4N0AA

Crystal structure of lsm2-3-pat1c complex from saccharomyces cerevisiae
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lsm2 and Lsm3 bridge the interaction of the Lsm1-7 complex with Pat1 for decapping activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm3
total genus 13
structure length 80
sequence length 80
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n0aA00
5GMKe 5GAMj 2DTOA 4XTZA 4M75A 3RIRA 2I2LA 1WQWA 2RB6A 4M77B 1TH7A 3JCMV 5GANj 2EWNA 5GAOp 2DJZA 4NL3A 4PJOF 1MGQA 5GANe 4QVDA 4HT8A 1JRIA 3SWNA 4J6XA 3SB2A 4XU3A 3V7CA 5CAIA 3JCMW 4M7DF 4M75G 4PJOE 3PGGA 5LJ5d 3JCMf 1Y96B 4M75F 3JB9G 2E41A 3QHSA 1LOJA 4M77C 4XU1A 5DY9A 1I5LA 4M7DE 5GAOq 4EMKC 3HSBA 1U1SA 1D3BA 4M7AD 1N9RA 1WNLA 4M78B 4MMLA 4C8QF 1H641 3GIBA 2DZ9A 4PJOD 2EJFA 2Y90A 2YLCA 4M7DD 4M77A 4HT9A 2DTIA 3JB9F 4QVCA 3JCMQ 3V8KA 4RCBA 2DTHA 5LJ3j 3JCMX 4M77G 3BW1A 3RUXA 4C92D 5GAMd 1WPYA 3FB9A 4C8QD 1JBMA 3M4GA 5LJ3h 3EFRA 5LJ5h 1YCYA 3JCMP 5LJ3g 4JRKA 4XTWA 5GAMh 1I4K1 4M7AC 4N0AA 2E10A 3JCMd 5GAOl 3AHUA 5GAN6 4PJOA 3QSUA 4JLIA 3V8LA 2E64A 4EMGA 4MMKA 4C8QE 2EJGA 4X9CA 1WQ7A 4M75C 2YHTA 4M7DC 4M78D 4PJOB 3RKWA 1HK9A 1U1TA 4X9DA 4PJOG 5GAN4 2VXFA 4OP0A 2EJ9A 3JCMb 1X01A 2RD1A 4M78E 4M7AE 5GANh 5I21A 4C8QA 5GANd 2RA2A 1B34B 4J5YA 2K57A 3INZA 2FYKA 4PNOA 4XTVA 2ZGWA 5GMKi 5LJ3d 2RM4A 5GAN7 4C92B 1B34A 3RERA 3JCMc 4C8QB 5GAN8 3QUIA 4F7UF 4N0AC 3JB9J 3JCMh 4WF2A 4XU2A 4M75D 4C8QG 4F7UG 5GAMf 5GAOn 4M78C 4C92C 1HXDA 5GMKl 3JCMJ 4M78A 1D3BB 2YLBA 3JB9D 4V2SA 4C8QC 5GMKj 2EAYA 4XU0A 5GMKm 3FJPA 4F7UA 1M5Q1 1M8VA 4JRIA 5LJ5j 3V7SA 4A54A 4M7AF 4M77E 1Y96A 4M7AG 5GMKh 3JCMe 4M7DG 3QO3A 4C92E 3BFMA 2VXEA 4HA8A 1KQ2A 2VC8A 4XTYA 4J6WA 4RCCA 3FIFA 4M75B 3VU3C 4C92A 5GAMe 5GAN5 2DVEA 2DKGA 3BDUA 2DZCA 3L1AA 5LJ5e 1I8FA 4J6YA 3RKYA 3HFOA 4XTUA 4M77D 4EMKA 4M7DA 3L2ZA 1LJOA 4F7UE 4M7AB 4A53A 5LJ5f 2DXUA 3EFSA 4M78F 4NL2A 1N9SA 4C92G 4EMKB 1BIAA 1KQ1A 2E65A 3SWNC 4XQ3A 5GANf 5LJ3f 3RKXA 1BIBA 2HNIA 5GAN3 3JB9H 2E1HA 2JN0A 5LJ3e 4M75E 2DXTA 3JB9I 2FB7A 2DEQA 4M77F 4EMHA 3BY7A 4M78G 5LJ5g 4JUVA 5GAOr 4C92F 3RESA 2QTXA 4F7UB 5GAMg 3V8JA 4DQ2A 4Y91A 5GAN2 1LNXA 4XTXA 5GAOm 4M7DB 4NOYA 2CGHA 3JCMg 5GANg 4PJOC 3SWNB 3HFNA 3V7RA 1I81A 4M7AA
chains in the Genus database with same CATH superfamily
1WJSA 2DTOA 3EG1A 4CI0C 1KC8U 1VQ6T 2QQSA 3M5AA 5GANj 2DJZA 4PFPA 3EGDA 2QG9B 3VKIA 4OMNA 1VQ4T 2PZ1A 4ESRA 1G83A 1Q7YC 1S72T 3KXTA 2VUBA 2J6OA 2KNBB 2RQVA 4RTWA 5CKHA 2IVWA 1YN8A 7AT1B 3EGUA 1AZGB 1IGUA 1BI2A 2MYSA 2Z0WA 1C1AA 5LJ3h 1UB4A 2QGFB 1I4K1 2AIRB 2LCSA 3CMAT 3I9QA 4ZN1A 2FRWA 2RI5A 2KRMA 4NS5A 2OAWA 1YHQQ 2VYTA 2LT4A 2YRCA 3G71T 2H3EB 4C5EA 2YUNA 1VQNA 1PSFA 5HY6A 2WACA 2NLUA 5AYFA 1ZSZA 1W2BP 2RHZA 1X2KA 3M57A 1AEYA 4D8KA 4C8QG 2DXBA 3VS5A 4HVUA 1M2VA 4HCBA 4EPCA 5GMKm 2QQ9A 1WHGA 1QVFP 4P5NA 1NPRA 3OYHA 4OVAA 1AWOA 1MNEA 1OX8A 2EPDA 3OYCA 2ZPFB 1VQ5T 2DKGA 4J83A 2DRMA 3MP8A 3VRZA 3VS2A 1S72Q 3L2RA 1NJIC 4F04B 5KCHA 3VUBA 3OY9A 4RTYA 4XQ3A 1WHKA 4OMOA 1RAFB 3CCUA 4FW1A 4QQGA 3QBYA 3LH0A 4FSSA 1VQ7A 3HHTB 2MI6A 3OS1A 2QEXA 2YWWA 1D0ZA 2V8JA 5FROA 5CR2A 2HL5C 3A98A 1PKSA 3QDRB 1K0XA 1KD1C 4DOWA 4RKUE 2K9GA 1OULA 3PMTA 4ANJA 2CSIA 1AD5A 1OQKA 1D3BA 2MCNA 3F70A 1GXIE 1U8RA 2HQEA 4HVWA 3PFSA 4AFQC 3PE0A 1YJNQ 3ZL7C 5EG2A 2X4XA 1YITT 2HSPA 2M0YA 2DBMA 2NUTB 2RMOA 3CCEA 2RK2A 4HCZA 4A4KA 2DILA 2J05A 4M75C 4M78D 3QIIA 4E7HA 4X9DA 4M78E 2KYBA 4A4GA 2RA2A 2KEAA 5I2SA 3CC2Q 2PQWA 4C92B 3I56T 1UFFA 3QUIA 1VYTA 1GCPA 4K11A 1HXDA 1WGSA 4QT7A 5KYUA 2QK0A 5HKCA 1MMDA 5FW9A 5HK3A 4XU0A 4AG2C 3N5BB 1M2OA 1VQ9A 2D6FA 3CCQA 2HDAA 2VXEA 4BUGA 2FEIA 3TSWA 5FWCA 3A8HB 5A0GA 3RMSA 2ED1A 1RI9A 3OMCA 1BIBA 2CREA 3O8VA 2DXTA 4C0DB 2COWA 1VIFA 4RTTA 1B07A 2BUDA 3LW5E 3CCSA 3C4SA 4BDZA 1JJ2S 4XTXA 4DOVA 4M7DB 1Q86U 5GANg 2P0QA 2LNHB 4M7AA 2RF0A 1YP5A 1QW1A 3FJ5A 4NL3A 1R0BG 2FPEA 1ZSZB 3OYEA 3CXCA 1KQSA 1QCOA 4GY5A 1VQPQ 1M1FA 4IUPA 2OJ2A 3EFOB 2X4WA 1K8AU 1K73R 4E7ZA 2JUFA 1YJ9A 3S3NA 4AT1B 3GIBA 2GGRA 2X3WD 4ELYC 2DA9A 2K2MA 3OW2S 2GTOA 3HRSA 3JCMX 2DFUA 3CBMA 3FB9A 3MJXA 3OB9A 3RNJA 2RJFA 1K9AA 1ZLMA 1EX4A 2YHTA 2NWMA 3FLGA 4PFOA 2EBPA 1UE9A 1YBYA 3CCRT 2GTJA 4FYWB 4KBMB 3NHNA 2ZGWA 3NGPA 4Y92A 2E6NA 3EG9B 2E3HA 2PVGB 4ZNXA 3THKA 2EYQA 1IO6A 2J6KA 5GAMf 1VQLQ 3NTIA 1WI7A 2LP5A 5HCKA 3CC7A 2DMOA 3CC7Q 2YT6A 1SSFA 1VQLA 2M16A 1OX9A 1PSEA 2K5LA 2RQRA 2HBWA 1PM3A 2ABLA 4E7KA 3FIFA 5FRMA 4C92A 1WXUA 3PIOA 2QI2A 2CDTA 4KGXB 4CC2A 4M77D 1NJIU 3EFSA 2KRSA 3M4YA 5CO7A 4LUEA 2LQWA 3JB9H 4KUIA 2RI2A 4M75E 3X26B 1C0MA 3JB9I 2CP5A 4EMHA 3QYGB 2CZ7B 3RESA 4F7UB 2DX1A 2QGGA 5GAN2 1EIFA 1YJWQ 2BIVA 5GAOp 1K73C 4MDXA 4QVDA 4HT8A 2V26A 2EYYA 4M75G 3QHSA 1LOJA 4M77C 3M0RA 4KUDK 1SPKA 1KHCA 1WNLA 2GFAA 2QQBA 1PD1A 3S6WA 1VQ5A 2XICA 3VUZA 3QPHA 4RCBA 1P92A 1G3WA 1ZHIA 3E9FA 3R6NA 1N27A 4ZTFA 1SHGA 3I55T 2X35A 1ZX6A 1IGQA 1RLPC 1XNIA 2G3RA 2P4TA 1HD3A 4BACA 1UHFA 2X9HA 2JM9A 3VS1A 5A2QE 5A0DA 2OX7A 3FDRA 3JCMb 1UUEA 2FG0A 5CQYA 3CMET 5I21A 5GANd 1QP3A 2YUOA 8AT1B 2XK0A 2KXCA 4GBQA 4A4HA 5KYNA 3CCQQ 1QVGA 3MEAA 4IUTA 1D3BB 2J7IA 4N4GA 1M90R 4MZPA 4RMOA 3CD6T 2RHIA 4M7DG 3BFMA 2VC8A 1Z9ZA 2DXCA 2RI3A 3NPFA 3OYMA 4A63B 4QQDA 1X6BA 4RG2A 1ZA1B 3DB3A 5KYWA 3P8DA 2DM1A 2LQ8A 1BIAA 1D1CA 4L59A 5IXFA 3H0FA 3MKDA 5GJVB 2MWPA 3T9NA 4PKCC 2I0NA 2FRYA 1K9MU 2DEQA 5GAMg 4LDYA 2GNCA 3EH2A 5DM7R 1JU5C 1M2VB 4JS5A 5GAMj 4VUBA 2DE0X 1WJQA 3OBWA 1PKTA 1UECA 2R57A 4CRIA 4OB1B 3MO8A 3A8LB 1JRIA 1MNDA 3V7CA 5CAIA 4LDXA 2BE7D 4JJBA 2VGMA 2JOYA 1UJYA 3G71A 1NYFA 3OYNA 2FO0A 3CCQT 4RTZA 2KVQG 3GLXA 2YLCA 3PNWC 4JJDA 4M4ZA 3JRZA 4LXCA 1T0JA 1M27C 4HXJA 4C0GA 1WYXA 1VQ6A 1SF9A 1F1BB 4J7IA 4JRKA 4XTWA 3VYHB 3NTHA 3CCUQ 4M7DC 4BE1A 3BDLA 3NMZC 5CKDA 2LQKA 2K57A 1ZSZC 2M9UA 1MMNA 1TUGB 4BY6C 3JCMh 2E5KA 1D1AA 1YIJQ 2C0TA 3DKMA 1ARKA 4J7FA 1M5Q1 5KYUB 2ZPIB 2K5IA 3LYIA 3J81E 1TU0B 4OB2B 4KGZB 2FZCB 5GAN5 1UGPB 2JZ2A 2L89A 4IURA 1VQNT 1UTIA 1I8FA 2LNVA 1OEBA 2ZCFB 2RQUA 2MIOA 5LJ5f 1K9MR 2C06A 1N9SA 2X4JA 3NTKA 1KQ1A 2EGCA 2IPOB 2HKNA 5GAN3 2JN0A 1G5VA 3UT1A 3VYGA 2FB7A 2C0IA 1NEGA 3R6OA 4M77F 4JUVA 1I5OB 3OSSC 4QVZA 1QMCA 2JMCA 3MP1A 5IHIA 3HPWA 1VQKQ 4HCCA 2OI3A 2VWFA 4DA4A 1VQMQ 1IZ6A 5GANe 1O75A 2PU9B 1GFDA 4M7DF 1OU8A 1WLPB 2YRVA 1AWJA 2CSQA 3CC7T 5A0LA 2FHDA 2CS7A 1WHLA 2QASA 2EKOA 2LRQA 2E70A 3U23A 2OTLT 2XKOC 2ENMA 3JCMQ 2EGAA 3PTAA 5IT9E 3G6EA 1I07A 2LQNA 3EGXB 4C8QE 2AZVA 2XD0A 4PJOB 2HBPA 3VV0A 2JTEA 4OP0A 4A4FA 4JZ4A 1ACMB 2B86A 1OZ3A 3H8ZA 3E1SA 1DJ7B 5LJ3d 1Q95G 5GAN7 1VQ6Q 1E6GA 1UGQB 1VQ8Q 4JLGA 5GAOn 1RUWA 4PJMA 2EQJA 3JB9D 5FU7B 1KD1R 3HRTA 2ED0A 1AVZC 3OYLA 1H3HA 2QQAA 2O2OA 4X1VA 3REAB 1KQ2A 5GJWB 4J6WA 4J9EA 1PD0A 3LX7A 1VQOQ 5LJ5e 2LT1A 4DBRA 4J6YA 3I55A 4F7UE 4ME7A 3J80E 3M59A 1RI0A 1B3QA 1RACB 2YDLA 3CMAA 2HEQA 5LJ3e 1ZSGA 2COYA 1K9MC 2V1QA 3BY7A 1KG1A 2D0NA 2RQTA 4C0FA 4HVVA 2H3JA 3JCMg 2CGHA 4NOYA 1N6AA 1IXDA 3SWNB 2JMAA 3V7RA 1YJWT 2P0PA 2I2LA 1RAIB 1M90C 2O9VA 3NFCA 1IHVA 3SWNA 3MEWA 1VOMA 1Y0MA 1KFZA 2BTTA 1BBZA 4FSXA 1HSQA 3X24B 2P0KA 3UWNA 3G6EQ 4II1A 4OMLA 2CT4A 2VGNA 1PHTA 5GAOq 1FX7A 3META 1S1NA 3L2UA 3CD6A 2CP6A 1C6VX 3CCRA 4HT9A 1XJWB 5KYWB 4LD9K 2QAZA 3VS0A 2ROTA 2K7AA 4D6WA 1BI0A 4M77G 3E19A 1AZEA 8ATCB 3EFRA 2M02A 3I5SA 4PFZA 1VQLT 4HKEA 2E64A 4RTUA 1VQKA 5GAN4 2BZXA 1ZA2B 1JEGA 4FW2A 4DEYA 1YJNT 2JTMA 1E6HA 5GMKi 4RTXA 1MMGA 4N0AC 3OYDA 3OS0A 3PT9A 2YLBA 2BE9B 3M54A 4LN2A 4BB7A 1H92A 1PRLC 4F7UA 4L5GA 3OYFA 4JRIA 3V7SA 2IIMA 2RHUA 4C92E 4C0ZA 1X69A 4R56A 2L3SA 5GAMe 5CQXA 5J26A 2AK5A 1YITA 4EMKA 1VIEA 3L2ZA 1LJOA 2CUBA 3OQ5A 4YTLA 2DXUA 3CCET 1UDLA 4RTVA 2EQKA 1VQPT 1V29B 3H41A 4ELZC 4D8DA 4PJOC 3HFNA 1X2QA 2M51A 4FT4A 4FCYA 1WDXA 3MCAB 1AOJA 5KE2A 4PJOF 1G2BA 2KAFA 3I56A 4J6XA 4PJOE 4B9WA 2PTKA 4XU1A 1EFNA 4EMKC 3H6ZA 2HQXA 4MMLA 2X4YA 3MP6A 2EJFA 4M7DD 4OB0B 4MZMA 3V8KA 2F1LA 2R5AA 1AWWA 2ROLA 3BW1A 2A0FB 2L3QA 4E6RA 3A8MB 4BI3A 2XDDA 1Y7XA 4LDVA 4MMKA 2EJGA 1IRXA 4RG8A 3CCJT 2MK5A 4IIMA 1M1GA 5IHNA 4O5VA 5D6YA 2RD1A 2KT8A 3L2WA 4C8QA 1FXXA 3WVDB 3GF5A 2O4XB 3QG1A 2EKHA 3CXCS 1OU9A 4WF2A 2HAXA 1GFCA 5GMKl 1Y57A 4ZN3A 1VQ4Q 4KRTA 5GMKj 3BE3A 4ZGEB 1KJWA 1Y96A 2MMPA 3KBGA 1QLYA 3EGDB 2COZA 3CC4A 4HCKA 1RL2A 3CQTA 2RN8A 1TUCA 1QVGP 2JT4A 4X34A 2CH4W 3SWNC 1TS9A 1PG5B 2O31A 2MPXC 4FM4B 3UATA 4IUQA 3QDFA 4LNPA 4KT0E 3CXCP 4B6MA 1V1CA 3OYKA 1BK2A 1LVKA 4R0KA 5LJ5j 3H0HA 2LJ0A 2BKDN 1QCNA 1XOVA 3G1JA 1WQWA 4M77B 1ZBXA 2V8KA 2CP2A 3JCMW 2A37A 3M0TA 3SDZA 1YI2T 2LMJA 1Y96B 4M75F 2KT1A 4E7JA 4J9IA 4PJOD 1H641 1X6GA 2KE9A 4N4IA 2HZYA 2ZPGB 1RLQC 3TQ7P 5LJ3j 4IIOA 2GFUA 5GAMd 1W6XA 1WPYA 2FZKB 3S3MA 2GBQA 4LDWA 2XU8A 4LE9A 1M1KU 1XTDA 5GAOl 5GAN6 2AT1B 1V76A 4FL6A 1TUDA 1KK7A 3Q1JA 3RR6A 2F5TX 2E5QA 1BYMA 5FRNA 1D09B 4PJOG 1MMAA 2VXFA 5CKBA 3C95A 2A36A 3JAME 1YJWA 3LGLA 3P8BB 4PNOA 2EVRA 4QQ6A 3CCMA 4AG1C 2EYWA 1VQMT 1H3ZA 2FPDA 2WSEE 4F7UF 4BI4A 2CZ0B 1OPLA 1MV0B 3S3OA 5KYXA 2YUPA 2O88A 3UA7A 2K3XA 2XDPA 4A54A 2LZ6B 3OYBA 2DVJA 1FWZA 2E4HA 2O4XA 2ZZDA 4RCCA 1JO8A 3VU3C 4J9BA 2LX7A 3LH5A 1FMVA 1Z9QA 3A8OB 2RJDA 3EG2A 4NL2A 2DL3A 1XQHA 2BZ8A 2HNIA 1W2BS 1JXOA 1YI2Q 2QEXQ 1HJDA 3TVTA 5GAOr 4AFZC 4LUDA 3L2VA 1M90U 4DQ2A 3MPUB 2KBTA 3ER0A 1TH7A 2CZ6B 3H9NA 3GOXA 3X20B 5C0MA 3PGGA 5LJ5d 1OV3A 2MWOA 2GQIA 3X28B 1ZUYA 3OYIA 2D0QB 1U06A 5KE3A 3HTRA 4M7AD 1UEBA 3CCVT 2F2WA 2DTIA 5J39A 3URGA 2XIDA 1Q81U 2V8IA 5FLXE 1RABB 3KUFA 1QVFA 4WTOB 1T3SA 4C92D 1N8RU 3VS4A 3CBPA 2XMFA 3M56A 4CC7A 4LDUA 4AFSC 3TEEA 1VQPA 4FT2A 3ZFJA 4X9CA 1ABOA 3L42A 2K4YA 4XK8E 1T3LA 1UG1A 2DIGA 2OTJQ 1X01A 2QA4T 4RUGA 1YHQA 3VRYA 3PMIA 1G8XA 2A28A 5M9OA 3HL8A 5J3BA 2ECZA 2FYKA 1UGSB 1M3AA 3CCSQ 2PVOB 4C8QB 3CCJQ 3J7AF 2HSEB 3M55A 4V2SA 3FJPA 1TSFA 2L3RA 1WX6A 1N5ZA 4HA8A 2ZAEA 2YSQA 4M75B 3EAEA 3L1AA 4EIKA 4DBQA 3D7SB 2DL4A 4XTUA 3RBBB 3M0PA 5CCAA 3CCLA 5LJ3f 4QKUA 3GPLA 3CCRQ 3A8GB 1NBEB 1NJIR 3CD6Q 2VASA 5LJ5g 1BCOA 5D6XA 5GAOm 1AHJB 1YNZA 2HQHA 1KSWA 1U5SA 2PNIA 1VQOT 4M75A 2L0AA 3RIRA 2RB6A 2KQWA 3RDVA 5LL6S 3QJ6A 3SD4A 4F17A 1I5LA 3CMEQ 1QCFA 2DAQA 2MOXA 1K8AC 2QXFA 1R77A 3HP9A 4E2FB 3EGXA 1YWOA 3EG0A 1YJNA 1WZOA 2DTHA 2EFIA 2RO0A 2F5KA 2KK4A 2VV5A 3I55Q 4FYYB 4C5GA 3UDCA 4PLLA 2KRNA 5LJ3g 2XG8D 4N0AA 4EDUA 3AHUA 4JLIA 3V8LA 2KROA 3JV3A 2FL7A 1WQ7A 2RPNA 2EIFA 4GLKA 1Q86C 2LX9A 4M7AE 3MHXA 2K3BA 2SEMA 1OYXA 2R58A 3OS2A 4OMFB 3INZA 1WIEA 4J9DA 2CZ1B 3PIPA 2HL3A 2OTLQ 2K2VA 4PLIA 1CKBA 3QWYA 2BZYA 2EYXA 2GCXA 1S72A 4M7AF 2B8AA 1D0XA 5GMKh 2OTLA 5D7UA 1VQKT 1K0SA 2M0OA 1Y07A 1X75C 2DZCA 3QXEB 3RKYA 1GRIA 3A1PA 5IXBA 4Z89A 2RNAA 4EMKB 3CC2T 5ECAA 2IG0A 3G4ST 4E7LA 1RAHB 4F14A 2GF7A 1W2BA 2L8DA 2L2PA 3G6ET 1YWPA 1X27A 1ZQ1A 2DEUA 2QA4Q 4AMCA 2DO3A 4PJNA 1KD1U 1LNXA 4GLMA 3OW2A 2W10A 3LLRA 3CCMT 9ATCB 3ME9A 5EC7A 1VQMA 2EWNA 1K8AR 1K73U 1QQJA 2WSFE 1WHMA 3SB2A 3OBYA 2FVUA 1OOTA 3GP8A 1M4ZA 4C5HA 4FYVB 1A0NB 2O01E 1N9RA 2WSCE 2EQIA 2YUQA 3UF4A 4FU6A 1W4SA 1YCSB 1GBRA 2DF6A 5FU6B 2R5MA 3RUXA 4JPBW 5LJ5h 3M4GA 3JCMP 1M30A 2RHXA 4M7AC 2JS2A 4KULA 3QSUA 2JJ9A 1WXTA 3I5RA 4JS4A 1VQ8T 1MHNA 2J06A 3CCLQ 4FYXB 1QVPA 2EJ9A 3CC4T 1YIJA 1SG5A 2QEXT 2YXYA 4KGVB 1B34B 4IUVA 4Y28E 3VS3A 3TCJA 4Z88A 1UGRB 5GAN8 1Q82U 1RAAB 1ZBJA 1G3SA 3GNGA 1ZUKA 3VS7A 4M78A 3EH1A 4QW2A 4Q5WA 2KDSA 5KCOA 2QTVA 4AFUC 1UGVA 2XI9A 4E47A 3QO3A 3CCJA 5I11A 2O9SA 3REBB 4OMMA 1BB9A 2DJQA 2DL7A 4Z8AA 4JRQA 3OYGA 4C92G 2OTJA 1FYNA 4OGEA 4JDSA 1NM7A 4DEXA 3AT1B 3CPWP 4J9CA 3GBQA 1QWEA 4C92F 3G71Q 2X51A 2JW4A 4J9HA 3MEUA 1VYUA 1G3YA 1JB0E 4PK4A 4XTZA 3CEYA 3SFMA 2DBKA 4JJCA 3LWHA 2CYZB 3EG3A 3HSBA 2E6ZA 2LCLA 1Q81C 3L2QA 5KYYA 4M78B 3EHRA 2ESWA 3E2UA 1M1KC 3ASKA 4ZTJA 3JSCA 2F2XA 4BY6B 1BI3A 1LPLA 2H8HA 4BI8B 4IKFA 3QJYA 4OMPA 2JVVA 4C8QD 1VUBA 1W70A 2NUZA 3ZEHA 4E7SA 3JCMd 2QYZA 1YI2A 1NE8A 2EYZA 1U3OA 3CCVQ 2DYIA 3C94A 4OF1A 2G6FX 1M3BA 4MDWA 3RKWA 1NZ9A 1IB8A 1Q82R 2X3XD 3OSVA 1X6OA 3QYHB 2LJ3A 2NUPA 2MF2A 1K1ZA 4N4HA 1FMKA 4XU2A 2DLPA 1CKAA 4C92C 3CCUT 1IREB 2DK3A 2K79A 2DYBA 3EHQA 5IH2A 1HYOA 4C8QC 1UHCA 1CSKA 3C0CA 3JCMe 4TVRA 1R8OB 1X43A 3CCMQ 2J6FA 3LGFA 4M7DA 1RADB 2NUPB 3M0SA 1RAGB 1SEMA 2EQMA 5GANf 1VQ5Q 2A08A 1WHHA 4IUUA 1M8MA 2RH2A 5KYYB 1VA7A 4J9GA 1AT1B 4PJLA 5IAYA 1NEBA 2QTXA 2V1RA 3PVLA 4Y91A 3M53A 1T0HA 3TREA 4CC4B 1H8KA 3OYJA 1YFNA 3CPFA 2W0ZA 1BU1A 3G7ZA 3M0QA 5CIUA 1QP2A 5I22A 2KGTA 1R0CB 1JXMA 1M3CA 3EFOA 2FPFA 3A5ZB 3X25B 2F2VA 3DLLA 3QKJA 4F16A 1YHQT 1WJRA 2DZ9A 3E9GA 1NLOC 1W1FA 2Y90A 1JJ2P 4M77A 1TWBA 1WA7A 3EG9A 5KH6A 1Q7YU 2P84A 2RQWA 4DBFA 5L8RE 1KC8R 5FU7C 1JBMA 3G4SA 5GAMh 1QKXA 2JNGA 2DETA 3GNFB 2DD4A 4MZTA 5D6WA 3RMQA 1KC8C 3UA6A 2Y4YA 1HK9A 1RAEB 1U1TA 1B7TA 4CC3A 2GQVA 2PUOB 5FU6C 5I2MA 3CCVA 1OPKA 3CC4Q 3VJPA 3CCLT 2VVKA 3RERA 2E3IA 2JS0A 4UC4A 3FC3A 4F7UG 2LTOA 3JCMJ 1O9SA 3TU4K 2AKLA 1VQ4A 2ZPHB 1M8VA 2LC4A 4R55A 1MUZA 1OZ2A 5DLOA 4ORZA 2K3YA 2AKKA 2EW3A 5IHKA 4M7AB 2A7YA 4M78F 1WFWA 3OYAA 1NG2A 1AWXA 2AZSA 2PVDB 3M58A 2SRCA 2CP7A 2M1HA 2DRKA 2KSSA 2D8HA 5DLQE 1LCKA 1YJ9Q 1KQSP 1MV3A 4M78G 4JRPA 2NUTA 1TXQA 5KYXB 3HRUA 1I81A 1GCQA 1BI1A 4B9XA 2KXDA 3QWXX 4L6V5 3JCMV 1QKWA 1WXBA 3CPWA 5IN1A 1PWTA 4BE2A 3JCMf 2DD5A 1G3TA 1ABQA 4PL6A 3JB9G 2E41A 5DY9A 1IHWA 4M7DE 2CH4A 3C12A 3G4SQ 1JJ2A 3WXMB 3VS6A 4ZGDB 2FZGB 2D8JA 2CKKA 3I56Q 3JB9F 2DL5A 3PVQA 2EQUA 2LVMA 1SRLA 5L23A 2KY9A 2OTJT 1PNJA 1YCYA 2LCCA 1GL5A 2E10A 4ZGJB 1BKBA 1PRMC 1VQ9Q 2D1XA 2DNUA 3WVEB 2A3LA 1EZZB 2QQRA 3I35A 5CK9A 2HCKA 2K6DA 2RJCA 1TG0A 2RJEA 4BE0A 5GANh 2DL8A 1VQ7T 1WHJA 2F69A 1YITQ 2EGEA 3CC2A 1Q81R 3O5ZA 1B34A 1N8RC 1SSHA 3JB9J 4ATOA 1N8RR 1PCXA 2DPPB 3QZ5B 2NYSA 3CPWS 4OMQA 2RK1A 2PUKB 3IQLA 2XHCA 2RHYA 4XTYA 3CCEQ 1K76A 3BDUA 2JXBA 1I1JA 1NYGA 2QDLA 3HFOA 2DERA 4A53A 1GBQA 4Z02A 4C5IA 3OMGA 1E7OA 3OA6A 2ZPEB 2KMTA 4BD3A 3FRNA 3M9QA 5CKFA 2E1HA 3H0IA 1D1BA 1SRMA 3SHWA 3V8JA 2ZPBB 3SEMA 2QA4A 3P8HA 3OW2P 2MAMA 5GMKe 2K5FA 3M0UA 4JJNK 2VKNA 4XAXB 1M9SA 1QVFS 1MGQA 3ULRB 1TTHB 1PC0A 4XU3A 1OI1A 1GCQC 1SKUB 1VQ7Q 4PJJA 2AHJB 4J8OA 1U1SA 2KR3A 3FEOA 2L5QA 4C8QF 1VQ9T 4QVCA 2XDBA 1Q86R 3LWIA 1QWFA 2JM8A 3MEVA 4KH1B 4BDYA 5AT1B 1J3TA 2HMAA 1FMWA 4DBHA 1SHFA 4PJOA 3HKSA 4A4EA 4EMGA 5CKEA 1D0YA 3CMAQ 1NLPC 2L3PA 4C0DC 1M1KR 3CCST 2OAUA 6AT1B 3QZ9B 3KFVA 4J5YA 1Y71A 4E7IA 4XTVA 1VQOA 2LDMA 2LJ1A 2RM4A 1KQSS 3JCMc 2D9TA 4M75D 2DIQA 4LD6A 4M78C 4O6JA 1VQNQ 3CBOA 1QVGS 3DLMA 2YRDA 4FIBA 1ZUUA 1UJ0A 3OS5A 2KYMA 2CP3A 2EAYA 4J9FA 2CT3A 1K4US 2VB6A 4M77E 1YJ9T 4M7AG 1VYVA 1BCMA 1VQ8A 2C0OA 2JTFA 2QDYB 2E12A 1Q82C 5CVIA 2DVEA 1YIJT 5C6SA 4KH0B 3CMEA 2KI7A 2Y4XA 3OYYA 1JQQA 2P4RA 2E65A 3DB4A 1I0CA 3RKXA 2ATCB 2HKQB 4WCIA 1KHIA 5HK0A 1TOVA 5FWBA 1NPPA 2HD0A 2CP0A 3TSZA 1KIKA 4OGCA 3ZBDA 4JZ3A 4OB3B 3UPUA 1Q7YR 2CUDA
chains in the Genus database with same CATH topology
1WJSA 1G3YA 5GAMj 1JB0E 2DTOA 4VUBA 4XTZA 4CI0C 1KC8U 1XOVA 1WJQA 1WQWA 3OBWA 4M77B 1VQ6T 1ZBXA 3CEYA 3SFMA 2QQSA 2R57A 3M5AA 5GANj 2DJZA 4CRIA 2V8KA 4OB1B 3MO8A 3A8LB 1JRIA 3VKIA 4LDXA 3V7CA 5CAIA 3JCMW 3SDZA 3LWHA 1YI2T 1Y96B 4M75F 2VGMA 1VQ4T 4E7JA 2CYZB 2JOYA 3G71A 3HSBA 3OYNA 2E6ZA 2LCLA 1Q81C 1Q7YC 3L2QA 3CCQT 4M78B 4PJOD 1H641 3KXTA 2KVQG 3GLXA 2VUBA 1S72T 2YLCA 1M1KC 5CKHA 4N4IA 3PNWC 3ASKA 2IVWA 4ZTJA 3JSCA 4BY6B 2ZPGB 3JRZA 1BI3A 5LJ3j 1BI2A 4BI8B 4C0GA 4IKFA 2GFUA 3QJYA 5GAMd 1WPYA 2JVVA 4C8QD 1VQ6A 5LJ3h 3S3MA 4J7IA 1VUBA 1UB4A 2XU8A 4JRKA 1I4K1 4LDWA 4XTWA 3VYHB 3ZEHA 1M1KU 1XTDA 3JCMd 5GAOl 3CMAT 5GAN6 4ZN1A 1BYMA 2RI5A 4FL6A 3NTHA 1YI2A 1NE8A 3Q1JA 4NS5A 2F5TX 3C94A 2E5QA 2VYTA 2LT4A 4OF1A 4MDWA 4BE1A 3G71T 3RKWA 5FRNA 3BDLA 4M7DC 1NZ9A 4PJOG 2VXFA 4C5EA 5CKBA 3C95A 1VQNA 3JAME 5CKDA 1YJWA 3OSVA 1PSFA 1X6OA 2WACA 2NLUA 3LGLA 2LQKA 3P8BB 3QYHB 5AYFA 5HY6A 2K57A 2MF2A 4PNOA 4N4HA 2M9UA 4QQ6A 3CCMA 2RHZA 1VQMT 1H3ZA 3M57A 2WSEE 4F7UF 4BI4A 4BY6C 3JCMh 4C8QG 4XU2A 2CZ0B 2DXBA 4C92C 3CCUT 1IREB 2DK3A 3DKMA 3S3OA 4HCBA 4J7FA 4C8QC 4EPCA 5GMKm 1M5Q1 2QQ9A 2K3XA 2XDPA 2ZPIB 4A54A 2K5IA 3OYBA 1FWZA 3LYIA 3JCMe 4P5NA 1NPRA 3J81E 4OVAA 3OYHA 4OB2B 4TVRA 2O4XA 2ZZDA 4RCCA 1R8OB 3VU3C 5GAN5 1UGPB 2ZPFB 3OYCA 2DKGA 2JZ2A 2L89A 4J83A 4IURA 1VQ5T 1VQNT 1I8FA 2LNVA 3A8OB 2ZCFB 3LGFA 3MP8A 4M7DA 2RJDA 5LJ5f 3L2RA 1NJIC 4NL2A 2C06A 1N9SA 2X4JA 5KCHA 3NTKA 1KQ1A 3VUBA 3OY9A 2EQMA 4XQ3A 5GANf 1XQHA 2HNIA 5GAN3 1W2BS 4IUUA 2JN0A 1G5VA 2RH2A 3UT1A 3VYGA 2FB7A 3CCUA 3R6OA 4M77F 4JUVA 5IAYA 5GAOr 4QQGA 3QBYA 2QTXA 3OSSC 4QVZA 3L2VA 1M90U 4DQ2A 3LH0A 4Y91A 3M53A 1VQ7A 3TREA 3HHTB 2MI6A 3OS1A 3OYJA 3MP1A 2QEXA 3CPFA 2V8JA 5FROA 5CR2A 3ER0A 3HPWA 1TH7A 3QDRB 4HCCA 3G7ZA 4DA4A 5CIUA 2CZ6B 1QP2A 1IZ6A 1KD1C 5GANe 1O75A 3GOXA 4DOWA 2PU9B 4RKUE 3X20B 5C0MA 4M7DF 3PGGA 5LJ5d 2YRVA 3CC7T 2MWOA 3PMTA 5A0LA 2FHDA 3X28B 2CS7A 3OYIA 2D0QB 5KE3A 3A5ZB 3X25B 3DLLA 1D3BA 2EKOA 2LRQA 3QKJA 3F70A 1YHQT 2E70A 4M7AD 1UEBA 1WJRA 2DZ9A 1U8RA 2HQEA 3CCVT 3E9GA 2XKOC 3PFSA 2Y90A 2OTLT 4M77A 2DTIA 5J39A 3JCMQ 3URGA 2XIDA 5KH6A 3PTAA 1Q81U 5EG2A 2X4XA 1YITT 1Q7YU 2V8IA 5IT9E 5FLXE 3KUFA 1QVFA 5L8RE 4C92D 1N8RU 5FU7C 1JBMA 3G4SA 3CBPA 3CCEA 3M56A 2JNGA 5GAMh 3G6EA 2RK2A 3GNFB 2DD4A 4HCZA 4MZTA 4LDUA 3TEEA 5D6WA 3RMQA 1VQPA 4A4KA 4FT2A 3ZFJA 4C8QE 1KC8C 4X9CA 4M75C 2XD0A 3L42A 4M78D 4PJOB 2HBPA 2K4YA 1HK9A 1U1TA 2Y4YA 3QIIA 4X9DA 4XK8E 4OP0A 2DIGA 3VV0A 4A4FA 1X01A 2GQVA 4M78E 2QA4T 1GXIE 2PUOB 1YHQA 3PMIA 5FU6C 4A4GA 5I2MA 5M9OA 1OZ3A 3CCVA 2RA2A 3H8ZA 3HL8A 5J3BA 2FYKA 1UGSB 5I2SA 3E1SA 1DJ7B 5LJ3d 3VJPA 3CCLT 2PVOB 5GAN7 2PQWA 4C92B 3I56T 3RERA 4C8QB 3QUIA 4UC4A 1UGQB 3FC3A 3J7AF 4JLGA 5GAOn 4F7UG 2LTOA 1HXDA 3JCMJ 1WGSA 3M55A 2EQJA 3JB9D 1O9SA 3TU4K 5FU7B 1VQ4A 4V2SA 5HKCA 3HRTA 5HK3A 4XU0A 2ZPHB 3FJPA 1M8VA 3OYLA 2LC4A 5LJ5j 4R55A 2L3RA 3N5BB 1VQ9A 2D6FA 1OZ2A 5DLOA 2QQAA 3CCQA 1KQ2A 2VXEA 4HA8A 4E7HA 4J6WA 3LX7A 4M75B 4BUGA 3EAEA 3L1AA 2K3YA 5LJ5e 2LT1A 4J6YA 3I55A 4XTUA 4F7UE 4ME7A 4M7AB 3J80E 3M59A 2A7YA 4M78F 3A8HB 3OYAA 5A0GA 1RI0A 5CCAA 3CCLA 3RMSA 5LJ3f 2PVDB 3OMCA 3GPLA 3CMAA 3M58A 1BIBA 3A8GB 5LJ3e 2M1HA 3O8VA 2DXTA 2KSSA 4C0DB 1K9MC 5DLQE 3BY7A 1VIFA 4M78G 5LJ5g 2BUDA 3LW5E 3CCSA 4JRPA 1KG1A 3C4SA 4BDZA 5D6XA 4C0FA 1JJ2S 4XTXA 4DOVA 5GAOm 4M7DB 1AHJB 2H3JA 2CGHA 4NOYA 1N6AA 3JCMg 3SWNB 5GANg 1Q86U 3HRUA 1I81A 3V7RA 2P0QA 4M7AA 1YJWT 1BI1A 2P0PA 1VQOT 4M75A 4B9XA 3RIRA 2I2LA 1QW1A 2RB6A 4L6V5 1M90C 3JCMV 4NL3A 3OYEA 3CXCA 3NFCA 1KQSA 4GY5A 2KQWA 3MEWA 3SWNA 5LL6S 3QJ6A 4FSXA 3CPWA 5IN1A 3SD4A 3JCMf 4BE2A 2DD5A 1G3TA 4PL6A 3X24B 2P0KA 1M1FA 2E41A 4IUPA 5DY9A 4II1A 3UWNA 3JB9G 1I5LA 2DAQA 3C12A 4M7DE 2VGNA 5GAOq 2X4WA 1FX7A 1K8AU 1K8AC 2QXFA 3META 1JJ2A 3L2UA 2JUFA 1YJ9A 3CD6A 3HP9A 3WXMB 4ZGDB 3S3NA 3GIBA 2CKKA 3CCRA 4ELYC 4HT9A 3JB9F 1YJNA 2EQUA 2LVMA 4LD9K 3OW2S 3HRSA 2DTHA 2EFIA 4D6WA 2KY9A 2F5KA 2RO0A 3JCMX 1BI0A 2KK4A 2VV5A 3E19A 4M77G 2OTJT 3CBMA 3FB9A 4C5GA 3UDCA 3EFRA 4PLLA 1YCYA 2LCCA 5LJ3g 2XG8D 3OB9A 4N0AA 2E10A 4EDUA 4ZGJB 3AHUA 2RJFA 1BKBA 1VQLT 4JLIA 4HKEA 3V8LA 2E64A 2FL7A 1WQ7A 3WVEB 2A3LA 2YHTA 1VQKA 2QQRA 3FLGA 5GAN4 2EIFA 4GLKA 5CK9A 1Q86C 4BE0A 2RJCA 2LX9A 4M7AE 2RJEA 3MHXA 5GANh 1OYXA 1VQ7T 1YBYA 2F69A 2R58A 3CCRT 3OS2A 4OMFB 3INZA 4KBMB 1YJNT 2ZGWA 2JTMA 3CC2A 2CZ1B 5GMKi 3PIPA 2E6NA 1B34A 1N8RC 2K2VA 3JB9J 4N0AC 2PVGB 4PLIA 3OYDA 2EYQA 5GAMf 4ATOA 3OS0A 2DPPB 3PT9A 3QZ5B 3NTIA 2YLBA 3CPWS 3CC7A 3M54A 4BB7A 2RK1A 1SSFA 4F7UA 2GCXA 4L5GA 3OYFA 4JRIA 2M16A 3V7SA 1S72A 1VQLA 2PUKB 2B8AA 1PSEA 2K5LA 4M7AF 2RHUA 5GMKh 2XHCA 2RHYA 4C92E 4C0ZA 4E7KA 2OTLA 4XTYA 1VQKT 3FIFA 4R56A 2M0OA 5FRMA 4C92A 1Y07A 5GAMe 1X75C 3BDUA 2DZCA 2QI2A 3PIOA 5CQXA 5J26A 3QXEB 1YITA 3RKYA 3HFOA 4EMKA 1VIEA 4M77D 3L2ZA 1LJOA 4A53A 3OQ5A 4YTLA 2DXUA 3EFSA 4Z02A 4C5IA 1NJIU 3OMGA 3CC2T 4EMKB 2IG0A 3OA6A 3G4ST 4E7LA 3M4YA 2ZPEB 2KMTA 5CO7A 4BD3A 2GF7A 3FRNA 2L8DA 3M9QA 5CKFA 3G6ET 1W2BA 4KUIA 2RI2A 3CCET 3JB9H 2E1HA 4M75E 3X26B 2EQKA 3JB9I 1ZQ1A 1VQPT 4EMHA 1V29B 3QYGB 2CZ7B 2DO3A 1KD1U 3RESA 4F7UB 3V8JA 4ELZC 5GAN2 1LNXA 2ZPBB 4PJOC 1EIFA 2QA4A 3P8HA 3HFNA 2MAMA 3OW2A 5GMKe 3LLRA 4FT4A 3CCMT 2K5FA 3ME9A 3MCAB 4JJNK 1VQMA 4XAXB 2BIVA 2EWNA 5KE2A 5GAOp 1M9SA 4PJOF 1K73C 1K73U 1QVFS 1MGQA 4MDXA 4QVDA 2WSFE 4HT8A 2KAFA 3I56A 4J6XA 3SB2A 4XU3A 4PJOE 4B9WA 1OI1A 3OBYA 4M75G 2FVUA 3QHSA 1LOJA 4M77C 4XU1A 3GP8A 4KUDK 4EMKC 1M4ZA 2AHJB 3H6ZA 4J8OA 1U1SA 4C5HA 3FEOA 1KHCA 2O01E 1N9RA 1WNLA 2HQXA 2L5QA 4MMLA 4C8QF 2X4YA 2WSCE 2GFAA 3MP6A 2EJFA 1VQ9T 4M7DD 4OB0B 2QQBA 3S6WA 1VQ5A 4QVCA 4MZMA 3V8KA 2XICA 2R5AA 4FU6A 1W4SA 3QPHA 4RCBA 3VUZA 2XDBA 3LWIA 3MEVA 1P92A 4BDYA 1G3WA 1ZHIA 3E9FA 1N27A 4ZTFA 3I55T 5FU6B 2R5MA 3BW1A 3RUXA 2X35A 5LJ5h 3M4GA 3JCMP 2RHXA 3A8MB 4BI3A 1XNIA 2G3RA 4M7AC 4KULA 2XDDA 1Y7XA 2P4TA 3QSUA 4PJOA 3HKSA 4A4EA 4EMGA 4LDVA 4MMKA 4JS4A 5CKEA 4BACA 2EJGA 1VQ8T 1MHNA 4RG8A 5A2QE 5A0DA 3CCJT 1M1GA 4O5VA 3FDRA 5D6YA 4C0DC 3CCST 1QVPA 2EJ9A 2OAUA 2RD1A 3JCMb 5CQYA 3CC4T 1YIJA 3QZ9B 3CMET 2QEXT 3L2WA 5I21A 4C8QA 1FXXA 5GANd 1B34B 4IUVA 3GF5A 4J5YA 1Y71A 3WVDB 4E7IA 1QP3A 4XTVA 1VQOA 2O4XB 3QG1A 4Y28E 2XK0A 2LDMA 2RM4A 3TCJA 4A4HA 1KQSS 3JCMc 1UGRB 5GAN8 3CXCS 1Q82U 4WF2A 2D9TA 4M75D 1QVGA 2HAXA 2DIQA 3MEAA 1G3SA 4LD6A 3GNGA 4M78C 5GMKl 4O6JA 4M78A 4IUTA 1D3BB 3CBOA 4ZN3A 1QVGS 3DLMA 4FIBA 4QW2A 4Q5WA 3OS5A 4N4GA 2KDSA 5KCOA 5GMKj 2EAYA 4ZGEB 4MZPA 4RMOA 4M77E 1YJ9T 1Y96A 4M7AG 3CD6T 2RHIA 2XI9A 4E47A 3QO3A 1VQ8A 4M7DG 3BFMA 3CCJA 2MMPA 3KBGA 2JTFA 2QDYB 2VC8A 2E12A 1Q82C 2DXCA 5CVIA 2RI3A 2DVEA 3CC4A 3OYMA 1YIJT 5C6SA 1RL2A 4QQDA 3CMEA 2Y4XA 3OYYA 4RG2A 3DB3A 4JRQA 3P8DA 3OYGA 4C92G 2OTJA 2LQ8A 1BIAA 2E65A 3DB4A 4X34A 4L59A 3SWNC 4OGEA 4JDSA 3RKXA 2MWPA 3T9NA 4PKCC 1KHIA 4FM4B 1K9MU 5HK0A 2DEQA 4IUQA 1NPPA 2HD0A 4KT0E 4C92F 5GAMg 3OYKA 4LDYA 4OGCA 3ZBDA 5DM7R 4OB3B 4JS5A 3UPUA 3MEUA 2BKDN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK e;  5GAM j;  2DTO A;  4XTZ A;  4M75 A;  3RIR A;  2I2L A;  1WQW A;  2RB6 A;  4M77 B;  1TH7 A;  3JCM V;  5GAN j;  2EWN A;  5GAO p;  2DJZ A;  4NL3 A;  4PJO F;  1MGQ A;  5GAN e;  4QVD A;  4HT8 A;  1JRI A;  3SWN A;  4J6X A;  3SB2 A;  4XU3 A;  3V7C A;  5CAI A;  3JCM W;  4M7D F;  4M75 G;  4PJO E;  3PGG A;  5LJ5 d;  3JCM f;  1Y96 B;  4M75 F;  3JB9 G;  2E41 A;  3QHS A;  1LOJ A;  4M77 C;  4XU1 A;  5DY9 A;  1I5L A;  4M7D E;  5GAO q;  4EMK C;  3HSB A;  1U1S A;  1D3B A;  4M7A D;  1N9R A;  1WNL A;  4M78 B;  4MML A;  4C8Q F;  1H64 1;  3GIB A;  2DZ9 A;  4PJO D;  2EJF A;  2Y90 A;  2YLC A;  4M7D D;  4M77 A;  4HT9 A;  2DTI A;  3JB9 F;  4QVC A;  3JCM Q;  3V8K A;  4RCB A;  2DTH A;  5LJ3 j;  3JCM X;  4M77 G;  3BW1 A;  3RUX A;  4C92 D;  5GAM d;  1WPY A;  3FB9 A;  4C8Q D;  1JBM A;  3M4G A;  5LJ3 h;  3EFR A;  5LJ5 h;  1YCY A;  3JCM P;  5LJ3 g;  4JRK A;  4XTW A;  5GAM h;  1I4K 1;  4M7A C;  4N0A A;  2E10 A;  3JCM d;  5GAO l;  3AHU A;  5GAN 6;  4PJO A;  3QSU A;  4JLI A;  3V8L A;  2E64 A;  4EMG A;  4MMK A;  4C8Q E;  2EJG A;  4X9C A;  1WQ7 A;  4M75 C;  2YHT A;  4M7D C;  4M78 D;  4PJO B;  3RKW A;  1HK9 A;  1U1T A;  4X9D A;  4PJO G;  5GAN 4;  2VXF A;  4OP0 A;  2EJ9 A;  3JCM b;  1X01 A;  2RD1 A;  4M78 E;  4M7A E;  5GAN h;  5I21 A;  4C8Q A;  5GAN d;  2RA2 A;  1B34 B;  4J5Y A;  2K57 A;  3INZ A;  2FYK A;  4PNO A;  4XTV A;  2ZGW A;  5GMK i;  5LJ3 d;  2RM4 A;  5GAN 7;  4C92 B;  1B34 A;  3RER A;  3JCM c;  4C8Q B;  5GAN 8;  3QUI A;  4F7U F;  4N0A C;  3JB9 J;  3JCM h;  4WF2 A;  4XU2 A;  4M75 D;  4C8Q G;  4F7U G;  5GAM f;  5GAO n;  4M78 C;  4C92 C;  1HXD A;  5GMK l;  3JCM J;  4M78 A;  1D3B B;  2YLB A;  3JB9 D;  4V2S A;  4C8Q C;  5GMK j;  2EAY A;  4XU0 A;  5GMK m;  3FJP A;  4F7U A;  1M5Q 1;  1M8V A;  4JRI A;  5LJ5 j;  3V7S A;  4A54 A;  4M7A F;  4M77 E;  1Y96 A;  4M7A G;  5GMK h;  3JCM e;  4M7D G;  3QO3 A;  4C92 E;  3BFM A;  2VXE A;  4HA8 A;  1KQ2 A;  2VC8 A;  4XTY A;  4J6W A;  4RCC A;  3FIF A;  4M75 B;  3VU3 C;  4C92 A;  5GAM e;  5GAN 5;  2DVE A;  2DKG A;  3BDU A;  2DZC A;  3L1A A;  5LJ5 e;  1I8F A;  4J6Y A;  3RKY A;  3HFO A;  4XTU A;  4M77 D;  4EMK A;  4M7D A;  3L2Z A;  1LJO A;  4F7U E;  4M7A B;  4A53 A;  5LJ5 f;  2DXU A;  3EFS A;  4M78 F;  4NL2 A;  1N9S A;  4C92 G;  4EMK B;  1BIA A;  1KQ1 A;  2E65 A;  3SWN C;  4XQ3 A;  5GAN f;  5LJ3 f;  3RKX A;  1BIB A;  2HNI A;  5GAN 3;  3JB9 H;  2E1H A;  2JN0 A;  5LJ3 e;  4M75 E;  2DXT A;  3JB9 I;  2FB7 A;  2DEQ A;  4M77 F;  4EMH A;  3BY7 A;  4M78 G;  5LJ5 g;  4JUV A;  5GAO r;  4C92 F;  3RES A;  2QTX A;  4F7U B;  5GAM g;  3V8J A;  4DQ2 A;  4Y91 A;  5GAN 2;  1LNX A;  4XTX A;  5GAO m;  4M7D B;  4NOY A;  2CGH A;  3JCM g;  5GAN g;  4PJO C;  3SWN B;  3HFN A;  3V7R A;  1I81 A;  4M7A A; 
#chains in the Genus database with same CATH topology
 1WJS A;  2DTO A;  3EG1 A;  4CI0 C;  1KC8 U;  1VQ6 T;  2QQS A;  3M5A A;  5GAN j;  2DJZ A;  4PFP A;  3EGD A;  2QG9 B;  3VKI A;  4OMN A;  1VQ4 T;  2PZ1 A;  4ESR A;  1G83 A;  1Q7Y C;  1S72 T;  3KXT A;  2VUB A;  2J6O A;  2KNB B;  2RQV A;  4RTW A;  5CKH A;  2IVW A;  1YN8 A;  7AT1 B;  3EGU A;  1AZG B;  1IGU A;  1BI2 A;  2MYS A;  2Z0W A;  1C1A A;  5LJ3 h;  1UB4 A;  2QGF B;  1I4K 1;  2AIR B;  2LCS A;  3CMA T;  3I9Q A;  4ZN1 A;  2FRW A;  2RI5 A;  2KRM A;  4NS5 A;  2OAW A;  1YHQ Q;  2VYT A;  2LT4 A;  2YRC A;  3G71 T;  2H3E B;  4C5E A;  2YUN A;  1VQN A;  1PSF A;  5HY6 A;  2WAC A;  2NLU A;  5AYF A;  1ZSZ A;  1W2B P;  2RHZ A;  1X2K A;  3M57 A;  1AEY A;  4D8K A;  4C8Q G;  2DXB A;  3VS5 A;  4HVU A;  1M2V A;  4HCB A;  4EPC A;  5GMK m;  2QQ9 A;  1WHG A;  1QVF P;  4P5N A;  1NPR A;  3OYH A;  4OVA A;  1AWO A;  1MNE A;  1OX8 A;  2EPD A;  3OYC A;  2ZPF B;  1VQ5 T;  2DKG A;  4J83 A;  2DRM A;  3MP8 A;  3VRZ A;  3VS2 A;  1S72 Q;  3L2R A;  1NJI C;  4F04 B;  5KCH A;  3VUB A;  3OY9 A;  4RTY A;  4XQ3 A;  1WHK A;  4OMO A;  1RAF B;  3CCU A;  4FW1 A;  4QQG A;  3QBY A;  3LH0 A;  4FSS A;  1VQ7 A;  3HHT B;  2MI6 A;  3OS1 A;  2QEX A;  2YWW A;  1D0Z A;  2V8J A;  5FRO A;  5CR2 A;  2HL5 C;  3A98 A;  1PKS A;  3QDR B;  1K0X A;  1KD1 C;  4DOW A;  4RKU E;  2K9G A;  1OUL A;  3PMT A;  4ANJ A;  2CSI A;  1AD5 A;  1OQK A;  1D3B A;  2MCN A;  3F70 A;  1GXI E;  1U8R A;  2HQE A;  4HVW A;  3PFS A;  4AFQ C;  3PE0 A;  1YJN Q;  3ZL7 C;  5EG2 A;  2X4X A;  1YIT T;  2HSP A;  2M0Y A;  2DBM A;  2NUT B;  2RMO A;  3CCE A;  2RK2 A;  4HCZ A;  4A4K A;  2DIL A;  2J05 A;  4M75 C;  4M78 D;  3QII A;  4E7H A;  4X9D A;  4M78 E;  2KYB A;  4A4G A;  2RA2 A;  2KEA A;  5I2S A;  3CC2 Q;  2PQW A;  4C92 B;  3I56 T;  1UFF A;  3QUI A;  1VYT A;  1GCP A;  4K11 A;  1HXD A;  1WGS A;  4QT7 A;  5KYU A;  2QK0 A;  5HKC A;  1MMD A;  5FW9 A;  5HK3 A;  4XU0 A;  4AG2 C;  3N5B B;  1M2O A;  1VQ9 A;  2D6F A;  3CCQ A;  2HDA A;  2VXE A;  4BUG A;  2FEI A;  3TSW A;  5FWC A;  3A8H B;  5A0G A;  3RMS A;  2ED1 A;  1RI9 A;  3OMC A;  1BIB A;  2CRE A;  3O8V A;  2DXT A;  4C0D B;  2COW A;  1VIF A;  4RTT A;  1B07 A;  2BUD A;  3LW5 E;  3CCS A;  3C4S A;  4BDZ A;  1JJ2 S;  4XTX A;  4DOV A;  4M7D B;  1Q86 U;  5GAN g;  2P0Q A;  2LNH B;  4M7A A;  2RF0 A;  1YP5 A;  1QW1 A;  3FJ5 A;  4NL3 A;  1R0B G;  2FPE A;  1ZSZ B;  3OYE A;  3CXC A;  1KQS A;  1QCO A;  4GY5 A;  1VQP Q;  1M1F A;  4IUP A;  2OJ2 A;  3EFO B;  2X4W A;  1K8A U;  1K73 R;  4E7Z A;  2JUF A;  1YJ9 A;  3S3N A;  4AT1 B;  3GIB A;  2GGR A;  2X3W D;  4ELY C;  2DA9 A;  2K2M A;  3OW2 S;  2GTO A;  3HRS A;  3JCM X;  2DFU A;  3CBM A;  3FB9 A;  3MJX A;  3OB9 A;  3RNJ A;  2RJF A;  1K9A A;  1ZLM A;  1EX4 A;  2YHT A;  2NWM A;  3FLG A;  4PFO A;  2EBP A;  1UE9 A;  1YBY A;  3CCR T;  2GTJ A;  4FYW B;  4KBM B;  3NHN A;  2ZGW A;  3NGP A;  4Y92 A;  2E6N A;  3EG9 B;  2E3H A;  2PVG B;  4ZNX A;  3THK A;  2EYQ A;  1IO6 A;  2J6K A;  5GAM f;  1VQL Q;  3NTI A;  1WI7 A;  2LP5 A;  5HCK A;  3CC7 A;  2DMO A;  3CC7 Q;  2YT6 A;  1SSF A;  1VQL A;  2M16 A;  1OX9 A;  1PSE A;  2K5L A;  2RQR A;  2HBW A;  1PM3 A;  2ABL A;  4E7K A;  3FIF A;  5FRM A;  4C92 A;  1WXU A;  3PIO A;  2QI2 A;  2CDT A;  4KGX B;  4CC2 A;  4M77 D;  1NJI U;  3EFS A;  2KRS A;  3M4Y A;  5CO7 A;  4LUE A;  2LQW A;  3JB9 H;  4KUI A;  2RI2 A;  4M75 E;  3X26 B;  1C0M A;  3JB9 I;  2CP5 A;  4EMH A;  3QYG B;  2CZ7 B;  3RES A;  4F7U B;  2DX1 A;  2QGG A;  5GAN 2;  1EIF A;  1YJW Q;  2BIV A;  5GAO p;  1K73 C;  4MDX A;  4QVD A;  4HT8 A;  2V26 A;  2EYY A;  4M75 G;  3QHS A;  1LOJ A;  4M77 C;  3M0R A;  4KUD K;  1SPK A;  1KHC A;  1WNL A;  2GFA A;  2QQB A;  1PD1 A;  3S6W A;  1VQ5 A;  2XIC A;  3VUZ A;  3QPH A;  4RCB A;  1P92 A;  1G3W A;  1ZHI A;  3E9F A;  3R6N A;  1N27 A;  4ZTF A;  1SHG A;  3I55 T;  2X35 A;  1ZX6 A;  1IGQ A;  1RLP C;  1XNI A;  2G3R A;  2P4T A;  1HD3 A;  4BAC A;  1UHF A;  2X9H A;  2JM9 A;  3VS1 A;  5A2Q E;  5A0D A;  2OX7 A;  3FDR A;  3JCM b;  1UUE A;  2FG0 A;  5CQY A;  3CME T;  5I21 A;  5GAN d;  1QP3 A;  2YUO A;  8AT1 B;  2XK0 A;  2KXC A;  4GBQ A;  4A4H A;  5KYN A;  3CCQ Q;  1QVG A;  3MEA A;  4IUT A;  1D3B B;  2J7I A;  4N4G A;  1M90 R;  4MZP A;  4RMO A;  3CD6 T;  2RHI A;  4M7D G;  3BFM A;  2VC8 A;  1Z9Z A;  2DXC A;  2RI3 A;  3NPF A;  3OYM A;  4A63 B;  4QQD A;  1X6B A;  4RG2 A;  1ZA1 B;  3DB3 A;  5KYW A;  3P8D A;  2DM1 A;  2LQ8 A;  1BIA A;  1D1C A;  4L59 A;  5IXF A;  3H0F A;  3MKD A;  5GJV B;  2MWP A;  3T9N A;  4PKC C;  2I0N A;  2FRY A;  1K9M U;  2DEQ A;  5GAM g;  4LDY A;  2GNC A;  3EH2 A;  5DM7 R;  1JU5 C;  1M2V B;  4JS5 A;  5GAM j;  4VUB A;  2DE0 X;  1WJQ A;  3OBW A;  1PKT A;  1UEC A;  2R57 A;  4CRI A;  4OB1 B;  3MO8 A;  3A8L B;  1JRI A;  1MND A;  3V7C A;  5CAI A;  4LDX A;  2BE7 D;  4JJB A;  2VGM A;  2JOY A;  1UJY A;  3G71 A;  1NYF A;  3OYN A;  2FO0 A;  3CCQ T;  4RTZ A;  2KVQ G;  3GLX A;  2YLC A;  3PNW C;  4JJD A;  4M4Z A;  3JRZ A;  4LXC A;  1T0J A;  1M27 C;  4HXJ A;  4C0G A;  1WYX A;  1VQ6 A;  1SF9 A;  1F1B B;  4J7I A;  4JRK A;  4XTW A;  3VYH B;  3NTH A;  3CCU Q;  4M7D C;  4BE1 A;  3BDL A;  3NMZ C;  5CKD A;  2LQK A;  2K57 A;  1ZSZ C;  2M9U A;  1MMN A;  1TUG B;  4BY6 C;  3JCM h;  2E5K A;  1D1A A;  1YIJ Q;  2C0T A;  3DKM A;  1ARK A;  4J7F A;  1M5Q 1;  5KYU B;  2ZPI B;  2K5I A;  3LYI A;  3J81 E;  1TU0 B;  4OB2 B;  4KGZ B;  2FZC B;  5GAN 5;  1UGP B;  2JZ2 A;  2L89 A;  4IUR A;  1VQN T;  1UTI A;  1I8F A;  2LNV A;  1OEB A;  2ZCF B;  2RQU A;  2MIO A;  5LJ5 f;  1K9M R;  2C06 A;  1N9S A;  2X4J A;  3NTK A;  1KQ1 A;  2EGC A;  2IPO B;  2HKN A;  5GAN 3;  2JN0 A;  1G5V A;  3UT1 A;  3VYG A;  2FB7 A;  2C0I A;  1NEG A;  3R6O A;  4M77 F;  4JUV A;  1I5O B;  3OSS C;  4QVZ A;  1QMC A;  2JMC A;  3MP1 A;  5IHI A;  3HPW A;  1VQK Q;  4HCC A;  2OI3 A;  2VWF A;  4DA4 A;  1VQM Q;  1IZ6 A;  5GAN e;  1O75 A;  2PU9 B;  1GFD A;  4M7D F;  1OU8 A;  1WLP B;  2YRV A;  1AWJ A;  2CSQ A;  3CC7 T;  5A0L A;  2FHD A;  2CS7 A;  1WHL A;  2QAS A;  2EKO A;  2LRQ A;  2E70 A;  3U23 A;  2OTL T;  2XKO C;  2ENM A;  3JCM Q;  2EGA A;  3PTA A;  5IT9 E;  3G6E A;  1I07 A;  2LQN A;  3EGX B;  4C8Q E;  2AZV A;  2XD0 A;  4PJO B;  2HBP A;  3VV0 A;  2JTE A;  4OP0 A;  4A4F A;  4JZ4 A;  1ACM B;  2B86 A;  1OZ3 A;  3H8Z A;  3E1S A;  1DJ7 B;  5LJ3 d;  1Q95 G;  5GAN 7;  1VQ6 Q;  1E6G A;  1UGQ B;  1VQ8 Q;  4JLG A;  5GAO n;  1RUW A;  4PJM A;  2EQJ A;  3JB9 D;  5FU7 B;  1KD1 R;  3HRT A;  2ED0 A;  1AVZ C;  3OYL A;  1H3H A;  2QQA A;  2O2O A;  4X1V A;  3REA B;  1KQ2 A;  5GJW B;  4J6W A;  4J9E A;  1PD0 A;  3LX7 A;  1VQO Q;  5LJ5 e;  2LT1 A;  4DBR A;  4J6Y A;  3I55 A;  4F7U E;  4ME7 A;  3J80 E;  3M59 A;  1RI0 A;  1B3Q A;  1RAC B;  2YDL A;  3CMA A;  2HEQ A;  5LJ3 e;  1ZSG A;  2COY A;  1K9M C;  2V1Q A;  3BY7 A;  1KG1 A;  2D0N A;  2RQT A;  4C0F A;  4HVV A;  2H3J A;  3JCM g;  2CGH A;  4NOY A;  1N6A A;  1IXD A;  3SWN B;  2JMA A;  3V7R A;  1YJW T;  2P0P A;  2I2L A;  1RAI B;  1M90 C;  2O9V A;  3NFC A;  1IHV A;  3SWN A;  3MEW A;  1VOM A;  1Y0M A;  1KFZ A;  2BTT A;  1BBZ A;  4FSX A;  1HSQ A;  3X24 B;  2P0K A;  3UWN A;  3G6E Q;  4II1 A;  4OML A;  2CT4 A;  2VGN A;  1PHT A;  5GAO q;  1FX7 A;  3MET A;  1S1N A;  3L2U A;  3CD6 A;  2CP6 A;  1C6V X;  3CCR A;  4HT9 A;  1XJW B;  5KYW B;  4LD9 K;  2QAZ A;  3VS0 A;  2ROT A;  2K7A A;  4D6W A;  1BI0 A;  4M77 G;  3E19 A;  1AZE A;  8ATC B;  3EFR A;  2M02 A;  3I5S A;  4PFZ A;  1VQL T;  4HKE A;  2E64 A;  4RTU A;  1VQK A;  5GAN 4;  2BZX A;  1ZA2 B;  1JEG A;  4FW2 A;  4DEY A;  1YJN T;  2JTM A;  1E6H A;  5GMK i;  4RTX A;  1MMG A;  4N0A C;  3OYD A;  3OS0 A;  3PT9 A;  2YLB A;  2BE9 B;  3M54 A;  4LN2 A;  4BB7 A;  1H92 A;  1PRL C;  4F7U A;  4L5G A;  3OYF A;  4JRI A;  3V7S A;  2IIM A;  2RHU A;  4C92 E;  4C0Z A;  1X69 A;  4R56 A;  2L3S A;  5GAM e;  5CQX A;  5J26 A;  2AK5 A;  1YIT A;  4EMK A;  1VIE A;  3L2Z A;  1LJO A;  2CUB A;  3OQ5 A;  4YTL A;  2DXU A;  3CCE T;  1UDL A;  4RTV A;  2EQK A;  1VQP T;  1V29 B;  3H41 A;  4ELZ C;  4D8D A;  4PJO C;  3HFN A;  1X2Q A;  2M51 A;  4FT4 A;  4FCY A;  1WDX A;  3MCA B;  1AOJ A;  5KE2 A;  4PJO F;  1G2B A;  2KAF A;  3I56 A;  4J6X A;  4PJO E;  4B9W A;  2PTK A;  4XU1 A;  1EFN A;  4EMK C;  3H6Z A;  2HQX A;  4MML A;  2X4Y A;  3MP6 A;  2EJF A;  4M7D D;  4OB0 B;  4MZM A;  3V8K A;  2F1L A;  2R5A A;  1AWW A;  2ROL A;  3BW1 A;  2A0F B;  2L3Q A;  4E6R A;  3A8M B;  4BI3 A;  2XDD A;  1Y7X A;  4LDV A;  4MMK A;  2EJG A;  1IRX A;  4RG8 A;  3CCJ T;  2MK5 A;  4IIM A;  1M1G A;  5IHN A;  4O5V A;  5D6Y A;  2RD1 A;  2KT8 A;  3L2W A;  4C8Q A;  1FXX A;  3WVD B;  3GF5 A;  2O4X B;  3QG1 A;  2EKH A;  3CXC S;  1OU9 A;  4WF2 A;  2HAX A;  1GFC A;  5GMK l;  1Y57 A;  4ZN3 A;  1VQ4 Q;  4KRT A;  5GMK j;  3BE3 A;  4ZGE B;  1KJW A;  1Y96 A;  2MMP A;  3KBG A;  1QLY A;  3EGD B;  2COZ A;  3CC4 A;  4HCK A;  1RL2 A;  3CQT A;  2RN8 A;  1TUC A;  1QVG P;  2JT4 A;  4X34 A;  2CH4 W;  3SWN C;  1TS9 A;  1PG5 B;  2O31 A;  2MPX C;  4FM4 B;  3UAT A;  4IUQ A;  3QDF A;  4LNP A;  4KT0 E;  3CXC P;  4B6M A;  1V1C A;  3OYK A;  1BK2 A;  1LVK A;  4R0K A;  5LJ5 j;  3H0H A;  2LJ0 A;  2BKD N;  1QCN A;  1XOV A;  3G1J A;  1WQW A;  4M77 B;  1ZBX A;  2V8K A;  2CP2 A;  3JCM W;  2A37 A;  3M0T A;  3SDZ A;  1YI2 T;  2LMJ A;  1Y96 B;  4M75 F;  2KT1 A;  4E7J A;  4J9I A;  4PJO D;  1H64 1;  1X6G A;  2KE9 A;  4N4I A;  2HZY A;  2ZPG B;  1RLQ C;  3TQ7 P;  5LJ3 j;  4IIO A;  2GFU A;  5GAM d;  1W6X A;  1WPY A;  2FZK B;  3S3M A;  2GBQ A;  4LDW A;  2XU8 A;  4LE9 A;  1M1K U;  1XTD A;  5GAO l;  5GAN 6;  2AT1 B;  1V76 A;  4FL6 A;  1TUD A;  1KK7 A;  3Q1J A;  3RR6 A;  2F5T X;  2E5Q A;  1BYM A;  5FRN A;  1D09 B;  4PJO G;  1MMA A;  2VXF A;  5CKB A;  3C95 A;  2A36 A;  3JAM E;  1YJW A;  3LGL A;  3P8B B;  4PNO A;  2EVR A;  4QQ6 A;  3CCM A;  4AG1 C;  2EYW A;  1VQM T;  1H3Z A;  2FPD A;  2WSE E;  4F7U F;  4BI4 A;  2CZ0 B;  1OPL A;  1MV0 B;  3S3O A;  5KYX A;  2YUP A;  2O88 A;  3UA7 A;  2K3X A;  2XDP A;  4A54 A;  2LZ6 B;  3OYB A;  2DVJ A;  1FWZ A;  2E4H A;  2O4X A;  2ZZD A;  4RCC A;  1JO8 A;  3VU3 C;  4J9B A;  2LX7 A;  3LH5 A;  1FMV A;  1Z9Q A;  3A8O B;  2RJD A;  3EG2 A;  4NL2 A;  2DL3 A;  1XQH A;  2BZ8 A;  2HNI A;  1W2B S;  1JXO A;  1YI2 Q;  2QEX Q;  1HJD A;  3TVT A;  5GAO r;  4AFZ C;  4LUD A;  3L2V A;  1M90 U;  4DQ2 A;  3MPU B;  2KBT A;  3ER0 A;  1TH7 A;  2CZ6 B;  3H9N A;  3GOX A;  3X20 B;  5C0M A;  3PGG A;  5LJ5 d;  1OV3 A;  2MWO A;  2GQI A;  3X28 B;  1ZUY A;  3OYI A;  2D0Q B;  1U06 A;  5KE3 A;  3HTR A;  4M7A D;  1UEB A;  3CCV T;  2F2W A;  2DTI A;  5J39 A;  3URG A;  2XID A;  1Q81 U;  2V8I A;  5FLX E;  1RAB B;  3KUF A;  1QVF A;  4WTO B;  1T3S A;  4C92 D;  1N8R U;  3VS4 A;  3CBP A;  2XMF A;  3M56 A;  4CC7 A;  4LDU A;  4AFS C;  3TEE A;  1VQP A;  4FT2 A;  3ZFJ A;  4X9C A;  1ABO A;  3L42 A;  2K4Y A;  4XK8 E;  1T3L A;  1UG1 A;  2DIG A;  2OTJ Q;  1X01 A;  2QA4 T;  4RUG A;  1YHQ A;  3VRY A;  3PMI A;  1G8X A;  2A28 A;  5M9O A;  3HL8 A;  5J3B A;  2ECZ A;  2FYK A;  1UGS B;  1M3A A;  3CCS Q;  2PVO B;  4C8Q B;  3CCJ Q;  3J7A F;  2HSE B;  3M55 A;  4V2S A;  3FJP A;  1TSF A;  2L3R A;  1WX6 A;  1N5Z A;  4HA8 A;  2ZAE A;  2YSQ A;  4M75 B;  3EAE A;  3L1A A;  4EIK A;  4DBQ A;  3D7S B;  2DL4 A;  4XTU A;  3RBB B;  3M0P A;  5CCA A;  3CCL A;  5LJ3 f;  4QKU A;  3GPL A;  3CCR Q;  3A8G B;  1NBE B;  1NJI R;  3CD6 Q;  2VAS A;  5LJ5 g;  1BCO A;  5D6X A;  5GAO m;  1AHJ B;  1YNZ A;  2HQH A;  1KSW A;  1U5S A;  2PNI A;  1VQO T;  4M75 A;  2L0A A;  3RIR A;  2RB6 A;  2KQW A;  3RDV A;  5LL6 S;  3QJ6 A;  3SD4 A;  4F17 A;  1I5L A;  3CME Q;  1QCF A;  2DAQ A;  2MOX A;  1K8A C;  2QXF A;  1R77 A;  3HP9 A;  4E2F B;  3EGX A;  1YWO A;  3EG0 A;  1YJN A;  1WZO A;  2DTH A;  2EFI A;  2RO0 A;  2F5K A;  2KK4 A;  2VV5 A;  3I55 Q;  4FYY B;  4C5G A;  3UDC A;  4PLL A;  2KRN A;  5LJ3 g;  2XG8 D;  4N0A A;  4EDU A;  3AHU A;  4JLI A;  3V8L A;  2KRO A;  3JV3 A;  2FL7 A;  1WQ7 A;  2RPN A;  2EIF A;  4GLK A;  1Q86 C;  2LX9 A;  4M7A E;  3MHX A;  2K3B A;  2SEM A;  1OYX A;  2R58 A;  3OS2 A;  4OMF B;  3INZ A;  1WIE A;  4J9D A;  2CZ1 B;  3PIP A;  2HL3 A;  2OTL Q;  2K2V A;  4PLI A;  1CKB A;  3QWY A;  2BZY A;  2EYX A;  2GCX A;  1S72 A;  4M7A F;  2B8A A;  1D0X A;  5GMK h;  2OTL A;  5D7U A;  1VQK T;  1K0S A;  2M0O A;  1Y07 A;  1X75 C;  2DZC A;  3QXE B;  3RKY A;  1GRI A;  3A1P A;  5IXB A;  4Z89 A;  2RNA A;  4EMK B;  3CC2 T;  5ECA A;  2IG0 A;  3G4S T;  4E7L A;  1RAH B;  4F14 A;  2GF7 A;  1W2B A;  2L8D A;  2L2P A;  3G6E T;  1YWP A;  1X27 A;  1ZQ1 A;  2DEU A;  2QA4 Q;  4AMC A;  2DO3 A;  4PJN A;  1KD1 U;  1LNX A;  4GLM A;  3OW2 A;  2W10 A;  3LLR A;  3CCM T;  9ATC B;  3ME9 A;  5EC7 A;  1VQM A;  2EWN A;  1K8A R;  1K73 U;  1QQJ A;  2WSF E;  1WHM A;  3SB2 A;  3OBY A;  2FVU A;  1OOT A;  3GP8 A;  1M4Z A;  4C5H A;  4FYV B;  1A0N B;  2O01 E;  1N9R A;  2WSC E;  2EQI A;  2YUQ A;  3UF4 A;  4FU6 A;  1W4S A;  1YCS B;  1GBR A;  2DF6 A;  5FU6 B;  2R5M A;  3RUX A;  4JPB W;  5LJ5 h;  3M4G A;  3JCM P;  1M30 A;  2RHX A;  4M7A C;  2JS2 A;  4KUL A;  3QSU A;  2JJ9 A;  1WXT A;  3I5R A;  4JS4 A;  1VQ8 T;  1MHN A;  2J06 A;  3CCL Q;  4FYX B;  1QVP A;  2EJ9 A;  3CC4 T;  1YIJ A;  1SG5 A;  2QEX T;  2YXY A;  4KGV B;  1B34 B;  4IUV A;  4Y28 E;  3VS3 A;  3TCJ A;  4Z88 A;  1UGR B;  5GAN 8;  1Q82 U;  1RAA B;  1ZBJ A;  1G3S A;  3GNG A;  1ZUK A;  3VS7 A;  4M78 A;  3EH1 A;  4QW2 A;  4Q5W A;  2KDS A;  5KCO A;  2QTV A;  4AFU C;  1UGV A;  2XI9 A;  4E47 A;  3QO3 A;  3CCJ A;  5I11 A;  2O9S A;  3REB B;  4OMM A;  1BB9 A;  2DJQ A;  2DL7 A;  4Z8A A;  4JRQ A;  3OYG A;  4C92 G;  2OTJ A;  1FYN A;  4OGE A;  4JDS A;  1NM7 A;  4DEX A;  3AT1 B;  3CPW P;  4J9C A;  3GBQ A;  1QWE A;  4C92 F;  3G71 Q;  2X51 A;  2JW4 A;  4J9H A;  3MEU A;  1VYU A;  1G3Y A;  1JB0 E;  4PK4 A;  4XTZ A;  3CEY A;  3SFM A;  2DBK A;  4JJC A;  3LWH A;  2CYZ B;  3EG3 A;  3HSB A;  2E6Z A;  2LCL A;  1Q81 C;  3L2Q A;  5KYY A;  4M78 B;  3EHR A;  2ESW A;  3E2U A;  1M1K C;  3ASK A;  4ZTJ A;  3JSC A;  2F2X A;  4BY6 B;  1BI3 A;  1LPL A;  2H8H A;  4BI8 B;  4IKF A;  3QJY A;  4OMP A;  2JVV A;  4C8Q D;  1VUB A;  1W70 A;  2NUZ A;  3ZEH A;  4E7S A;  3JCM d;  2QYZ A;  1YI2 A;  1NE8 A;  2EYZ A;  1U3O A;  3CCV Q;  2DYI A;  3C94 A;  4OF1 A;  2G6F X;  1M3B A;  4MDW A;  3RKW A;  1NZ9 A;  1IB8 A;  1Q82 R;  2X3X D;  3OSV A;  1X6O A;  3QYH B;  2LJ3 A;  2NUP A;  2MF2 A;  1K1Z A;  4N4H A;  1FMK A;  4XU2 A;  2DLP A;  1CKA A;  4C92 C;  3CCU T;  1IRE B;  2DK3 A;  2K79 A;  2DYB A;  3EHQ A;  5IH2 A;  1HYO A;  4C8Q C;  1UHC A;  1CSK A;  3C0C A;  3JCM e;  4TVR A;  1R8O B;  1X43 A;  3CCM Q;  2J6F A;  3LGF A;  4M7D A;  1RAD B;  2NUP B;  3M0S A;  1RAG B;  1SEM A;  2EQM A;  5GAN f;  1VQ5 Q;  2A08 A;  1WHH A;  4IUU A;  1M8M A;  2RH2 A;  5KYY B;  1VA7 A;  4J9G A;  1AT1 B;  4PJL A;  5IAY A;  1NEB A;  2QTX A;  2V1R A;  3PVL A;  4Y91 A;  3M53 A;  1T0H A;  3TRE A;  4CC4 B;  1H8K A;  3OYJ A;  1YFN A;  3CPF A;  2W0Z A;  1BU1 A;  3G7Z A;  3M0Q A;  5CIU A;  1QP2 A;  5I22 A;  2KGT A;  1R0C B;  1JXM A;  1M3C A;  3EFO A;  2FPF A;  3A5Z B;  3X25 B;  2F2V A;  3DLL A;  3QKJ A;  4F16 A;  1YHQ T;  1WJR A;  2DZ9 A;  3E9G A;  1NLO C;  1W1F A;  2Y90 A;  1JJ2 P;  4M77 A;  1TWB A;  1WA7 A;  3EG9 A;  5KH6 A;  1Q7Y U;  2P84 A;  2RQW A;  4DBF A;  5L8R E;  1KC8 R;  5FU7 C;  1JBM A;  3G4S A;  5GAM h;  1QKX A;  2JNG A;  2DET A;  3GNF B;  2DD4 A;  4MZT A;  5D6W A;  3RMQ A;  1KC8 C;  3UA6 A;  2Y4Y A;  1HK9 A;  1RAE B;  1U1T A;  1B7T A;  4CC3 A;  2GQV A;  2PUO B;  5FU6 C;  5I2M A;  3CCV A;  1OPK A;  3CC4 Q;  3VJP A;  3CCL T;  2VVK A;  3RER A;  2E3I A;  2JS0 A;  4UC4 A;  3FC3 A;  4F7U G;  2LTO A;  3JCM J;  1O9S A;  3TU4 K;  2AKL A;  1VQ4 A;  2ZPH B;  1M8V A;  2LC4 A;  4R55 A;  1MUZ A;  1OZ2 A;  5DLO A;  4ORZ A;  2K3Y A;  2AKK A;  2EW3 A;  5IHK A;  4M7A B;  2A7Y A;  4M78 F;  1WFW A;  3OYA A;  1NG2 A;  1AWX A;  2AZS A;  2PVD B;  3M58 A;  2SRC A;  2CP7 A;  2M1H A;  2DRK A;  2KSS A;  2D8H A;  5DLQ E;  1LCK A;  1YJ9 Q;  1KQS P;  1MV3 A;  4M78 G;  4JRP A;  2NUT A;  1TXQ A;  5KYX B;  3HRU A;  1I81 A;  1GCQ A;  1BI1 A;  4B9X A;  2KXD A;  3QWX X;  4L6V 5;  3JCM V;  1QKW A;  1WXB A;  3CPW A;  5IN1 A;  1PWT A;  4BE2 A;  3JCM f;  2DD5 A;  1G3T A;  1ABQ A;  4PL6 A;  3JB9 G;  2E41 A;  5DY9 A;  1IHW A;  4M7D E;  2CH4 A;  3C12 A;  3G4S Q;  1JJ2 A;  3WXM B;  3VS6 A;  4ZGD B;  2FZG B;  2D8J A;  2CKK A;  3I56 Q;  3JB9 F;  2DL5 A;  3PVQ A;  2EQU A;  2LVM A;  1SRL A;  5L23 A;  2KY9 A;  2OTJ T;  1PNJ A;  1YCY A;  2LCC A;  1GL5 A;  2E10 A;  4ZGJ B;  1BKB A;  1PRM C;  1VQ9 Q;  2D1X A;  2DNU A;  3WVE B;  2A3L A;  1EZZ B;  2QQR A;  3I35 A;  5CK9 A;  2HCK A;  2K6D A;  2RJC A;  1TG0 A;  2RJE A;  4BE0 A;  5GAN h;  2DL8 A;  1VQ7 T;  1WHJ A;  2F69 A;  1YIT Q;  2EGE A;  3CC2 A;  1Q81 R;  3O5Z A;  1B34 A;  1N8R C;  1SSH A;  3JB9 J;  4ATO A;  1N8R R;  1PCX A;  2DPP B;  3QZ5 B;  2NYS A;  3CPW S;  4OMQ A;  2RK1 A;  2PUK B;  3IQL A;  2XHC A;  2RHY A;  4XTY A;  3CCE Q;  1K76 A;  3BDU A;  2JXB A;  1I1J A;  1NYG A;  2QDL A;  3HFO A;  2DER A;  4A53 A;  1GBQ A;  4Z02 A;  4C5I A;  3OMG A;  1E7O A;  3OA6 A;  2ZPE B;  2KMT A;  4BD3 A;  3FRN A;  3M9Q A;  5CKF A;  2E1H A;  3H0I A;  1D1B A;  1SRM A;  3SHW A;  3V8J A;  2ZPB B;  3SEM A;  2QA4 A;  3P8H A;  3OW2 P;  2MAM A;  5GMK e;  2K5F A;  3M0U A;  4JJN K;  2VKN A;  4XAX B;  1M9S A;  1QVF S;  1MGQ A;  3ULR B;  1TTH B;  1PC0 A;  4XU3 A;  1OI1 A;  1GCQ C;  1SKU B;  1VQ7 Q;  4PJJ A;  2AHJ B;  4J8O A;  1U1S A;  2KR3 A;  3FEO A;  2L5Q A;  4C8Q F;  1VQ9 T;  4QVC A;  2XDB A;  1Q86 R;  3LWI A;  1QWF A;  2JM8 A;  3MEV A;  4KH1 B;  4BDY A;  5AT1 B;  1J3T A;  2HMA A;  1FMW A;  4DBH A;  1SHF A;  4PJO A;  3HKS A;  4A4E A;  4EMG A;  5CKE A;  1D0Y A;  3CMA Q;  1NLP C;  2L3P A;  4C0D C;  1M1K R;  3CCS T;  2OAU A;  6AT1 B;  3QZ9 B;  3KFV A;  4J5Y A;  1Y71 A;  4E7I A;  4XTV A;  1VQO A;  2LDM A;  2LJ1 A;  2RM4 A;  1KQS S;  3JCM c;  2D9T A;  4M75 D;  2DIQ A;  4LD6 A;  4M78 C;  4O6J A;  1VQN Q;  3CBO A;  1QVG S;  3DLM A;  2YRD A;  4FIB A;  1ZUU A;  1UJ0 A;  3OS5 A;  2KYM A;  2CP3 A;  2EAY A;  4J9F A;  2CT3 A;  1K4U S;  2VB6 A;  4M77 E;  1YJ9 T;  4M7A G;  1VYV A;  1BCM A;  1VQ8 A;  2C0O A;  2JTF A;  2QDY B;  2E12 A;  1Q82 C;  5CVI A;  2DVE A;  1YIJ T;  5C6S A;  4KH0 B;  3CME A;  2KI7 A;  2Y4X A;  3OYY A;  1JQQ A;  2P4R A;  2E65 A;  3DB4 A;  1I0C A;  3RKX A;  2ATC B;  2HKQ B;  4WCI A;  1KHI A;  5HK0 A;  1TOV A;  5FWB A;  1NPP A;  2HD0 A;  2CP0 A;  3TSZ A;  1KIK A;  4OGC A;  3ZBD A;  4JZ3 A;  4OB3 B;  3UPU A;  1Q7Y R;  2CUD A; 
#chains in the Genus database with same CATH homology
 1WJS A;  1G3Y A;  5GAM j;  1JB0 E;  2DTO A;  4VUB A;  4XTZ A;  4CI0 C;  1KC8 U;  1XOV A;  1WJQ A;  1WQW A;  3OBW A;  4M77 B;  1VQ6 T;  1ZBX A;  3CEY A;  3SFM A;  2QQS A;  2R57 A;  3M5A A;  5GAN j;  2DJZ A;  4CRI A;  2V8K A;  4OB1 B;  3MO8 A;  3A8L B;  1JRI A;  3VKI A;  4LDX A;  3V7C A;  5CAI A;  3JCM W;  3SDZ A;  3LWH A;  1YI2 T;  1Y96 B;  4M75 F;  2VGM A;  1VQ4 T;  4E7J A;  2CYZ B;  2JOY A;  3G71 A;  3HSB A;  3OYN A;  2E6Z A;  2LCL A;  1Q81 C;  1Q7Y C;  3L2Q A;  3CCQ T;  4M78 B;  4PJO D;  1H64 1;  3KXT A;  2KVQ G;  3GLX A;  2VUB A;  1S72 T;  2YLC A;  1M1K C;  5CKH A;  4N4I A;  3PNW C;  3ASK A;  2IVW A;  4ZTJ A;  3JSC A;  4BY6 B;  2ZPG B;  3JRZ A;  1BI3 A;  5LJ3 j;  1BI2 A;  4BI8 B;  4C0G A;  4IKF A;  2GFU A;  3QJY A;  5GAM d;  1WPY A;  2JVV A;  4C8Q D;  1VQ6 A;  5LJ3 h;  3S3M A;  4J7I A;  1VUB A;  1UB4 A;  2XU8 A;  4JRK A;  1I4K 1;  4LDW A;  4XTW A;  3VYH B;  3ZEH A;  1M1K U;  1XTD A;  3JCM d;  5GAO l;  3CMA T;  5GAN 6;  4ZN1 A;  1BYM A;  2RI5 A;  4FL6 A;  3NTH A;  1YI2 A;  1NE8 A;  3Q1J A;  4NS5 A;  2F5T X;  3C94 A;  2E5Q A;  2VYT A;  2LT4 A;  4OF1 A;  4MDW A;  4BE1 A;  3G71 T;  3RKW A;  5FRN A;  3BDL A;  4M7D C;  1NZ9 A;  4PJO G;  2VXF A;  4C5E A;  5CKB A;  3C95 A;  1VQN A;  3JAM E;  5CKD A;  1YJW A;  3OSV A;  1PSF A;  1X6O A;  2WAC A;  2NLU A;  3LGL A;  2LQK A;  3P8B B;  3QYH B;  5AYF A;  5HY6 A;  2K57 A;  2MF2 A;  4PNO A;  4N4H A;  2M9U A;  4QQ6 A;  3CCM A;  2RHZ A;  1VQM T;  1H3Z A;  3M57 A;  2WSE E;  4F7U F;  4BI4 A;  4BY6 C;  3JCM h;  4C8Q G;  4XU2 A;  2CZ0 B;  2DXB A;  4C92 C;  3CCU T;  1IRE B;  2DK3 A;  3DKM A;  3S3O A;  4HCB A;  4J7F A;  4C8Q C;  4EPC A;  5GMK m;  1M5Q 1;  2QQ9 A;  2K3X A;  2XDP A;  2ZPI B;  4A54 A;  2K5I A;  3OYB A;  1FWZ A;  3LYI A;  3JCM e;  4P5N A;  1NPR A;  3J81 E;  4OVA A;  3OYH A;  4OB2 B;  4TVR A;  2O4X A;  2ZZD A;  4RCC A;  1R8O B;  3VU3 C;  5GAN 5;  1UGP B;  2ZPF B;  3OYC A;  2DKG A;  2JZ2 A;  2L89 A;  4J83 A;  4IUR A;  1VQ5 T;  1VQN T;  1I8F A;  2LNV A;  3A8O B;  2ZCF B;  3LGF A;  3MP8 A;  4M7D A;  2RJD A;  5LJ5 f;  3L2R A;  1NJI C;  4NL2 A;  2C06 A;  1N9S A;  2X4J A;  5KCH A;  3NTK A;  1KQ1 A;  3VUB A;  3OY9 A;  2EQM A;  4XQ3 A;  5GAN f;  1XQH A;  2HNI A;  5GAN 3;  1W2B S;  4IUU A;  2JN0 A;  1G5V A;  2RH2 A;  3UT1 A;  3VYG A;  2FB7 A;  3CCU A;  3R6O A;  4M77 F;  4JUV A;  5IAY A;  5GAO r;  4QQG A;  3QBY A;  2QTX A;  3OSS C;  4QVZ A;  3L2V A;  1M90 U;  4DQ2 A;  3LH0 A;  4Y91 A;  3M53 A;  1VQ7 A;  3TRE A;  3HHT B;  2MI6 A;  3OS1 A;  3OYJ A;  3MP1 A;  2QEX A;  3CPF A;  2V8J A;  5FRO A;  5CR2 A;  3ER0 A;  3HPW A;  1TH7 A;  3QDR B;  4HCC A;  3G7Z A;  4DA4 A;  5CIU A;  2CZ6 B;  1QP2 A;  1IZ6 A;  1KD1 C;  5GAN e;  1O75 A;  3GOX A;  4DOW A;  2PU9 B;  4RKU E;  3X20 B;  5C0M A;  4M7D F;  3PGG A;  5LJ5 d;  2YRV A;  3CC7 T;  2MWO A;  3PMT A;  5A0L A;  2FHD A;  3X28 B;  2CS7 A;  3OYI A;  2D0Q B;  5KE3 A;  3A5Z B;  3X25 B;  3DLL A;  1D3B A;  2EKO A;  2LRQ A;  3QKJ A;  3F70 A;  1YHQ T;  2E70 A;  4M7A D;  1UEB A;  1WJR A;  2DZ9 A;  1U8R A;  2HQE A;  3CCV T;  3E9G A;  2XKO C;  3PFS A;  2Y90 A;  2OTL T;  4M77 A;  2DTI A;  5J39 A;  3JCM Q;  3URG A;  2XID A;  5KH6 A;  3PTA A;  1Q81 U;  5EG2 A;  2X4X A;  1YIT T;  1Q7Y U;  2V8I A;  5IT9 E;  5FLX E;  3KUF A;  1QVF A;  5L8R E;  4C92 D;  1N8R U;  5FU7 C;  1JBM A;  3G4S A;  3CBP A;  3CCE A;  3M56 A;  2JNG A;  5GAM h;  3G6E A;  2RK2 A;  3GNF B;  2DD4 A;  4HCZ A;  4MZT A;  4LDU A;  3TEE A;  5D6W A;  3RMQ A;  1VQP A;  4A4K A;  4FT2 A;  3ZFJ A;  4C8Q E;  1KC8 C;  4X9C A;  4M75 C;  2XD0 A;  3L42 A;  4M78 D;  4PJO B;  2HBP A;  2K4Y A;  1HK9 A;  1U1T A;  2Y4Y A;  3QII A;  4X9D A;  4XK8 E;  4OP0 A;  2DIG A;  3VV0 A;  4A4F A;  1X01 A;  2GQV A;  4M78 E;  2QA4 T;  1GXI E;  2PUO B;  1YHQ A;  3PMI A;  5FU6 C;  4A4G A;  5I2M A;  5M9O A;  1OZ3 A;  3CCV A;  2RA2 A;  3H8Z A;  3HL8 A;  5J3B A;  2FYK A;  1UGS B;  5I2S A;  3E1S A;  1DJ7 B;  5LJ3 d;  3VJP A;  3CCL T;  2PVO B;  5GAN 7;  2PQW A;  4C92 B;  3I56 T;  3RER A;  4C8Q B;  3QUI A;  4UC4 A;  1UGQ B;  3FC3 A;  3J7A F;  4JLG A;  5GAO n;  4F7U G;  2LTO A;  1HXD A;  3JCM J;  1WGS A;  3M55 A;  2EQJ A;  3JB9 D;  1O9S A;  3TU4 K;  5FU7 B;  1VQ4 A;  4V2S A;  5HKC A;  3HRT A;  5HK3 A;  4XU0 A;  2ZPH B;  3FJP A;  1M8V A;  3OYL A;  2LC4 A;  5LJ5 j;  4R55 A;  2L3R A;  3N5B B;  1VQ9 A;  2D6F A;  1OZ2 A;  5DLO A;  2QQA A;  3CCQ A;  1KQ2 A;  2VXE A;  4HA8 A;  4E7H A;  4J6W A;  3LX7 A;  4M75 B;  4BUG A;  3EAE A;  3L1A A;  2K3Y A;  5LJ5 e;  2LT1 A;  4J6Y A;  3I55 A;  4XTU A;  4F7U E;  4ME7 A;  4M7A B;  3J80 E;  3M59 A;  2A7Y A;  4M78 F;  3A8H B;  3OYA A;  5A0G A;  1RI0 A;  5CCA A;  3CCL A;  3RMS A;  5LJ3 f;  2PVD B;  3OMC A;  3GPL A;  3CMA A;  3M58 A;  1BIB A;  3A8G B;  5LJ3 e;  2M1H A;  3O8V A;  2DXT A;  2KSS A;  4C0D B;  1K9M C;  5DLQ E;  3BY7 A;  1VIF A;  4M78 G;  5LJ5 g;  2BUD A;  3LW5 E;  3CCS A;  4JRP A;  1KG1 A;  3C4S A;  4BDZ A;  5D6X A;  4C0F A;  1JJ2 S;  4XTX A;  4DOV A;  5GAO m;  4M7D B;  1AHJ B;  2H3J A;  2CGH A;  4NOY A;  1N6A A;  3JCM g;  3SWN B;  5GAN g;  1Q86 U;  3HRU A;  1I81 A;  3V7R A;  2P0Q A;  4M7A A;  1YJW T;  1BI1 A;  2P0P A;  1VQO T;  4M75 A;  4B9X A;  3RIR A;  2I2L A;  1QW1 A;  2RB6 A;  4L6V 5;  1M90 C;  3JCM V;  4NL3 A;  3OYE A;  3CXC A;  3NFC A;  1KQS A;  4GY5 A;  2KQW A;  3MEW A;  3SWN A;  5LL6 S;  3QJ6 A;  4FSX A;  3CPW A;  5IN1 A;  3SD4 A;  3JCM f;  4BE2 A;  2DD5 A;  1G3T A;  4PL6 A;  3X24 B;  2P0K A;  1M1F A;  2E41 A;  4IUP A;  5DY9 A;  4II1 A;  3UWN A;  3JB9 G;  1I5L A;  2DAQ A;  3C12 A;  4M7D E;  2VGN A;  5GAO q;  2X4W A;  1FX7 A;  1K8A U;  1K8A C;  2QXF A;  3MET A;  1JJ2 A;  3L2U A;  2JUF A;  1YJ9 A;  3CD6 A;  3HP9 A;  3WXM B;  4ZGD B;  3S3N A;  3GIB A;  2CKK A;  3CCR A;  4ELY C;  4HT9 A;  3JB9 F;  1YJN A;  2EQU A;  2LVM A;  4LD9 K;  3OW2 S;  3HRS A;  2DTH A;  2EFI A;  4D6W A;  2KY9 A;  2F5K A;  2RO0 A;  3JCM X;  1BI0 A;  2KK4 A;  2VV5 A;  3E19 A;  4M77 G;  2OTJ T;  3CBM A;  3FB9 A;  4C5G A;  3UDC A;  3EFR A;  4PLL A;  1YCY A;  2LCC A;  5LJ3 g;  2XG8 D;  3OB9 A;  4N0A A;  2E10 A;  4EDU A;  4ZGJ B;  3AHU A;  2RJF A;  1BKB A;  1VQL T;  4JLI A;  4HKE A;  3V8L A;  2E64 A;  2FL7 A;  1WQ7 A;  3WVE B;  2A3L A;  2YHT A;  1VQK A;  2QQR A;  3FLG A;  5GAN 4;  2EIF A;  4GLK A;  5CK9 A;  1Q86 C;  4BE0 A;  2RJC A;  2LX9 A;  4M7A E;  2RJE A;  3MHX A;  5GAN h;  1OYX A;  1VQ7 T;  1YBY A;  2F69 A;  2R58 A;  3CCR T;  3OS2 A;  4OMF B;  3INZ A;  4KBM B;  1YJN T;  2ZGW A;  2JTM A;  3CC2 A;  2CZ1 B;  5GMK i;  3PIP A;  2E6N A;  1B34 A;  1N8R C;  2K2V A;  3JB9 J;  4N0A C;  2PVG B;  4PLI A;  3OYD A;  2EYQ A;  5GAM f;  4ATO A;  3OS0 A;  2DPP B;  3PT9 A;  3QZ5 B;  3NTI A;  2YLB A;  3CPW S;  3CC7 A;  3M54 A;  4BB7 A;  2RK1 A;  1SSF A;  4F7U A;  2GCX A;  4L5G A;  3OYF A;  4JRI A;  2M16 A;  3V7S A;  1S72 A;  1VQL A;  2PUK B;  2B8A A;  1PSE A;  2K5L A;  4M7A F;  2RHU A;  5GMK h;  2XHC A;  2RHY A;  4C92 E;  4C0Z A;  4E7K A;  2OTL A;  4XTY A;  1VQK T;  3FIF A;  4R56 A;  2M0O A;  5FRM A;  4C92 A;  1Y07 A;  5GAM e;  1X75 C;  3BDU A;  2DZC A;  2QI2 A;  3PIO A;  5CQX A;  5J26 A;  3QXE B;  1YIT A;  3RKY A;  3HFO A;  4EMK A;  1VIE A;  4M77 D;  3L2Z A;  1LJO A;  4A53 A;  3OQ5 A;  4YTL A;  2DXU A;  3EFS A;  4Z02 A;  4C5I A;  1NJI U;  3OMG A;  3CC2 T;  4EMK B;  2IG0 A;  3OA6 A;  3G4S T;  4E7L A;  3M4Y A;  2ZPE B;  2KMT A;  5CO7 A;  4BD3 A;  2GF7 A;  3FRN A;  2L8D A;  3M9Q A;  5CKF A;  3G6E T;  1W2B A;  4KUI A;  2RI2 A;  3CCE T;  3JB9 H;  2E1H A;  4M75 E;  3X26 B;  2EQK A;  3JB9 I;  1ZQ1 A;  1VQP T;  4EMH A;  1V29 B;  3QYG B;  2CZ7 B;  2DO3 A;  1KD1 U;  3RES A;  4F7U B;  3V8J A;  4ELZ C;  5GAN 2;  1LNX A;  2ZPB B;  4PJO C;  1EIF A;  2QA4 A;  3P8H A;  3HFN A;  2MAM A;  3OW2 A;  5GMK e;  3LLR A;  4FT4 A;  3CCM T;  2K5F A;  3ME9 A;  3MCA B;  4JJN K;  1VQM A;  4XAX B;  2BIV A;  2EWN A;  5KE2 A;  5GAO p;  1M9S A;  4PJO F;  1K73 C;  1K73 U;  1QVF S;  1MGQ A;  4MDX A;  4QVD A;  2WSF E;  4HT8 A;  2KAF A;  3I56 A;  4J6X A;  3SB2 A;  4XU3 A;  4PJO E;  4B9W A;  1OI1 A;  3OBY A;  4M75 G;  2FVU A;  3QHS A;  1LOJ A;  4M77 C;  4XU1 A;  3GP8 A;  4KUD K;  4EMK C;  1M4Z A;  2AHJ B;  3H6Z A;  4J8O A;  1U1S A;  4C5H A;  3FEO A;  1KHC A;  2O01 E;  1N9R A;  1WNL A;  2HQX A;  2L5Q A;  4MML A;  4C8Q F;  2X4Y A;  2WSC E;  2GFA A;  3MP6 A;  2EJF A;  1VQ9 T;  4M7D D;  4OB0 B;  2QQB A;  3S6W A;  1VQ5 A;  4QVC A;  4MZM A;  3V8K A;  2XIC A;  2R5A A;  4FU6 A;  1W4S A;  3QPH A;  4RCB A;  3VUZ A;  2XDB A;  3LWI A;  3MEV A;  1P92 A;  4BDY A;  1G3W A;  1ZHI A;  3E9F A;  1N27 A;  4ZTF A;  3I55 T;  5FU6 B;  2R5M A;  3BW1 A;  3RUX A;  2X35 A;  5LJ5 h;  3M4G A;  3JCM P;  2RHX A;  3A8M B;  4BI3 A;  1XNI A;  2G3R A;  4M7A C;  4KUL A;  2XDD A;  1Y7X A;  2P4T A;  3QSU A;  4PJO A;  3HKS A;  4A4E A;  4EMG A;  4LDV A;  4MMK A;  4JS4 A;  5CKE A;  4BAC A;  2EJG A;  1VQ8 T;  1MHN A;  4RG8 A;  5A2Q E;  5A0D A;  3CCJ T;  1M1G A;  4O5V A;  3FDR A;  5D6Y A;  4C0D C;  3CCS T;  1QVP A;  2EJ9 A;  2OAU A;  2RD1 A;  3JCM b;  5CQY A;  3CC4 T;  1YIJ A;  3QZ9 B;  3CME T;  2QEX T;  3L2W A;  5I21 A;  4C8Q A;  1FXX A;  5GAN d;  1B34 B;  4IUV A;  3GF5 A;  4J5Y A;  1Y71 A;  3WVD B;  4E7I A;  1QP3 A;  4XTV A;  1VQO A;  2O4X B;  3QG1 A;  4Y28 E;  2XK0 A;  2LDM A;  2RM4 A;  3TCJ A;  4A4H A;  1KQS S;  3JCM c;  1UGR B;  5GAN 8;  3CXC S;  1Q82 U;  4WF2 A;  2D9T A;  4M75 D;  1QVG A;  2HAX A;  2DIQ A;  3MEA A;  1G3S A;  4LD6 A;  3GNG A;  4M78 C;  5GMK l;  4O6J A;  4M78 A;  4IUT A;  1D3B B;  3CBO A;  4ZN3 A;  1QVG S;  3DLM A;  4FIB A;  4QW2 A;  4Q5W A;  3OS5 A;  4N4G A;  2KDS A;  5KCO A;  5GMK j;  2EAY A;  4ZGE B;  4MZP A;  4RMO A;  4M77 E;  1YJ9 T;  1Y96 A;  4M7A G;  3CD6 T;  2RHI A;  2XI9 A;  4E47 A;  3QO3 A;  1VQ8 A;  4M7D G;  3BFM A;  3CCJ A;  2MMP A;  3KBG A;  2JTF A;  2QDY B;  2VC8 A;  2E12 A;  1Q82 C;  2DXC A;  5CVI A;  2RI3 A;  2DVE A;  3CC4 A;  3OYM A;  1YIJ T;  5C6S A;  1RL2 A;  4QQD A;  3CME A;  2Y4X A;  3OYY A;  4RG2 A;  3DB3 A;  4JRQ A;  3P8D A;  3OYG A;  4C92 G;  2OTJ A;  2LQ8 A;  1BIA A;  2E65 A;  3DB4 A;  4X34 A;  4L59 A;  3SWN C;  4OGE A;  4JDS A;  3RKX A;  2MWP A;  3T9N A;  4PKC C;  1KHI A;  4FM4 B;  1K9M U;  5HK0 A;  2DEQ A;  4IUQ A;  1NPP A;  2HD0 A;  4KT0 E;  4C92 F;  5GAM g;  3OYK A;  4LDY A;  4OGC A;  3ZBD A;  5DM7 R;  4OB3 B;  4JS5 A;  3UPU A;  3MEU A;  2BKD N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...