3EG1A

Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg1A00
3VS3A 2ENMA 2A08A 4JPBW 4KRTA 2K6DA 2HEQA 3M0SA 4E6RA 2JMCA 4OMPA 1UGVA 3VS6A 1CKAA 3TSZA 2BZYA 1KIKA 2DX1A 2KRNA 2AKKA 2KEAA 1ARKA 2FRYA 3H0IA 2SEMA 3JV3A 1T0JA 1ZUYA 2FO0A 2W0ZA 4J9HA 4RTYA 2HCKA 2LJ0A 1I0CA 2KRMA 2YUOA 3I9QA 3NGPA 2O88A 2K2MA 1YN8A 2RQTA 2O9VA 2AZVA 1YWOA 1B07A 3LH5A 3EG2A 1OOTA 2DL4A 1WDXA 1WYXA 1X2QA 5HCKA 1QWFA 1T0HA 1YP5A 4HVUA 3VS7A 1NYGA 1JEGA 2RNAA 1W6XA 2L3SA 1AWJA 2DYBA 3SEMA 1AEYA 3UATA 1UJYA 1S1NA 2FEIA 2JM9A 1TUCA 3QWYA 1AWWA 2VWFA 2PNIA 4R0KA 1UDLA 4X1VA 5FWCA 1JO8A 1QKXA 1LCKA 1ZBJA 2YT6A 2KRSA 2LJ1A 1WXUA 5IHIA 4J9FA 1T3SA 2KT1A 3VRYA 2A28A 3O5ZA 2D8HA 1OV3A 3RBBB 4F16A 1N5ZA 4J9CA 4CC4B 1PRLC 1E6GA 1NG2A 4J9GA 2DL5A 2L3QA 2X3XD 1K0SA 1KFZA 1Y0MA 4RTVA 4Z8AA 1JQQA 4WCIA 2DMOA 1PKSA 3I5SA 1GL5A 1WXTA 2X3WD 2ESWA 2L3PA 3VS1A 3UA6A 4IIMA 2KBTA 2LX7A 2YUQA 1YNZA 4AFSC 1VYVA 4J9EA 4RTUA 1MV0B 4OMLA 2YUPA 2EGCA 2RN8A 2H8HA 1RLPC 1GBQA 2FPEA 2J6FA 2KYMA 1JXMA 1AZGB 1X6GA 2RQVA 1M3BA 4F17A 2EYZA 2JXBA 2DM1A 2ED0A 2P4RA 1SPKA 1I07A 3I5RA 4OMOA 4LNPA 1FMKA 1BK2A 1K1ZA 1PHTA 2FPFA 2EYXA 1UECA 5EC7A 2GBQA 4HVWA 4J9IA 5L23A 1I1JA 5ECAA 1X6BA 2F2WA 1KSWA 1QKWA 1EFNA 3TSWA 4ORZA 1W1FA 4HCKA 2DF6A 2CH4A 3EG1A 2JS0A 2RPNA 2K79A 1U5SA 3PVQA 1J3TA 4RTZA 1AZEA 1WIEA 2EVRA 2LNHB 2DL8A 5I11A 1RUWA 2DRKA 2RF0A 2C0OA 1WXBA 1RI9A 1GFDA 5IHNA 1NEGA 4AG1C 2PTKA 2DRMA 2EYWA 1SRMA 4A63B 4Z89A 3UA7A 1WI7A 2DE0X 2KNBB 2ABLA 2I0NA 2CSIA 5IXFA 3VRZA 2CT3A 1BU1A 1K0XA 1AOJA 1BB9A 5FW9A 4Z88A 4K11A 2KYBA 1ABQA 1YWPA 4LE9A 1WX6A 1AVZC 1OPKA 4J9DA 2ROLA 4AFQC 1ZUKA 1ZX6A 2DJQA 1UTIA 1X69A 4DEXA 3ZL7C 5GJVB 4AFUC 2E5KA 3M0RA 2AZSA 1VYUA 2ROTA 2DBKA 1T3LA 4OMNA 1ZLMA 2EYYA 2MIOA 1ZSGA 2OJ2A 1WLPB 2JT4A 2BZ8A 2DL3A 4LUEA 1XOVA 2D0NA 1M8MA 1SHGA 2KXDA 2DBMA 4HXJA 2QDLA 4RTWA 4J9BA 2W10A 3U23A 3REAB 1MV3A 4GLMA 1PRMC 1UHCA 1UHFA 4JZ3A 3H0FA 1GBRA 1SSHA 2C0IA 1Z9QA 1M27C 2GNCA 4ESRA 1CSKA 3H0HA 4ZNXA 1AWOA 2RQUA 1K4US 5IHKA 3THKA 2MOXA 2IIMA 1FYNA 1W70A 1SEMA 3PE0A 2VKNA 1GCQA 2K9GA 1OPLA 2F2VA 2DL7A 2JTEA 3ULRB 1JU5C 5GJWB 3M0PA 2BTTA 2JS2A 3IQLA 4CC2A 1SHFA 2OI3A 2J6OA 2GGRA 3SHWA 3TVTA 3REBB 4FSSA 3M0UA 1X27A 2V1QA 3M0TA 2LZ6B 1NEBA 1M30A 3CQTA 1MUZA 5IXBA 2ECZA 2J06A 4D8DA 2CT4A 1QLYA 1U3OA 2FRWA 2SRCA 2EQIA 1HD3A 2L2PA 4D8KA 2EBPA 1GRIA 1HSQA 3QWXX 1VYTA 2EKHA 1H8KA 2A36A 2EGEA 2DVJA 2YDLA 2NUZA 1E6HA 2VVKA 3I35A 4AFZC 3M0QA 1TUDA 2F2XA 2CUBA 4Y92A 2YUNA 1BBZA 4OMMA 1WFWA 3GBQA 2DA9A 4EIKA 2G6FX 2JM8A 2KE9A 1G2BA 1PNJA 2XMFA 3PVLA 4RUGA 2CH4W 2PZ1A 2KROA 1IO6A 2B86A 5IH2A 2LMJA 4HVVA 1RLQC 1HJDA 2J7IA 2LQWA 2EW3A 1JXOA 2AK5A 3NPFA 3NMZC 2HBWA 2MCNA 4GBQA 2J6KA 2ED1A 4JJBA 1SRLA 1NLPC 1CKBA 2LCSA 3VS4A 1PKTA 1H3HA 4F14A 2JMAA 1K9AA 4OMQA 2LP5A 1UUEA 1TG0A 2K3BA 2O31A 2FG0A 3EGUA 2KR3A 2O9SA 2HSPA 2RMOA 4QT7A 1UG1A 2O2OA 1GCPA 1OEBA 4RTTA 1G83A 1QWEA 1H92A 1NYFA 2C0TA 1K76A 4LUDA 1WA7A 2AKLA 3KFVA 1M3AA 1VA7A 2DNUA 2J05A 3VS2A 1ABOA 1UE9A 1YCSB 2BZXA 2DLPA 3H41A 2CSQA 1NLOC 2K7AA 4IIOA 2RQRA 4CC7A 4JJDA 2D1XA 2EPDA 4M4ZA 1X2KA 2RQWA 1A0NB 2GTOA 3R6NA 2CDTA 1QCFA 3EHRA 1E7OA 2KT8A 1Y57A 2KGTA 2HDAA 3VS0A 2JW4A 4CC3A 2L0AA 2DILA 1Z9ZA 1GFCA 3A98A 1V1CA 5FWBA 3FJ5A 1B3QA 4JZ4A 1PWTA 2OAWA 2LJ3A 3EHQA 2YSQA 5I22A 2CUDA 1UJ0A 1NM7A 1X43A 2A37A 4JJCA 1M3CA 1UFFA 2GQIA 1ZUUA 3C0CA 1AD5A 3EG3A 3UF4A 2LQNA 2EGAA 2CREA 2GTJA 1KJWA 2M0YA 2M51A 2V1RA 4RTXA 3RNJA 3VS5A 2D8JA 4LN2A 1AWXA 3EG0A 4DEYA 2FPDA 4AG2C 2KXCA 2NWMA 3NHNA 1U06A 1GCQC
chains in the Genus database with same CATH superfamily
2DD5A 3VS3A 2KK4A 5LJ3f 3L2UA 2QQ9A 3QZ9B 4M78F 1OX9A 2LQKA 2DZCA 1K73C 3TSZA 2BZYA 3KXTA 1B34A 2RJEA 2KEAA 3GLXA 1ARKA 2SEMA 2FO0A 4A4KA 4ZTJA 1H3ZA 1I0CA 1M2VA 3JB9J 3I9QA 5EG2A 3G1JA 1VQ4A 2YRVA 1BIAA 4M7DB 1KHCA 3EG2A 2CZ7B 3EGXA 4XTXA 4ELZC 2DL4A 2EAYA 1OULA 1WYXA 4XTVA 5HCKA 1VQOA 1Y07A 1JEGA 2RNAA 1UGPB 4A53A 5GMKe 5GAMj 4L5GA 2QGFB 2KMTA 5GAN4 3GP8A 3JRZA 3SEMA 4BI3A 1S1NA 4PJOB 2JM9A 1TUCA 1XNIA 2PNIA 2OTJQ 1MHNA 2DIQA 5C6SA 1ZBJA 3A1PA 2LJ1A 1WXUA 1F1BB 4J9FA 1BI0A 3S3NA 3OA6A 1EZZB 3VRYA 2QQAA 2D9TA 4MDXA 3RBBB 4X34A 3N5BB 3J81E 1PRLC 1YIJT 2LT4A 1Y0MA 4RTVA 2XKOC 3L42A 3ASKA 2XIDA 4WCIA 5CKFA 2DMOA 4RMOA 1XQHA 3ZEHA 2GF7A 3HRUA 2COZA 2R57A 3JSCA 2VGMA 5LJ5j 2QQBA 2YUQA 3M56A 1KC8C 4NOYA 4LDUA 3M54A 3EFOB 4C5GA 2CP7A 4OMLA 4R55A 3CCQA 2EGCA 2RN8A 1OU9A 1GBQA 2WSFE 1K8AC 2KYMA 1AZGB 1X6GA 4M7AD 3QJYA 1YJ9A 2DM1A 5A2QE 4BE0A 2HQXA 1I07A 4L59A 1RAGB 4OMOA 4J7FA 2ZAEA 4LNPA 1I5LA 3QYHB 1K1ZA 1PHTA 1YHQQ 2YRDA 1M8VA 3ZFJA 5EC7A 4JLGA 2EQKA 2GBQA 4J9IA 1SKUB 2YLCA 2XDBA 4OVAA 3G71T 1VQ8T 2GFAA 4II1A 4HCKA 2RPNA 2RH2A 3L2WA 4E7KA 3META 3SWNC 1J3TA 4RTZA 2EVRA 3V8KA 1RUWA 4J5YA 1WQWA 3QHSA 3TREA 5IHNA 1ZA1B 1NEGA 2LDMA 1YI2Q 5CVIA 1SG5A 1WI7A 4KBMB 4HA8A 1K9MR 2P0KA 1RAFB 2I0NA 4PFZA 4FYVB 4AMCA 1Q81U 5FW9A 2KYBA 5CQXA 1ABQA 1WX6A 1AVZC 2GFUA 4M77A 2ROLA 2XHCA 4M75B 4AFQC 2DJQA 2CZ6B 1UTIA 2QK0A 5GAN3 1NE8A 3ZL7C 5GJVB 2ZPBB 3M0RA 1VYUA 5LJ3g 3MJXA 4C92F 2DJZA 3CBPA 1ZLMA 4LD6A 4AT1B 3FDRA 4PFPA 2DL3A 2FB7A 2IPOB 4M77D 1M8MA 2KXDA 1XTDA 1PD1A 1M4ZA 3UPUA 2L5QA 2K5LA 1PRMC 2RB6A 4IUQA 1UHCA 1QP3A 3H0FA 1GBRA 1NJIC 1M27C 1OQKA 2QA4Q 1TUGB 4C5EA 1CSKA 4OB3B 4ESRA 4N4HA 2HNIA 1KC8R 1FYNA 3FRNA 3M9QA 2VKNA 2CYZB 4PJOF 2DL7A 2R58A 2YWWA 2CP3A 4M78B 4ATOA 2BTTA 3OW2P 3CCJT 4EPCA 1N6AA 2JS2A 1X6OA 2E12A 2EKOA 2QEXQ 3CCQQ 2KY9A 1SHFA 3OYKA 2J6OA 4M77C 3SHWA 4M77E 1X27A 1D0YA 4CI0C 3PTAA 1W2BS 1M30A 1V29B 3CQTA 3CXCA 4ELYC 2V8JA 4BI4A 2J06A 3BDLA 3HSBA 4DQ2A 2CT4A 1IHWA 4IUUA 4D8KA 3FIFA 3QWXX 1VYTA 2E41A 3QO3A 1IGUA 2EGEA 2DVJA 1M2VB 3I35A 4AFZC 3FC3A 5LJ5f 3M0QA 4MMKA 4ZGEB 2CUBA 1QCNA 2EWNA 1BBZA 2DA9A 4EIKA 2X35A 4C8QB 2KE9A 1PNJA 2PZ1A 2B86A 4J7IA 1K73U 4ZTFA 1YI2A 4MDWA 4FT4A 3X28B 2JTFA 3G4SQ 4FT2A 1IB8A 3OYDA 1WJRA 1YITT 2FZCB 2AK5A 1XJWB 2HKNA 3NMZC 3NPFA 1VQPT 4MMLA 3HFOA 3VS4A 1Q86U 3LGFA 2JMAA 4EDUA 1JB0E 4BD3A 5FU6B 4OMQA 1UUEA 1TG0A 4BY6C 3QYGB 4HT8A 3MHXA 2RHUA 3MP6A 3WVEB 3OYLA 4M7AE 3E1SA 1OEBA 1G83A 4C0ZA 2FYKA 4KUDK 3F70A 1WQ7A 5FRNA 2C0TA 1KQSA 3M59A 2AKLA 1TXQA 3S6WA 2MWPA 2RI5A 4C92B 1VA7A 3CC4T 3ER0A 1UE9A 3CCVQ 2BZXA 2CSQA 3EH1A 1YITQ 1VQMA 2D1XA 4M4ZA 1QVFS 4XTWA 3OYBA 1A0NB 4OP0A 4RG8A 3EHRA 3SWNB 3I55Q 1BI3A 2KT8A 1Y57A 3VS0A 3HL8A 1GFCA 1PWTA 2OAWA 2LJ3A 5LL6S 3JB9G 4Y91A 2GQVA 3V8JA 5KH6A 4F7UA 1X43A 2A37A 3PMTA 3C0CA 4WF2A 4JRKA 2XK0A 1KQSP 4C0DB 1VQ7Q 1KJWA 2M0YA 1ZSZB 4IUTA 1U8RA 4J6WA 2MF2A 4VUBA 2FPDA 2E1HA 3QIIA 3DB3A 1C0MA 3E9FA 4FU6A 4LDXA 4C8QA 5GANe 2D6FA 3P8HA 3OBWA 5J39A 4NS5A 2O4XA 4J8OA 2JMCA 3QDRB 1OYXA 1D3BA 2EIFA 4OMPA 3VS6A 1CKAA 4C0FA 2OTJA 3GOXA 4QKUA 4PJOG 4JRIA 2DX1A 2QGGA 2AKKA 4JS5A 1TH7A 2FRYA 3CMET 1PSEA 3OSSC 3JV3A 4PK4A 3CCEQ 2DETA 4N4GA 1T0JA 1ZUYA 2JUFA 1VIEA 2Z0WA 4M75A 2HCKA 2KRMA 3FLGA 3OYJA 1VQ7A 3SFMA 2O9VA 3C4SA 2KI7A 1YWOA 3SD4A 3LH5A 2E64A 4LDVA 3BFMA 1OOTA 3GF5A 5HKCA 1WDXA 1X2QA 3OW2S 2QA4A 1D0XA 3JCMX 5J3BA 3RUXA 2L3SA 1GXIE 3A8GB 1AWJA 2FZGB 3OMCA 4HCZA 4RKUE 1AEYA 4EMKA 1UJYA 2FEIA 1AWWA 3QUIA 3P8BB 4M75C 2VWFA 3JCMP 5LJ5g 3M4YA 4R0KA 4X1VA 4C8QE 3CC4A 9ATCB 5GAMh 4XU3A 5DM7R 1VQ9Q 1LCKA 5KCHA 1EX4A 3CXCS 4Y28E 2MAMA 1C1AA 3URGA 1QMCA 2A28A 3O5ZA 4DBHA 2D8HA 1OV3A 2DEQA 2F69A 4PFOA 1BCOA 2VUBA 4J9GA 4M7AB 2M16A 1K0SA 1KFZA 4PNOA 1JQQA 4KH1B 4FW1A 2FL7A 3RKYA 5D6WA 1FWZA 2QASA 1KD1U 1GL5A 1VQ5T 3CMAQ 1IREB 2E10A 3UWNA 3CD6T 2E4HA 1RACB 1VQKT 2OX7A 4RTUA 2VYTA 1PG5B 2LT1A 3V7SA 2NUPB 5C0MA 2DXCA 2FPEA 4XU2A 1V76A 2RQVA 4F17A 2EYZA 2ED0A 4A4GA 4FYXB 2P4RA 2RO0A 2E6ZA 3I5RA 4GY5A 1Q86R 1BK2A 4DA4A 3JCMc 3H9NA 2FPFA 4PKCC 2ZPHB 4HVWA 4TVRA 4ANJA 5GAOq 2F2WA 1KG1A 1EFNA 1YJWA 1OU8A 2DTOA 5LJ5d 3X24B 3JB9D 3EG1A 2JS0A 4XQ3A 2F5KA 1S72Q 1HXDA 2WSEE 1KD1R 2XU8A 1AZEA 1WIEA 2LNHB 5I2MA 1X01A 3I55T 2RM4A 1WHJA 1PCXA 2DO3A 1RI9A 4FL6A 3QBYA 3CCJQ 2PTKA 2DRMA 1G5VA 1SRMA 1LJOA 3CC7A 2DE0X 2E6NA 2KNBB 4C0DC 3CC2A 5KE3A 3NFCA 1YJ9Q 1B34B 1AHJB 1UGSB 4A4HA 1VQPA 1BU1A 1K0XA 5GMKh 1O75A 4HCBA 2V26A 1YWPA 4LE9A 5KYWA 3ME9A 1ZUKA 2CP2A 2QEXA 2HBPA 5GAN5 4DEXA 4E2FB 1NPRA 1N8RR 2DFUA 2DBKA 4KGVB 1T3LA 4PL6A 4UC4A 1ZSGA 4FCYA 1MMDA 2RJCA 3JCMb 1LOJA 2D0NA 5GAOl 4HXJA 1TS9A 5LJ3e 3OMGA 3CCMA 2K5FA 3U23A 1IHVA 2E3IA 3REAB 4E7SA 4EMKC 1MV3A 4GLMA 3OS2A 3CCSQ 3KBGA 2RHIA 1QVFP 1UHFA 1SSHA 1G3TA 1Z9QA 2GNCA 4LXCA 4ZNXA 2ZGWA 3MEVA 2RQUA 1K4US 5IHKA 1W70A 2EYQA 2MWOA 2X9HA 1GCQA 3OYYA 2JTEA 2VASA 3ULRB 1JU5C 5FU7B 1M1GA 5GANj 3IQLA 2K57A 3OYCA 3CCQT 4IUVA 4KUIA 4CC2A 2NUTB 1DJ7B 2HAXA 3MEWA 4E7JA 4O6JA 3G71Q 3TQ7P 1HK9A 2XG8D 3REBB 4FYYB 1W2BA 5J26A 3PT9A 4N4IA 3OYIA 2QQSA 1D3BB 4JRQA 4J6XA 1RAEB 1PD0A 1Q95G 4JLIA 1Y96B 4DOVA 1KQ1A 4M75F 1SSFA 3X26B 2FRWA 2EQIA 1M1KC 3EFOA 1GRIA 4C8QC 4JS4A 1YJWT 4IUPA 3CMEQ 2FHDA 1K9MU 4N0AC 1WFWA 3GBQA 2G6FX 5CR2A 3I55A 1G2BA 2P0PA 3BDUA 2XMFA 3PVLA 2H3EB 4BI8B 4A54A 1OI1A 4KT0E 1RAIB 3OS5A 2DEUA 4P5NA 3C95A 3TEEA 1VQ5Q 3CXCP 4XK8E 3E9GA 2J6KA 1MNEA 4M7DE 2X4JA 1PKTA 1YIJQ 4F14A 2CS7A 1KD1C 2LP5A 1RL2A 4LDWA 3DKMA 2QA4T 3QXEB 4EMGA 4X9CA 2MYSA 4XTYA 3RR6A 2HSPA 2RMOA 1GCPA 2EQMA 4FSXA 3S3OA 2MPXC 2X4YA 3QZ5B 3BW1A 3OYFA 3CCMT 5KE2A 1FXXA 4LUDA 1NJIU 3KFVA 2LRQA 2F5TX 2DNUA 2J05A 1M90R 1YCSB 4PJNA 2E65A 3AT1B 5GAMe 4IIOA 1MMGA 2BE7D 3RMQA 1X2KA 2P84A 2XD0A 5GAN2 2GTOA 5FRMA 4C5IA 4M78E 1QCFA 2HDAA 4CC3A 4DBFA 1YIJA 1B3QA 2M0OA 4MZPA 1M5Q1 2M9UA 5GMKm 4V2SA 4C92C 2DZ9A 2MK5A 1W2BP 4C92E 1I5OB 4OGEA 1VQ5A 4IURA 4E7LA 5AT1B 1AD5A 3NTKA 3X20B 5LJ5e 2LQNA 2G3RA 4PJOD 1VQ6T 2EGAA 2CREA 3E2UA 4D6WA 2D8JA 3H6ZA 3EG0A 4DEYA 3OYHA 3CCST 1M1KU 4M7AG 2R5AA 1U06A 4DBQA 1MMAA 1Q86C 4YTLA 1GCQC 4NL2A 5CQYA 3EFRA 2RHYA 4A4EA 2A08A 4JPBW 4KRTA 1QVFA 2K6DA 3OQ5A 2FVUA 3CCRT 1TU0B 2NLUA 3CC4Q 3G71A 1OX8A 1VQ9T 2QI2A 2DVEA 2KDSA 3CCET 3VUZA 4J9HA 3JCMJ 2LJ0A 2ZPIB 3VU3C 1ZQ1A 3NGPA 2K2MA 2LVMA 1BCMA 2RQTA 3QKJA 2AZVA 1B07A 1VUBA 3SDZA 1PSFA 2HL5C 3GPLA 3CC7T 1X75C 5KYNA 4BY6B 4HVUA 1YP5A 2X51A 3VS7A 1K8AR 2RHXA 3JAME 3KUFA 5FU6C 2PVGB 3MEAA 3QWYA 2CZ0B 2C06A 3HTRA 2COWA 1TTHB 5FWCA 2DXTA 3EFSA 4A4FA 5GAN7 1Q82R 1QKXA 2YT6A 3GNFB 4OGCA 3A8LB 1T3SA 2OAUA 5DLQE 2KT1A 1WPYA 5CO7A 1N8RC 2DD4A 4F16A 2CGHA 2NUTA 2LX9A 2I2LA 4ZGJB 2X3XD 1UGRB 4HKEA 2JOYA 2VGNA 1M90C 5CCAA 2Y4YA 4HT9A 2AT1B 3OY9A 3D7SB 4C92A 2AHJB 4R56A 2HQEA 3LWIA 2L3PA 3VS1A 2KBTA 4M75E 3JB9I 4M77F 4PJOE 5GAMf 4AFSC 1RAHB 3CCJA 1MV0B 3SWNA 1B7TA 2YUPA 5KYYA 2IG0A 3CCLA 4C92D 4Q5WA 2H8HA 1RLPC 1YBYA 1YJWQ 2RK2A 1RAAB 1R0CB 1M3BA 1TWBA 3G6ET 2GCXA 2OTLA 5KCOA 4F7UB 3PIPA 1I81A 1WHLA 3CEYA 1D0ZA 5LJ3d 2DPPB 3CBMA 1WNLA 1UECA 3T9NA 4C92G 2L8DA 1PC0A 2X4XA 5ECAA 2LTOA 3LH0A 2KVQG 1KSWA 1TOVA 2K2VA 3C12A 3EGDA 4OMFB 4ORZA 3TSWA 2RA2A 1W1FA 5GAOr 2CH4A 5D6YA 2K4YA 3H8ZA 4M78C 3RIRA 2L89A 2DL8A 1RADB 2DRKA 2C0OA 1VQ6Q 1WXBA 2RJDA 2BKDN 3JCMQ 2EYWA 3BE3A 2YRCA 2ZZDA 4Z89A 3UA7A 2PVDB 2E5QA 2ABLA 2WSCE 1VQOT 2CSIA 2DTHA 4BB7A 5IXFA 1VQLA 3JCMe 2CT3A 1RABB 4XAXB 4OB1B 4Z88A 4K11A 2VC8A 2HSEB 4J9DA 2DERA 3E19A 1VQKQ 1O9SA 1HYOA 4C0GA 2CZ1B 2KQWA 3CCUA 2EQUA 1ZHIA 4OMNA 2OJ2A 1WLPB 2JT4A 4XTUA 3GIBA 4LUEA 1XOVA 4FM4B 1N9RA 1SHGA 2MI6A 2IVWA 2HQHA 4J9BA 5KYUB 2W10A 5FU7C 1LPLA 1VQNQ 1WHGA 4WTOB 1QVGP 4EMKB 1QVPA 4QQDA 2C0IA 3CC2Q 3H0HA 2QTVA 8AT1B 3S3MA 3L2ZA 3THKA 2MOXA 3PE0A 3MEUA 1YJNA 2K9GA 4E47A 4JDSA 2JZ2A 4ZGDB 2VXFA 1UEBA 2E3HA 4PJMA 4QW2A 3QSUA 3VYGA 3QPHA 2QG9B 2OI3A 4J83A 3EH2A 1M90U 3OYMA 1G3YA 3RDVA 1YJ9T 1NJIR 3PNWC 4MZTA 4PLIA 1NEBA 5DY9A 1YJNQ 5LJ5h 3VJPA 3DB4A 3OB9A 5IXBA 4O5VA 2COYA 1QVGS 1G8XA 4D8DA 1YHQT 1QLYA 3EGDB 1Q81R 5A0GA 1HD3A 4OB2B 2L2PA 3CCUQ 2EKHA 1H8KA 1KHIA 1UGQB 5CAIA 2RI3A 2NUZA 1E6HA 2NUPA 2VVKA 1TUDA 1R77A 4Y92A 2YUNA 5GANg 4LDYA 4M7DA 2JM8A 4M7AC 5CK9A 4PLLA 2CH4W 2KROA 1IO6A 1QQJA 1H641 2LMJA 2M1HA 4HVVA 2QYZA 4KGXB 3L2RA 2VV5A 4M75G 2LQWA 2EW3A 4RCCA 5CIUA 5M9OA 1QCOA 3C94A 2ZCFB 1S72A 3A8MB 3RKWA 3HFNA 1NLPC 1LNXA 1YFNA 2VXEA 1KQ2A 4E7HA 1H3HA 1VQ4T 1YCYA 3OS1A 3TU4K 1K9AA 2B8AA 1IGQA 2K3BA 3LX7A 2O31A 5HK3A 2FG0A 3EGUA 2KR3A 4QT7A 1UG1A 5KYUA 4RTTA 5CKEA 1QWEA 1H92A 1KK7A 2LCLA 1K76A 3QDFA 3OYGA 1VOMA 2DK3A 5KYWB 4KGZB 4DBRA 2LC4A 1BKBA 2DLPA 3H41A 1G3SA 1NLOC 2YHTA 4M75D 4JJDA 2EPDA 4M7DC 4F7UG 3RERA 1NZ9A 2LNVA 7AT1B 3VYHB 2RQWA 1YJNT 3OSVA 5KYYB 2JW4A 2L0AA 1K9MC 4B9XA 1Z9ZA 3A98A 1V1CA 3OBYA 3LWHA 3M4GA 4PJJA 2BIVA 4RG2A 2RJFA 1UJ0A 1NM7A 3M58A 5AYFA 2GQIA 3EAEA 3EG3A 2JJ9A 3QJ6A 3UF4A 4C8QG 2EJGA 3VV0A 2XI9A 1Q82U 4JRPA 2RHZA 1TSFA 3OW2A 1G3WA 2V1RA 1YHQA 2ZPEB 3VS5A 4BDYA 1FMWA 3VUBA 4AG2C 3V7RA 3QG1A 1P92A 2A3LA 2CP0A 2KXCA 2NWMA 3G6EA 2OTLT 4QVDA 4E7ZA 5IN1A 1EIFA 2ENMA 4B6MA 1BIBA 2HEQA 2M02A 3EG9A 3M0SA 4E6RA 3J80E 2R5MA 1M1FA 2DKGA 3Q1JA 3NTIA 1YI2T 1UGVA 4J6YA 1KIKA 3CC7Q 3BY7A 1Y96A 3HKSA 4LD9K 2KRNA 1VQ8A 3M53A 5CKDA 3I56A 3GNGA 1VQMQ 1YITA 3H0IA 1KQSS 3CBOA 1N27A 1WZOA 2VB6A 3DLMA 2W0ZA 2CP5A 2NYSA 4RTYA 1R8OB 3WVDB 2YUOA 4GLKA 3FJPA 2O88A 2PUOB 3CPFA 4QQGA 1YN8A 1ACMB 4BE2A 8ATCB 1BI2A 3ZBDA 6AT1B 4M78G 4C8QF 4XU0A 1QWFA 1T0HA 1NYGA 1W6XA 5A0DA 5FLXE 1N8RU 3UDCA 2OTLQ 2JVVA 1K73R 1D09B 2DYBA 3HRTA 3UATA 1M9SA 2EJ9A 4ZN3A 2DXBA 3G7ZA 4F7UE 3CCLQ 4Z02A 4DOWA 1UDLA 2DIGA 3G4SA 1JO8A 2XDPA 5CKHA 3CCUT 4L6V5 3CPWA 1D1CA 2KRSA 1M2OA 5IHIA 5GAN6 5I2SA 3X25B 3J7AF 2EFIA 4M78A 1NBEB 5KYXA 1MNDA 1N5ZA 4J9CA 4CC4B 1E6GA 2DTIA 1NG2A 2DL5A 2L3QA 1VQNA 4M7AF 5GANd 1VQ4Q 2BE9B 4Z8AA 1I8FA 5IT9E 1Q7YU 3CPWP 3MKDA 1JJ2P 2PU9B 1QW1A 4M78D 1PKSA 1NPPA 1WHHA 2DXUA 3I5SA 5DLOA 1VQOQ 1R0BG 1WXTA 2X3WD 2ESWA 1Q82C 5FROA 3UA6A 4IIMA 3OYNA 2LX7A 2PVOB 1VQ6A 1I4K1 1YNZA 1VYVA 4J9EA 1D1BA 4BUGA 3CCVA 4ME7A 5GMKl 2ZPFB 2J6FA 1WGSA 1IZ6A 1JXMA 1UB4A 4IKFA 4F04B 5GANh 2JXBA 1Y7XA 2HMAA 1W4SA 3V8LA 1OZ3A 1SPKA 3M57A 3EG9B 3UT1A 2O4XB 2CKKA 3SB2A 1MMNA 4FW2A 5D7UA 3P8DA 1FMKA 4M77G 3CCRA 2EYXA 1WHKA 5L23A 1I1JA 2OTJT 1X6BA 5GANf 1SF9A 2QAZA 4E7IA 1QKWA 4M7DD 1PM3A 1BI1A 2DF6A 2EQJA 2K79A 3HRSA 1U5SA 3RKXA 4B9WA 3PVQA 5LJ3j 2YLBA 5I11A 1VQ7T 2RF0A 3CCMQ 2MMPA 1GFDA 4FYWB 3LW5E 4AG1C 2QTXA 4A63B 2F1LA 5GAN8 3A8HB 1JBMA 1D1AA 1KC8U 2X4WA 4OF1A 5LJ3h 3VRZA 4OB0B 1S72T 1AOJA 1BB9A 4PJLA 5GAOp 2QDYB 2WACA 1OPKA 2V8IA 3HHTB 1ZX6A 3JCMV 2KAFA 1X69A 2A7YA 4AFUC 2E5KA 2HL3A 4NL3A 2AZSA 5D6XA 2ROTA 5IAYA 2D0QB 1N9SA 2ZPGB 3FEOA 2MIOA 2EYYA 5KYXB 3EGXB 2QQRA 2BZ8A 1ZSZC 2L3RA 4KH0B 3MPUB 1FMVA 2DBMA 2O01E 2QDLA 4M7AA 3PFSA 4RTWA 5GAOm 3PGGA 2LCCA 1AT1B 3LGLA 1VQNT 3PMIA 3WXMB 2QXFA 3L2VA 1MGQA 2A0FB 4BE1A 5A0LA 3L2QA 4JZ3A 4PJOA 2XICA 3HPWA 1JJ2S 2XDDA 1VQMT 1AWOA 2IIMA 3CMAA 1SEMA 3HP9A 1ZSZA 1IXDA 1BYMA 1OPLA 3RESA 3CD6A 2F2VA 2DYIA 5GJWB 3M0PA 3JB9H 1VQKA 5L8RE 4JUVA 1LVKA 3JCMg 3INZA 2LQ8A 4M7DG 2HD0A 2GGRA 4BACA 4EMHA 4CRIA 3TVTA 1VQLQ 2BUDA 2HZYA 2PUKB 3M0UA 4FSSA 4QQ6A 3V7CA 3JCMW 5GAMd 2V1QA 3M0TA 2LZ6B 2K5IA 1ZA2B 4N0AA 1FX7A 4C5HA 4FIBA 1MUZA 2V8KA 4HCCA 1Y71A 2ECZA 3CPWS 3MP1A 2YXYA 1U3OA 2SRCA 3CCSA 2EBPA 1HSQA 3L1AA 1U1TA 3DLLA 2A36A 2YDLA 3G6EQ 3PIOA 3M5AA 2F2XA 3AHUA 3JCMf 3MCAB 4OMMA 3JB9F 3VKIA 1WHMA 3A8OB 1C6VX 2K3YA 1JJ2A 2RK1A 4RUGA 3OS0A 3MP8A 5IH2A 1RLQC 1HJDA 4RCBA 2J7IA 3I56T 1VQ9A 3CC2T 1JXOA 3O8VA 3CMEA 3CCEA 2HBWA 5HY6A 1VQLT 2JNGA 2MCNA 4GBQA 1Q81C 2ED1A 1VQPQ 4JJBA 1M1KR 1SRLA 2FZKB 2ATCB 1Q7YR 1CKBA 3RMSA 2LCSA 5GMKj 4PJOC 2QEXT 1QP2A 2H3JA 2JTMA 5HK0A 1VIFA 4F7UF 5GAMg 3LYIA 5GMKi 2O9SA 2O2OA 3OYEA 1ZBXA 1NYFA 3JCMd 4XU1A 3LLRA 1WA7A 3MO8A 4QVCA 3OYAA 3FB9A 1M3AA 3G4ST 3VS2A 1ABOA 5I21A 4M77B 1RI0A 2Y90A 1IRXA 2CP6A 4XTZA 1QVGA 3I56Q 2K7AA 4CC7A 2RQRA 3A5ZB 3CMAT 2P0QA 4ZN1A 5GAOn 3R6OA 3R6NA 2CDTA 4JJNK 3JCMh 1E7OA 2KGTA 2DILA 5FWBA 3FJ5A 4JZ4A 1Q7YC 1WJQA 4M7DF 3EHQA 2YSQA 5I22A 1VQ8Q 2DAQA 2CUDA 2P4TA 1WJSA 4BDZA 4JJCA 4X9DA 1M3CA 1UFFA 1ZUUA 4QVZA 4MZMA 2K3XA 2AIRB 2E70A 1JRIA 2PQWA 1U1SA 3CD6Q 2EJFA 3NTHA 2RD1A 2GTJA 4C8QD 2M51A 3CCRQ 4RTXA 3RNJA 3CCLT 4LN2A 3CCVT 2KSSA 1AWXA 1OZ2A 1K8AU 2JN0A 2HKQB 3M55A 3NHNA 2Y4XA 5CKBA 2RI2A 4KULA 3TCJA
chains in the Genus database with same CATH topology
3VS3A 2ENMA 2A08A 4JPBW 4KRTA 2K6DA 2HEQA 3M0SA 4E6RA 2JMCA 4OMPA 1UGVA 3VS6A 1CKAA 3TSZA 2BZYA 1KIKA 2DX1A 2KRNA 2AKKA 2KEAA 1ARKA 2FRYA 3H0IA 2SEMA 3JV3A 1T0JA 1ZUYA 2FO0A 2W0ZA 4J9HA 4RTYA 2HCKA 2LJ0A 1I0CA 2KRMA 2YUOA 3I9QA 3NGPA 2O88A 2K2MA 1YN8A 2RQTA 2O9VA 2AZVA 1YWOA 1B07A 3LH5A 3EG2A 1OOTA 2DL4A 1WDXA 1WYXA 1X2QA 5HCKA 1QWFA 1T0HA 1YP5A 4HVUA 3VS7A 1NYGA 1JEGA 2RNAA 1W6XA 2L3SA 1AWJA 2DYBA 3SEMA 1AEYA 3UATA 1UJYA 1S1NA 2FEIA 2JM9A 1TUCA 3QWYA 1AWWA 2VWFA 2PNIA 4R0KA 1UDLA 4X1VA 5FWCA 1JO8A 1QKXA 1LCKA 1ZBJA 2YT6A 2KRSA 2LJ1A 1WXUA 5IHIA 4J9FA 1T3SA 2KT1A 3VRYA 2A28A 3O5ZA 2D8HA 1OV3A 3RBBB 4F16A 1N5ZA 4J9CA 4CC4B 1PRLC 1E6GA 1NG2A 4J9GA 2DL5A 2L3QA 2X3XD 1K0SA 1KFZA 1Y0MA 4RTVA 4Z8AA 1JQQA 4WCIA 2DMOA 1PKSA 3I5SA 1GL5A 1WXTA 2X3WD 2ESWA 2L3PA 3VS1A 3UA6A 4IIMA 2KBTA 2LX7A 2YUQA 1YNZA 4AFSC 1VYVA 4J9EA 4RTUA 1MV0B 4OMLA 2YUPA 2EGCA 2RN8A 2H8HA 1RLPC 1GBQA 2FPEA 2J6FA 2KYMA 1JXMA 1AZGB 1X6GA 2RQVA 1M3BA 4F17A 2EYZA 2JXBA 2DM1A 2ED0A 2P4RA 1SPKA 1I07A 3I5RA 4OMOA 4LNPA 1FMKA 1BK2A 1K1ZA 1PHTA 2FPFA 2EYXA 1UECA 5EC7A 2GBQA 4HVWA 4J9IA 5L23A 1I1JA 5ECAA 1X6BA 2F2WA 1KSWA 1QKWA 1EFNA 3TSWA 4ORZA 1W1FA 4HCKA 2DF6A 2CH4A 3EG1A 2JS0A 2RPNA 2K79A 1U5SA 3PVQA 1J3TA 4RTZA 1AZEA 1WIEA 2EVRA 2LNHB 2DL8A 5I11A 1RUWA 2DRKA 2RF0A 2C0OA 1WXBA 1RI9A 1GFDA 5IHNA 1NEGA 4AG1C 2PTKA 2DRMA 2EYWA 1SRMA 4A63B 4Z89A 3UA7A 1WI7A 2DE0X 2KNBB 2ABLA 2I0NA 2CSIA 5IXFA 3VRZA 2CT3A 1BU1A 1K0XA 1AOJA 1BB9A 5FW9A 4Z88A 4K11A 2KYBA 1ABQA 1YWPA 4LE9A 1WX6A 1AVZC 1OPKA 4J9DA 2ROLA 4AFQC 1ZUKA 1ZX6A 2DJQA 1UTIA 1X69A 4DEXA 3ZL7C 5GJVB 4AFUC 2E5KA 3M0RA 2AZSA 1VYUA 2ROTA 2DBKA 1T3LA 4OMNA 1ZLMA 2EYYA 2MIOA 1ZSGA 2OJ2A 1WLPB 2JT4A 2BZ8A 2DL3A 4LUEA 1XOVA 2D0NA 1M8MA 1SHGA 2KXDA 2DBMA 4HXJA 2QDLA 4RTWA 4J9BA 2W10A 3U23A 3REAB 1MV3A 4GLMA 1PRMC 1UHCA 1UHFA 4JZ3A 3H0FA 1GBRA 1SSHA 2C0IA 1Z9QA 1M27C 2GNCA 4ESRA 1CSKA 3H0HA 4ZNXA 1AWOA 2RQUA 1K4US 5IHKA 3THKA 2MOXA 2IIMA 1FYNA 1W70A 1SEMA 3PE0A 2VKNA 1GCQA 2K9GA 1OPLA 2F2VA 2DL7A 2JTEA 3ULRB 1JU5C 5GJWB 3M0PA 2BTTA 2JS2A 3IQLA 4CC2A 1SHFA 2OI3A 2J6OA 2GGRA 3SHWA 3TVTA 3REBB 4FSSA 3M0UA 1X27A 2V1QA 3M0TA 2LZ6B 1NEBA 1M30A 3CQTA 1MUZA 5IXBA 2ECZA 2J06A 4D8DA 2CT4A 1QLYA 1U3OA 2FRWA 2SRCA 2EQIA 1HD3A 2L2PA 4D8KA 2EBPA 1GRIA 1HSQA 3QWXX 1VYTA 2EKHA 1H8KA 2A36A 2EGEA 2DVJA 2YDLA 2NUZA 1E6HA 2VVKA 3I35A 4AFZC 3M0QA 1TUDA 2F2XA 2CUBA 4Y92A 2YUNA 1BBZA 4OMMA 1WFWA 3GBQA 2DA9A 4EIKA 2G6FX 2JM8A 2KE9A 1G2BA 1PNJA 2XMFA 3PVLA 4RUGA 2CH4W 2PZ1A 2KROA 1IO6A 2B86A 5IH2A 2LMJA 4HVVA 1RLQC 1HJDA 2J7IA 2LQWA 2EW3A 1JXOA 2AK5A 3NPFA 3NMZC 2HBWA 2MCNA 4GBQA 2J6KA 2ED1A 4JJBA 1SRLA 1NLPC 1CKBA 2LCSA 3VS4A 1PKTA 1H3HA 4F14A 2JMAA 1K9AA 4OMQA 2LP5A 1UUEA 1TG0A 2K3BA 2O31A 2FG0A 3EGUA 2KR3A 2O9SA 2HSPA 2RMOA 4QT7A 1UG1A 2O2OA 1GCPA 1OEBA 4RTTA 1G83A 1QWEA 1H92A 1NYFA 2C0TA 1K76A 4LUDA 1WA7A 2AKLA 3KFVA 1M3AA 1VA7A 2DNUA 2J05A 3VS2A 1ABOA 1UE9A 1YCSB 2BZXA 2DLPA 3H41A 2CSQA 1NLOC 2K7AA 4IIOA 2RQRA 4CC7A 4JJDA 2D1XA 2EPDA 4M4ZA 1X2KA 2RQWA 1A0NB 2GTOA 3R6NA 2CDTA 1QCFA 3EHRA 1E7OA 2KT8A 1Y57A 2KGTA 2HDAA 3VS0A 2JW4A 4CC3A 2L0AA 2DILA 1Z9ZA 1GFCA 3A98A 1V1CA 5FWBA 3FJ5A 1B3QA 4JZ4A 1PWTA 2OAWA 2LJ3A 3EHQA 2YSQA 5I22A 2CUDA 1UJ0A 1NM7A 1X43A 2A37A 4JJCA 1M3CA 1UFFA 2GQIA 1ZUUA 3C0CA 1AD5A 3EG3A 3UF4A 2LQNA 2EGAA 2CREA 2GTJA 1KJWA 2M0YA 2M51A 2V1RA 4RTXA 3RNJA 3VS5A 2D8JA 4LN2A 1AWXA 3EG0A 4DEYA 2FPDA 4AG2C 2KXCA 2NWMA 3NHNA 1U06A 1GCQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS3 A;  2ENM A;  2A08 A;  4JPB W;  4KRT A;  2K6D A;  2HEQ A;  3M0S A;  4E6R A;  2JMC A;  4OMP A;  1UGV A;  3VS6 A;  1CKA A;  3TSZ A;  2BZY A;  1KIK A;  2DX1 A;  2KRN A;  2AKK A;  2KEA A;  1ARK A;  2FRY A;  3H0I A;  2SEM A;  3JV3 A;  1T0J A;  1ZUY A;  2FO0 A;  2W0Z A;  4J9H A;  4RTY A;  2HCK A;  2LJ0 A;  1I0C A;  2KRM A;  2YUO A;  3I9Q A;  3NGP A;  2O88 A;  2K2M A;  1YN8 A;  2RQT A;  2O9V A;  2AZV A;  1YWO A;  1B07 A;  3LH5 A;  3EG2 A;  1OOT A;  2DL4 A;  1WDX A;  1WYX A;  1X2Q A;  5HCK A;  1QWF A;  1T0H A;  1YP5 A;  4HVU A;  3VS7 A;  1NYG A;  1JEG A;  2RNA A;  1W6X A;  2L3S A;  1AWJ A;  2DYB A;  3SEM A;  1AEY A;  3UAT A;  1UJY A;  1S1N A;  2FEI A;  2JM9 A;  1TUC A;  3QWY A;  1AWW A;  2VWF A;  2PNI A;  4R0K A;  1UDL A;  4X1V A;  5FWC A;  1JO8 A;  1QKX A;  1LCK A;  1ZBJ A;  2YT6 A;  2KRS A;  2LJ1 A;  1WXU A;  5IHI A;  4J9F A;  1T3S A;  2KT1 A;  3VRY A;  2A28 A;  3O5Z A;  2D8H A;  1OV3 A;  3RBB B;  4F16 A;  1N5Z A;  4J9C A;  4CC4 B;  1PRL C;  1E6G A;  1NG2 A;  4J9G A;  2DL5 A;  2L3Q A;  2X3X D;  1K0S A;  1KFZ A;  1Y0M A;  4RTV A;  4Z8A A;  1JQQ A;  4WCI A;  2DMO A;  1PKS A;  3I5S A;  1GL5 A;  1WXT A;  2X3W D;  2ESW A;  2L3P A;  3VS1 A;  3UA6 A;  4IIM A;  2KBT A;  2LX7 A;  2YUQ A;  1YNZ A;  4AFS C;  1VYV A;  4J9E A;  4RTU A;  1MV0 B;  4OML A;  2YUP A;  2EGC A;  2RN8 A;  2H8H A;  1RLP C;  1GBQ A;  2FPE A;  2J6F A;  2KYM A;  1JXM A;  1AZG B;  1X6G A;  2RQV A;  1M3B A;  4F17 A;  2EYZ A;  2JXB A;  2DM1 A;  2ED0 A;  2P4R A;  1SPK A;  1I07 A;  3I5R A;  4OMO A;  4LNP A;  1FMK A;  1BK2 A;  1K1Z A;  1PHT A;  2FPF A;  2EYX A;  1UEC A;  5EC7 A;  2GBQ A;  4HVW A;  4J9I A;  5L23 A;  1I1J A;  5ECA A;  1X6B A;  2F2W A;  1KSW A;  1QKW A;  1EFN A;  3TSW A;  4ORZ A;  1W1F A;  4HCK A;  2DF6 A;  2CH4 A;  3EG1 A;  2JS0 A;  2RPN A;  2K79 A;  1U5S A;  3PVQ A;  1J3T A;  4RTZ A;  1AZE A;  1WIE A;  2EVR A;  2LNH B;  2DL8 A;  5I11 A;  1RUW A;  2DRK A;  2RF0 A;  2C0O A;  1WXB A;  1RI9 A;  1GFD A;  5IHN A;  1NEG A;  4AG1 C;  2PTK A;  2DRM A;  2EYW A;  1SRM A;  4A63 B;  4Z89 A;  3UA7 A;  1WI7 A;  2DE0 X;  2KNB B;  2ABL A;  2I0N A;  2CSI A;  5IXF A;  3VRZ A;  2CT3 A;  1BU1 A;  1K0X A;  1AOJ A;  1BB9 A;  5FW9 A;  4Z88 A;  4K11 A;  2KYB A;  1ABQ A;  1YWP A;  4LE9 A;  1WX6 A;  1AVZ C;  1OPK A;  4J9D A;  2ROL A;  4AFQ C;  1ZUK A;  1ZX6 A;  2DJQ A;  1UTI A;  1X69 A;  4DEX A;  3ZL7 C;  5GJV B;  4AFU C;  2E5K A;  3M0R A;  2AZS A;  1VYU A;  2ROT A;  2DBK A;  1T3L A;  4OMN A;  1ZLM A;  2EYY A;  2MIO A;  1ZSG A;  2OJ2 A;  1WLP B;  2JT4 A;  2BZ8 A;  2DL3 A;  4LUE A;  1XOV A;  2D0N A;  1M8M A;  1SHG A;  2KXD A;  2DBM A;  4HXJ A;  2QDL A;  4RTW A;  4J9B A;  2W10 A;  3U23 A;  3REA B;  1MV3 A;  4GLM A;  1PRM C;  1UHC A;  1UHF A;  4JZ3 A;  3H0F A;  1GBR A;  1SSH A;  2C0I A;  1Z9Q A;  1M27 C;  2GNC A;  4ESR A;  1CSK A;  3H0H A;  4ZNX A;  1AWO A;  2RQU A;  1K4U S;  5IHK A;  3THK A;  2MOX A;  2IIM A;  1FYN A;  1W70 A;  1SEM A;  3PE0 A;  2VKN A;  1GCQ A;  2K9G A;  1OPL A;  2F2V A;  2DL7 A;  2JTE A;  3ULR B;  1JU5 C;  5GJW B;  3M0P A;  2BTT A;  2JS2 A;  3IQL A;  4CC2 A;  1SHF A;  2OI3 A;  2J6O A;  2GGR A;  3SHW A;  3TVT A;  3REB B;  4FSS A;  3M0U A;  1X27 A;  2V1Q A;  3M0T A;  2LZ6 B;  1NEB A;  1M30 A;  3CQT A;  1MUZ A;  5IXB A;  2ECZ A;  2J06 A;  4D8D A;  2CT4 A;  1QLY A;  1U3O A;  2FRW A;  2SRC A;  2EQI A;  1HD3 A;  2L2P A;  4D8K A;  2EBP A;  1GRI A;  1HSQ A;  3QWX X;  1VYT A;  2EKH A;  1H8K A;  2A36 A;  2EGE A;  2DVJ A;  2YDL A;  2NUZ A;  1E6H A;  2VVK A;  3I35 A;  4AFZ C;  3M0Q A;  1TUD A;  2F2X A;  2CUB A;  4Y92 A;  2YUN A;  1BBZ A;  4OMM A;  1WFW A;  3GBQ A;  2DA9 A;  4EIK A;  2G6F X;  2JM8 A;  2KE9 A;  1G2B A;  1PNJ A;  2XMF A;  3PVL A;  4RUG A;  2CH4 W;  2PZ1 A;  2KRO A;  1IO6 A;  2B86 A;  5IH2 A;  2LMJ A;  4HVV A;  1RLQ C;  1HJD A;  2J7I A;  2LQW A;  2EW3 A;  1JXO A;  2AK5 A;  3NPF A;  3NMZ C;  2HBW A;  2MCN A;  4GBQ A;  2J6K A;  2ED1 A;  4JJB A;  1SRL A;  1NLP C;  1CKB A;  2LCS A;  3VS4 A;  1PKT A;  1H3H A;  4F14 A;  2JMA A;  1K9A A;  4OMQ A;  2LP5 A;  1UUE A;  1TG0 A;  2K3B A;  2O31 A;  2FG0 A;  3EGU A;  2KR3 A;  2O9S A;  2HSP A;  2RMO A;  4QT7 A;  1UG1 A;  2O2O A;  1GCP A;  1OEB A;  4RTT A;  1G83 A;  1QWE A;  1H92 A;  1NYF A;  2C0T A;  1K76 A;  4LUD A;  1WA7 A;  2AKL A;  3KFV A;  1M3A A;  1VA7 A;  2DNU A;  2J05 A;  3VS2 A;  1ABO A;  1UE9 A;  1YCS B;  2BZX A;  2DLP A;  3H41 A;  2CSQ A;  1NLO C;  2K7A A;  4IIO A;  2RQR A;  4CC7 A;  4JJD A;  2D1X A;  2EPD A;  4M4Z A;  1X2K A;  2RQW A;  1A0N B;  2GTO A;  3R6N A;  2CDT A;  1QCF A;  3EHR A;  1E7O A;  2KT8 A;  1Y57 A;  2KGT A;  2HDA A;  3VS0 A;  2JW4 A;  4CC3 A;  2L0A A;  2DIL A;  1Z9Z A;  1GFC A;  3A98 A;  1V1C A;  5FWB A;  3FJ5 A;  1B3Q A;  4JZ4 A;  1PWT A;  2OAW A;  2LJ3 A;  3EHQ A;  2YSQ A;  5I22 A;  2CUD A;  1UJ0 A;  1NM7 A;  1X43 A;  2A37 A;  4JJC A;  1M3C A;  1UFF A;  2GQI A;  1ZUU A;  3C0C A;  1AD5 A;  3EG3 A;  3UF4 A;  2LQN A;  2EGA A;  2CRE A;  2GTJ A;  1KJW A;  2M0Y A;  2M51 A;  2V1R A;  4RTX A;  3RNJ A;  3VS5 A;  2D8J A;  4LN2 A;  1AWX A;  3EG0 A;  4DEY A;  2FPD A;  4AG2 C;  2KXC A;  2NWM A;  3NHN A;  1U06 A;  1GCQ C; 
#chains in the Genus database with same CATH topology
 2DD5 A;  3VS3 A;  2KK4 A;  5LJ3 f;  3L2U A;  2QQ9 A;  3QZ9 B;  4M78 F;  1OX9 A;  2LQK A;  2DZC A;  1K73 C;  3TSZ A;  2BZY A;  3KXT A;  1B34 A;  2RJE A;  2KEA A;  3GLX A;  1ARK A;  2SEM A;  2FO0 A;  4A4K A;  4ZTJ A;  1H3Z A;  1I0C A;  1M2V A;  3JB9 J;  3I9Q A;  5EG2 A;  3G1J A;  1VQ4 A;  2YRV A;  1BIA A;  4M7D B;  1KHC A;  3EG2 A;  2CZ7 B;  3EGX A;  4XTX A;  4ELZ C;  2DL4 A;  2EAY A;  1OUL A;  1WYX A;  4XTV A;  5HCK A;  1VQO A;  1Y07 A;  1JEG A;  2RNA A;  1UGP B;  4A53 A;  5GMK e;  5GAM j;  4L5G A;  2QGF B;  2KMT A;  5GAN 4;  3GP8 A;  3JRZ A;  3SEM A;  4BI3 A;  1S1N A;  4PJO B;  2JM9 A;  1TUC A;  1XNI A;  2PNI A;  2OTJ Q;  1MHN A;  2DIQ A;  5C6S A;  1ZBJ A;  3A1P A;  2LJ1 A;  1WXU A;  1F1B B;  4J9F A;  1BI0 A;  3S3N A;  3OA6 A;  1EZZ B;  3VRY A;  2QQA A;  2D9T A;  4MDX A;  3RBB B;  4X34 A;  3N5B B;  3J81 E;  1PRL C;  1YIJ T;  2LT4 A;  1Y0M A;  4RTV A;  2XKO C;  3L42 A;  3ASK A;  2XID A;  4WCI A;  5CKF A;  2DMO A;  4RMO A;  1XQH A;  3ZEH A;  2GF7 A;  3HRU A;  2COZ A;  2R57 A;  3JSC A;  2VGM A;  5LJ5 j;  2QQB A;  2YUQ A;  3M56 A;  1KC8 C;  4NOY A;  4LDU A;  3M54 A;  3EFO B;  4C5G A;  2CP7 A;  4OML A;  4R55 A;  3CCQ A;  2EGC A;  2RN8 A;  1OU9 A;  1GBQ A;  2WSF E;  1K8A C;  2KYM A;  1AZG B;  1X6G A;  4M7A D;  3QJY A;  1YJ9 A;  2DM1 A;  5A2Q E;  4BE0 A;  2HQX A;  1I07 A;  4L59 A;  1RAG B;  4OMO A;  4J7F A;  2ZAE A;  4LNP A;  1I5L A;  3QYH B;  1K1Z A;  1PHT A;  1YHQ Q;  2YRD A;  1M8V A;  3ZFJ A;  5EC7 A;  4JLG A;  2EQK A;  2GBQ A;  4J9I A;  1SKU B;  2YLC A;  2XDB A;  4OVA A;  3G71 T;  1VQ8 T;  2GFA A;  4II1 A;  4HCK A;  2RPN A;  2RH2 A;  3L2W A;  4E7K A;  3MET A;  3SWN C;  1J3T A;  4RTZ A;  2EVR A;  3V8K A;  1RUW A;  4J5Y A;  1WQW A;  3QHS A;  3TRE A;  5IHN A;  1ZA1 B;  1NEG A;  2LDM A;  1YI2 Q;  5CVI A;  1SG5 A;  1WI7 A;  4KBM B;  4HA8 A;  1K9M R;  2P0K A;  1RAF B;  2I0N A;  4PFZ A;  4FYV B;  4AMC A;  1Q81 U;  5FW9 A;  2KYB A;  5CQX A;  1ABQ A;  1WX6 A;  1AVZ C;  2GFU A;  4M77 A;  2ROL A;  2XHC A;  4M75 B;  4AFQ C;  2DJQ A;  2CZ6 B;  1UTI A;  2QK0 A;  5GAN 3;  1NE8 A;  3ZL7 C;  5GJV B;  2ZPB B;  3M0R A;  1VYU A;  5LJ3 g;  3MJX A;  4C92 F;  2DJZ A;  3CBP A;  1ZLM A;  4LD6 A;  4AT1 B;  3FDR A;  4PFP A;  2DL3 A;  2FB7 A;  2IPO B;  4M77 D;  1M8M A;  2KXD A;  1XTD A;  1PD1 A;  1M4Z A;  3UPU A;  2L5Q A;  2K5L A;  1PRM C;  2RB6 A;  4IUQ A;  1UHC A;  1QP3 A;  3H0F A;  1GBR A;  1NJI C;  1M27 C;  1OQK A;  2QA4 Q;  1TUG B;  4C5E A;  1CSK A;  4OB3 B;  4ESR A;  4N4H A;  2HNI A;  1KC8 R;  1FYN A;  3FRN A;  3M9Q A;  2VKN A;  2CYZ B;  4PJO F;  2DL7 A;  2R58 A;  2YWW A;  2CP3 A;  4M78 B;  4ATO A;  2BTT A;  3OW2 P;  3CCJ T;  4EPC A;  1N6A A;  2JS2 A;  1X6O A;  2E12 A;  2EKO A;  2QEX Q;  3CCQ Q;  2KY9 A;  1SHF A;  3OYK A;  2J6O A;  4M77 C;  3SHW A;  4M77 E;  1X27 A;  1D0Y A;  4CI0 C;  3PTA A;  1W2B S;  1M30 A;  1V29 B;  3CQT A;  3CXC A;  4ELY C;  2V8J A;  4BI4 A;  2J06 A;  3BDL A;  3HSB A;  4DQ2 A;  2CT4 A;  1IHW A;  4IUU A;  4D8K A;  3FIF A;  3QWX X;  1VYT A;  2E41 A;  3QO3 A;  1IGU A;  2EGE A;  2DVJ A;  1M2V B;  3I35 A;  4AFZ C;  3FC3 A;  5LJ5 f;  3M0Q A;  4MMK A;  4ZGE B;  2CUB A;  1QCN A;  2EWN A;  1BBZ A;  2DA9 A;  4EIK A;  2X35 A;  4C8Q B;  2KE9 A;  1PNJ A;  2PZ1 A;  2B86 A;  4J7I A;  1K73 U;  4ZTF A;  1YI2 A;  4MDW A;  4FT4 A;  3X28 B;  2JTF A;  3G4S Q;  4FT2 A;  1IB8 A;  3OYD A;  1WJR A;  1YIT T;  2FZC B;  2AK5 A;  1XJW B;  2HKN A;  3NMZ C;  3NPF A;  1VQP T;  4MML A;  3HFO A;  3VS4 A;  1Q86 U;  3LGF A;  2JMA A;  4EDU A;  1JB0 E;  4BD3 A;  5FU6 B;  4OMQ A;  1UUE A;  1TG0 A;  4BY6 C;  3QYG B;  4HT8 A;  3MHX A;  2RHU A;  3MP6 A;  3WVE B;  3OYL A;  4M7A E;  3E1S A;  1OEB A;  1G83 A;  4C0Z A;  2FYK A;  4KUD K;  3F70 A;  1WQ7 A;  5FRN A;  2C0T A;  1KQS A;  3M59 A;  2AKL A;  1TXQ A;  3S6W A;  2MWP A;  2RI5 A;  4C92 B;  1VA7 A;  3CC4 T;  3ER0 A;  1UE9 A;  3CCV Q;  2BZX A;  2CSQ A;  3EH1 A;  1YIT Q;  1VQM A;  2D1X A;  4M4Z A;  1QVF S;  4XTW A;  3OYB A;  1A0N B;  4OP0 A;  4RG8 A;  3EHR A;  3SWN B;  3I55 Q;  1BI3 A;  2KT8 A;  1Y57 A;  3VS0 A;  3HL8 A;  1GFC A;  1PWT A;  2OAW A;  2LJ3 A;  5LL6 S;  3JB9 G;  4Y91 A;  2GQV A;  3V8J A;  5KH6 A;  4F7U A;  1X43 A;  2A37 A;  3PMT A;  3C0C A;  4WF2 A;  4JRK A;  2XK0 A;  1KQS P;  4C0D B;  1VQ7 Q;  1KJW A;  2M0Y A;  1ZSZ B;  4IUT A;  1U8R A;  4J6W A;  2MF2 A;  4VUB A;  2FPD A;  2E1H A;  3QII A;  3DB3 A;  1C0M A;  3E9F A;  4FU6 A;  4LDX A;  4C8Q A;  5GAN e;  2D6F A;  3P8H A;  3OBW A;  5J39 A;  4NS5 A;  2O4X A;  4J8O A;  2JMC A;  3QDR B;  1OYX A;  1D3B A;  2EIF A;  4OMP A;  3VS6 A;  1CKA A;  4C0F A;  2OTJ A;  3GOX A;  4QKU A;  4PJO G;  4JRI A;  2DX1 A;  2QGG A;  2AKK A;  4JS5 A;  1TH7 A;  2FRY A;  3CME T;  1PSE A;  3OSS C;  3JV3 A;  4PK4 A;  3CCE Q;  2DET A;  4N4G A;  1T0J A;  1ZUY A;  2JUF A;  1VIE A;  2Z0W A;  4M75 A;  2HCK A;  2KRM A;  3FLG A;  3OYJ A;  1VQ7 A;  3SFM A;  2O9V A;  3C4S A;  2KI7 A;  1YWO A;  3SD4 A;  3LH5 A;  2E64 A;  4LDV A;  3BFM A;  1OOT A;  3GF5 A;  5HKC A;  1WDX A;  1X2Q A;  3OW2 S;  2QA4 A;  1D0X A;  3JCM X;  5J3B A;  3RUX A;  2L3S A;  1GXI E;  3A8G B;  1AWJ A;  2FZG B;  3OMC A;  4HCZ A;  4RKU E;  1AEY A;  4EMK A;  1UJY A;  2FEI A;  1AWW A;  3QUI A;  3P8B B;  4M75 C;  2VWF A;  3JCM P;  5LJ5 g;  3M4Y A;  4R0K A;  4X1V A;  4C8Q E;  3CC4 A;  9ATC B;  5GAM h;  4XU3 A;  5DM7 R;  1VQ9 Q;  1LCK A;  5KCH A;  1EX4 A;  3CXC S;  4Y28 E;  2MAM A;  1C1A A;  3URG A;  1QMC A;  2A28 A;  3O5Z A;  4DBH A;  2D8H A;  1OV3 A;  2DEQ A;  2F69 A;  4PFO A;  1BCO A;  2VUB A;  4J9G A;  4M7A B;  2M16 A;  1K0S A;  1KFZ A;  4PNO A;  1JQQ A;  4KH1 B;  4FW1 A;  2FL7 A;  3RKY A;  5D6W A;  1FWZ A;  2QAS A;  1KD1 U;  1GL5 A;  1VQ5 T;  3CMA Q;  1IRE B;  2E10 A;  3UWN A;  3CD6 T;  2E4H A;  1RAC B;  1VQK T;  2OX7 A;  4RTU A;  2VYT A;  1PG5 B;  2LT1 A;  3V7S A;  2NUP B;  5C0M A;  2DXC A;  2FPE A;  4XU2 A;  1V76 A;  2RQV A;  4F17 A;  2EYZ A;  2ED0 A;  4A4G A;  4FYX B;  2P4R A;  2RO0 A;  2E6Z A;  3I5R A;  4GY5 A;  1Q86 R;  1BK2 A;  4DA4 A;  3JCM c;  3H9N A;  2FPF A;  4PKC C;  2ZPH B;  4HVW A;  4TVR A;  4ANJ A;  5GAO q;  2F2W A;  1KG1 A;  1EFN A;  1YJW A;  1OU8 A;  2DTO A;  5LJ5 d;  3X24 B;  3JB9 D;  3EG1 A;  2JS0 A;  4XQ3 A;  2F5K A;  1S72 Q;  1HXD A;  2WSE E;  1KD1 R;  2XU8 A;  1AZE A;  1WIE A;  2LNH B;  5I2M A;  1X01 A;  3I55 T;  2RM4 A;  1WHJ A;  1PCX A;  2DO3 A;  1RI9 A;  4FL6 A;  3QBY A;  3CCJ Q;  2PTK A;  2DRM A;  1G5V A;  1SRM A;  1LJO A;  3CC7 A;  2DE0 X;  2E6N A;  2KNB B;  4C0D C;  3CC2 A;  5KE3 A;  3NFC A;  1YJ9 Q;  1B34 B;  1AHJ B;  1UGS B;  4A4H A;  1VQP A;  1BU1 A;  1K0X A;  5GMK h;  1O75 A;  4HCB A;  2V26 A;  1YWP A;  4LE9 A;  5KYW A;  3ME9 A;  1ZUK A;  2CP2 A;  2QEX A;  2HBP A;  5GAN 5;  4DEX A;  4E2F B;  1NPR A;  1N8R R;  2DFU A;  2DBK A;  4KGV B;  1T3L A;  4PL6 A;  4UC4 A;  1ZSG A;  4FCY A;  1MMD A;  2RJC A;  3JCM b;  1LOJ A;  2D0N A;  5GAO l;  4HXJ A;  1TS9 A;  5LJ3 e;  3OMG A;  3CCM A;  2K5F A;  3U23 A;  1IHV A;  2E3I A;  3REA B;  4E7S A;  4EMK C;  1MV3 A;  4GLM A;  3OS2 A;  3CCS Q;  3KBG A;  2RHI A;  1QVF P;  1UHF A;  1SSH A;  1G3T A;  1Z9Q A;  2GNC A;  4LXC A;  4ZNX A;  2ZGW A;  3MEV A;  2RQU A;  1K4U S;  5IHK A;  1W70 A;  2EYQ A;  2MWO A;  2X9H A;  1GCQ A;  3OYY A;  2JTE A;  2VAS A;  3ULR B;  1JU5 C;  5FU7 B;  1M1G A;  5GAN j;  3IQL A;  2K57 A;  3OYC A;  3CCQ T;  4IUV A;  4KUI A;  4CC2 A;  2NUT B;  1DJ7 B;  2HAX A;  3MEW A;  4E7J A;  4O6J A;  3G71 Q;  3TQ7 P;  1HK9 A;  2XG8 D;  3REB B;  4FYY B;  1W2B A;  5J26 A;  3PT9 A;  4N4I A;  3OYI A;  2QQS A;  1D3B B;  4JRQ A;  4J6X A;  1RAE B;  1PD0 A;  1Q95 G;  4JLI A;  1Y96 B;  4DOV A;  1KQ1 A;  4M75 F;  1SSF A;  3X26 B;  2FRW A;  2EQI A;  1M1K C;  3EFO A;  1GRI A;  4C8Q C;  4JS4 A;  1YJW T;  4IUP A;  3CME Q;  2FHD A;  1K9M U;  4N0A C;  1WFW A;  3GBQ A;  2G6F X;  5CR2 A;  3I55 A;  1G2B A;  2P0P A;  3BDU A;  2XMF A;  3PVL A;  2H3E B;  4BI8 B;  4A54 A;  1OI1 A;  4KT0 E;  1RAI B;  3OS5 A;  2DEU A;  4P5N A;  3C95 A;  3TEE A;  1VQ5 Q;  3CXC P;  4XK8 E;  3E9G A;  2J6K A;  1MNE A;  4M7D E;  2X4J A;  1PKT A;  1YIJ Q;  4F14 A;  2CS7 A;  1KD1 C;  2LP5 A;  1RL2 A;  4LDW A;  3DKM A;  2QA4 T;  3QXE B;  4EMG A;  4X9C A;  2MYS A;  4XTY A;  3RR6 A;  2HSP A;  2RMO A;  1GCP A;  2EQM A;  4FSX A;  3S3O A;  2MPX C;  2X4Y A;  3QZ5 B;  3BW1 A;  3OYF A;  3CCM T;  5KE2 A;  1FXX A;  4LUD A;  1NJI U;  3KFV A;  2LRQ A;  2F5T X;  2DNU A;  2J05 A;  1M90 R;  1YCS B;  4PJN A;  2E65 A;  3AT1 B;  5GAM e;  4IIO A;  1MMG A;  2BE7 D;  3RMQ A;  1X2K A;  2P84 A;  2XD0 A;  5GAN 2;  2GTO A;  5FRM A;  4C5I A;  4M78 E;  1QCF A;  2HDA A;  4CC3 A;  4DBF A;  1YIJ A;  1B3Q A;  2M0O A;  4MZP A;  1M5Q 1;  2M9U A;  5GMK m;  4V2S A;  4C92 C;  2DZ9 A;  2MK5 A;  1W2B P;  4C92 E;  1I5O B;  4OGE A;  1VQ5 A;  4IUR A;  4E7L A;  5AT1 B;  1AD5 A;  3NTK A;  3X20 B;  5LJ5 e;  2LQN A;  2G3R A;  4PJO D;  1VQ6 T;  2EGA A;  2CRE A;  3E2U A;  4D6W A;  2D8J A;  3H6Z A;  3EG0 A;  4DEY A;  3OYH A;  3CCS T;  1M1K U;  4M7A G;  2R5A A;  1U06 A;  4DBQ A;  1MMA A;  1Q86 C;  4YTL A;  1GCQ C;  4NL2 A;  5CQY A;  3EFR A;  2RHY A;  4A4E A;  2A08 A;  4JPB W;  4KRT A;  1QVF A;  2K6D A;  3OQ5 A;  2FVU A;  3CCR T;  1TU0 B;  2NLU A;  3CC4 Q;  3G71 A;  1OX8 A;  1VQ9 T;  2QI2 A;  2DVE A;  2KDS A;  3CCE T;  3VUZ A;  4J9H A;  3JCM J;  2LJ0 A;  2ZPI B;  3VU3 C;  1ZQ1 A;  3NGP A;  2K2M A;  2LVM A;  1BCM A;  2RQT A;  3QKJ A;  2AZV A;  1B07 A;  1VUB A;  3SDZ A;  1PSF A;  2HL5 C;  3GPL A;  3CC7 T;  1X75 C;  5KYN A;  4BY6 B;  4HVU A;  1YP5 A;  2X51 A;  3VS7 A;  1K8A R;  2RHX A;  3JAM E;  3KUF A;  5FU6 C;  2PVG B;  3MEA A;  3QWY A;  2CZ0 B;  2C06 A;  3HTR A;  2COW A;  1TTH B;  5FWC A;  2DXT A;  3EFS A;  4A4F A;  5GAN 7;  1Q82 R;  1QKX A;  2YT6 A;  3GNF B;  4OGC A;  3A8L B;  1T3S A;  2OAU A;  5DLQ E;  2KT1 A;  1WPY A;  5CO7 A;  1N8R C;  2DD4 A;  4F16 A;  2CGH A;  2NUT A;  2LX9 A;  2I2L A;  4ZGJ B;  2X3X D;  1UGR B;  4HKE A;  2JOY A;  2VGN A;  1M90 C;  5CCA A;  2Y4Y A;  4HT9 A;  2AT1 B;  3OY9 A;  3D7S B;  4C92 A;  2AHJ B;  4R56 A;  2HQE A;  3LWI A;  2L3P A;  3VS1 A;  2KBT A;  4M75 E;  3JB9 I;  4M77 F;  4PJO E;  5GAM f;  4AFS C;  1RAH B;  3CCJ A;  1MV0 B;  3SWN A;  1B7T A;  2YUP A;  5KYY A;  2IG0 A;  3CCL A;  4C92 D;  4Q5W A;  2H8H A;  1RLP C;  1YBY A;  1YJW Q;  2RK2 A;  1RAA B;  1R0C B;  1M3B A;  1TWB A;  3G6E T;  2GCX A;  2OTL A;  5KCO A;  4F7U B;  3PIP A;  1I81 A;  1WHL A;  3CEY A;  1D0Z A;  5LJ3 d;  2DPP B;  3CBM A;  1WNL A;  1UEC A;  3T9N A;  4C92 G;  2L8D A;  1PC0 A;  2X4X A;  5ECA A;  2LTO A;  3LH0 A;  2KVQ G;  1KSW A;  1TOV A;  2K2V A;  3C12 A;  3EGD A;  4OMF B;  4ORZ A;  3TSW A;  2RA2 A;  1W1F A;  5GAO r;  2CH4 A;  5D6Y A;  2K4Y A;  3H8Z A;  4M78 C;  3RIR A;  2L89 A;  2DL8 A;  1RAD B;  2DRK A;  2C0O A;  1VQ6 Q;  1WXB A;  2RJD A;  2BKD N;  3JCM Q;  2EYW A;  3BE3 A;  2YRC A;  2ZZD A;  4Z89 A;  3UA7 A;  2PVD B;  2E5Q A;  2ABL A;  2WSC E;  1VQO T;  2CSI A;  2DTH A;  4BB7 A;  5IXF A;  1VQL A;  3JCM e;  2CT3 A;  1RAB B;  4XAX B;  4OB1 B;  4Z88 A;  4K11 A;  2VC8 A;  2HSE B;  4J9D A;  2DER A;  3E19 A;  1VQK Q;  1O9S A;  1HYO A;  4C0G A;  2CZ1 B;  2KQW A;  3CCU A;  2EQU A;  1ZHI A;  4OMN A;  2OJ2 A;  1WLP B;  2JT4 A;  4XTU A;  3GIB A;  4LUE A;  1XOV A;  4FM4 B;  1N9R A;  1SHG A;  2MI6 A;  2IVW A;  2HQH A;  4J9B A;  5KYU B;  2W10 A;  5FU7 C;  1LPL A;  1VQN Q;  1WHG A;  4WTO B;  1QVG P;  4EMK B;  1QVP A;  4QQD A;  2C0I A;  3CC2 Q;  3H0H A;  2QTV A;  8AT1 B;  3S3M A;  3L2Z A;  3THK A;  2MOX A;  3PE0 A;  3MEU A;  1YJN A;  2K9G A;  4E47 A;  4JDS A;  2JZ2 A;  4ZGD B;  2VXF A;  1UEB A;  2E3H A;  4PJM A;  4QW2 A;  3QSU A;  3VYG A;  3QPH A;  2QG9 B;  2OI3 A;  4J83 A;  3EH2 A;  1M90 U;  3OYM A;  1G3Y A;  3RDV A;  1YJ9 T;  1NJI R;  3PNW C;  4MZT A;  4PLI A;  1NEB A;  5DY9 A;  1YJN Q;  5LJ5 h;  3VJP A;  3DB4 A;  3OB9 A;  5IXB A;  4O5V A;  2COY A;  1QVG S;  1G8X A;  4D8D A;  1YHQ T;  1QLY A;  3EGD B;  1Q81 R;  5A0G A;  1HD3 A;  4OB2 B;  2L2P A;  3CCU Q;  2EKH A;  1H8K A;  1KHI A;  1UGQ B;  5CAI A;  2RI3 A;  2NUZ A;  1E6H A;  2NUP A;  2VVK A;  1TUD A;  1R77 A;  4Y92 A;  2YUN A;  5GAN g;  4LDY A;  4M7D A;  2JM8 A;  4M7A C;  5CK9 A;  4PLL A;  2CH4 W;  2KRO A;  1IO6 A;  1QQJ A;  1H64 1;  2LMJ A;  2M1H A;  4HVV A;  2QYZ A;  4KGX B;  3L2R A;  2VV5 A;  4M75 G;  2LQW A;  2EW3 A;  4RCC A;  5CIU A;  5M9O A;  1QCO A;  3C94 A;  2ZCF B;  1S72 A;  3A8M B;  3RKW A;  3HFN A;  1NLP C;  1LNX A;  1YFN A;  2VXE A;  1KQ2 A;  4E7H A;  1H3H A;  1VQ4 T;  1YCY A;  3OS1 A;  3TU4 K;  1K9A A;  2B8A A;  1IGQ A;  2K3B A;  3LX7 A;  2O31 A;  5HK3 A;  2FG0 A;  3EGU A;  2KR3 A;  4QT7 A;  1UG1 A;  5KYU A;  4RTT A;  5CKE A;  1QWE A;  1H92 A;  1KK7 A;  2LCL A;  1K76 A;  3QDF A;  3OYG A;  1VOM A;  2DK3 A;  5KYW B;  4KGZ B;  4DBR A;  2LC4 A;  1BKB A;  2DLP A;  3H41 A;  1G3S A;  1NLO C;  2YHT A;  4M75 D;  4JJD A;  2EPD A;  4M7D C;  4F7U G;  3RER A;  1NZ9 A;  2LNV A;  7AT1 B;  3VYH B;  2RQW A;  1YJN T;  3OSV A;  5KYY B;  2JW4 A;  2L0A A;  1K9M C;  4B9X A;  1Z9Z A;  3A98 A;  1V1C A;  3OBY A;  3LWH A;  3M4G A;  4PJJ A;  2BIV A;  4RG2 A;  2RJF A;  1UJ0 A;  1NM7 A;  3M58 A;  5AYF A;  2GQI A;  3EAE A;  3EG3 A;  2JJ9 A;  3QJ6 A;  3UF4 A;  4C8Q G;  2EJG A;  3VV0 A;  2XI9 A;  1Q82 U;  4JRP A;  2RHZ A;  1TSF A;  3OW2 A;  1G3W A;  2V1R A;  1YHQ A;  2ZPE B;  3VS5 A;  4BDY A;  1FMW A;  3VUB A;  4AG2 C;  3V7R A;  3QG1 A;  1P92 A;  2A3L A;  2CP0 A;  2KXC A;  2NWM A;  3G6E A;  2OTL T;  4QVD A;  4E7Z A;  5IN1 A;  1EIF A;  2ENM A;  4B6M A;  1BIB A;  2HEQ A;  2M02 A;  3EG9 A;  3M0S A;  4E6R A;  3J80 E;  2R5M A;  1M1F A;  2DKG A;  3Q1J A;  3NTI A;  1YI2 T;  1UGV A;  4J6Y A;  1KIK A;  3CC7 Q;  3BY7 A;  1Y96 A;  3HKS A;  4LD9 K;  2KRN A;  1VQ8 A;  3M53 A;  5CKD A;  3I56 A;  3GNG A;  1VQM Q;  1YIT A;  3H0I A;  1KQS S;  3CBO A;  1N27 A;  1WZO A;  2VB6 A;  3DLM A;  2W0Z A;  2CP5 A;  2NYS A;  4RTY A;  1R8O B;  3WVD B;  2YUO A;  4GLK A;  3FJP A;  2O88 A;  2PUO B;  3CPF A;  4QQG A;  1YN8 A;  1ACM B;  4BE2 A;  8ATC B;  1BI2 A;  3ZBD A;  6AT1 B;  4M78 G;  4C8Q F;  4XU0 A;  1QWF A;  1T0H A;  1NYG A;  1W6X A;  5A0D A;  5FLX E;  1N8R U;  3UDC A;  2OTL Q;  2JVV A;  1K73 R;  1D09 B;  2DYB A;  3HRT A;  3UAT A;  1M9S A;  2EJ9 A;  4ZN3 A;  2DXB A;  3G7Z A;  4F7U E;  3CCL Q;  4Z02 A;  4DOW A;  1UDL A;  2DIG A;  3G4S A;  1JO8 A;  2XDP A;  5CKH A;  3CCU T;  4L6V 5;  3CPW A;  1D1C A;  2KRS A;  1M2O A;  5IHI A;  5GAN 6;  5I2S A;  3X25 B;  3J7A F;  2EFI A;  4M78 A;  1NBE B;  5KYX A;  1MND A;  1N5Z A;  4J9C A;  4CC4 B;  1E6G A;  2DTI A;  1NG2 A;  2DL5 A;  2L3Q A;  1VQN A;  4M7A F;  5GAN d;  1VQ4 Q;  2BE9 B;  4Z8A A;  1I8F A;  5IT9 E;  1Q7Y U;  3CPW P;  3MKD A;  1JJ2 P;  2PU9 B;  1QW1 A;  4M78 D;  1PKS A;  1NPP A;  1WHH A;  2DXU A;  3I5S A;  5DLO A;  1VQO Q;  1R0B G;  1WXT A;  2X3W D;  2ESW A;  1Q82 C;  5FRO A;  3UA6 A;  4IIM A;  3OYN A;  2LX7 A;  2PVO B;  1VQ6 A;  1I4K 1;  1YNZ A;  1VYV A;  4J9E A;  1D1B A;  4BUG A;  3CCV A;  4ME7 A;  5GMK l;  2ZPF B;  2J6F A;  1WGS A;  1IZ6 A;  1JXM A;  1UB4 A;  4IKF A;  4F04 B;  5GAN h;  2JXB A;  1Y7X A;  2HMA A;  1W4S A;  3V8L A;  1OZ3 A;  1SPK A;  3M57 A;  3EG9 B;  3UT1 A;  2O4X B;  2CKK A;  3SB2 A;  1MMN A;  4FW2 A;  5D7U A;  3P8D A;  1FMK A;  4M77 G;  3CCR A;  2EYX A;  1WHK A;  5L23 A;  1I1J A;  2OTJ T;  1X6B A;  5GAN f;  1SF9 A;  2QAZ A;  4E7I A;  1QKW A;  4M7D D;  1PM3 A;  1BI1 A;  2DF6 A;  2EQJ A;  2K79 A;  3HRS A;  1U5S A;  3RKX A;  4B9W A;  3PVQ A;  5LJ3 j;  2YLB A;  5I11 A;  1VQ7 T;  2RF0 A;  3CCM Q;  2MMP A;  1GFD A;  4FYW B;  3LW5 E;  4AG1 C;  2QTX A;  4A63 B;  2F1L A;  5GAN 8;  3A8H B;  1JBM A;  1D1A A;  1KC8 U;  2X4W A;  4OF1 A;  5LJ3 h;  3VRZ A;  4OB0 B;  1S72 T;  1AOJ A;  1BB9 A;  4PJL A;  5GAO p;  2QDY B;  2WAC A;  1OPK A;  2V8I A;  3HHT B;  1ZX6 A;  3JCM V;  2KAF A;  1X69 A;  2A7Y A;  4AFU C;  2E5K A;  2HL3 A;  4NL3 A;  2AZS A;  5D6X A;  2ROT A;  5IAY A;  2D0Q B;  1N9S A;  2ZPG B;  3FEO A;  2MIO A;  2EYY A;  5KYX B;  3EGX B;  2QQR A;  2BZ8 A;  1ZSZ C;  2L3R A;  4KH0 B;  3MPU B;  1FMV A;  2DBM A;  2O01 E;  2QDL A;  4M7A A;  3PFS A;  4RTW A;  5GAO m;  3PGG A;  2LCC A;  1AT1 B;  3LGL A;  1VQN T;  3PMI A;  3WXM B;  2QXF A;  3L2V A;  1MGQ A;  2A0F B;  4BE1 A;  5A0L A;  3L2Q A;  4JZ3 A;  4PJO A;  2XIC A;  3HPW A;  1JJ2 S;  2XDD A;  1VQM T;  1AWO A;  2IIM A;  3CMA A;  1SEM A;  3HP9 A;  1ZSZ A;  1IXD A;  1BYM A;  1OPL A;  3RES A;  3CD6 A;  2F2V A;  2DYI A;  5GJW B;  3M0P A;  3JB9 H;  1VQK A;  5L8R E;  4JUV A;  1LVK A;  3JCM g;  3INZ A;  2LQ8 A;  4M7D G;  2HD0 A;  2GGR A;  4BAC A;  4EMH A;  4CRI A;  3TVT A;  1VQL Q;  2BUD A;  2HZY A;  2PUK B;  3M0U A;  4FSS A;  4QQ6 A;  3V7C A;  3JCM W;  5GAM d;  2V1Q A;  3M0T A;  2LZ6 B;  2K5I A;  1ZA2 B;  4N0A A;  1FX7 A;  4C5H A;  4FIB A;  1MUZ A;  2V8K A;  4HCC A;  1Y71 A;  2ECZ A;  3CPW S;  3MP1 A;  2YXY A;  1U3O A;  2SRC A;  3CCS A;  2EBP A;  1HSQ A;  3L1A A;  1U1T A;  3DLL A;  2A36 A;  2YDL A;  3G6E Q;  3PIO A;  3M5A A;  2F2X A;  3AHU A;  3JCM f;  3MCA B;  4OMM A;  3JB9 F;  3VKI A;  1WHM A;  3A8O B;  1C6V X;  2K3Y A;  1JJ2 A;  2RK1 A;  4RUG A;  3OS0 A;  3MP8 A;  5IH2 A;  1RLQ C;  1HJD A;  4RCB A;  2J7I A;  3I56 T;  1VQ9 A;  3CC2 T;  1JXO A;  3O8V A;  3CME A;  3CCE A;  2HBW A;  5HY6 A;  1VQL T;  2JNG A;  2MCN A;  4GBQ A;  1Q81 C;  2ED1 A;  1VQP Q;  4JJB A;  1M1K R;  1SRL A;  2FZK B;  2ATC B;  1Q7Y R;  1CKB A;  3RMS A;  2LCS A;  5GMK j;  4PJO C;  2QEX T;  1QP2 A;  2H3J A;  2JTM A;  5HK0 A;  1VIF A;  4F7U F;  5GAM g;  3LYI A;  5GMK i;  2O9S A;  2O2O A;  3OYE A;  1ZBX A;  1NYF A;  3JCM d;  4XU1 A;  3LLR A;  1WA7 A;  3MO8 A;  4QVC A;  3OYA A;  3FB9 A;  1M3A A;  3G4S T;  3VS2 A;  1ABO A;  5I21 A;  4M77 B;  1RI0 A;  2Y90 A;  1IRX A;  2CP6 A;  4XTZ A;  1QVG A;  3I56 Q;  2K7A A;  4CC7 A;  2RQR A;  3A5Z B;  3CMA T;  2P0Q A;  4ZN1 A;  5GAO n;  3R6O A;  3R6N A;  2CDT A;  4JJN K;  3JCM h;  1E7O A;  2KGT A;  2DIL A;  5FWB A;  3FJ5 A;  4JZ4 A;  1Q7Y C;  1WJQ A;  4M7D F;  3EHQ A;  2YSQ A;  5I22 A;  1VQ8 Q;  2DAQ A;  2CUD A;  2P4T A;  1WJS A;  4BDZ A;  4JJC A;  4X9D A;  1M3C A;  1UFF A;  1ZUU A;  4QVZ A;  4MZM A;  2K3X A;  2AIR B;  2E70 A;  1JRI A;  2PQW A;  1U1S A;  3CD6 Q;  2EJF A;  3NTH A;  2RD1 A;  2GTJ A;  4C8Q D;  2M51 A;  3CCR Q;  4RTX A;  3RNJ A;  3CCL T;  4LN2 A;  3CCV T;  2KSS A;  1AWX A;  1OZ2 A;  1K8A U;  2JN0 A;  2HKQ B;  3M55 A;  3NHN A;  2Y4X A;  5CKB A;  2RI2 A;  4KUL A;  3TCJ A; 
#chains in the Genus database with same CATH homology
 3VS3 A;  2ENM A;  2A08 A;  4JPB W;  4KRT A;  2K6D A;  2HEQ A;  3M0S A;  4E6R A;  2JMC A;  4OMP A;  1UGV A;  3VS6 A;  1CKA A;  3TSZ A;  2BZY A;  1KIK A;  2DX1 A;  2KRN A;  2AKK A;  2KEA A;  1ARK A;  2FRY A;  3H0I A;  2SEM A;  3JV3 A;  1T0J A;  1ZUY A;  2FO0 A;  2W0Z A;  4J9H A;  4RTY A;  2HCK A;  2LJ0 A;  1I0C A;  2KRM A;  2YUO A;  3I9Q A;  3NGP A;  2O88 A;  2K2M A;  1YN8 A;  2RQT A;  2O9V A;  2AZV A;  1YWO A;  1B07 A;  3LH5 A;  3EG2 A;  1OOT A;  2DL4 A;  1WDX A;  1WYX A;  1X2Q A;  5HCK A;  1QWF A;  1T0H A;  1YP5 A;  4HVU A;  3VS7 A;  1NYG A;  1JEG A;  2RNA A;  1W6X A;  2L3S A;  1AWJ A;  2DYB A;  3SEM A;  1AEY A;  3UAT A;  1UJY A;  1S1N A;  2FEI A;  2JM9 A;  1TUC A;  3QWY A;  1AWW A;  2VWF A;  2PNI A;  4R0K A;  1UDL A;  4X1V A;  5FWC A;  1JO8 A;  1QKX A;  1LCK A;  1ZBJ A;  2YT6 A;  2KRS A;  2LJ1 A;  1WXU A;  5IHI A;  4J9F A;  1T3S A;  2KT1 A;  3VRY A;  2A28 A;  3O5Z A;  2D8H A;  1OV3 A;  3RBB B;  4F16 A;  1N5Z A;  4J9C A;  4CC4 B;  1PRL C;  1E6G A;  1NG2 A;  4J9G A;  2DL5 A;  2L3Q A;  2X3X D;  1K0S A;  1KFZ A;  1Y0M A;  4RTV A;  4Z8A A;  1JQQ A;  4WCI A;  2DMO A;  1PKS A;  3I5S A;  1GL5 A;  1WXT A;  2X3W D;  2ESW A;  2L3P A;  3VS1 A;  3UA6 A;  4IIM A;  2KBT A;  2LX7 A;  2YUQ A;  1YNZ A;  4AFS C;  1VYV A;  4J9E A;  4RTU A;  1MV0 B;  4OML A;  2YUP A;  2EGC A;  2RN8 A;  2H8H A;  1RLP C;  1GBQ A;  2FPE A;  2J6F A;  2KYM A;  1JXM A;  1AZG B;  1X6G A;  2RQV A;  1M3B A;  4F17 A;  2EYZ A;  2JXB A;  2DM1 A;  2ED0 A;  2P4R A;  1SPK A;  1I07 A;  3I5R A;  4OMO A;  4LNP A;  1FMK A;  1BK2 A;  1K1Z A;  1PHT A;  2FPF A;  2EYX A;  1UEC A;  5EC7 A;  2GBQ A;  4HVW A;  4J9I A;  5L23 A;  1I1J A;  5ECA A;  1X6B A;  2F2W A;  1KSW A;  1QKW A;  1EFN A;  3TSW A;  4ORZ A;  1W1F A;  4HCK A;  2DF6 A;  2CH4 A;  3EG1 A;  2JS0 A;  2RPN A;  2K79 A;  1U5S A;  3PVQ A;  1J3T A;  4RTZ A;  1AZE A;  1WIE A;  2EVR A;  2LNH B;  2DL8 A;  5I11 A;  1RUW A;  2DRK A;  2RF0 A;  2C0O A;  1WXB A;  1RI9 A;  1GFD A;  5IHN A;  1NEG A;  4AG1 C;  2PTK A;  2DRM A;  2EYW A;  1SRM A;  4A63 B;  4Z89 A;  3UA7 A;  1WI7 A;  2DE0 X;  2KNB B;  2ABL A;  2I0N A;  2CSI A;  5IXF A;  3VRZ A;  2CT3 A;  1BU1 A;  1K0X A;  1AOJ A;  1BB9 A;  5FW9 A;  4Z88 A;  4K11 A;  2KYB A;  1ABQ A;  1YWP A;  4LE9 A;  1WX6 A;  1AVZ C;  1OPK A;  4J9D A;  2ROL A;  4AFQ C;  1ZUK A;  1ZX6 A;  2DJQ A;  1UTI A;  1X69 A;  4DEX A;  3ZL7 C;  5GJV B;  4AFU C;  2E5K A;  3M0R A;  2AZS A;  1VYU A;  2ROT A;  2DBK A;  1T3L A;  4OMN A;  1ZLM A;  2EYY A;  2MIO A;  1ZSG A;  2OJ2 A;  1WLP B;  2JT4 A;  2BZ8 A;  2DL3 A;  4LUE A;  1XOV A;  2D0N A;  1M8M A;  1SHG A;  2KXD A;  2DBM A;  4HXJ A;  2QDL A;  4RTW A;  4J9B A;  2W10 A;  3U23 A;  3REA B;  1MV3 A;  4GLM A;  1PRM C;  1UHC A;  1UHF A;  4JZ3 A;  3H0F A;  1GBR A;  1SSH A;  2C0I A;  1Z9Q A;  1M27 C;  2GNC A;  4ESR A;  1CSK A;  3H0H A;  4ZNX A;  1AWO A;  2RQU A;  1K4U S;  5IHK A;  3THK A;  2MOX A;  2IIM A;  1FYN A;  1W70 A;  1SEM A;  3PE0 A;  2VKN A;  1GCQ A;  2K9G A;  1OPL A;  2F2V A;  2DL7 A;  2JTE A;  3ULR B;  1JU5 C;  5GJW B;  3M0P A;  2BTT A;  2JS2 A;  3IQL A;  4CC2 A;  1SHF A;  2OI3 A;  2J6O A;  2GGR A;  3SHW A;  3TVT A;  3REB B;  4FSS A;  3M0U A;  1X27 A;  2V1Q A;  3M0T A;  2LZ6 B;  1NEB A;  1M30 A;  3CQT A;  1MUZ A;  5IXB A;  2ECZ A;  2J06 A;  4D8D A;  2CT4 A;  1QLY A;  1U3O A;  2FRW A;  2SRC A;  2EQI A;  1HD3 A;  2L2P A;  4D8K A;  2EBP A;  1GRI A;  1HSQ A;  3QWX X;  1VYT A;  2EKH A;  1H8K A;  2A36 A;  2EGE A;  2DVJ A;  2YDL A;  2NUZ A;  1E6H A;  2VVK A;  3I35 A;  4AFZ C;  3M0Q A;  1TUD A;  2F2X A;  2CUB A;  4Y92 A;  2YUN A;  1BBZ A;  4OMM A;  1WFW A;  3GBQ A;  2DA9 A;  4EIK A;  2G6F X;  2JM8 A;  2KE9 A;  1G2B A;  1PNJ A;  2XMF A;  3PVL A;  4RUG A;  2CH4 W;  2PZ1 A;  2KRO A;  1IO6 A;  2B86 A;  5IH2 A;  2LMJ A;  4HVV A;  1RLQ C;  1HJD A;  2J7I A;  2LQW A;  2EW3 A;  1JXO A;  2AK5 A;  3NPF A;  3NMZ C;  2HBW A;  2MCN A;  4GBQ A;  2J6K A;  2ED1 A;  4JJB A;  1SRL A;  1NLP C;  1CKB A;  2LCS A;  3VS4 A;  1PKT A;  1H3H A;  4F14 A;  2JMA A;  1K9A A;  4OMQ A;  2LP5 A;  1UUE A;  1TG0 A;  2K3B A;  2O31 A;  2FG0 A;  3EGU A;  2KR3 A;  2O9S A;  2HSP A;  2RMO A;  4QT7 A;  1UG1 A;  2O2O A;  1GCP A;  1OEB A;  4RTT A;  1G83 A;  1QWE A;  1H92 A;  1NYF A;  2C0T A;  1K76 A;  4LUD A;  1WA7 A;  2AKL A;  3KFV A;  1M3A A;  1VA7 A;  2DNU A;  2J05 A;  3VS2 A;  1ABO A;  1UE9 A;  1YCS B;  2BZX A;  2DLP A;  3H41 A;  2CSQ A;  1NLO C;  2K7A A;  4IIO A;  2RQR A;  4CC7 A;  4JJD A;  2D1X A;  2EPD A;  4M4Z A;  1X2K A;  2RQW A;  1A0N B;  2GTO A;  3R6N A;  2CDT A;  1QCF A;  3EHR A;  1E7O A;  2KT8 A;  1Y57 A;  2KGT A;  2HDA A;  3VS0 A;  2JW4 A;  4CC3 A;  2L0A A;  2DIL A;  1Z9Z A;  1GFC A;  3A98 A;  1V1C A;  5FWB A;  3FJ5 A;  1B3Q A;  4JZ4 A;  1PWT A;  2OAW A;  2LJ3 A;  3EHQ A;  2YSQ A;  5I22 A;  2CUD A;  1UJ0 A;  1NM7 A;  1X43 A;  2A37 A;  4JJC A;  1M3C A;  1UFF A;  2GQI A;  1ZUU A;  3C0C A;  1AD5 A;  3EG3 A;  3UF4 A;  2LQN A;  2EGA A;  2CRE A;  2GTJ A;  1KJW A;  2M0Y A;  2M51 A;  2V1R A;  4RTX A;  3RNJ A;  3VS5 A;  2D8J A;  4LN2 A;  1AWX A;  3EG0 A;  4DEY A;  2FPD A;  4AG2 C;  2KXC A;  2NWM A;  3NHN A;  1U06 A;  1GCQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...