5GAN5

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
75
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 12
structure length 75
sequence length 81
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan500
3V8KA 1BIBA 4MMKA 5LJ3j 3JB9H 4C8QF 4XU2A 4PJOC 4F7UB 4F7UA 4M77C 2RB6A 4M77F 4HT9A 4C8QE 3JCMd 5GAOl 1HXDA 4XTZA 2EJFA 1M8VA 4M77E 5GAMe 5GAMf 1B34B 1B34A 4PJOB 4M75B 4M75A 2DZ9A 2Y90A 5LJ3g 3JB9G 5LJ5j 4M7AC 3JCMV 4C8QD 4RCCA 1TH7A 1I4K1 4OP0A 4XU0A 3RERA 4M7DC 4M7DF 4PNOA 4XTVA 3EFSA 4C92C 2K57A 4JRKA 4J5YA 4J6WA 4M7DE 4X9CA 1WNLA 1U1TA 4QVDA 3QSUA 3JCMc 3RIRA 4M78B 4M78A 4EMGA 4F7UF 5LJ5g 5LJ5e 2E10A 4J6XA 1U1SA 2FYKA 4XU3A 2DKGA 2RA2A 1WPYA 1HK9A 2I2LA 5LJ3d 3HFOA 3RUXA 5GAMj 4F7UE 3V8LA 5GMKl 1BIAA 4C8QG 5GAN7 5LJ5h 4M75C 4M77G 4PJOF 2CGHA 5GAOn 4DQ2A 1D3BB 1D3BA 4XTXA 1Y96B 1Y96A 4PJOE 4V2SA 3V7RA 5LJ5d 5GAMg 1H641 4HA8A 4WF2A 3SB2A 3V7SA 3JB9I 3QHSA 4M7AF 2RM4A 4M7DG 4M78C 4NOYA 5GAN2 4PJOD 5GAMh 2DXTA 4JUVA 4M77D 4C92G 3JCMJ 5GAOm 3FIFA 1KQ2A 4C92F 5GANg 4M7AE 5GANe 5GANf 5GAN6 2E41A 2DJZA 3RKYA 1WQWA 1WQ7A 2DEQA 4C92E 2JN0A 4F7UG 5GAMd 5GAOp 2DZCA 4N0AA 4XU1A 2FB7A 2DTOA 3FB9A 4M7AD 5GANh 1LOJA 3HFNA 2DTHA 2E64A 2E65A 4RCBA 3HSBA 4A54A 4M7DD 2DTIA 4C92D 4PJOG 4M75G 5GANd 4M75F 4NL3A 4C8QB 4C8QA 2YHTA 3M4GA 2VXFA 4XTYA 5GANj 1X01A 4M75E 5GMKi 4HT8A 2E1HA 1JRIA 4XQ3A 3V7CA 4J6YA 1LJOA 5GMKm 5GMKe 4NL2A 4EMKA 4XTUA 4M7AG 5I21A 1YCYA 4M75D 4M78F 4JLIA 4N0AC 5DY9A 1I8FA 3SWNB 3SWNA 3JCMf 3L2ZA 4JRIA 3JCMe 5GMKh 5GAN4 1M5Q1 3BFMA 2EAYA 3BY7A 4M78E 4X9DA 5GAN3 3JCMX 3JB9J 3JCMP 3JCMQ 1N9SA 2RD1A 3JCMW 2EWNA 3JCMh 1LNXA 3RKWA 2YLCA 4Y91A 4C8QC 2EJ9A 3FJPA 3QO3A 2DVEA 4A53A 5GAOr 3PGGA 4MMLA 4M78D 4C92A 5GAOq 4QVCA 5GMKj 5CAIA 2HNIA 3QUIA 3JCMb 2DXUA 2VXEA 3AHUA 2ZGWA 4EMKC 5GAN5 4PJOA 3INZA 4M77B 4M77A 5LJ3f 3SWNC 5LJ3e 3JB9F 1JBMA 2EJGA 3BDUA 3BW1A 2VC8A 1N9RA 4EMKB 3EFRA 2QTXA 3L1AA 5LJ3h 4M78G 4XTWA 3V8JA 2YLBA 1I5LA 3GIBA 4M7AB 1I81A 3JCMg 3VU3C 5GAN8 4M7AA 3RKXA 4M7DA 3RESA 4M7DB 3JB9D 5LJ5f 4EMHA 1MGQA 4C92B 1KQ1A
chains in the Genus database with same CATH superfamily
1MHNA 2X4WA 4C5IA 2QA4A 4RUGA 3ME9A 4NS5A 3GP8A 2RB6A 1MMGA 4J9CA 3CQTA 5GAMf 1D09B 3EG1A 1TU0B 4M7DC 3EFSA 4XAXB 1VQ8A 1Q7YC 4O6JA 1WNLA 4B9XA 3JCMc 4R55A 5D6YA 4OF1A 2J6KA 4XU3A 3SHWA 5GAMj 1YHQQ 1M3CA 1IGQA 3P8BB 1SG5A 3I56Q 3LWHA 1VQ5A 3EG9B 1Y96A 5CKHA 1VQ5T 1SSFA 3MEAA 5GAMg 3MP6A 3LH0A 3V7SA 3CCJQ 1OULA 3NTKA 1QVPA 1YIJQ 4M78C 4NOYA 1BI0A 5GAMh 1NZ9A 3NTIA 3E9FA 2XI9A 1U5SA 2DD4A 1WQWA 2P84A 2EKOA 5GAOp 4IIMA 3FB9A 3FC3A 3CC4T 1WJSA 3HFNA 1Q82R 2QYZA 4M75G 4C8QA 3OYFA 1JXOA 4J9HA 1BYMA 2V1RA 1VQPA 1VQ6Q 1VQPT 5EG2A 2QQRA 2DIQA 4M75D 4JZ3A 3JCMf 3P8DA 4E7SA 5A0DA 3JB9J 4M78E 3VV0A 1DJ7B 3OYCA 2O9SA 5GAOr 4OMLA 3U23A 2BE7D 3CC2T 2LDMA 4JDSA 1IGUA 2V26A 2PZ1A 1QCNA 1MMDA 1N9RA 2D0NA 4IUVA 3M54A 2Z0WA 3CBMA 3H9NA 4XTWA 1ZBJA 1IREB 3JCMg 1PWTA 3H0FA 3PMIA 3NPFA 1G8XA 2RMOA 2DYIA 3PE0A 1OEBA 1BKBA 4MMKA 5A2QE 2RHZA 4F7UA 1IXDA 4HT9A 2HCKA 2DK3A 2CREA 1M30A 5CVIA 2CP7A 2O31A 2HMAA 2P0KA 5HK3A 2CH4W 1N8RR 1MMNA 4OMFB 4RTTA 1M90C 3GBQA 4J5YA 1IB8A 2R5MA 4CI0C 4X9CA 1N5ZA 2GF7A 3OA6A 4DA4A 2ZPEB 1UDLA 4JJBA 1D0ZA 1MMAA 2F2VA 1MNEA 3R6NA 2RQTA 5I11A 2C0IA 2P0PA 1WFWA 3V7RA 4M4ZA 3I55T 1M1KC 3EG0A 2D1XA 1M1KR 2GBQA 4M7DG 2NWMA 1OU9A 5KYYB 5CQXA 2E41A 2XG8D 1TTHB 5KYUB 4LDUA 2HKQB 4RTUA 2E64A 5KYWA 2X35A 4M7DD 4GLMA 1VQKT 4CC3A 2LCCA 3MPUB 1X01A 2MCNA 3E19A 5AT1B 2QGGA 1K73U 1D0XA 3CBOA 2CZ7B 3KFVA 2LJ0A 4BE0A 2OTLQ 1VQNA 1TUCA 1ZBXA 1KJWA 1M4ZA 2X51A 3SWNA 4DBQA 3TSWA 2FZKB 4RTZA 5IT9E 4LXCA 2MK5A 2F69A 2JS2A 3EGXA 1JJ2S 4M78D 2DNUA 5GMKj 2F1LA 1PD0A 5LJ3f 1UGRB 2VC8A 3UF4A 1ARKA 1KIKA 1KSWA 3X25B 1BBZA 3L1AA 1OOTA 2K5LA 5KCHA 4KBMB 2RQWA 4ZGJB 2L8DA 2KXCA 2HQEA 4EPCA 4RTXA 2YRVA 4PKCC 1ZSZA 5LJ3j 4KGVB 3CCVA 2KYMA 2PUKB 1K9MC 3MP1A 1TXQA 1M8VA 1I5OB 1B34B 3OYLA 1VYUA 4M75A 5LJ3g 2M0YA 3NMZC 2LVMA 1EX4A 4A4HA 4KUIA 4ZTJA 2PUOB 1O75A 2HL3A 2M0OA 2HEQA 1VUBA 4AT1B 1OV3A 2KVQG 1VIFA 1M9SA 3RUXA 4HCZA 4QQGA 1SPKA 2DL7A 2ZPHB 4KT0E 5HY6A 2L3SA 2MAMA 4N4GA 2V1QA 3MO8A 2X4YA 3OYNA 4HA8A 4FT4A 2F5TX 2KI7A 1YI2Q 2X4XA 3SEMA 5CR2A 1QVGP 3QWYA 3L2RA 1WX6A 5DLOA 1QVGS 1M27C 2K5FA 4FT2A 3CMAA 4XU1A 1IHWA 2GGRA 4RCBA 4OVAA 1M1FA 2KY9A 4FM4B 2VXFA 3X24B 1UHCA 4HT8A 3O5ZA 2O01E 2J05A 2GNCA 2QA4Q 5CCAA 4A4EA 3KUFA 1RI9A 1FMVA 4QKUA 3BY7A 5GAN3 1NEGA 3JCMW 4D8KA 3RKWA 3QO3A 4A53A 4MMLA 2EQMA 2MOXA 3A8LB 2FHDA 2EQJA 2ED0A 3JB9F 1QWFA 2FZGB 2JTFA 1G3YA 1YN8A 2BE9B 2DD5A 1VQ5Q 4D8DA 2EGAA 2SRCA 3CC7A 1BCOA 4M7DA 2LX7A 2KMTA 2VASA 1MGQA 2M16A 4AG1C 2ROLA 1Q7YU 2GTOA 5CKBA 3TQ7P 2Y90A 4OB1B 2JUFA 1QWEA 2C06A 4KGZB 1P92A 2HL5C 5FWCA 1KFZA 2BTTA 4M78A 2CP3A 2VGMA 1VQPQ 1U1SA 2RA2A 1HK9A 3QBYA 2D8HA 2IVWA 2CZ0B 3EGDB 1RLQC 3OBWA 2K7AA 5I2MA 1SSHA 2HD0A 3EH2A 1VQ6T 2MIOA 3JV3A 3OY9A 4J9EA 1WHGA 4FU6A 1KQSA 5CO7A 5LJ5d 2KGTA 2X4JA 2QQAA 1V76A 1G3SA 4LDXA 1WHJA 4HCBA 5FLXE 1LPLA 5GJVB 3L2VA 4RG2A 5GAN6 1YJ9A 1WQ7A 3QYHB 3CCMT 1VQ7A 2CH4A 2DMOA 4BD3A 1M1GA 1VQ7T 4L6V5 1UGVA 1QKWA 2JM9A 2E3IA 4LN2A 3A8HB 3FDRA 1R0BG 4M7AG 2BKDN 4CRIA 5I21A 1AWOA 5DY9A 4J7IA 5M9OA 2M51A 4E6RA 4BI8B 1Q86C 1TOVA 5J26A 1Q86R 1ZLMA 2OAUA 2KR3A 3PGGA 2JW4A 3RNJA 3CCQA 4FSXA 1NJIR 4R56A 3CCQT 1M8MA 3VS1A 2ATCB 1YJNA 2QTXA 1KD1C 4MZTA 3OW2A 1GBQA 3CD6A 2LZ6B 3CD6T 3I55Q 3OB9A 4J9DA 4C92B 2JJ9A 1M90U 1CKAA 2KK4A 1G83A 3CXCA 2Y4YA 4X1VA 1NLPC 3JCMV 1VA7A 1TH7A 2I0NA 1VQKQ 3IQLA 2WSCE 3T9NA 4PNOA 5FU6C 2RQUA 3CCUA 2K57A 3LX7A 5IHKA 2XICA 3CCUT 4MDWA 2MWPA 2EYXA 3G1JA 5KYUA 4FSSA 5FU6B 1M1KU 3DB4A 2OTJT 4C8QG 3OYDA 4PJOF 1W2BP 3EG2A 1W2BS 3OYKA 2OTLT 2KAFA 1H641 3CMEA 2G6FX 4HCKA 3CMET 1VQ4A 4RTYA 5IXFA 1VQ4T 1E7OA 2LT1A 5GANf 2L0AA 2GQVA 2LT4A 2PNIA 1UG1A 1WXUA 4HXJA 5CQYA 4J9BA 2DXCA 3L2UA 1Z9QA 3UWNA 3G71T 5GANj 3PFSA 1LJOA 2FPFA 3CCVQ 4J7FA 3J81E 3RR6A 1UGPB 4OMMA 2E5QA 2KDSA 2DAQA 3CCRA 2DRKA 2IPOB 3VS2A 3MEVA 3NGPA 4OB0B 2CSIA 3QDFA 1RAHB 1MV0B 3TEEA 2VXEA 5KH6A 4ANJA 1VQ9A 1FX7A 3G6EA 2CUBA 1JBMA 2EJGA 2XD0A 1K9MU 2QTVA 1M2VB 4C0DC 2RI3A 2OX7A 2CT3A 2PVGB 2ZPBB 3Q1JA 4ZN3A 1RI0A 4C0DB 1K1ZA 4PL6A 1D1CA 1BIBA 3V8KA 3UPUA 2QI2A 3SFMA 3LGFA 3E2UA 1OQKA 3JSCA 4M77F 4IUQA 3I9QA 2PVDB 1YI2T 1Z9ZA 3OYGA 1FYNA 4QVZA 2FEIA 1GXIE 3URGA 3NTHA 5LJ5e 3EAEA 2DKGA 5HKCA 4JJNK 2FRYA 3I5RA 2LX9A 1OI1A 2QA4T 1D3BA 1I0CA 1RAIB 4N4IA 1VQLA 1K8AC 3SB2A 4KUDK 2QQSA 1K8AR 1VQLT 3QHSA 4KULA 5GAN2 2EYQA 2RHIA 1RAGB 1VQ8T 2CUDA 3CPWP 3CPWS 4DBHA 3F70A 2VGNA 2E65A 4ZNXA 4E7JA 3A5ZB 1HJDA 3OYJA 2E12A 1X2QA 2YHTA 1RAEB 3OS2A 3LW5E 4J6YA 1C6VX 2YUOA 4BACA 1YCSB 2H3JA 1XTDA 4NL3A 1M5Q1 3CCEA 4X9DA 4RMOA 1G5VA 1ZUKA 2EWNA 5A0GA 2QEXA 1S72A 1Q82C 5GAOq 2ECZA 4FCYA 4GY5A 1WI7A 2RJCA 2Y4XA 4BE2A 1O9SA 1C1AA 3L2QA 2GFUA 3PVLA 2LQWA 2PU9B 4XK8E 2M9UA 4A4KA 1B07A 3ASKA 2AZVA 2EQKA 1I81A 1VOMA 3MJXA 2B8AA 2M1HA 3RESA 1UJYA 4Z88A 4EMHA 2P4RA 1D1BA 1K9AA 3ZBDA 2J06A 2LTOA 1PM3A 2XU8A 2JM8A 4QQDA 1HXDA 3QDRB 3CCMQ 5GAMe 1RAAB 1VQ7Q 2GQIA 3MP8A 3EH1A 2P0QA 3PTAA 1M3AA 3EG3A 2LNVA 4F7UF 4C5EA 5IHIA 3BE3A 4LUDA 1BIAA 4IUTA 3R6OA 5KYXB 3UDCA 2NUTB 3QJ6A 2KBTA 1GCQC 2LRQA 2O2OA 1IHVA 8ATCB 3FLGA 1N8RC 1YJWA 4O5VA 4WCIA 1YJWT 3CCQQ 2VB6A 2CSQA 1K0SA 4C92F 3RKYA 1T3LA 1NM7A 1QCFA 1BK2A 1UGSB 1N27A 1VIEA 2KRNA 2DTHA 1TUGB 4C5GA 5FW9A 2EGEA 3CD6Q 2JXBA 1Q86U 2C0OA 1GCPA 4JZ4A 2DIGA 2YUPA 2K2MA 1NJIU 1HSQA 4N0AC 3RMQA 6AT1B 3JCMe 3JCMX 1RLPC 2KXDA 1KD1U 3CCUQ 2ZAEA 3PMTA 4AFUC 4J9GA 3VS3A 2K9GA 1OZ2A 4ESRA 2OTJQ 1Y57A 1X6OA 3RDVA 4BE1A 4M78G 2JS0A 5GAN8 2LJ3A 1VQNT 1XOVA 4OMQA 1V1CA 2RH2A 2ZPIB 3JB9D 3CMEQ 3M0RA 1VQ4Q 3OYMA 4PJOC 1RAFB 3GF5A 3H0IA 2K5IA 4BI3A 5FWBA 4BDYA 4PJOB 1VYTA 2YSQA 3X28B 2X3WD 4ORZA 4E47A 3RERA 4OP0A 4XTVA 1YITA 3G71Q 1GFCA 4LD9K 5DLQE 2E10A 2P4TA 1PRMC 2BUDA 3GNGA 1AWXA 2CGHA 3CCVT 2F5KA 4HVUA 1PC0A 4PJOE 1ZUYA 1W6XA 5GAOm 3LH5A 3SDZA 2CP0A 5IAYA 1K4US 3G6EQ 4IUUA 2KT1A 2NUPB 2E6NA 3GOXA 4J8OA 1UEBA 3KBGA 4OB3B 4UC4A 2A36A 4Y28E 4CC7A 3TCJA 2RPNA 5GMKe 3UATA 1M2VA 2CKKA 3M9QA 1I8FA 3JCMQ 5AYFA 4QQ6A 2YLCA 3VJPA 2KEAA 3CMAT 4F16A 3C12A 4D6WA 1UHFA 2EYWA 2L3PA 2HDAA 4JRPA 1H3ZA 2R57A 4M77B 5LJ3e 1RADB 1WHMA 1T0HA 1T3SA 3VYHB 4M7AB 1WJRA 1KQ1A 1QP2A 1SKUB 1VQLQ 3C4SA 2DL5A 1QQJA 5KE3A 3BDLA 3OYAA 2AKKA 1QVFP 1VQ8Q 4FYYB 1QVFS 3S6WA 1SEMA 2MPXC 2KT8A 2QQBA 4M77E 4OMNA 2DBKA 4PFZA 1K76A 3TSZA 1PHTA 3WVEB 4JJCA 2DL8A 2XDDA 1U06A 2A37A 4M7DF 1UJ0A 1OU8A 2H8HA 4EIKA 3QYGB 4P5NA 1NPRA 2CYZB 4QVDA 1PCXA 1K8AU 3CC7T 1I5LA 1SF9A 2I2LA 2KQWA 1NEBA 2X9HA 2KRSA 4E7LA 3QKJA 4R0KA 2MWOA 4J83A 5L8RE 2LCLA 1ZX6A 3EG9A 3CCEQ 1Y96B 4V2SA 2BZ8A 4OMOA 3LGLA 1YHQA 1S72Q 3FRNA 4PJJA 3I56A 4PJOD 3C94A 3FIFA 2RQRA 3H41A 2NYSA 1ABQA 2EGCA 3GNFB 1BI2A 2A7YA 1JO8A 1YIJA 2RI5A 4DBRA 4A54A 2DTIA 1ACMB 2R58A 5GANd 4C8QB 3OMGA 5KYNA 2COYA 3MEWA 1D0YA 1Q82U 1PSFA 1YCYA 2A28A 4FYVB 2W10A 4MZPA 2ZCFB 3AT1B 1YJ9T 2RD1A 3PT9A 2CZ6B 2HNIA 2K3BA 1ZQ1A 2RN8A 1UTIA 3A98A 1NYGA 5D6WA 1TS9A 2HSEB 5L23A 2LP5A 5A0LA 1HYOA 1I07A 3PIOA 1ZUUA 1YJWQ 3CPFA 2JOYA 4F7UB 1AZEA 1W70A 4HVVA 5FRMA 1NJIC 1LVKA 5GAOl 2EJFA 2ENMA 2QGFB 4CC4B 1WYXA 3NFCA 5KCOA 4RCCA 5J3BA 1GCQA 3NHNA 2EBPA 1JJ2A 5CIUA 4C92C 1YJNT 3UA6A 3ZL7C 4BB7A 4J6XA 3S3OA 1N8RU 1WPYA 2MI6A 2J7IA 4F7UE 5GAN7 1X27A 4DQ2A 4DOVA 3M0UA 4LE9A 2L3QA 4JRQA 2RHXA 2LCSA 3M0QA 5KYYA 1KQ2A 1T0JA 4Z89A 4C92E 5GAMd 4KGXB 4ZN1A 4N0AA 2FB7A 2DTOA 5KYWB 1K73R 1UGQB 1VQNQ 3M58A 4PJNA 1ZHIA 5J39A 2CP2A 4L5GA 4XQ3A 2O88A 2L89A 4BY6B 4NL2A 3S3NA 3C95A 4TVRA 3SWNB 2ZPFB 3UT1A 3BFMA 1GRIA 1SRMA 1G3TA 3EGXB 3VRYA 3EGUA 1YITQ 5CAIA 1TSFA 1PKSA 2VV5A 2MMPA 4EMKC 1QVGA 1AZGB 4E2FB 4WTOB 4PJOA 1NE8A 2G3RA 1YNZA 1YWPA 1Q81C 1Q81R 3EFOB 3VYGA 4EMKB 4Z8AA 2B86A 5LJ5f 2QAZA 2CT4A 2RJEA 3CCRT 4MZMA 1AHJB 2V8JA 1QLYA 4A63B 3JCMd 1TG0A 2L2PA 2RNAA 2DERA 1B34A 4M75B 5HK0A 2MF2A 5LJ5j 1VQ9T 2YUQA 3OS5A 3G6ET 2HAXA 3H6ZA 3VRZA 3OYYA 1PKTA 1U1TA 1MNDA 2NUPA 5LJ5g 2FZCB 3HFOA 4YTLA 2JZ2A 3MCAB 5LJ5h 2RI2A 3M55A 2K79A 3J7AF 2OI3A 1WJQA 2HZYA 2QDYB 1YWOA 3CMAQ 3JB9I 2QG9B 3META 1FMWA 1PD1A 4M7AF 1WXBA 4JUVA 4C92G 2EQUA 4B9WA 9ATCB 1UUEA 5GANe 1B7TA 4C0GA 1X6GA 2DEQA 4JPBW 3OQ5A 3HSBA 3QZ9B 4C92D 1C0MA 2D9TA 3THKA 1PNJA 2QK0A 2DE0X 2KSSA 1I1JA 2FRWA 2HQXA 2OJ2A 4AFQC 4J9IA 2X3XD 1R77A 1UB4A 4II1A 4KH0B 1YP5A 1BU1A 3LYIA 3QXEB 4C5HA 1WDXA 1JQQA 2SEMA 4RTWA 2DVEA 1AWWA 4F17A 1SHFA 1X69A 2YDLA 3JCMb 1E6HA 3CC7Q 2ZGWA 5GAN5 5I2SA 1KHCA 3I35A 3A8MB 4Y92A 3PVQA 4E7IA 1VQMA 2YWWA 2A3LA 3BDUA 1VQMT 1ZA2B 3HPWA 3LLRA 1Q7YR 1EIFA 2JNGA 2QASA 4CC2A 4E7ZA 2DEUA 2O9VA 4M7DB 2VWFA 2XKOC 3N5BB 7AT1B 3CCET 1WA7A 4IIOA 1AD5A 4C8QF 2V8KA 2DETA 2QEXT 1S72T 2D0QB 2M02A 1VQOA 5IH2A 2E5KA 1VQOT 1CSKA 1U8RA 4XU0A 2ESWA 1KC8C 2AHJB 1KC8R 4M7DE 3QSUA 2ED1A 3CC4A 4M78B 2E4HA 2E3HA 5LJ3d 3X26B 5D7UA 2VKNA 4Q5WA 4IKFA 3EGDA 4PJMA 4Z02A 1RL2A 5IHNA 1YJ9Q 2KE9A 1KK7A 3QPHA 3VUZA 2DFUA 5IN1A 4ELZC 3EHQA 2WSFE 3CCLA 2DVJA 2RK2A 2RM4A 3SD4A 3CCLT 2KNBB 1GFDA 1TUDA 2JN0A 2KRMA 2LJ1A 2O4XB 4PFPA 2DJQA 4PK4A 1WZOA 3A1PA 3CC2A 3ZFJA 2K4YA 1AVZC 3G4SA 3M4GA 2RHYA 4FW1A 1ZSGA 5KE2A 3G4ST 3HL8A 1JRIA 4KH1B 3PNWC 1XQHA 3RMSA 4XTUA 4RG8A 2PTKA 3QIIA 3E1SA 3OYEA 5CK9A 1W2BA 2L5QA 3L42A 4K11A 2FVUA 2RF0A 3JCMh 1LNXA 3FJPA 4ZTFA 1YJNQ 1NG2A 3HP9A 3QUIA 2LQKA 4DOWA 2COZA 1WHHA 4AG2C 5I22A 4OGCA 1Y07A 1JEGA 2J6FA 3OYHA 1M90R 2EKHA 2RQVA 4LDYA 2YLBA 1FXXA 1KQSP 1J3TA 2HSPA 1KQSS 1UE9A 3RKXA 2DRMA 2XK0A 4C92A 1XJWB 1M3BA 1SHGA 4JLGA 1IZ6A 8AT1B 2DBMA 2NLUA 3WVDB 3I55A 2D8JA 1BI1A 3JB9G 3M0SA 1FWZA 5ECAA 5HCKA 5FU7C 1VYVA 2K2VA 2EQIA 1AOJA 1WLPB 2AZSA 3RIRA 5FU7B 4EMGA 4KRTA 4J9FA 1VQKA 3V8LA 2DF6A 1OZ3A 1OPKA 1RACB 2DYBA 4XTXA 4AMCA 3JAME 1B3QA 2HQHA 2YT6A 3LWIA 2LQ8A 2FL7A 2ROTA 4WF2A 1XNIA 2RJFA 2EIFA 3ZEHA 2YXYA 2BIVA 2QXFA 3REAB 3HRUA 3M59A 4MDXA 1OPLA 1YITT 3A8OB 1JJ2P 4GLKA 2JVVA 4F14A 2CP6A 3OW2P 1H3HA 1G2BA 3OW2S 2QDLA 3G7ZA 4M75F 5CKDA 3CCRQ 1Y0MA 5GMKm 2WACA 3EFOA 4EMKA 1U3OA 4IUPA 3OS0A 5GJWB 2EFIA 4JLIA 3CXCP 4PFOA 2DO3A 4JRIA 3CXCS 5GMKh 3OYBA 5D6XA 1IO6A 1MUZA 2ABLA 2AT1B 2K6DA 3KXTA 1VQ9Q 4ATOA 1Q81U 2DXBA 2VUBA 4A4FA 4HVWA 1K9MR 2VYTA 4E7KA 3AHUA 1PSEA 5C6SA 5LL6S 1HD3A 3QWXX 1NYFA 3CPWA 1BCMA 2J6OA 3EFRA 3HRTA 5LJ3h 2PQWA 3GPLA 3GIBA 3VU3C 1JU5C 1Q95G 2FPEA 3JB9H 3CCSA 4M77C 3CCST 4ZGDB 5FROA 2YUNA 4BUGA 3S3MA 2A08A 1N6AA 2DA9A 2PVOB 2DZ9A 1WIEA 4M7AC 3P8HA 4JJDA 3M0TA 4LDWA 2E70A 2JT4A 1A0NB 2CDTA 1E6GA 2FPDA 5C0MA 2FYKA 3DLMA 3MEUA 3X20B 2HKNA 1D3BB 2R5AA 1CKBA 4LNPA 2DM1A 3M4YA 3M57A 1OYXA 1QKXA 5CKFA 1WGSA 4LD6A 4QT7A 2JMCA 3JCMJ 1QMCA 4M7AE 2DJZA 2XIDA 2IG0A 1VQMQ 2LQNA 1LOJA 3EHRA 3VKIA 4PJOG 2HBPA 1QW1A 3E9GA 4XTYA 1JB0E 4DBFA 3HRSA 2GFAA 4QW2A 4E7HA 1BB9A 2JTEA 2QEXQ 2EYZA 3I5SA 2DL4A 1YHQT 4ELYC 1PG5B 4M78F 2L3RA 3I56T 5GAN4 4FYWB 3L2ZA 2EW3A 2FO0A 1VQOQ 2EAYA 3OMCA 3JCMP 2EPDA 4AFZC 1R8OB 1X43A 2XHCA 4Y91A 2EJ9A 1PRLC 4C8QC 3CCJA 2C0TA 1AT1B 3CBPA 3CCJT 3GLXA 2DXUA 1YIJT 1KG1A 2JMAA 5DM7R 3CC4Q 2BZXA 2JTMA 1GBRA 1SRLA 2COWA 2RK1A 3D7SB 3H8ZA 1YBYA 1WHKA 1H8KA 1OX9A 2CZ1B 3VUBA 4OB2B 4VUBA 1Y7XA 4LDVA 2CS7A 3QZ5B 4ZGEB 3CCLQ 1VQ6A 3MKDA 1V29B 4IURA 1KC8U 1QP3A 2H3EB 1NBEB 2K3XA 2V8IA 4C8QE 4XTZA 4PLIA 1R0CB 4DEXA 1D1AA 4L59A 2GTJA 3CC2Q 1OX8A 3VS6A 3G4SQ 1Y71A 4RTVA 3CCMA 4OMPA 4PJLA 4PLLA 3M5AA 2O4XA 4N4HA 5GMKl 3PIPA 2LMJA 3QJYA 4FIBA 2IIMA 4HKEA 5KYXA 4M77G 2LC4A 2NUTA 4A4GA 2OAWA 1G3WA 2RJDA 3H0HA 2EVRA 4FL6A 3OBYA 2CP5A 1S1NA 4LUEA 3HHTB 4M77D 3FEOA 3HKSA 1YFNA 4M7AD 1UECA 2AK5A 3C0CA 4DEYA 3L2WA 3OS1A 1AWJA 2W0ZA 4BDZA 4B6MA 1H92A 4GBQA 4EDUA 1ZA1B 2DLPA 1RABB 2NUZA 1KD1R 1NPPA 4BI4A 4JS5A 2RHUA 1RUWA 3DB3A 1N9SA 3M56A 4HCCA 2XDBA 1K73C 2K3YA 2YRCA 2MYSA 3DLLA 3QG1A 4BY6C 2F2XA 3VS7A 2E6ZA 3SWNC 1WHLA 3V8JA 1BI3A 1M2OA 2LNHB 1JXMA 3MHXA 3J80E 2OTJA 2XDPA 3OSVA 2BZYA 4XU2A 2D6FA 2OTLA 3TVTA 1LCKA 1GL5A 3M53A 1W4SA 4X34A 1X6BA 4C8QD 1I4K1 2EYYA 1EFNA 1EZZB 1IRXA 4JRKA 4J6WA 1ZSZC 3TU4K 3JRZA 5EC7A 2RO0A 1ZSZB 2KROA 3VS4A 1X2KA 4M75C 3TREA 5GAOn 2AIRB 3G71A 4C0FA 3ER0A 2HBWA 3ULRB 4AFSC 2XMFA 3REBB 3WXMB 2DXTA 2VVKA 1QVFA 3OYIA 4ME7A 2YRDA 5GANg 3CEYA 4RKUE 2DL3A 1UFFA 4C0ZA 2KYBA 4F7UG 4F04B 2DZCA 3VS0A 1WXTA 5GANh 1NLOC 2F2WA 2A0FB 5CKEA 1QCOA 2FG0A 4M75E 5GMKi 2WSEE 4OGEA 2E1HA 4JS4A 1KHIA 3V7CA 1AEYA 3CCSQ 3RBBB 5FRNA 1FMKA 2DX1A 3O8VA 1F1BB 2ZPGB 1X75C 1ABOA 2DPPB 3OSSC 3A8GB 4QVCA 1YI2A 2AKLA 5IXBA 3UA7A 3INZA 3VS5A 4M77A 1K0XA 2GCXA 2QQ9A 3BW1A 3DKMA 3FJ5A 2DILA 4FW2A 1MV3A 4FYXB 2ZZDA 4M7AA 1TWBA 1W1FA 3HTRA 3M0PA
chains in the Genus database with same CATH topology
1MHNA 2X4WA 3BDLA 1M90U 4C5IA 4JLGA 2QA4A 1IZ6A 3OYAA 3ME9A 4NS5A 3GP8A 2RB6A 1QVFS 2NLUA 3S6WA 2KK4A 3WVDB 3CXCA 2Y4YA 2QQBA 4M77E 3I55A 5GAMf 1BI1A 3JB9G 3JCMV 1FWZA 1TH7A 3WVEB 2XDDA 5FU7C 4M7DC 4M7DF 2WSCE 3T9NA 4PNOA 5FU6C 2K2VA 3EFSA 4XAXB 3CCUA 2K57A 1Q7YC 1VQ8A 3LX7A 3QYGB 2XICA 4O6JA 3CCUT 4MDWA 1WNLA 1NPRA 2CYZB 4P5NA 4B9XA 4QVDA 2MWPA 3JCMc 4R55A 5D6YA 3RIRA 5FU7B 4EMGA 1K8AU 4OF1A 3CC7T 1I5LA 4XU3A 5FU6B 1M1KU 3DB4A 5GAMj 2I2LA 2KQWA 1VQKA 3P8BB 3V8LA 2OTJT 4C8QG 4E7LA 3QKJA 3OYDA 2MWOA 1OZ3A 4J83A 4PJOF 3LWHA 5L8RE 1VQ5A 2LCLA 1W2BS 4XTXA 1Y96B 1Y96A 5CKHA 3OYKA 1VQ5T 1SSFA 4V2SA 3MEAA 3JAME 2KAFA 2OTLT 5GAMg 3LWIA 3MP6A 2LQ8A 1H641 2FL7A 3CMEA 3LH0A 3LGLA 4WF2A 1XNIA 3V7SA 1YHQA 3CMET 3NTKA 2RJFA 3FRNA 3I56A 1VQ4A 1QVPA 2EIFA 4M78C 4NOYA 2BIVA 1BI0A 3ZEHA 5GAMh 1NZ9A 2QXFA 3C94A 3E9FA 3NTIA 3FIFA 3HRUA 2LT1A 1VQ4T 3M59A 4MDXA 5GANf 2XI9A 2DD4A 1WQWA 2EKOA 2GQVA 1YITT 2LT4A 3A8OB 5GAOp 3FB9A 3GNFB 3FC3A 3CC4T 4GLKA 1BI2A 1WJSA 2JVVA 3HFNA 2A7YA 1YIJA 2RI5A 4A54A 5CQYA 2DTIA 3OW2S 2DXCA 4M75G 2R58A 5GANd 3G7ZA 4M75F 4C8QB 4C8QA 5CKDA 3UWNA 3OYFA 3L2UA 3OMGA 3G71T 5GANj 1BYMA 3PFSA 1VQPA 3MEWA 1LJOA 2WACA 5GMKm 1Q82U 1VQPT 4EMKA 4J7FA 5EG2A 2QQRA 3J81E 4IUPA 1PSFA 2DIQA 3OS0A 1YCYA 4M75D 1UGPB 2EFIA 4JLIA 3JCMf 3P8DA 5A0DA 2DO3A 4JRIA 3CXCS 5GMKh 3OYBA 5D6XA 2E5QA 2KDSA 3JB9J 4M78E 4ATOA 3KXTA 4MZPA 3VV0A 2DAQA 2ZCFB 3CCRA 2RD1A 1YJ9T 1Q81U 2DXBA 1DJ7B 2VUBA 3MEVA 4OB0B 3OYCA 4A4FA 5GAOr 3PT9A 2CZ6B 2HNIA 3TEEA 2VYTA 4E7KA 1ZQ1A 2VXEA 5KH6A 5LJ5e 3AHUA 1PSEA 5C6SA 3CC2T 2LDMA 1VQ9A 5LL6S 4JDSA 1FX7A 3G6EA 1JBMA 2EJGA 3CPWA 5D6WA 1N9RA 2XD0A 1K9MU 4IUVA 3EFRA 3M54A 3CBMA 3HRTA 5LJ3h 2PQWA 4XTWA 2RI3A 4C0DC 3GPLA 3GIBA 1IREB 3VU3C 3JCMg 5A0LA 2PVGB 3PMIA 3PIOA 2ZPBB 3Q1JA 4ZN3A 1RI0A 4C0DB 4PL6A 3V8KA 1BIBA 1BKBA 3CPFA 4MMKA 2JOYA 3UPUA 2QI2A 3SFMA 3CCSA 3LGFA 5A2QE 3JB9H 4F7UB 2RHZA 4F7UA 3JSCA 4M77C 4M77F 3CCST 5FRMA 4ZGDB 2DK3A 1NJIC 4HT9A 5GAOl 5FROA 4BUGA 4IUQA 2EJFA 3S3MA 2PVDB 1YI2T 1N6AA 3NFCA 5CVIA 2PVOB 2DZ9A 2P0KA 5HK3A 4M7AC 3P8HA 5KCOA 4RCCA 4OMFB 5J3BA 3OYGA 1M90C 1JJ2A 4LDWA 2E70A 5CIUA 4C92C 1YJNT 4J5YA 4QVZA 2R5MA 4CI0C 4X9CA 2GF7A 3OA6A 1GXIE 4DA4A 2ZPEB 3URGA 3NTHA 4BB7A 3EAEA 4J6XA 2FYKA 3DLMA 5C0MA 2DKGA 1WPYA 2MI6A 5HKCA 4JJNK 3S3OA 3MEUA 1N8RU 4F7UE 2LX9A 3X20B 5GAN7 1OI1A 2QA4T 4DQ2A 1D3BB 1D3BA 2R5AA 2P0PA 3V7RA 3M4YA 3M57A 4N4IA 1OYXA 4DOVA 1K8AC 1VQLA 3SB2A 4KUDK 3I55T 2QQSA 1WGSA 4LD6A 5CKFA 1M1KC 3QHSA 1VQLT 4JRQA 4M7DG 4KULA 2RHXA 5GAN2 2EYQA 2RHIA 3JCMJ 1KQ2A 4M7AE 5CQXA 2E41A 2DJZA 2XIDA 1VQ8T 2IG0A 4C92E 5GAMd 2XG8D 4ZN1A 4N0AA 2FB7A 2DTOA 3CPWS 4LDUA 1LOJA 3F70A 2VGNA 2E64A 2E65A 1UGQB 2X35A 3VKIA 4E7JA 4M7DD 3A5ZB 4PJOG 3OYJA 3M58A 1VQKT 2E12A 2HBPA 1QW1A 2YHTA 3E9GA 2LCCA 4XTYA 1ZHIA 1JB0E 3HRSA 5J39A 1X01A 2GFAA 4L5GA 4QW2A 3E19A 3OS2A 3LW5E 4XQ3A 4E7HA 4J6YA 2L89A 1K73U 4BY6B 3CBOA 4NL2A 2CZ7B 1YHQT 4BACA 4ELYC 4BE0A 3S3NA 3C95A 1VQNA 4TVRA 2H3JA 1ZBXA 1M4ZA 1XTDA 2L3RA 4M78F 3SWNB 3SWNA 5GAN4 2ZPFB 3L2ZA 4NL3A 3I56T 3UT1A 1M5Q1 3BFMA 2EAYA 3CCEA 4X9DA 3OMCA 4RMOA 3JCMP 1G5VA 5IT9E 1G3TA 2EWNA 5A0GA 1R8OB 2F69A 2XHCA 4Y91A 2EJ9A 4C8QC 2QEXA 3CCJA 1S72A 1JJ2S 1Q82C 5GAOq 4M78D 3CBPA 5GMKj 3CCJT 5CAIA 3GLXA 2DXUA 1YIJT 4GY5A 1KG1A 5DM7R 2VV5A 2MMPA 2RJCA 2Y4XA 4EMKC 4BE2A 1QVGA 1O9SA 4PJOA 2JTMA 1NE8A 2G3RA 5LJ3f 1UGRB 3L2QA 1Q81C 2RK1A 2GFUA 2VC8A 3H8ZA 3VYGA 3X25B 4EMKB 2PU9B 4XK8E 3L1AA 2M9UA 1YBYA 3ASKA 4A4KA 2EQKA 2K5LA 5KCHA 1I81A 4KBMB 2B8AA 2M1HA 3RESA 2CZ1B 3VUBA 2L8DA 4OB2B 2HQEA 1Y7XA 4VUBA 4EMHA 4EPCA 4LDVA 4ZGJB 5LJ5f 2CS7A 2YRVA 3QZ5B 4PKCC 4ZGEB 3ZBDA 1VQ6A 5LJ3j 2RJEA 3CCRT 1V29B 4IURA 2LTOA 3CCVA 1KC8U 4MZMA 1QP3A 2K3XA 1AHJB 2PUKB 2V8JA 2XU8A 1K9MC 2V8IA 3MP1A 4C8QE 3JCMd 4QQDA 1HXDA 4XTZA 3QDRB 1M8VA 4PLIA 5GAMe 1B34B 1B34A 3OYLA 4M75B 4M75A 5HK0A 5LJ3g 2MF2A 5LJ5j 1VQ9T 3MP8A 3OS5A 2LVMA 4L59A 4A4HA 3G6ET 2P0QA 3H6ZA 4KUIA 2PUOB 3PTAA 4ZTJA 2HAXA 1O75A 2M0OA 3OYYA 2LNVA 1Y71A 1U1TA 1VUBA 3CCMA 4F7UF 5LJ5g 4PLLA 2KVQG 4C5EA 3M5AA 1VIFA 2O4XA 4N4HA 1M9SA 3HFOA 3RUXA 4YTLA 4HCZA 4QQGA 2JZ2A 5GMKl 1BIAA 3QJYA 4IUTA 3R6OA 4FIBA 2ZPHB 3MCAB 4HKEA 3PIPA 5LJ5h 2RI2A 3M55A 4KT0E 4M77G 3UDCA 3J7AF 5HY6A 2LC4A 2MAMA 3QJ6A 4N4GA 2LRQA 4A4GA 1WJQA 2QDYB 3MO8A 1G3WA 2RJDA 2X4YA 3OYNA 4FL6A 4HA8A 3FLGA 3JB9I 3OBYA 3META 1YJWA 4O5VA 1N8RC 4FT4A 2F5TX 4M7AF 1YJWT 2X4XA 4JUVA 3HHTB 4M77D 4C92G 2EQUA 4B9WA 4C92F 5CR2A 3L2RA 5GANe 3FEOA 3HKSA 3RKYA 4C0GA 5DLOA 1QVGS 2DEQA 2K5FA 4FT2A 3OQ5A 3CMAA 1UGSB 1N27A 1VIEA 4XU1A 4M7AD 2DTHA 4RCBA 4C5GA 3HSBA 4OVAA 1M1FA 2KY9A 3QZ9B 4C92D 4FM4B 3L2WA 3OS1A 2D9TA 1Q86U 2VXFA 3X24B 2KSSA 4BDZA 4HT8A 2O01E 4EDUA 2DIGA 2HQXA 5CCAA 1NJIU 4A4EA 3KUFA 4N0AC 3RMQA 3JCMe 1NPPA 4BI4A 4II1A 1UB4A 3BY7A 5GAN3 3JCMX 4JS5A 2RHUA 3DB3A 1N9SA 3JCMW 3LYIA 3RKWA 3M56A 3QXEB 4C5HA 4HCCA 3QO3A 4A53A 2DVEA 2XDBA 1K73C 2K3YA 1KD1U 4MMLA 3JCMb 2EQMA 3PMTA 3DLLA 3QG1A 3A8LB 2FHDA 4BY6C 2ZGWA 5GAN5 2EQJA 5I2SA 1KHCA 1OZ2A 3A8MB 4E7IA 2E6ZA 3SWNC 1VQMA 3JB9F 2JTFA 2A3LA 3BDUA 1VQMT 1X6OA 1G3YA 3HPWA 3LLRA 4BE1A 2DD5A 4M78G 1BI3A 1EIFA 2JNGA 3V8JA 3MHXA 5GAN8 3CC7A 1VQNT 1XOVA 4M7DB 4M7DA 2RH2A 2XKOC 2ZPIB 2KMTA 3J80E 3N5BB 1MGQA 3JB9D 2M16A 2OTJA 3CCET 2XDPA 3OSVA 4C8QF 3OYMA 4XU2A 1Q7YU 4PJOC 2V8KA 2D6FA 2QEXT 3GF5A 1S72T 2OTLA 2K5IA 2D0QB 3M53A 4BI3A 5CKBA 1VQOA 1W4SA 4X34A 4BDYA 4PJOB 1VQOT 2Y90A 3X28B 4OB1B 2JUFA 4C8QD 4E47A 3RERA 2C06A 1I4K1 4OP0A 4XU0A 1P92A 1U8RA 4XTVA 4JRKA 1KC8C 1YITA 2AHJB 4J6WA 4M7DE 3TU4K 3QSUA 4LD9K 5DLQE 3CC4A 4M78B 4M78A 3JRZA 2VGMA 2E10A 1U1SA 2P4TA 5LJ3d 2RA2A 1HK9A 3QBYA 2IVWA 3X26B 2BUDA 2CZ0B 2RO0A 4Q5WA 3GNGA 4IKFA 3OBWA 4Z02A 5I2MA 2HD0A 4M75C 3TREA 2CGHA 1RL2A 5GAOn 3G71A 1VQ6T 4PJOD 3CCVT 2F5KA 4C0FA 3OY9A 3ER0A 3VUZA 4FU6A 3QPHA 1KQSA 4PJOE 5CO7A 5LJ5d 2X4JA 5IN1A 4ELZC 2QQAA 2WSFE 3CCLA 1G3SA 2RK2A 2RM4A 4LDXA 3SD4A 3WXMB 4HCBA 5FLXE 3CCLT 2DXTA 5GAOm 1QVFA 3OYIA 4ME7A 5GANg 3SDZA 3L2VA 3CEYA 4RG2A 4RKUE 5GAN6 1YJ9A 4C0ZA 1WQ7A 5IAYA 3QYHB 4IUUA 2JN0A 4F7UG 2DZCA 2E6NA 3GOXA 3CCMT 2O4XB 5GANh 1VQ7A 4J8OA 4BD3A 1M1GA 1VQ7T 4L6V5 1UEBA 3KBGA 4OB3B 3CC2A 3ZFJA 2K4YA 4UC4A 3G4SA 3M4GA 2RHYA 5CKEA 5KE2A 3G4ST 4Y28E 4M75E 5GMKi 2WSEE 4OGEA 2E1HA 3HL8A 4JS4A 1JRIA 1KHIA 3A8HB 3TCJA 3FDRA 3PNWC 1XQHA 3RMSA 3V7CA 5GMKe 4M7AG 4XTUA 2BKDN 5FRNA 4RG8A 4CRIA 2CKKA 5I21A 3QIIA 3M9QA 5DY9A 3E1SA 1I8FA 3OYEA 5CK9A 4J7IA 1W2BA 5M9OA 2L5QA 3L42A 4BI8B 1Q86C 3O8VA 5J26A 2FVUA 3JCMQ 5AYFA 4QQ6A 2ZPGB 3JCMh 1LNXA 1X75C 3OSSC 2DPPB 2YLCA 3VJPA 3A8GB 3CMAT 3FJPA 2OAUA 4ZTFA 3PGGA 3C12A 3HP9A 4QVCA 3QUIA 4D6WA 1YI2A 2LQKA 3CCQA 4DOWA 4FSXA 4R56A 3CCQT 4JRPA 1H3ZA 3INZA 2R57A 4OGCA 1Y07A 4M77A 4M77B 5LJ3e 2GCXA 2QQ9A 3BW1A 3OYHA 1YJNA 3DKMA 2QTXA 1KD1C 4MZTA 3OW2A 4LDYA 2YLBA 3VYHB 1FXXA 1WJRA 2ZZDA 4M7AB 3CD6A 4M7AA 1QP2A 1KQSS 3RKXA 3CD6T 3OB9A 2XK0A 3C4SA 4C92B 4C92A 1KQ1A 5KE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8K A;  1BIB A;  4MMK A;  5LJ3 j;  3JB9 H;  4C8Q F;  4XU2 A;  4PJO C;  4F7U B;  4F7U A;  4M77 C;  2RB6 A;  4M77 F;  4HT9 A;  4C8Q E;  3JCM d;  5GAO l;  1HXD A;  4XTZ A;  2EJF A;  1M8V A;  4M77 E;  5GAM e;  5GAM f;  1B34 B;  1B34 A;  4PJO B;  4M75 B;  4M75 A;  2DZ9 A;  2Y90 A;  5LJ3 g;  3JB9 G;  5LJ5 j;  4M7A C;  3JCM V;  4C8Q D;  4RCC A;  1TH7 A;  1I4K 1;  4OP0 A;  4XU0 A;  3RER A;  4M7D C;  4M7D F;  4PNO A;  4XTV A;  3EFS A;  4C92 C;  2K57 A;  4JRK A;  4J5Y A;  4J6W A;  4M7D E;  4X9C A;  1WNL A;  1U1T A;  4QVD A;  3QSU A;  3JCM c;  3RIR A;  4M78 B;  4M78 A;  4EMG A;  4F7U F;  5LJ5 g;  5LJ5 e;  2E10 A;  4J6X A;  1U1S A;  2FYK A;  4XU3 A;  2DKG A;  2RA2 A;  1WPY A;  1HK9 A;  2I2L A;  5LJ3 d;  3HFO A;  3RUX A;  5GAM j;  4F7U E;  3V8L A;  5GMK l;  1BIA A;  4C8Q G;  5GAN 7;  5LJ5 h;  4M75 C;  4M77 G;  4PJO F;  2CGH A;  5GAO n;  4DQ2 A;  1D3B B;  1D3B A;  4XTX A;  1Y96 B;  1Y96 A;  4PJO E;  4V2S A;  3V7R A;  5LJ5 d;  5GAM g;  1H64 1;  4HA8 A;  4WF2 A;  3SB2 A;  3V7S A;  3JB9 I;  3QHS A;  4M7A F;  2RM4 A;  4M7D G;  4M78 C;  4NOY A;  5GAN 2;  4PJO D;  5GAM h;  2DXT A;  4JUV A;  4M77 D;  4C92 G;  3JCM J;  5GAO m;  3FIF A;  1KQ2 A;  4C92 F;  5GAN g;  4M7A E;  5GAN e;  5GAN f;  5GAN 6;  2E41 A;  2DJZ A;  3RKY A;  1WQW A;  1WQ7 A;  2DEQ A;  4C92 E;  2JN0 A;  4F7U G;  5GAM d;  5GAO p;  2DZC A;  4N0A A;  4XU1 A;  2FB7 A;  2DTO A;  3FB9 A;  4M7A D;  5GAN h;  1LOJ A;  3HFN A;  2DTH A;  2E64 A;  2E65 A;  4RCB A;  3HSB A;  4A54 A;  4M7D D;  2DTI A;  4C92 D;  4PJO G;  4M75 G;  5GAN d;  4M75 F;  4NL3 A;  4C8Q B;  4C8Q A;  2YHT A;  3M4G A;  2VXF A;  4XTY A;  5GAN j;  1X01 A;  4M75 E;  5GMK i;  4HT8 A;  2E1H A;  1JRI A;  4XQ3 A;  3V7C A;  4J6Y A;  1LJO A;  5GMK m;  5GMK e;  4NL2 A;  4EMK A;  4XTU A;  4M7A G;  5I21 A;  1YCY A;  4M75 D;  4M78 F;  4JLI A;  4N0A C;  5DY9 A;  1I8F A;  3SWN B;  3SWN A;  3JCM f;  3L2Z A;  4JRI A;  3JCM e;  5GMK h;  5GAN 4;  1M5Q 1;  3BFM A;  2EAY A;  3BY7 A;  4M78 E;  4X9D A;  5GAN 3;  3JCM X;  3JB9 J;  3JCM P;  3JCM Q;  1N9S A;  2RD1 A;  3JCM W;  2EWN A;  3JCM h;  1LNX A;  3RKW A;  2YLC A;  4Y91 A;  4C8Q C;  2EJ9 A;  3FJP A;  3QO3 A;  2DVE A;  4A53 A;  5GAO r;  3PGG A;  4MML A;  4M78 D;  4C92 A;  5GAO q;  4QVC A;  5GMK j;  5CAI A;  2HNI A;  3QUI A;  3JCM b;  2DXU A;  2VXE A;  3AHU A;  2ZGW A;  4EMK C;  5GAN 5;  4PJO A;  3INZ A;  4M77 B;  4M77 A;  5LJ3 f;  3SWN C;  5LJ3 e;  3JB9 F;  1JBM A;  2EJG A;  3BDU A;  3BW1 A;  2VC8 A;  1N9R A;  4EMK B;  3EFR A;  2QTX A;  3L1A A;  5LJ3 h;  4M78 G;  4XTW A;  3V8J A;  2YLB A;  1I5L A;  3GIB A;  4M7A B;  1I81 A;  3JCM g;  3VU3 C;  5GAN 8;  4M7A A;  3RKX A;  4M7D A;  3RES A;  4M7D B;  3JB9 D;  5LJ5 f;  4EMH A;  1MGQ A;  4C92 B;  1KQ1 A; 
#chains in the Genus database with same CATH topology
 1MHN A;  2X4W A;  4C5I A;  2QA4 A;  4RUG A;  3ME9 A;  4NS5 A;  3GP8 A;  2RB6 A;  1MMG A;  4J9C A;  3CQT A;  5GAM f;  1D09 B;  3EG1 A;  1TU0 B;  4M7D C;  3EFS A;  4XAX B;  1VQ8 A;  1Q7Y C;  4O6J A;  1WNL A;  4B9X A;  3JCM c;  4R55 A;  5D6Y A;  4OF1 A;  2J6K A;  4XU3 A;  3SHW A;  5GAM j;  1YHQ Q;  1M3C A;  1IGQ A;  3P8B B;  1SG5 A;  3I56 Q;  3LWH A;  1VQ5 A;  3EG9 B;  1Y96 A;  5CKH A;  1VQ5 T;  1SSF A;  3MEA A;  5GAM g;  3MP6 A;  3LH0 A;  3V7S A;  3CCJ Q;  1OUL A;  3NTK A;  1QVP A;  1YIJ Q;  4M78 C;  4NOY A;  1BI0 A;  5GAM h;  1NZ9 A;  3NTI A;  3E9F A;  2XI9 A;  1U5S A;  2DD4 A;  1WQW A;  2P84 A;  2EKO A;  5GAO p;  4IIM A;  3FB9 A;  3FC3 A;  3CC4 T;  1WJS A;  3HFN A;  1Q82 R;  2QYZ A;  4M75 G;  4C8Q A;  3OYF A;  1JXO A;  4J9H A;  1BYM A;  2V1R A;  1VQP A;  1VQ6 Q;  1VQP T;  5EG2 A;  2QQR A;  2DIQ A;  4M75 D;  4JZ3 A;  3JCM f;  3P8D A;  4E7S A;  5A0D A;  3JB9 J;  4M78 E;  3VV0 A;  1DJ7 B;  3OYC A;  2O9S A;  5GAO r;  4OML A;  3U23 A;  2BE7 D;  3CC2 T;  2LDM A;  4JDS A;  1IGU A;  2V26 A;  2PZ1 A;  1QCN A;  1MMD A;  1N9R A;  2D0N A;  4IUV A;  3M54 A;  2Z0W A;  3CBM A;  3H9N A;  4XTW A;  1ZBJ A;  1IRE B;  3JCM g;  1PWT A;  3H0F A;  3PMI A;  3NPF A;  1G8X A;  2RMO A;  2DYI A;  3PE0 A;  1OEB A;  1BKB A;  4MMK A;  5A2Q E;  2RHZ A;  4F7U A;  1IXD A;  4HT9 A;  2HCK A;  2DK3 A;  2CRE A;  1M30 A;  5CVI A;  2CP7 A;  2O31 A;  2HMA A;  2P0K A;  5HK3 A;  2CH4 W;  1N8R R;  1MMN A;  4OMF B;  4RTT A;  1M90 C;  3GBQ A;  4J5Y A;  1IB8 A;  2R5M A;  4CI0 C;  4X9C A;  1N5Z A;  2GF7 A;  3OA6 A;  4DA4 A;  2ZPE B;  1UDL A;  4JJB A;  1D0Z A;  1MMA A;  2F2V A;  1MNE A;  3R6N A;  2RQT A;  5I11 A;  2C0I A;  2P0P A;  1WFW A;  3V7R A;  4M4Z A;  3I55 T;  1M1K C;  3EG0 A;  2D1X A;  1M1K R;  2GBQ A;  4M7D G;  2NWM A;  1OU9 A;  5KYY B;  5CQX A;  2E41 A;  2XG8 D;  1TTH B;  5KYU B;  4LDU A;  2HKQ B;  4RTU A;  2E64 A;  5KYW A;  2X35 A;  4M7D D;  4GLM A;  1VQK T;  4CC3 A;  2LCC A;  3MPU B;  1X01 A;  2MCN A;  3E19 A;  5AT1 B;  2QGG A;  1K73 U;  1D0X A;  3CBO A;  2CZ7 B;  3KFV A;  2LJ0 A;  4BE0 A;  2OTL Q;  1VQN A;  1TUC A;  1ZBX A;  1KJW A;  1M4Z A;  2X51 A;  3SWN A;  4DBQ A;  3TSW A;  2FZK B;  4RTZ A;  5IT9 E;  4LXC A;  2MK5 A;  2F69 A;  2JS2 A;  3EGX A;  1JJ2 S;  4M78 D;  2DNU A;  5GMK j;  2F1L A;  1PD0 A;  5LJ3 f;  1UGR B;  2VC8 A;  3UF4 A;  1ARK A;  1KIK A;  1KSW A;  3X25 B;  1BBZ A;  3L1A A;  1OOT A;  2K5L A;  5KCH A;  4KBM B;  2RQW A;  4ZGJ B;  2L8D A;  2KXC A;  2HQE A;  4EPC A;  4RTX A;  2YRV A;  4PKC C;  1ZSZ A;  5LJ3 j;  4KGV B;  3CCV A;  2KYM A;  2PUK B;  1K9M C;  3MP1 A;  1TXQ A;  1M8V A;  1I5O B;  1B34 B;  3OYL A;  1VYU A;  4M75 A;  5LJ3 g;  2M0Y A;  3NMZ C;  2LVM A;  1EX4 A;  4A4H A;  4KUI A;  4ZTJ A;  2PUO B;  1O75 A;  2HL3 A;  2M0O A;  2HEQ A;  1VUB A;  4AT1 B;  1OV3 A;  2KVQ G;  1VIF A;  1M9S A;  3RUX A;  4HCZ A;  4QQG A;  1SPK A;  2DL7 A;  2ZPH B;  4KT0 E;  5HY6 A;  2L3S A;  2MAM A;  4N4G A;  2V1Q A;  3MO8 A;  2X4Y A;  3OYN A;  4HA8 A;  4FT4 A;  2F5T X;  2KI7 A;  1YI2 Q;  2X4X A;  3SEM A;  5CR2 A;  1QVG P;  3QWY A;  3L2R A;  1WX6 A;  5DLO A;  1QVG S;  1M27 C;  2K5F A;  4FT2 A;  3CMA A;  4XU1 A;  1IHW A;  2GGR A;  4RCB A;  4OVA A;  1M1F A;  2KY9 A;  4FM4 B;  2VXF A;  3X24 B;  1UHC A;  4HT8 A;  3O5Z A;  2O01 E;  2J05 A;  2GNC A;  2QA4 Q;  5CCA A;  4A4E A;  3KUF A;  1RI9 A;  1FMV A;  4QKU A;  3BY7 A;  5GAN 3;  1NEG A;  3JCM W;  4D8K A;  3RKW A;  3QO3 A;  4A53 A;  4MML A;  2EQM A;  2MOX A;  3A8L B;  2FHD A;  2EQJ A;  2ED0 A;  3JB9 F;  1QWF A;  2FZG B;  2JTF A;  1G3Y A;  1YN8 A;  2BE9 B;  2DD5 A;  1VQ5 Q;  4D8D A;  2EGA A;  2SRC A;  3CC7 A;  1BCO A;  4M7D A;  2LX7 A;  2KMT A;  2VAS A;  1MGQ A;  2M16 A;  4AG1 C;  2ROL A;  1Q7Y U;  2GTO A;  5CKB A;  3TQ7 P;  2Y90 A;  4OB1 B;  2JUF A;  1QWE A;  2C06 A;  4KGZ B;  1P92 A;  2HL5 C;  5FWC A;  1KFZ A;  2BTT A;  4M78 A;  2CP3 A;  2VGM A;  1VQP Q;  1U1S A;  2RA2 A;  1HK9 A;  3QBY A;  2D8H A;  2IVW A;  2CZ0 B;  3EGD B;  1RLQ C;  3OBW A;  2K7A A;  5I2M A;  1SSH A;  2HD0 A;  3EH2 A;  1VQ6 T;  2MIO A;  3JV3 A;  3OY9 A;  4J9E A;  1WHG A;  4FU6 A;  1KQS A;  5CO7 A;  5LJ5 d;  2KGT A;  2X4J A;  2QQA A;  1V76 A;  1G3S A;  4LDX A;  1WHJ A;  4HCB A;  5FLX E;  1LPL A;  5GJV B;  3L2V A;  4RG2 A;  5GAN 6;  1YJ9 A;  1WQ7 A;  3QYH B;  3CCM T;  1VQ7 A;  2CH4 A;  2DMO A;  4BD3 A;  1M1G A;  1VQ7 T;  4L6V 5;  1UGV A;  1QKW A;  2JM9 A;  2E3I A;  4LN2 A;  3A8H B;  3FDR A;  1R0B G;  4M7A G;  2BKD N;  4CRI A;  5I21 A;  1AWO A;  5DY9 A;  4J7I A;  5M9O A;  2M51 A;  4E6R A;  4BI8 B;  1Q86 C;  1TOV A;  5J26 A;  1Q86 R;  1ZLM A;  2OAU A;  2KR3 A;  3PGG A;  2JW4 A;  3RNJ A;  3CCQ A;  4FSX A;  1NJI R;  4R56 A;  3CCQ T;  1M8M A;  3VS1 A;  2ATC B;  1YJN A;  2QTX A;  1KD1 C;  4MZT A;  3OW2 A;  1GBQ A;  3CD6 A;  2LZ6 B;  3CD6 T;  3I55 Q;  3OB9 A;  4J9D A;  4C92 B;  2JJ9 A;  1M90 U;  1CKA A;  2KK4 A;  1G83 A;  3CXC A;  2Y4Y A;  4X1V A;  1NLP C;  3JCM V;  1VA7 A;  1TH7 A;  2I0N A;  1VQK Q;  3IQL A;  2WSC E;  3T9N A;  4PNO A;  5FU6 C;  2RQU A;  3CCU A;  2K57 A;  3LX7 A;  5IHK A;  2XIC A;  3CCU T;  4MDW A;  2MWP A;  2EYX A;  3G1J A;  5KYU A;  4FSS A;  5FU6 B;  1M1K U;  3DB4 A;  2OTJ T;  4C8Q G;  3OYD A;  4PJO F;  1W2B P;  3EG2 A;  1W2B S;  3OYK A;  2OTL T;  2KAF A;  1H64 1;  3CME A;  2G6F X;  4HCK A;  3CME T;  1VQ4 A;  4RTY A;  5IXF A;  1VQ4 T;  1E7O A;  2LT1 A;  5GAN f;  2L0A A;  2GQV A;  2LT4 A;  2PNI A;  1UG1 A;  1WXU A;  4HXJ A;  5CQY A;  4J9B A;  2DXC A;  3L2U A;  1Z9Q A;  3UWN A;  3G71 T;  5GAN j;  3PFS A;  1LJO A;  2FPF A;  3CCV Q;  4J7F A;  3J81 E;  3RR6 A;  1UGP B;  4OMM A;  2E5Q A;  2KDS A;  2DAQ A;  3CCR A;  2DRK A;  2IPO B;  3VS2 A;  3MEV A;  3NGP A;  4OB0 B;  2CSI A;  3QDF A;  1RAH B;  1MV0 B;  3TEE A;  2VXE A;  5KH6 A;  4ANJ A;  1VQ9 A;  1FX7 A;  3G6E A;  2CUB A;  1JBM A;  2EJG A;  2XD0 A;  1K9M U;  2QTV A;  1M2V B;  4C0D C;  2RI3 A;  2OX7 A;  2CT3 A;  2PVG B;  2ZPB B;  3Q1J A;  4ZN3 A;  1RI0 A;  4C0D B;  1K1Z A;  4PL6 A;  1D1C A;  1BIB A;  3V8K A;  3UPU A;  2QI2 A;  3SFM A;  3LGF A;  3E2U A;  1OQK A;  3JSC A;  4M77 F;  4IUQ A;  3I9Q A;  2PVD B;  1YI2 T;  1Z9Z A;  3OYG A;  1FYN A;  4QVZ A;  2FEI A;  1GXI E;  3URG A;  3NTH A;  5LJ5 e;  3EAE A;  2DKG A;  5HKC A;  4JJN K;  2FRY A;  3I5R A;  2LX9 A;  1OI1 A;  2QA4 T;  1D3B A;  1I0C A;  1RAI B;  4N4I A;  1VQL A;  1K8A C;  3SB2 A;  4KUD K;  2QQS A;  1K8A R;  1VQL T;  3QHS A;  4KUL A;  5GAN 2;  2EYQ A;  2RHI A;  1RAG B;  1VQ8 T;  2CUD A;  3CPW P;  3CPW S;  4DBH A;  3F70 A;  2VGN A;  2E65 A;  4ZNX A;  4E7J A;  3A5Z B;  1HJD A;  3OYJ A;  2E12 A;  1X2Q A;  2YHT A;  1RAE B;  3OS2 A;  3LW5 E;  4J6Y A;  1C6V X;  2YUO A;  4BAC A;  1YCS B;  2H3J A;  1XTD A;  4NL3 A;  1M5Q 1;  3CCE A;  4X9D A;  4RMO A;  1G5V A;  1ZUK A;  2EWN A;  5A0G A;  2QEX A;  1S72 A;  1Q82 C;  5GAO q;  2ECZ A;  4FCY A;  4GY5 A;  1WI7 A;  2RJC A;  2Y4X A;  4BE2 A;  1O9S A;  1C1A A;  3L2Q A;  2GFU A;  3PVL A;  2LQW A;  2PU9 B;  4XK8 E;  2M9U A;  4A4K A;  1B07 A;  3ASK A;  2AZV A;  2EQK A;  1I81 A;  1VOM A;  3MJX A;  2B8A A;  2M1H A;  3RES A;  1UJY A;  4Z88 A;  4EMH A;  2P4R A;  1D1B A;  1K9A A;  3ZBD A;  2J06 A;  2LTO A;  1PM3 A;  2XU8 A;  2JM8 A;  4QQD A;  1HXD A;  3QDR B;  3CCM Q;  5GAM e;  1RAA B;  1VQ7 Q;  2GQI A;  3MP8 A;  3EH1 A;  2P0Q A;  3PTA A;  1M3A A;  3EG3 A;  2LNV A;  4F7U F;  4C5E A;  5IHI A;  3BE3 A;  4LUD A;  1BIA A;  4IUT A;  3R6O A;  5KYX B;  3UDC A;  2NUT B;  3QJ6 A;  2KBT A;  1GCQ C;  2LRQ A;  2O2O A;  1IHV A;  8ATC B;  3FLG A;  1N8R C;  1YJW A;  4O5V A;  4WCI A;  1YJW T;  3CCQ Q;  2VB6 A;  2CSQ A;  1K0S A;  4C92 F;  3RKY A;  1T3L A;  1NM7 A;  1QCF A;  1BK2 A;  1UGS B;  1N27 A;  1VIE A;  2KRN A;  2DTH A;  1TUG B;  4C5G A;  5FW9 A;  2EGE A;  3CD6 Q;  2JXB A;  1Q86 U;  2C0O A;  1GCP A;  4JZ4 A;  2DIG A;  2YUP A;  2K2M A;  1NJI U;  1HSQ A;  4N0A C;  3RMQ A;  6AT1 B;  3JCM e;  3JCM X;  1RLP C;  2KXD A;  1KD1 U;  3CCU Q;  2ZAE A;  3PMT A;  4AFU C;  4J9G A;  3VS3 A;  2K9G A;  1OZ2 A;  4ESR A;  2OTJ Q;  1Y57 A;  1X6O A;  3RDV A;  4BE1 A;  4M78 G;  2JS0 A;  5GAN 8;  2LJ3 A;  1VQN T;  1XOV A;  4OMQ A;  1V1C A;  2RH2 A;  2ZPI B;  3JB9 D;  3CME Q;  3M0R A;  1VQ4 Q;  3OYM A;  4PJO C;  1RAF B;  3GF5 A;  3H0I A;  2K5I A;  4BI3 A;  5FWB A;  4BDY A;  4PJO B;  1VYT A;  2YSQ A;  3X28 B;  2X3W D;  4ORZ A;  4E47 A;  3RER A;  4OP0 A;  4XTV A;  1YIT A;  3G71 Q;  1GFC A;  4LD9 K;  5DLQ E;  2E10 A;  2P4T A;  1PRM C;  2BUD A;  3GNG A;  1AWX A;  2CGH A;  3CCV T;  2F5K A;  4HVU A;  1PC0 A;  4PJO E;  1ZUY A;  1W6X A;  5GAO m;  3LH5 A;  3SDZ A;  2CP0 A;  5IAY A;  1K4U S;  3G6E Q;  4IUU A;  2KT1 A;  2NUP B;  2E6N A;  3GOX A;  4J8O A;  1UEB A;  3KBG A;  4OB3 B;  4UC4 A;  2A36 A;  4Y28 E;  4CC7 A;  3TCJ A;  2RPN A;  5GMK e;  3UAT A;  1M2V A;  2CKK A;  3M9Q A;  1I8F A;  3JCM Q;  5AYF A;  4QQ6 A;  2YLC A;  3VJP A;  2KEA A;  3CMA T;  4F16 A;  3C12 A;  4D6W A;  1UHF A;  2EYW A;  2L3P A;  2HDA A;  4JRP A;  1H3Z A;  2R57 A;  4M77 B;  5LJ3 e;  1RAD B;  1WHM A;  1T0H A;  1T3S A;  3VYH B;  4M7A B;  1WJR A;  1KQ1 A;  1QP2 A;  1SKU B;  1VQL Q;  3C4S A;  2DL5 A;  1QQJ A;  5KE3 A;  3BDL A;  3OYA A;  2AKK A;  1QVF P;  1VQ8 Q;  4FYY B;  1QVF S;  3S6W A;  1SEM A;  2MPX C;  2KT8 A;  2QQB A;  4M77 E;  4OMN A;  2DBK A;  4PFZ A;  1K76 A;  3TSZ A;  1PHT A;  3WVE B;  4JJC A;  2DL8 A;  2XDD A;  1U06 A;  2A37 A;  4M7D F;  1UJ0 A;  1OU8 A;  2H8H A;  4EIK A;  3QYG B;  4P5N A;  1NPR A;  2CYZ B;  4QVD A;  1PCX A;  1K8A U;  3CC7 T;  1I5L A;  1SF9 A;  2I2L A;  2KQW A;  1NEB A;  2X9H A;  2KRS A;  4E7L A;  3QKJ A;  4R0K A;  2MWO A;  4J83 A;  5L8R E;  2LCL A;  1ZX6 A;  3EG9 A;  3CCE Q;  1Y96 B;  4V2S A;  2BZ8 A;  4OMO A;  3LGL A;  1YHQ A;  1S72 Q;  3FRN A;  4PJJ A;  3I56 A;  4PJO D;  3C94 A;  3FIF A;  2RQR A;  3H41 A;  2NYS A;  1ABQ A;  2EGC A;  3GNF B;  1BI2 A;  2A7Y A;  1JO8 A;  1YIJ A;  2RI5 A;  4DBR A;  4A54 A;  2DTI A;  1ACM B;  2R58 A;  5GAN d;  4C8Q B;  3OMG A;  5KYN A;  2COY A;  3MEW A;  1D0Y A;  1Q82 U;  1PSF A;  1YCY A;  2A28 A;  4FYV B;  2W10 A;  4MZP A;  2ZCF B;  3AT1 B;  1YJ9 T;  2RD1 A;  3PT9 A;  2CZ6 B;  2HNI A;  2K3B A;  1ZQ1 A;  2RN8 A;  1UTI A;  3A98 A;  1NYG A;  5D6W A;  1TS9 A;  2HSE B;  5L23 A;  2LP5 A;  5A0L A;  1HYO A;  1I07 A;  3PIO A;  1ZUU A;  1YJW Q;  3CPF A;  2JOY A;  4F7U B;  1AZE A;  1W70 A;  4HVV A;  5FRM A;  1NJI C;  1LVK A;  5GAO l;  2EJF A;  2ENM A;  2QGF B;  4CC4 B;  1WYX A;  3NFC A;  5KCO A;  4RCC A;  5J3B A;  1GCQ A;  3NHN A;  2EBP A;  1JJ2 A;  5CIU A;  4C92 C;  1YJN T;  3UA6 A;  3ZL7 C;  4BB7 A;  4J6X A;  3S3O A;  1N8R U;  1WPY A;  2MI6 A;  2J7I A;  4F7U E;  5GAN 7;  1X27 A;  4DQ2 A;  4DOV A;  3M0U A;  4LE9 A;  2L3Q A;  4JRQ A;  2RHX A;  2LCS A;  3M0Q A;  5KYY A;  1KQ2 A;  1T0J A;  4Z89 A;  4C92 E;  5GAM d;  4KGX B;  4ZN1 A;  4N0A A;  2FB7 A;  2DTO A;  5KYW B;  1K73 R;  1UGQ B;  1VQN Q;  3M58 A;  4PJN A;  1ZHI A;  5J39 A;  2CP2 A;  4L5G A;  4XQ3 A;  2O88 A;  2L89 A;  4BY6 B;  4NL2 A;  3S3N A;  3C95 A;  4TVR A;  3SWN B;  2ZPF B;  3UT1 A;  3BFM A;  1GRI A;  1SRM A;  1G3T A;  3EGX B;  3VRY A;  3EGU A;  1YIT Q;  5CAI A;  1TSF A;  1PKS A;  2VV5 A;  2MMP A;  4EMK C;  1QVG A;  1AZG B;  4E2F B;  4WTO B;  4PJO A;  1NE8 A;  2G3R A;  1YNZ A;  1YWP A;  1Q81 C;  1Q81 R;  3EFO B;  3VYG A;  4EMK B;  4Z8A A;  2B86 A;  5LJ5 f;  2QAZ A;  2CT4 A;  2RJE A;  3CCR T;  4MZM A;  1AHJ B;  2V8J A;  1QLY A;  4A63 B;  3JCM d;  1TG0 A;  2L2P A;  2RNA A;  2DER A;  1B34 A;  4M75 B;  5HK0 A;  2MF2 A;  5LJ5 j;  1VQ9 T;  2YUQ A;  3OS5 A;  3G6E T;  2HAX A;  3H6Z A;  3VRZ A;  3OYY A;  1PKT A;  1U1T A;  1MND A;  2NUP A;  5LJ5 g;  2FZC B;  3HFO A;  4YTL A;  2JZ2 A;  3MCA B;  5LJ5 h;  2RI2 A;  3M55 A;  2K79 A;  3J7A F;  2OI3 A;  1WJQ A;  2HZY A;  2QDY B;  1YWO A;  3CMA Q;  3JB9 I;  2QG9 B;  3MET A;  1FMW A;  1PD1 A;  4M7A F;  1WXB A;  4JUV A;  4C92 G;  2EQU A;  4B9W A;  9ATC B;  1UUE A;  5GAN e;  1B7T A;  4C0G A;  1X6G A;  2DEQ A;  4JPB W;  3OQ5 A;  3HSB A;  3QZ9 B;  4C92 D;  1C0M A;  2D9T A;  3THK A;  1PNJ A;  2QK0 A;  2DE0 X;  2KSS A;  1I1J A;  2FRW A;  2HQX A;  2OJ2 A;  4AFQ C;  4J9I A;  2X3X D;  1R77 A;  1UB4 A;  4II1 A;  4KH0 B;  1YP5 A;  1BU1 A;  3LYI A;  3QXE B;  4C5H A;  1WDX A;  1JQQ A;  2SEM A;  4RTW A;  2DVE A;  1AWW A;  4F17 A;  1SHF A;  1X69 A;  2YDL A;  3JCM b;  1E6H A;  3CC7 Q;  2ZGW A;  5GAN 5;  5I2S A;  1KHC A;  3I35 A;  3A8M B;  4Y92 A;  3PVQ A;  4E7I A;  1VQM A;  2YWW A;  2A3L A;  3BDU A;  1VQM T;  1ZA2 B;  3HPW A;  3LLR A;  1Q7Y R;  1EIF A;  2JNG A;  2QAS A;  4CC2 A;  4E7Z A;  2DEU A;  2O9V A;  4M7D B;  2VWF A;  2XKO C;  3N5B B;  7AT1 B;  3CCE T;  1WA7 A;  4IIO A;  1AD5 A;  4C8Q F;  2V8K A;  2DET A;  2QEX T;  1S72 T;  2D0Q B;  2M02 A;  1VQO A;  5IH2 A;  2E5K A;  1VQO T;  1CSK A;  1U8R A;  4XU0 A;  2ESW A;  1KC8 C;  2AHJ B;  1KC8 R;  4M7D E;  3QSU A;  2ED1 A;  3CC4 A;  4M78 B;  2E4H A;  2E3H A;  5LJ3 d;  3X26 B;  5D7U A;  2VKN A;  4Q5W A;  4IKF A;  3EGD A;  4PJM A;  4Z02 A;  1RL2 A;  5IHN A;  1YJ9 Q;  2KE9 A;  1KK7 A;  3QPH A;  3VUZ A;  2DFU A;  5IN1 A;  4ELZ C;  3EHQ A;  2WSF E;  3CCL A;  2DVJ A;  2RK2 A;  2RM4 A;  3SD4 A;  3CCL T;  2KNB B;  1GFD A;  1TUD A;  2JN0 A;  2KRM A;  2LJ1 A;  2O4X B;  4PFP A;  2DJQ A;  4PK4 A;  1WZO A;  3A1P A;  3CC2 A;  3ZFJ A;  2K4Y A;  1AVZ C;  3G4S A;  3M4G A;  2RHY A;  4FW1 A;  1ZSG A;  5KE2 A;  3G4S T;  3HL8 A;  1JRI A;  4KH1 B;  3PNW C;  1XQH A;  3RMS A;  4XTU A;  4RG8 A;  2PTK A;  3QII A;  3E1S A;  3OYE A;  5CK9 A;  1W2B A;  2L5Q A;  3L42 A;  4K11 A;  2FVU A;  2RF0 A;  3JCM h;  1LNX A;  3FJP A;  4ZTF A;  1YJN Q;  1NG2 A;  3HP9 A;  3QUI A;  2LQK A;  4DOW A;  2COZ A;  1WHH A;  4AG2 C;  5I22 A;  4OGC A;  1Y07 A;  1JEG A;  2J6F A;  3OYH A;  1M90 R;  2EKH A;  2RQV A;  4LDY A;  2YLB A;  1FXX A;  1KQS P;  1J3T A;  2HSP A;  1KQS S;  1UE9 A;  3RKX A;  2DRM A;  2XK0 A;  4C92 A;  1XJW B;  1M3B A;  1SHG A;  4JLG A;  1IZ6 A;  8AT1 B;  2DBM A;  2NLU A;  3WVD B;  3I55 A;  2D8J A;  1BI1 A;  3JB9 G;  3M0S A;  1FWZ A;  5ECA A;  5HCK A;  5FU7 C;  1VYV A;  2K2V A;  2EQI A;  1AOJ A;  1WLP B;  2AZS A;  3RIR A;  5FU7 B;  4EMG A;  4KRT A;  4J9F A;  1VQK A;  3V8L A;  2DF6 A;  1OZ3 A;  1OPK A;  1RAC B;  2DYB A;  4XTX A;  4AMC A;  3JAM E;  1B3Q A;  2HQH A;  2YT6 A;  3LWI A;  2LQ8 A;  2FL7 A;  2ROT A;  4WF2 A;  1XNI A;  2RJF A;  2EIF A;  3ZEH A;  2YXY A;  2BIV A;  2QXF A;  3REA B;  3HRU A;  3M59 A;  4MDX A;  1OPL A;  1YIT T;  3A8O B;  1JJ2 P;  4GLK A;  2JVV A;  4F14 A;  2CP6 A;  3OW2 P;  1H3H A;  1G2B A;  3OW2 S;  2QDL A;  3G7Z A;  4M75 F;  5CKD A;  3CCR Q;  1Y0M A;  5GMK m;  2WAC A;  3EFO A;  4EMK A;  1U3O A;  4IUP A;  3OS0 A;  5GJW B;  2EFI A;  4JLI A;  3CXC P;  4PFO A;  2DO3 A;  4JRI A;  3CXC S;  5GMK h;  3OYB A;  5D6X A;  1IO6 A;  1MUZ A;  2ABL A;  2AT1 B;  2K6D A;  3KXT A;  1VQ9 Q;  4ATO A;  1Q81 U;  2DXB A;  2VUB A;  4A4F A;  4HVW A;  1K9M R;  2VYT A;  4E7K A;  3AHU A;  1PSE A;  5C6S A;  5LL6 S;  1HD3 A;  3QWX X;  1NYF A;  3CPW A;  1BCM A;  2J6O A;  3EFR A;  3HRT A;  5LJ3 h;  2PQW A;  3GPL A;  3GIB A;  3VU3 C;  1JU5 C;  1Q95 G;  2FPE A;  3JB9 H;  3CCS A;  4M77 C;  3CCS T;  4ZGD B;  5FRO A;  2YUN A;  4BUG A;  3S3M A;  2A08 A;  1N6A A;  2DA9 A;  2PVO B;  2DZ9 A;  1WIE A;  4M7A C;  3P8H A;  4JJD A;  3M0T A;  4LDW A;  2E70 A;  2JT4 A;  1A0N B;  2CDT A;  1E6G A;  2FPD A;  5C0M A;  2FYK A;  3DLM A;  3MEU A;  3X20 B;  2HKN A;  1D3B B;  2R5A A;  1CKB A;  4LNP A;  2DM1 A;  3M4Y A;  3M57 A;  1OYX A;  1QKX A;  5CKF A;  1WGS A;  4LD6 A;  4QT7 A;  2JMC A;  3JCM J;  1QMC A;  4M7A E;  2DJZ A;  2XID A;  2IG0 A;  1VQM Q;  2LQN A;  1LOJ A;  3EHR A;  3VKI A;  4PJO G;  2HBP A;  1QW1 A;  3E9G A;  4XTY A;  1JB0 E;  4DBF A;  3HRS A;  2GFA A;  4QW2 A;  4E7H A;  1BB9 A;  2JTE A;  2QEX Q;  2EYZ A;  3I5S A;  2DL4 A;  1YHQ T;  4ELY C;  1PG5 B;  4M78 F;  2L3R A;  3I56 T;  5GAN 4;  4FYW B;  3L2Z A;  2EW3 A;  2FO0 A;  1VQO Q;  2EAY A;  3OMC A;  3JCM P;  2EPD A;  4AFZ C;  1R8O B;  1X43 A;  2XHC A;  4Y91 A;  2EJ9 A;  1PRL C;  4C8Q C;  3CCJ A;  2C0T A;  1AT1 B;  3CBP A;  3CCJ T;  3GLX A;  2DXU A;  1YIJ T;  1KG1 A;  2JMA A;  5DM7 R;  3CC4 Q;  2BZX A;  2JTM A;  1GBR A;  1SRL A;  2COW A;  2RK1 A;  3D7S B;  3H8Z A;  1YBY A;  1WHK A;  1H8K A;  1OX9 A;  2CZ1 B;  3VUB A;  4OB2 B;  4VUB A;  1Y7X A;  4LDV A;  2CS7 A;  3QZ5 B;  4ZGE B;  3CCL Q;  1VQ6 A;  3MKD A;  1V29 B;  4IUR A;  1KC8 U;  1QP3 A;  2H3E B;  1NBE B;  2K3X A;  2V8I A;  4C8Q E;  4XTZ A;  4PLI A;  1R0C B;  4DEX A;  1D1A A;  4L59 A;  2GTJ A;  3CC2 Q;  1OX8 A;  3VS6 A;  3G4S Q;  1Y71 A;  4RTV A;  3CCM A;  4OMP A;  4PJL A;  4PLL A;  3M5A A;  2O4X A;  4N4H A;  5GMK l;  3PIP A;  2LMJ A;  3QJY A;  4FIB A;  2IIM A;  4HKE A;  5KYX A;  4M77 G;  2LC4 A;  2NUT A;  4A4G A;  2OAW A;  1G3W A;  2RJD A;  3H0H A;  2EVR A;  4FL6 A;  3OBY A;  2CP5 A;  1S1N A;  4LUE A;  3HHT B;  4M77 D;  3FEO A;  3HKS A;  1YFN A;  4M7A D;  1UEC A;  2AK5 A;  3C0C A;  4DEY A;  3L2W A;  3OS1 A;  1AWJ A;  2W0Z A;  4BDZ A;  4B6M A;  1H92 A;  4GBQ A;  4EDU A;  1ZA1 B;  2DLP A;  1RAB B;  2NUZ A;  1KD1 R;  1NPP A;  4BI4 A;  4JS5 A;  2RHU A;  1RUW A;  3DB3 A;  1N9S A;  3M56 A;  4HCC A;  2XDB A;  1K73 C;  2K3Y A;  2YRC A;  2MYS A;  3DLL A;  3QG1 A;  4BY6 C;  2F2X A;  3VS7 A;  2E6Z A;  3SWN C;  1WHL A;  3V8J A;  1BI3 A;  1M2O A;  2LNH B;  1JXM A;  3MHX A;  3J80 E;  2OTJ A;  2XDP A;  3OSV A;  2BZY A;  4XU2 A;  2D6F A;  2OTL A;  3TVT A;  1LCK A;  1GL5 A;  3M53 A;  1W4S A;  4X34 A;  1X6B A;  4C8Q D;  1I4K 1;  2EYY A;  1EFN A;  1EZZ B;  1IRX A;  4JRK A;  4J6W A;  1ZSZ C;  3TU4 K;  3JRZ A;  5EC7 A;  2RO0 A;  1ZSZ B;  2KRO A;  3VS4 A;  1X2K A;  4M75 C;  3TRE A;  5GAO n;  2AIR B;  3G71 A;  4C0F A;  3ER0 A;  2HBW A;  3ULR B;  4AFS C;  2XMF A;  3REB B;  3WXM B;  2DXT A;  2VVK A;  1QVF A;  3OYI A;  4ME7 A;  2YRD A;  5GAN g;  3CEY A;  4RKU E;  2DL3 A;  1UFF A;  4C0Z A;  2KYB A;  4F7U G;  4F04 B;  2DZC A;  3VS0 A;  1WXT A;  5GAN h;  1NLO C;  2F2W A;  2A0F B;  5CKE A;  1QCO A;  2FG0 A;  4M75 E;  5GMK i;  2WSE E;  4OGE A;  2E1H A;  4JS4 A;  1KHI A;  3V7C A;  1AEY A;  3CCS Q;  3RBB B;  5FRN A;  1FMK A;  2DX1 A;  3O8V A;  1F1B B;  2ZPG B;  1X75 C;  1ABO A;  2DPP B;  3OSS C;  3A8G B;  4QVC A;  1YI2 A;  2AKL A;  5IXB A;  3UA7 A;  3INZ A;  3VS5 A;  4M77 A;  1K0X A;  2GCX A;  2QQ9 A;  3BW1 A;  3DKM A;  3FJ5 A;  2DIL A;  4FW2 A;  1MV3 A;  4FYX B;  2ZZD A;  4M7A A;  1TWB A;  1W1F A;  3HTR A;  3M0P A; 
#chains in the Genus database with same CATH homology
 1MHN A;  2X4W A;  3BDL A;  1M90 U;  4C5I A;  4JLG A;  2QA4 A;  1IZ6 A;  3OYA A;  3ME9 A;  4NS5 A;  3GP8 A;  2RB6 A;  1QVF S;  2NLU A;  3S6W A;  2KK4 A;  3WVD B;  3CXC A;  2Y4Y A;  2QQB A;  4M77 E;  3I55 A;  5GAM f;  1BI1 A;  3JB9 G;  3JCM V;  1FWZ A;  1TH7 A;  3WVE B;  2XDD A;  5FU7 C;  4M7D C;  4M7D F;  2WSC E;  3T9N A;  4PNO A;  5FU6 C;  2K2V A;  3EFS A;  4XAX B;  3CCU A;  2K57 A;  1Q7Y C;  1VQ8 A;  3LX7 A;  3QYG B;  2XIC A;  4O6J A;  3CCU T;  4MDW A;  1WNL A;  1NPR A;  2CYZ B;  4P5N A;  4B9X A;  4QVD A;  2MWP A;  3JCM c;  4R55 A;  5D6Y A;  3RIR A;  5FU7 B;  4EMG A;  1K8A U;  4OF1 A;  3CC7 T;  1I5L A;  4XU3 A;  5FU6 B;  1M1K U;  3DB4 A;  5GAM j;  2I2L A;  2KQW A;  1VQK A;  3P8B B;  3V8L A;  2OTJ T;  4C8Q G;  4E7L A;  3QKJ A;  3OYD A;  2MWO A;  1OZ3 A;  4J83 A;  4PJO F;  3LWH A;  5L8R E;  1VQ5 A;  2LCL A;  1W2B S;  4XTX A;  1Y96 B;  1Y96 A;  5CKH A;  3OYK A;  1VQ5 T;  1SSF A;  4V2S A;  3MEA A;  3JAM E;  2KAF A;  2OTL T;  5GAM g;  3LWI A;  3MP6 A;  2LQ8 A;  1H64 1;  2FL7 A;  3CME A;  3LH0 A;  3LGL A;  4WF2 A;  1XNI A;  3V7S A;  1YHQ A;  3CME T;  3NTK A;  2RJF A;  3FRN A;  3I56 A;  1VQ4 A;  1QVP A;  2EIF A;  4M78 C;  4NOY A;  2BIV A;  1BI0 A;  3ZEH A;  5GAM h;  1NZ9 A;  2QXF A;  3C94 A;  3E9F A;  3NTI A;  3FIF A;  3HRU A;  2LT1 A;  1VQ4 T;  3M59 A;  4MDX A;  5GAN f;  2XI9 A;  2DD4 A;  1WQW A;  2EKO A;  2GQV A;  1YIT T;  2LT4 A;  3A8O B;  5GAO p;  3FB9 A;  3GNF B;  3FC3 A;  3CC4 T;  4GLK A;  1BI2 A;  1WJS A;  2JVV A;  3HFN A;  2A7Y A;  1YIJ A;  2RI5 A;  4A54 A;  5CQY A;  2DTI A;  3OW2 S;  2DXC A;  4M75 G;  2R58 A;  5GAN d;  3G7Z A;  4M75 F;  4C8Q B;  4C8Q A;  5CKD A;  3UWN A;  3OYF A;  3L2U A;  3OMG A;  3G71 T;  5GAN j;  1BYM A;  3PFS A;  1VQP A;  3MEW A;  1LJO A;  2WAC A;  5GMK m;  1Q82 U;  1VQP T;  4EMK A;  4J7F A;  5EG2 A;  2QQR A;  3J81 E;  4IUP A;  1PSF A;  2DIQ A;  3OS0 A;  1YCY A;  4M75 D;  1UGP B;  2EFI A;  4JLI A;  3JCM f;  3P8D A;  5A0D A;  2DO3 A;  4JRI A;  3CXC S;  5GMK h;  3OYB A;  5D6X A;  2E5Q A;  2KDS A;  3JB9 J;  4M78 E;  4ATO A;  3KXT A;  4MZP A;  3VV0 A;  2DAQ A;  2ZCF B;  3CCR A;  2RD1 A;  1YJ9 T;  1Q81 U;  2DXB A;  1DJ7 B;  2VUB A;  3MEV A;  4OB0 B;  3OYC A;  4A4F A;  5GAO r;  3PT9 A;  2CZ6 B;  2HNI A;  3TEE A;  2VYT A;  4E7K A;  1ZQ1 A;  2VXE A;  5KH6 A;  5LJ5 e;  3AHU A;  1PSE A;  5C6S A;  3CC2 T;  2LDM A;  1VQ9 A;  5LL6 S;  4JDS A;  1FX7 A;  3G6E A;  1JBM A;  2EJG A;  3CPW A;  5D6W A;  1N9R A;  2XD0 A;  1K9M U;  4IUV A;  3EFR A;  3M54 A;  3CBM A;  3HRT A;  5LJ3 h;  2PQW A;  4XTW A;  2RI3 A;  4C0D C;  3GPL A;  3GIB A;  1IRE B;  3VU3 C;  3JCM g;  5A0L A;  2PVG B;  3PMI A;  3PIO A;  2ZPB B;  3Q1J A;  4ZN3 A;  1RI0 A;  4C0D B;  4PL6 A;  3V8K A;  1BIB A;  1BKB A;  3CPF A;  4MMK A;  2JOY A;  3UPU A;  2QI2 A;  3SFM A;  3CCS A;  3LGF A;  5A2Q E;  3JB9 H;  4F7U B;  2RHZ A;  4F7U A;  3JSC A;  4M77 C;  4M77 F;  3CCS T;  5FRM A;  4ZGD B;  2DK3 A;  1NJI C;  4HT9 A;  5GAO l;  5FRO A;  4BUG A;  4IUQ A;  2EJF A;  3S3M A;  2PVD B;  1YI2 T;  1N6A A;  3NFC A;  5CVI A;  2PVO B;  2DZ9 A;  2P0K A;  5HK3 A;  4M7A C;  3P8H A;  5KCO A;  4RCC A;  4OMF B;  5J3B A;  3OYG A;  1M90 C;  1JJ2 A;  4LDW A;  2E70 A;  5CIU A;  4C92 C;  1YJN T;  4J5Y A;  4QVZ A;  2R5M A;  4CI0 C;  4X9C A;  2GF7 A;  3OA6 A;  1GXI E;  4DA4 A;  2ZPE B;  3URG A;  3NTH A;  4BB7 A;  3EAE A;  4J6X A;  2FYK A;  3DLM A;  5C0M A;  2DKG A;  1WPY A;  2MI6 A;  5HKC A;  4JJN K;  3S3O A;  3MEU A;  1N8R U;  4F7U E;  2LX9 A;  3X20 B;  5GAN 7;  1OI1 A;  2QA4 T;  4DQ2 A;  1D3B B;  1D3B A;  2R5A A;  2P0P A;  3V7R A;  3M4Y A;  3M57 A;  4N4I A;  1OYX A;  4DOV A;  1K8A C;  1VQL A;  3SB2 A;  4KUD K;  3I55 T;  2QQS A;  1WGS A;  4LD6 A;  5CKF A;  1M1K C;  3QHS A;  1VQL T;  4JRQ A;  4M7D G;  4KUL A;  2RHX A;  5GAN 2;  2EYQ A;  2RHI A;  3JCM J;  1KQ2 A;  4M7A E;  5CQX A;  2E41 A;  2DJZ A;  2XID A;  1VQ8 T;  2IG0 A;  4C92 E;  5GAM d;  2XG8 D;  4ZN1 A;  4N0A A;  2FB7 A;  2DTO A;  3CPW S;  4LDU A;  1LOJ A;  3F70 A;  2VGN A;  2E64 A;  2E65 A;  1UGQ B;  2X35 A;  3VKI A;  4E7J A;  4M7D D;  3A5Z B;  4PJO G;  3OYJ A;  3M58 A;  1VQK T;  2E12 A;  2HBP A;  1QW1 A;  2YHT A;  3E9G A;  2LCC A;  4XTY A;  1ZHI A;  1JB0 E;  3HRS A;  5J39 A;  1X01 A;  2GFA A;  4L5G A;  4QW2 A;  3E19 A;  3OS2 A;  3LW5 E;  4XQ3 A;  4E7H A;  4J6Y A;  2L89 A;  1K73 U;  4BY6 B;  3CBO A;  4NL2 A;  2CZ7 B;  1YHQ T;  4BAC A;  4ELY C;  4BE0 A;  3S3N A;  3C95 A;  1VQN A;  4TVR A;  2H3J A;  1ZBX A;  1M4Z A;  1XTD A;  2L3R A;  4M78 F;  3SWN B;  3SWN A;  5GAN 4;  2ZPF B;  3L2Z A;  4NL3 A;  3I56 T;  3UT1 A;  1M5Q 1;  3BFM A;  2EAY A;  3CCE A;  4X9D A;  3OMC A;  4RMO A;  3JCM P;  1G5V A;  5IT9 E;  1G3T A;  2EWN A;  5A0G A;  1R8O B;  2F69 A;  2XHC A;  4Y91 A;  2EJ9 A;  4C8Q C;  2QEX A;  3CCJ A;  1S72 A;  1JJ2 S;  1Q82 C;  5GAO q;  4M78 D;  3CBP A;  5GMK j;  3CCJ T;  5CAI A;  3GLX A;  2DXU A;  1YIJ T;  4GY5 A;  1KG1 A;  5DM7 R;  2VV5 A;  2MMP A;  2RJC A;  2Y4X A;  4EMK C;  4BE2 A;  1QVG A;  1O9S A;  4PJO A;  2JTM A;  1NE8 A;  2G3R A;  5LJ3 f;  1UGR B;  3L2Q A;  1Q81 C;  2RK1 A;  2GFU A;  2VC8 A;  3H8Z A;  3VYG A;  3X25 B;  4EMK B;  2PU9 B;  4XK8 E;  3L1A A;  2M9U A;  1YBY A;  3ASK A;  4A4K A;  2EQK A;  2K5L A;  5KCH A;  1I81 A;  4KBM B;  2B8A A;  2M1H A;  3RES A;  2CZ1 B;  3VUB A;  2L8D A;  4OB2 B;  2HQE A;  1Y7X A;  4VUB A;  4EMH A;  4EPC A;  4LDV A;  4ZGJ B;  5LJ5 f;  2CS7 A;  2YRV A;  3QZ5 B;  4PKC C;  4ZGE B;  3ZBD A;  1VQ6 A;  5LJ3 j;  2RJE A;  3CCR T;  1V29 B;  4IUR A;  2LTO A;  3CCV A;  1KC8 U;  4MZM A;  1QP3 A;  2K3X A;  1AHJ B;  2PUK B;  2V8J A;  2XU8 A;  1K9M C;  2V8I A;  3MP1 A;  4C8Q E;  3JCM d;  4QQD A;  1HXD A;  4XTZ A;  3QDR B;  1M8V A;  4PLI A;  5GAM e;  1B34 B;  1B34 A;  3OYL A;  4M75 B;  4M75 A;  5HK0 A;  5LJ3 g;  2MF2 A;  5LJ5 j;  1VQ9 T;  3MP8 A;  3OS5 A;  2LVM A;  4L59 A;  4A4H A;  3G6E T;  2P0Q A;  3H6Z A;  4KUI A;  2PUO B;  3PTA A;  4ZTJ A;  2HAX A;  1O75 A;  2M0O A;  3OYY A;  2LNV A;  1Y71 A;  1U1T A;  1VUB A;  3CCM A;  4F7U F;  5LJ5 g;  4PLL A;  2KVQ G;  4C5E A;  3M5A A;  1VIF A;  2O4X A;  4N4H A;  1M9S A;  3HFO A;  3RUX A;  4YTL A;  4HCZ A;  4QQG A;  2JZ2 A;  5GMK l;  1BIA A;  3QJY A;  4IUT A;  3R6O A;  4FIB A;  2ZPH B;  3MCA B;  4HKE A;  3PIP A;  5LJ5 h;  2RI2 A;  3M55 A;  4KT0 E;  4M77 G;  3UDC A;  3J7A F;  5HY6 A;  2LC4 A;  2MAM A;  3QJ6 A;  4N4G A;  2LRQ A;  4A4G A;  1WJQ A;  2QDY B;  3MO8 A;  1G3W A;  2RJD A;  2X4Y A;  3OYN A;  4FL6 A;  4HA8 A;  3FLG A;  3JB9 I;  3OBY A;  3MET A;  1YJW A;  4O5V A;  1N8R C;  4FT4 A;  2F5T X;  4M7A F;  1YJW T;  2X4X A;  4JUV A;  3HHT B;  4M77 D;  4C92 G;  2EQU A;  4B9W A;  4C92 F;  5CR2 A;  3L2R A;  5GAN e;  3FEO A;  3HKS A;  3RKY A;  4C0G A;  5DLO A;  1QVG S;  2DEQ A;  2K5F A;  4FT2 A;  3OQ5 A;  3CMA A;  1UGS B;  1N27 A;  1VIE A;  4XU1 A;  4M7A D;  2DTH A;  4RCB A;  4C5G A;  3HSB A;  4OVA A;  1M1F A;  2KY9 A;  3QZ9 B;  4C92 D;  4FM4 B;  3L2W A;  3OS1 A;  2D9T A;  1Q86 U;  2VXF A;  3X24 B;  2KSS A;  4BDZ A;  4HT8 A;  2O01 E;  4EDU A;  2DIG A;  2HQX A;  5CCA A;  1NJI U;  4A4E A;  3KUF A;  4N0A C;  3RMQ A;  3JCM e;  1NPP A;  4BI4 A;  4II1 A;  1UB4 A;  3BY7 A;  5GAN 3;  3JCM X;  4JS5 A;  2RHU A;  3DB3 A;  1N9S A;  3JCM W;  3LYI A;  3RKW A;  3M56 A;  3QXE B;  4C5H A;  4HCC A;  3QO3 A;  4A53 A;  2DVE A;  2XDB A;  1K73 C;  2K3Y A;  1KD1 U;  4MML A;  3JCM b;  2EQM A;  3PMT A;  3DLL A;  3QG1 A;  3A8L B;  2FHD A;  4BY6 C;  2ZGW A;  5GAN 5;  2EQJ A;  5I2S A;  1KHC A;  1OZ2 A;  3A8M B;  4E7I A;  2E6Z A;  3SWN C;  1VQM A;  3JB9 F;  2JTF A;  2A3L A;  3BDU A;  1VQM T;  1X6O A;  1G3Y A;  3HPW A;  3LLR A;  4BE1 A;  2DD5 A;  4M78 G;  1BI3 A;  1EIF A;  2JNG A;  3V8J A;  3MHX A;  5GAN 8;  3CC7 A;  1VQN T;  1XOV A;  4M7D B;  4M7D A;  2RH2 A;  2XKO C;  2ZPI B;  2KMT A;  3J80 E;  3N5B B;  1MGQ A;  3JB9 D;  2M16 A;  2OTJ A;  3CCE T;  2XDP A;  3OSV A;  4C8Q F;  3OYM A;  4XU2 A;  1Q7Y U;  4PJO C;  2V8K A;  2D6F A;  2QEX T;  3GF5 A;  1S72 T;  2OTL A;  2K5I A;  2D0Q B;  3M53 A;  4BI3 A;  5CKB A;  1VQO A;  1W4S A;  4X34 A;  4BDY A;  4PJO B;  1VQO T;  2Y90 A;  3X28 B;  4OB1 B;  2JUF A;  4C8Q D;  4E47 A;  3RER A;  2C06 A;  1I4K 1;  4OP0 A;  4XU0 A;  1P92 A;  1U8R A;  4XTV A;  4JRK A;  1KC8 C;  1YIT A;  2AHJ B;  4J6W A;  4M7D E;  3TU4 K;  3QSU A;  4LD9 K;  5DLQ E;  3CC4 A;  4M78 B;  4M78 A;  3JRZ A;  2VGM A;  2E10 A;  1U1S A;  2P4T A;  5LJ3 d;  2RA2 A;  1HK9 A;  3QBY A;  2IVW A;  3X26 B;  2BUD A;  2CZ0 B;  2RO0 A;  4Q5W A;  3GNG A;  4IKF A;  3OBW A;  4Z02 A;  5I2M A;  2HD0 A;  4M75 C;  3TRE A;  2CGH A;  1RL2 A;  5GAO n;  3G71 A;  1VQ6 T;  4PJO D;  3CCV T;  2F5K A;  4C0F A;  3OY9 A;  3ER0 A;  3VUZ A;  4FU6 A;  3QPH A;  1KQS A;  4PJO E;  5CO7 A;  5LJ5 d;  2X4J A;  5IN1 A;  4ELZ C;  2QQA A;  2WSF E;  3CCL A;  1G3S A;  2RK2 A;  2RM4 A;  4LDX A;  3SD4 A;  3WXM B;  4HCB A;  5FLX E;  3CCL T;  2DXT A;  5GAO m;  1QVF A;  3OYI A;  4ME7 A;  5GAN g;  3SDZ A;  3L2V A;  3CEY A;  4RG2 A;  4RKU E;  5GAN 6;  1YJ9 A;  4C0Z A;  1WQ7 A;  5IAY A;  3QYH B;  4IUU A;  2JN0 A;  4F7U G;  2DZC A;  2E6N A;  3GOX A;  3CCM T;  2O4X B;  5GAN h;  1VQ7 A;  4J8O A;  4BD3 A;  1M1G A;  1VQ7 T;  4L6V 5;  1UEB A;  3KBG A;  4OB3 B;  3CC2 A;  3ZFJ A;  2K4Y A;  4UC4 A;  3G4S A;  3M4G A;  2RHY A;  5CKE A;  5KE2 A;  3G4S T;  4Y28 E;  4M75 E;  5GMK i;  2WSE E;  4OGE A;  2E1H A;  3HL8 A;  4JS4 A;  1JRI A;  1KHI A;  3A8H B;  3TCJ A;  3FDR A;  3PNW C;  1XQH A;  3RMS A;  3V7C A;  5GMK e;  4M7A G;  4XTU A;  2BKD N;  5FRN A;  4RG8 A;  4CRI A;  2CKK A;  5I21 A;  3QII A;  3M9Q A;  5DY9 A;  3E1S A;  1I8F A;  3OYE A;  5CK9 A;  4J7I A;  1W2B A;  5M9O A;  2L5Q A;  3L42 A;  4BI8 B;  1Q86 C;  3O8V A;  5J26 A;  2FVU A;  3JCM Q;  5AYF A;  4QQ6 A;  2ZPG B;  3JCM h;  1LNX A;  1X75 C;  3OSS C;  2DPP B;  2YLC A;  3VJP A;  3A8G B;  3CMA T;  3FJP A;  2OAU A;  4ZTF A;  3PGG A;  3C12 A;  3HP9 A;  4QVC A;  3QUI A;  4D6W A;  1YI2 A;  2LQK A;  3CCQ A;  4DOW A;  4FSX A;  4R56 A;  3CCQ T;  4JRP A;  1H3Z A;  3INZ A;  2R57 A;  4OGC A;  1Y07 A;  4M77 A;  4M77 B;  5LJ3 e;  2GCX A;  2QQ9 A;  3BW1 A;  3OYH A;  1YJN A;  3DKM A;  2QTX A;  1KD1 C;  4MZT A;  3OW2 A;  4LDY A;  2YLB A;  3VYH B;  1FXX A;  1WJR A;  2ZZD A;  4M7A B;  3CD6 A;  4M7A A;  1QP2 A;  1KQS S;  3RKX A;  3CD6 T;  3OB9 A;  2XK0 A;  3C4S A;  4C92 B;  4C92 A;  1KQ1 A;  5KE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...