2RHIA

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with h1.5k27me2 at 1.66 angstrom
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
CWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA03
2B8AA 2IG0A 2RO0A 3H8ZA 5FRNA 3META 1KHCA 4BE2A 2JZ2A 3ASKA 3L42A 2RJEA 2X4XA 3M9QA 4IUTA 5FRMA 2MWPA 3P8DA 3DB4A 3FLGA 2LVMA 2QQRA 3QIIA 4E7HA 5D6WA 4QVZA 5KE2A 3MP8A 3SD4A 3LX7A 2XK0A 4IUVA 4A4FA 4EDUA 3MEVA 3L2VA 2O4XB 4E7JA 2XDPA 1WGSA 2M16A 3OYBA 2BKDN 3H6ZA 3NTHA 3MO8A 2RI3A 3OMGA 4ZTJA 2M0OA 4ZTFA 3F70A 1WJQA 2JTFA 2EKOA 3PNWC 2DIGA 2R5AA 2EQMA 2F5KA 3S3OA 4B9WA 3ME9A 2RJDA 3OYIA 3FEOA 2MWOA 3PMIA 4QW2A 3OS0A 2QQSA 4E7IA 5KE3A 4BD3A 2L89A 4GY5A 1MHNA 4CRIA 5KH6A 3OYKA 4C5EA 4NS5A 2E5QA 3OS1A 4B9XA 5C6SA 2RHYA 2GFAA 1WJSA 5IN1A 3LYIA 4A4EA 4C5HA 3FC3A 3MP6A 1RI0A 2O4XA 3MEUA 3PFSA 3ZEHA 2K3XA 4A4HA 3L2RA 3CEYA 5CIUA 3DLMA 2L8DA 4IUQA 4Z02A 2R5MA 4UC4A 4E7KA 2LTOA 2LCCA 3C4SA 2X4WA 3QBYA 3E9GA 2L3RA 4IUUA 4QQGA 2BIVA 3OB9A 4C5IA 4QQ6A 2VYTA 3LGFA 4FU6A 3OYEA 1OZ2A 3S3MA 2EQKA 3OYCA 3L2UA 3S3NA 5D6YA 3FDRA 2M1HA 4BE0A 3MP1A 3OMCA 2LDMA 5J39A 4QQDA 2BUDA 4IUPA 3Q1JA 2LRQA 3NTIA 5C0MA 3PMTA 2HQEA 3OYJA 2GFUA 2R58A 4BDZA 3UT1A 3L2QA 2RI2A 3E9FA 3OYDA 4N4HA 2D9TA 3LLRA 4IURA 5D6XA 2RI5A 1OZ3A 2EQJA 2HQXA 2RHUA 3OA6A 1OI1A 4L59A 3LGLA 3O8VA 4HCZA 2G3RA 4PLLA 4II1A 3MEWA 4N4IA 2RHZA 3DB3A 2WACA 4IKFA 2K3YA 2RHXA 5KCHA 2X4YA 3UWNA 4E7LA 1OYXA 1WJRA 2EFIA 3LH0A 1G5VA 4BACA 4BDYA 2YRVA 3KUFA 3OYFA 3OQ5A 4N4GA 3MEAA 5J26A 1N27A 3OYGA 2R57A 4Q5WA 4C5GA 1H3ZA 3OS2A 4BE1A 3GOXA 4PL6A 2PQWA 4LD6A 2GF7A 1SSFA 2DIQA 2E6NA 5IAYA 3OY9A 2CKKA 4A4GA 2NLUA 2RHIA 3OYMA 2P0KA 2EQUA 3L2WA 5KCOA 3QKJA 4PLIA 3OYHA 3OYAA 3QJ6A 4X34A 1XNIA 2DAQA 2FHDA 3OYNA 3NTKA 3S6WA 3P8HA 5FROA 3OYLA 5M9OA 4OVAA 4FL6A 4RG2A 3BDLA 3EAEA 2RJCA 2X35A 2RJFA
chains in the Genus database with same CATH superfamily
2BZYA 3R6OA 3RKWA 4BE2A 4M7AB 3X20B 2J06A 2V8IA 3FLGA 2DE0X 1BB9A 3TSZA 1YJWA 2FZKB 3MEVA 4C0DB 4M7DD 2XDPA 5KYWB 5L23A 2HAXA 4F7UA 4ZTFA 1M90C 4EMKA 3JCMP 2E3HA 4BI3A 3OYIA 5GMKe 1O9SA 1K0XA 5L8RE 2PU9B 2E5QA 5FU6C 4XTXA 3TREA 5LJ5e 1WJSA 4JLIA 4A4EA 3FC3A 3SWNC 1M5Q1 3MEUA 2NUTA 3TU4K 3I55A 3PTAA 3C4SA 1QP2A 3QBYA 3OB9A 2LX9A 2EGAA 4L6V5 1WQWA 1RLPC 3L2UA 4QT7A 4JJBA 2ZPFB 5GAN8 4M78D 3HTRA 2FPFA 1N6AA 4FIBA 2RN8A 2RI2A 4CC3A 1IRXA 2DXCA 1K8AR 1M9SA 2WSCE 1JO8A 4LUEA 4E7SA 4AG2C 1YFNA 1N8RU 4KH0B 3MEWA 2BE9B 4WCIA 1IREB 3M4GA 3CMEQ 4X1VA 3OYFA 3CCVQ 5DM7R 4PJJA 2YRDA 2LQWA 4PFOA 4C5GA 2FPEA 4XU1A 1FMVA 2NLUA 1VUBA 2DF6A 2AK5A 1OX9A 3OYHA 2XG8D 4RKUE 2DAQA 1VQPA 1FYNA 4OVAA 4K11A 2HMAA 4RG2A 2VC8A 1IHWA 5LJ3h 3GBQA 4OMLA 1Y96B 2KT8A 1D1AA 2YUPA 1AD5A 5FU7C 5AYFA 2J6OA 1Y7XA 4GLMA 1YJ9A 1YWOA 2YT6A 4C0FA 4EDUA 3JB9I 2A08A 5HK3A 3M0UA 4KUIA 3RMSA 1D0XA 2PVOB 5LJ5d 1KC8C 4M77E 2RQRA 4L5GA 1WFWA 2E41A 2F5KA 3G71Q 3CCJT 1BIAA 4OMMA 3OBWA 3CCJQ 1NLOC 3ZBDA 1TSFA 4OMFB 6AT1B 1PWTA 1MNDA 1M1GA 2DRKA 2XKOC 2EQIA 5IN1A 1UJ0A 2DNUA 2ROTA 3JCMb 1I0CA 1ZUUA 2MIOA 3EGXB 3VS6A 2K3XA 4BY6B 2XI9A 4M75E 4JRPA 1N8RR 4UC4A 4PJLA 5AT1B 3CCMA 1N9SA 2CS7A 2EAYA 2HEQA 3CC4A 1YI2A 5LJ5j 1KSWA 1Q81C 5J39A 3VRYA 1QCOA 1OPLA 1Q86U 4OGCA 4M7AG 3E9FA 1UE9A 3SHWA 3NGPA 3BW1A 4X9DA 4F7UB 1K76A 1C6VX 4C92A 1TUCA 2KYBA 2QQBA 1AOJA 4MZTA 1ZSZB 1AWJA 5A0DA 3HSBA 4Q5WA 5IT9E 4D8DA 4CC2A 4A4GA 1K9MC 2EQUA 4FYVB 3OYAA 4M77A 2LMJA 4C92D 2D0QB 4WTOB 2CP6A 3JCMQ 3EAEA 2ZZDA 2K9GA 4OP0A 2CZ1B 1X6GA 1KHCA 1AWOA 4ATOA 5GANh 2DL3A 3DB4A 1UJYA 3A1PA 1M2OA 3KFVA 2HL3A 2LQ8A 2OJ2A 3M0QA 4HVVA 3H9NA 1UDLA 1XTDA 1YP5A 4E7JA 1SHGA 3OYBA 4AFZC 1QCNA 3NFCA 3HRSA 1T3LA 1AHJB 1JBMA 1CSKA 4AFUC 4PNOA 5GAOm 1Q86R 1B3QA 2P4TA 2YXYA 3LWHA 2MK5A 1QMCA 3CC7A 3CBOA 4LDWA 3QUIA 5GAOn 1OU8A 2GTOA 4IIMA 3X26B 2CSQA 1EIFA 4DEXA 2K2MA 4HT8A 3BE3A 2R5MA 3VS2A 1BBZA 3E9GA 4Y28E 3RKYA 3JCMc 3S3MA 4C0DC 2KGTA 5I2SA 1G83A 2PUKB 1JQQA 2KMTA 4FCYA 2LX7A 5CAIA 1NBEB 2GQIA 2WSEE 3HL8A 1ZA1B 5CO7A 2EYZA 1NLPC 2DTIA 2PUOB 3H0FA 8AT1B 2KBTA 4RTWA 1BKBA 5GAOq 2YRVA 5GMKh 3G1JA 5J26A 5GAN2 1D09B 4OB1B 1VYTA 1W1FA 1KFZA 3JCMh 2OAUA 1M2VB 3EGXA 4MMKA 3OSVA 1VQPQ 2JTEA 1VQNA 3QJYA 2O31A 3G6ET 3GLXA 3CPWS 3OBYA 2HL5C 1I07A 2KDSA 1TU0B 4EMHA 1W2BA 1RADB 2NWMA 2K4YA 3KXTA 1VQMQ 3M9QA 4LDYA 3CMEA 3CD6A 3RIRA 2OTJA 3I5RA 4M7DE 2L0AA 4PFZA 3HFNA 1M3BA 1KD1R 4IUVA 2RK1A 2DTOA 3CC4T 2EJ9A 2EYYA 2EW3A 3QSUA 4CI0C 1ZUKA 1VQKQ 3CCEQ 1QVFS 3L2ZA 2Z0WA 2L3QA 2IIMA 4PK4A 2V8KA 5C6SA 2YUQA 5GAMh 4PJOB 3CMAT 5A0GA 5FU7B 1RAAB 4OF1A 1F1BB 4ZN3A 4M75F 1ZUYA 2COYA 1G3YA 3OSSC 1GCPA 2HKNA 4ORZA 3I56A 3S3NA 1T3SA 1EX4A 1YN8A 4FSXA 2BUDA 2AZVA 3Q1JA 1YJ9T 1QQJA 2ED0A 5KYYB 4BDZA 3A5ZB 1K8AC 2FG0A 4N4HA 3WVEB 1OZ3A 4M77F 1YITQ 2MYSA 1VQ7A 3DB3A 4M75C 4R56A 1JEGA 1VQ5T 2HBPA 3RERA 4BE1A 1D1CA 4ELZC 5J3BA 1VQ7Q 3TEEA 3QKJA 3REBB 1N5ZA 4BY6C 1FMKA 3S6WA 3A8GB 2OAWA 3LWIA 5FU6B 5KYNA 1UHCA 1X2KA 2PVGB 2X51A 2CUBA 1YBYA 3ASKA 1Q81U 1VIEA 5GAOr 5LJ5f 2V1RA 4KT0E 1RABB 1MMGA 2MWPA 3P8DA 1H92A 3HKSA 3SD4A 2LQKA 2V1QA 4J9BA 3CCQA 3CCLA 2B86A 2BKDN 2CH4A 3H6ZA 3NTHA 4LN2A 4D6WA 4VUBA 2DIGA 2DVJA 3M58A 3CPFA 2YRCA 1B07A 4ELYC 2I2LA 4JRQA 1VQLA 1FMWA 1NJIU 1ZQ1A 2QQSA 2A36A 5GANe 4BD3A 4J9DA 1YCYA 2QTXA 3EGDB 1TWBA 3C95A 1WHKA 3CCEA 2HCKA 1AT1B 1OEBA 5IHKA 1VQLT 2XU8A 2L8DA 4E7KA 2KT1A 5HKCA 4QQGA 1OULA 1QW1A 3C12A 2KI7A 3QZ5B 2DO3A 1M8VA 3CD6Q 3PVLA 2DTHA 1VQOQ 2GCXA 1M30A 5D6YA 4BE0A 4KGXB 4M7AF 1WDXA 3UA7A 2Y4YA 3VS5A 3REAB 2ENMA 2YWWA 5D6XA 4XTVA 1OU9A 1U1SA 1OI1A 3LGLA 4HKEA 3PGGA 3V8KA 3HHTB 3CCLQ 1WHGA 4LDXA 2C0TA 2CT4A 4N4IA 1UEBA 2DMOA 2WACA 3GNFB 5GAN7 1G5VA 4RTXA 4XU2A 4M78A 2DYBA 2NUZA 2VB6A 2R57A 4GBQA 2HNIA 5LJ3j 4PL6A 2JMCA 2DL5A 3OYMA 3QHSA 4LDUA 2L3PA 4F04B 1QWEA 1YHQA 2AIRB 2W0ZA 1K1ZA 4AG1C 3OYNA 4HCBA 3OYLA 2CP5A 1NJIR 1NYFA 4RUGA 2B8AA 1OPKA 5FRNA 2LNVA 3META 1PKSA 2GTJA 3L42A 2DVEA 2PVDB 2VV5A 4DBQA 3G71T 4HVUA 3OW2P 1PM3A 4N0AA 3VYGA 1FXXA 1SKUB 3I55T 3VS3A 2M0OA 1HK9A 3TSWA 3LH5A 5CKBA 2QEXA 2D6FA 3CC7Q 1I5OB 3VJPA 2ZCFB 1MNEA 5KH6A 3G4ST 1YI2Q 3CC4Q 1YI2T 5A2QE 3CCJA 1N9RA 3JSCA 2QEXT 2G6FX 3CCMQ 5GMKj 2MAMA 2D8HA 4DQ2A 4PJOA 2GNCA 1GXIE 3NMZC 5CKFA 1UGPB 1M1FA 4XAXB 2RB6A 4QKUA 4R0KA 2RK2A 1WLPB 2M9UA 1ZSGA 4C5IA 4J9FA 2X4JA 2CP2A 4JJDA 5GAMg 1VQ6Q 4KULA 1UGVA 1GBRA 4FYYB 1NEGA 1W4SA 1VQOT 2O9VA 2R58A 4GLKA 2A0FB 3QPHA 3E19A 2JVVA 2RM4A 2KR3A 4MDXA 2CH4W 1AZEA 3CMET 2AHJB 5CQXA 2KY9A 4LDVA 2K3YA 4PJOC 1Z9ZA 4A4KA 4YTLA 4Z8AA 4V2SA 3X28B 2EJFA 2LNHB 1N27A 2JN0A 3M0RA 2AT1B 3EGDA 5I11A 2O9SA 2DIQA 1GBQA 1Z9QA 1V76A 3OY9A 3CCSA 1Q7YU 2RHIA 1YITA 3QJ6A 2VKNA 2KAFA 4DOWA 4D8KA 1VQKT 3CCSQ 1PG5B 2E5KA 3CCST 1PHTA 5DLQE 3H8ZA 1QLYA 3QDRB 4E2FB 2RPNA 2E10A 2YLBA 4LUDA 2P4RA 4M75B 5KE2A 3I56T 2JXBA 1TS9A 1K9MU 3F70A 4ME7A 1P92A 1M4ZA 4M78B 1V1CA 3PIPA 2L89A 4MZMA 4RCCA 4J6YA 3OS1A 2BZ8A 3D7SB 1AEYA 2LCSA 4C5HA 4C8QE 3A8MB 3OS5A 3L1AA 3JCMe 3CEYA 3I55Q 2P0PA 3H0HA 3CCQT 1YJWQ 2DFUA 3JCMX 2O88A 1H8KA 1WHLA 2L5QA 2DZCA 2HZYA 5CQYA 3SEMA 3FB9A 4JJCA 2QDYB 5I22A 2JT4A 4M7AD 2LDMA 1K0SA 3G7ZA 2OTJT 3QXEB 2PZ1A 2RF0A 4J9HA 2QEXQ 1QVPA 1KHIA 4IURA 2HBWA 3M0SA 3CXCA 1RUWA 4N0AC 5LL6S 1Y07A 1GL5A 4J6WA 5GAN3 2YUNA 2GQVA 1MGQA 1WI7A 4ESRA 3UF4A 1SHFA 3BFMA 2CP7A 4RTVA 2AKKA 4M75D 4C8QG 1KC8U 1SPKA 2RQVA 3QYGB 4PLIA 1H641 5KYUB 4HCCA 1YHQT 1VQ8Q 3RESA 5GANd 5FROA 3ULRB 4RCBA 4XTUA 2RJFA 8ATCB 3NHNA 2JZ2A 1IGQA 1UGSB 1WZOA 3WXMB 3ZFJA 1LJOA 1LCKA 3JAME 2LVMA 4J7FA 4QVZA 2O2OA 4FW1A 1TG0A 2EYQA 2XK0A 3L2VA 4FT4A 2O4XB 2VXEA 5GAN4 1NYGA 3V8LA 1G2BA 1WJQA 4M7DG 3ME9A 3M55A 3HRTA 3VS0A 2CZ6B 4QW2A 4E7IA 1BCOA 3OYKA 2EYWA 2E70A 2ZPEB 3CC2Q 3X25B 1WNLA 3CC2T 2FEIA 1SF9A 3SFMA 1RI0A 3PT9A 4C92E 1D3BB 2H3EB 2ED1A 2X4WA 4DEYA 2CGHA 1JXMA 4QQ6A 1GFDA 5GANj 1YJNA 1ZBJA 1BI0A 4E6RA 2DETA 1MUZA 1U3OA 1KQSA 5EG2A 4IUPA 2VWFA 1AWXA 1CKBA 4OGEA 1PSFA 3L2QA 2EBPA 3OYDA 3J81E 1B34A 1HYOA 1D0ZA 1VQ8A 4L59A 2D8JA 1M90R 4KH1B 1VQNT 3M56A 2ZPGB 3CCQQ 3M59A 5KYXA 4AFSC 4II1A 4F17A 1S72Q 1CKAA 3URGA 4XU3A 3AHUA 2LJ0A 1W6XA 2COZA 2D0NA 3VS7A 1RI9A 2DPPB 1UHFA 4XTZA 1EFNA 2FB7A 1KD1C 1GFCA 1UFFA 3JB9F 5KYWA 1VQ9A 3RMQA 2RQUA 1WHJA 4C92G 1Y0MA 1S72T 1QVGA 4X34A 2Y90A 4C8QD 2FHDA 5IXFA 1K73R 4BI4A 3JCMW 1Y57A 2LT4A 2XDBA 1X43A 5ECAA 4RMOA 1IHVA 4ZNXA 5GJWB 3CCVA 3QWXX 1O75A 1C0MA 2JTMA 3QIIA 3BY7A 2M51A 2PTKA 2K6DA 2XIDA 2K7AA 5CKHA 1IB8A 3M0TA 1WGSA 2M16A 5FLXE 5KYYA 1J3TA 1VQ8T 1X6BA 2EQMA 3PIOA 2HDAA 2EPDA 3CBPA 2FO0A 3I56Q 2E6ZA 2P84A 4M77B 2RH2A 2RHYA 3UA6A 4NOYA 1YJNT 1Q82C 1RAIB 1LOJA 4MMLA 1KK7A 9ATCB 2QDLA 4IIOA 2ABLA 4EIKA 1OX8A 3DLMA 4IUQA 4C8QB 1BK2A 2QQ9A 5GMKi 2VYTA 1OV3A 3OYEA 1G3WA 1ZX6A 3M0PA 5GAOl 3PVQA 2RQWA 3PMTA 3BDUA 2GFUA 3M53A 2RNAA 1LPLA 2SEMA 4RTTA 1Q82U 3EG9B 2K57A 2LJ1A 1W2BS 4OMQA 2HKQB 4KGZB 4JDSA 5FW9A 4OMNA 3HFOA 1YIJQ 1M1KU 2KVQG 4X9CA 2FYKA 1MV0B 4N4GA 2CZ0B 3WVDB 1RL2A 4M78C 2FRWA 5DY9A 3OS2A 3GOXA 1I81A 2K5LA 4RTUA 2DILA 2E6NA 2DXBA 1D0YA 3L2WA 5KCOA 2ROLA 2IPOB 4F7UE 1VQNQ 2H3JA 1ACMB 2MCNA 2QA4T 2IG0A 2JS2A 3VS1A 5GAMj 1FWZA 4XK8E 2CDTA 2WSFE 2H8HA 1MV3A 2L2PA 3M54A 3CCUT 3H41A 3LX7A 1WA7A 3OYYA 2E12A 3OMGA 2KQWA 1D1BA 3PNWC 1W70A 2NYSA 1VQMT 4BB7A 3QG1A 1M1KC 4B9WA 3ER0A 1XOVA 4J5YA 2E4HA 4GY5A 2F1LA 4JZ4A 4C5EA 4Z88A 3DKMA 2DL7A 5CR2A 1ZSZA 3CCMT 2LZ6B 2DYIA 3X24B 4F7UG 1M1KR 2BIVA 1G3TA 2QQAA 4J9CA 1I1JA 1OQKA 2CT3A 1UGRB 2KSSA 4EMGA 2F2WA 3ZL7C 4BI8B 4QQDA 2LRQA 5C0MA 1KIKA 2HQEA 4O6JA 3E1SA 2D9TA 1ABQA 5I21A 2O01E 4C0GA 4M4ZA 2EGCA 2HQXA 4DA4A 1YHQQ 1IZ6A 4HCZA 5GAMd 1U1TA 3JB9G 2RHXA 1BI1A 1JB0E 4M78F 3UWNA 1QVGS 1OOTA 2W10A 1BCMA 4AFQC 1X69A 1LNXA 3MEAA 1HXDA 4DBFA 1PC0A 2XMFA 3G6EA 5IAYA 2M0YA 1ARKA 1QWFA 2NUTB 1SRMA 1M2VA 3VRZA 3M5AA 4FSSA 3UPUA 1Q7YC 1VQ5Q 2DRMA 4ZGEB 1ZBXA 3NPFA 4A63B 2KRMA 3RUXA 1RAHB 1SEMA 3V7SA 2DJZA 2EJGA 2JUFA 2RJEA 2E64A 2QTVA 4C92C 4E7HA 4R55A 5D6WA 3QO3A 4J9IA 1KC8R 2D1XA 4M75A 3MO8A 2CREA 4ZTJA 1KQSP 3EHQA 4HT9A 2EIFA 1KQ1A 4JUVA 1E6GA 5CVIA 4JJNK 2JOYA 4B9XA 4HCKA 3KBGA 3MP6A 1R0BG 2EVRA 3ZEHA 2Y4XA 3L2RA 1B34B 2ZGWA 3VYHB 1M3AA 1JRIA 2LTOA 3G4SA 2VXFA 3JCMV 3LGFA 3CD6T 3VUBA 2VVKA 3VS4A 2E3IA 3CXCP 2DEQA 2M1HA 2C0OA 3EFSA 1VQLQ 3JRZA 5LJ5g 3HPWA 7AT1B 1SRLA 1JU5C 4CC7A 4E47A 3U23A 1ZHIA 2V8JA 3LLRA 3DLLA 1RACB 2RHUA 2DKGA 2JW4A 2KYMA 3O8VA 4PKCC 1T0JA 5CK9A 1PD1A 2F69A 4E7LA 3CCUA 2DD4A 2DL4A 1K73C 4Y92A 1V29B 4BDYA 2MI6A 3MKDA 4J9GA 1H3ZA 1NPPA 4Y91A 1BIBA 1FX7A 1GRIA 4Z89A 4ZGJB 1PNJA 3IQLA 1E7OA 1XNIA 4F14A 5GMKm 3J80E 4M7DF 3NTKA 5KYUA 1WXUA 5LJ3f 3MJXA 1WXBA 2RJCA 2FRYA 4M78G 4EMKB 2JNGA 2DERA 2LQNA 3VV0A 2KNBB 2AZSA 2MMPA 3RNJA 4LXCA 1NE8A 3CPWP 3EGUA 5HCKA 1VQOA 5FRMA 1X75C 3EG1A 3GP8A 5HK0A 5GANg 2ESWA 2K3BA 2LT1A 2LP5A 1VQ7T 2F5TX 1Q95G 2JJ9A 1AZGB 1X2QA 2JS0A 2VUBA 2RI3A 1PD0A 2CUDA 1WXTA 3EFOA 1JJ2P 2EKOA 2R5AA 3CC7T 4JS5A 3M57A 4QVCA 1VIFA 5KE3A 4CRIA 2L3SA 3QDFA 2DJQA 2FL7A 4XTWA 5LJ3d 3V8JA 4RTYA 2KEAA 2A37A 3PFSA 1X6OA 5GAMf 4FYXB 3R6NA 5GAMe 5GAOp 5IHIA 1E6HA 1KG1A 1PRMC 2NUPA 2LCCA 3VKIA 4FU6A 1N8RC 4HVWA 1VYVA 3VU3C 2OTJQ 4LNPA 2XHCA 2CP0A 3HP9A 3OYCA 3GPLA 1VQMA 1TXQA 1NJIC 2VASA 2E1HA 1VOMA 2VGNA 1WHMA 2DXUA 4OMOA 1VQKA 3EG3A 4PJOG 3MCAB 2ZPBB 1K9MR 4HA8A 2KK4A 4HXJA 2JMAA 3SDZA 4IKFA 4C8QA 4C0ZA 1OYXA 1X01A 2EFIA 2ATCB 3OQ5A 4F16A 2AKLA 1R0CB 1VQPT 3OYGA 3SB2A 3V7CA 3UATA 2JM8A 2PQWA 4B6MA 3CCUQ 1XQHA 2DD5A 1G3SA 5LJ5h 1MMNA 4M7DC 2X3XD 2KROA 2P0KA 3JCMf 3A8LB 3MPUB 4J6XA 1Q82R 3PE0A 3H0IA 5IHNA 2J6FA 2DA9A 2FZCB 4M77C 4FL6A 4QVDA 1WIEA 2EGEA 4ANJA 4AT1B 2PNIA 2OTLQ 1QP3A 2BZXA 2QK0A 3EFOB 4C8QC 1VQ6A 2DL8A 3FIFA 5GAN5 2YSQA 2MOXA 3CXCS 1RAFB 2LCLA 3THKA 3CPWA 2QAZA 1NPRA 3A8OB 4TVRA 2FZGB 5HY6A 2DXTA 3JB9D 3FEOA 2MWOA 3PMIA 1UG1A 2YDLA 3RBBB 3OS0A 1MHNA 1WYXA 4J9EA 3SWNA 2GFAA 3JV3A 3TVTA 1B7TA 2HSPA 2O4XA 3G4SQ 2DBMA 1Q7YR 3C0CA 1WPYA 3JB9H 2V26A 1KQ2A 3CMAA 1ZA2B 2X3WD 4DBRA 1ABOA 3CC2A 1QVFA 3A8HB 4EPCA 3OMCA 1R77A 1VQ6T 4BUGA 1KD1U 1GCQA 4MZPA 4C92B 3I35A 3CBMA 4M77D 1EZZB 2FVUA 1IO6A 2EQJA 4JPBW 4PFPA 2IVWA 1PRLC 1JXOA 1M27C 4JZ3A 4PJOD 2G3RA 5I2MA 5KCHA 4NL3A 3A98A 1WJRA 4AMCA 3G6EQ 2J05A 4BACA 1XJWB 1Q86C 3KUFA 4C92F 2ZPIB 1JJ2S 3EHRA 2C0IA 2QGFB 2QG9B 5GAN6 1SSFA 1BU1A 1IXDA 1S72A 4DBHA 2CKKA 2CYZB 1VQ5A 4ZN1A 2A7YA 3RR6A 4JRIA 1VQ4Q 1KJWA 1UTIA 1HSQA 5FWBA 3OW2A 4CC4B 1RAEB 2K5IA 4C8QF 3FJ5A 1AWWA 1K9AA 3TQ7P 2X35A 1WQ7A 3GNGA 1GCQC 2RO0A 4IUTA 4M77G 4KRTA 2CSIA 3FRNA 1LVKA 2CP3A 2QQRA 3MP8A 4NL2A 1VQ4T 1UECA 1M90U 4FW2A 2YUOA 2MF2A 2J6KA 3AT1B 1SG5A 4LE9A 1KQSS 1NZ9A 2JTFA 3QYHB 4A54A 3EG0A 2KXCA 2GGRA 4M75G 2C06A 2DEUA 3FJPA 2KRSA 3JCMJ 1JJ2A 3INZA 3LYIA 1K8AU 3E2UA 4Z02A 3CCLT 4PJOF 1PCXA 1YNZA 2RQTA 1TUGB 5KYXB 5GMKl 4M7DA 2DZ9A 4M7AE 4M7AC 1Q81R 1YJWT 1TUDA 2QXFA 3MP1A 2KE9A 4RG8A 1YWPA 3NTIA 2OI3A 1VYUA 2QYZA 1M8MA 5CCAA 2HD0A 2QASA 4KUDK 2RA2A 5D7UA 5IH2A 2DK3A 2XICA 2CZ7B 3OW2S 4KGVB 1G8XA 1Y96A 2X4YA 5DLOA 1WX6A 3LH0A 1U8RA 1AVZC 3I9QA 3C94A 3SWNB 4J83A 4LD6A 1QKWA 1YIJA 3JB9J 1I4K1 2DBKA 2VGMA 3VUZA 4JS4A 1IGUA 4J8OA 4E7ZA 5LJ3g 1U5SA 2KXDA 5LJ3e 3CCRT 1NEBA 4MDWA 1HJDA 1C1AA 2X4XA 1S1NA 2QA4Q 1NM7A 5GANf 3JCMg 3HRUA 3O5ZA 5CKDA 3P8BB 4XQ3A 4A4FA 1R8OB 1ZSZC 3V7RA 1QCFA 1M3CA 3TCJA 2DM1A 3CCRQ 2QI2A 4FT2A 1I5LA 1SSHA 3S3OA 2RJDA 3N5BB 3JCMd 3EH1A 5CKEA 2FPDA 1UB4A 1HD3A 2NUPB 1YJNQ 2OX7A 4FM4B 1VA7A 2EKHA 2DLPA 2E65A 4A4HA 4P5NA 4A53A 2XD0A 4M7DB 1Y71A 2L3RA 1A0NB 1UGQB 2K79A 1K73U 3EG9A 4JRKA 2EQKA 4J7IA 2YLCA 1I8FA 3MHXA 1RAGB 4LD9K 2A28A 1TH7A 2ZPHB 2EYXA 4EMKC 1TTHB 4PLLA 1VQ9Q 2RHZA 1H3HA 2F2VA 3J7AF 2OTLT 3QWYA 1TOVA 4KBMB 3T9NA 2COWA 2LC4A 4JLGA 3EG2A 1T0HA 2LJ3A 1U06A 2BTTA 2QGGA 2GF7A 5IXBA 1DJ7B 3RDVA 3QZ9B 1YIJT 1PKTA 1PSEA 4F7UF 4XTYA 2F2XA 3BDLA 1X27A 3RKXA 5GJVB 3GIBA 1QVGP 2K5FA 2HQHA 4OMPA 2M02A 1QKXA 4M78E 5EC7A 1BI2A 2RD1A 3GF5A 4PJMA 2MPXC 4WF2A 1ZLMA 3EFRA 4PJNA 1UUEA 1NG2A 2BE7D 3CQTA 2YHTA 4XU0A 4NS5A 2JM9A 1BYMA 2X9HA 1MMAA 3CMAQ 1W2BP 4O5VA 1BI3A 5FWCA 1QVFP 3CCET 3I5SA 5CIUA 4OB0B 2P0QA 4IUUA 2XDDA 2J7IA 2GBQA 4OB2B 3FDRA 2K2VA 5A0LA 3LW5E 3UDCA 4OB3B 3OYJA 1WHHA 3G71A 2EWNA 2KRNA 3UT1A 1D3BA 3CCRA 1VQ4A 2RI5A 3OA6A 2ECZA 1YITT 2DX1A 3CCVT 2QA4A 2RMOA 4PJOE 1YJ9Q 2A3LA 2I0NA 2OTLA 2ZAEA 1MMDA 1K4US 4DOVA 3M4YA 4M7AA 4FYWB 1YCSB 3EH2A 2SRCA 3P8HA 4RTZA 5M9OA 1VQ9T 1RLQC 4ZGDB 2HSEB 1OZ2A
chains in the Genus database with same CATH topology
3R6OA 3RKWA 4BE2A 4M7AB 1YBYA 3ASKA 1Q81U 1QP3A 1VIEA 4C8QC 3CCVA 5LJ5f 1O75A 4KT0E 3X20B 3FIFA 5GAOr 1VQ6A 2MWPA 3P8DA 2V8IA 3FLGA 2JTMA 3QIIA 5GAN5 3BY7A 3HKSA 3CXCS 3SD4A 2XIDA 2LQKA 5CKHA 3CCQA 1YJWA 3MEVA 3CCLA 4C0DB 2LCLA 4M7DD 2XDPA 1WGSA 2M16A 5FLXE 2BKDN 3H6ZA 3NTHA 1VQ8T 2HAXA 4F7UA 4D6WA 4ZTFA 4VUBA 3CPWA 2DIGA 3M58A 1M90C 2EQMA 1NPRA 3CPFA 3A8OB 4TVRA 3PIOA 4EMKA 5HY6A 3JCMP 4ELYC 3OYIA 4BI3A 2DXTA 2I2LA 5GMKe 4JRQA 3JB9D 1NJIU 1O9SA 3FEOA 1VQLA 2MWOA 3CBPA 3PMIA 1ZQ1A 2QQSA 3OS0A 5L8RE 5GANe 2PU9B 4BD3A 1MHNA 2E6ZA 1YCYA 2E5QA 2QTXA 4M77B 4XTXA 3C95A 2RH2A 2RHYA 2GFAA 5FU6C 4NOYA 1WJSA 3TREA 5LJ5e 4JLIA 4A4EA 3CCEA 1YJNT 3FC3A 1Q82C 1LOJA 4MMLA 3SWNC 1M5Q1 2O4XA 3MEUA 1VQLT 2XU8A 3TU4K 3I55A 3DLMA 1WPYA 2L8DA 4IUQA 4C8QB 3PTAA 4E7KA 3C4SA 1QP2A 2QQ9A 3QBYA 4QQGA 5HKCA 3JB9H 1QW1A 3C12A 3OB9A 5GMKi 2VYTA 3QZ5B 3CMAA 2LX9A 1KQ2A 4L6V5 2DO3A 1WQWA 3CC2A 1QVFA 1M8VA 3OYEA 1G3WA 2DTHA 3L2UA 2GCXA 3A8HB 5D6YA 4EPCA 4BE0A 3OMCA 5GAOl 2ZPFB 5GAN8 4M78D 4M7AF 3PMTA 1N6AA 2GFUA 3BDUA 3M53A 4FIBA 4BUGA 1KD1U 2Y4YA 4MZPA 1VQ6T 2RI2A 4C92B 1Q82U 3CBMA 4M77D 5D6XA 2FVUA 4XTVA 2K57A 2EQJA 1W2BS 1U1SA 1OI1A 2DXCA 3LGLA 1M9SA 3PGGA 4HKEA 2IVWA 2WSCE 3V8KA 3HHTB 4PJOD 4LDXA 2G3RA 4JDSA 1N8RU 3MEWA 3HFOA 4N4IA 1UEBA 5I2MA 2WACA 5KCHA 4NL3A 3GNFB 2KVQG 5GAN7 1M1KU 1IREB 1WJRA 1G5VA 4X9CA 3M4GA 4BACA 4XU2A 1Q86C 3KUFA 4M78A 3OYFA 2FYKA 4C92F 5DM7R 4N4GA 2CZ0B 2ZPIB 3WVDB 1RL2A 2R57A 4M78C 1JJ2S 5DY9A 4C5GA 3OS2A 2HNIA 4XU1A 4PL6A 5GAN6 1I81A 5LJ3j 2K5LA 1SSFA 3GOXA 2E6NA 1S72A 2CKKA 2NLUA 1VUBA 2CYZB 3OYMA 1VQ5A 2DXBA 3QHSA 3L2WA 5KCOA 3OYHA 4LDUA 2XG8D 4ZN1A 4RKUE 1YHQA 2DAQA 2A7YA 4F7UE 2H3JA 3OYNA 1VQPA 4JRIA 4HCBA 3OYLA 4OVAA 3OW2A 2K5IA 4RG2A 2VC8A 4C8QF 2X35A 1WQ7A 3GNGA 5LJ3h 2QA4T 2B8AA 2IG0A 2RO0A 5FRNA 2LNVA 1Y96B 3META 5GAMj 1FWZA 5FU7C 3L42A 4XK8E 2DVEA 2PVDB 2VV5A 5AYFA 4IUTA 2WSFE 3G71T 1Y7XA 4M77G 1YJ9A 3FRNA 2QQRA 3M54A 4N0AA 3CCUT 3MP8A 3VYGA 4NL2A 3LX7A 4C0FA 1VQ4T 1M90U 4EDUA 3OYYA 3JB9I 1FXXA 2MF2A 5HK3A 3I55T 2E12A 4KUIA 3RMSA 2PVOB 3OMGA 5LJ5d 1KC8C 2M0OA 4M77E 1KQSS 1HK9A 1NZ9A 2KQWA 2JTFA 3PNWC 5CKBA 2QEXA 4L5GA 2E41A 1VQMT 2F5KA 2D6FA 4BB7A 3QG1A 3QYHB 4B9WA 3CCJT 4A54A 1BIAA 3ER0A 1M1KC 3OBWA 1XOVA 4J5YA 3VJPA 3ZBDA 2ZCFB 4OMFB 4M75G 4GY5A 5KH6A 3G4ST 2C06A 4C5EA 1M1GA 3FJPA 5A2QE 1N9RA 3CCJA 3JCMJ 1YI2T 3DKMA 2XKOC 3JSCA 2QEXT 5CR2A 5IN1A 3INZA 3LYIA 1JJ2A 5GMKj 3CCMT 2MAMA 3JCMb 1K8AU 4DQ2A 4PJOA 2K3XA 4BY6B 2XI9A 4M75E 4Z02A 3X24B 3CCLT 4F7UG 4PJOF 4JRPA 4UC4A 1GXIE 5CKFA 1UGPB 1M1FA 4XAXB 2RB6A 2RK2A 5GMKl 2DZ9A 2BIVA 2M9UA 3SWNA 4M7DA 4C5IA 1G3TA 2QQAA 3CCMA 4M7AE 1N9SA 2CS7A 2EAYA 4M7AC 2X4JA 1UGRB 3CC4A 5GAMg 2KSSA 4EMGA 1YJWT 1YI2A 4BI8B 4KULA 5LJ5j 2QXFA 3MP1A 1Q81C 4RG8A 4QQDA 5J39A 1Q86U 2LRQA 1W4SA 3NTIA 5C0MA 2HQEA 4OGCA 1VQOT 2R58A 4M7AG 5CCAA 4GLKA 4O6JA 3E9FA 3E1SA 2D9TA 2HD0A 5I21A 2O01E 3QPHA 4C0GA 3E19A 3BW1A 2RA2A 4KUDK 2HQXA 4DA4A 1IZ6A 2JVVA 2RM4A 4HCZA 5GAMd 4MDXA 4X9DA 4F7UB 2AHJB 3CMET 2DK3A 5CQXA 2XICA 2CZ7B 1U1TA 3JB9G 2KY9A 3OW2S 4LDVA 2K3YA 1Y96A 2RHXA 2X4YA 1BI1A 1JB0E 4M78F 3UWNA 5DLOA 1QVGS 3LH0A 4C92A 1U8RA 4A4KA 2QQBA 4YTLA 4V2SA 3X28B 1LNXA 4MZTA 2EJFA 3MEAA 5A0DA 1HXDA 1N27A 2JN0A 3HSBA 4Q5WA 5IT9E 3C94A 3SWNB 4J83A 3G6EA 4LD6A 2DIQA 1YIJA 5IAYA 3OY9A 3CCSA 3JB9J 4A4GA 2RHIA 1Q7YU 1K9MC 1I4K1 2EQUA 2VGMA 3VUZA 1YITA 4JS4A 3OYAA 3QJ6A 3M5AA 2KAFA 4M77A 4DOWA 3UPUA 4J8OA 4C92D 1Q7YC 1VQKT 2D0QB 4ZGEB 5LJ3g 3JCMQ 3EAEA 3CCST 1ZBXA 2ZZDA 4OP0A 2CZ1B 5DLQE 3H8ZA 3QDRB 3RUXA 5LJ3e 3CCRT 1KHCA 4MDWA 3V7SA 2DJZA 2EJGA 2JUFA 2RJEA 2E64A 2E10A 2X4XA 4ATOA 5GANh 4C92C 3DB4A 4R55A 4E7HA 2YLBA 5D6WA 4M75B 5KE2A 5GANf 3QO3A 2LQ8A 3JCMg 3HRUA 5CKDA 3P8BB 4XQ3A 4A4FA 3I56T 1R8OB 1XTDA 3V7RA 4E7JA 4M75A 3OYBA 3TCJA 3MO8A 1K9MU 4ZTJA 3NFCA 3F70A 4ME7A 2QI2A 3HRSA 4FT2A 4HT9A 1AHJB 1JBMA 2EIFA 1P92A 1M4ZA 1I5LA 3S3OA 2RJDA 3N5BB 4M78B 3PIPA 1KQ1A 4PNOA 4JUVA 3JCMd 5CKEA 5GAOm 2L89A 5CVIA 4MZMA 2P4TA 4RCCA 1UB4A 4JJNK 4J6YA 3OS1A 3LWHA 2JOYA 4B9XA 3CC7A 3KBGA 3CBOA 4C5HA 4LDWA 4FM4B 3QUIA 3MP6A 4C8QE 3A8MB 3OS5A 3L1AA 2E65A 3JCMe 3ZEHA 2Y4XA 4A4HA 5GAOn 3L2RA 3CEYA 4P5NA 1B34B 4A53A 2ZGWA 3VYHB 3X26B 1EIFA 1JRIA 4HT8A 2XD0A 2P0PA 4M7DB 1Y71A 2R5MA 3CCQT 2LTOA 3G4SA 3E9GA 2L3RA 4Y28E 3JCMX 1UGQB 1K73U 2VXFA 3JCMV 2L5QA 3LGFA 3RKYA 2DZCA 5CQYA 3CD6T 3FB9A 3VUBA 3JCMc 3S3MA 4JRKA 4C0DC 2EQKA 4J7IA 2YLCA 2QDYB 1I8FA 2DEQA 2M1HA 3MHXA 5I2SA 4M7AD 2LDMA 3EFSA 3G7ZA 2PUKB 3JRZA 5LJ5g 2OTJT 3HPWA 4LD9K 3QXEB 1TH7A 2KMTA 2ZPHB 5CAIA 4E47A 2WSEE 1QVPA 1KHIA 3HL8A 1ZHIA 2V8JA 3LLRA 4IURA 3DLLA 2RHUA 2DKGA 5CO7A 4EMKC 3CXCA 3O8VA 4PKCC 2DTIA 2PUOB 4N0AC 5LL6S 1Y07A 5CK9A 4PLLA 2RHZA 3J7AF 2F69A 4E7LA 1BKBA 3CCUA 2DD4A 1K73C 5GAOq 4J6WA 1V29B 5GAN3 4BDYA 2YRVA 2OTLT 2GQVA 2MI6A 5GMKh 4KBMB 1MGQA 3T9NA 5J26A 3BFMA 2LC4A 4JLGA 5GAN2 4OB1B 1H3ZA 1NPPA 4Y91A 1BIBA 1FX7A 2GF7A 3JCMh 2OAUA 4M75D 4C8QG 1KC8U 1DJ7B 3OSVA 4MMKA 3QZ9B 3QYGB 1VQNA 4PLIA 1YIJT 1H641 3QJYA 4ZGJB 1PSEA 4HCCA 1YHQT 3G6ET 1XNIA 4F7UF 3RESA 3GLXA 5GMKm 3J80E 4M7DF 3CPWS 3OBYA 3NTKA 5GANd 5FROA 4XTYA 5LJ3f 2KDSA 3BDLA 4RCBA 2RJCA 3RKXA 4EMHA 4M78G 4XTUA 1W2BA 2RJFA 4EMKB 2JNGA 3GIBA 2JZ2A 2K4YA 3VV0A 3KXTA 2MMPA 2K5FA 1UGSB 1NE8A 3M9QA 4LDYA 3WXMB 3ZFJA 3CMEA 1VQOA 3RIRA 5FRMA 1X75C 1LJOA 3CD6A 3JAME 2OTJA 2LVMA 3GP8A 5HK0A 4J7FA 4QVZA 4M7DE 5GANg 2LT1A 4M78E 3HFNA 1VQ7T 1BI2A 2F5TX 2EYQA 2XK0A 2RD1A 4IUVA 2RK1A 2DTOA 4FT4A 3L2VA 3CC4T 2O4XB 2EJ9A 2VXEA 3GF5A 5GAN4 2VUBA 2RI3A 3V8LA 3QSUA 4WF2A 4CI0C 1WJQA 2EKOA 3EFRA 2R5AA 3CC7T 4M7DG 1QVFS 4JS5A 3ME9A 3M55A 3L2ZA 3HRTA 3M57A 2CZ6B 4QVCA 4QW2A 4E7IA 2YHTA 1VIFA 5KE3A 3OYKA 4CRIA 4XU0A 2E70A 2V8KA 4NS5A 2ZPEB 2FL7A 5C6SA 1BYMA 3X25B 1WNLA 4XTWA 3CC2T 5GAMh 5LJ3d 3V8JA 4PJOB 3CMAT 4O5VA 1RI0A 3PFSA 1X6OA 3SFMA 1BI3A 3PT9A 4C92E 5GAMe 5GAMf 3CCET 5GAOp 5A0GA 5FU7B 5CIUA 1D3BB 4OF1A 4OB0B 1KG1A 4ZN3A 2P0QA 2LCCA 4M75F 2X4WA 4IUUA 2XDDA 1G3YA 2CGHA 4QQ6A 3VKIA 4FU6A 3OSSC 1N8RC 5GANj 1YJNA 3VU3C 2XHCA 1BI0A 3HP9A 4OB2B 3OYCA 3I56A 3GPLA 3S3NA 1VQMA 3FDRA 2K2VA 1NJIC 5A0LA 3LW5E 2E1HA 5EG2A 1KQSA 4FSXA 2BUDA 4IUPA 2VGNA 3Q1JA 2DXUA 4OB3B 3UDCA 3OYJA 4BDZA 3G71A 1YJ9T 3A5ZB 4OGEA 1PSFA 2EWNA 3UT1A 3L2QA 1K8AC 1VQKA 3OYDA 4N4HA 1D3BA 4PJOG 3J81E 1B34A 3CCRA 3MCAB 3WVEB 1VQ4A 2RI5A 1OZ3A 2ZPBB 3OA6A 1VQ8A 4HA8A 4L59A 2KK4A 1YITT 4M77F 1VQNT 3M56A 2ZPGB 3CCVT 3M59A 4II1A 3SDZA 1VQ7A 4IKFA 3DB3A 4C8QA 4C0ZA 3URGA 2QA4A 1OYXA 4XU3A 4M75C 1X01A 2EFIA 3AHUA 4PJOE 4PJOC 4R56A 2A3LA 3OQ5A 1VQ5T 2OTLA 1VQPT 2DPPB 2HBPA 3OYGA 4XTZA 3RERA 3SB2A 2FB7A 3V7CA 4DOVA 1KD1C 4BE1A 3M4YA 4M7AA 2PQWA 1XQHA 2DD5A 1G3SA 5LJ5h 3JB9F 4ELZC 5J3BA 3TEEA 1VQ9A 3RMQA 2P0KA 3JCMf 4M7DC 4C92G 3A8LB 3QKJA 1S72T 1QVGA 4J6XA 4X34A 2Y90A 4C8QD 2FHDA 4BY6C 4BI4A 3S6WA 3JCMW 3A8GB 2LT4A 3P8HA 3LWIA 4M77C 5FU6B 5M9OA 4FL6A 4QVDA 1VQ9T 2XDBA 4ZGDB 2PVGB 4RMOA 1OZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8A A;  2IG0 A;  2RO0 A;  3H8Z A;  5FRN A;  3MET A;  1KHC A;  4BE2 A;  2JZ2 A;  3ASK A;  3L42 A;  2RJE A;  2X4X A;  3M9Q A;  4IUT A;  5FRM A;  2MWP A;  3P8D A;  3DB4 A;  3FLG A;  2LVM A;  2QQR A;  3QII A;  4E7H A;  5D6W A;  4QVZ A;  5KE2 A;  3MP8 A;  3SD4 A;  3LX7 A;  2XK0 A;  4IUV A;  4A4F A;  4EDU A;  3MEV A;  3L2V A;  2O4X B;  4E7J A;  2XDP A;  1WGS A;  2M16 A;  3OYB A;  2BKD N;  3H6Z A;  3NTH A;  3MO8 A;  2RI3 A;  3OMG A;  4ZTJ A;  2M0O A;  4ZTF A;  3F70 A;  1WJQ A;  2JTF A;  2EKO A;  3PNW C;  2DIG A;  2R5A A;  2EQM A;  2F5K A;  3S3O A;  4B9W A;  3ME9 A;  2RJD A;  3OYI A;  3FEO A;  2MWO A;  3PMI A;  4QW2 A;  3OS0 A;  2QQS A;  4E7I A;  5KE3 A;  4BD3 A;  2L89 A;  4GY5 A;  1MHN A;  4CRI A;  5KH6 A;  3OYK A;  4C5E A;  4NS5 A;  2E5Q A;  3OS1 A;  4B9X A;  5C6S A;  2RHY A;  2GFA A;  1WJS A;  5IN1 A;  3LYI A;  4A4E A;  4C5H A;  3FC3 A;  3MP6 A;  1RI0 A;  2O4X A;  3MEU A;  3PFS A;  3ZEH A;  2K3X A;  4A4H A;  3L2R A;  3CEY A;  5CIU A;  3DLM A;  2L8D A;  4IUQ A;  4Z02 A;  2R5M A;  4UC4 A;  4E7K A;  2LTO A;  2LCC A;  3C4S A;  2X4W A;  3QBY A;  3E9G A;  2L3R A;  4IUU A;  4QQG A;  2BIV A;  3OB9 A;  4C5I A;  4QQ6 A;  2VYT A;  3LGF A;  4FU6 A;  3OYE A;  1OZ2 A;  3S3M A;  2EQK A;  3OYC A;  3L2U A;  3S3N A;  5D6Y A;  3FDR A;  2M1H A;  4BE0 A;  3MP1 A;  3OMC A;  2LDM A;  5J39 A;  4QQD A;  2BUD A;  4IUP A;  3Q1J A;  2LRQ A;  3NTI A;  5C0M A;  3PMT A;  2HQE A;  3OYJ A;  2GFU A;  2R58 A;  4BDZ A;  3UT1 A;  3L2Q A;  2RI2 A;  3E9F A;  3OYD A;  4N4H A;  2D9T A;  3LLR A;  4IUR A;  5D6X A;  2RI5 A;  1OZ3 A;  2EQJ A;  2HQX A;  2RHU A;  3OA6 A;  1OI1 A;  4L59 A;  3LGL A;  3O8V A;  4HCZ A;  2G3R A;  4PLL A;  4II1 A;  3MEW A;  4N4I A;  2RHZ A;  3DB3 A;  2WAC A;  4IKF A;  2K3Y A;  2RHX A;  5KCH A;  2X4Y A;  3UWN A;  4E7L A;  1OYX A;  1WJR A;  2EFI A;  3LH0 A;  1G5V A;  4BAC A;  4BDY A;  2YRV A;  3KUF A;  3OYF A;  3OQ5 A;  4N4G A;  3MEA A;  5J26 A;  1N27 A;  3OYG A;  2R57 A;  4Q5W A;  4C5G A;  1H3Z A;  3OS2 A;  4BE1 A;  3GOX A;  4PL6 A;  2PQW A;  4LD6 A;  2GF7 A;  1SSF A;  2DIQ A;  2E6N A;  5IAY A;  3OY9 A;  2CKK A;  4A4G A;  2NLU A;  2RHI A;  3OYM A;  2P0K A;  2EQU A;  3L2W A;  5KCO A;  3QKJ A;  4PLI A;  3OYH A;  3OYA A;  3QJ6 A;  4X34 A;  1XNI A;  2DAQ A;  2FHD A;  3OYN A;  3NTK A;  3S6W A;  3P8H A;  5FRO A;  3OYL A;  5M9O A;  4OVA A;  4FL6 A;  4RG2 A;  3BDL A;  3EAE A;  2RJC A;  2X35 A;  2RJF A; 
#chains in the Genus database with same CATH topology
 2BZY A;  3R6O A;  3RKW A;  4BE2 A;  4M7A B;  3X20 B;  2J06 A;  2V8I A;  3FLG A;  2DE0 X;  1BB9 A;  3TSZ A;  1YJW A;  2FZK B;  3MEV A;  4C0D B;  4M7D D;  2XDP A;  5KYW B;  5L23 A;  2HAX A;  4F7U A;  4ZTF A;  1M90 C;  4EMK A;  3JCM P;  2E3H A;  4BI3 A;  3OYI A;  5GMK e;  1O9S A;  1K0X A;  5L8R E;  2PU9 B;  2E5Q A;  5FU6 C;  4XTX A;  3TRE A;  5LJ5 e;  1WJS A;  4JLI A;  4A4E A;  3FC3 A;  3SWN C;  1M5Q 1;  3MEU A;  2NUT A;  3TU4 K;  3I55 A;  3PTA A;  3C4S A;  1QP2 A;  3QBY A;  3OB9 A;  2LX9 A;  2EGA A;  4L6V 5;  1WQW A;  1RLP C;  3L2U A;  4QT7 A;  4JJB A;  2ZPF B;  5GAN 8;  4M78 D;  3HTR A;  2FPF A;  1N6A A;  4FIB A;  2RN8 A;  2RI2 A;  4CC3 A;  1IRX A;  2DXC A;  1K8A R;  1M9S A;  2WSC E;  1JO8 A;  4LUE A;  4E7S A;  4AG2 C;  1YFN A;  1N8R U;  4KH0 B;  3MEW A;  2BE9 B;  4WCI A;  1IRE B;  3M4G A;  3CME Q;  4X1V A;  3OYF A;  3CCV Q;  5DM7 R;  4PJJ A;  2YRD A;  2LQW A;  4PFO A;  4C5G A;  2FPE A;  4XU1 A;  1FMV A;  2NLU A;  1VUB A;  2DF6 A;  2AK5 A;  1OX9 A;  3OYH A;  2XG8 D;  4RKU E;  2DAQ A;  1VQP A;  1FYN A;  4OVA A;  4K11 A;  2HMA A;  4RG2 A;  2VC8 A;  1IHW A;  5LJ3 h;  3GBQ A;  4OML A;  1Y96 B;  2KT8 A;  1D1A A;  2YUP A;  1AD5 A;  5FU7 C;  5AYF A;  2J6O A;  1Y7X A;  4GLM A;  1YJ9 A;  1YWO A;  2YT6 A;  4C0F A;  4EDU A;  3JB9 I;  2A08 A;  5HK3 A;  3M0U A;  4KUI A;  3RMS A;  1D0X A;  2PVO B;  5LJ5 d;  1KC8 C;  4M77 E;  2RQR A;  4L5G A;  1WFW A;  2E41 A;  2F5K A;  3G71 Q;  3CCJ T;  1BIA A;  4OMM A;  3OBW A;  3CCJ Q;  1NLO C;  3ZBD A;  1TSF A;  4OMF B;  6AT1 B;  1PWT A;  1MND A;  1M1G A;  2DRK A;  2XKO C;  2EQI A;  5IN1 A;  1UJ0 A;  2DNU A;  2ROT A;  3JCM b;  1I0C A;  1ZUU A;  2MIO A;  3EGX B;  3VS6 A;  2K3X A;  4BY6 B;  2XI9 A;  4M75 E;  4JRP A;  1N8R R;  4UC4 A;  4PJL A;  5AT1 B;  3CCM A;  1N9S A;  2CS7 A;  2EAY A;  2HEQ A;  3CC4 A;  1YI2 A;  5LJ5 j;  1KSW A;  1Q81 C;  5J39 A;  3VRY A;  1QCO A;  1OPL A;  1Q86 U;  4OGC A;  4M7A G;  3E9F A;  1UE9 A;  3SHW A;  3NGP A;  3BW1 A;  4X9D A;  4F7U B;  1K76 A;  1C6V X;  4C92 A;  1TUC A;  2KYB A;  2QQB A;  1AOJ A;  4MZT A;  1ZSZ B;  1AWJ A;  5A0D A;  3HSB A;  4Q5W A;  5IT9 E;  4D8D A;  4CC2 A;  4A4G A;  1K9M C;  2EQU A;  4FYV B;  3OYA A;  4M77 A;  2LMJ A;  4C92 D;  2D0Q B;  4WTO B;  2CP6 A;  3JCM Q;  3EAE A;  2ZZD A;  2K9G A;  4OP0 A;  2CZ1 B;  1X6G A;  1KHC A;  1AWO A;  4ATO A;  5GAN h;  2DL3 A;  3DB4 A;  1UJY A;  3A1P A;  1M2O A;  3KFV A;  2HL3 A;  2LQ8 A;  2OJ2 A;  3M0Q A;  4HVV A;  3H9N A;  1UDL A;  1XTD A;  1YP5 A;  4E7J A;  1SHG A;  3OYB A;  4AFZ C;  1QCN A;  3NFC A;  3HRS A;  1T3L A;  1AHJ B;  1JBM A;  1CSK A;  4AFU C;  4PNO A;  5GAO m;  1Q86 R;  1B3Q A;  2P4T A;  2YXY A;  3LWH A;  2MK5 A;  1QMC A;  3CC7 A;  3CBO A;  4LDW A;  3QUI A;  5GAO n;  1OU8 A;  2GTO A;  4IIM A;  3X26 B;  2CSQ A;  1EIF A;  4DEX A;  2K2M A;  4HT8 A;  3BE3 A;  2R5M A;  3VS2 A;  1BBZ A;  3E9G A;  4Y28 E;  3RKY A;  3JCM c;  3S3M A;  4C0D C;  2KGT A;  5I2S A;  1G83 A;  2PUK B;  1JQQ A;  2KMT A;  4FCY A;  2LX7 A;  5CAI A;  1NBE B;  2GQI A;  2WSE E;  3HL8 A;  1ZA1 B;  5CO7 A;  2EYZ A;  1NLP C;  2DTI A;  2PUO B;  3H0F A;  8AT1 B;  2KBT A;  4RTW A;  1BKB A;  5GAO q;  2YRV A;  5GMK h;  3G1J A;  5J26 A;  5GAN 2;  1D09 B;  4OB1 B;  1VYT A;  1W1F A;  1KFZ A;  3JCM h;  2OAU A;  1M2V B;  3EGX A;  4MMK A;  3OSV A;  1VQP Q;  2JTE A;  1VQN A;  3QJY A;  2O31 A;  3G6E T;  3GLX A;  3CPW S;  3OBY A;  2HL5 C;  1I07 A;  2KDS A;  1TU0 B;  4EMH A;  1W2B A;  1RAD B;  2NWM A;  2K4Y A;  3KXT A;  1VQM Q;  3M9Q A;  4LDY A;  3CME A;  3CD6 A;  3RIR A;  2OTJ A;  3I5R A;  4M7D E;  2L0A A;  4PFZ A;  3HFN A;  1M3B A;  1KD1 R;  4IUV A;  2RK1 A;  2DTO A;  3CC4 T;  2EJ9 A;  2EYY A;  2EW3 A;  3QSU A;  4CI0 C;  1ZUK A;  1VQK Q;  3CCE Q;  1QVF S;  3L2Z A;  2Z0W A;  2L3Q A;  2IIM A;  4PK4 A;  2V8K A;  5C6S A;  2YUQ A;  5GAM h;  4PJO B;  3CMA T;  5A0G A;  5FU7 B;  1RAA B;  4OF1 A;  1F1B B;  4ZN3 A;  4M75 F;  1ZUY A;  2COY A;  1G3Y A;  3OSS C;  1GCP A;  2HKN A;  4ORZ A;  3I56 A;  3S3N A;  1T3S A;  1EX4 A;  1YN8 A;  4FSX A;  2BUD A;  2AZV A;  3Q1J A;  1YJ9 T;  1QQJ A;  2ED0 A;  5KYY B;  4BDZ A;  3A5Z B;  1K8A C;  2FG0 A;  4N4H A;  3WVE B;  1OZ3 A;  4M77 F;  1YIT Q;  2MYS A;  1VQ7 A;  3DB3 A;  4M75 C;  4R56 A;  1JEG A;  1VQ5 T;  2HBP A;  3RER A;  4BE1 A;  1D1C A;  4ELZ C;  5J3B A;  1VQ7 Q;  3TEE A;  3QKJ A;  3REB B;  1N5Z A;  4BY6 C;  1FMK A;  3S6W A;  3A8G B;  2OAW A;  3LWI A;  5FU6 B;  5KYN A;  1UHC A;  1X2K A;  2PVG B;  2X51 A;  2CUB A;  1YBY A;  3ASK A;  1Q81 U;  1VIE A;  5GAO r;  5LJ5 f;  2V1R A;  4KT0 E;  1RAB B;  1MMG A;  2MWP A;  3P8D A;  1H92 A;  3HKS A;  3SD4 A;  2LQK A;  2V1Q A;  4J9B A;  3CCQ A;  3CCL A;  2B86 A;  2BKD N;  2CH4 A;  3H6Z A;  3NTH A;  4LN2 A;  4D6W A;  4VUB A;  2DIG A;  2DVJ A;  3M58 A;  3CPF A;  2YRC A;  1B07 A;  4ELY C;  2I2L A;  4JRQ A;  1VQL A;  1FMW A;  1NJI U;  1ZQ1 A;  2QQS A;  2A36 A;  5GAN e;  4BD3 A;  4J9D A;  1YCY A;  2QTX A;  3EGD B;  1TWB A;  3C95 A;  1WHK A;  3CCE A;  2HCK A;  1AT1 B;  1OEB A;  5IHK A;  1VQL T;  2XU8 A;  2L8D A;  4E7K A;  2KT1 A;  5HKC A;  4QQG A;  1OUL A;  1QW1 A;  3C12 A;  2KI7 A;  3QZ5 B;  2DO3 A;  1M8V A;  3CD6 Q;  3PVL A;  2DTH A;  1VQO Q;  2GCX A;  1M30 A;  5D6Y A;  4BE0 A;  4KGX B;  4M7A F;  1WDX A;  3UA7 A;  2Y4Y A;  3VS5 A;  3REA B;  2ENM A;  2YWW A;  5D6X A;  4XTV A;  1OU9 A;  1U1S A;  1OI1 A;  3LGL A;  4HKE A;  3PGG A;  3V8K A;  3HHT B;  3CCL Q;  1WHG A;  4LDX A;  2C0T A;  2CT4 A;  4N4I A;  1UEB A;  2DMO A;  2WAC A;  3GNF B;  5GAN 7;  1G5V A;  4RTX A;  4XU2 A;  4M78 A;  2DYB A;  2NUZ A;  2VB6 A;  2R57 A;  4GBQ A;  2HNI A;  5LJ3 j;  4PL6 A;  2JMC A;  2DL5 A;  3OYM A;  3QHS A;  4LDU A;  2L3P A;  4F04 B;  1QWE A;  1YHQ A;  2AIR B;  2W0Z A;  1K1Z A;  4AG1 C;  3OYN A;  4HCB A;  3OYL A;  2CP5 A;  1NJI R;  1NYF A;  4RUG A;  2B8A A;  1OPK A;  5FRN A;  2LNV A;  3MET A;  1PKS A;  2GTJ A;  3L42 A;  2DVE A;  2PVD B;  2VV5 A;  4DBQ A;  3G71 T;  4HVU A;  3OW2 P;  1PM3 A;  4N0A A;  3VYG A;  1FXX A;  1SKU B;  3I55 T;  3VS3 A;  2M0O A;  1HK9 A;  3TSW A;  3LH5 A;  5CKB A;  2QEX A;  2D6F A;  3CC7 Q;  1I5O B;  3VJP A;  2ZCF B;  1MNE A;  5KH6 A;  3G4S T;  1YI2 Q;  3CC4 Q;  1YI2 T;  5A2Q E;  3CCJ A;  1N9R A;  3JSC A;  2QEX T;  2G6F X;  3CCM Q;  5GMK j;  2MAM A;  2D8H A;  4DQ2 A;  4PJO A;  2GNC A;  1GXI E;  3NMZ C;  5CKF A;  1UGP B;  1M1F A;  4XAX B;  2RB6 A;  4QKU A;  4R0K A;  2RK2 A;  1WLP B;  2M9U A;  1ZSG A;  4C5I A;  4J9F A;  2X4J A;  2CP2 A;  4JJD A;  5GAM g;  1VQ6 Q;  4KUL A;  1UGV A;  1GBR A;  4FYY B;  1NEG A;  1W4S A;  1VQO T;  2O9V A;  2R58 A;  4GLK A;  2A0F B;  3QPH A;  3E19 A;  2JVV A;  2RM4 A;  2KR3 A;  4MDX A;  2CH4 W;  1AZE A;  3CME T;  2AHJ B;  5CQX A;  2KY9 A;  4LDV A;  2K3Y A;  4PJO C;  1Z9Z A;  4A4K A;  4YTL A;  4Z8A A;  4V2S A;  3X28 B;  2EJF A;  2LNH B;  1N27 A;  2JN0 A;  3M0R A;  2AT1 B;  3EGD A;  5I11 A;  2O9S A;  2DIQ A;  1GBQ A;  1Z9Q A;  1V76 A;  3OY9 A;  3CCS A;  1Q7Y U;  2RHI A;  1YIT A;  3QJ6 A;  2VKN A;  2KAF A;  4DOW A;  4D8K A;  1VQK T;  3CCS Q;  1PG5 B;  2E5K A;  3CCS T;  1PHT A;  5DLQ E;  3H8Z A;  1QLY A;  3QDR B;  4E2F B;  2RPN A;  2E10 A;  2YLB A;  4LUD A;  2P4R A;  4M75 B;  5KE2 A;  3I56 T;  2JXB A;  1TS9 A;  1K9M U;  3F70 A;  4ME7 A;  1P92 A;  1M4Z A;  4M78 B;  1V1C A;  3PIP A;  2L89 A;  4MZM A;  4RCC A;  4J6Y A;  3OS1 A;  2BZ8 A;  3D7S B;  1AEY A;  2LCS A;  4C5H A;  4C8Q E;  3A8M B;  3OS5 A;  3L1A A;  3JCM e;  3CEY A;  3I55 Q;  2P0P A;  3H0H A;  3CCQ T;  1YJW Q;  2DFU A;  3JCM X;  2O88 A;  1H8K A;  1WHL A;  2L5Q A;  2DZC A;  2HZY A;  5CQY A;  3SEM A;  3FB9 A;  4JJC A;  2QDY B;  5I22 A;  2JT4 A;  4M7A D;  2LDM A;  1K0S A;  3G7Z A;  2OTJ T;  3QXE B;  2PZ1 A;  2RF0 A;  4J9H A;  2QEX Q;  1QVP A;  1KHI A;  4IUR A;  2HBW A;  3M0S A;  3CXC A;  1RUW A;  4N0A C;  5LL6 S;  1Y07 A;  1GL5 A;  4J6W A;  5GAN 3;  2YUN A;  2GQV A;  1MGQ A;  1WI7 A;  4ESR A;  3UF4 A;  1SHF A;  3BFM A;  2CP7 A;  4RTV A;  2AKK A;  4M75 D;  4C8Q G;  1KC8 U;  1SPK A;  2RQV A;  3QYG B;  4PLI A;  1H64 1;  5KYU B;  4HCC A;  1YHQ T;  1VQ8 Q;  3RES A;  5GAN d;  5FRO A;  3ULR B;  4RCB A;  4XTU A;  2RJF A;  8ATC B;  3NHN A;  2JZ2 A;  1IGQ A;  1UGS B;  1WZO A;  3WXM B;  3ZFJ A;  1LJO A;  1LCK A;  3JAM E;  2LVM A;  4J7F A;  4QVZ A;  2O2O A;  4FW1 A;  1TG0 A;  2EYQ A;  2XK0 A;  3L2V A;  4FT4 A;  2O4X B;  2VXE A;  5GAN 4;  1NYG A;  3V8L A;  1G2B A;  1WJQ A;  4M7D G;  3ME9 A;  3M55 A;  3HRT A;  3VS0 A;  2CZ6 B;  4QW2 A;  4E7I A;  1BCO A;  3OYK A;  2EYW A;  2E70 A;  2ZPE B;  3CC2 Q;  3X25 B;  1WNL A;  3CC2 T;  2FEI A;  1SF9 A;  3SFM A;  1RI0 A;  3PT9 A;  4C92 E;  1D3B B;  2H3E B;  2ED1 A;  2X4W A;  4DEY A;  2CGH A;  1JXM A;  4QQ6 A;  1GFD A;  5GAN j;  1YJN A;  1ZBJ A;  1BI0 A;  4E6R A;  2DET A;  1MUZ A;  1U3O A;  1KQS A;  5EG2 A;  4IUP A;  2VWF A;  1AWX A;  1CKB A;  4OGE A;  1PSF A;  3L2Q A;  2EBP A;  3OYD A;  3J81 E;  1B34 A;  1HYO A;  1D0Z A;  1VQ8 A;  4L59 A;  2D8J A;  1M90 R;  4KH1 B;  1VQN T;  3M56 A;  2ZPG B;  3CCQ Q;  3M59 A;  5KYX A;  4AFS C;  4II1 A;  4F17 A;  1S72 Q;  1CKA A;  3URG A;  4XU3 A;  3AHU A;  2LJ0 A;  1W6X A;  2COZ A;  2D0N A;  3VS7 A;  1RI9 A;  2DPP B;  1UHF A;  4XTZ A;  1EFN A;  2FB7 A;  1KD1 C;  1GFC A;  1UFF A;  3JB9 F;  5KYW A;  1VQ9 A;  3RMQ A;  2RQU A;  1WHJ A;  4C92 G;  1Y0M A;  1S72 T;  1QVG A;  4X34 A;  2Y90 A;  4C8Q D;  2FHD A;  5IXF A;  1K73 R;  4BI4 A;  3JCM W;  1Y57 A;  2LT4 A;  2XDB A;  1X43 A;  5ECA A;  4RMO A;  1IHV A;  4ZNX A;  5GJW B;  3CCV A;  3QWX X;  1O75 A;  1C0M A;  2JTM A;  3QII A;  3BY7 A;  2M51 A;  2PTK A;  2K6D A;  2XID A;  2K7A A;  5CKH A;  1IB8 A;  3M0T A;  1WGS A;  2M16 A;  5FLX E;  5KYY A;  1J3T A;  1VQ8 T;  1X6B A;  2EQM A;  3PIO A;  2HDA A;  2EPD A;  3CBP A;  2FO0 A;  3I56 Q;  2E6Z A;  2P84 A;  4M77 B;  2RH2 A;  2RHY A;  3UA6 A;  4NOY A;  1YJN T;  1Q82 C;  1RAI B;  1LOJ A;  4MML A;  1KK7 A;  9ATC B;  2QDL A;  4IIO A;  2ABL A;  4EIK A;  1OX8 A;  3DLM A;  4IUQ A;  4C8Q B;  1BK2 A;  2QQ9 A;  5GMK i;  2VYT A;  1OV3 A;  3OYE A;  1G3W A;  1ZX6 A;  3M0P A;  5GAO l;  3PVQ A;  2RQW A;  3PMT A;  3BDU A;  2GFU A;  3M53 A;  2RNA A;  1LPL A;  2SEM A;  4RTT A;  1Q82 U;  3EG9 B;  2K57 A;  2LJ1 A;  1W2B S;  4OMQ A;  2HKQ B;  4KGZ B;  4JDS A;  5FW9 A;  4OMN A;  3HFO A;  1YIJ Q;  1M1K U;  2KVQ G;  4X9C A;  2FYK A;  1MV0 B;  4N4G A;  2CZ0 B;  3WVD B;  1RL2 A;  4M78 C;  2FRW A;  5DY9 A;  3OS2 A;  3GOX A;  1I81 A;  2K5L A;  4RTU A;  2DIL A;  2E6N A;  2DXB A;  1D0Y A;  3L2W A;  5KCO A;  2ROL A;  2IPO B;  4F7U E;  1VQN Q;  2H3J A;  1ACM B;  2MCN A;  2QA4 T;  2IG0 A;  2JS2 A;  3VS1 A;  5GAM j;  1FWZ A;  4XK8 E;  2CDT A;  2WSF E;  2H8H A;  1MV3 A;  2L2P A;  3M54 A;  3CCU T;  3H41 A;  3LX7 A;  1WA7 A;  3OYY A;  2E12 A;  3OMG A;  2KQW A;  1D1B A;  3PNW C;  1W70 A;  2NYS A;  1VQM T;  4BB7 A;  3QG1 A;  1M1K C;  4B9W A;  3ER0 A;  1XOV A;  4J5Y A;  2E4H A;  4GY5 A;  2F1L A;  4JZ4 A;  4C5E A;  4Z88 A;  3DKM A;  2DL7 A;  5CR2 A;  1ZSZ A;  3CCM T;  2LZ6 B;  2DYI A;  3X24 B;  4F7U G;  1M1K R;  2BIV A;  1G3T A;  2QQA A;  4J9C A;  1I1J A;  1OQK A;  2CT3 A;  1UGR B;  2KSS A;  4EMG A;  2F2W A;  3ZL7 C;  4BI8 B;  4QQD A;  2LRQ A;  5C0M A;  1KIK A;  2HQE A;  4O6J A;  3E1S A;  2D9T A;  1ABQ A;  5I21 A;  2O01 E;  4C0G A;  4M4Z A;  2EGC A;  2HQX A;  4DA4 A;  1YHQ Q;  1IZ6 A;  4HCZ A;  5GAM d;  1U1T A;  3JB9 G;  2RHX A;  1BI1 A;  1JB0 E;  4M78 F;  3UWN A;  1QVG S;  1OOT A;  2W10 A;  1BCM A;  4AFQ C;  1X69 A;  1LNX A;  3MEA A;  1HXD A;  4DBF A;  1PC0 A;  2XMF A;  3G6E A;  5IAY A;  2M0Y A;  1ARK A;  1QWF A;  2NUT B;  1SRM A;  1M2V A;  3VRZ A;  3M5A A;  4FSS A;  3UPU A;  1Q7Y C;  1VQ5 Q;  2DRM A;  4ZGE B;  1ZBX A;  3NPF A;  4A63 B;  2KRM A;  3RUX A;  1RAH B;  1SEM A;  3V7S A;  2DJZ A;  2EJG A;  2JUF A;  2RJE A;  2E64 A;  2QTV A;  4C92 C;  4E7H A;  4R55 A;  5D6W A;  3QO3 A;  4J9I A;  1KC8 R;  2D1X A;  4M75 A;  3MO8 A;  2CRE A;  4ZTJ A;  1KQS P;  3EHQ A;  4HT9 A;  2EIF A;  1KQ1 A;  4JUV A;  1E6G A;  5CVI A;  4JJN K;  2JOY A;  4B9X A;  4HCK A;  3KBG A;  3MP6 A;  1R0B G;  2EVR A;  3ZEH A;  2Y4X A;  3L2R A;  1B34 B;  2ZGW A;  3VYH B;  1M3A A;  1JRI A;  2LTO A;  3G4S A;  2VXF A;  3JCM V;  3LGF A;  3CD6 T;  3VUB A;  2VVK A;  3VS4 A;  2E3I A;  3CXC P;  2DEQ A;  2M1H A;  2C0O A;  3EFS A;  1VQL Q;  3JRZ A;  5LJ5 g;  3HPW A;  7AT1 B;  1SRL A;  1JU5 C;  4CC7 A;  4E47 A;  3U23 A;  1ZHI A;  2V8J A;  3LLR A;  3DLL A;  1RAC B;  2RHU A;  2DKG A;  2JW4 A;  2KYM A;  3O8V A;  4PKC C;  1T0J A;  5CK9 A;  1PD1 A;  2F69 A;  4E7L A;  3CCU A;  2DD4 A;  2DL4 A;  1K73 C;  4Y92 A;  1V29 B;  4BDY A;  2MI6 A;  3MKD A;  4J9G A;  1H3Z A;  1NPP A;  4Y91 A;  1BIB A;  1FX7 A;  1GRI A;  4Z89 A;  4ZGJ B;  1PNJ A;  3IQL A;  1E7O A;  1XNI A;  4F14 A;  5GMK m;  3J80 E;  4M7D F;  3NTK A;  5KYU A;  1WXU A;  5LJ3 f;  3MJX A;  1WXB A;  2RJC A;  2FRY A;  4M78 G;  4EMK B;  2JNG A;  2DER A;  2LQN A;  3VV0 A;  2KNB B;  2AZS A;  2MMP A;  3RNJ A;  4LXC A;  1NE8 A;  3CPW P;  3EGU A;  5HCK A;  1VQO A;  5FRM A;  1X75 C;  3EG1 A;  3GP8 A;  5HK0 A;  5GAN g;  2ESW A;  2K3B A;  2LT1 A;  2LP5 A;  1VQ7 T;  2F5T X;  1Q95 G;  2JJ9 A;  1AZG B;  1X2Q A;  2JS0 A;  2VUB A;  2RI3 A;  1PD0 A;  2CUD A;  1WXT A;  3EFO A;  1JJ2 P;  2EKO A;  2R5A A;  3CC7 T;  4JS5 A;  3M57 A;  4QVC A;  1VIF A;  5KE3 A;  4CRI A;  2L3S A;  3QDF A;  2DJQ A;  2FL7 A;  4XTW A;  5LJ3 d;  3V8J A;  4RTY A;  2KEA A;  2A37 A;  3PFS A;  1X6O A;  5GAM f;  4FYX B;  3R6N A;  5GAM e;  5GAO p;  5IHI A;  1E6H A;  1KG1 A;  1PRM C;  2NUP A;  2LCC A;  3VKI A;  4FU6 A;  1N8R C;  4HVW A;  1VYV A;  3VU3 C;  2OTJ Q;  4LNP A;  2XHC A;  2CP0 A;  3HP9 A;  3OYC A;  3GPL A;  1VQM A;  1TXQ A;  1NJI C;  2VAS A;  2E1H A;  1VOM A;  2VGN A;  1WHM A;  2DXU A;  4OMO A;  1VQK A;  3EG3 A;  4PJO G;  3MCA B;  2ZPB B;  1K9M R;  4HA8 A;  2KK4 A;  4HXJ A;  2JMA A;  3SDZ A;  4IKF A;  4C8Q A;  4C0Z A;  1OYX A;  1X01 A;  2EFI A;  2ATC B;  3OQ5 A;  4F16 A;  2AKL A;  1R0C B;  1VQP T;  3OYG A;  3SB2 A;  3V7C A;  3UAT A;  2JM8 A;  2PQW A;  4B6M A;  3CCU Q;  1XQH A;  2DD5 A;  1G3S A;  5LJ5 h;  1MMN A;  4M7D C;  2X3X D;  2KRO A;  2P0K A;  3JCM f;  3A8L B;  3MPU B;  4J6X A;  1Q82 R;  3PE0 A;  3H0I A;  5IHN A;  2J6F A;  2DA9 A;  2FZC B;  4M77 C;  4FL6 A;  4QVD A;  1WIE A;  2EGE A;  4ANJ A;  4AT1 B;  2PNI A;  2OTL Q;  1QP3 A;  2BZX A;  2QK0 A;  3EFO B;  4C8Q C;  1VQ6 A;  2DL8 A;  3FIF A;  5GAN 5;  2YSQ A;  2MOX A;  3CXC S;  1RAF B;  2LCL A;  3THK A;  3CPW A;  2QAZ A;  1NPR A;  3A8O B;  4TVR A;  2FZG B;  5HY6 A;  2DXT A;  3JB9 D;  3FEO A;  2MWO A;  3PMI A;  1UG1 A;  2YDL A;  3RBB B;  3OS0 A;  1MHN A;  1WYX A;  4J9E A;  3SWN A;  2GFA A;  3JV3 A;  3TVT A;  1B7T A;  2HSP A;  2O4X A;  3G4S Q;  2DBM A;  1Q7Y R;  3C0C A;  1WPY A;  3JB9 H;  2V26 A;  1KQ2 A;  3CMA A;  1ZA2 B;  2X3W D;  4DBR A;  1ABO A;  3CC2 A;  1QVF A;  3A8H B;  4EPC A;  3OMC A;  1R77 A;  1VQ6 T;  4BUG A;  1KD1 U;  1GCQ A;  4MZP A;  4C92 B;  3I35 A;  3CBM A;  4M77 D;  1EZZ B;  2FVU A;  1IO6 A;  2EQJ A;  4JPB W;  4PFP A;  2IVW A;  1PRL C;  1JXO A;  1M27 C;  4JZ3 A;  4PJO D;  2G3R A;  5I2M A;  5KCH A;  4NL3 A;  3A98 A;  1WJR A;  4AMC A;  3G6E Q;  2J05 A;  4BAC A;  1XJW B;  1Q86 C;  3KUF A;  4C92 F;  2ZPI B;  1JJ2 S;  3EHR A;  2C0I A;  2QGF B;  2QG9 B;  5GAN 6;  1SSF A;  1BU1 A;  1IXD A;  1S72 A;  4DBH A;  2CKK A;  2CYZ B;  1VQ5 A;  4ZN1 A;  2A7Y A;  3RR6 A;  4JRI A;  1VQ4 Q;  1KJW A;  1UTI A;  1HSQ A;  5FWB A;  3OW2 A;  4CC4 B;  1RAE B;  2K5I A;  4C8Q F;  3FJ5 A;  1AWW A;  1K9A A;  3TQ7 P;  2X35 A;  1WQ7 A;  3GNG A;  1GCQ C;  2RO0 A;  4IUT A;  4M77 G;  4KRT A;  2CSI A;  3FRN A;  1LVK A;  2CP3 A;  2QQR A;  3MP8 A;  4NL2 A;  1VQ4 T;  1UEC A;  1M90 U;  4FW2 A;  2YUO A;  2MF2 A;  2J6K A;  3AT1 B;  1SG5 A;  4LE9 A;  1KQS S;  1NZ9 A;  2JTF A;  3QYH B;  4A54 A;  3EG0 A;  2KXC A;  2GGR A;  4M75 G;  2C06 A;  2DEU A;  3FJP A;  2KRS A;  3JCM J;  1JJ2 A;  3INZ A;  3LYI A;  1K8A U;  3E2U A;  4Z02 A;  3CCL T;  4PJO F;  1PCX A;  1YNZ A;  2RQT A;  1TUG B;  5KYX B;  5GMK l;  4M7D A;  2DZ9 A;  4M7A E;  4M7A C;  1Q81 R;  1YJW T;  1TUD A;  2QXF A;  3MP1 A;  2KE9 A;  4RG8 A;  1YWP A;  3NTI A;  2OI3 A;  1VYU A;  2QYZ A;  1M8M A;  5CCA A;  2HD0 A;  2QAS A;  4KUD K;  2RA2 A;  5D7U A;  5IH2 A;  2DK3 A;  2XIC A;  2CZ7 B;  3OW2 S;  4KGV B;  1G8X A;  1Y96 A;  2X4Y A;  5DLO A;  1WX6 A;  3LH0 A;  1U8R A;  1AVZ C;  3I9Q A;  3C94 A;  3SWN B;  4J83 A;  4LD6 A;  1QKW A;  1YIJ A;  3JB9 J;  1I4K 1;  2DBK A;  2VGM A;  3VUZ A;  4JS4 A;  1IGU A;  4J8O A;  4E7Z A;  5LJ3 g;  1U5S A;  2KXD A;  5LJ3 e;  3CCR T;  1NEB A;  4MDW A;  1HJD A;  1C1A A;  2X4X A;  1S1N A;  2QA4 Q;  1NM7 A;  5GAN f;  3JCM g;  3HRU A;  3O5Z A;  5CKD A;  3P8B B;  4XQ3 A;  4A4F A;  1R8O B;  1ZSZ C;  3V7R A;  1QCF A;  1M3C A;  3TCJ A;  2DM1 A;  3CCR Q;  2QI2 A;  4FT2 A;  1I5L A;  1SSH A;  3S3O A;  2RJD A;  3N5B B;  3JCM d;  3EH1 A;  5CKE A;  2FPD A;  1UB4 A;  1HD3 A;  2NUP B;  1YJN Q;  2OX7 A;  4FM4 B;  1VA7 A;  2EKH A;  2DLP A;  2E65 A;  4A4H A;  4P5N A;  4A53 A;  2XD0 A;  4M7D B;  1Y71 A;  2L3R A;  1A0N B;  1UGQ B;  2K79 A;  1K73 U;  3EG9 A;  4JRK A;  2EQK A;  4J7I A;  2YLC A;  1I8F A;  3MHX A;  1RAG B;  4LD9 K;  2A28 A;  1TH7 A;  2ZPH B;  2EYX A;  4EMK C;  1TTH B;  4PLL A;  1VQ9 Q;  2RHZ A;  1H3H A;  2F2V A;  3J7A F;  2OTL T;  3QWY A;  1TOV A;  4KBM B;  3T9N A;  2COW A;  2LC4 A;  4JLG A;  3EG2 A;  1T0H A;  2LJ3 A;  1U06 A;  2BTT A;  2QGG A;  2GF7 A;  5IXB A;  1DJ7 B;  3RDV A;  3QZ9 B;  1YIJ T;  1PKT A;  1PSE A;  4F7U F;  4XTY A;  2F2X A;  3BDL A;  1X27 A;  3RKX A;  5GJV B;  3GIB A;  1QVG P;  2K5F A;  2HQH A;  4OMP A;  2M02 A;  1QKX A;  4M78 E;  5EC7 A;  1BI2 A;  2RD1 A;  3GF5 A;  4PJM A;  2MPX C;  4WF2 A;  1ZLM A;  3EFR A;  4PJN A;  1UUE A;  1NG2 A;  2BE7 D;  3CQT A;  2YHT A;  4XU0 A;  4NS5 A;  2JM9 A;  1BYM A;  2X9H A;  1MMA A;  3CMA Q;  1W2B P;  4O5V A;  1BI3 A;  5FWC A;  1QVF P;  3CCE T;  3I5S A;  5CIU A;  4OB0 B;  2P0Q A;  4IUU A;  2XDD A;  2J7I A;  2GBQ A;  4OB2 B;  3FDR A;  2K2V A;  5A0L A;  3LW5 E;  3UDC A;  4OB3 B;  3OYJ A;  1WHH A;  3G71 A;  2EWN A;  2KRN A;  3UT1 A;  1D3B A;  3CCR A;  1VQ4 A;  2RI5 A;  3OA6 A;  2ECZ A;  1YIT T;  2DX1 A;  3CCV T;  2QA4 A;  2RMO A;  4PJO E;  1YJ9 Q;  2A3L A;  2I0N A;  2OTL A;  2ZAE A;  1MMD A;  1K4U S;  4DOV A;  3M4Y A;  4M7A A;  4FYW B;  1YCS B;  3EH2 A;  2SRC A;  3P8H A;  4RTZ A;  5M9O A;  1VQ9 T;  1RLQ C;  4ZGD B;  2HSE B;  1OZ2 A; 
#chains in the Genus database with same CATH homology
 3R6O A;  3RKW A;  4BE2 A;  4M7A B;  1YBY A;  3ASK A;  1Q81 U;  1QP3 A;  1VIE A;  4C8Q C;  3CCV A;  5LJ5 f;  1O75 A;  4KT0 E;  3X20 B;  3FIF A;  5GAO r;  1VQ6 A;  2MWP A;  3P8D A;  2V8I A;  3FLG A;  2JTM A;  3QII A;  5GAN 5;  3BY7 A;  3HKS A;  3CXC S;  3SD4 A;  2XID A;  2LQK A;  5CKH A;  3CCQ A;  1YJW A;  3MEV A;  3CCL A;  4C0D B;  2LCL A;  4M7D D;  2XDP A;  1WGS A;  2M16 A;  5FLX E;  2BKD N;  3H6Z A;  3NTH A;  1VQ8 T;  2HAX A;  4F7U A;  4D6W A;  4ZTF A;  4VUB A;  3CPW A;  2DIG A;  3M58 A;  1M90 C;  2EQM A;  1NPR A;  3CPF A;  3A8O B;  4TVR A;  3PIO A;  4EMK A;  5HY6 A;  3JCM P;  4ELY C;  3OYI A;  4BI3 A;  2DXT A;  2I2L A;  5GMK e;  4JRQ A;  3JB9 D;  1NJI U;  1O9S A;  3FEO A;  1VQL A;  2MWO A;  3CBP A;  3PMI A;  1ZQ1 A;  2QQS A;  3OS0 A;  5L8R E;  5GAN e;  2PU9 B;  4BD3 A;  1MHN A;  2E6Z A;  1YCY A;  2E5Q A;  2QTX A;  4M77 B;  4XTX A;  3C95 A;  2RH2 A;  2RHY A;  2GFA A;  5FU6 C;  4NOY A;  1WJS A;  3TRE A;  5LJ5 e;  4JLI A;  4A4E A;  3CCE A;  1YJN T;  3FC3 A;  1Q82 C;  1LOJ A;  4MML A;  3SWN C;  1M5Q 1;  2O4X A;  3MEU A;  1VQL T;  2XU8 A;  3TU4 K;  3I55 A;  3DLM A;  1WPY A;  2L8D A;  4IUQ A;  4C8Q B;  3PTA A;  4E7K A;  3C4S A;  1QP2 A;  2QQ9 A;  3QBY A;  4QQG A;  5HKC A;  3JB9 H;  1QW1 A;  3C12 A;  3OB9 A;  5GMK i;  2VYT A;  3QZ5 B;  3CMA A;  2LX9 A;  1KQ2 A;  4L6V 5;  2DO3 A;  1WQW A;  3CC2 A;  1QVF A;  1M8V A;  3OYE A;  1G3W A;  2DTH A;  3L2U A;  2GCX A;  3A8H B;  5D6Y A;  4EPC A;  4BE0 A;  3OMC A;  5GAO l;  2ZPF B;  5GAN 8;  4M78 D;  4M7A F;  3PMT A;  1N6A A;  2GFU A;  3BDU A;  3M53 A;  4FIB A;  4BUG A;  1KD1 U;  2Y4Y A;  4MZP A;  1VQ6 T;  2RI2 A;  4C92 B;  1Q82 U;  3CBM A;  4M77 D;  5D6X A;  2FVU A;  4XTV A;  2K57 A;  2EQJ A;  1W2B S;  1U1S A;  1OI1 A;  2DXC A;  3LGL A;  1M9S A;  3PGG A;  4HKE A;  2IVW A;  2WSC E;  3V8K A;  3HHT B;  4PJO D;  4LDX A;  2G3R A;  4JDS A;  1N8R U;  3MEW A;  3HFO A;  4N4I A;  1UEB A;  5I2M A;  2WAC A;  5KCH A;  4NL3 A;  3GNF B;  2KVQ G;  5GAN 7;  1M1K U;  1IRE B;  1WJR A;  1G5V A;  4X9C A;  3M4G A;  4BAC A;  4XU2 A;  1Q86 C;  3KUF A;  4M78 A;  3OYF A;  2FYK A;  4C92 F;  5DM7 R;  4N4G A;  2CZ0 B;  2ZPI B;  3WVD B;  1RL2 A;  2R57 A;  4M78 C;  1JJ2 S;  5DY9 A;  4C5G A;  3OS2 A;  2HNI A;  4XU1 A;  4PL6 A;  5GAN 6;  1I81 A;  5LJ3 j;  2K5L A;  1SSF A;  3GOX A;  2E6N A;  1S72 A;  2CKK A;  2NLU A;  1VUB A;  2CYZ B;  3OYM A;  1VQ5 A;  2DXB A;  3QHS A;  3L2W A;  5KCO A;  3OYH A;  4LDU A;  2XG8 D;  4ZN1 A;  4RKU E;  1YHQ A;  2DAQ A;  2A7Y A;  4F7U E;  2H3J A;  3OYN A;  1VQP A;  4JRI A;  4HCB A;  3OYL A;  4OVA A;  3OW2 A;  2K5I A;  4RG2 A;  2VC8 A;  4C8Q F;  2X35 A;  1WQ7 A;  3GNG A;  5LJ3 h;  2QA4 T;  2B8A A;  2IG0 A;  2RO0 A;  5FRN A;  2LNV A;  1Y96 B;  3MET A;  5GAM j;  1FWZ A;  5FU7 C;  3L42 A;  4XK8 E;  2DVE A;  2PVD B;  2VV5 A;  5AYF A;  4IUT A;  2WSF E;  3G71 T;  1Y7X A;  4M77 G;  1YJ9 A;  3FRN A;  2QQR A;  3M54 A;  4N0A A;  3CCU T;  3MP8 A;  3VYG A;  4NL2 A;  3LX7 A;  4C0F A;  1VQ4 T;  1M90 U;  4EDU A;  3OYY A;  3JB9 I;  1FXX A;  2MF2 A;  5HK3 A;  3I55 T;  2E12 A;  4KUI A;  3RMS A;  2PVO B;  3OMG A;  5LJ5 d;  1KC8 C;  2M0O A;  4M77 E;  1KQS S;  1HK9 A;  1NZ9 A;  2KQW A;  2JTF A;  3PNW C;  5CKB A;  2QEX A;  4L5G A;  2E41 A;  1VQM T;  2F5K A;  2D6F A;  4BB7 A;  3QG1 A;  3QYH B;  4B9W A;  3CCJ T;  4A54 A;  1BIA A;  3ER0 A;  1M1K C;  3OBW A;  1XOV A;  4J5Y A;  3VJP A;  3ZBD A;  2ZCF B;  4OMF B;  4M75 G;  4GY5 A;  5KH6 A;  3G4S T;  2C06 A;  4C5E A;  1M1G A;  3FJP A;  5A2Q E;  1N9R A;  3CCJ A;  3JCM J;  1YI2 T;  3DKM A;  2XKO C;  3JSC A;  2QEX T;  5CR2 A;  5IN1 A;  3INZ A;  3LYI A;  1JJ2 A;  5GMK j;  3CCM T;  2MAM A;  3JCM b;  1K8A U;  4DQ2 A;  4PJO A;  2K3X A;  4BY6 B;  2XI9 A;  4M75 E;  4Z02 A;  3X24 B;  3CCL T;  4F7U G;  4PJO F;  4JRP A;  4UC4 A;  1GXI E;  5CKF A;  1UGP B;  1M1F A;  4XAX B;  2RB6 A;  2RK2 A;  5GMK l;  2DZ9 A;  2BIV A;  2M9U A;  3SWN A;  4M7D A;  4C5I A;  1G3T A;  2QQA A;  3CCM A;  4M7A E;  1N9S A;  2CS7 A;  2EAY A;  4M7A C;  2X4J A;  1UGR B;  3CC4 A;  5GAM g;  2KSS A;  4EMG A;  1YJW T;  1YI2 A;  4BI8 B;  4KUL A;  5LJ5 j;  2QXF A;  3MP1 A;  1Q81 C;  4RG8 A;  4QQD A;  5J39 A;  1Q86 U;  2LRQ A;  1W4S A;  3NTI A;  5C0M A;  2HQE A;  4OGC A;  1VQO T;  2R58 A;  4M7A G;  5CCA A;  4GLK A;  4O6J A;  3E9F A;  3E1S A;  2D9T A;  2HD0 A;  5I21 A;  2O01 E;  3QPH A;  4C0G A;  3E19 A;  3BW1 A;  2RA2 A;  4KUD K;  2HQX A;  4DA4 A;  1IZ6 A;  2JVV A;  2RM4 A;  4HCZ A;  5GAM d;  4MDX A;  4X9D A;  4F7U B;  2AHJ B;  3CME T;  2DK3 A;  5CQX A;  2XIC A;  2CZ7 B;  1U1T A;  3JB9 G;  2KY9 A;  3OW2 S;  4LDV A;  2K3Y A;  1Y96 A;  2RHX A;  2X4Y A;  1BI1 A;  1JB0 E;  4M78 F;  3UWN A;  5DLO A;  1QVG S;  3LH0 A;  4C92 A;  1U8R A;  4A4K A;  2QQB A;  4YTL A;  4V2S A;  3X28 B;  1LNX A;  4MZT A;  2EJF A;  3MEA A;  5A0D A;  1HXD A;  1N27 A;  2JN0 A;  3HSB A;  4Q5W A;  5IT9 E;  3C94 A;  3SWN B;  4J83 A;  3G6E A;  4LD6 A;  2DIQ A;  1YIJ A;  5IAY A;  3OY9 A;  3CCS A;  3JB9 J;  4A4G A;  2RHI A;  1Q7Y U;  1K9M C;  1I4K 1;  2EQU A;  2VGM A;  3VUZ A;  1YIT A;  4JS4 A;  3OYA A;  3QJ6 A;  3M5A A;  2KAF A;  4M77 A;  4DOW A;  3UPU A;  4J8O A;  4C92 D;  1Q7Y C;  1VQK T;  2D0Q B;  4ZGE B;  5LJ3 g;  3JCM Q;  3EAE A;  3CCS T;  1ZBX A;  2ZZD A;  4OP0 A;  2CZ1 B;  5DLQ E;  3H8Z A;  3QDR B;  3RUX A;  5LJ3 e;  3CCR T;  1KHC A;  4MDW A;  3V7S A;  2DJZ A;  2EJG A;  2JUF A;  2RJE A;  2E64 A;  2E10 A;  2X4X A;  4ATO A;  5GAN h;  4C92 C;  3DB4 A;  4R55 A;  4E7H A;  2YLB A;  5D6W A;  4M75 B;  5KE2 A;  5GAN f;  3QO3 A;  2LQ8 A;  3JCM g;  3HRU A;  5CKD A;  3P8B B;  4XQ3 A;  4A4F A;  3I56 T;  1R8O B;  1XTD A;  3V7R A;  4E7J A;  4M75 A;  3OYB A;  3TCJ A;  3MO8 A;  1K9M U;  4ZTJ A;  3NFC A;  3F70 A;  4ME7 A;  2QI2 A;  3HRS A;  4FT2 A;  4HT9 A;  1AHJ B;  1JBM A;  2EIF A;  1P92 A;  1M4Z A;  1I5L A;  3S3O A;  2RJD A;  3N5B B;  4M78 B;  3PIP A;  1KQ1 A;  4PNO A;  4JUV A;  3JCM d;  5CKE A;  5GAO m;  2L89 A;  5CVI A;  4MZM A;  2P4T A;  4RCC A;  1UB4 A;  4JJN K;  4J6Y A;  3OS1 A;  3LWH A;  2JOY A;  4B9X A;  3CC7 A;  3KBG A;  3CBO A;  4C5H A;  4LDW A;  4FM4 B;  3QUI A;  3MP6 A;  4C8Q E;  3A8M B;  3OS5 A;  3L1A A;  2E65 A;  3JCM e;  3ZEH A;  2Y4X A;  4A4H A;  5GAO n;  3L2R A;  3CEY A;  4P5N A;  1B34 B;  4A53 A;  2ZGW A;  3VYH B;  3X26 B;  1EIF A;  1JRI A;  4HT8 A;  2XD0 A;  2P0P A;  4M7D B;  1Y71 A;  2R5M A;  3CCQ T;  2LTO A;  3G4S A;  3E9G A;  2L3R A;  4Y28 E;  3JCM X;  1UGQ B;  1K73 U;  2VXF A;  3JCM V;  2L5Q A;  3LGF A;  3RKY A;  2DZC A;  5CQY A;  3CD6 T;  3FB9 A;  3VUB A;  3JCM c;  3S3M A;  4JRK A;  4C0D C;  2EQK A;  4J7I A;  2YLC A;  2QDY B;  1I8F A;  2DEQ A;  2M1H A;  3MHX A;  5I2S A;  4M7A D;  2LDM A;  3EFS A;  3G7Z A;  2PUK B;  3JRZ A;  5LJ5 g;  2OTJ T;  3HPW A;  4LD9 K;  3QXE B;  1TH7 A;  2KMT A;  2ZPH B;  5CAI A;  4E47 A;  2WSE E;  1QVP A;  1KHI A;  3HL8 A;  1ZHI A;  2V8J A;  3LLR A;  4IUR A;  3DLL A;  2RHU A;  2DKG A;  5CO7 A;  4EMK C;  3CXC A;  3O8V A;  4PKC C;  2DTI A;  2PUO B;  4N0A C;  5LL6 S;  1Y07 A;  5CK9 A;  4PLL A;  2RHZ A;  3J7A F;  2F69 A;  4E7L A;  1BKB A;  3CCU A;  2DD4 A;  1K73 C;  5GAO q;  4J6W A;  1V29 B;  5GAN 3;  4BDY A;  2YRV A;  2OTL T;  2GQV A;  2MI6 A;  5GMK h;  4KBM B;  1MGQ A;  3T9N A;  5J26 A;  3BFM A;  2LC4 A;  4JLG A;  5GAN 2;  4OB1 B;  1H3Z A;  1NPP A;  4Y91 A;  1BIB A;  1FX7 A;  2GF7 A;  3JCM h;  2OAU A;  4M75 D;  4C8Q G;  1KC8 U;  1DJ7 B;  3OSV A;  4MMK A;  3QZ9 B;  3QYG B;  1VQN A;  4PLI A;  1YIJ T;  1H64 1;  3QJY A;  4ZGJ B;  1PSE A;  4HCC A;  1YHQ T;  3G6E T;  1XNI A;  4F7U F;  3RES A;  3GLX A;  5GMK m;  3J80 E;  4M7D F;  3CPW S;  3OBY A;  3NTK A;  5GAN d;  5FRO A;  4XTY A;  5LJ3 f;  2KDS A;  3BDL A;  4RCB A;  2RJC A;  3RKX A;  4EMH A;  4M78 G;  4XTU A;  1W2B A;  2RJF A;  4EMK B;  2JNG A;  3GIB A;  2JZ2 A;  2K4Y A;  3VV0 A;  3KXT A;  2MMP A;  2K5F A;  1UGS B;  1NE8 A;  3M9Q A;  4LDY A;  3WXM B;  3ZFJ A;  3CME A;  1VQO A;  3RIR A;  5FRM A;  1X75 C;  1LJO A;  3CD6 A;  3JAM E;  2OTJ A;  2LVM A;  3GP8 A;  5HK0 A;  4J7F A;  4QVZ A;  4M7D E;  5GAN g;  2LT1 A;  4M78 E;  3HFN A;  1VQ7 T;  1BI2 A;  2F5T X;  2EYQ A;  2XK0 A;  2RD1 A;  4IUV A;  2RK1 A;  2DTO A;  4FT4 A;  3L2V A;  3CC4 T;  2O4X B;  2EJ9 A;  2VXE A;  3GF5 A;  5GAN 4;  2VUB A;  2RI3 A;  3V8L A;  3QSU A;  4WF2 A;  4CI0 C;  1WJQ A;  2EKO A;  3EFR A;  2R5A A;  3CC7 T;  4M7D G;  1QVF S;  4JS5 A;  3ME9 A;  3M55 A;  3L2Z A;  3HRT A;  3M57 A;  2CZ6 B;  4QVC A;  4QW2 A;  4E7I A;  2YHT A;  1VIF A;  5KE3 A;  3OYK A;  4CRI A;  4XU0 A;  2E70 A;  2V8K A;  4NS5 A;  2ZPE B;  2FL7 A;  5C6S A;  1BYM A;  3X25 B;  1WNL A;  4XTW A;  3CC2 T;  5GAM h;  5LJ3 d;  3V8J A;  4PJO B;  3CMA T;  4O5V A;  1RI0 A;  3PFS A;  1X6O A;  3SFM A;  1BI3 A;  3PT9 A;  4C92 E;  5GAM e;  5GAM f;  3CCE T;  5GAO p;  5A0G A;  5FU7 B;  5CIU A;  1D3B B;  4OF1 A;  4OB0 B;  1KG1 A;  4ZN3 A;  2P0Q A;  2LCC A;  4M75 F;  2X4W A;  4IUU A;  2XDD A;  1G3Y A;  2CGH A;  4QQ6 A;  3VKI A;  4FU6 A;  3OSS C;  1N8R C;  5GAN j;  1YJN A;  3VU3 C;  2XHC A;  1BI0 A;  3HP9 A;  4OB2 B;  3OYC A;  3I56 A;  3GPL A;  3S3N A;  1VQM A;  3FDR A;  2K2V A;  1NJI C;  5A0L A;  3LW5 E;  2E1H A;  5EG2 A;  1KQS A;  4FSX A;  2BUD A;  4IUP A;  2VGN A;  3Q1J A;  2DXU A;  4OB3 B;  3UDC A;  3OYJ A;  4BDZ A;  3G71 A;  1YJ9 T;  3A5Z B;  4OGE A;  1PSF A;  2EWN A;  3UT1 A;  3L2Q A;  1K8A C;  1VQK A;  3OYD A;  4N4H A;  1D3B A;  4PJO G;  3J81 E;  1B34 A;  3CCR A;  3MCA B;  3WVE B;  1VQ4 A;  2RI5 A;  1OZ3 A;  2ZPB B;  3OA6 A;  1VQ8 A;  4HA8 A;  4L59 A;  2KK4 A;  1YIT T;  4M77 F;  1VQN T;  3M56 A;  2ZPG B;  3CCV T;  3M59 A;  4II1 A;  3SDZ A;  1VQ7 A;  4IKF A;  3DB3 A;  4C8Q A;  4C0Z A;  3URG A;  2QA4 A;  1OYX A;  4XU3 A;  4M75 C;  1X01 A;  2EFI A;  3AHU A;  4PJO E;  4PJO C;  4R56 A;  2A3L A;  3OQ5 A;  1VQ5 T;  2OTL A;  1VQP T;  2DPP B;  2HBP A;  3OYG A;  4XTZ A;  3RER A;  3SB2 A;  2FB7 A;  3V7C A;  4DOV A;  1KD1 C;  4BE1 A;  3M4Y A;  4M7A A;  2PQW A;  1XQH A;  2DD5 A;  1G3S A;  5LJ5 h;  3JB9 F;  4ELZ C;  5J3B A;  3TEE A;  1VQ9 A;  3RMQ A;  2P0K A;  3JCM f;  4M7D C;  4C92 G;  3A8L B;  3QKJ A;  1S72 T;  1QVG A;  4J6X A;  4X34 A;  2Y90 A;  4C8Q D;  2FHD A;  4BY6 C;  4BI4 A;  3S6W A;  3JCM W;  3A8G B;  2LT4 A;  3P8H A;  3LWI A;  4M77 C;  5FU6 B;  5M9O A;  4FL6 A;  4QVD A;  1VQ9 T;  2XDB A;  4ZGD B;  2PVG B;  4RMO A;  1OZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...