2RHIA

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with h1.5k27me2 at 1.66 angstrom
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
CWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhiA03
4ZTFA 5KE2A 4BD3A 4N4HA 3OYEA 1OYXA 2E5QA 2EQMA 5J39A 4BE1A 2PQWA 3OYKA 3H6ZA 2RI3A 3QBYA 3OYMA 2X4WA 2L8DA 3LLRA 2XDPA 3OMCA 2R5AA 3MP1A 3OYGA 2X35A 3H8ZA 4II1A 4CRIA 2HQXA 3S3MA 3META 4IUTA 3OYJA 2QQRA 3S6WA 3DLMA 2RO0A 4FL6A 4N4GA 2JZ2A 4EDUA 1WJSA 2O4XA 3OYCA 4GY5A 3L2WA 1SSFA 3OQ5A 2RHYA 3M9QA 2M16A 2M1HA 3MEWA 4A4FA 3ZEHA 4IURA 4Z02A 4IUVA 2EQKA 5J26A 4UC4A 4B9XA 4RG2A 4BDZA 3MP6A 3FC3A 2QQSA 2XK0A 5D6YA 3CEYA 2NLUA 3LYIA 2P0KA 2RHXA 4QQDA 5C6SA 4IUUA 3OS0A 1WJRA 4PL6A 3E9GA 3MEAA 1RI0A 5M9OA 2LVMA 2BIVA 3PFSA 4QW2A 3ME9A 4E7IA 4A4EA 5FROA 1WJQA 3OYAA 2GFAA 2GFUA 2RJCA 3QJ6A 3LGLA 3NTKA 3QKJA 2B8AA 2LTOA 3EAEA 2DIQA 3FDRA 2K3XA 3SD4A 5KCHA 5D6WA 2F5KA 4HCZA 1XNIA 3BDLA 2DAQA 3DB3A 2BKDN 2L89A 4Q5WA 3F70A 2E6NA 4N4IA 1WGSA 3LGFA 1OZ2A 3OYBA 3OYNA 2MWOA 2LRQA 2HQEA 4C5HA 3LH0A 4IUQA 4QQ6A 2RI5A 4NS5A 4PLIA 3NTHA 3OY9A 4E7JA 4QVZA 3KUFA 5KH6A 4E7KA 4C5IA 2G3RA 3ASKA 3LX7A 2GF7A 5KE3A 4BACA 3UWNA 2D9TA 2LDMA 3MO8A 3OS1A 4IUPA 5D6XA 5C0MA 4E7LA 3Q1JA 2FHDA 2X4XA 2X4YA 2YRVA 2CKKA 3OS2A 3E9FA 1OI1A 2RI2A 5FRNA 2M0OA 2K3YA 2R5MA 2RJEA 3QIIA 2RJFA 4BE2A 4B9WA 4FU6A 5CIUA 2O4XB 2R58A 2BUDA 2RHZA 2RHUA 5IAYA 1G5VA 2JTFA 3P8HA 4C5GA 3OA6A 2MWPA 2RJDA 4IKFA 2VYTA 3NTIA 2EKOA 3UT1A 3L2VA 4ZTJA 5KCOA 4A4HA 4BDYA 4X34A 1MHNA 2WACA 3P8DA 4QQGA 1N27A 3FLGA 3OYHA 2R57A 3OYFA 3L2QA 4BE0A 3GOXA 3PMIA 3L2RA 3OYIA 3OYLA 2L3RA 3DB4A 4A4GA 3MEVA 4LD6A 4PLLA 3OB9A 4OVAA 3PNWC 3L2UA 3S3NA 3S3OA 3MP8A 2IG0A 2RHIA 4L59A 2EFIA 1OZ3A 3PMTA 4C5EA 1H3ZA 3OYDA 2DIGA 1KHCA 3MEUA 2EQUA 3C4SA 3O8VA 4E7HA 5IN1A 5FRMA 3L42A 2LCCA 3FEOA 2EQJA 3OMGA
chains in the Genus database with same CATH superfamily
1RAIB 1KD1U 2ED1A 2HZYA 2E6ZA 4BD3A 3OYEA 4FYVB 2PQWA 1YJ9Q 3CC4Q 5I22A 3PT9A 2E5KA 3NFCA 1KSWA 3JCMd 3META 4IUTA 3OYJA 3S6WA 1JJ2S 2RO0A 3REBB 1YI2A 2HAXA 2EAYA 2O4XA 4M7DG 1SSFA 2EPDA 2KK4A 3M5AA 1AWWA 1NZ9A 1IZ6A 3CMEA 5AYFA 3MP6A 2CZ7B 2DFUA 2X51A 2V1QA 2QA4T 2K9GA 2RHXA 3G4SQ 1I5LA 3HFNA 4F14A 4MZPA 5GAN8 3QDRB 2RJCA 4JS4A 5GANj 2NUTA 1WGSA 3CCSA 4CC7A 5A0LA 4ZN3A 1XQHA 1ZUYA 2QTVA 1YITT 1KQSA 1R0CB 4JJCA 5KYUB 3ASKA 2DNUA 2KMTA 2DXBA 5GMKe 1Q81U 4HCBA 4FYWB 3E9FA 3CCMA 2R5MA 2K3YA 3HP9A 5IAYA 2R58A 1IGQA 2CT4A 4IKFA 4LDUA 5L8RE 3SHWA 5GAOq 4X34A 2HNIA 1GBRA 2R57A 2ATCB 3L2QA 1RLPC 3CBMA 5KYXA 2A0FB 3CBPA 2VB6A 1YP5A 4JPBW 4XTWA 2CP5A 2FO0A 4M75G 1K8AU 2KR3A 5FWCA 5LL6S 5IN1A 1QP3A 1RLQC 1U1TA 2BZXA 3M57A 2A37A 2K57A 1QLYA 2XMFA 3EHQA 2JOYA 1PSFA 1FX7A 2QQBA 4BE1A 1G83A 4EIKA 1G3WA 3CCQT 3GIBA 2X4WA 4ZGDB 1M1FA 2X35A 4KRTA 2KQWA 3EGXA 4OF1A 4OMLA 4GY5A 2EIFA 2HBWA 2JMAA 2DLPA 5A0DA 1VQ7A 4M7AG 1M2OA 3FC3A 4OB3B 2DRKA 2DBMA 1VQKA 1MMAA 1T3SA 5GMKj 5CKDA 2LVMA 4RMOA 5IHIA 1W2BP 2GFAA 2ZPFB 2JNGA 1AZEA 2DL5A 4M78C 4AG2C 4XTUA 3JCMP 2RQWA 1VQLA 3OYBA 2K4YA 4M7DD 2CP0A 4M4ZA 1CSKA 3HRUA 2V8KA 2AIRB 1MMDA 2C0OA 1TXQA 2AT1B 3JB9I 3MO8A 3Q1JA 4OMNA 5KYWA 4HVUA 3CC7Q 3QPHA 1N9SA 5LJ5d 2RJFA 2DJZA 2MWPA 2LJ3A 7AT1B 1U06A 2COZA 1WNLA 2XU8A 2OTLQ 1TH7A 3P8DA 1LJOA 4EMHA 1Q81R 4PFPA 2X3XD 3PNWC 5LJ3e 3CCJA 2RQVA 3MP8A 2A28A 2NYSA 4L59A 5CCAA 2X9HA 2EFIA 1RL2A 4DBHA 4C5EA 1SEMA 4RCBA 4C92G 2MAMA 2QDLA 1GFCA 4HKEA 1M2VA 3VU3C 4RTWA 2RK2A 4M77F 2A7YA 1YI2Q 5KYYA 1K73C 2FRWA 1AD5A 2Y90A 1SHFA 3RDVA 4XQ3A 3H6ZA 1ZUKA 3CMEQ 2KDSA 3EFSA 3H8ZA 1GL5A 2HQXA 2KYMA 2DXCA 3CQTA 4N4GA 2LQNA 1BI2A 2M9UA 3M9QA 5HKCA 2XDBA 1TG0A 5AT1B 4A4FA 4C8QA 1QVPA 4FYYB 3O5ZA 1D1AA 3X25B 3G71A 1M90U 4E47A 3I56Q 3OS0A 2OI3A 2K5IA 3E9GA 3CC7T 3PIOA 3KFVA 4X1VA 4HVVA 1EZZB 1FMKA 1VQMA 3CC2A 3TU4K 2LTOA 1M9SA 2F5KA 4HCZA 2A36A 4KUIA 2E6NA 2HQHA 1QCOA 1M3AA 2JUFA 3LH0A 3FJPA 2CP3A 4LN2A 2YUQA 2I2LA 2DZCA 2KT8A 5LJ3j 1SRMA 1O9SA 4DEXA 2DKGA 4FIBA 5FRNA 1MMGA 1G3TA 1K76A 1WHHA 3VS3A 3JCMf 5A0GA 4LDXA 4RKUE 3E19A 1OOTA 1ZSZB 2LQWA 1N5ZA 5GAOr 3M58A 1WIEA 1LOJA 3NGPA 2EBPA 5GJWB 3MEVA 4LD6A 4FSSA 2OAWA 2F5TX 2VV5A 3EG1A 1W4SA 1VQ5T 1M30A 3EGDA 4OP0A 1VOMA 2P84A 2LCCA 4Y91A 4R56A 1YJWA 4EMKB 4RTVA 3X24B 1YHQA 4ZTFA 3I56T 4J9IA 1U3OA 2JXBA 2J7IA 1VQ7Q 1K0XA 2H3JA 3RIRA 5CK9A 3REAB 4F7UG 4M78A 3R6NA 1OX9A 1KQ1A 1I81A 5LJ5h 4DOVA 3I35A 2OTJT 2PUKB 3EFOB 2M16A 2ZPGB 2VGMA 3VUZA 4PJOD 4M75F 1IHWA 2PNIA 3BE3A 4M7DB 4PJNA 1IXDA 1WHJA 3JSCA 4RG2A 2P0KA 5IHNA 4J83A 1B34A 1RI0A 1RAFB 2ZPBB 4XU2A 2JM9A 2DF6A 1WJQA 2VUBA 2B8AA 4F16A 5D6WA 5GAMg 3SB2A 2Y4XA 4PJOC 1X43A 3SDZA 5GAMe 1BIBA 1M90R 2E1HA 1E7OA 3CBOA 3SWNB 1D0XA 4NS5A 4M7AF 1JXOA 5KE3A 1BBZA 3UWNA 3CCRA 2QGGA 1YWPA 3OS2A 2L0AA 3H0HA 1WHGA 2M0OA 4ZGEB 2CYZB 2XD0A 3HHTB 4FU6A 3GF5A 4C5GA 1ACMB 3CCJQ 4V2SA 2XKOC 3M56A 2DRMA 1TU0B 2FPDA 4HT9A 1QVGA 2YLCA 1JEGA 1S72A 3GOXA 5CAIA 3CCUA 3M0TA 3DB4A 4XTZA 2O2OA 4J6XA 2AHJB 1OQKA 1WXUA 4X9CA 3A8GB 2D8JA 1WFWA 1WI7A 3CPWA 2HMAA 1YN8A 1NPPA 4M75E 5FRMA 3PIPA 4CC4B 1NBEB 3N5BB 2EGCA 4GLMA 3EG9B 2O9SA 5GANd 1AVZC 2KYBA 2EQMA 1WJSA 2FL7A 1BI1A 5LJ5f 4KUDK 2RH2A 1HXDA 5GAMj 3QWXX 3ZEHA 3CC2Q 2JM8A 1VQMQ 3QUIA 1D3BB 4C92F 3EG9A 2MYSA 2K2MA 4BI3A 2KAFA 4M7AE 3CCLT 4M7AB 3QHSA 3CXCP 1WQWA 1NLOC 1W6XA 2WSEE 1VA7A 2GFUA 3NPFA 3ER0A 4C8QG 2DIQA 1VQNT 2KROA 2DAQA 4Q5WA 4N4IA 1X6GA 8AT1B 2NUPA 2EGAA 1KC8U 4IUQA 2YDLA 4LD9K 1G8XA 1N8RU 1RAHB 2DEUA 4OB2B 2EYWA 4KGZB 1BI3A 2K6DA 1Q95G 2X4XA 2RF0A 1TUCA 3X26B 2CP2A 2MPXC 1G5VA 2RHZA 2PTKA 2JTFA 3P8HA 2J06A 1QMCA 4FW2A 1UJYA 3RKYA 4JJBA 1LVKA 2ROLA 2HEQA 2A08A 3JCMJ 4J9FA 1K4US 4HT8A 2FYKA 2DMOA 2B86A 1Y71A 2RN8A 3SEMA 1YJWQ 3GLXA 2DE0X 5HK0A 5FLXE 1UGSB 3UA7A 1YHQQ 1KHIA 2DILA 2RM4A 3G6EA 3VRYA 4J9BA 2DBKA 2KT1A 4LUDA 4AT1B 4FYXB 1WYXA 4PJOB 2DVEA 2RNAA 2VVKA 5CKEA 4PFZA 1VQ8A 4M77G 2QGFB 4C92E 3DKMA 1NEGA 5CKBA 4BI8B 1PWTA 1OULA 4JZ3A 5J39A 3EGUA 4E2FB 3QBYA 4FCYA 5FU7B 2XDPA 1I5OB 4MDWA 1C0MA 2JTMA 2KY9A 4HA8A 1ARKA 2V1RA 4C0ZA 1SHGA 2MOXA 2QASA 2DERA 1K73U 4IUVA 2RPNA 4A54A 3QYGB 5GMKl 1PSEA 1VQ9Q 4HXJA 2M02A 2VGNA 2HD0A 1VIEA 4IUUA 4RTXA 4PL6A 3TEEA 1UDLA 3EH2A 1MNEA 2XICA 4F7UF 1UTIA 3CCRQ 1MV3A 3MPUB 2ZPHB 5IT9E 2V8IA 3VRZA 2HQEA 4E7JA 1KK7A 4E7KA 3PVLA 4PNOA 1C6VX 1PHTA 3I55A 2F2WA 3MJXA 4WF2A 2O9VA 1WQ7A 4KT0E 4BE2A 1S72Q 5FU6B 2RHUA 4C0FA 1KC8R 2XG8D 2DA9A 1I8FA 1N8RR 2FEIA 3VS2A 4Y28E 3VV0A 4JLGA 1IGUA 2LNVA 2XIDA 3C94A 4QQGA 3UDCA 3OW2S 1OPLA 1Q82C 4WTOB 4A4GA 3VYGA 3CMAA 3S3OA 1JJ2A 4JRQA 3OSVA 3QZ5B 2FG0A 4AFQC 2PU9B 3GBQA 2DIGA 1KHCA 2LX9A 3X20B 2VASA 3CCEQ 2AK5A 3FEOA 1NPRA 1VQ9T 5FW9A 3C12A 5ECAA 4FT4A 3LW5E 5KYUA 1YJ9T 2ENMA 4EPCA 3CC4T 2K3BA 2HL3A 4GBQA 3LLRA 1LNXA 3S3MA 3OYGA 4R0KA 1RAEB 2DL7A 2QQRA 4JS5A 2L5QA 2XHCA 3CCRT 4F7UE 3T9NA 1YCYA 4O5VA 4F7UB 2CZ0B 1VQOA 2DYIA 1BB9A 2GTJA 5IXBA 1ABOA 4M77D 3A8LB 3VS7A 3OW2A 3G4ST 1RABB 1Q86C 4QQDA 2PVDB 2DETA 1OPKA 4R55A 2D0QB 2E41A 2PZ1A 4AFZC 1YNZA 3BY7A 4F17A 2ZAEA 1BIAA 1R77A 3SD4A 2QYZA 1W1FA 2VXFA 3FDRA 1K9MR 5L23A 3I5RA 1PRMC 5J3BA 3A8OB 1K73R 4LDVA 2C0IA 3LGFA 4J8OA 1VQ6Q 1KD1R 3JCMg 1QWFA 1TUGB 4QQ6A 2QQAA 2EYZA 3JCMe 4DOWA 1AOJA 1ZSZC 3LX7A 5GANf 3OS1A 4E7LA 5CQYA 2FHDA 1DJ7B 4E7SA 1VQPQ 4BI4A 2YRVA 3JCMc 9ATCB 1FMWA 2NUZA 2QEXA 4C8QF 3CCET 1AWJA 3VS1A 1Y96B 3G6EQ 1WA7A 1BI0A 2JW4A 4EMKC 1M1KC 4BE0A 1NYGA 1B7TA 3OYIA 2A3LA 2IG0A 1VQ4Q 5HCKA 2HCKA 2ZGWA 3JCMh 1IREB 3X28B 1H3ZA 3C4SA 3G7ZA 4IIMA 2CH4A 4M7DC 1EIFA 2FPEA 1CKBA 1FYNA 1X01A 3M53A 3E1SA 3PE0A 1OYXA 2E5QA 1FMVA 3P8BB 2L8DA 1IHVA 5CKHA 3MP1A 2HKQB 1Y7XA 4RTZA 3GPLA 3DLMA 2KXDA 1GRIA 1QWEA 2OAUA 4PJMA 1VQ6T 1ZBXA 3GNGA 1YIJA 1I1JA 1OU9A 4UC4A 4PKCC 2BZYA 3JRZA 4XTYA 3SWNC 3I9QA 1VQPT 1YBYA 1V29B 4A4EA 4ATOA 1K8AR 2W10A 1ZBJA 5FWBA 1OX8A 2MI6A 4C8QE 3I55Q 3VJPA 2DO3A 3A1PA 3OYNA 4M75D 2GQIA 4DBRA 4C5HA 4PLIA 1EX4A 1SG5A 3CCSQ 4BACA 3JB9F 1VQ4T 4M78F 1VYUA 2E4HA 1UGVA 2BZ8A 4LDWA 3JB9H 2XDDA 1UHCA 1YCSB 1GXIE 4DQ2A 5GAOl 1QVFP 4FSXA 2KVQG 2RJDA 5EC7A 2FRYA 2OTLT 3CCMQ 4M75C 3TSWA 4JRPA 1N27A 1KQ2A 4M7AD 1RADB 3QYHB 3INZA 2NWMA 4QVCA 2LCLA 4OVAA 2AZVA 1ZUUA 1RAAB 2MIOA 3C0CA 4KULA 4OGCA 3CD6A 4J7IA 4LXCA 2EWNA 1YI2T 1W2BS 4M77E 5LJ5g 4M77B 2L3SA 4B6MA 2EQIA 4L5GA 2KNBB 3EH1A 4N4HA 5LJ5e 3CCVA 2AKLA 4M7AC 3CMET 3OYMA 1T0HA 2GBQA 1UB4A 5I21A 1Q81C 2CH4W 2KRNA 3L2WA 3RKXA 4FW1A 1YJNA 1R0BG 2BE9B 4P5NA 5J26A 4B9XA 4JRKA 1ZSZA 5D6YA 2GGRA 3CCST 4KBMB 2L3PA 2PVOB 2EJFA 3IQLA 2KRMA 2RB6A 3GP8A 3PFSA 4XTVA 3OYAA 1WLPB 2E12A 4OMOA 2ED0A 5HY6A 1VQKQ 1PKTA 3UF4A 1GCPA 1H8KA 5CVIA 2QA4A 2RQUA 1W2BA 2EJGA 3CCMT 2MWOA 2HBPA 3HKSA 4EMKA 1E6HA 4C92D 1WX6A 2QEXQ 3QXEB 3VUBA 1VQLQ 2LMJA 1K0SA 3H0FA 4OMQA 3WVDB 3RUXA 1OV3A 1JBMA 1ZHIA 2OX7A 3UA6A 4HCCA 4B9WA 5GAN4 1YITA 1CKAA 3OA6A 3EFOA 4LDYA 5KYNA 1ZA2B 5LJ3f 4OB0B 2EKOA 1VYTA 4M7DA 5KCOA 4D8KA 3A8MB 5GAN7 5LJ5j 4C92C 4JUVA 1VYVA 3L2RA 2LJ0A 3M4GA 1UECA 5FU7C 1G2BA 3RMSA 3EFRA 3ZBDA 1UGRB 2QTXA 2DL8A 3OMGA 3SWNA 4J6WA 1VIFA 3M0PA 1RAGB 2CP7A 3RNJA 1ZX6A 1QVFS 4A63B 2ESWA 1VQ7T 1YIJQ 1T0JA 3L1AA 3M4YA 4HCKA 3H9NA 1VQKT 2LP5A 2W0ZA 4ESRA 2DD5A 3PGGA 4M75B 2FZCB 1T3LA 2E65A 3ZL7C 3CCQA 4C0DB 1VQLT 1IO6A 1M8VA 4DEYA 2DEQA 2YUOA 3ME9A 1NJIC 4NL3A 2ZPEB 1QKWA 3G71Q 3NTKA 2EYXA 3HRTA 3EAEA 2COWA 5GAN6 2YWWA 1KQSP 2I0NA 3TVTA 1OZ2A 5FU6C 4RG8A 4RCCA 4GLKA 3OY9A 3NTHA 1Q86U 4PFOA 1SSHA 2M51A 4C5IA 1NEBA 4FT2A 2LDMA 4OGEA 2VC8A 5GAN5 3RMQA 4KGVB 3JCMW 4J9EA 3V7SA 2PVGB 2LT1A 3CCJT 2JJ9A 1PRLC 4LUEA 3L2VA 4ZTJA 2EVRA 1D3BA 2QQ9A 1BKBA 1B3QA 4QT7A 4XTXA 4M7AA 2YUNA 2BE7D 1M90C 1WXBA 2VKNA 2SEMA 2JN0A 2KRSA 1Y0MA 2COYA 1Q7YC 1UGPB 5I2SA 1PM3A 1PD0A 3BFMA 3CCVQ 2HKNA 1OZ3A 2LNHB 1HK9A 1V76A 4J9HA 5DLOA 2JS0A 1M1KU 2K2VA 1X75C 1M8MA 1YJNQ 2IVWA 2K7AA 2CUBA 1UEBA 3HTRA 3URGA 3OYKA 3NHNA 4JRIA 5IHKA 3G71T 1AT1B 2FVUA 3BDUA 1LPLA 2ZPIB 1OEBA 4LE9A 2P0PA 2JZ2A 1YWOA 1ABQA 1D1CA 2X4JA 1TWBA 3CC2T 2M1HA 1VQMT 2VWFA 2E3IA 1X6OA 2DXTA 1BYMA 4C92B 5DY9A 2DL3A 2NLUA 3RKWA 2MMPA 1U5SA 3QSUA 2L3QA 2GNCA 4MMLA 1WJRA 2RK1A 4JDSA 1W70A 3J7AF 5GANg 3LGLA 2DXUA 5D7UA 2ABLA 1XNIA 1GCQC 5GANe 4PJOA 2L89A 2ECZA 2LZ6B 3F70A 4FM4B 2FZGB 3V8JA 2KGTA 1X2KA 1BCOA 2EW3A 3CC7A 1MV0B 3A5ZB 1YITQ 2JS2A 3JCMb 3JB9G 4M78G 3EG0A 1P92A 5D6XA 3QZ9B 5CO7A 2J6OA 2X3WD 1M1GA 1OI1A 4E6RA 1QP2A 5CIUA 2O4XB 1EFNA 3VS6A 2CGHA 1TUDA 4OB1B 2CUDA 1Q86R 3NMZC 1NE8A 3FB9A 2YRDA 2KE9A 1XOVA 1YJNT 1KQSS 1KFZA 5GANh 1AEYA 1YJWT 2DJQA 1SPKA 2WSFE 3OB9A 1YHQT 2YHTA 1H92A 4JJNK 1SF9A 2C0TA 2NUTB 3CXCS 1TS9A 3CCUQ 2V8JA 1A0NB 3O8VA 4E7HA 1TSFA 4C8QD 3MHXA 1RUWA 2M0YA 1YFNA 4RTTA 4EMGA 3DLLA 1VQ5A 4PJJA 2GTOA 2O31A 2RI3A 3CCQQ 2D1XA 3OMCA 1Y57A 4II1A 4ZGJB 4OMFB 4BUGA 3M0SA 4FL6A 2G6FX 3OYCA 3FRNA 3I56A 3AHUA 1M1KR 4LNPA 4IURA 1AZGB 1UJ0A 1N9RA 4C8QC 1S1NA 1M3BA 1WHMA 4J5YA 2QQSA 2XK0A 3G1JA 3CEYA 1NM7A 5KYXB 3PTAA 2LJ1A 2OTJA 2BIVA 4E7IA 4ZNXA 5FROA 4WCIA 3I5SA 1PCXA 5KCHA 3CXCA 2CREA 2K5LA 4IIOA 1WZOA 2Z0WA 3WVEB 4XU1A 3M55A 5LJ3d 3UPUA 3LWHA 3QWYA 2LRQA 2J6KA 2KEAA 2KI7A 4A53A 2RI5A 5KH6A 1V1CA 5GAN2 2G3RA 2E10A 3RESA 1S72T 3RR6A 2EKHA 3EGXB 4J6YA 1MMNA 3CCUT 4F7UA 4JJDA 5GMKh 3JAME 4TVRA 2YRCA 2VYTA 3UT1A 1M4ZA 1ZQ1A 2DL4A 4M77C 3PMIA 2HSEB 4PLLA 2GCXA 3MKDA 3JB9D 4M78D 2E3HA 3VS0A 1K9AA 2C06A 2RD1A 5IH2A 2O01E 3MEUA 4MDXA 3ULRB 1HD3A 2DYBA 2IIMA 3HFOA 1KC8C 4BY6C 1Z9QA 4C0GA 2MCNA 1N8RC 1VQ8Q 4XU0A 2CSQA 1K1ZA 3FJ5A 2WSCE 5GAN3 1E6GA 5KYWB 4J9GA 4RUGA 2R5AA 3L2ZA 4CRIA 1GCQA 2YSQA 2LC4A 3V8KA 1TTHB 2J6FA 5DM7R 1M27C 5CQXA 1Y96A 2BTTA 3AT1B 2DX1A 3LYIA 1H3HA 5C6SA 1D0YA 3OSSC 1I4K1 4CC2A 4Z89A 1LCKA 3QJYA 1AWXA 3QJ6A 1Z9ZA 2K3XA 2F69A 3CCLA 3FIFA 1M2VB 2PUOB 4JLIA 4L6V5 4O6JA 5KYYB 2AKKA 3KXTA 5LJ3g 2LCSA 3H0IA 3QO3A 3OBYA 1VQNA 2FPFA 2DTOA 2GF7A 1NJIU 1M5Q1 4PJOG 1NG2A 2RI2A 4K11A 3HPWA 4AFSC 5GMKi 1H641 1QVGP 2AZSA 4C8QB 1RACB 3G6ET 1K9MC 1JQQA 4ELZC 3TQ7P 2V26A 4A4HA 4DA4A 2HSPA 4J7FA 1G3YA 1VQ8T 3OYFA 1KD1C 3KBGA 2E70A 3OYLA 4MZTA 3CPWP 1AWOA 1PD1A 2CSIA 3TREA 4ELYC 3L2UA 2SRCA 5HK3A 1ZA1B 1VQ5Q 3EG3A 2CS7A 1XJWB 3OYDA 5LJ3h 1PNJA 3CMAQ 1D09B 5GAOm 4DBFA 4C0DC 1RI9A 1Q7YU 2QXFA 2JMCA 5GAMd 1WHKA 2K5FA 1X27A 1KG1A 3E2UA 4BB7A 2F1LA 2LT4A 1PKSA 3ZFJA 2FZKB 4EDUA 4Y92A 4JZ4A 2OTJQ 1BU1A 2K79A 4M7DF 1QCNA 2CDTA 3OBWA 2EQKA 1WPYA 1Y07A 2YXYA 3LWIA 3EG2A 4N0AC 2YUPA 3M0UA 1PG5B 1O75A 1VQOQ 3MEAA 1UFFA 5M9OA 2KXCA 4CC3A 1MGQA 3C95A 2DD4A 1HJDA 1PC0A 4VUBA 2CZ1B 3UATA 1U1SA 3I55T 3EGDB 3DB3A 2DTIA 4KGXB 1JRIA 1WXTA 4PJLA 1FWZA 5GAOn 1QW1A 3RBBB 2LQ8A 2JVVA 1SRLA 2ZZDA 4BY6B 4M77A 2DPPB 1G3SA 4QVZA 1UHFA 4D6WA 1IB8A 2Y4YA 2EGEA 4XAXB 4IUPA 4M78E 1FXXA 2QDYB 2X4YA 4M78B 2E64A 2CKKA 2P4RA 2RJEA 2YLBA 1HSQA 4E7ZA 1N6AA 1K8AC 3CMAT 2D6FA 3NTIA 3V7CA 4PK4A 3VS5A 5I11A 1NJIR 3FLGA 1F1BB 1MNDA 3EHRA 4RTYA 5A2QE 2KSSA 4NL2A 4ORZA 2L3RA 5CKFA 1B34B 1C1AA 3S3NA 1WDXA 2CT3A 2L2PA 3M54A 2RHIA 3JCMV 1UE9A 1X6BA 3PMTA 4A4KA 4D8DA 4AFUC 2QAZA 4M7DE 2EQJA 2CP6A 1KJWA 1VQOT 3U23A 1QVGS 4Z88A 4NOYA 3M59A 3HL8A 1D1BA 3PVQA 1UUEA 1VQ9A 1J3TA 2LQKA 3CPWS 3R6OA 2RHYA 3OYYA 5CR2A 4RTUA 2IPOB 3GNFB 1YJ9A 2KBTA 3CC4A 1QQJA 2H3EB 1JXMA 1Q7YR 2F2VA 4OMPA 4MZMA 3CCLQ 1Q82U 4QKUA 1R8OB 2CZ6B 4QW2A 3A98A 2MF2A 1JB0E 1WHLA 1VQNQ 2BKDN 2YT6A 1KIKA 1GBQA 8ATCB 3G4SA 1QKXA 5GJVB 3QG1A 2RQTA 1JO8A 1QCFA 2DVJA 3V8LA 2QEXT 3KUFA 3VS4A 1X69A 2FB7A 1IRXA 4XU3A 2DTHA 2DZ9A 3MCAB 5GAMh 5EG2A 5C0MA 1X2QA 2EYYA 4YTLA 2HL5C 2DK3A 2BUDA 1SKUB 5IXFA 2ROTA 1ZSGA 2EJ9A 3OS5A 1B07A 4M75A 2QK0A 3VYHB 1QVFA 1MUZA 3OYHA 1JJ2P 4ANJA 5I2MA 2RMOA 3CCEA 2MK5A 1HYOA 4KH0B 2GQVA 1I07A 4PJOF 3CPFA 1OU8A 2EQUA 2NUPB 2J05A 3V7RA 4QVDA 4F04B 4N0AA 1AHJB 1BK2A 5KE2A 3TSZA 3CD6Q 1YIJT 3HRSA 3THKA 2OJ2A 4HVWA 2RA2A 4DBQA 2JTEA 4CI0C 1XTDA 4XK8E 3OQ5A 3OW2P 3TCJA 3MEWA 3HSBA 1I0CA 3H41A 2JT4A 4Z02A 2VXEA 4ME7A 4AG1C 4BDZA 5GAOp 2F2XA 3WXMB 2O88A 3J80E 1GFDA 2P4TA 1VQ6A 1ZLMA 3JB9J 3QKJA 3QDFA 2EYQA 5DLQE 3JV3A 3BDLA 3VKIA 1TOVA 4X9DA 1JU5C 2D8HA 1Q82R 1VQPA 2XI9A 2ZCFB 4Z8AA 2P0QA 4OMMA 2QA4Q 1M3CA 2D9TA 1NLPC 5GAMf 1UGQB 3JCMQ 4J9CA 4AMCA 3M0RA 3QIIA 4PJOE 1BCMA 4KH1B 2HDAA 1D0ZA 4J9DA 1NYFA 3LH5A 4ZN1A 3BW1A 2RQRA 3JCMX 4MMKA 1VQ4A 2H8HA 4C92A 4BDYA 3CD6T 1MHNA 2WACA 6AT1B 1UG1A 5GMKm 2D0NA 3J81E 2LX7A 1VUBA 3CCVT 2OTLA 3D7SB 2QI2A 1K9MU 2DM1A 3SFMA 3M0QA 2QG9B 3L42A 3A8HB 3RERA 1U8RA
chains in the Genus database with same CATH topology
1KD1U 4M77B 1KC8C 2E6ZA 5GANd 4BY6C 4C0GA 4BD3A 4L5GA 1N8RC 4N4HA 3OYEA 5LJ5e 3CCVA 2EQMA 4M7AC 4XU0A 2PQWA 3CMET 2WSCE 5GAN3 3OYMA 1UB4A 3PT9A 2R5AA 5I21A 3L2ZA 3NFCA 4CRIA 1Q81C 3JCMd 3META 4IUTA 3OYJA 3S6WA 1JJ2S 2RO0A 1YI2A 2HAXA 2EAYA 2LC4A 3L2WA 1WJSA 2O4XA 2FL7A 3RKXA 4M7DG 1SSFA 1BI1A 3V8KA 2KK4A 3QSUA 5LJ5f 4KUDK 3M5AA 2RH2A 1YJNA 1HXDA 5GAMj 5DM7R 3ZEHA 5CQXA 3QUIA 1Y96A 1D3BB 1NZ9A 4P5NA 4C92F 1IZ6A 5J26A 4B9XA 4JRKA 5AYFA 4BI3A 3CMEA 3MP6A 2KAFA 2CZ7B 4M7AE 5D6YA 3LYIA 4M7AB 3CCLT 2QA4T 3CCST 2RHXA 4KBMB 2PVOB 5C6SA 3QHSA 2EJFA 3OSSC 1I4K1 1WQWA 1I5LA 2RB6A 3HFNA 3GP8A 3PFSA 3QJYA 4MZPA 4XTVA 2WSEE 5GAN8 3QDRB 3OYAA 2RJCA 2GFUA 3QJ6A 3ER0A 4JS4A 2E12A 4C8QG 5HY6A 2DIQA 1VQNT 2K3XA 5GANj 2DAQA 2F69A 4Q5WA 3CCLA 4N4IA 1WGSA 3FIFA 5CVIA 2QA4A 3CCSA 2EJGA 1W2BA 2PUOB 3CCMT 4JLIA 2MWOA 4L6V5 5A0LA 4O6JA 4ZN3A 1KC8U 2HBPA 3HKSA 4EMKA 1XQHA 4IUQA 1YITT 1KQSA 4C92D 4LD9K 3KXTA 1N8RU 5LJ3g 3ASKA 3QXEB 3QO3A 3OBYA 3VUBA 1VQNA 2GF7A 2DTOA 4OB2B 1NJIU 1BI3A 3WVDB 2KMTA 1M5Q1 2X4XA 3RUXA 2DXBA 5GMKe 1Q81U 4PJOG 4HCBA 3E9FA 3CCMA 2RI2A 1JBMA 1ZHIA 2K3YA 2R5MA 3HPWA 3HP9A 3X26B 4HCCA 4B9WA 5GAN4 5IAYA 1G5VA 2R58A 2RHZA 5GMKi 1H641 1YITA 2JTFA 3P8HA 3OA6A 4LDYA 4C8QB 3G6ET 5LJ3f 4OB0B 4LDUA 1K9MC 2EKOA 4IKFA 4M7DA 5L8RE 4ELZC 5KCOA 4A4HA 4DA4A 3RKYA 5GAOq 3A8MB 5GAN7 4X34A 2HNIA 4J7FA 5LJ5j 4C92C 1G3YA 4JUVA 3JCMJ 1VQ8T 2R57A 3OYFA 3L2QA 3CBMA 1KD1C 4HT8A 3KBGA 2E70A 2FYKA 3L2RA 3OYLA 3CBPA 1Y71A 4MZTA 3GLXA 3TREA 4ELYC 5HK0A 3L2UA 5FLXE 4XTWA 1UGSB 1KHIA 2RM4A 3M4GA 3G6EA 5FU7C 4M75G 1K8AU 5HK3A 3RMSA 4PJOB 2DVEA 2CS7A 3OYDA 5CKEA 5LL6S 5LJ3h 1VQ8A 3EFRA 4M77G 5IN1A 1QP3A 3ZBDA 1UGRB 2QTXA 3DKMA 4C92E 1U1TA 3M57A 3OMGA 3SWNA 5GAOm 2K57A 4J6WA 1VIFA 2JOYA 1QVFS 1PSFA 5CKBA 4C0DC 4BI8B 1VQ7T 1FX7A 2QQBA 1Q7YU 2QXFA 5J39A 4BE1A 5GAMd 1G3WA 2K5FA 3CCQT 3GIBA 3QBYA 2X4WA 5FU7B 2XDPA 4MDWA 3L1AA 4ZGDB 1M1FA 2X35A 3M4YA 4BB7A 1KG1A 2LT4A 1VQKT 2JTMA 2KQWA 2KY9A 4HA8A 3ZFJA 4OF1A 4EDUA 2DD5A 4GY5A 4C0ZA 2EIFA 3PGGA 4M7DF 5A0DA 1VQ7A 4M75B 3OBWA 4M7AG 1K73U 4IUVA 2EQKA 4A54A 1WPYA 3QYGB 2E65A 1Y07A 3CCQA 4C0DB 3LWIA 5GMKl 1PSEA 3FC3A 4OB3B 4N0AC 1VQLT 2VGNA 2HD0A 1VQKA 1VIEA 1M8VA 4IUUA 1O75A 4PL6A 3MEAA 5GMKj 5CKDA 5M9OA 2DEQA 3TEEA 2LVMA 4RMOA 3ME9A 1NJIC 4NL3A 1MGQA 2GFAA 2ZPEB 3C95A 2DD4A 2ZPFB 2JNGA 3NTKA 3HRTA 3EAEA 2XICA 4VUBA 2CZ1B 4M78C 1U1SA 4F7UF 5GAN6 4XTUA 3I55T 3DB3A 3JCMP 2ZPHB 2DTIA 1JRIA 1VQLA 1OZ2A 5FU6C 5IT9E 1FWZA 5GAOn 1QW1A 3OYBA 2LQ8A 2V8IA 2K4YA 2JVVA 4RG8A 4M7DD 2HQEA 2ZZDA 4BY6B 4RCCA 4GLKA 3OY9A 3NTHA 4M77A 3HRUA 2DPPB 4E7JA 1G3SA 4QVZA 1Q86U 4PJOD 4E7KA 4C5IA 4PNOA 2V8KA 4D6WA 3OS1A 2Y4YA 4XAXB 3JB9I 4FT2A 2LDMA 4OGEA 3MO8A 3I55A 4IUPA 2VC8A 3Q1JA 5GAN5 4M78E 1FXXA 3RMQA 2QDYB 2X4YA 4M78B 2E64A 2CKKA 1WQ7A 3QPHA 4WF2A 1N9SA 3JCMW 2RJEA 4KT0E 2RJFA 2YLBA 3V7SA 5LJ5d 4BE2A 5FU6B 2PVGB 2RHUA 4C0FA 1N6AA 2LT1A 2DJZA 3CCJT 1K8AC 3CMAT 2D6FA 2MWPA 2XG8D 3NTIA 3V7CA 1I8FA 3L2VA 4ZTJA 2QQ9A 1D3BA 1BKBA 4XTXA 1WNLA 2XU8A 4Y28E 1TH7A 3VV0A 4JLGA 2LNVA 2XIDA 3C94A 3P8DA 4QQGA 4M7AA 3FLGA 1LJOA 4EMHA 1M90C 5A2QE 2KSSA 3UDCA 4NL2A 3OW2S 1Q82C 2L3RA 5CKFA 1B34B 2JN0A 4A4GA 1Q7YC 3PNWC 1UGPB 3VYGA 5LJ3e 5I2SA 3CMAA 3CCJA 3MP8A 3S3NA 3S3OA 1JJ2A 4JRQA 3M54A 2RHIA 3BFMA 3OSVA 3QZ5B 4L59A 3JCMV 5CCAA 2EFIA 1OZ3A 1RL2A 2PU9B 3PMTA 4C5EA 4A4KA 4RCBA 4C92G 2MAMA 2DIGA 1KHCA 4M7DE 1HK9A 2LX9A 4HKEA 3X20B 3VU3C 5DLOA 2RK2A 3FEOA 2EQJA 1NPRA 2A7YA 4M77F 1VQ9T 1M1KU 1K73C 2K2VA 1X75C 3C12A 1VQOT 1QVGS 4FT4A 3LW5E 2IVWA 1YJ9T 4NOYA 2Y90A 4EPCA 3CC4T 1UEBA 3HL8A 3M59A 3H6ZA 4XQ3A 3URGA 3OYKA 4JRIA 3LLRA 1LNXA 3G71T 3S3MA 3BDUA 2FVUA 2KDSA 3EFSA 3H8ZA 2ZPIB 2HQXA 3OYGA 2DXCA 2P0PA 2QQRA 4JS5A 2L5QA 2XHCA 3CCRT 4N4GA 2JZ2A 4F7UE 1VQ9A 1BI2A 1YCYA 4O5VA 3T9NA 4F7UB 2M9UA 2X4JA 2LQKA 3CPWS 2CZ0B 2RHYA 3M9QA 3R6OA 3OYYA 5HKCA 2XDBA 1VQOA 3CC2T 2M1HA 4A4FA 5CR2A 1VQMT 4C8QA 3GNFB 1X6OA 1YJ9A 2DXTA 1QVPA 3CC4A 1BYMA 4C92B 5DY9A 3X25B 3G71A 3RKWA 2NLUA 4M77D 2MMPA 3A8LB 3OW2A 1M90U 4MZMA 3G4ST 4E47A 1Q82U 4QQDA 2PVDB 1Q86C 4MMLA 3OS0A 1WJRA 2K5IA 1R8OB 2RK1A 2CZ6B 3E9GA 2D0QB 2E41A 4R55A 3PIOA 3CC7T 4JDSA 3J7AF 4QW2A 3BY7A 3CC2A 1VQMA 2MF2A 3TU4K 1JB0E 1BIAA 3LGLA 5GANg 3SD4A 2LTOA 2DXUA 2VXFA 3FDRA 1M9SA 2F5KA 5J3BA 4HCZA 1XNIA 3A8OB 4LDVA 5GANe 2BKDN 2L89A 4FM4B 4KUIA 3F70A 2E6NA 4PJOA 3V8JA 3LGFA 3G4SA 4J8OA 3QG1A 3JCMg 3CC7A 2JUFA 3V8LA 3A5ZB 3LH0A 4QQ6A 3FJPA 2QQAA 2QEXT 3KUFA 2I2LA 3JCMe 4DOWA 3JCMb 2FB7A 3JB9G 4M78G 2DZCA 3LX7A 5GANf 4XU3A 5LJ3j 2DTHA 1O9SA 1P92A 2DZ9A 3MCAB 5EG2A 5D6XA 5C0MA 5GAMh 3QZ9B 2FHDA 5CO7A 5CQYA 1DJ7B 4E7LA 1M1GA 4BI4A 2YRVA 2DKGA 3JCMc 1OI1A 4FIBA 5FRNA 1QP2A 1G3TA 4YTLA 5CIUA 2DK3A 2O4XB 2BUDA 3JCMf 5A0GA 2QEXA 4LDXA 4C8QF 2CGHA 4RKUE 3E19A 3CCET 4OB1B 2EJ9A 3OS5A 4M75A 1NE8A 1Y96B 3FB9A 3VYHB 1XOVA 1YJNT 1QVFA 1BI0A 1KQSS 5GAOr 4EMKC 3OYHA 1M1KC 3M58A 5GANh 4BE0A 1LOJA 1YJWT 3OYIA 2A3LA 2WSFE 3MEVA 4LD6A 3OB9A 5I2MA 2F5TX 2VV5A 1YHQT 2YHTA 3CCEA 2IG0A 1W4SA 4JJNK 1VQ5T 2GQVA 2ZGWA 3JCMh 4PJOF 1IREB 3X28B 3CXCS 3CPFA 4OP0A 1H3ZA 2V8JA 2EQUA 3C4SA 3O8VA 4E7HA 3G7ZA 2LCCA 4C8QD 4Y91A 4R56A 1YJWA 4QVDA 3V7RA 3MHXA 4N0AA 4EMKB 1AHJB 3X24B 1YHQA 4M7DC 1EIFA 5KE2A 3I56T 4ZTFA 1YIJT 3HRSA 1X01A 3M53A 3E1SA 4EMGA 1OYXA 2E5QA 3DLLA 1VQ5A 2H3JA 3RIRA 5CK9A 2RI3A 3P8BB 2L8DA 5CKHA 3OMCA 3MP1A 4F7UG 4M78A 2RA2A 4II1A 4ZGJB 1Y7XA 4OMFB 4BUGA 3GPLA 1KQ1A 3DLMA 1I81A 4FL6A 4CI0C 5LJ5h 1XTDA 2OAUA 3OYCA 4XK8E 4DOVA 3FRNA 2OTJT 3OQ5A 2PUKB 3I56A 2M16A 2ZPGB 2VGMA 3VUZA 1VQ6T 4M75F 3MEWA 3TCJA 3AHUA 3HSBA 1ZBXA 3GNGA 4IURA 1YIJA 4Z02A 4M7DB 1N9RA 4C8QC 2VXEA 3JSCA 4ME7A 4UC4A 4PKCC 4RG2A 4BDZA 4J5YA 2QQSA 2XK0A 3JRZA 4XTYA 5GAOp 3CEYA 2P0KA 3SWNC 3WXMB 3J80E 3PTAA 4J83A 1VQPT 1B34A 1RI0A 1YBYA 2OTJA 2BIVA 2ZPBB 4XU2A 4E7IA 2P4TA 1VQ6A 1V29B 4A4EA 4ATOA 5FROA 1WJQA 3JB9J 3QKJA 2VUBA 2B8AA 2EYQA 5KCHA 5DLQE 3CXCA 2K5LA 5D6WA 2MI6A 3BDLA 5GAMg 3WVEB 3VKIA 4C8QE 4XU1A 3VJPA 2DO3A 3M55A 3SB2A 5LJ3d 2Y4XA 3UPUA 4PJOC 3LWHA 4X9DA 3SDZA 3OYNA 5GAMe 2LRQA 1BIBA 4M75D 2E1HA 4A53A 1VQPA 2XI9A 3CBOA 3SWNB 4C5HA 2RI5A 2ZCFB 4NS5A 4PLIA 4M7AF 5KH6A 2P0QA 5GAN2 2G3RA 2E10A 5KE3A 4BACA 3UWNA 3CCRA 2D9TA 3JB9F 1VQ4T 4M78F 5GAMf 3RESA 3OS2A 1UGQB 3JB9H 4LDWA 3JCMQ 2XDDA 2M0OA 4ZGEB 1S72T 2CYZB 3QIIA 3HHTB 4J6YA 2XD0A 4PJOE 3CCUT 4FU6A 1GXIE 4F7UA 4DQ2A 3GF5A 5GAOl 4C5GA 4FSXA 5GMKh 4ZN1A 3BW1A 2KVQG 2RJDA 4TVRA 3JAME 2XKOC 4V2SA 2VYTA 3UT1A 3M56A 1M4ZA 3JCMX 4MMKA 2OTLT 4M75C 4HT9A 1VQ4A 4JRPA 4C92A 1ZQ1A 4BDYA 1QVGA 3CD6T 2YLCA 1MHNA 2WACA 1N27A 1S72A 3GOXA 4M77C 1KQ2A 4M7AD 3PMIA 5CAIA 3CCUA 3QYHB 3INZA 3DB4A 4QVCA 4XTZA 4PLLA 2LCLA 2AHJB 4J6XA 4OVAA 5GMKm 2GCXA 4X9CA 3A8GB 3J81E 3JB9D 4M78D 1VUBA 3CCVT 2OTLA 4KULA 3CPWA 2C06A 2QI2A 4OGCA 2RD1A 3CD6A 4J7IA 1K9MU 1NPPA 2O01E 4M75E 3MEUA 3SFMA 4MDXA 5FRMA 3PIPA 3L42A 3N5BB 3A8HB 3RERA 2EWNA 1YI2T 1U8RA 1W2BS 3HFOA 4M77E 5LJ5g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTF A;  5KE2 A;  4BD3 A;  4N4H A;  3OYE A;  1OYX A;  2E5Q A;  2EQM A;  5J39 A;  4BE1 A;  2PQW A;  3OYK A;  3H6Z A;  2RI3 A;  3QBY A;  3OYM A;  2X4W A;  2L8D A;  3LLR A;  2XDP A;  3OMC A;  2R5A A;  3MP1 A;  3OYG A;  2X35 A;  3H8Z A;  4II1 A;  4CRI A;  2HQX A;  3S3M A;  3MET A;  4IUT A;  3OYJ A;  2QQR A;  3S6W A;  3DLM A;  2RO0 A;  4FL6 A;  4N4G A;  2JZ2 A;  4EDU A;  1WJS A;  2O4X A;  3OYC A;  4GY5 A;  3L2W A;  1SSF A;  3OQ5 A;  2RHY A;  3M9Q A;  2M16 A;  2M1H A;  3MEW A;  4A4F A;  3ZEH A;  4IUR A;  4Z02 A;  4IUV A;  2EQK A;  5J26 A;  4UC4 A;  4B9X A;  4RG2 A;  4BDZ A;  3MP6 A;  3FC3 A;  2QQS A;  2XK0 A;  5D6Y A;  3CEY A;  2NLU A;  3LYI A;  2P0K A;  2RHX A;  4QQD A;  5C6S A;  4IUU A;  3OS0 A;  1WJR A;  4PL6 A;  3E9G A;  3MEA A;  1RI0 A;  5M9O A;  2LVM A;  2BIV A;  3PFS A;  4QW2 A;  3ME9 A;  4E7I A;  4A4E A;  5FRO A;  1WJQ A;  3OYA A;  2GFA A;  2GFU A;  2RJC A;  3QJ6 A;  3LGL A;  3NTK A;  3QKJ A;  2B8A A;  2LTO A;  3EAE A;  2DIQ A;  3FDR A;  2K3X A;  3SD4 A;  5KCH A;  5D6W A;  2F5K A;  4HCZ A;  1XNI A;  3BDL A;  2DAQ A;  3DB3 A;  2BKD N;  2L89 A;  4Q5W A;  3F70 A;  2E6N A;  4N4I A;  1WGS A;  3LGF A;  1OZ2 A;  3OYB A;  3OYN A;  2MWO A;  2LRQ A;  2HQE A;  4C5H A;  3LH0 A;  4IUQ A;  4QQ6 A;  2RI5 A;  4NS5 A;  4PLI A;  3NTH A;  3OY9 A;  4E7J A;  4QVZ A;  3KUF A;  5KH6 A;  4E7K A;  4C5I A;  2G3R A;  3ASK A;  3LX7 A;  2GF7 A;  5KE3 A;  4BAC A;  3UWN A;  2D9T A;  2LDM A;  3MO8 A;  3OS1 A;  4IUP A;  5D6X A;  5C0M A;  4E7L A;  3Q1J A;  2FHD A;  2X4X A;  2X4Y A;  2YRV A;  2CKK A;  3OS2 A;  3E9F A;  1OI1 A;  2RI2 A;  5FRN A;  2M0O A;  2K3Y A;  2R5M A;  2RJE A;  3QII A;  2RJF A;  4BE2 A;  4B9W A;  4FU6 A;  5CIU A;  2O4X B;  2R58 A;  2BUD A;  2RHZ A;  2RHU A;  5IAY A;  1G5V A;  2JTF A;  3P8H A;  4C5G A;  3OA6 A;  2MWP A;  2RJD A;  4IKF A;  2VYT A;  3NTI A;  2EKO A;  3UT1 A;  3L2V A;  4ZTJ A;  5KCO A;  4A4H A;  4BDY A;  4X34 A;  1MHN A;  2WAC A;  3P8D A;  4QQG A;  1N27 A;  3FLG A;  3OYH A;  2R57 A;  3OYF A;  3L2Q A;  4BE0 A;  3GOX A;  3PMI A;  3L2R A;  3OYI A;  3OYL A;  2L3R A;  3DB4 A;  4A4G A;  3MEV A;  4LD6 A;  4PLL A;  3OB9 A;  4OVA A;  3PNW C;  3L2U A;  3S3N A;  3S3O A;  3MP8 A;  2IG0 A;  2RHI A;  4L59 A;  2EFI A;  1OZ3 A;  3PMT A;  4C5E A;  1H3Z A;  3OYD A;  2DIG A;  1KHC A;  3MEU A;  2EQU A;  3C4S A;  3O8V A;  4E7H A;  5IN1 A;  5FRM A;  3L42 A;  2LCC A;  3FEO A;  2EQJ A;  3OMG A; 
#chains in the Genus database with same CATH topology
 1RAI B;  1KD1 U;  2ED1 A;  2HZY A;  2E6Z A;  4BD3 A;  3OYE A;  4FYV B;  2PQW A;  1YJ9 Q;  3CC4 Q;  5I22 A;  3PT9 A;  2E5K A;  3NFC A;  1KSW A;  3JCM d;  3MET A;  4IUT A;  3OYJ A;  3S6W A;  1JJ2 S;  2RO0 A;  3REB B;  1YI2 A;  2HAX A;  2EAY A;  2O4X A;  4M7D G;  1SSF A;  2EPD A;  2KK4 A;  3M5A A;  1AWW A;  1NZ9 A;  1IZ6 A;  3CME A;  5AYF A;  3MP6 A;  2CZ7 B;  2DFU A;  2X51 A;  2V1Q A;  2QA4 T;  2K9G A;  2RHX A;  3G4S Q;  1I5L A;  3HFN A;  4F14 A;  4MZP A;  5GAN 8;  3QDR B;  2RJC A;  4JS4 A;  5GAN j;  2NUT A;  1WGS A;  3CCS A;  4CC7 A;  5A0L A;  4ZN3 A;  1XQH A;  1ZUY A;  2QTV A;  1YIT T;  1KQS A;  1R0C B;  4JJC A;  5KYU B;  3ASK A;  2DNU A;  2KMT A;  2DXB A;  5GMK e;  1Q81 U;  4HCB A;  4FYW B;  3E9F A;  3CCM A;  2R5M A;  2K3Y A;  3HP9 A;  5IAY A;  2R58 A;  1IGQ A;  2CT4 A;  4IKF A;  4LDU A;  5L8R E;  3SHW A;  5GAO q;  4X34 A;  2HNI A;  1GBR A;  2R57 A;  2ATC B;  3L2Q A;  1RLP C;  3CBM A;  5KYX A;  2A0F B;  3CBP A;  2VB6 A;  1YP5 A;  4JPB W;  4XTW A;  2CP5 A;  2FO0 A;  4M75 G;  1K8A U;  2KR3 A;  5FWC A;  5LL6 S;  5IN1 A;  1QP3 A;  1RLQ C;  1U1T A;  2BZX A;  3M57 A;  2A37 A;  2K57 A;  1QLY A;  2XMF A;  3EHQ A;  2JOY A;  1PSF A;  1FX7 A;  2QQB A;  4BE1 A;  1G83 A;  4EIK A;  1G3W A;  3CCQ T;  3GIB A;  2X4W A;  4ZGD B;  1M1F A;  2X35 A;  4KRT A;  2KQW A;  3EGX A;  4OF1 A;  4OML A;  4GY5 A;  2EIF A;  2HBW A;  2JMA A;  2DLP A;  5A0D A;  1VQ7 A;  4M7A G;  1M2O A;  3FC3 A;  4OB3 B;  2DRK A;  2DBM A;  1VQK A;  1MMA A;  1T3S A;  5GMK j;  5CKD A;  2LVM A;  4RMO A;  5IHI A;  1W2B P;  2GFA A;  2ZPF B;  2JNG A;  1AZE A;  2DL5 A;  4M78 C;  4AG2 C;  4XTU A;  3JCM P;  2RQW A;  1VQL A;  3OYB A;  2K4Y A;  4M7D D;  2CP0 A;  4M4Z A;  1CSK A;  3HRU A;  2V8K A;  2AIR B;  1MMD A;  2C0O A;  1TXQ A;  2AT1 B;  3JB9 I;  3MO8 A;  3Q1J A;  4OMN A;  5KYW A;  4HVU A;  3CC7 Q;  3QPH A;  1N9S A;  5LJ5 d;  2RJF A;  2DJZ A;  2MWP A;  2LJ3 A;  7AT1 B;  1U06 A;  2COZ A;  1WNL A;  2XU8 A;  2OTL Q;  1TH7 A;  3P8D A;  1LJO A;  4EMH A;  1Q81 R;  4PFP A;  2X3X D;  3PNW C;  5LJ3 e;  3CCJ A;  2RQV A;  3MP8 A;  2A28 A;  2NYS A;  4L59 A;  5CCA A;  2X9H A;  2EFI A;  1RL2 A;  4DBH A;  4C5E A;  1SEM A;  4RCB A;  4C92 G;  2MAM A;  2QDL A;  1GFC A;  4HKE A;  1M2V A;  3VU3 C;  4RTW A;  2RK2 A;  4M77 F;  2A7Y A;  1YI2 Q;  5KYY A;  1K73 C;  2FRW A;  1AD5 A;  2Y90 A;  1SHF A;  3RDV A;  4XQ3 A;  3H6Z A;  1ZUK A;  3CME Q;  2KDS A;  3EFS A;  3H8Z A;  1GL5 A;  2HQX A;  2KYM A;  2DXC A;  3CQT A;  4N4G A;  2LQN A;  1BI2 A;  2M9U A;  3M9Q A;  5HKC A;  2XDB A;  1TG0 A;  5AT1 B;  4A4F A;  4C8Q A;  1QVP A;  4FYY B;  3O5Z A;  1D1A A;  3X25 B;  3G71 A;  1M90 U;  4E47 A;  3I56 Q;  3OS0 A;  2OI3 A;  2K5I A;  3E9G A;  3CC7 T;  3PIO A;  3KFV A;  4X1V A;  4HVV A;  1EZZ B;  1FMK A;  1VQM A;  3CC2 A;  3TU4 K;  2LTO A;  1M9S A;  2F5K A;  4HCZ A;  2A36 A;  4KUI A;  2E6N A;  2HQH A;  1QCO A;  1M3A A;  2JUF A;  3LH0 A;  3FJP A;  2CP3 A;  4LN2 A;  2YUQ A;  2I2L A;  2DZC A;  2KT8 A;  5LJ3 j;  1SRM A;  1O9S A;  4DEX A;  2DKG A;  4FIB A;  5FRN A;  1MMG A;  1G3T A;  1K76 A;  1WHH A;  3VS3 A;  3JCM f;  5A0G A;  4LDX A;  4RKU E;  3E19 A;  1OOT A;  1ZSZ B;  2LQW A;  1N5Z A;  5GAO r;  3M58 A;  1WIE A;  1LOJ A;  3NGP A;  2EBP A;  5GJW B;  3MEV A;  4LD6 A;  4FSS A;  2OAW A;  2F5T X;  2VV5 A;  3EG1 A;  1W4S A;  1VQ5 T;  1M30 A;  3EGD A;  4OP0 A;  1VOM A;  2P84 A;  2LCC A;  4Y91 A;  4R56 A;  1YJW A;  4EMK B;  4RTV A;  3X24 B;  1YHQ A;  4ZTF A;  3I56 T;  4J9I A;  1U3O A;  2JXB A;  2J7I A;  1VQ7 Q;  1K0X A;  2H3J A;  3RIR A;  5CK9 A;  3REA B;  4F7U G;  4M78 A;  3R6N A;  1OX9 A;  1KQ1 A;  1I81 A;  5LJ5 h;  4DOV A;  3I35 A;  2OTJ T;  2PUK B;  3EFO B;  2M16 A;  2ZPG B;  2VGM A;  3VUZ A;  4PJO D;  4M75 F;  1IHW A;  2PNI A;  3BE3 A;  4M7D B;  4PJN A;  1IXD A;  1WHJ A;  3JSC A;  4RG2 A;  2P0K A;  5IHN A;  4J83 A;  1B34 A;  1RI0 A;  1RAF B;  2ZPB B;  4XU2 A;  2JM9 A;  2DF6 A;  1WJQ A;  2VUB A;  2B8A A;  4F16 A;  5D6W A;  5GAM g;  3SB2 A;  2Y4X A;  4PJO C;  1X43 A;  3SDZ A;  5GAM e;  1BIB A;  1M90 R;  2E1H A;  1E7O A;  3CBO A;  3SWN B;  1D0X A;  4NS5 A;  4M7A F;  1JXO A;  5KE3 A;  1BBZ A;  3UWN A;  3CCR A;  2QGG A;  1YWP A;  3OS2 A;  2L0A A;  3H0H A;  1WHG A;  2M0O A;  4ZGE B;  2CYZ B;  2XD0 A;  3HHT B;  4FU6 A;  3GF5 A;  4C5G A;  1ACM B;  3CCJ Q;  4V2S A;  2XKO C;  3M56 A;  2DRM A;  1TU0 B;  2FPD A;  4HT9 A;  1QVG A;  2YLC A;  1JEG A;  1S72 A;  3GOX A;  5CAI A;  3CCU A;  3M0T A;  3DB4 A;  4XTZ A;  2O2O A;  4J6X A;  2AHJ B;  1OQK A;  1WXU A;  4X9C A;  3A8G B;  2D8J A;  1WFW A;  1WI7 A;  3CPW A;  2HMA A;  1YN8 A;  1NPP A;  4M75 E;  5FRM A;  3PIP A;  4CC4 B;  1NBE B;  3N5B B;  2EGC A;  4GLM A;  3EG9 B;  2O9S A;  5GAN d;  1AVZ C;  2KYB A;  2EQM A;  1WJS A;  2FL7 A;  1BI1 A;  5LJ5 f;  4KUD K;  2RH2 A;  1HXD A;  5GAM j;  3QWX X;  3ZEH A;  3CC2 Q;  2JM8 A;  1VQM Q;  3QUI A;  1D3B B;  4C92 F;  3EG9 A;  2MYS A;  2K2M A;  4BI3 A;  2KAF A;  4M7A E;  3CCL T;  4M7A B;  3QHS A;  3CXC P;  1WQW A;  1NLO C;  1W6X A;  2WSE E;  1VA7 A;  2GFU A;  3NPF A;  3ER0 A;  4C8Q G;  2DIQ A;  1VQN T;  2KRO A;  2DAQ A;  4Q5W A;  4N4I A;  1X6G A;  8AT1 B;  2NUP A;  2EGA A;  1KC8 U;  4IUQ A;  2YDL A;  4LD9 K;  1G8X A;  1N8R U;  1RAH B;  2DEU A;  4OB2 B;  2EYW A;  4KGZ B;  1BI3 A;  2K6D A;  1Q95 G;  2X4X A;  2RF0 A;  1TUC A;  3X26 B;  2CP2 A;  2MPX C;  1G5V A;  2RHZ A;  2PTK A;  2JTF A;  3P8H A;  2J06 A;  1QMC A;  4FW2 A;  1UJY A;  3RKY A;  4JJB A;  1LVK A;  2ROL A;  2HEQ A;  2A08 A;  3JCM J;  4J9F A;  1K4U S;  4HT8 A;  2FYK A;  2DMO A;  2B86 A;  1Y71 A;  2RN8 A;  3SEM A;  1YJW Q;  3GLX A;  2DE0 X;  5HK0 A;  5FLX E;  1UGS B;  3UA7 A;  1YHQ Q;  1KHI A;  2DIL A;  2RM4 A;  3G6E A;  3VRY A;  4J9B A;  2DBK A;  2KT1 A;  4LUD A;  4AT1 B;  4FYX B;  1WYX A;  4PJO B;  2DVE A;  2RNA A;  2VVK A;  5CKE A;  4PFZ A;  1VQ8 A;  4M77 G;  2QGF B;  4C92 E;  3DKM A;  1NEG A;  5CKB A;  4BI8 B;  1PWT A;  1OUL A;  4JZ3 A;  5J39 A;  3EGU A;  4E2F B;  3QBY A;  4FCY A;  5FU7 B;  2XDP A;  1I5O B;  4MDW A;  1C0M A;  2JTM A;  2KY9 A;  4HA8 A;  1ARK A;  2V1R A;  4C0Z A;  1SHG A;  2MOX A;  2QAS A;  2DER A;  1K73 U;  4IUV A;  2RPN A;  4A54 A;  3QYG B;  5GMK l;  1PSE A;  1VQ9 Q;  4HXJ A;  2M02 A;  2VGN A;  2HD0 A;  1VIE A;  4IUU A;  4RTX A;  4PL6 A;  3TEE A;  1UDL A;  3EH2 A;  1MNE A;  2XIC A;  4F7U F;  1UTI A;  3CCR Q;  1MV3 A;  3MPU B;  2ZPH B;  5IT9 E;  2V8I A;  3VRZ A;  2HQE A;  4E7J A;  1KK7 A;  4E7K A;  3PVL A;  4PNO A;  1C6V X;  1PHT A;  3I55 A;  2F2W A;  3MJX A;  4WF2 A;  2O9V A;  1WQ7 A;  4KT0 E;  4BE2 A;  1S72 Q;  5FU6 B;  2RHU A;  4C0F A;  1KC8 R;  2XG8 D;  2DA9 A;  1I8F A;  1N8R R;  2FEI A;  3VS2 A;  4Y28 E;  3VV0 A;  4JLG A;  1IGU A;  2LNV A;  2XID A;  3C94 A;  4QQG A;  3UDC A;  3OW2 S;  1OPL A;  1Q82 C;  4WTO B;  4A4G A;  3VYG A;  3CMA A;  3S3O A;  1JJ2 A;  4JRQ A;  3OSV A;  3QZ5 B;  2FG0 A;  4AFQ C;  2PU9 B;  3GBQ A;  2DIG A;  1KHC A;  2LX9 A;  3X20 B;  2VAS A;  3CCE Q;  2AK5 A;  3FEO A;  1NPR A;  1VQ9 T;  5FW9 A;  3C12 A;  5ECA A;  4FT4 A;  3LW5 E;  5KYU A;  1YJ9 T;  2ENM A;  4EPC A;  3CC4 T;  2K3B A;  2HL3 A;  4GBQ A;  3LLR A;  1LNX A;  3S3M A;  3OYG A;  4R0K A;  1RAE B;  2DL7 A;  2QQR A;  4JS5 A;  2L5Q A;  2XHC A;  3CCR T;  4F7U E;  3T9N A;  1YCY A;  4O5V A;  4F7U B;  2CZ0 B;  1VQO A;  2DYI A;  1BB9 A;  2GTJ A;  5IXB A;  1ABO A;  4M77 D;  3A8L B;  3VS7 A;  3OW2 A;  3G4S T;  1RAB B;  1Q86 C;  4QQD A;  2PVD B;  2DET A;  1OPK A;  4R55 A;  2D0Q B;  2E41 A;  2PZ1 A;  4AFZ C;  1YNZ A;  3BY7 A;  4F17 A;  2ZAE A;  1BIA A;  1R77 A;  3SD4 A;  2QYZ A;  1W1F A;  2VXF A;  3FDR A;  1K9M R;  5L23 A;  3I5R A;  1PRM C;  5J3B A;  3A8O B;  1K73 R;  4LDV A;  2C0I A;  3LGF A;  4J8O A;  1VQ6 Q;  1KD1 R;  3JCM g;  1QWF A;  1TUG B;  4QQ6 A;  2QQA A;  2EYZ A;  3JCM e;  4DOW A;  1AOJ A;  1ZSZ C;  3LX7 A;  5GAN f;  3OS1 A;  4E7L A;  5CQY A;  2FHD A;  1DJ7 B;  4E7S A;  1VQP Q;  4BI4 A;  2YRV A;  3JCM c;  9ATC B;  1FMW A;  2NUZ A;  2QEX A;  4C8Q F;  3CCE T;  1AWJ A;  3VS1 A;  1Y96 B;  3G6E Q;  1WA7 A;  1BI0 A;  2JW4 A;  4EMK C;  1M1K C;  4BE0 A;  1NYG A;  1B7T A;  3OYI A;  2A3L A;  2IG0 A;  1VQ4 Q;  5HCK A;  2HCK A;  2ZGW A;  3JCM h;  1IRE B;  3X28 B;  1H3Z A;  3C4S A;  3G7Z A;  4IIM A;  2CH4 A;  4M7D C;  1EIF A;  2FPE A;  1CKB A;  1FYN A;  1X01 A;  3M53 A;  3E1S A;  3PE0 A;  1OYX A;  2E5Q A;  1FMV A;  3P8B B;  2L8D A;  1IHV A;  5CKH A;  3MP1 A;  2HKQ B;  1Y7X A;  4RTZ A;  3GPL A;  3DLM A;  2KXD A;  1GRI A;  1QWE A;  2OAU A;  4PJM A;  1VQ6 T;  1ZBX A;  3GNG A;  1YIJ A;  1I1J A;  1OU9 A;  4UC4 A;  4PKC C;  2BZY A;  3JRZ A;  4XTY A;  3SWN C;  3I9Q A;  1VQP T;  1YBY A;  1V29 B;  4A4E A;  4ATO A;  1K8A R;  2W10 A;  1ZBJ A;  5FWB A;  1OX8 A;  2MI6 A;  4C8Q E;  3I55 Q;  3VJP A;  2DO3 A;  3A1P A;  3OYN A;  4M75 D;  2GQI A;  4DBR A;  4C5H A;  4PLI A;  1EX4 A;  1SG5 A;  3CCS Q;  4BAC A;  3JB9 F;  1VQ4 T;  4M78 F;  1VYU A;  2E4H A;  1UGV A;  2BZ8 A;  4LDW A;  3JB9 H;  2XDD A;  1UHC A;  1YCS B;  1GXI E;  4DQ2 A;  5GAO l;  1QVF P;  4FSX A;  2KVQ G;  2RJD A;  5EC7 A;  2FRY A;  2OTL T;  3CCM Q;  4M75 C;  3TSW A;  4JRP A;  1N27 A;  1KQ2 A;  4M7A D;  1RAD B;  3QYH B;  3INZ A;  2NWM A;  4QVC A;  2LCL A;  4OVA A;  2AZV A;  1ZUU A;  1RAA B;  2MIO A;  3C0C A;  4KUL A;  4OGC A;  3CD6 A;  4J7I A;  4LXC A;  2EWN A;  1YI2 T;  1W2B S;  4M77 E;  5LJ5 g;  4M77 B;  2L3S A;  4B6M A;  2EQI A;  4L5G A;  2KNB B;  3EH1 A;  4N4H A;  5LJ5 e;  3CCV A;  2AKL A;  4M7A C;  3CME T;  3OYM A;  1T0H A;  2GBQ A;  1UB4 A;  5I21 A;  1Q81 C;  2CH4 W;  2KRN A;  3L2W A;  3RKX A;  4FW1 A;  1YJN A;  1R0B G;  2BE9 B;  4P5N A;  5J26 A;  4B9X A;  4JRK A;  1ZSZ A;  5D6Y A;  2GGR A;  3CCS T;  4KBM B;  2L3P A;  2PVO B;  2EJF A;  3IQL A;  2KRM A;  2RB6 A;  3GP8 A;  3PFS A;  4XTV A;  3OYA A;  1WLP B;  2E12 A;  4OMO A;  2ED0 A;  5HY6 A;  1VQK Q;  1PKT A;  3UF4 A;  1GCP A;  1H8K A;  5CVI A;  2QA4 A;  2RQU A;  1W2B A;  2EJG A;  3CCM T;  2MWO A;  2HBP A;  3HKS A;  4EMK A;  1E6H A;  4C92 D;  1WX6 A;  2QEX Q;  3QXE B;  3VUB A;  1VQL Q;  2LMJ A;  1K0S A;  3H0F A;  4OMQ A;  3WVD B;  3RUX A;  1OV3 A;  1JBM A;  1ZHI A;  2OX7 A;  3UA6 A;  4HCC A;  4B9W A;  5GAN 4;  1YIT A;  1CKA A;  3OA6 A;  3EFO A;  4LDY A;  5KYN A;  1ZA2 B;  5LJ3 f;  4OB0 B;  2EKO A;  1VYT A;  4M7D A;  5KCO A;  4D8K A;  3A8M B;  5GAN 7;  5LJ5 j;  4C92 C;  4JUV A;  1VYV A;  3L2R A;  2LJ0 A;  3M4G A;  1UEC A;  5FU7 C;  1G2B A;  3RMS A;  3EFR A;  3ZBD A;  1UGR B;  2QTX A;  2DL8 A;  3OMG A;  3SWN A;  4J6W A;  1VIF A;  3M0P A;  1RAG B;  2CP7 A;  3RNJ A;  1ZX6 A;  1QVF S;  4A63 B;  2ESW A;  1VQ7 T;  1YIJ Q;  1T0J A;  3L1A A;  3M4Y A;  4HCK A;  3H9N A;  1VQK T;  2LP5 A;  2W0Z A;  4ESR A;  2DD5 A;  3PGG A;  4M75 B;  2FZC B;  1T3L A;  2E65 A;  3ZL7 C;  3CCQ A;  4C0D B;  1VQL T;  1IO6 A;  1M8V A;  4DEY A;  2DEQ A;  2YUO A;  3ME9 A;  1NJI C;  4NL3 A;  2ZPE B;  1QKW A;  3G71 Q;  3NTK A;  2EYX A;  3HRT A;  3EAE A;  2COW A;  5GAN 6;  2YWW A;  1KQS P;  2I0N A;  3TVT A;  1OZ2 A;  5FU6 C;  4RG8 A;  4RCC A;  4GLK A;  3OY9 A;  3NTH A;  1Q86 U;  4PFO A;  1SSH A;  2M51 A;  4C5I A;  1NEB A;  4FT2 A;  2LDM A;  4OGE A;  2VC8 A;  5GAN 5;  3RMQ A;  4KGV B;  3JCM W;  4J9E A;  3V7S A;  2PVG B;  2LT1 A;  3CCJ T;  2JJ9 A;  1PRL C;  4LUE A;  3L2V A;  4ZTJ A;  2EVR A;  1D3B A;  2QQ9 A;  1BKB A;  1B3Q A;  4QT7 A;  4XTX A;  4M7A A;  2YUN A;  2BE7 D;  1M90 C;  1WXB A;  2VKN A;  2SEM A;  2JN0 A;  2KRS A;  1Y0M A;  2COY A;  1Q7Y C;  1UGP B;  5I2S A;  1PM3 A;  1PD0 A;  3BFM A;  3CCV Q;  2HKN A;  1OZ3 A;  2LNH B;  1HK9 A;  1V76 A;  4J9H A;  5DLO A;  2JS0 A;  1M1K U;  2K2V A;  1X75 C;  1M8M A;  1YJN Q;  2IVW A;  2K7A A;  2CUB A;  1UEB A;  3HTR A;  3URG A;  3OYK A;  3NHN A;  4JRI A;  5IHK A;  3G71 T;  1AT1 B;  2FVU A;  3BDU A;  1LPL A;  2ZPI B;  1OEB A;  4LE9 A;  2P0P A;  2JZ2 A;  1YWO A;  1ABQ A;  1D1C A;  2X4J A;  1TWB A;  3CC2 T;  2M1H A;  1VQM T;  2VWF A;  2E3I A;  1X6O A;  2DXT A;  1BYM A;  4C92 B;  5DY9 A;  2DL3 A;  2NLU A;  3RKW A;  2MMP A;  1U5S A;  3QSU A;  2L3Q A;  2GNC A;  4MML A;  1WJR A;  2RK1 A;  4JDS A;  1W70 A;  3J7A F;  5GAN g;  3LGL A;  2DXU A;  5D7U A;  2ABL A;  1XNI A;  1GCQ C;  5GAN e;  4PJO A;  2L89 A;  2ECZ A;  2LZ6 B;  3F70 A;  4FM4 B;  2FZG B;  3V8J A;  2KGT A;  1X2K A;  1BCO A;  2EW3 A;  3CC7 A;  1MV0 B;  3A5Z B;  1YIT Q;  2JS2 A;  3JCM b;  3JB9 G;  4M78 G;  3EG0 A;  1P92 A;  5D6X A;  3QZ9 B;  5CO7 A;  2J6O A;  2X3W D;  1M1G A;  1OI1 A;  4E6R A;  1QP2 A;  5CIU A;  2O4X B;  1EFN A;  3VS6 A;  2CGH A;  1TUD A;  4OB1 B;  2CUD A;  1Q86 R;  3NMZ C;  1NE8 A;  3FB9 A;  2YRD A;  2KE9 A;  1XOV A;  1YJN T;  1KQS S;  1KFZ A;  5GAN h;  1AEY A;  1YJW T;  2DJQ A;  1SPK A;  2WSF E;  3OB9 A;  1YHQ T;  2YHT A;  1H92 A;  4JJN K;  1SF9 A;  2C0T A;  2NUT B;  3CXC S;  1TS9 A;  3CCU Q;  2V8J A;  1A0N B;  3O8V A;  4E7H A;  1TSF A;  4C8Q D;  3MHX A;  1RUW A;  2M0Y A;  1YFN A;  4RTT A;  4EMG A;  3DLL A;  1VQ5 A;  4PJJ A;  2GTO A;  2O31 A;  2RI3 A;  3CCQ Q;  2D1X A;  3OMC A;  1Y57 A;  4II1 A;  4ZGJ B;  4OMF B;  4BUG A;  3M0S A;  4FL6 A;  2G6F X;  3OYC A;  3FRN A;  3I56 A;  3AHU A;  1M1K R;  4LNP A;  4IUR A;  1AZG B;  1UJ0 A;  1N9R A;  4C8Q C;  1S1N A;  1M3B A;  1WHM A;  4J5Y A;  2QQS A;  2XK0 A;  3G1J A;  3CEY A;  1NM7 A;  5KYX B;  3PTA A;  2LJ1 A;  2OTJ A;  2BIV A;  4E7I A;  4ZNX A;  5FRO A;  4WCI A;  3I5S A;  1PCX A;  5KCH A;  3CXC A;  2CRE A;  2K5L A;  4IIO A;  1WZO A;  2Z0W A;  3WVE B;  4XU1 A;  3M55 A;  5LJ3 d;  3UPU A;  3LWH A;  3QWY A;  2LRQ A;  2J6K A;  2KEA A;  2KI7 A;  4A53 A;  2RI5 A;  5KH6 A;  1V1C A;  5GAN 2;  2G3R A;  2E10 A;  3RES A;  1S72 T;  3RR6 A;  2EKH A;  3EGX B;  4J6Y A;  1MMN A;  3CCU T;  4F7U A;  4JJD A;  5GMK h;  3JAM E;  4TVR A;  2YRC A;  2VYT A;  3UT1 A;  1M4Z A;  1ZQ1 A;  2DL4 A;  4M77 C;  3PMI A;  2HSE B;  4PLL A;  2GCX A;  3MKD A;  3JB9 D;  4M78 D;  2E3H A;  3VS0 A;  1K9A A;  2C06 A;  2RD1 A;  5IH2 A;  2O01 E;  3MEU A;  4MDX A;  3ULR B;  1HD3 A;  2DYB A;  2IIM A;  3HFO A;  1KC8 C;  4BY6 C;  1Z9Q A;  4C0G A;  2MCN A;  1N8R C;  1VQ8 Q;  4XU0 A;  2CSQ A;  1K1Z A;  3FJ5 A;  2WSC E;  5GAN 3;  1E6G A;  5KYW B;  4J9G A;  4RUG A;  2R5A A;  3L2Z A;  4CRI A;  1GCQ A;  2YSQ A;  2LC4 A;  3V8K A;  1TTH B;  2J6F A;  5DM7 R;  1M27 C;  5CQX A;  1Y96 A;  2BTT A;  3AT1 B;  2DX1 A;  3LYI A;  1H3H A;  5C6S A;  1D0Y A;  3OSS C;  1I4K 1;  4CC2 A;  4Z89 A;  1LCK A;  3QJY A;  1AWX A;  3QJ6 A;  1Z9Z A;  2K3X A;  2F69 A;  3CCL A;  3FIF A;  1M2V B;  2PUO B;  4JLI A;  4L6V 5;  4O6J A;  5KYY B;  2AKK A;  3KXT A;  5LJ3 g;  2LCS A;  3H0I A;  3QO3 A;  3OBY A;  1VQN A;  2FPF A;  2DTO A;  2GF7 A;  1NJI U;  1M5Q 1;  4PJO G;  1NG2 A;  2RI2 A;  4K11 A;  3HPW A;  4AFS C;  5GMK i;  1H64 1;  1QVG P;  2AZS A;  4C8Q B;  1RAC B;  3G6E T;  1K9M C;  1JQQ A;  4ELZ C;  3TQ7 P;  2V26 A;  4A4H A;  4DA4 A;  2HSP A;  4J7F A;  1G3Y A;  1VQ8 T;  3OYF A;  1KD1 C;  3KBG A;  2E70 A;  3OYL A;  4MZT A;  3CPW P;  1AWO A;  1PD1 A;  2CSI A;  3TRE A;  4ELY C;  3L2U A;  2SRC A;  5HK3 A;  1ZA1 B;  1VQ5 Q;  3EG3 A;  2CS7 A;  1XJW B;  3OYD A;  5LJ3 h;  1PNJ A;  3CMA Q;  1D09 B;  5GAO m;  4DBF A;  4C0D C;  1RI9 A;  1Q7Y U;  2QXF A;  2JMC A;  5GAM d;  1WHK A;  2K5F A;  1X27 A;  1KG1 A;  3E2U A;  4BB7 A;  2F1L A;  2LT4 A;  1PKS A;  3ZFJ A;  2FZK B;  4EDU A;  4Y92 A;  4JZ4 A;  2OTJ Q;  1BU1 A;  2K79 A;  4M7D F;  1QCN A;  2CDT A;  3OBW A;  2EQK A;  1WPY A;  1Y07 A;  2YXY A;  3LWI A;  3EG2 A;  4N0A C;  2YUP A;  3M0U A;  1PG5 B;  1O75 A;  1VQO Q;  3MEA A;  1UFF A;  5M9O A;  2KXC A;  4CC3 A;  1MGQ A;  3C95 A;  2DD4 A;  1HJD A;  1PC0 A;  4VUB A;  2CZ1 B;  3UAT A;  1U1S A;  3I55 T;  3EGD B;  3DB3 A;  2DTI A;  4KGX B;  1JRI A;  1WXT A;  4PJL A;  1FWZ A;  5GAO n;  1QW1 A;  3RBB B;  2LQ8 A;  2JVV A;  1SRL A;  2ZZD A;  4BY6 B;  4M77 A;  2DPP B;  1G3S A;  4QVZ A;  1UHF A;  4D6W A;  1IB8 A;  2Y4Y A;  2EGE A;  4XAX B;  4IUP A;  4M78 E;  1FXX A;  2QDY B;  2X4Y A;  4M78 B;  2E64 A;  2CKK A;  2P4R A;  2RJE A;  2YLB A;  1HSQ A;  4E7Z A;  1N6A A;  1K8A C;  3CMA T;  2D6F A;  3NTI A;  3V7C A;  4PK4 A;  3VS5 A;  5I11 A;  1NJI R;  3FLG A;  1F1B B;  1MND A;  3EHR A;  4RTY A;  5A2Q E;  2KSS A;  4NL2 A;  4ORZ A;  2L3R A;  5CKF A;  1B34 B;  1C1A A;  3S3N A;  1WDX A;  2CT3 A;  2L2P A;  3M54 A;  2RHI A;  3JCM V;  1UE9 A;  1X6B A;  3PMT A;  4A4K A;  4D8D A;  4AFU C;  2QAZ A;  4M7D E;  2EQJ A;  2CP6 A;  1KJW A;  1VQO T;  3U23 A;  1QVG S;  4Z88 A;  4NOY A;  3M59 A;  3HL8 A;  1D1B A;  3PVQ A;  1UUE A;  1VQ9 A;  1J3T A;  2LQK A;  3CPW S;  3R6O A;  2RHY A;  3OYY A;  5CR2 A;  4RTU A;  2IPO B;  3GNF B;  1YJ9 A;  2KBT A;  3CC4 A;  1QQJ A;  2H3E B;  1JXM A;  1Q7Y R;  2F2V A;  4OMP A;  4MZM A;  3CCL Q;  1Q82 U;  4QKU A;  1R8O B;  2CZ6 B;  4QW2 A;  3A98 A;  2MF2 A;  1JB0 E;  1WHL A;  1VQN Q;  2BKD N;  2YT6 A;  1KIK A;  1GBQ A;  8ATC B;  3G4S A;  1QKX A;  5GJV B;  3QG1 A;  2RQT A;  1JO8 A;  1QCF A;  2DVJ A;  3V8L A;  2QEX T;  3KUF A;  3VS4 A;  1X69 A;  2FB7 A;  1IRX A;  4XU3 A;  2DTH A;  2DZ9 A;  3MCA B;  5GAM h;  5EG2 A;  5C0M A;  1X2Q A;  2EYY A;  4YTL A;  2HL5 C;  2DK3 A;  2BUD A;  1SKU B;  5IXF A;  2ROT A;  1ZSG A;  2EJ9 A;  3OS5 A;  1B07 A;  4M75 A;  2QK0 A;  3VYH B;  1QVF A;  1MUZ A;  3OYH A;  1JJ2 P;  4ANJ A;  5I2M A;  2RMO A;  3CCE A;  2MK5 A;  1HYO A;  4KH0 B;  2GQV A;  1I07 A;  4PJO F;  3CPF A;  1OU8 A;  2EQU A;  2NUP B;  2J05 A;  3V7R A;  4QVD A;  4F04 B;  4N0A A;  1AHJ B;  1BK2 A;  5KE2 A;  3TSZ A;  3CD6 Q;  1YIJ T;  3HRS A;  3THK A;  2OJ2 A;  4HVW A;  2RA2 A;  4DBQ A;  2JTE A;  4CI0 C;  1XTD A;  4XK8 E;  3OQ5 A;  3OW2 P;  3TCJ A;  3MEW A;  3HSB A;  1I0C A;  3H41 A;  2JT4 A;  4Z02 A;  2VXE A;  4ME7 A;  4AG1 C;  4BDZ A;  5GAO p;  2F2X A;  3WXM B;  2O88 A;  3J80 E;  1GFD A;  2P4T A;  1VQ6 A;  1ZLM A;  3JB9 J;  3QKJ A;  3QDF A;  2EYQ A;  5DLQ E;  3JV3 A;  3BDL A;  3VKI A;  1TOV A;  4X9D A;  1JU5 C;  2D8H A;  1Q82 R;  1VQP A;  2XI9 A;  2ZCF B;  4Z8A A;  2P0Q A;  4OMM A;  2QA4 Q;  1M3C A;  2D9T A;  1NLP C;  5GAM f;  1UGQ B;  3JCM Q;  4J9C A;  4AMC A;  3M0R A;  3QII A;  4PJO E;  1BCM A;  4KH1 B;  2HDA A;  1D0Z A;  4J9D A;  1NYF A;  3LH5 A;  4ZN1 A;  3BW1 A;  2RQR A;  3JCM X;  4MMK A;  1VQ4 A;  2H8H A;  4C92 A;  4BDY A;  3CD6 T;  1MHN A;  2WAC A;  6AT1 B;  1UG1 A;  5GMK m;  2D0N A;  3J81 E;  2LX7 A;  1VUB A;  3CCV T;  2OTL A;  3D7S B;  2QI2 A;  1K9M U;  2DM1 A;  3SFM A;  3M0Q A;  2QG9 B;  3L42 A;  3A8H B;  3RER A;  1U8R A; 
#chains in the Genus database with same CATH homology
 1KD1 U;  4M77 B;  1KC8 C;  2E6Z A;  5GAN d;  4BY6 C;  4C0G A;  4BD3 A;  4L5G A;  1N8R C;  4N4H A;  3OYE A;  5LJ5 e;  3CCV A;  2EQM A;  4M7A C;  4XU0 A;  2PQW A;  3CME T;  2WSC E;  5GAN 3;  3OYM A;  1UB4 A;  3PT9 A;  2R5A A;  5I21 A;  3L2Z A;  3NFC A;  4CRI A;  1Q81 C;  3JCM d;  3MET A;  4IUT A;  3OYJ A;  3S6W A;  1JJ2 S;  2RO0 A;  1YI2 A;  2HAX A;  2EAY A;  2LC4 A;  3L2W A;  1WJS A;  2O4X A;  2FL7 A;  3RKX A;  4M7D G;  1SSF A;  1BI1 A;  3V8K A;  2KK4 A;  3QSU A;  5LJ5 f;  4KUD K;  3M5A A;  2RH2 A;  1YJN A;  1HXD A;  5GAM j;  5DM7 R;  3ZEH A;  5CQX A;  3QUI A;  1Y96 A;  1D3B B;  1NZ9 A;  4P5N A;  4C92 F;  1IZ6 A;  5J26 A;  4B9X A;  4JRK A;  5AYF A;  4BI3 A;  3CME A;  3MP6 A;  2KAF A;  2CZ7 B;  4M7A E;  5D6Y A;  3LYI A;  4M7A B;  3CCL T;  2QA4 T;  3CCS T;  2RHX A;  4KBM B;  2PVO B;  5C6S A;  3QHS A;  2EJF A;  3OSS C;  1I4K 1;  1WQW A;  1I5L A;  2RB6 A;  3HFN A;  3GP8 A;  3PFS A;  3QJY A;  4MZP A;  4XTV A;  2WSE E;  5GAN 8;  3QDR B;  3OYA A;  2RJC A;  2GFU A;  3QJ6 A;  3ER0 A;  4JS4 A;  2E12 A;  4C8Q G;  5HY6 A;  2DIQ A;  1VQN T;  2K3X A;  5GAN j;  2DAQ A;  2F69 A;  4Q5W A;  3CCL A;  4N4I A;  1WGS A;  3FIF A;  5CVI A;  2QA4 A;  3CCS A;  2EJG A;  1W2B A;  2PUO B;  3CCM T;  4JLI A;  2MWO A;  4L6V 5;  5A0L A;  4O6J A;  4ZN3 A;  1KC8 U;  2HBP A;  3HKS A;  4EMK A;  1XQH A;  4IUQ A;  1YIT T;  1KQS A;  4C92 D;  4LD9 K;  3KXT A;  1N8R U;  5LJ3 g;  3ASK A;  3QXE B;  3QO3 A;  3OBY A;  3VUB A;  1VQN A;  2GF7 A;  2DTO A;  4OB2 B;  1NJI U;  1BI3 A;  3WVD B;  2KMT A;  1M5Q 1;  2X4X A;  3RUX A;  2DXB A;  5GMK e;  1Q81 U;  4PJO G;  4HCB A;  3E9F A;  3CCM A;  2RI2 A;  1JBM A;  1ZHI A;  2K3Y A;  2R5M A;  3HPW A;  3HP9 A;  3X26 B;  4HCC A;  4B9W A;  5GAN 4;  5IAY A;  1G5V A;  2R58 A;  2RHZ A;  5GMK i;  1H64 1;  1YIT A;  2JTF A;  3P8H A;  3OA6 A;  4LDY A;  4C8Q B;  3G6E T;  5LJ3 f;  4OB0 B;  4LDU A;  1K9M C;  2EKO A;  4IKF A;  4M7D A;  5L8R E;  4ELZ C;  5KCO A;  4A4H A;  4DA4 A;  3RKY A;  5GAO q;  3A8M B;  5GAN 7;  4X34 A;  2HNI A;  4J7F A;  5LJ5 j;  4C92 C;  1G3Y A;  4JUV A;  3JCM J;  1VQ8 T;  2R57 A;  3OYF A;  3L2Q A;  3CBM A;  1KD1 C;  4HT8 A;  3KBG A;  2E70 A;  2FYK A;  3L2R A;  3OYL A;  3CBP A;  1Y71 A;  4MZT A;  3GLX A;  3TRE A;  4ELY C;  5HK0 A;  3L2U A;  5FLX E;  4XTW A;  1UGS B;  1KHI A;  2RM4 A;  3M4G A;  3G6E A;  5FU7 C;  4M75 G;  1K8A U;  5HK3 A;  3RMS A;  4PJO B;  2DVE A;  2CS7 A;  3OYD A;  5CKE A;  5LL6 S;  5LJ3 h;  1VQ8 A;  3EFR A;  4M77 G;  5IN1 A;  1QP3 A;  3ZBD A;  1UGR B;  2QTX A;  3DKM A;  4C92 E;  1U1T A;  3M57 A;  3OMG A;  3SWN A;  5GAO m;  2K57 A;  4J6W A;  1VIF A;  2JOY A;  1QVF S;  1PSF A;  5CKB A;  4C0D C;  4BI8 B;  1VQ7 T;  1FX7 A;  2QQB A;  1Q7Y U;  2QXF A;  5J39 A;  4BE1 A;  5GAM d;  1G3W A;  2K5F A;  3CCQ T;  3GIB A;  3QBY A;  2X4W A;  5FU7 B;  2XDP A;  4MDW A;  3L1A A;  4ZGD B;  1M1F A;  2X35 A;  3M4Y A;  4BB7 A;  1KG1 A;  2LT4 A;  1VQK T;  2JTM A;  2KQW A;  2KY9 A;  4HA8 A;  3ZFJ A;  4OF1 A;  4EDU A;  2DD5 A;  4GY5 A;  4C0Z A;  2EIF A;  3PGG A;  4M7D F;  5A0D A;  1VQ7 A;  4M75 B;  3OBW A;  4M7A G;  1K73 U;  4IUV A;  2EQK A;  4A54 A;  1WPY A;  3QYG B;  2E65 A;  1Y07 A;  3CCQ A;  4C0D B;  3LWI A;  5GMK l;  1PSE A;  3FC3 A;  4OB3 B;  4N0A C;  1VQL T;  2VGN A;  2HD0 A;  1VQK A;  1VIE A;  1M8V A;  4IUU A;  1O75 A;  4PL6 A;  3MEA A;  5GMK j;  5CKD A;  5M9O A;  2DEQ A;  3TEE A;  2LVM A;  4RMO A;  3ME9 A;  1NJI C;  4NL3 A;  1MGQ A;  2GFA A;  2ZPE B;  3C95 A;  2DD4 A;  2ZPF B;  2JNG A;  3NTK A;  3HRT A;  3EAE A;  2XIC A;  4VUB A;  2CZ1 B;  4M78 C;  1U1S A;  4F7U F;  5GAN 6;  4XTU A;  3I55 T;  3DB3 A;  3JCM P;  2ZPH B;  2DTI A;  1JRI A;  1VQL A;  1OZ2 A;  5FU6 C;  5IT9 E;  1FWZ A;  5GAO n;  1QW1 A;  3OYB A;  2LQ8 A;  2V8I A;  2K4Y A;  2JVV A;  4RG8 A;  4M7D D;  2HQE A;  2ZZD A;  4BY6 B;  4RCC A;  4GLK A;  3OY9 A;  3NTH A;  4M77 A;  3HRU A;  2DPP B;  4E7J A;  1G3S A;  4QVZ A;  1Q86 U;  4PJO D;  4E7K A;  4C5I A;  4PNO A;  2V8K A;  4D6W A;  3OS1 A;  2Y4Y A;  4XAX B;  3JB9 I;  4FT2 A;  2LDM A;  4OGE A;  3MO8 A;  3I55 A;  4IUP A;  2VC8 A;  3Q1J A;  5GAN 5;  4M78 E;  1FXX A;  3RMQ A;  2QDY B;  2X4Y A;  4M78 B;  2E64 A;  2CKK A;  1WQ7 A;  3QPH A;  4WF2 A;  1N9S A;  3JCM W;  2RJE A;  4KT0 E;  2RJF A;  2YLB A;  3V7S A;  5LJ5 d;  4BE2 A;  5FU6 B;  2PVG B;  2RHU A;  4C0F A;  1N6A A;  2LT1 A;  2DJZ A;  3CCJ T;  1K8A C;  3CMA T;  2D6F A;  2MWP A;  2XG8 D;  3NTI A;  3V7C A;  1I8F A;  3L2V A;  4ZTJ A;  2QQ9 A;  1D3B A;  1BKB A;  4XTX A;  1WNL A;  2XU8 A;  4Y28 E;  1TH7 A;  3VV0 A;  4JLG A;  2LNV A;  2XID A;  3C94 A;  3P8D A;  4QQG A;  4M7A A;  3FLG A;  1LJO A;  4EMH A;  1M90 C;  5A2Q E;  2KSS A;  3UDC A;  4NL2 A;  3OW2 S;  1Q82 C;  2L3R A;  5CKF A;  1B34 B;  2JN0 A;  4A4G A;  1Q7Y C;  3PNW C;  1UGP B;  3VYG A;  5LJ3 e;  5I2S A;  3CMA A;  3CCJ A;  3MP8 A;  3S3N A;  3S3O A;  1JJ2 A;  4JRQ A;  3M54 A;  2RHI A;  3BFM A;  3OSV A;  3QZ5 B;  4L59 A;  3JCM V;  5CCA A;  2EFI A;  1OZ3 A;  1RL2 A;  2PU9 B;  3PMT A;  4C5E A;  4A4K A;  4RCB A;  4C92 G;  2MAM A;  2DIG A;  1KHC A;  4M7D E;  1HK9 A;  2LX9 A;  4HKE A;  3X20 B;  3VU3 C;  5DLO A;  2RK2 A;  3FEO A;  2EQJ A;  1NPR A;  2A7Y A;  4M77 F;  1VQ9 T;  1M1K U;  1K73 C;  2K2V A;  1X75 C;  3C12 A;  1VQO T;  1QVG S;  4FT4 A;  3LW5 E;  2IVW A;  1YJ9 T;  4NOY A;  2Y90 A;  4EPC A;  3CC4 T;  1UEB A;  3HL8 A;  3M59 A;  3H6Z A;  4XQ3 A;  3URG A;  3OYK A;  4JRI A;  3LLR A;  1LNX A;  3G71 T;  3S3M A;  3BDU A;  2FVU A;  2KDS A;  3EFS A;  3H8Z A;  2ZPI B;  2HQX A;  3OYG A;  2DXC A;  2P0P A;  2QQR A;  4JS5 A;  2L5Q A;  2XHC A;  3CCR T;  4N4G A;  2JZ2 A;  4F7U E;  1VQ9 A;  1BI2 A;  1YCY A;  4O5V A;  3T9N A;  4F7U B;  2M9U A;  2X4J A;  2LQK A;  3CPW S;  2CZ0 B;  2RHY A;  3M9Q A;  3R6O A;  3OYY A;  5HKC A;  2XDB A;  1VQO A;  3CC2 T;  2M1H A;  4A4F A;  5CR2 A;  1VQM T;  4C8Q A;  3GNF B;  1X6O A;  1YJ9 A;  2DXT A;  1QVP A;  3CC4 A;  1BYM A;  4C92 B;  5DY9 A;  3X25 B;  3G71 A;  3RKW A;  2NLU A;  4M77 D;  2MMP A;  3A8L B;  3OW2 A;  1M90 U;  4MZM A;  3G4S T;  4E47 A;  1Q82 U;  4QQD A;  2PVD B;  1Q86 C;  4MML A;  3OS0 A;  1WJR A;  2K5I A;  1R8O B;  2RK1 A;  2CZ6 B;  3E9G A;  2D0Q B;  2E41 A;  4R55 A;  3PIO A;  3CC7 T;  4JDS A;  3J7A F;  4QW2 A;  3BY7 A;  3CC2 A;  1VQM A;  2MF2 A;  3TU4 K;  1JB0 E;  1BIA A;  3LGL A;  5GAN g;  3SD4 A;  2LTO A;  2DXU A;  2VXF A;  3FDR A;  1M9S A;  2F5K A;  5J3B A;  4HCZ A;  1XNI A;  3A8O B;  4LDV A;  5GAN e;  2BKD N;  2L89 A;  4FM4 B;  4KUI A;  3F70 A;  2E6N A;  4PJO A;  3V8J A;  3LGF A;  3G4S A;  4J8O A;  3QG1 A;  3JCM g;  3CC7 A;  2JUF A;  3V8L A;  3A5Z B;  3LH0 A;  4QQ6 A;  3FJP A;  2QQA A;  2QEX T;  3KUF A;  2I2L A;  3JCM e;  4DOW A;  3JCM b;  2FB7 A;  3JB9 G;  4M78 G;  2DZC A;  3LX7 A;  5GAN f;  4XU3 A;  5LJ3 j;  2DTH A;  1O9S A;  1P92 A;  2DZ9 A;  3MCA B;  5EG2 A;  5D6X A;  5C0M A;  5GAM h;  3QZ9 B;  2FHD A;  5CO7 A;  5CQY A;  1DJ7 B;  4E7L A;  1M1G A;  4BI4 A;  2YRV A;  2DKG A;  3JCM c;  1OI1 A;  4FIB A;  5FRN A;  1QP2 A;  1G3T A;  4YTL A;  5CIU A;  2DK3 A;  2O4X B;  2BUD A;  3JCM f;  5A0G A;  2QEX A;  4LDX A;  4C8Q F;  2CGH A;  4RKU E;  3E19 A;  3CCE T;  4OB1 B;  2EJ9 A;  3OS5 A;  4M75 A;  1NE8 A;  1Y96 B;  3FB9 A;  3VYH B;  1XOV A;  1YJN T;  1QVF A;  1BI0 A;  1KQS S;  5GAO r;  4EMK C;  3OYH A;  1M1K C;  3M58 A;  5GAN h;  4BE0 A;  1LOJ A;  1YJW T;  3OYI A;  2A3L A;  2WSF E;  3MEV A;  4LD6 A;  3OB9 A;  5I2M A;  2F5T X;  2VV5 A;  1YHQ T;  2YHT A;  3CCE A;  2IG0 A;  1W4S A;  4JJN K;  1VQ5 T;  2GQV A;  2ZGW A;  3JCM h;  4PJO F;  1IRE B;  3X28 B;  3CXC S;  3CPF A;  4OP0 A;  1H3Z A;  2V8J A;  2EQU A;  3C4S A;  3O8V A;  4E7H A;  3G7Z A;  2LCC A;  4C8Q D;  4Y91 A;  4R56 A;  1YJW A;  4QVD A;  3V7R A;  3MHX A;  4N0A A;  4EMK B;  1AHJ B;  3X24 B;  1YHQ A;  4M7D C;  1EIF A;  5KE2 A;  3I56 T;  4ZTF A;  1YIJ T;  3HRS A;  1X01 A;  3M53 A;  3E1S A;  4EMG A;  1OYX A;  2E5Q A;  3DLL A;  1VQ5 A;  2H3J A;  3RIR A;  5CK9 A;  2RI3 A;  3P8B B;  2L8D A;  5CKH A;  3OMC A;  3MP1 A;  4F7U G;  4M78 A;  2RA2 A;  4II1 A;  4ZGJ B;  1Y7X A;  4OMF B;  4BUG A;  3GPL A;  1KQ1 A;  3DLM A;  1I81 A;  4FL6 A;  4CI0 C;  5LJ5 h;  1XTD A;  2OAU A;  3OYC A;  4XK8 E;  4DOV A;  3FRN A;  2OTJ T;  3OQ5 A;  2PUK B;  3I56 A;  2M16 A;  2ZPG B;  2VGM A;  3VUZ A;  1VQ6 T;  4M75 F;  3MEW A;  3TCJ A;  3AHU A;  3HSB A;  1ZBX A;  3GNG A;  4IUR A;  1YIJ A;  4Z02 A;  4M7D B;  1N9R A;  4C8Q C;  2VXE A;  3JSC A;  4ME7 A;  4UC4 A;  4PKC C;  4RG2 A;  4BDZ A;  4J5Y A;  2QQS A;  2XK0 A;  3JRZ A;  4XTY A;  5GAO p;  3CEY A;  2P0K A;  3SWN C;  3WXM B;  3J80 E;  3PTA A;  4J83 A;  1VQP T;  1B34 A;  1RI0 A;  1YBY A;  2OTJ A;  2BIV A;  2ZPB B;  4XU2 A;  4E7I A;  2P4T A;  1VQ6 A;  1V29 B;  4A4E A;  4ATO A;  5FRO A;  1WJQ A;  3JB9 J;  3QKJ A;  2VUB A;  2B8A A;  2EYQ A;  5KCH A;  5DLQ E;  3CXC A;  2K5L A;  5D6W A;  2MI6 A;  3BDL A;  5GAM g;  3WVE B;  3VKI A;  4C8Q E;  4XU1 A;  3VJP A;  2DO3 A;  3M55 A;  3SB2 A;  5LJ3 d;  2Y4X A;  3UPU A;  4PJO C;  3LWH A;  4X9D A;  3SDZ A;  3OYN A;  5GAM e;  2LRQ A;  1BIB A;  4M75 D;  2E1H A;  4A53 A;  1VQP A;  2XI9 A;  3CBO A;  3SWN B;  4C5H A;  2RI5 A;  2ZCF B;  4NS5 A;  4PLI A;  4M7A F;  5KH6 A;  2P0Q A;  5GAN 2;  2G3R A;  2E10 A;  5KE3 A;  4BAC A;  3UWN A;  3CCR A;  2D9T A;  3JB9 F;  1VQ4 T;  4M78 F;  5GAM f;  3RES A;  3OS2 A;  1UGQ B;  3JB9 H;  4LDW A;  3JCM Q;  2XDD A;  2M0O A;  4ZGE B;  1S72 T;  2CYZ B;  3QII A;  3HHT B;  4J6Y A;  2XD0 A;  4PJO E;  3CCU T;  4FU6 A;  1GXI E;  4F7U A;  4DQ2 A;  3GF5 A;  5GAO l;  4C5G A;  4FSX A;  5GMK h;  4ZN1 A;  3BW1 A;  2KVQ G;  2RJD A;  4TVR A;  3JAM E;  2XKO C;  4V2S A;  2VYT A;  3UT1 A;  3M56 A;  1M4Z A;  3JCM X;  4MMK A;  2OTL T;  4M75 C;  4HT9 A;  1VQ4 A;  4JRP A;  4C92 A;  1ZQ1 A;  4BDY A;  1QVG A;  3CD6 T;  2YLC A;  1MHN A;  2WAC A;  1N27 A;  1S72 A;  3GOX A;  4M77 C;  1KQ2 A;  4M7A D;  3PMI A;  5CAI A;  3CCU A;  3QYH B;  3INZ A;  3DB4 A;  4QVC A;  4XTZ A;  4PLL A;  2LCL A;  2AHJ B;  4J6X A;  4OVA A;  5GMK m;  2GCX A;  4X9C A;  3A8G B;  3J81 E;  3JB9 D;  4M78 D;  1VUB A;  3CCV T;  2OTL A;  4KUL A;  3CPW A;  2C06 A;  2QI2 A;  4OGC A;  2RD1 A;  3CD6 A;  4J7I A;  1K9M U;  1NPP A;  2O01 E;  4M75 E;  3MEU A;  3SFM A;  4MDX A;  5FRM A;  3PIP A;  3L42 A;  3N5B B;  3A8H B;  3RER A;  2EWN A;  1YI2 T;  1U8R A;  1W2B S;  3HFO A;  4M77 E;  5LJ5 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...