2RHIA

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with h1.5k27me2 at 1.66 angstrom
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
CWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA03
3PNWC 1WJRA 4C5GA 5M9OA 4BE1A 3LGFA 2WACA 2F5KA 1WJSA 3FDRA 4IUPA 4UC4A 2CKKA 2X4XA 3QBYA 3PFSA 1KHCA 2LCCA 2RO0A 2EQUA 5D6XA 2R58A 2D9TA 2RHIA 3L2RA 1N27A 2HQEA 3UT1A 2O4XB 5KE2A 1RI0A 4E7HA 2BKDN 5C0MA 2YRVA 3OYMA 1OYXA 3E9GA 4B9XA 3BDLA 2X4WA 4II1A 2EQMA 2EQKA 2RHUA 1XNIA 2JTFA 3PMTA 2GF7A 3L2UA 3MEAA 4Q5WA 3OYEA 2E5QA 3LGLA 4ZTJA 1SSFA 2B8AA 4NS5A 4BDZA 4QQ6A 3MO8A 4E7KA 4Z02A 2P0KA 3Q1JA 2E6NA 4FL6A 4QVZA 3OYGA 4IUQA 2M1HA 3OQ5A 5D6YA 3S6WA 3F70A 4E7LA 2RJCA 4IUVA 4LD6A 2LDMA 3MEWA 2EQJA 2LRQA 4X34A 4GY5A 2HQXA 2LTOA 3C4SA 4QW2A 3MP8A 3OMGA 5KH6A 3FC3A 2IG0A 3DLMA 2RI2A 2K3YA 4N4GA 4PLLA 3OYJA 4PLIA 4L59A 4EDUA 4N4IA 5FRMA 5J26A 4FU6A 5FROA 4QQGA 3P8DA 2VYTA 3S3MA 1OZ3A 4A4EA 3LH0A 2NLUA 3OYDA 2R5AA 4IUUA 3L2VA 5CIUA 2MWOA 3M9QA 2DAQA 4RG2A 3QIIA 3OYNA 4C5HA 3OYBA 1WGSA 3NTKA 2LVMA 3OB9A 3PMIA 2BUDA 5D6WA 3OYFA 4BACA 2MWPA 3ME9A 3FLGA 3OS0A 3S3OA 3OYCA 2FHDA 5KCOA 4A4HA 2EFIA 2DIQA 3MEUA 2K3XA 5IN1A 1MHNA 3E9FA 3QKJA 4IURA 4PL6A 5C6SA 2X4YA 3MP1A 3OA6A 2BIVA 2R5MA 3L2WA 4ZTFA 1G5VA 2L89A 2RI3A 3KUFA 3EAEA 2L3RA 2PQWA 1OI1A 5IAYA 4IKFA 2RJEA 2G3RA 3O8VA 4OVAA 5KE3A 3OYKA 4BE2A 3OYAA 4QQDA 2RHXA 2X35A 3FEOA 3L42A 3LX7A 2QQSA 3ZEHA 4A4FA 3OYHA 3CEYA 2RJFA 2EKOA 4C5IA 4BDYA 2M0OA 2XDPA 5KCHA 2O4XA 3H8ZA 2M16A 3L2QA 4A4GA 4CRIA 3DB4A 3MEVA 4BD3A 3OY9A 2RI5A 2JZ2A 2RHYA 3MP6A 2GFAA 3OS2A 3OYLA 3DB3A 4N4HA 3P8HA 3S3NA 2L8DA 4B9WA 3OS1A 5FRNA 4IUTA 3OYIA 4E7JA 3GOXA 2RJDA 3H6ZA 2RHZA 3NTHA 4HCZA 2R57A 3SD4A 3NTIA 2GFUA 3META 3QJ6A 2DIGA 2XK0A 2QQRA 1H3ZA 3LLRA 4E7IA 4C5EA 1OZ2A 5J39A 1WJQA 3OMCA 3LYIA 4BE0A 3UWNA 3ASKA
chains in the Genus database with same CATH superfamily
1SRLA 3J7AF 2NUTB 4XTZA 4ANJA 2LNHB 2DD4A 5LJ5e 4JJNK 5KYNA 2HQEA 1SEMA 2NUTA 1ZBJA 2QEXQ 2V1QA 3AHUA 3CCVQ 4CC2A 1LOJA 2VV5A 1RLPC 2K7AA 2GF7A 4M7DD 2C06A 1BI2A 2C0OA 3CCRQ 2EYXA 3PIOA 2P0KA 1YHQT 1PRLC 2ABLA 2KYBA 2VASA 4QW2A 3V7CA 4MZPA 1N6AA 4C8QC 2RI2A 2ROTA 2L0AA 4ME7A 4N4GA 1KC8C 1QP2A 2YWWA 1VYTA 1YJWA 1WX6A 3RBBB 4VUBA 1H92A 3E2UA 3QG1A 2EYZA 2NLUA 3M0RA 4IUUA 4J83A 1UB4A 3OYNA 4M7AC 1N8RR 1WFWA 5KCOA 4XAXB 2FZCB 3CCSQ 1N9SA 2FPFA 5KYXA 2E1HA 2L3RA 3VS6A 4FYYB 3RR6A 5HY6A 3JCMV 3OYKA 1AEYA 3GIBA 2RHXA 2X35A 3A8GB 2HKNA 2RJFA 2DNUA 5CKBA 2D8HA 2KK4A 1ZUUA 3ER0A 4F7UB 1KQSS 2QASA 3M54A 3SEMA 2YT6A 4C8QG 3CPWP 3OW2S 1X6OA 4B6MA 2RHZA 1YCSB 1VQPA 3M57A 3M0QA 4Z88A 2QK0A 1TG0A 3UDCA 4IUPA 2DJQA 1KD1C 5LJ5f 2B86A 1MV3A 3EGUA 4DEYA 2RQRA 3CC4Q 4M4ZA 1VQ8T 3SB2A 2CP7A 1M90R 2YUQA 2KR3A 4C0DB 2JN0A 2EQMA 4ZTJA 2RPNA 1VQKA 3A5ZB 2K2MA 4CI0C 4ATOA 1M2OA 4LUDA 3GLXA 1YNZA 2KXCA 4X34A 2D0QB 3M55A 4MZTA 4PJOF 4C8QE 2CGHA 3QDFA 3G4ST 1M2VB 1N5ZA 1AWJA 2JVVA 1NM7A 4JJDA 3S3MA 2HSPA 3TSZA 1I8FA 1E6GA 1KD1U 4M7AE 2E64A 5GAMg 2QI2A 3OB9A 1Q7YR 2E4HA 1V76A 1YJWT 5DY9A 3VS2A 3LWHA 3N5BB 4OMNA 1YITT 2C0TA 3MKDA 1VQ6T 4Y91A 1SRMA 2A0FB 4M7AF 3ZEHA 3TU4K 3PIPA 1S72Q 2P0PA 2FZGB 2HNIA 2OTLT 3PTAA 2DYIA 2M0OA 3HP9A 3CCQA 2M16A 1AVZC 1YJ9A 3GNGA 2PUOB 1X2QA 2M51A 4BD3A 2RB6A 4ZGJB 4NOYA 1UHCA 1PRMC 3EG1A 4FIBA 2GFAA 2A28A 3CXCS 2FYKA 2AHJB 5FRNA 2J6FA 1QVGA 2FO0A 3META 3QSUA 2DBMA 3SHWA 2KSSA 3BW1A 2LX9A 4E7ZA 1VA7A 3PNWC 3CCUT 1KSWA 2ZPFB 4KULA 1GCQC 2KI7A 2CKKA 2CZ1B 3VS7A 2LP5A 2YLBA 3G7ZA 3OYYA 3CMEQ 1W2BA 3JCMf 3J81E 1G2BA 5C0MA 4KGVB 1VQ5A 4KGXB 4KRTA 1U8RA 3VUBA 1WHHA 4DEXA 2E10A 2JTFA 3MEAA 4K11A 2HDAA 4DBRA 3LGLA 1RAEB 1NEGA 1SHGA 1KQSA 2PZ1A 2EGAA 2EGEA 3G4SQ 2FRYA 1BIAA 3PGGA 4C0DC 5HKCA 2E6NA 3WXMB 2KRNA 2EVRA 4LD6A 1G3TA 2M0YA 3G71A 2E3HA 1VQOT 3C4SA 1YWPA 1VQKT 1VQ4A 1KHIA 2XG8D 1ZSZC 4PLLA 3V7RA 5A2QE 1NE8A 3G6ET 1WA7A 4M77C 2R5AA 1RI9A 4X9CA 1HYOA 1VQ6Q 1K0XA 2QDLA 4AG2C 4HT9A 4C5HA 5D6WA 3U23A 2P0QA 3I56Q 3I5SA 7AT1B 2IPOB 2X4YA 1YI2T 5GAN4 1U3OA 3H0FA 2VC8A 4M7AB 1Q7YU 3PVLA 4LXCA 3X25B 2MYSA 2J6KA 3HFNA 2QA4A 3TCJA 2NUPA 2O9VA 5FU6C 2IVWA 2VVKA 2NUPB 4XQ3A 2FEIA 5LJ3f 1D1BA 2BTTA 4J5YA 4JPBW 1P92A 3VUZA 2OTJT 1MMAA 2RMOA 2L8DA 1KQ2A 3JV3A 4HCZA 5CAIA 3CCVA 1KC8U 4LDYA 2DIGA 1NG2A 2QQRA 1C0MA 2EYQA 1YITQ 5J39A 1G3SA 3LGFA 3HFOA 4UC4A 4XU0A 1N8RU 1BBZA 5DM7R 2JUFA 1JEGA 1VYUA 3UATA 1C6VX 1TU0B 3FRNA 4ELZC 1PC0A 3CD6T 1KQSP 1PD0A 5L23A 3HHTB 2V8IA 1XNIA 1K73R 3M0TA 4AFSC 2COYA 1I5LA 2KAFA 1GCQA 2ATCB 3CCJA 2O31A 2KVQG 1Y96B 3Q1JA 3OSSC 2JNGA 1TTHB 4RCBA 4JJCA 4M7AA 3I56A 2LJ1A 2JS2A 3MP8A 2HZYA 3CCSA 5GANj 1YIJQ 4N4IA 3EHRA 2E3IA 1NYGA 5KYUA 3P8DA 2VYTA 1QVGP 4DQ2A 2GQVA 2I2LA 1VQOA 2VXEA 4J9GA 2XMFA 4XTYA 4OGCA 3S3OA 4F7UF 4JRPA 3ME9A 4ZGDB 5IN1A 2LC4A 3HL8A 4J6XA 4MZMA 1VQMT 2CSIA 3VYHB 5KE3A 1QWFA 1JJ2S 2RK2A 1VQ4T 3JCMg 3QDRB 1BI1A 4F17A 3G6EA 1K8AC 3QWXX 3HKSA 3CCRA 2EWNA 1Q95G 1M1KU 3GNFB 3EG0A 3DB3A 2LNVA 4RCCA 3PT9A 3P8BB 1D0XA 2BE9B 2DPPB 2XIDA 3QWYA 4M78F 1MUZA 1ZQ1A 2XI9A 4LN2A 2X3WD 1Q82C 3A8HB 4HCBA 1QVFA 1PM3A 4E7IA 3CD6Q 1HK9A 3LYIA 2EJ9A 5FU7C 4BE1A 5GMKj 3OS5A 1O9SA 2KE9A 3CCVT 2EKHA 3REBB 4KGZB 4LD9K 5KYWB 4BY6C 4J9CA 1RABB 4M77D 3RDVA 3OYMA 1GRIA 2PUKB 2X4WA 2RHUA 1JXOA 3RKYA 4M75C 3DLLA 1XTDA 2WSCE 3M0PA 2EPDA 4PJOB 1X43A 4MMLA 2OI3A 3H0IA 2DD5A 3OQ5A 4E6RA 4BI3A 1UE9A 4D6WA 3CCJT 3CBMA 1UDLA 5D7UA 2JM9A 5IHNA 4LDXA 3OYJA 2EW3A 1UGSB 3CPFA 4DBHA 2YHTA 1NJIU 5FROA 4J9BA 2QGFB 4AMCA 2AT1B 3CPWA 3I56T 1QWEA 4XTUA 3PMIA 5GAN3 2HBWA 3FLGA 3CMAQ 5GAMh 3BDUA 1B3QA 2OJ2A 2DL5A 2K5LA 1RLQC 1U1SA 1E6HA 4ORZA 1UECA 3ZFJA 1EZZB 2RJEA 2EIFA 1YJNT 3FEOA 5GAN5 2CUBA 5CQYA 3G1JA 2DTIA 5KYWA 4KH1B 3DB4A 4J9HA 1UGPB 3H0HA 3P8HA 1QLYA 1XQHA 4FYXB 5LL6S 3I55T 2R57A 3QZ9B 3LLRA 2ZPEB 3ASKA 5CQXA 4EMKB 1VQ8Q 3V8LA 1OOTA 1K9MC 3G71T 2DA9A 1MNDA 1DJ7B 1D0YA 2XKOC 1IHVA 4E47A 5GANe 1K8AR 1N27A 3OBWA 1PSFA 3CC4A 3GF5A 3V8JA 1TOVA 4PFOA 5CO7A 2DXUA 1M1KR 2CT3A 4XK8E 8ATCB 1KD1R 2HL5C 2J06A 4JJBA 2FPEA 2AK5A 4C8QB 1ZSZB 2CZ6B 5FLXE 1BU1A 1BI3A 3EH1A 4BUGA 4OMMA 3CMAA 1ARKA 1G3WA 2QA4T 5L8RE 4XTVA 5ECAA 4ELYC 2KROA 2DL7A 2COZA 1R8OB 2K3BA 2F2XA 4A54A 5GAMd 2V26A 1M8MA 1BKBA 2A3LA 3NFCA 4A4HA 4M77G 3E1SA 4PL6A 2O2OA 4M7DB 3TVTA 3SFMA 3KUFA 1WDXA 2ED1A 3EH2A 2RQVA 2CZ7B 3VKIA 2LCLA 3E19A 5GAMe 2A7YA 1JU5C 1S72A 1G8XA 2LQNA 4BDYA 4C92B 2O01E 4LDUA 1NJIR 1VQ8A 4WTOB 4KT0E 1IRXA 3QJYA 5GAMj 1VQLT 1WHGA 2ESWA 1R0CB 1BYMA 4DOWA 1OZ2A 4OP0A 1UJYA 5I21A 2P4TA 4RTYA 4C92F 2O9SA 2F5KA 4WF2A 1CKBA 1KHCA 3FJ5A 3BE3A 4C92D 2LCCA 2Y4XA 2D9TA 3QYGB 5A0GA 1WYXA 1WQWA 4GLKA 1VYVA 1ZUKA 3EG2A 3VRYA 1IREB 4F14A 1R0BG 1RUWA 9ATCB 4TVRA 1WHMA 1VQPQ 5DLOA 3I55Q 4BB7A 2QA4Q 2YUOA 4HA8A 1M3AA 2FL7A 5D6YA 1T3LA 2ED0A 5GAOp 4JZ4A 3QXEB 1QP3A 4NL2A 2VWFA 4GY5A 2HQXA 4M77B 2F1LA 5KH6A 2MOXA 4PJNA 3VS4A 4JS5A 4MDXA 2FB7A 5KYYB 5I11A 4EPCA 1WNLA 2NYSA 3VS3A 1ACMB 1RACB 1KFZA 3NTKA 2K5FA 1HXDA 1ZX6A 1D1AA 1M27C 3M58A 3ULRB 4XU2A 5CKEA 3FJPA 4LE9A 4KBMB 4HXJA 3EHQA 3LX7A 3JCMd 1GXIE 1OX9A 3TEEA 5GAMf 1T0HA 2CP5A 1VQLQ 4DBQA 2VKNA 1ABQA 1VUBA 2A37A 3V8KA 2DTOA 5CVIA 4LNPA 1AZGB 1OV3A 3VYGA 3CCMT 3UF4A 5FU7B 1FMVA 2EYYA 2DVJA 3NTHA 4OB3B 3EGDB 1NZ9A 4FW1A 2BZ8A 4F7UE 2ZCFB 2E12A 4DBFA 5CK9A 2E41A 1KG1A 4XU3A 4AFZC 2JW4A 3JCMJ 3JB9I 4FCYA 2RQWA 2X4JA 2LX7A 4PNOA 1K9MU 4PFZA 2KRSA 1CKAA 1AT1B 1V1CA 1NLOC 2DX1A 2X9HA 1M90C 1X69A 2QG9B 2B8AA 3TQ7P 1VOMA 4BDZA 4E7KA 1NEBA 4BI8B 1RAIB 3SDZA 2CP2A 2VGMA 3G6EQ 2P84A 3JRZA 4M78E 2GCXA 3HTRA 1VQ5Q 4OGEA 3MCAB 2HD0A 1RL2A 4A63B 3FC3A 3DLMA 3CMET 1U5SA 3JB9J 3M59A 4CC4B 5HCKA 3RMQA 2JXBA 4EMHA 4YTLA 4JRKA 4OMPA 2BUDA 2MWPA 3EG3A 3OS0A 3HRTA 2FHDA 3MEUA 1YHQA 2EAYA 1FXXA 2XU8A 2QQAA 4QKUA 1A0NB 1F1BB 4Y28E 1JJ2A 5IAYA 2W0ZA 2LJ0A 1ZUYA 1VQKQ 1Z9QA 3L42A 5LJ5j 2OTJQ 2HL3A 1Q86U 1IB8A 2JMCA 2QQBA 1MGQA 1MNEA 2O88A 4F7UG 1PCXA 1N8RC 1X6GA 3M4YA 1YWOA 3GP8A 3OY9A 2RHYA 1OX8A 1V29B 5A0DA 4A53A 1QQJA 2MMPA 2ZPBB 5CR2A 2RH2A 2JJ9A 3HRSA 4ZGEB 2Y90A 2CS7A 2DYBA 4BY6B 4PFPA 3X28B 4HVUA 4NS5A 2QEXT 4RG8A 4Z8AA 3JCMQ 2SEMA 3PFSA 2BE7D 2XD0A 2DXBA 3J80E 1BB9A 2QTVA 1Q81R 3UT1A 1VQ7A 4M75B 2O4XB 2CSQA 1M2VA 3NMZC 3E9GA 1QW1A 4F04B 4GLMA 2KDSA 3H9NA 1MMGA 2ZGWA 2K57A 4RTXA 1ZSZA 5CCAA 2LJ3A 2H3JA 4CC7A 2PNIA 4QQ6A 3JCMh 1OQKA 3PE0A 1SKUB 2AKLA 2DJZA 3O5ZA 4IUVA 4ZN3A 1PD1A 3MEWA 1AZEA 2M9UA 2YLCA 1U1TA 3CCLQ 1W1FA 4L59A 1GFDA 4QQGA 1OULA 4EMGA 5LJ3j 2WSFE 2EJFA 3CPWS 1WPYA 3RERA 3PVQA 4Z89A 3OYCA 5GAN6 2K3XA 2QDYB 3OBYA 5LJ3d 4ZTFA 1YIJA 4HVVA 1RAGB 2GNCA 2F2VA 1RAFB 2KNBB 3OYHA 1B07A 3CEYA 2GTJA 3WVEB 4M7AD 5GJWB 2AZVA 3JCMW 1K76A 1VQMA 4CRIA 1IZ6A 2KT1A 4JS4A 1JXMA 2DMOA 4N4HA 3MJXA 2VXFA 2OTLA 1AD5A 2CP0A 4PJJA 2DVEA 3CCQT 1PHTA 1M30A 1I0CA 4J9IA 4J7FA 3LH5A 1H3ZA 3JCMX 4Y92A 2BZYA 2A36A 2DLPA 2FG0A 1K9AA 2DL3A 5GAOq 3L2RA 3X26B 1EFNA 3JCMe 4OB0B 2ECZA 4FSSA 4II1A 1LNXA 1KC8R 3EFOB 3L2UA 3OYEA 3CCJQ 2QQ9A 4P5NA 1W2BP 2QXFA 1FMWA 4Z02A 2CH4W 2HBPA 4QVZA 2CYZB 3CCET 3CCUA 4JRQA 2LDMA 5GAN2 2L3QA 1Y57A 3X20B 1VQ7T 2V8JA 2K3YA 2M02A 1Y7XA 3V7SA 4XTXA 5GJVB 1VQNQ 1VQ9Q 4LUEA 4C92A 1WQ7A 1X01A 1WHKA 1SF9A 1NPPA 1ABOA 2DILA 4M7DC 3CCMA 2L3PA 5HK0A 1JO8A 1YJNA 2V8KA 3OA6A 1M1FA 4RTUA 2K5IA 5CKHA 3CC7Q 4AG1C 4O6JA 1Q82R 3O8VA 2LT1A 3H41A 2V1RA 1M90U 2QQSA 1TH7A 2EKOA 1NPRA 1S1NA 2ROLA 3DKMA 2EGCA 1HJDA 2LQWA 1TUGB 4A4GA 1M5Q1 3MEVA 4C92E 5LJ3e 4HCKA 3OS2A 1U06A 1YCYA 3S3NA 3EFOA 1SPKA 2AIRB 2VUBA 1NBEB 2JT4A 3OYIA 2GGRA 3VS5A 2FVUA 1UUEA 5I2MA 3ZL7C 3MO8A 3RIRA 1QKXA 1ZA2B 1WJSA 3QUIA 4IIMA 2QTXA 3QBYA 2CH4A 4NL3A 4PJOG 2MK5A 2EQUA 5D6XA 3L2ZA 2HMAA 1X2KA 2H3EB 2RM4A 4F7UA 3CCUQ 2J6OA 2NWMA 5KYYA 3CCEQ 2ZAEA 1T0JA 2DL4A 2HCKA 2E5QA 2YSQA 3RKXA 4LDWA 1SSFA 3CC2A 1VQ9A 2BZXA 1AWOA 4M7AG 2DZCA 3VV0A 1UG1A 2OAUA 3OYGA 3CCLT 2EQJA 1YHQQ 3EG9B 1K73C 4F16A 4M78A 3CXCA 1LCKA 4HKEA 3HRUA 2YRCA 3CMAT 1AWXA 1JQQA 3M9QA 4E7SA 1SSHA 2YUNA 4C92G 2ZPHB 3VS1A 5FWBA 1MMDA 4N0AC 1GBRA 3KXTA 1MHNA 4IURA 3QKJA 3VS0A 1UHFA 3D7SB 3A8OB 1TXQA 4KH0B 1TWBA 1BI0A 1YJ9T 1LPLA 3HSBA 4BE2A 1YP5A 4HT8A 3M5AA 3TREA 1PKTA 2PTKA 1AHJB 1JB0E 2QYZA 1HD3A 3MHXA 3UA6A 2KMTA 1Y71A 4R55A 1I81A 3A8MB 3GOXA 1W70A 2DL8A 1I07A 1JRIA 4M75F 2KEAA 2XK0A 4FYWB 1Q7YC 2K2VA 3UA7A 4RUGA 4C5EA 1FWZA 3UWNA 1WJRA 1O75A 2JS0A 3RUXA 4JZ3A 2CP6A 2RO0A 1Y07A 4EMKA 1RI0A 4M75E 1CSKA 1AOJA 3RKWA 2F69A 1B34A 2XDBA 4PJMA 1GFCA 1UGRB 2XHCA 2YUPA 5GANd 1KJWA 3R6NA 1GL5A 5GANh 1M4ZA 4CC3A 4FL6A 4R0KA 1JBMA 1YIJT 4X1VA 2RJCA 4OF1A 2RQUA 3OMGA 5GMKl 2RA2A 1N9RA 2LT4A 2EQIA 2E5KA 4GBQA 1OZ3A 1OEBA 4BI4A 1QVGS 5AT1B 2MCNA 5CIUA 2DAQA 2HEQA 4J6YA 3KBGA 5FWCA 4PJOD 2E70A 2YRDA 1VQMQ 1HSQA 1K1ZA 2DIQA 1H3HA 4J7IA 3A8LB 1G5VA 3CCLA 1QCOA 2MI6A 4IKFA 3JSCA 2JTEA 3OYAA 4QT7A 4M7DG 2CP3A 2OTJA 3IQLA 5J3BA 4MDWA 5KCHA 3L1AA 3L2QA 1TUCA 2K4YA 1TSFA 2LCSA 1YN8A 2WSEE 3OYLA 2QGGA 1IHWA 3CQTA 2L3SA 4AFUC 2RJDA 4FSXA 5GMKh 2KXDA 2X51A 2AZSA 1OPKA 2EYWA 3JCMP 1I1JA 3EFSA 4BE0A 2AKKA 5I22A 1LJOA 1QVFP 1UGVA 3I5RA 2DXCA 2DKGA 4AT1B 1NLPC 5GAOr 2DZ9A 4HCCA 4PJOC 1M1KC 4V2SA 4E7HA 1VQPT 3SWNB 2BKDN 1UJ0A 1E7OA 2GQIA 1YBYA 5FW9A 1RADB 1Q82U 2FPDA 3INZA 3JCMb 1G3YA 1KQ1A 5LJ5d 3CC4T 3I55A 4J9EA 4M78C 4AFQC 2DETA 4C92C 2D8JA 1X75C 2A08A 2M1HA 3F70A 4M7DA 2HAXA 1IGUA 1QCFA 4N0AA 1XOVA 4FU6A 4O5VA 4KUDK 1D3BB 3EGXA 2EJGA 4PJLA 4JDSA 1MMNA 2DEQA 4RKUE 3L2VA 1YITA 2MWOA 2JMAA 4M7DE 3R6OA 3QIIA 2X3XD 4KUIA 3T9NA 1VQ6A 1WI7A 1BCOA 1BK2A 4RTTA 1QMCA 2NUZA 1K4US 1WHLA 4WCIA 5GAN8 3MP1A 1Y0MA 2RF0A 2OAWA 1OPLA 4M77A 5LJ3g 2G3RA 4M7DF 3FB9A 2JOYA 4RTZA 1NJIC 4MMKA 1W4SA 2CUDA 1PWTA 3M53A 3H8ZA 1X27A 3M0SA 1D09B 1Q86C 2RI5A 2LQ8A 3THKA 1X6BA 1K0SA 1S72T 1LVKA 4HVWA 2OTLQ 3CC2T 2L5QA 1Q81U 1K73U 4DA4A 2W10A 1BCMA 1I5OB 4C5GA 2SRCA 5M9OA 2KRMA 3VU3C 4A4KA 1RAAB 4RMOA 3FDRA 3EGDA 5GMKe 2R58A 2RHIA 4D8KA 5IHKA 1TS9A 3G71Q 1OYXA 2DK3A 5KYUB 1QVPA 3HPWA 1UGQB 1Y96A 1VQLA 2DF6A 3EFRA 1UTIA 1K9MR 1G83A 1M3BA 4X9DA 1VQ7Q 4ZN1A 3CBOA 3QHSA 3EG9A 4FT4A 3LWIA 1GCPA 2LTOA 4M78B 5GMKi 1QVFS 2D0NA 2IG0A 2FZKB 2JTMA 4J9DA 1KIKA 4PLIA 1EIFA 3BY7A 1PSEA 3UPUA 2I0NA 4M75D 1VQOQ 4QVCA 4RG2A 3OW2P 1XJWB 3KFVA 5IT9E 3M56A 2DE0X 3OYBA 3QZ5B 4C8QF 2LVMA 2K79A 4BACA 3OYFA 2FRWA 3BFMA 2PU9B 2EFIA 5LJ3h 2MF2A 3E9FA 2XDDA 2G6FX 5C6SA 2J7IA 3A1PA 4OMOA 1QCNA 3L2WA 3C12A 2CREA 1WXBA 4JRIA 2PVGB 1TUDA 5GAOn 1OI1A 2LQKA 3QYHB 2F5TX 1W2BS 5GMKm 1JJ2P 1B7TA 1QKWA 4L6V5 1IO6A 2RK1A 1M8VA 2MIOA 4C5IA 3CCQQ 3I9QA 1ZSGA 2KGTA 1WXTA 2HKQB 5IXFA 5CKDA 5HK3A 4OMLA 3JAME 2Y4YA 3OW2A 3QPHA 1PG5B 3C95A 5FU6B 4EMKC 2DFUA 1AWWA 2RNAA 2DM1A 4E7JA 4JLIA 1UEBA 3JB9D 4PJOA 3H6ZA 4PJOE 3SD4A 4DOVA 4D8DA 1YI2A 2MPXC 1MV0B 3C94A 3X24B 4FT2A 1Q86R 3CD6A 4FW2A 2KY9A 2DTHA 3SWNC 2X4XA 1T3SA 5GANf 6AT1B 1SG5A 1B34B 3JB9F 4M77F 2YRVA 2ZPIB 1IGQA 4B9XA 5CKFA 3BDLA 4FM4B 5IHIA 2EQKA 3GPLA 3CCEA 3A98A 2ENMA 5GAN7 1KK7A 5EC7A 2K9GA 2PVOB 1ZBXA 4LDVA 1WZOA 1Z9ZA 4J8OA 3CC2Q 1J3TA 3URGA 1ZHIA 5EG2A 3RMSA 2CDTA 1VQNT 1NYFA 4M77E 4M78D 1VIFA 4E2FB 2OX7A 5DLQE 2VGNA 1VQ4Q 4M75A 3AT1B 3M0UA 2C0IA 4C0FA 4EDUA 4RTVA 3LW5E 1PKSA 5LJ5g 2GBQA 4EIKA 2QAZA 1ZLMA 4A4EA 3OYDA 3CC7T 1M9SA 3ZBDA 1BIBA 3MPUB 3CMEA 1YJ9Q 8AT1B 2LZ6B 2R5MA 2L89A 2RI3A 5GAOl 1PNJA 3TSWA 2P4RA 3EAEA 5I2SA 1M1GA 2PQWA 3CBPA 4OVAA 3CCST 2KQWA 3WVDB 4A4FA 2H8HA 3I35A 3RESA 3G4SA 4J6WA 1YI2Q 3JCMc 3CCMQ 5IH2A 4QVDA 2XDPA 4ZNXA 2DRMA 2LMJA 1YJNQ 2JM8A 2O4XA 1ZA1B 2PVDB 4OB1B 5AYFA 3MP6A 2Z0WA 3C0CA 4C0GA 4IUTA 1M3CA 1FX7A 3CCRT 3QJ6A 1WIEA 2K6DA 5IXBA 3FIFA 2DERA 2E6ZA 2DRKA 4M75G 3JB9H 3GBQA 1Q81C 2WACA 5GANg 4OMQA 5A0LA 1K8AU 3OSVA 1D0ZA 1H8KA 1YFNA 2RN8A 2KBTA 2J05A 5KE2A 1H641 2CT4A 1OU9A 3NHNA 3NGPA 2COWA 2F2WA 2ZZDA 3PMTA 4C8QA 4XTWA 4Q5WA 2XICA 3QO3A 1WLPB 3NPFA 4IIOA 2D1XA 4IUQA 2DXTA 3S6WA 4E7LA 2LRQA 2QEXA 4C8QD 1VQ9T 1SHFA 1D3BA 3EGXB 4OB2B 2ZPGB 2VB6A 2DEUA 1GBQA 2GTOA 3JB9G 1I4K1 3M4GA 5FRMA 1VQNA 4FYVB 1RAHB 1VQ5T 1D1CA 5GAOm 3RNJA 2IIMA 4OMFB 3LH0A 1OU8A 1C1AA 4ESRA 3VRZA 2YXYA 3CXCP 2YDLA 1FMKA 2EBPA 1WGSA 4PK4A 4XU1A 4RTWA 1W6XA 2DBKA 2MAMA 2KYMA 3REAB 1UFFA 2BIVA 3CC7A 4J9FA 1YJWQ 1VIEA 2HSEB 1WXUA 4QQDA 4C0ZA 1R77A 2L2PA 1WHJA 1IXDA 2RQTA 4R56A 2HQHA 2KT8A 1FYNA 3SWNA 5LJ5h 4M78G 4PKCC 2JZ2A 2D6FA 2DO3A 2RD1A 2E65A 3OS1A 4B9WA 4JUVA 4L5GA 1EX4A 3VJPA 3NTIA 2GFUA 2CZ0B 5KYXB 4JLGA 1WJQA 3OMCA 5J26A
chains in the Genus database with same CATH topology
5FU7C 4BE1A 5GMKj 3OS5A 3J7AF 1LJOA 2QEXT 4RG8A 4XTZA 3JCMQ 1O9SA 1HK9A 3PFSA 2DXCA 2DKGA 2DD4A 2XD0A 3CCVT 2DXBA 5LJ5e 3J80E 4JJNK 5GAOr 2HQEA 3UT1A 4M75B 2DZ9A 1VQ7A 2O4XB 4BY6C 4HCCA 4LD9K 4M77D 4PJOC 1M1KC 4V2SA 4E7HA 1VQPT 3SWNB 2BKDN 1YBYA 3E9GA 1QW1A 3OYMA 3AHUA 2KDSA 2PUKB 2X4WA 1LOJA 1Q82U 2RHUA 2ZGWA 3RKYA 3INZA 2VV5A 4M75C 2K57A 2GF7A 3DLLA 1XTDA 3JCMb 1G3YA 1KQ1A 2WSCE 4PJOB 5CCAA 5LJ5d 3CC4T 3I55A 4M7DD 2H3JA 4M78C 4QQ6A 3JCMh 4MMLA 2C06A 1BI2A 4C92C 3PIOA 2P0KA 1X75C 1YHQT 2DD5A 2DJZA 2M1HA 3OQ5A 3F70A 4IUVA 4ZN3A 4M7DA 4BI3A 3MEWA 2M9UA 2HAXA 4D6WA 4QW2A 3CCJT 2YLCA 3CBMA 3V7CA 1U1TA 4MZPA 1N6AA 4C8QC 2RI2A 4ME7A 4N0AA 4N4GA 1XOVA 1KC8C 4LDXA 1QP2A 3OYJA 3CPFA 1UGSB 4L59A 1YJWA 2YHTA 5J26A 4FU6A 4O5VA 5FROA 1D3BB 4QQGA 2EJGA 4VUBA 1NJIU 4KUDK 4JDSA 3QG1A 4EMGA 2DEQA 2NLUA 3CPWA 3I56T 4IUUA 4RKUE 3L2VA 1YITA 2MWOA 4M7DE 5LJ3j 3R6OA 2WSFE 4J83A 2EJFA 3QIIA 1UB4A 1WPYA 3CPWS 4KUIA 3OYNA 3T9NA 1VQ6A 4XTUA 4M7AC 3PMIA 5GAN3 3RERA 3FLGA 5GAMh 3OYCA 5KCOA 4XAXB 5GAN6 2K3XA 3BDUA 5GAN8 2QDYB 3MP1A 3OBYA 1N9SA 5LJ3d 4ZTFA 2K5LA 1YIJA 1U1SA 2E1HA 2L3RA 3ZFJA 2RJEA 4M77A 5LJ3g 2EIFA 2G3RA 5HY6A 3JCMV 3OYKA 4M7DF 3FB9A 1YJNT 3GIBA 2RHXA 2JOYA 2X35A 3FEOA 3A8GB 1NJIC 3OYHA 4MMKA 3CEYA 5GAN5 1W4SA 2RJFA 3WVEB 4M7AD 5CQYA 5CKBA 3M53A 3JCMW 2DTIA 2KK4A 3H8ZA 1VQMA 3ER0A 4CRIA 4F7UB 1KQSS 3DB4A 1IZ6A 4JS4A 2RI5A 1Q86C 1UGPB 2LQ8A 4N4HA 3M54A 3P8HA 4C8QG 1S72T 3OW2S 2VXFA 1XQHA 2OTLA 5LL6S 1X6OA 3CC2T 2L5QA 3I55T 2DVEA 3CCQT 2RHZA 2R57A 1Q81U 1K73U 4DA4A 4J7FA 3QZ9B 1H3ZA 3LLRA 2ZPEB 3JCMX 1VQPA 3M57A 3ASKA 5CQXA 4EMKB 4C5GA 5M9OA 3V8LA 3VU3C 4A4KA 4RMOA 3G71T 3UDCA 3FDRA 4IUPA 1K9MC 1DJ7B 2XKOC 5GANe 4E47A 5GAOq 1KD1C 5LJ5f 5GMKe 2R58A 2RHIA 3L2RA 1N27A 3OBWA 1PSFA 3X26B 3CC4A 3GF5A 3JCMe 1VQ8T 4OB0B 3SB2A 3V8JA 1OYXA 2DK3A 4C0DB 5CO7A 2DXUA 2JN0A 4II1A 1LNXA 2EQMA 1QVPA 4XK8E 3HPWA 1UGQB 3L2UA 1Y96A 3OYEA 4ZTJA 1VQLA 3EFRA 2QQ9A 4P5NA 1VQKA 3A5ZB 2QXFA 4Z02A 4C8QB 4X9DA 2CZ6B 5FLXE 4CI0C 1BI3A 2HBPA 2CYZB 4QVZA 4ZN1A 3CBOA 3CCET 4ATOA 3QHSA 4FT4A 3GLXA 3LWIA 3CCUA 4JRQA 4BUGA 2LDMA 5GAN2 4X34A 2D0QB 2LTOA 3M55A 4M78B 4MZTA 4PJOF 4C8QE 2CGHA 5GMKi 3CMAA 1G3WA 3X20B 1QVFS 2IG0A 1VQ7T 2V8JA 2JTMA 4XTVA 2K3YA 5L8RE 3G4ST 2QA4T 4ELYC 1Y7XA 3V7SA 2JVVA 4PLIA 4XTXA 1EIFA 1R8OB 3BY7A 1PSEA 3UPUA 4C92A 1WQ7A 1X01A 3S3MA 4A54A 4M75D 5GAMd 1I8FA 1NPPA 4QVCA 4RG2A 5IT9E 3M56A 1KD1U 4M7DC 4M7AE 3CCMA 1BKBA 2E64A 5GAMg 2QI2A 3OYBA 3QZ5B 3OB9A 4C8QF 2LVMA 4BACA 3OYFA 5HK0A 1YJNA 1YJWT 2A3LA 5DY9A 3BFMA 2PU9B 3NFCA 3LWHA 3N5BB 2EFIA 4M77G 5LJ3h 2MF2A 4A4HA 3E9FA 3E1SA 2V8KA 4PL6A 1M1FA 5C6SA 2XDDA 3OA6A 4M7DB 2K5IA 1YITT 3L2WA 3C12A 5CKHA 3SFMA 3KUFA 4JRIA 2PVGB 4O6JA 5GAOn 1OI1A 1VQ6T 2CZ7B 2LQKA 3QYHB 2F5TX 4Y91A 3O8VA 2LCLA 3E19A 3VKIA 2LT1A 5GMKm 1W2BS 1M90U 4M7AF 3ZEHA 2QQSA 3PIPA 4L6V5 2P0PA 5GAMe 3TU4K 2A7YA 1S72A 2RK1A 1M8VA 1TH7A 2EKOA 1NPRA 2HNIA 2OTLT 4C5IA 4C92B 2O01E 3PTAA 3DKMA 4BDYA 2M0OA 4LDUA 3HP9A 3CCQA 1VQ8A 2M16A 1YJ9A 3GNGA 2PUOB 1M5Q1 4A4GA 3MEVA 4C92E 5CKDA 4BD3A 2RB6A 4ZGJB 5HK3A 4NOYA 5LJ3e 4KT0E 3JAME 2Y4YA 4FIBA 2GFAA 3OS2A 3OW2A 3QPHA 1YCYA 3CXCS 3C95A 5FU6B 2FYKA 4EMKC 2AHJB 3S3NA 2VUBA 5FRNA 3QJYA 5GAMj 3OYIA 4E7JA 4JLIA 1QVGA 1VQLT 1UEBA 3JB9D 4PJOA 3H6ZA 4PJOE 3SD4A 4DOVA 3META 3QSUA 1BYMA 1YI2A 2FVUA 4DOWA 3C94A 5I2MA 3X24B 2KSSA 1OZ2A 3BW1A 4FT2A 4OP0A 3MO8A 3CD6A 2LX9A 3RIRA 5I21A 2P4TA 2KY9A 3PNWC 4C92F 2DTHA 3SWNC 2ZPFB 4KULA 3CCUT 2F5KA 1WJSA 4WF2A 3QUIA 2CKKA 2QTXA 2CZ1B 2X4XA 1KHCA 3QBYA 4C92D 5GANf 2LCCA 4NL3A 4PJOG 2EQUA 2Y4XA 5D6XA 2D9TA 3QYGB 2YLBA 3L2ZA 3G7ZA 5A0GA 2RM4A 3OYYA 1WQWA 1W2BA 3JCMf 4GLKA 4F7UA 3J81E 5C0MA 1B34B 3JB9F 4M77F 2YRVA 2ZPIB 1VQ5A 1IREB 4B9XA 5CKFA 3BDLA 4FM4B 1U8RA 3VUBA 2EQKA 3GPLA 3CCEA 4TVRA 2E10A 2JTFA 3MEAA 5GAN7 2E5QA 3LGLA 4LDWA 3RKXA 1SSFA 2PVOB 1ZBXA 4LDVA 4J8OA 1KQSA 1VQ9A 3CC2A 5DLOA 4BB7A 4M7AG 3URGA 2DZCA 3PGGA 1BIAA 4HA8A 4C0DC 1ZHIA 5EG2A 3RMSA 5HKCA 3VV0A 2E6NA 1VQNT 2FL7A 2OAUA 3WXMB 3OYGA 5D6YA 4M77E 3CCLT 4LD6A 4M78D 5GAOp 1G3TA 2EQJA 3QXEB 1QP3A 1VIFA 4GY5A 4NL2A 3G71A 2HQXA 1VQOT 3C4SA 5DLQE 2VGNA 4M77B 5KH6A 4M75A 1KHIA 1VQ4A 1VQKT 2XG8D 1K73C 4PLLA 3V7RA 5A2QE 4C0FA 4EDUA 1NE8A 4M78A 3LW5E 3G6ET 4JS5A 3CXCA 4MDXA 2FB7A 5LJ5g 4HKEA 3HRUA 4A4EA 4M77C 4EPCA 3OYDA 1WNLA 2R5AA 3CMAT 3CC7T 1M9SA 3M9QA 4X9CA 3ZBDA 4C92G 4HT9A 2ZPHB 4C5HA 3NTKA 2K5FA 1BIBA 1HXDA 5D6WA 3CMEA 2P0QA 4N0AC 3KXTA 1MHNA 4IURA 3QKJA 2X4YA 3M58A 1YI2T 2R5MA 3A8OB 4XU2A 5CKEA 2L89A 2RI3A 3FJPA 5GAN4 5GAOl 3EAEA 2VC8A 4M7AB 4BY6B 1BI0A 1M1GA 2PQWA 5I2SA 1YJ9T 4KBMB 3X25B 1Q7YU 3CBPA 4OVAA 3HSBA 3CCST 4BE2A 4HT8A 3M5AA 2KQWA 3HFNA 3LX7A 3WVDB 3RESA 3TCJA 3TREA 4A4FA 3TEEA 4J6WA 5GAMf 3JCMd 1GXIE 3JCMc 5FU6C 2IVWA 4QVDA 2XDPA 1AHJB 1JB0E 3V8KA 1VUBA 2O4XA 2PVDB 4OB1B 5AYFA 3MHXA 2DTOA 5CVIA 4XQ3A 2KMTA 1Y71A 5LJ3f 3VYGA 4J5YA 3MP6A 3CCMT 4R55A 1P92A 3VUZA 2OTJT 5FU7B 1I81A 2L8DA 3A8MB 4C0GA 4IUTA 1KQ2A 3GOXA 3NTHA 4HCZA 5CAIA 3CCVA 1JRIA 4M75F 1FX7A 3CCRT 1KC8U 3QJ6A 4LDYA 2DIGA 2XK0A 2QQRA 2K2VA 4OB3B 2EYQA 3FIFA 1Q7YC 1NZ9A 4C5EA 5J39A 2E6ZA 1FWZA 4M75G 3UWNA 1G3SA 3JB9H 4F7UE 1WJRA 1O75A 2E12A 2ZCFB 3RUXA 3LGFA 2E41A 2WACA 5CK9A 5GANg 3HFOA 4UC4A 1Q81C 4XU0A 5A0LA 1K8AU 3OSVA 1KG1A 2RO0A 4XU3A 1N8RU 3G4SA 1Y07A 5DM7R 4EMKA 2JUFA 3JCMJ 3JB9I 2X4JA 3FRNA 4PNOA 4ELZC 5KE2A 1K9MU 1RI0A 1H641 4M75E 3CD6T 3HHTB 3RKWA 2F69A 1XNIA 2V8IA 1M90C 2ZZDA 3PMTA 4C8QA 4XTWA 1B34A 2XDBA 4Q5WA 2XICA 1I5LA 2KAFA 2B8AA 4BDZA 3CCJA 1UGRB 3QO3A 4E7KA 2KVQG 2XHCA 5GANd 4BI8B 3SDZA 1Y96B 3Q1JA 2VGMA 1M4ZA 5GANh 3OSSC 4FL6A 2JNGA 4IUQA 2DXTA 1JBMA 1YIJT 3S6WA 3JRZA 4E7LA 2RJCA 4M78E 4OF1A 2GCXA 2LRQA 2QEXA 4RCBA 4M7AA 4OGEA 3MCAB 4C8QD 3I56A 2HD0A 3MP8A 3OMGA 5GMKl 1RL2A 1D3BA 4OB2B 2ZPGB 2RA2A 3FC3A 3CCSA 3DLMA 5GANj 1N9RA 3JB9G 1I4K1 3M4GA 4N4IA 3CMET 3JB9J 5FRMA 1VQNA 3M59A 2LT4A 2VYTA 3P8DA 3RMQA 5GAOm 1VQ5T 1OZ3A 4DQ2A 4YTLA 4BI4A 4EMHA 4OMFB 3LH0A 2GQVA 2I2LA 4JRKA 1VQOA 1QVGS 5CIUA 2DAQA 2VXEA 4J6YA 3KBGA 4XTYA 4OGCA 1WGSA 4PJOD 4XU1A 2E70A 3S3OA 2BUDA 4F7UF 2MWPA 3ME9A 2MAMA 3OS0A 4JRPA 3HRTA 4ZGDB 2FHDA 3MEUA 2DIQA 2EAYA 5IN1A 1YHQA 1FXXA 2XU8A 2LC4A 2QQAA 4J7IA 3HL8A 4J6XA 2BIVA 3A8LB 3CC7A 1G5VA 3CCLA 2MI6A 4MZMA 4Y28E 1JJ2A 1VIEA 5IAYA 1VQMT 4IKFA 3VYHB 5KE3A 3JSCA 2QA4A 1JJ2S 2RK2A 1VQ4T 3OYAA 4QQDA 3JCMg 4C0ZA 3L42A 3QDRB 5LJ5j 4M7DG 1Q86U 2OTJA 1BI1A 2QQBA 4R56A 3G6EA 1K8AC 1MGQA 5J3BA 4MDWA 4F7UG 3HKSA 5KCHA 3EFSA 1N8RC 3L1AA 3L2QA 3CCRA 2EWNA 3M4YA 2K4YA 1VQ9T 3SWNA 5LJ5h 3GP8A 3OY9A 1M1KU 3GNFB 4M78G 4PKCC 2JZ2A 2WSEE 2RHYA 3OYLA 1V29B 2LNVA 3DB3A 3PT9A 4RCCA 5A0DA 2D6FA 2DO3A 4A53A 2RD1A 3P8BB 2DPPB 2E65A 2XIDA 3OS1A 2MMPA 4B9WA 4M78F 4JUVA 1Q82C 1ZQ1A 2XI9A 4L5GA 2RJDA 4FSXA 2ZPBB 5GMKh 5CR2A 3VJPA 3A8HB 2RH2A 3NTIA 2GFUA 4HCBA 2CZ0B 3HRSA 4ZGEB 3JCMP 1QVFA 4E7IA 2Y90A 2CS7A 4JLGA 1WJQA 3OMCA 3LYIA 4BE0A 3X28B 2EJ9A 4NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNW C;  1WJR A;  4C5G A;  5M9O A;  4BE1 A;  3LGF A;  2WAC A;  2F5K A;  1WJS A;  3FDR A;  4IUP A;  4UC4 A;  2CKK A;  2X4X A;  3QBY A;  3PFS A;  1KHC A;  2LCC A;  2RO0 A;  2EQU A;  5D6X A;  2R58 A;  2D9T A;  2RHI A;  3L2R A;  1N27 A;  2HQE A;  3UT1 A;  2O4X B;  5KE2 A;  1RI0 A;  4E7H A;  2BKD N;  5C0M A;  2YRV A;  3OYM A;  1OYX A;  3E9G A;  4B9X A;  3BDL A;  2X4W A;  4II1 A;  2EQM A;  2EQK A;  2RHU A;  1XNI A;  2JTF A;  3PMT A;  2GF7 A;  3L2U A;  3MEA A;  4Q5W A;  3OYE A;  2E5Q A;  3LGL A;  4ZTJ A;  1SSF A;  2B8A A;  4NS5 A;  4BDZ A;  4QQ6 A;  3MO8 A;  4E7K A;  4Z02 A;  2P0K A;  3Q1J A;  2E6N A;  4FL6 A;  4QVZ A;  3OYG A;  4IUQ A;  2M1H A;  3OQ5 A;  5D6Y A;  3S6W A;  3F70 A;  4E7L A;  2RJC A;  4IUV A;  4LD6 A;  2LDM A;  3MEW A;  2EQJ A;  2LRQ A;  4X34 A;  4GY5 A;  2HQX A;  2LTO A;  3C4S A;  4QW2 A;  3MP8 A;  3OMG A;  5KH6 A;  3FC3 A;  2IG0 A;  3DLM A;  2RI2 A;  2K3Y A;  4N4G A;  4PLL A;  3OYJ A;  4PLI A;  4L59 A;  4EDU A;  4N4I A;  5FRM A;  5J26 A;  4FU6 A;  5FRO A;  4QQG A;  3P8D A;  2VYT A;  3S3M A;  1OZ3 A;  4A4E A;  3LH0 A;  2NLU A;  3OYD A;  2R5A A;  4IUU A;  3L2V A;  5CIU A;  2MWO A;  3M9Q A;  2DAQ A;  4RG2 A;  3QII A;  3OYN A;  4C5H A;  3OYB A;  1WGS A;  3NTK A;  2LVM A;  3OB9 A;  3PMI A;  2BUD A;  5D6W A;  3OYF A;  4BAC A;  2MWP A;  3ME9 A;  3FLG A;  3OS0 A;  3S3O A;  3OYC A;  2FHD A;  5KCO A;  4A4H A;  2EFI A;  2DIQ A;  3MEU A;  2K3X A;  5IN1 A;  1MHN A;  3E9F A;  3QKJ A;  4IUR A;  4PL6 A;  5C6S A;  2X4Y A;  3MP1 A;  3OA6 A;  2BIV A;  2R5M A;  3L2W A;  4ZTF A;  1G5V A;  2L89 A;  2RI3 A;  3KUF A;  3EAE A;  2L3R A;  2PQW A;  1OI1 A;  5IAY A;  4IKF A;  2RJE A;  2G3R A;  3O8V A;  4OVA A;  5KE3 A;  3OYK A;  4BE2 A;  3OYA A;  4QQD A;  2RHX A;  2X35 A;  3FEO A;  3L42 A;  3LX7 A;  2QQS A;  3ZEH A;  4A4F A;  3OYH A;  3CEY A;  2RJF A;  2EKO A;  4C5I A;  4BDY A;  2M0O A;  2XDP A;  5KCH A;  2O4X A;  3H8Z A;  2M16 A;  3L2Q A;  4A4G A;  4CRI A;  3DB4 A;  3MEV A;  4BD3 A;  3OY9 A;  2RI5 A;  2JZ2 A;  2RHY A;  3MP6 A;  2GFA A;  3OS2 A;  3OYL A;  3DB3 A;  4N4H A;  3P8H A;  3S3N A;  2L8D A;  4B9W A;  3OS1 A;  5FRN A;  4IUT A;  3OYI A;  4E7J A;  3GOX A;  2RJD A;  3H6Z A;  2RHZ A;  3NTH A;  4HCZ A;  2R57 A;  3SD4 A;  3NTI A;  2GFU A;  3MET A;  3QJ6 A;  2DIG A;  2XK0 A;  2QQR A;  1H3Z A;  3LLR A;  4E7I A;  4C5E A;  1OZ2 A;  5J39 A;  1WJQ A;  3OMC A;  3LYI A;  4BE0 A;  3UWN A;  3ASK A; 
#chains in the Genus database with same CATH topology
 1SRL A;  3J7A F;  2NUT B;  4XTZ A;  4ANJ A;  2LNH B;  2DD4 A;  5LJ5 e;  4JJN K;  5KYN A;  2HQE A;  1SEM A;  2NUT A;  1ZBJ A;  2QEX Q;  2V1Q A;  3AHU A;  3CCV Q;  4CC2 A;  1LOJ A;  2VV5 A;  1RLP C;  2K7A A;  2GF7 A;  4M7D D;  2C06 A;  1BI2 A;  2C0O A;  3CCR Q;  2EYX A;  3PIO A;  2P0K A;  1YHQ T;  1PRL C;  2ABL A;  2KYB A;  2VAS A;  4QW2 A;  3V7C A;  4MZP A;  1N6A A;  4C8Q C;  2RI2 A;  2ROT A;  2L0A A;  4ME7 A;  4N4G A;  1KC8 C;  1QP2 A;  2YWW A;  1VYT A;  1YJW A;  1WX6 A;  3RBB B;  4VUB A;  1H92 A;  3E2U A;  3QG1 A;  2EYZ A;  2NLU A;  3M0R A;  4IUU A;  4J83 A;  1UB4 A;  3OYN A;  4M7A C;  1N8R R;  1WFW A;  5KCO A;  4XAX B;  2FZC B;  3CCS Q;  1N9S A;  2FPF A;  5KYX A;  2E1H A;  2L3R A;  3VS6 A;  4FYY B;  3RR6 A;  5HY6 A;  3JCM V;  3OYK A;  1AEY A;  3GIB A;  2RHX A;  2X35 A;  3A8G B;  2HKN A;  2RJF A;  2DNU A;  5CKB A;  2D8H A;  2KK4 A;  1ZUU A;  3ER0 A;  4F7U B;  1KQS S;  2QAS A;  3M54 A;  3SEM A;  2YT6 A;  4C8Q G;  3CPW P;  3OW2 S;  1X6O A;  4B6M A;  2RHZ A;  1YCS B;  1VQP A;  3M57 A;  3M0Q A;  4Z88 A;  2QK0 A;  1TG0 A;  3UDC A;  4IUP A;  2DJQ A;  1KD1 C;  5LJ5 f;  2B86 A;  1MV3 A;  3EGU A;  4DEY A;  2RQR A;  3CC4 Q;  4M4Z A;  1VQ8 T;  3SB2 A;  2CP7 A;  1M90 R;  2YUQ A;  2KR3 A;  4C0D B;  2JN0 A;  2EQM A;  4ZTJ A;  2RPN A;  1VQK A;  3A5Z B;  2K2M A;  4CI0 C;  4ATO A;  1M2O A;  4LUD A;  3GLX A;  1YNZ A;  2KXC A;  4X34 A;  2D0Q B;  3M55 A;  4MZT A;  4PJO F;  4C8Q E;  2CGH A;  3QDF A;  3G4S T;  1M2V B;  1N5Z A;  1AWJ A;  2JVV A;  1NM7 A;  4JJD A;  3S3M A;  2HSP A;  3TSZ A;  1I8F A;  1E6G A;  1KD1 U;  4M7A E;  2E64 A;  5GAM g;  2QI2 A;  3OB9 A;  1Q7Y R;  2E4H A;  1V76 A;  1YJW T;  5DY9 A;  3VS2 A;  3LWH A;  3N5B B;  4OMN A;  1YIT T;  2C0T A;  3MKD A;  1VQ6 T;  4Y91 A;  1SRM A;  2A0F B;  4M7A F;  3ZEH A;  3TU4 K;  3PIP A;  1S72 Q;  2P0P A;  2FZG B;  2HNI A;  2OTL T;  3PTA A;  2DYI A;  2M0O A;  3HP9 A;  3CCQ A;  2M16 A;  1AVZ C;  1YJ9 A;  3GNG A;  2PUO B;  1X2Q A;  2M51 A;  4BD3 A;  2RB6 A;  4ZGJ B;  4NOY A;  1UHC A;  1PRM C;  3EG1 A;  4FIB A;  2GFA A;  2A28 A;  3CXC S;  2FYK A;  2AHJ B;  5FRN A;  2J6F A;  1QVG A;  2FO0 A;  3MET A;  3QSU A;  2DBM A;  3SHW A;  2KSS A;  3BW1 A;  2LX9 A;  4E7Z A;  1VA7 A;  3PNW C;  3CCU T;  1KSW A;  2ZPF B;  4KUL A;  1GCQ C;  2KI7 A;  2CKK A;  2CZ1 B;  3VS7 A;  2LP5 A;  2YLB A;  3G7Z A;  3OYY A;  3CME Q;  1W2B A;  3JCM f;  3J81 E;  1G2B A;  5C0M A;  4KGV B;  1VQ5 A;  4KGX B;  4KRT A;  1U8R A;  3VUB A;  1WHH A;  4DEX A;  2E10 A;  2JTF A;  3MEA A;  4K11 A;  2HDA A;  4DBR A;  3LGL A;  1RAE B;  1NEG A;  1SHG A;  1KQS A;  2PZ1 A;  2EGA A;  2EGE A;  3G4S Q;  2FRY A;  1BIA A;  3PGG A;  4C0D C;  5HKC A;  2E6N A;  3WXM B;  2KRN A;  2EVR A;  4LD6 A;  1G3T A;  2M0Y A;  3G71 A;  2E3H A;  1VQO T;  3C4S A;  1YWP A;  1VQK T;  1VQ4 A;  1KHI A;  2XG8 D;  1ZSZ C;  4PLL A;  3V7R A;  5A2Q E;  1NE8 A;  3G6E T;  1WA7 A;  4M77 C;  2R5A A;  1RI9 A;  4X9C A;  1HYO A;  1VQ6 Q;  1K0X A;  2QDL A;  4AG2 C;  4HT9 A;  4C5H A;  5D6W A;  3U23 A;  2P0Q A;  3I56 Q;  3I5S A;  7AT1 B;  2IPO B;  2X4Y A;  1YI2 T;  5GAN 4;  1U3O A;  3H0F A;  2VC8 A;  4M7A B;  1Q7Y U;  3PVL A;  4LXC A;  3X25 B;  2MYS A;  2J6K A;  3HFN A;  2QA4 A;  3TCJ A;  2NUP A;  2O9V A;  5FU6 C;  2IVW A;  2VVK A;  2NUP B;  4XQ3 A;  2FEI A;  5LJ3 f;  1D1B A;  2BTT A;  4J5Y A;  4JPB W;  1P92 A;  3VUZ A;  2OTJ T;  1MMA A;  2RMO A;  2L8D A;  1KQ2 A;  3JV3 A;  4HCZ A;  5CAI A;  3CCV A;  1KC8 U;  4LDY A;  2DIG A;  1NG2 A;  2QQR A;  1C0M A;  2EYQ A;  1YIT Q;  5J39 A;  1G3S A;  3LGF A;  3HFO A;  4UC4 A;  4XU0 A;  1N8R U;  1BBZ A;  5DM7 R;  2JUF A;  1JEG A;  1VYU A;  3UAT A;  1C6V X;  1TU0 B;  3FRN A;  4ELZ C;  1PC0 A;  3CD6 T;  1KQS P;  1PD0 A;  5L23 A;  3HHT B;  2V8I A;  1XNI A;  1K73 R;  3M0T A;  4AFS C;  2COY A;  1I5L A;  2KAF A;  1GCQ A;  2ATC B;  3CCJ A;  2O31 A;  2KVQ G;  1Y96 B;  3Q1J A;  3OSS C;  2JNG A;  1TTH B;  4RCB A;  4JJC A;  4M7A A;  3I56 A;  2LJ1 A;  2JS2 A;  3MP8 A;  2HZY A;  3CCS A;  5GAN j;  1YIJ Q;  4N4I A;  3EHR A;  2E3I A;  1NYG A;  5KYU A;  3P8D A;  2VYT A;  1QVG P;  4DQ2 A;  2GQV A;  2I2L A;  1VQO A;  2VXE A;  4J9G A;  2XMF A;  4XTY A;  4OGC A;  3S3O A;  4F7U F;  4JRP A;  3ME9 A;  4ZGD B;  5IN1 A;  2LC4 A;  3HL8 A;  4J6X A;  4MZM A;  1VQM T;  2CSI A;  3VYH B;  5KE3 A;  1QWF A;  1JJ2 S;  2RK2 A;  1VQ4 T;  3JCM g;  3QDR B;  1BI1 A;  4F17 A;  3G6E A;  1K8A C;  3QWX X;  3HKS A;  3CCR A;  2EWN A;  1Q95 G;  1M1K U;  3GNF B;  3EG0 A;  3DB3 A;  2LNV A;  4RCC A;  3PT9 A;  3P8B B;  1D0X A;  2BE9 B;  2DPP B;  2XID A;  3QWY A;  4M78 F;  1MUZ A;  1ZQ1 A;  2XI9 A;  4LN2 A;  2X3W D;  1Q82 C;  3A8H B;  4HCB A;  1QVF A;  1PM3 A;  4E7I A;  3CD6 Q;  1HK9 A;  3LYI A;  2EJ9 A;  5FU7 C;  4BE1 A;  5GMK j;  3OS5 A;  1O9S A;  2KE9 A;  3CCV T;  2EKH A;  3REB B;  4KGZ B;  4LD9 K;  5KYW B;  4BY6 C;  4J9C A;  1RAB B;  4M77 D;  3RDV A;  3OYM A;  1GRI A;  2PUK B;  2X4W A;  2RHU A;  1JXO A;  3RKY A;  4M75 C;  3DLL A;  1XTD A;  2WSC E;  3M0P A;  2EPD A;  4PJO B;  1X43 A;  4MML A;  2OI3 A;  3H0I A;  2DD5 A;  3OQ5 A;  4E6R A;  4BI3 A;  1UE9 A;  4D6W A;  3CCJ T;  3CBM A;  1UDL A;  5D7U A;  2JM9 A;  5IHN A;  4LDX A;  3OYJ A;  2EW3 A;  1UGS B;  3CPF A;  4DBH A;  2YHT A;  1NJI U;  5FRO A;  4J9B A;  2QGF B;  4AMC A;  2AT1 B;  3CPW A;  3I56 T;  1QWE A;  4XTU A;  3PMI A;  5GAN 3;  2HBW A;  3FLG A;  3CMA Q;  5GAM h;  3BDU A;  1B3Q A;  2OJ2 A;  2DL5 A;  2K5L A;  1RLQ C;  1U1S A;  1E6H A;  4ORZ A;  1UEC A;  3ZFJ A;  1EZZ B;  2RJE A;  2EIF A;  1YJN T;  3FEO A;  5GAN 5;  2CUB A;  5CQY A;  3G1J A;  2DTI A;  5KYW A;  4KH1 B;  3DB4 A;  4J9H A;  1UGP B;  3H0H A;  3P8H A;  1QLY A;  1XQH A;  4FYX B;  5LL6 S;  3I55 T;  2R57 A;  3QZ9 B;  3LLR A;  2ZPE B;  3ASK A;  5CQX A;  4EMK B;  1VQ8 Q;  3V8L A;  1OOT A;  1K9M C;  3G71 T;  2DA9 A;  1MND A;  1DJ7 B;  1D0Y A;  2XKO C;  1IHV A;  4E47 A;  5GAN e;  1K8A R;  1N27 A;  3OBW A;  1PSF A;  3CC4 A;  3GF5 A;  3V8J A;  1TOV A;  4PFO A;  5CO7 A;  2DXU A;  1M1K R;  2CT3 A;  4XK8 E;  8ATC B;  1KD1 R;  2HL5 C;  2J06 A;  4JJB A;  2FPE A;  2AK5 A;  4C8Q B;  1ZSZ B;  2CZ6 B;  5FLX E;  1BU1 A;  1BI3 A;  3EH1 A;  4BUG A;  4OMM A;  3CMA A;  1ARK A;  1G3W A;  2QA4 T;  5L8R E;  4XTV A;  5ECA A;  4ELY C;  2KRO A;  2DL7 A;  2COZ A;  1R8O B;  2K3B A;  2F2X A;  4A54 A;  5GAM d;  2V26 A;  1M8M A;  1BKB A;  2A3L A;  3NFC A;  4A4H A;  4M77 G;  3E1S A;  4PL6 A;  2O2O A;  4M7D B;  3TVT A;  3SFM A;  3KUF A;  1WDX A;  2ED1 A;  3EH2 A;  2RQV A;  2CZ7 B;  3VKI A;  2LCL A;  3E19 A;  5GAM e;  2A7Y A;  1JU5 C;  1S72 A;  1G8X A;  2LQN A;  4BDY A;  4C92 B;  2O01 E;  4LDU A;  1NJI R;  1VQ8 A;  4WTO B;  4KT0 E;  1IRX A;  3QJY A;  5GAM j;  1VQL T;  1WHG A;  2ESW A;  1R0C B;  1BYM A;  4DOW A;  1OZ2 A;  4OP0 A;  1UJY A;  5I21 A;  2P4T A;  4RTY A;  4C92 F;  2O9S A;  2F5K A;  4WF2 A;  1CKB A;  1KHC A;  3FJ5 A;  3BE3 A;  4C92 D;  2LCC A;  2Y4X A;  2D9T A;  3QYG B;  5A0G A;  1WYX A;  1WQW A;  4GLK A;  1VYV A;  1ZUK A;  3EG2 A;  3VRY A;  1IRE B;  4F14 A;  1R0B G;  1RUW A;  9ATC B;  4TVR A;  1WHM A;  1VQP Q;  5DLO A;  3I55 Q;  4BB7 A;  2QA4 Q;  2YUO A;  4HA8 A;  1M3A A;  2FL7 A;  5D6Y A;  1T3L A;  2ED0 A;  5GAO p;  4JZ4 A;  3QXE B;  1QP3 A;  4NL2 A;  2VWF A;  4GY5 A;  2HQX A;  4M77 B;  2F1L A;  5KH6 A;  2MOX A;  4PJN A;  3VS4 A;  4JS5 A;  4MDX A;  2FB7 A;  5KYY B;  5I11 A;  4EPC A;  1WNL A;  2NYS A;  3VS3 A;  1ACM B;  1RAC B;  1KFZ A;  3NTK A;  2K5F A;  1HXD A;  1ZX6 A;  1D1A A;  1M27 C;  3M58 A;  3ULR B;  4XU2 A;  5CKE A;  3FJP A;  4LE9 A;  4KBM B;  4HXJ A;  3EHQ A;  3LX7 A;  3JCM d;  1GXI E;  1OX9 A;  3TEE A;  5GAM f;  1T0H A;  2CP5 A;  1VQL Q;  4DBQ A;  2VKN A;  1ABQ A;  1VUB A;  2A37 A;  3V8K A;  2DTO A;  5CVI A;  4LNP A;  1AZG B;  1OV3 A;  3VYG A;  3CCM T;  3UF4 A;  5FU7 B;  1FMV A;  2EYY A;  2DVJ A;  3NTH A;  4OB3 B;  3EGD B;  1NZ9 A;  4FW1 A;  2BZ8 A;  4F7U E;  2ZCF B;  2E12 A;  4DBF A;  5CK9 A;  2E41 A;  1KG1 A;  4XU3 A;  4AFZ C;  2JW4 A;  3JCM J;  3JB9 I;  4FCY A;  2RQW A;  2X4J A;  2LX7 A;  4PNO A;  1K9M U;  4PFZ A;  2KRS A;  1CKA A;  1AT1 B;  1V1C A;  1NLO C;  2DX1 A;  2X9H A;  1M90 C;  1X69 A;  2QG9 B;  2B8A A;  3TQ7 P;  1VOM A;  4BDZ A;  4E7K A;  1NEB A;  4BI8 B;  1RAI B;  3SDZ A;  2CP2 A;  2VGM A;  3G6E Q;  2P84 A;  3JRZ A;  4M78 E;  2GCX A;  3HTR A;  1VQ5 Q;  4OGE A;  3MCA B;  2HD0 A;  1RL2 A;  4A63 B;  3FC3 A;  3DLM A;  3CME T;  1U5S A;  3JB9 J;  3M59 A;  4CC4 B;  5HCK A;  3RMQ A;  2JXB A;  4EMH A;  4YTL A;  4JRK A;  4OMP A;  2BUD A;  2MWP A;  3EG3 A;  3OS0 A;  3HRT A;  2FHD A;  3MEU A;  1YHQ A;  2EAY A;  1FXX A;  2XU8 A;  2QQA A;  4QKU A;  1A0N B;  1F1B B;  4Y28 E;  1JJ2 A;  5IAY A;  2W0Z A;  2LJ0 A;  1ZUY A;  1VQK Q;  1Z9Q A;  3L42 A;  5LJ5 j;  2OTJ Q;  2HL3 A;  1Q86 U;  1IB8 A;  2JMC A;  2QQB A;  1MGQ A;  1MNE A;  2O88 A;  4F7U G;  1PCX A;  1N8R C;  1X6G A;  3M4Y A;  1YWO A;  3GP8 A;  3OY9 A;  2RHY A;  1OX8 A;  1V29 B;  5A0D A;  4A53 A;  1QQJ A;  2MMP A;  2ZPB B;  5CR2 A;  2RH2 A;  2JJ9 A;  3HRS A;  4ZGE B;  2Y90 A;  2CS7 A;  2DYB A;  4BY6 B;  4PFP A;  3X28 B;  4HVU A;  4NS5 A;  2QEX T;  4RG8 A;  4Z8A A;  3JCM Q;  2SEM A;  3PFS A;  2BE7 D;  2XD0 A;  2DXB A;  3J80 E;  1BB9 A;  2QTV A;  1Q81 R;  3UT1 A;  1VQ7 A;  4M75 B;  2O4X B;  2CSQ A;  1M2V A;  3NMZ C;  3E9G A;  1QW1 A;  4F04 B;  4GLM A;  2KDS A;  3H9N A;  1MMG A;  2ZGW A;  2K57 A;  4RTX A;  1ZSZ A;  5CCA A;  2LJ3 A;  2H3J A;  4CC7 A;  2PNI A;  4QQ6 A;  3JCM h;  1OQK A;  3PE0 A;  1SKU B;  2AKL A;  2DJZ A;  3O5Z A;  4IUV A;  4ZN3 A;  1PD1 A;  3MEW A;  1AZE A;  2M9U A;  2YLC A;  1U1T A;  3CCL Q;  1W1F A;  4L59 A;  1GFD A;  4QQG A;  1OUL A;  4EMG A;  5LJ3 j;  2WSF E;  2EJF A;  3CPW S;  1WPY A;  3RER A;  3PVQ A;  4Z89 A;  3OYC A;  5GAN 6;  2K3X A;  2QDY B;  3OBY A;  5LJ3 d;  4ZTF A;  1YIJ A;  4HVV A;  1RAG B;  2GNC A;  2F2V A;  1RAF B;  2KNB B;  3OYH A;  1B07 A;  3CEY A;  2GTJ A;  3WVE B;  4M7A D;  5GJW B;  2AZV A;  3JCM W;  1K76 A;  1VQM A;  4CRI A;  1IZ6 A;  2KT1 A;  4JS4 A;  1JXM A;  2DMO A;  4N4H A;  3MJX A;  2VXF A;  2OTL A;  1AD5 A;  2CP0 A;  4PJJ A;  2DVE A;  3CCQ T;  1PHT A;  1M30 A;  1I0C A;  4J9I A;  4J7F A;  3LH5 A;  1H3Z A;  3JCM X;  4Y92 A;  2BZY A;  2A36 A;  2DLP A;  2FG0 A;  1K9A A;  2DL3 A;  5GAO q;  3L2R A;  3X26 B;  1EFN A;  3JCM e;  4OB0 B;  2ECZ A;  4FSS A;  4II1 A;  1LNX A;  1KC8 R;  3EFO B;  3L2U A;  3OYE A;  3CCJ Q;  2QQ9 A;  4P5N A;  1W2B P;  2QXF A;  1FMW A;  4Z02 A;  2CH4 W;  2HBP A;  4QVZ A;  2CYZ B;  3CCE T;  3CCU A;  4JRQ A;  2LDM A;  5GAN 2;  2L3Q A;  1Y57 A;  3X20 B;  1VQ7 T;  2V8J A;  2K3Y A;  2M02 A;  1Y7X A;  3V7S A;  4XTX A;  5GJV B;  1VQN Q;  1VQ9 Q;  4LUE A;  4C92 A;  1WQ7 A;  1X01 A;  1WHK A;  1SF9 A;  1NPP A;  1ABO A;  2DIL A;  4M7D C;  3CCM A;  2L3P A;  5HK0 A;  1JO8 A;  1YJN A;  2V8K A;  3OA6 A;  1M1F A;  4RTU A;  2K5I A;  5CKH A;  3CC7 Q;  4AG1 C;  4O6J A;  1Q82 R;  3O8V A;  2LT1 A;  3H41 A;  2V1R A;  1M90 U;  2QQS A;  1TH7 A;  2EKO A;  1NPR A;  1S1N A;  2ROL A;  3DKM A;  2EGC A;  1HJD A;  2LQW A;  1TUG B;  4A4G A;  1M5Q 1;  3MEV A;  4C92 E;  5LJ3 e;  4HCK A;  3OS2 A;  1U06 A;  1YCY A;  3S3N A;  3EFO A;  1SPK A;  2AIR B;  2VUB A;  1NBE B;  2JT4 A;  3OYI A;  2GGR A;  3VS5 A;  2FVU A;  1UUE A;  5I2M A;  3ZL7 C;  3MO8 A;  3RIR A;  1QKX A;  1ZA2 B;  1WJS A;  3QUI A;  4IIM A;  2QTX A;  3QBY A;  2CH4 A;  4NL3 A;  4PJO G;  2MK5 A;  2EQU A;  5D6X A;  3L2Z A;  2HMA A;  1X2K A;  2H3E B;  2RM4 A;  4F7U A;  3CCU Q;  2J6O A;  2NWM A;  5KYY A;  3CCE Q;  2ZAE A;  1T0J A;  2DL4 A;  2HCK A;  2E5Q A;  2YSQ A;  3RKX A;  4LDW A;  1SSF A;  3CC2 A;  1VQ9 A;  2BZX A;  1AWO A;  4M7A G;  2DZC A;  3VV0 A;  1UG1 A;  2OAU A;  3OYG A;  3CCL T;  2EQJ A;  1YHQ Q;  3EG9 B;  1K73 C;  4F16 A;  4M78 A;  3CXC A;  1LCK A;  4HKE A;  3HRU A;  2YRC A;  3CMA T;  1AWX A;  1JQQ A;  3M9Q A;  4E7S A;  1SSH A;  2YUN A;  4C92 G;  2ZPH B;  3VS1 A;  5FWB A;  1MMD A;  4N0A C;  1GBR A;  3KXT A;  1MHN A;  4IUR A;  3QKJ A;  3VS0 A;  1UHF A;  3D7S B;  3A8O B;  1TXQ A;  4KH0 B;  1TWB A;  1BI0 A;  1YJ9 T;  1LPL A;  3HSB A;  4BE2 A;  1YP5 A;  4HT8 A;  3M5A A;  3TRE A;  1PKT A;  2PTK A;  1AHJ B;  1JB0 E;  2QYZ A;  1HD3 A;  3MHX A;  3UA6 A;  2KMT A;  1Y71 A;  4R55 A;  1I81 A;  3A8M B;  3GOX A;  1W70 A;  2DL8 A;  1I07 A;  1JRI A;  4M75 F;  2KEA A;  2XK0 A;  4FYW B;  1Q7Y C;  2K2V A;  3UA7 A;  4RUG A;  4C5E A;  1FWZ A;  3UWN A;  1WJR A;  1O75 A;  2JS0 A;  3RUX A;  4JZ3 A;  2CP6 A;  2RO0 A;  1Y07 A;  4EMK A;  1RI0 A;  4M75 E;  1CSK A;  1AOJ A;  3RKW A;  2F69 A;  1B34 A;  2XDB A;  4PJM A;  1GFC A;  1UGR B;  2XHC A;  2YUP A;  5GAN d;  1KJW A;  3R6N A;  1GL5 A;  5GAN h;  1M4Z A;  4CC3 A;  4FL6 A;  4R0K A;  1JBM A;  1YIJ T;  4X1V A;  2RJC A;  4OF1 A;  2RQU A;  3OMG A;  5GMK l;  2RA2 A;  1N9R A;  2LT4 A;  2EQI A;  2E5K A;  4GBQ A;  1OZ3 A;  1OEB A;  4BI4 A;  1QVG S;  5AT1 B;  2MCN A;  5CIU A;  2DAQ A;  2HEQ A;  4J6Y A;  3KBG A;  5FWC A;  4PJO D;  2E70 A;  2YRD A;  1VQM Q;  1HSQ A;  1K1Z A;  2DIQ A;  1H3H A;  4J7I A;  3A8L B;  1G5V A;  3CCL A;  1QCO A;  2MI6 A;  4IKF A;  3JSC A;  2JTE A;  3OYA A;  4QT7 A;  4M7D G;  2CP3 A;  2OTJ A;  3IQL A;  5J3B A;  4MDW A;  5KCH A;  3L1A A;  3L2Q A;  1TUC A;  2K4Y A;  1TSF A;  2LCS A;  1YN8 A;  2WSE E;  3OYL A;  2QGG A;  1IHW A;  3CQT A;  2L3S A;  4AFU C;  2RJD A;  4FSX A;  5GMK h;  2KXD A;  2X51 A;  2AZS A;  1OPK A;  2EYW A;  3JCM P;  1I1J A;  3EFS A;  4BE0 A;  2AKK A;  5I22 A;  1LJO A;  1QVF P;  1UGV A;  3I5R A;  2DXC A;  2DKG A;  4AT1 B;  1NLP C;  5GAO r;  2DZ9 A;  4HCC A;  4PJO C;  1M1K C;  4V2S A;  4E7H A;  1VQP T;  3SWN B;  2BKD N;  1UJ0 A;  1E7O A;  2GQI A;  1YBY A;  5FW9 A;  1RAD B;  1Q82 U;  2FPD A;  3INZ A;  3JCM b;  1G3Y A;  1KQ1 A;  5LJ5 d;  3CC4 T;  3I55 A;  4J9E A;  4M78 C;  4AFQ C;  2DET A;  4C92 C;  2D8J A;  1X75 C;  2A08 A;  2M1H A;  3F70 A;  4M7D A;  2HAX A;  1IGU A;  1QCF A;  4N0A A;  1XOV A;  4FU6 A;  4O5V A;  4KUD K;  1D3B B;  3EGX A;  2EJG A;  4PJL A;  4JDS A;  1MMN A;  2DEQ A;  4RKU E;  3L2V A;  1YIT A;  2MWO A;  2JMA A;  4M7D E;  3R6O A;  3QII A;  2X3X D;  4KUI A;  3T9N A;  1VQ6 A;  1WI7 A;  1BCO A;  1BK2 A;  4RTT A;  1QMC A;  2NUZ A;  1K4U S;  1WHL A;  4WCI A;  5GAN 8;  3MP1 A;  1Y0M A;  2RF0 A;  2OAW A;  1OPL A;  4M77 A;  5LJ3 g;  2G3R A;  4M7D F;  3FB9 A;  2JOY A;  4RTZ A;  1NJI C;  4MMK A;  1W4S A;  2CUD A;  1PWT A;  3M53 A;  3H8Z A;  1X27 A;  3M0S A;  1D09 B;  1Q86 C;  2RI5 A;  2LQ8 A;  3THK A;  1X6B A;  1K0S A;  1S72 T;  1LVK A;  4HVW A;  2OTL Q;  3CC2 T;  2L5Q A;  1Q81 U;  1K73 U;  4DA4 A;  2W10 A;  1BCM A;  1I5O B;  4C5G A;  2SRC A;  5M9O A;  2KRM A;  3VU3 C;  4A4K A;  1RAA B;  4RMO A;  3FDR A;  3EGD A;  5GMK e;  2R58 A;  2RHI A;  4D8K A;  5IHK A;  1TS9 A;  3G71 Q;  1OYX A;  2DK3 A;  5KYU B;  1QVP A;  3HPW A;  1UGQ B;  1Y96 A;  1VQL A;  2DF6 A;  3EFR A;  1UTI A;  1K9M R;  1G83 A;  1M3B A;  4X9D A;  1VQ7 Q;  4ZN1 A;  3CBO A;  3QHS A;  3EG9 A;  4FT4 A;  3LWI A;  1GCP A;  2LTO A;  4M78 B;  5GMK i;  1QVF S;  2D0N A;  2IG0 A;  2FZK B;  2JTM A;  4J9D A;  1KIK A;  4PLI A;  1EIF A;  3BY7 A;  1PSE A;  3UPU A;  2I0N A;  4M75 D;  1VQO Q;  4QVC A;  4RG2 A;  3OW2 P;  1XJW B;  3KFV A;  5IT9 E;  3M56 A;  2DE0 X;  3OYB A;  3QZ5 B;  4C8Q F;  2LVM A;  2K79 A;  4BAC A;  3OYF A;  2FRW A;  3BFM A;  2PU9 B;  2EFI A;  5LJ3 h;  2MF2 A;  3E9F A;  2XDD A;  2G6F X;  5C6S A;  2J7I A;  3A1P A;  4OMO A;  1QCN A;  3L2W A;  3C12 A;  2CRE A;  1WXB A;  4JRI A;  2PVG B;  1TUD A;  5GAO n;  1OI1 A;  2LQK A;  3QYH B;  2F5T X;  1W2B S;  5GMK m;  1JJ2 P;  1B7T A;  1QKW A;  4L6V 5;  1IO6 A;  2RK1 A;  1M8V A;  2MIO A;  4C5I A;  3CCQ Q;  3I9Q A;  1ZSG A;  2KGT A;  1WXT A;  2HKQ B;  5IXF A;  5CKD A;  5HK3 A;  4OML A;  3JAM E;  2Y4Y A;  3OW2 A;  3QPH A;  1PG5 B;  3C95 A;  5FU6 B;  4EMK C;  2DFU A;  1AWW A;  2RNA A;  2DM1 A;  4E7J A;  4JLI A;  1UEB A;  3JB9 D;  4PJO A;  3H6Z A;  4PJO E;  3SD4 A;  4DOV A;  4D8D A;  1YI2 A;  2MPX C;  1MV0 B;  3C94 A;  3X24 B;  4FT2 A;  1Q86 R;  3CD6 A;  4FW2 A;  2KY9 A;  2DTH A;  3SWN C;  2X4X A;  1T3S A;  5GAN f;  6AT1 B;  1SG5 A;  1B34 B;  3JB9 F;  4M77 F;  2YRV A;  2ZPI B;  1IGQ A;  4B9X A;  5CKF A;  3BDL A;  4FM4 B;  5IHI A;  2EQK A;  3GPL A;  3CCE A;  3A98 A;  2ENM A;  5GAN 7;  1KK7 A;  5EC7 A;  2K9G A;  2PVO B;  1ZBX A;  4LDV A;  1WZO A;  1Z9Z A;  4J8O A;  3CC2 Q;  1J3T A;  3URG A;  1ZHI A;  5EG2 A;  3RMS A;  2CDT A;  1VQN T;  1NYF A;  4M77 E;  4M78 D;  1VIF A;  4E2F B;  2OX7 A;  5DLQ E;  2VGN A;  1VQ4 Q;  4M75 A;  3AT1 B;  3M0U A;  2C0I A;  4C0F A;  4EDU A;  4RTV A;  3LW5 E;  1PKS A;  5LJ5 g;  2GBQ A;  4EIK A;  2QAZ A;  1ZLM A;  4A4E A;  3OYD A;  3CC7 T;  1M9S A;  3ZBD A;  1BIB A;  3MPU B;  3CME A;  1YJ9 Q;  8AT1 B;  2LZ6 B;  2R5M A;  2L89 A;  2RI3 A;  5GAO l;  1PNJ A;  3TSW A;  2P4R A;  3EAE A;  5I2S A;  1M1G A;  2PQW A;  3CBP A;  4OVA A;  3CCS T;  2KQW A;  3WVD B;  4A4F A;  2H8H A;  3I35 A;  3RES A;  3G4S A;  4J6W A;  1YI2 Q;  3JCM c;  3CCM Q;  5IH2 A;  4QVD A;  2XDP A;  4ZNX A;  2DRM A;  2LMJ A;  1YJN Q;  2JM8 A;  2O4X A;  1ZA1 B;  2PVD B;  4OB1 B;  5AYF A;  3MP6 A;  2Z0W A;  3C0C A;  4C0G A;  4IUT A;  1M3C A;  1FX7 A;  3CCR T;  3QJ6 A;  1WIE A;  2K6D A;  5IXB A;  3FIF A;  2DER A;  2E6Z A;  2DRK A;  4M75 G;  3JB9 H;  3GBQ A;  1Q81 C;  2WAC A;  5GAN g;  4OMQ A;  5A0L A;  1K8A U;  3OSV A;  1D0Z A;  1H8K A;  1YFN A;  2RN8 A;  2KBT A;  2J05 A;  5KE2 A;  1H64 1;  2CT4 A;  1OU9 A;  3NHN A;  3NGP A;  2COW A;  2F2W A;  2ZZD A;  3PMT A;  4C8Q A;  4XTW A;  4Q5W A;  2XIC A;  3QO3 A;  1WLP B;  3NPF A;  4IIO A;  2D1X A;  4IUQ A;  2DXT A;  3S6W A;  4E7L A;  2LRQ A;  2QEX A;  4C8Q D;  1VQ9 T;  1SHF A;  1D3B A;  3EGX B;  4OB2 B;  2ZPG B;  2VB6 A;  2DEU A;  1GBQ A;  2GTO A;  3JB9 G;  1I4K 1;  3M4G A;  5FRM A;  1VQN A;  4FYV B;  1RAH B;  1VQ5 T;  1D1C A;  5GAO m;  3RNJ A;  2IIM A;  4OMF B;  3LH0 A;  1OU8 A;  1C1A A;  4ESR A;  3VRZ A;  2YXY A;  3CXC P;  2YDL A;  1FMK A;  2EBP A;  1WGS A;  4PK4 A;  4XU1 A;  4RTW A;  1W6X A;  2DBK A;  2MAM A;  2KYM A;  3REA B;  1UFF A;  2BIV A;  3CC7 A;  4J9F A;  1YJW Q;  1VIE A;  2HSE B;  1WXU A;  4QQD A;  4C0Z A;  1R77 A;  2L2P A;  1WHJ A;  1IXD A;  2RQT A;  4R56 A;  2HQH A;  2KT8 A;  1FYN A;  3SWN A;  5LJ5 h;  4M78 G;  4PKC C;  2JZ2 A;  2D6F A;  2DO3 A;  2RD1 A;  2E65 A;  3OS1 A;  4B9W A;  4JUV A;  4L5G A;  1EX4 A;  3VJP A;  3NTI A;  2GFU A;  2CZ0 B;  5KYX B;  4JLG A;  1WJQ A;  3OMC A;  5J26 A; 
#chains in the Genus database with same CATH homology
 5FU7 C;  4BE1 A;  5GMK j;  3OS5 A;  3J7A F;  1LJO A;  2QEX T;  4RG8 A;  4XTZ A;  3JCM Q;  1O9S A;  1HK9 A;  3PFS A;  2DXC A;  2DKG A;  2DD4 A;  2XD0 A;  3CCV T;  2DXB A;  5LJ5 e;  3J80 E;  4JJN K;  5GAO r;  2HQE A;  3UT1 A;  4M75 B;  2DZ9 A;  1VQ7 A;  2O4X B;  4BY6 C;  4HCC A;  4LD9 K;  4M77 D;  4PJO C;  1M1K C;  4V2S A;  4E7H A;  1VQP T;  3SWN B;  2BKD N;  1YBY A;  3E9G A;  1QW1 A;  3OYM A;  3AHU A;  2KDS A;  2PUK B;  2X4W A;  1LOJ A;  1Q82 U;  2RHU A;  2ZGW A;  3RKY A;  3INZ A;  2VV5 A;  4M75 C;  2K57 A;  2GF7 A;  3DLL A;  1XTD A;  3JCM b;  1G3Y A;  1KQ1 A;  2WSC E;  4PJO B;  5CCA A;  5LJ5 d;  3CC4 T;  3I55 A;  4M7D D;  2H3J A;  4M78 C;  4QQ6 A;  3JCM h;  4MML A;  2C06 A;  1BI2 A;  4C92 C;  3PIO A;  2P0K A;  1X75 C;  1YHQ T;  2DD5 A;  2DJZ A;  2M1H A;  3OQ5 A;  3F70 A;  4IUV A;  4ZN3 A;  4M7D A;  4BI3 A;  3MEW A;  2M9U A;  2HAX A;  4D6W A;  4QW2 A;  3CCJ T;  2YLC A;  3CBM A;  3V7C A;  1U1T A;  4MZP A;  1N6A A;  4C8Q C;  2RI2 A;  4ME7 A;  4N0A A;  4N4G A;  1XOV A;  1KC8 C;  4LDX A;  1QP2 A;  3OYJ A;  3CPF A;  1UGS B;  4L59 A;  1YJW A;  2YHT A;  5J26 A;  4FU6 A;  4O5V A;  5FRO A;  1D3B B;  4QQG A;  2EJG A;  4VUB A;  1NJI U;  4KUD K;  4JDS A;  3QG1 A;  4EMG A;  2DEQ A;  2NLU A;  3CPW A;  3I56 T;  4IUU A;  4RKU E;  3L2V A;  1YIT A;  2MWO A;  4M7D E;  5LJ3 j;  3R6O A;  2WSF E;  4J83 A;  2EJF A;  3QII A;  1UB4 A;  1WPY A;  3CPW S;  4KUI A;  3OYN A;  3T9N A;  1VQ6 A;  4XTU A;  4M7A C;  3PMI A;  5GAN 3;  3RER A;  3FLG A;  5GAM h;  3OYC A;  5KCO A;  4XAX B;  5GAN 6;  2K3X A;  3BDU A;  5GAN 8;  2QDY B;  3MP1 A;  3OBY A;  1N9S A;  5LJ3 d;  4ZTF A;  2K5L A;  1YIJ A;  1U1S A;  2E1H A;  2L3R A;  3ZFJ A;  2RJE A;  4M77 A;  5LJ3 g;  2EIF A;  2G3R A;  5HY6 A;  3JCM V;  3OYK A;  4M7D F;  3FB9 A;  1YJN T;  3GIB A;  2RHX A;  2JOY A;  2X35 A;  3FEO A;  3A8G B;  1NJI C;  3OYH A;  4MMK A;  3CEY A;  5GAN 5;  1W4S A;  2RJF A;  3WVE B;  4M7A D;  5CQY A;  5CKB A;  3M53 A;  3JCM W;  2DTI A;  2KK4 A;  3H8Z A;  1VQM A;  3ER0 A;  4CRI A;  4F7U B;  1KQS S;  3DB4 A;  1IZ6 A;  4JS4 A;  2RI5 A;  1Q86 C;  1UGP B;  2LQ8 A;  4N4H A;  3M54 A;  3P8H A;  4C8Q G;  1S72 T;  3OW2 S;  2VXF A;  1XQH A;  2OTL A;  5LL6 S;  1X6O A;  3CC2 T;  2L5Q A;  3I55 T;  2DVE A;  3CCQ T;  2RHZ A;  2R57 A;  1Q81 U;  1K73 U;  4DA4 A;  4J7F A;  3QZ9 B;  1H3Z A;  3LLR A;  2ZPE B;  3JCM X;  1VQP A;  3M57 A;  3ASK A;  5CQX A;  4EMK B;  4C5G A;  5M9O A;  3V8L A;  3VU3 C;  4A4K A;  4RMO A;  3G71 T;  3UDC A;  3FDR A;  4IUP A;  1K9M C;  1DJ7 B;  2XKO C;  5GAN e;  4E47 A;  5GAO q;  1KD1 C;  5LJ5 f;  5GMK e;  2R58 A;  2RHI A;  3L2R A;  1N27 A;  3OBW A;  1PSF A;  3X26 B;  3CC4 A;  3GF5 A;  3JCM e;  1VQ8 T;  4OB0 B;  3SB2 A;  3V8J A;  1OYX A;  2DK3 A;  4C0D B;  5CO7 A;  2DXU A;  2JN0 A;  4II1 A;  1LNX A;  2EQM A;  1QVP A;  4XK8 E;  3HPW A;  1UGQ B;  3L2U A;  1Y96 A;  3OYE A;  4ZTJ A;  1VQL A;  3EFR A;  2QQ9 A;  4P5N A;  1VQK A;  3A5Z B;  2QXF A;  4Z02 A;  4C8Q B;  4X9D A;  2CZ6 B;  5FLX E;  4CI0 C;  1BI3 A;  2HBP A;  2CYZ B;  4QVZ A;  4ZN1 A;  3CBO A;  3CCE T;  4ATO A;  3QHS A;  4FT4 A;  3GLX A;  3LWI A;  3CCU A;  4JRQ A;  4BUG A;  2LDM A;  5GAN 2;  4X34 A;  2D0Q B;  2LTO A;  3M55 A;  4M78 B;  4MZT A;  4PJO F;  4C8Q E;  2CGH A;  5GMK i;  3CMA A;  1G3W A;  3X20 B;  1QVF S;  2IG0 A;  1VQ7 T;  2V8J A;  2JTM A;  4XTV A;  2K3Y A;  5L8R E;  3G4S T;  2QA4 T;  4ELY C;  1Y7X A;  3V7S A;  2JVV A;  4PLI A;  4XTX A;  1EIF A;  1R8O B;  3BY7 A;  1PSE A;  3UPU A;  4C92 A;  1WQ7 A;  1X01 A;  3S3M A;  4A54 A;  4M75 D;  5GAM d;  1I8F A;  1NPP A;  4QVC A;  4RG2 A;  5IT9 E;  3M56 A;  1KD1 U;  4M7D C;  4M7A E;  3CCM A;  1BKB A;  2E64 A;  5GAM g;  2QI2 A;  3OYB A;  3QZ5 B;  3OB9 A;  4C8Q F;  2LVM A;  4BAC A;  3OYF A;  5HK0 A;  1YJN A;  1YJW T;  2A3L A;  5DY9 A;  3BFM A;  2PU9 B;  3NFC A;  3LWH A;  3N5B B;  2EFI A;  4M77 G;  5LJ3 h;  2MF2 A;  4A4H A;  3E9F A;  3E1S A;  2V8K A;  4PL6 A;  1M1F A;  5C6S A;  2XDD A;  3OA6 A;  4M7D B;  2K5I A;  1YIT T;  3L2W A;  3C12 A;  5CKH A;  3SFM A;  3KUF A;  4JRI A;  2PVG B;  4O6J A;  5GAO n;  1OI1 A;  1VQ6 T;  2CZ7 B;  2LQK A;  3QYH B;  2F5T X;  4Y91 A;  3O8V A;  2LCL A;  3E19 A;  3VKI A;  2LT1 A;  5GMK m;  1W2B S;  1M90 U;  4M7A F;  3ZEH A;  2QQS A;  3PIP A;  4L6V 5;  2P0P A;  5GAM e;  3TU4 K;  2A7Y A;  1S72 A;  2RK1 A;  1M8V A;  1TH7 A;  2EKO A;  1NPR A;  2HNI A;  2OTL T;  4C5I A;  4C92 B;  2O01 E;  3PTA A;  3DKM A;  4BDY A;  2M0O A;  4LDU A;  3HP9 A;  3CCQ A;  1VQ8 A;  2M16 A;  1YJ9 A;  3GNG A;  2PUO B;  1M5Q 1;  4A4G A;  3MEV A;  4C92 E;  5CKD A;  4BD3 A;  2RB6 A;  4ZGJ B;  5HK3 A;  4NOY A;  5LJ3 e;  4KT0 E;  3JAM E;  2Y4Y A;  4FIB A;  2GFA A;  3OS2 A;  3OW2 A;  3QPH A;  1YCY A;  3CXC S;  3C95 A;  5FU6 B;  2FYK A;  4EMK C;  2AHJ B;  3S3N A;  2VUB A;  5FRN A;  3QJY A;  5GAM j;  3OYI A;  4E7J A;  4JLI A;  1QVG A;  1VQL T;  1UEB A;  3JB9 D;  4PJO A;  3H6Z A;  4PJO E;  3SD4 A;  4DOV A;  3MET A;  3QSU A;  1BYM A;  1YI2 A;  2FVU A;  4DOW A;  3C94 A;  5I2M A;  3X24 B;  2KSS A;  1OZ2 A;  3BW1 A;  4FT2 A;  4OP0 A;  3MO8 A;  3CD6 A;  2LX9 A;  3RIR A;  5I21 A;  2P4T A;  2KY9 A;  3PNW C;  4C92 F;  2DTH A;  3SWN C;  2ZPF B;  4KUL A;  3CCU T;  2F5K A;  1WJS A;  4WF2 A;  3QUI A;  2CKK A;  2QTX A;  2CZ1 B;  2X4X A;  1KHC A;  3QBY A;  4C92 D;  5GAN f;  2LCC A;  4NL3 A;  4PJO G;  2EQU A;  2Y4X A;  5D6X A;  2D9T A;  3QYG B;  2YLB A;  3L2Z A;  3G7Z A;  5A0G A;  2RM4 A;  3OYY A;  1WQW A;  1W2B A;  3JCM f;  4GLK A;  4F7U A;  3J81 E;  5C0M A;  1B34 B;  3JB9 F;  4M77 F;  2YRV A;  2ZPI B;  1VQ5 A;  1IRE B;  4B9X A;  5CKF A;  3BDL A;  4FM4 B;  1U8R A;  3VUB A;  2EQK A;  3GPL A;  3CCE A;  4TVR A;  2E10 A;  2JTF A;  3MEA A;  5GAN 7;  2E5Q A;  3LGL A;  4LDW A;  3RKX A;  1SSF A;  2PVO B;  1ZBX A;  4LDV A;  4J8O A;  1KQS A;  1VQ9 A;  3CC2 A;  5DLO A;  4BB7 A;  4M7A G;  3URG A;  2DZC A;  3PGG A;  1BIA A;  4HA8 A;  4C0D C;  1ZHI A;  5EG2 A;  3RMS A;  5HKC A;  3VV0 A;  2E6N A;  1VQN T;  2FL7 A;  2OAU A;  3WXM B;  3OYG A;  5D6Y A;  4M77 E;  3CCL T;  4LD6 A;  4M78 D;  5GAO p;  1G3T A;  2EQJ A;  3QXE B;  1QP3 A;  1VIF A;  4GY5 A;  4NL2 A;  3G71 A;  2HQX A;  1VQO T;  3C4S A;  5DLQ E;  2VGN A;  4M77 B;  5KH6 A;  4M75 A;  1KHI A;  1VQ4 A;  1VQK T;  2XG8 D;  1K73 C;  4PLL A;  3V7R A;  5A2Q E;  4C0F A;  4EDU A;  1NE8 A;  4M78 A;  3LW5 E;  3G6E T;  4JS5 A;  3CXC A;  4MDX A;  2FB7 A;  5LJ5 g;  4HKE A;  3HRU A;  4A4E A;  4M77 C;  4EPC A;  3OYD A;  1WNL A;  2R5A A;  3CMA T;  3CC7 T;  1M9S A;  3M9Q A;  4X9C A;  3ZBD A;  4C92 G;  4HT9 A;  2ZPH B;  4C5H A;  3NTK A;  2K5F A;  1BIB A;  1HXD A;  5D6W A;  3CME A;  2P0Q A;  4N0A C;  3KXT A;  1MHN A;  4IUR A;  3QKJ A;  2X4Y A;  3M58 A;  1YI2 T;  2R5M A;  3A8O B;  4XU2 A;  5CKE A;  2L89 A;  2RI3 A;  3FJP A;  5GAN 4;  5GAO l;  3EAE A;  2VC8 A;  4M7A B;  4BY6 B;  1BI0 A;  1M1G A;  2PQW A;  5I2S A;  1YJ9 T;  4KBM B;  3X25 B;  1Q7Y U;  3CBP A;  4OVA A;  3HSB A;  3CCS T;  4BE2 A;  4HT8 A;  3M5A A;  2KQW A;  3HFN A;  3LX7 A;  3WVD B;  3RES A;  3TCJ A;  3TRE A;  4A4F A;  3TEE A;  4J6W A;  5GAM f;  3JCM d;  1GXI E;  3JCM c;  5FU6 C;  2IVW A;  4QVD A;  2XDP A;  1AHJ B;  1JB0 E;  3V8K A;  1VUB A;  2O4X A;  2PVD B;  4OB1 B;  5AYF A;  3MHX A;  2DTO A;  5CVI A;  4XQ3 A;  2KMT A;  1Y71 A;  5LJ3 f;  3VYG A;  4J5Y A;  3MP6 A;  3CCM T;  4R55 A;  1P92 A;  3VUZ A;  2OTJ T;  5FU7 B;  1I81 A;  2L8D A;  3A8M B;  4C0G A;  4IUT A;  1KQ2 A;  3GOX A;  3NTH A;  4HCZ A;  5CAI A;  3CCV A;  1JRI A;  4M75 F;  1FX7 A;  3CCR T;  1KC8 U;  3QJ6 A;  4LDY A;  2DIG A;  2XK0 A;  2QQR A;  2K2V A;  4OB3 B;  2EYQ A;  3FIF A;  1Q7Y C;  1NZ9 A;  4C5E A;  5J39 A;  2E6Z A;  1FWZ A;  4M75 G;  3UWN A;  1G3S A;  3JB9 H;  4F7U E;  1WJR A;  1O75 A;  2E12 A;  2ZCF B;  3RUX A;  3LGF A;  2E41 A;  2WAC A;  5CK9 A;  5GAN g;  3HFO A;  4UC4 A;  1Q81 C;  4XU0 A;  5A0L A;  1K8A U;  3OSV A;  1KG1 A;  2RO0 A;  4XU3 A;  1N8R U;  3G4S A;  1Y07 A;  5DM7 R;  4EMK A;  2JUF A;  3JCM J;  3JB9 I;  2X4J A;  3FRN A;  4PNO A;  4ELZ C;  5KE2 A;  1K9M U;  1RI0 A;  1H64 1;  4M75 E;  3CD6 T;  3HHT B;  3RKW A;  2F69 A;  1XNI A;  2V8I A;  1M90 C;  2ZZD A;  3PMT A;  4C8Q A;  4XTW A;  1B34 A;  2XDB A;  4Q5W A;  2XIC A;  1I5L A;  2KAF A;  2B8A A;  4BDZ A;  3CCJ A;  1UGR B;  3QO3 A;  4E7K A;  2KVQ G;  2XHC A;  5GAN d;  4BI8 B;  3SDZ A;  1Y96 B;  3Q1J A;  2VGM A;  1M4Z A;  5GAN h;  3OSS C;  4FL6 A;  2JNG A;  4IUQ A;  2DXT A;  1JBM A;  1YIJ T;  3S6W A;  3JRZ A;  4E7L A;  2RJC A;  4M78 E;  4OF1 A;  2GCX A;  2LRQ A;  2QEX A;  4RCB A;  4M7A A;  4OGE A;  3MCA B;  4C8Q D;  3I56 A;  2HD0 A;  3MP8 A;  3OMG A;  5GMK l;  1RL2 A;  1D3B A;  4OB2 B;  2ZPG B;  2RA2 A;  3FC3 A;  3CCS A;  3DLM A;  5GAN j;  1N9R A;  3JB9 G;  1I4K 1;  3M4G A;  4N4I A;  3CME T;  3JB9 J;  5FRM A;  1VQN A;  3M59 A;  2LT4 A;  2VYT A;  3P8D A;  3RMQ A;  5GAO m;  1VQ5 T;  1OZ3 A;  4DQ2 A;  4YTL A;  4BI4 A;  4EMH A;  4OMF B;  3LH0 A;  2GQV A;  2I2L A;  4JRK A;  1VQO A;  1QVG S;  5CIU A;  2DAQ A;  2VXE A;  4J6Y A;  3KBG A;  4XTY A;  4OGC A;  1WGS A;  4PJO D;  4XU1 A;  2E70 A;  3S3O A;  2BUD A;  4F7U F;  2MWP A;  3ME9 A;  2MAM A;  3OS0 A;  4JRP A;  3HRT A;  4ZGD B;  2FHD A;  3MEU A;  2DIQ A;  2EAY A;  5IN1 A;  1YHQ A;  1FXX A;  2XU8 A;  2LC4 A;  2QQA A;  4J7I A;  3HL8 A;  4J6X A;  2BIV A;  3A8L B;  3CC7 A;  1G5V A;  3CCL A;  2MI6 A;  4MZM A;  4Y28 E;  1JJ2 A;  1VIE A;  5IAY A;  1VQM T;  4IKF A;  3VYH B;  5KE3 A;  3JSC A;  2QA4 A;  1JJ2 S;  2RK2 A;  1VQ4 T;  3OYA A;  4QQD A;  3JCM g;  4C0Z A;  3L42 A;  3QDR B;  5LJ5 j;  4M7D G;  1Q86 U;  2OTJ A;  1BI1 A;  2QQB A;  4R56 A;  3G6E A;  1K8A C;  1MGQ A;  5J3B A;  4MDW A;  4F7U G;  3HKS A;  5KCH A;  3EFS A;  1N8R C;  3L1A A;  3L2Q A;  3CCR A;  2EWN A;  3M4Y A;  2K4Y A;  1VQ9 T;  3SWN A;  5LJ5 h;  3GP8 A;  3OY9 A;  1M1K U;  3GNF B;  4M78 G;  4PKC C;  2JZ2 A;  2WSE E;  2RHY A;  3OYL A;  1V29 B;  2LNV A;  3DB3 A;  3PT9 A;  4RCC A;  5A0D A;  2D6F A;  2DO3 A;  4A53 A;  2RD1 A;  3P8B B;  2DPP B;  2E65 A;  2XID A;  3OS1 A;  2MMP A;  4B9W A;  4M78 F;  4JUV A;  1Q82 C;  1ZQ1 A;  2XI9 A;  4L5G A;  2RJD A;  4FSX A;  2ZPB B;  5GMK h;  5CR2 A;  3VJP A;  3A8H B;  2RH2 A;  3NTI A;  2GFU A;  4HCB A;  2CZ0 B;  3HRS A;  4ZGE B;  3JCM P;  1QVF A;  4E7I A;  2Y90 A;  2CS7 A;  4JLG A;  1WJQ A;  3OMC A;  3LYI A;  4BE0 A;  3X28 B;  2EJ9 A;  4NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...