4MZTA

Mazf from s. aureus crystal form ii, c2221, 2.3 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MazF mRNA interferase
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 30
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mztA00
5CQYA 5CKFA 4ME7A 5CO7A 5CQXA 2C06A 1X75C 4MZMA 5CKHA 1UB4A 4VUBA 4ELYC 5CR2A 5DLOA 1VUBA 1NE8A 3NFCA 4MDXA 5CKEA 2MF2A 4OF1A 4HKEA 5CKDA 5HKCA 3G7ZA 5CCAA 5CK9A 5HK3A 3TCJA 5HK0A 4ELZC 3JRZA 2KMTA 4MZTA 4MZPA 3HPWA 5CKBA 1M1FA 2VUBA 3VUBA 3JSCA
chains in the Genus database with same CATH superfamily
3VS1A 2BIVA 2GBQA 4ZGDB 3EHRA 2DBMA 1JO8A 1WJSA 1NEBA 4FT4A 2EJGA 3MPUB 2NWMA 3L1AA 1LPLA 2X35A 2AZVA 2I2LA 1YI2A 1Q81U 1UGVA 2WSEE 4PFOA 3SEMA 1PM3A 4M77F 4C92F 2YUNA 3M4YA 1QVFA 2EYXA 3CCUT 1GXIE 1YP5A 1B7TA 3JB9J 2E3HA 5LJ5f 1VQPA 2D8HA 2DILA 1YITA 1M3BA 1Q86U 3E1SA 1M2OA 3URGA 5KCHA 4PNOA 2HMAA 1VQ7A 2ZPHB 1K4US 1JEGA 2E12A 1KSWA 5GAN5 4PFPA 1K8AU 4M78B 1K8AC 2LT4A 3CCUQ 2OTJA 2BUDA 1MNDA 3S6WA 2JUFA 1C0MA 3MJXA 4GY5A 1SSHA 4C5EA 2P0KA 5CAIA 2FVUA 3OYAA 1UB4A 4D8KA 1RACB 1AWJA 4Y91A 1X69A 1G3TA 1X2KA 1MGQA 2O88A 2LX9A 4C5GA 3CCET 2EQIA 2E6ZA 1RAEB 3PMIA 1Z9ZA 4GBQA 1T3SA 2JS2A 2PUOB 1QVFP 2VUBA 2ENMA 1SRLA 1D3BB 1HK9A 1UEBA 3PT9A 1W2BP 4M7DB 4CC4B 1KFZA 2HKNA 4A53A 1UJ0A 2RQVA 2YUPA 2COWA 1KC8R 3CCVA 4C0DB 1GCQC 4L59A 1K73U 3FDRA 3CCEQ 2BTTA 1YIJA 1XTDA 1K73C 3M0UA 4RKUE 3GBQA 1M1GA 2CH4W 4IUVA 3OYBA 1Y96A 1ZBJA 1OQKA 4E7HA 3H8ZA 5IAYA 1ZA2B 3M55A 3I35A 4BY6B 1KQ1A 4NL2A 4RTVA 4PJLA 1Y57A 5CIUA 2ZGWA 3SWNC 2K3YA 5M9OA 4F04B 5LJ5d 2XU8A 1BB9A 1SPKA 2YRVA 4X9DA 2DVJA 3UDCA 5GAOr 5CR2A 1Q95G 4OVAA 4BB7A 3QJ6A 2WSFE 4J6YA 2P0PA 1MMDA 3GIBA 1OYXA 3EG0A 3T9NA 3JB9H 4E7LA 2DX1A 2L2PA 2LNVA 1VQMA 2DM1A 5GANd 4ZTFA 2E10A 3DB3A 1VQKT 3G71A 2KYMA 5LL6S 2DL7A 4AG1C 3I55Q 1PSFA 4BD3A 4N4GA 3L2QA 1UE9A 3J7AF 3NHNA 5CKBA 3CC2A 1W1FA 4N0AA 4N4IA 3BFMA 1BYMA 1OI1A 4BI8B 3RMQA 3CXCS 1UHCA 1AT1B 4BDZA 1VQKQ 2Z0WA 4F7UG 4J9CA 1WHHA 3V7SA 1OPKA 2DXTA 4C92C 1CKBA 4E7ZA 4RG8A 4II1A 1ABOA 2XDDA 2W10A 3OYEA 2X4XA 3EFRA 1UGPB 1M27C 1HD3A 1X27A 3NMZC 5GAN3 5DY9A 2YRCA 2ZZDA 1ARKA 2J6OA 1YI2T 3I9QA 4GLMA 1YNZA 5KE2A 1YCYA 2DJZA 2FRYA 1M90U 2LCCA 3S3NA 2M02A 2EKOA 1M90C 1ZQ1A 3E2UA 4J9EA 2JTEA 5GAMh 1W6XA 4C5HA 1VQPT 5GAOl 1MMAA 1YITT 2RK1A 4ZGJB 1IXDA 4FYXB 2NLUA 2HNIA 1VQ7T 3VS6A 1G3YA 1YI2Q 4LDVA 4A63B 1MHNA 1K1ZA 2RD1A 2ROTA 3I56A 5D6WA 1RAAB 2COZA 4ESRA 1UDLA 2KEAA 4OGCA 5I2SA 2OTJT 3V8LA 1J3TA 3M9QA 2RQUA 1KJWA 3KBGA 1IHVA 2MAMA 2M1HA 3S3OA 2LMJA 4EMKC 1VQPQ 1WQWA 1YITQ 1AVZC 2HBPA 3O5ZA 2EYQA 5KYXA 3VUBA 2XHCA 3A8MB 4PJOD 5C6SA 1Q7YC 4ELYC 2A37A 1OX8A 4J9GA 5FU6B 2F5KA 1K0XA 3JV3A 4MDXA 2OTJQ 2WSCE 2FPEA 3C94A 1VQOA 5FRMA 2A7YA 4HXJA 3SFMA 3GP8A 3KFVA 2D9TA 3CCVT 4M7AC 4Z88A 2JM9A 2K57A 4C8QC 2HZYA 4X1VA 4XAXB 1YIJT 4CC3A 5DM7R 1Y7XA 1IREB 1IRXA 2FEIA 2C0TA 1Y96B 1N6AA 4MMLA 2X4WA 2F1LA 1FX7A 3ZL7C 1VIFA 4M77D 4C92D 1ZSZA 1N8RR 3META 1PCXA 3HRUA 4FSXA 1RLPC 2K6DA 2MYSA 4HCKA 2PNIA 1RL2A 1E7OA 3QYGB 4R55A 2C06A 1R77A 4OB0B 1WXBA 2K79A 3H0FA 1H92A 1YIJQ 1QKWA 3BW1A 1YJNA 1PWTA 2HEQA 2ATCB 3G7ZA 1QVFS 2X3WD 5HK0A 1M1KU 1WHMA 2FHDA 4J7IA 4EMHA 2KY9A 1M1KC 1KD1U 3TSWA 1U1TA 2DZ9A 4A54A 3CMAA 4A4HA 1C6VX 4JPBW 2BE7D 1VQMT 1SKUB 2E1HA 5GAMg 1B34A 3C12A 1FMVA 3RDVA 1NJIR 1Y0MA 4HVVA 1WHJA 3G71T 4KUIA 2AK5A 1PD1A 4PJNA 3QPHA 4LDUA 1ZUUA 4MMKA 3JSCA 2RPNA 4OP0A 1LVKA 3L2VA 4C0GA 4OGEA 3MP8A 2JNGA 3TEEA 3CC2T 2CREA 1VQMQ 1SRMA 2BZYA 1U5SA 1NZ9A 1I07A 5HY6A 3ZBDA 4DEYA 4FYVB 1EIFA 1BI2A 1WYXA 4LUDA 4MZTA 3G71Q 4PFZA 3G4SA 2KRMA 4OB1B 3EGXB 3SB2A 1Z9QA 3MCAB 2AHJB 4Y92A 4OMQA 3QYHB 2V8KA 2XMFA 1IO6A 1VUBA 3M56A 2FZCB 1ZBXA 3CC2Q 4PJOG 5ECAA 2CUBA 4C8QD 4IUQA 5GMKj 2OJ2A 4Z89A 2PZ1A 3OYMA 4HVUA 1TTHB 3FC3A 1N8RU 5LJ5j 3CCQA 2AT1B 1LJOA 3OA6A 3X24B 3M58A 3C4SA 2D1XA 4XTZA 3G6ET 2DIGA 2E41A 1FMKA 2KNBB 2RHXA 1BKBA 3A8HB 1WJRA 1OV3A 1CSKA 3OSVA 1M9SA 4LDYA 2M9UA 2EQUA 2ED0A 4KBMB 3I56T 4M75C 2L3SA 4QQ6A 4DEXA 2K2VA 4XU2A 4M77G 4RCCA 4C92G 2IIMA 3RBBB 4F7UE 2E4HA 3H0IA 1H8KA 4VUBA 1R0CB 5KYXB 3MHXA 2QK0A 2VC8A 1OZ2A 5CKDA 1NJIU 1Q82U 1TUCA 2LQ8A 1A0NB 1Q82C 4M78F 3SWNA 1X43A 1FWZA 1BU1A 3RNJA 3I56Q 2B8AA 5FU7C 4B6MA 4F7UB 5AT1B 1GBRA 3CCRQ 3GF5A 3VUZA 4IURA 4FW1A 4DBQA 1WPYA 3VV0A 3MP6A 2JZ2A 1VQOT 2F5TX 1PHTA 3HFOA 2HQHA 3E19A 1DJ7B 2QTVA 1K0SA 1RLQC 3E9GA 4IKFA 4J7FA 3OYNA 1PC0A 1K8AR 3FLGA 4MZPA 4JLIA 1QP2A 2DE0X 1ZSZB 2KQWA 4PLIA 2PTKA 4M7DF 2BZ8A 5IHIA 1X6GA 3ME9A 1VQOQ 2DLPA 2JW4A 2DF6A 4M4ZA 2DBKA 4JS5A 3L2RA 4LXCA 4J5YA 1MMGA 2KGTA 3I5SA 1IHWA 3HHTB 2VXEA 5GAN4 1YJNT 1YHQA 1IZ6A 1YWPA 2K9GA 4HCZA 4RTWA 1ZUKA 2RK2A 2RQRA 2NUTA 2LQKA 2R5MA 3TREA 2RMOA 3X25B 3CMAT 1ZHIA 3GPLA 2VASA 4JJBA 2QDLA 1HXDA 1B34B 3MP1A 2FG0A 4OMFB 4C8QG 1MV3A 5GMKh 1W70A 1K73R 4LD9K 3OYGA 1ZA1B 1OULA 1YJNQ 2RI3A 1AWOA 4M75D 3OYKA 1WQ7A 5LJ5h 3CCJA 3NTKA 1KQ2A 2GTOA 3V7RA 2MOXA 1I1JA 2HQEA 3L42A 3VRZA 3CMAQ 2XG8D 3OSSC 4J83A 2SEMA 2D8JA 1NPRA 4XTXA 2EVRA 2GQIA 3S3MA 1PNJA 1TU0B 2M0OA 5CQYA 2JMAA 1WHGA 2H8HA 1W2BA 2EW3A 1UFFA 3G4ST 5GANh 1WXUA 2FPFA 3R6NA 2EJFA 2DL3A 3RESA 5GAOn 3THKA 2VGMA 1PKSA 1WXTA 1JB0E 2E64A 2KMTA 2RNAA 2DRMA 1UJYA 2LCLA 1UUEA 2KI7A 1OOTA 1UECA 2R57A 2YHTA 3FEOA 2J05A 3JB9D 5GANf 3CCQT 3G4SQ 5GAN7 2ZPIB 2GQVA 3EG3A 2KE9A 2CKKA 2G3RA 1JRIA 3U23A 2QXFA 3LWHA 2DA9A 5GAN8 1VQ5A 3RMSA 3GNFB 4CC7A 2CP5A 3JCMX 4BUGA 3OW2A 2JXBA 2HSPA 3VYHB 1I8FA 1HSQA 2XIDA 4M7AA 2IG0A 2JTMA 3RERA 2EBPA 2EQMA 2ED1A 5GAMj 3CCQQ 1UG1A 2A36A 4A4EA 5HKCA 3H9NA 3I5RA 1RAFB 5FLXE 4AFSC 3HPWA 4MDWA 5IXBA 5DLQE 3H41A 2PU9B 2VWFA 1UGQB 3CMEA 3SWNB 3EH2A 1FYNA 4ME7A 4NOYA 2LX7A 1NLOC 1M90R 4RG2A 2DVEA 3CBPA 3HFNA 4PJOE 2C0OA 1BCOA 3HTRA 3HSBA 3PVQA 1SHFA 3GLXA 4ELZC 2CP3A 1ACMB 2CT4A 5LJ5g 3FJ5A 1M1FA 2LJ3A 4P5NA 1SHGA 3M0RA 2EAYA 3OW2P 3HL8A 4QVZA 4JJNK 1H3HA 2RJFA 3I55T 4M75G 2XI9A 3JCMP 1WZOA 5GMKm 2RHIA 2LP5A 3M57A 4YTLA 1WLPB 5IH2A 2CP0A 4PJOC 2P84A 4M77E 4C92E 2CS7A 1U06A 4BY6C 4X34A 2QQAA 1VA7A 2NUTB 3JCMe 5IXFA 5D7UA 2KT8A 1YHQT 4Q5WA 4HKEA 1VQNA 3PGGA 2QGFB 3RKXA 4XU3A 2X3XD 1WGSA 2AKKA 5LJ3h 3OS0A 4FT2A 2K3BA 3P8BB 3TVTA 4JRKA 2DYIA 4E47A 1D0YA 2GFAA 2YXYA 2IPOB 1JXOA 1I0CA 3JAME 4M77C 2L3QA 3OYIA 2JOYA 2VB6A 3JB9G 1YHQQ 3LH0A 3EGXA 2DZCA 2KVQG 3EFOB 3F70A 4M78D 3CCJT 4DOWA 1TH7A 2QTXA 2L3PA 1U1SA 5LJ3f 3OS1A 5CQXA 3OYFA 3NGPA 1QWEA 2AKLA 2YWWA 4QKUA 2XKOC 3FB9A 5IHNA 1ABQA 3DKMA 7AT1B 5L23A 1M1KR 8ATCB 2EJ9A 3CCJQ 1VYVA 4R0KA 1PSEA 1KD1R 3EGDB 3PNWC 4FYYB 1MMNA 3JCMc 4M7DD 2F2VA 5DLOA 3VS3A 3NFCA 3UT1A 1QVGP 4E7KA 3CCRA 3OYYA 2X4JA 1YFNA 1T0JA 3M59A 1VQ4A 2OI3A 4ZTJA 2MWOA 4M7AE 4C8QE 1U3OA 1D0ZA 4QVDA 2O9SA 3PVLA 4KH1B 4RUGA 1Q7YU 1VQ5T 1UHFA 3M4GA 1QCNA 4DBFA 5GMKi 1WJQA 1RAGB 1KQSA 1M5Q1 4M7AB 4C8QB 3CPWP 5CCAA 2QQBA 2QQ9A 4F7UA 3LH5A 2O2OA 5AYFA 1AWXA 2EGAA 5FWBA 3QZ9B 4JJCA 4DBHA 2RA2A 2LDMA 1VQ5Q 4E2FB 2HKQB 3CMET 2DK3A 1IGUA 3QBYA 3MKDA 3TCJA 2WACA 5LJ3d 2C0IA 2NYSA 3A1PA 3DLMA 1C1AA 3BDLA 2V1QA 4ORZA 1WX6A 1X2QA 4JRQA 4WCIA 1T0HA 2O4XA 2L5QA 2OTLA 3EHQA 2DJQA 1XJWB 2O9VA 2CUDA 2QQSA 1KQSP 4FW2A 3CMEQ 2K2MA 3L2WA 2CT3A 5FWCA 3CC7A 3QJYA 2CSQA 3G1JA 1VQ6Q 3QWXX 4F7UF 1W2BS 2X51A 1G5VA 4M78G 3OYJA 1EFNA 1IB8A 2RN8A 1TWBA 4OMNA 2YT6A 3NTIA 1KHIA 4C0ZA 2ZPBB 4HT9A 2HL5C 4LD6A 1RUWA 4EIKA 2L3RA 2VXFA 1OU9A 1OEBA 1X6BA 2EGCA 2XDPA 1Q82R 5GMKe 3OYCA 1BK2A 1LNXA 1B3QA 1G2BA 1MV0B 2LQNA 2E5KA 1BIBA 4CRIA 5LJ5e 1WI7A 1VQNT 3NTHA 3FJPA 3TSZA 4ZNXA 3OYLA 2F2WA 3LGLA 3MEAA 4K11A 2SRCA 4M7DG 1D1CA 2YUOA 3A8GB 5CK9A 3QWYA 3V8KA 2P4RA 4Y28E 3OW2S 5KYYB 1D1AA 2W0ZA 4ZN3A 2V26A 2KBTA 2PUKB 2AZSA 2CH4A 2B86A 1NPPA 2K3XA 1VQNQ 1SF9A 1LCKA 1KG1A 2LNHB 3WVEB 4M75E 1K9MC 3ASKA 3JCMf 2DFUA 2YDLA 2EIFA 4RMOA 1BI3A 2CZ6B 1QKXA 3TQ7P 2OAWA 1JU5C 5GAOq 3M0PA 4J9HA 1TOVA 4BI4A 2L0AA 2OX7A 1CKAA 4J6XA 3FIFA 2NUPA 2RHZA 1PD0A 2V1RA 1WFWA 2JMCA 1WHKA 4XTYA 4RTXA 4E6RA 1JJ2A 3H6ZA 2GF7A 2LRQA 3MEWA 1VIEA 1GCQA 3QXEB 4AFQC 3X20B 3CCRT 2CP2A 5GANj 4EMGA 3VKIA 1VQ4T 5A0DA 4PJJA 2E65A 4AFZC 3CD6Q 1NYGA 4LE9A 5FU7B 1OX9A 1KHCA 3JCMV 3X28B 2VYTA 2EKHA 5KCOA 3GOXA 2DTIA 3EG1A 2RM4A 2EYYA 4A4GA 1XNIA 2QGGA 2DD4A 5I21A 1PRMC 2YUQA 2K5LA 3NPFA 2P0QA 4XU0A 1BCMA 1VQ4Q 2D6FA 4OMMA 1ZX6A 5I11A 2DXUA 5J3BA 4IIOA 1I5OB 1S72A 4DA4A 2O31A 1JJ2P 4PJMA 3OS5A 4PJOA 3VS7A 1JBMA 1I5LA 4KRTA 4HCBA 2EYZA 1Y71A 3JCMd 4LUEA 1U8RA 3LGFA 2DMOA 1V76A 1QVPA 3EGUA 3QG1A 2AIRB 5HCKA 2O4XB 3CC4A 4B9XA 2K5IA 4XQ3A 2FZKB 2M51A 3CCLA 2OTLT 5GAOm 1XOVA 1ZUYA 2GTJA 3E9FA 1WNLA 4AFUC 3CC7T 2CDTA 1TSFA 2DERA 2EQJA 1X75C 3LW5E 3RKWA 2QAZA 2HQXA 2VVKA 1M30A 2PVOB 4ZGEB 2DETA 4M77A 4C92A 1E6HA 2JN0A 1VYTA 1HJDA 3QKJA 4BI3A 3OQ5A 4XU1A 4C5IA 2ZCFB 5KH6A 5IN1A 2OTLQ 2HL3A 2QQRA 4ATOA 2K5FA 1YJWA 1P92A 3CC7Q 4AMCA 1BBZA 2J06A 2M16A 2YLCA 2YRDA 3R6OA 2CZ7B 1D0XA 3EFOA 3MO8A 2RF0A 4J8OA 2CP6A 1AOJA 1TG0A 2PVDB 1VYUA 4IUTA 1GL5A 1OU8A 2QYZA 1JQQA 3BE3A 4TVRA 2GGRA 1KQSS 1V29B 4EPCA 4XTVA 2L8DA 4KGXB 2KAFA 3KXTA 2PVGB 5A0GA 4AT1B 2CGHA 5GAMe 2QEXA 1Q81C 2RQWA 5LJ3j 3EGDA 3RIRA 4IUPA 4EMKA 4AG2C 4M78E 2K4YA 4R56A 2VKNA 4Z8AA 1TXQA 4OB2B 5KYNA 4WTOB 2O01E 3BY7A 4ZN1A 3M0TA 1Q86C 1X01A 1RAIB 2LZ6B 2E5QA 5I22A 5FW9A 1QCFA 2NUPB 5GAOp 3VS2A 1GFCA 3HP9A 3J80E 4JLGA 4FL6A 2ABLA 5GJVB 3VJPA 4IIMA 3RUXA 2X9HA 3LLRA 1AWWA 5KE3A 5L8RE 3CCMA 4C8QA 4HCCA 2LC4A 2KDSA 4M7DE 2EFIA 4LN2A 4M78C 2MPXC 2F2XA 5HK3A 2CZ0B 3HKSA 4V2SA 3EG2A 1T3LA 3M0QA 4CI0C 2DXCA 3QIIA 2KXDA 1SEMA 4FIBA 4JZ3A 4XK8E 1VQ6A 5KYWA 2A0FB 2FZGB 1D09B 1V1CA 2FYKA 3LYIA 5EG2A 2DPPB 2BE9B 3D7SB 4M7DC 1NEGA 3A5ZB 2DD5A 4J9DA 3H0HA 1NG2A 3ER0A 1S72T 2GNCA 4DBRA 3EG9B 4PJOB 4C0DC 1OPLA 4PKCC 4X9CA 4C8QF 4M7AF 3PTAA 3J81E 2J7IA 3PMTA 2XDBA 2H3EB 2DXBA 1VOMA 4JRPA 3VS5A 5C0MA 5GANg 3CC4T 1JXMA 6AT1B 2VV5A 3SD4A 4RTZA 1Q7YR 1S72Q 2JS0A 3CCLT 4B9WA 1BI0A 1M8MA 4ANJA 1NBEB 2MF2A 4E7JA 1QMCA 2J6FA 3OB9A 2JJ9A 4XTUA 3UA7A 2LVMA 1PG5B 4M77B 1OZ3A 3ULRB 2R58A 4C92B 1YJ9A 4O5VA 4KULA 4C0FA 2HAXA 1N9RA 1GCPA 2V8JA 3CC4Q 3JB9I 3SHWA 5KYUA 3OBYA 1YBYA 2Y4YA 2RI2A 2QASA 3QSUA 2G6FX 3CCLQ 1QVGA 1JJ2S 1VQ8A 5KYYA 4OMOA 2MI6A 3M5AA 2HBWA 1UGRB 4J9BA 4E7IA 1YJWT 4OB3B 4CC2A 2XICA 2JTFA 4RCBA 2JM8A 4JS4A 3PE0A 4OMLA 2MK5A 3OBWA 1M4ZA 1KC8U 5A2QE 1N27A 3CPWA 1GBQA 1KC8C 1FMWA 3C95A 3CCSA 3CD6A 4QVCA 1YJWQ 2LT1A 3P8HA 4J6WA 4M75A 2DRKA 3M53A 2QEXT 1IGQA 3O8VA 2D0NA 4EMKB 1AZEA 1TUDA 2LJ1A 2DTOA 4JUVA 2QA4A 3LX7A 2DL8A 2HDAA 1M2VA 2RB6A 2J6KA 3G6EA 2MWPA 1M8VA 1XQHA 3ZFJA 3A8LB 2GCXA 2R5AA 5FROA 3EFSA 4L5GA 3AT1B 3OYHA 1R0BG 2QEXQ 1EX4A 5IHKA 3C0CA 4BE2A 1I4K1 4DQ2A 1O9SA 2RH2A 5GAMf 2DYBA 3CCMT 2LQWA 2L89A 2KROA 3PFSA 3DB4A 3VRYA 2DNUA 3CBMA 4FM4B 3OS2A 9ATCB 2DTHA 4PLLA 1VQ7Q 4HVWA 5D6YA 4M75F 4RTUA 3L2UA 5GJWB 1K9MR 1RADB 2ROLA 1VQLA 1SG5A 3UF4A 2RJEA 2A08A 1H641 2PQWA 2BKDN 1KK7A 2HD0A 2DKGA 2KXCA 5KYWB 5LJ3g 1VQ6T 4J9IA 2D0QB 4O6JA 4BACA 3CCMQ 1SSFA 4EDUA 1FXXA 1K9AA 2RJCA 5J39A 5IT9E 2F69A 4HT8A 1LOJA 5FU6C 1O75A 1AHJB 3JCMQ 2DL4A 4KH0B 3UA6A 3RR6A 3CEYA 4JRIA 4J9FA 5GAN6 3SDZA 4Z02A 2LTOA 2EPDA 1PRLC 3HRTA 2KRNA 5CVIA 3P8DA 1WHLA 1X6OA 2H3JA 3JRZA 3ZEHA 1G83A 2P4TA 2JVVA 1VQ9A 2CP7A 1M3AA 3QO3A 1H3ZA 3N5BB 2HSEB 2MIOA 3PIPA 1N5ZA 1RI0A 3CCVQ 1KIKA 2EGEA 4RTYA 3JB9F 3A98A 2KR3A 2CZ1B 1WA7A 3GNGA 1QQJA 2QI2A 1F1BB 1QWFA 5D6XA 4KUDK 2XD0A 2YSQA 4QQDA 2MMPA 2NUZA 3QZ5B 4HA8A 1AEYA 4QW2A 1KD1C 2DEUA 2DEQA 2FL7A 2I0NA 2DIQA 5CO7A 4BE0A 1D1BA 1YJ9T 5GAMd 3QDRB 1GRIA 4GLKA 1NE8A 3JCMW 4KT0E 2EYWA 3TU4K 3JCMh 4OF1A 5KYUB 2KK4A 3OY9A 4IUUA 2Y4XA 1ZSGA 3PIOA 2RI5A 4LDWA 1VQ8T 2LJ0A 3A8OB 4F16A 4KGZB 3KUFA 2A28A 2XK0A 1G8XA 2FPDA 4FU6A 5GANe 3CQTA 3JCMJ 4UC4A 3OMCA 1K9MU 1YJ9Q 3CCUA 2EQKA 2ZPFB 1G3SA 2QG9B 2ZPEB 3AHUA 3RKYA 1WDXA 4FCYA 3OYDA 2K7AA 4N0AC 3DLLA 4LNPA 2GFUA 2A3LA 3REBB 1VQ8Q 2E6NA 4PK4A 3UATA 4DOVA 5I2MA 3CCST 3CD6T 4M75B 2ESWA 3CPFA 4OMPA 3VS4A 5GMKl 4M7AD 3WVDB 5GAN2 4M78A 4JDSA 2KSSA 2RQTA 3CBOA 3MEVA 1ZLMA 4L6V5 3QUIA 1M2VB 1E6GA 2DO3A 2M0YA 2MCNA 2QA4T 1R8OB 1RABB 4QQGA 5J26A 2JT4A 2QDYB 1N8RC 1MNEA 3M54A 1YCSB 1GFDA 3QDFA 2ZAEA 3CCSQ 3CCEA 2KRSA 3CXCA 3V8JA 1HYOA 3UPUA 2E3IA 4WF2A 1D3BA 4NL3A 2QA4Q 4M7DA 2FB7A 2Y90A 1TS9A 4A4KA 1NM7A 4D6WA 3G6EQ 3UWNA 4PL6A 3JCMb 3V7CA 5A0LA 2CSIA 1W4SA 1M3CA 2FO0A 1TUGB 4LDXA 1Q81R 1NJIC 2OAUA 2BZXA 1K76A 3VYGA 1AZGB 2E70A 2YLBA 3X26B 1VQLT 3EG9A 1RAHB 4BDYA 2IVWA 3BDUA 2LCSA 1QVGS 3JCMg 4N4HA 1S1NA 1B07A 1Q86R 5FRNA 3CXCP 3EAEA 1BI1A 3EH1A 1UGSB 2ECZA 1PKTA 1YWOA 1I81A 1NYFA 1BIAA 1NLPC 3Q1JA 3L2ZA 1MUZA 2COYA 2EWNA 4FYWB 2DL5A 1YN8A 3MEUA 3I55A 3M0SA 1RI9A 4NS5A 4JJDA 5EC7A 1VQLQ 2CYZB 2ZPGB 4BE1A 2KYBA 3IQLA 4MZMA 1AD5A 1VQ9T 1QP3A 3CPWS 2KT1A 5CKEA 3VS0A 3LWIA 3VU3C 4A4FA 1VQKA 4F17A 3QHSA 1ZSZC 3INZA 3WXMB 2VGNA 1N9SA 5LJ3e 3HRSA 4FSSA 1QW1A 4F14A 2X4YA 2HCKA 5CKFA 2FRWA 1Y07A 2RJDA 3FRNA 3OMGA 4PJOF 4RTTA 2RO0A 5CKHA 4XTWA 4QT7A 1VQ9Q 1EZZB 1G3WA 1QCOA 8AT1B 2V8IA 1WIEA 2DAQA 4E7SA 1UTIA 4KGVB 4M7AG 2RHYA 1QLYA 4JZ4A 2RHUA 3REAB 4D8DA
chains in the Genus database with same CATH topology
3CC4T 3G6ET 2DIGA 2BIVA 2E41A 4ZGDB 3QZ9B 2VV5A 2RHXA 1WJSA 1BKBA 3SD4A 3A8HB 2RA2A 2LDMA 3CCLT 1WJRA 4FT4A 2EJGA 4B9WA 1BI0A 3L1AA 3OSVA 3CMET 2DK3A 2X35A 2MF2A 2I2LA 1M9SA 4LDYA 4E7JA 1YI2A 3OB9A 1Q81U 2M9UA 3QBYA 2EQUA 2WSEE 3TCJA 2WACA 4XTUA 5LJ3d 4KBMB 2LVMA 4M77F 4C92F 3I56T 4M77B 1OZ3A 3M4YA 2R58A 4M75C 4C92B 4O5VA 4QQ6A 3DLMA 1YJ9A 3CCUT 1QVFA 3BDLA 4KULA 2K2VA 4C0FA 2HAXA 1GXIE 1N9RA 3JB9J 4XU2A 4M77G 2V8JA 4RCCA 4C92G 4JRQA 4F7UE 5LJ5f 1VQPA 4VUBA 1YITA 2O4XA 3JB9I 1Q86U 2L5QA 3OBYA 3MHXA 1YBYA 2Y4YA 2RI2A 2VC8A 1OZ2A 3E1SA 2OTLA 3QSUA 1JJ2S 3URGA 5KCHA 1QVGA 4PNOA 1VQ8A 2QQSA 5CKDA 1NJIU 1VQ7A 2MI6A 2ZPHB 3M5AA 3L2WA 1Q82U 2LQ8A 2E12A 1UGRB 3QJYA 5GAN5 3CC7A 4E7IA 1YJWT 1Q82C 1K8AU 4M78F 3SWNA 1FWZA 4M78B 1K8AC 4OB3B 2B8AA 4F7UF 5FU7C 4F7UB 1W2BS 1G5VA 2LT4A 2XICA 2JTFA 2OTJA 4M78G 4RCBA 3OYJA 3GF5A 3VUZA 4IURA 2BUDA 3S6WA 4JS4A 2JUFA 1WPYA 4GY5A 3VV0A 4C5EA 3MP6A 2JZ2A 2P0KA 2FVUA 5CAIA 2F5TX 3OYAA 1VQOT 3NTIA 1KHIA 1UB4A 4C0ZA 3HFOA 2ZPBB 4HT9A 4LD6A 3E19A 1DJ7B 4Y91A 2L3RA 3OBWA 1G3TA 2VXFA 1M4ZA 1KC8U 5A2QE 1N27A 3CPWA 1MGQA 3E9GA 1KC8C 3C95A 2XDPA 3CCSA 4IKFA 2LX9A 4J7FA 4C5GA 5GMKe 3CCET 3CD6A 3OYCA 4QVCA 3OYNA 2E6ZA 2LT1A 3FLGA 3P8HA 3PMIA 4MZPA 4J6WA 2PUOB 1LNXA 4JLIA 2VUBA 4M75A 1QP2A 4CRIA 1BIBA 3M53A 5LJ5e 1VQNT 2QEXT 3O8VA 1D3BB 2KQWA 1HK9A 4PLIA 3NTHA 4EMKB 4M7DF 1UEBA 3PT9A 4M7DB 4JUVA 2DTOA 3FJPA 3ME9A 3OYLA 2QA4A 3LGLA 3MEAA 3LX7A 4M7DG 4A53A 2RB6A 3G6EA 3A8GB 2MWPA 3CCVA 5CK9A 4C0DB 4JS5A 3L2RA 3V8KA 1M8VA 4Y28E 4L59A 1XQHA 3ZFJA 3A8LB 3OW2S 2GCXA 2R5AA 1K73U 3FDRA 4J5YA 5FROA 4ZN3A 1YIJA 1XTDA 2PUKB 3EFSA 4L5GA 1K73C 3HHTB 2VXEA 4RKUE 5GAN4 1YJNT 3OYHA 1YHQA 1IZ6A 4HCZA 1M1GA 1NPPA 4IUVA 3OYBA 2K3XA 2RK2A 2LQKA 1Y96A 4E7HA 2R5MA 1KG1A 3TREA 3WVEB 3H8ZA 5IAYA 3M55A 4M75E 1K9MC 4BY6B 3ASKA 4BE2A 1I4K1 1KQ1A 3X25B 1ZHIA 3GPLA 3CMAT 4NL2A 3JCMf 4DQ2A 1O9SA 5CIUA 2RH2A 1HXDA 2ZGWA 5GAMf 3SWNC 2EIFA 1B34B 3CCMT 2K3YA 2L89A 3MP1A 4RMOA 1BI3A 4OMFB 4C8QG 3PFSA 5M9OA 2CZ6B 5GMKh 5LJ5d 3DB4A 3CBMA 4FM4B 4LD9K 3OS2A 3OYGA 5GAOq 2DTHA 2XU8A 4PLLA 2RI3A 5D6YA 4BI4A 4M75F 4M75D 3OYKA 3L2UA 1WQ7A 2YRVA 5LJ5h 4X9DA 3UDCA 5GAOr 5CR2A 3CCJA 3NTKA 4J6XA 3FIFA 4OVAA 4BB7A 2RHZA 3QJ6A 1KQ2A 3V7RA 1VQLA 2WSFE 4J6YA 2P0PA 2RJEA 3GIBA 3L42A 2HQEA 1H641 1OYXA 4XTYA 2PQWA 2XG8D 2BKDN 3OSSC 3T9NA 3JB9H 2HD0A 2DKGA 5LJ3g 4E7LA 1JJ2A 3H6ZA 1VQ6T 2D0QB 2GF7A 2LRQA 2LNVA 3MEWA 4J83A 4O6JA 4BACA 1VIEA 1VQMA 1SSFA 3QXEB 4EDUA 1FXXA 1NPRA 2RJCA 4XTXA 5J39A 2F69A 5IT9E 4HT8A 3X20B 1LOJA 5FU6C 1O75A 5GANd 1AHJB 2E10A 3JCMQ 3CCRT 3S3MA 3DB3A 4ZTFA 2M0OA 4EMGA 3CEYA 4JRIA 3VKIA 5CQYA 5GAN6 5A0DA 5GANj 1VQ4T 1VQKT 2E65A 3SDZA 1W2BA 3G71A 5FU7B 3G4ST 5LL6S 1KHCA 5GANh 3JCMV 2EJFA 2VYTA 4Z02A 2LTOA 3X28B 3RESA 5KCOA 3GOXA 5GAOn 2VGMA 3HRTA 5CVIA 1PSFA 3P8DA 1X6OA 1JB0E 2H3JA 4N4GA 4BD3A 2DTIA 3JRZA 2E64A 2KMTA 2P4TA 3ZEHA 3L2QA 2JVVA 3J7AF 2RM4A 2LCLA 4A4GA 1VQ9A 1XNIA 2DD4A 3QO3A 5CKBA 5I21A 3CC2A 4N0AA 3N5BB 4N4IA 2K5LA 2R57A 1H3ZA 2P0QA 3BFMA 4XU0A 1OI1A 3PIPA 4BI8B 3RMQA 3CXCS 1BYMA 2YHTA 1RI0A 4BDZA 3FEOA 4F7UG 2D6FA 3JB9F 3JB9D 3V7SA 2CZ1B 5GANf 3CCQT 3GNGA 2DXTA 5GAN7 4C92C 2DXUA 2QI2A 2ZPIB 5J3BA 2GQVA 4RG8A 2CKKA 2G3RA 4II1A 2XDDA 1JRIA 2QXFA 5D6XA 4KUDK 3LWHA 3OYEA 1S72A 2XD0A 4DA4A 4QQDA 5GAN8 1VQ5A 3RMSA 2X4XA 2MMPA 3EFRA 1UGPB 3GNFB 3QZ5B 4HA8A 4QW2A 3JCMX 5GAN3 5DY9A 2ZZDA 3OS5A 4BUGA 3OW2A 2DEQA 1JBMA 1YI2T 1KD1C 1I5LA 4PJOA 2FL7A 2DIQA 5KE2A 3VYHB 5CO7A 4BE0A 1I8FA 2XIDA 1Y71A 1YCYA 2DJZA 3JCMd 1M90U 4HCBA 2LCCA 4M7AA 3S3NA 2IG0A 1U8RA 2JTMA 3LGFA 1YJ9T 3RERA 2EKOA 3QDRB 5GAMd 1M90C 4GLKA 1NE8A 2EQMA 5GAMj 3CCJT 1ZQ1A 1QVPA 3JCMW 4KT0E 3QG1A 4A4EA 3JCMh 5HKCA 4OF1A 3TU4K 2O4XB 3CC4A 2KK4A 4B9XA 3OY9A 4IUUA 5GAMh 4C5HA 1VQPT 2Y4XA 2K5IA 5GAOl 5FLXE 1YITT 2RK1A 3PIOA 4ZGJB 4XQ3A 2RI5A 3HPWA 4MDWA 4LDWA 5DLQE 2OTLT 3CCLA 5GAOm 2NLUA 1XOVA 2PU9B 1UGQB 1VQ8T 2HNIA 3CMEA 1VQ7T 3SWNB 3A8OB 3E9FA 1WNLA 3KUFA 1G3YA 2XK0A 4ME7A 4NOYA 3CC7T 4LDVA 2EQJA 4FU6A 5GANe 1X75C 1MHNA 3LW5E 3RKWA 4UC4A 3JCMJ 3I56A 2RD1A 3OMCA 2DVEA 4RG2A 1K9MU 3CBPA 5D6WA 2HQXA 3HFNA 3CCUA 4PJOE 4OGCA 2PVOB 5I2SA 4ZGEB 2EQKA 2ZPFB 1G3SA 3V8LA 2OTJT 3HSBA 2ZPEB 3M9QA 4M77A 4C92A 3AHUA 3RKYA 2JN0A 3GLXA 3KBGA 2MAMA 2M1HA 3QKJA 4ELZC 3OYDA 3S3OA 4BI3A 4EMKC 3OQ5A 4XU1A 4C5IA 1WQWA 4N0AC 5LJ5g 2ZCFB 5KH6A 3DLLA 1M1FA 4P5NA 5IN1A 2GFUA 2HBPA 2EYQA 2A3LA 3VUBA 2EAYA 2QQRA 4ATOA 3HL8A 2K5FA 2E6NA 2XHCA 4DOVA 5I2MA 3CCST 3CD6T 3A8MB 4PJOD 5C6SA 4M75B 1YJWA 3CPFA 4QVZA 1P92A 4JJNK 1Q7YC 4ELYC 2RJFA 5FU6B 2YLCA 2F5KA 2M16A 3I55T 5GMKl 4M75G 4M7AD 4MDXA 2XI9A 3R6OA 3JCMP 2CZ7B 3WVDB 3MO8A 4M78A 4JDSA 5GAN2 2KSSA 5GMKm 2RHIA 4J8OA 3CBOA 3M57A 3MEVA 2WSCE 4YTLA 4L6V5 3C94A 1VQOA 3QUIA 5FRMA 2DO3A 2QA4T 1R8OB 2PVDB 4QQGA 2A7YA 5J26A 3SFMA 2QDYB 1N8RC 4PJOC 3GP8A 4IUTA 4M77E 2CS7A 4C92E 4BY6C 3M54A 2D9TA 4X34A 3CCVT 2QQAA 4TVRA 4M7AC 4C8QC 2K57A 1KQSS 1V29B 3CCEA 4EPCA 3CXCA 4XTVA 3V8JA 4XAXB 1YIJT 2L8DA 5DM7R 1Y7XA 1IREB 2KAFA 3JCMe 3KXTA 2PVGB 1Y96B 1N6AA 5A0GA 1YHQT 4Q5WA 4HKEA 4MMLA 5GAMe 2CGHA 3UPUA 1VQNA 2QEXA 3PGGA 3RKXA 2X4WA 1Q81C 4XU3A 1FX7A 4WF2A 5LJ3j 1VIFA 4M77D 4C92D 1WGSA 3RIRA 1D3BA 4IUPA 4NL3A 4EMKA 3META 5LJ3h 4M7DA 4M78E 2K4YA 2FB7A 2Y90A 3HRUA 4FSXA 4R56A 4A4KA 3OS0A 4FT2A 4D6WA 3P8BB 1RL2A 4OB2B 3QYGB 4R55A 4JRKA 4E47A 2C06A 4OB0B 2GFAA 4PL6A 3UWNA 2O01E 3BY7A 4ZN1A 3JCMb 3V7CA 5A0LA 1Q86C 1W4SA 1X01A 2E5QA 3JAME 4M77C 3BW1A 1YJNA 3OYIA 2JOYA 4LDXA 1QVFS 3G7ZA 3JB9G 1NJIC 5GAOp 5HK0A 2OAUA 3LH0A 1M1KU 2DZCA 2KVQG 3F70A 4M78D 2FHDA 3HP9A 4J7IA 4DOWA 3VYGA 4EMHA 4JLGA 3J80E 2KY9A 1TH7A 4FL6A 1M1KC 3VJPA 2QTXA 2YLBA 2E70A 1KD1U 3X26B 1VQLT 1U1TA 1U1SA 2DZ9A 4A54A 5LJ3f 3RUXA 3CMAA 4BDYA 4A4HA 2IVWA 3BDUA 3LLRA 3OS1A 5CQXA 1QVGS 3JCMg 4N4HA 5KE3A 5L8RE 3CCMA 1VQMT 4C8QA 4HCCA 2E1HA 2LC4A 5GAMg 5FRNA 2KDSA 3EAEA 4M7DE 1BI1A 2EFIA 1UGSB 3OYFA 1B34A 4M78C 1I81A 3C12A 1BIAA 2XKOC 3FB9A 3Q1JA 5HK3A 3L2ZA 2CZ0B 3G71T 3DKMA 2EWNA 4KUIA 3MEUA 3HKSA 3I55A 2EJ9A 4NS5A 4V2SA 3QPHA 4LDUA 1PSEA 4CI0C 2DXCA 3QIIA 3JSCA 4MMKA 3PNWC 2CYZB 2ZPGB 4FIBA 4OP0A 3JCMc 4BE1A 4M7DD 3L2VA 4C0GA 4OGEA 4MZMA 1VQ9T 3MP8A 4XK8E 1QP3A 3CPWS 5DLOA 1VQ6A 2JNGA 3TEEA 3CC2T 3NFCA 1NZ9A 5CKEA 3UT1A 3LWIA 3VU3C 4E7KA 3CCRA 3OYYA 2X4JA 5HY6A 3M59A 4A4FA 3ZBDA 1VQKA 2FYKA 1VQ4A 3QHSA 4ZTJA 3LYIA 5EG2A 1EIFA 2MWOA 1BI2A 4M7AE 4C8QE 3INZA 4MZTA 3WXMB 3G4SA 2VGNA 4QVDA 1N9SA 2DPPB 5LJ3e 4M7DC 4OB1B 3HRSA 1QW1A 3A5ZB 2DD5A 3SB2A 3MCAB 2AHJB 2X4YA 5CKFA 3ER0A 1Q7YU 3FRNA 1Y07A 2RJDA 3QYHB 2V8KA 3OMGA 4PJOF 1S72T 1VQ5T 4PJOB 2RO0A 5CKHA 4C0DC 4XTWA 1VUBA 3M56A 3M4GA 5GMKi 1WJQA 4PKCC 1ZBXA 5GANg 1KQSA 4PJOG 4X9CA 1M5Q1 4C8QF 4M7AF 4M7AB 4C8QB 4C8QD 3J81E 4IUQA 5GMKj 3PTAA 3PMTA 1G3WA 2XDBA 5CCAA 2QQBA 3OYMA 2QQ9A 2V8IA 2DXBA 2DAQA 4F7UA 4M7AG 3FC3A 2RHYA 1N8RU 5AYFA 5LJ5j 3CCQA 1LJOA 2RHUA 3OA6A 4JRPA 3X24B 3M58A 3C4SA 4XTZA 5C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQY A;  5CKF A;  4ME7 A;  5CO7 A;  5CQX A;  2C06 A;  1X75 C;  4MZM A;  5CKH A;  1UB4 A;  4VUB A;  4ELY C;  5CR2 A;  5DLO A;  1VUB A;  1NE8 A;  3NFC A;  4MDX A;  5CKE A;  2MF2 A;  4OF1 A;  4HKE A;  5CKD A;  5HKC A;  3G7Z A;  5CCA A;  5CK9 A;  5HK3 A;  3TCJ A;  5HK0 A;  4ELZ C;  3JRZ A;  2KMT A;  4MZT A;  4MZP A;  3HPW A;  5CKB A;  1M1F A;  2VUB A;  3VUB A;  3JSC A; 
#chains in the Genus database with same CATH topology
 3VS1 A;  2BIV A;  2GBQ A;  4ZGD B;  3EHR A;  2DBM A;  1JO8 A;  1WJS A;  1NEB A;  4FT4 A;  2EJG A;  3MPU B;  2NWM A;  3L1A A;  1LPL A;  2X35 A;  2AZV A;  2I2L A;  1YI2 A;  1Q81 U;  1UGV A;  2WSE E;  4PFO A;  3SEM A;  1PM3 A;  4M77 F;  4C92 F;  2YUN A;  3M4Y A;  1QVF A;  2EYX A;  3CCU T;  1GXI E;  1YP5 A;  1B7T A;  3JB9 J;  2E3H A;  5LJ5 f;  1VQP A;  2D8H A;  2DIL A;  1YIT A;  1M3B A;  1Q86 U;  3E1S A;  1M2O A;  3URG A;  5KCH A;  4PNO A;  2HMA A;  1VQ7 A;  2ZPH B;  1K4U S;  1JEG A;  2E12 A;  1KSW A;  5GAN 5;  4PFP A;  1K8A U;  4M78 B;  1K8A C;  2LT4 A;  3CCU Q;  2OTJ A;  2BUD A;  1MND A;  3S6W A;  2JUF A;  1C0M A;  3MJX A;  4GY5 A;  1SSH A;  4C5E A;  2P0K A;  5CAI A;  2FVU A;  3OYA A;  1UB4 A;  4D8K A;  1RAC B;  1AWJ A;  4Y91 A;  1X69 A;  1G3T A;  1X2K A;  1MGQ A;  2O88 A;  2LX9 A;  4C5G A;  3CCE T;  2EQI A;  2E6Z A;  1RAE B;  3PMI A;  1Z9Z A;  4GBQ A;  1T3S A;  2JS2 A;  2PUO B;  1QVF P;  2VUB A;  2ENM A;  1SRL A;  1D3B B;  1HK9 A;  1UEB A;  3PT9 A;  1W2B P;  4M7D B;  4CC4 B;  1KFZ A;  2HKN A;  4A53 A;  1UJ0 A;  2RQV A;  2YUP A;  2COW A;  1KC8 R;  3CCV A;  4C0D B;  1GCQ C;  4L59 A;  1K73 U;  3FDR A;  3CCE Q;  2BTT A;  1YIJ A;  1XTD A;  1K73 C;  3M0U A;  4RKU E;  3GBQ A;  1M1G A;  2CH4 W;  4IUV A;  3OYB A;  1Y96 A;  1ZBJ A;  1OQK A;  4E7H A;  3H8Z A;  5IAY A;  1ZA2 B;  3M55 A;  3I35 A;  4BY6 B;  1KQ1 A;  4NL2 A;  4RTV A;  4PJL A;  1Y57 A;  5CIU A;  2ZGW A;  3SWN C;  2K3Y A;  5M9O A;  4F04 B;  5LJ5 d;  2XU8 A;  1BB9 A;  1SPK A;  2YRV A;  4X9D A;  2DVJ A;  3UDC A;  5GAO r;  5CR2 A;  1Q95 G;  4OVA A;  4BB7 A;  3QJ6 A;  2WSF E;  4J6Y A;  2P0P A;  1MMD A;  3GIB A;  1OYX A;  3EG0 A;  3T9N A;  3JB9 H;  4E7L A;  2DX1 A;  2L2P A;  2LNV A;  1VQM A;  2DM1 A;  5GAN d;  4ZTF A;  2E10 A;  3DB3 A;  1VQK T;  3G71 A;  2KYM A;  5LL6 S;  2DL7 A;  4AG1 C;  3I55 Q;  1PSF A;  4BD3 A;  4N4G A;  3L2Q A;  1UE9 A;  3J7A F;  3NHN A;  5CKB A;  3CC2 A;  1W1F A;  4N0A A;  4N4I A;  3BFM A;  1BYM A;  1OI1 A;  4BI8 B;  3RMQ A;  3CXC S;  1UHC A;  1AT1 B;  4BDZ A;  1VQK Q;  2Z0W A;  4F7U G;  4J9C A;  1WHH A;  3V7S A;  1OPK A;  2DXT A;  4C92 C;  1CKB A;  4E7Z A;  4RG8 A;  4II1 A;  1ABO A;  2XDD A;  2W10 A;  3OYE A;  2X4X A;  3EFR A;  1UGP B;  1M27 C;  1HD3 A;  1X27 A;  3NMZ C;  5GAN 3;  5DY9 A;  2YRC A;  2ZZD A;  1ARK A;  2J6O A;  1YI2 T;  3I9Q A;  4GLM A;  1YNZ A;  5KE2 A;  1YCY A;  2DJZ A;  2FRY A;  1M90 U;  2LCC A;  3S3N A;  2M02 A;  2EKO A;  1M90 C;  1ZQ1 A;  3E2U A;  4J9E A;  2JTE A;  5GAM h;  1W6X A;  4C5H A;  1VQP T;  5GAO l;  1MMA A;  1YIT T;  2RK1 A;  4ZGJ B;  1IXD A;  4FYX B;  2NLU A;  2HNI A;  1VQ7 T;  3VS6 A;  1G3Y A;  1YI2 Q;  4LDV A;  4A63 B;  1MHN A;  1K1Z A;  2RD1 A;  2ROT A;  3I56 A;  5D6W A;  1RAA B;  2COZ A;  4ESR A;  1UDL A;  2KEA A;  4OGC A;  5I2S A;  2OTJ T;  3V8L A;  1J3T A;  3M9Q A;  2RQU A;  1KJW A;  3KBG A;  1IHV A;  2MAM A;  2M1H A;  3S3O A;  2LMJ A;  4EMK C;  1VQP Q;  1WQW A;  1YIT Q;  1AVZ C;  2HBP A;  3O5Z A;  2EYQ A;  5KYX A;  3VUB A;  2XHC A;  3A8M B;  4PJO D;  5C6S A;  1Q7Y C;  4ELY C;  2A37 A;  1OX8 A;  4J9G A;  5FU6 B;  2F5K A;  1K0X A;  3JV3 A;  4MDX A;  2OTJ Q;  2WSC E;  2FPE A;  3C94 A;  1VQO A;  5FRM A;  2A7Y A;  4HXJ A;  3SFM A;  3GP8 A;  3KFV A;  2D9T A;  3CCV T;  4M7A C;  4Z88 A;  2JM9 A;  2K57 A;  4C8Q C;  2HZY A;  4X1V A;  4XAX B;  1YIJ T;  4CC3 A;  5DM7 R;  1Y7X A;  1IRE B;  1IRX A;  2FEI A;  2C0T A;  1Y96 B;  1N6A A;  4MML A;  2X4W A;  2F1L A;  1FX7 A;  3ZL7 C;  1VIF A;  4M77 D;  4C92 D;  1ZSZ A;  1N8R R;  3MET A;  1PCX A;  3HRU A;  4FSX A;  1RLP C;  2K6D A;  2MYS A;  4HCK A;  2PNI A;  1RL2 A;  1E7O A;  3QYG B;  4R55 A;  2C06 A;  1R77 A;  4OB0 B;  1WXB A;  2K79 A;  3H0F A;  1H92 A;  1YIJ Q;  1QKW A;  3BW1 A;  1YJN A;  1PWT A;  2HEQ A;  2ATC B;  3G7Z A;  1QVF S;  2X3W D;  5HK0 A;  1M1K U;  1WHM A;  2FHD A;  4J7I A;  4EMH A;  2KY9 A;  1M1K C;  1KD1 U;  3TSW A;  1U1T A;  2DZ9 A;  4A54 A;  3CMA A;  4A4H A;  1C6V X;  4JPB W;  2BE7 D;  1VQM T;  1SKU B;  2E1H A;  5GAM g;  1B34 A;  3C12 A;  1FMV A;  3RDV A;  1NJI R;  1Y0M A;  4HVV A;  1WHJ A;  3G71 T;  4KUI A;  2AK5 A;  1PD1 A;  4PJN A;  3QPH A;  4LDU A;  1ZUU A;  4MMK A;  3JSC A;  2RPN A;  4OP0 A;  1LVK A;  3L2V A;  4C0G A;  4OGE A;  3MP8 A;  2JNG A;  3TEE A;  3CC2 T;  2CRE A;  1VQM Q;  1SRM A;  2BZY A;  1U5S A;  1NZ9 A;  1I07 A;  5HY6 A;  3ZBD A;  4DEY A;  4FYV B;  1EIF A;  1BI2 A;  1WYX A;  4LUD A;  4MZT A;  3G71 Q;  4PFZ A;  3G4S A;  2KRM A;  4OB1 B;  3EGX B;  3SB2 A;  1Z9Q A;  3MCA B;  2AHJ B;  4Y92 A;  4OMQ A;  3QYH B;  2V8K A;  2XMF A;  1IO6 A;  1VUB A;  3M56 A;  2FZC B;  1ZBX A;  3CC2 Q;  4PJO G;  5ECA A;  2CUB A;  4C8Q D;  4IUQ A;  5GMK j;  2OJ2 A;  4Z89 A;  2PZ1 A;  3OYM A;  4HVU A;  1TTH B;  3FC3 A;  1N8R U;  5LJ5 j;  3CCQ A;  2AT1 B;  1LJO A;  3OA6 A;  3X24 B;  3M58 A;  3C4S A;  2D1X A;  4XTZ A;  3G6E T;  2DIG A;  2E41 A;  1FMK A;  2KNB B;  2RHX A;  1BKB A;  3A8H B;  1WJR A;  1OV3 A;  1CSK A;  3OSV A;  1M9S A;  4LDY A;  2M9U A;  2EQU A;  2ED0 A;  4KBM B;  3I56 T;  4M75 C;  2L3S A;  4QQ6 A;  4DEX A;  2K2V A;  4XU2 A;  4M77 G;  4RCC A;  4C92 G;  2IIM A;  3RBB B;  4F7U E;  2E4H A;  3H0I A;  1H8K A;  4VUB A;  1R0C B;  5KYX B;  3MHX A;  2QK0 A;  2VC8 A;  1OZ2 A;  5CKD A;  1NJI U;  1Q82 U;  1TUC A;  2LQ8 A;  1A0N B;  1Q82 C;  4M78 F;  3SWN A;  1X43 A;  1FWZ A;  1BU1 A;  3RNJ A;  3I56 Q;  2B8A A;  5FU7 C;  4B6M A;  4F7U B;  5AT1 B;  1GBR A;  3CCR Q;  3GF5 A;  3VUZ A;  4IUR A;  4FW1 A;  4DBQ A;  1WPY A;  3VV0 A;  3MP6 A;  2JZ2 A;  1VQO T;  2F5T X;  1PHT A;  3HFO A;  2HQH A;  3E19 A;  1DJ7 B;  2QTV A;  1K0S A;  1RLQ C;  3E9G A;  4IKF A;  4J7F A;  3OYN A;  1PC0 A;  1K8A R;  3FLG A;  4MZP A;  4JLI A;  1QP2 A;  2DE0 X;  1ZSZ B;  2KQW A;  4PLI A;  2PTK A;  4M7D F;  2BZ8 A;  5IHI A;  1X6G A;  3ME9 A;  1VQO Q;  2DLP A;  2JW4 A;  2DF6 A;  4M4Z A;  2DBK A;  4JS5 A;  3L2R A;  4LXC A;  4J5Y A;  1MMG A;  2KGT A;  3I5S A;  1IHW A;  3HHT B;  2VXE A;  5GAN 4;  1YJN T;  1YHQ A;  1IZ6 A;  1YWP A;  2K9G A;  4HCZ A;  4RTW A;  1ZUK A;  2RK2 A;  2RQR A;  2NUT A;  2LQK A;  2R5M A;  3TRE A;  2RMO A;  3X25 B;  3CMA T;  1ZHI A;  3GPL A;  2VAS A;  4JJB A;  2QDL A;  1HXD A;  1B34 B;  3MP1 A;  2FG0 A;  4OMF B;  4C8Q G;  1MV3 A;  5GMK h;  1W70 A;  1K73 R;  4LD9 K;  3OYG A;  1ZA1 B;  1OUL A;  1YJN Q;  2RI3 A;  1AWO A;  4M75 D;  3OYK A;  1WQ7 A;  5LJ5 h;  3CCJ A;  3NTK A;  1KQ2 A;  2GTO A;  3V7R A;  2MOX A;  1I1J A;  2HQE A;  3L42 A;  3VRZ A;  3CMA Q;  2XG8 D;  3OSS C;  4J83 A;  2SEM A;  2D8J A;  1NPR A;  4XTX A;  2EVR A;  2GQI A;  3S3M A;  1PNJ A;  1TU0 B;  2M0O A;  5CQY A;  2JMA A;  1WHG A;  2H8H A;  1W2B A;  2EW3 A;  1UFF A;  3G4S T;  5GAN h;  1WXU A;  2FPF A;  3R6N A;  2EJF A;  2DL3 A;  3RES A;  5GAO n;  3THK A;  2VGM A;  1PKS A;  1WXT A;  1JB0 E;  2E64 A;  2KMT A;  2RNA A;  2DRM A;  1UJY A;  2LCL A;  1UUE A;  2KI7 A;  1OOT A;  1UEC A;  2R57 A;  2YHT A;  3FEO A;  2J05 A;  3JB9 D;  5GAN f;  3CCQ T;  3G4S Q;  5GAN 7;  2ZPI B;  2GQV A;  3EG3 A;  2KE9 A;  2CKK A;  2G3R A;  1JRI A;  3U23 A;  2QXF A;  3LWH A;  2DA9 A;  5GAN 8;  1VQ5 A;  3RMS A;  3GNF B;  4CC7 A;  2CP5 A;  3JCM X;  4BUG A;  3OW2 A;  2JXB A;  2HSP A;  3VYH B;  1I8F A;  1HSQ A;  2XID A;  4M7A A;  2IG0 A;  2JTM A;  3RER A;  2EBP A;  2EQM A;  2ED1 A;  5GAM j;  3CCQ Q;  1UG1 A;  2A36 A;  4A4E A;  5HKC A;  3H9N A;  3I5R A;  1RAF B;  5FLX E;  4AFS C;  3HPW A;  4MDW A;  5IXB A;  5DLQ E;  3H41 A;  2PU9 B;  2VWF A;  1UGQ B;  3CME A;  3SWN B;  3EH2 A;  1FYN A;  4ME7 A;  4NOY A;  2LX7 A;  1NLO C;  1M90 R;  4RG2 A;  2DVE A;  3CBP A;  3HFN A;  4PJO E;  2C0O A;  1BCO A;  3HTR A;  3HSB A;  3PVQ A;  1SHF A;  3GLX A;  4ELZ C;  2CP3 A;  1ACM B;  2CT4 A;  5LJ5 g;  3FJ5 A;  1M1F A;  2LJ3 A;  4P5N A;  1SHG A;  3M0R A;  2EAY A;  3OW2 P;  3HL8 A;  4QVZ A;  4JJN K;  1H3H A;  2RJF A;  3I55 T;  4M75 G;  2XI9 A;  3JCM P;  1WZO A;  5GMK m;  2RHI A;  2LP5 A;  3M57 A;  4YTL A;  1WLP B;  5IH2 A;  2CP0 A;  4PJO C;  2P84 A;  4M77 E;  4C92 E;  2CS7 A;  1U06 A;  4BY6 C;  4X34 A;  2QQA A;  1VA7 A;  2NUT B;  3JCM e;  5IXF A;  5D7U A;  2KT8 A;  1YHQ T;  4Q5W A;  4HKE A;  1VQN A;  3PGG A;  2QGF B;  3RKX A;  4XU3 A;  2X3X D;  1WGS A;  2AKK A;  5LJ3 h;  3OS0 A;  4FT2 A;  2K3B A;  3P8B B;  3TVT A;  4JRK A;  2DYI A;  4E47 A;  1D0Y A;  2GFA A;  2YXY A;  2IPO B;  1JXO A;  1I0C A;  3JAM E;  4M77 C;  2L3Q A;  3OYI A;  2JOY A;  2VB6 A;  3JB9 G;  1YHQ Q;  3LH0 A;  3EGX A;  2DZC A;  2KVQ G;  3EFO B;  3F70 A;  4M78 D;  3CCJ T;  4DOW A;  1TH7 A;  2QTX A;  2L3P A;  1U1S A;  5LJ3 f;  3OS1 A;  5CQX A;  3OYF A;  3NGP A;  1QWE A;  2AKL A;  2YWW A;  4QKU A;  2XKO C;  3FB9 A;  5IHN A;  1ABQ A;  3DKM A;  7AT1 B;  5L23 A;  1M1K R;  8ATC B;  2EJ9 A;  3CCJ Q;  1VYV A;  4R0K A;  1PSE A;  1KD1 R;  3EGD B;  3PNW C;  4FYY B;  1MMN A;  3JCM c;  4M7D D;  2F2V A;  5DLO A;  3VS3 A;  3NFC A;  3UT1 A;  1QVG P;  4E7K A;  3CCR A;  3OYY A;  2X4J A;  1YFN A;  1T0J A;  3M59 A;  1VQ4 A;  2OI3 A;  4ZTJ A;  2MWO A;  4M7A E;  4C8Q E;  1U3O A;  1D0Z A;  4QVD A;  2O9S A;  3PVL A;  4KH1 B;  4RUG A;  1Q7Y U;  1VQ5 T;  1UHF A;  3M4G A;  1QCN A;  4DBF A;  5GMK i;  1WJQ A;  1RAG B;  1KQS A;  1M5Q 1;  4M7A B;  4C8Q B;  3CPW P;  5CCA A;  2QQB A;  2QQ9 A;  4F7U A;  3LH5 A;  2O2O A;  5AYF A;  1AWX A;  2EGA A;  5FWB A;  3QZ9 B;  4JJC A;  4DBH A;  2RA2 A;  2LDM A;  1VQ5 Q;  4E2F B;  2HKQ B;  3CME T;  2DK3 A;  1IGU A;  3QBY A;  3MKD A;  3TCJ A;  2WAC A;  5LJ3 d;  2C0I A;  2NYS A;  3A1P A;  3DLM A;  1C1A A;  3BDL A;  2V1Q A;  4ORZ A;  1WX6 A;  1X2Q A;  4JRQ A;  4WCI A;  1T0H A;  2O4X A;  2L5Q A;  2OTL A;  3EHQ A;  2DJQ A;  1XJW B;  2O9V A;  2CUD A;  2QQS A;  1KQS P;  4FW2 A;  3CME Q;  2K2M A;  3L2W A;  2CT3 A;  5FWC A;  3CC7 A;  3QJY A;  2CSQ A;  3G1J A;  1VQ6 Q;  3QWX X;  4F7U F;  1W2B S;  2X51 A;  1G5V A;  4M78 G;  3OYJ A;  1EFN A;  1IB8 A;  2RN8 A;  1TWB A;  4OMN A;  2YT6 A;  3NTI A;  1KHI A;  4C0Z A;  2ZPB B;  4HT9 A;  2HL5 C;  4LD6 A;  1RUW A;  4EIK A;  2L3R A;  2VXF A;  1OU9 A;  1OEB A;  1X6B A;  2EGC A;  2XDP A;  1Q82 R;  5GMK e;  3OYC A;  1BK2 A;  1LNX A;  1B3Q A;  1G2B A;  1MV0 B;  2LQN A;  2E5K A;  1BIB A;  4CRI A;  5LJ5 e;  1WI7 A;  1VQN T;  3NTH A;  3FJP A;  3TSZ A;  4ZNX A;  3OYL A;  2F2W A;  3LGL A;  3MEA A;  4K11 A;  2SRC A;  4M7D G;  1D1C A;  2YUO A;  3A8G B;  5CK9 A;  3QWY A;  3V8K A;  2P4R A;  4Y28 E;  3OW2 S;  5KYY B;  1D1A A;  2W0Z A;  4ZN3 A;  2V26 A;  2KBT A;  2PUK B;  2AZS A;  2CH4 A;  2B86 A;  1NPP A;  2K3X A;  1VQN Q;  1SF9 A;  1LCK A;  1KG1 A;  2LNH B;  3WVE B;  4M75 E;  1K9M C;  3ASK A;  3JCM f;  2DFU A;  2YDL A;  2EIF A;  4RMO A;  1BI3 A;  2CZ6 B;  1QKX A;  3TQ7 P;  2OAW A;  1JU5 C;  5GAO q;  3M0P A;  4J9H A;  1TOV A;  4BI4 A;  2L0A A;  2OX7 A;  1CKA A;  4J6X A;  3FIF A;  2NUP A;  2RHZ A;  1PD0 A;  2V1R A;  1WFW A;  2JMC A;  1WHK A;  4XTY A;  4RTX A;  4E6R A;  1JJ2 A;  3H6Z A;  2GF7 A;  2LRQ A;  3MEW A;  1VIE A;  1GCQ A;  3QXE B;  4AFQ C;  3X20 B;  3CCR T;  2CP2 A;  5GAN j;  4EMG A;  3VKI A;  1VQ4 T;  5A0D A;  4PJJ A;  2E65 A;  4AFZ C;  3CD6 Q;  1NYG A;  4LE9 A;  5FU7 B;  1OX9 A;  1KHC A;  3JCM V;  3X28 B;  2VYT A;  2EKH A;  5KCO A;  3GOX A;  2DTI A;  3EG1 A;  2RM4 A;  2EYY A;  4A4G A;  1XNI A;  2QGG A;  2DD4 A;  5I21 A;  1PRM C;  2YUQ A;  2K5L A;  3NPF A;  2P0Q A;  4XU0 A;  1BCM A;  1VQ4 Q;  2D6F A;  4OMM A;  1ZX6 A;  5I11 A;  2DXU A;  5J3B A;  4IIO A;  1I5O B;  1S72 A;  4DA4 A;  2O31 A;  1JJ2 P;  4PJM A;  3OS5 A;  4PJO A;  3VS7 A;  1JBM A;  1I5L A;  4KRT A;  4HCB A;  2EYZ A;  1Y71 A;  3JCM d;  4LUE A;  1U8R A;  3LGF A;  2DMO A;  1V76 A;  1QVP A;  3EGU A;  3QG1 A;  2AIR B;  5HCK A;  2O4X B;  3CC4 A;  4B9X A;  2K5I A;  4XQ3 A;  2FZK B;  2M51 A;  3CCL A;  2OTL T;  5GAO m;  1XOV A;  1ZUY A;  2GTJ A;  3E9F A;  1WNL A;  4AFU C;  3CC7 T;  2CDT A;  1TSF A;  2DER A;  2EQJ A;  1X75 C;  3LW5 E;  3RKW A;  2QAZ A;  2HQX A;  2VVK A;  1M30 A;  2PVO B;  4ZGE B;  2DET A;  4M77 A;  4C92 A;  1E6H A;  2JN0 A;  1VYT A;  1HJD A;  3QKJ A;  4BI3 A;  3OQ5 A;  4XU1 A;  4C5I A;  2ZCF B;  5KH6 A;  5IN1 A;  2OTL Q;  2HL3 A;  2QQR A;  4ATO A;  2K5F A;  1YJW A;  1P92 A;  3CC7 Q;  4AMC A;  1BBZ A;  2J06 A;  2M16 A;  2YLC A;  2YRD A;  3R6O A;  2CZ7 B;  1D0X A;  3EFO A;  3MO8 A;  2RF0 A;  4J8O A;  2CP6 A;  1AOJ A;  1TG0 A;  2PVD B;  1VYU A;  4IUT A;  1GL5 A;  1OU8 A;  2QYZ A;  1JQQ A;  3BE3 A;  4TVR A;  2GGR A;  1KQS S;  1V29 B;  4EPC A;  4XTV A;  2L8D A;  4KGX B;  2KAF A;  3KXT A;  2PVG B;  5A0G A;  4AT1 B;  2CGH A;  5GAM e;  2QEX A;  1Q81 C;  2RQW A;  5LJ3 j;  3EGD A;  3RIR A;  4IUP A;  4EMK A;  4AG2 C;  4M78 E;  2K4Y A;  4R56 A;  2VKN A;  4Z8A A;  1TXQ A;  4OB2 B;  5KYN A;  4WTO B;  2O01 E;  3BY7 A;  4ZN1 A;  3M0T A;  1Q86 C;  1X01 A;  1RAI B;  2LZ6 B;  2E5Q A;  5I22 A;  5FW9 A;  1QCF A;  2NUP B;  5GAO p;  3VS2 A;  1GFC A;  3HP9 A;  3J80 E;  4JLG A;  4FL6 A;  2ABL A;  5GJV B;  3VJP A;  4IIM A;  3RUX A;  2X9H A;  3LLR A;  1AWW A;  5KE3 A;  5L8R E;  3CCM A;  4C8Q A;  4HCC A;  2LC4 A;  2KDS A;  4M7D E;  2EFI A;  4LN2 A;  4M78 C;  2MPX C;  2F2X A;  5HK3 A;  2CZ0 B;  3HKS A;  4V2S A;  3EG2 A;  1T3L A;  3M0Q A;  4CI0 C;  2DXC A;  3QII A;  2KXD A;  1SEM A;  4FIB A;  4JZ3 A;  4XK8 E;  1VQ6 A;  5KYW A;  2A0F B;  2FZG B;  1D09 B;  1V1C A;  2FYK A;  3LYI A;  5EG2 A;  2DPP B;  2BE9 B;  3D7S B;  4M7D C;  1NEG A;  3A5Z B;  2DD5 A;  4J9D A;  3H0H A;  1NG2 A;  3ER0 A;  1S72 T;  2GNC A;  4DBR A;  3EG9 B;  4PJO B;  4C0D C;  1OPL A;  4PKC C;  4X9C A;  4C8Q F;  4M7A F;  3PTA A;  3J81 E;  2J7I A;  3PMT A;  2XDB A;  2H3E B;  2DXB A;  1VOM A;  4JRP A;  3VS5 A;  5C0M A;  5GAN g;  3CC4 T;  1JXM A;  6AT1 B;  2VV5 A;  3SD4 A;  4RTZ A;  1Q7Y R;  1S72 Q;  2JS0 A;  3CCL T;  4B9W A;  1BI0 A;  1M8M A;  4ANJ A;  1NBE B;  2MF2 A;  4E7J A;  1QMC A;  2J6F A;  3OB9 A;  2JJ9 A;  4XTU A;  3UA7 A;  2LVM A;  1PG5 B;  4M77 B;  1OZ3 A;  3ULR B;  2R58 A;  4C92 B;  1YJ9 A;  4O5V A;  4KUL A;  4C0F A;  2HAX A;  1N9R A;  1GCP A;  2V8J A;  3CC4 Q;  3JB9 I;  3SHW A;  5KYU A;  3OBY A;  1YBY A;  2Y4Y A;  2RI2 A;  2QAS A;  3QSU A;  2G6F X;  3CCL Q;  1QVG A;  1JJ2 S;  1VQ8 A;  5KYY A;  4OMO A;  2MI6 A;  3M5A A;  2HBW A;  1UGR B;  4J9B A;  4E7I A;  1YJW T;  4OB3 B;  4CC2 A;  2XIC A;  2JTF A;  4RCB A;  2JM8 A;  4JS4 A;  3PE0 A;  4OML A;  2MK5 A;  3OBW A;  1M4Z A;  1KC8 U;  5A2Q E;  1N27 A;  3CPW A;  1GBQ A;  1KC8 C;  1FMW A;  3C95 A;  3CCS A;  3CD6 A;  4QVC A;  1YJW Q;  2LT1 A;  3P8H A;  4J6W A;  4M75 A;  2DRK A;  3M53 A;  2QEX T;  1IGQ A;  3O8V A;  2D0N A;  4EMK B;  1AZE A;  1TUD A;  2LJ1 A;  2DTO A;  4JUV A;  2QA4 A;  3LX7 A;  2DL8 A;  2HDA A;  1M2V A;  2RB6 A;  2J6K A;  3G6E A;  2MWP A;  1M8V A;  1XQH A;  3ZFJ A;  3A8L B;  2GCX A;  2R5A A;  5FRO A;  3EFS A;  4L5G A;  3AT1 B;  3OYH A;  1R0B G;  2QEX Q;  1EX4 A;  5IHK A;  3C0C A;  4BE2 A;  1I4K 1;  4DQ2 A;  1O9S A;  2RH2 A;  5GAM f;  2DYB A;  3CCM T;  2LQW A;  2L89 A;  2KRO A;  3PFS A;  3DB4 A;  3VRY A;  2DNU A;  3CBM A;  4FM4 B;  3OS2 A;  9ATC B;  2DTH A;  4PLL A;  1VQ7 Q;  4HVW A;  5D6Y A;  4M75 F;  4RTU A;  3L2U A;  5GJW B;  1K9M R;  1RAD B;  2ROL A;  1VQL A;  1SG5 A;  3UF4 A;  2RJE A;  2A08 A;  1H64 1;  2PQW A;  2BKD N;  1KK7 A;  2HD0 A;  2DKG A;  2KXC A;  5KYW B;  5LJ3 g;  1VQ6 T;  4J9I A;  2D0Q B;  4O6J A;  4BAC A;  3CCM Q;  1SSF A;  4EDU A;  1FXX A;  1K9A A;  2RJC A;  5J39 A;  5IT9 E;  2F69 A;  4HT8 A;  1LOJ A;  5FU6 C;  1O75 A;  1AHJ B;  3JCM Q;  2DL4 A;  4KH0 B;  3UA6 A;  3RR6 A;  3CEY A;  4JRI A;  4J9F A;  5GAN 6;  3SDZ A;  4Z02 A;  2LTO A;  2EPD A;  1PRL C;  3HRT A;  2KRN A;  5CVI A;  3P8D A;  1WHL A;  1X6O A;  2H3J A;  3JRZ A;  3ZEH A;  1G83 A;  2P4T A;  2JVV A;  1VQ9 A;  2CP7 A;  1M3A A;  3QO3 A;  1H3Z A;  3N5B B;  2HSE B;  2MIO A;  3PIP A;  1N5Z A;  1RI0 A;  3CCV Q;  1KIK A;  2EGE A;  4RTY A;  3JB9 F;  3A98 A;  2KR3 A;  2CZ1 B;  1WA7 A;  3GNG A;  1QQJ A;  2QI2 A;  1F1B B;  1QWF A;  5D6X A;  4KUD K;  2XD0 A;  2YSQ A;  4QQD A;  2MMP A;  2NUZ A;  3QZ5 B;  4HA8 A;  1AEY A;  4QW2 A;  1KD1 C;  2DEU A;  2DEQ A;  2FL7 A;  2I0N A;  2DIQ A;  5CO7 A;  4BE0 A;  1D1B A;  1YJ9 T;  5GAM d;  3QDR B;  1GRI A;  4GLK A;  1NE8 A;  3JCM W;  4KT0 E;  2EYW A;  3TU4 K;  3JCM h;  4OF1 A;  5KYU B;  2KK4 A;  3OY9 A;  4IUU A;  2Y4X A;  1ZSG A;  3PIO A;  2RI5 A;  4LDW A;  1VQ8 T;  2LJ0 A;  3A8O B;  4F16 A;  4KGZ B;  3KUF A;  2A28 A;  2XK0 A;  1G8X A;  2FPD A;  4FU6 A;  5GAN e;  3CQT A;  3JCM J;  4UC4 A;  3OMC A;  1K9M U;  1YJ9 Q;  3CCU A;  2EQK A;  2ZPF B;  1G3S A;  2QG9 B;  2ZPE B;  3AHU A;  3RKY A;  1WDX A;  4FCY A;  3OYD A;  2K7A A;  4N0A C;  3DLL A;  4LNP A;  2GFU A;  2A3L A;  3REB B;  1VQ8 Q;  2E6N A;  4PK4 A;  3UAT A;  4DOV A;  5I2M A;  3CCS T;  3CD6 T;  4M75 B;  2ESW A;  3CPF A;  4OMP A;  3VS4 A;  5GMK l;  4M7A D;  3WVD B;  5GAN 2;  4M78 A;  4JDS A;  2KSS A;  2RQT A;  3CBO A;  3MEV A;  1ZLM A;  4L6V 5;  3QUI A;  1M2V B;  1E6G A;  2DO3 A;  2M0Y A;  2MCN A;  2QA4 T;  1R8O B;  1RAB B;  4QQG A;  5J26 A;  2JT4 A;  2QDY B;  1N8R C;  1MNE A;  3M54 A;  1YCS B;  1GFD A;  3QDF A;  2ZAE A;  3CCS Q;  3CCE A;  2KRS A;  3CXC A;  3V8J A;  1HYO A;  3UPU A;  2E3I A;  4WF2 A;  1D3B A;  4NL3 A;  2QA4 Q;  4M7D A;  2FB7 A;  2Y90 A;  1TS9 A;  4A4K A;  1NM7 A;  4D6W A;  3G6E Q;  3UWN A;  4PL6 A;  3JCM b;  3V7C A;  5A0L A;  2CSI A;  1W4S A;  1M3C A;  2FO0 A;  1TUG B;  4LDX A;  1Q81 R;  1NJI C;  2OAU A;  2BZX A;  1K76 A;  3VYG A;  1AZG B;  2E70 A;  2YLB A;  3X26 B;  1VQL T;  3EG9 A;  1RAH B;  4BDY A;  2IVW A;  3BDU A;  2LCS A;  1QVG S;  3JCM g;  4N4H A;  1S1N A;  1B07 A;  1Q86 R;  5FRN A;  3CXC P;  3EAE A;  1BI1 A;  3EH1 A;  1UGS B;  2ECZ A;  1PKT A;  1YWO A;  1I81 A;  1NYF A;  1BIA A;  1NLP C;  3Q1J A;  3L2Z A;  1MUZ A;  2COY A;  2EWN A;  4FYW B;  2DL5 A;  1YN8 A;  3MEU A;  3I55 A;  3M0S A;  1RI9 A;  4NS5 A;  4JJD A;  5EC7 A;  1VQL Q;  2CYZ B;  2ZPG B;  4BE1 A;  2KYB A;  3IQL A;  4MZM A;  1AD5 A;  1VQ9 T;  1QP3 A;  3CPW S;  2KT1 A;  5CKE A;  3VS0 A;  3LWI A;  3VU3 C;  4A4F A;  1VQK A;  4F17 A;  3QHS A;  1ZSZ C;  3INZ A;  3WXM B;  2VGN A;  1N9S A;  5LJ3 e;  3HRS A;  4FSS A;  1QW1 A;  4F14 A;  2X4Y A;  2HCK A;  5CKF A;  2FRW A;  1Y07 A;  2RJD A;  3FRN A;  3OMG A;  4PJO F;  4RTT A;  2RO0 A;  5CKH A;  4XTW A;  4QT7 A;  1VQ9 Q;  1EZZ B;  1G3W A;  1QCO A;  8AT1 B;  2V8I A;  1WIE A;  2DAQ A;  4E7S A;  1UTI A;  4KGV B;  4M7A G;  2RHY A;  1QLY A;  4JZ4 A;  2RHU A;  3REA B;  4D8D A; 
#chains in the Genus database with same CATH homology
 3CC4 T;  3G6E T;  2DIG A;  2BIV A;  2E41 A;  4ZGD B;  3QZ9 B;  2VV5 A;  2RHX A;  1WJS A;  1BKB A;  3SD4 A;  3A8H B;  2RA2 A;  2LDM A;  3CCL T;  1WJR A;  4FT4 A;  2EJG A;  4B9W A;  1BI0 A;  3L1A A;  3OSV A;  3CME T;  2DK3 A;  2X35 A;  2MF2 A;  2I2L A;  1M9S A;  4LDY A;  4E7J A;  1YI2 A;  3OB9 A;  1Q81 U;  2M9U A;  3QBY A;  2EQU A;  2WSE E;  3TCJ A;  2WAC A;  4XTU A;  5LJ3 d;  4KBM B;  2LVM A;  4M77 F;  4C92 F;  3I56 T;  4M77 B;  1OZ3 A;  3M4Y A;  2R58 A;  4M75 C;  4C92 B;  4O5V A;  4QQ6 A;  3DLM A;  1YJ9 A;  3CCU T;  1QVF A;  3BDL A;  4KUL A;  2K2V A;  4C0F A;  2HAX A;  1GXI E;  1N9R A;  3JB9 J;  4XU2 A;  4M77 G;  2V8J A;  4RCC A;  4C92 G;  4JRQ A;  4F7U E;  5LJ5 f;  1VQP A;  4VUB A;  1YIT A;  2O4X A;  3JB9 I;  1Q86 U;  2L5Q A;  3OBY A;  3MHX A;  1YBY A;  2Y4Y A;  2RI2 A;  2VC8 A;  1OZ2 A;  3E1S A;  2OTL A;  3QSU A;  1JJ2 S;  3URG A;  5KCH A;  1QVG A;  4PNO A;  1VQ8 A;  2QQS A;  5CKD A;  1NJI U;  1VQ7 A;  2MI6 A;  2ZPH B;  3M5A A;  3L2W A;  1Q82 U;  2LQ8 A;  2E12 A;  1UGR B;  3QJY A;  5GAN 5;  3CC7 A;  4E7I A;  1YJW T;  1Q82 C;  1K8A U;  4M78 F;  3SWN A;  1FWZ A;  4M78 B;  1K8A C;  4OB3 B;  2B8A A;  4F7U F;  5FU7 C;  4F7U B;  1W2B S;  1G5V A;  2LT4 A;  2XIC A;  2JTF A;  2OTJ A;  4M78 G;  4RCB A;  3OYJ A;  3GF5 A;  3VUZ A;  4IUR A;  2BUD A;  3S6W A;  4JS4 A;  2JUF A;  1WPY A;  4GY5 A;  3VV0 A;  4C5E A;  3MP6 A;  2JZ2 A;  2P0K A;  2FVU A;  5CAI A;  2F5T X;  3OYA A;  1VQO T;  3NTI A;  1KHI A;  1UB4 A;  4C0Z A;  3HFO A;  2ZPB B;  4HT9 A;  4LD6 A;  3E19 A;  1DJ7 B;  4Y91 A;  2L3R A;  3OBW A;  1G3T A;  2VXF A;  1M4Z A;  1KC8 U;  5A2Q E;  1N27 A;  3CPW A;  1MGQ A;  3E9G A;  1KC8 C;  3C95 A;  2XDP A;  3CCS A;  4IKF A;  2LX9 A;  4J7F A;  4C5G A;  5GMK e;  3CCE T;  3CD6 A;  3OYC A;  4QVC A;  3OYN A;  2E6Z A;  2LT1 A;  3FLG A;  3P8H A;  3PMI A;  4MZP A;  4J6W A;  2PUO B;  1LNX A;  4JLI A;  2VUB A;  4M75 A;  1QP2 A;  4CRI A;  1BIB A;  3M53 A;  5LJ5 e;  1VQN T;  2QEX T;  3O8V A;  1D3B B;  2KQW A;  1HK9 A;  4PLI A;  3NTH A;  4EMK B;  4M7D F;  1UEB A;  3PT9 A;  4M7D B;  4JUV A;  2DTO A;  3FJP A;  3ME9 A;  3OYL A;  2QA4 A;  3LGL A;  3MEA A;  3LX7 A;  4M7D G;  4A53 A;  2RB6 A;  3G6E A;  3A8G B;  2MWP A;  3CCV A;  5CK9 A;  4C0D B;  4JS5 A;  3L2R A;  3V8K A;  1M8V A;  4Y28 E;  4L59 A;  1XQH A;  3ZFJ A;  3A8L B;  3OW2 S;  2GCX A;  2R5A A;  1K73 U;  3FDR A;  4J5Y A;  5FRO A;  4ZN3 A;  1YIJ A;  1XTD A;  2PUK B;  3EFS A;  4L5G A;  1K73 C;  3HHT B;  2VXE A;  4RKU E;  5GAN 4;  1YJN T;  3OYH A;  1YHQ A;  1IZ6 A;  4HCZ A;  1M1G A;  1NPP A;  4IUV A;  3OYB A;  2K3X A;  2RK2 A;  2LQK A;  1Y96 A;  4E7H A;  2R5M A;  1KG1 A;  3TRE A;  3WVE B;  3H8Z A;  5IAY A;  3M55 A;  4M75 E;  1K9M C;  4BY6 B;  3ASK A;  4BE2 A;  1I4K 1;  1KQ1 A;  3X25 B;  1ZHI A;  3GPL A;  3CMA T;  4NL2 A;  3JCM f;  4DQ2 A;  1O9S A;  5CIU A;  2RH2 A;  1HXD A;  2ZGW A;  5GAM f;  3SWN C;  2EIF A;  1B34 B;  3CCM T;  2K3Y A;  2L89 A;  3MP1 A;  4RMO A;  1BI3 A;  4OMF B;  4C8Q G;  3PFS A;  5M9O A;  2CZ6 B;  5GMK h;  5LJ5 d;  3DB4 A;  3CBM A;  4FM4 B;  4LD9 K;  3OS2 A;  3OYG A;  5GAO q;  2DTH A;  2XU8 A;  4PLL A;  2RI3 A;  5D6Y A;  4BI4 A;  4M75 F;  4M75 D;  3OYK A;  3L2U A;  1WQ7 A;  2YRV A;  5LJ5 h;  4X9D A;  3UDC A;  5GAO r;  5CR2 A;  3CCJ A;  3NTK A;  4J6X A;  3FIF A;  4OVA A;  4BB7 A;  2RHZ A;  3QJ6 A;  1KQ2 A;  3V7R A;  1VQL A;  2WSF E;  4J6Y A;  2P0P A;  2RJE A;  3GIB A;  3L42 A;  2HQE A;  1H64 1;  1OYX A;  4XTY A;  2PQW A;  2XG8 D;  2BKD N;  3OSS C;  3T9N A;  3JB9 H;  2HD0 A;  2DKG A;  5LJ3 g;  4E7L A;  1JJ2 A;  3H6Z A;  1VQ6 T;  2D0Q B;  2GF7 A;  2LRQ A;  2LNV A;  3MEW A;  4J83 A;  4O6J A;  4BAC A;  1VIE A;  1VQM A;  1SSF A;  3QXE B;  4EDU A;  1FXX A;  1NPR A;  2RJC A;  4XTX A;  5J39 A;  2F69 A;  5IT9 E;  4HT8 A;  3X20 B;  1LOJ A;  5FU6 C;  1O75 A;  5GAN d;  1AHJ B;  2E10 A;  3JCM Q;  3CCR T;  3S3M A;  3DB3 A;  4ZTF A;  2M0O A;  4EMG A;  3CEY A;  4JRI A;  3VKI A;  5CQY A;  5GAN 6;  5A0D A;  5GAN j;  1VQ4 T;  1VQK T;  2E65 A;  3SDZ A;  1W2B A;  3G71 A;  5FU7 B;  3G4S T;  5LL6 S;  1KHC A;  5GAN h;  3JCM V;  2EJF A;  2VYT A;  4Z02 A;  2LTO A;  3X28 B;  3RES A;  5KCO A;  3GOX A;  5GAO n;  2VGM A;  3HRT A;  5CVI A;  1PSF A;  3P8D A;  1X6O A;  1JB0 E;  2H3J A;  4N4G A;  4BD3 A;  2DTI A;  3JRZ A;  2E64 A;  2KMT A;  2P4T A;  3ZEH A;  3L2Q A;  2JVV A;  3J7A F;  2RM4 A;  2LCL A;  4A4G A;  1VQ9 A;  1XNI A;  2DD4 A;  3QO3 A;  5CKB A;  5I21 A;  3CC2 A;  4N0A A;  3N5B B;  4N4I A;  2K5L A;  2R57 A;  1H3Z A;  2P0Q A;  3BFM A;  4XU0 A;  1OI1 A;  3PIP A;  4BI8 B;  3RMQ A;  3CXC S;  1BYM A;  2YHT A;  1RI0 A;  4BDZ A;  3FEO A;  4F7U G;  2D6F A;  3JB9 F;  3JB9 D;  3V7S A;  2CZ1 B;  5GAN f;  3CCQ T;  3GNG A;  2DXT A;  5GAN 7;  4C92 C;  2DXU A;  2QI2 A;  2ZPI B;  5J3B A;  2GQV A;  4RG8 A;  2CKK A;  2G3R A;  4II1 A;  2XDD A;  1JRI A;  2QXF A;  5D6X A;  4KUD K;  3LWH A;  3OYE A;  1S72 A;  2XD0 A;  4DA4 A;  4QQD A;  5GAN 8;  1VQ5 A;  3RMS A;  2X4X A;  2MMP A;  3EFR A;  1UGP B;  3GNF B;  3QZ5 B;  4HA8 A;  4QW2 A;  3JCM X;  5GAN 3;  5DY9 A;  2ZZD A;  3OS5 A;  4BUG A;  3OW2 A;  2DEQ A;  1JBM A;  1YI2 T;  1KD1 C;  1I5L A;  4PJO A;  2FL7 A;  2DIQ A;  5KE2 A;  3VYH B;  5CO7 A;  4BE0 A;  1I8F A;  2XID A;  1Y71 A;  1YCY A;  2DJZ A;  3JCM d;  1M90 U;  4HCB A;  2LCC A;  4M7A A;  3S3N A;  2IG0 A;  1U8R A;  2JTM A;  3LGF A;  1YJ9 T;  3RER A;  2EKO A;  3QDR B;  5GAM d;  1M90 C;  4GLK A;  1NE8 A;  2EQM A;  5GAM j;  3CCJ T;  1ZQ1 A;  1QVP A;  3JCM W;  4KT0 E;  3QG1 A;  4A4E A;  3JCM h;  5HKC A;  4OF1 A;  3TU4 K;  2O4X B;  3CC4 A;  2KK4 A;  4B9X A;  3OY9 A;  4IUU A;  5GAM h;  4C5H A;  1VQP T;  2Y4X A;  2K5I A;  5GAO l;  5FLX E;  1YIT T;  2RK1 A;  3PIO A;  4ZGJ B;  4XQ3 A;  2RI5 A;  3HPW A;  4MDW A;  4LDW A;  5DLQ E;  2OTL T;  3CCL A;  5GAO m;  2NLU A;  1XOV A;  2PU9 B;  1UGQ B;  1VQ8 T;  2HNI A;  3CME A;  1VQ7 T;  3SWN B;  3A8O B;  3E9F A;  1WNL A;  3KUF A;  1G3Y A;  2XK0 A;  4ME7 A;  4NOY A;  3CC7 T;  4LDV A;  2EQJ A;  4FU6 A;  5GAN e;  1X75 C;  1MHN A;  3LW5 E;  3RKW A;  4UC4 A;  3JCM J;  3I56 A;  2RD1 A;  3OMC A;  2DVE A;  4RG2 A;  1K9M U;  3CBP A;  5D6W A;  2HQX A;  3HFN A;  3CCU A;  4PJO E;  4OGC A;  2PVO B;  5I2S A;  4ZGE B;  2EQK A;  2ZPF B;  1G3S A;  3V8L A;  2OTJ T;  3HSB A;  2ZPE B;  3M9Q A;  4M77 A;  4C92 A;  3AHU A;  3RKY A;  2JN0 A;  3GLX A;  3KBG A;  2MAM A;  2M1H A;  3QKJ A;  4ELZ C;  3OYD A;  3S3O A;  4BI3 A;  4EMK C;  3OQ5 A;  4XU1 A;  4C5I A;  1WQW A;  4N0A C;  5LJ5 g;  2ZCF B;  5KH6 A;  3DLL A;  1M1F A;  4P5N A;  5IN1 A;  2GFU A;  2HBP A;  2EYQ A;  2A3L A;  3VUB A;  2EAY A;  2QQR A;  4ATO A;  3HL8 A;  2K5F A;  2E6N A;  2XHC A;  4DOV A;  5I2M A;  3CCS T;  3CD6 T;  3A8M B;  4PJO D;  5C6S A;  4M75 B;  1YJW A;  3CPF A;  4QVZ A;  1P92 A;  4JJN K;  1Q7Y C;  4ELY C;  2RJF A;  5FU6 B;  2YLC A;  2F5K A;  2M16 A;  3I55 T;  5GMK l;  4M75 G;  4M7A D;  4MDX A;  2XI9 A;  3R6O A;  3JCM P;  2CZ7 B;  3WVD B;  3MO8 A;  4M78 A;  4JDS A;  5GAN 2;  2KSS A;  5GMK m;  2RHI A;  4J8O A;  3CBO A;  3M57 A;  3MEV A;  2WSC E;  4YTL A;  4L6V 5;  3C94 A;  1VQO A;  3QUI A;  5FRM A;  2DO3 A;  2QA4 T;  1R8O B;  2PVD B;  4QQG A;  2A7Y A;  5J26 A;  3SFM A;  2QDY B;  1N8R C;  4PJO C;  3GP8 A;  4IUT A;  4M77 E;  2CS7 A;  4C92 E;  4BY6 C;  3M54 A;  2D9T A;  4X34 A;  3CCV T;  2QQA A;  4TVR A;  4M7A C;  4C8Q C;  2K57 A;  1KQS S;  1V29 B;  3CCE A;  4EPC A;  3CXC A;  4XTV A;  3V8J A;  4XAX B;  1YIJ T;  2L8D A;  5DM7 R;  1Y7X A;  1IRE B;  2KAF A;  3JCM e;  3KXT A;  2PVG B;  1Y96 B;  1N6A A;  5A0G A;  1YHQ T;  4Q5W A;  4HKE A;  4MML A;  5GAM e;  2CGH A;  3UPU A;  1VQN A;  2QEX A;  3PGG A;  3RKX A;  2X4W A;  1Q81 C;  4XU3 A;  1FX7 A;  4WF2 A;  5LJ3 j;  1VIF A;  4M77 D;  4C92 D;  1WGS A;  3RIR A;  1D3B A;  4IUP A;  4NL3 A;  4EMK A;  3MET A;  5LJ3 h;  4M7D A;  4M78 E;  2K4Y A;  2FB7 A;  2Y90 A;  3HRU A;  4FSX A;  4R56 A;  4A4K A;  3OS0 A;  4FT2 A;  4D6W A;  3P8B B;  1RL2 A;  4OB2 B;  3QYG B;  4R55 A;  4JRK A;  4E47 A;  2C06 A;  4OB0 B;  2GFA A;  4PL6 A;  3UWN A;  2O01 E;  3BY7 A;  4ZN1 A;  3JCM b;  3V7C A;  5A0L A;  1Q86 C;  1W4S A;  1X01 A;  2E5Q A;  3JAM E;  4M77 C;  3BW1 A;  1YJN A;  3OYI A;  2JOY A;  4LDX A;  1QVF S;  3G7Z A;  3JB9 G;  1NJI C;  5GAO p;  5HK0 A;  2OAU A;  3LH0 A;  1M1K U;  2DZC A;  2KVQ G;  3F70 A;  4M78 D;  2FHD A;  3HP9 A;  4J7I A;  4DOW A;  3VYG A;  4EMH A;  4JLG A;  3J80 E;  2KY9 A;  1TH7 A;  4FL6 A;  1M1K C;  3VJP A;  2QTX A;  2YLB A;  2E70 A;  1KD1 U;  3X26 B;  1VQL T;  1U1T A;  1U1S A;  2DZ9 A;  4A54 A;  5LJ3 f;  3RUX A;  3CMA A;  4BDY A;  4A4H A;  2IVW A;  3BDU A;  3LLR A;  3OS1 A;  5CQX A;  1QVG S;  3JCM g;  4N4H A;  5KE3 A;  5L8R E;  3CCM A;  1VQM T;  4C8Q A;  4HCC A;  2E1H A;  2LC4 A;  5GAM g;  5FRN A;  2KDS A;  3EAE A;  4M7D E;  1BI1 A;  2EFI A;  1UGS B;  3OYF A;  1B34 A;  4M78 C;  1I81 A;  3C12 A;  1BIA A;  2XKO C;  3FB9 A;  3Q1J A;  5HK3 A;  3L2Z A;  2CZ0 B;  3G71 T;  3DKM A;  2EWN A;  4KUI A;  3MEU A;  3HKS A;  3I55 A;  2EJ9 A;  4NS5 A;  4V2S A;  3QPH A;  4LDU A;  1PSE A;  4CI0 C;  2DXC A;  3QII A;  3JSC A;  4MMK A;  3PNW C;  2CYZ B;  2ZPG B;  4FIB A;  4OP0 A;  3JCM c;  4BE1 A;  4M7D D;  3L2V A;  4C0G A;  4OGE A;  4MZM A;  1VQ9 T;  3MP8 A;  4XK8 E;  1QP3 A;  3CPW S;  5DLO A;  1VQ6 A;  2JNG A;  3TEE A;  3CC2 T;  3NFC A;  1NZ9 A;  5CKE A;  3UT1 A;  3LWI A;  3VU3 C;  4E7K A;  3CCR A;  3OYY A;  2X4J A;  5HY6 A;  3M59 A;  4A4F A;  3ZBD A;  1VQK A;  2FYK A;  1VQ4 A;  3QHS A;  4ZTJ A;  3LYI A;  5EG2 A;  1EIF A;  2MWO A;  1BI2 A;  4M7A E;  4C8Q E;  3INZ A;  4MZT A;  3WXM B;  3G4S A;  2VGN A;  4QVD A;  1N9S A;  2DPP B;  5LJ3 e;  4M7D C;  4OB1 B;  3HRS A;  1QW1 A;  3A5Z B;  2DD5 A;  3SB2 A;  3MCA B;  2AHJ B;  2X4Y A;  5CKF A;  3ER0 A;  1Q7Y U;  3FRN A;  1Y07 A;  2RJD A;  3QYH B;  2V8K A;  3OMG A;  4PJO F;  1S72 T;  1VQ5 T;  4PJO B;  2RO0 A;  5CKH A;  4C0D C;  4XTW A;  1VUB A;  3M56 A;  3M4G A;  5GMK i;  1WJQ A;  4PKC C;  1ZBX A;  5GAN g;  1KQS A;  4PJO G;  4X9C A;  1M5Q 1;  4C8Q F;  4M7A F;  4M7A B;  4C8Q B;  4C8Q D;  3J81 E;  4IUQ A;  5GMK j;  3PTA A;  3PMT A;  1G3W A;  2XDB A;  5CCA A;  2QQB A;  3OYM A;  2QQ9 A;  2V8I A;  2DXB A;  2DAQ A;  4F7U A;  4M7A G;  3FC3 A;  2RHY A;  1N8R U;  5AYF A;  5LJ5 j;  3CCQ A;  1LJO A;  2RHU A;  3OA6 A;  4JRP A;  3X24 B;  3M58 A;  3C4S A;  4XTZ A;  5C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...