4EMKB

Crystal structure of splsm5/6/7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'MDSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYVSAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5
molecule tags Rna binding protein
source organism Schizosaccharomyces pombe
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkB00
1JBMA 5GAOr 1N9RA 3BW1A 4M77G 4EMHA 4EMKB 1U1TA 4M7DE 3FB9A 2HNIA 4C92E 4A53A 1TH7A 4M75E 4F7UB 4JRKA 3JCMd 5GAMg 4PJOB 4M75A 3RERA 4J6WA 2K57A 2RB6A 2DTOA 2E41A 1D3BA 3RESA 3V8KA 4C92C 4F7UA 5I21A 5GAOl 4M7AA 3SWNA 1B34B 1HXDA 1HK9A 4JRIA 4XU0A 2E1HA 5LJ3h 3V7SA 3SB2A 4C8QE 4NL2A 5DY9A 4M7AE 3QHSA 1B34A 2YLCA 3VU3C 4C8QC 4M78D 3JCMc 4J6XA 4M77C 4WF2A 3V7CA 4M7DF 2E65A 4M77B 2YLBA 4M78G 1BIBA 2EWNA 2I2LA 4PJOG 5LJ5j 3JCMh 5LJ5h 4XQ3A 4EMKC 3JCMQ 1Y96B 4A54A 4NL3A 2E10A 4M7DA 4NOYA 2RA2A 1I81A 3RKYA 3RKXA 1D3BB 4EMGA 4QVDA 2DXUA 4M75D 4MMLA 1Y96A 1KQ2A 4M78F 4C92B 1LJOA 1I8FA 3L1AA 4Y91A 4F7UE 3JCMb 1MGQA 3JB9H 4XTXA 4QVCA 5GAN3 1LOJA 3HFNA 4M78C 1M5Q1 4X9DA 3BFMA 3SWNC 4OP0A 4C8QB 3JCMe 5LJ3g 4N0AC 3JCMJ 5GANd 4M7DC 3BY7A 2RM4A 4M7AD 3JCMP 5GMKi 3RKWA 2DZ9A 4M77A 4F7UF 4M77E 3FJPA 5GAOm 5CAIA 4C92D 4C92G 2DVEA 3HSBA 3HFOA 4M75G 5GAMj 2YHTA 5GAN2 3JCMg 2Y90A 4XTZA 4EMKA 5LJ5e 5GAMd 3JB9D 5GAMe 5LJ5d 4HA8A 4X9CA 3V8JA 5GAN4 4C8QG 3EFRA 5GMKm 3L2ZA 5LJ3j 4M78B 5GANh 5GMKl 4M77F 5LJ3d 5GAOp 3SWNB 4V2SA 5LJ3e 5GANf 2DTIA 4M78A 3GIBA 2DKGA 2VXFA 3BDUA 3EFSA 2EJ9A 4PJOA 2DTHA 4N0AA 3JB9G 1X01A 4MMKA 1N9SA 2DEQA 4M7DG 4RCBA 1M8VA 1WPYA 4XU2A 3JCMW 2FYKA 5LJ5f 2VC8A 5LJ3f 4C92F 5GANe 3INZA 4XU3A 4PJOD 5GAN8 1BIAA 4J6YA 4F7UG 5GAN6 4M77D 4HT8A 4PNOA 4M7AG 4XTUA 3RUXA 4XU1A 5GMKe 4M7DD 5GAOq 1JRIA 2DXTA 3QO3A 5GMKj 4DQ2A 4HT9A 2JN0A 1LNXA 4J5YA 4M78E 5GANg 4M7DB 4M75F 3JB9J 4M75B 1WQWA 4PJOE 1I4K1 5GAMh 4PJOF 4M75C 2EAYA 3AHUA 4C92A 2FB7A 3JB9I 4M7AC 5GAN7 4PJOC 4XTWA 2EJFA 4JLIA 4RCCA 3RIRA 4M7AB 4M7AF 3V8LA 3JCMf 3V7RA 2ZGWA 2CGHA 3FIFA 3PGGA 4C8QA 1H641 3JCMX 5GANj 2QTXA 1KQ1A 1I5LA 4JUVA 1U1SA 4XTYA 3M4GA 2RD1A 5GAN5 2VXEA 5GMKh 1YCYA 3JB9F 2EJGA 4XTVA 4C8QF 4C8QD 5GAMf 5LJ5g 1WQ7A 2E64A 1WNLA 3QUIA 3QSUA 5GAOn 3JCMV 2DZCA 2DJZA
chains in the Genus database with same CATH superfamily
3PTAA 5GAOr 2X4XA 5KCOA 1OOTA 1ZSZB 2JTMA 4OVAA 4PJOB 1JQQA 5D6XA 5GJWB 1HXDA 4XU0A 1KJWA 2DETA 1OQKA 2C0TA 1NJIU 3EG0A 3VS3A 1BU1A 3SEMA 1ZLMA 4RTVA 3E19A 3DB4A 1OU8A 2X51A 3QKJA 2QXFA 2J7IA 2MOXA 4M75D 4BE2A 1LJOA 2X9HA 3PFSA 3L2VA 2BE7D 2QDLA 4XTXA 3HPWA 1Z9ZA 3L42A 4E7LA 5KYYB 2XG8D 4A4GA 5GANd 3OYFA 2JJ9A 2L2PA 1UJ0A 2PUKB 1XJWB 1QVGA 4IURA 3A5ZB 5HK0A 3ZL7C 4LXCA 2HL5C 4HA8A 4HCBA 5CKDA 4C8QG 3HHTB 2VGMA 2WSEE 1MNEA 1VQKA 4IUPA 2QGFB 3EHQA 4J9CA 3A8LB 4M78A 1KD1C 2DKGA 3GIBA 2R57A 1VIEA 3HTRA 1M8VA 3CPFA 2X3XD 2JTEA 4R55A 4DBFA 3LW5E 5D7UA 9ATCB 2DL5A 2CUDA 1PD0A 4LNPA 2WACA 5A0DA 2NWMA 1EFNA 4J5YA 4FYYB 2RHIA 2RI5A 3AHUA 2RNAA 3MEAA 4Y28E 2HKNA 1F1BB 1RAIB 2A36A 1RL2A 3V7RA 1VQPT 2FO0A 5A0GA 1YWOA 2CZ0B 1M90C 1U06A 2RJFA 1FXXA 1K76A 1WHMA 5EG2A 4OGEA 1YBYA 1KSWA 3UPUA 1ZX6A 4IIMA 2DBKA 2CSQA 1C0MA 2YT6A 4DBHA 2EGAA 3SWNA 4C0GA 4OB0B 1KQSS 5KYYA 5J3BA 3S3OA 1W2BA 2F5KA 2P0QA 1YJNT 2HAXA 2QQAA 3X28B 2EQJA 2EWNA 3OSSC 4ZNXA 2E10A 1SEMA 1M1KU 2MMPA 4JRPA 4A4HA 2NUTA 1MV3A 4M78F 3L1AA 1WHLA 4A63B 2HQEA 4OB2B 2QA4T 4OP0A 2SEMA 5LJ3g 1VYTA 3CCUQ 3DB3A 1FMKA 1WHKA 4MDXA 1WLPB 3FJPA 4RG2A 2YHTA 4EMKA 2YUNA 1VQOQ 1UG1A 3V8JA 1NEBA 5GANh 3CCRT 1NYFA 4M77F 4V2SA 4Y92A 1VQ7A 3LWHA 1SSFA 3EFSA 1P92A 1NE8A 3O5ZA 5IH2A 2K79A 2DEQA 4M7DG 4F04B 5CVIA 3CC2A 5CKFA 2A0FB 2CP2A 5LJ5f 4GY5A 2QASA 4NS5A 1IZ6A 2PNIA 2ABLA 5HCKA 2E70A 4FCYA 3CC4A 1ZUUA 2O4XB 1QCFA 3REAB 2DXCA 3TSWA 5GAMh 1VQ4A 2LCSA 4M7AC 3H6ZA 1V29B 4M7AB 1EZZB 5HKCA 2ZGWA 2IPOB 2QTXA 3LWIA 2QEXQ 1AWOA 3QZ9B 3VS1A 1MUZA 1I5OB 2MIOA 1MMAA 3JV3A 3PT9A 1YITA 3ZFJA 1NBEB 3JCMd 1CKBA 1Q86U 2DIGA 2X3WD 5CO7A 3V7SA 2E1HA 4M7AE 2K9GA 1YIJA 2JT4A 5IN1A 1ZSGA 4BUGA 4M78G 2L5QA 2LQ8A 4C5GA 2QA4A 3CCET 3G6EQ 2B86A 2KBTA 4EMGA 1VQNT 2DXUA 4FT4A 3J81E 1GFCA 1T3LA 2L89A 2JXBA 1RUWA 7AT1B 4M77A 2L3PA 4ZN3A 2EW3A 1QP2A 2YSQA 3HSBA 3M53A 4HVWA 2RF0A 1BB9A 3EFOB 4IKFA 3LX7A 3SWNB 1K0SA 1AVZC 1Q81U 2AZVA 1X01A 3CMAT 2E5KA 3I56T 1YHQQ 2LT1A 5GANe 2LNHB 2XU8A 1I1JA 4JJDA 1KQSP 1K9MC 1RAFB 2BIVA 2JN0A 1G3TA 1X27A 4PJOF 3QWXX 3RR6A 2MF2A 2K4YA 4J9EA 2K2MA 3V8LA 1WZOA 1QW1A 4JS4A 4E7IA 2CSIA 1KQ1A 3P8BB 3L2UA 5KE3A 1HD3A 2L0AA 1YCYA 2JZ2A 4C0DB 3I55A 3CMAQ 3OYLA 1JBMA 3P8HA 3M0SA 1M4ZA 1SPKA 4F7UB 2A28A 1ZSZC 1KHCA 2EYWA 1I0CA 2COYA 2E41A 1VA7A 2VASA 1HK9A 2ZPIB 3NMZC 1AWJA 2F2XA 4KT0E 4OB3B 4C5IA 1VQPQ 2K5LA 1KIKA 3CCMQ 1Q81R 3F70A 1ZUYA 3DLLA 3A98A 2KY9A 4Y91A 1UUEA 2NUPB 1D1AA 1YCSB 3CCUT 1VIFA 1DJ7B 2FPDA 2JMAA 1H3HA 5CAIA 4C92D 1K73C 3HFOA 3WVEB 2KE9A 2KT8A 3JCMg 3CPWP 2CH4A 2RJCA 1Q82U 3CC7T 4J7IA 1QWEA 4PJMA 3S3NA 2O88A 4PJOA 4FYXB 2YUPA 2R5MA 1UGQB 4XU2A 1IB8A 2PVOB 5LJ3f 2RK1A 3WVDB 2KQWA 5GAN8 2C06A 2K2VA 4O5VA 3O8VA 1UGRB 1QCOA 3HRUA 3GNGA 3HRSA 4DA4A 1KG1A 3KUFA 4M78E 4QT7A 3MP6A 2CKKA 1IXDA 3EH2A 2KYMA 2OAUA 3IQLA 1JB0E 2YRDA 1IRXA 4E7JA 3EGXB 2BZ8A 1ACMB 2BUDA 4JUVA 3CCSQ 2DLPA 4JJCA 1VQLA 2OTJQ 4C0FA 1WQ7A 1WNLA 1K1ZA 1RAEB 1D3BA 2WSFE 1KD1R 2VVKA 4PL6A 1VQ4Q 3OYDA 4M77G 5CQXA 2L3SA 2FRYA 2DYIA 2BTTA 1B34B 1UDLA 4ZTFA 2V1QA 2EYZA 4OB1B 1R0BG 1YHQA 1BIBA 2RN8A 4JPBW 5DM7R 2HZYA 4FW1A 4LDUA 4A54A 4KGXB 2V8JA 2K3XA 2ZCFB 5I2MA 2RJEA 2XICA 1TTHB 4RKUE 3L2QA 4IUVA 2H8HA 1MV0B 2DERA 4PFOA 4BDZA 1ZUKA 4OMOA 2RHXA 5I11A 4J9DA 1XTDA 1JO8A 4ZGJB 3CCUA 1UE9A 2FZKB 1AWXA 2LJ3A 1C6VX 4C0ZA 1S72A 3MPUB 5DLQE 1ABQA 5GMKl 3I56A 2H3JA 1BCOA 4ME7A 1N8RR 3KBGA 1VQLQ 5FRMA 4ANJA 2BZXA 3BDLA 4PJJA 2RJDA 5GJVB 1K8AR 1Y07A 2AK5A 3LGLA 2CP6A 1YNZA 2DL7A 4R56A 4HT8A 3G1JA 1YJWT 1VQ9T 5FU7B 3FJ5A 1LVKA 2GQIA 1PHTA 3H0FA 3GLXA 3CXCP 4M75F 1QMCA 3MP1A 2D8JA 4C92A 2DEUA 4RCCA 2QQBA 1H3ZA 2MYSA 2Y4YA 1GBQA 2ATCB 2VXEA 5GAN5 3G4ST 4LUDA 3NFCA 2KI7A 4C8QD 3I5RA 3QUIA 2VV5A 2DZCA 1UJYA 4LUEA 2PVDB 3DLMA 3M0PA 2OI3A 2RHUA 3QDRB 1AT1B 2HNIA 2GQVA 2NUTB 3OYEA 4JRKA 4M75A 3RERA 1BYMA 2VB6A 3RNJA 2ZPFB 4C8QC 4J6XA 1SG5A 1QVFA 1BI3A 4PJOG 2ED1A 4FYWB 4QVDA 1OZ3A 2LQWA 2YRVA 1OULA 1VQPA 3JCMb 4BACA 2VGNA 4DEXA 5CCAA 3G7ZA 4BI3A 1PWTA 2KRSA 3T9NA 2Z0WA 4DOWA 2KRNA 3OW2P 1O9SA 2G6FX 2CS7A 3VRYA 4WTOB 4RTXA 2HQXA 2DVEA 3CC4Q 3OYMA 3I55Q 2K3YA 2JNGA 2F2VA 1T0HA 2W10A 4M78B 3ER0A 1ABOA 5KH6A 1OPLA 2ZZDA 3H0IA 4J83A 4PKCC 3A8HB 1GCQC 2OTLT 5L8RE 1WPYA 1IHVA 2HBPA 1D0XA 1ZBXA 1WJQA 2DNUA 1T0JA 1XOVA 3H0HA 2JS0A 1OX9A 3S3MA 4KUDK 1KC8C 2AIRB 4HCZA 2EYXA 1YJ9Q 3JB9I 4QVZA 4J9GA 3RMSA 3C4SA 3OYHA 2CGHA 3VS2A 3R6OA 4LN2A 3VKIA 3M4GA 6AT1B 2XDBA 3LH0A 4C0DC 2VWFA 1VQ4T 5GAOn 1R0CB 2M0OA 4RTTA 1VQ5A 1WHGA 1SRMA 3Q1JA 4EMKB 1YIJT 1W1FA 1K73R 1Y57A 2DYBA 2DTOA 5GAOl 2X4JA 4HCKA 3SB2A 4MZMA 1B34A 2HMAA 3EG9A 2X4YA 5ECAA 1VQ8A 4E7KA 3OS2A 2HCKA 2DO3A 1B7TA 4NL3A 5FRNA 3PVQA 4MDWA 4CC7A 3CCMA 2JTFA 1KQ2A 3C95A 4MMLA 5FROA 4Z89A 4AFZC 3UWNA 4F16A 4C92B 1B07A 1I8FA 5D6YA 1VQMA 2W0ZA 2RQUA 2DD5A 2KRMA 2CDTA 1JEGA 2DL3A 3EGXA 3NPFA 2P0KA 5HK3A 1WJRA 4J7FA 2DVJA 4P5NA 1KC8U 2IG0A 3FLGA 1YN8A 3KFVA 4E7HA 1G3SA 5CQYA 1VQOT 3OS5A 5GAN4 2EGEA 3CC2T 3JSCA 1QP3A 3VYHB 3G71A 2DTIA 2QQSA 2MI6A 2DRKA 3JB9G 1WIEA 4MMKA 3MEWA 3A8OB 4PJLA 4B9WA 3OBWA 1NLPC 2XK0A 4J6YA 3QWYA 4PNOA 4X34A 2H3EB 2QTVA 3OYAA 5KYUA 3FEOA 2HQHA 4M7DB 4JDSA 1XQHA 2AT1B 2D9TA 3OW2S 1M3AA 1VYVA 4R0KA 1U5SA 4FT2A 3J7AF 2M1HA 2KYBA 1Q7YU 2XD0A 3CC2Q 4MZTA 2QEXT 2FRWA 2V26A 4FIBA 3VUBA 4A4FA 3X25B 3FRNA 3OQ5A 3JB9F 2V8KA 2E64A 1YJWQ 2DJZA 3G71T 3QDFA 2DD4A 1U1TA 1B3QA 4RTWA 1TXQA 1TS9A 2K57A 3RESA 2CZ1B 4Q5WA 3CMEA 2LRQA 3HP9A 3MEVA 2VYTA 4WF2A 2E3IA 2I2LA 2CP5A 2HSPA 3G6ET 4DEYA 4X1VA 3RKXA 4FL6A 2IIMA 2LJ0A 1ARKA 4EPCA 3PMIA 5IXBA 4KBMB 3HL8A 5A2QE 2C0IA 3ME9A 3OS1A 4CC3A 1YJ9A 1PRMC 2HDAA 3VV0A 3RKWA 2DZ9A 2PQWA 4N4HA 4FSSA 2CREA 1G8XA 2Y90A 4XTZA 2DJQA 1RADB 1Q82R 2MWOA 1WX6A 2GFUA 1G3YA 2CZ7B 3CMAA 3E1SA 2OTLA 3VJPA 2OTLQ 3M56A 3I56Q 1M1GA 1YHQT 2CH4W 4J9IA 1YI2A 2M9UA 4C92F 3INZA 1ZA2B 3RUXA 5GAOq 2J6OA 3PNWC 1JJ2S 2RQTA 1Y71A 3EFOA 1RAGB 3TQ7P 5EC7A 2COWA 1I4K1 4GLMA 3M57A 2XKOC 1PG5B 4EDUA 2EJFA 3OYNA 2K5FA 4B9XA 2RO0A 4BD3A 4BY6B 3QPHA 1W6XA 1U1SA 4BY6C 2LZ6B 1GBRA 1M1KC 1A0NB 2EBPA 1UHFA 1QVFP 3EH1A 3OYCA 5LJ5g 2LCLA 4II1A 5KYUB 3QSUA 1K8AC 3GNFB 1N8RC 2MPXC 4MZPA 4OMFB 5I22A 4C92E 1ZA1B 4WCIA 2F1LA 4JRQA 4ORZA 1WHHA 2COZA 4Z02A 1R77A 2RB6A 2QG9B 3ZEHA 4F7UA 4M7AA 2NUPA 3CQTA 1Q7YR 4NL2A 2P84A 3QHSA 1WXTA 4JLGA 3M54A 2WSCE 1FWZA 1Q95G 2JS2A 4M78D 5FU6C 4LD9K 2E65A 1K8AU 4AG2C 1WDXA 3META 1M90U 1I81A 1M9SA 1D0ZA 1YI2Q 1RLPC 2L3QA 4DBRA 1BI1A 1YIJQ 1SHFA 2EGCA 3MEUA 5IHIA 3CCQQ 3C0CA 1G2BA 4JS5A 2LJ1A 4QQGA 4M77E 4ZTJA 3VYGA 2RI3A 1PM3A 3CC7Q 1QQJA 4TVRA 1TUCA 3OB9A 2EFIA 2EYYA 1BK2A 4GLKA 1M30A 1LCKA 5CR2A 1NJIR 1VQ8Q 1VQKT 2F2WA 5C6SA 2I0NA 1BIAA 1TG0A 1Q82C 4M77D 3OY9A 4XTUA 5GMKe 1QKXA 4A4KA 4DOVA 4LDVA 1OZ2A 5GANg 4M75B 1WQWA 4M75C 4AFQC 2XDPA 1W2BP 1IO6A 3OYIA 3CCST 1I5LA 1NM7A 1WJSA 3MO8A 3QXEB 3R6NA 5GAMf 4AMCA 1G83A 3OSVA 1E6HA 2OAWA 2DAQA 1VQ8T 1MNDA 1TH7A 2FPEA 5GAMg 2HBWA 3CBOA 1VQ5Q 3X20B 3C12A 1T3SA 1GRIA 1AWWA 1OU9A 4RTUA 3VU3C 1VQNQ 8AT1B 3TU4K 2ZPEB 1FX7A 4XQ3A 4ZGEB 4JZ4A 4M7DA 1HSQA 1YWPA 2FZCB 5FWBA 2KVQG 1MGQA 5KYXA 3CCLA 3SWNC 1JU5C 3KXTA 1SKUB 2DILA 3CXCS 2L8DA 2KT1A 2XHCA 2K5IA 2PVGB 1O75A 4HKEA 1YJWA 5LJ5e 2M02A 3MCAB 4YTLA 5J39A 2P4TA 2EQIA 2PUOB 2RHZA 2GBQA 5GAOp 5LJ3e 1CKAA 1OEBA 2KR3A 4JZ3A 3BDUA 1VQ6T 4FSXA 2RI2A 3EG2A 5KYWB 4RCBA 3G71Q 2GTOA 4PJOD 4OF1A 2EKHA 4B6MA 4DQ2A 2R5AA 1X6OA 1YITT 4BE1A 1MMGA 2EAYA 3UA6A 3TCJA 2DM1A 2FB7A 4PJOC 3GF5A 4M7AF 3EG9B 1M2OA 1VQ7Q 3PGGA 2A08A 2V1RA 2O2OA 3ASKA 2DIQA 3CBPA 3CD6T 1WYXA 1FMWA 1VQ6Q 4XTVA 1AZGB 1UEBA 2KDSA 4C8QF 5C0MA 3OW2A 2HD0A 2ESWA 2J05A 3HKSA 4QKUA 1X2QA 2QK0A 5D6WA 5LJ3h 1M27C 4M77C 1OYXA 1HYOA 4M77B 3TEEA 2IVWA 2GTJA 2X35A 3QIIA 3JCMQ 4EIKA 1PC0A 4D6WA 3G4SA 1TUGB 3M4YA 2AHJB 1PSFA 1Y96A 1Y7XA 4QQ6A 4ZN1A 2L3RA 1LOJA 1SHGA 4JJBA 3VS5A 4AFUC 4CC4B 4X9DA 1X2KA 1N5ZA 2QDYB 2RM4A 2NYSA 4J9HA 4BI8B 1KQSA 1H8KA 2E6ZA 3SD4A 3CC4T 1PRLC 3CEYA 3P8DA 2VKNA 5GAN2 1Q86R 3VS0A 5GAMe 3H41A 1E7OA 5LJ3j 1BI2A 2K3BA 5GANf 3G6EA 1QVGP 2RQWA 1VQ6A 1GCPA 2O9VA 5HY6A 2B8AA 2M16A 2O9SA 3EGDB 2BZYA 5AYFA 5IHNA 3CCRQ 2K7AA 2LQKA 2LC4A 2VC8A 3UDCA 5GAN6 4VUBA 4PLIA 3ULRB 1NLOC 3OMGA 2QAZA 4ZGDB 3CBMA 5GMKj 3NGPA 1K9MR 2KMTA 5L23A 4M4ZA 1M2VA 3EG1A 3MHXA 4OMNA 3JB9J 5CIUA 2YXYA 3E2UA 1YJ9T 1VQ9Q 3TVTA 3RIRA 5KYXB 2OTJT 1GFDA 4E2FB 3U23A 5GANj 2YRCA 1U3OA 4CC2A 2JUFA 2EJGA 1R8OB 1QKWA 1MHNA 2D8HA 4EMHA 2BE9B 4A53A 4UC4A 3X26B 4HXJA 2XI9A 3BE3A 4C8QE 1AZEA 4CI0C 1X6GA 3JCMc 2FEIA 2YLBA 1GXIE 2HSEB 3CCJA 4NOYA 2K6DA 2MWPA 1D3BB 4F7UE 1VQKQ 3M0UA 3JB9H 4QVCA 1UECA 4F17A 1U8RA 4L59A 1VQOA 1M5Q1 1KK7A 4C8QB 5KYNA 3JCMJ 3BY7A 1GCQA 3I5SA 1KC8R 2JM9A 3M0QA 3CCVA 3SFMA 1UGVA 2CZ6B 1K9AA 1NPRA 2DFUA 1VQ9A 1WGSA 1K0XA 5GAMd 3UATA 3JB9D 4RTZA 4E7ZA 1UHCA 2KROA 3QZ5B 1VQMQ 1M1FA 2KK4A 2ZAEA 1WA7A 2KAFA 1I07A 4RTYA 1ZHIA 3CXCA 1KD1U 1N9SA 3UA7A 3E9GA 2C0OA 2R58A 1PCXA 1K4US 2F69A 5IHKA 4LDWA 1GL5A 2F5TX 3PIOA 3CMEQ 1VYUA 1YP5A 2A3LA 1JRIA 1M2VB 1K73U 1RAHB 4Z88A 3PVLA 3LGFA 4HT9A 1G3WA 3GOXA 3PE0A 2O4XA 1NG2A 2FZGB 2E3HA 2EYQA 4ELYC 3EGDA 2XIDA 1KHIA 1D1CA 1OPKA 3CD6Q 4KUIA 1UB4A 4IUTA 4L5GA 5FWCA 4PFPA 3RBBB 3SHWA 3BW1A 4RMOA 2LX9A 1VOMA 3M9QA 3CMET 2QA4Q 4J6WA 1G5VA 3V8KA 2CYZB 5I21A 4C5HA 2CP3A 2RPNA 1M3BA 1FYNA 4ATOA 1PD1A 1XNIA 3S6WA 2RH2A 1QVGS 2OJ2A 2A7YA 2CP0A 2DL8A 2MK5A 2LDMA 3JCMh 2EQMA 1W70A 1Y96B 1V76A 4BE0A 4FW2A 2NLUA 3JCMW 4KULA 2LT4A 1V1CA 1N6AA 3OBYA 4IUQA 1RABB 1Q7YC 1WI7A 2PU9B 4M78C 1M3CA 3CCJT 1JJ2P 3QJYA 8ATCB 4PFZA 1Y0MA 1AEYA 3JCMP 1YJNA 2O31A 2P0PA 3TREA 4F7UF 2NUZA 4OGCA 4C92G 3OYKA 4PK4A 2V8IA 4D8DA 5LJ5d 1QLYA 2DF6A 3REBB 2A37A 4AG1C 5A0LA 1QVFS 2YUOA 2LP5A 3OYGA 2EJ9A 4J8OA 3DKMA 2FVUA 3M0RA 5FW9A 3LYIA 2ZPGB 2QQ9A 1E6GA 5CKBA 3CPWA 3TSZA 2J6KA 2E4HA 1JXMA 3N5BB 2ED0A 2HL3A 1WFWA 2OX7A 3QO3A 3QYHB 4XAXB 1LNXA 2XDDA 3MP8A 3M55A 5GAN7 2KEAA 4HVUA 3JCMf 3X24B 3JRZA 2G3RA 1AOJA 1LPLA 2HKQB 3CCQA 3CCEA 2LNVA 2FPFA 2QQRA 1VQ7T 1TSFA 2RQRA 2PZ1A 2DK3A 3CCEQ 4RUGA 3UF4A 3MKDA 4M7DC 4KGZB 1UFFA 1N9RA 5IAYA 1SSHA 2P4RA 3LH5A 4M7DE 2LX7A 1WXBA 4C92C 3ZBDA 4JRIA 3QBYA 2ECZA 5IXFA 4BB7A 4O6JA 3THKA 1N8RU 1IHWA 5KCHA 1S1NA 2SRCA 4LDYA 2ROLA 2HEQA 3HRTA 2QEXA 1SRLA 3HFNA 2J6FA 1OI1A 1H92A 3JCMe 1YFNA 2CP7A 1WXUA 4BI4A 2Y4XA 5CKHA 1W2BS 1QCNA 2FHDA 4M75G 1VUBA 1K9MU 4OMPA 1AHJB 1D0YA 1X6BA 4X9CA 2BKDN 2QYZA 2ZPBB 1J3TA 1VQMT 1M90R 3CCVQ 1NPPA 1BCMA 2GCXA 1PKSA 1YI2T 2DBMA 4F14A 1X69A 3OYYA 3I9QA 2EQKA 3E9FA 2DTHA 5FLXE 1Q81C 1UTIA 3GBQA 3VS7A 4OMMA 1S72T 3OA6A 1IGQA 2YUQA 3CC7A 4J9FA 1ZQ1A 4XK8E 2D0NA 2JMCA 3EHRA 4K11A 3OS0A 2LTOA 4OMQA 1TWBA 3FC3A 2LQNA 4BDYA 2D0QB 1NYGA 2KXCA 4E7SA 3CCLQ 3WXMB 3L2RA 2FL7A 4AFSC 1FMVA 3CCMT 1Z9QA 5FU7C 2RD1A 3M59A 1PSEA 2ENMA 2DMOA 3NHNA 4FU6A 2RQVA 3M0TA 2EQUA 1SF9A 4JJNK 3FB9A 4E6RA 2EVRA 2KNBB 2KGTA 3OMCA 4A4EA 1RAAB 4HCCA 2DL4A 2AKLA 4KH1B 5J26A 1IREB 1Q86C 3PIPA 2M0YA 3URGA 1RACB 3LLRA 2YLCA 3V7CA 5KYWA 4M7DF 2EIFA 2D6FA 2JVVA 2RK2A 4N4GA 3CCLT 2RA2A 4L6V5 5LJ5j 4M7DD 1NEGA 2YDLA 1RI0A 3OYBA 2MAMA 3CCJQ 3SDZA 1JXOA 2E12A 5LL6S 2CT3A 1MMDA 1RLQC 4N0AC 2GGRA 2KXDA 1QWFA 4IIOA 4QQDA 4M7AD 4KGVB 5GMKi 3NTKA 3EGUA 1BKBA 5I2SA 3UT1A 5GAMj 4J9BA 4LE9A 3EFRA 2JM8A 5GMKm 2CT4A 2GFAA 5DLOA 2AKKA 2YWWA 3I55T 2XMFA 3C94A 4N0AA 1BI0A 1OX8A 3VS6A 1N27A 3CCRA 2RMOA 2GNCA 4XU3A 2CUBA 1UGPB 2JW4A 4Z8AA 4ESRA 2LMJA 4XU1A 3A8GB 2PTKA 2E5QA 1M8MA 1TOVA 3NTHA 1HJDA 3NTIA 2KSSA 3I35A 1ZSZA 4CRIA 1OV3A 3G4SQ 1EIFA 4E47A 1AD5A 2E6NA 3CPWS 3FIFA 1D1BA 4C8QA 1H641 3JCMX 3VRZA 1YJNQ 3GP8A 3QYGB 2LVMA 4LDXA 5GMKh 5FU6B 3EAEA 4PLLA 2FG0A 2AZSA 1UGSB 4GBQA 4HVVA 2EPDA 4IUUA 4ELZC 4DBQA 1NJIC 4KRTA 3RDVA 4M75E 4N4IA 3FDRA 2J06A 4QW2A 2ROTA 5GAN3 4AT1B 1PKTA 5KE2A 1C1AA 3GPLA 2DX1A 3EG3A 1RI9A 1BBZA 2DXBA 5DY9A 3RMQA 5IT9E 2M51A 3A8MB 1X75C 1NZ9A 1PNJA 3L2WA 1IGUA 2RHYA 3M58A 1VQ5T 1KFZA 4RG8A 5LJ5h 4EMKC 4PJNA 3D7SB 2QI2A 3PMTA 3CCQT 3RKYA 3CCSA 4D8KA 2DPPB 1VQNA 3M5AA 4LD6A 3JAME 2OTJA 1D09B 5CKEA 3BFMA 2ZPHB 1JJ2A 5M9OA 2EKOA 3A1PA 5GAOm 4FM4B 5AT1B 2JOYA 2QGGA 3L2ZA 5LJ3d 2GF7A 3H9NA 1QVPA 2VXFA 2O01E 3VUZA 1VQLT 1CSKA 3CD6A 1ZBJA 2DA9A 2FYKA 1W4SA 1X43A 2D1XA 4F7UG 4C5EA 4M7AG 1TU0B 2DRMA 2DXTA 5CK9A 1EX4A 2MCNA 3VS4A 3OYJA 2VUBA 3CCVT 4PJOE 1MMNA 3QG1A 4XTWA 3MJXA 4JLIA 1TUDA 3AT1B 3J80E 1YITQ 1M1KR 3QJ6A 3H8ZA 4XTYA 4KH0B 1S72Q 4OMLA 2LCCA 4FYVB 2X4WA 1WHJA 3JCMV 2DE0X
chains in the Genus database with same CATH topology
4MZPA 4OMFB 4PL6A 3PTAA 5GAOr 3OYDA 3BW1A 4M77G 2X4XA 5CQXA 4RMOA 5KCOA 2LX9A 4C92E 2JTMA 4OVAA 4JRQA 4PJOB 3M9QA 4Z02A 3CMET 4J6WA 2RB6A 3ZEHA 5D6XA 3V8KA 2CYZB 4F7UA 5I21A 4C5HA 4M7AA 1G5VA 1B34B 1HXDA 4XU0A 4ZTFA 4NL2A 3QHSA 4ATOA 4JLGA 4OB1B 3M54A 2WSCE 1FWZA 4M78D 5FU6C 1XNIA 3S6WA 2RH2A 4LD9K 2E65A 1QVGS 1NJIU 2A7YA 1YHQA 1K8AU 1BIBA 1K9MU 2LDMA 1N8RC 3JCMh 5DM7R 3E19A 2EQMA 1Y96B 4LDUA 4A54A 3DB4A 4BE0A 3META 1M90U 1VQ6T 2NLUA 1I81A 1M9SA 2V8JA 2K3XA 3QKJA 2QXFA 4KULA 4M75D 3JCMW 2LT4A 4BE2A 1LJOA 2ZCFB 1N6AA 1BI1A 3OBYA 4IUQA 5I2MA 1Q7YC 3PFSA 3L2VA 2RJEA 4XTXA 2XICA 2PU9B 4RKUE 4M78C 3HPWA 3MEUA 3CCJT 3L42A 4IUVA 3L2QA 4E7LA 3QJYA 4BDZA 2XG8D 4A4GA 5GANd 3OYFA 2RHXA 3JCMP 1YJNA 2PUKB 4JS5A 2P0PA 4QQGA 3TREA 4F7UF 1XTDA 4M77E 4ZTJA 1QVGA 4IURA 2RI3A 3VYGA 4OGCA 4C92G 3A5ZB 4ZGJB 3CCUA 5HK0A 3OYKA 2V8IA 4TVRA 5LJ5d 4HA8A 4C0ZA 5CKDA 4HCBA 4C8QG 3HHTB 1S72A 2VGMA 2WSEE 1VQKA 5A0LA 3OB9A 5DLQE 4IUPA 5GMKl 2EFIA 2H3JA 3I56A 1QVFS 4ME7A 3A8LB 4GLKA 3KBGA 2DKGA 4M78A 3OYGA 1KD1C 5FRMA 2R57A 3GIBA 2EJ9A 4J8OA 1VIEA 3DKMA 2FVUA 3BDLA 2RJDA 3LYIA 5CR2A 1M8VA 1Y07A 2ZPGB 3CPFA 2QQ9A 4R55A 3LGLA 5CKBA 3CPWA 1VQKT 3LW5E 4R56A 5C6SA 1BIAA 1Q82C 3N5BB 4M77D 1YJWT 3OY9A 1K8AC 4HT8A 4XTUA 5GMKe 5FU7B 1VQ9T 4A4KA 3QO3A 4DOVA 4LDVA 2WACA 1OZ2A 3QYHB 5A0DA 4XAXB 1LNXA 4J5YA 3GLXA 5GANg 2RHIA 4M75F 4M75B 1WQWA 2XDDA 2RI5A 4M75C 3MP1A 3MP8A 2XDPA 3M55A 4C92A 3AHUA 3MEAA 5GAN7 4Y28E 4RCCA 2QQBA 1H3ZA 1RL2A 3JCMf 3OYIA 3X24B 3JRZA 3V7RA 2G3RA 1VQPT 5A0GA 3CCST 1I5LA 2CZ0B 1WJSA 3CCQA 1M90C 2Y4YA 2VXEA 5GAN5 2RJFA 1FXXA 2LNVA 3MO8A 2QQRA 3QXEB 3G4ST 3NFCA 1VQ7T 5GAMf 5EG2A 2DK3A 4C8QD 4OGEA 1YBYA 3QUIA 2VV5A 2DZCA 4M7DC 3OSVA 2PVDB 3UPUA 1N9RA 3DLMA 5IAYA 2DAQA 1VQ8T 1KQ2A 2RHUA 3QDRB 4M7DE 2HNIA 1TH7A 2GQVA 3OYEA 4JRKA 5GAMg 3CBOA 4M75A 3RERA 1BYMA 3X20B 4C92C 3C12A 3ZBDA 3SWNA 4JRIA 3QBYA 4C0GA 4OB0B 1KQSS 5J3BA 3S3OA 2ZPFB 3VU3C 4C8QC 1W2BA 2F5KA 2P0QA 4J6XA 1YJNT 2HAXA 4BB7A 1QVFA 2QQAA 3TU4K 4O6JA 1N8RU 2ZPEB 3X28B 1BI3A 2EQJA 2EWNA 5KCHA 4PJOG 3OSSC 1FX7A 4LDYA 4XQ3A 4ZGEB 2E10A 4M7DA 1M1KU 2MMPA 4JRPA 4QVDA 1OZ3A 3HRTA 4A4HA 2YRVA 2QEXA 1VQPA 4M78F 3JCMb 3L1AA 4BACA 2VGNA 2KVQG 1MGQA 3CCLA 5CCAA 3HFNA 2HQEA 3G7ZA 4BI3A 4OB2B 2QA4T 1OI1A 3SWNC 4OP0A 3JCMe 5LJ3g 3T9NA 3KXTA 4DOWA 3CXCS 2L8DA 3DB3A 1O9SA 4BI4A 2CS7A 2Y4XA 4MDXA 2HQXA 2XHCA 5CKHA 1W2BS 4RG2A 3FJPA 2DVEA 2K5IA 2FHDA 4M75G 2PVGB 1O75A 1VUBA 2YHTA 4HKEA 3OYMA 1YJWA 2K3YA 1AHJB 2JNGA 4EMKA 5LJ5e 3MCAB 4X9CA 2BKDN 3V8JA 2ZPBB 4YTLA 5J39A 1VQMT 2P4TA 1NPPA 4M78B 5GANh 2GCXA 3CCRT 2PUOB 2RHZA 3ER0A 1YI2T 4M77F 5GAOp 4V2SA 5LJ3e 5KH6A 1VQ7A 2ZZDA 3LWHA 3OYYA 1SSFA 3BDUA 3EFSA 2EQKA 3E9FA 4FSXA 2RI2A 1P92A 2DTHA 1NE8A 4J83A 5FLXE 1Q81C 4PKCC 3A8HB 2OTLT 2DEQA 4M7DG 5CVIA 4RCBA 5L8RE 1WPYA 3CC2A 5CKFA 5LJ5f 1S72T 2HBPA 4GY5A 3OA6A 4PJOD 4NS5A 1IZ6A 4OF1A 1ZBXA 1WJQA 3CC7A 1ZQ1A 2E70A 4XK8E 1XOVA 3OS0A 3CC4A 2LTOA 4DQ2A 2R5AA 1X6OA 2O4XB 3S3MA 4KUDK 1YITT 1KC8C 4BE1A 2DXCA 5GAMh 3FC3A 1VQ4A 4HCZA 2EAYA 3TCJA 4BDYA 2FB7A 3JB9I 4M7AC 2D0QB 4QVZA 4PJOC 3H6ZA 3GF5A 3RMSA 1V29B 4M7AB 4M7AF 3C4SA 3OYHA 5HKCA 2ZGWA 2CGHA 3PGGA 3R6OA 3WXMB 3L2RA 2QTXA 3LWIA 2FL7A 3CCMT 3ASKA 3VKIA 3M4GA 2DIQA 5FU7C 3CBPA 2RD1A 3M59A 2XDBA 3CD6T 1PSEA 4XTVA 1UEBA 4C8QF 2KDSA 3OW2A 3LH0A 3QZ9B 5C0MA 4C0DC 2HD0A 1VQ4T 5GAOn 4FU6A 2M0OA 1VQ5A 2EQUA 3Q1JA 3PT9A 4EMKB 1YITA 1YIJT 3ZFJA 4JJNK 3FB9A 3HKSA 3JCMd 3OMCA 4A4EA 1Q86U 4HCCA 2DTOA 2DIGA 5GAOl 5CO7A 2X4JA 5D6WA 3V7SA 5J26A 5LJ3h 1IREB 2E1HA 3PIPA 3SB2A 1Q86C 4M7AE 3URGA 4MZMA 3LLRA 1B34A 2YLCA 1YIJA 2X4YA 5IN1A 4M77C 3V7CA 1OYXA 1VQ8A 4M7DF 4BUGA 4E7KA 4M77B 3TEEA 2IVWA 4M78G 3OS2A 2L5QA 2LQ8A 2DO3A 2EIFA 2D6FA 4C5GA 2QA4A 2X35A 3QIIA 3JCMQ 4NL3A 2JVVA 2RK2A 5FRNA 4MDWA 4N4GA 4D6WA 3G4SA 3CCLT 3CCET 2RA2A 3M4YA 4L6V5 2AHJB 4EMGA 2JTFA 5LJ5j 2DXUA 3C95A 1PSFA 1Y96A 1Y7XA 4FT4A 4MMLA 5FROA 3UWNA 4C92B 1RI0A 1I8FA 4QQ6A 5D6YA 4ZN1A 3J81E 2MAMA 3OYBA 2L3RA 1VQMA 5LL6S 2E12A 1LOJA 2DD5A 3SDZA 2L89A 4X9DA 2P0KA 4N0AC 4QQDA 5HK3A 1WJRA 2QDYB 2RM4A 4J7FA 4P5NA 1KC8U 2IG0A 4M7AD 5GMKi 3NTKA 3FLGA 4BI8B 1BKBA 4M77A 1KQSA 4ZN3A 1QP2A 2E6ZA 3SD4A 5I2SA 3CC4T 4E7HA 3UT1A 3HSBA 3CEYA 1G3SA 5GAMj 5CQYA 3P8DA 5GAN2 3M53A 1VQOT 5GAMe 3OS5A 4IKFA 5GAN4 3EFRA 5GMKm 3CC2T 5LJ3j 1BI2A 3JSCA 1QP3A 3LX7A 3VYHB 2GFAA 3SWNB 5GANf 5DLOA 3G71A 2DTIA 2QQSA 3G6EA 1Q81U 1VQ6A 2MI6A 3I55T 3CCEA 3C94A 5HY6A 2B8AA 4N0AA 2M16A 3JB9G 1BI0A 1X01A 4MMKA 3CMAT 3MEWA 3A8OB 5AYFA 1N27A 3CCRA 3I56T 2LT1A 2LQKA 2LC4A 2VC8A 3UDCA 3OBWA 4B9WA 5GANe 4XU3A 2XU8A 2XK0A 1UGPB 4J6YA 5GAN6 4PNOA 4VUBA 3GNFB 4PLIA 4M7DD 4XU1A 1K9MC 3OMGA 3A8GB 4X34A 4ZGDB 3CBMA 2E5QA 5GMKj 3OYAA 2KMTA 2BIVA 3FEOA 2JN0A 3NTHA 1G3TA 4M7DB 4JDSA 3MHXA 1XQHA 2D9TA 3NTIA 5CIUA 3OW2S 3JB9J 2KSSA 1YJ9T 4PJOF 4CRIA 2MF2A 4FT2A 2K4YA 1EIFA 3J7AF 2M1HA 3RIRA 2OTJT 3V8LA 4E47A 2E6NA 3CPWS 1Q7YU 1VQNT 5GANj 3FIFA 2XD0A 1QW1A 4C8QA 1H641 3JCMX 4MZTA 4JS4A 2QEXT 1KQ1A 4E7IA 3P8BB 4FIBA 3VUBA 4A4FA 3L2UA 3QYGB 2LVMA 3X25B 3GP8A 4LDXA 5KE3A 3FRNA 5GMKh 5FU6B 1YCYA 2JUFA 3OQ5A 2EJGA 2JZ2A 4C0DB 3JB9F 2V8KA 2E64A 3EAEA 4PLLA 3I55A 3OYLA 3CCMA 1R8OB 2DJZA 1MHNA 1JBMA 3G71T 1UGSB 1NJIC 4IUUA 4ELZC 3P8HA 4EMHA 1M4ZA 1U1TA 2DD4A 4F7UB 4A53A 4M75E 4UC4A 3X26B 4N4IA 3FDRA 2XI9A 1KHCA 4QW2A 5GAN3 2K57A 2E41A 3RESA 5KE2A 2CZ1B 3GPLA 4C8QE 1HK9A 2ZPIB 2DXBA 4CI0C 5DY9A 4Q5WA 3CMEA 3RMQA 2LRQA 4KT0E 4OB3B 4C5IA 5IT9E 3A8MB 1X75C 3HP9A 3MEVA 1NZ9A 2VYTA 4WF2A 3JCMc 2K5LA 3L2WA 2RHYA 2YLBA 3M58A 1VQ5T 1GXIE 3F70A 2I2LA 3DLLA 4RG8A 5LJ5h 4EMKC 3CCJA 3G6ET 2QI2A 3PMTA 3CCQT 4NOYA 2MWPA 2KY9A 3RKYA 1D3BB 3RKXA 3CCSA 4FL6A 4F7UE 4Y91A 2DPPB 4EPCA 1VQNA 3JB9H 3M5AA 4LD6A 3JAME 4QVCA 3PMIA 2OTJA 1U8RA 4L59A 1VQOA 4KBMB 5CKEA 1M5Q1 3HL8A 5A2QE 3BFMA 4C8QB 3CCUT 3JCMJ 1VIFA 3ME9A 1DJ7B 3OS1A 3BY7A 1YJ9A 2ZPHB 3VV0A 3CCVA 3RKWA 2DZ9A 3SFMA 2PQWA 4N4HA 5M9OA 1JJ2A 2EKOA 2CZ6B 1NPRA 5GAOm 5CAIA 4C92D 4FM4B 1K73C 3HFOA 3WVEB 1VQ9A 1WGSA 3JCMg 2Y90A 2JOYA 4XTZA 5GAMd 3JB9D 2RJCA 1Q82U 3CC7T 4J7IA 3L2ZA 3QZ5B 3S3NA 1M1FA 2MWOA 2GFUA 5LJ3d 2KK4A 1G3YA 2CZ7B 2GF7A 3CMAA 2KAFA 3E1SA 2OTLA 1QVPA 2VXFA 3VJPA 1ZHIA 3CXCA 4PJOA 2O01E 3VUZA 1KD1U 1VQLT 3M56A 1YHQT 1M1GA 3CD6A 1N9SA 2R5MA 1UGQB 3E9GA 4XU2A 1YI2A 2R58A 2FYKA 2PVOB 2M9UA 5LJ3f 2F69A 2RK1A 3WVDB 4C92F 1W4SA 2KQWA 3INZA 4LDWA 5GAN8 2C06A 2F5TX 2K2VA 3PIOA 4F7UG 4O5VA 4C5EA 4M7AG 3O8VA 2A3LA 3RUXA 1UGRB 5GAOq 1JRIA 1K73U 2DXTA 5CK9A 3HRUA 3PNWC 1JJ2S 3GNGA 3HRSA 1Y71A 3LGFA 3OYJA 2VUBA 4DA4A 4HT9A 3KUFA 1KG1A 4M78E 1G3WA 3MP6A 2CKKA 3GOXA 3CCVT 4PJOE 1I4K1 2O4XA 3M57A 2XKOC 2OAUA 3QG1A 4EDUA 4XTWA 2EJFA 4JLIA 1JB0E 3OYNA 2K5FA 2EYQA 4B9XA 4ELYC 2RO0A 4E7JA 2XIDA 4BD3A 3J80E 1KHIA 4BY6B 3QPHA 4JUVA 2BUDA 1U1SA 3QJ6A 3H8ZA 4XTYA 4BY6C 1M1KC 4KUIA 1UB4A 4IUTA 4L5GA 1VQLA 2LCCA 3OYCA 5LJ5g 2LCLA 1WQ7A 4C0FA 1WNLA 2X4WA 4II1A 3QSUA 3JCMV 1D3BA 2WSFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBM A;  5GAO r;  1N9R A;  3BW1 A;  4M77 G;  4EMH A;  4EMK B;  1U1T A;  4M7D E;  3FB9 A;  2HNI A;  4C92 E;  4A53 A;  1TH7 A;  4M75 E;  4F7U B;  4JRK A;  3JCM d;  5GAM g;  4PJO B;  4M75 A;  3RER A;  4J6W A;  2K57 A;  2RB6 A;  2DTO A;  2E41 A;  1D3B A;  3RES A;  3V8K A;  4C92 C;  4F7U A;  5I21 A;  5GAO l;  4M7A A;  3SWN A;  1B34 B;  1HXD A;  1HK9 A;  4JRI A;  4XU0 A;  2E1H A;  5LJ3 h;  3V7S A;  3SB2 A;  4C8Q E;  4NL2 A;  5DY9 A;  4M7A E;  3QHS A;  1B34 A;  2YLC A;  3VU3 C;  4C8Q C;  4M78 D;  3JCM c;  4J6X A;  4M77 C;  4WF2 A;  3V7C A;  4M7D F;  2E65 A;  4M77 B;  2YLB A;  4M78 G;  1BIB A;  2EWN A;  2I2L A;  4PJO G;  5LJ5 j;  3JCM h;  5LJ5 h;  4XQ3 A;  4EMK C;  3JCM Q;  1Y96 B;  4A54 A;  4NL3 A;  2E10 A;  4M7D A;  4NOY A;  2RA2 A;  1I81 A;  3RKY A;  3RKX A;  1D3B B;  4EMG A;  4QVD A;  2DXU A;  4M75 D;  4MML A;  1Y96 A;  1KQ2 A;  4M78 F;  4C92 B;  1LJO A;  1I8F A;  3L1A A;  4Y91 A;  4F7U E;  3JCM b;  1MGQ A;  3JB9 H;  4XTX A;  4QVC A;  5GAN 3;  1LOJ A;  3HFN A;  4M78 C;  1M5Q 1;  4X9D A;  3BFM A;  3SWN C;  4OP0 A;  4C8Q B;  3JCM e;  5LJ3 g;  4N0A C;  3JCM J;  5GAN d;  4M7D C;  3BY7 A;  2RM4 A;  4M7A D;  3JCM P;  5GMK i;  3RKW A;  2DZ9 A;  4M77 A;  4F7U F;  4M77 E;  3FJP A;  5GAO m;  5CAI A;  4C92 D;  4C92 G;  2DVE A;  3HSB A;  3HFO A;  4M75 G;  5GAM j;  2YHT A;  5GAN 2;  3JCM g;  2Y90 A;  4XTZ A;  4EMK A;  5LJ5 e;  5GAM d;  3JB9 D;  5GAM e;  5LJ5 d;  4HA8 A;  4X9C A;  3V8J A;  5GAN 4;  4C8Q G;  3EFR A;  5GMK m;  3L2Z A;  5LJ3 j;  4M78 B;  5GAN h;  5GMK l;  4M77 F;  5LJ3 d;  5GAO p;  3SWN B;  4V2S A;  5LJ3 e;  5GAN f;  2DTI A;  4M78 A;  3GIB A;  2DKG A;  2VXF A;  3BDU A;  3EFS A;  2EJ9 A;  4PJO A;  2DTH A;  4N0A A;  3JB9 G;  1X01 A;  4MMK A;  1N9S A;  2DEQ A;  4M7D G;  4RCB A;  1M8V A;  1WPY A;  4XU2 A;  3JCM W;  2FYK A;  5LJ5 f;  2VC8 A;  5LJ3 f;  4C92 F;  5GAN e;  3INZ A;  4XU3 A;  4PJO D;  5GAN 8;  1BIA A;  4J6Y A;  4F7U G;  5GAN 6;  4M77 D;  4HT8 A;  4PNO A;  4M7A G;  4XTU A;  3RUX A;  4XU1 A;  5GMK e;  4M7D D;  5GAO q;  1JRI A;  2DXT A;  3QO3 A;  5GMK j;  4DQ2 A;  4HT9 A;  2JN0 A;  1LNX A;  4J5Y A;  4M78 E;  5GAN g;  4M7D B;  4M75 F;  3JB9 J;  4M75 B;  1WQW A;  4PJO E;  1I4K 1;  5GAM h;  4PJO F;  4M75 C;  2EAY A;  3AHU A;  4C92 A;  2FB7 A;  3JB9 I;  4M7A C;  5GAN 7;  4PJO C;  4XTW A;  2EJF A;  4JLI A;  4RCC A;  3RIR A;  4M7A B;  4M7A F;  3V8L A;  3JCM f;  3V7R A;  2ZGW A;  2CGH A;  3FIF A;  3PGG A;  4C8Q A;  1H64 1;  3JCM X;  5GAN j;  2QTX A;  1KQ1 A;  1I5L A;  4JUV A;  1U1S A;  4XTY A;  3M4G A;  2RD1 A;  5GAN 5;  2VXE A;  5GMK h;  1YCY A;  3JB9 F;  2EJG A;  4XTV A;  4C8Q F;  4C8Q D;  5GAM f;  5LJ5 g;  1WQ7 A;  2E64 A;  1WNL A;  3QUI A;  3QSU A;  5GAO n;  3JCM V;  2DZC A;  2DJZ A; 
#chains in the Genus database with same CATH topology
 3PTA A;  5GAO r;  2X4X A;  5KCO A;  1OOT A;  1ZSZ B;  2JTM A;  4OVA A;  4PJO B;  1JQQ A;  5D6X A;  5GJW B;  1HXD A;  4XU0 A;  1KJW A;  2DET A;  1OQK A;  2C0T A;  1NJI U;  3EG0 A;  3VS3 A;  1BU1 A;  3SEM A;  1ZLM A;  4RTV A;  3E19 A;  3DB4 A;  1OU8 A;  2X51 A;  3QKJ A;  2QXF A;  2J7I A;  2MOX A;  4M75 D;  4BE2 A;  1LJO A;  2X9H A;  3PFS A;  3L2V A;  2BE7 D;  2QDL A;  4XTX A;  3HPW A;  1Z9Z A;  3L42 A;  4E7L A;  5KYY B;  2XG8 D;  4A4G A;  5GAN d;  3OYF A;  2JJ9 A;  2L2P A;  1UJ0 A;  2PUK B;  1XJW B;  1QVG A;  4IUR A;  3A5Z B;  5HK0 A;  3ZL7 C;  4LXC A;  2HL5 C;  4HA8 A;  4HCB A;  5CKD A;  4C8Q G;  3HHT B;  2VGM A;  2WSE E;  1MNE A;  1VQK A;  4IUP A;  2QGF B;  3EHQ A;  4J9C A;  3A8L B;  4M78 A;  1KD1 C;  2DKG A;  3GIB A;  2R57 A;  1VIE A;  3HTR A;  1M8V A;  3CPF A;  2X3X D;  2JTE A;  4R55 A;  4DBF A;  3LW5 E;  5D7U A;  9ATC B;  2DL5 A;  2CUD A;  1PD0 A;  4LNP A;  2WAC A;  5A0D A;  2NWM A;  1EFN A;  4J5Y A;  4FYY B;  2RHI A;  2RI5 A;  3AHU A;  2RNA A;  3MEA A;  4Y28 E;  2HKN A;  1F1B B;  1RAI B;  2A36 A;  1RL2 A;  3V7R A;  1VQP T;  2FO0 A;  5A0G A;  1YWO A;  2CZ0 B;  1M90 C;  1U06 A;  2RJF A;  1FXX A;  1K76 A;  1WHM A;  5EG2 A;  4OGE A;  1YBY A;  1KSW A;  3UPU A;  1ZX6 A;  4IIM A;  2DBK A;  2CSQ A;  1C0M A;  2YT6 A;  4DBH A;  2EGA A;  3SWN A;  4C0G A;  4OB0 B;  1KQS S;  5KYY A;  5J3B A;  3S3O A;  1W2B A;  2F5K A;  2P0Q A;  1YJN T;  2HAX A;  2QQA A;  3X28 B;  2EQJ A;  2EWN A;  3OSS C;  4ZNX A;  2E10 A;  1SEM A;  1M1K U;  2MMP A;  4JRP A;  4A4H A;  2NUT A;  1MV3 A;  4M78 F;  3L1A A;  1WHL A;  4A63 B;  2HQE A;  4OB2 B;  2QA4 T;  4OP0 A;  2SEM A;  5LJ3 g;  1VYT A;  3CCU Q;  3DB3 A;  1FMK A;  1WHK A;  4MDX A;  1WLP B;  3FJP A;  4RG2 A;  2YHT A;  4EMK A;  2YUN A;  1VQO Q;  1UG1 A;  3V8J A;  1NEB A;  5GAN h;  3CCR T;  1NYF A;  4M77 F;  4V2S A;  4Y92 A;  1VQ7 A;  3LWH A;  1SSF A;  3EFS A;  1P92 A;  1NE8 A;  3O5Z A;  5IH2 A;  2K79 A;  2DEQ A;  4M7D G;  4F04 B;  5CVI A;  3CC2 A;  5CKF A;  2A0F B;  2CP2 A;  5LJ5 f;  4GY5 A;  2QAS A;  4NS5 A;  1IZ6 A;  2PNI A;  2ABL A;  5HCK A;  2E70 A;  4FCY A;  3CC4 A;  1ZUU A;  2O4X B;  1QCF A;  3REA B;  2DXC A;  3TSW A;  5GAM h;  1VQ4 A;  2LCS A;  4M7A C;  3H6Z A;  1V29 B;  4M7A B;  1EZZ B;  5HKC A;  2ZGW A;  2IPO B;  2QTX A;  3LWI A;  2QEX Q;  1AWO A;  3QZ9 B;  3VS1 A;  1MUZ A;  1I5O B;  2MIO A;  1MMA A;  3JV3 A;  3PT9 A;  1YIT A;  3ZFJ A;  1NBE B;  3JCM d;  1CKB A;  1Q86 U;  2DIG A;  2X3W D;  5CO7 A;  3V7S A;  2E1H A;  4M7A E;  2K9G A;  1YIJ A;  2JT4 A;  5IN1 A;  1ZSG A;  4BUG A;  4M78 G;  2L5Q A;  2LQ8 A;  4C5G A;  2QA4 A;  3CCE T;  3G6E Q;  2B86 A;  2KBT A;  4EMG A;  1VQN T;  2DXU A;  4FT4 A;  3J81 E;  1GFC A;  1T3L A;  2L89 A;  2JXB A;  1RUW A;  7AT1 B;  4M77 A;  2L3P A;  4ZN3 A;  2EW3 A;  1QP2 A;  2YSQ A;  3HSB A;  3M53 A;  4HVW A;  2RF0 A;  1BB9 A;  3EFO B;  4IKF A;  3LX7 A;  3SWN B;  1K0S A;  1AVZ C;  1Q81 U;  2AZV A;  1X01 A;  3CMA T;  2E5K A;  3I56 T;  1YHQ Q;  2LT1 A;  5GAN e;  2LNH B;  2XU8 A;  1I1J A;  4JJD A;  1KQS P;  1K9M C;  1RAF B;  2BIV A;  2JN0 A;  1G3T A;  1X27 A;  4PJO F;  3QWX X;  3RR6 A;  2MF2 A;  2K4Y A;  4J9E A;  2K2M A;  3V8L A;  1WZO A;  1QW1 A;  4JS4 A;  4E7I A;  2CSI A;  1KQ1 A;  3P8B B;  3L2U A;  5KE3 A;  1HD3 A;  2L0A A;  1YCY A;  2JZ2 A;  4C0D B;  3I55 A;  3CMA Q;  3OYL A;  1JBM A;  3P8H A;  3M0S A;  1M4Z A;  1SPK A;  4F7U B;  2A28 A;  1ZSZ C;  1KHC A;  2EYW A;  1I0C A;  2COY A;  2E41 A;  1VA7 A;  2VAS A;  1HK9 A;  2ZPI B;  3NMZ C;  1AWJ A;  2F2X A;  4KT0 E;  4OB3 B;  4C5I A;  1VQP Q;  2K5L A;  1KIK A;  3CCM Q;  1Q81 R;  3F70 A;  1ZUY A;  3DLL A;  3A98 A;  2KY9 A;  4Y91 A;  1UUE A;  2NUP B;  1D1A A;  1YCS B;  3CCU T;  1VIF A;  1DJ7 B;  2FPD A;  2JMA A;  1H3H A;  5CAI A;  4C92 D;  1K73 C;  3HFO A;  3WVE B;  2KE9 A;  2KT8 A;  3JCM g;  3CPW P;  2CH4 A;  2RJC A;  1Q82 U;  3CC7 T;  4J7I A;  1QWE A;  4PJM A;  3S3N A;  2O88 A;  4PJO A;  4FYX B;  2YUP A;  2R5M A;  1UGQ B;  4XU2 A;  1IB8 A;  2PVO B;  5LJ3 f;  2RK1 A;  3WVD B;  2KQW A;  5GAN 8;  2C06 A;  2K2V A;  4O5V A;  3O8V A;  1UGR B;  1QCO A;  3HRU A;  3GNG A;  3HRS A;  4DA4 A;  1KG1 A;  3KUF A;  4M78 E;  4QT7 A;  3MP6 A;  2CKK A;  1IXD A;  3EH2 A;  2KYM A;  2OAU A;  3IQL A;  1JB0 E;  2YRD A;  1IRX A;  4E7J A;  3EGX B;  2BZ8 A;  1ACM B;  2BUD A;  4JUV A;  3CCS Q;  2DLP A;  4JJC A;  1VQL A;  2OTJ Q;  4C0F A;  1WQ7 A;  1WNL A;  1K1Z A;  1RAE B;  1D3B A;  2WSF E;  1KD1 R;  2VVK A;  4PL6 A;  1VQ4 Q;  3OYD A;  4M77 G;  5CQX A;  2L3S A;  2FRY A;  2DYI A;  2BTT A;  1B34 B;  1UDL A;  4ZTF A;  2V1Q A;  2EYZ A;  4OB1 B;  1R0B G;  1YHQ A;  1BIB A;  2RN8 A;  4JPB W;  5DM7 R;  2HZY A;  4FW1 A;  4LDU A;  4A54 A;  4KGX B;  2V8J A;  2K3X A;  2ZCF B;  5I2M A;  2RJE A;  2XIC A;  1TTH B;  4RKU E;  3L2Q A;  4IUV A;  2H8H A;  1MV0 B;  2DER A;  4PFO A;  4BDZ A;  1ZUK A;  4OMO A;  2RHX A;  5I11 A;  4J9D A;  1XTD A;  1JO8 A;  4ZGJ B;  3CCU A;  1UE9 A;  2FZK B;  1AWX A;  2LJ3 A;  1C6V X;  4C0Z A;  1S72 A;  3MPU B;  5DLQ E;  1ABQ A;  5GMK l;  3I56 A;  2H3J A;  1BCO A;  4ME7 A;  1N8R R;  3KBG A;  1VQL Q;  5FRM A;  4ANJ A;  2BZX A;  3BDL A;  4PJJ A;  2RJD A;  5GJV B;  1K8A R;  1Y07 A;  2AK5 A;  3LGL A;  2CP6 A;  1YNZ A;  2DL7 A;  4R56 A;  4HT8 A;  3G1J A;  1YJW T;  1VQ9 T;  5FU7 B;  3FJ5 A;  1LVK A;  2GQI A;  1PHT A;  3H0F A;  3GLX A;  3CXC P;  4M75 F;  1QMC A;  3MP1 A;  2D8J A;  4C92 A;  2DEU A;  4RCC A;  2QQB A;  1H3Z A;  2MYS A;  2Y4Y A;  1GBQ A;  2ATC B;  2VXE A;  5GAN 5;  3G4S T;  4LUD A;  3NFC A;  2KI7 A;  4C8Q D;  3I5R A;  3QUI A;  2VV5 A;  2DZC A;  1UJY A;  4LUE A;  2PVD B;  3DLM A;  3M0P A;  2OI3 A;  2RHU A;  3QDR B;  1AT1 B;  2HNI A;  2GQV A;  2NUT B;  3OYE A;  4JRK A;  4M75 A;  3RER A;  1BYM A;  2VB6 A;  3RNJ A;  2ZPF B;  4C8Q C;  4J6X A;  1SG5 A;  1QVF A;  1BI3 A;  4PJO G;  2ED1 A;  4FYW B;  4QVD A;  1OZ3 A;  2LQW A;  2YRV A;  1OUL A;  1VQP A;  3JCM b;  4BAC A;  2VGN A;  4DEX A;  5CCA A;  3G7Z A;  4BI3 A;  1PWT A;  2KRS A;  3T9N A;  2Z0W A;  4DOW A;  2KRN A;  3OW2 P;  1O9S A;  2G6F X;  2CS7 A;  3VRY A;  4WTO B;  4RTX A;  2HQX A;  2DVE A;  3CC4 Q;  3OYM A;  3I55 Q;  2K3Y A;  2JNG A;  2F2V A;  1T0H A;  2W10 A;  4M78 B;  3ER0 A;  1ABO A;  5KH6 A;  1OPL A;  2ZZD A;  3H0I A;  4J83 A;  4PKC C;  3A8H B;  1GCQ C;  2OTL T;  5L8R E;  1WPY A;  1IHV A;  2HBP A;  1D0X A;  1ZBX A;  1WJQ A;  2DNU A;  1T0J A;  1XOV A;  3H0H A;  2JS0 A;  1OX9 A;  3S3M A;  4KUD K;  1KC8 C;  2AIR B;  4HCZ A;  2EYX A;  1YJ9 Q;  3JB9 I;  4QVZ A;  4J9G A;  3RMS A;  3C4S A;  3OYH A;  2CGH A;  3VS2 A;  3R6O A;  4LN2 A;  3VKI A;  3M4G A;  6AT1 B;  2XDB A;  3LH0 A;  4C0D C;  2VWF A;  1VQ4 T;  5GAO n;  1R0C B;  2M0O A;  4RTT A;  1VQ5 A;  1WHG A;  1SRM A;  3Q1J A;  4EMK B;  1YIJ T;  1W1F A;  1K73 R;  1Y57 A;  2DYB A;  2DTO A;  5GAO l;  2X4J A;  4HCK A;  3SB2 A;  4MZM A;  1B34 A;  2HMA A;  3EG9 A;  2X4Y A;  5ECA A;  1VQ8 A;  4E7K A;  3OS2 A;  2HCK A;  2DO3 A;  1B7T A;  4NL3 A;  5FRN A;  3PVQ A;  4MDW A;  4CC7 A;  3CCM A;  2JTF A;  1KQ2 A;  3C95 A;  4MML A;  5FRO A;  4Z89 A;  4AFZ C;  3UWN A;  4F16 A;  4C92 B;  1B07 A;  1I8F A;  5D6Y A;  1VQM A;  2W0Z A;  2RQU A;  2DD5 A;  2KRM A;  2CDT A;  1JEG A;  2DL3 A;  3EGX A;  3NPF A;  2P0K A;  5HK3 A;  1WJR A;  4J7F A;  2DVJ A;  4P5N A;  1KC8 U;  2IG0 A;  3FLG A;  1YN8 A;  3KFV A;  4E7H A;  1G3S A;  5CQY A;  1VQO T;  3OS5 A;  5GAN 4;  2EGE A;  3CC2 T;  3JSC A;  1QP3 A;  3VYH B;  3G71 A;  2DTI A;  2QQS A;  2MI6 A;  2DRK A;  3JB9 G;  1WIE A;  4MMK A;  3MEW A;  3A8O B;  4PJL A;  4B9W A;  3OBW A;  1NLP C;  2XK0 A;  4J6Y A;  3QWY A;  4PNO A;  4X34 A;  2H3E B;  2QTV A;  3OYA A;  5KYU A;  3FEO A;  2HQH A;  4M7D B;  4JDS A;  1XQH A;  2AT1 B;  2D9T A;  3OW2 S;  1M3A A;  1VYV A;  4R0K A;  1U5S A;  4FT2 A;  3J7A F;  2M1H A;  2KYB A;  1Q7Y U;  2XD0 A;  3CC2 Q;  4MZT A;  2QEX T;  2FRW A;  2V26 A;  4FIB A;  3VUB A;  4A4F A;  3X25 B;  3FRN A;  3OQ5 A;  3JB9 F;  2V8K A;  2E64 A;  1YJW Q;  2DJZ A;  3G71 T;  3QDF A;  2DD4 A;  1U1T A;  1B3Q A;  4RTW A;  1TXQ A;  1TS9 A;  2K57 A;  3RES A;  2CZ1 B;  4Q5W A;  3CME A;  2LRQ A;  3HP9 A;  3MEV A;  2VYT A;  4WF2 A;  2E3I A;  2I2L A;  2CP5 A;  2HSP A;  3G6E T;  4DEY A;  4X1V A;  3RKX A;  4FL6 A;  2IIM A;  2LJ0 A;  1ARK A;  4EPC A;  3PMI A;  5IXB A;  4KBM B;  3HL8 A;  5A2Q E;  2C0I A;  3ME9 A;  3OS1 A;  4CC3 A;  1YJ9 A;  1PRM C;  2HDA A;  3VV0 A;  3RKW A;  2DZ9 A;  2PQW A;  4N4H A;  4FSS A;  2CRE A;  1G8X A;  2Y90 A;  4XTZ A;  2DJQ A;  1RAD B;  1Q82 R;  2MWO A;  1WX6 A;  2GFU A;  1G3Y A;  2CZ7 B;  3CMA A;  3E1S A;  2OTL A;  3VJP A;  2OTL Q;  3M56 A;  3I56 Q;  1M1G A;  1YHQ T;  2CH4 W;  4J9I A;  1YI2 A;  2M9U A;  4C92 F;  3INZ A;  1ZA2 B;  3RUX A;  5GAO q;  2J6O A;  3PNW C;  1JJ2 S;  2RQT A;  1Y71 A;  3EFO A;  1RAG B;  3TQ7 P;  5EC7 A;  2COW A;  1I4K 1;  4GLM A;  3M57 A;  2XKO C;  1PG5 B;  4EDU A;  2EJF A;  3OYN A;  2K5F A;  4B9X A;  2RO0 A;  4BD3 A;  4BY6 B;  3QPH A;  1W6X A;  1U1S A;  4BY6 C;  2LZ6 B;  1GBR A;  1M1K C;  1A0N B;  2EBP A;  1UHF A;  1QVF P;  3EH1 A;  3OYC A;  5LJ5 g;  2LCL A;  4II1 A;  5KYU B;  3QSU A;  1K8A C;  3GNF B;  1N8R C;  2MPX C;  4MZP A;  4OMF B;  5I22 A;  4C92 E;  1ZA1 B;  4WCI A;  2F1L A;  4JRQ A;  4ORZ A;  1WHH A;  2COZ A;  4Z02 A;  1R77 A;  2RB6 A;  2QG9 B;  3ZEH A;  4F7U A;  4M7A A;  2NUP A;  3CQT A;  1Q7Y R;  4NL2 A;  2P84 A;  3QHS A;  1WXT A;  4JLG A;  3M54 A;  2WSC E;  1FWZ A;  1Q95 G;  2JS2 A;  4M78 D;  5FU6 C;  4LD9 K;  2E65 A;  1K8A U;  4AG2 C;  1WDX A;  3MET A;  1M90 U;  1I81 A;  1M9S A;  1D0Z A;  1YI2 Q;  1RLP C;  2L3Q A;  4DBR A;  1BI1 A;  1YIJ Q;  1SHF A;  2EGC A;  3MEU A;  5IHI A;  3CCQ Q;  3C0C A;  1G2B A;  4JS5 A;  2LJ1 A;  4QQG A;  4M77 E;  4ZTJ A;  3VYG A;  2RI3 A;  1PM3 A;  3CC7 Q;  1QQJ A;  4TVR A;  1TUC A;  3OB9 A;  2EFI A;  2EYY A;  1BK2 A;  4GLK A;  1M30 A;  1LCK A;  5CR2 A;  1NJI R;  1VQ8 Q;  1VQK T;  2F2W A;  5C6S A;  2I0N A;  1BIA A;  1TG0 A;  1Q82 C;  4M77 D;  3OY9 A;  4XTU A;  5GMK e;  1QKX A;  4A4K A;  4DOV A;  4LDV A;  1OZ2 A;  5GAN g;  4M75 B;  1WQW A;  4M75 C;  4AFQ C;  2XDP A;  1W2B P;  1IO6 A;  3OYI A;  3CCS T;  1I5L A;  1NM7 A;  1WJS A;  3MO8 A;  3QXE B;  3R6N A;  5GAM f;  4AMC A;  1G83 A;  3OSV A;  1E6H A;  2OAW A;  2DAQ A;  1VQ8 T;  1MND A;  1TH7 A;  2FPE A;  5GAM g;  2HBW A;  3CBO A;  1VQ5 Q;  3X20 B;  3C12 A;  1T3S A;  1GRI A;  1AWW A;  1OU9 A;  4RTU A;  3VU3 C;  1VQN Q;  8AT1 B;  3TU4 K;  2ZPE B;  1FX7 A;  4XQ3 A;  4ZGE B;  4JZ4 A;  4M7D A;  1HSQ A;  1YWP A;  2FZC B;  5FWB A;  2KVQ G;  1MGQ A;  5KYX A;  3CCL A;  3SWN C;  1JU5 C;  3KXT A;  1SKU B;  2DIL A;  3CXC S;  2L8D A;  2KT1 A;  2XHC A;  2K5I A;  2PVG B;  1O75 A;  4HKE A;  1YJW A;  5LJ5 e;  2M02 A;  3MCA B;  4YTL A;  5J39 A;  2P4T A;  2EQI A;  2PUO B;  2RHZ A;  2GBQ A;  5GAO p;  5LJ3 e;  1CKA A;  1OEB A;  2KR3 A;  4JZ3 A;  3BDU A;  1VQ6 T;  4FSX A;  2RI2 A;  3EG2 A;  5KYW B;  4RCB A;  3G71 Q;  2GTO A;  4PJO D;  4OF1 A;  2EKH A;  4B6M A;  4DQ2 A;  2R5A A;  1X6O A;  1YIT T;  4BE1 A;  1MMG A;  2EAY A;  3UA6 A;  3TCJ A;  2DM1 A;  2FB7 A;  4PJO C;  3GF5 A;  4M7A F;  3EG9 B;  1M2O A;  1VQ7 Q;  3PGG A;  2A08 A;  2V1R A;  2O2O A;  3ASK A;  2DIQ A;  3CBP A;  3CD6 T;  1WYX A;  1FMW A;  1VQ6 Q;  4XTV A;  1AZG B;  1UEB A;  2KDS A;  4C8Q F;  5C0M A;  3OW2 A;  2HD0 A;  2ESW A;  2J05 A;  3HKS A;  4QKU A;  1X2Q A;  2QK0 A;  5D6W A;  5LJ3 h;  1M27 C;  4M77 C;  1OYX A;  1HYO A;  4M77 B;  3TEE A;  2IVW A;  2GTJ A;  2X35 A;  3QII A;  3JCM Q;  4EIK A;  1PC0 A;  4D6W A;  3G4S A;  1TUG B;  3M4Y A;  2AHJ B;  1PSF A;  1Y96 A;  1Y7X A;  4QQ6 A;  4ZN1 A;  2L3R A;  1LOJ A;  1SHG A;  4JJB A;  3VS5 A;  4AFU C;  4CC4 B;  4X9D A;  1X2K A;  1N5Z A;  2QDY B;  2RM4 A;  2NYS A;  4J9H A;  4BI8 B;  1KQS A;  1H8K A;  2E6Z A;  3SD4 A;  3CC4 T;  1PRL C;  3CEY A;  3P8D A;  2VKN A;  5GAN 2;  1Q86 R;  3VS0 A;  5GAM e;  3H41 A;  1E7O A;  5LJ3 j;  1BI2 A;  2K3B A;  5GAN f;  3G6E A;  1QVG P;  2RQW A;  1VQ6 A;  1GCP A;  2O9V A;  5HY6 A;  2B8A A;  2M16 A;  2O9S A;  3EGD B;  2BZY A;  5AYF A;  5IHN A;  3CCR Q;  2K7A A;  2LQK A;  2LC4 A;  2VC8 A;  3UDC A;  5GAN 6;  4VUB A;  4PLI A;  3ULR B;  1NLO C;  3OMG A;  2QAZ A;  4ZGD B;  3CBM A;  5GMK j;  3NGP A;  1K9M R;  2KMT A;  5L23 A;  4M4Z A;  1M2V A;  3EG1 A;  3MHX A;  4OMN A;  3JB9 J;  5CIU A;  2YXY A;  3E2U A;  1YJ9 T;  1VQ9 Q;  3TVT A;  3RIR A;  5KYX B;  2OTJ T;  1GFD A;  4E2F B;  3U23 A;  5GAN j;  2YRC A;  1U3O A;  4CC2 A;  2JUF A;  2EJG A;  1R8O B;  1QKW A;  1MHN A;  2D8H A;  4EMH A;  2BE9 B;  4A53 A;  4UC4 A;  3X26 B;  4HXJ A;  2XI9 A;  3BE3 A;  4C8Q E;  1AZE A;  4CI0 C;  1X6G A;  3JCM c;  2FEI A;  2YLB A;  1GXI E;  2HSE B;  3CCJ A;  4NOY A;  2K6D A;  2MWP A;  1D3B B;  4F7U E;  1VQK Q;  3M0U A;  3JB9 H;  4QVC A;  1UEC A;  4F17 A;  1U8R A;  4L59 A;  1VQO A;  1M5Q 1;  1KK7 A;  4C8Q B;  5KYN A;  3JCM J;  3BY7 A;  1GCQ A;  3I5S A;  1KC8 R;  2JM9 A;  3M0Q A;  3CCV A;  3SFM A;  1UGV A;  2CZ6 B;  1K9A A;  1NPR A;  2DFU A;  1VQ9 A;  1WGS A;  1K0X A;  5GAM d;  3UAT A;  3JB9 D;  4RTZ A;  4E7Z A;  1UHC A;  2KRO A;  3QZ5 B;  1VQM Q;  1M1F A;  2KK4 A;  2ZAE A;  1WA7 A;  2KAF A;  1I07 A;  4RTY A;  1ZHI A;  3CXC A;  1KD1 U;  1N9S A;  3UA7 A;  3E9G A;  2C0O A;  2R58 A;  1PCX A;  1K4U S;  2F69 A;  5IHK A;  4LDW A;  1GL5 A;  2F5T X;  3PIO A;  3CME Q;  1VYU A;  1YP5 A;  2A3L A;  1JRI A;  1M2V B;  1K73 U;  1RAH B;  4Z88 A;  3PVL A;  3LGF A;  4HT9 A;  1G3W A;  3GOX A;  3PE0 A;  2O4X A;  1NG2 A;  2FZG B;  2E3H A;  2EYQ A;  4ELY C;  3EGD A;  2XID A;  1KHI A;  1D1C A;  1OPK A;  3CD6 Q;  4KUI A;  1UB4 A;  4IUT A;  4L5G A;  5FWC A;  4PFP A;  3RBB B;  3SHW A;  3BW1 A;  4RMO A;  2LX9 A;  1VOM A;  3M9Q A;  3CME T;  2QA4 Q;  4J6W A;  1G5V A;  3V8K A;  2CYZ B;  5I21 A;  4C5H A;  2CP3 A;  2RPN A;  1M3B A;  1FYN A;  4ATO A;  1PD1 A;  1XNI A;  3S6W A;  2RH2 A;  1QVG S;  2OJ2 A;  2A7Y A;  2CP0 A;  2DL8 A;  2MK5 A;  2LDM A;  3JCM h;  2EQM A;  1W70 A;  1Y96 B;  1V76 A;  4BE0 A;  4FW2 A;  2NLU A;  3JCM W;  4KUL A;  2LT4 A;  1V1C A;  1N6A A;  3OBY A;  4IUQ A;  1RAB B;  1Q7Y C;  1WI7 A;  2PU9 B;  4M78 C;  1M3C A;  3CCJ T;  1JJ2 P;  3QJY A;  8ATC B;  4PFZ A;  1Y0M A;  1AEY A;  3JCM P;  1YJN A;  2O31 A;  2P0P A;  3TRE A;  4F7U F;  2NUZ A;  4OGC A;  4C92 G;  3OYK A;  4PK4 A;  2V8I A;  4D8D A;  5LJ5 d;  1QLY A;  2DF6 A;  3REB B;  2A37 A;  4AG1 C;  5A0L A;  1QVF S;  2YUO A;  2LP5 A;  3OYG A;  2EJ9 A;  4J8O A;  3DKM A;  2FVU A;  3M0R A;  5FW9 A;  3LYI A;  2ZPG B;  2QQ9 A;  1E6G A;  5CKB A;  3CPW A;  3TSZ A;  2J6K A;  2E4H A;  1JXM A;  3N5B B;  2ED0 A;  2HL3 A;  1WFW A;  2OX7 A;  3QO3 A;  3QYH B;  4XAX B;  1LNX A;  2XDD A;  3MP8 A;  3M55 A;  5GAN 7;  2KEA A;  4HVU A;  3JCM f;  3X24 B;  3JRZ A;  2G3R A;  1AOJ A;  1LPL A;  2HKQ B;  3CCQ A;  3CCE A;  2LNV A;  2FPF A;  2QQR A;  1VQ7 T;  1TSF A;  2RQR A;  2PZ1 A;  2DK3 A;  3CCE Q;  4RUG A;  3UF4 A;  3MKD A;  4M7D C;  4KGZ B;  1UFF A;  1N9R A;  5IAY A;  1SSH A;  2P4R A;  3LH5 A;  4M7D E;  2LX7 A;  1WXB A;  4C92 C;  3ZBD A;  4JRI A;  3QBY A;  2ECZ A;  5IXF A;  4BB7 A;  4O6J A;  3THK A;  1N8R U;  1IHW A;  5KCH A;  1S1N A;  2SRC A;  4LDY A;  2ROL A;  2HEQ A;  3HRT A;  2QEX A;  1SRL A;  3HFN A;  2J6F A;  1OI1 A;  1H92 A;  3JCM e;  1YFN A;  2CP7 A;  1WXU A;  4BI4 A;  2Y4X A;  5CKH A;  1W2B S;  1QCN A;  2FHD A;  4M75 G;  1VUB A;  1K9M U;  4OMP A;  1AHJ B;  1D0Y A;  1X6B A;  4X9C A;  2BKD N;  2QYZ A;  2ZPB B;  1J3T A;  1VQM T;  1M90 R;  3CCV Q;  1NPP A;  1BCM A;  2GCX A;  1PKS A;  1YI2 T;  2DBM A;  4F14 A;  1X69 A;  3OYY A;  3I9Q A;  2EQK A;  3E9F A;  2DTH A;  5FLX E;  1Q81 C;  1UTI A;  3GBQ A;  3VS7 A;  4OMM A;  1S72 T;  3OA6 A;  1IGQ A;  2YUQ A;  3CC7 A;  4J9F A;  1ZQ1 A;  4XK8 E;  2D0N A;  2JMC A;  3EHR A;  4K11 A;  3OS0 A;  2LTO A;  4OMQ A;  1TWB A;  3FC3 A;  2LQN A;  4BDY A;  2D0Q B;  1NYG A;  2KXC A;  4E7S A;  3CCL Q;  3WXM B;  3L2R A;  2FL7 A;  4AFS C;  1FMV A;  3CCM T;  1Z9Q A;  5FU7 C;  2RD1 A;  3M59 A;  1PSE A;  2ENM A;  2DMO A;  3NHN A;  4FU6 A;  2RQV A;  3M0T A;  2EQU A;  1SF9 A;  4JJN K;  3FB9 A;  4E6R A;  2EVR A;  2KNB B;  2KGT A;  3OMC A;  4A4E A;  1RAA B;  4HCC A;  2DL4 A;  2AKL A;  4KH1 B;  5J26 A;  1IRE B;  1Q86 C;  3PIP A;  2M0Y A;  3URG A;  1RAC B;  3LLR A;  2YLC A;  3V7C A;  5KYW A;  4M7D F;  2EIF A;  2D6F A;  2JVV A;  2RK2 A;  4N4G A;  3CCL T;  2RA2 A;  4L6V 5;  5LJ5 j;  4M7D D;  1NEG A;  2YDL A;  1RI0 A;  3OYB A;  2MAM A;  3CCJ Q;  3SDZ A;  1JXO A;  2E12 A;  5LL6 S;  2CT3 A;  1MMD A;  1RLQ C;  4N0A C;  2GGR A;  2KXD A;  1QWF A;  4IIO A;  4QQD A;  4M7A D;  4KGV B;  5GMK i;  3NTK A;  3EGU A;  1BKB A;  5I2S A;  3UT1 A;  5GAM j;  4J9B A;  4LE9 A;  3EFR A;  2JM8 A;  5GMK m;  2CT4 A;  2GFA A;  5DLO A;  2AKK A;  2YWW A;  3I55 T;  2XMF A;  3C94 A;  4N0A A;  1BI0 A;  1OX8 A;  3VS6 A;  1N27 A;  3CCR A;  2RMO A;  2GNC A;  4XU3 A;  2CUB A;  1UGP B;  2JW4 A;  4Z8A A;  4ESR A;  2LMJ A;  4XU1 A;  3A8G B;  2PTK A;  2E5Q A;  1M8M A;  1TOV A;  3NTH A;  1HJD A;  3NTI A;  2KSS A;  3I35 A;  1ZSZ A;  4CRI A;  1OV3 A;  3G4S Q;  1EIF A;  4E47 A;  1AD5 A;  2E6N A;  3CPW S;  3FIF A;  1D1B A;  4C8Q A;  1H64 1;  3JCM X;  3VRZ A;  1YJN Q;  3GP8 A;  3QYG B;  2LVM A;  4LDX A;  5GMK h;  5FU6 B;  3EAE A;  4PLL A;  2FG0 A;  2AZS A;  1UGS B;  4GBQ A;  4HVV A;  2EPD A;  4IUU A;  4ELZ C;  4DBQ A;  1NJI C;  4KRT A;  3RDV A;  4M75 E;  4N4I A;  3FDR A;  2J06 A;  4QW2 A;  2ROT A;  5GAN 3;  4AT1 B;  1PKT A;  5KE2 A;  1C1A A;  3GPL A;  2DX1 A;  3EG3 A;  1RI9 A;  1BBZ A;  2DXB A;  5DY9 A;  3RMQ A;  5IT9 E;  2M51 A;  3A8M B;  1X75 C;  1NZ9 A;  1PNJ A;  3L2W A;  1IGU A;  2RHY A;  3M58 A;  1VQ5 T;  1KFZ A;  4RG8 A;  5LJ5 h;  4EMK C;  4PJN A;  3D7S B;  2QI2 A;  3PMT A;  3CCQ T;  3RKY A;  3CCS A;  4D8K A;  2DPP B;  1VQN A;  3M5A A;  4LD6 A;  3JAM E;  2OTJ A;  1D09 B;  5CKE A;  3BFM A;  2ZPH B;  1JJ2 A;  5M9O A;  2EKO A;  3A1P A;  5GAO m;  4FM4 B;  5AT1 B;  2JOY A;  2QGG A;  3L2Z A;  5LJ3 d;  2GF7 A;  3H9N A;  1QVP A;  2VXF A;  2O01 E;  3VUZ A;  1VQL T;  1CSK A;  3CD6 A;  1ZBJ A;  2DA9 A;  2FYK A;  1W4S A;  1X43 A;  2D1X A;  4F7U G;  4C5E A;  4M7A G;  1TU0 B;  2DRM A;  2DXT A;  5CK9 A;  1EX4 A;  2MCN A;  3VS4 A;  3OYJ A;  2VUB A;  3CCV T;  4PJO E;  1MMN A;  3QG1 A;  4XTW A;  3MJX A;  4JLI A;  1TUD A;  3AT1 B;  3J80 E;  1YIT Q;  1M1K R;  3QJ6 A;  3H8Z A;  4XTY A;  4KH0 B;  1S72 Q;  4OML A;  2LCC A;  4FYV B;  2X4W A;  1WHJ A;  3JCM V;  2DE0 X; 
#chains in the Genus database with same CATH homology
 4MZP A;  4OMF B;  4PL6 A;  3PTA A;  5GAO r;  3OYD A;  3BW1 A;  4M77 G;  2X4X A;  5CQX A;  4RMO A;  5KCO A;  2LX9 A;  4C92 E;  2JTM A;  4OVA A;  4JRQ A;  4PJO B;  3M9Q A;  4Z02 A;  3CME T;  4J6W A;  2RB6 A;  3ZEH A;  5D6X A;  3V8K A;  2CYZ B;  4F7U A;  5I21 A;  4C5H A;  4M7A A;  1G5V A;  1B34 B;  1HXD A;  4XU0 A;  4ZTF A;  4NL2 A;  3QHS A;  4ATO A;  4JLG A;  4OB1 B;  3M54 A;  2WSC E;  1FWZ A;  4M78 D;  5FU6 C;  1XNI A;  3S6W A;  2RH2 A;  4LD9 K;  2E65 A;  1QVG S;  1NJI U;  2A7Y A;  1YHQ A;  1K8A U;  1BIB A;  1K9M U;  2LDM A;  1N8R C;  3JCM h;  5DM7 R;  3E19 A;  2EQM A;  1Y96 B;  4LDU A;  4A54 A;  3DB4 A;  4BE0 A;  3MET A;  1M90 U;  1VQ6 T;  2NLU A;  1I81 A;  1M9S A;  2V8J A;  2K3X A;  3QKJ A;  2QXF A;  4KUL A;  4M75 D;  3JCM W;  2LT4 A;  4BE2 A;  1LJO A;  2ZCF B;  1N6A A;  1BI1 A;  3OBY A;  4IUQ A;  5I2M A;  1Q7Y C;  3PFS A;  3L2V A;  2RJE A;  4XTX A;  2XIC A;  2PU9 B;  4RKU E;  4M78 C;  3HPW A;  3MEU A;  3CCJ T;  3L42 A;  4IUV A;  3L2Q A;  4E7L A;  3QJY A;  4BDZ A;  2XG8 D;  4A4G A;  5GAN d;  3OYF A;  2RHX A;  3JCM P;  1YJN A;  2PUK B;  4JS5 A;  2P0P A;  4QQG A;  3TRE A;  4F7U F;  1XTD A;  4M77 E;  4ZTJ A;  1QVG A;  4IUR A;  2RI3 A;  3VYG A;  4OGC A;  4C92 G;  3A5Z B;  4ZGJ B;  3CCU A;  5HK0 A;  3OYK A;  2V8I A;  4TVR A;  5LJ5 d;  4HA8 A;  4C0Z A;  5CKD A;  4HCB A;  4C8Q G;  3HHT B;  1S72 A;  2VGM A;  2WSE E;  1VQK A;  5A0L A;  3OB9 A;  5DLQ E;  4IUP A;  5GMK l;  2EFI A;  2H3J A;  3I56 A;  1QVF S;  4ME7 A;  3A8L B;  4GLK A;  3KBG A;  2DKG A;  4M78 A;  3OYG A;  1KD1 C;  5FRM A;  2R57 A;  3GIB A;  2EJ9 A;  4J8O A;  1VIE A;  3DKM A;  2FVU A;  3BDL A;  2RJD A;  3LYI A;  5CR2 A;  1M8V A;  1Y07 A;  2ZPG B;  3CPF A;  2QQ9 A;  4R55 A;  3LGL A;  5CKB A;  3CPW A;  1VQK T;  3LW5 E;  4R56 A;  5C6S A;  1BIA A;  1Q82 C;  3N5B B;  4M77 D;  1YJW T;  3OY9 A;  1K8A C;  4HT8 A;  4XTU A;  5GMK e;  5FU7 B;  1VQ9 T;  4A4K A;  3QO3 A;  4DOV A;  4LDV A;  2WAC A;  1OZ2 A;  3QYH B;  5A0D A;  4XAX B;  1LNX A;  4J5Y A;  3GLX A;  5GAN g;  2RHI A;  4M75 F;  4M75 B;  1WQW A;  2XDD A;  2RI5 A;  4M75 C;  3MP1 A;  3MP8 A;  2XDP A;  3M55 A;  4C92 A;  3AHU A;  3MEA A;  5GAN 7;  4Y28 E;  4RCC A;  2QQB A;  1H3Z A;  1RL2 A;  3JCM f;  3OYI A;  3X24 B;  3JRZ A;  3V7R A;  2G3R A;  1VQP T;  5A0G A;  3CCS T;  1I5L A;  2CZ0 B;  1WJS A;  3CCQ A;  1M90 C;  2Y4Y A;  2VXE A;  5GAN 5;  2RJF A;  1FXX A;  2LNV A;  3MO8 A;  2QQR A;  3QXE B;  3G4S T;  3NFC A;  1VQ7 T;  5GAM f;  5EG2 A;  2DK3 A;  4C8Q D;  4OGE A;  1YBY A;  3QUI A;  2VV5 A;  2DZC A;  4M7D C;  3OSV A;  2PVD B;  3UPU A;  1N9R A;  3DLM A;  5IAY A;  2DAQ A;  1VQ8 T;  1KQ2 A;  2RHU A;  3QDR B;  4M7D E;  2HNI A;  1TH7 A;  2GQV A;  3OYE A;  4JRK A;  5GAM g;  3CBO A;  4M75 A;  3RER A;  1BYM A;  3X20 B;  4C92 C;  3C12 A;  3ZBD A;  3SWN A;  4JRI A;  3QBY A;  4C0G A;  4OB0 B;  1KQS S;  5J3B A;  3S3O A;  2ZPF B;  3VU3 C;  4C8Q C;  1W2B A;  2F5K A;  2P0Q A;  4J6X A;  1YJN T;  2HAX A;  4BB7 A;  1QVF A;  2QQA A;  3TU4 K;  4O6J A;  1N8R U;  2ZPE B;  3X28 B;  1BI3 A;  2EQJ A;  2EWN A;  5KCH A;  4PJO G;  3OSS C;  1FX7 A;  4LDY A;  4XQ3 A;  4ZGE B;  2E10 A;  4M7D A;  1M1K U;  2MMP A;  4JRP A;  4QVD A;  1OZ3 A;  3HRT A;  4A4H A;  2YRV A;  2QEX A;  1VQP A;  4M78 F;  3JCM b;  3L1A A;  4BAC A;  2VGN A;  2KVQ G;  1MGQ A;  3CCL A;  5CCA A;  3HFN A;  2HQE A;  3G7Z A;  4BI3 A;  4OB2 B;  2QA4 T;  1OI1 A;  3SWN C;  4OP0 A;  3JCM e;  5LJ3 g;  3T9N A;  3KXT A;  4DOW A;  3CXC S;  2L8D A;  3DB3 A;  1O9S A;  4BI4 A;  2CS7 A;  2Y4X A;  4MDX A;  2HQX A;  2XHC A;  5CKH A;  1W2B S;  4RG2 A;  3FJP A;  2DVE A;  2K5I A;  2FHD A;  4M75 G;  2PVG B;  1O75 A;  1VUB A;  2YHT A;  4HKE A;  3OYM A;  1YJW A;  2K3Y A;  1AHJ B;  2JNG A;  4EMK A;  5LJ5 e;  3MCA B;  4X9C A;  2BKD N;  3V8J A;  2ZPB B;  4YTL A;  5J39 A;  1VQM T;  2P4T A;  1NPP A;  4M78 B;  5GAN h;  2GCX A;  3CCR T;  2PUO B;  2RHZ A;  3ER0 A;  1YI2 T;  4M77 F;  5GAO p;  4V2S A;  5LJ3 e;  5KH6 A;  1VQ7 A;  2ZZD A;  3LWH A;  3OYY A;  1SSF A;  3BDU A;  3EFS A;  2EQK A;  3E9F A;  4FSX A;  2RI2 A;  1P92 A;  2DTH A;  1NE8 A;  4J83 A;  5FLX E;  1Q81 C;  4PKC C;  3A8H B;  2OTL T;  2DEQ A;  4M7D G;  5CVI A;  4RCB A;  5L8R E;  1WPY A;  3CC2 A;  5CKF A;  5LJ5 f;  1S72 T;  2HBP A;  4GY5 A;  3OA6 A;  4PJO D;  4NS5 A;  1IZ6 A;  4OF1 A;  1ZBX A;  1WJQ A;  3CC7 A;  1ZQ1 A;  2E70 A;  4XK8 E;  1XOV A;  3OS0 A;  3CC4 A;  2LTO A;  4DQ2 A;  2R5A A;  1X6O A;  2O4X B;  3S3M A;  4KUD K;  1YIT T;  1KC8 C;  4BE1 A;  2DXC A;  5GAM h;  3FC3 A;  1VQ4 A;  4HCZ A;  2EAY A;  3TCJ A;  4BDY A;  2FB7 A;  3JB9 I;  4M7A C;  2D0Q B;  4QVZ A;  4PJO C;  3H6Z A;  3GF5 A;  3RMS A;  1V29 B;  4M7A B;  4M7A F;  3C4S A;  3OYH A;  5HKC A;  2ZGW A;  2CGH A;  3PGG A;  3R6O A;  3WXM B;  3L2R A;  2QTX A;  3LWI A;  2FL7 A;  3CCM T;  3ASK A;  3VKI A;  3M4G A;  2DIQ A;  5FU7 C;  3CBP A;  2RD1 A;  3M59 A;  2XDB A;  3CD6 T;  1PSE A;  4XTV A;  1UEB A;  4C8Q F;  2KDS A;  3OW2 A;  3LH0 A;  3QZ9 B;  5C0M A;  4C0D C;  2HD0 A;  1VQ4 T;  5GAO n;  4FU6 A;  2M0O A;  1VQ5 A;  2EQU A;  3Q1J A;  3PT9 A;  4EMK B;  1YIT A;  1YIJ T;  3ZFJ A;  4JJN K;  3FB9 A;  3HKS A;  3JCM d;  3OMC A;  4A4E A;  1Q86 U;  4HCC A;  2DTO A;  2DIG A;  5GAO l;  5CO7 A;  2X4J A;  5D6W A;  3V7S A;  5J26 A;  5LJ3 h;  1IRE B;  2E1H A;  3PIP A;  3SB2 A;  1Q86 C;  4M7A E;  3URG A;  4MZM A;  3LLR A;  1B34 A;  2YLC A;  1YIJ A;  2X4Y A;  5IN1 A;  4M77 C;  3V7C A;  1OYX A;  1VQ8 A;  4M7D F;  4BUG A;  4E7K A;  4M77 B;  3TEE A;  2IVW A;  4M78 G;  3OS2 A;  2L5Q A;  2LQ8 A;  2DO3 A;  2EIF A;  2D6F A;  4C5G A;  2QA4 A;  2X35 A;  3QII A;  3JCM Q;  4NL3 A;  2JVV A;  2RK2 A;  5FRN A;  4MDW A;  4N4G A;  4D6W A;  3G4S A;  3CCL T;  3CCE T;  2RA2 A;  3M4Y A;  4L6V 5;  2AHJ B;  4EMG A;  2JTF A;  5LJ5 j;  2DXU A;  3C95 A;  1PSF A;  1Y96 A;  1Y7X A;  4FT4 A;  4MML A;  5FRO A;  3UWN A;  4C92 B;  1RI0 A;  1I8F A;  4QQ6 A;  5D6Y A;  4ZN1 A;  3J81 E;  2MAM A;  3OYB A;  2L3R A;  1VQM A;  5LL6 S;  2E12 A;  1LOJ A;  2DD5 A;  3SDZ A;  2L89 A;  4X9D A;  2P0K A;  4N0A C;  4QQD A;  5HK3 A;  1WJR A;  2QDY B;  2RM4 A;  4J7F A;  4P5N A;  1KC8 U;  2IG0 A;  4M7A D;  5GMK i;  3NTK A;  3FLG A;  4BI8 B;  1BKB A;  4M77 A;  1KQS A;  4ZN3 A;  1QP2 A;  2E6Z A;  3SD4 A;  5I2S A;  3CC4 T;  4E7H A;  3UT1 A;  3HSB A;  3CEY A;  1G3S A;  5GAM j;  5CQY A;  3P8D A;  5GAN 2;  3M53 A;  1VQO T;  5GAM e;  3OS5 A;  4IKF A;  5GAN 4;  3EFR A;  5GMK m;  3CC2 T;  5LJ3 j;  1BI2 A;  3JSC A;  1QP3 A;  3LX7 A;  3VYH B;  2GFA A;  3SWN B;  5GAN f;  5DLO A;  3G71 A;  2DTI A;  2QQS A;  3G6E A;  1Q81 U;  1VQ6 A;  2MI6 A;  3I55 T;  3CCE A;  3C94 A;  5HY6 A;  2B8A A;  4N0A A;  2M16 A;  3JB9 G;  1BI0 A;  1X01 A;  4MMK A;  3CMA T;  3MEW A;  3A8O B;  5AYF A;  1N27 A;  3CCR A;  3I56 T;  2LT1 A;  2LQK A;  2LC4 A;  2VC8 A;  3UDC A;  3OBW A;  4B9W A;  5GAN e;  4XU3 A;  2XU8 A;  2XK0 A;  1UGP B;  4J6Y A;  5GAN 6;  4PNO A;  4VUB A;  3GNF B;  4PLI A;  4M7D D;  4XU1 A;  1K9M C;  3OMG A;  3A8G B;  4X34 A;  4ZGD B;  3CBM A;  2E5Q A;  5GMK j;  3OYA A;  2KMT A;  2BIV A;  3FEO A;  2JN0 A;  3NTH A;  1G3T A;  4M7D B;  4JDS A;  3MHX A;  1XQH A;  2D9T A;  3NTI A;  5CIU A;  3OW2 S;  3JB9 J;  2KSS A;  1YJ9 T;  4PJO F;  4CRI A;  2MF2 A;  4FT2 A;  2K4Y A;  1EIF A;  3J7A F;  2M1H A;  3RIR A;  2OTJ T;  3V8L A;  4E47 A;  2E6N A;  3CPW S;  1Q7Y U;  1VQN T;  5GAN j;  3FIF A;  2XD0 A;  1QW1 A;  4C8Q A;  1H64 1;  3JCM X;  4MZT A;  4JS4 A;  2QEX T;  1KQ1 A;  4E7I A;  3P8B B;  4FIB A;  3VUB A;  4A4F A;  3L2U A;  3QYG B;  2LVM A;  3X25 B;  3GP8 A;  4LDX A;  5KE3 A;  3FRN A;  5GMK h;  5FU6 B;  1YCY A;  2JUF A;  3OQ5 A;  2EJG A;  2JZ2 A;  4C0D B;  3JB9 F;  2V8K A;  2E64 A;  3EAE A;  4PLL A;  3I55 A;  3OYL A;  3CCM A;  1R8O B;  2DJZ A;  1MHN A;  1JBM A;  3G71 T;  1UGS B;  1NJI C;  4IUU A;  4ELZ C;  3P8H A;  4EMH A;  1M4Z A;  1U1T A;  2DD4 A;  4F7U B;  4A53 A;  4M75 E;  4UC4 A;  3X26 B;  4N4I A;  3FDR A;  2XI9 A;  1KHC A;  4QW2 A;  5GAN 3;  2K57 A;  2E41 A;  3RES A;  5KE2 A;  2CZ1 B;  3GPL A;  4C8Q E;  1HK9 A;  2ZPI B;  2DXB A;  4CI0 C;  5DY9 A;  4Q5W A;  3CME A;  3RMQ A;  2LRQ A;  4KT0 E;  4OB3 B;  4C5I A;  5IT9 E;  3A8M B;  1X75 C;  3HP9 A;  3MEV A;  1NZ9 A;  2VYT A;  4WF2 A;  3JCM c;  2K5L A;  3L2W A;  2RHY A;  2YLB A;  3M58 A;  1VQ5 T;  1GXI E;  3F70 A;  2I2L A;  3DLL A;  4RG8 A;  5LJ5 h;  4EMK C;  3CCJ A;  3G6E T;  2QI2 A;  3PMT A;  3CCQ T;  4NOY A;  2MWP A;  2KY9 A;  3RKY A;  1D3B B;  3RKX A;  3CCS A;  4FL6 A;  4F7U E;  4Y91 A;  2DPP B;  4EPC A;  1VQN A;  3JB9 H;  3M5A A;  4LD6 A;  3JAM E;  4QVC A;  3PMI A;  2OTJ A;  1U8R A;  4L59 A;  1VQO A;  4KBM B;  5CKE A;  1M5Q 1;  3HL8 A;  5A2Q E;  3BFM A;  4C8Q B;  3CCU T;  3JCM J;  1VIF A;  3ME9 A;  1DJ7 B;  3OS1 A;  3BY7 A;  1YJ9 A;  2ZPH B;  3VV0 A;  3CCV A;  3RKW A;  2DZ9 A;  3SFM A;  2PQW A;  4N4H A;  5M9O A;  1JJ2 A;  2EKO A;  2CZ6 B;  1NPR A;  5GAO m;  5CAI A;  4C92 D;  4FM4 B;  1K73 C;  3HFO A;  3WVE B;  1VQ9 A;  1WGS A;  3JCM g;  2Y90 A;  2JOY A;  4XTZ A;  5GAM d;  3JB9 D;  2RJC A;  1Q82 U;  3CC7 T;  4J7I A;  3L2Z A;  3QZ5 B;  3S3N A;  1M1F A;  2MWO A;  2GFU A;  5LJ3 d;  2KK4 A;  1G3Y A;  2CZ7 B;  2GF7 A;  3CMA A;  2KAF A;  3E1S A;  2OTL A;  1QVP A;  2VXF A;  3VJP A;  1ZHI A;  3CXC A;  4PJO A;  2O01 E;  3VUZ A;  1KD1 U;  1VQL T;  3M56 A;  1YHQ T;  1M1G A;  3CD6 A;  1N9S A;  2R5M A;  1UGQ B;  3E9G A;  4XU2 A;  1YI2 A;  2R58 A;  2FYK A;  2PVO B;  2M9U A;  5LJ3 f;  2F69 A;  2RK1 A;  3WVD B;  4C92 F;  1W4S A;  2KQW A;  3INZ A;  4LDW A;  5GAN 8;  2C06 A;  2F5T X;  2K2V A;  3PIO A;  4F7U G;  4O5V A;  4C5E A;  4M7A G;  3O8V A;  2A3L A;  3RUX A;  1UGR B;  5GAO q;  1JRI A;  1K73 U;  2DXT A;  5CK9 A;  3HRU A;  3PNW C;  1JJ2 S;  3GNG A;  3HRS A;  1Y71 A;  3LGF A;  3OYJ A;  2VUB A;  4DA4 A;  4HT9 A;  3KUF A;  1KG1 A;  4M78 E;  1G3W A;  3MP6 A;  2CKK A;  3GOX A;  3CCV T;  4PJO E;  1I4K 1;  2O4X A;  3M57 A;  2XKO C;  2OAU A;  3QG1 A;  4EDU A;  4XTW A;  2EJF A;  4JLI A;  1JB0 E;  3OYN A;  2K5F A;  2EYQ A;  4B9X A;  4ELY C;  2RO0 A;  4E7J A;  2XID A;  4BD3 A;  3J80 E;  1KHI A;  4BY6 B;  3QPH A;  4JUV A;  2BUD A;  1U1S A;  3QJ6 A;  3H8Z A;  4XTY A;  4BY6 C;  1M1K C;  4KUI A;  1UB4 A;  4IUT A;  4L5G A;  1VQL A;  2LCC A;  3OYC A;  5LJ5 g;  2LCL A;  1WQ7 A;  4C0F A;  1WNL A;  2X4W A;  4II1 A;  3QSU A;  3JCM V;  1D3B A;  2WSF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...