1B34A

Crystal structure of the d1d2 sub-complex from the human snrnp core domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
b'KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1)
molecule tags Rna binding protein
source organism Homo sapiens
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1b34A00
4M77F 3RKYA 3EFSA 4M77A 3V7CA 4M7AF 5LJ3h 3VU3C 2EJGA 4XTYA 4M7AA 4M7DB 4M77B 2FB7A 3JCMg 4EMGA 3RIRA 3EFRA 3JCMh 5GAOm 4M7AE 4M7DD 4PJOC 1N9SA 3JCMf 2E41A 3M4GA 1WNLA 1X01A 4M78B 1Y96B 4M75A 4M75E 1BIAA 1U1TA 1WQ7A 3INZA 1BIBA 1U1SA 4NL2A 4XTXA 3V7RA 5GAMj 1I8FA 1Y96A 4M77D 4M78F 4F7UG 2Y90A 5GAN7 3QSUA 3BY7A 3L2ZA 4PNOA 4XU0A 1WQWA 2DZCA 3RESA 2YLBA 4X9DA 4XTVA 3RKXA 4C8QD 4C92D 2RM4A 5GAOl 1B34B 3JB9J 2VXFA 4RCBA 2DXTA 1YCYA 4MMKA 4DQ2A 3JCMb 4M78E 3QHSA 2HNIA 5DY9A 3RUXA 3V8LA 4C8QA 1H641 1WPYA 3QUIA 4F7UB 5LJ3e 1I4K1 3JCMX 5GAOr 1KQ1A 1M8VA 2E10A 4XTWA 3JCMQ 5GAMg 2RA2A 2ZGWA 5GAN6 3SWNA 3FIFA 2QTXA 4NOYA 1JBMA 4F7UA 5GMKj 4MMLA 3V8KA 4M78C 2EWNA 4J6YA 4M7DC 4M77C 3V8JA 4PJOD 2DXUA 2DEQA 4M7AC 2E65A 1TH7A 4EMKB 1B34A 4M75G 4NL3A 4V2SA 2JN0A 3FJPA 2DVEA 1JRIA 4N0AC 2FYKA 4M7AB 3HFNA 1HXDA 2DTIA 2I2LA 4HA8A 4C8QG 5LJ5d 4PJOF 5LJ5j 5LJ5f 3AHUA 4PJOA 5GAN5 1KQ2A 4X9CA 3RKWA 2CGHA 2DTOA 2RB6A 5GANd 5GAOq 4C92C 4XU1A 4M75B 5GANg 4XQ3A 1MGQA 4EMHA 5GAMh 1D3BA 4HT9A 5GMKh 4XU3A 1LJOA 5LJ3g 4M7AG 5GAOn 3BDUA 4C8QB 4QVDA 4EMKC 3JCMW 3BW1A 5GAN2 3RERA 4J6XA 1D3BB 4M7AD 5GMKe 5LJ3f 3BFMA 4M7DE 2RD1A 4J5YA 4PJOG 5GAMf 4QVCA 2EJ9A 1I5LA 4C8QF 1LNXA 2E1HA 5GAMd 3HSBA 3FB9A 2VC8A 5GANf 5GAN3 4M75C 4RCCA 2DTHA 4M78D 4XU2A 5LJ3j 5CAIA 3JB9D 4A54A 5GAN4 5GANh 4M75F 4JUVA 5GMKl 5GANj 4JRKA 3JB9G 1HK9A 2DJZA 4XTUA 2K57A 4C92G 5LJ5e 4A53A 4C8QE 2VXEA 2YLCA 5GMKi 3JB9H 4PJOB 4M78A 4J6WA 4EMKA 3JB9I 4M7DA 4M7DF 5LJ5g 1N9RA 3SB2A 3L1AA 2EJFA 4OP0A 3JCMc 3V7SA 5I21A 5LJ5h 2DKGA 2EAYA 4M77E 4F7UF 4N0AA 4F7UE 2E64A 4WF2A 4XTZA 3JCMe 4HT8A 2YHTA 5GAMe 3JCMP 4JLIA 4C92B 4C8QC 3JCMV 4JRIA 5GMKm 1LOJA 4C92E 4M77G 4M7DG 1M5Q1 5GAN8 5GANe 3QO3A 3SWNB 3PGGA 5LJ3d 4M75D 3GIBA 4C92F 5GAOp 4C92A 3HFOA 1I81A 3SWNC 3JB9F 2DZ9A 3JCMJ 4PJOE 4Y91A 4M78G 3JCMd
chains in the Genus database with same CATH superfamily
2OTLQ 1PHTA 1PM3A 2R58A 1V76A 2BZXA 2CH4A 3RIRA 2X4JA 2VWFA 3VS0A 2OTJA 1VYUA 2DILA 3M4GA 1YIJA 2DMOA 2XMFA 3JRZA 1YHQA 1I8FA 4DOVA 3OYGA 2MPXC 5FWCA 1R0BG 4C8QD 5GJWB 1LVKA 4X9DA 1BI1A 3SD4A 3DLMA 4IUUA 1QVGA 2X4YA 3LWIA 4MMKA 2QQRA 4TVRA 3CXCP 1YIJT 1M1KC 1AVZC 4OMQA 2YSQA 2LCLA 4BI3A 4XTWA 1I0CA 3SWNA 2F5TX 2V8JA 1G2BA 2KMTA 3M0QA 5CKHA 2DIGA 2RPNA 5A0LA 1YJ9T 3EH2A 3ME9A 4M75G 1UTIA 3CCST 4HCCA 2K5FA 2M02A 1VQ8Q 3QYGB 1JRIA 3J80E 4LDYA 4M7AB 2FZCB 1G3TA 4HCKA 2CGHA 2X9HA 4KGVB 3CC7A 1Q7YC 1AZEA 4WCIA 2HQEA 3LW5E 5GAOn 4BE1A 5FU6B 3CMAQ 1MMDA 3HRSA 2FL7A 4IUPA 4RTXA 1KK7A 2CP0A 3CMEA 2FG0A 2IIMA 3ZEHA 1WGSA 1Q81U 1N9RA 3TEEA 1PCXA 2EBPA 4JS5A 1NLPC 5CQXA 3CMAA 1YBYA 4LDUA 1YJ9Q 3CCSQ 3CC7Q 3ZL7C 5GAOp 4MZMA 1RADB 4HXJA 2OJ2A 1TUCA 3CCQA 2QAZA 2GTOA 1H3ZA 1VQPA 3G1JA 4XTYA 5CK9A 3TSZA 1VQ5Q 1U3OA 2RI2A 4D8DA 5IXFA 3P8DA 3QWXX 2KNBB 1IB8A 1K76A 2ABLA 1IREB 1U1SA 1VUBA 2W10A 2AKLA 1V1CA 1M90U 1VIFA 5AYFA 1TS9A 4J7FA 3CD6Q 2VGNA 5CCAA 2HKQB 2HQXA 2NYSA 2LCCA 2RH2A 2LJ1A 1WPYA 1M8VA 1WIEA 2DK3A 3DB4A 3VS4A 2RQWA 4RTVA 2BZ8A 3GP8A 4N4GA 1TH7A 3I35A 2KYBA 3OYEA 3QIIA 2PVOB 3RMSA 2QA4T 2VB6A 2YDLA 4FU6A 4MDWA 4C92C 3VYGA 1M4ZA 3E19A 3WXMB 1HD3A 1ZQ1A 2CYZB 3EGXB 3TREA 3G4ST 3E1SA 4KGZB 4PJNA 1VQ7Q 4ZNXA 3ZBDA 1TG0A 5CKBA 5CKDA 2VC8A 3OYLA 5CVIA 3OYCA 5GAN4 1VQMQ 4C5GA 3GLXA 4J9CA 2KI7A 1G5VA 3M0UA 3KFVA 1X6OA 5KYXA 3CCUA 4C0ZA 1M1KR 1N27A 3C94A 3MEWA 1SG5A 2RHXA 3QPHA 4M77G 5GAN8 5DM7R 2QI2A 2X51A 4C5HA 4FIBA 1VQ8T 2LJ0A 1IZ6A 3CCLT 1QCFA 2NLUA 3OB9A 3OYFA 2HQHA 1WI7A 3CC2Q 3A8LB 2MIOA 1ZHIA 5GAOm 1VQ8A 3J81E 1X6GA 5IXBA 2K6DA 5IHIA 2RMOA 1H3HA 2V8IA 4M78B 4EIKA 1AT1B 3VS6A 4KUIA 1NZ9A 5FLXE 4BUGA 2HMAA 2D6FA 1YFNA 2X35A 4L6V5 2DVJA 3T9NA 3RESA 1G83A 5IHKA 4D8KA 2JT4A 2L3RA 1TUDA 4BDYA 4IIMA 2CDTA 2CP2A 3QUIA 1E6GA 5A0GA 1X2QA 3RR6A 2K3XA 2O4XA 3OS2A 2ZGWA 5GAN6 4A4KA 4DA4A 2HD0A 3MKDA 1OYXA 2HL5C 4E6RA 1CKBA 1KIKA 1KC8U 2OTJQ 1N5ZA 1W2BA 3TVTA 2KE9A 4HA8A 3QZ9B 2QA4A 3QG1A 1SRMA 5GANd 3UPUA 1WJSA 3S3MA 1WHLA 2HKNA 4RUGA 3NTHA 4QQ6A 3X25B 1TU0B 3BDUA 3MPUB 4QVDA 1ACMB 2EGCA 3PFSA 4RTUA 1MMGA 1DJ7B 2JJ9A 1QVFP 1VQ9T 1W6XA 2H3EB 2LT1A 5D6WA 4FYVB 1LPLA 1ABOA 1AEYA 2YLCA 1UGQB 2QEXT 4AG2C 4CC7A 4KUDK 2K2MA 2O9VA 2KEAA 1C1AA 2K5LA 4PKCC 4A4EA 5GANe 4FT2A 1WZOA 1GXIE 1T0HA 4C92F 1LCKA 5KYYB 4Y91A 4M78G 1VQPT 2HDAA 2F5KA 2LNVA 4FT4A 1SHGA 4EMGA 1T3SA 3OW2S 3I55T 3WVEB 1BIAA 1BIBA 1X43A 1XOVA 4LD9K 3RMQA 3UA6A 4E7KA 2WSCE 2FO0A 3CMET 4DEXA 4MZTA 1OPKA 1T3LA 4J8OA 3OMCA 3OA6A 1KQ1A 2O01E 4BE2A 3RNJA 1WFWA 1P92A 4LUDA 1BI2A 5A0DA 3CCUT 4J9DA 2A28A 1X2KA 1IRXA 4F17A 1KD1R 2M51A 2K79A 2DRMA 2R5AA 3CEYA 3C4SA 1KHIA 1Q86U 3I55Q 4AFZC 4BY6C 3EFOB 3FDRA 1YJ9A 2ATCB 2M0OA 2LDMA 1QWFA 3L2RA 2JTEA 4IUQA 4JDSA 4C8QF 2K3BA 2YUPA 5FRNA 2BIVA 5GJVB 1Y0MA 1IXDA 3EG1A 1TOVA 2L5QA 3E9GA 1GFCA 4M7DF 1D0ZA 2AK5A 2GFAA 3DLLA 4RTYA 2PNIA 2H8HA 3OQ5A 4C92B 2L3PA 1GCQC 2KXDA 3CCUQ 3LGFA 4C92A 2DZ9A 5C0MA 4PJOE 3BE3A 4N4HA 3MO8A 4ELZC 4M7AA 4Z8AA 3U23A 2LTOA 3A98A 2NUZA 4M7DD 4PFPA 1PKTA 4LE9A 5GAMj 1YJWQ 1D0YA 2GBQA 1M3AA 3C95A 5GAN7 1UDLA 1C0MA 1QVGS 3A8HB 3UATA 1NPRA 2A3LA 1JJ2A 5ECAA 2DXTA 1YCYA 1FXXA 4LDWA 5L23A 4L5GA 3CCQT 2DBMA 1YITA 2JVVA 4BB7A 4QQGA 4F7UA 4FM4B 2EFIA 1HJDA 1UE9A 2K7AA 2YT6A 1M27C 3HL8A 4JRQA 3QJYA 3MHXA 1YITQ 4M7AC 4N0AC 2YRDA 1HXDA 5LJ5d 3RBBB 1UG1A 1KQ2A 2MOXA 2L89A 2OAWA 5GANg 3CBMA 4EMHA 5GMKh 2V8KA 3ER0A 2M0YA 3H8ZA 1JXMA 4PJJA 1SF9A 4GBQA 3OBYA 4A4HA 2CSIA 5CAIA 2ZPIB 4C5EA 1VYTA 5I11A 4JRKA 3VV0A 4CRIA 3JB9G 1HK9A 1YI2Q 4PJOB 3CCQQ 4M78A 3JSCA 1PKSA 3I56Q 5D7UA 1E7OA 3I9QA 4E47A 3NTIA 5L8RE 2LX7A 2RN8A 3QO3A 2L3QA 1I81A 1O75A 1M3BA 3EFSA 4M77A 3UT1A 2PUKB 2DD5A 3PTAA 2QK0A 3DB3A 1N8RU 3VRYA 4A4GA 1N9SA 1Y96B 1M1FA 1Q86C 1U1TA 1WQ7A 3PMIA 4OB2B 1K9MC 1I1JA 3CD6A 1QQJA 2Y90A 3MJXA 4N4IA 2R5MA 2RI3A 2DZCA 1M9SA 4JJNK 4EPCA 2ZPHB 2DM1A 4LN2A 1YI2T 2LNHB 3RUXA 3JAME 2E3IA 2J06A 3EG3A 1OZ3A 1QLYA 3PMTA 2GFUA 4ZTFA 2C0OA 1S72T 3V8KA 3QZ5B 4PJOD 4M77C 4E2FB 4IKFA 4J83A 2B86A 2MAMA 3UWNA 4ZN1A 5CKEA 3PT9A 3G6ET 2FRYA 1BCMA 1Q81C 2X3XD 2DF6A 2I2LA 4D6WA 5D6XA 5LJ5j 2SRCA 2FPFA 4RTZA 1UGRB 1D3BA 4HT9A 3A5ZB 1WHMA 4HCZA 3FLGA 3BDLA 4KRTA 3SFMA 4A4FA 2DA9A 1BI0A 2LJ3A 2DYIA 2LQKA 1RABB 3EHRA 2FVUA 1RI0A 2E5KA 2EQKA 2KT1A 3LYIA 2QQ9A 5LJ5e 2J6KA 3UA7A 4M7DA 2ED0A 3I55A 3L1AA 2EAYA 2JW4A 4HVVA 1JEGA 1WHHA 4FW2A 3AT1B 3CPWS 2DYBA 2ED1A 3VYHB 4DBHA 2KRSA 4ZGEB 1PSFA 4QT7A 4E7LA 1H8KA 3M0SA 4JZ3A 2ENMA 3HTRA 3P8HA 1K73U 2FZGB 2QEXA 4UC4A 2KGTA 2JUFA 2DETA 2YRVA 2EGAA 4BD3A 1AD5A 4HKEA 3META 1FYNA 8ATCB 1VOMA 3OYJA 4EMKA 1VQMT 3RDVA 4XTVA 3NPFA 2QA4Q 4WTOB 3R6NA 4IUTA 1MMAA 1VQKQ 2OAUA 1W4SA 1VQLA 1AOJA 2PVDB 1I4K1 3OBWA 1VQ4A 5IHNA 4KT0E 1CKAA 4Q5WA 2HSPA 3FIFA 4LD6A 3VS7A 3M4YA 4MMLA 1QCOA 5FRMA 1K73C 2MWPA 5CQYA 1KQSA 1WJQA 5FU6C 1TSFA 1X69A 3I56A 2Y4XA 5J39A 3H9NA 3CCLQ 1M2VA 5LJ5f 3UF4A 4ZGJB 4F14A 1GCQA 3RKWA 3S6WA 2EYXA 2CREA 2OI3A 2CUDA 3KXTA 4XU3A 3CPWP 1BCOA 3QDFA 3BW1A 2DD4A 5GAN2 1AZGB 4BACA 4M7DE 3REBB 1YJWT 3MEUA 5GAMf 2P0PA 2A37A 2YUOA 5GANf 3JB9D 2EQJA 4BI8B 3HRTA 1G3YA 3Q1JA 4C8QE 1G3SA 2DLPA 4ATOA 1FMWA 5I21A 2EYQA 2BE9B 4Z89A 4XTZA 2CH4W 2KYMA 2AZVA 1WHKA 3CQTA 1AWWA 3JCMJ 4LXCA 2LZ6B 1M30A 2DL7A 2LVMA 4QVCA 3RKYA 2HAXA 2EYZA 3VU3C 3CCEA 2EJGA 1MMNA 1ZUUA 5J26A 3HP9A 2EKHA 2HL3A 3EH1A 1WYXA 2KROA 1RAHB 3M57A 2QASA 3CCRA 4J7IA 3L2ZA 1Y71A 3RKXA 1TWBA 1ZA1B 1GFDA 3JB9J 3L2VA 1VQPQ 3VJPA 1K8AU 3TQ7P 1YHQQ 3G4SA 1U5SA 2OX7A 5DY9A 3EFOA 2CP6A 2PUOB 5CR2A 1EIFA 2E10A 1ZBXA 4ELYC 3CC4A 2KXCA 4M78C 1BBZA 5DLOA 1MNDA 2KDSA 2RO0A 1AWJA 2IPOB 2DVEA 5DLQE 4R56A 1F1BB 3E9FA 3HRUA 3HFNA 2RJDA 4C8QG 3REAB 2ZZDA 5HCKA 4OGCA 2C0IA 1R77A 4XU1A 4EDUA 2LQ8A 4J9GA 5C6SA 1NYGA 2CZ7B 1RL2A 1IO6A 4ANJA 1XNIA 2VUBA 2A0FB 5FU7C 3SEMA 2PTKA 2LC4A 3EGDA 3LH0A 2COWA 2OTLT 2D1XA 1VQOT 5AT1B 3M5AA 4JJCA 2PVGB 1ABQA 2XDBA 4A53A 4ZN3A 1Q81R 4LNPA 3VS5A 1U8RA 2E12A 1VQNT 3M53A 1EFNA 5I22A 1UGPB 3JCMP 5GMKm 3H41A 3X20B 3PGGA 2D8JA 3M58A 5KYYA 4DOWA 3JB9F 3CPFA 4OMFB 4OMLA 4YTLA 2GNCA 1BK2A 1NYFA 1FMKA 2FB7A 4M7AE 3H0IA 1UB4A 2CP5A 3EAEA 4ESRA 2JMAA 2ZPBB 5EG2A 1VQNA 2F2XA 1FX7A 1YWPA 3VKIA 2RK1A 1O9SA 2BE7D 9ATCB 1VQ6Q 4K11A 1WDXA 2XI9A 2VASA 3P8BB 5D6YA 2HNIA 2RHYA 4AFUC 2LP5A 3NGPA 3JCMX 2COYA 1VQ5A 3GNFB 1PRMC 1Q95G 4GY5A 3H6ZA 2AHJB 4EMKB 2JTMA 2CKKA 3CCSA 3AHUA 3CXCS 1K9MU 2DL5A 2RB6A 4LDXA 2JS0A 5FROA 1QKXA 1VQ4Q 1ZUYA 1YJNA 3VS1A 4E7HA 4OGEA 1Z9ZA 2KRMA 3JCMW 3RERA 4JJBA 7AT1B 2EPDA 1JO8A 4J5YA 1Z9QA 2EJ9A 5GAMd 2F2WA 1YP5A 5LL6S 4M78D 2D8HA 5GANh 3NHNA 1YHQT 1IGUA 2A36A 1RUWA 2YXYA 2FHDA 2HCKA 1IHWA 3MP6A 3A8MB 1SHFA 1KC8C 1K9AA 2YRCA 4F7UE 4HT8A 1Y07A 3JCMV 4M7DG 2RQRA 4QQDA 5IH2A 3L42A 4VUBA 2EYWA 2PU9B 4X1VA 3VRZA 2PQWA 3PVQA 3V7CA 2MI6A 2EQUA 3CC4T 2RNAA 2E3HA 5EC7A 4C0DC 4FYXB 2DE0X 1SKUB 4RG8A 1WA7A 4XAXB 1OX8A 5HK3A 1V29B 4CC2A 3H0HA 2XDDA 4RKUE 1B3QA 4M77D 5IN1A 2QQSA 2A7YA 4C5IA 3I5SA 1B34B 3QKJA 4E7IA 4DQ2A 3JCMb 3CCMQ 3OYMA 1AHJB 1J3TA 3QYHB 4Z88A 1K1ZA 3A8GB 3MP1A 1G8XA 3M55A 3G4SQ 2EWNA 4JLGA 4II1A 3X26B 4IUVA 2QXFA 2L0AA 8AT1B 5A2QE 2O4XB 3CCMA 4QKUA 3G71T 1IHVA 3OYHA 2YWWA 2OTLA 4HCBA 1AWOA 2RHUA 2AKKA 2W0ZA 1RLPC 4JJDA 4OMMA 5IAYA 5GMKe 3BFMA 2RD1A 5KCHA 2RQUA 1SSHA 2JM8A 4M75C 4RCCA 5LJ3j 1YJWA 2XHCA 1AWXA 4O5VA 2DJZA 2Y4YA 4C92G 2RHZA 4QVZA 2VXEA 3N5BB 3JB9I 1R0CB 3O5ZA 3EHQA 2CSQA 2RQVA 1KQSS 4OP0A 2L2PA 1QVFS 4N0AA 1OEBA 3OS0A 3GOXA 3VUZA 2QQAA 3ZFJA 4Y92A 1VQ7T 3L2UA 5LJ3d 2SEMA 1QP2A 2V1QA 1VQ9Q 1NJIR 1T0JA 2E6NA 4AT1B 2XU8A 3I5RA 1VQ4T 1PWTA 3ULRB 3CCJT 2E41A 1NEBA 2DO3A 1ZA2B 3X24B 1S72Q 1Q82U 2J05A 2KRNA 2KSSA 3FRNA 3LH5A 2LCSA 3CCVT 2VYTA 2CS7A 5KYUB 2CZ6B 2M1HA 4C92D 1BKBA 1BYMA 4RCBA 5KYUA 1PD0A 4PK4A 1KC8R 1GL5A 3KBGA 1K8AR 2ZCFB 1NEGA 2QTXA 1VQKA 2E70A 2JXBA 2WSFE 2FPEA 2EGEA 2RQTA 3CCLA 2HBPA 2D0QB 2DPPB 2DTIA 4OF1A 2JNGA 4PJOA 1GBRA 1FWZA 2VVKA 3OYAA 1VQLQ 3EG0A 1ARKA 2EQIA 3J7AF 1WXBA 4M75B 1YCSB 2XDPA 4ORZA 3CCJQ 1VQ6A 4A63B 1RAFB 3OYDA 4AFSC 1NM7A 4M7AD 1N8RR 1KD1C 1ZBJA 4KULA 1N6AA 2DX1A 4BY6B 2ZPEB 4XU2A 2VGMA 1VQ6T 4QW2A 5FW9A 5GANj 1NLOC 1NJIU 1JJ2S 4XTUA 2F69A 2PZ1A 1E6HA 1K0XA 1QVGP 1WX6A 4RMOA 3CC2T 5I2MA 2GTJA 4L59A 2HSEB 4B6MA 3LLRA 2C0TA 2EJFA 5LJ5h 2CP7A 2DKGA 3X28B 2X4WA 4PFZA 4C0FA 3L2QA 2ROTA 1G3WA 4JRPA 4C92E 3PIOA 2DXBA 3F70A 3SWNB 3GPLA 1JQQA 2ROLA 3GIBA 3G6EA 2GQIA 1X75C 2FZKB 1VQLT 3QBYA 3CMEQ 1OULA 1S72A 1ZSZC 1RACB 4M7DB 2O2OA 3ASKA 5I2SA 5CKFA 4OVAA 2FEIA 3VS2A 2DEUA 2XKOC 2MF2A 2H3JA 4PLLA 3VS3A 3JCMf 3CCVA 2K2VA 1PG5B 3V7RA 3OY9A 4FL6A 1M2OA 1NPPA 3M59A 4XU0A 2WSEE 2YLBA 5GAOl 4OB1B 2AIRB 4R55A 4M78E 1UECA 1U06A 2O9SA 1OX9A 2BTTA 5GAOr 2RA2A 3EG2A 3G71A 4HVWA 1VQ7A 4M7DC 2P84A 1W70A 1YJNT 1RAIB 2IVWA 2JS2A 5GAN5 4J9BA 2D9TA 1Q86R 2XICA 4KH1B 5IT9E 3HPWA 2ZPFB 1MGQA 1ZX6A 1JJ2P 1MV0B 2JTFA 1B7TA 2XD0A 1SRLA 2E6ZA 1JXOA 5LJ3f 2KQWA 5CO7A 1I5LA 1LNXA 3EG9B 2BKDN 1PC0A 2O31A 4KGXB 2DTHA 1NG2A 4JUVA 3CBOA 1UJ0A 1KSWA 2QG9B 1K73R 2CZ1B 1BB9A 5KE2A 3CCMT 4PL6A 3JB9H 2V1RA 3OS5A 2YUQA 5M9OA 2KVQG 4MDXA 3MCAB 4Z02A 2KAFA 2AZSA 2YUNA 4JLIA 1GCPA 3MP8A 3OW2P 1Q7YU 1GBQA 4FYYB 1W1FA 4DBFA 4Y28E 2LRQA 1MHNA 3HFOA 2CZ0B 1KJWA 3H0FA 3GNGA 4OB3B 4B9WA 2KK4A 4M7AF 4XK8E 2I0NA 4J9FA 1ZSGA 3G71Q 2KT8A 1Q82R 4JS4A 4KBMB 1SEMA 3QJ6A 4M75A 2RHIA 4FSSA 2XK0A 4AG1C 4XTXA 3E2UA 5KE3A 2QDYB 3NTKA 1XTDA 1M2VB 2EQMA 4M78F 2F2VA 2DJQA 1NE8A 1H92A 2P4TA 1OU9A 2ECZA 3C12A 2MMPA 1HYOA 1VQOA 1I07A 1UUEA 2D0NA 2K9GA 4RTWA 5LJ3e 3A8OB 3QDRB 1VQNQ 1B07A 3JV3A 4PJMA 5FU7B 1M3CA 4RTTA 5GMKj 3THKA 4J6YA 1OI1A 3EGXA 2DXUA 1VYVA 1PD1A 1S1NA 2RI5A 3OSSC 2JN0A 3OYNA 2XG8D 1PRLC 2DBKA 1VQOQ 1KQSP 1D1CA 4X9CA 1M90C 1RAEB 1VQ5T 3QWYA 2COZA 2DIQA 1PNJA 2G6FX 1R8OB 1UHCA 1KG1A 2AT1B 4F16A 4M7AG 2RJEA 2M9UA 1C6VX 4LUEA 1WXTA 2VV5A 4PJOG 3LWHA 2F1LA 2DAQA 1Q7YR 3HSBA 5GAN3 1GRIA 2V26A 1KFZA 2JM9A 1WHJA 2P0QA 2M16A 2RF0A 3OSVA 3SB2A 1QVPA 3A1PA 2GF7A 3TU4K 3OYIA 4OMOA 3JCMe 1ZSZB 3FEOA 4IURA 5KYWA 2NUPB 1OU8A 2KR3A 4F7UF 1MUZA 4M77F 5LJ3h 4M77B 2EVRA 2G3RA 4O6JA 3HKSA 1X01A 2MCNA 3MEVA 2QDLA 4NL2A 2DL8A 3EGDB 5KH6A 3S3NA 3G6EQ 1JB0E 3S3OA 1K0SA 3BY7A 4PNOA 2L8DA 1X27A 3M56A 5KYNA 3CCRQ 4GLMA 2WACA 2EKOA 3QHSA 2LQWA 4C8QA 2RK2A 3JCMQ 2QGGA 1TTHB 4CI0C 2CP3A 1D0XA 2X3WD 1N8RC 1ZSZA 2X4XA 1B34A 2LX9A 2VKNA 1K4US 2HZYA 1Q82C 4LDVA 1UHFA 2J6OA 2DTOA 5GAOq 1Y57A 3EGUA 3I56T 3M54A 4C8QB 4DBRA 1D1AA 3O8VA 2E4HA 1FMVA 2K5IA 1M1GA 5KYWB 3NFCA 2E1HA 1UGSB 1VQ9A 4BI4A 4AMCA 4A54A 1MV3A 3CCRT 3CC4Q 2MK5A 4FSXA 2QGFB 3TSWA 5GMKi 4J6WA 1VQMA 1RLQC 3OYKA 4BDZA 3CXCA 2P4RA 3G7ZA 2C06A 2DFUA 2L3SA 4M77E 3IQLA 4JRIA 2HBWA 3PIPA 1HSQA 3SWNC 3CPWA 2FPDA 2ZPGB 3JCMd 1A0NB 1VA7A 4PJLA 1NBEB 2HEQA 5CIUA 4PJOC 1NJIC 5FWBA 4AFQC 1KD1U 1W2BP 1M8MA 3CC2A 3NMZC 1RI9A 3INZA 1Y7XA 1MNEA 2JOYA 1EX4A 3URGA 1Y96A 2GGRA 2IG0A 4F7UG 5HKCA 2Z0WA 3QSUA 3L2WA 4J9IA 4JZ4A 2MWOA 1IGQA 1UJYA 2RM4A 4P5NA 3PE0A 4MZPA 3OMGA 3CCET 2LMJA 2K4YA 4RG2A 2MYSA 1H641 4F7UB 3OYYA 2KBTA 3MEAA 3OS1A 2QEXQ 5GAMg 1QWEA 3OW2A 3UDCA 4NOYA 1JBMA 2CUBA 2DL4A 2DEQA 2E65A 1W2BS 1JU5C 2EYYA 4NL3A 4J9EA 2K3YA 2FYKA 1RAAB 2DL3A 4PJOF 4CC3A 4NS5A 2QTVA 4OMPA 2XIDA 1VQKT 1CSKA 1TUGB 4XQ3A 1OV3A 4ZGDB 1OQKA 4EMKC 2NUTA 1D3BB 3OYBA 1QKWA 2DNUA 2A08A 4DBQA 1TXQA 2B8AA 5HK0A 3FB9A 1ZUKA 1X6BA 2BUDA 1QMCA 4GLKA 4M4ZA 4FW1A 1BU1A 4M75F 1M1KU 1RAGB 5GMKl 4ZTJA 3CCEQ 2RJFA 4FYWB 1UFFA 1D1BA 1YIJQ 2O88A 5LJ5g 2DERA 1OOTA 3CCJA 4HVUA 1WHGA 2GCXA 1KHCA 2YHTA 4R0KA 5GAMe 4C8QC 1LOJA 3LGLA 1M5Q1 2P0KA 3M9QA 6AT1B 3FC3A 3CCVQ 3HHTB 1XJWB 1K8AC 1D09B 1VIEA 3KUFA 1YNZA 3GF5A 1YN8A 3C0CA 2ZAEA 3JCMg 3EFRA 4E7ZA 4IIOA 3M0TA 3JCMh 1SPKA 1PSEA 5HY6A 3LX7A 5KCOA 1WLPB 2KY9A 4OMNA 3PNWC 1WNLA 4M75E 2QYZA 3CMAT 4PLIA 4DEYA 4CC4B 2R57A 3DKMA 2EW3A 1UEBA 4PFOA 3SDZA 3R6OA 2DRKA 1WQWA 1BI3A 3EG9A 2E5QA 1OZ2A 4OB0B 2VXFA 2NUPA 2LQNA 3PVLA 3CBPA 1ZLMA 3V8LA 2BZYA 4X34A 3GBQA 2JMCA 4J9HA 2ESWA 4FCYA 1XQHA 1QW1A 3SHWA 2NUTB 3V8JA 1WXUA 4F04B 1I5OB 4V2SA 3FJPA 3CC7T 1K9MR 3FJ5A 3TCJA 4ME7A 1M90R 2GQVA 5GAMh 2J7IA 3M0RA 1LJOA 5LJ3g 2LT4A 2J6FA 1QP3A 4JPBW 1EZZB 5KYXB 1QVFA 4J6XA 1WJRA 1YWOA 1YI2A 4E7JA 1YITT 3WVDB 3VUBA 2QQBA 4E7SA 1YJNQ 3QXEB 2DXCA 4BE0A 3CD6T 4C0DB 2EIFA 2K57A 2CT3A 1OPLA 5J3BA 3JCMc 3V7SA 2FRWA 4WF2A 2E64A 3D7SB 4KH0B 1QCNA 2NWMA 4B9XA 2RJCA 1UGVA 1SSFA 3M0PA 4M75D 2JZ2A 2OTJT 2CT4A 4C0GA
chains in the Genus database with same CATH topology
4OB3B 4B9WA 3MO8A 2KK4A 4YTLA 4ELZC 4M7AF 4XK8E 4M7AA 2R58A 2LTOA 2FB7A 3RIRA 2X4JA 4M7AE 2OTJA 4M7DD 4JS4A 1UB4A 3M4GA 3EAEA 4KBMB 1YIJA 3QJ6A 4M75A 2RHIA 2XK0A 2ZPBB 4XTXA 5GAMj 3JRZA 5EG2A 1YHQA 1VQNA 1I8FA 1FX7A 5KE3A 2QDYB 3NTKA 1XTDA 3VKIA 4DOVA 2EQMA 3C95A 2RK1A 4M78F 5GAN7 3OYGA 1QVGS 1O9SA 1NE8A 3A8HB 2P4TA 4C8QD 4X9DA 1NPRA 1BI1A 2A3LA 3DLMA 4IUUA 3SD4A 1QVGA 1JJ2A 2X4YA 2XI9A 3C12A 2DXTA 3LWIA 1YCYA 1FXXA 2MMPA 4LDWA 2QQRA 4MMKA 3P8BB 5D6YA 4TVRA 1VQOA 1YIJT 2HNIA 1M1KC 2RHYA 4L5GA 3CCQT 5LJ3e 3A8OB 3QDRB 2LCLA 3JCMX 1YITA 4BI3A 4XTWA 2JVVA 1VQ5A 3SWNA 3GNFB 4QQGA 2F5TX 2V8JA 4FM4B 5FU7B 2KMTA 2EFIA 4BB7A 4F7UA 4GY5A 5GMKj 3HL8A 3H6ZA 2DIGA 4J6YA 5CKHA 1OI1A 3QJYA 2AHJB 3MHXA 2DXUA 4JRQA 5A0LA 4M7AC 1YJ9T 2RI5A 2JTMA 3ME9A 3OSSC 4M75G 4EMKB 3CCST 4HCCA 2JN0A 2K5FA 3OYNA 2CKKA 1JRIA 3QYGB 4N0AC 3J80E 2XG8D 4LDYA 4M7AB 1HXDA 1G3TA 5LJ5d 3CCSA 3AHUA 3CXCS 1K9MU 1KQ2A 4X9CA 2CGHA 2RB6A 1M90C 4LDXA 5FROA 2L89A 1VQ5T 3CC7A 1Q7YC 5GANg 2DIQA 3CBMA 4EMHA 1YJNA 2HQEA 1R8OB 3LW5E 5GMKh 2V8KA 1KG1A 4M7AG 3ER0A 5GAOn 2RJEA 2M9UA 4OGEA 4BE1A 4E7HA 3H8ZA 5FU6B 3JCMW 3RERA 3HRSA 2FL7A 4IUPA 2VV5A 3OBYA 4J5YA 4PJOG 2EJ9A 3LWHA 4A4HA 5GAMd 2DAQA 3HSBA 5LL6S 5GAN3 4M78D 5CAIA 5GANh 2ZPIB 4C5EA 4JRKA 3VV0A 4CRIA 3JB9G 2P0QA 1HK9A 3CMEA 2M16A 1YHQT 3ZEHA 1WGSA 4PJOB 4M78A 3JSCA 1Q81U 2FHDA 1N9RA 3OSVA 3SB2A 3TEEA 1QVPA 2GF7A 3A8MB 3MP6A 4E47A 3NTIA 4JS5A 3TU4K 3OYIA 5L8RE 1KC8C 4F7UE 5CQXA 3JCMe 4HT8A 3CMAA 3FEOA 1Y07A 1YBYA 3JCMV 4M7DG 4LDUA 4QQDA 3QO3A 3L42A 4VUBA 5GAOp 4MZMA 4IURA 1I81A 2PU9B 1O75A 2PQWA 4F7UF 3CCQA 4M77F 3V7CA 2MI6A 3EFSA 2EQUA 4M77A 2PUKB 2DD5A 3UT1A 5LJ3h 1VQPA 4XTYA 3PTAA 5CK9A 3CC4T 1H3ZA 4M77B 4C0DC 2G3RA 3DB3A 4O6JA 2RI2A 1N8RU 4A4GA 1N9SA 3HKSA 4RG8A 4XAXB 3P8DA 1X01A 1Y96B 1M1FA 3MEVA 5HK3A 1V29B 1Q86C 1U1TA 1WQ7A 1IREB 1U1SA 4NL2A 1VUBA 3PMIA 4OB2B 5KH6A 2XDDA 4RKUE 3S3NA 1K9MC 3CD6A 4M77D 5IN1A 1JB0E 2QQSA 2Y90A 3S3OA 4N4IA 2R5MA 3BY7A 1M90U 1VIFA 2RI3A 4PNOA 5AYFA 2DZCA 1M9SA 2A7YA 4C5IA 2L8DA 4JJNK 4J7FA 1B34B 4EPCA 3M56A 2ZPHB 2VGNA 3QKJA 5CCAA 4E7IA 2HQXA 4DQ2A 3JCMb 1YI2T 2WACA 3OYMA 1AHJB 2EKOA 3QHSA 2LCCA 2RH2A 4C8QA 3RUXA 3JAME 1WPYA 3QYHB 2RK2A 3A8GB 3MP1A 1OZ3A 1M8VA 3PMTA 3JCMQ 2GFUA 4CI0C 2DK3A 3M55A 4ZTFA 3DB4A 1S72T 3V8KA 3QZ5B 2EWNA 4PJOD 4M77C 1N8RC 3GP8A 4JLGA 4N4GA 2X4XA 4J83A 4II1A 1TH7A 4IKFA 1B34A 2MAMA 3UWNA 2LX9A 5CKEA 3QIIA 4ZN1A 3PT9A 3X26B 3OYEA 3G6ET 4IUVA 1Q82C 4LDVA 1Q81C 2PVOB 3RMSA 2I2LA 4D6WA 5D6XA 5LJ5j 2QA4T 2QXFA 5A2QE 3CCMA 2O4XB 2DTOA 5GAOq 4FU6A 4MDWA 4C92C 3VYGA 3G71T 1M4ZA 3OYHA 3I56T 2OTLA 4HCBA 1UGRB 3E19A 1D3BA 3WXMB 3M54A 4HT9A 2RHUA 1ZQ1A 3A5ZB 4C8QB 2CYZB 3TREA 3G4ST 4HCZA 3O8VA 3E1SA 3FLGA 5IAYA 3BDLA 5GMKe 3BFMA 2RD1A 3ZBDA 3SFMA 2K5IA 4A4FA 1M1GA 1BI0A 3NFCA 2E1HA 5CKBA 5CKDA 5KCHA 1UGSB 2VC8A 3OYLA 4M75C 4RCCA 5CVIA 1VQ9A 4BI4A 5LJ3j 2LQKA 3OYCA 4A54A 5GAN4 1YJWA 2XHCA 4C5GA 3GLXA 3CCRT 2FVUA 1RI0A 2DJZA 2EQKA 3LYIA 2Y4YA 2QQ9A 4FSXA 2RHZA 4O5VA 4C92G 5LJ5e 4QVZA 2VXEA 3N5BB 5GMKi 3JB9I 4J6WA 1VQMA 1G5VA 4M7DA 3OYKA 4BDZA 3CXCA 3I55A 3G7ZA 3L1AA 1X6OA 4OP0A 1KQSS 2C06A 2EAYA 3CCUA 1QVFS 4M77E 4C0ZA 4N0AA 1N27A 3C94A 3MEWA 3OS0A 3GOXA 3VUZA 2QQAA 2RHXA 3QPHA 4JRIA 3ZFJA 4M77G 1VQ7T 5GAN8 5DM7R 2QI2A 3CPWS 3L2UA 5LJ3d 4C5HA 4FIBA 1QP2A 3PIPA 1VQ8T 3VYHB 1IZ6A 3SWNC 3CPWA 4ZGEB 1PSFA 2ZPGB 3JCMd 3CCLT 2E6NA 2NLUA 3OB9A 3OYFA 4E7LA 2XU8A 5CIUA 4N4HA 1VQ4T 3A8LB 1K73U 1ZHIA 3P8HA 5GAOm 1VQ8A 3J81E 4PJOC 2QEXA 3CCJT 1NJIC 2E41A 1KD1U 2V8IA 4UC4A 4M78B 2DO3A 2JUFA 3X24B 1Q82U 3CC2A 4KUIA 1NZ9A 3INZA 1Y7XA 2YRVA 4BUGA 5FLXE 2JOYA 4BD3A 3URGA 4HKEA 2KSSA 3FRNA 1Y96A 3META 2D6FA 2IG0A 4F7UG 5HKCA 3OYJA 3CCVT 2VYTA 2X35A 3QSUA 2CS7A 3L2WA 4L6V5 2CZ6B 3RESA 3T9NA 4EMKA 2M1HA 4XTVA 4C92D 1VQMT 2MWOA 1BKBA 2RM4A 4P5NA 1BYMA 2L3RA 4RCBA 4MZPA 3OMGA 4BDYA 4IUTA 3CCET 4RG2A 2K4YA 2OAUA 1W4SA 4F7UB 1H641 3QUIA 5A0GA 3KBGA 1VQLA 2PVDB 1I4K1 2K3XA 2O4XA 3OBWA 3OYYA 3MEAA 1VQ4A 4KT0E 3OS1A 5GAMg 3OS2A 2ZGWA 5GAN6 2ZCFB 4Q5WA 3FIFA 2QTXA 2HD0A 1JBMA 4LD6A 4NOYA 3UDCA 4A4KA 3OW2A 1VQKA 1OYXA 3M4YA 2E70A 2WSFE 4MMLA 5FRMA 3CCLA 1K73C 2MWPA 2DEQA 5CQYA 2E65A 1WJQA 1W2BS 1KQSA 5FU6C 1KC8U 4NL3A 2HBPA 3I56A 2K3YA 2D0QB 2DPPB 1W2BA 2FYKA 2Y4XA 5J39A 2DTIA 2JNGA 4HA8A 4OF1A 3QZ9B 4PJOF 4PJOA 1FWZA 4NS5A 5LJ5f 3OYAA 4ZGJB 2QA4A 3QG1A 3RKWA 5GANd 3UPUA 1WJSA 3J7AF 3S6WA 2XIDA 3S3MA 4M75B 1VQKT 2XDPA 4XQ3A 3KXTA 3NTHA 1VQ6A 4QQ6A 3X25B 4XU3A 4ZGDB 3BDUA 3OYDA 4QVDA 4EMKC 3BW1A 2DD4A 5GAN2 3PFSA 4BACA 1D3BB 3OYBA 4M7AD 4M7DE 1DJ7B 1YJWT 1KD1C 3MEUA 5GAMf 4KULA 1N6AA 4BY6B 1VQ9T 2B8AA 2ZPEB 5HK0A 2P0PA 3FB9A 2BUDA 2LT1A 5GANf 3JB9D 4XU2A 2VGMA 4GLKA 1VQ6T 2EQJA 4M75F 4QW2A 1M1KU 5D6WA 4BI8B 5GMKl 3HRTA 5GANj 1NJIU 1JJ2S 4ZTJA 4XTUA 1G3YA 2F69A 2RJFA 3Q1JA 4C8QE 4RMOA 2YLCA 3CC2T 1G3SA 5I2MA 4ATOA 1UGQB 4L59A 5LJ5g 3LLRA 2QEXT 5I21A 2EJFA 2EYQA 5LJ5h 3CCJA 2DKGA 3X28B 4KUDK 2GCXA 2X4WA 4C0FA 3L2QA 4XTZA 1KHCA 2YHTA 1G3WA 5GAMe 2K5LA 4PKCC 4A4EA 4C8QC 4JRPA 4DA4A 1LOJA 3LGLA 4C92E 3PIOA 1M5Q1 2DXBA 2P0KA 3F70A 3M9QA 3SWNB 4FT2A 3HHTB 5GANe 3FC3A 3GPLA 1K8AC 1GXIE 3GIBA 4C92F 3G6EA 1VIEA 3KUFA 1X75C 3JCMJ 3GF5A 2LVMA 4M78G 4Y91A 4QVCA 1VQLT 3QBYA 3RKYA 2HAXA 1S72A 3VU3C 3CCEA 2EJGA 2F5KA 2LNVA 1VQPT 4FT4A 4M7DB 3ASKA 5I2SA 3JCMg 5CKFA 4EMGA 4OVAA 3EFRA 3JCMh 2XKOC 3OW2S 2MF2A 5J26A 1PSEA 5HY6A 3LX7A 5KCOA 3I55T 2H3JA 4PLLA 3JCMf 2KY9A 3WVEB 3PNWC 1WNLA 3CCVA 3HP9A 4M75E 1BIAA 3CMAT 4PLIA 2K2VA 1BIBA 3V7RA 3OY9A 2R57A 1XOVA 3DKMA 4FL6A 1UEBA 3M57A 4LD9K 3CCRA 3RMQA 1NPPA 4J7IA 3SDZA 3M59A 3L2ZA 3R6OA 4E7KA 2WSCE 1WQWA 1BI3A 1Y71A 2WSEE 2YLBA 2E5QA 1OZ2A 4XU0A 4OB1B 3RKXA 5GAOl 3JB9J 4OB0B 2VXFA 3CBPA 3L2VA 3CMET 3VJPA 1K8AU 4R55A 4M78E 3G4SA 5DY9A 4MZTA 3V8LA 2PUOB 4J8OA 5CR2A 4X34A 3OMCA 3OA6A 1KQ1A 1EIFA 2E10A 2O01E 4BE2A 1ZBXA 5GAOr 2RA2A 4ELYC 3G71A 3CC4A 1VQ7A 1XQHA 4M78C 1P92A 1QW1A 4M7DC 3V8JA 1BI2A 5A0DA 5DLOA 1YJNT 3CCUT 2KDSA 2RO0A 3FJPA 4V2SA 4R56A 2DVEA 5DLQE 3CC7T 3E9FA 3HRUA 3HFNA 2RJDA 4C8QG 2IVWA 3TCJA 4ME7A 2ZZDA 5GAN5 2D9TA 2XICA 4OGCA 2R5AA 4XU1A 5IT9E 3HPWA 3CEYA 4EDUA 2LQ8A 2ZPFB 1KHIA 2GQVA 3C4SA 1MGQA 5GAMh 1Q86U 4BY6C 5C6SA 2JTFA 2XD0A 1LJOA 3FDRA 5LJ3g 2CZ7B 2LT4A 1YJ9A 1QP3A 1RL2A 2E6ZA 2M0OA 1QVFA 4J6XA 2LDMA 1WJRA 5LJ3f 1XNIA 1YI2A 2VUBA 3L2RA 2KQWA 4IUQA 5CO7A 4E7JA 4JDSA 1YITT 5FU7C 3WVDB 1LNXA 4C8QF 3VUBA 2QQBA 2BKDN 1I5LA 2LC4A 3LH0A 2DTHA 5FRNA 3QXEB 2DXCA 2OTLT 2BIVA 1VQOT 4JUVA 3M5AA 3CBOA 2PVGB 4BE0A 3CD6T 2CZ1B 2EIFA 2K57A 4C0DB 2XDBA 2L5QA 4A53A 5KE2A 3CCMT 4PL6A 4ZN3A 3JB9H 3E9GA 3OS5A 4M7DF 5M9OA 1U8RA 5J3BA 2KVQG 3JCMc 2E12A 3V7SA 4MDXA 1VQNT 2GFAA 3M53A 2KAFA 3MCAB 4Z02A 2E64A 4WF2A 3DLLA 1UGPB 3OQ5A 3JCMP 4JLIA 4C92B 5GMKm 4B9XA 3MP8A 2RJCA 3X20B 1Q7YU 3PGGA 1SSFA 3M58A 4M75D 2JZ2A 3LGFA 2OTJT 4Y28E 4DOWA 4C92A 2LRQA 1MHNA 3HFOA 3JB9F 2CZ0B 2DZ9A 5C0MA 3CPFA 4PJOE 4OMFB 3GNGA 4C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 F;  3RKY A;  3EFS A;  4M77 A;  3V7C A;  4M7A F;  5LJ3 h;  3VU3 C;  2EJG A;  4XTY A;  4M7A A;  4M7D B;  4M77 B;  2FB7 A;  3JCM g;  4EMG A;  3RIR A;  3EFR A;  3JCM h;  5GAO m;  4M7A E;  4M7D D;  4PJO C;  1N9S A;  3JCM f;  2E41 A;  3M4G A;  1WNL A;  1X01 A;  4M78 B;  1Y96 B;  4M75 A;  4M75 E;  1BIA A;  1U1T A;  1WQ7 A;  3INZ A;  1BIB A;  1U1S A;  4NL2 A;  4XTX A;  3V7R A;  5GAM j;  1I8F A;  1Y96 A;  4M77 D;  4M78 F;  4F7U G;  2Y90 A;  5GAN 7;  3QSU A;  3BY7 A;  3L2Z A;  4PNO A;  4XU0 A;  1WQW A;  2DZC A;  3RES A;  2YLB A;  4X9D A;  4XTV A;  3RKX A;  4C8Q D;  4C92 D;  2RM4 A;  5GAO l;  1B34 B;  3JB9 J;  2VXF A;  4RCB A;  2DXT A;  1YCY A;  4MMK A;  4DQ2 A;  3JCM b;  4M78 E;  3QHS A;  2HNI A;  5DY9 A;  3RUX A;  3V8L A;  4C8Q A;  1H64 1;  1WPY A;  3QUI A;  4F7U B;  5LJ3 e;  1I4K 1;  3JCM X;  5GAO r;  1KQ1 A;  1M8V A;  2E10 A;  4XTW A;  3JCM Q;  5GAM g;  2RA2 A;  2ZGW A;  5GAN 6;  3SWN A;  3FIF A;  2QTX A;  4NOY A;  1JBM A;  4F7U A;  5GMK j;  4MML A;  3V8K A;  4M78 C;  2EWN A;  4J6Y A;  4M7D C;  4M77 C;  3V8J A;  4PJO D;  2DXU A;  2DEQ A;  4M7A C;  2E65 A;  1TH7 A;  4EMK B;  1B34 A;  4M75 G;  4NL3 A;  4V2S A;  2JN0 A;  3FJP A;  2DVE A;  1JRI A;  4N0A C;  2FYK A;  4M7A B;  3HFN A;  1HXD A;  2DTI A;  2I2L A;  4HA8 A;  4C8Q G;  5LJ5 d;  4PJO F;  5LJ5 j;  5LJ5 f;  3AHU A;  4PJO A;  5GAN 5;  1KQ2 A;  4X9C A;  3RKW A;  2CGH A;  2DTO A;  2RB6 A;  5GAN d;  5GAO q;  4C92 C;  4XU1 A;  4M75 B;  5GAN g;  4XQ3 A;  1MGQ A;  4EMH A;  5GAM h;  1D3B A;  4HT9 A;  5GMK h;  4XU3 A;  1LJO A;  5LJ3 g;  4M7A G;  5GAO n;  3BDU A;  4C8Q B;  4QVD A;  4EMK C;  3JCM W;  3BW1 A;  5GAN 2;  3RER A;  4J6X A;  1D3B B;  4M7A D;  5GMK e;  5LJ3 f;  3BFM A;  4M7D E;  2RD1 A;  4J5Y A;  4PJO G;  5GAM f;  4QVC A;  2EJ9 A;  1I5L A;  4C8Q F;  1LNX A;  2E1H A;  5GAM d;  3HSB A;  3FB9 A;  2VC8 A;  5GAN f;  5GAN 3;  4M75 C;  4RCC A;  2DTH A;  4M78 D;  4XU2 A;  5LJ3 j;  5CAI A;  3JB9 D;  4A54 A;  5GAN 4;  5GAN h;  4M75 F;  4JUV A;  5GMK l;  5GAN j;  4JRK A;  3JB9 G;  1HK9 A;  2DJZ A;  4XTU A;  2K57 A;  4C92 G;  5LJ5 e;  4A53 A;  4C8Q E;  2VXE A;  2YLC A;  5GMK i;  3JB9 H;  4PJO B;  4M78 A;  4J6W A;  4EMK A;  3JB9 I;  4M7D A;  4M7D F;  5LJ5 g;  1N9R A;  3SB2 A;  3L1A A;  2EJF A;  4OP0 A;  3JCM c;  3V7S A;  5I21 A;  5LJ5 h;  2DKG A;  2EAY A;  4M77 E;  4F7U F;  4N0A A;  4F7U E;  2E64 A;  4WF2 A;  4XTZ A;  3JCM e;  4HT8 A;  2YHT A;  5GAM e;  3JCM P;  4JLI A;  4C92 B;  4C8Q C;  3JCM V;  4JRI A;  5GMK m;  1LOJ A;  4C92 E;  4M77 G;  4M7D G;  1M5Q 1;  5GAN 8;  5GAN e;  3QO3 A;  3SWN B;  3PGG A;  5LJ3 d;  4M75 D;  3GIB A;  4C92 F;  5GAO p;  4C92 A;  3HFO A;  1I81 A;  3SWN C;  3JB9 F;  2DZ9 A;  3JCM J;  4PJO E;  4Y91 A;  4M78 G;  3JCM d; 
#chains in the Genus database with same CATH topology
 2OTL Q;  1PHT A;  1PM3 A;  2R58 A;  1V76 A;  2BZX A;  2CH4 A;  3RIR A;  2X4J A;  2VWF A;  3VS0 A;  2OTJ A;  1VYU A;  2DIL A;  3M4G A;  1YIJ A;  2DMO A;  2XMF A;  3JRZ A;  1YHQ A;  1I8F A;  4DOV A;  3OYG A;  2MPX C;  5FWC A;  1R0B G;  4C8Q D;  5GJW B;  1LVK A;  4X9D A;  1BI1 A;  3SD4 A;  3DLM A;  4IUU A;  1QVG A;  2X4Y A;  3LWI A;  4MMK A;  2QQR A;  4TVR A;  3CXC P;  1YIJ T;  1M1K C;  1AVZ C;  4OMQ A;  2YSQ A;  2LCL A;  4BI3 A;  4XTW A;  1I0C A;  3SWN A;  2F5T X;  2V8J A;  1G2B A;  2KMT A;  3M0Q A;  5CKH A;  2DIG A;  2RPN A;  5A0L A;  1YJ9 T;  3EH2 A;  3ME9 A;  4M75 G;  1UTI A;  3CCS T;  4HCC A;  2K5F A;  2M02 A;  1VQ8 Q;  3QYG B;  1JRI A;  3J80 E;  4LDY A;  4M7A B;  2FZC B;  1G3T A;  4HCK A;  2CGH A;  2X9H A;  4KGV B;  3CC7 A;  1Q7Y C;  1AZE A;  4WCI A;  2HQE A;  3LW5 E;  5GAO n;  4BE1 A;  5FU6 B;  3CMA Q;  1MMD A;  3HRS A;  2FL7 A;  4IUP A;  4RTX A;  1KK7 A;  2CP0 A;  3CME A;  2FG0 A;  2IIM A;  3ZEH A;  1WGS A;  1Q81 U;  1N9R A;  3TEE A;  1PCX A;  2EBP A;  4JS5 A;  1NLP C;  5CQX A;  3CMA A;  1YBY A;  4LDU A;  1YJ9 Q;  3CCS Q;  3CC7 Q;  3ZL7 C;  5GAO p;  4MZM A;  1RAD B;  4HXJ A;  2OJ2 A;  1TUC A;  3CCQ A;  2QAZ A;  2GTO A;  1H3Z A;  1VQP A;  3G1J A;  4XTY A;  5CK9 A;  3TSZ A;  1VQ5 Q;  1U3O A;  2RI2 A;  4D8D A;  5IXF A;  3P8D A;  3QWX X;  2KNB B;  1IB8 A;  1K76 A;  2ABL A;  1IRE B;  1U1S A;  1VUB A;  2W10 A;  2AKL A;  1V1C A;  1M90 U;  1VIF A;  5AYF A;  1TS9 A;  4J7F A;  3CD6 Q;  2VGN A;  5CCA A;  2HKQ B;  2HQX A;  2NYS A;  2LCC A;  2RH2 A;  2LJ1 A;  1WPY A;  1M8V A;  1WIE A;  2DK3 A;  3DB4 A;  3VS4 A;  2RQW A;  4RTV A;  2BZ8 A;  3GP8 A;  4N4G A;  1TH7 A;  3I35 A;  2KYB A;  3OYE A;  3QII A;  2PVO B;  3RMS A;  2QA4 T;  2VB6 A;  2YDL A;  4FU6 A;  4MDW A;  4C92 C;  3VYG A;  1M4Z A;  3E19 A;  3WXM B;  1HD3 A;  1ZQ1 A;  2CYZ B;  3EGX B;  3TRE A;  3G4S T;  3E1S A;  4KGZ B;  4PJN A;  1VQ7 Q;  4ZNX A;  3ZBD A;  1TG0 A;  5CKB A;  5CKD A;  2VC8 A;  3OYL A;  5CVI A;  3OYC A;  5GAN 4;  1VQM Q;  4C5G A;  3GLX A;  4J9C A;  2KI7 A;  1G5V A;  3M0U A;  3KFV A;  1X6O A;  5KYX A;  3CCU A;  4C0Z A;  1M1K R;  1N27 A;  3C94 A;  3MEW A;  1SG5 A;  2RHX A;  3QPH A;  4M77 G;  5GAN 8;  5DM7 R;  2QI2 A;  2X51 A;  4C5H A;  4FIB A;  1VQ8 T;  2LJ0 A;  1IZ6 A;  3CCL T;  1QCF A;  2NLU A;  3OB9 A;  3OYF A;  2HQH A;  1WI7 A;  3CC2 Q;  3A8L B;  2MIO A;  1ZHI A;  5GAO m;  1VQ8 A;  3J81 E;  1X6G A;  5IXB A;  2K6D A;  5IHI A;  2RMO A;  1H3H A;  2V8I A;  4M78 B;  4EIK A;  1AT1 B;  3VS6 A;  4KUI A;  1NZ9 A;  5FLX E;  4BUG A;  2HMA A;  2D6F A;  1YFN A;  2X35 A;  4L6V 5;  2DVJ A;  3T9N A;  3RES A;  1G83 A;  5IHK A;  4D8K A;  2JT4 A;  2L3R A;  1TUD A;  4BDY A;  4IIM A;  2CDT A;  2CP2 A;  3QUI A;  1E6G A;  5A0G A;  1X2Q A;  3RR6 A;  2K3X A;  2O4X A;  3OS2 A;  2ZGW A;  5GAN 6;  4A4K A;  4DA4 A;  2HD0 A;  3MKD A;  1OYX A;  2HL5 C;  4E6R A;  1CKB A;  1KIK A;  1KC8 U;  2OTJ Q;  1N5Z A;  1W2B A;  3TVT A;  2KE9 A;  4HA8 A;  3QZ9 B;  2QA4 A;  3QG1 A;  1SRM A;  5GAN d;  3UPU A;  1WJS A;  3S3M A;  1WHL A;  2HKN A;  4RUG A;  3NTH A;  4QQ6 A;  3X25 B;  1TU0 B;  3BDU A;  3MPU B;  4QVD A;  1ACM B;  2EGC A;  3PFS A;  4RTU A;  1MMG A;  1DJ7 B;  2JJ9 A;  1QVF P;  1VQ9 T;  1W6X A;  2H3E B;  2LT1 A;  5D6W A;  4FYV B;  1LPL A;  1ABO A;  1AEY A;  2YLC A;  1UGQ B;  2QEX T;  4AG2 C;  4CC7 A;  4KUD K;  2K2M A;  2O9V A;  2KEA A;  1C1A A;  2K5L A;  4PKC C;  4A4E A;  5GAN e;  4FT2 A;  1WZO A;  1GXI E;  1T0H A;  4C92 F;  1LCK A;  5KYY B;  4Y91 A;  4M78 G;  1VQP T;  2HDA A;  2F5K A;  2LNV A;  4FT4 A;  1SHG A;  4EMG A;  1T3S A;  3OW2 S;  3I55 T;  3WVE B;  1BIA A;  1BIB A;  1X43 A;  1XOV A;  4LD9 K;  3RMQ A;  3UA6 A;  4E7K A;  2WSC E;  2FO0 A;  3CME T;  4DEX A;  4MZT A;  1OPK A;  1T3L A;  4J8O A;  3OMC A;  3OA6 A;  1KQ1 A;  2O01 E;  4BE2 A;  3RNJ A;  1WFW A;  1P92 A;  4LUD A;  1BI2 A;  5A0D A;  3CCU T;  4J9D A;  2A28 A;  1X2K A;  1IRX A;  4F17 A;  1KD1 R;  2M51 A;  2K79 A;  2DRM A;  2R5A A;  3CEY A;  3C4S A;  1KHI A;  1Q86 U;  3I55 Q;  4AFZ C;  4BY6 C;  3EFO B;  3FDR A;  1YJ9 A;  2ATC B;  2M0O A;  2LDM A;  1QWF A;  3L2R A;  2JTE A;  4IUQ A;  4JDS A;  4C8Q F;  2K3B A;  2YUP A;  5FRN A;  2BIV A;  5GJV B;  1Y0M A;  1IXD A;  3EG1 A;  1TOV A;  2L5Q A;  3E9G A;  1GFC A;  4M7D F;  1D0Z A;  2AK5 A;  2GFA A;  3DLL A;  4RTY A;  2PNI A;  2H8H A;  3OQ5 A;  4C92 B;  2L3P A;  1GCQ C;  2KXD A;  3CCU Q;  3LGF A;  4C92 A;  2DZ9 A;  5C0M A;  4PJO E;  3BE3 A;  4N4H A;  3MO8 A;  4ELZ C;  4M7A A;  4Z8A A;  3U23 A;  2LTO A;  3A98 A;  2NUZ A;  4M7D D;  4PFP A;  1PKT A;  4LE9 A;  5GAM j;  1YJW Q;  1D0Y A;  2GBQ A;  1M3A A;  3C95 A;  5GAN 7;  1UDL A;  1C0M A;  1QVG S;  3A8H B;  3UAT A;  1NPR A;  2A3L A;  1JJ2 A;  5ECA A;  2DXT A;  1YCY A;  1FXX A;  4LDW A;  5L23 A;  4L5G A;  3CCQ T;  2DBM A;  1YIT A;  2JVV A;  4BB7 A;  4QQG A;  4F7U A;  4FM4 B;  2EFI A;  1HJD A;  1UE9 A;  2K7A A;  2YT6 A;  1M27 C;  3HL8 A;  4JRQ A;  3QJY A;  3MHX A;  1YIT Q;  4M7A C;  4N0A C;  2YRD A;  1HXD A;  5LJ5 d;  3RBB B;  1UG1 A;  1KQ2 A;  2MOX A;  2L89 A;  2OAW A;  5GAN g;  3CBM A;  4EMH A;  5GMK h;  2V8K A;  3ER0 A;  2M0Y A;  3H8Z A;  1JXM A;  4PJJ A;  1SF9 A;  4GBQ A;  3OBY A;  4A4H A;  2CSI A;  5CAI A;  2ZPI B;  4C5E A;  1VYT A;  5I11 A;  4JRK A;  3VV0 A;  4CRI A;  3JB9 G;  1HK9 A;  1YI2 Q;  4PJO B;  3CCQ Q;  4M78 A;  3JSC A;  1PKS A;  3I56 Q;  5D7U A;  1E7O A;  3I9Q A;  4E47 A;  3NTI A;  5L8R E;  2LX7 A;  2RN8 A;  3QO3 A;  2L3Q A;  1I81 A;  1O75 A;  1M3B A;  3EFS A;  4M77 A;  3UT1 A;  2PUK B;  2DD5 A;  3PTA A;  2QK0 A;  3DB3 A;  1N8R U;  3VRY A;  4A4G A;  1N9S A;  1Y96 B;  1M1F A;  1Q86 C;  1U1T A;  1WQ7 A;  3PMI A;  4OB2 B;  1K9M C;  1I1J A;  3CD6 A;  1QQJ A;  2Y90 A;  3MJX A;  4N4I A;  2R5M A;  2RI3 A;  2DZC A;  1M9S A;  4JJN K;  4EPC A;  2ZPH B;  2DM1 A;  4LN2 A;  1YI2 T;  2LNH B;  3RUX A;  3JAM E;  2E3I A;  2J06 A;  3EG3 A;  1OZ3 A;  1QLY A;  3PMT A;  2GFU A;  4ZTF A;  2C0O A;  1S72 T;  3V8K A;  3QZ5 B;  4PJO D;  4M77 C;  4E2F B;  4IKF A;  4J83 A;  2B86 A;  2MAM A;  3UWN A;  4ZN1 A;  5CKE A;  3PT9 A;  3G6E T;  2FRY A;  1BCM A;  1Q81 C;  2X3X D;  2DF6 A;  2I2L A;  4D6W A;  5D6X A;  5LJ5 j;  2SRC A;  2FPF A;  4RTZ A;  1UGR B;  1D3B A;  4HT9 A;  3A5Z B;  1WHM A;  4HCZ A;  3FLG A;  3BDL A;  4KRT A;  3SFM A;  4A4F A;  2DA9 A;  1BI0 A;  2LJ3 A;  2DYI A;  2LQK A;  1RAB B;  3EHR A;  2FVU A;  1RI0 A;  2E5K A;  2EQK A;  2KT1 A;  3LYI A;  2QQ9 A;  5LJ5 e;  2J6K A;  3UA7 A;  4M7D A;  2ED0 A;  3I55 A;  3L1A A;  2EAY A;  2JW4 A;  4HVV A;  1JEG A;  1WHH A;  4FW2 A;  3AT1 B;  3CPW S;  2DYB A;  2ED1 A;  3VYH B;  4DBH A;  2KRS A;  4ZGE B;  1PSF A;  4QT7 A;  4E7L A;  1H8K A;  3M0S A;  4JZ3 A;  2ENM A;  3HTR A;  3P8H A;  1K73 U;  2FZG B;  2QEX A;  4UC4 A;  2KGT A;  2JUF A;  2DET A;  2YRV A;  2EGA A;  4BD3 A;  1AD5 A;  4HKE A;  3MET A;  1FYN A;  8ATC B;  1VOM A;  3OYJ A;  4EMK A;  1VQM T;  3RDV A;  4XTV A;  3NPF A;  2QA4 Q;  4WTO B;  3R6N A;  4IUT A;  1MMA A;  1VQK Q;  2OAU A;  1W4S A;  1VQL A;  1AOJ A;  2PVD B;  1I4K 1;  3OBW A;  1VQ4 A;  5IHN A;  4KT0 E;  1CKA A;  4Q5W A;  2HSP A;  3FIF A;  4LD6 A;  3VS7 A;  3M4Y A;  4MML A;  1QCO A;  5FRM A;  1K73 C;  2MWP A;  5CQY A;  1KQS A;  1WJQ A;  5FU6 C;  1TSF A;  1X69 A;  3I56 A;  2Y4X A;  5J39 A;  3H9N A;  3CCL Q;  1M2V A;  5LJ5 f;  3UF4 A;  4ZGJ B;  4F14 A;  1GCQ A;  3RKW A;  3S6W A;  2EYX A;  2CRE A;  2OI3 A;  2CUD A;  3KXT A;  4XU3 A;  3CPW P;  1BCO A;  3QDF A;  3BW1 A;  2DD4 A;  5GAN 2;  1AZG B;  4BAC A;  4M7D E;  3REB B;  1YJW T;  3MEU A;  5GAM f;  2P0P A;  2A37 A;  2YUO A;  5GAN f;  3JB9 D;  2EQJ A;  4BI8 B;  3HRT A;  1G3Y A;  3Q1J A;  4C8Q E;  1G3S A;  2DLP A;  4ATO A;  1FMW A;  5I21 A;  2EYQ A;  2BE9 B;  4Z89 A;  4XTZ A;  2CH4 W;  2KYM A;  2AZV A;  1WHK A;  3CQT A;  1AWW A;  3JCM J;  4LXC A;  2LZ6 B;  1M30 A;  2DL7 A;  2LVM A;  4QVC A;  3RKY A;  2HAX A;  2EYZ A;  3VU3 C;  3CCE A;  2EJG A;  1MMN A;  1ZUU A;  5J26 A;  3HP9 A;  2EKH A;  2HL3 A;  3EH1 A;  1WYX A;  2KRO A;  1RAH B;  3M57 A;  2QAS A;  3CCR A;  4J7I A;  3L2Z A;  1Y71 A;  3RKX A;  1TWB A;  1ZA1 B;  1GFD A;  3JB9 J;  3L2V A;  1VQP Q;  3VJP A;  1K8A U;  3TQ7 P;  1YHQ Q;  3G4S A;  1U5S A;  2OX7 A;  5DY9 A;  3EFO A;  2CP6 A;  2PUO B;  5CR2 A;  1EIF A;  2E10 A;  1ZBX A;  4ELY C;  3CC4 A;  2KXC A;  4M78 C;  1BBZ A;  5DLO A;  1MND A;  2KDS A;  2RO0 A;  1AWJ A;  2IPO B;  2DVE A;  5DLQ E;  4R56 A;  1F1B B;  3E9F A;  3HRU A;  3HFN A;  2RJD A;  4C8Q G;  3REA B;  2ZZD A;  5HCK A;  4OGC A;  2C0I A;  1R77 A;  4XU1 A;  4EDU A;  2LQ8 A;  4J9G A;  5C6S A;  1NYG A;  2CZ7 B;  1RL2 A;  1IO6 A;  4ANJ A;  1XNI A;  2VUB A;  2A0F B;  5FU7 C;  3SEM A;  2PTK A;  2LC4 A;  3EGD A;  3LH0 A;  2COW A;  2OTL T;  2D1X A;  1VQO T;  5AT1 B;  3M5A A;  4JJC A;  2PVG B;  1ABQ A;  2XDB A;  4A53 A;  4ZN3 A;  1Q81 R;  4LNP A;  3VS5 A;  1U8R A;  2E12 A;  1VQN T;  3M53 A;  1EFN A;  5I22 A;  1UGP B;  3JCM P;  5GMK m;  3H41 A;  3X20 B;  3PGG A;  2D8J A;  3M58 A;  5KYY A;  4DOW A;  3JB9 F;  3CPF A;  4OMF B;  4OML A;  4YTL A;  2GNC A;  1BK2 A;  1NYF A;  1FMK A;  2FB7 A;  4M7A E;  3H0I A;  1UB4 A;  2CP5 A;  3EAE A;  4ESR A;  2JMA A;  2ZPB B;  5EG2 A;  1VQN A;  2F2X A;  1FX7 A;  1YWP A;  3VKI A;  2RK1 A;  1O9S A;  2BE7 D;  9ATC B;  1VQ6 Q;  4K11 A;  1WDX A;  2XI9 A;  2VAS A;  3P8B B;  5D6Y A;  2HNI A;  2RHY A;  4AFU C;  2LP5 A;  3NGP A;  3JCM X;  2COY A;  1VQ5 A;  3GNF B;  1PRM C;  1Q95 G;  4GY5 A;  3H6Z A;  2AHJ B;  4EMK B;  2JTM A;  2CKK A;  3CCS A;  3AHU A;  3CXC S;  1K9M U;  2DL5 A;  2RB6 A;  4LDX A;  2JS0 A;  5FRO A;  1QKX A;  1VQ4 Q;  1ZUY A;  1YJN A;  3VS1 A;  4E7H A;  4OGE A;  1Z9Z A;  2KRM A;  3JCM W;  3RER A;  4JJB A;  7AT1 B;  2EPD A;  1JO8 A;  4J5Y A;  1Z9Q A;  2EJ9 A;  5GAM d;  2F2W A;  1YP5 A;  5LL6 S;  4M78 D;  2D8H A;  5GAN h;  3NHN A;  1YHQ T;  1IGU A;  2A36 A;  1RUW A;  2YXY A;  2FHD A;  2HCK A;  1IHW A;  3MP6 A;  3A8M B;  1SHF A;  1KC8 C;  1K9A A;  2YRC A;  4F7U E;  4HT8 A;  1Y07 A;  3JCM V;  4M7D G;  2RQR A;  4QQD A;  5IH2 A;  3L42 A;  4VUB A;  2EYW A;  2PU9 B;  4X1V A;  3VRZ A;  2PQW A;  3PVQ A;  3V7C A;  2MI6 A;  2EQU A;  3CC4 T;  2RNA A;  2E3H A;  5EC7 A;  4C0D C;  4FYX B;  2DE0 X;  1SKU B;  4RG8 A;  1WA7 A;  4XAX B;  1OX8 A;  5HK3 A;  1V29 B;  4CC2 A;  3H0H A;  2XDD A;  4RKU E;  1B3Q A;  4M77 D;  5IN1 A;  2QQS A;  2A7Y A;  4C5I A;  3I5S A;  1B34 B;  3QKJ A;  4E7I A;  4DQ2 A;  3JCM b;  3CCM Q;  3OYM A;  1AHJ B;  1J3T A;  3QYH B;  4Z88 A;  1K1Z A;  3A8G B;  3MP1 A;  1G8X A;  3M55 A;  3G4S Q;  2EWN A;  4JLG A;  4II1 A;  3X26 B;  4IUV A;  2QXF A;  2L0A A;  8AT1 B;  5A2Q E;  2O4X B;  3CCM A;  4QKU A;  3G71 T;  1IHV A;  3OYH A;  2YWW A;  2OTL A;  4HCB A;  1AWO A;  2RHU A;  2AKK A;  2W0Z A;  1RLP C;  4JJD A;  4OMM A;  5IAY A;  5GMK e;  3BFM A;  2RD1 A;  5KCH A;  2RQU A;  1SSH A;  2JM8 A;  4M75 C;  4RCC A;  5LJ3 j;  1YJW A;  2XHC A;  1AWX A;  4O5V A;  2DJZ A;  2Y4Y A;  4C92 G;  2RHZ A;  4QVZ A;  2VXE A;  3N5B B;  3JB9 I;  1R0C B;  3O5Z A;  3EHQ A;  2CSQ A;  2RQV A;  1KQS S;  4OP0 A;  2L2P A;  1QVF S;  4N0A A;  1OEB A;  3OS0 A;  3GOX A;  3VUZ A;  2QQA A;  3ZFJ A;  4Y92 A;  1VQ7 T;  3L2U A;  5LJ3 d;  2SEM A;  1QP2 A;  2V1Q A;  1VQ9 Q;  1NJI R;  1T0J A;  2E6N A;  4AT1 B;  2XU8 A;  3I5R A;  1VQ4 T;  1PWT A;  3ULR B;  3CCJ T;  2E41 A;  1NEB A;  2DO3 A;  1ZA2 B;  3X24 B;  1S72 Q;  1Q82 U;  2J05 A;  2KRN A;  2KSS A;  3FRN A;  3LH5 A;  2LCS A;  3CCV T;  2VYT A;  2CS7 A;  5KYU B;  2CZ6 B;  2M1H A;  4C92 D;  1BKB A;  1BYM A;  4RCB A;  5KYU A;  1PD0 A;  4PK4 A;  1KC8 R;  1GL5 A;  3KBG A;  1K8A R;  2ZCF B;  1NEG A;  2QTX A;  1VQK A;  2E70 A;  2JXB A;  2WSF E;  2FPE A;  2EGE A;  2RQT A;  3CCL A;  2HBP A;  2D0Q B;  2DPP B;  2DTI A;  4OF1 A;  2JNG A;  4PJO A;  1GBR A;  1FWZ A;  2VVK A;  3OYA A;  1VQL Q;  3EG0 A;  1ARK A;  2EQI A;  3J7A F;  1WXB A;  4M75 B;  1YCS B;  2XDP A;  4ORZ A;  3CCJ Q;  1VQ6 A;  4A63 B;  1RAF B;  3OYD A;  4AFS C;  1NM7 A;  4M7A D;  1N8R R;  1KD1 C;  1ZBJ A;  4KUL A;  1N6A A;  2DX1 A;  4BY6 B;  2ZPE B;  4XU2 A;  2VGM A;  1VQ6 T;  4QW2 A;  5FW9 A;  5GAN j;  1NLO C;  1NJI U;  1JJ2 S;  4XTU A;  2F69 A;  2PZ1 A;  1E6H A;  1K0X A;  1QVG P;  1WX6 A;  4RMO A;  3CC2 T;  5I2M A;  2GTJ A;  4L59 A;  2HSE B;  4B6M A;  3LLR A;  2C0T A;  2EJF A;  5LJ5 h;  2CP7 A;  2DKG A;  3X28 B;  2X4W A;  4PFZ A;  4C0F A;  3L2Q A;  2ROT A;  1G3W A;  4JRP A;  4C92 E;  3PIO A;  2DXB A;  3F70 A;  3SWN B;  3GPL A;  1JQQ A;  2ROL A;  3GIB A;  3G6E A;  2GQI A;  1X75 C;  2FZK B;  1VQL T;  3QBY A;  3CME Q;  1OUL A;  1S72 A;  1ZSZ C;  1RAC B;  4M7D B;  2O2O A;  3ASK A;  5I2S A;  5CKF A;  4OVA A;  2FEI A;  3VS2 A;  2DEU A;  2XKO C;  2MF2 A;  2H3J A;  4PLL A;  3VS3 A;  3JCM f;  3CCV A;  2K2V A;  1PG5 B;  3V7R A;  3OY9 A;  4FL6 A;  1M2O A;  1NPP A;  3M59 A;  4XU0 A;  2WSE E;  2YLB A;  5GAO l;  4OB1 B;  2AIR B;  4R55 A;  4M78 E;  1UEC A;  1U06 A;  2O9S A;  1OX9 A;  2BTT A;  5GAO r;  2RA2 A;  3EG2 A;  3G71 A;  4HVW A;  1VQ7 A;  4M7D C;  2P84 A;  1W70 A;  1YJN T;  1RAI B;  2IVW A;  2JS2 A;  5GAN 5;  4J9B A;  2D9T A;  1Q86 R;  2XIC A;  4KH1 B;  5IT9 E;  3HPW A;  2ZPF B;  1MGQ A;  1ZX6 A;  1JJ2 P;  1MV0 B;  2JTF A;  1B7T A;  2XD0 A;  1SRL A;  2E6Z A;  1JXO A;  5LJ3 f;  2KQW A;  5CO7 A;  1I5L A;  1LNX A;  3EG9 B;  2BKD N;  1PC0 A;  2O31 A;  4KGX B;  2DTH A;  1NG2 A;  4JUV A;  3CBO A;  1UJ0 A;  1KSW A;  2QG9 B;  1K73 R;  2CZ1 B;  1BB9 A;  5KE2 A;  3CCM T;  4PL6 A;  3JB9 H;  2V1R A;  3OS5 A;  2YUQ A;  5M9O A;  2KVQ G;  4MDX A;  3MCA B;  4Z02 A;  2KAF A;  2AZS A;  2YUN A;  4JLI A;  1GCP A;  3MP8 A;  3OW2 P;  1Q7Y U;  1GBQ A;  4FYY B;  1W1F A;  4DBF A;  4Y28 E;  2LRQ A;  1MHN A;  3HFO A;  2CZ0 B;  1KJW A;  3H0F A;  3GNG A;  4OB3 B;  4B9W A;  2KK4 A;  4M7A F;  4XK8 E;  2I0N A;  4J9F A;  1ZSG A;  3G71 Q;  2KT8 A;  1Q82 R;  4JS4 A;  4KBM B;  1SEM A;  3QJ6 A;  4M75 A;  2RHI A;  4FSS A;  2XK0 A;  4AG1 C;  4XTX A;  3E2U A;  5KE3 A;  2QDY B;  3NTK A;  1XTD A;  1M2V B;  2EQM A;  4M78 F;  2F2V A;  2DJQ A;  1NE8 A;  1H92 A;  2P4T A;  1OU9 A;  2ECZ A;  3C12 A;  2MMP A;  1HYO A;  1VQO A;  1I07 A;  1UUE A;  2D0N A;  2K9G A;  4RTW A;  5LJ3 e;  3A8O B;  3QDR B;  1VQN Q;  1B07 A;  3JV3 A;  4PJM A;  5FU7 B;  1M3C A;  4RTT A;  5GMK j;  3THK A;  4J6Y A;  1OI1 A;  3EGX A;  2DXU A;  1VYV A;  1PD1 A;  1S1N A;  2RI5 A;  3OSS C;  2JN0 A;  3OYN A;  2XG8 D;  1PRL C;  2DBK A;  1VQO Q;  1KQS P;  1D1C A;  4X9C A;  1M90 C;  1RAE B;  1VQ5 T;  3QWY A;  2COZ A;  2DIQ A;  1PNJ A;  2G6F X;  1R8O B;  1UHC A;  1KG1 A;  2AT1 B;  4F16 A;  4M7A G;  2RJE A;  2M9U A;  1C6V X;  4LUE A;  1WXT A;  2VV5 A;  4PJO G;  3LWH A;  2F1L A;  2DAQ A;  1Q7Y R;  3HSB A;  5GAN 3;  1GRI A;  2V26 A;  1KFZ A;  2JM9 A;  1WHJ A;  2P0Q A;  2M16 A;  2RF0 A;  3OSV A;  3SB2 A;  1QVP A;  3A1P A;  2GF7 A;  3TU4 K;  3OYI A;  4OMO A;  3JCM e;  1ZSZ B;  3FEO A;  4IUR A;  5KYW A;  2NUP B;  1OU8 A;  2KR3 A;  4F7U F;  1MUZ A;  4M77 F;  5LJ3 h;  4M77 B;  2EVR A;  2G3R A;  4O6J A;  3HKS A;  1X01 A;  2MCN A;  3MEV A;  2QDL A;  4NL2 A;  2DL8 A;  3EGD B;  5KH6 A;  3S3N A;  3G6E Q;  1JB0 E;  3S3O A;  1K0S A;  3BY7 A;  4PNO A;  2L8D A;  1X27 A;  3M56 A;  5KYN A;  3CCR Q;  4GLM A;  2WAC A;  2EKO A;  3QHS A;  2LQW A;  4C8Q A;  2RK2 A;  3JCM Q;  2QGG A;  1TTH B;  4CI0 C;  2CP3 A;  1D0X A;  2X3W D;  1N8R C;  1ZSZ A;  2X4X A;  1B34 A;  2LX9 A;  2VKN A;  1K4U S;  2HZY A;  1Q82 C;  4LDV A;  1UHF A;  2J6O A;  2DTO A;  5GAO q;  1Y57 A;  3EGU A;  3I56 T;  3M54 A;  4C8Q B;  4DBR A;  1D1A A;  3O8V A;  2E4H A;  1FMV A;  2K5I A;  1M1G A;  5KYW B;  3NFC A;  2E1H A;  1UGS B;  1VQ9 A;  4BI4 A;  4AMC A;  4A54 A;  1MV3 A;  3CCR T;  3CC4 Q;  2MK5 A;  4FSX A;  2QGF B;  3TSW A;  5GMK i;  4J6W A;  1VQM A;  1RLQ C;  3OYK A;  4BDZ A;  3CXC A;  2P4R A;  3G7Z A;  2C06 A;  2DFU A;  2L3S A;  4M77 E;  3IQL A;  4JRI A;  2HBW A;  3PIP A;  1HSQ A;  3SWN C;  3CPW A;  2FPD A;  2ZPG B;  3JCM d;  1A0N B;  1VA7 A;  4PJL A;  1NBE B;  2HEQ A;  5CIU A;  4PJO C;  1NJI C;  5FWB A;  4AFQ C;  1KD1 U;  1W2B P;  1M8M A;  3CC2 A;  3NMZ C;  1RI9 A;  3INZ A;  1Y7X A;  1MNE A;  2JOY A;  1EX4 A;  3URG A;  1Y96 A;  2GGR A;  2IG0 A;  4F7U G;  5HKC A;  2Z0W A;  3QSU A;  3L2W A;  4J9I A;  4JZ4 A;  2MWO A;  1IGQ A;  1UJY A;  2RM4 A;  4P5N A;  3PE0 A;  4MZP A;  3OMG A;  3CCE T;  2LMJ A;  2K4Y A;  4RG2 A;  2MYS A;  1H64 1;  4F7U B;  3OYY A;  2KBT A;  3MEA A;  3OS1 A;  2QEX Q;  5GAM g;  1QWE A;  3OW2 A;  3UDC A;  4NOY A;  1JBM A;  2CUB A;  2DL4 A;  2DEQ A;  2E65 A;  1W2B S;  1JU5 C;  2EYY A;  4NL3 A;  4J9E A;  2K3Y A;  2FYK A;  1RAA B;  2DL3 A;  4PJO F;  4CC3 A;  4NS5 A;  2QTV A;  4OMP A;  2XID A;  1VQK T;  1CSK A;  1TUG B;  4XQ3 A;  1OV3 A;  4ZGD B;  1OQK A;  4EMK C;  2NUT A;  1D3B B;  3OYB A;  1QKW A;  2DNU A;  2A08 A;  4DBQ A;  1TXQ A;  2B8A A;  5HK0 A;  3FB9 A;  1ZUK A;  1X6B A;  2BUD A;  1QMC A;  4GLK A;  4M4Z A;  4FW1 A;  1BU1 A;  4M75 F;  1M1K U;  1RAG B;  5GMK l;  4ZTJ A;  3CCE Q;  2RJF A;  4FYW B;  1UFF A;  1D1B A;  1YIJ Q;  2O88 A;  5LJ5 g;  2DER A;  1OOT A;  3CCJ A;  4HVU A;  1WHG A;  2GCX A;  1KHC A;  2YHT A;  4R0K A;  5GAM e;  4C8Q C;  1LOJ A;  3LGL A;  1M5Q 1;  2P0K A;  3M9Q A;  6AT1 B;  3FC3 A;  3CCV Q;  3HHT B;  1XJW B;  1K8A C;  1D09 B;  1VIE A;  3KUF A;  1YNZ A;  3GF5 A;  1YN8 A;  3C0C A;  2ZAE A;  3JCM g;  3EFR A;  4E7Z A;  4IIO A;  3M0T A;  3JCM h;  1SPK A;  1PSE A;  5HY6 A;  3LX7 A;  5KCO A;  1WLP B;  2KY9 A;  4OMN A;  3PNW C;  1WNL A;  4M75 E;  2QYZ A;  3CMA T;  4PLI A;  4DEY A;  4CC4 B;  2R57 A;  3DKM A;  2EW3 A;  1UEB A;  4PFO A;  3SDZ A;  3R6O A;  2DRK A;  1WQW A;  1BI3 A;  3EG9 A;  2E5Q A;  1OZ2 A;  4OB0 B;  2VXF A;  2NUP A;  2LQN A;  3PVL A;  3CBP A;  1ZLM A;  3V8L A;  2BZY A;  4X34 A;  3GBQ A;  2JMC A;  4J9H A;  2ESW A;  4FCY A;  1XQH A;  1QW1 A;  3SHW A;  2NUT B;  3V8J A;  1WXU A;  4F04 B;  1I5O B;  4V2S A;  3FJP A;  3CC7 T;  1K9M R;  3FJ5 A;  3TCJ A;  4ME7 A;  1M90 R;  2GQV A;  5GAM h;  2J7I A;  3M0R A;  1LJO A;  5LJ3 g;  2LT4 A;  2J6F A;  1QP3 A;  4JPB W;  1EZZ B;  5KYX B;  1QVF A;  4J6X A;  1WJR A;  1YWO A;  1YI2 A;  4E7J A;  1YIT T;  3WVD B;  3VUB A;  2QQB A;  4E7S A;  1YJN Q;  3QXE B;  2DXC A;  4BE0 A;  3CD6 T;  4C0D B;  2EIF A;  2K57 A;  2CT3 A;  1OPL A;  5J3B A;  3JCM c;  3V7S A;  2FRW A;  4WF2 A;  2E64 A;  3D7S B;  4KH0 B;  1QCN A;  2NWM A;  4B9X A;  2RJC A;  1UGV A;  1SSF A;  3M0P A;  4M75 D;  2JZ2 A;  2OTJ T;  2CT4 A;  4C0G A; 
#chains in the Genus database with same CATH homology
 4OB3 B;  4B9W A;  3MO8 A;  2KK4 A;  4YTL A;  4ELZ C;  4M7A F;  4XK8 E;  4M7A A;  2R58 A;  2LTO A;  2FB7 A;  3RIR A;  2X4J A;  4M7A E;  2OTJ A;  4M7D D;  4JS4 A;  1UB4 A;  3M4G A;  3EAE A;  4KBM B;  1YIJ A;  3QJ6 A;  4M75 A;  2RHI A;  2XK0 A;  2ZPB B;  4XTX A;  5GAM j;  3JRZ A;  5EG2 A;  1YHQ A;  1VQN A;  1I8F A;  1FX7 A;  5KE3 A;  2QDY B;  3NTK A;  1XTD A;  3VKI A;  4DOV A;  2EQM A;  3C95 A;  2RK1 A;  4M78 F;  5GAN 7;  3OYG A;  1QVG S;  1O9S A;  1NE8 A;  3A8H B;  2P4T A;  4C8Q D;  4X9D A;  1NPR A;  1BI1 A;  2A3L A;  3DLM A;  4IUU A;  3SD4 A;  1QVG A;  1JJ2 A;  2X4Y A;  2XI9 A;  3C12 A;  2DXT A;  3LWI A;  1YCY A;  1FXX A;  2MMP A;  4LDW A;  2QQR A;  4MMK A;  3P8B B;  5D6Y A;  4TVR A;  1VQO A;  1YIJ T;  2HNI A;  1M1K C;  2RHY A;  4L5G A;  3CCQ T;  5LJ3 e;  3A8O B;  3QDR B;  2LCL A;  3JCM X;  1YIT A;  4BI3 A;  4XTW A;  2JVV A;  1VQ5 A;  3SWN A;  3GNF B;  4QQG A;  2F5T X;  2V8J A;  4FM4 B;  5FU7 B;  2KMT A;  2EFI A;  4BB7 A;  4F7U A;  4GY5 A;  5GMK j;  3HL8 A;  3H6Z A;  2DIG A;  4J6Y A;  5CKH A;  1OI1 A;  3QJY A;  2AHJ B;  3MHX A;  2DXU A;  4JRQ A;  5A0L A;  4M7A C;  1YJ9 T;  2RI5 A;  2JTM A;  3ME9 A;  3OSS C;  4M75 G;  4EMK B;  3CCS T;  4HCC A;  2JN0 A;  2K5F A;  3OYN A;  2CKK A;  1JRI A;  3QYG B;  4N0A C;  3J80 E;  2XG8 D;  4LDY A;  4M7A B;  1HXD A;  1G3T A;  5LJ5 d;  3CCS A;  3AHU A;  3CXC S;  1K9M U;  1KQ2 A;  4X9C A;  2CGH A;  2RB6 A;  1M90 C;  4LDX A;  5FRO A;  2L89 A;  1VQ5 T;  3CC7 A;  1Q7Y C;  5GAN g;  2DIQ A;  3CBM A;  4EMH A;  1YJN A;  2HQE A;  1R8O B;  3LW5 E;  5GMK h;  2V8K A;  1KG1 A;  4M7A G;  3ER0 A;  5GAO n;  2RJE A;  2M9U A;  4OGE A;  4BE1 A;  4E7H A;  3H8Z A;  5FU6 B;  3JCM W;  3RER A;  3HRS A;  2FL7 A;  4IUP A;  2VV5 A;  3OBY A;  4J5Y A;  4PJO G;  2EJ9 A;  3LWH A;  4A4H A;  5GAM d;  2DAQ A;  3HSB A;  5LL6 S;  5GAN 3;  4M78 D;  5CAI A;  5GAN h;  2ZPI B;  4C5E A;  4JRK A;  3VV0 A;  4CRI A;  3JB9 G;  2P0Q A;  1HK9 A;  3CME A;  2M16 A;  1YHQ T;  3ZEH A;  1WGS A;  4PJO B;  4M78 A;  3JSC A;  1Q81 U;  2FHD A;  1N9R A;  3OSV A;  3SB2 A;  3TEE A;  1QVP A;  2GF7 A;  3A8M B;  3MP6 A;  4E47 A;  3NTI A;  4JS5 A;  3TU4 K;  3OYI A;  5L8R E;  1KC8 C;  4F7U E;  5CQX A;  3JCM e;  4HT8 A;  3CMA A;  3FEO A;  1Y07 A;  1YBY A;  3JCM V;  4M7D G;  4LDU A;  4QQD A;  3QO3 A;  3L42 A;  4VUB A;  5GAO p;  4MZM A;  4IUR A;  1I81 A;  2PU9 B;  1O75 A;  2PQW A;  4F7U F;  3CCQ A;  4M77 F;  3V7C A;  2MI6 A;  3EFS A;  2EQU A;  4M77 A;  2PUK B;  2DD5 A;  3UT1 A;  5LJ3 h;  1VQP A;  4XTY A;  3PTA A;  5CK9 A;  3CC4 T;  1H3Z A;  4M77 B;  4C0D C;  2G3R A;  3DB3 A;  4O6J A;  2RI2 A;  1N8R U;  4A4G A;  1N9S A;  3HKS A;  4RG8 A;  4XAX B;  3P8D A;  1X01 A;  1Y96 B;  1M1F A;  3MEV A;  5HK3 A;  1V29 B;  1Q86 C;  1U1T A;  1WQ7 A;  1IRE B;  1U1S A;  4NL2 A;  1VUB A;  3PMI A;  4OB2 B;  5KH6 A;  2XDD A;  4RKU E;  3S3N A;  1K9M C;  3CD6 A;  4M77 D;  5IN1 A;  1JB0 E;  2QQS A;  2Y90 A;  3S3O A;  4N4I A;  2R5M A;  3BY7 A;  1M90 U;  1VIF A;  2RI3 A;  4PNO A;  5AYF A;  2DZC A;  1M9S A;  2A7Y A;  4C5I A;  2L8D A;  4JJN K;  4J7F A;  1B34 B;  4EPC A;  3M56 A;  2ZPH B;  2VGN A;  3QKJ A;  5CCA A;  4E7I A;  2HQX A;  4DQ2 A;  3JCM b;  1YI2 T;  2WAC A;  3OYM A;  1AHJ B;  2EKO A;  3QHS A;  2LCC A;  2RH2 A;  4C8Q A;  3RUX A;  3JAM E;  1WPY A;  3QYH B;  2RK2 A;  3A8G B;  3MP1 A;  1OZ3 A;  1M8V A;  3PMT A;  3JCM Q;  2GFU A;  4CI0 C;  2DK3 A;  3M55 A;  4ZTF A;  3DB4 A;  1S72 T;  3V8K A;  3QZ5 B;  2EWN A;  4PJO D;  4M77 C;  1N8R C;  3GP8 A;  4JLG A;  4N4G A;  2X4X A;  4J83 A;  4II1 A;  1TH7 A;  4IKF A;  1B34 A;  2MAM A;  3UWN A;  2LX9 A;  5CKE A;  3QII A;  4ZN1 A;  3PT9 A;  3X26 B;  3OYE A;  3G6E T;  4IUV A;  1Q82 C;  4LDV A;  1Q81 C;  2PVO B;  3RMS A;  2I2L A;  4D6W A;  5D6X A;  5LJ5 j;  2QA4 T;  2QXF A;  5A2Q E;  3CCM A;  2O4X B;  2DTO A;  5GAO q;  4FU6 A;  4MDW A;  4C92 C;  3VYG A;  3G71 T;  1M4Z A;  3OYH A;  3I56 T;  2OTL A;  4HCB A;  1UGR B;  3E19 A;  1D3B A;  3WXM B;  3M54 A;  4HT9 A;  2RHU A;  1ZQ1 A;  3A5Z B;  4C8Q B;  2CYZ B;  3TRE A;  3G4S T;  4HCZ A;  3O8V A;  3E1S A;  3FLG A;  5IAY A;  3BDL A;  5GMK e;  3BFM A;  2RD1 A;  3ZBD A;  3SFM A;  2K5I A;  4A4F A;  1M1G A;  1BI0 A;  3NFC A;  2E1H A;  5CKB A;  5CKD A;  5KCH A;  1UGS B;  2VC8 A;  3OYL A;  4M75 C;  4RCC A;  5CVI A;  1VQ9 A;  4BI4 A;  5LJ3 j;  2LQK A;  3OYC A;  4A54 A;  5GAN 4;  1YJW A;  2XHC A;  4C5G A;  3GLX A;  3CCR T;  2FVU A;  1RI0 A;  2DJZ A;  2EQK A;  3LYI A;  2Y4Y A;  2QQ9 A;  4FSX A;  2RHZ A;  4O5V A;  4C92 G;  5LJ5 e;  4QVZ A;  2VXE A;  3N5B B;  5GMK i;  3JB9 I;  4J6W A;  1VQM A;  1G5V A;  4M7D A;  3OYK A;  4BDZ A;  3CXC A;  3I55 A;  3G7Z A;  3L1A A;  1X6O A;  4OP0 A;  1KQS S;  2C06 A;  2EAY A;  3CCU A;  1QVF S;  4M77 E;  4C0Z A;  4N0A A;  1N27 A;  3C94 A;  3MEW A;  3OS0 A;  3GOX A;  3VUZ A;  2QQA A;  2RHX A;  3QPH A;  4JRI A;  3ZFJ A;  4M77 G;  1VQ7 T;  5GAN 8;  5DM7 R;  2QI2 A;  3CPW S;  3L2U A;  5LJ3 d;  4C5H A;  4FIB A;  1QP2 A;  3PIP A;  1VQ8 T;  3VYH B;  1IZ6 A;  3SWN C;  3CPW A;  4ZGE B;  1PSF A;  2ZPG B;  3JCM d;  3CCL T;  2E6N A;  2NLU A;  3OB9 A;  3OYF A;  4E7L A;  2XU8 A;  5CIU A;  4N4H A;  1VQ4 T;  3A8L B;  1K73 U;  1ZHI A;  3P8H A;  5GAO m;  1VQ8 A;  3J81 E;  4PJO C;  2QEX A;  3CCJ T;  1NJI C;  2E41 A;  1KD1 U;  2V8I A;  4UC4 A;  4M78 B;  2DO3 A;  2JUF A;  3X24 B;  1Q82 U;  3CC2 A;  4KUI A;  1NZ9 A;  3INZ A;  1Y7X A;  2YRV A;  4BUG A;  5FLX E;  2JOY A;  4BD3 A;  3URG A;  4HKE A;  2KSS A;  3FRN A;  1Y96 A;  3MET A;  2D6F A;  2IG0 A;  4F7U G;  5HKC A;  3OYJ A;  3CCV T;  2VYT A;  2X35 A;  3QSU A;  2CS7 A;  3L2W A;  4L6V 5;  2CZ6 B;  3RES A;  3T9N A;  4EMK A;  2M1H A;  4XTV A;  4C92 D;  1VQM T;  2MWO A;  1BKB A;  2RM4 A;  4P5N A;  1BYM A;  2L3R A;  4RCB A;  4MZP A;  3OMG A;  4BDY A;  4IUT A;  3CCE T;  4RG2 A;  2K4Y A;  2OAU A;  1W4S A;  4F7U B;  1H64 1;  3QUI A;  5A0G A;  3KBG A;  1VQL A;  2PVD B;  1I4K 1;  2K3X A;  2O4X A;  3OBW A;  3OYY A;  3MEA A;  1VQ4 A;  4KT0 E;  3OS1 A;  5GAM g;  3OS2 A;  2ZGW A;  5GAN 6;  2ZCF B;  4Q5W A;  3FIF A;  2QTX A;  2HD0 A;  1JBM A;  4LD6 A;  4NOY A;  3UDC A;  4A4K A;  3OW2 A;  1VQK A;  1OYX A;  3M4Y A;  2E70 A;  2WSF E;  4MML A;  5FRM A;  3CCL A;  1K73 C;  2MWP A;  2DEQ A;  5CQY A;  2E65 A;  1WJQ A;  1W2B S;  1KQS A;  5FU6 C;  1KC8 U;  4NL3 A;  2HBP A;  3I56 A;  2K3Y A;  2D0Q B;  2DPP B;  1W2B A;  2FYK A;  2Y4X A;  5J39 A;  2DTI A;  2JNG A;  4HA8 A;  4OF1 A;  3QZ9 B;  4PJO F;  4PJO A;  1FWZ A;  4NS5 A;  5LJ5 f;  3OYA A;  4ZGJ B;  2QA4 A;  3QG1 A;  3RKW A;  5GAN d;  3UPU A;  1WJS A;  3J7A F;  3S6W A;  2XID A;  3S3M A;  4M75 B;  1VQK T;  2XDP A;  4XQ3 A;  3KXT A;  3NTH A;  1VQ6 A;  4QQ6 A;  3X25 B;  4XU3 A;  4ZGD B;  3BDU A;  3OYD A;  4QVD A;  4EMK C;  3BW1 A;  2DD4 A;  5GAN 2;  3PFS A;  4BAC A;  1D3B B;  3OYB A;  4M7A D;  4M7D E;  1DJ7 B;  1YJW T;  1KD1 C;  3MEU A;  5GAM f;  4KUL A;  1N6A A;  4BY6 B;  1VQ9 T;  2B8A A;  2ZPE B;  5HK0 A;  2P0P A;  3FB9 A;  2BUD A;  2LT1 A;  5GAN f;  3JB9 D;  4XU2 A;  2VGM A;  4GLK A;  1VQ6 T;  2EQJ A;  4M75 F;  4QW2 A;  1M1K U;  5D6W A;  4BI8 B;  5GMK l;  3HRT A;  5GAN j;  1NJI U;  1JJ2 S;  4ZTJ A;  4XTU A;  1G3Y A;  2F69 A;  2RJF A;  3Q1J A;  4C8Q E;  4RMO A;  2YLC A;  3CC2 T;  1G3S A;  5I2M A;  4ATO A;  1UGQ B;  4L59 A;  5LJ5 g;  3LLR A;  2QEX T;  5I21 A;  2EJF A;  2EYQ A;  5LJ5 h;  3CCJ A;  2DKG A;  3X28 B;  4KUD K;  2GCX A;  2X4W A;  4C0F A;  3L2Q A;  4XTZ A;  1KHC A;  2YHT A;  1G3W A;  5GAM e;  2K5L A;  4PKC C;  4A4E A;  4C8Q C;  4JRP A;  4DA4 A;  1LOJ A;  3LGL A;  4C92 E;  3PIO A;  1M5Q 1;  2DXB A;  2P0K A;  3F70 A;  3M9Q A;  3SWN B;  4FT2 A;  3HHT B;  5GAN e;  3FC3 A;  3GPL A;  1K8A C;  1GXI E;  3GIB A;  4C92 F;  3G6E A;  1VIE A;  3KUF A;  1X75 C;  3JCM J;  3GF5 A;  2LVM A;  4M78 G;  4Y91 A;  4QVC A;  1VQL T;  3QBY A;  3RKY A;  2HAX A;  1S72 A;  3VU3 C;  3CCE A;  2EJG A;  2F5K A;  2LNV A;  1VQP T;  4FT4 A;  4M7D B;  3ASK A;  5I2S A;  3JCM g;  5CKF A;  4EMG A;  4OVA A;  3EFR A;  3JCM h;  2XKO C;  3OW2 S;  2MF2 A;  5J26 A;  1PSE A;  5HY6 A;  3LX7 A;  5KCO A;  3I55 T;  2H3J A;  4PLL A;  3JCM f;  2KY9 A;  3WVE B;  3PNW C;  1WNL A;  3CCV A;  3HP9 A;  4M75 E;  1BIA A;  3CMA T;  4PLI A;  2K2V A;  1BIB A;  3V7R A;  3OY9 A;  2R57 A;  1XOV A;  3DKM A;  4FL6 A;  1UEB A;  3M57 A;  4LD9 K;  3CCR A;  3RMQ A;  1NPP A;  4J7I A;  3SDZ A;  3M59 A;  3L2Z A;  3R6O A;  4E7K A;  2WSC E;  1WQW A;  1BI3 A;  1Y71 A;  2WSE E;  2YLB A;  2E5Q A;  1OZ2 A;  4XU0 A;  4OB1 B;  3RKX A;  5GAO l;  3JB9 J;  4OB0 B;  2VXF A;  3CBP A;  3L2V A;  3CME T;  3VJP A;  1K8A U;  4R55 A;  4M78 E;  3G4S A;  5DY9 A;  4MZT A;  3V8L A;  2PUO B;  4J8O A;  5CR2 A;  4X34 A;  3OMC A;  3OA6 A;  1KQ1 A;  1EIF A;  2E10 A;  2O01 E;  4BE2 A;  1ZBX A;  5GAO r;  2RA2 A;  4ELY C;  3G71 A;  3CC4 A;  1VQ7 A;  1XQH A;  4M78 C;  1P92 A;  1QW1 A;  4M7D C;  3V8J A;  1BI2 A;  5A0D A;  5DLO A;  1YJN T;  3CCU T;  2KDS A;  2RO0 A;  3FJP A;  4V2S A;  4R56 A;  2DVE A;  5DLQ E;  3CC7 T;  3E9F A;  3HRU A;  3HFN A;  2RJD A;  4C8Q G;  2IVW A;  3TCJ A;  4ME7 A;  2ZZD A;  5GAN 5;  2D9T A;  2XIC A;  4OGC A;  2R5A A;  4XU1 A;  5IT9 E;  3HPW A;  3CEY A;  4EDU A;  2LQ8 A;  2ZPF B;  1KHI A;  2GQV A;  3C4S A;  1MGQ A;  5GAM h;  1Q86 U;  4BY6 C;  5C6S A;  2JTF A;  2XD0 A;  1LJO A;  3FDR A;  5LJ3 g;  2CZ7 B;  2LT4 A;  1YJ9 A;  1QP3 A;  1RL2 A;  2E6Z A;  2M0O A;  1QVF A;  4J6X A;  2LDM A;  1WJR A;  5LJ3 f;  1XNI A;  1YI2 A;  2VUB A;  3L2R A;  2KQW A;  4IUQ A;  5CO7 A;  4E7J A;  4JDS A;  1YIT T;  5FU7 C;  3WVD B;  1LNX A;  4C8Q F;  3VUB A;  2QQB A;  2BKD N;  1I5L A;  2LC4 A;  3LH0 A;  2DTH A;  5FRN A;  3QXE B;  2DXC A;  2OTL T;  2BIV A;  1VQO T;  4JUV A;  3M5A A;  3CBO A;  2PVG B;  4BE0 A;  3CD6 T;  2CZ1 B;  2EIF A;  2K57 A;  4C0D B;  2XDB A;  2L5Q A;  4A53 A;  5KE2 A;  3CCM T;  4PL6 A;  4ZN3 A;  3JB9 H;  3E9G A;  3OS5 A;  4M7D F;  5M9O A;  1U8R A;  5J3B A;  2KVQ G;  3JCM c;  2E12 A;  3V7S A;  4MDX A;  1VQN T;  2GFA A;  3M53 A;  2KAF A;  3MCA B;  4Z02 A;  2E64 A;  4WF2 A;  3DLL A;  1UGP B;  3OQ5 A;  3JCM P;  4JLI A;  4C92 B;  5GMK m;  4B9X A;  3MP8 A;  2RJC A;  3X20 B;  1Q7Y U;  3PGG A;  1SSF A;  3M58 A;  4M75 D;  2JZ2 A;  3LGF A;  2OTJ T;  4Y28 E;  4DOW A;  4C92 A;  2LRQ A;  1MHN A;  3HFO A;  3JB9 F;  2CZ0 B;  2DZ9 A;  5C0M A;  3CPF A;  4PJO E;  4OMF B;  3GNG A;  4C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...