4M75A

Crystal structure of lsm1-7 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
139
Chain Sequence
DLYLDQYNFTTTAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 139
sequence length 141
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75A00
4M75G 1WNLA 1LJOA 2E10A 4XTYA 3JCMV 2VXFA 4EMGA 3HSBA 4PJOD 4EMKB 4QVDA 3JCMP 2EAYA 4PNOA 4XTZA 5GANe 3JCMb 3JB9D 5GANf 5LJ5e 3V8LA 1JBMA 4M75F 2E65A 2YHTA 3QSUA 2FB7A 1WQ7A 1Y96B 4A53A 3JCMd 3RKWA 4M78B 5GAN6 2DVEA 3SWNB 3QO3A 4RCCA 1N9SA 2E1HA 4XU1A 2CGHA 4M77D 4HT9A 1WQWA 4MMLA 2K57A 4J6YA 4JUVA 4XTVA 4XU0A 5GAN8 3RERA 4M7DD 3V7CA 3JB9H 4M77B 4XQ3A 4M7AB 4J5YA 2VC8A 3FJPA 4EMHA 3JCMh 4C92D 4M75C 3FB9A 3V8KA 1KQ1A 3V7SA 1B34A 3JCMW 5GANd 2DEQA 5GAMg 1LOJA 2E41A 2E64A 4M78G 4C92B 5LJ5g 5LJ5d 2DTIA 4JRIA 5LJ3g 5GMKe 4MMKA 4V2SA 4PJOB 4M75E 2RD1A 1D3BB 3QHSA 4XTWA 3RESA 5GAMe 4XTUA 1KQ2A 4C8QC 1HXDA 4M75A 3V7RA 5GAMf 5GAN3 1I8FA 4M78F 5GANh 2JN0A 5LJ5f 4XU2A 3BFMA 3HFNA 2DZCA 4J6XA 5LJ3e 3BY7A 3EFRA 4C8QG 5LJ3f 4X9CA 3RKYA 4EMKC 1JRIA 2YLBA 2DXUA 2I2LA 4PJOA 4C8QE 5GANj 1M5Q1 5DY9A 2RB6A 5GAOm 4C8QA 4PJOG 2DTOA 2QTXA 3SB2A 4C8QF 4QVCA 4M7DB 5GAN5 4M78C 4Y91A 1TH7A 4X9DA 3HFOA 3SWNC 4F7UB 3GIBA 2EJGA 3FIFA 3VU3C 5GAMd 4EMKA 2VXEA 2Y90A 3JB9G 2DTHA 3EFSA 5GAN7 4M75D 5LJ3d 4PJOF 3JB9I 2RM4A 4M77C 4M7AC 5GMKj 1U1TA 4DQ2A 4M78E 3L1AA 5GMKh 1Y96A 4M77G 1I5LA 4M78A 4M7AG 3PGGA 3SWNA 5I21A 4M7DG 3V8JA 4XTXA 5GMKl 4NOYA 5LJ5j 5GAMh 5GMKi 3JCMJ 4C92C 5LJ5h 5GAN2 4F7UG 4N0AC 4WF2A 4M77E 5LJ3h 4M7AE 1I4K1 4J6WA 4C92G 4M77A 4M7AA 3RUXA 4M77F 4PJOC 1LNXA 2EJFA 2DJZA 4M7AF 1X01A 4M7DF 3QUIA 4F7UA 5GAOn 4C92E 4F7UF 2YLCA 2DZ9A 4C92A 1B34B 4N0AA 4C92F 2EWNA 1MGQA 4RCBA 1BIBA 4PJOE 2EJ9A 3JB9F 3M4GA 1H641 4OP0A 2DXTA 4HA8A 4M78D 2HNIA 3BW1A 1D3BA 5GAN4 3JB9J 1HK9A 2FYKA 4XU3A 4JLIA 1N9RA 3INZA 1WPYA 2DKGA 4M7DC 3JCMg 3JCMQ 4M75B 5GMKm 5GAMj 4JRKA 5GAOr 5GAOp 4M7AD 3RIRA 5CAIA 2RA2A 5LJ3j 3BDUA 1M8VA 3RKXA 5GAOq 3L2ZA 4C8QD 4NL3A 2ZGWA 3JCMe 3AHUA 1YCYA 3JCMc 3JCMf 4NL2A 3JCMX 1I81A 5GAOl 4M7DE 1BIAA 4M7DA 4F7UE 4HT8A 4C8QB 5GANg 1U1SA 4A54A
chains in the Genus database with same CATH superfamily
1GFDA 1S72T 4C5IA 1WHLA 1VQ7Q 4HCZA 1WI7A 2FPFA 2KRNA 3EFOA 2EFIA 2E65A 2RI2A 2QGFB 2XU8A 3P8HA 1WHHA 3EHQA 5CKDA 4MMLA 2DIGA 1GXIE 2RJDA 1KC8C 2XG8D 4JPBW 3FB9A 2QAZA 1Q82C 4M78G 2VWFA 4IUQA 1GRIA 2L3PA 3L2WA 2E3HA 1NM7A 1LPLA 4LDWA 2QA4Q 1K8AU 2HMAA 4EMKC 2YLBA 3H0IA 2BZYA 1YJ9T 1OEBA 3QKJA 5LL6S 3ULRB 3VRZA 3LLRA 1KK7A 3LH5A 2WACA 3FRNA 1KD1R 2PUOB 1NBEB 3PGGA 3SWNA 2ROTA 3JCMJ 2JM9A 1PNJA 5IH2A 2HKQB 4QKUA 1RAHB 1VQPA 3TU4K 2DETA 1SSHA 1Q81R 4BD3A 1NZ9A 1BIBA 3MEAA 1H641 4FYXB 4M78D 3BW1A 4XU3A 1YP5A 2R5MA 1C6VX 1VQ4A 2ZPEB 4OMQA 1TOVA 1N27A 1Y0MA 3A8OB 1VQ5A 2RN8A 4NL3A 1BB9A 1F1BB 2ECZA 3M0TA 1FXXA 2OTLT 1SHFA 4J9HA 4ORZA 1K9MC 4E7HA 1LJOA 2M02A 1QVFS 1EIFA 2KVQG 3M4YA 1YJNT 2CT3A 1VQNT 1ZLMA 2DD4A 2PUKB 2D8JA 4ZN3A 1VYVA 2CH4A 2LP5A 4ZTJA 3F70A 1IO6A 2KT1A 2YHTA 1PKSA 5GAN6 1PCXA 3CQTA 4A4EA 3RBBB 4E47A 1TSFA 2RQWA 2AKLA 3QWXX 2RK2A 3MEUA 2DA9A 5D6XA 5LJ5d 1TU0B 1AHJB 3CMEA 4J8OA 4XTWA 1KHCA 5CIUA 5DLOA 3TSWA 1G83A 4ZNXA 4C0ZA 5GAMf 2A0FB 3SEMA 3BY7A 1QKXA 3FJ5A 2NYSA 4KT0E 3OBWA 4E7IA 1M1KU 2QA4A 6AT1B 3QXEB 2CZ0B 2QEXQ 5FWCA 3QBYA 2RJCA 3PTAA 3VU3C 3VS6A 2LJ3A 1YJWQ 1MNEA 2MAMA 2LQNA 3CCVQ 3J80E 3L1AA 3C94A 1V1CA 3GLXA 3CCUA 2ROLA 1M90R 2MF2A 4J7IA 2DX1A 1KD1C 2DYBA 3EG2A 3JRZA 2M16A 1UGPB 4LDUA 1ZSGA 3TCJA 1YIJA 2RQRA 3MEVA 1JB0E 3URGA 2HNIA 1YNZA 1WPYA 2DKGA 3JCMg 2VB6A 3OW2S 1BCOA 1SRMA 5CR2A 2HQXA 3QJ6A 1Q81C 1J3TA 3BDUA 1M8VA 1B07A 1RLPC 2XDPA 3PVLA 4A4HA 3CCRQ 2QASA 2DF6A 4M4ZA 3VRYA 4ZGJB 3OYDA 4A4GA 4XTYA 3HSBA 1MMGA 1X6GA 4PFOA 1K73U 5GANe 3HHTB 4J83A 2OTJA 1WQ7A 4M78B 2DVEA 4J9DA 2K57A 5CK9A 3U23A 4XQ3A 4JRPA 4OMLA 4ME7A 4HCCA 3ME9A 4FCYA 4R55A 1VQ4T 5CKHA 2YSQA 3CD6T 3VJPA 4C92B 2JUFA 2P4RA 1VQ5T 2LNVA 3CMAA 1PD1A 4PKCC 1R0BG 2RQTA 4V2SA 3L2RA 3WXMB 1ABQA 1I8FA 1M2VB 5LJ5f 3OYEA 2DZCA 3M54A 3EFRA 4OB2B 3OSVA 3UA7A 2X3WD 3OYIA 4OMOA 3OYYA 5KH6A 3CC2Q 4E7JA 1M5Q1 2DXCA 2YUQA 3RR6A 2HSEB 2NUPB 3REBB 3HFOA 1IREB 3OMCA 2F1LA 3I55Q 5A0GA 3OYKA 2QEXA 5GMKh 3VS0A 2XK0A 4BY6B 2L8DA 5LJ5j 1QMCA 1TTHB 2YUOA 1RABB 1OZ3A 1AZGB 4FL6A 3CMET 1D09B 5GAOn 1BK2A 5J39A 3X26B 1ZBJA 2LTOA 1B34B 4EIKA 1SKUB 1RL2A 1S72Q 5L8RE 4HKEA 4QW2A 2CDTA 2EGEA 3MP6A 3CPWS 5J3BA 4FIBA 3JCMQ 2LC4A 3O8VA 4PLIA 2I0NA 2LCCA 2ZGWA 1W70A 2C0OA 2LT4A 3VKIA 1BYMA 3M57A 3CC4A 1K0XA 4JLGA 3UPUA 3CCUT 3NGPA 4BE2A 3EH2A 4L5GA 3ZFJA 2OAUA 5KYNA 1DJ7B 2K4YA 4F16A 2NWMA 2QTVA 1OULA 3RKWA 3EG9B 3QO3A 2QK0A 1YIJT 3M0QA 4J6YA 5GAN8 3RERA 1OPLA 4KH1B 4BE1A 1YJ9Q 1ZA2B 1U3OA 1VQOT 3JCMW 3QYGB 3NMZC 1PM3A 3CXCP 4DBFA 2DL7A 5KYUB 1UGQB 3M0PA 1QQJA 4C5HA 5LJ3f 4OGEA 2EPDA 4J7FA 2COYA 4F04B 1X27A 3VS1A 5D6YA 2A3LA 2GFUA 2OTJT 3M9QA 4QQGA 3SWNC 2YDLA 3OQ5A 2DTHA 1U8RA 2EYYA 1YI2A 1SEMA 2O4XB 4DBHA 2YT6A 4M78A 2JS2A 4NOYA 1Y7XA 3J81E 2HCKA 1H92A 4B6MA 1KFZA 2EVRA 3CMAT 2D0QB 1PRMC 2BZ8A 4C92A 2CZ6B 4C92F 4DA4A 4VUBA 2OTLQ 4RCBA 1WLPB 2EJ9A 1XQHA 2CZ1B 2FPEA 3M58A 4LD6A 2MOXA 1YJNQ 1AOJA 1OV3A 1RUWA 2GBQA 2B8AA 3EFOB 1FWZA 1VQNQ 1M2VA 2KXDA 1GCQA 3RIRA 2D6FA 1OU9A 2R5AA 3M0RA 1AWXA 5GJWB 4J9FA 3OYMA 2R58A 4FU6A 2NUPA 2L2PA 4EMGA 1W4SA 1FX7A 4E7SA 2EAYA 4XTZA 4IUPA 2CT4A 3UF4A 3V8LA 4HXJA 2F2VA 1P92A 1YHQA 1FMVA 1U06A 4XU0A 2CP3A 2EGAA 2LZ6B 4XK8E 1B34A 3HL8A 2LNHB 3CCQA 1T0HA 2AKKA 3M53A 3A5ZB 2KGTA 2DRKA 1ZUYA 4BE0A 5IT9E 1N8RU 2HAXA 3CC4T 4AG2C 3GNGA 4LUDA 2W0ZA 2FO0A 1IZ6A 1R77A 1V29B 3E9GA 1C1AA 2QDYB 4OMPA 5DY9A 5KYWB 3SB2A 2X35A 3H9NA 3OW2A 1ZUUA 2XD0A 2VXEA 2DL3A 1KHIA 3SDZA 2EIFA 1VQMA 2W10A 2RHYA 2JS0A 1R8OB 4M78E 4LNPA 1I5LA 3X24B 3EG3A 4RTVA 3EG9A 2MPXC 4KRTA 1KQSS 3JB9F 5GMKi 1X75C 4WF2A 4PJMA 3QZ5B 1K76A 4MZTA 4M7DF 4IKFA 2CS7A 4C92E 3GNFB 2DRMA 5AT1B 2F2WA 2X4XA 4HCBA 2RJFA 1UDLA 2RQVA 5GAN4 1WFWA 5KYUA 3ASKA 2M0YA 4HVVA 1VQPQ 1Q82U 3QYHB 5GAOr 3KBGA 4UC4A 1IRXA 1SF9A 1YI2T 3JCMe 2RO0A 2O88A 2D0NA 1X2KA 1N8RC 2BKDN 4HCKA 4A54A 2EBPA 1WNLA 1VQ4Q 3E19A 3VYHB 3CD6Q 2O4XA 2KQWA 1ARKA 4DOVA 3P8BB 1ZA1B 1VQ5Q 5HY6A 4M75F 4A53A 3A8HB 3TQ7P 3FC3A 5A0LA 2X51A 4M77B 3S3NA 2RPNA 2JZ2A 1H3HA 1OPKA 1V76A 5CKFA 2DERA 4JJBA 3PMIA 1QVFP 1PG5B 2M0OA 5FRNA 1X43A 4E7LA 3HFNA 4RTXA 3R6OA 1Q7YR 2EQMA 1XTDA 5IHNA 5CKEA 4C0GA 2DXUA 1X6OA 3OB9A 4OB1B 3RMSA 3CPWA 2ED0A 3CMEQ 1UJ0A 2CUDA 4JS4A 1YHQT 3A8GB 5GAMd 1VIEA 1YBYA 3CBPA 2ED1A 2RHZA 1K9MU 5GAMh 2JXBA 2E4HA 3VYGA 3CCQT 1LVKA 4C92G 4Y28E 2GTOA 3QUIA 4Y92A 4Z89A 4FYYB 2KXCA 3QZ9B 3CCUQ 1WGSA 2RI5A 2WSCE 3OYCA 1M2OA 1QCNA 1IGQA 5IHKA 2YUNA 4FYVB 4IUUA 2ATCB 2X4YA 2BTTA 2KYBA 2EW3A 3M0SA 4JJDA 5DLQE 1UUEA 1VQMT 3AHUA 4KUDK 5KYWA 5GAOl 3G71A 1YIJQ 4NL2A 1WXUA 2DBMA 1Q95G 3H6ZA 1NJIR 1VQOQ 3GP8A 2BUDA 4OB0B 3CCST 1MV3A 3UATA 1AWOA 4CC7A 2DEUA 2V1RA 3UA6A 5GANf 4R0KA 3QSUA 3S6WA 3LX7A 4EDUA 3OW2P 1VQKT 1N9SA 1UGRB 3CD6A 1UTIA 2QQAA 5I11A 4A63B 3OS1A 1WA7A 1NG2A 2VC8A 4EMHA 4C92D 4BDYA 2YUPA 1KQ1A 2OTJQ 4DOWA 1KD1U 2DVJA 2ESWA 4O5VA 2XKOC 5GANj 2B86A 3N5BB 5FU7B 2LCLA 4FT4A 2VYTA 3C95A 2HQHA 3CMAQ 2V8JA 4M78C 2BE7D 4X9DA 3X28B 1Q7YC 2EJGA 3MEWA 4FM4B 3A8LB 1Q81U 1OZ2A 3JB9G 2HEQA 2FL7A 4PJOF 2KYMA 4BI8B 2KT8A 4M7DG 4XTXA 3G6ET 1QWEA 4C92C 5LJ5h 4M77A 4M77F 2G3RA 2VVKA 2FHDA 1ZSZB 2ABLA 1EX4A 2LVMA 3UWNA 1GCQC 2K3BA 4JDSA 2RHXA 4MZPA 3O5ZA 1VQ8T 3T9NA 3DB3A 4J9IA 4N4IA 4E6RA 2H3JA 5GAMj 2OAWA 3REAB 4M7AD 3CXCA 2HBWA 4C5EA 1XNIA 3HP9A 1UECA 4BY6C 5FROA 1E7OA 4M75G 3NHNA 2MMPA 2GTJA 1FMKA 4DBRA 5KE2A 1TXQA 3JB9D 2JTEA 2JW4A 3L2UA 1T3LA 3CPWP 4FYWB 1VQOA 2CZ7B 2HL5C 3CC4Q 2KROA 1NJIC 2MI6A 4QT7A 4PJNA 3PIOA 4M7DD 1TWBA 1C0MA 3CCJA 2SEMA 4HVUA 4P5NA 2CP5A 2DILA 5FWBA 1OX8A 3S3MA 3QDRB 3MPUB 2EYZA 2NLUA 3G71T 1Y71A 2DL5A 1JJ2S 3BFMA 1BI3A 1M90U 2AT1B 1VQ9A 2O01E 3E2UA 4KGVB 4JJCA 2FZCB 1JXMA 5GAN5 2DYIA 2A7YA 4M75D 5LJ3d 1WJRA 3J7AF 3I56A 5I2SA 1KJWA 5GMKl 2E6ZA 3H8ZA 4M77E 5LJ3h 2PTKA 1MNDA 2ENMA 2V8KA 4RG2A 2COWA 2RK1A 1YI2Q 2V26A 4AG1C 2JJ9A 2GQVA 2KK4A 4OMFB 1AT1B 2JMCA 2DXTA 2D8HA 3PIPA 1UHCA 2FYKA 4D6WA 3Q1JA 5GAOp 5IAYA 1OX9A 2RA2A 2V8IA 1BI1A 3RKXA 1AVZC 1WJSA 4C0DB 2YRCA 1RADB 3JCMc 1I81A 4HT8A 4C8QB 2F5KA 1NPRA 2DJQA 1U1SA 5L23A 4FW1A 1O9SA 4RMOA 1M90C 1UFFA 4PNOA 2OJ2A 5FU6B 2LT1A 1D1BA 3QWYA 4IURA 2PVOB 5KYXB 2VGMA 3X25B 2EQJA 1WQWA 4XTVA 2BE9B 4M7AB 1H3ZA 1G3SA 1ZSZA 1RI9A 2CUBA 3V8KA 1IGUA 2DEQA 4PL6A 2DTIA 1YHQQ 4D8KA 1TS9A 4CC2A 4X1VA 2KRMA 4XTUA 2EQKA 1IHVA 2SRCA 2JN0A 4MZMA 1YWPA 3HRTA 4X9CA 5EG2A 1WHKA 3CC7T 2RHUA 4CRIA 3CCQQ 2EYXA 1VQLA 4PJOG 4LD9K 4M7DB 3QJYA 3OYGA 2MK5A 2PZ1A 2EKHA 1ZQ1A 1E6GA 3SD4A 1VQ6A 3CCJT 5AYFA 2K5LA 2AZSA 1UGVA 4M77G 2K2MA 3WVEB 3V8JA 2DFUA 1Q86R 3LWIA 1JQQA 2IVWA 1WXBA 2GFAA 2G6FX 2DL8A 2GF7A 5A2QE 1SG5A 1QW1A 2NUZA 3RUXA 2LJ0A 4RTYA 2DBKA 1H8KA 2FRWA 2VGNA 1VQMQ 2PNIA 1WYXA 7AT1B 4N4GA 1VQ9T 3M4GA 3QPHA 2JT4A 3CCSQ 1HD3A 2QQSA 4F14A 4M75B 2EYWA 2YXYA 4Z88A 4E7KA 4OMNA 4RTUA 5GMKm 4F17A 4JRKA 1KQSP 3MHXA 4Z02A 1RAIB 1VQKQ 5LJ3j 1RAAB 2XHCA 1NYFA 3EAEA 3L2ZA 1QVFA 2CREA 3JCMf 1I07A 2KY9A 4WTOB 2JNGA 4AFQC 3I56T 1JO8A 4KH0B 2K3YA 4PJOD 4LDVA 1UJYA 2QYZA 3OYBA 2LQ8A 2OI3A 2LCSA 3I9QA 2MWOA 1IB8A 3E9FA 4JRQA 5LJ5e 2ZPIB 5D6WA 1TUCA 2EQUA 1IHWA 2CGHA 4M77D 4JS5A 1X6BA 1M3BA 4ZGDB 4KBMB 5IXFA 1GCPA 1U5SA 3FJPA 3JAME 4ZTFA 1M30A 5CQXA 1YWOA 5HK3A 3H0HA 2OX7A 1ZBXA 4MMKA 5HKCA 4O6JA 2IG0A 3QHSA 1FYNA 3RESA 3DB4A 1HXDA 3ER0A 1GBRA 4C5GA 3G6EQ 2I2LA 2L89A 2E6NA 2RB6A 3CCEA 4C8QA 2KR3A 2KDSA 4C8QF 3CPFA 3H0FA 2LX9A 5IXBA 1WX6A 4JJNK 3DLLA 4M77C 1CSKA 4C0FA 5D7UA 4RTZA 1VQ8Q 5KYXA 1SHGA 4OGCA 4GLKA 2MCNA 4M7AA 2QG9B 4M7AF 3HRSA 3JSCA 4F7UA 1W2BS 4TVRA 4F7UF 3E1SA 4OB3B 1Q86C 3IQLA 1QCOA 3OYNA 2K3XA 3G4SA 1BBZA 3OYHA 4HA8A 4BI4A 1VQLT 2DO3A 2DAQA 3EGXB 2RNAA 3VS5A 1G8XA 2MWPA 4RUGA 3CCMA 1M9SA 2NUTB 4ELYC 3CCSA 1VQ6T 2IPOB 2MIOA 4BB7A 4AFUC 4M7DA 2XMFA 1YITA 3KFVA 3ZEHA 2JM8A 3CCLA 1VQKA 2VXFA 2JTFA 2KRSA 2JOYA 3MP1A 1PSFA 3NTIA 3BDLA 2VASA 4NS5A 3G71Q 1Y96B 2AHJB 2PQWA 4J9CA 2E1HA 4JZ4A 3CBOA 4J5YA 2K2VA 2LRQA 2DLPA 5GANd 3OYJA 5GAMg 1LOJA 2QQ9A 2XIDA 1HSQA 5GMKe 2PVGB 2J6KA 4LN2A 2M1HA 4PJOB 1EFNA 1MMAA 3MO8A 2P0QA 4M75A 3G1JA 3GPLA 4Z8AA 5GANh 1VA7A 4GLMA 2L0AA 2DIQA 2K9GA 4J6XA 4E2FB 2M51A 5GJVB 1Y57A 4AFZC 4C8QE 3L2VA 4PK4A 8AT1B 1TH7A 2BZXA 3G6EA 4PLLA 2ZPFB 3HPWA 2J6FA 5C6SA 1G3TA 3JB9I 1HJDA 1I1JA 2J06A 1BU1A 3WVDB 1K8AR 3MKDA 2VKNA 4AMCA 1QVGS 1T0JA 3RDVA 4M7AE 2FEIA 4J6WA 1VQ8A 2J7IA 1G5VA 4RTWA 1OI1A 5FU7C 1MGQA 5I2MA 4KGXB 5A0DA 1ZX6A 1HK9A 1N9RA 3CCET 2D1XA 1NE8A 4AT1B 1PSEA 2BIVA 2CH4W 1I5OB 4IUVA 2CP2A 2LDMA 5CO7A 4M7DE 4QQDA 2HL3A 3JCMX 3LW5E 3NTKA 1VYUA 1KSWA 4A4KA 5KYYA 1WHMA 2O9VA 4BDZA 2RI3A 3JCMV 1KG1A 1QVPA 3JCMP 1ACMB 1ZSZC 3PMTA 4OVAA 5CQYA 1EZZB 4X34A 4RCCA 4XU1A 1SSFA 1Q7YU 1BCMA 2LMJA 2ZAEA 4QQ6A 3G4ST 3JB9H 2EYQA 1MUZA 4CC4B 3CC7Q 3S3OA 1O75A 1JU5C 2YWWA 1W6XA 2LQKA 1ZUKA 1UEBA 5LJ5g 1UE9A 3X20B 3CCMT 4JRIA 4IIOA 3SHWA 1WHGA 4M75E 3EGXA 3V7RA 3VV0A 3CCJQ 1YITT 4XU2A 3CCLT 5FW9A 4C8QG 2NUTA 1OYXA 2DNUA 1B7TA 2K79A 3HKSA 3EG1A 1QP2A 2ZPGB 1VOMA 4ATOA 3ZBDA 1Y07A 1VYTA 2QTXA 1M8MA 4ELZC 5I22A 3GIBA 1VQ9Q 2E3IA 2KAFA 2CKKA 1Y96A 4M7AG 5J26A 2A36A 3TVTA 3LGFA 1JJ2P 3A98A 4F7UG 3PVQA 3PNWC 2FPDA 1M1KR 3BE3A 3QIIA 5C0MA 1X01A 1K8AC 4R56A 2J05A 1D1AA 2DK3A 4K11A 4QVZA 3FEOA 1NJIU 3I56Q 4PJOA 3JB9J 3I35A 3M56A 4AFSC 3NPFA 1VQ7A 2VV5A 4OF1A 4ANJA 4EPCA 3OYAA 3VS7A 1D0ZA 2COZA 2O31A 4C8QD 3LWHA 3M5AA 2E5QA 1QCFA 1S1NA 1M1GA 1BIAA 2KI7A 1GL5A 1RI0A 4GY5A 2GGRA 2Z0WA 3NFCA 4EMKB 4CC3A 1NPPA 2DXBA 5DM7R 4FSXA 3MJXA 2CSIA 2F5TX 1JBMA 2P0KA 1AWWA 1D0XA 2C0TA 2P0PA 4KUIA 3LGLA 4MDXA 3L42A 2QDLA 4J9EA 3VUZA 1G3YA 1M4ZA 2H8HA 3V7SA 5M9OA 1JXOA 3EH1A 5LJ3g 4C0DC 1K4US 2X4JA 1M27C 3AT1B 2A28A 3CC7A 4KGZB 1K73R 1IXDA 2RQUA 4C8QC 1YFNA 2V1QA 5IHIA 1W2BA 2KBTA 2JVVA 1PD0A 2QI2A 2X3XD 5FU6C 4LE9A 5GAOm 5HK0A 2XICA 1KQSA 2AZVA 3EFSA 2F2XA 3TREA 3OYLA 4M7AC 1PHTA 3L2QA 1RAFB 1FMWA 3C4SA 5KE3A 3ZL7C 1VQLQ 4LDXA 1G2BA 1OOTA 1CKAA 5GAN2 1MMNA 3OY9A 1I4K1 4LXCA 1LNXA 1VQ6Q 1AD5A 3A8MB 2YLCA 8ATCB 1X69A 4N0AA 4PJOE 3OS0A 4OP0A 3FDRA 3M59A 1M1KC 1VQPT 1MMDA 2F69A 3VS2A 4M7DC 3HTRA 3QG1A 4JZ3A 4XAXB 4LDYA 4BACA 4RKUE 1WZOA 5HCKA 2CP6A 3VS3A 2JMAA 2H3EB 4DBQA 1MHNA 1TUGB 4FW2A 4B9XA 3FLGA 3D7SB 3JCMd 2IIMA 2YRDA 3RNJA 3EGUA 2AIRB 2HD0A 5FLXE 1XOVA 2CP7A 1MV0B 2RHIA 3JCMh 1VQ7T 4PFZA 4M75C 3MP8A 1WDXA 3JV3A 4YTLA 1QVGA 2E41A 2FRYA 2VUBA 3OS5A 4DEYA 3C12A 2XDBA 1QWFA 2Y4XA 1D3BB 2K7AA 5GAMe 4HT9A 2X4WA 4A4FA 3OS2A 1YJWA 2LX7A 1UG1A 1M3CA 3OYFA 3RKYA 1PC0A 3R6NA 3CCVA 1GFCA 1K73C 2K6DA 1QLYA 5ECAA 4QVCA 2DMOA 4F7UB 2EGCA 3THKA 3FIFA 2ZCFB 1OQKA 4EMKA 2Y90A 2QXFA 5GAN7 3CBMA 2QA4T 4DEXA 4DQ2A 2DD5A 4WCIA 5I21A 3CCEQ 1PRLC 4IUTA 2CSQA 2Y4YA 2KNBB 3OBYA 2DJZA 3PE0A 2KEAA 1RAEB 3OMGA 2EWNA 2WSEE 3CCRA 2O2OA 2E5KA 4L59A 2YRVA 2J6OA 4JLIA 4FT2A 2PU9B 1ABOA 4RTTA 1VUBA 1NEBA 2AK5A 2P4TA 1T3SA 5EC7A 1K9AA 3G4SQ 2P84A 3EGDB 1W2BP 1TUDA 3HRUA 2MYSA 4MDWA 4QVDA 1D1CA 4OMMA 2EQIA 3CCMQ 1M3AA 5CCAA 2C0IA 4L6V5 4RG8A 2L3RA 2L3SA 5CKBA 3EHRA 3DLMA 1YITQ 2DL4A 3CCLQ 2RF0A 4JUVA 1NLPC 2KMTA 1G3WA 3EG0A 1WIEA 1SRLA 3KUFA 3META 2R57A 4J9BA 2HQEA 3CC2A 1WXTA 4LUEA 3SFMA 2KSSA 1PKTA 1AEYA 1KIKA 5CVIA 3GBQA 4N4HA 1LCKA 4M78F 2C06A 5KCOA 1Q86U 3I55A 4ZGEB 2M9UA 3A1PA 4CI0C 4PJLA 2RMOA 5FRMA 1GBQA 1N5ZA 1K0SA 4PJJA 3TSZA 4Q5WA 3VUBA 3GOXA 2QQRA 2A37A 2ZPBB 2L3QA 2RM4A 1N8RR 2K5IA 3I5SA 1U1TA 5GMKj 2K5FA 3PFSA 2RJEA 1YCSB 1M1FA 1S72A 3OSSC 1RAGB 1WJQA 2WSFE 3I5RA 2QEXT 4PJOC 3LH0A 1SPKA 1D0YA 4ESRA 2GQIA 2DM1A 4II1A 3CEYA 3QDFA 2DZ9A 1ZHIA 1YJWT 1BI0A 5KYYB 3NTHA 4J9GA 3CCVT 1XJWB 2RH2A 1D3BA 1RACB 1E6HA 3INZA 1HYOA 2DPPB 1QVGP 1CKBA 2E70A 5KCHA 1JEGA 1X2QA 2FZKB 3UDCA 3MCAB 1NYGA 2A08A 4BI3A 5GANg 4IIMA 2E12A 2HSPA 2QQBA 3CXCS 2CYZB 2E10A 1OU8A 1YN8A 2KE9A 3M0UA 1YJ9A 2DE0X 2JTMA 3JCMb 2D9TA 2FG0A 1KC8R 2FB7A 1VIFA 2FZGB 2GNCA 1Q82R 2EKOA 3SWNB 1UHFA 3CCRT 3V7CA 1NEGA 1AZEA 3H41A 3OA6A 2HDAA 1Z9QA 3GF5A 4FSSA 2X9HA 3DKMA 3TEEA 2E64A 4B9WA 1JJ2A 5IN1A 4E7ZA 1KQ2A 2RD1A 5GAN3 1AWJA 5LJ3e 1QKWA 3C0CA 2HBPA 2FVUA 2GCXA 3KXTA 1Z9ZA 1B3QA 1JRIA 1NLOC 3EGDA 2DTOA 4PFPA 4Y91A 1PWTA 2PVDB 4BUGA 1N6AA 1I0CA 4ZN1A 2XI9A 1K1ZA 1KC8U 2OTLA 2HZYA 3M55A 4N0AC 1YJNA 3CC2T 4D8DA 1BI2A 2XDDA 3VS4A 2ZZDA 1TG0A 1VQNA 2EJFA 4GBQA 4KULA 2HKNA 1A0NB 2QGGA 1WHJA 3P8DA 3I55T 1UGSB 2LJ1A 1W1FA 2LQWA 2ZPHB 9ATCB 2O9SA 1RLQC 3UT1A 4HVWA 1K9MR 3RMQA 1UB4A 1BKBA 5CAIA 3LYIA 2CP0A 2L5QA 5GAOq 1YCYA 1QP3A 4F7UE 1R0CB 3PT9A 3G7ZA
chains in the Genus database with same CATH topology
1S72T 4C5IA 1O9SA 4EMGA 4RMOA 3NFCA 1W4SA 1M90C 1FX7A 4HCZA 4EMKB 1NPPA 2DXBA 2EAYA 4PNOA 4IUPA 4XTZA 5DM7R 4FSXA 5FU6B 2LT1A 2F5TX 3V8LA 1JBMA 2EFIA 4IURA 2E65A 2RI2A 2XU8A 3P8HA 2P0KA 1P92A 2PVOB 2VGMA 1YHQA 5CKDA 3X25B 2EQJA 2P0PA 1WQWA 4KUIA 4MMLA 4XU0A 4XTVA 2DIGA 3LGLA 4MDXA 3L42A 1GXIE 4M7AB 3VUZA 2RJDA 1G3YA 1G3SA 1H3ZA 1KC8C 1M4ZA 4XK8E 2XG8D 3FB9A 3V8KA 1Q82C 3V7SA 1B34A 2DEQA 5M9OA 4PL6A 3HL8A 4M78G 4IUQA 3CCQA 2DTIA 5LJ3g 3L2WA 3M53A 4C0DC 3A5ZB 2X4JA 3CC7A 4BE0A 5IT9E 1N8RU 4LDWA 4XTUA 2HAXA 2EQKA 4C8QC 1K8AU 3CC4T 2JN0A 4MZMA 1W2BA 3HRTA 4X9CA 3GNGA 2JVVA 5EG2A 4EMKC 2YLBA 3CC7T 1IZ6A 2RHUA 2QI2A 1V29B 4CRIA 1YJ9T 3E9GA 2QDYB 5FU6C 5DY9A 3QKJA 5GAOm 1VQLA 4PJOG 3SB2A 5LL6S 5HK0A 2X35A 4LD9K 4M7DB 3QJYA 3OYGA 3OW2A 3LLRA 2XD0A 2XICA 1ZQ1A 2VXEA 1KQSA 1KHIA 2WACA 2EIFA 3EFSA 3FRNA 3SDZA 3SD4A 2PUOB 3TREA 1VQMA 1VQ6A 3OYLA 3CCJT 4M7AC 2RHYA 4M78E 1R8OB 2K5LA 5AYFA 4M77G 3L2QA 3X24B 1I5LA 3PGGA 3WVEB 3SWNA 3C4SA 5KE3A 3V8JA 1KQSS 3JB9F 4LDXA 3JCMJ 5GMKi 3LWIA 4HCCA 2IVWA 5GAN2 2GFAA 1X75C 4WF2A 3OY9A 2GF7A 5A2QE 1I4K1 3QZ5B 1QW1A 3RUXA 1LNXA 1VQPA 4MZTA 2VGNA 4M7DF 4IKFA 2CS7A 3TU4K 4C92E 3A8MB 2YLCA 3GNFB 4N0AA 4N4GA 1VQ9T 4BD3A 2X4XA 1NZ9A 1BIBA 4PJOE 3MEAA 3OS0A 3M4GA 1H641 4OP0A 3FDRA 2RJFA 3M59A 1M1KC 4M78D 3BW1A 1VQPT 3QPHA 5GAN4 4XU3A 2F69A 2R5MA 3ASKA 4M7DC 1VQ4A 2QQSA 3QG1A 2ZPEB 4M75B 4XAXB 4E7KA 1Q82U 5GMKm 3QYHB 4JRKA 3KBGA 4LDYA 5GAOr 1N27A 3MHXA 4Z02A 4BACA 4RKUE 3A8OB 4UC4A 5LJ3j 2XHCA 1VQ5A 3EAEA 3L2ZA 4NL3A 1YI2T 3JCMe 1QVFA 2RO0A 3JCMf 1N8RC 2KY9A 2BKDN 1FXXA 2JNGA 3I56T 4A54A 2OTLT 1K9MC 1MHNA 1WNLA 4E7HA 1LJOA 2K3YA 1QVFS 4PJOD 1EIFA 2KVQG 4LDVA 3E19A 3M4YA 3OYBA 1YJNT 2LQ8A 3VYHB 2O4XA 2KQWA 1VQNT 2DD4A 2PUKB 2MWOA 4DOVA 3E9FA 3P8BB 4B9XA 4ZN3A 4JRQA 4ZTJA 3FLGA 3F70A 5LJ5e 5HY6A 4M75F 2YHTA 2ZPIB 5D6WA 2EQUA 3A8HB 4A53A 3JCMd 5GAN6 3FC3A 2CGHA 4M77D 5A0LA 4JS5A 4A4EA 4ZGDB 2HD0A 4KBMB 4M77B 5FLXE 4E47A 3S3NA 1XOVA 2RHIA 3FJPA 3JCMh 3JAME 4ZTFA 1VQ7T 4M75C 3MP8A 2JZ2A 4YTLA 5CQXA 5CKFA 1QVGA 2RK2A 3MEUA 5HK3A 2E41A 5D6XA 3PMIA 5LJ5d 2VUBA 3OS5A 1ZBXA 2M0OA 3C12A 4MMKA 5HKCA 4O6JA 2XDBA 1AHJB 2Y4XA 2IG0A 4J8OA 1KHCA 1D3BB 3QHSA 4XTWA 5CIUA 3DB4A 3RESA 5GAMe 5DLOA 1HXDA 3ER0A 5FRNA 5GAMf 2X4WA 4C0ZA 4HT9A 4A4FA 4E7LA 3OS2A 3HFNA 3BY7A 1YJWA 3R6OA 2EQMA 4C5GA 4KT0E 3OYFA 1XTDA 3RKYA 3CCVA 3OBWA 5CKEA 2DXUA 2I2LA 4C0GA 1X6OA 2L89A 3OB9A 4E7IA 4OB1B 1M1KU 1K73C 2E6NA 2QA4A 3QXEB 2RB6A 3CCEA 4C8QA 2KDSA 4C8QF 3RMSA 2CZ0B 4QVCA 3CPWA 4JS4A 3QBYA 2RJCA 4F7UB 1YHQT 3PTAA 3A8GB 3CPFA 3FIFA 2ZCFB 3VU3C 5GAMd 1VIEA 2LX9A 2Y90A 4EMKA 1YBYA 2QXFA 3CBPA 5GAN7 4JJNK 3CBMA 3DLLA 2QA4T 2MAMA 4M77C 2RHZA 4C0FA 4DQ2A 3J80E 3L1AA 2DD5A 3C94A 3GLXA 3CCUA 5I21A 1K9MU 5GAMh 2MF2A 3VYGA 4J7IA 4IUTA 4OGCA 4GLKA 3CCQT 1KD1C 4C92G 4M7AA 2Y4YA 4Y28E 3OBYA 4M7AF 2DJZA 3HRSA 3JSCA 3JRZA 2M16A 1UGPB 3QUIA 4LDUA 4F7UA 1W2BS 4TVRA 4F7UF 3E1SA 4OB3B 3QZ9B 1Q86C 3OMGA 3TCJA 2EWNA 1WGSA 1YIJA 3OYNA 2K3XA 3MEVA 2WSEE 1JB0E 3URGA 3OYHA 3G4SA 3CCRA 4HA8A 2HNIA 2RI5A 2YRVA 4L59A 2WSCE 4JLIA 3OYCA 1WPYA 2DKGA 4BI4A 1VQLT 2DO3A 4FT2A 2PU9B 3JCMg 2DAQA 3OW2S 1VUBA 2MWPA 5CR2A 2HQXA 3QJ6A 1Q81C 2P4TA 3CCMA 1M9SA 2X4YA 4IUUA 5DLQE 3BDUA 4ELYC 1M8VA 1VQMT 3CCSA 3AHUA 2XDPA 4A4HA 5GAOl 3G71A 4KUDK 4NL2A 1VQ6T 4BB7A 4M7DA 1YITA 3ZEHA 3H6ZA 3HRUA 4ZGJB 3OYDA 3CCLA 4A4GA 1VQKA 4XTYA 3HSBA 2VXFA 3GP8A 2BUDA 4MDWA 2JTFA 4OB0B 4QVDA 3CCST 2JOYA 3MP1A 1PSFA 3NTIA 3BDLA 5GANe 1K73U 5CCAA 4L6V5 4RG8A 5GANf 2L3RA 3HHTB 4J83A 4NS5A 2OTJA 3QSUA 3S6WA 1WQ7A 1Y96B 3LX7A 4M78B 4EDUA 1VQKT 2AHJB 2DVEA 5CKBA 2PQWA 1N9SA 2E1HA 1UGRB 3DLMA 3CD6A 2QQAA 2K57A 4HCBA 4JUVA 3CBOA 5CK9A 3OS1A 2KMTA 1G3WA 4XQ3A 4JRPA 4J5YA 2K2VA 2VC8A 3ME9A 3KUFA 4ME7A 4R55A 2LRQA 4EMHA 4C92D 4BDYA 1VQ4T 1KQ1A 3META 5CKHA 5GANd 3OYJA 2R57A 1LOJA 5GAMg 3CD6T 4DOWA 2HQEA 2QQ9A 2JUFA 2XIDA 3VJPA 4C92B 3CC2A 3SFMA 2KSSA 5GMKe 1KD1U 1VQ5T 2PVGB 2LNVA 3CMAA 2M1HA 4PJOB 4O5VA 4PKCC 2XKOC 3MO8A 5CVIA 2P0QA 4M75A 4N4HA 3WXMB 3L2RA 3GPLA 1I8FA 4M78F 5GANh 5GANj 5LJ5f 3OYEA 2DIQA 2DZCA 3M54A 3N5BB 3EFRA 4J6XA 4OB2B 3OSVA 5KCOA 1Q86U 2C06A 3I55A 5FU7B 4ZGEB 2M9UA 3OYIA 3OYYA 4CI0C 5KH6A 4C8QE 4E7JA 1M5Q1 5FRMA 2LCLA 2DXCA 4FT4A 2VYTA 3L2VA 3C95A 2V8JA 4M78C 1TH7A 4Q5WA 3HFOA 4X9DA 3X28B 1Q7YC 2EJGA 3MEWA 4FM4B 3A8LB 3G6EA 1Q81U 1OZ2A 3VUBA 4PLLA 1IREB 3JB9G 3GOXA 2ZPFB 2QQRA 3OMCA 2FL7A 3HPWA 5C6SA 4PJOF 1G3TA 2ZPBB 2RM4A 5A0GA 3JB9I 2K5IA 5GMKj 1U1TA 3OYKA 2QEXA 5GMKh 3WVDB 2XK0A 4BI8B 2K5FA 3PFSA 1QVGS 4BY6B 2RJEA 1M1FA 2L8DA 3OSSC 4XTXA 5LJ5j 3G6ET 1S72A 4M7DG 4C92C 5LJ5h 2WSFE 1WJQA 4M7AE 1OZ3A 4J6WA 4M77A 4M77F 2QEXT 2G3RA 3LH0A 4FL6A 3CMET 1VQ8A 2FHDA 4PJOC 4II1A 3CEYA 5GAOn 1G5VA 5J39A 2LVMA 2DZ9A 3UWNA 3X26B 1ZHIA 2LTOA 1B34B 1OI1A 1BI0A 1YJWT 3NTHA 5FU7C 4JDSA 2RHXA 1MGQA 1RL2A 4MZPA 3CCVT 5L8RE 4HKEA 5I2MA 2RH2A 4QW2A 1D3BA 5A0DA 3MP6A 1HK9A 1VQ8T 1N9RA 3INZA 3T9NA 5J3BA 3DB3A 2DPPB 4FIBA 3CPWS 3CCET 4N4IA 1NE8A 3JCMQ 1PSEA 2H3JA 2BIVA 5GAMj 4M7AD 2LC4A 2E70A 4IUVA 3O8VA 4PLIA 5KCHA 3CXCA 2LCCA 2LDMA 2ZGWA 5CO7A 4C5EA 4M7DE 2LT4A 4QQDA 3JCMX 3VKIA 3LW5E 3NTKA 1XNIA 3M57A 3MCAB 3UDCA 1BYMA 3HP9A 3CC4A 4BI3A 4A4KA 4JLGA 4BY6C 5GANg 3UPUA 3CCUT 2E12A 5FROA 4BDZA 2QQBA 4M75G 3CXCS 2CYZB 4BE2A 2MMPA 2E10A 2RI3A 3JCMV 1KG1A 1QVPA 4L5GA 5KE2A 3JCMP 1YJ9A 2JTMA 3JCMb 3JB9D 3ZFJA 2D9TA 3L2UA 2OAUA 1DJ7B 2FB7A 2K4YA 3RKWA 1VIFA 3PMTA 4OVAA 2CZ7B 1VQOA 5CQYA 2EKOA 4X34A 3QO3A 4RCCA 4XU1A 1SSFA 3SWNB 2MI6A 1Q7YU 1NJIC 1YIJT 4QQ6A 4J6YA 3PIOA 5GAN8 3G4ST 3RERA 4M7DD 3CCRT 3V7CA 3JB9H 3CCJA 2EYQA 3OA6A 4BE1A 3S3OA 1O75A 1VQOT 4P5NA 3GF5A 3JCMW 3QYGB 2LQKA 3TEEA 3DKMA 2E64A 4B9WA 1UEBA 5LJ5g 1JJ2A 5IN1A 3X20B 4JRIA 3CCMT 3S3MA 3QDRB 4V2SA 2NLUA 3G71T 4M75E 1Y71A 2RD1A 1KQ2A 3VV0A 3V7RA 5GAN3 1UGQB 1YITT 1JJ2S 4XU2A 3BFMA 4C5HA 5LJ3e 3CCLT 1BI3A 4C8QG 2HBPA 5LJ3f 2FVUA 1M90U 1VQ9A 2GCXA 4OGEA 2O01E 3KXTA 4J7FA 1OYXA 1JRIA 3HKSA 1QP2A 2ZPGB 4ATOA 3ZBDA 5D6YA 2A3LA 1Y07A 2DTOA 2GFUA 2QTXA 3M9QA 4QQGA 5GAN5 2OTJT 4ELZC 4Y91A 2PVDB 3SWNC 3GIBA 4BUGA 2A7YA 3OQ5A 1N6AA 2DTHA 4ZN1A 1U8RA 4M75D 5LJ3d 1YI2A 2XI9A 2O4XB 1KC8U 2KAFA 2CKKA 1WJRA 1Y96A 3J7AF 4M78A 3I56A 5J26A 4M7AG 2OTLA 3LGFA 5I2SA 5GMKl 4NOYA 1Y7XA 3M55A 3J81E 4F7UG 4N0AC 2E6ZA 1YJNA 3CC2T 3H8ZA 1BI2A 3PNWC 4M77E 5LJ3h 2XDDA 2ZZDA 3CMEA 1VQNA 2V8KA 4RG2A 3CMAT 2EJFA 2RK1A 3QIIA 2D0QB 4KULA 1X01A 5C0MA 1K8AC 4R56A 2GQVA 2KK4A 2DK3A 4OMFB 4QVZA 3FEOA 4C92A 2CZ6B 3P8DA 1NJIU 4C92F 4DA4A 4VUBA 3I55T 4RCBA 1UGSB 2EJ9A 1XQHA 2CZ1B 2DXTA 4PJOA 3JB9J 3M58A 4LD6A 3PIPA 2FYKA 2ZPHB 4D6WA 3M56A 3Q1JA 2B8AA 1FWZA 2VV5A 1VQ7A 4OF1A 3UT1A 4EPCA 3RMQA 5GAOp 3OYAA 1UB4A 1BKBA 5IAYA 3RIRA 5CAIA 2D6FA 2RA2A 2V8IA 3LYIA 1BI1A 2R5AA 2L5QA 3RKXA 5GAOq 1WJSA 4C0DB 4C8QD 3LWHA 1YCYA 3M5AA 3JCMc 2E5QA 1I81A 3OYMA 1M1GA 2R58A 1BIAA 1QP3A 4FU6A 4F7UE 4HT8A 4C8QB 1RI0A 4GY5A 2F5KA 1NPRA 1U1SA 3PT9A 3G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  1WNL A;  1LJO A;  2E10 A;  4XTY A;  3JCM V;  2VXF A;  4EMG A;  3HSB A;  4PJO D;  4EMK B;  4QVD A;  3JCM P;  2EAY A;  4PNO A;  4XTZ A;  5GAN e;  3JCM b;  3JB9 D;  5GAN f;  5LJ5 e;  3V8L A;  1JBM A;  4M75 F;  2E65 A;  2YHT A;  3QSU A;  2FB7 A;  1WQ7 A;  1Y96 B;  4A53 A;  3JCM d;  3RKW A;  4M78 B;  5GAN 6;  2DVE A;  3SWN B;  3QO3 A;  4RCC A;  1N9S A;  2E1H A;  4XU1 A;  2CGH A;  4M77 D;  4HT9 A;  1WQW A;  4MML A;  2K57 A;  4J6Y A;  4JUV A;  4XTV A;  4XU0 A;  5GAN 8;  3RER A;  4M7D D;  3V7C A;  3JB9 H;  4M77 B;  4XQ3 A;  4M7A B;  4J5Y A;  2VC8 A;  3FJP A;  4EMH A;  3JCM h;  4C92 D;  4M75 C;  3FB9 A;  3V8K A;  1KQ1 A;  3V7S A;  1B34 A;  3JCM W;  5GAN d;  2DEQ A;  5GAM g;  1LOJ A;  2E41 A;  2E64 A;  4M78 G;  4C92 B;  5LJ5 g;  5LJ5 d;  2DTI A;  4JRI A;  5LJ3 g;  5GMK e;  4MMK A;  4V2S A;  4PJO B;  4M75 E;  2RD1 A;  1D3B B;  3QHS A;  4XTW A;  3RES A;  5GAM e;  4XTU A;  1KQ2 A;  4C8Q C;  1HXD A;  4M75 A;  3V7R A;  5GAM f;  5GAN 3;  1I8F A;  4M78 F;  5GAN h;  2JN0 A;  5LJ5 f;  4XU2 A;  3BFM A;  3HFN A;  2DZC A;  4J6X A;  5LJ3 e;  3BY7 A;  3EFR A;  4C8Q G;  5LJ3 f;  4X9C A;  3RKY A;  4EMK C;  1JRI A;  2YLB A;  2DXU A;  2I2L A;  4PJO A;  4C8Q E;  5GAN j;  1M5Q 1;  5DY9 A;  2RB6 A;  5GAO m;  4C8Q A;  4PJO G;  2DTO A;  2QTX A;  3SB2 A;  4C8Q F;  4QVC A;  4M7D B;  5GAN 5;  4M78 C;  4Y91 A;  1TH7 A;  4X9D A;  3HFO A;  3SWN C;  4F7U B;  3GIB A;  2EJG A;  3FIF A;  3VU3 C;  5GAM d;  4EMK A;  2VXE A;  2Y90 A;  3JB9 G;  2DTH A;  3EFS A;  5GAN 7;  4M75 D;  5LJ3 d;  4PJO F;  3JB9 I;  2RM4 A;  4M77 C;  4M7A C;  5GMK j;  1U1T A;  4DQ2 A;  4M78 E;  3L1A A;  5GMK h;  1Y96 A;  4M77 G;  1I5L A;  4M78 A;  4M7A G;  3PGG A;  3SWN A;  5I21 A;  4M7D G;  3V8J A;  4XTX A;  5GMK l;  4NOY A;  5LJ5 j;  5GAM h;  5GMK i;  3JCM J;  4C92 C;  5LJ5 h;  5GAN 2;  4F7U G;  4N0A C;  4WF2 A;  4M77 E;  5LJ3 h;  4M7A E;  1I4K 1;  4J6W A;  4C92 G;  4M77 A;  4M7A A;  3RUX A;  4M77 F;  4PJO C;  1LNX A;  2EJF A;  2DJZ A;  4M7A F;  1X01 A;  4M7D F;  3QUI A;  4F7U A;  5GAO n;  4C92 E;  4F7U F;  2YLC A;  2DZ9 A;  4C92 A;  1B34 B;  4N0A A;  4C92 F;  2EWN A;  1MGQ A;  4RCB A;  1BIB A;  4PJO E;  2EJ9 A;  3JB9 F;  3M4G A;  1H64 1;  4OP0 A;  2DXT A;  4HA8 A;  4M78 D;  2HNI A;  3BW1 A;  1D3B A;  5GAN 4;  3JB9 J;  1HK9 A;  2FYK A;  4XU3 A;  4JLI A;  1N9R A;  3INZ A;  1WPY A;  2DKG A;  4M7D C;  3JCM g;  3JCM Q;  4M75 B;  5GMK m;  5GAM j;  4JRK A;  5GAO r;  5GAO p;  4M7A D;  3RIR A;  5CAI A;  2RA2 A;  5LJ3 j;  3BDU A;  1M8V A;  3RKX A;  5GAO q;  3L2Z A;  4C8Q D;  4NL3 A;  2ZGW A;  3JCM e;  3AHU A;  1YCY A;  3JCM c;  3JCM f;  4NL2 A;  3JCM X;  1I81 A;  5GAO l;  4M7D E;  1BIA A;  4M7D A;  4F7U E;  4HT8 A;  4C8Q B;  5GAN g;  1U1S A;  4A54 A; 
#chains in the Genus database with same CATH topology
 1GFD A;  1S72 T;  4C5I A;  1WHL A;  1VQ7 Q;  4HCZ A;  1WI7 A;  2FPF A;  2KRN A;  3EFO A;  2EFI A;  2E65 A;  2RI2 A;  2QGF B;  2XU8 A;  3P8H A;  1WHH A;  3EHQ A;  5CKD A;  4MML A;  2DIG A;  1GXI E;  2RJD A;  1KC8 C;  2XG8 D;  4JPB W;  3FB9 A;  2QAZ A;  1Q82 C;  4M78 G;  2VWF A;  4IUQ A;  1GRI A;  2L3P A;  3L2W A;  2E3H A;  1NM7 A;  1LPL A;  4LDW A;  2QA4 Q;  1K8A U;  2HMA A;  4EMK C;  2YLB A;  3H0I A;  2BZY A;  1YJ9 T;  1OEB A;  3QKJ A;  5LL6 S;  3ULR B;  3VRZ A;  3LLR A;  1KK7 A;  3LH5 A;  2WAC A;  3FRN A;  1KD1 R;  2PUO B;  1NBE B;  3PGG A;  3SWN A;  2ROT A;  3JCM J;  2JM9 A;  1PNJ A;  5IH2 A;  2HKQ B;  4QKU A;  1RAH B;  1VQP A;  3TU4 K;  2DET A;  1SSH A;  1Q81 R;  4BD3 A;  1NZ9 A;  1BIB A;  3MEA A;  1H64 1;  4FYX B;  4M78 D;  3BW1 A;  4XU3 A;  1YP5 A;  2R5M A;  1C6V X;  1VQ4 A;  2ZPE B;  4OMQ A;  1TOV A;  1N27 A;  1Y0M A;  3A8O B;  1VQ5 A;  2RN8 A;  4NL3 A;  1BB9 A;  1F1B B;  2ECZ A;  3M0T A;  1FXX A;  2OTL T;  1SHF A;  4J9H A;  4ORZ A;  1K9M C;  4E7H A;  1LJO A;  2M02 A;  1QVF S;  1EIF A;  2KVQ G;  3M4Y A;  1YJN T;  2CT3 A;  1VQN T;  1ZLM A;  2DD4 A;  2PUK B;  2D8J A;  4ZN3 A;  1VYV A;  2CH4 A;  2LP5 A;  4ZTJ A;  3F70 A;  1IO6 A;  2KT1 A;  2YHT A;  1PKS A;  5GAN 6;  1PCX A;  3CQT A;  4A4E A;  3RBB B;  4E47 A;  1TSF A;  2RQW A;  2AKL A;  3QWX X;  2RK2 A;  3MEU A;  2DA9 A;  5D6X A;  5LJ5 d;  1TU0 B;  1AHJ B;  3CME A;  4J8O A;  4XTW A;  1KHC A;  5CIU A;  5DLO A;  3TSW A;  1G83 A;  4ZNX A;  4C0Z A;  5GAM f;  2A0F B;  3SEM A;  3BY7 A;  1QKX A;  3FJ5 A;  2NYS A;  4KT0 E;  3OBW A;  4E7I A;  1M1K U;  2QA4 A;  6AT1 B;  3QXE B;  2CZ0 B;  2QEX Q;  5FWC A;  3QBY A;  2RJC A;  3PTA A;  3VU3 C;  3VS6 A;  2LJ3 A;  1YJW Q;  1MNE A;  2MAM A;  2LQN A;  3CCV Q;  3J80 E;  3L1A A;  3C94 A;  1V1C A;  3GLX A;  3CCU A;  2ROL A;  1M90 R;  2MF2 A;  4J7I A;  2DX1 A;  1KD1 C;  2DYB A;  3EG2 A;  3JRZ A;  2M16 A;  1UGP B;  4LDU A;  1ZSG A;  3TCJ A;  1YIJ A;  2RQR A;  3MEV A;  1JB0 E;  3URG A;  2HNI A;  1YNZ A;  1WPY A;  2DKG A;  3JCM g;  2VB6 A;  3OW2 S;  1BCO A;  1SRM A;  5CR2 A;  2HQX A;  3QJ6 A;  1Q81 C;  1J3T A;  3BDU A;  1M8V A;  1B07 A;  1RLP C;  2XDP A;  3PVL A;  4A4H A;  3CCR Q;  2QAS A;  2DF6 A;  4M4Z A;  3VRY A;  4ZGJ B;  3OYD A;  4A4G A;  4XTY A;  3HSB A;  1MMG A;  1X6G A;  4PFO A;  1K73 U;  5GAN e;  3HHT B;  4J83 A;  2OTJ A;  1WQ7 A;  4M78 B;  2DVE A;  4J9D A;  2K57 A;  5CK9 A;  3U23 A;  4XQ3 A;  4JRP A;  4OML A;  4ME7 A;  4HCC A;  3ME9 A;  4FCY A;  4R55 A;  1VQ4 T;  5CKH A;  2YSQ A;  3CD6 T;  3VJP A;  4C92 B;  2JUF A;  2P4R A;  1VQ5 T;  2LNV A;  3CMA A;  1PD1 A;  4PKC C;  1R0B G;  2RQT A;  4V2S A;  3L2R A;  3WXM B;  1ABQ A;  1I8F A;  1M2V B;  5LJ5 f;  3OYE A;  2DZC A;  3M54 A;  3EFR A;  4OB2 B;  3OSV A;  3UA7 A;  2X3W D;  3OYI A;  4OMO A;  3OYY A;  5KH6 A;  3CC2 Q;  4E7J A;  1M5Q 1;  2DXC A;  2YUQ A;  3RR6 A;  2HSE B;  2NUP B;  3REB B;  3HFO A;  1IRE B;  3OMC A;  2F1L A;  3I55 Q;  5A0G A;  3OYK A;  2QEX A;  5GMK h;  3VS0 A;  2XK0 A;  4BY6 B;  2L8D A;  5LJ5 j;  1QMC A;  1TTH B;  2YUO A;  1RAB B;  1OZ3 A;  1AZG B;  4FL6 A;  3CME T;  1D09 B;  5GAO n;  1BK2 A;  5J39 A;  3X26 B;  1ZBJ A;  2LTO A;  1B34 B;  4EIK A;  1SKU B;  1RL2 A;  1S72 Q;  5L8R E;  4HKE A;  4QW2 A;  2CDT A;  2EGE A;  3MP6 A;  3CPW S;  5J3B A;  4FIB A;  3JCM Q;  2LC4 A;  3O8V A;  4PLI A;  2I0N A;  2LCC A;  2ZGW A;  1W70 A;  2C0O A;  2LT4 A;  3VKI A;  1BYM A;  3M57 A;  3CC4 A;  1K0X A;  4JLG A;  3UPU A;  3CCU T;  3NGP A;  4BE2 A;  3EH2 A;  4L5G A;  3ZFJ A;  2OAU A;  5KYN A;  1DJ7 B;  2K4Y A;  4F16 A;  2NWM A;  2QTV A;  1OUL A;  3RKW A;  3EG9 B;  3QO3 A;  2QK0 A;  1YIJ T;  3M0Q A;  4J6Y A;  5GAN 8;  3RER A;  1OPL A;  4KH1 B;  4BE1 A;  1YJ9 Q;  1ZA2 B;  1U3O A;  1VQO T;  3JCM W;  3QYG B;  3NMZ C;  1PM3 A;  3CXC P;  4DBF A;  2DL7 A;  5KYU B;  1UGQ B;  3M0P A;  1QQJ A;  4C5H A;  5LJ3 f;  4OGE A;  2EPD A;  4J7F A;  2COY A;  4F04 B;  1X27 A;  3VS1 A;  5D6Y A;  2A3L A;  2GFU A;  2OTJ T;  3M9Q A;  4QQG A;  3SWN C;  2YDL A;  3OQ5 A;  2DTH A;  1U8R A;  2EYY A;  1YI2 A;  1SEM A;  2O4X B;  4DBH A;  2YT6 A;  4M78 A;  2JS2 A;  4NOY A;  1Y7X A;  3J81 E;  2HCK A;  1H92 A;  4B6M A;  1KFZ A;  2EVR A;  3CMA T;  2D0Q B;  1PRM C;  2BZ8 A;  4C92 A;  2CZ6 B;  4C92 F;  4DA4 A;  4VUB A;  2OTL Q;  4RCB A;  1WLP B;  2EJ9 A;  1XQH A;  2CZ1 B;  2FPE A;  3M58 A;  4LD6 A;  2MOX A;  1YJN Q;  1AOJ A;  1OV3 A;  1RUW A;  2GBQ A;  2B8A A;  3EFO B;  1FWZ A;  1VQN Q;  1M2V A;  2KXD A;  1GCQ A;  3RIR A;  2D6F A;  1OU9 A;  2R5A A;  3M0R A;  1AWX A;  5GJW B;  4J9F A;  3OYM A;  2R58 A;  4FU6 A;  2NUP A;  2L2P A;  4EMG A;  1W4S A;  1FX7 A;  4E7S A;  2EAY A;  4XTZ A;  4IUP A;  2CT4 A;  3UF4 A;  3V8L A;  4HXJ A;  2F2V A;  1P92 A;  1YHQ A;  1FMV A;  1U06 A;  4XU0 A;  2CP3 A;  2EGA A;  2LZ6 B;  4XK8 E;  1B34 A;  3HL8 A;  2LNH B;  3CCQ A;  1T0H A;  2AKK A;  3M53 A;  3A5Z B;  2KGT A;  2DRK A;  1ZUY A;  4BE0 A;  5IT9 E;  1N8R U;  2HAX A;  3CC4 T;  4AG2 C;  3GNG A;  4LUD A;  2W0Z A;  2FO0 A;  1IZ6 A;  1R77 A;  1V29 B;  3E9G A;  1C1A A;  2QDY B;  4OMP A;  5DY9 A;  5KYW B;  3SB2 A;  2X35 A;  3H9N A;  3OW2 A;  1ZUU A;  2XD0 A;  2VXE A;  2DL3 A;  1KHI A;  3SDZ A;  2EIF A;  1VQM A;  2W10 A;  2RHY A;  2JS0 A;  1R8O B;  4M78 E;  4LNP A;  1I5L A;  3X24 B;  3EG3 A;  4RTV A;  3EG9 A;  2MPX C;  4KRT A;  1KQS S;  3JB9 F;  5GMK i;  1X75 C;  4WF2 A;  4PJM A;  3QZ5 B;  1K76 A;  4MZT A;  4M7D F;  4IKF A;  2CS7 A;  4C92 E;  3GNF B;  2DRM A;  5AT1 B;  2F2W A;  2X4X A;  4HCB A;  2RJF A;  1UDL A;  2RQV A;  5GAN 4;  1WFW A;  5KYU A;  3ASK A;  2M0Y A;  4HVV A;  1VQP Q;  1Q82 U;  3QYH B;  5GAO r;  3KBG A;  4UC4 A;  1IRX A;  1SF9 A;  1YI2 T;  3JCM e;  2RO0 A;  2O88 A;  2D0N A;  1X2K A;  1N8R C;  2BKD N;  4HCK A;  4A54 A;  2EBP A;  1WNL A;  1VQ4 Q;  3E19 A;  3VYH B;  3CD6 Q;  2O4X A;  2KQW A;  1ARK A;  4DOV A;  3P8B B;  1ZA1 B;  1VQ5 Q;  5HY6 A;  4M75 F;  4A53 A;  3A8H B;  3TQ7 P;  3FC3 A;  5A0L A;  2X51 A;  4M77 B;  3S3N A;  2RPN A;  2JZ2 A;  1H3H A;  1OPK A;  1V76 A;  5CKF A;  2DER A;  4JJB A;  3PMI A;  1QVF P;  1PG5 B;  2M0O A;  5FRN A;  1X43 A;  4E7L A;  3HFN A;  4RTX A;  3R6O A;  1Q7Y R;  2EQM A;  1XTD A;  5IHN A;  5CKE A;  4C0G A;  2DXU A;  1X6O A;  3OB9 A;  4OB1 B;  3RMS A;  3CPW A;  2ED0 A;  3CME Q;  1UJ0 A;  2CUD A;  4JS4 A;  1YHQ T;  3A8G B;  5GAM d;  1VIE A;  1YBY A;  3CBP A;  2ED1 A;  2RHZ A;  1K9M U;  5GAM h;  2JXB A;  2E4H A;  3VYG A;  3CCQ T;  1LVK A;  4C92 G;  4Y28 E;  2GTO A;  3QUI A;  4Y92 A;  4Z89 A;  4FYY B;  2KXC A;  3QZ9 B;  3CCU Q;  1WGS A;  2RI5 A;  2WSC E;  3OYC A;  1M2O A;  1QCN A;  1IGQ A;  5IHK A;  2YUN A;  4FYV B;  4IUU A;  2ATC B;  2X4Y A;  2BTT A;  2KYB A;  2EW3 A;  3M0S A;  4JJD A;  5DLQ E;  1UUE A;  1VQM T;  3AHU A;  4KUD K;  5KYW A;  5GAO l;  3G71 A;  1YIJ Q;  4NL2 A;  1WXU A;  2DBM A;  1Q95 G;  3H6Z A;  1NJI R;  1VQO Q;  3GP8 A;  2BUD A;  4OB0 B;  3CCS T;  1MV3 A;  3UAT A;  1AWO A;  4CC7 A;  2DEU A;  2V1R A;  3UA6 A;  5GAN f;  4R0K A;  3QSU A;  3S6W A;  3LX7 A;  4EDU A;  3OW2 P;  1VQK T;  1N9S A;  1UGR B;  3CD6 A;  1UTI A;  2QQA A;  5I11 A;  4A63 B;  3OS1 A;  1WA7 A;  1NG2 A;  2VC8 A;  4EMH A;  4C92 D;  4BDY A;  2YUP A;  1KQ1 A;  2OTJ Q;  4DOW A;  1KD1 U;  2DVJ A;  2ESW A;  4O5V A;  2XKO C;  5GAN j;  2B86 A;  3N5B B;  5FU7 B;  2LCL A;  4FT4 A;  2VYT A;  3C95 A;  2HQH A;  3CMA Q;  2V8J A;  4M78 C;  2BE7 D;  4X9D A;  3X28 B;  1Q7Y C;  2EJG A;  3MEW A;  4FM4 B;  3A8L B;  1Q81 U;  1OZ2 A;  3JB9 G;  2HEQ A;  2FL7 A;  4PJO F;  2KYM A;  4BI8 B;  2KT8 A;  4M7D G;  4XTX A;  3G6E T;  1QWE A;  4C92 C;  5LJ5 h;  4M77 A;  4M77 F;  2G3R A;  2VVK A;  2FHD A;  1ZSZ B;  2ABL A;  1EX4 A;  2LVM A;  3UWN A;  1GCQ C;  2K3B A;  4JDS A;  2RHX A;  4MZP A;  3O5Z A;  1VQ8 T;  3T9N A;  3DB3 A;  4J9I A;  4N4I A;  4E6R A;  2H3J A;  5GAM j;  2OAW A;  3REA B;  4M7A D;  3CXC A;  2HBW A;  4C5E A;  1XNI A;  3HP9 A;  1UEC A;  4BY6 C;  5FRO A;  1E7O A;  4M75 G;  3NHN A;  2MMP A;  2GTJ A;  1FMK A;  4DBR A;  5KE2 A;  1TXQ A;  3JB9 D;  2JTE A;  2JW4 A;  3L2U A;  1T3L A;  3CPW P;  4FYW B;  1VQO A;  2CZ7 B;  2HL5 C;  3CC4 Q;  2KRO A;  1NJI C;  2MI6 A;  4QT7 A;  4PJN A;  3PIO A;  4M7D D;  1TWB A;  1C0M A;  3CCJ A;  2SEM A;  4HVU A;  4P5N A;  2CP5 A;  2DIL A;  5FWB A;  1OX8 A;  3S3M A;  3QDR B;  3MPU B;  2EYZ A;  2NLU A;  3G71 T;  1Y71 A;  2DL5 A;  1JJ2 S;  3BFM A;  1BI3 A;  1M90 U;  2AT1 B;  1VQ9 A;  2O01 E;  3E2U A;  4KGV B;  4JJC A;  2FZC B;  1JXM A;  5GAN 5;  2DYI A;  2A7Y A;  4M75 D;  5LJ3 d;  1WJR A;  3J7A F;  3I56 A;  5I2S A;  1KJW A;  5GMK l;  2E6Z A;  3H8Z A;  4M77 E;  5LJ3 h;  2PTK A;  1MND A;  2ENM A;  2V8K A;  4RG2 A;  2COW A;  2RK1 A;  1YI2 Q;  2V26 A;  4AG1 C;  2JJ9 A;  2GQV A;  2KK4 A;  4OMF B;  1AT1 B;  2JMC A;  2DXT A;  2D8H A;  3PIP A;  1UHC A;  2FYK A;  4D6W A;  3Q1J A;  5GAO p;  5IAY A;  1OX9 A;  2RA2 A;  2V8I A;  1BI1 A;  3RKX A;  1AVZ C;  1WJS A;  4C0D B;  2YRC A;  1RAD B;  3JCM c;  1I81 A;  4HT8 A;  4C8Q B;  2F5K A;  1NPR A;  2DJQ A;  1U1S A;  5L23 A;  4FW1 A;  1O9S A;  4RMO A;  1M90 C;  1UFF A;  4PNO A;  2OJ2 A;  5FU6 B;  2LT1 A;  1D1B A;  3QWY A;  4IUR A;  2PVO B;  5KYX B;  2VGM A;  3X25 B;  2EQJ A;  1WQW A;  4XTV A;  2BE9 B;  4M7A B;  1H3Z A;  1G3S A;  1ZSZ A;  1RI9 A;  2CUB A;  3V8K A;  1IGU A;  2DEQ A;  4PL6 A;  2DTI A;  1YHQ Q;  4D8K A;  1TS9 A;  4CC2 A;  4X1V A;  2KRM A;  4XTU A;  2EQK A;  1IHV A;  2SRC A;  2JN0 A;  4MZM A;  1YWP A;  3HRT A;  4X9C A;  5EG2 A;  1WHK A;  3CC7 T;  2RHU A;  4CRI A;  3CCQ Q;  2EYX A;  1VQL A;  4PJO G;  4LD9 K;  4M7D B;  3QJY A;  3OYG A;  2MK5 A;  2PZ1 A;  2EKH A;  1ZQ1 A;  1E6G A;  3SD4 A;  1VQ6 A;  3CCJ T;  5AYF A;  2K5L A;  2AZS A;  1UGV A;  4M77 G;  2K2M A;  3WVE B;  3V8J A;  2DFU A;  1Q86 R;  3LWI A;  1JQQ A;  2IVW A;  1WXB A;  2GFA A;  2G6F X;  2DL8 A;  2GF7 A;  5A2Q E;  1SG5 A;  1QW1 A;  2NUZ A;  3RUX A;  2LJ0 A;  4RTY A;  2DBK A;  1H8K A;  2FRW A;  2VGN A;  1VQM Q;  2PNI A;  1WYX A;  7AT1 B;  4N4G A;  1VQ9 T;  3M4G A;  3QPH A;  2JT4 A;  3CCS Q;  1HD3 A;  2QQS A;  4F14 A;  4M75 B;  2EYW A;  2YXY A;  4Z88 A;  4E7K A;  4OMN A;  4RTU A;  5GMK m;  4F17 A;  4JRK A;  1KQS P;  3MHX A;  4Z02 A;  1RAI B;  1VQK Q;  5LJ3 j;  1RAA B;  2XHC A;  1NYF A;  3EAE A;  3L2Z A;  1QVF A;  2CRE A;  3JCM f;  1I07 A;  2KY9 A;  4WTO B;  2JNG A;  4AFQ C;  3I56 T;  1JO8 A;  4KH0 B;  2K3Y A;  4PJO D;  4LDV A;  1UJY A;  2QYZ A;  3OYB A;  2LQ8 A;  2OI3 A;  2LCS A;  3I9Q A;  2MWO A;  1IB8 A;  3E9F A;  4JRQ A;  5LJ5 e;  2ZPI B;  5D6W A;  1TUC A;  2EQU A;  1IHW A;  2CGH A;  4M77 D;  4JS5 A;  1X6B A;  1M3B A;  4ZGD B;  4KBM B;  5IXF A;  1GCP A;  1U5S A;  3FJP A;  3JAM E;  4ZTF A;  1M30 A;  5CQX A;  1YWO A;  5HK3 A;  3H0H A;  2OX7 A;  1ZBX A;  4MMK A;  5HKC A;  4O6J A;  2IG0 A;  3QHS A;  1FYN A;  3RES A;  3DB4 A;  1HXD A;  3ER0 A;  1GBR A;  4C5G A;  3G6E Q;  2I2L A;  2L89 A;  2E6N A;  2RB6 A;  3CCE A;  4C8Q A;  2KR3 A;  2KDS A;  4C8Q F;  3CPF A;  3H0F A;  2LX9 A;  5IXB A;  1WX6 A;  4JJN K;  3DLL A;  4M77 C;  1CSK A;  4C0F A;  5D7U A;  4RTZ A;  1VQ8 Q;  5KYX A;  1SHG A;  4OGC A;  4GLK A;  2MCN A;  4M7A A;  2QG9 B;  4M7A F;  3HRS A;  3JSC A;  4F7U A;  1W2B S;  4TVR A;  4F7U F;  3E1S A;  4OB3 B;  1Q86 C;  3IQL A;  1QCO A;  3OYN A;  2K3X A;  3G4S A;  1BBZ A;  3OYH A;  4HA8 A;  4BI4 A;  1VQL T;  2DO3 A;  2DAQ A;  3EGX B;  2RNA A;  3VS5 A;  1G8X A;  2MWP A;  4RUG A;  3CCM A;  1M9S A;  2NUT B;  4ELY C;  3CCS A;  1VQ6 T;  2IPO B;  2MIO A;  4BB7 A;  4AFU C;  4M7D A;  2XMF A;  1YIT A;  3KFV A;  3ZEH A;  2JM8 A;  3CCL A;  1VQK A;  2VXF A;  2JTF A;  2KRS A;  2JOY A;  3MP1 A;  1PSF A;  3NTI A;  3BDL A;  2VAS A;  4NS5 A;  3G71 Q;  1Y96 B;  2AHJ B;  2PQW A;  4J9C A;  2E1H A;  4JZ4 A;  3CBO A;  4J5Y A;  2K2V A;  2LRQ A;  2DLP A;  5GAN d;  3OYJ A;  5GAM g;  1LOJ A;  2QQ9 A;  2XID A;  1HSQ A;  5GMK e;  2PVG B;  2J6K A;  4LN2 A;  2M1H A;  4PJO B;  1EFN A;  1MMA A;  3MO8 A;  2P0Q A;  4M75 A;  3G1J A;  3GPL A;  4Z8A A;  5GAN h;  1VA7 A;  4GLM A;  2L0A A;  2DIQ A;  2K9G A;  4J6X A;  4E2F B;  2M51 A;  5GJV B;  1Y57 A;  4AFZ C;  4C8Q E;  3L2V A;  4PK4 A;  8AT1 B;  1TH7 A;  2BZX A;  3G6E A;  4PLL A;  2ZPF B;  3HPW A;  2J6F A;  5C6S A;  1G3T A;  3JB9 I;  1HJD A;  1I1J A;  2J06 A;  1BU1 A;  3WVD B;  1K8A R;  3MKD A;  2VKN A;  4AMC A;  1QVG S;  1T0J A;  3RDV A;  4M7A E;  2FEI A;  4J6W A;  1VQ8 A;  2J7I A;  1G5V A;  4RTW A;  1OI1 A;  5FU7 C;  1MGQ A;  5I2M A;  4KGX B;  5A0D A;  1ZX6 A;  1HK9 A;  1N9R A;  3CCE T;  2D1X A;  1NE8 A;  4AT1 B;  1PSE A;  2BIV A;  2CH4 W;  1I5O B;  4IUV A;  2CP2 A;  2LDM A;  5CO7 A;  4M7D E;  4QQD A;  2HL3 A;  3JCM X;  3LW5 E;  3NTK A;  1VYU A;  1KSW A;  4A4K A;  5KYY A;  1WHM A;  2O9V A;  4BDZ A;  2RI3 A;  3JCM V;  1KG1 A;  1QVP A;  3JCM P;  1ACM B;  1ZSZ C;  3PMT A;  4OVA A;  5CQY A;  1EZZ B;  4X34 A;  4RCC A;  4XU1 A;  1SSF A;  1Q7Y U;  1BCM A;  2LMJ A;  2ZAE A;  4QQ6 A;  3G4S T;  3JB9 H;  2EYQ A;  1MUZ A;  4CC4 B;  3CC7 Q;  3S3O A;  1O75 A;  1JU5 C;  2YWW A;  1W6X A;  2LQK A;  1ZUK A;  1UEB A;  5LJ5 g;  1UE9 A;  3X20 B;  3CCM T;  4JRI A;  4IIO A;  3SHW A;  1WHG A;  4M75 E;  3EGX A;  3V7R A;  3VV0 A;  3CCJ Q;  1YIT T;  4XU2 A;  3CCL T;  5FW9 A;  4C8Q G;  2NUT A;  1OYX A;  2DNU A;  1B7T A;  2K79 A;  3HKS A;  3EG1 A;  1QP2 A;  2ZPG B;  1VOM A;  4ATO A;  3ZBD A;  1Y07 A;  1VYT A;  2QTX A;  1M8M A;  4ELZ C;  5I22 A;  3GIB A;  1VQ9 Q;  2E3I A;  2KAF A;  2CKK A;  1Y96 A;  4M7A G;  5J26 A;  2A36 A;  3TVT A;  3LGF A;  1JJ2 P;  3A98 A;  4F7U G;  3PVQ A;  3PNW C;  2FPD A;  1M1K R;  3BE3 A;  3QII A;  5C0M A;  1X01 A;  1K8A C;  4R56 A;  2J05 A;  1D1A A;  2DK3 A;  4K11 A;  4QVZ A;  3FEO A;  1NJI U;  3I56 Q;  4PJO A;  3JB9 J;  3I35 A;  3M56 A;  4AFS C;  3NPF A;  1VQ7 A;  2VV5 A;  4OF1 A;  4ANJ A;  4EPC A;  3OYA A;  3VS7 A;  1D0Z A;  2COZ A;  2O31 A;  4C8Q D;  3LWH A;  3M5A A;  2E5Q A;  1QCF A;  1S1N A;  1M1G A;  1BIA A;  2KI7 A;  1GL5 A;  1RI0 A;  4GY5 A;  2GGR A;  2Z0W A;  3NFC A;  4EMK B;  4CC3 A;  1NPP A;  2DXB A;  5DM7 R;  4FSX A;  3MJX A;  2CSI A;  2F5T X;  1JBM A;  2P0K A;  1AWW A;  1D0X A;  2C0T A;  2P0P A;  4KUI A;  3LGL A;  4MDX A;  3L42 A;  2QDL A;  4J9E A;  3VUZ A;  1G3Y A;  1M4Z A;  2H8H A;  3V7S A;  5M9O A;  1JXO A;  3EH1 A;  5LJ3 g;  4C0D C;  1K4U S;  2X4J A;  1M27 C;  3AT1 B;  2A28 A;  3CC7 A;  4KGZ B;  1K73 R;  1IXD A;  2RQU A;  4C8Q C;  1YFN A;  2V1Q A;  5IHI A;  1W2B A;  2KBT A;  2JVV A;  1PD0 A;  2QI2 A;  2X3X D;  5FU6 C;  4LE9 A;  5GAO m;  5HK0 A;  2XIC A;  1KQS A;  2AZV A;  3EFS A;  2F2X A;  3TRE A;  3OYL A;  4M7A C;  1PHT A;  3L2Q A;  1RAF B;  1FMW A;  3C4S A;  5KE3 A;  3ZL7 C;  1VQL Q;  4LDX A;  1G2B A;  1OOT A;  1CKA A;  5GAN 2;  1MMN A;  3OY9 A;  1I4K 1;  4LXC A;  1LNX A;  1VQ6 Q;  1AD5 A;  3A8M B;  2YLC A;  8ATC B;  1X69 A;  4N0A A;  4PJO E;  3OS0 A;  4OP0 A;  3FDR A;  3M59 A;  1M1K C;  1VQP T;  1MMD A;  2F69 A;  3VS2 A;  4M7D C;  3HTR A;  3QG1 A;  4JZ3 A;  4XAX B;  4LDY A;  4BAC A;  4RKU E;  1WZO A;  5HCK A;  2CP6 A;  3VS3 A;  2JMA A;  2H3E B;  4DBQ A;  1MHN A;  1TUG B;  4FW2 A;  4B9X A;  3FLG A;  3D7S B;  3JCM d;  2IIM A;  2YRD A;  3RNJ A;  3EGU A;  2AIR B;  2HD0 A;  5FLX E;  1XOV A;  2CP7 A;  1MV0 B;  2RHI A;  3JCM h;  1VQ7 T;  4PFZ A;  4M75 C;  3MP8 A;  1WDX A;  3JV3 A;  4YTL A;  1QVG A;  2E41 A;  2FRY A;  2VUB A;  3OS5 A;  4DEY A;  3C12 A;  2XDB A;  1QWF A;  2Y4X A;  1D3B B;  2K7A A;  5GAM e;  4HT9 A;  2X4W A;  4A4F A;  3OS2 A;  1YJW A;  2LX7 A;  1UG1 A;  1M3C A;  3OYF A;  3RKY A;  1PC0 A;  3R6N A;  3CCV A;  1GFC A;  1K73 C;  2K6D A;  1QLY A;  5ECA A;  4QVC A;  2DMO A;  4F7U B;  2EGC A;  3THK A;  3FIF A;  2ZCF B;  1OQK A;  4EMK A;  2Y90 A;  2QXF A;  5GAN 7;  3CBM A;  2QA4 T;  4DEX A;  4DQ2 A;  2DD5 A;  4WCI A;  5I21 A;  3CCE Q;  1PRL C;  4IUT A;  2CSQ A;  2Y4Y A;  2KNB B;  3OBY A;  2DJZ A;  3PE0 A;  2KEA A;  1RAE B;  3OMG A;  2EWN A;  2WSE E;  3CCR A;  2O2O A;  2E5K A;  4L59 A;  2YRV A;  2J6O A;  4JLI A;  4FT2 A;  2PU9 B;  1ABO A;  4RTT A;  1VUB A;  1NEB A;  2AK5 A;  2P4T A;  1T3S A;  5EC7 A;  1K9A A;  3G4S Q;  2P84 A;  3EGD B;  1W2B P;  1TUD A;  3HRU A;  2MYS A;  4MDW A;  4QVD A;  1D1C A;  4OMM A;  2EQI A;  3CCM Q;  1M3A A;  5CCA A;  2C0I A;  4L6V 5;  4RG8 A;  2L3R A;  2L3S A;  5CKB A;  3EHR A;  3DLM A;  1YIT Q;  2DL4 A;  3CCL Q;  2RF0 A;  4JUV A;  1NLP C;  2KMT A;  1G3W A;  3EG0 A;  1WIE A;  1SRL A;  3KUF A;  3MET A;  2R57 A;  4J9B A;  2HQE A;  3CC2 A;  1WXT A;  4LUE A;  3SFM A;  2KSS A;  1PKT A;  1AEY A;  1KIK A;  5CVI A;  3GBQ A;  4N4H A;  1LCK A;  4M78 F;  2C06 A;  5KCO A;  1Q86 U;  3I55 A;  4ZGE B;  2M9U A;  3A1P A;  4CI0 C;  4PJL A;  2RMO A;  5FRM A;  1GBQ A;  1N5Z A;  1K0S A;  4PJJ A;  3TSZ A;  4Q5W A;  3VUB A;  3GOX A;  2QQR A;  2A37 A;  2ZPB B;  2L3Q A;  2RM4 A;  1N8R R;  2K5I A;  3I5S A;  1U1T A;  5GMK j;  2K5F A;  3PFS A;  2RJE A;  1YCS B;  1M1F A;  1S72 A;  3OSS C;  1RAG B;  1WJQ A;  2WSF E;  3I5R A;  2QEX T;  4PJO C;  3LH0 A;  1SPK A;  1D0Y A;  4ESR A;  2GQI A;  2DM1 A;  4II1 A;  3CEY A;  3QDF A;  2DZ9 A;  1ZHI A;  1YJW T;  1BI0 A;  5KYY B;  3NTH A;  4J9G A;  3CCV T;  1XJW B;  2RH2 A;  1D3B A;  1RAC B;  1E6H A;  3INZ A;  1HYO A;  2DPP B;  1QVG P;  1CKB A;  2E70 A;  5KCH A;  1JEG A;  1X2Q A;  2FZK B;  3UDC A;  3MCA B;  1NYG A;  2A08 A;  4BI3 A;  5GAN g;  4IIM A;  2E12 A;  2HSP A;  2QQB A;  3CXC S;  2CYZ B;  2E10 A;  1OU8 A;  1YN8 A;  2KE9 A;  3M0U A;  1YJ9 A;  2DE0 X;  2JTM A;  3JCM b;  2D9T A;  2FG0 A;  1KC8 R;  2FB7 A;  1VIF A;  2FZG B;  2GNC A;  1Q82 R;  2EKO A;  3SWN B;  1UHF A;  3CCR T;  3V7C A;  1NEG A;  1AZE A;  3H41 A;  3OA6 A;  2HDA A;  1Z9Q A;  3GF5 A;  4FSS A;  2X9H A;  3DKM A;  3TEE A;  2E64 A;  4B9W A;  1JJ2 A;  5IN1 A;  4E7Z A;  1KQ2 A;  2RD1 A;  5GAN 3;  1AWJ A;  5LJ3 e;  1QKW A;  3C0C A;  2HBP A;  2FVU A;  2GCX A;  3KXT A;  1Z9Z A;  1B3Q A;  1JRI A;  1NLO C;  3EGD A;  2DTO A;  4PFP A;  4Y91 A;  1PWT A;  2PVD B;  4BUG A;  1N6A A;  1I0C A;  4ZN1 A;  2XI9 A;  1K1Z A;  1KC8 U;  2OTL A;  2HZY A;  3M55 A;  4N0A C;  1YJN A;  3CC2 T;  4D8D A;  1BI2 A;  2XDD A;  3VS4 A;  2ZZD A;  1TG0 A;  1VQN A;  2EJF A;  4GBQ A;  4KUL A;  2HKN A;  1A0N B;  2QGG A;  1WHJ A;  3P8D A;  3I55 T;  1UGS B;  2LJ1 A;  1W1F A;  2LQW A;  2ZPH B;  9ATC B;  2O9S A;  1RLQ C;  3UT1 A;  4HVW A;  1K9M R;  3RMQ A;  1UB4 A;  1BKB A;  5CAI A;  3LYI A;  2CP0 A;  2L5Q A;  5GAO q;  1YCY A;  1QP3 A;  4F7U E;  1R0C B;  3PT9 A;  3G7Z A; 
#chains in the Genus database with same CATH homology
 1S72 T;  4C5I A;  1O9S A;  4EMG A;  4RMO A;  3NFC A;  1W4S A;  1M90 C;  1FX7 A;  4HCZ A;  4EMK B;  1NPP A;  2DXB A;  2EAY A;  4PNO A;  4IUP A;  4XTZ A;  5DM7 R;  4FSX A;  5FU6 B;  2LT1 A;  2F5T X;  3V8L A;  1JBM A;  2EFI A;  4IUR A;  2E65 A;  2RI2 A;  2XU8 A;  3P8H A;  2P0K A;  1P92 A;  2PVO B;  2VGM A;  1YHQ A;  5CKD A;  3X25 B;  2EQJ A;  2P0P A;  1WQW A;  4KUI A;  4MML A;  4XU0 A;  4XTV A;  2DIG A;  3LGL A;  4MDX A;  3L42 A;  1GXI E;  4M7A B;  3VUZ A;  2RJD A;  1G3Y A;  1G3S A;  1H3Z A;  1KC8 C;  1M4Z A;  4XK8 E;  2XG8 D;  3FB9 A;  3V8K A;  1Q82 C;  3V7S A;  1B34 A;  2DEQ A;  5M9O A;  4PL6 A;  3HL8 A;  4M78 G;  4IUQ A;  3CCQ A;  2DTI A;  5LJ3 g;  3L2W A;  3M53 A;  4C0D C;  3A5Z B;  2X4J A;  3CC7 A;  4BE0 A;  5IT9 E;  1N8R U;  4LDW A;  4XTU A;  2HAX A;  2EQK A;  4C8Q C;  1K8A U;  3CC4 T;  2JN0 A;  4MZM A;  1W2B A;  3HRT A;  4X9C A;  3GNG A;  2JVV A;  5EG2 A;  4EMK C;  2YLB A;  3CC7 T;  1IZ6 A;  2RHU A;  2QI2 A;  1V29 B;  4CRI A;  1YJ9 T;  3E9G A;  2QDY B;  5FU6 C;  5DY9 A;  3QKJ A;  5GAO m;  1VQL A;  4PJO G;  3SB2 A;  5LL6 S;  5HK0 A;  2X35 A;  4LD9 K;  4M7D B;  3QJY A;  3OYG A;  3OW2 A;  3LLR A;  2XD0 A;  2XIC A;  1ZQ1 A;  2VXE A;  1KQS A;  1KHI A;  2WAC A;  2EIF A;  3EFS A;  3FRN A;  3SDZ A;  3SD4 A;  2PUO B;  3TRE A;  1VQM A;  1VQ6 A;  3OYL A;  3CCJ T;  4M7A C;  2RHY A;  4M78 E;  1R8O B;  2K5L A;  5AYF A;  4M77 G;  3L2Q A;  3X24 B;  1I5L A;  3PGG A;  3WVE B;  3SWN A;  3C4S A;  5KE3 A;  3V8J A;  1KQS S;  3JB9 F;  4LDX A;  3JCM J;  5GMK i;  3LWI A;  4HCC A;  2IVW A;  5GAN 2;  2GFA A;  1X75 C;  4WF2 A;  3OY9 A;  2GF7 A;  5A2Q E;  1I4K 1;  3QZ5 B;  1QW1 A;  3RUX A;  1LNX A;  1VQP A;  4MZT A;  2VGN A;  4M7D F;  4IKF A;  2CS7 A;  3TU4 K;  4C92 E;  3A8M B;  2YLC A;  3GNF B;  4N0A A;  4N4G A;  1VQ9 T;  4BD3 A;  2X4X A;  1NZ9 A;  1BIB A;  4PJO E;  3MEA A;  3OS0 A;  3M4G A;  1H64 1;  4OP0 A;  3FDR A;  2RJF A;  3M59 A;  1M1K C;  4M78 D;  3BW1 A;  1VQP T;  3QPH A;  5GAN 4;  4XU3 A;  2F69 A;  2R5M A;  3ASK A;  4M7D C;  1VQ4 A;  2QQS A;  3QG1 A;  2ZPE B;  4M75 B;  4XAX B;  4E7K A;  1Q82 U;  5GMK m;  3QYH B;  4JRK A;  3KBG A;  4LDY A;  5GAO r;  1N27 A;  3MHX A;  4Z02 A;  4BAC A;  4RKU E;  3A8O B;  4UC4 A;  5LJ3 j;  2XHC A;  1VQ5 A;  3EAE A;  3L2Z A;  4NL3 A;  1YI2 T;  3JCM e;  1QVF A;  2RO0 A;  3JCM f;  1N8R C;  2KY9 A;  2BKD N;  1FXX A;  2JNG A;  3I56 T;  4A54 A;  2OTL T;  1K9M C;  1MHN A;  1WNL A;  4E7H A;  1LJO A;  2K3Y A;  1QVF S;  4PJO D;  1EIF A;  2KVQ G;  4LDV A;  3E19 A;  3M4Y A;  3OYB A;  1YJN T;  2LQ8 A;  3VYH B;  2O4X A;  2KQW A;  1VQN T;  2DD4 A;  2PUK B;  2MWO A;  4DOV A;  3E9F A;  3P8B B;  4B9X A;  4ZN3 A;  4JRQ A;  4ZTJ A;  3FLG A;  3F70 A;  5LJ5 e;  5HY6 A;  4M75 F;  2YHT A;  2ZPI B;  5D6W A;  2EQU A;  3A8H B;  4A53 A;  3JCM d;  5GAN 6;  3FC3 A;  2CGH A;  4M77 D;  5A0L A;  4JS5 A;  4A4E A;  4ZGD B;  2HD0 A;  4KBM B;  4M77 B;  5FLX E;  4E47 A;  3S3N A;  1XOV A;  2RHI A;  3FJP A;  3JCM h;  3JAM E;  4ZTF A;  1VQ7 T;  4M75 C;  3MP8 A;  2JZ2 A;  4YTL A;  5CQX A;  5CKF A;  1QVG A;  2RK2 A;  3MEU A;  5HK3 A;  2E41 A;  5D6X A;  3PMI A;  5LJ5 d;  2VUB A;  3OS5 A;  1ZBX A;  2M0O A;  3C12 A;  4MMK A;  5HKC A;  4O6J A;  2XDB A;  1AHJ B;  2Y4X A;  2IG0 A;  4J8O A;  1KHC A;  1D3B B;  3QHS A;  4XTW A;  5CIU A;  3DB4 A;  3RES A;  5GAM e;  5DLO A;  1HXD A;  3ER0 A;  5FRN A;  5GAM f;  2X4W A;  4C0Z A;  4HT9 A;  4A4F A;  4E7L A;  3OS2 A;  3HFN A;  3BY7 A;  1YJW A;  3R6O A;  2EQM A;  4C5G A;  4KT0 E;  3OYF A;  1XTD A;  3RKY A;  3CCV A;  3OBW A;  5CKE A;  2DXU A;  2I2L A;  4C0G A;  1X6O A;  2L89 A;  3OB9 A;  4E7I A;  4OB1 B;  1M1K U;  1K73 C;  2E6N A;  2QA4 A;  3QXE B;  2RB6 A;  3CCE A;  4C8Q A;  2KDS A;  4C8Q F;  3RMS A;  2CZ0 B;  4QVC A;  3CPW A;  4JS4 A;  3QBY A;  2RJC A;  4F7U B;  1YHQ T;  3PTA A;  3A8G B;  3CPF A;  3FIF A;  2ZCF B;  3VU3 C;  5GAM d;  1VIE A;  2LX9 A;  2Y90 A;  4EMK A;  1YBY A;  2QXF A;  3CBP A;  5GAN 7;  4JJN K;  3CBM A;  3DLL A;  2QA4 T;  2MAM A;  4M77 C;  2RHZ A;  4C0F A;  4DQ2 A;  3J80 E;  3L1A A;  2DD5 A;  3C94 A;  3GLX A;  3CCU A;  5I21 A;  1K9M U;  5GAM h;  2MF2 A;  3VYG A;  4J7I A;  4IUT A;  4OGC A;  4GLK A;  3CCQ T;  1KD1 C;  4C92 G;  4M7A A;  2Y4Y A;  4Y28 E;  3OBY A;  4M7A F;  2DJZ A;  3HRS A;  3JSC A;  3JRZ A;  2M16 A;  1UGP B;  3QUI A;  4LDU A;  4F7U A;  1W2B S;  4TVR A;  4F7U F;  3E1S A;  4OB3 B;  3QZ9 B;  1Q86 C;  3OMG A;  3TCJ A;  2EWN A;  1WGS A;  1YIJ A;  3OYN A;  2K3X A;  3MEV A;  2WSE E;  1JB0 E;  3URG A;  3OYH A;  3G4S A;  3CCR A;  4HA8 A;  2HNI A;  2RI5 A;  2YRV A;  4L59 A;  2WSC E;  4JLI A;  3OYC A;  1WPY A;  2DKG A;  4BI4 A;  1VQL T;  2DO3 A;  4FT2 A;  2PU9 B;  3JCM g;  2DAQ A;  3OW2 S;  1VUB A;  2MWP A;  5CR2 A;  2HQX A;  3QJ6 A;  1Q81 C;  2P4T A;  3CCM A;  1M9S A;  2X4Y A;  4IUU A;  5DLQ E;  3BDU A;  4ELY C;  1M8V A;  1VQM T;  3CCS A;  3AHU A;  2XDP A;  4A4H A;  5GAO l;  3G71 A;  4KUD K;  4NL2 A;  1VQ6 T;  4BB7 A;  4M7D A;  1YIT A;  3ZEH A;  3H6Z A;  3HRU A;  4ZGJ B;  3OYD A;  3CCL A;  4A4G A;  1VQK A;  4XTY A;  3HSB A;  2VXF A;  3GP8 A;  2BUD A;  4MDW A;  2JTF A;  4OB0 B;  4QVD A;  3CCS T;  2JOY A;  3MP1 A;  1PSF A;  3NTI A;  3BDL A;  5GAN e;  1K73 U;  5CCA A;  4L6V 5;  4RG8 A;  5GAN f;  2L3R A;  3HHT B;  4J83 A;  4NS5 A;  2OTJ A;  3QSU A;  3S6W A;  1WQ7 A;  1Y96 B;  3LX7 A;  4M78 B;  4EDU A;  1VQK T;  2AHJ B;  2DVE A;  5CKB A;  2PQW A;  1N9S A;  2E1H A;  1UGR B;  3DLM A;  3CD6 A;  2QQA A;  2K57 A;  4HCB A;  4JUV A;  3CBO A;  5CK9 A;  3OS1 A;  2KMT A;  1G3W A;  4XQ3 A;  4JRP A;  4J5Y A;  2K2V A;  2VC8 A;  3ME9 A;  3KUF A;  4ME7 A;  4R55 A;  2LRQ A;  4EMH A;  4C92 D;  4BDY A;  1VQ4 T;  1KQ1 A;  3MET A;  5CKH A;  5GAN d;  3OYJ A;  2R57 A;  1LOJ A;  5GAM g;  3CD6 T;  4DOW A;  2HQE A;  2QQ9 A;  2JUF A;  2XID A;  3VJP A;  4C92 B;  3CC2 A;  3SFM A;  2KSS A;  5GMK e;  1KD1 U;  1VQ5 T;  2PVG B;  2LNV A;  3CMA A;  2M1H A;  4PJO B;  4O5V A;  4PKC C;  2XKO C;  3MO8 A;  5CVI A;  2P0Q A;  4M75 A;  4N4H A;  3WXM B;  3L2R A;  3GPL A;  1I8F A;  4M78 F;  5GAN h;  5GAN j;  5LJ5 f;  3OYE A;  2DIQ A;  2DZC A;  3M54 A;  3N5B B;  3EFR A;  4J6X A;  4OB2 B;  3OSV A;  5KCO A;  1Q86 U;  2C06 A;  3I55 A;  5FU7 B;  4ZGE B;  2M9U A;  3OYI A;  3OYY A;  4CI0 C;  5KH6 A;  4C8Q E;  4E7J A;  1M5Q 1;  5FRM A;  2LCL A;  2DXC A;  4FT4 A;  2VYT A;  3L2V A;  3C95 A;  2V8J A;  4M78 C;  1TH7 A;  4Q5W A;  3HFO A;  4X9D A;  3X28 B;  1Q7Y C;  2EJG A;  3MEW A;  4FM4 B;  3A8L B;  3G6E A;  1Q81 U;  1OZ2 A;  3VUB A;  4PLL A;  1IRE B;  3JB9 G;  3GOX A;  2ZPF B;  2QQR A;  3OMC A;  2FL7 A;  3HPW A;  5C6S A;  4PJO F;  1G3T A;  2ZPB B;  2RM4 A;  5A0G A;  3JB9 I;  2K5I A;  5GMK j;  1U1T A;  3OYK A;  2QEX A;  5GMK h;  3WVD B;  2XK0 A;  4BI8 B;  2K5F A;  3PFS A;  1QVG S;  4BY6 B;  2RJE A;  1M1F A;  2L8D A;  3OSS C;  4XTX A;  5LJ5 j;  3G6E T;  1S72 A;  4M7D G;  4C92 C;  5LJ5 h;  2WSF E;  1WJQ A;  4M7A E;  1OZ3 A;  4J6W A;  4M77 A;  4M77 F;  2QEX T;  2G3R A;  3LH0 A;  4FL6 A;  3CME T;  1VQ8 A;  2FHD A;  4PJO C;  4II1 A;  3CEY A;  5GAO n;  1G5V A;  5J39 A;  2LVM A;  2DZ9 A;  3UWN A;  3X26 B;  1ZHI A;  2LTO A;  1B34 B;  1OI1 A;  1BI0 A;  1YJW T;  3NTH A;  5FU7 C;  4JDS A;  2RHX A;  1MGQ A;  1RL2 A;  4MZP A;  3CCV T;  5L8R E;  4HKE A;  5I2M A;  2RH2 A;  4QW2 A;  1D3B A;  5A0D A;  3MP6 A;  1HK9 A;  1VQ8 T;  1N9R A;  3INZ A;  3T9N A;  5J3B A;  3DB3 A;  2DPP B;  4FIB A;  3CPW S;  3CCE T;  4N4I A;  1NE8 A;  3JCM Q;  1PSE A;  2H3J A;  2BIV A;  5GAM j;  4M7A D;  2LC4 A;  2E70 A;  4IUV A;  3O8V A;  4PLI A;  5KCH A;  3CXC A;  2LCC A;  2LDM A;  2ZGW A;  5CO7 A;  4C5E A;  4M7D E;  2LT4 A;  4QQD A;  3JCM X;  3VKI A;  3LW5 E;  3NTK A;  1XNI A;  3M57 A;  3MCA B;  3UDC A;  1BYM A;  3HP9 A;  3CC4 A;  4BI3 A;  4A4K A;  4JLG A;  4BY6 C;  5GAN g;  3UPU A;  3CCU T;  2E12 A;  5FRO A;  4BDZ A;  2QQB A;  4M75 G;  3CXC S;  2CYZ B;  4BE2 A;  2MMP A;  2E10 A;  2RI3 A;  3JCM V;  1KG1 A;  1QVP A;  4L5G A;  5KE2 A;  3JCM P;  1YJ9 A;  2JTM A;  3JCM b;  3JB9 D;  3ZFJ A;  2D9T A;  3L2U A;  2OAU A;  1DJ7 B;  2FB7 A;  2K4Y A;  3RKW A;  1VIF A;  3PMT A;  4OVA A;  2CZ7 B;  1VQO A;  5CQY A;  2EKO A;  4X34 A;  3QO3 A;  4RCC A;  4XU1 A;  1SSF A;  3SWN B;  2MI6 A;  1Q7Y U;  1NJI C;  1YIJ T;  4QQ6 A;  4J6Y A;  3PIO A;  5GAN 8;  3G4S T;  3RER A;  4M7D D;  3CCR T;  3V7C A;  3JB9 H;  3CCJ A;  2EYQ A;  3OA6 A;  4BE1 A;  3S3O A;  1O75 A;  1VQO T;  4P5N A;  3GF5 A;  3JCM W;  3QYG B;  2LQK A;  3TEE A;  3DKM A;  2E64 A;  4B9W A;  1UEB A;  5LJ5 g;  1JJ2 A;  5IN1 A;  3X20 B;  4JRI A;  3CCM T;  3S3M A;  3QDR B;  4V2S A;  2NLU A;  3G71 T;  4M75 E;  1Y71 A;  2RD1 A;  1KQ2 A;  3VV0 A;  3V7R A;  5GAN 3;  1UGQ B;  1YIT T;  1JJ2 S;  4XU2 A;  3BFM A;  4C5H A;  5LJ3 e;  3CCL T;  1BI3 A;  4C8Q G;  2HBP A;  5LJ3 f;  2FVU A;  1M90 U;  1VQ9 A;  2GCX A;  4OGE A;  2O01 E;  3KXT A;  4J7F A;  1OYX A;  1JRI A;  3HKS A;  1QP2 A;  2ZPG B;  4ATO A;  3ZBD A;  5D6Y A;  2A3L A;  1Y07 A;  2DTO A;  2GFU A;  2QTX A;  3M9Q A;  4QQG A;  5GAN 5;  2OTJ T;  4ELZ C;  4Y91 A;  2PVD B;  3SWN C;  3GIB A;  4BUG A;  2A7Y A;  3OQ5 A;  1N6A A;  2DTH A;  4ZN1 A;  1U8R A;  4M75 D;  5LJ3 d;  1YI2 A;  2XI9 A;  2O4X B;  1KC8 U;  2KAF A;  2CKK A;  1WJR A;  1Y96 A;  3J7A F;  4M78 A;  3I56 A;  5J26 A;  4M7A G;  2OTL A;  3LGF A;  5I2S A;  5GMK l;  4NOY A;  1Y7X A;  3M55 A;  3J81 E;  4F7U G;  4N0A C;  2E6Z A;  1YJN A;  3CC2 T;  3H8Z A;  1BI2 A;  3PNW C;  4M77 E;  5LJ3 h;  2XDD A;  2ZZD A;  3CME A;  1VQN A;  2V8K A;  4RG2 A;  3CMA T;  2EJF A;  2RK1 A;  3QII A;  2D0Q B;  4KUL A;  1X01 A;  5C0M A;  1K8A C;  4R56 A;  2GQV A;  2KK4 A;  2DK3 A;  4OMF B;  4QVZ A;  3FEO A;  4C92 A;  2CZ6 B;  3P8D A;  1NJI U;  4C92 F;  4DA4 A;  4VUB A;  3I55 T;  4RCB A;  1UGS B;  2EJ9 A;  1XQH A;  2CZ1 B;  2DXT A;  4PJO A;  3JB9 J;  3M58 A;  4LD6 A;  3PIP A;  2FYK A;  2ZPH B;  4D6W A;  3M56 A;  3Q1J A;  2B8A A;  1FWZ A;  2VV5 A;  1VQ7 A;  4OF1 A;  3UT1 A;  4EPC A;  3RMQ A;  5GAO p;  3OYA A;  1UB4 A;  1BKB A;  5IAY A;  3RIR A;  5CAI A;  2D6F A;  2RA2 A;  2V8I A;  3LYI A;  1BI1 A;  2R5A A;  2L5Q A;  3RKX A;  5GAO q;  1WJS A;  4C0D B;  4C8Q D;  3LWH A;  1YCY A;  3M5A A;  3JCM c;  2E5Q A;  1I81 A;  3OYM A;  1M1G A;  2R58 A;  1BIA A;  1QP3 A;  4FU6 A;  4F7U E;  4HT8 A;  4C8Q B;  1RI0 A;  4GY5 A;  2F5K A;  1NPR A;  1U1S A;  3PT9 A;  3G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...