1B34A

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34A00
3JCMf 4M78A 3JCMP 3JB9J 2CGHA 4NOYA 4M7DC 5LJ5e 2EWNA 4XTXA 2Y90A 5GANe 4PNOA 4J5YA 4C8QD 5LJ3d 4XTUA 2DZCA 1B34A 5GANf 5GAMd 3HFNA 2DEQA 3BFMA 4M75D 5GMKj 4XU0A 1Y96B 3BW1A 3L1AA 3EFSA 4A53A 5GAN5 4XTWA 3RERA 3BY7A 3JCMh 4PJOB 4NL2A 5GAOl 3RKYA 4C92D 2EJ9A 4PJOG 3V8LA 4PJOE 5LJ5h 3JCMW 1Y96A 3SB2A 2DTOA 3JCMb 1X01A 1BIAA 3L2ZA 4DQ2A 4N0AC 5GANh 4XQ3A 3V8KA 4J6WA 5LJ3e 5DY9A 3QO3A 3RKWA 4NL3A 1I5LA 4PJOC 4PJOA 5LJ3f 1H641 2DXTA 3JB9G 5GAN6 2RD1A 5GAMf 3JB9I 2HNIA 5CAIA 4MMLA 2QTXA 4M78D 2VC8A 4MMKA 3GIBA 4J6XA 4RCBA 4WF2A 4QVDA 1I4K1 4C8QF 5GAMj 4M7DD 3EFRA 2RM4A 1WQWA 2EJGA 3RIRA 1WQ7A 5GAOn 5GAOm 4M75F 2FYKA 4M75B 4JLIA 3INZA 5GMKe 4HA8A 2FB7A 4M75G 3SWNB 4OP0A 5GMKm 3JCMJ 4M75E 1N9SA 4X9CA 1BIBA 5GAOp 2DZ9A 3FB9A 1MGQA 4M7AD 4C92F 2YLBA 4QVCA 3JB9H 4M75A 4EMKB 2DTIA 1U1SA 2I2LA 3PGGA 4XTYA 3SWNC 3RKXA 4M77D 5GAMe 3SWNA 3V8JA 5GMKi 3JCMQ 2E64A 1HK9A 4HT9A 4M77F 1KQ2A 1I81A 1KQ1A 2JN0A 1LJOA 1U1TA 4PJOD 4JUVA 3V7SA 2DVEA 5GAOq 3M4GA 2ZGWA 4M78F 1N9RA 4C8QB 4EMKA 3JCMg 4F7UF 3FIFA 4F7UB 2DJZA 4M7DF 4M7DB 1LOJA 4C8QG 1M8VA 4N0AA 4C8QE 4Y91A 5I21A 3JB9D 4V2SA 2DXUA 2VXFA 3HFOA 5LJ5g 1I8FA 5LJ3h 3JCMX 5GANg 5GAN4 1JBMA 4M7DG 4M7DE 3QHSA 5LJ5j 1D3BB 5GAMh 2E10A 4C8QC 5GANj 5GAN3 2VXEA 4XU2A 4C8QA 3BDUA 5GAN2 4M75C 4C92B 4F7UA 2DTHA 4HT8A 1TH7A 4M7DA 2RB6A 4M7AF 3JCMd 4M7AB 1YCYA 5LJ5f 4C92G 2EAYA 4C92E 2RA2A 4M7AG 2E65A 1D3BA 5LJ5d 3QUIA 4M7AE 5GAOr 3AHUA 1LNXA 4M77B 3JCMV 5GANd 2E41A 5GMKh 4A54A 4RCCA 4C92C 2K57A 4C92A 4XTZA 4EMKC 4M7AC 4M77G 4M78B 4PJOF 1JRIA 4M7AA 4M77E 4JRKA 4XU1A 5LJ3g 2DKGA 3RUXA 4X9DA 3QSUA 4J6YA 5GAN8 2YHTA 3V7CA 4JRIA 4XTVA 4M78G 5LJ3j 5GAMg 4M78E 4EMGA 3FJPA 1B34B 4M77C 2EJFA 4XU3A 1WNLA 3V7RA 4M77A 1HXDA 4F7UG 4F7UE 2YLCA 5GMKl 3JCMc 1M5Q1 2E1HA 3JCMe 5GAN7 3HSBA 3JB9F 1WPYA 3RESA 4EMHA 4M78C 3VU3C
chains in the Genus database with same CATH superfamily
3LH0A 2CGHA 4FIBA 2HCKA 4XTXA 3CQTA 3CC4Q 2D6FA 1QWFA 2IVWA 3CBMA 1B34A 2X9HA 4XU0A 1PSFA 2DL7A 1FMKA 1MMNA 1YITA 4FYVB 3QXEB 5D6YA 2DAQA 2KGTA 3V8LA 1UDLA 2YUOA 1K4US 3SEMA 3CBPA 2HQXA 4LXCA 1K8AU 2VGNA 4E7SA 1XNIA 2GTJA 3O5ZA 3OB9A 3GIBA 4C8QF 3LX7A 2HMAA 2K79A 4IIOA 2V26A 3FEOA 1SHGA 4KGVB 5EC7A 1ZUYA 3CMAA 1SRMA 2DK3A 3A8OB 5KH6A 1G3WA 2O31A 5GMKi 1JXOA 4KT0E 1SG5A 5CCAA 4HT9A 2K2VA 4PJOD 2C0OA 2YRVA 3QJ6A 1WLPB 4FU6A 3TSZA 3X24B 1PHTA 1VQ7A 5GAN4 3MHXA 2MCNA 2DM1A 1I07A 1I0CA 3CCJQ 3S3OA 1VQKA 4M75C 3M58A 1NLOC 3HHTB 1UECA 4M7AB 1BI3A 3M0RA 1YHQQ 2VGMA 3H0IA 1LNXA 3RNJA 2KNBB 3UDCA 4KUDK 3WXMB 4LDYA 4ZN1A 1YFNA 2QA4Q 2YUPA 3OMGA 2EFIA 3R6NA 1NBEB 1LCKA 1UGVA 2DL8A 1VQLA 2YLCA 1IO6A 3JCMe 1WPYA 4X9CA 3JCMf 2YUQA 3KFVA 4MZPA 4OMOA 2RMOA 4PNOA 4C8QD 8ATCB 2HSEB 3HL8A 4B9WA 3CCEA 1R8OB 2V8JA 2AHJB 3CPFA 1PRMC 4KUIA 4BDYA 3EHRA 3CC2A 1G83A 1EZZB 2EQMA 4RUGA 1Y96A 2G6FX 1BIAA 4OB0B 4R0KA 1KHCA 3HTRA 2RHYA 1VQOA 5GAMf 3A8MB 2Y4XA 5HK3A 3G71T 1YI2T 2EYWA 1QP2A 2B86A 4AT1B 4F14A 9ATCB 1TUDA 2OTLT 3OW2A 1G3YA 2KAFA 5GAOp 1MGQA 5D7UA 1Y57A 1MMDA 5FU6B 1GFCA 4L59A 2DO3A 4ESRA 2GQIA 1FXXA 2AK5A 1WJSA 2LP5A 1W2BA 1HK9A 3AT1B 3HRSA 2QK0A 1B7TA 2RHZA 3JCMg 1OOTA 2ZPIB 2RI3A 4M7DB 1SHFA 2RF0A 5I21A 1D09B 2KI7A 5KCOA 3HFOA 5DM7R 1GFDA 1ABQA 2HD0A 2RJDA 1YJWT 5D6XA 3KBGA 3VS5A 3CCQT 3IQLA 1YCYA 5LJ5f 5L8RE 4C92E 2JS2A 4WTOB 3G4SA 4HKEA 1AD5A 2LQKA 3JSCA 1K9MC 4AFZC 3I56Q 4C92C 1RAEB 2DJQA 4M77E 1KC8U 2DKGA 3QG1A 5GAMg 2ESWA 2WACA 4M77C 1WNLA 5GAMj 1VQPA 1MHNA 1TS9A 1S72Q 1M90C 2BTTA 1UFFA 3OYMA 2Y90A 4QQGA 1P92A 2HQHA 1T0JA 2F5TX 5FRMA 2LCSA 3EFSA 4J9FA 4N4HA 3OYJA 1WHHA 1YBYA 2A28A 1WHKA 1G3SA 5GAOl 2EJ9A 3ULRB 3PE0A 1QKXA 2E5QA 3A8LB 3FLGA 4J9CA 3SB2A 1X01A 4C5GA 3OYCA 3V8KA 1X69A 2X4XA 4DBRA 3QO3A 2DL4A 2VASA 2V8KA 1Z9ZA 4OB3B 1V1CA 2EQJA 2LX9A 1EIFA 4WF2A 3CCVA 1VYUA 1QW1A 1VQ8Q 4HCBA 3A8GB 2EJGA 2D9TA 1VQ4Q 4JLIA 1VQMQ 8AT1B 1NG2A 3SHWA 1VYVA 3DB4A 3C12A 1Q82C 1BIBA 4JPBW 2QGGA 3OW2S 1RAFB 1G5VA 2CKKA 3A98A 4F04B 2XDBA 4JJDA 2I2LA 1YJ9A 2DXCA 3L2VA 3PIPA 2YUNA 5J39A 2YXYA 3E2UA 2DA9A 4F7UB 3GF5A 1C6VX 3CCSQ 3VS2A 2AT1B 2DXUA 1QVPA 1QCNA 3QYHB 3QHSA 1N6AA 1VIEA 2LNHB 3UT1A 4Y92A 3DLMA 3H8ZA 1YNZA 1ZHIA 4C0GA 1YJNQ 3VS6A 1RI0A 2RA2A 4D8KA 4R55A 1M2OA 2QQBA 2RQVA 1NM7A 5GMKh 2K57A 4XTZA 1ZUUA 4XU1A 3V7CA 4JRIA 4PFZA 3G6ET 3AHUA 4XU3A 1VQ6T 2C0IA 3RESA 4D8DA 3VU3C 1GCQA 4LD9K 2EGAA 2SEMA 2CP0A 2O4XA 2E4HA 5GJVB 4RTVA 2K4YA 3UWNA 5J3BA 1M3AA 1AT1B 4BE2A 3RERA 3VYHB 1AWXA 2HBWA 4JRQA 3MEUA 2EIFA 3RDVA 2L5QA 3X26B 3JCMW 4PJNA 3CCMQ 2GTOA 5KE3A 1RAAB 5LJ3e 5LJ3f 1LVKA 3CCRT 2M9UA 4L6V5 1VQ8A 4MMLA 1OV3A 3PFSA 3JRZA 4RG2A 1WQ7A 3OS1A 2ZCFB 2OTJA 3RMQA 1X75C 1YITT 4M75G 2R5AA 4OP0A 2W0ZA 5A0GA 2L0AA 2FEIA 2YLBA 3P8HA 3TSWA 1IREB 3ER0A 2DEUA 3QWXX 1JB0E 4Z8AA 2L3RA 2QYZA 2DVEA 2MPXC 1SSHA 2ZPEB 2RPNA 4RMOA 1EFNA 5KYWB 1B07A 1PNJA 3PTAA 1KIKA 2QQSA 2BUDA 5KYXA 1IHVA 2E10A 5GAN3 3BDUA 2P0QA 3CMAT 2HSPA 2LT4A 3RBBB 2FPEA 2DXBA 3EGDB 5A0LA 3LLRA 1GXIE 5FU6C 2LJ0A 4CC4B 1ZBJA 5LJ3g 3CC7Q 4J6YA 4BY6C 1X6OA 1OU9A 1RUWA 5LJ3j 5FROA 4ELYC 2CP3A 1K9MU 2LT1A 4ZTFA 3HSBA 1VQ7T 2M02A 4M78A 4M7DC 2DPPB 4OMPA 3I55T 2R57A 2DEQA 1JQQA 2EGEA 3EH1A 1QMCA 1PCXA 4AFUC 3FJ5A 3HPWA 3OYAA 5KYYA 1PG5B 3MO8A 1XQHA 4PJOG 5C0MA 1FMWA 3CCLA 4BB7A 1Q86R 2DBKA 3I9QA 1D1BA 4FSXA 4OF1A 1VQLT 2FVUA 1UGRB 1U3OA 4E7ZA 2VYTA 2Y4YA 3MPUB 4IIMA 4J6XA 4RCBA 2V1RA 1HD3A 4L5GA 2MK5A 3CCET 1H92A 4M75F 5LL6S 4LDUA 5CQXA 2PVDB 5M9OA 1TG0A 5IXFA 3M53A 2ROLA 3CC2T 2DTIA 1Q82U 4JZ4A 5KYUA 1KQ2A 1FYNA 1LJOA 1WYXA 2KR3A 3HKSA 1QCFA 5FU7C 1XTDA 1M1FA 3LYIA 2O2OA 2DJZA 4F17A 2KT8A 4C8QG 4JS4A 4Y91A 1Q86U 5CR2A 1QKWA 2LNVA 4C92B 2E6ZA 3VS1A 3NHNA 4RG8A 2EAYA 1NE8A 1NLPC 2MMPA 7AT1B 3OYDA 3J7AF 5FWBA 4M77B 1VQNT 5HY6A 1Y7XA 1UUEA 4IUQA 2KBTA 4E7LA 2MOXA 2RHIA 4BUGA 2JJ9A 1B34B 3CMEA 3QWYA 4F7UE 2JMCA 1M5Q1 1PM3A 5KE2A 2V8IA 5IT9E 2KT1A 2K3XA 1N27A 1WXUA 1UHCA 2D0NA 1X2QA 2LQWA 2XHCA 1K73R 1KG1A 4M75D 1M1KR 3S3MA 4A4HA 3G4ST 1KD1U 4OMFB 4AFQC 2COWA 4NL2A 2KVQG 2E3HA 3CPWS 2CYZB 2CUBA 2HL5C 2AZVA 4J6WA 1E6GA 2CZ7B 1VQPT 2KYMA 4A4GA 2CH4A 2JM8A 2HNIA 2JS0A 5FW9A 2YRCA 3URGA 4QVDA 2HQEA 2L3SA 2DMOA 1QVFP 1W4SA 2P0PA 2KRSA 3E9GA 3JCMJ 2PVOB 4J7FA 4F16A 2A7YA 2EVRA 2D8JA 4C92F 4PJJA 3PVQA 2RJFA 4KGXB 6AT1B 1JJ2P 3QKJA 3RR6A 2DL5A 1M1KU 4M77F 2JMAA 4J8OA 2MI6A 2RHUA 4AMCA 3L2WA 3CCVT 2DL3A 2COYA 2P0KA 2Z0WA 4O5VA 3THKA 4DOVA 4PLIA 2M0YA 3VRYA 2MWOA 4JJNK 4FL6A 5FRNA 1OEBA 5IH2A 1TOVA 1ACMB 2A08A 1MV0B 2GCXA 3OBYA 1YJ9T 5IHNA 4M7AG 3FC3A 2E41A 5HKCA 3CD6A 2X3XD 1Q81R 4M78E 1T0HA 2D8HA 4PJLA 1MNDA 2EYYA 2NYSA 4M78C 2O9VA 3E1SA 1JXMA 4EPCA 1Y07A 5GANe 4JDSA 5GANf 3OMCA 1PD1A 4ZN3A 2WSCE 4ME7A 1Y96B 3DB3A 3L1AA 2JT4A 5AYFA 4A53A 4VUBA 1ZSGA 3LGFA 1MV3A 2A36A 3OY9A 4C92D 2F2XA 5EG2A 4Z88A 1UB4A 1WHMA 2XICA 3CC4A 1U5SA 2PZ1A 3D7SB 2DXTA 1VQ5Q 2KYBA 2QG9B 1R0CB 2P4TA 2RI2A 3CCUT 4GBQA 2KY9A 4OB1B 1WGSA 5GAOn 2QEXQ 1Q81U 1VA7A 3INZA 5GMKe 2LDMA 1VQ9Q 1JEGA 2MWPA 1YIJT 2EKHA 1RLQC 2KQWA 1WI7A 1E7OA 5GAMe 4DBHA 3SWNA 4DEYA 3VRZA 1TXQA 1YP5A 2JTMA 3CXCP 5KCHA 2BZ8A 2ED1A 1M4ZA 3M4GA 4LUEA 2RJEA 4EMKA 4IUPA 3KXTA 3SFMA 2OTJT 4M7DG 5GANg 1OPKA 2H8HA 1Q7YR 2DRMA 5GANj 2VXEA 4HVVA 3MKDA 2DTHA 4JJBA 4TVRA 1TH7A 4M7AF 3JCMd 4JZ3A 4R56A 3UATA 4BY6B 2BZYA 3LGLA 3JCMV 1BKBA 1I1JA 2DIQA 1N5ZA 1H8KA 2QQAA 3CCJA 2XIDA 4UC4A 1BYMA 3VS4A 3VV0A 3WVEB 5LJ5e 1DJ7B 3M0UA 2NLUA 1QQJA 1YHQA 1N8RR 1VOMA 5GAMd 1OULA 3NPFA 5GMKj 3EH2A 1UGPB 4CI0C 3LH5A 2QA4A 2PTKA 2QDLA 1BCMA 2M0OA 1QVFA 3VS7A 1UJ0A 1XOVA 2L2PA 3EG9A 4PFOA 3OYLA 5CK9A 1MMAA 3LW5E 2XDDA 1XJWB 1VQ5A 2XG8D 1NJIR 5J26A 2ZPHB 3META 1O9SA 3JB9I 1JJ2A 1ZQ1A 3PT9A 2RQWA 2GNCA 2F2WA 3DLLA 1I4K1 2QEXA 3NGPA 1RAHB 2ZPBB 3OYFA 2FYKA 2ZZDA 2NUPA 4PKCC 2V1QA 4RTUA 2RQUA 3UA6A 1OYXA 1H3HA 2PU9B 1PC0A 4M7AD 5GJWB 4ANJA 3CCLT 4DEXA 5FU7B 4J7IA 4OMLA 2GF7A 3VUZA 1WFWA 2NUTA 4FYYB 1I81A 1KQ1A 4OVAA 1NYFA 2DIGA 2P4RA 4M7DF 1ABOA 1IB8A 3CPWP 2RQRA 5LJ5g 5IAYA 4CRIA 4ELZC 2CDTA 5LJ5j 2KSSA 2GQVA 4FYXB 4JLGA 1M2VA 3OS2A 2VB6A 3MEWA 1BI1A 4HXJA 1AWJA 1WX6A 4D6WA 3G71Q 1YI2Q 1D0ZA 2CSQA 1Q86C 4BE1A 3X28B 1JRIA 3OBWA 4JRKA 1GL5A 3CBOA 2OTLQ 1D0YA 2O4XB 3EFOA 3FJPA 1UG1A 3REAB 1H3ZA 2HL3A 1HXDA 5IXBA 2RN8A 4P5NA 3M0QA 2OI3A 3H9NA 4N0AA 1K0XA 3QDFA 1Z9QA 2DLPA 4HVUA 4LE9A 1K76A 4XTUA 3OS0A 3HFNA 2E12A 3I56A 1I5OB 2ECZA 2OX7A 4LDVA 4JRPA 2LQ8A 3OYHA 2KMTA 1D1CA 1V29B 3OYKA 3BY7A 3JCMh 2IG0A 2WSEE 1QVFS 3FDRA 2QGFB 3OSSC 1S72A 1YJWQ 3JCMb 2ENMA 4DQ2A 3CMET 1W70A 4DA4A 3CCQQ 1KD1C 2YRDA 4LDWA 5A0DA 2RD1A 2J6FA 5CAIA 1ZUKA 3SDZA 1BI0A 1JJ2S 4M7DD 2O9SA 4GLKA 3CXCA 4ZNXA 1PD0A 3M9QA 1A0NB 2C0TA 4J9BA 5CIUA 4MDXA 2ZPGB 3PIOA 3OYNA 1QVGP 1E6HA 2QAZA 2QI2A 3SWNC 4IURA 3EGXA 3RKXA 3V8JA 3JCMQ 2E64A 2EPDA 2K5IA 3JV3A 2QQ9A 2QQRA 1ZLMA 5KYXB 4FT2A 1AHJB 1VQ4A 3PMIA 3QZ9B 1VQMA 4F7UF 4CC3A 4LDXA 2FZGB 2F1LA 4E47A 2VXFA 4IUTA 1M27C 3CEYA 4E6RA 1K73C 3KUFA 3U23A 1M1KC 5CKBA 5GAN2 1G8XA 5DLQE 1X6BA 3OYEA 3GP8A 2RJCA 3MJXA 1ZSZA 2X4JA 2X51A 4M78B 2FZKB 2GBQA 3CCSA 2JNGA 4CC2A 2DNUA 5GAN7 2J06A 1JU5C 1W6XA 2E5KA 3TVTA 1YJNA 2QDYB 1IGQA 3C95A 5LJ3d 1RI9A 2VVKA 1X43A 3EAEA 1WZOA 5A2QE 3BFMA 1ARKA 2FL7A 3BW1A 5GAN5 2MYSA 3CD6T 1PSEA 1M9SA 4M4ZA 5IHKA 3E19A 3ZEHA 2HAXA 4LUDA 5CKEA 1AWWA 4J9IA 1UHFA 2LX7A 2FPDA 3RKWA 2M1HA 2JW4A 5I22A 2CP5A 1NPPA 3M54A 1GRIA 1VQKT 3J81E 2JUFA 1SF9A 4AG1C 1IZ6A 1D0XA 1WQWA 2A37A 3CXCS 1RACB 3A1PA 4RKUE 3NTHA 1RAIB 3MP1A 3G6EQ 1VQ6Q 3CPWA 5KYUB 3CCMA 2A0FB 4PL6A 4YTLA 2KRMA 4M75A 4C5EA 2PUOB 3HRUA 5I11A 2CZ0B 1Q81C 3CC4T 1GBQA 4E2FB 3V7SA 4M78F 2EBPA 5C6SA 4PFPA 4J9EA 4V2SA 3M56A 2RNAA 2CSIA 3CCRQ 2DYBA 4C5IA 1SRLA 4C92G 4KH1B 1O75A 1D3BA 1VQOT 3UPUA 1M30A 5GAOr 2H3EB 3H0FA 3A8HB 1UTIA 4MZTA 4M77G 4C0ZA 1M3CA 1YITQ 1U06A 2RH2A 2KDSA 2PVGB 3JB9F 1NEGA 3H6ZA 2OAUA 2DZCA 4FCYA 4KGZB 2DFUA 1OX9A 4ZGJB 2K6DA 2KK4A 4E7JA 4E7HA 2BE9B 1UJYA 3CC7A 1S1NA 1B3QA 3NFCA 4DBQA 1LPLA 5CVIA 1WA7A 1YCSB 3CMAQ 2DE0X 4BDZA 1GCQC 3CCJT 4PJOA 4KRTA 1QVGA 4BI4A 1KHIA 4HCKA 4B6MA 4M78D 4LN2A 1YHQT 1SPKA 1Q7YC 1OZ2A 4OMQA 4E7IA 4RTYA 2FB7A 2QA4T 1OI1A 3ZBDA 1VQ7Q 1G2BA 4X1VA 3ZFJA 1AOJA 3I5SA 4MDWA 2JTEA 1BBZA 5DLOA 1K8AR 3MEVA 4II1A 3I55Q 2J05A 1ZBXA 4E7KA 2CREA 1SSFA 1U1TA 2DX1A 4XAXB 5ECAA 1AZEA 1KK7A 1U8RA 3JB9D 4JS5A 2PUKB 1W1FA 1I8FA 4QQDA 1N8RC 3UA7A 1VQLQ 4JJCA 4C8QA 3CCRA 1UGSB 3LWHA 2J6OA 2E3IA 1K73U 4Q5WA 3CCEQ 1ZSZC 4A54A 1CSKA 2HDAA 1NJIC 4X34A 1ZX6A 2EJFA 2P84A 3UF4A 4O6JA 3CC2Q 4LD6A 2LCLA 3N5BB 3MEAA 4EMHA 4FW1A 2L3PA 3C94A 3HRTA 3JB9J 4NOYA 4FW2A 2BKDN 2EGCA 1VQOQ 4J9GA 2LTOA 3EG0A 1WJRA 1QWEA 2BIVA 1UE9A 4KBMB 3P8BB 4OGCA 2DD4A 2CS7A 1KSWA 3OSVA 1J3TA 4B9XA 3L2ZA 4A4EA 2X4YA 4HCCA 1VYTA 1NYGA 3S6WA 5HK0A 3PVLA 3A5ZB 1QVGS 1M3BA 2F5KA 2QTXA 4A63B 4HVWA 3L2RA 3M4YA 1VQNQ 2FHDA 2BZXA 4ATOA 3EFRA 3RIRA 1OX8A 2FRWA 3F70A 3LWIA 3I56T 1NEBA 2K9GA 2K3YA 1BCOA 2ZAEA 3J80E 2COZA 3SWNB 2F2VA 4M75E 2LJ1A 3VYGA 2CT4A 2LVMA 4QVCA 1S72T 4AFSC 3I55A 4EMKB 1SEMA 2CP2A 1UGQB 4M77D 1ZA2B 1Q95G 4FSSA 4Z02A 3G4SQ 4BD3A 1HYOA 4DBFA 4JUVA 2ZGWA 3M5AA 3NMZC 2VV5A 4BI3A 1KQSS 2E70A 1C0MA 2LJ3A 1V76A 4AG2C 3EG1A 1VIFA 3QPHA 2EYXA 2QASA 2LRQA 4XU2A 1VQPQ 4XK8E 4RTWA 2ABLA 3MCAB 2G3RA 5I2MA 2JOYA 4NS5A 2XU8A 3ASKA 3OA6A 2JVVA 1NPRA 3QJYA 5GANd 1AEYA 4IUUA 1VQ8T 4QVZA 4M7AA 1VQ4T 1OPLA 3RUXA 2LZ6B 5GAN8 2YHTA 1VQMT 3E9FA 3TQ7P 1QCOA 3EHQA 2RO0A 2KRNA 2XK0A 1F1BB 2E1HA 2FPFA 2VWFA 2KXCA 2PQWA 1GBRA 4FT4A 2LMJA 3WVDB 1RLPC 1WDXA 2R5MA 3EG9B 3CCVQ 2DD5A 1T3SA 2WSFE 3R6OA 1WHLA 4XTWA 1KC8R 4PK4A 2HKNA 3NTIA 3RKYA 3QZ5B 3CCST 2FRYA 4BI8B 4PJOE 2NWMA 4CC7A 4J9DA 4XQ3A 1FX7A 4PJOC 4NL3A 2L8DA 1H641 2NUPB 1YJ9Q 1VQNA 5CQYA 3SD4A 3ME9A 1YJNT 2PNIA 3OYGA 2XDPA 2K3BA 2RM4A 1Y71A 2OAWA 2GFAA 5GAOm 2YWWA 1D1AA 1R77A 4ZGEB 5GMKm 3L2UA 2NUTB 1KFZA 3VS3A 1Q7YU 3JB9H 4KH0B 2HBPA 1K9AA 3ZL7C 3MP8A 2XMFA 2R58A 2DETA 3L42A 1X2KA 2EYZA 2DF6A 2FO0A 3OYYA 5GAOq 1N9RA 2IPOB 3REBB 1M2VB 1VQ9A 1WXTA 1OQKA 3OYBA 4C8QE 5CO7A 3H41A 3OS5A 1TUGB 2L3QA 4C8QC 2RHXA 5IN1A 3CCMT 2H3JA 4C0DC 4M7DA 1PKTA 1MUZA 2J6KA 1N8RU 2RK2A 3CCUQ 2CP6A 2ED0A 3EFOB 3EGUA 5LJ5d 2LC4A 3EG2A 4HCZA 4RCCA 4OMMA 1YN8A 1TWBA 3M55A 2FZCB 1X27A 1YIJQ 4F7UG 2DVJA 4J83A 5GMKl 3JCMc 3QBYA 2HZYA 2XD0A 2JTFA 3JCMP 2EQKA 1NJIU 2BE7D 5CKHA 1IRXA 1YWPA 2DRKA 4KULA 2B8AA 2L89A 5FWCA 1PWTA 2M16A 2IIMA 2OTJQ 3M0SA 2MF2A 2K5FA 3M59A 2X3WD 5GANh 2KXDA 1JO8A 4QQ6A 1IXDA 3OYIA 1W2BS 2VC8A 4N4IA 1WHGA 4QKUA 1OU8A 2XI9A 2QTVA 2VUBA 4ZTJA 1TU0B 2A3LA 2KEAA 2JZ2A 2D1XA 3EGXB 2FG0A 2C06A 4RTTA 3CC7T 2LQNA 4A4KA 3S3NA 3FB9A 1SKUB 2GGRA 1IGUA 1C1AA 2OJ2A 1PKSA 4Z89A 1K1ZA 2X35A 5L23A 2CUDA 4LNPA 3JAME 1LOJA 3VS0A 1JBMA 2JM9A 3GLXA 1RADB 5GAMh 4IKFA 2EYQA 2J7IA 1ZSZB 4F7UA 2MAMA 2O88A 3CCUA 5HCKA 1EX4A 5AT1B 4M7AE 3QUIA 1ZA1B 3RMSA 4EMKC 4M7AC 1GCPA 1YIJA 4BE0A 4X9DA 2AKKA 4ORZA 1AZGB 3O8VA 4M78G 3G1JA 1T3LA 3G7ZA 3CCLQ 1G3TA 2DYIA 3HP9A 1Y0MA 1BK2A 2MIOA 3L2QA 2EQIA 2E6NA 4J5YA 3G71A 1YI2A 1WHJA 2O01E 3H0HA 3QYGB 2K2MA 1WJQA 1KQSP 2AIRB 4ZGDB 4GY5A 1YWOA 2VKNA 1K8AC 2OTLA 3GNGA 4QT7A 4C5HA 2W10A 4OMNA 1K9MR 5LJ5h 2DTOA 3X20B 3TU4K 1M8MA 2DERA 1AWOA 3BE3A 3QIIA 5GAN6 2RI5A 3JB9G 3GNFB 5KYYB 4MMKA 3I35A 2YDLA 1M90R 3M0TA 2QXFA 2D0QB 4M75B 4K11A 1AVZC 2EW3A 4HA8A 1CKAA 2YT6A 4MZMA 1YJWA 2DZ9A 2JXBA 3CCQA 2LCCA 1RL2A 2X4WA 3PGGA 4XTYA 2K7AA 2GFUA 2RQTA 4J9HA 5D6WA 4FM4B 3QDRB 1HSQA 2JN0A 2EKOA 4EDUA 3GOXA 2CT3A 3Q1JA 4M7DE 3CMEQ 1D3BB 4A4FA 3TEEA 2ATCB 4HT8A 5KYWA 2RB6A 1Q82R 1KJWA 4BACA 2E65A 1M90U 1HJDA 1BB9A 5CKFA 3QSUA 1BU1A 3C0CA 4EMGA 1MNEA 3EGDA 1FWZA 3V7RA 2CH4W 3VKIA 5FLXE 4C0FA 1FMVA 2EWNA 4FYWB 1IHWA 3TREA 1WIEA 3C4SA 4GLMA 3M0PA 5I2SA 4OB2B 3P8DA 3EG3A 4PJOB 1WXBA 1MMGA 1OZ3A 2RK1A 2K5LA 2KE9A 4N0AC 5DY9A 1I5LA 3NTKA 5CKDA 2AKLA 2DILA 2ROTA 2HKQB 3BDLA 3TCJA 1PRLC 1RAGB 1KD1R 4WCIA 2KROA 1TTHB 2CP7A 3T9NA 4EIKA 5KYNA 2CZ1B 1VUBA 3GPLA 2ZPFB 1UEBA 1N9SA 4DOWA 3X25B 1R0BG 3OQ5A 2M51A 1U1SA 1K0SA 4IUVA 3VUBA 2SRCA 5IHIA 2EQUA 3PNWC 2YSQA 1QLYA 4C8QB 3M57A 1RABB 3FIFA 4PJMA 3MP6A 1QP3A 3G6EA 3CD6Q 1M8VA 4PLLA 4C0DB 2HEQA 1VQ6A 3OW2P 2F69A 5LJ3h 3JCMX 3DKMA 3PMTA 1NZ9A 1X6GA 1VQKQ 1W2BP 1KC8C 4Y28E 2AZSA 4N4GA 1VQ5T 2NUZA 4RTXA 1BI2A 1TSFA 4C92A 4RTZA 1KQSA 1M1GA 4PJOF 1CKBA 3FRNA 2QEXT 3GBQA 4XTVA 2XKOC 2I0NA 1VQ9T 4QW2A 2DBMA 2CZ6B 4M77A 3VJPA 3I5RA 4OGEA 1TUCA
chains in the Genus database with same CATH topology
4M78A 3LH0A 2CGHA 4FIBA 4M7DC 2PQWA 2DPPB 4XTXA 2D6FA 4FT4A 2IVWA 3CBMA 4XTUA 1B34A 3WVDB 3OS0A 2R57A 2R5MA 3I55T 3HFNA 2DEQA 2E12A 3I56A 4XU0A 1PSFA 4LDVA 4JRPA 2LQ8A 3OYHA 2DD5A 2WSFE 2KMTA 1YITA 3R6OA 3HPWA 1V29B 4XTWA 3OYAA 3BY7A 3QXEB 2IG0A 3JCMh 5D6YA 3OYKA 3NTIA 2WSEE 3RKYA 3MO8A 3QZ5B 2DAQA 3CCST 3FDRA 1XQHA 4PJOG 4BI8B 5C0MA 3V8LA 4PJOE 3OSSC 1S72A 4BB7A 3CCLA 3JCMb 4DQ2A 3CMET 4DA4A 4XQ3A 3CBPA 4FSXA 4OF1A 1VQLT 2HQXA 1FX7A 1K8AU 4PJOC 4NL3A 2FVUA 1KD1C 1UGRB 2L8DA 4LDWA 2VGNA 5A0DA 1H641 1VQNA 2RD1A 1XNIA 5CQYA 3ME9A 2VYTA 3OB9A 3SD4A 2Y4YA 5CAIA 3SDZA 3OYGA 1BI0A 1YJNT 1JJ2S 3GIBA 4J6XA 4RCBA 4L5GA 2XDPA 4C8QF 4M7DD 2RM4A 4GLKA 3CCET 3LX7A 3CXCA 1Y71A 5GAOm 2GFAA 4M75F 5LL6S 3FEOA 4LDUA 5CQXA 2PVDB 3M9QA 4ZGEB 5GMKm 5M9OA 3L2UA 3CMAA 2DK3A 1Q7YU 3A8OB 3M53A 5CIUA 4MDXA 2ZPGB 3PIOA 3OYNA 3CC2T 3JB9H 2DTIA 2QI2A 5KH6A 1G3WA 3SWNC 4IURA 3RKXA 2HBPA 5GMKi 3V8JA 3JCMQ 2E64A 2K5IA 4KT0E 5CCAA 1Q82U 2QQ9A 3MP8A 4HT9A 2QQRA 1KQ2A 2R58A 2K2VA 3L42A 1LJOA 4PJOD 2YRVA 3HKSA 3OYYA 4FT2A 1AHJB 5FU7C 3PMIA 1N9RA 5GAOq 1VQ4A 1XTDA 1M1FA 3QJ6A 3QZ9B 1VQMA 3LYIA 4F7UF 2DJZA 4LDXA 1VQ9A 4FU6A 4C8QG 4JS4A 4E47A 3OYBA 4C8QE 3X24B 4Y91A 2VXFA 5CO7A 1Q86U 4IUTA 3CEYA 3OS5A 3MHXA 5GAN4 1VQ7A 1K73C 3KUFA 4C8QC 1M1KC 2RHXA 5IN1A 5CR2A 3S3OA 5CKBA 1VQKA 5GAN2 3CCMT 2H3JA 2LNVA 4M75C 4C92B 3M58A 4C0DC 3HHTB 2E6ZA 4M7DA 5DLQE 4M7AB 1BI3A 4RG8A 2EAYA 1NE8A 1N8RU 2RK2A 3OYEA 2VGMA 3GP8A 2MMPA 2RJCA 3OYDA 5LJ5d 2LC4A 3J7AF 1LNXA 4HCZA 4M77B 1VQNT 5HY6A 4RCCA 2X4JA 1Y7XA 4IUQA 3UDCA 4E7LA 4KUDK 4M78B 3WXMB 4LDYA 4ZN1A 3M55A 3OMGA 3CCSA 2RHIA 2EFIA 4OGEA 2JNGA 4BUGA 1B34B 4F7UG 3CMEA 4F7UE 4J83A 1VQLA 2YLCA 5GMKl 3JCMc 1M5Q1 3QBYA 3JCMe 5GAN7 5KE2A 1WPYA 4X9CA 2V8IA 2JTFA 2XD0A 3JCMf 3JCMP 5IT9E 1YJNA 2EQKA 2K3XA 1NJIU 4MZPA 1N27A 2QDYB 4PNOA 4C8QD 5LJ3d 3C95A 3HL8A 4B9WA 3CCEA 2XHCA 3EAEA 5CKHA 4M75D 1R8OB 3BFMA 5A2QE 1KG1A 3S3MA 4A4HA 2FL7A 3G4ST 2V8JA 1KD1U 3BW1A 2AHJB 4KULA 2B8AA 3CPFA 4KUIA 2L89A 2M16A 5GAN5 4OMFB 4BDYA 4NL2A 2KVQG 3CD6T 1PSEA 1M9SA 2MF2A 2K5FA 3M59A 2CYZB 2EQMA 3CPWS 3CC2A 1Y96A 3E19A 5GANh 1BIAA 3ZEHA 4OB0B 2HAXA 4J6WA 5CKEA 1KHCA 4QQ6A 2CZ7B 1VQPT 3RKWA 2RHYA 2M1HA 4A4GA 1VQOA 1NPPA 3M54A 3OYIA 5GAMf 1VQKT 2HNIA 3A8MB 1W2BS 3J81E 2JUFA 2VC8A 2Y4XA 1IZ6A 4N4IA 5HK3A 3G71T 3URGA 4QVDA 1YI2T 2XI9A 2HQEA 1WQWA 2VUBA 1QP2A 4ZTJA 3CXCS 2A3LA 1W4SA 2P0PA 2JZ2A 4RKUE 3NTHA 3MP1A 2C06A 3E9GA 3JCMJ 3CC7T 2PVOB 4J7FA 2OTLT 2A7YA 3OW2A 1G3YA 2KAFA 5GAOp 4A4KA 3CPWA 3CCMA 3FB9A 1MGQA 4PL6A 3S3NA 4YTLA 4C92F 5FU6B 4M75A 4L59A 2RJFA 2DO3A 1FXXA 1WJSA 2PUOB 4C5EA 3QKJA 3HRUA 2CZ0B 1Q81C 1W2BA 3CC4T 1M1KU 1HK9A 4M77F 4J8OA 2MI6A 2RHUA 2X35A 3HRSA 3V7SA 3L2WA 4M78F 3CCVT 2RHZA 3JCMg 2ZPIB 2RI3A 5C6SA 3JAME 4M7DB 1LOJA 4V2SA 5I21A 2P0KA 5DM7R 5KCOA 3HFOA 4O5VA 4DOVA 1JBMA 3GLXA 3M56A 4PLIA 5GAMh 4IKFA 2EYQA 2HD0A 2RJDA 1YJWT 5D6XA 3KBGA 2MWOA 4F7UA 4JJNK 3CCQT 4FL6A 2MAMA 5FRNA 1YCYA 4C5IA 5LJ5f 5L8RE 3CCUA 4C92G 4C92E 1O75A 3G4SA 1YJ9T 2GCXA 3OBYA 4HKEA 4M7AG 2LQKA 1D3BA 3JSCA 1VQOT 3QUIA 3FC3A 3UPUA 5GAOr 1K9MC 4M7AE 2E41A 4C92C 3A8HB 4MZTA 3RMSA 4EMKC 4M7AC 4M77G 5HKCA 4C0ZA 4M77E 3CD6A 1KC8U 1YIJA 2DKGA 4BE0A 4X9DA 3O8VA 3QG1A 4M78G 5GAMg 2WACA 4M78E 2RH2A 3G7ZA 4M77C 1WNLA 5GAMj 2KDSA 1MHNA 1VQPA 2PVGB 3JB9F 1M90C 1G3TA 3HP9A 4M78C 3E1SA 4EPCA 3H6ZA 3OYMA 2E6NA 1Y07A 2OAUA 2Y90A 5GANe 3L2QA 4J5YA 3G71A 1YI2A 2DZCA 4JDSA 4QQGA 1P92A 2O01E 3OMCA 3QYGB 5GANf 4ZN3A 1WJQA 4ZGJB 2WSCE 4ME7A 4E7JA 2KK4A 2F5TX 1Y96B 4ZGDB 4E7HA 3DB3A 4GY5A 3L1AA 5FRMA 3EFSA 4N4HA 5AYFA 3OYJA 4A53A 1YBYA 4VUBA 3CC7A 1K8AC 3LGFA 2OTLA 3GNGA 1G3SA 5GAOl 4C5HA 3OY9A 4C92D 2EJ9A 3NFCA 2E5QA 3A8LB 3FLGA 5CVIA 5LJ5h 5EG2A 3SB2A 2DTOA 3X20B 1X01A 3TU4K 1UB4A 2XICA 4C5GA 3V8KA 3OYCA 4BDZA 2X4XA 3CCJT 3QO3A 2V8KA 3CC4A 4PJOA 1QVGA 2DXTA 1KHIA 3QIIA 2RI5A 4BI4A 5GAN6 3JB9G 3GNFB 4OB3B 4M78D 2EQJA 2LX9A 4MMKA 1EIFA 4WF2A 2P4TA 3CCVA 2RI2A 3CCUT 1YHQT 1QW1A 4HCBA 2KY9A 3A8GB 2EJGA 4OB1B 1Q7YC 2QXFA 1WGSA 2D9TA 5GAOn 2D0QB 4M75B 1OZ2A 4JLIA 1Q81U 4E7IA 3INZA 5GMKe 2LDMA 4HA8A 2FB7A 3DB4A 2QA4T 4MZMA 3C12A 1Q82C 1OI1A 1BIBA 2MWPA 3ZBDA 1YIJT 1YJWA 2DZ9A 3OW2S 3ZFJA 1G5VA 3CCQA 2CKKA 2LCCA 4MDWA 2KQWA 5DLOA 1RL2A 2XDBA 3MEVA 4II1A 2I2LA 2X4WA 1YJ9A 3PGGA 4XTYA 2DXCA 5GAMe 2GFUA 3SWNA 3PIPA 3L2VA 1ZBXA 5D6WA 4E7KA 4FM4B 2JTMA 3QDRB 1SSFA 5J39A 2JN0A 1U1TA 5KCHA 4XAXB 2EKOA 1M4ZA 3M4GA 4EDUA 3GOXA 2RJEA 4EMKA 4IUPA 4F7UB 3GF5A 1U8RA 3KXTA 3JB9D 3Q1JA 4JS5A 2DXUA 1QVPA 2PUKB 3SFMA 2OTJT 1I8FA 4QQDA 5GANg 3QYHB 1N8RC 1QVFS 4M7DG 3QHSA 4M7DE 1D3BB 5GANj 1N6AA 1VIEA 2VXEA 3UT1A 3TEEA 4A4FA 3DLMA 4C8QA 3H8ZA 3CCRA 1UGSB 2DTHA 4TVRA 3LWHA 4HT8A 1TH7A 1ZHIA 2RB6A 4C0GA 4M7AF 3JCMd 1RI0A 4R56A 2RA2A 4BY6B 4R55A 1K73U 4Q5WA 2E65A 3LGLA 4BACA 1M90U 2QQBA 3JCMV 5GMKh 4A54A 1BKBA 2K57A 4XTZA 5CKFA 2DIQA 4XU1A 3QSUA 3V7CA 4JRIA 1NJIC 4X34A 4EMGA 3G6ET 3AHUA 2EJFA 4XU3A 1FWZA 2QQAA 3V7RA 1VQ6T 3CCJA 4O6JA 2XIDA 4LD6A 3VKIA 5FLXE 3RESA 2LCLA 3N5BB 3MEAA 4UC4A 3VU3C 4C0FA 4EMHA 1BYMA 3C94A 3HRTA 3JB9J 4NOYA 3VV0A 3WVEB 4LD9K 5LJ5e 1DJ7B 2EWNA 2BKDN 2NLUA 2O4XA 2LTOA 1YHQA 1WJRA 3TREA 5GAMd 2K4YA 3C4SA 5GMKj 3UWNA 1UGPB 5J3BA 4CI0C 2BIVA 5I2SA 4KBMB 3P8BB 2QA4A 4OB2B 4BE2A 3P8DA 4OGCA 3RERA 2DD4A 4PJOB 2CS7A 2M0OA 3VYHB 1QVFA 1OZ3A 1XOVA 4JRQA 3OSVA 3MEUA 4B9XA 2RK1A 2EIFA 3OYLA 2L5QA 3X26B 5CK9A 3JCMW 2K5LA 3L2ZA 3LW5E 4A4EA 5KE3A 4N0AC 2XDDA 5LJ3e 5DY9A 2X4YA 4HCCA 3S6WA 5HK0A 1I5LA 1VQ5A 2XG8D 5LJ3f 3A5ZB 3NTKA 5J26A 5CKDA 2ZPHB 2M9UA 4L6V5 3CCRT 3META 1O9SA 2F5KA 3JB9I 1QVGS 1JJ2A 3BDLA 1ZQ1A 2QTXA 4MMLA 3TCJA 3L2RA 3M4YA 1VQ8A 3PT9A 2FHDA 3PFSA 3DLLA 3JRZA 1I4K1 4RG2A 4ATOA 2QEXA 3EFRA 3RIRA 2ZPBB 1WQ7A 3F70A 3OS1A 3OYFA 3I56T 3LWIA 2FYKA 2ZZDA 2ZCFB 2K3YA 2OTJA 4PKCC 3RMQA 3T9NA 3J80E 1X75C 2CZ1B 1YITT 4M75G 3SWNB 1VUBA 2R5AA 2ZPFB 1UEBA 1OYXA 4M75E 1N9SA 4OP0A 5A0GA 3GPLA 2PU9B 5GAN8 4DOWA 3X25B 3VYGA 4M7AD 2LVMA 2YLBA 4QVCA 3P8HA 1S72T 3CCLT 3I55A 3OQ5A 5FU7B 4EMKB 1U1SA 4J7IA 1IREB 1UGQB 2GF7A 3ER0A 4IUVA 4M77D 3VUZA 1JB0E 2L3RA 4Z02A 3VUBA 4BD3A 1I81A 1KQ1A 2EQUA 3PNWC 4OVAA 4JUVA 2DVEA 2ZGWA 3M5AA 4C8QB 2VV5A 4BI3A 1KQSS 3M57A 2ZPEB 2DIGA 2E70A 3FIFA 4RMOA 3MP6A 4M7DF 1QP3A 3G6EA 1M8VA 4PLLA 4C0DB 3PTAA 1VQ6A 5LJ5g 2QQSA 1VIFA 2BUDA 2F69A 5IAYA 3QPHA 5LJ3h 4CRIA 3JCMX 4ELZC 2LRQA 5LJ5j 2E10A 5GAN3 4XU2A 2KSSA 3DKMA 2GQVA 3BDUA 2P0QA 4JLGA 3PMTA 3CMAT 4XK8E 1NZ9A 3MCAB 3OS2A 2G3RA 2LT4A 3MEWA 5I2MA 1BI1A 2JOYA 4NS5A 1KC8C 4D6WA 4Y28E 2XU8A 3ASKA 3OA6A 4N4GA 1VQ5T 2DXBA 2JVVA 1NPRA 5A0LA 3LLRA 3QJYA 5GANd 1GXIE 1Q86C 5FU6C 4IUUA 1BI2A 4BE1A 4C92A 1VQ8T 3X28B 1KQSA 1M1GA 4PJOF 1JRIA 4QVZA 4M7AA 3OBWA 4JRKA 1VQ4T 3FRNA 5LJ3g 3RUXA 2QEXT 4J6YA 3CBOA 2YHTA 4BY6C 3E9FA 1X6OA 2XKOC 2O4XB 4XTVA 5LJ3j 5FROA 1VQMT 4ELYC 3FJPA 1VQ9T 2RO0A 2LT1A 1K9MU 2XK0A 4QW2A 1H3ZA 2CZ6B 1HXDA 4M77A 3VJPA 4P5NA 4ZTFA 2E1HA 3HSBA 4N0AA 1VQ7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM f;  4M78 A;  3JCM P;  3JB9 J;  2CGH A;  4NOY A;  4M7D C;  5LJ5 e;  2EWN A;  4XTX A;  2Y90 A;  5GAN e;  4PNO A;  4J5Y A;  4C8Q D;  5LJ3 d;  4XTU A;  2DZC A;  1B34 A;  5GAN f;  5GAM d;  3HFN A;  2DEQ A;  3BFM A;  4M75 D;  5GMK j;  4XU0 A;  1Y96 B;  3BW1 A;  3L1A A;  3EFS A;  4A53 A;  5GAN 5;  4XTW A;  3RER A;  3BY7 A;  3JCM h;  4PJO B;  4NL2 A;  5GAO l;  3RKY A;  4C92 D;  2EJ9 A;  4PJO G;  3V8L A;  4PJO E;  5LJ5 h;  3JCM W;  1Y96 A;  3SB2 A;  2DTO A;  3JCM b;  1X01 A;  1BIA A;  3L2Z A;  4DQ2 A;  4N0A C;  5GAN h;  4XQ3 A;  3V8K A;  4J6W A;  5LJ3 e;  5DY9 A;  3QO3 A;  3RKW A;  4NL3 A;  1I5L A;  4PJO C;  4PJO A;  5LJ3 f;  1H64 1;  2DXT A;  3JB9 G;  5GAN 6;  2RD1 A;  5GAM f;  3JB9 I;  2HNI A;  5CAI A;  4MML A;  2QTX A;  4M78 D;  2VC8 A;  4MMK A;  3GIB A;  4J6X A;  4RCB A;  4WF2 A;  4QVD A;  1I4K 1;  4C8Q F;  5GAM j;  4M7D D;  3EFR A;  2RM4 A;  1WQW A;  2EJG A;  3RIR A;  1WQ7 A;  5GAO n;  5GAO m;  4M75 F;  2FYK A;  4M75 B;  4JLI A;  3INZ A;  5GMK e;  4HA8 A;  2FB7 A;  4M75 G;  3SWN B;  4OP0 A;  5GMK m;  3JCM J;  4M75 E;  1N9S A;  4X9C A;  1BIB A;  5GAO p;  2DZ9 A;  3FB9 A;  1MGQ A;  4M7A D;  4C92 F;  2YLB A;  4QVC A;  3JB9 H;  4M75 A;  4EMK B;  2DTI A;  1U1S A;  2I2L A;  3PGG A;  4XTY A;  3SWN C;  3RKX A;  4M77 D;  5GAM e;  3SWN A;  3V8J A;  5GMK i;  3JCM Q;  2E64 A;  1HK9 A;  4HT9 A;  4M77 F;  1KQ2 A;  1I81 A;  1KQ1 A;  2JN0 A;  1LJO A;  1U1T A;  4PJO D;  4JUV A;  3V7S A;  2DVE A;  5GAO q;  3M4G A;  2ZGW A;  4M78 F;  1N9R A;  4C8Q B;  4EMK A;  3JCM g;  4F7U F;  3FIF A;  4F7U B;  2DJZ A;  4M7D F;  4M7D B;  1LOJ A;  4C8Q G;  1M8V A;  4N0A A;  4C8Q E;  4Y91 A;  5I21 A;  3JB9 D;  4V2S A;  2DXU A;  2VXF A;  3HFO A;  5LJ5 g;  1I8F A;  5LJ3 h;  3JCM X;  5GAN g;  5GAN 4;  1JBM A;  4M7D G;  4M7D E;  3QHS A;  5LJ5 j;  1D3B B;  5GAM h;  2E10 A;  4C8Q C;  5GAN j;  5GAN 3;  2VXE A;  4XU2 A;  4C8Q A;  3BDU A;  5GAN 2;  4M75 C;  4C92 B;  4F7U A;  2DTH A;  4HT8 A;  1TH7 A;  4M7D A;  2RB6 A;  4M7A F;  3JCM d;  4M7A B;  1YCY A;  5LJ5 f;  4C92 G;  2EAY A;  4C92 E;  2RA2 A;  4M7A G;  2E65 A;  1D3B A;  5LJ5 d;  3QUI A;  4M7A E;  5GAO r;  3AHU A;  1LNX A;  4M77 B;  3JCM V;  5GAN d;  2E41 A;  5GMK h;  4A54 A;  4RCC A;  4C92 C;  2K57 A;  4C92 A;  4XTZ A;  4EMK C;  4M7A C;  4M77 G;  4M78 B;  4PJO F;  1JRI A;  4M7A A;  4M77 E;  4JRK A;  4XU1 A;  5LJ3 g;  2DKG A;  3RUX A;  4X9D A;  3QSU A;  4J6Y A;  5GAN 8;  2YHT A;  3V7C A;  4JRI A;  4XTV A;  4M78 G;  5LJ3 j;  5GAM g;  4M78 E;  4EMG A;  3FJP A;  1B34 B;  4M77 C;  2EJF A;  4XU3 A;  1WNL A;  3V7R A;  4M77 A;  1HXD A;  4F7U G;  4F7U E;  2YLC A;  5GMK l;  3JCM c;  1M5Q 1;  2E1H A;  3JCM e;  5GAN 7;  3HSB A;  3JB9 F;  1WPY A;  3RES A;  4EMH A;  4M78 C;  3VU3 C; 
#chains in the Genus database with same CATH topology
 3LH0 A;  2CGH A;  4FIB A;  2HCK A;  4XTX A;  3CQT A;  3CC4 Q;  2D6F A;  1QWF A;  2IVW A;  3CBM A;  1B34 A;  2X9H A;  4XU0 A;  1PSF A;  2DL7 A;  1FMK A;  1MMN A;  1YIT A;  4FYV B;  3QXE B;  5D6Y A;  2DAQ A;  2KGT A;  3V8L A;  1UDL A;  2YUO A;  1K4U S;  3SEM A;  3CBP A;  2HQX A;  4LXC A;  1K8A U;  2VGN A;  4E7S A;  1XNI A;  2GTJ A;  3O5Z A;  3OB9 A;  3GIB A;  4C8Q F;  3LX7 A;  2HMA A;  2K79 A;  4IIO A;  2V26 A;  3FEO A;  1SHG A;  4KGV B;  5EC7 A;  1ZUY A;  3CMA A;  1SRM A;  2DK3 A;  3A8O B;  5KH6 A;  1G3W A;  2O31 A;  5GMK i;  1JXO A;  4KT0 E;  1SG5 A;  5CCA A;  4HT9 A;  2K2V A;  4PJO D;  2C0O A;  2YRV A;  3QJ6 A;  1WLP B;  4FU6 A;  3TSZ A;  3X24 B;  1PHT A;  1VQ7 A;  5GAN 4;  3MHX A;  2MCN A;  2DM1 A;  1I07 A;  1I0C A;  3CCJ Q;  3S3O A;  1VQK A;  4M75 C;  3M58 A;  1NLO C;  3HHT B;  1UEC A;  4M7A B;  1BI3 A;  3M0R A;  1YHQ Q;  2VGM A;  3H0I A;  1LNX A;  3RNJ A;  2KNB B;  3UDC A;  4KUD K;  3WXM B;  4LDY A;  4ZN1 A;  1YFN A;  2QA4 Q;  2YUP A;  3OMG A;  2EFI A;  3R6N A;  1NBE B;  1LCK A;  1UGV A;  2DL8 A;  1VQL A;  2YLC A;  1IO6 A;  3JCM e;  1WPY A;  4X9C A;  3JCM f;  2YUQ A;  3KFV A;  4MZP A;  4OMO A;  2RMO A;  4PNO A;  4C8Q D;  8ATC B;  2HSE B;  3HL8 A;  4B9W A;  3CCE A;  1R8O B;  2V8J A;  2AHJ B;  3CPF A;  1PRM C;  4KUI A;  4BDY A;  3EHR A;  3CC2 A;  1G83 A;  1EZZ B;  2EQM A;  4RUG A;  1Y96 A;  2G6F X;  1BIA A;  4OB0 B;  4R0K A;  1KHC A;  3HTR A;  2RHY A;  1VQO A;  5GAM f;  3A8M B;  2Y4X A;  5HK3 A;  3G71 T;  1YI2 T;  2EYW A;  1QP2 A;  2B86 A;  4AT1 B;  4F14 A;  9ATC B;  1TUD A;  2OTL T;  3OW2 A;  1G3Y A;  2KAF A;  5GAO p;  1MGQ A;  5D7U A;  1Y57 A;  1MMD A;  5FU6 B;  1GFC A;  4L59 A;  2DO3 A;  4ESR A;  2GQI A;  1FXX A;  2AK5 A;  1WJS A;  2LP5 A;  1W2B A;  1HK9 A;  3AT1 B;  3HRS A;  2QK0 A;  1B7T A;  2RHZ A;  3JCM g;  1OOT A;  2ZPI B;  2RI3 A;  4M7D B;  1SHF A;  2RF0 A;  5I21 A;  1D09 B;  2KI7 A;  5KCO A;  3HFO A;  5DM7 R;  1GFD A;  1ABQ A;  2HD0 A;  2RJD A;  1YJW T;  5D6X A;  3KBG A;  3VS5 A;  3CCQ T;  3IQL A;  1YCY A;  5LJ5 f;  5L8R E;  4C92 E;  2JS2 A;  4WTO B;  3G4S A;  4HKE A;  1AD5 A;  2LQK A;  3JSC A;  1K9M C;  4AFZ C;  3I56 Q;  4C92 C;  1RAE B;  2DJQ A;  4M77 E;  1KC8 U;  2DKG A;  3QG1 A;  5GAM g;  2ESW A;  2WAC A;  4M77 C;  1WNL A;  5GAM j;  1VQP A;  1MHN A;  1TS9 A;  1S72 Q;  1M90 C;  2BTT A;  1UFF A;  3OYM A;  2Y90 A;  4QQG A;  1P92 A;  2HQH A;  1T0J A;  2F5T X;  5FRM A;  2LCS A;  3EFS A;  4J9F A;  4N4H A;  3OYJ A;  1WHH A;  1YBY A;  2A28 A;  1WHK A;  1G3S A;  5GAO l;  2EJ9 A;  3ULR B;  3PE0 A;  1QKX A;  2E5Q A;  3A8L B;  3FLG A;  4J9C A;  3SB2 A;  1X01 A;  4C5G A;  3OYC A;  3V8K A;  1X69 A;  2X4X A;  4DBR A;  3QO3 A;  2DL4 A;  2VAS A;  2V8K A;  1Z9Z A;  4OB3 B;  1V1C A;  2EQJ A;  2LX9 A;  1EIF A;  4WF2 A;  3CCV A;  1VYU A;  1QW1 A;  1VQ8 Q;  4HCB A;  3A8G B;  2EJG A;  2D9T A;  1VQ4 Q;  4JLI A;  1VQM Q;  8AT1 B;  1NG2 A;  3SHW A;  1VYV A;  3DB4 A;  3C12 A;  1Q82 C;  1BIB A;  4JPB W;  2QGG A;  3OW2 S;  1RAF B;  1G5V A;  2CKK A;  3A98 A;  4F04 B;  2XDB A;  4JJD A;  2I2L A;  1YJ9 A;  2DXC A;  3L2V A;  3PIP A;  2YUN A;  5J39 A;  2YXY A;  3E2U A;  2DA9 A;  4F7U B;  3GF5 A;  1C6V X;  3CCS Q;  3VS2 A;  2AT1 B;  2DXU A;  1QVP A;  1QCN A;  3QYH B;  3QHS A;  1N6A A;  1VIE A;  2LNH B;  3UT1 A;  4Y92 A;  3DLM A;  3H8Z A;  1YNZ A;  1ZHI A;  4C0G A;  1YJN Q;  3VS6 A;  1RI0 A;  2RA2 A;  4D8K A;  4R55 A;  1M2O A;  2QQB A;  2RQV A;  1NM7 A;  5GMK h;  2K57 A;  4XTZ A;  1ZUU A;  4XU1 A;  3V7C A;  4JRI A;  4PFZ A;  3G6E T;  3AHU A;  4XU3 A;  1VQ6 T;  2C0I A;  3RES A;  4D8D A;  3VU3 C;  1GCQ A;  4LD9 K;  2EGA A;  2SEM A;  2CP0 A;  2O4X A;  2E4H A;  5GJV B;  4RTV A;  2K4Y A;  3UWN A;  5J3B A;  1M3A A;  1AT1 B;  4BE2 A;  3RER A;  3VYH B;  1AWX A;  2HBW A;  4JRQ A;  3MEU A;  2EIF A;  3RDV A;  2L5Q A;  3X26 B;  3JCM W;  4PJN A;  3CCM Q;  2GTO A;  5KE3 A;  1RAA B;  5LJ3 e;  5LJ3 f;  1LVK A;  3CCR T;  2M9U A;  4L6V 5;  1VQ8 A;  4MML A;  1OV3 A;  3PFS A;  3JRZ A;  4RG2 A;  1WQ7 A;  3OS1 A;  2ZCF B;  2OTJ A;  3RMQ A;  1X75 C;  1YIT T;  4M75 G;  2R5A A;  4OP0 A;  2W0Z A;  5A0G A;  2L0A A;  2FEI A;  2YLB A;  3P8H A;  3TSW A;  1IRE B;  3ER0 A;  2DEU A;  3QWX X;  1JB0 E;  4Z8A A;  2L3R A;  2QYZ A;  2DVE A;  2MPX C;  1SSH A;  2ZPE B;  2RPN A;  4RMO A;  1EFN A;  5KYW B;  1B07 A;  1PNJ A;  3PTA A;  1KIK A;  2QQS A;  2BUD A;  5KYX A;  1IHV A;  2E10 A;  5GAN 3;  3BDU A;  2P0Q A;  3CMA T;  2HSP A;  2LT4 A;  3RBB B;  2FPE A;  2DXB A;  3EGD B;  5A0L A;  3LLR A;  1GXI E;  5FU6 C;  2LJ0 A;  4CC4 B;  1ZBJ A;  5LJ3 g;  3CC7 Q;  4J6Y A;  4BY6 C;  1X6O A;  1OU9 A;  1RUW A;  5LJ3 j;  5FRO A;  4ELY C;  2CP3 A;  1K9M U;  2LT1 A;  4ZTF A;  3HSB A;  1VQ7 T;  2M02 A;  4M78 A;  4M7D C;  2DPP B;  4OMP A;  3I55 T;  2R57 A;  2DEQ A;  1JQQ A;  2EGE A;  3EH1 A;  1QMC A;  1PCX A;  4AFU C;  3FJ5 A;  3HPW A;  3OYA A;  5KYY A;  1PG5 B;  3MO8 A;  1XQH A;  4PJO G;  5C0M A;  1FMW A;  3CCL A;  4BB7 A;  1Q86 R;  2DBK A;  3I9Q A;  1D1B A;  4FSX A;  4OF1 A;  1VQL T;  2FVU A;  1UGR B;  1U3O A;  4E7Z A;  2VYT A;  2Y4Y A;  3MPU B;  4IIM A;  4J6X A;  4RCB A;  2V1R A;  1HD3 A;  4L5G A;  2MK5 A;  3CCE T;  1H92 A;  4M75 F;  5LL6 S;  4LDU A;  5CQX A;  2PVD B;  5M9O A;  1TG0 A;  5IXF A;  3M53 A;  2ROL A;  3CC2 T;  2DTI A;  1Q82 U;  4JZ4 A;  5KYU A;  1KQ2 A;  1FYN A;  1LJO A;  1WYX A;  2KR3 A;  3HKS A;  1QCF A;  5FU7 C;  1XTD A;  1M1F A;  3LYI A;  2O2O A;  2DJZ A;  4F17 A;  2KT8 A;  4C8Q G;  4JS4 A;  4Y91 A;  1Q86 U;  5CR2 A;  1QKW A;  2LNV A;  4C92 B;  2E6Z A;  3VS1 A;  3NHN A;  4RG8 A;  2EAY A;  1NE8 A;  1NLP C;  2MMP A;  7AT1 B;  3OYD A;  3J7A F;  5FWB A;  4M77 B;  1VQN T;  5HY6 A;  1Y7X A;  1UUE A;  4IUQ A;  2KBT A;  4E7L A;  2MOX A;  2RHI A;  4BUG A;  2JJ9 A;  1B34 B;  3CME A;  3QWY A;  4F7U E;  2JMC A;  1M5Q 1;  1PM3 A;  5KE2 A;  2V8I A;  5IT9 E;  2KT1 A;  2K3X A;  1N27 A;  1WXU A;  1UHC A;  2D0N A;  1X2Q A;  2LQW A;  2XHC A;  1K73 R;  1KG1 A;  4M75 D;  1M1K R;  3S3M A;  4A4H A;  3G4S T;  1KD1 U;  4OMF B;  4AFQ C;  2COW A;  4NL2 A;  2KVQ G;  2E3H A;  3CPW S;  2CYZ B;  2CUB A;  2HL5 C;  2AZV A;  4J6W A;  1E6G A;  2CZ7 B;  1VQP T;  2KYM A;  4A4G A;  2CH4 A;  2JM8 A;  2HNI A;  2JS0 A;  5FW9 A;  2YRC A;  3URG A;  4QVD A;  2HQE A;  2L3S A;  2DMO A;  1QVF P;  1W4S A;  2P0P A;  2KRS A;  3E9G A;  3JCM J;  2PVO B;  4J7F A;  4F16 A;  2A7Y A;  2EVR A;  2D8J A;  4C92 F;  4PJJ A;  3PVQ A;  2RJF A;  4KGX B;  6AT1 B;  1JJ2 P;  3QKJ A;  3RR6 A;  2DL5 A;  1M1K U;  4M77 F;  2JMA A;  4J8O A;  2MI6 A;  2RHU A;  4AMC A;  3L2W A;  3CCV T;  2DL3 A;  2COY A;  2P0K A;  2Z0W A;  4O5V A;  3THK A;  4DOV A;  4PLI A;  2M0Y A;  3VRY A;  2MWO A;  4JJN K;  4FL6 A;  5FRN A;  1OEB A;  5IH2 A;  1TOV A;  1ACM B;  2A08 A;  1MV0 B;  2GCX A;  3OBY A;  1YJ9 T;  5IHN A;  4M7A G;  3FC3 A;  2E41 A;  5HKC A;  3CD6 A;  2X3X D;  1Q81 R;  4M78 E;  1T0H A;  2D8H A;  4PJL A;  1MND A;  2EYY A;  2NYS A;  4M78 C;  2O9V A;  3E1S A;  1JXM A;  4EPC A;  1Y07 A;  5GAN e;  4JDS A;  5GAN f;  3OMC A;  1PD1 A;  4ZN3 A;  2WSC E;  4ME7 A;  1Y96 B;  3DB3 A;  3L1A A;  2JT4 A;  5AYF A;  4A53 A;  4VUB A;  1ZSG A;  3LGF A;  1MV3 A;  2A36 A;  3OY9 A;  4C92 D;  2F2X A;  5EG2 A;  4Z88 A;  1UB4 A;  1WHM A;  2XIC A;  3CC4 A;  1U5S A;  2PZ1 A;  3D7S B;  2DXT A;  1VQ5 Q;  2KYB A;  2QG9 B;  1R0C B;  2P4T A;  2RI2 A;  3CCU T;  4GBQ A;  2KY9 A;  4OB1 B;  1WGS A;  5GAO n;  2QEX Q;  1Q81 U;  1VA7 A;  3INZ A;  5GMK e;  2LDM A;  1VQ9 Q;  1JEG A;  2MWP A;  1YIJ T;  2EKH A;  1RLQ C;  2KQW A;  1WI7 A;  1E7O A;  5GAM e;  4DBH A;  3SWN A;  4DEY A;  3VRZ A;  1TXQ A;  1YP5 A;  2JTM A;  3CXC P;  5KCH A;  2BZ8 A;  2ED1 A;  1M4Z A;  3M4G A;  4LUE A;  2RJE A;  4EMK A;  4IUP A;  3KXT A;  3SFM A;  2OTJ T;  4M7D G;  5GAN g;  1OPK A;  2H8H A;  1Q7Y R;  2DRM A;  5GAN j;  2VXE A;  4HVV A;  3MKD A;  2DTH A;  4JJB A;  4TVR A;  1TH7 A;  4M7A F;  3JCM d;  4JZ3 A;  4R56 A;  3UAT A;  4BY6 B;  2BZY A;  3LGL A;  3JCM V;  1BKB A;  1I1J A;  2DIQ A;  1N5Z A;  1H8K A;  2QQA A;  3CCJ A;  2XID A;  4UC4 A;  1BYM A;  3VS4 A;  3VV0 A;  3WVE B;  5LJ5 e;  1DJ7 B;  3M0U A;  2NLU A;  1QQJ A;  1YHQ A;  1N8R R;  1VOM A;  5GAM d;  1OUL A;  3NPF A;  5GMK j;  3EH2 A;  1UGP B;  4CI0 C;  3LH5 A;  2QA4 A;  2PTK A;  2QDL A;  1BCM A;  2M0O A;  1QVF A;  3VS7 A;  1UJ0 A;  1XOV A;  2L2P A;  3EG9 A;  4PFO A;  3OYL A;  5CK9 A;  1MMA A;  3LW5 E;  2XDD A;  1XJW B;  1VQ5 A;  2XG8 D;  1NJI R;  5J26 A;  2ZPH B;  3MET A;  1O9S A;  3JB9 I;  1JJ2 A;  1ZQ1 A;  3PT9 A;  2RQW A;  2GNC A;  2F2W A;  3DLL A;  1I4K 1;  2QEX A;  3NGP A;  1RAH B;  2ZPB B;  3OYF A;  2FYK A;  2ZZD A;  2NUP A;  4PKC C;  2V1Q A;  4RTU A;  2RQU A;  3UA6 A;  1OYX A;  1H3H A;  2PU9 B;  1PC0 A;  4M7A D;  5GJW B;  4ANJ A;  3CCL T;  4DEX A;  5FU7 B;  4J7I A;  4OML A;  2GF7 A;  3VUZ A;  1WFW A;  2NUT A;  4FYY B;  1I81 A;  1KQ1 A;  4OVA A;  1NYF A;  2DIG A;  2P4R A;  4M7D F;  1ABO A;  1IB8 A;  3CPW P;  2RQR A;  5LJ5 g;  5IAY A;  4CRI A;  4ELZ C;  2CDT A;  5LJ5 j;  2KSS A;  2GQV A;  4FYX B;  4JLG A;  1M2V A;  3OS2 A;  2VB6 A;  3MEW A;  1BI1 A;  4HXJ A;  1AWJ A;  1WX6 A;  4D6W A;  3G71 Q;  1YI2 Q;  1D0Z A;  2CSQ A;  1Q86 C;  4BE1 A;  3X28 B;  1JRI A;  3OBW A;  4JRK A;  1GL5 A;  3CBO A;  2OTL Q;  1D0Y A;  2O4X B;  3EFO A;  3FJP A;  1UG1 A;  3REA B;  1H3Z A;  2HL3 A;  1HXD A;  5IXB A;  2RN8 A;  4P5N A;  3M0Q A;  2OI3 A;  3H9N A;  4N0A A;  1K0X A;  3QDF A;  1Z9Q A;  2DLP A;  4HVU A;  4LE9 A;  1K76 A;  4XTU A;  3OS0 A;  3HFN A;  2E12 A;  3I56 A;  1I5O B;  2ECZ A;  2OX7 A;  4LDV A;  4JRP A;  2LQ8 A;  3OYH A;  2KMT A;  1D1C A;  1V29 B;  3OYK A;  3BY7 A;  3JCM h;  2IG0 A;  2WSE E;  1QVF S;  3FDR A;  2QGF B;  3OSS C;  1S72 A;  1YJW Q;  3JCM b;  2ENM A;  4DQ2 A;  3CME T;  1W70 A;  4DA4 A;  3CCQ Q;  1KD1 C;  2YRD A;  4LDW A;  5A0D A;  2RD1 A;  2J6F A;  5CAI A;  1ZUK A;  3SDZ A;  1BI0 A;  1JJ2 S;  4M7D D;  2O9S A;  4GLK A;  3CXC A;  4ZNX A;  1PD0 A;  3M9Q A;  1A0N B;  2C0T A;  4J9B A;  5CIU A;  4MDX A;  2ZPG B;  3PIO A;  3OYN A;  1QVG P;  1E6H A;  2QAZ A;  2QI2 A;  3SWN C;  4IUR A;  3EGX A;  3RKX A;  3V8J A;  3JCM Q;  2E64 A;  2EPD A;  2K5I A;  3JV3 A;  2QQ9 A;  2QQR A;  1ZLM A;  5KYX B;  4FT2 A;  1AHJ B;  1VQ4 A;  3PMI A;  3QZ9 B;  1VQM A;  4F7U F;  4CC3 A;  4LDX A;  2FZG B;  2F1L A;  4E47 A;  2VXF A;  4IUT A;  1M27 C;  3CEY A;  4E6R A;  1K73 C;  3KUF A;  3U23 A;  1M1K C;  5CKB A;  5GAN 2;  1G8X A;  5DLQ E;  1X6B A;  3OYE A;  3GP8 A;  2RJC A;  3MJX A;  1ZSZ A;  2X4J A;  2X51 A;  4M78 B;  2FZK B;  2GBQ A;  3CCS A;  2JNG A;  4CC2 A;  2DNU A;  5GAN 7;  2J06 A;  1JU5 C;  1W6X A;  2E5K A;  3TVT A;  1YJN A;  2QDY B;  1IGQ A;  3C95 A;  5LJ3 d;  1RI9 A;  2VVK A;  1X43 A;  3EAE A;  1WZO A;  5A2Q E;  3BFM A;  1ARK A;  2FL7 A;  3BW1 A;  5GAN 5;  2MYS A;  3CD6 T;  1PSE A;  1M9S A;  4M4Z A;  5IHK A;  3E19 A;  3ZEH A;  2HAX A;  4LUD A;  5CKE A;  1AWW A;  4J9I A;  1UHF A;  2LX7 A;  2FPD A;  3RKW A;  2M1H A;  2JW4 A;  5I22 A;  2CP5 A;  1NPP A;  3M54 A;  1GRI A;  1VQK T;  3J81 E;  2JUF A;  1SF9 A;  4AG1 C;  1IZ6 A;  1D0X A;  1WQW A;  2A37 A;  3CXC S;  1RAC B;  3A1P A;  4RKU E;  3NTH A;  1RAI B;  3MP1 A;  3G6E Q;  1VQ6 Q;  3CPW A;  5KYU B;  3CCM A;  2A0F B;  4PL6 A;  4YTL A;  2KRM A;  4M75 A;  4C5E A;  2PUO B;  3HRU A;  5I11 A;  2CZ0 B;  1Q81 C;  3CC4 T;  1GBQ A;  4E2F B;  3V7S A;  4M78 F;  2EBP A;  5C6S A;  4PFP A;  4J9E A;  4V2S A;  3M56 A;  2RNA A;  2CSI A;  3CCR Q;  2DYB A;  4C5I A;  1SRL A;  4C92 G;  4KH1 B;  1O75 A;  1D3B A;  1VQO T;  3UPU A;  1M30 A;  5GAO r;  2H3E B;  3H0F A;  3A8H B;  1UTI A;  4MZT A;  4M77 G;  4C0Z A;  1M3C A;  1YIT Q;  1U06 A;  2RH2 A;  2KDS A;  2PVG B;  3JB9 F;  1NEG A;  3H6Z A;  2OAU A;  2DZC A;  4FCY A;  4KGZ B;  2DFU A;  1OX9 A;  4ZGJ B;  2K6D A;  2KK4 A;  4E7J A;  4E7H A;  2BE9 B;  1UJY A;  3CC7 A;  1S1N A;  1B3Q A;  3NFC A;  4DBQ A;  1LPL A;  5CVI A;  1WA7 A;  1YCS B;  3CMA Q;  2DE0 X;  4BDZ A;  1GCQ C;  3CCJ T;  4PJO A;  4KRT A;  1QVG A;  4BI4 A;  1KHI A;  4HCK A;  4B6M A;  4M78 D;  4LN2 A;  1YHQ T;  1SPK A;  1Q7Y C;  1OZ2 A;  4OMQ A;  4E7I A;  4RTY A;  2FB7 A;  2QA4 T;  1OI1 A;  3ZBD A;  1VQ7 Q;  1G2B A;  4X1V A;  3ZFJ A;  1AOJ A;  3I5S A;  4MDW A;  2JTE A;  1BBZ A;  5DLO A;  1K8A R;  3MEV A;  4II1 A;  3I55 Q;  2J05 A;  1ZBX A;  4E7K A;  2CRE A;  1SSF A;  1U1T A;  2DX1 A;  4XAX B;  5ECA A;  1AZE A;  1KK7 A;  1U8R A;  3JB9 D;  4JS5 A;  2PUK B;  1W1F A;  1I8F A;  4QQD A;  1N8R C;  3UA7 A;  1VQL Q;  4JJC A;  4C8Q A;  3CCR A;  1UGS B;  3LWH A;  2J6O A;  2E3I A;  1K73 U;  4Q5W A;  3CCE Q;  1ZSZ C;  4A54 A;  1CSK A;  2HDA A;  1NJI C;  4X34 A;  1ZX6 A;  2EJF A;  2P84 A;  3UF4 A;  4O6J A;  3CC2 Q;  4LD6 A;  2LCL A;  3N5B B;  3MEA A;  4EMH A;  4FW1 A;  2L3P A;  3C94 A;  3HRT A;  3JB9 J;  4NOY A;  4FW2 A;  2BKD N;  2EGC A;  1VQO Q;  4J9G A;  2LTO A;  3EG0 A;  1WJR A;  1QWE A;  2BIV A;  1UE9 A;  4KBM B;  3P8B B;  4OGC A;  2DD4 A;  2CS7 A;  1KSW A;  3OSV A;  1J3T A;  4B9X A;  3L2Z A;  4A4E A;  2X4Y A;  4HCC A;  1VYT A;  1NYG A;  3S6W A;  5HK0 A;  3PVL A;  3A5Z B;  1QVG S;  1M3B A;  2F5K A;  2QTX A;  4A63 B;  4HVW A;  3L2R A;  3M4Y A;  1VQN Q;  2FHD A;  2BZX A;  4ATO A;  3EFR A;  3RIR A;  1OX8 A;  2FRW A;  3F70 A;  3LWI A;  3I56 T;  1NEB A;  2K9G A;  2K3Y A;  1BCO A;  2ZAE A;  3J80 E;  2COZ A;  3SWN B;  2F2V A;  4M75 E;  2LJ1 A;  3VYG A;  2CT4 A;  2LVM A;  4QVC A;  1S72 T;  4AFS C;  3I55 A;  4EMK B;  1SEM A;  2CP2 A;  1UGQ B;  4M77 D;  1ZA2 B;  1Q95 G;  4FSS A;  4Z02 A;  3G4S Q;  4BD3 A;  1HYO A;  4DBF A;  4JUV A;  2ZGW A;  3M5A A;  3NMZ C;  2VV5 A;  4BI3 A;  1KQS S;  2E70 A;  1C0M A;  2LJ3 A;  1V76 A;  4AG2 C;  3EG1 A;  1VIF A;  3QPH A;  2EYX A;  2QAS A;  2LRQ A;  4XU2 A;  1VQP Q;  4XK8 E;  4RTW A;  2ABL A;  3MCA B;  2G3R A;  5I2M A;  2JOY A;  4NS5 A;  2XU8 A;  3ASK A;  3OA6 A;  2JVV A;  1NPR A;  3QJY A;  5GAN d;  1AEY A;  4IUU A;  1VQ8 T;  4QVZ A;  4M7A A;  1VQ4 T;  1OPL A;  3RUX A;  2LZ6 B;  5GAN 8;  2YHT A;  1VQM T;  3E9F A;  3TQ7 P;  1QCO A;  3EHQ A;  2RO0 A;  2KRN A;  2XK0 A;  1F1B B;  2E1H A;  2FPF A;  2VWF A;  2KXC A;  2PQW A;  1GBR A;  4FT4 A;  2LMJ A;  3WVD B;  1RLP C;  1WDX A;  2R5M A;  3EG9 B;  3CCV Q;  2DD5 A;  1T3S A;  2WSF E;  3R6O A;  1WHL A;  4XTW A;  1KC8 R;  4PK4 A;  2HKN A;  3NTI A;  3RKY A;  3QZ5 B;  3CCS T;  2FRY A;  4BI8 B;  4PJO E;  2NWM A;  4CC7 A;  4J9D A;  4XQ3 A;  1FX7 A;  4PJO C;  4NL3 A;  2L8D A;  1H64 1;  2NUP B;  1YJ9 Q;  1VQN A;  5CQY A;  3SD4 A;  3ME9 A;  1YJN T;  2PNI A;  3OYG A;  2XDP A;  2K3B A;  2RM4 A;  1Y71 A;  2OAW A;  2GFA A;  5GAO m;  2YWW A;  1D1A A;  1R77 A;  4ZGE B;  5GMK m;  3L2U A;  2NUT B;  1KFZ A;  3VS3 A;  1Q7Y U;  3JB9 H;  4KH0 B;  2HBP A;  1K9A A;  3ZL7 C;  3MP8 A;  2XMF A;  2R58 A;  2DET A;  3L42 A;  1X2K A;  2EYZ A;  2DF6 A;  2FO0 A;  3OYY A;  5GAO q;  1N9R A;  2IPO B;  3REB B;  1M2V B;  1VQ9 A;  1WXT A;  1OQK A;  3OYB A;  4C8Q E;  5CO7 A;  3H41 A;  3OS5 A;  1TUG B;  2L3Q A;  4C8Q C;  2RHX A;  5IN1 A;  3CCM T;  2H3J A;  4C0D C;  4M7D A;  1PKT A;  1MUZ A;  2J6K A;  1N8R U;  2RK2 A;  3CCU Q;  2CP6 A;  2ED0 A;  3EFO B;  3EGU A;  5LJ5 d;  2LC4 A;  3EG2 A;  4HCZ A;  4RCC A;  4OMM A;  1YN8 A;  1TWB A;  3M55 A;  2FZC B;  1X27 A;  1YIJ Q;  4F7U G;  2DVJ A;  4J83 A;  5GMK l;  3JCM c;  3QBY A;  2HZY A;  2XD0 A;  2JTF A;  3JCM P;  2EQK A;  1NJI U;  2BE7 D;  5CKH A;  1IRX A;  1YWP A;  2DRK A;  4KUL A;  2B8A A;  2L89 A;  5FWC A;  1PWT A;  2M16 A;  2IIM A;  2OTJ Q;  3M0S A;  2MF2 A;  2K5F A;  3M59 A;  2X3W D;  5GAN h;  2KXD A;  1JO8 A;  4QQ6 A;  1IXD A;  3OYI A;  1W2B S;  2VC8 A;  4N4I A;  1WHG A;  4QKU A;  1OU8 A;  2XI9 A;  2QTV A;  2VUB A;  4ZTJ A;  1TU0 B;  2A3L A;  2KEA A;  2JZ2 A;  2D1X A;  3EGX B;  2FG0 A;  2C06 A;  4RTT A;  3CC7 T;  2LQN A;  4A4K A;  3S3N A;  3FB9 A;  1SKU B;  2GGR A;  1IGU A;  1C1A A;  2OJ2 A;  1PKS A;  4Z89 A;  1K1Z A;  2X35 A;  5L23 A;  2CUD A;  4LNP A;  3JAM E;  1LOJ A;  3VS0 A;  1JBM A;  2JM9 A;  3GLX A;  1RAD B;  5GAM h;  4IKF A;  2EYQ A;  2J7I A;  1ZSZ B;  4F7U A;  2MAM A;  2O88 A;  3CCU A;  5HCK A;  1EX4 A;  5AT1 B;  4M7A E;  3QUI A;  1ZA1 B;  3RMS A;  4EMK C;  4M7A C;  1GCP A;  1YIJ A;  4BE0 A;  4X9D A;  2AKK A;  4ORZ A;  1AZG B;  3O8V A;  4M78 G;  3G1J A;  1T3L A;  3G7Z A;  3CCL Q;  1G3T A;  2DYI A;  3HP9 A;  1Y0M A;  1BK2 A;  2MIO A;  3L2Q A;  2EQI A;  2E6N A;  4J5Y A;  3G71 A;  1YI2 A;  1WHJ A;  2O01 E;  3H0H A;  3QYG B;  2K2M A;  1WJQ A;  1KQS P;  2AIR B;  4ZGD B;  4GY5 A;  1YWO A;  2VKN A;  1K8A C;  2OTL A;  3GNG A;  4QT7 A;  4C5H A;  2W10 A;  4OMN A;  1K9M R;  5LJ5 h;  2DTO A;  3X20 B;  3TU4 K;  1M8M A;  2DER A;  1AWO A;  3BE3 A;  3QII A;  5GAN 6;  2RI5 A;  3JB9 G;  3GNF B;  5KYY B;  4MMK A;  3I35 A;  2YDL A;  1M90 R;  3M0T A;  2QXF A;  2D0Q B;  4M75 B;  4K11 A;  1AVZ C;  2EW3 A;  4HA8 A;  1CKA A;  2YT6 A;  4MZM A;  1YJW A;  2DZ9 A;  2JXB A;  3CCQ A;  2LCC A;  1RL2 A;  2X4W A;  3PGG A;  4XTY A;  2K7A A;  2GFU A;  2RQT A;  4J9H A;  5D6W A;  4FM4 B;  3QDR B;  1HSQ A;  2JN0 A;  2EKO A;  4EDU A;  3GOX A;  2CT3 A;  3Q1J A;  4M7D E;  3CME Q;  1D3B B;  4A4F A;  3TEE A;  2ATC B;  4HT8 A;  5KYW A;  2RB6 A;  1Q82 R;  1KJW A;  4BAC A;  2E65 A;  1M90 U;  1HJD A;  1BB9 A;  5CKF A;  3QSU A;  1BU1 A;  3C0C A;  4EMG A;  1MNE A;  3EGD A;  1FWZ A;  3V7R A;  2CH4 W;  3VKI A;  5FLX E;  4C0F A;  1FMV A;  2EWN A;  4FYW B;  1IHW A;  3TRE A;  1WIE A;  3C4S A;  4GLM A;  3M0P A;  5I2S A;  4OB2 B;  3P8D A;  3EG3 A;  4PJO B;  1WXB A;  1MMG A;  1OZ3 A;  2RK1 A;  2K5L A;  2KE9 A;  4N0A C;  5DY9 A;  1I5L A;  3NTK A;  5CKD A;  2AKL A;  2DIL A;  2ROT A;  2HKQ B;  3BDL A;  3TCJ A;  1PRL C;  1RAG B;  1KD1 R;  4WCI A;  2KRO A;  1TTH B;  2CP7 A;  3T9N A;  4EIK A;  5KYN A;  2CZ1 B;  1VUB A;  3GPL A;  2ZPF B;  1UEB A;  1N9S A;  4DOW A;  3X25 B;  1R0B G;  3OQ5 A;  2M51 A;  1U1S A;  1K0S A;  4IUV A;  3VUB A;  2SRC A;  5IHI A;  2EQU A;  3PNW C;  2YSQ A;  1QLY A;  4C8Q B;  3M57 A;  1RAB B;  3FIF A;  4PJM A;  3MP6 A;  1QP3 A;  3G6E A;  3CD6 Q;  1M8V A;  4PLL A;  4C0D B;  2HEQ A;  1VQ6 A;  3OW2 P;  2F69 A;  5LJ3 h;  3JCM X;  3DKM A;  3PMT A;  1NZ9 A;  1X6G A;  1VQK Q;  1W2B P;  1KC8 C;  4Y28 E;  2AZS A;  4N4G A;  1VQ5 T;  2NUZ A;  4RTX A;  1BI2 A;  1TSF A;  4C92 A;  4RTZ A;  1KQS A;  1M1G A;  4PJO F;  1CKB A;  3FRN A;  2QEX T;  3GBQ A;  4XTV A;  2XKO C;  2I0N A;  1VQ9 T;  4QW2 A;  2DBM A;  2CZ6 B;  4M77 A;  3VJP A;  3I5R A;  4OGE A;  1TUC A; 
#chains in the Genus database with same CATH homology
 4M78 A;  3LH0 A;  2CGH A;  4FIB A;  4M7D C;  2PQW A;  2DPP B;  4XTX A;  2D6F A;  4FT4 A;  2IVW A;  3CBM A;  4XTU A;  1B34 A;  3WVD B;  3OS0 A;  2R57 A;  2R5M A;  3I55 T;  3HFN A;  2DEQ A;  2E12 A;  3I56 A;  4XU0 A;  1PSF A;  4LDV A;  4JRP A;  2LQ8 A;  3OYH A;  2DD5 A;  2WSF E;  2KMT A;  1YIT A;  3R6O A;  3HPW A;  1V29 B;  4XTW A;  3OYA A;  3BY7 A;  3QXE B;  2IG0 A;  3JCM h;  5D6Y A;  3OYK A;  3NTI A;  2WSE E;  3RKY A;  3MO8 A;  3QZ5 B;  2DAQ A;  3CCS T;  3FDR A;  1XQH A;  4PJO G;  4BI8 B;  5C0M A;  3V8L A;  4PJO E;  3OSS C;  1S72 A;  4BB7 A;  3CCL A;  3JCM b;  4DQ2 A;  3CME T;  4DA4 A;  4XQ3 A;  3CBP A;  4FSX A;  4OF1 A;  1VQL T;  2HQX A;  1FX7 A;  1K8A U;  4PJO C;  4NL3 A;  2FVU A;  1KD1 C;  1UGR B;  2L8D A;  4LDW A;  2VGN A;  5A0D A;  1H64 1;  1VQN A;  2RD1 A;  1XNI A;  5CQY A;  3ME9 A;  2VYT A;  3OB9 A;  3SD4 A;  2Y4Y A;  5CAI A;  3SDZ A;  3OYG A;  1BI0 A;  1YJN T;  1JJ2 S;  3GIB A;  4J6X A;  4RCB A;  4L5G A;  2XDP A;  4C8Q F;  4M7D D;  2RM4 A;  4GLK A;  3CCE T;  3LX7 A;  3CXC A;  1Y71 A;  5GAO m;  2GFA A;  4M75 F;  5LL6 S;  3FEO A;  4LDU A;  5CQX A;  2PVD B;  3M9Q A;  4ZGE B;  5GMK m;  5M9O A;  3L2U A;  3CMA A;  2DK3 A;  1Q7Y U;  3A8O B;  3M53 A;  5CIU A;  4MDX A;  2ZPG B;  3PIO A;  3OYN A;  3CC2 T;  3JB9 H;  2DTI A;  2QI2 A;  5KH6 A;  1G3W A;  3SWN C;  4IUR A;  3RKX A;  2HBP A;  5GMK i;  3V8J A;  3JCM Q;  2E64 A;  2K5I A;  4KT0 E;  5CCA A;  1Q82 U;  2QQ9 A;  3MP8 A;  4HT9 A;  2QQR A;  1KQ2 A;  2R58 A;  2K2V A;  3L42 A;  1LJO A;  4PJO D;  2YRV A;  3HKS A;  3OYY A;  4FT2 A;  1AHJ B;  5FU7 C;  3PMI A;  1N9R A;  5GAO q;  1VQ4 A;  1XTD A;  1M1F A;  3QJ6 A;  3QZ9 B;  1VQM A;  3LYI A;  4F7U F;  2DJZ A;  4LDX A;  1VQ9 A;  4FU6 A;  4C8Q G;  4JS4 A;  4E47 A;  3OYB A;  4C8Q E;  3X24 B;  4Y91 A;  2VXF A;  5CO7 A;  1Q86 U;  4IUT A;  3CEY A;  3OS5 A;  3MHX A;  5GAN 4;  1VQ7 A;  1K73 C;  3KUF A;  4C8Q C;  1M1K C;  2RHX A;  5IN1 A;  5CR2 A;  3S3O A;  5CKB A;  1VQK A;  5GAN 2;  3CCM T;  2H3J A;  2LNV A;  4M75 C;  4C92 B;  3M58 A;  4C0D C;  3HHT B;  2E6Z A;  4M7D A;  5DLQ E;  4M7A B;  1BI3 A;  4RG8 A;  2EAY A;  1NE8 A;  1N8R U;  2RK2 A;  3OYE A;  2VGM A;  3GP8 A;  2MMP A;  2RJC A;  3OYD A;  5LJ5 d;  2LC4 A;  3J7A F;  1LNX A;  4HCZ A;  4M77 B;  1VQN T;  5HY6 A;  4RCC A;  2X4J A;  1Y7X A;  4IUQ A;  3UDC A;  4E7L A;  4KUD K;  4M78 B;  3WXM B;  4LDY A;  4ZN1 A;  3M55 A;  3OMG A;  3CCS A;  2RHI A;  2EFI A;  4OGE A;  2JNG A;  4BUG A;  1B34 B;  4F7U G;  3CME A;  4F7U E;  4J83 A;  1VQL A;  2YLC A;  5GMK l;  3JCM c;  1M5Q 1;  3QBY A;  3JCM e;  5GAN 7;  5KE2 A;  1WPY A;  4X9C A;  2V8I A;  2JTF A;  2XD0 A;  3JCM f;  3JCM P;  5IT9 E;  1YJN A;  2EQK A;  2K3X A;  1NJI U;  4MZP A;  1N27 A;  2QDY B;  4PNO A;  4C8Q D;  5LJ3 d;  3C95 A;  3HL8 A;  4B9W A;  3CCE A;  2XHC A;  3EAE A;  5CKH A;  4M75 D;  1R8O B;  3BFM A;  5A2Q E;  1KG1 A;  3S3M A;  4A4H A;  2FL7 A;  3G4S T;  2V8J A;  1KD1 U;  3BW1 A;  2AHJ B;  4KUL A;  2B8A A;  3CPF A;  4KUI A;  2L89 A;  2M16 A;  5GAN 5;  4OMF B;  4BDY A;  4NL2 A;  2KVQ G;  3CD6 T;  1PSE A;  1M9S A;  2MF2 A;  2K5F A;  3M59 A;  2CYZ B;  2EQM A;  3CPW S;  3CC2 A;  1Y96 A;  3E19 A;  5GAN h;  1BIA A;  3ZEH A;  4OB0 B;  2HAX A;  4J6W A;  5CKE A;  1KHC A;  4QQ6 A;  2CZ7 B;  1VQP T;  3RKW A;  2RHY A;  2M1H A;  4A4G A;  1VQO A;  1NPP A;  3M54 A;  3OYI A;  5GAM f;  1VQK T;  2HNI A;  3A8M B;  1W2B S;  3J81 E;  2JUF A;  2VC8 A;  2Y4X A;  1IZ6 A;  4N4I A;  5HK3 A;  3G71 T;  3URG A;  4QVD A;  1YI2 T;  2XI9 A;  2HQE A;  1WQW A;  2VUB A;  1QP2 A;  4ZTJ A;  3CXC S;  2A3L A;  1W4S A;  2P0P A;  2JZ2 A;  4RKU E;  3NTH A;  3MP1 A;  2C06 A;  3E9G A;  3JCM J;  3CC7 T;  2PVO B;  4J7F A;  2OTL T;  2A7Y A;  3OW2 A;  1G3Y A;  2KAF A;  5GAO p;  4A4K A;  3CPW A;  3CCM A;  3FB9 A;  1MGQ A;  4PL6 A;  3S3N A;  4YTL A;  4C92 F;  5FU6 B;  4M75 A;  4L59 A;  2RJF A;  2DO3 A;  1FXX A;  1WJS A;  2PUO B;  4C5E A;  3QKJ A;  3HRU A;  2CZ0 B;  1Q81 C;  1W2B A;  3CC4 T;  1M1K U;  1HK9 A;  4M77 F;  4J8O A;  2MI6 A;  2RHU A;  2X35 A;  3HRS A;  3V7S A;  3L2W A;  4M78 F;  3CCV T;  2RHZ A;  3JCM g;  2ZPI B;  2RI3 A;  5C6S A;  3JAM E;  4M7D B;  1LOJ A;  4V2S A;  5I21 A;  2P0K A;  5DM7 R;  5KCO A;  3HFO A;  4O5V A;  4DOV A;  1JBM A;  3GLX A;  3M56 A;  4PLI A;  5GAM h;  4IKF A;  2EYQ A;  2HD0 A;  2RJD A;  1YJW T;  5D6X A;  3KBG A;  2MWO A;  4F7U A;  4JJN K;  3CCQ T;  4FL6 A;  2MAM A;  5FRN A;  1YCY A;  4C5I A;  5LJ5 f;  5L8R E;  3CCU A;  4C92 G;  4C92 E;  1O75 A;  3G4S A;  1YJ9 T;  2GCX A;  3OBY A;  4HKE A;  4M7A G;  2LQK A;  1D3B A;  3JSC A;  1VQO T;  3QUI A;  3FC3 A;  3UPU A;  5GAO r;  1K9M C;  4M7A E;  2E41 A;  4C92 C;  3A8H B;  4MZT A;  3RMS A;  4EMK C;  4M7A C;  4M77 G;  5HKC A;  4C0Z A;  4M77 E;  3CD6 A;  1KC8 U;  1YIJ A;  2DKG A;  4BE0 A;  4X9D A;  3O8V A;  3QG1 A;  4M78 G;  5GAM g;  2WAC A;  4M78 E;  2RH2 A;  3G7Z A;  4M77 C;  1WNL A;  5GAM j;  2KDS A;  1MHN A;  1VQP A;  2PVG B;  3JB9 F;  1M90 C;  1G3T A;  3HP9 A;  4M78 C;  3E1S A;  4EPC A;  3H6Z A;  3OYM A;  2E6N A;  1Y07 A;  2OAU A;  2Y90 A;  5GAN e;  3L2Q A;  4J5Y A;  3G71 A;  1YI2 A;  2DZC A;  4JDS A;  4QQG A;  1P92 A;  2O01 E;  3OMC A;  3QYG B;  5GAN f;  4ZN3 A;  1WJQ A;  4ZGJ B;  2WSC E;  4ME7 A;  4E7J A;  2KK4 A;  2F5T X;  1Y96 B;  4ZGD B;  4E7H A;  3DB3 A;  4GY5 A;  3L1A A;  5FRM A;  3EFS A;  4N4H A;  5AYF A;  3OYJ A;  4A53 A;  1YBY A;  4VUB A;  3CC7 A;  1K8A C;  3LGF A;  2OTL A;  3GNG A;  1G3S A;  5GAO l;  4C5H A;  3OY9 A;  4C92 D;  2EJ9 A;  3NFC A;  2E5Q A;  3A8L B;  3FLG A;  5CVI A;  5LJ5 h;  5EG2 A;  3SB2 A;  2DTO A;  3X20 B;  1X01 A;  3TU4 K;  1UB4 A;  2XIC A;  4C5G A;  3V8K A;  3OYC A;  4BDZ A;  2X4X A;  3CCJ T;  3QO3 A;  2V8K A;  3CC4 A;  4PJO A;  1QVG A;  2DXT A;  1KHI A;  3QII A;  2RI5 A;  4BI4 A;  5GAN 6;  3JB9 G;  3GNF B;  4OB3 B;  4M78 D;  2EQJ A;  2LX9 A;  4MMK A;  1EIF A;  4WF2 A;  2P4T A;  3CCV A;  2RI2 A;  3CCU T;  1YHQ T;  1QW1 A;  4HCB A;  2KY9 A;  3A8G B;  2EJG A;  4OB1 B;  1Q7Y C;  2QXF A;  1WGS A;  2D9T A;  5GAO n;  2D0Q B;  4M75 B;  1OZ2 A;  4JLI A;  1Q81 U;  4E7I A;  3INZ A;  5GMK e;  2LDM A;  4HA8 A;  2FB7 A;  3DB4 A;  2QA4 T;  4MZM A;  3C12 A;  1Q82 C;  1OI1 A;  1BIB A;  2MWP A;  3ZBD A;  1YIJ T;  1YJW A;  2DZ9 A;  3OW2 S;  3ZFJ A;  1G5V A;  3CCQ A;  2CKK A;  2LCC A;  4MDW A;  2KQW A;  5DLO A;  1RL2 A;  2XDB A;  3MEV A;  4II1 A;  2I2L A;  2X4W A;  1YJ9 A;  3PGG A;  4XTY A;  2DXC A;  5GAM e;  2GFU A;  3SWN A;  3PIP A;  3L2V A;  1ZBX A;  5D6W A;  4E7K A;  4FM4 B;  2JTM A;  3QDR B;  1SSF A;  5J39 A;  2JN0 A;  1U1T A;  5KCH A;  4XAX B;  2EKO A;  1M4Z A;  3M4G A;  4EDU A;  3GOX A;  2RJE A;  4EMK A;  4IUP A;  4F7U B;  3GF5 A;  1U8R A;  3KXT A;  3JB9 D;  3Q1J A;  4JS5 A;  2DXU A;  1QVP A;  2PUK B;  3SFM A;  2OTJ T;  1I8F A;  4QQD A;  5GAN g;  3QYH B;  1N8R C;  1QVF S;  4M7D G;  3QHS A;  4M7D E;  1D3B B;  5GAN j;  1N6A A;  1VIE A;  2VXE A;  3UT1 A;  3TEE A;  4A4F A;  3DLM A;  4C8Q A;  3H8Z A;  3CCR A;  1UGS B;  2DTH A;  4TVR A;  3LWH A;  4HT8 A;  1TH7 A;  1ZHI A;  2RB6 A;  4C0G A;  4M7A F;  3JCM d;  1RI0 A;  4R56 A;  2RA2 A;  4BY6 B;  4R55 A;  1K73 U;  4Q5W A;  2E65 A;  3LGL A;  4BAC A;  1M90 U;  2QQB A;  3JCM V;  5GMK h;  4A54 A;  1BKB A;  2K57 A;  4XTZ A;  5CKF A;  2DIQ A;  4XU1 A;  3QSU A;  3V7C A;  4JRI A;  1NJI C;  4X34 A;  4EMG A;  3G6E T;  3AHU A;  2EJF A;  4XU3 A;  1FWZ A;  2QQA A;  3V7R A;  1VQ6 T;  3CCJ A;  4O6J A;  2XID A;  4LD6 A;  3VKI A;  5FLX E;  3RES A;  2LCL A;  3N5B B;  3MEA A;  4UC4 A;  3VU3 C;  4C0F A;  4EMH A;  1BYM A;  3C94 A;  3HRT A;  3JB9 J;  4NOY A;  3VV0 A;  3WVE B;  4LD9 K;  5LJ5 e;  1DJ7 B;  2EWN A;  2BKD N;  2NLU A;  2O4X A;  2LTO A;  1YHQ A;  1WJR A;  3TRE A;  5GAM d;  2K4Y A;  3C4S A;  5GMK j;  3UWN A;  1UGP B;  5J3B A;  4CI0 C;  2BIV A;  5I2S A;  4KBM B;  3P8B B;  2QA4 A;  4OB2 B;  4BE2 A;  3P8D A;  4OGC A;  3RER A;  2DD4 A;  4PJO B;  2CS7 A;  2M0O A;  3VYH B;  1QVF A;  1OZ3 A;  1XOV A;  4JRQ A;  3OSV A;  3MEU A;  4B9X A;  2RK1 A;  2EIF A;  3OYL A;  2L5Q A;  3X26 B;  5CK9 A;  3JCM W;  2K5L A;  3L2Z A;  3LW5 E;  4A4E A;  5KE3 A;  4N0A C;  2XDD A;  5LJ3 e;  5DY9 A;  2X4Y A;  4HCC A;  3S6W A;  5HK0 A;  1I5L A;  1VQ5 A;  2XG8 D;  5LJ3 f;  3A5Z B;  3NTK A;  5J26 A;  5CKD A;  2ZPH B;  2M9U A;  4L6V 5;  3CCR T;  3MET A;  1O9S A;  2F5K A;  3JB9 I;  1QVG S;  1JJ2 A;  3BDL A;  1ZQ1 A;  2QTX A;  4MML A;  3TCJ A;  3L2R A;  3M4Y A;  1VQ8 A;  3PT9 A;  2FHD A;  3PFS A;  3DLL A;  3JRZ A;  1I4K 1;  4RG2 A;  4ATO A;  2QEX A;  3EFR A;  3RIR A;  2ZPB B;  1WQ7 A;  3F70 A;  3OS1 A;  3OYF A;  3I56 T;  3LWI A;  2FYK A;  2ZZD A;  2ZCF B;  2K3Y A;  2OTJ A;  4PKC C;  3RMQ A;  3T9N A;  3J80 E;  1X75 C;  2CZ1 B;  1YIT T;  4M75 G;  3SWN B;  1VUB A;  2R5A A;  2ZPF B;  1UEB A;  1OYX A;  4M75 E;  1N9S A;  4OP0 A;  5A0G A;  3GPL A;  2PU9 B;  5GAN 8;  4DOW A;  3X25 B;  3VYG A;  4M7A D;  2LVM A;  2YLB A;  4QVC A;  3P8H A;  1S72 T;  3CCL T;  3I55 A;  3OQ5 A;  5FU7 B;  4EMK B;  1U1S A;  4J7I A;  1IRE B;  1UGQ B;  2GF7 A;  3ER0 A;  4IUV A;  4M77 D;  3VUZ A;  1JB0 E;  2L3R A;  4Z02 A;  3VUB A;  4BD3 A;  1I81 A;  1KQ1 A;  2EQU A;  3PNW C;  4OVA A;  4JUV A;  2DVE A;  2ZGW A;  3M5A A;  4C8Q B;  2VV5 A;  4BI3 A;  1KQS S;  3M57 A;  2ZPE B;  2DIG A;  2E70 A;  3FIF A;  4RMO A;  3MP6 A;  4M7D F;  1QP3 A;  3G6E A;  1M8V A;  4PLL A;  4C0D B;  3PTA A;  1VQ6 A;  5LJ5 g;  2QQS A;  1VIF A;  2BUD A;  2F69 A;  5IAY A;  3QPH A;  5LJ3 h;  4CRI A;  3JCM X;  4ELZ C;  2LRQ A;  5LJ5 j;  2E10 A;  5GAN 3;  4XU2 A;  2KSS A;  3DKM A;  2GQV A;  3BDU A;  2P0Q A;  4JLG A;  3PMT A;  3CMA T;  4XK8 E;  1NZ9 A;  3MCA B;  3OS2 A;  2G3R A;  2LT4 A;  3MEW A;  5I2M A;  1BI1 A;  2JOY A;  4NS5 A;  1KC8 C;  4D6W A;  4Y28 E;  2XU8 A;  3ASK A;  3OA6 A;  4N4G A;  1VQ5 T;  2DXB A;  2JVV A;  1NPR A;  5A0L A;  3LLR A;  3QJY A;  5GAN d;  1GXI E;  1Q86 C;  5FU6 C;  4IUU A;  1BI2 A;  4BE1 A;  4C92 A;  1VQ8 T;  3X28 B;  1KQS A;  1M1G A;  4PJO F;  1JRI A;  4QVZ A;  4M7A A;  3OBW A;  4JRK A;  1VQ4 T;  3FRN A;  5LJ3 g;  3RUX A;  2QEX T;  4J6Y A;  3CBO A;  2YHT A;  4BY6 C;  3E9F A;  1X6O A;  2XKO C;  2O4X B;  4XTV A;  5LJ3 j;  5FRO A;  1VQM T;  4ELY C;  3FJP A;  1VQ9 T;  2RO0 A;  2LT1 A;  1K9M U;  2XK0 A;  4QW2 A;  1H3Z A;  2CZ6 B;  1HXD A;  4M77 A;  3VJP A;  4P5N A;  4ZTF A;  2E1H A;  3HSB A;  4N0A A;  1VQ7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...