1B34A

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34A00
1KQ1A 4M77G 4PJOG 5GMKj 4J5YA 3JCMe 3V8LA 4M7AF 4M7AD 4M7DA 3V7CA 5DY9A 4M75F 5LJ3f 4M78G 4QVCA 1LJOA 4EMGA 1WQ7A 2HNIA 2YLCA 3QHSA 4C8QD 2EJFA 4XTVA 4C92F 5LJ5g 1D3BA 3SB2A 4M7AC 3GIBA 3EFRA 2RA2A 4XQ3A 4Y91A 2K57A 4M75C 2E64A 2Y90A 4M78A 4NL3A 5GANd 2ZGWA 4OP0A 3L2ZA 2VXFA 4A54A 4NOYA 4C8QC 2DKGA 5LJ5j 5GANf 3JB9D 3JB9G 1M8VA 2RD1A 3QUIA 4N0AC 3BW1A 5GAMh 5GAN3 3INZA 4M7DD 1BIAA 4EMKC 3QSUA 4F7UF 1LNXA 4M7DG 5GANe 2DXUA 5GAMe 4M77F 4PJOF 5CAIA 4M77D 4PJOD 4XTYA 4M7DC 3JB9J 4M78D 5LJ3j 4C92B 4X9CA 2E10A 1I5LA 2VC8A 3RIRA 4M77C 5GANg 3SWNB 4PJOC 3L1AA 4C8QF 5GAOq 2EWNA 1H641 4M78C 2EAYA 4XTWA 3PGGA 4XU2A 5GMKh 5GAMd 3JCMW 3V8JA 3RKYA 4HA8A 5GAOp 4NL2A 3JCMd 5GANj 3M4GA 3JB9F 4HT9A 3JCMP 4DQ2A 5GMKe 4XTZA 3SWNA 3JCMX 3BFMA 3VU3C 2DTHA 4XU1A 4XTUA 2CGHA 1JBMA 2YHTA 5GAN5 3AHUA 4M7DF 5LJ5h 2DVEA 2RM4A 2E41A 2DZ9A 4M7AB 1N9SA 3RKXA 1X01A 3HFNA 4J6WA 5GAN2 4PNOA 4M75B 5LJ5e 1I81A 2QTXA 5GAMg 4M7AE 4M78F 3JCMV 4C8QB 4F7UG 3JCMb 4A53A 1HK9A 4M75E 4RCCA 2E1HA 3V7SA 3JCMg 4C8QE 4MMLA 1U1SA 1U1TA 4C92E 4XU0A 1MGQA 5GAOl 3JCMc 4M7AA 5GAMf 1B34B 4M75A 1Y96B 4XU3A 5LJ3h 5GAN4 5GAOm 4EMKB 1WNLA 2YLBA 4C8QA 4HT8A 3JCMf 4C92A 4JLIA 2I2LA 1I4K1 1TH7A 5LJ3e 3HSBA 5GMKm 4M7DB 4N0AA 3BDUA 4X9DA 1B34A 1WQWA 1Y96A 4F7UB 5GANh 4EMKA 4MMKA 4M77B 2DJZA 3BY7A 3FIFA 4J6XA 4J6YA 4JUVA 4F7UE 4PJOB 4M77E 1I8FA 2FB7A 1JRIA 2DXTA 1YCYA 3HFOA 4M78B 4XTXA 1M5Q1 1HXDA 1WPYA 2FYKA 4RCBA 3RESA 1LOJA 4M78E 4M75D 5LJ3d 4M7AG 3RUXA 3FJPA 4F7UA 5I21A 4V2SA 4M75G 4M77A 4PJOA 3FB9A 3V8KA 4C92D 3RERA 4C8QG 5GAN8 1KQ2A 1N9RA 2E65A 4JRKA 3V7RA 2DTIA 4C92G 5GAMj 5GAN6 2EJ9A 2DZCA 4C92C 2RB6A 4EMHA 5LJ5d 5LJ5f 3SWNC 3JB9H 5GAN7 5GMKl 5GAOn 1BIBA 3JCMQ 4PJOE 2EJGA 3EFSA 3JCMJ 4WF2A 2DEQA 5LJ3g 2VXEA 3JCMh 5GAOr 3JB9I 4M7DE 3QO3A 4QVDA 4JRIA 5GMKi 3RKWA 1D3BB 2DTOA 2JN0A
chains in the Genus database with same CATH superfamily
2EPDA 5CIUA 1X69A 3REBB 4J5YA 4E7KA 3V8LA 2OTLQ 1SKUB 3V7CA 1YJWA 4M75F 1FMKA 3GF5A 2HNIA 1VQ9Q 3ASKA 5I2SA 4XQ3A 1S72A 1VQKQ 3WVDB 2EYYA 5CR2A 1RL2A 3JB9G 2LJ3A 1RAHB 2KEAA 1WHKA 1BIAA 2R58A 2ZPHB 2FPEA 1U8RA 5CKEA 4BB7A 3CC2Q 2FZCB 5CQYA 1WHJA 3A5ZB 4XTWA 1VQLQ 4ATOA 1TS9A 1TSFA 3CCMT 2WSFE 3J80E 1MV3A 2J6FA 2VGMA 3EHQA 2ATCB 3KUFA 3OYEA 3QG1A 3RKXA 1M27C 1I81A 1WXBA 1Q86R 3UPUA 2LZ6B 3EG3A 4OGCA 2DM1A 5KYXB 4C0DC 2RO0A 2RQUA 1OEBA 3JCMf 5GJWB 1G3WA 2RJCA 1M90C 4VUBA 1KG1A 1TH7A 3CMET 2RHIA 5LJ3e 3SDZA 1YJ9A 4RTZA 4FT4A 4M77B 1HD3A 2ZCFB 2P0QA 5HY6A 3HFOA 3PVLA 4BY6B 1ZX6A 3BE3A 2X4WA 7AT1B 5KCOA 1IO6A 1PKSA 2LX9A 1NJIU 2Y4XA 5FRNA 3JCMQ 3EFSA 1PCXA 2KSSA 2LC4A 2QA4A 2VXEA 2PQWA 1G5VA 3NTKA 3QO3A 4A63B 3RNJA 2HAXA 3CCUA 1WIEA 3VYHB 1D3BA 3CD6Q 1KSWA 2RA2A 4NL3A 1JXOA 2ZGWA 4KUIA 2DKGA 1YN8A 1Q7YR 2RD1A 1SF9A 2XDPA 3JAME 1WHHA 1Z9QA 1AWXA 3QSUA 3CC7Q 1K8AU 2KI7A 3M0UA 4IUQA 3S6WA 4IUPA 4M77D 1YITT 2HBWA 3OYJA 4ZGDB 1M1KR 3MCAB 2JTFA 4C8QF 4AFUC 3X28B 3PGGA 4K11A 3VKIA 3V8JA 3M54A 2M51A 2YT6A 3A8MB 1YHQT 2PNIA 2PUOB 2VASA 3HRSA 2XU8A 3X26B 2G6FX 3LX7A 1E6HA 3M0PA 1UTIA 3CPWS 2DILA 3EG9A 1UUEA 3CEYA 1YCSB 1NLPC 1ABOA 4A4EA 4LE9A 1ZSZA 2XI9A 4C92A 1WYXA 1NPPA 2MF2A 1AOJA 2JT4A 2E6NA 1KD1R 2OTLA 2D6FA 9ATCB 2L8DA 1QVFS 1PKTA 1VQ9A 4OB0B 1LOJA 3HTRA 2AIRB 5ECAA 3FRNA 1VQPT 4PJOA 2OTJQ 4DEYA 3G71Q 4C5GA 1N9RA 5CKFA 3OS0A 2D1XA 4C92C 3TSWA 2DD5A 2CS7A 5KYUB 4D8DA 4OMLA 4JRIA 1H3HA 1D3BB 1SRLA 2R5MA 2DTOA 5IAYA 2ED1A 1Q82C 3JCMe 1MMAA 2VKNA 3L2WA 1V76A 1VQLA 1N8RR 1YNZA 4FYVB 2YXYA 2GQIA 3G1JA 3OYHA 3SEMA 2WSCE 2E64A 4F16A 3CCQT 3L2ZA 2E5KA 4KGZB 1U06A 3F70A 2RQRA 4EMKC 1GBRA 3A8LB 2QDLA 1LNXA 3M9QA 2DXUA 1OX9A 1S1NA 2FL7A 4XTYA 3CPWA 3TSZA 1X75C 3VJPA 1RAIB 1XTDA 5DM7R 4C5HA 2QQAA 2O4XA 3OW2P 4DQ2A 2DRMA 3EG9B 2M9UA 5HK3A 4DBHA 1IXDA 1KC8C 1QVFA 3GIBA 1UGVA 2E3HA 4EDUA 1M1KU 1ZSZB 3EHRA 4BI3A 4LDVA 4ANJA 3CCMQ 3JCMc 2A37A 4HCBA 1I0CA 4C8QA 4JPBW 3MP8A 1UDLA 3HSBA 1MNDA 2IG0A 5J39A 2L3QA 4O5VA 3OQ5A 4PJOB 2DXCA 1VQ5Q 2KAFA 1Y07A 1VYUA 1O75A 2SEMA 2SRCA 3VS3A 1M5Q1 4M78E 4R0KA 4M75D 4M7AG 3M56A 3V8KA 2C0IA 2CZ1B 1Y57A 3V7RA 4J7FA 4AFZC 1QVGP 2K2MA 3M5AA 5DLOA 5GAN6 2IPOB 5LJ5d 4EMHA 3CC7A 3PMIA 5GAOn 3G4SQ 2DL4A 3QPHA 4GLMA 4M7DE 4F7UG 1JU5C 2DAQA 2QTVA 2D8JA 1BBZA 1N5ZA 4HCCA 1VQ8T 3OYAA 1YJNT 1LJOA 1FXXA 4E7ZA 5CVIA 2VUBA 2OI3A 2QXFA 2Y90A 4M78A 5GANd 4A54A 2BE9B 4QQ6A 2YWWA 2DYBA 3VS2A 4J9GA 1NEGA 1VQ7T 2YSQA 1WXUA 1YWOA 3P8BB 4N0AC 3EGDA 1VIFA 2KT1A 1Q86C 3A98A 1VQKT 4PJOD 3PTAA 1QMCA 2X3WD 3UF4A 4M78C 4C5EA 2DL8A 4HCKA 2K6DA 4NL2A 2DD4A 4PL6A 3OS5A 5KYYA 3SFMA 4XTZA 1YITQ 3CC2T 2NLUA 1I5OB 2ZZDA 2B86A 2O01E 1VQOT 3OYBA 4XU1A 3CCET 4AG1C 3OYLA 2HMAA 4ZN3A 1KIKA 3H0FA 1YHQQ 3G71A 2GTOA 4FW1A 1W2BS 5IXBA 4C8QB 4CI0C 4PLLA 2HQEA 1K9MR 4IKFA 4XU3A 4IIMA 4ZTJA 1GXIE 5FWBA 2DFUA 2FG0A 4J9EA 2FPFA 3L2UA 3MHXA 2J7IA 3TREA 3OYFA 4CC2A 2DXTA 1YCYA 2F5KA 3P8HA 4NS5A 4M75G 1Q7YC 3OYGA 5CKHA 2I0NA 2EQIA 2EBPA 1UJ0A 4E7HA 1R0BG 2RI3A 2XMFA 1OU8A 5GAN7 5I2MA 1O9SA 3VS0A 1M1KC 4MDWA 1VQPQ 1WI7A 1UHFA 1K0SA 2CDTA 3S3NA 1RLPC 4BDZA 2KT8A 5IHNA 1WQ7A 4C8QD 4XTVA 3EGDB 4D8KA 3EFRA 1C1AA 4Y91A 4QKUA 4R55A 2VXFA 2LQKA 2DO3A 4P5NA 1TTHB 1F1BB 2LNHB 3OBYA 3A8HB 1Y71A 2HSEB 5IXFA 4FIBA 2YUNA 3CD6T 5FU6C 1M8MA 3CXCA 5HCKA 3CCMA 1UHCA 3E1SA 4TVRA 4LUDA 4GBQA 5KYYB 1RAFB 1W2BA 2KRMA 4ESRA 1H641 1X43A 1ZQ1A 1N6AA 1KD1C 3FDRA 5LL6S 4IURA 3SWNA 1GFCA 4RKUE 1GFDA 2E5QA 1W6XA 5A0DA 4J9DA 1A0NB 5C6SA 2JXBA 3O5ZA 4B9WA 3CMEA 1M90U 1AEYA 1X01A 1M3AA 1ACMB 3OA6A 4ZGEB 4LXCA 2E70A 4RTXA 3MO8A 1U1TA 4XU0A 2H8HA 2LCCA 3DB3A 3PNWC 2C0OA 2QDYB 1T0HA 2K2VA 2NYSA 3L42A 1R8OB 2L2PA 2FZKB 5A0LA 1WXTA 4X9DA 1N8RC 2DJZA 4JUVA 4M77E 1WGSA 3NTIA 2CZ0B 4XTXA 2LJ1A 1G3TA 1RAAB 3A1PA 5CCAA 4IUVA 2QGGA 1ZA2B 1AWWA 2NWMA 1KQSS 2F1LA 3IQLA 5FRMA 2RK1A 4JZ3A 1IREB 3QBYA 2OTJT 5KYXA 3I9QA 2GFUA 3JB9I 1JO8A 1ARKA 3TEEA 2EYXA 2XK0A 3EH2A 1YITA 2BUDA 2LT1A 4F17A 3VV0A 1M2VA 1XJWB 3CC4T 3QUIA 1Y7XA 1VQ8Q 4DEXA 2ESWA 2PVOB 1YHQA 2MWPA 3TU4K 1G3YA 2CH4A 1ZUYA 4JJNK 4F14A 3UWNA 1VQ7Q 4M77C 3SWNB 3LWHA 3OYNA 4XU2A 3JCMW 3JCMd 4PFPA 4BY6C 2KXDA 1NM7A 3EH1A 3CCST 4LD9K 1OX8A 3BFMA 3A8OB 2DTHA 1PM3A 3OYDA 2HZYA 1E6GA 4OVAA 1G83A 1LPLA 3PVQA 2P0PA 3HFNA 2BZYA 2QTXA 4JJCA 5GAMg 2QQRA 4HVWA 3JCMb 1QKXA 1VQOQ 3MP1A 3CCEQ 3CCRT 4M7AA 2KYBA 4PJMA 1VQMQ 3M59A 2DIQA 4L5GA 1VQPA 1KQSA 3NFCA 2RHYA 3C12A 4GLKA 4HXJA 2D8HA 1B34A 3CBPA 1VQ4Q 1PRMC 2O31A 4J6YA 5KH6A 4E7IA 3Q1JA 2CP6A 4F7UA 4V2SA 1CKBA 3H6ZA 1EX4A 2E65A 1Q82U 1VUBA 1K73R 1HJDA 1VQ5T 2RB6A 2O88A 2A08A 3OYYA 2YUQA 1QWEA 4BD3A 1PG5B 3CCQA 1M30A 4BDYA 1X2KA 4QVDA 3EGXA 2QQSA 4DBFA 2KRSA 1D0XA 4EPCA 5KE2A 1M2VB 3CPWP 3G4ST 2Y4YA 2AKKA 2YLCA 3CPFA 4ZNXA 3MKDA 2KXCA 2ED0A 2CP3A 1D1BA 4OMNA 4FM4B 3INZA 1RABB 1X6GA 4DBQA 2L89A 1UGSB 5KYUA 2CP0A 1UJYA 2HL3A 3OS2A 4D6WA 3LLRA 1QVFP 3QXEB 2EQKA 2MMPA 3EGUA 1KC8U 4LD6A 3MEWA 3DKMA 3JCMP 2HCKA 2P4RA 2X9HA 4PJNA 2CGHA 2M16A 2XG8D 2DVEA 4ELZC 3QIIA 4M7AB 1N9SA 2B8AA 2JTMA 2DETA 1HK9A 1ZSGA 1JB0E 2VWFA 2HD0A 4C92E 1MGQA 1JJ2S 1B34B 4M75A 5GAOm 4MDXA 3QKJA 2NUZA 2DPPB 4PFOA 4RTYA 1OQKA 2AHJB 4BUGA 2QAZA 4F7UB 2JMAA 3QJ6A 4PJOE 4J9FA 2COWA 2LMJA 4AFQC 1XOVA 3G6EQ 2L3SA 3FB9A 1AHJB 2L3PA 1PSEA 1VQ8A 1SEMA 3RMQA 3FEOA 1YJNA 4C0GA 1OZ3A 3EGXB 2EGAA 2LTOA 1G2BA 5LJ3g 2G3RA 2BE7D 3I5SA 1VQ7A 5KE3A 3RKWA 2CP5A 4HVUA 4M7AD 3H41A 3GPLA 4UC4A 1Q86U 1VQKA 1QCNA 1ZSZC 3PIPA 5GAN3 3S3OA 2QGFB 3OYIA 3GNGA 1IHWA 3CC2A 2QEXT 5AYFA 3THKA 1MHNA 1VQOA 4JS5A 3CCEA 4OGEA 3KXTA 3CC4Q 1BU1A 4PJOC 2RQWA 2AKLA 3RBBB 3KBGA 2DEUA 1JJ2A 1BI0A 4FYXB 1QW1A 3I56T 1RAEB 3ER0A 3JCMX 2DVJA 2JUFA 2XICA 1TXQA 3FLGA 4E7SA 4BE1A 1Q95G 4M7DF 3RMSA 3GP8A 1K0XA 5FU7B 4Z02A 4M4ZA 4PNOA 4M75B 3JCMV 3CCSQ 4C8QE 1DJ7B 5GAOl 3M0QA 3VUZA 2W0ZA 2OAUA 1UECA 2YLBA 2MIOA 2F5TX 3PT9A 1LVKA 2GNCA 4Y92A 4ORZA 4AG2C 1Q7YU 1Q81R 3BDUA 5C0MA 1WQWA 3QZ5B 3M0SA 2VB6A 3U23A 4FYWB 2O9SA 3CCRQ 4OMFB 1M4ZA 3M57A 2K3YA 5AT1B 3JRZA 2VYTA 2V8KA 2K3BA 4QVZA 2AT1B 2F69A 1BKBA 2CSIA 2DEQA 5I11A 1QKWA 2CH4W 1OPLA 3M58A 1PD0A 2VGNA 5DY9A 4L6V5 1JQQA 1OU9A 4OF1A 4QVCA 3CXCP 3CD6A 1K76A 4OMPA 4EMGA 1N27A 1W2BP 1Z9ZA 3VS4A 4C8QC 1W70A 2EYWA 1ABQA 1UEBA 5KCHA 4MZTA 5GAMh 2ABLA 1KD1U 1VIEA 3MEUA 5CK9A 2K5LA 1C0MA 3HRUA 1WDXA 3UDCA 5FLXE 1D1AA 2DXBA 2HSPA 4JJDA 2H3JA 5GMKh 2RN8A 2RH2A 4HT9A 4LDWA 1VYVA 2KDSA 4KGVB 2RHUA 1SHGA 5GAN5 3AHUA 1FWZA 2GCXA 5LJ5h 2MI6A 1Y0MA 1VQ6T 1K73C 2X3XD 2HQHA 1LCKA 2BZXA 1GCQA 2RJDA 3G7ZA 1BB9A 1N8RU 4R56A 2DLPA 3CQTA 4RTWA 1TUCA 3P8DA 3VS7A 5HKCA 1EZZB 5GAMf 1T0JA 3M55A 2FPDA 1WNLA 5FROA 1YIJT 1WA7A 1XNIA 1RLQC 1I4K1 3L2RA 4J83A 1FMVA 5GANh 1C6VX 4MMKA 1NG2A 1VQMT 2LQWA 2OTJA 4F04B 2K9GA 3QWYA 3GOXA 1VQ4T 3LWIA 1YBYA 1W4SA 2RMOA 5LJ5f 3JB9H 1PC0A 1QWFA 4WTOB 2CT3A 3ULRB 4ZTFA 3HHTB 3CC4A 2RHZA 5GMKi 5M9OA 3DLMA 4J7IA 1AZEA 4AT1B 3EG1A 2EW3A 3AT1B 3X24B 2EFIA 2EGCA 2NUTA 5GANf 2JOYA 2KROA 3QDFA 3UA7A 2X4XA 2VV5A 3HL8A 4PLIA 2MCNA 3C95A 2PUKB 4A4HA 3CCSA 2JS2A 4M77F 1V1CA 1QVPA 1B3QA 1RI0A 4MZPA 4L59A 4FU6A 1IRXA 2XHCA 3EFOA 2OJ2A 1WX6A 2MOXA 1MMGA 3MP6A 2QEXQ 3C4SA 1AWOA 1PD1A 4HCZA 3CCRA 1OULA 2F2XA 2O2OA 1KQSP 4KH1B 2YHTA 1OI1A 4E47A 1UGQB 2BIVA 2BTTA 1ZBJA 3I56Q 4OMOA 4N4IA 5LJ3h 3VRYA 4KBMB 2X51A 5GJVB 1GL5A 2LQ8A 3OS1A 4OB3B 5GMKm 4M7DB 4Q5WA 1VQ5A 4ZN1A 4KULA 2V1QA 2YUPA 1MMDA 2FB7A 2RF0A 1KK7A 3RUXA 1VQNT 3LH0A 1UE9A 4A4FA 3CCVT 5IN1A 2JM8A 1D0YA 2V26A 3LW5E 3SWNC 5HK0A 3G4SA 3G6ET 1ZLMA 2QG9B 1HSQA 2DNUA 3CCJT 1YI2T 4WF2A 3QWXX 4EIKA 3ZL7C 2DX1A 2JN0A 5D7UA 1RACB 2NUTB 1WFWA 5LJ3f 1UG1A 2FEIA 3H8ZA 4PJJA 1PSFA 1K9MU 4JRPA 1NYGA 2HEQA 2DK3A 4DBRA 1M3CA 4CRIA 4FSXA 3OMCA 4RUGA 2L3RA 2EKOA 4LNPA 2CYZB 4M7DD 1EFNA 1RI9A 4LUEA 1AWJA 3EFOB 4JRQA 2E12A 1WJRA 1T3SA 1UGPB 1R0CB 4FL6A 1RADB 2MPXC 3M53A 1M2OA 2EWNA 4PJLA 1Q81C 2EAYA 5FU6B 1KHCA 3H0HA 2OAWA 3O8VA 4DOWA 1NJIR 8ATCB 2P4TA 3QJYA 1IZ6A 4E6RA 3ZEHA 2EIFA 4HKEA 2GFAA 2DA9A 2BZ8A 2DZ9A 4OB2B 2CUBA 3NGPA 4M7AE 1JEGA 1SSFA 4E7LA 4OB1B 2ROTA 4J9CA 1MUZA 4C5IA 2MAMA 2BKDN 3TCJA 1RUWA 1R77A 2RJEA 1VQ6Q 2MWOA 3OB9A 3NMZC 4E7JA 1K8AR 2LRQA 1V29B 4J6XA 1G8XA 3D7SB 4F7UE 4X1VA 1EIFA 2PVGB 1YIJQ 1HXDA 2FHDA 1QCOA 5I21A 1AD5A 1OV3A 3LH5A 2XIDA 5GAN8 2RI2A 3CCLT 3X20B 3DB4A 4KGXB 2RNAA 2DZCA 2LVMA 1GCPA 1M3BA 1BK2A 2R5AA 4QT7A 3JCMh 3REAB 2LP5A 2RK2A 1KHIA 4M78G 5L8RE 2KE9A 1ZA1B 2EJFA 4C92F 5LJ5g 2QEXA 4M7AC 4FCYA 2WSEE 2LJ0A 1JJ2P 2A28A 2JW4A 1HYOA 1MNEA 3VS1A 3OSSC 3DLLA 2MK5A 2E4HA 2A7YA 2RI5A 4LDUA 3I56A 4RTVA 1OZ2A 2E6ZA 4M7DG 3LGLA 4PJOF 3GLXA 4RMOA 2JS0A 3J7AF 2M1HA 1NEBA 1ZUKA 2C0TA 3SHWA 3EAEA 3E9GA 5GANg 1FMWA 4IIOA 5GAOq 2V1RA 3NTHA 3L2VA 3CMAT 3NPFA 4JJBA 2K5FA 3WXMB 4ZGJB 5GAOp 1H8KA 1NBEB 1OPKA 1SHFA 3VS5A 2CUDA 3VU3C 4XTUA 3R6NA 2KRNA 1JBMA 5KYNA 1IB8A 1IHVA 1K9MC 4M75E 1ZUUA 1IGUA 2X4JA 3GNFB 1NLOC 3CBMA 2YUOA 1OYXA 2LDMA 4JLIA 2JTEA 2D0QB 2DERA 1Y96A 1YP5A 4J9BA 2COZA 2X4YA 1WZOA 2EVRA 3ZBDA 3I55T 1WHMA 1QP3A 3HP9A 1CKAA 4RTTA 2J6OA 4J9IA 3RERA 4JRKA 5GAMj 4MZMA 1I1JA 3OY9A 5EC7A 3X25B 2LCSA 2ENMA 1VQNQ 1G3SA 2KBTA 2KK4A 3CCVQ 3OYKA 1KQ1A 4C0FA 5GMKj 1TU0B 1NPRA 4C0DB 1M9SA 3URGA 1PHTA 2RQTA 2FO0A 2GGRA 2F2WA 4BE0A 4DA4A 5FU7C 3CCJQ 4HVVA 2D0NA 1YI2Q 5IHKA 4M75C 1H3ZA 5LJ5j 2E3IA 1X6BA 2YRDA 4OMMA 2J06A 2A36A 1TOVA 3RDVA 2K4YA 1WLPB 2QI2A 1YJWT 3OSVA 2J05A 2HBPA 4J8OA 1S72T 2GTJA 2JJ9A 2YDLA 4CC7A 2DL7A 2WACA 2QQ9A 3MJXA 1VQ6A 3JV3A 3KFVA 1K73U 3QYHB 3RKYA 1K9AA 4HA8A 5GANj 3JB9F 4OMQA 1PRLC 2ROLA 3QYGB 2PZ1A 4CC3A 2GQVA 3M0RA 1YIJA 2ZAEA 1VOMA 2NUPA 2JNGA 2X35A 5GAN2 4M78F 3QZ9B 2K79A 3V7SA 4MMLA 2KNBB 2RQVA 2XDDA 1VQMA 4B6MA 2KYMA 1SG5A 2QK0A 1J3TA 1Y96B 2L0AA 4X34A 3N5BB 2I2LA 1VQ4A 4DOVA 2DYIA 3T9NA 3PFSA 1U3OA 4IUTA 3RR6A 4EMKA 1B07A 1I8FA 4QQGA 2JMCA 1BI3A 1SRMA 2EQMA 1KQ2A 6AT1B 1YJ9T 3M4YA 2RPNA 3JCMJ 1B7TA 1WHLA 5GAOr 1D1CA 3CCLQ 1GRIA 2HKQB 3MEVA 3VYGA 4J9HA 1BCMA 3MEAA 1TWBA 4M77G 3META 2QYZA 3VRZA 2KY9A 2DMOA 4II1A 1NJIC 2A3LA 3LGFA 2Z0WA 3SB2A 2GBQA 4LDYA 2QA4T 1GBQA 4NOYA 4ME7A 2AZVA 1TUGB 3C0CA 3HRTA 4BI8B 4BI4A 3WVEB 4GY5A 3CCUT 2IVWA 1BI2A 4KRTA 2AK5A 5CAIA 3PIOA 1VA7A 1K4US 3JB9J 5LJ3j 4C92B 1I5LA 2E10A 3PMTA 3RIRA 5KYWA 1RAGB 2EKHA 2JM9A 5GAMd 2CZ7B 1MMNA 4Z89A 2LNVA 3FC3A 4KH0B 2PVDB 1K8AC 1P92A 2FRYA 2NUPB 2DRKA 2LX7A 3PE0A 3I5RA 1JXMA 1U5SA 2A0FB 3CMAQ 5J26A 2RM4A 2E41A 4J6WA 3MPUB 3CMEQ 4IUUA 2ZPEB 2EQUA 2E1HA 3JCMg 3VUBA 2MYSA 1PNJA 2YRCA 5GAN4 4EMKB 3NHNA 2L5QA 4HT8A 1WJQA 1VQNA 1X27A 1BYMA 1QCFA 2PTKA 4N0AA 3CCVA 4AMCA 2DIGA 3BDLA 5J3BA 2DE0X 3G6EA 2OX7A 2FYKA 1WPYA 4RCBA 3RESA 3CCJA 1YI2A 1SSHA 2KVQG 3FJPA 4C92D 3R6OA 2LT4A 5A2QE 3OW2S 1AT1B 2QASA 2EJ9A 2OTLT 2XKOC 3EG0A 3I55Q 2JVVA 1BIBA 1VQ9T 1MV0B 2EJGA 2YRVA 2COYA 1FX7A 1D0ZA 2IIMA 4YTLA 1AVZC 2AZSA 1M90R 3E2UA 2O4XB 2DBMA 1GCQC 2PU9B 4M7DA 3E9FA 3QHSA 1X6OA 3CBOA 2V8IA 2K57A 3OYMA 3J81E 1M1GA 2EYQA 1M8VA 4Z88A 4PK4A 4RG2A 3A8GB 1Q81U 2EYZA 1VQLT 5KYWB 1YFNA 2EQJA 3CXCS 2DL3A 4BE2A 3S3MA 4N4HA 4M7DC 4JLGA 4CC4B 4X9CA 1KJWA 2CREA 1QVGS 3L1AA 4A4KA 8AT1B 1IGQA 5IH2A 1YJWQ 4PFZA 3M4GA 4FYYB 2RJFA 4BACA 4XK8E 1QLYA 2QQBA 3OBWA 1S72Q 2O9VA 2K7AA 3OYCA 2GF7A 2XD0A 2HDAA 4ELYC 2XDBA 4A53A 4RCCA 4JZ4A 2KQWA 1TUDA 2H3EB 1U1SA 3OW2A 1T3LA 4PKCC 3E19A 3M0TA 1ZBXA 2DF6A 2VVKA 2KMTA 1X2QA 1NE8A 3HKSA 3HPWA 3CCLA 4N4GA 2FRWA 5IT9E 3TVTA 3BY7A 3FIFA 4AFSC 4M78B 1JRIA 4QW2A 5LJ3d 3H0IA 5FW9A 2R57A 1QP2A 2V8JA 1SPKA 3ME9A 1W1FA 1AZGB 4C92G 2CKKA 5D6XA 3EG2A 4RTUA 3H9NA 2M02A 1XQHA 1ZHIA 2FVUA 3FJ5A 2C06A 2M0OA 4FW2A 1I07A 1UGRB 2P0KA 1BI1A 3CCQQ 5D6YA 1NYFA 1YJ9Q 1TG0A 2K3XA 4PJOG 4M7AF 2ECZA 1WHGA 1M1FA 1QVGA 1E7OA 2ZPGB 3CC7T 4Y28E 4QQDA 4KUDK 2CP7A 3C94A 4O6JA 4OP0A 3JB9D 3LYIA 3GBQA 2FZGB 2KR3A 3CMAA 3BW1A 2HKNA 3UA6A 2K5IA 5IHIA 4F7UF 5GAMe 1OOTA 2CT4A 2HQXA 3UATA 2CP2A 2HL5C 2QA4Q 4M78D 5FWCA 2VC8A 3UT1A 1CSKA 1NZ9A 3JSCA 2DL5A 1Q82R 1BCOA 3CCUQ 2ZPBB 2ZPFB 5L23A 5GMKe 5CQXA 3OMGA 1D09B 3ZFJA 1K1ZA 5D6WA 4WCIA 5CO7A 1KFZA 3SD4A 3QDRB 2RHXA 2CZ6B 1YWPA 2JZ2A 2EGEA 2F2VA 5LJ5e 4FSSA 1WJSA 2KGTA 2CSQA 4KT0E 4LN2A 3I55A 2LCLA 4B9XA 3L2QA 3VS6A 4LDXA 5DLQE 4RG8A 5A0GA 4FT2A 2LQNA 2ZPIB 5EG2A 1QQJA 2M0YA 3G71T 4XAXB 4JDSA 2D9TA 4A4GA 5GANe 1VYTA 2DBKA 2P84A 5I22A 1UB4A 2W10A 4M77A 4Z8AA 4C0ZA 4C8QG 4JS4A 2DJQA 1KC8R 2DTIA 4E2FB 1FYNA 3TQ7P 5GMKl 1UFFA 3I35A 1YJNQ 5CKDA 1H92A 5CKBA 2J6KA 1PWTA
chains in the Genus database with same CATH topology
1KQ1A 5CIUA 3M58A 4C0FA 5GMKj 1NPRA 4J5YA 3V8LA 1M9SA 3URGA 4C0DB 4BDZA 4E7KA 2VGNA 5DY9A 4L6V5 4M75F 4OF1A 3GF5A 3V7CA 4QVCA 1YJWA 3CD6A 4EMGA 1WQ7A 2HNIA 4C8QD 4BE0A 1N27A 4XTVA 3ASKA 4DA4A 5FU7C 5I2SA 3EFRA 4XQ3A 4Y91A 4R55A 1S72A 4M75C 1H3ZA 4C8QC 2VXFA 2LQKA 3WVDB 5CR2A 5LJ5j 2DO3A 1RL2A 4P5NA 3JB9G 1UEBA 5KCHA 3OBYA 2K4YA 3A8HB 1Y71A 2QI2A 4MZTA 5GAMh 1YJWT 1BIAA 1KD1U 1VIEA 4FIBA 3CD6T 3MEUA 5FU6C 2R58A 2ZPHB 3OSVA 5CK9A 2HBPA 2K5LA 4J8OA 3CXCA 3HRUA 3CCMA 1U8RA 1S72T 3E1SA 5CKEA 4TVRA 3UDCA 4BB7A 5FLXE 1W2BA 2WACA 2DXBA 2QQ9A 5CQYA 1VQ6A 3A5ZB 1H641 4XTWA 2H3JA 5GMKh 1ZQ1A 1K73U 1N6AA 3QYHB 2RH2A 3RKYA 4HA8A 5GANj 1KD1C 3JB9F 4ATOA 3FDRA 4HT9A 5LL6S 4LDWA 2KDSA 4IURA 3SWNA 3QYGB 4RKUE 2RHUA 3CCMT 2E5QA 2WSFE 3J80E 2VGMA 5A0DA 2GQVA 4M7DG 5GAN5 1YIJA 1FWZA 3AHUA 2GCXA 5LJ5h 2MI6A 5C6SA 4B9WA 3KUFA 3OYEA 3CMEA 3QG1A 1VQ6T 2JNGA 1M90U 2X35A 1X01A 3RKXA 5GAN2 1K73C 1I81A 3OA6A 4M78F 4ZGEB 2RJDA 3G7ZA 2E70A 3QZ9B 3UPUA 1N8RU 4R56A 3V7SA 4MMLA 4OGCA 3MO8A 1U1TA 2XDDA 4XU0A 1VQMA 2LCCA 3P8DA 3DB3A 5HKCA 3PNWC 4C0DC 5GAMf 2RO0A 1Y96B 3M55A 4X34A 1WNLA 5FROA 1YIJT 2QDYB 3N5BB 2K2VA 3L42A 1XNIA 1R8OB 3JCMf 3S3NA 2RJCA 1G3WA 2I2LA 4VUBA 4DOVA 1I4K1 1TH7A 2RHIA 5LJ3e 5A0LA 3L2RA 3CMET 1VQ4A 4J83A 3SDZA 1YJ9A 4X9DA 3T9NA 1N8RC 5GANh 3PFSA 4FT4A 4IUTA 4EMKA 4MMKA 4M77B 2DJZA 4JUVA 2ZCFB 2P0QA 4M77E 1I8FA 1WGSA 5HY6A 3HFOA 3NTIA 2CZ0B 4XTXA 1VQMT 4QQGA 1G3TA 2OTJA 4BY6B 1BI3A 3GOXA 2EQMA 5CCAA 1VQ4T 1KQ2A 4IUVA 2X4WA 5KCOA 3LWIA 1YBYA 1YJ9T 1W4SA 1KQSS 2LX9A 5LJ5f 3JB9H 1NJIU 2Y4XA 5FRNA 3M4YA 3JCMQ 5FRMA 2RK1A 3EFSA 3JCMJ 1IREB 2KSSA 3QBYA 2LC4A 2OTJT 4ZTFA 2QA4A 2GFUA 2VXEA 5GAOr 3JB9I 2PQWA 3HHTB 3CC4A 2RHZA 5GMKi 1G5VA 3MEVA 3NTKA 3QO3A 3DLMA 3VYGA 5M9OA 3MEAA 4M77G 3META 4J7IA 2KY9A 2HAXA 3CCUA 4II1A 3TEEA 2A3LA 3LGFA 1NJIC 3VYHB 2XK0A 1D3BA 3SB2A 2RA2A 1YITA 2BUDA 2LT1A 3VV0A 4LDYA 4NL3A 2ZGWA 3X24B 2EFIA 5GANf 4KUIA 4NOYA 2QA4T 2DKGA 4ME7A 2JOYA 3CC4T 2RD1A 3QUIA 1Y7XA 2X4XA 3HRTA 2VV5A 4BI8B 3HL8A 4PLIA 2PVOB 2XDPA 3JAME 4BI4A 3C95A 3WVEB 2PUKB 2MWPA 4A4HA 4GY5A 3CCUT 1YHQA 2IVWA 3TU4K 1K8AU 1BI2A 3S6WA 3CCSA 4IUQA 3QSUA 1G3YA 4IUPA 4M77F 5CAIA 4M77D 3PIOA 4JJNK 1YITT 1QVPA 3OYJA 3UWNA 4ZGDB 3JB9J 1RI0A 5LJ3j 3MCAB 4MZPA 4L59A 4C92B 2E10A 3PMTA 4FU6A 3RIRA 1I5LA 4M77C 3SWNB 2JTFA 4C8QF 3LWHA 3OYNA 5GAMd 3X28B 4XU2A 2XHCA 3PGGA 3VKIA 3MP6A 2CZ7B 3V8JA 3M54A 3JCMW 3A8MB 2LNVA 3FC3A 1YHQT 2PVDB 1K8AC 3JCMd 4BY6C 1P92A 2PUOB 3CCST 3C4SA 4HCZA 4LD9K 3BFMA 3CCRA 3A8OB 3HRSA 2DTHA 2YHTA 1OI1A 2XU8A 3OYDA 3X26B 3LX7A 5J26A 2RM4A 4OVAA 2E41A 4E47A 1UGQB 2BIVA 2P0PA 3CPWS 4J6WA 3HFNA 2QTXA 5GAMg 3CEYA 2QQRA 3JCMb 4IUUA 2ZPEB 2EQUA 2E1HA 4N4IA 3JCMg 3MP1A 3VUBA 3CCRT 4M7AA 4A4EA 5GAN4 5LJ3h 4EMKB 2L5QA 4HT8A 3M59A 1WJQA 4KBMB 2DIQA 2XI9A 4L5GA 4C92A 3NFCA 2RHYA 1VQPA 2LQ8A 3OS1A 1KQSA 1BYMA 4OB3B 3C12A 5GMKm 1NPPA 4M7DB 4N0AA 3CCVA 2MF2A 4GLKA 4Q5WA 2E6NA 1VQ5A 4ZN1A 1B34A 3CBPA 2DIGA 3BDLA 4KULA 5J3BA 2OTLA 2D6FA 4J6YA 5KH6A 4E7IA 3G6EA 2L8DA 1QVFS 3Q1JA 2FB7A 1VQ9A 4OB0B 2FYKA 1WPYA 4RCBA 3RESA 3CCJA 1LOJA 1YI2A 1M90C 3RUXA 2KVQG 3FJPA 4F7UA 4V2SA 1VQNT 3FRNA 3LH0A 1VQPT 4PJOA 4C92D 3R6OA 2LT4A 4C5GA 3H6ZA 5A2QE 3OW2S 1N9RA 2E65A 5CKFA 4A4FA 3CCVT 1VUBA 3OS0A 5IN1A 1Q82U 1VQ5T 2EJ9A 2OTLT 4C92C 2XKOC 2DD5A 2RB6A 3G4SA 2CS7A 3LW5E 3SWNC 5HK0A 3G6ET 2JVVA 3OYYA 1BIBA 4BD3A 1VQ9T 2EJGA 2YRVA 3CCJT 3CCQA 5GAN8 1YI2T 4WF2A 1FX7A 4BDYA 4QVDA 4JRIA 4YTLA 1D3BB 2R5MA 2DTOA 5IAYA 2QQSA 2JN0A 1Q82C 3JCMe 2O4XB 4EPCA 2PU9B 5KE2A 3L2WA 4M7DA 5LJ3f 1VQLA 3E9FA 3G4ST 2Y4YA 2YLCA 3CPFA 3H8ZA 3QHSA 1PSFA 1X6OA 3CBOA 1K9MU 3OYHA 2V8IA 4JRPA 2K57A 2WSCE 2E64A 3OYMA 3J81E 3CCQT 2DK3A 3L2ZA 1M1GA 2EYQA 4CRIA 4FSXA 3OMCA 1M8VA 2L3RA 2EKOA 4RG2A 3A8GB 3F70A 1Q81U 4FM4B 3INZA 2CYZB 4M7DD 1VQLT 4EMKC 3A8LB 2EQJA 2L89A 1LNXA 3M9QA 3CXCS 2DXUA 4BE2A 3S3MA 1UGSB 4N4HA 2FL7A 4XTYA 4JRQA 4M7DC 2E12A 1WJRA 1UGPB 3OS2A 3CPWA 4D6WA 4FL6A 3LLRA 4JLGA 4X9CA 1X75C 3VJPA 3QXEB 1QVGS 3M53A 3L1AA 4A4KA 1XTDA 5DM7R 2EQKA 2EWNA 4C5HA 1Q81C 2EAYA 2MMPA 1KC8U 2QQAA 5FU6B 2O4XA 1KHCA 3M4GA 4LD6A 2RJFA 3DKMA 3MEWA 3O8VA 4XK8E 2QQBA 4DOWA 3OBWA 4DQ2A 4BACA 3JCMP 2P4TA 3QJYA 1IZ6A 2CGHA 3ZEHA 2M16A 2EIFA 2M9UA 2GFAA 2XG8D 4HKEA 2GF7A 5HK3A 3OYCA 2DVEA 4ELZC 3QIIA 4M7AB 2DZ9A 2XD0A 1N9SA 2B8AA 4OB2B 1KC8C 1QVFA 3GIBA 4ELYC 4EDUA 2JTMA 4M7AE 1M1KU 1SSFA 2XDBA 4E7LA 4OB1B 1HK9A 4A53A 4RCCA 2KQWA 4BI3A 4LDVA 1JB0E 4C5IA 1U1SA 2HD0A 2MAMA 4C92E 2BKDN 1MGQA 1JJ2S 3TCJA 3JCMc 3OW2A 1VQNA 1B34B 4M75A 2RJEA 4PKCC 3E19A 5GAOm 4HCBA 4MDXA 1ZBXA 4C8QA 3QKJA 3MP8A 2DPPB 2KMTA 2MWOA 1NE8A 3HKSA 3HSBA 3HPWA 3OB9A 4N4GA 3CCLA 2AHJB 4BUGA 2IG0A 5IT9E 5J39A 4F7UB 4E7JA 4O5VA 3OQ5A 2LRQA 1V29B 4PJOB 3BY7A 3FIFA 4J6XA 2DXCA 4F7UE 3QJ6A 2KAFA 2PVGB 1EIFA 1Y07A 1O75A 1JRIA 4M78B 4PJOE 4QW2A 1M5Q1 1HXDA 5LJ3d 2R57A 1XOVA 4M78E 2FHDA 4M75D 1QP2A 4M7AG 1KG1A 5I21A 2V8JA 3M56A 3FB9A 3V8KA 2XIDA 1AHJB 2CZ1B 2RI2A 3ME9A 3X20B 3V7RA 4J7FA 1PSEA 4C92G 3CCLT 3DB4A 2CKKA 3M5AA 5D6XA 5GAN6 5DLOA 1VQ8A 3RMQA 3FEOA 1YJNA 2DZCA 4C0GA 4EMHA 5LJ5d 2LVMA 1OZ3A 1XQHA 1ZHIA 2FVUA 2C06A 3CC7A 3PMIA 2M0OA 2LTOA 5GAOn 2R5AA 3QPHA 5LJ3g 1UGRB 2G3RA 3JCMh 4M7DE 2P0KA 1VQ7A 1BI1A 5KE3A 3RKWA 4F7UG 5D6YA 2DAQA 2K3XA 2RK2A 4PJOG 4M7AF 4M7AD 4HCCA 1KHIA 1VQ8T 3GPLA 3OYAA 4M78G 4UC4A 1YJNT 1LJOA 5L8RE 1Q86U 1M1FA 1FXXA 1VQKA 1QVGA 2EJFA 2VUBA 2ZPGB 5CVIA 4C92F 5LJ5g 4Y28E 2QEXA 3CC7T 4M7AC 4QQDA 2QXFA 4KUDK 2Y90A 3C94A 4M78A 4O6JA 5GANd 2WSEE 4OP0A 4A54A 3LYIA 4QQ6A 3JB9D 1VQ7T 3P8BB 4N0AC 3PIPA 3OSSC 1VIFA 3CMAA 3BW1A 5GAN3 3DLLA 3S3OA 1Q86C 3OYIA 2K5IA 3GNGA 2A7YA 2RI5A 4LDUA 4F7UF 3I56A 1OZ2A 2E6ZA 5GAMe 3LGLA 4PJOF 3GLXA 4RMOA 2HQXA 2QEXT 3CC2A 5AYFA 1VQOA 1MHNA 3J7AF 4PJOD 4JS5A 2M1HA 3CCEA 4OGEA 4M78D 3KXTA 3PTAA 3EAEA 2VC8A 3E9GA 3UT1A 5GANg 4PJOC 5GAOq 1NZ9A 3JSCA 3NTHA 3KBGA 4M78C 4C5EA 3L2VA 3CMAT 1JJ2A 2K5FA 2ZPBB 3WXMB 4ZGJB 5GAOp 1BI0A 2ZPFB 2DD4A 4NL2A 3OS5A 4PL6A 1QW1A 3SFMA 3I56T 3ER0A 5GMKe 3JCMX 4XTZA 5CQXA 2JUFA 2NLUA 3OMGA 3CC2T 2ZZDA 2O01E 2XICA 3ZFJA 3OYBA 3VU3C 4XU1A 1VQOT 4XTUA 5D6WA 3CCET 3FLGA 4BE1A 5CO7A 1JBMA 4M7DF 3OYLA 3RMSA 3SD4A 3GP8A 4ZN3A 3QDRB 2RHXA 5FU7B 2CZ6B 2JZ2A 4Z02A 3G71A 1K9MC 4PNOA 4M75B 5LJ5e 1W2BS 3JCMV 1WJSA 4C8QB 4CI0C 4M75E 4PLLA 4C8QE 1DJ7B 2HQEA 4KT0E 2X4JA 5GAOl 4IKFA 3GNFB 3I55A 3VUZA 2LCLA 4B9XA 3L2QA 4XU3A 2OAUA 2YLBA 3CBMA 5DLQE 4RG8A 2F5TX 4ZTJA 4LDXA 1GXIE 1OYXA 2LDMA 3PT9A 4JLIA 5A0GA 4FT2A 2ZPIB 1Q7YU 2D0QB 5EG2A 3BDUA 3G71T 5C0MA 1WQWA 3QZ5B 1Y96A 1VQKT 4XAXB 4JDSA 3L2UA 3MHXA 2X4YA 2D9TA 4A4GA 3TREA 3ZBDA 3OYFA 5GANe 2DXTA 1YCYA 2F5KA 3P8HA 4NS5A 4OMFB 3I55T 1M4ZA 1QP3A 3HP9A 3M57A 2K3YA 4M75G 1UB4A 4M77A 1Q7YC 3OYGA 5CKHA 3JRZA 2VYTA 4C0ZA 4C8QG 4JS4A 2V8KA 3RERA 4JRKA 2DTIA 5GAMj 4QVZA 4E7HA 2RI3A 2F69A 4MZMA 5GAN7 5GMKl 3OY9A 5I2MA 1O9SA 1BKBA 5CKDA 3X25B 1M1KC 5CKBA 1G3SA 4MDWA 2DEQA 2KK4A 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ1 A;  4M77 G;  4PJO G;  5GMK j;  4J5Y A;  3JCM e;  3V8L A;  4M7A F;  4M7A D;  4M7D A;  3V7C A;  5DY9 A;  4M75 F;  5LJ3 f;  4M78 G;  4QVC A;  1LJO A;  4EMG A;  1WQ7 A;  2HNI A;  2YLC A;  3QHS A;  4C8Q D;  2EJF A;  4XTV A;  4C92 F;  5LJ5 g;  1D3B A;  3SB2 A;  4M7A C;  3GIB A;  3EFR A;  2RA2 A;  4XQ3 A;  4Y91 A;  2K57 A;  4M75 C;  2E64 A;  2Y90 A;  4M78 A;  4NL3 A;  5GAN d;  2ZGW A;  4OP0 A;  3L2Z A;  2VXF A;  4A54 A;  4NOY A;  4C8Q C;  2DKG A;  5LJ5 j;  5GAN f;  3JB9 D;  3JB9 G;  1M8V A;  2RD1 A;  3QUI A;  4N0A C;  3BW1 A;  5GAM h;  5GAN 3;  3INZ A;  4M7D D;  1BIA A;  4EMK C;  3QSU A;  4F7U F;  1LNX A;  4M7D G;  5GAN e;  2DXU A;  5GAM e;  4M77 F;  4PJO F;  5CAI A;  4M77 D;  4PJO D;  4XTY A;  4M7D C;  3JB9 J;  4M78 D;  5LJ3 j;  4C92 B;  4X9C A;  2E10 A;  1I5L A;  2VC8 A;  3RIR A;  4M77 C;  5GAN g;  3SWN B;  4PJO C;  3L1A A;  4C8Q F;  5GAO q;  2EWN A;  1H64 1;  4M78 C;  2EAY A;  4XTW A;  3PGG A;  4XU2 A;  5GMK h;  5GAM d;  3JCM W;  3V8J A;  3RKY A;  4HA8 A;  5GAO p;  4NL2 A;  3JCM d;  5GAN j;  3M4G A;  3JB9 F;  4HT9 A;  3JCM P;  4DQ2 A;  5GMK e;  4XTZ A;  3SWN A;  3JCM X;  3BFM A;  3VU3 C;  2DTH A;  4XU1 A;  4XTU A;  2CGH A;  1JBM A;  2YHT A;  5GAN 5;  3AHU A;  4M7D F;  5LJ5 h;  2DVE A;  2RM4 A;  2E41 A;  2DZ9 A;  4M7A B;  1N9S A;  3RKX A;  1X01 A;  3HFN A;  4J6W A;  5GAN 2;  4PNO A;  4M75 B;  5LJ5 e;  1I81 A;  2QTX A;  5GAM g;  4M7A E;  4M78 F;  3JCM V;  4C8Q B;  4F7U G;  3JCM b;  4A53 A;  1HK9 A;  4M75 E;  4RCC A;  2E1H A;  3V7S A;  3JCM g;  4C8Q E;  4MML A;  1U1S A;  1U1T A;  4C92 E;  4XU0 A;  1MGQ A;  5GAO l;  3JCM c;  4M7A A;  5GAM f;  1B34 B;  4M75 A;  1Y96 B;  4XU3 A;  5LJ3 h;  5GAN 4;  5GAO m;  4EMK B;  1WNL A;  2YLB A;  4C8Q A;  4HT8 A;  3JCM f;  4C92 A;  4JLI A;  2I2L A;  1I4K 1;  1TH7 A;  5LJ3 e;  3HSB A;  5GMK m;  4M7D B;  4N0A A;  3BDU A;  4X9D A;  1B34 A;  1WQW A;  1Y96 A;  4F7U B;  5GAN h;  4EMK A;  4MMK A;  4M77 B;  2DJZ A;  3BY7 A;  3FIF A;  4J6X A;  4J6Y A;  4JUV A;  4F7U E;  4PJO B;  4M77 E;  1I8F A;  2FB7 A;  1JRI A;  2DXT A;  1YCY A;  3HFO A;  4M78 B;  4XTX A;  1M5Q 1;  1HXD A;  1WPY A;  2FYK A;  4RCB A;  3RES A;  1LOJ A;  4M78 E;  4M75 D;  5LJ3 d;  4M7A G;  3RUX A;  3FJP A;  4F7U A;  5I21 A;  4V2S A;  4M75 G;  4M77 A;  4PJO A;  3FB9 A;  3V8K A;  4C92 D;  3RER A;  4C8Q G;  5GAN 8;  1KQ2 A;  1N9R A;  2E65 A;  4JRK A;  3V7R A;  2DTI A;  4C92 G;  5GAM j;  5GAN 6;  2EJ9 A;  2DZC A;  4C92 C;  2RB6 A;  4EMH A;  5LJ5 d;  5LJ5 f;  3SWN C;  3JB9 H;  5GAN 7;  5GMK l;  5GAO n;  1BIB A;  3JCM Q;  4PJO E;  2EJG A;  3EFS A;  3JCM J;  4WF2 A;  2DEQ A;  5LJ3 g;  2VXE A;  3JCM h;  5GAO r;  3JB9 I;  4M7D E;  3QO3 A;  4QVD A;  4JRI A;  5GMK i;  3RKW A;  1D3B B;  2DTO A;  2JN0 A; 
#chains in the Genus database with same CATH topology
 2EPD A;  5CIU A;  1X69 A;  3REB B;  4J5Y A;  4E7K A;  3V8L A;  2OTL Q;  1SKU B;  3V7C A;  1YJW A;  4M75 F;  1FMK A;  3GF5 A;  2HNI A;  1VQ9 Q;  3ASK A;  5I2S A;  4XQ3 A;  1S72 A;  1VQK Q;  3WVD B;  2EYY A;  5CR2 A;  1RL2 A;  3JB9 G;  2LJ3 A;  1RAH B;  2KEA A;  1WHK A;  1BIA A;  2R58 A;  2ZPH B;  2FPE A;  1U8R A;  5CKE A;  4BB7 A;  3CC2 Q;  2FZC B;  5CQY A;  1WHJ A;  3A5Z B;  4XTW A;  1VQL Q;  4ATO A;  1TS9 A;  1TSF A;  3CCM T;  2WSF E;  3J80 E;  1MV3 A;  2J6F A;  2VGM A;  3EHQ A;  2ATC B;  3KUF A;  3OYE A;  3QG1 A;  3RKX A;  1M27 C;  1I81 A;  1WXB A;  1Q86 R;  3UPU A;  2LZ6 B;  3EG3 A;  4OGC A;  2DM1 A;  5KYX B;  4C0D C;  2RO0 A;  2RQU A;  1OEB A;  3JCM f;  5GJW B;  1G3W A;  2RJC A;  1M90 C;  4VUB A;  1KG1 A;  1TH7 A;  3CME T;  2RHI A;  5LJ3 e;  3SDZ A;  1YJ9 A;  4RTZ A;  4FT4 A;  4M77 B;  1HD3 A;  2ZCF B;  2P0Q A;  5HY6 A;  3HFO A;  3PVL A;  4BY6 B;  1ZX6 A;  3BE3 A;  2X4W A;  7AT1 B;  5KCO A;  1IO6 A;  1PKS A;  2LX9 A;  1NJI U;  2Y4X A;  5FRN A;  3JCM Q;  3EFS A;  1PCX A;  2KSS A;  2LC4 A;  2QA4 A;  2VXE A;  2PQW A;  1G5V A;  3NTK A;  3QO3 A;  4A63 B;  3RNJ A;  2HAX A;  3CCU A;  1WIE A;  3VYH B;  1D3B A;  3CD6 Q;  1KSW A;  2RA2 A;  4NL3 A;  1JXO A;  2ZGW A;  4KUI A;  2DKG A;  1YN8 A;  1Q7Y R;  2RD1 A;  1SF9 A;  2XDP A;  3JAM E;  1WHH A;  1Z9Q A;  1AWX A;  3QSU A;  3CC7 Q;  1K8A U;  2KI7 A;  3M0U A;  4IUQ A;  3S6W A;  4IUP A;  4M77 D;  1YIT T;  2HBW A;  3OYJ A;  4ZGD B;  1M1K R;  3MCA B;  2JTF A;  4C8Q F;  4AFU C;  3X28 B;  3PGG A;  4K11 A;  3VKI A;  3V8J A;  3M54 A;  2M51 A;  2YT6 A;  3A8M B;  1YHQ T;  2PNI A;  2PUO B;  2VAS A;  3HRS A;  2XU8 A;  3X26 B;  2G6F X;  3LX7 A;  1E6H A;  3M0P A;  1UTI A;  3CPW S;  2DIL A;  3EG9 A;  1UUE A;  3CEY A;  1YCS B;  1NLP C;  1ABO A;  4A4E A;  4LE9 A;  1ZSZ A;  2XI9 A;  4C92 A;  1WYX A;  1NPP A;  2MF2 A;  1AOJ A;  2JT4 A;  2E6N A;  1KD1 R;  2OTL A;  2D6F A;  9ATC B;  2L8D A;  1QVF S;  1PKT A;  1VQ9 A;  4OB0 B;  1LOJ A;  3HTR A;  2AIR B;  5ECA A;  3FRN A;  1VQP T;  4PJO A;  2OTJ Q;  4DEY A;  3G71 Q;  4C5G A;  1N9R A;  5CKF A;  3OS0 A;  2D1X A;  4C92 C;  3TSW A;  2DD5 A;  2CS7 A;  5KYU B;  4D8D A;  4OML A;  4JRI A;  1H3H A;  1D3B B;  1SRL A;  2R5M A;  2DTO A;  5IAY A;  2ED1 A;  1Q82 C;  3JCM e;  1MMA A;  2VKN A;  3L2W A;  1V76 A;  1VQL A;  1N8R R;  1YNZ A;  4FYV B;  2YXY A;  2GQI A;  3G1J A;  3OYH A;  3SEM A;  2WSC E;  2E64 A;  4F16 A;  3CCQ T;  3L2Z A;  2E5K A;  4KGZ B;  1U06 A;  3F70 A;  2RQR A;  4EMK C;  1GBR A;  3A8L B;  2QDL A;  1LNX A;  3M9Q A;  2DXU A;  1OX9 A;  1S1N A;  2FL7 A;  4XTY A;  3CPW A;  3TSZ A;  1X75 C;  3VJP A;  1RAI B;  1XTD A;  5DM7 R;  4C5H A;  2QQA A;  2O4X A;  3OW2 P;  4DQ2 A;  2DRM A;  3EG9 B;  2M9U A;  5HK3 A;  4DBH A;  1IXD A;  1KC8 C;  1QVF A;  3GIB A;  1UGV A;  2E3H A;  4EDU A;  1M1K U;  1ZSZ B;  3EHR A;  4BI3 A;  4LDV A;  4ANJ A;  3CCM Q;  3JCM c;  2A37 A;  4HCB A;  1I0C A;  4C8Q A;  4JPB W;  3MP8 A;  1UDL A;  3HSB A;  1MND A;  2IG0 A;  5J39 A;  2L3Q A;  4O5V A;  3OQ5 A;  4PJO B;  2DXC A;  1VQ5 Q;  2KAF A;  1Y07 A;  1VYU A;  1O75 A;  2SEM A;  2SRC A;  3VS3 A;  1M5Q 1;  4M78 E;  4R0K A;  4M75 D;  4M7A G;  3M56 A;  3V8K A;  2C0I A;  2CZ1 B;  1Y57 A;  3V7R A;  4J7F A;  4AFZ C;  1QVG P;  2K2M A;  3M5A A;  5DLO A;  5GAN 6;  2IPO B;  5LJ5 d;  4EMH A;  3CC7 A;  3PMI A;  5GAO n;  3G4S Q;  2DL4 A;  3QPH A;  4GLM A;  4M7D E;  4F7U G;  1JU5 C;  2DAQ A;  2QTV A;  2D8J A;  1BBZ A;  1N5Z A;  4HCC A;  1VQ8 T;  3OYA A;  1YJN T;  1LJO A;  1FXX A;  4E7Z A;  5CVI A;  2VUB A;  2OI3 A;  2QXF A;  2Y90 A;  4M78 A;  5GAN d;  4A54 A;  2BE9 B;  4QQ6 A;  2YWW A;  2DYB A;  3VS2 A;  4J9G A;  1NEG A;  1VQ7 T;  2YSQ A;  1WXU A;  1YWO A;  3P8B B;  4N0A C;  3EGD A;  1VIF A;  2KT1 A;  1Q86 C;  3A98 A;  1VQK T;  4PJO D;  3PTA A;  1QMC A;  2X3W D;  3UF4 A;  4M78 C;  4C5E A;  2DL8 A;  4HCK A;  2K6D A;  4NL2 A;  2DD4 A;  4PL6 A;  3OS5 A;  5KYY A;  3SFM A;  4XTZ A;  1YIT Q;  3CC2 T;  2NLU A;  1I5O B;  2ZZD A;  2B86 A;  2O01 E;  1VQO T;  3OYB A;  4XU1 A;  3CCE T;  4AG1 C;  3OYL A;  2HMA A;  4ZN3 A;  1KIK A;  3H0F A;  1YHQ Q;  3G71 A;  2GTO A;  4FW1 A;  1W2B S;  5IXB A;  4C8Q B;  4CI0 C;  4PLL A;  2HQE A;  1K9M R;  4IKF A;  4XU3 A;  4IIM A;  4ZTJ A;  1GXI E;  5FWB A;  2DFU A;  2FG0 A;  4J9E A;  2FPF A;  3L2U A;  3MHX A;  2J7I A;  3TRE A;  3OYF A;  4CC2 A;  2DXT A;  1YCY A;  2F5K A;  3P8H A;  4NS5 A;  4M75 G;  1Q7Y C;  3OYG A;  5CKH A;  2I0N A;  2EQI A;  2EBP A;  1UJ0 A;  4E7H A;  1R0B G;  2RI3 A;  2XMF A;  1OU8 A;  5GAN 7;  5I2M A;  1O9S A;  3VS0 A;  1M1K C;  4MDW A;  1VQP Q;  1WI7 A;  1UHF A;  1K0S A;  2CDT A;  3S3N A;  1RLP C;  4BDZ A;  2KT8 A;  5IHN A;  1WQ7 A;  4C8Q D;  4XTV A;  3EGD B;  4D8K A;  3EFR A;  1C1A A;  4Y91 A;  4QKU A;  4R55 A;  2VXF A;  2LQK A;  2DO3 A;  4P5N A;  1TTH B;  1F1B B;  2LNH B;  3OBY A;  3A8H B;  1Y71 A;  2HSE B;  5IXF A;  4FIB A;  2YUN A;  3CD6 T;  5FU6 C;  1M8M A;  3CXC A;  5HCK A;  3CCM A;  1UHC A;  3E1S A;  4TVR A;  4LUD A;  4GBQ A;  5KYY B;  1RAF B;  1W2B A;  2KRM A;  4ESR A;  1H64 1;  1X43 A;  1ZQ1 A;  1N6A A;  1KD1 C;  3FDR A;  5LL6 S;  4IUR A;  3SWN A;  1GFC A;  4RKU E;  1GFD A;  2E5Q A;  1W6X A;  5A0D A;  4J9D A;  1A0N B;  5C6S A;  2JXB A;  3O5Z A;  4B9W A;  3CME A;  1M90 U;  1AEY A;  1X01 A;  1M3A A;  1ACM B;  3OA6 A;  4ZGE B;  4LXC A;  2E70 A;  4RTX A;  3MO8 A;  1U1T A;  4XU0 A;  2H8H A;  2LCC A;  3DB3 A;  3PNW C;  2C0O A;  2QDY B;  1T0H A;  2K2V A;  2NYS A;  3L42 A;  1R8O B;  2L2P A;  2FZK B;  5A0L A;  1WXT A;  4X9D A;  1N8R C;  2DJZ A;  4JUV A;  4M77 E;  1WGS A;  3NTI A;  2CZ0 B;  4XTX A;  2LJ1 A;  1G3T A;  1RAA B;  3A1P A;  5CCA A;  4IUV A;  2QGG A;  1ZA2 B;  1AWW A;  2NWM A;  1KQS S;  2F1L A;  3IQL A;  5FRM A;  2RK1 A;  4JZ3 A;  1IRE B;  3QBY A;  2OTJ T;  5KYX A;  3I9Q A;  2GFU A;  3JB9 I;  1JO8 A;  1ARK A;  3TEE A;  2EYX A;  2XK0 A;  3EH2 A;  1YIT A;  2BUD A;  2LT1 A;  4F17 A;  3VV0 A;  1M2V A;  1XJW B;  3CC4 T;  3QUI A;  1Y7X A;  1VQ8 Q;  4DEX A;  2ESW A;  2PVO B;  1YHQ A;  2MWP A;  3TU4 K;  1G3Y A;  2CH4 A;  1ZUY A;  4JJN K;  4F14 A;  3UWN A;  1VQ7 Q;  4M77 C;  3SWN B;  3LWH A;  3OYN A;  4XU2 A;  3JCM W;  3JCM d;  4PFP A;  4BY6 C;  2KXD A;  1NM7 A;  3EH1 A;  3CCS T;  4LD9 K;  1OX8 A;  3BFM A;  3A8O B;  2DTH A;  1PM3 A;  3OYD A;  2HZY A;  1E6G A;  4OVA A;  1G83 A;  1LPL A;  3PVQ A;  2P0P A;  3HFN A;  2BZY A;  2QTX A;  4JJC A;  5GAM g;  2QQR A;  4HVW A;  3JCM b;  1QKX A;  1VQO Q;  3MP1 A;  3CCE Q;  3CCR T;  4M7A A;  2KYB A;  4PJM A;  1VQM Q;  3M59 A;  2DIQ A;  4L5G A;  1VQP A;  1KQS A;  3NFC A;  2RHY A;  3C12 A;  4GLK A;  4HXJ A;  2D8H A;  1B34 A;  3CBP A;  1VQ4 Q;  1PRM C;  2O31 A;  4J6Y A;  5KH6 A;  4E7I A;  3Q1J A;  2CP6 A;  4F7U A;  4V2S A;  1CKB A;  3H6Z A;  1EX4 A;  2E65 A;  1Q82 U;  1VUB A;  1K73 R;  1HJD A;  1VQ5 T;  2RB6 A;  2O88 A;  2A08 A;  3OYY A;  2YUQ A;  1QWE A;  4BD3 A;  1PG5 B;  3CCQ A;  1M30 A;  4BDY A;  1X2K A;  4QVD A;  3EGX A;  2QQS A;  4DBF A;  2KRS A;  1D0X A;  4EPC A;  5KE2 A;  1M2V B;  3CPW P;  3G4S T;  2Y4Y A;  2AKK A;  2YLC A;  3CPF A;  4ZNX A;  3MKD A;  2KXC A;  2ED0 A;  2CP3 A;  1D1B A;  4OMN A;  4FM4 B;  3INZ A;  1RAB B;  1X6G A;  4DBQ A;  2L89 A;  1UGS B;  5KYU A;  2CP0 A;  1UJY A;  2HL3 A;  3OS2 A;  4D6W A;  3LLR A;  1QVF P;  3QXE B;  2EQK A;  2MMP A;  3EGU A;  1KC8 U;  4LD6 A;  3MEW A;  3DKM A;  3JCM P;  2HCK A;  2P4R A;  2X9H A;  4PJN A;  2CGH A;  2M16 A;  2XG8 D;  2DVE A;  4ELZ C;  3QII A;  4M7A B;  1N9S A;  2B8A A;  2JTM A;  2DET A;  1HK9 A;  1ZSG A;  1JB0 E;  2VWF A;  2HD0 A;  4C92 E;  1MGQ A;  1JJ2 S;  1B34 B;  4M75 A;  5GAO m;  4MDX A;  3QKJ A;  2NUZ A;  2DPP B;  4PFO A;  4RTY A;  1OQK A;  2AHJ B;  4BUG A;  2QAZ A;  4F7U B;  2JMA A;  3QJ6 A;  4PJO E;  4J9F A;  2COW A;  2LMJ A;  4AFQ C;  1XOV A;  3G6E Q;  2L3S A;  3FB9 A;  1AHJ B;  2L3P A;  1PSE A;  1VQ8 A;  1SEM A;  3RMQ A;  3FEO A;  1YJN A;  4C0G A;  1OZ3 A;  3EGX B;  2EGA A;  2LTO A;  1G2B A;  5LJ3 g;  2G3R A;  2BE7 D;  3I5S A;  1VQ7 A;  5KE3 A;  3RKW A;  2CP5 A;  4HVU A;  4M7A D;  3H41 A;  3GPL A;  4UC4 A;  1Q86 U;  1VQK A;  1QCN A;  1ZSZ C;  3PIP A;  5GAN 3;  3S3O A;  2QGF B;  3OYI A;  3GNG A;  1IHW A;  3CC2 A;  2QEX T;  5AYF A;  3THK A;  1MHN A;  1VQO A;  4JS5 A;  3CCE A;  4OGE A;  3KXT A;  3CC4 Q;  1BU1 A;  4PJO C;  2RQW A;  2AKL A;  3RBB B;  3KBG A;  2DEU A;  1JJ2 A;  1BI0 A;  4FYX B;  1QW1 A;  3I56 T;  1RAE B;  3ER0 A;  3JCM X;  2DVJ A;  2JUF A;  2XIC A;  1TXQ A;  3FLG A;  4E7S A;  4BE1 A;  1Q95 G;  4M7D F;  3RMS A;  3GP8 A;  1K0X A;  5FU7 B;  4Z02 A;  4M4Z A;  4PNO A;  4M75 B;  3JCM V;  3CCS Q;  4C8Q E;  1DJ7 B;  5GAO l;  3M0Q A;  3VUZ A;  2W0Z A;  2OAU A;  1UEC A;  2YLB A;  2MIO A;  2F5T X;  3PT9 A;  1LVK A;  2GNC A;  4Y92 A;  4ORZ A;  4AG2 C;  1Q7Y U;  1Q81 R;  3BDU A;  5C0M A;  1WQW A;  3QZ5 B;  3M0S A;  2VB6 A;  3U23 A;  4FYW B;  2O9S A;  3CCR Q;  4OMF B;  1M4Z A;  3M57 A;  2K3Y A;  5AT1 B;  3JRZ A;  2VYT A;  2V8K A;  2K3B A;  4QVZ A;  2AT1 B;  2F69 A;  1BKB A;  2CSI A;  2DEQ A;  5I11 A;  1QKW A;  2CH4 W;  1OPL A;  3M58 A;  1PD0 A;  2VGN A;  5DY9 A;  4L6V 5;  1JQQ A;  1OU9 A;  4OF1 A;  4QVC A;  3CXC P;  3CD6 A;  1K76 A;  4OMP A;  4EMG A;  1N27 A;  1W2B P;  1Z9Z A;  3VS4 A;  4C8Q C;  1W70 A;  2EYW A;  1ABQ A;  1UEB A;  5KCH A;  4MZT A;  5GAM h;  2ABL A;  1KD1 U;  1VIE A;  3MEU A;  5CK9 A;  2K5L A;  1C0M A;  3HRU A;  1WDX A;  3UDC A;  5FLX E;  1D1A A;  2DXB A;  2HSP A;  4JJD A;  2H3J A;  5GMK h;  2RN8 A;  2RH2 A;  4HT9 A;  4LDW A;  1VYV A;  2KDS A;  4KGV B;  2RHU A;  1SHG A;  5GAN 5;  3AHU A;  1FWZ A;  2GCX A;  5LJ5 h;  2MI6 A;  1Y0M A;  1VQ6 T;  1K73 C;  2X3X D;  2HQH A;  1LCK A;  2BZX A;  1GCQ A;  2RJD A;  3G7Z A;  1BB9 A;  1N8R U;  4R56 A;  2DLP A;  3CQT A;  4RTW A;  1TUC A;  3P8D A;  3VS7 A;  5HKC A;  1EZZ B;  5GAM f;  1T0J A;  3M55 A;  2FPD A;  1WNL A;  5FRO A;  1YIJ T;  1WA7 A;  1XNI A;  1RLQ C;  1I4K 1;  3L2R A;  4J83 A;  1FMV A;  5GAN h;  1C6V X;  4MMK A;  1NG2 A;  1VQM T;  2LQW A;  2OTJ A;  4F04 B;  2K9G A;  3QWY A;  3GOX A;  1VQ4 T;  3LWI A;  1YBY A;  1W4S A;  2RMO A;  5LJ5 f;  3JB9 H;  1PC0 A;  1QWF A;  4WTO B;  2CT3 A;  3ULR B;  4ZTF A;  3HHT B;  3CC4 A;  2RHZ A;  5GMK i;  5M9O A;  3DLM A;  4J7I A;  1AZE A;  4AT1 B;  3EG1 A;  2EW3 A;  3AT1 B;  3X24 B;  2EFI A;  2EGC A;  2NUT A;  5GAN f;  2JOY A;  2KRO A;  3QDF A;  3UA7 A;  2X4X A;  2VV5 A;  3HL8 A;  4PLI A;  2MCN A;  3C95 A;  2PUK B;  4A4H A;  3CCS A;  2JS2 A;  4M77 F;  1V1C A;  1QVP A;  1B3Q A;  1RI0 A;  4MZP A;  4L59 A;  4FU6 A;  1IRX A;  2XHC A;  3EFO A;  2OJ2 A;  1WX6 A;  2MOX A;  1MMG A;  3MP6 A;  2QEX Q;  3C4S A;  1AWO A;  1PD1 A;  4HCZ A;  3CCR A;  1OUL A;  2F2X A;  2O2O A;  1KQS P;  4KH1 B;  2YHT A;  1OI1 A;  4E47 A;  1UGQ B;  2BIV A;  2BTT A;  1ZBJ A;  3I56 Q;  4OMO A;  4N4I A;  5LJ3 h;  3VRY A;  4KBM B;  2X51 A;  5GJV B;  1GL5 A;  2LQ8 A;  3OS1 A;  4OB3 B;  5GMK m;  4M7D B;  4Q5W A;  1VQ5 A;  4ZN1 A;  4KUL A;  2V1Q A;  2YUP A;  1MMD A;  2FB7 A;  2RF0 A;  1KK7 A;  3RUX A;  1VQN T;  3LH0 A;  1UE9 A;  4A4F A;  3CCV T;  5IN1 A;  2JM8 A;  1D0Y A;  2V26 A;  3LW5 E;  3SWN C;  5HK0 A;  3G4S A;  3G6E T;  1ZLM A;  2QG9 B;  1HSQ A;  2DNU A;  3CCJ T;  1YI2 T;  4WF2 A;  3QWX X;  4EIK A;  3ZL7 C;  2DX1 A;  2JN0 A;  5D7U A;  1RAC B;  2NUT B;  1WFW A;  5LJ3 f;  1UG1 A;  2FEI A;  3H8Z A;  4PJJ A;  1PSF A;  1K9M U;  4JRP A;  1NYG A;  2HEQ A;  2DK3 A;  4DBR A;  1M3C A;  4CRI A;  4FSX A;  3OMC A;  4RUG A;  2L3R A;  2EKO A;  4LNP A;  2CYZ B;  4M7D D;  1EFN A;  1RI9 A;  4LUE A;  1AWJ A;  3EFO B;  4JRQ A;  2E12 A;  1WJR A;  1T3S A;  1UGP B;  1R0C B;  4FL6 A;  1RAD B;  2MPX C;  3M53 A;  1M2O A;  2EWN A;  4PJL A;  1Q81 C;  2EAY A;  5FU6 B;  1KHC A;  3H0H A;  2OAW A;  3O8V A;  4DOW A;  1NJI R;  8ATC B;  2P4T A;  3QJY A;  1IZ6 A;  4E6R A;  3ZEH A;  2EIF A;  4HKE A;  2GFA A;  2DA9 A;  2BZ8 A;  2DZ9 A;  4OB2 B;  2CUB A;  3NGP A;  4M7A E;  1JEG A;  1SSF A;  4E7L A;  4OB1 B;  2ROT A;  4J9C A;  1MUZ A;  4C5I A;  2MAM A;  2BKD N;  3TCJ A;  1RUW A;  1R77 A;  2RJE A;  1VQ6 Q;  2MWO A;  3OB9 A;  3NMZ C;  4E7J A;  1K8A R;  2LRQ A;  1V29 B;  4J6X A;  1G8X A;  3D7S B;  4F7U E;  4X1V A;  1EIF A;  2PVG B;  1YIJ Q;  1HXD A;  2FHD A;  1QCO A;  5I21 A;  1AD5 A;  1OV3 A;  3LH5 A;  2XID A;  5GAN 8;  2RI2 A;  3CCL T;  3X20 B;  3DB4 A;  4KGX B;  2RNA A;  2DZC A;  2LVM A;  1GCP A;  1M3B A;  1BK2 A;  2R5A A;  4QT7 A;  3JCM h;  3REA B;  2LP5 A;  2RK2 A;  1KHI A;  4M78 G;  5L8R E;  2KE9 A;  1ZA1 B;  2EJF A;  4C92 F;  5LJ5 g;  2QEX A;  4M7A C;  4FCY A;  2WSE E;  2LJ0 A;  1JJ2 P;  2A28 A;  2JW4 A;  1HYO A;  1MNE A;  3VS1 A;  3OSS C;  3DLL A;  2MK5 A;  2E4H A;  2A7Y A;  2RI5 A;  4LDU A;  3I56 A;  4RTV A;  1OZ2 A;  2E6Z A;  4M7D G;  3LGL A;  4PJO F;  3GLX A;  4RMO A;  2JS0 A;  3J7A F;  2M1H A;  1NEB A;  1ZUK A;  2C0T A;  3SHW A;  3EAE A;  3E9G A;  5GAN g;  1FMW A;  4IIO A;  5GAO q;  2V1R A;  3NTH A;  3L2V A;  3CMA T;  3NPF A;  4JJB A;  2K5F A;  3WXM B;  4ZGJ B;  5GAO p;  1H8K A;  1NBE B;  1OPK A;  1SHF A;  3VS5 A;  2CUD A;  3VU3 C;  4XTU A;  3R6N A;  2KRN A;  1JBM A;  5KYN A;  1IB8 A;  1IHV A;  1K9M C;  4M75 E;  1ZUU A;  1IGU A;  2X4J A;  3GNF B;  1NLO C;  3CBM A;  2YUO A;  1OYX A;  2LDM A;  4JLI A;  2JTE A;  2D0Q B;  2DER A;  1Y96 A;  1YP5 A;  4J9B A;  2COZ A;  2X4Y A;  1WZO A;  2EVR A;  3ZBD A;  3I55 T;  1WHM A;  1QP3 A;  3HP9 A;  1CKA A;  4RTT A;  2J6O A;  4J9I A;  3RER A;  4JRK A;  5GAM j;  4MZM A;  1I1J A;  3OY9 A;  5EC7 A;  3X25 B;  2LCS A;  2ENM A;  1VQN Q;  1G3S A;  2KBT A;  2KK4 A;  3CCV Q;  3OYK A;  1KQ1 A;  4C0F A;  5GMK j;  1TU0 B;  1NPR A;  4C0D B;  1M9S A;  3URG A;  1PHT A;  2RQT A;  2FO0 A;  2GGR A;  2F2W A;  4BE0 A;  4DA4 A;  5FU7 C;  3CCJ Q;  4HVV A;  2D0N A;  1YI2 Q;  5IHK A;  4M75 C;  1H3Z A;  5LJ5 j;  2E3I A;  1X6B A;  2YRD A;  4OMM A;  2J06 A;  2A36 A;  1TOV A;  3RDV A;  2K4Y A;  1WLP B;  2QI2 A;  1YJW T;  3OSV A;  2J05 A;  2HBP A;  4J8O A;  1S72 T;  2GTJ A;  2JJ9 A;  2YDL A;  4CC7 A;  2DL7 A;  2WAC A;  2QQ9 A;  3MJX A;  1VQ6 A;  3JV3 A;  3KFV A;  1K73 U;  3QYH B;  3RKY A;  1K9A A;  4HA8 A;  5GAN j;  3JB9 F;  4OMQ A;  1PRL C;  2ROL A;  3QYG B;  2PZ1 A;  4CC3 A;  2GQV A;  3M0R A;  1YIJ A;  2ZAE A;  1VOM A;  2NUP A;  2JNG A;  2X35 A;  5GAN 2;  4M78 F;  3QZ9 B;  2K79 A;  3V7S A;  4MML A;  2KNB B;  2RQV A;  2XDD A;  1VQM A;  4B6M A;  2KYM A;  1SG5 A;  2QK0 A;  1J3T A;  1Y96 B;  2L0A A;  4X34 A;  3N5B B;  2I2L A;  1VQ4 A;  4DOV A;  2DYI A;  3T9N A;  3PFS A;  1U3O A;  4IUT A;  3RR6 A;  4EMK A;  1B07 A;  1I8F A;  4QQG A;  2JMC A;  1BI3 A;  1SRM A;  2EQM A;  1KQ2 A;  6AT1 B;  1YJ9 T;  3M4Y A;  2RPN A;  3JCM J;  1B7T A;  1WHL A;  5GAO r;  1D1C A;  3CCL Q;  1GRI A;  2HKQ B;  3MEV A;  3VYG A;  4J9H A;  1BCM A;  3MEA A;  1TWB A;  4M77 G;  3MET A;  2QYZ A;  3VRZ A;  2KY9 A;  2DMO A;  4II1 A;  1NJI C;  2A3L A;  3LGF A;  2Z0W A;  3SB2 A;  2GBQ A;  4LDY A;  2QA4 T;  1GBQ A;  4NOY A;  4ME7 A;  2AZV A;  1TUG B;  3C0C A;  3HRT A;  4BI8 B;  4BI4 A;  3WVE B;  4GY5 A;  3CCU T;  2IVW A;  1BI2 A;  4KRT A;  2AK5 A;  5CAI A;  3PIO A;  1VA7 A;  1K4U S;  3JB9 J;  5LJ3 j;  4C92 B;  1I5L A;  2E10 A;  3PMT A;  3RIR A;  5KYW A;  1RAG B;  2EKH A;  2JM9 A;  5GAM d;  2CZ7 B;  1MMN A;  4Z89 A;  2LNV A;  3FC3 A;  4KH0 B;  2PVD B;  1K8A C;  1P92 A;  2FRY A;  2NUP B;  2DRK A;  2LX7 A;  3PE0 A;  3I5R A;  1JXM A;  1U5S A;  2A0F B;  3CMA Q;  5J26 A;  2RM4 A;  2E41 A;  4J6W A;  3MPU B;  3CME Q;  4IUU A;  2ZPE B;  2EQU A;  2E1H A;  3JCM g;  3VUB A;  2MYS A;  1PNJ A;  2YRC A;  5GAN 4;  4EMK B;  3NHN A;  2L5Q A;  4HT8 A;  1WJQ A;  1VQN A;  1X27 A;  1BYM A;  1QCF A;  2PTK A;  4N0A A;  3CCV A;  4AMC A;  2DIG A;  3BDL A;  5J3B A;  2DE0 X;  3G6E A;  2OX7 A;  2FYK A;  1WPY A;  4RCB A;  3RES A;  3CCJ A;  1YI2 A;  1SSH A;  2KVQ G;  3FJP A;  4C92 D;  3R6O A;  2LT4 A;  5A2Q E;  3OW2 S;  1AT1 B;  2QAS A;  2EJ9 A;  2OTL T;  2XKO C;  3EG0 A;  3I55 Q;  2JVV A;  1BIB A;  1VQ9 T;  1MV0 B;  2EJG A;  2YRV A;  2COY A;  1FX7 A;  1D0Z A;  2IIM A;  4YTL A;  1AVZ C;  2AZS A;  1M90 R;  3E2U A;  2O4X B;  2DBM A;  1GCQ C;  2PU9 B;  4M7D A;  3E9F A;  3QHS A;  1X6O A;  3CBO A;  2V8I A;  2K57 A;  3OYM A;  3J81 E;  1M1G A;  2EYQ A;  1M8V A;  4Z88 A;  4PK4 A;  4RG2 A;  3A8G B;  1Q81 U;  2EYZ A;  1VQL T;  5KYW B;  1YFN A;  2EQJ A;  3CXC S;  2DL3 A;  4BE2 A;  3S3M A;  4N4H A;  4M7D C;  4JLG A;  4CC4 B;  4X9C A;  1KJW A;  2CRE A;  1QVG S;  3L1A A;  4A4K A;  8AT1 B;  1IGQ A;  5IH2 A;  1YJW Q;  4PFZ A;  3M4G A;  4FYY B;  2RJF A;  4BAC A;  4XK8 E;  1QLY A;  2QQB A;  3OBW A;  1S72 Q;  2O9V A;  2K7A A;  3OYC A;  2GF7 A;  2XD0 A;  2HDA A;  4ELY C;  2XDB A;  4A53 A;  4RCC A;  4JZ4 A;  2KQW A;  1TUD A;  2H3E B;  1U1S A;  3OW2 A;  1T3L A;  4PKC C;  3E19 A;  3M0T A;  1ZBX A;  2DF6 A;  2VVK A;  2KMT A;  1X2Q A;  1NE8 A;  3HKS A;  3HPW A;  3CCL A;  4N4G A;  2FRW A;  5IT9 E;  3TVT A;  3BY7 A;  3FIF A;  4AFS C;  4M78 B;  1JRI A;  4QW2 A;  5LJ3 d;  3H0I A;  5FW9 A;  2R57 A;  1QP2 A;  2V8J A;  1SPK A;  3ME9 A;  1W1F A;  1AZG B;  4C92 G;  2CKK A;  5D6X A;  3EG2 A;  4RTU A;  3H9N A;  2M02 A;  1XQH A;  1ZHI A;  2FVU A;  3FJ5 A;  2C06 A;  2M0O A;  4FW2 A;  1I07 A;  1UGR B;  2P0K A;  1BI1 A;  3CCQ Q;  5D6Y A;  1NYF A;  1YJ9 Q;  1TG0 A;  2K3X A;  4PJO G;  4M7A F;  2ECZ A;  1WHG A;  1M1F A;  1QVG A;  1E7O A;  2ZPG B;  3CC7 T;  4Y28 E;  4QQD A;  4KUD K;  2CP7 A;  3C94 A;  4O6J A;  4OP0 A;  3JB9 D;  3LYI A;  3GBQ A;  2FZG B;  2KR3 A;  3CMA A;  3BW1 A;  2HKN A;  3UA6 A;  2K5I A;  5IHI A;  4F7U F;  5GAM e;  1OOT A;  2CT4 A;  2HQX A;  3UAT A;  2CP2 A;  2HL5 C;  2QA4 Q;  4M78 D;  5FWC A;  2VC8 A;  3UT1 A;  1CSK A;  1NZ9 A;  3JSC A;  2DL5 A;  1Q82 R;  1BCO A;  3CCU Q;  2ZPB B;  2ZPF B;  5L23 A;  5GMK e;  5CQX A;  3OMG A;  1D09 B;  3ZFJ A;  1K1Z A;  5D6W A;  4WCI A;  5CO7 A;  1KFZ A;  3SD4 A;  3QDR B;  2RHX A;  2CZ6 B;  1YWP A;  2JZ2 A;  2EGE A;  2F2V A;  5LJ5 e;  4FSS A;  1WJS A;  2KGT A;  2CSQ A;  4KT0 E;  4LN2 A;  3I55 A;  2LCL A;  4B9X A;  3L2Q A;  3VS6 A;  4LDX A;  5DLQ E;  4RG8 A;  5A0G A;  4FT2 A;  2LQN A;  2ZPI B;  5EG2 A;  1QQJ A;  2M0Y A;  3G71 T;  4XAX B;  4JDS A;  2D9T A;  4A4G A;  5GAN e;  1VYT A;  2DBK A;  2P84 A;  5I22 A;  1UB4 A;  2W10 A;  4M77 A;  4Z8A A;  4C0Z A;  4C8Q G;  4JS4 A;  2DJQ A;  1KC8 R;  2DTI A;  4E2F B;  1FYN A;  3TQ7 P;  5GMK l;  1UFF A;  3I35 A;  1YJN Q;  5CKD A;  1H92 A;  5CKB A;  2J6K A;  1PWT A; 
#chains in the Genus database with same CATH homology
 1KQ1 A;  5CIU A;  3M58 A;  4C0F A;  5GMK j;  1NPR A;  4J5Y A;  3V8L A;  1M9S A;  3URG A;  4C0D B;  4BDZ A;  4E7K A;  2VGN A;  5DY9 A;  4L6V 5;  4M75 F;  4OF1 A;  3GF5 A;  3V7C A;  4QVC A;  1YJW A;  3CD6 A;  4EMG A;  1WQ7 A;  2HNI A;  4C8Q D;  4BE0 A;  1N27 A;  4XTV A;  3ASK A;  4DA4 A;  5FU7 C;  5I2S A;  3EFR A;  4XQ3 A;  4Y91 A;  4R55 A;  1S72 A;  4M75 C;  1H3Z A;  4C8Q C;  2VXF A;  2LQK A;  3WVD B;  5CR2 A;  5LJ5 j;  2DO3 A;  1RL2 A;  4P5N A;  3JB9 G;  1UEB A;  5KCH A;  3OBY A;  2K4Y A;  3A8H B;  1Y71 A;  2QI2 A;  4MZT A;  5GAM h;  1YJW T;  1BIA A;  1KD1 U;  1VIE A;  4FIB A;  3CD6 T;  3MEU A;  5FU6 C;  2R58 A;  2ZPH B;  3OSV A;  5CK9 A;  2HBP A;  2K5L A;  4J8O A;  3CXC A;  3HRU A;  3CCM A;  1U8R A;  1S72 T;  3E1S A;  5CKE A;  4TVR A;  3UDC A;  4BB7 A;  5FLX E;  1W2B A;  2WAC A;  2DXB A;  2QQ9 A;  5CQY A;  1VQ6 A;  3A5Z B;  1H64 1;  4XTW A;  2H3J A;  5GMK h;  1ZQ1 A;  1K73 U;  1N6A A;  3QYH B;  2RH2 A;  3RKY A;  4HA8 A;  5GAN j;  1KD1 C;  3JB9 F;  4ATO A;  3FDR A;  4HT9 A;  5LL6 S;  4LDW A;  2KDS A;  4IUR A;  3SWN A;  3QYG B;  4RKU E;  2RHU A;  3CCM T;  2E5Q A;  2WSF E;  3J80 E;  2VGM A;  5A0D A;  2GQV A;  4M7D G;  5GAN 5;  1YIJ A;  1FWZ A;  3AHU A;  2GCX A;  5LJ5 h;  2MI6 A;  5C6S A;  4B9W A;  3KUF A;  3OYE A;  3CME A;  3QG1 A;  1VQ6 T;  2JNG A;  1M90 U;  2X35 A;  1X01 A;  3RKX A;  5GAN 2;  1K73 C;  1I81 A;  3OA6 A;  4M78 F;  4ZGE B;  2RJD A;  3G7Z A;  2E70 A;  3QZ9 B;  3UPU A;  1N8R U;  4R56 A;  3V7S A;  4MML A;  4OGC A;  3MO8 A;  1U1T A;  2XDD A;  4XU0 A;  1VQM A;  2LCC A;  3P8D A;  3DB3 A;  5HKC A;  3PNW C;  4C0D C;  5GAM f;  2RO0 A;  1Y96 B;  3M55 A;  4X34 A;  1WNL A;  5FRO A;  1YIJ T;  2QDY B;  3N5B B;  2K2V A;  3L42 A;  1XNI A;  1R8O B;  3JCM f;  3S3N A;  2RJC A;  1G3W A;  2I2L A;  4VUB A;  4DOV A;  1I4K 1;  1TH7 A;  2RHI A;  5LJ3 e;  5A0L A;  3L2R A;  3CME T;  1VQ4 A;  4J83 A;  3SDZ A;  1YJ9 A;  4X9D A;  3T9N A;  1N8R C;  5GAN h;  3PFS A;  4FT4 A;  4IUT A;  4EMK A;  4MMK A;  4M77 B;  2DJZ A;  4JUV A;  2ZCF B;  2P0Q A;  4M77 E;  1I8F A;  1WGS A;  5HY6 A;  3HFO A;  3NTI A;  2CZ0 B;  4XTX A;  1VQM T;  4QQG A;  1G3T A;  2OTJ A;  4BY6 B;  1BI3 A;  3GOX A;  2EQM A;  5CCA A;  1VQ4 T;  1KQ2 A;  4IUV A;  2X4W A;  5KCO A;  3LWI A;  1YBY A;  1YJ9 T;  1W4S A;  1KQS S;  2LX9 A;  5LJ5 f;  3JB9 H;  1NJI U;  2Y4X A;  5FRN A;  3M4Y A;  3JCM Q;  5FRM A;  2RK1 A;  3EFS A;  3JCM J;  1IRE B;  2KSS A;  3QBY A;  2LC4 A;  2OTJ T;  4ZTF A;  2QA4 A;  2GFU A;  2VXE A;  5GAO r;  3JB9 I;  2PQW A;  3HHT B;  3CC4 A;  2RHZ A;  5GMK i;  1G5V A;  3MEV A;  3NTK A;  3QO3 A;  3DLM A;  3VYG A;  5M9O A;  3MEA A;  4M77 G;  3MET A;  4J7I A;  2KY9 A;  2HAX A;  3CCU A;  4II1 A;  3TEE A;  2A3L A;  3LGF A;  1NJI C;  3VYH B;  2XK0 A;  1D3B A;  3SB2 A;  2RA2 A;  1YIT A;  2BUD A;  2LT1 A;  3VV0 A;  4LDY A;  4NL3 A;  2ZGW A;  3X24 B;  2EFI A;  5GAN f;  4KUI A;  4NOY A;  2QA4 T;  2DKG A;  4ME7 A;  2JOY A;  3CC4 T;  2RD1 A;  3QUI A;  1Y7X A;  2X4X A;  3HRT A;  2VV5 A;  4BI8 B;  3HL8 A;  4PLI A;  2PVO B;  2XDP A;  3JAM E;  4BI4 A;  3C95 A;  3WVE B;  2PUK B;  2MWP A;  4A4H A;  4GY5 A;  3CCU T;  1YHQ A;  2IVW A;  3TU4 K;  1K8A U;  1BI2 A;  3S6W A;  3CCS A;  4IUQ A;  3QSU A;  1G3Y A;  4IUP A;  4M77 F;  5CAI A;  4M77 D;  3PIO A;  4JJN K;  1YIT T;  1QVP A;  3OYJ A;  3UWN A;  4ZGD B;  3JB9 J;  1RI0 A;  5LJ3 j;  3MCA B;  4MZP A;  4L59 A;  4C92 B;  2E10 A;  3PMT A;  4FU6 A;  3RIR A;  1I5L A;  4M77 C;  3SWN B;  2JTF A;  4C8Q F;  3LWH A;  3OYN A;  5GAM d;  3X28 B;  4XU2 A;  2XHC A;  3PGG A;  3VKI A;  3MP6 A;  2CZ7 B;  3V8J A;  3M54 A;  3JCM W;  3A8M B;  2LNV A;  3FC3 A;  1YHQ T;  2PVD B;  1K8A C;  3JCM d;  4BY6 C;  1P92 A;  2PUO B;  3CCS T;  3C4S A;  4HCZ A;  4LD9 K;  3BFM A;  3CCR A;  3A8O B;  3HRS A;  2DTH A;  2YHT A;  1OI1 A;  2XU8 A;  3OYD A;  3X26 B;  3LX7 A;  5J26 A;  2RM4 A;  4OVA A;  2E41 A;  4E47 A;  1UGQ B;  2BIV A;  2P0P A;  3CPW S;  4J6W A;  3HFN A;  2QTX A;  5GAM g;  3CEY A;  2QQR A;  3JCM b;  4IUU A;  2ZPE B;  2EQU A;  2E1H A;  4N4I A;  3JCM g;  3MP1 A;  3VUB A;  3CCR T;  4M7A A;  4A4E A;  5GAN 4;  5LJ3 h;  4EMK B;  2L5Q A;  4HT8 A;  3M59 A;  1WJQ A;  4KBM B;  2DIQ A;  2XI9 A;  4L5G A;  4C92 A;  3NFC A;  2RHY A;  1VQP A;  2LQ8 A;  3OS1 A;  1KQS A;  1BYM A;  4OB3 B;  3C12 A;  5GMK m;  1NPP A;  4M7D B;  4N0A A;  3CCV A;  2MF2 A;  4GLK A;  4Q5W A;  2E6N A;  1VQ5 A;  4ZN1 A;  1B34 A;  3CBP A;  2DIG A;  3BDL A;  4KUL A;  5J3B A;  2OTL A;  2D6F A;  4J6Y A;  5KH6 A;  4E7I A;  3G6E A;  2L8D A;  1QVF S;  3Q1J A;  2FB7 A;  1VQ9 A;  4OB0 B;  2FYK A;  1WPY A;  4RCB A;  3RES A;  3CCJ A;  1LOJ A;  1YI2 A;  1M90 C;  3RUX A;  2KVQ G;  3FJP A;  4F7U A;  4V2S A;  1VQN T;  3FRN A;  3LH0 A;  1VQP T;  4PJO A;  4C92 D;  3R6O A;  2LT4 A;  4C5G A;  3H6Z A;  5A2Q E;  3OW2 S;  1N9R A;  2E65 A;  5CKF A;  4A4F A;  3CCV T;  1VUB A;  3OS0 A;  5IN1 A;  1Q82 U;  1VQ5 T;  2EJ9 A;  2OTL T;  4C92 C;  2XKO C;  2DD5 A;  2RB6 A;  3G4S A;  2CS7 A;  3LW5 E;  3SWN C;  5HK0 A;  3G6E T;  2JVV A;  3OYY A;  1BIB A;  4BD3 A;  1VQ9 T;  2EJG A;  2YRV A;  3CCJ T;  3CCQ A;  5GAN 8;  1YI2 T;  4WF2 A;  1FX7 A;  4BDY A;  4QVD A;  4JRI A;  4YTL A;  1D3B B;  2R5M A;  2DTO A;  5IAY A;  2QQS A;  2JN0 A;  1Q82 C;  3JCM e;  2O4X B;  4EPC A;  2PU9 B;  5KE2 A;  3L2W A;  4M7D A;  5LJ3 f;  1VQL A;  3E9F A;  3G4S T;  2Y4Y A;  2YLC A;  3CPF A;  3H8Z A;  3QHS A;  1PSF A;  1X6O A;  3CBO A;  1K9M U;  3OYH A;  2V8I A;  4JRP A;  2K57 A;  2WSC E;  2E64 A;  3OYM A;  3J81 E;  3CCQ T;  2DK3 A;  3L2Z A;  1M1G A;  2EYQ A;  4CRI A;  4FSX A;  3OMC A;  1M8V A;  2L3R A;  2EKO A;  4RG2 A;  3A8G B;  3F70 A;  1Q81 U;  4FM4 B;  3INZ A;  2CYZ B;  4M7D D;  1VQL T;  4EMK C;  3A8L B;  2EQJ A;  2L89 A;  1LNX A;  3M9Q A;  3CXC S;  2DXU A;  4BE2 A;  3S3M A;  1UGS B;  4N4H A;  2FL7 A;  4XTY A;  4JRQ A;  4M7D C;  2E12 A;  1WJR A;  1UGP B;  3OS2 A;  3CPW A;  4D6W A;  4FL6 A;  3LLR A;  4JLG A;  4X9C A;  1X75 C;  3VJP A;  3QXE B;  1QVG S;  3M53 A;  3L1A A;  4A4K A;  1XTD A;  5DM7 R;  2EQK A;  2EWN A;  4C5H A;  1Q81 C;  2EAY A;  2MMP A;  1KC8 U;  2QQA A;  5FU6 B;  2O4X A;  1KHC A;  3M4G A;  4LD6 A;  2RJF A;  3DKM A;  3MEW A;  3O8V A;  4XK8 E;  2QQB A;  4DOW A;  3OBW A;  4DQ2 A;  4BAC A;  3JCM P;  2P4T A;  3QJY A;  1IZ6 A;  2CGH A;  3ZEH A;  2M16 A;  2EIF A;  2M9U A;  2GFA A;  2XG8 D;  4HKE A;  2GF7 A;  5HK3 A;  3OYC A;  2DVE A;  4ELZ C;  3QII A;  4M7A B;  2DZ9 A;  2XD0 A;  1N9S A;  2B8A A;  4OB2 B;  1KC8 C;  1QVF A;  3GIB A;  4ELY C;  4EDU A;  2JTM A;  4M7A E;  1M1K U;  1SSF A;  2XDB A;  4E7L A;  4OB1 B;  1HK9 A;  4A53 A;  4RCC A;  2KQW A;  4BI3 A;  4LDV A;  1JB0 E;  4C5I A;  1U1S A;  2HD0 A;  2MAM A;  4C92 E;  2BKD N;  1MGQ A;  1JJ2 S;  3TCJ A;  3JCM c;  3OW2 A;  1VQN A;  1B34 B;  4M75 A;  2RJE A;  4PKC C;  3E19 A;  5GAO m;  4HCB A;  4MDX A;  1ZBX A;  4C8Q A;  3QKJ A;  3MP8 A;  2DPP B;  2KMT A;  2MWO A;  1NE8 A;  3HKS A;  3HSB A;  3HPW A;  3OB9 A;  4N4G A;  3CCL A;  2AHJ B;  4BUG A;  2IG0 A;  5IT9 E;  5J39 A;  4F7U B;  4E7J A;  4O5V A;  3OQ5 A;  2LRQ A;  1V29 B;  4PJO B;  3BY7 A;  3FIF A;  4J6X A;  2DXC A;  4F7U E;  3QJ6 A;  2KAF A;  2PVG B;  1EIF A;  1Y07 A;  1O75 A;  1JRI A;  4M78 B;  4PJO E;  4QW2 A;  1M5Q 1;  1HXD A;  5LJ3 d;  2R57 A;  1XOV A;  4M78 E;  2FHD A;  4M75 D;  1QP2 A;  4M7A G;  1KG1 A;  5I21 A;  2V8J A;  3M56 A;  3FB9 A;  3V8K A;  2XID A;  1AHJ B;  2CZ1 B;  2RI2 A;  3ME9 A;  3X20 B;  3V7R A;  4J7F A;  1PSE A;  4C92 G;  3CCL T;  3DB4 A;  2CKK A;  3M5A A;  5D6X A;  5GAN 6;  5DLO A;  1VQ8 A;  3RMQ A;  3FEO A;  1YJN A;  2DZC A;  4C0G A;  4EMH A;  5LJ5 d;  2LVM A;  1OZ3 A;  1XQH A;  1ZHI A;  2FVU A;  2C06 A;  3CC7 A;  3PMI A;  2M0O A;  2LTO A;  5GAO n;  2R5A A;  3QPH A;  5LJ3 g;  1UGR B;  2G3R A;  3JCM h;  4M7D E;  2P0K A;  1VQ7 A;  1BI1 A;  5KE3 A;  3RKW A;  4F7U G;  5D6Y A;  2DAQ A;  2K3X A;  2RK2 A;  4PJO G;  4M7A F;  4M7A D;  4HCC A;  1KHI A;  1VQ8 T;  3GPL A;  3OYA A;  4M78 G;  4UC4 A;  1YJN T;  1LJO A;  5L8R E;  1Q86 U;  1M1F A;  1FXX A;  1VQK A;  1QVG A;  2EJF A;  2VUB A;  2ZPG B;  5CVI A;  4C92 F;  5LJ5 g;  4Y28 E;  2QEX A;  3CC7 T;  4M7A C;  4QQD A;  2QXF A;  4KUD K;  2Y90 A;  3C94 A;  4M78 A;  4O6J A;  5GAN d;  2WSE E;  4OP0 A;  4A54 A;  3LYI A;  4QQ6 A;  3JB9 D;  1VQ7 T;  3P8B B;  4N0A C;  3PIP A;  3OSS C;  1VIF A;  3CMA A;  3BW1 A;  5GAN 3;  3DLL A;  3S3O A;  1Q86 C;  3OYI A;  2K5I A;  3GNG A;  2A7Y A;  2RI5 A;  4LDU A;  4F7U F;  3I56 A;  1OZ2 A;  2E6Z A;  5GAM e;  3LGL A;  4PJO F;  3GLX A;  4RMO A;  2HQX A;  2QEX T;  3CC2 A;  5AYF A;  1VQO A;  1MHN A;  3J7A F;  4PJO D;  4JS5 A;  2M1H A;  3CCE A;  4OGE A;  4M78 D;  3KXT A;  3PTA A;  3EAE A;  2VC8 A;  3E9G A;  3UT1 A;  5GAN g;  4PJO C;  5GAO q;  1NZ9 A;  3JSC A;  3NTH A;  3KBG A;  4M78 C;  4C5E A;  3L2V A;  3CMA T;  1JJ2 A;  2K5F A;  2ZPB B;  3WXM B;  4ZGJ B;  5GAO p;  1BI0 A;  2ZPF B;  2DD4 A;  4NL2 A;  3OS5 A;  4PL6 A;  1QW1 A;  3SFM A;  3I56 T;  3ER0 A;  5GMK e;  3JCM X;  4XTZ A;  5CQX A;  2JUF A;  2NLU A;  3OMG A;  3CC2 T;  2ZZD A;  2O01 E;  2XIC A;  3ZFJ A;  3OYB A;  3VU3 C;  4XU1 A;  1VQO T;  4XTU A;  5D6W A;  3CCE T;  3FLG A;  4BE1 A;  5CO7 A;  1JBM A;  4M7D F;  3OYL A;  3RMS A;  3SD4 A;  3GP8 A;  4ZN3 A;  3QDR B;  2RHX A;  5FU7 B;  2CZ6 B;  2JZ2 A;  4Z02 A;  3G71 A;  1K9M C;  4PNO A;  4M75 B;  5LJ5 e;  1W2B S;  3JCM V;  1WJS A;  4C8Q B;  4CI0 C;  4M75 E;  4PLL A;  4C8Q E;  1DJ7 B;  2HQE A;  4KT0 E;  2X4J A;  5GAO l;  4IKF A;  3GNF B;  3I55 A;  3VUZ A;  2LCL A;  4B9X A;  3L2Q A;  4XU3 A;  2OAU A;  2YLB A;  3CBM A;  5DLQ E;  4RG8 A;  2F5T X;  4ZTJ A;  4LDX A;  1GXI E;  1OYX A;  2LDM A;  3PT9 A;  4JLI A;  5A0G A;  4FT2 A;  2ZPI B;  1Q7Y U;  2D0Q B;  5EG2 A;  3BDU A;  3G71 T;  5C0M A;  1WQW A;  3QZ5 B;  1Y96 A;  1VQK T;  4XAX B;  4JDS A;  3L2U A;  3MHX A;  2X4Y A;  2D9T A;  4A4G A;  3TRE A;  3ZBD A;  3OYF A;  5GAN e;  2DXT A;  1YCY A;  2F5K A;  3P8H A;  4NS5 A;  4OMF B;  3I55 T;  1M4Z A;  1QP3 A;  3HP9 A;  3M57 A;  2K3Y A;  4M75 G;  1UB4 A;  4M77 A;  1Q7Y C;  3OYG A;  5CKH A;  3JRZ A;  2VYT A;  4C0Z A;  4C8Q G;  4JS4 A;  2V8K A;  3RER A;  4JRK A;  2DTI A;  5GAM j;  4QVZ A;  4E7H A;  2RI3 A;  2F69 A;  4MZM A;  5GAN 7;  5GMK l;  3OY9 A;  5I2M A;  1O9S A;  1BKB A;  5CKD A;  3X25 B;  1M1K C;  5CKB A;  1G3S A;  4MDW A;  2DEQ A;  2KK4 A;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...