2P84A

Crystal structure of orf041 from bacteriophage 37
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
LIPKFREFDRERHRTDYQKGMSYAEQQDFDMGFTIWFDHIEDLDLIEKDGTINRIVMMSTGLKDKNVKEIYESDIVRNLYGELYVVEWLDGSFVLTEFYNGGYDHYIIDSSTEYEVLGNIYENPELLEDDNHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ORF041
publication title Crystal structure of the hypothetical protein from Staphylococcus phage 37
rcsb
source organism Staphylococcus phage
total genus 27
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2p84A02
2.60.430.10 Mainly Beta Sandwich YopX-like fold YopX-like domain 2p84A01
2P84A 2QYZA 2OX7A
chains in the Genus database with same CATH superfamily
2D8JA 4M7DD 2M0YA 1LJOA 4JJDA 2F2WA 1VQPA 4A4KA 4FL6A 1U06A 5GMKh 2VXFA 2O2OA 2F69A 2J6FA 4M4ZA 5KYWA 2DRMA 4PJNA 1KQ2A 3GP8A 4Z88A 1VYTA 5D6WA 3RMSA 3G6EA 3EHQA 2JNGA 3PGGA 3NTHA 3VU3C 2FYKA 4OMMA 2K9GA 4Y92A 2MYSA 1K73U 2HMAA 3QZ9B 5GMKe 1V76A 2RHZA 3M57A 3KBGA 4M75G 5KYUA 1VQ5T 2BIVA 3LX7A 1GXIE 2HNIA 3S6WA 3M0TA 3MJXA 5J39A 1NYFA 2BKDN 1RAFB 2DERA 4J9BA 1WX6A 1Y71A 2BZYA 3I56T 3HFOA 2GCXA 4Y28E 2LDMA 2JTMA 1YIJT 1M1KC 3CD6Q 2MK5A 5A2QE 3G71A 3E1SA 4RTYA 2KE9A 1W2BP 2AKLA 2QQSA 4Z8AA 4ZTFA 1UHCA 4M78G 1K73R 3UA7A 4C5HA 3QXEB 2SEMA 3HRUA 2MIOA 2A0FB 2JTFA 1R8OB 4M77F 1ZLMA 4J8OA 3CCLT 1KQSS 1WFWA 4LDWA 3RERA 1XNIA 3OBYA 4HCZA 4DBQA 3URGA 4M75D 2M1HA 3FRNA 1WHMA 5AT1B 1UGPB 5FU6B 3JCMc 2JOYA 2HSEB 1M3AA 3EFOA 3GLXA 1I5LA 2CP0A 1YJNQ 2EYXA 1M90C 4EDUA 3TVTA 4FSXA 1VIFA 3C4SA 4J9GA 4D6WA 1B3QA 3QYHB 4HKEA 4DBFA 1KC8C 2RJDA 2HEQA 2GTJA 5CCAA 4QQGA 3M0QA 4M78E 1MMDA 2ABLA 2D1XA 2I2LA 1VQKQ 5KYXA 3EG9A 1YITQ 1VQ5A 3CBPA 3UF4A 3JSCA 3I56A 1Y0MA 4F7UG 4M7AB 3X28B 4M77A 3LWIA 4PJMA 1UJYA 2DO3A 2ZPBB 4LD9K 4E7ZA 1YIJA 1SRMA 3AT1B 1QCNA 3GPLA 4RCBA 4PFOA 3THKA 3MEUA 5HCKA 2FZGB 2P4RA 1AEYA 2C06A 4N0AA 4MZMA 1KD1U 1LOJA 1D0XA 7AT1B 3CPWP 2DL3A 2R5MA 2DLPA 1PKTA 4C0GA 1BKBA 3EGXA 1WHGA 3QJ6A 3LH0A 2RHUA 2MF2A 1Q86C 3CCLA 4ME7A 4XTUA 2FPEA 5DLQE 2H3JA 2X4XA 1D3BB 3BDLA 1ZUKA 3QPHA 1VQ4Q 4F7UE 1X2QA 1OOTA 1C1AA 4KGXB 3S3OA 2Y90A 2EIFA 1Y7XA 3EG1A 4LNPA 4J9FA 4C8QA 3HL8A 3H9NA 3HHTB 1KD1R 1RLQC 5FLXE 5GAOq 2YSQA 4M7DA 3RUXA 4HVVA 1K1ZA 2VVKA 1YI2T 2YRCA 1XOVA 3CCST 2L3QA 4BDZA 2ED0A 2DA9A 4C92B 1N9RA 4OMFB 2MWPA 3L1AA 1X01A 3CXCP 2E6ZA 2CSIA 3P8DA 1D1CA 2LNVA 4M75F 3X25B 3TSZA 2LT4A 2EKHA 5DLOA 3L2QA 4BUGA 4A63B 3M0RA 4FU6A 4FYVB 1AT1B 3TCJA 3WVDB 1U5SA 1VQ9A 1I1JA 2DKGA 2L5QA 3RIRA 2KYMA 1YCSB 3LWHA 1BK2A 5GAOn 2ENMA 2VWFA 4RTTA 2NUTA 3A1PA 4BI3A 4FYYB 2LCLA 4AFQC 2KXCA 2QDLA 4DEYA 3R6NA 4L59A 1N8RU 1IZ6A 1H8KA 1Y57A 4EPCA 3PNWC 2XKOC 3I5SA 2EFIA 1IHWA 1T3LA 4X9DA 2CP3A 1JO8A 4RTVA 3QHSA 1IO6A 1E6GA 2J7IA 1VQ7Q 1R0CB 1ZSZC 2O4XA 4E7JA 1TOVA 2CP5A 1I4K1 2BZ8A 3EG3A 5KYYA 2FO0A 4AG2C 4M75A 1DJ7B 1YWOA 2DBMA 3M53A 4XK8E 5GAN4 1MGQA 2KBTA 4CC4B 4HCBA 4R55A 3A98A 1YI2A 1GCPA 2ROTA 4L5GA 1VQLQ 4PFPA 2K3XA 3CCSA 1J3TA 2CZ6B 1VQOT 1K8AC 3JB9H 2KR3A 4EMKA 2PVOB 2DZCA 3OYHA 3LGFA 1OX9A 2DL7A 4ZGEB 3SEMA 3GF5A 2KEAA 1Z9ZA 5FWCA 2VC8A 2DEUA 2Z0WA 1H92A 4J83A 2LZ6B 3H8ZA 1K4US 3OYDA 1HK9A 1BCMA 2LQ8A 1OQKA 2DTIA 4MZTA 3CMEQ 2GFUA 1W6XA 4QVZA 5GAMj 2WSFE 2D8HA 2JMAA 2CYZB 3JAME 4HVWA 2X9HA 4LUEA 1S1NA 1RLPC 1X6GA 3INZA 3ME9A 1AWWA 3JCMb 1UE9A 3V7CA 1BIAA 2EQMA 4LDXA 1WA7A 4OMQA 2E3HA 3CC2Q 4CI0C 1M1KU 1BYMA 2V8IA 3CD6T 1GL5A 2KRNA 4L6V5 4QT7A 1B34B 1WXUA 3CCMQ 3CCRQ 8ATCB 1WZOA 3CCEQ 2QQAA 4MDWA 4TVRA 2XICA 5LJ3f 3JCMQ 4M7AD 1RADB 1BIBA 4C5EA 1D09B 1QW1A 2IG0A 1AVZC 1I0CA 2L3SA 4KT0E 3RDVA 1KQSP 2VUBA 3M5AA 1WLPB 4Z89A 2K5LA 4XAXB 3JCMd 2RH2A 4E7IA 2LMJA 4F7UA 4IIOA 4M77G 2B8AA 2CZ0B 1VQOA 2XIDA 2QTVA 5CKEA 1YFNA 1WNLA 5GAN6 1M1KR 2DPPB 2FZCB 1ARKA 2PUKB 3REBB 1Q81C 2CUDA 4PL6A 1M90U 1U3OA 2FZKB 5EC7A 1YJNT 2OJ2A 5I11A 1V1CA 4C5GA 1X6BA 5FWBA 4AFZC 2EGCA 1HD3A 1KQ1A 4LXCA 1NEGA 2KGTA 1U1TA 5CKHA 3CBMA 4J9CA 1QKXA 5LL6S 2RMOA 2R5AA 3JCMV 2M02A 3FB9A 4BY6B 3OA6A 3VS3A 4II1A 1YITT 3OB9A 1WHLA 3NFCA 1ABOA 4M77E 2DMOA 4OB3B 4F17A 3QDFA 3OYLA 4AMCA 2RHXA 2E3IA 4J5YA 4C92D 2LQNA 2RA2A 6AT1B 3CD6A 1WQWA 3M56A 5KCOA 1WJRA 2LX9A 4XU0A 1OPKA 1HSQA 1FX7A 1MNDA 4BE1A 2GGRA 2LJ1A 2QA4Q 2M51A 4IUPA 5GANe 3RKXA 1KSWA 3OYIA 2A28A 4FYXB 1G8XA 5I2MA 1Q86U 2KAFA 3MHXA 1EIFA 2DIGA 2CSQA 4LN2A 4ZN3A 3C95A 3JCMf 4J9EA 5GANd 2GQIA 5M9OA 1M3BA 1PNJA 2HKNA 2V26A 4OF1A 1VQ4T 5CAIA 3A5ZB 2D6FA 3EFRA 2V8KA 1MNEA 3VV0A 3JB9D 2PUOB 2QAZA 1VUBA 1NJIU 4JZ4A 2R57A 2JTEA 1YJNA 3M54A 1TS9A 1LNXA 2GF7A 4C0ZA 4XU3A 1EZZB 2JZ2A 4M7DE 3UDCA 4EMHA 3SWNC 2DJZA 2X3WD 4OMLA 2GFAA 4XQ3A 2RQTA 2ZAEA 3M9QA 2RK1A 4HCKA 3U23A 4JRKA 1M27C 1YJWQ 2E65A 1GCQA 4HA8A 4CC7A 4M7AF 5I21A 3J80E 3A8GB 4PJOB 3VUBA 4NS5A 2HBPA 2E4HA 4OMOA 3FJ5A 4BD3A 2G3RA 1YITA 1RUWA 2D0NA 2NUPA 3RKYA 2E12A 3I9QA 3P8HA 4J9DA 3CC7Q 1NJIR 3ER0A 1LCKA 2P4TA 3MCAB 5I2SA 4C5IA 1FYNA 3N5BB 4HCCA 4D8DA 1MV3A 4E6RA 2LTOA 4NL2A 5LJ5e 1WJQA 2JN0A 3TEEA 1YJ9Q 2RJEA 2DL5A 2PZ1A 2LX7A 2MWOA 2QASA 4E47A 1PRLC 2Y4YA 2DNUA 2WSEE 5GANf 4K11A 2RPNA 3KUFA 5LJ5d 4B9XA 2X51A 1PC0A 2L0AA 4M7AA 4JRIA 4PJLA 2NYSA 4A53A 1U1SA 1VQ4A 3HPWA 1YHQQ 1CKAA 4C92C 2H3EB 4X9CA 1VQ7T 1Q82C 1H3HA 4J6YA 1X2KA 2A08A 1AWOA 4JRPA 2RQRA 3JCMJ 4M75E 1SHGA 1WYXA 1T0HA 1AOJA 4C92F 1WQ7A 4ANJA 4IUTA 4OP0A 1OZ2A 2DVJA 2HDAA 1Q7YU 2EQJA 5KE2A 1QVGS 1VQLT 2LRQA 2YUQA 2CT4A 3EGDB 1QWEA 3ZFJA 1JBMA 2DX1A 5KYWB 1KK7A 3V7SA 2DVEA 2JT4A 2WSCE 2F2XA 2E10A 3I55Q 2CKKA 5IAYA 2XD0A 4DA4A 3ZEHA 1Y96B 1NEBA 2HL5C 2K2MA 4ZTJA 4A4HA 3NMZC 4CC3A 4XTWA 2LVMA 3LW5E 3JRZA 3JB9F 1VQNQ 3GBQA 1D0YA 2OTJT 1YBYA 3CMET 1OU9A 1WPYA 3PVLA 3UATA 4DQ2A 4D8KA 2KY9A 3SWNB 1D1BA 1RACB 1Q7YR 1ACMB 1FMWA 2IPOB 1RAIB 3QDRB 2K5IA 1W1FA 2K4YA 4GY5A 3DB3A 1RAEB 2LJ0A 3HRTA 2P0KA 3I5RA 1ZX6A 5LJ5f 1Z9QA 3V8LA 3CC2T 1NE8A 2JM8A 4MMLA 3EG2A 2GQVA 3CCMT 3CCRT 1M9SA 1VQ7A 3CCET 2CP7A 1FWZA 2GNCA 4RTWA 1BI0A 3ULRB 5ECAA 2DXTA 1VQ6Q 3ASKA 4RTXA 3OW2A 3HSBA 3QWYA 2AT1B 2LC4A 5J3BA 3VRZA 4OVAA 5GMKl 4WCIA 4XTYA 3MEWA 2COZA 1VQLA 3EFOB 3X26B 2BZXA 1ABQA 5A0GA 2KXDA 3UWNA 1Q81U 3SB2A 4E7KA 3OMCA 2RI3A 3VS4A 1EFNA 5GMKj 3CCUQ 2B86A 1JJ2A 3VS2A 5CKDA 2BTTA 1VA7A 4FSSA 4OMNA 2GTOA 5KYXB 3EG9B 2QYZA 2RK2A 2C0IA 2YUNA 4RUGA 4BE2A 5FRNA 1VQMQ 1TUDA 2OTJA 2PTKA 3BFMA 1WXBA 1M2OA 2EYQA 2KQWA 3SDZA 3RMQA 2LP5A 5KYNA 2YRDA 4P5NA 2P84A 1Q81R 2KT8A 2L3RA 2QG9B 2DETA 3FIFA 2D0QB 5LJ3h 4PJOD 1MUZA 2LCCA 3RBBB 3CC2A 1NPPA 4FT2A 2K57A 2OAWA 1K0SA 1B07A 3UPUA 1UB4A 4ATOA 1K73C 3MP8A 2QDYB 3CCRA 3CCMA 1ZBXA 1N9SA 2XDBA 1R77A 3AHUA 1PG5B 2JS2A 2HBWA 3CCEA 2RM4A 4BI8B 2OTLQ 3PFSA 2QA4T 3ZBDA 4WTOB 5LJ3e 2VKNA 4F16A 2PU9B 3EFSA 1BCOA 2XU8A 4M78C 1K9MC 2KRSA 4DOVA 1C0MA 2DK3A 2QQRA 3MKDA 3CBOA 1UHFA 5GAMf 2KSSA 5C6SA 2W10A 1QP3A 1VQ8Q 1X43A 3OYJA 5LJ3d 2CH4A 2ZPFB 4BY6C 4FW1A 2A7YA 4C8QB 2LJ3A 4ZGJB 2ZPEB 2ESWA 2EYWA 3OW2S 1B34A 1G5VA 2A37A 1M2VB 1Q95G 2ECZA 1EX4A 5FRMA 2DD5A 2EWNA 1N8RR 1WHJA 3M59A 4JZ3A 2CZ1B 5KH6A 2QGGA 4J6WA 3L42A 5GJWB 2RO0A 4IUUA 1KHIA 1KIKA 5GAOm 1T0JA 1X69A 4LDYA 5A0LA 2E5QA 1OZ3A 4PKCC 3BY7A 4M7AG 2HQHA 3ZL7C 1MV0B 4LDVA 1JJ2S 2DXCA 1E7OA 2DTOA 2FG0A 1JQQA 4XU1A 3OY9A 1YWPA 2FRWA 4DBRA 3CXCA 3CC7T 2MMPA 1UECA 3VS5A 5GMKi 1QQJA 1YCYA 2XHCA 3OQ5A 3EHRA 2NUTB 2KT1A 3KFVA 1PSFA 3UA6A 5GAN5 1WJSA 2ZZDA 1ZSZA 1TH7A 2YUPA 4NL3A 3JCMh 1QCOA 1VIEA 2RI2A 3MP6A 2HKQB 4HVUA 2QA4A 1YJ9T 2OAUA 3T9NA 4FM4B 4O5VA 3HKSA 1X75C 2H8HA 1SPKA 4BDYA 2J05A 4J7FA 4ELZC 4M7AE 3EAEA 2DILA 1I8FA 2ATCB 1VQ9Q 4R0KA 3FDRA 2FB7A 1NG2A 4XTZA 1M1FA 4LUDA 4DEXA 5GAOp 4PJOC 3JCMe 4F04B 1YHQT 3QKJA 1Q82U 1CKBA 1KD1C 2E5KA 3M55A 5IHNA 4OB0B 3OYYA 4HT9A 2CS7A 1BI2A 2LQWA 1K9AA 2HQEA 4RMOA 3NGPA 4PJOF 3S3NA 2FEIA 2KNBB 2DL8A 2PVGB 5CVIA 1UDLA 4C92G 1QVGP 2HSPA 1X27A 4EMKB 1KJWA 1QP2A 3V8JA 5DM7R 2Y4XA 5FU7C 4RCCA 1LVKA 1IGUA 5D6YA 3H6ZA 1KC8U 2K3YA 1FXXA 1PD0A 5AYFA 1ZSGA 4QVDA 4M78B 3HRSA 3OYFA 4PJJA 1N5ZA 2R58A 5CQYA 3I55T 3CC7A 4OGEA 2E1HA 2ED1A 2CZ7B 4X34A 1M8VA 2QEXQ 1VQKT 4JS5A 1WHKA 4E7HA 1VQNT 4IUQA 3OYKA 3RR6A 3OYAA 3JB9G 4RG8A 2EQIA 1ZA2B 2NWMA 1G3TA 5GANh 3JCMW 4FCYA 4C92E 4E7LA 1M90R 2HL3A 5GJVB 1YJ9A 3MEAA 5CR2A 3PMTA 1KC8R 2D9TA 2RJCA 2F5TX 5CK9A 1NYGA 1AZEA 1XTDA 2VASA 1JXOA 1OV3A 2CH4W 1XQHA 3F70A 4CRIA 5GAN7 2O88A 1PCXA 1E6HA 3PIOA 1YHQA 1JU5C 1QMCA 2WACA 4MMKA 3SHWA 1JXMA 4KH0B 3VS7A 1SRLA 3VRYA 3BW1A 2CP2A 2MCNA 1AZGB 4AFSC 4F7UB 1VQ6T 2GBQA 5KCHA 3FC3A 3OBWA 3M58A 5FW9A 3OYCA 4CC2A 4J6XA 1D0ZA 5CO7A 4O6JA 3CMAQ 2LT1A 1KQSA 2QI2A 1RAGB 4DBHA 2BE9B 2EQUA 1ZQ1A 5GAN3 5IHKA 5D7UA 3VYHB 2L8DA 1V29B 2COYA 5IN1A 5GAN8 3OYMA 3JB9J 1BI3A 2AHJB 3OS1A 1O9SA 1GFDA 2X4WA 3CCUT 1A0NB 3I55A 1P92A 2VXEA 2EAYA 1Q86R 1K76A 5HK0A 2E6NA 3M0PA 4JJNK 1VQKA 4C8QD 1NZ9A 3LLRA 2EYZA 2NUZA 2EGEA 3G4SQ 1VQNA 1VQMT 2F2VA 2DE0X 1IHVA 4ZGDB 4N4GA 4OB2B 4JLIA 4ORZA 1UUEA 1QCFA 3QBYA 2ZPGB 3FJPA 3A8LB 5LJ5h 2K79A 3EGDA 1QVFA 1BBZA 1WXTA 3CCVQ 3CCQQ 3J81E 2BUDA 4KBMB 2HD0A 4OGCA 1OPLA 2P0PA 3GNFB 4KGVB 3VYGA 5FU7B 3VS0A 2L2PA 4QQ6A 5IT9E 4JDSA 3A8HB 1TTHB 2XK0A 1PSEA 1TSFA 1Y96A 2RI5A 1UG1A 2J06A 1M4ZA 2FL7A 4PFZA 1OULA 5LJ3g 1HYOA 3R6OA 4PK4A 3C94A 4JLGA 3QYGB 2OTLT 2HQXA 3SWNA 4B9WA 3MEVA 1VQ6A 2RJFA 1K9MU 1G3YA 4DOWA 3GOXA 2O01E 4ELYC 2PVDB 2C0TA 3RESA 2EBPA 4Q5WA 1BI1A 1VQ8T 3LGLA 3PE0A 2F1LA 2DIQA 4OMPA 2E70A 3TSWA 3OYBA 1G3SA 3OW2P 2YDLA 4M77C 3QO3A 1S72Q 2RN8A 4R56A 3FLGA 4KUIA 3CC4Q 1PD1A 2MI6A 3EG0A 1RABB 4N4HA 3NHNA 2KROA 2M9UA 2YT6A 3CCUA 3I35A 2RD1A 1K8AU 3L2UA 2XI9A 4A4EA 4C0FA 2RF0A 4EMGA 1RI0A 2RB6A 3JCMX 2EPDA 4N0AC 2E64A 2DZ9A 1D3BA 1ZBJA 2DXUA 1VQMA 2RNAA 2NUPB 2JS0A 1K9MR 2MOXA 1M3CA 1OI1A 4WF2A 4PLLA 2I0NA 4BACA 3Q1JA 3QWXX 4OB1B 3KXTA 3CCJQ 1JJ2P 2O9VA 4QKUA 2FPFA 2MAMA 1M30A 1PRMC 3NTIA 1CSKA 3OYNA 1UEBA 5KYUB 3GNGA 1IXDA 1H641 1QKWA 2YRVA 5C0MA 2KK4A 2DJQA 5KE3A 1VQPQ 4AT1B 2OI3A 5GANj 3EH2A 3L2WA 3REAB 4A54A 1K8AR 1AWXA 3G1JA 4C92A 4M78D 5CIUA 1QVFS 1GFCA 4C8QC 2XDDA 3SD4A 3G6EQ 4HT8A 4M7DC 3VUZA 1HJDA 2YWWA 1RAHB 1AD5A 1PM3A 4BE0A 3M0SA 3JV3A 4ESRA 1N27A 5GAMh 2X3XD 2DTHA 2OTLA 3PT9A 4C8QF 1Y07A 1SEMA 4F14A 2IVWA 1MMGA 4M7DF 1PHTA 3JCMg 3TU4K 1X6OA 3E2UA 1VQ9T 2CP6A 2A36A 3JCMP 1OEBA 1VQ8A 2HAXA 2ZPIB 2YXYA 2YUOA 2FVUA 1W2BA 3QUIA 5GAMe 4KRTA 4JJBA 1WDXA 4UC4A 2JM9A 2CUBA 5GAN2 3G71Q 2K3BA 4E2FB 2QTXA 1MHNA 5GAMd 4PJOG 2J6OA 3QJYA 1SHFA 3QZ5B 3H0HA 2VB6A 1ZUYA 1SF9A 1SKUB 1IGQA 5GMKm 2ZGWA 4Y91A 1GBRA 2QGFB 1D1AA 1UGSB 2DRKA 9ATCB 1NJIC 5L23A 1YP5A 4A4FA 1NPRA 2DAQA 1FMKA 3H41A 2LQKA 4KUDK 4J9IA 4BI4A 1NLPC 2PNIA 2CREA 3CMEA 4LD6A 3TQ7P 1W4SA 4PNOA 5LJ5j 1M2VA 1SSFA 1I5OB 2QEXT 4QW2A 5IH2A 1JEGA 2RHYA 4M77B 2OX7A 1NBEB 4C0DC 4KULA 2M16A 3L2RA 1TWBA 3OYGA 4M75C 1FMVA 4PLIA 4PJOE 4LE9A 1G2BA 1R0BG 2AZSA 4BB7A 2IIMA 3VKIA 5GANg 2DD4A 2A3LA 4N4IA 1TU0B 1UGRB 1WHHA 4YTLA 5HY6A 1XJWB 2AIRB 5FROA 4EMKC 1VQ5Q 3EGXB 1UGQB 4XU2A 4JRQA 2JXBA 2G6FX 3X20B 2K6DA 2X35A 1JRIA 3I56Q 2ROLA 3RKWA 3OS5A 3O5ZA 2JW4A 2K2VA 3CPWA 2KDSA 4RG2A 1YIJQ 4ZN1A 5L8RE 1OYXA 3H0IA 4MDXA 2JMCA 2YHTA 1IB8A 3OSVA 2RQUA 4QVCA 3WXMB 3MP1A 1UFFA 5CQXA 2M0OA 2YLBA 4M78F 4RTZA 3LYIA 4B6MA 1HXDA 1M8MA 3OSSC 4QQDA 1W2BS 2J6KA 4IURA 1H3ZA 2VGMA 2EGAA 4M7DB 3CMAT 4RTUA 2EQKA 2V1QA 4HXJA 4JPBW 3CCLQ 1U8RA 2JUFA 2AZVA 1TXQA 5EG2A 4IUVA 3CEYA 1YJWT 2W0ZA 2DFUA 3H0FA 1I07A 2JJ9A 3OS0A 1WIEA 3PTAA 2VGNA 5GAOl 4FW2A 1BU1A 2SRCA 1NLOC 1RL2A 4RKUE 4JS4A 2QEXA 3NPFA 1Q7YC 1K0XA 2P0QA 3G4ST 3DLMA 1I81A 2KMTA 1OU8A 1KFZA 3G7ZA 1QVPA 2RHIA 3OMGA 3O8VA 2QQ9A 1ZHIA 2CT3A 4V2SA 2KVQG 3CCVT 5HK3A 3CCQT 1F1BB 3BE3A 1PKSA 2QQBA 3A8MB 1WI7A 2YLCA 5LJ5g 8AT1B 4M78A 1IRXA 2OTJQ 3PMIA 1UTIA 3M4YA 2L89A 1ZUUA 2PQWA 4AFUC 4F7UF 2F5KA 1KHCA 4FT4A 3E19A 1NM7A 2EKOA 3C12A 2VYTA 1PWTA 4IIMA 3SFMA 2EW3A 5I22A 3E9FA 4MZPA 2COWA 3CQTA 3EGUA 2FPDA 5GAOr 2K7AA 3L2ZA 3E9GA 2O4XB 2CDTA 4XTXA 2E41A 3HFNA 2X4YA 2O9SA 5CKFA 5IXBA 4C0DB 1KG1A 1QLYA 1C6VX 5KYYB 3V8KA 4M75B 1BB9A 3V7RA 3CMAA 3CPWS 3PIPA 3M4GA 1M5Q1 3TREA 3QSUA 2DL4A 3IQLA 4IKFA 3FEOA 4Z02A 1S72T 3VS6A 1VYUA 1MMNA 1JB0E 3MO8A 3L2VA 1O75A 3HP9A 5A0DA 3CC4T 3DB4A 3LH5A 1YJWA 3D7SB 2EYYA 1OX8A 4A4GA 1LPLA 4JJCA 4EIKA 4FYWB 5IHIA 4GBQA 3G4SA 2XDPA 2ZPHB 1TUCA 3WVEB 1Q82R 2DXBA 5D6XA 4VUBA 1YI2Q 1IREB 3DLLA 3CCJT 3JB9I 2QK0A 3EH1A 2FRYA 4X1VA 3CCVA 2EJ9A 3BDUA 1UJ0A 3CCQA 3CCSQ 3OS2A 2EVRA 3A8OB 4JUVA 3QG1A 2QXFA 1RI9A 2O31A 1VQPT 1ZSZB 3HTRA 2AK5A 4XTVA 3NTKA 1SG5A 5LJ3j 1QVFP 4PJOA 2X4JA 3CXCS 1TG0A 2JVVA 1G83A 4J9HA 1UGVA 5J26A 3G6ET 2DF6A 5DY9A 3M0UA 2K5FA 2FHDA 2BE7D 1GCQC 3META 2XG8D 2NLUA 3PVQA 4M77D 2EJGA 1QWFA 1MMAA 2AKKA 3P8BB 4GLMA 1AWJA 2RQWA 1WGSA 3DKMA 3X24B 3VJPA 4C8QG 1N6AA 3C0CA 4AG1C 1YN8A 5GAMg 4M7DG 1YNZA 2KI7A 4ZNXA 5FU6C 3J7AF 1W70A 2LNHB 2HZYA 2DYIA 1N8RC 2EJFA 1S72A 4J7IA 3OYEA 4GLKA 2HCKA 3CC4A 2KRMA 4LDUA 3CPFA 3RNJA 3GIBA 2VV5A 3G71T 2DM1A 2C0OA 1B7TA 3MPUB 4NOYA 2KYBA 2CGHA 1G3WA 1SSHA 2XMFA 1GRIA 5CKBA 5IXFA 3S3MA 2V1RA 4KH1B 1M1GA 1T3SA 1TUGB 2DEQA 1QVGA 1VYVA 3UT1A 4KGZB 2MPXC 1ZA1B 4C8QE 4E7SA 3CCJA 1GBQA 5HKCA 3QIIA 1RAAB 3VS1A 4FIBA 1AHJB 2L3PA 2DBKA 2DYBA 2ZCFB 1VOMA 4M7AC 1VQOQ 2LCSA 2RQVA 2V8JA
chains in the Genus database with same CATH topology
2P84A 2QYZA 2OX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P84 A;  2QYZ A;  2OX7 A; 
#chains in the Genus database with same CATH topology
 2D8J A;  4M7D D;  2M0Y A;  1LJO A;  4JJD A;  2F2W A;  1VQP A;  4A4K A;  4FL6 A;  1U06 A;  5GMK h;  2VXF A;  2O2O A;  2F69 A;  2J6F A;  4M4Z A;  5KYW A;  2DRM A;  4PJN A;  1KQ2 A;  3GP8 A;  4Z88 A;  1VYT A;  5D6W A;  3RMS A;  3G6E A;  3EHQ A;  2JNG A;  3PGG A;  3NTH A;  3VU3 C;  2FYK A;  4OMM A;  2K9G A;  4Y92 A;  2MYS A;  1K73 U;  2HMA A;  3QZ9 B;  5GMK e;  1V76 A;  2RHZ A;  3M57 A;  3KBG A;  4M75 G;  5KYU A;  1VQ5 T;  2BIV A;  3LX7 A;  1GXI E;  2HNI A;  3S6W A;  3M0T A;  3MJX A;  5J39 A;  1NYF A;  2BKD N;  1RAF B;  2DER A;  4J9B A;  1WX6 A;  1Y71 A;  2BZY A;  3I56 T;  3HFO A;  2GCX A;  4Y28 E;  2LDM A;  2JTM A;  1YIJ T;  1M1K C;  3CD6 Q;  2MK5 A;  5A2Q E;  3G71 A;  3E1S A;  4RTY A;  2KE9 A;  1W2B P;  2AKL A;  2QQS A;  4Z8A A;  4ZTF A;  1UHC A;  4M78 G;  1K73 R;  3UA7 A;  4C5H A;  3QXE B;  2SEM A;  3HRU A;  2MIO A;  2A0F B;  2JTF A;  1R8O B;  4M77 F;  1ZLM A;  4J8O A;  3CCL T;  1KQS S;  1WFW A;  4LDW A;  3RER A;  1XNI A;  3OBY A;  4HCZ A;  4DBQ A;  3URG A;  4M75 D;  2M1H A;  3FRN A;  1WHM A;  5AT1 B;  1UGP B;  5FU6 B;  3JCM c;  2JOY A;  2HSE B;  1M3A A;  3EFO A;  3GLX A;  1I5L A;  2CP0 A;  1YJN Q;  2EYX A;  1M90 C;  4EDU A;  3TVT A;  4FSX A;  1VIF A;  3C4S A;  4J9G A;  4D6W A;  1B3Q A;  3QYH B;  4HKE A;  4DBF A;  1KC8 C;  2RJD A;  2HEQ A;  2GTJ A;  5CCA A;  4QQG A;  3M0Q A;  4M78 E;  1MMD A;  2ABL A;  2D1X A;  2I2L A;  1VQK Q;  5KYX A;  3EG9 A;  1YIT Q;  1VQ5 A;  3CBP A;  3UF4 A;  3JSC A;  3I56 A;  1Y0M A;  4F7U G;  4M7A B;  3X28 B;  4M77 A;  3LWI A;  4PJM A;  1UJY A;  2DO3 A;  2ZPB B;  4LD9 K;  4E7Z A;  1YIJ A;  1SRM A;  3AT1 B;  1QCN A;  3GPL A;  4RCB A;  4PFO A;  3THK A;  3MEU A;  5HCK A;  2FZG B;  2P4R A;  1AEY A;  2C06 A;  4N0A A;  4MZM A;  1KD1 U;  1LOJ A;  1D0X A;  7AT1 B;  3CPW P;  2DL3 A;  2R5M A;  2DLP A;  1PKT A;  4C0G A;  1BKB A;  3EGX A;  1WHG A;  3QJ6 A;  3LH0 A;  2RHU A;  2MF2 A;  1Q86 C;  3CCL A;  4ME7 A;  4XTU A;  2FPE A;  5DLQ E;  2H3J A;  2X4X A;  1D3B B;  3BDL A;  1ZUK A;  3QPH A;  1VQ4 Q;  4F7U E;  1X2Q A;  1OOT A;  1C1A A;  4KGX B;  3S3O A;  2Y90 A;  2EIF A;  1Y7X A;  3EG1 A;  4LNP A;  4J9F A;  4C8Q A;  3HL8 A;  3H9N A;  3HHT B;  1KD1 R;  1RLQ C;  5FLX E;  5GAO q;  2YSQ A;  4M7D A;  3RUX A;  4HVV A;  1K1Z A;  2VVK A;  1YI2 T;  2YRC A;  1XOV A;  3CCS T;  2L3Q A;  4BDZ A;  2ED0 A;  2DA9 A;  4C92 B;  1N9R A;  4OMF B;  2MWP A;  3L1A A;  1X01 A;  3CXC P;  2E6Z A;  2CSI A;  3P8D A;  1D1C A;  2LNV A;  4M75 F;  3X25 B;  3TSZ A;  2LT4 A;  2EKH A;  5DLO A;  3L2Q A;  4BUG A;  4A63 B;  3M0R A;  4FU6 A;  4FYV B;  1AT1 B;  3TCJ A;  3WVD B;  1U5S A;  1VQ9 A;  1I1J A;  2DKG A;  2L5Q A;  3RIR A;  2KYM A;  1YCS B;  3LWH A;  1BK2 A;  5GAO n;  2ENM A;  2VWF A;  4RTT A;  2NUT A;  3A1P A;  4BI3 A;  4FYY B;  2LCL A;  4AFQ C;  2KXC A;  2QDL A;  4DEY A;  3R6N A;  4L59 A;  1N8R U;  1IZ6 A;  1H8K A;  1Y57 A;  4EPC A;  3PNW C;  2XKO C;  3I5S A;  2EFI A;  1IHW A;  1T3L A;  4X9D A;  2CP3 A;  1JO8 A;  4RTV A;  3QHS A;  1IO6 A;  1E6G A;  2J7I A;  1VQ7 Q;  1R0C B;  1ZSZ C;  2O4X A;  4E7J A;  1TOV A;  2CP5 A;  1I4K 1;  2BZ8 A;  3EG3 A;  5KYY A;  2FO0 A;  4AG2 C;  4M75 A;  1DJ7 B;  1YWO A;  2DBM A;  3M53 A;  4XK8 E;  5GAN 4;  1MGQ A;  2KBT A;  4CC4 B;  4HCB A;  4R55 A;  3A98 A;  1YI2 A;  1GCP A;  2ROT A;  4L5G A;  1VQL Q;  4PFP A;  2K3X A;  3CCS A;  1J3T A;  2CZ6 B;  1VQO T;  1K8A C;  3JB9 H;  2KR3 A;  4EMK A;  2PVO B;  2DZC A;  3OYH A;  3LGF A;  1OX9 A;  2DL7 A;  4ZGE B;  3SEM A;  3GF5 A;  2KEA A;  1Z9Z A;  5FWC A;  2VC8 A;  2DEU A;  2Z0W A;  1H92 A;  4J83 A;  2LZ6 B;  3H8Z A;  1K4U S;  3OYD A;  1HK9 A;  1BCM A;  2LQ8 A;  1OQK A;  2DTI A;  4MZT A;  3CME Q;  2GFU A;  1W6X A;  4QVZ A;  5GAM j;  2WSF E;  2D8H A;  2JMA A;  2CYZ B;  3JAM E;  4HVW A;  2X9H A;  4LUE A;  1S1N A;  1RLP C;  1X6G A;  3INZ A;  3ME9 A;  1AWW A;  3JCM b;  1UE9 A;  3V7C A;  1BIA A;  2EQM A;  4LDX A;  1WA7 A;  4OMQ A;  2E3H A;  3CC2 Q;  4CI0 C;  1M1K U;  1BYM A;  2V8I A;  3CD6 T;  1GL5 A;  2KRN A;  4L6V 5;  4QT7 A;  1B34 B;  1WXU A;  3CCM Q;  3CCR Q;  8ATC B;  1WZO A;  3CCE Q;  2QQA A;  4MDW A;  4TVR A;  2XIC A;  5LJ3 f;  3JCM Q;  4M7A D;  1RAD B;  1BIB A;  4C5E A;  1D09 B;  1QW1 A;  2IG0 A;  1AVZ C;  1I0C A;  2L3S A;  4KT0 E;  3RDV A;  1KQS P;  2VUB A;  3M5A A;  1WLP B;  4Z89 A;  2K5L A;  4XAX B;  3JCM d;  2RH2 A;  4E7I A;  2LMJ A;  4F7U A;  4IIO A;  4M77 G;  2B8A A;  2CZ0 B;  1VQO A;  2XID A;  2QTV A;  5CKE A;  1YFN A;  1WNL A;  5GAN 6;  1M1K R;  2DPP B;  2FZC B;  1ARK A;  2PUK B;  3REB B;  1Q81 C;  2CUD A;  4PL6 A;  1M90 U;  1U3O A;  2FZK B;  5EC7 A;  1YJN T;  2OJ2 A;  5I11 A;  1V1C A;  4C5G A;  1X6B A;  5FWB A;  4AFZ C;  2EGC A;  1HD3 A;  1KQ1 A;  4LXC A;  1NEG A;  2KGT A;  1U1T A;  5CKH A;  3CBM A;  4J9C A;  1QKX A;  5LL6 S;  2RMO A;  2R5A A;  3JCM V;  2M02 A;  3FB9 A;  4BY6 B;  3OA6 A;  3VS3 A;  4II1 A;  1YIT T;  3OB9 A;  1WHL A;  3NFC A;  1ABO A;  4M77 E;  2DMO A;  4OB3 B;  4F17 A;  3QDF A;  3OYL A;  4AMC A;  2RHX A;  2E3I A;  4J5Y A;  4C92 D;  2LQN A;  2RA2 A;  6AT1 B;  3CD6 A;  1WQW A;  3M56 A;  5KCO A;  1WJR A;  2LX9 A;  4XU0 A;  1OPK A;  1HSQ A;  1FX7 A;  1MND A;  4BE1 A;  2GGR A;  2LJ1 A;  2QA4 Q;  2M51 A;  4IUP A;  5GAN e;  3RKX A;  1KSW A;  3OYI A;  2A28 A;  4FYX B;  1G8X A;  5I2M A;  1Q86 U;  2KAF A;  3MHX A;  1EIF A;  2DIG A;  2CSQ A;  4LN2 A;  4ZN3 A;  3C95 A;  3JCM f;  4J9E A;  5GAN d;  2GQI A;  5M9O A;  1M3B A;  1PNJ A;  2HKN A;  2V26 A;  4OF1 A;  1VQ4 T;  5CAI A;  3A5Z B;  2D6F A;  3EFR A;  2V8K A;  1MNE A;  3VV0 A;  3JB9 D;  2PUO B;  2QAZ A;  1VUB A;  1NJI U;  4JZ4 A;  2R57 A;  2JTE A;  1YJN A;  3M54 A;  1TS9 A;  1LNX A;  2GF7 A;  4C0Z A;  4XU3 A;  1EZZ B;  2JZ2 A;  4M7D E;  3UDC A;  4EMH A;  3SWN C;  2DJZ A;  2X3W D;  4OML A;  2GFA A;  4XQ3 A;  2RQT A;  2ZAE A;  3M9Q A;  2RK1 A;  4HCK A;  3U23 A;  4JRK A;  1M27 C;  1YJW Q;  2E65 A;  1GCQ A;  4HA8 A;  4CC7 A;  4M7A F;  5I21 A;  3J80 E;  3A8G B;  4PJO B;  3VUB A;  4NS5 A;  2HBP A;  2E4H A;  4OMO A;  3FJ5 A;  4BD3 A;  2G3R A;  1YIT A;  1RUW A;  2D0N A;  2NUP A;  3RKY A;  2E12 A;  3I9Q A;  3P8H A;  4J9D A;  3CC7 Q;  1NJI R;  3ER0 A;  1LCK A;  2P4T A;  3MCA B;  5I2S A;  4C5I A;  1FYN A;  3N5B B;  4HCC A;  4D8D A;  1MV3 A;  4E6R A;  2LTO A;  4NL2 A;  5LJ5 e;  1WJQ A;  2JN0 A;  3TEE A;  1YJ9 Q;  2RJE A;  2DL5 A;  2PZ1 A;  2LX7 A;  2MWO A;  2QAS A;  4E47 A;  1PRL C;  2Y4Y A;  2DNU A;  2WSE E;  5GAN f;  4K11 A;  2RPN A;  3KUF A;  5LJ5 d;  4B9X A;  2X51 A;  1PC0 A;  2L0A A;  4M7A A;  4JRI A;  4PJL A;  2NYS A;  4A53 A;  1U1S A;  1VQ4 A;  3HPW A;  1YHQ Q;  1CKA A;  4C92 C;  2H3E B;  4X9C A;  1VQ7 T;  1Q82 C;  1H3H A;  4J6Y A;  1X2K A;  2A08 A;  1AWO A;  4JRP A;  2RQR A;  3JCM J;  4M75 E;  1SHG A;  1WYX A;  1T0H A;  1AOJ A;  4C92 F;  1WQ7 A;  4ANJ A;  4IUT A;  4OP0 A;  1OZ2 A;  2DVJ A;  2HDA A;  1Q7Y U;  2EQJ A;  5KE2 A;  1QVG S;  1VQL T;  2LRQ A;  2YUQ A;  2CT4 A;  3EGD B;  1QWE A;  3ZFJ A;  1JBM A;  2DX1 A;  5KYW B;  1KK7 A;  3V7S A;  2DVE A;  2JT4 A;  2WSC E;  2F2X A;  2E10 A;  3I55 Q;  2CKK A;  5IAY A;  2XD0 A;  4DA4 A;  3ZEH A;  1Y96 B;  1NEB A;  2HL5 C;  2K2M A;  4ZTJ A;  4A4H A;  3NMZ C;  4CC3 A;  4XTW A;  2LVM A;  3LW5 E;  3JRZ A;  3JB9 F;  1VQN Q;  3GBQ A;  1D0Y A;  2OTJ T;  1YBY A;  3CME T;  1OU9 A;  1WPY A;  3PVL A;  3UAT A;  4DQ2 A;  4D8K A;  2KY9 A;  3SWN B;  1D1B A;  1RAC B;  1Q7Y R;  1ACM B;  1FMW A;  2IPO B;  1RAI B;  3QDR B;  2K5I A;  1W1F A;  2K4Y A;  4GY5 A;  3DB3 A;  1RAE B;  2LJ0 A;  3HRT A;  2P0K A;  3I5R A;  1ZX6 A;  5LJ5 f;  1Z9Q A;  3V8L A;  3CC2 T;  1NE8 A;  2JM8 A;  4MML A;  3EG2 A;  2GQV A;  3CCM T;  3CCR T;  1M9S A;  1VQ7 A;  3CCE T;  2CP7 A;  1FWZ A;  2GNC A;  4RTW A;  1BI0 A;  3ULR B;  5ECA A;  2DXT A;  1VQ6 Q;  3ASK A;  4RTX A;  3OW2 A;  3HSB A;  3QWY A;  2AT1 B;  2LC4 A;  5J3B A;  3VRZ A;  4OVA A;  5GMK l;  4WCI A;  4XTY A;  3MEW A;  2COZ A;  1VQL A;  3EFO B;  3X26 B;  2BZX A;  1ABQ A;  5A0G A;  2KXD A;  3UWN A;  1Q81 U;  3SB2 A;  4E7K A;  3OMC A;  2RI3 A;  3VS4 A;  1EFN A;  5GMK j;  3CCU Q;  2B86 A;  1JJ2 A;  3VS2 A;  5CKD A;  2BTT A;  1VA7 A;  4FSS A;  4OMN A;  2GTO A;  5KYX B;  3EG9 B;  2QYZ A;  2RK2 A;  2C0I A;  2YUN A;  4RUG A;  4BE2 A;  5FRN A;  1VQM Q;  1TUD A;  2OTJ A;  2PTK A;  3BFM A;  1WXB A;  1M2O A;  2EYQ A;  2KQW A;  3SDZ A;  3RMQ A;  2LP5 A;  5KYN A;  2YRD A;  4P5N A;  2P84 A;  1Q81 R;  2KT8 A;  2L3R A;  2QG9 B;  2DET A;  3FIF A;  2D0Q B;  5LJ3 h;  4PJO D;  1MUZ A;  2LCC A;  3RBB B;  3CC2 A;  1NPP A;  4FT2 A;  2K57 A;  2OAW A;  1K0S A;  1B07 A;  3UPU A;  1UB4 A;  4ATO A;  1K73 C;  3MP8 A;  2QDY B;  3CCR A;  3CCM A;  1ZBX A;  1N9S A;  2XDB A;  1R77 A;  3AHU A;  1PG5 B;  2JS2 A;  2HBW A;  3CCE A;  2RM4 A;  4BI8 B;  2OTL Q;  3PFS A;  2QA4 T;  3ZBD A;  4WTO B;  5LJ3 e;  2VKN A;  4F16 A;  2PU9 B;  3EFS A;  1BCO A;  2XU8 A;  4M78 C;  1K9M C;  2KRS A;  4DOV A;  1C0M A;  2DK3 A;  2QQR A;  3MKD A;  3CBO A;  1UHF A;  5GAM f;  2KSS A;  5C6S A;  2W10 A;  1QP3 A;  1VQ8 Q;  1X43 A;  3OYJ A;  5LJ3 d;  2CH4 A;  2ZPF B;  4BY6 C;  4FW1 A;  2A7Y A;  4C8Q B;  2LJ3 A;  4ZGJ B;  2ZPE B;  2ESW A;  2EYW A;  3OW2 S;  1B34 A;  1G5V A;  2A37 A;  1M2V B;  1Q95 G;  2ECZ A;  1EX4 A;  5FRM A;  2DD5 A;  2EWN A;  1N8R R;  1WHJ A;  3M59 A;  4JZ3 A;  2CZ1 B;  5KH6 A;  2QGG A;  4J6W A;  3L42 A;  5GJW B;  2RO0 A;  4IUU A;  1KHI A;  1KIK A;  5GAO m;  1T0J A;  1X69 A;  4LDY A;  5A0L A;  2E5Q A;  1OZ3 A;  4PKC C;  3BY7 A;  4M7A G;  2HQH A;  3ZL7 C;  1MV0 B;  4LDV A;  1JJ2 S;  2DXC A;  1E7O A;  2DTO A;  2FG0 A;  1JQQ A;  4XU1 A;  3OY9 A;  1YWP A;  2FRW A;  4DBR A;  3CXC A;  3CC7 T;  2MMP A;  1UEC A;  3VS5 A;  5GMK i;  1QQJ A;  1YCY A;  2XHC A;  3OQ5 A;  3EHR A;  2NUT B;  2KT1 A;  3KFV A;  1PSF A;  3UA6 A;  5GAN 5;  1WJS A;  2ZZD A;  1ZSZ A;  1TH7 A;  2YUP A;  4NL3 A;  3JCM h;  1QCO A;  1VIE A;  2RI2 A;  3MP6 A;  2HKQ B;  4HVU A;  2QA4 A;  1YJ9 T;  2OAU A;  3T9N A;  4FM4 B;  4O5V A;  3HKS A;  1X75 C;  2H8H A;  1SPK A;  4BDY A;  2J05 A;  4J7F A;  4ELZ C;  4M7A E;  3EAE A;  2DIL A;  1I8F A;  2ATC B;  1VQ9 Q;  4R0K A;  3FDR A;  2FB7 A;  1NG2 A;  4XTZ A;  1M1F A;  4LUD A;  4DEX A;  5GAO p;  4PJO C;  3JCM e;  4F04 B;  1YHQ T;  3QKJ A;  1Q82 U;  1CKB A;  1KD1 C;  2E5K A;  3M55 A;  5IHN A;  4OB0 B;  3OYY A;  4HT9 A;  2CS7 A;  1BI2 A;  2LQW A;  1K9A A;  2HQE A;  4RMO A;  3NGP A;  4PJO F;  3S3N A;  2FEI A;  2KNB B;  2DL8 A;  2PVG B;  5CVI A;  1UDL A;  4C92 G;  1QVG P;  2HSP A;  1X27 A;  4EMK B;  1KJW A;  1QP2 A;  3V8J A;  5DM7 R;  2Y4X A;  5FU7 C;  4RCC A;  1LVK A;  1IGU A;  5D6Y A;  3H6Z A;  1KC8 U;  2K3Y A;  1FXX A;  1PD0 A;  5AYF A;  1ZSG A;  4QVD A;  4M78 B;  3HRS A;  3OYF A;  4PJJ A;  1N5Z A;  2R58 A;  5CQY A;  3I55 T;  3CC7 A;  4OGE A;  2E1H A;  2ED1 A;  2CZ7 B;  4X34 A;  1M8V A;  2QEX Q;  1VQK T;  4JS5 A;  1WHK A;  4E7H A;  1VQN T;  4IUQ A;  3OYK A;  3RR6 A;  3OYA A;  3JB9 G;  4RG8 A;  2EQI A;  1ZA2 B;  2NWM A;  1G3T A;  5GAN h;  3JCM W;  4FCY A;  4C92 E;  4E7L A;  1M90 R;  2HL3 A;  5GJV B;  1YJ9 A;  3MEA A;  5CR2 A;  3PMT A;  1KC8 R;  2D9T A;  2RJC A;  2F5T X;  5CK9 A;  1NYG A;  1AZE A;  1XTD A;  2VAS A;  1JXO A;  1OV3 A;  2CH4 W;  1XQH A;  3F70 A;  4CRI A;  5GAN 7;  2O88 A;  1PCX A;  1E6H A;  3PIO A;  1YHQ A;  1JU5 C;  1QMC A;  2WAC A;  4MMK A;  3SHW A;  1JXM A;  4KH0 B;  3VS7 A;  1SRL A;  3VRY A;  3BW1 A;  2CP2 A;  2MCN A;  1AZG B;  4AFS C;  4F7U B;  1VQ6 T;  2GBQ A;  5KCH A;  3FC3 A;  3OBW A;  3M58 A;  5FW9 A;  3OYC A;  4CC2 A;  4J6X A;  1D0Z A;  5CO7 A;  4O6J A;  3CMA Q;  2LT1 A;  1KQS A;  2QI2 A;  1RAG B;  4DBH A;  2BE9 B;  2EQU A;  1ZQ1 A;  5GAN 3;  5IHK A;  5D7U A;  3VYH B;  2L8D A;  1V29 B;  2COY A;  5IN1 A;  5GAN 8;  3OYM A;  3JB9 J;  1BI3 A;  2AHJ B;  3OS1 A;  1O9S A;  1GFD A;  2X4W A;  3CCU T;  1A0N B;  3I55 A;  1P92 A;  2VXE A;  2EAY A;  1Q86 R;  1K76 A;  5HK0 A;  2E6N A;  3M0P A;  4JJN K;  1VQK A;  4C8Q D;  1NZ9 A;  3LLR A;  2EYZ A;  2NUZ A;  2EGE A;  3G4S Q;  1VQN A;  1VQM T;  2F2V A;  2DE0 X;  1IHV A;  4ZGD B;  4N4G A;  4OB2 B;  4JLI A;  4ORZ A;  1UUE A;  1QCF A;  3QBY A;  2ZPG B;  3FJP A;  3A8L B;  5LJ5 h;  2K79 A;  3EGD A;  1QVF A;  1BBZ A;  1WXT A;  3CCV Q;  3CCQ Q;  3J81 E;  2BUD A;  4KBM B;  2HD0 A;  4OGC A;  1OPL A;  2P0P A;  3GNF B;  4KGV B;  3VYG A;  5FU7 B;  3VS0 A;  2L2P A;  4QQ6 A;  5IT9 E;  4JDS A;  3A8H B;  1TTH B;  2XK0 A;  1PSE A;  1TSF A;  1Y96 A;  2RI5 A;  1UG1 A;  2J06 A;  1M4Z A;  2FL7 A;  4PFZ A;  1OUL A;  5LJ3 g;  1HYO A;  3R6O A;  4PK4 A;  3C94 A;  4JLG A;  3QYG B;  2OTL T;  2HQX A;  3SWN A;  4B9W A;  3MEV A;  1VQ6 A;  2RJF A;  1K9M U;  1G3Y A;  4DOW A;  3GOX A;  2O01 E;  4ELY C;  2PVD B;  2C0T A;  3RES A;  2EBP A;  4Q5W A;  1BI1 A;  1VQ8 T;  3LGL A;  3PE0 A;  2F1L A;  2DIQ A;  4OMP A;  2E70 A;  3TSW A;  3OYB A;  1G3S A;  3OW2 P;  2YDL A;  4M77 C;  3QO3 A;  1S72 Q;  2RN8 A;  4R56 A;  3FLG A;  4KUI A;  3CC4 Q;  1PD1 A;  2MI6 A;  3EG0 A;  1RAB B;  4N4H A;  3NHN A;  2KRO A;  2M9U A;  2YT6 A;  3CCU A;  3I35 A;  2RD1 A;  1K8A U;  3L2U A;  2XI9 A;  4A4E A;  4C0F A;  2RF0 A;  4EMG A;  1RI0 A;  2RB6 A;  3JCM X;  2EPD A;  4N0A C;  2E64 A;  2DZ9 A;  1D3B A;  1ZBJ A;  2DXU A;  1VQM A;  2RNA A;  2NUP B;  2JS0 A;  1K9M R;  2MOX A;  1M3C A;  1OI1 A;  4WF2 A;  4PLL A;  2I0N A;  4BAC A;  3Q1J A;  3QWX X;  4OB1 B;  3KXT A;  3CCJ Q;  1JJ2 P;  2O9V A;  4QKU A;  2FPF A;  2MAM A;  1M30 A;  1PRM C;  3NTI A;  1CSK A;  3OYN A;  1UEB A;  5KYU B;  3GNG A;  1IXD A;  1H64 1;  1QKW A;  2YRV A;  5C0M A;  2KK4 A;  2DJQ A;  5KE3 A;  1VQP Q;  4AT1 B;  2OI3 A;  5GAN j;  3EH2 A;  3L2W A;  3REA B;  4A54 A;  1K8A R;  1AWX A;  3G1J A;  4C92 A;  4M78 D;  5CIU A;  1QVF S;  1GFC A;  4C8Q C;  2XDD A;  3SD4 A;  3G6E Q;  4HT8 A;  4M7D C;  3VUZ A;  1HJD A;  2YWW A;  1RAH B;  1AD5 A;  1PM3 A;  4BE0 A;  3M0S A;  3JV3 A;  4ESR A;  1N27 A;  5GAM h;  2X3X D;  2DTH A;  2OTL A;  3PT9 A;  4C8Q F;  1Y07 A;  1SEM A;  4F14 A;  2IVW A;  1MMG A;  4M7D F;  1PHT A;  3JCM g;  3TU4 K;  1X6O A;  3E2U A;  1VQ9 T;  2CP6 A;  2A36 A;  3JCM P;  1OEB A;  1VQ8 A;  2HAX A;  2ZPI B;  2YXY A;  2YUO A;  2FVU A;  1W2B A;  3QUI A;  5GAM e;  4KRT A;  4JJB A;  1WDX A;  4UC4 A;  2JM9 A;  2CUB A;  5GAN 2;  3G71 Q;  2K3B A;  4E2F B;  2QTX A;  1MHN A;  5GAM d;  4PJO G;  2J6O A;  3QJY A;  1SHF A;  3QZ5 B;  3H0H A;  2VB6 A;  1ZUY A;  1SF9 A;  1SKU B;  1IGQ A;  5GMK m;  2ZGW A;  4Y91 A;  1GBR A;  2QGF B;  1D1A A;  1UGS B;  2DRK A;  9ATC B;  1NJI C;  5L23 A;  1YP5 A;  4A4F A;  1NPR A;  2DAQ A;  1FMK A;  3H41 A;  2LQK A;  4KUD K;  4J9I A;  4BI4 A;  1NLP C;  2PNI A;  2CRE A;  3CME A;  4LD6 A;  3TQ7 P;  1W4S A;  4PNO A;  5LJ5 j;  1M2V A;  1SSF A;  1I5O B;  2QEX T;  4QW2 A;  5IH2 A;  1JEG A;  2RHY A;  4M77 B;  2OX7 A;  1NBE B;  4C0D C;  4KUL A;  2M16 A;  3L2R A;  1TWB A;  3OYG A;  4M75 C;  1FMV A;  4PLI A;  4PJO E;  4LE9 A;  1G2B A;  1R0B G;  2AZS A;  4BB7 A;  2IIM A;  3VKI A;  5GAN g;  2DD4 A;  2A3L A;  4N4I A;  1TU0 B;  1UGR B;  1WHH A;  4YTL A;  5HY6 A;  1XJW B;  2AIR B;  5FRO A;  4EMK C;  1VQ5 Q;  3EGX B;  1UGQ B;  4XU2 A;  4JRQ A;  2JXB A;  2G6F X;  3X20 B;  2K6D A;  2X35 A;  1JRI A;  3I56 Q;  2ROL A;  3RKW A;  3OS5 A;  3O5Z A;  2JW4 A;  2K2V A;  3CPW A;  2KDS A;  4RG2 A;  1YIJ Q;  4ZN1 A;  5L8R E;  1OYX A;  3H0I A;  4MDX A;  2JMC A;  2YHT A;  1IB8 A;  3OSV A;  2RQU A;  4QVC A;  3WXM B;  3MP1 A;  1UFF A;  5CQX A;  2M0O A;  2YLB A;  4M78 F;  4RTZ A;  3LYI A;  4B6M A;  1HXD A;  1M8M A;  3OSS C;  4QQD A;  1W2B S;  2J6K A;  4IUR A;  1H3Z A;  2VGM A;  2EGA A;  4M7D B;  3CMA T;  4RTU A;  2EQK A;  2V1Q A;  4HXJ A;  4JPB W;  3CCL Q;  1U8R A;  2JUF A;  2AZV A;  1TXQ A;  5EG2 A;  4IUV A;  3CEY A;  1YJW T;  2W0Z A;  2DFU A;  3H0F A;  1I07 A;  2JJ9 A;  3OS0 A;  1WIE A;  3PTA A;  2VGN A;  5GAO l;  4FW2 A;  1BU1 A;  2SRC A;  1NLO C;  1RL2 A;  4RKU E;  4JS4 A;  2QEX A;  3NPF A;  1Q7Y C;  1K0X A;  2P0Q A;  3G4S T;  3DLM A;  1I81 A;  2KMT A;  1OU8 A;  1KFZ A;  3G7Z A;  1QVP A;  2RHI A;  3OMG A;  3O8V A;  2QQ9 A;  1ZHI A;  2CT3 A;  4V2S A;  2KVQ G;  3CCV T;  5HK3 A;  3CCQ T;  1F1B B;  3BE3 A;  1PKS A;  2QQB A;  3A8M B;  1WI7 A;  2YLC A;  5LJ5 g;  8AT1 B;  4M78 A;  1IRX A;  2OTJ Q;  3PMI A;  1UTI A;  3M4Y A;  2L89 A;  1ZUU A;  2PQW A;  4AFU C;  4F7U F;  2F5K A;  1KHC A;  4FT4 A;  3E19 A;  1NM7 A;  2EKO A;  3C12 A;  2VYT A;  1PWT A;  4IIM A;  3SFM A;  2EW3 A;  5I22 A;  3E9F A;  4MZP A;  2COW A;  3CQT A;  3EGU A;  2FPD A;  5GAO r;  2K7A A;  3L2Z A;  3E9G A;  2O4X B;  2CDT A;  4XTX A;  2E41 A;  3HFN A;  2X4Y A;  2O9S A;  5CKF A;  5IXB A;  4C0D B;  1KG1 A;  1QLY A;  1C6V X;  5KYY B;  3V8K A;  4M75 B;  1BB9 A;  3V7R A;  3CMA A;  3CPW S;  3PIP A;  3M4G A;  1M5Q 1;  3TRE A;  3QSU A;  2DL4 A;  3IQL A;  4IKF A;  3FEO A;  4Z02 A;  1S72 T;  3VS6 A;  1VYU A;  1MMN A;  1JB0 E;  3MO8 A;  3L2V A;  1O75 A;  3HP9 A;  5A0D A;  3CC4 T;  3DB4 A;  3LH5 A;  1YJW A;  3D7S B;  2EYY A;  1OX8 A;  4A4G A;  1LPL A;  4JJC A;  4EIK A;  4FYW B;  5IHI A;  4GBQ A;  3G4S A;  2XDP A;  2ZPH B;  1TUC A;  3WVE B;  1Q82 R;  2DXB A;  5D6X A;  4VUB A;  1YI2 Q;  1IRE B;  3DLL A;  3CCJ T;  3JB9 I;  2QK0 A;  3EH1 A;  2FRY A;  4X1V A;  3CCV A;  2EJ9 A;  3BDU A;  1UJ0 A;  3CCQ A;  3CCS Q;  3OS2 A;  2EVR A;  3A8O B;  4JUV A;  3QG1 A;  2QXF A;  1RI9 A;  2O31 A;  1VQP T;  1ZSZ B;  3HTR A;  2AK5 A;  4XTV A;  3NTK A;  1SG5 A;  5LJ3 j;  1QVF P;  4PJO A;  2X4J A;  3CXC S;  1TG0 A;  2JVV A;  1G83 A;  4J9H A;  1UGV A;  5J26 A;  3G6E T;  2DF6 A;  5DY9 A;  3M0U A;  2K5F A;  2FHD A;  2BE7 D;  1GCQ C;  3MET A;  2XG8 D;  2NLU A;  3PVQ A;  4M77 D;  2EJG A;  1QWF A;  1MMA A;  2AKK A;  3P8B B;  4GLM A;  1AWJ A;  2RQW A;  1WGS A;  3DKM A;  3X24 B;  3VJP A;  4C8Q G;  1N6A A;  3C0C A;  4AG1 C;  1YN8 A;  5GAM g;  4M7D G;  1YNZ A;  2KI7 A;  4ZNX A;  5FU6 C;  3J7A F;  1W70 A;  2LNH B;  2HZY A;  2DYI A;  1N8R C;  2EJF A;  1S72 A;  4J7I A;  3OYE A;  4GLK A;  2HCK A;  3CC4 A;  2KRM A;  4LDU A;  3CPF A;  3RNJ A;  3GIB A;  2VV5 A;  3G71 T;  2DM1 A;  2C0O A;  1B7T A;  3MPU B;  4NOY A;  2KYB A;  2CGH A;  1G3W A;  1SSH A;  2XMF A;  1GRI A;  5CKB A;  5IXF A;  3S3M A;  2V1R A;  4KH1 B;  1M1G A;  1T3S A;  1TUG B;  2DEQ A;  1QVG A;  1VYV A;  3UT1 A;  4KGZ B;  2MPX C;  1ZA1 B;  4C8Q E;  4E7S A;  3CCJ A;  1GBQ A;  5HKC A;  3QII A;  1RAA B;  3VS1 A;  4FIB A;  1AHJ B;  2L3P A;  2DBK A;  2DYB A;  2ZCF B;  1VOM A;  4M7A C;  1VQO Q;  2LCS A;  2RQV A;  2V8J A; 
#chains in the Genus database with same CATH homology
 2P84 A;  2QYZ A;  2OX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...