4EMKB

Crystal structure of splsm5/6/7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MDSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYVSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emkB00
4M7AA 4JUVA 4N0AC 2DZ9A 4XU1A 4F7UF 3JCMg 4EMKC 1Y96B 3PGGA 3INZA 5GMKe 3HSBA 5GAN5 4XU2A 4C8QD 4M7AC 2RM4A 3JCMJ 1Y96A 3EFSA 2EJ9A 2EJFA 5GAN7 4JLIA 4MMKA 3JCMP 3JB9J 1I81A 4J6YA 5GMKj 3V8LA 2RB6A 4M7AG 4XTUA 4XTWA 3BW1A 3FIFA 3SWNB 2DVEA 1WQ7A 4M75E 3RESA 4PJOE 4M77E 1M8VA 3SWNA 5GAN8 1U1TA 5GMKm 3QSUA 2EAYA 2E41A 4M77B 4HA8A 4XTZA 5GAMg 2E1HA 2DXUA 2ZGWA 3SWNC 5GAMd 3JCMQ 4M77A 5LJ3f 3RERA 4M7AD 2DZCA 3QO3A 4C92E 1U1SA 1LJOA 5LJ5h 4M7AF 4M77C 5GANf 4NOYA 4C92B 5GANe 3JCMd 1WPYA 4NL3A 4HT8A 4M78E 2RA2A 2DTIA 1B34B 3JB9H 3JCMb 5GAMh 4C92A 1LOJA 1I8FA 1LNXA 5LJ3j 2QTXA 4C8QF 1B34A 4M75G 5GAOr 4PJOG 4M77G 1M5Q1 4J5YA 3VU3C 4C92C 5GAN2 3JCMh 5LJ5f 5LJ5e 5GANj 1I5LA 3V8JA 4XTXA 2DEQA 2EWNA 2JN0A 3V8KA 2HNIA 3FJPA 4QVDA 2FB7A 2RD1A 4NL2A 2YLCA 4M75B 4XTYA 3JB9D 4PJOB 4C92G 4JRKA 3GIBA 4M77D 1X01A 4A53A 5LJ3g 1JBMA 4M75A 5LJ5j 4M7DE 4PJOA 5LJ3d 3SB2A 3JCMc 4M78G 4QVCA 3BFMA 5GMKl 5GAN4 3RKWA 4M77F 4M7DB 2DJZA 4M75C 5GANg 4PJOC 3BY7A 4PJOD 4M7DA 5DY9A 4C92D 1TH7A 1KQ2A 3JB9I 1WNLA 1H641 3JCMW 2DTHA 4M78B 4M7DC 1JRIA 4EMHA 3V7RA 4C92F 5GAOm 1N9RA 4J6XA 3JB9G 4M78A 3JCMX 3RUXA 5GMKh 4F7UE 2VXEA 3RIRA 3V7CA 4EMGA 2Y90A 3QUIA 4F7UB 5GAN3 4M78C 5GAOn 4M7DG 3HFOA 5GAMf 1YCYA 5GAMe 4A54A 4JRIA 1D3BB 2DTOA 4F7UA 4M75D 4C8QE 5I21A 1N9SA 1BIBA 3RKYA 5GMKi 1BIAA 4J6WA 2E65A 3RKXA 1D3BA 4HT9A 4RCBA 4OP0A 4C8QB 3JCMf 3BDUA 4DQ2A 4X9DA 4XU0A 3JCMe 4M75F 2K57A 4PJOF 3JB9F 2CGHA 3V7SA 4M7DD 4XU3A 4C8QA 5GAMj 2DXTA 5GANd 2E64A 1HK9A 2EJGA 3L2ZA 2YLBA 2DKGA 2VXFA 3FB9A 4C8QC 4F7UG 4MMLA 1KQ1A 5LJ3h 1HXDA 4M7DF 2E10A 3L1AA 4M78D 4WF2A 3JCMV 3EFRA 5LJ5g 3AHUA 1I4K1 1WQWA 4Y91A 5GANh 5LJ5d 3HFNA 4M7AE 1MGQA 4EMKB 4M78F 4C8QG 4X9CA 5CAIA 2FYKA 4XQ3A 5GAOl 3M4GA 3QHSA 4N0AA 4M7AB 4V2SA 4EMKA 2YHTA 4XTVA 4PNOA 4RCCA 5LJ3e 5GAOp 5GAN6 2VC8A 2I2LA 5GAOq
chains in the Genus database with same CATH superfamily
4F7UF 3NGPA 2QYZA 1V1CA 4F17A 2YXYA 1KD1R 2RQWA 4KUDK 2IPOB 1ZSGA 2JW4A 4QQGA 1WQ7A 4C0GA 1K4US 1U1TA 3OSSC 2ROLA 4HA8A 2MK5A 4JJNK 1YI2Q 3RERA 3JV3A 1XTDA 3M0RA 5LJ5h 5IH2A 2E6ZA 2EGCA 4D8KA 2QGFB 2KAFA 1UEBA 1I1JA 2DTIA 4BI8B 3G4SQ 1LOJA 1Q81C 2CZ6B 3X26B 2XI9A 4BY6C 2BTTA 4KH0B 1T0HA 2DBKA 5J3BA 1OU9A 3PTAA 3KBGA 3OS5A 4BDYA 1YJWT 2C0IA 2P84A 2B8AA 5ECAA 1S72Q 1VQ8A 4HCZA 3M9QA 5LL6S 4C92F 5CQYA 2MMPA 4MZPA 4M78A 3MEWA 5D6XA 3MEAA 2M51A 4E7JA 2DYBA 2V1RA 5D6WA 4PLLA 4LE9A 4ZTJA 4C5GA 3CCQQ 3WVEB 3CC7T 1TUCA 1VIEA 3CCUQ 4KGZB 3OYIA 3M54A 4XU3A 4CC4B 1G3TA 2EQUA 1HK9A 3L2ZA 3ER0A 1TS9A 1V29B 1Q82R 3ULRB 1PRLC 4F7UG 2HCKA 2HKQB 2K4YA 2CZ1B 3E9GA 4L5GA 1WQWA 3UA7A 1I0CA 1NM7A 2FYKA 2KNBB 2BE9B 1YJ9T 1TG0A 3CXCP 1B7TA 4EMKC 1WYXA 1T3LA 4CRIA 4FL6A 5IHIA 2C0TA 1WIEA 3I9QA 2RB6A 1D09B 3VRZA 3OYEA 3GOXA 3SWNB 4R55A 3TU4K 4M77E 2VGMA 1OOTA 5GAN8 2RO0A 2L2PA 3MPUB 3OYMA 4J7FA 1AT1B 4OMQA 2D9TA 4QW2A 1D1CA 3EFOA 3JCMQ 2X4YA 2E70A 4A4EA 1QVPA 2L5QA 2VWFA 1N6AA 4Y92A 3CMAQ 2CYZB 2QEXA 2OTLA 1LPLA 3R6NA 3EAEA 2RHIA 1AEYA 1J3TA 1G2BA 3M5AA 3GNGA 3CXCA 1RACB 3VU3C 5GAN2 2QAZA 4J5YA 3EG0A 4LD6A 1QP2A 4DA4A 3KUFA 3URGA 2RD1A 4PJOB 4C92G 2KT8A 4C0ZA 1VQPA 3C95A 2KBTA 4BACA 3MCAB 4M4ZA 1VYTA 1NEGA 8ATCB 2KROA 1Q86C 1W1FA 4LDVA 4JS5A 1QVFS 1TWBA 4C92D 3I55Q 2YUOA 3S3OA 3MP8A 3CC2A 1BB9A 1R8OB 3NFCA 3RUXA 1HSQA 1H8KA 2PZ1A 4F7UA 1JO8A 4IUVA 2RN8A 2HQEA 3LH0A 1YITQ 4CC2A 2CGHA 2MWPA 3G6ET 3BDLA 5HY6A 1RABB 2YLBA 1ZSZC 4C0FA 4DBRA 2O01E 5LJ5g 2K5FA 4C8QG 1PWTA 3A8HB 4N0AA 3VV0A 1Y07A 2VYTA 4Z88A 2ZPGB 4OMOA 2GQIA 3E2UA 6AT1B 1N8RR 5GAN5 4C8QD 1ZBXA 3OA6A 1VQ8Q 3VS0A 1YJNQ 3J81E 3FJ5A 4J6YA 1JU5C 2KDSA 3MP1A 4EDUA 3TQ7P 2ZAEA 1AWJA 2EAYA 3CPFA 3FEOA 1G8XA 2DXUA 5GAMd 1W2BA 5LJ3f 3ZEHA 4AFQC 2MOXA 1K8AR 1WI7A 3UPUA 2CREA 5KH6A 5DLOA 4NOYA 3NTHA 1U06A 3RMSA 4C92A 1I8FA 4JLGA 1YJWA 3CCJA 3L42A 3A1PA 5FLXE 3OW2P 2DMOA 4ESRA 1M90R 4BI4A 4FT2A 1UJ0A 4M7DE 1K9MU 1KHCA 2LQNA 3RKWA 3EG3A 3M0UA 4MDWA 1KC8C 5CQXA 4Z8AA 1QKWA 4RTXA 3OYYA 3OSVA 3V7RA 2KK4A 3CCMT 1VQ9Q 1IGQA 4PFOA 1AZGB 1TU0B 1EZZB 1NPPA 3FC3A 1X6BA 5CIUA 5GAMf 3RMQA 1D3BB 4E6RA 3QBYA 1X6OA 4IUTA 1VA7A 2K57A 3S6WA 4C8QA 5DM7R 2DD5A 2XKOC 4R0KA 3I56A 2HQXA 1WJQA 3PMTA 3SFMA 3FB9A 4PJMA 3UT1A 3J7AF 3H0HA 1KG1A 3EHQA 3QG1A 1GBQA 2VUBA 3LYIA 8AT1B 2F69A 1WXUA 3QHSA 1M27C 2BUDA 4QVCA 1WXTA 1SRMA 1VQPQ 1WGSA 3M4YA 4BDZA 4BI3A 2EYXA 4XU2A 2JXBA 1CKBA 3EFSA 2IVWA 4RTWA 4DEXA 5GJWB 4FW1A 1QQJA 4E47A 4M75E 3RESA 2L3QA 3LGLA 4J9FA 1GRIA 4M77B 4N4IA 1RAEB 3EHRA 3META 3ZFJA 2RK2A 3OYGA 3GLXA 1B34B 3OB9A 3QWXX 4HXJA 2FO0A 1QVFP 1ABOA 5GANj 2DEQA 3VRYA 4AMCA 2HSPA 1WLPB 4OMMA 2QG9B 5GAN4 2DPPB 1VQKA 1SPKA 1LVKA 3OYNA 2M1HA 2RHYA 1FWZA 4RTUA 2NUTA 2DIGA 1LCKA 4JZ3A 2KVQG 3G6EA 2HL3A 4R56A 4RTTA 1AHJB 1RI9A 3AT1B 3RBBB 1VQ7A 5I21A 4WTOB 1TXQA 3CCVA 1X43A 3VS4A 4DQ2A 1Y71A 1FXXA 4M75F 1MMAA 2VXFA 3VS1A 3X28B 1HXDA 1OX9A 3C0CA 1YJWQ 1I4K1 5CKBA 1Z9QA 4KULA 3CPWP 1RAGB 3FRNA 1K73U 4FU6A 3PMIA 2GNCA 2VC8A 4F14A 4JUVA 1G83A 2XG8D 1FYNA 3VS6A 2QA4A 2QQAA 3QJYA 2VASA 4L59A 1WHGA 4PFZA 5L8RE 2RM4A 2HZYA 5GAN7 3T9NA 1MUZA 1UHCA 2Z0WA 1U3OA 3OBYA 3Q1JA 5GMKj 1NYFA 5HCKA 3CC7Q 1M8VA 2CUBA 4FCYA 2NLUA 1W6XA 1OPKA 5CKHA 2G6FX 3SWNC 1WX6A 1I5OB 2DRMA 2WSCE 3UATA 1U1SA 4M7AF 1QWEA 5KYXB 1QVGS 3FLGA 2L3PA 1YJ9Q 3H0IA 1X2KA 2XD0A 2XU8A 1VIFA 2CT4A 2K3BA 2HNIA 1T3SA 4QVDA 1KD1C 3CCEA 1YIJA 5AT1B 5LJ5j 3CCMA 4M7DB 2FPEA 4PJOC 3C4SA 1M3AA 2KXCA 3ZL7C 2DAQA 1A0NB 1BI3A 3F70A 4F7UE 1O75A 3EGXB 2QEXT 2OTLT 5GAOn 2JZ2A 2EYZA 2JTFA 4M75D 2FHDA 4IKFA 1BIAA 2DL7A 2CSIA 1GFDA 1QWFA 3TCJA 2LT1A 1JB0E 2DXTA 1TOVA 1T0JA 2QTVA 4IUQA 1YHQT 4C0DC 2RNAA 4GY5A 2LCLA 5KE2A 1RI0A 3QDFA 4RUGA 3AHUA 3M0PA 1MGQA 1NJIR 4XQ3A 5GAOl 5AYFA 1VUBA 2L8DA 4XTVA 5FROA 3L2WA 2I2LA 2CDTA 4CC7A 2DZ9A 4XU1A 4FYVB 4EIKA 1XNIA 3CC2T 2FZGB 2CP0A 4OMLA 1X2QA 1WHKA 4E7LA 1VYVA 1WJRA 2KSSA 4M7AG 2A0FB 2R5AA 2CZ0B 1Q82C 2CP2A 5KE3A 5CR2A 1Q95G 3G6EQ 2R57A 2DXBA 3DLMA 1VQ5A 5GAMg 4K11A 4J7IA 4M7AD 4JJDA 1M1FA 4C92E 2LJ0A 1SKUB 4DOWA 1GXIE 1VQNA 2E5QA 2IG0A 1AOJA 2HAXA 2DIQA 2FRYA 2GCXA 2KE9A 3NHNA 4NS5A 4XTXA 2KXDA 2NWMA 3A8MB 3OMCA 4JJCA 5KYNA 4J8OA 3REAB 2YLCA 4XTYA 4LDWA 4ZN3A 4M75A 1SHGA 1MMNA 5I22A 2D8JA 2J05A 4ANJA 2ENMA 4M78B 1VQ6A 1N9RA 2HDAA 4LUEA 3C12A 3X24B 3MHXA 2NUPA 1YCYA 4BD3A 2DYIA 4C8QE 3RKYA 1U8RA 4J6WA 1IXDA 2DE0X 1Y57A 3CCJT 3I35A 4TVRA 2EGAA 2QGGA 2ABLA 1OZ2A 5C6SA 2E64A 4Z89A 1PD0A 1CSKA 3OW2S 1KIKA 2LJ3A 2EVRA 2LNVA 2X3WD 4LNPA 2AIRB 2YDLA 3M58A 2COWA 3HRTA 2A36A 3M4GA 2EKOA 3EGDB 4PL6A 3M0QA 4HVWA 4J6XA 2OAUA 2O9VA 4M7AA 3CCMQ 1R0CB 1PNJA 2JMAA 4IIOA 3I5RA 2JTMA 3CCST 1ZX6A 3OYDA 2DETA 4FYYB 4FT4A 3OS2A 2V8JA 2D6FA 2NYSA 2E6NA 2L3SA 5FWCA 1QVGP 1QKXA 3EFOB 3BE3A 2E1HA 3I56T 1M2VA 1UGVA 4J9BA 1NZ9A 3EGDA 4M77C 4NL3A 1C1AA 1QCFA 2H3JA 1K9AA 2CSQA 2FZKB 3JB9H 2EQMA 1N8RC 2H3EB 4MZTA 5D7UA 4C8QF 1MHNA 4PJOG 2GGRA 5FU6B 2FEIA 2LNHB 1BKBA 2JM8A 2JM9A 2YRVA 3OYBA 4D6WA 2O88A 2DL4A 2DFUA 1K8AC 1NEBA 1PRMC 5GAOm 1KQSP 2M0OA 4LDYA 3JCMX 1UGSB 3QYGB 2YSQA 3C94A 2IIMA 2Y90A 4F7UB 1YHQA 4JRIA 1WHHA 4N4GA 1N9SA 3OYFA 3SEMA 5CK9A 3A8OB 1QMCA 1M90C 2F2WA 4XU0A 4X34A 4MZMA 1DJ7B 3DLLA 1OU8A 2FZCB 1Q81U 2ZPEB 2GBQA 2RQRA 2DD4A 2PNIA 2B86A 2JUFA 3LWHA 4X9CA 3TVTA 2FVUA 3GP8A 1VQKT 2JS2A 5LJ3e 4KGVB 2A28A 3PFSA 3CEYA 4JPBW 3PGGA 2CP3A 3QPHA 1D0XA 2D1XA 4OB3B 1IGUA 2RJDA 1VQ7T 1M1GA 1B07A 1SRLA 3CCVT 1SEMA 2ESWA 2RQTA 2LVMA 4A4GA 3QSUA 4A63B 4LDXA 3PIPA 3H0FA 5EG2A 4JRPA 3CD6A 1YFNA 3QJ6A 4C92B 1LNXA 5LJ3j 2RMOA 2QQ9A 1QCNA 3CPWS 2CZ7B 4FYWB 2QA4T 5IHNA 4J9CA 1V76A 1RUWA 2O9SA 2L0AA 2KRMA 3JRZA 3GIBA 4A53A 3MO8A 1ZQ1A 3LH5A 2QASA 2DO3A 2LX7A 2RI3A 1TTHB 1ARKA 5FU7B 1RL2A 2V8KA 1MNDA 5A0LA 1IO6A 4M7DC 1JRIA 1M8MA 2BZYA 3CBMA 3M0TA 4AFUC 2O4XB 5KYWA 1Y7XA 3V7CA 4AG1C 3N5BB 1Y0MA 4GLKA 3A8LB 2P0KA 1K9MR 4A54A 1IB8A 2NUZA 2OAWA 1ZUKA 4C8QB 3JCMe 2LQWA 3JB9F 4UC4A 3V7SA 5GAMj 4B9WA 1KSWA 3CCET 1WFWA 1YIJT 4BE0A 2LQKA 2W10A 3HTRA 2A7YA 3TREA 3CCSA 1H92A 2O4XA 4J9DA 3GNFB 5D6YA 3CQTA 5GAN6 1XOVA 2GFUA 2X4XA 3QYHB 3OW2A 1K1ZA 1Q86U 2VB6A 3LWIA 2QEXQ 2OTLQ 3M57A 3M59A 1SF9A 3ME9A 4MMKA 2MWOA 1M3CA 3KXTA 1P92A 4XTWA 3CMEA 4D8DA 2AZVA 2DLPA 5KYYA 4RG2A 2R58A 2DA9A 2ZZDA 1YHQQ 4E7KA 2K3XA 3TSWA 1BI0A 4ORZA 4QVZA 2K3YA 1LJOA 2CKKA 5GANe 1BCOA 2GF7A 2VKNA 3UDCA 4OB0B 1JQQA 1N5ZA 4B6MA 2K7AA 2O31A 2HEQA 2JN0A 4JZ4A 1VQ4A 2LJ1A 2X35A 2PVOB 4QKUA 3CC2Q 4NL2A 4LD9K 3RR6A 1X75C 3S3MA 5CO7A 2M9UA 1X01A 2F2VA 3H41A 3P8BB 1M2OA 2BKDN 2K2VA 4L6V5 3BFMA 3OYKA 2ZPHB 3VS2A 3QZ9B 2D8HA 5DY9A 2D0QB 2NUTB 2HSEB 1PD1A 1TUGB 2XDDA 3M53A 1VQ5T 3CCRA 1UDLA 1EFNA 3JB9G 5KYUA 2QI2A 3P8DA 2LP5A 1H3ZA 3U23A 2OX7A 4M78C 2M0YA 1VQNT 1GFCA 3JB9D 3HRSA 3BDUA 2AHJB 2LMJA 2W0ZA 3OYCA 1W70A 2K79A 1K0SA 4HCKA 2ED0A 2SEMA 2HQHA 3MEUA 4E7IA 4M7AE 1F1BB 2FPFA 1EX4A 2PTKA 4EMKA 5GAOq 1N27A 4RCCA 5GAN3 2RH2A 2LRQA 1QVFA 2AKLA 5GMKe 1VQ6T 1NE8A 4P5NA 2JJ9A 1Y96A 1KC8U 1YCSB 3G71A 1ZHIA 1SSHA 3JB9J 1I81A 4IUUA 1QP3A 4BB7A 2CP5A 5CKEA 3CCJQ 1M30A 4DBHA 2PU9B 4FSSA 5FW9A 3UA6A 4BE1A 4DOVA 3L2VA 2ATCB 2J6OA 2QQRA 2SRCA 3ASKA 1AWWA 1ZA2B 1NJIC 5CCAA 2BIVA 4F04B 2MYSA 3EG9B 4AFZC 4HT8A 4A4FA 3JCMb 2EYWA 3VS3A 2QTXA 1Q7YC 1M1KC 3JCMh 5LJ5e 2EGEA 1XJWB 3CBPA 1BYMA 3RNJA 2COZA 2KYBA 3O5ZA 5EC7A 3CCSQ 1GCPA 1OEBA 5CVIA 2M02A 3L2RA 1UFFA 3G4SA 1UGQB 3PVQA 3S3NA 1BI1A 3CPWA 4DBFA 4ZNXA 2RJCA 1AZEA 3EG9A 1IRXA 1I07A 1BK2A 3M55A 3I56Q 1UG1A 1S1NA 2EKHA 3OYJA 4J9HA 1YWPA 2CP6A 2C0OA 2P0PA 5IN1A 1UE9A 4IUPA 2PUOB 4X1VA 1ZSZA 1IHWA 1M3BA 1NLPC 2ZPBB 2Y4XA 4ZN1A 4WF2A 2QDLA 3EFRA 4KGXB 2JT4A 1WA7A 4O5VA 5GANh 2K6DA 1AWOA 2RI5A 5CAIA 4KRTA 4A4HA 1VQ4Q 1ZA1B 4C5IA 5GAOp 3CCQA 2KYMA 2O2OA 3CCUA 4N0AC 3HSBA 3VUBA 1OULA 2HL5C 3JCMJ 2EJFA 4JLIA 5KCHA 1KQSS 3JCMP 2EQJA 3V8LA 3NTKA 1ACMB 4PJOE 1PKTA 4Q5WA 4MDXA 3QWYA 3OQ5A 1PG5B 3JAME 3IQLA 4JRQA 3NPFA 1X6GA 2XDPA 9ATCB 2X3XD 4ZGEB 3E9FA 2KEAA 2RA2A 1Q7YR 1M1KR 1VQKQ 1MMDA 5FWBA 1IZ6A 4HCCA 4PJNA 4C92C 2DL8A 3EG1A 2RHUA 5HK0A 1RLQC 4OB2B 2COYA 4OMPA 2CT3A 3FJPA 2DNUA 4J9GA 4M75B 3E1SA 3OYLA 3GPLA 3CMAA 3OMGA 2ZPFB 1VQ7Q 4M78G 4ZGJB 1UB4A 3CCVQ 3O8VA 2CS7A 4CC3A 2DERA 1WNLA 3CD6T 1X69A 5GMKh 3WVDB 2OTJT 2VXEA 4OF1A 2NUPB 4EMGA 4DBQA 1NPRA 4E2FB 1QLYA 2E5KA 3DKMA 3GBQA 2VV5A 3NTIA 1HD3A 5GMKi 4BUGA 2ROTA 1EIFA 2DM1A 4PJOF 1W2BS 4ZGDB 3I55A 2QA4Q 1B3QA 1NYGA 2DJQA 4C8QC 4MMLA 3VS5A 1JXMA 3L1AA 2P4RA 2G3RA 4KBMB 1WJSA 3HFNA 1KD1U 5FRMA 5A2QE 4A4KA 4OMFB 4M7AB 4ZTFA 3H9NA 4PNOA 3SD4A 1YITA 4OMNA 5IAYA 1R0BG 3VUZA 3D7SB 1UJYA 2AK5A 3JCMg 2QK0A 1G3SA 2F2XA 5IT9E 2AZSA 1IREB 2ZCFB 2EYYA 2YT6A 2D0NA 5C0MA 4JDSA 1PCXA 5CKFA 3FIFA 1KFZA 4C5HA 3PIOA 1SSFA 1M2VB 2ED1A 2L3RA 2RQUA 2QDYB 2WSFE 2X4JA 1G5VA 2BZXA 3CCEQ 1OPLA 1YIJQ 1YWOA 1AD5A 2GTOA 3X20B 1YJNA 3A5ZB 2RJFA 4C5EA 2J06A 1YN8A 1H3HA 2RJEA 3PVLA 1WZOA 1BCMA 4QQDA 4WCIA 2XK0A 2EYQA 1JBMA 3MEVA 1GCQC 1C0MA 2DJZA 5GANg 3CMET 3CC4T 1ABQA 1BBZA 1FMKA 3BY7A 7AT1B 5IHKA 3VYGA 2Y4YA 2JMCA 3EH2A 3JB9I 1K0XA 2EW3A 1OZ3A 1H641 1KHIA 5I11A 4EMHA 4II1A 2BE7D 4XK8E 1Q82U 3I5SA 4OVAA 1XQHA 3H8ZA 3NMZC 2DTOA 4PLIA 4PJOD 2QXFA 2JS0A 2LCCA 2EFIA 3THKA 2C06A 1QVGA 2GTJA 1VQ4T 1U5SA 2DRKA 2L89A 4OGCA 1D0YA 1ZLMA 1VQ9A 1E7OA 4QQ6A 4RTZA 2EIFA 1TUDA 4QT7A 1OQKA 3JCMV 3OBWA 3J80E 2LC4A 1VQMT 2MIOA 2FG0A 4V2SA 2EBPA 1TSFA 1VQ5Q 3VYHB 1ZUUA 4RTYA 3CCRT 1K9MC 1Q81R 1OX8A 2YRCA 1K76A 5A0DA 2H8HA 2HBWA 2P0QA 2KMTA 1VQNQ 5J39A 1BI2A 4CI0C 2DVEA 3X25B 3SWNA 2LQ8A 3PE0A 2JVVA 3CCLT 4XTZA 4IURA 2QQBA 1ZUYA 2DZCA 1KQSA 4PK4A 1SG5A 1AWXA 1QW1A 2PQWA 2YUPA 1UUEA 3QZ5B 1WPYA 4LXCA 2VVKA 2J6KA 3LW5E 3CBOA 3QIIA 1I5LA 4Y28E 2VGNA 1VQLT 1VQ6Q 2E4HA 1YBYA 3UWNA 2X51A 3E19A 3R6OA 5GJVB 1RADB 2DL5A 1PHTA 1PSFA 3G71T 3A8GB 4C0DB 4PJOA 5LJ3d 2OTJA 5GMKl 1FMVA 2MF2A 3REBB 4M77F 2FL7A 2K9GA 4GLMA 1VQOT 1GL5A 4OB1B 2E3IA 3M0SA 3RDVA 4RG8A 1X27A 3PNWC 3VKIA 2QQSA 1W2BP 5KYWB 2A37A 3G7ZA 1BU1A 2AKKA 3HFOA 2K5IA 5GAMe 4HKEA 2OI3A 4X9DA 1WHJA 1NBEB 3HRUA 4JJBA 3OY9A 2OJ2A 1N8RU 1IHVA 1YI2T 4PJJA 2CH4W 2E12A 1MNEA 2RK1A 4LUDA 1W4SA 1SHFA 3G4ST 2M16A 2LTOA 2RHZA 1G3WA 2XDBA 2KGTA 2XICA 2DK3A 5IXBA 2EJ9A 4F16A 1K8AU 1PC0A 1MV3A 3JSCA 5KYYB 4XTUA 1WHLA 3HL8A 3UF4A 1S72T 1PKSA 3QKJA 1GBRA 4GBQA 4XAXB 2RF0A 4FSXA 2CUDA 1QCOA 2ZGWA 1Q86R 1PM3A 1M90U 3QO3A 1JJ2S 4FW2A 1R77A 3JCMd 4BY6B 1WHMA 4YTLA 5GAOr 3CC7A 2XIDA 4M77G 3LGFA 3CCQT 2JOYA 2DEUA 3CCUT 3CC4A 2EWNA 1K73C 3MP6A 4M77D 2I0NA 3A98A 2DBMA 3JCMc 1RAFB 4FM4B 1YNZA 4M75C 3SDZA 2HKNA 1YJ9A 3DB3A 1KK7A 1KQ2A 3QDRB 5KYUB 2DTHA 1JEGA 1FX7A 1OV3A 5CKDA 1AVZC 5KCOA 2J7IA 3QUIA 1UGRB 5IXFA 4J83A 2DF6A 4ELYC 3ZBDA 3DB4A 2DL3A 1BIBA 3RKXA 1VYUA 1D3BA 2LCSA 3JCMf 2J6FA 4HVUA 1VQMA 5GANd 3EGUA 2RI2A 4M7DF 5LJ3h 1KQ1A 2KI7A 2CP7A 2E10A 2DILA 3CMAT 2MPXC 1C6VX 1UECA 4EMKB 2JTEA 5I2MA 2RPNA 2V1QA 2YHTA 3FDRA 4B9XA 3H6ZA 2CH4A 4DEYA 3CD6Q 1Y96B 2KRNA 2OTJQ 4EPCA 4M7AC 3CCLA 3TSZA 4E7SA 2LZ6B 2KY9A 5A0GA 2ECZA 1D0ZA 1WDXA 4HCBA 2KR3A 2PVGB 5J26A 3GF5A 5GMKm 4RKUE 2PVDB 2E41A 1GCQA 3I55T 4N4HA 4ATOA 4M77A 1KC8R 1D1BA 1M9SA 2JNGA 3WXMB 3HP9A 2WACA 1VQLA 5GANf 2P4TA 4M78E 1OYXA 3KFVA 5GAMh 1HJDA 1B34A 5L23A 2WSEE 2KQWA 1YITT 1WXBA 2F5TX 4O6JA 1VQOA 1K73R 3V8KA 3OYAA 5HKCA 3OS0A 3HKSA 2PUKB 3SHWA 3OYHA 2BZ8A 2LT4A 3SB2A 2FPDA 1E6HA 4KT0E 5M9OA 2HD0A 2YRDA 3M56A 2EPDA 4AFSC 1TH7A 2KT1A 2LX9A 3JCMW 4HVVA 3HHTB 2E3HA 2F5KA 4PJLA 2YWWA 3P8HA 4AT1B 4E7HA 3RIRA 5HK3A 3L2QA 4RTVA 2GFAA 4M7DG 1VQ8T 1RAIB 1YI2A 1YJNT 5FU6C 4HT9A 2RQVA 4RCBA 1G3YA 4OP0A 1ZSZB 2EQKA 4M7DD 1UGPB 1O9SA 2XHCA 1NG2A 3OS1A 1CKAA 1RAAB 3VJPA 4PKCC 4J9IA 1UTIA 5I2SA 5LJ5d 2ZPIB 5DLQE 1KJWA 4AG2C 3CMEQ 4M78F 2A08A 3CC4Q 3MKDA 3QXEB 4FIBA 2HMAA 2V26A 3EH1A 3INZA 1S72A 1MV0B 3HPWA 2X9HA 2YUQA 4J9EA 1JJ2P 3PT9A 4IIMA 1MMGA 2KRSA 2GQVA 3BW1A 3MJXA 1D1AA 2R5MA 3EG2A 4FYXB 3CXCS 1RLPC 4Z02A 2DX1A 3G1JA 1VQ9T 4VUBA 2MI6A 3L2UA 1VQMQ 4E7ZA 2RHXA 5KYXA 5FRNA 4KUIA 4M75G 1HYOA 1M5Q1 2MCNA 5LJ5f 2MAMA 3V8JA 3CCRQ 1FMWA 1JJ2A 2FB7A 2K5LA 1Z9ZA 2EQIA 4JRKA 2DXCA 2A3LA 5LJ3g 4OGEA 4RMOA 1M4ZA 1E6GA 2F1LA 4M7DA 4PFPA 1YP5A 3CCLQ 3LLRA 1VOMA 2YUNA 1VQPT 2DVJA 2AT1B 1ZBJA 2K2MA 4JS4A 3LX7A 1OI1A 4LN2A 1PSEA 4BE2A 3EGXA 4ELZC 1NJIU 4LDUA 2E65A 2V8IA 2FRWA 1VQLQ 2EJGA 1NLOC 2HBPA 3VS7A 2DKGA 4KH1B 3G71Q 2X4WA 1UHFA 1JXOA 2XMFA 1Q7YU 4M78D 1M1KU 4ME7A 3TEEA 5FU7C 2LDMA 4Y91A 1VQOQ 1RAHB
chains in the Genus database with same CATH topology
4JUVA 3VYHB 2GFUA 2X4XA 4F7UF 3CCRT 1K9MC 2XG8D 3QYHB 3OW2A 2QA4A 2QQAA 3QJYA 4L59A 5L8RE 1Q86U 2RM4A 3LWIA 3M57A 3M59A 5A0DA 5GAN7 3ME9A 4MMKA 2P0QA 2KMTA 3T9NA 5J39A 2MWOA 3KXTA 3OBYA 3Q1JA 5GMKj 4KUDK 1P92A 4XTWA 3CMEA 4QQGA 1BI2A 4CI0C 2DVEA 1WQ7A 4C0GA 3X25B 4RG2A 2R58A 1M8VA 3SWNA 1U1TA 2ZZDA 2LQ8A 3OSSC 2JVVA 3CCLT 4HA8A 4XTZA 4E7KA 2K3XA 2NLUA 5CKHA 4JJNK 1BI0A 3SWNC 4IURA 4QVZA 3RERA 2QQBA 2WSCE 1KQSA 2DZCA 1XTDA 2K3YA 1QW1A 1U1SA 2PQWA 1LJOA 5LJ5h 2CKKA 4M7AF 2E6ZA 5GANe 3QZ5B 1WPYA 2KAFA 1UEBA 2DTIA 2GF7A 4BI8B 1QVGS 1LOJA 3FLGA 1Q81C 2CZ6B 3UDCA 4OB0B 3X26B 2XD0A 3LW5E 2XU8A 3CBOA 2XI9A 3QIIA 1VIFA 4BY6C 1I5LA 4Y28E 2VGNA 2JN0A 1VQLT 1VQ4A 2X35A 2HNIA 2PVOB 1YBYA 5J3BA 3UWNA 4NL2A 4QVDA 1KD1C 3CCEA 1X75C 3S3MA 5CO7A 4LD9K 3PTAA 3E19A 2M9UA 3KBGA 3R6OA 1YIJA 1PSFA 1X01A 3G71T 3A8GB 3OS5A 3P8BB 4C0DB 5LJ5j 3CCMA 2BKDN 2K2VA 5LJ3d 4BDYA 1YJWT 4PJOA 2OTJA 2B8AA 4L6V5 5GMKl 3BFMA 2MF2A 4M7DB 4M77F 2FL7A 3OYKA 1VQOT 4OB1B 2ZPHB 4PJOC 3C4SA 3QZ9B 1VQ8A 4HCZA 5DY9A 4RG8A 2D0QB 2XDDA 2DAQA 3M9QA 3M53A 3PNWC 2QQSA 5LL6S 3VKIA 3CCRA 1VQ5T 4C92F 5CQYA 1BI3A 3JB9G 3F70A 2MMPA 4MZPA 4M78A 2QI2A 3MEWA 4F7UE 5D6XA 3P8DA 1O75A 3MEAA 1H3ZA 3G7ZA 2QEXT 2OTLT 5GAOn 4M78C 4E7JA 2JZ2A 3HFOA 1VQNT 2K5IA 5GAMe 4HKEA 2JTFA 4M75D 2FHDA 5D6WA 3HRSA 3JB9D 4IKFA 4PLLA 1BIAA 4ZTJA 4C5GA 3WVEB 3CC7T 3BDUA 3TCJA 2AHJB 1VIEA 4X9DA 2LT1A 3OYIA 1JB0E 3HRUA 3M54A 4XU3A 2DXTA 1G3TA 4IUQA 2EQUA 3OY9A 1HK9A 3L2ZA 3OYCA 1YHQT 1N8RU 4C0DC 4GY5A 3ER0A 1V29B 1YI2T 2LCLA 4F7UG 5KE2A 1RI0A 2K4YA 2E12A 2CZ1B 3E9GA 2RK1A 4L5GA 1W4SA 3AHUA 1WQWA 3MEUA 4E7IA 4M7AE 1MGQA 3G4ST 2M16A 2FYKA 4XQ3A 5GAOl 5AYFA 1VUBA 2LTOA 1YJ9T 2L8DA 2RHZA 4EMKA 4XTVA 1N27A 1G3WA 4RCCA 5FROA 5GAN3 5GAOq 2I2LA 2RH2A 3L2WA 2XDBA 2LRQA 1QVFA 2DZ9A 2XICA 4XU1A 4EMKC 2DK3A 5GMKe 1VQ6T 1XNIA 1NE8A 3CC2T 4P5NA 4CRIA 1Y96A 1KC8U 2EJ9A 1K8AU 3G71A 1ZHIA 4FL6A 3JSCA 3JB9J 1I81A 4E7LA 1WJRA 2KSSA 4IUUA 1QP3A 2RB6A 4M7AG 4XTUA 4BB7A 3OYEA 3GOXA 3SWNB 4R55A 3HL8A 5CKEA 2R5AA 2CZ0B 1S72T 3TU4K 4M77E 1Q82C 2VGMA 5KE3A 3QKJA 5GAN8 2RO0A 2PU9B 5CR2A 2R57A 4XAXB 2DXBA 3DLMA 3OYMA 5GAMg 4J7FA 4BE1A 4DOVA 1VQ5A 4FSXA 3L2VA 2ZGWA 4J7IA 2D9TA 2QQRA 3ASKA 4QW2A 3JCMQ 4M7AD 2X4YA 2E70A 5CCAA 1M1FA 1NJIC 3QO3A 1QVPA 2L5QA 4A4EA 2BIVA 4C92E 1M90U 1N6AA 1JJ2S 2CYZB 2QEXA 2OTLA 4HT8A 3EAEA 4DOWA 3JCMd 1GXIE 2RHIA 4BY6B 2E5QA 1VQNA 2IG0A 4A4FA 3JCMb 4YTLA 2QTXA 3M5AA 3GNGA 5GAOr 3CXCA 3CC7A 2HAXA 2XIDA 2DIQA 4M77G 3LGFA 4J5YA 2JOYA 3VU3C 2GCXA 5GAN2 3CCQT 1Q7YC 3JCMh 4NS5A 5LJ5e 3CCUT 1M1KC 3CC4A 4LD6A 4XTXA 2EWNA 3A8MB 1QP2A 3OMCA 3CBPA 4DA4A 1BYMA 3KUFA 3URGA 4J8OA 2RD1A 2YLCA 4XTYA 4LDWA 1K73C 4PJOB 4C92G 3MP6A 4C0ZA 4ZN3A 3C95A 4M77D 1VQPA 4M75A 4BACA 3MCAB 3JCMc 5CVIA 4FM4B 3L2RA 3G4SA 1UGQB 4M75C 3SDZA 3S3NA 1BI1A 1Q86C 3CPWA 4LDVA 1YJ9A 4JS5A 1QVFS 4C92D 2RJCA 3DB3A 1KQ2A 3QDRB 2DTHA 4M78B 3M55A 1VQ6A 3S3OA 1FX7A 1N9RA 3MP8A 5CKDA 3CC2A 3RUXA 1R8OB 3NFCA 3C12A 5KCOA 3X24B 3MHXA 3QUIA 1UGRB 1YCYA 4J83A 4BD3A 3OYJA 4ELYC 4F7UA 4IUVA 3ZBDA 3DB4A 4C8QE 1BIBA 3RKYA 1U8RA 4J6WA 3RKXA 1D3BA 2HQEA 3LH0A 2P0PA 5IN1A 3JCMf 3CCJT 4IUPA 4TVRA 2CGHA 2PUOB 1VQMA 2MWPA 1OZ2A 5C6SA 3BDLA 5GANd 3G6ET 2E64A 2RI2A 5HY6A 2YLBA 4M7DF 3OW2S 5LJ3h 1KQ1A 4C0FA 2ZPBB 2E10A 2O01E 2Y4XA 4ZN1A 4WF2A 3CMAT 2LNVA 3EFRA 5LJ5g 4O5VA 5GANh 3M58A 2K5FA 2RI5A 4EMKB 4C8QG 5CAIA 3HRTA 4A4HA 3A8HB 3M4GA 4N0AA 1Y07A 2EKOA 2VYTA 5I2MA 3VV0A 4PL6A 2YHTA 4C5IA 2ZPGB 3FDRA 4B9XA 3H6ZA 5GAOp 3CCQA 4J6XA 2OAUA 3CCUA 4M7AA 4N0AC 1Y96B 3HSBA 5GAN5 3VUBA 4C8QD 4EPCA 1ZBXA 4M7AC 3OA6A 3JCMJ 3CCLA 2JTMA 2EJFA 3CCST 4JLIA 5KCHA 1KQSS 3OYDA 3JCMP 4FT4A 3J81E 2KY9A 4J6YA 2EQJA 5A0GA 3OS2A 2V8JA 2D6FA 3V8LA 2KDSA 3NTKA 2E6NA 3MP1A 4EDUA 4HCBA 4PJOE 2PVGB 4Q5WA 5J26A 4MDXA 3OQ5A 3GF5A 5GMKm 4RKUE 2PVDB 2EAYA 2E41A 3CPFA 3JAME 3I55T 4N4HA 3FEOA 2E1HA 4JRQA 2DXUA 5GAMd 3I56T 1W2BA 4ATOA 4M77A 5LJ3f 1NZ9A 3ZEHA 1M9SA 2JNGA 3WXMB 2XDPA 3HP9A 2WACA 3UPUA 1VQLA 4M77C 5KH6A 4ZGEB 3E9FA 4NOYA 5DLOA 5GANf 2P4TA 4NL3A 3NTHA 1OYXA 2H3JA 4M78E 2RA2A 3RMSA 3JB9H 5GAMh 2EQMA 4C92A 1N8RC 1I8FA 4MZTA 4JLGA 4C8QF 1IZ6A 1B34A 1MHNA 4HCCA 4PJOG 1YJWA 3CCJA 2WSEE 2KQWA 3L42A 4C92C 1YITT 5FU6B 2F5TX 2RHUA 5FLXE 4O6JA 1VQOA 5HK0A 4OB2B 3V8KA 3OYAA 5HKCA 3OS0A 3FJPA 1BKBA 3HKSA 2PUKB 4M75B 3E1SA 4BI4A 3OYLA 3OYHA 3GPLA 2YRVA 4FT2A 3OYBA 2LT4A 3CMAA 3OMGA 4D6WA 4M7DE 3SB2A 2ZPFB 1K9MU 1KHCA 4M78G 4ZGJB 1UB4A 3RKWA 4KT0E 5M9OA 3O8VA 2HD0A 3M56A 4MDWA 1KC8C 2CS7A 5CQXA 1K8AC 1TH7A 1WNLA 2LX9A 3JCMW 3OYYA 3OSVA 3V7RA 3HHTB 2KK4A 5GAOm 3CCMT 2F5KA 3CD6T 2M0OA 3P8HA 4LDYA 5GMKh 3WVDB 3JCMX 2OTJT 4E7HA 2VXEA 1UGSB 3QYGB 4OF1A 3RIRA 3C94A 4EMGA 1NPPA 5HK3A 1NPRA 3FC3A 3L2QA 2Y90A 2GFAA 4F7UB 1YHQA 5CIUA 4M7DG 1VQ8T 5GAMf 3RMQA 4JRIA 1D3BB 1YI2A 1YJNT 4N4GA 3DKMA 1N9SA 2VV5A 3NTIA 5FU6C 3QBYA 1X6OA 4BUGA 5GMKi 3OYFA 4HT9A 5CK9A 3A8OB 4RCBA 1G3YA 1EIFA 4OP0A 1M90C 4XU0A 4X34A 2EQKA 4IUTA 4MZMA 2K57A 4PJOF 3S6WA 1DJ7B 1W2BS 4M7DD 4C8QA 5DM7R 1UGPB 3DLLA 2DD5A 4ZGDB 3I55A 1O9SA 2XKOC 3I56A 1Q81U 2XHCA 2HQXA 1WJQA 3PMTA 3SFMA 2ZPEB 4C8QC 3OS1A 3FB9A 4MMLA 3UT1A 3J7AF 3L1AA 2DD4A 3VJPA 4PKCC 1KG1A 2JUFA 3LWHA 2G3RA 5I2SA 4KBMB 1WJSA 3HFNA 2ZPIB 3QG1A 5DLQE 5LJ5d 2VUBA 4M78F 5A2QE 4X9CA 4A4KA 3LYIA 2FVUA 2F69A 3QHSA 3GP8A 4OMFB 4M7AB 4ZTFA 2BUDA 3QXEB 1VQKT 4PNOA 3SD4A 5LJ3e 4FIBA 4QVCA 1YITA 5IAYA 1WGSA 3M4YA 3PFSA 3CEYA 3VUZA 4BDZA 3JCMg 4BI3A 3PGGA 1G3SA 3INZA 1S72A 4XU2A 3HPWA 3EFSA 5IT9E 3QPHA 1IREB 2IVWA 2ZCFB 3PT9A 4OB3B 2RJDA 2GQVA 5C0MA 4JDSA 1VQ7T 1M1GA 3BW1A 5CKFA 3FIFA 4E47A 3CCVT 4M75E 3RESA 4C5HA 3PIOA 2R5MA 1SSFA 3LGLA 2LVMA 4A4GA 2L3RA 2WSFE 3CXCS 2X4JA 2QDYB 4M77B 4LDXA 3QSUA 1G5VA 4N4IA 3PIPA 4Z02A 3CD6A 5EG2A 4JRPA 3META 1VQ9T 4VUBA 3ZFJA 2RK2A 3QJ6A 4C92B 3OYGA 2MI6A 3GLXA 3X20B 1YJNA 3L2UA 1B34B 3A5ZB 2RHXA 3OB9A 1LNXA 5LJ3j 5FRNA 4KUIA 4M75G 2QQ9A 1M5Q1 2RJFA 3CPWS 5GANj 5LJ5f 2MAMA 4C5EA 3V8JA 2DEQA 2CZ7B 2RJEA 1JJ2A 2FB7A 2K5LA 2QA4T 5FRMA 3JRZA 2DXCA 4JRKA 4QQDA 4A53A 2A3LA 2XK0A 2EYQA 5LJ3g 1JBMA 3GIBA 3MO8A 4OGEA 1ZQ1A 4RMOA 1M4ZA 3MEVA 5GAN4 2DO3A 2DJZA 5GANg 3CMET 2DPPB 2RI3A 3BY7A 3CC4T 5FU7B 3VYGA 1RL2A 2V8KA 2Y4YA 1VQKA 4M7DA 3OYNA 3JB9I 3LLRA 2M1HA 2RHYA 5A0LA 1FWZA 1OZ3A 1H641 1VQPT 1KHIA 4M7DC 1JRIA 3CBMA 2DIGA 4EMHA 4II1A 2O4XB 4XK8E 1Q82U 1Y7XA 2KVQG 3LX7A 3N5BB 4OVAA 3V7CA 4GLKA 4JS4A 3G6EA 4R56A 1OI1A 1AHJB 3A8LB 1XQHA 2P0KA 1PSEA 3H8ZA 4BE2A 4A54A 2DTOA 4ELZC 1VQ7A 4PLIA 4PJOD 2QXFA 5I21A 1NJIU 2LCCA 2E65A 2EFIA 2V8IA 4LDUA 3CCVA 2C06A 1QVGA 4DQ2A 1Y71A 4C8QB 1FXXA 3JCMe 4M75F 3JB9F 4UC4A 3V7SA 5GAMj 1VQ4T 4B9WA 2EJGA 2L89A 2HBPA 4OGCA 3CCET 1VQ9A 2DKGA 2VXFA 4QQ6A 3X28B 4BE0A 1YIJT 1HXDA 2LQKA 2X4WA 2EIFA 1Q7YU 4M78D 1M1KU 4ME7A 3JCMV 2A7YA 5FU7C 1I4K1 5CKBA 3TEEA 2LDMA 4Y91A 3OBWA 3TREA 3J80E 2LC4A 4KULA 3CCSA 1VQMT 2O4XA 3FRNA 1K73U 4FU6A 4V2SA 3GNFB 3PMIA 5D6YA 1KD1U 5GAN6 2VC8A 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A A;  4JUV A;  4N0A C;  2DZ9 A;  4XU1 A;  4F7U F;  3JCM g;  4EMK C;  1Y96 B;  3PGG A;  3INZ A;  5GMK e;  3HSB A;  5GAN 5;  4XU2 A;  4C8Q D;  4M7A C;  2RM4 A;  3JCM J;  1Y96 A;  3EFS A;  2EJ9 A;  2EJF A;  5GAN 7;  4JLI A;  4MMK A;  3JCM P;  3JB9 J;  1I81 A;  4J6Y A;  5GMK j;  3V8L A;  2RB6 A;  4M7A G;  4XTU A;  4XTW A;  3BW1 A;  3FIF A;  3SWN B;  2DVE A;  1WQ7 A;  4M75 E;  3RES A;  4PJO E;  4M77 E;  1M8V A;  3SWN A;  5GAN 8;  1U1T A;  5GMK m;  3QSU A;  2EAY A;  2E41 A;  4M77 B;  4HA8 A;  4XTZ A;  5GAM g;  2E1H A;  2DXU A;  2ZGW A;  3SWN C;  5GAM d;  3JCM Q;  4M77 A;  5LJ3 f;  3RER A;  4M7A D;  2DZC A;  3QO3 A;  4C92 E;  1U1S A;  1LJO A;  5LJ5 h;  4M7A F;  4M77 C;  5GAN f;  4NOY A;  4C92 B;  5GAN e;  3JCM d;  1WPY A;  4NL3 A;  4HT8 A;  4M78 E;  2RA2 A;  2DTI A;  1B34 B;  3JB9 H;  3JCM b;  5GAM h;  4C92 A;  1LOJ A;  1I8F A;  1LNX A;  5LJ3 j;  2QTX A;  4C8Q F;  1B34 A;  4M75 G;  5GAO r;  4PJO G;  4M77 G;  1M5Q 1;  4J5Y A;  3VU3 C;  4C92 C;  5GAN 2;  3JCM h;  5LJ5 f;  5LJ5 e;  5GAN j;  1I5L A;  3V8J A;  4XTX A;  2DEQ A;  2EWN A;  2JN0 A;  3V8K A;  2HNI A;  3FJP A;  4QVD A;  2FB7 A;  2RD1 A;  4NL2 A;  2YLC A;  4M75 B;  4XTY A;  3JB9 D;  4PJO B;  4C92 G;  4JRK A;  3GIB A;  4M77 D;  1X01 A;  4A53 A;  5LJ3 g;  1JBM A;  4M75 A;  5LJ5 j;  4M7D E;  4PJO A;  5LJ3 d;  3SB2 A;  3JCM c;  4M78 G;  4QVC A;  3BFM A;  5GMK l;  5GAN 4;  3RKW A;  4M77 F;  4M7D B;  2DJZ A;  4M75 C;  5GAN g;  4PJO C;  3BY7 A;  4PJO D;  4M7D A;  5DY9 A;  4C92 D;  1TH7 A;  1KQ2 A;  3JB9 I;  1WNL A;  1H64 1;  3JCM W;  2DTH A;  4M78 B;  4M7D C;  1JRI A;  4EMH A;  3V7R A;  4C92 F;  5GAO m;  1N9R A;  4J6X A;  3JB9 G;  4M78 A;  3JCM X;  3RUX A;  5GMK h;  4F7U E;  2VXE A;  3RIR A;  3V7C A;  4EMG A;  2Y90 A;  3QUI A;  4F7U B;  5GAN 3;  4M78 C;  5GAO n;  4M7D G;  3HFO A;  5GAM f;  1YCY A;  5GAM e;  4A54 A;  4JRI A;  1D3B B;  2DTO A;  4F7U A;  4M75 D;  4C8Q E;  5I21 A;  1N9S A;  1BIB A;  3RKY A;  5GMK i;  1BIA A;  4J6W A;  2E65 A;  3RKX A;  1D3B A;  4HT9 A;  4RCB A;  4OP0 A;  4C8Q B;  3JCM f;  3BDU A;  4DQ2 A;  4X9D A;  4XU0 A;  3JCM e;  4M75 F;  2K57 A;  4PJO F;  3JB9 F;  2CGH A;  3V7S A;  4M7D D;  4XU3 A;  4C8Q A;  5GAM j;  2DXT A;  5GAN d;  2E64 A;  1HK9 A;  2EJG A;  3L2Z A;  2YLB A;  2DKG A;  2VXF A;  3FB9 A;  4C8Q C;  4F7U G;  4MML A;  1KQ1 A;  5LJ3 h;  1HXD A;  4M7D F;  2E10 A;  3L1A A;  4M78 D;  4WF2 A;  3JCM V;  3EFR A;  5LJ5 g;  3AHU A;  1I4K 1;  1WQW A;  4Y91 A;  5GAN h;  5LJ5 d;  3HFN A;  4M7A E;  1MGQ A;  4EMK B;  4M78 F;  4C8Q G;  4X9C A;  5CAI A;  2FYK A;  4XQ3 A;  5GAO l;  3M4G A;  3QHS A;  4N0A A;  4M7A B;  4V2S A;  4EMK A;  2YHT A;  4XTV A;  4PNO A;  4RCC A;  5LJ3 e;  5GAO p;  5GAN 6;  2VC8 A;  2I2L A;  5GAO q; 
#chains in the Genus database with same CATH topology
 4F7U F;  3NGP A;  2QYZ A;  1V1C A;  4F17 A;  2YXY A;  1KD1 R;  2RQW A;  4KUD K;  2IPO B;  1ZSG A;  2JW4 A;  4QQG A;  1WQ7 A;  4C0G A;  1K4U S;  1U1T A;  3OSS C;  2ROL A;  4HA8 A;  2MK5 A;  4JJN K;  1YI2 Q;  3RER A;  3JV3 A;  1XTD A;  3M0R A;  5LJ5 h;  5IH2 A;  2E6Z A;  2EGC A;  4D8K A;  2QGF B;  2KAF A;  1UEB A;  1I1J A;  2DTI A;  4BI8 B;  3G4S Q;  1LOJ A;  1Q81 C;  2CZ6 B;  3X26 B;  2XI9 A;  4BY6 C;  2BTT A;  4KH0 B;  1T0H A;  2DBK A;  5J3B A;  1OU9 A;  3PTA A;  3KBG A;  3OS5 A;  4BDY A;  1YJW T;  2C0I A;  2P84 A;  2B8A A;  5ECA A;  1S72 Q;  1VQ8 A;  4HCZ A;  3M9Q A;  5LL6 S;  4C92 F;  5CQY A;  2MMP A;  4MZP A;  4M78 A;  3MEW A;  5D6X A;  3MEA A;  2M51 A;  4E7J A;  2DYB A;  2V1R A;  5D6W A;  4PLL A;  4LE9 A;  4ZTJ A;  4C5G A;  3CCQ Q;  3WVE B;  3CC7 T;  1TUC A;  1VIE A;  3CCU Q;  4KGZ B;  3OYI A;  3M54 A;  4XU3 A;  4CC4 B;  1G3T A;  2EQU A;  1HK9 A;  3L2Z A;  3ER0 A;  1TS9 A;  1V29 B;  1Q82 R;  3ULR B;  1PRL C;  4F7U G;  2HCK A;  2HKQ B;  2K4Y A;  2CZ1 B;  3E9G A;  4L5G A;  1WQW A;  3UA7 A;  1I0C A;  1NM7 A;  2FYK A;  2KNB B;  2BE9 B;  1YJ9 T;  1TG0 A;  3CXC P;  1B7T A;  4EMK C;  1WYX A;  1T3L A;  4CRI A;  4FL6 A;  5IHI A;  2C0T A;  1WIE A;  3I9Q A;  2RB6 A;  1D09 B;  3VRZ A;  3OYE A;  3GOX A;  3SWN B;  4R55 A;  3TU4 K;  4M77 E;  2VGM A;  1OOT A;  5GAN 8;  2RO0 A;  2L2P A;  3MPU B;  3OYM A;  4J7F A;  1AT1 B;  4OMQ A;  2D9T A;  4QW2 A;  1D1C A;  3EFO A;  3JCM Q;  2X4Y A;  2E70 A;  4A4E A;  1QVP A;  2L5Q A;  2VWF A;  1N6A A;  4Y92 A;  3CMA Q;  2CYZ B;  2QEX A;  2OTL A;  1LPL A;  3R6N A;  3EAE A;  2RHI A;  1AEY A;  1J3T A;  1G2B A;  3M5A A;  3GNG A;  3CXC A;  1RAC B;  3VU3 C;  5GAN 2;  2QAZ A;  4J5Y A;  3EG0 A;  4LD6 A;  1QP2 A;  4DA4 A;  3KUF A;  3URG A;  2RD1 A;  4PJO B;  4C92 G;  2KT8 A;  4C0Z A;  1VQP A;  3C95 A;  2KBT A;  4BAC A;  3MCA B;  4M4Z A;  1VYT A;  1NEG A;  8ATC B;  2KRO A;  1Q86 C;  1W1F A;  4LDV A;  4JS5 A;  1QVF S;  1TWB A;  4C92 D;  3I55 Q;  2YUO A;  3S3O A;  3MP8 A;  3CC2 A;  1BB9 A;  1R8O B;  3NFC A;  3RUX A;  1HSQ A;  1H8K A;  2PZ1 A;  4F7U A;  1JO8 A;  4IUV A;  2RN8 A;  2HQE A;  3LH0 A;  1YIT Q;  4CC2 A;  2CGH A;  2MWP A;  3G6E T;  3BDL A;  5HY6 A;  1RAB B;  2YLB A;  1ZSZ C;  4C0F A;  4DBR A;  2O01 E;  5LJ5 g;  2K5F A;  4C8Q G;  1PWT A;  3A8H B;  4N0A A;  3VV0 A;  1Y07 A;  2VYT A;  4Z88 A;  2ZPG B;  4OMO A;  2GQI A;  3E2U A;  6AT1 B;  1N8R R;  5GAN 5;  4C8Q D;  1ZBX A;  3OA6 A;  1VQ8 Q;  3VS0 A;  1YJN Q;  3J81 E;  3FJ5 A;  4J6Y A;  1JU5 C;  2KDS A;  3MP1 A;  4EDU A;  3TQ7 P;  2ZAE A;  1AWJ A;  2EAY A;  3CPF A;  3FEO A;  1G8X A;  2DXU A;  5GAM d;  1W2B A;  5LJ3 f;  3ZEH A;  4AFQ C;  2MOX A;  1K8A R;  1WI7 A;  3UPU A;  2CRE A;  5KH6 A;  5DLO A;  4NOY A;  3NTH A;  1U06 A;  3RMS A;  4C92 A;  1I8F A;  4JLG A;  1YJW A;  3CCJ A;  3L42 A;  3A1P A;  5FLX E;  3OW2 P;  2DMO A;  4ESR A;  1M90 R;  4BI4 A;  4FT2 A;  1UJ0 A;  4M7D E;  1K9M U;  1KHC A;  2LQN A;  3RKW A;  3EG3 A;  3M0U A;  4MDW A;  1KC8 C;  5CQX A;  4Z8A A;  1QKW A;  4RTX A;  3OYY A;  3OSV A;  3V7R A;  2KK4 A;  3CCM T;  1VQ9 Q;  1IGQ A;  4PFO A;  1AZG B;  1TU0 B;  1EZZ B;  1NPP A;  3FC3 A;  1X6B A;  5CIU A;  5GAM f;  3RMQ A;  1D3B B;  4E6R A;  3QBY A;  1X6O A;  4IUT A;  1VA7 A;  2K57 A;  3S6W A;  4C8Q A;  5DM7 R;  2DD5 A;  2XKO C;  4R0K A;  3I56 A;  2HQX A;  1WJQ A;  3PMT A;  3SFM A;  3FB9 A;  4PJM A;  3UT1 A;  3J7A F;  3H0H A;  1KG1 A;  3EHQ A;  3QG1 A;  1GBQ A;  2VUB A;  3LYI A;  8AT1 B;  2F69 A;  1WXU A;  3QHS A;  1M27 C;  2BUD A;  4QVC A;  1WXT A;  1SRM A;  1VQP Q;  1WGS A;  3M4Y A;  4BDZ A;  4BI3 A;  2EYX A;  4XU2 A;  2JXB A;  1CKB A;  3EFS A;  2IVW A;  4RTW A;  4DEX A;  5GJW B;  4FW1 A;  1QQJ A;  4E47 A;  4M75 E;  3RES A;  2L3Q A;  3LGL A;  4J9F A;  1GRI A;  4M77 B;  4N4I A;  1RAE B;  3EHR A;  3MET A;  3ZFJ A;  2RK2 A;  3OYG A;  3GLX A;  1B34 B;  3OB9 A;  3QWX X;  4HXJ A;  2FO0 A;  1QVF P;  1ABO A;  5GAN j;  2DEQ A;  3VRY A;  4AMC A;  2HSP A;  1WLP B;  4OMM A;  2QG9 B;  5GAN 4;  2DPP B;  1VQK A;  1SPK A;  1LVK A;  3OYN A;  2M1H A;  2RHY A;  1FWZ A;  4RTU A;  2NUT A;  2DIG A;  1LCK A;  4JZ3 A;  2KVQ G;  3G6E A;  2HL3 A;  4R56 A;  4RTT A;  1AHJ B;  1RI9 A;  3AT1 B;  3RBB B;  1VQ7 A;  5I21 A;  4WTO B;  1TXQ A;  3CCV A;  1X43 A;  3VS4 A;  4DQ2 A;  1Y71 A;  1FXX A;  4M75 F;  1MMA A;  2VXF A;  3VS1 A;  3X28 B;  1HXD A;  1OX9 A;  3C0C A;  1YJW Q;  1I4K 1;  5CKB A;  1Z9Q A;  4KUL A;  3CPW P;  1RAG B;  3FRN A;  1K73 U;  4FU6 A;  3PMI A;  2GNC A;  2VC8 A;  4F14 A;  4JUV A;  1G83 A;  2XG8 D;  1FYN A;  3VS6 A;  2QA4 A;  2QQA A;  3QJY A;  2VAS A;  4L59 A;  1WHG A;  4PFZ A;  5L8R E;  2RM4 A;  2HZY A;  5GAN 7;  3T9N A;  1MUZ A;  1UHC A;  2Z0W A;  1U3O A;  3OBY A;  3Q1J A;  5GMK j;  1NYF A;  5HCK A;  3CC7 Q;  1M8V A;  2CUB A;  4FCY A;  2NLU A;  1W6X A;  1OPK A;  5CKH A;  2G6F X;  3SWN C;  1WX6 A;  1I5O B;  2DRM A;  2WSC E;  3UAT A;  1U1S A;  4M7A F;  1QWE A;  5KYX B;  1QVG S;  3FLG A;  2L3P A;  1YJ9 Q;  3H0I A;  1X2K A;  2XD0 A;  2XU8 A;  1VIF A;  2CT4 A;  2K3B A;  2HNI A;  1T3S A;  4QVD A;  1KD1 C;  3CCE A;  1YIJ A;  5AT1 B;  5LJ5 j;  3CCM A;  4M7D B;  2FPE A;  4PJO C;  3C4S A;  1M3A A;  2KXC A;  3ZL7 C;  2DAQ A;  1A0N B;  1BI3 A;  3F70 A;  4F7U E;  1O75 A;  3EGX B;  2QEX T;  2OTL T;  5GAO n;  2JZ2 A;  2EYZ A;  2JTF A;  4M75 D;  2FHD A;  4IKF A;  1BIA A;  2DL7 A;  2CSI A;  1GFD A;  1QWF A;  3TCJ A;  2LT1 A;  1JB0 E;  2DXT A;  1TOV A;  1T0J A;  2QTV A;  4IUQ A;  1YHQ T;  4C0D C;  2RNA A;  4GY5 A;  2LCL A;  5KE2 A;  1RI0 A;  3QDF A;  4RUG A;  3AHU A;  3M0P A;  1MGQ A;  1NJI R;  4XQ3 A;  5GAO l;  5AYF A;  1VUB A;  2L8D A;  4XTV A;  5FRO A;  3L2W A;  2I2L A;  2CDT A;  4CC7 A;  2DZ9 A;  4XU1 A;  4FYV B;  4EIK A;  1XNI A;  3CC2 T;  2FZG B;  2CP0 A;  4OML A;  1X2Q A;  1WHK A;  4E7L A;  1VYV A;  1WJR A;  2KSS A;  4M7A G;  2A0F B;  2R5A A;  2CZ0 B;  1Q82 C;  2CP2 A;  5KE3 A;  5CR2 A;  1Q95 G;  3G6E Q;  2R57 A;  2DXB A;  3DLM A;  1VQ5 A;  5GAM g;  4K11 A;  4J7I A;  4M7A D;  4JJD A;  1M1F A;  4C92 E;  2LJ0 A;  1SKU B;  4DOW A;  1GXI E;  1VQN A;  2E5Q A;  2IG0 A;  1AOJ A;  2HAX A;  2DIQ A;  2FRY A;  2GCX A;  2KE9 A;  3NHN A;  4NS5 A;  4XTX A;  2KXD A;  2NWM A;  3A8M B;  3OMC A;  4JJC A;  5KYN A;  4J8O A;  3REA B;  2YLC A;  4XTY A;  4LDW A;  4ZN3 A;  4M75 A;  1SHG A;  1MMN A;  5I22 A;  2D8J A;  2J05 A;  4ANJ A;  2ENM A;  4M78 B;  1VQ6 A;  1N9R A;  2HDA A;  4LUE A;  3C12 A;  3X24 B;  3MHX A;  2NUP A;  1YCY A;  4BD3 A;  2DYI A;  4C8Q E;  3RKY A;  1U8R A;  4J6W A;  1IXD A;  2DE0 X;  1Y57 A;  3CCJ T;  3I35 A;  4TVR A;  2EGA A;  2QGG A;  2ABL A;  1OZ2 A;  5C6S A;  2E64 A;  4Z89 A;  1PD0 A;  1CSK A;  3OW2 S;  1KIK A;  2LJ3 A;  2EVR A;  2LNV A;  2X3W D;  4LNP A;  2AIR B;  2YDL A;  3M58 A;  2COW A;  3HRT A;  2A36 A;  3M4G A;  2EKO A;  3EGD B;  4PL6 A;  3M0Q A;  4HVW A;  4J6X A;  2OAU A;  2O9V A;  4M7A A;  3CCM Q;  1R0C B;  1PNJ A;  2JMA A;  4IIO A;  3I5R A;  2JTM A;  3CCS T;  1ZX6 A;  3OYD A;  2DET A;  4FYY B;  4FT4 A;  3OS2 A;  2V8J A;  2D6F A;  2NYS A;  2E6N A;  2L3S A;  5FWC A;  1QVG P;  1QKX A;  3EFO B;  3BE3 A;  2E1H A;  3I56 T;  1M2V A;  1UGV A;  4J9B A;  1NZ9 A;  3EGD A;  4M77 C;  4NL3 A;  1C1A A;  1QCF A;  2H3J A;  1K9A A;  2CSQ A;  2FZK B;  3JB9 H;  2EQM A;  1N8R C;  2H3E B;  4MZT A;  5D7U A;  4C8Q F;  1MHN A;  4PJO G;  2GGR A;  5FU6 B;  2FEI A;  2LNH B;  1BKB A;  2JM8 A;  2JM9 A;  2YRV A;  3OYB A;  4D6W A;  2O88 A;  2DL4 A;  2DFU A;  1K8A C;  1NEB A;  1PRM C;  5GAO m;  1KQS P;  2M0O A;  4LDY A;  3JCM X;  1UGS B;  3QYG B;  2YSQ A;  3C94 A;  2IIM A;  2Y90 A;  4F7U B;  1YHQ A;  4JRI A;  1WHH A;  4N4G A;  1N9S A;  3OYF A;  3SEM A;  5CK9 A;  3A8O B;  1QMC A;  1M90 C;  2F2W A;  4XU0 A;  4X34 A;  4MZM A;  1DJ7 B;  3DLL A;  1OU8 A;  2FZC B;  1Q81 U;  2ZPE B;  2GBQ A;  2RQR A;  2DD4 A;  2PNI A;  2B86 A;  2JUF A;  3LWH A;  4X9C A;  3TVT A;  2FVU A;  3GP8 A;  1VQK T;  2JS2 A;  5LJ3 e;  4KGV B;  2A28 A;  3PFS A;  3CEY A;  4JPB W;  3PGG A;  2CP3 A;  3QPH A;  1D0X A;  2D1X A;  4OB3 B;  1IGU A;  2RJD A;  1VQ7 T;  1M1G A;  1B07 A;  1SRL A;  3CCV T;  1SEM A;  2ESW A;  2RQT A;  2LVM A;  4A4G A;  3QSU A;  4A63 B;  4LDX A;  3PIP A;  3H0F A;  5EG2 A;  4JRP A;  3CD6 A;  1YFN A;  3QJ6 A;  4C92 B;  1LNX A;  5LJ3 j;  2RMO A;  2QQ9 A;  1QCN A;  3CPW S;  2CZ7 B;  4FYW B;  2QA4 T;  5IHN A;  4J9C A;  1V76 A;  1RUW A;  2O9S A;  2L0A A;  2KRM A;  3JRZ A;  3GIB A;  4A53 A;  3MO8 A;  1ZQ1 A;  3LH5 A;  2QAS A;  2DO3 A;  2LX7 A;  2RI3 A;  1TTH B;  1ARK A;  5FU7 B;  1RL2 A;  2V8K A;  1MND A;  5A0L A;  1IO6 A;  4M7D C;  1JRI A;  1M8M A;  2BZY A;  3CBM A;  3M0T A;  4AFU C;  2O4X B;  5KYW A;  1Y7X A;  3V7C A;  4AG1 C;  3N5B B;  1Y0M A;  4GLK A;  3A8L B;  2P0K A;  1K9M R;  4A54 A;  1IB8 A;  2NUZ A;  2OAW A;  1ZUK A;  4C8Q B;  3JCM e;  2LQW A;  3JB9 F;  4UC4 A;  3V7S A;  5GAM j;  4B9W A;  1KSW A;  3CCE T;  1WFW A;  1YIJ T;  4BE0 A;  2LQK A;  2W10 A;  3HTR A;  2A7Y A;  3TRE A;  3CCS A;  1H92 A;  2O4X A;  4J9D A;  3GNF B;  5D6Y A;  3CQT A;  5GAN 6;  1XOV A;  2GFU A;  2X4X A;  3QYH B;  3OW2 A;  1K1Z A;  1Q86 U;  2VB6 A;  3LWI A;  2QEX Q;  2OTL Q;  3M57 A;  3M59 A;  1SF9 A;  3ME9 A;  4MMK A;  2MWO A;  1M3C A;  3KXT A;  1P92 A;  4XTW A;  3CME A;  4D8D A;  2AZV A;  2DLP A;  5KYY A;  4RG2 A;  2R58 A;  2DA9 A;  2ZZD A;  1YHQ Q;  4E7K A;  2K3X A;  3TSW A;  1BI0 A;  4ORZ A;  4QVZ A;  2K3Y A;  1LJO A;  2CKK A;  5GAN e;  1BCO A;  2GF7 A;  2VKN A;  3UDC A;  4OB0 B;  1JQQ A;  1N5Z A;  4B6M A;  2K7A A;  2O31 A;  2HEQ A;  2JN0 A;  4JZ4 A;  1VQ4 A;  2LJ1 A;  2X35 A;  2PVO B;  4QKU A;  3CC2 Q;  4NL2 A;  4LD9 K;  3RR6 A;  1X75 C;  3S3M A;  5CO7 A;  2M9U A;  1X01 A;  2F2V A;  3H41 A;  3P8B B;  1M2O A;  2BKD N;  2K2V A;  4L6V 5;  3BFM A;  3OYK A;  2ZPH B;  3VS2 A;  3QZ9 B;  2D8H A;  5DY9 A;  2D0Q B;  2NUT B;  2HSE B;  1PD1 A;  1TUG B;  2XDD A;  3M53 A;  1VQ5 T;  3CCR A;  1UDL A;  1EFN A;  3JB9 G;  5KYU A;  2QI2 A;  3P8D A;  2LP5 A;  1H3Z A;  3U23 A;  2OX7 A;  4M78 C;  2M0Y A;  1VQN T;  1GFC A;  3JB9 D;  3HRS A;  3BDU A;  2AHJ B;  2LMJ A;  2W0Z A;  3OYC A;  1W70 A;  2K79 A;  1K0S A;  4HCK A;  2ED0 A;  2SEM A;  2HQH A;  3MEU A;  4E7I A;  4M7A E;  1F1B B;  2FPF A;  1EX4 A;  2PTK A;  4EMK A;  5GAO q;  1N27 A;  4RCC A;  5GAN 3;  2RH2 A;  2LRQ A;  1QVF A;  2AKL A;  5GMK e;  1VQ6 T;  1NE8 A;  4P5N A;  2JJ9 A;  1Y96 A;  1KC8 U;  1YCS B;  3G71 A;  1ZHI A;  1SSH A;  3JB9 J;  1I81 A;  4IUU A;  1QP3 A;  4BB7 A;  2CP5 A;  5CKE A;  3CCJ Q;  1M30 A;  4DBH A;  2PU9 B;  4FSS A;  5FW9 A;  3UA6 A;  4BE1 A;  4DOV A;  3L2V A;  2ATC B;  2J6O A;  2QQR A;  2SRC A;  3ASK A;  1AWW A;  1ZA2 B;  1NJI C;  5CCA A;  2BIV A;  4F04 B;  2MYS A;  3EG9 B;  4AFZ C;  4HT8 A;  4A4F A;  3JCM b;  2EYW A;  3VS3 A;  2QTX A;  1Q7Y C;  1M1K C;  3JCM h;  5LJ5 e;  2EGE A;  1XJW B;  3CBP A;  1BYM A;  3RNJ A;  2COZ A;  2KYB A;  3O5Z A;  5EC7 A;  3CCS Q;  1GCP A;  1OEB A;  5CVI A;  2M02 A;  3L2R A;  1UFF A;  3G4S A;  1UGQ B;  3PVQ A;  3S3N A;  1BI1 A;  3CPW A;  4DBF A;  4ZNX A;  2RJC A;  1AZE A;  3EG9 A;  1IRX A;  1I07 A;  1BK2 A;  3M55 A;  3I56 Q;  1UG1 A;  1S1N A;  2EKH A;  3OYJ A;  4J9H A;  1YWP A;  2CP6 A;  2C0O A;  2P0P A;  5IN1 A;  1UE9 A;  4IUP A;  2PUO B;  4X1V A;  1ZSZ A;  1IHW A;  1M3B A;  1NLP C;  2ZPB B;  2Y4X A;  4ZN1 A;  4WF2 A;  2QDL A;  3EFR A;  4KGX B;  2JT4 A;  1WA7 A;  4O5V A;  5GAN h;  2K6D A;  1AWO A;  2RI5 A;  5CAI A;  4KRT A;  4A4H A;  1VQ4 Q;  1ZA1 B;  4C5I A;  5GAO p;  3CCQ A;  2KYM A;  2O2O A;  3CCU A;  4N0A C;  3HSB A;  3VUB A;  1OUL A;  2HL5 C;  3JCM J;  2EJF A;  4JLI A;  5KCH A;  1KQS S;  3JCM P;  2EQJ A;  3V8L A;  3NTK A;  1ACM B;  4PJO E;  1PKT A;  4Q5W A;  4MDX A;  3QWY A;  3OQ5 A;  1PG5 B;  3JAM E;  3IQL A;  4JRQ A;  3NPF A;  1X6G A;  2XDP A;  9ATC B;  2X3X D;  4ZGE B;  3E9F A;  2KEA A;  2RA2 A;  1Q7Y R;  1M1K R;  1VQK Q;  1MMD A;  5FWB A;  1IZ6 A;  4HCC A;  4PJN A;  4C92 C;  2DL8 A;  3EG1 A;  2RHU A;  5HK0 A;  1RLQ C;  4OB2 B;  2COY A;  4OMP A;  2CT3 A;  3FJP A;  2DNU A;  4J9G A;  4M75 B;  3E1S A;  3OYL A;  3GPL A;  3CMA A;  3OMG A;  2ZPF B;  1VQ7 Q;  4M78 G;  4ZGJ B;  1UB4 A;  3CCV Q;  3O8V A;  2CS7 A;  4CC3 A;  2DER A;  1WNL A;  3CD6 T;  1X69 A;  5GMK h;  3WVD B;  2OTJ T;  2VXE A;  4OF1 A;  2NUP B;  4EMG A;  4DBQ A;  1NPR A;  4E2F B;  1QLY A;  2E5K A;  3DKM A;  3GBQ A;  2VV5 A;  3NTI A;  1HD3 A;  5GMK i;  4BUG A;  2ROT A;  1EIF A;  2DM1 A;  4PJO F;  1W2B S;  4ZGD B;  3I55 A;  2QA4 Q;  1B3Q A;  1NYG A;  2DJQ A;  4C8Q C;  4MML A;  3VS5 A;  1JXM A;  3L1A A;  2P4R A;  2G3R A;  4KBM B;  1WJS A;  3HFN A;  1KD1 U;  5FRM A;  5A2Q E;  4A4K A;  4OMF B;  4M7A B;  4ZTF A;  3H9N A;  4PNO A;  3SD4 A;  1YIT A;  4OMN A;  5IAY A;  1R0B G;  3VUZ A;  3D7S B;  1UJY A;  2AK5 A;  3JCM g;  2QK0 A;  1G3S A;  2F2X A;  5IT9 E;  2AZS A;  1IRE B;  2ZCF B;  2EYY A;  2YT6 A;  2D0N A;  5C0M A;  4JDS A;  1PCX A;  5CKF A;  3FIF A;  1KFZ A;  4C5H A;  3PIO A;  1SSF A;  1M2V B;  2ED1 A;  2L3R A;  2RQU A;  2QDY B;  2WSF E;  2X4J A;  1G5V A;  2BZX A;  3CCE Q;  1OPL A;  1YIJ Q;  1YWO A;  1AD5 A;  2GTO A;  3X20 B;  1YJN A;  3A5Z B;  2RJF A;  4C5E A;  2J06 A;  1YN8 A;  1H3H A;  2RJE A;  3PVL A;  1WZO A;  1BCM A;  4QQD A;  4WCI A;  2XK0 A;  2EYQ A;  1JBM A;  3MEV A;  1GCQ C;  1C0M A;  2DJZ A;  5GAN g;  3CME T;  3CC4 T;  1ABQ A;  1BBZ A;  1FMK A;  3BY7 A;  7AT1 B;  5IHK A;  3VYG A;  2Y4Y A;  2JMC A;  3EH2 A;  3JB9 I;  1K0X A;  2EW3 A;  1OZ3 A;  1H64 1;  1KHI A;  5I11 A;  4EMH A;  4II1 A;  2BE7 D;  4XK8 E;  1Q82 U;  3I5S A;  4OVA A;  1XQH A;  3H8Z A;  3NMZ C;  2DTO A;  4PLI A;  4PJO D;  2QXF A;  2JS0 A;  2LCC A;  2EFI A;  3THK A;  2C06 A;  1QVG A;  2GTJ A;  1VQ4 T;  1U5S A;  2DRK A;  2L89 A;  4OGC A;  1D0Y A;  1ZLM A;  1VQ9 A;  1E7O A;  4QQ6 A;  4RTZ A;  2EIF A;  1TUD A;  4QT7 A;  1OQK A;  3JCM V;  3OBW A;  3J80 E;  2LC4 A;  1VQM T;  2MIO A;  2FG0 A;  4V2S A;  2EBP A;  1TSF A;  1VQ5 Q;  3VYH B;  1ZUU A;  4RTY A;  3CCR T;  1K9M C;  1Q81 R;  1OX8 A;  2YRC A;  1K76 A;  5A0D A;  2H8H A;  2HBW A;  2P0Q A;  2KMT A;  1VQN Q;  5J39 A;  1BI2 A;  4CI0 C;  2DVE A;  3X25 B;  3SWN A;  2LQ8 A;  3PE0 A;  2JVV A;  3CCL T;  4XTZ A;  4IUR A;  2QQB A;  1ZUY A;  2DZC A;  1KQS A;  4PK4 A;  1SG5 A;  1AWX A;  1QW1 A;  2PQW A;  2YUP A;  1UUE A;  3QZ5 B;  1WPY A;  4LXC A;  2VVK A;  2J6K A;  3LW5 E;  3CBO A;  3QII A;  1I5L A;  4Y28 E;  2VGN A;  1VQL T;  1VQ6 Q;  2E4H A;  1YBY A;  3UWN A;  2X51 A;  3E19 A;  3R6O A;  5GJV B;  1RAD B;  2DL5 A;  1PHT A;  1PSF A;  3G71 T;  3A8G B;  4C0D B;  4PJO A;  5LJ3 d;  2OTJ A;  5GMK l;  1FMV A;  2MF2 A;  3REB B;  4M77 F;  2FL7 A;  2K9G A;  4GLM A;  1VQO T;  1GL5 A;  4OB1 B;  2E3I A;  3M0S A;  3RDV A;  4RG8 A;  1X27 A;  3PNW C;  3VKI A;  2QQS A;  1W2B P;  5KYW B;  2A37 A;  3G7Z A;  1BU1 A;  2AKK A;  3HFO A;  2K5I A;  5GAM e;  4HKE A;  2OI3 A;  4X9D A;  1WHJ A;  1NBE B;  3HRU A;  4JJB A;  3OY9 A;  2OJ2 A;  1N8R U;  1IHV A;  1YI2 T;  4PJJ A;  2CH4 W;  2E12 A;  1MNE A;  2RK1 A;  4LUD A;  1W4S A;  1SHF A;  3G4S T;  2M16 A;  2LTO A;  2RHZ A;  1G3W A;  2XDB A;  2KGT A;  2XIC A;  2DK3 A;  5IXB A;  2EJ9 A;  4F16 A;  1K8A U;  1PC0 A;  1MV3 A;  3JSC A;  5KYY B;  4XTU A;  1WHL A;  3HL8 A;  3UF4 A;  1S72 T;  1PKS A;  3QKJ A;  1GBR A;  4GBQ A;  4XAX B;  2RF0 A;  4FSX A;  2CUD A;  1QCO A;  2ZGW A;  1Q86 R;  1PM3 A;  1M90 U;  3QO3 A;  1JJ2 S;  4FW2 A;  1R77 A;  3JCM d;  4BY6 B;  1WHM A;  4YTL A;  5GAO r;  3CC7 A;  2XID A;  4M77 G;  3LGF A;  3CCQ T;  2JOY A;  2DEU A;  3CCU T;  3CC4 A;  2EWN A;  1K73 C;  3MP6 A;  4M77 D;  2I0N A;  3A98 A;  2DBM A;  3JCM c;  1RAF B;  4FM4 B;  1YNZ A;  4M75 C;  3SDZ A;  2HKN A;  1YJ9 A;  3DB3 A;  1KK7 A;  1KQ2 A;  3QDR B;  5KYU B;  2DTH A;  1JEG A;  1FX7 A;  1OV3 A;  5CKD A;  1AVZ C;  5KCO A;  2J7I A;  3QUI A;  1UGR B;  5IXF A;  4J83 A;  2DF6 A;  4ELY C;  3ZBD A;  3DB4 A;  2DL3 A;  1BIB A;  3RKX A;  1VYU A;  1D3B A;  2LCS A;  3JCM f;  2J6F A;  4HVU A;  1VQM A;  5GAN d;  3EGU A;  2RI2 A;  4M7D F;  5LJ3 h;  1KQ1 A;  2KI7 A;  2CP7 A;  2E10 A;  2DIL A;  3CMA T;  2MPX C;  1C6V X;  1UEC A;  4EMK B;  2JTE A;  5I2M A;  2RPN A;  2V1Q A;  2YHT A;  3FDR A;  4B9X A;  3H6Z A;  2CH4 A;  4DEY A;  3CD6 Q;  1Y96 B;  2KRN A;  2OTJ Q;  4EPC A;  4M7A C;  3CCL A;  3TSZ A;  4E7S A;  2LZ6 B;  2KY9 A;  5A0G A;  2ECZ A;  1D0Z A;  1WDX A;  4HCB A;  2KR3 A;  2PVG B;  5J26 A;  3GF5 A;  5GMK m;  4RKU E;  2PVD B;  2E41 A;  1GCQ A;  3I55 T;  4N4H A;  4ATO A;  4M77 A;  1KC8 R;  1D1B A;  1M9S A;  2JNG A;  3WXM B;  3HP9 A;  2WAC A;  1VQL A;  5GAN f;  2P4T A;  4M78 E;  1OYX A;  3KFV A;  5GAM h;  1HJD A;  1B34 A;  5L23 A;  2WSE E;  2KQW A;  1YIT T;  1WXB A;  2F5T X;  4O6J A;  1VQO A;  1K73 R;  3V8K A;  3OYA A;  5HKC A;  3OS0 A;  3HKS A;  2PUK B;  3SHW A;  3OYH A;  2BZ8 A;  2LT4 A;  3SB2 A;  2FPD A;  1E6H A;  4KT0 E;  5M9O A;  2HD0 A;  2YRD A;  3M56 A;  2EPD A;  4AFS C;  1TH7 A;  2KT1 A;  2LX9 A;  3JCM W;  4HVV A;  3HHT B;  2E3H A;  2F5K A;  4PJL A;  2YWW A;  3P8H A;  4AT1 B;  4E7H A;  3RIR A;  5HK3 A;  3L2Q A;  4RTV A;  2GFA A;  4M7D G;  1VQ8 T;  1RAI B;  1YI2 A;  1YJN T;  5FU6 C;  4HT9 A;  2RQV A;  4RCB A;  1G3Y A;  4OP0 A;  1ZSZ B;  2EQK A;  4M7D D;  1UGP B;  1O9S A;  2XHC A;  1NG2 A;  3OS1 A;  1CKA A;  1RAA B;  3VJP A;  4PKC C;  4J9I A;  1UTI A;  5I2S A;  5LJ5 d;  2ZPI B;  5DLQ E;  1KJW A;  4AG2 C;  3CME Q;  4M78 F;  2A08 A;  3CC4 Q;  3MKD A;  3QXE B;  4FIB A;  2HMA A;  2V26 A;  3EH1 A;  3INZ A;  1S72 A;  1MV0 B;  3HPW A;  2X9H A;  2YUQ A;  4J9E A;  1JJ2 P;  3PT9 A;  4IIM A;  1MMG A;  2KRS A;  2GQV A;  3BW1 A;  3MJX A;  1D1A A;  2R5M A;  3EG2 A;  4FYX B;  3CXC S;  1RLP C;  4Z02 A;  2DX1 A;  3G1J A;  1VQ9 T;  4VUB A;  2MI6 A;  3L2U A;  1VQM Q;  4E7Z A;  2RHX A;  5KYX A;  5FRN A;  4KUI A;  4M75 G;  1HYO A;  1M5Q 1;  2MCN A;  5LJ5 f;  2MAM A;  3V8J A;  3CCR Q;  1FMW A;  1JJ2 A;  2FB7 A;  2K5L A;  1Z9Z A;  2EQI A;  4JRK A;  2DXC A;  2A3L A;  5LJ3 g;  4OGE A;  4RMO A;  1M4Z A;  1E6G A;  2F1L A;  4M7D A;  4PFP A;  1YP5 A;  3CCL Q;  3LLR A;  1VOM A;  2YUN A;  1VQP T;  2DVJ A;  2AT1 B;  1ZBJ A;  2K2M A;  4JS4 A;  3LX7 A;  1OI1 A;  4LN2 A;  1PSE A;  4BE2 A;  3EGX A;  4ELZ C;  1NJI U;  4LDU A;  2E65 A;  2V8I A;  2FRW A;  1VQL Q;  2EJG A;  1NLO C;  2HBP A;  3VS7 A;  2DKG A;  4KH1 B;  3G71 Q;  2X4W A;  1UHF A;  1JXO A;  2XMF A;  1Q7Y U;  4M78 D;  1M1K U;  4ME7 A;  3TEE A;  5FU7 C;  2LDM A;  4Y91 A;  1VQO Q;  1RAH B; 
#chains in the Genus database with same CATH homology
 4JUV A;  3VYH B;  2GFU A;  2X4X A;  4F7U F;  3CCR T;  1K9M C;  2XG8 D;  3QYH B;  3OW2 A;  2QA4 A;  2QQA A;  3QJY A;  4L59 A;  5L8R E;  1Q86 U;  2RM4 A;  3LWI A;  3M57 A;  3M59 A;  5A0D A;  5GAN 7;  3ME9 A;  4MMK A;  2P0Q A;  2KMT A;  3T9N A;  5J39 A;  2MWO A;  3KXT A;  3OBY A;  3Q1J A;  5GMK j;  4KUD K;  1P92 A;  4XTW A;  3CME A;  4QQG A;  1BI2 A;  4CI0 C;  2DVE A;  1WQ7 A;  4C0G A;  3X25 B;  4RG2 A;  2R58 A;  1M8V A;  3SWN A;  1U1T A;  2ZZD A;  2LQ8 A;  3OSS C;  2JVV A;  3CCL T;  4HA8 A;  4XTZ A;  4E7K A;  2K3X A;  2NLU A;  5CKH A;  4JJN K;  1BI0 A;  3SWN C;  4IUR A;  4QVZ A;  3RER A;  2QQB A;  2WSC E;  1KQS A;  2DZC A;  1XTD A;  2K3Y A;  1QW1 A;  1U1S A;  2PQW A;  1LJO A;  5LJ5 h;  2CKK A;  4M7A F;  2E6Z A;  5GAN e;  3QZ5 B;  1WPY A;  2KAF A;  1UEB A;  2DTI A;  2GF7 A;  4BI8 B;  1QVG S;  1LOJ A;  3FLG A;  1Q81 C;  2CZ6 B;  3UDC A;  4OB0 B;  3X26 B;  2XD0 A;  3LW5 E;  2XU8 A;  3CBO A;  2XI9 A;  3QII A;  1VIF A;  4BY6 C;  1I5L A;  4Y28 E;  2VGN A;  2JN0 A;  1VQL T;  1VQ4 A;  2X35 A;  2HNI A;  2PVO B;  1YBY A;  5J3B A;  3UWN A;  4NL2 A;  4QVD A;  1KD1 C;  3CCE A;  1X75 C;  3S3M A;  5CO7 A;  4LD9 K;  3PTA A;  3E19 A;  2M9U A;  3KBG A;  3R6O A;  1YIJ A;  1PSF A;  1X01 A;  3G71 T;  3A8G B;  3OS5 A;  3P8B B;  4C0D B;  5LJ5 j;  3CCM A;  2BKD N;  2K2V A;  5LJ3 d;  4BDY A;  1YJW T;  4PJO A;  2OTJ A;  2B8A A;  4L6V 5;  5GMK l;  3BFM A;  2MF2 A;  4M7D B;  4M77 F;  2FL7 A;  3OYK A;  1VQO T;  4OB1 B;  2ZPH B;  4PJO C;  3C4S A;  3QZ9 B;  1VQ8 A;  4HCZ A;  5DY9 A;  4RG8 A;  2D0Q B;  2XDD A;  2DAQ A;  3M9Q A;  3M53 A;  3PNW C;  2QQS A;  5LL6 S;  3VKI A;  3CCR A;  1VQ5 T;  4C92 F;  5CQY A;  1BI3 A;  3JB9 G;  3F70 A;  2MMP A;  4MZP A;  4M78 A;  2QI2 A;  3MEW A;  4F7U E;  5D6X A;  3P8D A;  1O75 A;  3MEA A;  1H3Z A;  3G7Z A;  2QEX T;  2OTL T;  5GAO n;  4M78 C;  4E7J A;  2JZ2 A;  3HFO A;  1VQN T;  2K5I A;  5GAM e;  4HKE A;  2JTF A;  4M75 D;  2FHD A;  5D6W A;  3HRS A;  3JB9 D;  4IKF A;  4PLL A;  1BIA A;  4ZTJ A;  4C5G A;  3WVE B;  3CC7 T;  3BDU A;  3TCJ A;  2AHJ B;  1VIE A;  4X9D A;  2LT1 A;  3OYI A;  1JB0 E;  3HRU A;  3M54 A;  4XU3 A;  2DXT A;  1G3T A;  4IUQ A;  2EQU A;  3OY9 A;  1HK9 A;  3L2Z A;  3OYC A;  1YHQ T;  1N8R U;  4C0D C;  4GY5 A;  3ER0 A;  1V29 B;  1YI2 T;  2LCL A;  4F7U G;  5KE2 A;  1RI0 A;  2K4Y A;  2E12 A;  2CZ1 B;  3E9G A;  2RK1 A;  4L5G A;  1W4S A;  3AHU A;  1WQW A;  3MEU A;  4E7I A;  4M7A E;  1MGQ A;  3G4S T;  2M16 A;  2FYK A;  4XQ3 A;  5GAO l;  5AYF A;  1VUB A;  2LTO A;  1YJ9 T;  2L8D A;  2RHZ A;  4EMK A;  4XTV A;  1N27 A;  1G3W A;  4RCC A;  5FRO A;  5GAN 3;  5GAO q;  2I2L A;  2RH2 A;  3L2W A;  2XDB A;  2LRQ A;  1QVF A;  2DZ9 A;  2XIC A;  4XU1 A;  4EMK C;  2DK3 A;  5GMK e;  1VQ6 T;  1XNI A;  1NE8 A;  3CC2 T;  4P5N A;  4CRI A;  1Y96 A;  1KC8 U;  2EJ9 A;  1K8A U;  3G71 A;  1ZHI A;  4FL6 A;  3JSC A;  3JB9 J;  1I81 A;  4E7L A;  1WJR A;  2KSS A;  4IUU A;  1QP3 A;  2RB6 A;  4M7A G;  4XTU A;  4BB7 A;  3OYE A;  3GOX A;  3SWN B;  4R55 A;  3HL8 A;  5CKE A;  2R5A A;  2CZ0 B;  1S72 T;  3TU4 K;  4M77 E;  1Q82 C;  2VGM A;  5KE3 A;  3QKJ A;  5GAN 8;  2RO0 A;  2PU9 B;  5CR2 A;  2R57 A;  4XAX B;  2DXB A;  3DLM A;  3OYM A;  5GAM g;  4J7F A;  4BE1 A;  4DOV A;  1VQ5 A;  4FSX A;  3L2V A;  2ZGW A;  4J7I A;  2D9T A;  2QQR A;  3ASK A;  4QW2 A;  3JCM Q;  4M7A D;  2X4Y A;  2E70 A;  5CCA A;  1M1F A;  1NJI C;  3QO3 A;  1QVP A;  2L5Q A;  4A4E A;  2BIV A;  4C92 E;  1M90 U;  1N6A A;  1JJ2 S;  2CYZ B;  2QEX A;  2OTL A;  4HT8 A;  3EAE A;  4DOW A;  3JCM d;  1GXI E;  2RHI A;  4BY6 B;  2E5Q A;  1VQN A;  2IG0 A;  4A4F A;  3JCM b;  4YTL A;  2QTX A;  3M5A A;  3GNG A;  5GAO r;  3CXC A;  3CC7 A;  2HAX A;  2XID A;  2DIQ A;  4M77 G;  3LGF A;  4J5Y A;  2JOY A;  3VU3 C;  2GCX A;  5GAN 2;  3CCQ T;  1Q7Y C;  3JCM h;  4NS5 A;  5LJ5 e;  3CCU T;  1M1K C;  3CC4 A;  4LD6 A;  4XTX A;  2EWN A;  3A8M B;  1QP2 A;  3OMC A;  3CBP A;  4DA4 A;  1BYM A;  3KUF A;  3URG A;  4J8O A;  2RD1 A;  2YLC A;  4XTY A;  4LDW A;  1K73 C;  4PJO B;  4C92 G;  3MP6 A;  4C0Z A;  4ZN3 A;  3C95 A;  4M77 D;  1VQP A;  4M75 A;  4BAC A;  3MCA B;  3JCM c;  5CVI A;  4FM4 B;  3L2R A;  3G4S A;  1UGQ B;  4M75 C;  3SDZ A;  3S3N A;  1BI1 A;  1Q86 C;  3CPW A;  4LDV A;  1YJ9 A;  4JS5 A;  1QVF S;  4C92 D;  2RJC A;  3DB3 A;  1KQ2 A;  3QDR B;  2DTH A;  4M78 B;  3M55 A;  1VQ6 A;  3S3O A;  1FX7 A;  1N9R A;  3MP8 A;  5CKD A;  3CC2 A;  3RUX A;  1R8O B;  3NFC A;  3C12 A;  5KCO A;  3X24 B;  3MHX A;  3QUI A;  1UGR B;  1YCY A;  4J83 A;  4BD3 A;  3OYJ A;  4ELY C;  4F7U A;  4IUV A;  3ZBD A;  3DB4 A;  4C8Q E;  1BIB A;  3RKY A;  1U8R A;  4J6W A;  3RKX A;  1D3B A;  2HQE A;  3LH0 A;  2P0P A;  5IN1 A;  3JCM f;  3CCJ T;  4IUP A;  4TVR A;  2CGH A;  2PUO B;  1VQM A;  2MWP A;  1OZ2 A;  5C6S A;  3BDL A;  5GAN d;  3G6E T;  2E64 A;  2RI2 A;  5HY6 A;  2YLB A;  4M7D F;  3OW2 S;  5LJ3 h;  1KQ1 A;  4C0F A;  2ZPB B;  2E10 A;  2O01 E;  2Y4X A;  4ZN1 A;  4WF2 A;  3CMA T;  2LNV A;  3EFR A;  5LJ5 g;  4O5V A;  5GAN h;  3M58 A;  2K5F A;  2RI5 A;  4EMK B;  4C8Q G;  5CAI A;  3HRT A;  4A4H A;  3A8H B;  3M4G A;  4N0A A;  1Y07 A;  2EKO A;  2VYT A;  5I2M A;  3VV0 A;  4PL6 A;  2YHT A;  4C5I A;  2ZPG B;  3FDR A;  4B9X A;  3H6Z A;  5GAO p;  3CCQ A;  4J6X A;  2OAU A;  3CCU A;  4M7A A;  4N0A C;  1Y96 B;  3HSB A;  5GAN 5;  3VUB A;  4C8Q D;  4EPC A;  1ZBX A;  4M7A C;  3OA6 A;  3JCM J;  3CCL A;  2JTM A;  2EJF A;  3CCS T;  4JLI A;  5KCH A;  1KQS S;  3OYD A;  3JCM P;  4FT4 A;  3J81 E;  2KY9 A;  4J6Y A;  2EQJ A;  5A0G A;  3OS2 A;  2V8J A;  2D6F A;  3V8L A;  2KDS A;  3NTK A;  2E6N A;  3MP1 A;  4EDU A;  4HCB A;  4PJO E;  2PVG B;  4Q5W A;  5J26 A;  4MDX A;  3OQ5 A;  3GF5 A;  5GMK m;  4RKU E;  2PVD B;  2EAY A;  2E41 A;  3CPF A;  3JAM E;  3I55 T;  4N4H A;  3FEO A;  2E1H A;  4JRQ A;  2DXU A;  5GAM d;  3I56 T;  1W2B A;  4ATO A;  4M77 A;  5LJ3 f;  1NZ9 A;  3ZEH A;  1M9S A;  2JNG A;  3WXM B;  2XDP A;  3HP9 A;  2WAC A;  3UPU A;  1VQL A;  4M77 C;  5KH6 A;  4ZGE B;  3E9F A;  4NOY A;  5DLO A;  5GAN f;  2P4T A;  4NL3 A;  3NTH A;  1OYX A;  2H3J A;  4M78 E;  2RA2 A;  3RMS A;  3JB9 H;  5GAM h;  2EQM A;  4C92 A;  1N8R C;  1I8F A;  4MZT A;  4JLG A;  4C8Q F;  1IZ6 A;  1B34 A;  1MHN A;  4HCC A;  4PJO G;  1YJW A;  3CCJ A;  2WSE E;  2KQW A;  3L42 A;  4C92 C;  1YIT T;  5FU6 B;  2F5T X;  2RHU A;  5FLX E;  4O6J A;  1VQO A;  5HK0 A;  4OB2 B;  3V8K A;  3OYA A;  5HKC A;  3OS0 A;  3FJP A;  1BKB A;  3HKS A;  2PUK B;  4M75 B;  3E1S A;  4BI4 A;  3OYL A;  3OYH A;  3GPL A;  2YRV A;  4FT2 A;  3OYB A;  2LT4 A;  3CMA A;  3OMG A;  4D6W A;  4M7D E;  3SB2 A;  2ZPF B;  1K9M U;  1KHC A;  4M78 G;  4ZGJ B;  1UB4 A;  3RKW A;  4KT0 E;  5M9O A;  3O8V A;  2HD0 A;  3M56 A;  4MDW A;  1KC8 C;  2CS7 A;  5CQX A;  1K8A C;  1TH7 A;  1WNL A;  2LX9 A;  3JCM W;  3OYY A;  3OSV A;  3V7R A;  3HHT B;  2KK4 A;  5GAO m;  3CCM T;  2F5K A;  3CD6 T;  2M0O A;  3P8H A;  4LDY A;  5GMK h;  3WVD B;  3JCM X;  2OTJ T;  4E7H A;  2VXE A;  1UGS B;  3QYG B;  4OF1 A;  3RIR A;  3C94 A;  4EMG A;  1NPP A;  5HK3 A;  1NPR A;  3FC3 A;  3L2Q A;  2Y90 A;  2GFA A;  4F7U B;  1YHQ A;  5CIU A;  4M7D G;  1VQ8 T;  5GAM f;  3RMQ A;  4JRI A;  1D3B B;  1YI2 A;  1YJN T;  4N4G A;  3DKM A;  1N9S A;  2VV5 A;  3NTI A;  5FU6 C;  3QBY A;  1X6O A;  4BUG A;  5GMK i;  3OYF A;  4HT9 A;  5CK9 A;  3A8O B;  4RCB A;  1G3Y A;  1EIF A;  4OP0 A;  1M90 C;  4XU0 A;  4X34 A;  2EQK A;  4IUT A;  4MZM A;  2K57 A;  4PJO F;  3S6W A;  1DJ7 B;  1W2B S;  4M7D D;  4C8Q A;  5DM7 R;  1UGP B;  3DLL A;  2DD5 A;  4ZGD B;  3I55 A;  1O9S A;  2XKO C;  3I56 A;  1Q81 U;  2XHC A;  2HQX A;  1WJQ A;  3PMT A;  3SFM A;  2ZPE B;  4C8Q C;  3OS1 A;  3FB9 A;  4MML A;  3UT1 A;  3J7A F;  3L1A A;  2DD4 A;  3VJP A;  4PKC C;  1KG1 A;  2JUF A;  3LWH A;  2G3R A;  5I2S A;  4KBM B;  1WJS A;  3HFN A;  2ZPI B;  3QG1 A;  5DLQ E;  5LJ5 d;  2VUB A;  4M78 F;  5A2Q E;  4X9C A;  4A4K A;  3LYI A;  2FVU A;  2F69 A;  3QHS A;  3GP8 A;  4OMF B;  4M7A B;  4ZTF A;  2BUD A;  3QXE B;  1VQK T;  4PNO A;  3SD4 A;  5LJ3 e;  4FIB A;  4QVC A;  1YIT A;  5IAY A;  1WGS A;  3M4Y A;  3PFS A;  3CEY A;  3VUZ A;  4BDZ A;  3JCM g;  4BI3 A;  3PGG A;  1G3S A;  3INZ A;  1S72 A;  4XU2 A;  3HPW A;  3EFS A;  5IT9 E;  3QPH A;  1IRE B;  2IVW A;  2ZCF B;  3PT9 A;  4OB3 B;  2RJD A;  2GQV A;  5C0M A;  4JDS A;  1VQ7 T;  1M1G A;  3BW1 A;  5CKF A;  3FIF A;  4E47 A;  3CCV T;  4M75 E;  3RES A;  4C5H A;  3PIO A;  2R5M A;  1SSF A;  3LGL A;  2LVM A;  4A4G A;  2L3R A;  2WSF E;  3CXC S;  2X4J A;  2QDY B;  4M77 B;  4LDX A;  3QSU A;  1G5V A;  4N4I A;  3PIP A;  4Z02 A;  3CD6 A;  5EG2 A;  4JRP A;  3MET A;  1VQ9 T;  4VUB A;  3ZFJ A;  2RK2 A;  3QJ6 A;  4C92 B;  3OYG A;  2MI6 A;  3GLX A;  3X20 B;  1YJN A;  3L2U A;  1B34 B;  3A5Z B;  2RHX A;  3OB9 A;  1LNX A;  5LJ3 j;  5FRN A;  4KUI A;  4M75 G;  2QQ9 A;  1M5Q 1;  2RJF A;  3CPW S;  5GAN j;  5LJ5 f;  2MAM A;  4C5E A;  3V8J A;  2DEQ A;  2CZ7 B;  2RJE A;  1JJ2 A;  2FB7 A;  2K5L A;  2QA4 T;  5FRM A;  3JRZ A;  2DXC A;  4JRK A;  4QQD A;  4A53 A;  2A3L A;  2XK0 A;  2EYQ A;  5LJ3 g;  1JBM A;  3GIB A;  3MO8 A;  4OGE A;  1ZQ1 A;  4RMO A;  1M4Z A;  3MEV A;  5GAN 4;  2DO3 A;  2DJZ A;  5GAN g;  3CME T;  2DPP B;  2RI3 A;  3BY7 A;  3CC4 T;  5FU7 B;  3VYG A;  1RL2 A;  2V8K A;  2Y4Y A;  1VQK A;  4M7D A;  3OYN A;  3JB9 I;  3LLR A;  2M1H A;  2RHY A;  5A0L A;  1FWZ A;  1OZ3 A;  1H64 1;  1VQP T;  1KHI A;  4M7D C;  1JRI A;  3CBM A;  2DIG A;  4EMH A;  4II1 A;  2O4X B;  4XK8 E;  1Q82 U;  1Y7X A;  2KVQ G;  3LX7 A;  3N5B B;  4OVA A;  3V7C A;  4GLK A;  4JS4 A;  3G6E A;  4R56 A;  1OI1 A;  1AHJ B;  3A8L B;  1XQH A;  2P0K A;  1PSE A;  3H8Z A;  4BE2 A;  4A54 A;  2DTO A;  4ELZ C;  1VQ7 A;  4PLI A;  4PJO D;  2QXF A;  5I21 A;  1NJI U;  2LCC A;  2E65 A;  2EFI A;  2V8I A;  4LDU A;  3CCV A;  2C06 A;  1QVG A;  4DQ2 A;  1Y71 A;  4C8Q B;  1FXX A;  3JCM e;  4M75 F;  3JB9 F;  4UC4 A;  3V7S A;  5GAM j;  1VQ4 T;  4B9W A;  2EJG A;  2L89 A;  2HBP A;  4OGC A;  3CCE T;  1VQ9 A;  2DKG A;  2VXF A;  4QQ6 A;  3X28 B;  4BE0 A;  1YIJ T;  1HXD A;  2LQK A;  2X4W A;  2EIF A;  1Q7Y U;  4M78 D;  1M1K U;  4ME7 A;  3JCM V;  2A7Y A;  5FU7 C;  1I4K 1;  5CKB A;  3TEE A;  2LDM A;  4Y91 A;  3OBW A;  3TRE A;  3J80 E;  2LC4 A;  4KUL A;  3CCS A;  1VQM T;  2O4X A;  3FRN A;  1K73 U;  4FU6 A;  4V2S A;  3GNF B;  3PMI A;  5D6Y A;  1KD1 U;  5GAN 6;  2VC8 A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...