4A53A

Structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
125
structure length
125
Chain Sequence
b'GAMGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMDCDEEFDFAANLEKFDKKQVFAEFREKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EDC3
molecule tags Rna binding protein
source organism Schizosaccharomyces pombe
publication title The Structural Basis of Edc3- and Scd6-Mediated Activation of the Dcp1:Dcp2 Mrna Decapping Complex.
pubmed doi rcsb
total genus 10
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a53A01
3SB2A 5LJ3e 4JLIA 4M77E 5GAOl 3RERA 2ZGWA 4PJOB 1BIBA 5LJ3j 4MMLA 4M75C 4M7DA 3QHSA 2FB7A 5GAN5 4RCCA 3EFRA 4M75F 3RESA 4Y91A 1HK9A 3JB9D 5GANe 4F7UE 4M7AD 2RM4A 2Y90A 5GAN3 4XTZA 3JCMg 4J6YA 3JCMe 4C92A 2RD1A 4M75A 4M7AG 4C92G 4PJOE 4M7DB 5GANg 5LJ5g 5GANh 4N0AA 4XTUA 4C92F 4C8QG 1JRIA 4XU0A 3RKYA 2YLBA 5GMKi 1WPYA 5GAOq 3AHUA 4XTXA 3PGGA 4JRIA 3RUXA 4C92D 4C92C 2DJZA 4C8QC 2CGHA 4XTWA 5GAN6 3QSUA 2YHTA 3FB9A 3V7CA 4N0AC 5GANf 1I4K1 4M7DE 3JB9G 4J6XA 3RIRA 4C92B 4M75B 2EJFA 1D3BA 4HT9A 4C8QD 4HT8A 2DXUA 2EWNA 3L1AA 1U1SA 4M78E 3M4GA 4M78F 4C8QA 5GMKe 5GAMj 3JCMP 2VXFA 4XTVA 4M75G 3SWNB 5GMKl 3JB9J 4C8QE 2E64A 1LJOA 1U1TA 4M7DF 1HXDA 5LJ3f 1WQWA 2DTOA 2DZCA 4M7AB 3RKXA 2YLCA 5GANd 5GAOp 4M78B 2DXTA 4NOYA 2QTXA 3RKWA 1KQ2A 1Y96B 2EAYA 3L2ZA 4OP0A 5GAN8 3V8LA 2K57A 4C8QB 5GAMf 4PJOA 1WNLA 5LJ3h 2DZ9A 4M75D 3BDUA 2I2LA 4M77C 4MMKA 5GAMg 1H641 2E41A 2JN0A 3EFSA 5GAMd 3V8JA 4EMGA 4M7AE 5GANj 3QUIA 2VC8A 3V7SA 3JCMX 4M75E 3JB9H 1M5Q1 5GAMh 4M7DD 4X9CA 3HFNA 4PJOC 1LNXA 3FIFA 2VXEA 4M77A 4M7AA 2HNIA 4EMHA 2E1HA 2E65A 3HFOA 4M78G 4F7UB 3HSBA 2EJ9A 3JCMf 1Y96A 2RB6A 1I5LA 4M77F 1KQ1A 4M78D 4HA8A 1M8VA 3V7RA 1I81A 3JB9I 3SWNA 3BY7A 5LJ5f 4M7DG 4EMKB 3JCMc 4M7AC 3BFMA 1N9RA 1I8FA 3JCMb 5GAOm 4PNOA 3INZA 3JCMh 4WF2A 4XU3A 4RCBA 3FJPA 4A54A 3JCMW 5GAOr 3JCMQ 5LJ3d 1X01A 4XQ3A 2DVEA 4XU1A 3JB9F 4M77B 3SWNC 5LJ5h 1WQ7A 2EJGA 5GAMe 4XU2A 5LJ5j 1N9SA 3QO3A 1LOJA 4C92E 4JUVA 4PJOG 2DTIA 5GMKm 4M78C 4XTYA 3JCMV 5DY9A 5I21A 3JCMJ 3BW1A 4PJOF 4F7UG 4QVDA 5GMKh 3V8KA 2DKGA 5LJ5e 3GIBA 4EMKA 2E10A 3VU3C 4V2SA 2RA2A 1D3BB 4J5YA 4F7UF 1TH7A 1BIAA 5LJ5d 1B34B 5GAN7 1JBMA 2DTHA 4NL3A 5CAIA 5GMKj 3JCMd 4M78A 4NL2A 4C8QF 2FYKA 5LJ3g 4F7UA 4M77G 4QVCA 5GAN4 4A53A 5GAOn 1YCYA 2DEQA 4J6WA 4M7AF 4EMKC 4DQ2A 4JRKA 5GAN2 1MGQA 4M77D 4PJOD 4M7DC 1B34A 4X9DA
chains in the Genus database with same CATH superfamily
4O6JA 2ECZA 2HDAA 3URGA 4R0KA 4M7DA 5HCKA 3CMAQ 3I35A 2BZYA 4M7AG 3DKMA 2P4RA 1H3ZA 3OS2A 2CZ6B 2QGFB 4XTXA 4D8KA 2OAWA 1PD1A 4XTWA 3L2VA 2JMAA 1I4K1 3OS5A 2EWNA 2JTEA 3CCSA 1UECA 4J7FA 3R6OA 3OS1A 2OTJA 2ZPEB 2X3XD 2DYBA 1LJOA 1AEYA 5J39A 3UT1A 1PC0A 2CP7A 1KQ2A 3OY9A 3NFCA 2M9UA 2JN0A 5CIUA 2M51A 2D9TA 2M1HA 3M56A 3HFNA 1KD1C 5CVIA 4M78D 3I5SA 2LJ1A 2J06A 4WF2A 2DX1A 1QVGS 2OTLA 1IO6A 5LJ5j 2RK2A 2GBQA 1OX8A 3QO3A 1V29B 1LOJA 2B86A 2C0OA 1VQNQ 4AMCA 2O4XB 5KYWA 1R0CB 5A2QE 5GMKh 2K7AA 2E10A 3KBGA 5C6SA 5LJ5d 1NPPA 3G6EA 2EFIA 2RI3A 2KRNA 2AZSA 1RAHB 2FG0A 1YHQQ 4P5NA 4DBRA 4M7DC 1QLYA 1B34A 2E5QA 1TWBA 2OI3A 3VS3A 2LNVA 3ME9A 1PCXA 2P0KA 1WZOA 2GNCA 5GAN5 1OZ2A 3ER0A 3M58A 1NYGA 1VQOA 3JCMg 1SRLA 1VQ5T 1YJ9Q 2KQWA 4E7JA 4N4GA 3OSSC 1JRIA 5FU7B 1QWEA 3AHUA 2L3RA 4C92D 3PE0A 3JV3A 1G3SA 4ELZC 5IHKA 5FROA 5GANf 4HCZA 1PSFA 2RJEA 1VQKT 4PKCC 4CC4B 1G3YA 3A8HB 1OU8A 1U1SA 4HVUA 3PIOA 5A0LA 2OTLT 3OS0A 2VYTA 1W2BS 1X2KA 5KYUB 2HL5C 3L2WA 1HXDA 3H8ZA 1R0BG 1SKUB 1YIJT 4M78B 5GAN8 1YJ9A 4C0GA 2VVKA 2KDSA 3VS5A 3HP9A 4WCIA 4DOWA 2ROLA 5D6WA 2F5TX 3OBYA 3EGDA 1ABOA 1EZZB 4JDSA 2CKKA 4ANJA 1Y96A 4JS4A 1FMWA 1XQHA 1KSWA 2KRMA 4M7DG 1RAGB 4A4EA 2C0TA 3JCMQ 4M77B 1Q7YU 4VUBA 4Z8AA 2EJGA 2EYXA 4E47A 3L2UA 2KXCA 1I0CA 4C92E 1X69A 1ZSZB 3EG1A 4BACA 2VWFA 4GBQA 2XKOC 1KD1R 2M02A 4PL6A 2E70A 4EIKA 1Q81R 1BKBA 2CP2A 4E7LA 2GQVA 1G2BA 4EMKC 1LCKA 1X6OA 4LDUA 3OYBA 5FLXE 3PT9A 1UGSB 2HL3A 2KNBB 4C5GA 1QKXA 2ZCFB 4PJNA 3Q1JA 4CRIA 2Y4XA 4OB3B 4X34A 4FCYA 2XU8A 1YCSB 3REAB 4A4GA 5FU6C 3RDVA 5LJ5g 1U5SA 2O31A 1I07A 1AWWA 4FYVB 1T0HA 3OYDA 3PGGA 4JRIA 1VQPQ 4J9DA 2FZGB 2LJ0A 4FW2A 4II1A 4Z89A 1VQ4T 1BCMA 5HY6A 4E7HA 1N8RC 3MP6A 2FZKB 1WHHA 2GGRA 3J7AF 2QAZA 1YITQ 2CP3A 6AT1B 3CCLT 3RKWA 1N6AA 2AT1B 1Q82C 3L2ZA 5GAMf 2IIMA 1ZSZA 3MP1A 3I56A 2CDTA 2DXCA 2HBWA 4OGEA 3G1JA 3GP8A 3QUIA 2LT4A 2VC8A 1OYXA 5IXBA 3HFOA 1FX7A 3A8GB 1RAFB 2BZ8A 1VYVA 3CQTA 3NTIA 2BE7D 4AG2C 5LJ3d 4M4ZA 3JB9F 4ZGJB 1XJWB 1VQ7A 3NTHA 1WHLA 2RH2A 2ZPGB 5GMKm 1NE8A 3CPWP 4F7UG 2V1RA 1QKWA 1YHQT 1GFDA 1FYNA 3JCMd 1TXQA 1ZLMA 4M78A 4BI8B 5I2MA 5DLOA 2ZPHB 2E6NA 2RHYA 3VS4A 1VQLQ 1VUBA 4OMNA 1RI0A 3RERA 2O9SA 3VUBA 1YI2T 3RMSA 2ED0A 2A36A 3ULRB 2D6FA 4LNPA 2DF6A 2K79A 3CMEQ 4C92F 5GAOq 4C92C 4MZPA 1TUGB 2PU9B 5A0GA 3RIRA 2EJFA 1K76A 2XK0A 2X35A 8ATCB 2QYZA 1JXOA 1EIFA 3CCET 1BYMA 3MKDA 2LZ6B 2CREA 1S72A 2LX7A 2L89A 2HSEB 3H0HA 1E6GA 3WVEB 4J9CA 2RJFA 4GLKA 4AFUC 1YJWT 3O8VA 1P92A 3TSZA 2A3LA 3OB9A 2KY9A 2DFUA 4JLGA 3L42A 3JCMX 2YRCA 4DBHA 5GAMh 1LNXA 3CCUQ 3C95A 5ECAA 3JCMf 4HA8A 4LXCA 1YI2A 3OYAA 2A37A 1SRMA 5GJWB 4UC4A 5GAOm 1VQPA 4L59A 3INZA 4RCBA 3VS7A 3VRZA 1Q82R 1K9MU 3AT1B 1CKBA 1KG1A 1M2VB 3CC2A 2EQJA 5GJVB 1PHTA 3CCSQ 4M78C 2CP5A 4OMOA 5LJ5e 4PJOF 2PTKA 1YFNA 1F1BB 1BIAA 1WLPB 1VQ6T 3CC4Q 5EG2A 4KUIA 4AG1C 3JSCA 4F04B 4A4FA 3M53A 3C0CA 1XNIA 2WSCE 2IG0A 1JJ2A 1NBEB 2AKKA 1VYTA 2OTLQ 3M0PA 1GBQA 3FC3A 1TU0B 3MEVA 3OYEA 3G7ZA 3CCQA 1X75C 3CC7T 2V8KA 1HK9A 1Q86R 2JVVA 4J6YA 1V76A 1AZGB 3EAEA 3U23A 2KAFA 4C92A 4PJOE 3QZ5B 1S1NA 4O5VA 1QVFA 4XU0A 3RKYA 4Y92A 1WA7A 3E19A 2EKOA 3OW2S 2CGHA 3NTKA 2YHTA 2WSEE 3JB9G 5IXFA 4ZGDB 5I2SA 2JT4A 2KROA 3RNJA 1ZUUA 2J05A 1X27A 5KH6A 2XG8D 5GAOp 2EBPA 4QVZA 1QVFS 2EAYA 2QK0A 2MPXC 5HKCA 3KXTA 5LJ3h 5CCAA 1AZEA 3DLLA 2YWWA 3UATA 3VYGA 3CCUT 4LDYA 4AFSC 2RN8A 1QVGP 1KHIA 1M5Q1 1FMVA 1RI9A 1NJIC 1ZUKA 1VQOQ 2VUBA 5FRMA 2EJ9A 2JMCA 2RB6A 3OYIA 1KQ1A 2JS0A 1YJNQ 5CKHA 2LCLA 3BFMA 3CBOA 2JXBA 2QTVA 3JCMh 1YJNT 4A54A 3PMTA 3A98A 1GXIE 3SWNC 3O5ZA 4OF1A 5IH2A 3QDRB 5CR2A 1KK7A 1IZ6A 5KYXA 3JAME 3JCMV 2CT3A 1VQ5Q 3D7SB 4JS5A 3CCJT 1B34B 1HYOA 3C4SA 1VQKA 5LJ3g 2YUOA 3RR6A 4KH1B 4M77D 2DL4A 3BDLA 1M3AA 2R58A 2X4JA 2W10A 3QYGB 2DEUA 1PKTA 3CCLA 4PJOB 2FRWA 1OX9A 3OYLA 4RCCA 2FO0A 4ME7A 2D8JA 5HK3A 1R77A 5KE2A 4N0AA 3ASKA 3OMCA 2LMJA 2H8HA 2K4YA 5CKDA 1RLPC 1VQMA 3I9QA 3I55Q 4F17A 2JNGA 2RQUA 4J8OA 1UHFA 4JPBW 1E7OA 2QDLA 2FHDA 2DXUA 2CUBA 1WXUA 4M78F 2J6OA 3M4GA 4HVVA 5GMKe 1VQ7T 1QCFA 2E6ZA 2ZPIB 2HBPA 2PNIA 1Q7YR 2VASA 4Q5WA 2DJQA 2DL3A 2ZPBB 2YLCA 2D1XA 1M27C 2QQRA 2KVQG 4KH0B 2ROTA 5KYXB 5GAMd 3OW2P 1VIFA 1U3OA 3JB9H 3V7SA 1KHCA 4F14A 2VXEA 4M77F 1M4ZA 1G8XA 1Z9QA 3V7RA 3MEWA 1GFCA 3JCMb 3I56T 2GQIA 1HJDA 1MMAA 1WGSA 4DEXA 1YWPA 2CZ7B 4B6MA 3SHWA 4ZGEB 5I21A 4LUEA 1EX4A 2HSPA 1SSFA 2JM9A 4V2SA 3OYCA 3MP8A 1UTIA 2NUPA 4C5EA 4C8QF 2DVJA 3HKSA 2KRSA 2DEQA 4A53A 1UE9A 2L3QA 1MGQA 1K73C 3H6ZA 5LJ3e 5GAOl 2ABLA 3EG9B 4PFPA 1Y07A 4J9EA 2FB7A 1M3BA 3CBMA 2MF2A 4MDXA 1WXTA 1GRIA 5AT1B 3I5RA 3JCMe 4C92G 3VRYA 2KT8A 1SPKA 2PVDB 4XTUA 1PD0A 1ACMB 2KEAA 4WTOB 4GLMA 3CD6T 1LPLA 4CC7A 2FL7A 4FSXA 1BB9A 1VQPT 4LDVA 3HL8A 4XTVA 2ZPFB 3M4YA 5GMKl 1WI7A 4FYXB 1NJIR 1B7TA 1X2QA 1U06A 3CCST 4PJOA 2LC4A 1BI0A 2DL7A 3QJYA 2EGCA 4IUTA 1T0JA 2NUPB 1WIEA 2KSSA 1RAEB 3HSBA 1N8RR 1Q82U 4FIBA 2EYYA 2JOYA 1QVGA 1MHNA 2LQWA 4AT1B 1KC8U 3CCEQ 4FU6A 1K9MC 2XI9A 1I8FA 3R6NA 4R56A 1D09B 3JCMW 2D8HA 4D6WA 1VQNT 1M90U 1MV0B 3T9NA 4K11A 1WHKA 3EG2A 4ATOA 4FYWB 4A4KA 2RA2A 1TH7A 4OMMA 5GMKj 3RBBB 3RMQA 2LT1A 2MYSA 1MMNA 3CC2T 1KQSP 3LX7A 5GAN2 3VV0A 1AHJB 1QCNA 3MPUB 1IRXA 1OEBA 4M77E 1SF9A 4FT4A 2LCCA 3CCVA 4Z02A 3MEUA 3RESA 3UF4A 3QKJA 4F7UE 4BE1A 5GAN3 1KC8C 1WXBA 3S3MA 2FPEA 1VQ9Q 2LQKA 1JEGA 1C1AA 4BDYA 1WPYA 3CMET 1M1KU 1KD1U 2FZCB 5CQYA 3M59A 4C8QC 1UGRB 3LH0A 2P84A 2CSQA 2K5FA 3LWIA 5IN1A 1UFFA 4C0DC 1KJWA 3MJXA 4HT8A 2KYBA 1NEBA 3L1AA 4M78E 3M0SA 5KYWB 2E64A 5LJ3f 4FL6A 3G4SQ 4NOYA 2DXTA 4A4HA 3TSWA 1MMGA 2LP5A 4OP0A 1XTDA 1YWOA 1WJRA 2KI7A 2R5AA 3EFSA 4EDUA 1H3HA 2CP6A 4M7AE 2MWPA 4PLLA 1BI3A 4RMOA 1VQ6A 5I11A 1M2OA 4X9CA 2J6FA 4EMHA 4CC3A 1QMCA 1BK2A 2AIRB 2RK1A 4ZN1A 1Q86U 8AT1B 1JB0E 2KXDA 3M0QA 3TEEA 1ZBXA 3JCMc 1UDLA 3CCQT 4TVRA 1OQKA 2XHCA 3P8BB 1M1KC 1QWFA 2A7YA 4KT0E 4QQDA 1SSHA 2DLPA 1K8AU 2IPOB 2PVGB 3IQLA 3CPWS 4BD3A 1ZHIA 2QEXA 3S6WA 1N9SA 4RKUE 2I0NA 3EH2A 2F5KA 3OYYA 3BW1A 4HXJA 4HKEA 3OYHA 2XICA 5IHIA 2DD4A 1W6XA 2HQEA 2P0QA 4BI4A 2MOXA 2V8IA 2YUPA 4BE0A 3H41A 4QVCA 4QQGA 4HCCA 2FPFA 1W2BP 4PJMA 4ZN3A 3CXCP 2EPDA 2QA4T 3I56Q 2CUDA 1UG1A 2HQXA 2L3SA 3ZBDA 1O75A 3QHSA 2W0ZA 2LJ3A 2L0AA 2QEXQ 4M7AD 3E9FA 3FRNA 2M0OA 3CCLQ 3F70A 2RD1A 3OW2A 1M90R 1I5OB 2R5MA 4C8QG 3HTRA 2FVUA 1WHMA 2J7IA 3CCMT 3CCRA 1OI1A 4BY6C 3QYHB 1M1FA 3FB9A 1PKSA 1AVZC 2RHZA 2CZ1B 4HT9A 4C8QD 2DIGA 4IURA 3JCMP 1YJNA 1VQ8T 1YP5A 4RTTA 1IHVA 2X4WA 4GY5A 2HCKA 1Q81C 1WHJA 2EKHA 2HQHA 2EW3A 2QQAA 4LE9A 4LD6A 2DAQA 2QTXA 1VQ9A 3PIPA 4DBFA 3V8LA 1VQLA 2HMAA 3QPHA 4AFZC 4B9WA 2BE9B 2CT4A 3UA6A 2DL8A 2YT6A 3I55A 1KIKA 1NLOC 3V8JA 3TU4K 3CCJQ 3MCAB 2K2VA 5CKBA 4M7DD 1QQJA 4DBQA 4OB2B 4JJNK 1JU5C 5FW9A 1FWZA 1D1AA 1M8VA 4R55A 1T3LA 3JB9I 3LYIA 2DXBA 4B9XA 4JJBA 4LDXA 4E6RA 7AT1B 5L23A 4ORZA 4KGVB 3OBWA 1QP3A 3G4ST 2XMFA 1X01A 4XQ3A 4CC2A 2X51A 5GAMe 4NS5A 3PTAA 4OMFB 1D0XA 4PJOG 2EQIA 1UB4A 1NZ9A 3A8MB 1Q81U 1N27A 3PFSA 3ZFJA 4E7SA 2E3HA 2FYKA 4D8DA 1VQ4A 4J6WA 4LD9K 1VQ8A 1BI2A 2QG9B 1UUEA 2EQKA 1IREB 4MZTA 2KT1A 3LH5A 4JLIA 2YDLA 1VOMA 5LJ3j 1X6BA 3OYJA 1MMDA 1YN8A 1C6VX 4IUQA 3M5AA 4CI0C 2EYZA 1K8AC 4PJJA 2K5LA 2QASA 2GFAA 2KMTA 4RTXA 3EG9A 1NM7A 2M16A 2LVMA 2QDYB 2DJZA 3V7CA 2BIVA 3S3NA 1PSEA 1VQ7Q 2SEMA 3CXCS 4RTZA 3KFVA 4C5IA 4F16A 5CK9A 5D6XA 4JRPA 1U8RA 4MDWA 1TOVA 2RF0A 2VXFA 2EYQA 3BE3A 3SEMA 2DMOA 3QIIA 2MK5A 3HRTA 1D1CA 4ZTJA 4LDWA 4JJCA 1K0SA 2XDBA 1M8MA 4L5GA 4C8QB 5KE3A 2CP0A 3HPWA 2CSIA 3CCMQ 2JW4A 1M9SA 4JZ3A 2YRVA 1VQKQ 3WXMB 2DRMA 1I81A 4EPCA 3EGUA 3OYGA 4A63B 1YITT 1KQSS 3CCQQ 1WQ7A 2LQNA 4J9IA 3QDFA 2P0PA 2YUNA 3HRSA 3GIBA 4BI3A 3UA7A 2YXYA 2HD0A 5GAN7 1JBMA 2DTHA 4J9HA 2HZYA 1VQNA 3SFMA 3M0TA 1TUCA 3OQ5A 4ELYC 4IUUA 4KGXB 5AYFA 2A28A 2KGTA 3CBPA 1ARKA 3EGXA 5D6YA 1B3QA 1YNZA 2DL5A 3G71T 1GCQC 4BB7A 2ZZDA 3DLMA 1UJ0A 4MZMA 3SD4A 2KR3A 2X3WD 2KE9A 5C0MA 1WDXA 3VS6A 2CS7A 3CCUA 2KYMA 3LGLA 5IT9E 1PRLC 3LGFA 2K5IA 5GANg 2LCSA 3TVTA 2QXFA 2A08A 5GAN6 2L8DA 3EGDB 3NGPA 1PWTA 1ZSGA 4N4IA 1VQMQ 2ZAEA 4J83A 4BUGA 5GAMj 2FPDA 4FW1A 1YI2Q 3VKIA 1OPLA 4C8QE 4OMPA 1O9SA 1WQWA 2CZ0B 1UJYA 3RKXA 2PUOB 3C94A 3NPFA 1PRMC 4BY6B 1WNLA 3FEOA 1VQ5A 2I2LA 4PLIA 3CD6Q 1A0NB 3EFOB 3G6EQ 2EVRA 3P8HA 1AWJA 2QI2A 1S72Q 3DB4A 3CCVT 3BY7A 3UDCA 1YBYA 5FU6B 4PNOA 4XU3A 1W4SA 3CCVQ 3CC7A 4E7IA 1YIJQ 2AZVA 2DVEA 2NUTB 2K3XA 2DO3A 2RQWA 1K0XA 1GBRA 5FU7C 2NWMA 3QWYA 4EMKA 1WX6A 4J5YA 3QG1A 2RHIA 2G6FX 2O88A 1RAAB 1M90C 1SHFA 5GAN4 1GCQA 1YCYA 2BUDA 2QA4Q 2GFUA 3SB2A 3QBYA 2WSFE 3CC4T 4XK8E 2FRYA 2GTOA 2EQMA 1ZBJA 2X4XA 1W70A 2MI6A 1NPRA 2D0NA 2COZA 3S3OA 1TTHB 1OU9A 4Y91A 3JRZA 1QP2A 3E2UA 5DM7R 4M75A 1Z9ZA 1DJ7B 3GLXA 2DERA 5GMKi 4J6XA 2K9GA 1UGPB 1ZA1B 1NLPC 4JZ4A 2L2PA 1B07A 2C0IA 2VV5A 4LN2A 2OX7A 1VQMT 2QQ9A 2PZ1A 3PMIA 4KUDK 1ZSZC 2QEXT 2L5QA 3M55A 1T3SA 3ZEHA 2DZCA 1X43A 5GANd 1G83A 3EGXB 5I22A 4ZNXA 3BDUA 4MMKA 2BZXA 3PVQA 1YJWQ 1VQOT 4KULA 5GANj 2JJ9A 1RL2A 3HRUA 3CXCA 3CC4A 4PJLA 1JXMA 3X20B 2CH4W 2O2OA 4M78G 3X28B 1K9MR 2QA4A 4LUDA 4E7KA 1HD3A 1J3TA 1NYFA 1N9RA 2IVWA 1JJ2S 1GL5A 3FJPA 1W1FA 4L6V5 3M54A 5FWBA 1BU1A 2F69A 4C0FA 1WFWA 3QXEB 1PG5B 1G3WA 2DE0X 2CYZB 3QWXX 2ATCB 4OVAA 1YIJA 3CCMA 1JQQA 4J9GA 5KYYB 1TUDA 4NL3A 2HKNA 3UPUA 2R57A 4F7UA 2VGNA 9ATCB 4PJOD 1IB8A 4X9DA 2F2WA 4OGCA 2RQVA 1KQSA 4MMLA 4M75C 3CMAT 2FEIA 2A0FB 2AK5A 3UWNA 2RM4A 3REBB 3A8LB 1E6HA 3I55T 4M7DB 1C0MA 3GNFB 5GANh 2DNUA 4OMQA 1I1JA 1IHWA 3FDRA 2MWOA 2YLBA 2K2MA 1YHQA 1D1BA 1UGVA 4XAXB 4N0AC 1K4US 5LL6S 5DLQE 1TG0A 3CPFA 5KCHA 2P4TA 3JB9J 1V1CA 1U1TA 3VS0A 3CC7Q 2VKNA 2RQRA 1Y57A 4M7AB 1RADB 2RI2A 3TQ7P 3L2RA 2DZ9A 3GNGA 3EHQA 4JRQA 3H9NA 1M1GA 1ZX6A 1ABQA 2K3BA 1BI1A 2COWA 2E3IA 5KYYA 2GCXA 2XDDA 4IIOA 1K1ZA 1RAIB 2E4HA 2JUFA 2E1HA 1GCPA 4F7UB 1RUWA 2QQBA 2MCNA 1OPKA 3OYNA 3L2QA 4N4HA 5IHNA 5CKFA 5L8RE 2DK3A 2O4XA 3VYHB 4XU1A 3TREA 2HKQB 1K9AA 2OAUA 5LJ5h 2H3EB 4FM4B 1SG5A 2RI5A 3DB3A 1RACB 4RG2A 3VU3C 1VIEA 1AD5A 1D3BB 2ED1A 4OMLA 1VQ6Q 3CD6A 1TSFA 1MUZA 3NHNA 2PQWA 4JJDA 3MHXA 3E1SA 2XD0A 1ZA2B 2BKDN 1SHGA 4Z88A 1D0YA 4IKFA 4BE2A 1BIBA 4J7IA 1NJIU 4RTVA 1OULA 2LX9A 3C12A 4M75F 5GANe 2Y90A 3N5BB 2RMOA 2MAMA 1UHCA 2PUKB 4X1VA 1QCOA 1R8OB 2RJDA 4HVWA 3LW5E 5CKEA 2RHUA 2KK4A 2DA9A 2OTJT 2V1QA 4RTUA 2AHJB 1Y71A 4IIMA 4RG8A 3CC2Q 3QSUA 4DOVA 3G6ET 3M9QA 2NLUA 3J81E 2MIOA 5A0DA 5CO7A 4IUPA 2DETA 4QKUA 2RJCA 4M75G 3VUZA 1AT1B 1K8AR 4FT2A 4M7DF 1H8KA 1G3TA 2LNHB 5KYUA 1PNJA 3LWHA 2QQSA 1QVFP 4M75D 2D0QB 3EH1A 2E41A 4QT7A 1MNEA 4EMGA 5HK0A 5KCOA 3X26B 4C0ZA 2F2VA 4PJOC 2K3YA 2HNIA 2E65A 1WYXA 1VQ8Q 1Q86C 3P8DA 3SWNA 1PM3A 1Y0MA 2DBMA 2WACA 4PFZA 3QJ6A 3GPLA 3EFOA 1UGQB 3VS1A 5GAOr 1AWOA 1TS9A 2RHXA 3CEYA 2JM8A 3CCEA 2JS2A 2JTMA 2HEQA 1VYUA 3JCMJ 4J9BA 3V8KA 2DKGA 1YJ9T 3OSVA 1Y7XA 4F7UF 2OJ2A 3CMEA 5CAIA 4J9FA 4YTLA 2NUTA 2XDPA 2O01E 1NG2A 2DILA 1WJQA 2DRKA 3M0RA 3KUFA 5KYNA 3LLRA 2ZGWA 2YRDA 1ZQ1A 4RUGA 4RTWA 2YSQA 1VQLT 1JO8A 3EG0A 3GF5A 1FMKA 3OYMA 2QGGA 2Z0WA 3JB9D 5EC7A 3OYKA 2F2XA 1M1KR 2J6KA 2DPPB 2EIFA 2DD5A 1VQ4Q 3CCJA 3RUXA 4DA4A 1QVPA 3SDZA 5M9OA 2VGMA 2Y4YA 1RLQC 3VJPA 4M75B 4PK4A 1D3BA 3G4SA 3H0FA 4C8QA 2V8JA 3MO8A 2GTJA 1BBZA 2M0YA 2DM1A 3OYFA 2EGAA 2EYWA 3SWNB 4FSSA 2DTOA 4KRTA 2O9VA 1X6GA 4C5HA 3MEAA 4OB0B 1AWXA 4HCKA 3EG3A 1Y96B 3OMGA 3M57A 2ENMA 2K57A 5GAMg 3PVLA 1N8RU 2COYA 3CCRQ 2K6DA 4Y28E 4M77A 1WJSA 1IGQA 1I5LA 1NEGA 2XIDA 2LRQA 2E12A 1JJ2P 1EFNA 2DBKA 4M7AC 1IGUA 1ZUYA 3E9GA 2E5KA 1XOVA 2DIQA 4FYYB 4XU2A 1CKAA 3M0UA 2AKLA 2DTIA 1MNDA 3THKA 5DY9A 1Q7YC 4RTYA 3CCRT 2VB6A 2EGEA 5IAYA 3PNWC 5GAOn 2CH4A 4M7AF 4E2FB 3VS2A 4DQ2A 1CSKA 3A5ZB 2KBTA 4AFQC 1WHGA 2V26A 2X9HA 2JZ2A 4ESRA 3X24B 4OB1B 2L3PA 3G71Q 1OOTA 2ESWA 2H3JA 3EFRA 1LVKA 3GBQA 1KC8R 2C06A 5J3BA 1VQ9T 2G3RA 4XTZA 3FJ5A 3TCJA 5FWCA 1MV3A 3META 3FLGA 3ZL7C 1G5VA 5CQXA 1M30A 3CMAA 2SRCA 1RABB 1SEMA 1D0ZA 2OTJQ 1BCOA 4M7DE 1W2BA 2F1LA 1HSQA 3QZ9B 4C92B 4PFOA 2DYIA 4ZTFA 1QW1A 1VA7A 2B8AA 2HAXA 3WVDB 1K73R 4E7ZA 2RQTA 3A1PA 4KGZB 5J26A 3CPWA 1IXDA 1KFZA 1H92A 4KBMB 4M77C 1H641 3A8OB 1M3CA 1UEBA 4QW2A 2RPNA 1OV3A 3J80E 1FXXA 4M75E 3EHRA 2RO0A 3FIFA 3G71A 2YUQA 4M7AA 2EQUA 2NUZA 2NYSA 2JTFA 2PVOB 5FRNA 5LJ5f 3X25B 4EMKB 3HHTB 1S72T 2LTOA 2X4YA 2GF7A 2BTTA 4DEYA 1OZ3A 2RNAA 4JUVA 1Q95G 4XTYA 4QVDA 3GOXA 3NMZC 4C0DB 5D7UA 2MMPA 2LQ8A 4IUVA 1M2VA 1YJWA 3OA6A 1AOJA 4NL2A 3H0IA 1YITA 4M77G 4JRKA 1K73U 1N5ZA 4QQ6A 2LDMA 4HCBA 4BDZA
chains in the Genus database with same CATH topology
4O6JA 4ZN3A 1XNIA 2WSCE 2IG0A 2QA4T 1JJ2A 4OGCA 2HQXA 1KQSA 3ZBDA 3URGA 3FC3A 4MMLA 4M75C 3CMAT 1O75A 3MEVA 4M7DA 3QHSA 3OYEA 3G7ZA 3CCQA 1X75C 3CC7T 2V8KA 3UWNA 1HK9A 4M7AD 2RM4A 3A8LB 3E9FA 2JVVA 3FRNA 2M0OA 4J6YA 4C92A 3F70A 2RD1A 3EAEA 2KAFA 3OW2A 3I55T 4M7AG 4M7DB 4PJOE 3GNFB 3DKMA 3QZ5B 5GANh 1H3ZA 3OS2A 4O5VA 2R5MA 4C8QG 1QVFA 2FVUA 3FDRA 4XU0A 2CZ6B 2MWOA 2YLBA 3RKYA 3CCMT 3CCRA 4XTXA 3E19A 1OI1A 1YHQA 2EKOA 4BY6C 3OW2S 2CGHA 4XTWA 3NTKA 3QYHB 1M1FA 2YHTA 3FB9A 4XAXB 2WSEE 4N0AC 1I4K1 3L2VA 3JB9G 3OS5A 5LL6S 2RHZA 4ZGDB 5DLQE 5I2SA 2CZ1B 4HT9A 4C8QD 2DIGA 2EWNA 3CPFA 4IURA 5KCHA 3CCSA 3JCMP 1YJNA 1VQ8T 2P4TA 2X4WA 4J7FA 3R6OA 3OS1A 4GY5A 2OTJA 2ZPEB 3JB9J 1Q81C 1LJOA 1U1TA 4C0FA 5KH6A 5J39A 3UT1A 2QQAA 4M7AB 2XG8D 5GAOp 4LD6A 2DAQA 4BDZA 2QTXA 1VQ9A 3PIPA 1KQ2A 4QVZA 1QVFS 2EAYA 2RI2A 3KXTA 5HKCA 3V8LA 1VQLA 3QPHA 5LJ3h 4B9WA 2DZ9A 5CCAA 3OY9A 3NFCA 3I55A 2M9UA 3GNGA 2JN0A 3DLLA 3VYGA 4JRQA 3V8JA 3CCUT 4LDYA 1M1GA 3TU4K 5CIUA 3MCAB 2K2VA 2D9TA 1BI1A 5CKBA 2M1HA 1KHIA 1M5Q1 3M56A 4M7DD 2GCXA 3HFNA 2XDDA 1NJIC 2JUFA 2E1HA 2VUBA 4OB2B 4JJNK 4F7UB 5FRMA 2EJ9A 1KD1C 2RB6A 5CVIA 2QQBA 1FWZA 3OYIA 1KQ1A 4M78D 1M8VA 4R55A 3JB9I 3OYNA 3LYIA 3OYAA 2DXBA 4N4HA 5CKHA 5CKFA 5L8RE 2LCLA 3BFMA 4B9XA 4LDXA 2DK3A 3CBOA 3OBWA 2O4XA 1QP3A 4WF2A 3JCMh 4A54A 1YJNT 3G4ST 3PMTA 3VYHB 1QVGS 1X01A 4XQ3A 4XU1A 3TREA 2OTLA 1GXIE 3SWNC 2OAUA 5LJ5h 4OF1A 2RK2A 5GAMe 5LJ5j 3QDRB 3CCQT 3QO3A 4NS5A 5CR2A 1LOJA 1V29B 4FM4B 4OMFB 4PJOG 3PTAA 1IZ6A 2RI5A 3DB3A 2O4XB 3JAME 5A2QE 3JCMV 4RG2A 5GMKh 1UB4A 1NZ9A 3A8MB 1Q81U 1N27A 2E10A 3KBGA 1VIEA 1D3BB 3PFSA 3VU3C 5C6SA 3CCJT 4JS5A 5LJ5d 1B34B 1NPPA 3CD6A 3C4SA 1VQKA 3ZFJA 2FYKA 5LJ3g 3G6EA 2EFIA 2RI3A 1VQ4A 2PQWA 4J6WA 4LD9K 1VQ8A 3MHXA 4M77D 4P5NA 3E1SA 1BI2A 3BDLA 2XD0A 2E5QA 1B34A 4M7DC 2EQKA 2R58A 1IREB 4MZTA 2BKDN 2X4JA 3QYGB 4JLIA 4IKFA 4BE2A 2LNVA 3CCLA 4PJOB 1BIBA 5LJ3j 3ME9A 2P0KA 3OYJA 4J7IA 1NJIU 2LX9A 5GAN5 1OZ2A 3OYLA 4RCCA 3C12A 4M75F 4IUQA 3ER0A 3M58A 3M5AA 5GANe 4CI0C 2Y90A 3N5BB 1K8AC 1VQOA 3JCMg 2K5LA 1VQ5T 2MAMA 2PUKB 2KQWA 4ME7A 4E7JA 5HK3A 2GFAA 4N4GA 5KE2A 3ASKA 1R8OB 2KMTA 2RJDA 3LW5E 3OMCA 3OSSC 2RHUA 2KK4A 4N0AA 2K4YA 1JRIA 5FU7B 2OTJT 5CKDA 1VQMA 2AHJB 3AHUA 2M16A 1Y71A 2L3RA 4C92D 2LVMA 2QDYB 2JNGA 1G3SA 2DJZA 4ELZC 4J8OA 4RG8A 3QSUA 5FROA 4DOVA 5GANf 3V7CA 2BIVA 3M9QA 2NLUA 3J81E 3G6ET 4HCZA 1PSEA 1PSFA 3S3NA 2FHDA 2RJEA 4PKCC 1VQKT 1G3YA 3A8HB 5CO7A 5A0DA 3CXCS 4IUPA 4C5IA 2DXUA 5CK9A 1U1SA 4M78F 3M4GA 5D6XA 3PIOA 5GMKe 4MDWA 5A0LA 4JRPA 2VXFA 1U8RA 2E6ZA 2EYQA 2ZPIB 1VQ7T 3OS0A 2VYTA 2HBPA 2RJCA 1W2BS 2OTLT 4M75G 3VUZA 3QIIA 4Q5WA 4FT2A 1HXDA 3H8ZA 2ZPBB 3HRTA 3L2WA 4M7DF 1G3TA 1YIJT 2YLCA 4M78B 4LDWA 4ZTJA 2QQRA 2KVQG 2XDBA 5GAN8 1YJ9A 4C0GA 4L5GA 3LWHA 4C8QB 2QQSA 2KDSA 5KE3A 4M75D 3HPWA 2D0QB 2E41A 3HP9A 4DOWA 4A4FA 5GAMd 5D6WA 4EMGA 5HK0A 1VIFA 2F5TX 3OBYA 1M9SA 5KCOA 3X26B 3JB9H 3V7SA 4JDSA 4C0ZA 2YRVA 2CKKA 1KHCA 4PJOC 2VXEA 2K3YA 2HNIA 2E65A 3WXMB 1Y96A 4JS4A 4M77F 1M4ZA 1Q86C 3P8DA 3V7RA 1I81A 4EPCA 1XQHA 3SWNA 3OYGA 4M7DG 3MEWA 4A4EA 3I56T 3JCMb 2WACA 3QJ6A 3GPLA 1UGQB 5GAOr 3JCMQ 1YITT 1KQSS 1WGSA 2RHXA 3CEYA 4M77B 1Q7YU 4VUBA 3CCEA 1WQ7A 2EJGA 1M1KC 4E47A 3L2UA 2JTMA 4C92E 2CZ7B 2P0PA 4ZGEB 3JCMJ 5I21A 3HRSA 4BACA 3V8KA 2DKGA 1SSFA 1YJ9T 3GIBA 3OSVA 4V2SA 3OYCA 3MP8A 1Y7XA 4F7UF 3CMEA 4BI3A 2HD0A 2XKOC 4C5EA 5GAN7 1JBMA 2DTHA 5CAIA 4PL6A 4C8QF 2E70A 4YTLA 1VQNA 3SFMA 1BKBA 3HKSA 4A53A 2DEQA 4E7LA 2GQVA 2XDPA 3OQ5A 4EMKC 2O01E 4ELYC 1MGQA 1X6OA 4LDUA 4IUUA 1K73C 3OYBA 5AYFA 1WJQA 5FLXE 3CBPA 3H6ZA 5LJ3e 3KUFA 5D6YA 3PT9A 3LLRA 3G71T 1UGSB 4BB7A 5GAOl 2ZGWA 4C5GA 1ZQ1A 2ZZDA 2ZCFB 3DLMA 4MZMA 1Y07A 3Q1JA 3SD4A 1VQLT 2FB7A 4CRIA 3GF5A 2Y4XA 3CBMA 5C0MA 2MF2A 4OB3B 4X34A 4MDXA 3OYMA 3JB9D 2CS7A 3CCUA 3OYKA 2XU8A 3LGLA 5IT9E 3JCMe 4A4GA 3LGFA 5FU6C 2K5IA 4C92G 5GANg 5LJ5g 2DPPB 2PVDB 4XTUA 2EIFA 2DD5A 3OYDA 3CCJA 3PGGA 4JRIA 1QVPA 3RUXA 4DA4A 3CD6T 2QXFA 3SDZA 5GAN6 5M9OA 2L8DA 2FL7A 2VGMA 4FSXA 2Y4YA 4II1A 1VQ4T 1VQPT 4LDVA 4N4IA 3VJPA 4M75B 1D3BA 4J83A 3G4SA 5HY6A 4BUGA 3HL8A 4E7HA 5GAMj 4C8QA 2V8JA 3MO8A 4XTVA 1N8RC 3OYFA 3VKIA 2ZPFB 3SWNB 3M4YA 3MP6A 5GMKl 4C8QE 3J7AF 1O9SA 1WQWA 2DTOA 2CZ0B 4C5HA 3MEAA 4OB0B 3RKXA 3L2RA 3CCLT 3RKWA 2PUOB 1N6AA 1Y96B 3C94A 3OMGA 3M57A 1Q82C 3L2ZA 2K57A 4BY6B 5GAMf 3CCST 1WNLA 5GAMg 1N8RU 3FEOA 1VQ5A 2I2LA 4PLIA 4PJOA 3MP1A 2LC4A 1BI0A 3I56A 3QJYA 2DXCA 4OGEA 4IUTA 3GP8A 3QUIA 2VC8A 2LT4A 4Y28E 1OYXA 2KSSA 3P8HA 4M77A 3HFOA 3HSBA 1FX7A 1WJSA 3A8GB 2QI2A 1Q82U 4FIBA 1I5LA 1QVGA 2JOYA 1MHNA 2XIDA 2LRQA 1KC8U 4FU6A 2E12A 3DB4A 3BY7A 3CCVT 3UDCA 1K9MC 2XI9A 4M7AC 1YBYA 1I8FA 3NTIA 5FU6B 4PNOA 3E9GA 1XOVA 4XU3A 2DIQA 1W4SA 4R56A 3CC7A 3JCMW 4E7IA 5LJ3d 4D6WA 1VQNT 2DVEA 4ZGJB 3JB9F 1M90U 1VQ7A 3NTHA 4XU2A 3T9NA 2K3XA 2DO3A 2RH2A 4PJOD 2ZPGB 2DTIA 5FU7C 5GMKm 1NE8A 5DY9A 4F7UG 1Q7YC 4ATOA 4A4KA 4EMKA 2RA2A 4J5YA 3QG1A 3CCRT 1TH7A 2RHIA 1YHQT 5GMKj 5IAYA 3RMQA 3JCMd 4M78A 1M90C 2LT1A 5GAN4 3PNWC 5GAOn 4BI8B 1YCYA 5I2MA 4M7AF 3CC2T 2BUDA 5DLOA 3LX7A 4DQ2A 5GAN2 3VV0A 2GFUA 1AHJB 2ZPHB 3A5ZB 3SB2A 3QBYA 2WSFE 2E6NA 2RHYA 3CC4T 4XK8E 1VUBA 2EQMA 2JZ2A 1RI0A 2X4XA 4M77E 3RERA 2MI6A 4FT4A 3X24B 2LCCA 1NPRA 4OB1B 3VUBA 1YI2T 3CCVA 3RMSA 4Z02A 3MEUA 3S3OA 2H3JA 3EFRA 3RESA 4Y91A 2C06A 5J3BA 1VQ9T 2D6FA 2G3RA 3JRZA 3QKJA 4F7UE 4BE1A 5GAN3 4XTZA 1KC8C 1QP2A 3S3MA 5DM7R 4M75A 3TCJA 3META 4C92F 2LQKA 3FLGA 1DJ7B 3GLXA 4BDYA 5GMKi 1WPYA 5GAOq 1G5VA 5CQXA 3CMET 3CMAA 1M1KU 1KD1U 4C92C 5CQYA 3M59A 4C8QC 1UGRB 3LH0A 4MZPA 2K5FA 2PU9B 3LWIA 1W2BA 4M7DE 5IN1A 4J6XA 5A0GA 1UGPB 4C0DC 3QZ9B 3RIRA 4C92B 2EJFA 4HT8A 2XK0A 2X35A 3L1AA 4M78E 1EIFA 2VV5A 4ZTFA 3CCET 1BYMA 1QW1A 1S72A 1VQMT 2QQ9A 2B8AA 2E64A 3PMIA 4KUDK 2L89A 2HAXA 5LJ3f 3WVDB 2QEXT 4FL6A 2L5QA 3M55A 3WVEB 3ZEHA 2DZCA 2RJFA 5GANd 4NOYA 2DXTA 4GLKA 5J26A 1YJWT 4A4HA 3CPWA 4OP0A 3O8VA 1XTDA 4KBMB 1WJRA 3BDUA 4M77C 4MMKA 1P92A 1H641 2A3LA 2R5AA 3A8OB 3EFSA 3OB9A 4EDUA 1UEBA 2KY9A 4JLGA 4M7AE 1VQOT 4KULA 2MWPA 4QW2A 5GANj 3J80E 4PLLA 1BI3A 1FXXA 3L42A 4M75E 3JCMX 1RL2A 3HRUA 4RMOA 3CXCA 5GAMh 1VQ6A 2RO0A 4X9CA 1LNXA 3FIFA 3G71A 3CC4A 4M7AA 3X20B 2EQUA 4EMHA 4M78G 3C95A 3X28B 3JCMf 4ZN1A 2RK1A 1Q86U 2QA4A 4HA8A 1YI2A 1JB0E 2JTFA 2PVOB 5FRNA 5LJ5f 4E7KA 3TEEA 1ZBXA 3JCMc 3X25B 4EMKB 1N9RA 4TVRA 2XHCA 3P8BB 4UC4A 5GAOm 2A7YA 2IVWA 3HHTB 3INZA 4KT0E 4L59A 4QQDA 1VQPA 1S72T 4RCBA 3FJPA 1K8AU 1JJ2S 2PVGB 2LTOA 4L6V5 2X4YA 2GF7A 1K9MU 3CPWS 4BD3A 1ZHIA 1KG1A 1OZ3A 3M54A 3CC2A 2QEXA 1N9SA 2F69A 2EQJA 4RKUE 3S6WA 4JUVA 3QXEB 2F5KA 1G3WA 3OYYA 2CYZB 4M78C 4XTYA 3BW1A 4PJOF 4HKEA 4QVDA 5LJ5e 4OVAA 4C0DB 3GOXA 1YIJA 2MMPA 3OYHA 2LQ8A 2XICA 4IUVA 3CCMA 3OA6A 1YJWA 2DD4A 2HQEA 2P0QA 1BIAA 5CKEA 3L2QA 4BI4A 4NL3A 2V8IA 3UPUA 4NL2A 1YITA 2R57A 4F7UA 2VGNA 4BE0A 4M77G 4QVCA 1VQ6T 4QQGA 5EG2A 4KUIA 4HCCA 3JSCA 4JRKA 1K73U 4QQ6A 2LDMA 3M53A 4HCBA 4X9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB2 A;  5LJ3 e;  4JLI A;  4M77 E;  5GAO l;  3RER A;  2ZGW A;  4PJO B;  1BIB A;  5LJ3 j;  4MML A;  4M75 C;  4M7D A;  3QHS A;  2FB7 A;  5GAN 5;  4RCC A;  3EFR A;  4M75 F;  3RES A;  4Y91 A;  1HK9 A;  3JB9 D;  5GAN e;  4F7U E;  4M7A D;  2RM4 A;  2Y90 A;  5GAN 3;  4XTZ A;  3JCM g;  4J6Y A;  3JCM e;  4C92 A;  2RD1 A;  4M75 A;  4M7A G;  4C92 G;  4PJO E;  4M7D B;  5GAN g;  5LJ5 g;  5GAN h;  4N0A A;  4XTU A;  4C92 F;  4C8Q G;  1JRI A;  4XU0 A;  3RKY A;  2YLB A;  5GMK i;  1WPY A;  5GAO q;  3AHU A;  4XTX A;  3PGG A;  4JRI A;  3RUX A;  4C92 D;  4C92 C;  2DJZ A;  4C8Q C;  2CGH A;  4XTW A;  5GAN 6;  3QSU A;  2YHT A;  3FB9 A;  3V7C A;  4N0A C;  5GAN f;  1I4K 1;  4M7D E;  3JB9 G;  4J6X A;  3RIR A;  4C92 B;  4M75 B;  2EJF A;  1D3B A;  4HT9 A;  4C8Q D;  4HT8 A;  2DXU A;  2EWN A;  3L1A A;  1U1S A;  4M78 E;  3M4G A;  4M78 F;  4C8Q A;  5GMK e;  5GAM j;  3JCM P;  2VXF A;  4XTV A;  4M75 G;  3SWN B;  5GMK l;  3JB9 J;  4C8Q E;  2E64 A;  1LJO A;  1U1T A;  4M7D F;  1HXD A;  5LJ3 f;  1WQW A;  2DTO A;  2DZC A;  4M7A B;  3RKX A;  2YLC A;  5GAN d;  5GAO p;  4M78 B;  2DXT A;  4NOY A;  2QTX A;  3RKW A;  1KQ2 A;  1Y96 B;  2EAY A;  3L2Z A;  4OP0 A;  5GAN 8;  3V8L A;  2K57 A;  4C8Q B;  5GAM f;  4PJO A;  1WNL A;  5LJ3 h;  2DZ9 A;  4M75 D;  3BDU A;  2I2L A;  4M77 C;  4MMK A;  5GAM g;  1H64 1;  2E41 A;  2JN0 A;  3EFS A;  5GAM d;  3V8J A;  4EMG A;  4M7A E;  5GAN j;  3QUI A;  2VC8 A;  3V7S A;  3JCM X;  4M75 E;  3JB9 H;  1M5Q 1;  5GAM h;  4M7D D;  4X9C A;  3HFN A;  4PJO C;  1LNX A;  3FIF A;  2VXE A;  4M77 A;  4M7A A;  2HNI A;  4EMH A;  2E1H A;  2E65 A;  3HFO A;  4M78 G;  4F7U B;  3HSB A;  2EJ9 A;  3JCM f;  1Y96 A;  2RB6 A;  1I5L A;  4M77 F;  1KQ1 A;  4M78 D;  4HA8 A;  1M8V A;  3V7R A;  1I81 A;  3JB9 I;  3SWN A;  3BY7 A;  5LJ5 f;  4M7D G;  4EMK B;  3JCM c;  4M7A C;  3BFM A;  1N9R A;  1I8F A;  3JCM b;  5GAO m;  4PNO A;  3INZ A;  3JCM h;  4WF2 A;  4XU3 A;  4RCB A;  3FJP A;  4A54 A;  3JCM W;  5GAO r;  3JCM Q;  5LJ3 d;  1X01 A;  4XQ3 A;  2DVE A;  4XU1 A;  3JB9 F;  4M77 B;  3SWN C;  5LJ5 h;  1WQ7 A;  2EJG A;  5GAM e;  4XU2 A;  5LJ5 j;  1N9S A;  3QO3 A;  1LOJ A;  4C92 E;  4JUV A;  4PJO G;  2DTI A;  5GMK m;  4M78 C;  4XTY A;  3JCM V;  5DY9 A;  5I21 A;  3JCM J;  3BW1 A;  4PJO F;  4F7U G;  4QVD A;  5GMK h;  3V8K A;  2DKG A;  5LJ5 e;  3GIB A;  4EMK A;  2E10 A;  3VU3 C;  4V2S A;  2RA2 A;  1D3B B;  4J5Y A;  4F7U F;  1TH7 A;  1BIA A;  5LJ5 d;  1B34 B;  5GAN 7;  1JBM A;  2DTH A;  4NL3 A;  5CAI A;  5GMK j;  3JCM d;  4M78 A;  4NL2 A;  4C8Q F;  2FYK A;  5LJ3 g;  4F7U A;  4M77 G;  4QVC A;  5GAN 4;  4A53 A;  5GAO n;  1YCY A;  2DEQ A;  4J6W A;  4M7A F;  4EMK C;  4DQ2 A;  4JRK A;  5GAN 2;  1MGQ A;  4M77 D;  4PJO D;  4M7D C;  1B34 A;  4X9D A; 
#chains in the Genus database with same CATH topology
 4O6J A;  2ECZ A;  2HDA A;  3URG A;  4R0K A;  4M7D A;  5HCK A;  3CMA Q;  3I35 A;  2BZY A;  4M7A G;  3DKM A;  2P4R A;  1H3Z A;  3OS2 A;  2CZ6 B;  2QGF B;  4XTX A;  4D8K A;  2OAW A;  1PD1 A;  4XTW A;  3L2V A;  2JMA A;  1I4K 1;  3OS5 A;  2EWN A;  2JTE A;  3CCS A;  1UEC A;  4J7F A;  3R6O A;  3OS1 A;  2OTJ A;  2ZPE B;  2X3X D;  2DYB A;  1LJO A;  1AEY A;  5J39 A;  3UT1 A;  1PC0 A;  2CP7 A;  1KQ2 A;  3OY9 A;  3NFC A;  2M9U A;  2JN0 A;  5CIU A;  2M51 A;  2D9T A;  2M1H A;  3M56 A;  3HFN A;  1KD1 C;  5CVI A;  4M78 D;  3I5S A;  2LJ1 A;  2J06 A;  4WF2 A;  2DX1 A;  1QVG S;  2OTL A;  1IO6 A;  5LJ5 j;  2RK2 A;  2GBQ A;  1OX8 A;  3QO3 A;  1V29 B;  1LOJ A;  2B86 A;  2C0O A;  1VQN Q;  4AMC A;  2O4X B;  5KYW A;  1R0C B;  5A2Q E;  5GMK h;  2K7A A;  2E10 A;  3KBG A;  5C6S A;  5LJ5 d;  1NPP A;  3G6E A;  2EFI A;  2RI3 A;  2KRN A;  2AZS A;  1RAH B;  2FG0 A;  1YHQ Q;  4P5N A;  4DBR A;  4M7D C;  1QLY A;  1B34 A;  2E5Q A;  1TWB A;  2OI3 A;  3VS3 A;  2LNV A;  3ME9 A;  1PCX A;  2P0K A;  1WZO A;  2GNC A;  5GAN 5;  1OZ2 A;  3ER0 A;  3M58 A;  1NYG A;  1VQO A;  3JCM g;  1SRL A;  1VQ5 T;  1YJ9 Q;  2KQW A;  4E7J A;  4N4G A;  3OSS C;  1JRI A;  5FU7 B;  1QWE A;  3AHU A;  2L3R A;  4C92 D;  3PE0 A;  3JV3 A;  1G3S A;  4ELZ C;  5IHK A;  5FRO A;  5GAN f;  4HCZ A;  1PSF A;  2RJE A;  1VQK T;  4PKC C;  4CC4 B;  1G3Y A;  3A8H B;  1OU8 A;  1U1S A;  4HVU A;  3PIO A;  5A0L A;  2OTL T;  3OS0 A;  2VYT A;  1W2B S;  1X2K A;  5KYU B;  2HL5 C;  3L2W A;  1HXD A;  3H8Z A;  1R0B G;  1SKU B;  1YIJ T;  4M78 B;  5GAN 8;  1YJ9 A;  4C0G A;  2VVK A;  2KDS A;  3VS5 A;  3HP9 A;  4WCI A;  4DOW A;  2ROL A;  5D6W A;  2F5T X;  3OBY A;  3EGD A;  1ABO A;  1EZZ B;  4JDS A;  2CKK A;  4ANJ A;  1Y96 A;  4JS4 A;  1FMW A;  1XQH A;  1KSW A;  2KRM A;  4M7D G;  1RAG B;  4A4E A;  2C0T A;  3JCM Q;  4M77 B;  1Q7Y U;  4VUB A;  4Z8A A;  2EJG A;  2EYX A;  4E47 A;  3L2U A;  2KXC A;  1I0C A;  4C92 E;  1X69 A;  1ZSZ B;  3EG1 A;  4BAC A;  2VWF A;  4GBQ A;  2XKO C;  1KD1 R;  2M02 A;  4PL6 A;  2E70 A;  4EIK A;  1Q81 R;  1BKB A;  2CP2 A;  4E7L A;  2GQV A;  1G2B A;  4EMK C;  1LCK A;  1X6O A;  4LDU A;  3OYB A;  5FLX E;  3PT9 A;  1UGS B;  2HL3 A;  2KNB B;  4C5G A;  1QKX A;  2ZCF B;  4PJN A;  3Q1J A;  4CRI A;  2Y4X A;  4OB3 B;  4X34 A;  4FCY A;  2XU8 A;  1YCS B;  3REA B;  4A4G A;  5FU6 C;  3RDV A;  5LJ5 g;  1U5S A;  2O31 A;  1I07 A;  1AWW A;  4FYV B;  1T0H A;  3OYD A;  3PGG A;  4JRI A;  1VQP Q;  4J9D A;  2FZG B;  2LJ0 A;  4FW2 A;  4II1 A;  4Z89 A;  1VQ4 T;  1BCM A;  5HY6 A;  4E7H A;  1N8R C;  3MP6 A;  2FZK B;  1WHH A;  2GGR A;  3J7A F;  2QAZ A;  1YIT Q;  2CP3 A;  6AT1 B;  3CCL T;  3RKW A;  1N6A A;  2AT1 B;  1Q82 C;  3L2Z A;  5GAM f;  2IIM A;  1ZSZ A;  3MP1 A;  3I56 A;  2CDT A;  2DXC A;  2HBW A;  4OGE A;  3G1J A;  3GP8 A;  3QUI A;  2LT4 A;  2VC8 A;  1OYX A;  5IXB A;  3HFO A;  1FX7 A;  3A8G B;  1RAF B;  2BZ8 A;  1VYV A;  3CQT A;  3NTI A;  2BE7 D;  4AG2 C;  5LJ3 d;  4M4Z A;  3JB9 F;  4ZGJ B;  1XJW B;  1VQ7 A;  3NTH A;  1WHL A;  2RH2 A;  2ZPG B;  5GMK m;  1NE8 A;  3CPW P;  4F7U G;  2V1R A;  1QKW A;  1YHQ T;  1GFD A;  1FYN A;  3JCM d;  1TXQ A;  1ZLM A;  4M78 A;  4BI8 B;  5I2M A;  5DLO A;  2ZPH B;  2E6N A;  2RHY A;  3VS4 A;  1VQL Q;  1VUB A;  4OMN A;  1RI0 A;  3RER A;  2O9S A;  3VUB A;  1YI2 T;  3RMS A;  2ED0 A;  2A36 A;  3ULR B;  2D6F A;  4LNP A;  2DF6 A;  2K79 A;  3CME Q;  4C92 F;  5GAO q;  4C92 C;  4MZP A;  1TUG B;  2PU9 B;  5A0G A;  3RIR A;  2EJF A;  1K76 A;  2XK0 A;  2X35 A;  8ATC B;  2QYZ A;  1JXO A;  1EIF A;  3CCE T;  1BYM A;  3MKD A;  2LZ6 B;  2CRE A;  1S72 A;  2LX7 A;  2L89 A;  2HSE B;  3H0H A;  1E6G A;  3WVE B;  4J9C A;  2RJF A;  4GLK A;  4AFU C;  1YJW T;  3O8V A;  1P92 A;  3TSZ A;  2A3L A;  3OB9 A;  2KY9 A;  2DFU A;  4JLG A;  3L42 A;  3JCM X;  2YRC A;  4DBH A;  5GAM h;  1LNX A;  3CCU Q;  3C95 A;  5ECA A;  3JCM f;  4HA8 A;  4LXC A;  1YI2 A;  3OYA A;  2A37 A;  1SRM A;  5GJW B;  4UC4 A;  5GAO m;  1VQP A;  4L59 A;  3INZ A;  4RCB A;  3VS7 A;  3VRZ A;  1Q82 R;  1K9M U;  3AT1 B;  1CKB A;  1KG1 A;  1M2V B;  3CC2 A;  2EQJ A;  5GJV B;  1PHT A;  3CCS Q;  4M78 C;  2CP5 A;  4OMO A;  5LJ5 e;  4PJO F;  2PTK A;  1YFN A;  1F1B B;  1BIA A;  1WLP B;  1VQ6 T;  3CC4 Q;  5EG2 A;  4KUI A;  4AG1 C;  3JSC A;  4F04 B;  4A4F A;  3M53 A;  3C0C A;  1XNI A;  2WSC E;  2IG0 A;  1JJ2 A;  1NBE B;  2AKK A;  1VYT A;  2OTL Q;  3M0P A;  1GBQ A;  3FC3 A;  1TU0 B;  3MEV A;  3OYE A;  3G7Z A;  3CCQ A;  1X75 C;  3CC7 T;  2V8K A;  1HK9 A;  1Q86 R;  2JVV A;  4J6Y A;  1V76 A;  1AZG B;  3EAE A;  3U23 A;  2KAF A;  4C92 A;  4PJO E;  3QZ5 B;  1S1N A;  4O5V A;  1QVF A;  4XU0 A;  3RKY A;  4Y92 A;  1WA7 A;  3E19 A;  2EKO A;  3OW2 S;  2CGH A;  3NTK A;  2YHT A;  2WSE E;  3JB9 G;  5IXF A;  4ZGD B;  5I2S A;  2JT4 A;  2KRO A;  3RNJ A;  1ZUU A;  2J05 A;  1X27 A;  5KH6 A;  2XG8 D;  5GAO p;  2EBP A;  4QVZ A;  1QVF S;  2EAY A;  2QK0 A;  2MPX C;  5HKC A;  3KXT A;  5LJ3 h;  5CCA A;  1AZE A;  3DLL A;  2YWW A;  3UAT A;  3VYG A;  3CCU T;  4LDY A;  4AFS C;  2RN8 A;  1QVG P;  1KHI A;  1M5Q 1;  1FMV A;  1RI9 A;  1NJI C;  1ZUK A;  1VQO Q;  2VUB A;  5FRM A;  2EJ9 A;  2JMC A;  2RB6 A;  3OYI A;  1KQ1 A;  2JS0 A;  1YJN Q;  5CKH A;  2LCL A;  3BFM A;  3CBO A;  2JXB A;  2QTV A;  3JCM h;  1YJN T;  4A54 A;  3PMT A;  3A98 A;  1GXI E;  3SWN C;  3O5Z A;  4OF1 A;  5IH2 A;  3QDR B;  5CR2 A;  1KK7 A;  1IZ6 A;  5KYX A;  3JAM E;  3JCM V;  2CT3 A;  1VQ5 Q;  3D7S B;  4JS5 A;  3CCJ T;  1B34 B;  1HYO A;  3C4S A;  1VQK A;  5LJ3 g;  2YUO A;  3RR6 A;  4KH1 B;  4M77 D;  2DL4 A;  3BDL A;  1M3A A;  2R58 A;  2X4J A;  2W10 A;  3QYG B;  2DEU A;  1PKT A;  3CCL A;  4PJO B;  2FRW A;  1OX9 A;  3OYL A;  4RCC A;  2FO0 A;  4ME7 A;  2D8J A;  5HK3 A;  1R77 A;  5KE2 A;  4N0A A;  3ASK A;  3OMC A;  2LMJ A;  2H8H A;  2K4Y A;  5CKD A;  1RLP C;  1VQM A;  3I9Q A;  3I55 Q;  4F17 A;  2JNG A;  2RQU A;  4J8O A;  1UHF A;  4JPB W;  1E7O A;  2QDL A;  2FHD A;  2DXU A;  2CUB A;  1WXU A;  4M78 F;  2J6O A;  3M4G A;  4HVV A;  5GMK e;  1VQ7 T;  1QCF A;  2E6Z A;  2ZPI B;  2HBP A;  2PNI A;  1Q7Y R;  2VAS A;  4Q5W A;  2DJQ A;  2DL3 A;  2ZPB B;  2YLC A;  2D1X A;  1M27 C;  2QQR A;  2KVQ G;  4KH0 B;  2ROT A;  5KYX B;  5GAM d;  3OW2 P;  1VIF A;  1U3O A;  3JB9 H;  3V7S A;  1KHC A;  4F14 A;  2VXE A;  4M77 F;  1M4Z A;  1G8X A;  1Z9Q A;  3V7R A;  3MEW A;  1GFC A;  3JCM b;  3I56 T;  2GQI A;  1HJD A;  1MMA A;  1WGS A;  4DEX A;  1YWP A;  2CZ7 B;  4B6M A;  3SHW A;  4ZGE B;  5I21 A;  4LUE A;  1EX4 A;  2HSP A;  1SSF A;  2JM9 A;  4V2S A;  3OYC A;  3MP8 A;  1UTI A;  2NUP A;  4C5E A;  4C8Q F;  2DVJ A;  3HKS A;  2KRS A;  2DEQ A;  4A53 A;  1UE9 A;  2L3Q A;  1MGQ A;  1K73 C;  3H6Z A;  5LJ3 e;  5GAO l;  2ABL A;  3EG9 B;  4PFP A;  1Y07 A;  4J9E A;  2FB7 A;  1M3B A;  3CBM A;  2MF2 A;  4MDX A;  1WXT A;  1GRI A;  5AT1 B;  3I5R A;  3JCM e;  4C92 G;  3VRY A;  2KT8 A;  1SPK A;  2PVD B;  4XTU A;  1PD0 A;  1ACM B;  2KEA A;  4WTO B;  4GLM A;  3CD6 T;  1LPL A;  4CC7 A;  2FL7 A;  4FSX A;  1BB9 A;  1VQP T;  4LDV A;  3HL8 A;  4XTV A;  2ZPF B;  3M4Y A;  5GMK l;  1WI7 A;  4FYX B;  1NJI R;  1B7T A;  1X2Q A;  1U06 A;  3CCS T;  4PJO A;  2LC4 A;  1BI0 A;  2DL7 A;  3QJY A;  2EGC A;  4IUT A;  1T0J A;  2NUP B;  1WIE A;  2KSS A;  1RAE B;  3HSB A;  1N8R R;  1Q82 U;  4FIB A;  2EYY A;  2JOY A;  1QVG A;  1MHN A;  2LQW A;  4AT1 B;  1KC8 U;  3CCE Q;  4FU6 A;  1K9M C;  2XI9 A;  1I8F A;  3R6N A;  4R56 A;  1D09 B;  3JCM W;  2D8H A;  4D6W A;  1VQN T;  1M90 U;  1MV0 B;  3T9N A;  4K11 A;  1WHK A;  3EG2 A;  4ATO A;  4FYW B;  4A4K A;  2RA2 A;  1TH7 A;  4OMM A;  5GMK j;  3RBB B;  3RMQ A;  2LT1 A;  2MYS A;  1MMN A;  3CC2 T;  1KQS P;  3LX7 A;  5GAN 2;  3VV0 A;  1AHJ B;  1QCN A;  3MPU B;  1IRX A;  1OEB A;  4M77 E;  1SF9 A;  4FT4 A;  2LCC A;  3CCV A;  4Z02 A;  3MEU A;  3RES A;  3UF4 A;  3QKJ A;  4F7U E;  4BE1 A;  5GAN 3;  1KC8 C;  1WXB A;  3S3M A;  2FPE A;  1VQ9 Q;  2LQK A;  1JEG A;  1C1A A;  4BDY A;  1WPY A;  3CME T;  1M1K U;  1KD1 U;  2FZC B;  5CQY A;  3M59 A;  4C8Q C;  1UGR B;  3LH0 A;  2P84 A;  2CSQ A;  2K5F A;  3LWI A;  5IN1 A;  1UFF A;  4C0D C;  1KJW A;  3MJX A;  4HT8 A;  2KYB A;  1NEB A;  3L1A A;  4M78 E;  3M0S A;  5KYW B;  2E64 A;  5LJ3 f;  4FL6 A;  3G4S Q;  4NOY A;  2DXT A;  4A4H A;  3TSW A;  1MMG A;  2LP5 A;  4OP0 A;  1XTD A;  1YWO A;  1WJR A;  2KI7 A;  2R5A A;  3EFS A;  4EDU A;  1H3H A;  2CP6 A;  4M7A E;  2MWP A;  4PLL A;  1BI3 A;  4RMO A;  1VQ6 A;  5I11 A;  1M2O A;  4X9C A;  2J6F A;  4EMH A;  4CC3 A;  1QMC A;  1BK2 A;  2AIR B;  2RK1 A;  4ZN1 A;  1Q86 U;  8AT1 B;  1JB0 E;  2KXD A;  3M0Q A;  3TEE A;  1ZBX A;  3JCM c;  1UDL A;  3CCQ T;  4TVR A;  1OQK A;  2XHC A;  3P8B B;  1M1K C;  1QWF A;  2A7Y A;  4KT0 E;  4QQD A;  1SSH A;  2DLP A;  1K8A U;  2IPO B;  2PVG B;  3IQL A;  3CPW S;  4BD3 A;  1ZHI A;  2QEX A;  3S6W A;  1N9S A;  4RKU E;  2I0N A;  3EH2 A;  2F5K A;  3OYY A;  3BW1 A;  4HXJ A;  4HKE A;  3OYH A;  2XIC A;  5IHI A;  2DD4 A;  1W6X A;  2HQE A;  2P0Q A;  4BI4 A;  2MOX A;  2V8I A;  2YUP A;  4BE0 A;  3H41 A;  4QVC A;  4QQG A;  4HCC A;  2FPF A;  1W2B P;  4PJM A;  4ZN3 A;  3CXC P;  2EPD A;  2QA4 T;  3I56 Q;  2CUD A;  1UG1 A;  2HQX A;  2L3S A;  3ZBD A;  1O75 A;  3QHS A;  2W0Z A;  2LJ3 A;  2L0A A;  2QEX Q;  4M7A D;  3E9F A;  3FRN A;  2M0O A;  3CCL Q;  3F70 A;  2RD1 A;  3OW2 A;  1M90 R;  1I5O B;  2R5M A;  4C8Q G;  3HTR A;  2FVU A;  1WHM A;  2J7I A;  3CCM T;  3CCR A;  1OI1 A;  4BY6 C;  3QYH B;  1M1F A;  3FB9 A;  1PKS A;  1AVZ C;  2RHZ A;  2CZ1 B;  4HT9 A;  4C8Q D;  2DIG A;  4IUR A;  3JCM P;  1YJN A;  1VQ8 T;  1YP5 A;  4RTT A;  1IHV A;  2X4W A;  4GY5 A;  2HCK A;  1Q81 C;  1WHJ A;  2EKH A;  2HQH A;  2EW3 A;  2QQA A;  4LE9 A;  4LD6 A;  2DAQ A;  2QTX A;  1VQ9 A;  3PIP A;  4DBF A;  3V8L A;  1VQL A;  2HMA A;  3QPH A;  4AFZ C;  4B9W A;  2BE9 B;  2CT4 A;  3UA6 A;  2DL8 A;  2YT6 A;  3I55 A;  1KIK A;  1NLO C;  3V8J A;  3TU4 K;  3CCJ Q;  3MCA B;  2K2V A;  5CKB A;  4M7D D;  1QQJ A;  4DBQ A;  4OB2 B;  4JJN K;  1JU5 C;  5FW9 A;  1FWZ A;  1D1A A;  1M8V A;  4R55 A;  1T3L A;  3JB9 I;  3LYI A;  2DXB A;  4B9X A;  4JJB A;  4LDX A;  4E6R A;  7AT1 B;  5L23 A;  4ORZ A;  4KGV B;  3OBW A;  1QP3 A;  3G4S T;  2XMF A;  1X01 A;  4XQ3 A;  4CC2 A;  2X51 A;  5GAM e;  4NS5 A;  3PTA A;  4OMF B;  1D0X A;  4PJO G;  2EQI A;  1UB4 A;  1NZ9 A;  3A8M B;  1Q81 U;  1N27 A;  3PFS A;  3ZFJ A;  4E7S A;  2E3H A;  2FYK A;  4D8D A;  1VQ4 A;  4J6W A;  4LD9 K;  1VQ8 A;  1BI2 A;  2QG9 B;  1UUE A;  2EQK A;  1IRE B;  4MZT A;  2KT1 A;  3LH5 A;  4JLI A;  2YDL A;  1VOM A;  5LJ3 j;  1X6B A;  3OYJ A;  1MMD A;  1YN8 A;  1C6V X;  4IUQ A;  3M5A A;  4CI0 C;  2EYZ A;  1K8A C;  4PJJ A;  2K5L A;  2QAS A;  2GFA A;  2KMT A;  4RTX A;  3EG9 A;  1NM7 A;  2M16 A;  2LVM A;  2QDY B;  2DJZ A;  3V7C A;  2BIV A;  3S3N A;  1PSE A;  1VQ7 Q;  2SEM A;  3CXC S;  4RTZ A;  3KFV A;  4C5I A;  4F16 A;  5CK9 A;  5D6X A;  4JRP A;  1U8R A;  4MDW A;  1TOV A;  2RF0 A;  2VXF A;  2EYQ A;  3BE3 A;  3SEM A;  2DMO A;  3QII A;  2MK5 A;  3HRT A;  1D1C A;  4ZTJ A;  4LDW A;  4JJC A;  1K0S A;  2XDB A;  1M8M A;  4L5G A;  4C8Q B;  5KE3 A;  2CP0 A;  3HPW A;  2CSI A;  3CCM Q;  2JW4 A;  1M9S A;  4JZ3 A;  2YRV A;  1VQK Q;  3WXM B;  2DRM A;  1I81 A;  4EPC A;  3EGU A;  3OYG A;  4A63 B;  1YIT T;  1KQS S;  3CCQ Q;  1WQ7 A;  2LQN A;  4J9I A;  3QDF A;  2P0P A;  2YUN A;  3HRS A;  3GIB A;  4BI3 A;  3UA7 A;  2YXY A;  2HD0 A;  5GAN 7;  1JBM A;  2DTH A;  4J9H A;  2HZY A;  1VQN A;  3SFM A;  3M0T A;  1TUC A;  3OQ5 A;  4ELY C;  4IUU A;  4KGX B;  5AYF A;  2A28 A;  2KGT A;  3CBP A;  1ARK A;  3EGX A;  5D6Y A;  1B3Q A;  1YNZ A;  2DL5 A;  3G71 T;  1GCQ C;  4BB7 A;  2ZZD A;  3DLM A;  1UJ0 A;  4MZM A;  3SD4 A;  2KR3 A;  2X3W D;  2KE9 A;  5C0M A;  1WDX A;  3VS6 A;  2CS7 A;  3CCU A;  2KYM A;  3LGL A;  5IT9 E;  1PRL C;  3LGF A;  2K5I A;  5GAN g;  2LCS A;  3TVT A;  2QXF A;  2A08 A;  5GAN 6;  2L8D A;  3EGD B;  3NGP A;  1PWT A;  1ZSG A;  4N4I A;  1VQM Q;  2ZAE A;  4J83 A;  4BUG A;  5GAM j;  2FPD A;  4FW1 A;  1YI2 Q;  3VKI A;  1OPL A;  4C8Q E;  4OMP A;  1O9S A;  1WQW A;  2CZ0 B;  1UJY A;  3RKX A;  2PUO B;  3C94 A;  3NPF A;  1PRM C;  4BY6 B;  1WNL A;  3FEO A;  1VQ5 A;  2I2L A;  4PLI A;  3CD6 Q;  1A0N B;  3EFO B;  3G6E Q;  2EVR A;  3P8H A;  1AWJ A;  2QI2 A;  1S72 Q;  3DB4 A;  3CCV T;  3BY7 A;  3UDC A;  1YBY A;  5FU6 B;  4PNO A;  4XU3 A;  1W4S A;  3CCV Q;  3CC7 A;  4E7I A;  1YIJ Q;  2AZV A;  2DVE A;  2NUT B;  2K3X A;  2DO3 A;  2RQW A;  1K0X A;  1GBR A;  5FU7 C;  2NWM A;  3QWY A;  4EMK A;  1WX6 A;  4J5Y A;  3QG1 A;  2RHI A;  2G6F X;  2O88 A;  1RAA B;  1M90 C;  1SHF A;  5GAN 4;  1GCQ A;  1YCY A;  2BUD A;  2QA4 Q;  2GFU A;  3SB2 A;  3QBY A;  2WSF E;  3CC4 T;  4XK8 E;  2FRY A;  2GTO A;  2EQM A;  1ZBJ A;  2X4X A;  1W70 A;  2MI6 A;  1NPR A;  2D0N A;  2COZ A;  3S3O A;  1TTH B;  1OU9 A;  4Y91 A;  3JRZ A;  1QP2 A;  3E2U A;  5DM7 R;  4M75 A;  1Z9Z A;  1DJ7 B;  3GLX A;  2DER A;  5GMK i;  4J6X A;  2K9G A;  1UGP B;  1ZA1 B;  1NLP C;  4JZ4 A;  2L2P A;  1B07 A;  2C0I A;  2VV5 A;  4LN2 A;  2OX7 A;  1VQM T;  2QQ9 A;  2PZ1 A;  3PMI A;  4KUD K;  1ZSZ C;  2QEX T;  2L5Q A;  3M55 A;  1T3S A;  3ZEH A;  2DZC A;  1X43 A;  5GAN d;  1G83 A;  3EGX B;  5I22 A;  4ZNX A;  3BDU A;  4MMK A;  2BZX A;  3PVQ A;  1YJW Q;  1VQO T;  4KUL A;  5GAN j;  2JJ9 A;  1RL2 A;  3HRU A;  3CXC A;  3CC4 A;  4PJL A;  1JXM A;  3X20 B;  2CH4 W;  2O2O A;  4M78 G;  3X28 B;  1K9M R;  2QA4 A;  4LUD A;  4E7K A;  1HD3 A;  1J3T A;  1NYF A;  1N9R A;  2IVW A;  1JJ2 S;  1GL5 A;  3FJP A;  1W1F A;  4L6V 5;  3M54 A;  5FWB A;  1BU1 A;  2F69 A;  4C0F A;  1WFW A;  3QXE B;  1PG5 B;  1G3W A;  2DE0 X;  2CYZ B;  3QWX X;  2ATC B;  4OVA A;  1YIJ A;  3CCM A;  1JQQ A;  4J9G A;  5KYY B;  1TUD A;  4NL3 A;  2HKN A;  3UPU A;  2R57 A;  4F7U A;  2VGN A;  9ATC B;  4PJO D;  1IB8 A;  4X9D A;  2F2W A;  4OGC A;  2RQV A;  1KQS A;  4MML A;  4M75 C;  3CMA T;  2FEI A;  2A0F B;  2AK5 A;  3UWN A;  2RM4 A;  3REB B;  3A8L B;  1E6H A;  3I55 T;  4M7D B;  1C0M A;  3GNF B;  5GAN h;  2DNU A;  4OMQ A;  1I1J A;  1IHW A;  3FDR A;  2MWO A;  2YLB A;  2K2M A;  1YHQ A;  1D1B A;  1UGV A;  4XAX B;  4N0A C;  1K4U S;  5LL6 S;  5DLQ E;  1TG0 A;  3CPF A;  5KCH A;  2P4T A;  3JB9 J;  1V1C A;  1U1T A;  3VS0 A;  3CC7 Q;  2VKN A;  2RQR A;  1Y57 A;  4M7A B;  1RAD B;  2RI2 A;  3TQ7 P;  3L2R A;  2DZ9 A;  3GNG A;  3EHQ A;  4JRQ A;  3H9N A;  1M1G A;  1ZX6 A;  1ABQ A;  2K3B A;  1BI1 A;  2COW A;  2E3I A;  5KYY A;  2GCX A;  2XDD A;  4IIO A;  1K1Z A;  1RAI B;  2E4H A;  2JUF A;  2E1H A;  1GCP A;  4F7U B;  1RUW A;  2QQB A;  2MCN A;  1OPK A;  3OYN A;  3L2Q A;  4N4H A;  5IHN A;  5CKF A;  5L8R E;  2DK3 A;  2O4X A;  3VYH B;  4XU1 A;  3TRE A;  2HKQ B;  1K9A A;  2OAU A;  5LJ5 h;  2H3E B;  4FM4 B;  1SG5 A;  2RI5 A;  3DB3 A;  1RAC B;  4RG2 A;  3VU3 C;  1VIE A;  1AD5 A;  1D3B B;  2ED1 A;  4OML A;  1VQ6 Q;  3CD6 A;  1TSF A;  1MUZ A;  3NHN A;  2PQW A;  4JJD A;  3MHX A;  3E1S A;  2XD0 A;  1ZA2 B;  2BKD N;  1SHG A;  4Z88 A;  1D0Y A;  4IKF A;  4BE2 A;  1BIB A;  4J7I A;  1NJI U;  4RTV A;  1OUL A;  2LX9 A;  3C12 A;  4M75 F;  5GAN e;  2Y90 A;  3N5B B;  2RMO A;  2MAM A;  1UHC A;  2PUK B;  4X1V A;  1QCO A;  1R8O B;  2RJD A;  4HVW A;  3LW5 E;  5CKE A;  2RHU A;  2KK4 A;  2DA9 A;  2OTJ T;  2V1Q A;  4RTU A;  2AHJ B;  1Y71 A;  4IIM A;  4RG8 A;  3CC2 Q;  3QSU A;  4DOV A;  3G6E T;  3M9Q A;  2NLU A;  3J81 E;  2MIO A;  5A0D A;  5CO7 A;  4IUP A;  2DET A;  4QKU A;  2RJC A;  4M75 G;  3VUZ A;  1AT1 B;  1K8A R;  4FT2 A;  4M7D F;  1H8K A;  1G3T A;  2LNH B;  5KYU A;  1PNJ A;  3LWH A;  2QQS A;  1QVF P;  4M75 D;  2D0Q B;  3EH1 A;  2E41 A;  4QT7 A;  1MNE A;  4EMG A;  5HK0 A;  5KCO A;  3X26 B;  4C0Z A;  2F2V A;  4PJO C;  2K3Y A;  2HNI A;  2E65 A;  1WYX A;  1VQ8 Q;  1Q86 C;  3P8D A;  3SWN A;  1PM3 A;  1Y0M A;  2DBM A;  2WAC A;  4PFZ A;  3QJ6 A;  3GPL A;  3EFO A;  1UGQ B;  3VS1 A;  5GAO r;  1AWO A;  1TS9 A;  2RHX A;  3CEY A;  2JM8 A;  3CCE A;  2JS2 A;  2JTM A;  2HEQ A;  1VYU A;  3JCM J;  4J9B A;  3V8K A;  2DKG A;  1YJ9 T;  3OSV A;  1Y7X A;  4F7U F;  2OJ2 A;  3CME A;  5CAI A;  4J9F A;  4YTL A;  2NUT A;  2XDP A;  2O01 E;  1NG2 A;  2DIL A;  1WJQ A;  2DRK A;  3M0R A;  3KUF A;  5KYN A;  3LLR A;  2ZGW A;  2YRD A;  1ZQ1 A;  4RUG A;  4RTW A;  2YSQ A;  1VQL T;  1JO8 A;  3EG0 A;  3GF5 A;  1FMK A;  3OYM A;  2QGG A;  2Z0W A;  3JB9 D;  5EC7 A;  3OYK A;  2F2X A;  1M1K R;  2J6K A;  2DPP B;  2EIF A;  2DD5 A;  1VQ4 Q;  3CCJ A;  3RUX A;  4DA4 A;  1QVP A;  3SDZ A;  5M9O A;  2VGM A;  2Y4Y A;  1RLQ C;  3VJP A;  4M75 B;  4PK4 A;  1D3B A;  3G4S A;  3H0F A;  4C8Q A;  2V8J A;  3MO8 A;  2GTJ A;  1BBZ A;  2M0Y A;  2DM1 A;  3OYF A;  2EGA A;  2EYW A;  3SWN B;  4FSS A;  2DTO A;  4KRT A;  2O9V A;  1X6G A;  4C5H A;  3MEA A;  4OB0 B;  1AWX A;  4HCK A;  3EG3 A;  1Y96 B;  3OMG A;  3M57 A;  2ENM A;  2K57 A;  5GAM g;  3PVL A;  1N8R U;  2COY A;  3CCR Q;  2K6D A;  4Y28 E;  4M77 A;  1WJS A;  1IGQ A;  1I5L A;  1NEG A;  2XID A;  2LRQ A;  2E12 A;  1JJ2 P;  1EFN A;  2DBK A;  4M7A C;  1IGU A;  1ZUY A;  3E9G A;  2E5K A;  1XOV A;  2DIQ A;  4FYY B;  4XU2 A;  1CKA A;  3M0U A;  2AKL A;  2DTI A;  1MND A;  3THK A;  5DY9 A;  1Q7Y C;  4RTY A;  3CCR T;  2VB6 A;  2EGE A;  5IAY A;  3PNW C;  5GAO n;  2CH4 A;  4M7A F;  4E2F B;  3VS2 A;  4DQ2 A;  1CSK A;  3A5Z B;  2KBT A;  4AFQ C;  1WHG A;  2V26 A;  2X9H A;  2JZ2 A;  4ESR A;  3X24 B;  4OB1 B;  2L3P A;  3G71 Q;  1OOT A;  2ESW A;  2H3J A;  3EFR A;  1LVK A;  3GBQ A;  1KC8 R;  2C06 A;  5J3B A;  1VQ9 T;  2G3R A;  4XTZ A;  3FJ5 A;  3TCJ A;  5FWC A;  1MV3 A;  3MET A;  3FLG A;  3ZL7 C;  1G5V A;  5CQX A;  1M30 A;  3CMA A;  2SRC A;  1RAB B;  1SEM A;  1D0Z A;  2OTJ Q;  1BCO A;  4M7D E;  1W2B A;  2F1L A;  1HSQ A;  3QZ9 B;  4C92 B;  4PFO A;  2DYI A;  4ZTF A;  1QW1 A;  1VA7 A;  2B8A A;  2HAX A;  3WVD B;  1K73 R;  4E7Z A;  2RQT A;  3A1P A;  4KGZ B;  5J26 A;  3CPW A;  1IXD A;  1KFZ A;  1H92 A;  4KBM B;  4M77 C;  1H64 1;  3A8O B;  1M3C A;  1UEB A;  4QW2 A;  2RPN A;  1OV3 A;  3J80 E;  1FXX A;  4M75 E;  3EHR A;  2RO0 A;  3FIF A;  3G71 A;  2YUQ A;  4M7A A;  2EQU A;  2NUZ A;  2NYS A;  2JTF A;  2PVO B;  5FRN A;  5LJ5 f;  3X25 B;  4EMK B;  3HHT B;  1S72 T;  2LTO A;  2X4Y A;  2GF7 A;  2BTT A;  4DEY A;  1OZ3 A;  2RNA A;  4JUV A;  1Q95 G;  4XTY A;  4QVD A;  3GOX A;  3NMZ C;  4C0D B;  5D7U A;  2MMP A;  2LQ8 A;  4IUV A;  1M2V A;  1YJW A;  3OA6 A;  1AOJ A;  4NL2 A;  3H0I A;  1YIT A;  4M77 G;  4JRK A;  1K73 U;  1N5Z A;  4QQ6 A;  2LDM A;  4HCB A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 4O6J A;  4ZN3 A;  1XNI A;  2WSC E;  2IG0 A;  2QA4 T;  1JJ2 A;  4OGC A;  2HQX A;  1KQS A;  3ZBD A;  3URG A;  3FC3 A;  4MML A;  4M75 C;  3CMA T;  1O75 A;  3MEV A;  4M7D A;  3QHS A;  3OYE A;  3G7Z A;  3CCQ A;  1X75 C;  3CC7 T;  2V8K A;  3UWN A;  1HK9 A;  4M7A D;  2RM4 A;  3A8L B;  3E9F A;  2JVV A;  3FRN A;  2M0O A;  4J6Y A;  4C92 A;  3F70 A;  2RD1 A;  3EAE A;  2KAF A;  3OW2 A;  3I55 T;  4M7A G;  4M7D B;  4PJO E;  3GNF B;  3DKM A;  3QZ5 B;  5GAN h;  1H3Z A;  3OS2 A;  4O5V A;  2R5M A;  4C8Q G;  1QVF A;  2FVU A;  3FDR A;  4XU0 A;  2CZ6 B;  2MWO A;  2YLB A;  3RKY A;  3CCM T;  3CCR A;  4XTX A;  3E19 A;  1OI1 A;  1YHQ A;  2EKO A;  4BY6 C;  3OW2 S;  2CGH A;  4XTW A;  3NTK A;  3QYH B;  1M1F A;  2YHT A;  3FB9 A;  4XAX B;  2WSE E;  4N0A C;  1I4K 1;  3L2V A;  3JB9 G;  3OS5 A;  5LL6 S;  2RHZ A;  4ZGD B;  5DLQ E;  5I2S A;  2CZ1 B;  4HT9 A;  4C8Q D;  2DIG A;  2EWN A;  3CPF A;  4IUR A;  5KCH A;  3CCS A;  3JCM P;  1YJN A;  1VQ8 T;  2P4T A;  2X4W A;  4J7F A;  3R6O A;  3OS1 A;  4GY5 A;  2OTJ A;  2ZPE B;  3JB9 J;  1Q81 C;  1LJO A;  1U1T A;  4C0F A;  5KH6 A;  5J39 A;  3UT1 A;  2QQA A;  4M7A B;  2XG8 D;  5GAO p;  4LD6 A;  2DAQ A;  4BDZ A;  2QTX A;  1VQ9 A;  3PIP A;  1KQ2 A;  4QVZ A;  1QVF S;  2EAY A;  2RI2 A;  3KXT A;  5HKC A;  3V8L A;  1VQL A;  3QPH A;  5LJ3 h;  4B9W A;  2DZ9 A;  5CCA A;  3OY9 A;  3NFC A;  3I55 A;  2M9U A;  3GNG A;  2JN0 A;  3DLL A;  3VYG A;  4JRQ A;  3V8J A;  3CCU T;  4LDY A;  1M1G A;  3TU4 K;  5CIU A;  3MCA B;  2K2V A;  2D9T A;  1BI1 A;  5CKB A;  2M1H A;  1KHI A;  1M5Q 1;  3M56 A;  4M7D D;  2GCX A;  3HFN A;  2XDD A;  1NJI C;  2JUF A;  2E1H A;  2VUB A;  4OB2 B;  4JJN K;  4F7U B;  5FRM A;  2EJ9 A;  1KD1 C;  2RB6 A;  5CVI A;  2QQB A;  1FWZ A;  3OYI A;  1KQ1 A;  4M78 D;  1M8V A;  4R55 A;  3JB9 I;  3OYN A;  3LYI A;  3OYA A;  2DXB A;  4N4H A;  5CKH A;  5CKF A;  5L8R E;  2LCL A;  3BFM A;  4B9X A;  4LDX A;  2DK3 A;  3CBO A;  3OBW A;  2O4X A;  1QP3 A;  4WF2 A;  3JCM h;  4A54 A;  1YJN T;  3G4S T;  3PMT A;  3VYH B;  1QVG S;  1X01 A;  4XQ3 A;  4XU1 A;  3TRE A;  2OTL A;  1GXI E;  3SWN C;  2OAU A;  5LJ5 h;  4OF1 A;  2RK2 A;  5GAM e;  5LJ5 j;  3QDR B;  3CCQ T;  3QO3 A;  4NS5 A;  5CR2 A;  1LOJ A;  1V29 B;  4FM4 B;  4OMF B;  4PJO G;  3PTA A;  1IZ6 A;  2RI5 A;  3DB3 A;  2O4X B;  3JAM E;  5A2Q E;  3JCM V;  4RG2 A;  5GMK h;  1UB4 A;  1NZ9 A;  3A8M B;  1Q81 U;  1N27 A;  2E10 A;  3KBG A;  1VIE A;  1D3B B;  3PFS A;  3VU3 C;  5C6S A;  3CCJ T;  4JS5 A;  5LJ5 d;  1B34 B;  1NPP A;  3CD6 A;  3C4S A;  1VQK A;  3ZFJ A;  2FYK A;  5LJ3 g;  3G6E A;  2EFI A;  2RI3 A;  1VQ4 A;  2PQW A;  4J6W A;  4LD9 K;  1VQ8 A;  3MHX A;  4M77 D;  4P5N A;  3E1S A;  1BI2 A;  3BDL A;  2XD0 A;  2E5Q A;  1B34 A;  4M7D C;  2EQK A;  2R58 A;  1IRE B;  4MZT A;  2BKD N;  2X4J A;  3QYG B;  4JLI A;  4IKF A;  4BE2 A;  2LNV A;  3CCL A;  4PJO B;  1BIB A;  5LJ3 j;  3ME9 A;  2P0K A;  3OYJ A;  4J7I A;  1NJI U;  2LX9 A;  5GAN 5;  1OZ2 A;  3OYL A;  4RCC A;  3C12 A;  4M75 F;  4IUQ A;  3ER0 A;  3M58 A;  3M5A A;  5GAN e;  4CI0 C;  2Y90 A;  3N5B B;  1K8A C;  1VQO A;  3JCM g;  2K5L A;  1VQ5 T;  2MAM A;  2PUK B;  2KQW A;  4ME7 A;  4E7J A;  5HK3 A;  2GFA A;  4N4G A;  5KE2 A;  3ASK A;  1R8O B;  2KMT A;  2RJD A;  3LW5 E;  3OMC A;  3OSS C;  2RHU A;  2KK4 A;  4N0A A;  2K4Y A;  1JRI A;  5FU7 B;  2OTJ T;  5CKD A;  1VQM A;  2AHJ B;  3AHU A;  2M16 A;  1Y71 A;  2L3R A;  4C92 D;  2LVM A;  2QDY B;  2JNG A;  1G3S A;  2DJZ A;  4ELZ C;  4J8O A;  4RG8 A;  3QSU A;  5FRO A;  4DOV A;  5GAN f;  3V7C A;  2BIV A;  3M9Q A;  2NLU A;  3J81 E;  3G6E T;  4HCZ A;  1PSE A;  1PSF A;  3S3N A;  2FHD A;  2RJE A;  4PKC C;  1VQK T;  1G3Y A;  3A8H B;  5CO7 A;  5A0D A;  3CXC S;  4IUP A;  4C5I A;  2DXU A;  5CK9 A;  1U1S A;  4M78 F;  3M4G A;  5D6X A;  3PIO A;  5GMK e;  4MDW A;  5A0L A;  4JRP A;  2VXF A;  1U8R A;  2E6Z A;  2EYQ A;  2ZPI B;  1VQ7 T;  3OS0 A;  2VYT A;  2HBP A;  2RJC A;  1W2B S;  2OTL T;  4M75 G;  3VUZ A;  3QII A;  4Q5W A;  4FT2 A;  1HXD A;  3H8Z A;  2ZPB B;  3HRT A;  3L2W A;  4M7D F;  1G3T A;  1YIJ T;  2YLC A;  4M78 B;  4LDW A;  4ZTJ A;  2QQR A;  2KVQ G;  2XDB A;  5GAN 8;  1YJ9 A;  4C0G A;  4L5G A;  3LWH A;  4C8Q B;  2QQS A;  2KDS A;  5KE3 A;  4M75 D;  3HPW A;  2D0Q B;  2E41 A;  3HP9 A;  4DOW A;  4A4F A;  5GAM d;  5D6W A;  4EMG A;  5HK0 A;  1VIF A;  2F5T X;  3OBY A;  1M9S A;  5KCO A;  3X26 B;  3JB9 H;  3V7S A;  4JDS A;  4C0Z A;  2YRV A;  2CKK A;  1KHC A;  4PJO C;  2VXE A;  2K3Y A;  2HNI A;  2E65 A;  3WXM B;  1Y96 A;  4JS4 A;  4M77 F;  1M4Z A;  1Q86 C;  3P8D A;  3V7R A;  1I81 A;  4EPC A;  1XQH A;  3SWN A;  3OYG A;  4M7D G;  3MEW A;  4A4E A;  3I56 T;  3JCM b;  2WAC A;  3QJ6 A;  3GPL A;  1UGQ B;  5GAO r;  3JCM Q;  1YIT T;  1KQS S;  1WGS A;  2RHX A;  3CEY A;  4M77 B;  1Q7Y U;  4VUB A;  3CCE A;  1WQ7 A;  2EJG A;  1M1K C;  4E47 A;  3L2U A;  2JTM A;  4C92 E;  2CZ7 B;  2P0P A;  4ZGE B;  3JCM J;  5I21 A;  3HRS A;  4BAC A;  3V8K A;  2DKG A;  1SSF A;  1YJ9 T;  3GIB A;  3OSV A;  4V2S A;  3OYC A;  3MP8 A;  1Y7X A;  4F7U F;  3CME A;  4BI3 A;  2HD0 A;  2XKO C;  4C5E A;  5GAN 7;  1JBM A;  2DTH A;  5CAI A;  4PL6 A;  4C8Q F;  2E70 A;  4YTL A;  1VQN A;  3SFM A;  1BKB A;  3HKS A;  4A53 A;  2DEQ A;  4E7L A;  2GQV A;  2XDP A;  3OQ5 A;  4EMK C;  2O01 E;  4ELY C;  1MGQ A;  1X6O A;  4LDU A;  4IUU A;  1K73 C;  3OYB A;  5AYF A;  1WJQ A;  5FLX E;  3CBP A;  3H6Z A;  5LJ3 e;  3KUF A;  5D6Y A;  3PT9 A;  3LLR A;  3G71 T;  1UGS B;  4BB7 A;  5GAO l;  2ZGW A;  4C5G A;  1ZQ1 A;  2ZZD A;  2ZCF B;  3DLM A;  4MZM A;  1Y07 A;  3Q1J A;  3SD4 A;  1VQL T;  2FB7 A;  4CRI A;  3GF5 A;  2Y4X A;  3CBM A;  5C0M A;  2MF2 A;  4OB3 B;  4X34 A;  4MDX A;  3OYM A;  3JB9 D;  2CS7 A;  3CCU A;  3OYK A;  2XU8 A;  3LGL A;  5IT9 E;  3JCM e;  4A4G A;  3LGF A;  5FU6 C;  2K5I A;  4C92 G;  5GAN g;  5LJ5 g;  2DPP B;  2PVD B;  4XTU A;  2EIF A;  2DD5 A;  3OYD A;  3CCJ A;  3PGG A;  4JRI A;  1QVP A;  3RUX A;  4DA4 A;  3CD6 T;  2QXF A;  3SDZ A;  5GAN 6;  5M9O A;  2L8D A;  2FL7 A;  2VGM A;  4FSX A;  2Y4Y A;  4II1 A;  1VQ4 T;  1VQP T;  4LDV A;  4N4I A;  3VJP A;  4M75 B;  1D3B A;  4J83 A;  3G4S A;  5HY6 A;  4BUG A;  3HL8 A;  4E7H A;  5GAM j;  4C8Q A;  2V8J A;  3MO8 A;  4XTV A;  1N8R C;  3OYF A;  3VKI A;  2ZPF B;  3SWN B;  3M4Y A;  3MP6 A;  5GMK l;  4C8Q E;  3J7A F;  1O9S A;  1WQW A;  2DTO A;  2CZ0 B;  4C5H A;  3MEA A;  4OB0 B;  3RKX A;  3L2R A;  3CCL T;  3RKW A;  2PUO B;  1N6A A;  1Y96 B;  3C94 A;  3OMG A;  3M57 A;  1Q82 C;  3L2Z A;  2K57 A;  4BY6 B;  5GAM f;  3CCS T;  1WNL A;  5GAM g;  1N8R U;  3FEO A;  1VQ5 A;  2I2L A;  4PLI A;  4PJO A;  3MP1 A;  2LC4 A;  1BI0 A;  3I56 A;  3QJY A;  2DXC A;  4OGE A;  4IUT A;  3GP8 A;  3QUI A;  2VC8 A;  2LT4 A;  4Y28 E;  1OYX A;  2KSS A;  3P8H A;  4M77 A;  3HFO A;  3HSB A;  1FX7 A;  1WJS A;  3A8G B;  2QI2 A;  1Q82 U;  4FIB A;  1I5L A;  1QVG A;  2JOY A;  1MHN A;  2XID A;  2LRQ A;  1KC8 U;  4FU6 A;  2E12 A;  3DB4 A;  3BY7 A;  3CCV T;  3UDC A;  1K9M C;  2XI9 A;  4M7A C;  1YBY A;  1I8F A;  3NTI A;  5FU6 B;  4PNO A;  3E9G A;  1XOV A;  4XU3 A;  2DIQ A;  1W4S A;  4R56 A;  3CC7 A;  3JCM W;  4E7I A;  5LJ3 d;  4D6W A;  1VQN T;  2DVE A;  4ZGJ B;  3JB9 F;  1M90 U;  1VQ7 A;  3NTH A;  4XU2 A;  3T9N A;  2K3X A;  2DO3 A;  2RH2 A;  4PJO D;  2ZPG B;  2DTI A;  5FU7 C;  5GMK m;  1NE8 A;  5DY9 A;  4F7U G;  1Q7Y C;  4ATO A;  4A4K A;  4EMK A;  2RA2 A;  4J5Y A;  3QG1 A;  3CCR T;  1TH7 A;  2RHI A;  1YHQ T;  5GMK j;  5IAY A;  3RMQ A;  3JCM d;  4M78 A;  1M90 C;  2LT1 A;  5GAN 4;  3PNW C;  5GAO n;  4BI8 B;  1YCY A;  5I2M A;  4M7A F;  3CC2 T;  2BUD A;  5DLO A;  3LX7 A;  4DQ2 A;  5GAN 2;  3VV0 A;  2GFU A;  1AHJ B;  2ZPH B;  3A5Z B;  3SB2 A;  3QBY A;  2WSF E;  2E6N A;  2RHY A;  3CC4 T;  4XK8 E;  1VUB A;  2EQM A;  2JZ2 A;  1RI0 A;  2X4X A;  4M77 E;  3RER A;  2MI6 A;  4FT4 A;  3X24 B;  2LCC A;  1NPR A;  4OB1 B;  3VUB A;  1YI2 T;  3CCV A;  3RMS A;  4Z02 A;  3MEU A;  3S3O A;  2H3J A;  3EFR A;  3RES A;  4Y91 A;  2C06 A;  5J3B A;  1VQ9 T;  2D6F A;  2G3R A;  3JRZ A;  3QKJ A;  4F7U E;  4BE1 A;  5GAN 3;  4XTZ A;  1KC8 C;  1QP2 A;  3S3M A;  5DM7 R;  4M75 A;  3TCJ A;  3MET A;  4C92 F;  2LQK A;  3FLG A;  1DJ7 B;  3GLX A;  4BDY A;  5GMK i;  1WPY A;  5GAO q;  1G5V A;  5CQX A;  3CME T;  3CMA A;  1M1K U;  1KD1 U;  4C92 C;  5CQY A;  3M59 A;  4C8Q C;  1UGR B;  3LH0 A;  4MZP A;  2K5F A;  2PU9 B;  3LWI A;  1W2B A;  4M7D E;  5IN1 A;  4J6X A;  5A0G A;  1UGP B;  4C0D C;  3QZ9 B;  3RIR A;  4C92 B;  2EJF A;  4HT8 A;  2XK0 A;  2X35 A;  3L1A A;  4M78 E;  1EIF A;  2VV5 A;  4ZTF A;  3CCE T;  1BYM A;  1QW1 A;  1S72 A;  1VQM T;  2QQ9 A;  2B8A A;  2E64 A;  3PMI A;  4KUD K;  2L89 A;  2HAX A;  5LJ3 f;  3WVD B;  2QEX T;  4FL6 A;  2L5Q A;  3M55 A;  3WVE B;  3ZEH A;  2DZC A;  2RJF A;  5GAN d;  4NOY A;  2DXT A;  4GLK A;  5J26 A;  1YJW T;  4A4H A;  3CPW A;  4OP0 A;  3O8V A;  1XTD A;  4KBM B;  1WJR A;  3BDU A;  4M77 C;  4MMK A;  1P92 A;  1H64 1;  2A3L A;  2R5A A;  3A8O B;  3EFS A;  3OB9 A;  4EDU A;  1UEB A;  2KY9 A;  4JLG A;  4M7A E;  1VQO T;  4KUL A;  2MWP A;  4QW2 A;  5GAN j;  3J80 E;  4PLL A;  1BI3 A;  1FXX A;  3L42 A;  4M75 E;  3JCM X;  1RL2 A;  3HRU A;  4RMO A;  3CXC A;  5GAM h;  1VQ6 A;  2RO0 A;  4X9C A;  1LNX A;  3FIF A;  3G71 A;  3CC4 A;  4M7A A;  3X20 B;  2EQU A;  4EMH A;  4M78 G;  3C95 A;  3X28 B;  3JCM f;  4ZN1 A;  2RK1 A;  1Q86 U;  2QA4 A;  4HA8 A;  1YI2 A;  1JB0 E;  2JTF A;  2PVO B;  5FRN A;  5LJ5 f;  4E7K A;  3TEE A;  1ZBX A;  3JCM c;  3X25 B;  4EMK B;  1N9R A;  4TVR A;  2XHC A;  3P8B B;  4UC4 A;  5GAO m;  2A7Y A;  2IVW A;  3HHT B;  3INZ A;  4KT0 E;  4L59 A;  4QQD A;  1VQP A;  1S72 T;  4RCB A;  3FJP A;  1K8A U;  1JJ2 S;  2PVG B;  2LTO A;  4L6V 5;  2X4Y A;  2GF7 A;  1K9M U;  3CPW S;  4BD3 A;  1ZHI A;  1KG1 A;  1OZ3 A;  3M54 A;  3CC2 A;  2QEX A;  1N9S A;  2F69 A;  2EQJ A;  4RKU E;  3S6W A;  4JUV A;  3QXE B;  2F5K A;  1G3W A;  3OYY A;  2CYZ B;  4M78 C;  4XTY A;  3BW1 A;  4PJO F;  4HKE A;  4QVD A;  5LJ5 e;  4OVA A;  4C0D B;  3GOX A;  1YIJ A;  2MMP A;  3OYH A;  2LQ8 A;  2XIC A;  4IUV A;  3CCM A;  3OA6 A;  1YJW A;  2DD4 A;  2HQE A;  2P0Q A;  1BIA A;  5CKE A;  3L2Q A;  4BI4 A;  4NL3 A;  2V8I A;  3UPU A;  4NL2 A;  1YIT A;  2R57 A;  4F7U A;  2VGN A;  4BE0 A;  4M77 G;  4QVC A;  1VQ6 T;  4QQG A;  5EG2 A;  4KUI A;  4HCC A;  3JSC A;  4JRK A;  1K73 U;  4QQ6 A;  2LDM A;  3M53 A;  4HCB A;  4X9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...