4BD3A

Phf19 links methylated lysine 36 of histone h3 to regulation of polycomb activity
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
SKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PHD FINGER PROTEIN 19
publication title Phf19 Links Methylated Lys36 of Histone H3 to Regulation of Polycomb Activity
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bd3A00
3OYIA 4II1A 2X4XA 2E5QA 3MEUA 3OMGA 4N4HA 4B9WA 2R58A 2RHIA 3MP8A 3UWNA 3ZEHA 5KH6A 1XNIA 3MEAA 2L8DA 4BD3A 2RJEA 4X34A 4GY5A 3OQ5A 3S6WA 3L2VA 3FDRA 3P8HA 2PQWA 2LTOA 5FROA 1SSFA 2X35A 2DIQA 4FL6A 1G5VA 2RI3A 4E7IA 3OYHA 5D6XA 4IUTA 3UT1A 3OYLA 5M9OA 1MHNA 3NTKA 2RJFA 2RHZA 3PMIA 3M9QA 2RI2A 2QQSA 2GFAA 2DAQA 3Q1JA 4C5EA 3OS1A 4N4IA 3OYBA 2WACA 3SD4A 2FHDA 2BIVA 2G3RA 4PL6A 3OYAA 3OYGA 3E9FA 1OYXA 3DB3A 4PLIA 2R5AA 2EKOA 4IUQA 3P8DA 1OZ3A 3L2QA 4E7HA 4E7KA 2GFUA 3ASKA 3MO8A 3PFSA 3QKJA 2EFIA 2X4WA 3OYEA 3OYCA 2JTFA 2E6NA 3H8ZA 2EQMA 3DB4A 4Z02A 3C4SA 2F5KA 3OYFA 4E7JA 4BACA 3OYJA 2JZ2A 2RHYA 5D6WA 4RG2A 4ZTFA 2EQUA 2RO0A 4UC4A 1WJRA 3S3NA 4A4FA 1KHCA 2RHUA 3NTHA 2R5MA 5FRNA 2EQKA 3MP6A 3OB9A 3H6ZA 3PNWC 5J26A 2O4XB 4Q5WA 3OYDA 4C5IA 3QBYA 3LLRA 2LRQA 3E9GA 3META 4OVAA 2YRVA 3FLGA 4PLLA 5KE2A 3L2UA 2P0KA 4CRIA 3DLMA 2MWPA 3FEOA 3PMTA 5D6YA 4QQDA 4A4EA 2L3RA 4C5HA 4IUPA 3LH0A 5FRMA 3L2RA 4FU6A 2EQJA 2K3XA 3CEYA 2HQXA 2K3YA 3LYIA 4IURA 3OY9A 2D9TA 4QW2A 4C5GA 4QVZA 4BE0A 1WJQA 5KCOA 5KCHA 3OA6A 2LVMA 5C0MA 3F70A 2IG0A 2HQEA 2RI5A 2XDPA 2LDMA 5IN1A 2RJCA 2GF7A 3L42A 5J39A 4BDYA 2NLUA 5CIUA 3O8VA 4IUUA 4LD6A 4BDZA 5IAYA 4BE2A 3OS0A 3MP1A 5KE3A 2B8AA 3S3MA 3OMCA 2L89A 1N27A 4L59A 3BDLA 3OYMA 3GOXA 1WGSA 2O4XA 1OI1A 2BKDN 3EAEA 3KUFA 2M16A 2VYTA 3LGFA 3ME9A 3NTIA 3QIIA 4QQGA 3LX7A 3OYNA 3S3OA 1WJSA 2LCCA 2RHXA 4N4GA 2XK0A 3OYKA 3QJ6A 4A4GA 2M0OA 4QQ6A 4E7LA 4EDUA 2BUDA 3LGLA 4A4HA 2X4YA 2MWOA 4BE1A 4NS5A 5C6SA 3FC3A 1RI0A 2RJDA 3L2WA 2R57A 4HCZA 4IUVA 4B9XA 3MEVA 4IKFA 2M1HA 1OZ2A 3MEWA 1H3ZA 3OS2A 2CKKA 4ZTJA 2DIGA 2QQRA
chains in the Genus database with same CATH superfamily
2DETA 2FZCB 3I56T 3SEMA 1U5SA 2DD4A 3EG0A 1VQ8Q 4N0AA 3X20B 1TTHB 4XTVA 4C0FA 2QASA 3QPHA 1W70A 2NWMA 1ZX6A 5IXBA 3RMQA 2AHJB 4EMHA 4ATOA 2E3IA 2QTVA 1CKBA 4J9HA 2WACA 2FHDA 5IHNA 1SHGA 2CT3A 1S72T 1UGQB 1M8VA 4M77C 4E7HA 2MYSA 2QQAA 1M90C 1WHGA 5LL6S 4C0DC 1GFDA 1GCQA 1VQ6A 1UG1A 4R0KA 5CKBA 2CP0A 1AZGB 2HBPA 3S3NA 2DX1A 2YUPA 3PVQA 1VQ6Q 2O4XB 2LMJA 3EGUA 2SEMA 3QUIA 2QA4T 1GL5A 3E9GA 4DQ2A 5LJ3j 4PLLA 1SEMA 2F5TX 1KD1R 1QQJA 1RACB 2LQ8A 3LWHA 2PVGB 4PJOD 3R6NA 4WTOB 2K7AA 4ORZA 1W6XA 5GMKl 1VQ7T 2DEQA 3VYGA 2K5IA 3E1SA 3OS0A 3QWXX 3CCQA 2EYYA 2NUTB 1W2BS 3EG9A 3KUFA 3CCQQ 4QQGA 5I2MA 3OYKA 4ZNXA 3ULRB 5CAIA 2A08A 2C0IA 1U06A 2DO3A 2ROLA 3CXCA 3DKMA 5HY6A 2HMAA 4RTWA 2VXFA 4JZ4A 2BE9B 3CPWS 1VQMT 4II1A 2ESWA 2EYXA 4C8QG 3DLLA 2OJ2A 3A8MB 4CI0C 4OB0B 3MEAA 5DM7R 1HYOA 4PJOA 4GY5A 3RERA 2D0NA 1Q7YU 3JV3A 1QKWA 5LJ5f 4QVCA 2JW4A 1Q7YC 1X6OA 4OMNA 3SWNC 1X01A 5HCKA 1G3YA 4LDUA 2PU9B 1ABOA 3E9FA 3PIOA 4PLIA 3HRTA 1OZ3A 5GMKi 1PKTA 3PIPA 2WSFE 4BI3A 2QDLA 4M75D 2RHYA 2XD0A 4ZTFA 1Q81U 2OTLT 1WIEA 4C5IA 4XU1A 1PSFA 2DERA 5CKFA 2WSCE 3GF5A 4C92C 3BE3A 1VQLA 1G3TA 1PD0A 3I55A 5FWBA 3GNGA 2LCSA 1D1CA 1VQLQ 5DY9A 2E1HA 2EAYA 3EGDA 5GANh 1W1FA 5J39A 2GF7A 1XTDA 5KYUB 2B86A 4EPCA 5GMKm 5GAMd 3CC7T 1Y07A 4PJOE 2O01E 2ZPIB 2V1QA 4C8QF 2M16A 3C95A 3CCLA 3CMEA 2WSEE 4M75A 2HDAA 1OOTA 5A0GA 2HSEB 1N5ZA 5LJ3g 4LXCA 4LDVA 2NUPB 3OSVA 4NS5A 3O5ZA 3L2WA 4OMOA 4B9XA 1E7OA 2JM8A 2E41A 3MEWA 1VQ8T 4JS4A 1AWXA 3QYGB 4LUDA 4AG1C 2RHIA 1XNIA 3FRNA 4BD3A 1YIJA 1G3SA 2RQWA 4ZGEB 3L2VA 2OX7A 1NPRA 2DXCA 4J9BA 1X2KA 2X35A 5GANf 3VS3A 1NPPA 2YT6A 2P4TA 2LT4A 4PFOA 2DL7A 2YUQA 5L23A 3FIFA 1ZHIA 2EYZA 2RHZA 4QT7A 1IZ6A 4F7UB 3A8HB 2DVEA 1VQKQ 4JLGA 2XG8D 4VUBA 4XU2A 3JCMg 4J9CA 2DFUA 2E6NA 1VQ6T 2F5KA 4CC3A 1GCPA 1LCKA 3PVLA 3CXCP 2EQKA 3CQTA 4O5VA 2AK5A 4M75F 4M75E 2XDDA 4YTLA 3JAME 1R77A 5D6YA 1VQ4A 4FM4B 3NHNA 4FU6A 4N0AC 2AZSA 4QW2A 1VQ4Q 5C0MA 1C1AA 3MPUB 4RTYA 4BDYA 5GMKh 1D0YA 2DNUA 2PUOB 2RK1A 1EZZB 3OBYA 3CCQT 4JRKA 3V7CA 1JEGA 2QQ9A 2KDSA 3RIRA 3EAEA 3OYNA 3LX7A 2M0OA 2VC8A 1YCSB 2X3XD 1N9SA 1RADB 5FU7C 1WHMA 1TU0B 2F2WA 2YSQA 1WI7A 2M51A 1B7TA 2J6OA 3SHWA 5CKEA 3GBQA 1OX9A 1BCMA 4M77G 1D09B 2YLCA 1U8RA 3ZEHA 1V76A 2CZ6B 5LJ5d 2DXBA 1GBQA 2EJ9A 3WXMB 1AWWA 3UDCA 3OYHA 2MCNA 5GAOm 4C5EA 1QP3A 3MHXA 3OS1A 1AWJA 2V8IA 4K11A 1ZSZB 5KYXA 1I81A 1ZLMA 5IHIA 2DK3A 5CO7A 1RL2A 3I56Q 2OAWA 4MMLA 3CCVA 3JB9H 1NBEB 4NOYA 1FMKA 4M78B 1K8AU 1T3LA 1UUEA 4M7AD 1RLQC 2AZVA 2HKQB 1VQLT 1TH7A 2LRQA 3JB9J 3FLGA 3I55T 3L2UA 3EFOB 4XTZA 2F2VA 2MWPA 2W0ZA 2RF0A 4PJOC 2A28A 3QYHB 3LYIA 3OY9A 1A0NB 1KQSA 4J7IA 5KCHA 2COZA 3JB9D 2KRSA 1S72Q 5IN1A 2LDMA 1BBZA 1SRMA 1M3CA 3MP1A 2DJZA 3RKYA 4M77F 4PNOA 1JO8A 3H0HA 5FU6C 3X26B 2XICA 5HK3A 2LCCA 1PRLC 4BY6C 2VUBA 1Z9ZA 1BB9A 2E4HA 4M7AA 2KR3A 3CCMQ 5L8RE 2P84A 1MMGA 1JQQA 4KRTA 1H92A 4LDWA 2NUPA 1YJ9Q 4XU3A 5J3BA 3HPWA 4HXJA 3G6EA 1TUGB 2V26A 3VS1A 3KBGA 4AFUC 2R58A 2YRDA 1UGPB 3MP8A 5KYYB 3G6EQ 1YIJT 1VQ7Q 2FZGB 2VXEA 4L5GA 5GANd 3U23A 2YXYA 4AT1B 1JB0E 5FROA 3VS6A 1NYFA 3H41A 1JBMA 1G5VA 2P4RA 1VQKT 3CC4A 4C92G 3OYLA 2RJFA 3UF4A 2F69A 2GQVA 4JRQA 2ZPHB 4P5NA 3MO8A 2DXTA 3EG3A 4M75C 1YN8A 1VQMQ 1P92A 2BZYA 3N5BB 3CCRA 4RG2A 2VWFA 4OB2B 1WJRA 3RUXA 3NTHA 1UHFA 3EH1A 1UGVA 2L3PA 4C8QB 3HRUA 5FLXE 1UTIA 1MMNA 1VQ4T 1X27A 1YBYA 2G6FX 4DOWA 5GAMh 1LPLA 3PTAA 4M7AE 1S1NA 1YITA 4M7DD 4HKEA 4A4KA 4RKUE 2Y4XA 2RJCA 3RNJA 3CCEA 2F2XA 4PKCC 1YITQ 4ZN1A 2DKGA 3EH2A 1ZBXA 2CGHA 2MF2A 3TU4K 1KQ2A 4OMLA 3JB9F 1UDLA 3M58A 1VQOA 1PKSA 3QJ6A 2BTTA 2K79A 1KC8U 4EDUA 1WHLA 1NZ9A 3RDVA 1VQOQ 1R8OB 3OSSC 5C6SA 1Q86U 2CZ7B 1Y96B 4PFPA 1ZUUA 2JT4A 3M53A 1IO6A 4C92F 4E7ZA 3CD6A 4OB1B 1YWOA 4OMPA 1OV3A 2X9HA 3H0FA 4M7DA 3QDRB 5CQYA 4O6JA 3EFSA 5GAMf 4RTTA 4M78D 3G4SA 1Y0MA 4Y91A 3CC7Q 2LTOA 2FRWA 3CBOA 1U1SA 2D8JA 2V8JA 2HZYA 3SFMA 3BDUA 2RI2A 2XU8A 4JDSA 2BZXA 4N4IA 1H8KA 5DLOA 4PL6A 4FYYB 4OP0A 3CC2A 3P8DA 2HKNA 1AZEA 5CCAA 1N9RA 1HSQA 1QVGA 1VOMA 2DBMA 5LJ5e 3CC2Q 2RQTA 2J7IA 2DTOA 2LQWA 4Z02A 2ZCFB 3G1JA 4F14A 1YI2A 2J05A 1WXBA 2PTKA 1G83A 2VV5A 4UC4A 2YWWA 3OBWA 4LNPA 3CCJA 3OW2S 3QBYA 1YI2Q 4Y28E 4OVAA 2YRVA 3G71A 7AT1B 5KE2A 3PMTA 3CCJQ 1FYNA 8AT1B 4KBMB 3G71Q 4KUDK 1K0XA 2KGTA 2O88A 5KCOA 3RKWA 2LVMA 2XDPA 2ZPGB 1M5Q1 1EFNA 3M0TA 4IUUA 3BW1A 1MUZA 3T9NA 1QWEA 4M7DE 2L89A 4DBHA 3LGFA 3CCMT 3ME9A 2VYTA 4RUGA 1GXIE 4HVWA 2COYA 2J6FA 1YJ9T 1Q7YR 1AVZC 3LGLA 2HBWA 4A63B 2KXDA 2HL3A 4AFQC 1X69A 1QVFS 4BE1A 4WF2A 5EG2A 5LJ5h 2R57A 2GQIA 2DLPA 3G6ET 4IKFA 1M30A 4JPBW 1M2VA 2KE9A 2PZ1A 1K1ZA 4ELZC 2E5QA 2RN8A 4LD9K 1HXDA 4X34A 1K73U 2A36A 4JJDA 4JS5A 1M3BA 1GBRA 2K6DA 2DM1A 2RI3A 1I4K1 3CC4T 4M78E 2GNCA 2KYMA 3G7ZA 2GFAA 2QQSA 3Q1JA 1NJIU 2KNBB 4PJOG 3VUBA 1WYXA 2BIVA 2EJGA 1QCOA 2KEAA 4BI8B 4X9CA 5GANe 2K5FA 2AKLA 3JCMJ 3TQ7P 3DB4A 4MMKA 5CKDA 3V7SA 3OYJA 2JZ2A 4M7AC 1DJ7B 3V8LA 5FRNA 2LJ1A 1RAIB 1Q82U 2DF6A 3OB9A 4M77B 4Z8AA 2MIOA 3CBPA 1Q82C 4EMGA 4C0DB 1SRLA 1JJ2S 2KROA 4A4EA 2Z0WA 3LH0A 1YITT 4RTUA 2D8HA 4IIMA 4IURA 2FRYA 2PVOB 1WJQA 4FT2A 4JRPA 2RI5A 3A5ZB 1QW1A 3J81E 1XQHA 4EMKA 4E6RA 2YRCA 3S3MA 1RABB 3EG2A 3TCJA 2CP2A 1W2BA 2O9VA 1UECA 3BDLA 1Q81C 1VQOT 1PNJA 1RAEB 2QI2A 1LNXA 2FPEA 1T0JA 4A4GA 4E7LA 2JM9A 3INZA 2ABLA 4FYVB 1QVGP 3I55Q 1LVKA 3FC3A 1I07A 1YHQA 4HCZA 4A54A 3CD6T 3CPWA 2QEXA 5LJ3d 2A3LA 2FO0A 3JCMQ 3TSZA 1YHQQ 4PJOF 2X4XA 1OQKA 2QEXQ 4XTYA 4M75G 1B34B 3G4ST 3HSBA 1V1CA 4QKUA 4OMQA 2PQWA 2EKHA 4PFZA 1N8RU 3CCLQ 1I8FA 3CMEQ 3EGXA 2JMCA 3GNFB 5M9OA 1BIAA 2FB7A 1WHHA 3VYHB 1H3HA 1X75C 3SD4A 1ZSGA 3CC2T 2YUOA 1OX8A 1CSKA 1K0SA 1MMAA 2DILA 2X4WA 4Z88A 3SWNB 1W4SA 3C4SA 1YI2T 5GMKe 1SKUB 1YIJQ 4HA8A 5GAOl 1RAHB 4OF1A 2RHUA 2FPFA 3BY7A 3CCJT 3H6ZA 3G71T 2DRMA 3LLRA 2ATCB 1VIFA 3I5SA 5GAN5 4KGVB 3DLMA 4RMOA 4OMFB 4QQDA 5GAN8 2L3RA 4M7DC 2HEQA 2LJ0A 3HHTB 2K3XA 4CC4B 2D0QB 4C92B 1N6AA 2FEIA 2NLUA 4BE2A 2KI7A 2JS0A 4J7FA 1PCXA 2HQHA 3A8OB 4HT9A 3M0SA 1IGQA 1QP2A 5GAN4 2O4XA 1OI1A 3S3OA 3I9QA 2AKKA 1M1GA 5FW9A 1D3BB 2BE7D 1FMWA 2BUDA 2EQIA 1K9MU 1K76A 3FB9A 2QYZA 2CUBA 3UA6A 1WXTA 1K9MC 3ER0A 2QTXA 3V8KA 4Y92A 1PHTA 3MEUA 2K3BA 1QWFA 2L8DA 1JXMA 3OQ5A 3S6WA 2NUTA 2E3HA 2LJ3A 3KXTA 3M4GA 2CZ1B 4XU0A 2LX7A 5AYFA 1K8AR 1QCNA 1SSHA 2EIFA 2C0TA 2M02A 1K4US 4NL2A 3JCMW 1X6GA 2VASA 2CREA 1W2BP 2HD0A 2E10A 2V1RA 1NEBA 1X43A 3FJ5A 1YJWA 2EKOA 3VV0A 1BYMA 2MAMA 4PJMA 1IHWA 3RR6A 3HFOA 5GANj 1BKBA 3TEEA 2COWA 1YJWQ 1KQSS 3OYFA 3LW5E 5D6WA 2DL5A 2ZPEB 3PGGA 3JCMP 4J83A 3X28B 4HCKA 4F04B 3CPWP 1YNZA 1PM3A 5EC7A 1TOVA 3META 4J9DA 3FEOA 4RCCA 4C5HA 1PRMC 1RI9A 2D9TA 5A2QE 1TG0A 1E6GA 1Z9QA 1WHKA 3CMAA 4LD6A 5LJ5g 5KE3A 3CCVQ 1BI0A 1K8AC 3UATA 4HCCA 2DYIA 4LDXA 1UJYA 5GAN7 1CKAA 1TUDA 1Y57A 5CR2A 3C0CA 1KK7A 1YHQT 1J3TA 3JCMX 4DBQA 4BI4A 2QEXT 3MEVA 4LDYA 1WNLA 1OZ2A 5HK0A 4PK4A 2CT4A 3OYYA 2RH2A 5KYUA 2E65A 1FWZA 2CP6A 3UWNA 2IVWA 5A0LA 3CCLT 3CMET 1ZUKA 2EGAA 1YP5A 4M7AG 4D8KA 2DIQA 1M1KU 4FL6A 2JTEA 4PJLA 2X51A 4XAXB 1R0CB 3M9QA 1VQNA 4EMKC 5A0DA 4DA4A 4OGCA 2CH4A 2DTIA 3JB9G 5GAMe 1MV3A 4DEYA 1VQNQ 1MV0B 4FSSA 1ZQ1A 2RNAA 3ASKA 1PD1A 2DL8A 4FYWB 3VS7A 4LN2A 3V8JA 5CK9A 3D7SB 3MCAB 5GMKj 1SHFA 3JB9I 4Z89A 1AD5A 2PVDB 2DTHA 1I1JA 4XTUA 3PE0A 3IQLA 4NL3A 4FCYA 1NLOC 4GLMA 3EG9B 1ZUYA 3HRSA 2J06A 2D1XA 3C94A 3CC4Q 1UE9A 2P0KA 4F7UA 2KYBA 3NMZC 2LQKA 4ESRA 1WX6A 2HQXA 1KC8R 2CSQA 3H0IA 4BE0A 3GIBA 3A98A 2GTJA 5ECAA 2RB6A 1U3OA 1Q86R 5IT9E 2HQEA 4FIBA 2QAZA 5GANg 2VGMA 3LWIA 1VQ5A 1ZA1B 3MJXA 2OTJA 1TSFA 3HTRA 1VQPA 5IAYA 5GAN3 2XDBA 4JLIA 3CCRQ 1IXDA 1VQ5Q 2D6FA 2OTJQ 1VQPQ 3QIIA 5KYNA 1BI2A 1ZBJA 5LJ3h 2JN0A 5GAN2 3CCUA 1Y7XA 4JUVA 4M7AF 1D3BA 4RTXA 2MWOA 1UEBA 2FG0A 3CCUQ 2K2VA 2KRMA 1UGRB 5FU6B 3VU3C 3M55A 3THKA 1VUBA 4FYXB 4ZGDB 3QZ5B 2FPDA 2QQRA 4BY6B 1D1BA 3CCEQ 3M0QA 5KH6A 3RKXA 4FW2A 2RJEA 2LNVA 1WA7A 2L2PA 1D1AA 2HL5C 3P8HA 1PWTA 2EW3A 1NEGA 3BFMA 4MDWA 2P0PA 4AG2C 1VQ9A 1KC8C 4IUTA 2VB6A 4XQ3A 1MHNA 3NTKA 3PMIA 5I2SA 1PC0A 1Q86C 4M7DG 2KSSA 2K5LA 4F7UF 4F7UE 2PNIA 5IXFA 3OYGA 1YJWT 2OI3A 3OYAA 3CD6Q 2H3JA 5LJ3f 3EGDB 2JUFA 1VIEA 1ARKA 1RLPC 1JRIA 2GFUA 4F16A 2PUKB 2HAXA 5HKCA 4E7JA 3G4SQ 2DXUA 2L3SA 3REBB 1SG5A 2NYSA 1KHCA 2ZPFB 2ED1A 4LE9A 2DRKA 1VYUA 1VYTA 1BI3A 3M57A 4M75B 3MKDA 2O31A 2X4JA 1F1BB 4CC7A 2KQWA 5FRMA 2CH4W 2DL4A 3CEYA 2K3YA 3E2UA 2DL3A 4QVZA 3CCVT 3JCMb 1ZSZA 2ED0A 2LX9A 3CMAT 3R6OA 5AT1B 2CUDA 4D8DA 3RMSA 1UHCA 5CIUA 3O8VA 5I22A 1I5LA 4AFSC 4QVDA 1G2BA 2XKOC 5GAOp 3QZ9B 4M78A 3ZBDA 2V8KA 1N27A 1C6VX 2HCKA 2JXBA 2E64A 1WGSA 3JCMf 3NTIA 1WJSA 1K73R 1I5OB 1QKXA 3EFOA 4A4HA 1BK2A 4J6XA 4DBFA 4M4ZA 3CXCS 3OS2A 1OU9A 4M7DF 1NJIR 4N4HA 4B9WA 4KT0E 1M90U 4ME7A 2YDLA 2DEUA 4PJNA 3TREA 2M0YA 4R56A 3AT1B 2X3WD 4WCIA 1WQWA 2DJQA 1ACMB 5D6XA 3SDZA 4KH0B 1VQNT 1Q82R 2DYBA 2VKNA 3OYBA 5GAMj 4RCBA 6AT1B 1UJ0A 2R5AA 2L5QA 3ZFJA 3L2QA 4FW1A 5KYYA 2KMTA 2O2OA 3QKJA 1G3WA 3VS0A 1K73C 4C8QD 2QG9B 1ZA2B 5GJWB 2EQUA 4M78F 3OW2A 1ABQA 3NFCA 3UA7A 1Q81R 2XI9A 3WVDB 1OEBA 1IHVA 3M56A 5I11A 2L3QA 2EWNA 2LP5A 1NJIC 2JMAA 2QDYB 1M27C 2XMFA 2OAUA 4C5GA 3FJPA 3CCRT 1PSEA 1VQ5T 2IG0A 2OTJT 1VQPT 4JJBA 2GGRA 4BB7A 1VYVA 2DA9A 2KXCA 4L59A 2DE0X 1LOJA 4HT8A 1KD1U 4MDXA 3CCUT 4C8QA 1IRXA 2RQVA 1QVFA 1KD1C 2JJ9A 3JCMV 1N8RR 1BIBA 3CCET 2RJDA 3V7RA 1HD3A 2FVUA 1X2QA 2M1HA 3VKIA 3GPLA 2CKKA 4AFZC 3C12A 2CS7A 1R0BG 5KYXB 1WZOA 1HJDA 4X1VA 3QHSA 4E47A 1AT1B 1G8XA 1QCFA 3PT9A 2BZ8A 3EG1A 3JSCA 4MZTA 1YJNA 2EBPA 1VQ9T 3E19A 1M2OA 4RG8A 4E7IA 1K9AA 4IIOA 1YJNQ 2QGGA 5GAOn 1Y96A 4E2FB 2NUZA 3QSUA 4KUIA 2ZZDA 1YFNA 2GCXA 1KSWA 5GAOq 4FT4A 4IUQA 1IREB 2E12A 2RM4A 3VUZA 1TWBA 1NE8A 2L0AA 2QQBA 3A8LB 3OYEA 1OULA 2EQMA 4OB3B 4BACA 5KYWB 1UFFA 2VVKA 1RUWA 2DZCA 3EHRA 1N8RC 3M5AA 3PNWC 1SF9A 3QXEB 1JJ2A 4C8QE 3VRZA 2DBKA 2XHCA 3RESA 2VGNA 1LJOA 2AT1B 3VJPA 1KG1A 3L2ZA 4IUPA 4M7AB 2MI6A 5GAMg 1K9MR 5LJ5j 4C0ZA 4BUGA 3JRZA 4JZ3A 3JCMd 2B8AA 5DLQE 3OMCA 1NM7A 1TXQA 2RQRA 4MZMA 2ZAEA 1Y71A 3M54A 4CC2A 3OYMA 3GOXA 2A37A 1UB4A 2BKDN 4ANJA 1AWOA 1O9SA 2LT1A 4J6WA 4N4GA 2XK0A 3HL8A 4JJCA 4KH1B 3VS4A 2KAFA 4QQ6A 2Y4YA 1BCOA 3CPFA 1M9SA 2RMOA 2X4YA 4JRIA 3J80E 2A0FB 2HSPA 4J9GA 2H8HA 3REAB 2P0QA 3I5RA 1VQKA 3OW2P 4ZTJA 8ATCB 4AMCA 2FZKB 4F17A 3OYIA 2DMOA 2ROTA 1WHJA 1GRIA 3X24B 3CCSA 2FYKA 4HVUA 2I0NA 1B3QA 4V2SA 1SSFA 4ZN3A 2DD5A 3CCSQ 2DZ9A 3X25B 1ZSZC 1FX7A 1MNDA 3TVTA 9ATCB 3P8BB 2MOXA 3GP8A 3OS5A 3QWYA 4M78C 3WVEB 1OYXA 3VS5A 2EFIA 4M77D 2RA2A 1XOVA 4JJNK 1QVFP 3URGA 2CSIA 3QDFA 1SPKA 4R55A 1U1TA 2E6ZA 3TSWA 2JNGA 3MP6A 1C0MA 5J26A 4DBRA 3OYDA 2JTMA 1EX4A 1JU5C 1KFZA 3L1AA 1KJWA 3RBBB 3VRYA 2YLBA 2MK5A 3L2RA 2EQJA 2K9GA 5GJVB 1NLPC 3OA6A 2KK4A 1GCQC 4C0GA 3QG1A 4DEXA 2DVJA 4M7DB 4EIKA 2LQNA 2EYWA 2SRCA 2KT8A 4M77A 3UPUA 2CP7A 1I0CA 1NG2A 1PG5B 2LNHB 3LH5A 5CVIA 1UGSB 1M1KR 2C0OA 2QK0A 5GAOr 4DOVA 1OU8A 4IUVA 3KFVA 4J9IA 1H3ZA 2DPPB 2ZPBB 3A8GB 1Q95G 3CMAQ 1QVPA 1JJ2P 3J7AF 3HKSA 3I56A 4D6WA 2KY9A 3ZL7C 3M0PA 1YJNT 1T0HA 3QO3A 2FL7A 3NGPA 4J9FA 2HNIA 1M3AA 1IGUA 4XTXA 2ZGWA 3I35A 2DAQA 4J9EA 2G3RA 1WDXA 2RD1A 3DB3A 2C06A 4B6MA 2GTOA 1OPLA 5I21A 1S72A 5FU7B 3PFSA 1B34A 1FMVA 4C8QC 1MMDA 2JTFA 5FWCA 1XJWB 2MMPA 3H8ZA 4GLKA 2RQUA 4OMMA 2E70A 1D0XA 1H641 1TUCA 2F1LA 3M59A 4A4FA 1M1KC 1MGQA 5KYWA 4M77E 1QLYA 1V29B 1B07A 1VA7A 4FSXA 3VS2A 1HK9A 5LJ3e 2MPXC 2QA4A 2EPDA 4CRIA 3CCMA 2EGCA 2JVVA 2K4YA 4C92D 1RAGB 3HP9A 1E6HA 1RAAB 1YJ9A 2QA4Q 4E7SA 1JXOA 4J8OA 1M2VB 4GBQA 3SWNA 3F70A 2QGFB 3L42A 5IHKA 2GBQA 4BDZA 3M4YA 1VQ7A 1KIKA 2RK2A 2EVRA 3M0RA 2H3EB 2JOYA 2XIDA 4F7UG 1EIFA 3AHUA 5IH2A 1M4ZA 2RHXA 2E5KA 1TS9A 2M9UA 3H9NA 4RTVA 3JCMc 1AOJA 4XTWA 2CYZB 2K57A 2KRNA 1RI0A 1X6BA 4ZGJB 4RTZA 4LUEA 4XK8E 1WXUA 2DIGA 4C92A 4PJOB 1KHIA 3OMGA 3JCMe 1VQMA 3CCST 2ENMA 2KVQG 4J6YA 4MZPA 3FDRA 1BI1A 4A53A 1OPKA 4KGXB 2W10A 1AHJB 4TVRA 2AIRB 5D7UA 1WLPB 3UT1A 1NYGA 2QXFA 3HFNA 4J5YA 5CKHA 4KULA 2ECZA 2KBTA 2RPNA 1QMCA 2LCLA 2J6KA 4E7KA 3A1PA 2LZ6B 1YCYA 3CBMA 1BU1A 4OGEA 4PJJA 3OYCA 4KGZB 4EMKB 1QVGS 1D0ZA 2RO0A 5GAN6 2CZ0B 2R5MA 4L6V5 3QJYA 2JS2A 1O75A 4Q5WA 2OTLA 1WFWA 2IIMA 1VQ9Q 3M0UA 2K2MA 1T3SA 2LC4A 3EHQA 3JCMh 3EFRA 2OTLQ 1YWPA 1MNEA 4HCBA 2YUNA 2CP3A 2CP5A 3NPFA 4HVVA 4C92E 1M8MA 1WPYA 2A7YA 2IPOB 2O9SA 3CC7A 1GFCA 2KT1A 1RAFB 4X9DA 2YHTA 1M90R 2EJFA 2EGEA 2CDTA 3EGXB 1AEYA 1KQ1A 1M1FA 1KQSP 1IB8A 3GLXA 4ELYC 3SB2A 2I2LA 2Y90A 1FXXA 1WQ7A 5CQXA 4M78G 2EYQA 1VQ8A
chains in the Genus database with same CATH topology
3I56T 3MEUA 2R58A 1UGPB 3MP8A 1YIJT 2DD4A 2VXEA 4L5GA 2L8DA 5GANd 4N0AA 3OQ5A 3QHSA 4E47A 3S6WA 1JB0E 3X20B 3PT9A 5FROA 4XTVA 3JSCA 4MZTA 3KXTA 4C0FA 1YJNA 3M4GA 1VQ9T 3E19A 3QPHA 1JBMA 1G5VA 2CZ1B 4RG8A 4E7IA 4XU0A 3RMQA 5AYFA 1VQKT 2AHJB 3CC4A 2EIFA 4C92G 3OYLA 5GAOn 2RJFA 4EMHA 1Y96A 4ATOA 4NL2A 3JCMW 3QSUA 4KUIA 2HD0A 2ZZDA 2WACA 2E10A 2FHDA 2F69A 2GCXA 1YJWA 2GQVA 1UGQB 2ZPHB 4M77C 4FT4A 2EKOA 4IUQA 1IREB 5GAOq 4P5NA 2E12A 3VV0A 4E7HA 2MAMA 1BYMA 2RM4A 2QQAA 3VUZA 3MO8A 3HFOA 1NE8A 2DXTA 2QQBA 4M75C 5GANj 1M90C 1BKBA 3A8LB 3TEEA 3OYEA 5LL6S 4C0DC 2EQMA 4OB3B 1P92A 1KQSS 3N5BB 3OYFA 3LW5E 3CCRA 4BACA 1VQ6A 5D6WA 4RG2A 5CKBA 4OB2B 2ZPEB 3PGGA 2HBPA 4J83A 1WJRA 3JCMP 3S3NA 3X28B 3RUXA 3NTHA 2DZCA 1N8RC 3M5AA 3PNWC 2O4XB 3QXEB 3QUIA 1JJ2A 4C8QB 3HRUA 3E9GA 3META 4C8QE 2QA4T 4DQ2A 2XHCA 5FLXE 4PLLA 5LJ3j 3RESA 1M8VA 1VQ4T 2F5TX 2VGNA 3FEOA 1LJOA 1YBYA 3VJPA 4DOWA 4RCCA 4C5HA 5GAMh 3L2ZA 4IUPA 4M7AB 3PTAA 4M7AE 1KG1A 2LQ8A 1YITA 2MI6A 5GAMg 4M7DD 4HKEA 4A4KA 2D9TA 3LWHA 2PVGB 4PJOD 5LJ5j 4RKUE 2Y4XA 5A2QE 4C0ZA 5GMKl 4BUGA 2RJCA 3CCEA 3CMAA 4PKCC 1VQ7T 3JRZA 2DEQA 4LD6A 4ZN1A 2DKGA 3VYGA 5LJ5g 1ZBXA 2CGHA 2K5IA 2MF2A 3E1SA 5KE3A 2B8AA 3JCMd 5DLQE 3OS0A 3TU4K 3OMCA 3CCQA 1KQ2A 4MZMA 1BI0A 1K8AC 4HCCA 1Y71A 3M54A 3JB9F 3OYMA 3GOXA 4LDXA 1UB4A 1W2BS 2BKDN 3KUFA 3M58A 4QQGA 1O9SA 2LT1A 4J6WA 4N4GA 5I2MA 1VQOA 5GAN7 2XK0A 3OYKA 3QJ6A 3HL8A 5CAIA 2KAFA 1KC8U 4QQ6A 4EDUA 2Y4YA 3CPFA 1M9SA 2X4YA 1NZ9A 4JRIA 5CR2A 1R8OB 2DO3A 3OSSC 3J80E 1YHQT 5C6SA 1Q86U 2CZ7B 1Y96B 3JCMX 3DKMA 3CXCA 2P0QA 4BI4A 2QEXT 5HY6A 3MEVA 3M53A 4LDYA 4C92F 1WNLA 1VQKA 1OZ2A 3CD6A 2VXFA 4ZTJA 5HK0A 4OB1B 3OYYA 3CPWS 2RH2A 3OYIA 1VQMT 4II1A 2E65A 4M7DA 3QDRB 5CQYA 4C8QG 4O6JA 1FWZA 3A8MB 3EFSA 2IVWA 3UWNA 5A0LA 4CI0C 4OB0B 3MEAA 5GAMf 5DM7R 3CMET 4M78D 3X24B 3CCLT 3CCSA 4GY5A 3G4SA 3RERA 2FYKA 4Y91A 1Q7YU 2LTOA 4M7AG 4V2SA 1SSFA 2DIQA 3CBOA 4ZN3A 2DD5A 1M1KU 5LJ5f 4QVCA 1U1SA 2DZ9A 4FL6A 3X25B 1Q7YC 2V8JA 1X6OA 3SFMA 1FX7A 3BDUA 3SWNC 1X01A 4XAXB 1G3YA 3M9QA 1VQNA 3P8BB 4EMKC 5A0DA 2RI2A 2XU8A 3GP8A 4OGCA 4DA4A 3OS5A 4JDSA 2DTIA 4N4IA 4LDUA 5DLOA 4M78C 2PU9B 4PL6A 3WVEB 3JB9G 5GAMe 3E9FA 4OP0A 1OYXA 3PIOA 4PLIA 3CC2A 3HRTA 1OZ3A 3P8DA 5GMKi 5CCAA 1N9RA 1ZQ1A 3ASKA 2EFIA 4M77D 2RA2A 1XOVA 4JJNK 3PIPA 2WSFE 3URGA 1QVGA 3V8JA 4BI3A 5LJ5e 4Z02A 2DTOA 5CK9A 3MCAB 4M75D 5GMKj 2RHYA 2ZCFB 2XD0A 4ZTFA 3JB9I 1YI2A 2PVDB 4UC4A 2VV5A 1U1TA 4R55A 2DTHA 4XTUA 2E6ZA 4NL3A 1Q81U 2JNGA 3MP6A 2OTLT 3OBWA 5J26A 3OYDA 3CCJA 4C5IA 4XU1A 3OW2S 1PSFA 3HRSA 3QBYA 5CKFA 2JTMA 2WSCE 4Y28E 4OVAA 3GF5A 4C92C 2YRVA 3C94A 3G71A 1VQLA 1S72T 3L1AA 5KE2A 2P0KA 1G3TA 4F7UA 3PMTA 3I55A 2YLBA 3GNGA 3L2RA 2LQKA 4KBMB 2EQJA 2HQXA 5DY9A 2E1HA 2EAYA 4KUDK 4BE0A 3GIBA 5KCOA 5GANh 3RKWA 2RB6A 2LVMA 2KK4A 3OA6A 5IT9E 4JRQA 2HQEA 2XDPA 2ZPGB 4FIBA 5J39A 1M5Q1 2GF7A 2VGMA 5GANg 1XTDA 3LWIA 1VQ5A 2OTJA 4IUUA 4EPCA 3DLLA 5GMKm 3BW1A 4C0GA 3QG1A 5IAYA 3T9NA 5GAN3 1VQPA 5GAMd 2XDBA 4M7DB 4M7DE 3CC7T 2L89A 1Y07A 4JLIA 4PJOE 2O01E 2ZPIB 2D6FA 4C8QF 4M77A 3UPUA 3LGFA 3CCMT 3QIIA 2M16A 2VYTA 3C95A 1BI2A 3ME9A 3CCLA 5LJ3h 2JN0A 2WSEE 4M75A 5A0GA 5GAN2 3CMEA 1GXIE 3CCUA 1Y7XA 4JUVA 1YJ9T 4M7AF 5LJ3g 3LGLA 5CVIA 1UGSB 1D3BA 4LDVA 2MWOA 1UEBA 3OSVA 4BE1A 4NS5A 1QVFS 4WF2A 2K2VA 5EG2A 3L2WA 4DOVA 5LJ5h 1UGRB 2R57A 4IUVA 5FU6B 3VU3C 4B9XA 5GAOr 3M55A 3G6ET 1VUBA 4IKFA 2E41A 4ZGDB 3MEWA 1VQ8T 1H3ZA 2DPPB 2ZPBB 4JS4A 3QZ5B 4ELZC 3QYGB 2QQRA 3A8GB 4BY6B 2E5QA 1QVPA 2RHIA 3J7AF 3HKSA 3I56A 4D6WA 4LD9K 2KY9A 3RKXA 1XNIA 1HXDA 3FRNA 4BD3A 5KH6A 2RJEA 2LNVA 4X34A 1YIJA 1G3SA 1K73U 4ZGEB 3L2VA 1NPRA 3P8HA 2DXCA 1YJNT 3QO3A 2FL7A 3BFMA 2X35A 4MDWA 4JS5A 5GANf 2P0PA 1NPPA 2P4TA 2LT4A 2RI3A 1I4K1 1VQ9A 3CC4T 4M78E 2HNIA 1KC8C 3FIFA 4IUTA 1ZHIA 4XQ3A 1MHNA 3NTKA 3PMIA 2RHZA 3G7ZA 5I2SA 1Q86C 1IZ6A 4XTXA 2ZGWA 4M7DG 2GFAA 2DAQA 2KSSA 2K5LA 2QQSA 3Q1JA 4F7UB 4F7UF 4F7UE 1NJIU 4PJOG 3A8HB 3VUBA 3OYGA 2G3RA 2BIVA 2DVEA 3OYAA 1YJWT 4PJOA 2RD1A 3DB3A 2C06A 2H3JA 5LJ3f 2JUFA 1VIEA 2EJGA 4JLGA 1JRIA 2XG8D 5I21A 4BI8B 1S72A 4VUBA 4XU2A 5FU7B 2GFUA 3PFSA 4X9CA 1B34A 3JCMg 4C8QC 2PUKB 5GANe 2K5FA 3JCMJ 2JTFA 2E6NA 2MMPA 3DB4A 3H8ZA 5HKCA 4MMKA 4GLKA 5CKDA 2HAXA 1VQ6T 2F5KA 3V7SA 2E70A 4E7JA 3OYJA 2JZ2A 2DXUA 1H641 4M7AC 1DJ7B 3M59A 4A4FA 1KHCA 2ZPFB 3V8LA 5FRNA 1Q82U 2EQKA 1M1KC 1MGQA 3OB9A 4M77B 4M77E 1V29B 4FSXA 1BI3A 4O5VA 3M57A 3CBPA 4M75B 4M75F 4M75E 2XDDA 1Q82C 1HK9A 4YTLA 4C0DB 4EMGA 5LJ3e 3JAME 2QA4A 2X4JA 4CRIA 3CCMA 1JJ2S 5D6YA 2JVVA 2K4YA 4A4EA 4C92D 1VQ4A 2KQWA 3LH0A 4FM4B 1YITT 5FRMA 3HP9A 4FU6A 3CEYA 4N0AC 1YJ9A 2K3YA 4IURA 1Q81C 4QW2A 2PVOB 4QVZA 3CCVT 1WJQA 4FT2A 3JCMb 2LX9A 4JRPA 4J8OA 5C0MA 3R6OA 3CMAT 3SWNA 3F70A 2RI5A 3A5ZB 1QW1A 3L42A 3RMSA 5GMKh 4BDYA 2PUOB 2RK1A 5CIUA 3O8VA 1XQHA 3M4YA 3OBYA 4EMKA 3J81E 4JRKA 3CCQT 4BDZA 1I5LA 4QVDA 1VQ7A 3S3MA 2XKOC 2RK2A 3TCJA 5GAOp 3QZ9B 4M78A 3ZBDA 1W2BA 2V8KA 1N27A 2JOYA 3BDLA 3V7CA 2XIDA 4F7UG 2E64A 2QQ9A 1WGSA 2KDSA 3RIRA 1EIFA 3EAEA 3JCMf 3NTIA 3OYNA 1VQOT 3AHUA 2QI2A 1LNXA 1M4ZA 3LX7A 1WJSA 2RHXA 4A4GA 2M0OA 4E7LA 2M9UA 2VC8A 3JCMc 3INZA 4XTWA 4A4HA 2CYZB 1N9SA 2K57A 4J6XA 3FC3A 5FU7C 1RI0A 1YHQA 4HCZA 4A54A 4ZGJB 3CD6T 3CPWA 2QEXA 3CXCS 4XK8E 3OS2A 5LJ3d 2A3LA 5CKEA 2DIGA 4C92A 4M7DF 3JCMQ 4M77G 4PJOB 2YLCA 4PJOF 2X4XA 4N4HA 1KHIA 3OMGA 4B9WA 3JCMe 1U8RA 1M90U 1VQMA 4KT0E 4M75G 4XTYA 1B34B 4ME7A 3ZEHA 3G4ST 2KVQG 4J6YA 4MZPA 3CCST 2CZ6B 3HSBA 5LJ5d 3FDRA 2PQWA 1BI1A 4A53A 3TREA 4R56A 1AHJB 4TVRA 2DXBA 1N8RU 2EJ9A 1WQWA 3WXMB 1I8FA 3UDCA 3OYHA 5D6XA 3UT1A 3SDZA 3GNFB 5GAOm 2QXFA 5M9OA 1VQNT 3HFNA 1BIAA 2FB7A 3VYHB 4J5YA 1QP3A 4C5EA 3MHXA 3OS1A 1X75C 3OYBA 2V8IA 3SD4A 3CC2T 5GAMj 4RCBA 5CKHA 2R5AA 2L5QA 4KULA 3ZFJA 3L2QA 2LCLA 4E7KA 1I81A 2KMTA 3QKJA 3SWNB 2DK3A 2X4WA 1YCYA 3CBMA 3OYCA 4OGEA 5CO7A 1RL2A 1W4SA 1G3WA 4MMLA 3CCVA 3C4SA 4EMKB 4C8QD 1YI2T 5GMKe 1K73C 3JB9H 4HA8A 4NOYA 1QVGS 5GAOl 2EQUA 2RO0A 4M78B 4M78F 5GAN6 1K8AU 3OW2A 4OF1A 2CZ0B 2RHUA 2R5MA 3NFCA 4L6V5 3BY7A 3CCJT 3QJYA 4M7AD 3H6ZA 1O75A 4Q5WA 2OTLA 2XI9A 3WVDB 3G71T 1VQLT 1TH7A 2LRQA 3LLRA 3JB9J 1VIFA 3FLGA 3I55T 2LC4A 3M56A 5GAN5 3L2UA 4XTZA 3DLMA 2MWPA 2EWNA 4RMOA 4OMFB 3EFRA 4QQDA 2L3RA 3JCMh 5GAN8 1NJIC 4M7DC 4PJOC 3HHTB 2QDYB 3QYHB 2K3XA 3LYIA 3OY9A 2OAUA 1KQSA 4C5GA 4J7IA 5KCHA 3FJPA 3CCRT 3JB9D 1PSEA 1VQ5T 2IG0A 2D0QB 5IN1A 4HCBA 2LDMA 4C92B 1VQPT 2OTJT 4C92E 1N6AA 1WPYA 2A7YA 2NLUA 4BE2A 3MP1A 4J7FA 4BB7A 2DJZA 3RKYA 4M77F 4PNOA 3A8OB 3CC7A 4HT9A 4L59A 5FU6C 4X9DA 3X26B 1QP2A 5GAN4 1LOJA 2YHTA 2O4XA 1OI1A 4HT8A 1KD1U 2XICA 3S3OA 4MDXA 3CCUT 2EJFA 5HK3A 1M1GA 4C8QA 2LCCA 1D3BB 4BY6C 1QVFA 2VUBA 1KD1C 2BUDA 1KQ1A 1M1FA 1K9MU 3GLXA 4M7AA 5L8RE 3JCMV 3FB9A 1BIBA 4ELYC 4LDWA 2RJDA 3SB2A 3V7RA 2FVUA 3CCET 2I2LA 2Y90A 1FXXA 1K9MC 1WQ7A 3ER0A 2M1HA 4XU3A 2QTXA 3HPWA 4M78G 5CQXA 5J3BA 3VKIA 2CKKA 3G6EA 3GPLA 2EYQA 3C12A 3V8KA 2CS7A 1VQ8A 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYI A;  4II1 A;  2X4X A;  2E5Q A;  3MEU A;  3OMG A;  4N4H A;  4B9W A;  2R58 A;  2RHI A;  3MP8 A;  3UWN A;  3ZEH A;  5KH6 A;  1XNI A;  3MEA A;  2L8D A;  4BD3 A;  2RJE A;  4X34 A;  4GY5 A;  3OQ5 A;  3S6W A;  3L2V A;  3FDR A;  3P8H A;  2PQW A;  2LTO A;  5FRO A;  1SSF A;  2X35 A;  2DIQ A;  4FL6 A;  1G5V A;  2RI3 A;  4E7I A;  3OYH A;  5D6X A;  4IUT A;  3UT1 A;  3OYL A;  5M9O A;  1MHN A;  3NTK A;  2RJF A;  2RHZ A;  3PMI A;  3M9Q A;  2RI2 A;  2QQS A;  2GFA A;  2DAQ A;  3Q1J A;  4C5E A;  3OS1 A;  4N4I A;  3OYB A;  2WAC A;  3SD4 A;  2FHD A;  2BIV A;  2G3R A;  4PL6 A;  3OYA A;  3OYG A;  3E9F A;  1OYX A;  3DB3 A;  4PLI A;  2R5A A;  2EKO A;  4IUQ A;  3P8D A;  1OZ3 A;  3L2Q A;  4E7H A;  4E7K A;  2GFU A;  3ASK A;  3MO8 A;  3PFS A;  3QKJ A;  2EFI A;  2X4W A;  3OYE A;  3OYC A;  2JTF A;  2E6N A;  3H8Z A;  2EQM A;  3DB4 A;  4Z02 A;  3C4S A;  2F5K A;  3OYF A;  4E7J A;  4BAC A;  3OYJ A;  2JZ2 A;  2RHY A;  5D6W A;  4RG2 A;  4ZTF A;  2EQU A;  2RO0 A;  4UC4 A;  1WJR A;  3S3N A;  4A4F A;  1KHC A;  2RHU A;  3NTH A;  2R5M A;  5FRN A;  2EQK A;  3MP6 A;  3OB9 A;  3H6Z A;  3PNW C;  5J26 A;  2O4X B;  4Q5W A;  3OYD A;  4C5I A;  3QBY A;  3LLR A;  2LRQ A;  3E9G A;  3MET A;  4OVA A;  2YRV A;  3FLG A;  4PLL A;  5KE2 A;  3L2U A;  2P0K A;  4CRI A;  3DLM A;  2MWP A;  3FEO A;  3PMT A;  5D6Y A;  4QQD A;  4A4E A;  2L3R A;  4C5H A;  4IUP A;  3LH0 A;  5FRM A;  3L2R A;  4FU6 A;  2EQJ A;  2K3X A;  3CEY A;  2HQX A;  2K3Y A;  3LYI A;  4IUR A;  3OY9 A;  2D9T A;  4QW2 A;  4C5G A;  4QVZ A;  4BE0 A;  1WJQ A;  5KCO A;  5KCH A;  3OA6 A;  2LVM A;  5C0M A;  3F70 A;  2IG0 A;  2HQE A;  2RI5 A;  2XDP A;  2LDM A;  5IN1 A;  2RJC A;  2GF7 A;  3L42 A;  5J39 A;  4BDY A;  2NLU A;  5CIU A;  3O8V A;  4IUU A;  4LD6 A;  4BDZ A;  5IAY A;  4BE2 A;  3OS0 A;  3MP1 A;  5KE3 A;  2B8A A;  3S3M A;  3OMC A;  2L89 A;  1N27 A;  4L59 A;  3BDL A;  3OYM A;  3GOX A;  1WGS A;  2O4X A;  1OI1 A;  2BKD N;  3EAE A;  3KUF A;  2M16 A;  2VYT A;  3LGF A;  3ME9 A;  3NTI A;  3QII A;  4QQG A;  3LX7 A;  3OYN A;  3S3O A;  1WJS A;  2LCC A;  2RHX A;  4N4G A;  2XK0 A;  3OYK A;  3QJ6 A;  4A4G A;  2M0O A;  4QQ6 A;  4E7L A;  4EDU A;  2BUD A;  3LGL A;  4A4H A;  2X4Y A;  2MWO A;  4BE1 A;  4NS5 A;  5C6S A;  3FC3 A;  1RI0 A;  2RJD A;  3L2W A;  2R57 A;  4HCZ A;  4IUV A;  4B9X A;  3MEV A;  4IKF A;  2M1H A;  1OZ2 A;  3MEW A;  1H3Z A;  3OS2 A;  2CKK A;  4ZTJ A;  2DIG A;  2QQR A; 
#chains in the Genus database with same CATH topology
 2DET A;  2FZC B;  3I56 T;  3SEM A;  1U5S A;  2DD4 A;  3EG0 A;  1VQ8 Q;  4N0A A;  3X20 B;  1TTH B;  4XTV A;  4C0F A;  2QAS A;  3QPH A;  1W70 A;  2NWM A;  1ZX6 A;  5IXB A;  3RMQ A;  2AHJ B;  4EMH A;  4ATO A;  2E3I A;  2QTV A;  1CKB A;  4J9H A;  2WAC A;  2FHD A;  5IHN A;  1SHG A;  2CT3 A;  1S72 T;  1UGQ B;  1M8V A;  4M77 C;  4E7H A;  2MYS A;  2QQA A;  1M90 C;  1WHG A;  5LL6 S;  4C0D C;  1GFD A;  1GCQ A;  1VQ6 A;  1UG1 A;  4R0K A;  5CKB A;  2CP0 A;  1AZG B;  2HBP A;  3S3N A;  2DX1 A;  2YUP A;  3PVQ A;  1VQ6 Q;  2O4X B;  2LMJ A;  3EGU A;  2SEM A;  3QUI A;  2QA4 T;  1GL5 A;  3E9G A;  4DQ2 A;  5LJ3 j;  4PLL A;  1SEM A;  2F5T X;  1KD1 R;  1QQJ A;  1RAC B;  2LQ8 A;  3LWH A;  2PVG B;  4PJO D;  3R6N A;  4WTO B;  2K7A A;  4ORZ A;  1W6X A;  5GMK l;  1VQ7 T;  2DEQ A;  3VYG A;  2K5I A;  3E1S A;  3OS0 A;  3QWX X;  3CCQ A;  2EYY A;  2NUT B;  1W2B S;  3EG9 A;  3KUF A;  3CCQ Q;  4QQG A;  5I2M A;  3OYK A;  4ZNX A;  3ULR B;  5CAI A;  2A08 A;  2C0I A;  1U06 A;  2DO3 A;  2ROL A;  3CXC A;  3DKM A;  5HY6 A;  2HMA A;  4RTW A;  2VXF A;  4JZ4 A;  2BE9 B;  3CPW S;  1VQM T;  4II1 A;  2ESW A;  2EYX A;  4C8Q G;  3DLL A;  2OJ2 A;  3A8M B;  4CI0 C;  4OB0 B;  3MEA A;  5DM7 R;  1HYO A;  4PJO A;  4GY5 A;  3RER A;  2D0N A;  1Q7Y U;  3JV3 A;  1QKW A;  5LJ5 f;  4QVC A;  2JW4 A;  1Q7Y C;  1X6O A;  4OMN A;  3SWN C;  1X01 A;  5HCK A;  1G3Y A;  4LDU A;  2PU9 B;  1ABO A;  3E9F A;  3PIO A;  4PLI A;  3HRT A;  1OZ3 A;  5GMK i;  1PKT A;  3PIP A;  2WSF E;  4BI3 A;  2QDL A;  4M75 D;  2RHY A;  2XD0 A;  4ZTF A;  1Q81 U;  2OTL T;  1WIE A;  4C5I A;  4XU1 A;  1PSF A;  2DER A;  5CKF A;  2WSC E;  3GF5 A;  4C92 C;  3BE3 A;  1VQL A;  1G3T A;  1PD0 A;  3I55 A;  5FWB A;  3GNG A;  2LCS A;  1D1C A;  1VQL Q;  5DY9 A;  2E1H A;  2EAY A;  3EGD A;  5GAN h;  1W1F A;  5J39 A;  2GF7 A;  1XTD A;  5KYU B;  2B86 A;  4EPC A;  5GMK m;  5GAM d;  3CC7 T;  1Y07 A;  4PJO E;  2O01 E;  2ZPI B;  2V1Q A;  4C8Q F;  2M16 A;  3C95 A;  3CCL A;  3CME A;  2WSE E;  4M75 A;  2HDA A;  1OOT A;  5A0G A;  2HSE B;  1N5Z A;  5LJ3 g;  4LXC A;  4LDV A;  2NUP B;  3OSV A;  4NS5 A;  3O5Z A;  3L2W A;  4OMO A;  4B9X A;  1E7O A;  2JM8 A;  2E41 A;  3MEW A;  1VQ8 T;  4JS4 A;  1AWX A;  3QYG B;  4LUD A;  4AG1 C;  2RHI A;  1XNI A;  3FRN A;  4BD3 A;  1YIJ A;  1G3S A;  2RQW A;  4ZGE B;  3L2V A;  2OX7 A;  1NPR A;  2DXC A;  4J9B A;  1X2K A;  2X35 A;  5GAN f;  3VS3 A;  1NPP A;  2YT6 A;  2P4T A;  2LT4 A;  4PFO A;  2DL7 A;  2YUQ A;  5L23 A;  3FIF A;  1ZHI A;  2EYZ A;  2RHZ A;  4QT7 A;  1IZ6 A;  4F7U B;  3A8H B;  2DVE A;  1VQK Q;  4JLG A;  2XG8 D;  4VUB A;  4XU2 A;  3JCM g;  4J9C A;  2DFU A;  2E6N A;  1VQ6 T;  2F5K A;  4CC3 A;  1GCP A;  1LCK A;  3PVL A;  3CXC P;  2EQK A;  3CQT A;  4O5V A;  2AK5 A;  4M75 F;  4M75 E;  2XDD A;  4YTL A;  3JAM E;  1R77 A;  5D6Y A;  1VQ4 A;  4FM4 B;  3NHN A;  4FU6 A;  4N0A C;  2AZS A;  4QW2 A;  1VQ4 Q;  5C0M A;  1C1A A;  3MPU B;  4RTY A;  4BDY A;  5GMK h;  1D0Y A;  2DNU A;  2PUO B;  2RK1 A;  1EZZ B;  3OBY A;  3CCQ T;  4JRK A;  3V7C A;  1JEG A;  2QQ9 A;  2KDS A;  3RIR A;  3EAE A;  3OYN A;  3LX7 A;  2M0O A;  2VC8 A;  1YCS B;  2X3X D;  1N9S A;  1RAD B;  5FU7 C;  1WHM A;  1TU0 B;  2F2W A;  2YSQ A;  1WI7 A;  2M51 A;  1B7T A;  2J6O A;  3SHW A;  5CKE A;  3GBQ A;  1OX9 A;  1BCM A;  4M77 G;  1D09 B;  2YLC A;  1U8R A;  3ZEH A;  1V76 A;  2CZ6 B;  5LJ5 d;  2DXB A;  1GBQ A;  2EJ9 A;  3WXM B;  1AWW A;  3UDC A;  3OYH A;  2MCN A;  5GAO m;  4C5E A;  1QP3 A;  3MHX A;  3OS1 A;  1AWJ A;  2V8I A;  4K11 A;  1ZSZ B;  5KYX A;  1I81 A;  1ZLM A;  5IHI A;  2DK3 A;  5CO7 A;  1RL2 A;  3I56 Q;  2OAW A;  4MML A;  3CCV A;  3JB9 H;  1NBE B;  4NOY A;  1FMK A;  4M78 B;  1K8A U;  1T3L A;  1UUE A;  4M7A D;  1RLQ C;  2AZV A;  2HKQ B;  1VQL T;  1TH7 A;  2LRQ A;  3JB9 J;  3FLG A;  3I55 T;  3L2U A;  3EFO B;  4XTZ A;  2F2V A;  2MWP A;  2W0Z A;  2RF0 A;  4PJO C;  2A28 A;  3QYH B;  3LYI A;  3OY9 A;  1A0N B;  1KQS A;  4J7I A;  5KCH A;  2COZ A;  3JB9 D;  2KRS A;  1S72 Q;  5IN1 A;  2LDM A;  1BBZ A;  1SRM A;  1M3C A;  3MP1 A;  2DJZ A;  3RKY A;  4M77 F;  4PNO A;  1JO8 A;  3H0H A;  5FU6 C;  3X26 B;  2XIC A;  5HK3 A;  2LCC A;  1PRL C;  4BY6 C;  2VUB A;  1Z9Z A;  1BB9 A;  2E4H A;  4M7A A;  2KR3 A;  3CCM Q;  5L8R E;  2P84 A;  1MMG A;  1JQQ A;  4KRT A;  1H92 A;  4LDW A;  2NUP A;  1YJ9 Q;  4XU3 A;  5J3B A;  3HPW A;  4HXJ A;  3G6E A;  1TUG B;  2V26 A;  3VS1 A;  3KBG A;  4AFU C;  2R58 A;  2YRD A;  1UGP B;  3MP8 A;  5KYY B;  3G6E Q;  1YIJ T;  1VQ7 Q;  2FZG B;  2VXE A;  4L5G A;  5GAN d;  3U23 A;  2YXY A;  4AT1 B;  1JB0 E;  5FRO A;  3VS6 A;  1NYF A;  3H41 A;  1JBM A;  1G5V A;  2P4R A;  1VQK T;  3CC4 A;  4C92 G;  3OYL A;  2RJF A;  3UF4 A;  2F69 A;  2GQV A;  4JRQ A;  2ZPH B;  4P5N A;  3MO8 A;  2DXT A;  3EG3 A;  4M75 C;  1YN8 A;  1VQM Q;  1P92 A;  2BZY A;  3N5B B;  3CCR A;  4RG2 A;  2VWF A;  4OB2 B;  1WJR A;  3RUX A;  3NTH A;  1UHF A;  3EH1 A;  1UGV A;  2L3P A;  4C8Q B;  3HRU A;  5FLX E;  1UTI A;  1MMN A;  1VQ4 T;  1X27 A;  1YBY A;  2G6F X;  4DOW A;  5GAM h;  1LPL A;  3PTA A;  4M7A E;  1S1N A;  1YIT A;  4M7D D;  4HKE A;  4A4K A;  4RKU E;  2Y4X A;  2RJC A;  3RNJ A;  3CCE A;  2F2X A;  4PKC C;  1YIT Q;  4ZN1 A;  2DKG A;  3EH2 A;  1ZBX A;  2CGH A;  2MF2 A;  3TU4 K;  1KQ2 A;  4OML A;  3JB9 F;  1UDL A;  3M58 A;  1VQO A;  1PKS A;  3QJ6 A;  2BTT A;  2K79 A;  1KC8 U;  4EDU A;  1WHL A;  1NZ9 A;  3RDV A;  1VQO Q;  1R8O B;  3OSS C;  5C6S A;  1Q86 U;  2CZ7 B;  1Y96 B;  4PFP A;  1ZUU A;  2JT4 A;  3M53 A;  1IO6 A;  4C92 F;  4E7Z A;  3CD6 A;  4OB1 B;  1YWO A;  4OMP A;  1OV3 A;  2X9H A;  3H0F A;  4M7D A;  3QDR B;  5CQY A;  4O6J A;  3EFS A;  5GAM f;  4RTT A;  4M78 D;  3G4S A;  1Y0M A;  4Y91 A;  3CC7 Q;  2LTO A;  2FRW A;  3CBO A;  1U1S A;  2D8J A;  2V8J A;  2HZY A;  3SFM A;  3BDU A;  2RI2 A;  2XU8 A;  4JDS A;  2BZX A;  4N4I A;  1H8K A;  5DLO A;  4PL6 A;  4FYY B;  4OP0 A;  3CC2 A;  3P8D A;  2HKN A;  1AZE A;  5CCA A;  1N9R A;  1HSQ A;  1QVG A;  1VOM A;  2DBM A;  5LJ5 e;  3CC2 Q;  2RQT A;  2J7I A;  2DTO A;  2LQW A;  4Z02 A;  2ZCF B;  3G1J A;  4F14 A;  1YI2 A;  2J05 A;  1WXB A;  2PTK A;  1G83 A;  2VV5 A;  4UC4 A;  2YWW A;  3OBW A;  4LNP A;  3CCJ A;  3OW2 S;  3QBY A;  1YI2 Q;  4Y28 E;  4OVA A;  2YRV A;  3G71 A;  7AT1 B;  5KE2 A;  3PMT A;  3CCJ Q;  1FYN A;  8AT1 B;  4KBM B;  3G71 Q;  4KUD K;  1K0X A;  2KGT A;  2O88 A;  5KCO A;  3RKW A;  2LVM A;  2XDP A;  2ZPG B;  1M5Q 1;  1EFN A;  3M0T A;  4IUU A;  3BW1 A;  1MUZ A;  3T9N A;  1QWE A;  4M7D E;  2L89 A;  4DBH A;  3LGF A;  3CCM T;  3ME9 A;  2VYT A;  4RUG A;  1GXI E;  4HVW A;  2COY A;  2J6F A;  1YJ9 T;  1Q7Y R;  1AVZ C;  3LGL A;  2HBW A;  4A63 B;  2KXD A;  2HL3 A;  4AFQ C;  1X69 A;  1QVF S;  4BE1 A;  4WF2 A;  5EG2 A;  5LJ5 h;  2R57 A;  2GQI A;  2DLP A;  3G6E T;  4IKF A;  1M30 A;  4JPB W;  1M2V A;  2KE9 A;  2PZ1 A;  1K1Z A;  4ELZ C;  2E5Q A;  2RN8 A;  4LD9 K;  1HXD A;  4X34 A;  1K73 U;  2A36 A;  4JJD A;  4JS5 A;  1M3B A;  1GBR A;  2K6D A;  2DM1 A;  2RI3 A;  1I4K 1;  3CC4 T;  4M78 E;  2GNC A;  2KYM A;  3G7Z A;  2GFA A;  2QQS A;  3Q1J A;  1NJI U;  2KNB B;  4PJO G;  3VUB A;  1WYX A;  2BIV A;  2EJG A;  1QCO A;  2KEA A;  4BI8 B;  4X9C A;  5GAN e;  2K5F A;  2AKL A;  3JCM J;  3TQ7 P;  3DB4 A;  4MMK A;  5CKD A;  3V7S A;  3OYJ A;  2JZ2 A;  4M7A C;  1DJ7 B;  3V8L A;  5FRN A;  2LJ1 A;  1RAI B;  1Q82 U;  2DF6 A;  3OB9 A;  4M77 B;  4Z8A A;  2MIO A;  3CBP A;  1Q82 C;  4EMG A;  4C0D B;  1SRL A;  1JJ2 S;  2KRO A;  4A4E A;  2Z0W A;  3LH0 A;  1YIT T;  4RTU A;  2D8H A;  4IIM A;  4IUR A;  2FRY A;  2PVO B;  1WJQ A;  4FT2 A;  4JRP A;  2RI5 A;  3A5Z B;  1QW1 A;  3J81 E;  1XQH A;  4EMK A;  4E6R A;  2YRC A;  3S3M A;  1RAB B;  3EG2 A;  3TCJ A;  2CP2 A;  1W2B A;  2O9V A;  1UEC A;  3BDL A;  1Q81 C;  1VQO T;  1PNJ A;  1RAE B;  2QI2 A;  1LNX A;  2FPE A;  1T0J A;  4A4G A;  4E7L A;  2JM9 A;  3INZ A;  2ABL A;  4FYV B;  1QVG P;  3I55 Q;  1LVK A;  3FC3 A;  1I07 A;  1YHQ A;  4HCZ A;  4A54 A;  3CD6 T;  3CPW A;  2QEX A;  5LJ3 d;  2A3L A;  2FO0 A;  3JCM Q;  3TSZ A;  1YHQ Q;  4PJO F;  2X4X A;  1OQK A;  2QEX Q;  4XTY A;  4M75 G;  1B34 B;  3G4S T;  3HSB A;  1V1C A;  4QKU A;  4OMQ A;  2PQW A;  2EKH A;  4PFZ A;  1N8R U;  3CCL Q;  1I8F A;  3CME Q;  3EGX A;  2JMC A;  3GNF B;  5M9O A;  1BIA A;  2FB7 A;  1WHH A;  3VYH B;  1H3H A;  1X75 C;  3SD4 A;  1ZSG A;  3CC2 T;  2YUO A;  1OX8 A;  1CSK A;  1K0S A;  1MMA A;  2DIL A;  2X4W A;  4Z88 A;  3SWN B;  1W4S A;  3C4S A;  1YI2 T;  5GMK e;  1SKU B;  1YIJ Q;  4HA8 A;  5GAO l;  1RAH B;  4OF1 A;  2RHU A;  2FPF A;  3BY7 A;  3CCJ T;  3H6Z A;  3G71 T;  2DRM A;  3LLR A;  2ATC B;  1VIF A;  3I5S A;  5GAN 5;  4KGV B;  3DLM A;  4RMO A;  4OMF B;  4QQD A;  5GAN 8;  2L3R A;  4M7D C;  2HEQ A;  2LJ0 A;  3HHT B;  2K3X A;  4CC4 B;  2D0Q B;  4C92 B;  1N6A A;  2FEI A;  2NLU A;  4BE2 A;  2KI7 A;  2JS0 A;  4J7F A;  1PCX A;  2HQH A;  3A8O B;  4HT9 A;  3M0S A;  1IGQ A;  1QP2 A;  5GAN 4;  2O4X A;  1OI1 A;  3S3O A;  3I9Q A;  2AKK A;  1M1G A;  5FW9 A;  1D3B B;  2BE7 D;  1FMW A;  2BUD A;  2EQI A;  1K9M U;  1K76 A;  3FB9 A;  2QYZ A;  2CUB A;  3UA6 A;  1WXT A;  1K9M C;  3ER0 A;  2QTX A;  3V8K A;  4Y92 A;  1PHT A;  3MEU A;  2K3B A;  1QWF A;  2L8D A;  1JXM A;  3OQ5 A;  3S6W A;  2NUT A;  2E3H A;  2LJ3 A;  3KXT A;  3M4G A;  2CZ1 B;  4XU0 A;  2LX7 A;  5AYF A;  1K8A R;  1QCN A;  1SSH A;  2EIF A;  2C0T A;  2M02 A;  1K4U S;  4NL2 A;  3JCM W;  1X6G A;  2VAS A;  2CRE A;  1W2B P;  2HD0 A;  2E10 A;  2V1R A;  1NEB A;  1X43 A;  3FJ5 A;  1YJW A;  2EKO A;  3VV0 A;  1BYM A;  2MAM A;  4PJM A;  1IHW A;  3RR6 A;  3HFO A;  5GAN j;  1BKB A;  3TEE A;  2COW A;  1YJW Q;  1KQS S;  3OYF A;  3LW5 E;  5D6W A;  2DL5 A;  2ZPE B;  3PGG A;  3JCM P;  4J83 A;  3X28 B;  4HCK A;  4F04 B;  3CPW P;  1YNZ A;  1PM3 A;  5EC7 A;  1TOV A;  3MET A;  4J9D A;  3FEO A;  4RCC A;  4C5H A;  1PRM C;  1RI9 A;  2D9T A;  5A2Q E;  1TG0 A;  1E6G A;  1Z9Q A;  1WHK A;  3CMA A;  4LD6 A;  5LJ5 g;  5KE3 A;  3CCV Q;  1BI0 A;  1K8A C;  3UAT A;  4HCC A;  2DYI A;  4LDX A;  1UJY A;  5GAN 7;  1CKA A;  1TUD A;  1Y57 A;  5CR2 A;  3C0C A;  1KK7 A;  1YHQ T;  1J3T A;  3JCM X;  4DBQ A;  4BI4 A;  2QEX T;  3MEV A;  4LDY A;  1WNL A;  1OZ2 A;  5HK0 A;  4PK4 A;  2CT4 A;  3OYY A;  2RH2 A;  5KYU A;  2E65 A;  1FWZ A;  2CP6 A;  3UWN A;  2IVW A;  5A0L A;  3CCL T;  3CME T;  1ZUK A;  2EGA A;  1YP5 A;  4M7A G;  4D8K A;  2DIQ A;  1M1K U;  4FL6 A;  2JTE A;  4PJL A;  2X51 A;  4XAX B;  1R0C B;  3M9Q A;  1VQN A;  4EMK C;  5A0D A;  4DA4 A;  4OGC A;  2CH4 A;  2DTI A;  3JB9 G;  5GAM e;  1MV3 A;  4DEY A;  1VQN Q;  1MV0 B;  4FSS A;  1ZQ1 A;  2RNA A;  3ASK A;  1PD1 A;  2DL8 A;  4FYW B;  3VS7 A;  4LN2 A;  3V8J A;  5CK9 A;  3D7S B;  3MCA B;  5GMK j;  1SHF A;  3JB9 I;  4Z89 A;  1AD5 A;  2PVD B;  2DTH A;  1I1J A;  4XTU A;  3PE0 A;  3IQL A;  4NL3 A;  4FCY A;  1NLO C;  4GLM A;  3EG9 B;  1ZUY A;  3HRS A;  2J06 A;  2D1X A;  3C94 A;  3CC4 Q;  1UE9 A;  2P0K A;  4F7U A;  2KYB A;  3NMZ C;  2LQK A;  4ESR A;  1WX6 A;  2HQX A;  1KC8 R;  2CSQ A;  3H0I A;  4BE0 A;  3GIB A;  3A98 A;  2GTJ A;  5ECA A;  2RB6 A;  1U3O A;  1Q86 R;  5IT9 E;  2HQE A;  4FIB A;  2QAZ A;  5GAN g;  2VGM A;  3LWI A;  1VQ5 A;  1ZA1 B;  3MJX A;  2OTJ A;  1TSF A;  3HTR A;  1VQP A;  5IAY A;  5GAN 3;  2XDB A;  4JLI A;  3CCR Q;  1IXD A;  1VQ5 Q;  2D6F A;  2OTJ Q;  1VQP Q;  3QII A;  5KYN A;  1BI2 A;  1ZBJ A;  5LJ3 h;  2JN0 A;  5GAN 2;  3CCU A;  1Y7X A;  4JUV A;  4M7A F;  1D3B A;  4RTX A;  2MWO A;  1UEB A;  2FG0 A;  3CCU Q;  2K2V A;  2KRM A;  1UGR B;  5FU6 B;  3VU3 C;  3M55 A;  3THK A;  1VUB A;  4FYX B;  4ZGD B;  3QZ5 B;  2FPD A;  2QQR A;  4BY6 B;  1D1B A;  3CCE Q;  3M0Q A;  5KH6 A;  3RKX A;  4FW2 A;  2RJE A;  2LNV A;  1WA7 A;  2L2P A;  1D1A A;  2HL5 C;  3P8H A;  1PWT A;  2EW3 A;  1NEG A;  3BFM A;  4MDW A;  2P0P A;  4AG2 C;  1VQ9 A;  1KC8 C;  4IUT A;  2VB6 A;  4XQ3 A;  1MHN A;  3NTK A;  3PMI A;  5I2S A;  1PC0 A;  1Q86 C;  4M7D G;  2KSS A;  2K5L A;  4F7U F;  4F7U E;  2PNI A;  5IXF A;  3OYG A;  1YJW T;  2OI3 A;  3OYA A;  3CD6 Q;  2H3J A;  5LJ3 f;  3EGD B;  2JUF A;  1VIE A;  1ARK A;  1RLP C;  1JRI A;  2GFU A;  4F16 A;  2PUK B;  2HAX A;  5HKC A;  4E7J A;  3G4S Q;  2DXU A;  2L3S A;  3REB B;  1SG5 A;  2NYS A;  1KHC A;  2ZPF B;  2ED1 A;  4LE9 A;  2DRK A;  1VYU A;  1VYT A;  1BI3 A;  3M57 A;  4M75 B;  3MKD A;  2O31 A;  2X4J A;  1F1B B;  4CC7 A;  2KQW A;  5FRM A;  2CH4 W;  2DL4 A;  3CEY A;  2K3Y A;  3E2U A;  2DL3 A;  4QVZ A;  3CCV T;  3JCM b;  1ZSZ A;  2ED0 A;  2LX9 A;  3CMA T;  3R6O A;  5AT1 B;  2CUD A;  4D8D A;  3RMS A;  1UHC A;  5CIU A;  3O8V A;  5I22 A;  1I5L A;  4AFS C;  4QVD A;  1G2B A;  2XKO C;  5GAO p;  3QZ9 B;  4M78 A;  3ZBD A;  2V8K A;  1N27 A;  1C6V X;  2HCK A;  2JXB A;  2E64 A;  1WGS A;  3JCM f;  3NTI A;  1WJS A;  1K73 R;  1I5O B;  1QKX A;  3EFO A;  4A4H A;  1BK2 A;  4J6X A;  4DBF A;  4M4Z A;  3CXC S;  3OS2 A;  1OU9 A;  4M7D F;  1NJI R;  4N4H A;  4B9W A;  4KT0 E;  1M90 U;  4ME7 A;  2YDL A;  2DEU A;  4PJN A;  3TRE A;  2M0Y A;  4R56 A;  3AT1 B;  2X3W D;  4WCI A;  1WQW A;  2DJQ A;  1ACM B;  5D6X A;  3SDZ A;  4KH0 B;  1VQN T;  1Q82 R;  2DYB A;  2VKN A;  3OYB A;  5GAM j;  4RCB A;  6AT1 B;  1UJ0 A;  2R5A A;  2L5Q A;  3ZFJ A;  3L2Q A;  4FW1 A;  5KYY A;  2KMT A;  2O2O A;  3QKJ A;  1G3W A;  3VS0 A;  1K73 C;  4C8Q D;  2QG9 B;  1ZA2 B;  5GJW B;  2EQU A;  4M78 F;  3OW2 A;  1ABQ A;  3NFC A;  3UA7 A;  1Q81 R;  2XI9 A;  3WVD B;  1OEB A;  1IHV A;  3M56 A;  5I11 A;  2L3Q A;  2EWN A;  2LP5 A;  1NJI C;  2JMA A;  2QDY B;  1M27 C;  2XMF A;  2OAU A;  4C5G A;  3FJP A;  3CCR T;  1PSE A;  1VQ5 T;  2IG0 A;  2OTJ T;  1VQP T;  4JJB A;  2GGR A;  4BB7 A;  1VYV A;  2DA9 A;  2KXC A;  4L59 A;  2DE0 X;  1LOJ A;  4HT8 A;  1KD1 U;  4MDX A;  3CCU T;  4C8Q A;  1IRX A;  2RQV A;  1QVF A;  1KD1 C;  2JJ9 A;  3JCM V;  1N8R R;  1BIB A;  3CCE T;  2RJD A;  3V7R A;  1HD3 A;  2FVU A;  1X2Q A;  2M1H A;  3VKI A;  3GPL A;  2CKK A;  4AFZ C;  3C12 A;  2CS7 A;  1R0B G;  5KYX B;  1WZO A;  1HJD A;  4X1V A;  3QHS A;  4E47 A;  1AT1 B;  1G8X A;  1QCF A;  3PT9 A;  2BZ8 A;  3EG1 A;  3JSC A;  4MZT A;  1YJN A;  2EBP A;  1VQ9 T;  3E19 A;  1M2O A;  4RG8 A;  4E7I A;  1K9A A;  4IIO A;  1YJN Q;  2QGG A;  5GAO n;  1Y96 A;  4E2F B;  2NUZ A;  3QSU A;  4KUI A;  2ZZD A;  1YFN A;  2GCX A;  1KSW A;  5GAO q;  4FT4 A;  4IUQ A;  1IRE B;  2E12 A;  2RM4 A;  3VUZ A;  1TWB A;  1NE8 A;  2L0A A;  2QQB A;  3A8L B;  3OYE A;  1OUL A;  2EQM A;  4OB3 B;  4BAC A;  5KYW B;  1UFF A;  2VVK A;  1RUW A;  2DZC A;  3EHR A;  1N8R C;  3M5A A;  3PNW C;  1SF9 A;  3QXE B;  1JJ2 A;  4C8Q E;  3VRZ A;  2DBK A;  2XHC A;  3RES A;  2VGN A;  1LJO A;  2AT1 B;  3VJP A;  1KG1 A;  3L2Z A;  4IUP A;  4M7A B;  2MI6 A;  5GAM g;  1K9M R;  5LJ5 j;  4C0Z A;  4BUG A;  3JRZ A;  4JZ3 A;  3JCM d;  2B8A A;  5DLQ E;  3OMC A;  1NM7 A;  1TXQ A;  2RQR A;  4MZM A;  2ZAE A;  1Y71 A;  3M54 A;  4CC2 A;  3OYM A;  3GOX A;  2A37 A;  1UB4 A;  2BKD N;  4ANJ A;  1AWO A;  1O9S A;  2LT1 A;  4J6W A;  4N4G A;  2XK0 A;  3HL8 A;  4JJC A;  4KH1 B;  3VS4 A;  2KAF A;  4QQ6 A;  2Y4Y A;  1BCO A;  3CPF A;  1M9S A;  2RMO A;  2X4Y A;  4JRI A;  3J80 E;  2A0F B;  2HSP A;  4J9G A;  2H8H A;  3REA B;  2P0Q A;  3I5R A;  1VQK A;  3OW2 P;  4ZTJ A;  8ATC B;  4AMC A;  2FZK B;  4F17 A;  3OYI A;  2DMO A;  2ROT A;  1WHJ A;  1GRI A;  3X24 B;  3CCS A;  2FYK A;  4HVU A;  2I0N A;  1B3Q A;  4V2S A;  1SSF A;  4ZN3 A;  2DD5 A;  3CCS Q;  2DZ9 A;  3X25 B;  1ZSZ C;  1FX7 A;  1MND A;  3TVT A;  9ATC B;  3P8B B;  2MOX A;  3GP8 A;  3OS5 A;  3QWY A;  4M78 C;  3WVE B;  1OYX A;  3VS5 A;  2EFI A;  4M77 D;  2RA2 A;  1XOV A;  4JJN K;  1QVF P;  3URG A;  2CSI A;  3QDF A;  1SPK A;  4R55 A;  1U1T A;  2E6Z A;  3TSW A;  2JNG A;  3MP6 A;  1C0M A;  5J26 A;  4DBR A;  3OYD A;  2JTM A;  1EX4 A;  1JU5 C;  1KFZ A;  3L1A A;  1KJW A;  3RBB B;  3VRY A;  2YLB A;  2MK5 A;  3L2R A;  2EQJ A;  2K9G A;  5GJV B;  1NLP C;  3OA6 A;  2KK4 A;  1GCQ C;  4C0G A;  3QG1 A;  4DEX A;  2DVJ A;  4M7D B;  4EIK A;  2LQN A;  2EYW A;  2SRC A;  2KT8 A;  4M77 A;  3UPU A;  2CP7 A;  1I0C A;  1NG2 A;  1PG5 B;  2LNH B;  3LH5 A;  5CVI A;  1UGS B;  1M1K R;  2C0O A;  2QK0 A;  5GAO r;  4DOV A;  1OU8 A;  4IUV A;  3KFV A;  4J9I A;  1H3Z A;  2DPP B;  2ZPB B;  3A8G B;  1Q95 G;  3CMA Q;  1QVP A;  1JJ2 P;  3J7A F;  3HKS A;  3I56 A;  4D6W A;  2KY9 A;  3ZL7 C;  3M0P A;  1YJN T;  1T0H A;  3QO3 A;  2FL7 A;  3NGP A;  4J9F A;  2HNI A;  1M3A A;  1IGU A;  4XTX A;  2ZGW A;  3I35 A;  2DAQ A;  4J9E A;  2G3R A;  1WDX A;  2RD1 A;  3DB3 A;  2C06 A;  4B6M A;  2GTO A;  1OPL A;  5I21 A;  1S72 A;  5FU7 B;  3PFS A;  1B34 A;  1FMV A;  4C8Q C;  1MMD A;  2JTF A;  5FWC A;  1XJW B;  2MMP A;  3H8Z A;  4GLK A;  2RQU A;  4OMM A;  2E70 A;  1D0X A;  1H64 1;  1TUC A;  2F1L A;  3M59 A;  4A4F A;  1M1K C;  1MGQ A;  5KYW A;  4M77 E;  1QLY A;  1V29 B;  1B07 A;  1VA7 A;  4FSX A;  3VS2 A;  1HK9 A;  5LJ3 e;  2MPX C;  2QA4 A;  2EPD A;  4CRI A;  3CCM A;  2EGC A;  2JVV A;  2K4Y A;  4C92 D;  1RAG B;  3HP9 A;  1E6H A;  1RAA B;  1YJ9 A;  2QA4 Q;  4E7S A;  1JXO A;  4J8O A;  1M2V B;  4GBQ A;  3SWN A;  3F70 A;  2QGF B;  3L42 A;  5IHK A;  2GBQ A;  4BDZ A;  3M4Y A;  1VQ7 A;  1KIK A;  2RK2 A;  2EVR A;  3M0R A;  2H3E B;  2JOY A;  2XID A;  4F7U G;  1EIF A;  3AHU A;  5IH2 A;  1M4Z A;  2RHX A;  2E5K A;  1TS9 A;  2M9U A;  3H9N A;  4RTV A;  3JCM c;  1AOJ A;  4XTW A;  2CYZ B;  2K57 A;  2KRN A;  1RI0 A;  1X6B A;  4ZGJ B;  4RTZ A;  4LUE A;  4XK8 E;  1WXU A;  2DIG A;  4C92 A;  4PJO B;  1KHI A;  3OMG A;  3JCM e;  1VQM A;  3CCS T;  2ENM A;  2KVQ G;  4J6Y A;  4MZP A;  3FDR A;  1BI1 A;  4A53 A;  1OPK A;  4KGX B;  2W10 A;  1AHJ B;  4TVR A;  2AIR B;  5D7U A;  1WLP B;  3UT1 A;  1NYG A;  2QXF A;  3HFN A;  4J5Y A;  5CKH A;  4KUL A;  2ECZ A;  2KBT A;  2RPN A;  1QMC A;  2LCL A;  2J6K A;  4E7K A;  3A1P A;  2LZ6 B;  1YCY A;  3CBM A;  1BU1 A;  4OGE A;  4PJJ A;  3OYC A;  4KGZ B;  4EMK B;  1QVG S;  1D0Z A;  2RO0 A;  5GAN 6;  2CZ0 B;  2R5M A;  4L6V 5;  3QJY A;  2JS2 A;  1O75 A;  4Q5W A;  2OTL A;  1WFW A;  2IIM A;  1VQ9 Q;  3M0U A;  2K2M A;  1T3S A;  2LC4 A;  3EHQ A;  3JCM h;  3EFR A;  2OTL Q;  1YWP A;  1MNE A;  4HCB A;  2YUN A;  2CP3 A;  2CP5 A;  3NPF A;  4HVV A;  4C92 E;  1M8M A;  1WPY A;  2A7Y A;  2IPO B;  2O9S A;  3CC7 A;  1GFC A;  2KT1 A;  1RAF B;  4X9D A;  2YHT A;  1M90 R;  2EJF A;  2EGE A;  2CDT A;  3EGX B;  1AEY A;  1KQ1 A;  1M1F A;  1KQS P;  1IB8 A;  3GLX A;  4ELY C;  3SB2 A;  2I2L A;  2Y90 A;  1FXX A;  1WQ7 A;  5CQX A;  4M78 G;  2EYQ A;  1VQ8 A; 
#chains in the Genus database with same CATH homology
 3I56 T;  3MEU A;  2R58 A;  1UGP B;  3MP8 A;  1YIJ T;  2DD4 A;  2VXE A;  4L5G A;  2L8D A;  5GAN d;  4N0A A;  3OQ5 A;  3QHS A;  4E47 A;  3S6W A;  1JB0 E;  3X20 B;  3PT9 A;  5FRO A;  4XTV A;  3JSC A;  4MZT A;  3KXT A;  4C0F A;  1YJN A;  3M4G A;  1VQ9 T;  3E19 A;  3QPH A;  1JBM A;  1G5V A;  2CZ1 B;  4RG8 A;  4E7I A;  4XU0 A;  3RMQ A;  5AYF A;  1VQK T;  2AHJ B;  3CC4 A;  2EIF A;  4C92 G;  3OYL A;  5GAO n;  2RJF A;  4EMH A;  1Y96 A;  4ATO A;  4NL2 A;  3JCM W;  3QSU A;  4KUI A;  2HD0 A;  2ZZD A;  2WAC A;  2E10 A;  2FHD A;  2F69 A;  2GCX A;  1YJW A;  2GQV A;  1UGQ B;  2ZPH B;  4M77 C;  4FT4 A;  2EKO A;  4IUQ A;  1IRE B;  5GAO q;  4P5N A;  2E12 A;  3VV0 A;  4E7H A;  2MAM A;  1BYM A;  2RM4 A;  2QQA A;  3VUZ A;  3MO8 A;  3HFO A;  1NE8 A;  2DXT A;  2QQB A;  4M75 C;  5GAN j;  1M90 C;  1BKB A;  3A8L B;  3TEE A;  3OYE A;  5LL6 S;  4C0D C;  2EQM A;  4OB3 B;  1P92 A;  1KQS S;  3N5B B;  3OYF A;  3LW5 E;  3CCR A;  4BAC A;  1VQ6 A;  5D6W A;  4RG2 A;  5CKB A;  4OB2 B;  2ZPE B;  3PGG A;  2HBP A;  4J83 A;  1WJR A;  3JCM P;  3S3N A;  3X28 B;  3RUX A;  3NTH A;  2DZC A;  1N8R C;  3M5A A;  3PNW C;  2O4X B;  3QXE B;  3QUI A;  1JJ2 A;  4C8Q B;  3HRU A;  3E9G A;  3MET A;  4C8Q E;  2QA4 T;  4DQ2 A;  2XHC A;  5FLX E;  4PLL A;  5LJ3 j;  3RES A;  1M8V A;  1VQ4 T;  2F5T X;  2VGN A;  3FEO A;  1LJO A;  1YBY A;  3VJP A;  4DOW A;  4RCC A;  4C5H A;  5GAM h;  3L2Z A;  4IUP A;  4M7A B;  3PTA A;  4M7A E;  1KG1 A;  2LQ8 A;  1YIT A;  2MI6 A;  5GAM g;  4M7D D;  4HKE A;  4A4K A;  2D9T A;  3LWH A;  2PVG B;  4PJO D;  5LJ5 j;  4RKU E;  2Y4X A;  5A2Q E;  4C0Z A;  5GMK l;  4BUG A;  2RJC A;  3CCE A;  3CMA A;  4PKC C;  1VQ7 T;  3JRZ A;  2DEQ A;  4LD6 A;  4ZN1 A;  2DKG A;  3VYG A;  5LJ5 g;  1ZBX A;  2CGH A;  2K5I A;  2MF2 A;  3E1S A;  5KE3 A;  2B8A A;  3JCM d;  5DLQ E;  3OS0 A;  3TU4 K;  3OMC A;  3CCQ A;  1KQ2 A;  4MZM A;  1BI0 A;  1K8A C;  4HCC A;  1Y71 A;  3M54 A;  3JB9 F;  3OYM A;  3GOX A;  4LDX A;  1UB4 A;  1W2B S;  2BKD N;  3KUF A;  3M58 A;  4QQG A;  1O9S A;  2LT1 A;  4J6W A;  4N4G A;  5I2M A;  1VQO A;  5GAN 7;  2XK0 A;  3OYK A;  3QJ6 A;  3HL8 A;  5CAI A;  2KAF A;  1KC8 U;  4QQ6 A;  4EDU A;  2Y4Y A;  3CPF A;  1M9S A;  2X4Y A;  1NZ9 A;  4JRI A;  5CR2 A;  1R8O B;  2DO3 A;  3OSS C;  3J80 E;  1YHQ T;  5C6S A;  1Q86 U;  2CZ7 B;  1Y96 B;  3JCM X;  3DKM A;  3CXC A;  2P0Q A;  4BI4 A;  2QEX T;  5HY6 A;  3MEV A;  3M53 A;  4LDY A;  4C92 F;  1WNL A;  1VQK A;  1OZ2 A;  3CD6 A;  2VXF A;  4ZTJ A;  5HK0 A;  4OB1 B;  3OYY A;  3CPW S;  2RH2 A;  3OYI A;  1VQM T;  4II1 A;  2E65 A;  4M7D A;  3QDR B;  5CQY A;  4C8Q G;  4O6J A;  1FWZ A;  3A8M B;  3EFS A;  2IVW A;  3UWN A;  5A0L A;  4CI0 C;  4OB0 B;  3MEA A;  5GAM f;  5DM7 R;  3CME T;  4M78 D;  3X24 B;  3CCL T;  3CCS A;  4GY5 A;  3G4S A;  3RER A;  2FYK A;  4Y91 A;  1Q7Y U;  2LTO A;  4M7A G;  4V2S A;  1SSF A;  2DIQ A;  3CBO A;  4ZN3 A;  2DD5 A;  1M1K U;  5LJ5 f;  4QVC A;  1U1S A;  2DZ9 A;  4FL6 A;  3X25 B;  1Q7Y C;  2V8J A;  1X6O A;  3SFM A;  1FX7 A;  3BDU A;  3SWN C;  1X01 A;  4XAX B;  1G3Y A;  3M9Q A;  1VQN A;  3P8B B;  4EMK C;  5A0D A;  2RI2 A;  2XU8 A;  3GP8 A;  4OGC A;  4DA4 A;  3OS5 A;  4JDS A;  2DTI A;  4N4I A;  4LDU A;  5DLO A;  4M78 C;  2PU9 B;  4PL6 A;  3WVE B;  3JB9 G;  5GAM e;  3E9F A;  4OP0 A;  1OYX A;  3PIO A;  4PLI A;  3CC2 A;  3HRT A;  1OZ3 A;  3P8D A;  5GMK i;  5CCA A;  1N9R A;  1ZQ1 A;  3ASK A;  2EFI A;  4M77 D;  2RA2 A;  1XOV A;  4JJN K;  3PIP A;  2WSF E;  3URG A;  1QVG A;  3V8J A;  4BI3 A;  5LJ5 e;  4Z02 A;  2DTO A;  5CK9 A;  3MCA B;  4M75 D;  5GMK j;  2RHY A;  2ZCF B;  2XD0 A;  4ZTF A;  3JB9 I;  1YI2 A;  2PVD B;  4UC4 A;  2VV5 A;  1U1T A;  4R55 A;  2DTH A;  4XTU A;  2E6Z A;  4NL3 A;  1Q81 U;  2JNG A;  3MP6 A;  2OTL T;  3OBW A;  5J26 A;  3OYD A;  3CCJ A;  4C5I A;  4XU1 A;  3OW2 S;  1PSF A;  3HRS A;  3QBY A;  5CKF A;  2JTM A;  2WSC E;  4Y28 E;  4OVA A;  3GF5 A;  4C92 C;  2YRV A;  3C94 A;  3G71 A;  1VQL A;  1S72 T;  3L1A A;  5KE2 A;  2P0K A;  1G3T A;  4F7U A;  3PMT A;  3I55 A;  2YLB A;  3GNG A;  3L2R A;  2LQK A;  4KBM B;  2EQJ A;  2HQX A;  5DY9 A;  2E1H A;  2EAY A;  4KUD K;  4BE0 A;  3GIB A;  5KCO A;  5GAN h;  3RKW A;  2RB6 A;  2LVM A;  2KK4 A;  3OA6 A;  5IT9 E;  4JRQ A;  2HQE A;  2XDP A;  2ZPG B;  4FIB A;  5J39 A;  1M5Q 1;  2GF7 A;  2VGM A;  5GAN g;  1XTD A;  3LWI A;  1VQ5 A;  2OTJ A;  4IUU A;  4EPC A;  3DLL A;  5GMK m;  3BW1 A;  4C0G A;  3QG1 A;  5IAY A;  3T9N A;  5GAN 3;  1VQP A;  5GAM d;  2XDB A;  4M7D B;  4M7D E;  3CC7 T;  2L89 A;  1Y07 A;  4JLI A;  4PJO E;  2O01 E;  2ZPI B;  2D6F A;  4C8Q F;  4M77 A;  3UPU A;  3LGF A;  3CCM T;  3QII A;  2M16 A;  2VYT A;  3C95 A;  1BI2 A;  3ME9 A;  3CCL A;  5LJ3 h;  2JN0 A;  2WSE E;  4M75 A;  5A0G A;  5GAN 2;  3CME A;  1GXI E;  3CCU A;  1Y7X A;  4JUV A;  1YJ9 T;  4M7A F;  5LJ3 g;  3LGL A;  5CVI A;  1UGS B;  1D3B A;  4LDV A;  2MWO A;  1UEB A;  3OSV A;  4BE1 A;  4NS5 A;  1QVF S;  4WF2 A;  2K2V A;  5EG2 A;  3L2W A;  4DOV A;  5LJ5 h;  1UGR B;  2R57 A;  4IUV A;  5FU6 B;  3VU3 C;  4B9X A;  5GAO r;  3M55 A;  3G6E T;  1VUB A;  4IKF A;  2E41 A;  4ZGD B;  3MEW A;  1VQ8 T;  1H3Z A;  2DPP B;  2ZPB B;  4JS4 A;  3QZ5 B;  4ELZ C;  3QYG B;  2QQR A;  3A8G B;  4BY6 B;  2E5Q A;  1QVP A;  2RHI A;  3J7A F;  3HKS A;  3I56 A;  4D6W A;  4LD9 K;  2KY9 A;  3RKX A;  1XNI A;  1HXD A;  3FRN A;  4BD3 A;  5KH6 A;  2RJE A;  2LNV A;  4X34 A;  1YIJ A;  1G3S A;  1K73 U;  4ZGE B;  3L2V A;  1NPR A;  3P8H A;  2DXC A;  1YJN T;  3QO3 A;  2FL7 A;  3BFM A;  2X35 A;  4MDW A;  4JS5 A;  5GAN f;  2P0P A;  1NPP A;  2P4T A;  2LT4 A;  2RI3 A;  1I4K 1;  1VQ9 A;  3CC4 T;  4M78 E;  2HNI A;  1KC8 C;  3FIF A;  4IUT A;  1ZHI A;  4XQ3 A;  1MHN A;  3NTK A;  3PMI A;  2RHZ A;  3G7Z A;  5I2S A;  1Q86 C;  1IZ6 A;  4XTX A;  2ZGW A;  4M7D G;  2GFA A;  2DAQ A;  2KSS A;  2K5L A;  2QQS A;  3Q1J A;  4F7U B;  4F7U F;  4F7U E;  1NJI U;  4PJO G;  3A8H B;  3VUB A;  3OYG A;  2G3R A;  2BIV A;  2DVE A;  3OYA A;  1YJW T;  4PJO A;  2RD1 A;  3DB3 A;  2C06 A;  2H3J A;  5LJ3 f;  2JUF A;  1VIE A;  2EJG A;  4JLG A;  1JRI A;  2XG8 D;  5I21 A;  4BI8 B;  1S72 A;  4VUB A;  4XU2 A;  5FU7 B;  2GFU A;  3PFS A;  4X9C A;  1B34 A;  3JCM g;  4C8Q C;  2PUK B;  5GAN e;  2K5F A;  3JCM J;  2JTF A;  2E6N A;  2MMP A;  3DB4 A;  3H8Z A;  5HKC A;  4MMK A;  4GLK A;  5CKD A;  2HAX A;  1VQ6 T;  2F5K A;  3V7S A;  2E70 A;  4E7J A;  3OYJ A;  2JZ2 A;  2DXU A;  1H64 1;  4M7A C;  1DJ7 B;  3M59 A;  4A4F A;  1KHC A;  2ZPF B;  3V8L A;  5FRN A;  1Q82 U;  2EQK A;  1M1K C;  1MGQ A;  3OB9 A;  4M77 B;  4M77 E;  1V29 B;  4FSX A;  1BI3 A;  4O5V A;  3M57 A;  3CBP A;  4M75 B;  4M75 F;  4M75 E;  2XDD A;  1Q82 C;  1HK9 A;  4YTL A;  4C0D B;  4EMG A;  5LJ3 e;  3JAM E;  2QA4 A;  2X4J A;  4CRI A;  3CCM A;  1JJ2 S;  5D6Y A;  2JVV A;  2K4Y A;  4A4E A;  4C92 D;  1VQ4 A;  2KQW A;  3LH0 A;  4FM4 B;  1YIT T;  5FRM A;  3HP9 A;  4FU6 A;  3CEY A;  4N0A C;  1YJ9 A;  2K3Y A;  4IUR A;  1Q81 C;  4QW2 A;  2PVO B;  4QVZ A;  3CCV T;  1WJQ A;  4FT2 A;  3JCM b;  2LX9 A;  4JRP A;  4J8O A;  5C0M A;  3R6O A;  3CMA T;  3SWN A;  3F70 A;  2RI5 A;  3A5Z B;  1QW1 A;  3L42 A;  3RMS A;  5GMK h;  4BDY A;  2PUO B;  2RK1 A;  5CIU A;  3O8V A;  1XQH A;  3M4Y A;  3OBY A;  4EMK A;  3J81 E;  4JRK A;  3CCQ T;  4BDZ A;  1I5L A;  4QVD A;  1VQ7 A;  3S3M A;  2XKO C;  2RK2 A;  3TCJ A;  5GAO p;  3QZ9 B;  4M78 A;  3ZBD A;  1W2B A;  2V8K A;  1N27 A;  2JOY A;  3BDL A;  3V7C A;  2XID A;  4F7U G;  2E64 A;  2QQ9 A;  1WGS A;  2KDS A;  3RIR A;  1EIF A;  3EAE A;  3JCM f;  3NTI A;  3OYN A;  1VQO T;  3AHU A;  2QI2 A;  1LNX A;  1M4Z A;  3LX7 A;  1WJS A;  2RHX A;  4A4G A;  2M0O A;  4E7L A;  2M9U A;  2VC8 A;  3JCM c;  3INZ A;  4XTW A;  4A4H A;  2CYZ B;  1N9S A;  2K57 A;  4J6X A;  3FC3 A;  5FU7 C;  1RI0 A;  1YHQ A;  4HCZ A;  4A54 A;  4ZGJ B;  3CD6 T;  3CPW A;  2QEX A;  3CXC S;  4XK8 E;  3OS2 A;  5LJ3 d;  2A3L A;  5CKE A;  2DIG A;  4C92 A;  4M7D F;  3JCM Q;  4M77 G;  4PJO B;  2YLC A;  4PJO F;  2X4X A;  4N4H A;  1KHI A;  3OMG A;  4B9W A;  3JCM e;  1U8R A;  1M90 U;  1VQM A;  4KT0 E;  4M75 G;  4XTY A;  1B34 B;  4ME7 A;  3ZEH A;  3G4S T;  2KVQ G;  4J6Y A;  4MZP A;  3CCS T;  2CZ6 B;  3HSB A;  5LJ5 d;  3FDR A;  2PQW A;  1BI1 A;  4A53 A;  3TRE A;  4R56 A;  1AHJ B;  4TVR A;  2DXB A;  1N8R U;  2EJ9 A;  1WQW A;  3WXM B;  1I8F A;  3UDC A;  3OYH A;  5D6X A;  3UT1 A;  3SDZ A;  3GNF B;  5GAO m;  2QXF A;  5M9O A;  1VQN T;  3HFN A;  1BIA A;  2FB7 A;  3VYH B;  4J5Y A;  1QP3 A;  4C5E A;  3MHX A;  3OS1 A;  1X75 C;  3OYB A;  2V8I A;  3SD4 A;  3CC2 T;  5GAM j;  4RCB A;  5CKH A;  2R5A A;  2L5Q A;  4KUL A;  3ZFJ A;  3L2Q A;  2LCL A;  4E7K A;  1I81 A;  2KMT A;  3QKJ A;  3SWN B;  2DK3 A;  2X4W A;  1YCY A;  3CBM A;  3OYC A;  4OGE A;  5CO7 A;  1RL2 A;  1W4S A;  1G3W A;  4MML A;  3CCV A;  3C4S A;  4EMK B;  4C8Q D;  1YI2 T;  5GMK e;  1K73 C;  3JB9 H;  4HA8 A;  4NOY A;  1QVG S;  5GAO l;  2EQU A;  2RO0 A;  4M78 B;  4M78 F;  5GAN 6;  1K8A U;  3OW2 A;  4OF1 A;  2CZ0 B;  2RHU A;  2R5M A;  3NFC A;  4L6V 5;  3BY7 A;  3CCJ T;  3QJY A;  4M7A D;  3H6Z A;  1O75 A;  4Q5W A;  2OTL A;  2XI9 A;  3WVD B;  3G71 T;  1VQL T;  1TH7 A;  2LRQ A;  3LLR A;  3JB9 J;  1VIF A;  3FLG A;  3I55 T;  2LC4 A;  3M56 A;  5GAN 5;  3L2U A;  4XTZ A;  3DLM A;  2MWP A;  2EWN A;  4RMO A;  4OMF B;  3EFR A;  4QQD A;  2L3R A;  3JCM h;  5GAN 8;  1NJI C;  4M7D C;  4PJO C;  3HHT B;  2QDY B;  3QYH B;  2K3X A;  3LYI A;  3OY9 A;  2OAU A;  1KQS A;  4C5G A;  4J7I A;  5KCH A;  3FJP A;  3CCR T;  3JB9 D;  1PSE A;  1VQ5 T;  2IG0 A;  2D0Q B;  5IN1 A;  4HCB A;  2LDM A;  4C92 B;  1VQP T;  2OTJ T;  4C92 E;  1N6A A;  1WPY A;  2A7Y A;  2NLU A;  4BE2 A;  3MP1 A;  4J7F A;  4BB7 A;  2DJZ A;  3RKY A;  4M77 F;  4PNO A;  3A8O B;  3CC7 A;  4HT9 A;  4L59 A;  5FU6 C;  4X9D A;  3X26 B;  1QP2 A;  5GAN 4;  1LOJ A;  2YHT A;  2O4X A;  1OI1 A;  4HT8 A;  1KD1 U;  2XIC A;  3S3O A;  4MDX A;  3CCU T;  2EJF A;  5HK3 A;  1M1G A;  4C8Q A;  2LCC A;  1D3B B;  4BY6 C;  1QVF A;  2VUB A;  1KD1 C;  2BUD A;  1KQ1 A;  1M1F A;  1K9M U;  3GLX A;  4M7A A;  5L8R E;  3JCM V;  3FB9 A;  1BIB A;  4ELY C;  4LDW A;  2RJD A;  3SB2 A;  3V7R A;  2FVU A;  3CCE T;  2I2L A;  2Y90 A;  1FXX A;  1K9M C;  1WQ7 A;  3ER0 A;  2M1H A;  4XU3 A;  2QTX A;  3HPW A;  4M78 G;  5CQX A;  5J3B A;  3VKI A;  2CKK A;  3G6E A;  3GPL A;  2EYQ A;  3C12 A;  3V8K A;  2CS7 A;  1VQ8 A;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...