A;  2DXT A;  1T0H A;  2Y4X A;  2E3I A;  4BDY A;  4QQD A;  4EMG A;  5I21 A;  1K0X A;  1TSF A;  4DBF A;  1VQO T;  1C0M A;  4HT8 A;  1WJR A;  4JJB A;  2ROT A;  2QDL A;  5LJ5 h;  4X9D A;  4C8Q D;  4HVW A;  5KYW A;  4ZN1 A;  3JCM V;  1WQ7 A;  1KJW A;  2H3J A;  2LVM A;  1S72 T;  1RLQ C;  3LGF A;  4AT1 B;  2DA9 A;  3QDR B;  1K9M C;  4F17 A;  2PVO B;  2HEQ A;  4JS4 A;  3OYI A;  5GAN 2;  4PJO G;  3EG9 B;  7AT1 B;  1ZUY A;  2HL5 C;  3G4S T;  3L42 A;  2YRV A;  2JTE A;  1WHL A;  3V7R A;  4M7D B;  3OYD A;  2FEI A;  3EGD B;  3EG9 A;  4LNP A;  1VUB A;  1W1F A;  3C0C A;  3PMI A;  3RUX A;  1KD1 C;  1XJW B;  3CCL T;  3UT1 A;  4D8D A;  3G4S A;  2ESW A;  4JJD A;  4QKU A;  1KC8 U;  2K57 A;  2VXF A;  3ZBD A;  1M4Z A;  3M4G A;  4PKC C;  1M9S A;  1ZHI A;  2EQU A;  2MF2 A;  1SRL A;  2FZG B;  4NOY A;  1Q86 U;  3CD6 T;  2C0O A;  4BDZ A;  2JMA A;  2M51 A;  3JSC A;  1XNI A;  3LH5 A;  3QKJ A;  2KRO A;  2DNU A;  1RAH B;  4M75 C;  3OQ5 A;  2D0N A;  3CCR T;  3E9F A;  2KYB A;  3REA B;  2LC4 A;  3VS3 A;  1Y71 A;  4ESR A;  3MEV A;  1D1B A;  4IKF A;  2DX1 A;  5GAM j;  5A2Q E;  1WHK A;  2GQV A;  4OMQ A;  3ZL7 C;  3A8L B;  1NJI U;  3CC2 T;  2FL7 A;  1PSF A;  1VYT A;  4IUV A;  3J7A F;  1J3T A;  3I56 Q;  1U1S A;  1YI2 Q;  3G71 A;  1VQK Q;  5GMK h;  4BE0 A;  3C95 A;  1WA7 A;  3RER A;  2HCK A;  4PJM A;  2DL4 A;  2DE0 X;  2F5T X;  2O4X A;  2QA4 Q;  1SSF A;  3V7C A;  2C0I A;  3CMA T;  1OZ2 A;  1U3O A;  1EFN A;  1VQ7 T;  2E64 A;  1LOJ A;  1WQW A;  1VQ8 A;  1H92 A;  5GAO m;  1UTI A;  2COZ A;  1NM7 A;  1WFW A;  4C8Q G;  4E7Z A;  1K4U S;  1AVZ C;  4M77 G;  1UGS B;  2EYZ A;  5CAI A;  1K0S A;  2HKN A;  2HNI A;  4DBQ A;  1QP3 A;  1Q7Y R;  3AHU A;  2AT1 B;  4M78 B;  3QJ6 A;  2BKD N;  2RHU A;  1F1B B;  4C0D C;  3M0T A;  3CPW P;  4Y92 A;  2E4H A;  5FWC A;  4M7D D;  1M30 A;  3OYH A;  4OMF B;  4C0F A;  4OMO A;  2YT6 A;  4M75 E;  1Q82 C;  3QG1 A;  8ATC B;  1RL2 A;  2DD5 A;  3I56 A;  2GFA A;  2V1Q A;  1NJI R;  3X26 B;  3OYY A;  2D6F A;  3CME T;  1GFD A;  1N8R R;  4C92 D;  3OS0 A;  1YHQ Q;  1TS9 A;  5GMK e;  2ZPH B;  2D1X A;  5FU7 C;  4PJO C;  3TSW A;  2GQI A;  1VQ7 A;  2K5I A;  3M57 A;  3CCQ T;  5FWB A;  3CCJ T;  4XU3 A;  4C5I A;  1YIT Q;  1UHF A;  3AT1 B;  4M78 F;  3BFM A;  2COY A;  2LNV A;  3A8M B;  4PNO A;  1WHG A;  2GBQ A;  2VB6 A;  3UPU A;  3CCJ Q;  3MJX A;  4BD3 A;  2K3X A;  2X3W D;  2ZPB B;  3VU3 C;  3FJP A;  3I55 A;  9ATC B;  4WCI A;  1MNE A;  3NTK A;  1XOV A;  4J83 A;  3JCM h;  1LVK A;  2G3R A;  1VQN Q;  2R5M A;  2XDP A;  1Y07 A;  2GTO A;  2COW A;  2DL3 A;  4OP0 A;  4YTL A;  2K79 A;  3C4S A;  1UJY A;  1TOV A;  1Q7Y C;  1MND A;  1FYN A;  1VQK A;  4NL2 A;  4JLI A;  4KUL A;  2DIG A;  4F7U G;  4C92 B;  2LJ1 A;  1WXT A;  3BDU A;  2EWN A;  3CCV A;  2LT4 A;  4LXC A;  3PVQ A;  2MWP A;  2DMO A;  1UB4 A;  2RHI A;  3EAE A;  4GLM A;  2XHC A;  2I0N A;  3RKW A;  2PNI A;  3HSB A;  1RAE B;  4RG2 A;  4FW1 A;  5J3B A;  2JNG A;  2E10 A;  4B6M A;  1VQM T;  4DEX A;  2ROL A;  1UGV A;  3KXT A;  1C1A A;  1WXB A;  1WYX A;  1QCN A;  1NJI C;  4A4H A;  1GCQ A;  4KBM B;  3UWN A;  3LX7 A;  3INZ A;  5GAN 7;  3PMT A;  3OS1 A;  1Q82 R;  1RAG B;  4MZM A;  1VQ9 T;  2B8A A;  3JB9 F;  4OMP A;  2DRK A;  2FRY A;  4C5G A;  2DTH A;  2DVE A;  2NUP A;  5KYX A;  2A0F B;  1YIJ T;  5DM7 R;  3MEA A;  2DJZ A;  1WHJ A;  3LW5 E;  4F16 A;  1Q7Y U;  1ZUK A;  1G83 A;  4LDV A;  1R0B G;  4M78 C;  4FSS A;  4EMH A;  2JM8 A;  4XAX B;  1WHH A;  2JT4 A;  4PJO E;  1I07 A;  4OMM A;  2VGN A;  1WZO A;  4BI3 A;  4BB7 A;  5CKB A;  5GMK i;  3JCM e;  1HSQ A;  3ER0 A;  4Q5W A;  2R58 A;  1OPL A;  3EG1 A;  1FMW A;  2Z0W A;  2LCS A;  2K6D A;  1O9S A;  1EZZ B;  3OYN A;  2CP2 A;  3M58 A;  4OGE A;  3EFO A;  4A4E A;  5LJ5 f;  5DLO A;  1OPK A;  4WTO B;  5D6X A;  2QDY B;  4LUD A;  1ZQ1 A;  1WXU A;  4KT0 E;  3CPW S;  2HQH A;  2PQW A;  2RHZ A;  2RH2 A;  1D1C A;  2L89 A;  2RQW A;  2JW4 A;  5IXF A;  4XTZ A;  3JCM Q;  4BY6 B;  3A98 A;  3QHS A;  3MCA B;  2KY9 A;  3HFO A;  1ZBJ A;  2YSQ A;  1G5V A;  3LYI A;  2RI3 A;  1JJ2 A;  2MI6 A;  2CP3 A;  3OW2 P;  2WAC A;  1RAF B;  3CCU Q;  3LGL A;  1WI7 A;  3VS6 A;  5FLX E;  1H3Z A;  2GF7 A;  2H3E B;  1AWX A;  1NLP C;  2DKG A;  4M7A A;  1T3L A;  1HK9 A;  1QVG A;  1U5S A;  4XU1 A;  1VQL Q;  2CSQ A;  2FPE A;  2KR3 A;  1BBZ A;  3FRN A;  3DKM A;  3TRE A;  2CZ7 B;  5I11 A;  1R77 A;  3UA7 A;  2K3B A;  2YUQ A;  2V8J A;  4QW2 A;  1UGP B;  2QQ9 A;  2JXB A;  1KD1 U;  3I55 T;  2EAY A;  1AWO A;  5IAY A;  3EFO B;  1RUW A;  5IHK A;  4VUB A;  1H3H A;  3DB4 A;  1K8A R;  3MP1 A;  2SEM A;  4XTU A;  3M0U A;  2D9T A;  3OBW A;  2LRQ A;  4RTZ A;  2O01 E;  2OTJ Q;  4ELZ C;  4RTT A;  3G6E T;  1SPK A;  5CO7 A;  4HXJ A;  1N8R C;  4BI4 A;  4M75 B;  4M7A C;  2MK5 A;  2EJF A;  3PIP A;  2WSC E;  4FT4 A;  4PJO A;  4F7U A;  1TU0 B;  1HD3 A;  1YCS B;  2YWW A;  1M2O A;  2OTJ A;  2MIO A;  3M5A A;  3GPL A;  2VWF A;  3CPF A;  1GCQ C;  3P8D A;  2MMP A;  2RI2 A;  1UGQ B;  2D8H A;  3QUI A;  1V76 A;  2L0A A;  3VS0 A;  5DLQ E;  4J8O A;  4IUT A;  2FZC B;  3RMS A;  2CZ6 B;  5GAN 5;  5CVI A;  4M7D E;  4M78 G;  4MZT A;  3VV0 A;  1N9R A;  3O8V A;  1K8A C;  1JXM A;  2X3X D;  4D8K A;  4ZTF A;  1S1N A;  3C12 A;  2VV5 A;  2MPX C;  4M77 B;  1VQ4 T;  5ECA A;  4OB3 B;  4E7J A;  3JCM c;  1IHV A;  2HKQ B;  2GNC A;  5I22 A;  1E6G A;  2P0K A;  4J9G A;  4XTY A;  3OMC A;  4E7K A;  3J81 E;  5GAN 8;  3QXE B;  1G2B A;  1X69 A;  3A8O B;  1M3C A;  5GAN 6;  4O6J A;  2JMC A;  1N6A A;  1Q95 G;  8AT1 B;  3QZ5 B;  2HAX A;  3M9Q A;  3X28 B;  1K73 C;  4IUP A;  1BIA A;  4HKE A;  2NUP B;  2DYI A;  5FU7 B;  1D1A A;  3VS5 A;  2YLB A;  5FU6 C;  2BE7 D;  1PG5 B;  2EGC A;  1OI1 A;  4OB1 B;  1KIK A;  1TWB A;  4RTW A;  3EFR A;  2IIM A;  2M16 A;  5HK0 A;  3BY7 A;  3CCU A;  2JUF A;  2M0Y A;  4OB0 B;  1NLO C;  4ZGJ B;  1W70 A;  2CKK A;  1X75 C;  3OMG A;  3MO8 A;  2F2V A;  4A4K A;  2X35 A;  2QAS A;  1UDL A;  1K73 R;  4PFO A;  6AT1 B;  2O9V A;  5AYF A;  3OYE A;  3CD6 Q;  4KH0 B;  2K7A A;  4BUG A;  2KEA A;  2DF6 A;  2A08 A;  2KT8 A;  4KGV B;  5A0L A;  1QWE A;  2E65 A;  2PVG B;  1MV0 B;  3OW2 A;  1RAD B;  3SB2 A;  3PT9 A;  4C92 A;  4QVC A;  4F7U E;  1O75 A;  4CC2 A;  1KD1 R;  3CBM A;  3CCL Q;  2RN8 A;  1T3S A;  3FJ5 A;  2HSE B;  1M2V A;  2W0Z A;  4M7D F;  3PGG A;  1YCY A;  1PKS A;  3G6E A;  1YFN A;  2J06 A;  2R57 A;  1JRI A;  1V29 B;  3FLG A;  2LP5 A;  1E7O A;  3FIF A;  4J9B A;  1IXD A;  2EQJ A;  1RI0 A;  4M7A G;  2GCX A;  2HMA A;  4Z88 A;  3CC7 A;  2VKN A;  1EIF A;  3PNW C;  3S6W A;  4PFZ A;  3X24 B;  1D0Z A;  1N27 A;  2KGT A;  2KXC A;  5FRN A;  4E7H A;  5GAN d;  4JJC A;  3TCJ A;  1B07 A;  3LWH A;  2QQR A;  3L2V A;  1VQ4 Q;  2BZX A;  2DL7 A;  2Y90 A;  3H9N A;  1IRE B;  3UF4 A;  1QVF A;  3UAT A;  3ULR B;  2F69 A;  3S3N A;  5GAM g;  4V2S A;  1Y96 B;  2NUT B;  2EGA A;  4AG2 C;  4PJJ A;  4OB2 B;  4M77 C;  5GJW B;  2ED1 A;  4PJO F;  2VVK A;  4R55 A;  1W6X A;  2JTM A;  1YJW A;  3CCV T;  3NPF A;  5GAM d;  1IGU A;  1W2B P;  3CMA Q;  1ZSZ C;  1VQ4 A;  1WX6 A;  2EJ9 A;  2ENM A;  2KDS A;  4DBR A;  4Y28 E;  1VQK T;  1MMD A;  3V7S A;  2B86 A;  2QYZ A;  5GAN j;  4M78 A;  3CCV Q;  4KUD K;  2A37 A;  2CP0 A;  2HZY A;  4F04 B;  4J9D A;  3CCQ A;  3G71 Q;  2J7I A;  2IVW A;  4UC4 A;  1Y0M A;  2KMT A;  2CGH A;  4JLG A;  2MYS A;  3SD4 A;  2F5K A;  4J9I A;  4MZP A;  4FSX A;  3JAM E;  2VUB A;  3EGX B;  3TSZ A;  3WXM B;  1YJW T;  3I35 A;  1FWZ A;  1BI1 A;  4LE9 A;  1QVP A;  3T9N A;  1VQ8 Q;  3Q1J A;  4ME7 A;  3CXC S;  5C0M A;  2XID A;  5CR2 A;  1VQL A;  3RNJ A;  3L2R A;  4HVU A;  2DZC A;  1SEM A;  2QQA A;  1VQ6 Q;  4C5E A;  4BY6 C;  1NEB A;  4ZGD B;  2EQM A;  3SWN B;  4ZTJ A;  4JZ4 A;  1I81 A;  1IHW A;  2DXU A;  2PZ1 A;  3VS7 A;  3EGU A;  3CCJ A;  1X01 A;  5L8R E;  1OYX A;  2L8D A;  2CRE A;  1CKA A;  2DJQ A;  4K11 A;  2ZPE B;  2E6Z A;  2HBW A;  5FRM A;  3A1P A;  3SFM A;  2YXY A;  5IN1 A;  2V1R A;  1NE8 A;  1VQ8 T;  2OTJ T;  2O31 A;  2EPD A;  3OYA A;  3RIR A;  3NTI A;  1PM3 A;  3H0I A;  3RR6 A;  4RMO A;  3G1J A;  3BE3 A;  2XG8 D;  3D7S B;  4C92 E;  4J9C A;  2E5Q A;  3UDC A;  3URG A;  2EW3 A;  4EMK A;  2NWM A;  1VQL T;  1VQ5 Q;  5GAO q;  3OYC A;  1KHC A;  2PTK A;  3FB9 A;  1M3A A;  3M59 A;  2DL5 A;  2XK0 A;  1IRX A;  2KI7 A;  1CSK A;  5GAO r;  1SHG A;  1QCO A;  1R0C B;  1K73 U;  2X9H A;  3HFN A;  3PTA A;  3SWN A;  3RES A;  5A0G A;  4BAC A;  3F70 A;  4HT9 A;  4N0A A;  3QWX X;  4R0K A;  2FO0 A;  2L3Q A;  2I2L A;  3CCM T;  3CCE T;  3RBB B;  1OX8 A;  2L3S A;  3MEU A;  3CPW A;  1OX9 A;  1VYV A;  1OQK A;  2BIV A;  2G6F X;  2L5Q A;  5GJV B;  2X4W A;  3NMZ C;  2CH4 W;  1FMV A;  3I5S A;  4KH1 B;  3A5Z B;  4ANJ A;  4FW2 A;  1M90 U;  2LDM A;  3CCR A;  3J80 E;  1ZSZ B;  5GMK m;  1VQP A;  1WJS A;  1BI3 A;  2P0P A;  4QT7 A;  3ZEH A;  1ZSG A;  2F1L A;  1W4S A;  2OAU A;  2DET A;  1RAI B;  2EGE A;  3DLL A;  4J6X A;  4DOW A;  2XKO C;  1BK2 A;  2LMJ A;  1BU1 A;  2LJ0 A;  1G3W A;  4AFQ C;  2KRS A;  1BCM A;  1PRM C;  1X43 A;  3WVE B;  5IH2 A;  2EVR A;  5LJ3 d;  2A28 A;  1KSW A;  1N8R U;  2HQE A;  1Y7X A;  4FT2 A;  2WSF E;  5GAO l;  2D8J A;  5LL6 S;  5GAM h;  3EHR A;  2CP5 A;  3QII A;  1I4K 1;  1YJ9 A;  4N4G A;  5KYU A;  3M55 A;  4C8Q A;  4FU6 A;  4P5N A;  1OOT A;  1TUD A;  3RKX A;  3QJY A;  2EFI A;  1D0X A;  1OU9 A;  1Q82 U;  4XTX A;  5M9O A;  1HXD A;  2ZZD A;  5HK3 A;  1YWP A;  1QVF P;  2GFU A;  4C92 C;  5LJ3 e;  1VQP T;  4F14 A;  2ZPG B;  4NS5 A;  4C92 G;  4IUQ A;  2DXB A;  1YBY A;  2LQ8 A;  3CBP A;  2P4R A;  1JO8 A;  3REB B;  1JU5 C;  1JQQ A;  2A3L A;  2LCL A;  3FEO A;  2JOY A;  4JRP A;  4M7D G;  4XTW A;  3VS4 A;  3H41 A;  1QVF S;  3HKS A;  4E7L A;  4WF2 A;  1VQ9 A;  1VQN A;  4M7D C;  2AKL A;  2DO3 A;  3CMA A;  3OW2 S;  2FPF A;  2FVU A;  2J05 A;  2H8H A;  1KQS P;  2YUN A;  2KYM A;  4L59 A;  3OYG A;  4A54 A;  3VRY A;  4J9H A;  2FYK A;  4PJN A;  2DPP B;  2KSS A;  3JCM P;  4KRT A;  1Y96 A;  1SHF A;  2M02 A;  2KRN A;  1AHJ B;  3EH2 A;  2CZ0 B;  2LTO A;  2VGM A;  4A4G A;  5C6S A;  3MP8 A;  2XD0 A;  4J7I A; 
#chains in the Genus database with same CATH homology
 3OS1 A;  4PKC C;  1M9S A;  1MGQ A;  4X9C A;  1ZHI A;  2RA2 A;  2QA4 T;  3CCL A;  2EQU A;  2FHD A;  2MF2 A;  3QZ5 B;  3M9Q A;  5CQX A;  4NOY A;  3X28 B;  5LJ3 j;  1Q86 U;  2HAX A;  2EJG A;  2IG0 A;  3CD6 T;  4BDZ A;  1K73 C;  4IUP A;  1BIA A;  4HKE A;  4MML A;  3JSC A;  4C8Q C;  1XNI A;  4M7A D;  3LH0 A;  3QKJ A;  3H8Z A;  4XU2 A;  4XQ3 A;  4C8Q E;  5FU7 B;  2V8I A;  5GAN e;  4EPC A;  3OYB A;  2YLB A;  3JCM W;  4M75 C;  5FU6 C;  3OQ5 A;  2XDD A;  3CEY A;  2QA4 A;  5GAN 4;  3CCR T;  3E9F A;  1WGS A;  4Z02 A;  2E41 A;  5DY9 A;  1OI1 A;  2LC4 A;  4OB1 B;  3V8K A;  2M0O A;  2PUK B;  4B9X A;  1Y71 A;  3EFR A;  2M16 A;  5HK0 A;  3MEV A;  4IKF A;  5KH6 A;  3BY7 A;  3CCU A;  2JUF A;  5I2S A;  3P8B B;  4EDU A;  5GAM j;  2RM4 A;  4L5G A;  5A2Q E;  4OB0 B;  2QXF A;  3QPH A;  5I2M A;  4ZGJ B;  2CKK A;  3JB9 D;  3L2Z A;  1X75 C;  2GQV A;  2DTO A;  3A8L B;  3OMG A;  2NLU A;  3WVD B;  1NJI U;  3CC2 T;  1KQ1 A;  1N9S A;  1PSF A;  2FL7 A;  2K2V A;  3C94 A;  3MO8 A;  4IUV A;  3J7A F;  4A4K A;  1U1S A;  2X35 A;  3NFC A;  3G71 A;  3A8G B;  3LWI A;  4KUI A;  1M1K U;  1WNL A;  5GMK h;  1DJ7 B;  3BW1 A;  3C95 A;  4BE0 A;  3DB3 A;  4RCB A;  5GAN h;  3RER A;  3I56 T;  3E9G A;  1FX7 A;  5AYF A;  1KQS A;  3OYE A;  2F5T X;  4ZGE B;  4LDU A;  4MDW A;  2O4X A;  3ZFJ A;  1SSF A;  2KAF A;  1B34 B;  3V7C A;  2M1H A;  2MWO A;  4BUG A;  3CMA T;  1BI0 A;  2ZPF B;  1OZ2 A;  1VQ7 T;  1VQ6 T;  2E64 A;  1LOJ A;  1WQW A;  1VQ8 A;  1I8F A;  4M75 A;  5A0L A;  5GAO m;  1NPP A;  4N4I A;  2E65 A;  2PVG B;  3OW2 A;  5FRO A;  4C8Q G;  2RO0 A;  3SB2 A;  3PT9 A;  4C92 A;  4QVC A;  3OYL A;  4F7U E;  1VQ5 A;  1O75 A;  3CBM A;  4QVD A;  2RK1 A;  4OF1 A;  1UGR B;  1UGS B;  4M77 G;  5CAI A;  1YHQ T;  3VUB A;  2HNI A;  2LCC A;  4EMK C;  1QP3 A;  5CK9 A;  2JTF A;  4M7D F;  1VQO A;  2LQK A;  4CI0 C;  3EFS A;  3AHU A;  3PGG A;  3RMQ A;  2JN0 A;  1XQH A;  1YCY A;  2X4J A;  4M78 B;  4X34 A;  3QJ6 A;  2BKD N;  2RHU A;  1QP2 A;  1WJQ A;  3TEE A;  2X4X A;  4C8Q B;  3G6E A;  3L2W A;  2R57 A;  2PVD B;  1JRI A;  1V29 B;  3FLG A;  4C0D C;  3MET A;  1X6O A;  4O6J A;  4NL3 A;  3FIF A;  2EQJ A;  4LDX A;  1RI0 A;  5CCA A;  3L2Q A;  3CCU T;  4M7D D;  1R8O B;  4MDX A;  3OYH A;  4M7A G;  2GCX A;  4OMF B;  4C0F A;  3SWN C;  5J39 A;  3CC7 A;  5LJ3 g;  1EIF A;  3PNW C;  3S6W A;  4M75 E;  1Q82 C;  3X24 B;  4LD9 K;  2R5A A;  2KQW A;  3E19 A;  3QG1 A;  1RL2 A;  1VIE A;  1N27 A;  1BI2 A;  2DD5 A;  2RHX A;  3CBO A;  4J6W A;  2GFA A;  4R56 A;  3VKI A;  3I56 A;  3S3M A;  3CC4 A;  1Q86 C;  5FRN A;  3X26 B;  4E7H A;  4GY5 A;  4M7A B;  1VQ5 T;  5GAN d;  3OYY A;  2D6F A;  3TCJ A;  3CME T;  1VQM A;  4JUV A;  3LWH A;  2QQR A;  3L2V A;  4C92 D;  1Q81 U;  3OS0 A;  4J7F A;  2DK3 A;  5GMK e;  2DTI A;  2Y90 A;  2DAQ A;  2ZPH B;  3HRT A;  5GMK l;  3CXC A;  1IRE B;  2EYQ A;  5LJ5 d;  5FU7 C;  4PJO C;  1QVF A;  1VQ7 A;  1VQ6 A;  3R6O A;  2K5I A;  4J5Y A;  3M57 A;  2F69 A;  3S3N A;  5GAM g;  4BI8 B;  3CCQ T;  4V2S A;  1Y96 B;  3CCJ T;  4ELY C;  3OSV A;  4XU3 A;  4C5I A;  4DOV A;  4L6V 5;  1LNX A;  4OB2 B;  4M77 C;  4JJN K;  1WPY A;  5GAO n;  3FDR A;  3BFM A;  3N5B B;  4M78 F;  4PJO F;  4R55 A;  2LNV A;  3A8M B;  4M77 A;  4PNO A;  2JTM A;  1YJW A;  3CCV T;  4M7D A;  3UPU A;  2JZ2 A;  4C0Z A;  1GXI E;  4Y91 A;  4BD3 A;  2K3X A;  1G3S A;  4XU0 A;  3OY9 A;  3MHX A;  3MP6 A;  2QQS A;  2ZPB B;  5GAM d;  3VU3 C;  3GOX A;  3FJP A;  2E6N A;  1MHN A;  3X20 B;  3I55 A;  3JCM f;  4TVR A;  3NTK A;  1VQ4 A;  1XOV A;  4J83 A;  3JCM h;  3GP8 A;  1M1K C;  2EJ9 A;  1XTD A;  2G3R A;  2KDS A;  4Y28 E;  5HKC A;  1K9M U;  1VQK T;  5GMK j;  4OVA A;  3V7S A;  2R5M A;  1P92 A;  3OYJ A;  3GIB A;  2XDP A;  5GAN j;  4M78 A;  3OYM A;  1Y07 A;  1YJN A;  4KUD K;  3KUF A;  4FIB A;  1ZBX A;  4JRK A;  1QVG S;  4OP0 A;  2QQB A;  3GLX A;  4YTL A;  1B34 A;  3CCQ A;  2DXC A;  3C4S A;  1W2B S;  2QI2 A;  3VJP A;  1Q7Y C;  2ZPI B;  2IVW A;  3OB9 A;  5KE3 A;  4UC4 A;  2KMT A;  2PU9 B;  2CGH A;  4JLG A;  4JLI A;  4NL2 A;  1VQK A;  4KUL A;  3SD4 A;  2F5K A;  4MZP A;  2V8K A;  2DIG A;  4FSX A;  2VXE A;  3PFS A;  4M75 D;  4F7U G;  4JRQ A;  2DZ9 A;  5IT9 E;  3JAM E;  2VUB A;  3CD6 A;  4DA4 A;  3DLM A;  3WXM B;  4C92 B;  1YJW T;  4C5H A;  1FWZ A;  2VYT A;  1BI1 A;  4M77 E;  3X25 B;  3BDU A;  2EWN A;  3JCM J;  3HP9 A;  2FB7 A;  2WSE E;  5A0D A;  3CCV A;  1QW1 A;  2LT4 A;  2E12 A;  3V8J A;  1QVP A;  3T9N A;  3Q1J A;  4ME7 A;  3ASK A;  4IUU A;  3CC2 A;  2MWP A;  4EMK B;  3CXC S;  5C0M A;  1UB4 A;  2RHI A;  3EAE A;  2XID A;  5CR2 A;  1VQL A;  2OTL A;  3L2R A;  4HA8 A;  1K8A U;  2XHC A;  3RKW A;  2DZC A;  4OGC A;  3HSB A;  4RG2 A;  2RJE A;  2QQA A;  3HPW A;  4C0D B;  1KC8 C;  3GNG A;  5J3B A;  4C5E A;  1D3B A;  2JNG A;  4BY6 C;  2E10 A;  2HBP A;  2CZ1 B;  2RI5 A;  2QEX T;  4ZGD B;  3CME A;  1VQM T;  4M7A F;  2EQM A;  3SWN B;  3KXT A;  4ZTJ A;  3RKY A;  5CKD A;  1JJ2 S;  3GNF B;  1I81 A;  1U1T A;  1NJI C;  3M54 A;  4A4H A;  3G71 T;  2DXU A;  3HL8 A;  3JB9 H;  3M4Y A;  2K3Y A;  4KBM B;  1JBM A;  3UWN A;  3LX7 A;  3INZ A;  5GAN f;  2DIQ A;  1X01 A;  3OSS C;  3PMT A;  4PLI A;  4XTV A;  5L8R E;  5LJ5 j;  4MZM A;  3CCJ A;  1OYX A;  1NPR A;  3M56 A;  2L8D A;  4DQ2 A;  1VQ9 T;  2B8A A;  4JS5 A;  3JB9 F;  3JB9 J;  2ZPE B;  2E6Z A;  5FRM A;  2CYZ B;  2YHT A;  4C5G A;  2DTH A;  2K5F A;  2L3R A;  2XIC A;  3SFM A;  2D0Q B;  5IN1 A;  2DVE A;  2JVV A;  1NE8 A;  3OS5 A;  3QO3 A;  4C8Q F;  1I5L A;  1VQ8 T;  2OTJ T;  3QZ9 B;  2A7Y A;  2EKO A;  3OYA A;  1W2B A;  4IUR A;  3RIR A;  3NTI A;  5DM7 R;  3MEA A;  3CC4 T;  1YIJ T;  2DJZ A;  1Q7Y U;  3LW5 E;  3M53 A;  4RMO A;  4J6Y A;  4LDY A;  5D6W A;  3HRU A;  2AHJ B;  5KCO A;  4LDV A;  2XG8 D;  3VYG A;  4C92 E;  5GAO p;  1KHI A;  2QTX A;  4QQ6 A;  4M78 C;  3JB9 I;  3JB9 G;  2E5Q A;  2PUO B;  2ZGW A;  3UDC A;  2HD0 A;  4EMH A;  2QEX A;  2EIF A;  3OBY A;  3URG A;  3CCS A;  4XAX B;  1YHQ A;  4M78 E;  3P8H A;  4A4F A;  4EMK A;  4PJO E;  5GAM f;  3CC7 T;  1N6A A;  1VIF A;  4M77 D;  2VGN A;  4FL6 A;  5LJ5 e;  1VQL T;  2OTL T;  3G7Z A;  3HRS A;  3NTH A;  4BI3 A;  5CKF A;  4BB7 A;  4ZN3 A;  5CKB A;  4XK8 E;  5GAN g;  4E7I A;  5GMK i;  5GAO q;  3OYC A;  1IZ6 A;  4RG8 A;  3JCM e;  1KHC A;  1KG1 A;  3JCM X;  3FB9 A;  4O5V A;  1BIB A;  3M59 A;  1YI2 T;  2RB6 A;  2P0Q A;  2XK0 A;  3ER0 A;  4JRI A;  4Q5W A;  3L2U A;  2R58 A;  2Y4Y A;  1JB0 E;  1VQN T;  1G3Y A;  5GAO r;  4MMK A;  1YIT A;  2YLC A;  1BKB A;  1O9S A;  3L1A A;  1K73 U;  3OYN A;  3QSU A;  1M5Q 1;  3KBG A;  4M78 D;  4QVZ A;  3HFN A;  3BDL A;  3M58 A;  3PTA A;  1G3T A;  2O4X B;  5FU6 B;  1YIJ A;  4F7U B;  4OGE A;  3SWN A;  3RES A;  4A4E A;  5A0G A;  5LJ5 f;  5CQY A;  4BAC A;  4RCC A;  5DLO A;  3F70 A;  2ZCF B;  4HT9 A;  4N0A A;  5D6X A;  2QDY B;  2LX9 A;  1ZQ1 A;  1FXX A;  2XU8 A;  4GLK A;  2I2L A;  3CCM T;  3CCE T;  4KT0 E;  1YJN T;  3CPW S;  2E70 A;  2PQW A;  2RHZ A;  3LLR A;  2DEQ A;  3MEU A;  3CPW A;  1YIT T;  3QYH B;  3FC3 A;  4PL6 A;  2RH2 A;  4F7U F;  1M90 C;  5J26 A;  1LJO A;  2BIV A;  3M4G A;  2E1H A;  2RJF A;  1Q81 C;  2L5Q A;  2L89 A;  4A53 A;  3PIO A;  2C06 A;  2RHY A;  4XTZ A;  3H6Z A;  2X4W A;  4FM4 B;  4BY6 B;  4C0G A;  3JCM Q;  1M1G A;  3OA6 A;  2RK2 A;  4ATO A;  3QHS A;  3MCA B;  3A5Z B;  4N4H A;  2KY9 A;  3HFO A;  3JCM d;  3SDZ A;  3OS2 A;  4RKU E;  3QYG B;  1M90 U;  2LDM A;  3TU4 K;  5D6Y A;  3CCR A;  1G5V A;  3GF5 A;  3LYI A;  4II1 A;  3J80 E;  4BE1 A;  5GMK m;  2RI3 A;  1VQP A;  1WJS A;  1YJ9 T;  1U8R A;  1BI3 A;  1JJ2 A;  3CCS T;  2MI6 A;  2P0P A;  4QQG A;  2XI9 A;  5KE2 A;  1M8V A;  3ZEH A;  2WAC A;  4M75 F;  1NZ9 A;  1KQS S;  5HY6 A;  5LJ5 g;  3MEW A;  4N0A C;  3LGL A;  5CIU A;  5FLX E;  1H3Z A;  1W4S A;  2OAU A;  1TH7 A;  3QBY A;  4HCB A;  5LJ3 h;  2GF7 A;  5EG2 A;  5GAN 7;  3JRZ A;  2HQX A;  3DLL A;  4J6X A;  3VYH B;  4DOW A;  3OYF A;  2DKG A;  2XKO C;  4M7A A;  1YI2 A;  2DD4 A;  1HK9 A;  1QVG A;  4XU1 A;  1G3W A;  3CCE A;  3CCM A;  3FRN A;  3DKM A;  4B9W A;  3TRE A;  2K4Y A;  2CS7 A;  2CZ7 B;  3WVE B;  2KVQ G;  5LJ3 d;  2RJD A;  2P4T A;  2RD1 A;  2V8J A;  4QW2 A;  3OYK A;  1N8R U;  3A8H B;  1UGP B;  2QQ9 A;  2HQE A;  1Y7X A;  4FT2 A;  1D3B B;  1UEB A;  4LD6 A;  2WSF E;  5CKE A;  5GAO l;  3I55 T;  2EAY A;  1KD1 U;  3S3O A;  1KQ2 A;  3ME9 A;  5LL6 S;  5GAM h;  4LDW A;  3QII A;  5IAY A;  1I4K 1;  2X4Y A;  1YJ9 A;  4N4G A;  2DXT A;  2XDB A;  4VUB A;  3M55 A;  3DB4 A;  4C8Q A;  2Y4X A;  3MP1 A;  4FU6 A;  4P5N A;  4C92 F;  3RKX A;  3QJY A;  4XTU A;  2EFI A;  2D9T A;  4BDY A;  4QQD A;  4EMG A;  1Q82 U;  3OBW A;  4XTX A;  2KK4 A;  5M9O A;  2LRQ A;  5I21 A;  2MAM A;  2O01 E;  1HXD A;  4ELZ C;  3G6E T;  2ZZD A;  1VQO T;  2K5L A;  5HK3 A;  1S72 A;  4HT8 A;  1WJR A;  5CO7 A;  4BE2 A;  1N8R C;  4BI4 A;  2GFU A;  5KCH A;  4C92 C;  4M75 B;  4M7A C;  5LJ3 e;  1VQP T;  5LJ5 h;  2EJF A;  4X9D A;  4C8Q D;  3PIP A;  2WSC E;  2ZPG B;  4ZN1 A;  4FT4 A;  4PJO A;  4NS5 A;  3JCM V;  4C92 G;  4F7U A;  2DXB A;  4IUQ A;  1YBY A;  2LQ8 A;  1WQ7 A;  2H3J A;  3CBP A;  2OTJ A;  2BUD A;  4PJO B;  2LVM A;  3M5A A;  3GPL A;  3CPF A;  2A3L A;  2LCL A;  3FEO A;  1S72 T;  3P8D A;  2MMP A;  2JOY A;  2RI2 A;  4JRP A;  3LGF A;  1UGQ B;  4HCZ A;  4XTW A;  4M7D G;  3V8L A;  4M75 G;  1QVF S;  3QDR B;  3HKS A;  4E7L A;  3QUI A;  4JDS A;  4WF2 A;  1VQ9 A;  4M77 F;  2RJC A;  1K9M C;  4HCC A;  1VQN A;  4M7D C;  2PVO B;  5DLQ E;  4PJO D;  2DO3 A;  4J8O A;  4IUT A;  3RMS A;  2CZ6 B;  3ZBD A;  5GAN 5;  1M1F A;  4JS4 A;  5CVI A;  3CMA A;  3OYI A;  5GAN 2;  4M7D E;  4PJO G;  3OW2 S;  3G4S T;  4M78 G;  2FVU A;  4MZT A;  1H64 1;  3L42 A;  2YRV A;  3VV0 A;  1N9R A;  3O8V A;  2LT1 A;  3JCM g;  1K8A C;  4ZTF A;  3V7R A;  3C12 A;  3OYD A;  2M9U A;  3HHT B;  2VV5 A;  4M7D B;  4M77 B;  3E1S A;  5GAN 6;  1VQ4 T;  4L59 A;  4D6W A;  3OYG A;  1VUB A;  4OB3 B;  4E7J A;  5CKH A;  4A54 A;  4CRI A;  3PMI A;  3RUX A;  4E47 A;  1KD1 C;  1OZ3 A;  3CCL T;  2FYK A;  3JCM c;  2DPP B;  2KSS A;  5GAM e;  3JCM P;  4M7A E;  1PSE A;  3UT1 A;  3G4S A;  2P0K A;  1Y96 A;  4XTY A;  5GAN 3;  3OMC A;  1AHJ B;  4E7K A;  2VC8 A;  2CZ0 B;  2LTO A;  2VGM A;  3JCM b;  4PLL A;  2EQK A;  3J81 E;  1KC8 U;  1BYM A;  5GAN 8;  3QXE B;  4A4G A;  2K57 A;  3VUZ A;  5C6S A;  5LJ3 f;  3MP8 A;  2XD0 A;  4J7I A;  3A8O B;  2VXF A;  1M4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...