3EG1A

Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg1A00
2ED0A 2JS0A 2DF6A 1X6BA 4JPBW 1CSKA 1AVZC 4IIOA 2FG0A 4RTYA 5I22A 2GBQA 1WI7A 2YUNA 4F17A 1J3TA 1I07A 5FWCA 4LNPA 5ECAA 4AG2C 1PRMC 1W1FA 2AZVA 3VS6A 2V1QA 2AK5A 1CKBA 2MIOA 1OEBA 2L0AA 1U06A 2QDLA 3EG3A 4X1VA 2L2PA 1GFDA 5IHNA 5IHIA 2JXBA 1WXTA 1ZUKA 1G2BA 2SRCA 3M0TA 4J9FA 1T3SA 2K7AA 1MUZA 1SSHA 2M0YA 3NPFA 2JM8A 3A98A 1N5ZA 2YUOA 3NHNA 1AZEA 3M0QA 1HSQA 1JEGA 2XMFA 2DJQA 4FSSA 2KR3A 3EHQA 4IIMA 4JJBA 3TSZA 1UG1A 1T3LA 1WFWA 2CDTA 2LJ3A 1NEBA 3ZL7C 1NYFA 1VYVA 4AG1C 2KRSA 2PTKA 2SEMA 1JU5C 2IIMA 4RTTA 2GQIA 2KBTA 3R6NA 1CKAA 1TUDA 2DL8A 3VS3A 2F2VA 2CREA 2DILA 2HBWA 1GCQC 2DE0X 2O9VA 1TUCA 2ENMA 2M51A 4A63B 1K0SA 1VYUA 3VS1A 1AWWA 2DX1A 1K4US 4OMOA 2I0NA 1WYXA 2RF0A 4HVVA 2YDLA 4D8DA 2DYBA 1AWOA 1RLPC 1SRLA 4J9IA 2RQRA 3H41A 1M8MA 1Y0MA 1QCFA 3UA7A 2AZSA 3U23A 2DRKA 1E6GA 2KEAA 3I9QA 4EIKA 1X27A 1K9AA 2KT8A 1UE9A 2J7IA 2HSPA 2C0IA 5IHKA 1UGVA 4HVWA 2JMAA 2FPFA 4AFQC 3TSWA 1ZUYA 4JZ3A 2LX7A 1UHCA 2BZXA 2NUZA 1Z9ZA 4LN2A 4RTUA 3I35A 4J9BA 2A08A 3REBB 4RTXA 4K11A 2W10A 1ABOA 2RMOA 3UA6A 2LNHB 1OPLA 1UECA 1QWEA 2DM1A 2O31A 2CH4A 3M0PA 1GBQA 4GBQA 1M3BA 3VS2A 2FO0A 1M27C 2LCSA 2AKKA 3PVQA 2EVRA 5IH2A 1G83A 2PZ1A 2HDAA 2K3BA 1BBZA 2A36A 1JXOA 2BZYA 2RQTA 2CSIA 2OAWA 1ARKA 2YSQA 4HVUA 4HXJA 4M4ZA 2LJ0A 3EHRA 2K2MA 1QWFA 2PNIA 1T0HA 3M0UA 1UTIA 1W70A 1X69A 4D8KA 1AZGB 1AWXA 1FYNA 1UJYA 2LJ1A 1PKSA 4OMLA 2O9SA 1K76A 2L3PA 1FMKA 3O5ZA 4J9HA 2EBPA 2JT4A 1KJWA 2BTTA 4E6RA 5GJWB 1XOVA 1ABQA 2JTEA 2JMCA 1PRLC 3C0CA 4QT7A 2ABLA 2YT6A 2EPDA 2KROA 3PVLA 1UHFA 4JJCA 1E6HA 2EKHA 5GJVB 2ROLA 4ESRA 3VS5A 2KRNA 1E7OA 2K6DA 2LZ6B 1YN8A 3CQTA 2DL4A 1YWOA 2RQWA 2DLPA 1GCQA 2VVKA 3I5RA 4ZNXA 5IXFA 1H3HA 3EG2A 2D0NA 2KT1A 1ZSGA 2GTJA 3VS0A 1BK2A 4J9CA 4RTVA 2KXCA 3VS7A 1GRIA 2JW4A 1WIEA 2JM9A 4AFUC 1S1NA 5HCKA 1RI9A 1ZX6A 1HD3A 1AD5A 4J9EA 2ECZA 2CT4A 2OI3A 2O2OA 2EW3A 2P4RA 1VA7A 2EYZA 3QWXX 4J9DA 2VKNA 1YWPA 3SEMA 1WLPB 1A0NB 4ORZA 2EYYA 1X2KA 1OOTA 1KIKA 1K1ZA 2OJ2A 4JZ4A 2RQUA 1Z9QA 2EGCA 4JJDA 4OMPA 2O88A 2EGEA 2G6FX 2L3SA 1M3CA 2LMJA 2MOXA 1JQQA 4KRTA 1WA7A 4OMQA 3IQLA 2B86A 3EG1A 1VYTA 2FRYA 1Y57A 2V1RA 4HCKA 4CC2A 1KFZA 3I5SA 4Z89A 2DBMA 1X2QA 1SEMA 2YUQA 3H0FA 1B07A 1BB9A 2CH4W 3NGPA 1K0XA 2FPDA 2ROTA 2D1XA 5IXBA 4RTWA 1SHFA 4J9GA 1WXUA 1T0JA 1WX6A 3VS4A 1LCKA 4F16A 1SRMA 1UDLA 2LP5A 1NEGA 4RTZA 1RUWA 3VRZA 2HEQA 2MCNA 3EG0A 1QKWA 4CC4B 3NMZC 2KYMA 2C0TA 1W6XA 2GNCA 1ZLMA 2L3QA 1UJ0A 2D8HA 5L23A 2CT3A 1PKTA 1PHTA 2BZ8A 2F2WA 4LUDA 2J6FA 1EFNA 3FJ5A 1BU1A 2RN8A 1AWJA 2A37A 2X3WD 2DA9A 2J05A 3RNJA 2LQWA 2GTOA 1AOJA 1H8KA 3PE0A 1U5SA 2EGAA 2DL5A 1IO6A 2YUPA 1NYGA 4OMMA 3KFVA 1I0CA 3H0HA 4WCIA 3UF4A 2CSQA 2X3XD 2GGRA 1WDXA 1NM7A 2NWMA 2W0ZA 1H92A 1RLQC 1V1CA 2RNAA 1NLPC 2ESWA 1SHGA 1M30A 2EYWA 1PWTA 2A28A 2J06A 2FPEA 3JV3A 1MV0B 2KYBA 1MV3A 2KRMA 2K79A 1OPKA 2FEIA 1NG2A 1I1JA 2E5KA 2DRMA 1HJDA 2KE9A 2DBKA 3M0SA 3ULRB 3H0IA 4LE9A 1TG0A 4CC3A 2VWFA 3GBQA 5FW9A 1JO8A 4Z88A 3THKA 2DL7A 2D8JA 1QKXA 1M3AA 1GBRA 1NLOC 4OMNA 2RPNA 2FRWA 4F14A 1YP5A 2DL3A 4LUEA 4R0KA 1PNJA 3REAB 3RBBB 4GLMA 2HCKA 2H8HA 1QLYA 1YNZA 1WXBA 2KGTA 1SPKA 2AKLA 2JS2A 4DEYA 1UUEA 1OV3A 2CUDA 4RUGA 1ZBJA 4AFZC 3LH5A 3UATA 1AEYA 2F2XA 1ZUUA 2LQNA 1UFFA 1YCSB 2DMOA 3QWYA 1B3QA 4Z8AA 3VRYA 2C0OA 5EC7A 5I11A 2J6KA 3M0RA 1GCPA 1JXMA 1GFCA 4Y92A 2EQIA 2DNUA 1U3OA 2CUBA 2KNBB 3SHWA 3TVTA 4DEXA 4AFSC 2K9GA 2RQVA 1X6GA 3EGUA 2EYXA 2DVJA 1GL5A 5FWBA 1X43A 2ED1A 2KXDA 1KSWA 4CC7A 2J6OA
chains in the Genus database with same CATH superfamily
4KT0E 2JS0A 2DF6A 4FM4B 4OVAA 1AT1B 5KYUA 3FEOA 1CSKA 3P8BB 1WI7A 2MYSA 3CC7A 1VQ7Q 4F17A 2CYZB 1VQ4T 5ECAA 4E7JA 4XK8E 1UB4A 2KI7A 1PRMC 1W1FA 2AZVA 4VUBA 2QQ9A 3OMCA 1CKBA 1OEBA 2L0AA 3GIBA 1R77A 2L2PA 5IHNA 1WXTA 4XQ3A 5IN1A 3M0TA 4A54A 5GAN5 1VQPA 2V26A 1SSHA 2JM8A 1N5ZA 2FL7A 2XMFA 2ZPHB 3QO3A 4M77B 5D7UA 3CD6T 4JLGA 4PFZA 4IIMA 1YJ9T 3TSZA 1UG1A 1QVGA 1WFWA 1QVGP 2DTHA 1U8RA 3CCUQ 2LJ3A 1NEBA 3ZL7C 1NYFA 1VYVA 2XDBA 4ZTFA 1VQMA 2FZCB 2ZPIB 4RTTA 4N0AC 3QYGB 2XDDA 2H3JA 1CKAA 4RCCA 2DL8A 2CREA 3CMAT 4DQ2A 2OTJT 3CCJT 4DA4A 4R56A 1Q86R 3M54A 3X28B 3OYFA 4TVRA 1AWWA 2DX1A 1QCOA 2DD4A 2YDLA 3T9NA 2JTMA 1FXXA 5HK3A 2DIGA 2DD5A 3BW1A 4QVCA 1SSFA 2LTOA 4PNOA 3C94A 3UA7A 1KC8C 4PJOC 1ZHIA 3N5BB 1E6GA 2KEAA 4EIKA 2LT1A 1K9AA 2KT8A 4A4FA 2C0IA 3MEAA 5IHKA 4HVWA 2JMAA 3CCQA 2FPFA 4AFQC 1ZUYA 5GMKe 5CKFA 3CC4A 2MK5A 1Z9ZA 4LN2A 2MMPA 5GAMd 1FMWA 2A08A 4GLKA 4RTXA 1BYMA 2A3LA 4C92D 2JUFA 3V8KA 5FRMA 4XAXB 5KE2A 2R5AA 4M7AC 4Y28E 1KD1U 2O31A 3KXTA 3RDVA 2E6NA 1GBQA 1M3BA 4C92F 1YCYA 1RACB 1M27C 4XTUA 4C5GA 3EGXB 5IH2A 2QA4Q 2WSCE 2K3BA 2A36A 1JXOA 3I55T 1ARKA 2YSQA 3A8GB 1IGUA 3FB9A 4M4ZA 4J6YA 5GANg 3CCST 4A53A 4JRPA 2IG0A 1PSEA 1X69A 2ZGWA 1OI1A 2O01E 3TQ7P 1UJYA 1SG5A 3C95A 4E7HA 1WGSA 3OSVA 3MCAB 2NUTA 3EH2A 2O9SA 2BUDA 2X4WA 3A8HB 1YIJA 3G1JA 3RESA 5DLQE 1NJIC 2JMCA 4L6V5 3C0CA 1OX8A 4C8QD 2ABLA 2EPDA 2P0KA 2HQXA 3PVLA 5LJ3f 2QEXT 3X26B 4C8QF 3I56T 1M1KC 1IXDA 3L1AA 5J39A 3RIRA 1NE8A 2DL4A 1IZ6A 1YWOA 3OYMA 3JB9D 1M90C 1IREB 2KMTA 5A2QE 2GTJA 4XTXA 1TS9A 1BK2A 4J9CA 2LVMA 3OW2S 4C92B 1K9MC 3JB9F 1D3BA 1R8OB 2KXCA 1VQ7A 1GRIA 4AFUC 2JM9A 3WVEB 5CKHA 3LX7A 1HD3A 3M9QA 3SDZA 1KHCA 3KBGA 3P8HA 2KK4A 1IHVA 2O2OA 2EYZA 1WHJA 2FYKA 1Y07A 2P0QA 2RI3A 3UDCA 4DBFA 2R57A 4KGVB 2P84A 1KQ2A 1TH7A 3CCVT 1OOTA 2HKQB 4RMOA 2D9TA 2O88A 2LMJA 3META 2MOXA 1JQQA 5GAMj 3CMEQ 4KRTA 4OMQA 6AT1B 1LOJA 5AT1B 5EG2A 3EG1A 3GNGA 3G71Q 1VYTA 1VQ9Q 1QQJA 2V1RA 2XKOC 1X2QA 1SEMA 3H0FA 1YHQQ 3E9FA 3CC7T 5A0DA 1BB9A 3HTRA 4RTWA 4C8QB 1LCKA 3EH1A 1SRMA 4ZTJA 2E70A 2LP5A 1PM3A 4X9DA 2EQMA 3VRZA 1B7TA 3EG0A 2KYMA 1X6OA 2C0TA 5GAOl 2GNCA 1VQPT 2L3QA 4MDWA 1UJ0A 5GAN3 4FCYA 2DFUA 2HKNA 2ZPEB 4M7DA 1OULA 1IRXA 1QMCA 4DBRA 1WQ7A 1KQSS 1EFNA 3FJ5A 1BU1A 2X3WD 2A37A 2DA9A 3R6OA 3RNJA 1Q95G 4II1A 3QZ5B 2KQWA 1M1FA 4N4IA 4OMMA 2DPPB 1HYOA 4M7DG 2X3XD 3E1SA 2GGRA 3OS0A 1YITT 1V1CA 3RKWA 3MP6A 2KAFA 1BI0A 2DXBA 5IAYA 4M78F 5GAMe 5CKEA 4B9XA 4M78E 4FYWB 3OYNA 1C1AA 2RJEA 2MF2A 4JRIA 2KRMA 2DAQA 2KE9A 1VQ6A 3QUIA 3PIOA 1HJDA 3CCQT 2DBKA 3O8VA 4OGEA 3X25B 4ZGJB 1KC8U 1K73C 2YRCA 3WXMB 4B9WA 5KCOA 2D8JA 1M3AA 3OW2A 2CZ6B 4OMNA 3JRZA 4Y91A 3OW2P 4LUEA 3E2UA 2EJFA 2OX7A 3RBBB 2HCKA 3AT1B 2H8HA 2QG9B 4HCCA 1BI2A 4A4EA 4QQ6A 1YNZA 2AKLA 1UUEA 3G4SA 5GANd 3VKIA 3EFSA 1D1CA 1R0BG 2HMAA 4AFZC 3DKMA 5LJ3h 4E7ZA 2F2XA 1I81A 4PJLA 1UEBA 5M9OA 3SD4A 4M77A 1YCSB 1B3QA 4CRIA 4M7DE 3M0RA 1JXMA 5GAMg 5GAN8 5KE3A 4EMKB 2DNUA 4A4HA 1GXIE 1YBYA 1YFNA 2KNBB 3ME9A 3S3OA 2RQVA 3X20B 1YI2A 1Q82U 3Q1JA 2DVJA 1X43A 3OSSC 4M77G 4BI4A 1ZQ1A 2ED0A 3RMQA 3KUFA 1ZSZC 1AVZC 4LDWA 1RAFB 2NUPB 3OMGA 2YUNA 3FIFA 2CZ1B 1NJIU 1QVFS 5FWCA 4LNPA 2E1HA 2H3EB 1U06A 3E9GA 3V8LA 4M75D 2RM4A 5IHIA 1ZUKA 4JJNK 2F69A 4QVDA 3G71A 2K7AA 3CC4Q 3CC2T 2I2LA 3M0QA 1HSQA 2WSEE 2X51A 4M75F 3EHQA 4NS5A 1KQSP 1YHQA 4M75E 2F5KA 2PU9B 1M90U 1T3LA 5GAN7 1I5OB 2VXFA 1BIAA 4AG1C 2KY9A 2SEMA 1JU5C 2IIMA 1WHLA 2DYIA 4BDYA 4MZPA 3R6NA 1VUBA 3VS3A 2DILA 3EGXA 5HY6A 2DE0X 1WNLA 2LQKA 3C12A 2LC4A 2PQWA 1OZ2A 4A4GA 2HNIA 4OMOA 2RD1A 2DTIA 4OB3B 4HVVA 5LJ5f 3J80E 1AWOA 3M57A 4HKEA 1JB0E 2RA2A 3QDRB 3CCUT 1Q7YU 1SRLA 2BKDN 4J9IA 3H41A 1Y0MA 3BE3A 4OB1B 4M77E 1X27A 3BDUA 4LD6A 2HSPA 5AYFA 3HHTB 5J26A 3TSWA 5C0MA 2DK3A 1YIJQ 5FU6B 2LX7A 1UHCA 1YJWQ 2RHXA 3QZ9B 2GCXA 2NUZA 4PFOA 4EMGA 2VXEA 3I35A 5GAN2 2Z0WA 2M9UA 1M2VB 1ABOA 1BI1A 2RMOA 1TU0B 3QPHA 2CP0A 1UECA 1XTDA 4FW1A 3JCMf 2VV5A 3VV0A 4GBQA 2AKKA 3WVDB 2CZ0B 1RAHB 3L2VA 1G83A 4JLIA 4XU3A 5CAIA 2PZ1A 3VU3C 2LCLA 4M75B 5LJ3j 4LD9K 2LJ0A 2E10A 2HD0A 3EHRA 1QWFA 2XIDA 4EPCA 3JCMc 1VQ8A 3M0UA 4D8KA 4C92A 2P4TA 1BCOA 3QDFA 2Y4YA 1QCNA 4N4GA 2BE9B 2CGHA 1NZ9A 2PVGB 2QA4T 1K76A 3O5ZA 4J9HA 2ZPGB 4M7DC 2JT4A 3VUZA 2JNGA 5C6SA 5FLXE 1XOVA 3L2RA 1DJ7B 2JTEA 4C92G 1PRLC 4AT1B 2YRVA 4QT7A 5HKCA 2KROA 4RKUE 2CP5A 4JJCA 1QVFP 4WTOB 5GJVB 3ZEHA 3PTAA 1OQKA 4QW2A 3X24B 2KRNA 3QJ6A 3SWNC 4JRQA 2QQAA 4F7UB 3H8ZA 4RG2A 2O4XB 4FW2A 1MNDA 3HFNA 5GANe 3CBPA 4ANJA 1GCQA 4ZNXA 3I5RA 5IXFA 1H3HA 2CP6A 3EG2A 1XQHA 1KC8R 1K73U 3VS0A 4BY6C 4C0ZA 3QSUA 1TUGB 4JRKA 1N8RR 1WIEA 3NTKA 2CP7A 4DOWA 4C8QA 1RI9A 1MGQA 4OB2B 2CT4A 2ZPFB 4IUPA 1H3ZA 3S6WA 2EW3A 4E7SA 2P4RA 1VA7A 2K4YA 2COWA 1N9SA 4BE2A 2GFUA 1K8AC 1YJNQ 2E64A 3SEMA 1WLPB 4C8QG 4BUGA 2EYYA 3TREA 4GY5A 1UGSB 1Q86C 1K1ZA 4OMPA 4JZ4A 2G6FX 2L3SA 3L42A 1HXDA 1M3CA 3UPUA 3OBYA 4X34A 3MEWA 5CQXA 5KYYB 2YLBA 4RCBA 2B86A 3MKDA 2VGMA 4C92E 3JB9G 2CP2A 1Y57A 2VB6A 4Z89A 2YUQA 2A7YA 2MAMA 3P8DA 1B07A 2G3RA 4M77C 1G3SA 3RKXA 1WHKA 1K0XA 1SHFA 3GNFB 3VS4A 1NPRA 3M58A 1NEGA 2RJFA 4R55A 3HL8A 1VQ6Q 3CMET 3NMZC 1Q82C 5A0LA 5LJ3g 3G71T 1VQ9T 3QXEB 5KYXB 5LJ5h 4BB7A 1ACMB 4XTYA 5L23A 1PKTA 2E4HA 1YJWA 3JSCA 2RH2A 3GPLA 3H9NA 4MMLA 1M1KR 5GAOm 1AWJA 2JN0A 2J05A 2GTOA 2IPOB 1SKUB 1PD0A 1NYGA 2X35A 1AHJB 3G4SQ 3CCEA 1OX9A 4FU6A 2OTJQ 2FHDA 4C8QE 1VQKT 1K9MR 1RLQC 1JBMA 1NLPC 2ESWA 1VQOQ 3VUBA 2EYWA 2QGGA 2RHZA 4V2SA 1PWTA 3CCMQ 3JCMh 3INZA 2XDPA 3JV3A 4ELZC 1MV3A 1OYXA 2GFAA 3EG9B 2JOYA 2DRMA 3LWIA 5CKDA 1F1BB 1RI0A 3M0SA 1D1BA 4EMKA 3JCMP 3J81E 1I8FA 3ULRB 4IKFA 1WHHA 3H0IA 1YI2Q 4C0GA 2L5QA 4LE9A 5L8RE 3OYEA 3GBQA 4M78A 4Z88A 2DL7A 1QKXA 2E41A 3CCLA 2JZ2A 3OYDA 2OTLQ 1Q7YC 1NLOC 1VQNA 2QI2A 2RPNA 1VQ5Q 2FRWA 3CCRQ 1S72T 2DL3A 2NUPA 2Y4XA 3BFMA 4ATOA 3OYBA 4PL6A 1QLYA 3DB3A 3HP9A 5KYNA 2JS2A 4M78G 1OV3A 2XU8A 2CUDA 4RUGA 4C0DC 3LH5A 2CS7A 1KQ1A 2JVVA 5FROA 3MHXA 2E65A 3EFOB 2F1LA 2VGNA 3JB9J 3OQ5A 4Z8AA 3VRYA 3QKJA 1B34B 1UGRB 5EC7A 8AT1B 5CQYA 4FIBA 2XD0A 5IT9E 3UWNA 4DOVA 1WJQA 4AFSC 2KSSA 5KYWA 1X6GA 2DEQA 5FWBA 3A8LB 2J6OA 4JPBW 3CBOA 1M5Q1 1C6VX 2FG0A 3E19A 7AT1B 1YJNA 2AT1B 2DIQA 2HBPA 3TCJA 1Y71A 2OAUA 4J83A 4DBQA 4AG2C 5I2SA 1VQMT 1VIEA 3VS6A 4UC4A 1ZA2B 2AK5A 2V1QA 3JB9H 3L2WA 2NYSA 2M0OA 3MEVA 5LJ5j 2YLCA 1G2BA 4J9FA 1T3SA 4X9CA 1LPLA 1TSFA 1MUZA 3M56A 2M0YA 3NPFA 2QAZA 3A98A 2YUOA 1AZEA 5I21A 2WSFE 4HT8A 1JEGA 2KR3A 2BE7D 3TU4K 2RI5A 1VIFA 2M16A 2MI6A 2CDTA 2K2VA 5FU7B 1Y96A 1VQ4A 5CO7A 2KRSA 2RK2A 3MP8A 2GQIA 3HRUA 2KBTA 4PLIA 1M9SA 2F2VA 1PSFA 4E2FB 2HBWA 1GCQC 2GF7A 3CC4T 4M75A 2CP3A 1VYUA 1ZSZB 5KCHA 1Q81C 2RF0A 3CD6A 3NTHA 4N4HA 4D8DA 1YJ9A 1VQ8Q 4KGZB 4C8QC 1K8AU 3JCMW 2R58A 1M8MA 1QCFA 4C5HA 2DRKA 2QTXA 1Q86U 3MO8A 3URGA 2QXFA 2J7IA 4M75G 1H641 4F04B 1KD1R 1OU9A 3CCJA 2OTJA 2BZXA 1ZA1B 4PFPA 4ZN1A 3GOXA 2NLUA 3OB9A 1VQOA 4C5EA 5GAOn 3UA6A 4XTWA 3CCMA 1QW1A 1HK9A 2LNHB 1KG1A 4BDZA 3L2ZA 5LJ5e 4NOYA 2QQBA 3GP8A 5LJ3d 1OPLA 2DM1A 1EX4A 1TWBA 3M0PA 3VS2A 2Y90A 2LCSA 3EFRA 3V8JA 3OYKA 4KULA 3OA6A 2EVRA 3PGGA 3A8MB 2HDAA 1BBZA 4EMHA 1NPPA 1QP2A 1YIJT 3G6EQ 2BZYA 1YJWT 2O4XA 3PMTA 2LX9A 3RERA 2HQEA 2HSEB 1C0MA 4Q5WA 5CVIA 2JTFA 1FMVA 4XU0A 1G3WA 3OYIA 2OTLA 2EWNA 5GMKh 1W70A 1VQ5A 3CCRA 1AZGB 1AWXA 4IUUA 2K5IA 2FZKB 1PKSA 1SF9A 4OMLA 1P92A 1FMKA 3A5ZB 2YWWA 2EBPA 3I55A 3HKSA 5GAMf 5GJWB 2RJCA 3V7SA 2ATCB 2LDMA 2XHCA 2M02A 1KQSA 1MMGA 3OS1A 1UHFA 2HAXA 1VQ7T 3LWHA 4PJOD 1D09B 2ROLA 4ESRA 3H6ZA 3S3MA 3QHSA 5LJ5g 1BKBA 1D1AA 1E7OA 2QYZA 3M53A 5KYYA 3S3NA 2VASA 4PJOF 5DM7R 3JCMX 5J3BA 4KGXB 3HSBA 2VVKA 2DERA 2X4JA 1ZSGA 4M7AD 3DLMA 3QYHB 3G7ZA 2YXYA 3FDRA 3MPUB 2JW4A 3VYGA 1WJSA 4JUVA 5CIUA 5HCKA 3DB4A 4M7AF 3ZFJA 3FLGA 2ECZA 1WQWA 2COYA 3DLLA 3PIPA 4FL6A 4ELYC 3FRNA 3JCMg 4M78C 2DZ9A 5KYXA 3AHUA 3FJPA 4J9DA 2VKNA 1YWPA 1WZOA 1A0NB 1IGQA 4F7UF 4LDUA 4ZGDB 4ORZA 1PG5B 1X2KA 4F7UE 2OJ2A 2RQUA 3M5AA 1RAGB 4PK4A 2CZ7B 5D6XA 3SWNB 3CCEQ 1N6AA 2FRYA 3M4YA 2K57A 2X4XA 4HCKA 3A1PA 2DBMA 1OZ3A 1YJNT 2CKKA 4BY6B 1N9RA 3NGPA 4JDSA 2FPDA 5GAN6 2ROTA 3CCVA 2D1XA 1WXUA 1T0JA 1WX6A 1W2BS 1OU8A 4LXCA 2XI9A 5GAOp 2E12A 2KDSA 1RUWA 4PJOB 2HEQA 2FZGB 2MCNA 1IB8A 2HL5C 3JCMQ 1QKWA 3PNWC 4CC4B 4PJJA 3D7SB 1RAAB 1ZLMA 4MZTA 2CT3A 2YHTA 1LJOA 4EDUA 2BZ8A 2F2WA 2VYTA 4LUDA 3CCLQ 4KH1B 5GMKj 5CCAA 1VQNQ 3OY9A 4PJMA 4M7AB 1AOJA 1QVFA 3PE0A 4ME7A 1U5SA 2DL5A 1IO6A 2YUPA 1VQ6T 4WCIA 3H0HA 3UF4A 1X01A 1VQLQ 1JRIA 2X9HA 4PLLA 1NM7A 1V76A 2VUBA 3PT9A 5FU6C 3TEEA 2RNAA 4BI3A 1SHGA 1WPYA 3G6EA 1M30A 2D6FA 2HZYA 4KH0B 2A28A 4OMFB 2FVUA 2MWPA 4LDXA 2FPEA 1EZZB 3EFOA 1O75A 3L2UA 1Q81U 1B34A 1OPKA 2EQUA 1G8XA 1I1JA 2E5KA 5LJ3e 1K8AR 4A4KA 4D6WA 2E6ZA 1BI3A 3G4ST 4OB0B 3CPFA 4M75C 1YITA 2RI2A 1D0XA 2VWFA 2JJ9A 3HFOA 5FW9A 3ASKA 1JO8A 1VQOT 2DXUA 3OYLA 2RHYA 3CCMT 3CXCS 1U1TA 2K3YA 4IUTA 4RG8A 4F14A 1YP5A 2MPXC 1G3TA 4BD3A 2KVQG 4KUIA 5GAMh 2KGTA 1N8RC 2K5FA 2V8JA 2QTVA 1LNXA 3M59A 1YI2T 5GAOq 3SB2A 2DVEA 1ZBJA 2DXCA 3VJPA 4MZMA 1UFFA 2OTLT 2DMOA 3MP1A 3ER0A 3QWYA 3C4SA 3CCRT 1Q82R 1VQ5T 5GMKl 5I11A 2J6KA 1M4ZA 4MMKA 3JB9I 1VQ4Q 3M55A 3CBMA 2EQIA 2A0FB 4DEXA 2RK1A 1NJIR 2K9GA 2QK0A 4P5NA 3EGUA 4HCBA 4JS4A 2KXDA 1UGVA 1KSWA 3OS5A 2PVOB 5A0GA 2GQVA 1X6BA 1ZSZA 4IIOA 4RTYA 3CD6Q 1YJ9Q 5I22A 1YHQT 2GBQA 3OYGA 5LJ5d 4E7KA 1W2BA 1KHIA 1FX7A 4J8OA 1I07A 1W2BP 1J3TA 3OBWA 2L3RA 3LYIA 1M2OA 3M4GA 2D0QB 4IUQA 4PJNA 2MIOA 2E3IA 1M90R 2QDLA 1BIBA 2PUKB 3EG3A 4X1VA 5GANf 1GFDA 2VC8A 2JXBA 3SFMA 3CMAQ 1RL2A 2SRCA 4C0DB 1MMNA 1PCXA 3CCJQ 2LQ8A 3NHNA 4FSXA 1RAEB 1WHMA 2DJQA 4FSSA 2EQKA 3EGDB 1O9SA 2LNVA 4JJBA 4HA8A 4J5YA 3NTIA 2F5TX 4O6JA 4XU2A 2PTKA 4J6XA 2LCCA 3JCMd 1TUDA 1Q7YR 2EYQA 2O9VA 4FYVB 1TUCA 2DEUA 2ENMA 2M51A 4A63B 3CC2A 4C0FA 1XNIA 2EJGA 5KYUB 1K0SA 3VS1A 1N27A 5GMKi 1K4US 1PC0A 2I0NA 1WYXA 2L8DA 3ZBDA 2DYBA 1RLPC 5GAOr 3RUXA 4CI0C 2RQRA 2AZSA 3U23A 3CPWS 3RR6A 3I9QA 2DZCA 1UE9A 1D0ZA 2X4YA 1VQLA 2XICA 3QIIA 1M1GA 4OGCA 4OP0A 2WACA 4JZ3A 3OYCA 3I55Q 2E3HA 5I2MA 1RAIB 1W4SA 2EAYA 4RTUA 4J9BA 3CXCA 3REBB 4K11A 3CXCP 3CCSQ 4LDVA 2W10A 4BE0A 1VQ8T 4WF2A 3CCUA 2ZZDA 3L2QA 5DY9A 1QWEA 2CH4A 2FO0A 4FT4A 3PVQA 2HL3A 2RQTA 2CSIA 2OAWA 1VOMA 4HVUA 1MNEA 4HXJA 2XG8D 2QDYB 2EJ9A 2K2MA 1TXQA 2PNIA 1T0HA 4ZN3A 1UTIA 3QBYA 4FT2A 4C92C 3BY7A 2QEXQ 2EQJA 2QASA 2XK0A 3OYHA 3LGLA 1FYNA 2LJ1A 4L59A 3I56Q 1VQKQ 4AMCA 1RADB 3LLRA 2L3PA 2EKOA 2MWOA 3G6ET 1KJWA 2BTTA 2B8AA 4E6RA 2RHUA 4BI8B 1ABQA 3GF5A 2PVDB 2P0PA 2QQSA 3LGFA 4NL3A 3PFSA 3OYJA 2YT6A 3RMSA 4OF1A 1I4K1 4J7FA 1M8VA 1M2VA 1WJRA 1E6HA 4J7IA 2EKHA 3OS2A 1K73R 3VS5A 1G3YA 1Q81R 4M78D 4HCZA 4N0AA 3SWNA 2K6DA 3V7CA 2LZ6B 5HK0A 2QA4A 4BE1A 2RO0A 1YN8A 3CQTA 4O5VA 2RQWA 3UT1A 2RHIA 4QKUA 2DLPA 1G5VA 2DO3A 3GLXA 4LDYA 2K5LA 2D0NA 2KT1A 4E7LA 2PUOB 5GAN4 1S72Q 1TOVA 3CCVQ 4RTVA 3QJYA 3VS7A 3J7AF 3HPWA 3JCMV 1S1NA 2R5MA 4E47A 3JCMb 4QQDA 5KH6A 1ZX6A 2NUTB 1AD5A 4J9EA 4PJOA 1BCMA 5CK9A 2OI3A 5LL6S 3CEYA 2DXTA 3JCMJ 3CMAA 1RABB 3QWXX 1N8RU 4Z02A 4QVZA 3CC7Q 1PD1A 1KIKA 1Z9QA 2EGCA 4JJDA 2LT4A 4PJOG 5GANh 4M7AA 2EGEA 2HQHA 2V8IA 3JAME 3CPWA 4IUVA 3CPWP 5D6YA 4HT9A 2ZPBB 1WA7A 1JJ2S 3IQLA 3V7RA 1FWZA 4M7DD 2QGFB 1MMAA 2C06A 1VQPQ 3MEUA 4CC2A 2DETA 1KFZA 3I5SA 2K3XA 4F7UA 3FC3A 4M7AG 3OYYA 1KD1C 2CH4W 3MJXA 4M7DF 1D3BB 3VYHB 2E5QA 5IXBA 4J9GA 3QG1A 3PMIA 4F16A 1VQMQ 1UDLA 5FU7C 4RTZA 4PKCC 3BDLA 4E7IA 3EAEA 1R0CB 2L89A 1U1SA 2LRQA 1I5LA 4XTZA 3JCMe 1UGPB 4F7UG 3CCET 2YRDA 4M78B 1W6XA 1Y7XA 2D8HA 1YITQ 4ZGEB 1PHTA 2DJZA 2EIFA 2IVWA 2J6FA 4KBMB 2RN8A 3CCSA 1UGQB 2LQWA 1QVGS 1H8KA 3F70A 2M1HA 2EGAA 5FRNA 4KUDK 3KFVA 1I0CA 3CMEA 2RB6A 3CCQQ 2CSQA 3HRSA 4QQGA 1VQ9A 1WDXA 4BACA 2NWMA 1TTHB 1M1KU 2W0ZA 1H92A 3A8OB 4JS5A 4PJOE 2V8KA 4J6WA 1NBEB 2QQRA 3CCLT 2J06A 1VQNT 2BIVA 1QP3A 1MV0B 2KYBA 5D6WA 2K79A 1K9MU 2FEIA 1NG2A 1XJWB 4IURA 2QEXA 4C5IA 1X75C 5KYWB 1VQLT 2DKGA 4EMKC 2EFIA 3I56A 4M7AE 8ATCB 1VQKA 9ATCB 4M7DB 1TG0A 1WHGA 4CC3A 4M77D 3THKA 1MMDA 4FYYB 3LW5E 1QVPA 1D0YA 3HRTA 1GBRA 5CR2A 4R0KA 1PNJA 4XTVA 3REAB 4M77F 1MHNA 4GLMA 2COZA 2ZAEA 3RKYA 1WXBA 1ZBXA 1SPKA 2AIRB 2ZCFB 4NL2A 4DEYA 2RJDA 1LVKA 2AHJB 1EIFA 4L5GA 2FB7A 3UATA 4DBHA 1AEYA 1ZUUA 4YTLA 2LQNA 4MDXA 1Y96B 5GANj 3EGDA 5DLOA 2DTOA 1S72A 2C0OA 4B6MA 4XU1A 1GCPA 1GFCA 3LH0A 4Y92A 1V29B 1JJ2A 5CKBA 1U3OA 2CUBA 1JJ2P 3SHWA 3TVTA 3EG9A 3OYAA 1KK7A 3NFCA 5GMKm 2EYXA 1GL5A 1IHWA 3CC2Q 2ED1A 4FYXB 4CC7A
chains in the Genus database with same CATH topology
2ED0A 2JS0A 2DF6A 1X6BA 4JPBW 1CSKA 1AVZC 4IIOA 2FG0A 4RTYA 5I22A 2GBQA 1WI7A 2YUNA 4F17A 1J3TA 1I07A 5FWCA 4LNPA 5ECAA 4AG2C 1PRMC 1W1FA 2AZVA 3VS6A 2V1QA 2AK5A 1CKBA 2MIOA 1OEBA 2L0AA 1U06A 2QDLA 3EG3A 4X1VA 2L2PA 1GFDA 5IHNA 5IHIA 2JXBA 1WXTA 1ZUKA 1G2BA 2SRCA 3M0TA 4J9FA 1T3SA 2K7AA 1MUZA 1SSHA 2M0YA 3NPFA 2JM8A 3A98A 1N5ZA 2YUOA 3NHNA 1AZEA 3M0QA 1HSQA 1JEGA 2XMFA 2DJQA 4FSSA 2KR3A 3EHQA 4IIMA 4JJBA 3TSZA 1UG1A 1T3LA 1WFWA 2CDTA 2LJ3A 1NEBA 3ZL7C 1NYFA 1VYVA 4AG1C 2KRSA 2PTKA 2SEMA 1JU5C 2IIMA 4RTTA 2GQIA 2KBTA 3R6NA 1CKAA 1TUDA 2DL8A 3VS3A 2F2VA 2CREA 2DILA 2HBWA 1GCQC 2DE0X 2O9VA 1TUCA 2ENMA 2M51A 4A63B 1K0SA 1VYUA 3VS1A 1AWWA 2DX1A 1K4US 4OMOA 2I0NA 1WYXA 2RF0A 4HVVA 2YDLA 4D8DA 2DYBA 1AWOA 1RLPC 1SRLA 4J9IA 2RQRA 3H41A 1M8MA 1Y0MA 1QCFA 3UA7A 2AZSA 3U23A 2DRKA 1E6GA 2KEAA 3I9QA 4EIKA 1X27A 1K9AA 2KT8A 1UE9A 2J7IA 2HSPA 2C0IA 5IHKA 1UGVA 4HVWA 2JMAA 2FPFA 4AFQC 3TSWA 1ZUYA 4JZ3A 2LX7A 1UHCA 2BZXA 2NUZA 1Z9ZA 4LN2A 4RTUA 3I35A 4J9BA 2A08A 3REBB 4RTXA 4K11A 2W10A 1ABOA 2RMOA 3UA6A 2LNHB 1OPLA 1UECA 1QWEA 2DM1A 2O31A 2CH4A 3M0PA 1GBQA 4GBQA 1M3BA 3VS2A 2FO0A 1M27C 2LCSA 2AKKA 3PVQA 2EVRA 5IH2A 1G83A 2PZ1A 2HDAA 2K3BA 1BBZA 2A36A 1JXOA 2BZYA 2RQTA 2CSIA 2OAWA 1ARKA 2YSQA 4HVUA 4HXJA 4M4ZA 2LJ0A 3EHRA 2K2MA 1QWFA 2PNIA 1T0HA 3M0UA 1UTIA 1W70A 1X69A 4D8KA 1AZGB 1AWXA 1FYNA 1UJYA 2LJ1A 1PKSA 4OMLA 2O9SA 1K76A 2L3PA 1FMKA 3O5ZA 4J9HA 2EBPA 2JT4A 1KJWA 2BTTA 4E6RA 5GJWB 1XOVA 1ABQA 2JTEA 2JMCA 1PRLC 3C0CA 4QT7A 2ABLA 2YT6A 2EPDA 2KROA 3PVLA 1UHFA 4JJCA 1E6HA 2EKHA 5GJVB 2ROLA 4ESRA 3VS5A 2KRNA 1E7OA 2K6DA 2LZ6B 1YN8A 3CQTA 2DL4A 1YWOA 2RQWA 2DLPA 1GCQA 2VVKA 3I5RA 4ZNXA 5IXFA 1H3HA 3EG2A 2D0NA 2KT1A 1ZSGA 2GTJA 3VS0A 1BK2A 4J9CA 4RTVA 2KXCA 3VS7A 1GRIA 2JW4A 1WIEA 2JM9A 4AFUC 1S1NA 5HCKA 1RI9A 1ZX6A 1HD3A 1AD5A 4J9EA 2ECZA 2CT4A 2OI3A 2O2OA 2EW3A 2P4RA 1VA7A 2EYZA 3QWXX 4J9DA 2VKNA 1YWPA 3SEMA 1WLPB 1A0NB 4ORZA 2EYYA 1X2KA 1OOTA 1KIKA 1K1ZA 2OJ2A 4JZ4A 2RQUA 1Z9QA 2EGCA 4JJDA 4OMPA 2O88A 2EGEA 2G6FX 2L3SA 1M3CA 2LMJA 2MOXA 1JQQA 4KRTA 1WA7A 4OMQA 3IQLA 2B86A 3EG1A 1VYTA 2FRYA 1Y57A 2V1RA 4HCKA 4CC2A 1KFZA 3I5SA 4Z89A 2DBMA 1X2QA 1SEMA 2YUQA 3H0FA 1B07A 1BB9A 2CH4W 3NGPA 1K0XA 2FPDA 2ROTA 2D1XA 5IXBA 4RTWA 1SHFA 4J9GA 1WXUA 1T0JA 1WX6A 3VS4A 1LCKA 4F16A 1SRMA 1UDLA 2LP5A 1NEGA 4RTZA 1RUWA 3VRZA 2HEQA 2MCNA 3EG0A 1QKWA 4CC4B 3NMZC 2KYMA 2C0TA 1W6XA 2GNCA 1ZLMA 2L3QA 1UJ0A 2D8HA 5L23A 2CT3A 1PKTA 1PHTA 2BZ8A 2F2WA 4LUDA 2J6FA 1EFNA 3FJ5A 1BU1A 2RN8A 1AWJA 2A37A 2X3WD 2DA9A 2J05A 3RNJA 2LQWA 2GTOA 1AOJA 1H8KA 3PE0A 1U5SA 2EGAA 2DL5A 1IO6A 2YUPA 1NYGA 4OMMA 3KFVA 1I0CA 3H0HA 4WCIA 3UF4A 2CSQA 2X3XD 2GGRA 1WDXA 1NM7A 2NWMA 2W0ZA 1H92A 1RLQC 1V1CA 2RNAA 1NLPC 2ESWA 1SHGA 1M30A 2EYWA 1PWTA 2A28A 2J06A 2FPEA 3JV3A 1MV0B 2KYBA 1MV3A 2KRMA 2K79A 1OPKA 2FEIA 1NG2A 1I1JA 2E5KA 2DRMA 1HJDA 2KE9A 2DBKA 3M0SA 3ULRB 3H0IA 4LE9A 1TG0A 4CC3A 2VWFA 3GBQA 5FW9A 1JO8A 4Z88A 3THKA 2DL7A 2D8JA 1QKXA 1M3AA 1GBRA 1NLOC 4OMNA 2RPNA 2FRWA 4F14A 1YP5A 2DL3A 4LUEA 4R0KA 1PNJA 3REAB 3RBBB 4GLMA 2HCKA 2H8HA 1QLYA 1YNZA 1WXBA 2KGTA 1SPKA 2AKLA 2JS2A 4DEYA 1UUEA 1OV3A 2CUDA 4RUGA 1ZBJA 4AFZC 3LH5A 3UATA 1AEYA 2F2XA 1ZUUA 2LQNA 1UFFA 1YCSB 2DMOA 3QWYA 1B3QA 4Z8AA 3VRYA 2C0OA 5EC7A 5I11A 2J6KA 3M0RA 1GCPA 1JXMA 1GFCA 4Y92A 2EQIA 2DNUA 1U3OA 2CUBA 2KNBB 3SHWA 3TVTA 4DEXA 4AFSC 2K9GA 2RQVA 1X6GA 3EGUA 2EYXA 2DVJA 1GL5A 5FWBA 1X43A 2ED1A 2KXDA 1KSWA 4CC7A 2J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ED0 A;  2JS0 A;  2DF6 A;  1X6B A;  4JPB W;  1CSK A;  1AVZ C;  4IIO A;  2FG0 A;  4RTY A;  5I22 A;  2GBQ A;  1WI7 A;  2YUN A;  4F17 A;  1J3T A;  1I07 A;  5FWC A;  4LNP A;  5ECA A;  4AG2 C;  1PRM C;  1W1F A;  2AZV A;  3VS6 A;  2V1Q A;  2AK5 A;  1CKB A;  2MIO A;  1OEB A;  2L0A A;  1U06 A;  2QDL A;  3EG3 A;  4X1V A;  2L2P A;  1GFD A;  5IHN A;  5IHI A;  2JXB A;  1WXT A;  1ZUK A;  1G2B A;  2SRC A;  3M0T A;  4J9F A;  1T3S A;  2K7A A;  1MUZ A;  1SSH A;  2M0Y A;  3NPF A;  2JM8 A;  3A98 A;  1N5Z A;  2YUO A;  3NHN A;  1AZE A;  3M0Q A;  1HSQ A;  1JEG A;  2XMF A;  2DJQ A;  4FSS A;  2KR3 A;  3EHQ A;  4IIM A;  4JJB A;  3TSZ A;  1UG1 A;  1T3L A;  1WFW A;  2CDT A;  2LJ3 A;  1NEB A;  3ZL7 C;  1NYF A;  1VYV A;  4AG1 C;  2KRS A;  2PTK A;  2SEM A;  1JU5 C;  2IIM A;  4RTT A;  2GQI A;  2KBT A;  3R6N A;  1CKA A;  1TUD A;  2DL8 A;  3VS3 A;  2F2V A;  2CRE A;  2DIL A;  2HBW A;  1GCQ C;  2DE0 X;  2O9V A;  1TUC A;  2ENM A;  2M51 A;  4A63 B;  1K0S A;  1VYU A;  3VS1 A;  1AWW A;  2DX1 A;  1K4U S;  4OMO A;  2I0N A;  1WYX A;  2RF0 A;  4HVV A;  2YDL A;  4D8D A;  2DYB A;  1AWO A;  1RLP C;  1SRL A;  4J9I A;  2RQR A;  3H41 A;  1M8M A;  1Y0M A;  1QCF A;  3UA7 A;  2AZS A;  3U23 A;  2DRK A;  1E6G A;  2KEA A;  3I9Q A;  4EIK A;  1X27 A;  1K9A A;  2KT8 A;  1UE9 A;  2J7I A;  2HSP A;  2C0I A;  5IHK A;  1UGV A;  4HVW A;  2JMA A;  2FPF A;  4AFQ C;  3TSW A;  1ZUY A;  4JZ3 A;  2LX7 A;  1UHC A;  2BZX A;  2NUZ A;  1Z9Z A;  4LN2 A;  4RTU A;  3I35 A;  4J9B A;  2A08 A;  3REB B;  4RTX A;  4K11 A;  2W10 A;  1ABO A;  2RMO A;  3UA6 A;  2LNH B;  1OPL A;  1UEC A;  1QWE A;  2DM1 A;  2O31 A;  2CH4 A;  3M0P A;  1GBQ A;  4GBQ A;  1M3B A;  3VS2 A;  2FO0 A;  1M27 C;  2LCS A;  2AKK A;  3PVQ A;  2EVR A;  5IH2 A;  1G83 A;  2PZ1 A;  2HDA A;  2K3B A;  1BBZ A;  2A36 A;  1JXO A;  2BZY A;  2RQT A;  2CSI A;  2OAW A;  1ARK A;  2YSQ A;  4HVU A;  4HXJ A;  4M4Z A;  2LJ0 A;  3EHR A;  2K2M A;  1QWF A;  2PNI A;  1T0H A;  3M0U A;  1UTI A;  1W70 A;  1X69 A;  4D8K A;  1AZG B;  1AWX A;  1FYN A;  1UJY A;  2LJ1 A;  1PKS A;  4OML A;  2O9S A;  1K76 A;  2L3P A;  1FMK A;  3O5Z A;  4J9H A;  2EBP A;  2JT4 A;  1KJW A;  2BTT A;  4E6R A;  5GJW B;  1XOV A;  1ABQ A;  2JTE A;  2JMC A;  1PRL C;  3C0C A;  4QT7 A;  2ABL A;  2YT6 A;  2EPD A;  2KRO A;  3PVL A;  1UHF A;  4JJC A;  1E6H A;  2EKH A;  5GJV B;  2ROL A;  4ESR A;  3VS5 A;  2KRN A;  1E7O A;  2K6D A;  2LZ6 B;  1YN8 A;  3CQT A;  2DL4 A;  1YWO A;  2RQW A;  2DLP A;  1GCQ A;  2VVK A;  3I5R A;  4ZNX A;  5IXF A;  1H3H A;  3EG2 A;  2D0N A;  2KT1 A;  1ZSG A;  2GTJ A;  3VS0 A;  1BK2 A;  4J9C A;  4RTV A;  2KXC A;  3VS7 A;  1GRI A;  2JW4 A;  1WIE A;  2JM9 A;  4AFU C;  1S1N A;  5HCK A;  1RI9 A;  1ZX6 A;  1HD3 A;  1AD5 A;  4J9E A;  2ECZ A;  2CT4 A;  2OI3 A;  2O2O A;  2EW3 A;  2P4R A;  1VA7 A;  2EYZ A;  3QWX X;  4J9D A;  2VKN A;  1YWP A;  3SEM A;  1WLP B;  1A0N B;  4ORZ A;  2EYY A;  1X2K A;  1OOT A;  1KIK A;  1K1Z A;  2OJ2 A;  4JZ4 A;  2RQU A;  1Z9Q A;  2EGC A;  4JJD A;  4OMP A;  2O88 A;  2EGE A;  2G6F X;  2L3S A;  1M3C A;  2LMJ A;  2MOX A;  1JQQ A;  4KRT A;  1WA7 A;  4OMQ A;  3IQL A;  2B86 A;  3EG1 A;  1VYT A;  2FRY A;  1Y57 A;  2V1R A;  4HCK A;  4CC2 A;  1KFZ A;  3I5S A;  4Z89 A;  2DBM A;  1X2Q A;  1SEM A;  2YUQ A;  3H0F A;  1B07 A;  1BB9 A;  2CH4 W;  3NGP A;  1K0X A;  2FPD A;  2ROT A;  2D1X A;  5IXB A;  4RTW A;  1SHF A;  4J9G A;  1WXU A;  1T0J A;  1WX6 A;  3VS4 A;  1LCK A;  4F16 A;  1SRM A;  1UDL A;  2LP5 A;  1NEG A;  4RTZ A;  1RUW A;  3VRZ A;  2HEQ A;  2MCN A;  3EG0 A;  1QKW A;  4CC4 B;  3NMZ C;  2KYM A;  2C0T A;  1W6X A;  2GNC A;  1ZLM A;  2L3Q A;  1UJ0 A;  2D8H A;  5L23 A;  2CT3 A;  1PKT A;  1PHT A;  2BZ8 A;  2F2W A;  4LUD A;  2J6F A;  1EFN A;  3FJ5 A;  1BU1 A;  2RN8 A;  1AWJ A;  2A37 A;  2X3W D;  2DA9 A;  2J05 A;  3RNJ A;  2LQW A;  2GTO A;  1AOJ A;  1H8K A;  3PE0 A;  1U5S A;  2EGA A;  2DL5 A;  1IO6 A;  2YUP A;  1NYG A;  4OMM A;  3KFV A;  1I0C A;  3H0H A;  4WCI A;  3UF4 A;  2CSQ A;  2X3X D;  2GGR A;  1WDX A;  1NM7 A;  2NWM A;  2W0Z A;  1H92 A;  1RLQ C;  1V1C A;  2RNA A;  1NLP C;  2ESW A;  1SHG A;  1M30 A;  2EYW A;  1PWT A;  2A28 A;  2J06 A;  2FPE A;  3JV3 A;  1MV0 B;  2KYB A;  1MV3 A;  2KRM A;  2K79 A;  1OPK A;  2FEI A;  1NG2 A;  1I1J A;  2E5K A;  2DRM A;  1HJD A;  2KE9 A;  2DBK A;  3M0S A;  3ULR B;  3H0I A;  4LE9 A;  1TG0 A;  4CC3 A;  2VWF A;  3GBQ A;  5FW9 A;  1JO8 A;  4Z88 A;  3THK A;  2DL7 A;  2D8J A;  1QKX A;  1M3A A;  1GBR A;  1NLO C;  4OMN A;  2RPN A;  2FRW A;  4F14 A;  1YP5 A;  2DL3 A;  4LUE A;  4R0K A;  1PNJ A;  3REA B;  3RBB B;  4GLM A;  2HCK A;  2H8H A;  1QLY A;  1YNZ A;  1WXB A;  2KGT A;  1SPK A;  2AKL A;  2JS2 A;  4DEY A;  1UUE A;  1OV3 A;  2CUD A;  4RUG A;  1ZBJ A;  4AFZ C;  3LH5 A;  3UAT A;  1AEY A;  2F2X A;  1ZUU A;  2LQN A;  1UFF A;  1YCS B;  2DMO A;  3QWY A;  1B3Q A;  4Z8A A;  3VRY A;  2C0O A;  5EC7 A;  5I11 A;  2J6K A;  3M0R A;  1GCP A;  1JXM A;  1GFC A;  4Y92 A;  2EQI A;  2DNU A;  1U3O A;  2CUB A;  2KNB B;  3SHW A;  3TVT A;  4DEX A;  4AFS C;  2K9G A;  2RQV A;  1X6G A;  3EGU A;  2EYX A;  2DVJ A;  1GL5 A;  5FWB A;  1X43 A;  2ED1 A;  2KXD A;  1KSW A;  4CC7 A;  2J6O A; 
#chains in the Genus database with same CATH topology
 4KT0 E;  2JS0 A;  2DF6 A;  4FM4 B;  4OVA A;  1AT1 B;  5KYU A;  3FEO A;  1CSK A;  3P8B B;  1WI7 A;  2MYS A;  3CC7 A;  1VQ7 Q;  4F17 A;  2CYZ B;  1VQ4 T;  5ECA A;  4E7J A;  4XK8 E;  1UB4 A;  2KI7 A;  1PRM C;  1W1F A;  2AZV A;  4VUB A;  2QQ9 A;  3OMC A;  1CKB A;  1OEB A;  2L0A A;  3GIB A;  1R77 A;  2L2P A;  5IHN A;  1WXT A;  4XQ3 A;  5IN1 A;  3M0T A;  4A54 A;  5GAN 5;  1VQP A;  2V26 A;  1SSH A;  2JM8 A;  1N5Z A;  2FL7 A;  2XMF A;  2ZPH B;  3QO3 A;  4M77 B;  5D7U A;  3CD6 T;  4JLG A;  4PFZ A;  4IIM A;  1YJ9 T;  3TSZ A;  1UG1 A;  1QVG A;  1WFW A;  1QVG P;  2DTH A;  1U8R A;  3CCU Q;  2LJ3 A;  1NEB A;  3ZL7 C;  1NYF A;  1VYV A;  2XDB A;  4ZTF A;  1VQM A;  2FZC B;  2ZPI B;  4RTT A;  4N0A C;  3QYG B;  2XDD A;  2H3J A;  1CKA A;  4RCC A;  2DL8 A;  2CRE A;  3CMA T;  4DQ2 A;  2OTJ T;  3CCJ T;  4DA4 A;  4R56 A;  1Q86 R;  3M54 A;  3X28 B;  3OYF A;  4TVR A;  1AWW A;  2DX1 A;  1QCO A;  2DD4 A;  2YDL A;  3T9N A;  2JTM A;  1FXX A;  5HK3 A;  2DIG A;  2DD5 A;  3BW1 A;  4QVC A;  1SSF A;  2LTO A;  4PNO A;  3C94 A;  3UA7 A;  1KC8 C;  4PJO C;  1ZHI A;  3N5B B;  1E6G A;  2KEA A;  4EIK A;  2LT1 A;  1K9A A;  2KT8 A;  4A4F A;  2C0I A;  3MEA A;  5IHK A;  4HVW A;  2JMA A;  3CCQ A;  2FPF A;  4AFQ C;  1ZUY A;  5GMK e;  5CKF A;  3CC4 A;  2MK5 A;  1Z9Z A;  4LN2 A;  2MMP A;  5GAM d;  1FMW A;  2A08 A;  4GLK A;  4RTX A;  1BYM A;  2A3L A;  4C92 D;  2JUF A;  3V8K A;  5FRM A;  4XAX B;  5KE2 A;  2R5A A;  4M7A C;  4Y28 E;  1KD1 U;  2O31 A;  3KXT A;  3RDV A;  2E6N A;  1GBQ A;  1M3B A;  4C92 F;  1YCY A;  1RAC B;  1M27 C;  4XTU A;  4C5G A;  3EGX B;  5IH2 A;  2QA4 Q;  2WSC E;  2K3B A;  2A36 A;  1JXO A;  3I55 T;  1ARK A;  2YSQ A;  3A8G B;  1IGU A;  3FB9 A;  4M4Z A;  4J6Y A;  5GAN g;  3CCS T;  4A53 A;  4JRP A;  2IG0 A;  1PSE A;  1X69 A;  2ZGW A;  1OI1 A;  2O01 E;  3TQ7 P;  1UJY A;  1SG5 A;  3C95 A;  4E7H A;  1WGS A;  3OSV A;  3MCA B;  2NUT A;  3EH2 A;  2O9S A;  2BUD A;  2X4W A;  3A8H B;  1YIJ A;  3G1J A;  3RES A;  5DLQ E;  1NJI C;  2JMC A;  4L6V 5;  3C0C A;  1OX8 A;  4C8Q D;  2ABL A;  2EPD A;  2P0K A;  2HQX A;  3PVL A;  5LJ3 f;  2QEX T;  3X26 B;  4C8Q F;  3I56 T;  1M1K C;  1IXD A;  3L1A A;  5J39 A;  3RIR A;  1NE8 A;  2DL4 A;  1IZ6 A;  1YWO A;  3OYM A;  3JB9 D;  1M90 C;  1IRE B;  2KMT A;  5A2Q E;  2GTJ A;  4XTX A;  1TS9 A;  1BK2 A;  4J9C A;  2LVM A;  3OW2 S;  4C92 B;  1K9M C;  3JB9 F;  1D3B A;  1R8O B;  2KXC A;  1VQ7 A;  1GRI A;  4AFU C;  2JM9 A;  3WVE B;  5CKH A;  3LX7 A;  1HD3 A;  3M9Q A;  3SDZ A;  1KHC A;  3KBG A;  3P8H A;  2KK4 A;  1IHV A;  2O2O A;  2EYZ A;  1WHJ A;  2FYK A;  1Y07 A;  2P0Q A;  2RI3 A;  3UDC A;  4DBF A;  2R57 A;  4KGV B;  2P84 A;  1KQ2 A;  1TH7 A;  3CCV T;  1OOT A;  2HKQ B;  4RMO A;  2D9T A;  2O88 A;  2LMJ A;  3MET A;  2MOX A;  1JQQ A;  5GAM j;  3CME Q;  4KRT A;  4OMQ A;  6AT1 B;  1LOJ A;  5AT1 B;  5EG2 A;  3EG1 A;  3GNG A;  3G71 Q;  1VYT A;  1VQ9 Q;  1QQJ A;  2V1R A;  2XKO C;  1X2Q A;  1SEM A;  3H0F A;  1YHQ Q;  3E9F A;  3CC7 T;  5A0D A;  1BB9 A;  3HTR A;  4RTW A;  4C8Q B;  1LCK A;  3EH1 A;  1SRM A;  4ZTJ A;  2E70 A;  2LP5 A;  1PM3 A;  4X9D A;  2EQM A;  3VRZ A;  1B7T A;  3EG0 A;  2KYM A;  1X6O A;  2C0T A;  5GAO l;  2GNC A;  1VQP T;  2L3Q A;  4MDW A;  1UJ0 A;  5GAN 3;  4FCY A;  2DFU A;  2HKN A;  2ZPE B;  4M7D A;  1OUL A;  1IRX A;  1QMC A;  4DBR A;  1WQ7 A;  1KQS S;  1EFN A;  3FJ5 A;  1BU1 A;  2X3W D;  2A37 A;  2DA9 A;  3R6O A;  3RNJ A;  1Q95 G;  4II1 A;  3QZ5 B;  2KQW A;  1M1F A;  4N4I A;  4OMM A;  2DPP B;  1HYO A;  4M7D G;  2X3X D;  3E1S A;  2GGR A;  3OS0 A;  1YIT T;  1V1C A;  3RKW A;  3MP6 A;  2KAF A;  1BI0 A;  2DXB A;  5IAY A;  4M78 F;  5GAM e;  5CKE A;  4B9X A;  4M78 E;  4FYW B;  3OYN A;  1C1A A;  2RJE A;  2MF2 A;  4JRI A;  2KRM A;  2DAQ A;  2KE9 A;  1VQ6 A;  3QUI A;  3PIO A;  1HJD A;  3CCQ T;  2DBK A;  3O8V A;  4OGE A;  3X25 B;  4ZGJ B;  1KC8 U;  1K73 C;  2YRC A;  3WXM B;  4B9W A;  5KCO A;  2D8J A;  1M3A A;  3OW2 A;  2CZ6 B;  4OMN A;  3JRZ A;  4Y91 A;  3OW2 P;  4LUE A;  3E2U A;  2EJF A;  2OX7 A;  3RBB B;  2HCK A;  3AT1 B;  2H8H A;  2QG9 B;  4HCC A;  1BI2 A;  4A4E A;  4QQ6 A;  1YNZ A;  2AKL A;  1UUE A;  3G4S A;  5GAN d;  3VKI A;  3EFS A;  1D1C A;  1R0B G;  2HMA A;  4AFZ C;  3DKM A;  5LJ3 h;  4E7Z A;  2F2X A;  1I81 A;  4PJL A;  1UEB A;  5M9O A;  3SD4 A;  4M77 A;  1YCS B;  1B3Q A;  4CRI A;  4M7D E;  3M0R A;  1JXM A;  5GAM g;  5GAN 8;  5KE3 A;  4EMK B;  2DNU A;  4A4H A;  1GXI E;  1YBY A;  1YFN A;  2KNB B;  3ME9 A;  3S3O A;  2RQV A;  3X20 B;  1YI2 A;  1Q82 U;  3Q1J A;  2DVJ A;  1X43 A;  3OSS C;  4M77 G;  4BI4 A;  1ZQ1 A;  2ED0 A;  3RMQ A;  3KUF A;  1ZSZ C;  1AVZ C;  4LDW A;  1RAF B;  2NUP B;  3OMG A;  2YUN A;  3FIF A;  2CZ1 B;  1NJI U;  1QVF S;  5FWC A;  4LNP A;  2E1H A;  2H3E B;  1U06 A;  3E9G A;  3V8L A;  4M75 D;  2RM4 A;  5IHI A;  1ZUK A;  4JJN K;  2F69 A;  4QVD A;  3G71 A;  2K7A A;  3CC4 Q;  3CC2 T;  2I2L A;  3M0Q A;  1HSQ A;  2WSE E;  2X51 A;  4M75 F;  3EHQ A;  4NS5 A;  1KQS P;  1YHQ A;  4M75 E;  2F5K A;  2PU9 B;  1M90 U;  1T3L A;  5GAN 7;  1I5O B;  2VXF A;  1BIA A;  4AG1 C;  2KY9 A;  2SEM A;  1JU5 C;  2IIM A;  1WHL A;  2DYI A;  4BDY A;  4MZP A;  3R6N A;  1VUB A;  3VS3 A;  2DIL A;  3EGX A;  5HY6 A;  2DE0 X;  1WNL A;  2LQK A;  3C12 A;  2LC4 A;  2PQW A;  1OZ2 A;  4A4G A;  2HNI A;  4OMO A;  2RD1 A;  2DTI A;  4OB3 B;  4HVV A;  5LJ5 f;  3J80 E;  1AWO A;  3M57 A;  4HKE A;  1JB0 E;  2RA2 A;  3QDR B;  3CCU T;  1Q7Y U;  1SRL A;  2BKD N;  4J9I A;  3H41 A;  1Y0M A;  3BE3 A;  4OB1 B;  4M77 E;  1X27 A;  3BDU A;  4LD6 A;  2HSP A;  5AYF A;  3HHT B;  5J26 A;  3TSW A;  5C0M A;  2DK3 A;  1YIJ Q;  5FU6 B;  2LX7 A;  1UHC A;  1YJW Q;  2RHX A;  3QZ9 B;  2GCX A;  2NUZ A;  4PFO A;  4EMG A;  2VXE A;  3I35 A;  5GAN 2;  2Z0W A;  2M9U A;  1M2V B;  1ABO A;  1BI1 A;  2RMO A;  1TU0 B;  3QPH A;  2CP0 A;  1UEC A;  1XTD A;  4FW1 A;  3JCM f;  2VV5 A;  3VV0 A;  4GBQ A;  2AKK A;  3WVD B;  2CZ0 B;  1RAH B;  3L2V A;  1G83 A;  4JLI A;  4XU3 A;  5CAI A;  2PZ1 A;  3VU3 C;  2LCL A;  4M75 B;  5LJ3 j;  4LD9 K;  2LJ0 A;  2E10 A;  2HD0 A;  3EHR A;  1QWF A;  2XID A;  4EPC A;  3JCM c;  1VQ8 A;  3M0U A;  4D8K A;  4C92 A;  2P4T A;  1BCO A;  3QDF A;  2Y4Y A;  1QCN A;  4N4G A;  2BE9 B;  2CGH A;  1NZ9 A;  2PVG B;  2QA4 T;  1K76 A;  3O5Z A;  4J9H A;  2ZPG B;  4M7D C;  2JT4 A;  3VUZ A;  2JNG A;  5C6S A;  5FLX E;  1XOV A;  3L2R A;  1DJ7 B;  2JTE A;  4C92 G;  1PRL C;  4AT1 B;  2YRV A;  4QT7 A;  5HKC A;  2KRO A;  4RKU E;  2CP5 A;  4JJC A;  1QVF P;  4WTO B;  5GJV B;  3ZEH A;  3PTA A;  1OQK A;  4QW2 A;  3X24 B;  2KRN A;  3QJ6 A;  3SWN C;  4JRQ A;  2QQA A;  4F7U B;  3H8Z A;  4RG2 A;  2O4X B;  4FW2 A;  1MND A;  3HFN A;  5GAN e;  3CBP A;  4ANJ A;  1GCQ A;  4ZNX A;  3I5R A;  5IXF A;  1H3H A;  2CP6 A;  3EG2 A;  1XQH A;  1KC8 R;  1K73 U;  3VS0 A;  4BY6 C;  4C0Z A;  3QSU A;  1TUG B;  4JRK A;  1N8R R;  1WIE A;  3NTK A;  2CP7 A;  4DOW A;  4C8Q A;  1RI9 A;  1MGQ A;  4OB2 B;  2CT4 A;  2ZPF B;  4IUP A;  1H3Z A;  3S6W A;  2EW3 A;  4E7S A;  2P4R A;  1VA7 A;  2K4Y A;  2COW A;  1N9S A;  4BE2 A;  2GFU A;  1K8A C;  1YJN Q;  2E64 A;  3SEM A;  1WLP B;  4C8Q G;  4BUG A;  2EYY A;  3TRE A;  4GY5 A;  1UGS B;  1Q86 C;  1K1Z A;  4OMP A;  4JZ4 A;  2G6F X;  2L3S A;  3L42 A;  1HXD A;  1M3C A;  3UPU A;  3OBY A;  4X34 A;  3MEW A;  5CQX A;  5KYY B;  2YLB A;  4RCB A;  2B86 A;  3MKD A;  2VGM A;  4C92 E;  3JB9 G;  2CP2 A;  1Y57 A;  2VB6 A;  4Z89 A;  2YUQ A;  2A7Y A;  2MAM A;  3P8D A;  1B07 A;  2G3R A;  4M77 C;  1G3S A;  3RKX A;  1WHK A;  1K0X A;  1SHF A;  3GNF B;  3VS4 A;  1NPR A;  3M58 A;  1NEG A;  2RJF A;  4R55 A;  3HL8 A;  1VQ6 Q;  3CME T;  3NMZ C;  1Q82 C;  5A0L A;  5LJ3 g;  3G71 T;  1VQ9 T;  3QXE B;  5KYX B;  5LJ5 h;  4BB7 A;  1ACM B;  4XTY A;  5L23 A;  1PKT A;  2E4H A;  1YJW A;  3JSC A;  2RH2 A;  3GPL A;  3H9N A;  4MML A;  1M1K R;  5GAO m;  1AWJ A;  2JN0 A;  2J05 A;  2GTO A;  2IPO B;  1SKU B;  1PD0 A;  1NYG A;  2X35 A;  1AHJ B;  3G4S Q;  3CCE A;  1OX9 A;  4FU6 A;  2OTJ Q;  2FHD A;  4C8Q E;  1VQK T;  1K9M R;  1RLQ C;  1JBM A;  1NLP C;  2ESW A;  1VQO Q;  3VUB A;  2EYW A;  2QGG A;  2RHZ A;  4V2S A;  1PWT A;  3CCM Q;  3JCM h;  3INZ A;  2XDP A;  3JV3 A;  4ELZ C;  1MV3 A;  1OYX A;  2GFA A;  3EG9 B;  2JOY A;  2DRM A;  3LWI A;  5CKD A;  1F1B B;  1RI0 A;  3M0S A;  1D1B A;  4EMK A;  3JCM P;  3J81 E;  1I8F A;  3ULR B;  4IKF A;  1WHH A;  3H0I A;  1YI2 Q;  4C0G A;  2L5Q A;  4LE9 A;  5L8R E;  3OYE A;  3GBQ A;  4M78 A;  4Z88 A;  2DL7 A;  1QKX A;  2E41 A;  3CCL A;  2JZ2 A;  3OYD A;  2OTL Q;  1Q7Y C;  1NLO C;  1VQN A;  2QI2 A;  2RPN A;  1VQ5 Q;  2FRW A;  3CCR Q;  1S72 T;  2DL3 A;  2NUP A;  2Y4X A;  3BFM A;  4ATO A;  3OYB A;  4PL6 A;  1QLY A;  3DB3 A;  3HP9 A;  5KYN A;  2JS2 A;  4M78 G;  1OV3 A;  2XU8 A;  2CUD A;  4RUG A;  4C0D C;  3LH5 A;  2CS7 A;  1KQ1 A;  2JVV A;  5FRO A;  3MHX A;  2E65 A;  3EFO B;  2F1L A;  2VGN A;  3JB9 J;  3OQ5 A;  4Z8A A;  3VRY A;  3QKJ A;  1B34 B;  1UGR B;  5EC7 A;  8AT1 B;  5CQY A;  4FIB A;  2XD0 A;  5IT9 E;  3UWN A;  4DOV A;  1WJQ A;  4AFS C;  2KSS A;  5KYW A;  1X6G A;  2DEQ A;  5FWB A;  3A8L B;  2J6O A;  4JPB W;  3CBO A;  1M5Q 1;  1C6V X;  2FG0 A;  3E19 A;  7AT1 B;  1YJN A;  2AT1 B;  2DIQ A;  2HBP A;  3TCJ A;  1Y71 A;  2OAU A;  4J83 A;  4DBQ A;  4AG2 C;  5I2S A;  1VQM T;  1VIE A;  3VS6 A;  4UC4 A;  1ZA2 B;  2AK5 A;  2V1Q A;  3JB9 H;  3L2W A;  2NYS A;  2M0O A;  3MEV A;  5LJ5 j;  2YLC A;  1G2B A;  4J9F A;  1T3S A;  4X9C A;  1LPL A;  1TSF A;  1MUZ A;  3M56 A;  2M0Y A;  3NPF A;  2QAZ A;  3A98 A;  2YUO A;  1AZE A;  5I21 A;  2WSF E;  4HT8 A;  1JEG A;  2KR3 A;  2BE7 D;  3TU4 K;  2RI5 A;  1VIF A;  2M16 A;  2MI6 A;  2CDT A;  2K2V A;  5FU7 B;  1Y96 A;  1VQ4 A;  5CO7 A;  2KRS A;  2RK2 A;  3MP8 A;  2GQI A;  3HRU A;  2KBT A;  4PLI A;  1M9S A;  2F2V A;  1PSF A;  4E2F B;  2HBW A;  1GCQ C;  2GF7 A;  3CC4 T;  4M75 A;  2CP3 A;  1VYU A;  1ZSZ B;  5KCH A;  1Q81 C;  2RF0 A;  3CD6 A;  3NTH A;  4N4H A;  4D8D A;  1YJ9 A;  1VQ8 Q;  4KGZ B;  4C8Q C;  1K8A U;  3JCM W;  2R58 A;  1M8M A;  1QCF A;  4C5H A;  2DRK A;  2QTX A;  1Q86 U;  3MO8 A;  3URG A;  2QXF A;  2J7I A;  4M75 G;  1H64 1;  4F04 B;  1KD1 R;  1OU9 A;  3CCJ A;  2OTJ A;  2BZX A;  1ZA1 B;  4PFP A;  4ZN1 A;  3GOX A;  2NLU A;  3OB9 A;  1VQO A;  4C5E A;  5GAO n;  3UA6 A;  4XTW A;  3CCM A;  1QW1 A;  1HK9 A;  2LNH B;  1KG1 A;  4BDZ A;  3L2Z A;  5LJ5 e;  4NOY A;  2QQB A;  3GP8 A;  5LJ3 d;  1OPL A;  2DM1 A;  1EX4 A;  1TWB A;  3M0P A;  3VS2 A;  2Y90 A;  2LCS A;  3EFR A;  3V8J A;  3OYK A;  4KUL A;  3OA6 A;  2EVR A;  3PGG A;  3A8M B;  2HDA A;  1BBZ A;  4EMH A;  1NPP A;  1QP2 A;  1YIJ T;  3G6E Q;  2BZY A;  1YJW T;  2O4X A;  3PMT A;  2LX9 A;  3RER A;  2HQE A;  2HSE B;  1C0M A;  4Q5W A;  5CVI A;  2JTF A;  1FMV A;  4XU0 A;  1G3W A;  3OYI A;  2OTL A;  2EWN A;  5GMK h;  1W70 A;  1VQ5 A;  3CCR A;  1AZG B;  1AWX A;  4IUU A;  2K5I A;  2FZK B;  1PKS A;  1SF9 A;  4OML A;  1P92 A;  1FMK A;  3A5Z B;  2YWW A;  2EBP A;  3I55 A;  3HKS A;  5GAM f;  5GJW B;  2RJC A;  3V7S A;  2ATC B;  2LDM A;  2XHC A;  2M02 A;  1KQS A;  1MMG A;  3OS1 A;  1UHF A;  2HAX A;  1VQ7 T;  3LWH A;  4PJO D;  1D09 B;  2ROL A;  4ESR A;  3H6Z A;  3S3M A;  3QHS A;  5LJ5 g;  1BKB A;  1D1A A;  1E7O A;  2QYZ A;  3M53 A;  5KYY A;  3S3N A;  2VAS A;  4PJO F;  5DM7 R;  3JCM X;  5J3B A;  4KGX B;  3HSB A;  2VVK A;  2DER A;  2X4J A;  1ZSG A;  4M7A D;  3DLM A;  3QYH B;  3G7Z A;  2YXY A;  3FDR A;  3MPU B;  2JW4 A;  3VYG A;  1WJS A;  4JUV A;  5CIU A;  5HCK A;  3DB4 A;  4M7A F;  3ZFJ A;  3FLG A;  2ECZ A;  1WQW A;  2COY A;  3DLL A;  3PIP A;  4FL6 A;  4ELY C;  3FRN A;  3JCM g;  4M78 C;  2DZ9 A;  5KYX A;  3AHU A;  3FJP A;  4J9D A;  2VKN A;  1YWP A;  1WZO A;  1A0N B;  1IGQ A;  4F7U F;  4LDU A;  4ZGD B;  4ORZ A;  1PG5 B;  1X2K A;  4F7U E;  2OJ2 A;  2RQU A;  3M5A A;  1RAG B;  4PK4 A;  2CZ7 B;  5D6X A;  3SWN B;  3CCE Q;  1N6A A;  2FRY A;  3M4Y A;  2K57 A;  2X4X A;  4HCK A;  3A1P A;  2DBM A;  1OZ3 A;  1YJN T;  2CKK A;  4BY6 B;  1N9R A;  3NGP A;  4JDS A;  2FPD A;  5GAN 6;  2ROT A;  3CCV A;  2D1X A;  1WXU A;  1T0J A;  1WX6 A;  1W2B S;  1OU8 A;  4LXC A;  2XI9 A;  5GAO p;  2E12 A;  2KDS A;  1RUW A;  4PJO B;  2HEQ A;  2FZG B;  2MCN A;  1IB8 A;  2HL5 C;  3JCM Q;  1QKW A;  3PNW C;  4CC4 B;  4PJJ A;  3D7S B;  1RAA B;  1ZLM A;  4MZT A;  2CT3 A;  2YHT A;  1LJO A;  4EDU A;  2BZ8 A;  2F2W A;  2VYT A;  4LUD A;  3CCL Q;  4KH1 B;  5GMK j;  5CCA A;  1VQN Q;  3OY9 A;  4PJM A;  4M7A B;  1AOJ A;  1QVF A;  3PE0 A;  4ME7 A;  1U5S A;  2DL5 A;  1IO6 A;  2YUP A;  1VQ6 T;  4WCI A;  3H0H A;  3UF4 A;  1X01 A;  1VQL Q;  1JRI A;  2X9H A;  4PLL A;  1NM7 A;  1V76 A;  2VUB A;  3PT9 A;  5FU6 C;  3TEE A;  2RNA A;  4BI3 A;  1SHG A;  1WPY A;  3G6E A;  1M30 A;  2D6F A;  2HZY A;  4KH0 B;  2A28 A;  4OMF B;  2FVU A;  2MWP A;  4LDX A;  2FPE A;  1EZZ B;  3EFO A;  1O75 A;  3L2U A;  1Q81 U;  1B34 A;  1OPK A;  2EQU A;  1G8X A;  1I1J A;  2E5K A;  5LJ3 e;  1K8A R;  4A4K A;  4D6W A;  2E6Z A;  1BI3 A;  3G4S T;  4OB0 B;  3CPF A;  4M75 C;  1YIT A;  2RI2 A;  1D0X A;  2VWF A;  2JJ9 A;  3HFO A;  5FW9 A;  3ASK A;  1JO8 A;  1VQO T;  2DXU A;  3OYL A;  2RHY A;  3CCM T;  3CXC S;  1U1T A;  2K3Y A;  4IUT A;  4RG8 A;  4F14 A;  1YP5 A;  2MPX C;  1G3T A;  4BD3 A;  2KVQ G;  4KUI A;  5GAM h;  2KGT A;  1N8R C;  2K5F A;  2V8J A;  2QTV A;  1LNX A;  3M59 A;  1YI2 T;  5GAO q;  3SB2 A;  2DVE A;  1ZBJ A;  2DXC A;  3VJP A;  4MZM A;  1UFF A;  2OTL T;  2DMO A;  3MP1 A;  3ER0 A;  3QWY A;  3C4S A;  3CCR T;  1Q82 R;  1VQ5 T;  5GMK l;  5I11 A;  2J6K A;  1M4Z A;  4MMK A;  3JB9 I;  1VQ4 Q;  3M55 A;  3CBM A;  2EQI A;  2A0F B;  4DEX A;  2RK1 A;  1NJI R;  2K9G A;  2QK0 A;  4P5N A;  3EGU A;  4HCB A;  4JS4 A;  2KXD A;  1UGV A;  1KSW A;  3OS5 A;  2PVO B;  5A0G A;  2GQV A;  1X6B A;  1ZSZ A;  4IIO A;  4RTY A;  3CD6 Q;  1YJ9 Q;  5I22 A;  1YHQ T;  2GBQ A;  3OYG A;  5LJ5 d;  4E7K A;  1W2B A;  1KHI A;  1FX7 A;  4J8O A;  1I07 A;  1W2B P;  1J3T A;  3OBW A;  2L3R A;  3LYI A;  1M2O A;  3M4G A;  2D0Q B;  4IUQ A;  4PJN A;  2MIO A;  2E3I A;  1M90 R;  2QDL A;  1BIB A;  2PUK B;  3EG3 A;  4X1V A;  5GAN f;  1GFD A;  2VC8 A;  2JXB A;  3SFM A;  3CMA Q;  1RL2 A;  2SRC A;  4C0D B;  1MMN A;  1PCX A;  3CCJ Q;  2LQ8 A;  3NHN A;  4FSX A;  1RAE B;  1WHM A;  2DJQ A;  4FSS A;  2EQK A;  3EGD B;  1O9S A;  2LNV A;  4JJB A;  4HA8 A;  4J5Y A;  3NTI A;  2F5T X;  4O6J A;  4XU2 A;  2PTK A;  4J6X A;  2LCC A;  3JCM d;  1TUD A;  1Q7Y R;  2EYQ A;  2O9V A;  4FYV B;  1TUC A;  2DEU A;  2ENM A;  2M51 A;  4A63 B;  3CC2 A;  4C0F A;  1XNI A;  2EJG A;  5KYU B;  1K0S A;  3VS1 A;  1N27 A;  5GMK i;  1K4U S;  1PC0 A;  2I0N A;  1WYX A;  2L8D A;  3ZBD A;  2DYB A;  1RLP C;  5GAO r;  3RUX A;  4CI0 C;  2RQR A;  2AZS A;  3U23 A;  3CPW S;  3RR6 A;  3I9Q A;  2DZC A;  1UE9 A;  1D0Z A;  2X4Y A;  1VQL A;  2XIC A;  3QII A;  1M1G A;  4OGC A;  4OP0 A;  2WAC A;  4JZ3 A;  3OYC A;  3I55 Q;  2E3H A;  5I2M A;  1RAI B;  1W4S A;  2EAY A;  4RTU A;  4J9B A;  3CXC A;  3REB B;  4K11 A;  3CXC P;  3CCS Q;  4LDV A;  2W10 A;  4BE0 A;  1VQ8 T;  4WF2 A;  3CCU A;  2ZZD A;  3L2Q A;  5DY9 A;  1QWE A;  2CH4 A;  2FO0 A;  4FT4 A;  3PVQ A;  2HL3 A;  2RQT A;  2CSI A;  2OAW A;  1VOM A;  4HVU A;  1MNE A;  4HXJ A;  2XG8 D;  2QDY B;  2EJ9 A;  2K2M A;  1TXQ A;  2PNI A;  1T0H A;  4ZN3 A;  1UTI A;  3QBY A;  4FT2 A;  4C92 C;  3BY7 A;  2QEX Q;  2EQJ A;  2QAS A;  2XK0 A;  3OYH A;  3LGL A;  1FYN A;  2LJ1 A;  4L59 A;  3I56 Q;  1VQK Q;  4AMC A;  1RAD B;  3LLR A;  2L3P A;  2EKO A;  2MWO A;  3G6E T;  1KJW A;  2BTT A;  2B8A A;  4E6R A;  2RHU A;  4BI8 B;  1ABQ A;  3GF5 A;  2PVD B;  2P0P A;  2QQS A;  3LGF A;  4NL3 A;  3PFS A;  3OYJ A;  2YT6 A;  3RMS A;  4OF1 A;  1I4K 1;  4J7F A;  1M8V A;  1M2V A;  1WJR A;  1E6H A;  4J7I A;  2EKH A;  3OS2 A;  1K73 R;  3VS5 A;  1G3Y A;  1Q81 R;  4M78 D;  4HCZ A;  4N0A A;  3SWN A;  2K6D A;  3V7C A;  2LZ6 B;  5HK0 A;  2QA4 A;  4BE1 A;  2RO0 A;  1YN8 A;  3CQT A;  4O5V A;  2RQW A;  3UT1 A;  2RHI A;  4QKU A;  2DLP A;  1G5V A;  2DO3 A;  3GLX A;  4LDY A;  2K5L A;  2D0N A;  2KT1 A;  4E7L A;  2PUO B;  5GAN 4;  1S72 Q;  1TOV A;  3CCV Q;  4RTV A;  3QJY A;  3VS7 A;  3J7A F;  3HPW A;  3JCM V;  1S1N A;  2R5M A;  4E47 A;  3JCM b;  4QQD A;  5KH6 A;  1ZX6 A;  2NUT B;  1AD5 A;  4J9E A;  4PJO A;  1BCM A;  5CK9 A;  2OI3 A;  5LL6 S;  3CEY A;  2DXT A;  3JCM J;  3CMA A;  1RAB B;  3QWX X;  1N8R U;  4Z02 A;  4QVZ A;  3CC7 Q;  1PD1 A;  1KIK A;  1Z9Q A;  2EGC A;  4JJD A;  2LT4 A;  4PJO G;  5GAN h;  4M7A A;  2EGE A;  2HQH A;  2V8I A;  3JAM E;  3CPW A;  4IUV A;  3CPW P;  5D6Y A;  4HT9 A;  2ZPB B;  1WA7 A;  1JJ2 S;  3IQL A;  3V7R A;  1FWZ A;  4M7D D;  2QGF B;  1MMA A;  2C06 A;  1VQP Q;  3MEU A;  4CC2 A;  2DET A;  1KFZ A;  3I5S A;  2K3X A;  4F7U A;  3FC3 A;  4M7A G;  3OYY A;  1KD1 C;  2CH4 W;  3MJX A;  4M7D F;  1D3B B;  3VYH B;  2E5Q A;  5IXB A;  4J9G A;  3QG1 A;  3PMI A;  4F16 A;  1VQM Q;  1UDL A;  5FU7 C;  4RTZ A;  4PKC C;  3BDL A;  4E7I A;  3EAE A;  1R0C B;  2L89 A;  1U1S A;  2LRQ A;  1I5L A;  4XTZ A;  3JCM e;  1UGP B;  4F7U G;  3CCE T;  2YRD A;  4M78 B;  1W6X A;  1Y7X A;  2D8H A;  1YIT Q;  4ZGE B;  1PHT A;  2DJZ A;  2EIF A;  2IVW A;  2J6F A;  4KBM B;  2RN8 A;  3CCS A;  1UGQ B;  2LQW A;  1QVG S;  1H8K A;  3F70 A;  2M1H A;  2EGA A;  5FRN A;  4KUD K;  3KFV A;  1I0C A;  3CME A;  2RB6 A;  3CCQ Q;  2CSQ A;  3HRS A;  4QQG A;  1VQ9 A;  1WDX A;  4BAC A;  2NWM A;  1TTH B;  1M1K U;  2W0Z A;  1H92 A;  3A8O B;  4JS5 A;  4PJO E;  2V8K A;  4J6W A;  1NBE B;  2QQR A;  3CCL T;  2J06 A;  1VQN T;  2BIV A;  1QP3 A;  1MV0 B;  2KYB A;  5D6W A;  2K79 A;  1K9M U;  2FEI A;  1NG2 A;  1XJW B;  4IUR A;  2QEX A;  4C5I A;  1X75 C;  5KYW B;  1VQL T;  2DKG A;  4EMK C;  2EFI A;  3I56 A;  4M7A E;  8ATC B;  1VQK A;  9ATC B;  4M7D B;  1TG0 A;  1WHG A;  4CC3 A;  4M77 D;  3THK A;  1MMD A;  4FYY B;  3LW5 E;  1QVP A;  1D0Y A;  3HRT A;  1GBR A;  5CR2 A;  4R0K A;  1PNJ A;  4XTV A;  3REA B;  4M77 F;  1MHN A;  4GLM A;  2COZ A;  2ZAE A;  3RKY A;  1WXB A;  1ZBX A;  1SPK A;  2AIR B;  2ZCF B;  4NL2 A;  4DEY A;  2RJD A;  1LVK A;  2AHJ B;  1EIF A;  4L5G A;  2FB7 A;  3UAT A;  4DBH A;  1AEY A;  1ZUU A;  4YTL A;  2LQN A;  4MDX A;  1Y96 B;  5GAN j;  3EGD A;  5DLO A;  2DTO A;  1S72 A;  2C0O A;  4B6M A;  4XU1 A;  1GCP A;  1GFC A;  3LH0 A;  4Y92 A;  1V29 B;  1JJ2 A;  5CKB A;  1U3O A;  2CUB A;  1JJ2 P;  3SHW A;  3TVT A;  3EG9 A;  3OYA A;  1KK7 A;  3NFC A;  5GMK m;  2EYX A;  1GL5 A;  1IHW A;  3CC2 Q;  2ED1 A;  4FYX B;  4CC7 A; 
#chains in the Genus database with same CATH homology
 2ED0 A;  2JS0 A;  2DF6 A;  1X6B A;  4JPB W;  1CSK A;  1AVZ C;  4IIO A;  2FG0 A;  4RTY A;  5I22 A;  2GBQ A;  1WI7 A;  2YUN A;  4F17 A;  1J3T A;  1I07 A;  5FWC A;  4LNP A;  5ECA A;  4AG2 C;  1PRM C;  1W1F A;  2AZV A;  3VS6 A;  2V1Q A;  2AK5 A;  1CKB A;  2MIO A;  1OEB A;  2L0A A;  1U06 A;  2QDL A;  3EG3 A;  4X1V A;  2L2P A;  1GFD A;  5IHN A;  5IHI A;  2JXB A;  1WXT A;  1ZUK A;  1G2B A;  2SRC A;  3M0T A;  4J9F A;  1T3S A;  2K7A A;  1MUZ A;  1SSH A;  2M0Y A;  3NPF A;  2JM8 A;  3A98 A;  1N5Z A;  2YUO A;  3NHN A;  1AZE A;  3M0Q A;  1HSQ A;  1JEG A;  2XMF A;  2DJQ A;  4FSS A;  2KR3 A;  3EHQ A;  4IIM A;  4JJB A;  3TSZ A;  1UG1 A;  1T3L A;  1WFW A;  2CDT A;  2LJ3 A;  1NEB A;  3ZL7 C;  1NYF A;  1VYV A;  4AG1 C;  2KRS A;  2PTK A;  2SEM A;  1JU5 C;  2IIM A;  4RTT A;  2GQI A;  2KBT A;  3R6N A;  1CKA A;  1TUD A;  2DL8 A;  3VS3 A;  2F2V A;  2CRE A;  2DIL A;  2HBW A;  1GCQ C;  2DE0 X;  2O9V A;  1TUC A;  2ENM A;  2M51 A;  4A63 B;  1K0S A;  1VYU A;  3VS1 A;  1AWW A;  2DX1 A;  1K4U S;  4OMO A;  2I0N A;  1WYX A;  2RF0 A;  4HVV A;  2YDL A;  4D8D A;  2DYB A;  1AWO A;  1RLP C;  1SRL A;  4J9I A;  2RQR A;  3H41 A;  1M8M A;  1Y0M A;  1QCF A;  3UA7 A;  2AZS A;  3U23 A;  2DRK A;  1E6G A;  2KEA A;  3I9Q A;  4EIK A;  1X27 A;  1K9A A;  2KT8 A;  1UE9 A;  2J7I A;  2HSP A;  2C0I A;  5IHK A;  1UGV A;  4HVW A;  2JMA A;  2FPF A;  4AFQ C;  3TSW A;  1ZUY A;  4JZ3 A;  2LX7 A;  1UHC A;  2BZX A;  2NUZ A;  1Z9Z A;  4LN2 A;  4RTU A;  3I35 A;  4J9B A;  2A08 A;  3REB B;  4RTX A;  4K11 A;  2W10 A;  1ABO A;  2RMO A;  3UA6 A;  2LNH B;  1OPL A;  1UEC A;  1QWE A;  2DM1 A;  2O31 A;  2CH4 A;  3M0P A;  1GBQ A;  4GBQ A;  1M3B A;  3VS2 A;  2FO0 A;  1M27 C;  2LCS A;  2AKK A;  3PVQ A;  2EVR A;  5IH2 A;  1G83 A;  2PZ1 A;  2HDA A;  2K3B A;  1BBZ A;  2A36 A;  1JXO A;  2BZY A;  2RQT A;  2CSI A;  2OAW A;  1ARK A;  2YSQ A;  4HVU A;  4HXJ A;  4M4Z A;  2LJ0 A;  3EHR A;  2K2M A;  1QWF A;  2PNI A;  1T0H A;  3M0U A;  1UTI A;  1W70 A;  1X69 A;  4D8K A;  1AZG B;  1AWX A;  1FYN A;  1UJY A;  2LJ1 A;  1PKS A;  4OML A;  2O9S A;  1K76 A;  2L3P A;  1FMK A;  3O5Z A;  4J9H A;  2EBP A;  2JT4 A;  1KJW A;  2BTT A;  4E6R A;  5GJW B;  1XOV A;  1ABQ A;  2JTE A;  2JMC A;  1PRL C;  3C0C A;  4QT7 A;  2ABL A;  2YT6 A;  2EPD A;  2KRO A;  3PVL A;  1UHF A;  4JJC A;  1E6H A;  2EKH A;  5GJV B;  2ROL A;  4ESR A;  3VS5 A;  2KRN A;  1E7O A;  2K6D A;  2LZ6 B;  1YN8 A;  3CQT A;  2DL4 A;  1YWO A;  2RQW A;  2DLP A;  1GCQ A;  2VVK A;  3I5R A;  4ZNX A;  5IXF A;  1H3H A;  3EG2 A;  2D0N A;  2KT1 A;  1ZSG A;  2GTJ A;  3VS0 A;  1BK2 A;  4J9C A;  4RTV A;  2KXC A;  3VS7 A;  1GRI A;  2JW4 A;  1WIE A;  2JM9 A;  4AFU C;  1S1N A;  5HCK A;  1RI9 A;  1ZX6 A;  1HD3 A;  1AD5 A;  4J9E A;  2ECZ A;  2CT4 A;  2OI3 A;  2O2O A;  2EW3 A;  2P4R A;  1VA7 A;  2EYZ A;  3QWX X;  4J9D A;  2VKN A;  1YWP A;  3SEM A;  1WLP B;  1A0N B;  4ORZ A;  2EYY A;  1X2K A;  1OOT A;  1KIK A;  1K1Z A;  2OJ2 A;  4JZ4 A;  2RQU A;  1Z9Q A;  2EGC A;  4JJD A;  4OMP A;  2O88 A;  2EGE A;  2G6F X;  2L3S A;  1M3C A;  2LMJ A;  2MOX A;  1JQQ A;  4KRT A;  1WA7 A;  4OMQ A;  3IQL A;  2B86 A;  3EG1 A;  1VYT A;  2FRY A;  1Y57 A;  2V1R A;  4HCK A;  4CC2 A;  1KFZ A;  3I5S A;  4Z89 A;  2DBM A;  1X2Q A;  1SEM A;  2YUQ A;  3H0F A;  1B07 A;  1BB9 A;  2CH4 W;  3NGP A;  1K0X A;  2FPD A;  2ROT A;  2D1X A;  5IXB A;  4RTW A;  1SHF A;  4J9G A;  1WXU A;  1T0J A;  1WX6 A;  3VS4 A;  1LCK A;  4F16 A;  1SRM A;  1UDL A;  2LP5 A;  1NEG A;  4RTZ A;  1RUW A;  3VRZ A;  2HEQ A;  2MCN A;  3EG0 A;  1QKW A;  4CC4 B;  3NMZ C;  2KYM A;  2C0T A;  1W6X A;  2GNC A;  1ZLM A;  2L3Q A;  1UJ0 A;  2D8H A;  5L23 A;  2CT3 A;  1PKT A;  1PHT A;  2BZ8 A;  2F2W A;  4LUD A;  2J6F A;  1EFN A;  3FJ5 A;  1BU1 A;  2RN8 A;  1AWJ A;  2A37 A;  2X3W D;  2DA9 A;  2J05 A;  3RNJ A;  2LQW A;  2GTO A;  1AOJ A;  1H8K A;  3PE0 A;  1U5S A;  2EGA A;  2DL5 A;  1IO6 A;  2YUP A;  1NYG A;  4OMM A;  3KFV A;  1I0C A;  3H0H A;  4WCI A;  3UF4 A;  2CSQ A;  2X3X D;  2GGR A;  1WDX A;  1NM7 A;  2NWM A;  2W0Z A;  1H92 A;  1RLQ C;  1V1C A;  2RNA A;  1NLP C;  2ESW A;  1SHG A;  1M30 A;  2EYW A;  1PWT A;  2A28 A;  2J06 A;  2FPE A;  3JV3 A;  1MV0 B;  2KYB A;  1MV3 A;  2KRM A;  2K79 A;  1OPK A;  2FEI A;  1NG2 A;  1I1J A;  2E5K A;  2DRM A;  1HJD A;  2KE9 A;  2DBK A;  3M0S A;  3ULR B;  3H0I A;  4LE9 A;  1TG0 A;  4CC3 A;  2VWF A;  3GBQ A;  5FW9 A;  1JO8 A;  4Z88 A;  3THK A;  2DL7 A;  2D8J A;  1QKX A;  1M3A A;  1GBR A;  1NLO C;  4OMN A;  2RPN A;  2FRW A;  4F14 A;  1YP5 A;  2DL3 A;  4LUE A;  4R0K A;  1PNJ A;  3REA B;  3RBB B;  4GLM A;  2HCK A;  2H8H A;  1QLY A;  1YNZ A;  1WXB A;  2KGT A;  1SPK A;  2AKL A;  2JS2 A;  4DEY A;  1UUE A;  1OV3 A;  2CUD A;  4RUG A;  1ZBJ A;  4AFZ C;  3LH5 A;  3UAT A;  1AEY A;  2F2X A;  1ZUU A;  2LQN A;  1UFF A;  1YCS B;  2DMO A;  3QWY A;  1B3Q A;  4Z8A A;  3VRY A;  2C0O A;  5EC7 A;  5I11 A;  2J6K A;  3M0R A;  1GCP A;  1JXM A;  1GFC A;  4Y92 A;  2EQI A;  2DNU A;  1U3O A;  2CUB A;  2KNB B;  3SHW A;  3TVT A;  4DEX A;  4AFS C;  2K9G A;  2RQV A;  1X6G A;  3EGU A;  2EYX A;  2DVJ A;  1GL5 A;  5FWB A;  1X43 A;  2ED1 A;  2KXD A;  1KSW A;  4CC7 A;  2J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...