4N0AA

Crystal structure of lsm2-3-pat1c complex from saccharomyces cerevisiae
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm3
publication title Lsm2 and Lsm3 bridge the interaction of the Lsm1-7 complex with Pat1 for decapping activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 80
sequence length 80
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n0aA00
4J6WA 2DJZA 3JCMX 4M77G 2RD1A 5LJ5f 4M77F 3RUXA 4HA8A 1D3BB 4M7DE 1D3BA 4M77C 1LOJA 5GANf 4A54A 4M7AF 4V2SA 4MMKA 3SWNC 4F7UB 4PJOG 4M7DA 4F7UA 4M7AC 3JB9G 2DZ9A 5LJ3f 4QVDA 2HNIA 2DVEA 4M75E 2DTIA 5GAN6 3V8JA 1H641 2E65A 3JB9J 2E41A 4M7DG 5LJ5d 1I5LA 1KQ2A 4C8QE 5GAN7 5GAN5 5GAN8 5GAOm 3JCMf 5GAN3 5GANd 4C8QA 1Y96A 4NL2A 1TH7A 2ZGWA 4M75G 3INZA 5LJ3d 5GMKm 5GAN2 2JN0A 1LNXA 4M77B 4DQ2A 4C8QG 4M77A 4M7AE 4XTVA 1U1TA 4XU3A 2VXEA 3JCMV 5DY9A 3SWNA 4N0AA 2DZCA 2YHTA 2RB6A 3V7CA 5LJ5h 5GAMd 3JB9I 3JCMd 4PJOB 4PJOA 2DXUA 2QTXA 4XU0A 2EJGA 3JCMQ 5GANh 3QSUA 1JRIA 3HSBA 4M7AG 3V8KA 5GAOr 4M7DB 5LJ3h 2E64A 2YLBA 3JB9H 4JRKA 3PGGA 4XQ3A 5I21A 1I4K1 2DXTA 4XTYA 3HFNA 5GMKh 4C92D 5GAOn 1X01A 4M75B 3JCMh 2RA2A 4M75A 5GAMf 3JCMW 4C92B 2YLCA 4J6YA 4X9CA 4C8QB 4XTUA 1Y96B 4PNOA 4JUVA 1WNLA 3BDUA 1MGQA 3V7RA 4QVCA 4JRIA 4Y91A 4MMLA 4XU1A 4J6XA 3BFMA 5GMKi 3SWNB 2RM4A 4M7AB 2E1HA 2EJ9A 4M7AA 3JCMP 4M78D 3RKYA 3FIFA 4C92C 2DKGA 3HFOA 5CAIA 3GIBA 3V7SA 4M7AD 1YCYA 2E10A 1KQ1A 1LJOA 3L1AA 4M78E 4HT9A 4C92A 2VC8A 5GAOl 1WQWA 5GAMh 3RIRA 4PJOD 4EMGA 3JB9D 1HXDA 4EMKC 4XTWA 2EAYA 2DEQA 1WQ7A 4M78G 1B34A 4M78F 5GAN4 4M7DD 4C92E 5GAOp 1M8VA 4M78C 1I81A 3BW1A 3QHSA 2DTHA 4A53A 5LJ5e 2I2LA 2EWNA 4M7DC 1JBMA 5LJ5g 2VXFA 1BIBA 4J5YA 4M75D 2K57A 4F7UE 5GANe 3RKXA 4C92G 4C92F 3VU3C 1N9RA 3QUIA 5GANg 4N0AC 4C8QD 1I8FA 4PJOF 4X9DA 2EJFA 5LJ3e 5GAOq 1HK9A 5LJ5j 3JB9F 1N9SA 4PJOC 3EFSA 3FJPA 5LJ3g 4EMKB 4HT8A 3RESA 4EMKA 5GANj 4M77D 1M5Q1 4F7UG 5GMKe 4F7UF 4M7DF 3QO3A 4XTZA 2CGHA 4OP0A 4WF2A 4JLIA 4RCCA 4M78B 3JCMc 3V8LA 5LJ3j 3JCMe 2FYKA 2Y90A 4M78A 5GAMg 3JCMg 3EFRA 3JCMJ 3RERA 3FB9A 4NOYA 3SB2A 4EMHA 3AHUA 4M77E 3BY7A 4M75F 5GMKj 5GMKl 1B34B 4XTXA 5GAMj 3M4GA 4XU2A 4M75C 3JCMb 4NL3A 1U1SA 4C8QF 1WPYA 2DTOA 4RCBA 2FB7A 5GAMe 4PJOE 3RKWA 4C8QC 3L2ZA 1BIAA
chains in the Genus database with same CATH superfamily
2YRDA 3P8HA 3OYLA 1K9MU 2KRNA 3M53A 1UGPB 1UGVA 4C0GA 2RPNA 2GF7A 3A98A 3J80E 1SSFA 2DTIA 4AFQC 1QVGS 2DD4A 1Y71A 5LJ5d 1PNJA 2RHIA 2DXCA 2CUBA 1YJWQ 4E7IA 2EQKA 3JV3A 2DIGA 2DZCA 2RB6A 5CQYA 3QYGB 3VUZA 1FMVA 5LJ3h 3RMQA 2A7YA 2DYBA 2O2OA 1BK2A 1WHJA 1X01A 1CKAA 3KXTA 2RO0A 1Q82R 3CCMA 1D1CA 2RQTA 3E2UA 2E3HA 1NYFA 1VQ5Q 5I2MA 2ESWA 1WJSA 3TCJA 5KYXA 2P4TA 1AVZC 1D0ZA 2PU9B 2YDLA 2AHJB 2ED0A 2HBPA 3HFOA 2LX7A 4LD9K 2DL5A 4CC3A 2CH4A 1YITT 4OMQA 1VQ8T 1ARKA 2FPFA 1IHVA 2L3SA 4LUEA 2RMOA 1QP3A 1MNDA 4M78G 2W0ZA 1K73C 3EG3A 2FRYA 3EFOB 4HCCA 4C5GA 3FC3A 3X26B 3OS5A 1VQNA 3S3NA 3THKA 4X9DA 1AEYA 1N9SA 1VQNT 3NTKA 2LJ1A 2EQMA 4KGXB 1QQJA 4DBHA 1GFDA 1H3HA 1TUCA 2FYKA 2YRCA 3AHUA 3GNFB 2D8HA 2E4HA 1Q86C 2DX1A 2FPDA 3OYGA 2H3EB 3CCET 3ZL7C 2RHZA 1YJNA 3META 5HKCA 4KGVB 5GANf 3TQ7P 2KVQG 2OTJA 2I0NA 1G3YA 2HNIA 1PD1A 3DKMA 3GBQA 1YIJQ 2XD0A 2M02A 5GAN5 5KYYA 2PQWA 2FZGB 2K9GA 2VYTA 1TH7A 5DM7R 3INZA 3PNWC 2JN0A 2OJ2A 2ZPBB 1RACB 3QYHB 2V1QA 3VS2A 4DBRA 3SEMA 3VYHB 1FXXA 2E3IA 2EPDA 3V8KA 2J06A 3E9GA 5CKDA 4ZN3A 3X20B 1RABB 1WHGA 2PVOB 1WJRA 1BU1A 5GAOn 2EYQA 1VOMA 4ME7A 1WNLA 3CMEQ 5D7UA 4AG2C 4XU1A 3OYEA 4J9GA 1OYXA 2E1HA 3VS7A 1ZX6A 2RHUA 2DL4A 2YSQA 5D6YA 3GIBA 5IHKA 1VQ7A 1TWBA 1LJOA 4M78E 2CT3A 3QPHA 4HT9A 1VQ9Q 3CMAT 1VQ7T 5CO7A 2MMPA 2VGMA 5LL6S 3L2WA 4TVRA 3CD6Q 1QVGA 2LQNA 2COWA 1N9RA 1M5Q1 3C0CA 3GP8A 4OP0A 3FLGA 1RLQC 2RJDA 1ZSZA 1UGQB 4BDYA 5GMKl 5CVIA 1BCMA 2GGRA 5HK3A 1RAFB 4HVUA 2V8KA 4EDUA 3CCVQ 1Y57A 3G6EQ 5A0LA 3SD4A 2ZPGB 2JUFA 3LYIA 4X1VA 1M90U 3JB9G 2LNVA 2M0YA 1EIFA 3VS3A 2A28A 2OAWA 2PUOB 2EGCA 4QT7A 1WDXA 2FPEA 1IB8A 3EGDA 1HJDA 3CCUA 1YFNA 4DQ2A 3O5ZA 4M77A 2HL3A 2K2VA 4FYWB 2O9SA 1NEGA 1NLPC 3OYMA 4IUUA 4N4HA 2DBKA 4M7AG 4MZPA 2L2PA 2EYZA 1YI2A 2RA2A 3PVQA 1DJ7B 2R58A 3EGDB 1LCKA 2DYIA 1MGQA 1TOVA 2CP5A 4A4GA 1NLOC 3RKYA 1OEBA 3I55T 3M0UA 3V7SA 1VQPA 2J6OA 1RADB 2E10A 1KQ1A 1ZUKA 5KYNA 2VGNA 1T3SA 3M59A 3L2RA 2EQUA 1I5OB 3CC4Q 2CP7A 2YUQA 1WQ7A 2DETA 1GCQA 1ZA2B 3CCLT 1ZSZC 2X4XA 1JJ2S 3CCRQ 4GLKA 1WI7A 3A8HB 2F2XA 2MK5A 1JEGA 1M1GA 5GANj 4RCCA 3JCMe 1PM3A 3JCMJ 3KFVA 3SB2A 2NUPA 3HRSA 3MEVA 1VQOQ 4IUTA 2FZKB 1TG0A 1YHQA 3OYYA 1SSHA 1D3BA 4M77C 2JMAA 2D6FA 2OTLT 2DZ9A 1SPKA 5LJ3f 1EZZB 1ZLMA 1C1AA 2G6FX 1PKSA 2EYWA 1G3TA 2YUOA 4DA4A 2LMJA 2NUPB 3QWYA 3EG9B 3CC2A 1PKTA 5A2QE 3FJ5A 2KY9A 5GAN2 1K73R 4M7AE 1U1TA 2X9HA 1VYUA 3CC2T 5FWBA 3V7CA 2NUZA 1UDLA 4C5HA 4PJOA 2XDBA 1JRIA 3QIIA 2E64A 1KC8C 1VQLT 2X35A 2DL3A 1NG2A 3EG1A 3QJYA 4KT0E 1K0SA 3A8OB 3C4SA 1Q86R 1YJ9A 1YITQ 1KQSA 1Q7YC 1VQ8Q 2KBTA 3M56A 1Z9ZA 2QA4T 3SDZA 4L6V5 2CDTA 5FU7B 3CPWA 3JB9D 3OSSC 3S3OA 1IO6A 2DEQA 1VQNQ 2DTHA 2CZ7B 2JTMA 4C0DB 2C0OA 1Q95G 3JB9F 5D6WA 2DL7A 3F70A 4EMKB 4PK4A 2D0NA 4LNPA 4R0KA 1K8AC 4F7UG 2LJ0A 5GAMe 2CGHA 1VQKT 2F5KA 4M7AD 3CCEQ 1OPKA 1D0XA 4RTUA 4XTXA 3H0FA 2E5QA 4XU2A 1M27C 2KE9A 3VS4A 3L2ZA 1BIAA 4C92A 2DJZA 1WIEA 3NPFA 3VJPA 2HMAA 4M7AF 3BDLA 1VQ4Q 2HQHA 1AWWA 4M7DG 8ATCB 4JJNK 1VUBA 5FU7C 1AT1B 1X27A 2FZCB 3AT1B 4LDUA 3ZFJA 1S72A 2ZPIB 2VUBA 2XDDA 2RH2A 1E7OA 1R0CB 2HD0A 4BE0A 2BIVA 1VYTA 3LGFA 2WSEE 4Z88A 5A0GA 4OVAA 1NPRA 2BTTA 1W1FA 4AMCA 1X6GA 2YLBA 3OBYA 1JJ2A 3DB4A 2YT6A 5EG2A 3M4YA 3OW2S 2M9UA 4M75B 3JCMh 1NJIU 2FO0A 3HRTA 4LXCA 4PNOA 1TUDA 4BDZA 3UA7A 3A5ZB 4ZGDB 4HVWA 1PSFA 1IRXA 1BI0A 5AT1B 4A4HA 1JJ2P 4R55A 3CMAQ 1VQ7Q 4E7ZA 2O9VA 5I11A 3TVTA 3OMGA 2FRWA 3PIOA 2ECZA 1M3BA 1M8MA 1JO8A 1N5ZA 3DLLA 1M1KU 4LD6A 4LE9A 3HKSA 4FYYB 5HCKA 3ZEHA 2MWOA 1WHLA 5LJ5e 2ROLA 4E7LA 4JJBA 4F7UE 3G4ST 3RKXA 1PD0A 3LLRA 5HK0A 5GANg 3GPLA 2JTFA 3TU4K 5I2SA 1HK9A 4J9DA 2YUNA 2JT4A 5DLQE 5GMKe 4PLIA 5LJ3j 3OYBA 2XU8A 4NOYA 3UWNA 2GTJA 4M75C 1VQMA 1U5SA 2EVRA 1X43A 4M7DE 4O6JA 2P84A 1GL5A 1RAGB 2BUDA 4RTTA 1EFNA 1YN8A 2H8HA 4R56A 3CBOA 1MV0B 1OX9A 1SEMA 5GAN7 1PRMC 2EBPA 4ZNXA 1Y96A 3L2VA 3KBGA 3OMCA 4II1A 2ZGWA 3S6WA 5CR2A 2L3RA 1B7TA 3MP6A 2AK5A 4XTVA 3TSWA 5DY9A 3QG1A 3IQLA 1P92A 3QSUA 2LZ6B 1RL2A 3EGXB 2L5QA 4C5EA 1PHTA 3CXCS 1GRIA 3D7SB 4X9CA 4XTUA 1Y96B 3I55Q 2DPPB 4ELYC 3OBWA 4N4IA 1JB0E 2RK2A 1BKBA 1WHHA 1M1FA 2EJ9A 4J7IA 3I5SA 3M0SA 1NBEB 4HCBA 2F1LA 2GTOA 1YCYA 1AZEA 1MMNA 4PL6A 3CCLQ 2DERA 1IHWA 4IIOA 1M4ZA 4GY5A 3RIRA 4E7HA 3RMSA 1HXDA 2MIOA 3M58A 1K1ZA 2CH4W 4XTWA 2COZA 3QJ6A 4M7DD 2F2VA 1M8VA 1KD1R 1UTIA 3CCMT 3EFOA 4JDSA 2HKNA 1Q81C 2VXFA 3CCJA 2JNGA 3LH0A 3QUIA 4KBMB 1K9MC 2X51A 5KCOA 3OYFA 2KYBA 1KC8R 2YRVA 4M7DF 4XTZA 4J9HA 3R6NA 5GAOl 4L59A 2AZVA 2HQEA 1QCFA 2R5AA 3NFCA 4FYVB 2OTLQ 3A8GB 4A4KA 3OW2A 3MKDA 1Q7YR 2KT1A 2PVDB 5IHNA 4MMKA 2O88A 1RI0A 3URGA 3FEOA 4Y92A 4RG2A 5GAN6 3V8JA 1VQ6A 4Q5WA 2LRQA 1KQ2A 1FWZA 1ZA1B 5J26A 4J9CA 4AFZC 1D0YA 2LDMA 3FRNA 3GF5A 5LJ5h 1VQLQ 3OYNA 2EJGA 1VIEA 3HSBA 1UECA 1I4K1 1ZUUA 5GMKh 2K3YA 1YJNT 2MPXC 1K8AR 5FRNA 4FW1A 2OTJT 1G8XA 5KE2A 1PWTA 2QA4Q 1M30A 2GQIA 2ENMA 2A37A 1NYGA 2DKGA 1RAAB 1E6GA 1MUZA 2E6NA 1HD3A 2CREA 1I0CA 1E6HA 1UUEA 5GAOp 4GBQA 3C12A 2JMCA 3RDVA 4FL6A 2FEIA 4JLGA 2JM8A 3WVDB 1N8RR 2FHDA 1VQKQ 4UC4A 2QQRA 2A3LA 2J7IA 2CYZB 4WTOB 2KR3A 2P0QA 1KG1A 4DOVA 5LJ3g 2M0OA 2JXBA 2V8JA 4ZGEB 4JS4A 1UJYA 4M78B 2HEQA 4LDVA 2Y4YA 1H8KA 1QVPA 2XKOC 4EPCA 1KHCA 1N6AA 2R57A 1SHFA 2RN8A 4ORZA 3JCMX 4M77G 1R8OB 3RUXA 3CXCA 2K3BA 2HDAA 4FW2A 1NEBA 3I56A 4WCIA 3ER0A 4ZTJA 2K6DA 4KRTA 2DM1A 3O8VA 3EG0A 4GLMA 3JCMf 1KQSS 1G2BA 1QVGP 4IUPA 3HHTB 1TSFA 2X4WA 3CXCP 1ABOA 4C8QG 1QW1A 4PFZA 1ZBXA 3LGLA 2AIRB 3VRYA 3CCQA 4JJDA 4D6WA 1OZ3A 2DXUA 2RI2A 5C0MA 2LP5A 2XG8D 4FYXB 3CPWS 3JRZA 5FROA 3CCSA 2P0KA 3CCQT 1WLPB 3QDFA 4XQ3A 2L0AA 3L2QA 3RNJA 4RTXA 1KHIA 2DXTA 4A4FA 1Y0MA 2OX7A 3P8BB 1XQHA 2JTEA 4OMMA 2WACA 5IXBA 1ZUYA 2R5MA 1B07A 1M3CA 2DL8A 2QG9B 3PFSA 3G71A 2RM4A 3KUFA 3VRZA 4M78D 3CCUT 4J9FA 5CAIA 5J39A 1Y7XA 2MAMA 3R6OA 2DRKA 4OMOA 4JZ3A 1AWOA 2DE0X 3G4SQ 1YCSB 5CK9A 5GAN4 1SRLA 4M78F 1K76A 2KEAA 2YWWA 4DBQA 1YI2T 1BB9A 1I81A 2EKHA 3N5BB 4LUDA 5CKHA 3J81E 4A53A 2EWNA 3GNGA 2JS2A 4O5VA 3MEAA 5GJVB 3DLMA 4E6RA 4N0AC 2EJFA 1XNIA 4AT1B 4QQ6A 5D6XA 5KYWB 1X6OA 3RESA 2HAXA 2KAFA 1M90C 2H3JA 3QO3A 4RMOA 2HSPA 3E1SA 1VQPT 4M77E 2GNCA 2CP2A 3M4GA 2ABLA 1FMWA 3CPFA 2FB7A 1M2VB 4J6WA 4QW2A 2RD1A 3LWHA 4HA8A 5KYUA 1X6BA 4BD3A 4HCKA 1Q82U 4PJOG 4C0ZA 4F04B 1A0NB 1KD1U 4AFSC 4KUDK 4C8QE 1OULA 4IUVA 1AZGB 5L8RE 5GANd 4ANJA 7AT1B 4NL2A 2CKKA 3EG9A 1SKUB 1K4US 1NM7A 5GMKm 1VQ5A 3QWXX 1Q81R 2KRSA 5KYUB 2DAQA 1K9MR 1KSWA 1YHQT 3LWIA 3HFNA 1YNZA 4VUBA 2QI2A 3JSCA 3U23A 4KH1B 1W4SA 4LDXA 1MV3A 5FU6B 3V7RA 4JJCA 4Y91A 1QMCA 1U3OA 2MOXA 4M7AB 3JCMP 4BY6B 4IKFA 1SF9A 1MMGA 1OV3A 2IVWA 1WX6A 1QVFS 3NGPA 1W6XA 3CCMQ 2XDPA 2LVMA 1W70A 2KGTA 2K79A 2KK4A 2MYSA 3OQ5A 3OB9A 1QCNA 1BI1A 3CC7A 3BW1A 2DJQA 3NTIA 5KCHA 5IAYA 3CC7T 3OYKA 4C92G 4JZ4A 2CSIA 2RI3A 4C8QD 1YJ9T 1PSEA 1C6VX 5IHIA 4HT8A 4EMKA 3RBBB 1K9AA 3JCMc 2X3XD 1VIFA 2XI9A 1YIJA 1W2BS 4ESRA 4QQDA 3UA6A 3H6ZA 2Y4XA 2DBMA 4NL3A 5AYFA 1YIJT 4BI3A 4C8QF 1UGSB 2DTOA 2X4JA 1KQSP 2BKDN 4PJOE 3RKWA 1T0HA 2QQBA 5LJ5f 2BE9B 1V76A 5CKFA 4BE2A 4V2SA 1WJQA 4RTVA 3GOXA 4M7AC 4HCZA 1AHJB 4FM4B 4BE1A 4BY6C 1NE8A 3REBB 3CPWP 1O75A 1IXDA 1TU0B 1H641 4A63B 2JZ2A 5DLOA 2JM9A 1N8RU 2K3XA 1LNXA 2A0FB 5KH6A 2QQ9A 4XAXB 2K7AA 1PC0A 1YJNQ 3X24B 4JS5A 4OB0B 2OTJQ 3REAB 2MWPA 8AT1B 5GAOr 3VUBA 1AWXA 4FT2A 5L23A 2LCCA 2GFAA 2CSQA 2EGAA 4M75A 1VQ9A 1UHFA 3L42A 2CT4A 4QVCA 1SG5A 2J05A 3CD6A 2O31A 3A8LB 1S72T 1NPPA 2RQWA 2AZSA 1OI1A 4C0DC 2HQXA 1QKXA 4QQGA 1TUGB 4FSSA 4ZN1A 2FL7A 4PJOD 3NHNA 1ZBJA 4EMKC 2GBQA 1YP5A 3A8MB 2E12A 3HP9A 1M9SA 4C92E 2L89A 3I35A 3PMIA 3UDCA 4PJLA 1X75C 4J5YA 4X34A 2OI3A 2JOYA 4PJOF 1UHCA 2V26A 4B9XA 6AT1B 2ZZDA 3CCVA 2BZXA 3G6EA 3EFSA 2AT1B 3OYAA 3E19A 2V8IA 3G6ET 3FDRA 4ZTFA 4PKCC 4DBFA 5GAMj 4FIBA 1UG1A 1V1CA 3MO8A 1OZ2A 3EG2A 5IXFA 4L5GA 4EIKA 2K4YA 3DB3A 4J83A 2DA9A 2RQUA 4F7UB 4M7DA 2EYXA 3VV0A 3M0RA 4QVDA 2DVEA 1IGQA 1X69A 2KDSA 2IIMA 4IIMA 1NZ9A 1I5LA 2KMTA 5FLXE 3OY9A 1KFZA 3M0TA 2O4XB 2XK0A 2YXYA 5LJ3d 2L3PA 1NJIC 4Z02A 1QVFA 1OPLA 1WA7A 3CCQQ 4D8DA 1VQMT 1RAEB 2QGGA 3RR6A 4IUQA 5C6SA 1ZSGA 4C5IA 4LN2A 4M7DB 4PFOA 1YBYA 3JB9H 3PGGA 2A08A 1VA7A 3EGXA 4OB2B 3EHRA 1LVKA 4C92D 3MPUB 4CI0C 5M9OA 2EW3A 3CEYA 4PJNA 1QVFP 1MMDA 1M90R 3CC4A 4J9BA 4F17A 4RUGA 3CCUQ 4JUVA 1M1KC 2QXFA 2DD5A 2MF2A 2RQVA 4PLLA 4MMLA 4J6XA 2VASA 2CP0A 2COYA 4JPBW 1W2BA 1WHKA 3CCRA 2L8DA 1I07A 3TEEA 3C95A 2EIFA 3QZ5B 2EKOA 3QDRB 3EAEA 3LW5E 1YI2Q 3NMZC 2EGEA 4OMPA 3I9QA 3ZBDA 5GAMh 3BE3A 4EMGA 3H8ZA 4OMNA 3VS1A 1H92A 2CP3A 1QWFA 3EGUA 3LX7A 5CKEA 4E47A 4RTZA 5FRMA 2LCSA 1VQOA 4AFUC 1MHNA 3SFMA 2LT1A 1VQPQ 1M3AA 2EQJA 2QQAA 2QGFB 1VQOT 5LJ5j 9ATCB 2AKLA 4F7UF 4AG1C 1UGRB 4M7DC 3EH2A 1K73U 3JCMg 4E2FB 2VB6A 2HBWA 4OGEA 2RHXA 2ZPHB 3BY7A 3I5RA 5GMKj 3PE0A 1D1AA 2W10A 2ATCB 2M51A 1WPYA 3OYCA 2WSCE 3WXMB 4JRKA 1OX8A 4A54A 4MZTA 2DEUA 3CCJT 2DNUA 5GAN8 2RQRA 5GAN3 1Q86U 5GJWB 3MEWA 3PTAA 4OB3B 4XK8E 1QLYA 1YHQQ 2ZPEB 3MCAB 3SWNA 1IGUA 2M16A 4LDYA 1MMAA 2C0IA 2QTXA 3JCMQ 1YITA 1VQ8A 2DF6A 4OMLA 3UF4A 4E7SA 2P4RA 1S1NA 2L3QA 4BACA 2EYYA 1GFCA 3CC2Q 4PJMA 3VYGA 1D09B 2XIDA 3VKIA 3MJXA 1VQ6T 4OF1A 3OW2P 1XTDA 2PVGB 4JRIA 2BE7D 2DXBA 2CZ6B 5KYXB 1H3ZA 3BFMA 3SWNB 3M54A 4D8KA 2RJFA 1N27A 4J9EA 1D1BA 3FIFA 2K2MA 3ULRB 2JVVA 1HYOA 3PMTA 5IH2A 4YTLA 4J7FA 1RAHB 3CC7Q 1KIKA 2KSSA 3CCEA 1YJ9Q 5FWCA 2EFIA 2IG0A 1WGSA 2F5TX 1BIBA 2CUDA 4P5NA 3VU3C 1I8FA 1ZHIA 2DK3A 3OYHA 1JXMA 1TXQA 1X2QA 2LTOA 4HVVA 2NUTA 2WSFE 1VQ4A 3V8LA 1RLPC 1QP2A 2V1RA 4JLIA 1G3WA 4Z89A 5GAMg 4M78A 3VS5A 1U8RA 2D8JA 1VQ4T 1I1JA 3ME9A 3JCMb 1BI3A 1U1SA 1FX7A 1Z9QA 1JU5C 2BZYA 4FSXA 5FW9A 4RTWA 1LOJA 4BB7A 3M9QA 3SWNC 2NUTB 3CBPA 4MDXA 2VVKA 4CRIA 4MZMA 5I22A 5KYYB 5GAOm 1ABQA 3QBYA 3C94A 1G5VA 1KJWA 4N0AA 3JB9I 2DO3A 2O01E 2RHYA 2HSEB 2NYSA 2CS7A 3HTRA 4Y28E 4XU0A 3G7ZA 1RUWA 3CMAA 5CIUA 3HPWA 3HRUA 2DILA 3I56T 1WXUA 1K0XA 1WXTA 2YLCA 4J6YA 1S72Q 3HL8A 1RAIB 3BDUA 2K5FA 4Z8AA 2HCKA 2EQIA 2LC4A 2F2WA 1WYXA 2QDYB 2QEXA 2KI7A 3L1AA 2QK0A 1B3QA 3OS1A 2VC8A 2QEXT 1WQWA 2D1XA 2QYZA 3CCST 4LDWA 1RI9A 4M78C 1NJIR 5LJ5g 3J7AF 2HL5C 2K57A 1LPLA 5GANe 3M0QA 1AD5A 2P0PA 4RTYA 4OB1B 2LQKA 3G71T 3H0IA 5KYWA 4M4ZA 4NS5A 1VYVA 2LNHB 1ZSZB 5A0DA 3EFRA 5IN1A 3QZ9B 1M1KR 2KT8A 1M2VA 2KROA 5CCAA 1HSQA 2DVJA 1U06A 2X3WD 2LX9A 4JRPA 2E6ZA 2NWMA 3M55A 1QWEA 2XMFA 3JB9J 2E41A 2DMOA 1V29B 2NLUA 4KULA 4KGZB 1VQMQ 4C8QA 2HZYA 5ECAA 4BUGA 4FU6A 1YJWA 2OAUA 3E9FA 4M77B 3A1PA 3I55A 3JCMV 4XU3A 2VXEA 2PUKB 1YJWT 3VS0A 1J3TA 2J6FA 4KH0B 1WFWA 4RKUE 3CCLA 5GAMf 3JCMW 1PRLC 2E70A 1JXOA 2JW4A 2KNBB 4ATOA 4C8QB 1GBRA 3M5AA 3CQTA 2BZ8A 1OOTA 4DEXA 2GCXA 4HXJA 4M7AA 2FVUA 1KC8U 4RG8A 3UPUA 2VKNA 1VQ5T 2PTKA 1BYMA 2QDLA 1Y07A 3EH1A 2RJCA 5IT9E 4B6MA 1WZOA 3PT9A 1UFFA 2EAYA 1B34A 1C0MA 3M57A 4BI4A 4PJJA 1Q7YU 5EC7A 2OTLA 4OGCA 3PVLA 4QVZA 1WHMA 2E5KA 2RK1A 1R0BG 2ROTA 3H9NA 4M77D 1Q82C 2Y90A 2GFUA 2Z0WA 3EHQA 1TS9A 1KD1C 4PFPA 4EMHA 1PG5B 3MHXA 1XOVA 1B34B 2SRCA 4RCBA 2ED1A 4C8QC 3CCJQ 4ELZC 2VWFA 4M77F 2CZ0B 1D3BB 1WXBA 2LJ3A 1VQLA 1X2KA 2C06A 1YWPA 1K8AU 3WVEB 5CKBA 1SRMA 3TSZA 2KRMA 2A36A 1GXIE 3S3MA 2E65A 2KQWA 4HKEA 2VV5A 1IZ6A 4M75G 2JJ9A 3M0PA 2QA4A 3NTHA 1FMKA 1UB4A 1GCQC 3JCMd 4PJOB 4K11A 3H0HA 5GANh 5FU6C 2QAZA 3OYDA 2C0TA 2B8AA 4E7KA 1VQ6Q 2SEMA 3OYJA 1EX4A 2PNIA 4FT4A 3OSVA 4XTYA 4FCYA 5KE3A 3H41A 2MCNA 2F69A 1OQKA 4N4GA 1AWJA 3QKJA 2X4YA 3TREA 4B9WA 1XJWB 1PCXA 1T0JA 5GMKi 1QCOA 4F14A 3CMEA 1UEBA 1VQKA 3CMET 2RF0A 4KUIA 1BCOA 2XICA 2FG0A 1BI2A 1OU9A 3X28B 2QASA 1AOJA 1JQQA 2D9TA 4QKUA 2J6KA 3QHSA 2I2LA 3MEUA 2DLPA 1VQ9T 2D0QB 3VS6A 3JAME 2PZ1A 2DFUA 4DOWA 1ZQ1A 3Q1JA 5LJ3e 5GAOq 3CD6T 2K5IA 3FJPA 4PJOC 2CZ1B 4J8OA 1OU8A 4OMFB 1GBQA 2XHCA 2JS0A 3RERA 3FB9A 2GQVA 2RJEA 1SHGA 2B86A 2AKKA 2G3RA 3SHWA 1N8RC 2MI6A 4C92B 2K5LA 4CC4B 4J9IA 3OS2A 1BBZA 1F1BB 3P8DA 4F7UA 1KK7A 4M75E 3CCVT 3OA6A 5CQXA 2O4XA 1UJ0A 2LT4A 2ZCFB 2LQ8A 2LQWA 1O9SA 4A4EA 4ZGJB 1GCPA 2YHTA 5GAMd 3I56Q 1YWOA 1CKBA 3L2UA 2DRMA 2RNAA 4IURA 3MP1A 2ZPFB 3MP8A 4DEYA 5I21A 1ACMB 2RI5A 2YUPA 1CSKA 1G3SA 3OYIA 1UE9A 3G4SA 4BI8B 5J3BA 2DIQA 1MNEA 2QEXQ 3CCSQ 3X25B 4CC7A 4C92C 3CBMA 1M2OA 2QQSA 2KXDA 1T3LA 2HKQB 4F16A 1TTHB 3T9NA 4JRQA 5HY6A 4CC2A 3UATA 1FYNA 3G71Q 2QTVA 1G83A 3CC4T 1QKWA 1JBMA 3GLXA 2KXCA 3ASKA 3QXEB 4M75D 3LH5A 1IREB 4E7JA 4C92F 1R77A 3OS0A 3CCRT 4MDWA 2ZAEA 2IPOB 4WF2A 3UT1A 3PIPA 4M75F 4C0FA 2M1HA 2KYMA 1W2BP 2LCLA 1Q81U 2CP6A 3G1JA
chains in the Genus database with same CATH topology
4J6WA 4QW2A 3P8HA 3OYLA 1K9MU 2DJZA 4FSXA 3M53A 2RD1A 3LWHA 4HA8A 3VJPA 1UGPB 1LOJA 4BD3A 3M9QA 4BB7A 4M7AF 3BDLA 4C0GA 3SWNC 1Q82U 4PJOG 4C0ZA 2GF7A 3J80E 1SSFA 3CBPA 4MDXA 2DTIA 4CRIA 1QVGS 4M7DG 2DD4A 1KD1U 1Y71A 4MZMA 5LJ5d 4KUDK 2RHIA 4C8QE 2DXCA 5GAOm 4IUVA 5L8RE 5GANd 4JJNK 1VUBA 5FU7C 4NL2A 2CKKA 4E7IA 3ZFJA 4LDUA 5GMKm 3QBYA 1S72A 3C94A 2ZPIB 1VQ5A 2EQKA 1G5VA 2VUBA 2DIGA 2XDDA 2RH2A 2DZCA 4N0AA 2DO3A 2RB6A 2O01E 5CQYA 2RHYA 3JB9I 2CS7A 2HD0A 4BE0A 2BIVA 3LGFA 4Y28E 2WSEE 4XU0A 3G7ZA 5A0GA 3QYGB 3VUZA 4OVAA 1NPRA 5LJ3h 3CMAA 2DAQA 5CIUA 2YLBA 2A7YA 3HPWA 3HRUA 3OBYA 3DB4A 3RMQA 1YHQT 5EG2A 1JJ2A 3LWIA 3HFNA 3I56T 1X01A 4VUBA 3M4YA 2RO0A 3KXTA 3OW2S 2M9UA 4M75B 3JCMh 1NJIU 3CCMA 2QI2A 2YLCA 3JSCA 4J6YA 3HRTA 4PNOA 3HL8A 1W4SA 4LDXA 4BDZA 5I2MA 3BDUA 2K5FA 5FU6B 3V7RA 3A5ZB 1WJSA 4Y91A 4ZGDB 1PSFA 3TCJA 2P4TA 1BI0A 2LC4A 2PU9B 4M7AB 4A4HA 3JCMP 4BY6B 4R55A 4IKFA 2IVWA 2AHJB 2HBPA 2QDYB 3HFOA 2QEXA 4LD9K 1QVFS 3OMGA 3L1AA 3PIOA 3OS1A 2VC8A 2QEXT 1YITT 1WQWA 2XDPA 2LVMA 1VQ8T 3CCST 3DLLA 1M1KU 2KK4A 4LD6A 4M7DD 1QP3A 4LDWA 3HKSA 3OQ5A 3OB9A 4M78G 1K73C 3ZEHA 2MWOA 1BI1A 3CC7A 4M78C 3BW1A 5LJ5e 4C5GA 3FC3A 4HCCA 3NTIA 3X26B 3OS5A 5KCHA 5IAYA 5LJ5g 4E7LA 1VQNA 3J7AF 3CC7T 4F7UE 2K57A 3OYKA 3G4ST 5GANe 3RKXA 4C92G 3S3NA 3LLRA 2P0PA 2RI3A 5HK0A 5GANg 2JTFA 4C8QD 3GPLA 3TU4K 4X9DA 5I2SA 1YJ9T 1HK9A 1PSEA 1N9SA 2LQKA 3NTKA 4OB1B 3G71T 1VQNT 2EQMA 4HT8A 5DLQE 4EMKA 5GMKe 4NS5A 3JCMc 4PLIA 5LJ3j 3OYBA 2FYKA 1VIFA 2XI9A 2XU8A 5A0DA 3EFRA 1YIJA 1W2BS 4NOYA 5IN1A 3QZ9B 4QQDA 3AHUA 3GNFB 3UWNA 3H6ZA 2Y4XA 4M75C 4NL3A 1VQMA 5AYFA 1YIJT 1Q86C 4BI3A 4C8QF 1UGSB 2DTOA 2X4JA 2BKDN 4PJOE 3RKWA 3OYGA 2QQBA 5CCAA 3CCET 5LJ5f 2LX9A 4M7DE 5CKFA 4O6JA 4BE2A 2RHZA 1YJNA 4JRPA 3META 5HKCA 1WJQA 2E6ZA 5GANf 4V2SA 2BUDA 3GOXA 2KVQG 4M7AC 4HCZA 4R56A 1AHJB 2OTJA 4FM4B 4BE1A 3M55A 3CBOA 1NE8A 1G3YA 2HNIA 3DKMA 4BY6C 1O75A 3JB9J 1H641 2XD0A 2E41A 2NLUA 1V29B 5GAN7 5GAN5 4KULA 2JZ2A 5DLOA 2PQWA 4C8QA 3L2VA 1Y96A 1N8RU 2VYTA 3KBGA 1TH7A 3OMCA 2K3XA 2ZGWA 4FU6A 3INZA 4II1A 2L3RA 3S6WA 2OAUA 3E9FA 2JN0A 3PNWC 1LNXA 5CR2A 4M77B 1YJWA 5KH6A 3MP6A 2ZPBB 4XTVA 2QQ9A 4XU3A 2VXEA 3JCMV 3I55A 3QYHB 4XAXB 5DY9A 2PUKB 1YJWT 3X24B 4JS5A 3QG1A 1P92A 4OB0B 3QSUA 2MWPA 3VYHB 1FXXA 3V8KA 5GAOr 5CKDA 3E9GA 3VUBA 4ZN3A 4BUGA 3X20B 1RL2A 2PVOB 1WJRA 4FT2A 2L5QA 2LCCA 5GAOn 2GFAA 2EYQA 4C5EA 4ME7A 4RKUE 3CCLA 4M75A 5GAMf 3CXCS 3JCMW 2E70A 4X9CA 4C8QB 4XTUA 1Y96B 4ATOA 1VQ9A 3M5AA 1WNLA 3L42A 2DPPB 4ELYC 3OBWA 4N4IA 4QVCA 1JB0E 4XU1A 2RK2A 1BKBA 3OYEA 3CD6A 1M1FA 1OYXA 2GCXA 2E1HA 2EJ9A 4M7AA 3A8LB 2FVUA 1KC8U 4J7IA 1S72T 1NPPA 2RHUA 5D6YA 4RG8A 3UPUA 1VQ5T 1OI1A 4HCBA 3GIBA 4C0DC 1BYMA 1YCYA 2HQXA 1VQ7A 1LJOA 4M78E 4PL6A 4QQGA 3QPHA 4HT9A 1Y07A 2RJCA 4ZN1A 2FL7A 1M4ZA 4GY5A 3RIRA 5IT9E 1VQ7T 4E7HA 3CMAT 3RMSA 5CO7A 4PJOD 2MMPA 1HXDA 3PT9A 3M58A 4EMKC 4XTWA 2EAYA 2VGMA 1B34A 3A8MB 2E12A 3HP9A 1M9SA 3QJ6A 5LL6S 4C92E 2L89A 3M57A 3L2WA 3PMIA 3UDCA 4TVRA 4BI4A 1M8VA 1Q7YU 3CCMT 1QVGA 2OTLA 4OGCA 4JDSA 1Q81C 1X75C 2VXFA 4J5YA 3CCJA 2JNGA 4X34A 4QVZA 3LH0A 1N9RA 3QUIA 4KBMB 1K9MC 2JOYA 4PJOF 4B9XA 3CCVA 2ZZDA 2RK1A 5KCOA 3EFSA 3G6EA 3OYFA 2YRVA 4M77D 1M5Q1 4M7DF 1Q82C 3GP8A 4XTZA 4OP0A 3OYAA 3E19A 2V8IA 3FLGA 5GAOl 3G6ET 2RJDA 2Y90A 3FDRA 2GFUA 4L59A 4ZTFA 4PKCC 1UGQB 1KD1C 2HQEA 2R5AA 3NFCA 4EMHA 3MHXA 4BDYA 1XOVA 5GMKl 1B34B 5GAMj 4FIBA 5CVIA 3A8GB 4A4KA 4RCBA 5GAMe 5HK3A 4C8QC 3MO8A 1OZ2A 3OW2A 2V8KA 4ELZC 4L5GA 2K4YA 3DB3A 4M77F 4EDUA 2CZ0B 1D3BB 1VQLA 4J83A 2C06A 5A0LA 3SD4A 2ZPGB 2JUFA 2PVDB 3LYIA 4MMKA 4F7UB 1RI0A 3VV0A 3WVEB 1K8AU 5CKBA 3JB9G 3URGA 1M90U 2LNVA 3FEOA 4QVDA 1GXIE 3S3MA 2DVEA 4RG2A 1EIFA 4RMOA 5GAN6 3V8JA 2E65A 4Q5WA 2KDSA 1VQ6A 2LRQA 1I5LA 1NZ9A 2KMTA 1KQ2A 5FLXE 2PUOB 3OY9A 2KQWA 4HKEA 1FWZA 2O4XB 2XK0A 2VV5A 1IZ6A 4M75G 5J26A 5LJ3d 1NJIC 1QVFA 4Z02A 3CCUA 4DQ2A 4M77A 2LDMA 2QA4A 2K2VA 3FRNA 3GF5A 3NTHA 5LJ5h 1UB4A 3JCMd 4PJOB 3OYNA 1VQMT 5C6SA 4IUQA 2EJGA 5GANh 5FU6C 3OYMA 1VIEA 3OYDA 4IUUA 4C5IA 4N4HA 3HSBA 4M7AG 4M7DB 2B8AA 4E7KA 4MZPA 1YBYA 3OYJA 3JB9H 3PGGA 4FT4A 1I4K1 4OB2B 3OSVA 4XTYA 5GMKh 2K3YA 4C92D 4CI0C 5KE3A 5M9OA 3CEYA 1YJNT 5FRNA 1YI2A 2RA2A 2OTJT 3CC4A 2F69A 4N4GA 1DJ7B 2R58A 3QKJA 4JUVA 5KE2A 1M1KC 2QXFA 1MGQA 2DD5A 2MF2A 2X4YA 3TREA 4PLLA 4MMLA 4B9WA 4J6XA 5GMKi 1W2BA 4A4GA 3CMEA 3CCRA 2L8DA 1UEBA 3RKYA 3TEEA 2DKGA 3I55T 1VQKA 3C95A 2EIFA 3QZ5B 3V7SA 2E6NA 2EKOA 3QDRB 3CMET 1VQPA 2E10A 1KQ1A 3EAEA 3LW5E 4KUIA 2VGNA 3M59A 3L2RA 2EQUA 3ZBDA 5GAMh 2XICA 4EMGA 3H8ZA 1BI2A 3X28B 1WQ7A 5GAOp 3C12A 2D9TA 3CCLT 2X4XA 5CKEA 3LX7A 4FL6A 4E47A 1JJ2S 5FRMA 3QHSA 2I2LA 3MEUA 4JLGA 3WVDB 4GLKA 2FHDA 1VQ9T 2D0QB 3A8HB 1VQOA 3JAME 1MHNA 3SFMA 2LT1A 4UC4A 2QQRA 2A3LA 2EQJA 2CYZB 2QQAA 4DOWA 1M1GA 1ZQ1A 3Q1JA 5LJ3e 2P0QA 5LJ5j 5GAOq 1VQOT 4DOVA 3CD6T 2K5IA 2M0OA 3FJPA 5LJ3g 4PJOC 1KG1A 2V8JA 2CZ1B 5GANj 4J8OA 4ZGEB 4F7UF 4OMFB 4JS4A 1UGRB 4RCCA 4M78B 3JCMe 4M7DC 2XHCA 3JCMJ 1K73U 3JCMg 3RERA 3FB9A 2GQVA 2RJEA 3SB2A 4OGEA 2RHXA 2ZPHB 3BY7A 4LDVA 3HRSA 5GMKj 2Y4YA 2G3RA 1QVPA 2XKOC 4EPCA 1KHCA 3MEVA 1N6AA 1WPYA 4IUTA 1N8RC 2MI6A 4C92B 2K5LA 3OYCA 2WSCE 2R57A 4JRKA 3WXMB 3OS2A 1YHQA 3JCMX 3OYYA 4M77G 1R8OB 3RUXA 3CXCA 1D3BA 4M77C 3I56A 2D6FA 4A54A 2OTLT 4MZTA 3ER0A 3P8DA 4F7UA 2DZ9A 5LJ3f 3CCJT 4ZTJA 4M75E 3O8VA 3CCVT 3OA6A 5GAN8 3JCMf 5GAN3 1Q86U 1KQSS 3MEWA 1G3TA 5CQXA 3PTAA 4OB3B 4DA4A 4XK8E 3CC2A 5A2QE 2O4XA 4IUPA 3HHTB 2LT4A 2KY9A 5GAN2 2X4WA 2ZCFB 2LQ8A 4C8QG 4M7AE 1QW1A 1O9SA 2ZPEB 1U1TA 3CC2T 1ZBXA 3MCAB 3SWNA 3V7CA 4A4EA 2YHTA 4ZGJB 3LGLA 5GAMd 3L2UA 2M16A 4D6WA 4C5HA 4LDYA 3CCQA 4PJOA 1OZ3A 2DXUA 2RI2A 2QTXA 5C0MA 3JCMQ 2XDBA 2XG8D 3CPWS 1JRIA 4IURA 1YITA 3JRZA 5FROA 1VQ8A 3MP1A 3CCSA 2P0KA 2ZPFB 3QIIA 2E64A 3MP8A 3CCQT 1KC8C 4XQ3A 3L2QA 5I21A 4BACA 1KHIA 2DXTA 4A4FA 1VQLT 2X35A 2RI5A 1G3SA 3P8BB 1XQHA 3QJYA 3VYGA 2WACA 2XIDA 3OYIA 3VKIA 1VQ6T 4KT0E 4OF1A 3G4SA 1XTDA 4BI8B 2R5MA 2PVGB 3A8OB 3C4SA 4JRIA 5J3BA 2DXBA 2CZ6B 1YJ9A 3PFSA 1H3ZA 3BFMA 2DIQA 3SWNB 3G71A 2RM4A 3KUFA 3M54A 1KQSA 2RJFA 1Q7YC 4M78D 1N27A 3CCUT 3X25B 3FIFA 3M56A 4C92C 2QA4T 5CAIA 2JVVA 5J39A 3CBMA 3PMTA 3SDZA 1Y7XA 2MAMA 4L6V5 4YTLA 2QQSA 3R6OA 4J7FA 5FU7B 4C92A 4M7DA 3CPWA 3JB9D 3OSSC 2KSSA 3T9NA 4JRQA 3S3OA 2DEQA 5HY6A 5CK9A 5GAN4 4M78F 3CCEA 2EFIA 1YI2T 2IG0A 1I81A 1WGSA 3N5BB 5CKHA 3J81E 2F5TX 3CC4T 2DTHA 4A53A 2EWNA 2CZ7B 2JTMA 3GNGA 1JBMA 4C0DB 4O5VA 3MEAA 3GLXA 1BIBA 3ASKA 3DLMA 3QXEB 4M75D 1IREB 4P5NA 4E7JA 4C92F 3VU3C 4N0AC 1I8FA 1ZHIA 2EJFA 3JB9F 2DK3A 3OYHA 1XNIA 5D6WA 4QQ6A 5D6XA 3F70A 2LTOA 3OS0A 1X6OA 4EMKB 3RESA 3CCRT 2HAXA 2WSFE 1K8AC 2KAFA 4MDWA 4F7UG 1VQ4A 1M90C 2H3JA 3QO3A 2CGHA 1QP2A 4WF2A 4JLIA 1G3WA 3V8LA 2F5KA 3UT1A 5GAMg 1VQKT 4M78A 3E1SA 4M7AD 1U8RA 1VQPT 3PIPA 1VQ4T 4M77E 4M75F 4XTXA 4C0FA 3M4GA 4XU2A 2E5QA 2M1HA 3ME9A 3JCMb 1BI3A 1U1SA 1FX7A 2LCLA 3CPFA 1Q81U 2FB7A 5DM7R 3L2ZA 1BIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6W A;  2DJZ A;  3JCM X;  4M77 G;  2RD1 A;  5LJ5 f;  4M77 F;  3RUX A;  4HA8 A;  1D3B B;  4M7D E;  1D3B A;  4M77 C;  1LOJ A;  5GAN f;  4A54 A;  4M7A F;  4V2S A;  4MMK A;  3SWN C;  4F7U B;  4PJO G;  4M7D A;  4F7U A;  4M7A C;  3JB9 G;  2DZ9 A;  5LJ3 f;  4QVD A;  2HNI A;  2DVE A;  4M75 E;  2DTI A;  5GAN 6;  3V8J A;  1H64 1;  2E65 A;  3JB9 J;  2E41 A;  4M7D G;  5LJ5 d;  1I5L A;  1KQ2 A;  4C8Q E;  5GAN 7;  5GAN 5;  5GAN 8;  5GAO m;  3JCM f;  5GAN 3;  5GAN d;  4C8Q A;  1Y96 A;  4NL2 A;  1TH7 A;  2ZGW A;  4M75 G;  3INZ A;  5LJ3 d;  5GMK m;  5GAN 2;  2JN0 A;  1LNX A;  4M77 B;  4DQ2 A;  4C8Q G;  4M77 A;  4M7A E;  4XTV A;  1U1T A;  4XU3 A;  2VXE A;  3JCM V;  5DY9 A;  3SWN A;  4N0A A;  2DZC A;  2YHT A;  2RB6 A;  3V7C A;  5LJ5 h;  5GAM d;  3JB9 I;  3JCM d;  4PJO B;  4PJO A;  2DXU A;  2QTX A;  4XU0 A;  2EJG A;  3JCM Q;  5GAN h;  3QSU A;  1JRI A;  3HSB A;  4M7A G;  3V8K A;  5GAO r;  4M7D B;  5LJ3 h;  2E64 A;  2YLB A;  3JB9 H;  4JRK A;  3PGG A;  4XQ3 A;  5I21 A;  1I4K 1;  2DXT A;  4XTY A;  3HFN A;  5GMK h;  4C92 D;  5GAO n;  1X01 A;  4M75 B;  3JCM h;  2RA2 A;  4M75 A;  5GAM f;  3JCM W;  4C92 B;  2YLC A;  4J6Y A;  4X9C A;  4C8Q B;  4XTU A;  1Y96 B;  4PNO A;  4JUV A;  1WNL A;  3BDU A;  1MGQ A;  3V7R A;  4QVC A;  4JRI A;  4Y91 A;  4MML A;  4XU1 A;  4J6X A;  3BFM A;  5GMK i;  3SWN B;  2RM4 A;  4M7A B;  2E1H A;  2EJ9 A;  4M7A A;  3JCM P;  4M78 D;  3RKY A;  3FIF A;  4C92 C;  2DKG A;  3HFO A;  5CAI A;  3GIB A;  3V7S A;  4M7A D;  1YCY A;  2E10 A;  1KQ1 A;  1LJO A;  3L1A A;  4M78 E;  4HT9 A;  4C92 A;  2VC8 A;  5GAO l;  1WQW A;  5GAM h;  3RIR A;  4PJO D;  4EMG A;  3JB9 D;  1HXD A;  4EMK C;  4XTW A;  2EAY A;  2DEQ A;  1WQ7 A;  4M78 G;  1B34 A;  4M78 F;  5GAN 4;  4M7D D;  4C92 E;  5GAO p;  1M8V A;  4M78 C;  1I81 A;  3BW1 A;  3QHS A;  2DTH A;  4A53 A;  5LJ5 e;  2I2L A;  2EWN A;  4M7D C;  1JBM A;  5LJ5 g;  2VXF A;  1BIB A;  4J5Y A;  4M75 D;  2K57 A;  4F7U E;  5GAN e;  3RKX A;  4C92 G;  4C92 F;  3VU3 C;  1N9R A;  3QUI A;  5GAN g;  4N0A C;  4C8Q D;  1I8F A;  4PJO F;  4X9D A;  2EJF A;  5LJ3 e;  5GAO q;  1HK9 A;  5LJ5 j;  3JB9 F;  1N9S A;  4PJO C;  3EFS A;  3FJP A;  5LJ3 g;  4EMK B;  4HT8 A;  3RES A;  4EMK A;  5GAN j;  4M77 D;  1M5Q 1;  4F7U G;  5GMK e;  4F7U F;  4M7D F;  3QO3 A;  4XTZ A;  2CGH A;  4OP0 A;  4WF2 A;  4JLI A;  4RCC A;  4M78 B;  3JCM c;  3V8L A;  5LJ3 j;  3JCM e;  2FYK A;  2Y90 A;  4M78 A;  5GAM g;  3JCM g;  3EFR A;  3JCM J;  3RER A;  3FB9 A;  4NOY A;  3SB2 A;  4EMH A;  3AHU A;  4M77 E;  3BY7 A;  4M75 F;  5GMK j;  5GMK l;  1B34 B;  4XTX A;  5GAM j;  3M4G A;  4XU2 A;  4M75 C;  3JCM b;  4NL3 A;  1U1S A;  4C8Q F;  1WPY A;  2DTO A;  4RCB A;  2FB7 A;  5GAM e;  4PJO E;  3RKW A;  4C8Q C;  3L2Z A;  1BIA A; 
#chains in the Genus database with same CATH topology
 2YRD A;  3P8H A;  3OYL A;  1K9M U;  2KRN A;  3M53 A;  1UGP B;  1UGV A;  4C0G A;  2RPN A;  2GF7 A;  3A98 A;  3J80 E;  1SSF A;  2DTI A;  4AFQ C;  1QVG S;  2DD4 A;  1Y71 A;  5LJ5 d;  1PNJ A;  2RHI A;  2DXC A;  2CUB A;  1YJW Q;  4E7I A;  2EQK A;  3JV3 A;  2DIG A;  2DZC A;  2RB6 A;  5CQY A;  3QYG B;  3VUZ A;  1FMV A;  5LJ3 h;  3RMQ A;  2A7Y A;  2DYB A;  2O2O A;  1BK2 A;  1WHJ A;  1X01 A;  1CKA A;  3KXT A;  2RO0 A;  1Q82 R;  3CCM A;  1D1C A;  2RQT A;  3E2U A;  2E3H A;  1NYF A;  1VQ5 Q;  5I2M A;  2ESW A;  1WJS A;  3TCJ A;  5KYX A;  2P4T A;  1AVZ C;  1D0Z A;  2PU9 B;  2YDL A;  2AHJ B;  2ED0 A;  2HBP A;  3HFO A;  2LX7 A;  4LD9 K;  2DL5 A;  4CC3 A;  2CH4 A;  1YIT T;  4OMQ A;  1VQ8 T;  1ARK A;  2FPF A;  1IHV A;  2L3S A;  4LUE A;  2RMO A;  1QP3 A;  1MND A;  4M78 G;  2W0Z A;  1K73 C;  3EG3 A;  2FRY A;  3EFO B;  4HCC A;  4C5G A;  3FC3 A;  3X26 B;  3OS5 A;  1VQN A;  3S3N A;  3THK A;  4X9D A;  1AEY A;  1N9S A;  1VQN T;  3NTK A;  2LJ1 A;  2EQM A;  4KGX B;  1QQJ A;  4DBH A;  1GFD A;  1H3H A;  1TUC A;  2FYK A;  2YRC A;  3AHU A;  3GNF B;  2D8H A;  2E4H A;  1Q86 C;  2DX1 A;  2FPD A;  3OYG A;  2H3E B;  3CCE T;  3ZL7 C;  2RHZ A;  1YJN A;  3MET A;  5HKC A;  4KGV B;  5GAN f;  3TQ7 P;  2KVQ G;  2OTJ A;  2I0N A;  1G3Y A;  2HNI A;  1PD1 A;  3DKM A;  3GBQ A;  1YIJ Q;  2XD0 A;  2M02 A;  5GAN 5;  5KYY A;  2PQW A;  2FZG B;  2K9G A;  2VYT A;  1TH7 A;  5DM7 R;  3INZ A;  3PNW C;  2JN0 A;  2OJ2 A;  2ZPB B;  1RAC B;  3QYH B;  2V1Q A;  3VS2 A;  4DBR A;  3SEM A;  3VYH B;  1FXX A;  2E3I A;  2EPD A;  3V8K A;  2J06 A;  3E9G A;  5CKD A;  4ZN3 A;  3X20 B;  1RAB B;  1WHG A;  2PVO B;  1WJR A;  1BU1 A;  5GAO n;  2EYQ A;  1VOM A;  4ME7 A;  1WNL A;  3CME Q;  5D7U A;  4AG2 C;  4XU1 A;  3OYE A;  4J9G A;  1OYX A;  2E1H A;  3VS7 A;  1ZX6 A;  2RHU A;  2DL4 A;  2YSQ A;  5D6Y A;  3GIB A;  5IHK A;  1VQ7 A;  1TWB A;  1LJO A;  4M78 E;  2CT3 A;  3QPH A;  4HT9 A;  1VQ9 Q;  3CMA T;  1VQ7 T;  5CO7 A;  2MMP A;  2VGM A;  5LL6 S;  3L2W A;  4TVR A;  3CD6 Q;  1QVG A;  2LQN A;  2COW A;  1N9R A;  1M5Q 1;  3C0C A;  3GP8 A;  4OP0 A;  3FLG A;  1RLQ C;  2RJD A;  1ZSZ A;  1UGQ B;  4BDY A;  5GMK l;  5CVI A;  1BCM A;  2GGR A;  5HK3 A;  1RAF B;  4HVU A;  2V8K A;  4EDU A;  3CCV Q;  1Y57 A;  3G6E Q;  5A0L A;  3SD4 A;  2ZPG B;  2JUF A;  3LYI A;  4X1V A;  1M90 U;  3JB9 G;  2LNV A;  2M0Y A;  1EIF A;  3VS3 A;  2A28 A;  2OAW A;  2PUO B;  2EGC A;  4QT7 A;  1WDX A;  2FPE A;  1IB8 A;  3EGD A;  1HJD A;  3CCU A;  1YFN A;  4DQ2 A;  3O5Z A;  4M77 A;  2HL3 A;  2K2V A;  4FYW B;  2O9S A;  1NEG A;  1NLP C;  3OYM A;  4IUU A;  4N4H A;  2DBK A;  4M7A G;  4MZP A;  2L2P A;  2EYZ A;  1YI2 A;  2RA2 A;  3PVQ A;  1DJ7 B;  2R58 A;  3EGD B;  1LCK A;  2DYI A;  1MGQ A;  1TOV A;  2CP5 A;  4A4G A;  1NLO C;  3RKY A;  1OEB A;  3I55 T;  3M0U A;  3V7S A;  1VQP A;  2J6O A;  1RAD B;  2E10 A;  1KQ1 A;  1ZUK A;  5KYN A;  2VGN A;  1T3S A;  3M59 A;  3L2R A;  2EQU A;  1I5O B;  3CC4 Q;  2CP7 A;  2YUQ A;  1WQ7 A;  2DET A;  1GCQ A;  1ZA2 B;  3CCL T;  1ZSZ C;  2X4X A;  1JJ2 S;  3CCR Q;  4GLK A;  1WI7 A;  3A8H B;  2F2X A;  2MK5 A;  1JEG A;  1M1G A;  5GAN j;  4RCC A;  3JCM e;  1PM3 A;  3JCM J;  3KFV A;  3SB2 A;  2NUP A;  3HRS A;  3MEV A;  1VQO Q;  4IUT A;  2FZK B;  1TG0 A;  1YHQ A;  3OYY A;  1SSH A;  1D3B A;  4M77 C;  2JMA A;  2D6F A;  2OTL T;  2DZ9 A;  1SPK A;  5LJ3 f;  1EZZ B;  1ZLM A;  1C1A A;  2G6F X;  1PKS A;  2EYW A;  1G3T A;  2YUO A;  4DA4 A;  2LMJ A;  2NUP B;  3QWY A;  3EG9 B;  3CC2 A;  1PKT A;  5A2Q E;  3FJ5 A;  2KY9 A;  5GAN 2;  1K73 R;  4M7A E;  1U1T A;  2X9H A;  1VYU A;  3CC2 T;  5FWB A;  3V7C A;  2NUZ A;  1UDL A;  4C5H A;  4PJO A;  2XDB A;  1JRI A;  3QII A;  2E64 A;  1KC8 C;  1VQL T;  2X35 A;  2DL3 A;  1NG2 A;  3EG1 A;  3QJY A;  4KT0 E;  1K0S A;  3A8O B;  3C4S A;  1Q86 R;  1YJ9 A;  1YIT Q;  1KQS A;  1Q7Y C;  1VQ8 Q;  2KBT A;  3M56 A;  1Z9Z A;  2QA4 T;  3SDZ A;  4L6V 5;  2CDT A;  5FU7 B;  3CPW A;  3JB9 D;  3OSS C;  3S3O A;  1IO6 A;  2DEQ A;  1VQN Q;  2DTH A;  2CZ7 B;  2JTM A;  4C0D B;  2C0O A;  1Q95 G;  3JB9 F;  5D6W A;  2DL7 A;  3F70 A;  4EMK B;  4PK4 A;  2D0N A;  4LNP A;  4R0K A;  1K8A C;  4F7U G;  2LJ0 A;  5GAM e;  2CGH A;  1VQK T;  2F5K A;  4M7A D;  3CCE Q;  1OPK A;  1D0X A;  4RTU A;  4XTX A;  3H0F A;  2E5Q A;  4XU2 A;  1M27 C;  2KE9 A;  3VS4 A;  3L2Z A;  1BIA A;  4C92 A;  2DJZ A;  1WIE A;  3NPF A;  3VJP A;  2HMA A;  4M7A F;  3BDL A;  1VQ4 Q;  2HQH A;  1AWW A;  4M7D G;  8ATC B;  4JJN K;  1VUB A;  5FU7 C;  1AT1 B;  1X27 A;  2FZC B;  3AT1 B;  4LDU A;  3ZFJ A;  1S72 A;  2ZPI B;  2VUB A;  2XDD A;  2RH2 A;  1E7O A;  1R0C B;  2HD0 A;  4BE0 A;  2BIV A;  1VYT A;  3LGF A;  2WSE E;  4Z88 A;  5A0G A;  4OVA A;  1NPR A;  2BTT A;  1W1F A;  4AMC A;  1X6G A;  2YLB A;  3OBY A;  1JJ2 A;  3DB4 A;  2YT6 A;  5EG2 A;  3M4Y A;  3OW2 S;  2M9U A;  4M75 B;  3JCM h;  1NJI U;  2FO0 A;  3HRT A;  4LXC A;  4PNO A;  1TUD A;  4BDZ A;  3UA7 A;  3A5Z B;  4ZGD B;  4HVW A;  1PSF A;  1IRX A;  1BI0 A;  5AT1 B;  4A4H A;  1JJ2 P;  4R55 A;  3CMA Q;  1VQ7 Q;  4E7Z A;  2O9V A;  5I11 A;  3TVT A;  3OMG A;  2FRW A;  3PIO A;  2ECZ A;  1M3B A;  1M8M A;  1JO8 A;  1N5Z A;  3DLL A;  1M1K U;  4LD6 A;  4LE9 A;  3HKS A;  4FYY B;  5HCK A;  3ZEH A;  2MWO A;  1WHL A;  5LJ5 e;  2ROL A;  4E7L A;  4JJB A;  4F7U E;  3G4S T;  3RKX A;  1PD0 A;  3LLR A;  5HK0 A;  5GAN g;  3GPL A;  2JTF A;  3TU4 K;  5I2S A;  1HK9 A;  4J9D A;  2YUN A;  2JT4 A;  5DLQ E;  5GMK e;  4PLI A;  5LJ3 j;  3OYB A;  2XU8 A;  4NOY A;  3UWN A;  2GTJ A;  4M75 C;  1VQM A;  1U5S A;  2EVR A;  1X43 A;  4M7D E;  4O6J A;  2P84 A;  1GL5 A;  1RAG B;  2BUD A;  4RTT A;  1EFN A;  1YN8 A;  2H8H A;  4R56 A;  3CBO A;  1MV0 B;  1OX9 A;  1SEM A;  5GAN 7;  1PRM C;  2EBP A;  4ZNX A;  1Y96 A;  3L2V A;  3KBG A;  3OMC A;  4II1 A;  2ZGW A;  3S6W A;  5CR2 A;  2L3R A;  1B7T A;  3MP6 A;  2AK5 A;  4XTV A;  3TSW A;  5DY9 A;  3QG1 A;  3IQL A;  1P92 A;  3QSU A;  2LZ6 B;  1RL2 A;  3EGX B;  2L5Q A;  4C5E A;  1PHT A;  3CXC S;  1GRI A;  3D7S B;  4X9C A;  4XTU A;  1Y96 B;  3I55 Q;  2DPP B;  4ELY C;  3OBW A;  4N4I A;  1JB0 E;  2RK2 A;  1BKB A;  1WHH A;  1M1F A;  2EJ9 A;  4J7I A;  3I5S A;  3M0S A;  1NBE B;  4HCB A;  2F1L A;  2GTO A;  1YCY A;  1AZE A;  1MMN A;  4PL6 A;  3CCL Q;  2DER A;  1IHW A;  4IIO A;  1M4Z A;  4GY5 A;  3RIR A;  4E7H A;  3RMS A;  1HXD A;  2MIO A;  3M58 A;  1K1Z A;  2CH4 W;  4XTW A;  2COZ A;  3QJ6 A;  4M7D D;  2F2V A;  1M8V A;  1KD1 R;  1UTI A;  3CCM T;  3EFO A;  4JDS A;  2HKN A;  1Q81 C;  2VXF A;  3CCJ A;  2JNG A;  3LH0 A;  3QUI A;  4KBM B;  1K9M C;  2X51 A;  5KCO A;  3OYF A;  2KYB A;  1KC8 R;  2YRV A;  4M7D F;  4XTZ A;  4J9H A;  3R6N A;  5GAO l;  4L59 A;  2AZV A;  2HQE A;  1QCF A;  2R5A A;  3NFC A;  4FYV B;  2OTL Q;  3A8G B;  4A4K A;  3OW2 A;  3MKD A;  1Q7Y R;  2KT1 A;  2PVD B;  5IHN A;  4MMK A;  2O88 A;  1RI0 A;  3URG A;  3FEO A;  4Y92 A;  4RG2 A;  5GAN 6;  3V8J A;  1VQ6 A;  4Q5W A;  2LRQ A;  1KQ2 A;  1FWZ A;  1ZA1 B;  5J26 A;  4J9C A;  4AFZ C;  1D0Y A;  2LDM A;  3FRN A;  3GF5 A;  5LJ5 h;  1VQL Q;  3OYN A;  2EJG A;  1VIE A;  3HSB A;  1UEC A;  1I4K 1;  1ZUU A;  5GMK h;  2K3Y A;  1YJN T;  2MPX C;  1K8A R;  5FRN A;  4FW1 A;  2OTJ T;  1G8X A;  5KE2 A;  1PWT A;  2QA4 Q;  1M30 A;  2GQI A;  2ENM A;  2A37 A;  1NYG A;  2DKG A;  1RAA B;  1E6G A;  1MUZ A;  2E6N A;  1HD3 A;  2CRE A;  1I0C A;  1E6H A;  1UUE A;  5GAO p;  4GBQ A;  3C12 A;  2JMC A;  3RDV A;  4FL6 A;  2FEI A;  4JLG A;  2JM8 A;  3WVD B;  1N8R R;  2FHD A;  1VQK Q;  4UC4 A;  2QQR A;  2A3L A;  2J7I A;  2CYZ B;  4WTO B;  2KR3 A;  2P0Q A;  1KG1 A;  4DOV A;  5LJ3 g;  2M0O A;  2JXB A;  2V8J A;  4ZGE B;  4JS4 A;  1UJY A;  4M78 B;  2HEQ A;  4LDV A;  2Y4Y A;  1H8K A;  1QVP A;  2XKO C;  4EPC A;  1KHC A;  1N6A A;  2R57 A;  1SHF A;  2RN8 A;  4ORZ A;  3JCM X;  4M77 G;  1R8O B;  3RUX A;  3CXC A;  2K3B A;  2HDA A;  4FW2 A;  1NEB A;  3I56 A;  4WCI A;  3ER0 A;  4ZTJ A;  2K6D A;  4KRT A;  2DM1 A;  3O8V A;  3EG0 A;  4GLM A;  3JCM f;  1KQS S;  1G2B A;  1QVG P;  4IUP A;  3HHT B;  1TSF A;  2X4W A;  3CXC P;  1ABO A;  4C8Q G;  1QW1 A;  4PFZ A;  1ZBX A;  3LGL A;  2AIR B;  3VRY A;  3CCQ A;  4JJD A;  4D6W A;  1OZ3 A;  2DXU A;  2RI2 A;  5C0M A;  2LP5 A;  2XG8 D;  4FYX B;  3CPW S;  3JRZ A;  5FRO A;  3CCS A;  2P0K A;  3CCQ T;  1WLP B;  3QDF A;  4XQ3 A;  2L0A A;  3L2Q A;  3RNJ A;  4RTX A;  1KHI A;  2DXT A;  4A4F A;  1Y0M A;  2OX7 A;  3P8B B;  1XQH A;  2JTE A;  4OMM A;  2WAC A;  5IXB A;  1ZUY A;  2R5M A;  1B07 A;  1M3C A;  2DL8 A;  2QG9 B;  3PFS A;  3G71 A;  2RM4 A;  3KUF A;  3VRZ A;  4M78 D;  3CCU T;  4J9F A;  5CAI A;  5J39 A;  1Y7X A;  2MAM A;  3R6O A;  2DRK A;  4OMO A;  4JZ3 A;  1AWO A;  2DE0 X;  3G4S Q;  1YCS B;  5CK9 A;  5GAN 4;  1SRL A;  4M78 F;  1K76 A;  2KEA A;  2YWW A;  4DBQ A;  1YI2 T;  1BB9 A;  1I81 A;  2EKH A;  3N5B B;  4LUD A;  5CKH A;  3J81 E;  4A53 A;  2EWN A;  3GNG A;  2JS2 A;  4O5V A;  3MEA A;  5GJV B;  3DLM A;  4E6R A;  4N0A C;  2EJF A;  1XNI A;  4AT1 B;  4QQ6 A;  5D6X A;  5KYW B;  1X6O A;  3RES A;  2HAX A;  2KAF A;  1M90 C;  2H3J A;  3QO3 A;  4RMO A;  2HSP A;  3E1S A;  1VQP T;  4M77 E;  2GNC A;  2CP2 A;  3M4G A;  2ABL A;  1FMW A;  3CPF A;  2FB7 A;  1M2V B;  4J6W A;  4QW2 A;  2RD1 A;  3LWH A;  4HA8 A;  5KYU A;  1X6B A;  4BD3 A;  4HCK A;  1Q82 U;  4PJO G;  4C0Z A;  4F04 B;  1A0N B;  1KD1 U;  4AFS C;  4KUD K;  4C8Q E;  1OUL A;  4IUV A;  1AZG B;  5L8R E;  5GAN d;  4ANJ A;  7AT1 B;  4NL2 A;  2CKK A;  3EG9 A;  1SKU B;  1K4U S;  1NM7 A;  5GMK m;  1VQ5 A;  3QWX X;  1Q81 R;  2KRS A;  5KYU B;  2DAQ A;  1K9M R;  1KSW A;  1YHQ T;  3LWI A;  3HFN A;  1YNZ A;  4VUB A;  2QI2 A;  3JSC A;  3U23 A;  4KH1 B;  1W4S A;  4LDX A;  1MV3 A;  5FU6 B;  3V7R A;  4JJC A;  4Y91 A;  1QMC A;  1U3O A;  2MOX A;  4M7A B;  3JCM P;  4BY6 B;  4IKF A;  1SF9 A;  1MMG A;  1OV3 A;  2IVW A;  1WX6 A;  1QVF S;  3NGP A;  1W6X A;  3CCM Q;  2XDP A;  2LVM A;  1W70 A;  2KGT A;  2K79 A;  2KK4 A;  2MYS A;  3OQ5 A;  3OB9 A;  1QCN A;  1BI1 A;  3CC7 A;  3BW1 A;  2DJQ A;  3NTI A;  5KCH A;  5IAY A;  3CC7 T;  3OYK A;  4C92 G;  4JZ4 A;  2CSI A;  2RI3 A;  4C8Q D;  1YJ9 T;  1PSE A;  1C6V X;  5IHI A;  4HT8 A;  4EMK A;  3RBB B;  1K9A A;  3JCM c;  2X3X D;  1VIF A;  2XI9 A;  1YIJ A;  1W2B S;  4ESR A;  4QQD A;  3UA6 A;  3H6Z A;  2Y4X A;  2DBM A;  4NL3 A;  5AYF A;  1YIJ T;  4BI3 A;  4C8Q F;  1UGS B;  2DTO A;  2X4J A;  1KQS P;  2BKD N;  4PJO E;  3RKW A;  1T0H A;  2QQB A;  5LJ5 f;  2BE9 B;  1V76 A;  5CKF A;  4BE2 A;  4V2S A;  1WJQ A;  4RTV A;  3GOX A;  4M7A C;  4HCZ A;  1AHJ B;  4FM4 B;  4BE1 A;  4BY6 C;  1NE8 A;  3REB B;  3CPW P;  1O75 A;  1IXD A;  1TU0 B;  1H64 1;  4A63 B;  2JZ2 A;  5DLO A;  2JM9 A;  1N8R U;  2K3X A;  1LNX A;  2A0F B;  5KH6 A;  2QQ9 A;  4XAX B;  2K7A A;  1PC0 A;  1YJN Q;  3X24 B;  4JS5 A;  4OB0 B;  2OTJ Q;  3REA B;  2MWP A;  8AT1 B;  5GAO r;  3VUB A;  1AWX A;  4FT2 A;  5L23 A;  2LCC A;  2GFA A;  2CSQ A;  2EGA A;  4M75 A;  1VQ9 A;  1UHF A;  3L42 A;  2CT4 A;  4QVC A;  1SG5 A;  2J05 A;  3CD6 A;  2O31 A;  3A8L B;  1S72 T;  1NPP A;  2RQW A;  2AZS A;  1OI1 A;  4C0D C;  2HQX A;  1QKX A;  4QQG A;  1TUG B;  4FSS A;  4ZN1 A;  2FL7 A;  4PJO D;  3NHN A;  1ZBJ A;  4EMK C;  2GBQ A;  1YP5 A;  3A8M B;  2E12 A;  3HP9 A;  1M9S A;  4C92 E;  2L89 A;  3I35 A;  3PMI A;  3UDC A;  4PJL A;  1X75 C;  4J5Y A;  4X34 A;  2OI3 A;  2JOY A;  4PJO F;  1UHC A;  2V26 A;  4B9X A;  6AT1 B;  2ZZD A;  3CCV A;  2BZX A;  3G6E A;  3EFS A;  2AT1 B;  3OYA A;  3E19 A;  2V8I A;  3G6E T;  3FDR A;  4ZTF A;  4PKC C;  4DBF A;  5GAM j;  4FIB A;  1UG1 A;  1V1C A;  3MO8 A;  1OZ2 A;  3EG2 A;  5IXF A;  4L5G A;  4EIK A;  2K4Y A;  3DB3 A;  4J83 A;  2DA9 A;  2RQU A;  4F7U B;  4M7D A;  2EYX A;  3VV0 A;  3M0R A;  4QVD A;  2DVE A;  1IGQ A;  1X69 A;  2KDS A;  2IIM A;  4IIM A;  1NZ9 A;  1I5L A;  2KMT A;  5FLX E;  3OY9 A;  1KFZ A;  3M0T A;  2O4X B;  2XK0 A;  2YXY A;  5LJ3 d;  2L3P A;  1NJI C;  4Z02 A;  1QVF A;  1OPL A;  1WA7 A;  3CCQ Q;  4D8D A;  1VQM T;  1RAE B;  2QGG A;  3RR6 A;  4IUQ A;  5C6S A;  1ZSG A;  4C5I A;  4LN2 A;  4M7D B;  4PFO A;  1YBY A;  3JB9 H;  3PGG A;  2A08 A;  1VA7 A;  3EGX A;  4OB2 B;  3EHR A;  1LVK A;  4C92 D;  3MPU B;  4CI0 C;  5M9O A;  2EW3 A;  3CEY A;  4PJN A;  1QVF P;  1MMD A;  1M90 R;  3CC4 A;  4J9B A;  4F17 A;  4RUG A;  3CCU Q;  4JUV A;  1M1K C;  2QXF A;  2DD5 A;  2MF2 A;  2RQV A;  4PLL A;  4MML A;  4J6X A;  2VAS A;  2CP0 A;  2COY A;  4JPB W;  1W2B A;  1WHK A;  3CCR A;  2L8D A;  1I07 A;  3TEE A;  3C95 A;  2EIF A;  3QZ5 B;  2EKO A;  3QDR B;  3EAE A;  3LW5 E;  1YI2 Q;  3NMZ C;  2EGE A;  4OMP A;  3I9Q A;  3ZBD A;  5GAM h;  3BE3 A;  4EMG A;  3H8Z A;  4OMN A;  3VS1 A;  1H92 A;  2CP3 A;  1QWF A;  3EGU A;  3LX7 A;  5CKE A;  4E47 A;  4RTZ A;  5FRM A;  2LCS A;  1VQO A;  4AFU C;  1MHN A;  3SFM A;  2LT1 A;  1VQP Q;  1M3A A;  2EQJ A;  2QQA A;  2QGF B;  1VQO T;  5LJ5 j;  9ATC B;  2AKL A;  4F7U F;  4AG1 C;  1UGR B;  4M7D C;  3EH2 A;  1K73 U;  3JCM g;  4E2F B;  2VB6 A;  2HBW A;  4OGE A;  2RHX A;  2ZPH B;  3BY7 A;  3I5R A;  5GMK j;  3PE0 A;  1D1A A;  2W10 A;  2ATC B;  2M51 A;  1WPY A;  3OYC A;  2WSC E;  3WXM B;  4JRK A;  1OX8 A;  4A54 A;  4MZT A;  2DEU A;  3CCJ T;  2DNU A;  5GAN 8;  2RQR A;  5GAN 3;  1Q86 U;  5GJW B;  3MEW A;  3PTA A;  4OB3 B;  4XK8 E;  1QLY A;  1YHQ Q;  2ZPE B;  3MCA B;  3SWN A;  1IGU A;  2M16 A;  4LDY A;  1MMA A;  2C0I A;  2QTX A;  3JCM Q;  1YIT A;  1VQ8 A;  2DF6 A;  4OML A;  3UF4 A;  4E7S A;  2P4R A;  1S1N A;  2L3Q A;  4BAC A;  2EYY A;  1GFC A;  3CC2 Q;  4PJM A;  3VYG A;  1D09 B;  2XID A;  3VKI A;  3MJX A;  1VQ6 T;  4OF1 A;  3OW2 P;  1XTD A;  2PVG B;  4JRI A;  2BE7 D;  2DXB A;  2CZ6 B;  5KYX B;  1H3Z A;  3BFM A;  3SWN B;  3M54 A;  4D8K A;  2RJF A;  1N27 A;  4J9E A;  1D1B A;  3FIF A;  2K2M A;  3ULR B;  2JVV A;  1HYO A;  3PMT A;  5IH2 A;  4YTL A;  4J7F A;  1RAH B;  3CC7 Q;  1KIK A;  2KSS A;  3CCE A;  1YJ9 Q;  5FWC A;  2EFI A;  2IG0 A;  1WGS A;  2F5T X;  1BIB A;  2CUD A;  4P5N A;  3VU3 C;  1I8F A;  1ZHI A;  2DK3 A;  3OYH A;  1JXM A;  1TXQ A;  1X2Q A;  2LTO A;  4HVV A;  2NUT A;  2WSF E;  1VQ4 A;  3V8L A;  1RLP C;  1QP2 A;  2V1R A;  4JLI A;  1G3W A;  4Z89 A;  5GAM g;  4M78 A;  3VS5 A;  1U8R A;  2D8J A;  1VQ4 T;  1I1J A;  3ME9 A;  3JCM b;  1BI3 A;  1U1S A;  1FX7 A;  1Z9Q A;  1JU5 C;  2BZY A;  4FSX A;  5FW9 A;  4RTW A;  1LOJ A;  4BB7 A;  3M9Q A;  3SWN C;  2NUT B;  3CBP A;  4MDX A;  2VVK A;  4CRI A;  4MZM A;  5I22 A;  5KYY B;  5GAO m;  1ABQ A;  3QBY A;  3C94 A;  1G5V A;  1KJW A;  4N0A A;  3JB9 I;  2DO3 A;  2O01 E;  2RHY A;  2HSE B;  2NYS A;  2CS7 A;  3HTR A;  4Y28 E;  4XU0 A;  3G7Z A;  1RUW A;  3CMA A;  5CIU A;  3HPW A;  3HRU A;  2DIL A;  3I56 T;  1WXU A;  1K0X A;  1WXT A;  2YLC A;  4J6Y A;  1S72 Q;  3HL8 A;  1RAI B;  3BDU A;  2K5F A;  4Z8A A;  2HCK A;  2EQI A;  2LC4 A;  2F2W A;  1WYX A;  2QDY B;  2QEX A;  2KI7 A;  3L1A A;  2QK0 A;  1B3Q A;  3OS1 A;  2VC8 A;  2QEX T;  1WQW A;  2D1X A;  2QYZ A;  3CCS T;  4LDW A;  1RI9 A;  4M78 C;  1NJI R;  5LJ5 g;  3J7A F;  2HL5 C;  2K57 A;  1LPL A;  5GAN e;  3M0Q A;  1AD5 A;  2P0P A;  4RTY A;  4OB1 B;  2LQK A;  3G71 T;  3H0I A;  5KYW A;  4M4Z A;  4NS5 A;  1VYV A;  2LNH B;  1ZSZ B;  5A0D A;  3EFR A;  5IN1 A;  3QZ9 B;  1M1K R;  2KT8 A;  1M2V A;  2KRO A;  5CCA A;  1HSQ A;  2DVJ A;  1U06 A;  2X3W D;  2LX9 A;  4JRP A;  2E6Z A;  2NWM A;  3M55 A;  1QWE A;  2XMF A;  3JB9 J;  2E41 A;  2DMO A;  1V29 B;  2NLU A;  4KUL A;  4KGZ B;  1VQM Q;  4C8Q A;  2HZY A;  5ECA A;  4BUG A;  4FU6 A;  1YJW A;  2OAU A;  3E9F A;  4M77 B;  3A1P A;  3I55 A;  3JCM V;  4XU3 A;  2VXE A;  2PUK B;  1YJW T;  3VS0 A;  1J3T A;  2J6F A;  4KH0 B;  1WFW A;  4RKU E;  3CCL A;  5GAM f;  3JCM W;  1PRL C;  2E70 A;  1JXO A;  2JW4 A;  2KNB B;  4ATO A;  4C8Q B;  1GBR A;  3M5A A;  3CQT A;  2BZ8 A;  1OOT A;  4DEX A;  2GCX A;  4HXJ A;  4M7A A;  2FVU A;  1KC8 U;  4RG8 A;  3UPU A;  2VKN A;  1VQ5 T;  2PTK A;  1BYM A;  2QDL A;  1Y07 A;  3EH1 A;  2RJC A;  5IT9 E;  4B6M A;  1WZO A;  3PT9 A;  1UFF A;  2EAY A;  1B34 A;  1C0M A;  3M57 A;  4BI4 A;  4PJJ A;  1Q7Y U;  5EC7 A;  2OTL A;  4OGC A;  3PVL A;  4QVZ A;  1WHM A;  2E5K A;  2RK1 A;  1R0B G;  2ROT A;  3H9N A;  4M77 D;  1Q82 C;  2Y90 A;  2GFU A;  2Z0W A;  3EHQ A;  1TS9 A;  1KD1 C;  4PFP A;  4EMH A;  1PG5 B;  3MHX A;  1XOV A;  1B34 B;  2SRC A;  4RCB A;  2ED1 A;  4C8Q C;  3CCJ Q;  4ELZ C;  2VWF A;  4M77 F;  2CZ0 B;  1D3B B;  1WXB A;  2LJ3 A;  1VQL A;  1X2K A;  2C06 A;  1YWP A;  1K8A U;  3WVE B;  5CKB A;  1SRM A;  3TSZ A;  2KRM A;  2A36 A;  1GXI E;  3S3M A;  2E65 A;  2KQW A;  4HKE A;  2VV5 A;  1IZ6 A;  4M75 G;  2JJ9 A;  3M0P A;  2QA4 A;  3NTH A;  1FMK A;  1UB4 A;  1GCQ C;  3JCM d;  4PJO B;  4K11 A;  3H0H A;  5GAN h;  5FU6 C;  2QAZ A;  3OYD A;  2C0T A;  2B8A A;  4E7K A;  1VQ6 Q;  2SEM A;  3OYJ A;  1EX4 A;  2PNI A;  4FT4 A;  3OSV A;  4XTY A;  4FCY A;  5KE3 A;  3H41 A;  2MCN A;  2F69 A;  1OQK A;  4N4G A;  1AWJ A;  3QKJ A;  2X4Y A;  3TRE A;  4B9W A;  1XJW B;  1PCX A;  1T0J A;  5GMK i;  1QCO A;  4F14 A;  3CME A;  1UEB A;  1VQK A;  3CME T;  2RF0 A;  4KUI A;  1BCO A;  2XIC A;  2FG0 A;  1BI2 A;  1OU9 A;  3X28 B;  2QAS A;  1AOJ A;  1JQQ A;  2D9T A;  4QKU A;  2J6K A;  3QHS A;  2I2L A;  3MEU A;  2DLP A;  1VQ9 T;  2D0Q B;  3VS6 A;  3JAM E;  2PZ1 A;  2DFU A;  4DOW A;  1ZQ1 A;  3Q1J A;  5LJ3 e;  5GAO q;  3CD6 T;  2K5I A;  3FJP A;  4PJO C;  2CZ1 B;  4J8O A;  1OU8 A;  4OMF B;  1GBQ A;  2XHC A;  2JS0 A;  3RER A;  3FB9 A;  2GQV A;  2RJE A;  1SHG A;  2B86 A;  2AKK A;  2G3R A;  3SHW A;  1N8R C;  2MI6 A;  4C92 B;  2K5L A;  4CC4 B;  4J9I A;  3OS2 A;  1BBZ A;  1F1B B;  3P8D A;  4F7U A;  1KK7 A;  4M75 E;  3CCV T;  3OA6 A;  5CQX A;  2O4X A;  1UJ0 A;  2LT4 A;  2ZCF B;  2LQ8 A;  2LQW A;  1O9S A;  4A4E A;  4ZGJ B;  1GCP A;  2YHT A;  5GAM d;  3I56 Q;  1YWO A;  1CKB A;  3L2U A;  2DRM A;  2RNA A;  4IUR A;  3MP1 A;  2ZPF B;  3MP8 A;  4DEY A;  5I21 A;  1ACM B;  2RI5 A;  2YUP A;  1CSK A;  1G3S A;  3OYI A;  1UE9 A;  3G4S A;  4BI8 B;  5J3B A;  2DIQ A;  1MNE A;  2QEX Q;  3CCS Q;  3X25 B;  4CC7 A;  4C92 C;  3CBM A;  1M2O A;  2QQS A;  2KXD A;  1T3L A;  2HKQ B;  4F16 A;  1TTH B;  3T9N A;  4JRQ A;  5HY6 A;  4CC2 A;  3UAT A;  1FYN A;  3G71 Q;  2QTV A;  1G83 A;  3CC4 T;  1QKW A;  1JBM A;  3GLX A;  2KXC A;  3ASK A;  3QXE B;  4M75 D;  3LH5 A;  1IRE B;  4E7J A;  4C92 F;  1R77 A;  3OS0 A;  3CCR T;  4MDW A;  2ZAE A;  2IPO B;  4WF2 A;  3UT1 A;  3PIP A;  4M75 F;  4C0F A;  2M1H A;  2KYM A;  1W2B P;  2LCL A;  1Q81 U;  2CP6 A;  3G1J A; 
#chains in the Genus database with same CATH homology
 4J6W A;  4QW2 A;  3P8H A;  3OYL A;  1K9M U;  2DJZ A;  4FSX A;  3M53 A;  2RD1 A;  3LWH A;  4HA8 A;  3VJP A;  1UGP B;  1LOJ A;  4BD3 A;  3M9Q A;  4BB7 A;  4M7A F;  3BDL A;  4C0G A;  3SWN C;  1Q82 U;  4PJO G;  4C0Z A;  2GF7 A;  3J80 E;  1SSF A;  3CBP A;  4MDX A;  2DTI A;  4CRI A;  1QVG S;  4M7D G;  2DD4 A;  1KD1 U;  1Y71 A;  4MZM A;  5LJ5 d;  4KUD K;  2RHI A;  4C8Q E;  2DXC A;  5GAO m;  4IUV A;  5L8R E;  5GAN d;  4JJN K;  1VUB A;  5FU7 C;  4NL2 A;  2CKK A;  4E7I A;  3ZFJ A;  4LDU A;  5GMK m;  3QBY A;  1S72 A;  3C94 A;  2ZPI B;  1VQ5 A;  2EQK A;  1G5V A;  2VUB A;  2DIG A;  2XDD A;  2RH2 A;  2DZC A;  4N0A A;  2DO3 A;  2RB6 A;  2O01 E;  5CQY A;  2RHY A;  3JB9 I;  2CS7 A;  2HD0 A;  4BE0 A;  2BIV A;  3LGF A;  4Y28 E;  2WSE E;  4XU0 A;  3G7Z A;  5A0G A;  3QYG B;  3VUZ A;  4OVA A;  1NPR A;  5LJ3 h;  3CMA A;  2DAQ A;  5CIU A;  2YLB A;  2A7Y A;  3HPW A;  3HRU A;  3OBY A;  3DB4 A;  3RMQ A;  1YHQ T;  5EG2 A;  1JJ2 A;  3LWI A;  3HFN A;  3I56 T;  1X01 A;  4VUB A;  3M4Y A;  2RO0 A;  3KXT A;  3OW2 S;  2M9U A;  4M75 B;  3JCM h;  1NJI U;  3CCM A;  2QI2 A;  2YLC A;  3JSC A;  4J6Y A;  3HRT A;  4PNO A;  3HL8 A;  1W4S A;  4LDX A;  4BDZ A;  5I2M A;  3BDU A;  2K5F A;  5FU6 B;  3V7R A;  3A5Z B;  1WJS A;  4Y91 A;  4ZGD B;  1PSF A;  3TCJ A;  2P4T A;  1BI0 A;  2LC4 A;  2PU9 B;  4M7A B;  4A4H A;  3JCM P;  4BY6 B;  4R55 A;  4IKF A;  2IVW A;  2AHJ B;  2HBP A;  2QDY B;  3HFO A;  2QEX A;  4LD9 K;  1QVF S;  3OMG A;  3L1A A;  3PIO A;  3OS1 A;  2VC8 A;  2QEX T;  1YIT T;  1WQW A;  2XDP A;  2LVM A;  1VQ8 T;  3CCS T;  3DLL A;  1M1K U;  2KK4 A;  4LD6 A;  4M7D D;  1QP3 A;  4LDW A;  3HKS A;  3OQ5 A;  3OB9 A;  4M78 G;  1K73 C;  3ZEH A;  2MWO A;  1BI1 A;  3CC7 A;  4M78 C;  3BW1 A;  5LJ5 e;  4C5G A;  3FC3 A;  4HCC A;  3NTI A;  3X26 B;  3OS5 A;  5KCH A;  5IAY A;  5LJ5 g;  4E7L A;  1VQN A;  3J7A F;  3CC7 T;  4F7U E;  2K57 A;  3OYK A;  3G4S T;  5GAN e;  3RKX A;  4C92 G;  3S3N A;  3LLR A;  2P0P A;  2RI3 A;  5HK0 A;  5GAN g;  2JTF A;  4C8Q D;  3GPL A;  3TU4 K;  4X9D A;  5I2S A;  1YJ9 T;  1HK9 A;  1PSE A;  1N9S A;  2LQK A;  3NTK A;  4OB1 B;  3G71 T;  1VQN T;  2EQM A;  4HT8 A;  5DLQ E;  4EMK A;  5GMK e;  4NS5 A;  3JCM c;  4PLI A;  5LJ3 j;  3OYB A;  2FYK A;  1VIF A;  2XI9 A;  2XU8 A;  5A0D A;  3EFR A;  1YIJ A;  1W2B S;  4NOY A;  5IN1 A;  3QZ9 B;  4QQD A;  3AHU A;  3GNF B;  3UWN A;  3H6Z A;  2Y4X A;  4M75 C;  4NL3 A;  1VQM A;  5AYF A;  1YIJ T;  1Q86 C;  4BI3 A;  4C8Q F;  1UGS B;  2DTO A;  2X4J A;  2BKD N;  4PJO E;  3RKW A;  3OYG A;  2QQB A;  5CCA A;  3CCE T;  5LJ5 f;  2LX9 A;  4M7D E;  5CKF A;  4O6J A;  4BE2 A;  2RHZ A;  1YJN A;  4JRP A;  3MET A;  5HKC A;  1WJQ A;  2E6Z A;  5GAN f;  4V2S A;  2BUD A;  3GOX A;  2KVQ G;  4M7A C;  4HCZ A;  4R56 A;  1AHJ B;  2OTJ A;  4FM4 B;  4BE1 A;  3M55 A;  3CBO A;  1NE8 A;  1G3Y A;  2HNI A;  3DKM A;  4BY6 C;  1O75 A;  3JB9 J;  1H64 1;  2XD0 A;  2E41 A;  2NLU A;  1V29 B;  5GAN 7;  5GAN 5;  4KUL A;  2JZ2 A;  5DLO A;  2PQW A;  4C8Q A;  3L2V A;  1Y96 A;  1N8R U;  2VYT A;  3KBG A;  1TH7 A;  3OMC A;  2K3X A;  2ZGW A;  4FU6 A;  3INZ A;  4II1 A;  2L3R A;  3S6W A;  2OAU A;  3E9F A;  2JN0 A;  3PNW C;  1LNX A;  5CR2 A;  4M77 B;  1YJW A;  5KH6 A;  3MP6 A;  2ZPB B;  4XTV A;  2QQ9 A;  4XU3 A;  2VXE A;  3JCM V;  3I55 A;  3QYH B;  4XAX B;  5DY9 A;  2PUK B;  1YJW T;  3X24 B;  4JS5 A;  3QG1 A;  1P92 A;  4OB0 B;  3QSU A;  2MWP A;  3VYH B;  1FXX A;  3V8K A;  5GAO r;  5CKD A;  3E9G A;  3VUB A;  4ZN3 A;  4BUG A;  3X20 B;  1RL2 A;  2PVO B;  1WJR A;  4FT2 A;  2L5Q A;  2LCC A;  5GAO n;  2GFA A;  2EYQ A;  4C5E A;  4ME7 A;  4RKU E;  3CCL A;  4M75 A;  5GAM f;  3CXC S;  3JCM W;  2E70 A;  4X9C A;  4C8Q B;  4XTU A;  1Y96 B;  4ATO A;  1VQ9 A;  3M5A A;  1WNL A;  3L42 A;  2DPP B;  4ELY C;  3OBW A;  4N4I A;  4QVC A;  1JB0 E;  4XU1 A;  2RK2 A;  1BKB A;  3OYE A;  3CD6 A;  1M1F A;  1OYX A;  2GCX A;  2E1H A;  2EJ9 A;  4M7A A;  3A8L B;  2FVU A;  1KC8 U;  4J7I A;  1S72 T;  1NPP A;  2RHU A;  5D6Y A;  4RG8 A;  3UPU A;  1VQ5 T;  1OI1 A;  4HCB A;  3GIB A;  4C0D C;  1BYM A;  1YCY A;  2HQX A;  1VQ7 A;  1LJO A;  4M78 E;  4PL6 A;  4QQG A;  3QPH A;  4HT9 A;  1Y07 A;  2RJC A;  4ZN1 A;  2FL7 A;  1M4Z A;  4GY5 A;  3RIR A;  5IT9 E;  1VQ7 T;  4E7H A;  3CMA T;  3RMS A;  5CO7 A;  4PJO D;  2MMP A;  1HXD A;  3PT9 A;  3M58 A;  4EMK C;  4XTW A;  2EAY A;  2VGM A;  1B34 A;  3A8M B;  2E12 A;  3HP9 A;  1M9S A;  3QJ6 A;  5LL6 S;  4C92 E;  2L89 A;  3M57 A;  3L2W A;  3PMI A;  3UDC A;  4TVR A;  4BI4 A;  1M8V A;  1Q7Y U;  3CCM T;  1QVG A;  2OTL A;  4OGC A;  4JDS A;  1Q81 C;  1X75 C;  2VXF A;  4J5Y A;  3CCJ A;  2JNG A;  4X34 A;  4QVZ A;  3LH0 A;  1N9R A;  3QUI A;  4KBM B;  1K9M C;  2JOY A;  4PJO F;  4B9X A;  3CCV A;  2ZZD A;  2RK1 A;  5KCO A;  3EFS A;  3G6E A;  3OYF A;  2YRV A;  4M77 D;  1M5Q 1;  4M7D F;  1Q82 C;  3GP8 A;  4XTZ A;  4OP0 A;  3OYA A;  3E19 A;  2V8I A;  3FLG A;  5GAO l;  3G6E T;  2RJD A;  2Y90 A;  3FDR A;  2GFU A;  4L59 A;  4ZTF A;  4PKC C;  1UGQ B;  1KD1 C;  2HQE A;  2R5A A;  3NFC A;  4EMH A;  3MHX A;  4BDY A;  1XOV A;  5GMK l;  1B34 B;  5GAM j;  4FIB A;  5CVI A;  3A8G B;  4A4K A;  4RCB A;  5GAM e;  5HK3 A;  4C8Q C;  3MO8 A;  1OZ2 A;  3OW2 A;  2V8K A;  4ELZ C;  4L5G A;  2K4Y A;  3DB3 A;  4M77 F;  4EDU A;  2CZ0 B;  1D3B B;  1VQL A;  4J83 A;  2C06 A;  5A0L A;  3SD4 A;  2ZPG B;  2JUF A;  2PVD B;  3LYI A;  4MMK A;  4F7U B;  1RI0 A;  3VV0 A;  3WVE B;  1K8A U;  5CKB A;  3JB9 G;  3URG A;  1M90 U;  2LNV A;  3FEO A;  4QVD A;  1GXI E;  3S3M A;  2DVE A;  4RG2 A;  1EIF A;  4RMO A;  5GAN 6;  3V8J A;  2E65 A;  4Q5W A;  2KDS A;  1VQ6 A;  2LRQ A;  1I5L A;  1NZ9 A;  2KMT A;  1KQ2 A;  5FLX E;  2PUO B;  3OY9 A;  2KQW A;  4HKE A;  1FWZ A;  2O4X B;  2XK0 A;  2VV5 A;  1IZ6 A;  4M75 G;  5J26 A;  5LJ3 d;  1NJI C;  1QVF A;  4Z02 A;  3CCU A;  4DQ2 A;  4M77 A;  2LDM A;  2QA4 A;  2K2V A;  3FRN A;  3GF5 A;  3NTH A;  5LJ5 h;  1UB4 A;  3JCM d;  4PJO B;  3OYN A;  1VQM T;  5C6S A;  4IUQ A;  2EJG A;  5GAN h;  5FU6 C;  3OYM A;  1VIE A;  3OYD A;  4IUU A;  4C5I A;  4N4H A;  3HSB A;  4M7A G;  4M7D B;  2B8A A;  4E7K A;  4MZP A;  1YBY A;  3OYJ A;  3JB9 H;  3PGG A;  4FT4 A;  1I4K 1;  4OB2 B;  3OSV A;  4XTY A;  5GMK h;  2K3Y A;  4C92 D;  4CI0 C;  5KE3 A;  5M9O A;  3CEY A;  1YJN T;  5FRN A;  1YI2 A;  2RA2 A;  2OTJ T;  3CC4 A;  2F69 A;  4N4G A;  1DJ7 B;  2R58 A;  3QKJ A;  4JUV A;  5KE2 A;  1M1K C;  2QXF A;  1MGQ A;  2DD5 A;  2MF2 A;  2X4Y A;  3TRE A;  4PLL A;  4MML A;  4B9W A;  4J6X A;  5GMK i;  1W2B A;  4A4G A;  3CME A;  3CCR A;  2L8D A;  1UEB A;  3RKY A;  3TEE A;  2DKG A;  3I55 T;  1VQK A;  3C95 A;  2EIF A;  3QZ5 B;  3V7S A;  2E6N A;  2EKO A;  3QDR B;  3CME T;  1VQP A;  2E10 A;  1KQ1 A;  3EAE A;  3LW5 E;  4KUI A;  2VGN A;  3M59 A;  3L2R A;  2EQU A;  3ZBD A;  5GAM h;  2XIC A;  4EMG A;  3H8Z A;  1BI2 A;  3X28 B;  1WQ7 A;  5GAO p;  3C12 A;  2D9T A;  3CCL T;  2X4X A;  5CKE A;  3LX7 A;  4FL6 A;  4E47 A;  1JJ2 S;  5FRM A;  3QHS A;  2I2L A;  3MEU A;  4JLG A;  3WVD B;  4GLK A;  2FHD A;  1VQ9 T;  2D0Q B;  3A8H B;  1VQO A;  3JAM E;  1MHN A;  3SFM A;  2LT1 A;  4UC4 A;  2QQR A;  2A3L A;  2EQJ A;  2CYZ B;  2QQA A;  4DOW A;  1M1G A;  1ZQ1 A;  3Q1J A;  5LJ3 e;  2P0Q A;  5LJ5 j;  5GAO q;  1VQO T;  4DOV A;  3CD6 T;  2K5I A;  2M0O A;  3FJP A;  5LJ3 g;  4PJO C;  1KG1 A;  2V8J A;  2CZ1 B;  5GAN j;  4J8O A;  4ZGE B;  4F7U F;  4OMF B;  4JS4 A;  1UGR B;  4RCC A;  4M78 B;  3JCM e;  4M7D C;  2XHC A;  3JCM J;  1K73 U;  3JCM g;  3RER A;  3FB9 A;  2GQV A;  2RJE A;  3SB2 A;  4OGE A;  2RHX A;  2ZPH B;  3BY7 A;  4LDV A;  3HRS A;  5GMK j;  2Y4Y A;  2G3R A;  1QVP A;  2XKO C;  4EPC A;  1KHC A;  3MEV A;  1N6A A;  1WPY A;  4IUT A;  1N8R C;  2MI6 A;  4C92 B;  2K5L A;  3OYC A;  2WSC E;  2R57 A;  4JRK A;  3WXM B;  3OS2 A;  1YHQ A;  3JCM X;  3OYY A;  4M77 G;  1R8O B;  3RUX A;  3CXC A;  1D3B A;  4M77 C;  3I56 A;  2D6F A;  4A54 A;  2OTL T;  4MZT A;  3ER0 A;  3P8D A;  4F7U A;  2DZ9 A;  5LJ3 f;  3CCJ T;  4ZTJ A;  4M75 E;  3O8V A;  3CCV T;  3OA6 A;  5GAN 8;  3JCM f;  5GAN 3;  1Q86 U;  1KQS S;  3MEW A;  1G3T A;  5CQX A;  3PTA A;  4OB3 B;  4DA4 A;  4XK8 E;  3CC2 A;  5A2Q E;  2O4X A;  4IUP A;  3HHT B;  2LT4 A;  2KY9 A;  5GAN 2;  2X4W A;  2ZCF B;  2LQ8 A;  4C8Q G;  4M7A E;  1QW1 A;  1O9S A;  2ZPE B;  1U1T A;  3CC2 T;  1ZBX A;  3MCA B;  3SWN A;  3V7C A;  4A4E A;  2YHT A;  4ZGJ B;  3LGL A;  5GAM d;  3L2U A;  2M16 A;  4D6W A;  4C5H A;  4LDY A;  3CCQ A;  4PJO A;  1OZ3 A;  2DXU A;  2RI2 A;  2QTX A;  5C0M A;  3JCM Q;  2XDB A;  2XG8 D;  3CPW S;  1JRI A;  4IUR A;  1YIT A;  3JRZ A;  5FRO A;  1VQ8 A;  3MP1 A;  3CCS A;  2P0K A;  2ZPF B;  3QII A;  2E64 A;  3MP8 A;  3CCQ T;  1KC8 C;  4XQ3 A;  3L2Q A;  5I21 A;  4BAC A;  1KHI A;  2DXT A;  4A4F A;  1VQL T;  2X35 A;  2RI5 A;  1G3S A;  3P8B B;  1XQH A;  3QJY A;  3VYG A;  2WAC A;  2XID A;  3OYI A;  3VKI A;  1VQ6 T;  4KT0 E;  4OF1 A;  3G4S A;  1XTD A;  4BI8 B;  2R5M A;  2PVG B;  3A8O B;  3C4S A;  4JRI A;  5J3B A;  2DXB A;  2CZ6 B;  1YJ9 A;  3PFS A;  1H3Z A;  3BFM A;  2DIQ A;  3SWN B;  3G71 A;  2RM4 A;  3KUF A;  3M54 A;  1KQS A;  2RJF A;  1Q7Y C;  4M78 D;  1N27 A;  3CCU T;  3X25 B;  3FIF A;  3M56 A;  4C92 C;  2QA4 T;  5CAI A;  2JVV A;  5J39 A;  3CBM A;  3PMT A;  3SDZ A;  1Y7X A;  2MAM A;  4L6V 5;  4YTL A;  2QQS A;  3R6O A;  4J7F A;  5FU7 B;  4C92 A;  4M7D A;  3CPW A;  3JB9 D;  3OSS C;  2KSS A;  3T9N A;  4JRQ A;  3S3O A;  2DEQ A;  5HY6 A;  5CK9 A;  5GAN 4;  4M78 F;  3CCE A;  2EFI A;  1YI2 T;  2IG0 A;  1I81 A;  1WGS A;  3N5B B;  5CKH A;  3J81 E;  2F5T X;  3CC4 T;  2DTH A;  4A53 A;  2EWN A;  2CZ7 B;  2JTM A;  3GNG A;  1JBM A;  4C0D B;  4O5V A;  3MEA A;  3GLX A;  1BIB A;  3ASK A;  3DLM A;  3QXE B;  4M75 D;  1IRE B;  4P5N A;  4E7J A;  4C92 F;  3VU3 C;  4N0A C;  1I8F A;  1ZHI A;  2EJF A;  3JB9 F;  2DK3 A;  3OYH A;  1XNI A;  5D6W A;  4QQ6 A;  5D6X A;  3F70 A;  2LTO A;  3OS0 A;  1X6O A;  4EMK B;  3RES A;  3CCR T;  2HAX A;  2WSF E;  1K8A C;  2KAF A;  4MDW A;  4F7U G;  1VQ4 A;  1M90 C;  2H3J A;  3QO3 A;  2CGH A;  1QP2 A;  4WF2 A;  4JLI A;  1G3W A;  3V8L A;  2F5K A;  3UT1 A;  5GAM g;  1VQK T;  4M78 A;  3E1S A;  4M7A D;  1U8R A;  1VQP T;  3PIP A;  1VQ4 T;  4M77 E;  4M75 F;  4XTX A;  4C0F A;  3M4G A;  4XU2 A;  2E5Q A;  2M1H A;  3ME9 A;  3JCM b;  1BI3 A;  1U1S A;  1FX7 A;  2LCL A;  3CPF A;  1Q81 U;  2FB7 A;  5DM7 R;  3L2Z A;  1BIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...