4MZTA

Mazf from s. aureus crystal form ii, c2221, 2.3 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MazF mRNA interferase
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 30
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mztA00
5DLOA 3G7ZA 1M1FA 5HK0A 1VUBA 4ME7A 4OF1A 4ELYC 4MDXA 4MZMA 4MZTA 1UB4A 5CQYA 5CKBA 4HKEA 5HKCA 2VUBA 3JRZA 5CQXA 5CKEA 5CKDA 3VUBA 1X75C 5HK3A 4MZPA 5CO7A 3TCJA 3JSCA 5CKFA 3HPWA 5CR2A 2KMTA 4ELZC 2MF2A 1NE8A 3NFCA 5CK9A 5CKHA 4VUBA 5CCAA 2C06A
chains in the Genus database with same CATH superfamily
2V8KA 1YJ9A 1TUDA 1Q82U 1FWZA 5KCOA 3GF5A 2EYWA 1QWFA 2KEAA 1TS9A 2LQNA 4J9FA 4C5GA 3GPLA 4LDWA 4QVDA 3OSVA 1H92A 3INZA 5KYYB 5FRMA 5FU7C 1LVKA 2NUTB 4M75B 2CUDA 3O5ZA 2CZ1B 3G7ZA 5CIUA 3CCET 1GCQA 3L2ZA 2KDSA 3SWNC 1O75A 5DY9A 2CUBA 2MWPA 3OMCA 2NUZA 1KQSS 1UJYA 1BI3A 3A5ZB 2HL5C 1T0HA 4J9HA 2RH2A 4MZPA 4FW2A 4PJOF 4J6WA 4RTWA 4EMKA 2P0PA 1YWPA 2GTOA 1G3TA 1Y71A 1MV0B 2QEXT 3S3MA 1RUWA 1WJRA 3I55T 1VOMA 2KNBB 1WJQA 3BW1A 3VS3A 3NTKA 2PVOB 3C4SA 4MZMA 5D6WA 4E7ZA 3G71T 1B07A 3M0QA 4IURA 4OB3B 3UF4A 2FEIA 4RTVA 3BDLA 4J9BA 2CH4A 4M77G 2DD5A 2EJGA 5GAMj 3OS1A 2QASA 1VQ6A 2HZYA 3D7SB 4M7DC 3VS5A 5GMKe 2HBPA 3VV0A 4PNOA 1FMWA 3CBMA 2CP7A 4BB7A 1K0XA 2E1HA 1SG5A 2YRDA 3I5SA 2O4XB 2FRYA 2YLCA 2GFUA 4IUUA 2LX9A 1QKXA 2JXBA 4CC4B 5GAOn 2RQWA 1GBRA 2NUPB 4LDYA 1AOJA 3REBB 5CKFA 1RACB 1X6GA 1Q86U 2RJDA 4QVCA 1I0CA 4E7SA 4M78D 1I8FA 3META 3CCEQ 2VGMA 1KQSP 2KT1A 2AK5A 3M53A 4DBQA 4C8QF 3M9QA 3OYIA 4MDXA 2RHYA 4JDSA 4M75C 3CMET 1G5VA 2P4RA 4XTVA 1KJWA 2O01E 2CP2A 4L6V5 2HKQB 3SD4A 1QCNA 2DD4A 1Q81C 1QVFA 4KBMB 2O2OA 3JCMb 3VRZA 1WI7A 1JB0E 1RAAB 2EGCA 1MHNA 4M78E 4FIBA 2HSPA 2QEXQ 3I55Q 3QUIA 2EPDA 2M02A 4JJNK 1KC8R 1AWJA 2XICA 1M4ZA 4WF2A 5GJWB 1BB9A 3G71Q 1BKBA 3PTAA 2W0ZA 2ZPBB 2CKKA 2FO0A 4BY6B 2HDAA 2X3XD 1QVPA 4DEYA 3SHWA 2LZ6B 2XKOC 4PKCC 3CCST 3OYMA 3SFMA 2KBTA 2FB7A 1G8XA 1VQ5A 3MCAB 4ORZA 4CI0C 2QA4A 1BK2A 2KY9A 3V8JA 1HJDA 3HPWA 3OB9A 1X6BA 2M9UA 1BIAA 1MV3A 2FVUA 1QP3A 2XI9A 2CDTA 2P0QA 5LJ5j 3JCMQ 1KIKA 2DL3A 5GAOr 4RKUE 2BZYA 2RMOA 4OVAA 3J7AF 1WHKA 3DLMA 4OMQA 4M7DD 5C0MA 2JM8A 2GGRA 4XTUA 1OULA 2V1RA 2X3WD 2QXFA 2JNGA 3VS6A 2A08A 3H6ZA 3KUFA 1IZ6A 2NWMA 3TQ7P 4RUGA 3RBBB 4ZN1A 5CR2A 5D7UA 2I0NA 1KD1R 5DLOA 3CD6A 4DOWA 4JLGA 1K9MR 2HEQA 4DBFA 1YJNA 4ZN3A 3CMEQ 2Y90A 5EG2A 1QMCA 2KRSA 1D1BA 2L3RA 3L42A 2JT4A 3V7RA 4DQ2A 3QJYA 5GANe 1NG2A 4HT8A 4XU0A 4FT2A 1Q82R 3P8HA 1X01A 1R0BG 1D0ZA 2VC8A 3I9QA 4F7UB 3CCQT 4D6WA 1WQ7A 2E3IA 3A8MB 4IUPA 1LOJA 1R8OB 3VUZA 2DZ9A 1QW1A 2QTVA 1FYNA 3NPFA 1JRIA 1Z9ZA 4X1VA 1WHJA 2A3LA 2CSQA 4M77C 1W2BS 3DKMA 4JRKA 2LT4A 1VQ6T 3ASKA 2PVGB 4HT9A 2DTIA 1RAFB 3CCSQ 1OZ2A 1Q81U 3R6OA 2HMAA 4BY6C 1NBEB 3OYBA 3OYDA 4ME7A 5FU6C 2ZGWA 9ATCB 5GAMg 2HAXA 2EYQA 2M51A 3EGXA 2XDBA 3LX7A 1BI0A 2PUKB 3OYYA 4E7HA 3S6WA 2G6FX 5J26A 1GFCA 3OYKA 4M7AB 1B7TA 2QI2A 2E10A 4CC2A 2D9TA 1D0YA 5KYUB 4HA8A 3OYCA 2X4XA 1N9SA 4ZTFA 1JQQA 2XIDA 2MPXC 2KSSA 4FCYA 1NPPA 5I21A 4AMCA 1OU9A 4FL6A 1IHWA 1OPLA 3FRNA 1MNEA 3JCMV 3CXCS 4M78A 1FMKA 2L8DA 3OBWA 4PL6A 2OTLA 1UG1A 4BE2A 1NJIC 3EFSA 4JRIA 1NYGA 1M1GA 3QDFA 2JTEA 4XAXB 4DBHA 4C92G 5KH6A 3JB9I 1PRMC 1RAHB 2FYKA 5IHKA 4GLMA 2LDMA 1OPKA 4WTOB 1PKTA 2RB6A 1HSQA 4F17A 3TU4K 3A98A 1NEGA 3OS5A 1D1CA 2WSFE 3O8VA 4IIMA 3M0SA 2HQEA 2VGNA 5LJ5e 1M2VA 3QZ9B 3CCQQ 2R58A 4J9EA 3EGDA 2VVKA 3X26B 4QQ6A 2E5QA 3PT9A 4D8KA 1WHMA 1VQPA 3OYNA 1W2BP 4PJNA 4RTYA 2H3EB 2O9SA 1Y57A 2RI2A 2ZPIB 3S3OA 3ZBDA 2KAFA 3JV3A 1VQ6Q 2K5IA 3HRUA 2QGGA 1UFFA 2OTJA 2XU8A 2RJEA 3PFSA 4N0AA 2CP3A 1VQOT 2YUPA 4M78F 5FRNA 4EIKA 2QA4T 2KI7A 2JVVA 3H41A 1JXOA 1G3WA 2ZZDA 2ECZA 1GL5A 1MMGA 1H641 3OS2A 2K3XA 2A0FB 1PD0A 1AWXA 3EFRA 4M77D 2MIOA 1M90C 1I5OB 1ZA2B 3JCMe 3AT1B 4C8QD 2CREA 4M7AC 1RADB 3CCMA 1SEMA 3OSSC 1S1NA 5LJ5g 4XQ3A 4NL3A 2SRCA 2BUDA 1V29B 2YRVA 3CXCP 1GCPA 1CKBA 3HKSA 2AKLA 2XDPA 4M77E 1VQKA 3CMAA 5GAMf 4C8QE 4QQDA 5GAOl 5GAN4 2BZ8A 1M27C 2YXYA 2ZCFB 5GANf 1BIBA 2K5LA 3JB9G 1ZUUA 1PCXA 1YI2A 1WA7A 3JRZA 1YITT 4C0FA 2RN8A 1BCOA 1X2QA 4C5HA 2GBQA 4AG2C 1Y07A 5DM7R 2EGAA 1NE8A 3UDCA 2ZPEB 3M59A 2KXCA 4L5GA 2LTOA 2KR3A 1T3SA 1TUGB 1ZLMA 3RDVA 2LVMA 2KYBA 3L2RA 1VQ8A 3FIFA 4OMFB 2KRNA 3QWYA 4M7DF 4E47A 1NJIU 4ZGEB 2EQJA 4ZGJB 3OA6A 2LJ3A 3M5AA 2HD0A 2BE7D 1XQHA 5CO7A 3VS7A 2YT6A 3TREA 4OB1B 2DERA 1ABOA 5L23A 2GQIA 1M2VB 1M8MA 1VQOQ 2CZ0B 1ZSZC 2QA4Q 2EYZA 4AFQC 1YWOA 2DXUA 3EG9A 4EDUA 2QDLA 3QZ5B 5J39A 4N4HA 1WHLA 1ACMB 1YFNA 2IVWA 5FWBA 4LN2A 5GANd 2FG0A 2YUOA 2DVEA 1NYFA 4PJOA 3C95A 4LDXA 2J06A 1WDXA 1WXBA 1X43A 1Q86C 4BUGA 4C0ZA 1VQMA 4E7LA 3L2UA 1T3LA 1D3BB 2X4WA 3E1SA 4Z89A 1Q81R 4E7IA 2X51A 2QQSA 2OTLT 1MMAA 1FMVA 4KGZB 2EKOA 2KK4A 4PK4A 1JU5C 2HQHA 1M90U 4C92C 2JUFA 4GY5A 1YITQ 1AHJB 3FJPA 3H0FA 5CKEA 4L59A 4OMPA 5LJ5f 2DJZA 3H8ZA 5HK3A 3OYEA 3CC4A 3M0UA 2R5MA 3JSCA 2YLBA 1YHQT 3BFMA 3DB4A 2DEQA 2KMTA 3LGLA 4JRQA 5GAOp 1QLYA 5IH2A 2GQVA 1R0CB 3CC2A 1VQPT 3SDZA 3C12A 2E6NA 3L2QA 3N5BB 4YTLA 2BTTA 1JJ2S 2P4TA 1VQ4T 4BI3A 2HSEB 4BD3A 4OGCA 3M4GA 4Z02A 2OTJT 1K1ZA 1D0XA 3CCJT 4OB2B 3CCRA 2DNUA 2QGFB 5L8RE 2C0OA 3G4ST 1RLPC 4A4KA 3CPWS 1RI0A 3REAB 2F5KA 3JCMf 2X9HA 4R56A 1LCKA 4JLIA 4Z8AA 1KQSA 3UA6A 4C8QA 1B34B 1LJOA 2JW4A 3E9GA 1VYVA 2RA2A 1X2KA 3E2UA 4MMLA 4QVZA 2QYZA 3CCMT 4HVWA 1Z9QA 1I4K1 2CZ7B 3CCLA 1PRLC 3EG0A 2YUNA 2O88A 1W4SA 4FU6A 2K3YA 1C0MA 5LJ5d 3EG9B 1RI9A 5IXBA 4CC3A 5GMKm 1VQKT 1X27A 3EHRA 4HCKA 2OTLQ 1I1JA 3CBPA 4ELZC 3QBYA 2QQRA 3VJPA 4PJOB 3RR6A 4E7JA 1YI2T 2HQXA 1NLPC 2K2VA 2HBWA 3EFOB 4LNPA 8ATCB 1UB4A 2D8JA 4XTXA 5HKCA 1TSFA 2EWNA 4KH1B 1W70A 3RMSA 4A54A 2DIGA 5LJ3h 1YHQQ 1ARKA 1XNIA 2QQAA 3NGPA 2OI3A 3L2WA 2EVRA 3GBQA 1D1AA 4M77F 3THKA 5GMKh 3JCMd 1VQ8T 2YUQA 1N5ZA 1AWOA 4PJJA 4C92D 3G6EA 1IGUA 4ELYC 2CZ6B 2KGTA 4EPCA 1VQPQ 4JJBA 1JJ2P 2F5TX 2MCNA 2V26A 1AEYA 3EG2A 4EMGA 3CCUT 2L89A 1VQ4Q 1V1CA 3OYHA 5FWCA 1NEBA 4XTYA 4BACA 2PZ1A 2OTJQ 3CCJQ 2L5QA 1OYXA 1N6AA 2KYMA 3PVLA 4P5NA 2DL7A 1F1BB 1Y96A 3CPWP 3G4SQ 5FLXE 1RABB 2H8HA 5KYXA 5CQYA 1AD5A 2DTOA 2NLUA 2RO0A 2D6FA 3PVQA 3OYJA 2V1QA 1IHVA 4F7UG 3KXTA 4RG8A 3X25B 1BCMA 2RHIA 2PNIA 2LRQA 4EMKB 3QKJA 2LCCA 2DPPB 5KYNA 3V7CA 3RERA 5M9OA 2QQ9A 2IPOB 3HL8A 4DBRA 2DBKA 2KROA 3OYGA 1VQMT 1C6VX 2MWOA 2QDYB 2ESWA 1VQKQ 1H3HA 2EGEA 5CQXA 3NTIA 4C8QB 1Y7XA 2EBPA 1WHGA 1XJWB 1K8AU 4B6MA 1YJ9T 3V8LA 1GXIE 1YIJA 1WLPB 4M7AG 1YI2Q 1EFNA 1NPRA 1WHHA 2EW3A 3ER0A 3PGGA 2MMPA 2L2PA 2E12A 4RTUA 3MP6A 2LJ1A 1M3CA 1MNDA 5KCHA 2CSIA 1WNLA 4J6XA 2MYSA 4A4FA 1GBQA 2DLPA 2QK0A 2RJFA 4MDWA 3BDUA 4FSXA 4FW1A 5HY6A 2DRMA 1QWEA 1VQ8Q 4M7DE 2FHDA 3CC2T 3I56A 5GAMe 4FYWB 3A8GB 2DYIA 3I5RA 3CCUQ 1M1KC 4X9DA 3MP8A 2K2MA 3J80E 3MEVA 1AVZC 2E6ZA 4LDVA 3CCRT 1M90R 4J8OA 1UHFA 2EQKA 4KT0E 5HK0A 2CP5A 1HYOA 1AZGB 1V76A 3GNFB 4XK8E 2ZPHB 4M75D 3LWHA 2Y4YA 3J81E 3NHNA 2ROTA 1U1TA 1GCQC 4K11A 3Q1JA 1TTHB 2COYA 2JMAA 3M58A 3VU3C 2E4HA 2GF7A 3CCLT 4FM4B 1QCFA 4QKUA 1M5Q1 2EIFA 1Y96B 2B86A 2CP0A 4XU2A 2IG0A 1UTIA 2F2VA 4M75E 4EMKC 2CGHA 2ZAEA 1VQMQ 5A0GA 2JS0A 5KYXB 4N4GA 2BE9B 3QPHA 1D09B 3OQ5A 3KFVA 3GP8A 2VWFA 2DZCA 1UHCA 1YJ9Q 3GIBA 2IIMA 3LH5A 1W2BA 2F1LA 2R57A 2SEMA 4IUVA 2DAQA 2AZVA 1PSFA 4E6RA 4HKEA 3FJ5A 3KBGA 1KQ2A 5C6SA 2RD1A 1E7OA 4JZ3A 1WQWA 2JMCA 5EC7A 2RQUA 2WSCE 4CRIA 5CK9A 4XU3A 1N9RA 1ZQ1A 3BE3A 1PG5B 4VUBA 1KC8C 4Q5WA 3G6ET 3CC2Q 2EQMA 3FC3A 4HCCA 4X9CA 2M0YA 1RL2A 2A37A 5GAN3 4NS5A 3OMGA 2DJQA 4BDYA 3QYGB 2EAYA 3CEYA 3HFNA 5GAOm 3SWNA 3CXCA 3CCRQ 3F70A 3HP9A 3OW2S 1VYTA 2RQVA 4RCBA 1QQJA 1B3QA 2DTHA 5IT9E 3MJXA 2VYTA 5J3BA 1Q86R 2AKKA 2RQRA 3WVDB 4IKFA 1ZSGA 2YDLA 1K4US 3CCLQ 3TSWA 3M0RA 3NFCA 2D8HA 3VS1A 4NOYA 4N4IA 1M1KU 2HNIA 1VQ5T 3PIOA 4X34A 3GNGA 4HXJA 2DETA 5D6YA 1E6HA 4LXCA 3RUXA 4RTTA 3MHXA 4C92F 2RI3A 3L2VA 4Z88A 2WACA 2DA9A 2LX7A 4FYVB 2XK0A 1YBYA 4M7DA 3EG3A 3H0IA 2VXFA 1YIJT 1K73C 3X24B 2GCXA 4FSSA 1I81A 3MKDA 4KUIA 1VQNA 2PUOB 4EMHA 2RK2A 5GMKi 1TH7A 3QYHB 3EGXB 1VIFA 2FL7A 1H3ZA 2RF0A 4DOVA 3G71A 5AYFA 2DL4A 3ME9A 2PTKA 4OMOA 4QT7A 2CS7A 4HCZA 2DRKA 3OS0A 3CD6T 1WYXA 3I56T 1YJNT 4RTZA 4C0DB 1WJSA 4II1A 4KRTA 1QP2A 3ZL7C 3QG1A 2K4YA 3CC7A 2EJFA 3TVTA 3OW2P 4M78B 4NL2A 1KK7A 5I11A 7AT1B 5KYYA 1Q7YC 4RCCA 4QW2A 4JJCA 1SF9A 2NUTA 4M75A 1GFDA 3QHSA 1G3YA 5D6XA 1QVGS 1ZA1B 3M55A 2K57A 3CCVA 1YP5A 2PVDB 4HVVA 2RHUA 5KE2A 1KC8U 2C0TA 2CT4A 5FU7B 3H9NA 4Y92A 3WVEB 5KE3A 5LJ3j 4BDZA 3SEMA 1SHFA 1JXMA 1PC0A 3LW5E 1MMDA 1VA7A 3UT1A 1RAGB 2RM4A 4UC4A 3URGA 4PJMA 3JCMX 5GMKj 2EQIA 2EYXA 1VQ5Q 3A8OB 1M3AA 3EGDB 2ED0A 2LMJA 2DVJA 3E9FA 2L3PA 5GAMd 2K3BA 3S3NA 1G83A 2FPEA 2K5FA 3ULRB 1U5SA 4XTWA 3M57A 1WXUA 1MMNA 3QO3A 3V8KA 2O9VA 3RKXA 3QXEB 1YIJQ 3FEOA 4LUEA 2LJ0A 2KVQG 1NLOC 2XD0A 4OF1A 2P84A 4F7UE 3ZEHA 3MPUB 3OBYA 2KQWA 2VV5A 4M75F 2G3RA 4M4ZA 4J7FA 3JCMP 1M30A 1UECA 4A4HA 1UDLA 5I22A 5A0LA 4OP0A 4M7DB 3CD6Q 4M7AD 1YJNQ 1OQKA 3QJ6A 1UUEA 4OGEA 1U06A 3CCSA 2AZSA 1N8RC 1WXTA 1TU0B 1AZEA 4ESRA 1C1AA 5CKBA 3NTHA 2DXTA 1NM7A 2NUPA 2LCSA 1K73U 2QTXA 1Q95G 4PJOG 3V7SA 3FLGA 4FT4A 1QVGP 3U23A 2D0NA 3TSZA 4M7AE 1X69A 4JZ4A 1OZ3A 4RG2A 2KE9A 3JCMW 4M78C 1S72A 1K0SA 1G3SA 1VQ7A 1SKUB 2L3SA 4LD9K 3LWIA 1KG1A 1UGQB 2VXEA 4J7IA 3A8HB 1GRIA 3C0CA 3P8DA 2CP6A 3CBOA 4J6YA 2FPDA 2O31A 1KQ1A 1LPLA 3A1PA 4JUVA 1CSKA 5GAN7 1WX6A 4BE1A 1VUBA 2RK1A 2DF6A 4RMOA 4JS5A 1IO6A 1Q7YU 1K8AC 1TUCA 4LUDA 2F2WA 4M77A 2JZ2A 3QIIA 4JRPA 2KRMA 2CT3A 2X4JA 1ZBJA 3VRYA 3MEUA 3RMQA 5AT1B 1JJ2A 1RAIB 4XU1A 3GLXA 2H3JA 3VS0A 3EH1A 2OAWA 1VQNT 1VQLA 1U3OA 4AG1C 2J05A 2NYSA 1HK9A 6AT1B 3CCQA 3EG1A 5GAN5 1PSEA 3FB9A 3RKYA 1UE9A 2E3HA 3E19A 3CPWA 3CMAT 4N0AC 2L0AA 1JO8A 1JBMA 5LJ3e 1HD3A 4C5EA 1M1KR 1VIEA 2V8IA 1NZ9A 2RHXA 4E7KA 1BYMA 4C8QG 1P92A 4KUDK 2GFAA 1UGPB 2L3QA 2E41A 4PLLA 5I2MA 3QSUA 2FZGB 3PMTA 1N27A 3CC7T 5IHNA 4HCBA 1OOTA 2VASA 1UGRB 2XG8D 1M9SA 5GANj 2DEUA 1SHGA 5CAIA 3I35A 4BI4A 2M0OA 3GOXA 2HL3A 3CCVT 3OYLA 3MO8A 2DBMA 1YCYA 3EHQA 4IIOA 1QVFS 1IRXA 1G2BA 1YJWA 1YNZA 1N8RU 2RNAA 2CYZB 1M8VA 2JTMA 5A0DA 5LL6S 5LJ3g 1O9SA 1T0JA 2C06A 3UATA 1I5LA 1M1FA 3PNWC 4E2FB 2F2XA 4F04B 4F7UA 5A2QE 4C92E 2HCKA 4O5VA 4J83A 1WZOA 1TXQA 4AT1B 1WFWA 1WPYA 4ZNXA 1UGVA 1BI1A 2LT1A 3C94A 4V2SA 2XHCA 2MF2A 3CCMQ 3EAEA 1VQNQ 1OU8A 4AFZC 5IAYA 4DA4A 3MEAA 1NJIR 2ZPGB 4Y28E 2RPNA 5GAN6 1YCSB 4IUTA 4M77B 3CMAQ 2AHJB 5GMKl 1UGSB 2QG9B 4M7AA 1I07A 3RIRA 3MP1A 2CH4W 2LQKA 3VYGA 5FU6B 4J9GA 3JB9H 4RTXA 3T9NA 5KYUA 1AT1B 1PHTA 1U8RA 1KFZA 2FPFA 3LLRA 2R5AA 2A28A 1TOVA 3CC7Q 2DFUA 2RI5A 3WXMB 2D1XA 2DYBA 2E5KA 4ZGDB 2F69A 1VQOA 2DIQA 4J5YA 1FX7A 4PJOC 2A36A 2J7IA 3CC4T 2DKGA 1A0NB 4ANJA 4PFZA 3FDRA 1OI1A 1S72T 4F7UF 2RJCA 1OEBA 8AT1B 2ZPFB 3CCVQ 1VQ7T 1VQ9A 3M54A 2LP5A 2YHTA 1QVFP 3JB9J 3JB9D 4PJLA 4PFPA 2J6KA 3NMZC 4J9IA 4A4EA 3AHUA 1BI2A 5GJVB 1X75C 2D0QB 2COWA 2DILA 4QQGA 3L1AA 3CQTA 3VKIA 1ABQA 2EQUA 2OX7A 2C0IA 4PFOA 4CC7A 1HXDA 1K73R 2FZKB 3PE0A 4M7AF 2K6DA 2WSEE 4FYXB 2J6FA 5ECAA 3JCMJ 4GBQA 3X28B 3LYIA 1J3TA 4D8DA 1YITA 3VYHB 2K7AA 3TCJA 4AFSC 3EGUA 5FW9A 1EX4A 3VS4A 1ZSZA 1VQLT 5CKHA 4HVUA 5GAMh 4XTZA 3HSBA 5LJ3f 2EKHA 1U1SA 2DL5A 1BU1A 5GANh 2GTJA 5GAOq 2J6OA 3PIPA 3P8BB 4C8QC 2QAZA 2RQTA 1Q7YR 2DO3A 2LCLA 1Y0MA 2EYYA 3H0HA 4MMKA 1IXDA 4MZTA 1OX8A 3RNJA 4J9DA 3MEWA 4Y91A 3CC4Q 3LGFA 1UEBA 1ZHIA 1IGQA 5GANg 1S72Q 2DM1A 1SPKA 2BZXA 2VKNA 1VQ7Q 4C92A 1SRMA 4TVRA 4WCIA 4LE9A 4R55A 2LQWA 4R0KA 2YRCA 1KSWA 2MI6A 5I2SA 1K9AA 4PJOD 4JJDA 5GAN2 1YJWT 2M16A 2KXDA 4KULA 4ZTJA 2JOYA 3QDRB 4F14A 1IB8A 2OAUA 5LJ3d 4A53A 1ZX6A 2LNHB 1DJ7B 4M78G 2Z0WA 4PJOE 4BE0A 5IXFA 1ZUKA 2PQWA 2I2LA 5GAN8 1M2OA 3OYFA 2ABLA 1WGSA 2LNVA 2P0KA 4C5IA 2B8AA 3HRTA 1VQLQ 3DLLA 1YHQA 4ATOA 1ZUYA 3UWNA 2ATCB 2E70A 4OB0B 1XTDA 3OW2A 1R77A 4OMNA 2JTFA 3CCEA 2Y4XA 1PM3A 3PMIA 1N8RR 2K79A 2QQBA 3CPFA 1MGQA 3HHTB 1IREB 2E65A 3R6NA 1KD1C 1LNXA 1VQ4A 2DK3A 1ZSZB 5LJ5h 1K9MC 5CCAA 3CCJA 3M0PA 2M1HA 1SSFA 2QEXA 3JAME 3I55A 4JS4A 3G4SA 3VS2A 4DEXA 2DXCA 3RESA 2VB6A 4JPBW 2LQ8A 1Q82C 2JS2A 1D3BA 2KT8A 2AIRB 2OJ2A 2BIVA 2ENMA 5KYWA 4B9WA 1W6XA 1VQ9T 2FZCB 3X20B 3EH2A 3A8LB 3HRSA 2A7YA 5FROA 4LD6A 3G6EQ 4J9CA 3RKWA 3IQLA 3QWXX 1X6OA 3DB3A 2DMOA 5IN1A 4M7DG 1YJWQ 2LC4A 1PNJA 4BI8B 1KHCA 1CKAA 3SB2A 1K8AR 2COZA 1BBZA 3LH0A 2DL8A 1SRLA 3JCMh 2JN0A 2E64A 2MK5A 5DLQE 1RAEB 1M3BA 3HTRA 3ZFJA 4C92B 1QKWA 2EFIA 1JEGA 1PD1A 1K76A 4AFUC 2X4YA 4A63B 3TEEA 2DE0X 1YN8A 4C0GA 2AT1B 3VUBA 3UA7A 2MOXA 2BKDN 1OV3A 3UPUA 1TWBA 1ZBXA 2HKNA 3SWNB 1XOVA 2FRWA 2YWWA 3JCMg 4IUQA 3OY9A 1EZZB 3HFOA 1QVGA 3JCMc 1PKSA 4GLKA 2JM9A 4M75G 1FXXA 3CMEA 2VUBA 1QCOA 4KGXB 2XMFA 1B34A 3JB9F 1UJ0A 2ED1A 1KHIA 2MAMA 4FYYB 1H8KA 5CVIA 3CCUA 2RHZA 3M4YA 2XDDA 1RLQC 4PLIA 1VYUA 2DX1A 3BY7A 2K9GA 4OMMA 1SSHA 1W1FA 4KGVB 2X35A 4OMLA 3M0TA 4LDUA 4F16A 1E6GA 2YSQA 5HCKA 3OYAA 5IHIA 4B9XA 3G1JA 1VQ9Q 1TG0A 1MUZA 2ROLA 1OX9A 2EJ9A 2DXBA 2GNCA 1EIFA 1AWWA 3I56Q 2O4XA 2JJ9A 2W10A 4A4GA 2PU9B 1PWTA 2V8JA 3EFOA 1KD1U 3M56A 1K9MU 4C0DC 5CKDA 5KYWB 4KH0B 1WIEA 4O6JA
chains in the Genus database with same CATH topology
2V8KA 1Y96B 1YJ9A 1I5LA 1M1FA 3CCMA 1S72A 1FWZA 3OSSC 2IG0A 3PNWC 4XU2A 4F7UA 5A2QE 1Q82U 4M75E 4EMKC 2CGHA 4C92E 5KCOA 5LJ5g 4XQ3A 3GF5A 4NL3A 4O5VA 2BUDA 1V29B 2YRVA 4J83A 5A0GA 3HKSA 1WPYA 4N4GA 4C5GA 3GPLA 5CK9A 3QPHA 4LDWA 2XDPA 4M77E 1VQKA 3CMAA 4QVDA 3OQ5A 3OSVA 5GAMf 3GP8A 1BI1A 2LT1A 3C94A 2DZCA 4C8QE 3INZA 4QQDA 5FRMA 4V2SA 2XHCA 5FU7C 2MF2A 5GAN4 5GAOl 3GIBA 3EAEA 4M75B 1W2BA 2CZ1B 3G7ZA 5CIUA 5IAYA 3CCET 3L2ZA 2KDSA 2R57A 3SWNC 1O75A 2ZCFB 4IUVA 5DY9A 2DAQA 5GANf 1PSFA 4DA4A 2MWPA 3OMCA 3MEAA 1BIBA 2K5LA 3JB9G 1KQSS 2ZPGB 4Y28E 1BI3A 5GAN6 4HKEA 1YI2A 4IUTA 4M77B 3JRZA 3KBGA 1YITT 3A5ZB 4C0FA 1KQ2A 5C6SA 2RD1A 2AHJB 5GMKl 2RH2A 1UGSB 4M7AA 4C5HA 4MZPA 4PJOF 3RIRA 1WQWA 3MP1A 2LQKA 3VYGA 4J6WA 1Y07A 5FU6B 2P0PA 4EMKA 2WSCE 3JB9H 3T9NA 5DM7R 1NE8A 1G3TA 3UDCA 2ZPEB 1Y71A 3M59A 4XU3A 4CRIA 1N9RA 1ZQ1A 4L5GA 4VUBA 2LTOA 1KC8C 1U8RA 2QEXT 4Q5WA 3S3MA 1WJRA 3I55T 3G6ET 3LLRA 2EQMA 2R5AA 3FC3A 1WJQA 3BW1A 2RI5A 2LVMA 3WXMB 4HCCA 4X9CA 3NTKA 3L2RA 2PVOB 3C4SA 4MZMA 1VQ8A 1RL2A 2F69A 4ZGDB 5GAN3 1VQOA 2DIQA 3FIFA 1FX7A 3OMGA 4J5YA 4NS5A 4OMFB 4PJOC 5D6WA 4M7DF 4E47A 4BDYA 3G71T 3QYGB 2DKGA 4ZGEB 2EAYA 2EQJA 4ZGJB 3OA6A 3CC4T 1NJIU 3CEYA 3HFNA 3M5AA 2HD0A 4IURA 1XQHA 5CO7A 5GAOm 4OB3B 3FDRA 3SWNA 3CXCA 1OI1A 3F70A 1S72T 4F7UF 2RJCA 3TREA 4OB1B 3BDLA 3HP9A 3OW2S 2ZPFB 4M77G 1VQ7T 1VQ9A 2DD5A 2EJGA 3M54A 5GAMj 3OS1A 2YHTA 1VQ6A 3JB9J 4RCBA 3JB9D 2CZ0B 4M7DC 5GMKe 2DXUA 2DTHA 4A4EA 2HBPA 5IT9E 3AHUA 3VV0A 4EDUA 2VYTA 4PNOA 5J3BA 1BI2A 3QZ5B 5J39A 3WVDB 4IKFA 4N4HA 1X75C 2D0QB 3CBMA 4BB7A 4QQGA 2E1HA 2IVWA 3L1AA 3VKIA 5GANd 2EQUA 3NFCA 2DVEA 4NOYA 4PJOA 2O4XB 4N4IA 3C95A 2HNIA 1M1KU 4LDXA 2YLCA 1HXDA 2GFUA 1VQ5T 4IUUA 3PIOA 2LX9A 4X34A 3GNGA 4M7AF 2WSEE 5GAOn 1Q86C 5D6YA 4BUGA 3JCMJ 3X28B 4C0ZA 3LYIA 1VQMA 3RUXA 4E7LA 4LDYA 3L2UA 3MHXA 4C92F 3VYHB 1YITA 2RI3A 3L2VA 1D3BB 2WACA 2X4WA 3E1SA 3TCJA 4E7IA 5CKFA 1Q86U 2QQSA 2OTLT 2RJDA 2XK0A 1YBYA 4M7DA 4QVCA 1VQLT 5CKHA 2VXFA 4M78D 1YIJT 1K73C 1I8FA 3META 3X24B 2GCXA 5GAMh 2VGMA 4XTZA 1I81A 3M53A 4KUIA 2EKOA 2KK4A 4C8QF 1VQNA 3M9QA 3OYIA 3HSBA 2PUOB 4MDXA 2RHYA 4JDSA 2RK2A 4EMHA 4M75C 3CMET 4C92C 1M90U 1G5VA 4XTVA 5LJ3f 5GMKi 1TH7A 1U1SA 2JUFA 2O01E 4GY5A 1AHJB 4L6V5 3QYHB 1VIFA 2FL7A 3SD4A 3FJPA 5GANh 2DD4A 5CKEA 4L59A 1Q81C 1QVFA 1H3ZA 4KBMB 5LJ5f 2DJZA 3H8ZA 4DOVA 5HK3A 3JCMb 3OYEA 3G71A 3CC4A 5AYFA 2R5MA 3JSCA 2YLBA 5GAOq 1JB0E 1YHQT 3BFMA 3DB4A 1MHNA 3ME9A 2DEQA 2KMTA 3LGLA 4M78E 2CS7A 3P8BB 4FIBA 4HCZA 3PIPA 4C8QC 3OS0A 4JRQA 3CD6T 3QUIA 3I56T 1YJNT 2DO3A 2LCLA 4C0DB 5GAOp 1WJSA 4II1A 4JJNK 1QP2A 4MMKA 5LJ3e 2GQVA 2XICA 3QG1A 1M4ZA 4MZTA 4WF2A 3CC2A 2K4YA 1VQPT 3SDZA 3CC7A 3C12A 2E6NA 3MEWA 4Y91A 3N5BB 4YTLA 3L2QA 2EJFA 1BKBA 3LGFA 1UEBA 3PTAA 2ZPBB 1JJ2S 1ZHIA 4M78B 2CKKA 4NL2A 5GANg 2P4TA 1VQ4T 4BI3A 4BD3A 4OGCA 3M4GA 4BY6B 4Z02A 1Q7YC 4RCCA 4QW2A 2OTJT 3CCJT 1QVPA 4M75A 3QHSA 1G3YA 4OB2B 5D6XA 4TVRA 4C92A 3CCRA 1QVGS 2XKOC 4PKCC 3CCST 3OYMA 5L8RE 3M55A 4R55A 2K57A 3SFMA 3CCVA 3G4ST 2PVDB 2FB7A 2MI6A 5I2SA 1VQ5A 4A4KA 4PJOD 3MCAB 1RI0A 2RHUA 2F5KA 5GAN2 3CPWS 1YJWT 3JCMf 4CI0C 5KE2A 4R56A 2M16A 1KC8U 4JLIA 2QA4A 5FU7B 1KQSA 4C8QA 1B34B 2KY9A 3WVEB 5KE3A 5LJ3j 4BDZA 1LJOA 4KULA 4ZTJA 3V8JA 3E9GA 2JOYA 3LW5E 2RA2A 3QDRB 3HPWA 3OB9A 3UT1A 2M9UA 2RM4A 4MMLA 4QVZA 1BIAA 2FVUA 1QP3A 2XI9A 4UC4A 2P0QA 5LJ5j 2OAUA 3URGA 3JCMQ 3CCMT 5GAOr 1I4K1 2CZ7B 4RKUE 5LJ3d 4A53A 3CCLA 4OVAA 3JCMX 5GMKj 3J7AF 3DLMA 1DJ7B 4M78G 4M7DD 3A8OB 1W4SA 5C0MA 4FU6A 4PJOE 2K3YA 4XTUA 5LJ5d 4BE0A 2PQWA 2I2LA 2QXFA 3E9FA 5GAMd 5GMKm 1VQKT 5GAN8 2JNGA 3OYFA 3S3NA 2K5FA 3H6ZA 3KUFA 1IZ6A 4XTWA 3M57A 1WGSA 2LNVA 2P0KA 3QO3A 2B8AA 3V8KA 4C5IA 4ZN1A 5CR2A 3HRTA 3CBPA 3RKXA 3DLLA 4ELZC 1YHQA 4ATOA 3QXEB 3UWNA 3FEOA 2E70A 3QBYA 5DLOA 2KVQG 2QQRA 4OB0B 1XTDA 3VJPA 4DOWA 3OW2A 3CD6A 4PJOB 4JLGA 1YJNA 4E7JA 2JTFA 2XD0A 4ZN3A 4OF1A 1YI2T 3CCEA 2HQXA 2Y4XA 2K2VA 2Y90A 1UB4A 3PMIA 4XTXA 5EG2A 4F7UE 5HKCA 2L3RA 3L42A 3ZEHA 3V7RA 2QQBA 3CPFA 3OBYA 2KQWA 2VV5A 2EWNA 4DQ2A 1MGQA 2G3RA 4M75F 3RMSA 3QJYA 2DIGA 3HHTB 5LJ3h 4J7FA 4A54A 5GANe 3JCMP 4HT8A 1IREB 1XNIA 2E65A 4A4HA 2QQAA 4XU0A 4FT2A 5A0LA 1KD1C 3P8HA 1X01A 4OP0A 1LNXA 3L2WA 1VQ4A 4M7DB 2DK3A 5LJ5h 1K9MC 4M7AD 5CCAA 3CCJA 3QJ6A 2M1HA 4M77F 5GMKh 4OGEA 1SSFA 2VC8A 3JCMd 1VQ8T 2QEXA 4F7UB 3CCQT 3JAME 3CCSA 1N8RC 4C92D 3I55A 4ELYC 4D6WA 1WQ7A 3G6EA 4JS4A 3G4SA 3A8MB 4IUPA 2CZ6B 4EPCA 5CKBA 3NTHA 2DXTA 1LOJA 2DXCA 1R8OB 2F5TX 3RESA 2QTXA 1K73U 3VUZA 2DZ9A 4EMGA 1QW1A 4PJOG 2LQ8A 3V7SA 1Q82C 3CCUT 1D3BA 1JRIA 2L89A 2A3LA 3FLGA 2BIVA 4FT4A 3OYHA 4B9WA 4XTYA 4BACA 1VQ9T 4M77C 1W2BS 2L5QA 1OYXA 4M7AE 3DKMA 3X20B 1N6AA 1OZ3A 2LT4A 3ASKA 4JRKA 2PVGB 3A8LB 3HRSA 4M78C 2DTIA 4P5NA 4RG2A 3JCMW 1OZ2A 1Y96A 2A7YA 4LD6A 5FROA 1Q81U 3R6OA 1G3SA 1VQ7A 4BY6C 3OYBA 3OYDA 5FLXE 4ME7A 5FU6C 2ZGWA 3RKWA 4LD9K 1X6OA 3DB3A 5GAMg 5IN1A 2HAXA 2EYQA 3LWIA 1KG1A 4M7DG 5CQYA 1UGQB 2DTOA 2VXEA 2LC4A 2NLUA 2RO0A 4J7IA 2XDBA 4BI8B 2D6FA 2C06A 1KHCA 3A8HB 3LX7A 1BI0A 2PUKB 3OYJA 3SB2A 3OYYA 3P8DA 4E7HA 3CBOA 3S6WA 5J26A 3LH0A 4J6YA 4F7UG 3OYKA 4M7AB 3KXTA 4RG8A 3JCMh 2JN0A 3X25B 2E64A 2RHIA 5DLQE 2QI2A 2LRQA 2E10A 4EMKB 3QKJA 2LCCA 3ZFJA 1KQ1A 2D9TA 4C92B 2DPPB 4JUVA 4HA8A 3V7CA 3RERA 3OYCA 5M9OA 2EFIA 2X4XA 2QQ9A 5GAN7 4BE1A 1VUBA 2RK1A 4RMOA 1N9SA 4ZTFA 2XIDA 3HL8A 2KSSA 4JS5A 2X4YA 1NPPA 3OYGA 1VQMT 1Q7YU 5I21A 2MWOA 2QDYB 3TEEA 1K8AC 4FL6A 3FRNA 4M77A 2JZ2A 4C0GA 5CQXA 3NTIA 3JCMV 3QIIA 3VUBA 4C8QB 4JRPA 3CXCS 1Y7XA 4M78A 2BKDN 2X4JA 3MEUA 3UPUA 1K8AU 1ZBXA 3RMQA 3SWNB 1JJ2A 1XOVA 4XU1A 2L8DA 2H3JA 3GLXA 3OBWA 3JCMg 4IUQA 1YJ9T 4PL6A 2OTLA 1VQ6T 1VQNT 1VQLA 3V8LA 4BE2A 1NJIC 1GXIE 3OY9A 1YIJA 3EFSA 3HFOA 4JRIA 4M7AG 4HT9A 1NPRA 3PGGA 1M1GA 1HK9A 3ER0A 2MMPA 3JCMc 1QVGA 3CCQA 4XAXB 4GLKA 5GAN5 2E12A 4M75G 3MP6A 4C92G 5KH6A 1FXXA 1PSEA 3FB9A 2VUBA 3RKYA 5KCHA 3CMEA 3JB9I 1B34A 3E19A 3JB9F 1WNLA 4J6XA 3CPWA 2FYKA 3CMAT 4N0AC 1KHIA 2LDMA 4A4FA 2MAMA 2RB6A 5CVIA 3CCUA 1JBMA 3TU4K 2RHZA 2RJFA 3M4YA 3BDUA 3OS5A 4MDWA 4FSXA 1VIEA 2WSFE 2V8IA 4PLIA 3O8VA 4C5EA 2XDDA 1NZ9A 2RHXA 3BY7A 4E7KA 1BYMA 5HY6A 2HQEA 4C8QG 1P92A 2VGNA 5LJ5e 4KUDK 2GFAA 3QZ9B 1UGPB 2FHDA 2X35A 2E41A 2R58A 4M7DE 4PLLA 5I2MA 3CC2T 3QSUA 4LDUA 3PMTA 1N27A 5GAMe 3I56A 3CC7T 4HCBA 3X26B 1UGRB 4QQ6A 2XG8D 2E5QA 1M9SA 3A8GB 3OYAA 5GANj 3PT9A 1VQPA 4B9XA 5CAIA 3OYNA 1M1KC 4X9DA 3MP8A 3J80E 3MEVA 2E6ZA 4LDVA 4BI4A 2RI2A 2ZPIB 3S3OA 2M0OA 3ZBDA 2KAFA 3CCRT 2K5IA 2EJ9A 3HRUA 3GOXA 2DXBA 1EIFA 3CCVT 4J8OA 2EQKA 3OYLA 2OTJA 2XU8A 4KT0E 5HK0A 2O4XA 3MO8A 4A4GA 2PU9B 2RJEA 3PFSA 1YCYA 2V8JA 3GNFB 4N0AA 4XK8E 2ZPHB 4M75D 3LWHA 1VQOT 2Y4YA 1KD1U 4M78F 3J81E 5FRNA 2QA4T 1QVFS 3M56A 2JVVA 1K9MU 1U1TA 4C0DC 1G3WA 2ZZDA 3Q1JA 5CKDA 1YJWA 1H641 3OS2A 2K3XA 1N8RU 3EFRA 2CYZB 1M8VA 3M58A 4M77D 3VU3C 4O6JA 1M90C 2JTMA 5A0DA 2GF7A 3CCLT 3JCMe 5LL6S 5LJ3g 4C8QD 4FM4B 1O9SA 1M5Q1 4M7AC 2EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLO A;  3G7Z A;  1M1F A;  5HK0 A;  1VUB A;  4ME7 A;  4OF1 A;  4ELY C;  4MDX A;  4MZM A;  4MZT A;  1UB4 A;  5CQY A;  5CKB A;  4HKE A;  5HKC A;  2VUB A;  3JRZ A;  5CQX A;  5CKE A;  5CKD A;  3VUB A;  1X75 C;  5HK3 A;  4MZP A;  5CO7 A;  3TCJ A;  3JSC A;  5CKF A;  3HPW A;  5CR2 A;  2KMT A;  4ELZ C;  2MF2 A;  1NE8 A;  3NFC A;  5CK9 A;  5CKH A;  4VUB A;  5CCA A;  2C06 A; 
#chains in the Genus database with same CATH topology
 2V8K A;  1YJ9 A;  1TUD A;  1Q82 U;  1FWZ A;  5KCO A;  3GF5 A;  2EYW A;  1QWF A;  2KEA A;  1TS9 A;  2LQN A;  4J9F A;  4C5G A;  3GPL A;  4LDW A;  4QVD A;  3OSV A;  1H92 A;  3INZ A;  5KYY B;  5FRM A;  5FU7 C;  1LVK A;  2NUT B;  4M75 B;  2CUD A;  3O5Z A;  2CZ1 B;  3G7Z A;  5CIU A;  3CCE T;  1GCQ A;  3L2Z A;  2KDS A;  3SWN C;  1O75 A;  5DY9 A;  2CUB A;  2MWP A;  3OMC A;  2NUZ A;  1KQS S;  1UJY A;  1BI3 A;  3A5Z B;  2HL5 C;  1T0H A;  4J9H A;  2RH2 A;  4MZP A;  4FW2 A;  4PJO F;  4J6W A;  4RTW A;  4EMK A;  2P0P A;  1YWP A;  2GTO A;  1G3T A;  1Y71 A;  1MV0 B;  2QEX T;  3S3M A;  1RUW A;  1WJR A;  3I55 T;  1VOM A;  2KNB B;  1WJQ A;  3BW1 A;  3VS3 A;  3NTK A;  2PVO B;  3C4S A;  4MZM A;  5D6W A;  4E7Z A;  3G71 T;  1B07 A;  3M0Q A;  4IUR A;  4OB3 B;  3UF4 A;  2FEI A;  4RTV A;  3BDL A;  4J9B A;  2CH4 A;  4M77 G;  2DD5 A;  2EJG A;  5GAM j;  3OS1 A;  2QAS A;  1VQ6 A;  2HZY A;  3D7S B;  4M7D C;  3VS5 A;  5GMK e;  2HBP A;  3VV0 A;  4PNO A;  1FMW A;  3CBM A;  2CP7 A;  4BB7 A;  1K0X A;  2E1H A;  1SG5 A;  2YRD A;  3I5S A;  2O4X B;  2FRY A;  2YLC A;  2GFU A;  4IUU A;  2LX9 A;  1QKX A;  2JXB A;  4CC4 B;  5GAO n;  2RQW A;  1GBR A;  2NUP B;  4LDY A;  1AOJ A;  3REB B;  5CKF A;  1RAC B;  1X6G A;  1Q86 U;  2RJD A;  4QVC A;  1I0C A;  4E7S A;  4M78 D;  1I8F A;  3MET A;  3CCE Q;  2VGM A;  1KQS P;  2KT1 A;  2AK5 A;  3M53 A;  4DBQ A;  4C8Q F;  3M9Q A;  3OYI A;  4MDX A;  2RHY A;  4JDS A;  4M75 C;  3CME T;  1G5V A;  2P4R A;  4XTV A;  1KJW A;  2O01 E;  2CP2 A;  4L6V 5;  2HKQ B;  3SD4 A;  1QCN A;  2DD4 A;  1Q81 C;  1QVF A;  4KBM B;  2O2O A;  3JCM b;  3VRZ A;  1WI7 A;  1JB0 E;  1RAA B;  2EGC A;  1MHN A;  4M78 E;  4FIB A;  2HSP A;  2QEX Q;  3I55 Q;  3QUI A;  2EPD A;  2M02 A;  4JJN K;  1KC8 R;  1AWJ A;  2XIC A;  1M4Z A;  4WF2 A;  5GJW B;  1BB9 A;  3G71 Q;  1BKB A;  3PTA A;  2W0Z A;  2ZPB B;  2CKK A;  2FO0 A;  4BY6 B;  2HDA A;  2X3X D;  1QVP A;  4DEY A;  3SHW A;  2LZ6 B;  2XKO C;  4PKC C;  3CCS T;  3OYM A;  3SFM A;  2KBT A;  2FB7 A;  1G8X A;  1VQ5 A;  3MCA B;  4ORZ A;  4CI0 C;  2QA4 A;  1BK2 A;  2KY9 A;  3V8J A;  1HJD A;  3HPW A;  3OB9 A;  1X6B A;  2M9U A;  1BIA A;  1MV3 A;  2FVU A;  1QP3 A;  2XI9 A;  2CDT A;  2P0Q A;  5LJ5 j;  3JCM Q;  1KIK A;  2DL3 A;  5GAO r;  4RKU E;  2BZY A;  2RMO A;  4OVA A;  3J7A F;  1WHK A;  3DLM A;  4OMQ A;  4M7D D;  5C0M A;  2JM8 A;  2GGR A;  4XTU A;  1OUL A;  2V1R A;  2X3W D;  2QXF A;  2JNG A;  3VS6 A;  2A08 A;  3H6Z A;  3KUF A;  1IZ6 A;  2NWM A;  3TQ7 P;  4RUG A;  3RBB B;  4ZN1 A;  5CR2 A;  5D7U A;  2I0N A;  1KD1 R;  5DLO A;  3CD6 A;  4DOW A;  4JLG A;  1K9M R;  2HEQ A;  4DBF A;  1YJN A;  4ZN3 A;  3CME Q;  2Y90 A;  5EG2 A;  1QMC A;  2KRS A;  1D1B A;  2L3R A;  3L42 A;  2JT4 A;  3V7R A;  4DQ2 A;  3QJY A;  5GAN e;  1NG2 A;  4HT8 A;  4XU0 A;  4FT2 A;  1Q82 R;  3P8H A;  1X01 A;  1R0B G;  1D0Z A;  2VC8 A;  3I9Q A;  4F7U B;  3CCQ T;  4D6W A;  1WQ7 A;  2E3I A;  3A8M B;  4IUP A;  1LOJ A;  1R8O B;  3VUZ A;  2DZ9 A;  1QW1 A;  2QTV A;  1FYN A;  3NPF A;  1JRI A;  1Z9Z A;  4X1V A;  1WHJ A;  2A3L A;  2CSQ A;  4M77 C;  1W2B S;  3DKM A;  4JRK A;  2LT4 A;  1VQ6 T;  3ASK A;  2PVG B;  4HT9 A;  2DTI A;  1RAF B;  3CCS Q;  1OZ2 A;  1Q81 U;  3R6O A;  2HMA A;  4BY6 C;  1NBE B;  3OYB A;  3OYD A;  4ME7 A;  5FU6 C;  2ZGW A;  9ATC B;  5GAM g;  2HAX A;  2EYQ A;  2M51 A;  3EGX A;  2XDB A;  3LX7 A;  1BI0 A;  2PUK B;  3OYY A;  4E7H A;  3S6W A;  2G6F X;  5J26 A;  1GFC A;  3OYK A;  4M7A B;  1B7T A;  2QI2 A;  2E10 A;  4CC2 A;  2D9T A;  1D0Y A;  5KYU B;  4HA8 A;  3OYC A;  2X4X A;  1N9S A;  4ZTF A;  1JQQ A;  2XID A;  2MPX C;  2KSS A;  4FCY A;  1NPP A;  5I21 A;  4AMC A;  1OU9 A;  4FL6 A;  1IHW A;  1OPL A;  3FRN A;  1MNE A;  3JCM V;  3CXC S;  4M78 A;  1FMK A;  2L8D A;  3OBW A;  4PL6 A;  2OTL A;  1UG1 A;  4BE2 A;  1NJI C;  3EFS A;  4JRI A;  1NYG A;  1M1G A;  3QDF A;  2JTE A;  4XAX B;  4DBH A;  4C92 G;  5KH6 A;  3JB9 I;  1PRM C;  1RAH B;  2FYK A;  5IHK A;  4GLM A;  2LDM A;  1OPK A;  4WTO B;  1PKT A;  2RB6 A;  1HSQ A;  4F17 A;  3TU4 K;  3A98 A;  1NEG A;  3OS5 A;  1D1C A;  2WSF E;  3O8V A;  4IIM A;  3M0S A;  2HQE A;  2VGN A;  5LJ5 e;  1M2V A;  3QZ9 B;  3CCQ Q;  2R58 A;  4J9E A;  3EGD A;  2VVK A;  3X26 B;  4QQ6 A;  2E5Q A;  3PT9 A;  4D8K A;  1WHM A;  1VQP A;  3OYN A;  1W2B P;  4PJN A;  4RTY A;  2H3E B;  2O9S A;  1Y57 A;  2RI2 A;  2ZPI B;  3S3O A;  3ZBD A;  2KAF A;  3JV3 A;  1VQ6 Q;  2K5I A;  3HRU A;  2QGG A;  1UFF A;  2OTJ A;  2XU8 A;  2RJE A;  3PFS A;  4N0A A;  2CP3 A;  1VQO T;  2YUP A;  4M78 F;  5FRN A;  4EIK A;  2QA4 T;  2KI7 A;  2JVV A;  3H41 A;  1JXO A;  1G3W A;  2ZZD A;  2ECZ A;  1GL5 A;  1MMG A;  1H64 1;  3OS2 A;  2K3X A;  2A0F B;  1PD0 A;  1AWX A;  3EFR A;  4M77 D;  2MIO A;  1M90 C;  1I5O B;  1ZA2 B;  3JCM e;  3AT1 B;  4C8Q D;  2CRE A;  4M7A C;  1RAD B;  3CCM A;  1SEM A;  3OSS C;  1S1N A;  5LJ5 g;  4XQ3 A;  4NL3 A;  2SRC A;  2BUD A;  1V29 B;  2YRV A;  3CXC P;  1GCP A;  1CKB A;  3HKS A;  2AKL A;  2XDP A;  4M77 E;  1VQK A;  3CMA A;  5GAM f;  4C8Q E;  4QQD A;  5GAO l;  5GAN 4;  2BZ8 A;  1M27 C;  2YXY A;  2ZCF B;  5GAN f;  1BIB A;  2K5L A;  3JB9 G;  1ZUU A;  1PCX A;  1YI2 A;  1WA7 A;  3JRZ A;  1YIT T;  4C0F A;  2RN8 A;  1BCO A;  1X2Q A;  4C5H A;  2GBQ A;  4AG2 C;  1Y07 A;  5DM7 R;  2EGA A;  1NE8 A;  3UDC A;  2ZPE B;  3M59 A;  2KXC A;  4L5G A;  2LTO A;  2KR3 A;  1T3S A;  1TUG B;  1ZLM A;  3RDV A;  2LVM A;  2KYB A;  3L2R A;  1VQ8 A;  3FIF A;  4OMF B;  2KRN A;  3QWY A;  4M7D F;  4E47 A;  1NJI U;  4ZGE B;  2EQJ A;  4ZGJ B;  3OA6 A;  2LJ3 A;  3M5A A;  2HD0 A;  2BE7 D;  1XQH A;  5CO7 A;  3VS7 A;  2YT6 A;  3TRE A;  4OB1 B;  2DER A;  1ABO A;  5L23 A;  2GQI A;  1M2V B;  1M8M A;  1VQO Q;  2CZ0 B;  1ZSZ C;  2QA4 Q;  2EYZ A;  4AFQ C;  1YWO A;  2DXU A;  3EG9 A;  4EDU A;  2QDL A;  3QZ5 B;  5J39 A;  4N4H A;  1WHL A;  1ACM B;  1YFN A;  2IVW A;  5FWB A;  4LN2 A;  5GAN d;  2FG0 A;  2YUO A;  2DVE A;  1NYF A;  4PJO A;  3C95 A;  4LDX A;  2J06 A;  1WDX A;  1WXB A;  1X43 A;  1Q86 C;  4BUG A;  4C0Z A;  1VQM A;  4E7L A;  3L2U A;  1T3L A;  1D3B B;  2X4W A;  3E1S A;  4Z89 A;  1Q81 R;  4E7I A;  2X51 A;  2QQS A;  2OTL T;  1MMA A;  1FMV A;  4KGZ B;  2EKO A;  2KK4 A;  4PK4 A;  1JU5 C;  2HQH A;  1M90 U;  4C92 C;  2JUF A;  4GY5 A;  1YIT Q;  1AHJ B;  3FJP A;  3H0F A;  5CKE A;  4L59 A;  4OMP A;  5LJ5 f;  2DJZ A;  3H8Z A;  5HK3 A;  3OYE A;  3CC4 A;  3M0U A;  2R5M A;  3JSC A;  2YLB A;  1YHQ T;  3BFM A;  3DB4 A;  2DEQ A;  2KMT A;  3LGL A;  4JRQ A;  5GAO p;  1QLY A;  5IH2 A;  2GQV A;  1R0C B;  3CC2 A;  1VQP T;  3SDZ A;  3C12 A;  2E6N A;  3L2Q A;  3N5B B;  4YTL A;  2BTT A;  1JJ2 S;  2P4T A;  1VQ4 T;  4BI3 A;  2HSE B;  4BD3 A;  4OGC A;  3M4G A;  4Z02 A;  2OTJ T;  1K1Z A;  1D0X A;  3CCJ T;  4OB2 B;  3CCR A;  2DNU A;  2QGF B;  5L8R E;  2C0O A;  3G4S T;  1RLP C;  4A4K A;  3CPW S;  1RI0 A;  3REA B;  2F5K A;  3JCM f;  2X9H A;  4R56 A;  1LCK A;  4JLI A;  4Z8A A;  1KQS A;  3UA6 A;  4C8Q A;  1B34 B;  1LJO A;  2JW4 A;  3E9G A;  1VYV A;  2RA2 A;  1X2K A;  3E2U A;  4MML A;  4QVZ A;  2QYZ A;  3CCM T;  4HVW A;  1Z9Q A;  1I4K 1;  2CZ7 B;  3CCL A;  1PRL C;  3EG0 A;  2YUN A;  2O88 A;  1W4S A;  4FU6 A;  2K3Y A;  1C0M A;  5LJ5 d;  3EG9 B;  1RI9 A;  5IXB A;  4CC3 A;  5GMK m;  1VQK T;  1X27 A;  3EHR A;  4HCK A;  2OTL Q;  1I1J A;  3CBP A;  4ELZ C;  3QBY A;  2QQR A;  3VJP A;  4PJO B;  3RR6 A;  4E7J A;  1YI2 T;  2HQX A;  1NLP C;  2K2V A;  2HBW A;  3EFO B;  4LNP A;  8ATC B;  1UB4 A;  2D8J A;  4XTX A;  5HKC A;  1TSF A;  2EWN A;  4KH1 B;  1W70 A;  3RMS A;  4A54 A;  2DIG A;  5LJ3 h;  1YHQ Q;  1ARK A;  1XNI A;  2QQA A;  3NGP A;  2OI3 A;  3L2W A;  2EVR A;  3GBQ A;  1D1A A;  4M77 F;  3THK A;  5GMK h;  3JCM d;  1VQ8 T;  2YUQ A;  1N5Z A;  1AWO A;  4PJJ A;  4C92 D;  3G6E A;  1IGU A;  4ELY C;  2CZ6 B;  2KGT A;  4EPC A;  1VQP Q;  4JJB A;  1JJ2 P;  2F5T X;  2MCN A;  2V26 A;  1AEY A;  3EG2 A;  4EMG A;  3CCU T;  2L89 A;  1VQ4 Q;  1V1C A;  3OYH A;  5FWC A;  1NEB A;  4XTY A;  4BAC A;  2PZ1 A;  2OTJ Q;  3CCJ Q;  2L5Q A;  1OYX A;  1N6A A;  2KYM A;  3PVL A;  4P5N A;  2DL7 A;  1F1B B;  1Y96 A;  3CPW P;  3G4S Q;  5FLX E;  1RAB B;  2H8H A;  5KYX A;  5CQY A;  1AD5 A;  2DTO A;  2NLU A;  2RO0 A;  2D6F A;  3PVQ A;  3OYJ A;  2V1Q A;  1IHV A;  4F7U G;  3KXT A;  4RG8 A;  3X25 B;  1BCM A;  2RHI A;  2PNI A;  2LRQ A;  4EMK B;  3QKJ A;  2LCC A;  2DPP B;  5KYN A;  3V7C A;  3RER A;  5M9O A;  2QQ9 A;  2IPO B;  3HL8 A;  4DBR A;  2DBK A;  2KRO A;  3OYG A;  1VQM T;  1C6V X;  2MWO A;  2QDY B;  2ESW A;  1VQK Q;  1H3H A;  2EGE A;  5CQX A;  3NTI A;  4C8Q B;  1Y7X A;  2EBP A;  1WHG A;  1XJW B;  1K8A U;  4B6M A;  1YJ9 T;  3V8L A;  1GXI E;  1YIJ A;  1WLP B;  4M7A G;  1YI2 Q;  1EFN A;  1NPR A;  1WHH A;  2EW3 A;  3ER0 A;  3PGG A;  2MMP A;  2L2P A;  2E12 A;  4RTU A;  3MP6 A;  2LJ1 A;  1M3C A;  1MND A;  5KCH A;  2CSI A;  1WNL A;  4J6X A;  2MYS A;  4A4F A;  1GBQ A;  2DLP A;  2QK0 A;  2RJF A;  4MDW A;  3BDU A;  4FSX A;  4FW1 A;  5HY6 A;  2DRM A;  1QWE A;  1VQ8 Q;  4M7D E;  2FHD A;  3CC2 T;  3I56 A;  5GAM e;  4FYW B;  3A8G B;  2DYI A;  3I5R A;  3CCU Q;  1M1K C;  4X9D A;  3MP8 A;  2K2M A;  3J80 E;  3MEV A;  1AVZ C;  2E6Z A;  4LDV A;  3CCR T;  1M90 R;  4J8O A;  1UHF A;  2EQK A;  4KT0 E;  5HK0 A;  2CP5 A;  1HYO A;  1AZG B;  1V76 A;  3GNF B;  4XK8 E;  2ZPH B;  4M75 D;  3LWH A;  2Y4Y A;  3J81 E;  3NHN A;  2ROT A;  1U1T A;  1GCQ C;  4K11 A;  3Q1J A;  1TTH B;  2COY A;  2JMA A;  3M58 A;  3VU3 C;  2E4H A;  2GF7 A;  3CCL T;  4FM4 B;  1QCF A;  4QKU A;  1M5Q 1;  2EIF A;  1Y96 B;  2B86 A;  2CP0 A;  4XU2 A;  2IG0 A;  1UTI A;  2F2V A;  4M75 E;  4EMK C;  2CGH A;  2ZAE A;  1VQM Q;  5A0G A;  2JS0 A;  5KYX B;  4N4G A;  2BE9 B;  3QPH A;  1D09 B;  3OQ5 A;  3KFV A;  3GP8 A;  2VWF A;  2DZC A;  1UHC A;  1YJ9 Q;  3GIB A;  2IIM A;  3LH5 A;  1W2B A;  2F1L A;  2R57 A;  2SEM A;  4IUV A;  2DAQ A;  2AZV A;  1PSF A;  4E6R A;  4HKE A;  3FJ5 A;  3KBG A;  1KQ2 A;  5C6S A;  2RD1 A;  1E7O A;  4JZ3 A;  1WQW A;  2JMC A;  5EC7 A;  2RQU A;  2WSC E;  4CRI A;  5CK9 A;  4XU3 A;  1N9R A;  1ZQ1 A;  3BE3 A;  1PG5 B;  4VUB A;  1KC8 C;  4Q5W A;  3G6E T;  3CC2 Q;  2EQM A;  3FC3 A;  4HCC A;  4X9C A;  2M0Y A;  1RL2 A;  2A37 A;  5GAN 3;  4NS5 A;  3OMG A;  2DJQ A;  4BDY A;  3QYG B;  2EAY A;  3CEY A;  3HFN A;  5GAO m;  3SWN A;  3CXC A;  3CCR Q;  3F70 A;  3HP9 A;  3OW2 S;  1VYT A;  2RQV A;  4RCB A;  1QQJ A;  1B3Q A;  2DTH A;  5IT9 E;  3MJX A;  2VYT A;  5J3B A;  1Q86 R;  2AKK A;  2RQR A;  3WVD B;  4IKF A;  1ZSG A;  2YDL A;  1K4U S;  3CCL Q;  3TSW A;  3M0R A;  3NFC A;  2D8H A;  3VS1 A;  4NOY A;  4N4I A;  1M1K U;  2HNI A;  1VQ5 T;  3PIO A;  4X34 A;  3GNG A;  4HXJ A;  2DET A;  5D6Y A;  1E6H A;  4LXC A;  3RUX A;  4RTT A;  3MHX A;  4C92 F;  2RI3 A;  3L2V A;  4Z88 A;  2WAC A;  2DA9 A;  2LX7 A;  4FYV B;  2XK0 A;  1YBY A;  4M7D A;  3EG3 A;  3H0I A;  2VXF A;  1YIJ T;  1K73 C;  3X24 B;  2GCX A;  4FSS A;  1I81 A;  3MKD A;  4KUI A;  1VQN A;  2PUO B;  4EMH A;  2RK2 A;  5GMK i;  1TH7 A;  3QYH B;  3EGX B;  1VIF A;  2FL7 A;  1H3Z A;  2RF0 A;  4DOV A;  3G71 A;  5AYF A;  2DL4 A;  3ME9 A;  2PTK A;  4OMO A;  4QT7 A;  2CS7 A;  4HCZ A;  2DRK A;  3OS0 A;  3CD6 T;  1WYX A;  3I56 T;  1YJN T;  4RTZ A;  4C0D B;  1WJS A;  4II1 A;  4KRT A;  1QP2 A;  3ZL7 C;  3QG1 A;  2K4Y A;  3CC7 A;  2EJF A;  3TVT A;  3OW2 P;  4M78 B;  4NL2 A;  1KK7 A;  5I11 A;  7AT1 B;  5KYY A;  1Q7Y C;  4RCC A;  4QW2 A;  4JJC A;  1SF9 A;  2NUT A;  4M75 A;  1GFD A;  3QHS A;  1G3Y A;  5D6X A;  1QVG S;  1ZA1 B;  3M55 A;  2K57 A;  3CCV A;  1YP5 A;  2PVD B;  4HVV A;  2RHU A;  5KE2 A;  1KC8 U;  2C0T A;  2CT4 A;  5FU7 B;  3H9N A;  4Y92 A;  3WVE B;  5KE3 A;  5LJ3 j;  4BDZ A;  3SEM A;  1SHF A;  1JXM A;  1PC0 A;  3LW5 E;  1MMD A;  1VA7 A;  3UT1 A;  1RAG B;  2RM4 A;  4UC4 A;  3URG A;  4PJM A;  3JCM X;  5GMK j;  2EQI A;  2EYX A;  1VQ5 Q;  3A8O B;  1M3A A;  3EGD B;  2ED0 A;  2LMJ A;  2DVJ A;  3E9F A;  2L3P A;  5GAM d;  2K3B A;  3S3N A;  1G83 A;  2FPE A;  2K5F A;  3ULR B;  1U5S A;  4XTW A;  3M57 A;  1WXU A;  1MMN A;  3QO3 A;  3V8K A;  2O9V A;  3RKX A;  3QXE B;  1YIJ Q;  3FEO A;  4LUE A;  2LJ0 A;  2KVQ G;  1NLO C;  2XD0 A;  4OF1 A;  2P84 A;  4F7U E;  3ZEH A;  3MPU B;  3OBY A;  2KQW A;  2VV5 A;  4M75 F;  2G3R A;  4M4Z A;  4J7F A;  3JCM P;  1M30 A;  1UEC A;  4A4H A;  1UDL A;  5I22 A;  5A0L A;  4OP0 A;  4M7D B;  3CD6 Q;  4M7A D;  1YJN Q;  1OQK A;  3QJ6 A;  1UUE A;  4OGE A;  1U06 A;  3CCS A;  2AZS A;  1N8R C;  1WXT A;  1TU0 B;  1AZE A;  4ESR A;  1C1A A;  5CKB A;  3NTH A;  2DXT A;  1NM7 A;  2NUP A;  2LCS A;  1K73 U;  2QTX A;  1Q95 G;  4PJO G;  3V7S A;  3FLG A;  4FT4 A;  1QVG P;  3U23 A;  2D0N A;  3TSZ A;  4M7A E;  1X69 A;  4JZ4 A;  1OZ3 A;  4RG2 A;  2KE9 A;  3JCM W;  4M78 C;  1S72 A;  1K0S A;  1G3S A;  1VQ7 A;  1SKU B;  2L3S A;  4LD9 K;  3LWI A;  1KG1 A;  1UGQ B;  2VXE A;  4J7I A;  3A8H B;  1GRI A;  3C0C A;  3P8D A;  2CP6 A;  3CBO A;  4J6Y A;  2FPD A;  2O31 A;  1KQ1 A;  1LPL A;  3A1P A;  4JUV A;  1CSK A;  5GAN 7;  1WX6 A;  4BE1 A;  1VUB A;  2RK1 A;  2DF6 A;  4RMO A;  4JS5 A;  1IO6 A;  1Q7Y U;  1K8A C;  1TUC A;  4LUD A;  2F2W A;  4M77 A;  2JZ2 A;  3QII A;  4JRP A;  2KRM A;  2CT3 A;  2X4J A;  1ZBJ A;  3VRY A;  3MEU A;  3RMQ A;  5AT1 B;  1JJ2 A;  1RAI B;  4XU1 A;  3GLX A;  2H3J A;  3VS0 A;  3EH1 A;  2OAW A;  1VQN T;  1VQL A;  1U3O A;  4AG1 C;  2J05 A;  2NYS A;  1HK9 A;  6AT1 B;  3CCQ A;  3EG1 A;  5GAN 5;  1PSE A;  3FB9 A;  3RKY A;  1UE9 A;  2E3H A;  3E19 A;  3CPW A;  3CMA T;  4N0A C;  2L0A A;  1JO8 A;  1JBM A;  5LJ3 e;  1HD3 A;  4C5E A;  1M1K R;  1VIE A;  2V8I A;  1NZ9 A;  2RHX A;  4E7K A;  1BYM A;  4C8Q G;  1P92 A;  4KUD K;  2GFA A;  1UGP B;  2L3Q A;  2E41 A;  4PLL A;  5I2M A;  3QSU A;  2FZG B;  3PMT A;  1N27 A;  3CC7 T;  5IHN A;  4HCB A;  1OOT A;  2VAS A;  1UGR B;  2XG8 D;  1M9S A;  5GAN j;  2DEU A;  1SHG A;  5CAI A;  3I35 A;  4BI4 A;  2M0O A;  3GOX A;  2HL3 A;  3CCV T;  3OYL A;  3MO8 A;  2DBM A;  1YCY A;  3EHQ A;  4IIO A;  1QVF S;  1IRX A;  1G2B A;  1YJW A;  1YNZ A;  1N8R U;  2RNA A;  2CYZ B;  1M8V A;  2JTM A;  5A0D A;  5LL6 S;  5LJ3 g;  1O9S A;  1T0J A;  2C06 A;  3UAT A;  1I5L A;  1M1F A;  3PNW C;  4E2F B;  2F2X A;  4F04 B;  4F7U A;  5A2Q E;  4C92 E;  2HCK A;  4O5V A;  4J83 A;  1WZO A;  1TXQ A;  4AT1 B;  1WFW A;  1WPY A;  4ZNX A;  1UGV A;  1BI1 A;  2LT1 A;  3C94 A;  4V2S A;  2XHC A;  2MF2 A;  3CCM Q;  3EAE A;  1VQN Q;  1OU8 A;  4AFZ C;  5IAY A;  4DA4 A;  3MEA A;  1NJI R;  2ZPG B;  4Y28 E;  2RPN A;  5GAN 6;  1YCS B;  4IUT A;  4M77 B;  3CMA Q;  2AHJ B;  5GMK l;  1UGS B;  2QG9 B;  4M7A A;  1I07 A;  3RIR A;  3MP1 A;  2CH4 W;  2LQK A;  3VYG A;  5FU6 B;  4J9G A;  3JB9 H;  4RTX A;  3T9N A;  5KYU A;  1AT1 B;  1PHT A;  1U8R A;  1KFZ A;  2FPF A;  3LLR A;  2R5A A;  2A28 A;  1TOV A;  3CC7 Q;  2DFU A;  2RI5 A;  3WXM B;  2D1X A;  2DYB A;  2E5K A;  4ZGD B;  2F69 A;  1VQO A;  2DIQ A;  4J5Y A;  1FX7 A;  4PJO C;  2A36 A;  2J7I A;  3CC4 T;  2DKG A;  1A0N B;  4ANJ A;  4PFZ A;  3FDR A;  1OI1 A;  1S72 T;  4F7U F;  2RJC A;  1OEB A;  8AT1 B;  2ZPF B;  3CCV Q;  1VQ7 T;  1VQ9 A;  3M54 A;  2LP5 A;  2YHT A;  1QVF P;  3JB9 J;  3JB9 D;  4PJL A;  4PFP A;  2J6K A;  3NMZ C;  4J9I A;  4A4E A;  3AHU A;  1BI2 A;  5GJV B;  1X75 C;  2D0Q B;  2COW A;  2DIL A;  4QQG A;  3L1A A;  3CQT A;  3VKI A;  1ABQ A;  2EQU A;  2OX7 A;  2C0I A;  4PFO A;  4CC7 A;  1HXD A;  1K73 R;  2FZK B;  3PE0 A;  4M7A F;  2K6D A;  2WSE E;  4FYX B;  2J6F A;  5ECA A;  3JCM J;  4GBQ A;  3X28 B;  3LYI A;  1J3T A;  4D8D A;  1YIT A;  3VYH B;  2K7A A;  3TCJ A;  4AFS C;  3EGU A;  5FW9 A;  1EX4 A;  3VS4 A;  1ZSZ A;  1VQL T;  5CKH A;  4HVU A;  5GAM h;  4XTZ A;  3HSB A;  5LJ3 f;  2EKH A;  1U1S A;  2DL5 A;  1BU1 A;  5GAN h;  2GTJ A;  5GAO q;  2J6O A;  3PIP A;  3P8B B;  4C8Q C;  2QAZ A;  2RQT A;  1Q7Y R;  2DO3 A;  2LCL A;  1Y0M A;  2EYY A;  3H0H A;  4MMK A;  1IXD A;  4MZT A;  1OX8 A;  3RNJ A;  4J9D A;  3MEW A;  4Y91 A;  3CC4 Q;  3LGF A;  1UEB A;  1ZHI A;  1IGQ A;  5GAN g;  1S72 Q;  2DM1 A;  1SPK A;  2BZX A;  2VKN A;  1VQ7 Q;  4C92 A;  1SRM A;  4TVR A;  4WCI A;  4LE9 A;  4R55 A;  2LQW A;  4R0K A;  2YRC A;  1KSW A;  2MI6 A;  5I2S A;  1K9A A;  4PJO D;  4JJD A;  5GAN 2;  1YJW T;  2M16 A;  2KXD A;  4KUL A;  4ZTJ A;  2JOY A;  3QDR B;  4F14 A;  1IB8 A;  2OAU A;  5LJ3 d;  4A53 A;  1ZX6 A;  2LNH B;  1DJ7 B;  4M78 G;  2Z0W A;  4PJO E;  4BE0 A;  5IXF A;  1ZUK A;  2PQW A;  2I2L A;  5GAN 8;  1M2O A;  3OYF A;  2ABL A;  1WGS A;  2LNV A;  2P0K A;  4C5I A;  2B8A A;  3HRT A;  1VQL Q;  3DLL A;  1YHQ A;  4ATO A;  1ZUY A;  3UWN A;  2ATC B;  2E70 A;  4OB0 B;  1XTD A;  3OW2 A;  1R77 A;  4OMN A;  2JTF A;  3CCE A;  2Y4X A;  1PM3 A;  3PMI A;  1N8R R;  2K79 A;  2QQB A;  3CPF A;  1MGQ A;  3HHT B;  1IRE B;  2E65 A;  3R6N A;  1KD1 C;  1LNX A;  1VQ4 A;  2DK3 A;  1ZSZ B;  5LJ5 h;  1K9M C;  5CCA A;  3CCJ A;  3M0P A;  2M1H A;  1SSF A;  2QEX A;  3JAM E;  3I55 A;  4JS4 A;  3G4S A;  3VS2 A;  4DEX A;  2DXC A;  3RES A;  2VB6 A;  4JPB W;  2LQ8 A;  1Q82 C;  2JS2 A;  1D3B A;  2KT8 A;  2AIR B;  2OJ2 A;  2BIV A;  2ENM A;  5KYW A;  4B9W A;  1W6X A;  1VQ9 T;  2FZC B;  3X20 B;  3EH2 A;  3A8L B;  3HRS A;  2A7Y A;  5FRO A;  4LD6 A;  3G6E Q;  4J9C A;  3RKW A;  3IQL A;  3QWX X;  1X6O A;  3DB3 A;  2DMO A;  5IN1 A;  4M7D G;  1YJW Q;  2LC4 A;  1PNJ A;  4BI8 B;  1KHC A;  1CKA A;  3SB2 A;  1K8A R;  2COZ A;  1BBZ A;  3LH0 A;  2DL8 A;  1SRL A;  3JCM h;  2JN0 A;  2E64 A;  2MK5 A;  5DLQ E;  1RAE B;  1M3B A;  3HTR A;  3ZFJ A;  4C92 B;  1QKW A;  2EFI A;  1JEG A;  1PD1 A;  1K76 A;  4AFU C;  2X4Y A;  4A63 B;  3TEE A;  2DE0 X;  1YN8 A;  4C0G A;  2AT1 B;  3VUB A;  3UA7 A;  2MOX A;  2BKD N;  1OV3 A;  3UPU A;  1TWB A;  1ZBX A;  2HKN A;  3SWN B;  1XOV A;  2FRW A;  2YWW A;  3JCM g;  4IUQ A;  3OY9 A;  1EZZ B;  3HFO A;  1QVG A;  3JCM c;  1PKS A;  4GLK A;  2JM9 A;  4M75 G;  1FXX A;  3CME A;  2VUB A;  1QCO A;  4KGX B;  2XMF A;  1B34 A;  3JB9 F;  1UJ0 A;  2ED1 A;  1KHI A;  2MAM A;  4FYY B;  1H8K A;  5CVI A;  3CCU A;  2RHZ A;  3M4Y A;  2XDD A;  1RLQ C;  4PLI A;  1VYU A;  2DX1 A;  3BY7 A;  2K9G A;  4OMM A;  1SSH A;  1W1F A;  4KGV B;  2X35 A;  4OML A;  3M0T A;  4LDU A;  4F16 A;  1E6G A;  2YSQ A;  5HCK A;  3OYA A;  5IHI A;  4B9X A;  3G1J A;  1VQ9 Q;  1TG0 A;  1MUZ A;  2ROL A;  1OX9 A;  2EJ9 A;  2DXB A;  2GNC A;  1EIF A;  1AWW A;  3I56 Q;  2O4X A;  2JJ9 A;  2W10 A;  4A4G A;  2PU9 B;  1PWT A;  2V8J A;  3EFO A;  1KD1 U;  3M56 A;  1K9M U;  4C0D C;  5CKD A;  5KYW B;  4KH0 B;  1WIE A;  4O6J A; 
#chains in the Genus database with same CATH homology
 2V8K A;  1Y96 B;  1YJ9 A;  1I5L A;  1M1F A;  3CCM A;  1S72 A;  1FWZ A;  3OSS C;  2IG0 A;  3PNW C;  4XU2 A;  4F7U A;  5A2Q E;  1Q82 U;  4M75 E;  4EMK C;  2CGH A;  4C92 E;  5KCO A;  5LJ5 g;  4XQ3 A;  3GF5 A;  4NL3 A;  4O5V A;  2BUD A;  1V29 B;  2YRV A;  4J83 A;  5A0G A;  3HKS A;  1WPY A;  4N4G A;  4C5G A;  3GPL A;  5CK9 A;  3QPH A;  4LDW A;  2XDP A;  4M77 E;  1VQK A;  3CMA A;  4QVD A;  3OQ5 A;  3OSV A;  5GAM f;  3GP8 A;  1BI1 A;  2LT1 A;  3C94 A;  2DZC A;  4C8Q E;  3INZ A;  4QQD A;  5FRM A;  4V2S A;  2XHC A;  5FU7 C;  2MF2 A;  5GAN 4;  5GAO l;  3GIB A;  3EAE A;  4M75 B;  1W2B A;  2CZ1 B;  3G7Z A;  5CIU A;  5IAY A;  3CCE T;  3L2Z A;  2KDS A;  2R57 A;  3SWN C;  1O75 A;  2ZCF B;  4IUV A;  5DY9 A;  2DAQ A;  5GAN f;  1PSF A;  4DA4 A;  2MWP A;  3OMC A;  3MEA A;  1BIB A;  2K5L A;  3JB9 G;  1KQS S;  2ZPG B;  4Y28 E;  1BI3 A;  5GAN 6;  4HKE A;  1YI2 A;  4IUT A;  4M77 B;  3JRZ A;  3KBG A;  1YIT T;  3A5Z B;  4C0F A;  1KQ2 A;  5C6S A;  2RD1 A;  2AHJ B;  5GMK l;  2RH2 A;  1UGS B;  4M7A A;  4C5H A;  4MZP A;  4PJO F;  3RIR A;  1WQW A;  3MP1 A;  2LQK A;  3VYG A;  4J6W A;  1Y07 A;  5FU6 B;  2P0P A;  4EMK A;  2WSC E;  3JB9 H;  3T9N A;  5DM7 R;  1NE8 A;  1G3T A;  3UDC A;  2ZPE B;  1Y71 A;  3M59 A;  4XU3 A;  4CRI A;  1N9R A;  1ZQ1 A;  4L5G A;  4VUB A;  2LTO A;  1KC8 C;  1U8R A;  2QEX T;  4Q5W A;  3S3M A;  1WJR A;  3I55 T;  3G6E T;  3LLR A;  2EQM A;  2R5A A;  3FC3 A;  1WJQ A;  3BW1 A;  2RI5 A;  2LVM A;  3WXM B;  4HCC A;  4X9C A;  3NTK A;  3L2R A;  2PVO B;  3C4S A;  4MZM A;  1VQ8 A;  1RL2 A;  2F69 A;  4ZGD B;  5GAN 3;  1VQO A;  2DIQ A;  3FIF A;  1FX7 A;  3OMG A;  4J5Y A;  4NS5 A;  4OMF B;  4PJO C;  5D6W A;  4M7D F;  4E47 A;  4BDY A;  3G71 T;  3QYG B;  2DKG A;  4ZGE B;  2EAY A;  2EQJ A;  4ZGJ B;  3OA6 A;  3CC4 T;  1NJI U;  3CEY A;  3HFN A;  3M5A A;  2HD0 A;  4IUR A;  1XQH A;  5CO7 A;  5GAO m;  4OB3 B;  3FDR A;  3SWN A;  3CXC A;  1OI1 A;  3F70 A;  1S72 T;  4F7U F;  2RJC A;  3TRE A;  4OB1 B;  3BDL A;  3HP9 A;  3OW2 S;  2ZPF B;  4M77 G;  1VQ7 T;  1VQ9 A;  2DD5 A;  2EJG A;  3M54 A;  5GAM j;  3OS1 A;  2YHT A;  1VQ6 A;  3JB9 J;  4RCB A;  3JB9 D;  2CZ0 B;  4M7D C;  5GMK e;  2DXU A;  2DTH A;  4A4E A;  2HBP A;  5IT9 E;  3AHU A;  3VV0 A;  4EDU A;  2VYT A;  4PNO A;  5J3B A;  1BI2 A;  3QZ5 B;  5J39 A;  3WVD B;  4IKF A;  4N4H A;  1X75 C;  2D0Q B;  3CBM A;  4BB7 A;  4QQG A;  2E1H A;  2IVW A;  3L1A A;  3VKI A;  5GAN d;  2EQU A;  3NFC A;  2DVE A;  4NOY A;  4PJO A;  2O4X B;  4N4I A;  3C95 A;  2HNI A;  1M1K U;  4LDX A;  2YLC A;  1HXD A;  2GFU A;  1VQ5 T;  4IUU A;  3PIO A;  2LX9 A;  4X34 A;  3GNG A;  4M7A F;  2WSE E;  5GAO n;  1Q86 C;  5D6Y A;  4BUG A;  3JCM J;  3X28 B;  4C0Z A;  3LYI A;  1VQM A;  3RUX A;  4E7L A;  4LDY A;  3L2U A;  3MHX A;  4C92 F;  3VYH B;  1YIT A;  2RI3 A;  3L2V A;  1D3B B;  2WAC A;  2X4W A;  3E1S A;  3TCJ A;  4E7I A;  5CKF A;  1Q86 U;  2QQS A;  2OTL T;  2RJD A;  2XK0 A;  1YBY A;  4M7D A;  4QVC A;  1VQL T;  5CKH A;  2VXF A;  4M78 D;  1YIJ T;  1K73 C;  1I8F A;  3MET A;  3X24 B;  2GCX A;  5GAM h;  2VGM A;  4XTZ A;  1I81 A;  3M53 A;  4KUI A;  2EKO A;  2KK4 A;  4C8Q F;  1VQN A;  3M9Q A;  3OYI A;  3HSB A;  2PUO B;  4MDX A;  2RHY A;  4JDS A;  2RK2 A;  4EMH A;  4M75 C;  3CME T;  4C92 C;  1M90 U;  1G5V A;  4XTV A;  5LJ3 f;  5GMK i;  1TH7 A;  1U1S A;  2JUF A;  2O01 E;  4GY5 A;  1AHJ B;  4L6V 5;  3QYH B;  1VIF A;  2FL7 A;  3SD4 A;  3FJP A;  5GAN h;  2DD4 A;  5CKE A;  4L59 A;  1Q81 C;  1QVF A;  1H3Z A;  4KBM B;  5LJ5 f;  2DJZ A;  3H8Z A;  4DOV A;  5HK3 A;  3JCM b;  3OYE A;  3G71 A;  3CC4 A;  5AYF A;  2R5M A;  3JSC A;  2YLB A;  5GAO q;  1JB0 E;  1YHQ T;  3BFM A;  3DB4 A;  1MHN A;  3ME9 A;  2DEQ A;  2KMT A;  3LGL A;  4M78 E;  2CS7 A;  3P8B B;  4FIB A;  4HCZ A;  3PIP A;  4C8Q C;  3OS0 A;  4JRQ A;  3CD6 T;  3QUI A;  3I56 T;  1YJN T;  2DO3 A;  2LCL A;  4C0D B;  5GAO p;  1WJS A;  4II1 A;  4JJN K;  1QP2 A;  4MMK A;  5LJ3 e;  2GQV A;  2XIC A;  3QG1 A;  1M4Z A;  4MZT A;  4WF2 A;  3CC2 A;  2K4Y A;  1VQP T;  3SDZ A;  3CC7 A;  3C12 A;  2E6N A;  3MEW A;  4Y91 A;  3N5B B;  4YTL A;  3L2Q A;  2EJF A;  1BKB A;  3LGF A;  1UEB A;  3PTA A;  2ZPB B;  1JJ2 S;  1ZHI A;  4M78 B;  2CKK A;  4NL2 A;  5GAN g;  2P4T A;  1VQ4 T;  4BI3 A;  4BD3 A;  4OGC A;  3M4G A;  4BY6 B;  4Z02 A;  1Q7Y C;  4RCC A;  4QW2 A;  2OTJ T;  3CCJ T;  1QVP A;  4M75 A;  3QHS A;  1G3Y A;  4OB2 B;  5D6X A;  4TVR A;  4C92 A;  3CCR A;  1QVG S;  2XKO C;  4PKC C;  3CCS T;  3OYM A;  5L8R E;  3M55 A;  4R55 A;  2K57 A;  3SFM A;  3CCV A;  3G4S T;  2PVD B;  2FB7 A;  2MI6 A;  5I2S A;  1VQ5 A;  4A4K A;  4PJO D;  3MCA B;  1RI0 A;  2RHU A;  2F5K A;  5GAN 2;  3CPW S;  1YJW T;  3JCM f;  4CI0 C;  5KE2 A;  4R56 A;  2M16 A;  1KC8 U;  4JLI A;  2QA4 A;  5FU7 B;  1KQS A;  4C8Q A;  1B34 B;  2KY9 A;  3WVE B;  5KE3 A;  5LJ3 j;  4BDZ A;  1LJO A;  4KUL A;  4ZTJ A;  3V8J A;  3E9G A;  2JOY A;  3LW5 E;  2RA2 A;  3QDR B;  3HPW A;  3OB9 A;  3UT1 A;  2M9U A;  2RM4 A;  4MML A;  4QVZ A;  1BIA A;  2FVU A;  1QP3 A;  2XI9 A;  4UC4 A;  2P0Q A;  5LJ5 j;  2OAU A;  3URG A;  3JCM Q;  3CCM T;  5GAO r;  1I4K 1;  2CZ7 B;  4RKU E;  5LJ3 d;  4A53 A;  3CCL A;  4OVA A;  3JCM X;  5GMK j;  3J7A F;  3DLM A;  1DJ7 B;  4M78 G;  4M7D D;  3A8O B;  1W4S A;  5C0M A;  4FU6 A;  4PJO E;  2K3Y A;  4XTU A;  5LJ5 d;  4BE0 A;  2PQW A;  2I2L A;  2QXF A;  3E9F A;  5GAM d;  5GMK m;  1VQK T;  5GAN 8;  2JNG A;  3OYF A;  3S3N A;  2K5F A;  3H6Z A;  3KUF A;  1IZ6 A;  4XTW A;  3M57 A;  1WGS A;  2LNV A;  2P0K A;  3QO3 A;  2B8A A;  3V8K A;  4C5I A;  4ZN1 A;  5CR2 A;  3HRT A;  3CBP A;  3RKX A;  3DLL A;  4ELZ C;  1YHQ A;  4ATO A;  3QXE B;  3UWN A;  3FEO A;  2E70 A;  3QBY A;  5DLO A;  2KVQ G;  2QQR A;  4OB0 B;  1XTD A;  3VJP A;  4DOW A;  3OW2 A;  3CD6 A;  4PJO B;  4JLG A;  1YJN A;  4E7J A;  2JTF A;  2XD0 A;  4ZN3 A;  4OF1 A;  1YI2 T;  3CCE A;  2HQX A;  2Y4X A;  2K2V A;  2Y90 A;  1UB4 A;  3PMI A;  4XTX A;  5EG2 A;  4F7U E;  5HKC A;  2L3R A;  3L42 A;  3ZEH A;  3V7R A;  2QQB A;  3CPF A;  3OBY A;  2KQW A;  2VV5 A;  2EWN A;  4DQ2 A;  1MGQ A;  2G3R A;  4M75 F;  3RMS A;  3QJY A;  2DIG A;  3HHT B;  5LJ3 h;  4J7F A;  4A54 A;  5GAN e;  3JCM P;  4HT8 A;  1IRE B;  1XNI A;  2E65 A;  4A4H A;  2QQA A;  4XU0 A;  4FT2 A;  5A0L A;  1KD1 C;  3P8H A;  1X01 A;  4OP0 A;  1LNX A;  3L2W A;  1VQ4 A;  4M7D B;  2DK3 A;  5LJ5 h;  1K9M C;  4M7A D;  5CCA A;  3CCJ A;  3QJ6 A;  2M1H A;  4M77 F;  5GMK h;  4OGE A;  1SSF A;  2VC8 A;  3JCM d;  1VQ8 T;  2QEX A;  4F7U B;  3CCQ T;  3JAM E;  3CCS A;  1N8R C;  4C92 D;  3I55 A;  4ELY C;  4D6W A;  1WQ7 A;  3G6E A;  4JS4 A;  3G4S A;  3A8M B;  4IUP A;  2CZ6 B;  4EPC A;  5CKB A;  3NTH A;  2DXT A;  1LOJ A;  2DXC A;  1R8O B;  2F5T X;  3RES A;  2QTX A;  1K73 U;  3VUZ A;  2DZ9 A;  4EMG A;  1QW1 A;  4PJO G;  2LQ8 A;  3V7S A;  1Q82 C;  3CCU T;  1D3B A;  1JRI A;  2L89 A;  2A3L A;  3FLG A;  2BIV A;  4FT4 A;  3OYH A;  4B9W A;  4XTY A;  4BAC A;  1VQ9 T;  4M77 C;  1W2B S;  2L5Q A;  1OYX A;  4M7A E;  3DKM A;  3X20 B;  1N6A A;  1OZ3 A;  2LT4 A;  3ASK A;  4JRK A;  2PVG B;  3A8L B;  3HRS A;  4M78 C;  2DTI A;  4P5N A;  4RG2 A;  3JCM W;  1OZ2 A;  1Y96 A;  2A7Y A;  4LD6 A;  5FRO A;  1Q81 U;  3R6O A;  1G3S A;  1VQ7 A;  4BY6 C;  3OYB A;  3OYD A;  5FLX E;  4ME7 A;  5FU6 C;  2ZGW A;  3RKW A;  4LD9 K;  1X6O A;  3DB3 A;  5GAM g;  5IN1 A;  2HAX A;  2EYQ A;  3LWI A;  1KG1 A;  4M7D G;  5CQY A;  1UGQ B;  2DTO A;  2VXE A;  2LC4 A;  2NLU A;  2RO0 A;  4J7I A;  2XDB A;  4BI8 B;  2D6F A;  2C06 A;  1KHC A;  3A8H B;  3LX7 A;  1BI0 A;  2PUK B;  3OYJ A;  3SB2 A;  3OYY A;  3P8D A;  4E7H A;  3CBO A;  3S6W A;  5J26 A;  3LH0 A;  4J6Y A;  4F7U G;  3OYK A;  4M7A B;  3KXT A;  4RG8 A;  3JCM h;  2JN0 A;  3X25 B;  2E64 A;  2RHI A;  5DLQ E;  2QI2 A;  2LRQ A;  2E10 A;  4EMK B;  3QKJ A;  2LCC A;  3ZFJ A;  1KQ1 A;  2D9T A;  4C92 B;  2DPP B;  4JUV A;  4HA8 A;  3V7C A;  3RER A;  3OYC A;  5M9O A;  2EFI A;  2X4X A;  2QQ9 A;  5GAN 7;  4BE1 A;  1VUB A;  2RK1 A;  4RMO A;  1N9S A;  4ZTF A;  2XID A;  3HL8 A;  2KSS A;  4JS5 A;  2X4Y A;  1NPP A;  3OYG A;  1VQM T;  1Q7Y U;  5I21 A;  2MWO A;  2QDY B;  3TEE A;  1K8A C;  4FL6 A;  3FRN A;  4M77 A;  2JZ2 A;  4C0G A;  5CQX A;  3NTI A;  3JCM V;  3QII A;  3VUB A;  4C8Q B;  4JRP A;  3CXC S;  1Y7X A;  4M78 A;  2BKD N;  2X4J A;  3MEU A;  3UPU A;  1K8A U;  1ZBX A;  3RMQ A;  3SWN B;  1JJ2 A;  1XOV A;  4XU1 A;  2L8D A;  2H3J A;  3GLX A;  3OBW A;  3JCM g;  4IUQ A;  1YJ9 T;  4PL6 A;  2OTL A;  1VQ6 T;  1VQN T;  1VQL A;  3V8L A;  4BE2 A;  1NJI C;  1GXI E;  3OY9 A;  1YIJ A;  3EFS A;  3HFO A;  4JRI A;  4M7A G;  4HT9 A;  1NPR A;  3PGG A;  1M1G A;  1HK9 A;  3ER0 A;  2MMP A;  3JCM c;  1QVG A;  3CCQ A;  4XAX B;  4GLK A;  5GAN 5;  2E12 A;  4M75 G;  3MP6 A;  4C92 G;  5KH6 A;  1FXX A;  1PSE A;  3FB9 A;  2VUB A;  3RKY A;  5KCH A;  3CME A;  3JB9 I;  1B34 A;  3E19 A;  3JB9 F;  1WNL A;  4J6X A;  3CPW A;  2FYK A;  3CMA T;  4N0A C;  1KHI A;  2LDM A;  4A4F A;  2MAM A;  2RB6 A;  5CVI A;  3CCU A;  1JBM A;  3TU4 K;  2RHZ A;  2RJF A;  3M4Y A;  3BDU A;  3OS5 A;  4MDW A;  4FSX A;  1VIE A;  2WSF E;  2V8I A;  4PLI A;  3O8V A;  4C5E A;  2XDD A;  1NZ9 A;  2RHX A;  3BY7 A;  4E7K A;  1BYM A;  5HY6 A;  2HQE A;  4C8Q G;  1P92 A;  2VGN A;  5LJ5 e;  4KUD K;  2GFA A;  3QZ9 B;  1UGP B;  2FHD A;  2X35 A;  2E41 A;  2R58 A;  4M7D E;  4PLL A;  5I2M A;  3CC2 T;  3QSU A;  4LDU A;  3PMT A;  1N27 A;  5GAM e;  3I56 A;  3CC7 T;  4HCB A;  3X26 B;  1UGR B;  4QQ6 A;  2XG8 D;  2E5Q A;  1M9S A;  3A8G B;  3OYA A;  5GAN j;  3PT9 A;  1VQP A;  4B9X A;  5CAI A;  3OYN A;  1M1K C;  4X9D A;  3MP8 A;  3J80 E;  3MEV A;  2E6Z A;  4LDV A;  4BI4 A;  2RI2 A;  2ZPI B;  3S3O A;  2M0O A;  3ZBD A;  2KAF A;  3CCR T;  2K5I A;  2EJ9 A;  3HRU A;  3GOX A;  2DXB A;  1EIF A;  3CCV T;  4J8O A;  2EQK A;  3OYL A;  2OTJ A;  2XU8 A;  4KT0 E;  5HK0 A;  2O4X A;  3MO8 A;  4A4G A;  2PU9 B;  2RJE A;  3PFS A;  1YCY A;  2V8J A;  3GNF B;  4N0A A;  4XK8 E;  2ZPH B;  4M75 D;  3LWH A;  1VQO T;  2Y4Y A;  1KD1 U;  4M78 F;  3J81 E;  5FRN A;  2QA4 T;  1QVF S;  3M56 A;  2JVV A;  1K9M U;  1U1T A;  4C0D C;  1G3W A;  2ZZD A;  3Q1J A;  5CKD A;  1YJW A;  1H64 1;  3OS2 A;  2K3X A;  1N8R U;  3EFR A;  2CYZ B;  1M8V A;  3M58 A;  4M77 D;  3VU3 C;  4O6J A;  1M90 C;  2JTM A;  5A0D A;  2GF7 A;  3CCL T;  3JCM e;  5LL6 S;  5LJ3 g;  4C8Q D;  4FM4 B;  1O9S A;  1M5Q 1;  4M7A C;  2EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...