4M75A

Crystal structure of lsm1-7 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
139
Chain Sequence
DLYLDQYNFTTTAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 23
structure length 139
sequence length 141
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75A00
1KQ1A 5LJ5j 4J5YA 3BDUA 4M7DE 2DXUA 5LJ3e 4Y91A 4OP0A 1MGQA 1N9RA 2JN0A 2FB7A 5GANe 1JBMA 4A53A 4M75B 2EJGA 5GAMh 4M7DA 3AHUA 4M77G 4M7AE 3JCMP 4M7AD 4XTZA 5GAOq 4RCBA 2K57A 1H641 4F7UB 4HT8A 4M7AF 1LOJA 4M7AA 1M5Q1 1B34A 3BW1A 3JCMb 5LJ5e 5GAN3 5GMKh 3BFMA 2DTHA 3HFOA 4XQ3A 5LJ3j 3JCMf 4M78C 2RM4A 4EMKC 4M75G 2DVEA 3L1AA 3V8LA 5GANj 4M77B 2DJZA 5GAMe 4NL2A 4F7UG 4XU1A 2YLCA 5LJ3d 3JCMh 2E65A 4M78D 4A54A 4X9CA 4PNOA 3SB2A 4C92B 4M78E 5GMKl 1D3BB 1D3BA 1HK9A 4M78F 4M78B 4J6XA 4M78A 1KQ2A 4EMKA 4XTXA 3JB9D 1I4K1 2FYKA 2DTIA 4M7DF 4XU0A 4M7DB 2DEQA 2EAYA 5LJ5g 5LJ5d 1I8FA 1WQWA 4EMGA 1JRIA 5GAMj 3JB9F 2RD1A 4C92G 5GAN8 4J6YA 4M7AB 1B34B 4MMKA 3GIBA 5GMKi 4V2SA 5GAOm 1WNLA 3RERA 4PJOC 3FJPA 4M78G 1WQ7A 5GAN7 3V8JA 2EJFA 3RESA 5GMKj 4M7DG 3V7CA 3V7SA 3RKWA 2I2LA 1I5LA 2HNIA 2DZCA 2DZ9A 4PJOD 1LJOA 3JB9G 5LJ3g 4PJOE 4M7AG 5I21A 3JCMW 4MMLA 4JUVA 2DXTA 1LNXA 4HA8A 5GANg 5GANd 1BIBA 3QUIA 4PJOF 4XTYA 2YLBA 4JLIA 4XU3A 4PJOA 4EMKB 5GMKe 1U1SA 3EFSA 3JCMJ 1HXDA 5GAOn 3QSUA 4XTWA 2E1HA 5GMKm 4JRIA 3PGGA 3HFNA 4X9DA 4C8QC 3INZA 3M4GA 1M8VA 2VC8A 5LJ5f 1Y96A 2EWNA 4EMHA 1BIAA 4NL3A 5DY9A 3SWNC 3JCMe 2Y90A 4M75C 4N0AC 4NOYA 5GAMg 1U1TA 4C8QD 5GAMd 2VXFA 3RKXA 3JCMV 3JB9H 4C8QE 4XTVA 2CGHA 1TH7A 5GAN4 3JCMc 4C8QF 2E10A 4M75D 4C8QA 3JCMQ 3FB9A 3QO3A 4M75E 4XU2A 4QVCA 2E64A 3SWNB 3SWNA 5CAIA 5GAOl 4M75F 4WF2A 5LJ3f 4PJOB 4M75A 2DTOA 4N0AA 4F7UE 5GAOr 3BY7A 5GAN6 3V7RA 4M77C 3RKYA 5GANf 4F7UF 3JCMX 4J6WA 3FIFA 2ZGWA 4F7UA 5GAN2 3JB9I 4JRKA 3RIRA 4C92C 5LJ3h 4C8QG 3JCMg 3V8KA 3JCMd 3HSBA 4HT9A 4QVDA 2EJ9A 3EFRA 5GANh 2E41A 4M77D 3L2ZA 1Y96B 4M77E 2QTXA 1WPYA 1X01A 2VXEA 4PJOG 3RUXA 4C92D 5GAN5 5GAOp 3JB9J 1N9SA 3QHSA 4XTUA 4M77F 4C92E 4M7DC 2DKGA 2YHTA 4M77A 3VU3C 4DQ2A 2RB6A 4M7DD 5LJ5h 1I81A 4C92F 4C92A 5GAMf 4M7AC 4RCCA 2RA2A 1YCYA 4C8QB
chains in the Genus database with same CATH superfamily
1VQ7A 4J9DA 4OGEA 4M7AD 3DB3A 4JRQA 4XTZA 2VGMA 2GFUA 1NE8A 3CCMA 3PE0A 3CCVA 3FRNA 1O75A 1NZ9A 4C0ZA 2K5LA 2GF7A 5CKEA 5GANj 1M8MA 3OS5A 2SEMA 4GY5A 3DB4A 4J83A 1X6BA 3LWHA 4M78F 2DNUA 3FDRA 1I4K1 3E9FA 2YRDA 3I5RA 2IIMA 4M7AB 2CYZB 3OYNA 3GIBA 4V2SA 1TUCA 2DL4A 4AFQC 1VQKQ 2KYMA 3V7CA 3RKWA 2AK5A 2RHUA 1YHQQ 1UHCA 2LMJA 1K73R 2KXDA 1N8RR 5DLQE 4HA8A 4IUUA 4XTYA 2BIVA 4J7IA 3EFSA 3VS7A 2DJQA 4KGXB 2ZAEA 4PJJA 4C8QC 8AT1B 3DLMA 3FJ5A 5DY9A 2YT6A 2A28A 3QKJA 5KYXA 2L8DA 2V8KA 2HBWA 1VQ7Q 2M02A 2O4XA 3QO3A 4KH0B 3CMAA 2IPOB 5CAIA 2JVVA 1V76A 3MO8A 4X34A 3BY7A 2K3XA 4OMLA 3CCMQ 4OGCA 1UGRB 5FRMA 1Y0MA 3OYGA 5CO7A 3CCVQ 5FU6C 2E41A 3L2WA 5GAN5 2LQWA 3RUXA 2LRQA 4XTUA 3SDZA 2YHTA 3H8ZA 4FSXA 1WHHA 4AG1C 3MCAB 4OMFB 2XD0A 4LN2A 1N9RA 5GANe 4DBRA 1LOJA 1WXBA 1ZQ1A 2DTHA 1VYTA 1SSHA 3CCUT 1K73C 2DAQA 3RBBB 1N8RC 1RACB 2MWOA 3OYAA 2CP7A 4HCKA 4MDXA 4J6XA 4KBMB 1QVPA 4EDUA 4CC2A 2RHYA 3EGXB 2EAYA 1X43A 2EBPA 2LCSA 4C92G 1OPLA 4J6YA 5CK9A 3OYEA 1H92A 3TEEA 3H0HA 2QDLA 3CMAQ 3G4ST 3VS1A 2KRMA 2P4TA 3U23A 4MZTA 2NWMA 2MAMA 2ROLA 1YI2A 1V29B 2KT1A 3LWIA 2OJ2A 3JCMe 5I22A 4M75C 4BI4A 3VS0A 3QJ6A 3JB9H 1NG2A 4KULA 2DL7A 4C8QD 1UGPB 2JTEA 3SD4A 3I56T 2COWA 1VQ9T 5EG2A 1AT1B 3L42A 1SKUB 2LQKA 2I0NA 1OX9A 5CCAA 3OBYA 3UATA 4JJNK 2VVKA 4PLLA 3OSVA 3GPLA 3CC2A 3JB9I 3CCJA 3D7SB 3JCMg 3VKIA 2CP5A 3AT1B 5GANh 1M1KR 3EG9A 1D09B 1PHTA 3EGDA 3J7AF 1YJ9Q 4OMNA 4UC4A 4LD9K 4LDYA 1KD1U 4C8QB 4E2FB 2F2VA 5FWCA 2JN0A 2ZCFB 4FT4A 1JBMA 3G71A 3O5ZA 2LCCA 2DD5A 2K9GA 5FWBA 3HFOA 3VS4A 1BI2A 1PNJA 2FZGB 2E65A 4M78E 2VASA 4FIBA 5FU6B 2DILA 3C94A 1VIFA 4M78B 4LDXA 1YBYA 2DX1A 2FYKA 4Q5WA 1YI2Q 1WIEA 1GL5A 4C5HA 5LJ5d 1Y7XA 3L2VA 2RF0A 1R0CB 3JB9F 2YUNA 2L3SA 1N6AA 1WGSA 4ZNXA 2L5QA 4PJOC 1UDLA 1WQ7A 1VQ5A 2DETA 3LW5E 1M1GA 2HNIA 2JUFA 1VQ4A 4N4HA 1R77A 4JUVA 4J9GA 1FMVA 3ASKA 1VQ8T 3CC2Q 2JNGA 3CCJQ 4ME7A 2E6ZA 3TSWA 1M1KC 3PGGA 3OB9A 1QVFS 2M0OA 3M4GA 1LCKA 3QYGB 1BIAA 4PK4A 1I0CA 4FYXB 1ZHIA 1G3YA 2GQVA 3CBOA 1WHJA 5FROA 1X6OA 1KJWA 1MMAA 4M75D 1SRLA 5A0LA 4XU2A 5KYNA 3G71Q 2DTOA 2RQRA 1RABB 1KSWA 1VQ6A 4C8QG 2WACA 5LL6S 1WLPB 2WSFE 3L2ZA 4II1A 3CPFA 4XAXB 3NHNA 4AFUC 5IAYA 2DKGA 1SG5A 4RG8A 4F14A 4ATOA 4RTZA 2QQAA 4LDWA 3QWXX 4QKUA 6AT1B 1YJNT 2YWWA 2MOXA 3OYDA 3X28B 1UJ0A 2RJFA 4M75B 4JJDA 4M7DA 1E6HA 1M1FA 4PJNA 3CPWA 2FEIA 3LLRA 5KYUB 3MP8A 2LX7A 4HCZA 2KXCA 2RO0A 2EVRA 3MPUB 4A63B 2E70A 4LUEA 5IH2A 2RNAA 4C5GA 1ZUKA 1X27A 2RI3A 3ZEHA 2C06A 1VQ4Q 1KHIA 3NFCA 3GP8A 2L2PA 1QVFP 1RI9A 1YWOA 2L3RA 2P0QA 4KH1B 1MNEA 2SRCA 1Q81U 1PCXA 2MK5A 5FW9A 1BK2A 4L59A 1YIJT 4PJOD 4K11A 2C0TA 3WVDB 3CCRA 4JLIA 1U8RA 2LC4A 2JMAA 1VQ6Q 1LVKA 4D6WA 2YXYA 3QDRB 1NBEB 2K6DA 1PD0A 1QCOA 2HBPA 3SEMA 2KBTA 3C0CA 4J9FA 2JOYA 2QQ9A 3RR6A 4IKFA 2YUOA 1YP5A 2OTJT 1WI7A 2EYYA 2CUDA 3JSCA 4DBQA 4F04B 3SWNA 4PJOB 3VYGA 1M3AA 4R56A 4PFOA 1K8AR 1N8RU 1OX8A 1XJWB 4PFZA 1GRIA 4QVDA 2XHCA 2MCNA 2DL3A 3UDCA 1YJWT 1KD1R 1GBRA 1WDXA 2JTFA 1I81A 4C92F 5GAMf 3PTAA 4RCCA 2RA2A 1GFDA 4A4HA 2QEXA 4RCBA 2XU8A 2K57A 2GTJA 4M7AA 3HRTA 2QQRA 2EGCA 5LJ5e 4C5IA 4F16A 1S72T 2AZVA 1WHGA 3QPHA 2RM4A 2K3BA 1OZ2A 1C0MA 3CCRQ 8ATCB 2PUOB 1XQHA 1FXXA 2DEQA 5LJ5g 2FPFA 5GAMj 1H8KA 2RJEA 1PKSA 2GQIA 2KVQG 1T0JA 3LH0A 1IZ6A 4EPCA 2DXTA 5GANd 1K8AC 2R57A 2PVOB 2YLBA 4Y28E 2W10A 2G3RA 1D1AA 3QXEB 2BKDN 2RN8A 1TSFA 1Q82R 3CMEA 4XTWA 1IO6A 1EIFA 1M8VA 5CQXA 3ME9A 1KD1C 2Y90A 4WCIA 4RKUE 5KCHA 2Y4XA 2H3JA 3FB9A 2P0PA 3GNFB 1M4ZA 4X1VA 4FCYA 3DLLA 4KGZB 3I5SA 5GAOr 2QEXQ 4LDVA 4YTLA 2L89A 1T3SA 3RIRA 1G2BA 1QKXA 3HSBA 1AZEA 2DIQA 1QVGS 2YRCA 5HY6A 4E7ZA 1WPYA 2VXEA 3QHSA 3I55T 4M77F 1UE9A 5LJ5h 1AEYA 1B3QA 2F5TX 4BB7A 1Z9ZA 2CT3A 4A4KA 1RAAB 3EGXA 4JRPA 2HL3A 1UGVA 2K2MA 4A4EA 5IXBA 4F7UB 1KQSA 2QQBA 4CC4B 1W2BA 4EMKC 1NYGA 3THKA 3FEOA 1IRXA 5GAMe 2QTVA 1MMDA 2YLCA 1G5VA 1KQSS 1TG0A 1D3BA 2DFUA 2CZ1B 1Q82C 2E5QA 4IURA 2AZSA 1D0YA 3CMEQ 5I11A 2NYSA 3G6ET 1I8FA 4KUIA 1KFZA 5AT1B 1JQQA 1BKBA 3HRSA 4HCCA 1Q81R 4JS4A 2HCKA 2RPNA 1P92A 4M7DG 4PJLA 2AKKA 3V7SA 1KC8U 1LJOA 4N4GA 4E7JA 2VB6A 3J80E 1KHCA 1QVGP 2VV5A 1QWFA 2IVWA 2QAZA 3PFSA 3HKSA 3T9NA 3HL8A 1FX7A 1ZLMA 1VQOT 3L2UA 3S3OA 2E1HA 1CKAA 3VS6A 1V1CA 2RQUA 1ZBJA 2EWNA 4EMHA 4ZTJA 4RTWA 5EC7A 1W4SA 1BYMA 1YCSB 5GAN4 1TH7A 3CC4Q 1NLOC 4C8QA 1VYUA 2E64A 3PVQA 2HMAA 1C6VX 1N5ZA 4QVZA 1KK7A 3JCMX 4J6WA 1YITA 2FZKB 1VQ8A 2NUTB 2J6OA 4BDYA 2M0YA 4OMPA 2EJ9A 2HQXA 1VQPT 2DD4A 1UECA 2E3IA 4ELZC 3F70A 5GAOp 4C92E 9ATCB 1K9MU 2BE9B 1M2OA 3PIOA 5IHIA 4J5YA 1TTHB 3ULRB 2NLUA 2DRKA 1UFFA 3VUBA 2DLPA 1MGQA 3M59A 5GAMh 1PRLC 4C0GA 4E7KA 1VQLA 2EYWA 3ZL7C 2D9TA 1Q81C 1ZUUA 2NUPB 2X3WD 2DERA 4M78C 4C5EA 2DVEA 5C0MA 1WJSA 2KE9A 1NYFA 1W6XA 2BUDA 1JU5C 2BTTA 4RUGA 3JRZA 2QQSA 3CBPA 4MZMA 1KQ2A 1QCNA 2DTIA 4DOVA 3OYIA 2XICA 3NPFA 2CZ6B 3HPWA 2ZZDA 5GMKi 2EQUA 4C0FA 3CCQA 4FW1A 1AOJA 4BE2A 1ZSZC 1OEBA 1PSFA 3UF4A 4M7AG 4DBHA 5GANg 2DXCA 2LNHB 2RQVA 4EMKB 1YITQ 1CKBA 2GGRA 3CXCA 2XKOC 1VQ8Q 1IREB 1RLPC 4HKEA 5GAOn 3M0TA 4RTXA 2H8HA 2O2OA 2HQHA 5IHKA 3IQLA 1NEGA 2EGAA 3RKXA 1VOMA 3L2QA 1ZX6A 4J9IA 4QT7A 3CCSA 1YIJA 1D0XA 2KMTA 3EHRA 4QQDA 1VQLQ 1K1ZA 4M75A 1MHNA 2X3XD 5KYUA 2XIDA 1DJ7B 4VUBA 3M57A 3EHQA 1NJIR 1R0BG 1G3TA 4M77E 2JT4A 1HSQA 3M0QA 5CKBA 4WTOB 2EGEA 3OYKA 3URGA 1VIEA 2D6FA 3OYFA 3TQ7P 1JXMA 2V8IA 3MEVA 4OP0A 4RTYA 2EQJA 3RMQA 5A2QE 2LQ8A 4JJBA 2HDAA 1K8AU 3CCQQ 1VQKT 2EYZA 4RTVA 4ELYC 1IB8A 2Z0WA 2ZPFB 1YHQT 3MJXA 5LJ3d 3X26B 1TXQA 5GJVB 4M78D 2HKQB 4A54A 5L8RE 7AT1B 3EG0A 4OB3B 3N5BB 1VQMA 1WQWA 1OU9A 1X69A 5GAN8 2FL7A 2GBQA 1YWPA 2X4XA 1KC8R 1OQKA 3FJPA 2KT8A 4LDUA 1Y57A 4DOWA 1WXTA 2KRNA 3CCSQ 4L6V5 1UG1A 1YIJQ 2KYBA 3A8LB 3M58A 3OA6A 1UHFA 1LNXA 3QG1A 3CCEA 2CSIA 3TSZA 2OAWA 5HK3A 4PJOA 5KYYB 3CCMT 1NJIC 1PKTA 4FYYB 1RUWA 3PNWC 2XI9A 1WHKA 2LZ6B 2CP2A 1G83A 4CC3A 1G3WA 2X9HA 2DEUA 1WHLA 2M9UA 2ESWA 1JJ2A 2JM8A 4AT1B 5LJ3f 5A0DA 1WYXA 1ZSZB 3FIFA 5GAN2 3HRUA 3PMIA 2FPEA 3A1PA 2M51A 2LQNA 1TU0B 1K9MR 1Q82U 1YNZA 3H0FA 3PMTA 2OTLT 3KXTA 2FHDA 3CQTA 3EGUA 3E1SA 1ZA2B 1VQMQ 3OW2A 1SEMA 2P4RA 3AHUA 1TUGB 1KC8C 2HEQA 3MKDA 1M5Q1 4OB2B 2A7YA 2LTOA 4B6MA 3SFMA 2JW4A 5LJ3j 3H0IA 4J9BA 3L1AA 1QP2A 1UEBA 3MHXA 2JZ2A 3CCEQ 2KSSA 2X4JA 2QA4T 3EG1A 2L3PA 3CCLT 4MDWA 1X2QA 1A0NB 3NMZC 3NTHA 2V26A 1B34B 1RI0A 4M78G 1UTIA 1VQ5Q 5ECAA 3CPWS 4C0DC 1PSEA 3MEUA 1WA7A 3JCMW 2ENMA 1BI3A 1OZ3A 1BIBA 3P8BB 3EG3A 2RI2A 1PM3A 2F1LA 3OMCA 4J8OA 3EG2A 1M3BA 4IIMA 1K9MC 2KI7A 3G6EA 2VC8A 2LNVA 1RL2A 4KUDK 2JXBA 1MV0B 2DRMA 4N0AC 5GAMd 3JCMV 1YJ9T 5FRNA 5I2MA 3SHWA 4JZ3A 4BE1A 2ABLA 2MMPA 3M55A 4D8DA 4ZGDB 4WF2A 1JO8A 5D6XA 4F7UA 5HK0A 5J3BA 3V8KA 5CIUA 2XMFA 4ZN1A 1RLQC 1ACMB 2VWFA 4HT9A 1ABQA 4RTTA 1ZUYA 2CP6A 1QW1A 2LVMA 3OS2A 5LJ3e 2EFIA 2MI6A 4GLKA 1G8XA 3A8MB 1YI2T 1K76A 2HAXA 1XNIA 4J9HA 2KQWA 2X4YA 2EYQA 1B7TA 4IIOA 1H641 4M7AF 4E47A 3CPWP 1I5OB 1RAFB 2XK0A 4XQ3A 5GJWB 3UT1A 4M75G 5DLOA 4A4GA 2EIFA 1QKWA 1OV3A 4LNPA 4PNOA 1RADB 3MEAA 2MF2A 1HJDA 3CC2T 2E6NA 4XTXA 3CCJT 3JB9D 3A8HB 4FM4B 2GNCA 3G6EQ 4LUDA 1OI1A 3CEYA 3M5AA 3RERA 2RHIA 3V8JA 5GMKj 1OULA 5CKHA 2I2LA 5IT9E 2J06A 1AWWA 3VS2A 3G71T 3VRYA 1WFWA 1FMKA 2PVGB 1U1SA 2YDLA 2NUTA 3QSUA 2QASA 2RJCA 1B07A 2CH4W 3RMSA 5KH6A 2KEAA 4E7HA 2VXFA 3REAB 3DKMA 1KG1A 1SF9A 2EQKA 3CCUA 2FVUA 2DMOA 3JCMQ 2LP5A 2NUZA 2OX7A 1GCPA 1BI1A 2JS2A 1QMCA 5GAN6 2BE7D 2RH2A 2E4HA 3WXMB 4OVAA 4JRKA 4C0DB 2NUPA 5LJ3h 4C92C 4BD3A 2F2XA 4FYVB 1TUDA 1Y96B 4PJOG 3OS0A 3VU3C 4DQ2A 2X35A 1HD3A 1GFCA 3GF5A 1IGUA 3VRZA 1ZBXA 4QQGA 1YCYA 4AFZC 3BDUA 4M7DE 4R0KA 2JM9A 1M27C 4NS5A 1QLYA 4CC7A 3G4SA 3QBYA 1M2VB 5GAOq 2RK1A 4PL6A 1RAGB 3QWYA 3TREA 2CH4A 1GCQC 5IN1A 3H9NA 2O9VA 3VS5A 2HSEB 2HKNA 3RNJA 1NJIU 4ZN3A 3L2RA 4QW2A 1WXUA 2DK3A 1N27A 4KGVB 3OY9A 3I56A 1G3SA 1VQ9A 3TU4K 1VQ6T 4EMKA 2FRWA 3VV0A 1AZGB 3LH5A 1E6GA 1R8OB 1NLPC 3VS3A 2LT1A 2V8JA 5FU7C 2WSCE 3RDVA 2JTMA 2KRSA 1RAIB 1Q86R 2QXFA 1I5LA 2IG0A 3CCUQ 1MMGA 4BE0A 3JB9G 1IHVA 5I21A 1Z9QA 3LYIA 2B8AA 4J9EA 3QIIA 1GBQA 1W2BS 4PKCC 2DL8A 2EQMA 3JCMJ 1SSFA 1VQNT 1HXDA 1JEGA 5GMKm 1FYNA 4JPBW 3INZA 3KUFA 4LXCA 4NL3A 1D0ZA 1SPKA 4ESRA 5GAMg 2E12A 5M9OA 3CC7T 3M0PA 4C8QF 3EFOB 2FPDA 3SWNB 3G4SQ 2EYXA 3EAEA 1MNDA 4M77C 2LX9A 2CSQA 4B9XA 5KCOA 1PD1A 4JZ4A 2F5KA 1Q7YR 2DIGA 5KE3A 4Z02A 5KYWB 2KK4A 4C92D 1AWOA 1H3ZA 2D8HA 2LDMA 3CCRT 3I56Q 1UB4A 1VQ9Q 1KQ1A 1LPLA 3E2UA 1U5SA 2ZPGB 4OB0B 2FB7A 1PRMC 3QJYA 4A53A 4M7AE 1BBZA 1W70A 4IUTA 5A0GA 2KR3A 4RTUA 4M4ZA 1UGSB 3BW1A 4AMCA 1Q86C 5GMKh 2VYTA 3X20B 5DM7R 1RAEB 3JCMf 1KQSP 2Y4YA 3HTRA 4IUVA 5HKCA 1AHJB 1W2BP 2COZA 4XK8E 5CQYA 4F7UG 2OTLA 4C92B 1VUBA 1TOVA 2MIOA 2CUBA 2LJ1A 4DEXA 3X24B 4M78A 5KYYA 2R58A 3M0RA 2GTOA 2F2WA 1VA7A 4TVRA 4L5GA 5HCKA 2EKHA 3OYLA 4EIKA 2X4WA 2K5FA 1U06A 3LGFA 1JB0E 1EZZB 4DEYA 2CP0A 3BE3A 3KFVA 2DM1A 1NM7A 2DZ9A 2CZ0B 2K4YA 3O8VA 2QK0A 2QEXT 3QUIA 1M90U 2EW3A 1YJNA 2HSPA 5D6YA 2QA4A 1CSKA 1ZSZA 1Q7YC 1H3HA 4ZGEB 2A3LA 3CCLA 4E6RA 1K9AA 4GBQA 2KGTA 2ED0A 4DBFA 1T3LA 4XTVA 4KRTA 1NPPA 2CGHA 2E5KA 2V1RA 3X25B 4KT0E 4PLIA 5FU7B 2FO0A 1J3TA 4M75F 4FSSA 3RKYA 2G6FX 1O9SA 2ZGWA 4JS5A 2JMCA 3R6NA 2ZPHB 3OYHA 3FC3A 3QYHB 4M77D 3TVTA 5CR2A 2DBMA 3FLGA 1X6GA 2OTLQ 3CD6T 3CXCS 1ARKA 1YJ9A 3LGLA 2F69A 4E7IA 3OYJA 3LX7A 1AWXA 1T0HA 5IXFA 3CMET 1XOVA 3OS1A 3J81E 1B34A 2RHZA 2RK2A 3BFMA 1BI0A 5CKDA 3GBQA 2ED1A 3A5ZB 4M77B 4E7SA 4GLMA 4OMQA 4LD6A 1GXIE 1IHWA 2XDPA 3GOXA 2EKOA 1D3BB 3OBWA 1YJNQ 1HK9A 2QA4Q 2OTJA 1SHGA 2AIRB 3UA7A 3VUZA 3NTKA 3CCLQ 5I2SA 2CT4A 2O9SA 4MMKA 1ZSGA 2XDBA 1WNLA 3OMGA 4O5VA 4B9WA 2D0QB 1QQJA 1OOTA 2DBKA 2ZPIB 3CC4T 2BZXA 1X75C 2DZCA 1YJWA 2DL5A 3H41A 5IHNA 4PJOF 2KY9A 3A98A 1Y07A 5AYFA 3GLXA 2K7AA 4Z8AA 2DYIA 4X9DA 4D8KA 4FW2A 3CXCP 2VKNA 1S72A 1I07A 2CKKA 4C8QE 3WVEB 3HHTB 5C6SA 1VQ7T 3ZBDA 1WZOA 2OI3A 2KROA 2QG9B 1F1BB 2A36A 3BDLA 2XDDA 4RG2A 3ZFJA 3OSSC 3CCVT 1S1NA 2D0NA 2LCLA 2X51A 4F17A 1D1CA 2HQEA 2AT1B 1N9SA 1JXOA 4J7FA 1UJYA 1PWTA 1WJQA 3I35A 1WX6A 2ECZA 2RB6A 5KYXB 2FG0A 4ANJA 2LJ0A 3S3MA 3JAME 2O4XB 2OTJQ 4Y91A 5J39A 4M77G 3ER0A 4HT8A 5KE2A 2GFAA 3JCMb 1SHFA 2VUBA 1JJ2S 3QDFA 2L0AA 2CS7A 4HXJA 4BY6C 5D7UA 1YN8A 3V8LA 2DPPB 1YJWQ 2RI5A 4NL2A 3JCMh 1QVFA 4JLGA 2JS0A 2C0OA 2PNIA 3S6WA 1YITT 4M7DF 4XU0A 3HP9A 1EX4A 2YSQA 3CBMA 2COYA 2QI2A 2MPXC 1NEBA 1FWZA 3Q1JA 1AVZC 1S72Q 4OB1B 3OYMA 2EJFA 1QCFA 2FZCB 3MP1A 1W1FA 3OW2S 1XTDA 3I9QA 1QP3A 1M90R 2K5IA 4Y92A 3CMAT 3I55A 2QYZA 1VQLT 1TS9A 1BCOA 2KDSA 2GCXA 4Z89A 4LE9A 3HFNA 1UUEA 3M53A 5J26A 2MWPA 5LJ5f 2EPDA 2ROTA 1Y96A 2VGNA 3P8HA 1M30A 2O88A 3M54A 1C1AA 1Q86U 4M75E 3OYYA 5GAOl 4FU6A 4BDZA 4N0AA 2PQWA 2OAUA 3REBB 1JJ2P 4O6JA 2XG8D 3V7RA 1M2VA 2BZ8A 4F7UF 1E7OA 1MMNA 2CP3A 2DE0X 5L23A 4OMOA 1VQNA 3CCQT 2CZ7B 2WSEE 3EFRA 3P8DA 4M7DC 1AWJA 3CC7A 4FT2A 5LJ5j 4JDSA 3UPUA 2EJGA 1TWBA 3EH1A 2ATCB 1KIKA 1ABOA 3OW2P 1VQOA 2J05A 2LJ3A 3EG9B 1PC0A 3PT9A 2RHXA 1M90C 2K3YA 3EGDB 2MYSA 1OPKA 3TCJA 3CCST 3VYHB 1Q7YU 3I55Q 4XU1A 1Q95G 4AFSC 4X9CA 3SB2A 2PVDB 4Z88A 1K0XA 3EH2A 1WJRA 3E19A 1WHMA 4N4IA 1RAHB 4HVUA 4EMGA 1JRIA 2K79A 2AKLA 3G1JA 2PUKB 5GAOm 2D1XA 3VJPA 1VQPA 4A4FA 3RESA 4BI3A 3OQ5A 3UWNA 2AHJB 2H3EB 5LJ3g 4PJOE 4HVVA 3EFOA 4MMLA 4PFPA 2LT4A 1K73U 4BY6B 2M1HA 4MZPA 1VQNQ 2O31A 2QDYB 2A0FB 4JRIA 1PG5B 3KBGA 4AG2C 2DO3A 5KYWA 3SWNC 4QQ6A 4NOYA 1U1TA 2K2VA 2W0ZA 4E7LA 1MV3A 4ZTFA 3CC7Q 5FLXE 1IGQA 4OF1A 1VQMT 3M4YA 4QVCA 2J6FA 3PIPA 2J6KA 1Y71A 3M9QA 1UGQB 3MEWA 2RJDA 2M16A 1VQOQ 2J7IA 3PVLA 3GNGA 3NTIA 2A08A 3C12A 2QTXA 3R6OA 3JB9J 2HZYA 5CKFA 2DF6A 3C95A 4OMMA 4DA4A 4J9CA 4CRIA 3CCET 4C92A 4M7AC 4FYWB 4M7DD 2R5AA 1I1JA 4BI8B 1BU1A 2DXUA 1OU8A 1OYXA 2ZPBB 3JCMP 2B86A 2P84A 3OYBA 2KAFA 1M9SA 3MP6A 4HCBA 5GAN3 1K0SA 1VQ5T 1VQPQ 2FRYA 1NPRA 2CREA 1VQ4T 1EFNA 2R5MA 5D6WA 3S3NA 2DVJA 2DJZA 2DYBA 1IXDA 2C0IA 5GMKl 3CD6A 1ZA1B 1AD5A 4PJMA 1GCQA 3META 2P0KA 4ZGJB 1X2KA 4M7DB 2KNBB 4IUQA 2RD1A 3A8OB 3JV3A 3C4SA 4P5NA 5GAN7 2HL5C 4RMOA 3UA6A 2E3HA 1D1BA 3G7ZA 2DA9A 3QZ9B 3OYCA 1QVGA 4IUPA 2QGGA 1QWEA 2PTKA 1MUZA 2CDTA 2HD0A 4XU3A 3QZ5B 2D8JA 1HYOA 1BCMA 5GMKe 1U3OA 2V1QA 2DXBA 1M3CA 1VYVA 2RQWA 2JJ9A 2YUQA 4ORZA 2ZPEB 1FMWA 2QGFB 4HVWA 2YUPA 1VQKA 4JJCA 3M0SA 3JCMc 1K4US 3NGPA 2E10A 3CC4A 3E9GA 2L3QA 4CI0C 4R55A 5CVIA 1YHQA 2RQTA 4BUGA 2YRVA 3M56A 2BZYA 4F7UE 2O01E 1BB9A 5GANf 4BACA 2EQIA 3JCMd 1YFNA 3H6ZA 2PU9B 1SRMA 1X01A 2A37A 4M77A 3A8GB 2RMOA 1M1KU 3CD6Q 2PZ1A 4FL6A 3M0UA
chains in the Genus database with same CATH topology
3OYJA 3LX7A 3E1SA 1VQ7A 4A4HA 4OGEA 3CMET 1XOVA 4M7AD 3DB3A 4JRQA 3OW2A 3AHUA 2QEXA 4XTZA 2VGMA 2GFUA 4RCBA 2XU8A 1NE8A 2K57A 3OS1A 1KC8C 3CCMA 4M7AA 1M5Q1 1B34A 3HRTA 2QQRA 4OB2B 3J81E 2A7YA 2LTOA 2RHZA 4C5IA 5LJ5e 2RK2A 3BFMA 1S72T 3SFMA 3CCVA 1BI0A 3FRNA 5LJ3j 3QPHA 1O75A 1NZ9A 2RM4A 2K5LA 4C0ZA 5CKDA 3L1AA 2GF7A 1OZ2A 5CKEA 5GANj 3A5ZB 1QP2A 1UEBA 4M77B 3MHXA 4LD6A 1GXIE 3OS5A 2XDPA 2JZ2A 4GY5A 3DB4A 2EKOA 3GOXA 4J83A 1D3BB 5FRMA 2KSSA 2X4JA 3OBWA 2QA4T 1HK9A 3LWHA 4M78F 2OTJA 3FDRA 2PUOB 1I4K1 1XQHA 3E9FA 3CCLT 1FXXA 2DEQA 4MDWA 3VUZA 3NTKA 5LJ5g 5GAMj 5I2SA 3NTHA 4M7AB 2CYZB 1B34B 4MMKA 3OYNA 3GIBA 2RJEA 1RI0A 4V2SA 2XDBA 1WNLA 4M78G 3OMGA 4O5VA 4B9WA 2D0QB 2KVQG 3V7CA 3RKWA 2ZPIB 3LH0A 3CC4T 2RHUA 3CPWS 1IZ6A 4C0DC 1X75C 2DZCA 4EPCA 1PSEA 1YJWA 3MEUA 3JCMW 2DXTA 5DLQE 1BI3A 4HA8A 1OZ3A 4IUUA 1BIBA 2R57A 2KY9A 2PVOB 3P8BB 2BIVA 2YLBA 4J7IA 1Y07A 4XTYA 5AYFA 3GLXA 4Y28E 2G3RA 3QXEB 2BKDN 2RI2A 3EFSA 4J8OA 3OMCA 3CMEA 4XTWA 1K9MC 4C8QC 4X9DA 1EIFA 3G6EA 1M8VA 5CQXA 2VC8A 3ME9A 1KD1C 3DLMA 2LNVA 1RL2A 5DY9A 4KUDK 2Y90A 3QKJA 4N0AC 1S72A 5GAMd 3JCMV 1YJ9T 2CKKA 4C8QE 5FRNA 4RKUE 5I2MA 3WVEB 3HHTB 2L8DA 5C6SA 4BE1A 2V8KA 1VQ7T 3ZBDA 5KCHA 1K8AC 2MMPA 2H3JA 2O4XA 2P0PA 2Y4XA 1M4ZA 3FB9A 3GNFB 3M55A 3QO3A 3CMAA 3DLLA 4ZGDB 5CAIA 2JVVA 3MO8A 4WF2A 5GAOr 4X34A 4LDVA 3BY7A 4YTLA 3BDLA 2XDDA 5D6XA 4RG2A 2K3XA 4F7UA 4OGCA 1UGRB 2L89A 3ZFJA 3OSSC 3RIRA 5HK0A 3OYGA 3CCVT 2LCLA 5J3BA 5CIUA 3V8KA 2DIQA 5CO7A 4ZN1A 1QVGS 5FU6C 2E41A 3L2WA 2HQEA 5HY6A 1WPYA 2VXEA 5GAN5 4HT9A 3RUXA 2LRQA 1N9SA 3QHSA 4XTUA 4J7FA 4M77F 3SDZA 3I55T 2YHTA 3H8ZA 1WJQA 4FSXA 2RB6A 5LJ5h 4FL6A 2F5TX 4BB7A 3S3MA 1QW1A 2LVMA 2O4XB 3MCAB 4OMFB 3JAME 3OS2A 2XD0A 5LJ3e 4Y91A 2EFIA 4A4KA 2MI6A 1N9RA 5J39A 4GLKA 3A8MB 1YI2T 5GANe 2HAXA 1XNIA 4M77G 2KQWA 2X4YA 4JRPA 3ER0A 2EYQA 4A4EA 1H641 4F7UB 4HT8A 4M7AF 1LOJA 5KE2A 2GFAA 1KQSA 4E47A 3JCMb 1ZQ1A 2QQBA 2VUBA 1JJ2S 2DTHA 2XK0A 4XQ3A 2CS7A 4BY6C 1W2BA 4EMKC 3UT1A 4M75G 3CCUT 2DAQA 5DLOA 4A4GA 3V8LA 1K73C 2EIFA 2DPPB 3FEOA 2RI5A 1N8RC 2MWOA 5GAMe 4NL2A 2YLCA 3JCMh 1QVFA 4JLGA 3OYAA 1KQSS 1G5VA 4PNOA 3CC2T 1D3BA 4MDXA 3MEAA 2CZ1B 2MF2A 1Q82C 3S6WA 4J6XA 1YITT 2E5QA 1QVPA 4KBMB 4IURA 2E6NA 4XTXA 4EDUA 3CCJT 3JB9D 4M7DF 2RHYA 4XU0A 3HP9A 3A8HB 2EAYA 4FM4B 3G6ET 1I8FA 4KUIA 3CBMA 1BKBA 3HRSA 4J6YA 4C92G 2QI2A 5CK9A 3OYEA 4HCCA 4JS4A 1OI1A 1FWZA 3CEYA 1P92A 3M5AA 3Q1JA 3TEEA 3RERA 4OB1B 3OYMA 2RHIA 3V8JA 2EJFA 3HSBA 5GMKj 4M7DG 3MP1A 3V7SA 5CKHA 2I2LA 3OW2S 1XTDA 5IT9E 1KC8U 1QP3A 2K5IA 1LJOA 3I55A 3CMAT 4N4GA 3G71T 4E7JA 3J80E 3G4ST 1VQLT 4PJOF 1KHCA 2P4TA 2PVGB 2VV5A 2IVWA 4MZTA 3PFSA 1U1SA 3HKSA 3T9NA 3HL8A 2KDSA 1FX7A 2MAMA 2GCXA 1YI2A 1VQOT 3L2UA 3QSUA 3S3OA 2E1HA 2RJCA 3HFNA 1V29B 3M53A 5J26A 2MWPA 3RMSA 5LJ5f 3LWIA 4ZTJA 1Y96A 2EWNA 4EMHA 5KH6A 2VGNA 3P8HA 3JCMe 4M75C 4BI4A 1W4SA 3QJ6A 1BYMA 3JB9H 4KULA 4C8QD 2VXFA 4E7HA 1UGPB 3SD4A 3M54A 5GAN4 1TH7A 3I56T 3DKMA 1VQ9T 1KG1A 5EG2A 2EQKA 3CCUA 2FVUA 3L42A 4C8QA 5GANd 3JCMQ 2LQKA 1Q86U 4M75E 5CCAA 3OBYA 3OYYA 2E64A 5GAOl 4FU6A 4JJNK 4BDZA 1BI1A 4N0AA 2PQWA 2OAUA 4O6JA 5GAN6 2XG8D 3V7RA 4PLLA 2RH2A 3OSVA 4QVZA 4F7UF 3JCMX 3WXMB 4J6WA 3GPLA 3JB9I 1YITA 4OVAA 3CC2A 4JRKA 4C0DB 4C92C 5LJ3h 3CCJA 3JCMg 3VKIA 4BD3A 4BDYA 3CCQT 1VQNA 2EJ9A 2CZ7B 2HQXA 2DD4A 2WSEE 3EFRA 5GANh 1VQPT 3P8DA 1Y96B 4PJOG 4ELZC 3F70A 5GAOp 3OS0A 4M7DC 4C92E 3VU3C 4DQ2A 2X35A 1K9MU 3J7AF 3GF5A 4UC4A 1ZBXA 4QQGA 3PIOA 4LD9K 4LDYA 1KD1U 1YCYA 4C8QB 4FT2A 5LJ5j 4J5YA 3CC7A 3BDUA 4M7DE 2NLUA 4JDSA 3VUBA 3UPUA 1MGQA 3M59A 2JN0A 2ZCFB 4FT4A 5GAMh 4NS5A 1JBMA 4C0GA 3G71A 2EJGA 3G4SA 4E7KA 1VQLA 2D9TA 1Q81C 3QBYA 5GAOq 2RK1A 4PL6A 2LCCA 2DD5A 3TREA 5IN1A 3HFOA 1VQOA 1BI2A 4M78C 3PT9A 2RHXA 1M90C 4C5EA 2K3YA 2DVEA 5C0MA 1NJIU 3TCJA 3CCST 3VYHB 4ZN3A 1Q7YU 3L2RA 4QW2A 2DK3A 1WJSA 4XU1A 1N27A 2E65A 4X9CA 3SB2A 4M78E 2PVDB 3OY9A 2BUDA 4FIBA 1G3SA 5FU6B 3I56A 1VQ9A 1WJRA 3JRZA 3TU4K 2QQSA 3CBPA 1VIFA 3C94A 3E19A 4M78B 4MZMA 4EMKA 4LDXA 1KQ2A 1YBYA 1VQ6T 2FYKA 2DTIA 4Q5WA 3VV0A 4N4IA 4DOVA 3OYIA 1R8OB 2XICA 4C5HA 1Y7XA 5LJ5d 3L2VA 4EMGA 1JRIA 2LT1A 2CZ6B 3JB9F 1N6AA 2V8JA 3HPWA 5FU7C 1WGSA 2ZZDA 2WSCE 5GMKi 2EQUA 2PUKB 4C0FA 5GAOm 2L5QA 2JTMA 4PJOC 1WQ7A 3VJPA 3CCQA 1VQPA 4A4FA 1VQ5A 3RESA 4BI3A 4BE2A 3OQ5A 2QXFA 1I5LA 2IG0A 3UWNA 3LW5E 1M1GA 2HNIA 2JUFA 1VQ4A 4N4HA 4BE0A 1PSFA 3JB9G 2AHJB 5LJ3g 4M7AG 4PJOE 5I21A 4MMLA 4JUVA 5GANg 3LYIA 2LT4A 2B8AA 2DXCA 1K73U 3QIIA 4BY6B 2M1HA 1W2BS 4EMKB 3ASKA 4PKCC 2EQMA 1VQ8T 3JCMJ 1SSFA 2JNGA 4MZPA 3CXCA 2XKOC 1VQNT 1IREB 1HXDA 4ME7A 2E6ZA 4HKEA 5GAOn 1M1KC 2QDYB 5GMKm 4JRIA 3PGGA 3OB9A 1QVFS 2M0OA 3INZA 3M4GA 3KBGA 3KUFA 2DO3A 3QYGB 1BIAA 4NL3A 3SWNC 4QQ6A 1ZHIA 1G3YA 2GQVA 4NOYA 5GAMg 1U1TA 2E12A 3RKXA 2K2VA 3L2QA 5M9OA 3CBOA 4E7LA 5FROA 3CC7T 4ZTFA 5FLXE 1X6OA 4C8QF 4M75D 3CCSA 1YIJA 5A0LA 4XU2A 4OF1A 1VQMT 2KMTA 4QQDA 3M4YA 3SWNB 4QVCA 4M75A 2DTOA 1MHNA 3PIPA 3M9QA 1Y71A 3EAEA 4M77C 1UGQB 3MEWA 2XIDA 1DJ7B 2LX9A 1VQ6A 4VUBA 2RJDA 3M57A 4B9XA 4C8QG 5KCOA 2M16A 2F5KA 2WACA 5LL6S 2DIGA 5KE3A 2WSFE 4II1A 3GNGA 3L2ZA 3NTIA 1G3TA 3C12A 4M77E 3CPFA 4XAXB 2QTXA 3R6OA 4Z02A 2KK4A 4C92D 3JB9J 5IAYA 5CKFA 3C95A 1VQ8A 2DKGA 4RG8A 5CKBA 1H3ZA 4ATOA 2QQAA 4LDWA 4CRIA 4DA4A 3CCET 3OYKA 2LDMA 4C92A 3CCRT 4M7AC 1UB4A 3URGA 1VIEA 1YJNT 2D6FA 3OYFA 4M7DD 1KQ1A 2R5AA 4BI8B 2DXUA 2V8IA 3OYDA 3MEVA 4OP0A 2ZPGB 4OB0B 1OYXA 3X28B 2FB7A 3QJYA 2EQJA 2RJFA 2ZPBB 4M75B 3RMQA 1M1FA 4A53A 4M7DA 4M7AE 5A2QE 3JCMP 3CPWA 4IUTA 3LLRA 5A0GA 3MP8A 2LQ8A 4HCZA 2KAFA 3OYBA 1M9SA 3MP6A 4HCBA 1UGSB 2RO0A 3BW1A 1Q86C 5GAN3 5GMKh 2VYTA 3X20B 2E70A 5DM7R 1K8AU 1VQ5T 1VQKT 3JCMf 4C5GA 4ELYC 2Y4YA 1NPRA 2RI3A 3ZEHA 1VQ4T 2C06A 2R5MA 2ZPFB 4IUVA 1AHJB 1KHIA 5D6WA 5HKCA 3S3NA 2DJZA 1YHQT 3NFCA 4F7UG 4XK8E 5CQYA 5LJ3d 3X26B 2OTLA 4M78D 4A54A 4C92B 3GP8A 5L8RE 3CD6A 1VUBA 5GMKl 4OB3B 3META 2P0KA 3X24B 4ZGJB 4M78A 3N5BB 2R58A 1VQMA 4M7DB 2L3RA 3LGLA 4E7IA 1WQWA 4IUQA 4TVRA 2RD1A 4L5GA 3A8OB 5GAN8 2FL7A 2P0QA 3OYLA 2X4XA 2X4WA 2K5FA 3FJPA 3C4SA 3LGFA 4P5NA 5GAN7 4RMOA 1JB0E 1Q81U 4DOWA 4LDUA 4L59A 3G7ZA 1YIJT 4L6V5 3QZ9B 2DZ9A 3A8LB 3M58A 3OA6A 3OYCA 1QVGA 4PJOD 4IUPA 2CZ0B 2K4YA 3O8VA 3WVDB 1LNXA 2HD0A 3QG1A 2QEXT 3QUIA 3CCEA 5HK3A 4XU3A 4JLIA 3QZ5B 3CCRA 1YJNA 1M90U 4PJOA 1U8RA 5D6YA 2QA4A 5GMKe 3CCMT 2LC4A 1NJIC 1Q7YC 2DXBA 4ZGEB 2A3LA 4D6WA 3CCLA 2ZPEB 3QDRB 3PNWC 2XI9A 2HBPA 2JOYA 4XTVA 1G3WA 2QQ9A 1NPPA 2CGHA 1VQKA 4IKFA 3JCMc 3X25B 2E10A 3CC4A 2OTJT 2M9UA 3E9GA 4KT0E 4CI0C 5CVIA 4R55A 4PLIA 1YHQA 1JJ2A 3JSCA 5FU7B 4BUGA 2YRVA 3SWNA 3M56A 4M75F 5LJ3f 4PJOB 4F7UE 5A0DA 2O01E 3VYGA 4R56A 5GANf 3RKYA 1N8RU 3FIFA 1O9SA 2ZGWA 5GAN2 4JS5A 4BACA 3HRUA 3PMIA 3JCMd 4QVDA 2ZPHB 3OYHA 2XHCA 3H6ZA 3FC3A 3QYHB 4M77D 2PU9B 3UDCA 1Q82U 5CR2A 1X01A 1YJWT 3FLGA 4M77A 3PMTA 2OTLT 3A8GB 3KXTA 2FHDA 1M1KU 3CD6T 2JTFA 1I81A 4C92F 3CXCS 1YJ9A 5GAMf 3PTAA 4RCCA 2F69A 2RA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ1 A;  5LJ5 j;  4J5Y A;  3BDU A;  4M7D E;  2DXU A;  5LJ3 e;  4Y91 A;  4OP0 A;  1MGQ A;  1N9R A;  2JN0 A;  2FB7 A;  5GAN e;  1JBM A;  4A53 A;  4M75 B;  2EJG A;  5GAM h;  4M7D A;  3AHU A;  4M77 G;  4M7A E;  3JCM P;  4M7A D;  4XTZ A;  5GAO q;  4RCB A;  2K57 A;  1H64 1;  4F7U B;  4HT8 A;  4M7A F;  1LOJ A;  4M7A A;  1M5Q 1;  1B34 A;  3BW1 A;  3JCM b;  5LJ5 e;  5GAN 3;  5GMK h;  3BFM A;  2DTH A;  3HFO A;  4XQ3 A;  5LJ3 j;  3JCM f;  4M78 C;  2RM4 A;  4EMK C;  4M75 G;  2DVE A;  3L1A A;  3V8L A;  5GAN j;  4M77 B;  2DJZ A;  5GAM e;  4NL2 A;  4F7U G;  4XU1 A;  2YLC A;  5LJ3 d;  3JCM h;  2E65 A;  4M78 D;  4A54 A;  4X9C A;  4PNO A;  3SB2 A;  4C92 B;  4M78 E;  5GMK l;  1D3B B;  1D3B A;  1HK9 A;  4M78 F;  4M78 B;  4J6X A;  4M78 A;  1KQ2 A;  4EMK A;  4XTX A;  3JB9 D;  1I4K 1;  2FYK A;  2DTI A;  4M7D F;  4XU0 A;  4M7D B;  2DEQ A;  2EAY A;  5LJ5 g;  5LJ5 d;  1I8F A;  1WQW A;  4EMG A;  1JRI A;  5GAM j;  3JB9 F;  2RD1 A;  4C92 G;  5GAN 8;  4J6Y A;  4M7A B;  1B34 B;  4MMK A;  3GIB A;  5GMK i;  4V2S A;  5GAO m;  1WNL A;  3RER A;  4PJO C;  3FJP A;  4M78 G;  1WQ7 A;  5GAN 7;  3V8J A;  2EJF A;  3RES A;  5GMK j;  4M7D G;  3V7C A;  3V7S A;  3RKW A;  2I2L A;  1I5L A;  2HNI A;  2DZC A;  2DZ9 A;  4PJO D;  1LJO A;  3JB9 G;  5LJ3 g;  4PJO E;  4M7A G;  5I21 A;  3JCM W;  4MML A;  4JUV A;  2DXT A;  1LNX A;  4HA8 A;  5GAN g;  5GAN d;  1BIB A;  3QUI A;  4PJO F;  4XTY A;  2YLB A;  4JLI A;  4XU3 A;  4PJO A;  4EMK B;  5GMK e;  1U1S A;  3EFS A;  3JCM J;  1HXD A;  5GAO n;  3QSU A;  4XTW A;  2E1H A;  5GMK m;  4JRI A;  3PGG A;  3HFN A;  4X9D A;  4C8Q C;  3INZ A;  3M4G A;  1M8V A;  2VC8 A;  5LJ5 f;  1Y96 A;  2EWN A;  4EMH A;  1BIA A;  4NL3 A;  5DY9 A;  3SWN C;  3JCM e;  2Y90 A;  4M75 C;  4N0A C;  4NOY A;  5GAM g;  1U1T A;  4C8Q D;  5GAM d;  2VXF A;  3RKX A;  3JCM V;  3JB9 H;  4C8Q E;  4XTV A;  2CGH A;  1TH7 A;  5GAN 4;  3JCM c;  4C8Q F;  2E10 A;  4M75 D;  4C8Q A;  3JCM Q;  3FB9 A;  3QO3 A;  4M75 E;  4XU2 A;  4QVC A;  2E64 A;  3SWN B;  3SWN A;  5CAI A;  5GAO l;  4M75 F;  4WF2 A;  5LJ3 f;  4PJO B;  4M75 A;  2DTO A;  4N0A A;  4F7U E;  5GAO r;  3BY7 A;  5GAN 6;  3V7R A;  4M77 C;  3RKY A;  5GAN f;  4F7U F;  3JCM X;  4J6W A;  3FIF A;  2ZGW A;  4F7U A;  5GAN 2;  3JB9 I;  4JRK A;  3RIR A;  4C92 C;  5LJ3 h;  4C8Q G;  3JCM g;  3V8K A;  3JCM d;  3HSB A;  4HT9 A;  4QVD A;  2EJ9 A;  3EFR A;  5GAN h;  2E41 A;  4M77 D;  3L2Z A;  1Y96 B;  4M77 E;  2QTX A;  1WPY A;  1X01 A;  2VXE A;  4PJO G;  3RUX A;  4C92 D;  5GAN 5;  5GAO p;  3JB9 J;  1N9S A;  3QHS A;  4XTU A;  4M77 F;  4C92 E;  4M7D C;  2DKG A;  2YHT A;  4M77 A;  3VU3 C;  4DQ2 A;  2RB6 A;  4M7D D;  5LJ5 h;  1I81 A;  4C92 F;  4C92 A;  5GAM f;  4M7A C;  4RCC A;  2RA2 A;  1YCY A;  4C8Q B; 
#chains in the Genus database with same CATH topology
 1VQ7 A;  4J9D A;  4OGE A;  4M7A D;  3DB3 A;  4JRQ A;  4XTZ A;  2VGM A;  2GFU A;  1NE8 A;  3CCM A;  3PE0 A;  3CCV A;  3FRN A;  1O75 A;  1NZ9 A;  4C0Z A;  2K5L A;  2GF7 A;  5CKE A;  5GAN j;  1M8M A;  3OS5 A;  2SEM A;  4GY5 A;  3DB4 A;  4J83 A;  1X6B A;  3LWH A;  4M78 F;  2DNU A;  3FDR A;  1I4K 1;  3E9F A;  2YRD A;  3I5R A;  2IIM A;  4M7A B;  2CYZ B;  3OYN A;  3GIB A;  4V2S A;  1TUC A;  2DL4 A;  4AFQ C;  1VQK Q;  2KYM A;  3V7C A;  3RKW A;  2AK5 A;  2RHU A;  1YHQ Q;  1UHC A;  2LMJ A;  1K73 R;  2KXD A;  1N8R R;  5DLQ E;  4HA8 A;  4IUU A;  4XTY A;  2BIV A;  4J7I A;  3EFS A;  3VS7 A;  2DJQ A;  4KGX B;  2ZAE A;  4PJJ A;  4C8Q C;  8AT1 B;  3DLM A;  3FJ5 A;  5DY9 A;  2YT6 A;  2A28 A;  3QKJ A;  5KYX A;  2L8D A;  2V8K A;  2HBW A;  1VQ7 Q;  2M02 A;  2O4X A;  3QO3 A;  4KH0 B;  3CMA A;  2IPO B;  5CAI A;  2JVV A;  1V76 A;  3MO8 A;  4X34 A;  3BY7 A;  2K3X A;  4OML A;  3CCM Q;  4OGC A;  1UGR B;  5FRM A;  1Y0M A;  3OYG A;  5CO7 A;  3CCV Q;  5FU6 C;  2E41 A;  3L2W A;  5GAN 5;  2LQW A;  3RUX A;  2LRQ A;  4XTU A;  3SDZ A;  2YHT A;  3H8Z A;  4FSX A;  1WHH A;  4AG1 C;  3MCA B;  4OMF B;  2XD0 A;  4LN2 A;  1N9R A;  5GAN e;  4DBR A;  1LOJ A;  1WXB A;  1ZQ1 A;  2DTH A;  1VYT A;  1SSH A;  3CCU T;  1K73 C;  2DAQ A;  3RBB B;  1N8R C;  1RAC B;  2MWO A;  3OYA A;  2CP7 A;  4HCK A;  4MDX A;  4J6X A;  4KBM B;  1QVP A;  4EDU A;  4CC2 A;  2RHY A;  3EGX B;  2EAY A;  1X43 A;  2EBP A;  2LCS A;  4C92 G;  1OPL A;  4J6Y A;  5CK9 A;  3OYE A;  1H92 A;  3TEE A;  3H0H A;  2QDL A;  3CMA Q;  3G4S T;  3VS1 A;  2KRM A;  2P4T A;  3U23 A;  4MZT A;  2NWM A;  2MAM A;  2ROL A;  1YI2 A;  1V29 B;  2KT1 A;  3LWI A;  2OJ2 A;  3JCM e;  5I22 A;  4M75 C;  4BI4 A;  3VS0 A;  3QJ6 A;  3JB9 H;  1NG2 A;  4KUL A;  2DL7 A;  4C8Q D;  1UGP B;  2JTE A;  3SD4 A;  3I56 T;  2COW A;  1VQ9 T;  5EG2 A;  1AT1 B;  3L42 A;  1SKU B;  2LQK A;  2I0N A;  1OX9 A;  5CCA A;  3OBY A;  3UAT A;  4JJN K;  2VVK A;  4PLL A;  3OSV A;  3GPL A;  3CC2 A;  3JB9 I;  3CCJ A;  3D7S B;  3JCM g;  3VKI A;  2CP5 A;  3AT1 B;  5GAN h;  1M1K R;  3EG9 A;  1D09 B;  1PHT A;  3EGD A;  3J7A F;  1YJ9 Q;  4OMN A;  4UC4 A;  4LD9 K;  4LDY A;  1KD1 U;  4C8Q B;  4E2F B;  2F2V A;  5FWC A;  2JN0 A;  2ZCF B;  4FT4 A;  1JBM A;  3G71 A;  3O5Z A;  2LCC A;  2DD5 A;  2K9G A;  5FWB A;  3HFO A;  3VS4 A;  1BI2 A;  1PNJ A;  2FZG B;  2E65 A;  4M78 E;  2VAS A;  4FIB A;  5FU6 B;  2DIL A;  3C94 A;  1VIF A;  4M78 B;  4LDX A;  1YBY A;  2DX1 A;  2FYK A;  4Q5W A;  1YI2 Q;  1WIE A;  1GL5 A;  4C5H A;  5LJ5 d;  1Y7X A;  3L2V A;  2RF0 A;  1R0C B;  3JB9 F;  2YUN A;  2L3S A;  1N6A A;  1WGS A;  4ZNX A;  2L5Q A;  4PJO C;  1UDL A;  1WQ7 A;  1VQ5 A;  2DET A;  3LW5 E;  1M1G A;  2HNI A;  2JUF A;  1VQ4 A;  4N4H A;  1R77 A;  4JUV A;  4J9G A;  1FMV A;  3ASK A;  1VQ8 T;  3CC2 Q;  2JNG A;  3CCJ Q;  4ME7 A;  2E6Z A;  3TSW A;  1M1K C;  3PGG A;  3OB9 A;  1QVF S;  2M0O A;  3M4G A;  1LCK A;  3QYG B;  1BIA A;  4PK4 A;  1I0C A;  4FYX B;  1ZHI A;  1G3Y A;  2GQV A;  3CBO A;  1WHJ A;  5FRO A;  1X6O A;  1KJW A;  1MMA A;  4M75 D;  1SRL A;  5A0L A;  4XU2 A;  5KYN A;  3G71 Q;  2DTO A;  2RQR A;  1RAB B;  1KSW A;  1VQ6 A;  4C8Q G;  2WAC A;  5LL6 S;  1WLP B;  2WSF E;  3L2Z A;  4II1 A;  3CPF A;  4XAX B;  3NHN A;  4AFU C;  5IAY A;  2DKG A;  1SG5 A;  4RG8 A;  4F14 A;  4ATO A;  4RTZ A;  2QQA A;  4LDW A;  3QWX X;  4QKU A;  6AT1 B;  1YJN T;  2YWW A;  2MOX A;  3OYD A;  3X28 B;  1UJ0 A;  2RJF A;  4M75 B;  4JJD A;  4M7D A;  1E6H A;  1M1F A;  4PJN A;  3CPW A;  2FEI A;  3LLR A;  5KYU B;  3MP8 A;  2LX7 A;  4HCZ A;  2KXC A;  2RO0 A;  2EVR A;  3MPU B;  4A63 B;  2E70 A;  4LUE A;  5IH2 A;  2RNA A;  4C5G A;  1ZUK A;  1X27 A;  2RI3 A;  3ZEH A;  2C06 A;  1VQ4 Q;  1KHI A;  3NFC A;  3GP8 A;  2L2P A;  1QVF P;  1RI9 A;  1YWO A;  2L3R A;  2P0Q A;  4KH1 B;  1MNE A;  2SRC A;  1Q81 U;  1PCX A;  2MK5 A;  5FW9 A;  1BK2 A;  4L59 A;  1YIJ T;  4PJO D;  4K11 A;  2C0T A;  3WVD B;  3CCR A;  4JLI A;  1U8R A;  2LC4 A;  2JMA A;  1VQ6 Q;  1LVK A;  4D6W A;  2YXY A;  3QDR B;  1NBE B;  2K6D A;  1PD0 A;  1QCO A;  2HBP A;  3SEM A;  2KBT A;  3C0C A;  4J9F A;  2JOY A;  2QQ9 A;  3RR6 A;  4IKF A;  2YUO A;  1YP5 A;  2OTJ T;  1WI7 A;  2EYY A;  2CUD A;  3JSC A;  4DBQ A;  4F04 B;  3SWN A;  4PJO B;  3VYG A;  1M3A A;  4R56 A;  4PFO A;  1K8A R;  1N8R U;  1OX8 A;  1XJW B;  4PFZ A;  1GRI A;  4QVD A;  2XHC A;  2MCN A;  2DL3 A;  3UDC A;  1YJW T;  1KD1 R;  1GBR A;  1WDX A;  2JTF A;  1I81 A;  4C92 F;  5GAM f;  3PTA A;  4RCC A;  2RA2 A;  1GFD A;  4A4H A;  2QEX A;  4RCB A;  2XU8 A;  2K57 A;  2GTJ A;  4M7A A;  3HRT A;  2QQR A;  2EGC A;  5LJ5 e;  4C5I A;  4F16 A;  1S72 T;  2AZV A;  1WHG A;  3QPH A;  2RM4 A;  2K3B A;  1OZ2 A;  1C0M A;  3CCR Q;  8ATC B;  2PUO B;  1XQH A;  1FXX A;  2DEQ A;  5LJ5 g;  2FPF A;  5GAM j;  1H8K A;  2RJE A;  1PKS A;  2GQI A;  2KVQ G;  1T0J A;  3LH0 A;  1IZ6 A;  4EPC A;  2DXT A;  5GAN d;  1K8A C;  2R57 A;  2PVO B;  2YLB A;  4Y28 E;  2W10 A;  2G3R A;  1D1A A;  3QXE B;  2BKD N;  2RN8 A;  1TSF A;  1Q82 R;  3CME A;  4XTW A;  1IO6 A;  1EIF A;  1M8V A;  5CQX A;  3ME9 A;  1KD1 C;  2Y90 A;  4WCI A;  4RKU E;  5KCH A;  2Y4X A;  2H3J A;  3FB9 A;  2P0P A;  3GNF B;  1M4Z A;  4X1V A;  4FCY A;  3DLL A;  4KGZ B;  3I5S A;  5GAO r;  2QEX Q;  4LDV A;  4YTL A;  2L89 A;  1T3S A;  3RIR A;  1G2B A;  1QKX A;  3HSB A;  1AZE A;  2DIQ A;  1QVG S;  2YRC A;  5HY6 A;  4E7Z A;  1WPY A;  2VXE A;  3QHS A;  3I55 T;  4M77 F;  1UE9 A;  5LJ5 h;  1AEY A;  1B3Q A;  2F5T X;  4BB7 A;  1Z9Z A;  2CT3 A;  4A4K A;  1RAA B;  3EGX A;  4JRP A;  2HL3 A;  1UGV A;  2K2M A;  4A4E A;  5IXB A;  4F7U B;  1KQS A;  2QQB A;  4CC4 B;  1W2B A;  4EMK C;  1NYG A;  3THK A;  3FEO A;  1IRX A;  5GAM e;  2QTV A;  1MMD A;  2YLC A;  1G5V A;  1KQS S;  1TG0 A;  1D3B A;  2DFU A;  2CZ1 B;  1Q82 C;  2E5Q A;  4IUR A;  2AZS A;  1D0Y A;  3CME Q;  5I11 A;  2NYS A;  3G6E T;  1I8F A;  4KUI A;  1KFZ A;  5AT1 B;  1JQQ A;  1BKB A;  3HRS A;  4HCC A;  1Q81 R;  4JS4 A;  2HCK A;  2RPN A;  1P92 A;  4M7D G;  4PJL A;  2AKK A;  3V7S A;  1KC8 U;  1LJO A;  4N4G A;  4E7J A;  2VB6 A;  3J80 E;  1KHC A;  1QVG P;  2VV5 A;  1QWF A;  2IVW A;  2QAZ A;  3PFS A;  3HKS A;  3T9N A;  3HL8 A;  1FX7 A;  1ZLM A;  1VQO T;  3L2U A;  3S3O A;  2E1H A;  1CKA A;  3VS6 A;  1V1C A;  2RQU A;  1ZBJ A;  2EWN A;  4EMH A;  4ZTJ A;  4RTW A;  5EC7 A;  1W4S A;  1BYM A;  1YCS B;  5GAN 4;  1TH7 A;  3CC4 Q;  1NLO C;  4C8Q A;  1VYU A;  2E64 A;  3PVQ A;  2HMA A;  1C6V X;  1N5Z A;  4QVZ A;  1KK7 A;  3JCM X;  4J6W A;  1YIT A;  2FZK B;  1VQ8 A;  2NUT B;  2J6O A;  4BDY A;  2M0Y A;  4OMP A;  2EJ9 A;  2HQX A;  1VQP T;  2DD4 A;  1UEC A;  2E3I A;  4ELZ C;  3F70 A;  5GAO p;  4C92 E;  9ATC B;  1K9M U;  2BE9 B;  1M2O A;  3PIO A;  5IHI A;  4J5Y A;  1TTH B;  3ULR B;  2NLU A;  2DRK A;  1UFF A;  3VUB A;  2DLP A;  1MGQ A;  3M59 A;  5GAM h;  1PRL C;  4C0G A;  4E7K A;  1VQL A;  2EYW A;  3ZL7 C;  2D9T A;  1Q81 C;  1ZUU A;  2NUP B;  2X3W D;  2DER A;  4M78 C;  4C5E A;  2DVE A;  5C0M A;  1WJS A;  2KE9 A;  1NYF A;  1W6X A;  2BUD A;  1JU5 C;  2BTT A;  4RUG A;  3JRZ A;  2QQS A;  3CBP A;  4MZM A;  1KQ2 A;  1QCN A;  2DTI A;  4DOV A;  3OYI A;  2XIC A;  3NPF A;  2CZ6 B;  3HPW A;  2ZZD A;  5GMK i;  2EQU A;  4C0F A;  3CCQ A;  4FW1 A;  1AOJ A;  4BE2 A;  1ZSZ C;  1OEB A;  1PSF A;  3UF4 A;  4M7A G;  4DBH A;  5GAN g;  2DXC A;  2LNH B;  2RQV A;  4EMK B;  1YIT Q;  1CKB A;  2GGR A;  3CXC A;  2XKO C;  1VQ8 Q;  1IRE B;  1RLP C;  4HKE A;  5GAO n;  3M0T A;  4RTX A;  2H8H A;  2O2O A;  2HQH A;  5IHK A;  3IQL A;  1NEG A;  2EGA A;  3RKX A;  1VOM A;  3L2Q A;  1ZX6 A;  4J9I A;  4QT7 A;  3CCS A;  1YIJ A;  1D0X A;  2KMT A;  3EHR A;  4QQD A;  1VQL Q;  1K1Z A;  4M75 A;  1MHN A;  2X3X D;  5KYU A;  2XID A;  1DJ7 B;  4VUB A;  3M57 A;  3EHQ A;  1NJI R;  1R0B G;  1G3T A;  4M77 E;  2JT4 A;  1HSQ A;  3M0Q A;  5CKB A;  4WTO B;  2EGE A;  3OYK A;  3URG A;  1VIE A;  2D6F A;  3OYF A;  3TQ7 P;  1JXM A;  2V8I A;  3MEV A;  4OP0 A;  4RTY A;  2EQJ A;  3RMQ A;  5A2Q E;  2LQ8 A;  4JJB A;  2HDA A;  1K8A U;  3CCQ Q;  1VQK T;  2EYZ A;  4RTV A;  4ELY C;  1IB8 A;  2Z0W A;  2ZPF B;  1YHQ T;  3MJX A;  5LJ3 d;  3X26 B;  1TXQ A;  5GJV B;  4M78 D;  2HKQ B;  4A54 A;  5L8R E;  7AT1 B;  3EG0 A;  4OB3 B;  3N5B B;  1VQM A;  1WQW A;  1OU9 A;  1X69 A;  5GAN 8;  2FL7 A;  2GBQ A;  1YWP A;  2X4X A;  1KC8 R;  1OQK A;  3FJP A;  2KT8 A;  4LDU A;  1Y57 A;  4DOW A;  1WXT A;  2KRN A;  3CCS Q;  4L6V 5;  1UG1 A;  1YIJ Q;  2KYB A;  3A8L B;  3M58 A;  3OA6 A;  1UHF A;  1LNX A;  3QG1 A;  3CCE A;  2CSI A;  3TSZ A;  2OAW A;  5HK3 A;  4PJO A;  5KYY B;  3CCM T;  1NJI C;  1PKT A;  4FYY B;  1RUW A;  3PNW C;  2XI9 A;  1WHK A;  2LZ6 B;  2CP2 A;  1G83 A;  4CC3 A;  1G3W A;  2X9H A;  2DEU A;  1WHL A;  2M9U A;  2ESW A;  1JJ2 A;  2JM8 A;  4AT1 B;  5LJ3 f;  5A0D A;  1WYX A;  1ZSZ B;  3FIF A;  5GAN 2;  3HRU A;  3PMI A;  2FPE A;  3A1P A;  2M51 A;  2LQN A;  1TU0 B;  1K9M R;  1Q82 U;  1YNZ A;  3H0F A;  3PMT A;  2OTL T;  3KXT A;  2FHD A;  3CQT A;  3EGU A;  3E1S A;  1ZA2 B;  1VQM Q;  3OW2 A;  1SEM A;  2P4R A;  3AHU A;  1TUG B;  1KC8 C;  2HEQ A;  3MKD A;  1M5Q 1;  4OB2 B;  2A7Y A;  2LTO A;  4B6M A;  3SFM A;  2JW4 A;  5LJ3 j;  3H0I A;  4J9B A;  3L1A A;  1QP2 A;  1UEB A;  3MHX A;  2JZ2 A;  3CCE Q;  2KSS A;  2X4J A;  2QA4 T;  3EG1 A;  2L3P A;  3CCL T;  4MDW A;  1X2Q A;  1A0N B;  3NMZ C;  3NTH A;  2V26 A;  1B34 B;  1RI0 A;  4M78 G;  1UTI A;  1VQ5 Q;  5ECA A;  3CPW S;  4C0D C;  1PSE A;  3MEU A;  1WA7 A;  3JCM W;  2ENM A;  1BI3 A;  1OZ3 A;  1BIB A;  3P8B B;  3EG3 A;  2RI2 A;  1PM3 A;  2F1L A;  3OMC A;  4J8O A;  3EG2 A;  1M3B A;  4IIM A;  1K9M C;  2KI7 A;  3G6E A;  2VC8 A;  2LNV A;  1RL2 A;  4KUD K;  2JXB A;  1MV0 B;  2DRM A;  4N0A C;  5GAM d;  3JCM V;  1YJ9 T;  5FRN A;  5I2M A;  3SHW A;  4JZ3 A;  4BE1 A;  2ABL A;  2MMP A;  3M55 A;  4D8D A;  4ZGD B;  4WF2 A;  1JO8 A;  5D6X A;  4F7U A;  5HK0 A;  5J3B A;  3V8K A;  5CIU A;  2XMF A;  4ZN1 A;  1RLQ C;  1ACM B;  2VWF A;  4HT9 A;  1ABQ A;  4RTT A;  1ZUY A;  2CP6 A;  1QW1 A;  2LVM A;  3OS2 A;  5LJ3 e;  2EFI A;  2MI6 A;  4GLK A;  1G8X A;  3A8M B;  1YI2 T;  1K76 A;  2HAX A;  1XNI A;  4J9H A;  2KQW A;  2X4Y A;  2EYQ A;  1B7T A;  4IIO A;  1H64 1;  4M7A F;  4E47 A;  3CPW P;  1I5O B;  1RAF B;  2XK0 A;  4XQ3 A;  5GJW B;  3UT1 A;  4M75 G;  5DLO A;  4A4G A;  2EIF A;  1QKW A;  1OV3 A;  4LNP A;  4PNO A;  1RAD B;  3MEA A;  2MF2 A;  1HJD A;  3CC2 T;  2E6N A;  4XTX A;  3CCJ T;  3JB9 D;  3A8H B;  4FM4 B;  2GNC A;  3G6E Q;  4LUD A;  1OI1 A;  3CEY A;  3M5A A;  3RER A;  2RHI A;  3V8J A;  5GMK j;  1OUL A;  5CKH A;  2I2L A;  5IT9 E;  2J06 A;  1AWW A;  3VS2 A;  3G71 T;  3VRY A;  1WFW A;  1FMK A;  2PVG B;  1U1S A;  2YDL A;  2NUT A;  3QSU A;  2QAS A;  2RJC A;  1B07 A;  2CH4 W;  3RMS A;  5KH6 A;  2KEA A;  4E7H A;  2VXF A;  3REA B;  3DKM A;  1KG1 A;  1SF9 A;  2EQK A;  3CCU A;  2FVU A;  2DMO A;  3JCM Q;  2LP5 A;  2NUZ A;  2OX7 A;  1GCP A;  1BI1 A;  2JS2 A;  1QMC A;  5GAN 6;  2BE7 D;  2RH2 A;  2E4H A;  3WXM B;  4OVA A;  4JRK A;  4C0D B;  2NUP A;  5LJ3 h;  4C92 C;  4BD3 A;  2F2X A;  4FYV B;  1TUD A;  1Y96 B;  4PJO G;  3OS0 A;  3VU3 C;  4DQ2 A;  2X35 A;  1HD3 A;  1GFC A;  3GF5 A;  1IGU A;  3VRZ A;  1ZBX A;  4QQG A;  1YCY A;  4AFZ C;  3BDU A;  4M7D E;  4R0K A;  2JM9 A;  1M27 C;  4NS5 A;  1QLY A;  4CC7 A;  3G4S A;  3QBY A;  1M2V B;  5GAO q;  2RK1 A;  4PL6 A;  1RAG B;  3QWY A;  3TRE A;  2CH4 A;  1GCQ C;  5IN1 A;  3H9N A;  2O9V A;  3VS5 A;  2HSE B;  2HKN A;  3RNJ A;  1NJI U;  4ZN3 A;  3L2R A;  4QW2 A;  1WXU A;  2DK3 A;  1N27 A;  4KGV B;  3OY9 A;  3I56 A;  1G3S A;  1VQ9 A;  3TU4 K;  1VQ6 T;  4EMK A;  2FRW A;  3VV0 A;  1AZG B;  3LH5 A;  1E6G A;  1R8O B;  1NLP C;  3VS3 A;  2LT1 A;  2V8J A;  5FU7 C;  2WSC E;  3RDV A;  2JTM A;  2KRS A;  1RAI B;  1Q86 R;  2QXF A;  1I5L A;  2IG0 A;  3CCU Q;  1MMG A;  4BE0 A;  3JB9 G;  1IHV A;  5I21 A;  1Z9Q A;  3LYI A;  2B8A A;  4J9E A;  3QII A;  1GBQ A;  1W2B S;  4PKC C;  2DL8 A;  2EQM A;  3JCM J;  1SSF A;  1VQN T;  1HXD A;  1JEG A;  5GMK m;  1FYN A;  4JPB W;  3INZ A;  3KUF A;  4LXC A;  4NL3 A;  1D0Z A;  1SPK A;  4ESR A;  5GAM g;  2E12 A;  5M9O A;  3CC7 T;  3M0P A;  4C8Q F;  3EFO B;  2FPD A;  3SWN B;  3G4S Q;  2EYX A;  3EAE A;  1MND A;  4M77 C;  2LX9 A;  2CSQ A;  4B9X A;  5KCO A;  1PD1 A;  4JZ4 A;  2F5K A;  1Q7Y R;  2DIG A;  5KE3 A;  4Z02 A;  5KYW B;  2KK4 A;  4C92 D;  1AWO A;  1H3Z A;  2D8H A;  2LDM A;  3CCR T;  3I56 Q;  1UB4 A;  1VQ9 Q;  1KQ1 A;  1LPL A;  3E2U A;  1U5S A;  2ZPG B;  4OB0 B;  2FB7 A;  1PRM C;  3QJY A;  4A53 A;  4M7A E;  1BBZ A;  1W70 A;  4IUT A;  5A0G A;  2KR3 A;  4RTU A;  4M4Z A;  1UGS B;  3BW1 A;  4AMC A;  1Q86 C;  5GMK h;  2VYT A;  3X20 B;  5DM7 R;  1RAE B;  3JCM f;  1KQS P;  2Y4Y A;  3HTR A;  4IUV A;  5HKC A;  1AHJ B;  1W2B P;  2COZ A;  4XK8 E;  5CQY A;  4F7U G;  2OTL A;  4C92 B;  1VUB A;  1TOV A;  2MIO A;  2CUB A;  2LJ1 A;  4DEX A;  3X24 B;  4M78 A;  5KYY A;  2R58 A;  3M0R A;  2GTO A;  2F2W A;  1VA7 A;  4TVR A;  4L5G A;  5HCK A;  2EKH A;  3OYL A;  4EIK A;  2X4W A;  2K5F A;  1U06 A;  3LGF A;  1JB0 E;  1EZZ B;  4DEY A;  2CP0 A;  3BE3 A;  3KFV A;  2DM1 A;  1NM7 A;  2DZ9 A;  2CZ0 B;  2K4Y A;  3O8V A;  2QK0 A;  2QEX T;  3QUI A;  1M90 U;  2EW3 A;  1YJN A;  2HSP A;  5D6Y A;  2QA4 A;  1CSK A;  1ZSZ A;  1Q7Y C;  1H3H A;  4ZGE B;  2A3L A;  3CCL A;  4E6R A;  1K9A A;  4GBQ A;  2KGT A;  2ED0 A;  4DBF A;  1T3L A;  4XTV A;  4KRT A;  1NPP A;  2CGH A;  2E5K A;  2V1R A;  3X25 B;  4KT0 E;  4PLI A;  5FU7 B;  2FO0 A;  1J3T A;  4M75 F;  4FSS A;  3RKY A;  2G6F X;  1O9S A;  2ZGW A;  4JS5 A;  2JMC A;  3R6N A;  2ZPH B;  3OYH A;  3FC3 A;  3QYH B;  4M77 D;  3TVT A;  5CR2 A;  2DBM A;  3FLG A;  1X6G A;  2OTL Q;  3CD6 T;  3CXC S;  1ARK A;  1YJ9 A;  3LGL A;  2F69 A;  4E7I A;  3OYJ A;  3LX7 A;  1AWX A;  1T0H A;  5IXF A;  3CME T;  1XOV A;  3OS1 A;  3J81 E;  1B34 A;  2RHZ A;  2RK2 A;  3BFM A;  1BI0 A;  5CKD A;  3GBQ A;  2ED1 A;  3A5Z B;  4M77 B;  4E7S A;  4GLM A;  4OMQ A;  4LD6 A;  1GXI E;  1IHW A;  2XDP A;  3GOX A;  2EKO A;  1D3B B;  3OBW A;  1YJN Q;  1HK9 A;  2QA4 Q;  2OTJ A;  1SHG A;  2AIR B;  3UA7 A;  3VUZ A;  3NTK A;  3CCL Q;  5I2S A;  2CT4 A;  2O9S A;  4MMK A;  1ZSG A;  2XDB A;  1WNL A;  3OMG A;  4O5V A;  4B9W A;  2D0Q B;  1QQJ A;  1OOT A;  2DBK A;  2ZPI B;  3CC4 T;  2BZX A;  1X75 C;  2DZC A;  1YJW A;  2DL5 A;  3H41 A;  5IHN A;  4PJO F;  2KY9 A;  3A98 A;  1Y07 A;  5AYF A;  3GLX A;  2K7A A;  4Z8A A;  2DYI A;  4X9D A;  4D8K A;  4FW2 A;  3CXC P;  2VKN A;  1S72 A;  1I07 A;  2CKK A;  4C8Q E;  3WVE B;  3HHT B;  5C6S A;  1VQ7 T;  3ZBD A;  1WZO A;  2OI3 A;  2KRO A;  2QG9 B;  1F1B B;  2A36 A;  3BDL A;  2XDD A;  4RG2 A;  3ZFJ A;  3OSS C;  3CCV T;  1S1N A;  2D0N A;  2LCL A;  2X51 A;  4F17 A;  1D1C A;  2HQE A;  2AT1 B;  1N9S A;  1JXO A;  4J7F A;  1UJY A;  1PWT A;  1WJQ A;  3I35 A;  1WX6 A;  2ECZ A;  2RB6 A;  5KYX B;  2FG0 A;  4ANJ A;  2LJ0 A;  3S3M A;  3JAM E;  2O4X B;  2OTJ Q;  4Y91 A;  5J39 A;  4M77 G;  3ER0 A;  4HT8 A;  5KE2 A;  2GFA A;  3JCM b;  1SHF A;  2VUB A;  1JJ2 S;  3QDF A;  2L0A A;  2CS7 A;  4HXJ A;  4BY6 C;  5D7U A;  1YN8 A;  3V8L A;  2DPP B;  1YJW Q;  2RI5 A;  4NL2 A;  3JCM h;  1QVF A;  4JLG A;  2JS0 A;  2C0O A;  2PNI A;  3S6W A;  1YIT T;  4M7D F;  4XU0 A;  3HP9 A;  1EX4 A;  2YSQ A;  3CBM A;  2COY A;  2QI2 A;  2MPX C;  1NEB A;  1FWZ A;  3Q1J A;  1AVZ C;  1S72 Q;  4OB1 B;  3OYM A;  2EJF A;  1QCF A;  2FZC B;  3MP1 A;  1W1F A;  3OW2 S;  1XTD A;  3I9Q A;  1QP3 A;  1M90 R;  2K5I A;  4Y92 A;  3CMA T;  3I55 A;  2QYZ A;  1VQL T;  1TS9 A;  1BCO A;  2KDS A;  2GCX A;  4Z89 A;  4LE9 A;  3HFN A;  1UUE A;  3M53 A;  5J26 A;  2MWP A;  5LJ5 f;  2EPD A;  2ROT A;  1Y96 A;  2VGN A;  3P8H A;  1M30 A;  2O88 A;  3M54 A;  1C1A A;  1Q86 U;  4M75 E;  3OYY A;  5GAO l;  4FU6 A;  4BDZ A;  4N0A A;  2PQW A;  2OAU A;  3REB B;  1JJ2 P;  4O6J A;  2XG8 D;  3V7R A;  1M2V A;  2BZ8 A;  4F7U F;  1E7O A;  1MMN A;  2CP3 A;  2DE0 X;  5L23 A;  4OMO A;  1VQN A;  3CCQ T;  2CZ7 B;  2WSE E;  3EFR A;  3P8D A;  4M7D C;  1AWJ A;  3CC7 A;  4FT2 A;  5LJ5 j;  4JDS A;  3UPU A;  2EJG A;  1TWB A;  3EH1 A;  2ATC B;  1KIK A;  1ABO A;  3OW2 P;  1VQO A;  2J05 A;  2LJ3 A;  3EG9 B;  1PC0 A;  3PT9 A;  2RHX A;  1M90 C;  2K3Y A;  3EGD B;  2MYS A;  1OPK A;  3TCJ A;  3CCS T;  3VYH B;  1Q7Y U;  3I55 Q;  4XU1 A;  1Q95 G;  4AFS C;  4X9C A;  3SB2 A;  2PVD B;  4Z88 A;  1K0X A;  3EH2 A;  1WJR A;  3E19 A;  1WHM A;  4N4I A;  1RAH B;  4HVU A;  4EMG A;  1JRI A;  2K79 A;  2AKL A;  3G1J A;  2PUK B;  5GAO m;  2D1X A;  3VJP A;  1VQP A;  4A4F A;  3RES A;  4BI3 A;  3OQ5 A;  3UWN A;  2AHJ B;  2H3E B;  5LJ3 g;  4PJO E;  4HVV A;  3EFO A;  4MML A;  4PFP A;  2LT4 A;  1K73 U;  4BY6 B;  2M1H A;  4MZP A;  1VQN Q;  2O31 A;  2QDY B;  2A0F B;  4JRI A;  1PG5 B;  3KBG A;  4AG2 C;  2DO3 A;  5KYW A;  3SWN C;  4QQ6 A;  4NOY A;  1U1T A;  2K2V A;  2W0Z A;  4E7L A;  1MV3 A;  4ZTF A;  3CC7 Q;  5FLX E;  1IGQ A;  4OF1 A;  1VQM T;  3M4Y A;  4QVC A;  2J6F A;  3PIP A;  2J6K A;  1Y71 A;  3M9Q A;  1UGQ B;  3MEW A;  2RJD A;  2M16 A;  1VQO Q;  2J7I A;  3PVL A;  3GNG A;  3NTI A;  2A08 A;  3C12 A;  2QTX A;  3R6O A;  3JB9 J;  2HZY A;  5CKF A;  2DF6 A;  3C95 A;  4OMM A;  4DA4 A;  4J9C A;  4CRI A;  3CCE T;  4C92 A;  4M7A C;  4FYW B;  4M7D D;  2R5A A;  1I1J A;  4BI8 B;  1BU1 A;  2DXU A;  1OU8 A;  1OYX A;  2ZPB B;  3JCM P;  2B86 A;  2P84 A;  3OYB A;  2KAF A;  1M9S A;  3MP6 A;  4HCB A;  5GAN 3;  1K0S A;  1VQ5 T;  1VQP Q;  2FRY A;  1NPR A;  2CRE A;  1VQ4 T;  1EFN A;  2R5M A;  5D6W A;  3S3N A;  2DVJ A;  2DJZ A;  2DYB A;  1IXD A;  2C0I A;  5GMK l;  3CD6 A;  1ZA1 B;  1AD5 A;  4PJM A;  1GCQ A;  3MET A;  2P0K A;  4ZGJ B;  1X2K A;  4M7D B;  2KNB B;  4IUQ A;  2RD1 A;  3A8O B;  3JV3 A;  3C4S A;  4P5N A;  5GAN 7;  2HL5 C;  4RMO A;  3UA6 A;  2E3H A;  1D1B A;  3G7Z A;  2DA9 A;  3QZ9 B;  3OYC A;  1QVG A;  4IUP A;  2QGG A;  1QWE A;  2PTK A;  1MUZ A;  2CDT A;  2HD0 A;  4XU3 A;  3QZ5 B;  2D8J A;  1HYO A;  1BCM A;  5GMK e;  1U3O A;  2V1Q A;  2DXB A;  1M3C A;  1VYV A;  2RQW A;  2JJ9 A;  2YUQ A;  4ORZ A;  2ZPE B;  1FMW A;  2QGF B;  4HVW A;  2YUP A;  1VQK A;  4JJC A;  3M0S A;  3JCM c;  1K4U S;  3NGP A;  2E10 A;  3CC4 A;  3E9G A;  2L3Q A;  4CI0 C;  4R55 A;  5CVI A;  1YHQ A;  2RQT A;  4BUG A;  2YRV A;  3M56 A;  2BZY A;  4F7U E;  2O01 E;  1BB9 A;  5GAN f;  4BAC A;  2EQI A;  3JCM d;  1YFN A;  3H6Z A;  2PU9 B;  1SRM A;  1X01 A;  2A37 A;  4M77 A;  3A8G B;  2RMO A;  1M1K U;  3CD6 Q;  2PZ1 A;  4FL6 A;  3M0U A; 
#chains in the Genus database with same CATH homology
 3OYJ A;  3LX7 A;  3E1S A;  1VQ7 A;  4A4H A;  4OGE A;  3CME T;  1XOV A;  4M7A D;  3DB3 A;  4JRQ A;  3OW2 A;  3AHU A;  2QEX A;  4XTZ A;  2VGM A;  2GFU A;  4RCB A;  2XU8 A;  1NE8 A;  2K57 A;  3OS1 A;  1KC8 C;  3CCM A;  4M7A A;  1M5Q 1;  1B34 A;  3HRT A;  2QQR A;  4OB2 B;  3J81 E;  2A7Y A;  2LTO A;  2RHZ A;  4C5I A;  5LJ5 e;  2RK2 A;  3BFM A;  1S72 T;  3SFM A;  3CCV A;  1BI0 A;  3FRN A;  5LJ3 j;  3QPH A;  1O75 A;  1NZ9 A;  2RM4 A;  2K5L A;  4C0Z A;  5CKD A;  3L1A A;  2GF7 A;  1OZ2 A;  5CKE A;  5GAN j;  3A5Z B;  1QP2 A;  1UEB A;  4M77 B;  3MHX A;  4LD6 A;  1GXI E;  3OS5 A;  2XDP A;  2JZ2 A;  4GY5 A;  3DB4 A;  2EKO A;  3GOX A;  4J83 A;  1D3B B;  5FRM A;  2KSS A;  2X4J A;  3OBW A;  2QA4 T;  1HK9 A;  3LWH A;  4M78 F;  2OTJ A;  3FDR A;  2PUO B;  1I4K 1;  1XQH A;  3E9F A;  3CCL T;  1FXX A;  2DEQ A;  4MDW A;  3VUZ A;  3NTK A;  5LJ5 g;  5GAM j;  5I2S A;  3NTH A;  4M7A B;  2CYZ B;  1B34 B;  4MMK A;  3OYN A;  3GIB A;  2RJE A;  1RI0 A;  4V2S A;  2XDB A;  1WNL A;  4M78 G;  3OMG A;  4O5V A;  4B9W A;  2D0Q B;  2KVQ G;  3V7C A;  3RKW A;  2ZPI B;  3LH0 A;  3CC4 T;  2RHU A;  3CPW S;  1IZ6 A;  4C0D C;  1X75 C;  2DZC A;  4EPC A;  1PSE A;  1YJW A;  3MEU A;  3JCM W;  2DXT A;  5DLQ E;  1BI3 A;  4HA8 A;  1OZ3 A;  4IUU A;  1BIB A;  2R57 A;  2KY9 A;  2PVO B;  3P8B B;  2BIV A;  2YLB A;  4J7I A;  1Y07 A;  4XTY A;  5AYF A;  3GLX A;  4Y28 E;  2G3R A;  3QXE B;  2BKD N;  2RI2 A;  3EFS A;  4J8O A;  3OMC A;  3CME A;  4XTW A;  1K9M C;  4C8Q C;  4X9D A;  1EIF A;  3G6E A;  1M8V A;  5CQX A;  2VC8 A;  3ME9 A;  1KD1 C;  3DLM A;  2LNV A;  1RL2 A;  5DY9 A;  4KUD K;  2Y90 A;  3QKJ A;  4N0A C;  1S72 A;  5GAM d;  3JCM V;  1YJ9 T;  2CKK A;  4C8Q E;  5FRN A;  4RKU E;  5I2M A;  3WVE B;  3HHT B;  2L8D A;  5C6S A;  4BE1 A;  2V8K A;  1VQ7 T;  3ZBD A;  5KCH A;  1K8A C;  2MMP A;  2H3J A;  2O4X A;  2P0P A;  2Y4X A;  1M4Z A;  3FB9 A;  3GNF B;  3M55 A;  3QO3 A;  3CMA A;  3DLL A;  4ZGD B;  5CAI A;  2JVV A;  3MO8 A;  4WF2 A;  5GAO r;  4X34 A;  4LDV A;  3BY7 A;  4YTL A;  3BDL A;  2XDD A;  5D6X A;  4RG2 A;  2K3X A;  4F7U A;  4OGC A;  1UGR B;  2L89 A;  3ZFJ A;  3OSS C;  3RIR A;  5HK0 A;  3OYG A;  3CCV T;  2LCL A;  5J3B A;  5CIU A;  3V8K A;  2DIQ A;  5CO7 A;  4ZN1 A;  1QVG S;  5FU6 C;  2E41 A;  3L2W A;  2HQE A;  5HY6 A;  1WPY A;  2VXE A;  5GAN 5;  4HT9 A;  3RUX A;  2LRQ A;  1N9S A;  3QHS A;  4XTU A;  4J7F A;  4M77 F;  3SDZ A;  3I55 T;  2YHT A;  3H8Z A;  1WJQ A;  4FSX A;  2RB6 A;  5LJ5 h;  4FL6 A;  2F5T X;  4BB7 A;  3S3M A;  1QW1 A;  2LVM A;  2O4X B;  3MCA B;  4OMF B;  3JAM E;  3OS2 A;  2XD0 A;  5LJ3 e;  4Y91 A;  2EFI A;  4A4K A;  2MI6 A;  1N9R A;  5J39 A;  4GLK A;  3A8M B;  1YI2 T;  5GAN e;  2HAX A;  1XNI A;  4M77 G;  2KQW A;  2X4Y A;  4JRP A;  3ER0 A;  2EYQ A;  4A4E A;  1H64 1;  4F7U B;  4HT8 A;  4M7A F;  1LOJ A;  5KE2 A;  2GFA A;  1KQS A;  4E47 A;  3JCM b;  1ZQ1 A;  2QQB A;  2VUB A;  1JJ2 S;  2DTH A;  2XK0 A;  4XQ3 A;  2CS7 A;  4BY6 C;  1W2B A;  4EMK C;  3UT1 A;  4M75 G;  3CCU T;  2DAQ A;  5DLO A;  4A4G A;  3V8L A;  1K73 C;  2EIF A;  2DPP B;  3FEO A;  2RI5 A;  1N8R C;  2MWO A;  5GAM e;  4NL2 A;  2YLC A;  3JCM h;  1QVF A;  4JLG A;  3OYA A;  1KQS S;  1G5V A;  4PNO A;  3CC2 T;  1D3B A;  4MDX A;  3MEA A;  2CZ1 B;  2MF2 A;  1Q82 C;  3S6W A;  4J6X A;  1YIT T;  2E5Q A;  1QVP A;  4KBM B;  4IUR A;  2E6N A;  4XTX A;  4EDU A;  3CCJ T;  3JB9 D;  4M7D F;  2RHY A;  4XU0 A;  3HP9 A;  3A8H B;  2EAY A;  4FM4 B;  3G6E T;  1I8F A;  4KUI A;  3CBM A;  1BKB A;  3HRS A;  4J6Y A;  4C92 G;  2QI2 A;  5CK9 A;  3OYE A;  4HCC A;  4JS4 A;  1OI1 A;  1FWZ A;  3CEY A;  1P92 A;  3M5A A;  3Q1J A;  3TEE A;  3RER A;  4OB1 B;  3OYM A;  2RHI A;  3V8J A;  2EJF A;  3HSB A;  5GMK j;  4M7D G;  3MP1 A;  3V7S A;  5CKH A;  2I2L A;  3OW2 S;  1XTD A;  5IT9 E;  1KC8 U;  1QP3 A;  2K5I A;  1LJO A;  3I55 A;  3CMA T;  4N4G A;  3G71 T;  4E7J A;  3J80 E;  3G4S T;  1VQL T;  4PJO F;  1KHC A;  2P4T A;  2PVG B;  2VV5 A;  2IVW A;  4MZT A;  3PFS A;  1U1S A;  3HKS A;  3T9N A;  3HL8 A;  2KDS A;  1FX7 A;  2MAM A;  2GCX A;  1YI2 A;  1VQO T;  3L2U A;  3QSU A;  3S3O A;  2E1H A;  2RJC A;  3HFN A;  1V29 B;  3M53 A;  5J26 A;  2MWP A;  3RMS A;  5LJ5 f;  3LWI A;  4ZTJ A;  1Y96 A;  2EWN A;  4EMH A;  5KH6 A;  2VGN A;  3P8H A;  3JCM e;  4M75 C;  4BI4 A;  1W4S A;  3QJ6 A;  1BYM A;  3JB9 H;  4KUL A;  4C8Q D;  2VXF A;  4E7H A;  1UGP B;  3SD4 A;  3M54 A;  5GAN 4;  1TH7 A;  3I56 T;  3DKM A;  1VQ9 T;  1KG1 A;  5EG2 A;  2EQK A;  3CCU A;  2FVU A;  3L42 A;  4C8Q A;  5GAN d;  3JCM Q;  2LQK A;  1Q86 U;  4M75 E;  5CCA A;  3OBY A;  3OYY A;  2E64 A;  5GAO l;  4FU6 A;  4JJN K;  4BDZ A;  1BI1 A;  4N0A A;  2PQW A;  2OAU A;  4O6J A;  5GAN 6;  2XG8 D;  3V7R A;  4PLL A;  2RH2 A;  3OSV A;  4QVZ A;  4F7U F;  3JCM X;  3WXM B;  4J6W A;  3GPL A;  3JB9 I;  1YIT A;  4OVA A;  3CC2 A;  4JRK A;  4C0D B;  4C92 C;  5LJ3 h;  3CCJ A;  3JCM g;  3VKI A;  4BD3 A;  4BDY A;  3CCQ T;  1VQN A;  2EJ9 A;  2CZ7 B;  2HQX A;  2DD4 A;  2WSE E;  3EFR A;  5GAN h;  1VQP T;  3P8D A;  1Y96 B;  4PJO G;  4ELZ C;  3F70 A;  5GAO p;  3OS0 A;  4M7D C;  4C92 E;  3VU3 C;  4DQ2 A;  2X35 A;  1K9M U;  3J7A F;  3GF5 A;  4UC4 A;  1ZBX A;  4QQG A;  3PIO A;  4LD9 K;  4LDY A;  1KD1 U;  1YCY A;  4C8Q B;  4FT2 A;  5LJ5 j;  4J5Y A;  3CC7 A;  3BDU A;  4M7D E;  2NLU A;  4JDS A;  3VUB A;  3UPU A;  1MGQ A;  3M59 A;  2JN0 A;  2ZCF B;  4FT4 A;  5GAM h;  4NS5 A;  1JBM A;  4C0G A;  3G71 A;  2EJG A;  3G4S A;  4E7K A;  1VQL A;  2D9T A;  1Q81 C;  3QBY A;  5GAO q;  2RK1 A;  4PL6 A;  2LCC A;  2DD5 A;  3TRE A;  5IN1 A;  3HFO A;  1VQO A;  1BI2 A;  4M78 C;  3PT9 A;  2RHX A;  1M90 C;  4C5E A;  2K3Y A;  2DVE A;  5C0M A;  1NJI U;  3TCJ A;  3CCS T;  3VYH B;  4ZN3 A;  1Q7Y U;  3L2R A;  4QW2 A;  2DK3 A;  1WJS A;  4XU1 A;  1N27 A;  2E65 A;  4X9C A;  3SB2 A;  4M78 E;  2PVD B;  3OY9 A;  2BUD A;  4FIB A;  1G3S A;  5FU6 B;  3I56 A;  1VQ9 A;  1WJR A;  3JRZ A;  3TU4 K;  2QQS A;  3CBP A;  1VIF A;  3C94 A;  3E19 A;  4M78 B;  4MZM A;  4EMK A;  4LDX A;  1KQ2 A;  1YBY A;  1VQ6 T;  2FYK A;  2DTI A;  4Q5W A;  3VV0 A;  4N4I A;  4DOV A;  3OYI A;  1R8O B;  2XIC A;  4C5H A;  1Y7X A;  5LJ5 d;  3L2V A;  4EMG A;  1JRI A;  2LT1 A;  2CZ6 B;  3JB9 F;  1N6A A;  2V8J A;  3HPW A;  5FU7 C;  1WGS A;  2ZZD A;  2WSC E;  5GMK i;  2EQU A;  2PUK B;  4C0F A;  5GAO m;  2L5Q A;  2JTM A;  4PJO C;  1WQ7 A;  3VJP A;  3CCQ A;  1VQP A;  4A4F A;  1VQ5 A;  3RES A;  4BI3 A;  4BE2 A;  3OQ5 A;  2QXF A;  1I5L A;  2IG0 A;  3UWN A;  3LW5 E;  1M1G A;  2HNI A;  2JUF A;  1VQ4 A;  4N4H A;  4BE0 A;  1PSF A;  3JB9 G;  2AHJ B;  5LJ3 g;  4M7A G;  4PJO E;  5I21 A;  4MML A;  4JUV A;  5GAN g;  3LYI A;  2LT4 A;  2B8A A;  2DXC A;  1K73 U;  3QII A;  4BY6 B;  2M1H A;  1W2B S;  4EMK B;  3ASK A;  4PKC C;  2EQM A;  1VQ8 T;  3JCM J;  1SSF A;  2JNG A;  4MZP A;  3CXC A;  2XKO C;  1VQN T;  1IRE B;  1HXD A;  4ME7 A;  2E6Z A;  4HKE A;  5GAO n;  1M1K C;  2QDY B;  5GMK m;  4JRI A;  3PGG A;  3OB9 A;  1QVF S;  2M0O A;  3INZ A;  3M4G A;  3KBG A;  3KUF A;  2DO3 A;  3QYG B;  1BIA A;  4NL3 A;  3SWN C;  4QQ6 A;  1ZHI A;  1G3Y A;  2GQV A;  4NOY A;  5GAM g;  1U1T A;  2E12 A;  3RKX A;  2K2V A;  3L2Q A;  5M9O A;  3CBO A;  4E7L A;  5FRO A;  3CC7 T;  4ZTF A;  5FLX E;  1X6O A;  4C8Q F;  4M75 D;  3CCS A;  1YIJ A;  5A0L A;  4XU2 A;  4OF1 A;  1VQM T;  2KMT A;  4QQD A;  3M4Y A;  3SWN B;  4QVC A;  4M75 A;  2DTO A;  1MHN A;  3PIP A;  3M9Q A;  1Y71 A;  3EAE A;  4M77 C;  1UGQ B;  3MEW A;  2XID A;  1DJ7 B;  2LX9 A;  1VQ6 A;  4VUB A;  2RJD A;  3M57 A;  4B9X A;  4C8Q G;  5KCO A;  2M16 A;  2F5K A;  2WAC A;  5LL6 S;  2DIG A;  5KE3 A;  2WSF E;  4II1 A;  3GNG A;  3L2Z A;  3NTI A;  1G3T A;  3C12 A;  4M77 E;  3CPF A;  4XAX B;  2QTX A;  3R6O A;  4Z02 A;  2KK4 A;  4C92 D;  3JB9 J;  5IAY A;  5CKF A;  3C95 A;  1VQ8 A;  2DKG A;  4RG8 A;  5CKB A;  1H3Z A;  4ATO A;  2QQA A;  4LDW A;  4CRI A;  4DA4 A;  3CCE T;  3OYK A;  2LDM A;  4C92 A;  3CCR T;  4M7A C;  1UB4 A;  3URG A;  1VIE A;  1YJN T;  2D6F A;  3OYF A;  4M7D D;  1KQ1 A;  2R5A A;  4BI8 B;  2DXU A;  2V8I A;  3OYD A;  3MEV A;  4OP0 A;  2ZPG B;  4OB0 B;  1OYX A;  3X28 B;  2FB7 A;  3QJY A;  2EQJ A;  2RJF A;  2ZPB B;  4M75 B;  3RMQ A;  1M1F A;  4A53 A;  4M7D A;  4M7A E;  5A2Q E;  3JCM P;  3CPW A;  4IUT A;  3LLR A;  5A0G A;  3MP8 A;  2LQ8 A;  4HCZ A;  2KAF A;  3OYB A;  1M9S A;  3MP6 A;  4HCB A;  1UGS B;  2RO0 A;  3BW1 A;  1Q86 C;  5GAN 3;  5GMK h;  2VYT A;  3X20 B;  2E70 A;  5DM7 R;  1K8A U;  1VQ5 T;  1VQK T;  3JCM f;  4C5G A;  4ELY C;  2Y4Y A;  1NPR A;  2RI3 A;  3ZEH A;  1VQ4 T;  2C06 A;  2R5M A;  2ZPF B;  4IUV A;  1AHJ B;  1KHI A;  5D6W A;  5HKC A;  3S3N A;  2DJZ A;  1YHQ T;  3NFC A;  4F7U G;  4XK8 E;  5CQY A;  5LJ3 d;  3X26 B;  2OTL A;  4M78 D;  4A54 A;  4C92 B;  3GP8 A;  5L8R E;  3CD6 A;  1VUB A;  5GMK l;  4OB3 B;  3MET A;  2P0K A;  3X24 B;  4ZGJ B;  4M78 A;  3N5B B;  2R58 A;  1VQM A;  4M7D B;  2L3R A;  3LGL A;  4E7I A;  1WQW A;  4IUQ A;  4TVR A;  2RD1 A;  4L5G A;  3A8O B;  5GAN 8;  2FL7 A;  2P0Q A;  3OYL A;  2X4X A;  2X4W A;  2K5F A;  3FJP A;  3C4S A;  3LGF A;  4P5N A;  5GAN 7;  4RMO A;  1JB0 E;  1Q81 U;  4DOW A;  4LDU A;  4L59 A;  3G7Z A;  1YIJ T;  4L6V 5;  3QZ9 B;  2DZ9 A;  3A8L B;  3M58 A;  3OA6 A;  3OYC A;  1QVG A;  4PJO D;  4IUP A;  2CZ0 B;  2K4Y A;  3O8V A;  3WVD B;  1LNX A;  2HD0 A;  3QG1 A;  2QEX T;  3QUI A;  3CCE A;  5HK3 A;  4XU3 A;  4JLI A;  3QZ5 B;  3CCR A;  1YJN A;  1M90 U;  4PJO A;  1U8R A;  5D6Y A;  2QA4 A;  5GMK e;  3CCM T;  2LC4 A;  1NJI C;  1Q7Y C;  2DXB A;  4ZGE B;  2A3L A;  4D6W A;  3CCL A;  2ZPE B;  3QDR B;  3PNW C;  2XI9 A;  2HBP A;  2JOY A;  4XTV A;  1G3W A;  2QQ9 A;  1NPP A;  2CGH A;  1VQK A;  4IKF A;  3JCM c;  3X25 B;  2E10 A;  3CC4 A;  2OTJ T;  2M9U A;  3E9G A;  4KT0 E;  4CI0 C;  5CVI A;  4R55 A;  4PLI A;  1YHQ A;  1JJ2 A;  3JSC A;  5FU7 B;  4BUG A;  2YRV A;  3SWN A;  3M56 A;  4M75 F;  5LJ3 f;  4PJO B;  4F7U E;  5A0D A;  2O01 E;  3VYG A;  4R56 A;  5GAN f;  3RKY A;  1N8R U;  3FIF A;  1O9S A;  2ZGW A;  5GAN 2;  4JS5 A;  4BAC A;  3HRU A;  3PMI A;  3JCM d;  4QVD A;  2ZPH B;  3OYH A;  2XHC A;  3H6Z A;  3FC3 A;  3QYH B;  4M77 D;  2PU9 B;  3UDC A;  1Q82 U;  5CR2 A;  1X01 A;  1YJW T;  3FLG A;  4M77 A;  3PMT A;  2OTL T;  3A8G B;  3KXT A;  2FHD A;  1M1K U;  3CD6 T;  2JTF A;  1I81 A;  4C92 F;  3CXC S;  1YJ9 A;  5GAM f;  3PTA A;  4RCC A;  2F69 A;  2RA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...