3EG1A

Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg1A00
2DVJA 2ROLA 2JXBA 2L3PA 2IIMA 1GBRA 1ZSGA 2JTEA 2EGAA 4AFZC 2D8HA 3M0TA 2O88A 2AZVA 5FWCA 4D8KA 2VWFA 4M4ZA 2KRMA 4F16A 1MV3A 2OAWA 3C0CA 2GNCA 2A36A 4ZNXA 3VS2A 5IXBA 3M0UA 3GBQA 2C0TA 2DNUA 1X6GA 3I35A 4AFQC 3REBB 2DJQA 2RQWA 2EPDA 1A0NB 1NYFA 3NMZC 1WFWA 1G2BA 2HDAA 3M0RA 1OEBA 1TUCA 1SPKA 1BU1A 5IHNA 1ZUKA 1AZEA 1GBQA 3EHRA 3FJ5A 1NLOC 2RF0A 1W70A 2K7AA 2YUQA 2GBQA 2JMCA 2OJ2A 1U3OA 2DL7A 2KRSA 2G6FX 3U23A 1UJYA 1KIKA 2EGEA 2DRKA 4A63B 2A28A 1GL5A 3I5RA 2LMJA 2SRCA 1X6BA 4ESRA 1QWFA 1JU5C 2AKLA 2O31A 1GCQA 2W10A 4CC7A 2O9SA 3M0SA 3PVLA 3ULRB 1KJWA 2GQIA 4WCIA 5FW9A 4LE9A 1UE9A 1K4US 1SRMA 2RQUA 1X2QA 1OOTA 1MV0B 1QLYA 4GLMA 1U06A 2J7IA 2BZ8A 2A08A 5I11A 2X3WD 1QCFA 2DL5A 3QWXX 4Z8AA 2CUDA 1WXTA 3SEMA 2PZ1A 2AZSA 2KR3A 1YWOA 3TSZA 1E7OA 1W1FA 1M3AA 2RQRA 1NYGA 2EBPA 1Y57A 2DILA 2DX1A 1HJDA 2CH4A 3UA7A 2KT1A 1H8KA 2V1QA 2EKHA 1U5SA 2RNAA 1AD5A 1X27A 2GTJA 3NPFA 1BK2A 2EYZA 4IIMA 4JPBW 1IO6A 2LP5A 3H41A 2YSQA 1AWWA 1K0XA 5EC7A 2CUBA 4Z88A 1GRIA 1WDXA 3NHNA 4IIOA 2JS0A 4HXJA 4OMPA 4OMNA 2F2VA 4HVVA 1ZX6A 4RUGA 1UFFA 4K11A 1OV3A 1Y0MA 1AWXA 1YN8A 2F2WA 3VS4A 1M30A 1VA7A 4JJBA 2J6OA 2RMOA 1UTIA 1ZBJA 2NWMA 2CSIA 2L0AA 1M3CA 2KROA 3VS5A 1V1CA 2J05A 1I0CA 2MCNA 2JT4A 3THKA 2QDLA 3EG0A 2KXDA 2AK5A 4AG2C 2F2XA 2OI3A 2LNHB 1TUDA 2DL4A 1VYTA 1UUEA 3EG1A 1JXMA 1UJ0A 2DMOA 1YNZA 1E6GA 2KNBB 1T0JA 2BTTA 2E5KA 4GBQA 3RNJA 1SHGA 1GFDA 2DBMA 1WYXA 2XMFA 2EVRA 1PKSA 4F14A 2VVKA 1H3HA 1X43A 1M27C 2CSQA 3IQLA 4J9HA 4KRTA 3VS7A 1W6XA 1UDLA 2DRMA 2L3SA 1FYNA 1NM7A 1NEGA 2M51A 1AEYA 2DYBA 2D1XA 2LQNA 1CSKA 3I9QA 3JV3A 2C0IA 2ED1A 4JZ4A 2CDTA 3LH5A 2HEQA 1OPLA 2MIOA 4OMQA 1RLQC 2ESWA 2DF6A 1T0HA 1YCSB 4EIKA 3PE0A 2AKKA 2GTOA 1RUWA 1ZUUA 1AVZC 4LNPA 3TSWA 2GGRA 3NGPA 1VYVA 1EFNA 5GJVB 1WX6A 3ZL7C 2EW3A 2FRYA 2ECZA 1UHCA 2FEIA 2A37A 2FPDA 4JJCA 4HVUA 2DE0X 1HD3A 3EGUA 3EG3A 2DLPA 1JO8A 2CT4A 2KGTA 4HCKA 4J9FA 1WI7A 1X69A 5ECAA 5FWBA 3EG2A 2PTKA 5HCKA 2BZXA 2KEAA 1B07A 3VRYA 1PHTA 4OMLA 2PNIA 1WIEA 2KE9A 2DBKA 1RLPC 1N5ZA 5GJWB 5L23A 4ORZA 1ZLMA 2YUNA 2ENMA 4J9GA 1PNJA 2L3QA 5IXFA 2K79A 4J9IA 4FSSA 1MUZA 2RQVA 3RBBB 2JW4A 1BBZA 4JZ3A 4AG1C 3TVTA 2EGCA 4RTWA 1AWOA 4RTUA 4CC3A 2K9GA 3R6NA 2DM1A 2NUZA 2ROTA 2K2MA 3M0QA 2FO0A 1PWTA 2X3XD 2FPEA 4AFUC 1K9AA 2D0NA 4J9CA 4HVWA 1JXOA 1PKTA 2KBTA 5IHIA 1RI9A 4R0KA 1B3QA 1XOVA 2VKNA 2HCKA 5IHKA 4J9EA 3H0HA 3I5SA 5I22A 1AOJA 3UA6A 2EYXA 2J6FA 2KRNA 2BZYA 1E6HA 2I0NA 1GFCA 4J9BA 1GCPA 3VS3A 1Z9QA 2YUPA 2LJ0A 2O2OA 4D8DA 2EYYA 1J3TA 2FG0A 3VRZA 1UG1A 2YDLA 4LUEA 1UGVA 4RTVA 1WA7A 1M8MA 1NLPC 2M0YA 1K1ZA 1ZUYA 2SEMA 2LJ1A 3QWYA 4JJDA 2JS2A 4RTZA 3PVQA 2EQIA 1TG0A 4RTXA 3H0IA 1PRMC 1SEMA 2CREA 3SHWA 2KXCA 4QT7A 1YP5A 1QKXA 3EHQA 3VS0A 1WXUA 2CH4W 1AWJA 2ABLA 2DL8A 1YWPA 5IH2A 1WLPB 3H0FA 1BB9A 1UECA 4DEYA 1S1NA 2H8HA 2ED0A 2HSPA 1JQQA 1ABQA 2J06A 4X1VA 1UHFA 1AZGB 1T3LA 2LX7A 2K3BA 1K0SA 2FPFA 1VYUA 4OMOA 2RQTA 3UATA 2RPNA 2KYMA 3A98A 1KFZA 2LZ6B 1M3BA 4Y92A 4CC4B 2YT6A 1SRLA 1SSHA 3REAB 2CT3A 1ABOA 3VS1A 2O9VA 3CQTA 4Z89A 2B86A 2V1RA 2W0ZA 1NEBA 4E6RA 3KFVA 4LUDA 2KT8A 4CC2A 1KSWA 1SHFA 1T3SA 2J6KA 2JM8A 4F17A 1HSQA 2K6DA 2JM9A 1QKWA 2P4RA 1H92A 1X2KA 1JEGA 1GCQC 2C0OA 4DEXA 2RN8A 2LCSA 1I07A 1CKAA 1WXBA 2D8JA 4OMMA 1FMKA 1I1JA 3UF4A 4J9DA 2DA9A 1K76A 4LN2A 1QWEA 1ARKA 4AFSC 1Z9ZA 2YUOA 2JMAA 2FRWA 3M0PA 1LCKA 2HBWA 1OPKA 4RTYA 3O5ZA 1NG2A 2EYWA 2L2PA 1CKBA 1G83A 2LQWA 2LJ3A 2KYBA 4RTTA 2DL3A 3VS6A 2MOXA 1PRLC
chains in the Genus database with same CATH superfamily
1D0YA 3OS1A 3MEUA 5FRNA 2JXBA 3CCLQ 4MDXA 4BUGA 3CMET 2KQWA 4L59A 2VWFA 2XICA 4F16A 1MV3A 1KQSP 1H3ZA 2ZPBB 4M75D 2XDDA 1JRIA 2CP6A 1YHQA 1M1KU 2X4YA 3MEVA 4N4IA 1IRXA 3I35A 4AFQC 3GPLA 2QGFB 2O4XA 4QKUA 3NMZC 4A4EA 1WFWA 2D0QB 2RJEA 3CMEQ 4OP0A 1OEBA 3CCLT 3CCJA 1TWBA 3OYJA 1VQ6A 5KYXA 5IHNA 1TH7A 1ZUKA 4JRIA 5LJ5j 3I56Q 1TOVA 3OB9A 3EH2A 1UGSB 2AIRB 1BI3A 4M77G 1I81A 2V8KA 3RDVA 5KYYA 1YITT 2AT1B 1U3OA 2DL7A 3M4GA 1G3YA 1KIKA 2EGEA 4X34A 2QTXA 1GL5A 3I5RA 2LMJA 2K3YA 2SRCA 4C5HA 2KI7A 2OTJT 4PFZA 4Y28E 1YJNT 1OX8A 3PVLA 3JCMV 4OF1A 4F7UG 5FW9A 4XU3A 4LE9A 1ZBXA 3CD6T 4C92D 1SRMA 3VYHB 1OYXA 3V8LA 3FIFA 3KUFA 3PGGA 4Q5WA 1HK9A 1RAGB 1X2QA 1OOTA 1KC8C 3VJPA 2NUTB 2BZ8A 2VASA 3QWXX 4Z8AA 2CUDA 1WXTA 2GFUA 2COZA 2KR3A 3TQ7P 1YWOA 4X9DA 1IHVA 1KD1R 4ZGDB 1UB4A 2LT4A 4PFOA 1W1FA 4BDYA 4E7IA 1M3AA 2EBPA 1I5LA 3L1AA 1UGQB 2DILA 4XAXB 3S3MA 1N8RC 2KT1A 2QQRA 1WJQA 2V1QA 2EKHA 3DB3A 3PMIA 1X6OA 1AD5A 3GNGA 1G3WA 4OGCA 3L2UA 1IO6A 3CCQA 1KD1U 1Q7YC 3H41A 4E7KA 1K0XA 5EC7A 3SWNC 2F5TX 3SWNA 2DD4A 1K8AR 2RHYA 3NHNA 2JS0A 2LCCA 5I2SA 4HXJA 3OYYA 3JB9I 4OMPA 2CZ7B 2KSSA 4NS5A 1N27A 4E7LA 1JJ2S 4K11A 1Y0MA 2XG8D 1NPRA 4KH1B 3BE3A 1RAHB 4QVZA 5HY6A 4JJNK 2KVQG 2RMOA 2WSCE 1VQ4T 1ZBJA 2LX9A 2CSIA 2L0AA 1M3CA 4OMFB 2KROA 1I0CA 3PNWC 2LCLA 3THKA 4M77D 4FYYB 4B9WA 1D3BB 2QGGA 4PJNA 4OGEA 2F2XA 2OI3A 1TUDA 4LD6A 1VYTA 3EG9B 1UUEA 3OS2A 4HA8A 1UJ0A 4MMKA 2QDYB 1SKUB 1YNZA 4J8OA 1E6GA 4J6WA 1VQNA 2BTTA 2HQEA 3KXTA 3RR6A 3TREA 4C8QF 1QVFP 1GFDA 2DBMA 4C92F 4UC4A 3HRSA 2DO3A 3FDRA 2DETA 4KRTA 3IQLA 4XU2A 1UDLA 2DRMA 2DZCA 1FYNA 5GAOp 3V8KA 4IKFA 3OW2P 2ZGWA 3PTAA 3GLXA 2D1XA 2LQNA 1MMAA 3I9QA 2EQKA 3HFOA 3ZBDA 4HKEA 1VQNT 3CCEA 2ZZDA 5AYFA 1QVGA 4FIBA 4EPCA 1Y96B 5IN1A 3CCET 4ZN1A 1YCSB 1QCOA 4NL2A 1D0XA 2GTOA 1F1BB 4BE1A 2HQHA 1AVZC 2MMPA 3TSWA 2GGRA 1MNEA 1WNLA 4X9CA 1X75C 5FROA 3OW2S 5GJVB 2QA4Q 4JJCA 3M4YA 2RH2A 3MO8A 4HVUA 1WHJA 1MGQA 3EG3A 1S72A 1K8AC 1JO8A 2OTLA 4HCKA 1VQOA 3G1JA 2DTIA 3FB9A 5ECAA 4E47A 2DXBA 4D6WA 3C4SA 3EG2A 4FU6A 1K73R 3CCUQ 1DJ7B 5DLQE 1RAFB 2BZXA 3QUIA 2ZCFB 5D6XA 4OMLA 2KE9A 3TCJA 2DBKA 2FZCB 4M78A 1TSFA 3LYIA 5GJWB 2KK4A 4ORZA 2ENMA 2L3QA 4N4GA 5IXFA 3H8ZA 4E7HA 2K79A 2QAZA 4LDYA 1MUZA 2LQ8A 4IUQA 4JZ3A 1PD1A 2G3RA 4AG1C 4A4FA 3PIOA 3NTHA 5A2QE 2ROTA 2K2MA 4ATOA 1PWTA 2EKOA 2X3XD 4J9CA 2D0NA 5GANg 1D1BA 4XU1A 2E6ZA 2ZPIB 5IHIA 4NL3A 2E1HA 1XOVA 2HCKA 2KDSA 2D9TA 4R56A 4O6JA 3OYMA 1AOJA 3UA6A 1YJWA 5CKBA 2HKNA 1IGQA 4A54A 1Z9QA 3CC7A 3OW2A 3G4SA 5GAOm 3QZ5B 4PK4A 2YDLA 3OYDA 3L2QA 4BACA 1M8MA 1NLPC 1ZUYA 3M5AA 3JCMQ 1TS9A 5AT1B 1QVGS 2EQJA 2FL7A 3PVQA 4C0GA 2EQIA 3JAME 1VQ9T 5LJ3e 4J6YA 1TG0A 2HL5C 4RTXA 1SEMA 3M59A 1VQMQ 1YP5A 2Z0WA 3OS5A 4L6V5 1AWJA 1LNXA 1WGSA 3Q1JA 5KYNA 4PJOC 4F04B 5HK3A 5GAN8 1K73U 2QQ9A 2DXCA 1UECA 1S1NA 2DXTA 2O4XB 1YIJA 1IXDA 1UHFA 1NZ9A 4PKCC 2F69A 1K0SA 2FPFA 1VYUA 3V7CA 5CK9A 3BY7A 3UATA 2KYMA 2CP5A 1P92A 3E9GA 3CCMA 4PJOG 2AHJB 2NUPB 4CC4B 5GAOq 3OS0A 1M1GA 3OYHA 3CPWP 2CT3A 1V29B 3QO3A 2E6NA 4Z89A 2B86A 4B6MA 2P84A 1NEBA 2KT8A 1YCYA 3MP8A 2J6KA 5GANe 4M7AG 3VKIA 1VQ4Q 5FU7C 2JM9A 3J80E 2DTHA 1JEGA 2DD5A 1GCQC 2DEUA 2C0OA 4XU0A 4PJOE 2RN8A 3HRUA 2EFIA 1WQ7A 1WXBA 1I1JA 4DBHA 2K57A 1K76A 2CZ1B 4OVAA 3CCUA 4E2FB 5GANf 2JJ9A 3G71A 5CAIA 2FRWA 3CBOA 1KK7A 3HP9A 1Q81R 3O5ZA 1NG2A 2EQUA 4BY6B 1G83A 1RAIB 2FZGB 1VQPQ 5KYUB 3VS6A 1IHWA 3PMTA 4M75E 3P8HA 5CQYA 1NJIR 2L3PA 1ZSGA 2JTEA 4AFZC 2AZVA 4D8KA 2KRMA 3CCRT 2A3LA 4FCYA 2QASA 4HCCA 3OYFA 2PU9B 1S72Q 2A36A 3VS2A 5IXBA 1FXXA 3GF5A 1YIJT 2HL3A 2C0TA 3BDLA 1X6GA 3LH0A 3CCEQ 1GXIE 2EPDA 2JN0A 4PJOA 1NYFA 3P8DA 1G2BA 3SWNB 3VYGA 1TUCA 4OB3B 4CRIA 2HZYA 1BU1A 1MMGA 2GFAA 3CCVT 2QTVA 3G6ET 3EHRA 1K9MR 3H9NA 2DAQA 3RMSA 4C5GA 8ATCB 2F5KA 3CD6A 2OJ2A 2GQVA 4M75A 3WVEB 1UJYA 2A7YA 1TU0B 2E5QA 2DRKA 5FLXE 2A28A 3L2VA 4QQGA 3CPWS 1WZOA 1YBYA 2QEXT 2RHIA 1XQHA 1JU5C 2W10A 2O31A 1GCQA 3ME9A 1VQ7A 2O9SA 3LLRA 1VQ9Q 2DYIA 3OYAA 1WHKA 4VUBA 5GAN5 2Y4XA 2XDBA 5LJ3j 2RQUA 4A4HA 2GCXA 1KQSA 1OULA 1MV0B 3EAEA 5I11A 2X3WD 2DL5A 2NYSA 3CPWA 3SEMA 2BUDA 4TVRA 2LT1A 2QEXQ 1E7OA 5GANd 2DERA 1WPYA 2CP3A 4IUVA 5J3BA 3EFRA 2D6FA 4DOWA 3RIRA 1KD1C 3JB9H 4M77F 4XTYA 4OB0B 4JS5A 3WXMB 2K5LA 3QKJA 1JJ2P 1IB8A 1YI2A 3UA7A 4KULA 1I5OB 2CP2A 3HRTA 5HKCA 4J5YA 3NPFA 4IIMA 4JLGA 1R8OB 3CXCP 4FSXA 4JPBW 4M77A 1QW1A 4EMGA 4HT9A 3FLGA 1GRIA 4C92B 2XIDA 2K5FA 2F2VA 2OTJA 1WJRA 2X35A 1UFFA 1MNDA 8AT1B 2IVWA 1YN8A 3JCMh 3OA6A 1Q86C 2P4TA 1VA7A 1N8RR 3D7SB 3LWIA 1UTIA 1YHQT 2NWMA 1VQ6T 1B34A 3CCVA 5LJ3d 1FX7A 3M54A 2E41A 1ZA2B 2QA4T 5CR2A 2VUBA 2KXDA 2AK5A 3E19A 2DMOA 3CC2T 1D1AA 4Z02A 1EZZB 1KC8R 1M2OA 4C92E 5LJ3f 1T0JA 4GBQA 3OYBA 4M75F 4M75G 1WYXA 1LOJA 1U1TA 3EFSA 1YITA 4ELZC 5GANh 1YJ9Q 4J9HA 3VS7A 3CCJQ 1NM7A 1NEGA 2PUKB 3A8LB 1AEYA 2DPPB 1CSKA 4PJLA 1VQKQ 2K5IA 3L2ZA 3O8VA 2C0IA 2CDTA 3QBYA 2HEQA 1OPLA 1RLQC 1T0HA 3A8OB 4EIKA 1N9SA 1ZUUA 2QQSA 2WACA 3QSUA 2CZ0B 3H6ZA 3EG9A 4FYXB 1Y07A 4HCZA 1NE8A 2ECZA 1PCXA 2CKKA 4J7FA 2DE0X 3DLLA 1X01A 1HD3A 3EGUA 2DLPA 2NLUA 3L2WA 2RO0A 4ELYC 1ACMB 2KMTA 5LJ3h 1NBEB 3MPUB 1VIEA 4GLKA 5CQXA 1PM3A 2KEAA 4M7DC 1PHTA 4M7DA 2RJDA 3G6EQ 1RLPC 3CCQQ 1VQ8A 2LRQA 3X24B 2RI2A 1N5ZA 1XNIA 1ZLMA 1PNJA 4V2SA 4F7UF 4J9IA 5GAN6 2V8JA 1I4K1 2JW4A 1BBZA 4MDWA 1VQ4A 2VC8A 4FL6A 4RTWA 5GAN7 4CC3A 4FW1A 1UGRB 2NUZA 3M0QA 4AFUC 3UDCA 1JXOA 2XK0A 1RI9A 1M90C 1B3QA 1UGPB 1PSFA 5A0DA 3H0HA 5I22A 4PJOF 1V76A 4JRPA 2EYXA 2BZYA 2L89A 2JUFA 2I0NA 1Q86R 2FYKA 4J9BA 1GCPA 2RJCA 2YUPA 2O2OA 1TTHB 2PUOB 1PG5B 1KHCA 1YIJQ 1W2BA 1Y71A 1UG1A 4LUEA 4E7SA 1WA7A 1KQSS 2EQMA 4AT1B 4WF2A 3JCMg 2SEMA 1QVPA 3X28B 2E12A 4QVCA 2JZ2A 2RK2A 1EIFA 1VQPA 4QT7A 4OB1B 1QKXA 2CH4W 1VQOT 3HL8A 4KGVB 2VGMA 3VUBA 2P0QA 4QW2A 3HSBA 1YWPA 3URGA 1XJWB 2XHCA 4ZTJA 4M7AF 3FJPA 4LDUA 3I55Q 2DEQA 5CKHA 1RAAB 4PJOB 4X1VA 1KQ2A 3CC7Q 1T3LA 1ZA1B 2K3BA 3OYIA 1RADB 3A8HB 3A98A 2LZ6B 2QYZA 4Y92A 3OSSC 2OTLT 1SRLA 3OY9A 1SSHA 3JCMX 1M5Q1 4XTVA 1M2VB 2PVDB 2CS7A 4M77B 3MJXA 3KFVA 2JOYA 1C6VX 5GAN3 4CC2A 2DJZA 1SHFA 1S72T 3C94A 5IT9E 1B7TA 2L5QA 3CCLA 1OZ3A 1X2KA 2DIGA 1K8AU 5LJ5f 3M56A 1I07A 3CXCA 5CCAA 3JCMb 4OMMA 1VQMT 1FMKA 5A0LA 3CC7T 2DA9A 3QHSA 1ARKA 4AFSC 2YUOA 5GAN4 2JMAA 3M57A 4M78F 3JCMW 1BIAA 1YFNA 4KUIA 1KC8U 4IURA 5CIUA 4FYWB 3EFOA 4RG8A 2HD0A 1VQ9A 2EYWA 2ZPHB 3S3OA 5IAYA 2KYBA 1VQMA 5KCOA 2XD0A 2PVGB 1RAEB 2VB6A 4M7AC 3JCMe 3CXCS 2EGAA 2D8HA 2O88A 5FWCA 5LL6S 1LVKA 2NUPA 2OAWA 3GNFB 2H3EB 1JB0E 1PC0A 5HK0A 4M7DG 2DJQA 2RQWA 1A0NB 5DM7R 4M77C 5A0GA 2MAMA 3PFSA 2HDAA 4LXCA 1SPKA 2OTJQ 3ER0A 2Y90A 1AZEA 2M16A 3M9QA 1GBQA 4E7ZA 1G5VA 1TXQA 3RKWA 3JSCA 2RF0A 1W70A 1VQ8Q 3OMCA 2YUQA 2GBQA 2JMCA 1VQNQ 3DLMA 1D0ZA 2KRSA 2G6FX 3MEWA 3SB2A 4C8QA 4KUDK 4JUVA 3FC3A 1MMNA 4L5GA 1RL2A 3R6OA 4ESRA 3JCMJ 1QWFA 3NTKA 4PJMA 3VU3C 3EFOB 4CC7A 1Q82R 3M0SA 1IZ6A 2EJGA 2YLBA 4J83A 2GQIA 4WCIA 3I56T 1OZ2A 4GY5A 1UE9A 2RB6A 1C1AA 1K4US 4PLIA 1LJOA 1W2BS 2JTMA 2FB7A 4GLMA 1U06A 2R57A 3UWNA 2J7IA 5GANj 1YJWT 2A08A 1YJNQ 2XDPA 3P8BB 4ZTFA 4N0AA 4N0AC 3TSZA 2YHTA 4M75B 3T9NA 4M7DE 2XU8A 4M78G 4BI3A 1N8RU 3F70A 1N6AA 2MWOA 5C6SA 2DX1A 2VXFA 4QQ6A 3HHTB 2CP7A 4A4KA 3L2RA 4FYVB 5DY9A 2RNAA 2EYZA 1G3TA 2A0FB 2DKGA 4PFPA 2QQBA 2LP5A 3BFMA 1AWWA 5LJ3g 1M1FA 1PD0A 3MEAA 4Z88A 4M7AD 1WDXA 4C92A 4C92C 1Q7YR 4OMNA 3ZEHA 3C95A 1M90U 1Y7XA 1ZX6A 4RUGA 4XTZA 2BKDN 3TEEA 5KE3A 4MZPA 3E9FA 2J6OA 2Y4YA 3QYGB 4C92G 2E65A 2RA2A 1O9SA 3QPHA 3VS5A 2J05A 1VQLQ 3M58A 1OX9A 2QDLA 3PT9A 2EYQA 4II1A 2LNHB 2IPOB 1Q81U 3RKYA 3JB9G 3QG1A 2E5KA 2DTOA 4C8QG 2B8AA 1YI2T 5KH6A 1NJIC 2EVRA 1QMCA 4M78E 4PJOD 4LDXA 3CMAA 1OU8A 1PKSA 2VVKA 2LVMA 4F14A 1X43A 3EH1A 1WHGA 1W6XA 2L3SA 4DA4A 4F7UE 2QQAA 3CCQT 2M51A 3QZ9B 4RKUE 2E64A 4C0DB 2QEXA 4RCCA 2ED1A 3CEYA 4JZ4A 1C0MA 5EG2A 1ZSZB 2DF6A 4J7IA 3CCRA 3PE0A 2HBPA 4EMKC 3MHXA 4F7UB 4HCBA 1RUWA 2X51A 4LNPA 2LDMA 3MP6A 1SG5A 4C0FA 3NGPA 3RUXA 3UPUA 2EW3A 1BI1A 5FU6C 2FEIA 2A37A 2FPDA 3UT1A 1SSFA 3M53A 2BE9B 1QQJA 2YWWA 2OTLQ 2CT4A 2KGTA 2QK0A 1IREB 4J9FA 1X69A 4MZMA 2L8DA 5FWBA 3CCJT 3L42A 5HCKA 1G3SA 2QA4A 3VRYA 1B07A 5GAMe 2C06A 2R5AA 1WIEA 2MPXC 3PIPA 4C0ZA 4QVDA 3J7AF 5L23A 3S6WA 1VQ8T 2YUNA 4J9GA 2RHUA 2VV5A 1M8VA 2RK1A 1YJ9A 2DFUA 1W2BP 4M7AE 1YITQ 1AWOA 4RMOA 2K9GA 3R6NA 2LQKA 2DM1A 4DQ2A 2FO0A 3CBPA 2JNGA 4ME7A 1VQ5T 2FPEA 4KGXB 3DKMA 1VQ6Q 3G4SQ 2LNVA 4R0KA 5J39A 3EGDB 3CC4Q 2VKNA 5IHKA 1QVGP 5KYUA 4WTOB 4M78C 1E6HA 2RD1A 4EMKB 3MP1A 2COWA 1H641 1YJNA 2EYYA 2E3HA 3M55A 3LX7A 3VRZA 3VV0A 2MWPA 4KT0E 4C5IA 3QJ6A 5FU6B 2M0YA 1OQKA 3CCST 4M7AA 2LJ1A 2RI3A 4IUPA 1FWZA 2O01E 2JS2A 1M90R 1B34B 5L8RE 5LJ5e 1PRMC 2K2VA 3OYLA 2CREA 2KXCA 3EHQA 5GMKh 1G8XA 3HKSA 1D3BA 4A4GA 4XTUA 2DVEA 1RABB 2L3RA 3LGLA 5IH2A 1WLPB 2KAFA 1BB9A 2HKQB 4JRQA 2M9UA 2V8IA 1M9SA 4DEYA 3SD4A 2ED0A 2HSPA 2QI2A 4C5EA 3A8MB 3JRZA 1FMVA 2J06A 4MMLA 4XQ3A 3QXEB 1YI2Q 4DOVA 2YLCA 3ZFJA 3CCSQ 2LX7A 4N4HA 5GAMf 1Q81C 3V7SA 2RQTA 1MMDA 1TUGB 2VXEA 3EGXA 1W4SA 2ZAEA 2YT6A 3QIIA 3CD6Q 2ZPGB 2O9VA 2X4XA 2V1RA 2W0ZA 4C8QC 5KYWA 4XK8E 1VQKA 1KSWA 2HQXA 2JM8A 4F17A 1VUBA 2K6DA 3TU4K 1Q7YU 1VQ5Q 1H92A 4FM4B 1HYOA 2MK5A 2LCSA 2R5MA 1CKAA 2P0PA 4J9DA 4PJJA 2FHDA 4JS4A 3EGDA 1QWEA 1VIFA 3V7RA 1Z9ZA 4BI4A 3OYNA 2CZ6B 3HFNA 1LCKA 1OPKA 4M7DF 1ZHIA 5GAMg 4CI0C 2X4WA 3META 3CC2A 1CKBA 2LQWA 2DL3A 2MOXA 3CCVQ 1MHNA 1PRLC 2K4YA 2DVJA 4BB7A 2ROLA 3CPFA 1I8FA 2IIMA 1VQ5A 1GBRA 3M0TA 4M4ZA 2HAXA 2ZPFB 3C0CA 2GNCA 4KBMB 4ANJA 3AT1B 4ZGEB 4ZNXA 2WSEE 4M75C 1BI2A 3M0UA 3FEOA 3GBQA 2R58A 2DNUA 1M4ZA 3REBB 2YRCA 4Y91A 5KYWB 9ATCB 1AHJB 1VQPT 3M0RA 3CMEA 3RMQA 2RHZA 3OBYA 3CCSA 2X9HA 3FJ5A 1VQKT 1NLOC 2OX7A 3CCUT 2K7AA 4F7UA 4LDVA 4HT8A 4FT2A 3U23A 1R77A 2WSFE 4A63B 1Q95G 1X6BA 3JB9J 2AKLA 5GAMj 2NUTA 3RERA 2YRDA 3ULRB 3C12A 1KJWA 5GAN2 1Y96A 5GMKe 4M7AB 2YXYA 1BYMA 4BE2A 1O75A 5GMKl 1VQLT 1VQ7Q 2EJFA 2QG9B 1QLYA 3G4ST 1BCMA 1IGUA 3KBGA 1QCFA 3CC4A 6AT1B 2PZ1A 2AZSA 3CC4T 1D1CA 1WHLA 4EMHA 4C0DC 1QP3A 2PVOB 2RQRA 1NYGA 3MCAB 1KG1A 4KH0B 3ASKA 2RHXA 1WHHA 4JLIA 1Y57A 1ZQ1A 5KYYB 1BIBA 1HJDA 2CH4A 1N9RA 2E4HA 3EGXB 1H8KA 3JCMP 1U5SA 4B9XA 3JCMc 5CVIA 1X27A 2GTJA 1BK2A 2JVVA 2YSQA 2M02A 2CUBA 1OU9A 3OYGA 1KQ1A 4IIOA 4LDWA 2E3IA 2CYZB 4ZN3A 5D7UA 4HVVA 1U8RA 3GP8A 1OV3A 1Q82C 3JB9F 2P0KA 1M1KR 1AWXA 2F2WA 3VS4A 5GAMd 1KHIA 1M30A 1JJ2A 4JJBA 5KCHA 5LJ5d 5GAMh 4NOYA 7AT1B 2RI5A 3QYHB 1V1CA 5FRMA 2MCNA 1R0BG 2E70A 2JT4A 2BIVA 3FRNA 1BCOA 3BW1A 3EG0A 1NJIU 4EDUA 4PLLA 1YJWQ 4AG2C 5C0MA 3LGFA 2XKOC 2DL4A 3CCRQ 5GAOr 3EG1A 3G71Q 1JXMA 2EWNA 4EMKA 5GMKi 1VQOQ 4PL6A 1XTDA 3OYEA 2KNBB 2MYSA 3J81E 1FMWA 3RNJA 1SHGA 2IG0A 2XMFA 3QDRB 3LWHA 3I55T 1H3HA 1AT1B 1M27C 2CSQA 3BDUA 4M7DD 4A53A 2DYBA 3HTRA 4M77E 4BI8B 5FU7B 4XTWA 3JV3A 2CP0A 3A8GB 3LH5A 1WJSA 2MIOA 2VGNA 4OMQA 2ESWA 4BE0A 3V8JA 1PSEA 2E10A 5CO7A 5D6YA 4XTXA 2AKKA 3I55A 2COYA 2LC4A 3LW5E 3CCMQ 3G71T 2RJFA 4RCBA 4M78B 1BKBA 3OYKA 4QQDA 1VYVA 4LD9K 1EFNA 2KY9A 1WX6A 3ZL7C 1VQLA 1U1SA 1UEBA 2FRYA 1UHCA 5GAOl 2ZPEB 4BY6C 3JCMd 3X26B 4PNOA 4RG2A 3A5ZB 4C8QB 1EX4A 4AMCA 2H3JA 3JCMf 1BI0A 3X25B 5LJ5h 1WI7A 3RESA 3AHUA 2CGHA 2DZ9A 4M7DB 3OBWA 1OI1A 3N5BB 5M9OA 3HPWA 2PTKA 4P5NA 2M1HA 5KYXB 3A1PA 2PNIA 1LPLA 3G6EA 1QCNA 3OYCA 3RKXA 2ATCB 1JBMA 1ZSZA 4FW2A 4BD3A 5GMKm 4FSSA 2LTOA 2RQVA 3RBBB 3OQ5A 3TVTA 4KGZB 5J26A 2EGCA 4RTUA 3WVDB 3CMAT 1YJ9T 2VYTA 2X4JA 3DB4A 3OSVA 1K9AA 3S3NA 2OAUA 4HVWA 5CKDA 1PKTA 2KBTA 1RI0A 2PQWA 3I56A 1SF9A 2EIFA 4J9EA 4YTLA 4E7JA 3I5SA 4IUUA 5LJ5g 4FT4A 2DK3A 2J6FA 2KRNA 2K3XA 4IUTA 1GFCA 3VS3A 1M1KC 2LJ0A 3GOXA 4D8DA 1J3TA 1D09B 2FG0A 3SFMA 3CMAQ 1UGVA 2EJ9A 3NTIA 4RTVA 3QDFA 5GAOn 5D6WA 1K1ZA 1YHQQ 3INZA 3QWYA 4JJDA 5GMKj 1NPPA 4RTZA 1QP2A 3E1SA 1Q82U 3H0IA 3GIBA 3SHWA 1K9MC 3VS0A 1WXUA 4DBFA 4JDSA 2V26A 3CC2Q 2ABLA 2DL8A 3G7ZA 3H0FA 1M2VA 1QVFA 5DLOA 2H8HA 2F1LA 3X20B 4R55A 2DIQA 5I2MA 1JQQA 2XI9A 1ABQA 2GF7A 3JB9D 5CKFA 1AZGB 1R0CB 3CBMA 2M0OA 2RM4A 4OMOA 2RPNA 1K73C 1KFZA 4ZGJB 1M3BA 4O5VA 2HSEB 4JRKA 3OMGA 3REAB 3NFCA 1ABOA 3VS1A 4OB2B 3CQTA 1ZSZC 3QJYA 1VQ7T 2HNIA 2EAYA 1QVFS 4E6RA 3E2UA 4LUDA 4MZTA 1T3SA 2DXUA 1RACB 2YRVA 1HSQA 1Q86U 1QKWA 2P4RA 4J6XA 2FZKB 4DEXA 3CCMT 2BE7D 2MI6A 1HXDA 4DBRA 4C8QE 1WQWA 2D8JA 1VOMA 3UF4A 2I2LA 2QXFA 4C8QD 2HMAA 5CKEA 4LN2A 2MF2A 5I21A 3SDZA 2FVUA 3M0PA 2HBWA 4RTYA 2JTFA 3VUZA 5KE2A 4DBQA 1K9MU 4M78D 2L2PA 4BDZA 3MKDA 2LJ3A 4RTTA 1WHMA
chains in the Genus database with same CATH topology
2DVJA 2ROLA 2JXBA 2L3PA 2IIMA 1GBRA 1ZSGA 2JTEA 2EGAA 4AFZC 2D8HA 3M0TA 2O88A 2AZVA 5FWCA 4D8KA 2VWFA 4M4ZA 2KRMA 4F16A 1MV3A 2OAWA 3C0CA 2GNCA 2A36A 4ZNXA 3VS2A 5IXBA 3M0UA 3GBQA 2C0TA 2DNUA 1X6GA 3I35A 4AFQC 3REBB 2DJQA 2RQWA 2EPDA 1A0NB 1NYFA 3NMZC 1WFWA 1G2BA 2HDAA 3M0RA 1OEBA 1TUCA 1SPKA 1BU1A 5IHNA 1ZUKA 1AZEA 1GBQA 3EHRA 3FJ5A 1NLOC 2RF0A 1W70A 2K7AA 2YUQA 2GBQA 2JMCA 2OJ2A 1U3OA 2DL7A 2KRSA 2G6FX 3U23A 1UJYA 1KIKA 2EGEA 2DRKA 4A63B 2A28A 1GL5A 3I5RA 2LMJA 2SRCA 1X6BA 4ESRA 1QWFA 1JU5C 2AKLA 2O31A 1GCQA 2W10A 4CC7A 2O9SA 3M0SA 3PVLA 3ULRB 1KJWA 2GQIA 4WCIA 5FW9A 4LE9A 1UE9A 1K4US 1SRMA 2RQUA 1X2QA 1OOTA 1MV0B 1QLYA 4GLMA 1U06A 2J7IA 2BZ8A 2A08A 5I11A 2X3WD 1QCFA 2DL5A 3QWXX 4Z8AA 2CUDA 1WXTA 3SEMA 2PZ1A 2AZSA 2KR3A 1YWOA 3TSZA 1E7OA 1W1FA 1M3AA 2RQRA 1NYGA 2EBPA 1Y57A 2DILA 2DX1A 1HJDA 2CH4A 3UA7A 2KT1A 1H8KA 2V1QA 2EKHA 1U5SA 2RNAA 1AD5A 1X27A 2GTJA 3NPFA 1BK2A 2EYZA 4IIMA 4JPBW 1IO6A 2LP5A 3H41A 2YSQA 1AWWA 1K0XA 5EC7A 2CUBA 4Z88A 1GRIA 1WDXA 3NHNA 4IIOA 2JS0A 4HXJA 4OMPA 4OMNA 2F2VA 4HVVA 1ZX6A 4RUGA 1UFFA 4K11A 1OV3A 1Y0MA 1AWXA 1YN8A 2F2WA 3VS4A 1M30A 1VA7A 4JJBA 2J6OA 2RMOA 1UTIA 1ZBJA 2NWMA 2CSIA 2L0AA 1M3CA 2KROA 3VS5A 1V1CA 2J05A 1I0CA 2MCNA 2JT4A 3THKA 2QDLA 3EG0A 2KXDA 2AK5A 4AG2C 2F2XA 2OI3A 2LNHB 1TUDA 2DL4A 1VYTA 1UUEA 3EG1A 1JXMA 1UJ0A 2DMOA 1YNZA 1E6GA 2KNBB 1T0JA 2BTTA 2E5KA 4GBQA 3RNJA 1SHGA 1GFDA 2DBMA 1WYXA 2XMFA 2EVRA 1PKSA 4F14A 2VVKA 1H3HA 1X43A 1M27C 2CSQA 3IQLA 4J9HA 4KRTA 3VS7A 1W6XA 1UDLA 2DRMA 2L3SA 1FYNA 1NM7A 1NEGA 2M51A 1AEYA 2DYBA 2D1XA 2LQNA 1CSKA 3I9QA 3JV3A 2C0IA 2ED1A 4JZ4A 2CDTA 3LH5A 2HEQA 1OPLA 2MIOA 4OMQA 1RLQC 2ESWA 2DF6A 1T0HA 1YCSB 4EIKA 3PE0A 2AKKA 2GTOA 1RUWA 1ZUUA 1AVZC 4LNPA 3TSWA 2GGRA 3NGPA 1VYVA 1EFNA 5GJVB 1WX6A 3ZL7C 2EW3A 2FRYA 2ECZA 1UHCA 2FEIA 2A37A 2FPDA 4JJCA 4HVUA 2DE0X 1HD3A 3EGUA 3EG3A 2DLPA 1JO8A 2CT4A 2KGTA 4HCKA 4J9FA 1WI7A 1X69A 5ECAA 5FWBA 3EG2A 2PTKA 5HCKA 2BZXA 2KEAA 1B07A 3VRYA 1PHTA 4OMLA 2PNIA 1WIEA 2KE9A 2DBKA 1RLPC 1N5ZA 5GJWB 5L23A 4ORZA 1ZLMA 2YUNA 2ENMA 4J9GA 1PNJA 2L3QA 5IXFA 2K79A 4J9IA 4FSSA 1MUZA 2RQVA 3RBBB 2JW4A 1BBZA 4JZ3A 4AG1C 3TVTA 2EGCA 4RTWA 1AWOA 4RTUA 4CC3A 2K9GA 3R6NA 2DM1A 2NUZA 2ROTA 2K2MA 3M0QA 2FO0A 1PWTA 2X3XD 2FPEA 4AFUC 1K9AA 2D0NA 4J9CA 4HVWA 1JXOA 1PKTA 2KBTA 5IHIA 1RI9A 4R0KA 1B3QA 1XOVA 2VKNA 2HCKA 5IHKA 4J9EA 3H0HA 3I5SA 5I22A 1AOJA 3UA6A 2EYXA 2J6FA 2KRNA 2BZYA 1E6HA 2I0NA 1GFCA 4J9BA 1GCPA 3VS3A 1Z9QA 2YUPA 2LJ0A 2O2OA 4D8DA 2EYYA 1J3TA 2FG0A 3VRZA 1UG1A 2YDLA 4LUEA 1UGVA 4RTVA 1WA7A 1M8MA 1NLPC 2M0YA 1K1ZA 1ZUYA 2SEMA 2LJ1A 3QWYA 4JJDA 2JS2A 4RTZA 3PVQA 2EQIA 1TG0A 4RTXA 3H0IA 1PRMC 1SEMA 2CREA 3SHWA 2KXCA 4QT7A 1YP5A 1QKXA 3EHQA 3VS0A 1WXUA 2CH4W 1AWJA 2ABLA 2DL8A 1YWPA 5IH2A 1WLPB 3H0FA 1BB9A 1UECA 4DEYA 1S1NA 2H8HA 2ED0A 2HSPA 1JQQA 1ABQA 2J06A 4X1VA 1UHFA 1AZGB 1T3LA 2LX7A 2K3BA 1K0SA 2FPFA 1VYUA 4OMOA 2RQTA 3UATA 2RPNA 2KYMA 3A98A 1KFZA 2LZ6B 1M3BA 4Y92A 4CC4B 2YT6A 1SRLA 1SSHA 3REAB 2CT3A 1ABOA 3VS1A 2O9VA 3CQTA 4Z89A 2B86A 2V1RA 2W0ZA 1NEBA 4E6RA 3KFVA 4LUDA 2KT8A 4CC2A 1KSWA 1SHFA 1T3SA 2J6KA 2JM8A 4F17A 1HSQA 2K6DA 2JM9A 1QKWA 2P4RA 1H92A 1X2KA 1JEGA 1GCQC 2C0OA 4DEXA 2RN8A 2LCSA 1I07A 1CKAA 1WXBA 2D8JA 4OMMA 1FMKA 1I1JA 3UF4A 4J9DA 2DA9A 1K76A 4LN2A 1QWEA 1ARKA 4AFSC 1Z9ZA 2YUOA 2JMAA 2FRWA 3M0PA 1LCKA 2HBWA 1OPKA 4RTYA 3O5ZA 1NG2A 2EYWA 2L2PA 1CKBA 1G83A 2LQWA 2LJ3A 2KYBA 4RTTA 2DL3A 3VS6A 2MOXA 1PRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  2ROL A;  2JXB A;  2L3P A;  2IIM A;  1GBR A;  1ZSG A;  2JTE A;  2EGA A;  4AFZ C;  2D8H A;  3M0T A;  2O88 A;  2AZV A;  5FWC A;  4D8K A;  2VWF A;  4M4Z A;  2KRM A;  4F16 A;  1MV3 A;  2OAW A;  3C0C A;  2GNC A;  2A36 A;  4ZNX A;  3VS2 A;  5IXB A;  3M0U A;  3GBQ A;  2C0T A;  2DNU A;  1X6G A;  3I35 A;  4AFQ C;  3REB B;  2DJQ A;  2RQW A;  2EPD A;  1A0N B;  1NYF A;  3NMZ C;  1WFW A;  1G2B A;  2HDA A;  3M0R A;  1OEB A;  1TUC A;  1SPK A;  1BU1 A;  5IHN A;  1ZUK A;  1AZE A;  1GBQ A;  3EHR A;  3FJ5 A;  1NLO C;  2RF0 A;  1W70 A;  2K7A A;  2YUQ A;  2GBQ A;  2JMC A;  2OJ2 A;  1U3O A;  2DL7 A;  2KRS A;  2G6F X;  3U23 A;  1UJY A;  1KIK A;  2EGE A;  2DRK A;  4A63 B;  2A28 A;  1GL5 A;  3I5R A;  2LMJ A;  2SRC A;  1X6B A;  4ESR A;  1QWF A;  1JU5 C;  2AKL A;  2O31 A;  1GCQ A;  2W10 A;  4CC7 A;  2O9S A;  3M0S A;  3PVL A;  3ULR B;  1KJW A;  2GQI A;  4WCI A;  5FW9 A;  4LE9 A;  1UE9 A;  1K4U S;  1SRM A;  2RQU A;  1X2Q A;  1OOT A;  1MV0 B;  1QLY A;  4GLM A;  1U06 A;  2J7I A;  2BZ8 A;  2A08 A;  5I11 A;  2X3W D;  1QCF A;  2DL5 A;  3QWX X;  4Z8A A;  2CUD A;  1WXT A;  3SEM A;  2PZ1 A;  2AZS A;  2KR3 A;  1YWO A;  3TSZ A;  1E7O A;  1W1F A;  1M3A A;  2RQR A;  1NYG A;  2EBP A;  1Y57 A;  2DIL A;  2DX1 A;  1HJD A;  2CH4 A;  3UA7 A;  2KT1 A;  1H8K A;  2V1Q A;  2EKH A;  1U5S A;  2RNA A;  1AD5 A;  1X27 A;  2GTJ A;  3NPF A;  1BK2 A;  2EYZ A;  4IIM A;  4JPB W;  1IO6 A;  2LP5 A;  3H41 A;  2YSQ A;  1AWW A;  1K0X A;  5EC7 A;  2CUB A;  4Z88 A;  1GRI A;  1WDX A;  3NHN A;  4IIO A;  2JS0 A;  4HXJ A;  4OMP A;  4OMN A;  2F2V A;  4HVV A;  1ZX6 A;  4RUG A;  1UFF A;  4K11 A;  1OV3 A;  1Y0M A;  1AWX A;  1YN8 A;  2F2W A;  3VS4 A;  1M30 A;  1VA7 A;  4JJB A;  2J6O A;  2RMO A;  1UTI A;  1ZBJ A;  2NWM A;  2CSI A;  2L0A A;  1M3C A;  2KRO A;  3VS5 A;  1V1C A;  2J05 A;  1I0C A;  2MCN A;  2JT4 A;  3THK A;  2QDL A;  3EG0 A;  2KXD A;  2AK5 A;  4AG2 C;  2F2X A;  2OI3 A;  2LNH B;  1TUD A;  2DL4 A;  1VYT A;  1UUE A;  3EG1 A;  1JXM A;  1UJ0 A;  2DMO A;  1YNZ A;  1E6G A;  2KNB B;  1T0J A;  2BTT A;  2E5K A;  4GBQ A;  3RNJ A;  1SHG A;  1GFD A;  2DBM A;  1WYX A;  2XMF A;  2EVR A;  1PKS A;  4F14 A;  2VVK A;  1H3H A;  1X43 A;  1M27 C;  2CSQ A;  3IQL A;  4J9H A;  4KRT A;  3VS7 A;  1W6X A;  1UDL A;  2DRM A;  2L3S A;  1FYN A;  1NM7 A;  1NEG A;  2M51 A;  1AEY A;  2DYB A;  2D1X A;  2LQN A;  1CSK A;  3I9Q A;  3JV3 A;  2C0I A;  2ED1 A;  4JZ4 A;  2CDT A;  3LH5 A;  2HEQ A;  1OPL A;  2MIO A;  4OMQ A;  1RLQ C;  2ESW A;  2DF6 A;  1T0H A;  1YCS B;  4EIK A;  3PE0 A;  2AKK A;  2GTO A;  1RUW A;  1ZUU A;  1AVZ C;  4LNP A;  3TSW A;  2GGR A;  3NGP A;  1VYV A;  1EFN A;  5GJV B;  1WX6 A;  3ZL7 C;  2EW3 A;  2FRY A;  2ECZ A;  1UHC A;  2FEI A;  2A37 A;  2FPD A;  4JJC A;  4HVU A;  2DE0 X;  1HD3 A;  3EGU A;  3EG3 A;  2DLP A;  1JO8 A;  2CT4 A;  2KGT A;  4HCK A;  4J9F A;  1WI7 A;  1X69 A;  5ECA A;  5FWB A;  3EG2 A;  2PTK A;  5HCK A;  2BZX A;  2KEA A;  1B07 A;  3VRY A;  1PHT A;  4OML A;  2PNI A;  1WIE A;  2KE9 A;  2DBK A;  1RLP C;  1N5Z A;  5GJW B;  5L23 A;  4ORZ A;  1ZLM A;  2YUN A;  2ENM A;  4J9G A;  1PNJ A;  2L3Q A;  5IXF A;  2K79 A;  4J9I A;  4FSS A;  1MUZ A;  2RQV A;  3RBB B;  2JW4 A;  1BBZ A;  4JZ3 A;  4AG1 C;  3TVT A;  2EGC A;  4RTW A;  1AWO A;  4RTU A;  4CC3 A;  2K9G A;  3R6N A;  2DM1 A;  2NUZ A;  2ROT A;  2K2M A;  3M0Q A;  2FO0 A;  1PWT A;  2X3X D;  2FPE A;  4AFU C;  1K9A A;  2D0N A;  4J9C A;  4HVW A;  1JXO A;  1PKT A;  2KBT A;  5IHI A;  1RI9 A;  4R0K A;  1B3Q A;  1XOV A;  2VKN A;  2HCK A;  5IHK A;  4J9E A;  3H0H A;  3I5S A;  5I22 A;  1AOJ A;  3UA6 A;  2EYX A;  2J6F A;  2KRN A;  2BZY A;  1E6H A;  2I0N A;  1GFC A;  4J9B A;  1GCP A;  3VS3 A;  1Z9Q A;  2YUP A;  2LJ0 A;  2O2O A;  4D8D A;  2EYY A;  1J3T A;  2FG0 A;  3VRZ A;  1UG1 A;  2YDL A;  4LUE A;  1UGV A;  4RTV A;  1WA7 A;  1M8M A;  1NLP C;  2M0Y A;  1K1Z A;  1ZUY A;  2SEM A;  2LJ1 A;  3QWY A;  4JJD A;  2JS2 A;  4RTZ A;  3PVQ A;  2EQI A;  1TG0 A;  4RTX A;  3H0I A;  1PRM C;  1SEM A;  2CRE A;  3SHW A;  2KXC A;  4QT7 A;  1YP5 A;  1QKX A;  3EHQ A;  3VS0 A;  1WXU A;  2CH4 W;  1AWJ A;  2ABL A;  2DL8 A;  1YWP A;  5IH2 A;  1WLP B;  3H0F A;  1BB9 A;  1UEC A;  4DEY A;  1S1N A;  2H8H A;  2ED0 A;  2HSP A;  1JQQ A;  1ABQ A;  2J06 A;  4X1V A;  1UHF A;  1AZG B;  1T3L A;  2LX7 A;  2K3B A;  1K0S A;  2FPF A;  1VYU A;  4OMO A;  2RQT A;  3UAT A;  2RPN A;  2KYM A;  3A98 A;  1KFZ A;  2LZ6 B;  1M3B A;  4Y92 A;  4CC4 B;  2YT6 A;  1SRL A;  1SSH A;  3REA B;  2CT3 A;  1ABO A;  3VS1 A;  2O9V A;  3CQT A;  4Z89 A;  2B86 A;  2V1R A;  2W0Z A;  1NEB A;  4E6R A;  3KFV A;  4LUD A;  2KT8 A;  4CC2 A;  1KSW A;  1SHF A;  1T3S A;  2J6K A;  2JM8 A;  4F17 A;  1HSQ A;  2K6D A;  2JM9 A;  1QKW A;  2P4R A;  1H92 A;  1X2K A;  1JEG A;  1GCQ C;  2C0O A;  4DEX A;  2RN8 A;  2LCS A;  1I07 A;  1CKA A;  1WXB A;  2D8J A;  4OMM A;  1FMK A;  1I1J A;  3UF4 A;  4J9D A;  2DA9 A;  1K76 A;  4LN2 A;  1QWE A;  1ARK A;  4AFS C;  1Z9Z A;  2YUO A;  2JMA A;  2FRW A;  3M0P A;  1LCK A;  2HBW A;  1OPK A;  4RTY A;  3O5Z A;  1NG2 A;  2EYW A;  2L2P A;  1CKB A;  1G83 A;  2LQW A;  2LJ3 A;  2KYB A;  4RTT A;  2DL3 A;  3VS6 A;  2MOX A;  1PRL C; 
#chains in the Genus database with same CATH topology
 1D0Y A;  3OS1 A;  3MEU A;  5FRN A;  2JXB A;  3CCL Q;  4MDX A;  4BUG A;  3CME T;  2KQW A;  4L59 A;  2VWF A;  2XIC A;  4F16 A;  1MV3 A;  1KQS P;  1H3Z A;  2ZPB B;  4M75 D;  2XDD A;  1JRI A;  2CP6 A;  1YHQ A;  1M1K U;  2X4Y A;  3MEV A;  4N4I A;  1IRX A;  3I35 A;  4AFQ C;  3GPL A;  2QGF B;  2O4X A;  4QKU A;  3NMZ C;  4A4E A;  1WFW A;  2D0Q B;  2RJE A;  3CME Q;  4OP0 A;  1OEB A;  3CCL T;  3CCJ A;  1TWB A;  3OYJ A;  1VQ6 A;  5KYX A;  5IHN A;  1TH7 A;  1ZUK A;  4JRI A;  5LJ5 j;  3I56 Q;  1TOV A;  3OB9 A;  3EH2 A;  1UGS B;  2AIR B;  1BI3 A;  4M77 G;  1I81 A;  2V8K A;  3RDV A;  5KYY A;  1YIT T;  2AT1 B;  1U3O A;  2DL7 A;  3M4G A;  1G3Y A;  1KIK A;  2EGE A;  4X34 A;  2QTX A;  1GL5 A;  3I5R A;  2LMJ A;  2K3Y A;  2SRC A;  4C5H A;  2KI7 A;  2OTJ T;  4PFZ A;  4Y28 E;  1YJN T;  1OX8 A;  3PVL A;  3JCM V;  4OF1 A;  4F7U G;  5FW9 A;  4XU3 A;  4LE9 A;  1ZBX A;  3CD6 T;  4C92 D;  1SRM A;  3VYH B;  1OYX A;  3V8L A;  3FIF A;  3KUF A;  3PGG A;  4Q5W A;  1HK9 A;  1RAG B;  1X2Q A;  1OOT A;  1KC8 C;  3VJP A;  2NUT B;  2BZ8 A;  2VAS A;  3QWX X;  4Z8A A;  2CUD A;  1WXT A;  2GFU A;  2COZ A;  2KR3 A;  3TQ7 P;  1YWO A;  4X9D A;  1IHV A;  1KD1 R;  4ZGD B;  1UB4 A;  2LT4 A;  4PFO A;  1W1F A;  4BDY A;  4E7I A;  1M3A A;  2EBP A;  1I5L A;  3L1A A;  1UGQ B;  2DIL A;  4XAX B;  3S3M A;  1N8R C;  2KT1 A;  2QQR A;  1WJQ A;  2V1Q A;  2EKH A;  3DB3 A;  3PMI A;  1X6O A;  1AD5 A;  3GNG A;  1G3W A;  4OGC A;  3L2U A;  1IO6 A;  3CCQ A;  1KD1 U;  1Q7Y C;  3H41 A;  4E7K A;  1K0X A;  5EC7 A;  3SWN C;  2F5T X;  3SWN A;  2DD4 A;  1K8A R;  2RHY A;  3NHN A;  2JS0 A;  2LCC A;  5I2S A;  4HXJ A;  3OYY A;  3JB9 I;  4OMP A;  2CZ7 B;  2KSS A;  4NS5 A;  1N27 A;  4E7L A;  1JJ2 S;  4K11 A;  1Y0M A;  2XG8 D;  1NPR A;  4KH1 B;  3BE3 A;  1RAH B;  4QVZ A;  5HY6 A;  4JJN K;  2KVQ G;  2RMO A;  2WSC E;  1VQ4 T;  1ZBJ A;  2LX9 A;  2CSI A;  2L0A A;  1M3C A;  4OMF B;  2KRO A;  1I0C A;  3PNW C;  2LCL A;  3THK A;  4M77 D;  4FYY B;  4B9W A;  1D3B B;  2QGG A;  4PJN A;  4OGE A;  2F2X A;  2OI3 A;  1TUD A;  4LD6 A;  1VYT A;  3EG9 B;  1UUE A;  3OS2 A;  4HA8 A;  1UJ0 A;  4MMK A;  2QDY B;  1SKU B;  1YNZ A;  4J8O A;  1E6G A;  4J6W A;  1VQN A;  2BTT A;  2HQE A;  3KXT A;  3RR6 A;  3TRE A;  4C8Q F;  1QVF P;  1GFD A;  2DBM A;  4C92 F;  4UC4 A;  3HRS A;  2DO3 A;  3FDR A;  2DET A;  4KRT A;  3IQL A;  4XU2 A;  1UDL A;  2DRM A;  2DZC A;  1FYN A;  5GAO p;  3V8K A;  4IKF A;  3OW2 P;  2ZGW A;  3PTA A;  3GLX A;  2D1X A;  2LQN A;  1MMA A;  3I9Q A;  2EQK A;  3HFO A;  3ZBD A;  4HKE A;  1VQN T;  3CCE A;  2ZZD A;  5AYF A;  1QVG A;  4FIB A;  4EPC A;  1Y96 B;  5IN1 A;  3CCE T;  4ZN1 A;  1YCS B;  1QCO A;  4NL2 A;  1D0X A;  2GTO A;  1F1B B;  4BE1 A;  2HQH A;  1AVZ C;  2MMP A;  3TSW A;  2GGR A;  1MNE A;  1WNL A;  4X9C A;  1X75 C;  5FRO A;  3OW2 S;  5GJV B;  2QA4 Q;  4JJC A;  3M4Y A;  2RH2 A;  3MO8 A;  4HVU A;  1WHJ A;  1MGQ A;  3EG3 A;  1S72 A;  1K8A C;  1JO8 A;  2OTL A;  4HCK A;  1VQO A;  3G1J A;  2DTI A;  3FB9 A;  5ECA A;  4E47 A;  2DXB A;  4D6W A;  3C4S A;  3EG2 A;  4FU6 A;  1K73 R;  3CCU Q;  1DJ7 B;  5DLQ E;  1RAF B;  2BZX A;  3QUI A;  2ZCF B;  5D6X A;  4OML A;  2KE9 A;  3TCJ A;  2DBK A;  2FZC B;  4M78 A;  1TSF A;  3LYI A;  5GJW B;  2KK4 A;  4ORZ A;  2ENM A;  2L3Q A;  4N4G A;  5IXF A;  3H8Z A;  4E7H A;  2K79 A;  2QAZ A;  4LDY A;  1MUZ A;  2LQ8 A;  4IUQ A;  4JZ3 A;  1PD1 A;  2G3R A;  4AG1 C;  4A4F A;  3PIO A;  3NTH A;  5A2Q E;  2ROT A;  2K2M A;  4ATO A;  1PWT A;  2EKO A;  2X3X D;  4J9C A;  2D0N A;  5GAN g;  1D1B A;  4XU1 A;  2E6Z A;  2ZPI B;  5IHI A;  4NL3 A;  2E1H A;  1XOV A;  2HCK A;  2KDS A;  2D9T A;  4R56 A;  4O6J A;  3OYM A;  1AOJ A;  3UA6 A;  1YJW A;  5CKB A;  2HKN A;  1IGQ A;  4A54 A;  1Z9Q A;  3CC7 A;  3OW2 A;  3G4S A;  5GAO m;  3QZ5 B;  4PK4 A;  2YDL A;  3OYD A;  3L2Q A;  4BAC A;  1M8M A;  1NLP C;  1ZUY A;  3M5A A;  3JCM Q;  1TS9 A;  5AT1 B;  1QVG S;  2EQJ A;  2FL7 A;  3PVQ A;  4C0G A;  2EQI A;  3JAM E;  1VQ9 T;  5LJ3 e;  4J6Y A;  1TG0 A;  2HL5 C;  4RTX A;  1SEM A;  3M59 A;  1VQM Q;  1YP5 A;  2Z0W A;  3OS5 A;  4L6V 5;  1AWJ A;  1LNX A;  1WGS A;  3Q1J A;  5KYN A;  4PJO C;  4F04 B;  5HK3 A;  5GAN 8;  1K73 U;  2QQ9 A;  2DXC A;  1UEC A;  1S1N A;  2DXT A;  2O4X B;  1YIJ A;  1IXD A;  1UHF A;  1NZ9 A;  4PKC C;  2F69 A;  1K0S A;  2FPF A;  1VYU A;  3V7C A;  5CK9 A;  3BY7 A;  3UAT A;  2KYM A;  2CP5 A;  1P92 A;  3E9G A;  3CCM A;  4PJO G;  2AHJ B;  2NUP B;  4CC4 B;  5GAO q;  3OS0 A;  1M1G A;  3OYH A;  3CPW P;  2CT3 A;  1V29 B;  3QO3 A;  2E6N A;  4Z89 A;  2B86 A;  4B6M A;  2P84 A;  1NEB A;  2KT8 A;  1YCY A;  3MP8 A;  2J6K A;  5GAN e;  4M7A G;  3VKI A;  1VQ4 Q;  5FU7 C;  2JM9 A;  3J80 E;  2DTH A;  1JEG A;  2DD5 A;  1GCQ C;  2DEU A;  2C0O A;  4XU0 A;  4PJO E;  2RN8 A;  3HRU A;  2EFI A;  1WQ7 A;  1WXB A;  1I1J A;  4DBH A;  2K57 A;  1K76 A;  2CZ1 B;  4OVA A;  3CCU A;  4E2F B;  5GAN f;  2JJ9 A;  3G71 A;  5CAI A;  2FRW A;  3CBO A;  1KK7 A;  3HP9 A;  1Q81 R;  3O5Z A;  1NG2 A;  2EQU A;  4BY6 B;  1G83 A;  1RAI B;  2FZG B;  1VQP Q;  5KYU B;  3VS6 A;  1IHW A;  3PMT A;  4M75 E;  3P8H A;  5CQY A;  1NJI R;  2L3P A;  1ZSG A;  2JTE A;  4AFZ C;  2AZV A;  4D8K A;  2KRM A;  3CCR T;  2A3L A;  4FCY A;  2QAS A;  4HCC A;  3OYF A;  2PU9 B;  1S72 Q;  2A36 A;  3VS2 A;  5IXB A;  1FXX A;  3GF5 A;  1YIJ T;  2HL3 A;  2C0T A;  3BDL A;  1X6G A;  3LH0 A;  3CCE Q;  1GXI E;  2EPD A;  2JN0 A;  4PJO A;  1NYF A;  3P8D A;  1G2B A;  3SWN B;  3VYG A;  1TUC A;  4OB3 B;  4CRI A;  2HZY A;  1BU1 A;  1MMG A;  2GFA A;  3CCV T;  2QTV A;  3G6E T;  3EHR A;  1K9M R;  3H9N A;  2DAQ A;  3RMS A;  4C5G A;  8ATC B;  2F5K A;  3CD6 A;  2OJ2 A;  2GQV A;  4M75 A;  3WVE B;  1UJY A;  2A7Y A;  1TU0 B;  2E5Q A;  2DRK A;  5FLX E;  2A28 A;  3L2V A;  4QQG A;  3CPW S;  1WZO A;  1YBY A;  2QEX T;  2RHI A;  1XQH A;  1JU5 C;  2W10 A;  2O31 A;  1GCQ A;  3ME9 A;  1VQ7 A;  2O9S A;  3LLR A;  1VQ9 Q;  2DYI A;  3OYA A;  1WHK A;  4VUB A;  5GAN 5;  2Y4X A;  2XDB A;  5LJ3 j;  2RQU A;  4A4H A;  2GCX A;  1KQS A;  1OUL A;  1MV0 B;  3EAE A;  5I11 A;  2X3W D;  2DL5 A;  2NYS A;  3CPW A;  3SEM A;  2BUD A;  4TVR A;  2LT1 A;  2QEX Q;  1E7O A;  5GAN d;  2DER A;  1WPY A;  2CP3 A;  4IUV A;  5J3B A;  3EFR A;  2D6F A;  4DOW A;  3RIR A;  1KD1 C;  3JB9 H;  4M77 F;  4XTY A;  4OB0 B;  4JS5 A;  3WXM B;  2K5L A;  3QKJ A;  1JJ2 P;  1IB8 A;  1YI2 A;  3UA7 A;  4KUL A;  1I5O B;  2CP2 A;  3HRT A;  5HKC A;  4J5Y A;  3NPF A;  4IIM A;  4JLG A;  1R8O B;  3CXC P;  4FSX A;  4JPB W;  4M77 A;  1QW1 A;  4EMG A;  4HT9 A;  3FLG A;  1GRI A;  4C92 B;  2XID A;  2K5F A;  2F2V A;  2OTJ A;  1WJR A;  2X35 A;  1UFF A;  1MND A;  8AT1 B;  2IVW A;  1YN8 A;  3JCM h;  3OA6 A;  1Q86 C;  2P4T A;  1VA7 A;  1N8R R;  3D7S B;  3LWI A;  1UTI A;  1YHQ T;  2NWM A;  1VQ6 T;  1B34 A;  3CCV A;  5LJ3 d;  1FX7 A;  3M54 A;  2E41 A;  1ZA2 B;  2QA4 T;  5CR2 A;  2VUB A;  2KXD A;  2AK5 A;  3E19 A;  2DMO A;  3CC2 T;  1D1A A;  4Z02 A;  1EZZ B;  1KC8 R;  1M2O A;  4C92 E;  5LJ3 f;  1T0J A;  4GBQ A;  3OYB A;  4M75 F;  4M75 G;  1WYX A;  1LOJ A;  1U1T A;  3EFS A;  1YIT A;  4ELZ C;  5GAN h;  1YJ9 Q;  4J9H A;  3VS7 A;  3CCJ Q;  1NM7 A;  1NEG A;  2PUK B;  3A8L B;  1AEY A;  2DPP B;  1CSK A;  4PJL A;  1VQK Q;  2K5I A;  3L2Z A;  3O8V A;  2C0I A;  2CDT A;  3QBY A;  2HEQ A;  1OPL A;  1RLQ C;  1T0H A;  3A8O B;  4EIK A;  1N9S A;  1ZUU A;  2QQS A;  2WAC A;  3QSU A;  2CZ0 B;  3H6Z A;  3EG9 A;  4FYX B;  1Y07 A;  4HCZ A;  1NE8 A;  2ECZ A;  1PCX A;  2CKK A;  4J7F A;  2DE0 X;  3DLL A;  1X01 A;  1HD3 A;  3EGU A;  2DLP A;  2NLU A;  3L2W A;  2RO0 A;  4ELY C;  1ACM B;  2KMT A;  5LJ3 h;  1NBE B;  3MPU B;  1VIE A;  4GLK A;  5CQX A;  1PM3 A;  2KEA A;  4M7D C;  1PHT A;  4M7D A;  2RJD A;  3G6E Q;  1RLP C;  3CCQ Q;  1VQ8 A;  2LRQ A;  3X24 B;  2RI2 A;  1N5Z A;  1XNI A;  1ZLM A;  1PNJ A;  4V2S A;  4F7U F;  4J9I A;  5GAN 6;  2V8J A;  1I4K 1;  2JW4 A;  1BBZ A;  4MDW A;  1VQ4 A;  2VC8 A;  4FL6 A;  4RTW A;  5GAN 7;  4CC3 A;  4FW1 A;  1UGR B;  2NUZ A;  3M0Q A;  4AFU C;  3UDC A;  1JXO A;  2XK0 A;  1RI9 A;  1M90 C;  1B3Q A;  1UGP B;  1PSF A;  5A0D A;  3H0H A;  5I22 A;  4PJO F;  1V76 A;  4JRP A;  2EYX A;  2BZY A;  2L89 A;  2JUF A;  2I0N A;  1Q86 R;  2FYK A;  4J9B A;  1GCP A;  2RJC A;  2YUP A;  2O2O A;  1TTH B;  2PUO B;  1PG5 B;  1KHC A;  1YIJ Q;  1W2B A;  1Y71 A;  1UG1 A;  4LUE A;  4E7S A;  1WA7 A;  1KQS S;  2EQM A;  4AT1 B;  4WF2 A;  3JCM g;  2SEM A;  1QVP A;  3X28 B;  2E12 A;  4QVC A;  2JZ2 A;  2RK2 A;  1EIF A;  1VQP A;  4QT7 A;  4OB1 B;  1QKX A;  2CH4 W;  1VQO T;  3HL8 A;  4KGV B;  2VGM A;  3VUB A;  2P0Q A;  4QW2 A;  3HSB A;  1YWP A;  3URG A;  1XJW B;  2XHC A;  4ZTJ A;  4M7A F;  3FJP A;  4LDU A;  3I55 Q;  2DEQ A;  5CKH A;  1RAA B;  4PJO B;  4X1V A;  1KQ2 A;  3CC7 Q;  1T3L A;  1ZA1 B;  2K3B A;  3OYI A;  1RAD B;  3A8H B;  3A98 A;  2LZ6 B;  2QYZ A;  4Y92 A;  3OSS C;  2OTL T;  1SRL A;  3OY9 A;  1SSH A;  3JCM X;  1M5Q 1;  4XTV A;  1M2V B;  2PVD B;  2CS7 A;  4M77 B;  3MJX A;  3KFV A;  2JOY A;  1C6V X;  5GAN 3;  4CC2 A;  2DJZ A;  1SHF A;  1S72 T;  3C94 A;  5IT9 E;  1B7T A;  2L5Q A;  3CCL A;  1OZ3 A;  1X2K A;  2DIG A;  1K8A U;  5LJ5 f;  3M56 A;  1I07 A;  3CXC A;  5CCA A;  3JCM b;  4OMM A;  1VQM T;  1FMK A;  5A0L A;  3CC7 T;  2DA9 A;  3QHS A;  1ARK A;  4AFS C;  2YUO A;  5GAN 4;  2JMA A;  3M57 A;  4M78 F;  3JCM W;  1BIA A;  1YFN A;  4KUI A;  1KC8 U;  4IUR A;  5CIU A;  4FYW B;  3EFO A;  4RG8 A;  2HD0 A;  1VQ9 A;  2EYW A;  2ZPH B;  3S3O A;  5IAY A;  2KYB A;  1VQM A;  5KCO A;  2XD0 A;  2PVG B;  1RAE B;  2VB6 A;  4M7A C;  3JCM e;  3CXC S;  2EGA A;  2D8H A;  2O88 A;  5FWC A;  5LL6 S;  1LVK A;  2NUP A;  2OAW A;  3GNF B;  2H3E B;  1JB0 E;  1PC0 A;  5HK0 A;  4M7D G;  2DJQ A;  2RQW A;  1A0N B;  5DM7 R;  4M77 C;  5A0G A;  2MAM A;  3PFS A;  2HDA A;  4LXC A;  1SPK A;  2OTJ Q;  3ER0 A;  2Y90 A;  1AZE A;  2M16 A;  3M9Q A;  1GBQ A;  4E7Z A;  1G5V A;  1TXQ A;  3RKW A;  3JSC A;  2RF0 A;  1W70 A;  1VQ8 Q;  3OMC A;  2YUQ A;  2GBQ A;  2JMC A;  1VQN Q;  3DLM A;  1D0Z A;  2KRS A;  2G6F X;  3MEW A;  3SB2 A;  4C8Q A;  4KUD K;  4JUV A;  3FC3 A;  1MMN A;  4L5G A;  1RL2 A;  3R6O A;  4ESR A;  3JCM J;  1QWF A;  3NTK A;  4PJM A;  3VU3 C;  3EFO B;  4CC7 A;  1Q82 R;  3M0S A;  1IZ6 A;  2EJG A;  2YLB A;  4J83 A;  2GQI A;  4WCI A;  3I56 T;  1OZ2 A;  4GY5 A;  1UE9 A;  2RB6 A;  1C1A A;  1K4U S;  4PLI A;  1LJO A;  1W2B S;  2JTM A;  2FB7 A;  4GLM A;  1U06 A;  2R57 A;  3UWN A;  2J7I A;  5GAN j;  1YJW T;  2A08 A;  1YJN Q;  2XDP A;  3P8B B;  4ZTF A;  4N0A A;  4N0A C;  3TSZ A;  2YHT A;  4M75 B;  3T9N A;  4M7D E;  2XU8 A;  4M78 G;  4BI3 A;  1N8R U;  3F70 A;  1N6A A;  2MWO A;  5C6S A;  2DX1 A;  2VXF A;  4QQ6 A;  3HHT B;  2CP7 A;  4A4K A;  3L2R A;  4FYV B;  5DY9 A;  2RNA A;  2EYZ A;  1G3T A;  2A0F B;  2DKG A;  4PFP A;  2QQB A;  2LP5 A;  3BFM A;  1AWW A;  5LJ3 g;  1M1F A;  1PD0 A;  3MEA A;  4Z88 A;  4M7A D;  1WDX A;  4C92 A;  4C92 C;  1Q7Y R;  4OMN A;  3ZEH A;  3C95 A;  1M90 U;  1Y7X A;  1ZX6 A;  4RUG A;  4XTZ A;  2BKD N;  3TEE A;  5KE3 A;  4MZP A;  3E9F A;  2J6O A;  2Y4Y A;  3QYG B;  4C92 G;  2E65 A;  2RA2 A;  1O9S A;  3QPH A;  3VS5 A;  2J05 A;  1VQL Q;  3M58 A;  1OX9 A;  2QDL A;  3PT9 A;  2EYQ A;  4II1 A;  2LNH B;  2IPO B;  1Q81 U;  3RKY A;  3JB9 G;  3QG1 A;  2E5K A;  2DTO A;  4C8Q G;  2B8A A;  1YI2 T;  5KH6 A;  1NJI C;  2EVR A;  1QMC A;  4M78 E;  4PJO D;  4LDX A;  3CMA A;  1OU8 A;  1PKS A;  2VVK A;  2LVM A;  4F14 A;  1X43 A;  3EH1 A;  1WHG A;  1W6X A;  2L3S A;  4DA4 A;  4F7U E;  2QQA A;  3CCQ T;  2M51 A;  3QZ9 B;  4RKU E;  2E64 A;  4C0D B;  2QEX A;  4RCC A;  2ED1 A;  3CEY A;  4JZ4 A;  1C0M A;  5EG2 A;  1ZSZ B;  2DF6 A;  4J7I A;  3CCR A;  3PE0 A;  2HBP A;  4EMK C;  3MHX A;  4F7U B;  4HCB A;  1RUW A;  2X51 A;  4LNP A;  2LDM A;  3MP6 A;  1SG5 A;  4C0F A;  3NGP A;  3RUX A;  3UPU A;  2EW3 A;  1BI1 A;  5FU6 C;  2FEI A;  2A37 A;  2FPD A;  3UT1 A;  1SSF A;  3M53 A;  2BE9 B;  1QQJ A;  2YWW A;  2OTL Q;  2CT4 A;  2KGT A;  2QK0 A;  1IRE B;  4J9F A;  1X69 A;  4MZM A;  2L8D A;  5FWB A;  3CCJ T;  3L42 A;  5HCK A;  1G3S A;  2QA4 A;  3VRY A;  1B07 A;  5GAM e;  2C06 A;  2R5A A;  1WIE A;  2MPX C;  3PIP A;  4C0Z A;  4QVD A;  3J7A F;  5L23 A;  3S6W A;  1VQ8 T;  2YUN A;  4J9G A;  2RHU A;  2VV5 A;  1M8V A;  2RK1 A;  1YJ9 A;  2DFU A;  1W2B P;  4M7A E;  1YIT Q;  1AWO A;  4RMO A;  2K9G A;  3R6N A;  2LQK A;  2DM1 A;  4DQ2 A;  2FO0 A;  3CBP A;  2JNG A;  4ME7 A;  1VQ5 T;  2FPE A;  4KGX B;  3DKM A;  1VQ6 Q;  3G4S Q;  2LNV A;  4R0K A;  5J39 A;  3EGD B;  3CC4 Q;  2VKN A;  5IHK A;  1QVG P;  5KYU A;  4WTO B;  4M78 C;  1E6H A;  2RD1 A;  4EMK B;  3MP1 A;  2COW A;  1H64 1;  1YJN A;  2EYY A;  2E3H A;  3M55 A;  3LX7 A;  3VRZ A;  3VV0 A;  2MWP A;  4KT0 E;  4C5I A;  3QJ6 A;  5FU6 B;  2M0Y A;  1OQK A;  3CCS T;  4M7A A;  2LJ1 A;  2RI3 A;  4IUP A;  1FWZ A;  2O01 E;  2JS2 A;  1M90 R;  1B34 B;  5L8R E;  5LJ5 e;  1PRM C;  2K2V A;  3OYL A;  2CRE A;  2KXC A;  3EHQ A;  5GMK h;  1G8X A;  3HKS A;  1D3B A;  4A4G A;  4XTU A;  2DVE A;  1RAB B;  2L3R A;  3LGL A;  5IH2 A;  1WLP B;  2KAF A;  1BB9 A;  2HKQ B;  4JRQ A;  2M9U A;  2V8I A;  1M9S A;  4DEY A;  3SD4 A;  2ED0 A;  2HSP A;  2QI2 A;  4C5E A;  3A8M B;  3JRZ A;  1FMV A;  2J06 A;  4MML A;  4XQ3 A;  3QXE B;  1YI2 Q;  4DOV A;  2YLC A;  3ZFJ A;  3CCS Q;  2LX7 A;  4N4H A;  5GAM f;  1Q81 C;  3V7S A;  2RQT A;  1MMD A;  1TUG B;  2VXE A;  3EGX A;  1W4S A;  2ZAE A;  2YT6 A;  3QII A;  3CD6 Q;  2ZPG B;  2O9V A;  2X4X A;  2V1R A;  2W0Z A;  4C8Q C;  5KYW A;  4XK8 E;  1VQK A;  1KSW A;  2HQX A;  2JM8 A;  4F17 A;  1VUB A;  2K6D A;  3TU4 K;  1Q7Y U;  1VQ5 Q;  1H92 A;  4FM4 B;  1HYO A;  2MK5 A;  2LCS A;  2R5M A;  1CKA A;  2P0P A;  4J9D A;  4PJJ A;  2FHD A;  4JS4 A;  3EGD A;  1QWE A;  1VIF A;  3V7R A;  1Z9Z A;  4BI4 A;  3OYN A;  2CZ6 B;  3HFN A;  1LCK A;  1OPK A;  4M7D F;  1ZHI A;  5GAM g;  4CI0 C;  2X4W A;  3MET A;  3CC2 A;  1CKB A;  2LQW A;  2DL3 A;  2MOX A;  3CCV Q;  1MHN A;  1PRL C;  2K4Y A;  2DVJ A;  4BB7 A;  2ROL A;  3CPF A;  1I8F A;  2IIM A;  1VQ5 A;  1GBR A;  3M0T A;  4M4Z A;  2HAX A;  2ZPF B;  3C0C A;  2GNC A;  4KBM B;  4ANJ A;  3AT1 B;  4ZGE B;  4ZNX A;  2WSE E;  4M75 C;  1BI2 A;  3M0U A;  3FEO A;  3GBQ A;  2R58 A;  2DNU A;  1M4Z A;  3REB B;  2YRC A;  4Y91 A;  5KYW B;  9ATC B;  1AHJ B;  1VQP T;  3M0R A;  3CME A;  3RMQ A;  2RHZ A;  3OBY A;  3CCS A;  2X9H A;  3FJ5 A;  1VQK T;  1NLO C;  2OX7 A;  3CCU T;  2K7A A;  4F7U A;  4LDV A;  4HT8 A;  4FT2 A;  3U23 A;  1R77 A;  2WSF E;  4A63 B;  1Q95 G;  1X6B A;  3JB9 J;  2AKL A;  5GAM j;  2NUT A;  3RER A;  2YRD A;  3ULR B;  3C12 A;  1KJW A;  5GAN 2;  1Y96 A;  5GMK e;  4M7A B;  2YXY A;  1BYM A;  4BE2 A;  1O75 A;  5GMK l;  1VQL T;  1VQ7 Q;  2EJF A;  2QG9 B;  1QLY A;  3G4S T;  1BCM A;  1IGU A;  3KBG A;  1QCF A;  3CC4 A;  6AT1 B;  2PZ1 A;  2AZS A;  3CC4 T;  1D1C A;  1WHL A;  4EMH A;  4C0D C;  1QP3 A;  2PVO B;  2RQR A;  1NYG A;  3MCA B;  1KG1 A;  4KH0 B;  3ASK A;  2RHX A;  1WHH A;  4JLI A;  1Y57 A;  1ZQ1 A;  5KYY B;  1BIB A;  1HJD A;  2CH4 A;  1N9R A;  2E4H A;  3EGX B;  1H8K A;  3JCM P;  1U5S A;  4B9X A;  3JCM c;  5CVI A;  1X27 A;  2GTJ A;  1BK2 A;  2JVV A;  2YSQ A;  2M02 A;  2CUB A;  1OU9 A;  3OYG A;  1KQ1 A;  4IIO A;  4LDW A;  2E3I A;  2CYZ B;  4ZN3 A;  5D7U A;  4HVV A;  1U8R A;  3GP8 A;  1OV3 A;  1Q82 C;  3JB9 F;  2P0K A;  1M1K R;  1AWX A;  2F2W A;  3VS4 A;  5GAM d;  1KHI A;  1M30 A;  1JJ2 A;  4JJB A;  5KCH A;  5LJ5 d;  5GAM h;  4NOY A;  7AT1 B;  2RI5 A;  3QYH B;  1V1C A;  5FRM A;  2MCN A;  1R0B G;  2E70 A;  2JT4 A;  2BIV A;  3FRN A;  1BCO A;  3BW1 A;  3EG0 A;  1NJI U;  4EDU A;  4PLL A;  1YJW Q;  4AG2 C;  5C0M A;  3LGF A;  2XKO C;  2DL4 A;  3CCR Q;  5GAO r;  3EG1 A;  3G71 Q;  1JXM A;  2EWN A;  4EMK A;  5GMK i;  1VQO Q;  4PL6 A;  1XTD A;  3OYE A;  2KNB B;  2MYS A;  3J81 E;  1FMW A;  3RNJ A;  1SHG A;  2IG0 A;  2XMF A;  3QDR B;  3LWH A;  3I55 T;  1H3H A;  1AT1 B;  1M27 C;  2CSQ A;  3BDU A;  4M7D D;  4A53 A;  2DYB A;  3HTR A;  4M77 E;  4BI8 B;  5FU7 B;  4XTW A;  3JV3 A;  2CP0 A;  3A8G B;  3LH5 A;  1WJS A;  2MIO A;  2VGN A;  4OMQ A;  2ESW A;  4BE0 A;  3V8J A;  1PSE A;  2E10 A;  5CO7 A;  5D6Y A;  4XTX A;  2AKK A;  3I55 A;  2COY A;  2LC4 A;  3LW5 E;  3CCM Q;  3G71 T;  2RJF A;  4RCB A;  4M78 B;  1BKB A;  3OYK A;  4QQD A;  1VYV A;  4LD9 K;  1EFN A;  2KY9 A;  1WX6 A;  3ZL7 C;  1VQL A;  1U1S A;  1UEB A;  2FRY A;  1UHC A;  5GAO l;  2ZPE B;  4BY6 C;  3JCM d;  3X26 B;  4PNO A;  4RG2 A;  3A5Z B;  4C8Q B;  1EX4 A;  4AMC A;  2H3J A;  3JCM f;  1BI0 A;  3X25 B;  5LJ5 h;  1WI7 A;  3RES A;  3AHU A;  2CGH A;  2DZ9 A;  4M7D B;  3OBW A;  1OI1 A;  3N5B B;  5M9O A;  3HPW A;  2PTK A;  4P5N A;  2M1H A;  5KYX B;  3A1P A;  2PNI A;  1LPL A;  3G6E A;  1QCN A;  3OYC A;  3RKX A;  2ATC B;  1JBM A;  1ZSZ A;  4FW2 A;  4BD3 A;  5GMK m;  4FSS A;  2LTO A;  2RQV A;  3RBB B;  3OQ5 A;  3TVT A;  4KGZ B;  5J26 A;  2EGC A;  4RTU A;  3WVD B;  3CMA T;  1YJ9 T;  2VYT A;  2X4J A;  3DB4 A;  3OSV A;  1K9A A;  3S3N A;  2OAU A;  4HVW A;  5CKD A;  1PKT A;  2KBT A;  1RI0 A;  2PQW A;  3I56 A;  1SF9 A;  2EIF A;  4J9E A;  4YTL A;  4E7J A;  3I5S A;  4IUU A;  5LJ5 g;  4FT4 A;  2DK3 A;  2J6F A;  2KRN A;  2K3X A;  4IUT A;  1GFC A;  3VS3 A;  1M1K C;  2LJ0 A;  3GOX A;  4D8D A;  1J3T A;  1D09 B;  2FG0 A;  3SFM A;  3CMA Q;  1UGV A;  2EJ9 A;  3NTI A;  4RTV A;  3QDF A;  5GAO n;  5D6W A;  1K1Z A;  1YHQ Q;  3INZ A;  3QWY A;  4JJD A;  5GMK j;  1NPP A;  4RTZ A;  1QP2 A;  3E1S A;  1Q82 U;  3H0I A;  3GIB A;  3SHW A;  1K9M C;  3VS0 A;  1WXU A;  4DBF A;  4JDS A;  2V26 A;  3CC2 Q;  2ABL A;  2DL8 A;  3G7Z A;  3H0F A;  1M2V A;  1QVF A;  5DLO A;  2H8H A;  2F1L A;  3X20 B;  4R55 A;  2DIQ A;  5I2M A;  1JQQ A;  2XI9 A;  1ABQ A;  2GF7 A;  3JB9 D;  5CKF A;  1AZG B;  1R0C B;  3CBM A;  2M0O A;  2RM4 A;  4OMO A;  2RPN A;  1K73 C;  1KFZ A;  4ZGJ B;  1M3B A;  4O5V A;  2HSE B;  4JRK A;  3OMG A;  3REA B;  3NFC A;  1ABO A;  3VS1 A;  4OB2 B;  3CQT A;  1ZSZ C;  3QJY A;  1VQ7 T;  2HNI A;  2EAY A;  1QVF S;  4E6R A;  3E2U A;  4LUD A;  4MZT A;  1T3S A;  2DXU A;  1RAC B;  2YRV A;  1HSQ A;  1Q86 U;  1QKW A;  2P4R A;  4J6X A;  2FZK B;  4DEX A;  3CCM T;  2BE7 D;  2MI6 A;  1HXD A;  4DBR A;  4C8Q E;  1WQW A;  2D8J A;  1VOM A;  3UF4 A;  2I2L A;  2QXF A;  4C8Q D;  2HMA A;  5CKE A;  4LN2 A;  2MF2 A;  5I21 A;  3SDZ A;  2FVU A;  3M0P A;  2HBW A;  4RTY A;  2JTF A;  3VUZ A;  5KE2 A;  4DBQ A;  1K9M U;  4M78 D;  2L2P A;  4BDZ A;  3MKD A;  2LJ3 A;  4RTT A;  1WHM A; 
#chains in the Genus database with same CATH homology
 2DVJ A;  2ROL A;  2JXB A;  2L3P A;  2IIM A;  1GBR A;  1ZSG A;  2JTE A;  2EGA A;  4AFZ C;  2D8H A;  3M0T A;  2O88 A;  2AZV A;  5FWC A;  4D8K A;  2VWF A;  4M4Z A;  2KRM A;  4F16 A;  1MV3 A;  2OAW A;  3C0C A;  2GNC A;  2A36 A;  4ZNX A;  3VS2 A;  5IXB A;  3M0U A;  3GBQ A;  2C0T A;  2DNU A;  1X6G A;  3I35 A;  4AFQ C;  3REB B;  2DJQ A;  2RQW A;  2EPD A;  1A0N B;  1NYF A;  3NMZ C;  1WFW A;  1G2B A;  2HDA A;  3M0R A;  1OEB A;  1TUC A;  1SPK A;  1BU1 A;  5IHN A;  1ZUK A;  1AZE A;  1GBQ A;  3EHR A;  3FJ5 A;  1NLO C;  2RF0 A;  1W70 A;  2K7A A;  2YUQ A;  2GBQ A;  2JMC A;  2OJ2 A;  1U3O A;  2DL7 A;  2KRS A;  2G6F X;  3U23 A;  1UJY A;  1KIK A;  2EGE A;  2DRK A;  4A63 B;  2A28 A;  1GL5 A;  3I5R A;  2LMJ A;  2SRC A;  1X6B A;  4ESR A;  1QWF A;  1JU5 C;  2AKL A;  2O31 A;  1GCQ A;  2W10 A;  4CC7 A;  2O9S A;  3M0S A;  3PVL A;  3ULR B;  1KJW A;  2GQI A;  4WCI A;  5FW9 A;  4LE9 A;  1UE9 A;  1K4U S;  1SRM A;  2RQU A;  1X2Q A;  1OOT A;  1MV0 B;  1QLY A;  4GLM A;  1U06 A;  2J7I A;  2BZ8 A;  2A08 A;  5I11 A;  2X3W D;  1QCF A;  2DL5 A;  3QWX X;  4Z8A A;  2CUD A;  1WXT A;  3SEM A;  2PZ1 A;  2AZS A;  2KR3 A;  1YWO A;  3TSZ A;  1E7O A;  1W1F A;  1M3A A;  2RQR A;  1NYG A;  2EBP A;  1Y57 A;  2DIL A;  2DX1 A;  1HJD A;  2CH4 A;  3UA7 A;  2KT1 A;  1H8K A;  2V1Q A;  2EKH A;  1U5S A;  2RNA A;  1AD5 A;  1X27 A;  2GTJ A;  3NPF A;  1BK2 A;  2EYZ A;  4IIM A;  4JPB W;  1IO6 A;  2LP5 A;  3H41 A;  2YSQ A;  1AWW A;  1K0X A;  5EC7 A;  2CUB A;  4Z88 A;  1GRI A;  1WDX A;  3NHN A;  4IIO A;  2JS0 A;  4HXJ A;  4OMP A;  4OMN A;  2F2V A;  4HVV A;  1ZX6 A;  4RUG A;  1UFF A;  4K11 A;  1OV3 A;  1Y0M A;  1AWX A;  1YN8 A;  2F2W A;  3VS4 A;  1M30 A;  1VA7 A;  4JJB A;  2J6O A;  2RMO A;  1UTI A;  1ZBJ A;  2NWM A;  2CSI A;  2L0A A;  1M3C A;  2KRO A;  3VS5 A;  1V1C A;  2J05 A;  1I0C A;  2MCN A;  2JT4 A;  3THK A;  2QDL A;  3EG0 A;  2KXD A;  2AK5 A;  4AG2 C;  2F2X A;  2OI3 A;  2LNH B;  1TUD A;  2DL4 A;  1VYT A;  1UUE A;  3EG1 A;  1JXM A;  1UJ0 A;  2DMO A;  1YNZ A;  1E6G A;  2KNB B;  1T0J A;  2BTT A;  2E5K A;  4GBQ A;  3RNJ A;  1SHG A;  1GFD A;  2DBM A;  1WYX A;  2XMF A;  2EVR A;  1PKS A;  4F14 A;  2VVK A;  1H3H A;  1X43 A;  1M27 C;  2CSQ A;  3IQL A;  4J9H A;  4KRT A;  3VS7 A;  1W6X A;  1UDL A;  2DRM A;  2L3S A;  1FYN A;  1NM7 A;  1NEG A;  2M51 A;  1AEY A;  2DYB A;  2D1X A;  2LQN A;  1CSK A;  3I9Q A;  3JV3 A;  2C0I A;  2ED1 A;  4JZ4 A;  2CDT A;  3LH5 A;  2HEQ A;  1OPL A;  2MIO A;  4OMQ A;  1RLQ C;  2ESW A;  2DF6 A;  1T0H A;  1YCS B;  4EIK A;  3PE0 A;  2AKK A;  2GTO A;  1RUW A;  1ZUU A;  1AVZ C;  4LNP A;  3TSW A;  2GGR A;  3NGP A;  1VYV A;  1EFN A;  5GJV B;  1WX6 A;  3ZL7 C;  2EW3 A;  2FRY A;  2ECZ A;  1UHC A;  2FEI A;  2A37 A;  2FPD A;  4JJC A;  4HVU A;  2DE0 X;  1HD3 A;  3EGU A;  3EG3 A;  2DLP A;  1JO8 A;  2CT4 A;  2KGT A;  4HCK A;  4J9F A;  1WI7 A;  1X69 A;  5ECA A;  5FWB A;  3EG2 A;  2PTK A;  5HCK A;  2BZX A;  2KEA A;  1B07 A;  3VRY A;  1PHT A;  4OML A;  2PNI A;  1WIE A;  2KE9 A;  2DBK A;  1RLP C;  1N5Z A;  5GJW B;  5L23 A;  4ORZ A;  1ZLM A;  2YUN A;  2ENM A;  4J9G A;  1PNJ A;  2L3Q A;  5IXF A;  2K79 A;  4J9I A;  4FSS A;  1MUZ A;  2RQV A;  3RBB B;  2JW4 A;  1BBZ A;  4JZ3 A;  4AG1 C;  3TVT A;  2EGC A;  4RTW A;  1AWO A;  4RTU A;  4CC3 A;  2K9G A;  3R6N A;  2DM1 A;  2NUZ A;  2ROT A;  2K2M A;  3M0Q A;  2FO0 A;  1PWT A;  2X3X D;  2FPE A;  4AFU C;  1K9A A;  2D0N A;  4J9C A;  4HVW A;  1JXO A;  1PKT A;  2KBT A;  5IHI A;  1RI9 A;  4R0K A;  1B3Q A;  1XOV A;  2VKN A;  2HCK A;  5IHK A;  4J9E A;  3H0H A;  3I5S A;  5I22 A;  1AOJ A;  3UA6 A;  2EYX A;  2J6F A;  2KRN A;  2BZY A;  1E6H A;  2I0N A;  1GFC A;  4J9B A;  1GCP A;  3VS3 A;  1Z9Q A;  2YUP A;  2LJ0 A;  2O2O A;  4D8D A;  2EYY A;  1J3T A;  2FG0 A;  3VRZ A;  1UG1 A;  2YDL A;  4LUE A;  1UGV A;  4RTV A;  1WA7 A;  1M8M A;  1NLP C;  2M0Y A;  1K1Z A;  1ZUY A;  2SEM A;  2LJ1 A;  3QWY A;  4JJD A;  2JS2 A;  4RTZ A;  3PVQ A;  2EQI A;  1TG0 A;  4RTX A;  3H0I A;  1PRM C;  1SEM A;  2CRE A;  3SHW A;  2KXC A;  4QT7 A;  1YP5 A;  1QKX A;  3EHQ A;  3VS0 A;  1WXU A;  2CH4 W;  1AWJ A;  2ABL A;  2DL8 A;  1YWP A;  5IH2 A;  1WLP B;  3H0F A;  1BB9 A;  1UEC A;  4DEY A;  1S1N A;  2H8H A;  2ED0 A;  2HSP A;  1JQQ A;  1ABQ A;  2J06 A;  4X1V A;  1UHF A;  1AZG B;  1T3L A;  2LX7 A;  2K3B A;  1K0S A;  2FPF A;  1VYU A;  4OMO A;  2RQT A;  3UAT A;  2RPN A;  2KYM A;  3A98 A;  1KFZ A;  2LZ6 B;  1M3B A;  4Y92 A;  4CC4 B;  2YT6 A;  1SRL A;  1SSH A;  3REA B;  2CT3 A;  1ABO A;  3VS1 A;  2O9V A;  3CQT A;  4Z89 A;  2B86 A;  2V1R A;  2W0Z A;  1NEB A;  4E6R A;  3KFV A;  4LUD A;  2KT8 A;  4CC2 A;  1KSW A;  1SHF A;  1T3S A;  2J6K A;  2JM8 A;  4F17 A;  1HSQ A;  2K6D A;  2JM9 A;  1QKW A;  2P4R A;  1H92 A;  1X2K A;  1JEG A;  1GCQ C;  2C0O A;  4DEX A;  2RN8 A;  2LCS A;  1I07 A;  1CKA A;  1WXB A;  2D8J A;  4OMM A;  1FMK A;  1I1J A;  3UF4 A;  4J9D A;  2DA9 A;  1K76 A;  4LN2 A;  1QWE A;  1ARK A;  4AFS C;  1Z9Z A;  2YUO A;  2JMA A;  2FRW A;  3M0P A;  1LCK A;  2HBW A;  1OPK A;  4RTY A;  3O5Z A;  1NG2 A;  2EYW A;  2L2P A;  1CKB A;  1G83 A;  2LQW A;  2LJ3 A;  2KYB A;  4RTT A;  2DL3 A;  3VS6 A;  2MOX A;  1PRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...