4M75A

Crystal structure of lsm1-7 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
139
Chain Sequence
b'DLYLDQYNFTTTAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 23
structure length 139
sequence length 141
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75A00
4M7AB 5GAMd 3HFOA 2RM4A 4JUVA 1KQ2A 2EWNA 4M7AE 4F7UA 1U1TA 2EAYA 4XU0A 3JCMP 3BDUA 1D3BB 1WQWA 2DTIA 2FYKA 1M5Q1 1LOJA 3AHUA 1M8VA 5GAN4 4XU1A 1BIAA 1LNXA 3QSUA 5GAOq 2DZCA 4JLIA 2RD1A 1X01A 1YCYA 2VXFA 2YLCA 3EFSA 3QHSA 4C92C 4C92D 4C92A 4HA8A 4M78B 3EFRA 3JCMJ 3QUIA 4M78E 4EMGA 2E10A 3RKYA 2VXEA 5LJ5j 4QVCA 3BFMA 3JB9D 5GAN2 5GANd 4PJOD 4PJOC 5GMKe 4M7AF 4PJOA 3JB9F 4C8QB 1LJOA 5GMKh 4M7DG 2DXUA 4C8QE 2EJ9A 5LJ5f 3HSBA 3L1AA 4J5YA 2HNIA 4M7AG 3RERA 1B34A 1B34B 3PGGA 5LJ3e 4F7UB 1MGQA 5LJ3h 5CAIA 4J6XA 4XTZA 1Y96A 1WNLA 1HK9A 3BW1A 4XTXA 4F7UE 5LJ5d 3JCMQ 1U1SA 3V8LA 2EJFA 5GAOr 1I4K1 4M78F 4M75D 4M77D 4PNOA 4M7DD 4M75C 4M77C 4M77A 4M75A 4C92B 4M7DA 4M7DC 4PJOE 3RIRA 4M78G 1I8FA 4NL2A 4XTYA 3JCMV 4C92E 5I21A 3BY7A 3RKWA 5GAN8 4RCBA 4EMKC 5GAN5 4MMKA 1KQ1A 4C8QF 2E65A 4XTVA 2DJZA 4XQ3A 5GAMe 2DKGA 3V8JA 5GAMh 4Y91A 3INZA 2YLBA 2DTHA 4PJOB 1N9SA 2RA2A 4C8QG 3SWNC 2E64A 5GANe 4N0AC 3JB9J 3V7SA 5GANh 3JB9H 4F7UF 5LJ5e 4OP0A 5LJ5h 3JCMg 3JB9G 4HT8A 5GAOm 2JN0A 4NOYA 4XU3A 1JRIA 3JCMX 2YHTA 4F7UG 2VC8A 4QVDA 1Y96B 3JCMf 2DTOA 2QTXA 4M7DB 4C92F 4EMHA 1TH7A 5GMKj 2DZ9A 3RESA 4A54A 2DVEA 2EJGA 2DEQA 4M75B 2FB7A 4M77B 1HXDA 3V7CA 1N9RA 4JRKA 4C92G 4M75E 4M77E 3JCMd 3VU3C 4M7DE 5GAOp 5GMKm 3FJPA 1BIBA 4V2SA 4EMKA 3M4GA 4MMLA 5LJ3j 3JCMW 3GIBA 3JCMc 5LJ3g 4PJOF 1H641 4WF2A 4M7AD 2E1HA 4M7AC 4M7AA 4A53A 3SB2A 3V8KA 4PJOG 5LJ3f 5GAOl 3SWNA 2K57A 1D3BA 4N0AA 3SWNB 5GAN7 3QO3A 3V7RA 1I5LA 4HT9A 5GMKi 3JCMb 2DXTA 5GAOn 2RB6A 3L2ZA 5LJ3d 4M78D 2ZGWA 4J6YA 4M78C 4M78A 3JCMe 3FB9A 4X9DA 4DQ2A 4M75F 4M77F 3JCMh 3RKXA 4XTWA 4RCCA 5GAMj 5GAMg 2CGHA 5GAN3 4M7DF 3HFNA 1JBMA 5GMKl 5GANj 1WPYA 4M75G 2I2LA 4M77G 5GAN6 5GANg 3FIFA 4J6WA 4JRIA 5GAMf 5LJ5g 2E41A 4X9CA 4C8QD 3JB9I 5DY9A 4C8QC 4C8QA 1WQ7A 4EMKB 4NL3A 3RUXA 1I81A 5GANf 4XTUA 2Y90A 4XU2A
chains in the Genus database with same CATH superfamily
1W2BP 1JJ2P 1JXOA 1XQHA 3C12A 1YCYA 2AKLA 3X24B 2DL7A 2GFAA 3CC4Q 1AZGB 2RQWA 3PMIA 3J80E 2MPXC 4C8QB 1I07A 4M7AG 1QWEA 5HKCA 1N6AA 2KBTA 1AVZC 1W2BS 1WNLA 1T3LA 2MI6A 1I4K1 4WCIA 4KUDK 3G1JA 2QK0A 5FU7B 5KYWB 3S3MA 1BI0A 2DF6A 2DNUA 2EQKA 3CCST 2KRNA 2ZPEB 4J9EA 3FLGA 2FO0A 1GCQA 2RA2A 2CKKA 1WHGA 1QP3A 2JN0A 5ECAA 3EG0A 2E3IA 3MO8A 1K73C 3M56A 4F7UG 3CC2Q 2QDYB 2KRMA 1N27A 3OYFA 4C92G 2D8JA 1G3SA 4E7KA 4M7AC 1QP2A 4N4GA 3SWNA 3CXCP 1G83A 3EGUA 2BZYA 1WXBA 4FYWB 3URGA 2JTFA 1ZA1B 2DX1A 2ZGWA 2DYBA 2CZ7B 4J6YA 1IGQA 2MMPA 3H0IA 2P0KA 2I2LA 2KVQG 3N5BB 2E41A 2R5MA 1JQQA 1K0XA 1VQOA 1OX8A 1K4US 2M0YA 2EWNA 4OMPA 1EX4A 4AFSC 1UGSB 1KC8C 2EAYA 4FSSA 3L2UA 5CKBA 1SSHA 2NUPA 3G6EQ 2LZ6B 4XU1A 3CXCS 3QHSA 5CK9A 4C92C 3VYHB 1NBEB 2EPDA 2KT8A 3AT1B 1OQKA 4A4KA 2X3XD 1ABQA 4JZ4A 3CCLT 2H3JA 4LE9A 4OMQA 3ER0A 3CD6T 1WHMA 2OTJQ 1V1CA 1PKTA 3OYAA 4J5YA 4RUGA 2DBMA 2D9TA 4PLIA 1C0MA 3ZBDA 1C1AA 4O5VA 4M7DD 2CS7A 4BI3A 3JSCA 5LL6S 3BY7A 3CMAT 3M59A 4BE2A 3PMTA 1D09B 4KT0E 1PSEA 4FIBA 2C0OA 9ATCB 1OULA 4IUPA 4OP0A 5KYUB 4NS5A 2EFIA 1YJNA 2BIVA 4JDSA 1A0NB 1MNDA 2ESWA 5HK3A 2EIFA 5AT1B 2QQRA 5CQXA 5IH2A 1VYUA 1N9RA 1Q86U 3QPHA 5GMKm 1MMAA 4AG2C 3LX7A 1M90U 4VUBA 3EFOB 3HP9A 5CO7A 1R77A 2NUTA 1ACMB 3OSVA 1YI2Q 2CT3A 3Q1JA 4HT9A 1YHQA 2K4YA 1QVPA 4RG2A 3UT1A 5C0MA 3CC7T 5D6WA 1W2BA 2NLUA 4M7DF 2QEXQ 4ZGJB 2AZSA 2P4TA 3VYGA 5GMKl 1UTIA 1K9MU 4HVVA 4J6WA 1LVKA 3ZL7C 2PZ1A 2QTVA 2PTKA 5GANf 4AT1B 1I5OB 3FDRA 1PD0A 5FU6B 3CCVA 3VUBA 2FZCB 2QDLA 4R0KA 1VQ6T 3M57A 1WHKA 4JLIA 1X01A 1EZZB 3NGPA 1Y57A 4RKUE 4RTXA 4II1A 4JPBW 4MDXA 3M54A 5EC7A 2VXEA 1VQ7A 3CCQA 3META 3NFCA 2A28A 3I56A 4RTUA 4LDYA 1MMDA 2V8JA 3LH5A 2COYA 1JB0E 3EGXA 5KYXB 3VS6A 1YITT 4E7SA 5GJVB 5DLOA 1R0BG 3BE3A 3HL8A 5D7UA 2GF7A 2QA4A 2COZA 2AIRB 3RKWA 3CPFA 4LUDA 2CT4A 1SSFA 2O4XB 2CYZB 1QCFA 1WIEA 1X2KA 3NTIA 1WGSA 1SRMA 8AT1B 3J81E 2E6ZA 1M2OA 2K5LA 3U23A 1TTHB 3OS0A 3VRYA 1VQMQ 1KQSP 3X26B 1FX7A 3E19A 3CXCA 1EIFA 2J6OA 3EGDB 1SF9A 2FB7A 1PNJA 1BI3A 2LC4A 2DL3A 4MMLA 2D0QB 1H3HA 2QASA 2E1HA 2L89A 4M7AA 3MEUA 1M30A 3I55A 1QW1A 1RUWA 4IURA 3MEWA 3T9NA 1CKBA 3HTRA 3JCMe 1NEGA 4ESRA 3CCEQ 4C0DB 1KQSS 4RG8A 5LJ5g 1PKSA 2CUBA 3MPUB 4L5GA 2ATCB 1WQ7A 2YUPA 1QKXA 2GCXA 4YTLA 1ABOA 2OAWA 1WJRA 2VGNA 4F7UA 2V1QA 1UEBA 2P0PA 1PC0A 2HL5C 1ZSZB 2DZCA 2FRYA 2VXFA 2KYMA 4C92A 5I22A 3JCMJ 1QVGP 2QGFB 1VQ5A 2AZVA 3GOXA 4PJOD 1BCOA 1B7TA 1UECA 3JB9F 4OMLA 3J7AF 1IO6A 2LNHB 1S72Q 3M9QA 3CQTA 3OYIA 5LJ3h 1M1FA 2RK2A 2QQSA 1WFWA 3OMGA 2RJCA 2EJFA 2VWFA 3OYDA 2X9HA 1VQOT 2J05A 3EG9B 1XNIA 3G71Q 6AT1B 2CH4A 1SEMA 1YWPA 1KQ1A 2EYXA 1M8MA 2V26A 2FHDA 4C0FA 5GAMh 3OYCA 8ATCB 1VQNQ 2ZPBB 2ZPHB 3VJPA 2VC8A 3TSZA 2QYZA 1OU9A 2DBKA 4LNPA 2DZ9A 3I5SA 1W4SA 2EYZA 1YJWQ 2EJGA 2O01E 5GAN3 2Y4XA 4OB0B 3JAME 1BIBA 2KE9A 4PJOF 1NYFA 2KK4A 5IHKA 2OTLQ 2FL7A 2HSPA 2CREA 2XICA 3TQ7P 2XDPA 2OX7A 4M78D 4HVWA 2NUZA 1WLPB 3VS3A 1BYMA 2HBWA 4M7DG 1YJNT 3LYIA 1YIJQ 2L5QA 2KEAA 2R5AA 3RUXA 1BBZA 4JUVA 1K8AR 2BUDA 1KQ2A 1HJDA 1D3BB 2P0QA 3G4SQ 2K79A 1H92A 2AK5A 4A4HA 1I1JA 5IN1A 3QUIA 4A4EA 2KT1A 1YJ9T 4PFOA 2ECZA 5CQYA 5LJ5j 3C94A 4OF1A 1M9SA 1AWOA 1GCPA 2LP5A 1VQLA 4R56A 4OVAA 4OMFB 1Y7XA 4A63B 2DETA 3LGLA 4DBRA 3OBWA 5GANd 4GLKA 1D0YA 4M78F 1O75A 4M77D 3L2RA 1VQKT 4OMMA 4JZ3A 4M7DC 4A4GA 1ZUYA 2X35A 3LWIA 3JCMV 2CUDA 3CCVT 4Z02A 4XAXB 2LQ8A 1M27C 2E65A 2RQVA 1KQSA 3CC4A 2W10A 3REAB 4TVRA 2DA9A 2D6FA 3PT9A 2L3SA 1D1CA 4F17A 1LPLA 2XK0A 1VQ7T 2QQBA 2DIGA 1FMVA 1WHLA 3A5ZB 2JMAA 1D1AA 3CCMQ 3PNWC 2B86A 4F16A 4WF2A 3GF5A 1UUEA 3LLRA 1YN8A 2EBPA 2QA4T 2HCKA 4J9FA 1AWWA 1X43A 5FU7C 1UGQB 1KJWA 4BY6B 2GQIA 4M77F 2YXYA 4ZGDB 3CC2A 5KH6A 3QYHB 3HFNA 2LX9A 1MUZA 2DPPB 4ZNXA 3NTHA 4UC4A 4D8DA 1MNEA 1I81A 1XTDA 1GBRA 2K3BA 4MZTA 3JCMP 1RAGB 3DB3A 3C95A 1JO8A 1U3OA 1WHHA 2JJ9A 4Z88A 3FJ5A 1AWJA 2EGCA 4FYYB 3I55T 1S1NA 1T3SA 5A0LA 5C6SA 1IGUA 4OGCA 2GFUA 5GAN2 2YRVA 2JM9A 3CCLQ 4OGEA 1AT1B 4RTWA 2F2WA 4KH0B 1WXTA 2RHXA 1Y96A 4CC2A 1Q81C 2NUPB 1YFNA 1R0CB 3GLXA 1Q7YR 1KD1C 1VQPQ 4R55A 4LD6A 2PVGB 3G6EA 1Y07A 3MP1A 4CC3A 2CP0A 1Q82C 4C5HA 3TVTA 1OZ3A 2FZKB 1N9SA 1VQ4Q 1K9AA 4N4HA 1Q86C 5GANh 2RQUA 1QLYA 2OTJA 1ZX6A 3QDRB 3D7SB 1M90C 3X25B 1VQ5T 2OJ2A 5IHNA 2L8DA 5M9OA 4BDYA 1RI0A 1N8RC 3A1PA 2M51A 2V8IA 2PQWA 5KE2A 3FJPA 5CIUA 4EMKA 1H3ZA 4FT2A 1D1BA 1VQ8T 1SPKA 2WSCE 4PJOG 1K9MC 2MOXA 3NTKA 1M3CA 1P92A 2K3YA 2K5FA 3VS0A 2FEIA 3QKJA 4ELZC 4JS4A 3QJ6A 1W1FA 4XTWA 4ELYC 2XD0A 3H0FA 2DL8A 3MHXA 3M0PA 1WPYA 4OB1B 5CKFA 3FIFA 2M02A 1G5VA 4C5EA 2XKOC 3PFSA 5DY9A 2YUNA 2KNBB 2YUQA 5CCAA 4HCBA 4M7AE 2NUTB 3QWXX 3OB9A 3MKDA 3MEAA 4LN2A 1U06A 2SEMA 1O9SA 1YI2A 2RD1A 2YDLA 2QG9B 4EMGA 2AHJB 2BZXA 1TG0A 1UGVA 2QEXA 4QVCA 3CCUQ 4Z8AA 2K7AA 1UG1A 2RPNA 2LJ1A 4PJOC 2MIOA 1YWOA 2PVOB 3M5AA 2I0NA 2ZPIB 2HNIA 4KBMB 1UE9A 4PFPA 3BW1A 4F7UE 1WXUA 4ZN3A 2ED1A 2CZ1B 1X6OA 1BI2A 2DRMA 1YITQ 4M75D 2C0TA 4M7DA 3CCJT 4M78G 4C92E 3L2WA 4LDXA 5GAN5 3GBQA 2LTOA 5J3BA 1WA7A 1RABB 3QG1A 2YLBA 4ORZA 1B3QA 2E64A 3TU4K 2GQVA 2F5KA 2LRQA 1PRMC 1JEGA 3H8ZA 3EGXB 1OPLA 1M3AA 2DM1A 3HHTB 1ZQ1A 4J9CA 4CC4B 3GPLA 1VQLT 1Z9QA 4KRTA 4JJNK 1RAIB 2W0ZA 3VU3C 4V2SA 2XIDA 1GRIA 3M4GA 1ZHIA 2M0OA 3DLLA 4BE0A 2ZZDA 4A53A 1WDXA 1Q81U 4DA4A 1KD1U 1RAFB 1VQ9Q 3L2QA 2NYSA 2O9SA 5GMKi 1NYGA 1M1KR 2DIQA 4M78C 1Q82U 2DEUA 4M75F 3PE0A 1VQMA 2X51A 1JBMA 4P5NA 4M77G 1E6HA 2ZAEA 3CEYA 4C8QD 2HEQA 2X3WD 1E7OA 3EG1A 5EG2A 1JU5C 2VV5A 3GNFB 4M7AB 3HFOA 4IUUA 4L6V5 4PFZA 1N8RU 2RJDA 4EPCA 1GL5A 2EQMA 2ROLA 4PJJA 2VB6A 4QQ6A 1RL2A 3NMZC 1SG5A 2E10A 2PNIA 2X4YA 2RI5A 2EGAA 3CCEA 2L3RA 1WI7A 1LJOA 2K2VA 4FSXA 2IIMA 2LDMA 3CC2T 1UB4A 2ZCFB 4F7UB 4E7HA 4XTZA 2RHZA 4XTXA 5LJ5d 2C0IA 2ED0A 4ZN1A 1BK2A 1FMKA 4M77C 1W70A 4C92B 3VV0A 2V1RA 4JJDA 2FPDA 4FYVB 4C8QF 1OX9A 2LCCA 4KGVB 4JRPA 5A0DA 2PUOB 4N0AC 4QT7A 2LJ3A 2JVVA 2DYIA 1ZSZC 2YHTA 2RQTA 1K8AU 1S72A 2KYBA 3CBMA 3A8LB 4RTVA 2BZ8A 3EHQA 2DVEA 1HSQA 4QQDA 1D0ZA 3JCMW 3SEMA 3G71A 2X4XA 3G6ET 1NJIR 2KROA 2HMAA 5GAN7 1PCXA 3UA6A 5GAOn 1VQNA 3UWNA 1ZLMA 5I2SA 3FB9A 3O5ZA 3JV3A 2RHIA 1YJWA 1DJ7B 1M3BA 4XTUA 3JB9D 4M4ZA 2E5KA 3MEVA 2CDTA 4E7LA 4LXCA 2OTLA 5GJWB 1M8VA 5GAN4 2KQWA 5D6YA 2EQUA 1YP5A 5FRMA 2RO0A 2OI3A 4JJCA 4PJMA 1XOVA 2KXCA 3C0CA 5KCOA 3BFMA 1AOJA 1YJ9Q 2LCSA 4PJOA 2HQHA 2FRWA 4PJNA 1NG2A 5GMKh 4D8KA 1YIJA 3S6WA 3RERA 2CP2A 2DFUA 3BDLA 2MWPA 4DEXA 4HCKA 4IUVA 3VS7A 3G4SA 4FW2A 2BE9B 2KXDA 3E1SA 5FWCA 1VQKQ 4J7IA 3TEEA 2A0FB 3MP8A 5J26A 1FXXA 2XDBA 2GGRA 3V8JA 4Y91A 4AG1C 2DO3A 2YRCA 3S3NA 1RAEB 1G8XA 3OYNA 5LJ5h 2D8HA 4C0GA 1G2BA 2KR3A 4QVZA 3SHWA 2QEXT 2YUOA 4RTZA 2FPEA 2G6FX 4IIOA 5GAOp 2K2MA 1YCSB 2HQXA 1E6GA 4E7IA 2XI9A 3SB2A 3CMEQ 1NLOC 2VGMA 3H6ZA 3P8DA 3THKA 1OPKA 1ZBXA 2F69A 1IXDA 4M78A 4RMOA 4Z89A 1Q7YU 2F2VA 2IPOB 1U5SA 4M75G 3P8BB 3JB9I 2X4JA 3CCMA 3CCRQ 3MP6A 2CP7A 3H41A 2QI2A 1X2QA 1M5Q1 1LOJA 1FYNA 3QSUA 2YLCA 4DOVA 5J39A 2CSQA 3M53A 1K73R 3OYHA 1IZ6A 3L2VA 1RACB 2PU9B 4HCCA 2HL3A 3L1AA 5D6XA 1PHTA 3DB4A 2RJFA 4DBFA 2RN8A 1HK9A 1MV3A 3V8LA 4K11A 4XK8E 5I11A 3EAEA 4M75C 4M77A 3DKMA 1UGRB 4NL2A 1EFNA 1PD1A 4MMKA 2HBPA 2MAMA 1YHQT 2DKGA 4IIMA 3M0QA 3TCJA 4OMNA 2CH4W 4C8QG 3SWNC 3CCLA 1JRIA 4J7FA 1K76A 5KYYB 1HYOA 1SRLA 3CCET 1Y96B 2HZYA 3SFMA 4E47A 2KAFA 2QQAA 1OEBA 1KC8R 4LDWA 5CKHA 1BKBA 1VQPA 2F1LA 1M2VA 4M7DE 2YWWA 5DM7R 5LJ3j 2A7YA 1UHFA 4B9XA 1BCMA 2ROTA 2VASA 3QWYA 3VUZA 1Y71A 3CCSQ 1CSKA 1VQ8Q 1QCNA 1V76A 1VQ4A 2M16A 2DLPA 3CCQT 4DBHA 1TXQA 1LCKA 5GAMj 3CBOA 2A37A 2EQJA 3I56T 2FG0A 3RKXA 3H9NA 2MWOA 1MMNA 3R6NA 1MMGA 2EKOA 4C8QC 4EMKB 3P8HA 1FWZA 2Y90A 3ULRB 1NZ9A 2RM4A 5IAYA 2BKDN 4XU0A 3OQ5A 1OI1A 1NE8A 4BI8B 1OYXA 3OA6A 3OW2P 2WACA 3G71T 1UFFA 5GAOq 2L3PA 2LQNA 1WYXA 4EDUA 2DILA 3QYGB 4OMOA 1IB8A 2RI2A 2E12A 2GTJA 2QGGA 2DAQA 7AT1B 4AFZC 1VQNT 3PVLA 3MCAB 1KK7A 2P84A 4GBQA 3ZEHA 5LJ5f 4EIKA 3DLMA 1B34B 3M0TA 3PGGA 5LJ3e 1MGQA 5IXFA 4J6XA 1YJWT 2X4WA 2WSFE 1KG1A 2L0AA 4Y28E 2F2XA 3LWHA 1U1SA 5GAOr 1G3YA 3OS5A 3OW2S 1M1KU 1OU8A 2J6FA 2AT1B 1TUCA 4Y92A 3CCJQ 1N5ZA 5GAMe 3INZA 1VIEA 3OYEA 3CCUA 4Q5WA 3H0HA 1BI1A 4JLGA 3HRSA 3V7SA 4F14A 3CD6Q 3JB9G 5GAOm 4E7ZA 5KYYA 2KGTA 2COWA 2A36A 3HPWA 2LT1A 1YIJT 4A54A 4OB3B 4M7DB 3OSSC 4JRKA 2RI3A 3JCMd 4GY5A 1YITA 4OB2B 2EGEA 4KULA 1VYTA 5KCHA 2HSEB 3JCMc 3CMAQ 3V8KA 2VKNA 3VKIA 3G4ST 1ARKA 5GAOl 4LD9K 1I5LA 2K3XA 3WVEB 2DVJA 4X9DA 2K5IA 4RCCA 4HKEA 2LNVA 2DXBA 1VOMA 1QKWA 2EYQA 4A4FA 1QVFP 1QQJA 3KFVA 4ZGEB 1PSFA 2CP5A 3VS5A 4O6JA 4PKCC 1WQWA 1JJ2S 2DE0X 1WZOA 4FM4B 4CI0C 1VQ9A 3EFSA 1MHNA 2J7IA 2E70A 3CC7Q 4X34A 1B07A 1IHVA 4ANJA 3OYMA 3REBB 2MK5A 3O8VA 4HVUA 2XG8D 1X27A 5HCKA 4BUGA 3CBPA 4J9DA 5A2QE 5KYNA 1QVFS 5FWBA 1TSFA 1B34A 5CR2A 1AWXA 2L2PA 1NJIU 1BB9A 3RBBB 3CCMT 3EH1A 3HKSA 4M75A 1VQ6Q 3A8HB 1I8FA 2CSIA 1K8AC 5I21A 1XJWB 4RCBA 1Y0MA 3VS2A 4ME7A 2D0NA 1UDLA 2QAZA 1AD5A 4PJOE 3M0RA 1PM3A 3JB9H 1WHJA 2O2OA 1JXMA 3JCMg 2RK1A 4HT8A 3JCMX 1AZEA 2P4RA 2CZ0B 1F1BB 5FRNA 2DJQA 4WTOB 3TSWA 3WXMB 2QQ9A 3RESA 3CPWP 2H8HA 1KIKA 4BI4A 5FU6C 3PIPA 1UHCA 3G7ZA 3NPFA 4JJBA 1AHJB 3QO3A 4J83A 3V7RA 5CKEA 3R6OA 2L3QA 2D1XA 3JCMb 3UA7A 3OMCA 3JCMh 4BB7A 1G3TA 2O88A 2FPFA 5GANj 3A8MB 2LQKA 4E6RA 3OW2A 1T0JA 2OAUA 3CPWS 3MJXA 4C8QA 2M1HA 3GNGA 4RTYA 4FU6A 3VS4A 3HRTA 1WJQA 1RLPC 1VQPT 1IHWA 2KMTA 3BDUA 4C5IA 3AHUA 2V8KA 1RAHB 4F04B 1NPPA 4BDZA 5KYWA 2HQEA 3CC4T 2VVKA 4M78E 4AFQC 3IQLA 2JZ2A 1GXIE 1VQ4T 2IG0A 2HDAA 1QWFA 1UJ0A 1TWBA 4HXJA 4BE1A 3OYYA 1TUDA 5A0GA 1IREB 1GFCA 2RNAA 3M0UA 4AMCA 3QDFA 3QZ9B 4PNOA 1KFZA 3RIRA 4BACA 3QBYA 2KI7A 4C5GA 3OYGA 2DJZA 5DLQE 3FRNA 1OV3A 4PJOB 3RDVA 1YBYA 3HRUA 1YJ9A 5GANe 1MV0B 4LUEA 5AYFA 3FEOA 4KGZB 4B9WA 2EYWA 2HAXA 2ENMA 2J06A 5L8RE 1JJ2A 4EMHA 4FL6A 4C0DC 2RHUA 2DMOA 4M77E 1VQOQ 5FW9A 1K73U 3ASKA 1ZUUA 4AFUC 3L42A 1VQKA 2KDSA 2JS0A 3M0SA 3RNJA 1Q7YC 2JOYA 1K0SA 4LDUA 3KUFA 1QVFA 2K6DA 5KE3A 2ZPGB 2RHYA 2RB6A 3L2ZA 5LJ3d 1SHGA 1V29B 1VYVA 3PIOA 1PRLC 1ZUKA 3CCUT 2CGHA 4N4IA 2JW4A 3KXTA 4DEYA 2AKKA 4FCYA 2CZ6B 4XU2A 3VRZA 5GAMd 3UATA 2DERA 3UDCA 1NLPC 2FYKA 2O31A 3CMEA 4E7JA 4RTTA 1KSWA 1PG5B 2R58A 4M78B 3EFRA 2DL4A 1CKAA 3A98A 1FMWA 1KC8U 2OTJT 3NHNA 2MF2A 4J9BA 1WX6A 2HKQB 1RLQC 1ZA2B 4B6MA 1YJNQ 2MCNA 2EJ9A 3CCRA 5KYUA 2VUBA 2FZGB 4FW1A 3JCMQ 3I35A 4GLMA 2GBQA 4PJLA 5L23A 2J6KA 3LH0A 4XTYA 4E2FB 1GBQA 3RMQA 3EFOA 1VQ9T 4IKFA 4KUIA 5FLXE 3CPWA 2JXBA 1YHQQ 2XMFA 2BE7D 1PWTA 2BTTA 3EG3A 1G3WA 4BD3A 1KHIA 2RMOA 3JCMf 4ZTJA 1TH7A 2LCLA 4M77B 1UGPB 3V7CA 2HKNA 1W6XA 3VS1A 1RADB 2H3EB 5LJ3g 1VA7A 1RAAB 3UPUA 2XHCA 3CCVQ 4M7AD 3E2UA 1YI2T 3ZFJA 1SKUB 2B8AA 3OY9A 4D6WA 2K57A 4CC7A 3QXEB 3OYLA 2JT4A 1OZ2A 2YSQA 2E5QA 5GAMg 1VQ7Q 3CCQQ 1D0XA 1X6GA 3I56Q 2GTOA 1Q95G 1Q81R 1M2VB 1KD1R 1M1GA 2HD0A 2Z0WA 1U8RA 2FVUA 3OYJA 1M4ZA 3LW5E 3I5RA 5KYXA 2DD5A 1Q82R 2JTEA 4C0ZA 5HK0A 3CCSA 1ZSGA 2QA4Q 1VQ8A 1X69A 3SDZA 4C92D 3WVDB 1Q86R 3M4YA 4IUTA 1M90R 3LGFA 3JRZA 3M58A 2O9VA 3RKYA 1QMCA 1QVGS 1ZBJA 2DK3A 2O4XA 1N8RR 2NWMA 4M7AF 3EHRA 2JUFA 2CP6A 1M1KC 2DXUA 2LMJA 2LJ0A 3HSBA 4PL6A 5FROA 5CAIA 4KH1B 4X1VA 2LQWA 4MZPA 4QQGA 4DOWA 1K9MR 3PTAA 2XU8A 3EGDA 3GP8A 4CRIA 3X28B 4EMKC 2JS2A 5IXBA 4FT4A 3QZ5B 2E4HA 4XTVA 3I55Q 2ABLA 1RI9A 2SRCA 2DTHA 1GCQC 2JM8A 2R57A 3JB9J 4J8OA 4F7UF 1VQMT 2GNCA 4NOYA 4XU3A 1I0CA 1K1ZA 2EKHA 2KSSA 4BY6C 1TUGB 4C92F 5GMKj 4L59A 2DEQA 2RQRA 4PK4A 4M75E 2E3HA 3EH2A 3KBGA 3GIBA 4MZMA 2PUKB 3F70A 3CCJA 4KGXB 2RJEA 2EYYA 4N0AA 2DXCA 2JMCA 3TREA 2ZPFB 2A08A 1ZSZA 2C06A 2QXFA 2DXTA 2WSEE 3CD6A 4LDVA 2VYTA 4DQ2A 1VQ5Q 2M9UA 4QW2A 4FYXB 3QIIA 3UF4A 5GAN6 4JRIA 3OS1A 2PVDB 1VIFA 2LVMA 1WJSA 2RF0A 4MDWA 2YRDA 5CVIA 1C6VX 2RH2A 3CMAA 1U1TA 4ZTFA 2DTIA 1NM7A 1BIAA 1LNXA 3OS2A 3EG9A 1NEBA 4HA8A 3S3OA 1X6BA 2LT4A 1NJIC 2LX7A 3EG2A 5GMKe 1S72T 1KHCA 5HY6A 1HD3A 3RR6A 2K9GA 4C8QE 2YT6A 3I9QA 3C4SA 1IRXA 1T0HA 1H8KA 1BU1A 5CKDA 5IHIA 1Z9ZA 1QCOA 4DBQA 1GFDA 3RMSA 3A8OB 1VUBA 3ME9A 1X75C 2Y4YA 5GAN8 2DL5A 5IT9E 3CC7A 3CMET 4XQ3A 4J9GA 1YNZA 2KY9A 4JS5A 3OYKA 3OYBA 2DRKA 2IVWA 5LJ5e 3FC3A 1OOTA 1SHFA 4IUQA 4HCZA 5I2MA 4QVDA 3SD4A 2DTOA 2QTXA 2A3LA 1TU0B 3CCRT 4M75B 1HXDA 3X20B 3PVQA 1VQ6A 2OTLT 1H641 2E6NA 4J9HA 2JNGA 3E9FA 1QVGA 4ATOA 2EVRA 3M55A 5LJ3f 2XDDA 3A8GB 3E9GA 1D3BA 3OBYA 3SWNB 1J3TA 2JTMA 2G3RA 2MYSA 2EW3A 4QKUA 1NPRA 2CP3A 4JRQA 1UJYA 2EQIA 2KRSA 1R8OB 4PLLA 5GANg 4J9IA 5GAMf 2F5TX 4X9CA 1VQLQ 2DD4A 4NL3A 1TS9A 1AEYA 1TOVA 3QJYA
chains in the Genus database with same CATH topology
3HRTA 3MEVA 4JUVA 1WJQA 2BUDA 1KQ2A 4E7LA 1VQPT 2OTLA 1XQHA 2KMTA 1D3BB 3BDUA 4C5IA 2P0QA 3AHUA 1M8VA 3C12A 5GAN4 2V8KA 2KQWA 5D6YA 2EQUA 5FRMA 1YCYA 4A4HA 1NPPA 2RO0A 4BDZA 2HQEA 3CC4T 5IN1A 3QUIA 4M78E 3X24B 4A4EA 1XOVA 1YJ9T 2GFAA 5CQYA 2JZ2A 5KCOA 5LJ5j 1VQ4T 3C94A 3BFMA 1GXIE 4OF1A 1M9SA 2IG0A 3PMIA 3J80E 4PJOA 4C8QB 5GMKh 1YIJA 1VQLA 3S6WA 4R56A 4OVAA 4OMFB 4BE1A 4M7AG 1Y7XA 5HKCA 3RERA 3OYYA 1N6AA 3LGLA 3OBWA 5A0GA 1IREB 1WNLA 5GANd 1W2BS 3BDLA 2MWPA 2MI6A 4GLKA 1I4K1 4M78F 4KUDK 4IUVA 1O75A 3QZ9B 4M77D 4PNOA 3L2RA 3G4SA 1VQKT 4M7DC 5FU7B 4A4GA 2X35A 3LWIA 3S3MA 3RIRA 1BI0A 3E1SA 3JCMV 4BACA 3CCVT 4Z02A 4XAXB 4J7IA 3QBYA 2LQ8A 3TEEA 3MP8A 4C5GA 2EQKA 3OYGA 3CCST 2E65A 5J26A 2ZPEB 1FXXA 1KQSA 2XDBA 2DJZA 5DLQE 3FRNA 3V8JA 3FLGA 3CC4A 4Y91A 4PJOB 2DO3A 1YBYA 2RA2A 3HRUA 4TVRA 3S3NA 5GANe 1YJ9A 2CKKA 2D6FA 3OYNA 3PT9A 5LJ5h 1QP3A 4C0GA 2JN0A 2XK0A 5AYFA 1K73C 3FEOA 3MO8A 3M56A 2QQBA 4QVZA 4B9WA 4F7UG 2DIGA 2QEXT 1VQ7T 2HAXA 2QDYB 5L8RE 1JJ2A 1N27A 4EMHA 3OYFA 3A5ZB 4FL6A 4C0DC 4C92G 2RHUA 4M77E 5GAOp 3PNWC 1K73U 3ASKA 1G3SA 3L42A 2HQXA 3GF5A 4WF2A 4E7KA 1VQKA 2KDSA 4M7AC 4E7IA 2XI9A 1QP2A 3SB2A 3LLRA 1Q7YC 2JOYA 4N4GA 2QA4T 2VGMA 3H6ZA 3P8DA 3SWNA 4LDUA 3KUFA 1QVFA 5KE3A 2ZPGB 2RHYA 2RB6A 1ZBXA 3L2ZA 5LJ3d 2JTFA 2F69A 5FU7C 3URGA 1UGQB 2ZGWA 4J6YA 2CZ7B 4M78A 1V29B 3PIOA 4BY6B 4RMOA 4M77F 2MMPA 3CCUT 4ZGDB 3CC2A 2CGHA 5KH6A 1Q7YU 3QYHB 3HFNA 2LX9A 2P0KA 2DPPB 4M75G 2I2LA 2KVQG 3P8BB 3NTHA 4N4IA 3N5BB 2E41A 3JB9I 4UC4A 2X4JA 3CCMA 3KXTA 2R5MA 1I81A 1VQOA 3MP6A 2CZ6B 1XTDA 4XU2A 5GAMd 2EWNA 2QI2A 4MZTA 1UGSB 1KC8C 2EAYA 3L2UA 3JCMP 5CKBA 3UDCA 3DB3A 2FYKA 3C95A 1M5Q1 1LOJA 3CMEA 4XU1A 4E7JA 3CXCS 3QSUA 2YLCA 3QHSA 5CK9A 4C92C 2R58A 3VYHB 4M78B 4DOVA 5J39A 3EFRA 3M53A 4A4KA 3I55T 5A0LA 5C6SA 4OGCA 1KC8U 2GFUA 3OYHA 3CCLT 2OTJT 2MF2A 1IZ6A 2H3JA 2YRVA 5GAN2 3L2VA 3ER0A 3CD6T 2PU9B 4HCCA 4OGEA 2EJ9A 3L1AA 4J5YA 3OYAA 5D6XA 3CCRA 3DB4A 2D9TA 2RJFA 4PLIA 2VUBA 3ZBDA 2RHXA 4O5VA 1Y96A 1HK9A 3JCMQ 1Q81C 3V8LA 3GLXA 1KD1C 4R55A 4XK8E 4LD6A 2PVGB 3EAEA 3G6EA 4M7DD 4M75C 1Y07A 3MP1A 3LH0A 3DKMA 4M77A 2CS7A 1UGRB 4BI3A 3JSCA 4XTYA 4NL2A 5LL6S 3BY7A 3CMAT 3M59A 4M7DF 4BE2A 4MMKA 2HBPA 3PMTA 3RMQA 1Q82C 2MAMA 4C5HA 4KT0E 1YHQT 2DKGA 1OZ3A 1PSEA 4FIBA 4KUIA 3TCJA 1VQ9T 4IKFA 5FLXE 1N9SA 3CPWA 4C8QG 4N4HA 3SWNC 1Q86C 4IUPA 5GANh 4OP0A 3CCLA 2OTJA 4NS5A 2EFIA 3QDRB 1YJNA 1M90C 1JRIA 2BIVA 4J7FA 4JDSA 3X25B 1VQ5T 1G3WA 3CCET 4BD3A 1KHIA 2L8DA 1Y96B 3SFMA 3JCMf 4E47A 5M9OA 1RI0A 4BDYA 2KAFA 4ZTJA 1N8RC 2QQAA 1TH7A 2EIFA 5HK3A 2QQRA 2V8IA 2LCLA 4LDWA 5CKHA 1BKBA 5CQXA 4M77B 1UGPB 2PQWA 5KE2A 3V7CA 1N9RA 1VQPA 1Q86U 4M7DE 3QPHA 5GMKm 5DM7R 3FJPA 5CIUA 4EMKA 5LJ3j 3LX7A 2A7YA 1M90U 5LJ3g 4VUBA 1H3ZA 4B9XA 2XHCA 4FT2A 3HP9A 3UPUA 5CO7A 1VQ8T 4M7AD 1YI2T 3ZFJA 3VUZA 1Y71A 2WSCE 4PJOG 1K9MC 2B8AA 3NTKA 3OY9A 4D6WA 2K57A 1P92A 2K3YA 3OSVA 3Q1JA 2K5FA 3QXEB 1VQ4A 3OYLA 4HT9A 1OZ2A 1YHQA 2K4YA 1QVPA 2M16A 4RG2A 3UT1A 5C0MA 3CC7T 3CCQT 5D6WA 3QKJA 4ELZC 4JS4A 5GAMj 3CBOA 3QJ6A 2E5QA 2EQJA 2NLUA 4XTWA 3RKXA 4ELYC 4ZGJB 2P4TA 5GAMg 2XD0A 3VYGA 2MWOA 5GMKl 3MHXA 1K9MU 4OB1B 1WPYA 5CKFA 3FIFA 4J6WA 1G5VA 4C5EA 2XKOC 2EKOA 3PFSA 5DY9A 4C8QC 1M1GA 2HD0A 3P8HA 4EMKB 5GANf 1U8RA 2FVUA 1FWZA 2Y90A 5CCAA 3FDRA 3OYJA 4HCBA 1NZ9A 5FU6B 1M4ZA 2RM4A 4M7AE 3LW5E 5IAYA 2BKDN 3VUBA 2DD5A 3OB9A 3CCVA 4XU0A 3OQ5A 1OI1A 3MEAA 1NE8A 4BI8B 4C0ZA 5HK0A 3CCSA 1OYXA 3OA6A 1VQ6T 2WACA 3G71T 1VQ8A 1O9SA 3M57A 3SDZA 4JLIA 2RD1A 1X01A 5GAOq 4C92D 3WVDB 1YI2A 4RKUE 3M4YA 4EDUA 4II1A 4MDXA 3QYGB 4IUTA 4EMGA 2RI2A 2AHJB 3LGFA 3JRZA 3M54A 3M58A 2E12A 3RKYA 2VXEA 2QEXA 3CCQA 4QVCA 1QVGS 1VQ7A 2DK3A 2O4XA 2DAQA 3META 3NFCA 1VQNT 4PJOC 3I56A 4M7AF 2JUFA 3MCAB 1M1KC 2DXUA 4LDYA 2V8JA 3ZEHA 2PVOB 3M5AA 4PL6A 2ZPIB 5FROA 5LJ5f 3HSBA 2HNIA 3DLMA 4KBMB 1B34B 1JB0E 3PGGA 5LJ3e 1MGQA 5CAIA 4J6XA 1YITT 3BW1A 2X4WA 2WSFE 4F7UE 1YJWT 1KG1A 4Y28E 3LWHA 4ZN3A 1U1SA 2CZ1B 1G3YA 5DLOA 4MZPA 4QQGA 5GAOr 1X6OA 3HL8A 4DOWA 1BI2A 3OS5A 2XU8A 2GF7A 4M75D 3PTAA 2QA4A 3OW2S 4M7DA 1M1KU 3GP8A 3CCJT 4M78G 4C92E 4CRIA 3RKWA 3L2WA 4LDXA 3X28B 4EMKC 5GAN5 3CPFA 4FT4A 2LTOA 3QZ5B 5J3BA 4XTVA 1SSFA 2O4XB 5GAMe 2CYZB 3INZA 1VIEA 2YLBA 3QG1A 2DTHA 3OYEA 3NTIA 2R57A 4Q5WA 1BI1A 3CCUA 3JB9J 1WGSA 2E64A 4J8OA 4JLGA 2GQVA 2F5KA 2LRQA 3HRSA 3V7SA 4F7UF 3TU4K 3J81E 3JB9G 1VQMT 5GAOm 2E6ZA 4NOYA 3H8ZA 2K5LA 4XU3A 3OS0A 2KSSA 3HHTB 4BY6C 3GPLA 1ZQ1A 4C92F 3X26B 1FX7A 5GMKj 3HPWA 2LT1A 3E19A 1YIJT 3CXCA 4L59A 1VQLT 1EIFA 4A54A 2DEQA 4OB3B 2FB7A 4M7DB 3OSSC 4JRKA 2RI3A 4M75E 4GY5A 1BI3A 3VU3C 4OB2B 3JCMd 4JJNK 2LC4A 1YITA 4V2SA 2XIDA 4KULA 3M4GA 4MMLA 5KCHA 3KBGA 3GIBA 2D0QB 3JCMc 1ZHIA 2M0OA 4MZMA 3DLLA 2E1HA 2L89A 4BE0A 2ZZDA 4M7AA 4A53A 3MEUA 2PUKB 3F70A 3V8KA 3CCJA 3VKIA 1Q81U 3G4ST 4DA4A 1KD1U 2RJEA 5GAOl 3I55A 4LD9K 1QW1A 4N0AA 4IURA 2DXCA 3MEWA 3T9NA 1I5LA 3L2QA 2K3XA 3TREA 2ZPFB 3WVEB 5GMKi 2C06A 2QXFA 2DXTA 2WSEE 3CD6A 4LDVA 2DIQA 2VYTA 4M78C 3JCMe 1Q82U 4X9DA 4DQ2A 2K5IA 4M75F 2M9UA 4RCCA 4QW2A 4HKEA 1VQMA 1JBMA 2LNVA 4P5NA 4C0DB 1KQSS 2DXBA 3QJYA 3QIIA 4M77G 5GAN6 4RG8A 4JRIA 2EYQA 5LJ5g 4A4FA 4L5GA 2PVDB 3CEYA 4C8QD 3OS1A 1VIFA 1WQ7A 2LVMA 1WJSA 5EG2A 4ZGEB 2VV5A 3GNFB 2GCXA 1PSFA 4YTLA 4M7AB 4MDWA 3HFOA 1WJRA 4O6JA 4IUUA 4L6V5 5CVIA 2RH2A 1N8RU 2VGNA 3CMAA 4F7UA 1U1TA 4PKCC 1UEBA 4ZTFA 1WQWA 2DTIA 2P0PA 1JJ2S 2RJDA 4EPCA 1BIAA 1LNXA 4CI0C 4FM4B 3OS2A 1VQ9A 2DZCA 2EQMA 2VXFA 3EFSA 1MHNA 4C92A 4HA8A 1RL2A 4QQ6A 3S3OA 2E70A 3JCMJ 3I56T 4X34A 2LT4A 2E10A 1NJIC 2X4YA 3OYMA 2RI5A 1VQ5A 3O8VA 3GOXA 3CCEA 2XG8D 2L3RA 4PJOD 4BUGA 3CBPA 5GMKe 1S72T 1KHCA 3JB9F 1LJOA 2K2VA 5HY6A 5A2QE 4C8QE 3J7AF 1QVFS 4FSXA 3C4SA 2LDMA 3CC2T 1UB4A 3M9QA 3OYIA 1B34A 5CR2A 2ZCFB 4F7UB 5CKDA 5LJ3h 4E7HA 1M1FA 4XTZA 1NJIU 2RHZA 2RK2A 4XTXA 2QQSA 5LJ5d 3OMGA 2RJCA 2EJFA 3CCMT 3OYDA 3RMSA 3A8OB 4ZN1A 1VQOT 3HKSA 4M77C 4M75A 4C92B 3A8HB 1XNIA 3VV0A 1VUBA 1I8FA 3ME9A 1X75C 5I21A 1K8AC 2Y4YA 5GAN8 4RCBA 5IT9E 3CC7A 1KQ1A 4ME7A 4C8QF 3CMET 2LCCA 4XQ3A 2FHDA 4C0FA 5GAMh 3OYCA 4JRPA 2KY9A 5A0DA 2PUOB 4JS5A 4PJOE 3OYKA 4N0AC 3OYBA 3JB9H 5LJ5e 2IVWA 3FC3A 2JVVA 3JCMg 2RK1A 4HT8A 2ZPBB 3JCMX 2ZPHB 2YHTA 4HCZA 4IUQA 3VJPA 1K8AU 5I2MA 2VC8A 4QVDA 1S72A 2CZ0B 3SD4A 2DTOA 2QTXA 3CBMA 5FRNA 3A8LB 2A3LA 2DZ9A 3WXMB 1W4SA 2QQ9A 3RESA 2DVEA 2EJGA 2O01E 4M75B 3CCRT 5GAN3 1HXDA 3X20B 2Y4XA 4OB0B 3JAME 1BIBA 4QQDA 2OTLT 1VQ6A 3JCMW 3G71A 4PJOF 4BI4A 1H641 2KK4A 2E6NA 2JNGA 3E9FA 2X4XA 5FU6C 1QVGA 3PIPA 4ATOA 3G7ZA 3G6ET 3M55A 2FL7A 5LJ3f 2XDDA 3A8GB 3E9GA 1D3BA 3OBYA 1AHJB 3SWNB 5GAN7 2JTMA 2G3RA 3QO3A 4J83A 3V7RA 2XICA 5CKEA 3R6OA 3JCMb 5GAOn 1VQNA 2XDPA 3OMCA 4M78D 3UWNA 5I2SA 1NPRA 3FB9A 4JRQA 3JCMh 1BYMA 1R8OB 4BB7A 1W2BA 1G3TA 5GANj 4PLLA 5GANg 3A8MB 4M7DG 2LQKA 2RHIA 5GAMf 2F5TX 3OW2A 3LYIA 4X9CA 1YJNT 2OAUA 3CPWS 1YJWA 2DD4A 2L5QA 1DJ7B 4C8QA 4NL3A 2R5AA 3RUXA 2M1HA 3GNGA 4XTUA 3JB9D 4FU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  5GAM d;  3HFO A;  2RM4 A;  4JUV A;  1KQ2 A;  2EWN A;  4M7A E;  4F7U A;  1U1T A;  2EAY A;  4XU0 A;  3JCM P;  3BDU A;  1D3B B;  1WQW A;  2DTI A;  2FYK A;  1M5Q 1;  1LOJ A;  3AHU A;  1M8V A;  5GAN 4;  4XU1 A;  1BIA A;  1LNX A;  3QSU A;  5GAO q;  2DZC A;  4JLI A;  2RD1 A;  1X01 A;  1YCY A;  2VXF A;  2YLC A;  3EFS A;  3QHS A;  4C92 C;  4C92 D;  4C92 A;  4HA8 A;  4M78 B;  3EFR A;  3JCM J;  3QUI A;  4M78 E;  4EMG A;  2E10 A;  3RKY A;  2VXE A;  5LJ5 j;  4QVC A;  3BFM A;  3JB9 D;  5GAN 2;  5GAN d;  4PJO D;  4PJO C;  5GMK e;  4M7A F;  4PJO A;  3JB9 F;  4C8Q B;  1LJO A;  5GMK h;  4M7D G;  2DXU A;  4C8Q E;  2EJ9 A;  5LJ5 f;  3HSB A;  3L1A A;  4J5Y A;  2HNI A;  4M7A G;  3RER A;  1B34 A;  1B34 B;  3PGG A;  5LJ3 e;  4F7U B;  1MGQ A;  5LJ3 h;  5CAI A;  4J6X A;  4XTZ A;  1Y96 A;  1WNL A;  1HK9 A;  3BW1 A;  4XTX A;  4F7U E;  5LJ5 d;  3JCM Q;  1U1S A;  3V8L A;  2EJF A;  5GAO r;  1I4K 1;  4M78 F;  4M75 D;  4M77 D;  4PNO A;  4M7D D;  4M75 C;  4M77 C;  4M77 A;  4M75 A;  4C92 B;  4M7D A;  4M7D C;  4PJO E;  3RIR A;  4M78 G;  1I8F A;  4NL2 A;  4XTY A;  3JCM V;  4C92 E;  5I21 A;  3BY7 A;  3RKW A;  5GAN 8;  4RCB A;  4EMK C;  5GAN 5;  4MMK A;  1KQ1 A;  4C8Q F;  2E65 A;  4XTV A;  2DJZ A;  4XQ3 A;  5GAM e;  2DKG A;  3V8J A;  5GAM h;  4Y91 A;  3INZ A;  2YLB A;  2DTH A;  4PJO B;  1N9S A;  2RA2 A;  4C8Q G;  3SWN C;  2E64 A;  5GAN e;  4N0A C;  3JB9 J;  3V7S A;  5GAN h;  3JB9 H;  4F7U F;  5LJ5 e;  4OP0 A;  5LJ5 h;  3JCM g;  3JB9 G;  4HT8 A;  5GAO m;  2JN0 A;  4NOY A;  4XU3 A;  1JRI A;  3JCM X;  2YHT A;  4F7U G;  2VC8 A;  4QVD A;  1Y96 B;  3JCM f;  2DTO A;  2QTX A;  4M7D B;  4C92 F;  4EMH A;  1TH7 A;  5GMK j;  2DZ9 A;  3RES A;  4A54 A;  2DVE A;  2EJG A;  2DEQ A;  4M75 B;  2FB7 A;  4M77 B;  1HXD A;  3V7C A;  1N9R A;  4JRK A;  4C92 G;  4M75 E;  4M77 E;  3JCM d;  3VU3 C;  4M7D E;  5GAO p;  5GMK m;  3FJP A;  1BIB A;  4V2S A;  4EMK A;  3M4G A;  4MML A;  5LJ3 j;  3JCM W;  3GIB A;  3JCM c;  5LJ3 g;  4PJO F;  1H64 1;  4WF2 A;  4M7A D;  2E1H A;  4M7A C;  4M7A A;  4A53 A;  3SB2 A;  3V8K A;  4PJO G;  5LJ3 f;  5GAO l;  3SWN A;  2K57 A;  1D3B A;  4N0A A;  3SWN B;  5GAN 7;  3QO3 A;  3V7R A;  1I5L A;  4HT9 A;  5GMK i;  3JCM b;  2DXT A;  5GAO n;  2RB6 A;  3L2Z A;  5LJ3 d;  4M78 D;  2ZGW A;  4J6Y A;  4M78 C;  4M78 A;  3JCM e;  3FB9 A;  4X9D A;  4DQ2 A;  4M75 F;  4M77 F;  3JCM h;  3RKX A;  4XTW A;  4RCC A;  5GAM j;  5GAM g;  2CGH A;  5GAN 3;  4M7D F;  3HFN A;  1JBM A;  5GMK l;  5GAN j;  1WPY A;  4M75 G;  2I2L A;  4M77 G;  5GAN 6;  5GAN g;  3FIF A;  4J6W A;  4JRI A;  5GAM f;  5LJ5 g;  2E41 A;  4X9C A;  4C8Q D;  3JB9 I;  5DY9 A;  4C8Q C;  4C8Q A;  1WQ7 A;  4EMK B;  4NL3 A;  3RUX A;  1I81 A;  5GAN f;  4XTU A;  2Y90 A;  4XU2 A; 
#chains in the Genus database with same CATH topology
 1W2B P;  1JJ2 P;  1JXO A;  1XQH A;  3C12 A;  1YCY A;  2AKL A;  3X24 B;  2DL7 A;  2GFA A;  3CC4 Q;  1AZG B;  2RQW A;  3PMI A;  3J80 E;  2MPX C;  4C8Q B;  1I07 A;  4M7A G;  1QWE A;  5HKC A;  1N6A A;  2KBT A;  1AVZ C;  1W2B S;  1WNL A;  1T3L A;  2MI6 A;  1I4K 1;  4WCI A;  4KUD K;  3G1J A;  2QK0 A;  5FU7 B;  5KYW B;  3S3M A;  1BI0 A;  2DF6 A;  2DNU A;  2EQK A;  3CCS T;  2KRN A;  2ZPE B;  4J9E A;  3FLG A;  2FO0 A;  1GCQ A;  2RA2 A;  2CKK A;  1WHG A;  1QP3 A;  2JN0 A;  5ECA A;  3EG0 A;  2E3I A;  3MO8 A;  1K73 C;  3M56 A;  4F7U G;  3CC2 Q;  2QDY B;  2KRM A;  1N27 A;  3OYF A;  4C92 G;  2D8J A;  1G3S A;  4E7K A;  4M7A C;  1QP2 A;  4N4G A;  3SWN A;  3CXC P;  1G83 A;  3EGU A;  2BZY A;  1WXB A;  4FYW B;  3URG A;  2JTF A;  1ZA1 B;  2DX1 A;  2ZGW A;  2DYB A;  2CZ7 B;  4J6Y A;  1IGQ A;  2MMP A;  3H0I A;  2P0K A;  2I2L A;  2KVQ G;  3N5B B;  2E41 A;  2R5M A;  1JQQ A;  1K0X A;  1VQO A;  1OX8 A;  1K4U S;  2M0Y A;  2EWN A;  4OMP A;  1EX4 A;  4AFS C;  1UGS B;  1KC8 C;  2EAY A;  4FSS A;  3L2U A;  5CKB A;  1SSH A;  2NUP A;  3G6E Q;  2LZ6 B;  4XU1 A;  3CXC S;  3QHS A;  5CK9 A;  4C92 C;  3VYH B;  1NBE B;  2EPD A;  2KT8 A;  3AT1 B;  1OQK A;  4A4K A;  2X3X D;  1ABQ A;  4JZ4 A;  3CCL T;  2H3J A;  4LE9 A;  4OMQ A;  3ER0 A;  3CD6 T;  1WHM A;  2OTJ Q;  1V1C A;  1PKT A;  3OYA A;  4J5Y A;  4RUG A;  2DBM A;  2D9T A;  4PLI A;  1C0M A;  3ZBD A;  1C1A A;  4O5V A;  4M7D D;  2CS7 A;  4BI3 A;  3JSC A;  5LL6 S;  3BY7 A;  3CMA T;  3M59 A;  4BE2 A;  3PMT A;  1D09 B;  4KT0 E;  1PSE A;  4FIB A;  2C0O A;  9ATC B;  1OUL A;  4IUP A;  4OP0 A;  5KYU B;  4NS5 A;  2EFI A;  1YJN A;  2BIV A;  4JDS A;  1A0N B;  1MND A;  2ESW A;  5HK3 A;  2EIF A;  5AT1 B;  2QQR A;  5CQX A;  5IH2 A;  1VYU A;  1N9R A;  1Q86 U;  3QPH A;  5GMK m;  1MMA A;  4AG2 C;  3LX7 A;  1M90 U;  4VUB A;  3EFO B;  3HP9 A;  5CO7 A;  1R77 A;  2NUT A;  1ACM B;  3OSV A;  1YI2 Q;  2CT3 A;  3Q1J A;  4HT9 A;  1YHQ A;  2K4Y A;  1QVP A;  4RG2 A;  3UT1 A;  5C0M A;  3CC7 T;  5D6W A;  1W2B A;  2NLU A;  4M7D F;  2QEX Q;  4ZGJ B;  2AZS A;  2P4T A;  3VYG A;  5GMK l;  1UTI A;  1K9M U;  4HVV A;  4J6W A;  1LVK A;  3ZL7 C;  2PZ1 A;  2QTV A;  2PTK A;  5GAN f;  4AT1 B;  1I5O B;  3FDR A;  1PD0 A;  5FU6 B;  3CCV A;  3VUB A;  2FZC B;  2QDL A;  4R0K A;  1VQ6 T;  3M57 A;  1WHK A;  4JLI A;  1X01 A;  1EZZ B;  3NGP A;  1Y57 A;  4RKU E;  4RTX A;  4II1 A;  4JPB W;  4MDX A;  3M54 A;  5EC7 A;  2VXE A;  1VQ7 A;  3CCQ A;  3MET A;  3NFC A;  2A28 A;  3I56 A;  4RTU A;  4LDY A;  1MMD A;  2V8J A;  3LH5 A;  2COY A;  1JB0 E;  3EGX A;  5KYX B;  3VS6 A;  1YIT T;  4E7S A;  5GJV B;  5DLO A;  1R0B G;  3BE3 A;  3HL8 A;  5D7U A;  2GF7 A;  2QA4 A;  2COZ A;  2AIR B;  3RKW A;  3CPF A;  4LUD A;  2CT4 A;  1SSF A;  2O4X B;  2CYZ B;  1QCF A;  1WIE A;  1X2K A;  3NTI A;  1WGS A;  1SRM A;  8AT1 B;  3J81 E;  2E6Z A;  1M2O A;  2K5L A;  3U23 A;  1TTH B;  3OS0 A;  3VRY A;  1VQM Q;  1KQS P;  3X26 B;  1FX7 A;  3E19 A;  3CXC A;  1EIF A;  2J6O A;  3EGD B;  1SF9 A;  2FB7 A;  1PNJ A;  1BI3 A;  2LC4 A;  2DL3 A;  4MML A;  2D0Q B;  1H3H A;  2QAS A;  2E1H A;  2L89 A;  4M7A A;  3MEU A;  1M30 A;  3I55 A;  1QW1 A;  1RUW A;  4IUR A;  3MEW A;  3T9N A;  1CKB A;  3HTR A;  3JCM e;  1NEG A;  4ESR A;  3CCE Q;  4C0D B;  1KQS S;  4RG8 A;  5LJ5 g;  1PKS A;  2CUB A;  3MPU B;  4L5G A;  2ATC B;  1WQ7 A;  2YUP A;  1QKX A;  2GCX A;  4YTL A;  1ABO A;  2OAW A;  1WJR A;  2VGN A;  4F7U A;  2V1Q A;  1UEB A;  2P0P A;  1PC0 A;  2HL5 C;  1ZSZ B;  2DZC A;  2FRY A;  2VXF A;  2KYM A;  4C92 A;  5I22 A;  3JCM J;  1QVG P;  2QGF B;  1VQ5 A;  2AZV A;  3GOX A;  4PJO D;  1BCO A;  1B7T A;  1UEC A;  3JB9 F;  4OML A;  3J7A F;  1IO6 A;  2LNH B;  1S72 Q;  3M9Q A;  3CQT A;  3OYI A;  5LJ3 h;  1M1F A;  2RK2 A;  2QQS A;  1WFW A;  3OMG A;  2RJC A;  2EJF A;  2VWF A;  3OYD A;  2X9H A;  1VQO T;  2J05 A;  3EG9 B;  1XNI A;  3G71 Q;  6AT1 B;  2CH4 A;  1SEM A;  1YWP A;  1KQ1 A;  2EYX A;  1M8M A;  2V26 A;  2FHD A;  4C0F A;  5GAM h;  3OYC A;  8ATC B;  1VQN Q;  2ZPB B;  2ZPH B;  3VJP A;  2VC8 A;  3TSZ A;  2QYZ A;  1OU9 A;  2DBK A;  4LNP A;  2DZ9 A;  3I5S A;  1W4S A;  2EYZ A;  1YJW Q;  2EJG A;  2O01 E;  5GAN 3;  2Y4X A;  4OB0 B;  3JAM E;  1BIB A;  2KE9 A;  4PJO F;  1NYF A;  2KK4 A;  5IHK A;  2OTL Q;  2FL7 A;  2HSP A;  2CRE A;  2XIC A;  3TQ7 P;  2XDP A;  2OX7 A;  4M78 D;  4HVW A;  2NUZ A;  1WLP B;  3VS3 A;  1BYM A;  2HBW A;  4M7D G;  1YJN T;  3LYI A;  1YIJ Q;  2L5Q A;  2KEA A;  2R5A A;  3RUX A;  1BBZ A;  4JUV A;  1K8A R;  2BUD A;  1KQ2 A;  1HJD A;  1D3B B;  2P0Q A;  3G4S Q;  2K79 A;  1H92 A;  2AK5 A;  4A4H A;  1I1J A;  5IN1 A;  3QUI A;  4A4E A;  2KT1 A;  1YJ9 T;  4PFO A;  2ECZ A;  5CQY A;  5LJ5 j;  3C94 A;  4OF1 A;  1M9S A;  1AWO A;  1GCP A;  2LP5 A;  1VQL A;  4R56 A;  4OVA A;  4OMF B;  1Y7X A;  4A63 B;  2DET A;  3LGL A;  4DBR A;  3OBW A;  5GAN d;  4GLK A;  1D0Y A;  4M78 F;  1O75 A;  4M77 D;  3L2R A;  1VQK T;  4OMM A;  4JZ3 A;  4M7D C;  4A4G A;  1ZUY A;  2X35 A;  3LWI A;  3JCM V;  2CUD A;  3CCV T;  4Z02 A;  4XAX B;  2LQ8 A;  1M27 C;  2E65 A;  2RQV A;  1KQS A;  3CC4 A;  2W10 A;  3REA B;  4TVR A;  2DA9 A;  2D6F A;  3PT9 A;  2L3S A;  1D1C A;  4F17 A;  1LPL A;  2XK0 A;  1VQ7 T;  2QQB A;  2DIG A;  1FMV A;  1WHL A;  3A5Z B;  2JMA A;  1D1A A;  3CCM Q;  3PNW C;  2B86 A;  4F16 A;  4WF2 A;  3GF5 A;  1UUE A;  3LLR A;  1YN8 A;  2EBP A;  2QA4 T;  2HCK A;  4J9F A;  1AWW A;  1X43 A;  5FU7 C;  1UGQ B;  1KJW A;  4BY6 B;  2GQI A;  4M77 F;  2YXY A;  4ZGD B;  3CC2 A;  5KH6 A;  3QYH B;  3HFN A;  2LX9 A;  1MUZ A;  2DPP B;  4ZNX A;  3NTH A;  4UC4 A;  4D8D A;  1MNE A;  1I81 A;  1XTD A;  1GBR A;  2K3B A;  4MZT A;  3JCM P;  1RAG B;  3DB3 A;  3C95 A;  1JO8 A;  1U3O A;  1WHH A;  2JJ9 A;  4Z88 A;  3FJ5 A;  1AWJ A;  2EGC A;  4FYY B;  3I55 T;  1S1N A;  1T3S A;  5A0L A;  5C6S A;  1IGU A;  4OGC A;  2GFU A;  5GAN 2;  2YRV A;  2JM9 A;  3CCL Q;  4OGE A;  1AT1 B;  4RTW A;  2F2W A;  4KH0 B;  1WXT A;  2RHX A;  1Y96 A;  4CC2 A;  1Q81 C;  2NUP B;  1YFN A;  1R0C B;  3GLX A;  1Q7Y R;  1KD1 C;  1VQP Q;  4R55 A;  4LD6 A;  2PVG B;  3G6E A;  1Y07 A;  3MP1 A;  4CC3 A;  2CP0 A;  1Q82 C;  4C5H A;  3TVT A;  1OZ3 A;  2FZK B;  1N9S A;  1VQ4 Q;  1K9A A;  4N4H A;  1Q86 C;  5GAN h;  2RQU A;  1QLY A;  2OTJ A;  1ZX6 A;  3QDR B;  3D7S B;  1M90 C;  3X25 B;  1VQ5 T;  2OJ2 A;  5IHN A;  2L8D A;  5M9O A;  4BDY A;  1RI0 A;  1N8R C;  3A1P A;  2M51 A;  2V8I A;  2PQW A;  5KE2 A;  3FJP A;  5CIU A;  4EMK A;  1H3Z A;  4FT2 A;  1D1B A;  1VQ8 T;  1SPK A;  2WSC E;  4PJO G;  1K9M C;  2MOX A;  3NTK A;  1M3C A;  1P92 A;  2K3Y A;  2K5F A;  3VS0 A;  2FEI A;  3QKJ A;  4ELZ C;  4JS4 A;  3QJ6 A;  1W1F A;  4XTW A;  4ELY C;  2XD0 A;  3H0F A;  2DL8 A;  3MHX A;  3M0P A;  1WPY A;  4OB1 B;  5CKF A;  3FIF A;  2M02 A;  1G5V A;  4C5E A;  2XKO C;  3PFS A;  5DY9 A;  2YUN A;  2KNB B;  2YUQ A;  5CCA A;  4HCB A;  4M7A E;  2NUT B;  3QWX X;  3OB9 A;  3MKD A;  3MEA A;  4LN2 A;  1U06 A;  2SEM A;  1O9S A;  1YI2 A;  2RD1 A;  2YDL A;  2QG9 B;  4EMG A;  2AHJ B;  2BZX A;  1TG0 A;  1UGV A;  2QEX A;  4QVC A;  3CCU Q;  4Z8A A;  2K7A A;  1UG1 A;  2RPN A;  2LJ1 A;  4PJO C;  2MIO A;  1YWO A;  2PVO B;  3M5A A;  2I0N A;  2ZPI B;  2HNI A;  4KBM B;  1UE9 A;  4PFP A;  3BW1 A;  4F7U E;  1WXU A;  4ZN3 A;  2ED1 A;  2CZ1 B;  1X6O A;  1BI2 A;  2DRM A;  1YIT Q;  4M75 D;  2C0T A;  4M7D A;  3CCJ T;  4M78 G;  4C92 E;  3L2W A;  4LDX A;  5GAN 5;  3GBQ A;  2LTO A;  5J3B A;  1WA7 A;  1RAB B;  3QG1 A;  2YLB A;  4ORZ A;  1B3Q A;  2E64 A;  3TU4 K;  2GQV A;  2F5K A;  2LRQ A;  1PRM C;  1JEG A;  3H8Z A;  3EGX B;  1OPL A;  1M3A A;  2DM1 A;  3HHT B;  1ZQ1 A;  4J9C A;  4CC4 B;  3GPL A;  1VQL T;  1Z9Q A;  4KRT A;  4JJN K;  1RAI B;  2W0Z A;  3VU3 C;  4V2S A;  2XID A;  1GRI A;  3M4G A;  1ZHI A;  2M0O A;  3DLL A;  4BE0 A;  2ZZD A;  4A53 A;  1WDX A;  1Q81 U;  4DA4 A;  1KD1 U;  1RAF B;  1VQ9 Q;  3L2Q A;  2NYS A;  2O9S A;  5GMK i;  1NYG A;  1M1K R;  2DIQ A;  4M78 C;  1Q82 U;  2DEU A;  4M75 F;  3PE0 A;  1VQM A;  2X51 A;  1JBM A;  4P5N A;  4M77 G;  1E6H A;  2ZAE A;  3CEY A;  4C8Q D;  2HEQ A;  2X3W D;  1E7O A;  3EG1 A;  5EG2 A;  1JU5 C;  2VV5 A;  3GNF B;  4M7A B;  3HFO A;  4IUU A;  4L6V 5;  4PFZ A;  1N8R U;  2RJD A;  4EPC A;  1GL5 A;  2EQM A;  2ROL A;  4PJJ A;  2VB6 A;  4QQ6 A;  1RL2 A;  3NMZ C;  1SG5 A;  2E10 A;  2PNI A;  2X4Y A;  2RI5 A;  2EGA A;  3CCE A;  2L3R A;  1WI7 A;  1LJO A;  2K2V A;  4FSX A;  2IIM A;  2LDM A;  3CC2 T;  1UB4 A;  2ZCF B;  4F7U B;  4E7H A;  4XTZ A;  2RHZ A;  4XTX A;  5LJ5 d;  2C0I A;  2ED0 A;  4ZN1 A;  1BK2 A;  1FMK A;  4M77 C;  1W70 A;  4C92 B;  3VV0 A;  2V1R A;  4JJD A;  2FPD A;  4FYV B;  4C8Q F;  1OX9 A;  2LCC A;  4KGV B;  4JRP A;  5A0D A;  2PUO B;  4N0A C;  4QT7 A;  2LJ3 A;  2JVV A;  2DYI A;  1ZSZ C;  2YHT A;  2RQT A;  1K8A U;  1S72 A;  2KYB A;  3CBM A;  3A8L B;  4RTV A;  2BZ8 A;  3EHQ A;  2DVE A;  1HSQ A;  4QQD A;  1D0Z A;  3JCM W;  3SEM A;  3G71 A;  2X4X A;  3G6E T;  1NJI R;  2KRO A;  2HMA A;  5GAN 7;  1PCX A;  3UA6 A;  5GAO n;  1VQN A;  3UWN A;  1ZLM A;  5I2S A;  3FB9 A;  3O5Z A;  3JV3 A;  2RHI A;  1YJW A;  1DJ7 B;  1M3B A;  4XTU A;  3JB9 D;  4M4Z A;  2E5K A;  3MEV A;  2CDT A;  4E7L A;  4LXC A;  2OTL A;  5GJW B;  1M8V A;  5GAN 4;  2KQW A;  5D6Y A;  2EQU A;  1YP5 A;  5FRM A;  2RO0 A;  2OI3 A;  4JJC A;  4PJM A;  1XOV A;  2KXC A;  3C0C A;  5KCO A;  3BFM A;  1AOJ A;  1YJ9 Q;  2LCS A;  4PJO A;  2HQH A;  2FRW A;  4PJN A;  1NG2 A;  5GMK h;  4D8K A;  1YIJ A;  3S6W A;  3RER A;  2CP2 A;  2DFU A;  3BDL A;  2MWP A;  4DEX A;  4HCK A;  4IUV A;  3VS7 A;  3G4S A;  4FW2 A;  2BE9 B;  2KXD A;  3E1S A;  5FWC A;  1VQK Q;  4J7I A;  3TEE A;  2A0F B;  3MP8 A;  5J26 A;  1FXX A;  2XDB A;  2GGR A;  3V8J A;  4Y91 A;  4AG1 C;  2DO3 A;  2YRC A;  3S3N A;  1RAE B;  1G8X A;  3OYN A;  5LJ5 h;  2D8H A;  4C0G A;  1G2B A;  2KR3 A;  4QVZ A;  3SHW A;  2QEX T;  2YUO A;  4RTZ A;  2FPE A;  2G6F X;  4IIO A;  5GAO p;  2K2M A;  1YCS B;  2HQX A;  1E6G A;  4E7I A;  2XI9 A;  3SB2 A;  3CME Q;  1NLO C;  2VGM A;  3H6Z A;  3P8D A;  3THK A;  1OPK A;  1ZBX A;  2F69 A;  1IXD A;  4M78 A;  4RMO A;  4Z89 A;  1Q7Y U;  2F2V A;  2IPO B;  1U5S A;  4M75 G;  3P8B B;  3JB9 I;  2X4J A;  3CCM A;  3CCR Q;  3MP6 A;  2CP7 A;  3H41 A;  2QI2 A;  1X2Q A;  1M5Q 1;  1LOJ A;  1FYN A;  3QSU A;  2YLC A;  4DOV A;  5J39 A;  2CSQ A;  3M53 A;  1K73 R;  3OYH A;  1IZ6 A;  3L2V A;  1RAC B;  2PU9 B;  4HCC A;  2HL3 A;  3L1A A;  5D6X A;  1PHT A;  3DB4 A;  2RJF A;  4DBF A;  2RN8 A;  1HK9 A;  1MV3 A;  3V8L A;  4K11 A;  4XK8 E;  5I11 A;  3EAE A;  4M75 C;  4M77 A;  3DKM A;  1UGR B;  4NL2 A;  1EFN A;  1PD1 A;  4MMK A;  2HBP A;  2MAM A;  1YHQ T;  2DKG A;  4IIM A;  3M0Q A;  3TCJ A;  4OMN A;  2CH4 W;  4C8Q G;  3SWN C;  3CCL A;  1JRI A;  4J7F A;  1K76 A;  5KYY B;  1HYO A;  1SRL A;  3CCE T;  1Y96 B;  2HZY A;  3SFM A;  4E47 A;  2KAF A;  2QQA A;  1OEB A;  1KC8 R;  4LDW A;  5CKH A;  1BKB A;  1VQP A;  2F1L A;  1M2V A;  4M7D E;  2YWW A;  5DM7 R;  5LJ3 j;  2A7Y A;  1UHF A;  4B9X A;  1BCM A;  2ROT A;  2VAS A;  3QWY A;  3VUZ A;  1Y71 A;  3CCS Q;  1CSK A;  1VQ8 Q;  1QCN A;  1V76 A;  1VQ4 A;  2M16 A;  2DLP A;  3CCQ T;  4DBH A;  1TXQ A;  1LCK A;  5GAM j;  3CBO A;  2A37 A;  2EQJ A;  3I56 T;  2FG0 A;  3RKX A;  3H9N A;  2MWO A;  1MMN A;  3R6N A;  1MMG A;  2EKO A;  4C8Q C;  4EMK B;  3P8H A;  1FWZ A;  2Y90 A;  3ULR B;  1NZ9 A;  2RM4 A;  5IAY A;  2BKD N;  4XU0 A;  3OQ5 A;  1OI1 A;  1NE8 A;  4BI8 B;  1OYX A;  3OA6 A;  3OW2 P;  2WAC A;  3G71 T;  1UFF A;  5GAO q;  2L3P A;  2LQN A;  1WYX A;  4EDU A;  2DIL A;  3QYG B;  4OMO A;  1IB8 A;  2RI2 A;  2E12 A;  2GTJ A;  2QGG A;  2DAQ A;  7AT1 B;  4AFZ C;  1VQN T;  3PVL A;  3MCA B;  1KK7 A;  2P84 A;  4GBQ A;  3ZEH A;  5LJ5 f;  4EIK A;  3DLM A;  1B34 B;  3M0T A;  3PGG A;  5LJ3 e;  1MGQ A;  5IXF A;  4J6X A;  1YJW T;  2X4W A;  2WSF E;  1KG1 A;  2L0A A;  4Y28 E;  2F2X A;  3LWH A;  1U1S A;  5GAO r;  1G3Y A;  3OS5 A;  3OW2 S;  1M1K U;  1OU8 A;  2J6F A;  2AT1 B;  1TUC A;  4Y92 A;  3CCJ Q;  1N5Z A;  5GAM e;  3INZ A;  1VIE A;  3OYE A;  3CCU A;  4Q5W A;  3H0H A;  1BI1 A;  4JLG A;  3HRS A;  3V7S A;  4F14 A;  3CD6 Q;  3JB9 G;  5GAO m;  4E7Z A;  5KYY A;  2KGT A;  2COW A;  2A36 A;  3HPW A;  2LT1 A;  1YIJ T;  4A54 A;  4OB3 B;  4M7D B;  3OSS C;  4JRK A;  2RI3 A;  3JCM d;  4GY5 A;  1YIT A;  4OB2 B;  2EGE A;  4KUL A;  1VYT A;  5KCH A;  2HSE B;  3JCM c;  3CMA Q;  3V8K A;  2VKN A;  3VKI A;  3G4S T;  1ARK A;  5GAO l;  4LD9 K;  1I5L A;  2K3X A;  3WVE B;  2DVJ A;  4X9D A;  2K5I A;  4RCC A;  4HKE A;  2LNV A;  2DXB A;  1VOM A;  1QKW A;  2EYQ A;  4A4F A;  1QVF P;  1QQJ A;  3KFV A;  4ZGE B;  1PSF A;  2CP5 A;  3VS5 A;  4O6J A;  4PKC C;  1WQW A;  1JJ2 S;  2DE0 X;  1WZO A;  4FM4 B;  4CI0 C;  1VQ9 A;  3EFS A;  1MHN A;  2J7I A;  2E70 A;  3CC7 Q;  4X34 A;  1B07 A;  1IHV A;  4ANJ A;  3OYM A;  3REB B;  2MK5 A;  3O8V A;  4HVU A;  2XG8 D;  1X27 A;  5HCK A;  4BUG A;  3CBP A;  4J9D A;  5A2Q E;  5KYN A;  1QVF S;  5FWB A;  1TSF A;  1B34 A;  5CR2 A;  1AWX A;  2L2P A;  1NJI U;  1BB9 A;  3RBB B;  3CCM T;  3EH1 A;  3HKS A;  4M75 A;  1VQ6 Q;  3A8H B;  1I8F A;  2CSI A;  1K8A C;  5I21 A;  1XJW B;  4RCB A;  1Y0M A;  3VS2 A;  4ME7 A;  2D0N A;  1UDL A;  2QAZ A;  1AD5 A;  4PJO E;  3M0R A;  1PM3 A;  3JB9 H;  1WHJ A;  2O2O A;  1JXM A;  3JCM g;  2RK1 A;  4HT8 A;  3JCM X;  1AZE A;  2P4R A;  2CZ0 B;  1F1B B;  5FRN A;  2DJQ A;  4WTO B;  3TSW A;  3WXM B;  2QQ9 A;  3RES A;  3CPW P;  2H8H A;  1KIK A;  4BI4 A;  5FU6 C;  3PIP A;  1UHC A;  3G7Z A;  3NPF A;  4JJB A;  1AHJ B;  3QO3 A;  4J83 A;  3V7R A;  5CKE A;  3R6O A;  2L3Q A;  2D1X A;  3JCM b;  3UA7 A;  3OMC A;  3JCM h;  4BB7 A;  1G3T A;  2O88 A;  2FPF A;  5GAN j;  3A8M B;  2LQK A;  4E6R A;  3OW2 A;  1T0J A;  2OAU A;  3CPW S;  3MJX A;  4C8Q A;  2M1H A;  3GNG A;  4RTY A;  4FU6 A;  3VS4 A;  3HRT A;  1WJQ A;  1RLP C;  1VQP T;  1IHW A;  2KMT A;  3BDU A;  4C5I A;  3AHU A;  2V8K A;  1RAH B;  4F04 B;  1NPP A;  4BDZ A;  5KYW A;  2HQE A;  3CC4 T;  2VVK A;  4M78 E;  4AFQ C;  3IQL A;  2JZ2 A;  1GXI E;  1VQ4 T;  2IG0 A;  2HDA A;  1QWF A;  1UJ0 A;  1TWB A;  4HXJ A;  4BE1 A;  3OYY A;  1TUD A;  5A0G A;  1IRE B;  1GFC A;  2RNA A;  3M0U A;  4AMC A;  3QDF A;  3QZ9 B;  4PNO A;  1KFZ A;  3RIR A;  4BAC A;  3QBY A;  2KI7 A;  4C5G A;  3OYG A;  2DJZ A;  5DLQ E;  3FRN A;  1OV3 A;  4PJO B;  3RDV A;  1YBY A;  3HRU A;  1YJ9 A;  5GAN e;  1MV0 B;  4LUE A;  5AYF A;  3FEO A;  4KGZ B;  4B9W A;  2EYW A;  2HAX A;  2ENM A;  2J06 A;  5L8R E;  1JJ2 A;  4EMH A;  4FL6 A;  4C0D C;  2RHU A;  2DMO A;  4M77 E;  1VQO Q;  5FW9 A;  1K73 U;  3ASK A;  1ZUU A;  4AFU C;  3L42 A;  1VQK A;  2KDS A;  2JS0 A;  3M0S A;  3RNJ A;  1Q7Y C;  2JOY A;  1K0S A;  4LDU A;  3KUF A;  1QVF A;  2K6D A;  5KE3 A;  2ZPG B;  2RHY A;  2RB6 A;  3L2Z A;  5LJ3 d;  1SHG A;  1V29 B;  1VYV A;  3PIO A;  1PRL C;  1ZUK A;  3CCU T;  2CGH A;  4N4I A;  2JW4 A;  3KXT A;  4DEY A;  2AKK A;  4FCY A;  2CZ6 B;  4XU2 A;  3VRZ A;  5GAM d;  3UAT A;  2DER A;  3UDC A;  1NLP C;  2FYK A;  2O31 A;  3CME A;  4E7J A;  4RTT A;  1KSW A;  1PG5 B;  2R58 A;  4M78 B;  3EFR A;  2DL4 A;  1CKA A;  3A98 A;  1FMW A;  1KC8 U;  2OTJ T;  3NHN A;  2MF2 A;  4J9B A;  1WX6 A;  2HKQ B;  1RLQ C;  1ZA2 B;  4B6M A;  1YJN Q;  2MCN A;  2EJ9 A;  3CCR A;  5KYU A;  2VUB A;  2FZG B;  4FW1 A;  3JCM Q;  3I35 A;  4GLM A;  2GBQ A;  4PJL A;  5L23 A;  2J6K A;  3LH0 A;  4XTY A;  4E2F B;  1GBQ A;  3RMQ A;  3EFO A;  1VQ9 T;  4IKF A;  4KUI A;  5FLX E;  3CPW A;  2JXB A;  1YHQ Q;  2XMF A;  2BE7 D;  1PWT A;  2BTT A;  3EG3 A;  1G3W A;  4BD3 A;  1KHI A;  2RMO A;  3JCM f;  4ZTJ A;  1TH7 A;  2LCL A;  4M77 B;  1UGP B;  3V7C A;  2HKN A;  1W6X A;  3VS1 A;  1RAD B;  2H3E B;  5LJ3 g;  1VA7 A;  1RAA B;  3UPU A;  2XHC A;  3CCV Q;  4M7A D;  3E2U A;  1YI2 T;  3ZFJ A;  1SKU B;  2B8A A;  3OY9 A;  4D6W A;  2K57 A;  4CC7 A;  3QXE B;  3OYL A;  2JT4 A;  1OZ2 A;  2YSQ A;  2E5Q A;  5GAM g;  1VQ7 Q;  3CCQ Q;  1D0X A;  1X6G A;  3I56 Q;  2GTO A;  1Q95 G;  1Q81 R;  1M2V B;  1KD1 R;  1M1G A;  2HD0 A;  2Z0W A;  1U8R A;  2FVU A;  3OYJ A;  1M4Z A;  3LW5 E;  3I5R A;  5KYX A;  2DD5 A;  1Q82 R;  2JTE A;  4C0Z A;  5HK0 A;  3CCS A;  1ZSG A;  2QA4 Q;  1VQ8 A;  1X69 A;  3SDZ A;  4C92 D;  3WVD B;  1Q86 R;  3M4Y A;  4IUT A;  1M90 R;  3LGF A;  3JRZ A;  3M58 A;  2O9V A;  3RKY A;  1QMC A;  1QVG S;  1ZBJ A;  2DK3 A;  2O4X A;  1N8R R;  2NWM A;  4M7A F;  3EHR A;  2JUF A;  2CP6 A;  1M1K C;  2DXU A;  2LMJ A;  2LJ0 A;  3HSB A;  4PL6 A;  5FRO A;  5CAI A;  4KH1 B;  4X1V A;  2LQW A;  4MZP A;  4QQG A;  4DOW A;  1K9M R;  3PTA A;  2XU8 A;  3EGD A;  3GP8 A;  4CRI A;  3X28 B;  4EMK C;  2JS2 A;  5IXB A;  4FT4 A;  3QZ5 B;  2E4H A;  4XTV A;  3I55 Q;  2ABL A;  1RI9 A;  2SRC A;  2DTH A;  1GCQ C;  2JM8 A;  2R57 A;  3JB9 J;  4J8O A;  4F7U F;  1VQM T;  2GNC A;  4NOY A;  4XU3 A;  1I0C A;  1K1Z A;  2EKH A;  2KSS A;  4BY6 C;  1TUG B;  4C92 F;  5GMK j;  4L59 A;  2DEQ A;  2RQR A;  4PK4 A;  4M75 E;  2E3H A;  3EH2 A;  3KBG A;  3GIB A;  4MZM A;  2PUK B;  3F70 A;  3CCJ A;  4KGX B;  2RJE A;  2EYY A;  4N0A A;  2DXC A;  2JMC A;  3TRE A;  2ZPF B;  2A08 A;  1ZSZ A;  2C06 A;  2QXF A;  2DXT A;  2WSE E;  3CD6 A;  4LDV A;  2VYT A;  4DQ2 A;  1VQ5 Q;  2M9U A;  4QW2 A;  4FYX B;  3QII A;  3UF4 A;  5GAN 6;  4JRI A;  3OS1 A;  2PVD B;  1VIF A;  2LVM A;  1WJS A;  2RF0 A;  4MDW A;  2YRD A;  5CVI A;  1C6V X;  2RH2 A;  3CMA A;  1U1T A;  4ZTF A;  2DTI A;  1NM7 A;  1BIA A;  1LNX A;  3OS2 A;  3EG9 A;  1NEB A;  4HA8 A;  3S3O A;  1X6B A;  2LT4 A;  1NJI C;  2LX7 A;  3EG2 A;  5GMK e;  1S72 T;  1KHC A;  5HY6 A;  1HD3 A;  3RR6 A;  2K9G A;  4C8Q E;  2YT6 A;  3I9Q A;  3C4S A;  1IRX A;  1T0H A;  1H8K A;  1BU1 A;  5CKD A;  5IHI A;  1Z9Z A;  1QCO A;  4DBQ A;  1GFD A;  3RMS A;  3A8O B;  1VUB A;  3ME9 A;  1X75 C;  2Y4Y A;  5GAN 8;  2DL5 A;  5IT9 E;  3CC7 A;  3CME T;  4XQ3 A;  4J9G A;  1YNZ A;  2KY9 A;  4JS5 A;  3OYK A;  3OYB A;  2DRK A;  2IVW A;  5LJ5 e;  3FC3 A;  1OOT A;  1SHF A;  4IUQ A;  4HCZ A;  5I2M A;  4QVD A;  3SD4 A;  2DTO A;  2QTX A;  2A3L A;  1TU0 B;  3CCR T;  4M75 B;  1HXD A;  3X20 B;  3PVQ A;  1VQ6 A;  2OTL T;  1H64 1;  2E6N A;  4J9H A;  2JNG A;  3E9F A;  1QVG A;  4ATO A;  2EVR A;  3M55 A;  5LJ3 f;  2XDD A;  3A8G B;  3E9G A;  1D3B A;  3OBY A;  3SWN B;  1J3T A;  2JTM A;  2G3R A;  2MYS A;  2EW3 A;  4QKU A;  1NPR A;  2CP3 A;  4JRQ A;  1UJY A;  2EQI A;  2KRS A;  1R8O B;  4PLL A;  5GAN g;  4J9I A;  5GAM f;  2F5T X;  4X9C A;  1VQL Q;  2DD4 A;  4NL3 A;  1TS9 A;  1AEY A;  1TOV A;  3QJY A; 
#chains in the Genus database with same CATH homology
 3HRT A;  3MEV A;  4JUV A;  1WJQ A;  2BUD A;  1KQ2 A;  4E7L A;  1VQP T;  2OTL A;  1XQH A;  2KMT A;  1D3B B;  3BDU A;  4C5I A;  2P0Q A;  3AHU A;  1M8V A;  3C12 A;  5GAN 4;  2V8K A;  2KQW A;  5D6Y A;  2EQU A;  5FRM A;  1YCY A;  4A4H A;  1NPP A;  2RO0 A;  4BDZ A;  2HQE A;  3CC4 T;  5IN1 A;  3QUI A;  4M78 E;  3X24 B;  4A4E A;  1XOV A;  1YJ9 T;  2GFA A;  5CQY A;  2JZ2 A;  5KCO A;  5LJ5 j;  1VQ4 T;  3C94 A;  3BFM A;  1GXI E;  4OF1 A;  1M9S A;  2IG0 A;  3PMI A;  3J80 E;  4PJO A;  4C8Q B;  5GMK h;  1YIJ A;  1VQL A;  3S6W A;  4R56 A;  4OVA A;  4OMF B;  4BE1 A;  4M7A G;  1Y7X A;  5HKC A;  3RER A;  3OYY A;  1N6A A;  3LGL A;  3OBW A;  5A0G A;  1IRE B;  1WNL A;  5GAN d;  1W2B S;  3BDL A;  2MWP A;  2MI6 A;  4GLK A;  1I4K 1;  4M78 F;  4KUD K;  4IUV A;  1O75 A;  3QZ9 B;  4M77 D;  4PNO A;  3L2R A;  3G4S A;  1VQK T;  4M7D C;  5FU7 B;  4A4G A;  2X35 A;  3LWI A;  3S3M A;  3RIR A;  1BI0 A;  3E1S A;  3JCM V;  4BAC A;  3CCV T;  4Z02 A;  4XAX B;  4J7I A;  3QBY A;  2LQ8 A;  3TEE A;  3MP8 A;  4C5G A;  2EQK A;  3OYG A;  3CCS T;  2E65 A;  5J26 A;  2ZPE B;  1FXX A;  1KQS A;  2XDB A;  2DJZ A;  5DLQ E;  3FRN A;  3V8J A;  3FLG A;  3CC4 A;  4Y91 A;  4PJO B;  2DO3 A;  1YBY A;  2RA2 A;  3HRU A;  4TVR A;  3S3N A;  5GAN e;  1YJ9 A;  2CKK A;  2D6F A;  3OYN A;  3PT9 A;  5LJ5 h;  1QP3 A;  4C0G A;  2JN0 A;  2XK0 A;  5AYF A;  1K73 C;  3FEO A;  3MO8 A;  3M56 A;  2QQB A;  4QVZ A;  4B9W A;  4F7U G;  2DIG A;  2QEX T;  1VQ7 T;  2HAX A;  2QDY B;  5L8R E;  1JJ2 A;  1N27 A;  4EMH A;  3OYF A;  3A5Z B;  4FL6 A;  4C0D C;  4C92 G;  2RHU A;  4M77 E;  5GAO p;  3PNW C;  1K73 U;  3ASK A;  1G3S A;  3L42 A;  2HQX A;  3GF5 A;  4WF2 A;  4E7K A;  1VQK A;  2KDS A;  4M7A C;  4E7I A;  2XI9 A;  1QP2 A;  3SB2 A;  3LLR A;  1Q7Y C;  2JOY A;  4N4G A;  2QA4 T;  2VGM A;  3H6Z A;  3P8D A;  3SWN A;  4LDU A;  3KUF A;  1QVF A;  5KE3 A;  2ZPG B;  2RHY A;  2RB6 A;  1ZBX A;  3L2Z A;  5LJ3 d;  2JTF A;  2F69 A;  5FU7 C;  3URG A;  1UGQ B;  2ZGW A;  4J6Y A;  2CZ7 B;  4M78 A;  1V29 B;  3PIO A;  4BY6 B;  4RMO A;  4M77 F;  2MMP A;  3CCU T;  4ZGD B;  3CC2 A;  2CGH A;  5KH6 A;  1Q7Y U;  3QYH B;  3HFN A;  2LX9 A;  2P0K A;  2DPP B;  4M75 G;  2I2L A;  2KVQ G;  3P8B B;  3NTH A;  4N4I A;  3N5B B;  2E41 A;  3JB9 I;  4UC4 A;  2X4J A;  3CCM A;  3KXT A;  2R5M A;  1I81 A;  1VQO A;  3MP6 A;  2CZ6 B;  1XTD A;  4XU2 A;  5GAM d;  2EWN A;  2QI2 A;  4MZT A;  1UGS B;  1KC8 C;  2EAY A;  3L2U A;  3JCM P;  5CKB A;  3UDC A;  3DB3 A;  2FYK A;  3C95 A;  1M5Q 1;  1LOJ A;  3CME A;  4XU1 A;  4E7J A;  3CXC S;  3QSU A;  2YLC A;  3QHS A;  5CK9 A;  4C92 C;  2R58 A;  3VYH B;  4M78 B;  4DOV A;  5J39 A;  3EFR A;  3M53 A;  4A4K A;  3I55 T;  5A0L A;  5C6S A;  4OGC A;  1KC8 U;  2GFU A;  3OYH A;  3CCL T;  2OTJ T;  2MF2 A;  1IZ6 A;  2H3J A;  2YRV A;  5GAN 2;  3L2V A;  3ER0 A;  3CD6 T;  2PU9 B;  4HCC A;  4OGE A;  2EJ9 A;  3L1A A;  4J5Y A;  3OYA A;  5D6X A;  3CCR A;  3DB4 A;  2D9T A;  2RJF A;  4PLI A;  2VUB A;  3ZBD A;  2RHX A;  4O5V A;  1Y96 A;  1HK9 A;  3JCM Q;  1Q81 C;  3V8L A;  3GLX A;  1KD1 C;  4R55 A;  4XK8 E;  4LD6 A;  2PVG B;  3EAE A;  3G6E A;  4M7D D;  4M75 C;  1Y07 A;  3MP1 A;  3LH0 A;  3DKM A;  4M77 A;  2CS7 A;  1UGR B;  4BI3 A;  3JSC A;  4XTY A;  4NL2 A;  5LL6 S;  3BY7 A;  3CMA T;  3M59 A;  4M7D F;  4BE2 A;  4MMK A;  2HBP A;  3PMT A;  3RMQ A;  1Q82 C;  2MAM A;  4C5H A;  4KT0 E;  1YHQ T;  2DKG A;  1OZ3 A;  1PSE A;  4FIB A;  4KUI A;  3TCJ A;  1VQ9 T;  4IKF A;  5FLX E;  1N9S A;  3CPW A;  4C8Q G;  4N4H A;  3SWN C;  1Q86 C;  4IUP A;  5GAN h;  4OP0 A;  3CCL A;  2OTJ A;  4NS5 A;  2EFI A;  3QDR B;  1YJN A;  1M90 C;  1JRI A;  2BIV A;  4J7F A;  4JDS A;  3X25 B;  1VQ5 T;  1G3W A;  3CCE T;  4BD3 A;  1KHI A;  2L8D A;  1Y96 B;  3SFM A;  3JCM f;  4E47 A;  5M9O A;  1RI0 A;  4BDY A;  2KAF A;  4ZTJ A;  1N8R C;  2QQA A;  1TH7 A;  2EIF A;  5HK3 A;  2QQR A;  2V8I A;  2LCL A;  4LDW A;  5CKH A;  1BKB A;  5CQX A;  4M77 B;  1UGP B;  2PQW A;  5KE2 A;  3V7C A;  1N9R A;  1VQP A;  1Q86 U;  4M7D E;  3QPH A;  5GMK m;  5DM7 R;  3FJP A;  5CIU A;  4EMK A;  5LJ3 j;  3LX7 A;  2A7Y A;  1M90 U;  5LJ3 g;  4VUB A;  1H3Z A;  4B9X A;  2XHC A;  4FT2 A;  3HP9 A;  3UPU A;  5CO7 A;  1VQ8 T;  4M7A D;  1YI2 T;  3ZFJ A;  3VUZ A;  1Y71 A;  2WSC E;  4PJO G;  1K9M C;  2B8A A;  3NTK A;  3OY9 A;  4D6W A;  2K57 A;  1P92 A;  2K3Y A;  3OSV A;  3Q1J A;  2K5F A;  3QXE B;  1VQ4 A;  3OYL A;  4HT9 A;  1OZ2 A;  1YHQ A;  2K4Y A;  1QVP A;  2M16 A;  4RG2 A;  3UT1 A;  5C0M A;  3CC7 T;  3CCQ T;  5D6W A;  3QKJ A;  4ELZ C;  4JS4 A;  5GAM j;  3CBO A;  3QJ6 A;  2E5Q A;  2EQJ A;  2NLU A;  4XTW A;  3RKX A;  4ELY C;  4ZGJ B;  2P4T A;  5GAM g;  2XD0 A;  3VYG A;  2MWO A;  5GMK l;  3MHX A;  1K9M U;  4OB1 B;  1WPY A;  5CKF A;  3FIF A;  4J6W A;  1G5V A;  4C5E A;  2XKO C;  2EKO A;  3PFS A;  5DY9 A;  4C8Q C;  1M1G A;  2HD0 A;  3P8H A;  4EMK B;  5GAN f;  1U8R A;  2FVU A;  1FWZ A;  2Y90 A;  5CCA A;  3FDR A;  3OYJ A;  4HCB A;  1NZ9 A;  5FU6 B;  1M4Z A;  2RM4 A;  4M7A E;  3LW5 E;  5IAY A;  2BKD N;  3VUB A;  2DD5 A;  3OB9 A;  3CCV A;  4XU0 A;  3OQ5 A;  1OI1 A;  3MEA A;  1NE8 A;  4BI8 B;  4C0Z A;  5HK0 A;  3CCS A;  1OYX A;  3OA6 A;  1VQ6 T;  2WAC A;  3G71 T;  1VQ8 A;  1O9S A;  3M57 A;  3SDZ A;  4JLI A;  2RD1 A;  1X01 A;  5GAO q;  4C92 D;  3WVD B;  1YI2 A;  4RKU E;  3M4Y A;  4EDU A;  4II1 A;  4MDX A;  3QYG B;  4IUT A;  4EMG A;  2RI2 A;  2AHJ B;  3LGF A;  3JRZ A;  3M54 A;  3M58 A;  2E12 A;  3RKY A;  2VXE A;  2QEX A;  3CCQ A;  4QVC A;  1QVG S;  1VQ7 A;  2DK3 A;  2O4X A;  2DAQ A;  3MET A;  3NFC A;  1VQN T;  4PJO C;  3I56 A;  4M7A F;  2JUF A;  3MCA B;  1M1K C;  2DXU A;  4LDY A;  2V8J A;  3ZEH A;  2PVO B;  3M5A A;  4PL6 A;  2ZPI B;  5FRO A;  5LJ5 f;  3HSB A;  2HNI A;  3DLM A;  4KBM B;  1B34 B;  1JB0 E;  3PGG A;  5LJ3 e;  1MGQ A;  5CAI A;  4J6X A;  1YIT T;  3BW1 A;  2X4W A;  2WSF E;  4F7U E;  1YJW T;  1KG1 A;  4Y28 E;  3LWH A;  4ZN3 A;  1U1S A;  2CZ1 B;  1G3Y A;  5DLO A;  4MZP A;  4QQG A;  5GAO r;  1X6O A;  3HL8 A;  4DOW A;  1BI2 A;  3OS5 A;  2XU8 A;  2GF7 A;  4M75 D;  3PTA A;  2QA4 A;  3OW2 S;  4M7D A;  1M1K U;  3GP8 A;  3CCJ T;  4M78 G;  4C92 E;  4CRI A;  3RKW A;  3L2W A;  4LDX A;  3X28 B;  4EMK C;  5GAN 5;  3CPF A;  4FT4 A;  2LTO A;  3QZ5 B;  5J3B A;  4XTV A;  1SSF A;  2O4X B;  5GAM e;  2CYZ B;  3INZ A;  1VIE A;  2YLB A;  3QG1 A;  2DTH A;  3OYE A;  3NTI A;  2R57 A;  4Q5W A;  1BI1 A;  3CCU A;  3JB9 J;  1WGS A;  2E64 A;  4J8O A;  4JLG A;  2GQV A;  2F5K A;  2LRQ A;  3HRS A;  3V7S A;  4F7U F;  3TU4 K;  3J81 E;  3JB9 G;  1VQM T;  5GAO m;  2E6Z A;  4NOY A;  3H8Z A;  2K5L A;  4XU3 A;  3OS0 A;  2KSS A;  3HHT B;  4BY6 C;  3GPL A;  1ZQ1 A;  4C92 F;  3X26 B;  1FX7 A;  5GMK j;  3HPW A;  2LT1 A;  3E19 A;  1YIJ T;  3CXC A;  4L59 A;  1VQL T;  1EIF A;  4A54 A;  2DEQ A;  4OB3 B;  2FB7 A;  4M7D B;  3OSS C;  4JRK A;  2RI3 A;  4M75 E;  4GY5 A;  1BI3 A;  3VU3 C;  4OB2 B;  3JCM d;  4JJN K;  2LC4 A;  1YIT A;  4V2S A;  2XID A;  4KUL A;  3M4G A;  4MML A;  5KCH A;  3KBG A;  3GIB A;  2D0Q B;  3JCM c;  1ZHI A;  2M0O A;  4MZM A;  3DLL A;  2E1H A;  2L89 A;  4BE0 A;  2ZZD A;  4M7A A;  4A53 A;  3MEU A;  2PUK B;  3F70 A;  3V8K A;  3CCJ A;  3VKI A;  1Q81 U;  3G4S T;  4DA4 A;  1KD1 U;  2RJE A;  5GAO l;  3I55 A;  4LD9 K;  1QW1 A;  4N0A A;  4IUR A;  2DXC A;  3MEW A;  3T9N A;  1I5L A;  3L2Q A;  2K3X A;  3TRE A;  2ZPF B;  3WVE B;  5GMK i;  2C06 A;  2QXF A;  2DXT A;  2WSE E;  3CD6 A;  4LDV A;  2DIQ A;  2VYT A;  4M78 C;  3JCM e;  1Q82 U;  4X9D A;  4DQ2 A;  2K5I A;  4M75 F;  2M9U A;  4RCC A;  4QW2 A;  4HKE A;  1VQM A;  1JBM A;  2LNV A;  4P5N A;  4C0D B;  1KQS S;  2DXB A;  3QJY A;  3QII A;  4M77 G;  5GAN 6;  4RG8 A;  4JRI A;  2EYQ A;  5LJ5 g;  4A4F A;  4L5G A;  2PVD B;  3CEY A;  4C8Q D;  3OS1 A;  1VIF A;  1WQ7 A;  2LVM A;  1WJS A;  5EG2 A;  4ZGE B;  2VV5 A;  3GNF B;  2GCX A;  1PSF A;  4YTL A;  4M7A B;  4MDW A;  3HFO A;  1WJR A;  4O6J A;  4IUU A;  4L6V 5;  5CVI A;  2RH2 A;  1N8R U;  2VGN A;  3CMA A;  4F7U A;  1U1T A;  4PKC C;  1UEB A;  4ZTF A;  1WQW A;  2DTI A;  2P0P A;  1JJ2 S;  2RJD A;  4EPC A;  1BIA A;  1LNX A;  4CI0 C;  4FM4 B;  3OS2 A;  1VQ9 A;  2DZC A;  2EQM A;  2VXF A;  3EFS A;  1MHN A;  4C92 A;  4HA8 A;  1RL2 A;  4QQ6 A;  3S3O A;  2E70 A;  3JCM J;  3I56 T;  4X34 A;  2LT4 A;  2E10 A;  1NJI C;  2X4Y A;  3OYM A;  2RI5 A;  1VQ5 A;  3O8V A;  3GOX A;  3CCE A;  2XG8 D;  2L3R A;  4PJO D;  4BUG A;  3CBP A;  5GMK e;  1S72 T;  1KHC A;  3JB9 F;  1LJO A;  2K2V A;  5HY6 A;  5A2Q E;  4C8Q E;  3J7A F;  1QVF S;  4FSX A;  3C4S A;  2LDM A;  3CC2 T;  1UB4 A;  3M9Q A;  3OYI A;  1B34 A;  5CR2 A;  2ZCF B;  4F7U B;  5CKD A;  5LJ3 h;  4E7H A;  1M1F A;  4XTZ A;  1NJI U;  2RHZ A;  2RK2 A;  4XTX A;  2QQS A;  5LJ5 d;  3OMG A;  2RJC A;  2EJF A;  3CCM T;  3OYD A;  3RMS A;  3A8O B;  4ZN1 A;  1VQO T;  3HKS A;  4M77 C;  4M75 A;  4C92 B;  3A8H B;  1XNI A;  3VV0 A;  1VUB A;  1I8F A;  3ME9 A;  1X75 C;  5I21 A;  1K8A C;  2Y4Y A;  5GAN 8;  4RCB A;  5IT9 E;  3CC7 A;  1KQ1 A;  4ME7 A;  4C8Q F;  3CME T;  2LCC A;  4XQ3 A;  2FHD A;  4C0F A;  5GAM h;  3OYC A;  4JRP A;  2KY9 A;  5A0D A;  2PUO B;  4JS5 A;  4PJO E;  3OYK A;  4N0A C;  3OYB A;  3JB9 H;  5LJ5 e;  2IVW A;  3FC3 A;  2JVV A;  3JCM g;  2RK1 A;  4HT8 A;  2ZPB B;  3JCM X;  2ZPH B;  2YHT A;  4HCZ A;  4IUQ A;  3VJP A;  1K8A U;  5I2M A;  2VC8 A;  4QVD A;  1S72 A;  2CZ0 B;  3SD4 A;  2DTO A;  2QTX A;  3CBM A;  5FRN A;  3A8L B;  2A3L A;  2DZ9 A;  3WXM B;  1W4S A;  2QQ9 A;  3RES A;  2DVE A;  2EJG A;  2O01 E;  4M75 B;  3CCR T;  5GAN 3;  1HXD A;  3X20 B;  2Y4X A;  4OB0 B;  3JAM E;  1BIB A;  4QQD A;  2OTL T;  1VQ6 A;  3JCM W;  3G71 A;  4PJO F;  4BI4 A;  1H64 1;  2KK4 A;  2E6N A;  2JNG A;  3E9F A;  2X4X A;  5FU6 C;  1QVG A;  3PIP A;  4ATO A;  3G7Z A;  3G6E T;  3M55 A;  2FL7 A;  5LJ3 f;  2XDD A;  3A8G B;  3E9G A;  1D3B A;  3OBY A;  1AHJ B;  3SWN B;  5GAN 7;  2JTM A;  2G3R A;  3QO3 A;  4J83 A;  3V7R A;  2XIC A;  5CKE A;  3R6O A;  3JCM b;  5GAO n;  1VQN A;  2XDP A;  3OMC A;  4M78 D;  3UWN A;  5I2S A;  1NPR A;  3FB9 A;  4JRQ A;  3JCM h;  1BYM A;  1R8O B;  4BB7 A;  1W2B A;  1G3T A;  5GAN j;  4PLL A;  5GAN g;  3A8M B;  4M7D G;  2LQK A;  2RHI A;  5GAM f;  2F5T X;  3OW2 A;  3LYI A;  4X9C A;  1YJN T;  2OAU A;  3CPW S;  1YJW A;  2DD4 A;  2L5Q A;  1DJ7 B;  4C8Q A;  4NL3 A;  2R5A A;  3RUX A;  2M1H A;  3GNG A;  4XTU A;  3JB9 D;  4FU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...