4N0AA

Crystal structure of lsm2-3-pat1c complex from saccharomyces cerevisiae
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lsm2 and Lsm3 bridge the interaction of the Lsm1-7 complex with Pat1 for decapping activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm3
total genus 13
structure length 80
sequence length 80
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n0aA00
4HT8A 5I21A 4M75F 3SWNA 1KQ2A 5GANh 4F7UE 5GAN3 4EMKB 1U1TA 2E1HA 4JRIA 3V7RA 4C92F 2EJ9A 2EJGA 4Y91A 3AHUA 3FIFA 4J6YA 2E10A 4M78A 3BFMA 3INZA 4MMLA 4M7AA 4PJOC 4WF2A 1WPYA 4M78G 2EJFA 4M78D 4XQ3A 5GAN5 4NOYA 2YLBA 4N0AC 3EFRA 1WQ7A 4C8QD 5LJ3g 3V8KA 1JBMA 2E65A 4RCCA 5GAN8 2K57A 3EFSA 2HNIA 5LJ5d 3L1AA 3HFOA 4RCBA 3RIRA 5LJ3j 4M77F 1I81A 2FB7A 2E64A 1M5Q1 2EAYA 3PGGA 4PNOA 5GAN4 3JCMg 5GANd 3QO3A 5GAN7 3JB9G 1HXDA 1LJOA 4HT9A 3JCMf 3QSUA 1I8FA 1I5LA 3JCMQ 3M4GA 3RERA 3SWNC 3RESA 2DTHA 5GMKi 4PJOF 5LJ5e 4C92G 4JUVA 1Y96A 2DTOA 4XTUA 4C8QC 2DZ9A 4M7DA 3JB9I 3QHSA 4NL3A 1B34A 4M78C 1TH7A 4EMGA 4JLIA 5GANe 5GAOq 4M7DF 4PJOA 1U1SA 4XU1A 3JCMh 2EWNA 4JRKA 3JCMc 4A54A 2FYKA 5GAMh 4M77E 5GAN6 5GAMj 3JCMV 5GAN2 1X01A 3FJPA 4M77D 4X9CA 1H641 1D3BB 1M8VA 5GAMg 3V7CA 5GAOp 4M77C 5GAMf 2DZCA 5DY9A 1JRIA 1MGQA 4J6XA 5GAOr 4MMKA 4PJOG 3JCMb 4M7AD 4QVCA 4XU0A 4C92B 2E41A 2RA2A 1Y96B 4M7AF 3JCMX 2DXUA 1BIAA 3QUIA 1YCYA 5LJ3d 3V8JA 2DJZA 4EMKC 2CGHA 4M78B 5CAIA 4A53A 4C92C 3JCMW 3RKWA 5GAOm 3GIBA 5GMKh 4M75C 3V8LA 4OP0A 3SWNB 2I2LA 4M77B 2YHTA 3JB9J 5LJ5f 3VU3C 4M77A 2RB6A 5GANj 4M75G 4M7DE 5LJ5g 5LJ3f 1N9RA 2VC8A 3BW1A 4J6WA 3HFNA 4NL2A 3JCMe 3JCMP 2QTXA 4XTWA 4M7AB 5LJ5j 4M7DG 4XTXA 5GAMe 4M7AG 4C8QF 1WQWA 4PJOD 4M78F 4HA8A 1BIBA 4EMKA 4C8QB 4XU2A 5LJ3h 4M7AE 4C92A 1HK9A 2DXTA 2DKGA 4XU3A 4C92E 2RM4A 2VXEA 4M75E 4DQ2A 1D3BA 5GAOn 4C8QE 4F7UA 4M75A 4M75D 5GAOl 4M77G 3L2ZA 3JB9F 4V2SA 5GAMd 4F7UF 3JCMd 2JN0A 2ZGWA 3BY7A 3JB9D 5GMKm 2VXFA 5LJ3e 5GMKe 1KQ1A 1B34B 2Y90A 3FB9A 2RD1A 1LNXA 4M7AC 4XTVA 4C8QA 4M7DC 1WNLA 2DTIA 4C92D 3RKYA 4C8QG 3HSBA 4XTZA 4PJOB 3JB9H 4N0AA 3JCMJ 1N9SA 1LOJA 4QVDA 5GMKj 4M7DD 4X9DA 4M7DB 2YLCA 4PJOE 2DEQA 5GANf 4XTYA 3RUXA 4J5YA 2DVEA 1I4K1 5GMKl 4M78E 3RKXA 5GANg 5LJ5h 3V7SA 4M75B 4F7UB 3SB2A 4EMHA 3BDUA 4F7UG
chains in the Genus database with same CATH superfamily
5I21A 1SG5A 4EMKB 4JRIA 3CCUA 4C92F 2R57A 1VQ5T 2AKLA 3L42A 1IXDA 2EJFA 3A5ZB 4J9BA 1I81A 2IIMA 3CMEA 2XD0A 3M0UA 3QO3A 3HRUA 3OYIA 3EH2A 3M4GA 2LT1A 1GXIE 1RUWA 4JUVA 1PHTA 4J9EA 3A8LB 3DKMA 1U1SA 4X1VA 3KFVA 1BBZA 2LT4A 1V1CA 5GAN6 1Y07A 2K5IA 2LCCA 1NPPA 2HQEA 5GJWB 2AZVA 1VQMQ 4FW1A 1FYNA 4YTLA 3M54A 3V8JA 1VIFA 2EYWA 4L5GA 1QVFP 3OSSC 4DOWA 1VQKT 3RDVA 1VQNT 3L2WA 2K2MA 2FZCB 5LJ5j 4NS5A 4EMKA 1WJQA 1VQ4Q 1GFDA 3M0QA 4OMLA 3CBPA 5KCOA 4DQ2A 4CC3A 5FU7B 3PMIA 3WVDB 3BY7A 5LJ3e 2CP0A 4KGZB 1G83A 3EGXA 3QPHA 1RAFB 4N0AA 3JCMJ 4X9DA 2PUKB 3KUFA 5HY6A 2LQNA 1I4K1 4O6JA 5GMKl 2EQJA 1YJNQ 4HT8A 2E12A 2DBMA 2KYMA 3LX7A 3E2UA 3R6OA 4MZMA 2YT6A 4BACA 4FM4B 3SDZA 3MPUB 1RI9A 4FYXB 2AT1B 4LNPA 5FWBA 4PKCC 4JPBW 2E64A 3FRNA 1TU0B 4DEYA 3CCVT 2XICA 3Q1JA 2EKHA 2RHUA 5GMKi 2CREA 4FYYB 1HJDA 2L5QA 4D6WA 1AWJA 4N4GA 2XDBA 1RLPC 3ME9A 1VQ9T 2A37A 1P92A 4KGVB 4HCCA 3THKA 1RABB 2LJ3A 3G6EQ 1FMWA 2M02A 3HP9A 3LGLA 4Z02A 5EC7A 2BTTA 3PMTA 1JXMA 1WFWA 2E41A 2ZPHB 3TQ7P 2JZ2A 1VQNQ 3CCJQ 2AIRB 4M75C 1X27A 3KBGA 1YHQT 2EQIA 2RHZA 2RJFA 1UDLA 3HFNA 3J80E 3UWNA 1VQPQ 1K0XA 1OU8A 2OI3A 2G3RA 2BIVA 2HZYA 4M78F 2IVWA 2JTMA 4C5HA 1KD1U 3EGUA 4KULA 1M8MA 4XU3A 1QW1A 1WXUA 2DL3A 3VRYA 1TSFA 2HMAA 1X6BA 2DXBA 1JQQA 1O9SA 2JTFA 2MAMA 5D6WA 2CP6A 1VQ7T 2O31A 2QG9B 4XTVA 3H0HA 3CC2A 2OTJA 1R8OB 1TS9A 3OW2A 3CCRT 2DRKA 4J5YA 1PKSA 4A4FA 3RKXA 3MJXA 2O9SA 2WSEE 1RI0A 3VS5A 1RAGB 2D0QB 4OGEA 4RTYA 3CCST 2Y4YA 3EG2A 2EJGA 2HL5C 4Y91A 3GLXA 2E10A 3R6NA 3QG1A 4M78G 2HSPA 2DK3A 2KT8A 1JBMA 4RCCA 4JRPA 1X75C 5LJ5d 2V1RA 3NFCA 4OMNA 4C5EA 2CP5A 5CR2A 3ZBDA 1YI2Q 1C6VX 1M1FA 3P8DA 3CCLA 2VVKA 3VV0A 3SWNC 1W2BA 2RI2A 4IIOA 1GCQA 1Y96A 4XTUA 4E7SA 1W2BP 3ER0A 4OB0B 1PRLC 2O4XB 3PNWC 1ZUKA 3E19A 2D0NA 1N8RU 3JCMV 4MDWA 2A7YA 1D3BB 1E6HA 2V8IA 2X4WA 2LNHB 4M77C 3OS0A 3UATA 1PM3A 1KG1A 1KJWA 1MGQA 5A2QE 3M0TA 2K6DA 2P4TA 1I1JA 5KH6A 1BI1A 3M59A 3O5ZA 2O01E 1PSEA 2A3LA 1OI1A 1YFNA 4E2FB 1X6OA 3V8LA 1JEGA 3L2QA 1E6GA 2PVDB 1IRXA 4QVZA 4A4EA 1VYTA 2CZ0B 2RK2A 4NL2A 2GCXA 5KE3A 4BDYA 2X9HA 3CD6Q 4C92E 2K4YA 2NWMA 3L2ZA 2RJDA 2JN0A 4QKUA 1MMDA 2VXFA 4R56A 3CCQA 3QIIA 2EYQA 2ECZA 1QWEA 2KE9A 3I56T 1BI3A 1NZ9A 3CCVQ 4PK4A 2EQMA 2DEQA 4XTYA 2DVEA 3MP1A 4E7ZA 4JJCA 3SB2A 1VQOA 4EMHA 4OB3B 4CC4B 3V7RA 3EFOA 4VUBA 3MO8A 2DD4A 4M78A 4MMLA 1YJ9A 2ROTA 2RQVA 1GBQA 1K8AC 1N6AA 1IHWA 1ABQA 3PVQA 2JOYA 4PNOA 4A63B 2EAYA 2E70A 3EG1A 1I8FA 3JCMQ 2RN8A 2DTHA 1AWWA 2R5AA 4RTZA 4RTVA 4M7DA 2P0QA 4JDSA 4XU1A 1ZQ1A 2QDYB 2DPPB 4P5NA 3UA7A 3M0PA 5IXFA 2XDPA 1RAAB 1YWOA 3EGDB 1B7TA 4E7JA 2KDSA 1UGPB 5CO7A 1M8VA 3RNJA 1KC8R 1JB0E 3TSZA 3CPWS 3CMET 2KRNA 2X4JA 2MYSA 2CZ1B 2NUPB 4BI8B 1QWFA 4LDWA 3MEWA 1VQLQ 1IGQA 3I55A 1S72A 2EIFA 4J9DA 4PFZA 5LJ5g 4GLKA 1N9RA 5LJ3f 4ANJA 3T9NA 2NUTB 1H3HA 2NUZA 3META 4C8QF 3X25B 1QVGP 2LQWA 4LD9K 3S3MA 8ATCB 2VXEA 3BE3A 1Q86C 4C8QE 2DETA 1T3SA 1FMVA 2RJCA 1OV3A 5IT9E 3OYFA 3QYHB 2CZ7B 4M7DC 2HBPA 4C92D 3HSBA 5ECAA 2F69A 2YDLA 1BCOA 4FCYA 2KI7A 4HKEA 2E6ZA 3CPFA 4Q5WA 1OEBA 1VQPT 3JSCA 5GANg 1FWZA 5DLQE 2HSEB 2XDDA 2BUDA 2P4RA 3URGA 3VYGA 2NYSA 4MZTA 2VASA 1K73C 3OS1A 5D7UA 1KC8C 4ZGJB 3FLGA 2RO0A 3CPWP 1VQ7A 1XQHA 4RCBA 1PCXA 1ZSGA 5CKBA 1G8XA 4X34A 3CD6A 3FEOA 3JCMg 5I2SA 5HKCA 2ENMA 2VWFA 3PE0A 1I5LA 1J3TA 1ZX6A 3OW2S 4C92G 2LCLA 3QJYA 1T3LA 2MPXC 3QHSA 3OYGA 1LPLA 1WHKA 2H8HA 3JCMh 2JS2A 3CC7T 1NJIR 3MHXA 2YWWA 1ZUUA 2P84A 1WYXA 1Q95G 2DEUA 4JJNK 4OMOA 5GAOr 4M7AD 1Y71A 3JCMX 1QVGA 2HL3A 2DJZA 1VQ6T 3DB3A 2C0IA 1Q7YU 2A0FB 2R5MA 2XU8A 2RK1A 2X4YA 3OS5A 3RBBB 1WXBA 1F1BB 2H3EB 1VOMA 2CP2A 4RUGA 3G7ZA 4QQDA 4DEXA 4M7AB 1ACMB 1U8RA 3JRZA 4E7KA 2DBKA 2JXBA 4XU2A 3NGPA 1KHIA 4M75E 1UE9A 2ZAEA 1KK7A 1VQPA 5L23A 2ATCB 4XK8E 1ZSZB 2GQIA 1GBRA 4F17A 1GRIA 3JB9D 2OAUA 2M0YA 3VS1A 1B34B 3FB9A 4ESRA 5KYYB 2QYZA 3ZFJA 3H41A 2YRVA 2J05A 4PLLA 4KUIA 2RI3A 4IUVA 3OW2P 2PZ1A 3BDUA 4JS4A 5LL6S 2HKNA 4HCZA 1VQ8A 5CKFA 1T0JA 4J9HA 4C5GA 1M1KU 4F16A 1WHJA 3G71Q 3AHUA 4IUUA 4M4ZA 4ZN3A 5C6SA 4XQ3A 4AFSC 5LJ3g 3M58A 4CC2A 3HFOA 4BB7A 3VS0A 4DBRA 3JB9G 4OB1B 5I11A 1OPKA 1Z9QA 3D7SB 1WIEA 1D1BA 2M0OA 4PJOF 3VS4A 3CCMA 2V1QA 2EQUA 4JLGA 1X6GA 1CSKA 2EWNA 3AT1B 4A54A 5GAMh 1QCFA 2CUDA 2DO3A 1VQNA 2RQUA 1NBEB 1KQSS 4J9IA 3X24B 2W0ZA 5KYXB 4OF1A 2RH2A 4CC7A 2PU9B 4PLIA 1VQ6Q 1JRIA 3VJPA 4J6XA 3VKIA 4QVCA 5IAYA 2CP3A 2DXUA 3CMEQ 4C92C 1OX8A 4F14A 1YIJA 4OMPA 1QP3A 2AZSA 4LDUA 2YHTA 2M16A 1D1AA 4IURA 2HBWA 2CS7A 2QQBA 1N5ZA 1UGQB 2RB6A 3VU3C 5GANj 2F1LA 1D1CA 4J6WA 1QP2A 4LXCA 1TUGB 1H3ZA 4HA8A 1BIBA 4M7AE 3UT1A 3CC2Q 2OTJQ 2DXTA 2HDAA 4J8OA 1SHGA 4K11A 3OYCA 3REBB 2MMPA 2EGEA 3VS6A 3OYMA 1WHGA 3EGDA 3DLLA 3NHNA 3EGXB 3I5SA 1C0MA 4GLMA 3JAME 2QI2A 4XTZA 4J9FA 3VYHB 5KYWA 4M7DD 1LOJA 4QVDA 3EAEA 4M7DB 2L0AA 3N5BB 2KBTA 3PIOA 2KRMA 3GNGA 2E5KA 1XJWB 3MP8A 2YUNA 4ZN1A 1Y7XA 2KRSA 4C0GA 2XK0A 1OYXA 2EYYA 3TVTA 5FW9A 2D6FA 3G6ET 3I56A 2KQWA 2E65A 3EFSA 5FU6C 2E3HA 2VKNA 3JCMW 1OQKA 4PJNA 1UG1A 3RESA 1Q7YC 5C0MA 4BI4A 3G6EA 3QDFA 2L8DA 2EW3A 1CKAA 2DTOA 4RTXA 2OTLA 4EMGA 5GANe 1Q82U 2DA9A 3J7AF 1OOTA 3KXTA 4M77E 3WXMB 4JZ4A 3QZ5B 2AK5A 2IG0A 1D0ZA 2COYA 3SHWA 1TG0A 5GAMf 4ELYC 5CKDA 1OX9A 4IUTA 3HL8A 1KC8U 2HKQB 1BI2A 3S3OA 4IKFA 2KXCA 1R0CB 2RA2A 2KYBA 1K73U 3QUIA 5GAN7 3J81E 1NEGA 4EIKA 1AT1B 1YJNA 2QASA 1FX7A 1M9SA 5GMKh 2D9TA 2JM9A 2GF7A 3ZEHA 1AWOA 4HCBA 1IO6A 2CUBA 3QWYA 4BE2A 1W4SA 5CKHA 4C0DB 2FZGB 1BCMA 3OYYA 3QJ6A 3EG0A 1DJ7B 1KSWA 1VQ8T 4DBQA 4J7IA 1YJ9Q 5GAOl 3TU4K 2MI6A 1FMKA 2OTLQ 1XTDA 4ZGDB 1UUEA 3DLMA 2DERA 2LDMA 1LNXA 4M7AC 1AEYA 1UEBA 1M1KR 4AFZC 1WDXA 4R55A 1NLPC 1GL5A 5GANf 2FPDA 4F7UB 5DLOA 2KK4A 3A1PA 4M75F 5GJVB 5KYNA 3C0CA 2EJ9A 2DYBA 2JJ9A 2OAWA 2JVVA 1KIKA 4PJOC 4WF2A 1WPYA 1AHJB 2DFUA 3UF4A 3L1AA 1AZGB 2CT3A 2FVUA 5EG2A 1MUZA 1HXDA 2ESWA 3CMAQ 2ZPGB 3CMAA 1MMAA 2DIQA 2J7IA 1QKXA 2KAFA 5KYYA 2DZ9A 2YXYA 1B34A 5FLXE 2RQTA 2FRYA 3GNFB 1W6XA 5GAN2 1K76A 4M77D 2Z0WA 3C4SA 3OY9A 4OMMA 3CCEQ 4AG1C 5DY9A 4LDYA 2RQWA 1NJIU 2L3PA 4L59A 1GCQC 1GCPA 5KCHA 4M7AF 2MOXA 1UFFA 3RKWA 3CCVA 4PFOA 2J6OA 1M3CA 1VQMT 2HQXA 1BKBA 2FZKB 3TEEA 3CXCS 1TUDA 3OS2A 1M90C 2EPDA 2KMTA 4N4HA 3H6ZA 4CI0C 2V26A 4E7HA 1VQ9A 3EG9A 4BE1A 1R0BG 1SF9A 3CBMA 3LH5A 2RPNA 2K79A 4A4KA 5GAMd 2YUOA 1FXXA 2QXFA 4PJMA 4L6V5 1U3OA 1VYVA 1KFZA 3HHTB 1WNLA 4PFPA 2DTIA 1PKTA 1LVKA 4PJOE 2LVMA 3MEVA 3LW5E 2LX7A 2RJEA 1O75A 3X20B 2DAQA 1VYUA 1YITQ 1M30A 1ZA1B 3C94A 1YJWQ 3V8KA 1T0HA 3M0RA 1YJWA 1EFNA 2IPOB 5LJ3j 4C5IA 2FB7A 5IHIA 3NPFA 3OBWA 2CT4A 2YUQA 3HTRA 3EHQA 1Y57A 3OMCA 4RTUA 2QEXT 4ZGEB 2CYZB 3NTKA 1K73R 4JJBA 2SEMA 5CK9A 4KT0E 1X01A 1IGUA 5KYUA 1Z9ZA 1ARKA 2E3IA 2F2WA 1ZUYA 2DZCA 1BB9A 2ZPEB 2DNUA 3HRTA 3UDCA 3QYGB 1JU5C 1MV3A 2YUPA 1JJ2P 4XAXB 5GAOm 3GIBA 1TWBA 1Q81C 3UPUA 3OYAA 2HAXA 4LUEA 2P0KA 2O9VA 2L3SA 3E9GA 3BW1A 2O88A 2JMAA 2BE7D 2BKDN 1AZEA 1TOVA 4HVVA 2KR3A 2DKGA 2EGAA 2JW4A 2DL5A 2KEAA 3G71T 5CKEA 4F7UF 1Y0MA 3JCMd 3HPWA 3OYLA 1UTIA 2Y90A 4ZNXA 3CBOA 5CIUA 1HYOA 3OYBA 4DA4A 1SKUB 1M2VB 3MEAA 1VQ4A 1K9MU 4O5VA 3ASKA 1WHLA 1SHFA 2QQSA 2DL4A 3I35A 2LX9A 1H8KA 2A28A 2CSIA 2LJ1A 4E7LA 3SWNA 1VQKA 1WXTA 4TVRA 4EDUA 2EVRA 3FIFA 1KD1C 1TUCA 1M27C 2MWPA 4NOYA 2XMFA 2BZ8A 1M1KC 1AWXA 4LDVA 3JV3A 3JB9J 4D8KA 5IH2A 1JO8A 1YBYA 1ZSZC 2VB6A 2WACA 4JJDA 3SFMA 2FPEA 3G1JA 7AT1B 2DD5A 1PSFA 2QGGA 4E6RA 1YCSB 3M9QA 3H0FA 1PD1A 2CH4W 1YJNT 3GBQA 4PJOG 4R0KA 2P0PA 3CCMT 2XI9A 1Q7YR 1MHNA 1E7OA 1MV0B 4IIMA 4LE9A 1RLQC 1WHHA 2B86A 5HK0A 4OVAA 1VQ7Q 3OYHA 2I0NA 2DL8A 2MIOA 1YJWT 1QCNA 2RMOA 2EGCA 1WI7A 2DRMA 2QTXA 1VQLT 4M7AG 4Z8AA 4A4GA 1QQJA 4B9WA 1SEMA 2JUFA 2RM4A 4RTTA 4F7UA 1KQSA 1YN8A 3CCRA 3M4YA 1ZSZA 3M56A 2ZGWA 3H9NA 4CRIA 1WGSA 2KROA 1ZA2B 1KQ1A 2VGNA 3PVLA 3VS2A 2QTVA 3PTAA 2VYTA 5GMKj 1PNJA 1D09B 2AHJB 1BYMA 2LQKA 3S6WA 1UJYA 3P8BB 3CCJA 2KSSA 2DF6A 2CZ6B 3VRZA 5GAN3 1U1TA 3CCLQ 3TCJA 2MK5A 1YHQA 2KXDA 2QGFB 4N0AC 1YITT 2K57A 2HNIA 2C0OA 4M7DE 5I2MA 3E1SA 2QA4Q 5GANd 1ZLMA 1NM7A 1SRLA 2MF2A 3P8HA 4BY6C 2YSQA 3IQLA 3I55Q 5LJ5e 1AVZC 3QWXX 4C8QC 1UB4A 3CCEA 2A36A 2WSFE 1TH7A 5CVIA 2LJ0A 4FIBA 5CQYA 2CKKA 3V7CA 1SSHA 1HD3A 2FO0A 2VGMA 1WX6A 1Q86U 1RAIB 4ORZA 3CC4A 4XU0A 3CCRQ 1UGSB 3LGFA 3BDLA 3CMAT 4HCKA 1BIAA 3O8VA 2E6NA 3G4SQ 1IHVA 4N4IA 1U06A 1JXOA 5IN1A 1U5SA 1VQ4T 3JCMe 2ED0A 4AG2C 1WQWA 4OMQA 1PRMC 1BK2A 4C0ZA 2X51A 1X69A 4C92A 2J6FA 1NPRA 2DM1A 2FPFA 1QVPA 4M75A 3REAB 2H3JA 3H0IA 2M9UA 5DM7R 2K9GA 4GY5A 5KYUB 2X3WD 5GMKm 2DVJA 1VQ6A 1G5VA 3X26B 1VQOQ 4D8DA 3A8GB 5I22A 3CEYA 3WVEB 4C0DC 4E7IA 2GTOA 4C8QG 2KVQG 1JJ2S 3CC4T 2NUTA 1QCOA 3QDRB 1QVGS 1M4ZA 3GPLA 2YLCA 1G3SA 1N27A 3M53A 1PC0A 2EBPA 3I56Q 5LJ5h 3JB9F 4WTOB 4Y92A 2D1XA 2CH4A 3C95A 4F7UE 2E1HA 1VUBA 4DBHA 3OYEA 4J6YA 4AMCA 2COZA 9ATCB 4JRQA 2E4HA 1ABOA 1GFCA 1BU1A 1WQ7A 1S72T 5GAN8 1A0NB 3PGGA 3L2VA 4OB2B 3RMSA 4ZTJA 2XIDA 1M90U 4LUDA 4ATOA 1X2KA 4KBMB 1WZOA 4FSSA 1Q82R 2JT4A 2ZPIB 3A8OB 3JB9I 3A8HB 2DJQA 2K5FA 1NEBA 3GF5A 1NJIC 4RG2A 5KYXA 3FJPA 4ME7A 2CDTA 4C0FA 4IUQA 4B9XA 1I0CA 1B07A 2E5QA 3CCUQ 3L2UA 3LWHA 4DBFA 5LJ3d 4EMKC 4M78B 4A53A 3EG9B 1RACB 3I9QA 2X35A 4II1A 1EIFA 3SWNB 2XG8D 2RHIA 4HVUA 4M77A 2YRCA 1YP5A 2QQAA 1G3YA 1EX4A 4RTWA 1S1NA 3S3NA 4UC4A 3OYDA 1MNEA 5GAMe 5CQXA 2GQVA 1WJRA 2DX1A 2F2XA 4BI3A 1KHCA 1YHQQ 1WLPB 1VQOT 3I55T 1RAEB 1Q81R 3OYKA 1SSFA 2GFAA 1N8RC 3OQ5A 3SD4A 1XNIA 1UECA 1VIEA 4KUDK 2LNVA 1UGVA 2LTOA 1IB8A 2GFUA 3RUXA 4M78E 4BD3A 5AYFA 4M75B 1OPLA 5AT1B 1K8AU 2F5KA 3CQTA 2PQWA 3QKJA 2EYXA 5A0GA 4M7AA 2FHDA 2K3BA 5HK3A 1NYFA 4C8QD 1G3TA 2DYIA 3LYIA 1QVFS 2K3XA 2YRDA 1M2OA 3QZ9B 4Y28E 1M5Q1 1TTHB 3X28B 2MWOA 4RMOA 1YWPA 2ZZDA 1WJSA 1WHMA 2QQ9A 5KYWB 1Q82C 1YI2A 2PVGB 1Q86R 2O4XA 4M78C 4HVWA 4PJOA 3FJ5A 2LZ6B 4FSXA 3VUBA 4GBQA 2PNIA 2FYKA 4KH0B 2KNBB 5GAMj 3HKSA 5FRMA 1H641 1QLYA 3EH1A 2JNGA 4RG8A 3DB4A 4J7FA 1K0SA 5J3BA 3CCQT 3CCLT 3LWIA 2EQKA 5KE2A 2RF0A 3FDRA 2I2LA 2JTEA 3LH0A 2QDLA 1RL2A 1OULA 5CCAA 1VQKQ 4M7DG 2FEIA 3VS7A 1V76A 2LC4A 5LJ3h 3U23A 2BZYA 4RKUE 1HK9A 5GAOn 3UA6A 2DIGA 5D6XA 1MMNA 3C12A 2F5TX 1PWTA 2L2PA 2HEQA 2BZXA 2DILA 6AT1B 3M0SA 5HCKA 1ZBXA 2RD1A 3CC7Q 3TREA 3OB9A 4PJOB 3JB9H 2RQRA 2KGTA 2K3YA 1K4US 1H92A 3CPWA 4FW2A 1V29B 2QQRA 2KY9A 2LP5A 4HXJA 1M90R 2V8JA 2K5LA 4OGCA 1D0XA 3GP8A 4BUGA 2YLBA 4IUPA 2GNCA 4PL6A 4B6MA 1PD0A 3RIRA 5A0LA 5GAN4 2ZCFB 3CC4Q 4HT9A 5FU7C 3VS3A 4Z89A 3L2RA 1K1ZA 2VV5A 2M51A 2WSCE 4M7DF 2JM8A 4JLIA 4BY6B 3NTIA 4Z88A 4MDXA 1XOVA 3M55A 1M3BA 3PIPA 2LMJA 2EFIA 1VQ8Q 1VQ9Q 3CCQQ 1YIJT 1NYGA 3G4ST 3CC2T 2OTJT 4BE0A 2QA4A 1CKBA 3QXEB 1JJ2A 2L3QA 1BI0A 4J9CA 2VUBA 4J83A 1G2BA 1SRMA 4OMFB 1YNZA 3OSVA 4FU6A 4M77B 1NLOC 1Q81U 2KT1A 1M1GA 2G6FX 1HSQA 3EFOB 2QEXA 4EPCA 5M9OA 2MCNA 2OJ2A 2DE0X 4M75D 4M77G 1VA7A 2X3XD 2FRWA 2QEXQ 2JS0A 1M2VA 5GMKe 5FU6B 3G71A 4LDXA 2DLPA 2C0TA 1K8AR 4JS5A 1K9MR 3OYJA 1N9SA 1RAHB 2M1HA 4FL6A 3CCSA 3VUZA 1YIJQ 4LD6A 1RADB 2F2VA 1G3WA 2QK0A 1QMCA 2Y4XA 2R58A 4KRTA 5J26A 5GANh 1AOJA 3BFMA 2RNAA 1UHCA 4M78D 5J39A 1W2BS 4E47A 4M77F 2GGRA 5FRNA 1MNDA 2A08A 1K9MC 3JCMf 4QQ6A 1W1FA 1UJ0A 2QA4T 4NL3A 1OU9A 4KH1B 1M3AA 4FT2A 3JCMc 2D8JA 3CXCA 5IHKA 3OYNA 1I5OB 1VQMA 3OA6A 4C92B 1Y96B 1D0YA 1YCYA 5CAIA 1TXQA 2EKOA 1OZ3A 2PVOB 1EZZB 2L3RA 3TSWA 5FWCA 4FT4A 5LJ5f 4M75G 2DMOA 1W70A 1AD5A 3PT9A 2CP7A 3CC7A 2VC8A 4XTWA 1VQ5A 3PFSA 3EHRA 4PJOD 3CCET 3EG3A 3OMGA 3A98A 2ABLA 1LCKA 3NTHA 3CXCP 1X43A 1IREB 3SEMA 1S72Q 2DXCA 1SPKA 4AFUC 2LRQA 4C8QA 3QBYA 2DL7A 3RKYA 2K7AA 4BDZA 4ZTFA 1NE8A 3MKDA 5IXBA 3GOXA 3V7SA 1R77A 3CCMQ 2O2OA 1QVFA 4J9GA 1KQ2A 4F04B 5FROA 2B8AA 3NMZC 4AFQC 1MMGA 3INZA 2ROLA 2ED1A 2ZPBB 4LN2A 2RHXA 5GAN5 2J06A 3EFRA 1I07A 4QT7A 3ZL7C 3CCSQ 2LCSA 5IHNA 2NLUA 3G4SA 1VQ5Q 4ELZC 1OZ2A 1LJOA 2L89A 3QSUA 3RERA 2LQ8A 4PJJA 4FYWB 2V8KA 1YJ9T 1N8RR 2PUOB 5GAOq 3MCAB 1K9AA 1VQLA 4JRKA 4FYVB 2JMCA 4X9CA 1NG2A 2K2VA 5GAMg 5GAOp 2HQHA 3MP6A 3LLRA 5L8RE 3M5AA 3MEUA 3CD6T 3RMQA 1C1AA 1QKWA 2ZPFB 4MMKA 3OBYA 1WA7A 3JCMb 4DOVA 1IZ6A 2SRCA 1YITA 3A8MB 1YI2T 1PG5B 2CGHA 4MZPA 2X4XA 1UHFA 2EYZA 4JZ3A 8AT1B 2AKKA 4OP0A 1B3QA 3RR6A 4PJLA 2GTJA 2HD0A 3I5RA 3CCJT 3JCMP 4XTXA 2NUPA 1ZBJA 4QQGA 1X2QA 2C06A 4WCIA 2J6KA 2OTLT 2W10A 2COWA 2XKOC 4C8QB 1ZHIA 3M57A 1KQSP 1D3BA 2XHCA 2QAZA 1UGRB 2RHYA 4V2SA 2PTKA 2RI5A 5D6YA 2BE9B 2GBQA 3H8ZA 4QW2A 2HCKA 1KD1R 3E9FA 3ULRB 3F70A 2D8HA 3HRSA 3CCUT 4KGXB 4A4HA 2OX7A 2CSQA 2FG0A 4AT1B 5A0DA 3FC3A 2FL7A 4F7UG
chains in the Genus database with same CATH topology
5I21A 2XDDA 2DAQA 2BUDA 4EMKB 2F5KA 1K8AU 2PQWA 3URGA 4JRIA 3VYGA 3CCUA 4C92F 3QKJA 5A0GA 2R57A 1K73C 4MZTA 1VQ5T 4M7AA 3OS1A 3L42A 1KC8C 3C94A 2FHDA 2EJFA 5HK3A 3A5ZB 4C8QD 1G3TA 4ZGJB 3FLGA 3V8KA 2RO0A 1VQ7A 1XQHA 3LYIA 4RCBA 5LJ3j 2K3XA 3QZ9B 3X20B 1I81A 2FB7A 4Y28E 1M5Q1 5CKBA 4X34A 4C5IA 3X28B 3CD6A 3FEOA 3JCMg 2MWOA 5I2SA 3QO3A 5HKCA 3CMEA 3HRUA 2XD0A 4RMOA 3OYIA 2ZZDA 1I5LA 1WJSA 3M4GA 2QQ9A 3OBWA 2LT1A 1Q82C 1GXIE 1YI2A 2PVGB 3OW2S 4C92G 2LCLA 4JUVA 3OMCA 3QJYA 2O4XA 3QHSA 4M78C 2QEXT 3OYGA 3A8LB 3DKMA 2CYZB 4ZGEB 4PJOA 1U1SA 3NTKA 4FSXA 3VUBA 3JCMh 2FYKA 3CC7T 5CK9A 2LT4A 4KT0E 5GAN6 5GAMj 1Y07A 3HKSA 5FRMA 1X01A 1H641 2K5IA 2LCCA 3MHXA 1NPPA 2JNGA 2HQEA 2DZCA 4JJNK 5GAOr 4RG8A 1Y71A 2ZPEB 4M7AD 3DB4A 4J7FA 4YTLA 3JCMX 3M54A 3HRTA 1QVGA 3UDCA 3QYGB 3V8JA 2DJZA 1VIFA 5J3BA 3CCQT 1VQ6T 4XAXB 3DB3A 2EQKA 5KE2A 4L5GA 5GAOm 3LWIA 3CCLT 1Q81C 1Q7YU 3UPUA 3GIBA 3OYAA 2HAXA 3FDRA 2R5MA 2XU8A 2RK1A 2X4YA 3OS5A 3OSSC 2I2LA 4DOWA 1VQKT 2P0KA 3LH0A 1VQNT 1RL2A 3G7ZA 3E9GA 4QQDA 5CCAA 3BW1A 3L2WA 4M7AB 5LJ5j 4M7DG 1U8RA 3JRZA 4E7KA 4NS5A 2BKDN 2LC4A 4EMKA 4XU2A 5LJ3h 1WJQA 4RKUE 1HK9A 2DKGA 1KHIA 3CBPA 4M75E 5KCOA 2DIGA 5D6XA 4DQ2A 5GAOn 3C12A 2F5TX 1VQPA 3G71T 5CKEA 4XK8E 5FU7B 4F7UF 3PMIA 3JCMd 3WVDB 3BY7A 3JB9D 2OAUA 3HPWA 5LJ3e 3OYLA 1B34B 1ZBXA 2Y90A 2RD1A 3FB9A 3ZFJA 3TREA 3QPHA 3OB9A 3CBOA 5CIUA 4PJOB 3JB9H 4N0AA 3OYBA 4DA4A 3JCMJ 2YRVA 4X9DA 3MEAA 2K3YA 2PUKB 3KUFA 4PLLA 5HY6A 4KUIA 2RI3A 1I4K1 4O6JA 4O5VA 3ASKA 5GMKl 4IUVA 2QQSA 2EQJA 1K9MU 2LX9A 3BDUA 1V29B 4JS4A 5LL6S 4HT8A 4E7LA 2E12A 2QQRA 4HCZA 3SWNA 5CKFA 1VQ8A 4TVRA 1VQKA 3LX7A 4C5GA 1M1KU 2KY9A 3R6OA 4MZMA 4EDUA 3AHUA 2V8JA 3FIFA 2K5LA 4IUUA 4OGCA 4ZN3A 5C6SA 4BACA 3GP8A 1KD1C 1M90C 4BUGA 4FM4B 4XQ3A 2MWPA 4NOYA 3SDZA 2YLBA 5LJ3g 3M58A 4IUPA 1M1KC 4PL6A 4LDVA 3RIRA 3HFOA 5A0LA 3JB9J 4PKCC 2E64A 4BB7A 3FRNA 5GAN4 2ZCFB 3JB9G 4OB1B 4HT9A 1YBYA 2WACA 5FU7C 3CCVT 2XICA 3L2RA 3Q1JA 2RHUA 3SFMA 5GMKi 2M0OA 2VV5A 4PJOF 2L5QA 3CCMA 2DD5A 4D6WA 2EQUA 2WSCE 4M7DF 4JLGA 4JLIA 4N4GA 4BY6B 2XDBA 3NTIA 3ME9A 2EWNA 1PSFA 1VQ9T 4A54A 5GAMh 1P92A 4MDXA 2DO3A 1VQNA 1KQSS 4HCCA 1XOVA 3X24B 3M55A 3M9QA 3HP9A 2RH2A 4OF1A 3PIPA 3LGLA 2PU9B 2EFIA 4Z02A 4PLIA 1YIJT 1JRIA 3VJPA 4J6XA 3G4ST 3CC2T 2OTJT 4BE0A 3PMTA 4PJOG 1YJNT 3VKIA 4QVCA 2P0PA 3CCMT 2QA4A 3QXEB 5IAYA 2XI9A 2E41A 1JJ2A 2ZPHB 1MHNA 1BI0A 2DXUA 2VUBA 2JZ2A 4C92C 4J83A 4OMFB 5HK0A 4OVAA 1YIJA 4M75C 3OYHA 1QP3A 3OSVA 1YJWT 4FU6A 4LDUA 4M77B 1VQ4A 2YHTA 2M16A 4IURA 2CS7A 2QQBA 1UGQB 3VU3C 2RB6A 3KBGA 5GANj 1Q81U 1YHQT 2RHZA 2RJFA 4J6WA 3HFNA 2QTXA 1QP2A 3J80E 1M1GA 3UWNA 1VQLT 1QVFS 4M7AG 2QEXA 1H3ZA 2G3RA 4A4GA 2BIVA 4M78F 4HA8A 1BIBA 2IVWA 2JTMA 4C5HA 4B9WA 4EPCA 1KD1U 4M7AE 4KULA 3UT1A 5M9OA 2DXTA 4XU3A 1QW1A 2JUFA 2RM4A 4F7UA 4M75D 4M77G 4J8OA 1KQSA 5AYFA 3CCRA 3M4YA 4M75B 2DXBA 3M56A 3OYCA 2ZGWA 4CRIA 1WGSA 1O9SA 2MMPA 2JTFA 2MAMA 5D6WA 5FU6B 5GMKe 3OYMA 3G71A 1KQ1A 1VQ7T 4LDXA 2VGNA 3DLLA 4XTVA 3PTAA 2VYTA 4JS5A 3JAME 2QI2A 4XTZA 3VYHB 3OYJA 4M7DD 1N9SA 1LOJA 4QVDA 5GMKj 1R8OB 2M1HA 3CC2A 2OTJA 3EAEA 4FL6A 3CCSA 4M7DB 2AHJB 3OW2A 2LQKA 3VUZA 3CCRT 1BYMA 3N5BB 3S6WA 3P8BB 3CCJA 4J5YA 4LD6A 4A4FA 3RKXA 3PIOA 3GNGA 1G3WA 2WSEE 1RI0A 3MP8A 2KSSA 2Y4XA 2R58A 2CZ6B 2D0QB 5J26A 4OGEA 4ZN1A 5GANh 1Y7XA 5GAN3 1U1TA 4C0GA 2XK0A 3CCST 2Y4YA 1OYXA 2EJGA 4Y91A 3GLXA 2E10A 3TCJA 3BFMA 3QG1A 4M78G 4M78D 1YHQA 2D6FA 3G6ET 3I56A 4N0AC 2KQWA 2DK3A 5J39A 1YITT 1JBMA 2E65A 4RCCA 4JRPA 2K57A 1W2BS 1X75C 2HNIA 3EFSA 5LJ5d 5FU6C 3JCMW 3NFCA 4M77F 4C5EA 4E47A 1O75A 5I2MA 5CR2A 4M7DE 5FRNA 3E1SA 3ZBDA 5GANd 1M1FA 3P8DA 1K9MC 3JCMf 3CCLA 4QQ6A 2MF2A 3VV0A 3SWNC 1W2BA 3P8HA 3RESA 2RI2A 4BY6C 1Q7YC 5C0MA 4BI4A 3G6EA 5LJ5e 2L8DA 4XTUA 1Y96A 2DTOA 4C8QC 1UB4A 2QA4T 3ER0A 3CCEA 4NL3A 2WSFE 4OB0B 1TH7A 5CVIA 4EMGA 5GANe 2OTLA 2O4XB 3PNWC 1Q82U 3J7AF 3E19A 4FT2A 3JCMc 3KXTA 1N8RU 4M77E 3CXCA 3JCMV 4FIBA 4MDWA 3WXMB 5CQYA 3QZ5B 2A7YA 1D3BB 2V8IA 2X4WA 2IG0A 2CKKA 3V7CA 4M77C 2VGMA 3OS0A 5GAMf 1Q86U 4ELYC 1KG1A 1MGQA 3OYNA 5CKDA 1VQMA 4IUTA 3HL8A 3CC4A 1KC8U 5A2QE 4XU0A 3OA6A 1BI2A 1UGSB 4C92B 3S3OA 4IKFA 3LGFA 1Y96B 2RA2A 3BDLA 1K73U 3CMAT 1BIAA 3QUIA 5GAN7 1YCYA 3J81E 2P4TA 5CAIA 3O8VA 2E6NA 5KH6A 1BI1A 3M59A 1YJNA 2O01E 1PSEA 2A3LA 1OI1A 1OZ3A 1FX7A 1M9SA 2EKOA 5GMKh 1X6OA 2D9TA 2PVOB 4N4IA 3V8LA 2GF7A 2L3RA 3ZEHA 4HCBA 3L2QA 2PVDB 4FT4A 5LJ5f 4QVZA 4M75G 5IN1A 4A4EA 4BE2A 1W4SA 3PT9A 5CKHA 2CZ0B 2RK2A 2VC8A 4NL2A 3CC7A 4C0DB 2GCXA 3JCMe 1VQ4T 4XTWA 1VQ5A 3PFSA 5KE3A 3OYYA 1WQWA 3QJ6A 4PJOD 4BDYA 3CCET 1DJ7B 4C0ZA 3OMGA 1VQ8T 4C92A 4J7IA 4C92E 1NPRA 1QVPA 2K4YA 4M75A 5GAOl 2H3JA 3L2ZA 3TU4K 2MI6A 3NTHA 1XTDA 4ZGDB 2RJDA 3DLMA 2M9UA 2JN0A 5DM7R 4GY5A 1IREB 2LDMA 5GMKm 2VXFA 4R56A 3CCQA 1VQ6A 1G5VA 3QIIA 2DXCA 2EYQA 3X26B 3A8GB 1LNXA 2LRQA 4M7AC 3I56T 4C8QA 1UEBA 3CEYA 3QBYA 3WVEB 4C0DC 4E7IA 3RKYA 4C8QG 2KVQG 4BDZA 1BI3A 3CC4T 1JJ2S 1NZ9A 1NE8A 4ZTFA 4R55A 1QVGS 3QDRB 1M4ZA 3GPLA 2YLCA 1G3SA 1N27A 2EQMA 2DEQA 3M53A 5GANf 4XTYA 2DVEA 3GOXA 5LJ5h 3MP1A 3V7SA 4F7UB 3SB2A 1VQOA 4EMHA 5DLOA 1QVFA 3JB9F 2KK4A 4M75F 1KQ2A 3C95A 4F7UE 4OB3B 1YJWA 5FROA 2E1HA 3V7RA 1VUBA 2EJ9A 2JVVA 3OYEA 4J6YA 2B8AA 3MO8A 2DD4A 4M78A 3INZA 4MMLA 4VUBA 4JRQA 4PJOC 4WF2A 1YJ9A 1WPYA 2ZPBB 1AHJB 2RHXA 5GAN5 3EFRA 1WQ7A 1S72T 1K8AC 1N6AA 5GAN8 3L1AA 2FVUA 2NLUA 2JOYA 4PNOA 3PGGA 2EAYA 3L2VA 4OB2B 3G4SA 3RMSA 4ELZC 5EG2A 2E70A 1OZ2A 1HXDA 1LJOA 2L89A 3QSUA 4ZTJA 1I8FA 2XIDA 3JCMQ 1M90U 3RERA 2LQ8A 2ZPGB 2DTHA 4ATOA 4KBMB 3CMAA 2R5AA 2DIQA 2ZPIB 2V8KA 3A8OB 2KAFA 1YJ9T 2DZ9A 2P0QA 4M7DA 3JB9I 1B34A 2PUOB 3A8HB 5GAOq 2K5FA 4JDSA 3MCAB 4XU1A 1ZQ1A 2QDYB 2DPPB 3GF5A 4P5NA 5FLXE 1VQLA 4JRKA 1NJIC 3GNFB 2XDPA 4RG2A 4E7JA 2KDSA 5GAN2 3FJPA 1UGPB 4M77D 4ME7A 4X9CA 5CO7A 1M8VA 2K2VA 3C4SA 5GAMg 5GAOp 1JB0E 4IUQA 4C0FA 3MP6A 3OY9A 3LLRA 5L8RE 3CPWS 3M5AA 4B9XA 3CMET 3MEUA 5DY9A 2E5QA 3CD6T 4LDYA 3RMQA 2ZPFB 4MMKA 3OBYA 4L59A 3JCMb 4DOVA 1NJIU 1IZ6A 5KCHA 3L2UA 3A8MB 1YI2T 1YITA 3LWHA 2X4JA 4M7AF 5LJ3d 4EMKC 2CGHA 4M78B 4A53A 2CZ1B 4MZPA 3RKWA 3CCVA 4BI8B 1VQMT 2HQXA 2X4XA 1BKBA 2X35A 4OP0A 4LDWA 4II1A 3TEEA 1EIFA 3MEWA 2KMTA 3SWNB 4N4HA 3OS2A 3CXCS 2XG8D 2RHIA 3I55A 3H6ZA 1S72A 2EIFA 4CI0C 4M77A 5LJ5g 2QQAA 1N9RA 1G3YA 2HD0A 4GLKA 5LJ3f 3CCJT 4E7HA 3JCMP 3T9NA 1VQ9A 3S3NA 4UC4A 3OYDA 3META 4XTXA 5GAMe 4QQGA 5CQXA 4C8QF 4BE1A 2C06A 2OTLT 3X25B 2GQVA 1WJRA 4LD9K 3CPWA 3S3MA 2XKOC 4BI3A 4C8QB 1KHCA 3CBMA 1ZHIA 3M57A 1VQOT 2VXEA 1Q86C 1D3BA 2XHCA 4C8QE 3I55T 1UGRB 2RHYA 4A4KA 5GAMd 4V2SA 1FXXA 2RJCA 3OYKA 5IT9E 2RI5A 1SSFA 2GFAA 3OYFA 5D6YA 1N8RC 2QXFA 3OQ5A 3SD4A 3QYHB 4L6V5 2CZ7B 1XNIA 3H8ZA 3HHTB 1VIEA 1WNLA 2HBPA 2DTIA 4QW2A 4KUDK 4M7DC 4C92D 3HSBA 3E9FA 2LNVA 2F69A 3F70A 2LTOA 3HRSA 4HKEA 3CCUT 2E6ZA 3CPFA 4A4HA 2GFUA 2LVMA 3MEVA 3LW5E 4Q5WA 3RUXA 4PJOE 1VQPT 4M78E 3JSCA 5A0DA 5GANg 4BD3A 2RJEA 1FWZA 5DLQE 3FC3A 2FL7A 4F7UG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT8 A;  5I21 A;  4M75 F;  3SWN A;  1KQ2 A;  5GAN h;  4F7U E;  5GAN 3;  4EMK B;  1U1T A;  2E1H A;  4JRI A;  3V7R A;  4C92 F;  2EJ9 A;  2EJG A;  4Y91 A;  3AHU A;  3FIF A;  4J6Y A;  2E10 A;  4M78 A;  3BFM A;  3INZ A;  4MML A;  4M7A A;  4PJO C;  4WF2 A;  1WPY A;  4M78 G;  2EJF A;  4M78 D;  4XQ3 A;  5GAN 5;  4NOY A;  2YLB A;  4N0A C;  3EFR A;  1WQ7 A;  4C8Q D;  5LJ3 g;  3V8K A;  1JBM A;  2E65 A;  4RCC A;  5GAN 8;  2K57 A;  3EFS A;  2HNI A;  5LJ5 d;  3L1A A;  3HFO A;  4RCB A;  3RIR A;  5LJ3 j;  4M77 F;  1I81 A;  2FB7 A;  2E64 A;  1M5Q 1;  2EAY A;  3PGG A;  4PNO A;  5GAN 4;  3JCM g;  5GAN d;  3QO3 A;  5GAN 7;  3JB9 G;  1HXD A;  1LJO A;  4HT9 A;  3JCM f;  3QSU A;  1I8F A;  1I5L A;  3JCM Q;  3M4G A;  3RER A;  3SWN C;  3RES A;  2DTH A;  5GMK i;  4PJO F;  5LJ5 e;  4C92 G;  4JUV A;  1Y96 A;  2DTO A;  4XTU A;  4C8Q C;  2DZ9 A;  4M7D A;  3JB9 I;  3QHS A;  4NL3 A;  1B34 A;  4M78 C;  1TH7 A;  4EMG A;  4JLI A;  5GAN e;  5GAO q;  4M7D F;  4PJO A;  1U1S A;  4XU1 A;  3JCM h;  2EWN A;  4JRK A;  3JCM c;  4A54 A;  2FYK A;  5GAM h;  4M77 E;  5GAN 6;  5GAM j;  3JCM V;  5GAN 2;  1X01 A;  3FJP A;  4M77 D;  4X9C A;  1H64 1;  1D3B B;  1M8V A;  5GAM g;  3V7C A;  5GAO p;  4M77 C;  5GAM f;  2DZC A;  5DY9 A;  1JRI A;  1MGQ A;  4J6X A;  5GAO r;  4MMK A;  4PJO G;  3JCM b;  4M7A D;  4QVC A;  4XU0 A;  4C92 B;  2E41 A;  2RA2 A;  1Y96 B;  4M7A F;  3JCM X;  2DXU A;  1BIA A;  3QUI A;  1YCY A;  5LJ3 d;  3V8J A;  2DJZ A;  4EMK C;  2CGH A;  4M78 B;  5CAI A;  4A53 A;  4C92 C;  3JCM W;  3RKW A;  5GAO m;  3GIB A;  5GMK h;  4M75 C;  3V8L A;  4OP0 A;  3SWN B;  2I2L A;  4M77 B;  2YHT A;  3JB9 J;  5LJ5 f;  3VU3 C;  4M77 A;  2RB6 A;  5GAN j;  4M75 G;  4M7D E;  5LJ5 g;  5LJ3 f;  1N9R A;  2VC8 A;  3BW1 A;  4J6W A;  3HFN A;  4NL2 A;  3JCM e;  3JCM P;  2QTX A;  4XTW A;  4M7A B;  5LJ5 j;  4M7D G;  4XTX A;  5GAM e;  4M7A G;  4C8Q F;  1WQW A;  4PJO D;  4M78 F;  4HA8 A;  1BIB A;  4EMK A;  4C8Q B;  4XU2 A;  5LJ3 h;  4M7A E;  4C92 A;  1HK9 A;  2DXT A;  2DKG A;  4XU3 A;  4C92 E;  2RM4 A;  2VXE A;  4M75 E;  4DQ2 A;  1D3B A;  5GAO n;  4C8Q E;  4F7U A;  4M75 A;  4M75 D;  5GAO l;  4M77 G;  3L2Z A;  3JB9 F;  4V2S A;  5GAM d;  4F7U F;  3JCM d;  2JN0 A;  2ZGW A;  3BY7 A;  3JB9 D;  5GMK m;  2VXF A;  5LJ3 e;  5GMK e;  1KQ1 A;  1B34 B;  2Y90 A;  3FB9 A;  2RD1 A;  1LNX A;  4M7A C;  4XTV A;  4C8Q A;  4M7D C;  1WNL A;  2DTI A;  4C92 D;  3RKY A;  4C8Q G;  3HSB A;  4XTZ A;  4PJO B;  3JB9 H;  4N0A A;  3JCM J;  1N9S A;  1LOJ A;  4QVD A;  5GMK j;  4M7D D;  4X9D A;  4M7D B;  2YLC A;  4PJO E;  2DEQ A;  5GAN f;  4XTY A;  3RUX A;  4J5Y A;  2DVE A;  1I4K 1;  5GMK l;  4M78 E;  3RKX A;  5GAN g;  5LJ5 h;  3V7S A;  4M75 B;  4F7U B;  3SB2 A;  4EMH A;  3BDU A;  4F7U G; 
#chains in the Genus database with same CATH topology
 5I21 A;  1SG5 A;  4EMK B;  4JRI A;  3CCU A;  4C92 F;  2R57 A;  1VQ5 T;  2AKL A;  3L42 A;  1IXD A;  2EJF A;  3A5Z B;  4J9B A;  1I81 A;  2IIM A;  3CME A;  2XD0 A;  3M0U A;  3QO3 A;  3HRU A;  3OYI A;  3EH2 A;  3M4G A;  2LT1 A;  1GXI E;  1RUW A;  4JUV A;  1PHT A;  4J9E A;  3A8L B;  3DKM A;  1U1S A;  4X1V A;  3KFV A;  1BBZ A;  2LT4 A;  1V1C A;  5GAN 6;  1Y07 A;  2K5I A;  2LCC A;  1NPP A;  2HQE A;  5GJW B;  2AZV A;  1VQM Q;  4FW1 A;  1FYN A;  4YTL A;  3M54 A;  3V8J A;  1VIF A;  2EYW A;  4L5G A;  1QVF P;  3OSS C;  4DOW A;  1VQK T;  3RDV A;  1VQN T;  3L2W A;  2K2M A;  2FZC B;  5LJ5 j;  4NS5 A;  4EMK A;  1WJQ A;  1VQ4 Q;  1GFD A;  3M0Q A;  4OML A;  3CBP A;  5KCO A;  4DQ2 A;  4CC3 A;  5FU7 B;  3PMI A;  3WVD B;  3BY7 A;  5LJ3 e;  2CP0 A;  4KGZ B;  1G83 A;  3EGX A;  3QPH A;  1RAF B;  4N0A A;  3JCM J;  4X9D A;  2PUK B;  3KUF A;  5HY6 A;  2LQN A;  1I4K 1;  4O6J A;  5GMK l;  2EQJ A;  1YJN Q;  4HT8 A;  2E12 A;  2DBM A;  2KYM A;  3LX7 A;  3E2U A;  3R6O A;  4MZM A;  2YT6 A;  4BAC A;  4FM4 B;  3SDZ A;  3MPU B;  1RI9 A;  4FYX B;  2AT1 B;  4LNP A;  5FWB A;  4PKC C;  4JPB W;  2E64 A;  3FRN A;  1TU0 B;  4DEY A;  3CCV T;  2XIC A;  3Q1J A;  2EKH A;  2RHU A;  5GMK i;  2CRE A;  4FYY B;  1HJD A;  2L5Q A;  4D6W A;  1AWJ A;  4N4G A;  2XDB A;  1RLP C;  3ME9 A;  1VQ9 T;  2A37 A;  1P92 A;  4KGV B;  4HCC A;  3THK A;  1RAB B;  2LJ3 A;  3G6E Q;  1FMW A;  2M02 A;  3HP9 A;  3LGL A;  4Z02 A;  5EC7 A;  2BTT A;  3PMT A;  1JXM A;  1WFW A;  2E41 A;  2ZPH B;  3TQ7 P;  2JZ2 A;  1VQN Q;  3CCJ Q;  2AIR B;  4M75 C;  1X27 A;  3KBG A;  1YHQ T;  2EQI A;  2RHZ A;  2RJF A;  1UDL A;  3HFN A;  3J80 E;  3UWN A;  1VQP Q;  1K0X A;  1OU8 A;  2OI3 A;  2G3R A;  2BIV A;  2HZY A;  4M78 F;  2IVW A;  2JTM A;  4C5H A;  1KD1 U;  3EGU A;  4KUL A;  1M8M A;  4XU3 A;  1QW1 A;  1WXU A;  2DL3 A;  3VRY A;  1TSF A;  2HMA A;  1X6B A;  2DXB A;  1JQQ A;  1O9S A;  2JTF A;  2MAM A;  5D6W A;  2CP6 A;  1VQ7 T;  2O31 A;  2QG9 B;  4XTV A;  3H0H A;  3CC2 A;  2OTJ A;  1R8O B;  1TS9 A;  3OW2 A;  3CCR T;  2DRK A;  4J5Y A;  1PKS A;  4A4F A;  3RKX A;  3MJX A;  2O9S A;  2WSE E;  1RI0 A;  3VS5 A;  1RAG B;  2D0Q B;  4OGE A;  4RTY A;  3CCS T;  2Y4Y A;  3EG2 A;  2EJG A;  2HL5 C;  4Y91 A;  3GLX A;  2E10 A;  3R6N A;  3QG1 A;  4M78 G;  2HSP A;  2DK3 A;  2KT8 A;  1JBM A;  4RCC A;  4JRP A;  1X75 C;  5LJ5 d;  2V1R A;  3NFC A;  4OMN A;  4C5E A;  2CP5 A;  5CR2 A;  3ZBD A;  1YI2 Q;  1C6V X;  1M1F A;  3P8D A;  3CCL A;  2VVK A;  3VV0 A;  3SWN C;  1W2B A;  2RI2 A;  4IIO A;  1GCQ A;  1Y96 A;  4XTU A;  4E7S A;  1W2B P;  3ER0 A;  4OB0 B;  1PRL C;  2O4X B;  3PNW C;  1ZUK A;  3E19 A;  2D0N A;  1N8R U;  3JCM V;  4MDW A;  2A7Y A;  1D3B B;  1E6H A;  2V8I A;  2X4W A;  2LNH B;  4M77 C;  3OS0 A;  3UAT A;  1PM3 A;  1KG1 A;  1KJW A;  1MGQ A;  5A2Q E;  3M0T A;  2K6D A;  2P4T A;  1I1J A;  5KH6 A;  1BI1 A;  3M59 A;  3O5Z A;  2O01 E;  1PSE A;  2A3L A;  1OI1 A;  1YFN A;  4E2F B;  1X6O A;  3V8L A;  1JEG A;  3L2Q A;  1E6G A;  2PVD B;  1IRX A;  4QVZ A;  4A4E A;  1VYT A;  2CZ0 B;  2RK2 A;  4NL2 A;  2GCX A;  5KE3 A;  4BDY A;  2X9H A;  3CD6 Q;  4C92 E;  2K4Y A;  2NWM A;  3L2Z A;  2RJD A;  2JN0 A;  4QKU A;  1MMD A;  2VXF A;  4R56 A;  3CCQ A;  3QII A;  2EYQ A;  2ECZ A;  1QWE A;  2KE9 A;  3I56 T;  1BI3 A;  1NZ9 A;  3CCV Q;  4PK4 A;  2EQM A;  2DEQ A;  4XTY A;  2DVE A;  3MP1 A;  4E7Z A;  4JJC A;  3SB2 A;  1VQO A;  4EMH A;  4OB3 B;  4CC4 B;  3V7R A;  3EFO A;  4VUB A;  3MO8 A;  2DD4 A;  4M78 A;  4MML A;  1YJ9 A;  2ROT A;  2RQV A;  1GBQ A;  1K8A C;  1N6A A;  1IHW A;  1ABQ A;  3PVQ A;  2JOY A;  4PNO A;  4A63 B;  2EAY A;  2E70 A;  3EG1 A;  1I8F A;  3JCM Q;  2RN8 A;  2DTH A;  1AWW A;  2R5A A;  4RTZ A;  4RTV A;  4M7D A;  2P0Q A;  4JDS A;  4XU1 A;  1ZQ1 A;  2QDY B;  2DPP B;  4P5N A;  3UA7 A;  3M0P A;  5IXF A;  2XDP A;  1RAA B;  1YWO A;  3EGD B;  1B7T A;  4E7J A;  2KDS A;  1UGP B;  5CO7 A;  1M8V A;  3RNJ A;  1KC8 R;  1JB0 E;  3TSZ A;  3CPW S;  3CME T;  2KRN A;  2X4J A;  2MYS A;  2CZ1 B;  2NUP B;  4BI8 B;  1QWF A;  4LDW A;  3MEW A;  1VQL Q;  1IGQ A;  3I55 A;  1S72 A;  2EIF A;  4J9D A;  4PFZ A;  5LJ5 g;  4GLK A;  1N9R A;  5LJ3 f;  4ANJ A;  3T9N A;  2NUT B;  1H3H A;  2NUZ A;  3MET A;  4C8Q F;  3X25 B;  1QVG P;  2LQW A;  4LD9 K;  3S3M A;  8ATC B;  2VXE A;  3BE3 A;  1Q86 C;  4C8Q E;  2DET A;  1T3S A;  1FMV A;  2RJC A;  1OV3 A;  5IT9 E;  3OYF A;  3QYH B;  2CZ7 B;  4M7D C;  2HBP A;  4C92 D;  3HSB A;  5ECA A;  2F69 A;  2YDL A;  1BCO A;  4FCY A;  2KI7 A;  4HKE A;  2E6Z A;  3CPF A;  4Q5W A;  1OEB A;  1VQP T;  3JSC A;  5GAN g;  1FWZ A;  5DLQ E;  2HSE B;  2XDD A;  2BUD A;  2P4R A;  3URG A;  3VYG A;  2NYS A;  4MZT A;  2VAS A;  1K73 C;  3OS1 A;  5D7U A;  1KC8 C;  4ZGJ B;  3FLG A;  2RO0 A;  3CPW P;  1VQ7 A;  1XQH A;  4RCB A;  1PCX A;  1ZSG A;  5CKB A;  1G8X A;  4X34 A;  3CD6 A;  3FEO A;  3JCM g;  5I2S A;  5HKC A;  2ENM A;  2VWF A;  3PE0 A;  1I5L A;  1J3T A;  1ZX6 A;  3OW2 S;  4C92 G;  2LCL A;  3QJY A;  1T3L A;  2MPX C;  3QHS A;  3OYG A;  1LPL A;  1WHK A;  2H8H A;  3JCM h;  2JS2 A;  3CC7 T;  1NJI R;  3MHX A;  2YWW A;  1ZUU A;  2P84 A;  1WYX A;  1Q95 G;  2DEU A;  4JJN K;  4OMO A;  5GAO r;  4M7A D;  1Y71 A;  3JCM X;  1QVG A;  2HL3 A;  2DJZ A;  1VQ6 T;  3DB3 A;  2C0I A;  1Q7Y U;  2A0F B;  2R5M A;  2XU8 A;  2RK1 A;  2X4Y A;  3OS5 A;  3RBB B;  1WXB A;  1F1B B;  2H3E B;  1VOM A;  2CP2 A;  4RUG A;  3G7Z A;  4QQD A;  4DEX A;  4M7A B;  1ACM B;  1U8R A;  3JRZ A;  4E7K A;  2DBK A;  2JXB A;  4XU2 A;  3NGP A;  1KHI A;  4M75 E;  1UE9 A;  2ZAE A;  1KK7 A;  1VQP A;  5L23 A;  2ATC B;  4XK8 E;  1ZSZ B;  2GQI A;  1GBR A;  4F17 A;  1GRI A;  3JB9 D;  2OAU A;  2M0Y A;  3VS1 A;  1B34 B;  3FB9 A;  4ESR A;  5KYY B;  2QYZ A;  3ZFJ A;  3H41 A;  2YRV A;  2J05 A;  4PLL A;  4KUI A;  2RI3 A;  4IUV A;  3OW2 P;  2PZ1 A;  3BDU A;  4JS4 A;  5LL6 S;  2HKN A;  4HCZ A;  1VQ8 A;  5CKF A;  1T0J A;  4J9H A;  4C5G A;  1M1K U;  4F16 A;  1WHJ A;  3G71 Q;  3AHU A;  4IUU A;  4M4Z A;  4ZN3 A;  5C6S A;  4XQ3 A;  4AFS C;  5LJ3 g;  3M58 A;  4CC2 A;  3HFO A;  4BB7 A;  3VS0 A;  4DBR A;  3JB9 G;  4OB1 B;  5I11 A;  1OPK A;  1Z9Q A;  3D7S B;  1WIE A;  1D1B A;  2M0O A;  4PJO F;  3VS4 A;  3CCM A;  2V1Q A;  2EQU A;  4JLG A;  1X6G A;  1CSK A;  2EWN A;  3AT1 B;  4A54 A;  5GAM h;  1QCF A;  2CUD A;  2DO3 A;  1VQN A;  2RQU A;  1NBE B;  1KQS S;  4J9I A;  3X24 B;  2W0Z A;  5KYX B;  4OF1 A;  2RH2 A;  4CC7 A;  2PU9 B;  4PLI A;  1VQ6 Q;  1JRI A;  3VJP A;  4J6X A;  3VKI A;  4QVC A;  5IAY A;  2CP3 A;  2DXU A;  3CME Q;  4C92 C;  1OX8 A;  4F14 A;  1YIJ A;  4OMP A;  1QP3 A;  2AZS A;  4LDU A;  2YHT A;  2M16 A;  1D1A A;  4IUR A;  2HBW A;  2CS7 A;  2QQB A;  1N5Z A;  1UGQ B;  2RB6 A;  3VU3 C;  5GAN j;  2F1L A;  1D1C A;  4J6W A;  1QP2 A;  4LXC A;  1TUG B;  1H3Z A;  4HA8 A;  1BIB A;  4M7A E;  3UT1 A;  3CC2 Q;  2OTJ Q;  2DXT A;  2HDA A;  4J8O A;  1SHG A;  4K11 A;  3OYC A;  3REB B;  2MMP A;  2EGE A;  3VS6 A;  3OYM A;  1WHG A;  3EGD A;  3DLL A;  3NHN A;  3EGX B;  3I5S A;  1C0M A;  4GLM A;  3JAM E;  2QI2 A;  4XTZ A;  4J9F A;  3VYH B;  5KYW A;  4M7D D;  1LOJ A;  4QVD A;  3EAE A;  4M7D B;  2L0A A;  3N5B B;  2KBT A;  3PIO A;  2KRM A;  3GNG A;  2E5K A;  1XJW B;  3MP8 A;  2YUN A;  4ZN1 A;  1Y7X A;  2KRS A;  4C0G A;  2XK0 A;  1OYX A;  2EYY A;  3TVT A;  5FW9 A;  2D6F A;  3G6E T;  3I56 A;  2KQW A;  2E65 A;  3EFS A;  5FU6 C;  2E3H A;  2VKN A;  3JCM W;  1OQK A;  4PJN A;  1UG1 A;  3RES A;  1Q7Y C;  5C0M A;  4BI4 A;  3G6E A;  3QDF A;  2L8D A;  2EW3 A;  1CKA A;  2DTO A;  4RTX A;  2OTL A;  4EMG A;  5GAN e;  1Q82 U;  2DA9 A;  3J7A F;  1OOT A;  3KXT A;  4M77 E;  3WXM B;  4JZ4 A;  3QZ5 B;  2AK5 A;  2IG0 A;  1D0Z A;  2COY A;  3SHW A;  1TG0 A;  5GAM f;  4ELY C;  5CKD A;  1OX9 A;  4IUT A;  3HL8 A;  1KC8 U;  2HKQ B;  1BI2 A;  3S3O A;  4IKF A;  2KXC A;  1R0C B;  2RA2 A;  2KYB A;  1K73 U;  3QUI A;  5GAN 7;  3J81 E;  1NEG A;  4EIK A;  1AT1 B;  1YJN A;  2QAS A;  1FX7 A;  1M9S A;  5GMK h;  2D9T A;  2JM9 A;  2GF7 A;  3ZEH A;  1AWO A;  4HCB A;  1IO6 A;  2CUB A;  3QWY A;  4BE2 A;  1W4S A;  5CKH A;  4C0D B;  2FZG B;  1BCM A;  3OYY A;  3QJ6 A;  3EG0 A;  1DJ7 B;  1KSW A;  1VQ8 T;  4DBQ A;  4J7I A;  1YJ9 Q;  5GAO l;  3TU4 K;  2MI6 A;  1FMK A;  2OTL Q;  1XTD A;  4ZGD B;  1UUE A;  3DLM A;  2DER A;  2LDM A;  1LNX A;  4M7A C;  1AEY A;  1UEB A;  1M1K R;  4AFZ C;  1WDX A;  4R55 A;  1NLP C;  1GL5 A;  5GAN f;  2FPD A;  4F7U B;  5DLO A;  2KK4 A;  3A1P A;  4M75 F;  5GJV B;  5KYN A;  3C0C A;  2EJ9 A;  2DYB A;  2JJ9 A;  2OAW A;  2JVV A;  1KIK A;  4PJO C;  4WF2 A;  1WPY A;  1AHJ B;  2DFU A;  3UF4 A;  3L1A A;  1AZG B;  2CT3 A;  2FVU A;  5EG2 A;  1MUZ A;  1HXD A;  2ESW A;  3CMA Q;  2ZPG B;  3CMA A;  1MMA A;  2DIQ A;  2J7I A;  1QKX A;  2KAF A;  5KYY A;  2DZ9 A;  2YXY A;  1B34 A;  5FLX E;  2RQT A;  2FRY A;  3GNF B;  1W6X A;  5GAN 2;  1K76 A;  4M77 D;  2Z0W A;  3C4S A;  3OY9 A;  4OMM A;  3CCE Q;  4AG1 C;  5DY9 A;  4LDY A;  2RQW A;  1NJI U;  2L3P A;  4L59 A;  1GCQ C;  1GCP A;  5KCH A;  4M7A F;  2MOX A;  1UFF A;  3RKW A;  3CCV A;  4PFO A;  2J6O A;  1M3C A;  1VQM T;  2HQX A;  1BKB A;  2FZK B;  3TEE A;  3CXC S;  1TUD A;  3OS2 A;  1M90 C;  2EPD A;  2KMT A;  4N4H A;  3H6Z A;  4CI0 C;  2V26 A;  4E7H A;  1VQ9 A;  3EG9 A;  4BE1 A;  1R0B G;  1SF9 A;  3CBM A;  3LH5 A;  2RPN A;  2K79 A;  4A4K A;  5GAM d;  2YUO A;  1FXX A;  2QXF A;  4PJM A;  4L6V 5;  1U3O A;  1VYV A;  1KFZ A;  3HHT B;  1WNL A;  4PFP A;  2DTI A;  1PKT A;  1LVK A;  4PJO E;  2LVM A;  3MEV A;  3LW5 E;  2LX7 A;  2RJE A;  1O75 A;  3X20 B;  2DAQ A;  1VYU A;  1YIT Q;  1M30 A;  1ZA1 B;  3C94 A;  1YJW Q;  3V8K A;  1T0H A;  3M0R A;  1YJW A;  1EFN A;  2IPO B;  5LJ3 j;  4C5I A;  2FB7 A;  5IHI A;  3NPF A;  3OBW A;  2CT4 A;  2YUQ A;  3HTR A;  3EHQ A;  1Y57 A;  3OMC A;  4RTU A;  2QEX T;  4ZGE B;  2CYZ B;  3NTK A;  1K73 R;  4JJB A;  2SEM A;  5CK9 A;  4KT0 E;  1X01 A;  1IGU A;  5KYU A;  1Z9Z A;  1ARK A;  2E3I A;  2F2W A;  1ZUY A;  2DZC A;  1BB9 A;  2ZPE B;  2DNU A;  3HRT A;  3UDC A;  3QYG B;  1JU5 C;  1MV3 A;  2YUP A;  1JJ2 P;  4XAX B;  5GAO m;  3GIB A;  1TWB A;  1Q81 C;  3UPU A;  3OYA A;  2HAX A;  4LUE A;  2P0K A;  2O9V A;  2L3S A;  3E9G A;  3BW1 A;  2O88 A;  2JMA A;  2BE7 D;  2BKD N;  1AZE A;  1TOV A;  4HVV A;  2KR3 A;  2DKG A;  2EGA A;  2JW4 A;  2DL5 A;  2KEA A;  3G71 T;  5CKE A;  4F7U F;  1Y0M A;  3JCM d;  3HPW A;  3OYL A;  1UTI A;  2Y90 A;  4ZNX A;  3CBO A;  5CIU A;  1HYO A;  3OYB A;  4DA4 A;  1SKU B;  1M2V B;  3MEA A;  1VQ4 A;  1K9M U;  4O5V A;  3ASK A;  1WHL A;  1SHF A;  2QQS A;  2DL4 A;  3I35 A;  2LX9 A;  1H8K A;  2A28 A;  2CSI A;  2LJ1 A;  4E7L A;  3SWN A;  1VQK A;  1WXT A;  4TVR A;  4EDU A;  2EVR A;  3FIF A;  1KD1 C;  1TUC A;  1M27 C;  2MWP A;  4NOY A;  2XMF A;  2BZ8 A;  1M1K C;  1AWX A;  4LDV A;  3JV3 A;  3JB9 J;  4D8K A;  5IH2 A;  1JO8 A;  1YBY A;  1ZSZ C;  2VB6 A;  2WAC A;  4JJD A;  3SFM A;  2FPE A;  3G1J A;  7AT1 B;  2DD5 A;  1PSF A;  2QGG A;  4E6R A;  1YCS B;  3M9Q A;  3H0F A;  1PD1 A;  2CH4 W;  1YJN T;  3GBQ A;  4PJO G;  4R0K A;  2P0P A;  3CCM T;  2XI9 A;  1Q7Y R;  1MHN A;  1E7O A;  1MV0 B;  4IIM A;  4LE9 A;  1RLQ C;  1WHH A;  2B86 A;  5HK0 A;  4OVA A;  1VQ7 Q;  3OYH A;  2I0N A;  2DL8 A;  2MIO A;  1YJW T;  1QCN A;  2RMO A;  2EGC A;  1WI7 A;  2DRM A;  2QTX A;  1VQL T;  4M7A G;  4Z8A A;  4A4G A;  1QQJ A;  4B9W A;  1SEM A;  2JUF A;  2RM4 A;  4RTT A;  4F7U A;  1KQS A;  1YN8 A;  3CCR A;  3M4Y A;  1ZSZ A;  3M56 A;  2ZGW A;  3H9N A;  4CRI A;  1WGS A;  2KRO A;  1ZA2 B;  1KQ1 A;  2VGN A;  3PVL A;  3VS2 A;  2QTV A;  3PTA A;  2VYT A;  5GMK j;  1PNJ A;  1D09 B;  2AHJ B;  1BYM A;  2LQK A;  3S6W A;  1UJY A;  3P8B B;  3CCJ A;  2KSS A;  2DF6 A;  2CZ6 B;  3VRZ A;  5GAN 3;  1U1T A;  3CCL Q;  3TCJ A;  2MK5 A;  1YHQ A;  2KXD A;  2QGF B;  4N0A C;  1YIT T;  2K57 A;  2HNI A;  2C0O A;  4M7D E;  5I2M A;  3E1S A;  2QA4 Q;  5GAN d;  1ZLM A;  1NM7 A;  1SRL A;  2MF2 A;  3P8H A;  4BY6 C;  2YSQ A;  3IQL A;  3I55 Q;  5LJ5 e;  1AVZ C;  3QWX X;  4C8Q C;  1UB4 A;  3CCE A;  2A36 A;  2WSF E;  1TH7 A;  5CVI A;  2LJ0 A;  4FIB A;  5CQY A;  2CKK A;  3V7C A;  1SSH A;  1HD3 A;  2FO0 A;  2VGM A;  1WX6 A;  1Q86 U;  1RAI B;  4ORZ A;  3CC4 A;  4XU0 A;  3CCR Q;  1UGS B;  3LGF A;  3BDL A;  3CMA T;  4HCK A;  1BIA A;  3O8V A;  2E6N A;  3G4S Q;  1IHV A;  4N4I A;  1U06 A;  1JXO A;  5IN1 A;  1U5S A;  1VQ4 T;  3JCM e;  2ED0 A;  4AG2 C;  1WQW A;  4OMQ A;  1PRM C;  1BK2 A;  4C0Z A;  2X51 A;  1X69 A;  4C92 A;  2J6F A;  1NPR A;  2DM1 A;  2FPF A;  1QVP A;  4M75 A;  3REA B;  2H3J A;  3H0I A;  2M9U A;  5DM7 R;  2K9G A;  4GY5 A;  5KYU B;  2X3W D;  5GMK m;  2DVJ A;  1VQ6 A;  1G5V A;  3X26 B;  1VQO Q;  4D8D A;  3A8G B;  5I22 A;  3CEY A;  3WVE B;  4C0D C;  4E7I A;  2GTO A;  4C8Q G;  2KVQ G;  1JJ2 S;  3CC4 T;  2NUT A;  1QCO A;  3QDR B;  1QVG S;  1M4Z A;  3GPL A;  2YLC A;  1G3S A;  1N27 A;  3M53 A;  1PC0 A;  2EBP A;  3I56 Q;  5LJ5 h;  3JB9 F;  4WTO B;  4Y92 A;  2D1X A;  2CH4 A;  3C95 A;  4F7U E;  2E1H A;  1VUB A;  4DBH A;  3OYE A;  4J6Y A;  4AMC A;  2COZ A;  9ATC B;  4JRQ A;  2E4H A;  1ABO A;  1GFC A;  1BU1 A;  1WQ7 A;  1S72 T;  5GAN 8;  1A0N B;  3PGG A;  3L2V A;  4OB2 B;  3RMS A;  4ZTJ A;  2XID A;  1M90 U;  4LUD A;  4ATO A;  1X2K A;  4KBM B;  1WZO A;  4FSS A;  1Q82 R;  2JT4 A;  2ZPI B;  3A8O B;  3JB9 I;  3A8H B;  2DJQ A;  2K5F A;  1NEB A;  3GF5 A;  1NJI C;  4RG2 A;  5KYX A;  3FJP A;  4ME7 A;  2CDT A;  4C0F A;  4IUQ A;  4B9X A;  1I0C A;  1B07 A;  2E5Q A;  3CCU Q;  3L2U A;  3LWH A;  4DBF A;  5LJ3 d;  4EMK C;  4M78 B;  4A53 A;  3EG9 B;  1RAC B;  3I9Q A;  2X35 A;  4II1 A;  1EIF A;  3SWN B;  2XG8 D;  2RHI A;  4HVU A;  4M77 A;  2YRC A;  1YP5 A;  2QQA A;  1G3Y A;  1EX4 A;  4RTW A;  1S1N A;  3S3N A;  4UC4 A;  3OYD A;  1MNE A;  5GAM e;  5CQX A;  2GQV A;  1WJR A;  2DX1 A;  2F2X A;  4BI3 A;  1KHC A;  1YHQ Q;  1WLP B;  1VQO T;  3I55 T;  1RAE B;  1Q81 R;  3OYK A;  1SSF A;  2GFA A;  1N8R C;  3OQ5 A;  3SD4 A;  1XNI A;  1UEC A;  1VIE A;  4KUD K;  2LNV A;  1UGV A;  2LTO A;  1IB8 A;  2GFU A;  3RUX A;  4M78 E;  4BD3 A;  5AYF A;  4M75 B;  1OPL A;  5AT1 B;  1K8A U;  2F5K A;  3CQT A;  2PQW A;  3QKJ A;  2EYX A;  5A0G A;  4M7A A;  2FHD A;  2K3B A;  5HK3 A;  1NYF A;  4C8Q D;  1G3T A;  2DYI A;  3LYI A;  1QVF S;  2K3X A;  2YRD A;  1M2O A;  3QZ9 B;  4Y28 E;  1M5Q 1;  1TTH B;  3X28 B;  2MWO A;  4RMO A;  1YWP A;  2ZZD A;  1WJS A;  1WHM A;  2QQ9 A;  5KYW B;  1Q82 C;  1YI2 A;  2PVG B;  1Q86 R;  2O4X A;  4M78 C;  4HVW A;  4PJO A;  3FJ5 A;  2LZ6 B;  4FSX A;  3VUB A;  4GBQ A;  2PNI A;  2FYK A;  4KH0 B;  2KNB B;  5GAM j;  3HKS A;  5FRM A;  1H64 1;  1QLY A;  3EH1 A;  2JNG A;  4RG8 A;  3DB4 A;  4J7F A;  1K0S A;  5J3B A;  3CCQ T;  3CCL T;  3LWI A;  2EQK A;  5KE2 A;  2RF0 A;  3FDR A;  2I2L A;  2JTE A;  3LH0 A;  2QDL A;  1RL2 A;  1OUL A;  5CCA A;  1VQK Q;  4M7D G;  2FEI A;  3VS7 A;  1V76 A;  2LC4 A;  5LJ3 h;  3U23 A;  2BZY A;  4RKU E;  1HK9 A;  5GAO n;  3UA6 A;  2DIG A;  5D6X A;  1MMN A;  3C12 A;  2F5T X;  1PWT A;  2L2P A;  2HEQ A;  2BZX A;  2DIL A;  6AT1 B;  3M0S A;  5HCK A;  1ZBX A;  2RD1 A;  3CC7 Q;  3TRE A;  3OB9 A;  4PJO B;  3JB9 H;  2RQR A;  2KGT A;  2K3Y A;  1K4U S;  1H92 A;  3CPW A;  4FW2 A;  1V29 B;  2QQR A;  2KY9 A;  2LP5 A;  4HXJ A;  1M90 R;  2V8J A;  2K5L A;  4OGC A;  1D0X A;  3GP8 A;  4BUG A;  2YLB A;  4IUP A;  2GNC A;  4PL6 A;  4B6M A;  1PD0 A;  3RIR A;  5A0L A;  5GAN 4;  2ZCF B;  3CC4 Q;  4HT9 A;  5FU7 C;  3VS3 A;  4Z89 A;  3L2R A;  1K1Z A;  2VV5 A;  2M51 A;  2WSC E;  4M7D F;  2JM8 A;  4JLI A;  4BY6 B;  3NTI A;  4Z88 A;  4MDX A;  1XOV A;  3M55 A;  1M3B A;  3PIP A;  2LMJ A;  2EFI A;  1VQ8 Q;  1VQ9 Q;  3CCQ Q;  1YIJ T;  1NYG A;  3G4S T;  3CC2 T;  2OTJ T;  4BE0 A;  2QA4 A;  1CKB A;  3QXE B;  1JJ2 A;  2L3Q A;  1BI0 A;  4J9C A;  2VUB A;  4J83 A;  1G2B A;  1SRM A;  4OMF B;  1YNZ A;  3OSV A;  4FU6 A;  4M77 B;  1NLO C;  1Q81 U;  2KT1 A;  1M1G A;  2G6F X;  1HSQ A;  3EFO B;  2QEX A;  4EPC A;  5M9O A;  2MCN A;  2OJ2 A;  2DE0 X;  4M75 D;  4M77 G;  1VA7 A;  2X3X D;  2FRW A;  2QEX Q;  2JS0 A;  1M2V A;  5GMK e;  5FU6 B;  3G71 A;  4LDX A;  2DLP A;  2C0T A;  1K8A R;  4JS5 A;  1K9M R;  3OYJ A;  1N9S A;  1RAH B;  2M1H A;  4FL6 A;  3CCS A;  3VUZ A;  1YIJ Q;  4LD6 A;  1RAD B;  2F2V A;  1G3W A;  2QK0 A;  1QMC A;  2Y4X A;  2R58 A;  4KRT A;  5J26 A;  5GAN h;  1AOJ A;  3BFM A;  2RNA A;  1UHC A;  4M78 D;  5J39 A;  1W2B S;  4E47 A;  4M77 F;  2GGR A;  5FRN A;  1MND A;  2A08 A;  1K9M C;  3JCM f;  4QQ6 A;  1W1F A;  1UJ0 A;  2QA4 T;  4NL3 A;  1OU9 A;  4KH1 B;  1M3A A;  4FT2 A;  3JCM c;  2D8J A;  3CXC A;  5IHK A;  3OYN A;  1I5O B;  1VQM A;  3OA6 A;  4C92 B;  1Y96 B;  1D0Y A;  1YCY A;  5CAI A;  1TXQ A;  2EKO A;  1OZ3 A;  2PVO B;  1EZZ B;  2L3R A;  3TSW A;  5FWC A;  4FT4 A;  5LJ5 f;  4M75 G;  2DMO A;  1W70 A;  1AD5 A;  3PT9 A;  2CP7 A;  3CC7 A;  2VC8 A;  4XTW A;  1VQ5 A;  3PFS A;  3EHR A;  4PJO D;  3CCE T;  3EG3 A;  3OMG A;  3A98 A;  2ABL A;  1LCK A;  3NTH A;  3CXC P;  1X43 A;  1IRE B;  3SEM A;  1S72 Q;  2DXC A;  1SPK A;  4AFU C;  2LRQ A;  4C8Q A;  3QBY A;  2DL7 A;  3RKY A;  2K7A A;  4BDZ A;  4ZTF A;  1NE8 A;  3MKD A;  5IXB A;  3GOX A;  3V7S A;  1R77 A;  3CCM Q;  2O2O A;  1QVF A;  4J9G A;  1KQ2 A;  4F04 B;  5FRO A;  2B8A A;  3NMZ C;  4AFQ C;  1MMG A;  3INZ A;  2ROL A;  2ED1 A;  2ZPB B;  4LN2 A;  2RHX A;  5GAN 5;  2J06 A;  3EFR A;  1I07 A;  4QT7 A;  3ZL7 C;  3CCS Q;  2LCS A;  5IHN A;  2NLU A;  3G4S A;  1VQ5 Q;  4ELZ C;  1OZ2 A;  1LJO A;  2L89 A;  3QSU A;  3RER A;  2LQ8 A;  4PJJ A;  4FYW B;  2V8K A;  1YJ9 T;  1N8R R;  2PUO B;  5GAO q;  3MCA B;  1K9A A;  1VQL A;  4JRK A;  4FYV B;  2JMC A;  4X9C A;  1NG2 A;  2K2V A;  5GAM g;  5GAO p;  2HQH A;  3MP6 A;  3LLR A;  5L8R E;  3M5A A;  3MEU A;  3CD6 T;  3RMQ A;  1C1A A;  1QKW A;  2ZPF B;  4MMK A;  3OBY A;  1WA7 A;  3JCM b;  4DOV A;  1IZ6 A;  2SRC A;  1YIT A;  3A8M B;  1YI2 T;  1PG5 B;  2CGH A;  4MZP A;  2X4X A;  1UHF A;  2EYZ A;  4JZ3 A;  8AT1 B;  2AKK A;  4OP0 A;  1B3Q A;  3RR6 A;  4PJL A;  2GTJ A;  2HD0 A;  3I5R A;  3CCJ T;  3JCM P;  4XTX A;  2NUP A;  1ZBJ A;  4QQG A;  1X2Q A;  2C06 A;  4WCI A;  2J6K A;  2OTL T;  2W10 A;  2COW A;  2XKO C;  4C8Q B;  1ZHI A;  3M57 A;  1KQS P;  1D3B A;  2XHC A;  2QAZ A;  1UGR B;  2RHY A;  4V2S A;  2PTK A;  2RI5 A;  5D6Y A;  2BE9 B;  2GBQ A;  3H8Z A;  4QW2 A;  2HCK A;  1KD1 R;  3E9F A;  3ULR B;  3F70 A;  2D8H A;  3HRS A;  3CCU T;  4KGX B;  4A4H A;  2OX7 A;  2CSQ A;  2FG0 A;  4AT1 B;  5A0D A;  3FC3 A;  2FL7 A;  4F7U G; 
#chains in the Genus database with same CATH homology
 5I21 A;  2XDD A;  2DAQ A;  2BUD A;  4EMK B;  2F5K A;  1K8A U;  2PQW A;  3URG A;  4JRI A;  3VYG A;  3CCU A;  4C92 F;  3QKJ A;  5A0G A;  2R57 A;  1K73 C;  4MZT A;  1VQ5 T;  4M7A A;  3OS1 A;  3L42 A;  1KC8 C;  3C94 A;  2FHD A;  2EJF A;  5HK3 A;  3A5Z B;  4C8Q D;  1G3T A;  4ZGJ B;  3FLG A;  3V8K A;  2RO0 A;  1VQ7 A;  1XQH A;  3LYI A;  4RCB A;  5LJ3 j;  2K3X A;  3QZ9 B;  3X20 B;  1I81 A;  2FB7 A;  4Y28 E;  1M5Q 1;  5CKB A;  4X34 A;  4C5I A;  3X28 B;  3CD6 A;  3FEO A;  3JCM g;  2MWO A;  5I2S A;  3QO3 A;  5HKC A;  3CME A;  3HRU A;  2XD0 A;  4RMO A;  3OYI A;  2ZZD A;  1I5L A;  1WJS A;  3M4G A;  2QQ9 A;  3OBW A;  2LT1 A;  1Q82 C;  1GXI E;  1YI2 A;  2PVG B;  3OW2 S;  4C92 G;  2LCL A;  4JUV A;  3OMC A;  3QJY A;  2O4X A;  3QHS A;  4M78 C;  2QEX T;  3OYG A;  3A8L B;  3DKM A;  2CYZ B;  4ZGE B;  4PJO A;  1U1S A;  3NTK A;  4FSX A;  3VUB A;  3JCM h;  2FYK A;  3CC7 T;  5CK9 A;  2LT4 A;  4KT0 E;  5GAN 6;  5GAM j;  1Y07 A;  3HKS A;  5FRM A;  1X01 A;  1H64 1;  2K5I A;  2LCC A;  3MHX A;  1NPP A;  2JNG A;  2HQE A;  2DZC A;  4JJN K;  5GAO r;  4RG8 A;  1Y71 A;  2ZPE B;  4M7A D;  3DB4 A;  4J7F A;  4YTL A;  3JCM X;  3M54 A;  3HRT A;  1QVG A;  3UDC A;  3QYG B;  3V8J A;  2DJZ A;  1VIF A;  5J3B A;  3CCQ T;  1VQ6 T;  4XAX B;  3DB3 A;  2EQK A;  5KE2 A;  4L5G A;  5GAO m;  3LWI A;  3CCL T;  1Q81 C;  1Q7Y U;  3UPU A;  3GIB A;  3OYA A;  2HAX A;  3FDR A;  2R5M A;  2XU8 A;  2RK1 A;  2X4Y A;  3OS5 A;  3OSS C;  2I2L A;  4DOW A;  1VQK T;  2P0K A;  3LH0 A;  1VQN T;  1RL2 A;  3G7Z A;  3E9G A;  4QQD A;  5CCA A;  3BW1 A;  3L2W A;  4M7A B;  5LJ5 j;  4M7D G;  1U8R A;  3JRZ A;  4E7K A;  4NS5 A;  2BKD N;  2LC4 A;  4EMK A;  4XU2 A;  5LJ3 h;  1WJQ A;  4RKU E;  1HK9 A;  2DKG A;  1KHI A;  3CBP A;  4M75 E;  5KCO A;  2DIG A;  5D6X A;  4DQ2 A;  5GAO n;  3C12 A;  2F5T X;  1VQP A;  3G71 T;  5CKE A;  4XK8 E;  5FU7 B;  4F7U F;  3PMI A;  3JCM d;  3WVD B;  3BY7 A;  3JB9 D;  2OAU A;  3HPW A;  5LJ3 e;  3OYL A;  1B34 B;  1ZBX A;  2Y90 A;  2RD1 A;  3FB9 A;  3ZFJ A;  3TRE A;  3QPH A;  3OB9 A;  3CBO A;  5CIU A;  4PJO B;  3JB9 H;  4N0A A;  3OYB A;  4DA4 A;  3JCM J;  2YRV A;  4X9D A;  3MEA A;  2K3Y A;  2PUK B;  3KUF A;  4PLL A;  5HY6 A;  4KUI A;  2RI3 A;  1I4K 1;  4O6J A;  4O5V A;  3ASK A;  5GMK l;  4IUV A;  2QQS A;  2EQJ A;  1K9M U;  2LX9 A;  3BDU A;  1V29 B;  4JS4 A;  5LL6 S;  4HT8 A;  4E7L A;  2E12 A;  2QQR A;  4HCZ A;  3SWN A;  5CKF A;  1VQ8 A;  4TVR A;  1VQK A;  3LX7 A;  4C5G A;  1M1K U;  2KY9 A;  3R6O A;  4MZM A;  4EDU A;  3AHU A;  2V8J A;  3FIF A;  2K5L A;  4IUU A;  4OGC A;  4ZN3 A;  5C6S A;  4BAC A;  3GP8 A;  1KD1 C;  1M90 C;  4BUG A;  4FM4 B;  4XQ3 A;  2MWP A;  4NOY A;  3SDZ A;  2YLB A;  5LJ3 g;  3M58 A;  4IUP A;  1M1K C;  4PL6 A;  4LDV A;  3RIR A;  3HFO A;  5A0L A;  3JB9 J;  4PKC C;  2E64 A;  4BB7 A;  3FRN A;  5GAN 4;  2ZCF B;  3JB9 G;  4OB1 B;  4HT9 A;  1YBY A;  2WAC A;  5FU7 C;  3CCV T;  2XIC A;  3L2R A;  3Q1J A;  2RHU A;  3SFM A;  5GMK i;  2M0O A;  2VV5 A;  4PJO F;  2L5Q A;  3CCM A;  2DD5 A;  4D6W A;  2EQU A;  2WSC E;  4M7D F;  4JLG A;  4JLI A;  4N4G A;  4BY6 B;  2XDB A;  3NTI A;  3ME9 A;  2EWN A;  1PSF A;  1VQ9 T;  4A54 A;  5GAM h;  1P92 A;  4MDX A;  2DO3 A;  1VQN A;  1KQS S;  4HCC A;  1XOV A;  3X24 B;  3M55 A;  3M9Q A;  3HP9 A;  2RH2 A;  4OF1 A;  3PIP A;  3LGL A;  2PU9 B;  2EFI A;  4Z02 A;  4PLI A;  1YIJ T;  1JRI A;  3VJP A;  4J6X A;  3G4S T;  3CC2 T;  2OTJ T;  4BE0 A;  3PMT A;  4PJO G;  1YJN T;  3VKI A;  4QVC A;  2P0P A;  3CCM T;  2QA4 A;  3QXE B;  5IAY A;  2XI9 A;  2E41 A;  1JJ2 A;  2ZPH B;  1MHN A;  1BI0 A;  2DXU A;  2VUB A;  2JZ2 A;  4C92 C;  4J83 A;  4OMF B;  5HK0 A;  4OVA A;  1YIJ A;  4M75 C;  3OYH A;  1QP3 A;  3OSV A;  1YJW T;  4FU6 A;  4LDU A;  4M77 B;  1VQ4 A;  2YHT A;  2M16 A;  4IUR A;  2CS7 A;  2QQB A;  1UGQ B;  3VU3 C;  2RB6 A;  3KBG A;  5GAN j;  1Q81 U;  1YHQ T;  2RHZ A;  2RJF A;  4J6W A;  3HFN A;  2QTX A;  1QP2 A;  3J80 E;  1M1G A;  3UWN A;  1VQL T;  1QVF S;  4M7A G;  2QEX A;  1H3Z A;  2G3R A;  4A4G A;  2BIV A;  4M78 F;  4HA8 A;  1BIB A;  2IVW A;  2JTM A;  4C5H A;  4B9W A;  4EPC A;  1KD1 U;  4M7A E;  4KUL A;  3UT1 A;  5M9O A;  2DXT A;  4XU3 A;  1QW1 A;  2JUF A;  2RM4 A;  4F7U A;  4M75 D;  4M77 G;  4J8O A;  1KQS A;  5AYF A;  3CCR A;  3M4Y A;  4M75 B;  2DXB A;  3M56 A;  3OYC A;  2ZGW A;  4CRI A;  1WGS A;  1O9S A;  2MMP A;  2JTF A;  2MAM A;  5D6W A;  5FU6 B;  5GMK e;  3OYM A;  3G71 A;  1KQ1 A;  1VQ7 T;  4LDX A;  2VGN A;  3DLL A;  4XTV A;  3PTA A;  2VYT A;  4JS5 A;  3JAM E;  2QI2 A;  4XTZ A;  3VYH B;  3OYJ A;  4M7D D;  1N9S A;  1LOJ A;  4QVD A;  5GMK j;  1R8O B;  2M1H A;  3CC2 A;  2OTJ A;  3EAE A;  4FL6 A;  3CCS A;  4M7D B;  2AHJ B;  3OW2 A;  2LQK A;  3VUZ A;  3CCR T;  1BYM A;  3N5B B;  3S6W A;  3P8B B;  3CCJ A;  4J5Y A;  4LD6 A;  4A4F A;  3RKX A;  3PIO A;  3GNG A;  1G3W A;  2WSE E;  1RI0 A;  3MP8 A;  2KSS A;  2Y4X A;  2R58 A;  2CZ6 B;  2D0Q B;  5J26 A;  4OGE A;  4ZN1 A;  5GAN h;  1Y7X A;  5GAN 3;  1U1T A;  4C0G A;  2XK0 A;  3CCS T;  2Y4Y A;  1OYX A;  2EJG A;  4Y91 A;  3GLX A;  2E10 A;  3TCJ A;  3BFM A;  3QG1 A;  4M78 G;  4M78 D;  1YHQ A;  2D6F A;  3G6E T;  3I56 A;  4N0A C;  2KQW A;  2DK3 A;  5J39 A;  1YIT T;  1JBM A;  2E65 A;  4RCC A;  4JRP A;  2K57 A;  1W2B S;  1X75 C;  2HNI A;  3EFS A;  5LJ5 d;  5FU6 C;  3JCM W;  3NFC A;  4M77 F;  4C5E A;  4E47 A;  1O75 A;  5I2M A;  5CR2 A;  4M7D E;  5FRN A;  3E1S A;  3ZBD A;  5GAN d;  1M1F A;  3P8D A;  1K9M C;  3JCM f;  3CCL A;  4QQ6 A;  2MF2 A;  3VV0 A;  3SWN C;  1W2B A;  3P8H A;  3RES A;  2RI2 A;  4BY6 C;  1Q7Y C;  5C0M A;  4BI4 A;  3G6E A;  5LJ5 e;  2L8D A;  4XTU A;  1Y96 A;  2DTO A;  4C8Q C;  1UB4 A;  2QA4 T;  3ER0 A;  3CCE A;  4NL3 A;  2WSF E;  4OB0 B;  1TH7 A;  5CVI A;  4EMG A;  5GAN e;  2OTL A;  2O4X B;  3PNW C;  1Q82 U;  3J7A F;  3E19 A;  4FT2 A;  3JCM c;  3KXT A;  1N8R U;  4M77 E;  3CXC A;  3JCM V;  4FIB A;  4MDW A;  3WXM B;  5CQY A;  3QZ5 B;  2A7Y A;  1D3B B;  2V8I A;  2X4W A;  2IG0 A;  2CKK A;  3V7C A;  4M77 C;  2VGM A;  3OS0 A;  5GAM f;  1Q86 U;  4ELY C;  1KG1 A;  1MGQ A;  3OYN A;  5CKD A;  1VQM A;  4IUT A;  3HL8 A;  3CC4 A;  1KC8 U;  5A2Q E;  4XU0 A;  3OA6 A;  1BI2 A;  1UGS B;  4C92 B;  3S3O A;  4IKF A;  3LGF A;  1Y96 B;  2RA2 A;  3BDL A;  1K73 U;  3CMA T;  1BIA A;  3QUI A;  5GAN 7;  1YCY A;  3J81 E;  2P4T A;  5CAI A;  3O8V A;  2E6N A;  5KH6 A;  1BI1 A;  3M59 A;  1YJN A;  2O01 E;  1PSE A;  2A3L A;  1OI1 A;  1OZ3 A;  1FX7 A;  1M9S A;  2EKO A;  5GMK h;  1X6O A;  2D9T A;  2PVO B;  4N4I A;  3V8L A;  2GF7 A;  2L3R A;  3ZEH A;  4HCB A;  3L2Q A;  2PVD B;  4FT4 A;  5LJ5 f;  4QVZ A;  4M75 G;  5IN1 A;  4A4E A;  4BE2 A;  1W4S A;  3PT9 A;  5CKH A;  2CZ0 B;  2RK2 A;  2VC8 A;  4NL2 A;  3CC7 A;  4C0D B;  2GCX A;  3JCM e;  1VQ4 T;  4XTW A;  1VQ5 A;  3PFS A;  5KE3 A;  3OYY A;  1WQW A;  3QJ6 A;  4PJO D;  4BDY A;  3CCE T;  1DJ7 B;  4C0Z A;  3OMG A;  1VQ8 T;  4C92 A;  4J7I A;  4C92 E;  1NPR A;  1QVP A;  2K4Y A;  4M75 A;  5GAO l;  2H3J A;  3L2Z A;  3TU4 K;  2MI6 A;  3NTH A;  1XTD A;  4ZGD B;  2RJD A;  3DLM A;  2M9U A;  2JN0 A;  5DM7 R;  4GY5 A;  1IRE B;  2LDM A;  5GMK m;  2VXF A;  4R56 A;  3CCQ A;  1VQ6 A;  1G5V A;  3QII A;  2DXC A;  2EYQ A;  3X26 B;  3A8G B;  1LNX A;  2LRQ A;  4M7A C;  3I56 T;  4C8Q A;  1UEB A;  3CEY A;  3QBY A;  3WVE B;  4C0D C;  4E7I A;  3RKY A;  4C8Q G;  2KVQ G;  4BDZ A;  1BI3 A;  3CC4 T;  1JJ2 S;  1NZ9 A;  1NE8 A;  4ZTF A;  4R55 A;  1QVG S;  3QDR B;  1M4Z A;  3GPL A;  2YLC A;  1G3S A;  1N27 A;  2EQM A;  2DEQ A;  3M53 A;  5GAN f;  4XTY A;  2DVE A;  3GOX A;  5LJ5 h;  3MP1 A;  3V7S A;  4F7U B;  3SB2 A;  1VQO A;  4EMH A;  5DLO A;  1QVF A;  3JB9 F;  2KK4 A;  4M75 F;  1KQ2 A;  3C95 A;  4F7U E;  4OB3 B;  1YJW A;  5FRO A;  2E1H A;  3V7R A;  1VUB A;  2EJ9 A;  2JVV A;  3OYE A;  4J6Y A;  2B8A A;  3MO8 A;  2DD4 A;  4M78 A;  3INZ A;  4MML A;  4VUB A;  4JRQ A;  4PJO C;  4WF2 A;  1YJ9 A;  1WPY A;  2ZPB B;  1AHJ B;  2RHX A;  5GAN 5;  3EFR A;  1WQ7 A;  1S72 T;  1K8A C;  1N6A A;  5GAN 8;  3L1A A;  2FVU A;  2NLU A;  2JOY A;  4PNO A;  3PGG A;  2EAY A;  3L2V A;  4OB2 B;  3G4S A;  3RMS A;  4ELZ C;  5EG2 A;  2E70 A;  1OZ2 A;  1HXD A;  1LJO A;  2L89 A;  3QSU A;  4ZTJ A;  1I8F A;  2XID A;  3JCM Q;  1M90 U;  3RER A;  2LQ8 A;  2ZPG B;  2DTH A;  4ATO A;  4KBM B;  3CMA A;  2R5A A;  2DIQ A;  2ZPI B;  2V8K A;  3A8O B;  2KAF A;  1YJ9 T;  2DZ9 A;  2P0Q A;  4M7D A;  3JB9 I;  1B34 A;  2PUO B;  3A8H B;  5GAO q;  2K5F A;  4JDS A;  3MCA B;  4XU1 A;  1ZQ1 A;  2QDY B;  2DPP B;  3GF5 A;  4P5N A;  5FLX E;  1VQL A;  4JRK A;  1NJI C;  3GNF B;  2XDP A;  4RG2 A;  4E7J A;  2KDS A;  5GAN 2;  3FJP A;  1UGP B;  4M77 D;  4ME7 A;  4X9C A;  5CO7 A;  1M8V A;  2K2V A;  3C4S A;  5GAM g;  5GAO p;  1JB0 E;  4IUQ A;  4C0F A;  3MP6 A;  3OY9 A;  3LLR A;  5L8R E;  3CPW S;  3M5A A;  4B9X A;  3CME T;  3MEU A;  5DY9 A;  2E5Q A;  3CD6 T;  4LDY A;  3RMQ A;  2ZPF B;  4MMK A;  3OBY A;  4L59 A;  3JCM b;  4DOV A;  1NJI U;  1IZ6 A;  5KCH A;  3L2U A;  3A8M B;  1YI2 T;  1YIT A;  3LWH A;  2X4J A;  4M7A F;  5LJ3 d;  4EMK C;  2CGH A;  4M78 B;  4A53 A;  2CZ1 B;  4MZP A;  3RKW A;  3CCV A;  4BI8 B;  1VQM T;  2HQX A;  2X4X A;  1BKB A;  2X35 A;  4OP0 A;  4LDW A;  4II1 A;  3TEE A;  1EIF A;  3MEW A;  2KMT A;  3SWN B;  4N4H A;  3OS2 A;  3CXC S;  2XG8 D;  2RHI A;  3I55 A;  3H6Z A;  1S72 A;  2EIF A;  4CI0 C;  4M77 A;  5LJ5 g;  2QQA A;  1N9R A;  1G3Y A;  2HD0 A;  4GLK A;  5LJ3 f;  3CCJ T;  4E7H A;  3JCM P;  3T9N A;  1VQ9 A;  3S3N A;  4UC4 A;  3OYD A;  3MET A;  4XTX A;  5GAM e;  4QQG A;  5CQX A;  4C8Q F;  4BE1 A;  2C06 A;  2OTL T;  3X25 B;  2GQV A;  1WJR A;  4LD9 K;  3CPW A;  3S3M A;  2XKO C;  4BI3 A;  4C8Q B;  1KHC A;  3CBM A;  1ZHI A;  3M57 A;  1VQO T;  2VXE A;  1Q86 C;  1D3B A;  2XHC A;  4C8Q E;  3I55 T;  1UGR B;  2RHY A;  4A4K A;  5GAM d;  4V2S A;  1FXX A;  2RJC A;  3OYK A;  5IT9 E;  2RI5 A;  1SSF A;  2GFA A;  3OYF A;  5D6Y A;  1N8R C;  2QXF A;  3OQ5 A;  3SD4 A;  3QYH B;  4L6V 5;  2CZ7 B;  1XNI A;  3H8Z A;  3HHT B;  1VIE A;  1WNL A;  2HBP A;  2DTI A;  4QW2 A;  4KUD K;  4M7D C;  4C92 D;  3HSB A;  3E9F A;  2LNV A;  2F69 A;  3F70 A;  2LTO A;  3HRS A;  4HKE A;  3CCU T;  2E6Z A;  3CPF A;  4A4H A;  2GFU A;  2LVM A;  3MEV A;  3LW5 E;  4Q5W A;  3RUX A;  4PJO E;  1VQP T;  4M78 E;  3JSC A;  5A0D A;  5GAN g;  4BD3 A;  2RJE A;  1FWZ A;  5DLQ E;  3FC3 A;  2FL7 A;  4F7U G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...