2RHIA

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with h1.5k27me2 at 1.66 angstrom
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
CWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA03
2RHXA 2BKDN 3FC3A 4EDUA 4Q5WA 4Z02A 2RHUA 3BDLA 3OMGA 2FHDA 3L2WA 3OYFA 3L2UA 5C6SA 4QW2A 1RI0A 3O8VA 5D6WA 5D6XA 2DAQA 5C0MA 5D6YA 2NLUA 4IUVA 2P0KA 4ZTFA 3Q1JA 2LTOA 3QBYA 4N4GA 2EQJA 3META 2D9TA 3PFSA 2R57A 4C5EA 3OYMA 3QIIA 3ASKA 5KCOA 2JZ2A 2GFUA 3PMTA 4C5GA 2GF7A 3OYHA 2EQKA 2K3YA 3FDRA 4IUTA 2EQMA 2GFAA 3E9GA 2RJEA 4IKFA 3OYBA 2RJCA 4A4GA 5KE2A 4RG2A 5CIUA 5KCHA 3L2RA 2DIGA 3S3NA 3LGLA 1KHCA 3EAEA 4E7IA 4BE2A 2XK0A 2X35A 3CEYA 3ME9A 5FROA 2R5AA 4UC4A 1WJQA 2XDPA 4II1A 3OYDA 2O4XA 2O4XB 2RI2A 2X4XA 2E5QA 3S3OA 2EKOA 2L8DA 2X4WA 4LD6A 4B9XA 2WACA 3S3MA 2LRQA 2BIVA 2MWPA 2RO0A 4GY5A 3QJ6A 1G5VA 4QQDA 2X4YA 2MWOA 4HCZA 3OYKA 4IUQA 3FLGA 2VYTA 2RI5A 3L2VA 3P8DA 1OZ3A 3UT1A 2M0OA 3MEUA 4ZTJA 3M9QA 3OYJA 2RI3A 5M9OA 3OYGA 1SSFA 1OYXA 4X34A 2CKKA 3ZEHA 3OYCA 1XNIA 3MP6A 4IURA 3SD4A 2LCCA 3GOXA 3NTKA 2G3RA 2YRVA 2EQUA 3H8ZA 2M1HA 3P8HA 5IN1A 5J39A 2B8AA 3MP8A 4A4FA 4C5HA 4E7HA 4L59A 2RHZA 4PLLA 4QVZA 4E7JA 3LLRA 3OS2A 3QKJA 5KH6A 4NS5A 4B9WA 1WJRA 3OMCA 3PMIA 4QQGA 3S6WA 4BDZA 2EFIA 2R58A 5FRNA 2E6NA 3OA6A 1N27A 3OYLA 3DLMA 4A4HA 4FU6A 1WJSA 4N4IA 3OS1A 2M16A 3KUFA 3MEVA 4E7LA 5KE3A 4IUPA 1MHNA 3UWNA 3MEAA 4PL6A 3OYEA 3MEWA 4BE0A 3OQ5A 4QQ6A 1WGSA 3E9FA 5IAYA 2RJDA 2IG0A 1OZ2A 4A4EA 3PNWC 3OYAA 3NTHA 3H6ZA 3L42A 2K3XA 3DB3A 3L2QA 4OVAA 2HQXA 1H3ZA 2HQEA 3LGFA 3OS0A 4C5IA 3MO8A 2RHIA 4PLIA 3LH0A 4BACA 2LDMA 3OYNA 4N4HA 3OB9A 4BDYA 2BUDA 2RJFA 3LYIA 3NTIA 2R5MA 2RHYA 3OYIA 5FRMA 2DIQA 2QQRA 3DB4A 3MP1A 2L89A 4E7KA 2JTFA 1OI1A 2PQWA 2QQSA 3C4SA 3F70A 2L3RA 4FL6A 5J26A 4CRIA 3LX7A 4BE1A 4BD3A 4IUUA 2F5KA 3OY9A 3FEOA 2LVMA
chains in the Genus database with same CATH superfamily
1W2BA 1VQ5Q 4LD9K 2DNUA 3C0CA 4C8QE 4M75A 2DXTA 5FW9A 1WNLA 1N8RC 5EC7A 1JQQA 1VQ8Q 4KRTA 2K3YA 2D1XA 3RMQA 3AHUA 3E9GA 1NEGA 4E47A 2WSEE 2K2VA 5KE2A 5GAN5 4LDVA 3M0TA 2MAMA 2YLCA 2X35A 5KYWA 3ME9A 3CXCA 1G3WA 2XMFA 3L1AA 3J80E 2I2LA 1RADB 4X9DA 4HVWA 2EKOA 2X4WA 5CVIA 2DXBA 2LRQA 2BIVA 3VUZA 1JJ2S 2EW3A 1OPKA 1OZ3A 3UT1A 4OMLA 4AFZC 2M51A 3ULRB 2RI3A 5GAMe 4F7UE 4JJDA 2HKNA 3PE0A 2V26A 4PJOD 1Q7YC 1WXUA 2EYXA 3MP8A 2B86A 2X9HA 1TH7A 2PUKB 1QVFP 5A0GA 3I5RA 2MCNA 2OTLT 2GBQA 3CPWA 3M54A 2LJ1A 3FIFA 1UFFA 2F1LA 1SG5A 1XOVA 1QCFA 3EG0A 3X26B 2DM1A 2K3XA 2MPXC 3A8HB 5CAIA 3VS0A 1H8KA 1QKWA 4J9BA 1N6AA 4C0ZA 2ZAEA 1Z9QA 1H92A 3QHSA 1BU1A 4M7AE 1W4SA 4QVDA 1ZX6A 3CCJT 1QVGS 2E5KA 2JMAA 2XD0A 3FJ5A 2F5KA 1Q95G 2NUTB 1ZSZC 2JTEA 4F04B 1LCKA 4LNPA 1C1AA 4L5GA 4HCKA 5GANj 4RTXA 2F69A 1I8FA 2JM9A 2D0QB 1MMDA 1X27A 3RKWA 4RKUE 2PVDB 2EAYA 1Y7XA 2KSSA 3H41A 1QQJA 1K73R 4L6V5 1ZA2B 3G71T 3S3NA 1VQPA 1Q86U 1KHCA 2LQKA 5HY6A 5FROA 1W2BS 2XDPA 5LJ3j 3WXMB 1GCQA 1U5SA 3BY7A 4E6RA 5LJ5f 4C8QC 3JCMP 4FT4A 2CSIA 2Z0WA 4PK4A 4N0AA 3J7AF 1PSEA 3IQLA 2DERA 3E19A 4ORZA 3CMET 3M9QA 1U8RA 2DVEA 1SSFA 2CP5A 5HK0A 1N8RR 4FW1A 4OB2B 2ZPFB 2YUNA 1GRIA 2RQTA 4L59A 3O5ZA 4QVZA 3KXTA 5GAOp 4NOYA 2DZCA 1PKSA 3EGUA 2HBPA 3FJPA 2E10A 3PMIA 1ZSZA 1IGUA 2BTTA 2DVJA 5KYXB 1LOJA 4C8QF 4N4IA 4M78A 2DO3A 2PVOB 4DBHA 3UWNA 2O2OA 3WVDB 3E9FA 2IG0A 4Z8AA 4GLMA 3VS4A 3I55A 4M7AD 3L2QA 5FU6B 5KYYA 2VUBA 2RQUA 1ABOA 2LCLA 2RHIA 2P4TA 2HEQA 4J8OA 3LYIA 3RDVA 4F7UF 3EG2A 2QQRA 3DB4A 3EG9A 4FL6A 3VS3A 4JRPA 1VQ7A 4M7DA 1NYFA 1B34B 4PKCC 1KK7A 2PUOB 1QVPA 3FC3A 4Z02A 1VQ9A 4M75B 5L8RE 2DAQA 2FRWA 3RMSA 2LNHB 4BE0A 3QIIA 4MZPA 5FWCA 2X51A 1MV3A 2RJEA 3MHXA 4MMLA 3CCVT 2CREA 3HRTA 1K8AR 2QG9B 5GAOm 3JCMf 5KYWB 1VQ8T 2XDBA 4C92D 2RNAA 2ZPIB 1K8AU 2X3XD 2DJQA 2CT3A 2DL8A 3S3OA 2L3SA 3SHWA 2MOXA 4RUGA 4ZGEB 3UF4A 1G5VA 1HK9A 2X4YA 3HSBA 2XU8A 4JJBA 2CKKA 1HD3A 3RNJA 1XTDA 2E3IA 1BCOA 4JLGA 1WXBA 1LJOA 3A8OB 4C5HA 5GAMf 4M78G 4QKUA 3CCUQ 4TVRA 3CCVQ 3HRSA 2BZYA 4JLIA 2XHCA 4FU6A 1Q7YU 1VQMQ 4PJJA 3PIPA 1VQMA 4FW2A 3QJYA 2KDSA 4ELZC 1G3SA 1KQSA 2MI6A 2YDLA 3JCMc 2C06A 2JMCA 3GNGA 3CPFA 1PSFA 1LPLA 4ESRA 3CCVA 1D1CA 2CUBA 4C0GA 1BYMA 1N9SA 2DETA 4JJCA 2RHYA 1NPRA 5GJVB 1D09B 2LJ0A 2PQWA 2QQSA 4QT7A 3ZFJA 1M27C 3HRUA 2NUTA 2YLBA 1MMGA 2SEMA 1K76A 5CO7A 1FYNA 4EDUA 1VIEA 2EJGA 5LJ3d 4PJOF 4EMKC 2PZ1A 4GLKA 1MGQA 5GAN8 1UB4A 2P0KA 4DEXA 2VC8A 1WZOA 1EZZB 3Q1JA 2KNBB 4C5EA 4OB3B 3OYMA 5CKBA 4IUTA 1YFNA 2VVKA 4JZ4A 4M77D 3NHNA 4PJNA 1FMWA 5LJ3f 3N5BB 4BB7A 5LJ5h 2LP5A 3LGLA 1UJ0A 2KRSA 1K73U 4Z88A 1IREB 3VS2A 1WJQA 4IIOA 3KBGA 3CCQQ 4LD6A 4GY5A 5GJWB 1LNXA 4XTYA 1X6BA 1YJ9A 1BIAA 3C12A 3D7SB 1VQPT 2E70A 3L2VA 2ROTA 2JXBA 3SWNA 4X1VA 5M9OA 1NJIR 5J3BA 4XU0A 1TUCA 4J9HA 1NJIU 2GTJA 3UATA 2L0AA 3EHQA 3P8HA 4XK8E 4OP0A 2E6ZA 1AWOA 2EYZA 2FPFA 1W6XA 4E7HA 3CCMT 3LLRA 2DBKA 2P0PA 2D0NA 1VQ9T 2DL3A 2M0YA 1YJ9Q 2X4JA 1MMAA 3CC7T 1ZSZB 2FB7A 1CKBA 2O31A 1VQ6T 1YP5A 1QLYA 3UA6A 2XI9A 3JCMX 1YITA 2QXFA 4M78B 2FZGB 4FIBA 3MEWA 2HNIA 2KI7A 1E7OA 3PNWC 2GCXA 2KMTA 1WHHA 2FYKA 1M30A 4HKEA 1X01A 1D0ZA 2CGHA 2QAZA 4HCCA 1Q86C 1BIBA 1RAAB 5GMKm 3TREA 1YN8A 4M7DB 1B34A 4IUUA 3JB9J 4PLLA 2HSPA 2LZ6B 2OAUA 2ZPBB 5C0MA 3EH1A 2QDLA 3CQTA 2JM8A 5GMKi 2DTOA 5LJ5e 1BKBA 3CBPA 4C8QD 4RG2A 4R56A 2A7YA 3M4GA 4YTLA 4BY6C 2XK0A 2ED1A 1VQPQ 3PTAA 2D8HA 1EIFA 2GQVA 3HL8A 3VKIA 3S3MA 2EGEA 1Q82U 1IXDA 2ZPEB 4LUEA 2PNIA 6AT1B 5HK3A 2E65A 3MJXA 3FLGA 1AD5A 3P8DA 2RQVA 2F2VA 4ANJA 3TCJA 3A8GB 2FVUA 5FU6C 2FG0A 1M4ZA 5GAMh 3PVLA 3JCMb 1VQLQ 3TEEA 2EIFA 4E7SA 1AT1B 3CMAQ 3G6ET 3UPUA 2A0FB 2JJ9A 3LW5E 2CYZB 2KVQG 5FRNA 1ACMB 4LDYA 1N27A 1PHTA 5GAMj 3THKA 1WJSA 4F7UA 1OQKA 1HJDA 1UGQB 2BE9B 1V1CA 1YIJQ 5EG2A 4A4EA 4ATOA 1VQ4A 3I56Q 2RMOA 1NM7A 3M59A 3R6NA 1D0YA 4FSXA 4CI0C 1VQ5T 1ZHIA 2O9VA 3EHRA 2E64A 2HCKA 2FL7A 1WFWA 1NG2A 5DLQE 4Y91A 2L89A 1PCXA 2KROA 5IH2A 1SSHA 1GCQC 4DOVA 1JB0E 2K9GA 1BI3A 1BK2A 1I1JA 3EGDB 4Q5WA 2YXYA 1K9AA 4OMPA 4RCCA 3L2UA 2LCSA 4LUDA 3T9NA 1VQ7T 2DL7A 4J9GA 4FCYA 1V76A 2LTOA 2AHJB 2R57A 4M7DF 1Z9ZA 1KQSP 1WA7A 3LWHA 4O5VA 2DMOA 1M1FA 3I55Q 1EX4A 1NBEB 2KK4A 3VYHB 5GMKh 3AT1B 3V8LA 2L8DA 1B07A 1R77A 1E6HA 4M77E 1VQ8A 2MWOA 3VUBA 1QVGP 3JCMW 5FWBA 1UJYA 2K5LA 3I56T 3A1PA 2CZ1B 3SWNB 4M7AB 4JZ3A 2KRMA 3M0QA 2J05A 4J6WA 2BE7D 2M1HA 2GQIA 4FM4B 2M02A 2FZCB 1G3YA 2JS0A 4NS5A 5GAOn 1WJRA 4F14A 3CCLQ 2YT6A 4AG2C 1Q82R 1ZBJA 1WXTA 2M16A 4FYXB 2LC4A 2EVRA 3CCRT 3M4YA 1OOTA 2HBWA 3A5ZB 3VS6A 4C0DC 3H6ZA 3DB3A 1MMNA 2D6FA 2HQEA 3HHTB 8ATCB 4BI4A 4CC2A 3V8JA 1PKTA 5I2MA 5LJ3h 2RJFA 3VS1A 4BY6B 2LX7A 4D8KA 1BI0A 4DBFA 4BD3A 3FEOA 5L23A 2YSQA 5GANf 1FMVA 2QA4T 5C6SA 4QW2A 1UTIA 2ZZDA 1QWFA 3VJPA 1OX9A 1JXMA 1VQMT 3RESA 3HFOA 2X3WD 1PWTA 4J9DA 5FU7C 2FO0A 3CCET 3X25B 1D0XA 4EIKA 1SF9A 1I81A 3EAEA 4F7UG 3NPFA 1AOJA 2VGNA 3M55A 3QDFA 1FWZA 3OYDA 2E5QA 1QP3A 1A0NB 1YWPA 1LVKA 5AT1B 2LQWA 3JCMJ 1Y0MA 1YJNT 2OAWA 1VIFA 1C6VX 3C94A 2QASA 1ZLMA 3JCMg 5IXFA 5GAOl 4KUIA 1RACB 3X20B 1QVGA 2YUPA 1VQNT 2YUOA 4AMCA 1RL2A 2ECZA 2QI2A 4OB0B 2GNCA 2JNGA 2KAFA 1KD1U 1AZGB 1K9MU 2EYYA 2RHZA 1OU9A 1N8RU 1JO8A 2K3BA 2GTOA 3S6WA 4RTUA 2J7IA 4RTVA 3CXCP 1KJWA 3OA6A 3CCMA 1WHJA 4F7UB 1KHIA 2V8IA 3EFOB 4J6YA 3CCST 1M1GA 3VRZA 2ZPHB 3G71A 1Q81C 1ARKA 2KT1A 1Q86R 3HFNA 4OVAA 1YHQT 4FYVB 4M7AC 2LMJA 2DD5A 2D8JA 1K73C 4N4HA 3CD6A 5GAN6 1XQHA 2LT4A 1KQ2A 2JTFA 1OI1A 4CRIA 4N0AC 1AHJB 1AZEA 4J9IA 2DXCA 4KUDK 3EGDA 3GLXA 3VS7A 3M58A 1VQ5A 1NPPA 5KYUA 2K5IA 3L2ZA 1T0JA 4V2SA 2IVWA 4XTUA 1VYUA 1ZQ1A 2RF0A 4WF2A 3SWNC 5IT9E 4C5GA 4FT2A 3M53A 1HXDA 2C0IA 4CC7A 3CC2Q 4ZN3A 3OYBA 2RJCA 4A4GA 2J6KA 2PVGB 1G8XA 1OULA 5LJ5j 4JJNK 3CEYA 1RAGB 4X9CA 2OX7A 4M78C 2Y4YA 2RI2A 3EGXB 2IIMA 1K1ZA 5LJ5g 2EYQA 4KH0B 3JRZA 4WCIA 2MWPA 3ZBDA 1VA7A 3CC7Q 2ENMA 1M1KU 1X69A 4AG1C 5CKEA 3OYKA 3SFMA 1SEMA 3JB9G 3V7SA 5CKDA 3CC4Q 1YHQA 4E7ZA 2EGCA 2Y90A 4M7AA 1S72T 1MV0B 2RH2A 5IN1A 2YHTA 3QYGB 3HKSA 3CCMQ 1I07A 2K5FA 7AT1B 1YI2T 2YRDA 3G4SQ 1CKAA 4M7DD 3OBYA 1BCMA 2R58A 2MMPA 2K57A 1UGRB 2F2XA 1ZA1B 3KUFA 4E7LA 1MHNA 1BB9A 1W70A 3LWIA 2NWMA 3CD6T 1SPKA 4ELYC 2E4HA 3OYAA 3DLLA 3CCEA 5IHNA 2DTIA 2XIDA 2CP6A 2DLPA 3GNFB 1ZSGA 4JDSA 3CCRQ 3G7ZA 4C8QB 3NTIA 2R5MA 3CCRA 1M2VB 3OYIA 1YJNA 1D3BB 2EJ9A 3V8KA 2L3RA 3QYHB 4CC4B 1ZUYA 4EPCA 1U1SA 2RHUA 4CC3A 2CT4A 1K9MC 3FB9A 4ZTFA 1TWBA 1M2OA 5GAOr 3QBYA 4OGCA 2JZ2A 2GF7A 1S72A 5GAN7 4M75D 2FPDA 1TG0A 1D1BA 4D8DA 1YBYA 2OI3A 2DRKA 2DXUA 1MNEA 1UGPB 4NL3A 1YI2A 4UC4A 3H0IA 3X24B 2O4XB 1YJWT 1X6OA 2EYWA 2QK0A 2EBPA 4OMMA 4EMGA 3ER0A 4HCZA 4C92B 1WHGA 3E2UA 2VYTA 4J9FA 4AFQC 4C8QG 2RK1A 1PD0A 3MEUA 3VU3C 3V7CA 2QYZA 2KEAA 3MP6A 3REBB 1TOVA 1YCYA 2EQUA 2HZYA 3H8ZA 3QWXX 2FEIA 5IHIA 1RLQC 2QEXT 2ZGWA 3RKXA 1X2KA 2C0OA 2DYBA 4QQGA 4BDZA 2OTLA 1W1FA 4M7DE 2AZVA 2QTVA 4J7IA 4RCBA 1X2QA 3CMEQ 3ZL7C 3EFOA 3CBOA 4RMOA 3JV3A 1PM3A 1K0SA 3OYEA 4PJOC 3MEAA 3C95A 3SDZA 1M90U 3PGGA 2RPNA 4PJMA 1ABQA 3KFVA 2EPDA 2JTMA 2W0ZA 2EQIA 1H3ZA 2LT1A 1M1KC 1QVFA 5FU7B 2CUDA 3LH0A 5GAMd 3JB9H 1VQKT 1KIKA 1VOMA 1RLPC 2KXDA 5GMKe 3MP1A 2QEXQ 4LDUA 2OTJT 1TSFA 2DEQA 5GAN2 4BE1A 3LX7A 1OEBA 1YJWA 1M5Q1 2XG8D 2RHXA 3BDLA 1OX8A 4F16A 5ECAA 3OYFA 4MMKA 5KYUB 4AT1B 2E3HA 2HQHA 5D6YA 1IB8A 1WQWA 3OSSC 4IUVA 3EH2A 4PNOA 2AK5A 1BI2A 3META 2KXCA 4FSSA 5KCOA 1ZUUA 3QG1A 4O6JA 3EFRA 1UGVA 2CH4A 3VRYA 4IKFA 3R6OA 3CCJQ 3CPWS 3JCMd 3BDUA 3JCMV 2DIGA 2SRCA 2P0QA 2CZ7B 2AKKA 4M75F 3EGXA 3NMZC 4M77B 4NL2A 4OGEA 3OW2A 2DYIA 3CCQT 2BZ8A 4Y28E 5CK9A 5LJ3g 2OTJQ 2H3EB 1SRLA 4JS5A 1OYXA 2LCCA 1K0XA 4LXCA 3RKYA 5CKHA 5GAOq 2B8AA 1TXQA 3REAB 1V29B 1KD1C 4DEYA 1JBMA 3QSUA 3QKJA 2L3QA 4A54A 5CQYA 2ATCB 3OYLA 3DLMA 1B7TA 5DLOA 3NGPA 1Y07A 1U1TA 2VWFA 1SKUB 2LNVA 4C92C 1VQLA 1T0HA 2KT8A 4QQ6A 1WGSA 1VQKA 1OZ2A 1JXOA 3L42A 1M8MA 1VQ6Q 2HQXA 1I4K1 2DX1A 2VXEA 4M78D 3G4ST 4C8QA 1M1KR 2COWA 2BUDA 2PTKA 1M2VA 1D3BA 1I5LA 3F70A 1M8VA 2JUFA 3MKDA 3EFSA 1HSQA 2YUQA 4R55A 2COYA 1JRIA 2CSQA 2P4RA 1VQOA 2DJZA 3BW1A 3QWYA 3M0UA 3RR6A 3CCLA 5LJ5d 2KBTA 2QQ9A 3PMTA 1M9SA 1TS9A 2RQRA 3CBMA 4M4ZA 5CIUA 5KCHA 1Y57A 4E7IA 2R5AA 3QXEB 1QWEA 2O4XA 5KYNA 3CC2T 4B9XA 2DF6A 1W2BP 4LDXA 2M9UA 2P84A 4PJOB 2RN8A 4M77G 4C92A 1UEBA 2RI5A 4ZGDB 2KYBA 4ZNXA 1O75A 2L3PA 2K6DA 4HVVA 4M75C 1X43A 2QGFB 4DBQA 2J06A 2YRVA 1YITQ 1G83A 4J83A 1KC8C 4E7JA 1IHVA 1BI1A 2RM4A 1KC8R 1JEGA 1D1AA 3OW2S 4ZN1A 2QA4A 2CS7A 4R0KA 1YNZA 3PIOA 1KG1A 4M7AF 1RAEB 1U06A 2IPOB 5A0DA 3M0SA 4J9CA 2AT1B 2QQBA 1KQ1A 2ZPGB 4OF1A 3CCSQ 5FLXE 4PFOA 3CCSA 3I35A 1K4US 4LN2A 3NTHA 3JSCA 4M7DG 2LJ3A 3A8LB 4BDYA 2LX9A 1R0CB 2DIQA 1AVZC 2V1QA 3OS5A 3URGA 4DOWA 1T3LA 5J26A 2O01E 3I56A 1M3BA 1VQ4Q 2A3LA 4J9EA 2O88A 4M78F 1MUZA 1AWXA 1YIJA 1SHFA 1NYGA 4KH1B 2J6OA 4LDWA 1N5ZA 1ZUKA 1VQNA 2NLUA 2DL5A 3OBWA 1RI9A 1WHMA 1UDLA 1U3OA 1O9SA 2EQJA 2K4YA 2LQ8A 2GFUA 5GAN4 1IZ6A 3J81E 4FYWB 1N9RA 3CMAA 4MZMA 2HL3A 3L2RA 3H0HA 4HT8A 1PC0A 2X4XA 4M77A 1IO6A 1OPLA 2FZKB 2COZA 2FRYA 2VV5A 2RO0A 3QJ6A 2NUZA 4JUVA 4QQDA 1S1NA 4KGVB 1QKXA 4AFSC 3RERA 8AT1B 2ZCFB 5HKCA 1VQOQ 3ZEHA 3SEMA 5GMKl 2G3RA 4XQ3A 4DA4A 4RTWA 1Q7YR 2V8KA 3GBQA 1NLPC 2CH4W 3H9NA 1PRLC 4BUGA 5KH6A 4PFZA 4RTTA 3OMCA 3OYYA 4XTZA 1YIJT 3HPWA 2XICA 1GFCA 1YITT 2KRNA 1M90R 2RQWA 2EJFA 2QTXA 3INZA 4HVUA 5GANe 2F2WA 2MIOA 1H641 3E1SA 4FYYB 2RB6A 1X75C 2NUPA 1QW1A 3M5AA 4BACA 2GGRA 1Q82C 5I21A 1OV3A 1JJ2P 5IHKA 1GCPA 1PG5B 1WQ7A 1VQNQ 1RABB 1CSKA 2BKDN 2C0TA 1M90C 3A8MB 3M0PA 3OMGA 1JJ2A 5D6WA 3RIRA 4M77F 4M75E 2ED0A 1UG1A 1KQSS 3PT9A 3U23A 2J6FA 4N4GA 4XU2A 3TU4K 1QVFS 1M3AA 4RTYA 2A08A 1HYOA 1SHGA 2EQMA 2GFAA 1WIEA 1ZBXA 9ATCB 1VQOT 2JVVA 3SB2A 1QCNA 2KY9A 4C0FA 1TUDA 1AEYA 4II1A 1GXIE 1TTHB 2KQWA 3CCJA 5GAN3 3M56A 2HAXA 1K8AC 4JPBW 2QA4Q 4M7DC 4PJOA 2FPEA 3CCQA 2M0OA 3FRNA 2MYSA 5CR2A 3OYGA 1C0MA 1UECA 3QPHA 3MPUB 1FX7A 4IURA 4A4KA 3CCUT 1GBRA 5CKFA 2QDYB 1YJWQ 3EG3A 3DKMA 4MDWA 3JB9D 3GF5A 2K79A 5GANd 3OS2A 1FMKA 5LJ3e 1IRXA 2VGMA 1NE8A 4OMQA 4A4HA 1T3SA 2KGTA 1QCOA 3OQ5A 3GIBA 4OMNA 1KSWA 4DQ2A 3QO3A 1FXXA 3CMEA 1VQ4T 4XAXB 3TVTA 5GAMg 3OS0A 1H3HA 2QGGA 3I9QA 4PLIA 1Y71A 2OTLQ 5CCAA 4IIMA 2ABLA 2DFUA 4E7KA 5I2SA 1WYXA 4WTOB 3OY9A 2LVMA 2DEUA 2FHDA 1X6GA 2WSCE 3JCMe 1RI0A 3O8VA 4J6XA 3CMAT 4XU3A 2YRCA 2NYSA 4A53A 1G2BA 2DL4A 3CCUA 2HMAA 2AZSA 3OYHA 2V1RA 1VQ6A 2E1HA 4ZGJB 1RAHB 4BI3A 1YI2Q 1VQKQ 4BE2A 2MK5A 1E6GA 3BE3A 4PJOG 1Q81R 5A2QE 4KULA 4OB1B 2WACA 1S72Q 1GFDA 3JB9I 2DA9A 1VUBA 1VYVA 3I5SA 1GBQA 2HD0A 4EMHA 4PJLA 5DM7R 1KC8U 3OYJA 4EMKA 2BZXA 2JW4A 4X34A 3P8BB 4JRKA 2LQNA 1KFZA 2Y4XA 4A4FA 4XTXA 4HCBA 4RG8A 2OTJA 3HP9A 1YJNQ 4PFPA 2RK2A 3CPWP 1Y96B 2DKGA 2ESWA 4VUBA 4MDXA 4HT9A 3PVQA 4PJOE 3CCEQ 5KE3A 1VQ9Q 2V8JA 4KGZB 4KBMB 4QVCA 2I0NA 1OU8A 3QZ9B 1VQ7Q 3X28B 3RUXA 4RTZA 2NUPB 1YJ9T 4P5NA 2CP7A 1AWWA 1MNDA 2H3JA 3C4SA 1Q81U 4M7AG 2JOYA 2K2MA 1I0CA 2WSFE 1UGSB 4C92E 4HXJA 3RBBB 4Z89A 3L2WA 3JAME 2KR3A 2DK3A 2RA2A 2QEXA 2AKLA 2XDDA 2D9TA 3CCLT 2EKHA 3WVEB 1XJWB 1R8OB 1I5OB 1WHKA 1TU0B 2A28A 2HL5C 3NFCA 1WX6A 1TUGB 5DY9A 1WPYA 2DTHA 1DJ7B 1PNJA 3VV0A 2EGAA 3CC2A 4HA8A 2A36A 2G6FX 4IUQA 4C92G 1P92A 2DE0X 3TQ7P 2HKQB 4ZTJA 3I55T 1UHCA 1K9MR 3GPLA 3SD4A 3GOXA 2A37A 3NTKA 1KD1R 5J39A 1WHLA 3QUIA 1G3TA 1EFNA 3G1JA 3CD6Q 2EFIA 2DPPB 2H8HA 2DBMA 2DZ9A 3CC4T 2VB6A 1WLPB 2DD4A 4JRQA 2CZ0B 3G71Q 3V7RA 2MF2A 2L2PA 2ROLA 4OMOA 4PL6A 3QZ5B 1SRMA 4JRIA 2E12A 5HCKA 5IAYA 1PD1A 2RJDA 4XTVA 4J7FA 1PRMC 2E41A 2RD1A 4KT0E 3LGFA 4C5IA 3TSWA 2KE9A 1F1BB 3OB9A 2DRMA 2VASA 3VS5A 5I22A 1UUEA 3UDCA 3OSVA 3TSZA 4M77C 4DBRA 2AIRB 1BBZA 1RAIB 4M75G 5CQXA 2QQAA 5D6XA 3G6EA 1R0BG 4AFUC 3JB9F 1WDXA 4E2FB 2CP0A 4J5YA 3OW2P 1UHFA 3PFSA 1J3TA 3ASKA 2L5QA 1UE9A 5I11A 2EQKA 3FDRA 3M0RA 4K11A 4F17A 2EWNA 5A0LA 2JN0A 5AYFA 3G6EQ 3UA7A 2CZ6B 4C0DB 1M3CA 2XKOC 3H0FA 1VQLT 2CDTA 4Y92A 2VKNA 2W10A 5LL6S 2PU9B 2F5TX 2YWWA 3G4SA 4BI8B 4MZTA 5GANg 3QDRB 1WI7A 4KGXB 2KYMA 2OJ2A 4OMFB 4EMKB 4B6MA 3OYCA 1XNIA 1YWOA 1IHWA 5GMKj 3JCMh 4ME7A 1YHQQ 3CC4A 1B3QA 2CP2A 2VXFA 2O9SA 1NZ9A 1NJIC 3MCAB 4B9WA 3CC7A 1GL5A 1NEBA 1JU5C 1RAFB 4M78E 2E6NA 1QP2A 1Y96A 2JS2A 3EG1A 3M57A 4JS4A 3HTRA 5KYXA 3OS1A 3LH5A 3MEVA 1AWJA 4IUPA 3A98A 3CXCS 3VYGA 4LE9A 4C92F 1NLOC 1VYTA 3BFMA 5KYYB 1RUWA 3MO8A 4GBQA 2JT4A 2LDMA 3OYNA 1QMCA 2HSEB 2DILA 4D6WA 3GP8A 5D7UA 2K7AA 1IGQA 3JCMQ 5GANh 5FRMA 3EG9B 2HDAA 4XTWA 2CP3A 4XU1A 1YCSB 4A63B 5IXBA
chains in the Genus database with same CATH topology
1W2BA 2BKDN 4EPCA 1M90C 1U1SA 4LD9K 3A8MB 2RHUA 3OMGA 4C8QE 1JJ2A 2OAUA 4M75A 5D6WA 3RIRA 2ZPBB 4M77F 2DXTA 4M75E 5C0MA 1K9MC 3FB9A 1WNLA 1N8RC 1KQSS 3PT9A 4ZTFA 5GAOr 3QBYA 4N4GA 5GMKi 4XU2A 3TU4K 2DTOA 1QVFS 4OGCA 2JZ2A 5LJ5e 2GF7A 1BKBA 2K3YA 1S72A 3RMQA 2EQMA 2GFAA 5GAN7 3AHUA 1ZBXA 3E9GA 4M75D 4E47A 2WSEE 2K2VA 3CBPA 5KE2A 1YBYA 4RG2A 4C8QD 5GAN5 1VQOT 2JVVA 2DXUA 4LDVA 4R56A 3SB2A 2A7YA 3M4GA 4YTLA 1UGPB 2MAMA 4BY6C 4NL3A 2YLCA 2XK0A 2KY9A 2X35A 3ME9A 4C0FA 3CXCA 1YI2A 1G3WA 4UC4A 3X24B 4II1A 3L1AA 3J80E 3PTAA 2O4XB 1YJWT 1GXIE 2I2LA 4X9DA 1EIFA 2GQVA 2KQWA 1X6OA 3HL8A 3CCJA 5GAN3 2EKOA 2X4WA 3M56A 2HAXA 5CVIA 3VKIA 2DXBA 1K8AC 3S3MA 1Q82U 2LRQA 2BIVA 3VUZA 2ZPEB 1JJ2S 4EMGA 4M7DC 4PJOA 3ER0A 4HCZA 5HK3A 4C92B 2E65A 3FLGA 2VYTA 3CCQA 3P8DA 4C8QG 1OZ3A 3UT1A 2M0OA 2RK1A 3FRNA 3MEUA 3VU3C 5CR2A 2RI3A 3TCJA 3OYGA 5GAMe 3QPHA 3A8GB 2FVUA 3V7CA 5FU6C 4F7UE 5GAMh 1M4ZA 3MP6A 1FX7A 4IURA 4A4KA 3CCUT 1YCYA 3JCMb 3TEEA 4PJOD 1Q7YC 2EQUA 3H8ZA 2EIFA 5CKFA 2QDYB 3MP8A 2QEXT 2ZGWA 3DKMA 4MDWA 1TH7A 3G6ET 2PUKB 3UPUA 3GF5A 3JB9D 3LW5E 3RKXA 5A0GA 5GANd 3OS2A 2OTLT 5LJ3e 2CYZB 4QQGA 2KVQG 4BDZA 2OTLA 4M7DE 5FRNA 2VGMA 4LDYA 1NE8A 1N27A 4J7IA 4RCBA 3CPWA 4A4HA 5GAMj 1WJSA 4F7UA 3CBOA 4RMOA 3OYEA 4PJOC 3M54A 3MEAA 3C95A 3FIFA 3SDZA 1M90U 3PGGA 3OQ5A 3GIBA 1UGQB 1XOVA 5EG2A 3X26B 4A4EA 4DQ2A 4ATOA 3QO3A 1VQ4A 2JTMA 2K3XA 1FXXA 3CMEA 1VQ4T 4XAXB 1H3ZA 2LT1A 3A8HB 5CAIA 3M59A 5GAMg 3OS0A 4FSXA 1M1KC 1QVFA 4CI0C 1VQ5T 1ZHIA 1N6AA 5FU7B 4PLIA 3LH0A 5GAMd 3JB9H 1Y71A 4C0ZA 1VQKT 2E64A 5CCAA 5GMKe 2FL7A 5DLQE 3QHSA 4Y91A 4E7KA 3MP1A 4M7AE 2L89A 1W4SA 4LDUA 4QVDA 2OTJT 3CCJT 2DEQA 5GAN2 4BE1A 5I2SA 1QVGS 3LX7A 1YJWA 2XD0A 2F5KA 3OY9A 2LVMA 1M5Q1 2XG8D 4DOVA 1JB0E 2RHXA 1BI3A 4Q5WA 3BDLA 2FHDA 2WSCE 4RCCA 3OYFA 4MMKA 3JCMe 3L2UA 1RI0A 3O8VA 4J6XA 3CMAT 4XU3A 5D6YA 1WQWA 3OSSC 4L5GA 3T9NA 1VQ7T 4IUVA 5GANj 4A53A 2F69A 4PNOA 1I8FA 2D0QB 2LTOA 2AHJB 1BI2A 3META 3CCUA 2R57A 3RKWA 4M7DF 5KCOA 4RKUE 3OYHA 3QG1A 2PVDB 4O6JA 2EAYA 3EFRA 1Y7XA 3LWHA 4IKFA 3R6OA 4O5VA 3CPWS 3JCMd 1VQ6A 2KSSA 1M1FA 3BDUA 4L6V5 2E1HA 4ZGJB 3G71T 3JCMV 2DIGA 2KK4A 4BI3A 3S3NA 1VQPA 1KHCA 1Q86U 4BE2A 2LQKA 5HY6A 5FROA 1W2BS 3VYHB 2P0QA 2CZ7B 2XDPA 4M75F 4PJOG 5GMKh 5LJ3j 3WXMB 3BY7A 4M77B 4NL2A 5LJ5f 4C8QC 5A2QE 3V8LA 4KULA 4OGEA 2L8DA 3OW2A 3JCMP 4OB1B 2WACA 4FT4A 3CCQT 4Y28E 4M77E 3JB9I 1VQ8A 4N0AA 2MWOA 3VUBA 3J7AF 1VUBA 1PSEA 2HD0A 3JCMW 3E19A 2K5LA 4EMHA 3I56T 3CMET 5CK9A 5LJ3g 5DM7R 2CZ1B 1KC8U 3M9QA 3OYJA 3SWNB 4EMKA 4JS5A 1U8RA 2DVEA 1SSFA 1OYXA 4X34A 5HK0A 4M7AB 3P8BB 4JRKA 2LCCA 4J6WA 3RKYA 5CKHA 2M1HA 2Y4XA 4OB2B 4FM4B 2B8AA 5GAOq 2ZPFB 4XTXA 4A4FA 4RG8A 4HCBA 2OTJA 4L59A 3KXTA 4QVZA 1V29B 5GAOp 4NOYA 1KD1C 2DZCA 1JBMA 3HP9A 3QSUA 1G3YA 3FJPA 2HBPA 3QKJA 5GAOn 4NS5A 2E10A 1WJRA 3PMIA 4A54A 5CQYA 2RK2A 1Y96B 2DKGA 4MDXA 4VUBA 3OYLA 3DLMA 4HT9A 1LOJA 4C8QF 4N4IA 4PJOE 5DLOA 2M16A 1Y07A 2LC4A 4M78A 2DO3A 1U1TA 2PVOB 5KE3A 3CCRT 3UWNA 3M4YA 2LNVA 3WVDB 4C92C 1VQLA 4QQ6A 1WGSA 3E9FA 1VQKA 2V8JA 3A5ZB 2IG0A 4KBMB 4QVCA 1OZ2A 4C0DC 3H6ZA 3L42A 3I55A 4M7AD 3QZ9B 3DB3A 3L2QA 3X28B 2HQXA 2D6FA 5FU6B 1I4K1 3RUXA 2HQEA 3HHTB 2VXEA 4BI4A 2VUBA 4M78D 2RHIA 2LCLA 3V8JA 2P4TA 3G4ST 1YJ9T 4P5NA 5I2MA 4J8OA 4C8QA 2BUDA 2RJFA 3LYIA 5LJ3h 4F7UF 4BY6B 1D3BA 2QQRA 3DB4A 1I5LA 3F70A 2H3JA 4FL6A 3C4SA 1BI0A 4JRPA 1Q81U 4M7AG 1VQ7A 4M7DA 1M8VA 4BD3A 1B34B 3FEOA 2JUFA 2JOYA 4PKCC 5GANf 2PUOB 1QVPA 3FC3A 3EFSA 2WSFE 4C92E 1UGSB 4Z02A 3L2WA 4R55A 2QA4T 5C6SA 4QW2A 1VQ9A 1JRIA 2ZZDA 4M75B 5L8RE 3JAME 2DAQA 1VQOA 2DJZA 3VJPA 2DK3A 2RA2A 3BW1A 3RMSA 2QEXA 1VQMT 2XDDA 3CCLA 3RESA 5LJ5d 2D9TA 2QQ9A 4BE0A 3QIIA 3CCLT 3PMTA 3HFOA 4MZPA 3WVEB 1R8OB 1M9SA 2RJEA 3MHXA 4MMLA 3CCVT 3HRTA 3CBMA 5FU7C 3NFCA 5CIUA 5GAOm 3JCMf 3CCET 3X25B 5KCHA 5DY9A 1WPYA 4E7IA 1I81A 2DTHA 3EAEA 4F7UG 1VQ8T 1DJ7B 2XDBA 2R5AA 2VGNA 2ZPIB 3M55A 3QXEB 4C92D 1K8AU 1FWZA 2O4XA 3OYDA 3VV0A 2E5QA 3CC2T 1QP3A 3S3OA 3JCMJ 4B9XA 3CC2A 4HA8A 1YJNT 1VIFA 4LDXA 2M9UA 4ZGEB 3C94A 1G5VA 1HK9A 2X4YA 4PJOB 3JCMg 3HSBA 4M77G 2XU8A 4C92A 5GAOl 4IUQA 1UEBA 4C92G 1P92A 4KUIA 3X20B 2RI5A 1QVGA 4ZGDB 1VQNT 4ZTJA 3I55T 1O75A 1RL2A 4M75C 2CKKA 3GPLA 3SD4A 3GOXA 1XTDA 2QI2A 3NTKA 4OB0B 2YRVA 4JLGA 2JNGA 2KAFA 5J39A 1KD1U 1LJOA 3A8OB 4C5HA 5GAMf 4J83A 2RHZA 1K9MU 1N8RU 1KC8C 4E7JA 3QUIA 1BI1A 2RM4A 1G3TA 4M78G 3OW2S 3S6WA 4ZN1A 2QA4A 2EFIA 2DPPB 4TVRA 2CS7A 3PIOA 3HRSA 3OA6A 1KG1A 3CCMA 2DZ9A 4JLIA 3CC4T 4M7AF 2XHCA 4FU6A 2DD4A 4F7UB 1KHIA 2CZ0B 2V8IA 5A0DA 4JRQA 3V7RA 2MF2A 1Q7YU 4J6YA 4C5EA 2QQBA 1KQ1A 1M1GA 2ZPGB 3QZ5B 4PL6A 3CCST 4JRIA 4OF1A 2E12A 5FLXE 3PIPA 3CCSA 5IAYA 1VQMA 2RJDA 3QJYA 2KDSA 4XTVA 1G3SA 4J7FA 4ELZC 2MI6A 1KQSA 3JCMc 2E41A 2ZPHB 3NTHA 3G71A 1Q81C 3JSCA 3HFNA 4OVAA 2RD1A 3GNGA 4KT0E 1YHQT 2C06A 3CPFA 4M7AC 1PSFA 3LGFA 2DD5A 3CCVA 4C5IA 4C0GA 4M7DG 1BYMA 1K73C 1N9SA 4N4HA 3A8LB 3OB9A 4BDYA 3CD6A 5GAN6 1XQHA 2LT4A 2LX9A 2RHYA 1NPRA 1KQ2A 2DIQA 3OS5A 3URGA 4DOWA 2QQSA 1OI1A 2JTFA 2PQWA 5J26A 3UDCA 2O01E 3ZFJA 3OSVA 4N0AC 3HRUA 4CRIA 3I56A 1AHJB 4M77C 2A3LA 2YLBA 4M78F 1YIJA 2DXCA 4KUDK 5CO7A 3GLXA 4EDUA 3M58A 1VIEA 2EJGA 5LJ3d 1VQ5A 1NPPA 4M75G 4PJOF 2K5IA 3L2ZA 4LDWA 5CQXA 2QQAA 4GLKA 5D6XA 4EMKC 1MGQA 2IVWA 3G6EA 1VQNA 4V2SA 2NLUA 5GAN8 1UB4A 4XTUA 2P0KA 3JB9F 2VC8A 3OBWA 3Q1JA 4J5YA 1O9SA 2EQJA 2K4YA 1ZQ1A 3PFSA 4OB3B 2LQ8A 4WF2A 3SWNC 3ASKA 3OYMA 5IT9E 2GFUA 2L5QA 4C5GA 5GAN4 4FT2A 1IZ6A 3M53A 5CKBA 1HXDA 2EQKA 3FDRA 4IUTA 3J81E 1N9RA 4M77D 4ZN3A 3OYBA 2RJCA 4A4GA 2EWNA 5A0LA 2JN0A 2PVGB 5LJ3f 3N5BB 4MZMA 5AYFA 4BB7A 3CMAA 4C0DB 2CZ6B 5LJ5j 4JJNK 2XKOC 3L2RA 5LJ5h 3LGLA 1K73U 4HT8A 3CEYA 1IREB 1VQLT 4X9CA 1WJQA 4M78C 2Y4YA 2RI2A 2X4XA 4M77A 5LJ5g 2EYQA 3KBGA 5LL6S 2PU9B 4LD6A 3JRZA 2F5TX 2VV5A 2RO0A 4GY5A 2MWPA 3QJ6A 3ZBDA 1LNXA 4JUVA 4QQDA 4XTYA 3G4SA 1YJ9A 1BIAA 3C12A 1M1KU 4BI8B 1VQPT 5CKEA 4MZTA 3OYKA 2E70A 5GANg 3SFMA 3L2VA 3JB9G 3QDRB 3V7SA 5CKDA 3RERA 1YHQA 2ZCFB 4OMFB 5HKCA 3SWNA 4EMKB 5M9OA 2Y90A 3ZEHA 5J3BA 4XU0A 4M7AA 1S72T 3OYCA 1XNIA 1NJIU 5GMKl 2G3RA 5GMKj 2RH2A 3P8HA 4XK8E 5IN1A 4OP0A 2E6ZA 3JCMh 4XQ3A 4E7HA 2YHTA 3QYGB 3CCMT 4ME7A 3HKSA 4DA4A 3CC4A 2V8KA 2VXFA 3LLRA 2K5FA 2P0PA 1VQ9T 1NZ9A 1YI2T 4BUGA 5KH6A 1NJIC 3MCAB 4B9WA 3CC7A 3OMCA 4M7DD 2X4JA 3OBYA 3OYYA 4XTZA 2R58A 4M78E 1YIJT 3CC7T 2FB7A 3HPWA 2E6NA 1QP2A 1Y96A 2MMPA 2K57A 3M57A 1UGRB 4JS4A 1VQ6T 2XICA 1YITT 2XI9A 3JCMX 3OS1A 1YITA 2QXFA 3KUFA 4M78B 3MEVA 4E7LA 4IUPA 1MHNA 4FIBA 3MEWA 3VYGA 3CXCS 2HNIA 3LWIA 2EJFA 2QTXA 3INZA 4C92F 4ELYC 3CD6T 5GANe 3PNWC 3OYAA 2GCXA 2KMTA 3DLLA 1H641 3CCEA 3BFMA 2DTIA 2XIDA 2FYKA 3E1SA 4HKEA 3GNFB 1X01A 1X75C 2CGHA 2RB6A 3MO8A 4JDSA 1QW1A 3M5AA 4BACA 2LDMA 3G7ZA 3OYNA 1Q82C 4C8QB 5I21A 3NTIA 4D6WA 2R5MA 3CCRA 4HCCA 3GP8A 1Q86C 3OYIA 1YJNA 3JCMQ 5FRMA 1D3BB 5GANh 1BIBA 5GMKm 2EJ9A 3V8KA 1WQ7A 4XTWA 2L3RA 3TREA 4M7DB 4XU1A 1B34A 4IUUA 3QYHB 3JB9J 4PLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHX A;  2BKD N;  3FC3 A;  4EDU A;  4Q5W A;  4Z02 A;  2RHU A;  3BDL A;  3OMG A;  2FHD A;  3L2W A;  3OYF A;  3L2U A;  5C6S A;  4QW2 A;  1RI0 A;  3O8V A;  5D6W A;  5D6X A;  2DAQ A;  5C0M A;  5D6Y A;  2NLU A;  4IUV A;  2P0K A;  4ZTF A;  3Q1J A;  2LTO A;  3QBY A;  4N4G A;  2EQJ A;  3MET A;  2D9T A;  3PFS A;  2R57 A;  4C5E A;  3OYM A;  3QII A;  3ASK A;  5KCO A;  2JZ2 A;  2GFU A;  3PMT A;  4C5G A;  2GF7 A;  3OYH A;  2EQK A;  2K3Y A;  3FDR A;  4IUT A;  2EQM A;  2GFA A;  3E9G A;  2RJE A;  4IKF A;  3OYB A;  2RJC A;  4A4G A;  5KE2 A;  4RG2 A;  5CIU A;  5KCH A;  3L2R A;  2DIG A;  3S3N A;  3LGL A;  1KHC A;  3EAE A;  4E7I A;  4BE2 A;  2XK0 A;  2X35 A;  3CEY A;  3ME9 A;  5FRO A;  2R5A A;  4UC4 A;  1WJQ A;  2XDP A;  4II1 A;  3OYD A;  2O4X A;  2O4X B;  2RI2 A;  2X4X A;  2E5Q A;  3S3O A;  2EKO A;  2L8D A;  2X4W A;  4LD6 A;  4B9X A;  2WAC A;  3S3M A;  2LRQ A;  2BIV A;  2MWP A;  2RO0 A;  4GY5 A;  3QJ6 A;  1G5V A;  4QQD A;  2X4Y A;  2MWO A;  4HCZ A;  3OYK A;  4IUQ A;  3FLG A;  2VYT A;  2RI5 A;  3L2V A;  3P8D A;  1OZ3 A;  3UT1 A;  2M0O A;  3MEU A;  4ZTJ A;  3M9Q A;  3OYJ A;  2RI3 A;  5M9O A;  3OYG A;  1SSF A;  1OYX A;  4X34 A;  2CKK A;  3ZEH A;  3OYC A;  1XNI A;  3MP6 A;  4IUR A;  3SD4 A;  2LCC A;  3GOX A;  3NTK A;  2G3R A;  2YRV A;  2EQU A;  3H8Z A;  2M1H A;  3P8H A;  5IN1 A;  5J39 A;  2B8A A;  3MP8 A;  4A4F A;  4C5H A;  4E7H A;  4L59 A;  2RHZ A;  4PLL A;  4QVZ A;  4E7J A;  3LLR A;  3OS2 A;  3QKJ A;  5KH6 A;  4NS5 A;  4B9W A;  1WJR A;  3OMC A;  3PMI A;  4QQG A;  3S6W A;  4BDZ A;  2EFI A;  2R58 A;  5FRN A;  2E6N A;  3OA6 A;  1N27 A;  3OYL A;  3DLM A;  4A4H A;  4FU6 A;  1WJS A;  4N4I A;  3OS1 A;  2M16 A;  3KUF A;  3MEV A;  4E7L A;  5KE3 A;  4IUP A;  1MHN A;  3UWN A;  3MEA A;  4PL6 A;  3OYE A;  3MEW A;  4BE0 A;  3OQ5 A;  4QQ6 A;  1WGS A;  3E9F A;  5IAY A;  2RJD A;  2IG0 A;  1OZ2 A;  4A4E A;  3PNW C;  3OYA A;  3NTH A;  3H6Z A;  3L42 A;  2K3X A;  3DB3 A;  3L2Q A;  4OVA A;  2HQX A;  1H3Z A;  2HQE A;  3LGF A;  3OS0 A;  4C5I A;  3MO8 A;  2RHI A;  4PLI A;  3LH0 A;  4BAC A;  2LDM A;  3OYN A;  4N4H A;  3OB9 A;  4BDY A;  2BUD A;  2RJF A;  3LYI A;  3NTI A;  2R5M A;  2RHY A;  3OYI A;  5FRM A;  2DIQ A;  2QQR A;  3DB4 A;  3MP1 A;  2L89 A;  4E7K A;  2JTF A;  1OI1 A;  2PQW A;  2QQS A;  3C4S A;  3F70 A;  2L3R A;  4FL6 A;  5J26 A;  4CRI A;  3LX7 A;  4BE1 A;  4BD3 A;  4IUU A;  2F5K A;  3OY9 A;  3FEO A;  2LVM A; 
#chains in the Genus database with same CATH topology
 1W2B A;  1VQ5 Q;  4LD9 K;  2DNU A;  3C0C A;  4C8Q E;  4M75 A;  2DXT A;  5FW9 A;  1WNL A;  1N8R C;  5EC7 A;  1JQQ A;  1VQ8 Q;  4KRT A;  2K3Y A;  2D1X A;  3RMQ A;  3AHU A;  3E9G A;  1NEG A;  4E47 A;  2WSE E;  2K2V A;  5KE2 A;  5GAN 5;  4LDV A;  3M0T A;  2MAM A;  2YLC A;  2X35 A;  5KYW A;  3ME9 A;  3CXC A;  1G3W A;  2XMF A;  3L1A A;  3J80 E;  2I2L A;  1RAD B;  4X9D A;  4HVW A;  2EKO A;  2X4W A;  5CVI A;  2DXB A;  2LRQ A;  2BIV A;  3VUZ A;  1JJ2 S;  2EW3 A;  1OPK A;  1OZ3 A;  3UT1 A;  4OML A;  4AFZ C;  2M51 A;  3ULR B;  2RI3 A;  5GAM e;  4F7U E;  4JJD A;  2HKN A;  3PE0 A;  2V26 A;  4PJO D;  1Q7Y C;  1WXU A;  2EYX A;  3MP8 A;  2B86 A;  2X9H A;  1TH7 A;  2PUK B;  1QVF P;  5A0G A;  3I5R A;  2MCN A;  2OTL T;  2GBQ A;  3CPW A;  3M54 A;  2LJ1 A;  3FIF A;  1UFF A;  2F1L A;  1SG5 A;  1XOV A;  1QCF A;  3EG0 A;  3X26 B;  2DM1 A;  2K3X A;  2MPX C;  3A8H B;  5CAI A;  3VS0 A;  1H8K A;  1QKW A;  4J9B A;  1N6A A;  4C0Z A;  2ZAE A;  1Z9Q A;  1H92 A;  3QHS A;  1BU1 A;  4M7A E;  1W4S A;  4QVD A;  1ZX6 A;  3CCJ T;  1QVG S;  2E5K A;  2JMA A;  2XD0 A;  3FJ5 A;  2F5K A;  1Q95 G;  2NUT B;  1ZSZ C;  2JTE A;  4F04 B;  1LCK A;  4LNP A;  1C1A A;  4L5G A;  4HCK A;  5GAN j;  4RTX A;  2F69 A;  1I8F A;  2JM9 A;  2D0Q B;  1MMD A;  1X27 A;  3RKW A;  4RKU E;  2PVD B;  2EAY A;  1Y7X A;  2KSS A;  3H41 A;  1QQJ A;  1K73 R;  4L6V 5;  1ZA2 B;  3G71 T;  3S3N A;  1VQP A;  1Q86 U;  1KHC A;  2LQK A;  5HY6 A;  5FRO A;  1W2B S;  2XDP A;  5LJ3 j;  3WXM B;  1GCQ A;  1U5S A;  3BY7 A;  4E6R A;  5LJ5 f;  4C8Q C;  3JCM P;  4FT4 A;  2CSI A;  2Z0W A;  4PK4 A;  4N0A A;  3J7A F;  1PSE A;  3IQL A;  2DER A;  3E19 A;  4ORZ A;  3CME T;  3M9Q A;  1U8R A;  2DVE A;  1SSF A;  2CP5 A;  5HK0 A;  1N8R R;  4FW1 A;  4OB2 B;  2ZPF B;  2YUN A;  1GRI A;  2RQT A;  4L59 A;  3O5Z A;  4QVZ A;  3KXT A;  5GAO p;  4NOY A;  2DZC A;  1PKS A;  3EGU A;  2HBP A;  3FJP A;  2E10 A;  3PMI A;  1ZSZ A;  1IGU A;  2BTT A;  2DVJ A;  5KYX B;  1LOJ A;  4C8Q F;  4N4I A;  4M78 A;  2DO3 A;  2PVO B;  4DBH A;  3UWN A;  2O2O A;  3WVD B;  3E9F A;  2IG0 A;  4Z8A A;  4GLM A;  3VS4 A;  3I55 A;  4M7A D;  3L2Q A;  5FU6 B;  5KYY A;  2VUB A;  2RQU A;  1ABO A;  2LCL A;  2RHI A;  2P4T A;  2HEQ A;  4J8O A;  3LYI A;  3RDV A;  4F7U F;  3EG2 A;  2QQR A;  3DB4 A;  3EG9 A;  4FL6 A;  3VS3 A;  4JRP A;  1VQ7 A;  4M7D A;  1NYF A;  1B34 B;  4PKC C;  1KK7 A;  2PUO B;  1QVP A;  3FC3 A;  4Z02 A;  1VQ9 A;  4M75 B;  5L8R E;  2DAQ A;  2FRW A;  3RMS A;  2LNH B;  4BE0 A;  3QII A;  4MZP A;  5FWC A;  2X51 A;  1MV3 A;  2RJE A;  3MHX A;  4MML A;  3CCV T;  2CRE A;  3HRT A;  1K8A R;  2QG9 B;  5GAO m;  3JCM f;  5KYW B;  1VQ8 T;  2XDB A;  4C92 D;  2RNA A;  2ZPI B;  1K8A U;  2X3X D;  2DJQ A;  2CT3 A;  2DL8 A;  3S3O A;  2L3S A;  3SHW A;  2MOX A;  4RUG A;  4ZGE B;  3UF4 A;  1G5V A;  1HK9 A;  2X4Y A;  3HSB A;  2XU8 A;  4JJB A;  2CKK A;  1HD3 A;  3RNJ A;  1XTD A;  2E3I A;  1BCO A;  4JLG A;  1WXB A;  1LJO A;  3A8O B;  4C5H A;  5GAM f;  4M78 G;  4QKU A;  3CCU Q;  4TVR A;  3CCV Q;  3HRS A;  2BZY A;  4JLI A;  2XHC A;  4FU6 A;  1Q7Y U;  1VQM Q;  4PJJ A;  3PIP A;  1VQM A;  4FW2 A;  3QJY A;  2KDS A;  4ELZ C;  1G3S A;  1KQS A;  2MI6 A;  2YDL A;  3JCM c;  2C06 A;  2JMC A;  3GNG A;  3CPF A;  1PSF A;  1LPL A;  4ESR A;  3CCV A;  1D1C A;  2CUB A;  4C0G A;  1BYM A;  1N9S A;  2DET A;  4JJC A;  2RHY A;  1NPR A;  5GJV B;  1D09 B;  2LJ0 A;  2PQW A;  2QQS A;  4QT7 A;  3ZFJ A;  1M27 C;  3HRU A;  2NUT A;  2YLB A;  1MMG A;  2SEM A;  1K76 A;  5CO7 A;  1FYN A;  4EDU A;  1VIE A;  2EJG A;  5LJ3 d;  4PJO F;  4EMK C;  2PZ1 A;  4GLK A;  1MGQ A;  5GAN 8;  1UB4 A;  2P0K A;  4DEX A;  2VC8 A;  1WZO A;  1EZZ B;  3Q1J A;  2KNB B;  4C5E A;  4OB3 B;  3OYM A;  5CKB A;  4IUT A;  1YFN A;  2VVK A;  4JZ4 A;  4M77 D;  3NHN A;  4PJN A;  1FMW A;  5LJ3 f;  3N5B B;  4BB7 A;  5LJ5 h;  2LP5 A;  3LGL A;  1UJ0 A;  2KRS A;  1K73 U;  4Z88 A;  1IRE B;  3VS2 A;  1WJQ A;  4IIO A;  3KBG A;  3CCQ Q;  4LD6 A;  4GY5 A;  5GJW B;  1LNX A;  4XTY A;  1X6B A;  1YJ9 A;  1BIA A;  3C12 A;  3D7S B;  1VQP T;  2E70 A;  3L2V A;  2ROT A;  2JXB A;  3SWN A;  4X1V A;  5M9O A;  1NJI R;  5J3B A;  4XU0 A;  1TUC A;  4J9H A;  1NJI U;  2GTJ A;  3UAT A;  2L0A A;  3EHQ A;  3P8H A;  4XK8 E;  4OP0 A;  2E6Z A;  1AWO A;  2EYZ A;  2FPF A;  1W6X A;  4E7H A;  3CCM T;  3LLR A;  2DBK A;  2P0P A;  2D0N A;  1VQ9 T;  2DL3 A;  2M0Y A;  1YJ9 Q;  2X4J A;  1MMA A;  3CC7 T;  1ZSZ B;  2FB7 A;  1CKB A;  2O31 A;  1VQ6 T;  1YP5 A;  1QLY A;  3UA6 A;  2XI9 A;  3JCM X;  1YIT A;  2QXF A;  4M78 B;  2FZG B;  4FIB A;  3MEW A;  2HNI A;  2KI7 A;  1E7O A;  3PNW C;  2GCX A;  2KMT A;  1WHH A;  2FYK A;  1M30 A;  4HKE A;  1X01 A;  1D0Z A;  2CGH A;  2QAZ A;  4HCC A;  1Q86 C;  1BIB A;  1RAA B;  5GMK m;  3TRE A;  1YN8 A;  4M7D B;  1B34 A;  4IUU A;  3JB9 J;  4PLL A;  2HSP A;  2LZ6 B;  2OAU A;  2ZPB B;  5C0M A;  3EH1 A;  2QDL A;  3CQT A;  2JM8 A;  5GMK i;  2DTO A;  5LJ5 e;  1BKB A;  3CBP A;  4C8Q D;  4RG2 A;  4R56 A;  2A7Y A;  3M4G A;  4YTL A;  4BY6 C;  2XK0 A;  2ED1 A;  1VQP Q;  3PTA A;  2D8H A;  1EIF A;  2GQV A;  3HL8 A;  3VKI A;  3S3M A;  2EGE A;  1Q82 U;  1IXD A;  2ZPE B;  4LUE A;  2PNI A;  6AT1 B;  5HK3 A;  2E65 A;  3MJX A;  3FLG A;  1AD5 A;  3P8D A;  2RQV A;  2F2V A;  4ANJ A;  3TCJ A;  3A8G B;  2FVU A;  5FU6 C;  2FG0 A;  1M4Z A;  5GAM h;  3PVL A;  3JCM b;  1VQL Q;  3TEE A;  2EIF A;  4E7S A;  1AT1 B;  3CMA Q;  3G6E T;  3UPU A;  2A0F B;  2JJ9 A;  3LW5 E;  2CYZ B;  2KVQ G;  5FRN A;  1ACM B;  4LDY A;  1N27 A;  1PHT A;  5GAM j;  3THK A;  1WJS A;  4F7U A;  1OQK A;  1HJD A;  1UGQ B;  2BE9 B;  1V1C A;  1YIJ Q;  5EG2 A;  4A4E A;  4ATO A;  1VQ4 A;  3I56 Q;  2RMO A;  1NM7 A;  3M59 A;  3R6N A;  1D0Y A;  4FSX A;  4CI0 C;  1VQ5 T;  1ZHI A;  2O9V A;  3EHR A;  2E64 A;  2HCK A;  2FL7 A;  1WFW A;  1NG2 A;  5DLQ E;  4Y91 A;  2L89 A;  1PCX A;  2KRO A;  5IH2 A;  1SSH A;  1GCQ C;  4DOV A;  1JB0 E;  2K9G A;  1BI3 A;  1BK2 A;  1I1J A;  3EGD B;  4Q5W A;  2YXY A;  1K9A A;  4OMP A;  4RCC A;  3L2U A;  2LCS A;  4LUD A;  3T9N A;  1VQ7 T;  2DL7 A;  4J9G A;  4FCY A;  1V76 A;  2LTO A;  2AHJ B;  2R57 A;  4M7D F;  1Z9Z A;  1KQS P;  1WA7 A;  3LWH A;  4O5V A;  2DMO A;  1M1F A;  3I55 Q;  1EX4 A;  1NBE B;  2KK4 A;  3VYH B;  5GMK h;  3AT1 B;  3V8L A;  2L8D A;  1B07 A;  1R77 A;  1E6H A;  4M77 E;  1VQ8 A;  2MWO A;  3VUB A;  1QVG P;  3JCM W;  5FWB A;  1UJY A;  2K5L A;  3I56 T;  3A1P A;  2CZ1 B;  3SWN B;  4M7A B;  4JZ3 A;  2KRM A;  3M0Q A;  2J05 A;  4J6W A;  2BE7 D;  2M1H A;  2GQI A;  4FM4 B;  2M02 A;  2FZC B;  1G3Y A;  2JS0 A;  4NS5 A;  5GAO n;  1WJR A;  4F14 A;  3CCL Q;  2YT6 A;  4AG2 C;  1Q82 R;  1ZBJ A;  1WXT A;  2M16 A;  4FYX B;  2LC4 A;  2EVR A;  3CCR T;  3M4Y A;  1OOT A;  2HBW A;  3A5Z B;  3VS6 A;  4C0D C;  3H6Z A;  3DB3 A;  1MMN A;  2D6F A;  2HQE A;  3HHT B;  8ATC B;  4BI4 A;  4CC2 A;  3V8J A;  1PKT A;  5I2M A;  5LJ3 h;  2RJF A;  3VS1 A;  4BY6 B;  2LX7 A;  4D8K A;  1BI0 A;  4DBF A;  4BD3 A;  3FEO A;  5L23 A;  2YSQ A;  5GAN f;  1FMV A;  2QA4 T;  5C6S A;  4QW2 A;  1UTI A;  2ZZD A;  1QWF A;  3VJP A;  1OX9 A;  1JXM A;  1VQM T;  3RES A;  3HFO A;  2X3W D;  1PWT A;  4J9D A;  5FU7 C;  2FO0 A;  3CCE T;  3X25 B;  1D0X A;  4EIK A;  1SF9 A;  1I81 A;  3EAE A;  4F7U G;  3NPF A;  1AOJ A;  2VGN A;  3M55 A;  3QDF A;  1FWZ A;  3OYD A;  2E5Q A;  1QP3 A;  1A0N B;  1YWP A;  1LVK A;  5AT1 B;  2LQW A;  3JCM J;  1Y0M A;  1YJN T;  2OAW A;  1VIF A;  1C6V X;  3C94 A;  2QAS A;  1ZLM A;  3JCM g;  5IXF A;  5GAO l;  4KUI A;  1RAC B;  3X20 B;  1QVG A;  2YUP A;  1VQN T;  2YUO A;  4AMC A;  1RL2 A;  2ECZ A;  2QI2 A;  4OB0 B;  2GNC A;  2JNG A;  2KAF A;  1KD1 U;  1AZG B;  1K9M U;  2EYY A;  2RHZ A;  1OU9 A;  1N8R U;  1JO8 A;  2K3B A;  2GTO A;  3S6W A;  4RTU A;  2J7I A;  4RTV A;  3CXC P;  1KJW A;  3OA6 A;  3CCM A;  1WHJ A;  4F7U B;  1KHI A;  2V8I A;  3EFO B;  4J6Y A;  3CCS T;  1M1G A;  3VRZ A;  2ZPH B;  3G71 A;  1Q81 C;  1ARK A;  2KT1 A;  1Q86 R;  3HFN A;  4OVA A;  1YHQ T;  4FYV B;  4M7A C;  2LMJ A;  2DD5 A;  2D8J A;  1K73 C;  4N4H A;  3CD6 A;  5GAN 6;  1XQH A;  2LT4 A;  1KQ2 A;  2JTF A;  1OI1 A;  4CRI A;  4N0A C;  1AHJ B;  1AZE A;  4J9I A;  2DXC A;  4KUD K;  3EGD A;  3GLX A;  3VS7 A;  3M58 A;  1VQ5 A;  1NPP A;  5KYU A;  2K5I A;  3L2Z A;  1T0J A;  4V2S A;  2IVW A;  4XTU A;  1VYU A;  1ZQ1 A;  2RF0 A;  4WF2 A;  3SWN C;  5IT9 E;  4C5G A;  4FT2 A;  3M53 A;  1HXD A;  2C0I A;  4CC7 A;  3CC2 Q;  4ZN3 A;  3OYB A;  2RJC A;  4A4G A;  2J6K A;  2PVG B;  1G8X A;  1OUL A;  5LJ5 j;  4JJN K;  3CEY A;  1RAG B;  4X9C A;  2OX7 A;  4M78 C;  2Y4Y A;  2RI2 A;  3EGX B;  2IIM A;  1K1Z A;  5LJ5 g;  2EYQ A;  4KH0 B;  3JRZ A;  4WCI A;  2MWP A;  3ZBD A;  1VA7 A;  3CC7 Q;  2ENM A;  1M1K U;  1X69 A;  4AG1 C;  5CKE A;  3OYK A;  3SFM A;  1SEM A;  3JB9 G;  3V7S A;  5CKD A;  3CC4 Q;  1YHQ A;  4E7Z A;  2EGC A;  2Y90 A;  4M7A A;  1S72 T;  1MV0 B;  2RH2 A;  5IN1 A;  2YHT A;  3QYG B;  3HKS A;  3CCM Q;  1I07 A;  2K5F A;  7AT1 B;  1YI2 T;  2YRD A;  3G4S Q;  1CKA A;  4M7D D;  3OBY A;  1BCM A;  2R58 A;  2MMP A;  2K57 A;  1UGR B;  2F2X A;  1ZA1 B;  3KUF A;  4E7L A;  1MHN A;  1BB9 A;  1W70 A;  3LWI A;  2NWM A;  3CD6 T;  1SPK A;  4ELY C;  2E4H A;  3OYA A;  3DLL A;  3CCE A;  5IHN A;  2DTI A;  2XID A;  2CP6 A;  2DLP A;  3GNF B;  1ZSG A;  4JDS A;  3CCR Q;  3G7Z A;  4C8Q B;  3NTI A;  2R5M A;  3CCR A;  1M2V B;  3OYI A;  1YJN A;  1D3B B;  2EJ9 A;  3V8K A;  2L3R A;  3QYH B;  4CC4 B;  1ZUY A;  4EPC A;  1U1S A;  2RHU A;  4CC3 A;  2CT4 A;  1K9M C;  3FB9 A;  4ZTF A;  1TWB A;  1M2O A;  5GAO r;  3QBY A;  4OGC A;  2JZ2 A;  2GF7 A;  1S72 A;  5GAN 7;  4M75 D;  2FPD A;  1TG0 A;  1D1B A;  4D8D A;  1YBY A;  2OI3 A;  2DRK A;  2DXU A;  1MNE A;  1UGP B;  4NL3 A;  1YI2 A;  4UC4 A;  3H0I A;  3X24 B;  2O4X B;  1YJW T;  1X6O A;  2EYW A;  2QK0 A;  2EBP A;  4OMM A;  4EMG A;  3ER0 A;  4HCZ A;  4C92 B;  1WHG A;  3E2U A;  2VYT A;  4J9F A;  4AFQ C;  4C8Q G;  2RK1 A;  1PD0 A;  3MEU A;  3VU3 C;  3V7C A;  2QYZ A;  2KEA A;  3MP6 A;  3REB B;  1TOV A;  1YCY A;  2EQU A;  2HZY A;  3H8Z A;  3QWX X;  2FEI A;  5IHI A;  1RLQ C;  2QEX T;  2ZGW A;  3RKX A;  1X2K A;  2C0O A;  2DYB A;  4QQG A;  4BDZ A;  2OTL A;  1W1F A;  4M7D E;  2AZV A;  2QTV A;  4J7I A;  4RCB A;  1X2Q A;  3CME Q;  3ZL7 C;  3EFO A;  3CBO A;  4RMO A;  3JV3 A;  1PM3 A;  1K0S A;  3OYE A;  4PJO C;  3MEA A;  3C95 A;  3SDZ A;  1M90 U;  3PGG A;  2RPN A;  4PJM A;  1ABQ A;  3KFV A;  2EPD A;  2JTM A;  2W0Z A;  2EQI A;  1H3Z A;  2LT1 A;  1M1K C;  1QVF A;  5FU7 B;  2CUD A;  3LH0 A;  5GAM d;  3JB9 H;  1VQK T;  1KIK A;  1VOM A;  1RLP C;  2KXD A;  5GMK e;  3MP1 A;  2QEX Q;  4LDU A;  2OTJ T;  1TSF A;  2DEQ A;  5GAN 2;  4BE1 A;  3LX7 A;  1OEB A;  1YJW A;  1M5Q 1;  2XG8 D;  2RHX A;  3BDL A;  1OX8 A;  4F16 A;  5ECA A;  3OYF A;  4MMK A;  5KYU B;  4AT1 B;  2E3H A;  2HQH A;  5D6Y A;  1IB8 A;  1WQW A;  3OSS C;  4IUV A;  3EH2 A;  4PNO A;  2AK5 A;  1BI2 A;  3MET A;  2KXC A;  4FSS A;  5KCO A;  1ZUU A;  3QG1 A;  4O6J A;  3EFR A;  1UGV A;  2CH4 A;  3VRY A;  4IKF A;  3R6O A;  3CCJ Q;  3CPW S;  3JCM d;  3BDU A;  3JCM V;  2DIG A;  2SRC A;  2P0Q A;  2CZ7 B;  2AKK A;  4M75 F;  3EGX A;  3NMZ C;  4M77 B;  4NL2 A;  4OGE A;  3OW2 A;  2DYI A;  3CCQ T;  2BZ8 A;  4Y28 E;  5CK9 A;  5LJ3 g;  2OTJ Q;  2H3E B;  1SRL A;  4JS5 A;  1OYX A;  2LCC A;  1K0X A;  4LXC A;  3RKY A;  5CKH A;  5GAO q;  2B8A A;  1TXQ A;  3REA B;  1V29 B;  1KD1 C;  4DEY A;  1JBM A;  3QSU A;  3QKJ A;  2L3Q A;  4A54 A;  5CQY A;  2ATC B;  3OYL A;  3DLM A;  1B7T A;  5DLO A;  3NGP A;  1Y07 A;  1U1T A;  2VWF A;  1SKU B;  2LNV A;  4C92 C;  1VQL A;  1T0H A;  2KT8 A;  4QQ6 A;  1WGS A;  1VQK A;  1OZ2 A;  1JXO A;  3L42 A;  1M8M A;  1VQ6 Q;  2HQX A;  1I4K 1;  2DX1 A;  2VXE A;  4M78 D;  3G4S T;  4C8Q A;  1M1K R;  2COW A;  2BUD A;  2PTK A;  1M2V A;  1D3B A;  1I5L A;  3F70 A;  1M8V A;  2JUF A;  3MKD A;  3EFS A;  1HSQ A;  2YUQ A;  4R55 A;  2COY A;  1JRI A;  2CSQ A;  2P4R A;  1VQO A;  2DJZ A;  3BW1 A;  3QWY A;  3M0U A;  3RR6 A;  3CCL A;  5LJ5 d;  2KBT A;  2QQ9 A;  3PMT A;  1M9S A;  1TS9 A;  2RQR A;  3CBM A;  4M4Z A;  5CIU A;  5KCH A;  1Y57 A;  4E7I A;  2R5A A;  3QXE B;  1QWE A;  2O4X A;  5KYN A;  3CC2 T;  4B9X A;  2DF6 A;  1W2B P;  4LDX A;  2M9U A;  2P84 A;  4PJO B;  2RN8 A;  4M77 G;  4C92 A;  1UEB A;  2RI5 A;  4ZGD B;  2KYB A;  4ZNX A;  1O75 A;  2L3P A;  2K6D A;  4HVV A;  4M75 C;  1X43 A;  2QGF B;  4DBQ A;  2J06 A;  2YRV A;  1YIT Q;  1G83 A;  4J83 A;  1KC8 C;  4E7J A;  1IHV A;  1BI1 A;  2RM4 A;  1KC8 R;  1JEG A;  1D1A A;  3OW2 S;  4ZN1 A;  2QA4 A;  2CS7 A;  4R0K A;  1YNZ A;  3PIO A;  1KG1 A;  4M7A F;  1RAE B;  1U06 A;  2IPO B;  5A0D A;  3M0S A;  4J9C A;  2AT1 B;  2QQB A;  1KQ1 A;  2ZPG B;  4OF1 A;  3CCS Q;  5FLX E;  4PFO A;  3CCS A;  3I35 A;  1K4U S;  4LN2 A;  3NTH A;  3JSC A;  4M7D G;  2LJ3 A;  3A8L B;  4BDY A;  2LX9 A;  1R0C B;  2DIQ A;  1AVZ C;  2V1Q A;  3OS5 A;  3URG A;  4DOW A;  1T3L A;  5J26 A;  2O01 E;  3I56 A;  1M3B A;  1VQ4 Q;  2A3L A;  4J9E A;  2O88 A;  4M78 F;  1MUZ A;  1AWX A;  1YIJ A;  1SHF A;  1NYG A;  4KH1 B;  2J6O A;  4LDW A;  1N5Z A;  1ZUK A;  1VQN A;  2NLU A;  2DL5 A;  3OBW A;  1RI9 A;  1WHM A;  1UDL A;  1U3O A;  1O9S A;  2EQJ A;  2K4Y A;  2LQ8 A;  2GFU A;  5GAN 4;  1IZ6 A;  3J81 E;  4FYW B;  1N9R A;  3CMA A;  4MZM A;  2HL3 A;  3L2R A;  3H0H A;  4HT8 A;  1PC0 A;  2X4X A;  4M77 A;  1IO6 A;  1OPL A;  2FZK B;  2COZ A;  2FRY A;  2VV5 A;  2RO0 A;  3QJ6 A;  2NUZ A;  4JUV A;  4QQD A;  1S1N A;  4KGV B;  1QKX A;  4AFS C;  3RER A;  8AT1 B;  2ZCF B;  5HKC A;  1VQO Q;  3ZEH A;  3SEM A;  5GMK l;  2G3R A;  4XQ3 A;  4DA4 A;  4RTW A;  1Q7Y R;  2V8K A;  3GBQ A;  1NLP C;  2CH4 W;  3H9N A;  1PRL C;  4BUG A;  5KH6 A;  4PFZ A;  4RTT A;  3OMC A;  3OYY A;  4XTZ A;  1YIJ T;  3HPW A;  2XIC A;  1GFC A;  1YIT T;  2KRN A;  1M90 R;  2RQW A;  2EJF A;  2QTX A;  3INZ A;  4HVU A;  5GAN e;  2F2W A;  2MIO A;  1H64 1;  3E1S A;  4FYY B;  2RB6 A;  1X75 C;  2NUP A;  1QW1 A;  3M5A A;  4BAC A;  2GGR A;  1Q82 C;  5I21 A;  1OV3 A;  1JJ2 P;  5IHK A;  1GCP A;  1PG5 B;  1WQ7 A;  1VQN Q;  1RAB B;  1CSK A;  2BKD N;  2C0T A;  1M90 C;  3A8M B;  3M0P A;  3OMG A;  1JJ2 A;  5D6W A;  3RIR A;  4M77 F;  4M75 E;  2ED0 A;  1UG1 A;  1KQS S;  3PT9 A;  3U23 A;  2J6F A;  4N4G A;  4XU2 A;  3TU4 K;  1QVF S;  1M3A A;  4RTY A;  2A08 A;  1HYO A;  1SHG A;  2EQM A;  2GFA A;  1WIE A;  1ZBX A;  9ATC B;  1VQO T;  2JVV A;  3SB2 A;  1QCN A;  2KY9 A;  4C0F A;  1TUD A;  1AEY A;  4II1 A;  1GXI E;  1TTH B;  2KQW A;  3CCJ A;  5GAN 3;  3M56 A;  2HAX A;  1K8A C;  4JPB W;  2QA4 Q;  4M7D C;  4PJO A;  2FPE A;  3CCQ A;  2M0O A;  3FRN A;  2MYS A;  5CR2 A;  3OYG A;  1C0M A;  1UEC A;  3QPH A;  3MPU B;  1FX7 A;  4IUR A;  4A4K A;  3CCU T;  1GBR A;  5CKF A;  2QDY B;  1YJW Q;  3EG3 A;  3DKM A;  4MDW A;  3JB9 D;  3GF5 A;  2K79 A;  5GAN d;  3OS2 A;  1FMK A;  5LJ3 e;  1IRX A;  2VGM A;  1NE8 A;  4OMQ A;  4A4H A;  1T3S A;  2KGT A;  1QCO A;  3OQ5 A;  3GIB A;  4OMN A;  1KSW A;  4DQ2 A;  3QO3 A;  1FXX A;  3CME A;  1VQ4 T;  4XAX B;  3TVT A;  5GAM g;  3OS0 A;  1H3H A;  2QGG A;  3I9Q A;  4PLI A;  1Y71 A;  2OTL Q;  5CCA A;  4IIM A;  2ABL A;  2DFU A;  4E7K A;  5I2S A;  1WYX A;  4WTO B;  3OY9 A;  2LVM A;  2DEU A;  2FHD A;  1X6G A;  2WSC E;  3JCM e;  1RI0 A;  3O8V A;  4J6X A;  3CMA T;  4XU3 A;  2YRC A;  2NYS A;  4A53 A;  1G2B A;  2DL4 A;  3CCU A;  2HMA A;  2AZS A;  3OYH A;  2V1R A;  1VQ6 A;  2E1H A;  4ZGJ B;  1RAH B;  4BI3 A;  1YI2 Q;  1VQK Q;  4BE2 A;  2MK5 A;  1E6G A;  3BE3 A;  4PJO G;  1Q81 R;  5A2Q E;  4KUL A;  4OB1 B;  2WAC A;  1S72 Q;  1GFD A;  3JB9 I;  2DA9 A;  1VUB A;  1VYV A;  3I5S A;  1GBQ A;  2HD0 A;  4EMH A;  4PJL A;  5DM7 R;  1KC8 U;  3OYJ A;  4EMK A;  2BZX A;  2JW4 A;  4X34 A;  3P8B B;  4JRK A;  2LQN A;  1KFZ A;  2Y4X A;  4A4F A;  4XTX A;  4HCB A;  4RG8 A;  2OTJ A;  3HP9 A;  1YJN Q;  4PFP A;  2RK2 A;  3CPW P;  1Y96 B;  2DKG A;  2ESW A;  4VUB A;  4MDX A;  4HT9 A;  3PVQ A;  4PJO E;  3CCE Q;  5KE3 A;  1VQ9 Q;  2V8J A;  4KGZ B;  4KBM B;  4QVC A;  2I0N A;  1OU8 A;  3QZ9 B;  1VQ7 Q;  3X28 B;  3RUX A;  4RTZ A;  2NUP B;  1YJ9 T;  4P5N A;  2CP7 A;  1AWW A;  1MND A;  2H3J A;  3C4S A;  1Q81 U;  4M7A G;  2JOY A;  2K2M A;  1I0C A;  2WSF E;  1UGS B;  4C92 E;  4HXJ A;  3RBB B;  4Z89 A;  3L2W A;  3JAM E;  2KR3 A;  2DK3 A;  2RA2 A;  2QEX A;  2AKL A;  2XDD A;  2D9T A;  3CCL T;  2EKH A;  3WVE B;  1XJW B;  1R8O B;  1I5O B;  1WHK A;  1TU0 B;  2A28 A;  2HL5 C;  3NFC A;  1WX6 A;  1TUG B;  5DY9 A;  1WPY A;  2DTH A;  1DJ7 B;  1PNJ A;  3VV0 A;  2EGA A;  3CC2 A;  4HA8 A;  2A36 A;  2G6F X;  4IUQ A;  4C92 G;  1P92 A;  2DE0 X;  3TQ7 P;  2HKQ B;  4ZTJ A;  3I55 T;  1UHC A;  1K9M R;  3GPL A;  3SD4 A;  3GOX A;  2A37 A;  3NTK A;  1KD1 R;  5J39 A;  1WHL A;  3QUI A;  1G3T A;  1EFN A;  3G1J A;  3CD6 Q;  2EFI A;  2DPP B;  2H8H A;  2DBM A;  2DZ9 A;  3CC4 T;  2VB6 A;  1WLP B;  2DD4 A;  4JRQ A;  2CZ0 B;  3G71 Q;  3V7R A;  2MF2 A;  2L2P A;  2ROL A;  4OMO A;  4PL6 A;  3QZ5 B;  1SRM A;  4JRI A;  2E12 A;  5HCK A;  5IAY A;  1PD1 A;  2RJD A;  4XTV A;  4J7F A;  1PRM C;  2E41 A;  2RD1 A;  4KT0 E;  3LGF A;  4C5I A;  3TSW A;  2KE9 A;  1F1B B;  3OB9 A;  2DRM A;  2VAS A;  3VS5 A;  5I22 A;  1UUE A;  3UDC A;  3OSV A;  3TSZ A;  4M77 C;  4DBR A;  2AIR B;  1BBZ A;  1RAI B;  4M75 G;  5CQX A;  2QQA A;  5D6X A;  3G6E A;  1R0B G;  4AFU C;  3JB9 F;  1WDX A;  4E2F B;  2CP0 A;  4J5Y A;  3OW2 P;  1UHF A;  3PFS A;  1J3T A;  3ASK A;  2L5Q A;  1UE9 A;  5I11 A;  2EQK A;  3FDR A;  3M0R A;  4K11 A;  4F17 A;  2EWN A;  5A0L A;  2JN0 A;  5AYF A;  3G6E Q;  3UA7 A;  2CZ6 B;  4C0D B;  1M3C A;  2XKO C;  3H0F A;  1VQL T;  2CDT A;  4Y92 A;  2VKN A;  2W10 A;  5LL6 S;  2PU9 B;  2F5T X;  2YWW A;  3G4S A;  4BI8 B;  4MZT A;  5GAN g;  3QDR B;  1WI7 A;  4KGX B;  2KYM A;  2OJ2 A;  4OMF B;  4EMK B;  4B6M A;  3OYC A;  1XNI A;  1YWO A;  1IHW A;  5GMK j;  3JCM h;  4ME7 A;  1YHQ Q;  3CC4 A;  1B3Q A;  2CP2 A;  2VXF A;  2O9S A;  1NZ9 A;  1NJI C;  3MCA B;  4B9W A;  3CC7 A;  1GL5 A;  1NEB A;  1JU5 C;  1RAF B;  4M78 E;  2E6N A;  1QP2 A;  1Y96 A;  2JS2 A;  3EG1 A;  3M57 A;  4JS4 A;  3HTR A;  5KYX A;  3OS1 A;  3LH5 A;  3MEV A;  1AWJ A;  4IUP A;  3A98 A;  3CXC S;  3VYG A;  4LE9 A;  4C92 F;  1NLO C;  1VYT A;  3BFM A;  5KYY B;  1RUW A;  3MO8 A;  4GBQ A;  2JT4 A;  2LDM A;  3OYN A;  1QMC A;  2HSE B;  2DIL A;  4D6W A;  3GP8 A;  5D7U A;  2K7A A;  1IGQ A;  3JCM Q;  5GAN h;  5FRM A;  3EG9 B;  2HDA A;  4XTW A;  2CP3 A;  4XU1 A;  1YCS B;  4A63 B;  5IXB A; 
#chains in the Genus database with same CATH homology
 1W2B A;  2BKD N;  4EPC A;  1M90 C;  1U1S A;  4LD9 K;  3A8M B;  2RHU A;  3OMG A;  4C8Q E;  1JJ2 A;  2OAU A;  4M75 A;  5D6W A;  3RIR A;  2ZPB B;  4M77 F;  2DXT A;  4M75 E;  5C0M A;  1K9M C;  3FB9 A;  1WNL A;  1N8R C;  1KQS S;  3PT9 A;  4ZTF A;  5GAO r;  3QBY A;  4N4G A;  5GMK i;  4XU2 A;  3TU4 K;  2DTO A;  1QVF S;  4OGC A;  2JZ2 A;  5LJ5 e;  2GF7 A;  1BKB A;  2K3Y A;  1S72 A;  3RMQ A;  2EQM A;  2GFA A;  5GAN 7;  3AHU A;  1ZBX A;  3E9G A;  4M75 D;  4E47 A;  2WSE E;  2K2V A;  3CBP A;  5KE2 A;  1YBY A;  4RG2 A;  4C8Q D;  5GAN 5;  1VQO T;  2JVV A;  2DXU A;  4LDV A;  4R56 A;  3SB2 A;  2A7Y A;  3M4G A;  4YTL A;  1UGP B;  2MAM A;  4BY6 C;  4NL3 A;  2YLC A;  2XK0 A;  2KY9 A;  2X35 A;  3ME9 A;  4C0F A;  3CXC A;  1YI2 A;  1G3W A;  4UC4 A;  3X24 B;  4II1 A;  3L1A A;  3J80 E;  3PTA A;  2O4X B;  1YJW T;  1GXI E;  2I2L A;  4X9D A;  1EIF A;  2GQV A;  2KQW A;  1X6O A;  3HL8 A;  3CCJ A;  5GAN 3;  2EKO A;  2X4W A;  3M56 A;  2HAX A;  5CVI A;  3VKI A;  2DXB A;  1K8A C;  3S3M A;  1Q82 U;  2LRQ A;  2BIV A;  3VUZ A;  2ZPE B;  1JJ2 S;  4EMG A;  4M7D C;  4PJO A;  3ER0 A;  4HCZ A;  5HK3 A;  4C92 B;  2E65 A;  3FLG A;  2VYT A;  3CCQ A;  3P8D A;  4C8Q G;  1OZ3 A;  3UT1 A;  2M0O A;  2RK1 A;  3FRN A;  3MEU A;  3VU3 C;  5CR2 A;  2RI3 A;  3TCJ A;  3OYG A;  5GAM e;  3QPH A;  3A8G B;  2FVU A;  3V7C A;  5FU6 C;  4F7U E;  5GAM h;  1M4Z A;  3MP6 A;  1FX7 A;  4IUR A;  4A4K A;  3CCU T;  1YCY A;  3JCM b;  3TEE A;  4PJO D;  1Q7Y C;  2EQU A;  3H8Z A;  2EIF A;  5CKF A;  2QDY B;  3MP8 A;  2QEX T;  2ZGW A;  3DKM A;  4MDW A;  1TH7 A;  3G6E T;  2PUK B;  3UPU A;  3GF5 A;  3JB9 D;  3LW5 E;  3RKX A;  5A0G A;  5GAN d;  3OS2 A;  2OTL T;  5LJ3 e;  2CYZ B;  4QQG A;  2KVQ G;  4BDZ A;  2OTL A;  4M7D E;  5FRN A;  2VGM A;  4LDY A;  1NE8 A;  1N27 A;  4J7I A;  4RCB A;  3CPW A;  4A4H A;  5GAM j;  1WJS A;  4F7U A;  3CBO A;  4RMO A;  3OYE A;  4PJO C;  3M54 A;  3MEA A;  3C95 A;  3FIF A;  3SDZ A;  1M90 U;  3PGG A;  3OQ5 A;  3GIB A;  1UGQ B;  1XOV A;  5EG2 A;  3X26 B;  4A4E A;  4DQ2 A;  4ATO A;  3QO3 A;  1VQ4 A;  2JTM A;  2K3X A;  1FXX A;  3CME A;  1VQ4 T;  4XAX B;  1H3Z A;  2LT1 A;  3A8H B;  5CAI A;  3M59 A;  5GAM g;  3OS0 A;  4FSX A;  1M1K C;  1QVF A;  4CI0 C;  1VQ5 T;  1ZHI A;  1N6A A;  5FU7 B;  4PLI A;  3LH0 A;  5GAM d;  3JB9 H;  1Y71 A;  4C0Z A;  1VQK T;  2E64 A;  5CCA A;  5GMK e;  2FL7 A;  5DLQ E;  3QHS A;  4Y91 A;  4E7K A;  3MP1 A;  4M7A E;  2L89 A;  1W4S A;  4LDU A;  4QVD A;  2OTJ T;  3CCJ T;  2DEQ A;  5GAN 2;  4BE1 A;  5I2S A;  1QVG S;  3LX7 A;  1YJW A;  2XD0 A;  2F5K A;  3OY9 A;  2LVM A;  1M5Q 1;  2XG8 D;  4DOV A;  1JB0 E;  2RHX A;  1BI3 A;  4Q5W A;  3BDL A;  2FHD A;  2WSC E;  4RCC A;  3OYF A;  4MMK A;  3JCM e;  3L2U A;  1RI0 A;  3O8V A;  4J6X A;  3CMA T;  4XU3 A;  5D6Y A;  1WQW A;  3OSS C;  4L5G A;  3T9N A;  1VQ7 T;  4IUV A;  5GAN j;  4A53 A;  2F69 A;  4PNO A;  1I8F A;  2D0Q B;  2LTO A;  2AHJ B;  1BI2 A;  3MET A;  3CCU A;  2R57 A;  3RKW A;  4M7D F;  5KCO A;  4RKU E;  3OYH A;  3QG1 A;  2PVD B;  4O6J A;  2EAY A;  3EFR A;  1Y7X A;  3LWH A;  4IKF A;  3R6O A;  4O5V A;  3CPW S;  3JCM d;  1VQ6 A;  2KSS A;  1M1F A;  3BDU A;  4L6V 5;  2E1H A;  4ZGJ B;  3G71 T;  3JCM V;  2DIG A;  2KK4 A;  4BI3 A;  3S3N A;  1VQP A;  1KHC A;  1Q86 U;  4BE2 A;  2LQK A;  5HY6 A;  5FRO A;  1W2B S;  3VYH B;  2P0Q A;  2CZ7 B;  2XDP A;  4M75 F;  4PJO G;  5GMK h;  5LJ3 j;  3WXM B;  3BY7 A;  4M77 B;  4NL2 A;  5LJ5 f;  4C8Q C;  5A2Q E;  3V8L A;  4KUL A;  4OGE A;  2L8D A;  3OW2 A;  3JCM P;  4OB1 B;  2WAC A;  4FT4 A;  3CCQ T;  4Y28 E;  4M77 E;  3JB9 I;  1VQ8 A;  4N0A A;  2MWO A;  3VUB A;  3J7A F;  1VUB A;  1PSE A;  2HD0 A;  3JCM W;  3E19 A;  2K5L A;  4EMH A;  3I56 T;  3CME T;  5CK9 A;  5LJ3 g;  5DM7 R;  2CZ1 B;  1KC8 U;  3M9Q A;  3OYJ A;  3SWN B;  4EMK A;  4JS5 A;  1U8R A;  2DVE A;  1SSF A;  1OYX A;  4X34 A;  5HK0 A;  4M7A B;  3P8B B;  4JRK A;  2LCC A;  4J6W A;  3RKY A;  5CKH A;  2M1H A;  2Y4X A;  4OB2 B;  4FM4 B;  2B8A A;  5GAO q;  2ZPF B;  4XTX A;  4A4F A;  4RG8 A;  4HCB A;  2OTJ A;  4L59 A;  3KXT A;  4QVZ A;  1V29 B;  5GAO p;  4NOY A;  1KD1 C;  2DZC A;  1JBM A;  3HP9 A;  3QSU A;  1G3Y A;  3FJP A;  2HBP A;  3QKJ A;  5GAO n;  4NS5 A;  2E10 A;  1WJR A;  3PMI A;  4A54 A;  5CQY A;  2RK2 A;  1Y96 B;  2DKG A;  4MDX A;  4VUB A;  3OYL A;  3DLM A;  4HT9 A;  1LOJ A;  4C8Q F;  4N4I A;  4PJO E;  5DLO A;  2M16 A;  1Y07 A;  2LC4 A;  4M78 A;  2DO3 A;  1U1T A;  2PVO B;  5KE3 A;  3CCR T;  3UWN A;  3M4Y A;  2LNV A;  3WVD B;  4C92 C;  1VQL A;  4QQ6 A;  1WGS A;  3E9F A;  1VQK A;  2V8J A;  3A5Z B;  2IG0 A;  4KBM B;  4QVC A;  1OZ2 A;  4C0D C;  3H6Z A;  3L42 A;  3I55 A;  4M7A D;  3QZ9 B;  3DB3 A;  3L2Q A;  3X28 B;  2HQX A;  2D6F A;  5FU6 B;  1I4K 1;  3RUX A;  2HQE A;  3HHT B;  2VXE A;  4BI4 A;  2VUB A;  4M78 D;  2RHI A;  2LCL A;  3V8J A;  2P4T A;  3G4S T;  1YJ9 T;  4P5N A;  5I2M A;  4J8O A;  4C8Q A;  2BUD A;  2RJF A;  3LYI A;  5LJ3 h;  4F7U F;  4BY6 B;  1D3B A;  2QQR A;  3DB4 A;  1I5L A;  3F70 A;  2H3J A;  4FL6 A;  3C4S A;  1BI0 A;  4JRP A;  1Q81 U;  4M7A G;  1VQ7 A;  4M7D A;  1M8V A;  4BD3 A;  1B34 B;  3FEO A;  2JUF A;  2JOY A;  4PKC C;  5GAN f;  2PUO B;  1QVP A;  3FC3 A;  3EFS A;  2WSF E;  4C92 E;  1UGS B;  4Z02 A;  3L2W A;  4R55 A;  2QA4 T;  5C6S A;  4QW2 A;  1VQ9 A;  1JRI A;  2ZZD A;  4M75 B;  5L8R E;  3JAM E;  2DAQ A;  1VQO A;  2DJZ A;  3VJP A;  2DK3 A;  2RA2 A;  3BW1 A;  3RMS A;  2QEX A;  1VQM T;  2XDD A;  3CCL A;  3RES A;  5LJ5 d;  2D9T A;  2QQ9 A;  4BE0 A;  3QII A;  3CCL T;  3PMT A;  3HFO A;  4MZP A;  3WVE B;  1R8O B;  1M9S A;  2RJE A;  3MHX A;  4MML A;  3CCV T;  3HRT A;  3CBM A;  5FU7 C;  3NFC A;  5CIU A;  5GAO m;  3JCM f;  3CCE T;  3X25 B;  5KCH A;  5DY9 A;  1WPY A;  4E7I A;  1I81 A;  2DTH A;  3EAE A;  4F7U G;  1VQ8 T;  1DJ7 B;  2XDB A;  2R5A A;  2VGN A;  2ZPI B;  3M55 A;  3QXE B;  4C92 D;  1K8A U;  1FWZ A;  2O4X A;  3OYD A;  3VV0 A;  2E5Q A;  3CC2 T;  1QP3 A;  3S3O A;  3JCM J;  4B9X A;  3CC2 A;  4HA8 A;  1YJN T;  1VIF A;  4LDX A;  2M9U A;  4ZGE B;  3C94 A;  1G5V A;  1HK9 A;  2X4Y A;  4PJO B;  3JCM g;  3HSB A;  4M77 G;  2XU8 A;  4C92 A;  5GAO l;  4IUQ A;  1UEB A;  4C92 G;  1P92 A;  4KUI A;  3X20 B;  2RI5 A;  1QVG A;  4ZGD B;  1VQN T;  4ZTJ A;  3I55 T;  1O75 A;  1RL2 A;  4M75 C;  2CKK A;  3GPL A;  3SD4 A;  3GOX A;  1XTD A;  2QI2 A;  3NTK A;  4OB0 B;  2YRV A;  4JLG A;  2JNG A;  2KAF A;  5J39 A;  1KD1 U;  1LJO A;  3A8O B;  4C5H A;  5GAM f;  4J83 A;  2RHZ A;  1K9M U;  1N8R U;  1KC8 C;  4E7J A;  3QUI A;  1BI1 A;  2RM4 A;  1G3T A;  4M78 G;  3OW2 S;  3S6W A;  4ZN1 A;  2QA4 A;  2EFI A;  2DPP B;  4TVR A;  2CS7 A;  3PIO A;  3HRS A;  3OA6 A;  1KG1 A;  3CCM A;  2DZ9 A;  4JLI A;  3CC4 T;  4M7A F;  2XHC A;  4FU6 A;  2DD4 A;  4F7U B;  1KHI A;  2CZ0 B;  2V8I A;  5A0D A;  4JRQ A;  3V7R A;  2MF2 A;  1Q7Y U;  4J6Y A;  4C5E A;  2QQB A;  1KQ1 A;  1M1G A;  2ZPG B;  3QZ5 B;  4PL6 A;  3CCS T;  4JRI A;  4OF1 A;  2E12 A;  5FLX E;  3PIP A;  3CCS A;  5IAY A;  1VQM A;  2RJD A;  3QJY A;  2KDS A;  4XTV A;  1G3S A;  4J7F A;  4ELZ C;  2MI6 A;  1KQS A;  3JCM c;  2E41 A;  2ZPH B;  3NTH A;  3G71 A;  1Q81 C;  3JSC A;  3HFN A;  4OVA A;  2RD1 A;  3GNG A;  4KT0 E;  1YHQ T;  2C06 A;  3CPF A;  4M7A C;  1PSF A;  3LGF A;  2DD5 A;  3CCV A;  4C5I A;  4C0G A;  4M7D G;  1BYM A;  1K73 C;  1N9S A;  4N4H A;  3A8L B;  3OB9 A;  4BDY A;  3CD6 A;  5GAN 6;  1XQH A;  2LT4 A;  2LX9 A;  2RHY A;  1NPR A;  1KQ2 A;  2DIQ A;  3OS5 A;  3URG A;  4DOW A;  2QQS A;  1OI1 A;  2JTF A;  2PQW A;  5J26 A;  3UDC A;  2O01 E;  3ZFJ A;  3OSV A;  4N0A C;  3HRU A;  4CRI A;  3I56 A;  1AHJ B;  4M77 C;  2A3L A;  2YLB A;  4M78 F;  1YIJ A;  2DXC A;  4KUD K;  5CO7 A;  3GLX A;  4EDU A;  3M58 A;  1VIE A;  2EJG A;  5LJ3 d;  1VQ5 A;  1NPP A;  4M75 G;  4PJO F;  2K5I A;  3L2Z A;  4LDW A;  5CQX A;  2QQA A;  4GLK A;  5D6X A;  4EMK C;  1MGQ A;  2IVW A;  3G6E A;  1VQN A;  4V2S A;  2NLU A;  5GAN 8;  1UB4 A;  4XTU A;  2P0K A;  3JB9 F;  2VC8 A;  3OBW A;  3Q1J A;  4J5Y A;  1O9S A;  2EQJ A;  2K4Y A;  1ZQ1 A;  3PFS A;  4OB3 B;  2LQ8 A;  4WF2 A;  3SWN C;  3ASK A;  3OYM A;  5IT9 E;  2GFU A;  2L5Q A;  4C5G A;  5GAN 4;  4FT2 A;  1IZ6 A;  3M53 A;  5CKB A;  1HXD A;  2EQK A;  3FDR A;  4IUT A;  3J81 E;  1N9R A;  4M77 D;  4ZN3 A;  3OYB A;  2RJC A;  4A4G A;  2EWN A;  5A0L A;  2JN0 A;  2PVG B;  5LJ3 f;  3N5B B;  4MZM A;  5AYF A;  4BB7 A;  3CMA A;  4C0D B;  2CZ6 B;  5LJ5 j;  4JJN K;  2XKO C;  3L2R A;  5LJ5 h;  3LGL A;  1K73 U;  4HT8 A;  3CEY A;  1IRE B;  1VQL T;  4X9C A;  1WJQ A;  4M78 C;  2Y4Y A;  2RI2 A;  2X4X A;  4M77 A;  5LJ5 g;  2EYQ A;  3KBG A;  5LL6 S;  2PU9 B;  4LD6 A;  3JRZ A;  2F5T X;  2VV5 A;  2RO0 A;  4GY5 A;  2MWP A;  3QJ6 A;  3ZBD A;  1LNX A;  4JUV A;  4QQD A;  4XTY A;  3G4S A;  1YJ9 A;  1BIA A;  3C12 A;  1M1K U;  4BI8 B;  1VQP T;  5CKE A;  4MZT A;  3OYK A;  2E70 A;  5GAN g;  3SFM A;  3L2V A;  3JB9 G;  3QDR B;  3V7S A;  5CKD A;  3RER A;  1YHQ A;  2ZCF B;  4OMF B;  5HKC A;  3SWN A;  4EMK B;  5M9O A;  2Y90 A;  3ZEH A;  5J3B A;  4XU0 A;  4M7A A;  1S72 T;  3OYC A;  1XNI A;  1NJI U;  5GMK l;  2G3R A;  5GMK j;  2RH2 A;  3P8H A;  4XK8 E;  5IN1 A;  4OP0 A;  2E6Z A;  3JCM h;  4XQ3 A;  4E7H A;  2YHT A;  3QYG B;  3CCM T;  4ME7 A;  3HKS A;  4DA4 A;  3CC4 A;  2V8K A;  2VXF A;  3LLR A;  2K5F A;  2P0P A;  1VQ9 T;  1NZ9 A;  1YI2 T;  4BUG A;  5KH6 A;  1NJI C;  3MCA B;  4B9W A;  3CC7 A;  3OMC A;  4M7D D;  2X4J A;  3OBY A;  3OYY A;  4XTZ A;  2R58 A;  4M78 E;  1YIJ T;  3CC7 T;  2FB7 A;  3HPW A;  2E6N A;  1QP2 A;  1Y96 A;  2MMP A;  2K57 A;  3M57 A;  1UGR B;  4JS4 A;  1VQ6 T;  2XIC A;  1YIT T;  2XI9 A;  3JCM X;  3OS1 A;  1YIT A;  2QXF A;  3KUF A;  4M78 B;  3MEV A;  4E7L A;  4IUP A;  1MHN A;  4FIB A;  3MEW A;  3VYG A;  3CXC S;  2HNI A;  3LWI A;  2EJF A;  2QTX A;  3INZ A;  4C92 F;  4ELY C;  3CD6 T;  5GAN e;  3PNW C;  3OYA A;  2GCX A;  2KMT A;  3DLL A;  1H64 1;  3CCE A;  3BFM A;  2DTI A;  2XID A;  2FYK A;  3E1S A;  4HKE A;  3GNF B;  1X01 A;  1X75 C;  2CGH A;  2RB6 A;  3MO8 A;  4JDS A;  1QW1 A;  3M5A A;  4BAC A;  2LDM A;  3G7Z A;  3OYN A;  1Q82 C;  4C8Q B;  5I21 A;  3NTI A;  4D6W A;  2R5M A;  3CCR A;  4HCC A;  3GP8 A;  1Q86 C;  3OYI A;  1YJN A;  3JCM Q;  5FRM A;  1D3B B;  5GAN h;  1BIB A;  5GMK m;  2EJ9 A;  3V8K A;  1WQ7 A;  4XTW A;  2L3R A;  3TRE A;  4M7D B;  4XU1 A;  1B34 A;  4IUU A;  3QYH B;  3JB9 J;  4PLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...