4MZTA

Mazf from s. aureus crystal form ii, c2221, 2.3 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MazF mRNA interferase
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 30
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mztA00
5HK0A 5CO7A 5CKEA 4ELYC 1NE8A 2C06A 4MZTA 4OF1A 4MDXA 1UB4A 2MF2A 2VUBA 3G7ZA 1M1FA 5CKHA 5DLOA 4VUBA 4MZPA 1VUBA 5CCAA 3HPWA 5CKDA 5CKFA 5CKBA 5HK3A 5HKCA 3JSCA 4MZMA 3NFCA 4ELZC 2KMTA 3JRZA 4ME7A 5CQYA 1X75C 4HKEA 3VUBA 5CR2A 3TCJA 5CQXA 5CK9A
chains in the Genus database with same CATH superfamily
2E4HA 4IIMA 4TVRA 1NJIR 4IUQA 3CCVA 1QMCA 4M78D 4FIBA 2QYZA 1FMKA 1VQKT 1RUWA 1WHKA 4J7FA 4M77G 2L2PA 3I55T 3T9NA 2F2XA 2EGEA 3CC4A 2MK5A 4M77B 2E1HA 1S72A 1H92A 3OBYA 3V8KA 2CREA 1ZX6A 2X35A 4DBQA 2PQWA 4M77C 1UHCA 2YLBA 3A8MB 4N4HA 3OYMA 1I5LA 1CSKA 1QWEA 2YSQA 2QI2A 3JCMW 2EGCA 4LN2A 3OYFA 1VYTA 1VQNA 1AOJA 2VGNA 1TWBA 4PJOF 9ATCB 1AWOA 4QQ6A 5CAIA 3G71Q 5CKDA 2KQWA 4HCBA 1WHLA 2ZZDA 1QW1A 1U1SA 3P8DA 2YUPA 3RUXA 3M55A 2LCCA 2DKGA 1JRIA 1UFFA 3CCMT 4PJOA 4HT8A 1JJ2P 2DL3A 3CD6A 3X28B 1VYVA 3URGA 1Y57A 3EG2A 2OJ2A 3SWNB 4KGZB 3CXCS 1K8AU 5IHKA 1QVFA 3OW2A 2P4TA 4N0AC 4C8QE 3V7RA 2DXTA 1Q81R 3OMCA 3FRNA 4M77F 5KCHA 2JT4A 3HTRA 4M7DG 4QVZA 2OTLT 3E9GA 2QDYB 4FW2A 2MCNA 2EVRA 3H0HA 2X4YA 4M77A 4PK4A 3M4YA 3TSZA 5GAOp 2E64A 4M7DC 1WHHA 4EPCA 1KQSA 2J6OA 2KBTA 1VQPA 2LJ0A 1WGSA 2JOYA 3A8LB 4FSSA 3I56A 1C6VX 1RABB 4PFPA 1I0CA 2I0NA 3GNGA 2Y90A 3CMEQ 4WCIA 3SB2A 2VUBA 3QHSA 4CC2A 2JMCA 1X2QA 2JXBA 3OYKA 2C0OA 2E6NA 4LD9K 1K9MR 2DF6A 3LWHA 3QUIA 3SWNA 4BI3A 2DIQA 5AT1B 3O8VA 1W2BA 5GMKl 2JTMA 4M7DF 3S3NA 3N5BB 2LQWA 1HYOA 4BACA 5GAN4 3HFOA 3JB9J 4M78G 1UECA 1Q7YR 4JZ4A 4M7DA 2EBPA 4JRIA 4ME7A 1D1AA 4M78B 4OMFB 2GTOA 2IPOB 1YHQQ 1QQJA 2XK0A 4C0FA 2EQIA 3SD4A 3CCRA 3CCQQ 2EKOA 4J6WA 2DILA 2AT1B 2YUNA 3M59A 2XICA 4PJJA 2H3JA 4RMOA 2RJFA 1VQ4A 5FU6B 2V1QA 2EJFA 1RLQC 3MJXA 1OYXA 2SRCA 2FHDA 5GANj 2YWWA 2LT4A 3CQTA 1QVGS 1N27A 4UC4A 3VS3A 4JUVA 5LJ3j 1NEBA 4PFZA 1VQ9Q 3CMAT 4C5IA 2E3HA 1HJDA 1UJYA 2V8JA 1PD1A 1X6BA 4Y91A 4M78F 1TUGB 5FWBA 1IO6A 2R58A 1OPLA 3CCEA 5LJ5h 4ZNXA 1Y07A 4JJBA 4M78A 4C5EA 4E2FB 3UA6A 2RNAA 1NYGA 2BUDA 2CP5A 2GFUA 4RTWA 1M1GA 3JAME 3I5SA 1YCYA 2K4YA 2A3LA 2JVVA 1U8RA 3ME9A 2V8KA 3CC2T 2A7YA 2FB7A 4A53A 8AT1B 2CKKA 3OS1A 2KRMA 4CRIA 5KE2A 3EFSA 4X34A 3TSWA 2DM1A 2L5QA 1LJOA 4HKEA 5CR2A 4B6MA 2CH4W 4RKUE 4LD6A 4Z88A 4LDXA 1YJNA 2OTJQ 3OS0A 2E5KA 4OF1A 2VV5A 1SHFA 2CUDA 2EQKA 2JNGA 1K0XA 4RTUA 1XNIA 1LPLA 4ZN1A 1YIJQ 3EGDB 4NOYA 1UGRB 4JDSA 2QGGA 4CC7A 3BDUA 5A0LA 5GAOr 1WXTA 4E7ZA 1SKUB 5J39A 4FW1A 4FYVB 3QO3A 1N9RA 3JCMJ 3A1PA 3DB3A 4ZGJB 5IAYA 2ZPFB 2YHTA 5GAMj 2XKOC 2QGFB 2QEXT 5KE3A 2HBPA 3JCMg 3G6EA 2KYBA 2C0TA 1QCNA 1OI1A 1EFNA 2MPXC 1W6XA 1VOMA 4DOVA 2JUFA 1KHIA 2DAQA 2QA4A 3NHNA 2LQNA 1VQ8T 4J9GA 1V76A 3PIPA 1HD3A 2QXFA 3J7AF 1VQMA 1M2OA 3KBGA 1QVFP 4KGVB 4A4FA 2RMOA 8ATCB 2O9VA 3QKJA 2MIOA 2LT1A 3H6ZA 2AKLA 1VQOT 1WIEA 2RQRA 2BIVA 3EGDA 1ZUKA 4HCZA 4AG2C 4QVCA 4XTWA 3C95A 2COYA 2EW3A 2RA2A 2R5MA 1HXDA 3QXEB 2HQEA 4F7UB 2DO3A 3SEMA 1KIKA 3CC7A 1Q82R 2KEAA 3QBYA 2RQTA 2VB6A 1PKSA 2M0YA 2K79A 5LJ5d 4F16A 2DETA 5KYXB 2HEQA 3X20B 5FU7C 3DLLA 4FU6A 2LMJA 4VUBA 2ZPIB 4L59A 1KK7A 3JRZA 1X75C 3KFVA 3R6NA 5GANf 2YDLA 5CK9A 1ABOA 1WXBA 4AG1C 2DTOA 3L42A 3EGUA 2L89A 1W2BP 1OULA 3CCVT 2O31A 2DVJA 5CKHA 3C12A 3G4SQ 5J3BA 2EKHA 1ZBJA 5GANh 4OVAA 3BE3A 4JRQA 2QK0A 4HVWA 3CC4T 3ZEHA 5LJ5e 5HCKA 1K1ZA 1S72T 2AKKA 3LX7A 4KT0E 3CCUA 2RH2A 4YTLA 5GAOn 1PHTA 4ZTFA 2EGAA 3RMQA 4C8QB 3H41A 3MP1A 4C5HA 2PTKA 1AEYA 2DL5A 2FG0A 1KHCA 2FEIA 1VQNT 2DA9A 3UATA 1YJWQ 1AZEA 4C92E 1K76A 4MDXA 2ZGWA 2Y4YA 4A54A 3OYNA 1RAEB 3CD6T 1GCQA 1PRMC 1R0BG 1IREB 3E9FA 1N6AA 2HL3A 4MZPA 3NTIA 2L3SA 3CBOA 2ZPEB 2K6DA 1H3ZA 5CQYA 2PVGB 1MNDA 2A37A 2OI3A 2XU8A 3GNFB 3P8BB 4XU3A 1M1KU 2DJZA 1WX6A 4C8QF 1NG2A 2LJ1A 1TU0B 3LGLA 1VIFA 2NYSA 3EG9B 4N4GA 5C6SA 4O5VA 2EJ9A 3S3OA 1RLPC 1MGQA 1M1KC 4C8QA 1VQPT 1D0YA 2FPDA 5DLQE 2D8HA 2M9UA 2KT8A 4XU0A 3I56T 2RF0A 4XTVA 3OYIA 1ARKA 2OAWA 1M2VA 1KD1R 5HKCA 5CKBA 1E6GA 4GBQA 2MWOA 3JCMQ 1PKTA 4XU2A 1Q86U 2F5KA 3CMEA 2D1XA 2RPNA 2ZPGB 2FPEA 4RTVA 2IVWA 1OX8A 3QSUA 1RAAB 1IZ6A 1Y96B 2YRCA 3CCSQ 1QCFA 2KR3A 3P8HA 3HPWA 4F7UE 1M90R 1Q86C 1MMDA 1OV3A 2K3YA 3HRSA 3PTAA 3CPWS 1T3LA 2M16A 1AVZC 3OBWA 1YCSB 3OY9A 4HT9A 5KCOA 4OMMA 3EG9A 2QG9B 1G3YA 1BB9A 2VWFA 1SG5A 1TH7A 4RTZA 2RHUA 3TU4K 2GGRA 2MF2A 4KUIA 3BW1A 3CCRT 3CCJQ 3HFNA 4F17A 1D09B 3MEUA 1B07A 4FCYA 5FRNA 1YHQA 2RJEA 2E41A 2VYTA 2KRNA 1ZSZB 2LX7A 1YBYA 4D6WA 1GBRA 1B34A 1RAFB 1H3HA 1IGQA 3CCQA 1X69A 1VQ4T 4F14A 1K8AR 5LJ3d 1RACB 4PJLA 4J9EA 3OYAA 2E12A 2A28A 2EIFA 2HQXA 4OGEA 2L3QA 4DQ2A 2CP7A 1E6HA 1U3OA 2CYZB 1PSFA 4ELZC 1Y96A 3V7SA 2P0PA 2QQSA 3GP8A 4QQDA 1C1AA 1D3BB 4J8OA 4J9HA 1PG5B 4M7AE 2O01E 1GFDA 1NJIU 3CCET 3QWXX 5GANe 3SWNC 4E7SA 1NM7A 3JCMb 1ACMB 1T0JA 3C4SA 5LJ3e 5CO7A 2X4XA 1NJIC 3OYBA 4Q5WA 4M75B 4E7IA 1O9SA 3VS1A 5LL6S 3PT9A 2JTEA 1D1BA 3RNJA 2ENMA 2FRWA 3DB4A 3QWYA 4ANJA 2F69A 1VUBA 4FYYB 4A63B 4RUGA 2NLUA 2BZXA 1WXUA 3UA7A 2CZ7B 1BIBA 4DEXA 2HD0A 4ESRA 1W70A 2X4WA 2R57A 1K9AA 2JZ2A 3JCMV 2CZ6B 3OYYA 1I4K1 1UG1A 4FL6A 3DKMA 5GAOq 5GAOm 4EMHA 1RL2A 5GJWB 1YJNT 2XMFA 3UT1A 1D3BA 3MP6A 2ED0A 3L2VA 3PMIA 1GRIA 4PLIA 2DJQA 2ESWA 3EHQA 2OTJA 1NLPC 3NGPA 2KSSA 2LDMA 2LTOA 2V1RA 1Q81U 1VQLQ 1V1CA 4XAXB 2L8DA 5GMKm 2KAFA 4BE0A 1KQ1A 2ZPHB 1YITQ 1BCOA 5GAMd 1YIJA 3DLMA 1EX4A 1NZ9A 2RI3A 2M02A 2ZCFB 5KYNA 3FEOA 2AZVA 1SRLA 2AK5A 1D0ZA 1BI1A 1Q81C 1IHVA 1RAIB 2ROLA 1GFCA 1J3TA 5CQXA 3G6ET 1QVPA 1BI3A 1X01A 2X4JA 4JRPA 1PD0A 1VQ7A 4M78C 1XTDA 1ABQA 2QA4T 3JV3A 5KYWB 3OYGA 4XTYA 1VQ6Q 5KYUB 1C0MA 3ASKA 4JPBW 1QCOA 2E10A 2EAYA 3IQLA 1VQMT 1M3AA 4Z8AA 2P84A 2GQVA 1N5ZA 1YN8A 5GAMe 2DL8A 3M53A 2KYMA 2VASA 1AHJB 5FU6C 2EQJA 3C0CA 3ULRB 2X3XD 1IGUA 3VYGA 4E7HA 3UDCA 3CCLQ 2DZCA 5GMKh 5ECAA 1M9SA 2F1LA 1YI2Q 1K9MC 2CZ1B 2GQIA 1LVKA 3L2UA 5LJ5g 2I2LA 2ROTA 4J9FA 3CC7T 2DZ9A 1RADB 3GBQA 3VS7A 1ZHIA 4GY5A 1WPYA 4XTZA 5IN1A 1BIAA 2IG0A 3OSVA 5FLXE 3CD6Q 3AHUA 4R55A 4D8DA 2MAMA 2DTIA 1Z9QA 2CT3A 1Q7YC 3OYJA 1W4SA 3UPUA 4RTXA 2RHYA 3PVQA 4E7KA 2RJCA 3BFMA 2X51A 2JMAA 3LGFA 3EG0A 2QQAA 2A08A 2DRKA 4CC4B 3QJ6A 1M27C 4C0DB 4DA4A 4LDVA 2LNHB 1OU8A 3L1AA 3OQ5A 3CXCP 2PU9B 1JXMA 2GNCA 4FT4A 2PUOB 2RB6A 2V26A 4LNPA 5CKFA 1YJ9T 4Y28E 5GAN7 2RJDA 3FLGA 1VQPQ 4HCKA 4C92B 4IKFA 1KC8R 2JTFA 2EWNA 4N4IA 1WNLA 1IB8A 4E47A 4X9CA 3TQ7P 4M7AD 3NTHA 1UJ0A 3G4SA 1PSEA 4M75E 3CCUT 1VQ5Q 2SEMA 2KGTA 5KH6A 2J6KA 4J6YA 4C8QD 5GMKi 3TEEA 1WHJA 4BDYA 2XDDA 1YWOA 3PGGA 2K3BA 1JB0E 2KK4A 2RHZA 4J9DA 5D7UA 1RAGB 4EIKA 3M0TA 3GF5A 4BDZA 3HSBA 4FSXA 3PE0A 1YJWA 1N8RR 4KGXB 3E19A 1JQQA 1JEGA 5DM7R 1WJQA 5GAN2 3THKA 1R77A 3RR6A 4C92F 2KXDA 1X27A 3QZ5B 1BKBA 2MYSA 3JCMf 3FB9A 2VVKA 3OYCA 2ZAEA 1VQKQ 4C92A 5KYYB 1ZUUA 4R0KA 3ZFJA 1MV3A 3I55Q 3SFMA 2G3RA 2GCXA 5IXFA 3QDRB 2GTJA 4E6RA 2YXYA 3PVLA 1GCPA 5CVIA 5IH2A 1ZBXA 2OX7A 5CIUA 4EMKB 1HK9A 1G3TA 2AZSA 3JCMh 4F7UG 7AT1B 4DEYA 2DXBA 3LLRA 4X1VA 2KY9A 2J05A 1SSFA 4LDWA 4LDYA 2DE0X 2CSQA 3OYHA 3MKDA 2VKNA 3QG1A 1QP2A 2X3WD 3A8HB 2COWA 4PLLA 3EGXB 1VIEA 2ED1A 2H8HA 4PNOA 3CCMQ 3E1SA 4LDUA 2QTVA 1GL5A 1I5OB 3CMET 2KVQG 1QVGP 2F5TX 3S3MA 1N9SA 1O75A 3MP8A 3OYDA 1FXXA 2QDLA 4ZN3A 2RI5A 1FMWA 5KYYA 3L2QA 2K2VA 2OTLQ 5AYFA 1NLOC 2VC8A 4QKUA 1DJ7B 3CCSA 3VRYA 4CI0C 1TUDA 1G2BA 1GCQC 2CP2A 5GMKe 1NBEB 4F7UF 3J80E 4XTXA 2QQRA 1AWJA 2MI6A 3EAEA 1I1JA 4KULA 2XG8D 4M7AG 2KMTA 2CSIA 1E7OA 2O2OA 3HRTA 2LQKA 3VUZA 5LJ3g 2K57A 2DBKA 4F7UA 4QW2A 2JJ9A 1YHQT 4M7AB 1VYUA 4C8QG 3G1JA 3RKWA 2C06A 4FYXB 4JJDA 1G3WA 2GF7A 3CCJA 5I2SA 3CCQT 1U5SA 3EGXA 2M0OA 4MMKA 2K5FA 3EH1A 2C0IA 1PNJA 2DMOA 2BE9B 1WZOA 4E7JA 5HK3A 3M9QA 1Q82C 1M3BA 4C8QC 3VKIA 5KYXA 5EC7A 2K2MA 3VS6A 3KXTA 3FIFA 1ZA1B 2LP5A 1K73R 4A4KA 1JJ2S 3PMTA 3UWNA 4BI4A 5M9OA 2CP0A 1FX7A 1UGSB 4KRTA 3UF4A 1WQ7A 3LYIA 3G71A 2Y4XA 4HXJA 3L2ZA 1BK2A 1OZ2A 3CPWA 1WJRA 2JN0A 2EYYA 1U1TA 2J06A 1PWTA 4BD3A 3X26B 4OMOA 2BKDN 4M7AF 3GIBA 3EH2A 5GAN6 2A0FB 3FC3A 1KSWA 2CGHA 2K9GA 4M7AA 4M75D 2XD0A 1X43A 3RDVA 3VS5A 2E6ZA 1AT1B 2J6FA 2RQVA 3OYEA 3L2WA 1PM3A 1FMVA 1WQWA 2KDSA 3VYHB 4JJCA 2P0QA 4J83A 2CT4A 5I22A 4RTYA 4IUUA 4D8KA 4L5GA 4QT7A 5FWCA 5IHNA 4C0GA 4MDWA 3CMAQ 4MMLA 3JCMc 1XJWB 1MUZA 1RI9A 5GAN8 1W1FA 2MMPA 4A4EA 2RN8A 4JLIA 5GMKj 5GAMg 1AZGB 4J9IA 2EYWA 2L0AA 4BY6B 5A2QE 2DD5A 2WSEE 2OTJT 2LJ3A 2B8AA 4JZ3A 4MZTA 1YNZA 1ZLMA 4AMCA 1WDXA 3CXCA 1KFZA 1BYMA 1EIFA 1SF9A 1FWZA 1YIJT 4AFZC 2QASA 4HVVA 2M1HA 3QYGB 2NUZA 1QKWA 2CP3A 2EJGA 5D6XA 2KROA 1VQLA 2PUKB 1X2KA 1F1BB 3JCMe 1YITA 2DK3A 3RESA 3CC2Q 2G6FX 5IHIA 4KBMB 1T0HA 2DXCA 3NTKA 2L3PA 3INZA 1EZZB 1Y71A 1Z9ZA 1VQ7T 3WXMB 1M4ZA 3A8GB 2D6FA 2XDBA 1X6OA 4J6XA 1UDLA 1LOJA 1YJ9Q 3JB9D 3JSCA 1Y0MA 4JS5A 3M0SA 5GANd 3PNWC 4J9BA 1KD1U 3TCJA 4Y92A 2P4RA 4RG2A 1K0SA 4IUVA 2EPDA 1UB4A 1ZSZC 3NMZC 1VQ6A 3VS4A 3CCUQ 2VGMA 5DLOA 4XK8E 2CP6A 1KD1C 1WYXA 1SPKA 2YRVA 2DBMA 2IIMA 1I81A 6AT1B 4OMLA 3I35A 4EDUA 3M58A 1G5VA 1WHMA 1M90U 2CH4A 3CCLA 3RMSA 2YLCA 5L8RE 2LCSA 4OP0A 1VQ9A 3H0IA 1YI2A 4PFOA 3JB9I 3GPLA 4RCCA 1M90C 2QEXQ 4M75G 4ZTJA 3MPUB 1ZA2B 3VS2A 4F04B 3MEAA 4X9DA 3CBPA 1VQ8Q 2EYQA 2PVDB 2KXCA 3AT1B 3CBMA 1TSFA 1YP5A 1ZSZA 4KUDK 4GLKA 4M75C 2EFIA 4IUPA 3X25B 2JW4A 3SHWA 2LCLA 5I2MA 4KH1B 3M0QA 2VXEA 1MNEA 3JCMP 1VQOQ 4OB3B 1UHFA 3A5ZB 3RBBB 2RD1A 4E7LA 1K8AC 4M7DB 4AFSC 1QVGA 3H8ZA 1YWPA 4C92D 1WA7A 4QVDA 1WLPB 1R8OB 2DX1A 3G4ST 4MZMA 2A36A 3MCAB 2YRDA 5I21A 2BTTA 3O5ZA 2JS2A 1JXOA 1P92A 5GAOl 3A8OB 4J9CA 4M75F 2DL7A 1VQ5A 1CKBA 1TS9A 1LNXA 2GFAA 4OB2B 4QQGA 2YT6A 2FRYA 1M8VA 4BUGA 2EQUA 4O6JA 4HCCA 3QZ9B 4OB0B 4M75A 4N0AA 3VJPA 1AWWA 2E5QA 3VS0A 2EYXA 1WI7A 1YJWT 3M5AA 3KUFA 3JB9G 2DYBA 4JJNK 2D9TA 2RK1A 4RCBA 1MMNA 1VA7A 1MMGA 2QAZA 2D8JA 2DVEA 2KE9A 3CCVQ 2ECZA 2CUBA 3RERA 2DNUA 1GBQA 4NL3A 1QVFS 3OW2S 2WACA 3CPWP 1OZ3A 1OPKA 1B3QA 4FM4B 3CC4Q 5HK0A 5D6YA 1K9MU 1T3SA 1S72Q 1VQKA 2FZKB 4IIOA 3I55A 5C0MA 2GBQA 1UTIA 4LUDA 1Y7XA 3ER0A 1UUEA 1XOVA 4OB1B 4PJOE 1KQSS 3F70A 1VQNQ 1SRMA 1UGPB 1MV0B 2DRMA 1Q7YU 2FO0A 1QLYA 5DY9A 2DXUA 2BE7D 3HKSA 3REBB 3QDFA 1M30A 2RI2A 2XHCA 3I5RA 2VXFA 3L2RA 1KG1A 2K5IA 5LJ5f 2HL5C 1XQHA 1OU9A 1ZQ1A 3JB9F 3H0FA 1BI0A 1OEBA 4PJNA 3V7CA 2HCKA 4M4ZA 2KNBB 3JB9H 4R56A 3CCMA 3LWIA 3SDZA 5KYWA 4PKCC 2E70A 4M77E 5KYUA 1KQ2A 1BU1A 2WSFE 2QQ9A 3MEWA 1W2BS 4OMPA 3G7ZA 3PFSA 3CCST 2XI9A 4WTOB 4K11A 4DBHA 1ZUYA 1QKXA 2MWPA 4C0DC 3LH0A 4C92G 5GJVB 2OTLA 1IRXA 2YUQA 4A4GA 1RAHB 4WF2A 5FW9A 3OS5A 3ZBDA 1S1NA 3NPFA 2NWMA 4JLGA 3HRUA 1B7TA 1G8XA 3I56Q 2RK2A 2DEQA 1PCXA 1M8MA 1FYNA 4C92C 3CEYA 3FJPA 4Z02A 3QPHA 3CCJT 3QYHB 2R5AA 2DERA 5GAN3 1IXDA 3RKYA 2RM4A 2DEUA 3U23A 3VUBA 4Z89A 1OQKA 2JM8A 1AD5A 2HBWA 4XQ3A 2M51A 4BB7A 4JS4A 2RQWA 1LCKA 4M7DE 1TTHB 4HVUA 2FZGB 3M57A 2WSCE 1AWXA 3G71T 1OX9A 3HL8A 2F2VA 1NPRA 4EMGA 4P5NA 2HNIA 1D0XA 2QTXA 3VU3C 4FT2A 2H3EB 4DBFA 4JRKA 1JBMA 3CPFA 2L3RA 1KC8U 3GLXA 1M1FA 1VQ7Q 3V8LA 3CCRQ 3HP9A 1WJSA 2QQBA 2HKNA 4DBRA 5J26A 2K5LA 2K7AA 2NUTB 4OMNA 4ATOA 2BZ8A 2LQ8A 3H9NA 3J81E 2RO0A 4DOWA 2YUOA 5FRMA 2XDPA 4XTUA 1KC8C 1VQ4Q 2F2WA 5A0DA 5FROA 4LXCA 4EMKC 2LVMA 1G83A 3EHRA 3MO8A 2OAUA 3OW2P 1A0NB 2CZ0B 1TOVA 4FYWB 5EG2A 2ATCB 2HAXA 1JU5C 3EFOB 1N8RU 1U06A 1JJ2A 1PRLC 3FDRA 5IT9E 4M78E 4ELYC 1IHWA 2DYIA 1NE8A 2RQUA 3V8JA 2X9HA 4B9WA 2DIGA 4KH0B 2JM9A 5HY6A 3CMAA 2RHXA 3M0RA 3CCEQ 3QIIA 3C94A 3OS2A 1N8RC 2AHJB 1KQSP 2PVOB 1TG0A 1NYFA 3EG1A 3FJ5A 4HA8A 5FU7B 3RKXA 2DFUA 1VQLT 3MHXA 2FYKA 2ABLA 3M0PA 2NUTA 1YITT 1SEMA 2JS0A 3OA6A 2DTHA 1K4US 1UGQB 3HHTB 4EMKA 4AFUC 2RHIA 5A0GA 5GANg 1WHGA 1NPPA 2ZPBB 2COZA 2O88A 3CC2A 4OGCA 4PJOD 1X6GA 3X24B 2HSPA 3META 3A98A 1Q82U 2J7IA 3D7SB 5CKEA 2EYZA 1MHNA 2LZ6B 1HSQA 2HDAA 2HQHA 2O4XB 3M54A 5LJ3f 3EFOA 4BE1A 1NEGA 1YJNQ 4J5YA 4M7AC 1YJ9A 3JCMX 1UGVA 1VQ6T 2D0QB 1SSHA 2HSEB 3S6WA 2KRSA 2NUPB 1PC0A 3WVEB 1M1KR 1TXQA 1I07A 2HKQB 3M4GA 4NL2A 1ZSGA 4ZGEB 1H8KA 4J7IA 1WFWA 4M77D 5LJ3h 3M56A 4GLMA 2XIDA 3GOXA 3PIOA 2LNVA 4AFQC 3CCLT 5CCAA 3EFRA 1VQ9T 1YI2T 4RG8A 2PZ1A 4C0ZA 2FPFA 3G6EQ 1M2VB 2LX9A 2AIRB 2V8IA 2W10A 4PJMA 3BDLA 4CC3A 2QA4Q 1BBZA 4ZGDB 2D0NA 2CDTA 5I11A 2E65A 2QEXA 1SHGA 1BCMA 3NFCA 4II1A 4L6V5 4RTTA 1Q86R 2O4XA 5L23A 3EG3A 1VQMQ 3QJYA 2DPPB 1BI2A 2E3IA 3I9QA 4XU1A 1VQ8A 1GXIE 5IXBA 1MMAA 3JCMd 4BI8B 2FL7A 2NUPA 3BY7A 1JO8A 3TREA 3R6OA 2HZYA 2KI7A 2LC4A 4V2SA 1K73U 3TVTA 3OYLA 1M3CA 1V29B 3LH5A 3RIRA 2K3XA 4M7DD 3OMGA 4LE9A 4C5GA 1UEBA 1Q95G 1VQOA 2DLPA 1I8FA 1R0CB 4PL6A 3OB9A 2HMAA 4B9XA 1QP3A 3M0UA 5GAN5 3CC7Q 1UE9A 4OMQA 1K73C 2B86A 2PNIA 3Q1JA 4BE2A 2LRQA 2W0ZA 1H641 3E2UA 5GAMf 4BY6C 1YFNA 2KT1A 3REAB 4ORZA 4LUEA 2MOXA 2P0KA 4IUTA 2DD4A 1B34B 1VQ5T 1KJWA 2BZYA 2FZCB 1OOTA 3VV0A 4NS5A 3ZL7C 1RI0A 5D6WA 3WVDB 1QWFA 2EQMA 2Z0WA 4IURA 1G3SA 2O9SA 1D1CA 2DL4A 1CKAA 4PJOG 5GAMh 3VRZA 4AT1B 5LJ5j 4PJOB 3OSSC 2FVUA 3LW5E 4PJOC 4A4HA 3MEVA 1M5Q1 1TUCA 2CS7A
chains in the Genus database with same CATH topology
4TVRA 3PGGA 3ZEHA 5LJ5e 3JB9G 4IUQA 4JJNK 1S72T 2D9TA 1JB0E 3CCVA 2RK1A 3LX7A 4KT0E 4RCBA 3CCUA 4M78D 2KK4A 2RH2A 4FIBA 2RHZA 4YTLA 2DVEA 5GAOn 4ZTFA 3GF5A 3RMQA 1VQKT 4C8QB 4J7FA 4BDZA 3MP1A 3HSBA 3RERA 4FSXA 4C5HA 4M77G 3I55T 3T9NA 1YJWA 4NL3A 1QVFS 1KHCA 3OW2S 3E19A 3CC4A 1VQNT 4M77B 2WACA 2E1HA 5DM7R 1WJQA 5GAN2 1S72A 1OZ3A 3OBYA 3V8KA 4C92F 4FM4B 2X35A 3QZ5B 5HK0A 5D6YA 1K9MU 2PQWA 4M77C 1VQKA 1BKBA 2YLBA 4C92E 3A8MB 4MDXA 2ZGWA 2Y4YA 4N4HA 4A54A 3OYMA 3JCMf 3OYNA 3FB9A 3I55A 1I5LA 5C0MA 3OYCA 3CD6T 3JCMW 4C92A 2QI2A 1IREB 3E9FA 3OYFA 3ZFJA 1N6AA 4MZPA 1VQNA 2VGNA 4PJOF 1Y7XA 3NTIA 3ER0A 4QQ6A 3SFMA 5CAIA 2G3RA 2GCXA 3CBOA 2ZPEB 5CKDA 2KQWA 1XOVA 3QDRB 4OB1B 4HCBA 4PJOE 1H3ZA 5CQYA 3F70A 2PVGB 5CVIA 1KQSS 1UGPB 1ZBXA 2ZZDA 1QW1A 1U1SA 3P8DA 1Q7YU 5CIUA 3RUXA 4EMKB 3M55A 1HK9A 2LCCA 2DKGA 1JRIA 5DY9A 3CCMT 4PJOA 2DXUA 3HKSA 2XU8A 4HT8A 1G3TA 3GNFB 3P8BB 4XU3A 3JCMh 1M1KU 4F7UG 3CD6A 2RI2A 2XHCA 2DJZA 3X28B 3URGA 2DXBA 4BY6B 2VXFA 3LLRA 3L2RA 2KY9A 1KG1A 2K5IA 5LJ5f 1SSFA 1XQHA 1ZQ1A 3SWNB 3JB9F 4LDWA 4LDYA 1BI0A 4C8QF 3CXCS 1K8AU 1QVFA 3V7CA 3OW2A 3OYHA 2P4TA 4N0AC 3LGLA 1VIFA 3QG1A 4C8QE 1QP2A 4N4GA 3V7RA 5C6SA 3JB9H 4O5VA 2DXTA 4R56A 2EJ9A 3S3OA 3CCMA 3OMCA 1MGQA 3FRNA 4M77F 3A8HB 5KCHA 3LWIA 4PLLA 3SDZA 4C8QA 1M1KC 4M7DG 4QVZA 1VQPT 1VIEA 2OTLT 4PKCC 4PNOA 5DLQE 2E70A 3E9GA 2M9UA 4M77E 1KQ2A 2QDYB 3E1SA 4LDUA 4XU0A 3I56T 2WSFE 2QQ9A 2X4YA 4M77A 3MEWA 1W2BS 3CMET 2KVQG 3G7ZA 3PFSA 3CCST 2XI9A 3M4YA 2F5TX 4XTVA 5GAOp 3OYIA 3S3MA 1N9SA 2E64A 4M7DC 1O75A 4EPCA 1KQSA 3MP8A 3OYDA 1FXXA 2MWPA 4C0DC 4C92G 3LH0A 5CKBA 5HKCA 1VQPA 2OTLA 1WGSA 2JOYA 4ZN3A 4A4GA 2RI5A 3A8LB 2MWOA 4WF2A 3L2QA 3JCMQ 2K2VA 3I56A 4XU2A 5AYFA 3OS5A 3ZBDA 1Q86U 2F5KA 2VC8A 3CMEA 1DJ7B 2ZPGB 3CCSA 3HRUA 3GNGA 4JLGA 2IVWA 2Y90A 4CI0C 2RK2A 2DEQA 3QSUA 1IZ6A 1Y96B 4C92C 3CEYA 3SB2A 2VUBA 3QHSA 3FJPA 5GMKe 3P8HA 3J80E 4Z02A 4F7UF 3QPHA 4XTXA 3CCJT 2QQRA 3QYHB 3OYKA 2R5AA 2E6NA 3HPWA 2MI6A 3EAEA 4F7UE 4KULA 5GAN3 2XG8D 4LD9K 3RKYA 4M7AG 2KMTA 1Q86C 3LWHA 2RM4A 3HRTA 3QUIA 3SWNA 2K3YA 2LQKA 3VUZA 3HRSA 2DIQA 3VUBA 2K57A 4BI3A 5LJ3g 3PTAA 3CPWS 4F7UA 4QW2A 3O8VA 2M16A 3OBWA 3OY9A 1YHQT 4M7AB 1W2BA 5KCOA 4HT9A 4C8QG 4XQ3A 3RKWA 4BB7A 5GMKl 1G3YA 2C06A 2JTMA 4M7DF 4JS4A 1G3WA 2GF7A 3CCJA 3S3NA 5I2SA 1TH7A 2RHUA 3TU4K 3CCQT 2MF2A 3N5BB 4KUIA 2M0OA 4MMKA 2K5FA 3BW1A 4BACA 4M7DE 5GAN4 3HFOA 3CCRT 3HFNA 3JB9J 4M78G 3M57A 4E7JA 5HK3A 2WSCE 3M9QA 3G71T 3HL8A 1Q82C 4M7DA 4JRIA 1NPRA 4C8QC 3MEUA 4EMGA 4ME7A 4P5NA 3VKIA 1YHQA 5FRNA 2RJEA 2HNIA 2E41A 2VYTA 2QTXA 4M78B 3VU3C 4OMFB 1YBYA 4D6WA 3KXTA 4FT2A 1B34A 2XK0A 3FIFA 4C0FA 3CCQA 4JRKA 1VQ4T 4A4KA 1JJ2S 5LJ3d 3PMTA 3SD4A 3UWNA 4BI4A 3CCRA 1JBMA 3CPFA 3OYAA 2L3RA 5M9OA 1FX7A 1UGSB 1KC8U 2E12A 1WQ7A 2EIFA 2HQXA 4OGEA 3LYIA 3GLXA 1M1FA 2EKOA 4J6WA 3V8LA 3G71A 2Y4XA 3HP9A 4DQ2A 3L2ZA 1WJSA 2QQBA 3M59A 2XICA 2CYZB 5J26A 1PSFA 2K5LA 1OZ2A 3CPWA 4ELZC 4ATOA 1Y96A 1WJRA 2JN0A 3V7SA 1U1TA 2LQ8A 2H3JA 4BD3A 4RMOA 3J81E 2RJFA 2RO0A 1VQ4A 2P0PA 4DOWA 2QQSA 5FU6B 3GP8A 3X26B 5FRMA 4QQDA 2EJFA 2XDPA 4XTUA 1D3BB 2BKDN 4J8OA 1OYXA 1KC8C 4M7AF 2FHDA 5GANj 5A0DA 5FROA 4M7AE 3GIBA 4EMKC 2O01E 2LT4A 5GAN6 1NJIU 1QVGS 1N27A 2LVMA 3FC3A 4UC4A 3CCET 2CGHA 4JUVA 5LJ3j 4M7AA 3MO8A 4M75D 2XD0A 3CMAT 4C5IA 2OAUA 2CZ0B 5GANe 2E6ZA 3SWNC 3OYEA 5EG2A 2V8JA 3L2WA 2HAXA 3JCMb 4Y91A 1N8RU 4M78F 1JJ2A 1WQWA 2KDSA 3FDRA 3VYHB 2R58A 3C4SA 5LJ3e 5IT9E 5CO7A 2X4XA 1NJIC 4M78E 4ELYC 2P0QA 3OYBA 1NE8A 4Q5WA 3V8JA 4M75B 4E7IA 4J83A 4B9WA 2DIGA 1O9SA 5LJ5h 3CCEA 5LL6S 1Y07A 3PT9A 5HY6A 4M78A 4C5EA 3CMAA 4IUUA 3DB4A 2RHXA 4L5GA 4C0GA 3QIIA 2F69A 1VUBA 3C94A 2BUDA 4MDWA 3OS2A 2NLUA 1N8RC 2AHJB 4MMLA 3JCMc 2CZ7B 1BIBA 2HD0A 5GAN8 2GFUA 1M1GA 3JAME 2MMPA 4A4EA 2PVOB 2X4WA 2R57A 1YCYA 2K4YA 2A3LA 2JVVA 2JZ2A 4JLIA 5GMKj 5GAMg 1U8RA 3ME9A 2V8KA 3CC2T 3JCMV 2CZ6B 4HA8A 5FU7B 2A7YA 2DD5A 1I4K1 2FB7A 3OYYA 3RKXA 5A2QE 2WSEE 4FL6A 1VQLT 2OTJT 3MHXA 2FYKA 2B8AA 3DKMA 4MZTA 5GAOq 4EMHA 5GAOm 1YITT 4A53A 3CXCA 1RL2A 3OA6A 2DTHA 1BYMA 2CKKA 1YJNT 1EIFA 3OS1A 1UGQB 3HHTB 4CRIA 4EMKA 3UT1A 1FWZA 2RHIA 1D3BA 3MP6A 5KE2A 3L2VA 5A0GA 3PMIA 5GANg 1YIJT 3EFSA 1NPPA 2M1HA 2ZPBB 3QYGB 4X34A 4PLIA 2EJGA 5D6XA 3CC2A 2L5QA 1LJOA 4OGCA 4HKEA 1VQLA 2PUKB 2OTJA 4PJOD 3X24B 5CR2A 3META 2KSSA 2LDMA 2LTOA 3JCMe 1YITA 2DK3A 3RESA 4RKUE 1Q82U 4LD6A 1Q81U 4LDXA 5CKEA 1YJNA 4XAXB 4KBMB 2L8DA 5GMKm 2KAFA 3OS0A 1MHNA 4OF1A 1KQ1A 2ZPHB 4BE0A 2VV5A 5GAMd 2DXCA 5LJ3f 2O4XB 3M54A 4BE1A 1YIJA 3NTKA 2EQKA 3INZA 2JNGA 3DLMA 4J5YA 1NZ9A 2RI3A 4M7AC 1Y71A 1YJ9A 3JCMX 1XNIA 1VQ7T 2ZCFB 3WXMB 1VQ6T 1M4ZA 2D0QB 3A8GB 4ZN1A 2D6FA 2XDBA 1X6OA 4J6XA 3S6WA 3FEOA 1LOJA 3JB9D 3JSCA 4JS5A 4NOYA 1BI1A 3WVEB 1UGRB 1Q81C 4JDSA 3M4GA 5GANd 4NL2A 3PNWC 1KD1U 3TCJA 3BDUA 5A0LA 4ZGEB 5GAOr 5CQXA 3G6ET 1QVPA 4J7IA 4M77D 1BI3A 1X01A 2X4JA 3M56A 5LJ3h 5J39A 4RG2A 4JRPA 1VQ7A 4IUVA 1UB4A 4M78C 1VQ6A 1XTDA 2XIDA 3GOXA 2QA4T 3QO3A 3PIOA 1N9RA 3KUFA 3OYGA 3JCMJ 2VGMA 2LNVA 5DLOA 3DB3A 4XK8E 4XTYA 4ZGJB 5IAYA 3CCLT 5CCAA 2ZPFB 3ASKA 2YHTA 5GAMj 3EFRA 1VQ9T 1KD1C 2XKOC 1YI2T 4RG8A 2YRVA 2E10A 2QEXT 2EAYA 5KE3A 2HBPA 1I81A 3JCMg 3G6EA 1VQMT 1OI1A 2GQVA 4EDUA 3M58A 4DOVA 1G5VA 2JUFA 4C0ZA 1M90U 1KHIA 2DAQA 2QA4A 2LX9A 5GAMe 3M53A 1VQ8T 2V8IA 3CCLA 1AHJB 5FU6C 3BDLA 3RMSA 2EQJA 2YLCA 3PIPA 5L8RE 4ZGDB 4OP0A 1VQ9A 3VYGA 4E7HA 1YI2A 2QXFA 3UDCA 2E65A 3J7AF 2QEXA 2DZCA 5GMKh 1M9SA 1VQMA 3KBGA 4A4FA 3JB9I 3GPLA 3NFCA 4RCCA 4II1A 4L6V5 1K9MC 2CZ1B 2O4XA 1M90C 3QKJA 3L2UA 2LT1A 5LJ5g 2I2LA 3H6ZA 4M75G 3CC7T 2DZ9A 3QJYA 1VQOT 2DPPB 1BI2A 4ZTJA 4XU1A 1VQ8A 1GXIE 2BIVA 1ZHIA 4GY5A 1WPYA 4XTZA 2FL7A 4HCZA 3BY7A 5IN1A 4BI8B 3JCMd 3MEAA 4QVCA 3TREA 3R6OA 4X9DA 1BIAA 3CBPA 4XTWA 2IG0A 3C95A 2EYQA 2LC4A 2PVDB 3OSVA 5FLXE 4V2SA 2RA2A 2R5MA 3AHUA 3CBMA 1HXDA 3QXEB 2HQEA 4R55A 4F7UB 2DO3A 3OYLA 1K73U 4KUDK 2MAMA 1V29B 2DTIA 3RIRA 2K3XA 4GLKA 4M7DD 4M75C 2EFIA 4IUPA 1Q7YC 3OMGA 3X25B 1UEBA 4C5GA 3OYJA 3CC7A 1W4SA 3UPUA 2LCLA 2RHYA 5I2MA 4E7KA 1VQOA 1I8FA 2RJCA 4PL6A 2VXEA 3OB9A 3BFMA 3QBYA 1QP3A 4B9XA 3JCMP 5GAN5 4OB3B 3A5ZB 3LGFA 2RD1A 2QQAA 4E7LA 1K73C 1K8AC 4M7DB 5LJ5d 1QVGA 3H8ZA 3Q1JA 4BE2A 2LRQA 3QJ6A 4C0DB 4DA4A 4LDVA 1H641 4C92D 3L1AA 3OQ5A 3X20B 5GAMf 4BY6C 5FU7C 3DLLA 2PU9B 4FU6A 4QVDA 4VUBA 2P0KA 4IUTA 2DD4A 1B34B 4FT4A 2ZPIB 1VQ5T 3VV0A 2PUOB 2RB6A 4L59A 1R8OB 4NS5A 3G4ST 5CKFA 1RI0A 4MZMA 3MCAB 1YJ9T 4Y28E 5D6WA 3JRZA 3WVDB 1X75C 5I21A 2RJDA 5GAN7 2EQMA 3FLGA 4IURA 4C92B 4IKFA 1G3SA 5GANf 5CK9A 2JTFA 1P92A 5GAOl 2DTOA 3A8OB 2EWNA 3L42A 4N4IA 2L89A 4M75F 4PJOG 5GAMh 1WNLA 1VQ5A 4E47A 4X9CA 4M7AD 1LNXA 3NTHA 3CCVT 3G4SA 3CCUT 1PSEA 2GFAA 4M75E 4OB2B 4QQGA 5CKHA 1M8VA 3C12A 5LJ5j 4BUGA 4PJOB 3OSSC 2EQUA 4O6JA 5KH6A 4HCCA 3QZ9B 4OB0B 4M75A 4N0AA 4J6YA 5J3BA 3VJPA 2E5QA 4C8QD 2FVUA 5GMKi 1YJWT 5GANh 3LW5E 3M5AA 4PJOC 3TEEA 4A4HA 3MEVA 1M5Q1 4OVAA 4JRQA 4BDYA 2XDDA 2CS7A 3CC4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK0 A;  5CO7 A;  5CKE A;  4ELY C;  1NE8 A;  2C06 A;  4MZT A;  4OF1 A;  4MDX A;  1UB4 A;  2MF2 A;  2VUB A;  3G7Z A;  1M1F A;  5CKH A;  5DLO A;  4VUB A;  4MZP A;  1VUB A;  5CCA A;  3HPW A;  5CKD A;  5CKF A;  5CKB A;  5HK3 A;  5HKC A;  3JSC A;  4MZM A;  3NFC A;  4ELZ C;  2KMT A;  3JRZ A;  4ME7 A;  5CQY A;  1X75 C;  4HKE A;  3VUB A;  5CR2 A;  3TCJ A;  5CQX A;  5CK9 A; 
#chains in the Genus database with same CATH topology
 2E4H A;  4IIM A;  4TVR A;  1NJI R;  4IUQ A;  3CCV A;  1QMC A;  4M78 D;  4FIB A;  2QYZ A;  1FMK A;  1VQK T;  1RUW A;  1WHK A;  4J7F A;  4M77 G;  2L2P A;  3I55 T;  3T9N A;  2F2X A;  2EGE A;  3CC4 A;  2MK5 A;  4M77 B;  2E1H A;  1S72 A;  1H92 A;  3OBY A;  3V8K A;  2CRE A;  1ZX6 A;  2X35 A;  4DBQ A;  2PQW A;  4M77 C;  1UHC A;  2YLB A;  3A8M B;  4N4H A;  3OYM A;  1I5L A;  1CSK A;  1QWE A;  2YSQ A;  2QI2 A;  3JCM W;  2EGC A;  4LN2 A;  3OYF A;  1VYT A;  1VQN A;  1AOJ A;  2VGN A;  1TWB A;  4PJO F;  9ATC B;  1AWO A;  4QQ6 A;  5CAI A;  3G71 Q;  5CKD A;  2KQW A;  4HCB A;  1WHL A;  2ZZD A;  1QW1 A;  1U1S A;  3P8D A;  2YUP A;  3RUX A;  3M55 A;  2LCC A;  2DKG A;  1JRI A;  1UFF A;  3CCM T;  4PJO A;  4HT8 A;  1JJ2 P;  2DL3 A;  3CD6 A;  3X28 B;  1VYV A;  3URG A;  1Y57 A;  3EG2 A;  2OJ2 A;  3SWN B;  4KGZ B;  3CXC S;  1K8A U;  5IHK A;  1QVF A;  3OW2 A;  2P4T A;  4N0A C;  4C8Q E;  3V7R A;  2DXT A;  1Q81 R;  3OMC A;  3FRN A;  4M77 F;  5KCH A;  2JT4 A;  3HTR A;  4M7D G;  4QVZ A;  2OTL T;  3E9G A;  2QDY B;  4FW2 A;  2MCN A;  2EVR A;  3H0H A;  2X4Y A;  4M77 A;  4PK4 A;  3M4Y A;  3TSZ A;  5GAO p;  2E64 A;  4M7D C;  1WHH A;  4EPC A;  1KQS A;  2J6O A;  2KBT A;  1VQP A;  2LJ0 A;  1WGS A;  2JOY A;  3A8L B;  4FSS A;  3I56 A;  1C6V X;  1RAB B;  4PFP A;  1I0C A;  2I0N A;  3GNG A;  2Y90 A;  3CME Q;  4WCI A;  3SB2 A;  2VUB A;  3QHS A;  4CC2 A;  2JMC A;  1X2Q A;  2JXB A;  3OYK A;  2C0O A;  2E6N A;  4LD9 K;  1K9M R;  2DF6 A;  3LWH A;  3QUI A;  3SWN A;  4BI3 A;  2DIQ A;  5AT1 B;  3O8V A;  1W2B A;  5GMK l;  2JTM A;  4M7D F;  3S3N A;  3N5B B;  2LQW A;  1HYO A;  4BAC A;  5GAN 4;  3HFO A;  3JB9 J;  4M78 G;  1UEC A;  1Q7Y R;  4JZ4 A;  4M7D A;  2EBP A;  4JRI A;  4ME7 A;  1D1A A;  4M78 B;  4OMF B;  2GTO A;  2IPO B;  1YHQ Q;  1QQJ A;  2XK0 A;  4C0F A;  2EQI A;  3SD4 A;  3CCR A;  3CCQ Q;  2EKO A;  4J6W A;  2DIL A;  2AT1 B;  2YUN A;  3M59 A;  2XIC A;  4PJJ A;  2H3J A;  4RMO A;  2RJF A;  1VQ4 A;  5FU6 B;  2V1Q A;  2EJF A;  1RLQ C;  3MJX A;  1OYX A;  2SRC A;  2FHD A;  5GAN j;  2YWW A;  2LT4 A;  3CQT A;  1QVG S;  1N27 A;  4UC4 A;  3VS3 A;  4JUV A;  5LJ3 j;  1NEB A;  4PFZ A;  1VQ9 Q;  3CMA T;  4C5I A;  2E3H A;  1HJD A;  1UJY A;  2V8J A;  1PD1 A;  1X6B A;  4Y91 A;  4M78 F;  1TUG B;  5FWB A;  1IO6 A;  2R58 A;  1OPL A;  3CCE A;  5LJ5 h;  4ZNX A;  1Y07 A;  4JJB A;  4M78 A;  4C5E A;  4E2F B;  3UA6 A;  2RNA A;  1NYG A;  2BUD A;  2CP5 A;  2GFU A;  4RTW A;  1M1G A;  3JAM E;  3I5S A;  1YCY A;  2K4Y A;  2A3L A;  2JVV A;  1U8R A;  3ME9 A;  2V8K A;  3CC2 T;  2A7Y A;  2FB7 A;  4A53 A;  8AT1 B;  2CKK A;  3OS1 A;  2KRM A;  4CRI A;  5KE2 A;  3EFS A;  4X34 A;  3TSW A;  2DM1 A;  2L5Q A;  1LJO A;  4HKE A;  5CR2 A;  4B6M A;  2CH4 W;  4RKU E;  4LD6 A;  4Z88 A;  4LDX A;  1YJN A;  2OTJ Q;  3OS0 A;  2E5K A;  4OF1 A;  2VV5 A;  1SHF A;  2CUD A;  2EQK A;  2JNG A;  1K0X A;  4RTU A;  1XNI A;  1LPL A;  4ZN1 A;  1YIJ Q;  3EGD B;  4NOY A;  1UGR B;  4JDS A;  2QGG A;  4CC7 A;  3BDU A;  5A0L A;  5GAO r;  1WXT A;  4E7Z A;  1SKU B;  5J39 A;  4FW1 A;  4FYV B;  3QO3 A;  1N9R A;  3JCM J;  3A1P A;  3DB3 A;  4ZGJ B;  5IAY A;  2ZPF B;  2YHT A;  5GAM j;  2XKO C;  2QGF B;  2QEX T;  5KE3 A;  2HBP A;  3JCM g;  3G6E A;  2KYB A;  2C0T A;  1QCN A;  1OI1 A;  1EFN A;  2MPX C;  1W6X A;  1VOM A;  4DOV A;  2JUF A;  1KHI A;  2DAQ A;  2QA4 A;  3NHN A;  2LQN A;  1VQ8 T;  4J9G A;  1V76 A;  3PIP A;  1HD3 A;  2QXF A;  3J7A F;  1VQM A;  1M2O A;  3KBG A;  1QVF P;  4KGV B;  4A4F A;  2RMO A;  8ATC B;  2O9V A;  3QKJ A;  2MIO A;  2LT1 A;  3H6Z A;  2AKL A;  1VQO T;  1WIE A;  2RQR A;  2BIV A;  3EGD A;  1ZUK A;  4HCZ A;  4AG2 C;  4QVC A;  4XTW A;  3C95 A;  2COY A;  2EW3 A;  2RA2 A;  2R5M A;  1HXD A;  3QXE B;  2HQE A;  4F7U B;  2DO3 A;  3SEM A;  1KIK A;  3CC7 A;  1Q82 R;  2KEA A;  3QBY A;  2RQT A;  2VB6 A;  1PKS A;  2M0Y A;  2K79 A;  5LJ5 d;  4F16 A;  2DET A;  5KYX B;  2HEQ A;  3X20 B;  5FU7 C;  3DLL A;  4FU6 A;  2LMJ A;  4VUB A;  2ZPI B;  4L59 A;  1KK7 A;  3JRZ A;  1X75 C;  3KFV A;  3R6N A;  5GAN f;  2YDL A;  5CK9 A;  1ABO A;  1WXB A;  4AG1 C;  2DTO A;  3L42 A;  3EGU A;  2L89 A;  1W2B P;  1OUL A;  3CCV T;  2O31 A;  2DVJ A;  5CKH A;  3C12 A;  3G4S Q;  5J3B A;  2EKH A;  1ZBJ A;  5GAN h;  4OVA A;  3BE3 A;  4JRQ A;  2QK0 A;  4HVW A;  3CC4 T;  3ZEH A;  5LJ5 e;  5HCK A;  1K1Z A;  1S72 T;  2AKK A;  3LX7 A;  4KT0 E;  3CCU A;  2RH2 A;  4YTL A;  5GAO n;  1PHT A;  4ZTF A;  2EGA A;  3RMQ A;  4C8Q B;  3H41 A;  3MP1 A;  4C5H A;  2PTK A;  1AEY A;  2DL5 A;  2FG0 A;  1KHC A;  2FEI A;  1VQN T;  2DA9 A;  3UAT A;  1YJW Q;  1AZE A;  4C92 E;  1K76 A;  4MDX A;  2ZGW A;  2Y4Y A;  4A54 A;  3OYN A;  1RAE B;  3CD6 T;  1GCQ A;  1PRM C;  1R0B G;  1IRE B;  3E9F A;  1N6A A;  2HL3 A;  4MZP A;  3NTI A;  2L3S A;  3CBO A;  2ZPE B;  2K6D A;  1H3Z A;  5CQY A;  2PVG B;  1MND A;  2A37 A;  2OI3 A;  2XU8 A;  3GNF B;  3P8B B;  4XU3 A;  1M1K U;  2DJZ A;  1WX6 A;  4C8Q F;  1NG2 A;  2LJ1 A;  1TU0 B;  3LGL A;  1VIF A;  2NYS A;  3EG9 B;  4N4G A;  5C6S A;  4O5V A;  2EJ9 A;  3S3O A;  1RLP C;  1MGQ A;  1M1K C;  4C8Q A;  1VQP T;  1D0Y A;  2FPD A;  5DLQ E;  2D8H A;  2M9U A;  2KT8 A;  4XU0 A;  3I56 T;  2RF0 A;  4XTV A;  3OYI A;  1ARK A;  2OAW A;  1M2V A;  1KD1 R;  5HKC A;  5CKB A;  1E6G A;  4GBQ A;  2MWO A;  3JCM Q;  1PKT A;  4XU2 A;  1Q86 U;  2F5K A;  3CME A;  2D1X A;  2RPN A;  2ZPG B;  2FPE A;  4RTV A;  2IVW A;  1OX8 A;  3QSU A;  1RAA B;  1IZ6 A;  1Y96 B;  2YRC A;  3CCS Q;  1QCF A;  2KR3 A;  3P8H A;  3HPW A;  4F7U E;  1M90 R;  1Q86 C;  1MMD A;  1OV3 A;  2K3Y A;  3HRS A;  3PTA A;  3CPW S;  1T3L A;  2M16 A;  1AVZ C;  3OBW A;  1YCS B;  3OY9 A;  4HT9 A;  5KCO A;  4OMM A;  3EG9 A;  2QG9 B;  1G3Y A;  1BB9 A;  2VWF A;  1SG5 A;  1TH7 A;  4RTZ A;  2RHU A;  3TU4 K;  2GGR A;  2MF2 A;  4KUI A;  3BW1 A;  3CCR T;  3CCJ Q;  3HFN A;  4F17 A;  1D09 B;  3MEU A;  1B07 A;  4FCY A;  5FRN A;  1YHQ A;  2RJE A;  2E41 A;  2VYT A;  2KRN A;  1ZSZ B;  2LX7 A;  1YBY A;  4D6W A;  1GBR A;  1B34 A;  1RAF B;  1H3H A;  1IGQ A;  3CCQ A;  1X69 A;  1VQ4 T;  4F14 A;  1K8A R;  5LJ3 d;  1RAC B;  4PJL A;  4J9E A;  3OYA A;  2E12 A;  2A28 A;  2EIF A;  2HQX A;  4OGE A;  2L3Q A;  4DQ2 A;  2CP7 A;  1E6H A;  1U3O A;  2CYZ B;  1PSF A;  4ELZ C;  1Y96 A;  3V7S A;  2P0P A;  2QQS A;  3GP8 A;  4QQD A;  1C1A A;  1D3B B;  4J8O A;  4J9H A;  1PG5 B;  4M7A E;  2O01 E;  1GFD A;  1NJI U;  3CCE T;  3QWX X;  5GAN e;  3SWN C;  4E7S A;  1NM7 A;  3JCM b;  1ACM B;  1T0J A;  3C4S A;  5LJ3 e;  5CO7 A;  2X4X A;  1NJI C;  3OYB A;  4Q5W A;  4M75 B;  4E7I A;  1O9S A;  3VS1 A;  5LL6 S;  3PT9 A;  2JTE A;  1D1B A;  3RNJ A;  2ENM A;  2FRW A;  3DB4 A;  3QWY A;  4ANJ A;  2F69 A;  1VUB A;  4FYY B;  4A63 B;  4RUG A;  2NLU A;  2BZX A;  1WXU A;  3UA7 A;  2CZ7 B;  1BIB A;  4DEX A;  2HD0 A;  4ESR A;  1W70 A;  2X4W A;  2R57 A;  1K9A A;  2JZ2 A;  3JCM V;  2CZ6 B;  3OYY A;  1I4K 1;  1UG1 A;  4FL6 A;  3DKM A;  5GAO q;  5GAO m;  4EMH A;  1RL2 A;  5GJW B;  1YJN T;  2XMF A;  3UT1 A;  1D3B A;  3MP6 A;  2ED0 A;  3L2V A;  3PMI A;  1GRI A;  4PLI A;  2DJQ A;  2ESW A;  3EHQ A;  2OTJ A;  1NLP C;  3NGP A;  2KSS A;  2LDM A;  2LTO A;  2V1R A;  1Q81 U;  1VQL Q;  1V1C A;  4XAX B;  2L8D A;  5GMK m;  2KAF A;  4BE0 A;  1KQ1 A;  2ZPH B;  1YIT Q;  1BCO A;  5GAM d;  1YIJ A;  3DLM A;  1EX4 A;  1NZ9 A;  2RI3 A;  2M02 A;  2ZCF B;  5KYN A;  3FEO A;  2AZV A;  1SRL A;  2AK5 A;  1D0Z A;  1BI1 A;  1Q81 C;  1IHV A;  1RAI B;  2ROL A;  1GFC A;  1J3T A;  5CQX A;  3G6E T;  1QVP A;  1BI3 A;  1X01 A;  2X4J A;  4JRP A;  1PD0 A;  1VQ7 A;  4M78 C;  1XTD A;  1ABQ A;  2QA4 T;  3JV3 A;  5KYW B;  3OYG A;  4XTY A;  1VQ6 Q;  5KYU B;  1C0M A;  3ASK A;  4JPB W;  1QCO A;  2E10 A;  2EAY A;  3IQL A;  1VQM T;  1M3A A;  4Z8A A;  2P84 A;  2GQV A;  1N5Z A;  1YN8 A;  5GAM e;  2DL8 A;  3M53 A;  2KYM A;  2VAS A;  1AHJ B;  5FU6 C;  2EQJ A;  3C0C A;  3ULR B;  2X3X D;  1IGU A;  3VYG A;  4E7H A;  3UDC A;  3CCL Q;  2DZC A;  5GMK h;  5ECA A;  1M9S A;  2F1L A;  1YI2 Q;  1K9M C;  2CZ1 B;  2GQI A;  1LVK A;  3L2U A;  5LJ5 g;  2I2L A;  2ROT A;  4J9F A;  3CC7 T;  2DZ9 A;  1RAD B;  3GBQ A;  3VS7 A;  1ZHI A;  4GY5 A;  1WPY A;  4XTZ A;  5IN1 A;  1BIA A;  2IG0 A;  3OSV A;  5FLX E;  3CD6 Q;  3AHU A;  4R55 A;  4D8D A;  2MAM A;  2DTI A;  1Z9Q A;  2CT3 A;  1Q7Y C;  3OYJ A;  1W4S A;  3UPU A;  4RTX A;  2RHY A;  3PVQ A;  4E7K A;  2RJC A;  3BFM A;  2X51 A;  2JMA A;  3LGF A;  3EG0 A;  2QQA A;  2A08 A;  2DRK A;  4CC4 B;  3QJ6 A;  1M27 C;  4C0D B;  4DA4 A;  4LDV A;  2LNH B;  1OU8 A;  3L1A A;  3OQ5 A;  3CXC P;  2PU9 B;  1JXM A;  2GNC A;  4FT4 A;  2PUO B;  2RB6 A;  2V26 A;  4LNP A;  5CKF A;  1YJ9 T;  4Y28 E;  5GAN 7;  2RJD A;  3FLG A;  1VQP Q;  4HCK A;  4C92 B;  4IKF A;  1KC8 R;  2JTF A;  2EWN A;  4N4I A;  1WNL A;  1IB8 A;  4E47 A;  4X9C A;  3TQ7 P;  4M7A D;  3NTH A;  1UJ0 A;  3G4S A;  1PSE A;  4M75 E;  3CCU T;  1VQ5 Q;  2SEM A;  2KGT A;  5KH6 A;  2J6K A;  4J6Y A;  4C8Q D;  5GMK i;  3TEE A;  1WHJ A;  4BDY A;  2XDD A;  1YWO A;  3PGG A;  2K3B A;  1JB0 E;  2KK4 A;  2RHZ A;  4J9D A;  5D7U A;  1RAG B;  4EIK A;  3M0T A;  3GF5 A;  4BDZ A;  3HSB A;  4FSX A;  3PE0 A;  1YJW A;  1N8R R;  4KGX B;  3E19 A;  1JQQ A;  1JEG A;  5DM7 R;  1WJQ A;  5GAN 2;  3THK A;  1R77 A;  3RR6 A;  4C92 F;  2KXD A;  1X27 A;  3QZ5 B;  1BKB A;  2MYS A;  3JCM f;  3FB9 A;  2VVK A;  3OYC A;  2ZAE A;  1VQK Q;  4C92 A;  5KYY B;  1ZUU A;  4R0K A;  3ZFJ A;  1MV3 A;  3I55 Q;  3SFM A;  2G3R A;  2GCX A;  5IXF A;  3QDR B;  2GTJ A;  4E6R A;  2YXY A;  3PVL A;  1GCP A;  5CVI A;  5IH2 A;  1ZBX A;  2OX7 A;  5CIU A;  4EMK B;  1HK9 A;  1G3T A;  2AZS A;  3JCM h;  4F7U G;  7AT1 B;  4DEY A;  2DXB A;  3LLR A;  4X1V A;  2KY9 A;  2J05 A;  1SSF A;  4LDW A;  4LDY A;  2DE0 X;  2CSQ A;  3OYH A;  3MKD A;  2VKN A;  3QG1 A;  1QP2 A;  2X3W D;  3A8H B;  2COW A;  4PLL A;  3EGX B;  1VIE A;  2ED1 A;  2H8H A;  4PNO A;  3CCM Q;  3E1S A;  4LDU A;  2QTV A;  1GL5 A;  1I5O B;  3CME T;  2KVQ G;  1QVG P;  2F5T X;  3S3M A;  1N9S A;  1O75 A;  3MP8 A;  3OYD A;  1FXX A;  2QDL A;  4ZN3 A;  2RI5 A;  1FMW A;  5KYY A;  3L2Q A;  2K2V A;  2OTL Q;  5AYF A;  1NLO C;  2VC8 A;  4QKU A;  1DJ7 B;  3CCS A;  3VRY A;  4CI0 C;  1TUD A;  1G2B A;  1GCQ C;  2CP2 A;  5GMK e;  1NBE B;  4F7U F;  3J80 E;  4XTX A;  2QQR A;  1AWJ A;  2MI6 A;  3EAE A;  1I1J A;  4KUL A;  2XG8 D;  4M7A G;  2KMT A;  2CSI A;  1E7O A;  2O2O A;  3HRT A;  2LQK A;  3VUZ A;  5LJ3 g;  2K57 A;  2DBK A;  4F7U A;  4QW2 A;  2JJ9 A;  1YHQ T;  4M7A B;  1VYU A;  4C8Q G;  3G1J A;  3RKW A;  2C06 A;  4FYX B;  4JJD A;  1G3W A;  2GF7 A;  3CCJ A;  5I2S A;  3CCQ T;  1U5S A;  3EGX A;  2M0O A;  4MMK A;  2K5F A;  3EH1 A;  2C0I A;  1PNJ A;  2DMO A;  2BE9 B;  1WZO A;  4E7J A;  5HK3 A;  3M9Q A;  1Q82 C;  1M3B A;  4C8Q C;  3VKI A;  5KYX A;  5EC7 A;  2K2M A;  3VS6 A;  3KXT A;  3FIF A;  1ZA1 B;  2LP5 A;  1K73 R;  4A4K A;  1JJ2 S;  3PMT A;  3UWN A;  4BI4 A;  5M9O A;  2CP0 A;  1FX7 A;  1UGS B;  4KRT A;  3UF4 A;  1WQ7 A;  3LYI A;  3G71 A;  2Y4X A;  4HXJ A;  3L2Z A;  1BK2 A;  1OZ2 A;  3CPW A;  1WJR A;  2JN0 A;  2EYY A;  1U1T A;  2J06 A;  1PWT A;  4BD3 A;  3X26 B;  4OMO A;  2BKD N;  4M7A F;  3GIB A;  3EH2 A;  5GAN 6;  2A0F B;  3FC3 A;  1KSW A;  2CGH A;  2K9G A;  4M7A A;  4M75 D;  2XD0 A;  1X43 A;  3RDV A;  3VS5 A;  2E6Z A;  1AT1 B;  2J6F A;  2RQV A;  3OYE A;  3L2W A;  1PM3 A;  1FMV A;  1WQW A;  2KDS A;  3VYH B;  4JJC A;  2P0Q A;  4J83 A;  2CT4 A;  5I22 A;  4RTY A;  4IUU A;  4D8K A;  4L5G A;  4QT7 A;  5FWC A;  5IHN A;  4C0G A;  4MDW A;  3CMA Q;  4MML A;  3JCM c;  1XJW B;  1MUZ A;  1RI9 A;  5GAN 8;  1W1F A;  2MMP A;  4A4E A;  2RN8 A;  4JLI A;  5GMK j;  5GAM g;  1AZG B;  4J9I A;  2EYW A;  2L0A A;  4BY6 B;  5A2Q E;  2DD5 A;  2WSE E;  2OTJ T;  2LJ3 A;  2B8A A;  4JZ3 A;  4MZT A;  1YNZ A;  1ZLM A;  4AMC A;  1WDX A;  3CXC A;  1KFZ A;  1BYM A;  1EIF A;  1SF9 A;  1FWZ A;  1YIJ T;  4AFZ C;  2QAS A;  4HVV A;  2M1H A;  3QYG B;  2NUZ A;  1QKW A;  2CP3 A;  2EJG A;  5D6X A;  2KRO A;  1VQL A;  2PUK B;  1X2K A;  1F1B B;  3JCM e;  1YIT A;  2DK3 A;  3RES A;  3CC2 Q;  2G6F X;  5IHI A;  4KBM B;  1T0H A;  2DXC A;  3NTK A;  2L3P A;  3INZ A;  1EZZ B;  1Y71 A;  1Z9Z A;  1VQ7 T;  3WXM B;  1M4Z A;  3A8G B;  2D6F A;  2XDB A;  1X6O A;  4J6X A;  1UDL A;  1LOJ A;  1YJ9 Q;  3JB9 D;  3JSC A;  1Y0M A;  4JS5 A;  3M0S A;  5GAN d;  3PNW C;  4J9B A;  1KD1 U;  3TCJ A;  4Y92 A;  2P4R A;  4RG2 A;  1K0S A;  4IUV A;  2EPD A;  1UB4 A;  1ZSZ C;  3NMZ C;  1VQ6 A;  3VS4 A;  3CCU Q;  2VGM A;  5DLO A;  4XK8 E;  2CP6 A;  1KD1 C;  1WYX A;  1SPK A;  2YRV A;  2DBM A;  2IIM A;  1I81 A;  6AT1 B;  4OML A;  3I35 A;  4EDU A;  3M58 A;  1G5V A;  1WHM A;  1M90 U;  2CH4 A;  3CCL A;  3RMS A;  2YLC A;  5L8R E;  2LCS A;  4OP0 A;  1VQ9 A;  3H0I A;  1YI2 A;  4PFO A;  3JB9 I;  3GPL A;  4RCC A;  1M90 C;  2QEX Q;  4M75 G;  4ZTJ A;  3MPU B;  1ZA2 B;  3VS2 A;  4F04 B;  3MEA A;  4X9D A;  3CBP A;  1VQ8 Q;  2EYQ A;  2PVD B;  2KXC A;  3AT1 B;  3CBM A;  1TSF A;  1YP5 A;  1ZSZ A;  4KUD K;  4GLK A;  4M75 C;  2EFI A;  4IUP A;  3X25 B;  2JW4 A;  3SHW A;  2LCL A;  5I2M A;  4KH1 B;  3M0Q A;  2VXE A;  1MNE A;  3JCM P;  1VQO Q;  4OB3 B;  1UHF A;  3A5Z B;  3RBB B;  2RD1 A;  4E7L A;  1K8A C;  4M7D B;  4AFS C;  1QVG A;  3H8Z A;  1YWP A;  4C92 D;  1WA7 A;  4QVD A;  1WLP B;  1R8O B;  2DX1 A;  3G4S T;  4MZM A;  2A36 A;  3MCA B;  2YRD A;  5I21 A;  2BTT A;  3O5Z A;  2JS2 A;  1JXO A;  1P92 A;  5GAO l;  3A8O B;  4J9C A;  4M75 F;  2DL7 A;  1VQ5 A;  1CKB A;  1TS9 A;  1LNX A;  2GFA A;  4OB2 B;  4QQG A;  2YT6 A;  2FRY A;  1M8V A;  4BUG A;  2EQU A;  4O6J A;  4HCC A;  3QZ9 B;  4OB0 B;  4M75 A;  4N0A A;  3VJP A;  1AWW A;  2E5Q A;  3VS0 A;  2EYX A;  1WI7 A;  1YJW T;  3M5A A;  3KUF A;  3JB9 G;  2DYB A;  4JJN K;  2D9T A;  2RK1 A;  4RCB A;  1MMN A;  1VA7 A;  1MMG A;  2QAZ A;  2D8J A;  2DVE A;  2KE9 A;  3CCV Q;  2ECZ A;  2CUB A;  3RER A;  2DNU A;  1GBQ A;  4NL3 A;  1QVF S;  3OW2 S;  2WAC A;  3CPW P;  1OZ3 A;  1OPK A;  1B3Q A;  4FM4 B;  3CC4 Q;  5HK0 A;  5D6Y A;  1K9M U;  1T3S A;  1S72 Q;  1VQK A;  2FZK B;  4IIO A;  3I55 A;  5C0M A;  2GBQ A;  1UTI A;  4LUD A;  1Y7X A;  3ER0 A;  1UUE A;  1XOV A;  4OB1 B;  4PJO E;  1KQS S;  3F70 A;  1VQN Q;  1SRM A;  1UGP B;  1MV0 B;  2DRM A;  1Q7Y U;  2FO0 A;  1QLY A;  5DY9 A;  2DXU A;  2BE7 D;  3HKS A;  3REB B;  3QDF A;  1M30 A;  2RI2 A;  2XHC A;  3I5R A;  2VXF A;  3L2R A;  1KG1 A;  2K5I A;  5LJ5 f;  2HL5 C;  1XQH A;  1OU9 A;  1ZQ1 A;  3JB9 F;  3H0F A;  1BI0 A;  1OEB A;  4PJN A;  3V7C A;  2HCK A;  4M4Z A;  2KNB B;  3JB9 H;  4R56 A;  3CCM A;  3LWI A;  3SDZ A;  5KYW A;  4PKC C;  2E70 A;  4M77 E;  5KYU A;  1KQ2 A;  1BU1 A;  2WSF E;  2QQ9 A;  3MEW A;  1W2B S;  4OMP A;  3G7Z A;  3PFS A;  3CCS T;  2XI9 A;  4WTO B;  4K11 A;  4DBH A;  1ZUY A;  1QKX A;  2MWP A;  4C0D C;  3LH0 A;  4C92 G;  5GJV B;  2OTL A;  1IRX A;  2YUQ A;  4A4G A;  1RAH B;  4WF2 A;  5FW9 A;  3OS5 A;  3ZBD A;  1S1N A;  3NPF A;  2NWM A;  4JLG A;  3HRU A;  1B7T A;  1G8X A;  3I56 Q;  2RK2 A;  2DEQ A;  1PCX A;  1M8M A;  1FYN A;  4C92 C;  3CEY A;  3FJP A;  4Z02 A;  3QPH A;  3CCJ T;  3QYH B;  2R5A A;  2DER A;  5GAN 3;  1IXD A;  3RKY A;  2RM4 A;  2DEU A;  3U23 A;  3VUB A;  4Z89 A;  1OQK A;  2JM8 A;  1AD5 A;  2HBW A;  4XQ3 A;  2M51 A;  4BB7 A;  4JS4 A;  2RQW A;  1LCK A;  4M7D E;  1TTH B;  4HVU A;  2FZG B;  3M57 A;  2WSC E;  1AWX A;  3G71 T;  1OX9 A;  3HL8 A;  2F2V A;  1NPR A;  4EMG A;  4P5N A;  2HNI A;  1D0X A;  2QTX A;  3VU3 C;  4FT2 A;  2H3E B;  4DBF A;  4JRK A;  1JBM A;  3CPF A;  2L3R A;  1KC8 U;  3GLX A;  1M1F A;  1VQ7 Q;  3V8L A;  3CCR Q;  3HP9 A;  1WJS A;  2QQB A;  2HKN A;  4DBR A;  5J26 A;  2K5L A;  2K7A A;  2NUT B;  4OMN A;  4ATO A;  2BZ8 A;  2LQ8 A;  3H9N A;  3J81 E;  2RO0 A;  4DOW A;  2YUO A;  5FRM A;  2XDP A;  4XTU A;  1KC8 C;  1VQ4 Q;  2F2W A;  5A0D A;  5FRO A;  4LXC A;  4EMK C;  2LVM A;  1G83 A;  3EHR A;  3MO8 A;  2OAU A;  3OW2 P;  1A0N B;  2CZ0 B;  1TOV A;  4FYW B;  5EG2 A;  2ATC B;  2HAX A;  1JU5 C;  3EFO B;  1N8R U;  1U06 A;  1JJ2 A;  1PRL C;  3FDR A;  5IT9 E;  4M78 E;  4ELY C;  1IHW A;  2DYI A;  1NE8 A;  2RQU A;  3V8J A;  2X9H A;  4B9W A;  2DIG A;  4KH0 B;  2JM9 A;  5HY6 A;  3CMA A;  2RHX A;  3M0R A;  3CCE Q;  3QII A;  3C94 A;  3OS2 A;  1N8R C;  2AHJ B;  1KQS P;  2PVO B;  1TG0 A;  1NYF A;  3EG1 A;  3FJ5 A;  4HA8 A;  5FU7 B;  3RKX A;  2DFU A;  1VQL T;  3MHX A;  2FYK A;  2ABL A;  3M0P A;  2NUT A;  1YIT T;  1SEM A;  2JS0 A;  3OA6 A;  2DTH A;  1K4U S;  1UGQ B;  3HHT B;  4EMK A;  4AFU C;  2RHI A;  5A0G A;  5GAN g;  1WHG A;  1NPP A;  2ZPB B;  2COZ A;  2O88 A;  3CC2 A;  4OGC A;  4PJO D;  1X6G A;  3X24 B;  2HSP A;  3MET A;  3A98 A;  1Q82 U;  2J7I A;  3D7S B;  5CKE A;  2EYZ A;  1MHN A;  2LZ6 B;  1HSQ A;  2HDA A;  2HQH A;  2O4X B;  3M54 A;  5LJ3 f;  3EFO A;  4BE1 A;  1NEG A;  1YJN Q;  4J5Y A;  4M7A C;  1YJ9 A;  3JCM X;  1UGV A;  1VQ6 T;  2D0Q B;  1SSH A;  2HSE B;  3S6W A;  2KRS A;  2NUP B;  1PC0 A;  3WVE B;  1M1K R;  1TXQ A;  1I07 A;  2HKQ B;  3M4G A;  4NL2 A;  1ZSG A;  4ZGE B;  1H8K A;  4J7I A;  1WFW A;  4M77 D;  5LJ3 h;  3M56 A;  4GLM A;  2XID A;  3GOX A;  3PIO A;  2LNV A;  4AFQ C;  3CCL T;  5CCA A;  3EFR A;  1VQ9 T;  1YI2 T;  4RG8 A;  2PZ1 A;  4C0Z A;  2FPF A;  3G6E Q;  1M2V B;  2LX9 A;  2AIR B;  2V8I A;  2W10 A;  4PJM A;  3BDL A;  4CC3 A;  2QA4 Q;  1BBZ A;  4ZGD B;  2D0N A;  2CDT A;  5I11 A;  2E65 A;  2QEX A;  1SHG A;  1BCM A;  3NFC A;  4II1 A;  4L6V 5;  4RTT A;  1Q86 R;  2O4X A;  5L23 A;  3EG3 A;  1VQM Q;  3QJY A;  2DPP B;  1BI2 A;  2E3I A;  3I9Q A;  4XU1 A;  1VQ8 A;  1GXI E;  5IXB A;  1MMA A;  3JCM d;  4BI8 B;  2FL7 A;  2NUP A;  3BY7 A;  1JO8 A;  3TRE A;  3R6O A;  2HZY A;  2KI7 A;  2LC4 A;  4V2S A;  1K73 U;  3TVT A;  3OYL A;  1M3C A;  1V29 B;  3LH5 A;  3RIR A;  2K3X A;  4M7D D;  3OMG A;  4LE9 A;  4C5G A;  1UEB A;  1Q95 G;  1VQO A;  2DLP A;  1I8F A;  1R0C B;  4PL6 A;  3OB9 A;  2HMA A;  4B9X A;  1QP3 A;  3M0U A;  5GAN 5;  3CC7 Q;  1UE9 A;  4OMQ A;  1K73 C;  2B86 A;  2PNI A;  3Q1J A;  4BE2 A;  2LRQ A;  2W0Z A;  1H64 1;  3E2U A;  5GAM f;  4BY6 C;  1YFN A;  2KT1 A;  3REA B;  4ORZ A;  4LUE A;  2MOX A;  2P0K A;  4IUT A;  2DD4 A;  1B34 B;  1VQ5 T;  1KJW A;  2BZY A;  2FZC B;  1OOT A;  3VV0 A;  4NS5 A;  3ZL7 C;  1RI0 A;  5D6W A;  3WVD B;  1QWF A;  2EQM A;  2Z0W A;  4IUR A;  1G3S A;  2O9S A;  1D1C A;  2DL4 A;  1CKA A;  4PJO G;  5GAM h;  3VRZ A;  4AT1 B;  5LJ5 j;  4PJO B;  3OSS C;  2FVU A;  3LW5 E;  4PJO C;  4A4H A;  3MEV A;  1M5Q 1;  1TUC A;  2CS7 A; 
#chains in the Genus database with same CATH homology
 4TVR A;  3PGG A;  3ZEH A;  5LJ5 e;  3JB9 G;  4IUQ A;  4JJN K;  1S72 T;  2D9T A;  1JB0 E;  3CCV A;  2RK1 A;  3LX7 A;  4KT0 E;  4RCB A;  3CCU A;  4M78 D;  2KK4 A;  2RH2 A;  4FIB A;  2RHZ A;  4YTL A;  2DVE A;  5GAO n;  4ZTF A;  3GF5 A;  3RMQ A;  1VQK T;  4C8Q B;  4J7F A;  4BDZ A;  3MP1 A;  3HSB A;  3RER A;  4FSX A;  4C5H A;  4M77 G;  3I55 T;  3T9N A;  1YJW A;  4NL3 A;  1QVF S;  1KHC A;  3OW2 S;  3E19 A;  3CC4 A;  1VQN T;  4M77 B;  2WAC A;  2E1H A;  5DM7 R;  1WJQ A;  5GAN 2;  1S72 A;  1OZ3 A;  3OBY A;  3V8K A;  4C92 F;  4FM4 B;  2X35 A;  3QZ5 B;  5HK0 A;  5D6Y A;  1K9M U;  2PQW A;  4M77 C;  1VQK A;  1BKB A;  2YLB A;  4C92 E;  3A8M B;  4MDX A;  2ZGW A;  2Y4Y A;  4N4H A;  4A54 A;  3OYM A;  3JCM f;  3OYN A;  3FB9 A;  3I55 A;  1I5L A;  5C0M A;  3OYC A;  3CD6 T;  3JCM W;  4C92 A;  2QI2 A;  1IRE B;  3E9F A;  3OYF A;  3ZFJ A;  1N6A A;  4MZP A;  1VQN A;  2VGN A;  4PJO F;  1Y7X A;  3NTI A;  3ER0 A;  4QQ6 A;  3SFM A;  5CAI A;  2G3R A;  2GCX A;  3CBO A;  2ZPE B;  5CKD A;  2KQW A;  1XOV A;  3QDR B;  4OB1 B;  4HCB A;  4PJO E;  1H3Z A;  5CQY A;  3F70 A;  2PVG B;  5CVI A;  1KQS S;  1UGP B;  1ZBX A;  2ZZD A;  1QW1 A;  1U1S A;  3P8D A;  1Q7Y U;  5CIU A;  3RUX A;  4EMK B;  3M55 A;  1HK9 A;  2LCC A;  2DKG A;  1JRI A;  5DY9 A;  3CCM T;  4PJO A;  2DXU A;  3HKS A;  2XU8 A;  4HT8 A;  1G3T A;  3GNF B;  3P8B B;  4XU3 A;  3JCM h;  1M1K U;  4F7U G;  3CD6 A;  2RI2 A;  2XHC A;  2DJZ A;  3X28 B;  3URG A;  2DXB A;  4BY6 B;  2VXF A;  3LLR A;  3L2R A;  2KY9 A;  1KG1 A;  2K5I A;  5LJ5 f;  1SSF A;  1XQH A;  1ZQ1 A;  3SWN B;  3JB9 F;  4LDW A;  4LDY A;  1BI0 A;  4C8Q F;  3CXC S;  1K8A U;  1QVF A;  3V7C A;  3OW2 A;  3OYH A;  2P4T A;  4N0A C;  3LGL A;  1VIF A;  3QG1 A;  4C8Q E;  1QP2 A;  4N4G A;  3V7R A;  5C6S A;  3JB9 H;  4O5V A;  2DXT A;  4R56 A;  2EJ9 A;  3S3O A;  3CCM A;  3OMC A;  1MGQ A;  3FRN A;  4M77 F;  3A8H B;  5KCH A;  3LWI A;  4PLL A;  3SDZ A;  4C8Q A;  1M1K C;  4M7D G;  4QVZ A;  1VQP T;  1VIE A;  2OTL T;  4PKC C;  4PNO A;  5DLQ E;  2E70 A;  3E9G A;  2M9U A;  4M77 E;  1KQ2 A;  2QDY B;  3E1S A;  4LDU A;  4XU0 A;  3I56 T;  2WSF E;  2QQ9 A;  2X4Y A;  4M77 A;  3MEW A;  1W2B S;  3CME T;  2KVQ G;  3G7Z A;  3PFS A;  3CCS T;  2XI9 A;  3M4Y A;  2F5T X;  4XTV A;  5GAO p;  3OYI A;  3S3M A;  1N9S A;  2E64 A;  4M7D C;  1O75 A;  4EPC A;  1KQS A;  3MP8 A;  3OYD A;  1FXX A;  2MWP A;  4C0D C;  4C92 G;  3LH0 A;  5CKB A;  5HKC A;  1VQP A;  2OTL A;  1WGS A;  2JOY A;  4ZN3 A;  4A4G A;  2RI5 A;  3A8L B;  2MWO A;  4WF2 A;  3L2Q A;  3JCM Q;  2K2V A;  3I56 A;  4XU2 A;  5AYF A;  3OS5 A;  3ZBD A;  1Q86 U;  2F5K A;  2VC8 A;  3CME A;  1DJ7 B;  2ZPG B;  3CCS A;  3HRU A;  3GNG A;  4JLG A;  2IVW A;  2Y90 A;  4CI0 C;  2RK2 A;  2DEQ A;  3QSU A;  1IZ6 A;  1Y96 B;  4C92 C;  3CEY A;  3SB2 A;  2VUB A;  3QHS A;  3FJP A;  5GMK e;  3P8H A;  3J80 E;  4Z02 A;  4F7U F;  3QPH A;  4XTX A;  3CCJ T;  2QQR A;  3QYH B;  3OYK A;  2R5A A;  2E6N A;  3HPW A;  2MI6 A;  3EAE A;  4F7U E;  4KUL A;  5GAN 3;  2XG8 D;  4LD9 K;  3RKY A;  4M7A G;  2KMT A;  1Q86 C;  3LWH A;  2RM4 A;  3HRT A;  3QUI A;  3SWN A;  2K3Y A;  2LQK A;  3VUZ A;  3HRS A;  2DIQ A;  3VUB A;  2K57 A;  4BI3 A;  5LJ3 g;  3PTA A;  3CPW S;  4F7U A;  4QW2 A;  3O8V A;  2M16 A;  3OBW A;  3OY9 A;  1YHQ T;  4M7A B;  1W2B A;  5KCO A;  4HT9 A;  4C8Q G;  4XQ3 A;  3RKW A;  4BB7 A;  5GMK l;  1G3Y A;  2C06 A;  2JTM A;  4M7D F;  4JS4 A;  1G3W A;  2GF7 A;  3CCJ A;  3S3N A;  5I2S A;  1TH7 A;  2RHU A;  3TU4 K;  3CCQ T;  2MF2 A;  3N5B B;  4KUI A;  2M0O A;  4MMK A;  2K5F A;  3BW1 A;  4BAC A;  4M7D E;  5GAN 4;  3HFO A;  3CCR T;  3HFN A;  3JB9 J;  4M78 G;  3M57 A;  4E7J A;  5HK3 A;  2WSC E;  3M9Q A;  3G71 T;  3HL8 A;  1Q82 C;  4M7D A;  4JRI A;  1NPR A;  4C8Q C;  3MEU A;  4EMG A;  4ME7 A;  4P5N A;  3VKI A;  1YHQ A;  5FRN A;  2RJE A;  2HNI A;  2E41 A;  2VYT A;  2QTX A;  4M78 B;  3VU3 C;  4OMF B;  1YBY A;  4D6W A;  3KXT A;  4FT2 A;  1B34 A;  2XK0 A;  3FIF A;  4C0F A;  3CCQ A;  4JRK A;  1VQ4 T;  4A4K A;  1JJ2 S;  5LJ3 d;  3PMT A;  3SD4 A;  3UWN A;  4BI4 A;  3CCR A;  1JBM A;  3CPF A;  3OYA A;  2L3R A;  5M9O A;  1FX7 A;  1UGS B;  1KC8 U;  2E12 A;  1WQ7 A;  2EIF A;  2HQX A;  4OGE A;  3LYI A;  3GLX A;  1M1F A;  2EKO A;  4J6W A;  3V8L A;  3G71 A;  2Y4X A;  3HP9 A;  4DQ2 A;  3L2Z A;  1WJS A;  2QQB A;  3M59 A;  2XIC A;  2CYZ B;  5J26 A;  1PSF A;  2K5L A;  1OZ2 A;  3CPW A;  4ELZ C;  4ATO A;  1Y96 A;  1WJR A;  2JN0 A;  3V7S A;  1U1T A;  2LQ8 A;  2H3J A;  4BD3 A;  4RMO A;  3J81 E;  2RJF A;  2RO0 A;  1VQ4 A;  2P0P A;  4DOW A;  2QQS A;  5FU6 B;  3GP8 A;  3X26 B;  5FRM A;  4QQD A;  2EJF A;  2XDP A;  4XTU A;  1D3B B;  2BKD N;  4J8O A;  1OYX A;  1KC8 C;  4M7A F;  2FHD A;  5GAN j;  5A0D A;  5FRO A;  4M7A E;  3GIB A;  4EMK C;  2O01 E;  2LT4 A;  5GAN 6;  1NJI U;  1QVG S;  1N27 A;  2LVM A;  3FC3 A;  4UC4 A;  3CCE T;  2CGH A;  4JUV A;  5LJ3 j;  4M7A A;  3MO8 A;  4M75 D;  2XD0 A;  3CMA T;  4C5I A;  2OAU A;  2CZ0 B;  5GAN e;  2E6Z A;  3SWN C;  3OYE A;  5EG2 A;  2V8J A;  3L2W A;  2HAX A;  3JCM b;  4Y91 A;  1N8R U;  4M78 F;  1JJ2 A;  1WQW A;  2KDS A;  3FDR A;  3VYH B;  2R58 A;  3C4S A;  5LJ3 e;  5IT9 E;  5CO7 A;  2X4X A;  1NJI C;  4M78 E;  4ELY C;  2P0Q A;  3OYB A;  1NE8 A;  4Q5W A;  3V8J A;  4M75 B;  4E7I A;  4J83 A;  4B9W A;  2DIG A;  1O9S A;  5LJ5 h;  3CCE A;  5LL6 S;  1Y07 A;  3PT9 A;  5HY6 A;  4M78 A;  4C5E A;  3CMA A;  4IUU A;  3DB4 A;  2RHX A;  4L5G A;  4C0G A;  3QII A;  2F69 A;  1VUB A;  3C94 A;  2BUD A;  4MDW A;  3OS2 A;  2NLU A;  1N8R C;  2AHJ B;  4MML A;  3JCM c;  2CZ7 B;  1BIB A;  2HD0 A;  5GAN 8;  2GFU A;  1M1G A;  3JAM E;  2MMP A;  4A4E A;  2PVO B;  2X4W A;  2R57 A;  1YCY A;  2K4Y A;  2A3L A;  2JVV A;  2JZ2 A;  4JLI A;  5GMK j;  5GAM g;  1U8R A;  3ME9 A;  2V8K A;  3CC2 T;  3JCM V;  2CZ6 B;  4HA8 A;  5FU7 B;  2A7Y A;  2DD5 A;  1I4K 1;  2FB7 A;  3OYY A;  3RKX A;  5A2Q E;  2WSE E;  4FL6 A;  1VQL T;  2OTJ T;  3MHX A;  2FYK A;  2B8A A;  3DKM A;  4MZT A;  5GAO q;  4EMH A;  5GAO m;  1YIT T;  4A53 A;  3CXC A;  1RL2 A;  3OA6 A;  2DTH A;  1BYM A;  2CKK A;  1YJN T;  1EIF A;  3OS1 A;  1UGQ B;  3HHT B;  4CRI A;  4EMK A;  3UT1 A;  1FWZ A;  2RHI A;  1D3B A;  3MP6 A;  5KE2 A;  3L2V A;  5A0G A;  3PMI A;  5GAN g;  1YIJ T;  3EFS A;  1NPP A;  2M1H A;  2ZPB B;  3QYG B;  4X34 A;  4PLI A;  2EJG A;  5D6X A;  3CC2 A;  2L5Q A;  1LJO A;  4OGC A;  4HKE A;  1VQL A;  2PUK B;  2OTJ A;  4PJO D;  3X24 B;  5CR2 A;  3MET A;  2KSS A;  2LDM A;  2LTO A;  3JCM e;  1YIT A;  2DK3 A;  3RES A;  4RKU E;  1Q82 U;  4LD6 A;  1Q81 U;  4LDX A;  5CKE A;  1YJN A;  4XAX B;  4KBM B;  2L8D A;  5GMK m;  2KAF A;  3OS0 A;  1MHN A;  4OF1 A;  1KQ1 A;  2ZPH B;  4BE0 A;  2VV5 A;  5GAM d;  2DXC A;  5LJ3 f;  2O4X B;  3M54 A;  4BE1 A;  1YIJ A;  3NTK A;  2EQK A;  3INZ A;  2JNG A;  3DLM A;  4J5Y A;  1NZ9 A;  2RI3 A;  4M7A C;  1Y71 A;  1YJ9 A;  3JCM X;  1XNI A;  1VQ7 T;  2ZCF B;  3WXM B;  1VQ6 T;  1M4Z A;  2D0Q B;  3A8G B;  4ZN1 A;  2D6F A;  2XDB A;  1X6O A;  4J6X A;  3S6W A;  3FEO A;  1LOJ A;  3JB9 D;  3JSC A;  4JS5 A;  4NOY A;  1BI1 A;  3WVE B;  1UGR B;  1Q81 C;  4JDS A;  3M4G A;  5GAN d;  4NL2 A;  3PNW C;  1KD1 U;  3TCJ A;  3BDU A;  5A0L A;  4ZGE B;  5GAO r;  5CQX A;  3G6E T;  1QVP A;  4J7I A;  4M77 D;  1BI3 A;  1X01 A;  2X4J A;  3M56 A;  5LJ3 h;  5J39 A;  4RG2 A;  4JRP A;  1VQ7 A;  4IUV A;  1UB4 A;  4M78 C;  1VQ6 A;  1XTD A;  2XID A;  3GOX A;  2QA4 T;  3QO3 A;  3PIO A;  1N9R A;  3KUF A;  3OYG A;  3JCM J;  2VGM A;  2LNV A;  5DLO A;  3DB3 A;  4XK8 E;  4XTY A;  4ZGJ B;  5IAY A;  3CCL T;  5CCA A;  2ZPF B;  3ASK A;  2YHT A;  5GAM j;  3EFR A;  1VQ9 T;  1KD1 C;  2XKO C;  1YI2 T;  4RG8 A;  2YRV A;  2E10 A;  2QEX T;  2EAY A;  5KE3 A;  2HBP A;  1I81 A;  3JCM g;  3G6E A;  1VQM T;  1OI1 A;  2GQV A;  4EDU A;  3M58 A;  4DOV A;  1G5V A;  2JUF A;  4C0Z A;  1M90 U;  1KHI A;  2DAQ A;  2QA4 A;  2LX9 A;  5GAM e;  3M53 A;  1VQ8 T;  2V8I A;  3CCL A;  1AHJ B;  5FU6 C;  3BDL A;  3RMS A;  2EQJ A;  2YLC A;  3PIP A;  5L8R E;  4ZGD B;  4OP0 A;  1VQ9 A;  3VYG A;  4E7H A;  1YI2 A;  2QXF A;  3UDC A;  2E65 A;  3J7A F;  2QEX A;  2DZC A;  5GMK h;  1M9S A;  1VQM A;  3KBG A;  4A4F A;  3JB9 I;  3GPL A;  3NFC A;  4RCC A;  4II1 A;  4L6V 5;  1K9M C;  2CZ1 B;  2O4X A;  1M90 C;  3QKJ A;  3L2U A;  2LT1 A;  5LJ5 g;  2I2L A;  3H6Z A;  4M75 G;  3CC7 T;  2DZ9 A;  3QJY A;  1VQO T;  2DPP B;  1BI2 A;  4ZTJ A;  4XU1 A;  1VQ8 A;  1GXI E;  2BIV A;  1ZHI A;  4GY5 A;  1WPY A;  4XTZ A;  2FL7 A;  4HCZ A;  3BY7 A;  5IN1 A;  4BI8 B;  3JCM d;  3MEA A;  4QVC A;  3TRE A;  3R6O A;  4X9D A;  1BIA A;  3CBP A;  4XTW A;  2IG0 A;  3C95 A;  2EYQ A;  2LC4 A;  2PVD B;  3OSV A;  5FLX E;  4V2S A;  2RA2 A;  2R5M A;  3AHU A;  3CBM A;  1HXD A;  3QXE B;  2HQE A;  4R55 A;  4F7U B;  2DO3 A;  3OYL A;  1K73 U;  4KUD K;  2MAM A;  1V29 B;  2DTI A;  3RIR A;  2K3X A;  4GLK A;  4M7D D;  4M75 C;  2EFI A;  4IUP A;  1Q7Y C;  3OMG A;  3X25 B;  1UEB A;  4C5G A;  3OYJ A;  3CC7 A;  1W4S A;  3UPU A;  2LCL A;  2RHY A;  5I2M A;  4E7K A;  1VQO A;  1I8F A;  2RJC A;  4PL6 A;  2VXE A;  3OB9 A;  3BFM A;  3QBY A;  1QP3 A;  4B9X A;  3JCM P;  5GAN 5;  4OB3 B;  3A5Z B;  3LGF A;  2RD1 A;  2QQA A;  4E7L A;  1K73 C;  1K8A C;  4M7D B;  5LJ5 d;  1QVG A;  3H8Z A;  3Q1J A;  4BE2 A;  2LRQ A;  3QJ6 A;  4C0D B;  4DA4 A;  4LDV A;  1H64 1;  4C92 D;  3L1A A;  3OQ5 A;  3X20 B;  5GAM f;  4BY6 C;  5FU7 C;  3DLL A;  2PU9 B;  4FU6 A;  4QVD A;  4VUB A;  2P0K A;  4IUT A;  2DD4 A;  1B34 B;  4FT4 A;  2ZPI B;  1VQ5 T;  3VV0 A;  2PUO B;  2RB6 A;  4L59 A;  1R8O B;  4NS5 A;  3G4S T;  5CKF A;  1RI0 A;  4MZM A;  3MCA B;  1YJ9 T;  4Y28 E;  5D6W A;  3JRZ A;  3WVD B;  1X75 C;  5I21 A;  2RJD A;  5GAN 7;  2EQM A;  3FLG A;  4IUR A;  4C92 B;  4IKF A;  1G3S A;  5GAN f;  5CK9 A;  2JTF A;  1P92 A;  5GAO l;  2DTO A;  3A8O B;  2EWN A;  3L42 A;  4N4I A;  2L89 A;  4M75 F;  4PJO G;  5GAM h;  1WNL A;  1VQ5 A;  4E47 A;  4X9C A;  4M7A D;  1LNX A;  3NTH A;  3CCV T;  3G4S A;  3CCU T;  1PSE A;  2GFA A;  4M75 E;  4OB2 B;  4QQG A;  5CKH A;  1M8V A;  3C12 A;  5LJ5 j;  4BUG A;  4PJO B;  3OSS C;  2EQU A;  4O6J A;  5KH6 A;  4HCC A;  3QZ9 B;  4OB0 B;  4M75 A;  4N0A A;  4J6Y A;  5J3B A;  3VJP A;  2E5Q A;  4C8Q D;  2FVU A;  5GMK i;  1YJW T;  5GAN h;  3LW5 E;  3M5A A;  4PJO C;  3TEE A;  4A4H A;  3MEV A;  1M5Q 1;  4OVA A;  4JRQ A;  4BDY A;  2XDD A;  2CS7 A;  3CC4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...