1B34A

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34A00
4RCBA 5LJ5j 3QHSA 5GMKl 1Y96A 1KQ1A 3BFMA 5GMKj 5GAN2 4PJOC 4F7UG 2DXUA 4QVDA 3JCMQ 3RERA 5GAOm 4M7AC 4DQ2A 4M75A 3JCMP 3HFOA 5GAMf 3V7CA 2DXTA 2ZGWA 4N0AA 4PJOD 1B34B 4PJOB 4M75G 1KQ2A 1D3BB 2DTHA 2DKGA 4M77D 4PJOF 2EJGA 4M77B 4C8QC 4M77F 4M7AD 5GMKi 4JLIA 4M7AB 1JBMA 4M7AF 2DZCA 3JCMb 2RD1A 4M78E 3JB9G 4X9CA 3JCMX 4XU3A 5LJ3f 3QSUA 4V2SA 4J6WA 4A53A 4XU1A 2HNIA 4C92E 3QO3A 3FB9A 5GAMd 4OP0A 5GAN3 4C8QD 4C8QB 5GMKm 4C8QF 2QTXA 5GANd 4NOYA 1WPYA 1BIAA 4EMGA 4M77C 3SWNA 4EMKC 2E1HA 1WQ7A 3M4GA 2VXEA 4M78G 5LJ3d 5LJ5d 3EFRA 1MGQA 4WF2A 2EJ9A 1LJOA 4XQ3A 4F7UF 5DY9A 4M7DC 1M5Q1 4HT8A 1H641 5GAMh 4C92G 3JCMd 3L1AA 2DJZA 4XTVA 4Y91A 3RIRA 5GAMe 5GANf 3FIFA 5GAN6 5GAMg 5GANh 4EMKB 4PJOE 2RB6A 3FJPA 4M77E 3V7SA 3V8LA 3L2ZA 5GANe 5CAIA 2EWNA 1JRIA 4X9DA 4M7DD 4M7AE 4M7DB 4XTYA 5LJ5f 5LJ3h 3JCMW 1WQWA 3EFSA 4M7DF 3BDUA 5LJ5h 2RA2A 5I21A 4A54A 5LJ3e 3JB9F 1U1TA 3V8KA 3HFNA 4JRIA 5GMKh 5LJ3g 1N9RA 4NL2A 5GAOr 1N9SA 1B34A 3JCMf 5GMKe 1D3BA 3JCMh 2EAYA 4C8QE 1LOJA 4M78A 3SWNC 3JCMe 4PJOG 5GAOl 5GAOq 4M77G 3VU3C 1M8VA 4M75C 2YLBA 2JN0A 2E10A 3RKYA 3BY7A 4XU0A 2DTOA 1LNXA 3JCMV 3V8JA 4N0AC 2E64A 4F7UB 4M7AG 1WNLA 1Y96B 2DVEA 5GAN5 2VC8A 3SB2A 5GAMj 5GAN8 4C8QA 4J6XA 4PNOA 4JRKA 2DTIA 2RM4A 3SWNB 4HT9A 1X01A 3HSBA 5GAN7 1HXDA 2DZ9A 4M75D 4M75B 4C8QG 4NL3A 4XTWA 4XU2A 4XTUA 3GIBA 4M75F 3JCMc 5GANg 1I4K1 5LJ3j 3JB9D 2YHTA 3BW1A 3INZA 4M7DE 4RCCA 4HA8A 5LJ5e 4J6YA 2VXFA 2FYKA 2Y90A 5LJ5g 4PJOA 5GAOn 4M78C 4EMHA 4MMKA 4C92A 4M77A 3RKXA 3RUXA 4EMKA 2E41A 4M7AA 2I2LA 3JCMg 2FB7A 2YLCA 4C92C 4MMLA 3JCMJ 3QUIA 1YCYA 4M7DA 1U1SA 5GAOp 3V7RA 4M78D 4M78B 2DEQA 3JB9J 4F7UE 3AHUA 5GAN4 4M7DG 4M78F 3JB9H 4JUVA 2K57A 4J5YA 4QVCA 2EJFA 4C92D 1I5LA 4C92B 3JB9I 5GANj 4C92F 1BIBA 1HK9A 4XTZA 2E65A 4M75E 4XTXA 2CGHA 1I81A 1TH7A 1I8FA 3RKWA 3RESA 4F7UA 3PGGA
chains in the Genus database with same CATH superfamily
1AWOA 1AT1B 2QTVA 3CCMA 5GAOm 1PNJA 4M7AC 5FRMA 1ZBJA 2VUBA 4MDXA 1G3WA 1Q86U 3VS1A 3GPLA 5A0DA 2HL5C 3J80E 2DKGA 3HP9A 2COYA 3CBMA 2DPPB 3JCMb 5LJ3f 3HRSA 1EZZB 1AD5A 5KYNA 2MCNA 3CCET 1IXDA 4QQGA 2QGFB 1TG0A 1BIAA 1I1JA 1T3SA 2A3LA 5LJ3d 2EYQA 1WLPB 4TVRA 4XAXB 2EVRA 3H6ZA 5I22A 4M7DC 1H641 3S3MA 2COWA 4CRIA 1K73R 1UHFA 4RTYA 3VS3A 1WYXA 3OSVA 3CC2Q 3FJPA 2ZPGB 3SD4A 1WQWA 5CCAA 2QASA 3ZBDA 1JXOA 2AKKA 2XMFA 3CMAA 2DJQA 1UGQB 4A4FA 1CKBA 3BY7A 2DTOA 4LD6A 1WNLA 1RL2A 2DD5A 3REAB 3SWNB 3MCAB 2A0FB 2EIFA 4XTUA 3G6ET 1T0JA 1E7OA 2KE9A 4DBRA 1K9MU 1EX4A 2LMJA 1QQJA 2DRKA 2OI3A 1ZUUA 3X20B 4EMHA 3CCJQ 1TUGB 4PFPA 3VS5A 3J81E 2H3EB 1VQ7A 3VS6A 1RAIB 1BBZA 2MI6A 4L59A 4A4EA 2DA9A 2JXBA 3I55A 1W2BA 4C92F 1SEMA 1BIBA 3CMEQ 1WHLA 1AHJB 1KHCA 5C0MA 1ZHIA 2CGHA 2KDSA 2KBTA 5CQXA 2KXCA 3RKWA 1C1AA 2VB6A 1M1KC 1M3BA 1QCNA 1YJWQ 3JCMQ 2CP5A 2BZYA 5CIUA 4M75A 2L8DA 3L42A 2IG0A 1ZSZA 4M77D 1ZLMA 2CUBA 1RAGB 4M77B 1Q82U 3QIIA 2DNUA 1H3ZA 4ELYC 4L6V5 5CKBA 2LQ8A 2L89A 3FB9A 3HRUA 4OMLA 2F69A 4C8QF 1B3QA 2DERA 1AZEA 2LQWA 4X1VA 1WGSA 2JZ2A 3GP8A 2QEXQ 2GNCA 4F7UF 2MPXC 2EQIA 1YHQT 1Y07A 2QA4T 4EMKB 5CKFA 2DXBA 2P4RA 2DAQA 4AG2C 3OW2A 2A28A 2MMPA 2QK0A 3VS4A 4M77G 3VU3C 1IGUA 1PD0A 2P4TA 5GAN8 4HT9A 4PNOA 1YI2T 1OOTA 1VQ6Q 1PRMC 2OTLT 3FRNA 2JUFA 1D1AA 2JNGA 4NS5A 2BUDA 1WJSA 1VQPT 3PNWC 4HA8A 1VQKA 1BCOA 2FZKB 4IIMA 3X24B 5J39A 2VYTA 4JJCA 1XQHA 1XOVA 4KULA 3IQLA 1GL5A 4C92C 4MMLA 2FPEA 4X34A 2C0IA 2X4XA 1UTIA 3CXCA 2DEQA 1VQOT 2PNIA 4E7SA 1MMGA 3VS7A 4Q5WA 2PU9B 4M75E 5GMKl 1IGQA 2LZ6B 1ZX6A 3VYHB 1M1KU 1NPPA 1PRLC 2X4YA 3PMIA 4BE0A 4C8QC 4GLMA 3CPWA 3UF4A 2HNIA 4BI8B 1FX7A 4J9GA 3O5ZA 1VQ9Q 2E5QA 4HCZA 4E2FB 2FRYA 3CC7A 1UUEA 3EH1A 4BI3A 1W6XA 1LJOA 1JQQA 5CKEA 2EW3A 2QAZA 3OYNA 2YWWA 1ABQA 2DL8A 2KNBB 2K3YA 3A8MB 3M0PA 2EYWA 1MV3A 3HKSA 2CP3A 4ZN1A 3H9NA 4RTWA 3CMAQ 1N9SA 2DO3A 3JCMh 1WJQA 3JCMe 1I0CA 1KD1U 2JM8A 2K3BA 2R58A 5DM7R 3CCQA 4JRQA 3DLMA 5IAYA 2KMTA 4OGEA 3M0UA 4DA4A 5I11A 2E12A 4RTVA 3OS5A 1HXDA 1VYVA 2DIGA 2IPOB 3VRYA 2K6DA 2VASA 4DOVA 2YHTA 3BW1A 4AFQC 5LJ5e 3LWHA 1SSFA 4PJOA 1RLPC 1Q7YC 4MMKA 4PFOA 1K1ZA 3O8VA 1PM3A 4RTZA 5CQYA 3BE3A 1ABOA 4CC3A 3I55Q 1WHGA 3R6OA 5FWBA 2ZPHB 5GAN4 2E3HA 1RAFB 2CH4A 3QYGB 3OQ5A 3CCVT 2C06A 1TH7A 4JPBW 3RESA 2HSPA 1FWZA 3H0IA 5GAN2 4HKEA 3G6EQ 1MV0B 4QVDA 2BE9B 1CKAA 1F1BB 2LRQA 1D09B 3OS2A 1KQ2A 3QBYA 4KRTA 3L2UA 2PZ1A 5IHKA 2RD1A 2RO0A 3TCJA 4E7JA 2J6KA 1HSQA 1ZBXA 3QO3A 1ARKA 4E7ZA 2C0TA 5GMKm 2F1LA 2FZCB 2RPNA 3A8HB 2FG0A 4LDXA 4Z89A 2LJ1A 4E7IA 2Y4XA 1WA7A 2VXEA 3QWYA 1UGVA 4AMCA 1QVGA 4WF2A 5GAMh 1M27C 2KRNA 5FLXE 1M2OA 5GAMe 2KAFA 4J83A 2OTJT 2WSEE 3L2ZA 1UDLA 3JCMW 3BDUA 3WVDB 1RADB 4JRIA 4BDYA 2GQIA 2ESWA 1NJIR 5KE3A 2L5QA 3CC4T 1QP2A 2X3WD 4F7UB 2E64A 5FW9A 1GXIE 1X01A 1BI3A 1VQ4T 1PWTA 4R56A 1VQKQ 2QI2A 4K11A 4RTXA 5LJ3j 2OX7A 3QDRB 2NWMA 4LD9K 1KG1A 4KH0B 2I2LA 3OBWA 3JCMg 3M0QA 4Z02A 1Q81C 2D8JA 3DB4A 2RHZA 2NUTB 4BB7A 2MOXA 5EC7A 2QGGA 2BTTA 4E47A 2EKHA 1XTDA 4P5NA 2LT4A 5I2MA 1Q82R 5A0GA 4CC4B 4A63B 2OTLQ 1X43A 2CP0A 2CYZB 4F7UG 4JS4A 4FW1A 3EHQA 4JZ3A 1BI1A 4FYYB 3HFOA 3CQTA 4DBFA 1UGPB 4N0AA 3CCJA 1B34B 2ZZDA 1D3BB 1QKXA 2O4XA 4M77F 3CXCS 2AKLA 2B8AA 1QMCA 1VQOQ 2HCKA 1LVKA 3GLXA 1H3HA 2YRDA 1JJ2A 3JAME 2EGEA 2M0YA 4FSXA 2K7AA 5CKHA 2VKNA 2J05A 5DY9A 1M5Q1 4QQDA 4Z88A 1VQNA 1AZGB 2K5LA 1JU5C 3FJ5A 3S3OA 2PVDB 3EFSA 1KC8U 2A7YA 2RA2A 3FC3A 4II1A 4HXJA 2YUPA 2E70A 2FRWA 2RNAA 2H3JA 2J7IA 5LJ3g 1G5VA 1X6GA 1LOJA 3SWNC 1C6VX 4BDZA 5IN1A 3GBQA 3LX7A 3PVQA 2O9VA 2JN0A 3RKYA 2WSFE 5J26A 3MEVA 4J6XA 2XG8D 4OMMA 3ULRB 2QEXA 5GAN7 2DZ9A 3OYJA 3A8OB 2DX1A 1VQ5A 5L8RE 2FHDA 3OYLA 1VQLA 3INZA 2HBWA 2VV5A 3RNJA 4ZTJA 1PSEA 4IUPA 3M5AA 4YTLA 1WXUA 1YJNT 3M58A 1YNZA 1C0MA 3JCMJ 4M7DA 3M0RA 3AHUA 3G71T 2IIMA 4PLLA 1Q81U 2EJFA 3JB9I 2KY9A 3L2QA 2CP6A 3D7SB 1UB4A 1BYMA 1VQ6A 4RCBA 2MAMA 4OGCA 1I5OB 4N4GA 3SHWA 2DBMA 4DQ2A 4MDWA 4DEYA 4PJOD 4PJOB 2RI5A 4LN2A 3U23A 1I07A 2EJGA 2O88A 1Y0MA 4N4IA 1QVFA 4M78E 2G6FX 2KYMA 3C4SA 3X26B 1K8AR 4FYXB 2K4YA 3AT1B 2LP5A 1VQ8T 3CCSA 5GANd 4OMPA 1M3AA 3TSZA 2D0QB 4EMGA 4EMKC 3M4GA 5LJ5d 1KD1R 4C5GA 3PMTA 1P92A 4QVZA 1MMNA 4DBQA 4J8OA 1BK2A 3QWXX 3CCRT 4DOWA 1D1BA 3V7SA 4LNPA 3F70A 3HPWA 3HRTA 1BI2A 4ZGDB 4M7AE 4ZTFA 1TU0B 1WXBA 2SRCA 2PVOB 2JM9A 3JB9F 2CSIA 3UWNA 4AG1C 1HJDA 4PJOG 1VQ9A 2PUKB 1M90R 3TSWA 1QWEA 2DXCA 3EHRA 5KYXA 1YP5A 5CR2A 3I56T 2XDPA 3X25B 1WHMA 2PTKA 1GFCA 2RQVA 1W2BP 1T3LA 4D6WA 4M7DE 4J9BA 2OTJQ 1PHTA 3OB9A 1OV3A 2KROA 1M1GA 3GNGA 1J3TA 4ANJA 1D1CA 2JW4A 1SHFA 1N6AA 2JVVA 3OSSC 3RDVA 2GF7A 3JB9J 1U06A 2M16A 5DLOA 1KQSA 3OYMA 1VQ7T 4EDUA 3SFMA 4JS5A 4JLGA 3NPFA 3H8ZA 1WDXA 1ZUKA 2GFUA 3PFSA 5IT9E 3LLRA 1Q95G 2RQTA 5L23A 1RI9A 1WHHA 4CC7A 4OMQA 4ZGJB 4KT0E 3WVEB 3TEEA 2GBQA 1GCQC 2DYBA 2KK4A 3QJYA 2DL3A 1SRMA 4RMOA 4JLIA 2L0AA 2XKOC 3NGPA 1JO8A 3JCMX 4XU1A 1UJYA 4A4GA 3A98A 4F04B 3OW2P 3G4ST 1W70A 5KYYA 3RMQA 3G6EA 1VQNQ 4RTUA 1MGQA 3EFOB 2ZPFB 1TOVA 3OS0A 2RJDA 2V8JA 1N8RC 4D8KA 1FXXA 1T0HA 5HCKA 1SG5A 3NTIA 3UATA 4FW2A 1TSFA 4QKUA 2JJ9A 3HL8A 3EG9B 1NPRA 2E3IA 4XU0A 3CXCP 3VS2A 2X3XD 1AWJA 4LXCA 2DYIA 3P8HA 3OYHA 1VQ5Q 3NMZC 2QQRA 4LDWA 2QG9B 5FROA 4B9XA 4C8QA 4EPCA 2LQKA 1VQLQ 3JCMc 5IXFA 3ER0A 4J7IA 1M8MA 4F16A 1SPKA 4R0KA 5FU6B 2FYKA 2CKKA 4FYVB 3CCUT 1D0ZA 2XIDA 2DD4A 3CPWP 2D1XA 1YBYA 3FLGA 3LW5E 4QVCA 1NZ9A 5IH2A 2FVUA 3M9QA 3VJPA 2ROTA 3PGGA 1VYTA 4JRPA 2FEIA 1YHQA 3QDFA 1Y96A 3BFMA 2QA4A 1AWWA 2GTOA 4OB1B 5D7UA 1ACMB 2ZGWA 1YIJT 3VS0A 2O2OA 4D8DA 4C0GA 1PSFA 5KH6A 1G3TA 4PLIA 1K0SA 3OYBA 3EGDA 1JBMA 1S72T 3H0FA 2RHIA 4A53A 3CCSQ 2HAXA 4C92E 1KC8R 3CD6T 1FMWA 4J9EA 2RJCA 3CPFA 1PG5B 1YI2A 1K73C 2CH4W 2MF2A 2OTLA 1WQ7A 1VQPA 3EFRA 1R77A 4XQ3A 1TS9A 1K4US 1Z9ZA 3EG3A 4IKFA 3L1AA 1N27A 2FPFA 5A0LA 1MMAA 3SEMA 1N8RU 3BDLA 2QQ9A 1KHIA 2CZ1B 5KCHA 2XHCA 2WACA 1VQOA 4RTTA 4C8QE 4BI4A 2KRSA 2JT4A 1AWXA 3C94A 2QQAA 2SEMA 5C6SA 4ELZC 5FU7B 5GAN5 1YJ9T 1RUWA 1OI1A 3HSBA 1YITT 1Q81R 3GIBA 4OB3B 1X6BA 2PUOB 2DL7A 4E7HA 2LDMA 2LNHB 3ZL7C 3JB9D 1NBEB 3FEOA 1PKSA 4J6YA 4J9FA 4RKUE 2CSQA 1EFNA 3EH2A 2DL4A 1ZQ1A 3M54A 3QUIA 3CCEQ 1U1SA 1H92A 4KBMB 3HHTB 1OYXA 1GRIA 3ZFJA 2JTMA 2V8IA 4FSSA 5KYXB 2E6NA 3HTRA 1QVPA 1H8KA 4MZTA 2PQWA 3QPHA 2HKQB 4R55A 3RERA 3MKDA 1X27A 4C0DB 1BU1A 2DXTA 3KBGA 4PJOF 1N5ZA 1Q86R 1OEBA 2RH2A 3JB9G 2YRCA 2LNVA 2L3SA 2W10A 1VA7A 2CDTA 4PJJA 2HQXA 1QP3A 2LCCA 4LDUA 1U3OA 2QTXA 2YT6A 2V1RA 2MWPA 5LL6S 3LH5A 5IHNA 1K73U 2JTFA 2M02A 4HT8A 3RMSA 2YDLA 2CT3A 4XTVA 3RIRA 2ZPIB 5GAN6 4ZN3A 4BY6B 1IREB 3C95A 5LJ3h 2DK3A 3UA6A 3VV0A 1W2BS 2AHJB 5I21A 1IRXA 5LJ3e 5GAOr 2F5KA 5AYFA 4IUUA 5CK9A 1NM7A 1AVZC 1M4ZA 1QKWA 5M9OA 5EG2A 5GAOq 5KYYB 1M9SA 2DVEA 2EYYA 2L3QA 4JRKA 1OX9A 2M0OA 4M75D 4M75B 1R0BG 4NL3A 1UECA 3OMCA 4E7KA 1SSHA 2ENMA 5I2SA 2ZAEA 1ZSZB 4GBQA 1K76A 4JJNK 2K2VA 1K9MR 3I5RA 4BACA 4F14A 1NYGA 2GQVA 3OYYA 2F5TX 2XU8A 2LQNA 4J7FA 3CC2T 1FYNA 2DETA 3LYIA 4ME7A 1RABB 1HYOA 2R57A 4FL6A 1YHQQ 1TUDA 2QA4Q 1JJ2P 1NLPC 2RN8A 3L2RA 4PJOC 1KFZA 1WHJA 1TXQA 3OW2S 2AK5A 2R5AA 2OTJA 2WSCE 2EYXA 2DMOA 3JCMP 1Q7YU 1WX6A 4M75G 7AT1B 2YXYA 4Y92A 1VQMT 5GMKi 2X9HA 3PVLA 3M4YA 1MHNA 3CC4A 1VYUA 3TVTA 3ME9A 5DLQE 3CCJT 1E6GA 4C0FA 1OU8A 1YI2Q 2F2WA 3UDCA 4LUEA 1VQPQ 1KIKA 1OPLA 1WHKA 1VQ4A 2D0NA 2I0NA 3GNFB 3L2WA 2ZPBB 4PJNA 3CMET 2Y4YA 3X28B 3FIFA 2YUQA 2C0OA 3KUFA 4M4ZA 1UGSB 2RB6A 4Z8AA 3V8LA 4HVVA 4IUVA 2K79A 2BE7D 1YJWT 1RAAB 4OMFB 1YWOA 1ZUYA 4A54A 3CCLT 1X2KA 4IIOA 1N9RA 2KVQG 3NTHA 2ZPEB 4IUQA 1SKUB 2EAYA 3OYGA 4M78A 1AEYA 5J3BA 5GAOl 3CD6Q 2EYZA 3SDZA 2VC8A 2D6FA 2AIRB 2J6FA 2RI2A 4WTOB 3JSCA 2X4WA 4XTWA 3CPWS 2GTJA 4BD3A 2LJ3A 2K5FA 3S3NA 1WIEA 2RQWA 4AFZC 5CKDA 2Y90A 2ED0A 5IHIA 2LJ0A 4EMKA 2E41A 3E9GA 4M7AA 1VOMA 1NYFA 4DBHA 3C0CA 4RG8A 2VGMA 3VRZA 2CP7A 2EGCA 1QVFP 1KJWA 2MYSA 5A2QE 4J5YA 3P8DA 1PC0A 2V1QA 2E65A 1BCMA 4XTXA 1SHGA 4PKCC 2HSEB 2HEQA 2XDDA 3MEWA 2YSQA 1MNDA 2NLUA 3LGFA 1D0XA 1M1KR 1QWFA 2CZ6B 4L5GA 1TWBA 1CSKA 4HCBA 5GJWB 4X9CA 2JOYA 2EQJA 2R5MA 1IB8A 4KUDK 4IURA 3OMGA 3URGA 3DKMA 4M77C 2JTEA 3PTAA 1YCSB 4FCYA 3MEUA 3META 3JCMd 5GANf 1U5SA 2RMOA 2NUPA 4ORZA 3H0HA 3CCMT 4M77E 5FWCA 4N4HA 1YJNA 1G3SA 4XTYA 2CUDA 5LJ5f 2CS7A 4HVWA 1NJIC 3CCVQ 1E6HA 3E19A 3G71A 2KSSA 1UJ0A 2RQUA 1M8VA 1GCQA 3R6NA 1XJWB 4XK8E 4ESRA 2JS2A 4A4HA 2EKOA 1VQ9T 1QCOA 2DFUA 2HBPA 3GF5A 3EG0A 4PJMA 4CI0C 1VUBA 1V29B 4RCCA 2IVWA 1FMKA 4PFZA 4BE2A 3A8GB 1G83A 4CC2A 1Q82C 2YLCA 2QDLA 4PK4A 3PE0A 8ATCB 1VQ8A 3V7RA 1QVGS 1W4SA 2YUOA 2MWOA 3CMAT 1PKTA 4XTZA 2GFAA 1OQKA 1ZA2B 2BKDN 2LCSA 2KGTA 3CCRA 1NG2A 1FMVA 4E6RA 3EGUA 5GAMf 2ED1A 1RAHB 1VIEA 5HY6A 1VIFA 3REBB 2V26A 3EGXA 3CC4Q 3CCEA 4AT1B 4FT4A 2HQEA 4RG2A 3RR6A 4B6MA 5GAMd 2DE0X 4OP0A 5GAN3 3I56A 2ROLA 1KK7A 1BKBA 1VQ4Q 2M51A 3I55T 4RUGA 2A08A 1V76A 2EJ9A 1MUZA 2FO0A 1U8RA 5GJVB 1RAEB 2MIOA 4IUTA 3A5ZB 2DF6A 2B86A 3CBOA 3P8BB 3UA7A 1VQMQ 3UPUA 3CBPA 1TTHB 1M2VA 1UEBA 3V8KA 1QLYA 2KT8A 2VWFA 4NL2A 4VUBA 3M56A 1NJIU 5FU7C 1A0NB 3OYCA 3VUZA 3THKA 2YLBA 4C92A 2E10A 5CO7A 2LT1A 2ZCFB 3PT9A 2G3RA 2RM4A 1W1FA 2H8HA 4DEXA 1QW1A 6AT1B 3GOXA 4PJLA 1WXTA 4M75F 1X6OA 2E6ZA 4FM4B 1O9SA 2QQSA 3EG2A 2O4XB 2E4HA 2EPDA 1QCFA 5GAOn 1UHCA 3CCLQ 1JJ2S 2BZXA 2KXDA 3OBYA 2RHYA 3E2UA 3G4SA 2P0QA 4M78D 1Q7YR 4M78B 2DBKA 3JB9H 2DL5A 3LWIA 2KT1A 3NFCA 2KRMA 4KGXB 4A4KA 4C0DC 3RKXA 2O01E 4F7UA 3QHSA 1HD3A 2HMAA 1KQ1A 3MJXA 2DXUA 3MHXA 3TQ7P 4HCKA 3I5SA 2LVMA 1OZ2A 4WCIA 3VUBA 3V7CA 1K8AC 1EIFA 4O6JA 3CEYA 4KGVB 1VQKT 3DLLA 4M7AD 4M7AB 1BI0A 1ZSGA 1IHWA 4JDSA 1KD1C 2RF0A 2NUTA 3VYGA 3M53A 4HVUA 4M78G 1SF9A 4BY6C 1KSWA 3PIPA 2D9TA 2JMAA 2ATCB 2COZA 4C0ZA 1YJNQ 2QYZA 4AFUC 3CCUA 1JRIA 1V1CA 4X9DA 4M7DD 4M7DB 1JEGA 1M90C 2EQMA 2NUZA 3G71Q 4JJDA 2F2VA 1U1TA 2CT4A 3HFNA 2K9GA 5D6YA 1B34A 2HDAA 1D3BA 1OU9A 3QYHB 2KYBA 4C5IA 3OS1A 4M75C 2LX9A 4M7AG 1BB9A 2EQKA 1ZSZC 4OVAA 3S6WA 4JZ4A 3CC7T 1JXMA 2J06A 1QVFS 4FYWB 1X69A 2XI9A 1YIJA 3CCMQ 5D6WA 2NUPB 3QXEB 4OB0B 3RUXA 4QQ6A 1S72A 5KYWA 1VQ8Q 4J9CA 2ECZA 2VGNA 1YCYA 4GY5A 2PVGB 4OB2B 5D6XA 3WXMB 4F7UE 4M7DG 3CD6A 4JUVA 2K57A 2CZ7B 3LGLA 1IHVA 5IXBA 4LDVA 1RLQC 3CCQT 4FT2A 3CCRQ 3H41A 2L2PA 2XK0A 2XD0A 3QZ5B 3T9NA 4BUGA 4Y28E 3KFVA 3E1SA 2KR3A 2KQWA 1K8AU 1WFWA 2FL7A 3EG1A 3QSUA 1R0CB 3I56Q 4V2SA 4ZGEB 3QKJA 4QT7A 1YJ9A 2NYSA 1GBQA 3OYKA 2X4JA 4NOYA 1ZA1B 2L3PA 1WPYA 4KUIA 2F2XA 1YITA 2AT1B 3NTKA 1QVGP 4QW2A 2DLPA 4MZPA 2LCLA 4B9WA 1XNIA 3QJ6A 5GANh 4LE9A 5KYUA 5GANe 2ABLA 5LJ5h 1KQSS 3KXTA 3EGXB 1GFDA 4GLKA 1D0YA 3A1PA 3Q1JA 1VQ7Q 1M90U 2OAUA 2HQHA 3OYDA 2DVJA 4KGZB 4OMNA 1LNXA 3V8JA 2XDBA 3RBBB 2X35A 3OA6A 2RQRA 4PL6A 2D8HA 1IZ6A 2O9SA 2DIQA 2M1HA 2MK5A 1X75C 4XU2A 2YRVA 1Y71A 3M59A 1Y57A 4J9DA 1IO6A 2VXFA 3C12A 3G4SQ 3MO8A 2P0PA 1K0XA 3CCVA 1M2VB 4OF1A 3ASKA 4C92D 4C92B 5GANj 2EQUA 3JV3A 2FZGB 3PIOA 5LJ5j 4MZMA 1UE9A 1UG1A 2JS0A 1DJ7B 1X2QA 2AZVA 1NEBA 1B7TA 3OY9A 1WZOA 1UGRB 2YUNA 1KC8C 4KH1B 4FU6A 3A8LB 5FRNA 4XU3A 4UC4A 4J6WA 3G7ZA 1O75A 2EFIA 3JRZA 1YWPA 4C8QD 3TU4K 1LCKA 2AZSA 4C8QB 2OJ2A 2QXFA 2BIVA 2CZ0B 2LX7A 3SWNA 2E1HA 2XICA 3M57A 2RHXA 3J7AF 2V8KA 4C92G 1M30A 2DJZA 2K5IA 4O5VA 3CCUQ 3QG1A 4PJOE 1JB0E 3ZEHA 1B07A 2EWNA 3CC2A 4ZNXA 1MMDA 8AT1B 1R8OB 5GMKh 2CREA 2M9UA 5GMKe 2A37A 2KEAA 2HD0A 4C5HA 3OYEA 1S1NA 9ATCB 1G3YA 1MNEA 1PD1A 2P0KA 1Y96B 1YFNA 2K3XA 3SB2A 5GAMj 2DTIA 4OMOA 4C5EA 2DRMA 1YIJQ 4C8QG 1AOJA 5GANg 3MEAA 3QZ9B 1I4K1 2LC4A 3EFOA 1OPKA 1UFFA 2DEUA 3EGDB 1VQNT 1S72Q 5LJ5g 1TUCA 1VQMA 3DB3A 4M77A 3M0SA 4E7LA 5KCOA 4BE1A 1NEGA 2A36A 2RK1A 5HK3A 2K2MA 3MP1A 1K9AA 4M78F 2LTOA 2J6OA 2HKNA 1I5LA 2W0ZA 1HK9A 4JJBA 3EG9A 4LUDA 3I35A 1I81A 1I8FA 2Z0WA 3CC7Q 5CAIA 3CMEA 1G8XA 5GMKj 2QEXT 1Q86C 4J9IA 1VQ5T 2RK2A 1NE8A 4EIKA 1YJWA 1VQLT 2BZ8A 2QDYB 2RJFA 3CCLA 3FDRA 2DTHA 4J9HA 1GCPA 5KYWB 4M7AF 2DZCA 3NHNA 3OYIA 2JMCA 4LDYA 4AFSC 1YJ9Q 4F17A 2O31A 1GBRA 1YITQ 2KI7A 3MP8A 3CCQQ 2RJEA 5ECAA 3OYAA 1M1FA 2VVKA 2DILA 2X51A 3EAEA 2HL3A 1VQ6T 3MP6A 1YN8A 1RACB 4Y91A 3M55A 5GAMg 2FPDA 2QQBA 3E9FA 5HK0A 4ATOA 5AT1B 1M3CA 2E5KA 2CP2A 2OAWA 4M7DF 1OULA 1WI7A 3UT1A 3TREA 3JCMf 1N8RR 2EGAA 2RI3A 3N5BB 1OZ3A 1OX8A 3JCMV 4N0AC 2GCXA 5HKCA 2HZYA 3CCST 1G2BA 3LH0A 1K9MC 4HCCA 2GGRA 3L2VA 3M0TA 4FIBA 3I9QA 5KE2A 1Y7XA 5KYUB 3VKIA 3OYFA 3G1JA 4M78C 3MPUB 2EBPA 1RI0A 2FB7A 1LPLA 5CVIA 1NLOC 2L3RA 5GAOp 1SRLA 5FU6C 1KQSP 1WJRA 1Z9QA 1PCXA 2DM1A 2P84A 2RHUA
chains in the Genus database with same CATH topology
3QPHA 3QHSA 1KQ1A 2CYZB 4F7UG 2DXUA 4JS4A 4R55A 3CCMA 5GAOm 3RERA 3MHXA 4M7AC 5FRMA 2LVMA 2VUBA 1OZ2A 4C0DB 1BI1A 3VUBA 3HFOA 4MDXA 3V7CA 1G3WA 2DXTA 1UGPB 1EIFA 4N0AA 4O6JA 5A0DA 3GPLA 3J80E 3CCJA 1B34B 3CEYA 2ZZDA 1D3BB 3KBGA 2DKGA 4PJOF 1VQKT 3HP9A 3DLLA 4M77F 2O4XA 3CXCS 4M7AB 4M7AD 1BI0A 3CBMA 2RH2A 2DPPB 3JCMb 3JB9G 2B8AA 2LNVA 5LJ3f 1M90C 2HQXA 3HRSA 1QP3A 4JDSA 2LCCA 1KD1C 4LDUA 3GLXA 2QTXA 1JJ2A 3CCET 4QQGA 3VYGA 3JAME 3M53A 1BIAA 2A3LA 5LJ3d 4M78G 2MWPA 5LL6S 4BY6C 4FSXA 2EYQA 3PIPA 4TVRA 2JTFA 2D9TA 3H6ZA 4XAXB 5CKHA 5DY9A 1M5Q1 4QQDA 1H641 4HT8A 4C0ZA 3S3MA 4CRIA 3RMSA 1VQNA 4XTVA 3RIRA 2ZPIB 3OSVA 5GAN6 2K5LA 4ZN3A 3FJPA 2ZPGB 4BY6B 3SD4A 1IREB 3CCUA 1JRIA 4X9DA 3S3OA 4M7DD 4M7DB 2PVDB 3C95A 5LJ3h 1WQWA 2DK3A 2EQMA 2A7YA 3EFSA 3VV0A 2AHJB 2RA2A 4II1A 5CCAA 5I21A 5LJ3e 1U1TA 3FC3A 3HFNA 5GAOr 2E70A 2F5KA 5LJ3g 2H3JA 5AYFA 5D6YA 3ZBDA 1B34A 1G5VA 1D3BA 4IUUA 5CK9A 1LOJA 3SWNC 1M4ZA 3CMAA 3QYHB 4BDZA 5IN1A 5M9OA 1UGQB 5EG2A 4C5IA 5GAOq 3OS1A 3LX7A 4M75C 2LX9A 4A4FA 2JN0A 3RKYA 3BY7A 4M7AG 2DTOA 2EQKA 2WSFE 1M9SA 4LD6A 5J26A 1WNLA 1RL2A 2DD5A 2DVEA 3MEVA 4OVAA 4J6XA 2XG8D 4JRKA 3MCAB 3S6WA 3SWNB 2QEXA 2EIFA 2M0OA 5GAN7 2DZ9A 3CC7T 4M75D 3A8OB 4M75B 3OYJA 4NL3A 3OMCA 4XTUA 4E7KA 1VQ5A 3G6ET 5L8RE 5I2SA 2FHDA 3OYLA 1QVFS 1VQLA 2XI9A 1YIJA 1Q86U 3INZA 1K9MU 2VV5A 4ZTJA 5D6WA 3QXEB 1PSEA 2K2VA 3M5AA 4IUPA 4OB0B 4JJNK 4YTLA 3X20B 4EMHA 4BACA 3RUXA 1YJNT 4QQ6A 1S72A 2GQVA 3OYYA 2F5TX 2XU8A 3M58A 4J7FA 3J81E 3CC2T 1VQ7A 3JCMJ 2VGNA 1YCYA 4M7DA 4GY5A 2PVGB 2MI6A 4L59A 4OB2B 5D6XA 3WXMB 4A4EA 4F7UE 3AHUA 3G71T 3LYIA 3CD6A 4JUVA 4PLLA 4M7DG 3I55A 2K57A 1Q81U 4ME7A 2CZ7B 2EJFA 3LGLA 1W2BA 3JB9I 2KY9A 3L2QA 4C92F 1BIBA 2R57A 4LDVA 4FL6A 1AHJB 1KHCA 5C0MA 3CCQT 1ZHIA 2CGHA 1UB4A 2KDSA 4FT2A 5CQXA 1VQ6A 3RKWA 1BYMA 4RCBA 2MAMA 4OGCA 2XK0A 3L2RA 1M1KC 2XD0A 4PJOC 4N4GA 3JCMQ 3QZ5B 3OW2S 5CIUA 2R5AA 3T9NA 2OTJA 2WSCE 4DQ2A 4M75A 2L8DA 3JCMP 3L42A 4BUGA 4MDWA 1Q7YU 4Y28E 2IG0A 4PJOD 4PJOB 2RI5A 4M75G 3E1SA 4M77D 2EJGA 2KQWA 4M77B 1Q82U 3QIIA 1VQMT 5GMKi 1K8AU 4N4IA 1QVFA 4M78E 2FL7A 3QSUA 1H3ZA 3M4YA 1MHNA 3C4SA 3X26B 4V2SA 4ELYC 4ZGEB 3QKJA 3CC4A 4L6V5 5CKBA 2LQ8A 3ME9A 5DLQE 2L89A 2K4YA 3FB9A 4C0FA 3HRUA 3CCJT 1VQ8T 2F69A 3CCSA 1YJ9A 4C8QF 3OYKA 4M7DC 5GANd 3UDCA 2X4JA 4NOYA 1WGSA 1WPYA 2JZ2A 4KUIA 2D0QB 4EMGA 1YITA 4EMKC 1VQ4A 3M4GA 3NTKA 3GP8A 5LJ5d 4C5GA 3GNFB 3PMTA 4F7UF 2ZPBB 4QW2A 3L2WA 1P92A 3CMET 2Y4YA 4QVZA 4MZPA 3X28B 1YHQT 2LCLA 4B9WA 1XNIA 1Y07A 3QJ6A 4J8OA 2QA4T 3FIFA 3CCRT 5GANh 4EMKB 3KUFA 1UGSB 2RB6A 4DOWA 5CKFA 3V7SA 3V8LA 5GANe 2DXBA 3F70A 3HPWA 3HRTA 1BI2A 4ZGDB 4M7AE 4IUVA 4ZTFA 1YJWT 2DAQA 4OMFB 5LJ5h 1KQSS 2PVOB 4A54A 3KXTA 3CCLT 3JB9F 4GLKA 3OW2A 1N9RA 2KVQG 3Q1JA 3NTHA 3UWNA 2ZPEB 4IUQA 2MMPA 1M90U 2OAUA 2EAYA 3OYGA 3OYDA 4M78A 5J3BA 4PJOG 5GAOl 1VQ9A 2PUKB 4M77G 3VU3C 2DXCA 1LNXA 3V8JA 5CR2A 3I56T 2XDBA 2X35A 2XDPA 3SDZA 2VC8A 3X25B 4PL6A 3OA6A 2P4TA 5GAN8 2D6FA 4PNOA 4HT9A 1IZ6A 1YI2T 2DIQA 2RI2A 2M1HA 2OTLT 1X75C 3JSCA 2X4WA 2JUFA 3FRNA 2JNGA 4NS5A 2BUDA 2YRVA 1WJSA 4XTWA 1VQPT 3CPWS 1Y71A 4D6WA 4BD3A 3PNWC 2K5FA 4M7DE 3M59A 3S3NA 4HA8A 1VQKA 5CKDA 3OB9A 2VXFA 2Y90A 3X24B 1M1GA 3GNGA 5J39A 2VYTA 4EMKA 2E41A 3C12A 3E9GA 3MO8A 4M7AA 1XQHA 1XOVA 2P0PA 4KULA 3CCVA 4C92C 4MMLA 4X34A 1N6AA 2JVVA 2X4XA 4XU2A 3OSSC 2VGMA 4RG8A 3CXCA 2GF7A 3JB9J 2DEQA 2M16A 1VQOT 5DLOA 5A2QE 4J5YA 3P8DA 4OF1A 3ASKA 4C92D 4C92B 1KQSA 5GANj 2EQUA 3OYMA 1VQ7T 4EDUA 3SFMA 4Q5WA 4JS5A 4JLGA 3PIOA 2E65A 2PU9B 4M75E 4XTXA 3H8ZA 2GFUA 3PFSA 4PKCC 5LJ5j 5GMKl 4MZMA 5IT9E 3LLRA 4ZGJB 4KT0E 1DJ7B 3VYHB 3WVEB 3TEEA 1NPPA 3MEWA 2XDDA 1M1KU 2NLUA 3LGFA 3OY9A 2CZ6B 2X4YA 1UGRB 2KK4A 3QJYA 3PMIA 4L5GA 4BE0A 4C8QC 1KC8C 4RMOA 4JLIA 3CPWA 2XKOC 4HCBA 4FU6A 3A8LB 4X9CA 3JCMX 4XU3A 2JOYA 5FRNA 2EQJA 4UC4A 4J6WA 2R5MA 3G7ZA 4XU1A 1O75A 2HNIA 4A4GA 4BI8B 4KUDK 2EFIA 3JRZA 1FX7A 4IURA 3G4ST 3TU4K 4C8QD 4C8QB 2E5QA 3OMGA 2QXFA 2BIVA 4HCZA 2CZ0B 3URGA 3DKMA 4M77C 3RMQA 3SWNA 3CC7A 3PTAA 2E1HA 2XICA 3M57A 4BI3A 3G6EA 2RHXA 1MGQA 1LJOA 2ZPFB 5CKEA 3OS0A 2V8KA 4C92G 2RJDA 2V8JA 3META 3MEUA 1K8AC 3J7AF 3OYNA 3JCMd 2DJZA 5GANf 2K5IA 4O5VA 3QG1A 4PJOE 1N8RC 3CCMT 2K3YA 1FXXA 1JB0E 3A8MB 4M77E 4N4HA 3ZEHA 1YJNA 2EWNA 1G3SA 3CC2A 3NTIA 4XTYA 3HKSA 5LJ5f 2CS7A 1NJIC 4ZN1A 5GMKh 1R8OB 1KC8U 1N9SA 2DO3A 2M9UA 5GMKe 3E19A 3G71A 3JCMh 2KSSA 1WJQA 3JCMe 2HD0A 1KD1U 3HL8A 4C5HA 1NPRA 3OYEA 1M8VA 2R58A 4XU0A 5DM7R 3CCQA 4JRQA 1G3YA 1W2BS 3DLMA 5IAYA 2P0KA 1Y96B 4XK8E 2K3XA 3P8HA 2KMTA 3SB2A 5GAMj 3OYHA 4LDWA 2QQRA 4OGEA 5FROA 4B9XA 2DTIA 4C8QA 4C5EA 2LQKA 2E12A 4EPCA 4DA4A 4A4HA 3OS5A 2EKOA 1HXDA 1VQ9T 4C8QG 2DIGA 2HBPA 3JCMc 3GF5A 3ER0A 5GANg 3MEAA 3QZ9B 4J7IA 4CI0C 1VUBA 1I4K1 4DOVA 2YHTA 2LC4A 1V29B 3BW1A 4RCCA 5FU6B 1VQNT 5LJ5e 3LWHA 1SSFA 2FYKA 5LJ5g 1VQMA 2IVWA 4BE2A 1Q7YC 4PJOA 4MMKA 3A8GB 3DB3A 4M77A 2CKKA 3O8VA 3CCUT 1Q82C 4E7LA 2YLCA 5CQYA 5KCOA 4BE1A 2RK1A 2XIDA 3R6OA 5HK3A 1VQ8A 2DD4A 3V7RA 2ZPHB 1QVGS 3MP1A 1W4SA 5GAN4 4M78F 2LTOA 1YBYA 3FLGA 2MWOA 3LW5E 3QYGB 4QVCA 1I5LA 3CMAT 3OQ5A 3CCVT 1NZ9A 2C06A 1HK9A 2GFAA 4XTZA 2BKDN 2FVUA 1I81A 1K73U 1TH7A 1I8FA 3M9QA 3VJPA 3RESA 5CAIA 3PGGA 3CMEA 4JRPA 1YHQA 1FWZA 5GAN2 1Y96A 3BFMA 4HKEA 5GMKj 2QEXT 3CCRA 2QA4A 4QVDA 1Q86C 1VQ5T 2RK2A 4OB1B 1NE8A 2LRQA 5GAMf 1YJWA 3OS2A 1VQLT 2ZGWA 1YIJT 1VIEA 5HY6A 2QDYB 2RJFA 3CCLA 3FDRA 4C0GA 1KQ2A 1VIFA 1PSFA 2DTHA 3QBYA 5KH6A 1G3TA 4PLIA 3OYBA 3CCEA 3L2UA 1JBMA 4M7AF 2DZCA 2RD1A 3OYIA 1S72T 2RO0A 4FT4A 2HQEA 4LDYA 3TCJA 4RG2A 4E7JA 2RHIA 4A53A 2HAXA 4C92E 1ZBXA 3QO3A 5GAMd 4OP0A 5GAN3 3I56A 5GMKm 3A8HB 1BKBA 3CD6T 4LDXA 2RJCA 3CPFA 3I55T 3MP8A 1YI2A 1K73C 2RJEA 2MF2A 2OTLA 4E7IA 1WQ7A 2Y4XA 3OYAA 2VXEA 1VQPA 1M1FA 3EFRA 1QVGA 4WF2A 2EJ9A 4XQ3A 3EAEA 1VQ6T 3MP6A 5GAMh 1U8RA 5FLXE 4IKFA 3L1AA 4Y91A 5GAMe 4IUTA 3M55A 2KAFA 5GAMg 3A5ZB 1N27A 4J83A 2QQBA 5A0LA 3E9FA 5HK0A 2OTJT 2WSEE 3CBOA 3L2ZA 4ATOA 3P8BB 4M7DF 3JCMW 1N8RU 3BDUA 3UPUA 3CBPA 1UEBA 3BDLA 3V8KA 4JRIA 3WVDB 2QQ9A 1KHIA 2CZ1B 3M56A 4NL2A 4VUBA 3JCMf 3TREA 3UT1A 5KCHA 2XHCA 4BDYA 2WACA 5FU7C 1VQOA 1NJIU 4C8QE 3OYCA 4BI4A 2RI3A 3VUZA 5KE3A 2L5QA 3N5BB 1OZ3A 3CC4T 3C94A 2YLBA 4C92A 2E10A 5CO7A 3JCMV 1QP2A 4F7UB 2LT1A 2QQAA 4N0AC 2E64A 2GCXA 5C6SA 5HKCA 2ZCFB 5FU7B 4ELZC 5GAN5 3CCST 1YJ9T 3LH0A 2G3RA 3PT9A 1GXIE 2RM4A 1X01A 1OI1A 1BI3A 3HSBA 1QW1A 1YITT 1K9MC 3GOXA 1VQ4T 3GIBA 4OB3B 4M75F 4R56A 4HCCA 1X6OA 2PUOB 3L2VA 4E7HA 2QI2A 2LDMA 2E6ZA 4FM4B 1O9SA 5LJ3j 3JB9D 2QQSA 4FIBA 5KE2A 2O4XB 1Y7XA 3FEOA 3QDRB 4J6YA 3VKIA 3OYFA 5GAOn 4M78C 4RKUE 4LD9K 3RKXA 1JJ2S 1KG1A 2I2LA 3OBWA 1RI0A 3OBYA 2FB7A 3JCMg 1ZQ1A 3M54A 4Z02A 2RHYA 3QUIA 1Q81C 3DB4A 2RHZA 1U1SA 5CVIA 3G4SA 2L3RA 4BB7A 5GAOp 2P0QA 4KBMB 4M78D 4M78B 3HHTB 4E47A 3JB9H 1OYXA 1XTDA 2JTMA 2V8IA 4P5NA 2LT4A 5FU6C 3NFCA 5I2MA 3ZFJA 5A0GA 2E6NA 3LWIA 1WJRA 1QVPA 4A4KA 4C0DC 4MZTA 2PQWA 2O01E 4F7UA 2RHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCB A;  5LJ5 j;  3QHS A;  5GMK l;  1Y96 A;  1KQ1 A;  3BFM A;  5GMK j;  5GAN 2;  4PJO C;  4F7U G;  2DXU A;  4QVD A;  3JCM Q;  3RER A;  5GAO m;  4M7A C;  4DQ2 A;  4M75 A;  3JCM P;  3HFO A;  5GAM f;  3V7C A;  2DXT A;  2ZGW A;  4N0A A;  4PJO D;  1B34 B;  4PJO B;  4M75 G;  1KQ2 A;  1D3B B;  2DTH A;  2DKG A;  4M77 D;  4PJO F;  2EJG A;  4M77 B;  4C8Q C;  4M77 F;  4M7A D;  5GMK i;  4JLI A;  4M7A B;  1JBM A;  4M7A F;  2DZC A;  3JCM b;  2RD1 A;  4M78 E;  3JB9 G;  4X9C A;  3JCM X;  4XU3 A;  5LJ3 f;  3QSU A;  4V2S A;  4J6W A;  4A53 A;  4XU1 A;  2HNI A;  4C92 E;  3QO3 A;  3FB9 A;  5GAM d;  4OP0 A;  5GAN 3;  4C8Q D;  4C8Q B;  5GMK m;  4C8Q F;  2QTX A;  5GAN d;  4NOY A;  1WPY A;  1BIA A;  4EMG A;  4M77 C;  3SWN A;  4EMK C;  2E1H A;  1WQ7 A;  3M4G A;  2VXE A;  4M78 G;  5LJ3 d;  5LJ5 d;  3EFR A;  1MGQ A;  4WF2 A;  2EJ9 A;  1LJO A;  4XQ3 A;  4F7U F;  5DY9 A;  4M7D C;  1M5Q 1;  4HT8 A;  1H64 1;  5GAM h;  4C92 G;  3JCM d;  3L1A A;  2DJZ A;  4XTV A;  4Y91 A;  3RIR A;  5GAM e;  5GAN f;  3FIF A;  5GAN 6;  5GAM g;  5GAN h;  4EMK B;  4PJO E;  2RB6 A;  3FJP A;  4M77 E;  3V7S A;  3V8L A;  3L2Z A;  5GAN e;  5CAI A;  2EWN A;  1JRI A;  4X9D A;  4M7D D;  4M7A E;  4M7D B;  4XTY A;  5LJ5 f;  5LJ3 h;  3JCM W;  1WQW A;  3EFS A;  4M7D F;  3BDU A;  5LJ5 h;  2RA2 A;  5I21 A;  4A54 A;  5LJ3 e;  3JB9 F;  1U1T A;  3V8K A;  3HFN A;  4JRI A;  5GMK h;  5LJ3 g;  1N9R A;  4NL2 A;  5GAO r;  1N9S A;  1B34 A;  3JCM f;  5GMK e;  1D3B A;  3JCM h;  2EAY A;  4C8Q E;  1LOJ A;  4M78 A;  3SWN C;  3JCM e;  4PJO G;  5GAO l;  5GAO q;  4M77 G;  3VU3 C;  1M8V A;  4M75 C;  2YLB A;  2JN0 A;  2E10 A;  3RKY A;  3BY7 A;  4XU0 A;  2DTO A;  1LNX A;  3JCM V;  3V8J A;  4N0A C;  2E64 A;  4F7U B;  4M7A G;  1WNL A;  1Y96 B;  2DVE A;  5GAN 5;  2VC8 A;  3SB2 A;  5GAM j;  5GAN 8;  4C8Q A;  4J6X A;  4PNO A;  4JRK A;  2DTI A;  2RM4 A;  3SWN B;  4HT9 A;  1X01 A;  3HSB A;  5GAN 7;  1HXD A;  2DZ9 A;  4M75 D;  4M75 B;  4C8Q G;  4NL3 A;  4XTW A;  4XU2 A;  4XTU A;  3GIB A;  4M75 F;  3JCM c;  5GAN g;  1I4K 1;  5LJ3 j;  3JB9 D;  2YHT A;  3BW1 A;  3INZ A;  4M7D E;  4RCC A;  4HA8 A;  5LJ5 e;  4J6Y A;  2VXF A;  2FYK A;  2Y90 A;  5LJ5 g;  4PJO A;  5GAO n;  4M78 C;  4EMH A;  4MMK A;  4C92 A;  4M77 A;  3RKX A;  3RUX A;  4EMK A;  2E41 A;  4M7A A;  2I2L A;  3JCM g;  2FB7 A;  2YLC A;  4C92 C;  4MML A;  3JCM J;  3QUI A;  1YCY A;  4M7D A;  1U1S A;  5GAO p;  3V7R A;  4M78 D;  4M78 B;  2DEQ A;  3JB9 J;  4F7U E;  3AHU A;  5GAN 4;  4M7D G;  4M78 F;  3JB9 H;  4JUV A;  2K57 A;  4J5Y A;  4QVC A;  2EJF A;  4C92 D;  1I5L A;  4C92 B;  3JB9 I;  5GAN j;  4C92 F;  1BIB A;  1HK9 A;  4XTZ A;  2E65 A;  4M75 E;  4XTX A;  2CGH A;  1I81 A;  1TH7 A;  1I8F A;  3RKW A;  3RES A;  4F7U A;  3PGG A; 
#chains in the Genus database with same CATH topology
 1AWO A;  1AT1 B;  2QTV A;  3CCM A;  5GAO m;  1PNJ A;  4M7A C;  5FRM A;  1ZBJ A;  2VUB A;  4MDX A;  1G3W A;  1Q86 U;  3VS1 A;  3GPL A;  5A0D A;  2HL5 C;  3J80 E;  2DKG A;  3HP9 A;  2COY A;  3CBM A;  2DPP B;  3JCM b;  5LJ3 f;  3HRS A;  1EZZ B;  1AD5 A;  5KYN A;  2MCN A;  3CCE T;  1IXD A;  4QQG A;  2QGF B;  1TG0 A;  1BIA A;  1I1J A;  1T3S A;  2A3L A;  5LJ3 d;  2EYQ A;  1WLP B;  4TVR A;  4XAX B;  2EVR A;  3H6Z A;  5I22 A;  4M7D C;  1H64 1;  3S3M A;  2COW A;  4CRI A;  1K73 R;  1UHF A;  4RTY A;  3VS3 A;  1WYX A;  3OSV A;  3CC2 Q;  3FJP A;  2ZPG B;  3SD4 A;  1WQW A;  5CCA A;  2QAS A;  3ZBD A;  1JXO A;  2AKK A;  2XMF A;  3CMA A;  2DJQ A;  1UGQ B;  4A4F A;  1CKB A;  3BY7 A;  2DTO A;  4LD6 A;  1WNL A;  1RL2 A;  2DD5 A;  3REA B;  3SWN B;  3MCA B;  2A0F B;  2EIF A;  4XTU A;  3G6E T;  1T0J A;  1E7O A;  2KE9 A;  4DBR A;  1K9M U;  1EX4 A;  2LMJ A;  1QQJ A;  2DRK A;  2OI3 A;  1ZUU A;  3X20 B;  4EMH A;  3CCJ Q;  1TUG B;  4PFP A;  3VS5 A;  3J81 E;  2H3E B;  1VQ7 A;  3VS6 A;  1RAI B;  1BBZ A;  2MI6 A;  4L59 A;  4A4E A;  2DA9 A;  2JXB A;  3I55 A;  1W2B A;  4C92 F;  1SEM A;  1BIB A;  3CME Q;  1WHL A;  1AHJ B;  1KHC A;  5C0M A;  1ZHI A;  2CGH A;  2KDS A;  2KBT A;  5CQX A;  2KXC A;  3RKW A;  1C1A A;  2VB6 A;  1M1K C;  1M3B A;  1QCN A;  1YJW Q;  3JCM Q;  2CP5 A;  2BZY A;  5CIU A;  4M75 A;  2L8D A;  3L42 A;  2IG0 A;  1ZSZ A;  4M77 D;  1ZLM A;  2CUB A;  1RAG B;  4M77 B;  1Q82 U;  3QII A;  2DNU A;  1H3Z A;  4ELY C;  4L6V 5;  5CKB A;  2LQ8 A;  2L89 A;  3FB9 A;  3HRU A;  4OML A;  2F69 A;  4C8Q F;  1B3Q A;  2DER A;  1AZE A;  2LQW A;  4X1V A;  1WGS A;  2JZ2 A;  3GP8 A;  2QEX Q;  2GNC A;  4F7U F;  2MPX C;  2EQI A;  1YHQ T;  1Y07 A;  2QA4 T;  4EMK B;  5CKF A;  2DXB A;  2P4R A;  2DAQ A;  4AG2 C;  3OW2 A;  2A28 A;  2MMP A;  2QK0 A;  3VS4 A;  4M77 G;  3VU3 C;  1IGU A;  1PD0 A;  2P4T A;  5GAN 8;  4HT9 A;  4PNO A;  1YI2 T;  1OOT A;  1VQ6 Q;  1PRM C;  2OTL T;  3FRN A;  2JUF A;  1D1A A;  2JNG A;  4NS5 A;  2BUD A;  1WJS A;  1VQP T;  3PNW C;  4HA8 A;  1VQK A;  1BCO A;  2FZK B;  4IIM A;  3X24 B;  5J39 A;  2VYT A;  4JJC A;  1XQH A;  1XOV A;  4KUL A;  3IQL A;  1GL5 A;  4C92 C;  4MML A;  2FPE A;  4X34 A;  2C0I A;  2X4X A;  1UTI A;  3CXC A;  2DEQ A;  1VQO T;  2PNI A;  4E7S A;  1MMG A;  3VS7 A;  4Q5W A;  2PU9 B;  4M75 E;  5GMK l;  1IGQ A;  2LZ6 B;  1ZX6 A;  3VYH B;  1M1K U;  1NPP A;  1PRL C;  2X4Y A;  3PMI A;  4BE0 A;  4C8Q C;  4GLM A;  3CPW A;  3UF4 A;  2HNI A;  4BI8 B;  1FX7 A;  4J9G A;  3O5Z A;  1VQ9 Q;  2E5Q A;  4HCZ A;  4E2F B;  2FRY A;  3CC7 A;  1UUE A;  3EH1 A;  4BI3 A;  1W6X A;  1LJO A;  1JQQ A;  5CKE A;  2EW3 A;  2QAZ A;  3OYN A;  2YWW A;  1ABQ A;  2DL8 A;  2KNB B;  2K3Y A;  3A8M B;  3M0P A;  2EYW A;  1MV3 A;  3HKS A;  2CP3 A;  4ZN1 A;  3H9N A;  4RTW A;  3CMA Q;  1N9S A;  2DO3 A;  3JCM h;  1WJQ A;  3JCM e;  1I0C A;  1KD1 U;  2JM8 A;  2K3B A;  2R58 A;  5DM7 R;  3CCQ A;  4JRQ A;  3DLM A;  5IAY A;  2KMT A;  4OGE A;  3M0U A;  4DA4 A;  5I11 A;  2E12 A;  4RTV A;  3OS5 A;  1HXD A;  1VYV A;  2DIG A;  2IPO B;  3VRY A;  2K6D A;  2VAS A;  4DOV A;  2YHT A;  3BW1 A;  4AFQ C;  5LJ5 e;  3LWH A;  1SSF A;  4PJO A;  1RLP C;  1Q7Y C;  4MMK A;  4PFO A;  1K1Z A;  3O8V A;  1PM3 A;  4RTZ A;  5CQY A;  3BE3 A;  1ABO A;  4CC3 A;  3I55 Q;  1WHG A;  3R6O A;  5FWB A;  2ZPH B;  5GAN 4;  2E3H A;  1RAF B;  2CH4 A;  3QYG B;  3OQ5 A;  3CCV T;  2C06 A;  1TH7 A;  4JPB W;  3RES A;  2HSP A;  1FWZ A;  3H0I A;  5GAN 2;  4HKE A;  3G6E Q;  1MV0 B;  4QVD A;  2BE9 B;  1CKA A;  1F1B B;  2LRQ A;  1D09 B;  3OS2 A;  1KQ2 A;  3QBY A;  4KRT A;  3L2U A;  2PZ1 A;  5IHK A;  2RD1 A;  2RO0 A;  3TCJ A;  4E7J A;  2J6K A;  1HSQ A;  1ZBX A;  3QO3 A;  1ARK A;  4E7Z A;  2C0T A;  5GMK m;  2F1L A;  2FZC B;  2RPN A;  3A8H B;  2FG0 A;  4LDX A;  4Z89 A;  2LJ1 A;  4E7I A;  2Y4X A;  1WA7 A;  2VXE A;  3QWY A;  1UGV A;  4AMC A;  1QVG A;  4WF2 A;  5GAM h;  1M27 C;  2KRN A;  5FLX E;  1M2O A;  5GAM e;  2KAF A;  4J83 A;  2OTJ T;  2WSE E;  3L2Z A;  1UDL A;  3JCM W;  3BDU A;  3WVD B;  1RAD B;  4JRI A;  4BDY A;  2GQI A;  2ESW A;  1NJI R;  5KE3 A;  2L5Q A;  3CC4 T;  1QP2 A;  2X3W D;  4F7U B;  2E64 A;  5FW9 A;  1GXI E;  1X01 A;  1BI3 A;  1VQ4 T;  1PWT A;  4R56 A;  1VQK Q;  2QI2 A;  4K11 A;  4RTX A;  5LJ3 j;  2OX7 A;  3QDR B;  2NWM A;  4LD9 K;  1KG1 A;  4KH0 B;  2I2L A;  3OBW A;  3JCM g;  3M0Q A;  4Z02 A;  1Q81 C;  2D8J A;  3DB4 A;  2RHZ A;  2NUT B;  4BB7 A;  2MOX A;  5EC7 A;  2QGG A;  2BTT A;  4E47 A;  2EKH A;  1XTD A;  4P5N A;  2LT4 A;  5I2M A;  1Q82 R;  5A0G A;  4CC4 B;  4A63 B;  2OTL Q;  1X43 A;  2CP0 A;  2CYZ B;  4F7U G;  4JS4 A;  4FW1 A;  3EHQ A;  4JZ3 A;  1BI1 A;  4FYY B;  3HFO A;  3CQT A;  4DBF A;  1UGP B;  4N0A A;  3CCJ A;  1B34 B;  2ZZD A;  1D3B B;  1QKX A;  2O4X A;  4M77 F;  3CXC S;  2AKL A;  2B8A A;  1QMC A;  1VQO Q;  2HCK A;  1LVK A;  3GLX A;  1H3H A;  2YRD A;  1JJ2 A;  3JAM E;  2EGE A;  2M0Y A;  4FSX A;  2K7A A;  5CKH A;  2VKN A;  2J05 A;  5DY9 A;  1M5Q 1;  4QQD A;  4Z88 A;  1VQN A;  1AZG B;  2K5L A;  1JU5 C;  3FJ5 A;  3S3O A;  2PVD B;  3EFS A;  1KC8 U;  2A7Y A;  2RA2 A;  3FC3 A;  4II1 A;  4HXJ A;  2YUP A;  2E70 A;  2FRW A;  2RNA A;  2H3J A;  2J7I A;  5LJ3 g;  1G5V A;  1X6G A;  1LOJ A;  3SWN C;  1C6V X;  4BDZ A;  5IN1 A;  3GBQ A;  3LX7 A;  3PVQ A;  2O9V A;  2JN0 A;  3RKY A;  2WSF E;  5J26 A;  3MEV A;  4J6X A;  2XG8 D;  4OMM A;  3ULR B;  2QEX A;  5GAN 7;  2DZ9 A;  3OYJ A;  3A8O B;  2DX1 A;  1VQ5 A;  5L8R E;  2FHD A;  3OYL A;  1VQL A;  3INZ A;  2HBW A;  2VV5 A;  3RNJ A;  4ZTJ A;  1PSE A;  4IUP A;  3M5A A;  4YTL A;  1WXU A;  1YJN T;  3M58 A;  1YNZ A;  1C0M A;  3JCM J;  4M7D A;  3M0R A;  3AHU A;  3G71 T;  2IIM A;  4PLL A;  1Q81 U;  2EJF A;  3JB9 I;  2KY9 A;  3L2Q A;  2CP6 A;  3D7S B;  1UB4 A;  1BYM A;  1VQ6 A;  4RCB A;  2MAM A;  4OGC A;  1I5O B;  4N4G A;  3SHW A;  2DBM A;  4DQ2 A;  4MDW A;  4DEY A;  4PJO D;  4PJO B;  2RI5 A;  4LN2 A;  3U23 A;  1I07 A;  2EJG A;  2O88 A;  1Y0M A;  4N4I A;  1QVF A;  4M78 E;  2G6F X;  2KYM A;  3C4S A;  3X26 B;  1K8A R;  4FYX B;  2K4Y A;  3AT1 B;  2LP5 A;  1VQ8 T;  3CCS A;  5GAN d;  4OMP A;  1M3A A;  3TSZ A;  2D0Q B;  4EMG A;  4EMK C;  3M4G A;  5LJ5 d;  1KD1 R;  4C5G A;  3PMT A;  1P92 A;  4QVZ A;  1MMN A;  4DBQ A;  4J8O A;  1BK2 A;  3QWX X;  3CCR T;  4DOW A;  1D1B A;  3V7S A;  4LNP A;  3F70 A;  3HPW A;  3HRT A;  1BI2 A;  4ZGD B;  4M7A E;  4ZTF A;  1TU0 B;  1WXB A;  2SRC A;  2PVO B;  2JM9 A;  3JB9 F;  2CSI A;  3UWN A;  4AG1 C;  1HJD A;  4PJO G;  1VQ9 A;  2PUK B;  1M90 R;  3TSW A;  1QWE A;  2DXC A;  3EHR A;  5KYX A;  1YP5 A;  5CR2 A;  3I56 T;  2XDP A;  3X25 B;  1WHM A;  2PTK A;  1GFC A;  2RQV A;  1W2B P;  1T3L A;  4D6W A;  4M7D E;  4J9B A;  2OTJ Q;  1PHT A;  3OB9 A;  1OV3 A;  2KRO A;  1M1G A;  3GNG A;  1J3T A;  4ANJ A;  1D1C A;  2JW4 A;  1SHF A;  1N6A A;  2JVV A;  3OSS C;  3RDV A;  2GF7 A;  3JB9 J;  1U06 A;  2M16 A;  5DLO A;  1KQS A;  3OYM A;  1VQ7 T;  4EDU A;  3SFM A;  4JS5 A;  4JLG A;  3NPF A;  3H8Z A;  1WDX A;  1ZUK A;  2GFU A;  3PFS A;  5IT9 E;  3LLR A;  1Q95 G;  2RQT A;  5L23 A;  1RI9 A;  1WHH A;  4CC7 A;  4OMQ A;  4ZGJ B;  4KT0 E;  3WVE B;  3TEE A;  2GBQ A;  1GCQ C;  2DYB A;  2KK4 A;  3QJY A;  2DL3 A;  1SRM A;  4RMO A;  4JLI A;  2L0A A;  2XKO C;  3NGP A;  1JO8 A;  3JCM X;  4XU1 A;  1UJY A;  4A4G A;  3A98 A;  4F04 B;  3OW2 P;  3G4S T;  1W70 A;  5KYY A;  3RMQ A;  3G6E A;  1VQN Q;  4RTU A;  1MGQ A;  3EFO B;  2ZPF B;  1TOV A;  3OS0 A;  2RJD A;  2V8J A;  1N8R C;  4D8K A;  1FXX A;  1T0H A;  5HCK A;  1SG5 A;  3NTI A;  3UAT A;  4FW2 A;  1TSF A;  4QKU A;  2JJ9 A;  3HL8 A;  3EG9 B;  1NPR A;  2E3I A;  4XU0 A;  3CXC P;  3VS2 A;  2X3X D;  1AWJ A;  4LXC A;  2DYI A;  3P8H A;  3OYH A;  1VQ5 Q;  3NMZ C;  2QQR A;  4LDW A;  2QG9 B;  5FRO A;  4B9X A;  4C8Q A;  4EPC A;  2LQK A;  1VQL Q;  3JCM c;  5IXF A;  3ER0 A;  4J7I A;  1M8M A;  4F16 A;  1SPK A;  4R0K A;  5FU6 B;  2FYK A;  2CKK A;  4FYV B;  3CCU T;  1D0Z A;  2XID A;  2DD4 A;  3CPW P;  2D1X A;  1YBY A;  3FLG A;  3LW5 E;  4QVC A;  1NZ9 A;  5IH2 A;  2FVU A;  3M9Q A;  3VJP A;  2ROT A;  3PGG A;  1VYT A;  4JRP A;  2FEI A;  1YHQ A;  3QDF A;  1Y96 A;  3BFM A;  2QA4 A;  1AWW A;  2GTO A;  4OB1 B;  5D7U A;  1ACM B;  2ZGW A;  1YIJ T;  3VS0 A;  2O2O A;  4D8D A;  4C0G A;  1PSF A;  5KH6 A;  1G3T A;  4PLI A;  1K0S A;  3OYB A;  3EGD A;  1JBM A;  1S72 T;  3H0F A;  2RHI A;  4A53 A;  3CCS Q;  2HAX A;  4C92 E;  1KC8 R;  3CD6 T;  1FMW A;  4J9E A;  2RJC A;  3CPF A;  1PG5 B;  1YI2 A;  1K73 C;  2CH4 W;  2MF2 A;  2OTL A;  1WQ7 A;  1VQP A;  3EFR A;  1R77 A;  4XQ3 A;  1TS9 A;  1K4U S;  1Z9Z A;  3EG3 A;  4IKF A;  3L1A A;  1N27 A;  2FPF A;  5A0L A;  1MMA A;  3SEM A;  1N8R U;  3BDL A;  2QQ9 A;  1KHI A;  2CZ1 B;  5KCH A;  2XHC A;  2WAC A;  1VQO A;  4RTT A;  4C8Q E;  4BI4 A;  2KRS A;  2JT4 A;  1AWX A;  3C94 A;  2QQA A;  2SEM A;  5C6S A;  4ELZ C;  5FU7 B;  5GAN 5;  1YJ9 T;  1RUW A;  1OI1 A;  3HSB A;  1YIT T;  1Q81 R;  3GIB A;  4OB3 B;  1X6B A;  2PUO B;  2DL7 A;  4E7H A;  2LDM A;  2LNH B;  3ZL7 C;  3JB9 D;  1NBE B;  3FEO A;  1PKS A;  4J6Y A;  4J9F A;  4RKU E;  2CSQ A;  1EFN A;  3EH2 A;  2DL4 A;  1ZQ1 A;  3M54 A;  3QUI A;  3CCE Q;  1U1S A;  1H92 A;  4KBM B;  3HHT B;  1OYX A;  1GRI A;  3ZFJ A;  2JTM A;  2V8I A;  4FSS A;  5KYX B;  2E6N A;  3HTR A;  1QVP A;  1H8K A;  4MZT A;  2PQW A;  3QPH A;  2HKQ B;  4R55 A;  3RER A;  3MKD A;  1X27 A;  4C0D B;  1BU1 A;  2DXT A;  3KBG A;  4PJO F;  1N5Z A;  1Q86 R;  1OEB A;  2RH2 A;  3JB9 G;  2YRC A;  2LNV A;  2L3S A;  2W10 A;  1VA7 A;  2CDT A;  4PJJ A;  2HQX A;  1QP3 A;  2LCC A;  4LDU A;  1U3O A;  2QTX A;  2YT6 A;  2V1R A;  2MWP A;  5LL6 S;  3LH5 A;  5IHN A;  1K73 U;  2JTF A;  2M02 A;  4HT8 A;  3RMS A;  2YDL A;  2CT3 A;  4XTV A;  3RIR A;  2ZPI B;  5GAN 6;  4ZN3 A;  4BY6 B;  1IRE B;  3C95 A;  5LJ3 h;  2DK3 A;  3UA6 A;  3VV0 A;  1W2B S;  2AHJ B;  5I21 A;  1IRX A;  5LJ3 e;  5GAO r;  2F5K A;  5AYF A;  4IUU A;  5CK9 A;  1NM7 A;  1AVZ C;  1M4Z A;  1QKW A;  5M9O A;  5EG2 A;  5GAO q;  5KYY B;  1M9S A;  2DVE A;  2EYY A;  2L3Q A;  4JRK A;  1OX9 A;  2M0O A;  4M75 D;  4M75 B;  1R0B G;  4NL3 A;  1UEC A;  3OMC A;  4E7K A;  1SSH A;  2ENM A;  5I2S A;  2ZAE A;  1ZSZ B;  4GBQ A;  1K76 A;  4JJN K;  2K2V A;  1K9M R;  3I5R A;  4BAC A;  4F14 A;  1NYG A;  2GQV A;  3OYY A;  2F5T X;  2XU8 A;  2LQN A;  4J7F A;  3CC2 T;  1FYN A;  2DET A;  3LYI A;  4ME7 A;  1RAB B;  1HYO A;  2R57 A;  4FL6 A;  1YHQ Q;  1TUD A;  2QA4 Q;  1JJ2 P;  1NLP C;  2RN8 A;  3L2R A;  4PJO C;  1KFZ A;  1WHJ A;  1TXQ A;  3OW2 S;  2AK5 A;  2R5A A;  2OTJ A;  2WSC E;  2EYX A;  2DMO A;  3JCM P;  1Q7Y U;  1WX6 A;  4M75 G;  7AT1 B;  2YXY A;  4Y92 A;  1VQM T;  5GMK i;  2X9H A;  3PVL A;  3M4Y A;  1MHN A;  3CC4 A;  1VYU A;  3TVT A;  3ME9 A;  5DLQ E;  3CCJ T;  1E6G A;  4C0F A;  1OU8 A;  1YI2 Q;  2F2W A;  3UDC A;  4LUE A;  1VQP Q;  1KIK A;  1OPL A;  1WHK A;  1VQ4 A;  2D0N A;  2I0N A;  3GNF B;  3L2W A;  2ZPB B;  4PJN A;  3CME T;  2Y4Y A;  3X28 B;  3FIF A;  2YUQ A;  2C0O A;  3KUF A;  4M4Z A;  1UGS B;  2RB6 A;  4Z8A A;  3V8L A;  4HVV A;  4IUV A;  2K79 A;  2BE7 D;  1YJW T;  1RAA B;  4OMF B;  1YWO A;  1ZUY A;  4A54 A;  3CCL T;  1X2K A;  4IIO A;  1N9R A;  2KVQ G;  3NTH A;  2ZPE B;  4IUQ A;  1SKU B;  2EAY A;  3OYG A;  4M78 A;  1AEY A;  5J3B A;  5GAO l;  3CD6 Q;  2EYZ A;  3SDZ A;  2VC8 A;  2D6F A;  2AIR B;  2J6F A;  2RI2 A;  4WTO B;  3JSC A;  2X4W A;  4XTW A;  3CPW S;  2GTJ A;  4BD3 A;  2LJ3 A;  2K5F A;  3S3N A;  1WIE A;  2RQW A;  4AFZ C;  5CKD A;  2Y90 A;  2ED0 A;  5IHI A;  2LJ0 A;  4EMK A;  2E41 A;  3E9G A;  4M7A A;  1VOM A;  1NYF A;  4DBH A;  3C0C A;  4RG8 A;  2VGM A;  3VRZ A;  2CP7 A;  2EGC A;  1QVF P;  1KJW A;  2MYS A;  5A2Q E;  4J5Y A;  3P8D A;  1PC0 A;  2V1Q A;  2E65 A;  1BCM A;  4XTX A;  1SHG A;  4PKC C;  2HSE B;  2HEQ A;  2XDD A;  3MEW A;  2YSQ A;  1MND A;  2NLU A;  3LGF A;  1D0X A;  1M1K R;  1QWF A;  2CZ6 B;  4L5G A;  1TWB A;  1CSK A;  4HCB A;  5GJW B;  4X9C A;  2JOY A;  2EQJ A;  2R5M A;  1IB8 A;  4KUD K;  4IUR A;  3OMG A;  3URG A;  3DKM A;  4M77 C;  2JTE A;  3PTA A;  1YCS B;  4FCY A;  3MEU A;  3MET A;  3JCM d;  5GAN f;  1U5S A;  2RMO A;  2NUP A;  4ORZ A;  3H0H A;  3CCM T;  4M77 E;  5FWC A;  4N4H A;  1YJN A;  1G3S A;  4XTY A;  2CUD A;  5LJ5 f;  2CS7 A;  4HVW A;  1NJI C;  3CCV Q;  1E6H A;  3E19 A;  3G71 A;  2KSS A;  1UJ0 A;  2RQU A;  1M8V A;  1GCQ A;  3R6N A;  1XJW B;  4XK8 E;  4ESR A;  2JS2 A;  4A4H A;  2EKO A;  1VQ9 T;  1QCO A;  2DFU A;  2HBP A;  3GF5 A;  3EG0 A;  4PJM A;  4CI0 C;  1VUB A;  1V29 B;  4RCC A;  2IVW A;  1FMK A;  4PFZ A;  4BE2 A;  3A8G B;  1G83 A;  4CC2 A;  1Q82 C;  2YLC A;  2QDL A;  4PK4 A;  3PE0 A;  8ATC B;  1VQ8 A;  3V7R A;  1QVG S;  1W4S A;  2YUO A;  2MWO A;  3CMA T;  1PKT A;  4XTZ A;  2GFA A;  1OQK A;  1ZA2 B;  2BKD N;  2LCS A;  2KGT A;  3CCR A;  1NG2 A;  1FMV A;  4E6R A;  3EGU A;  5GAM f;  2ED1 A;  1RAH B;  1VIE A;  5HY6 A;  1VIF A;  3REB B;  2V26 A;  3EGX A;  3CC4 Q;  3CCE A;  4AT1 B;  4FT4 A;  2HQE A;  4RG2 A;  3RR6 A;  4B6M A;  5GAM d;  2DE0 X;  4OP0 A;  5GAN 3;  3I56 A;  2ROL A;  1KK7 A;  1BKB A;  1VQ4 Q;  2M51 A;  3I55 T;  4RUG A;  2A08 A;  1V76 A;  2EJ9 A;  1MUZ A;  2FO0 A;  1U8R A;  5GJV B;  1RAE B;  2MIO A;  4IUT A;  3A5Z B;  2DF6 A;  2B86 A;  3CBO A;  3P8B B;  3UA7 A;  1VQM Q;  3UPU A;  3CBP A;  1TTH B;  1M2V A;  1UEB A;  3V8K A;  1QLY A;  2KT8 A;  2VWF A;  4NL2 A;  4VUB A;  3M56 A;  1NJI U;  5FU7 C;  1A0N B;  3OYC A;  3VUZ A;  3THK A;  2YLB A;  4C92 A;  2E10 A;  5CO7 A;  2LT1 A;  2ZCF B;  3PT9 A;  2G3R A;  2RM4 A;  1W1F A;  2H8H A;  4DEX A;  1QW1 A;  6AT1 B;  3GOX A;  4PJL A;  1WXT A;  4M75 F;  1X6O A;  2E6Z A;  4FM4 B;  1O9S A;  2QQS A;  3EG2 A;  2O4X B;  2E4H A;  2EPD A;  1QCF A;  5GAO n;  1UHC A;  3CCL Q;  1JJ2 S;  2BZX A;  2KXD A;  3OBY A;  2RHY A;  3E2U A;  3G4S A;  2P0Q A;  4M78 D;  1Q7Y R;  4M78 B;  2DBK A;  3JB9 H;  2DL5 A;  3LWI A;  2KT1 A;  3NFC A;  2KRM A;  4KGX B;  4A4K A;  4C0D C;  3RKX A;  2O01 E;  4F7U A;  3QHS A;  1HD3 A;  2HMA A;  1KQ1 A;  3MJX A;  2DXU A;  3MHX A;  3TQ7 P;  4HCK A;  3I5S A;  2LVM A;  1OZ2 A;  4WCI A;  3VUB A;  3V7C A;  1K8A C;  1EIF A;  4O6J A;  3CEY A;  4KGV B;  1VQK T;  3DLL A;  4M7A D;  4M7A B;  1BI0 A;  1ZSG A;  1IHW A;  4JDS A;  1KD1 C;  2RF0 A;  2NUT A;  3VYG A;  3M53 A;  4HVU A;  4M78 G;  1SF9 A;  4BY6 C;  1KSW A;  3PIP A;  2D9T A;  2JMA A;  2ATC B;  2COZ A;  4C0Z A;  1YJN Q;  2QYZ A;  4AFU C;  3CCU A;  1JRI A;  1V1C A;  4X9D A;  4M7D D;  4M7D B;  1JEG A;  1M90 C;  2EQM A;  2NUZ A;  3G71 Q;  4JJD A;  2F2V A;  1U1T A;  2CT4 A;  3HFN A;  2K9G A;  5D6Y A;  1B34 A;  2HDA A;  1D3B A;  1OU9 A;  3QYH B;  2KYB A;  4C5I A;  3OS1 A;  4M75 C;  2LX9 A;  4M7A G;  1BB9 A;  2EQK A;  1ZSZ C;  4OVA A;  3S6W A;  4JZ4 A;  3CC7 T;  1JXM A;  2J06 A;  1QVF S;  4FYW B;  1X69 A;  2XI9 A;  1YIJ A;  3CCM Q;  5D6W A;  2NUP B;  3QXE B;  4OB0 B;  3RUX A;  4QQ6 A;  1S72 A;  5KYW A;  1VQ8 Q;  4J9C A;  2ECZ A;  2VGN A;  1YCY A;  4GY5 A;  2PVG B;  4OB2 B;  5D6X A;  3WXM B;  4F7U E;  4M7D G;  3CD6 A;  4JUV A;  2K57 A;  2CZ7 B;  3LGL A;  1IHV A;  5IXB A;  4LDV A;  1RLQ C;  3CCQ T;  4FT2 A;  3CCR Q;  3H41 A;  2L2P A;  2XK0 A;  2XD0 A;  3QZ5 B;  3T9N A;  4BUG A;  4Y28 E;  3KFV A;  3E1S A;  2KR3 A;  2KQW A;  1K8A U;  1WFW A;  2FL7 A;  3EG1 A;  3QSU A;  1R0C B;  3I56 Q;  4V2S A;  4ZGE B;  3QKJ A;  4QT7 A;  1YJ9 A;  2NYS A;  1GBQ A;  3OYK A;  2X4J A;  4NOY A;  1ZA1 B;  2L3P A;  1WPY A;  4KUI A;  2F2X A;  1YIT A;  2AT1 B;  3NTK A;  1QVG P;  4QW2 A;  2DLP A;  4MZP A;  2LCL A;  4B9W A;  1XNI A;  3QJ6 A;  5GAN h;  4LE9 A;  5KYU A;  5GAN e;  2ABL A;  5LJ5 h;  1KQS S;  3KXT A;  3EGX B;  1GFD A;  4GLK A;  1D0Y A;  3A1P A;  3Q1J A;  1VQ7 Q;  1M90 U;  2OAU A;  2HQH A;  3OYD A;  2DVJ A;  4KGZ B;  4OMN A;  1LNX A;  3V8J A;  2XDB A;  3RBB B;  2X35 A;  3OA6 A;  2RQR A;  4PL6 A;  2D8H A;  1IZ6 A;  2O9S A;  2DIQ A;  2M1H A;  2MK5 A;  1X75 C;  4XU2 A;  2YRV A;  1Y71 A;  3M59 A;  1Y57 A;  4J9D A;  1IO6 A;  2VXF A;  3C12 A;  3G4S Q;  3MO8 A;  2P0P A;  1K0X A;  3CCV A;  1M2V B;  4OF1 A;  3ASK A;  4C92 D;  4C92 B;  5GAN j;  2EQU A;  3JV3 A;  2FZG B;  3PIO A;  5LJ5 j;  4MZM A;  1UE9 A;  1UG1 A;  2JS0 A;  1DJ7 B;  1X2Q A;  2AZV A;  1NEB A;  1B7T A;  3OY9 A;  1WZO A;  1UGR B;  2YUN A;  1KC8 C;  4KH1 B;  4FU6 A;  3A8L B;  5FRN A;  4XU3 A;  4UC4 A;  4J6W A;  3G7Z A;  1O75 A;  2EFI A;  3JRZ A;  1YWP A;  4C8Q D;  3TU4 K;  1LCK A;  2AZS A;  4C8Q B;  2OJ2 A;  2QXF A;  2BIV A;  2CZ0 B;  2LX7 A;  3SWN A;  2E1H A;  2XIC A;  3M57 A;  2RHX A;  3J7A F;  2V8K A;  4C92 G;  1M30 A;  2DJZ A;  2K5I A;  4O5V A;  3CCU Q;  3QG1 A;  4PJO E;  1JB0 E;  3ZEH A;  1B07 A;  2EWN A;  3CC2 A;  4ZNX A;  1MMD A;  8AT1 B;  1R8O B;  5GMK h;  2CRE A;  2M9U A;  5GMK e;  2A37 A;  2KEA A;  2HD0 A;  4C5H A;  3OYE A;  1S1N A;  9ATC B;  1G3Y A;  1MNE A;  1PD1 A;  2P0K A;  1Y96 B;  1YFN A;  2K3X A;  3SB2 A;  5GAM j;  2DTI A;  4OMO A;  4C5E A;  2DRM A;  1YIJ Q;  4C8Q G;  1AOJ A;  5GAN g;  3MEA A;  3QZ9 B;  1I4K 1;  2LC4 A;  3EFO A;  1OPK A;  1UFF A;  2DEU A;  3EGD B;  1VQN T;  1S72 Q;  5LJ5 g;  1TUC A;  1VQM A;  3DB3 A;  4M77 A;  3M0S A;  4E7L A;  5KCO A;  4BE1 A;  1NEG A;  2A36 A;  2RK1 A;  5HK3 A;  2K2M A;  3MP1 A;  1K9A A;  4M78 F;  2LTO A;  2J6O A;  2HKN A;  1I5L A;  2W0Z A;  1HK9 A;  4JJB A;  3EG9 A;  4LUD A;  3I35 A;  1I81 A;  1I8F A;  2Z0W A;  3CC7 Q;  5CAI A;  3CME A;  1G8X A;  5GMK j;  2QEX T;  1Q86 C;  4J9I A;  1VQ5 T;  2RK2 A;  1NE8 A;  4EIK A;  1YJW A;  1VQL T;  2BZ8 A;  2QDY B;  2RJF A;  3CCL A;  3FDR A;  2DTH A;  4J9H A;  1GCP A;  5KYW B;  4M7A F;  2DZC A;  3NHN A;  3OYI A;  2JMC A;  4LDY A;  4AFS C;  1YJ9 Q;  4F17 A;  2O31 A;  1GBR A;  1YIT Q;  2KI7 A;  3MP8 A;  3CCQ Q;  2RJE A;  5ECA A;  3OYA A;  1M1F A;  2VVK A;  2DIL A;  2X51 A;  3EAE A;  2HL3 A;  1VQ6 T;  3MP6 A;  1YN8 A;  1RAC B;  4Y91 A;  3M55 A;  5GAM g;  2FPD A;  2QQB A;  3E9F A;  5HK0 A;  4ATO A;  5AT1 B;  1M3C A;  2E5K A;  2CP2 A;  2OAW A;  4M7D F;  1OUL A;  1WI7 A;  3UT1 A;  3TRE A;  3JCM f;  1N8R R;  2EGA A;  2RI3 A;  3N5B B;  1OZ3 A;  1OX8 A;  3JCM V;  4N0A C;  2GCX A;  5HKC A;  2HZY A;  3CCS T;  1G2B A;  3LH0 A;  1K9M C;  4HCC A;  2GGR A;  3L2V A;  3M0T A;  4FIB A;  3I9Q A;  5KE2 A;  1Y7X A;  5KYU B;  3VKI A;  3OYF A;  3G1J A;  4M78 C;  3MPU B;  2EBP A;  1RI0 A;  2FB7 A;  1LPL A;  5CVI A;  1NLO C;  2L3R A;  5GAO p;  1SRL A;  5FU6 C;  1KQS P;  1WJR A;  1Z9Q A;  1PCX A;  2DM1 A;  2P84 A;  2RHU A; 
#chains in the Genus database with same CATH homology
 3QPH A;  3QHS A;  1KQ1 A;  2CYZ B;  4F7U G;  2DXU A;  4JS4 A;  4R55 A;  3CCM A;  5GAO m;  3RER A;  3MHX A;  4M7A C;  5FRM A;  2LVM A;  2VUB A;  1OZ2 A;  4C0D B;  1BI1 A;  3VUB A;  3HFO A;  4MDX A;  3V7C A;  1G3W A;  2DXT A;  1UGP B;  1EIF A;  4N0A A;  4O6J A;  5A0D A;  3GPL A;  3J80 E;  3CCJ A;  1B34 B;  3CEY A;  2ZZD A;  1D3B B;  3KBG A;  2DKG A;  4PJO F;  1VQK T;  3HP9 A;  3DLL A;  4M77 F;  2O4X A;  3CXC S;  4M7A B;  4M7A D;  1BI0 A;  3CBM A;  2RH2 A;  2DPP B;  3JCM b;  3JB9 G;  2B8A A;  2LNV A;  5LJ3 f;  1M90 C;  2HQX A;  3HRS A;  1QP3 A;  4JDS A;  2LCC A;  1KD1 C;  4LDU A;  3GLX A;  2QTX A;  1JJ2 A;  3CCE T;  4QQG A;  3VYG A;  3JAM E;  3M53 A;  1BIA A;  2A3L A;  5LJ3 d;  4M78 G;  2MWP A;  5LL6 S;  4BY6 C;  4FSX A;  2EYQ A;  3PIP A;  4TVR A;  2JTF A;  2D9T A;  3H6Z A;  4XAX B;  5CKH A;  5DY9 A;  1M5Q 1;  4QQD A;  1H64 1;  4HT8 A;  4C0Z A;  3S3M A;  4CRI A;  3RMS A;  1VQN A;  4XTV A;  3RIR A;  2ZPI B;  3OSV A;  5GAN 6;  2K5L A;  4ZN3 A;  3FJP A;  2ZPG B;  4BY6 B;  3SD4 A;  1IRE B;  3CCU A;  1JRI A;  4X9D A;  3S3O A;  4M7D D;  4M7D B;  2PVD B;  3C95 A;  5LJ3 h;  1WQW A;  2DK3 A;  2EQM A;  2A7Y A;  3EFS A;  3VV0 A;  2AHJ B;  2RA2 A;  4II1 A;  5CCA A;  5I21 A;  5LJ3 e;  1U1T A;  3FC3 A;  3HFN A;  5GAO r;  2E70 A;  2F5K A;  5LJ3 g;  2H3J A;  5AYF A;  5D6Y A;  3ZBD A;  1B34 A;  1G5V A;  1D3B A;  4IUU A;  5CK9 A;  1LOJ A;  3SWN C;  1M4Z A;  3CMA A;  3QYH B;  4BDZ A;  5IN1 A;  5M9O A;  1UGQ B;  5EG2 A;  4C5I A;  5GAO q;  3OS1 A;  3LX7 A;  4M75 C;  2LX9 A;  4A4F A;  2JN0 A;  3RKY A;  3BY7 A;  4M7A G;  2DTO A;  2EQK A;  2WSF E;  1M9S A;  4LD6 A;  5J26 A;  1WNL A;  1RL2 A;  2DD5 A;  2DVE A;  3MEV A;  4OVA A;  4J6X A;  2XG8 D;  4JRK A;  3MCA B;  3S6W A;  3SWN B;  2QEX A;  2EIF A;  2M0O A;  5GAN 7;  2DZ9 A;  3CC7 T;  4M75 D;  3A8O B;  4M75 B;  3OYJ A;  4NL3 A;  3OMC A;  4XTU A;  4E7K A;  1VQ5 A;  3G6E T;  5L8R E;  5I2S A;  2FHD A;  3OYL A;  1QVF S;  1VQL A;  2XI9 A;  1YIJ A;  1Q86 U;  3INZ A;  1K9M U;  2VV5 A;  4ZTJ A;  5D6W A;  3QXE B;  1PSE A;  2K2V A;  3M5A A;  4IUP A;  4OB0 B;  4JJN K;  4YTL A;  3X20 B;  4EMH A;  4BAC A;  3RUX A;  1YJN T;  4QQ6 A;  1S72 A;  2GQV A;  3OYY A;  2F5T X;  2XU8 A;  3M58 A;  4J7F A;  3J81 E;  3CC2 T;  1VQ7 A;  3JCM J;  2VGN A;  1YCY A;  4M7D A;  4GY5 A;  2PVG B;  2MI6 A;  4L59 A;  4OB2 B;  5D6X A;  3WXM B;  4A4E A;  4F7U E;  3AHU A;  3G71 T;  3LYI A;  3CD6 A;  4JUV A;  4PLL A;  4M7D G;  3I55 A;  2K57 A;  1Q81 U;  4ME7 A;  2CZ7 B;  2EJF A;  3LGL A;  1W2B A;  3JB9 I;  2KY9 A;  3L2Q A;  4C92 F;  1BIB A;  2R57 A;  4LDV A;  4FL6 A;  1AHJ B;  1KHC A;  5C0M A;  3CCQ T;  1ZHI A;  2CGH A;  1UB4 A;  2KDS A;  4FT2 A;  5CQX A;  1VQ6 A;  3RKW A;  1BYM A;  4RCB A;  2MAM A;  4OGC A;  2XK0 A;  3L2R A;  1M1K C;  2XD0 A;  4PJO C;  4N4G A;  3JCM Q;  3QZ5 B;  3OW2 S;  5CIU A;  2R5A A;  3T9N A;  2OTJ A;  2WSC E;  4DQ2 A;  4M75 A;  2L8D A;  3JCM P;  3L42 A;  4BUG A;  4MDW A;  1Q7Y U;  4Y28 E;  2IG0 A;  4PJO D;  4PJO B;  2RI5 A;  4M75 G;  3E1S A;  4M77 D;  2EJG A;  2KQW A;  4M77 B;  1Q82 U;  3QII A;  1VQM T;  5GMK i;  1K8A U;  4N4I A;  1QVF A;  4M78 E;  2FL7 A;  3QSU A;  1H3Z A;  3M4Y A;  1MHN A;  3C4S A;  3X26 B;  4V2S A;  4ELY C;  4ZGE B;  3QKJ A;  3CC4 A;  4L6V 5;  5CKB A;  2LQ8 A;  3ME9 A;  5DLQ E;  2L89 A;  2K4Y A;  3FB9 A;  4C0F A;  3HRU A;  3CCJ T;  1VQ8 T;  2F69 A;  3CCS A;  1YJ9 A;  4C8Q F;  3OYK A;  4M7D C;  5GAN d;  3UDC A;  2X4J A;  4NOY A;  1WGS A;  1WPY A;  2JZ2 A;  4KUI A;  2D0Q B;  4EMG A;  1YIT A;  4EMK C;  1VQ4 A;  3M4G A;  3NTK A;  3GP8 A;  5LJ5 d;  4C5G A;  3GNF B;  3PMT A;  4F7U F;  2ZPB B;  4QW2 A;  3L2W A;  1P92 A;  3CME T;  2Y4Y A;  4QVZ A;  4MZP A;  3X28 B;  1YHQ T;  2LCL A;  4B9W A;  1XNI A;  1Y07 A;  3QJ6 A;  4J8O A;  2QA4 T;  3FIF A;  3CCR T;  5GAN h;  4EMK B;  3KUF A;  1UGS B;  2RB6 A;  4DOW A;  5CKF A;  3V7S A;  3V8L A;  5GAN e;  2DXB A;  3F70 A;  3HPW A;  3HRT A;  1BI2 A;  4ZGD B;  4M7A E;  4IUV A;  4ZTF A;  1YJW T;  2DAQ A;  4OMF B;  5LJ5 h;  1KQS S;  2PVO B;  4A54 A;  3KXT A;  3CCL T;  3JB9 F;  4GLK A;  3OW2 A;  1N9R A;  2KVQ G;  3Q1J A;  3NTH A;  3UWN A;  2ZPE B;  4IUQ A;  2MMP A;  1M90 U;  2OAU A;  2EAY A;  3OYG A;  3OYD A;  4M78 A;  5J3B A;  4PJO G;  5GAO l;  1VQ9 A;  2PUK B;  4M77 G;  3VU3 C;  2DXC A;  1LNX A;  3V8J A;  5CR2 A;  3I56 T;  2XDB A;  2X35 A;  2XDP A;  3SDZ A;  2VC8 A;  3X25 B;  4PL6 A;  3OA6 A;  2P4T A;  5GAN 8;  2D6F A;  4PNO A;  4HT9 A;  1IZ6 A;  1YI2 T;  2DIQ A;  2RI2 A;  2M1H A;  2OTL T;  1X75 C;  3JSC A;  2X4W A;  2JUF A;  3FRN A;  2JNG A;  4NS5 A;  2BUD A;  2YRV A;  1WJS A;  4XTW A;  1VQP T;  3CPW S;  1Y71 A;  4D6W A;  4BD3 A;  3PNW C;  2K5F A;  4M7D E;  3M59 A;  3S3N A;  4HA8 A;  1VQK A;  5CKD A;  3OB9 A;  2VXF A;  2Y90 A;  3X24 B;  1M1G A;  3GNG A;  5J39 A;  2VYT A;  4EMK A;  2E41 A;  3C12 A;  3E9G A;  3MO8 A;  4M7A A;  1XQH A;  1XOV A;  2P0P A;  4KUL A;  3CCV A;  4C92 C;  4MML A;  4X34 A;  1N6A A;  2JVV A;  2X4X A;  4XU2 A;  3OSS C;  2VGM A;  4RG8 A;  3CXC A;  2GF7 A;  3JB9 J;  2DEQ A;  2M16 A;  1VQO T;  5DLO A;  5A2Q E;  4J5Y A;  3P8D A;  4OF1 A;  3ASK A;  4C92 D;  4C92 B;  1KQS A;  5GAN j;  2EQU A;  3OYM A;  1VQ7 T;  4EDU A;  3SFM A;  4Q5W A;  4JS5 A;  4JLG A;  3PIO A;  2E65 A;  2PU9 B;  4M75 E;  4XTX A;  3H8Z A;  2GFU A;  3PFS A;  4PKC C;  5LJ5 j;  5GMK l;  4MZM A;  5IT9 E;  3LLR A;  4ZGJ B;  4KT0 E;  1DJ7 B;  3VYH B;  3WVE B;  3TEE A;  1NPP A;  3MEW A;  2XDD A;  1M1K U;  2NLU A;  3LGF A;  3OY9 A;  2CZ6 B;  2X4Y A;  1UGR B;  2KK4 A;  3QJY A;  3PMI A;  4L5G A;  4BE0 A;  4C8Q C;  1KC8 C;  4RMO A;  4JLI A;  3CPW A;  2XKO C;  4HCB A;  4FU6 A;  3A8L B;  4X9C A;  3JCM X;  4XU3 A;  2JOY A;  5FRN A;  2EQJ A;  4UC4 A;  4J6W A;  2R5M A;  3G7Z A;  4XU1 A;  1O75 A;  2HNI A;  4A4G A;  4BI8 B;  4KUD K;  2EFI A;  3JRZ A;  1FX7 A;  4IUR A;  3G4S T;  3TU4 K;  4C8Q D;  4C8Q B;  2E5Q A;  3OMG A;  2QXF A;  2BIV A;  4HCZ A;  2CZ0 B;  3URG A;  3DKM A;  4M77 C;  3RMQ A;  3SWN A;  3CC7 A;  3PTA A;  2E1H A;  2XIC A;  3M57 A;  4BI3 A;  3G6E A;  2RHX A;  1MGQ A;  1LJO A;  2ZPF B;  5CKE A;  3OS0 A;  2V8K A;  4C92 G;  2RJD A;  2V8J A;  3MET A;  3MEU A;  1K8A C;  3J7A F;  3OYN A;  3JCM d;  2DJZ A;  5GAN f;  2K5I A;  4O5V A;  3QG1 A;  4PJO E;  1N8R C;  3CCM T;  2K3Y A;  1FXX A;  1JB0 E;  3A8M B;  4M77 E;  4N4H A;  3ZEH A;  1YJN A;  2EWN A;  1G3S A;  3CC2 A;  3NTI A;  4XTY A;  3HKS A;  5LJ5 f;  2CS7 A;  1NJI C;  4ZN1 A;  5GMK h;  1R8O B;  1KC8 U;  1N9S A;  2DO3 A;  2M9U A;  5GMK e;  3E19 A;  3G71 A;  3JCM h;  2KSS A;  1WJQ A;  3JCM e;  2HD0 A;  1KD1 U;  3HL8 A;  4C5H A;  1NPR A;  3OYE A;  1M8V A;  2R58 A;  4XU0 A;  5DM7 R;  3CCQ A;  4JRQ A;  1G3Y A;  1W2B S;  3DLM A;  5IAY A;  2P0K A;  1Y96 B;  4XK8 E;  2K3X A;  3P8H A;  2KMT A;  3SB2 A;  5GAM j;  3OYH A;  4LDW A;  2QQR A;  4OGE A;  5FRO A;  4B9X A;  2DTI A;  4C8Q A;  4C5E A;  2LQK A;  2E12 A;  4EPC A;  4DA4 A;  4A4H A;  3OS5 A;  2EKO A;  1HXD A;  1VQ9 T;  4C8Q G;  2DIG A;  2HBP A;  3JCM c;  3GF5 A;  3ER0 A;  5GAN g;  3MEA A;  3QZ9 B;  4J7I A;  4CI0 C;  1VUB A;  1I4K 1;  4DOV A;  2YHT A;  2LC4 A;  1V29 B;  3BW1 A;  4RCC A;  5FU6 B;  1VQN T;  5LJ5 e;  3LWH A;  1SSF A;  2FYK A;  5LJ5 g;  1VQM A;  2IVW A;  4BE2 A;  1Q7Y C;  4PJO A;  4MMK A;  3A8G B;  3DB3 A;  4M77 A;  2CKK A;  3O8V A;  3CCU T;  1Q82 C;  4E7L A;  2YLC A;  5CQY A;  5KCO A;  4BE1 A;  2RK1 A;  2XID A;  3R6O A;  5HK3 A;  1VQ8 A;  2DD4 A;  3V7R A;  2ZPH B;  1QVG S;  3MP1 A;  1W4S A;  5GAN 4;  4M78 F;  2LTO A;  1YBY A;  3FLG A;  2MWO A;  3LW5 E;  3QYG B;  4QVC A;  1I5L A;  3CMA T;  3OQ5 A;  3CCV T;  1NZ9 A;  2C06 A;  1HK9 A;  2GFA A;  4XTZ A;  2BKD N;  2FVU A;  1I81 A;  1K73 U;  1TH7 A;  1I8F A;  3M9Q A;  3VJP A;  3RES A;  5CAI A;  3PGG A;  3CME A;  4JRP A;  1YHQ A;  1FWZ A;  5GAN 2;  1Y96 A;  3BFM A;  4HKE A;  5GMK j;  2QEX T;  3CCR A;  2QA4 A;  4QVD A;  1Q86 C;  1VQ5 T;  2RK2 A;  4OB1 B;  1NE8 A;  2LRQ A;  5GAM f;  1YJW A;  3OS2 A;  1VQL T;  2ZGW A;  1YIJ T;  1VIE A;  5HY6 A;  2QDY B;  2RJF A;  3CCL A;  3FDR A;  4C0G A;  1KQ2 A;  1VIF A;  1PSF A;  2DTH A;  3QBY A;  5KH6 A;  1G3T A;  4PLI A;  3OYB A;  3CCE A;  3L2U A;  1JBM A;  4M7A F;  2DZC A;  2RD1 A;  3OYI A;  1S72 T;  2RO0 A;  4FT4 A;  2HQE A;  4LDY A;  3TCJ A;  4RG2 A;  4E7J A;  2RHI A;  4A53 A;  2HAX A;  4C92 E;  1ZBX A;  3QO3 A;  5GAM d;  4OP0 A;  5GAN 3;  3I56 A;  5GMK m;  3A8H B;  1BKB A;  3CD6 T;  4LDX A;  2RJC A;  3CPF A;  3I55 T;  3MP8 A;  1YI2 A;  1K73 C;  2RJE A;  2MF2 A;  2OTL A;  4E7I A;  1WQ7 A;  2Y4X A;  3OYA A;  2VXE A;  1VQP A;  1M1F A;  3EFR A;  1QVG A;  4WF2 A;  2EJ9 A;  4XQ3 A;  3EAE A;  1VQ6 T;  3MP6 A;  5GAM h;  1U8R A;  5FLX E;  4IKF A;  3L1A A;  4Y91 A;  5GAM e;  4IUT A;  3M55 A;  2KAF A;  5GAM g;  3A5Z B;  1N27 A;  4J83 A;  2QQB A;  5A0L A;  3E9F A;  5HK0 A;  2OTJ T;  2WSE E;  3CBO A;  3L2Z A;  4ATO A;  3P8B B;  4M7D F;  3JCM W;  1N8R U;  3BDU A;  3UPU A;  3CBP A;  1UEB A;  3BDL A;  3V8K A;  4JRI A;  3WVD B;  2QQ9 A;  1KHI A;  2CZ1 B;  3M56 A;  4NL2 A;  4VUB A;  3JCM f;  3TRE A;  3UT1 A;  5KCH A;  2XHC A;  4BDY A;  2WAC A;  5FU7 C;  1VQO A;  1NJI U;  4C8Q E;  3OYC A;  4BI4 A;  2RI3 A;  3VUZ A;  5KE3 A;  2L5Q A;  3N5B B;  1OZ3 A;  3CC4 T;  3C94 A;  2YLB A;  4C92 A;  2E10 A;  5CO7 A;  3JCM V;  1QP2 A;  4F7U B;  2LT1 A;  2QQA A;  4N0A C;  2E64 A;  2GCX A;  5C6S A;  5HKC A;  2ZCF B;  5FU7 B;  4ELZ C;  5GAN 5;  3CCS T;  1YJ9 T;  3LH0 A;  2G3R A;  3PT9 A;  1GXI E;  2RM4 A;  1X01 A;  1OI1 A;  1BI3 A;  3HSB A;  1QW1 A;  1YIT T;  1K9M C;  3GOX A;  1VQ4 T;  3GIB A;  4OB3 B;  4M75 F;  4R56 A;  4HCC A;  1X6O A;  2PUO B;  3L2V A;  4E7H A;  2QI2 A;  2LDM A;  2E6Z A;  4FM4 B;  1O9S A;  5LJ3 j;  3JB9 D;  2QQS A;  4FIB A;  5KE2 A;  2O4X B;  1Y7X A;  3FEO A;  3QDR B;  4J6Y A;  3VKI A;  3OYF A;  5GAO n;  4M78 C;  4RKU E;  4LD9 K;  3RKX A;  1JJ2 S;  1KG1 A;  2I2L A;  3OBW A;  1RI0 A;  3OBY A;  2FB7 A;  3JCM g;  1ZQ1 A;  3M54 A;  4Z02 A;  2RHY A;  3QUI A;  1Q81 C;  3DB4 A;  2RHZ A;  1U1S A;  5CVI A;  3G4S A;  2L3R A;  4BB7 A;  5GAO p;  2P0Q A;  4KBM B;  4M78 D;  4M78 B;  3HHT B;  4E47 A;  3JB9 H;  1OYX A;  1XTD A;  2JTM A;  2V8I A;  4P5N A;  2LT4 A;  5FU6 C;  3NFC A;  5I2M A;  3ZFJ A;  5A0G A;  2E6N A;  3LWI A;  1WJR A;  1QVP A;  4A4K A;  4C0D C;  4MZT A;  2PQW A;  2O01 E;  4F7U A;  2RHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...