4EMKB

Crystal structure of splsm5/6/7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MDSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYVSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm5
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkB00
4NL3A 5LJ3d 2VXFA 5GAOr 5GAOq 3JCMW 2EJ9A 4PJOB 4N0AC 4PJOA 5GAOm 4JLIA 2I2LA 1U1TA 3RIRA 2CGHA 4M75B 4M77G 2DZ9A 4M75A 4C8QF 4EMHA 4NOYA 1BIBA 1I8FA 4HT9A 5GANf 1JBMA 1HK9A 1MGQA 2YHTA 3BDUA 3FB9A 1LOJA 3QO3A 4MMLA 4XQ3A 3RUXA 3JCMc 3JCMQ 5GANd 5GAOp 3SWNB 4C92B 4C92A 4M7DB 4J6YA 4J6WA 3L1AA 4C8QD 1U1SA 4A54A 5GAMf 1BIAA 4M75C 5GAN3 2DEQA 4M78B 4M78A 2RD1A 1N9SA 1Y96A 5GAMd 3FJPA 3QUIA 4M7AC 5LJ3j 4XU0A 3V8JA 3JCMe 4M7DC 2FB7A 2EJGA 3HFOA 1M8VA 1YCYA 3SWNC 4C92C 4PJOG 4M77F 5GAN4 3VU3C 4M75G 5CAIA 1TH7A 1WQWA 4M78C 2DTHA 4X9CA 4M7DA 3RESA 3BW1A 3INZA 4PJOE 5GAN5 3JCMP 5GANj 4F7UB 4F7UA 5LJ5f 2DVEA 2E41A 2YLBA 4M77D 4M75E 5DY9A 4M7AB 2RA2A 4XTWA 1KQ1A 1N9RA 2K57A 3JCMh 2JN0A 3BY7A 4XTVA 4EMKA 5LJ5d 5GAN8 1LJOA 4XU1A 3SWNA 4OP0A 3JCMg 5LJ3e 4XU2A 3BFMA 4M7DE 4M78G 3HSBA 3FIFA 5GAMj 4C92E 4XU3A 2DTIA 2E65A 5GANg 4XTYA 1WNLA 4XTXA 4PJOF 4Y91A 2DKGA 5GMKl 4EMKC 4M78E 1HXDA 1M5Q1 2HNIA 2Y90A 3QHSA 5GMKi 3JB9J 3RERA 1KQ2A 5GAN6 4EMGA 3JB9H 5GANe 1WPYA 2E1HA 2DXUA 4DQ2A 2EWNA 4PJOD 5LJ3h 3JB9G 4C92G 3V8KA 3JCMX 1X01A 1I81A 4F7UG 4M7AA 4RCBA 1WQ7A 3V8LA 5LJ3g 4M7AG 5I21A 4XTUA 4M7DG 5LJ5j 4QVDA 5GAMe 1D3BB 4MMKA 1D3BA 4RCCA 4M78F 4PNOA 4WF2A 4C8QB 4C8QA 2E64A 4QVCA 3QSUA 3EFRA 3V7SA 4F7UE 2DJZA 5GAN7 5GAOl 4HA8A 3RKXA 1JRIA 4HT8A 4XTZA 4M7AE 2EJFA 5GANh 5GMKe 4M77C 5GAOn 5LJ5g 4M78D 3AHUA 2E10A 4J6XA 2DZCA 2EAYA 4C8QC 3JCMV 1I4K1 4M75F 5GMKj 3JB9F 3EFSA 2FYKA 5GAMh 5GAN2 3SB2A 3JB9I 4V2SA 4F7UF 3JCMJ 2VC8A 3JCMf 5LJ5e 5GAMg 3M4GA 3PGGA 4JUVA 4M7AF 4J5YA 4M7DF 4A53A 4EMKB 3JCMd 4M77B 4M77A 4C92F 5GMKh 4M75D 4NL2A 4JRIA 2RM4A 4C8QG 3JCMb 3JB9D 3L2ZA 4M77E 3V7RA 5GMKm 2YLCA 2DXTA 4PJOC 2DTOA 2QTXA 1I5LA 1B34B 1H641 1B34A 3GIBA 4M7DD 4M7AD 1LNXA 4JRKA 4N0AA 3RKWA 4C92D 4C8QE 2RB6A 1Y96B 2ZGWA 5LJ5h 3RKYA 3HFNA 4X9DA 2VXEA 3V7CA 5LJ3f
chains in the Genus database with same CATH superfamily
3M0SA 4ANJA 2M16A 1A0NB 3OQ5A 1YI2T 1W2BA 4M77G 2CKKA 2DL7A 3EFOA 6AT1B 4J9CA 3RDVA 1OU9A 3CCQQ 3CC7T 3ER0A 2DL5A 4KRTA 3P8HA 2DETA 1YI2A 3EG1A 4KH1B 4LXCA 5KYXB 3VS6A 1UEBA 1XNIA 5KYUA 2JT4A 4PJMA 3CC7A 2KK4A 2RO0A 2CP2A 1MMDA 2QGGA 2XIDA 2CZ1B 3JCMh 3GLXA 1IRXA 4E7JA 2X4YA 4XU1A 2E5KA 2ZZDA 2MOXA 4MZTA 4LDVA 2AZVA 4Y91A 1Q95G 2WSFE 4OB3B 4M78E 1H92A 3ASKA 1M1KC 5GANe 1WPYA 1CSKA 2GFAA 2EW3A 4RMOA 1I81A 2BZYA 1TG0A 2DMOA 1AWOA 2HEQA 2PUKB 2EJFA 4PJNA 3NPFA 4ZN1A 3UA6A 1KK7A 2VUBA 1I4K1 5GMKj 2GF7A 4ATOA 3CQTA 5GMKh 4RG2A 2GNCA 1FYNA 2QQAA 2M0OA 4ZN3A 1TS9A 3MP6A 4GLKA 2QEXQ 3L42A 4A4HA 2DEUA 3CCET 1CKBA 1J3TA 1I5OB 1G3SA 2DVJA 3GF5A 2K9GA 3DLMA 4A63B 2ZPFB 4XAXB 2EJ9A 2KXDA 3CCEA 2QAZA 4AG1C 1OPLA 2DPPB 2RHYA 4C0ZA 2YT6A 3QDFA 5GANf 5IT9E 2O9VA 2LQ8A 3TSZA 4OB0B 2OX7A 3QO3A 1LOJA 1PRMC 1GBRA 5GAOp 2LCLA 4C92B 4LD6A 2OAUA 1B3QA 1AWWA 1X6OA 4Z02A 4PL6A 4M7AC 3A1PA 1Q81C 4HKEA 2QI2A 1TH7A 2DTHA 3O5ZA 2ROTA 1Q82C 4P5NA 3FC3A 2DIGA 5IHNA 1GFCA 5AYFA 4M7AB 3I35A 4FSSA 5LJ5d 3QDRB 4R56A 3L2UA 3I5RA 4RTWA 1PM3A 2E65A 4JDSA 1WNLA 3OYNA 1V1CA 3HPWA 1QVGS 1JB0E 4EMGA 3MHXA 3CCRA 5EC7A 2E1HA 1BI0A 3G6EQ 2EKHA 4E7KA 4KGXB 4KUDK 4C8QB 1ZSZA 3HHTB 1IO6A 2O01E 3EFRA 5GAN7 3NFCA 4HT8A 3OW2P 2DAQA 4LDYA 3OSSC 1G3WA 4IUPA 1ZSZC 3BE3A 1SHFA 2RJEA 3ME9A 2FYKA 1V76A 2JTEA 3M4GA 1WHMA 3PGGA 3CCJQ 4LUEA 1RLQC 1VYVA 5L8RE 8ATCB 1M8MA 2HSPA 1VQ4Q 2VXEA 2BE7D 2OAWA 3CCLQ 3QZ5B 1JQQA 1WHKA 3X20B 1BB9A 2RQTA 3QZ9B 3QWYA 1K0XA 1RLPC 2L3PA 4JLIA 1YWPA 4EMHA 2LNHB 2GFUA 2FZGB 4N4IA 4FIBA 2ED1A 2RQVA 4DOWA 2ZPHB 4A54A 3LWHA 1KQSS 4M78A 2LDMA 2K5LA 1YJNT 1YJ9T 2FB7A 2RJDA 3CBPA 2J7IA 5CQXA 2R57A 5FRMA 3LGFA 3EGDA 2K3XA 4M78C 2FVUA 4X9CA 3L2RA 1M2VB 4OVAA 3UWNA 2DYBA 1OYXA 2RA2A 1YJNA 2J06A 1YJ9A 3OBWA 3MP1A 2RN8A 2DM1A 4PFOA 5D7UA 4M78G 5FRNA 3NGPA 1JEGA 3TVTA 3WVDB 4VUBA 2F69A 2RMOA 2ZPGB 4EDUA 1VA7A 3L2QA 2HNIA 3LWIA 3OYHA 2P0PA 1M1KU 4IIOA 3RMSA 3OYFA 3MPUB 2EGEA 4PJOD 2RK1A 2A3LA 4HCZA 5FLXE 5KYYA 1D3BA 4PNOA 3VS4A 3QYGB 1VQPT 1YNZA 1YI2Q 2LJ1A 2MWOA 4C0GA 3M0PA 3FDRA 2YSQA 1QCFA 2CP7A 1MMGA 1WHLA 3JAME 5GAN2 1N5ZA 3GPLA 3SB2A 2VC8A 1VQPA 3CC7Q 2JNGA 2WACA 2ZPEB 2DD4A 3TQ7P 3UF4A 3LX7A 3L2WA 3RMQA 2KI7A 5I22A 1NJIR 3OYMA 4JRKA 4AFSC 3OW2A 3MP8A 1YFNA 4F16A 1M9SA 3OS2A 4N4GA 1W6XA 1KJWA 5EG2A 1SHGA 2CT4A 2L5QA 5L23A 1I8FA 3QYHB 3VJPA 2RHUA 2QDLA 2J6OA 2YHTA 3RUXA 3JCMQ 4AMCA 4AG2C 1AT1B 3PT9A 3LW5E 5GAMd 2PVGB 1GCPA 2VV5A 1SRLA 3M58A 1NBEB 3NTIA 4OGEA 2LJ3A 3SWNC 1Q81U 2CP3A 4M77F 2EKOA 4PJJA 3FLGA 4PFZA 1PD1A 1Q82U 4LD9K 1AWXA 2VGMA 1QVFS 1UUEA 4EMKA 2FZCB 1MV0B 2X4JA 2JXBA 2LQNA 1BKBA 1T0JA 1WLPB 3EGUA 3VUBA 1WFWA 1QWEA 3ZFJA 2IVWA 3PFSA 4EMKC 4E7IA 1GBQA 3G71T 5GAN6 4CI0C 2QASA 2RQRA 2H3EB 2DXUA 5KCHA 3JB9G 3CCEQ 3A5ZB 2CREA 2Y4XA 5LJ5j 4WF2A 4JJDA 1IREB 2DJZA 3G71A 2CSIA 1JJ2P 1MMAA 5J26A 2PUOB 3A98A 1I07A 3X24B 4HVWA 3CPWP 2EAYA 2LJ0A 1PHTA 1D1CA 1YCSB 2XD0A 1UGRB 2HQEA 4BE1A 1RACB 2AZSA 3TSWA 3OS0A 4OMPA 3M9QA 2LT4A 2SRCA 2DXTA 2KT1A 2JZ2A 4GY5A 1OEBA 4C92D 2CZ6B 2D6FA 2QTVA 1M3CA 3AT1B 4OB1B 5CIUA 3HFNA 2DA9A 3UA7A 3TEEA 1W2BP 3JCMW 1W2BS 3EGXA 2CGHA 2DZ9A 1BIBA 3ZEHA 4FYVB 2X51A 5IH2A 2MAMA 4ELYC 2DX1A 2H8HA 4C5HA 2KT8A 1I1JA 1NG2A 5DM7R 4EIKA 4CRIA 3CMAT 2EGAA 4JLGA 1OPKA 2JS0A 2VKNA 1S1NA 3P8BB 1PKTA 2C0IA 2CH4A 4FL6A 4F7UB 1K8AC 2GQIA 2DJQA 1UGQB 2K3YA 3OYCA 2HQHA 1RAGB 3UT1A 3CMAA 3BFMA 2QK0A 3CXCA 5IXFA 3C12A 4C92E 5FU6C 3OYBA 2X3XD 1SKUB 5GMKi 2CSQA 1JXMA 2ABLA 2NWMA 2K5IA 1AOJA 2LMJA 3QG1A 4QVDA 3QBYA 1U06A 3QSUA 4M7AE 4BY6B 1T0HA 1KD1C 5GANh 1P92A 2ENMA 2QQRA 3M4YA 4LDXA 3HP9A 2YRVA 4B9XA 3M0UA 3EFSA 4V2SA 2C0OA 5LJ5e 4J5YA 3GBQA 2F1LA 2QG9B 2RQUA 4IIMA 3SFMA 2K6DA 7AT1B 1C6VX 1YJNQ 5AT1B 1YJ9Q 4Y28E 4PJOC 4JS4A 4M7DD 4C8QE 2ZGWA 3HTRA 3CBOA 1Y07A 2AT1B 2PNIA 4J7IA 9ATCB 3CPWA 3HRUA 4PJOB 5IAYA 2DXBA 3MKDA 4BI4A 2FO0A 2LRQA 4JJCA 5HY6A 3Q1JA 1WXTA 1C0MA 1KHCA 5GAN3 4O6JA 3PMTA 1V29B 1BI2A 3H6ZA 4XU0A 5FWBA 2B86A 4FW2A 1O75A 2KRMA 3G7ZA 4RTVA 1VQPQ 3PVLA 1WQWA 2LCCA 2RI2A 3DB4A 3LH0A 1UGPB 4RUGA 2ESWA 5LJ5f 2E41A 1BK2A 2MMPA 4HT9A 1PD0A 2DL4A 1K73C 5HK3A 4MDXA 4M7DE 1HSQA 1U8RA 5GAMj 4J9FA 3S3OA 3E19A 2QGFB 1YN8A 1Q86R 1M90C 2M0YA 1IXDA 2HKQB 2CP0A 4LUDA 2JOYA 1TTHB 4KUIA 4XTUA 3G1JA 4M78F 2J6KA 4C0FA 1QKXA 3OSVA 2YDLA 5DLOA 2B8AA 1WHJA 4Y92A 2ZCFB 1ARKA 3MO8A 4RKUE 3JB9I 4X1VA 4J9GA 1VQ7T 3X26B 3CD6T 5HCKA 2D8JA 3M0TA 1VIEA 3VYHB 1HJDA 2Y4YA 5IHIA 2ZPBB 2KEAA 2RB6A 1FMWA 3CCVT 1NYFA 4J9BA 1R0BG 3G4ST 1VQ7A 1QP2A 3CD6A 2W0ZA 2EPDA 1LPLA 3HKSA 2VXFA 4PLIA 4B9WA 1UFFA 5GAOm 2LT1A 3QIIA 4NOYA 4PJLA 3CCVA 1PCXA 2PVOB 1G3YA 3FB9A 3G4SA 2KBTA 1JU5C 4C92A 2V8KA 4J9EA 3G71Q 4BDYA 5CK9A 1Q7YR 1YBYA 2V1QA 3P8DA 4GBQA 2D8HA 2BZ8A 2ZPIB 2NUPB 4C92C 3UDCA 1RAIB 3OB9A 4FYXB 4JZ4A 1R0CB 4FSXA 1LVKA 3BW1A 3INZA 1X69A 2MPXC 4C92G 1K8AU 1VQNT 4M7AA 1M4ZA 3BY7A 1N8RR 2F5TX 4OP0A 3TREA 4QQGA 3M0RA 2EQUA 1GXIE 1X2QA 2DK3A 4ZGDB 1K9AA 4AT1B 2COWA 1NM7A 1KQ2A 1VQNA 2OTJT 1X6BA 1UHCA 2DBMA 4M7AG 5I21A 1Y7XA 2X3WD 3VRYA 5GAMe 4MMKA 4C8QA 2E64A 3FRNA 2OTJA 4IUUA 1KD1U 2KNBB 1AZGB 1E6GA 2OI3A 4J6XA 3RNJA 1WDXA 4C8QC 3THKA 2RHIA 3JB9F 5GAMg 2CDTA 4JZ3A 1LCKA 3H41A 4NL2A 2VWFA 4C8QG 2DD5A 3RR6A 4QQ6A 3CMAQ 2AK5A 3UATA 1OI1A 3OW2S 3ZL7C 3RKYA 3MEWA 2PU9B 1H8KA 2GGRA 2X4WA 5LJ3d 5GAOr 2CS7A 1Y57A 1VQ9T 1YHQT 3SEMA 3RIRA 1KHIA 3DLLA 4J7FA 4RG8A 4MMLA 3VS1A 4WTOB 2FHDA 2QA4T 4DBHA 3GNGA 3CCUT 4HCCA 5GAMf 2HDAA 1VQ9A 1YHQA 3A8MB 1IGUA 4M7DC 2HQXA 2E4HA 2EYZA 2EQJA 4R55A 2ECZA 3OMGA 2QA4A 2RHXA 1ABOA 5A0LA 3CCUA 1VQLT 1ZLMA 1TUDA 4JPBW 1TXQA 3C0CA 1M2VA 4NS5A 4PLLA 3SHWA 5I2SA 4M7DB 1KQ1A 2MYSA 2GBQA 1K73U 2HCKA 2P0KA 1RAFB 5KYWB 2XKOC 3QXEB 4B6MA 2L3QA 2W10A 4E7HA 2HD0A 4ESRA 1M90U 2X4XA 4C5IA 2V1RA 2XICA 1U5SA 2DLPA 3U23A 4RCBA 1WGSA 3I5SA 2HBPA 1ZX6A 2A0FB 4PKCC 4F7UE 5GJVB 5KE3A 3S6WA 1RAAB 2JM9A 2JMAA 1E6HA 3VYGA 4C0DB 2CH4W 2DZCA 1NE8A 2NYSA 1K4US 3WXMB 5CKFA 4M75F 4CC7A 3M5AA 3NTKA 3QWXX 1R77A 1TUCA 3OBYA 2JMCA 1QCNA 1ZQ1A 1NEGA 2NUZA 3EG9A 1B07A 1H641 1WIEA 2A7YA 5CR2A 3OMCA 1UGVA 1N8RC 2KYMA 1MMNA 3EG2A 2DL3A 1KSWA 1ZBXA 3EGDB 2COZA 2JS2A 4J83A 1Z9QA 3X28B 1UB4A 1ZSGA 1ZA2B 4FCYA 2KY9A 4YTLA 2FRWA 4RTYA 1HD3A 3KBGA 1C1AA 2NUTB 4HCKA 1X75C 1HYOA 1ZUKA 2DBKA 1G83A 2M02A 1VYTA 2DRMA 1K76A 4FM4B 3I55T 1CKAA 3V8JA 5KE2A 1MNDA 2DXCA 2O2OA 3NMZC 3OS5A 1BU1A 2QQSA 3EH2A 1H3HA 2O4XA 3RESA 3R6OA 1X43A 1KFZA 4PJOE 3H0IA 2ATCB 2FRYA 2ROLA 3VV0A 2DILA 4M77D 3I55A 1N9RA 2VGNA 1YJWT 1OZ2A 4OMMA 3SWNA 3CXCP 5C0MA 3CXCS 4XU3A 2XU8A 1VQ7Q 2DKGA 3CD6Q 1NPPA 5CKBA 2LC4A 2L3SA 2FL7A 3JB9H 1YJWA 5HK0A 1TOVA 2EWNA 1RUWA 3H9NA 4L59A 1X01A 2AIRB 3CCVQ 1WQ7A 3SD4A 3V8LA 4JRPA 4R0KA 3G4SQ 2BE9B 1WXUA 1KC8R 4Z89A 2M1HA 2DL8A 1JRIA 2RJFA 1WJQA 4LDUA 5GAOn 3PNWC 2YWWA 1I0CA 2M51A 2COYA 2ED0A 1TSFA 1WX6A 4FYYB 1QQJA 1XOVA 1QP3A 3EHQA 3MEVA 4K11A 2AKKA 5A2QE 2LTOA 3JCMd 2O31A 2AKLA 2JTMA 4MZMA 5GMKm 4M77E 1R8OB 2DTOA 2QTXA 2RI3A 1B34B 1LNXA 3RKWA 1YIJT 5LJ5h 1JJ2S 2P4TA 1VIFA 2P84A 1WHGA 3CPWS 3E2UA 3EAEA 1WI7A 1VQ8T 1VQNQ 4E7ZA 3OS1A 4KGZB 2R5AA 3VKIA 1Q86U 2K5FA 1M1FA 1NLOC 1OZ3A 3KFVA 3IQLA 4JJNK 4HXJA 3JCMc 4QKUA 2E6ZA 4J6WA 1VQ8A 3CC2T 2OTJQ 2FZKB 1EFNA 1Y96A 1OV3A 2WSCE 3FJPA 5LJ3j 3J81E 1AWJA 3M56A 3QKJA 1M30A 2BUDA 3GP8A 3CC2A 2P4RA 5GAN5 4F7UA 2YLBA 4ZTJA 1AD5A 2L8DA 4BE2A 4E2FB 3H0FA 2K79A 1WHHA 1NZ9A 3H0HA 2LX9A 3QHSA 1YITT 3GOXA 1TUGB 2JJ9A 3CCST 2KR3A 2XDPA 4F7UG 1M1GA 4ZGJB 2KGTA 4JJBA 2EYQA 4OMFB 4C5EA 4Z8AA 1YITA 1VQ9Q 1YHQQ 1M1KR 3PE0A 1NJIC 3CCSA 2KVQG 1QW1A 3JCMV 1QMCA 5D6WA 4QW2A 3E9FA 3LH5A 3J7AF 4BY6C 4OMOA 2LQWA 4M7AF 1DJ7B 2QA4Q 4A4EA 3CCUQ 2FEIA 1X27A 1MV3A 2WSEE 2VB6A 1EIFA 1UTIA 2O9SA 3M57A 1W70A 2K2VA 1Z9ZA 2YUQA 1N8RU 4X34A 1WJRA 3C4SA 3DKMA 1VQLQ 1BI1A 4QT7A 3VS0A 2D9TA 5FWCA 4PJOA 4M75B 4C8QF 4E47A 4D6WA 2HKNA 2A08A 2XG8D 2BZXA 2LP5A 1KC8C 3EG3A 1G2BA 2KRNA 2P0QA 1IHWA 5IN1A 4PJOG 2L89A 5CCAA 2YUPA 1EX4A 1OU8A 1SSHA 1NEBA 3CMET 2F2WA 2RF0A 2A36A 2Z0WA 4LN2A 4CC3A 4XTWA 1VQOT 4XTVA 2RPNA 3VS5A 5LJ3e 2FPEA 1KIKA 2KXCA 1Q81R 5KH6A 4BI8B 3CMEA 2GTOA 5KYXA 3JRZA 3BDLA 1Q82R 1ZUYA 2XDBA 2KQWA 1VQOA 1S72T 2QDYB 3VS2A 3EG0A 4M4ZA 1BCMA 3FEOA 5LJ3g 4GLMA 1ZBJA 4ME7A 2D1XA 2D0NA 3KUFA 2RHZA 2YXYA 2VVKA 4QVCA 5D6XA 4HA8A 1S72A 2E3IA 3CPFA 4M77C 4M78D 4FU6A 4BI3A 2QXFA 1RAEB 1JXOA 5GAMh 1Y71A 3A8HB 3JCMJ 2MF2A 2LCSA 2KDSA 4J9IA 4M77B 4QVZA 2XMFA 4DBRA 2DFUA 3T9NA 2RM4A 3I55Q 3V7RA 1W1FA 2QQBA 2QYZA 3LGLA 2J6FA 5CKEA 5LL6S 1BBZA 3OYKA 1PC0A 4DEXA 4E6RA 5LJ3f 2LX7A 5DLQE 3EHRA 4NL3A 3I56T 3F70A 5KCOA 1YJWQ 2I2LA 2KRSA 3LYIA 4OMQA 2EQMA 2YUOA 3M55A 2EGCA 1UGSB 1VQ6T 4E7SA 4DBQA 3EFOB 1M3AA 1MGQA 3BDUA 3VS3A 1RAHB 2OJ2A 3I56A 3L1AA 1NYGA 2K3BA 1X2KA 2BIVA 1OX8A 1BCOA 2RD1A 3PMIA 1K9MR 3OA6A 1VQ6A 3C95A 2NUPA 1G8XA 4IKFA 2YRCA 5KYUB 2R58A 1VOMA 2A28A 3VUZA 3D7SB 4ZNXA 2K2MA 2K57A 1OULA 2DTIA 5GANg 3ULRB 2XI9A 2E6NA 2KYBA 2CUBA 2E5QA 1VQKT 2Y90A 2VASA 4RTUA 2X9HA 3V8KA 2KROA 1VQ5T 1YIJQ 2PVDB 3VS7A 3GNFB 3A8OB 1UG1A 3A8LB 1VQKA 1VQ8Q 1D1AA 4CC2A 1NPRA 2M9UA 3PIOA 1NJIU 1VQ5A 2OTLT 2F2XA 5I2MA 4D8DA 1SF9A 1PKSA 5CO7A 3CC2Q 1WA7A 2VYTA 1SRMA 4OGCA 1BI3A 3JB9D 2OTLA 3HRTA 3EH1A 3MCAB 2C0TA 3OYYA 2CUDA 1T3LA 4L5GA 3O8VA 1B7TA 2J05A 2MWPA 5CKDA 2RJCA 3MEUA 3QJ6A 1GFDA 1HK9A 4XQ3A 3CCRT 4J9HA 4DBFA 2HL3A 1K1ZA 1FWZA 1YITQ 1MUZA 1KC8U 1WYXA 4WCIA 2PQWA 3CCSQ 3MJXA 3JCMe 1QVGP 2EJGA 1G5VA 4BB7A 5GAN4 3ZBDA 1AVZC 1VYUA 3A8GB 3VU3C 3JV3A 2K4YA 4Q5WA 3VRZA 1Q86C 4AFUC 2DERA 1IB8A 5IXBA 4M7DA 2JM8A 4RTTA 5CKHA 5GAN8 1LJOA 3CEYA 4OF1A 2YUNA 5KYWA 3JCMg 3L2VA 4HVUA 2RQWA 3HSBA 3FIFA 3CBMA 2KMTA 4A4GA 8AT1B 3CC4T 2D0QB 2IIMA 4KGVB 4MDWA 3QJYA 3CCMT 1TU0B 2CP5A 5CQYA 3CC4A 4M7DG 1UJYA 4RCCA 3S3MA 1ZSZB 3V7SA 3CCMA 5GAOl 1OOTA 1FX7A 3RKXA 1VUBA 5GMKe 4KT0E 4KULA 1UHFA 1NLPC 2EQIA 4BUGA 2E10A 5KYNA 2E3HA 2PZ1A 1VQMT 2HMAA 1GRIA 1VQLA 4C5GA 4A4KA 1XQHA 1K9MC 2G6FX 3REAB 4F7UF 4KH0B 3JCMf 1TWBA 4JUVA 1UECA 1FMVA 4A4FA 1WXBA 3E1SA 4C0DC 2JUFA 2RI5A 4JRIA 4M75D 3JCMb 3L2ZA 1VQMA 2E70A 2HZYA 4ZGEB 2KE9A 5A0GA 1I5LA 1ZA1B 1KQSP 4N0AA 3KXTA 2V8JA 1PSEA 3V7CA 2MI6A 3CMEQ 4UC4A 3OYDA 1GL5A 1Q7YC 5ECAA 2NLUA 1VQOQ 3M53A 1M3BA 4N0AC 5CVIA 1OX9A 2KAFA 3LLRA 1AZEA 2NUTA 1Y0MA 2CZ7B 2H3JA 5GANd 4IURA 4AFQC 2JTFA 2JW4A 4J6YA 1GCQA 1RL2A 3OYLA 1S72Q 2MK5A 1PG5B 4M78B 2V8IA 3QPHA 1BYMA 2EYXA 3H8ZA 4J8OA 1IZ6A 4HVVA 1YCYA 1PNJA 1GCQC 4IUVA 3OYIA 2XHCA 1N6AA 1RABB 3HRSA 4KBMB 3M0QA 2RK2A 1FXXA 2L2PA 4BE0A 2IPOB 5J3BA 4Z88A 4M75E 2FPDA 4TVRA 2JN0A 5C6SA 1PSFA 2PTKA 1G3TA 2EFIA 4ELZC 4PFPA 2BKDN 4AFZC 3OYJA 4F04B 1D0XA 4LDWA 1E7OA 4PJOF 1RI0A 1WJSA 2EYWA 4DA4A 3CCQT 3JB9J 1M5Q1 1MHNA 1QVGA 2F5KA 1ACMB 1K8AR 2X35A 1ZUUA 1K0SA 1RADB 4RTZA 5KYYB 3NTHA 2HL5C 1D3BB 3EG9B 3CCQA 1MNEA 3I56Q 2LZ6B 2L0AA 4XTZA 3X25B 1VQ6Q 5A0DA 4N4HA 4DOVA 2EVRA 2C06A 2DNUA 2LNVA 4F14A 4A53A 3R6NA 4DEYA 2HAXA 1IGQA 1KD1R 2YLCA 1PWTA 1B34A 2XK0A 3TCJA 2JVVA 1YP5A 4ORZA 1SEMA 2DF6A 2CP6A 3M59A 3I9QA 2RH2A 5GAOq 2O4XB 1JO8A 4II1A 3JSCA 5M9OA 1QVFP 2I0NA 4BD3A 3SWNB 2MCNA 1VQKQ 5J39A 1ABQA 2DEQA 1KQSA 2E12A 1VQ5Q 2QEXT 1D09B 1M8VA 1RI9A 3OY9A 4E7LA 5CAIA 1SSFA 1ZHIA 2YRDA 2O88A 1YIJA 5DY9A 4EMKB 2OTLQ 2QEXA 3OYAA 1WZOA 4XK8E 4XTXA 1T3SA 3PTAA 1HXDA 3RERA 1PRLC 5GJWB 1QWFA 2A37A 4DQ2A 5LJ3h 3WVEB 3JCMX 1D0ZA 4HCBA 1K73R 1X6GA 5HKCA 4IUQA 4LNPA 3OYGA 1SPKA 4ZTFA 2RNAA 3OYEA 2KSSA 1M90R 2QQ9A 3N5BB 2EIFA 2DYIA 1EZZB 2ZAEA 1K9MU 3CCRQ 3META 4JRQA 1OQKA 3UPUA 2FG0A 4C92F 2SEMA 2K7AA 3GIBA 4M7AD 4RTXA 4OB2B 4F17A 3G6ET 4BACA 1M2OA 1UDLA 1Y96B 2IG0A 3HL8A 4X9DA 4FT2A 3TU4K 3URGA 4OMNA 3J80E 3PIPA 1Q7YU 1IHVA 4FT4A 1UE9A 4LE9A 3EGXB 1U1TA 1O9SA 4M75A 3G6EA 4FW1A 2HBWA 4EPCA 1JBMA 3CC4Q 2G3RA 2GQVA 2GTJA 3CCMQ 4C8QD 3CCJT 1U1SA 2EBPA 2LQKA 1BIAA 4M75C 2FPFA 1N9SA 3SDZA 3QUIA 2V26A 2DIQA 3HFOA 5FW9A 3DB3A 4CC4B 1XJWB 3S3NA 1QCOA 4M75G 3CCJA 1VQ4T 5FU6B 2EYYA 3CCLT 3JCMP 4PK4A 5GANj 2DVEA 1VQMQ 1QVFA 1D0YA 4BDZA 1QKWA 2R5MA 3M54A 4OMLA 4XU2A 4FYWB 2MIOA 4XTYA 1VQ4A 5GMKl 5FROA 1H3ZA 3CCLA 1XTDA 1YWOA 5IHKA 3C94A 3FJ5A 5FU7C 4JS5A 2XDDA 4D8KA 1UJ0A 5D6YA 2DE0X 1U3OA 1N27A 4MZPA 1FMKA 2LVMA 4O5VA 2DO3A 1QLYA 1AEYA 1JJ2A 3MEAA 1D1BA 5FU7B 5LJ5g 1M27C 3REBB 3AHUA 4IUTA 1F1BB 2CZ0B 3E9GA 5I11A 3NHNA 2F2VA 4M7DF 1KG1A 2AHJB 4QQDA 2CT3A 4M77A 2DRKA 1SG5A 3PVQA 1W4SA 1QVPA 2CYZB 2GCXA 2L3RA 4J9DA 1AHJB 4L6V5 2EQKA 2HSEB 3RBBB 2BTTA
chains in the Genus database with same CATH topology
2MWPA 2M16A 3OQ5A 5CKDA 1ZBXA 4J83A 3X28B 2RJCA 3MEUA 1UB4A 3TEEA 3JCMW 3QJ6A 1W2BS 1YI2T 1W2BA 2CGHA 4M77G 2DZ9A 2KY9A 4YTLA 1BIBA 2CKKA 3ZEHA 1HK9A 3KBGA 4XQ3A 3CCRT 1X75C 3CC7T 1FWZA 3ER0A 3P8HA 1KC8U 4FM4B 2MAMA 1YI2A 4ELYC 4C5HA 2PQWA 3I55T 3V8JA 5KE2A 3JCMe 1UEBA 2DXCA 2EJGA 5DM7R 1G5VA 3OS5A 4BB7A 4CRIA 3CMAT 4JLGA 5GAN4 3ZBDA 3A8GB 3VU3C 1XNIA 2K4YA 4Q5WA 3CC7A 2QQSA 2KK4A 3P8BB 2O4XA 3RESA 3R6OA 1Q86C 2RO0A 4FL6A 4PJOE 2XIDA 4F7UB 3VV0A 4M77D 3I55A 1K8AC 2CZ1B 1N9RA 4M7DA 2VGNA 1UGQB 2K3YA 3GLXA 5CKHA 3JCMh 2X4YA 5GAN8 1LJOA 3OYCA 1OZ2A 3CEYA 4OF1A 4XU1A 3SWNA 3JCMg 3UT1A 5C0MA 3BFMA 3L2VA 3CXCS 3CMAA 3CXCA 2ZZDA 3HSBA 3FIFA 3CBMA 2KMTA 3C12A 4XU3A 4A4GA 4C92E 5FU6C 3CC4T 2XU8A 4MZTA 3OYBA 4LDVA 2D0QB 4Y91A 2DKGA 4MDWA 2WSFE 4OB3B 4M78E 3QJYA 1NPPA 5CKBA 3ASKA 3CCMT 2LC4A 5GMKi 1M1KC 3JB9H 2FL7A 5GANe 1YJWA 5HK0A 1WPYA 2GFAA 2EWNA 5CQYA 1VQNT 4L59A 1X01A 1I81A 2K5IA 4RMOA 1WQ7A 3SD4A 3V8LA 3CC4A 4M7DG 3QG1A 4QVDA 4JRPA 4RCCA 3S3MA 3QBYA 2M1HA 3QSUA 3V7SA 3CCMA 5GAOl 1FX7A 3RKXA 4M7AE 1JRIA 1VUBA 2RJFA 1WJQA 2PUKB 2EJFA 4BY6B 5GANh 5GMKe 4KT0E 4KULA 1KD1C 4LDUA 4BUGA 5GAOn 1P92A 4ZN1A 3PNWC 2E10A 1VQMT 2QQRA 3M4YA 4LDXA 1VQLA 3HP9A 4A4KA 4C5GA 2YRVA 1XQHA 2VUBA 4B9XA 1I4K1 1XOVA 5GMKj 1QP3A 3EFSA 1K9MC 4V2SA 2GF7A 4F7UF 3JCMf 5LJ5e 4JUVA 4ATOA 3MEVA 4J5YA 4A4FA 5A2QE 2LTOA 3JCMd 5GMKh 3E1SA 4C0DC 2JTMA 4RG2A 3SFMA 2JUFA 2RI5A 4JRIA 4M75D 4MZMA 3JCMb 3L2ZA 4M77E 5GMKm 1VQMA 2E70A 2QQAA 4ZGEB 2M0OA 4ZN3A 1R8OB 2DTOA 2QTXA 2RI3A 1B34B 3MP6A 3L42A 4GLKA 4Y28E 5A0GA 4JS4A 1LNXA 4A4HA 1I5LA 4M7DD 3CCET 4N0AA 3RKWA 4C8QE 3KXTA 1YIJT 1G3SA 3GF5A 5LJ5h 2ZGWA 1JJ2S 2P4TA 1VIFA 1PSEA 2V8JA 3V7CA 2MI6A 4UC4A 3CBOA 1Y07A 3OYDA 3CPWS 4J7IA 3DLMA 1Q7YC 3CPWA 3EAEA 2NLUA 2ZPFB 3HRUA 4XAXB 3M53A 1VQ8T 4PJOB 2EJ9A 5IAYA 4N0AC 3OS1A 2DXBA 5CVIA 2R5AA 3VKIA 3CCEA 2K5FA 1Q86U 2KAFA 2DPPB 2RHYA 3LLRA 4C0ZA 4BI4A 1M1FA 5GANf 2LRQA 5IT9E 2LQ8A 1OZ3A 5HY6A 4OB0B 3QO3A 3Q1JA 1LOJA 2CZ7B 2H3JA 3JCMc 5GANd 5GAOp 2LCLA 4IURA 4JJNK 4C92B 2E6ZA 2JTFA 4LD6A 4J6YA 4J6WA 1RL2A 2OAUA 1VQ8A 3CC2T 3OYLA 1KHCA 5GAN3 4O6JA 1X6OA 4M78B 4Z02A 2V8IA 3PMTA 3QPHA 4PL6A 1BYMA 1Y96A 2WSCE 1V29B 1BI2A 3FJPA 3H8ZA 3H6ZA 4XU0A 5LJ3j 4M7AC 3J81E 4J8OA 1IZ6A 1O75A 1Q81C 1YCYA 4HKEA 4IUVA 3M56A 3G7ZA 2XHCA 3QKJA 3OYIA 2QI2A 1N6AA 1TH7A 1WQWA 2BUDA 2DTHA 2LCCA 3HRSA 4KBMB 3GP8A 1Q82C 3CC2A 4P5NA 2RI2A 2RK2A 1FXXA 3DB4A 3FC3A 5GAN5 3LH0A 4BE0A 2DIGA 1UGPB 5J3BA 4F7UA 5LJ5f 2E41A 5AYFA 2YLBA 4M75E 4M7AB 2MMPA 4HT9A 4TVRA 2JN0A 5C6SA 1PSFA 5LJ5d 1G3TA 2EFIA 3QDRB 5HK3A 4ZTJA 1K73C 4MDXA 4M7DE 4ELZC 1U8RA 2BKDN 2L8DA 5GAMj 4R56A 3OYJA 3L2UA 4BE2A 2XDBA 2E65A 3S3OA 4JDSA 3E19A 1WNLA 4LDWA 4PJOF 3OYNA 1RI0A 1WJSA 3HPWA 4DA4A 1NZ9A 2LX9A 3CCQT 3JB9J 1M5Q1 3QHSA 1MHNA 1YITT 1QVGS 1M90C 1JB0E 1QVGA 4EMGA 2F5KA 3GOXA 3MHXA 3CCRA 2E1HA 1BI0A 2X35A 3CCST 2XDPA 2JOYA 4F7UG 1M1GA 4ZGJB 4KUIA 4XTUA 4E7KA 3NTHA 1D3BB 4M78F 2EYQA 4C8QB 4KUDK 3HHTB 4OMFB 4C5EA 3CCQA 2O01E 3EFRA 5GAN7 1YITA 4C0FA 3NFCA 4HT8A 4XTZA 3OSVA 2DAQA 5DLOA 1YJWT 4LDYA 3X25B 3OSSC 3CCSA 1NJIC 1G3WA 2B8AA 2KVQG 4IUPA 5A0DA 1QW1A 4N4HA 3JCMV 2RJEA 5D6WA 4DOVA 3ME9A 2ZCFB 3E9FA 4QW2A 2FYKA 2C06A 3MO8A 4RKUE 3JB9I 3J7AF 4BY6C 3M4GA 3PGGA 1DJ7B 4M7AF 2LNVA 4A4EA 1VQ7T 4A53A 3X26B 3CD6T 2HAXA 2WSEE 2YLCA 1VIEA 1EIFA 5L8RE 3VYHB 2Y4YA 1B34A 2ZPBB 2XK0A 3TCJA 3M57A 2JVVA 2RB6A 3CCVT 2K2VA 1N8RU 4E7JA 4X34A 1WJRA 3C4SA 3DKMA 2VXEA 3G4ST 1VQ7A 1QP2A 1BI1A 3CD6A 3QZ5B 3HKSA 3X20B 2VXFA 3M59A 3QZ9B 5GAOq 2D9TA 2RH2A 4PLIA 4B9WA 4PJOA 5GAOm 2O4XB 4JLIA 4II1A 2LT1A 3QIIA 4M75B 3JSCA 4C8QF 4EMHA 4NOYA 5M9OA 2GFUA 3CCVA 4E47A 2PVOB 1G3YA 4D6WA 4N4IA 3FB9A 4FIBA 4BD3A 3G4SA 4PJOC 3SWNB 4C92A 2XG8D 2V8KA 4DOWA 2ZPHB 5J39A 1KC8C 4A54A 3LWHA 4BDYA 1KQSS 2DEQA 5CK9A 4M78A 1YBYA 3P8DA 1KQSA 2E12A 2LDMA 2K5LA 2P0QA 1YJNT 2QEXT 2ZPIB 1YJ9T 2FB7A 1M8VA 5IN1A 3OY9A 4C92C 2RJDA 3CBPA 4E7LA 4PJOG 3UDCA 2L89A 5CQXA 3OB9A 2R57A 5CCAA 3LGFA 5FRMA 5CAIA 2K3XA 4FSXA 4M78C 2FVUA 4X9CA 3CMET 3BW1A 3L2RA 1SSFA 1ZHIA 3INZA 1YIJA 4OVAA 5DY9A 3UWNA 4C92G 4EMKB 1K8AU 2RA2A 1OYXA 4XTWA 1VQOT 1YJNA 2QEXA 1M4ZA 3BY7A 4XTVA 1YJ9A 3OBWA 3MP1A 2F5TX 4OP0A 5LJ3e 4M78G 3OYAA 3TREA 4QQGA 5FRNA 2EQUA 4XK8E 4BI8B 4XTXA 3WVDB 5KH6A 4VUBA 2F69A 2ZPGB 3CMEA 2DK3A 1GXIE 3JRZA 4EDUA 4ZGDB 3PTAA 3L2QA 1HXDA 2HNIA 3RERA 3BDLA 3LWIA 3OYHA 2P0PA 1M1KU 1KQ2A 2KQWA 3RMSA 3OYFA 1VQOA 2QDYB 1S72T 2OTJT 4DQ2A 4PJOD 3FEOA 5LJ3h 3WVEB 3JCMX 4HCBA 4M7AA 2RK1A 2A3LA 4HCZA 5FLXE 5LJ3g 5I21A 5HKCA 1Y7XA 4IUQA 4M7AG 4ME7A 5GAMe 4MMKA 1D3BA 3KUFA 4PNOA 3OYGA 2RHZA 4C8QA 2E64A 4QVCA 3QYGB 4ZTFA 1VQPT 5D6XA 3FRNA 4HA8A 2OTJA 1S72A 4IUUA 2KSSA 3OYEA 3CPFA 4M77C 1KD1U 2MWOA 4C0GA 3FDRA 4FU6A 2QQ9A 4M78D 4J6XA 4BI3A 2QXFA 3N5BB 2EIFA 4C8QC 3JAME 2RHIA 1K9MU 5GAMh 5GAN2 3GPLA 3JB9F 3SB2A 1Y71A 3A8HB 3JCMJ 2VC8A 2MF2A 1VQPA 5GAMg 3META 4JRQA 3UPUA 2KDSA 2JNGA 2WACA 4M77B 4QVZA 4C92F 4NL2A 3T9NA 2ZPEB 2DD4A 2RM4A 2DD5A 4C8QG 3V7RA 2QQBA 3LGLA 3LX7A 4QQ6A 3RMQA 3L2WA 3GIBA 4M7AD 5CKEA 5LL6S 3OYMA 4JRKA 4OB2B 3OYKA 3G6ET 4BACA 1OI1A 1Y96B 3OW2S 2IG0A 3RKYA 3HL8A 4X9DA 4FT2A 3MEWA 3MP8A 5LJ3f 3OW2A 3TU4K 2PU9B 1M9SA 5DLQE 3URGA 3J80E 3PIPA 4NL3A 3OS2A 2X4WA 3I56T 5LJ3d 4N4GA 1Q7YU 5GAOr 4FT4A 3F70A 5KCOA 5EG2A 2CS7A 1VQ9T 1YHQT 2I2LA 1U1TA 3RIRA 1O9SA 1KHIA 2L5QA 3LYIA 4M75A 2EQMA 3G6EA 3M55A 1VQ6T 3DLLA 1UGSB 1I8FA 4J7FA 4EPCA 3QYHB 1JBMA 3VJPA 4RG8A 1MGQA 2G3RA 2GQVA 2RHUA 2YHTA 3BDUA 4MMLA 3RUXA 3JCMQ 2FHDA 3I56A 3L1AA 4C8QD 2QA4T 3CCJT 1U1SA 2LQKA 3GNGA 2BIVA 3CCUT 5GAMf 1BIAA 3PT9A 4M75C 1VQ9A 1YHQA 4HCCA 3A8MB 2RD1A 3PMIA 3LW5E 1N9SA 3OA6A 5GAMd 2PVGB 3QUIA 3SDZA 1VQ6A 2VV5A 4M7DC 2HQXA 2DIQA 3HFOA 3M58A 3NTIA 4OGEA 3C95A 3SWNC 3DB3A 1Q81U 4M77F 3S3NA 4IKFA 2EQJA 4R55A 4M75G 2R58A 2EKOA 3OMGA 2QA4A 2RHXA 3CCJA 1VQ4T 3FLGA 5A0LA 1VQNA 3CCUA 1Q82U 5FU6B 1VQLT 4LD9K 3VUZA 3CCLT 3JCMP 5GANj 2VGMA 4NS5A 4PLLA 2DVEA 1QVFS 5I2SA 1QVFA 4EMKA 4M7DB 1KQ1A 2K57A 4BDZA 2R5MA 2X4JA 3M54A 1K73U 2P0KA 1BKBA 4XU2A 3VUBA 2XKOC 3QXEB 2DTIA 5GANg 4XTYA 2XI9A 3ZFJA 1VQ4A 2E6NA 4E7HA 5GMKl 5FROA 1H3ZA 2IVWA 3PFSA 1XTDA 4EMKC 4E7IA 3CCLA 2HD0A 2E5QA 1VQKT 2Y90A 3G71T 5GAN6 1M90U 2X4XA 4C5IA 4CI0C 2XICA 3C94A 2DXUA 5FU7C 5KCHA 3JB9G 3V8KA 3A5ZB 4JS5A 1VQ5T 2Y4XA 4RCBA 2XDDA 1WGSA 2PVDB 5D6YA 5LJ5j 3GNFB 3A8OB 1N27A 4MZPA 4WF2A 2HBPA 3A8LB 4PKCC 1IREB 2LVMA 4F7UE 2DJZA 1VQKA 4O5VA 3G71A 5KE3A 2DO3A 3S6WA 5J26A 2PUOB 1JJ2A 1NPRA 3MEAA 2M9UA 5FU7B 5LJ5g 3PIOA 3X24B 1NJIU 3AHUA 1VQ5A 3VYGA 4C0DB 2OTLT 2DZCA 1NE8A 2EAYA 4IUTA 3WXMB 5CKFA 2XD0A 1UGRB 2HQEA 4M75F 4BE1A 5I2MA 2CZ0B 3E9GA 3M5AA 3NTKA 4M7DF 3OBYA 5CO7A 1KG1A 2VYTA 2AHJB 4QQDA 4M77A 3OS0A 4OGCA 1BI3A 3M9QA 1ZQ1A 3JB9D 2LT4A 1W4SA 1QVPA 2OTLA 3HRTA 2DXTA 1H641 2A7YA 2JZ2A 5CR2A 3MCAB 4GY5A 3OMCA 2CYZB 2GCXA 2L3RA 4C92D 2CZ6B 2D6FA 1AHJB 3OYYA 1N8RC 4OB1B 4L5GA 4L6V5 5CIUA 2EQKA 3HFNA 3O8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL3 A;  5LJ3 d;  2VXF A;  5GAO r;  5GAO q;  3JCM W;  2EJ9 A;  4PJO B;  4N0A C;  4PJO A;  5GAO m;  4JLI A;  2I2L A;  1U1T A;  3RIR A;  2CGH A;  4M75 B;  4M77 G;  2DZ9 A;  4M75 A;  4C8Q F;  4EMH A;  4NOY A;  1BIB A;  1I8F A;  4HT9 A;  5GAN f;  1JBM A;  1HK9 A;  1MGQ A;  2YHT A;  3BDU A;  3FB9 A;  1LOJ A;  3QO3 A;  4MML A;  4XQ3 A;  3RUX A;  3JCM c;  3JCM Q;  5GAN d;  5GAO p;  3SWN B;  4C92 B;  4C92 A;  4M7D B;  4J6Y A;  4J6W A;  3L1A A;  4C8Q D;  1U1S A;  4A54 A;  5GAM f;  1BIA A;  4M75 C;  5GAN 3;  2DEQ A;  4M78 B;  4M78 A;  2RD1 A;  1N9S A;  1Y96 A;  5GAM d;  3FJP A;  3QUI A;  4M7A C;  5LJ3 j;  4XU0 A;  3V8J A;  3JCM e;  4M7D C;  2FB7 A;  2EJG A;  3HFO A;  1M8V A;  1YCY A;  3SWN C;  4C92 C;  4PJO G;  4M77 F;  5GAN 4;  3VU3 C;  4M75 G;  5CAI A;  1TH7 A;  1WQW A;  4M78 C;  2DTH A;  4X9C A;  4M7D A;  3RES A;  3BW1 A;  3INZ A;  4PJO E;  5GAN 5;  3JCM P;  5GAN j;  4F7U B;  4F7U A;  5LJ5 f;  2DVE A;  2E41 A;  2YLB A;  4M77 D;  4M75 E;  5DY9 A;  4M7A B;  2RA2 A;  4XTW A;  1KQ1 A;  1N9R A;  2K57 A;  3JCM h;  2JN0 A;  3BY7 A;  4XTV A;  4EMK A;  5LJ5 d;  5GAN 8;  1LJO A;  4XU1 A;  3SWN A;  4OP0 A;  3JCM g;  5LJ3 e;  4XU2 A;  3BFM A;  4M7D E;  4M78 G;  3HSB A;  3FIF A;  5GAM j;  4C92 E;  4XU3 A;  2DTI A;  2E65 A;  5GAN g;  4XTY A;  1WNL A;  4XTX A;  4PJO F;  4Y91 A;  2DKG A;  5GMK l;  4EMK C;  4M78 E;  1HXD A;  1M5Q 1;  2HNI A;  2Y90 A;  3QHS A;  5GMK i;  3JB9 J;  3RER A;  1KQ2 A;  5GAN 6;  4EMG A;  3JB9 H;  5GAN e;  1WPY A;  2E1H A;  2DXU A;  4DQ2 A;  2EWN A;  4PJO D;  5LJ3 h;  3JB9 G;  4C92 G;  3V8K A;  3JCM X;  1X01 A;  1I81 A;  4F7U G;  4M7A A;  4RCB A;  1WQ7 A;  3V8L A;  5LJ3 g;  4M7A G;  5I21 A;  4XTU A;  4M7D G;  5LJ5 j;  4QVD A;  5GAM e;  1D3B B;  4MMK A;  1D3B A;  4RCC A;  4M78 F;  4PNO A;  4WF2 A;  4C8Q B;  4C8Q A;  2E64 A;  4QVC A;  3QSU A;  3EFR A;  3V7S A;  4F7U E;  2DJZ A;  5GAN 7;  5GAO l;  4HA8 A;  3RKX A;  1JRI A;  4HT8 A;  4XTZ A;  4M7A E;  2EJF A;  5GAN h;  5GMK e;  4M77 C;  5GAO n;  5LJ5 g;  4M78 D;  3AHU A;  2E10 A;  4J6X A;  2DZC A;  2EAY A;  4C8Q C;  3JCM V;  1I4K 1;  4M75 F;  5GMK j;  3JB9 F;  3EFS A;  2FYK A;  5GAM h;  5GAN 2;  3SB2 A;  3JB9 I;  4V2S A;  4F7U F;  3JCM J;  2VC8 A;  3JCM f;  5LJ5 e;  5GAM g;  3M4G A;  3PGG A;  4JUV A;  4M7A F;  4J5Y A;  4M7D F;  4A53 A;  4EMK B;  3JCM d;  4M77 B;  4M77 A;  4C92 F;  5GMK h;  4M75 D;  4NL2 A;  4JRI A;  2RM4 A;  4C8Q G;  3JCM b;  3JB9 D;  3L2Z A;  4M77 E;  3V7R A;  5GMK m;  2YLC A;  2DXT A;  4PJO C;  2DTO A;  2QTX A;  1I5L A;  1B34 B;  1H64 1;  1B34 A;  3GIB A;  4M7D D;  4M7A D;  1LNX A;  4JRK A;  4N0A A;  3RKW A;  4C92 D;  4C8Q E;  2RB6 A;  1Y96 B;  2ZGW A;  5LJ5 h;  3RKY A;  3HFN A;  4X9D A;  2VXE A;  3V7C A;  5LJ3 f; 
#chains in the Genus database with same CATH topology
 3M0S A;  4ANJ A;  2M16 A;  1A0N B;  3OQ5 A;  1YI2 T;  1W2B A;  4M77 G;  2CKK A;  2DL7 A;  3EFO A;  6AT1 B;  4J9C A;  3RDV A;  1OU9 A;  3CCQ Q;  3CC7 T;  3ER0 A;  2DL5 A;  4KRT A;  3P8H A;  2DET A;  1YI2 A;  3EG1 A;  4KH1 B;  4LXC A;  5KYX B;  3VS6 A;  1UEB A;  1XNI A;  5KYU A;  2JT4 A;  4PJM A;  3CC7 A;  2KK4 A;  2RO0 A;  2CP2 A;  1MMD A;  2QGG A;  2XID A;  2CZ1 B;  3JCM h;  3GLX A;  1IRX A;  4E7J A;  2X4Y A;  4XU1 A;  2E5K A;  2ZZD A;  2MOX A;  4MZT A;  4LDV A;  2AZV A;  4Y91 A;  1Q95 G;  2WSF E;  4OB3 B;  4M78 E;  1H92 A;  3ASK A;  1M1K C;  5GAN e;  1WPY A;  1CSK A;  2GFA A;  2EW3 A;  4RMO A;  1I81 A;  2BZY A;  1TG0 A;  2DMO A;  1AWO A;  2HEQ A;  2PUK B;  2EJF A;  4PJN A;  3NPF A;  4ZN1 A;  3UA6 A;  1KK7 A;  2VUB A;  1I4K 1;  5GMK j;  2GF7 A;  4ATO A;  3CQT A;  5GMK h;  4RG2 A;  2GNC A;  1FYN A;  2QQA A;  2M0O A;  4ZN3 A;  1TS9 A;  3MP6 A;  4GLK A;  2QEX Q;  3L42 A;  4A4H A;  2DEU A;  3CCE T;  1CKB A;  1J3T A;  1I5O B;  1G3S A;  2DVJ A;  3GF5 A;  2K9G A;  3DLM A;  4A63 B;  2ZPF B;  4XAX B;  2EJ9 A;  2KXD A;  3CCE A;  2QAZ A;  4AG1 C;  1OPL A;  2DPP B;  2RHY A;  4C0Z A;  2YT6 A;  3QDF A;  5GAN f;  5IT9 E;  2O9V A;  2LQ8 A;  3TSZ A;  4OB0 B;  2OX7 A;  3QO3 A;  1LOJ A;  1PRM C;  1GBR A;  5GAO p;  2LCL A;  4C92 B;  4LD6 A;  2OAU A;  1B3Q A;  1AWW A;  1X6O A;  4Z02 A;  4PL6 A;  4M7A C;  3A1P A;  1Q81 C;  4HKE A;  2QI2 A;  1TH7 A;  2DTH A;  3O5Z A;  2ROT A;  1Q82 C;  4P5N A;  3FC3 A;  2DIG A;  5IHN A;  1GFC A;  5AYF A;  4M7A B;  3I35 A;  4FSS A;  5LJ5 d;  3QDR B;  4R56 A;  3L2U A;  3I5R A;  4RTW A;  1PM3 A;  2E65 A;  4JDS A;  1WNL A;  3OYN A;  1V1C A;  3HPW A;  1QVG S;  1JB0 E;  4EMG A;  3MHX A;  3CCR A;  5EC7 A;  2E1H A;  1BI0 A;  3G6E Q;  2EKH A;  4E7K A;  4KGX B;  4KUD K;  4C8Q B;  1ZSZ A;  3HHT B;  1IO6 A;  2O01 E;  3EFR A;  5GAN 7;  3NFC A;  4HT8 A;  3OW2 P;  2DAQ A;  4LDY A;  3OSS C;  1G3W A;  4IUP A;  1ZSZ C;  3BE3 A;  1SHF A;  2RJE A;  3ME9 A;  2FYK A;  1V76 A;  2JTE A;  3M4G A;  1WHM A;  3PGG A;  3CCJ Q;  4LUE A;  1RLQ C;  1VYV A;  5L8R E;  8ATC B;  1M8M A;  2HSP A;  1VQ4 Q;  2VXE A;  2BE7 D;  2OAW A;  3CCL Q;  3QZ5 B;  1JQQ A;  1WHK A;  3X20 B;  1BB9 A;  2RQT A;  3QZ9 B;  3QWY A;  1K0X A;  1RLP C;  2L3P A;  4JLI A;  1YWP A;  4EMH A;  2LNH B;  2GFU A;  2FZG B;  4N4I A;  4FIB A;  2ED1 A;  2RQV A;  4DOW A;  2ZPH B;  4A54 A;  3LWH A;  1KQS S;  4M78 A;  2LDM A;  2K5L A;  1YJN T;  1YJ9 T;  2FB7 A;  2RJD A;  3CBP A;  2J7I A;  5CQX A;  2R57 A;  5FRM A;  3LGF A;  3EGD A;  2K3X A;  4M78 C;  2FVU A;  4X9C A;  3L2R A;  1M2V B;  4OVA A;  3UWN A;  2DYB A;  1OYX A;  2RA2 A;  1YJN A;  2J06 A;  1YJ9 A;  3OBW A;  3MP1 A;  2RN8 A;  2DM1 A;  4PFO A;  5D7U A;  4M78 G;  5FRN A;  3NGP A;  1JEG A;  3TVT A;  3WVD B;  4VUB A;  2F69 A;  2RMO A;  2ZPG B;  4EDU A;  1VA7 A;  3L2Q A;  2HNI A;  3LWI A;  3OYH A;  2P0P A;  1M1K U;  4IIO A;  3RMS A;  3OYF A;  3MPU B;  2EGE A;  4PJO D;  2RK1 A;  2A3L A;  4HCZ A;  5FLX E;  5KYY A;  1D3B A;  4PNO A;  3VS4 A;  3QYG B;  1VQP T;  1YNZ A;  1YI2 Q;  2LJ1 A;  2MWO A;  4C0G A;  3M0P A;  3FDR A;  2YSQ A;  1QCF A;  2CP7 A;  1MMG A;  1WHL A;  3JAM E;  5GAN 2;  1N5Z A;  3GPL A;  3SB2 A;  2VC8 A;  1VQP A;  3CC7 Q;  2JNG A;  2WAC A;  2ZPE B;  2DD4 A;  3TQ7 P;  3UF4 A;  3LX7 A;  3L2W A;  3RMQ A;  2KI7 A;  5I22 A;  1NJI R;  3OYM A;  4JRK A;  4AFS C;  3OW2 A;  3MP8 A;  1YFN A;  4F16 A;  1M9S A;  3OS2 A;  4N4G A;  1W6X A;  1KJW A;  5EG2 A;  1SHG A;  2CT4 A;  2L5Q A;  5L23 A;  1I8F A;  3QYH B;  3VJP A;  2RHU A;  2QDL A;  2J6O A;  2YHT A;  3RUX A;  3JCM Q;  4AMC A;  4AG2 C;  1AT1 B;  3PT9 A;  3LW5 E;  5GAM d;  2PVG B;  1GCP A;  2VV5 A;  1SRL A;  3M58 A;  1NBE B;  3NTI A;  4OGE A;  2LJ3 A;  3SWN C;  1Q81 U;  2CP3 A;  4M77 F;  2EKO A;  4PJJ A;  3FLG A;  4PFZ A;  1PD1 A;  1Q82 U;  4LD9 K;  1AWX A;  2VGM A;  1QVF S;  1UUE A;  4EMK A;  2FZC B;  1MV0 B;  2X4J A;  2JXB A;  2LQN A;  1BKB A;  1T0J A;  1WLP B;  3EGU A;  3VUB A;  1WFW A;  1QWE A;  3ZFJ A;  2IVW A;  3PFS A;  4EMK C;  4E7I A;  1GBQ A;  3G71 T;  5GAN 6;  4CI0 C;  2QAS A;  2RQR A;  2H3E B;  2DXU A;  5KCH A;  3JB9 G;  3CCE Q;  3A5Z B;  2CRE A;  2Y4X A;  5LJ5 j;  4WF2 A;  4JJD A;  1IRE B;  2DJZ A;  3G71 A;  2CSI A;  1JJ2 P;  1MMA A;  5J26 A;  2PUO B;  3A98 A;  1I07 A;  3X24 B;  4HVW A;  3CPW P;  2EAY A;  2LJ0 A;  1PHT A;  1D1C A;  1YCS B;  2XD0 A;  1UGR B;  2HQE A;  4BE1 A;  1RAC B;  2AZS A;  3TSW A;  3OS0 A;  4OMP A;  3M9Q A;  2LT4 A;  2SRC A;  2DXT A;  2KT1 A;  2JZ2 A;  4GY5 A;  1OEB A;  4C92 D;  2CZ6 B;  2D6F A;  2QTV A;  1M3C A;  3AT1 B;  4OB1 B;  5CIU A;  3HFN A;  2DA9 A;  3UA7 A;  3TEE A;  1W2B P;  3JCM W;  1W2B S;  3EGX A;  2CGH A;  2DZ9 A;  1BIB A;  3ZEH A;  4FYV B;  2X51 A;  5IH2 A;  2MAM A;  4ELY C;  2DX1 A;  2H8H A;  4C5H A;  2KT8 A;  1I1J A;  1NG2 A;  5DM7 R;  4EIK A;  4CRI A;  3CMA T;  2EGA A;  4JLG A;  1OPK A;  2JS0 A;  2VKN A;  1S1N A;  3P8B B;  1PKT A;  2C0I A;  2CH4 A;  4FL6 A;  4F7U B;  1K8A C;  2GQI A;  2DJQ A;  1UGQ B;  2K3Y A;  3OYC A;  2HQH A;  1RAG B;  3UT1 A;  3CMA A;  3BFM A;  2QK0 A;  3CXC A;  5IXF A;  3C12 A;  4C92 E;  5FU6 C;  3OYB A;  2X3X D;  1SKU B;  5GMK i;  2CSQ A;  1JXM A;  2ABL A;  2NWM A;  2K5I A;  1AOJ A;  2LMJ A;  3QG1 A;  4QVD A;  3QBY A;  1U06 A;  3QSU A;  4M7A E;  4BY6 B;  1T0H A;  1KD1 C;  5GAN h;  1P92 A;  2ENM A;  2QQR A;  3M4Y A;  4LDX A;  3HP9 A;  2YRV A;  4B9X A;  3M0U A;  3EFS A;  4V2S A;  2C0O A;  5LJ5 e;  4J5Y A;  3GBQ A;  2F1L A;  2QG9 B;  2RQU A;  4IIM A;  3SFM A;  2K6D A;  7AT1 B;  1C6V X;  1YJN Q;  5AT1 B;  1YJ9 Q;  4Y28 E;  4PJO C;  4JS4 A;  4M7D D;  4C8Q E;  2ZGW A;  3HTR A;  3CBO A;  1Y07 A;  2AT1 B;  2PNI A;  4J7I A;  9ATC B;  3CPW A;  3HRU A;  4PJO B;  5IAY A;  2DXB A;  3MKD A;  4BI4 A;  2FO0 A;  2LRQ A;  4JJC A;  5HY6 A;  3Q1J A;  1WXT A;  1C0M A;  1KHC A;  5GAN 3;  4O6J A;  3PMT A;  1V29 B;  1BI2 A;  3H6Z A;  4XU0 A;  5FWB A;  2B86 A;  4FW2 A;  1O75 A;  2KRM A;  3G7Z A;  4RTV A;  1VQP Q;  3PVL A;  1WQW A;  2LCC A;  2RI2 A;  3DB4 A;  3LH0 A;  1UGP B;  4RUG A;  2ESW A;  5LJ5 f;  2E41 A;  1BK2 A;  2MMP A;  4HT9 A;  1PD0 A;  2DL4 A;  1K73 C;  5HK3 A;  4MDX A;  4M7D E;  1HSQ A;  1U8R A;  5GAM j;  4J9F A;  3S3O A;  3E19 A;  2QGF B;  1YN8 A;  1Q86 R;  1M90 C;  2M0Y A;  1IXD A;  2HKQ B;  2CP0 A;  4LUD A;  2JOY A;  1TTH B;  4KUI A;  4XTU A;  3G1J A;  4M78 F;  2J6K A;  4C0F A;  1QKX A;  3OSV A;  2YDL A;  5DLO A;  2B8A A;  1WHJ A;  4Y92 A;  2ZCF B;  1ARK A;  3MO8 A;  4RKU E;  3JB9 I;  4X1V A;  4J9G A;  1VQ7 T;  3X26 B;  3CD6 T;  5HCK A;  2D8J A;  3M0T A;  1VIE A;  3VYH B;  1HJD A;  2Y4Y A;  5IHI A;  2ZPB B;  2KEA A;  2RB6 A;  1FMW A;  3CCV T;  1NYF A;  4J9B A;  1R0B G;  3G4S T;  1VQ7 A;  1QP2 A;  3CD6 A;  2W0Z A;  2EPD A;  1LPL A;  3HKS A;  2VXF A;  4PLI A;  4B9W A;  1UFF A;  5GAO m;  2LT1 A;  3QII A;  4NOY A;  4PJL A;  3CCV A;  1PCX A;  2PVO B;  1G3Y A;  3FB9 A;  3G4S A;  2KBT A;  1JU5 C;  4C92 A;  2V8K A;  4J9E A;  3G71 Q;  4BDY A;  5CK9 A;  1Q7Y R;  1YBY A;  2V1Q A;  3P8D A;  4GBQ A;  2D8H A;  2BZ8 A;  2ZPI B;  2NUP B;  4C92 C;  3UDC A;  1RAI B;  3OB9 A;  4FYX B;  4JZ4 A;  1R0C B;  4FSX A;  1LVK A;  3BW1 A;  3INZ A;  1X69 A;  2MPX C;  4C92 G;  1K8A U;  1VQN T;  4M7A A;  1M4Z A;  3BY7 A;  1N8R R;  2F5T X;  4OP0 A;  3TRE A;  4QQG A;  3M0R A;  2EQU A;  1GXI E;  1X2Q A;  2DK3 A;  4ZGD B;  1K9A A;  4AT1 B;  2COW A;  1NM7 A;  1KQ2 A;  1VQN A;  2OTJ T;  1X6B A;  1UHC A;  2DBM A;  4M7A G;  5I21 A;  1Y7X A;  2X3W D;  3VRY A;  5GAM e;  4MMK A;  4C8Q A;  2E64 A;  3FRN A;  2OTJ A;  4IUU A;  1KD1 U;  2KNB B;  1AZG B;  1E6G A;  2OI3 A;  4J6X A;  3RNJ A;  1WDX A;  4C8Q C;  3THK A;  2RHI A;  3JB9 F;  5GAM g;  2CDT A;  4JZ3 A;  1LCK A;  3H41 A;  4NL2 A;  2VWF A;  4C8Q G;  2DD5 A;  3RR6 A;  4QQ6 A;  3CMA Q;  2AK5 A;  3UAT A;  1OI1 A;  3OW2 S;  3ZL7 C;  3RKY A;  3MEW A;  2PU9 B;  1H8K A;  2GGR A;  2X4W A;  5LJ3 d;  5GAO r;  2CS7 A;  1Y57 A;  1VQ9 T;  1YHQ T;  3SEM A;  3RIR A;  1KHI A;  3DLL A;  4J7F A;  4RG8 A;  4MML A;  3VS1 A;  4WTO B;  2FHD A;  2QA4 T;  4DBH A;  3GNG A;  3CCU T;  4HCC A;  5GAM f;  2HDA A;  1VQ9 A;  1YHQ A;  3A8M B;  1IGU A;  4M7D C;  2HQX A;  2E4H A;  2EYZ A;  2EQJ A;  4R55 A;  2ECZ A;  3OMG A;  2QA4 A;  2RHX A;  1ABO A;  5A0L A;  3CCU A;  1VQL T;  1ZLM A;  1TUD A;  4JPB W;  1TXQ A;  3C0C A;  1M2V A;  4NS5 A;  4PLL A;  3SHW A;  5I2S A;  4M7D B;  1KQ1 A;  2MYS A;  2GBQ A;  1K73 U;  2HCK A;  2P0K A;  1RAF B;  5KYW B;  2XKO C;  3QXE B;  4B6M A;  2L3Q A;  2W10 A;  4E7H A;  2HD0 A;  4ESR A;  1M90 U;  2X4X A;  4C5I A;  2V1R A;  2XIC A;  1U5S A;  2DLP A;  3U23 A;  4RCB A;  1WGS A;  3I5S A;  2HBP A;  1ZX6 A;  2A0F B;  4PKC C;  4F7U E;  5GJV B;  5KE3 A;  3S6W A;  1RAA B;  2JM9 A;  2JMA A;  1E6H A;  3VYG A;  4C0D B;  2CH4 W;  2DZC A;  1NE8 A;  2NYS A;  1K4U S;  3WXM B;  5CKF A;  4M75 F;  4CC7 A;  3M5A A;  3NTK A;  3QWX X;  1R77 A;  1TUC A;  3OBY A;  2JMC A;  1QCN A;  1ZQ1 A;  1NEG A;  2NUZ A;  3EG9 A;  1B07 A;  1H64 1;  1WIE A;  2A7Y A;  5CR2 A;  3OMC A;  1UGV A;  1N8R C;  2KYM A;  1MMN A;  3EG2 A;  2DL3 A;  1KSW A;  1ZBX A;  3EGD B;  2COZ A;  2JS2 A;  4J83 A;  1Z9Q A;  3X28 B;  1UB4 A;  1ZSG A;  1ZA2 B;  4FCY A;  2KY9 A;  4YTL A;  2FRW A;  4RTY A;  1HD3 A;  3KBG A;  1C1A A;  2NUT B;  4HCK A;  1X75 C;  1HYO A;  1ZUK A;  2DBK A;  1G83 A;  2M02 A;  1VYT A;  2DRM A;  1K76 A;  4FM4 B;  3I55 T;  1CKA A;  3V8J A;  5KE2 A;  1MND A;  2DXC A;  2O2O A;  3NMZ C;  3OS5 A;  1BU1 A;  2QQS A;  3EH2 A;  1H3H A;  2O4X A;  3RES A;  3R6O A;  1X43 A;  1KFZ A;  4PJO E;  3H0I A;  2ATC B;  2FRY A;  2ROL A;  3VV0 A;  2DIL A;  4M77 D;  3I55 A;  1N9R A;  2VGN A;  1YJW T;  1OZ2 A;  4OMM A;  3SWN A;  3CXC P;  5C0M A;  3CXC S;  4XU3 A;  2XU8 A;  1VQ7 Q;  2DKG A;  3CD6 Q;  1NPP A;  5CKB A;  2LC4 A;  2L3S A;  2FL7 A;  3JB9 H;  1YJW A;  5HK0 A;  1TOV A;  2EWN A;  1RUW A;  3H9N A;  4L59 A;  1X01 A;  2AIR B;  3CCV Q;  1WQ7 A;  3SD4 A;  3V8L A;  4JRP A;  4R0K A;  3G4S Q;  2BE9 B;  1WXU A;  1KC8 R;  4Z89 A;  2M1H A;  2DL8 A;  1JRI A;  2RJF A;  1WJQ A;  4LDU A;  5GAO n;  3PNW C;  2YWW A;  1I0C A;  2M51 A;  2COY A;  2ED0 A;  1TSF A;  1WX6 A;  4FYY B;  1QQJ A;  1XOV A;  1QP3 A;  3EHQ A;  3MEV A;  4K11 A;  2AKK A;  5A2Q E;  2LTO A;  3JCM d;  2O31 A;  2AKL A;  2JTM A;  4MZM A;  5GMK m;  4M77 E;  1R8O B;  2DTO A;  2QTX A;  2RI3 A;  1B34 B;  1LNX A;  3RKW A;  1YIJ T;  5LJ5 h;  1JJ2 S;  2P4T A;  1VIF A;  2P84 A;  1WHG A;  3CPW S;  3E2U A;  3EAE A;  1WI7 A;  1VQ8 T;  1VQN Q;  4E7Z A;  3OS1 A;  4KGZ B;  2R5A A;  3VKI A;  1Q86 U;  2K5F A;  1M1F A;  1NLO C;  1OZ3 A;  3KFV A;  3IQL A;  4JJN K;  4HXJ A;  3JCM c;  4QKU A;  2E6Z A;  4J6W A;  1VQ8 A;  3CC2 T;  2OTJ Q;  2FZK B;  1EFN A;  1Y96 A;  1OV3 A;  2WSC E;  3FJP A;  5LJ3 j;  3J81 E;  1AWJ A;  3M56 A;  3QKJ A;  1M30 A;  2BUD A;  3GP8 A;  3CC2 A;  2P4R A;  5GAN 5;  4F7U A;  2YLB A;  4ZTJ A;  1AD5 A;  2L8D A;  4BE2 A;  4E2F B;  3H0F A;  2K79 A;  1WHH A;  1NZ9 A;  3H0H A;  2LX9 A;  3QHS A;  1YIT T;  3GOX A;  1TUG B;  2JJ9 A;  3CCS T;  2KR3 A;  2XDP A;  4F7U G;  1M1G A;  4ZGJ B;  2KGT A;  4JJB A;  2EYQ A;  4OMF B;  4C5E A;  4Z8A A;  1YIT A;  1VQ9 Q;  1YHQ Q;  1M1K R;  3PE0 A;  1NJI C;  3CCS A;  2KVQ G;  1QW1 A;  3JCM V;  1QMC A;  5D6W A;  4QW2 A;  3E9F A;  3LH5 A;  3J7A F;  4BY6 C;  4OMO A;  2LQW A;  4M7A F;  1DJ7 B;  2QA4 Q;  4A4E A;  3CCU Q;  2FEI A;  1X27 A;  1MV3 A;  2WSE E;  2VB6 A;  1EIF A;  1UTI A;  2O9S A;  3M57 A;  1W70 A;  2K2V A;  1Z9Z A;  2YUQ A;  1N8R U;  4X34 A;  1WJR A;  3C4S A;  3DKM A;  1VQL Q;  1BI1 A;  4QT7 A;  3VS0 A;  2D9T A;  5FWC A;  4PJO A;  4M75 B;  4C8Q F;  4E47 A;  4D6W A;  2HKN A;  2A08 A;  2XG8 D;  2BZX A;  2LP5 A;  1KC8 C;  3EG3 A;  1G2B A;  2KRN A;  2P0Q A;  1IHW A;  5IN1 A;  4PJO G;  2L89 A;  5CCA A;  2YUP A;  1EX4 A;  1OU8 A;  1SSH A;  1NEB A;  3CME T;  2F2W A;  2RF0 A;  2A36 A;  2Z0W A;  4LN2 A;  4CC3 A;  4XTW A;  1VQO T;  4XTV A;  2RPN A;  3VS5 A;  5LJ3 e;  2FPE A;  1KIK A;  2KXC A;  1Q81 R;  5KH6 A;  4BI8 B;  3CME A;  2GTO A;  5KYX A;  3JRZ A;  3BDL A;  1Q82 R;  1ZUY A;  2XDB A;  2KQW A;  1VQO A;  1S72 T;  2QDY B;  3VS2 A;  3EG0 A;  4M4Z A;  1BCM A;  3FEO A;  5LJ3 g;  4GLM A;  1ZBJ A;  4ME7 A;  2D1X A;  2D0N A;  3KUF A;  2RHZ A;  2YXY A;  2VVK A;  4QVC A;  5D6X A;  4HA8 A;  1S72 A;  2E3I A;  3CPF A;  4M77 C;  4M78 D;  4FU6 A;  4BI3 A;  2QXF A;  1RAE B;  1JXO A;  5GAM h;  1Y71 A;  3A8H B;  3JCM J;  2MF2 A;  2LCS A;  2KDS A;  4J9I A;  4M77 B;  4QVZ A;  2XMF A;  4DBR A;  2DFU A;  3T9N A;  2RM4 A;  3I55 Q;  3V7R A;  1W1F A;  2QQB A;  2QYZ A;  3LGL A;  2J6F A;  5CKE A;  5LL6 S;  1BBZ A;  3OYK A;  1PC0 A;  4DEX A;  4E6R A;  5LJ3 f;  2LX7 A;  5DLQ E;  3EHR A;  4NL3 A;  3I56 T;  3F70 A;  5KCO A;  1YJW Q;  2I2L A;  2KRS A;  3LYI A;  4OMQ A;  2EQM A;  2YUO A;  3M55 A;  2EGC A;  1UGS B;  1VQ6 T;  4E7S A;  4DBQ A;  3EFO B;  1M3A A;  1MGQ A;  3BDU A;  3VS3 A;  1RAH B;  2OJ2 A;  3I56 A;  3L1A A;  1NYG A;  2K3B A;  1X2K A;  2BIV A;  1OX8 A;  1BCO A;  2RD1 A;  3PMI A;  1K9M R;  3OA6 A;  1VQ6 A;  3C95 A;  2NUP A;  1G8X A;  4IKF A;  2YRC A;  5KYU B;  2R58 A;  1VOM A;  2A28 A;  3VUZ A;  3D7S B;  4ZNX A;  2K2M A;  2K57 A;  1OUL A;  2DTI A;  5GAN g;  3ULR B;  2XI9 A;  2E6N A;  2KYB A;  2CUB A;  2E5Q A;  1VQK T;  2Y90 A;  2VAS A;  4RTU A;  2X9H A;  3V8K A;  2KRO A;  1VQ5 T;  1YIJ Q;  2PVD B;  3VS7 A;  3GNF B;  3A8O B;  1UG1 A;  3A8L B;  1VQK A;  1VQ8 Q;  1D1A A;  4CC2 A;  1NPR A;  2M9U A;  3PIO A;  1NJI U;  1VQ5 A;  2OTL T;  2F2X A;  5I2M A;  4D8D A;  1SF9 A;  1PKS A;  5CO7 A;  3CC2 Q;  1WA7 A;  2VYT A;  1SRM A;  4OGC A;  1BI3 A;  3JB9 D;  2OTL A;  3HRT A;  3EH1 A;  3MCA B;  2C0T A;  3OYY A;  2CUD A;  1T3L A;  4L5G A;  3O8V A;  1B7T A;  2J05 A;  2MWP A;  5CKD A;  2RJC A;  3MEU A;  3QJ6 A;  1GFD A;  1HK9 A;  4XQ3 A;  3CCR T;  4J9H A;  4DBF A;  2HL3 A;  1K1Z A;  1FWZ A;  1YIT Q;  1MUZ A;  1KC8 U;  1WYX A;  4WCI A;  2PQW A;  3CCS Q;  3MJX A;  3JCM e;  1QVG P;  2EJG A;  1G5V A;  4BB7 A;  5GAN 4;  3ZBD A;  1AVZ C;  1VYU A;  3A8G B;  3VU3 C;  3JV3 A;  2K4Y A;  4Q5W A;  3VRZ A;  1Q86 C;  4AFU C;  2DER A;  1IB8 A;  5IXB A;  4M7D A;  2JM8 A;  4RTT A;  5CKH A;  5GAN 8;  1LJO A;  3CEY A;  4OF1 A;  2YUN A;  5KYW A;  3JCM g;  3L2V A;  4HVU A;  2RQW A;  3HSB A;  3FIF A;  3CBM A;  2KMT A;  4A4G A;  8AT1 B;  3CC4 T;  2D0Q B;  2IIM A;  4KGV B;  4MDW A;  3QJY A;  3CCM T;  1TU0 B;  2CP5 A;  5CQY A;  3CC4 A;  4M7D G;  1UJY A;  4RCC A;  3S3M A;  1ZSZ B;  3V7S A;  3CCM A;  5GAO l;  1OOT A;  1FX7 A;  3RKX A;  1VUB A;  5GMK e;  4KT0 E;  4KUL A;  1UHF A;  1NLP C;  2EQI A;  4BUG A;  2E10 A;  5KYN A;  2E3H A;  2PZ1 A;  1VQM T;  2HMA A;  1GRI A;  1VQL A;  4C5G A;  4A4K A;  1XQH A;  1K9M C;  2G6F X;  3REA B;  4F7U F;  4KH0 B;  3JCM f;  1TWB A;  4JUV A;  1UEC A;  1FMV A;  4A4F A;  1WXB A;  3E1S A;  4C0D C;  2JUF A;  2RI5 A;  4JRI A;  4M75 D;  3JCM b;  3L2Z A;  1VQM A;  2E70 A;  2HZY A;  4ZGE B;  2KE9 A;  5A0G A;  1I5L A;  1ZA1 B;  1KQS P;  4N0A A;  3KXT A;  2V8J A;  1PSE A;  3V7C A;  2MI6 A;  3CME Q;  4UC4 A;  3OYD A;  1GL5 A;  1Q7Y C;  5ECA A;  2NLU A;  1VQO Q;  3M53 A;  1M3B A;  4N0A C;  5CVI A;  1OX9 A;  2KAF A;  3LLR A;  1AZE A;  2NUT A;  1Y0M A;  2CZ7 B;  2H3J A;  5GAN d;  4IUR A;  4AFQ C;  2JTF A;  2JW4 A;  4J6Y A;  1GCQ A;  1RL2 A;  3OYL A;  1S72 Q;  2MK5 A;  1PG5 B;  4M78 B;  2V8I A;  3QPH A;  1BYM A;  2EYX A;  3H8Z A;  4J8O A;  1IZ6 A;  4HVV A;  1YCY A;  1PNJ A;  1GCQ C;  4IUV A;  3OYI A;  2XHC A;  1N6A A;  1RAB B;  3HRS A;  4KBM B;  3M0Q A;  2RK2 A;  1FXX A;  2L2P A;  4BE0 A;  2IPO B;  5J3B A;  4Z88 A;  4M75 E;  2FPD A;  4TVR A;  2JN0 A;  5C6S A;  1PSF A;  2PTK A;  1G3T A;  2EFI A;  4ELZ C;  4PFP A;  2BKD N;  4AFZ C;  3OYJ A;  4F04 B;  1D0X A;  4LDW A;  1E7O A;  4PJO F;  1RI0 A;  1WJS A;  2EYW A;  4DA4 A;  3CCQ T;  3JB9 J;  1M5Q 1;  1MHN A;  1QVG A;  2F5K A;  1ACM B;  1K8A R;  2X35 A;  1ZUU A;  1K0S A;  1RAD B;  4RTZ A;  5KYY B;  3NTH A;  2HL5 C;  1D3B B;  3EG9 B;  3CCQ A;  1MNE A;  3I56 Q;  2LZ6 B;  2L0A A;  4XTZ A;  3X25 B;  1VQ6 Q;  5A0D A;  4N4H A;  4DOV A;  2EVR A;  2C06 A;  2DNU A;  2LNV A;  4F14 A;  4A53 A;  3R6N A;  4DEY A;  2HAX A;  1IGQ A;  1KD1 R;  2YLC A;  1PWT A;  1B34 A;  2XK0 A;  3TCJ A;  2JVV A;  1YP5 A;  4ORZ A;  1SEM A;  2DF6 A;  2CP6 A;  3M59 A;  3I9Q A;  2RH2 A;  5GAO q;  2O4X B;  1JO8 A;  4II1 A;  3JSC A;  5M9O A;  1QVF P;  2I0N A;  4BD3 A;  3SWN B;  2MCN A;  1VQK Q;  5J39 A;  1ABQ A;  2DEQ A;  1KQS A;  2E12 A;  1VQ5 Q;  2QEX T;  1D09 B;  1M8V A;  1RI9 A;  3OY9 A;  4E7L A;  5CAI A;  1SSF A;  1ZHI A;  2YRD A;  2O88 A;  1YIJ A;  5DY9 A;  4EMK B;  2OTL Q;  2QEX A;  3OYA A;  1WZO A;  4XK8 E;  4XTX A;  1T3S A;  3PTA A;  1HXD A;  3RER A;  1PRL C;  5GJW B;  1QWF A;  2A37 A;  4DQ2 A;  5LJ3 h;  3WVE B;  3JCM X;  1D0Z A;  4HCB A;  1K73 R;  1X6G A;  5HKC A;  4IUQ A;  4LNP A;  3OYG A;  1SPK A;  4ZTF A;  2RNA A;  3OYE A;  2KSS A;  1M90 R;  2QQ9 A;  3N5B B;  2EIF A;  2DYI A;  1EZZ B;  2ZAE A;  1K9M U;  3CCR Q;  3MET A;  4JRQ A;  1OQK A;  3UPU A;  2FG0 A;  4C92 F;  2SEM A;  2K7A A;  3GIB A;  4M7A D;  4RTX A;  4OB2 B;  4F17 A;  3G6E T;  4BAC A;  1M2O A;  1UDL A;  1Y96 B;  2IG0 A;  3HL8 A;  4X9D A;  4FT2 A;  3TU4 K;  3URG A;  4OMN A;  3J80 E;  3PIP A;  1Q7Y U;  1IHV A;  4FT4 A;  1UE9 A;  4LE9 A;  3EGX B;  1U1T A;  1O9S A;  4M75 A;  3G6E A;  4FW1 A;  2HBW A;  4EPC A;  1JBM A;  3CC4 Q;  2G3R A;  2GQV A;  2GTJ A;  3CCM Q;  4C8Q D;  3CCJ T;  1U1S A;  2EBP A;  2LQK A;  1BIA A;  4M75 C;  2FPF A;  1N9S A;  3SDZ A;  3QUI A;  2V26 A;  2DIQ A;  3HFO A;  5FW9 A;  3DB3 A;  4CC4 B;  1XJW B;  3S3N A;  1QCO A;  4M75 G;  3CCJ A;  1VQ4 T;  5FU6 B;  2EYY A;  3CCL T;  3JCM P;  4PK4 A;  5GAN j;  2DVE A;  1VQM Q;  1QVF A;  1D0Y A;  4BDZ A;  1QKW A;  2R5M A;  3M54 A;  4OML A;  4XU2 A;  4FYW B;  2MIO A;  4XTY A;  1VQ4 A;  5GMK l;  5FRO A;  1H3Z A;  3CCL A;  1XTD A;  1YWO A;  5IHK A;  3C94 A;  3FJ5 A;  5FU7 C;  4JS5 A;  2XDD A;  4D8K A;  1UJ0 A;  5D6Y A;  2DE0 X;  1U3O A;  1N27 A;  4MZP A;  1FMK A;  2LVM A;  4O5V A;  2DO3 A;  1QLY A;  1AEY A;  1JJ2 A;  3MEA A;  1D1B A;  5FU7 B;  5LJ5 g;  1M27 C;  3REB B;  3AHU A;  4IUT A;  1F1B B;  2CZ0 B;  3E9G A;  5I11 A;  3NHN A;  2F2V A;  4M7D F;  1KG1 A;  2AHJ B;  4QQD A;  2CT3 A;  4M77 A;  2DRK A;  1SG5 A;  3PVQ A;  1W4S A;  1QVP A;  2CYZ B;  2GCX A;  2L3R A;  4J9D A;  1AHJ B;  4L6V 5;  2EQK A;  2HSE B;  3RBB B;  2BTT A; 
#chains in the Genus database with same CATH homology
 2MWP A;  2M16 A;  3OQ5 A;  5CKD A;  1ZBX A;  4J83 A;  3X28 B;  2RJC A;  3MEU A;  1UB4 A;  3TEE A;  3JCM W;  3QJ6 A;  1W2B S;  1YI2 T;  1W2B A;  2CGH A;  4M77 G;  2DZ9 A;  2KY9 A;  4YTL A;  1BIB A;  2CKK A;  3ZEH A;  1HK9 A;  3KBG A;  4XQ3 A;  3CCR T;  1X75 C;  3CC7 T;  1FWZ A;  3ER0 A;  3P8H A;  1KC8 U;  4FM4 B;  2MAM A;  1YI2 A;  4ELY C;  4C5H A;  2PQW A;  3I55 T;  3V8J A;  5KE2 A;  3JCM e;  1UEB A;  2DXC A;  2EJG A;  5DM7 R;  1G5V A;  3OS5 A;  4BB7 A;  4CRI A;  3CMA T;  4JLG A;  5GAN 4;  3ZBD A;  3A8G B;  3VU3 C;  1XNI A;  2K4Y A;  4Q5W A;  3CC7 A;  2QQS A;  2KK4 A;  3P8B B;  2O4X A;  3RES A;  3R6O A;  1Q86 C;  2RO0 A;  4FL6 A;  4PJO E;  2XID A;  4F7U B;  3VV0 A;  4M77 D;  3I55 A;  1K8A C;  2CZ1 B;  1N9R A;  4M7D A;  2VGN A;  1UGQ B;  2K3Y A;  3GLX A;  5CKH A;  3JCM h;  2X4Y A;  5GAN 8;  1LJO A;  3OYC A;  1OZ2 A;  3CEY A;  4OF1 A;  4XU1 A;  3SWN A;  3JCM g;  3UT1 A;  5C0M A;  3BFM A;  3L2V A;  3CXC S;  3CMA A;  3CXC A;  2ZZD A;  3HSB A;  3FIF A;  3CBM A;  2KMT A;  3C12 A;  4XU3 A;  4A4G A;  4C92 E;  5FU6 C;  3CC4 T;  2XU8 A;  4MZT A;  3OYB A;  4LDV A;  2D0Q B;  4Y91 A;  2DKG A;  4MDW A;  2WSF E;  4OB3 B;  4M78 E;  3QJY A;  1NPP A;  5CKB A;  3ASK A;  3CCM T;  2LC4 A;  5GMK i;  1M1K C;  3JB9 H;  2FL7 A;  5GAN e;  1YJW A;  5HK0 A;  1WPY A;  2GFA A;  2EWN A;  5CQY A;  1VQN T;  4L59 A;  1X01 A;  1I81 A;  2K5I A;  4RMO A;  1WQ7 A;  3SD4 A;  3V8L A;  3CC4 A;  4M7D G;  3QG1 A;  4QVD A;  4JRP A;  4RCC A;  3S3M A;  3QBY A;  2M1H A;  3QSU A;  3V7S A;  3CCM A;  5GAO l;  1FX7 A;  3RKX A;  4M7A E;  1JRI A;  1VUB A;  2RJF A;  1WJQ A;  2PUK B;  2EJF A;  4BY6 B;  5GAN h;  5GMK e;  4KT0 E;  4KUL A;  1KD1 C;  4LDU A;  4BUG A;  5GAO n;  1P92 A;  4ZN1 A;  3PNW C;  2E10 A;  1VQM T;  2QQR A;  3M4Y A;  4LDX A;  1VQL A;  3HP9 A;  4A4K A;  4C5G A;  2YRV A;  1XQH A;  2VUB A;  4B9X A;  1I4K 1;  1XOV A;  5GMK j;  1QP3 A;  3EFS A;  1K9M C;  4V2S A;  2GF7 A;  4F7U F;  3JCM f;  5LJ5 e;  4JUV A;  4ATO A;  3MEV A;  4J5Y A;  4A4F A;  5A2Q E;  2LTO A;  3JCM d;  5GMK h;  3E1S A;  4C0D C;  2JTM A;  4RG2 A;  3SFM A;  2JUF A;  2RI5 A;  4JRI A;  4M75 D;  4MZM A;  3JCM b;  3L2Z A;  4M77 E;  5GMK m;  1VQM A;  2E70 A;  2QQA A;  4ZGE B;  2M0O A;  4ZN3 A;  1R8O B;  2DTO A;  2QTX A;  2RI3 A;  1B34 B;  3MP6 A;  3L42 A;  4GLK A;  4Y28 E;  5A0G A;  4JS4 A;  1LNX A;  4A4H A;  1I5L A;  4M7D D;  3CCE T;  4N0A A;  3RKW A;  4C8Q E;  3KXT A;  1YIJ T;  1G3S A;  3GF5 A;  5LJ5 h;  2ZGW A;  1JJ2 S;  2P4T A;  1VIF A;  1PSE A;  2V8J A;  3V7C A;  2MI6 A;  4UC4 A;  3CBO A;  1Y07 A;  3OYD A;  3CPW S;  4J7I A;  3DLM A;  1Q7Y C;  3CPW A;  3EAE A;  2NLU A;  2ZPF B;  3HRU A;  4XAX B;  3M53 A;  1VQ8 T;  4PJO B;  2EJ9 A;  5IAY A;  4N0A C;  3OS1 A;  2DXB A;  5CVI A;  2R5A A;  3VKI A;  3CCE A;  2K5F A;  1Q86 U;  2KAF A;  2DPP B;  2RHY A;  3LLR A;  4C0Z A;  4BI4 A;  1M1F A;  5GAN f;  2LRQ A;  5IT9 E;  2LQ8 A;  1OZ3 A;  5HY6 A;  4OB0 B;  3QO3 A;  3Q1J A;  1LOJ A;  2CZ7 B;  2H3J A;  3JCM c;  5GAN d;  5GAO p;  2LCL A;  4IUR A;  4JJN K;  4C92 B;  2E6Z A;  2JTF A;  4LD6 A;  4J6Y A;  4J6W A;  1RL2 A;  2OAU A;  1VQ8 A;  3CC2 T;  3OYL A;  1KHC A;  5GAN 3;  4O6J A;  1X6O A;  4M78 B;  4Z02 A;  2V8I A;  3PMT A;  3QPH A;  4PL6 A;  1BYM A;  1Y96 A;  2WSC E;  1V29 B;  1BI2 A;  3FJP A;  3H8Z A;  3H6Z A;  4XU0 A;  5LJ3 j;  4M7A C;  3J81 E;  4J8O A;  1IZ6 A;  1O75 A;  1Q81 C;  1YCY A;  4HKE A;  4IUV A;  3M56 A;  3G7Z A;  2XHC A;  3QKJ A;  3OYI A;  2QI2 A;  1N6A A;  1TH7 A;  1WQW A;  2BUD A;  2DTH A;  2LCC A;  3HRS A;  4KBM B;  3GP8 A;  1Q82 C;  3CC2 A;  4P5N A;  2RI2 A;  2RK2 A;  1FXX A;  3DB4 A;  3FC3 A;  5GAN 5;  3LH0 A;  4BE0 A;  2DIG A;  1UGP B;  5J3B A;  4F7U A;  5LJ5 f;  2E41 A;  5AYF A;  2YLB A;  4M75 E;  4M7A B;  2MMP A;  4HT9 A;  4TVR A;  2JN0 A;  5C6S A;  1PSF A;  5LJ5 d;  1G3T A;  2EFI A;  3QDR B;  5HK3 A;  4ZTJ A;  1K73 C;  4MDX A;  4M7D E;  4ELZ C;  1U8R A;  2BKD N;  2L8D A;  5GAM j;  4R56 A;  3OYJ A;  3L2U A;  4BE2 A;  2XDB A;  2E65 A;  3S3O A;  4JDS A;  3E19 A;  1WNL A;  4LDW A;  4PJO F;  3OYN A;  1RI0 A;  1WJS A;  3HPW A;  4DA4 A;  1NZ9 A;  2LX9 A;  3CCQ T;  3JB9 J;  1M5Q 1;  3QHS A;  1MHN A;  1YIT T;  1QVG S;  1M90 C;  1JB0 E;  1QVG A;  4EMG A;  2F5K A;  3GOX A;  3MHX A;  3CCR A;  2E1H A;  1BI0 A;  2X35 A;  3CCS T;  2XDP A;  2JOY A;  4F7U G;  1M1G A;  4ZGJ B;  4KUI A;  4XTU A;  4E7K A;  3NTH A;  1D3B B;  4M78 F;  2EYQ A;  4C8Q B;  4KUD K;  3HHT B;  4OMF B;  4C5E A;  3CCQ A;  2O01 E;  3EFR A;  5GAN 7;  1YIT A;  4C0F A;  3NFC A;  4HT8 A;  4XTZ A;  3OSV A;  2DAQ A;  5DLO A;  1YJW T;  4LDY A;  3X25 B;  3OSS C;  3CCS A;  1NJI C;  1G3W A;  2B8A A;  2KVQ G;  4IUP A;  5A0D A;  1QW1 A;  4N4H A;  3JCM V;  2RJE A;  5D6W A;  4DOV A;  3ME9 A;  2ZCF B;  3E9F A;  4QW2 A;  2FYK A;  2C06 A;  3MO8 A;  4RKU E;  3JB9 I;  3J7A F;  4BY6 C;  3M4G A;  3PGG A;  1DJ7 B;  4M7A F;  2LNV A;  4A4E A;  1VQ7 T;  4A53 A;  3X26 B;  3CD6 T;  2HAX A;  2WSE E;  2YLC A;  1VIE A;  1EIF A;  5L8R E;  3VYH B;  2Y4Y A;  1B34 A;  2ZPB B;  2XK0 A;  3TCJ A;  3M57 A;  2JVV A;  2RB6 A;  3CCV T;  2K2V A;  1N8R U;  4E7J A;  4X34 A;  1WJR A;  3C4S A;  3DKM A;  2VXE A;  3G4S T;  1VQ7 A;  1QP2 A;  1BI1 A;  3CD6 A;  3QZ5 B;  3HKS A;  3X20 B;  2VXF A;  3M59 A;  3QZ9 B;  5GAO q;  2D9T A;  2RH2 A;  4PLI A;  4B9W A;  4PJO A;  5GAO m;  2O4X B;  4JLI A;  4II1 A;  2LT1 A;  3QII A;  4M75 B;  3JSC A;  4C8Q F;  4EMH A;  4NOY A;  5M9O A;  2GFU A;  3CCV A;  4E47 A;  2PVO B;  1G3Y A;  4D6W A;  4N4I A;  3FB9 A;  4FIB A;  4BD3 A;  3G4S A;  4PJO C;  3SWN B;  4C92 A;  2XG8 D;  2V8K A;  4DOW A;  2ZPH B;  5J39 A;  1KC8 C;  4A54 A;  3LWH A;  4BDY A;  1KQS S;  2DEQ A;  5CK9 A;  4M78 A;  1YBY A;  3P8D A;  1KQS A;  2E12 A;  2LDM A;  2K5L A;  2P0Q A;  1YJN T;  2QEX T;  2ZPI B;  1YJ9 T;  2FB7 A;  1M8V A;  5IN1 A;  3OY9 A;  4C92 C;  2RJD A;  3CBP A;  4E7L A;  4PJO G;  3UDC A;  2L89 A;  5CQX A;  3OB9 A;  2R57 A;  5CCA A;  3LGF A;  5FRM A;  5CAI A;  2K3X A;  4FSX A;  4M78 C;  2FVU A;  4X9C A;  3CME T;  3BW1 A;  3L2R A;  1SSF A;  1ZHI A;  3INZ A;  1YIJ A;  4OVA A;  5DY9 A;  3UWN A;  4C92 G;  4EMK B;  1K8A U;  2RA2 A;  1OYX A;  4XTW A;  1VQO T;  1YJN A;  2QEX A;  1M4Z A;  3BY7 A;  4XTV A;  1YJ9 A;  3OBW A;  3MP1 A;  2F5T X;  4OP0 A;  5LJ3 e;  4M78 G;  3OYA A;  3TRE A;  4QQG A;  5FRN A;  2EQU A;  4XK8 E;  4BI8 B;  4XTX A;  3WVD B;  5KH6 A;  4VUB A;  2F69 A;  2ZPG B;  3CME A;  2DK3 A;  1GXI E;  3JRZ A;  4EDU A;  4ZGD B;  3PTA A;  3L2Q A;  1HXD A;  2HNI A;  3RER A;  3BDL A;  3LWI A;  3OYH A;  2P0P A;  1M1K U;  1KQ2 A;  2KQW A;  3RMS A;  3OYF A;  1VQO A;  2QDY B;  1S72 T;  2OTJ T;  4DQ2 A;  4PJO D;  3FEO A;  5LJ3 h;  3WVE B;  3JCM X;  4HCB A;  4M7A A;  2RK1 A;  2A3L A;  4HCZ A;  5FLX E;  5LJ3 g;  5I21 A;  5HKC A;  1Y7X A;  4IUQ A;  4M7A G;  4ME7 A;  5GAM e;  4MMK A;  1D3B A;  3KUF A;  4PNO A;  3OYG A;  2RHZ A;  4C8Q A;  2E64 A;  4QVC A;  3QYG B;  4ZTF A;  1VQP T;  5D6X A;  3FRN A;  4HA8 A;  2OTJ A;  1S72 A;  4IUU A;  2KSS A;  3OYE A;  3CPF A;  4M77 C;  1KD1 U;  2MWO A;  4C0G A;  3FDR A;  4FU6 A;  2QQ9 A;  4M78 D;  4J6X A;  4BI3 A;  2QXF A;  3N5B B;  2EIF A;  4C8Q C;  3JAM E;  2RHI A;  1K9M U;  5GAM h;  5GAN 2;  3GPL A;  3JB9 F;  3SB2 A;  1Y71 A;  3A8H B;  3JCM J;  2VC8 A;  2MF2 A;  1VQP A;  5GAM g;  3MET A;  4JRQ A;  3UPU A;  2KDS A;  2JNG A;  2WAC A;  4M77 B;  4QVZ A;  4C92 F;  4NL2 A;  3T9N A;  2ZPE B;  2DD4 A;  2RM4 A;  2DD5 A;  4C8Q G;  3V7R A;  2QQB A;  3LGL A;  3LX7 A;  4QQ6 A;  3RMQ A;  3L2W A;  3GIB A;  4M7A D;  5CKE A;  5LL6 S;  3OYM A;  4JRK A;  4OB2 B;  3OYK A;  3G6E T;  4BAC A;  1OI1 A;  1Y96 B;  3OW2 S;  2IG0 A;  3RKY A;  3HL8 A;  4X9D A;  4FT2 A;  3MEW A;  3MP8 A;  5LJ3 f;  3OW2 A;  3TU4 K;  2PU9 B;  1M9S A;  5DLQ E;  3URG A;  3J80 E;  3PIP A;  4NL3 A;  3OS2 A;  2X4W A;  3I56 T;  5LJ3 d;  4N4G A;  1Q7Y U;  5GAO r;  4FT4 A;  3F70 A;  5KCO A;  5EG2 A;  2CS7 A;  1VQ9 T;  1YHQ T;  2I2L A;  1U1T A;  3RIR A;  1O9S A;  1KHI A;  2L5Q A;  3LYI A;  4M75 A;  2EQM A;  3G6E A;  3M55 A;  1VQ6 T;  3DLL A;  1UGS B;  1I8F A;  4J7F A;  4EPC A;  3QYH B;  1JBM A;  3VJP A;  4RG8 A;  1MGQ A;  2G3R A;  2GQV A;  2RHU A;  2YHT A;  3BDU A;  4MML A;  3RUX A;  3JCM Q;  2FHD A;  3I56 A;  3L1A A;  4C8Q D;  2QA4 T;  3CCJ T;  1U1S A;  2LQK A;  3GNG A;  2BIV A;  3CCU T;  5GAM f;  1BIA A;  3PT9 A;  4M75 C;  1VQ9 A;  1YHQ A;  4HCC A;  3A8M B;  2RD1 A;  3PMI A;  3LW5 E;  1N9S A;  3OA6 A;  5GAM d;  2PVG B;  3QUI A;  3SDZ A;  1VQ6 A;  2VV5 A;  4M7D C;  2HQX A;  2DIQ A;  3HFO A;  3M58 A;  3NTI A;  4OGE A;  3C95 A;  3SWN C;  3DB3 A;  1Q81 U;  4M77 F;  3S3N A;  4IKF A;  2EQJ A;  4R55 A;  4M75 G;  2R58 A;  2EKO A;  3OMG A;  2QA4 A;  2RHX A;  3CCJ A;  1VQ4 T;  3FLG A;  5A0L A;  1VQN A;  3CCU A;  1Q82 U;  5FU6 B;  1VQL T;  4LD9 K;  3VUZ A;  3CCL T;  3JCM P;  5GAN j;  2VGM A;  4NS5 A;  4PLL A;  2DVE A;  1QVF S;  5I2S A;  1QVF A;  4EMK A;  4M7D B;  1KQ1 A;  2K57 A;  4BDZ A;  2R5M A;  2X4J A;  3M54 A;  1K73 U;  2P0K A;  1BKB A;  4XU2 A;  3VUB A;  2XKO C;  3QXE B;  2DTI A;  5GAN g;  4XTY A;  2XI9 A;  3ZFJ A;  1VQ4 A;  2E6N A;  4E7H A;  5GMK l;  5FRO A;  1H3Z A;  2IVW A;  3PFS A;  1XTD A;  4EMK C;  4E7I A;  3CCL A;  2HD0 A;  2E5Q A;  1VQK T;  2Y90 A;  3G71 T;  5GAN 6;  1M90 U;  2X4X A;  4C5I A;  4CI0 C;  2XIC A;  3C94 A;  2DXU A;  5FU7 C;  5KCH A;  3JB9 G;  3V8K A;  3A5Z B;  4JS5 A;  1VQ5 T;  2Y4X A;  4RCB A;  2XDD A;  1WGS A;  2PVD B;  5D6Y A;  5LJ5 j;  3GNF B;  3A8O B;  1N27 A;  4MZP A;  4WF2 A;  2HBP A;  3A8L B;  4PKC C;  1IRE B;  2LVM A;  4F7U E;  2DJZ A;  1VQK A;  4O5V A;  3G71 A;  5KE3 A;  2DO3 A;  3S6W A;  5J26 A;  2PUO B;  1JJ2 A;  1NPR A;  3MEA A;  2M9U A;  5FU7 B;  5LJ5 g;  3PIO A;  3X24 B;  1NJI U;  3AHU A;  1VQ5 A;  3VYG A;  4C0D B;  2OTL T;  2DZC A;  1NE8 A;  2EAY A;  4IUT A;  3WXM B;  5CKF A;  2XD0 A;  1UGR B;  2HQE A;  4M75 F;  4BE1 A;  5I2M A;  2CZ0 B;  3E9G A;  3M5A A;  3NTK A;  4M7D F;  3OBY A;  5CO7 A;  1KG1 A;  2VYT A;  2AHJ B;  4QQD A;  4M77 A;  3OS0 A;  4OGC A;  1BI3 A;  3M9Q A;  1ZQ1 A;  3JB9 D;  2LT4 A;  1W4S A;  1QVP A;  2OTL A;  3HRT A;  2DXT A;  1H64 1;  2A7Y A;  2JZ2 A;  5CR2 A;  3MCA B;  4GY5 A;  3OMC A;  2CYZ B;  2GCX A;  2L3R A;  4C92 D;  2CZ6 B;  2D6F A;  1AHJ B;  3OYY A;  1N8R C;  4OB1 B;  4L5G A;  4L6V 5;  5CIU A;  2EQK A;  3HFN A;  3O8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...