4A53A

Structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
125
structure length
125
Chain Sequence
GAMGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMDCDEEFDFAANLEKFDKKQVFAEFREKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EDC3
publication title The Structural Basis of Edc3- and Scd6-Mediated Activation of the Dcp1:Dcp2 Mrna Decapping Complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 10
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a53A01
1N9RA 1M5Q1 3SWNA 3VU3C 4EMKC 4MMKA 4X9CA 5LJ5e 4OP0A 4XU3A 5GAN2 5GAN4 4NL2A 4JUVA 3JCMb 2EJ9A 5GAOq 2FB7A 4M75E 3BW1A 4M78E 4C92G 5LJ3e 1H641 5GAMe 4PJOE 4EMHA 4C92F 3HFNA 3FB9A 3V8KA 4M7DG 5GANd 4Y91A 3V8JA 4A53A 4C92C 2E41A 4XTZA 4M7DF 4PJOB 3JB9I 4M7AE 4M7DC 4NL3A 3JCMP 4C8QG 4M77E 3RUXA 3HFOA 4F7UG 5GMKl 4PNOA 5I21A 4N0AC 4RCCA 3BY7A 3EFSA 3JCMc 4M7AB 4C8QF 4F7UF 3HSBA 1WQ7A 4JRKA 3INZA 1M8VA 3JCMe 4M77B 4RCBA 5GMKi 5LJ5d 3M4GA 3BFMA 4C92D 4X9DA 2I2LA 1BIBA 2DEQA 4QVCA 5GAOr 3GIBA 4M7AA 1I4K1 4M7DD 3RESA 1WPYA 1X01A 2YLCA 5LJ3d 4DQ2A 5GAMd 3EFRA 4J6WA 1LNXA 3PGGA 5GMKm 4C8QD 1I5LA 2DZ9A 2JN0A 3V7RA 3RERA 3JB9G 2EJFA 3RIRA 1KQ1A 5GANg 5GMKj 1D3BB 2EWNA 3JB9F 3JB9H 3BDUA 3FIFA 1Y96B 2DXTA 4M75B 2VXEA 2YHTA 4M78B 3JCMd 1D3BA 2ZGWA 4PJOF 4XU1A 2YLBA 2RM4A 4M75A 1Y96A 1KQ2A 4M78A 4EMKB 3V7CA 3JCMJ 4PJOA 2DVEA 4C8QC 4M7AF 3QSUA 2VXFA 3L2ZA 4M77F 4EMGA 2CGHA 3QO3A 2QTXA 4EMKA 5GMKe 2RB6A 3JB9D 5LJ3g 4C92E 4J5YA 2RD1A 4C8QA 4M77A 4WF2A 5GAMg 5GAOp 3SWNC 4M7DE 1WNLA 2K57A 1N9SA 3JB9J 4PJOD 4C92B 5DY9A 2DZCA 4M7DB 2DXUA 4C8QE 2EAYA 1BIAA 4F7UE 4M7AD 1TH7A 2E10A 3L1AA 2E1HA 4M77D 1WQWA 3JCMg 2VC8A 4HA8A 2Y90A 4J6XA 4F7UB 1LJOA 4M75G 3JCMQ 4M78G 4N0AA 4PJOG 1HXDA 4M75F 5GAOm 5GANf 4M78F 4HT8A 3JCMV 4JRIA 5GANh 5GAN5 4J6YA 4PJOC 4M7AG 3QUIA 5LJ5g 2EJGA 4M77G 2E64A 1U1SA 4M7AC 5LJ5f 4M77C 5GANj 2DJZA 2DTHA 5GAOl 4XTVA 3JCMW 5LJ5h 3AHUA 1I8FA 4M75D 4XTUA 4M78D 3RKXA 2HNIA 2DKGA 5LJ3f 2E65A 4XTWA 4XU2A 5GAMf 4MMLA 5GAN7 1JRIA 5LJ3h 3SB2A 3FJPA 5GAMh 1B34B 2FYKA 4XU0A 3RKWA 4C92A 3V7SA 5GAN6 1I81A 5LJ5j 2RA2A 4M7DA 4C8QB 4V2SA 1B34A 3JCMX 5GANe 4QVDA 5GAN3 4HT9A 5LJ3j 2DTOA 4XTXA 5CAIA 5GAMj 1MGQA 3QHSA 1JBMA 1YCYA 4M75C 3JCMf 4M78C 4A54A 3SWNB 3V8LA 3RKYA 4XQ3A 3JCMh 1U1TA 4F7UA 4NOYA 5GAOn 1HK9A 4JLIA 5GAN8 2DTIA 5GMKh 1LOJA 4XTYA
chains in the Genus database with same CATH superfamily
3F70A 1WX6A 4Z89A 2FEIA 4C0GA 3KFVA 2OTLT 5LJ3e 4C92G 2Y4XA 1Y07A 4Y91A 3VS5A 3VV0A 3JCMP 2K5IA 2DL5A 1SHFA 4KUDK 3INZA 1WHJA 3GIBA 2DEQA 2M51A 1GCQA 1VQLQ 2YLCA 2CT4A 5GAMd 2LJ3A 1W1FA 1K8AR 3CMEA 3META 4Q5WA 4RTYA 4B9WA 1H8KA 4M75B 2FPEA 1YI2A 2MPXC 3CBOA 2VYTA 3HKSA 1XNIA 5J26A 3H41A 1K0SA 2KK4A 2JT4A 1VIFA 3MHXA 2B8AA 4EMGA 3JB9D 1JO8A 3REBB 3PVLA 1EX4A 4M77A 4WF2A 2XIDA 1WNLA 2LRQA 1AD5A 2KYBA 2OTLQ 1SHGA 1NG2A 1WLPB 2RJCA 2C0IA 1VQ9Q 1RLQC 4LN2A 2XK0A 4M78G 1V1CA 4N0AA 4PJOG 1RAFB 1QVPA 2QK0A 4M7AG 1UUEA 1Z9ZA 1X69A 2R5MA 1UB4A 3CCLA 2CSQA 5GANj 3URGA 1M1KR 2L3SA 4IUPA 1I8FA 1KFZA 3PFSA 3L2VA 3OMGA 1E7OA 2DA9A 3UATA 1IHWA 3NMZC 1HYOA 2ATCB 3SD4A 3V7SA 4C5GA 2XMFA 1NEGA 4HCBA 2JS2A 5LJ3j 5CAIA 1TSFA 1WZOA 4XQ3A 2DM1A 1YJ9T 2ROLA 3GPLA 4RG8A 2HCKA 3U23A 2MF2A 4OP0A 3JCMb 1S72T 2RN8A 2VKNA 3OW2P 1T3LA 3JRZA 2RI3A 3FB9A 2E6NA 2KMTA 2M16A 2IPOB 2FG0A 3JCMc 2DEUA 1RABB 3A8OB 1VQMT 4AT1B 2QTVA 1FXXA 1VQNQ 2WSFE 3R6NA 1D1BA 5KYXA 3OYEA 3OYFA 2O4XA 4M7AA 2K3BA 2K7AA 2PQWA 1YJWA 4J6WA 2L0AA 5A0LA 5GMKm 2PU9B 4X1VA 1TTHB 4PJMA 3JB9F 4J9HA 4Y92A 4HVVA 4PKCC 4LUEA 1AWXA 2ZGWA 2HKQB 1UJYA 1KQ2A 3JCMJ 2F2WA 2DVEA 4ANJA 3HL8A 2D6FA 2W0ZA 2EQMA 1KK7A 2ENMA 2CZ0B 3M55A 4YTLA 3E9FA 2K57A 1S72Q 2DZCA 5FRMA 3JSCA 4M77D 2QQRA 2FZKB 1TXQA 1BCOA 1MUZA 4E7SA 4C0FA 1VQMQ 3G71T 3GF5A 2LX9A 3OQ5A 2RQRA 3OBYA 5DM7R 1G3WA 1K1ZA 2X4JA 1WHMA 3RKXA 4HVUA 4LDVA 2LCSA 2L8DA 4E7KA 3CXCA 3EGXA 1KC8C 3VRYA 5IXFA 1UEBA 4BUGA 2VGMA 3E19A 4A54A 2X35A 4F7UA 2D0NA 4K11A 4PFPA 3SWNB 2ZPIB 3SEMA 2VUBA 3M0SA 2LMJA 1X27A 4E6RA 4XU3A 2CSIA 5IHNA 5I22A 5D6YA 5L23A 4EMHA 1WJQA 1A0NB 1RAIB 2NUPA 3D7SB 1WDXA 5HY6A 4C8QG 1NPPA 4JRKA 3BDLA 4ORZA 4LDXA 4LXCA 1OQKA 1UHCA 4X9DA 2OAUA 2EYXA 3QPHA 5CO7A 1Q86U 1I4K1 1YHQA 3EG9B 4JZ4A 2PZ1A 2KBTA 3EG2A 2EKHA 3LWHA 4F17A 1H3ZA 5HKCA 2EWNA 2FRYA 3M54A 3I35A 4M78B 4D8KA 9ATCB 2RM4A 2BZYA 2A0FB 4EMKB 1X6BA 3G6ET 1B7TA 3CCVQ 4M77F 4Z02A 4E7JA 3L2RA 1GBRA 1G3TA 2YUOA 3CCRT 5FWCA 2DD5A 5FU6B 1VQ5Q 5DY9A 1Y7XA 4II1A 2DXUA 3I56A 3EGDA 1QP2A 1BB9A 3ZEHA 3ZL7C 1RLPC 3JCMg 3PMTA 1HSQA 5AT1B 1VQ4T 2BZ8A 3VUZA 5GAN5 4J6YA 2AIRB 5AYFA 3GOXA 3H9NA 2NYSA 1U1SA 4JRQA 2KI7A 5DLQE 1Z9QA 2E4HA 3OS0A 2DTHA 3HP9A 4AFUC 4OMPA 2XDPA 5CKDA 1VQKA 2DYIA 4OMLA 2BUDA 8ATCB 2GTOA 1N8RR 4BE0A 4ESRA 2JXBA 1X2KA 3LW5E 3QDFA 2HMAA 2D0QB 1M9SA 2RHUA 5GAN4 2LQKA 1TUGB 1VYUA 3QYHB 2DBKA 2F69A 1UJ0A 2LNHB 3HFNA 3EHRA 4FIBA 5CKEA 2E12A 1D1CA 5FU7C 3H0FA 4C5IA 2KNBB 1YJNT 1VQ4Q 5KYYB 5D6XA 1JJ2S 2EQJA 1V76A 1PCXA 1SKUB 1CKBA 3EG0A 1YI2T 3QG1A 2KXDA 1X01A 2ROTA 2VGNA 2ZPBB 3HHTB 3OB9A 1LNXA 2VB6A 3CQTA 2JM8A 1D0YA 3FJ5A 2HDAA 4JJBA 1M90U 2WACA 1YJ9A 1D3BA 2RJFA 3CBPA 4WCIA 3SFMA 2NUTB 2KRSA 3CMAT 4BY6C 1K8AC 1JQQA 1IGUA 5HCKA 2RD1A 1GFCA 3M53A 1FMKA 3M0TA 5FROA 3S3MA 3VYGA 3OYMA 1K4US 4DEYA 2PVDB 1EFNA 1VIEA 2VC8A 3S6WA 1YJNQ 3C12A 2LP5A 2R5AA 3NPFA 1HXDA 5GAOm 2O9SA 1ABOA 2DXBA 4C0DB 4LD9K 1YI2Q 1EZZB 4D8DA 2EGAA 2JM9A 5LJ5f 1GCQC 1OZ3A 2HEQA 4MDXA 3C95A 1J3TA 4MZPA 3G4SA 4VUBA 1B34B 3EFOA 4PJNA 2L2PA 2ZCFB 1UGSB 3MP1A 4C8QB 2BZXA 4V2SA 3E1SA 1VQ7A 2DE0X 1N5ZA 1PKTA 3CPWS 3JCMf 1M1KC 4JLIA 1TUCA 4CC4B 4JRPA 1KC8R 3MEAA 4AG2C 3THKA 1M2OA 1WXUA 3OYJA 1QWFA 4JLGA 1YBYA 2LX7A 2HZYA 4OMFB 3VS2A 3N5BB 2HL3A 2AT1B 2EQIA 3CCLQ 3G71A 2YUQA 2VV5A 2RQTA 4C92C 1YJWT 2COZA 1F1BB 1BU1A 5CQYA 4N0AC 2P0KA 1JXMA 3A8GB 1WQ7A 2RJEA 2MI6A 1CKAA 2EYWA 2DYBA 1PSEA 3WVEB 2EYQA 3G1JA 3QZ5B 1ZBJA 3PGGA 2WSCE 3JB9G 3RIRA 3S3OA 1RAAB 2OJ2A 2A37A 2CREA 3M5AA 3FIFA 3OMCA 4FT4A 2CP3A 1WFWA 4M75A 1S1NA 2QXFA 5IH2A 1UGRB 1WJSA 1QCNA 1OOTA 2CGHA 1FX7A 2JW4A 2LT1A 1SSHA 1BI0A 1GRIA 3L42A 2JMCA 4O5VA 4RTZA 1NLOC 2QGFB 2DD4A 1YJWQ 1WQWA 2E3HA 2VVKA 3QWXX 2DNUA 2CP7A 2LCLA 4FYXB 5GANh 4PJOC 2E64A 2V8IA 4XK8E 1DJ7B 1UGVA 4M7AC 4ZGJB 1NE8A 4EPCA 3H0HA 4RKUE 1R0CB 2K4YA 3O8VA 1ZA2B 3EH2A 4MMLA 2F2XA 2COWA 5FW9A 5LJ3h 4A4HA 3G6EA 3EH1A 3LGFA 1G3SA 2FL7A 3JCMX 2QYZA 3EHQA 2PVOB 3FDRA 3CCRA 2K5FA 2EBPA 5GMKh 3SDZA 1GL5A 3C4SA 1GBQA 1KIKA 4RMOA 1NJIU 5KCHA 1UECA 1MMGA 2ZPFB 1KG1A 3HRUA 3HRTA 2ESWA 4JDSA 1NLPC 1NYGA 4NL3A 3CCSA 3KUFA 4LNPA 2CP0A 1BK2A 2AKKA 3P8HA 4Z88A 2KE9A 3BFMA 1PC0A 2YSQA 2EVRA 3CCEA 4OB0B 5CKBA 4JS5A 1W2BS 2C06A 2IVWA 4B9XA 1FWZA 1Y57A 2RI2A 3X24B 2C0OA 3I56T 3OS5A 1ZX6A 3QIIA 2D8JA 1JB0E 5M9OA 3QSUA 2FPDA 3X25B 1WIEA 2QTXA 3TSZA 5GMKe 4ME7A 5GAMg 4QVZA 2KEAA 1X6OA 2HQEA 2XI9A 1VQ8A 1IRXA 1M3BA 3J80E 1YJNA 1OPLA 2DAQA 3CCUT 1YHQQ 2DJQA 2M9UA 1QCOA 2Y90A 2YUPA 1VQKT 2EQUA 3LH5A 1RADB 3A1PA 3J7AF 4FYYB 4HCCA 1ARKA 2FZCB 3E9GA 1Q86R 2RK1A 5GAOl 4GLMA 1WYXA 2CP6A 4XTWA 1E6HA 4FYWB 2K5LA 1ZSZB 3VS1A 2E70A 3OSVA 4C92A 5GAN6 1Y0MA 2A7YA 3CMAA 1Y71A 3I56Q 1QKWA 2YWWA 3VS4A 4CC7A 5J39A 4L6V5 4XTYA 3SWNA 2KSSA 3VRZA 1D1AA 1UFFA 2L89A 3M9QA 5GAOq 3H8ZA 4NS5A 2FZGB 2KY9A 5A2QE 1N8RC 3LX7A 4GLKA 5GANd 3OYAA 2RQVA 3RNJA 4XTZA 4AFZC 4J83A 4JS4A 3PNWC 3ZFJA 2A3LA 1VQKQ 4RCCA 5KYUB 5GMKi 2QGGA 3OYIA 1QP3A 4WTOB 2L3RA 4OF1A 1OULA 4M7DD 2LQNA 3DB3A 5LJ3d 1I0CA 2YRVA 1Q82R 2O9VA 2K79A 2M0OA 3ASKA 1KQSP 3MO8A 2YRCA 3V7RA 3VS7A 5GMKj 3EG9A 2DO3A 2DXTA 4IKFA 2AHJB 3JAME 1RAGB 4M78A 1VUBA 1M3AA 4PJOA 2E3IA 2MYSA 4OGEA 2M1HA 1LVKA 4EMKA 2P0PA 2RB6A 4QQDA 2QQBA 2LTOA 1G8XA 2J6OA 4M7DE 4PLIA 2EIFA 7AT1B 4M7DB 2DERA 1U5SA 1IREB 2BE9B 2XU8A 4E7IA 1Q81U 3VYHB 4HA8A 2L3QA 1JXOA 4M4ZA 1G3YA 1GFDA 4JRIA 2EYZA 3G4ST 1WI7A 4KULA 3A8LB 2EJGA 1YJ9Q 1ZQ1A 3ME9A 1VQ7T 1TG0A 2O01E 3RBBB 1M3CA 1WHGA 5CVIA 1D0XA 2ED1A 5GAMf 3CPWA 1JRIA 1WGSA 3DLLA 2CT3A 2FYKA 1I81A 2CDTA 1K9MU 2JTMA 5GAN3 1PWTA 2M02A 4ZTFA 2X3XD 1MGQA 3QHSA 4FW1A 1K73U 5CK9A 1RACB 1U1TA 4AG1C 2X4YA 3VU3C 4MMKA 4X9CA 2RH2A 5LJ5e 4L5GA 2KRMA 3KBGA 2JNGA 1IB8A 3V8KA 5DLOA 5I11A 2RHYA 4M7DF 3JB9I 1Q7YU 2FRWA 5EC7A 4M77E 3RUXA 4RUGA 4PNOA 3G4SQ 2ABLA 2F2VA 3OYCA 3OYLA 3JCMe 4M77B 2QDYB 4DOWA 4ZTJA 2I2LA 1BIBA 1VQ7Q 2A36A 1SPKA 2CUBA 3NFCA 4J9CA 3OW2S 2XD0A 2EJFA 1KQ1A 3M0PA 3JB9H 4J7IA 1Y96B 1T0JA 2DVJA 4Z8AA 5IT9E 4QT7A 4KH0B 3CCJA 4XU1A 1PRMC 5KYWB 2QG9B 3G71Q 2VWFA 2FPFA 2G3RA 4ZGEB 2GF7A 3NHNA 3OYHA 5GJWB 3JB9J 2JMAA 4PJOD 5A0GA 3L2QA 2GFAA 4DBFA 2PUOB 4M7AD 1KHIA 3OYBA 1ABQA 4J6XA 4PFZA 1QVGA 1BI1A 4HT8A 1WHLA 4BE2A 1ZLMA 4HKEA 4DBRA 2QEXT 1ZSGA 1PNJA 5LJ5g 2J6KA 4J7FA 2R58A 1KD1U 1SG5A 3JCMW 4LE9A 3CPFA 1M27C 2W10A 1NM7A 2RF0A 3X28B 2D9TA 3E2UA 2BE7D 1EIFA 1UG1A 5LJ5j 2RNAA 1YITT 5KYXB 1B34A 1AHJB 3Q1JA 4C8QA 4M75C 2X51A 3RKYA 4QW2A 2LJ1A 3CCST 1N9RA 2K2VA 3CCUA 2A08A 2QQ9A 1QVFA 3G7ZA 3C94A 3UA7A 1YIJT 1H641 2K2MA 2DFUA 1NEBA 3I55T 1VOMA 1OI1A 3CCET 2OTJT 1PKSA 2ED0A 3G6EQ 3ZBDA 4R56A 1W2BA 4QVCA 2EYYA 5IAYA 3PMIA 1ZUKA 2BKDN 1WJRA 3ER0A 1IZ6A 3CCRQ 1SRMA 1U06A 1BI2A 3KXTA 1Q95G 1XOVA 5EG2A 1E6GA 5C0MA 1GCPA 1M1GA 3TSWA 3LYIA 2CYZB 2YXYA 1VQ8T 1VYVA 4RTWA 4PJOF 3L2UA 4N4HA 2OI3A 1PD1A 5L8RE 4HCKA 2XKOC 1OV3A 4M7AF 2HD0A 3CCSQ 2ZAEA 1QQJA 1QKXA 4RG2A 3EGXB 4CC2A 4F7UE 4IURA 1NJIR 3FRNA 1UDLA 3I55Q 3TCJA 2EKOA 3CCEQ 1XJWB 4F7UB 2JUFA 1MHNA 3PIPA 1PHTA 3P8BB 1GXIE 1D09B 1OU9A 4HVWA 4ZGDB 3CXCP 3NTKA 3UDCA 2CP5A 3QWYA 3DLMA 2CUDA 2E65A 4OMMA 4DBQA 4XU0A 4IIMA 1WXBA 4A4GA 3LWIA 3GP8A 2DL4A 1VQ8Q 2EQKA 1W6XA 4RTUA 3M57A 4QVDA 4HT9A 4XTXA 1Q86C 2GCXA 3RR6A 1UTIA 1RUWA 4NOYA 2K3XA 3IQLA 2DTIA 1I5OB 4JUVA 3EGUA 3PE0A 1U3OA 4FW2A 4N4GA 1MNEA 1IHVA 4OMNA 3CEYA 3OS2A 5FRNA 4E7HA 2HSEB 1KSWA 2XG8D 4F04B 1ZUYA 3OYNA 3CC4T 4F7UF 3MEVA 3L2WA 3CMAQ 2D1XA 1QVGP 4IUUA 1YWPA 1T0HA 1VQOT 2PTKA 2DL3A 5IHKA 1AWWA 1OZ2A 1K76A 5GJVB 4PJLA 5D7UA 1SF9A 4HCZA 1UHFA 3RDVA 2RJDA 2QASA 1QCFA 4IIOA 2HBWA 3CC7T 3MKDA 4KGZB 4E7ZA 1Q82C 4OMOA 3WVDB 4JZ3A 1ZA1B 1YCSB 4BD3A 2LQ8A 3SWNC 1VQPT 4LDYA 5C6SA 5LL6S 1RAHB 1QVFP 1AWOA 2IIMA 2K6DA 1R77A 2KR3A 3CC4Q 1MNDA 1JEGA 1TUDA 5HK3A 3CXCS 3RMQA 3PTAA 2EGEA 3QBYA 1K9AA 1BKBA 5CIUA 2JJ9A 2DJZA 4L59A 2KRNA 3AHUA 1I1JA 3FJPA 1R8OB 3CC2A 1FMWA 1ZSZA 3FEOA 3CCQT 2XICA 1QMCA 4FL6A 3FC3A 1BYMA 4M78C 3TVTA 1TU0B 4EMKC 5CKFA 4R55A 2ZPGB 5FWBA 2JTEA 2SRCA 5GAMe 4M7DG 1O75A 3BE3A 4KT0E 2QEXA 3M59A 4A53A 5FU6C 2DL7A 4QQGA 2G6FX 1SRLA 3X20B 1IO6A 3M56A 4OB1B 3WXMB 2AZVA 4PL6A 5D6WA 3TQ7P 4RCBA 2CS7A 3M4GA 2AZSA 3I5RA 3TEEA 2RHIA 3QXEB 5KYUA 3CCJT 3RESA 2QI2A 4R0KA 2O88A 1UE9A 1I5LA 1YITA 2DZ9A 3RERA 4D6WA 2DX1A 2MK5A 1U8RA 4FU6A 2R57A 3M4YA 4X34A 3M0RA 2GBQA 2VXEA 2QQAA 3S3NA 3PT9A 4JJCA 1PD0A 1NPRA 1K73R 1FMVA 1YIJA 2KQWA 3OYYA 3I55A 2L3PA 3SHWA 4J9IA 3LGLA 2OTJA 2KGTA 2LT4A 1W4SA 5I2MA 2MIOA 2X4WA 5A0DA 1M2VB 3JCMV 4F16A 1Q7YR 2DPPB 2RQWA 2E6ZA 4BB7A 1M1FA 2RO0A 4M77G 2JVVA 2P4TA 3CCJQ 4E7LA 1UGQB 4XTVA 2FHDA 4M75D 3TU4K 2YDLA 4XAXB 4XU2A 1VQ9T 3RKWA 1O9SA 3GBQA 1VQ6A 4KUIA 4KH1B 2DTOA 5GAMj 2PUKB 4DA4A 5GAOn 2LVMA 2ECZA 4BI8B 1PG5B 2LDMA 4EIKA 2KT1A 2O2OA 4NL2A 2X3WD 4M75E 2KAFA 3MPUB 3BW1A 1M4ZA 2HBPA 3M0QA 2E41A 1X6GA 3CCMA 1LCKA 2MWPA 5IHIA 1VYTA 2RI5A 3HFOA 1TS9A 1KC8U 1YNZA 2RQUA 1OX8A 3R6OA 2QQSA 2WSEE 2BTTA 4KBMB 3QYGB 3UF4A 1WPYA 2B86A 4A4KA 4DQ2A 4C0DC 3LLRA 4FYVB 5CQXA 4A63B 4BACA 1KD1R 3OY9A 5GANg 1JJ2A 3CCUQ 2D8HA 3MP8A 1Y96A 2LJ0A 5IN1A 1VQNT 3CD6A 2KROA 4C8QC 5KYWA 2VXFA 1PRLC 5LJ3g 4J5YA 5FU7B 4BI3A 4LD6A 2EAYA 3CC4A 4OB2B 1TH7A 3H0IA 1P92A 2EFIA 1TWBA 4AFQC 4M75F 1HD3A 4HXJA 2V8JA 1VQOA 1QWEA 3QUIA 4C0ZA 2DF6A 2YRDA 1QLYA 3A8HB 4KGVB 1WA7A 1NJIC 3HTRA 4C5EA 2LC4A 2LZ6B 3AT1B 5LJ5h 4XTUA 3CC7A 2J06A 4LUDA 2RMOA 1G5VA 3SB2A 2HSPA 4RTVA 2KT8A 2RPNA 4BY6B 4J9BA 3QJYA 3JCMh 1VQPA 1NYFA 4OGCA 4OMQA 2CZ7B 2QAZA 4CC3A 1HJDA 2DK3A 2YUNA 3H6ZA 2QA4A 1XTDA 1NBEB 2EJ9A 4LDUA 3J81E 2HKNA 4EDUA 1M90R 1SEMA 3X26B 3VS3A 2X4XA 4F7UG 4KGXB 3HSBA 1AWJA 4ATOA 1M8VA 4B6MA 3A5ZB 4JPBW 1AZGB 1H3HA 4C92D 3EFRA 2FVUA 4PJJA 3CCQA 2PNIA 2CH4W 1MMAA 3NGPA 2O31A 1XQHA 2JOYA 3PIOA 1RAEB 4FM4B 4BDYA 4JJDA 2J7IA 2GNCA 1UGPB 4MDWA 3V7CA 1OYXA 3L2ZA 3QO3A 5KYYA 3OA6A 4O6JA 4C92E 4C92B 1KQSS 2MMPA 4PLLA 2FO0A 4BDZA 1AVZC 2E10A 1PM3A 3JCMQ 1LJOA 1K0XA 1OU8A 5GANf 2EW3A 3CC2T 1V29B 3EG3A 3CCVT 4ZNXA 3T9NA 3ULRB 2OX7A 2NUTA 1AOJA 2JS0A 2MWOA 1K8AU 4M78D 1VQ5T 2DKGA 5CKHA 5LJ3f 3OYKA 1WHHA 1MMNA 1D0ZA 2CKKA 2Z0WA 1VQLA 2HQHA 1JJ2P 2MOXA 3HRSA 4FSXA 2X9HA 1YFNA 3EAEA 3VJPA 4AFSC 2XHCA 5IXBA 2HL5C 4J9EA 1SSFA 4J9DA 5GAN2 2K3YA 1I07A 2FB7A 4E47A 4M78E 5CR2A 4PJOE 2H3EB 4C92F 3HPWA 4QQ6A 3CBMA 4PJOB 4M7AE 3PVQA 5I21A 2O4XB 1MV3A 4M7AB 3CC2Q 5LJ5d 5ECAA 2OTLA 2KYMA 1M1KU 2RHZA 2ZPEB 1H92A 2KXCA 1VQ9A 4TVRA 2RK2A 4DEXA 4QKUA 1C0MA 4JJNK 1Q81C 1W70A 1T3SA 1OPKA 3JCMd 4P5NA 1ZSZC 4GBQA 5KE3A 2QEXQ 3C0CA 3GLXA 1Q82U 2ZZDA 1RI0A 3A8MB 1IXDA 5GAOp 1AEYA 2JTFA 4UC4A 2F1LA 3QZ9B 1R0BG 2NWMA 3P8DA 2MCNA 1B07A 2V1QA 1K9MC 1AZEA 2LCCA 1K73C 1YITQ 4ZN3A 4M78F 3CPWP 1ZBXA 2EPDA 4IUTA 1VQ6T 4ZN1A 1IGQA 4LDWA 4GY5A 2HNIA 3I5SA 1YIJQ 2DILA 2CH4A 1Q7YC 2H8HA 1VQNA 2Y4YA 4J9FA 5KE2A 4ELYC 2OTJQ 1QW1A 1BI3A 2DRKA 3CMET 3OSSC 4PFOA 1N6AA 1X75C 3CCMT 1LOJA 1VA7A 2I0NA 3M0UA 2COYA 3LH0A 1X43A 1RL2A 2NUPB 3VS6A 3I9QA 2BIVA 2E5QA 3UPUA 4M7DC 1MMDA 5GMKl 4J9GA 5J3BA 1S72A 1VQ6Q 4N4IA 2JZ2A 2KDSA 3MEUA 2J05A 4PK4A 4Y28E 3CD6T 2DIQA 4C8QD 2AK5A 4MZMA 1VQMA 4CI0C 3CCLT 1C6VX 3JV3A 4FT2A 5I2SA 3CMEQ 2YLBA 2IG0A 2LNVA 1M30A 4C5HA 1KD1C 1NZ9A 4DOVA 3CCMQ 1BCMA 1OEBA 1WHKA 1KHCA 4E2FB 8AT1B 2CZ6B 3EGDB 2NUZA 1CSKA 1M8MA 4OB3B 2L5QA 4C8QE 1BIAA 3UWNA 3L1AA 2E1HA 2OAWA 1G83A 1BBZA 4M75G 4CRIA 1N27A 2DETA 1M2VA 2ZPHB 3UA6A 2PVGB 4M77C 5CCAA 3CD6Q 3QKJA 3RMSA 4RTTA 3MCAB 1YP5A 4BE1A 3EG1A 5GAMh 2NLUA 2QA4T 5FLXE 2RA2A 3QJ6A 2DL8A 4RTXA 3MP6A 3OS1A 1YCYA 2RHXA 3V8LA 2C0TA 2GGRA 2HAXA 5GAN8 3MEWA 3NTIA 1FYNA 2MAMA 4BI4A 1VQOQ 1M5Q1 4F14A 5HK0A 3O5ZA 1W2BP 2DMOA 2P0QA 3REAB 1OX9A 2K9GA 3V8JA 2E5KA 3CC7Q 2KVQG 3CCVA 4AMCA 2AKLA 2LQWA 2QDLA 2A28A 4ELZC 1ZUUA 2V26A 3BY7A 3EFSA 4C8QF 5KYNA 1JU5C 1ZHIA 1VQ5A 3VKIA 5GAOr 2SEMA 2F5TX 1X2QA 3OYGA 4OVAA 1AT1B 4J8OA 6AT1B 1VQPQ 1M90C 2XDDA 2JN0A 1D3BB 2CP2A 5KH6A 2QA4Q 3BDUA 1RI9A 3QDRB 3OYDA 2DLPA 2YHTA 1B3QA 1N8RU 2XDBA 1MV0B 1WXTA 1Q81R 2F5KA 3GNGA 1KQSA 3OBWA 3OW2A 3MJXA 1QVGS 2H3JA 1LPLA 2HQXA 3NTHA 1KJWA 1N9SA 3DB4A 3VUBA 2V1RA 2P4RA 4IUQA 3M58A 1TOVA 4IUVA 3UT1A 2GQIA 4MZTA 1PSFA 4DBHA 3VS0A 1C1AA 1YN8A 3GNFB 3CCQQ 1ACMB 1K9MR 2DRMA 1G2BA 2CZ1B 3FLGA 1VQLT 4FSSA 2GTJA 2DXCA 3EFOB 1VQ4A 5GAN7 2DBMA 4A4FA 1YHQT 2EGCA 2GFUA 1QVFS 2GQVA 2M0YA 4M7DA 3A98A 5KCOA 1YWOA 2P84A 3DKMA 5GANe 1JBMA 4A4EA 3TREA 2DIGA 2J6FA 2V8KA 1HK9A 2VASA 4FCYA 2YT6A 4KRTA
chains in the Genus database with same CATH topology
1N9RA 3F70A 2K2VA 3OYJA 3CCUA 2DK3A 4JLGA 1YBYA 2QQ9A 3H6ZA 2QA4A 4OMFB 3G7ZA 1QVFA 3C94A 1XTDA 3N5BB 2EJ9A 4C0GA 2OTLT 5LJ3e 4C92G 4LDUA 1YIJT 1H641 3J81E 2Y4XA 1Y07A 4Y91A 3G71A 2VV5A 4EDUA 4C92C 3I55T 1OI1A 1YJWT 3X26B 3CCET 3VV0A 3JCMP 2OTJT 2K5IA 2X4XA 4F7UG 5CQYA 4N0AC 2P0KA 3A8GB 3HSBA 4ATOA 1WQ7A 2RJEA 3INZA 3A5ZB 2MI6A 4KUDK 1M8VA 3ZBDA 4R56A 1PSEA 1W2BA 4C92D 4QVCA 3GIBA 2DEQA 3WVEB 2EYQA 3QZ5B 5IAYA 3PMIA 2YLCA 2BKDN 5GAMd 3EFRA 1WJRA 3ER0A 1IZ6A 2FVUA 3PGGA 1BI2A 3CCQA 3KXTA 2WSCE 3JB9G 3RIRA 3S3OA 1XOVA 1XQHA 3CMEA 2JOYA 3META 4Q5WA 5EG2A 3PIOA 5C0MA 4B9WA 3M5AA 1M1GA 3FIFA 3LYIA 2CYZB 3OMCA 4M75B 1YI2A 4FM4B 4FT4A 1VQ8T 3CBOA 2VYTA 3HKSA 4PJOF 4BDYA 1XNIA 4N4HA 5J26A 3L2UA 4M75A 5L8RE 1UGPB 2QXFA 4MDWA 2KK4A 3V7CA 1UGRB 4M7AF 2XKOC 1WJSA 2HD0A 1OYXA 1VIFA 3L2ZA 2B8AA 3MHXA 4EMGA 2CGHA 3QO3A 1FX7A 3JB9D 2LT1A 4O6JA 4C92E 3OA6A 4M77A 1BI0A 4WF2A 2XIDA 1WNLA 2LRQA 3L42A 4C92B 1KQSS 2MMPA 4RG2A 4PLLA 4O5VA 4BDZA 2RJCA 4F7UE 4IURA 2E10A 3FRNA 2DD4A 3TCJA 1WQWA 2EKOA 3JCMQ 4F7UB 1LJOA 2XK0A 4M78G 2JUFA 4N0AA 4PJOG 5GANf 1MHNA 3PIPA 3GOXA 1QVPA 2LCLA 3P8BB 5GANh 1GXIE 4ZGDB 4PJOC 4M7AG 3CC2T 3NTKA 1V29B 3CCVT 3T9NA 3UDCA 2E64A 2V8IA 4XK8E 1DJ7B 2R5MA 4M7AC 1UB4A 4ZGJB 1NE8A 3DLMA 3CCLA 4EPCA 5GANj 3URGA 2MWOA 1K8AU 4IUPA 1I8FA 4RKUE 4M78D 1VQ5T 2DKGA 3O8VA 2K4YA 3PFSA 5CKHA 5LJ3f 3L2VA 2E65A 3OMGA 4MMLA 5LJ3h 3OYKA 4XU0A 3SD4A 4A4HA 3V7SA 4C5GA 3G6EA 4A4GA 3LWIA 3GP8A 4HCBA 2EQKA 3LGFA 1G3SA 2FL7A 3JCMX 2CKKA 3M57A 4QVDA 4HT9A 1VQLA 5LJ3j 4XTXA 5CAIA 2PVOB 3FDRA 1Q86C 3HRSA 2GCXA 4FSXA 3CCRA 4XQ3A 3EAEA 4NOYA 2K5FA 2K3XA 3VJPA 3GPLA 1YJ9T 2XHCA 2DTIA 5GMKh 3SDZA 4RG8A 3C4SA 2MF2A 1SSFA 4OP0A 5GAN2 4JRPA 4JUVA 3JCMb 1S72T 2K3YA 4RMOA 2FB7A 1NJIU 3JRZA 4E47A 5KCHA 4M78E 5CR2A 2ZPFB 1KG1A 4PJOE 2RI3A 4N4GA 3HRUA 4C92F 3FB9A 3HRTA 3HPWA 4QQ6A 3CEYA 2E6NA 3OS2A 3CBMA 4E7HA 5FRNA 4JDSA 4PJOB 4M7AE 2KMTA 2XG8D 4NL3A 3CCSA 2M16A 3KUFA 3OYNA 5I21A 3JCMc 2O4XB 3CC4T 3A8OB 4M7AB 4F7UF 1VQMT 3MEVA 1FXXA 3P8HA 3L2WA 2WSFE 5LJ5d 3OYEA 3OYFA 2O4XA 2OTLA 3BFMA 4M7AA 4IUUA 1M1KU 1VQOT 2RHZA 2ZPEB 1VQ9A 4TVRA 2RK2A 2PQWA 1YJWA 4J6WA 1OZ2A 3CCEA 5A0LA 5GMKm 4OB0B 2PU9B 5CKBA 4JJNK 4JS5A 1Q81C 4HCZA 1W2BS 2C06A 2RJDA 3JB9F 2IVWA 4PKCC 4B9XA 3CC7T 3JCMd 1FWZA 4P5NA 2ZGWA 2RI2A 3X24B 5KE3A 3I56T 3OS5A 3QIIA 1KQ2A 1Q82C 1JB0E 3WVDB 5M9OA 3JCMJ 2DVEA 3GLXA 3QSUA 1Q82U 2ZZDA 1RI0A 3HL8A 3X25B 3A8MB 4BD3A 2QTXA 2LQ8A 5GMKe 2EQMA 2D6FA 2CZ0B 4ME7A 5GAMg 3M55A 4YTLA 4QVZA 5GAOp 3SWNC 1X6OA 2HQEA 3E9FA 2K57A 2JTFA 2XI9A 4UC4A 3QZ9B 1VQPT 4LDYA 1VQ8A 5C6SA 2DZCA 5LL6S 3J80E 1YJNA 3P8DA 5FRMA 3JSCA 2DAQA 3CCUT 1K9MC 4M77D 2M9UA 2Y90A 2QQRA 2LCCA 1K73C 4ZN3A 4C0FA 4M78F 1VQKT 3G71T 2EQUA 3GF5A 1ZBXA 5HK3A 3RMQA 3PTAA 3CXCS 3QBYA 4IUTA 1VQ6T 3J7AF 2LX9A 3OQ5A 4ZN1A 4HCCA 1BKBA 5CIUA 3OBYA 2DJZA 3E9GA 2RK1A 4L59A 5DM7R 5GAOl 3AHUA 1G3WA 2X4JA 4LDWA 4GY5A 3RKXA 2HNIA 4XTWA 2K5LA 1Q7YC 4LDVA 3FJPA 4E7KA 2L8DA 3CXCA 1R8OB 2E70A 3OSVA 4C92A 3CC2A 2Y4YA 5GAN6 1VQNA 2A7YA 5KE2A 3CMAA 1Y71A 1KC8C 3FEOA 3CCQT 4ELYC 1QW1A 2XICA 1UEBA 4BUGA 1BI3A 3CMET 2VGMA 3E19A 3OSSC 2X35A 4FL6A 4A54A 4M78C 4F7UA 3SWNB 3FC3A 1BYMA 2ZPIB 1N6AA 1X75C 3CCMT 5J39A 4L6V5 1LOJA 4XTYA 3SWNA 2KSSA 2VUBA 4EMKC 3LH0A 5CKFA 4R55A 2L89A 4XU3A 3M9QA 5GAOq 2ZPGB 3H8ZA 5D6YA 1RL2A 4NS5A 5GAMe 2KY9A 4EMHA 5A2QE 1N8RC 4M7DG 1O75A 1WJQA 3LX7A 4GLKA 5GANd 3OYAA 4KT0E 2QEXA 3M59A 4A53A 5FU6C 4XTZA 2BIVA 4QQGA 2E5QA 3UPUA 4M7DC 4J83A 4JS4A 5HY6A 4C8QG 3PNWC 3ZFJA 5GMKl 2A3LA 3X20B 3WXMB 3M56A 4OB1B 4RCCA 1NPPA 5J3BA 4JRKA 3BDLA 4PL6A 5D6WA 4LDXA 1S72A 4RCBA 2CS7A 5GMKi 3M4GA 3OYIA 1QP3A 4N4IA 3TEEA 4X9DA 2L3RA 2OAUA 3QPHA 2JZ2A 4OF1A 5CO7A 1Q86U 2RHIA 1I4K1 3QXEB 4M7DD 3CCJT 3RESA 3DB3A 5LJ3d 2YRVA 2KDSA 3MEUA 1YHQA 2QI2A 2M0OA 4Y28E 3ASKA 3CD6T 2DIQA 3MO8A 4C8QD 1I5LA 1YITA 2DZ9A 1H3ZA 3LWHA 3V7RA 4MZMA 1VQMA 4CI0C 4D6WA 3CCLT 3RERA 5HKCA 5GMKj 1U8RA 2EWNA 3M54A 2DO3A 2R57A 3M4YA 4FU6A 2DXTA 4X34A 4M78B 2VXEA 2QQAA 4IKFA 1K73U 2AHJB 4FT2A 3S3NA 3PT9A 5I2SA 2YLBA 2IG0A 2RM4A 2LNVA 3JAME 4M78A 1VUBA 4EMKB 4PJOA 1NPRA 3G6ET 4C5HA 1KD1C 1NZ9A 4OGEA 4DOVA 2M1HA 4M77F 4EMKA 2P0PA 2RB6A 4QQDA 2QQBA 4Z02A 4E7JA 2LTOA 1KHCA 1YIJA 3L2RA 2KQWA 1G3TA 4M7DE 3OYYA 4PLIA 3CCRT 2EIFA 2CZ6B 2DD5A 3I55A 5FU6B 5DY9A 1Y7XA 3LGLA 4II1A 2OTJA 4OB3B 4M7DB 2DXUA 2L5QA 4C8QE 3I56A 1BIAA 2LT4A 3UWNA 1QP2A 3ZEHA 3L1AA 1IREB 2E1HA 2XU8A 4E7IA 1Q81U 3JCMg 1W4SA 3PMTA 4HA8A 3VYHB 4M75G 5I2MA 2X4WA 1G3YA 5A0DA 1VQ4T 3JCMV 4CRIA 3VUZA 2DPPB 4JRIA 3G4ST 5GAN5 1N27A 4J6YA 2E6ZA 4BB7A 1M1FA 2RO0A 2ZPHB 2EJGA 3A8LB 1ZQ1A 4KULA 4M77G 5AYFA 2JVVA 2P4TA 1U1SA 2PVGB 3ME9A 4JRQA 5DLQE 4E7LA 1VQ7T 3OS0A 4M77C 5CCAA 2DTHA 3HP9A 1UGQB 4XTVA 3QKJA 3RMSA 2FHDA 4M75D 2O01E 3TU4K 2XDPA 3MCAB 5CKDA 5CVIA 4XAXB 4XU2A 5GAMf 3CPWA 1VQKA 1JRIA 1WGSA 3DLLA 4BE1A 1VQ9T 5GAMh 2FYKA 2NLUA 3RKWA 1O9SA 1I81A 2QA4T 5FLXE 1VQ6A 2RA2A 2BUDA 3QJ6A 1K9MU 2JTMA 4KUIA 5GAN3 4ZTFA 2DTOA 3MP6A 4BE0A 5GAMj 1MGQA 3QHSA 1YCYA 2PUKB 3OS1A 2RHXA 3LW5E 5CK9A 3V8LA 4DA4A 5GAOn 1U1TA 2LVMA 2HAXA 4BI8B 5GAN8 2D0QB 3MEWA 3NTIA 2MAMA 2X4YA 4BI4A 1M5Q1 1M9SA 3VU3C 4MMKA 4X9CA 2RH2A 5LJ5e 2LDMA 4L5GA 2RHUA 5GAN4 4NL2A 5HK0A 3KBGA 2JNGA 2LQKA 4M75E 2KAFA 3BW1A 1M4ZA 3QYHB 2P0QA 2F69A 2HBPA 3HFNA 3V8KA 4FIBA 5DLOA 5CKEA 2E12A 2RHYA 3V8JA 4M7DF 2E41A 5FU7C 2KVQG 3JB9I 3CCVA 4C5IA 3CCMA 1Q7YU 1YJNT 2MWPA 4M77E 3RUXA 2RI5A 3HFOA 4PNOA 4ELZC 3BY7A 3EFSA 4C8QF 3OYCA 3OYLA 5D6XA 1JJ2S 1KC8U 3JCMe 2EQJA 2QDYB 4M77B 4DOWA 3R6OA 2QQSA 1ZHIA 2WSEE 4ZTJA 1VQ5A 4KBMB 1YI2T 2I2LA 1BIBA 3QG1A 3VKIA 5GAOr 3QYGB 2F5TX 1WPYA 1X01A 4OVAA 4A4KA 4DQ2A 3OYGA 2VGNA 4C0DC 4J8OA 2ZPBB 3HHTB 3LLRA 1LNXA 3OB9A 5CQXA 1M90C 4BACA 3OY9A 3NFCA 3OW2S 2XDDA 1M90U 2JN0A 2XD0A 2EJFA 1KQ1A 5GANg 1JJ2A 1D3BB 2WACA 5KH6A 3JB9H 3BDUA 4J7IA 3MP8A 1Y96B 3QDRB 3OYDA 2YHTA 2XDBA 1YJ9A 1N8RU 1D3BA 5IT9E 3CCJA 4XU1A 2RJFA 3CBPA 1Y96A 5IN1A 2F5KA 3SFMA 3GNGA 1VQNT 1KQSA 3CD6A 4C8QC 3CMAT 2G3RA 4BY6C 2VXFA 3OBWA 1K8AC 3OW2A 1QVGS 4ZGEB 2GF7A 2H3JA 5LJ3g 3OYHA 4J5YA 2RD1A 2HQXA 3M53A 3NTHA 1N9SA 3JB9J 3DB4A 3VUBA 4PJOD 5A0GA 3L2QA 4IUQA 2GFAA 5FU7B 3M58A 4BI3A 4LD6A 2PUOB 5FROA 4IUVA 2EAYA 3UT1A 3S3MA 4OB2B 4MZTA 3VYGA 1KHIA 1TH7A 3OYMA 1PSFA 3CC4A 4M7AD 1P92A 2EFIA 2PVDB 3OYBA 1VIEA 2VC8A 4J6XA 3S6WA 1QVGA 3C12A 3GNFB 2R5AA 1BI1A 4HT8A 1HXDA 4M75F 5GAOm 4BE2A 4HKEA 2V8JA 1VQOA 2QEXT 2DXBA 3QUIA 4C0DB 5LJ5g 4LD9K 4C0ZA 2CZ1B 3FLGA 3A8HB 4J7FA 2R58A 1NJIC 5LJ5f 4C5EA 2LC4A 1KD1U 1VQLT 1OZ3A 3JCMW 5LJ5h 4XTUA 3CPFA 2DXCA 3CC7A 4MDXA 1VQ4A 3C95A 1G5VA 3X28B 4MZPA 2D9TA 5GAN7 3G4SA 3SB2A 4A4FA 1YHQT 1EIFA 4VUBA 1B34B 2GFUA 5LJ5j 1QVFS 2GQVA 4M7DA 2ZCFB 1UGSB 3MP1A 4BY6B 4C8QB 5KCOA 1YITT 4V2SA 1B34A 3E1SA 3DKMA 5GANe 1VQ7A 1AHJB 3Q1JA 3CPWS 3JCMf 1JBMA 4M75C 4A4EA 4C8QA 1M1KC 3TREA 2DIGA 3RKYA 3QJYA 3JCMh 1VQPA 2V8KA 4QW2A 1HK9A 4JLIA 4OGCA 3MEAA 3CCST 2CZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9R A;  1M5Q 1;  3SWN A;  3VU3 C;  4EMK C;  4MMK A;  4X9C A;  5LJ5 e;  4OP0 A;  4XU3 A;  5GAN 2;  5GAN 4;  4NL2 A;  4JUV A;  3JCM b;  2EJ9 A;  5GAO q;  2FB7 A;  4M75 E;  3BW1 A;  4M78 E;  4C92 G;  5LJ3 e;  1H64 1;  5GAM e;  4PJO E;  4EMH A;  4C92 F;  3HFN A;  3FB9 A;  3V8K A;  4M7D G;  5GAN d;  4Y91 A;  3V8J A;  4A53 A;  4C92 C;  2E41 A;  4XTZ A;  4M7D F;  4PJO B;  3JB9 I;  4M7A E;  4M7D C;  4NL3 A;  3JCM P;  4C8Q G;  4M77 E;  3RUX A;  3HFO A;  4F7U G;  5GMK l;  4PNO A;  5I21 A;  4N0A C;  4RCC A;  3BY7 A;  3EFS A;  3JCM c;  4M7A B;  4C8Q F;  4F7U F;  3HSB A;  1WQ7 A;  4JRK A;  3INZ A;  1M8V A;  3JCM e;  4M77 B;  4RCB A;  5GMK i;  5LJ5 d;  3M4G A;  3BFM A;  4C92 D;  4X9D A;  2I2L A;  1BIB A;  2DEQ A;  4QVC A;  5GAO r;  3GIB A;  4M7A A;  1I4K 1;  4M7D D;  3RES A;  1WPY A;  1X01 A;  2YLC A;  5LJ3 d;  4DQ2 A;  5GAM d;  3EFR A;  4J6W A;  1LNX A;  3PGG A;  5GMK m;  4C8Q D;  1I5L A;  2DZ9 A;  2JN0 A;  3V7R A;  3RER A;  3JB9 G;  2EJF A;  3RIR A;  1KQ1 A;  5GAN g;  5GMK j;  1D3B B;  2EWN A;  3JB9 F;  3JB9 H;  3BDU A;  3FIF A;  1Y96 B;  2DXT A;  4M75 B;  2VXE A;  2YHT A;  4M78 B;  3JCM d;  1D3B A;  2ZGW A;  4PJO F;  4XU1 A;  2YLB A;  2RM4 A;  4M75 A;  1Y96 A;  1KQ2 A;  4M78 A;  4EMK B;  3V7C A;  3JCM J;  4PJO A;  2DVE A;  4C8Q C;  4M7A F;  3QSU A;  2VXF A;  3L2Z A;  4M77 F;  4EMG A;  2CGH A;  3QO3 A;  2QTX A;  4EMK A;  5GMK e;  2RB6 A;  3JB9 D;  5LJ3 g;  4C92 E;  4J5Y A;  2RD1 A;  4C8Q A;  4M77 A;  4WF2 A;  5GAM g;  5GAO p;  3SWN C;  4M7D E;  1WNL A;  2K57 A;  1N9S A;  3JB9 J;  4PJO D;  4C92 B;  5DY9 A;  2DZC A;  4M7D B;  2DXU A;  4C8Q E;  2EAY A;  1BIA A;  4F7U E;  4M7A D;  1TH7 A;  2E10 A;  3L1A A;  2E1H A;  4M77 D;  1WQW A;  3JCM g;  2VC8 A;  4HA8 A;  2Y90 A;  4J6X A;  4F7U B;  1LJO A;  4M75 G;  3JCM Q;  4M78 G;  4N0A A;  4PJO G;  1HXD A;  4M75 F;  5GAO m;  5GAN f;  4M78 F;  4HT8 A;  3JCM V;  4JRI A;  5GAN h;  5GAN 5;  4J6Y A;  4PJO C;  4M7A G;  3QUI A;  5LJ5 g;  2EJG A;  4M77 G;  2E64 A;  1U1S A;  4M7A C;  5LJ5 f;  4M77 C;  5GAN j;  2DJZ A;  2DTH A;  5GAO l;  4XTV A;  3JCM W;  5LJ5 h;  3AHU A;  1I8F A;  4M75 D;  4XTU A;  4M78 D;  3RKX A;  2HNI A;  2DKG A;  5LJ3 f;  2E65 A;  4XTW A;  4XU2 A;  5GAM f;  4MML A;  5GAN 7;  1JRI A;  5LJ3 h;  3SB2 A;  3FJP A;  5GAM h;  1B34 B;  2FYK A;  4XU0 A;  3RKW A;  4C92 A;  3V7S A;  5GAN 6;  1I81 A;  5LJ5 j;  2RA2 A;  4M7D A;  4C8Q B;  4V2S A;  1B34 A;  3JCM X;  5GAN e;  4QVD A;  5GAN 3;  4HT9 A;  5LJ3 j;  2DTO A;  4XTX A;  5CAI A;  5GAM j;  1MGQ A;  3QHS A;  1JBM A;  1YCY A;  4M75 C;  3JCM f;  4M78 C;  4A54 A;  3SWN B;  3V8L A;  3RKY A;  4XQ3 A;  3JCM h;  1U1T A;  4F7U A;  4NOY A;  5GAO n;  1HK9 A;  4JLI A;  5GAN 8;  2DTI A;  5GMK h;  1LOJ A;  4XTY A; 
#chains in the Genus database with same CATH topology
 3F70 A;  1WX6 A;  4Z89 A;  2FEI A;  4C0G A;  3KFV A;  2OTL T;  5LJ3 e;  4C92 G;  2Y4X A;  1Y07 A;  4Y91 A;  3VS5 A;  3VV0 A;  3JCM P;  2K5I A;  2DL5 A;  1SHF A;  4KUD K;  3INZ A;  1WHJ A;  3GIB A;  2DEQ A;  2M51 A;  1GCQ A;  1VQL Q;  2YLC A;  2CT4 A;  5GAM d;  2LJ3 A;  1W1F A;  1K8A R;  3CME A;  3MET A;  4Q5W A;  4RTY A;  4B9W A;  1H8K A;  4M75 B;  2FPE A;  1YI2 A;  2MPX C;  3CBO A;  2VYT A;  3HKS A;  1XNI A;  5J26 A;  3H41 A;  1K0S A;  2KK4 A;  2JT4 A;  1VIF A;  3MHX A;  2B8A A;  4EMG A;  3JB9 D;  1JO8 A;  3REB B;  3PVL A;  1EX4 A;  4M77 A;  4WF2 A;  2XID A;  1WNL A;  2LRQ A;  1AD5 A;  2KYB A;  2OTL Q;  1SHG A;  1NG2 A;  1WLP B;  2RJC A;  2C0I A;  1VQ9 Q;  1RLQ C;  4LN2 A;  2XK0 A;  4M78 G;  1V1C A;  4N0A A;  4PJO G;  1RAF B;  1QVP A;  2QK0 A;  4M7A G;  1UUE A;  1Z9Z A;  1X69 A;  2R5M A;  1UB4 A;  3CCL A;  2CSQ A;  5GAN j;  3URG A;  1M1K R;  2L3S A;  4IUP A;  1I8F A;  1KFZ A;  3PFS A;  3L2V A;  3OMG A;  1E7O A;  2DA9 A;  3UAT A;  1IHW A;  3NMZ C;  1HYO A;  2ATC B;  3SD4 A;  3V7S A;  4C5G A;  2XMF A;  1NEG A;  4HCB A;  2JS2 A;  5LJ3 j;  5CAI A;  1TSF A;  1WZO A;  4XQ3 A;  2DM1 A;  1YJ9 T;  2ROL A;  3GPL A;  4RG8 A;  2HCK A;  3U23 A;  2MF2 A;  4OP0 A;  3JCM b;  1S72 T;  2RN8 A;  2VKN A;  3OW2 P;  1T3L A;  3JRZ A;  2RI3 A;  3FB9 A;  2E6N A;  2KMT A;  2M16 A;  2IPO B;  2FG0 A;  3JCM c;  2DEU A;  1RAB B;  3A8O B;  1VQM T;  4AT1 B;  2QTV A;  1FXX A;  1VQN Q;  2WSF E;  3R6N A;  1D1B A;  5KYX A;  3OYE A;  3OYF A;  2O4X A;  4M7A A;  2K3B A;  2K7A A;  2PQW A;  1YJW A;  4J6W A;  2L0A A;  5A0L A;  5GMK m;  2PU9 B;  4X1V A;  1TTH B;  4PJM A;  3JB9 F;  4J9H A;  4Y92 A;  4HVV A;  4PKC C;  4LUE A;  1AWX A;  2ZGW A;  2HKQ B;  1UJY A;  1KQ2 A;  3JCM J;  2F2W A;  2DVE A;  4ANJ A;  3HL8 A;  2D6F A;  2W0Z A;  2EQM A;  1KK7 A;  2ENM A;  2CZ0 B;  3M55 A;  4YTL A;  3E9F A;  2K57 A;  1S72 Q;  2DZC A;  5FRM A;  3JSC A;  4M77 D;  2QQR A;  2FZK B;  1TXQ A;  1BCO A;  1MUZ A;  4E7S A;  4C0F A;  1VQM Q;  3G71 T;  3GF5 A;  2LX9 A;  3OQ5 A;  2RQR A;  3OBY A;  5DM7 R;  1G3W A;  1K1Z A;  2X4J A;  1WHM A;  3RKX A;  4HVU A;  4LDV A;  2LCS A;  2L8D A;  4E7K A;  3CXC A;  3EGX A;  1KC8 C;  3VRY A;  5IXF A;  1UEB A;  4BUG A;  2VGM A;  3E19 A;  4A54 A;  2X35 A;  4F7U A;  2D0N A;  4K11 A;  4PFP A;  3SWN B;  2ZPI B;  3SEM A;  2VUB A;  3M0S A;  2LMJ A;  1X27 A;  4E6R A;  4XU3 A;  2CSI A;  5IHN A;  5I22 A;  5D6Y A;  5L23 A;  4EMH A;  1WJQ A;  1A0N B;  1RAI B;  2NUP A;  3D7S B;  1WDX A;  5HY6 A;  4C8Q G;  1NPP A;  4JRK A;  3BDL A;  4ORZ A;  4LDX A;  4LXC A;  1OQK A;  1UHC A;  4X9D A;  2OAU A;  2EYX A;  3QPH A;  5CO7 A;  1Q86 U;  1I4K 1;  1YHQ A;  3EG9 B;  4JZ4 A;  2PZ1 A;  2KBT A;  3EG2 A;  2EKH A;  3LWH A;  4F17 A;  1H3Z A;  5HKC A;  2EWN A;  2FRY A;  3M54 A;  3I35 A;  4M78 B;  4D8K A;  9ATC B;  2RM4 A;  2BZY A;  2A0F B;  4EMK B;  1X6B A;  3G6E T;  1B7T A;  3CCV Q;  4M77 F;  4Z02 A;  4E7J A;  3L2R A;  1GBR A;  1G3T A;  2YUO A;  3CCR T;  5FWC A;  2DD5 A;  5FU6 B;  1VQ5 Q;  5DY9 A;  1Y7X A;  4II1 A;  2DXU A;  3I56 A;  3EGD A;  1QP2 A;  1BB9 A;  3ZEH A;  3ZL7 C;  1RLP C;  3JCM g;  3PMT A;  1HSQ A;  5AT1 B;  1VQ4 T;  2BZ8 A;  3VUZ A;  5GAN 5;  4J6Y A;  2AIR B;  5AYF A;  3GOX A;  3H9N A;  2NYS A;  1U1S A;  4JRQ A;  2KI7 A;  5DLQ E;  1Z9Q A;  2E4H A;  3OS0 A;  2DTH A;  3HP9 A;  4AFU C;  4OMP A;  2XDP A;  5CKD A;  1VQK A;  2DYI A;  4OML A;  2BUD A;  8ATC B;  2GTO A;  1N8R R;  4BE0 A;  4ESR A;  2JXB A;  1X2K A;  3LW5 E;  3QDF A;  2HMA A;  2D0Q B;  1M9S A;  2RHU A;  5GAN 4;  2LQK A;  1TUG B;  1VYU A;  3QYH B;  2DBK A;  2F69 A;  1UJ0 A;  2LNH B;  3HFN A;  3EHR A;  4FIB A;  5CKE A;  2E12 A;  1D1C A;  5FU7 C;  3H0F A;  4C5I A;  2KNB B;  1YJN T;  1VQ4 Q;  5KYY B;  5D6X A;  1JJ2 S;  2EQJ A;  1V76 A;  1PCX A;  1SKU B;  1CKB A;  3EG0 A;  1YI2 T;  3QG1 A;  2KXD A;  1X01 A;  2ROT A;  2VGN A;  2ZPB B;  3HHT B;  3OB9 A;  1LNX A;  2VB6 A;  3CQT A;  2JM8 A;  1D0Y A;  3FJ5 A;  2HDA A;  4JJB A;  1M90 U;  2WAC A;  1YJ9 A;  1D3B A;  2RJF A;  3CBP A;  4WCI A;  3SFM A;  2NUT B;  2KRS A;  3CMA T;  4BY6 C;  1K8A C;  1JQQ A;  1IGU A;  5HCK A;  2RD1 A;  1GFC A;  3M53 A;  1FMK A;  3M0T A;  5FRO A;  3S3M A;  3VYG A;  3OYM A;  1K4U S;  4DEY A;  2PVD B;  1EFN A;  1VIE A;  2VC8 A;  3S6W A;  1YJN Q;  3C12 A;  2LP5 A;  2R5A A;  3NPF A;  1HXD A;  5GAO m;  2O9S A;  1ABO A;  2DXB A;  4C0D B;  4LD9 K;  1YI2 Q;  1EZZ B;  4D8D A;  2EGA A;  2JM9 A;  5LJ5 f;  1GCQ C;  1OZ3 A;  2HEQ A;  4MDX A;  3C95 A;  1J3T A;  4MZP A;  3G4S A;  4VUB A;  1B34 B;  3EFO A;  4PJN A;  2L2P A;  2ZCF B;  1UGS B;  3MP1 A;  4C8Q B;  2BZX A;  4V2S A;  3E1S A;  1VQ7 A;  2DE0 X;  1N5Z A;  1PKT A;  3CPW S;  3JCM f;  1M1K C;  4JLI A;  1TUC A;  4CC4 B;  4JRP A;  1KC8 R;  3MEA A;  4AG2 C;  3THK A;  1M2O A;  1WXU A;  3OYJ A;  1QWF A;  4JLG A;  1YBY A;  2LX7 A;  2HZY A;  4OMF B;  3VS2 A;  3N5B B;  2HL3 A;  2AT1 B;  2EQI A;  3CCL Q;  3G71 A;  2YUQ A;  2VV5 A;  2RQT A;  4C92 C;  1YJW T;  2COZ A;  1F1B B;  1BU1 A;  5CQY A;  4N0A C;  2P0K A;  1JXM A;  3A8G B;  1WQ7 A;  2RJE A;  2MI6 A;  1CKA A;  2EYW A;  2DYB A;  1PSE A;  3WVE B;  2EYQ A;  3G1J A;  3QZ5 B;  1ZBJ A;  3PGG A;  2WSC E;  3JB9 G;  3RIR A;  3S3O A;  1RAA B;  2OJ2 A;  2A37 A;  2CRE A;  3M5A A;  3FIF A;  3OMC A;  4FT4 A;  2CP3 A;  1WFW A;  4M75 A;  1S1N A;  2QXF A;  5IH2 A;  1UGR B;  1WJS A;  1QCN A;  1OOT A;  2CGH A;  1FX7 A;  2JW4 A;  2LT1 A;  1SSH A;  1BI0 A;  1GRI A;  3L42 A;  2JMC A;  4O5V A;  4RTZ A;  1NLO C;  2QGF B;  2DD4 A;  1YJW Q;  1WQW A;  2E3H A;  2VVK A;  3QWX X;  2DNU A;  2CP7 A;  2LCL A;  4FYX B;  5GAN h;  4PJO C;  2E64 A;  2V8I A;  4XK8 E;  1DJ7 B;  1UGV A;  4M7A C;  4ZGJ B;  1NE8 A;  4EPC A;  3H0H A;  4RKU E;  1R0C B;  2K4Y A;  3O8V A;  1ZA2 B;  3EH2 A;  4MML A;  2F2X A;  2COW A;  5FW9 A;  5LJ3 h;  4A4H A;  3G6E A;  3EH1 A;  3LGF A;  1G3S A;  2FL7 A;  3JCM X;  2QYZ A;  3EHQ A;  2PVO B;  3FDR A;  3CCR A;  2K5F A;  2EBP A;  5GMK h;  3SDZ A;  1GL5 A;  3C4S A;  1GBQ A;  1KIK A;  4RMO A;  1NJI U;  5KCH A;  1UEC A;  1MMG A;  2ZPF B;  1KG1 A;  3HRU A;  3HRT A;  2ESW A;  4JDS A;  1NLP C;  1NYG A;  4NL3 A;  3CCS A;  3KUF A;  4LNP A;  2CP0 A;  1BK2 A;  2AKK A;  3P8H A;  4Z88 A;  2KE9 A;  3BFM A;  1PC0 A;  2YSQ A;  2EVR A;  3CCE A;  4OB0 B;  5CKB A;  4JS5 A;  1W2B S;  2C06 A;  2IVW A;  4B9X A;  1FWZ A;  1Y57 A;  2RI2 A;  3X24 B;  2C0O A;  3I56 T;  3OS5 A;  1ZX6 A;  3QII A;  2D8J A;  1JB0 E;  5M9O A;  3QSU A;  2FPD A;  3X25 B;  1WIE A;  2QTX A;  3TSZ A;  5GMK e;  4ME7 A;  5GAM g;  4QVZ A;  2KEA A;  1X6O A;  2HQE A;  2XI9 A;  1VQ8 A;  1IRX A;  1M3B A;  3J80 E;  1YJN A;  1OPL A;  2DAQ A;  3CCU T;  1YHQ Q;  2DJQ A;  2M9U A;  1QCO A;  2Y90 A;  2YUP A;  1VQK T;  2EQU A;  3LH5 A;  1RAD B;  3A1P A;  3J7A F;  4FYY B;  4HCC A;  1ARK A;  2FZC B;  3E9G A;  1Q86 R;  2RK1 A;  5GAO l;  4GLM A;  1WYX A;  2CP6 A;  4XTW A;  1E6H A;  4FYW B;  2K5L A;  1ZSZ B;  3VS1 A;  2E70 A;  3OSV A;  4C92 A;  5GAN 6;  1Y0M A;  2A7Y A;  3CMA A;  1Y71 A;  3I56 Q;  1QKW A;  2YWW A;  3VS4 A;  4CC7 A;  5J39 A;  4L6V 5;  4XTY A;  3SWN A;  2KSS A;  3VRZ A;  1D1A A;  1UFF A;  2L89 A;  3M9Q A;  5GAO q;  3H8Z A;  4NS5 A;  2FZG B;  2KY9 A;  5A2Q E;  1N8R C;  3LX7 A;  4GLK A;  5GAN d;  3OYA A;  2RQV A;  3RNJ A;  4XTZ A;  4AFZ C;  4J83 A;  4JS4 A;  3PNW C;  3ZFJ A;  2A3L A;  1VQK Q;  4RCC A;  5KYU B;  5GMK i;  2QGG A;  3OYI A;  1QP3 A;  4WTO B;  2L3R A;  4OF1 A;  1OUL A;  4M7D D;  2LQN A;  3DB3 A;  5LJ3 d;  1I0C A;  2YRV A;  1Q82 R;  2O9V A;  2K79 A;  2M0O A;  3ASK A;  1KQS P;  3MO8 A;  2YRC A;  3V7R A;  3VS7 A;  5GMK j;  3EG9 A;  2DO3 A;  2DXT A;  4IKF A;  2AHJ B;  3JAM E;  1RAG B;  4M78 A;  1VUB A;  1M3A A;  4PJO A;  2E3I A;  2MYS A;  4OGE A;  2M1H A;  1LVK A;  4EMK A;  2P0P A;  2RB6 A;  4QQD A;  2QQB A;  2LTO A;  1G8X A;  2J6O A;  4M7D E;  4PLI A;  2EIF A;  7AT1 B;  4M7D B;  2DER A;  1U5S A;  1IRE B;  2BE9 B;  2XU8 A;  4E7I A;  1Q81 U;  3VYH B;  4HA8 A;  2L3Q A;  1JXO A;  4M4Z A;  1G3Y A;  1GFD A;  4JRI A;  2EYZ A;  3G4S T;  1WI7 A;  4KUL A;  3A8L B;  2EJG A;  1YJ9 Q;  1ZQ1 A;  3ME9 A;  1VQ7 T;  1TG0 A;  2O01 E;  3RBB B;  1M3C A;  1WHG A;  5CVI A;  1D0X A;  2ED1 A;  5GAM f;  3CPW A;  1JRI A;  1WGS A;  3DLL A;  2CT3 A;  2FYK A;  1I81 A;  2CDT A;  1K9M U;  2JTM A;  5GAN 3;  1PWT A;  2M02 A;  4ZTF A;  2X3X D;  1MGQ A;  3QHS A;  4FW1 A;  1K73 U;  5CK9 A;  1RAC B;  1U1T A;  4AG1 C;  2X4Y A;  3VU3 C;  4MMK A;  4X9C A;  2RH2 A;  5LJ5 e;  4L5G A;  2KRM A;  3KBG A;  2JNG A;  1IB8 A;  3V8K A;  5DLO A;  5I11 A;  2RHY A;  4M7D F;  3JB9 I;  1Q7Y U;  2FRW A;  5EC7 A;  4M77 E;  3RUX A;  4RUG A;  4PNO A;  3G4S Q;  2ABL A;  2F2V A;  3OYC A;  3OYL A;  3JCM e;  4M77 B;  2QDY B;  4DOW A;  4ZTJ A;  2I2L A;  1BIB A;  1VQ7 Q;  2A36 A;  1SPK A;  2CUB A;  3NFC A;  4J9C A;  3OW2 S;  2XD0 A;  2EJF A;  1KQ1 A;  3M0P A;  3JB9 H;  4J7I A;  1Y96 B;  1T0J A;  2DVJ A;  4Z8A A;  5IT9 E;  4QT7 A;  4KH0 B;  3CCJ A;  4XU1 A;  1PRM C;  5KYW B;  2QG9 B;  3G71 Q;  2VWF A;  2FPF A;  2G3R A;  4ZGE B;  2GF7 A;  3NHN A;  3OYH A;  5GJW B;  3JB9 J;  2JMA A;  4PJO D;  5A0G A;  3L2Q A;  2GFA A;  4DBF A;  2PUO B;  4M7A D;  1KHI A;  3OYB A;  1ABQ A;  4J6X A;  4PFZ A;  1QVG A;  1BI1 A;  4HT8 A;  1WHL A;  4BE2 A;  1ZLM A;  4HKE A;  4DBR A;  2QEX T;  1ZSG A;  1PNJ A;  5LJ5 g;  2J6K A;  4J7F A;  2R58 A;  1KD1 U;  1SG5 A;  3JCM W;  4LE9 A;  3CPF A;  1M27 C;  2W10 A;  1NM7 A;  2RF0 A;  3X28 B;  2D9T A;  3E2U A;  2BE7 D;  1EIF A;  1UG1 A;  5LJ5 j;  2RNA A;  1YIT T;  5KYX B;  1B34 A;  1AHJ B;  3Q1J A;  4C8Q A;  4M75 C;  2X51 A;  3RKY A;  4QW2 A;  2LJ1 A;  3CCS T;  1N9R A;  2K2V A;  3CCU A;  2A08 A;  2QQ9 A;  1QVF A;  3G7Z A;  3C94 A;  3UA7 A;  1YIJ T;  1H64 1;  2K2M A;  2DFU A;  1NEB A;  3I55 T;  1VOM A;  1OI1 A;  3CCE T;  2OTJ T;  1PKS A;  2ED0 A;  3G6E Q;  3ZBD A;  4R56 A;  1W2B A;  4QVC A;  2EYY A;  5IAY A;  3PMI A;  1ZUK A;  2BKD N;  1WJR A;  3ER0 A;  1IZ6 A;  3CCR Q;  1SRM A;  1U06 A;  1BI2 A;  3KXT A;  1Q95 G;  1XOV A;  5EG2 A;  1E6G A;  5C0M A;  1GCP A;  1M1G A;  3TSW A;  3LYI A;  2CYZ B;  2YXY A;  1VQ8 T;  1VYV A;  4RTW A;  4PJO F;  3L2U A;  4N4H A;  2OI3 A;  1PD1 A;  5L8R E;  4HCK A;  2XKO C;  1OV3 A;  4M7A F;  2HD0 A;  3CCS Q;  2ZAE A;  1QQJ A;  1QKX A;  4RG2 A;  3EGX B;  4CC2 A;  4F7U E;  4IUR A;  1NJI R;  3FRN A;  1UDL A;  3I55 Q;  3TCJ A;  2EKO A;  3CCE Q;  1XJW B;  4F7U B;  2JUF A;  1MHN A;  3PIP A;  1PHT A;  3P8B B;  1GXI E;  1D09 B;  1OU9 A;  4HVW A;  4ZGD B;  3CXC P;  3NTK A;  3UDC A;  2CP5 A;  3QWY A;  3DLM A;  2CUD A;  2E65 A;  4OMM A;  4DBQ A;  4XU0 A;  4IIM A;  1WXB A;  4A4G A;  3LWI A;  3GP8 A;  2DL4 A;  1VQ8 Q;  2EQK A;  1W6X A;  4RTU A;  3M57 A;  4QVD A;  4HT9 A;  4XTX A;  1Q86 C;  2GCX A;  3RR6 A;  1UTI A;  1RUW A;  4NOY A;  2K3X A;  3IQL A;  2DTI A;  1I5O B;  4JUV A;  3EGU A;  3PE0 A;  1U3O A;  4FW2 A;  4N4G A;  1MNE A;  1IHV A;  4OMN A;  3CEY A;  3OS2 A;  5FRN A;  4E7H A;  2HSE B;  1KSW A;  2XG8 D;  4F04 B;  1ZUY A;  3OYN A;  3CC4 T;  4F7U F;  3MEV A;  3L2W A;  3CMA Q;  2D1X A;  1QVG P;  4IUU A;  1YWP A;  1T0H A;  1VQO T;  2PTK A;  2DL3 A;  5IHK A;  1AWW A;  1OZ2 A;  1K76 A;  5GJV B;  4PJL A;  5D7U A;  1SF9 A;  4HCZ A;  1UHF A;  3RDV A;  2RJD A;  2QAS A;  1QCF A;  4IIO A;  2HBW A;  3CC7 T;  3MKD A;  4KGZ B;  4E7Z A;  1Q82 C;  4OMO A;  3WVD B;  4JZ3 A;  1ZA1 B;  1YCS B;  4BD3 A;  2LQ8 A;  3SWN C;  1VQP T;  4LDY A;  5C6S A;  5LL6 S;  1RAH B;  1QVF P;  1AWO A;  2IIM A;  2K6D A;  1R77 A;  2KR3 A;  3CC4 Q;  1MND A;  1JEG A;  1TUD A;  5HK3 A;  3CXC S;  3RMQ A;  3PTA A;  2EGE A;  3QBY A;  1K9A A;  1BKB A;  5CIU A;  2JJ9 A;  2DJZ A;  4L59 A;  2KRN A;  3AHU A;  1I1J A;  3FJP A;  1R8O B;  3CC2 A;  1FMW A;  1ZSZ A;  3FEO A;  3CCQ T;  2XIC A;  1QMC A;  4FL6 A;  3FC3 A;  1BYM A;  4M78 C;  3TVT A;  1TU0 B;  4EMK C;  5CKF A;  4R55 A;  2ZPG B;  5FWB A;  2JTE A;  2SRC A;  5GAM e;  4M7D G;  1O75 A;  3BE3 A;  4KT0 E;  2QEX A;  3M59 A;  4A53 A;  5FU6 C;  2DL7 A;  4QQG A;  2G6F X;  1SRL A;  3X20 B;  1IO6 A;  3M56 A;  4OB1 B;  3WXM B;  2AZV A;  4PL6 A;  5D6W A;  3TQ7 P;  4RCB A;  2CS7 A;  3M4G A;  2AZS A;  3I5R A;  3TEE A;  2RHI A;  3QXE B;  5KYU A;  3CCJ T;  3RES A;  2QI2 A;  4R0K A;  2O88 A;  1UE9 A;  1I5L A;  1YIT A;  2DZ9 A;  3RER A;  4D6W A;  2DX1 A;  2MK5 A;  1U8R A;  4FU6 A;  2R57 A;  3M4Y A;  4X34 A;  3M0R A;  2GBQ A;  2VXE A;  2QQA A;  3S3N A;  3PT9 A;  4JJC A;  1PD0 A;  1NPR A;  1K73 R;  1FMV A;  1YIJ A;  2KQW A;  3OYY A;  3I55 A;  2L3P A;  3SHW A;  4J9I A;  3LGL A;  2OTJ A;  2KGT A;  2LT4 A;  1W4S A;  5I2M A;  2MIO A;  2X4W A;  5A0D A;  1M2V B;  3JCM V;  4F16 A;  1Q7Y R;  2DPP B;  2RQW A;  2E6Z A;  4BB7 A;  1M1F A;  2RO0 A;  4M77 G;  2JVV A;  2P4T A;  3CCJ Q;  4E7L A;  1UGQ B;  4XTV A;  2FHD A;  4M75 D;  3TU4 K;  2YDL A;  4XAX B;  4XU2 A;  1VQ9 T;  3RKW A;  1O9S A;  3GBQ A;  1VQ6 A;  4KUI A;  4KH1 B;  2DTO A;  5GAM j;  2PUK B;  4DA4 A;  5GAO n;  2LVM A;  2ECZ A;  4BI8 B;  1PG5 B;  2LDM A;  4EIK A;  2KT1 A;  2O2O A;  4NL2 A;  2X3W D;  4M75 E;  2KAF A;  3MPU B;  3BW1 A;  1M4Z A;  2HBP A;  3M0Q A;  2E41 A;  1X6G A;  3CCM A;  1LCK A;  2MWP A;  5IHI A;  1VYT A;  2RI5 A;  3HFO A;  1TS9 A;  1KC8 U;  1YNZ A;  2RQU A;  1OX8 A;  3R6O A;  2QQS A;  2WSE E;  2BTT A;  4KBM B;  3QYG B;  3UF4 A;  1WPY A;  2B86 A;  4A4K A;  4DQ2 A;  4C0D C;  3LLR A;  4FYV B;  5CQX A;  4A63 B;  4BAC A;  1KD1 R;  3OY9 A;  5GAN g;  1JJ2 A;  3CCU Q;  2D8H A;  3MP8 A;  1Y96 A;  2LJ0 A;  5IN1 A;  1VQN T;  3CD6 A;  2KRO A;  4C8Q C;  5KYW A;  2VXF A;  1PRL C;  5LJ3 g;  4J5Y A;  5FU7 B;  4BI3 A;  4LD6 A;  2EAY A;  3CC4 A;  4OB2 B;  1TH7 A;  3H0I A;  1P92 A;  2EFI A;  1TWB A;  4AFQ C;  4M75 F;  1HD3 A;  4HXJ A;  2V8J A;  1VQO A;  1QWE A;  3QUI A;  4C0Z A;  2DF6 A;  2YRD A;  1QLY A;  3A8H B;  4KGV B;  1WA7 A;  1NJI C;  3HTR A;  4C5E A;  2LC4 A;  2LZ6 B;  3AT1 B;  5LJ5 h;  4XTU A;  3CC7 A;  2J06 A;  4LUD A;  2RMO A;  1G5V A;  3SB2 A;  2HSP A;  4RTV A;  2KT8 A;  2RPN A;  4BY6 B;  4J9B A;  3QJY A;  3JCM h;  1VQP A;  1NYF A;  4OGC A;  4OMQ A;  2CZ7 B;  2QAZ A;  4CC3 A;  1HJD A;  2DK3 A;  2YUN A;  3H6Z A;  2QA4 A;  1XTD A;  1NBE B;  2EJ9 A;  4LDU A;  3J81 E;  2HKN A;  4EDU A;  1M90 R;  1SEM A;  3X26 B;  3VS3 A;  2X4X A;  4F7U G;  4KGX B;  3HSB A;  1AWJ A;  4ATO A;  1M8V A;  4B6M A;  3A5Z B;  4JPB W;  1AZG B;  1H3H A;  4C92 D;  3EFR A;  2FVU A;  4PJJ A;  3CCQ A;  2PNI A;  2CH4 W;  1MMA A;  3NGP A;  2O31 A;  1XQH A;  2JOY A;  3PIO A;  1RAE B;  4FM4 B;  4BDY A;  4JJD A;  2J7I A;  2GNC A;  1UGP B;  4MDW A;  3V7C A;  1OYX A;  3L2Z A;  3QO3 A;  5KYY A;  3OA6 A;  4O6J A;  4C92 E;  4C92 B;  1KQS S;  2MMP A;  4PLL A;  2FO0 A;  4BDZ A;  1AVZ C;  2E10 A;  1PM3 A;  3JCM Q;  1LJO A;  1K0X A;  1OU8 A;  5GAN f;  2EW3 A;  3CC2 T;  1V29 B;  3EG3 A;  3CCV T;  4ZNX A;  3T9N A;  3ULR B;  2OX7 A;  2NUT A;  1AOJ A;  2JS0 A;  2MWO A;  1K8A U;  4M78 D;  1VQ5 T;  2DKG A;  5CKH A;  5LJ3 f;  3OYK A;  1WHH A;  1MMN A;  1D0Z A;  2CKK A;  2Z0W A;  1VQL A;  2HQH A;  1JJ2 P;  2MOX A;  3HRS A;  4FSX A;  2X9H A;  1YFN A;  3EAE A;  3VJP A;  4AFS C;  2XHC A;  5IXB A;  2HL5 C;  4J9E A;  1SSF A;  4J9D A;  5GAN 2;  2K3Y A;  1I07 A;  2FB7 A;  4E47 A;  4M78 E;  5CR2 A;  4PJO E;  2H3E B;  4C92 F;  3HPW A;  4QQ6 A;  3CBM A;  4PJO B;  4M7A E;  3PVQ A;  5I21 A;  2O4X B;  1MV3 A;  4M7A B;  3CC2 Q;  5LJ5 d;  5ECA A;  2OTL A;  2KYM A;  1M1K U;  2RHZ A;  2ZPE B;  1H92 A;  2KXC A;  1VQ9 A;  4TVR A;  2RK2 A;  4DEX A;  4QKU A;  1C0M A;  4JJN K;  1Q81 C;  1W70 A;  1T3S A;  1OPK A;  3JCM d;  4P5N A;  1ZSZ C;  4GBQ A;  5KE3 A;  2QEX Q;  3C0C A;  3GLX A;  1Q82 U;  2ZZD A;  1RI0 A;  3A8M B;  1IXD A;  5GAO p;  1AEY A;  2JTF A;  4UC4 A;  2F1L A;  3QZ9 B;  1R0B G;  2NWM A;  3P8D A;  2MCN A;  1B07 A;  2V1Q A;  1K9M C;  1AZE A;  2LCC A;  1K73 C;  1YIT Q;  4ZN3 A;  4M78 F;  3CPW P;  1ZBX A;  2EPD A;  4IUT A;  1VQ6 T;  4ZN1 A;  1IGQ A;  4LDW A;  4GY5 A;  2HNI A;  3I5S A;  1YIJ Q;  2DIL A;  2CH4 A;  1Q7Y C;  2H8H A;  1VQN A;  2Y4Y A;  4J9F A;  5KE2 A;  4ELY C;  2OTJ Q;  1QW1 A;  1BI3 A;  2DRK A;  3CME T;  3OSS C;  4PFO A;  1N6A A;  1X75 C;  3CCM T;  1LOJ A;  1VA7 A;  2I0N A;  3M0U A;  2COY A;  3LH0 A;  1X43 A;  1RL2 A;  2NUP B;  3VS6 A;  3I9Q A;  2BIV A;  2E5Q A;  3UPU A;  4M7D C;  1MMD A;  5GMK l;  4J9G A;  5J3B A;  1S72 A;  1VQ6 Q;  4N4I A;  2JZ2 A;  2KDS A;  3MEU A;  2J05 A;  4PK4 A;  4Y28 E;  3CD6 T;  2DIQ A;  4C8Q D;  2AK5 A;  4MZM A;  1VQM A;  4CI0 C;  3CCL T;  1C6V X;  3JV3 A;  4FT2 A;  5I2S A;  3CME Q;  2YLB A;  2IG0 A;  2LNV A;  1M30 A;  4C5H A;  1KD1 C;  1NZ9 A;  4DOV A;  3CCM Q;  1BCM A;  1OEB A;  1WHK A;  1KHC A;  4E2F B;  8AT1 B;  2CZ6 B;  3EGD B;  2NUZ A;  1CSK A;  1M8M A;  4OB3 B;  2L5Q A;  4C8Q E;  1BIA A;  3UWN A;  3L1A A;  2E1H A;  2OAW A;  1G83 A;  1BBZ A;  4M75 G;  4CRI A;  1N27 A;  2DET A;  1M2V A;  2ZPH B;  3UA6 A;  2PVG B;  4M77 C;  5CCA A;  3CD6 Q;  3QKJ A;  3RMS A;  4RTT A;  3MCA B;  1YP5 A;  4BE1 A;  3EG1 A;  5GAM h;  2NLU A;  2QA4 T;  5FLX E;  2RA2 A;  3QJ6 A;  2DL8 A;  4RTX A;  3MP6 A;  3OS1 A;  1YCY A;  2RHX A;  3V8L A;  2C0T A;  2GGR A;  2HAX A;  5GAN 8;  3MEW A;  3NTI A;  1FYN A;  2MAM A;  4BI4 A;  1VQO Q;  1M5Q 1;  4F14 A;  5HK0 A;  3O5Z A;  1W2B P;  2DMO A;  2P0Q A;  3REA B;  1OX9 A;  2K9G A;  3V8J A;  2E5K A;  3CC7 Q;  2KVQ G;  3CCV A;  4AMC A;  2AKL A;  2LQW A;  2QDL A;  2A28 A;  4ELZ C;  1ZUU A;  2V26 A;  3BY7 A;  3EFS A;  4C8Q F;  5KYN A;  1JU5 C;  1ZHI A;  1VQ5 A;  3VKI A;  5GAO r;  2SEM A;  2F5T X;  1X2Q A;  3OYG A;  4OVA A;  1AT1 B;  4J8O A;  6AT1 B;  1VQP Q;  1M90 C;  2XDD A;  2JN0 A;  1D3B B;  2CP2 A;  5KH6 A;  2QA4 Q;  3BDU A;  1RI9 A;  3QDR B;  3OYD A;  2DLP A;  2YHT A;  1B3Q A;  1N8R U;  2XDB A;  1MV0 B;  1WXT A;  1Q81 R;  2F5K A;  3GNG A;  1KQS A;  3OBW A;  3OW2 A;  3MJX A;  1QVG S;  2H3J A;  1LPL A;  2HQX A;  3NTH A;  1KJW A;  1N9S A;  3DB4 A;  3VUB A;  2V1R A;  2P4R A;  4IUQ A;  3M58 A;  1TOV A;  4IUV A;  3UT1 A;  2GQI A;  4MZT A;  1PSF A;  4DBH A;  3VS0 A;  1C1A A;  1YN8 A;  3GNF B;  3CCQ Q;  1ACM B;  1K9M R;  2DRM A;  1G2B A;  2CZ1 B;  3FLG A;  1VQL T;  4FSS A;  2GTJ A;  2DXC A;  3EFO B;  1VQ4 A;  5GAN 7;  2DBM A;  4A4F A;  1YHQ T;  2EGC A;  2GFU A;  1QVF S;  2GQV A;  2M0Y A;  4M7D A;  3A98 A;  5KCO A;  1YWO A;  2P84 A;  3DKM A;  5GAN e;  1JBM A;  4A4E A;  3TRE A;  2DIG A;  2J6F A;  2V8K A;  1HK9 A;  2VAS A;  4FCY A;  2YT6 A;  4KRT A; 
#chains in the Genus database with same CATH homology
 1N9R A;  3F70 A;  2K2V A;  3OYJ A;  3CCU A;  2DK3 A;  4JLG A;  1YBY A;  2QQ9 A;  3H6Z A;  2QA4 A;  4OMF B;  3G7Z A;  1QVF A;  3C94 A;  1XTD A;  3N5B B;  2EJ9 A;  4C0G A;  2OTL T;  5LJ3 e;  4C92 G;  4LDU A;  1YIJ T;  1H64 1;  3J81 E;  2Y4X A;  1Y07 A;  4Y91 A;  3G71 A;  2VV5 A;  4EDU A;  4C92 C;  3I55 T;  1OI1 A;  1YJW T;  3X26 B;  3CCE T;  3VV0 A;  3JCM P;  2OTJ T;  2K5I A;  2X4X A;  4F7U G;  5CQY A;  4N0A C;  2P0K A;  3A8G B;  3HSB A;  4ATO A;  1WQ7 A;  2RJE A;  3INZ A;  3A5Z B;  2MI6 A;  4KUD K;  1M8V A;  3ZBD A;  4R56 A;  1PSE A;  1W2B A;  4C92 D;  4QVC A;  3GIB A;  2DEQ A;  3WVE B;  2EYQ A;  3QZ5 B;  5IAY A;  3PMI A;  2YLC A;  2BKD N;  5GAM d;  3EFR A;  1WJR A;  3ER0 A;  1IZ6 A;  2FVU A;  3PGG A;  1BI2 A;  3CCQ A;  3KXT A;  2WSC E;  3JB9 G;  3RIR A;  3S3O A;  1XOV A;  1XQH A;  3CME A;  2JOY A;  3MET A;  4Q5W A;  5EG2 A;  3PIO A;  5C0M A;  4B9W A;  3M5A A;  1M1G A;  3FIF A;  3LYI A;  2CYZ B;  3OMC A;  4M75 B;  1YI2 A;  4FM4 B;  4FT4 A;  1VQ8 T;  3CBO A;  2VYT A;  3HKS A;  4PJO F;  4BDY A;  1XNI A;  4N4H A;  5J26 A;  3L2U A;  4M75 A;  5L8R E;  1UGP B;  2QXF A;  4MDW A;  2KK4 A;  3V7C A;  1UGR B;  4M7A F;  2XKO C;  1WJS A;  2HD0 A;  1OYX A;  1VIF A;  3L2Z A;  2B8A A;  3MHX A;  4EMG A;  2CGH A;  3QO3 A;  1FX7 A;  3JB9 D;  2LT1 A;  4O6J A;  4C92 E;  3OA6 A;  4M77 A;  1BI0 A;  4WF2 A;  2XID A;  1WNL A;  2LRQ A;  3L42 A;  4C92 B;  1KQS S;  2MMP A;  4RG2 A;  4PLL A;  4O5V A;  4BDZ A;  2RJC A;  4F7U E;  4IUR A;  2E10 A;  3FRN A;  2DD4 A;  3TCJ A;  1WQW A;  2EKO A;  3JCM Q;  4F7U B;  1LJO A;  2XK0 A;  4M78 G;  2JUF A;  4N0A A;  4PJO G;  5GAN f;  1MHN A;  3PIP A;  3GOX A;  1QVP A;  2LCL A;  3P8B B;  5GAN h;  1GXI E;  4ZGD B;  4PJO C;  4M7A G;  3CC2 T;  3NTK A;  1V29 B;  3CCV T;  3T9N A;  3UDC A;  2E64 A;  2V8I A;  4XK8 E;  1DJ7 B;  2R5M A;  4M7A C;  1UB4 A;  4ZGJ B;  1NE8 A;  3DLM A;  3CCL A;  4EPC A;  5GAN j;  3URG A;  2MWO A;  1K8A U;  4IUP A;  1I8F A;  4RKU E;  4M78 D;  1VQ5 T;  2DKG A;  3O8V A;  2K4Y A;  3PFS A;  5CKH A;  5LJ3 f;  3L2V A;  2E65 A;  3OMG A;  4MML A;  5LJ3 h;  3OYK A;  4XU0 A;  3SD4 A;  4A4H A;  3V7S A;  4C5G A;  3G6E A;  4A4G A;  3LWI A;  3GP8 A;  4HCB A;  2EQK A;  3LGF A;  1G3S A;  2FL7 A;  3JCM X;  2CKK A;  3M57 A;  4QVD A;  4HT9 A;  1VQL A;  5LJ3 j;  4XTX A;  5CAI A;  2PVO B;  3FDR A;  1Q86 C;  3HRS A;  2GCX A;  4FSX A;  3CCR A;  4XQ3 A;  3EAE A;  4NOY A;  2K5F A;  2K3X A;  3VJP A;  3GPL A;  1YJ9 T;  2XHC A;  2DTI A;  5GMK h;  3SDZ A;  4RG8 A;  3C4S A;  2MF2 A;  1SSF A;  4OP0 A;  5GAN 2;  4JRP A;  4JUV A;  3JCM b;  1S72 T;  2K3Y A;  4RMO A;  2FB7 A;  1NJI U;  3JRZ A;  4E47 A;  5KCH A;  4M78 E;  5CR2 A;  2ZPF B;  1KG1 A;  4PJO E;  2RI3 A;  4N4G A;  3HRU A;  4C92 F;  3FB9 A;  3HRT A;  3HPW A;  4QQ6 A;  3CEY A;  2E6N A;  3OS2 A;  3CBM A;  4E7H A;  5FRN A;  4JDS A;  4PJO B;  4M7A E;  2KMT A;  2XG8 D;  4NL3 A;  3CCS A;  2M16 A;  3KUF A;  3OYN A;  5I21 A;  3JCM c;  2O4X B;  3CC4 T;  3A8O B;  4M7A B;  4F7U F;  1VQM T;  3MEV A;  1FXX A;  3P8H A;  3L2W A;  2WSF E;  5LJ5 d;  3OYE A;  3OYF A;  2O4X A;  2OTL A;  3BFM A;  4M7A A;  4IUU A;  1M1K U;  1VQO T;  2RHZ A;  2ZPE B;  1VQ9 A;  4TVR A;  2RK2 A;  2PQW A;  1YJW A;  4J6W A;  1OZ2 A;  3CCE A;  5A0L A;  5GMK m;  4OB0 B;  2PU9 B;  5CKB A;  4JJN K;  4JS5 A;  1Q81 C;  4HCZ A;  1W2B S;  2C06 A;  2RJD A;  3JB9 F;  2IVW A;  4PKC C;  4B9X A;  3CC7 T;  3JCM d;  1FWZ A;  4P5N A;  2ZGW A;  2RI2 A;  3X24 B;  5KE3 A;  3I56 T;  3OS5 A;  3QII A;  1KQ2 A;  1Q82 C;  1JB0 E;  3WVD B;  5M9O A;  3JCM J;  2DVE A;  3GLX A;  3QSU A;  1Q82 U;  2ZZD A;  1RI0 A;  3HL8 A;  3X25 B;  3A8M B;  4BD3 A;  2QTX A;  2LQ8 A;  5GMK e;  2EQM A;  2D6F A;  2CZ0 B;  4ME7 A;  5GAM g;  3M55 A;  4YTL A;  4QVZ A;  5GAO p;  3SWN C;  1X6O A;  2HQE A;  3E9F A;  2K57 A;  2JTF A;  2XI9 A;  4UC4 A;  3QZ9 B;  1VQP T;  4LDY A;  1VQ8 A;  5C6S A;  2DZC A;  5LL6 S;  3J80 E;  1YJN A;  3P8D A;  5FRM A;  3JSC A;  2DAQ A;  3CCU T;  1K9M C;  4M77 D;  2M9U A;  2Y90 A;  2QQR A;  2LCC A;  1K73 C;  4ZN3 A;  4C0F A;  4M78 F;  1VQK T;  3G71 T;  2EQU A;  3GF5 A;  1ZBX A;  5HK3 A;  3RMQ A;  3PTA A;  3CXC S;  3QBY A;  4IUT A;  1VQ6 T;  3J7A F;  2LX9 A;  3OQ5 A;  4ZN1 A;  4HCC A;  1BKB A;  5CIU A;  3OBY A;  2DJZ A;  3E9G A;  2RK1 A;  4L59 A;  5DM7 R;  5GAO l;  3AHU A;  1G3W A;  2X4J A;  4LDW A;  4GY5 A;  3RKX A;  2HNI A;  4XTW A;  2K5L A;  1Q7Y C;  4LDV A;  3FJP A;  4E7K A;  2L8D A;  3CXC A;  1R8O B;  2E70 A;  3OSV A;  4C92 A;  3CC2 A;  2Y4Y A;  5GAN 6;  1VQN A;  2A7Y A;  5KE2 A;  3CMA A;  1Y71 A;  1KC8 C;  3FEO A;  3CCQ T;  4ELY C;  1QW1 A;  2XIC A;  1UEB A;  4BUG A;  1BI3 A;  3CME T;  2VGM A;  3E19 A;  3OSS C;  2X35 A;  4FL6 A;  4A54 A;  4M78 C;  4F7U A;  3SWN B;  3FC3 A;  1BYM A;  2ZPI B;  1N6A A;  1X75 C;  3CCM T;  5J39 A;  4L6V 5;  1LOJ A;  4XTY A;  3SWN A;  2KSS A;  2VUB A;  4EMK C;  3LH0 A;  5CKF A;  4R55 A;  2L89 A;  4XU3 A;  3M9Q A;  5GAO q;  2ZPG B;  3H8Z A;  5D6Y A;  1RL2 A;  4NS5 A;  5GAM e;  2KY9 A;  4EMH A;  5A2Q E;  1N8R C;  4M7D G;  1O75 A;  1WJQ A;  3LX7 A;  4GLK A;  5GAN d;  3OYA A;  4KT0 E;  2QEX A;  3M59 A;  4A53 A;  5FU6 C;  4XTZ A;  2BIV A;  4QQG A;  2E5Q A;  3UPU A;  4M7D C;  4J83 A;  4JS4 A;  5HY6 A;  4C8Q G;  3PNW C;  3ZFJ A;  5GMK l;  2A3L A;  3X20 B;  3WXM B;  3M56 A;  4OB1 B;  4RCC A;  1NPP A;  5J3B A;  4JRK A;  3BDL A;  4PL6 A;  5D6W A;  4LDX A;  1S72 A;  4RCB A;  2CS7 A;  5GMK i;  3M4G A;  3OYI A;  1QP3 A;  4N4I A;  3TEE A;  4X9D A;  2L3R A;  2OAU A;  3QPH A;  2JZ2 A;  4OF1 A;  5CO7 A;  1Q86 U;  2RHI A;  1I4K 1;  3QXE B;  4M7D D;  3CCJ T;  3RES A;  3DB3 A;  5LJ3 d;  2YRV A;  2KDS A;  3MEU A;  1YHQ A;  2QI2 A;  2M0O A;  4Y28 E;  3ASK A;  3CD6 T;  2DIQ A;  3MO8 A;  4C8Q D;  1I5L A;  1YIT A;  2DZ9 A;  1H3Z A;  3LWH A;  3V7R A;  4MZM A;  1VQM A;  4CI0 C;  4D6W A;  3CCL T;  3RER A;  5HKC A;  5GMK j;  1U8R A;  2EWN A;  3M54 A;  2DO3 A;  2R57 A;  3M4Y A;  4FU6 A;  2DXT A;  4X34 A;  4M78 B;  2VXE A;  2QQA A;  4IKF A;  1K73 U;  2AHJ B;  4FT2 A;  3S3N A;  3PT9 A;  5I2S A;  2YLB A;  2IG0 A;  2RM4 A;  2LNV A;  3JAM E;  4M78 A;  1VUB A;  4EMK B;  4PJO A;  1NPR A;  3G6E T;  4C5H A;  1KD1 C;  1NZ9 A;  4OGE A;  4DOV A;  2M1H A;  4M77 F;  4EMK A;  2P0P A;  2RB6 A;  4QQD A;  2QQB A;  4Z02 A;  4E7J A;  2LTO A;  1KHC A;  1YIJ A;  3L2R A;  2KQW A;  1G3T A;  4M7D E;  3OYY A;  4PLI A;  3CCR T;  2EIF A;  2CZ6 B;  2DD5 A;  3I55 A;  5FU6 B;  5DY9 A;  1Y7X A;  3LGL A;  4II1 A;  2OTJ A;  4OB3 B;  4M7D B;  2DXU A;  2L5Q A;  4C8Q E;  3I56 A;  1BIA A;  2LT4 A;  3UWN A;  1QP2 A;  3ZEH A;  3L1A A;  1IRE B;  2E1H A;  2XU8 A;  4E7I A;  1Q81 U;  3JCM g;  1W4S A;  3PMT A;  4HA8 A;  3VYH B;  4M75 G;  5I2M A;  2X4W A;  1G3Y A;  5A0D A;  1VQ4 T;  3JCM V;  4CRI A;  3VUZ A;  2DPP B;  4JRI A;  3G4S T;  5GAN 5;  1N27 A;  4J6Y A;  2E6Z A;  4BB7 A;  1M1F A;  2RO0 A;  2ZPH B;  2EJG A;  3A8L B;  1ZQ1 A;  4KUL A;  4M77 G;  5AYF A;  2JVV A;  2P4T A;  1U1S A;  2PVG B;  3ME9 A;  4JRQ A;  5DLQ E;  4E7L A;  1VQ7 T;  3OS0 A;  4M77 C;  5CCA A;  2DTH A;  3HP9 A;  1UGQ B;  4XTV A;  3QKJ A;  3RMS A;  2FHD A;  4M75 D;  2O01 E;  3TU4 K;  2XDP A;  3MCA B;  5CKD A;  5CVI A;  4XAX B;  4XU2 A;  5GAM f;  3CPW A;  1VQK A;  1JRI A;  1WGS A;  3DLL A;  4BE1 A;  1VQ9 T;  5GAM h;  2FYK A;  2NLU A;  3RKW A;  1O9S A;  1I81 A;  2QA4 T;  5FLX E;  1VQ6 A;  2RA2 A;  2BUD A;  3QJ6 A;  1K9M U;  2JTM A;  4KUI A;  5GAN 3;  4ZTF A;  2DTO A;  3MP6 A;  4BE0 A;  5GAM j;  1MGQ A;  3QHS A;  1YCY A;  2PUK B;  3OS1 A;  2RHX A;  3LW5 E;  5CK9 A;  3V8L A;  4DA4 A;  5GAO n;  1U1T A;  2LVM A;  2HAX A;  4BI8 B;  5GAN 8;  2D0Q B;  3MEW A;  3NTI A;  2MAM A;  2X4Y A;  4BI4 A;  1M5Q 1;  1M9S A;  3VU3 C;  4MMK A;  4X9C A;  2RH2 A;  5LJ5 e;  2LDM A;  4L5G A;  2RHU A;  5GAN 4;  4NL2 A;  5HK0 A;  3KBG A;  2JNG A;  2LQK A;  4M75 E;  2KAF A;  3BW1 A;  1M4Z A;  3QYH B;  2P0Q A;  2F69 A;  2HBP A;  3HFN A;  3V8K A;  4FIB A;  5DLO A;  5CKE A;  2E12 A;  2RHY A;  3V8J A;  4M7D F;  2E41 A;  5FU7 C;  2KVQ G;  3JB9 I;  3CCV A;  4C5I A;  3CCM A;  1Q7Y U;  1YJN T;  2MWP A;  4M77 E;  3RUX A;  2RI5 A;  3HFO A;  4PNO A;  4ELZ C;  3BY7 A;  3EFS A;  4C8Q F;  3OYC A;  3OYL A;  5D6X A;  1JJ2 S;  1KC8 U;  3JCM e;  2EQJ A;  2QDY B;  4M77 B;  4DOW A;  3R6O A;  2QQS A;  1ZHI A;  2WSE E;  4ZTJ A;  1VQ5 A;  4KBM B;  1YI2 T;  2I2L A;  1BIB A;  3QG1 A;  3VKI A;  5GAO r;  3QYG B;  2F5T X;  1WPY A;  1X01 A;  4OVA A;  4A4K A;  4DQ2 A;  3OYG A;  2VGN A;  4C0D C;  4J8O A;  2ZPB B;  3HHT B;  3LLR A;  1LNX A;  3OB9 A;  5CQX A;  1M90 C;  4BAC A;  3OY9 A;  3NFC A;  3OW2 S;  2XDD A;  1M90 U;  2JN0 A;  2XD0 A;  2EJF A;  1KQ1 A;  5GAN g;  1JJ2 A;  1D3B B;  2WAC A;  5KH6 A;  3JB9 H;  3BDU A;  4J7I A;  3MP8 A;  1Y96 B;  3QDR B;  3OYD A;  2YHT A;  2XDB A;  1YJ9 A;  1N8R U;  1D3B A;  5IT9 E;  3CCJ A;  4XU1 A;  2RJF A;  3CBP A;  1Y96 A;  5IN1 A;  2F5K A;  3SFM A;  3GNG A;  1VQN T;  1KQS A;  3CD6 A;  4C8Q C;  3CMA T;  2G3R A;  4BY6 C;  2VXF A;  3OBW A;  1K8A C;  3OW2 A;  1QVG S;  4ZGE B;  2GF7 A;  2H3J A;  5LJ3 g;  3OYH A;  4J5Y A;  2RD1 A;  2HQX A;  3M53 A;  3NTH A;  1N9S A;  3JB9 J;  3DB4 A;  3VUB A;  4PJO D;  5A0G A;  3L2Q A;  4IUQ A;  2GFA A;  5FU7 B;  3M58 A;  4BI3 A;  4LD6 A;  2PUO B;  5FRO A;  4IUV A;  2EAY A;  3UT1 A;  3S3M A;  4OB2 B;  4MZT A;  3VYG A;  1KHI A;  1TH7 A;  3OYM A;  1PSF A;  3CC4 A;  4M7A D;  1P92 A;  2EFI A;  2PVD B;  3OYB A;  1VIE A;  2VC8 A;  4J6X A;  3S6W A;  1QVG A;  3C12 A;  3GNF B;  2R5A A;  1BI1 A;  4HT8 A;  1HXD A;  4M75 F;  5GAO m;  4BE2 A;  4HKE A;  2V8J A;  1VQO A;  2QEX T;  2DXB A;  3QUI A;  4C0D B;  5LJ5 g;  4LD9 K;  4C0Z A;  2CZ1 B;  3FLG A;  3A8H B;  4J7F A;  2R58 A;  1NJI C;  5LJ5 f;  4C5E A;  2LC4 A;  1KD1 U;  1VQL T;  1OZ3 A;  3JCM W;  5LJ5 h;  4XTU A;  3CPF A;  2DXC A;  3CC7 A;  4MDX A;  1VQ4 A;  3C95 A;  1G5V A;  3X28 B;  4MZP A;  2D9T A;  5GAN 7;  3G4S A;  3SB2 A;  4A4F A;  1YHQ T;  1EIF A;  4VUB A;  1B34 B;  2GFU A;  5LJ5 j;  1QVF S;  2GQV A;  4M7D A;  2ZCF B;  1UGS B;  3MP1 A;  4BY6 B;  4C8Q B;  5KCO A;  1YIT T;  4V2S A;  1B34 A;  3E1S A;  3DKM A;  5GAN e;  1VQ7 A;  1AHJ B;  3Q1J A;  3CPW S;  3JCM f;  1JBM A;  4M75 C;  4A4E A;  4C8Q A;  1M1K C;  3TRE A;  2DIG A;  3RKY A;  3QJY A;  3JCM h;  1VQP A;  2V8K A;  4QW2 A;  1HK9 A;  4JLI A;  4OGC A;  3MEA A;  3CCS T;  2CZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...