2RHIA

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with h1.5k27me2 at 1.66 angstrom
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
CWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/nuclear protein
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA03
4II1A 4A4FA 3OYJA 4A4GA 3OYHA 1G5VA 3PMIA 2EFIA 3OMCA 4Q5WA 2EQMA 4N4IA 2XK0A 2R5AA 3H6ZA 5J39A 4IUTA 4IUQA 2K3XA 2LCCA 3MP8A 4Z02A 4ZTJA 2RI3A 4HCZA 2GFAA 3DB3A 3ASKA 5CIUA 4IURA 1XNIA 2R58A 4PL6A 1WJRA 2O4XB 2YRVA 4RG2A 2EQJA 3QIIA 4C5IA 3QJ6A 3L2UA 2MWOA 1WGSA 2F5KA 3NTIA 3MEWA 3MP6A 3OY9A 3NTHA 3OYFA 3FEOA 2K3YA 2O4XA 3OS2A 3UT1A 3M9QA 4B9WA 2JTFA 3LH0A 4A4HA 5KCHA 4BE0A 4E7JA 3H8ZA 3E9FA 2FHDA 4BACA 4BE2A 3QKJA 4GY5A 2HQXA 2RHXA 4X34A 3OA6A 3E9GA 3LLRA 4BDYA 2IG0A 4C5HA 2RJDA 1MHNA 3OS0A 3S6WA 3PMTA 4E7KA 5KH6A 3MO8A 4QW2A 4EDUA 3OYEA 4OVAA 3P8DA 3C4SA 3L42A 1WJQA 4BE1A 4FU6A 4E7IA 3OYDA 4UC4A 5IN1A 3OYAA 3OYNA 2RHIA 3L2WA 2EQKA 3DB4A 3OMGA 3GOXA 2LDMA 1KHCA 3MP1A 4QVZA 5D6XA 4N4GA 3FLGA 1N27A 3ME9A 3OYIA 4BD3A 3OYCA 2NLUA 4ZTFA 2X35A 4E7LA 3META 4QQDA 2DIGA 4IUPA 3ZEHA 3MEVA 2HQEA 3L2RA 1OZ3A 2B8AA 2EKOA 2BUDA 4QQ6A 3UWNA 5FRMA 2M1HA 2RI5A 2JZ2A 3MEUA 2QQRA 4L59A 3L2QA 3BDLA 3PFSA 5FRNA 2M16A 3OYBA 2MWPA 1OYXA 4CRIA 3OYKA 2RJCA 4C5EA 4LD6A 3OS1A 3PNWC 4B9XA 2RI2A 2BKDN 2E6NA 2LVMA 2G3RA 3MEAA 5C0MA 3EAEA 5C6SA 2E5QA 4BDZA 2GFUA 5KCOA 3L2VA 2RHUA 3OQ5A 2D9TA 2CKKA 4IUVA 2PQWA 2RO0A 1SSFA 1WJSA 2R57A 2EQUA 4NS5A 4A4EA 1OZ2A 3KUFA 2GF7A 4C5GA 2X4XA 4E7HA 3S3MA 3Q1JA 3S3OA 4QQGA 3OYLA 3OYGA 2VYTA 5FROA 3FDRA 2M0OA 2WACA 3CEYA 3SD4A 2X4WA 3P8HA 2X4YA 1H3ZA 4PLLA 2R5MA 3LYIA 2DAQA 1OI1A 2L8DA 5M9OA 3O8VA 2BIVA 4IUUA 5D6WA 1RI0A 5KE3A 5KE2A 4IKFA 3LX7A 3NTKA 2RJEA 2L89A 2P0KA 3OB9A 2RHYA 4PLIA 4FL6A 2XDPA 3F70A 4N4HA 2DIQA 3LGFA 3OYMA 2LRQA 2LTOA 3LGLA 5D6YA 5J26A 2RJFA 5IAYA 3DLMA 3FC3A 2QQSA 2RHZA 2L3RA 3S3NA 3QBYA
chains in the Genus database with same CATH superfamily
2MMPA 3VS7A 2DXTA 2CH4W 4C8QB 1HJDA 5GANh 4PFOA 2CP2A 4PJOD 1U06A 4HVUA 1M5Q1 1Q81U 1F1BB 1QVGS 2C0TA 2YLCA 1AVZC 1QKWA 2K9GA 3NTHA 1RACB 1YNZA 2C06A 1X43A 4HXJA 3OS2A 2X3XD 1KC8R 3G4ST 2LX9A 2FHDA 1VQ4A 1IO6A 2EW3A 3CMET 1WX6A 4QW2A 4RKUE 4ESRA 4OMPA 3OYAA 2LNHB 4AT1B 3DB4A 2PNIA 1UGSB 2CUDA 1H3HA 4J8OA 1QWFA 3CMAQ 2OX7A 2COYA 3M57A 2AK5A 4ANJA 3WVEB 3OSSC 1YITQ 4C8QF 2KE9A 1VQOA 3BDLA 5IHKA 3QWXX 1H8KA 2HL5C 2LZ6B 3PNWC 1E6GA 1D1CA 1VQNA 2K5IA 1N8RR 2RMOA 7AT1B 3OBWA 4IIOA 2DETA 1OPLA 4OMNA 1OZ2A 3KUFA 2KSSA 4JS4A 2XIDA 2P4TA 4JDSA 1BCOA 1H3ZA 3LH5A 1GBQA 5M9OA 2GQVA 4IKFA 5HKCA 2FZCB 1UECA 3OB9A 4HKEA 4N4HA 4NL2A 1S72Q 2KVQG 2KXDA 2M02A 2F5TX 4C92G 3CCUA 3V7CA 3UATA 3HFNA 3MPUB 1YHQT 3UDCA 1BB9A 3HRSA 2DO3A 4D8DA 2XU8A 4FYWB 2QGFB 1AZEA 2MCNA 2RI3A 2F2VA 4A54A 4V2SA 1RL2A 4NL3A 1YJNA 2EQJA 5GMKm 3CCVQ 1Q82C 1NPRA 1PWTA 4GLMA 3M0RA 3VS0A 1NJIC 1GL5A 5I2MA 3JRZA 4JLIA 3E9FA 1K4US 2HQXA 4J6XA 2DM1A 4LDYA 1K8AC 2LQKA 3TREA 3VU3C 1G2BA 5GAN5 2HL3A 1RAIB 2M0YA 2X4JA 2FPEA 1VQ8T 1SRMA 4C8QD 3RNJA 4C8QA 1SHGA 3OYNA 3CBOA 3SFMA 3L2WA 3TEEA 4QKUA 5FLXE 2DYBA 4BY6C 4LNPA 4D8KA 2NLUA 1AD5A 2X35A 5GMKi 2B8AA 4X9DA 3CCLQ 2EGEA 1VQ5A 2C0IA 2MOXA 1ZSZB 4L59A 1AWOA 3L2QA 2DFUA 1AEYA 4MZTA 1SSHA 3OQ5A 1SEMA 4M78E 3M0TA 2DE0X 2BZXA 5ECAA 2X4WA 3SWNC 5CQXA 1YI2T 4YTLA 1FMWA 2YT6A 2E4HA 2FL7A 3EHRA 2AT1B 5LJ3j 2DD5A 4Z89A 3CC2A 4OP0A 3JV3A 1KQ1A 4M77B 2E6ZA 3M0PA 1M3AA 1BI3A 3EG2A 3LGFA 2YRDA 2RQUA 1PD1A 2QA4T 3HPWA 3GF5A 4Y91A 1WHJA 1XQHA 1I0CA 1I4K1 4II1A 1VIFA 2LX7A 2KBTA 1K0XA 3M4GA 2NWMA 3DKMA 2IPOB 2GBQA 5CIUA 4PL6A 2YRVA 1B07A 1JBMA 5IXBA 1VQ7T 3QIIA 3IQLA 2DL7A 3QJ6A 3LWIA 3G1JA 1BI0A 2A0FB 2KMTA 1UGQB 1IREB 2EKHA 1X6BA 2O4XA 4Z88A 3A8LB 1TUDA 1PRMC 2PU9B 2ECZA 4RTWA 4M75D 2DVEA 4E7KA 2RK1A 2ED0A 3H0IA 1LPLA 4EDUA 1UHCA 4XU2A 1EIFA 3UPUA 2V8JA 4UC4A 1YJWT 4RCCA 1BCMA 1RAAB 1GFDA 3EG1A 4M77F 5L8RE 3DLLA 3EGDB 2GCXA 3FIFA 1X69A 4PJOE 3JB9H 3GBQA 4ZTFA 1X01A 4DBHA 1YN8A 2QQBA 2ESWA 2J6FA 2HQEA 1UJ0A 5FRMA 1KD1C 4PFPA 3G6EA 2M16A 5GAN7 2YLBA 2LVMA 2E6NA 2BZ8A 5GAN2 1B34B 1SPKA 3L2VA 4FIBA 1UE9A 1Q82R 1SKUB 3S3MA 3CCJQ 2VYTA 3FDRA 4JZ4A 2JTEA 3A8OB 3JB9D 3SWNA 4C0DC 4N0AC 3ER0A 2K2VA 4HCBA 2RN8A 4ORZA 1WQ7A 2EYXA 1YIJQ 1K8AR 3KBGA 4K11A 2M9UA 1ZSZA 1YJ9Q 2XDPA 5AT1B 3OYMA 3V8JA 2VV5A 3G4SA 2QQSA 1K76A 2DJZA 1VQPT 2JTMA 4A4GA 4DBFA 4IUTA 1VQ6Q 3CMEA 1QLYA 4XU0A 1NYFA 3CD6Q 1YFNA 1XNIA 1D09B 4AFZC 1W2BA 1C0MA 3NTIA 1R77A 2JOYA 4EMGA 1W6XA 4KGXB 5A0DA 4BE0A 4OGCA 4M77D 4M77A 4BACA 2GQIA 2RHXA 1I5LA 2V26A 1V76A 3EFOB 3PVLA 3HFOA 4J9HA 2QK0A 3MO8A 4JJBA 2OTJT 1D0YA 2Y90A 1WJQA 2PTKA 4FCYA 4AFQC 1OOTA 2EQKA 2QASA 5GJVB 1R0BG 3UF4A 3X25B 4JRKA 2AKLA 3M0QA 5GAOl 2W0ZA 2KR3A 1ZUUA 1UGRB 1YWPA 4VUBA 2DEUA 2QQRA 3M0UA 3FRNA 4M7AB 1FMKA 2RJCA 4KBMB 5GAN4 1RADB 4M7DB 2O31A 1X2QA 2G3RA 5C6SA 4JUVA 3HP9A 5HK3A 1YHQA 1KC8U 3OYGA 2OAUA 3M56A 4M78C 2CSQA 2QI2A 4PLLA 3EGDA 2L8DA 3PGGA 1AZGB 3CQTA 2QGGA 2K5FA 1YITT 1ACMB 5FU6B 1M3BA 2PVGB 2P0PA 1HK9A 1XTDA 4J7IA 5GANg 4M7AC 2JW4A 1WLPB 5J26A 3DLMA 3CPFA 2JMAA 3OYHA 3J81E 2ZAEA 1B34A 3OBYA 1LNXA 2K3XA 4IUQA 4M78G 3MP8A 2EJFA 1R8OB 1VQ8A 3P8BB 1M27C 5CKHA 1VQ9T 4C5IA 2ENMA 2ZZDA 4M7AF 1N8RU 4F16A 4FYYB 1ZA2B 1KD1R 1VQKT 3M9QA 2OTLT 4FYVB 3LH0A 1AWXA 3EGUA 5CKDA 3INZA 1M1KR 1M1GA 4CC2A 1JRIA 3MCAB 3X24B 1ZBXA 1E6HA 1M3CA 4J5YA 1X6GA 3VKIA 1G8XA 3X28B 2DTIA 2JS2A 1PHTA 5IXFA 1ZQ1A 1NEBA 2LMJA 4FT2A 3LWHA 2KK4A 4J6YA 1YI2A 5LJ3e 1Q86C 2CS7A 4KH1B 4FM4B 2M1HA 4LDXA 2KI7A 3CCMT 2KT1A 4E47A 1HXDA 1JU5C 1W2BS 2QQAA 2A28A 2L2PA 4B9XA 2CP7A 2QXFA 1CKAA 1NPPA 3EFOA 4M75E 2QQ9A 2RHUA 2EQIA 2QA4A 4C5GA 2J6KA 2K4YA 2WACA 1ABOA 2RA2A 3I5SA 3GNGA 2ZCFB 3VS2A 4JPBW 5LJ3h 2V1QA 4PJOG 2DEQA 4GBQA 2EWNA 3ZBDA 5KE3A 3CCLT 1I5OB 3OYYA 2NYSA 1VQ7A 5GAOq 3OSVA 1WXUA 5LJ5e 3M58A 2DIQA 5GANf 1VQ4Q 2D1XA 2HBWA 5HY6A 4M7AD 1EX4A 4M7AA 2DX1A 5GANd 4M7DD 2DA9A 4OMLA 1Y57A 3KXTA 3CC4T 5GAMg 1QCNA 1TUGB 1K9AA 1YJWA 2JN0A 4B6MA 1ZUYA 3MJXA 3EG3A 1WGSA 2VUBA 3PT9A 5LJ5h 1MGQA 3BDUA 3QO3A 3QYGB 1RI9A 4MZPA 2YDLA 3LLRA 1VQOQ 3JAME 3SEMA 4MDXA 1VQNQ 3C95A 2XI9A 4BE1A 3OYDA 2KXCA 2VGMA 2BE9B 1WDXA 3PIPA 1U3OA 4J9IA 3ME9A 3JB9I 2DXUA 2XG8D 1TSFA 4BD3A 2VXFA 1QWEA 1QVFP 2IIMA 1T3LA 1K9MC 4QQDA 2VB6A 1Z9ZA 1X2KA 1OEBA 1X75C 2FB7A 1O75A 1K1ZA 5FRNA 5CK9A 8ATCB 4AFUC 3T9NA 5FU7C 1TXQA 4C92B 2EAYA 2MK5A 3CCUQ 3BE3A 4KGVB 1GRIA 3EAEA 2GFUA 3CCST 3UA7A 2CKKA 2DL8A 1YWOA 1VQPA 2KROA 4MMKA 3A98A 3RKXA 3REBB 3OYLA 1Q81C 2CT3A 1MV3A 2M51A 2KRMA 2X4YA 1YJNQ 5IHNA 3VYGA 2YHTA 1KFZA 2E10A 4TVRA 1RAEB 2FO0A 3O8VA 3RERA 4PJJA 4ZGEB 1T0HA 2DXCA 3CPWA 2RJEA 1I07A 2L89A 3RBBB 2F69A 4C92C 5GAOp 2KYBA 4F14A 1Y96B 3QBYA 1VQMT 4A4FA 2RD1A 1TWBA 3QXEB 2XK0A 2HMAA 5J39A 3ZFJA 2D0QB 2CSIA 3I56T 2AHJB 5I11A 1NZ9A 3I55T 2RNAA 1TH7A 2OTJA 4A53A 5GAMf 2R58A 3TVTA 2O4XB 1QMCA 4X1VA 1PM3A 5GAMd 3X26B 1JQQA 4DOVA 2ZPHB 2MYSA 4C92F 2DZCA 5GAMe 3MP6A 1WFWA 3OW2P 1VQ5Q 2RQVA 1Q82U 4HCCA 3NHNA 4AFSC 1K0SA 1AT1B 3O5ZA 4OMMA 2DBKA 3OYEA 3P8DA 1U5SA 2DL4A 2CZ1B 2QYZA 3CXCA 1K8AU 4EIKA 2RHIA 4BY6B 4RTZA 1LVKA 2BE7D 5GAMh 5GAOn 2K57A 3OYIA 1OX8A 2RH2A 3NGPA 4DBRA 3CC2Q 2FVUA 2YUPA 3RKYA 1KQSA 1BBZA 3PFSA 4RTYA 4KT0E 3VUZA 3RKWA 3VYHB 2QAZA 1IZ6A 2X51A 4DOWA 5GMKe 4CI0C 3SWNB 3QDRB 3C12A 1J3TA 2NUPB 3WVDB 1UHFA 2DL3A 1PD0A 2ZPIB 3HL8A 1OI1A 1WIEA 5FWCA 1D3BB 1JJ2P 4KUDK 4DA4A 3LX7A 1VQ9A 2VASA 3H41A 1V1CA 4M4ZA 1VQKA 1K73C 5D6YA 2LT4A 3RESA 2OTLA 4C92D 1UUEA 5GMKh 3JCMW 2RHZA 2COWA 4C92A 2E70A 4M75G 2X3WD 1WHMA 1FWZA 4Q5WA 2DXBA 4DBQA 4F7UE 4FW1A 1D1BA 3E2UA 3PE0A 3ASKA 1K9MR 5CAIA 4A4KA 1PG5B 2EYZA 2IVWA 2DF6A 4J7FA 3RMQA 1X6OA 4FYXB 1VYTA 2ZPEB 3M53A 3FEOA 3TSWA 3UT1A 3EG0A 3CBMA 2ZPGB 1I1JA 1UGVA 2QEXT 3PVQA 4NOYA 1PKSA 3G6EQ 1U8RA 4L5GA 3OS0A 3CCMA 3NFCA 3I35A 3C4SA 1Y96A 2XMFA 2E1HA 1LJOA 2XICA 3CPWS 2ZPFB 1WHGA 2DK3A 3CCET 5DLQE 2QTXA 2E65A 4J83A 1WYXA 4PJNA 2AIRB 4PNOA 3JB9G 2GNCA 4JS5A 3JCMJ 3V8KA 4LXCA 1MMDA 1QVPA 2FRWA 3QPHA 3OYBA 2MWPA 1GCQC 1D0XA 1AOJA 4OB1B 3G4SQ 3MEAA 1UJYA 2H3JA 1ZA1B 2E5QA 2AZSA 5KCOA 4X9CA 4WCIA 1FX7A 1KK7A 2R57A 1KD1U 4NS5A 1TTHB 4BI8B 4ME7A 5DM7R 3CMEQ 2HSPA 4JJCA 4C0DB 3CC4A 2R5MA 2DAQA 1I8FA 1SRLA 1VA7A 1QVGP 1M1KU 3GP8A 3G71T 2JM8A 2LQ8A 2DRKA 2CZ0B 2DKGA 3VUBA 3CXCS 1FYNA 2XDDA 3F70A 2LTOA 3VS4A 2DVJA 4DEYA 3FC3A 1OV3A 4FSXA 2CZ7B 2FG0A 4ATOA 3PMIA 1IHWA 2P0QA 2HKQB 4MMLA 3E1SA 3EGXA 1KQSS 2KRSA 4ZN1A 1NJIR 1NYGA 3AT1B 4IURA 2NUPA 1M8VA 3CC7T 1RAGB 2ED1A 1YP5A 3QJYA 1IRXA 4HT9A 1C6VX 3QSUA 2V8IA 3L2UA 1ZX6A 2KGTA 3VRZA 2RQTA 1D3BA 1VQLT 5EC7A 2A3LA 2CGHA 2QDYB 2GTJA 3RDVA 3M54A 4Y28E 2YUNA 1UB4A 3CCQT 5HK0A 1Y07A 5EG2A 5GAOm 4OVAA 2FPFA 2F2WA 4E7IA 2GGRA 4BUGA 3JCMb 3JCMP 1YHQQ 3CCSA 4QT7A 1RAHB 4OB2B 1E7OA 3CCRT 2FEIA 2O01E 4CC3A 1HD3A 1KJWA 3FJPA 2WSCE 1M2VA 4PJLA 2HQHA 2V8KA 1K73R 1TU0B 1WHKA 5IHIA 1G3YA 1QQJA 3MEUA 1BU1A 1M90C 2DL5A 5GAOr 1WXBA 2EPDA 2K2MA 3EG9B 4XU1A 4ZN3A 2LCSA 3SHWA 3QG1A 2C0OA 2MPXC 2BZYA 1GCQA 2VVKA 2YSQA 2L3PA 4BDZA 4KH0B 4LD9K 5LJ3g 1ZLMA 3RUXA 4R55A 4M78B 1WXTA 1VQMA 4E7HA 1MNDA 3Q1JA 2HBPA 4QQGA 1UG1A 3SD4A 2M0OA 3HSBA 3RIRA 2CP5A 2LP5A 1VQ8Q 2RM4A 3EH2A 3I56A 3I55A 2EJGA 3JCMV 5DLOA 3M0SA 3H9NA 2LJ3A 8AT1B 2LRQA 5CVIA 4R56A 2DLPA 4OGEA 3OYJA 3ULRB 1LCKA 1YCSB 4C8QE 2H3EB 4J9DA 3J80E 1WPYA 5L23A 3PTAA 3CMAT 2DTOA 5GAN8 2DERA 5LJ5g 5FW9A 4N0AA 4OF1A 4A63B 2DJQA 2MWOA 3OY9A 1OU9A 1Y71A 2KQWA 1YI2Q 3HHTB 1G3TA 4E7JA 1TS9A 4A4HA 1I81A 3H8ZA 4M78F 3OA6A 3QDFA 4FT4A 2IG0A 2EBPA 1QCFA 2LJ1A 2F2XA 2J05A 2KEAA 2RB6A 1GXIE 4F7UG 2QA4Q 1G3SA 3N5BB 4J9FA 4JRIA 1KHCA 4QVZA 5D6XA 4F17A 4LDWA 3GLXA 1S72T 4EMHA 1UDLA 1QW1A 4J9EA 4ZNXA 3VS1A 1VQ7Q 1M1FA 1G83A 2DPPB 1EFNA 4CRIA 1OYXA 1Q86U 2D8HA 5IH2A 1Q7YC 2XD0A 2HNIA 2PQWA 3L1AA 4BB7A 4M7DG 3CCVT 5LJ3f 4KUIA 2E41A 3BY7A 5LJ3d 3HTRA 3V8LA 4MDWA 1YJWQ 2OJ2A 4PJOC 1VYVA 2YUOA 2MF2A 4XAXB 1PNJA 2J7IA 4PLIA 2DMOA 5CKFA 5D7UA 2HSEB 1M8MA 4PFZA 3EG9A 4LUEA 1FXXA 4RG8A 2QEXA 2A7YA 1UTIA 4PJOF 4M78D 2EVRA 4XK8E 4M78A 1NM7A 3DB3A 3A8MB 1M4ZA 5I2SA 5LJ5f 5I21A 2CDTA 2CYZB 4HCKA 3UA6A 1FMVA 5LJ5d 3CCEA 2YRCA 1W1FA 2ABLA 1M90R 3SB2A 1UEBA 3HRTA 2J06A 4B9WA 2PUKB 2A37A 3E9GA 4C0GA 1ARKA 2RJDA 1MHNA 3TQ7P 3I5RA 2DD4A 3M55A 1JB0E 5IN1A 3JCMe 4ELYC 2ROTA 1VQPQ 2OI3A 3CBPA 5CQYA 1NLPC 2DBMA 3VV0A 2RQRA 2EYWA 2HEQA 1N27A 1NLOC 3VRYA 1BIBA 3OYCA 2CUBA 4E7LA 3A8GB 3MEVA 4EMKC 3M5AA 4WF2A 2RI5A 5HCKA 5FU7B 4J9GA 3G71A 3MHXA 2PZ1A 1K9MU 5CKEA 3ZL7C 2O2OA 3M59A 3JCMh 3VJPA 1H641 4JLGA 1H92A 3HRUA 3EFSA 2GF7A 1MMGA 4P5NA 3S3OA 2OTJQ 4RTTA 2LJ0A 4ELZC 4JRQA 4LN2A 2LQWA 1DJ7B 5FWBA 2K3BA 2EJ9A 4E7SA 1Q95G 1WHLA 5D6WA 4PJOA 3CC7A 5KE2A 2XDBA 4M77E 2P0KA 4XQ3A 1UFFA 2OAWA 2NUZA 2DYIA 2QDLA 1VQLA 2P84A 1SG5A 4J9BA 1VIEA 1G5VA 2EFIA 1ABQA 3CCQA 2LCCA 4Z02A 1IXDA 5DY9A 4HCZA 4C8QC 2MIOA 2Y4XA 3V7SA 4OB3B 1JXMA 4RG2A 1VOMA 1MNEA 3BFMA 2FZKB 4XTVA 3CCRA 4FSSA 5KCHA 1IB8A 2JXBA 1BI1A 1LOJA 1Q7YR 3QUIA 4O5VA 2CP0A 3QKJA 4GY5A 2PUOB 1ZSGA 2ROLA 1TOVA 3SDZA 3S6WA 2KT8A 3PMTA 2MAMA 3CCJT 4PKCC 5CR2A 1EZZB 3KFVA 4C8QG 1A0NB 3AHUA 2YWWA 3RMSA 1Q86R 2FZGB 1M2OA 4XU3A 1OQKA 3OMGA 3GOXA 4E2FB 1YIJT 5I22A 1YJ9T 1WQWA 3JCMQ 4JZ3A 3L2RA 1RABB 5GAN6 1T3SA 2CP3A 1VQ9Q 2ATCB 1X27A 4EMKA 2VXEA 1NJIU 2HKNA 1VQKQ 4C5EA 2F1LA 4LD6A 1VQ6T 1B3QA 2OTLQ 3CD6T 5A2QE 1N5ZA 4FW2A 4DQ2A 4M75B 2RO0A 1MUZA 2RF0A 1JEGA 5FROA 4OMFB 1HSQA 3CMAA 3OS5A 2WSEE 2SRCA 1RI0A 3EHQA 1YITA 2EIFA 2H8HA 1IGUA 3EGXB 1AWJA 2RJFA 3CCMQ 3QHSA 2HZYA 2JM9A 4M75C 1AWWA 1XJWB 3OMCA 2RQWA 4XTZA 1K73U 3LW5E 4ZTJA 1QKXA 1C1AA 1BI2A 4OB0B 1T0JA 2D6FA 1BK2A 2SEMA 1KSWA 1JXOA 1WA7A 1N9SA 1SF9A 2K3YA 1UGPB 1HYOA 2JTFA 2PVDB 4M75F 4BI3A 1GBRA 2ZGWA 3M4YA 1S72A 2JT4A 4X34A 5CCAA 2NUTB 2A36A 2YXYA 1W2BP 2L3QA 5KH6A 5GMKl 1QVFA 4XTUA 2D8JA 1XOVA 4AMCA 1D0ZA 1M2VB 1KIKA 2LDMA 3MP1A 1W4SA 3CCVA 3C0CA 1PKTA 3CC4Q 4WTOB 4IUPA 4XTXA 4MZMA 3QZ9B 1AHJB 3X20B 4C0FA 4R0KA 2JZ2A 4E6RA 9ATCB 5IT9E 4M7AE 1Q81R 1ZSZC 3OS1A 2GTOA 4M7DE 2RK2A 1N6AA 2VKNA 2W10A 3JB9F 4BI4A 2O9VA 2FPDA 3RR6A 2KY9A 1GFCA 4KGZB 4JRPA 3GNFB 2BIVA 2I2LA 4IUUA 3CCLA 5A0LA 1PSEA 4AG1C 1OU8A 2CREA 4RTUA 1Y7XA 3TCJA 4M77C 4XTYA 4C0ZA 2AZVA 5LJ5j 3L2ZA 1GCPA 2KRNA 4M75A 5LL6S 3OW2A 4IIMA 1W70A 2GFAA 3VS3A 5GANj 3QYHB 2QG9B 3CCSQ 2FRYA 1P92A 3PIOA 2AKKA 4CC4B 3GIBA 1QCOA 2DNUA 2F5KA 4OMQA 5J3BA 2JMCA 2E5KA 3G7ZA 4M77G 3I9QA 1ZBJA 4GLKA 4BDYA 4C5HA 2FYKA 1YBYA 1M30A 4CC7A 2Y4YA 3C94A 4HVVA 3QWYA 1PRLC 1G3WA 3VS5A 1WHHA 1VQMQ 5GAN3 1M1KC 1OX9A 3I56Q 4O6JA 3I55Q 1WI7A 1S1NA 2DIGA 1OZ3A 1VQ4T 1KG1A 1R0CB 2A08A 1CSKA 2K5LA 3OYKA 2JUFA 2P4RA 1WZOA 1PSFA 2CZ6B 2NUTA 2KAFA 1NEGA 4PJMA 2Z0WA 3QZ5B 1JJ2A 1SSFA 1M90U 1VYUA 1OPKA 4PK4A 1OULA 2VGNA 3JSCA 5KYNA 2KYMA 3A5ZB 1QVFS 4J6WA 2K6DA 1N9RA 4LUDA 1VQOT 5A0GA 4RTVA 4DEXA 4QVCA 4KULA 1VQNT 2RHYA 5KYXB 2E3IA 4RTXA 3HKSA 1RLPC 3NMZC 4RUGA 1KHIA 2EQMA 4N4IA 1QP2A 1RUWA 2EYYA 3H6ZA 3EFRA 4ZGJB 4EPCA 1VUBA 4F7UB 3CCJA 2COZA 3GPLA 5GJWB 1BIAA 2B86A 2LNVA 5AYFA 3U23A 2HDAA 5KYUB 3MEWA 1YCYA 3NPFA 2VC8A 1MMNA 1YIJA 2E3HA 3CCUT 4HT8A 1KQ2A 1YJ9A 5GAMj 3JB9J 4JJDA 2RPNA 4L6V5 1QP3A 3A1PA 2EYQA 2CP6A 4D6WA 3TSZA 1IHVA 3D7SB 2VWFA 4J9CA 5KYWB 2KNBB 2WSFE 3L42A 1VQ6A 1YJNT 4KRTA 3CD6A 3FJ5A 2EGAA 2DRMA 3R6OA 1U1SA 3WXMB 1D1AA 4HVWA 2L0AA 2CT4A 1MMAA 4F04B 2BUDA 3UWNA 3OW2S 2K7AA 3JCMg 1WNLA 4F7UF 4C92E 5KYYB 1RAFB 1KC8C 2YUQA 3JCMX 2L5QA 3E19A 1QVGA 1TG0A 2QEXQ 4IUVA 4M7DC 2EQUA 2G6FX 6AT1B 4PJOB 3BW1A 5GMKj 1Q7YU 3CEYA 1U1TA 3P8HA 3H0FA 3H0HA 4AG2C 1VQ5T 4XTWA 3CCEQ 3EH1A 1O9SA 1PC0A 4Y92A 3NTKA 1M9SA 3URGA 3THKA 4M7DF 5FU6C 2DTHA 4M7AG 1JO8A 2JVVA 5IAYA 1TUCA 2MI6A 2L3RA 3S3NA 1PCXA 2D0NA 2J6OA 2R5AA 3CPWP 5CKBA 1N8RC 2HD0A 3TU4K 3A8HB 4ZGDB 1WJRA 3CC2T 2O9SA 2X9HA 2LQNA 2KDSA 1JJ2S 3OYFA 4RMOA 2BTTA 3REAB 3G71Q 4BE2A 5KYXA 2LCLA 3VS6A 2L3SA 1NE8A 2K79A 4LDVA 2V1RA 2QTVA 1MV0B 3FB9A 2JS0A 4FU6A 1BYMA 3V7RA 4F7UA 1BKBA 2EGCA 1ZHIA 1CKBA 1Y0MA 4N4GA 3FLGA 4RCBA 4EMKB 1RLQC 3R6NA 1V29B 4LDUA 2JJ9A 3META 3ZEHA 2EKOA 5KYUA 4QQ6A 3CC7Q 2DZ9A 3CXCP 3J7AF 2XHCA 3JCMf 2E64A 3JCMd 2O88A 2JNGA 1B7TA 1VQLQ 2RI2A 2ZPBB 2BKDN 4QVDA 5C0MA 2I0NA 1IGQA 2D9TA 5KYWA 1WJSA 1KQSP 4A4EA 1ZUKA 2LC4A 3CCQQ 4M7DA 2X4XA 4HA8A 1NG2A 5GANe 4Z8AA 2PVOB 3LYIA 4OMOA 1Z9QA 2LT1A 4E7ZA 3MKDA 2CH4A 3G6ET 3CCRQ 1SHFA 3JCMc 5CO7A 2XKOC 1NBEB 2HCKA 4FL6A 2HAXA 2E12A 4JJNK 3LGLA 5KYYA 2DILA 4LE9A
chains in the Genus database with same CATH topology
2MMPA 4M75C 4ATOA 2DXTA 3OYHA 3PMIA 3OMCA 3J81E 2P0QA 4MMLA 1B34A 3OBYA 4C8QB 3E1SA 1LNXA 2K3XA 4IUQA 4M78G 4XTZA 4ZN1A 5GANh 3MP8A 3LW5E 1K73U 1KQSS 4ZTJA 2EJFA 1R8OB 1BI2A 1VQ8A 3P8BB 4PJOD 4IURA 1M8VA 4OB0B 3CC7T 2D6FA 1M5Q1 5CKHA 1Q81U 1VQ9T 3QJYA 4C5IA 2ZZDA 1QVGS 4HT9A 3QSUA 4M7AF 2V8IA 3L2UA 1N8RU 2YLCA 1N9SA 1D3BA 1VQLT 3NTHA 1VQKT 2C06A 3OS2A 2K3YA 2A3LA 1UGPB 2CGHA 2QDYB 2JTFA 2PVDB 3LH0A 3M9QA 4M75F 4BI3A 3G4ST 2OTLT 2ZGWA 2LX9A 3M4YA 1S72A 2FHDA 4X34A 1VQ4A 5CKDA 5CCAA 3M54A 4Y28E 3INZA 1UB4A 3CMET 3CCQT 1M1GA 5HK0A 1Y07A 5EG2A 5KH6A 5GAOm 4QW2A 4RKUE 5GMKl 1QVFA 4OVAA 1JRIA 3MCAB 4XTUA 3X24B 1ZBXA 4E7IA 1XOVA 4BUGA 3JCMb 3OYAA 3JCMP 3CCSA 3DB4A 4J5YA 2LDMA 4OB2B 3MP1A 1UGSB 1W4SA 3CCRT 3CCVA 3VKIA 2O01E 4J8OA 3X28B 2DTIA 3FJPA 2WSCE 1ZQ1A 3M57A 4FT2A 4IUPA 2KK4A 4J6YA 3LWHA 1YI2A 5LJ3e 2V8KA 1Q86C 2CS7A 3WVEB 4XTXA 3OSSC 2M1HA 4FM4B 4MZMA 3QZ9B 1AHJB 4LDXA 3CCMT 3X20B 1G3YA 4C0FA 4C8QF 2JZ2A 3MEUA 4E47A 1HXDA 5IT9E 1VQOA 3BDLA 1M90C 4M7AE 5GAOr 1W2BS 2QQAA 4XU1A 4ZN3A 3OS1A 3QG1A 4M7DE 3PNWC 4B9XA 1VQNA 2K5IA 2RK2A 2QXFA 1N6AA 1NPPA 4BDZA 4M75E 3OBWA 2QQ9A 2RHUA 4LD9K 5LJ3g 2QA4A 3RUXA 4R55A 1OZ2A 3KUFA 2KSSA 4M78B 4C5GA 4JS4A 1VQMA 3JB9F 2XIDA 4BI4A 4E7HA 3Q1JA 2HBPA 4QQGA 2K4YA 2P4TA 2M0OA 2WACA 2RA2A 3SD4A 3HSBA 4JDSA 3RIRA 3GNGA 2RM4A 1H3ZA 2ZCFB 3I56A 5LJ3h 2KY9A 3I55A 4PJOG 2DEQA 2EJGA 3JCMV 5M9OA 5DLOA 2GQVA 4JRPA 2EWNA 3GNFB 2BIVA 2I2LA 4IUUA 3ZBDA 5KE3A 3CCLT 3OYYA 3CCLA 4IKFA 5A0LA 5HKCA 1PSEA 1VQ7A 3OB9A 4HKEA 5GAOq 1Y7XA 3OSVA 4N4HA 4NL2A 5LJ5e 2KVQG 3M58A 2DIQA 3TCJA 2F5TX 2LRQA 4M77C 3V7CA 4C92G 5GANf 5HY6A 3CCUA 4M7AD 3HFNA 4M7AA 5GANd 4XTYA 5CVIA 3UDCA 4C0ZA 5LJ5j 3L2ZA 4R56A 4OGEA 1YHQT 4M7DD 3HRSA 3OYJA 2DO3A 2XU8A 4C8QE 4M75A 3KXTA 3CC4T 5LL6S 1WPYA 3J80E 3PTAA 3OW2A 2RI3A 4A54A 3CMAT 2DTOA 5GAN8 2GFAA 5GAMg 4V2SA 1RL2A 3QYHB 5LJ5g 5GANj 4NL3A 1YJWA 1YJNA 1P92A 2JN0A 4N0AA 2EQJA 5GMKm 3PIOA 4OF1A 1Q82C 3GIBA 1NPRA 2MWOA 1WGSA 2F5KA 3OY9A 2VUBA 3PT9A 5J3BA 1Y71A 2KQWA 5LJ5h 1NJIC 3G7ZA 3HHTB 1G3TA 1MGQA 3BDUA 3QO3A 4M77G 3JRZA 3QYGB 5I2MA 4A4HA 4JLIA 1I81A 3H8ZA 3E9FA 4MZPA 2HQXA 4GLKA 4M78F 4FT4A 3LLRA 4J6XA 3OA6A 4BDYA 2IG0A 4C5HA 4LDYA 2FYKA 1YBYA 1K8AC 2LQKA 3JAME 3TREA 4MDXA 3VU3C 5GAN5 3C95A 2Y4YA 2X4JA 2XI9A 3C94A 1VQ8T 2RB6A 4BE1A 3OYDA 4C8QD 1GXIE 1G3WA 4F7UG 4C8QA 1G3SA 3CBOA 2VGMA 3SFMA 3N5BB 3OYNA 3L2WA 3TEEA 4JRIA 1KHCA 4QVZA 5D6XA 3PIPA 5FLXE 5GAN3 4LDWA 1M1KC 3ME9A 3JB9I 2DXUA 3GLXA 2XG8D 4BY6C 4BD3A 2VXFA 2NLUA 4O6JA 2X35A 5GMKi 1K9MC 4QQDA 2DIGA 1S72T 4EMHA 1QW1A 1OZ3A 2B8AA 1VQ4T 4X9DA 1KG1A 1VQ5A 1X75C 2FB7A 1M1FA 1O75A 2DPPB 4L59A 5CK9A 2K5LA 3L2QA 5FRNA 3OYKA 4CRIA 1OYXA 2JUFA 3T9NA 5FU7C 4C92B 2EAYA 1PSFA 4MZTA 2CZ6B 1Q86U 1Q7YC 2KAFA 3EAEA 2XD0A 2GFUA 3CCST 2HNIA 3QZ5B 3OQ5A 1JJ2A 2CKKA 2PQWA 3L1AA 1SSFA 4BB7A 1M90U 3CCVT 4M7DG 4M78E 5LJ3f 1VQPA 4KUIA 4MMKA 3RKXA 2E41A 3BY7A 5LJ3d 3OYLA 2VGNA 1Q81C 2X4WA 3SWNC 5CQXA 3JSCA 1YI2T 3V8LA 2X4YA 3A5ZB 4YTLA 4MDWA 3VYGA 2YHTA 4PJOC 1QVFS 4J6WA 2E10A 2FL7A 4TVRA 3O8VA 2MF2A 3RERA 4XAXB 1N9RA 4ZGEB 5LJ3j 2DD5A 1VQOT 5A0GA 3CC2A 2DXCA 4OP0A 1KQ1A 3CPWA 2RJEA 4M77B 2L89A 4KULA 4PLIA 2E6ZA 2RHYA 5CKFA 4QVCA 1VQNT 2F69A 1BI3A 3LGFA 4C92C 5GAOp 2QA4T 3HKSA 3HPWA 3GF5A 4Y91A 1Y96B 3QBYA 1XQHA 1FXXA 1I4K1 2RD1A 4II1A 1VIFA 2A7YA 3QXEB 4RG8A 4A4FA 2QEXA 1KHIA 2EQMA 3M4GA 2XK0A 1QP2A 3H6ZA 4N4IA 4PJOF 3ZFJA 3EFRA 5J39A 2D0QB 4ZGJB 3DKMA 4EPCA 1VUBA 4F7UB 2AHJB 3I56T 3CCJA 4M78D 1NZ9A 3I55T 4XK8E 1TH7A 4M78A 3GPLA 3DB3A 1BIAA 3A8MB 4A53A 2OTJA 5CIUA 5GAMf 4PL6A 1M4ZA 2R58A 5I2SA 5I21A 2YRVA 2O4XB 5LJ5f 1JBMA 2CYZB 2LNVA 5GAMd 1VQ7T 3QIIA 3X26B 5LJ5d 3CCEA 4DOVA 3QJ6A 3LWIA 2ZPHB 1BI0A 5AYFA 4C92F 2DZCA 5GAMe 3MEWA 3MP6A 1YCYA 2KMTA 1UGQB 2VC8A 1IREB 3SB2A 1YIJA 4HT8A 3CCUT 1KQ2A 2O4XA 1UEBA 3HRTA 4B9WA 1YJ9A 5GAMj 3JB9J 1Q82U 2PUKB 4HCCA 3A8LB 2PU9B 3E9GA 4C0GA 4L6V5 1QP3A 2RJDA 2EYQA 1MHNA 4M75D 2DVEA 4D6WA 4E7KA 2RK1A 2DD4A 4EDUA 3OYEA 3P8DA 3M55A 4XU2A 1EIFA 2WSFE 3L42A 1VQ6A 1JB0E 3UPUA 2V8JA 4UC4A 1YJNT 4RCCA 1YJWT 5IN1A 3JCMe 2CZ1B 3CD6A 4ELYC 3CXCA 1K8AU 2RHIA 3CBPA 5CQYA 4BY6B 3VV0A 4M77F 3R6OA 5L8RE 1U1SA 3DLLA 3WXMB 2GCXA 5GAMh 3FIFA 1N27A 2K57A 5GAOn 1BIBA 3OYIA 4PJOE 3OYCA 3JB9H 4ZTFA 2RH2A 4E7LA 1X01A 3A8GB 2QQBA 3MEVA 2HQEA 4EMKC 5FRMA 2BUDA 3M5AA 4WF2A 3UWNA 3OW2S 2RI5A 5FU7B 3JCMg 2FVUA 3RKYA 1KQSA 3G71A 1WNLA 3MHXA 3PFSA 1KD1C 3G6EA 2M16A 4F7UF 5GAN7 4C92E 2YLBA 1K9MU 4KT0E 1KC8C 3VUZA 3JCMX 2L5QA 5CKEA 2LVMA 2E6NA 3E19A 3RKWA 5GAN2 2OTLA 3M59A 3VYHB 1IZ6A 1B34B 3JCMh 1QVGA 3L2VA 4FIBA 3VJPA 1H641 4IUVA 4JLGA 4DOWA 3HRUA 5GMKe 4M7DC 2EQUA 4CI0C 3SWNB 3EFSA 2GF7A 3QDRB 3C12A 4P5NA 3S3MA 3S3OA 3WVDB 4PJOB 2VYTA 3BW1A 3FDRA 3CEYA 5GMKj 1Q7YU 1U1TA 3P8HA 4ELZC 4JRQA 2ZPIB 3A8OB 3HL8A 3JB9D 1OI1A 3SWNA 1VQ5T 1DJ7B 4C0DC 2EJ9A 4N0AC 4XTWA 1D3BB 1O9SA 3ER0A 2K2VA 5D6WA 3CC7A 4HCBA 4KUDK 5KE2A 4DA4A 4PJOA 3LX7A 1WQ7A 1VQ9A 2XDBA 4M77E 3NTKA 1M9SA 3KBGA 2P0KA 2M9UA 4XQ3A 3URGA 4M7DF 2XDPA 5FU6C 1VQLA 1VQKA 2DTHA 1K73C 4M7AG 3OYMA 3V8JA 5D6YA 2LT4A 3RESA 2VV5A 2JVVA 5IAYA 3G4SA 4C92D 2QQSA 2MI6A 2DJZA 2RHZA 4C92A 2L3RA 1VIEA 5GMKh 3JCMW 3S3NA 1VQPT 2E70A 2JTMA 4M75G 4A4GA 1G5VA 1FWZA 2EFIA 4Q5WA 2R5AA 5CKBA 4IUTA 2DXBA 3CCQA 2LCCA 4F7UE 3CMEA 1N8RC 4XU0A 4Z02A 2HD0A 5DY9A 4HCZA 3TU4K 4C8QC 3A8HB 3ASKA 2Y4XA 3V7SA 5CAIA 4OB3B 1XNIA 4ZGDB 1WJRA 4RG2A 4A4KA 3CC2T 1W2BA 2IVWA 3BFMA 4J7FA 3RMQA 2KDSA 1X6OA 1JJ2S 1VQMT 3NTIA 4XTVA 3CCRA 2ZPEB 3OYFA 2JOYA 4EMGA 4RMOA 3M53A 3FEOA 5A0DA 3UT1A 5KCHA 4BE0A 1BI1A 4OGCA 4M77D 1LOJA 3CBMA 2ZPGB 3QUIA 4M77A 4O5VA 4BACA 3QKJA 4GY5A 2QEXT 4BE2A 2RHXA 2PUOB 1I5LA 2LCLA 4NOYA 1U8RA 1NE8A 4L5GA 3OS0A 3CCMA 3SDZA 4LDVA 3PMTA 3S6WA 2MAMA 3CCJT 3NFCA 3HFOA 3MO8A 2OTJT 4PKCC 5CR2A 3C4SA 1Y96A 3FB9A 2E1HA 2Y90A 1LJOA 1WJQA 2XICA 2ZPFB 4FU6A 4C8QG 3CPWS 3AHUA 2DK3A 3RMSA 4XU3A 3CCET 1BYMA 2EQKA 3OMGA 1BKBA 3V7RA 4F7UA 5DLQE 3GOXA 2QTXA 1ZHIA 2E65A 4N4GA 4RCBA 3FLGA 4EMKB 4J83A 1YIJT 3X25B 1V29B 4JRKA 4LDUA 1YJ9T 3META 1WQWA 4PNOA 3JCMQ 3JB9G 3ZEHA 4JS5A 3L2RA 3JCMJ 2EKOA 5GAOl 4QQ6A 2DZ9A 5GAN6 3J7AF 1UGRB 2XHCA 3V8KA 4EMKA 4VUBA 3JCMf 1QVPA 2VXEA 2E64A 1NJIU 2QQRA 3QPHA 3JCMd 2MWPA 3OYBA 2JNGA 3FRNA 4M7AB 2RJCA 4KBMB 4C5EA 4LD6A 5GAN4 1VQ6T 2RI2A 4M7DB 2ZPBB 2BKDN 2G3RA 4OB1B 4QVDA 3MEAA 5C0MA 2H3JA 5A2QE 3CD6T 5C6SA 2E5QA 4DQ2A 4M75B 5KCOA 4X9CA 2D9TA 4JUVA 2RO0A 1FX7A 1WJSA 2R57A 1KD1U 4NS5A 3HP9A 4A4EA 4BI8B 4ME7A 5HK3A 1YHQA 2LC4A 5DM7R 4M7DA 2X4XA 1KC8U 4HA8A 4C0DB 2OAUA 5FROA 3OYGA 5GANe 3M56A 4M78C 2QI2A 2PVOB 3CC4A 4OMFB 2R5MA 3LYIA 2DAQA 1I8FA 4PLLA 3CMAA 3OS5A 2L8DA 3PGGA 2WSEE 1M1KU 3GP8A 3G71T 2LT1A 2K5FA 2LQ8A 1RI0A 2CZ0B 3G6ET 2DKGA 1YITT 2EIFA 3JCMc 5FU6B 3VUBA 1YITA 3CXCS 5CO7A 2XKOC 4FL6A 2PVGB 4E7JA 2XDDA 2HAXA 2P0PA 1HK9A 1XTDA 3F70A 4J7IA 2E12A 5GANg 4M7AC 4JJNK 2LTOA 3LGLA 5J26A 2RJFA 3DLMA 3CPFA 3FC3A 4FSXA 2CZ7B 3QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II1 A;  4A4F A;  3OYJ A;  4A4G A;  3OYH A;  1G5V A;  3PMI A;  2EFI A;  3OMC A;  4Q5W A;  2EQM A;  4N4I A;  2XK0 A;  2R5A A;  3H6Z A;  5J39 A;  4IUT A;  4IUQ A;  2K3X A;  2LCC A;  3MP8 A;  4Z02 A;  4ZTJ A;  2RI3 A;  4HCZ A;  2GFA A;  3DB3 A;  3ASK A;  5CIU A;  4IUR A;  1XNI A;  2R58 A;  4PL6 A;  1WJR A;  2O4X B;  2YRV A;  4RG2 A;  2EQJ A;  3QII A;  4C5I A;  3QJ6 A;  3L2U A;  2MWO A;  1WGS A;  2F5K A;  3NTI A;  3MEW A;  3MP6 A;  3OY9 A;  3NTH A;  3OYF A;  3FEO A;  2K3Y A;  2O4X A;  3OS2 A;  3UT1 A;  3M9Q A;  4B9W A;  2JTF A;  3LH0 A;  4A4H A;  5KCH A;  4BE0 A;  4E7J A;  3H8Z A;  3E9F A;  2FHD A;  4BAC A;  4BE2 A;  3QKJ A;  4GY5 A;  2HQX A;  2RHX A;  4X34 A;  3OA6 A;  3E9G A;  3LLR A;  4BDY A;  2IG0 A;  4C5H A;  2RJD A;  1MHN A;  3OS0 A;  3S6W A;  3PMT A;  4E7K A;  5KH6 A;  3MO8 A;  4QW2 A;  4EDU A;  3OYE A;  4OVA A;  3P8D A;  3C4S A;  3L42 A;  1WJQ A;  4BE1 A;  4FU6 A;  4E7I A;  3OYD A;  4UC4 A;  5IN1 A;  3OYA A;  3OYN A;  2RHI A;  3L2W A;  2EQK A;  3DB4 A;  3OMG A;  3GOX A;  2LDM A;  1KHC A;  3MP1 A;  4QVZ A;  5D6X A;  4N4G A;  3FLG A;  1N27 A;  3ME9 A;  3OYI A;  4BD3 A;  3OYC A;  2NLU A;  4ZTF A;  2X35 A;  4E7L A;  3MET A;  4QQD A;  2DIG A;  4IUP A;  3ZEH A;  3MEV A;  2HQE A;  3L2R A;  1OZ3 A;  2B8A A;  2EKO A;  2BUD A;  4QQ6 A;  3UWN A;  5FRM A;  2M1H A;  2RI5 A;  2JZ2 A;  3MEU A;  2QQR A;  4L59 A;  3L2Q A;  3BDL A;  3PFS A;  5FRN A;  2M16 A;  3OYB A;  2MWP A;  1OYX A;  4CRI A;  3OYK A;  2RJC A;  4C5E A;  4LD6 A;  3OS1 A;  3PNW C;  4B9X A;  2RI2 A;  2BKD N;  2E6N A;  2LVM A;  2G3R A;  3MEA A;  5C0M A;  3EAE A;  5C6S A;  2E5Q A;  4BDZ A;  2GFU A;  5KCO A;  3L2V A;  2RHU A;  3OQ5 A;  2D9T A;  2CKK A;  4IUV A;  2PQW A;  2RO0 A;  1SSF A;  1WJS A;  2R57 A;  2EQU A;  4NS5 A;  4A4E A;  1OZ2 A;  3KUF A;  2GF7 A;  4C5G A;  2X4X A;  4E7H A;  3S3M A;  3Q1J A;  3S3O A;  4QQG A;  3OYL A;  3OYG A;  2VYT A;  5FRO A;  3FDR A;  2M0O A;  2WAC A;  3CEY A;  3SD4 A;  2X4W A;  3P8H A;  2X4Y A;  1H3Z A;  4PLL A;  2R5M A;  3LYI A;  2DAQ A;  1OI1 A;  2L8D A;  5M9O A;  3O8V A;  2BIV A;  4IUU A;  5D6W A;  1RI0 A;  5KE3 A;  5KE2 A;  4IKF A;  3LX7 A;  3NTK A;  2RJE A;  2L89 A;  2P0K A;  3OB9 A;  2RHY A;  4PLI A;  4FL6 A;  2XDP A;  3F70 A;  4N4H A;  2DIQ A;  3LGF A;  3OYM A;  2LRQ A;  2LTO A;  3LGL A;  5D6Y A;  5J26 A;  2RJF A;  5IAY A;  3DLM A;  3FC3 A;  2QQS A;  2RHZ A;  2L3R A;  3S3N A;  3QBY A; 
#chains in the Genus database with same CATH topology
 2MMP A;  3VS7 A;  2DXT A;  2CH4 W;  4C8Q B;  1HJD A;  5GAN h;  4PFO A;  2CP2 A;  4PJO D;  1U06 A;  4HVU A;  1M5Q 1;  1Q81 U;  1F1B B;  1QVG S;  2C0T A;  2YLC A;  1AVZ C;  1QKW A;  2K9G A;  3NTH A;  1RAC B;  1YNZ A;  2C06 A;  1X43 A;  4HXJ A;  3OS2 A;  2X3X D;  1KC8 R;  3G4S T;  2LX9 A;  2FHD A;  1VQ4 A;  1IO6 A;  2EW3 A;  3CME T;  1WX6 A;  4QW2 A;  4RKU E;  4ESR A;  4OMP A;  3OYA A;  2LNH B;  4AT1 B;  3DB4 A;  2PNI A;  1UGS B;  2CUD A;  1H3H A;  4J8O A;  1QWF A;  3CMA Q;  2OX7 A;  2COY A;  3M57 A;  2AK5 A;  4ANJ A;  3WVE B;  3OSS C;  1YIT Q;  4C8Q F;  2KE9 A;  1VQO A;  3BDL A;  5IHK A;  3QWX X;  1H8K A;  2HL5 C;  2LZ6 B;  3PNW C;  1E6G A;  1D1C A;  1VQN A;  2K5I A;  1N8R R;  2RMO A;  7AT1 B;  3OBW A;  4IIO A;  2DET A;  1OPL A;  4OMN A;  1OZ2 A;  3KUF A;  2KSS A;  4JS4 A;  2XID A;  2P4T A;  4JDS A;  1BCO A;  1H3Z A;  3LH5 A;  1GBQ A;  5M9O A;  2GQV A;  4IKF A;  5HKC A;  2FZC B;  1UEC A;  3OB9 A;  4HKE A;  4N4H A;  4NL2 A;  1S72 Q;  2KVQ G;  2KXD A;  2M02 A;  2F5T X;  4C92 G;  3CCU A;  3V7C A;  3UAT A;  3HFN A;  3MPU B;  1YHQ T;  3UDC A;  1BB9 A;  3HRS A;  2DO3 A;  4D8D A;  2XU8 A;  4FYW B;  2QGF B;  1AZE A;  2MCN A;  2RI3 A;  2F2V A;  4A54 A;  4V2S A;  1RL2 A;  4NL3 A;  1YJN A;  2EQJ A;  5GMK m;  3CCV Q;  1Q82 C;  1NPR A;  1PWT A;  4GLM A;  3M0R A;  3VS0 A;  1NJI C;  1GL5 A;  5I2M A;  3JRZ A;  4JLI A;  3E9F A;  1K4U S;  2HQX A;  4J6X A;  2DM1 A;  4LDY A;  1K8A C;  2LQK A;  3TRE A;  3VU3 C;  1G2B A;  5GAN 5;  2HL3 A;  1RAI B;  2M0Y A;  2X4J A;  2FPE A;  1VQ8 T;  1SRM A;  4C8Q D;  3RNJ A;  4C8Q A;  1SHG A;  3OYN A;  3CBO A;  3SFM A;  3L2W A;  3TEE A;  4QKU A;  5FLX E;  2DYB A;  4BY6 C;  4LNP A;  4D8K A;  2NLU A;  1AD5 A;  2X35 A;  5GMK i;  2B8A A;  4X9D A;  3CCL Q;  2EGE A;  1VQ5 A;  2C0I A;  2MOX A;  1ZSZ B;  4L59 A;  1AWO A;  3L2Q A;  2DFU A;  1AEY A;  4MZT A;  1SSH A;  3OQ5 A;  1SEM A;  4M78 E;  3M0T A;  2DE0 X;  2BZX A;  5ECA A;  2X4W A;  3SWN C;  5CQX A;  1YI2 T;  4YTL A;  1FMW A;  2YT6 A;  2E4H A;  2FL7 A;  3EHR A;  2AT1 B;  5LJ3 j;  2DD5 A;  4Z89 A;  3CC2 A;  4OP0 A;  3JV3 A;  1KQ1 A;  4M77 B;  2E6Z A;  3M0P A;  1M3A A;  1BI3 A;  3EG2 A;  3LGF A;  2YRD A;  2RQU A;  1PD1 A;  2QA4 T;  3HPW A;  3GF5 A;  4Y91 A;  1WHJ A;  1XQH A;  1I0C A;  1I4K 1;  4II1 A;  1VIF A;  2LX7 A;  2KBT A;  1K0X A;  3M4G A;  2NWM A;  3DKM A;  2IPO B;  2GBQ A;  5CIU A;  4PL6 A;  2YRV A;  1B07 A;  1JBM A;  5IXB A;  1VQ7 T;  3QII A;  3IQL A;  2DL7 A;  3QJ6 A;  3LWI A;  3G1J A;  1BI0 A;  2A0F B;  2KMT A;  1UGQ B;  1IRE B;  2EKH A;  1X6B A;  2O4X A;  4Z88 A;  3A8L B;  1TUD A;  1PRM C;  2PU9 B;  2ECZ A;  4RTW A;  4M75 D;  2DVE A;  4E7K A;  2RK1 A;  2ED0 A;  3H0I A;  1LPL A;  4EDU A;  1UHC A;  4XU2 A;  1EIF A;  3UPU A;  2V8J A;  4UC4 A;  1YJW T;  4RCC A;  1BCM A;  1RAA B;  1GFD A;  3EG1 A;  4M77 F;  5L8R E;  3DLL A;  3EGD B;  2GCX A;  3FIF A;  1X69 A;  4PJO E;  3JB9 H;  3GBQ A;  4ZTF A;  1X01 A;  4DBH A;  1YN8 A;  2QQB A;  2ESW A;  2J6F A;  2HQE A;  1UJ0 A;  5FRM A;  1KD1 C;  4PFP A;  3G6E A;  2M16 A;  5GAN 7;  2YLB A;  2LVM A;  2E6N A;  2BZ8 A;  5GAN 2;  1B34 B;  1SPK A;  3L2V A;  4FIB A;  1UE9 A;  1Q82 R;  1SKU B;  3S3M A;  3CCJ Q;  2VYT A;  3FDR A;  4JZ4 A;  2JTE A;  3A8O B;  3JB9 D;  3SWN A;  4C0D C;  4N0A C;  3ER0 A;  2K2V A;  4HCB A;  2RN8 A;  4ORZ A;  1WQ7 A;  2EYX A;  1YIJ Q;  1K8A R;  3KBG A;  4K11 A;  2M9U A;  1ZSZ A;  1YJ9 Q;  2XDP A;  5AT1 B;  3OYM A;  3V8J A;  2VV5 A;  3G4S A;  2QQS A;  1K76 A;  2DJZ A;  1VQP T;  2JTM A;  4A4G A;  4DBF A;  4IUT A;  1VQ6 Q;  3CME A;  1QLY A;  4XU0 A;  1NYF A;  3CD6 Q;  1YFN A;  1XNI A;  1D09 B;  4AFZ C;  1W2B A;  1C0M A;  3NTI A;  1R77 A;  2JOY A;  4EMG A;  1W6X A;  4KGX B;  5A0D A;  4BE0 A;  4OGC A;  4M77 D;  4M77 A;  4BAC A;  2GQI A;  2RHX A;  1I5L A;  2V26 A;  1V76 A;  3EFO B;  3PVL A;  3HFO A;  4J9H A;  2QK0 A;  3MO8 A;  4JJB A;  2OTJ T;  1D0Y A;  2Y90 A;  1WJQ A;  2PTK A;  4FCY A;  4AFQ C;  1OOT A;  2EQK A;  2QAS A;  5GJV B;  1R0B G;  3UF4 A;  3X25 B;  4JRK A;  2AKL A;  3M0Q A;  5GAO l;  2W0Z A;  2KR3 A;  1ZUU A;  1UGR B;  1YWP A;  4VUB A;  2DEU A;  2QQR A;  3M0U A;  3FRN A;  4M7A B;  1FMK A;  2RJC A;  4KBM B;  5GAN 4;  1RAD B;  4M7D B;  2O31 A;  1X2Q A;  2G3R A;  5C6S A;  4JUV A;  3HP9 A;  5HK3 A;  1YHQ A;  1KC8 U;  3OYG A;  2OAU A;  3M56 A;  4M78 C;  2CSQ A;  2QI2 A;  4PLL A;  3EGD A;  2L8D A;  3PGG A;  1AZG B;  3CQT A;  2QGG A;  2K5F A;  1YIT T;  1ACM B;  5FU6 B;  1M3B A;  2PVG B;  2P0P A;  1HK9 A;  1XTD A;  4J7I A;  5GAN g;  4M7A C;  2JW4 A;  1WLP B;  5J26 A;  3DLM A;  3CPF A;  2JMA A;  3OYH A;  3J81 E;  2ZAE A;  1B34 A;  3OBY A;  1LNX A;  2K3X A;  4IUQ A;  4M78 G;  3MP8 A;  2EJF A;  1R8O B;  1VQ8 A;  3P8B B;  1M27 C;  5CKH A;  1VQ9 T;  4C5I A;  2ENM A;  2ZZD A;  4M7A F;  1N8R U;  4F16 A;  4FYY B;  1ZA2 B;  1KD1 R;  1VQK T;  3M9Q A;  2OTL T;  4FYV B;  3LH0 A;  1AWX A;  3EGU A;  5CKD A;  3INZ A;  1M1K R;  1M1G A;  4CC2 A;  1JRI A;  3MCA B;  3X24 B;  1ZBX A;  1E6H A;  1M3C A;  4J5Y A;  1X6G A;  3VKI A;  1G8X A;  3X28 B;  2DTI A;  2JS2 A;  1PHT A;  5IXF A;  1ZQ1 A;  1NEB A;  2LMJ A;  4FT2 A;  3LWH A;  2KK4 A;  4J6Y A;  1YI2 A;  5LJ3 e;  1Q86 C;  2CS7 A;  4KH1 B;  4FM4 B;  2M1H A;  4LDX A;  2KI7 A;  3CCM T;  2KT1 A;  4E47 A;  1HXD A;  1JU5 C;  1W2B S;  2QQA A;  2A28 A;  2L2P A;  4B9X A;  2CP7 A;  2QXF A;  1CKA A;  1NPP A;  3EFO A;  4M75 E;  2QQ9 A;  2RHU A;  2EQI A;  2QA4 A;  4C5G A;  2J6K A;  2K4Y A;  2WAC A;  1ABO A;  2RA2 A;  3I5S A;  3GNG A;  2ZCF B;  3VS2 A;  4JPB W;  5LJ3 h;  2V1Q A;  4PJO G;  2DEQ A;  4GBQ A;  2EWN A;  3ZBD A;  5KE3 A;  3CCL T;  1I5O B;  3OYY A;  2NYS A;  1VQ7 A;  5GAO q;  3OSV A;  1WXU A;  5LJ5 e;  3M58 A;  2DIQ A;  5GAN f;  1VQ4 Q;  2D1X A;  2HBW A;  5HY6 A;  4M7A D;  1EX4 A;  4M7A A;  2DX1 A;  5GAN d;  4M7D D;  2DA9 A;  4OML A;  1Y57 A;  3KXT A;  3CC4 T;  5GAM g;  1QCN A;  1TUG B;  1K9A A;  1YJW A;  2JN0 A;  4B6M A;  1ZUY A;  3MJX A;  3EG3 A;  1WGS A;  2VUB A;  3PT9 A;  5LJ5 h;  1MGQ A;  3BDU A;  3QO3 A;  3QYG B;  1RI9 A;  4MZP A;  2YDL A;  3LLR A;  1VQO Q;  3JAM E;  3SEM A;  4MDX A;  1VQN Q;  3C95 A;  2XI9 A;  4BE1 A;  3OYD A;  2KXC A;  2VGM A;  2BE9 B;  1WDX A;  3PIP A;  1U3O A;  4J9I A;  3ME9 A;  3JB9 I;  2DXU A;  2XG8 D;  1TSF A;  4BD3 A;  2VXF A;  1QWE A;  1QVF P;  2IIM A;  1T3L A;  1K9M C;  4QQD A;  2VB6 A;  1Z9Z A;  1X2K A;  1OEB A;  1X75 C;  2FB7 A;  1O75 A;  1K1Z A;  5FRN A;  5CK9 A;  8ATC B;  4AFU C;  3T9N A;  5FU7 C;  1TXQ A;  4C92 B;  2EAY A;  2MK5 A;  3CCU Q;  3BE3 A;  4KGV B;  1GRI A;  3EAE A;  2GFU A;  3CCS T;  3UA7 A;  2CKK A;  2DL8 A;  1YWO A;  1VQP A;  2KRO A;  4MMK A;  3A98 A;  3RKX A;  3REB B;  3OYL A;  1Q81 C;  2CT3 A;  1MV3 A;  2M51 A;  2KRM A;  2X4Y A;  1YJN Q;  5IHN A;  3VYG A;  2YHT A;  1KFZ A;  2E10 A;  4TVR A;  1RAE B;  2FO0 A;  3O8V A;  3RER A;  4PJJ A;  4ZGE B;  1T0H A;  2DXC A;  3CPW A;  2RJE A;  1I07 A;  2L89 A;  3RBB B;  2F69 A;  4C92 C;  5GAO p;  2KYB A;  4F14 A;  1Y96 B;  3QBY A;  1VQM T;  4A4F A;  2RD1 A;  1TWB A;  3QXE B;  2XK0 A;  2HMA A;  5J39 A;  3ZFJ A;  2D0Q B;  2CSI A;  3I56 T;  2AHJ B;  5I11 A;  1NZ9 A;  3I55 T;  2RNA A;  1TH7 A;  2OTJ A;  4A53 A;  5GAM f;  2R58 A;  3TVT A;  2O4X B;  1QMC A;  4X1V A;  1PM3 A;  5GAM d;  3X26 B;  1JQQ A;  4DOV A;  2ZPH B;  2MYS A;  4C92 F;  2DZC A;  5GAM e;  3MP6 A;  1WFW A;  3OW2 P;  1VQ5 Q;  2RQV A;  1Q82 U;  4HCC A;  3NHN A;  4AFS C;  1K0S A;  1AT1 B;  3O5Z A;  4OMM A;  2DBK A;  3OYE A;  3P8D A;  1U5S A;  2DL4 A;  2CZ1 B;  2QYZ A;  3CXC A;  1K8A U;  4EIK A;  2RHI A;  4BY6 B;  4RTZ A;  1LVK A;  2BE7 D;  5GAM h;  5GAO n;  2K57 A;  3OYI A;  1OX8 A;  2RH2 A;  3NGP A;  4DBR A;  3CC2 Q;  2FVU A;  2YUP A;  3RKY A;  1KQS A;  1BBZ A;  3PFS A;  4RTY A;  4KT0 E;  3VUZ A;  3RKW A;  3VYH B;  2QAZ A;  1IZ6 A;  2X51 A;  4DOW A;  5GMK e;  4CI0 C;  3SWN B;  3QDR B;  3C12 A;  1J3T A;  2NUP B;  3WVD B;  1UHF A;  2DL3 A;  1PD0 A;  2ZPI B;  3HL8 A;  1OI1 A;  1WIE A;  5FWC A;  1D3B B;  1JJ2 P;  4KUD K;  4DA4 A;  3LX7 A;  1VQ9 A;  2VAS A;  3H41 A;  1V1C A;  4M4Z A;  1VQK A;  1K73 C;  5D6Y A;  2LT4 A;  3RES A;  2OTL A;  4C92 D;  1UUE A;  5GMK h;  3JCM W;  2RHZ A;  2COW A;  4C92 A;  2E70 A;  4M75 G;  2X3W D;  1WHM A;  1FWZ A;  4Q5W A;  2DXB A;  4DBQ A;  4F7U E;  4FW1 A;  1D1B A;  3E2U A;  3PE0 A;  3ASK A;  1K9M R;  5CAI A;  4A4K A;  1PG5 B;  2EYZ A;  2IVW A;  2DF6 A;  4J7F A;  3RMQ A;  1X6O A;  4FYX B;  1VYT A;  2ZPE B;  3M53 A;  3FEO A;  3TSW A;  3UT1 A;  3EG0 A;  3CBM A;  2ZPG B;  1I1J A;  1UGV A;  2QEX T;  3PVQ A;  4NOY A;  1PKS A;  3G6E Q;  1U8R A;  4L5G A;  3OS0 A;  3CCM A;  3NFC A;  3I35 A;  3C4S A;  1Y96 A;  2XMF A;  2E1H A;  1LJO A;  2XIC A;  3CPW S;  2ZPF B;  1WHG A;  2DK3 A;  3CCE T;  5DLQ E;  2QTX A;  2E65 A;  4J83 A;  1WYX A;  4PJN A;  2AIR B;  4PNO A;  3JB9 G;  2GNC A;  4JS5 A;  3JCM J;  3V8K A;  4LXC A;  1MMD A;  1QVP A;  2FRW A;  3QPH A;  3OYB A;  2MWP A;  1GCQ C;  1D0X A;  1AOJ A;  4OB1 B;  3G4S Q;  3MEA A;  1UJY A;  2H3J A;  1ZA1 B;  2E5Q A;  2AZS A;  5KCO A;  4X9C A;  4WCI A;  1FX7 A;  1KK7 A;  2R57 A;  1KD1 U;  4NS5 A;  1TTH B;  4BI8 B;  4ME7 A;  5DM7 R;  3CME Q;  2HSP A;  4JJC A;  4C0D B;  3CC4 A;  2R5M A;  2DAQ A;  1I8F A;  1SRL A;  1VA7 A;  1QVG P;  1M1K U;  3GP8 A;  3G71 T;  2JM8 A;  2LQ8 A;  2DRK A;  2CZ0 B;  2DKG A;  3VUB A;  3CXC S;  1FYN A;  2XDD A;  3F70 A;  2LTO A;  3VS4 A;  2DVJ A;  4DEY A;  3FC3 A;  1OV3 A;  4FSX A;  2CZ7 B;  2FG0 A;  4ATO A;  3PMI A;  1IHW A;  2P0Q A;  2HKQ B;  4MML A;  3E1S A;  3EGX A;  1KQS S;  2KRS A;  4ZN1 A;  1NJI R;  1NYG A;  3AT1 B;  4IUR A;  2NUP A;  1M8V A;  3CC7 T;  1RAG B;  2ED1 A;  1YP5 A;  3QJY A;  1IRX A;  4HT9 A;  1C6V X;  3QSU A;  2V8I A;  3L2U A;  1ZX6 A;  2KGT A;  3VRZ A;  2RQT A;  1D3B A;  1VQL T;  5EC7 A;  2A3L A;  2CGH A;  2QDY B;  2GTJ A;  3RDV A;  3M54 A;  4Y28 E;  2YUN A;  1UB4 A;  3CCQ T;  5HK0 A;  1Y07 A;  5EG2 A;  5GAO m;  4OVA A;  2FPF A;  2F2W A;  4E7I A;  2GGR A;  4BUG A;  3JCM b;  3JCM P;  1YHQ Q;  3CCS A;  4QT7 A;  1RAH B;  4OB2 B;  1E7O A;  3CCR T;  2FEI A;  2O01 E;  4CC3 A;  1HD3 A;  1KJW A;  3FJP A;  2WSC E;  1M2V A;  4PJL A;  2HQH A;  2V8K A;  1K73 R;  1TU0 B;  1WHK A;  5IHI A;  1G3Y A;  1QQJ A;  3MEU A;  1BU1 A;  1M90 C;  2DL5 A;  5GAO r;  1WXB A;  2EPD A;  2K2M A;  3EG9 B;  4XU1 A;  4ZN3 A;  2LCS A;  3SHW A;  3QG1 A;  2C0O A;  2MPX C;  2BZY A;  1GCQ A;  2VVK A;  2YSQ A;  2L3P A;  4BDZ A;  4KH0 B;  4LD9 K;  5LJ3 g;  1ZLM A;  3RUX A;  4R55 A;  4M78 B;  1WXT A;  1VQM A;  4E7H A;  1MND A;  3Q1J A;  2HBP A;  4QQG A;  1UG1 A;  3SD4 A;  2M0O A;  3HSB A;  3RIR A;  2CP5 A;  2LP5 A;  1VQ8 Q;  2RM4 A;  3EH2 A;  3I56 A;  3I55 A;  2EJG A;  3JCM V;  5DLO A;  3M0S A;  3H9N A;  2LJ3 A;  8AT1 B;  2LRQ A;  5CVI A;  4R56 A;  2DLP A;  4OGE A;  3OYJ A;  3ULR B;  1LCK A;  1YCS B;  4C8Q E;  2H3E B;  4J9D A;  3J80 E;  1WPY A;  5L23 A;  3PTA A;  3CMA T;  2DTO A;  5GAN 8;  2DER A;  5LJ5 g;  5FW9 A;  4N0A A;  4OF1 A;  4A63 B;  2DJQ A;  2MWO A;  3OY9 A;  1OU9 A;  1Y71 A;  2KQW A;  1YI2 Q;  3HHT B;  1G3T A;  4E7J A;  1TS9 A;  4A4H A;  1I81 A;  3H8Z A;  4M78 F;  3OA6 A;  3QDF A;  4FT4 A;  2IG0 A;  2EBP A;  1QCF A;  2LJ1 A;  2F2X A;  2J05 A;  2KEA A;  2RB6 A;  1GXI E;  4F7U G;  2QA4 Q;  1G3S A;  3N5B B;  4J9F A;  4JRI A;  1KHC A;  4QVZ A;  5D6X A;  4F17 A;  4LDW A;  3GLX A;  1S72 T;  4EMH A;  1UDL A;  1QW1 A;  4J9E A;  4ZNX A;  3VS1 A;  1VQ7 Q;  1M1F A;  1G83 A;  2DPP B;  1EFN A;  4CRI A;  1OYX A;  1Q86 U;  2D8H A;  5IH2 A;  1Q7Y C;  2XD0 A;  2HNI A;  2PQW A;  3L1A A;  4BB7 A;  4M7D G;  3CCV T;  5LJ3 f;  4KUI A;  2E41 A;  3BY7 A;  5LJ3 d;  3HTR A;  3V8L A;  4MDW A;  1YJW Q;  2OJ2 A;  4PJO C;  1VYV A;  2YUO A;  2MF2 A;  4XAX B;  1PNJ A;  2J7I A;  4PLI A;  2DMO A;  5CKF A;  5D7U A;  2HSE B;  1M8M A;  4PFZ A;  3EG9 A;  4LUE A;  1FXX A;  4RG8 A;  2QEX A;  2A7Y A;  1UTI A;  4PJO F;  4M78 D;  2EVR A;  4XK8 E;  4M78 A;  1NM7 A;  3DB3 A;  3A8M B;  1M4Z A;  5I2S A;  5LJ5 f;  5I21 A;  2CDT A;  2CYZ B;  4HCK A;  3UA6 A;  1FMV A;  5LJ5 d;  3CCE A;  2YRC A;  1W1F A;  2ABL A;  1M90 R;  3SB2 A;  1UEB A;  3HRT A;  2J06 A;  4B9W A;  2PUK B;  2A37 A;  3E9G A;  4C0G A;  1ARK A;  2RJD A;  1MHN A;  3TQ7 P;  3I5R A;  2DD4 A;  3M55 A;  1JB0 E;  5IN1 A;  3JCM e;  4ELY C;  2ROT A;  1VQP Q;  2OI3 A;  3CBP A;  5CQY A;  1NLP C;  2DBM A;  3VV0 A;  2RQR A;  2EYW A;  2HEQ A;  1N27 A;  1NLO C;  3VRY A;  1BIB A;  3OYC A;  2CUB A;  4E7L A;  3A8G B;  3MEV A;  4EMK C;  3M5A A;  4WF2 A;  2RI5 A;  5HCK A;  5FU7 B;  4J9G A;  3G71 A;  3MHX A;  2PZ1 A;  1K9M U;  5CKE A;  3ZL7 C;  2O2O A;  3M59 A;  3JCM h;  3VJP A;  1H64 1;  4JLG A;  1H92 A;  3HRU A;  3EFS A;  2GF7 A;  1MMG A;  4P5N A;  3S3O A;  2OTJ Q;  4RTT A;  2LJ0 A;  4ELZ C;  4JRQ A;  4LN2 A;  2LQW A;  1DJ7 B;  5FWB A;  2K3B A;  2EJ9 A;  4E7S A;  1Q95 G;  1WHL A;  5D6W A;  4PJO A;  3CC7 A;  5KE2 A;  2XDB A;  4M77 E;  2P0K A;  4XQ3 A;  1UFF A;  2OAW A;  2NUZ A;  2DYI A;  2QDL A;  1VQL A;  2P84 A;  1SG5 A;  4J9B A;  1VIE A;  1G5V A;  2EFI A;  1ABQ A;  3CCQ A;  2LCC A;  4Z02 A;  1IXD A;  5DY9 A;  4HCZ A;  4C8Q C;  2MIO A;  2Y4X A;  3V7S A;  4OB3 B;  1JXM A;  4RG2 A;  1VOM A;  1MNE A;  3BFM A;  2FZK B;  4XTV A;  3CCR A;  4FSS A;  5KCH A;  1IB8 A;  2JXB A;  1BI1 A;  1LOJ A;  1Q7Y R;  3QUI A;  4O5V A;  2CP0 A;  3QKJ A;  4GY5 A;  2PUO B;  1ZSG A;  2ROL A;  1TOV A;  3SDZ A;  3S6W A;  2KT8 A;  3PMT A;  2MAM A;  3CCJ T;  4PKC C;  5CR2 A;  1EZZ B;  3KFV A;  4C8Q G;  1A0N B;  3AHU A;  2YWW A;  3RMS A;  1Q86 R;  2FZG B;  1M2O A;  4XU3 A;  1OQK A;  3OMG A;  3GOX A;  4E2F B;  1YIJ T;  5I22 A;  1YJ9 T;  1WQW A;  3JCM Q;  4JZ3 A;  3L2R A;  1RAB B;  5GAN 6;  1T3S A;  2CP3 A;  1VQ9 Q;  2ATC B;  1X27 A;  4EMK A;  2VXE A;  1NJI U;  2HKN A;  1VQK Q;  4C5E A;  2F1L A;  4LD6 A;  1VQ6 T;  1B3Q A;  2OTL Q;  3CD6 T;  5A2Q E;  1N5Z A;  4FW2 A;  4DQ2 A;  4M75 B;  2RO0 A;  1MUZ A;  2RF0 A;  1JEG A;  5FRO A;  4OMF B;  1HSQ A;  3CMA A;  3OS5 A;  2WSE E;  2SRC A;  1RI0 A;  3EHQ A;  1YIT A;  2EIF A;  2H8H A;  1IGU A;  3EGX B;  1AWJ A;  2RJF A;  3CCM Q;  3QHS A;  2HZY A;  2JM9 A;  4M75 C;  1AWW A;  1XJW B;  3OMC A;  2RQW A;  4XTZ A;  1K73 U;  3LW5 E;  4ZTJ A;  1QKX A;  1C1A A;  1BI2 A;  4OB0 B;  1T0J A;  2D6F A;  1BK2 A;  2SEM A;  1KSW A;  1JXO A;  1WA7 A;  1N9S A;  1SF9 A;  2K3Y A;  1UGP B;  1HYO A;  2JTF A;  2PVD B;  4M75 F;  4BI3 A;  1GBR A;  2ZGW A;  3M4Y A;  1S72 A;  2JT4 A;  4X34 A;  5CCA A;  2NUT B;  2A36 A;  2YXY A;  1W2B P;  2L3Q A;  5KH6 A;  5GMK l;  1QVF A;  4XTU A;  2D8J A;  1XOV A;  4AMC A;  1D0Z A;  1M2V B;  1KIK A;  2LDM A;  3MP1 A;  1W4S A;  3CCV A;  3C0C A;  1PKT A;  3CC4 Q;  4WTO B;  4IUP A;  4XTX A;  4MZM A;  3QZ9 B;  1AHJ B;  3X20 B;  4C0F A;  4R0K A;  2JZ2 A;  4E6R A;  9ATC B;  5IT9 E;  4M7A E;  1Q81 R;  1ZSZ C;  3OS1 A;  2GTO A;  4M7D E;  2RK2 A;  1N6A A;  2VKN A;  2W10 A;  3JB9 F;  4BI4 A;  2O9V A;  2FPD A;  3RR6 A;  2KY9 A;  1GFC A;  4KGZ B;  4JRP A;  3GNF B;  2BIV A;  2I2L A;  4IUU A;  3CCL A;  5A0L A;  1PSE A;  4AG1 C;  1OU8 A;  2CRE A;  4RTU A;  1Y7X A;  3TCJ A;  4M77 C;  4XTY A;  4C0Z A;  2AZV A;  5LJ5 j;  3L2Z A;  1GCP A;  2KRN A;  4M75 A;  5LL6 S;  3OW2 A;  4IIM A;  1W70 A;  2GFA A;  3VS3 A;  5GAN j;  3QYH B;  2QG9 B;  3CCS Q;  2FRY A;  1P92 A;  3PIO A;  2AKK A;  4CC4 B;  3GIB A;  1QCO A;  2DNU A;  2F5K A;  4OMQ A;  5J3B A;  2JMC A;  2E5K A;  3G7Z A;  4M77 G;  3I9Q A;  1ZBJ A;  4GLK A;  4BDY A;  4C5H A;  2FYK A;  1YBY A;  1M30 A;  4CC7 A;  2Y4Y A;  3C94 A;  4HVV A;  3QWY A;  1PRL C;  1G3W A;  3VS5 A;  1WHH A;  1VQM Q;  5GAN 3;  1M1K C;  1OX9 A;  3I56 Q;  4O6J A;  3I55 Q;  1WI7 A;  1S1N A;  2DIG A;  1OZ3 A;  1VQ4 T;  1KG1 A;  1R0C B;  2A08 A;  1CSK A;  2K5L A;  3OYK A;  2JUF A;  2P4R A;  1WZO A;  1PSF A;  2CZ6 B;  2NUT A;  2KAF A;  1NEG A;  4PJM A;  2Z0W A;  3QZ5 B;  1JJ2 A;  1SSF A;  1M90 U;  1VYU A;  1OPK A;  4PK4 A;  1OUL A;  2VGN A;  3JSC A;  5KYN A;  2KYM A;  3A5Z B;  1QVF S;  4J6W A;  2K6D A;  1N9R A;  4LUD A;  1VQO T;  5A0G A;  4RTV A;  4DEX A;  4QVC A;  4KUL A;  1VQN T;  2RHY A;  5KYX B;  2E3I A;  4RTX A;  3HKS A;  1RLP C;  3NMZ C;  4RUG A;  1KHI A;  2EQM A;  4N4I A;  1QP2 A;  1RUW A;  2EYY A;  3H6Z A;  3EFR A;  4ZGJ B;  4EPC A;  1VUB A;  4F7U B;  3CCJ A;  2COZ A;  3GPL A;  5GJW B;  1BIA A;  2B86 A;  2LNV A;  5AYF A;  3U23 A;  2HDA A;  5KYU B;  3MEW A;  1YCY A;  3NPF A;  2VC8 A;  1MMN A;  1YIJ A;  2E3H A;  3CCU T;  4HT8 A;  1KQ2 A;  1YJ9 A;  5GAM j;  3JB9 J;  4JJD A;  2RPN A;  4L6V 5;  1QP3 A;  3A1P A;  2EYQ A;  2CP6 A;  4D6W A;  3TSZ A;  1IHV A;  3D7S B;  2VWF A;  4J9C A;  5KYW B;  2KNB B;  2WSF E;  3L42 A;  1VQ6 A;  1YJN T;  4KRT A;  3CD6 A;  3FJ5 A;  2EGA A;  2DRM A;  3R6O A;  1U1S A;  3WXM B;  1D1A A;  4HVW A;  2L0A A;  2CT4 A;  1MMA A;  4F04 B;  2BUD A;  3UWN A;  3OW2 S;  2K7A A;  3JCM g;  1WNL A;  4F7U F;  4C92 E;  5KYY B;  1RAF B;  1KC8 C;  2YUQ A;  3JCM X;  2L5Q A;  3E19 A;  1QVG A;  1TG0 A;  2QEX Q;  4IUV A;  4M7D C;  2EQU A;  2G6F X;  6AT1 B;  4PJO B;  3BW1 A;  5GMK j;  1Q7Y U;  3CEY A;  1U1T A;  3P8H A;  3H0F A;  3H0H A;  4AG2 C;  1VQ5 T;  4XTW A;  3CCE Q;  3EH1 A;  1O9S A;  1PC0 A;  4Y92 A;  3NTK A;  1M9S A;  3URG A;  3THK A;  4M7D F;  5FU6 C;  2DTH A;  4M7A G;  1JO8 A;  2JVV A;  5IAY A;  1TUC A;  2MI6 A;  2L3R A;  3S3N A;  1PCX A;  2D0N A;  2J6O A;  2R5A A;  3CPW P;  5CKB A;  1N8R C;  2HD0 A;  3TU4 K;  3A8H B;  4ZGD B;  1WJR A;  3CC2 T;  2O9S A;  2X9H A;  2LQN A;  2KDS A;  1JJ2 S;  3OYF A;  4RMO A;  2BTT A;  3REA B;  3G71 Q;  4BE2 A;  5KYX A;  2LCL A;  3VS6 A;  2L3S A;  1NE8 A;  2K79 A;  4LDV A;  2V1R A;  2QTV A;  1MV0 B;  3FB9 A;  2JS0 A;  4FU6 A;  1BYM A;  3V7R A;  4F7U A;  1BKB A;  2EGC A;  1ZHI A;  1CKB A;  1Y0M A;  4N4G A;  3FLG A;  4RCB A;  4EMK B;  1RLQ C;  3R6N A;  1V29 B;  4LDU A;  2JJ9 A;  3MET A;  3ZEH A;  2EKO A;  5KYU A;  4QQ6 A;  3CC7 Q;  2DZ9 A;  3CXC P;  3J7A F;  2XHC A;  3JCM f;  2E64 A;  3JCM d;  2O88 A;  2JNG A;  1B7T A;  1VQL Q;  2RI2 A;  2ZPB B;  2BKD N;  4QVD A;  5C0M A;  2I0N A;  1IGQ A;  2D9T A;  5KYW A;  1WJS A;  1KQS P;  4A4E A;  1ZUK A;  2LC4 A;  3CCQ Q;  4M7D A;  2X4X A;  4HA8 A;  1NG2 A;  5GAN e;  4Z8A A;  2PVO B;  3LYI A;  4OMO A;  1Z9Q A;  2LT1 A;  4E7Z A;  3MKD A;  2CH4 A;  3G6E T;  3CCR Q;  1SHF A;  3JCM c;  5CO7 A;  2XKO C;  1NBE B;  2HCK A;  4FL6 A;  2HAX A;  2E12 A;  4JJN K;  3LGL A;  5KYY A;  2DIL A;  4LE9 A; 
#chains in the Genus database with same CATH homology
 2MMP A;  4M75 C;  4ATO A;  2DXT A;  3OYH A;  3PMI A;  3OMC A;  3J81 E;  2P0Q A;  4MML A;  1B34 A;  3OBY A;  4C8Q B;  3E1S A;  1LNX A;  2K3X A;  4IUQ A;  4M78 G;  4XTZ A;  4ZN1 A;  5GAN h;  3MP8 A;  3LW5 E;  1K73 U;  1KQS S;  4ZTJ A;  2EJF A;  1R8O B;  1BI2 A;  1VQ8 A;  3P8B B;  4PJO D;  4IUR A;  1M8V A;  4OB0 B;  3CC7 T;  2D6F A;  1M5Q 1;  5CKH A;  1Q81 U;  1VQ9 T;  3QJY A;  4C5I A;  2ZZD A;  1QVG S;  4HT9 A;  3QSU A;  4M7A F;  2V8I A;  3L2U A;  1N8R U;  2YLC A;  1N9S A;  1D3B A;  1VQL T;  3NTH A;  1VQK T;  2C06 A;  3OS2 A;  2K3Y A;  2A3L A;  1UGP B;  2CGH A;  2QDY B;  2JTF A;  2PVD B;  3LH0 A;  3M9Q A;  4M75 F;  4BI3 A;  3G4S T;  2OTL T;  2ZGW A;  2LX9 A;  3M4Y A;  1S72 A;  2FHD A;  4X34 A;  1VQ4 A;  5CKD A;  5CCA A;  3M54 A;  4Y28 E;  3INZ A;  1UB4 A;  3CME T;  3CCQ T;  1M1G A;  5HK0 A;  1Y07 A;  5EG2 A;  5KH6 A;  5GAO m;  4QW2 A;  4RKU E;  5GMK l;  1QVF A;  4OVA A;  1JRI A;  3MCA B;  4XTU A;  3X24 B;  1ZBX A;  4E7I A;  1XOV A;  4BUG A;  3JCM b;  3OYA A;  3JCM P;  3CCS A;  3DB4 A;  4J5Y A;  2LDM A;  4OB2 B;  3MP1 A;  1UGS B;  1W4S A;  3CCR T;  3CCV A;  3VKI A;  2O01 E;  4J8O A;  3X28 B;  2DTI A;  3FJP A;  2WSC E;  1ZQ1 A;  3M57 A;  4FT2 A;  4IUP A;  2KK4 A;  4J6Y A;  3LWH A;  1YI2 A;  5LJ3 e;  2V8K A;  1Q86 C;  2CS7 A;  3WVE B;  4XTX A;  3OSS C;  2M1H A;  4FM4 B;  4MZM A;  3QZ9 B;  1AHJ B;  4LDX A;  3CCM T;  3X20 B;  1G3Y A;  4C0F A;  4C8Q F;  2JZ2 A;  3MEU A;  4E47 A;  1HXD A;  5IT9 E;  1VQO A;  3BDL A;  1M90 C;  4M7A E;  5GAO r;  1W2B S;  2QQA A;  4XU1 A;  4ZN3 A;  3OS1 A;  3QG1 A;  4M7D E;  3PNW C;  4B9X A;  1VQN A;  2K5I A;  2RK2 A;  2QXF A;  1N6A A;  1NPP A;  4BDZ A;  4M75 E;  3OBW A;  2QQ9 A;  2RHU A;  4LD9 K;  5LJ3 g;  2QA4 A;  3RUX A;  4R55 A;  1OZ2 A;  3KUF A;  2KSS A;  4M78 B;  4C5G A;  4JS4 A;  1VQM A;  3JB9 F;  2XID A;  4BI4 A;  4E7H A;  3Q1J A;  2HBP A;  4QQG A;  2K4Y A;  2P4T A;  2M0O A;  2WAC A;  2RA2 A;  3SD4 A;  3HSB A;  4JDS A;  3RIR A;  3GNG A;  2RM4 A;  1H3Z A;  2ZCF B;  3I56 A;  5LJ3 h;  2KY9 A;  3I55 A;  4PJO G;  2DEQ A;  2EJG A;  3JCM V;  5M9O A;  5DLO A;  2GQV A;  4JRP A;  2EWN A;  3GNF B;  2BIV A;  2I2L A;  4IUU A;  3ZBD A;  5KE3 A;  3CCL T;  3OYY A;  3CCL A;  4IKF A;  5A0L A;  5HKC A;  1PSE A;  1VQ7 A;  3OB9 A;  4HKE A;  5GAO q;  1Y7X A;  3OSV A;  4N4H A;  4NL2 A;  5LJ5 e;  2KVQ G;  3M58 A;  2DIQ A;  3TCJ A;  2F5T X;  2LRQ A;  4M77 C;  3V7C A;  4C92 G;  5GAN f;  5HY6 A;  3CCU A;  4M7A D;  3HFN A;  4M7A A;  5GAN d;  4XTY A;  5CVI A;  3UDC A;  4C0Z A;  5LJ5 j;  3L2Z A;  4R56 A;  4OGE A;  1YHQ T;  4M7D D;  3HRS A;  3OYJ A;  2DO3 A;  2XU8 A;  4C8Q E;  4M75 A;  3KXT A;  3CC4 T;  5LL6 S;  1WPY A;  3J80 E;  3PTA A;  3OW2 A;  2RI3 A;  4A54 A;  3CMA T;  2DTO A;  5GAN 8;  2GFA A;  5GAM g;  4V2S A;  1RL2 A;  3QYH B;  5LJ5 g;  5GAN j;  4NL3 A;  1YJW A;  1YJN A;  1P92 A;  2JN0 A;  4N0A A;  2EQJ A;  5GMK m;  3PIO A;  4OF1 A;  1Q82 C;  3GIB A;  1NPR A;  2MWO A;  1WGS A;  2F5K A;  3OY9 A;  2VUB A;  3PT9 A;  5J3B A;  1Y71 A;  2KQW A;  5LJ5 h;  1NJI C;  3G7Z A;  3HHT B;  1G3T A;  1MGQ A;  3BDU A;  3QO3 A;  4M77 G;  3JRZ A;  3QYG B;  5I2M A;  4A4H A;  4JLI A;  1I81 A;  3H8Z A;  3E9F A;  4MZP A;  2HQX A;  4GLK A;  4M78 F;  4FT4 A;  3LLR A;  4J6X A;  3OA6 A;  4BDY A;  2IG0 A;  4C5H A;  4LDY A;  2FYK A;  1YBY A;  1K8A C;  2LQK A;  3JAM E;  3TRE A;  4MDX A;  3VU3 C;  5GAN 5;  3C95 A;  2Y4Y A;  2X4J A;  2XI9 A;  3C94 A;  1VQ8 T;  2RB6 A;  4BE1 A;  3OYD A;  4C8Q D;  1GXI E;  1G3W A;  4F7U G;  4C8Q A;  1G3S A;  3CBO A;  2VGM A;  3SFM A;  3N5B B;  3OYN A;  3L2W A;  3TEE A;  4JRI A;  1KHC A;  4QVZ A;  5D6X A;  3PIP A;  5FLX E;  5GAN 3;  4LDW A;  1M1K C;  3ME9 A;  3JB9 I;  2DXU A;  3GLX A;  2XG8 D;  4BY6 C;  4BD3 A;  2VXF A;  2NLU A;  4O6J A;  2X35 A;  5GMK i;  1K9M C;  4QQD A;  2DIG A;  1S72 T;  4EMH A;  1QW1 A;  1OZ3 A;  2B8A A;  1VQ4 T;  4X9D A;  1KG1 A;  1VQ5 A;  1X75 C;  2FB7 A;  1M1F A;  1O75 A;  2DPP B;  4L59 A;  5CK9 A;  2K5L A;  3L2Q A;  5FRN A;  3OYK A;  4CRI A;  1OYX A;  2JUF A;  3T9N A;  5FU7 C;  4C92 B;  2EAY A;  1PSF A;  4MZT A;  2CZ6 B;  1Q86 U;  1Q7Y C;  2KAF A;  3EAE A;  2XD0 A;  2GFU A;  3CCS T;  2HNI A;  3QZ5 B;  3OQ5 A;  1JJ2 A;  2CKK A;  2PQW A;  3L1A A;  1SSF A;  4BB7 A;  1M90 U;  3CCV T;  4M7D G;  4M78 E;  5LJ3 f;  1VQP A;  4KUI A;  4MMK A;  3RKX A;  2E41 A;  3BY7 A;  5LJ3 d;  3OYL A;  2VGN A;  1Q81 C;  2X4W A;  3SWN C;  5CQX A;  3JSC A;  1YI2 T;  3V8L A;  2X4Y A;  3A5Z B;  4YTL A;  4MDW A;  3VYG A;  2YHT A;  4PJO C;  1QVF S;  4J6W A;  2E10 A;  2FL7 A;  4TVR A;  3O8V A;  2MF2 A;  3RER A;  4XAX B;  1N9R A;  4ZGE B;  5LJ3 j;  2DD5 A;  1VQO T;  5A0G A;  3CC2 A;  2DXC A;  4OP0 A;  1KQ1 A;  3CPW A;  2RJE A;  4M77 B;  2L89 A;  4KUL A;  4PLI A;  2E6Z A;  2RHY A;  5CKF A;  4QVC A;  1VQN T;  2F69 A;  1BI3 A;  3LGF A;  4C92 C;  5GAO p;  2QA4 T;  3HKS A;  3HPW A;  3GF5 A;  4Y91 A;  1Y96 B;  3QBY A;  1XQH A;  1FXX A;  1I4K 1;  2RD1 A;  4II1 A;  1VIF A;  2A7Y A;  3QXE B;  4RG8 A;  4A4F A;  2QEX A;  1KHI A;  2EQM A;  3M4G A;  2XK0 A;  1QP2 A;  3H6Z A;  4N4I A;  4PJO F;  3ZFJ A;  3EFR A;  5J39 A;  2D0Q B;  4ZGJ B;  3DKM A;  4EPC A;  1VUB A;  4F7U B;  2AHJ B;  3I56 T;  3CCJ A;  4M78 D;  1NZ9 A;  3I55 T;  4XK8 E;  1TH7 A;  4M78 A;  3GPL A;  3DB3 A;  1BIA A;  3A8M B;  4A53 A;  2OTJ A;  5CIU A;  5GAM f;  4PL6 A;  1M4Z A;  2R58 A;  5I2S A;  5I21 A;  2YRV A;  2O4X B;  5LJ5 f;  1JBM A;  2CYZ B;  2LNV A;  5GAM d;  1VQ7 T;  3QII A;  3X26 B;  5LJ5 d;  3CCE A;  4DOV A;  3QJ6 A;  3LWI A;  2ZPH B;  1BI0 A;  5AYF A;  4C92 F;  2DZC A;  5GAM e;  3MEW A;  3MP6 A;  1YCY A;  2KMT A;  1UGQ B;  2VC8 A;  1IRE B;  3SB2 A;  1YIJ A;  4HT8 A;  3CCU T;  1KQ2 A;  2O4X A;  1UEB A;  3HRT A;  4B9W A;  1YJ9 A;  5GAM j;  3JB9 J;  1Q82 U;  2PUK B;  4HCC A;  3A8L B;  2PU9 B;  3E9G A;  4C0G A;  4L6V 5;  1QP3 A;  2RJD A;  2EYQ A;  1MHN A;  4M75 D;  2DVE A;  4D6W A;  4E7K A;  2RK1 A;  2DD4 A;  4EDU A;  3OYE A;  3P8D A;  3M55 A;  4XU2 A;  1EIF A;  2WSF E;  3L42 A;  1VQ6 A;  1JB0 E;  3UPU A;  2V8J A;  4UC4 A;  1YJN T;  4RCC A;  1YJW T;  5IN1 A;  3JCM e;  2CZ1 B;  3CD6 A;  4ELY C;  3CXC A;  1K8A U;  2RHI A;  3CBP A;  5CQY A;  4BY6 B;  3VV0 A;  4M77 F;  3R6O A;  5L8R E;  1U1S A;  3DLL A;  3WXM B;  2GCX A;  5GAM h;  3FIF A;  1N27 A;  2K57 A;  5GAO n;  1BIB A;  3OYI A;  4PJO E;  3OYC A;  3JB9 H;  4ZTF A;  2RH2 A;  4E7L A;  1X01 A;  3A8G B;  2QQB A;  3MEV A;  2HQE A;  4EMK C;  5FRM A;  2BUD A;  3M5A A;  4WF2 A;  3UWN A;  3OW2 S;  2RI5 A;  5FU7 B;  3JCM g;  2FVU A;  3RKY A;  1KQS A;  3G71 A;  1WNL A;  3MHX A;  3PFS A;  1KD1 C;  3G6E A;  2M16 A;  4F7U F;  5GAN 7;  4C92 E;  2YLB A;  1K9M U;  4KT0 E;  1KC8 C;  3VUZ A;  3JCM X;  2L5Q A;  5CKE A;  2LVM A;  2E6N A;  3E19 A;  3RKW A;  5GAN 2;  2OTL A;  3M59 A;  3VYH B;  1IZ6 A;  1B34 B;  3JCM h;  1QVG A;  3L2V A;  4FIB A;  3VJP A;  1H64 1;  4IUV A;  4JLG A;  4DOW A;  3HRU A;  5GMK e;  4M7D C;  2EQU A;  4CI0 C;  3SWN B;  3EFS A;  2GF7 A;  3QDR B;  3C12 A;  4P5N A;  3S3M A;  3S3O A;  3WVD B;  4PJO B;  2VYT A;  3BW1 A;  3FDR A;  3CEY A;  5GMK j;  1Q7Y U;  1U1T A;  3P8H A;  4ELZ C;  4JRQ A;  2ZPI B;  3A8O B;  3HL8 A;  3JB9 D;  1OI1 A;  3SWN A;  1VQ5 T;  1DJ7 B;  4C0D C;  2EJ9 A;  4N0A C;  4XTW A;  1D3B B;  1O9S A;  3ER0 A;  2K2V A;  5D6W A;  3CC7 A;  4HCB A;  4KUD K;  5KE2 A;  4DA4 A;  4PJO A;  3LX7 A;  1WQ7 A;  1VQ9 A;  2XDB A;  4M77 E;  3NTK A;  1M9S A;  3KBG A;  2P0K A;  2M9U A;  4XQ3 A;  3URG A;  4M7D F;  2XDP A;  5FU6 C;  1VQL A;  1VQK A;  2DTH A;  1K73 C;  4M7A G;  3OYM A;  3V8J A;  5D6Y A;  2LT4 A;  3RES A;  2VV5 A;  2JVV A;  5IAY A;  3G4S A;  4C92 D;  2QQS A;  2MI6 A;  2DJZ A;  2RHZ A;  4C92 A;  2L3R A;  1VIE A;  5GMK h;  3JCM W;  3S3N A;  1VQP T;  2E70 A;  2JTM A;  4M75 G;  4A4G A;  1G5V A;  1FWZ A;  2EFI A;  4Q5W A;  2R5A A;  5CKB A;  4IUT A;  2DXB A;  3CCQ A;  2LCC A;  4F7U E;  3CME A;  1N8R C;  4XU0 A;  4Z02 A;  2HD0 A;  5DY9 A;  4HCZ A;  3TU4 K;  4C8Q C;  3A8H B;  3ASK A;  2Y4X A;  3V7S A;  5CAI A;  4OB3 B;  1XNI A;  4ZGD B;  1WJR A;  4RG2 A;  4A4K A;  3CC2 T;  1W2B A;  2IVW A;  3BFM A;  4J7F A;  3RMQ A;  2KDS A;  1X6O A;  1JJ2 S;  1VQM T;  3NTI A;  4XTV A;  3CCR A;  2ZPE B;  3OYF A;  2JOY A;  4EMG A;  4RMO A;  3M53 A;  3FEO A;  5A0D A;  3UT1 A;  5KCH A;  4BE0 A;  1BI1 A;  4OGC A;  4M77 D;  1LOJ A;  3CBM A;  2ZPG B;  3QUI A;  4M77 A;  4O5V A;  4BAC A;  3QKJ A;  4GY5 A;  2QEX T;  4BE2 A;  2RHX A;  2PUO B;  1I5L A;  2LCL A;  4NOY A;  1U8R A;  1NE8 A;  4L5G A;  3OS0 A;  3CCM A;  3SDZ A;  4LDV A;  3PMT A;  3S6W A;  2MAM A;  3CCJ T;  3NFC A;  3HFO A;  3MO8 A;  2OTJ T;  4PKC C;  5CR2 A;  3C4S A;  1Y96 A;  3FB9 A;  2E1H A;  2Y90 A;  1LJO A;  1WJQ A;  2XIC A;  2ZPF B;  4FU6 A;  4C8Q G;  3CPW S;  3AHU A;  2DK3 A;  3RMS A;  4XU3 A;  3CCE T;  1BYM A;  2EQK A;  3OMG A;  1BKB A;  3V7R A;  4F7U A;  5DLQ E;  3GOX A;  2QTX A;  1ZHI A;  2E65 A;  4N4G A;  4RCB A;  3FLG A;  4EMK B;  4J83 A;  1YIJ T;  3X25 B;  1V29 B;  4JRK A;  4LDU A;  1YJ9 T;  3MET A;  1WQW A;  4PNO A;  3JCM Q;  3JB9 G;  3ZEH A;  4JS5 A;  3L2R A;  3JCM J;  2EKO A;  5GAO l;  4QQ6 A;  2DZ9 A;  5GAN 6;  3J7A F;  1UGR B;  2XHC A;  3V8K A;  4EMK A;  4VUB A;  3JCM f;  1QVP A;  2VXE A;  2E64 A;  1NJI U;  2QQR A;  3QPH A;  3JCM d;  2MWP A;  3OYB A;  2JNG A;  3FRN A;  4M7A B;  2RJC A;  4KBM B;  4C5E A;  4LD6 A;  5GAN 4;  1VQ6 T;  2RI2 A;  4M7D B;  2ZPB B;  2BKD N;  2G3R A;  4OB1 B;  4QVD A;  3MEA A;  5C0M A;  2H3J A;  5A2Q E;  3CD6 T;  5C6S A;  2E5Q A;  4DQ2 A;  4M75 B;  5KCO A;  4X9C A;  2D9T A;  4JUV A;  2RO0 A;  1FX7 A;  1WJS A;  2R57 A;  1KD1 U;  4NS5 A;  3HP9 A;  4A4E A;  4BI8 B;  4ME7 A;  5HK3 A;  1YHQ A;  2LC4 A;  5DM7 R;  4M7D A;  2X4X A;  1KC8 U;  4HA8 A;  4C0D B;  2OAU A;  5FRO A;  3OYG A;  5GAN e;  3M56 A;  4M78 C;  2QI2 A;  2PVO B;  3CC4 A;  4OMF B;  2R5M A;  3LYI A;  2DAQ A;  1I8F A;  4PLL A;  3CMA A;  3OS5 A;  2L8D A;  3PGG A;  2WSE E;  1M1K U;  3GP8 A;  3G71 T;  2LT1 A;  2K5F A;  2LQ8 A;  1RI0 A;  2CZ0 B;  3G6E T;  2DKG A;  1YIT T;  2EIF A;  3JCM c;  5FU6 B;  3VUB A;  1YIT A;  3CXC S;  5CO7 A;  2XKO C;  4FL6 A;  2PVG B;  4E7J A;  2XDD A;  2HAX A;  2P0P A;  1HK9 A;  1XTD A;  3F70 A;  4J7I A;  2E12 A;  5GAN g;  4M7A C;  4JJN K;  2LTO A;  3LGL A;  5J26 A;  2RJF A;  3DLM A;  3CPF A;  3FC3 A;  4FSX A;  2CZ7 B;  3QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...