3EG1A

Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg1A00
2MIOA 4J9BA 3RBBB 2FPFA 2J7IA 1PWTA 2MCNA 2EVRA 3M0RA 2DMOA 2KYMA 3H0HA 2F2VA 2H8HA 1E6GA 2K7AA 2QDLA 1WXBA 1VA7A 4J9DA 1TUCA 3PVQA 2GGRA 2VVKA 4JJDA 3U23A 1JXMA 2ED0A 2YUOA 2KR3A 1AEYA 2RQRA 3JV3A 2ROLA 4JZ4A 1ARKA 2I0NA 1EFNA 4LUEA 2OI3A 4AFZC 1GBQA 2MOXA 2FG0A 1T0JA 2A28A 4OMMA 1V1CA 1AWWA 4IIMA 1PKTA 1NM7A 1RLQC 2P4RA 4ORZA 1UUEA 2D8JA 2K3BA 5I11A 2LQNA 1WX6A 4AFSC 2L0AA 1NYGA 1ZLMA 2AZVA 2HDAA 3NHNA 1NG2A 1Z9ZA 3M0QA 2LCSA 1QLYA 3I35A 1TG0A 2KBTA 3SEMA 1ZSGA 2EQIA 2CUBA 3IQLA 2V1QA 2J6KA 1M8MA 1K76A 4RTUA 1K1ZA 1N5ZA 2JS2A 2HSPA 1FMKA 3VRYA 3EG3A 4AG2C 5IHKA 1LCKA 4OMPA 2ED1A 1G2BA 4HVWA 4KRTA 1X2QA 2DLPA 3THKA 1QKXA 1WI7A 4Z88A 2KEAA 2J6FA 1W6XA 2EW3A 2K6DA 2YUPA 2RQUA 1GL5A 2AZSA 2EYXA 2DNUA 1I1JA 4IIOA 1YCSB 2PTKA 2RQWA 2X3XD 2O9SA 1VYUA 3C0CA 2FPDA 1SPKA 2LJ3A 1AVZC 4RTTA 4R0KA 1MV0B 3NPFA 4K11A 2YT6A 2DM1A 1M30A 2O2OA 1U5SA 2RQVA 1AWXA 2CH4A 1KSWA 2BZXA 5ECAA 1QKWA 1H3HA 1QCFA 4J9EA 1OPKA 1Y0MA 4CC4B 2A36A 4Z89A 2LQWA 2ESWA 1WFWA 1T0HA 1UHCA 1KFZA 4JPBW 1PRMC 5I22A 4Y92A 1X6GA 1U06A 1X2KA 4ESRA 4LE9A 4HXJA 2X3WD 2EGCA 3NMZC 2FEIA 1K0XA 1CKAA 2DYBA 1GRIA 2DL5A 1JEGA 1SEMA 2M51A 1X43A 5GJWB 1WIEA 1JQQA 1A0NB 2AK5A 2V1RA 2GTOA 3QWXX 1PNJA 1M3BA 3VS6A 1KIKA 4J9FA 3TSZA 2JS0A 4RTZA 2D8HA 1ZUYA 3VS3A 2DX1A 2C0TA 2DE0X 3A98A 1AD5A 1BK2A 3O5ZA 2DJQA 1UJYA 2J05A 3M0UA 2G6FX 3CQTA 4ZNXA 2W0ZA 1UJ0A 4RUGA 5IHIA 2L3QA 1E7OA 5L23A 2A08A 1GCQA 1QWFA 2PNIA 3H0FA 2HCKA 4J9IA 2IIMA 2W10A 1ZX6A 2LX7A 2RNAA 2OJ2A 2EGEA 1HSQA 2L3SA 1U3OA 1K4US 1X6BA 1PRLC 1X27A 1VYVA 1AWOA 1B3QA 1JU5C 1PKSA 2XMFA 2LP5A 4A63B 4LN2A 3REBB 1QWEA 1UGVA 3PVLA 3FJ5A 2D1XA 2JW4A 2FRWA 2KT8A 3I9QA 3EG1A 3M0TA 5IXFA 1H92A 1YP5A 4F14A 2DA9A 2RPNA 1GCPA 4M4ZA 3EGUA 1W70A 2DVJA 2O88A 2BTTA 3I5SA 1UECA 2FO0A 1WXUA 2RMOA 3PE0A 2EKHA 3H41A 4CC2A 4DEXA 3M0PA 2FPEA 3ULRB 3EG0A 2CUDA 2ABLA 1SSHA 4E6RA 1RLPC 2DL8A 3NGPA 1UDLA 2DBKA 1GCQC 2F2WA 1RI9A 4JJBA 2LJ1A 1J3TA 4QT7A 1YNZA 1KJWA 1ZBJA 3REAB 1I07A 3UA7A 5IH2A 1MV3A 1Y57A 3EHQA 2LNHB 2DBMA 1WXTA 3R6NA 2KROA 1AZGB 2K79A 4AG1C 1T3SA 1SHFA 1WDXA 4AFQC 1AZEA 2VWFA 3VRZA 1CSKA 1BB9A 1NEBA 5FWBA 2HEQA 1TUDA 2RN8A 1OEBA 1AWJA 1AOJA 3VS7A 2ENMA 1ZUUA 4J9HA 4OMOA 3EHRA 2AKKA 4J9GA 2NWMA 2EYZA 5FWCA 3VS0A 2LJ0A 4RTXA 2VKNA 4F16A 5IHNA 4OMLA 1MUZA 2B86A 4GLMA 1SHGA 1IO6A 3M0SA 4J9CA 2ECZA 1SRLA 1UE9A 2DL4A 2J6OA 3EG2A 1YWOA 4CC7A 2DRMA 2JMCA 4X1VA 2OAWA 1ABOA 1BU1A 2KXDA 4F17A 1X69A 2GTJA 1ABQA 1JO8A 1BBZA 1B07A 2KXCA 3SHWA 2L2PA 1HJDA 1XOVA 1M3AA 2GBQA 2JM8A 1GFDA 1GBRA 1UG1A 5IXBA 3GBQA 1RUWA 1OPLA 2LZ6B 2CT3A 4HVVA 2CDTA 1K9AA 1G83A 2CSQA 4FSSA 2CREA 4RTWA 2RQTA 2GNCA 2AKLA 3RNJA 2BZYA 2KNBB 2CSIA 2EYWA 1FYNA 4RTVA 2O9VA 2K2MA 2ROTA 1K0SA 4CC3A 2F2XA 4D8DA 4D8KA 4OMNA 1WLPB 2M0YA 1NLOC 1HD3A 4JJCA 4JZ3A 1M3CA 3UA6A 1YN8A 4LUDA 2GQIA 1WYXA 2EBPA 1W1FA 2KGTA 2SRCA 4AFUC 3VS5A 2KRSA 2LMJA 4WCIA 4OMQA 1UFFA 2KYBA 3VS2A 2RF0A 2DF6A 2KE9A 4HCKA 1PHTA 4RTYA 3KFVA 2A37A 1UTIA 2D0NA 1YWPA 2KT1A 4GBQA 2CH4W 2NUZA 1H8KA 1OV3A 2C0IA 1VYTA 2DILA 1S1NA 2DRKA 3VS4A 2C0OA 2YUQA 4Z8AA 3I5RA 2PZ1A 1ZUKA 1T3LA 1M27C 1NYFA 1I0CA 1SRMA 3LH5A 2FRYA 2KRNA 2E5KA 2L3PA 4EIKA 2YSQA 5HCKA 1NEGA 2EGAA 2JT4A 3H0IA 5EC7A 2EYYA 1WA7A 1UHFA 5GJVB 2J06A 2BZ8A 2K9GA 3TVTA 1CKBA 2O31A 2DL7A 2DL3A 1NLPC 2KRMA 5FW9A 4DEYA 1OOTA 3QWYA 2JM9A 4LNPA 2CT4A 2EPDA 2HBWA 3UF4A 1E6HA 4HVUA 3VS1A 2YUNA 1JXOA 1Z9QA 2JTEA 3ZL7C 2JMAA 2YDLA 3UATA 1GFCA 3TSWA 2JXBA 2SEMA
chains in the Genus database with same CATH superfamily
2MIOA 5GAN7 1XNIA 3SDZA 3RBBB 4DBFA 1TTHB 1JBMA 2MCNA 2EVRA 3CCLQ 3H0HA 2F2VA 2H8HA 2K7AA 5KYWB 2QDLA 4QW2A 1VA7A 1GXIE 2ZPFB 3U23A 1VQKT 1QVFP 3CCUQ 1KG1A 1AEYA 2QQ9A 2ROLA 2QEXQ 3EAEA 2MAMA 4E47A 2LTOA 1EFNA 5LJ3d 2OI3A 4AFZC 1D3BA 1T0JA 2LCLA 1AWWA 4PJOF 2AIRB 4IIMA 1ZBXA 3LWIA 3HL8A 1RLQC 4B9XA 2COZA 5GAMh 3FC3A 1G8XA 3LYIA 1I81A 2OAUA 2CP7A 1NG2A 1Z9ZA 5DLQE 3I35A 1TG0A 2ZPIB 2KBTA 1SKUB 2RJFA 1ZSGA 2JZ2A 2RK1A 1M9SA 4C8QF 2HKQB 3OW2P 4RTUA 5GANh 2O4XA 4XU3A 1NJIC 2ZGWA 4OMPA 3A8LB 3MHXA 3EGXB 2LT1A 2J6FA 2EJFA 4IUTA 2YUPA 1GL5A 4M77C 2EYXA 8ATCB 2RQWA 4JRKA 3OMCA 2X9HA 4J7FA 2ATCB 1SPKA 2NUTB 1YHQQ 2LJ3A 3BE3A 4RTTA 3LGFA 2AT1B 3SD4A 4R0KA 3NPFA 2E5QA 1Q81U 2DM1A 3RMQA 3ER0A 1U5SA 2WSCE 1EX4A 2BZXA 1H3HA 5KYYB 4J9EA 1VQ4A 1C0MA 1Y0MA 3JCMQ 4M7AE 2CYZB 2A36A 4LDXA 3C95A 5FU7B 5GAOm 1MGQA 5DM7R 1UHCA 1KFZA 2CZ1B 5GAN2 1X6GA 5LJ5g 2RHZA 2Y4YA 3H9NA 3NMZC 1Y71A 2LRQA 2VXFA 3X24B 1S72Q 1VQLQ 3X26B 2X4XA 4BI8B 1W4SA 1VOMA 5M9OA 2DIGA 3P8DA 2EKOA 4Y28E 2F5TX 1YI2T 3CXCS 2EQMA 3J7AF 1VQ6Q 1V76A 1A0NB 2V1RA 4RCBA 3CCVQ 3L2RA 3CD6Q 4RTZA 1TXQA 3G6EQ 3VYHB 1K9MR 5A0LA 4GLKA 1QQJA 5LJ3g 1BK2A 3M55A 1UJYA 2J05A 2G6FX 1R0BG 4ZNXA 2W0ZA 1UJ0A 2L3QA 3SB2A 1FWZA 2PNIA 3H0FA 4BE0A 2IIMA 1ZX6A 2LX7A 3RIRA 5GMKi 5IN1A 3M4GA 3V8LA 2M02A 1K8AU 1X6BA 3HRTA 1VQNQ 5HK3A 2F69A 3OQ5A 1WQWA 2NUTA 2GCXA 4A63B 2CP3A 2PVOB 1FMWA 4KT0E 1G3SA 3MO8A 3PVLA 5AYFA 2M1HA 3VJPA 4BY6B 2DD4A 2M0OA 3KUFA 5J39A 1OULA 2CGHA 3I55Q 3EG1A 3M0TA 9ATCB 1H92A 3LWHA 4XU1A 1OU8A 4FT4A 3VYGA 4A54A 3FLGA 3ZFJA 4PJJA 3N5BB 4BI3A 2ZPHB 3CCSQ 2CP6A 3I5SA 1QVGP 1O9SA 2DD5A 3CCJA 2G3RA 1XQHA 5KYXB 2WACA 2X4YA 2HZYA 3ULRB 2LX9A 2MK5A 4BDYA 4PJOE 4BY6C 2CUDA 1M90C 4E6RA 4BACA 2XD0A 3CC7T 4IURA 1PD1A 3CBMA 1M2OA 8AT1B 4NOYA 2DBKA 1OZ3A 2LJ1A 3RKYA 1Q86R 3REAB 3UA7A 5GAOq 4C0FA 1LJOA 1G3YA 3R6NA 1VQ8T 7AT1B 2K79A 1MNDA 4AG1C 3G71A 2COWA 1SHFA 4AFQC 3VRZA 5FWBA 3META 3M9QA 3QYGB 2KK4A 4M7AB 1AWJA 4XTWA 4OMOA 1D0ZA 4J9GA 3OYNA 2EYZA 3RUXA 4ELYC 3CC2A 1BI0A 1F1BB 4GLMA 4O5VA 1SHGA 4DQ2A 3M0SA 1SRLA 3G71T 4A4HA 4M77G 1VQPA 1M90U 2J6OA 3PT9A 2BE9B 2DRMA 5CR2A 3OYCA 1VQKQ 1BI3A 4QVDA 1ABOA 1BU1A 4F17A 4M7DG 5J3BA 3OW2A 1D0YA 1ABQA 3LX7A 3SHWA 2KXCA 3JSCA 4KH0B 1RL2A 3GBQA 2LZ6B 4HCZA 2XG8D 1WZOA 2CT3A 3GIBA 1R77A 3QJ6A 4FSSA 1VQPT 3NTKA 4OGEA 1JJ2A 2JVVA 2DYIA 3OA6A 2E12A 1VIEA 3SWNA 4FYWB 2O9VA 4EMKB 2F2XA 3P8BB 4V2SA 1KC8R 1U1TA 4D8DA 3HHTB 1HD3A 1LPLA 3ME9A 4C0GA 2R5MA 3L2WA 1QCOA 1W1FA 3C12A 1AT1B 2SRCA 4XTXA 5D6YA 1U8RA 4WCIA 2HD0A 2DXUA 2HQXA 5HKCA 3VS2A 4HCKA 1PHTA 4RTYA 5GAMd 3KFVA 2HNIA 2XHCA 2D0NA 4M7AA 1TU0B 2CH4W 1Q7YC 2COYA 1K73C 4PFOA 1OV3A 2C0IA 1VYTA 4FU6A 3VS4A 1KD1U 2QAZA 4XK8E 3JCMe 4IUPA 2K4YA 1NYFA 1IREB 3LH5A 1M2VA 3OS5A 2KRNA 2QGGA 4PJLA 2YRDA 5GANd 4M7AD 1ZSZB 2OX7A 1UHFA 1P92A 2J06A 2BZ8A 4EMHA 3RKXA 4PJOB 4NS5A 1NLPC 4HT9A 2RB6A 1Q82U 3P8HA 3QWYA 2X4JA 5CK9A 2RHYA 4LNPA 2CT4A 2EPDA 2HBWA 4HVUA 2XDDA 4M75A 4Y91A 2BUDA 1PG5B 1Z9QA 2JTEA 4J83A 2EQKA 1WHMA 3QJYA 2QDYB 2SEMA 3S3MA 5KCOA 1PM3A 1VQ6T 2FPFA 3BDUA 1PWTA 5GMKh 3QZ9B 5LL6S 4B9WA 1Q7YU 1K73U 2K3XA 1VQ4Q 1E6GA 3CCVT 3CD6T 3FJPA 4EMKA 3MEVA 4PJOC 1JXMA 3M56A 2ED0A 4DOWA 1MMGA 2YLBA 4LUEA 1PCXA 4BE1A 1MHNA 4F7UG 2EFIA 2A28A 4ZTJA 4JRPA 1NM7A 1Y96B 2P4RA 4ORZA 4LD6A 1V29B 1QVGA 4FM4B 4M7AF 3MPUB 1NYGA 2AZVA 4FYYB 3OW2S 3M0QA 3X28B 1QLYA 3I55T 4MZTA 2XDPA 2DO3A 1M8MA 2DKGA 5FROA 2E3IA 1ZSZA 2NLUA 4XTYA 1D3BB 3JB9I 1I8FA 2K5IA 4A4GA 4CI0C 4AG2C 5I2SA 3CPWP 2HL5C 4DBQA 1QKXA 2QQAA 2KMTA 4Z88A 2EW3A 4C92E 1RADB 3NFCA 4L5GA 2RHUA 2DNUA 4IIOA 5GAMg 3FEOA 1YCSB 5GMKm 1QVPA 4PJOD 1BYMA 3QBYA 4JRIA 1X75C 5LJ5e 1KHCA 2E6ZA 3M5AA 3C0CA 3CCMA 3JB9H 3JCMf 1N8RC 1KQ1A 1UEBA 2YT6A 5DLOA 1B34A 1IGUA 2P0PA 5GANg 1TS9A 4LDYA 1QKWA 3CXCA 3CMAA 3OYEA 4Z89A 4FT2A 3CCJQ 1WFWA 2CZ0B 1T0HA 2HSEB 5I22A 4Y92A 5LJ3e 3BW1A 1U06A 1Y96A 4NL2A 4M78E 1X2KA 1O75A 3OS1A 4LE9A 4HXJA 2X3WD 3QDRB 2FYKA 1RAAB 5HK0A 1VIFA 2VASA 2OTLA 1CKAA 3CMAT 1TUGB 2DYBA 4JJNK 2DL5A 5EG2A 3MP8A 2M51A 5GJWB 1JQQA 1N8RU 3CPFA 1D1CA 2GTOA 1PNJA 4BDZA 5GAN8 3INZA 4ZGDB 1QW1A 3G71Q 1KIKA 2HQHA 1NJIR 4E7HA 2D8HA 4ZGEB 3VS3A 4MZPA 2C0TA 4MMLA 2QGFB 1AD5A 3O5ZA 3M0UA 4LDUA 4PNOA 3CQTA 3CC2Q 2A08A 3A8MB 3QYHB 5L8RE 1VQPQ 1Q81C 4OVAA 1WGSA 1AHJB 1WHLA 2M9UA 2GFAA 1AWOA 3KBGA 3HRUA 1U1SA 2LP5A 1WHGA 2CP5A 3V8JA 2IPOB 2D1XA 2BIVA 3FJ5A 3CBPA 2FRWA 2RHXA 2E4HA 2KT8A 3I9QA 3OYHA 3X25B 5GAN4 1QVGS 2XICA 5LJ5j 2RPNA 4N0AA 1GCPA 2K5FA 4M4ZA 2EQUA 3UWNA 4B6MA 2QTXA 3OYYA 2DVJA 2O88A 2B8AA 4YTLA 2HKNA 3WVDB 3ZBDA 2FO0A 1ZA2B 3EFOA 5DY9A 2RMOA 3EGDA 3PE0A 2EKHA 1VQOA 3E2UA 3HP9A 2WSFE 2VGMA 2E64A 1XTDA 3QIIA 4C92B 3GP8A 4N4IA 3L2ZA 4FYXB 1SSHA 1OI1A 4KH1B 1I4K1 2DL8A 1MMNA 4C8QG 2BKDN 5LJ3j 2F2WA 1J3TA 4QT7A 1ZBJA 2X4WA 4WF2A 5IH2A 3J80E 2DBMA 1VQOT 3LGLA 1PC0A 4QQGA 3BFMA 1AZGB 3BY7A 5HY6A 1G3WA 4KGXB 4E7SA 4OP0A 1WDXA 2DJZA 1K8AC 3RESA 2RJEA 4L6V5 1CSKA 1UGRB 1VQ4T 4JDSA 4BI4A 1H641 3JCMP 4PFPA 3RERA 3CMEA 4E2FB 4RTXA 2HAXA 2PU9B 3G4SA 3HTRA 4QVCA 1NZ9A 2ZCFB 4M75E 2B86A 2ECZA 5C6SA 3H8ZA 1UE9A 4M78B 5FU7C 1G5VA 1WJSA 1OU9A 2LT4A 1YITA 4GY5A 3QDFA 3CMET 2LC4A 5CKFA 4JLGA 1B07A 2L2PA 3DLMA 2VYTA 2ZPGB 2QA4A 4M7DA 2GBQA 2GFUA 1GFDA 1GBRA 1Y07A 5IXBA 2DTOA 4F04B 1RUWA 1OPLA 2YRVA 4RG8A 5FLXE 2CDTA 3FDRA 1G83A 2CSQA 3A8GB 5CKEA 2RQTA 1YIJQ 1KQSA 3DKMA 3RNJA 2BZYA 3ZEHA 2LQKA 1FYNA 2K2MA 2ROTA 2RD1A 4PFZA 2QA4T 2EIFA 4C92A 3A8OB 4OMNA 2WSEE 2M0YA 1NLOC 4FW2A 4JJCA 1M3CA 2Y90A 4R55A 1R0CB 2HBPA 2GQIA 2EBPA 4XU0A 3OS2A 2KGTA 4C92D 4MZMA 1R8OB 2DFUA 4FL6A 3HSBA 1K9MC 3PFSA 2KI7A 4ME7A 2KE9A 5GAN3 2BE7D 3SWNB 2OTJA 1WJQA 1N9SA 2KT1A 4GBQA 2MWOA 3OYAA 4DA4A 1S1NA 1UGPB 2YUQA 1OZ2A 4XAXB 4JUVA 2FRYA 2L3PA 3OMGA 1BKBA 4Q5WA 1QVFA 4OB1B 4M78A 3CCJT 3H0IA 1VQ5A 2EYYA 2E65A 2OTJT 2RA2A 3EFRA 3TVTA 1CKBA 4EMGA 3HRSA 2DVEA 3EFSA 2DL7A 2GQVA 2KRMA 5FW9A 4DEYA 3GPLA 2HL3A 3SWNC 2YUNA 5I2MA 4M78D 3CCMQ 2JMAA 1WJRA 2FL7A 2FHDA 4LXCA 3TSWA 1K9MU 2LNVA 2LQ8A 1M2VB 2PVGB 5J26A 3M0RA 3UT1A 3CMAQ 1WXBA 4C92F 1TUCA 2VVKA 4X9CA 2H3EB 3PMIA 1ZA1B 2RQRA 3JV3A 1ARKA 4M75B 3CC2T 4M7AC 3S3OA 1I5LA 2P0QA 1Q86C 1N27A 2MOXA 4OMMA 3EG9A 1V1CA 3GNFB 2OTLQ 4F7UA 1PD0A 2HMAA 1PKTA 2VC8A 1KD1C 1UUEA 2D8JA 2K3BA 3VUZA 2LQNA 1WX6A 2DK3A 2L0AA 2DAQA 4JLIA 1RAFB 4A4KA 1ZLMA 5GAMe 3NHNA 1VUBA 2IG0A 2QQRA 4QQ6A 3CC4A 3A5ZB 5GAOp 3SEMA 1WHHA 4M75C 1Q82C 2EQIA 2CUBA 2V1QA 2ZPBB 4M78F 3CPWS 2H3JA 1K76A 3JCMb 1K1ZA 2JS2A 2HSPA 3VRYA 3EG3A 5IHKA 4MDWA 2LDMA 1KQSS 5GANe 3MP6A 1KHIA 1SSFA 4IUQA 1X2QA 1YCYA 2DLPA 4N4HA 3THKA 2LVMA 3CC4T 1WI7A 1Q86U 2KEAA 1VQ9A 1W6XA 4EMKC 3LLRA 4EPCA 3C4SA 2RQUA 2NYSA 4J6YA 2AZSA 1RAHB 2FZKB 3AT1B 1I1JA 3DB4A 4HT8A 1QP3A 2O9SA 5FU6B 2QK0A 1YJWA 1VYUA 1BI1A 3M4YA 1KK7A 2XK0A 2FPDA 1WPYA 4ZN3A 1AVZC 1FMVA 3GF5A 2PQWA 2XKOC 4K11A 1M4ZA 1M30A 2L5QA 1VQ9T 2F5KA 1RACB 2RQVA 1AWXA 1KSWA 5ECAA 3TU4K 1KC8C 2ZPEB 4WTOB 1DJ7B 1HXDA 1BI2A 1OPKA 5FRNA 4CC4B 1YJWT 2ESWA 2QASA 1VQOQ 4JPBW 5FU6C 3R6OA 3E9GA 1QVFS 1YJNA 3QSUA 2DZCA 4E7IA 4ESRA 4M75D 3V8KA 2EGCA 2P84A 3FB9A 1ZSZC 1Y7XA 3C94A 2KY9A 1B34B 1FXXA 1K0XA 5GAOl 1YJ9A 2RI5A 3CCQA 1GRIA 1JEGA 1SEMA 1YIJA 6AT1B 3DLLA 4OB2B 3MKDA 1WIEA 2DTIA 2RO0A 4Z02A 3NTIA 3QHSA 3QWXX 1IXDA 3OB9A 2JNGA 1M3BA 3D7SB 4J9FA 1X01A 4E7ZA 3TSZA 1YJNT 2JS0A 1M1KR 4IKFA 2MYSA 3I56A 4KGZB 3X20B 1KC8U 3CMEQ 3L2QA 3L2UA 1YJ9T 2DETA 5GAMj 1OYXA 1YIJT 5IHIA 4RUGA 3G4SQ 1E7OA 5L23A 1M1GA 2QYZA 1GCQA 1QWFA 1HYOA 4M77E 4J9IA 4DBHA 4VUBA 5KH6A 2RNAA 2L3SA 4HKEA 1U3OA 1K4US 3I56T 4M7DE 1YITQ 1B3QA 1JU5C 1PKSA 2FVUA 2XMFA 5GANj 4LN2A 2GF7A 2QA4Q 2JW4A 2XU8A 1JRIA 2R5AA 2VXEA 3PIPA 5IXFA 1M5Q1 3QUIA 4M75F 3UDCA 2DA9A 2PUKB 3MCAB 2JUFA 2R58A 2DPPB 3CCEA 4II1A 1EIFA 1IRXA 4E7KA 4C5HA 4CRIA 3H41A 4DBRA 4CC2A 2FPEA 4BB7A 2PVDB 5GAOr 2ABLA 1IB8A 4PKCC 1RLPC 2F1LA 3OS0A 3NGPA 3Q1JA 4ZGJB 4RMOA 1UDLA 3CCET 1RI9A 4JJBA 3OSSC 1I07A 2EQJA 1Y57A 3QZ5B 3CCMT 1RAIB 2LNHB 1C6VX 4C8QA 2OTJQ 2EAYA 3OBYA 1LVKA 1UGQB 2KROA 1N6AA 3EFOB 1T3SA 1BIBA 4IUVA 3S6WA 3EGDB 2VGNA 2VUBA 5KYUA 4ANJA 1VQ7A 1BB9A 3OSVA 2HEQA 3OYFA 5KE3A 2Z0WA 2RN8A 3VS7A 2RI2A 1Q81R 1M1KU 2ENMA 1ZUUA 4J9HA 3CCRA 5FWCA 1VQ5Q 3VS0A 2LJ0A 2RH2A 1EZZB 4OMLA 4J9CA 4N0AC 3GLXA 2E6NA 1XJWB 2DL4A 5GAOn 3EG2A 1YWOA 4CC7A 1VQ7T 3JB9G 4E7LA 2K57A 2OTLT 2GTJA 4KBMB 2CZ6B 3CEYA 3CCRT 2EJGA 4RCCA 1Q95G 1NE8A 1UB4A 3HPWA 1HJDA 1G3TA 2MPXC 3V7RA 2A0FB 2CZ7B 1H3ZA 2RHIA 4HVVA 1K9AA 4KUDK 2CREA 2CP0A 4RTWA 3A1PA 3TCJA 4PLIA 1IHVA 1PSFA 3V7CA 2KQWA 4P5NA 3JAME 2AKLA 4OB0B 2CSIA 4FSXA 4RTVA 1K0SA 4CC3A 1HK9A 4F7UE 4M77B 3OYBA 2V8KA 4D8KA 1WLPB 4FIBA 1OX8A 3T9NA 1YN8A 1D1BA 4M7DB 2DZ9A 3RDVA 4PJOG 3CBOA 1ACMB 3QG1A 3G1JA 3WVEB 3TEEA 2KRSA 1K8AR 3URGA 1MNEA 2KYBA 4JS5A 2RF0A 3CC4Q 1UGSB 5LJ5f 2A37A 1YWPA 4PJMA 1LOJA 1JJ2P 4J5YA 2NUZA 3JCMh 1H8KA 5FRMA 2DILA 3ASKA 3A8HB 2QG9B 3I5RA 2PZ1A 3HKSA 1ZUKA 1T3LA 1B7TA 4OB3B 4M7DC 1SRMA 2PUOB 1TOVA 1MMDA 1TWBA 2YSQA 4BD3A 1SF9A 2EGAA 3HFNA 2K2VA 5EC7A 1WA7A 5KYWA 1VQ9Q 2DL3A 3NTHA 2E70A 1BIAA 5LJ3f 5D6WA 3UF4A 1YJWQ 1JXOA 2L89A 1W2BP 4N4GA 4C92C 1NJIU 1YI2A 2YDLA 3UATA 3VUBA 4L59A 2AHJB 5IAYA 2JXBA 4OMFB 4J9BA 1IHWA 5KYNA 2J7IA 4XTZA 2A7YA 2DMOA 2KYMA 4RKUE 4J9DA 5GMKe 4LDVA 3PVQA 2GGRA 4M77A 4JJDA 3GOXA 4X9DA 4J6XA 2YUOA 2KR3A 4J6WA 4JZ4A 4C0ZA 2I0NA 3G4ST 1YJNQ 1D09B 3CPWA 1GBQA 2QTVA 2X35A 2FG0A 2MI6A 2KAFA 4M77D 3OYMA 1D1AA 3PTAA 1YJ9Q 3CCQQ 1YITT 2DIQA 2KDSA 4M78C 4M7DD 3EGXA 5I11A 2QI2A 2CS7A 1M90R 4AFSC 4JRQA 2L8DA 2D6FA 2HDAA 1WQ7A 2LCSA 1QMCA 3I56Q 2QQSA 2DTHA 3IQLA 2J6KA 5A2QE 3O8VA 3PNWC 1IGQA 4QKUA 3E1SA 5CCAA 1N5ZA 1OQKA 1FMKA 3EG9B 4D6WA 3QO3A 1LCKA 4AMCA 4F7UB 2P0KA 2ED1A 1G2BA 4HVWA 4KRTA 4XTVA 1WHKA 5KYYA 2YXYA 4KULA 4A4FA 2Y4XA 2E3HA 2K6DA 4HCBA 4XTUA 3CC7A 5LJ5h 4IUUA 2PTKA 2X3XD 4XQ3A 4ZTFA 1LNXA 2V8JA 1VQMA 2C06A 3FIFA 3PMTA 3GNGA 1VQ8A 1MV0B 1ZQ1A 2O2OA 4M77F 3RMSA 3SFMA 5GMKl 5AT1B 4KUIA 2E41A 2MMPA 5I21A 3OY9A 5IT9E 2IVWA 2CH4A 2D0QB 3CCEQ 3CCLA 1QCFA 3KXTA 4UC4A 2DERA 3G7ZA 3M57A 4M7DF 3L2VA 1QP2A 2LQWA 1VQMT 2FZCB 5LJ3h 3CCUA 3EH2A 1KD1R 1PRMC 1VQ5T 3FRNA 2QEXA 5GMKj 1N9RA 1JB0E 3TREA 1RI0A 4C8QE 4QVZA 4MMKA 2FEIA 3CCLT 2X51A 4ZN1A 2MF2A 1X6OA 4TVRA 2DEQA 2JN0A 3M58A 1X43A 2YWWA 3PGGA 1C1AA 1Q82R 2EYQA 2K5LA 3CCUT 2AK5A 2YHTA 2QEXT 2QXFA 3VS6A 5D6XA 1VQ7Q 3M59A 3CXCP 1ZUYA 4C5EA 1IZ6A 1MMAA 2DX1A 2DE0X 3A98A 2ZAEA 2R57A 3V7SA 3OYLA 3CCRQ 2DJQA 1D0XA 1Q7YR 3OYJA 1K73R 1SG5A 4LD9K 2DXCA 2I2LA 2O01E 2RK2A 2VB6A 5GAN5 2HCKA 2HQEA 2W10A 1QCNA 2OJ2A 2EGEA 1HSQA 2LCCA 1PRLC 1X27A 1VYVA 2NUPB 3DB3A 4MDXA 5KYXA 5CKBA 4C92G 3REBB 1QWEA 1UGVA 3JRZA 5CKHA 5KE2A 2ZZDA 3M53A 1RAGB 2KVQG 1YHQA 1KQ2A 3M54A 3S3NA 4DOVA 1YP5A 3JCMc 3TQ7P 3VU3C 4F14A 2RI3A 2RM4A 2MWPA 2A3LA 3EGUA 1W70A 1TH7A 2BTTA 1UECA 1W2BA 2DEUA 1WXUA 3WXMB 2XI9A 4J7IA 1YHQT 4DEXA 3M0PA 4FYVB 3EG0A 5KCHA 5CKDA 2JOYA 2RJCA 3OYKA 3F70A 2DXBA 4M78G 3MJXA 3QPHA 4R56A 1S72A 1GCQC 1VQLA 2K3YA 3OBWA 4PLLA 1YNZA 1KJWA 2CP2A 1MV3A 3EHQA 2FB7A 1WXTA 3JCMV 1VQ6A 4F7UF 1YBYA 1YFNA 2CKKA 3LH0A 1AZEA 2VWFA 3CCVA 3CD6A 1I5OB 1NEBA 1TUDA 3G6EA 3MEAA 2QQBA 1OEBA 4ELZC 3JCMd 1BCMA 4LDWA 3L1AA 1AOJA 4OF1A 4PL6A 1S72T 1VQLT 1RAEB 5CQXA 1BCOA 3EHRA 2AKKA 3AHUA 2JTMA 2NWMA 5CO7A 2E10A 2VKNA 4HA8A 4F16A 2VV5A 5IHNA 2NUPA 1MUZA 4A53A 4QQDA 1IO6A 2XDBA 3L42A 1OX9A 5A0DA 4C8QB 3RR6A 3LW5E 3BDLA 1M8VA 2JMCA 4X1VA 2RJDA 3G6ET 2OAWA 2EWNA 2KXDA 2D9TA 5C0MA 1YI2Q 1VQNA 1X69A 3OYIA 3CCQT 2EJ9A 3VV0A 1JO8A 1BBZA 5KYUB 2V8IA 4XU2A 1XOVA 2P4TA 1M3AA 2JM8A 1WNLA 2XIDA 3E9FA 4C5IA 1UG1A 4FCYA 4J8OA 5GAN6 1FX7A 1NPPA 3EH1A 3I55A 1TSFA 5GAMf 4OGCA 3JCMJ 1N8RR 3JB9D 2GNCA 3MP1A 2YRCA 4E7JA 1VQNT 4FW1A 5CQYA 2KNBB 4JS4A 4C8QC 2EYWA 3J81E 2JTFA 3CCSA 1WHJA 3MEWA 2KSSA 2FZGB 4BE2A 2M16A 5CIUA 3UPUA 4JZ3A 4C0DB 5GANf 3UA6A 4LUDA 1WYXA 2V26A 3PIOA 4PJNA 1M1FA 3JCMW 2L3RA 4AFUC 3VS5A 1ZHIA 3H6ZA 4RG2A 1JJ2S 1M1KC 2LMJA 4OMQA 4PJOA 4KGVB 3JCMX 1UFFA 3CCST 1NBEB 2DXTA 4NL3A 1RABB 4AT1B 4M7AG 2DF6A 3OYDA 1UTIA 4PK4A 1NPRA 4HCCA 1KQSP 2DRKA 3E19A 2C0OA 4Z8AA 4C0DC 5D7UA 1M27C 3HFOA 1I0CA 4BUGA 5CVIA 2E5KA 4EIKA 1PSEA 3MEUA 5HCKA 1NEGA 2JT4A 5CAIA 4C5GA 2JJ9A 2O4XB 5GJVB 4EDUA 2K9GA 1W2BS 3CC7Q 4O6JA 2O31A 3VKIA 4A4EA 4M75G 3RKWA 1OOTA 3JB9F 3JB9J 2E1HA 2JM9A 4X34A 3OYGA 1E6HA 1VQMQ 3VS1A 3QKJA 1VQKA 4C8QD 5LJ5d 3ZL7C 1VQ8Q 5A0GA 1GFCA 3QXEB 2YLCA 4ATOA 3JCMg
chains in the Genus database with same CATH topology
2MIOA 4J9BA 3RBBB 2FPFA 2J7IA 1PWTA 2MCNA 2EVRA 3M0RA 2DMOA 2KYMA 3H0HA 2F2VA 2H8HA 1E6GA 2K7AA 2QDLA 1WXBA 1VA7A 4J9DA 1TUCA 3PVQA 2GGRA 2VVKA 4JJDA 3U23A 1JXMA 2ED0A 2YUOA 2KR3A 1AEYA 2RQRA 3JV3A 2ROLA 4JZ4A 1ARKA 2I0NA 1EFNA 4LUEA 2OI3A 4AFZC 1GBQA 2MOXA 2FG0A 1T0JA 2A28A 4OMMA 1V1CA 1AWWA 4IIMA 1PKTA 1NM7A 1RLQC 2P4RA 4ORZA 1UUEA 2D8JA 2K3BA 5I11A 2LQNA 1WX6A 4AFSC 2L0AA 1NYGA 1ZLMA 2AZVA 2HDAA 3NHNA 1NG2A 1Z9ZA 3M0QA 2LCSA 1QLYA 3I35A 1TG0A 2KBTA 3SEMA 1ZSGA 2EQIA 2CUBA 3IQLA 2V1QA 2J6KA 1M8MA 1K76A 4RTUA 1K1ZA 1N5ZA 2JS2A 2HSPA 1FMKA 3VRYA 3EG3A 4AG2C 5IHKA 1LCKA 4OMPA 2ED1A 1G2BA 4HVWA 4KRTA 1X2QA 2DLPA 3THKA 1QKXA 1WI7A 4Z88A 2KEAA 2J6FA 1W6XA 2EW3A 2K6DA 2YUPA 2RQUA 1GL5A 2AZSA 2EYXA 2DNUA 1I1JA 4IIOA 1YCSB 2PTKA 2RQWA 2X3XD 2O9SA 1VYUA 3C0CA 2FPDA 1SPKA 2LJ3A 1AVZC 4RTTA 4R0KA 1MV0B 3NPFA 4K11A 2YT6A 2DM1A 1M30A 2O2OA 1U5SA 2RQVA 1AWXA 2CH4A 1KSWA 2BZXA 5ECAA 1QKWA 1H3HA 1QCFA 4J9EA 1OPKA 1Y0MA 4CC4B 2A36A 4Z89A 2LQWA 2ESWA 1WFWA 1T0HA 1UHCA 1KFZA 4JPBW 1PRMC 5I22A 4Y92A 1X6GA 1U06A 1X2KA 4ESRA 4LE9A 4HXJA 2X3WD 2EGCA 3NMZC 2FEIA 1K0XA 1CKAA 2DYBA 1GRIA 2DL5A 1JEGA 1SEMA 2M51A 1X43A 5GJWB 1WIEA 1JQQA 1A0NB 2AK5A 2V1RA 2GTOA 3QWXX 1PNJA 1M3BA 3VS6A 1KIKA 4J9FA 3TSZA 2JS0A 4RTZA 2D8HA 1ZUYA 3VS3A 2DX1A 2C0TA 2DE0X 3A98A 1AD5A 1BK2A 3O5ZA 2DJQA 1UJYA 2J05A 3M0UA 2G6FX 3CQTA 4ZNXA 2W0ZA 1UJ0A 4RUGA 5IHIA 2L3QA 1E7OA 5L23A 2A08A 1GCQA 1QWFA 2PNIA 3H0FA 2HCKA 4J9IA 2IIMA 2W10A 1ZX6A 2LX7A 2RNAA 2OJ2A 2EGEA 1HSQA 2L3SA 1U3OA 1K4US 1X6BA 1PRLC 1X27A 1VYVA 1AWOA 1B3QA 1JU5C 1PKSA 2XMFA 2LP5A 4A63B 4LN2A 3REBB 1QWEA 1UGVA 3PVLA 3FJ5A 2D1XA 2JW4A 2FRWA 2KT8A 3I9QA 3EG1A 3M0TA 5IXFA 1H92A 1YP5A 4F14A 2DA9A 2RPNA 1GCPA 4M4ZA 3EGUA 1W70A 2DVJA 2O88A 2BTTA 3I5SA 1UECA 2FO0A 1WXUA 2RMOA 3PE0A 2EKHA 3H41A 4CC2A 4DEXA 3M0PA 2FPEA 3ULRB 3EG0A 2CUDA 2ABLA 1SSHA 4E6RA 1RLPC 2DL8A 3NGPA 1UDLA 2DBKA 1GCQC 2F2WA 1RI9A 4JJBA 2LJ1A 1J3TA 4QT7A 1YNZA 1KJWA 1ZBJA 3REAB 1I07A 3UA7A 5IH2A 1MV3A 1Y57A 3EHQA 2LNHB 2DBMA 1WXTA 3R6NA 2KROA 1AZGB 2K79A 4AG1C 1T3SA 1SHFA 1WDXA 4AFQC 1AZEA 2VWFA 3VRZA 1CSKA 1BB9A 1NEBA 5FWBA 2HEQA 1TUDA 2RN8A 1OEBA 1AWJA 1AOJA 3VS7A 2ENMA 1ZUUA 4J9HA 4OMOA 3EHRA 2AKKA 4J9GA 2NWMA 2EYZA 5FWCA 3VS0A 2LJ0A 4RTXA 2VKNA 4F16A 5IHNA 4OMLA 1MUZA 2B86A 4GLMA 1SHGA 1IO6A 3M0SA 4J9CA 2ECZA 1SRLA 1UE9A 2DL4A 2J6OA 3EG2A 1YWOA 4CC7A 2DRMA 2JMCA 4X1VA 2OAWA 1ABOA 1BU1A 2KXDA 4F17A 1X69A 2GTJA 1ABQA 1JO8A 1BBZA 1B07A 2KXCA 3SHWA 2L2PA 1HJDA 1XOVA 1M3AA 2GBQA 2JM8A 1GFDA 1GBRA 1UG1A 5IXBA 3GBQA 1RUWA 1OPLA 2LZ6B 2CT3A 4HVVA 2CDTA 1K9AA 1G83A 2CSQA 4FSSA 2CREA 4RTWA 2RQTA 2GNCA 2AKLA 3RNJA 2BZYA 2KNBB 2CSIA 2EYWA 1FYNA 4RTVA 2O9VA 2K2MA 2ROTA 1K0SA 4CC3A 2F2XA 4D8DA 4D8KA 4OMNA 1WLPB 2M0YA 1NLOC 1HD3A 4JJCA 4JZ3A 1M3CA 3UA6A 1YN8A 4LUDA 2GQIA 1WYXA 2EBPA 1W1FA 2KGTA 2SRCA 4AFUC 3VS5A 2KRSA 2LMJA 4WCIA 4OMQA 1UFFA 2KYBA 3VS2A 2RF0A 2DF6A 2KE9A 4HCKA 1PHTA 4RTYA 3KFVA 2A37A 1UTIA 2D0NA 1YWPA 2KT1A 4GBQA 2CH4W 2NUZA 1H8KA 1OV3A 2C0IA 1VYTA 2DILA 1S1NA 2DRKA 3VS4A 2C0OA 2YUQA 4Z8AA 3I5RA 2PZ1A 1ZUKA 1T3LA 1M27C 1NYFA 1I0CA 1SRMA 3LH5A 2FRYA 2KRNA 2E5KA 2L3PA 4EIKA 2YSQA 5HCKA 1NEGA 2EGAA 2JT4A 3H0IA 5EC7A 2EYYA 1WA7A 1UHFA 5GJVB 2J06A 2BZ8A 2K9GA 3TVTA 1CKBA 2O31A 2DL7A 2DL3A 1NLPC 2KRMA 5FW9A 4DEYA 1OOTA 3QWYA 2JM9A 4LNPA 2CT4A 2EPDA 2HBWA 3UF4A 1E6HA 4HVUA 3VS1A 2YUNA 1JXOA 1Z9QA 2JTEA 3ZL7C 2JMAA 2YDLA 3UATA 1GFCA 3TSWA 2JXBA 2SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MIO A;  4J9B A;  3RBB B;  2FPF A;  2J7I A;  1PWT A;  2MCN A;  2EVR A;  3M0R A;  2DMO A;  2KYM A;  3H0H A;  2F2V A;  2H8H A;  1E6G A;  2K7A A;  2QDL A;  1WXB A;  1VA7 A;  4J9D A;  1TUC A;  3PVQ A;  2GGR A;  2VVK A;  4JJD A;  3U23 A;  1JXM A;  2ED0 A;  2YUO A;  2KR3 A;  1AEY A;  2RQR A;  3JV3 A;  2ROL A;  4JZ4 A;  1ARK A;  2I0N A;  1EFN A;  4LUE A;  2OI3 A;  4AFZ C;  1GBQ A;  2MOX A;  2FG0 A;  1T0J A;  2A28 A;  4OMM A;  1V1C A;  1AWW A;  4IIM A;  1PKT A;  1NM7 A;  1RLQ C;  2P4R A;  4ORZ A;  1UUE A;  2D8J A;  2K3B A;  5I11 A;  2LQN A;  1WX6 A;  4AFS C;  2L0A A;  1NYG A;  1ZLM A;  2AZV A;  2HDA A;  3NHN A;  1NG2 A;  1Z9Z A;  3M0Q A;  2LCS A;  1QLY A;  3I35 A;  1TG0 A;  2KBT A;  3SEM A;  1ZSG A;  2EQI A;  2CUB A;  3IQL A;  2V1Q A;  2J6K A;  1M8M A;  1K76 A;  4RTU A;  1K1Z A;  1N5Z A;  2JS2 A;  2HSP A;  1FMK A;  3VRY A;  3EG3 A;  4AG2 C;  5IHK A;  1LCK A;  4OMP A;  2ED1 A;  1G2B A;  4HVW A;  4KRT A;  1X2Q A;  2DLP A;  3THK A;  1QKX A;  1WI7 A;  4Z88 A;  2KEA A;  2J6F A;  1W6X A;  2EW3 A;  2K6D A;  2YUP A;  2RQU A;  1GL5 A;  2AZS A;  2EYX A;  2DNU A;  1I1J A;  4IIO A;  1YCS B;  2PTK A;  2RQW A;  2X3X D;  2O9S A;  1VYU A;  3C0C A;  2FPD A;  1SPK A;  2LJ3 A;  1AVZ C;  4RTT A;  4R0K A;  1MV0 B;  3NPF A;  4K11 A;  2YT6 A;  2DM1 A;  1M30 A;  2O2O A;  1U5S A;  2RQV A;  1AWX A;  2CH4 A;  1KSW A;  2BZX A;  5ECA A;  1QKW A;  1H3H A;  1QCF A;  4J9E A;  1OPK A;  1Y0M A;  4CC4 B;  2A36 A;  4Z89 A;  2LQW A;  2ESW A;  1WFW A;  1T0H A;  1UHC A;  1KFZ A;  4JPB W;  1PRM C;  5I22 A;  4Y92 A;  1X6G A;  1U06 A;  1X2K A;  4ESR A;  4LE9 A;  4HXJ A;  2X3W D;  2EGC A;  3NMZ C;  2FEI A;  1K0X A;  1CKA A;  2DYB A;  1GRI A;  2DL5 A;  1JEG A;  1SEM A;  2M51 A;  1X43 A;  5GJW B;  1WIE A;  1JQQ A;  1A0N B;  2AK5 A;  2V1R A;  2GTO A;  3QWX X;  1PNJ A;  1M3B A;  3VS6 A;  1KIK A;  4J9F A;  3TSZ A;  2JS0 A;  4RTZ A;  2D8H A;  1ZUY A;  3VS3 A;  2DX1 A;  2C0T A;  2DE0 X;  3A98 A;  1AD5 A;  1BK2 A;  3O5Z A;  2DJQ A;  1UJY A;  2J05 A;  3M0U A;  2G6F X;  3CQT A;  4ZNX A;  2W0Z A;  1UJ0 A;  4RUG A;  5IHI A;  2L3Q A;  1E7O A;  5L23 A;  2A08 A;  1GCQ A;  1QWF A;  2PNI A;  3H0F A;  2HCK A;  4J9I A;  2IIM A;  2W10 A;  1ZX6 A;  2LX7 A;  2RNA A;  2OJ2 A;  2EGE A;  1HSQ A;  2L3S A;  1U3O A;  1K4U S;  1X6B A;  1PRL C;  1X27 A;  1VYV A;  1AWO A;  1B3Q A;  1JU5 C;  1PKS A;  2XMF A;  2LP5 A;  4A63 B;  4LN2 A;  3REB B;  1QWE A;  1UGV A;  3PVL A;  3FJ5 A;  2D1X A;  2JW4 A;  2FRW A;  2KT8 A;  3I9Q A;  3EG1 A;  3M0T A;  5IXF A;  1H92 A;  1YP5 A;  4F14 A;  2DA9 A;  2RPN A;  1GCP A;  4M4Z A;  3EGU A;  1W70 A;  2DVJ A;  2O88 A;  2BTT A;  3I5S A;  1UEC A;  2FO0 A;  1WXU A;  2RMO A;  3PE0 A;  2EKH A;  3H41 A;  4CC2 A;  4DEX A;  3M0P A;  2FPE A;  3ULR B;  3EG0 A;  2CUD A;  2ABL A;  1SSH A;  4E6R A;  1RLP C;  2DL8 A;  3NGP A;  1UDL A;  2DBK A;  1GCQ C;  2F2W A;  1RI9 A;  4JJB A;  2LJ1 A;  1J3T A;  4QT7 A;  1YNZ A;  1KJW A;  1ZBJ A;  3REA B;  1I07 A;  3UA7 A;  5IH2 A;  1MV3 A;  1Y57 A;  3EHQ A;  2LNH B;  2DBM A;  1WXT A;  3R6N A;  2KRO A;  1AZG B;  2K79 A;  4AG1 C;  1T3S A;  1SHF A;  1WDX A;  4AFQ C;  1AZE A;  2VWF A;  3VRZ A;  1CSK A;  1BB9 A;  1NEB A;  5FWB A;  2HEQ A;  1TUD A;  2RN8 A;  1OEB A;  1AWJ A;  1AOJ A;  3VS7 A;  2ENM A;  1ZUU A;  4J9H A;  4OMO A;  3EHR A;  2AKK A;  4J9G A;  2NWM A;  2EYZ A;  5FWC A;  3VS0 A;  2LJ0 A;  4RTX A;  2VKN A;  4F16 A;  5IHN A;  4OML A;  1MUZ A;  2B86 A;  4GLM A;  1SHG A;  1IO6 A;  3M0S A;  4J9C A;  2ECZ A;  1SRL A;  1UE9 A;  2DL4 A;  2J6O A;  3EG2 A;  1YWO A;  4CC7 A;  2DRM A;  2JMC A;  4X1V A;  2OAW A;  1ABO A;  1BU1 A;  2KXD A;  4F17 A;  1X69 A;  2GTJ A;  1ABQ A;  1JO8 A;  1BBZ A;  1B07 A;  2KXC A;  3SHW A;  2L2P A;  1HJD A;  1XOV A;  1M3A A;  2GBQ A;  2JM8 A;  1GFD A;  1GBR A;  1UG1 A;  5IXB A;  3GBQ A;  1RUW A;  1OPL A;  2LZ6 B;  2CT3 A;  4HVV A;  2CDT A;  1K9A A;  1G83 A;  2CSQ A;  4FSS A;  2CRE A;  4RTW A;  2RQT A;  2GNC A;  2AKL A;  3RNJ A;  2BZY A;  2KNB B;  2CSI A;  2EYW A;  1FYN A;  4RTV A;  2O9V A;  2K2M A;  2ROT A;  1K0S A;  4CC3 A;  2F2X A;  4D8D A;  4D8K A;  4OMN A;  1WLP B;  2M0Y A;  1NLO C;  1HD3 A;  4JJC A;  4JZ3 A;  1M3C A;  3UA6 A;  1YN8 A;  4LUD A;  2GQI A;  1WYX A;  2EBP A;  1W1F A;  2KGT A;  2SRC A;  4AFU C;  3VS5 A;  2KRS A;  2LMJ A;  4WCI A;  4OMQ A;  1UFF A;  2KYB A;  3VS2 A;  2RF0 A;  2DF6 A;  2KE9 A;  4HCK A;  1PHT A;  4RTY A;  3KFV A;  2A37 A;  1UTI A;  2D0N A;  1YWP A;  2KT1 A;  4GBQ A;  2CH4 W;  2NUZ A;  1H8K A;  1OV3 A;  2C0I A;  1VYT A;  2DIL A;  1S1N A;  2DRK A;  3VS4 A;  2C0O A;  2YUQ A;  4Z8A A;  3I5R A;  2PZ1 A;  1ZUK A;  1T3L A;  1M27 C;  1NYF A;  1I0C A;  1SRM A;  3LH5 A;  2FRY A;  2KRN A;  2E5K A;  2L3P A;  4EIK A;  2YSQ A;  5HCK A;  1NEG A;  2EGA A;  2JT4 A;  3H0I A;  5EC7 A;  2EYY A;  1WA7 A;  1UHF A;  5GJV B;  2J06 A;  2BZ8 A;  2K9G A;  3TVT A;  1CKB A;  2O31 A;  2DL7 A;  2DL3 A;  1NLP C;  2KRM A;  5FW9 A;  4DEY A;  1OOT A;  3QWY A;  2JM9 A;  4LNP A;  2CT4 A;  2EPD A;  2HBW A;  3UF4 A;  1E6H A;  4HVU A;  3VS1 A;  2YUN A;  1JXO A;  1Z9Q A;  2JTE A;  3ZL7 C;  2JMA A;  2YDL A;  3UAT A;  1GFC A;  3TSW A;  2JXB A;  2SEM A; 
#chains in the Genus database with same CATH topology
 2MIO A;  5GAN 7;  1XNI A;  3SDZ A;  3RBB B;  4DBF A;  1TTH B;  1JBM A;  2MCN A;  2EVR A;  3CCL Q;  3H0H A;  2F2V A;  2H8H A;  2K7A A;  5KYW B;  2QDL A;  4QW2 A;  1VA7 A;  1GXI E;  2ZPF B;  3U23 A;  1VQK T;  1QVF P;  3CCU Q;  1KG1 A;  1AEY A;  2QQ9 A;  2ROL A;  2QEX Q;  3EAE A;  2MAM A;  4E47 A;  2LTO A;  1EFN A;  5LJ3 d;  2OI3 A;  4AFZ C;  1D3B A;  1T0J A;  2LCL A;  1AWW A;  4PJO F;  2AIR B;  4IIM A;  1ZBX A;  3LWI A;  3HL8 A;  1RLQ C;  4B9X A;  2COZ A;  5GAM h;  3FC3 A;  1G8X A;  3LYI A;  1I81 A;  2OAU A;  2CP7 A;  1NG2 A;  1Z9Z A;  5DLQ E;  3I35 A;  1TG0 A;  2ZPI B;  2KBT A;  1SKU B;  2RJF A;  1ZSG A;  2JZ2 A;  2RK1 A;  1M9S A;  4C8Q F;  2HKQ B;  3OW2 P;  4RTU A;  5GAN h;  2O4X A;  4XU3 A;  1NJI C;  2ZGW A;  4OMP A;  3A8L B;  3MHX A;  3EGX B;  2LT1 A;  2J6F A;  2EJF A;  4IUT A;  2YUP A;  1GL5 A;  4M77 C;  2EYX A;  8ATC B;  2RQW A;  4JRK A;  3OMC A;  2X9H A;  4J7F A;  2ATC B;  1SPK A;  2NUT B;  1YHQ Q;  2LJ3 A;  3BE3 A;  4RTT A;  3LGF A;  2AT1 B;  3SD4 A;  4R0K A;  3NPF A;  2E5Q A;  1Q81 U;  2DM1 A;  3RMQ A;  3ER0 A;  1U5S A;  2WSC E;  1EX4 A;  2BZX A;  1H3H A;  5KYY B;  4J9E A;  1VQ4 A;  1C0M A;  1Y0M A;  3JCM Q;  4M7A E;  2CYZ B;  2A36 A;  4LDX A;  3C95 A;  5FU7 B;  5GAO m;  1MGQ A;  5DM7 R;  1UHC A;  1KFZ A;  2CZ1 B;  5GAN 2;  1X6G A;  5LJ5 g;  2RHZ A;  2Y4Y A;  3H9N A;  3NMZ C;  1Y71 A;  2LRQ A;  2VXF A;  3X24 B;  1S72 Q;  1VQL Q;  3X26 B;  2X4X A;  4BI8 B;  1W4S A;  1VOM A;  5M9O A;  2DIG A;  3P8D A;  2EKO A;  4Y28 E;  2F5T X;  1YI2 T;  3CXC S;  2EQM A;  3J7A F;  1VQ6 Q;  1V76 A;  1A0N B;  2V1R A;  4RCB A;  3CCV Q;  3L2R A;  3CD6 Q;  4RTZ A;  1TXQ A;  3G6E Q;  3VYH B;  1K9M R;  5A0L A;  4GLK A;  1QQJ A;  5LJ3 g;  1BK2 A;  3M55 A;  1UJY A;  2J05 A;  2G6F X;  1R0B G;  4ZNX A;  2W0Z A;  1UJ0 A;  2L3Q A;  3SB2 A;  1FWZ A;  2PNI A;  3H0F A;  4BE0 A;  2IIM A;  1ZX6 A;  2LX7 A;  3RIR A;  5GMK i;  5IN1 A;  3M4G A;  3V8L A;  2M02 A;  1K8A U;  1X6B A;  3HRT A;  1VQN Q;  5HK3 A;  2F69 A;  3OQ5 A;  1WQW A;  2NUT A;  2GCX A;  4A63 B;  2CP3 A;  2PVO B;  1FMW A;  4KT0 E;  1G3S A;  3MO8 A;  3PVL A;  5AYF A;  2M1H A;  3VJP A;  4BY6 B;  2DD4 A;  2M0O A;  3KUF A;  5J39 A;  1OUL A;  2CGH A;  3I55 Q;  3EG1 A;  3M0T A;  9ATC B;  1H92 A;  3LWH A;  4XU1 A;  1OU8 A;  4FT4 A;  3VYG A;  4A54 A;  3FLG A;  3ZFJ A;  4PJJ A;  3N5B B;  4BI3 A;  2ZPH B;  3CCS Q;  2CP6 A;  3I5S A;  1QVG P;  1O9S A;  2DD5 A;  3CCJ A;  2G3R A;  1XQH A;  5KYX B;  2WAC A;  2X4Y A;  2HZY A;  3ULR B;  2LX9 A;  2MK5 A;  4BDY A;  4PJO E;  4BY6 C;  2CUD A;  1M90 C;  4E6R A;  4BAC A;  2XD0 A;  3CC7 T;  4IUR A;  1PD1 A;  3CBM A;  1M2O A;  8AT1 B;  4NOY A;  2DBK A;  1OZ3 A;  2LJ1 A;  3RKY A;  1Q86 R;  3REA B;  3UA7 A;  5GAO q;  4C0F A;  1LJO A;  1G3Y A;  3R6N A;  1VQ8 T;  7AT1 B;  2K79 A;  1MND A;  4AG1 C;  3G71 A;  2COW A;  1SHF A;  4AFQ C;  3VRZ A;  5FWB A;  3MET A;  3M9Q A;  3QYG B;  2KK4 A;  4M7A B;  1AWJ A;  4XTW A;  4OMO A;  1D0Z A;  4J9G A;  3OYN A;  2EYZ A;  3RUX A;  4ELY C;  3CC2 A;  1BI0 A;  1F1B B;  4GLM A;  4O5V A;  1SHG A;  4DQ2 A;  3M0S A;  1SRL A;  3G71 T;  4A4H A;  4M77 G;  1VQP A;  1M90 U;  2J6O A;  3PT9 A;  2BE9 B;  2DRM A;  5CR2 A;  3OYC A;  1VQK Q;  1BI3 A;  4QVD A;  1ABO A;  1BU1 A;  4F17 A;  4M7D G;  5J3B A;  3OW2 A;  1D0Y A;  1ABQ A;  3LX7 A;  3SHW A;  2KXC A;  3JSC A;  4KH0 B;  1RL2 A;  3GBQ A;  2LZ6 B;  4HCZ A;  2XG8 D;  1WZO A;  2CT3 A;  3GIB A;  1R77 A;  3QJ6 A;  4FSS A;  1VQP T;  3NTK A;  4OGE A;  1JJ2 A;  2JVV A;  2DYI A;  3OA6 A;  2E12 A;  1VIE A;  3SWN A;  4FYW B;  2O9V A;  4EMK B;  2F2X A;  3P8B B;  4V2S A;  1KC8 R;  1U1T A;  4D8D A;  3HHT B;  1HD3 A;  1LPL A;  3ME9 A;  4C0G A;  2R5M A;  3L2W A;  1QCO A;  1W1F A;  3C12 A;  1AT1 B;  2SRC A;  4XTX A;  5D6Y A;  1U8R A;  4WCI A;  2HD0 A;  2DXU A;  2HQX A;  5HKC A;  3VS2 A;  4HCK A;  1PHT A;  4RTY A;  5GAM d;  3KFV A;  2HNI A;  2XHC A;  2D0N A;  4M7A A;  1TU0 B;  2CH4 W;  1Q7Y C;  2COY A;  1K73 C;  4PFO A;  1OV3 A;  2C0I A;  1VYT A;  4FU6 A;  3VS4 A;  1KD1 U;  2QAZ A;  4XK8 E;  3JCM e;  4IUP A;  2K4Y A;  1NYF A;  1IRE B;  3LH5 A;  1M2V A;  3OS5 A;  2KRN A;  2QGG A;  4PJL A;  2YRD A;  5GAN d;  4M7A D;  1ZSZ B;  2OX7 A;  1UHF A;  1P92 A;  2J06 A;  2BZ8 A;  4EMH A;  3RKX A;  4PJO B;  4NS5 A;  1NLP C;  4HT9 A;  2RB6 A;  1Q82 U;  3P8H A;  3QWY A;  2X4J A;  5CK9 A;  2RHY A;  4LNP A;  2CT4 A;  2EPD A;  2HBW A;  4HVU A;  2XDD A;  4M75 A;  4Y91 A;  2BUD A;  1PG5 B;  1Z9Q A;  2JTE A;  4J83 A;  2EQK A;  1WHM A;  3QJY A;  2QDY B;  2SEM A;  3S3M A;  5KCO A;  1PM3 A;  1VQ6 T;  2FPF A;  3BDU A;  1PWT A;  5GMK h;  3QZ9 B;  5LL6 S;  4B9W A;  1Q7Y U;  1K73 U;  2K3X A;  1VQ4 Q;  1E6G A;  3CCV T;  3CD6 T;  3FJP A;  4EMK A;  3MEV A;  4PJO C;  1JXM A;  3M56 A;  2ED0 A;  4DOW A;  1MMG A;  2YLB A;  4LUE A;  1PCX A;  4BE1 A;  1MHN A;  4F7U G;  2EFI A;  2A28 A;  4ZTJ A;  4JRP A;  1NM7 A;  1Y96 B;  2P4R A;  4ORZ A;  4LD6 A;  1V29 B;  1QVG A;  4FM4 B;  4M7A F;  3MPU B;  1NYG A;  2AZV A;  4FYY B;  3OW2 S;  3M0Q A;  3X28 B;  1QLY A;  3I55 T;  4MZT A;  2XDP A;  2DO3 A;  1M8M A;  2DKG A;  5FRO A;  2E3I A;  1ZSZ A;  2NLU A;  4XTY A;  1D3B B;  3JB9 I;  1I8F A;  2K5I A;  4A4G A;  4CI0 C;  4AG2 C;  5I2S A;  3CPW P;  2HL5 C;  4DBQ A;  1QKX A;  2QQA A;  2KMT A;  4Z88 A;  2EW3 A;  4C92 E;  1RAD B;  3NFC A;  4L5G A;  2RHU A;  2DNU A;  4IIO A;  5GAM g;  3FEO A;  1YCS B;  5GMK m;  1QVP A;  4PJO D;  1BYM A;  3QBY A;  4JRI A;  1X75 C;  5LJ5 e;  1KHC A;  2E6Z A;  3M5A A;  3C0C A;  3CCM A;  3JB9 H;  3JCM f;  1N8R C;  1KQ1 A;  1UEB A;  2YT6 A;  5DLO A;  1B34 A;  1IGU A;  2P0P A;  5GAN g;  1TS9 A;  4LDY A;  1QKW A;  3CXC A;  3CMA A;  3OYE A;  4Z89 A;  4FT2 A;  3CCJ Q;  1WFW A;  2CZ0 B;  1T0H A;  2HSE B;  5I22 A;  4Y92 A;  5LJ3 e;  3BW1 A;  1U06 A;  1Y96 A;  4NL2 A;  4M78 E;  1X2K A;  1O75 A;  3OS1 A;  4LE9 A;  4HXJ A;  2X3W D;  3QDR B;  2FYK A;  1RAA B;  5HK0 A;  1VIF A;  2VAS A;  2OTL A;  1CKA A;  3CMA T;  1TUG B;  2DYB A;  4JJN K;  2DL5 A;  5EG2 A;  3MP8 A;  2M51 A;  5GJW B;  1JQQ A;  1N8R U;  3CPF A;  1D1C A;  2GTO A;  1PNJ A;  4BDZ A;  5GAN 8;  3INZ A;  4ZGD B;  1QW1 A;  3G71 Q;  1KIK A;  2HQH A;  1NJI R;  4E7H A;  2D8H A;  4ZGE B;  3VS3 A;  4MZP A;  2C0T A;  4MML A;  2QGF B;  1AD5 A;  3O5Z A;  3M0U A;  4LDU A;  4PNO A;  3CQT A;  3CC2 Q;  2A08 A;  3A8M B;  3QYH B;  5L8R E;  1VQP Q;  1Q81 C;  4OVA A;  1WGS A;  1AHJ B;  1WHL A;  2M9U A;  2GFA A;  1AWO A;  3KBG A;  3HRU A;  1U1S A;  2LP5 A;  1WHG A;  2CP5 A;  3V8J A;  2IPO B;  2D1X A;  2BIV A;  3FJ5 A;  3CBP A;  2FRW A;  2RHX A;  2E4H A;  2KT8 A;  3I9Q A;  3OYH A;  3X25 B;  5GAN 4;  1QVG S;  2XIC A;  5LJ5 j;  2RPN A;  4N0A A;  1GCP A;  2K5F A;  4M4Z A;  2EQU A;  3UWN A;  4B6M A;  2QTX A;  3OYY A;  2DVJ A;  2O88 A;  2B8A A;  4YTL A;  2HKN A;  3WVD B;  3ZBD A;  2FO0 A;  1ZA2 B;  3EFO A;  5DY9 A;  2RMO A;  3EGD A;  3PE0 A;  2EKH A;  1VQO A;  3E2U A;  3HP9 A;  2WSF E;  2VGM A;  2E64 A;  1XTD A;  3QII A;  4C92 B;  3GP8 A;  4N4I A;  3L2Z A;  4FYX B;  1SSH A;  1OI1 A;  4KH1 B;  1I4K 1;  2DL8 A;  1MMN A;  4C8Q G;  2BKD N;  5LJ3 j;  2F2W A;  1J3T A;  4QT7 A;  1ZBJ A;  2X4W A;  4WF2 A;  5IH2 A;  3J80 E;  2DBM A;  1VQO T;  3LGL A;  1PC0 A;  4QQG A;  3BFM A;  1AZG B;  3BY7 A;  5HY6 A;  1G3W A;  4KGX B;  4E7S A;  4OP0 A;  1WDX A;  2DJZ A;  1K8A C;  3RES A;  2RJE A;  4L6V 5;  1CSK A;  1UGR B;  1VQ4 T;  4JDS A;  4BI4 A;  1H64 1;  3JCM P;  4PFP A;  3RER A;  3CME A;  4E2F B;  4RTX A;  2HAX A;  2PU9 B;  3G4S A;  3HTR A;  4QVC A;  1NZ9 A;  2ZCF B;  4M75 E;  2B86 A;  2ECZ A;  5C6S A;  3H8Z A;  1UE9 A;  4M78 B;  5FU7 C;  1G5V A;  1WJS A;  1OU9 A;  2LT4 A;  1YIT A;  4GY5 A;  3QDF A;  3CME T;  2LC4 A;  5CKF A;  4JLG A;  1B07 A;  2L2P A;  3DLM A;  2VYT A;  2ZPG B;  2QA4 A;  4M7D A;  2GBQ A;  2GFU A;  1GFD A;  1GBR A;  1Y07 A;  5IXB A;  2DTO A;  4F04 B;  1RUW A;  1OPL A;  2YRV A;  4RG8 A;  5FLX E;  2CDT A;  3FDR A;  1G83 A;  2CSQ A;  3A8G B;  5CKE A;  2RQT A;  1YIJ Q;  1KQS A;  3DKM A;  3RNJ A;  2BZY A;  3ZEH A;  2LQK A;  1FYN A;  2K2M A;  2ROT A;  2RD1 A;  4PFZ A;  2QA4 T;  2EIF A;  4C92 A;  3A8O B;  4OMN A;  2WSE E;  2M0Y A;  1NLO C;  4FW2 A;  4JJC A;  1M3C A;  2Y90 A;  4R55 A;  1R0C B;  2HBP A;  2GQI A;  2EBP A;  4XU0 A;  3OS2 A;  2KGT A;  4C92 D;  4MZM A;  1R8O B;  2DFU A;  4FL6 A;  3HSB A;  1K9M C;  3PFS A;  2KI7 A;  4ME7 A;  2KE9 A;  5GAN 3;  2BE7 D;  3SWN B;  2OTJ A;  1WJQ A;  1N9S A;  2KT1 A;  4GBQ A;  2MWO A;  3OYA A;  4DA4 A;  1S1N A;  1UGP B;  2YUQ A;  1OZ2 A;  4XAX B;  4JUV A;  2FRY A;  2L3P A;  3OMG A;  1BKB A;  4Q5W A;  1QVF A;  4OB1 B;  4M78 A;  3CCJ T;  3H0I A;  1VQ5 A;  2EYY A;  2E65 A;  2OTJ T;  2RA2 A;  3EFR A;  3TVT A;  1CKB A;  4EMG A;  3HRS A;  2DVE A;  3EFS A;  2DL7 A;  2GQV A;  2KRM A;  5FW9 A;  4DEY A;  3GPL A;  2HL3 A;  3SWN C;  2YUN A;  5I2M A;  4M78 D;  3CCM Q;  2JMA A;  1WJR A;  2FL7 A;  2FHD A;  4LXC A;  3TSW A;  1K9M U;  2LNV A;  2LQ8 A;  1M2V B;  2PVG B;  5J26 A;  3M0R A;  3UT1 A;  3CMA Q;  1WXB A;  4C92 F;  1TUC A;  2VVK A;  4X9C A;  2H3E B;  3PMI A;  1ZA1 B;  2RQR A;  3JV3 A;  1ARK A;  4M75 B;  3CC2 T;  4M7A C;  3S3O A;  1I5L A;  2P0Q A;  1Q86 C;  1N27 A;  2MOX A;  4OMM A;  3EG9 A;  1V1C A;  3GNF B;  2OTL Q;  4F7U A;  1PD0 A;  2HMA A;  1PKT A;  2VC8 A;  1KD1 C;  1UUE A;  2D8J A;  2K3B A;  3VUZ A;  2LQN A;  1WX6 A;  2DK3 A;  2L0A A;  2DAQ A;  4JLI A;  1RAF B;  4A4K A;  1ZLM A;  5GAM e;  3NHN A;  1VUB A;  2IG0 A;  2QQR A;  4QQ6 A;  3CC4 A;  3A5Z B;  5GAO p;  3SEM A;  1WHH A;  4M75 C;  1Q82 C;  2EQI A;  2CUB A;  2V1Q A;  2ZPB B;  4M78 F;  3CPW S;  2H3J A;  1K76 A;  3JCM b;  1K1Z A;  2JS2 A;  2HSP A;  3VRY A;  3EG3 A;  5IHK A;  4MDW A;  2LDM A;  1KQS S;  5GAN e;  3MP6 A;  1KHI A;  1SSF A;  4IUQ A;  1X2Q A;  1YCY A;  2DLP A;  4N4H A;  3THK A;  2LVM A;  3CC4 T;  1WI7 A;  1Q86 U;  2KEA A;  1VQ9 A;  1W6X A;  4EMK C;  3LLR A;  4EPC A;  3C4S A;  2RQU A;  2NYS A;  4J6Y A;  2AZS A;  1RAH B;  2FZK B;  3AT1 B;  1I1J A;  3DB4 A;  4HT8 A;  1QP3 A;  2O9S A;  5FU6 B;  2QK0 A;  1YJW A;  1VYU A;  1BI1 A;  3M4Y A;  1KK7 A;  2XK0 A;  2FPD A;  1WPY A;  4ZN3 A;  1AVZ C;  1FMV A;  3GF5 A;  2PQW A;  2XKO C;  4K11 A;  1M4Z A;  1M30 A;  2L5Q A;  1VQ9 T;  2F5K A;  1RAC B;  2RQV A;  1AWX A;  1KSW A;  5ECA A;  3TU4 K;  1KC8 C;  2ZPE B;  4WTO B;  1DJ7 B;  1HXD A;  1BI2 A;  1OPK A;  5FRN A;  4CC4 B;  1YJW T;  2ESW A;  2QAS A;  1VQO Q;  4JPB W;  5FU6 C;  3R6O A;  3E9G A;  1QVF S;  1YJN A;  3QSU A;  2DZC A;  4E7I A;  4ESR A;  4M75 D;  3V8K A;  2EGC A;  2P84 A;  3FB9 A;  1ZSZ C;  1Y7X A;  3C94 A;  2KY9 A;  1B34 B;  1FXX A;  1K0X A;  5GAO l;  1YJ9 A;  2RI5 A;  3CCQ A;  1GRI A;  1JEG A;  1SEM A;  1YIJ A;  6AT1 B;  3DLL A;  4OB2 B;  3MKD A;  1WIE A;  2DTI A;  2RO0 A;  4Z02 A;  3NTI A;  3QHS A;  3QWX X;  1IXD A;  3OB9 A;  2JNG A;  1M3B A;  3D7S B;  4J9F A;  1X01 A;  4E7Z A;  3TSZ A;  1YJN T;  2JS0 A;  1M1K R;  4IKF A;  2MYS A;  3I56 A;  4KGZ B;  3X20 B;  1KC8 U;  3CME Q;  3L2Q A;  3L2U A;  1YJ9 T;  2DET A;  5GAM j;  1OYX A;  1YIJ T;  5IHI A;  4RUG A;  3G4S Q;  1E7O A;  5L23 A;  1M1G A;  2QYZ A;  1GCQ A;  1QWF A;  1HYO A;  4M77 E;  4J9I A;  4DBH A;  4VUB A;  5KH6 A;  2RNA A;  2L3S A;  4HKE A;  1U3O A;  1K4U S;  3I56 T;  4M7D E;  1YIT Q;  1B3Q A;  1JU5 C;  1PKS A;  2FVU A;  2XMF A;  5GAN j;  4LN2 A;  2GF7 A;  2QA4 Q;  2JW4 A;  2XU8 A;  1JRI A;  2R5A A;  2VXE A;  3PIP A;  5IXF A;  1M5Q 1;  3QUI A;  4M75 F;  3UDC A;  2DA9 A;  2PUK B;  3MCA B;  2JUF A;  2R58 A;  2DPP B;  3CCE A;  4II1 A;  1EIF A;  1IRX A;  4E7K A;  4C5H A;  4CRI A;  3H41 A;  4DBR A;  4CC2 A;  2FPE A;  4BB7 A;  2PVD B;  5GAO r;  2ABL A;  1IB8 A;  4PKC C;  1RLP C;  2F1L A;  3OS0 A;  3NGP A;  3Q1J A;  4ZGJ B;  4RMO A;  1UDL A;  3CCE T;  1RI9 A;  4JJB A;  3OSS C;  1I07 A;  2EQJ A;  1Y57 A;  3QZ5 B;  3CCM T;  1RAI B;  2LNH B;  1C6V X;  4C8Q A;  2OTJ Q;  2EAY A;  3OBY A;  1LVK A;  1UGQ B;  2KRO A;  1N6A A;  3EFO B;  1T3S A;  1BIB A;  4IUV A;  3S6W A;  3EGD B;  2VGN A;  2VUB A;  5KYU A;  4ANJ A;  1VQ7 A;  1BB9 A;  3OSV A;  2HEQ A;  3OYF A;  5KE3 A;  2Z0W A;  2RN8 A;  3VS7 A;  2RI2 A;  1Q81 R;  1M1K U;  2ENM A;  1ZUU A;  4J9H A;  3CCR A;  5FWC A;  1VQ5 Q;  3VS0 A;  2LJ0 A;  2RH2 A;  1EZZ B;  4OML A;  4J9C A;  4N0A C;  3GLX A;  2E6N A;  1XJW B;  2DL4 A;  5GAO n;  3EG2 A;  1YWO A;  4CC7 A;  1VQ7 T;  3JB9 G;  4E7L A;  2K57 A;  2OTL T;  2GTJ A;  4KBM B;  2CZ6 B;  3CEY A;  3CCR T;  2EJG A;  4RCC A;  1Q95 G;  1NE8 A;  1UB4 A;  3HPW A;  1HJD A;  1G3T A;  2MPX C;  3V7R A;  2A0F B;  2CZ7 B;  1H3Z A;  2RHI A;  4HVV A;  1K9A A;  4KUD K;  2CRE A;  2CP0 A;  4RTW A;  3A1P A;  3TCJ A;  4PLI A;  1IHV A;  1PSF A;  3V7C A;  2KQW A;  4P5N A;  3JAM E;  2AKL A;  4OB0 B;  2CSI A;  4FSX A;  4RTV A;  1K0S A;  4CC3 A;  1HK9 A;  4F7U E;  4M77 B;  3OYB A;  2V8K A;  4D8K A;  1WLP B;  4FIB A;  1OX8 A;  3T9N A;  1YN8 A;  1D1B A;  4M7D B;  2DZ9 A;  3RDV A;  4PJO G;  3CBO A;  1ACM B;  3QG1 A;  3G1J A;  3WVE B;  3TEE A;  2KRS A;  1K8A R;  3URG A;  1MNE A;  2KYB A;  4JS5 A;  2RF0 A;  3CC4 Q;  1UGS B;  5LJ5 f;  2A37 A;  1YWP A;  4PJM A;  1LOJ A;  1JJ2 P;  4J5Y A;  2NUZ A;  3JCM h;  1H8K A;  5FRM A;  2DIL A;  3ASK A;  3A8H B;  2QG9 B;  3I5R A;  2PZ1 A;  3HKS A;  1ZUK A;  1T3L A;  1B7T A;  4OB3 B;  4M7D C;  1SRM A;  2PUO B;  1TOV A;  1MMD A;  1TWB A;  2YSQ A;  4BD3 A;  1SF9 A;  2EGA A;  3HFN A;  2K2V A;  5EC7 A;  1WA7 A;  5KYW A;  1VQ9 Q;  2DL3 A;  3NTH A;  2E70 A;  1BIA A;  5LJ3 f;  5D6W A;  3UF4 A;  1YJW Q;  1JXO A;  2L89 A;  1W2B P;  4N4G A;  4C92 C;  1NJI U;  1YI2 A;  2YDL A;  3UAT A;  3VUB A;  4L59 A;  2AHJ B;  5IAY A;  2JXB A;  4OMF B;  4J9B A;  1IHW A;  5KYN A;  2J7I A;  4XTZ A;  2A7Y A;  2DMO A;  2KYM A;  4RKU E;  4J9D A;  5GMK e;  4LDV A;  3PVQ A;  2GGR A;  4M77 A;  4JJD A;  3GOX A;  4X9D A;  4J6X A;  2YUO A;  2KR3 A;  4J6W A;  4JZ4 A;  4C0Z A;  2I0N A;  3G4S T;  1YJN Q;  1D09 B;  3CPW A;  1GBQ A;  2QTV A;  2X35 A;  2FG0 A;  2MI6 A;  2KAF A;  4M77 D;  3OYM A;  1D1A A;  3PTA A;  1YJ9 Q;  3CCQ Q;  1YIT T;  2DIQ A;  2KDS A;  4M78 C;  4M7D D;  3EGX A;  5I11 A;  2QI2 A;  2CS7 A;  1M90 R;  4AFS C;  4JRQ A;  2L8D A;  2D6F A;  2HDA A;  1WQ7 A;  2LCS A;  1QMC A;  3I56 Q;  2QQS A;  2DTH A;  3IQL A;  2J6K A;  5A2Q E;  3O8V A;  3PNW C;  1IGQ A;  4QKU A;  3E1S A;  5CCA A;  1N5Z A;  1OQK A;  1FMK A;  3EG9 B;  4D6W A;  3QO3 A;  1LCK A;  4AMC A;  4F7U B;  2P0K A;  2ED1 A;  1G2B A;  4HVW A;  4KRT A;  4XTV A;  1WHK A;  5KYY A;  2YXY A;  4KUL A;  4A4F A;  2Y4X A;  2E3H A;  2K6D A;  4HCB A;  4XTU A;  3CC7 A;  5LJ5 h;  4IUU A;  2PTK A;  2X3X D;  4XQ3 A;  4ZTF A;  1LNX A;  2V8J A;  1VQM A;  2C06 A;  3FIF A;  3PMT A;  3GNG A;  1VQ8 A;  1MV0 B;  1ZQ1 A;  2O2O A;  4M77 F;  3RMS A;  3SFM A;  5GMK l;  5AT1 B;  4KUI A;  2E41 A;  2MMP A;  5I21 A;  3OY9 A;  5IT9 E;  2IVW A;  2CH4 A;  2D0Q B;  3CCE Q;  3CCL A;  1QCF A;  3KXT A;  4UC4 A;  2DER A;  3G7Z A;  3M57 A;  4M7D F;  3L2V A;  1QP2 A;  2LQW A;  1VQM T;  2FZC B;  5LJ3 h;  3CCU A;  3EH2 A;  1KD1 R;  1PRM C;  1VQ5 T;  3FRN A;  2QEX A;  5GMK j;  1N9R A;  1JB0 E;  3TRE A;  1RI0 A;  4C8Q E;  4QVZ A;  4MMK A;  2FEI A;  3CCL T;  2X51 A;  4ZN1 A;  2MF2 A;  1X6O A;  4TVR A;  2DEQ A;  2JN0 A;  3M58 A;  1X43 A;  2YWW A;  3PGG A;  1C1A A;  1Q82 R;  2EYQ A;  2K5L A;  3CCU T;  2AK5 A;  2YHT A;  2QEX T;  2QXF A;  3VS6 A;  5D6X A;  1VQ7 Q;  3M59 A;  3CXC P;  1ZUY A;  4C5E A;  1IZ6 A;  1MMA A;  2DX1 A;  2DE0 X;  3A98 A;  2ZAE A;  2R57 A;  3V7S A;  3OYL A;  3CCR Q;  2DJQ A;  1D0X A;  1Q7Y R;  3OYJ A;  1K73 R;  1SG5 A;  4LD9 K;  2DXC A;  2I2L A;  2O01 E;  2RK2 A;  2VB6 A;  5GAN 5;  2HCK A;  2HQE A;  2W10 A;  1QCN A;  2OJ2 A;  2EGE A;  1HSQ A;  2LCC A;  1PRL C;  1X27 A;  1VYV A;  2NUP B;  3DB3 A;  4MDX A;  5KYX A;  5CKB A;  4C92 G;  3REB B;  1QWE A;  1UGV A;  3JRZ A;  5CKH A;  5KE2 A;  2ZZD A;  3M53 A;  1RAG B;  2KVQ G;  1YHQ A;  1KQ2 A;  3M54 A;  3S3N A;  4DOV A;  1YP5 A;  3JCM c;  3TQ7 P;  3VU3 C;  4F14 A;  2RI3 A;  2RM4 A;  2MWP A;  2A3L A;  3EGU A;  1W70 A;  1TH7 A;  2BTT A;  1UEC A;  1W2B A;  2DEU A;  1WXU A;  3WXM B;  2XI9 A;  4J7I A;  1YHQ T;  4DEX A;  3M0P A;  4FYV B;  3EG0 A;  5KCH A;  5CKD A;  2JOY A;  2RJC A;  3OYK A;  3F70 A;  2DXB A;  4M78 G;  3MJX A;  3QPH A;  4R56 A;  1S72 A;  1GCQ C;  1VQL A;  2K3Y A;  3OBW A;  4PLL A;  1YNZ A;  1KJW A;  2CP2 A;  1MV3 A;  3EHQ A;  2FB7 A;  1WXT A;  3JCM V;  1VQ6 A;  4F7U F;  1YBY A;  1YFN A;  2CKK A;  3LH0 A;  1AZE A;  2VWF A;  3CCV A;  3CD6 A;  1I5O B;  1NEB A;  1TUD A;  3G6E A;  3MEA A;  2QQB A;  1OEB A;  4ELZ C;  3JCM d;  1BCM A;  4LDW A;  3L1A A;  1AOJ A;  4OF1 A;  4PL6 A;  1S72 T;  1VQL T;  1RAE B;  5CQX A;  1BCO A;  3EHR A;  2AKK A;  3AHU A;  2JTM A;  2NWM A;  5CO7 A;  2E10 A;  2VKN A;  4HA8 A;  4F16 A;  2VV5 A;  5IHN A;  2NUP A;  1MUZ A;  4A53 A;  4QQD A;  1IO6 A;  2XDB A;  3L42 A;  1OX9 A;  5A0D A;  4C8Q B;  3RR6 A;  3LW5 E;  3BDL A;  1M8V A;  2JMC A;  4X1V A;  2RJD A;  3G6E T;  2OAW A;  2EWN A;  2KXD A;  2D9T A;  5C0M A;  1YI2 Q;  1VQN A;  1X69 A;  3OYI A;  3CCQ T;  2EJ9 A;  3VV0 A;  1JO8 A;  1BBZ A;  5KYU B;  2V8I A;  4XU2 A;  1XOV A;  2P4T A;  1M3A A;  2JM8 A;  1WNL A;  2XID A;  3E9F A;  4C5I A;  1UG1 A;  4FCY A;  4J8O A;  5GAN 6;  1FX7 A;  1NPP A;  3EH1 A;  3I55 A;  1TSF A;  5GAM f;  4OGC A;  3JCM J;  1N8R R;  3JB9 D;  2GNC A;  3MP1 A;  2YRC A;  4E7J A;  1VQN T;  4FW1 A;  5CQY A;  2KNB B;  4JS4 A;  4C8Q C;  2EYW A;  3J81 E;  2JTF A;  3CCS A;  1WHJ A;  3MEW A;  2KSS A;  2FZG B;  4BE2 A;  2M16 A;  5CIU A;  3UPU A;  4JZ3 A;  4C0D B;  5GAN f;  3UA6 A;  4LUD A;  1WYX A;  2V26 A;  3PIO A;  4PJN A;  1M1F A;  3JCM W;  2L3R A;  4AFU C;  3VS5 A;  1ZHI A;  3H6Z A;  4RG2 A;  1JJ2 S;  1M1K C;  2LMJ A;  4OMQ A;  4PJO A;  4KGV B;  3JCM X;  1UFF A;  3CCS T;  1NBE B;  2DXT A;  4NL3 A;  1RAB B;  4AT1 B;  4M7A G;  2DF6 A;  3OYD A;  1UTI A;  4PK4 A;  1NPR A;  4HCC A;  1KQS P;  2DRK A;  3E19 A;  2C0O A;  4Z8A A;  4C0D C;  5D7U A;  1M27 C;  3HFO A;  1I0C A;  4BUG A;  5CVI A;  2E5K A;  4EIK A;  1PSE A;  3MEU A;  5HCK A;  1NEG A;  2JT4 A;  5CAI A;  4C5G A;  2JJ9 A;  2O4X B;  5GJV B;  4EDU A;  2K9G A;  1W2B S;  3CC7 Q;  4O6J A;  2O31 A;  3VKI A;  4A4E A;  4M75 G;  3RKW A;  1OOT A;  3JB9 F;  3JB9 J;  2E1H A;  2JM9 A;  4X34 A;  3OYG A;  1E6H A;  1VQM Q;  3VS1 A;  3QKJ A;  1VQK A;  4C8Q D;  5LJ5 d;  3ZL7 C;  1VQ8 Q;  5A0G A;  1GFC A;  3QXE B;  2YLC A;  4ATO A;  3JCM g; 
#chains in the Genus database with same CATH homology
 2MIO A;  4J9B A;  3RBB B;  2FPF A;  2J7I A;  1PWT A;  2MCN A;  2EVR A;  3M0R A;  2DMO A;  2KYM A;  3H0H A;  2F2V A;  2H8H A;  1E6G A;  2K7A A;  2QDL A;  1WXB A;  1VA7 A;  4J9D A;  1TUC A;  3PVQ A;  2GGR A;  2VVK A;  4JJD A;  3U23 A;  1JXM A;  2ED0 A;  2YUO A;  2KR3 A;  1AEY A;  2RQR A;  3JV3 A;  2ROL A;  4JZ4 A;  1ARK A;  2I0N A;  1EFN A;  4LUE A;  2OI3 A;  4AFZ C;  1GBQ A;  2MOX A;  2FG0 A;  1T0J A;  2A28 A;  4OMM A;  1V1C A;  1AWW A;  4IIM A;  1PKT A;  1NM7 A;  1RLQ C;  2P4R A;  4ORZ A;  1UUE A;  2D8J A;  2K3B A;  5I11 A;  2LQN A;  1WX6 A;  4AFS C;  2L0A A;  1NYG A;  1ZLM A;  2AZV A;  2HDA A;  3NHN A;  1NG2 A;  1Z9Z A;  3M0Q A;  2LCS A;  1QLY A;  3I35 A;  1TG0 A;  2KBT A;  3SEM A;  1ZSG A;  2EQI A;  2CUB A;  3IQL A;  2V1Q A;  2J6K A;  1M8M A;  1K76 A;  4RTU A;  1K1Z A;  1N5Z A;  2JS2 A;  2HSP A;  1FMK A;  3VRY A;  3EG3 A;  4AG2 C;  5IHK A;  1LCK A;  4OMP A;  2ED1 A;  1G2B A;  4HVW A;  4KRT A;  1X2Q A;  2DLP A;  3THK A;  1QKX A;  1WI7 A;  4Z88 A;  2KEA A;  2J6F A;  1W6X A;  2EW3 A;  2K6D A;  2YUP A;  2RQU A;  1GL5 A;  2AZS A;  2EYX A;  2DNU A;  1I1J A;  4IIO A;  1YCS B;  2PTK A;  2RQW A;  2X3X D;  2O9S A;  1VYU A;  3C0C A;  2FPD A;  1SPK A;  2LJ3 A;  1AVZ C;  4RTT A;  4R0K A;  1MV0 B;  3NPF A;  4K11 A;  2YT6 A;  2DM1 A;  1M30 A;  2O2O A;  1U5S A;  2RQV A;  1AWX A;  2CH4 A;  1KSW A;  2BZX A;  5ECA A;  1QKW A;  1H3H A;  1QCF A;  4J9E A;  1OPK A;  1Y0M A;  4CC4 B;  2A36 A;  4Z89 A;  2LQW A;  2ESW A;  1WFW A;  1T0H A;  1UHC A;  1KFZ A;  4JPB W;  1PRM C;  5I22 A;  4Y92 A;  1X6G A;  1U06 A;  1X2K A;  4ESR A;  4LE9 A;  4HXJ A;  2X3W D;  2EGC A;  3NMZ C;  2FEI A;  1K0X A;  1CKA A;  2DYB A;  1GRI A;  2DL5 A;  1JEG A;  1SEM A;  2M51 A;  1X43 A;  5GJW B;  1WIE A;  1JQQ A;  1A0N B;  2AK5 A;  2V1R A;  2GTO A;  3QWX X;  1PNJ A;  1M3B A;  3VS6 A;  1KIK A;  4J9F A;  3TSZ A;  2JS0 A;  4RTZ A;  2D8H A;  1ZUY A;  3VS3 A;  2DX1 A;  2C0T A;  2DE0 X;  3A98 A;  1AD5 A;  1BK2 A;  3O5Z A;  2DJQ A;  1UJY A;  2J05 A;  3M0U A;  2G6F X;  3CQT A;  4ZNX A;  2W0Z A;  1UJ0 A;  4RUG A;  5IHI A;  2L3Q A;  1E7O A;  5L23 A;  2A08 A;  1GCQ A;  1QWF A;  2PNI A;  3H0F A;  2HCK A;  4J9I A;  2IIM A;  2W10 A;  1ZX6 A;  2LX7 A;  2RNA A;  2OJ2 A;  2EGE A;  1HSQ A;  2L3S A;  1U3O A;  1K4U S;  1X6B A;  1PRL C;  1X27 A;  1VYV A;  1AWO A;  1B3Q A;  1JU5 C;  1PKS A;  2XMF A;  2LP5 A;  4A63 B;  4LN2 A;  3REB B;  1QWE A;  1UGV A;  3PVL A;  3FJ5 A;  2D1X A;  2JW4 A;  2FRW A;  2KT8 A;  3I9Q A;  3EG1 A;  3M0T A;  5IXF A;  1H92 A;  1YP5 A;  4F14 A;  2DA9 A;  2RPN A;  1GCP A;  4M4Z A;  3EGU A;  1W70 A;  2DVJ A;  2O88 A;  2BTT A;  3I5S A;  1UEC A;  2FO0 A;  1WXU A;  2RMO A;  3PE0 A;  2EKH A;  3H41 A;  4CC2 A;  4DEX A;  3M0P A;  2FPE A;  3ULR B;  3EG0 A;  2CUD A;  2ABL A;  1SSH A;  4E6R A;  1RLP C;  2DL8 A;  3NGP A;  1UDL A;  2DBK A;  1GCQ C;  2F2W A;  1RI9 A;  4JJB A;  2LJ1 A;  1J3T A;  4QT7 A;  1YNZ A;  1KJW A;  1ZBJ A;  3REA B;  1I07 A;  3UA7 A;  5IH2 A;  1MV3 A;  1Y57 A;  3EHQ A;  2LNH B;  2DBM A;  1WXT A;  3R6N A;  2KRO A;  1AZG B;  2K79 A;  4AG1 C;  1T3S A;  1SHF A;  1WDX A;  4AFQ C;  1AZE A;  2VWF A;  3VRZ A;  1CSK A;  1BB9 A;  1NEB A;  5FWB A;  2HEQ A;  1TUD A;  2RN8 A;  1OEB A;  1AWJ A;  1AOJ A;  3VS7 A;  2ENM A;  1ZUU A;  4J9H A;  4OMO A;  3EHR A;  2AKK A;  4J9G A;  2NWM A;  2EYZ A;  5FWC A;  3VS0 A;  2LJ0 A;  4RTX A;  2VKN A;  4F16 A;  5IHN A;  4OML A;  1MUZ A;  2B86 A;  4GLM A;  1SHG A;  1IO6 A;  3M0S A;  4J9C A;  2ECZ A;  1SRL A;  1UE9 A;  2DL4 A;  2J6O A;  3EG2 A;  1YWO A;  4CC7 A;  2DRM A;  2JMC A;  4X1V A;  2OAW A;  1ABO A;  1BU1 A;  2KXD A;  4F17 A;  1X69 A;  2GTJ A;  1ABQ A;  1JO8 A;  1BBZ A;  1B07 A;  2KXC A;  3SHW A;  2L2P A;  1HJD A;  1XOV A;  1M3A A;  2GBQ A;  2JM8 A;  1GFD A;  1GBR A;  1UG1 A;  5IXB A;  3GBQ A;  1RUW A;  1OPL A;  2LZ6 B;  2CT3 A;  4HVV A;  2CDT A;  1K9A A;  1G83 A;  2CSQ A;  4FSS A;  2CRE A;  4RTW A;  2RQT A;  2GNC A;  2AKL A;  3RNJ A;  2BZY A;  2KNB B;  2CSI A;  2EYW A;  1FYN A;  4RTV A;  2O9V A;  2K2M A;  2ROT A;  1K0S A;  4CC3 A;  2F2X A;  4D8D A;  4D8K A;  4OMN A;  1WLP B;  2M0Y A;  1NLO C;  1HD3 A;  4JJC A;  4JZ3 A;  1M3C A;  3UA6 A;  1YN8 A;  4LUD A;  2GQI A;  1WYX A;  2EBP A;  1W1F A;  2KGT A;  2SRC A;  4AFU C;  3VS5 A;  2KRS A;  2LMJ A;  4WCI A;  4OMQ A;  1UFF A;  2KYB A;  3VS2 A;  2RF0 A;  2DF6 A;  2KE9 A;  4HCK A;  1PHT A;  4RTY A;  3KFV A;  2A37 A;  1UTI A;  2D0N A;  1YWP A;  2KT1 A;  4GBQ A;  2CH4 W;  2NUZ A;  1H8K A;  1OV3 A;  2C0I A;  1VYT A;  2DIL A;  1S1N A;  2DRK A;  3VS4 A;  2C0O A;  2YUQ A;  4Z8A A;  3I5R A;  2PZ1 A;  1ZUK A;  1T3L A;  1M27 C;  1NYF A;  1I0C A;  1SRM A;  3LH5 A;  2FRY A;  2KRN A;  2E5K A;  2L3P A;  4EIK A;  2YSQ A;  5HCK A;  1NEG A;  2EGA A;  2JT4 A;  3H0I A;  5EC7 A;  2EYY A;  1WA7 A;  1UHF A;  5GJV B;  2J06 A;  2BZ8 A;  2K9G A;  3TVT A;  1CKB A;  2O31 A;  2DL7 A;  2DL3 A;  1NLP C;  2KRM A;  5FW9 A;  4DEY A;  1OOT A;  3QWY A;  2JM9 A;  4LNP A;  2CT4 A;  2EPD A;  2HBW A;  3UF4 A;  1E6H A;  4HVU A;  3VS1 A;  2YUN A;  1JXO A;  1Z9Q A;  2JTE A;  3ZL7 C;  2JMA A;  2YDL A;  3UAT A;  1GFC A;  3TSW A;  2JXB A;  2SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...