1U3OA

Solution structure of rat kalirin n-terminal sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
b'SGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSTLCISHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Huntingtin-associated protein-interacting protein
molecule tags Signaling protein
source organism Rattus norvegicus
publication title Regulation of RhoGEF Activity by Intramolecular and Intermolecular SH3 Domain Interactions.
pubmed doi rcsb
total genus 6
structure length 67
sequence length 67
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1u3oA01
4F17A 2DRKA 2YUOA 1AWXA 4RTWA 2EPDA 1CSKA 3UA7A 2EYWA 2CDTA 1M8MA 2GTOA 4AFSC 4HVUA 2JMCA 1Z9ZA 1WXUA 2CSIA 2YUQA 4OMLA 1XOVA 2BTTA 1RUWA 2GGRA 1GCQA 4FSSA 2M51A 2K9GA 4OMQA 2YT6A 2QDLA 2A36A 3U23A 2C0IA 4LE9A 2AKKA 2FG0A 2GNCA 4LNPA 2J06A 4LUEA 2EBPA 3TVTA 2ROTA 2KEAA 4AFZC 3M0UA 3H41A 1ZSGA 1G83A 2D0NA 2LQWA 1K1ZA 1W1FA 3SEMA 5IHNA 2G6FX 3GBQA 4RTVA 2DL4A 1WX6A 2RQTA 1ZUKA 2EQIA 4D8KA 4JJDA 2VVKA 1KFZA 2VKNA 3CQTA 3EG0A 1ZLMA 3I5RA 4J9IA 1SEMA 4RTXA 5GJWB 2W10A 3H0HA 3VS1A 1NEBA 1JXOA 2DRMA 1RLQC 2J7IA 4DEYA 2ROLA 2RQWA 2RQRA 1X2KA 1VYTA 1IO6A 2DF6A 2DJQA 2KYBA 3LH5A 1WI7A 4OMPA 4IIOA 3TSZA 4ORZA 1BBZA 1OPKA 4JZ4A 1BK2A 2D8JA 5FWBA 4CC3A 4RTZA 2A08A 2FRWA 1T0JA 1T3LA 1TG0A 2FEIA 2LCSA 2HSPA 3EG1A 2L3QA 1QKXA 4OMNA 1H3HA 2P4RA 3VS6A 1VYUA 2JT4A 2V1QA 1NG2A 2LP5A 3VS2A 1X69A 1MUZA 2NWMA 2DE0X 4A63B 1UJ0A 2JM8A 2EW3A 3PVLA 2HDAA 4J9HA 1UUEA 4ESRA 1QLYA 1UFFA 2DILA 1WLPB 1UTIA 1X2QA 1AWWA 2J6KA 2LJ0A 4KRTA 1HJDA 2EGCA 1PKTA 2KGTA 1T0HA 2I0NA 2RNAA 4IIMA 1K76A 3REBB 1ZBJA 2D1XA 1MV3A 2C0TA 4CC4B 1M30A 1PKSA 2LQNA 3KFVA 2H8HA 2DNUA 5IH2A 2L0AA 1UECA 1HD3A 3ULRB 1SHFA 2DLPA 3RNJA 1X6GA 2AKLA 1B3QA 4JZ3A 2RPNA 3EG2A 2CUBA 2GTJA 1JXMA 3EHRA 2F2WA 4K11A 2K6DA 2L3PA 3I5SA 1VYVA 1PRMC 2NUZA 2JTEA 4HCKA 1S1NA 2HEQA 1K9AA 1SRLA 1QWFA 1E6HA 1ZUYA 5IHIA 3RBBB 4HVVA 1V1CA 2KYMA 2RQUA 1UG1A 2MCNA 5FWCA 2FPFA 2F2VA 4J9DA 2L2PA 2CH4W 2AK5A 4AFQC 1M3CA 2GQIA 2YUPA 2OAWA 1NLPC 1K0XA 3VS4A 4RTUA 3M0RA 1NYGA 1GBQA 1RI9A 4J9CA 2DX1A 1HSQA 1YN8A 1AEYA 5IXFA 3NHNA 1I1JA 2K2MA 2VWFA 1TUCA 4X1VA 1AD5A 1NEGA 1JU5C 3M0PA 5GJVB 1YP5A 2DL7A 2K79A 1VA7A 1UE9A 2SEMA 1SPKA 2KROA 2B86A 1PRLC 1W70A 1WXTA 4WCIA 2F2XA 3UA6A 2ENMA 5HCKA 5ECAA 3M0QA 2EGAA 5I22A 1ABOA 2ECZA 2M0YA 1J3TA 1OV3A 2KNBB 4LUDA 2DBKA 1YNZA 4M4ZA 1GFCA 1X43A 1QKWA 2A37A 2DM1A 2JS0A 4JJBA 2RN8A 1YWPA 2HBWA 1WFWA 3VS7A 2IIMA 5IHKA 1BB9A 2FPDA 2DBMA 3NMZC 2DMOA 2ESWA 2LNHB 4RTTA 1AZGB 3QWXX 2DL8A 1G2BA 2MOXA 3UF4A 1WA7A 1OOTA 3VS5A 2BZ8A 1X6BA 3FJ5A 1RLPC 2PTKA 2DYBA 2YUNA 2CT3A 2KRMA 3SHWA 2EKHA 2FO0A 3EG3A 2KR3A 2L3SA 2KRSA 2O9SA 3H0FA 1AWOA 4CC7A 3I35A 1NLOC 4AG2C 1FYNA 1GL5A 1LCKA 1JEGA 2E5KA 4E6RA 1NYFA 3C0CA 2EYYA 1OPLA 1GFDA 2O2OA 1KSWA 3PVQA 3NGPA 2ED0A 2YSQA 2BZYA 4OMOA 3A98A 2JXBA 1GBRA 1E7OA 2KXDA 2DL3A 1I0CA 2LJ3A 1B07A 2DA9A 1Z9QA 1OEBA 4F14A 4AFUC 1CKAA 2AZSA 3IQLA 2O31A 1UHCA 2PNIA 1JQQA 3M0TA 4J9GA 1ABQA 1U06A 1KIKA 2GBQA 2SRCA 2J6OA 1UJYA 4JJCA 2YDLA 4CC2A 2KT8A 1UDLA 4LN2A 3QWYA 4Y92A 1YCSB 2J6FA 1K4US 4Z89A 1GRIA 2K3BA 3VRZA 2W0ZA 4HXJA 3EHQA 4J9FA 2K7AA 2CUDA 2EYZA 2V1RA 4RUGA 2BZXA 2JMAA 5IXBA 1WYXA 3TSWA 4D8DA 1AZEA 2J05A 2D8HA 5EC7A 1T3SA 4F16A 1PWTA 1KJWA 2DL5A 1GCQC 4R0KA 2O9VA 4RTYA 4J9BA 4Z88A 1H92A 2JM9A 1K0SA 3REAB 2JS2A 2X3XD 2PZ1A 1SRMA 3PE0A 5I11A 2LX7A 1GCPA 3I9QA 1QCFA 1ARKA 2KRNA 2KBTA 2LMJA 1AWJA 2FRYA 1SSHA 2CREA 4HVWA 2RF0A 4Z8AA 1N5ZA 1AVZC 1Y57A 2XMFA 1BU1A 1WDXA 3H0IA 1EFNA 4QT7A 1WIEA 4DEXA 2HCKA 4JPBW 3JV3A 3NPFA 3VS0A 2LJ1A 3VS3A 1NM7A 1SHGA 4GLMA 3ZL7C 1QWEA 1Y0MA 5L23A 3UATA 2EVRA 2JW4A 1U5SA 1WXBA 1AOJA 4EIKA 2ABLA 2LZ6B 1M27C 1YWOA 2RQVA 2RMOA 2KT1A 1TUDA 4GBQA 3VRYA 2AZVA 1M3BA 1PNJA 3O5ZA 1U3OA 2A28A 1UGVA 1UHFA 2O88A 2ED1A 5FW9A 2C0OA 4OMMA 2KE9A 3EGUA 1ZX6A 1W6XA 2MIOA 2FPEA 1X27A 4ZNXA 4AG1C 4J9EA 1JO8A 2EYXA 2X3WD 2KXCA 3M0SA 2OJ2A 1FMKA 2CT4A 1PHTA 2CH4A 2DVJA 1ZUUA 3THKA 1CKBA 1A0NB 1M3AA 1MV0B 1E6GA 2EGEA 2CSQA 1I07A 2OI3A 3R6NA 1H8KA
chains in the Genus database with same CATH superfamily
2IPOB 2X4YA 2P84A 3CBMA 2XK0A 4RTWA 2KQWA 2Y4YA 3UA7A 3E9GA 3CXCP 3CCST 1JJ2P 1YJWQ 2CDTA 4AFSC 2JMCA 3JCMh 3LGFA 2GFAA 1WXUA 1X01A 1XTDA 1XOVA 3AT1B 2ZPFB 3ER0A 4FSSA 1I81A 2O4XB 3VUBA 4OMQA 2QDLA 1WZOA 5GMKm 2C0IA 1G3YA 2AKKA 3MKDA 2J06A 2K5FA 4QQ6A 5CKFA 3JAME 2BE7D 3M0UA 3H41A 2ZAEA 4C8QE 3TREA 2HQXA 3PGGA 3CCJQ 1N9SA 3OB9A 1YI2Q 4M78B 2RQTA 2OTJT 4D8KA 1M1KU 2BKDN 1VIFA 1Q7YC 3FIFA 4RTXA 3H0HA 2YLBA 4NS5A 2ZPBB 3UPUA 5CKHA 3CPWA 1Q81C 4ELZC 3LWIA 3CCET 2QA4Q 1Y7XA 2ATCB 3V8LA 4C5IA 4J8OA 2DJQA 3ZBDA 4ORZA 1OPKA 3CPFA 5LJ5f 3V8JA 2FEIA 1M2VB 3TQ7P 4C92D 1W2BS 3CBPA 3VS6A 5GAMd 1NG2A 4M78E 3CMET 2CP2A 3CCRQ 2YRVA 1MMAA 1ZSZB 2LP5A 3JSCA 2NWMA 4IKFA 4DOWA 2DE0X 3PFSA 4BDYA 1UFFA 2DIQA 2KGTA 1T0HA 1YHQT 3X24B 4IIMA 4DBHA 3REBB 3QJ6A 4FU6A 5IT9E 3CCUQ 2QEXA 3UWNA 3FB9A 2RI2A 3KFVA 1VQ5Q 4KBMB 3M55A 5I2SA 3CCMA 1M1KR 3G1JA 3OMCA 3OYEA 3BFMA 4M78G 2DLPA 4PJJA 1I5LA 1UGRB 2MF2A 2RJEA 3MP6A 3LYIA 1JXMA 3N5BB 3HKSA 2BUDA 4L6V5 2NUZA 2JTEA 1S1NA 4C92E 1FMWA 3PMIA 1VQOT 1YBYA 1QWFA 1E6HA 3RBBB 2HAXA 3NTHA 2RQUA 1BI0A 3M4YA 2F2VA 4J9DA 3DB4A 2RJFA 2L2PA 3H6ZA 4AFQC 4M75G 2QQRA 4IUPA 1HSQA 2DVEA 2EJGA 2FZGB 2XG8D 2WSFE 2ZPIB 3OBYA 3CCUA 4JS5A 1RACB 2HSEB 2G3RA 2O01E 3C95A 1QCNA 4XQ3A 1NEGA 2XD0A 4M7DD 1YP5A 2DL7A 3OA6A 1KQ1A 1UE9A 4PLLA 3I56A 3OYNA 2F2XA 2E6NA 3CEYA 2E1HA 3CC2A 2ENMA 1OZ2A 3M0QA 3OYAA 2ECZA 3VU3C 4LDVA 2DBKA 1YNZA 4LUDA 1GFCA 2COWA 3G4ST 1QKWA 2EQMA 1M1FA 2DM1A 3QUIA 1YHQQ 1NE8A 2QQ9A 3NMZC 4F7UA 3G6ET 2ESWA 3MEAA 1LOJA 2MOXA 1G2BA 4ATOA 3FJ5A 2X51A 3CMAA 1RLPC 5EG2A 3CCJA 2QA4A 2YUNA 1XNIA 2CT3A 4JDSA 1GXIE 3SHWA 4DBFA 3E19A 4LDWA 2P4TA 3GNFB 2KRSA 3META 2K3XA 2O9SA 4CC7A 4E7ZA 2LT1A 5GAN5 1VQLT 3QKJA 2K2VA 4AG2C 2MWPA 1XQHA 9ATCB 2HQEA 4XTWA 4M7AC 1D1BA 4E6RA 1IRXA 4XAXB 2M02A 2EYYA 2CZ0B 3GP8A 1YFNA 8ATCB 4FL6A 5LJ3f 2L89A 3CCSA 3NGPA 4OMOA 3OYMA 4C5GA 2VXFA 2KXDA 3OYBA 1YJNQ 4DBRA 1N8RU 1B07A 1OU8A 1Z9QA 3H8ZA 3QXEB 3CPWP 3SD4A 5LJ3h 3IQLA 2XICA 4LDXA 4A4EA 3O8VA 4ZGJB 1ABQA 4EMKC 3G7ZA 1O9SA 2J6OA 1WQ7A 4JJCA 4JRKA 4CC2A 3OYKA 1Q82U 4PJOB 1YCSB 2RHZA 2J6FA 3RUXA 1KC8R 4ELYC 5GAMj 4O6JA 2K3BA 3JCMe 4HXJA 3S3NA 2K7AA 2CUDA 1VQOQ 4M7DA 5LJ5h 1M90R 2J05A 2D8HA 3ASKA 4C0DB 1GCQC 1B34B 1RL2A 4J9BA 3RKYA 1H92A 2E41A 2JM9A 1YIJT 1K8AC 1K0SA 2DZCA 1SRMA 2A0FB 3GPLA 1HK9A 2LX7A 4N4IA 1GCPA 1Q7YR 4F04B 1QCFA 5HKCA 2MI6A 1ARKA 1IXDA 3SWNC 5DLOA 2LMJA 1KD1C 1QCOA 4IURA 2CREA 4Z8AA 1F1BB 2MMPA 3CD6A 4X9CA 4NL2A 1BCMA 5LL6S 3H0IA 1EFNA 1IHWA 5A0LA 1WIEA 2Y4XA 1VQ6A 3OBWA 1M90U 4JPBW 2YRCA 2ZGWA 4OGEA 4JRIA 4BE2A 4NL3A 4GLMA 3OYLA 4C92G 1KQSA 1QWEA 4XU1A 3JCMP 4M7AA 3JCMX 1VQ8T 1WXBA 2EJFA 3LH0A 1PCXA 4X9DA 3G4SA 1M27C 2RQVA 1U8RA 3I55A 4GBQA 2QYZA 3CCVA 1M3BA 4PNOA 2DKGA 1B34A 1IZ6A 2QDYB 2C0OA 4M77C 3CC2Q 2MIOA 2QQAA 5GMKl 2RA2A 1TSFA 3PNWC 3MP1A 3M0SA 4RG2A 2OJ2A 2CT4A 1M2VA 1LVKA 1Y71A 4KGZB 2YRDA 2LC4A 1BI1A 5J3BA 1I07A 4MZMA 1H8KA 1G3WA 4EMHA 2VASA 4OF1A 4ZN1A 1LPLA 4F7UG 3HFOA 1CSKA 4KH0B 3OSSC 3E2UA 2YHTA 3JB9D 4B9WA 1WHJA 2MK5A 3DB3A 2DZ9A 2P0QA 2LDMA 4HVUA 1YJ9T 4M7DG 2QI2A 2RK1A 2CSIA 2YUQA 5FU7C 2OTLT 3EFOA 3FEOA 1RUWA 3VV0A 2K9GA 5GAOm 4DQ2A 2QQBA 1PSFA 2A36A 4HCBA 2FG0A 2GNCA 3PIOA 3L2RA 3HPWA 1MMNA 1RAGB 1ZSGA 5C6SA 1G83A 2D0NA 3SEMA 5IHNA 4RTVA 4B6MA 2DL4A 4A4HA 4TVRA 2OTLA 4E7HA 2ZPHB 2F5KA 5IAYA 1ZLMA 4E7KA 1VQ4A 3I5RA 1SEMA 3LWHA 3LW5E 4M78D 3E1SA 4M75B 4L59A 1OI1A 1VQMQ 2CP6A 2DRMA 1RLQC 3CCQA 5CCAA 2AT1B 1X2KA 1RAAB 1VYTA 3CMEA 5GAMe 2DF6A 1VIEA 2H3JA 3G71T 4IIOA 2JNGA 3CCLA 3OY9A 5J26A 2D8JA 1TXQA 4CC3A 2A08A 2FRWA 4M78A 5GANf 3Q1JA 4PFPA 2XU8A 1RAEB 4A4GA 5GMKi 1RABB 2LCSA 4DA4A 2F69A 4OMNA 1H3HA 4HA8A 2RI3A 1PC0A 1VYUA 2JT4A 1HYOA 5FROA 2JM8A 2EW3A 3LGLA 3OYJA 2WACA 4J9HA 1PM3A 4ESRA 1WHMA 1K73C 1WLPB 2K57A 4E7SA 2YLCA 2CP5A 1UTIA 1AWWA 4KRTA 5KYYB 3OS1A 2RNAA 1G3TA 1X75C 4A4FA 1NJIC 1M30A 2OTJA 2DNUA 3V7CA 5HK3A 4PJOD 3L2QA 4C92B 1M5Q1 4HT9A 2CZ7B 2GFUA 1HD3A 4M75F 3ZEHA 4XTVA 1VQLQ 3RNJA 4QKUA 1U1SA 4ZGDB 2DERA 4M7DF 5AT1B 2RPNA 1EX4A 2NLUA 2F2WA 1FXXA 3F70A 1PRMC 1QQJA 5LJ5j 4N0AC 3A5ZB 4OVAA 1AHJB 3DLLA 1SRLA 2X35A 1Q82C 5IHIA 2PU9B 3JB9F 1C6VX 5FWCA 1D3BA 1K9MR 4HKEA 5KYNA 1K9MU 1BYMA 2YUPA 1K0XA 3VS4A 1JRIA 1OQKA 2K3YA 1NYGA 1GBQA 2DO3A 1M90C 4M77F 4RCBA 5IXFA 1QVFP 2DIGA 3NHNA 1MNEA 3VUZA 2VWFA 3CCVT 2M1HA 4BD3A 4Y28E 4BUGA 3JB9I 4NOYA 3MEVA 4M7AD 3VYHB 1VQPQ 1D0XA 1SPKA 2KROA 2KI7A 3EAEA 1WQWA 1WXTA 4WCIA 1LNXA 1S72Q 2EFIA 1IB8A 2XI9A 2EGAA 1ABOA 3GIBA 1TUGB 2IVWA 5GANe 3WVEB 4M4ZA 1X43A 2GCXA 4M7DB 1VQ7T 1YWPA 2HBWA 5IHKA 3LX7A 2FPDA 2DMOA 4RTTA 3QYHB 3UF4A 1WA7A 3VS5A 3VJPA 2HBPA 4UC4A 3HRSA 2KRMA 3WXMB 4EDUA 2E64A 3UDCA 2AHJB 2LVMA 3I35A 1NLOC 5L8RE 3OS0A 1FYNA 3M54A 1GL5A 1OU9A 3OYHA 4LXCA 3VYGA 1LCKA 1JEGA 1V29B 5FU6C 2VB6A 4XTYA 1M9SA 5A0GA 2LCLA 4KUIA 4JRPA 1WGSA 1KSWA 3RKXA 1Y96B 5CKBA 2ED0A 1PG5B 2FZCB 1GBRA 1UGSB 1E7OA 1W2BP 1FX7A 2QGGA 4YTLA 4FYWB 4RMOA 1VQ5A 2QGFB 1RADB 3BE3A 3FDRA 4IUQA 3HTRA 5KYXA 3I55Q 4M75D 3JB9G 4XK8E 1VOMA 2HNIA 3CXCA 1JJ2A 1TU0B 4PJOG 1NPRA 2WSEE 4B9XA 2A3LA 2ZPEB 2DD5A 4Y92A 4Z89A 1ACMB 2EQJA 3D7SB 1GRIA 4FW2A 3VRZA 1YITT 3EHQA 3NTIA 1O75A 2E4HA 4CI0C 3JCMJ 2V1RA 2JMAA 4V2SA 2OTJQ 1XJWB 4MZPA 1HXDA 5GAMf 2QEXQ 1WHHA 4F7UE 4OB2B 5A0DA 2D9TA 3QIIA 4E47A 3A8LB 2X4XA 2OX7A 1K73R 4R0KA 3EH2A 2O9VA 4RTYA 1TOVA 3V8KA 1YI2A 3MPUB 1Y96A 3QYGB 3REAB 2E10A 2PZ1A 4XU2A 1TWBA 4C92F 2DXBA 3I9QA 1N8RR 3RMSA 2KRNA 4Y91A 5LJ5e 3SB2A 5KYXB 1OX8A 3G6EA 4PKCC 1H3ZA 1SSHA 3SWNA 2RF0A 3QZ9B 4KUDK 3CC7T 1BU1A 2QTXA 1S72T 3M53A 3JV3A 2PUOB 3PIPA 3JB9H 3VS0A 3VS3A 2JOYA 3RKWA 1VQNT 3KBGA 2CGHA 5CQYA 5LJ3e 4C0DC 4XU0A 1KG1A 1VUBA 5GAN6 1M4ZA 1YJWT 2YXYA 2L8DA 4A4KA 1KHIA 2ABLA 1QMCA 1K9MC 3BDUA 3VKIA 4ANJA 2AIRB 1G8XA 1TUDA 1EIFA 4EMGA 1U3OA 3URGA 3OYCA 2LQ8A 2DTIA 1IGQA 5GAOl 4PJOC 1W6XA 5CK9A 4ZNXA 4PJOF 5DY9A 2X9HA 1JO8A 2Z0WA 3OQ5A 1KHCA 1OX9A 2X3WD 4FCYA 4BY6B 1PHTA 3UT1A 2DVJA 1ZUUA 3NTKA 3THKA 1A0NB 3MEUA 2CKKA 1M3AA 1MV0B 2EGEA 2CSQA 3M57A 5GAN3 5KH6A 2DRKA 2JTMA 2YUOA 3J80E 4RCCA 1AWXA 3CCSQ 3L1AA 2HL3A 1M8MA 3C12A 1Z9ZA 1QP2A 3A8MB 4OMLA 3LLRA 1D0YA 2VYTA 2B8AA 4C5HA 2VC8A 3EGXA 2GGRA 3FJPA 2M51A 3I55T 2JTFA 3X28B 1KC8U 3HRTA 4KGXB 4HCZA 3TVTA 1FMVA 2EBPA 3EGDB 1B7TA 3S6WA 4AFZC 2BE9B 2EQUA 1N6AA 3CMEQ 1W1FA 3M4GA 2G6FX 3GBQA 3CCMQ 1YI2T 3M58A 3A8OB 4JJDA 5KYYA 4R55A 1Q86R 3CQTA 2R57A 3EG0A 4J7FA 5GAN7 1YHQA 5KYWA 4J9IA 5GJWB 4BI4A 2W10A 1NBEB 1NZ9A 1ZSZA 2QXFA 2RJCA 3VS1A 2RO0A 1NEBA 1JXOA 1YJNT 4AT1B 1D09B 3J81E 4FYXB 2QTVA 2ROLA 2RQWA 2RQRA 3LH5A 1WI7A 4OMPA 3OYYA 1ZBXA 2XHCA 1BBZA 3PMTA 4JZ4A 4E7LA 1T0JA 4X34A 2E3IA 2HSPA 2L3QA 5D6YA 1BI3A 2P4RA 2XKOC 3MP8A 1D1CA 3QZ5B 3EGDA 3CCRT 4DBQA 3JCMb 3CCLQ 3GOXA 1UGPB 1YITA 1ZA2B 2ZZDA 4A63B 1D3BB 3BDLA 2HDAA 4F7UF 1UUEA 2LNVA 2DILA 2EIFA 1VQ8A 1X2QA 4JS4A 2M0OA 5GANj 1KQSS 3CD6T 2EGCA 1PKTA 3I56Q 4QVZA 1Q86C 3H9NA 2JN0A 2I0NA 4E7JA 1K76A 1ZBJA 2D1XA 1MV3A 2C0TA 4C8QF 3SFMA 4JUVA 1VQ5T 1PKSA 3X25B 1I8FA 2H8HA 5DLQE 2L3RA 3CC4T 1YJNA 4JRQA 3CC4Q 1RAIB 2GF7A 3P8DA 2CS7A 4M77G 1UECA 3L2WA 2ZCFB 3ULRB 5CR2A 1TH7A 1X6GA 2AKLA 1B3QA 4JZ3A 1VQ7A 2CZ6B 1M8VA 1NJIR 3EG2A 3JCMf 2E5QA 1WPYA 2A7YA 3RDVA 2K6DA 3CCJT 5CKEA 4ZGEB 2L3PA 5GANg 1VYVA 2K5LA 3INZA 4HCKA 2HEQA 3M9QA 4PK4A 1K9AA 1QVGA 1KQSP 1UG1A 1LJOA 2FPFA 4MMLA 4LDUA 4C92A 5GAOn 5C0MA 2CH4W 2AK5A 1M3CA 1C1AA 2OAWA 1NLPC 1OZ3A 3M0RA 4M75C 3OYDA 1RI9A 4J9CA 2DX1A 5GAN8 1ZSZC 3JRZA 1AEYA 2CP7A 4OB1B 2KAFA 4BI3A 3CCRA 2K2MA 4PFOA 1TUCA 4FT2A 1JU5C 3AHUA 2QQSA 2K79A 4WTOB 2DEUA 1K8AR 3RMQA 2SEMA 4FW1A 1PRLC 1M2OA 3CCLT 1QVGP 2COYA 1KD1U 5ECAA 2E12A 1QW1A 5I22A 3MEWA 2LT4A 1VQNQ 2QASA 1W4SA 1OV3A 2KNBB 2DXCA 2WSCE 4KH1B 7AT1B 3PTAA 3P8BB 1D1AA 3QJYA 1ZA1B 3CD6Q 2NUTB 4QQDA 2DPPB 4R56A 2A37A 2H3EB 4JJBA 2XIDA 2RN8A 3OW2A 3RERA 1WFWA 3G6EQ 2DBMA 1VQOA 3S3OA 1YIJQ 1OOTA 2XDBA 2BZ8A 2C06A 2PTKA 1R8OB 2FO0A 6AT1B 3EG3A 2OAUA 2KR3A 2L3SA 3NFCA 2LQKA 3H0FA 1AWOA 5LJ3d 2FZKB 3ZFJA 2K5IA 4IUTA 1VQ4Q 3SWNB 3BW1A 1VQKQ 1Q81U 2CP0A 5GAN4 3MO8A 2P0PA 2E5KA 1SF9A 2MYSA 3CXCS 1JJ2S 1NYFA 3C0CA 3GF5A 4M77B 2MPXC 3JB9J 3X20B 5D6XA 3OMGA 1R77A 3I56T 3JCMV 2R58A 4FT4A 2BZYA 2DD4A 2RHIA 3HL8A 4C8QG 1I0CA 1SKUB 2LJ3A 4F14A 4XTXA 1TTHB 4II1A 4PFZA 1CKAA 1WHLA 1H641 4BB7A 2FL7A 2O31A 5GMKj 3OSVA 1UHCA 1JQQA 3M0TA 4J9GA 3A8GB 1U06A 2JUFA 1MNDA 1UJYA 2YDLA 2KT8A 1UDLA 4J83A 5KE2A 1K4US 2V26A 3G71A 4EMKB 2KDSA 2W0ZA 2DFUA 4C0ZA 4M77E 4RUGA 2BZXA 4N0AA 4P5NA 1N27A 8AT1B 4MZTA 1WYXA 3TSWA 3HHTB 4D8DA 2RHYA 2E70A 3CC7A 1T3SA 2HZYA 1KJWA 4C8QC 1KD1R 2E65A 2DEQA 3M59A 4M77D 5HK0A 3GNGA 3OYIA 4M7AF 2DJZA 2JS2A 2X3XD 4M7AB 3CCQQ 3PE0A 3QHSA 2VXEA 1R0BG 3L2VA 5DM7R 2V8IA 4ZTJA 5KE3A 3RIRA 2KBTA 4N4HA 1AWJA 2FRYA 2ZPGB 3RESA 1N5ZA 1AVZC 3RR6A 1Y57A 4Z02A 1WDXA 4M7DC 2HL5C 5D7UA 2DETA 4PLIA 2HCKA 1KQ2A 3QG1A 3NPFA 3KXTA 4VUBA 2RHXA 3E9FA 4C8QA 1M1GA 3JCMd 1YJ9A 4PJOE 1ZQ1A 3EG9B 4RKUE 2JW4A 2VUBA 1AOJA 4E2FB 4EIKA 2LZ6B 3EGXB 2PQWA 1YWOA 3V7SA 2RMOA 2KT1A 3QO3A 4QVDA 3VRYA 4M7AE 1PNJA 3O5ZA 1BIBA 1UGVA 2O88A 5M9OA 2KY9A 2FVUA 5FW9A 5FRMA 1WJQA 1ZHIA 2KE9A 3EGUA 2FPEA 1X27A 4J9EA 2HD0A 2EYXA 1BCOA 4BI8B 2KXCA 4J5YA 2CH4A 2X4WA 2DXTA 5J39A 4DOVA 2DTOA 2JVVA 2FHDA 1VQKA 1E6GA 2OI3A 4F17A 4BY6C 1NPPA 2EPDA 1PD1A 2EYQA 3TEEA 2EYWA 3R6OA 4FYVB 4O5VA 2RHUA 2GTOA 2QK0A 1TS9A 2COZA 3EFOB 3DKMA 4RG8A 3T9NA 3TCJA 2BTTA 3BY7A 2PVOB 1GCQA 4OP0A 2KMTA 3A8HB 2YT6A 3U23A 2F1LA 4LE9A 1SSFA 4LNPA 4LUEA 3FC3A 2ROTA 5GAMg 2KEAA 2HKQB 5GAOp 1OYXA 3C94A 1QVFA 2LQWA 1K1ZA 2PUKB 1WX6A 4KULA 2LTOA 1ZUKA 2EQIA 5LJ3j 1YIJA 2D0QB 2HKNA 5GAN2 2CZ1B 4C5EA 2VVKA 1KFZA 2VKNA 2GQVA 4D6WA 1Y07A 2LCCA 5GMKe 4C0FA 4QQGA 2EKOA 3QDFA 3X26B 2J7IA 4E7IA 4BACA 2M16A 4DEYA 1NJIU 5KCHA 1IO6A 3G71Q 2KYBA 3CC2T 3TSZA 3CMAQ 1BK2A 5FWBA 2O4XA 2VGMA 4RTZA 1VQPA 2EJ9A 1T3LA 1K8AU 1TG0A 2PVDB 3EG1A 1QKXA 1IGUA 2RI5A 5KYWB 2V1QA 1VQ9Q 1BIAA 3CPWS 4M75A 3VS2A 1X69A 1MUZA 4OB3B 1UJ0A 3FRNA 4HT8A 3PVLA 5GANh 5CKDA 1QLYA 3HFNA 5I21A 1HJDA 2J6KA 2KVQG 2LJ0A 1VQMA 3C4SA 4J6WA 1G5VA 1WNLA 1FWZA 4CC4B 1YCYA 4M78C 2LQNA 4ME7A 3HP9A 5CO7A 5IH2A 5FRNA 2L0AA 3P8HA 3L2UA 2FB7A 2L5QA 1SHFA 4FM4B 4QVCA 4Q5WA 1EZZB 2CUBA 2GTJA 3EHRA 4K11A 4JJNK 5LJ5g 1WHGA 2RM4A 3CC4A 3I5SA 2KSSA 3M56A 3M5AA 5KYUB 1VQ9A 4GY5A 1Q95G 1ZUYA 4HVVA 1V1CA 2KYMA 2MCNA 3CBOA 2XDDA 4GLKA 2CYZB 3HSBA 1VQ7Q 1VQ8Q 2DAQA 3OW2S 4PL6A 2GQIA 3SDZA 4KGVB 4RTUA 1R0CB 2DTHA 4IUVA 3OS5A 4J6YA 5GMKh 1KC8C 1YN8A 1WJRA 3JCMg 2FYKA 1I1JA 4JLIA 1DJ7B 4FSXA 1QP3A 3CCVQ 2EAYA 4X1VA 1AD5A 2E6ZA 3M0PA 5GJVB 4FIBA 5CQXA 2V8JA 4M75E 4QW2A 2JZ2A 1VA7A 1WJSA 4ZTFA 2B86A 1VQ4T 1C0MA 1W70A 4FYYB 4M78F 3UA6A 5HCKA 4J7IA 5IN1A 3MJXA 2M0YA 2RD1A 1MGQA 1J3TA 5FU6B 3OW2P 3JCMQ 2QG9B 5KCOA 2RJDA 5KYUA 2VGNA 4WF2A 1PD0A 3ME9A 2JS0A 2EWNA 3A1PA 3OS2A 4M7DE 3VS7A 2IIMA 1K73U 1BB9A 1Q86U 2LNHB 3EH1A 1AZGB 1VQNA 3QWXX 2DL8A 4L5GA 2XDPA 3CCQT 1JB0E 1X6BA 2NYSA 2QA4T 1Q81R 3CMAT 2DYBA 3TU4K 2EKHA 5I2MA 5GAOq 2F5TX 3KUFA 2DYIA 3MCAB 5GAMh 5HY6A 4EMKA 5LJ3g 2K4YA 4A53A 1UB4A 2I2LA 5LJ5d 3HRUA 4OMFB 4A54A 1VQ9T 2NUTA 3CCMT 3DLMA 3QDRB 2EQKA 4MDWA 2BIVA 1UGQB 4LD6A 2QEXT 2HQHA 2Y90A 1OPLA 2CP3A 4XTUA 2QAZA 2LX9A 1GFDA 3MHXA 4M7AG 1RAFB 2O2OA 3PVQA 1U1TA 1G3SA 2VV5A 2YSQA 5GANd 3A98A 4OB0B 2JXBA 4PJMA 2YWWA 2DL3A 2DA9A 4LDYA 4CRIA 3OYFA 1N9RA 3CCUT 1OEBA 1BI2A 4AFUC 5CIUA 2AZSA 4JLGA 4KT0E 1JBMA 2PNIA 2IG0A 1KIKA 1BKBA 2GBQA 2SRCA 3V7RA 1P92A 5AYFA 2MAMA 4M77A 4LN2A 1M1KC 3QWYA 4IUUA 1VQPT 4EPCA 1I4K1 5FLXE 1YJWA 3QSUA 2HMAA 1VQ6Q 4J9FA 2EYZA 4PJLA 4C8QB 4C0GA 1IREB 3EG9A 5CVIA 5IXBA 1RI0A 2PVGB 2KK4A 1AZEA 3G4SQ 1W2BA 5EC7A 3L42A 4XU3A 4F16A 3GLXA 1PWTA 4OGCA 1WHKA 4F7UB 1D0ZA 2DL5A 1YJ9Q 2E3HA 4MDXA 3EFSA 4Z88A 1RAHB 2RB6A 4J6XA 2RK2A 4N4GA 2P0KA 5A2QE 1AT1B 3CCEQ 1X6OA 5I11A 1S72A 4PJNA 3S3MA 4C92C 2R5MA 2NUPA 2D6FA 1PSEA 2DXUA 4BE0A 1SG5A 2LRQA 3JCMc 4HVWA 1V76A 3WVDB 2XMFA 4BDZA 1Q82R 4QT7A 3QBYA 1VQ6T 2DK3A 1Q7YU 4DEXA 4PJOA 1UEBA 5D6WA 4BE1A 3PT9A 1N8RC 3L2ZA 3QPHA 4XTZA 2LJ1A 1VQLA 1NM7A 1SHGA 1QVGS 3ZL7C 1Y0MA 5L23A 1KK7A 2RH2A 3UATA 2EVRA 1U5SA 1VQMT 2M9UA 3OYGA 1QVPA 1MHNA 4LD9K 1IHVA 5GAOr 2AZVA 2OTLQ 1MMGA 2A28A 5FU7B 1I5OB 1MMDA 1UHFA 2X4JA 5CAIA 2ED1A 2V8KA 4OMMA 2MWOA 3CCEA 1ZX6A 4ZN3A 4AG1C 2JJ9A 3J7AF 4C8QD 2NUPB 1FMKA 2R5AA 1YITQ 3EFRA 3CC7Q 4AMCA 1CKBA 1VQKT 4HCCA 1QVFS 3JCMW 3R6NA 3FLGA 4MMKA 1OULA
chains in the Genus database with same CATH topology
4F17A 2DRKA 2YUOA 1AWXA 4RTWA 2EPDA 1CSKA 3UA7A 2EYWA 2CDTA 1M8MA 2GTOA 4AFSC 4HVUA 2JMCA 1Z9ZA 1WXUA 2CSIA 2YUQA 4OMLA 1XOVA 2BTTA 1RUWA 2GGRA 1GCQA 4FSSA 2M51A 2K9GA 4OMQA 2YT6A 2QDLA 2A36A 3U23A 2C0IA 4LE9A 2AKKA 2FG0A 2GNCA 4LNPA 2J06A 4LUEA 2EBPA 3TVTA 2ROTA 2KEAA 4AFZC 3M0UA 3H41A 1ZSGA 1G83A 2D0NA 2LQWA 1K1ZA 1W1FA 3SEMA 5IHNA 2G6FX 3GBQA 4RTVA 2DL4A 1WX6A 2RQTA 1ZUKA 2EQIA 4D8KA 4JJDA 2VVKA 1KFZA 2VKNA 3CQTA 3EG0A 1ZLMA 3I5RA 4J9IA 1SEMA 4RTXA 5GJWB 2W10A 3H0HA 3VS1A 1NEBA 1JXOA 2DRMA 1RLQC 2J7IA 4DEYA 2ROLA 2RQWA 2RQRA 1X2KA 1VYTA 1IO6A 2DF6A 2DJQA 2KYBA 3LH5A 1WI7A 4OMPA 4IIOA 3TSZA 4ORZA 1BBZA 1OPKA 4JZ4A 1BK2A 2D8JA 5FWBA 4CC3A 4RTZA 2A08A 2FRWA 1T0JA 1T3LA 1TG0A 2FEIA 2LCSA 2HSPA 3EG1A 2L3QA 1QKXA 4OMNA 1H3HA 2P4RA 3VS6A 1VYUA 2JT4A 2V1QA 1NG2A 2LP5A 3VS2A 1X69A 1MUZA 2NWMA 2DE0X 4A63B 1UJ0A 2JM8A 2EW3A 3PVLA 2HDAA 4J9HA 1UUEA 4ESRA 1QLYA 1UFFA 2DILA 1WLPB 1UTIA 1X2QA 1AWWA 2J6KA 2LJ0A 4KRTA 1HJDA 2EGCA 1PKTA 2KGTA 1T0HA 2I0NA 2RNAA 4IIMA 1K76A 3REBB 1ZBJA 2D1XA 1MV3A 2C0TA 4CC4B 1M30A 1PKSA 2LQNA 3KFVA 2H8HA 2DNUA 5IH2A 2L0AA 1UECA 1HD3A 3ULRB 1SHFA 2DLPA 3RNJA 1X6GA 2AKLA 1B3QA 4JZ3A 2RPNA 3EG2A 2CUBA 2GTJA 1JXMA 3EHRA 2F2WA 4K11A 2K6DA 2L3PA 3I5SA 1VYVA 1PRMC 2NUZA 2JTEA 4HCKA 1S1NA 2HEQA 1K9AA 1SRLA 1QWFA 1E6HA 1ZUYA 5IHIA 3RBBB 4HVVA 1V1CA 2KYMA 2RQUA 1UG1A 2MCNA 5FWCA 2FPFA 2F2VA 4J9DA 2L2PA 2CH4W 2AK5A 4AFQC 1M3CA 2GQIA 2YUPA 2OAWA 1NLPC 1K0XA 3VS4A 4RTUA 3M0RA 1NYGA 1GBQA 1RI9A 4J9CA 2DX1A 1HSQA 1YN8A 1AEYA 5IXFA 3NHNA 1I1JA 2K2MA 2VWFA 1TUCA 4X1VA 1AD5A 1NEGA 1JU5C 3M0PA 5GJVB 1YP5A 2DL7A 2K79A 1VA7A 1UE9A 2SEMA 1SPKA 2KROA 2B86A 1PRLC 1W70A 1WXTA 4WCIA 2F2XA 3UA6A 2ENMA 5HCKA 5ECAA 3M0QA 2EGAA 5I22A 1ABOA 2ECZA 2M0YA 1J3TA 1OV3A 2KNBB 4LUDA 2DBKA 1YNZA 4M4ZA 1GFCA 1X43A 1QKWA 2A37A 2DM1A 2JS0A 4JJBA 2RN8A 1YWPA 2HBWA 1WFWA 3VS7A 2IIMA 5IHKA 1BB9A 2FPDA 2DBMA 3NMZC 2DMOA 2ESWA 2LNHB 4RTTA 1AZGB 3QWXX 2DL8A 1G2BA 2MOXA 3UF4A 1WA7A 1OOTA 3VS5A 2BZ8A 1X6BA 3FJ5A 1RLPC 2PTKA 2DYBA 2YUNA 2CT3A 2KRMA 3SHWA 2EKHA 2FO0A 3EG3A 2KR3A 2L3SA 2KRSA 2O9SA 3H0FA 1AWOA 4CC7A 3I35A 1NLOC 4AG2C 1FYNA 1GL5A 1LCKA 1JEGA 2E5KA 4E6RA 1NYFA 3C0CA 2EYYA 1OPLA 1GFDA 2O2OA 1KSWA 3PVQA 3NGPA 2ED0A 2YSQA 2BZYA 4OMOA 3A98A 2JXBA 1GBRA 1E7OA 2KXDA 2DL3A 1I0CA 2LJ3A 1B07A 2DA9A 1Z9QA 1OEBA 4F14A 4AFUC 1CKAA 2AZSA 3IQLA 2O31A 1UHCA 2PNIA 1JQQA 3M0TA 4J9GA 1ABQA 1U06A 1KIKA 2GBQA 2SRCA 2J6OA 1UJYA 4JJCA 2YDLA 4CC2A 2KT8A 1UDLA 4LN2A 3QWYA 4Y92A 1YCSB 2J6FA 1K4US 4Z89A 1GRIA 2K3BA 3VRZA 2W0ZA 4HXJA 3EHQA 4J9FA 2K7AA 2CUDA 2EYZA 2V1RA 4RUGA 2BZXA 2JMAA 5IXBA 1WYXA 3TSWA 4D8DA 1AZEA 2J05A 2D8HA 5EC7A 1T3SA 4F16A 1PWTA 1KJWA 2DL5A 1GCQC 4R0KA 2O9VA 4RTYA 4J9BA 4Z88A 1H92A 2JM9A 1K0SA 3REAB 2JS2A 2X3XD 2PZ1A 1SRMA 3PE0A 5I11A 2LX7A 1GCPA 3I9QA 1QCFA 1ARKA 2KRNA 2KBTA 2LMJA 1AWJA 2FRYA 1SSHA 2CREA 4HVWA 2RF0A 4Z8AA 1N5ZA 1AVZC 1Y57A 2XMFA 1BU1A 1WDXA 3H0IA 1EFNA 4QT7A 1WIEA 4DEXA 2HCKA 4JPBW 3JV3A 3NPFA 3VS0A 2LJ1A 3VS3A 1NM7A 1SHGA 4GLMA 3ZL7C 1QWEA 1Y0MA 5L23A 3UATA 2EVRA 2JW4A 1U5SA 1WXBA 1AOJA 4EIKA 2ABLA 2LZ6B 1M27C 1YWOA 2RQVA 2RMOA 2KT1A 1TUDA 4GBQA 3VRYA 2AZVA 1M3BA 1PNJA 3O5ZA 1U3OA 2A28A 1UGVA 1UHFA 2O88A 2ED1A 5FW9A 2C0OA 4OMMA 2KE9A 3EGUA 1ZX6A 1W6XA 2MIOA 2FPEA 1X27A 4ZNXA 4AG1C 4J9EA 1JO8A 2EYXA 2X3WD 2KXCA 3M0SA 2OJ2A 1FMKA 2CT4A 1PHTA 2CH4A 2DVJA 1ZUUA 3THKA 1CKBA 1A0NB 1M3AA 1MV0B 1E6GA 2EGEA 2CSQA 1I07A 2OI3A 3R6NA 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F17 A;  2DRK A;  2YUO A;  1AWX A;  4RTW A;  2EPD A;  1CSK A;  3UA7 A;  2EYW A;  2CDT A;  1M8M A;  2GTO A;  4AFS C;  4HVU A;  2JMC A;  1Z9Z A;  1WXU A;  2CSI A;  2YUQ A;  4OML A;  1XOV A;  2BTT A;  1RUW A;  2GGR A;  1GCQ A;  4FSS A;  2M51 A;  2K9G A;  4OMQ A;  2YT6 A;  2QDL A;  2A36 A;  3U23 A;  2C0I A;  4LE9 A;  2AKK A;  2FG0 A;  2GNC A;  4LNP A;  2J06 A;  4LUE A;  2EBP A;  3TVT A;  2ROT A;  2KEA A;  4AFZ C;  3M0U A;  3H41 A;  1ZSG A;  1G83 A;  2D0N A;  2LQW A;  1K1Z A;  1W1F A;  3SEM A;  5IHN A;  2G6F X;  3GBQ A;  4RTV A;  2DL4 A;  1WX6 A;  2RQT A;  1ZUK A;  2EQI A;  4D8K A;  4JJD A;  2VVK A;  1KFZ A;  2VKN A;  3CQT A;  3EG0 A;  1ZLM A;  3I5R A;  4J9I A;  1SEM A;  4RTX A;  5GJW B;  2W10 A;  3H0H A;  3VS1 A;  1NEB A;  1JXO A;  2DRM A;  1RLQ C;  2J7I A;  4DEY A;  2ROL A;  2RQW A;  2RQR A;  1X2K A;  1VYT A;  1IO6 A;  2DF6 A;  2DJQ A;  2KYB A;  3LH5 A;  1WI7 A;  4OMP A;  4IIO A;  3TSZ A;  4ORZ A;  1BBZ A;  1OPK A;  4JZ4 A;  1BK2 A;  2D8J A;  5FWB A;  4CC3 A;  4RTZ A;  2A08 A;  2FRW A;  1T0J A;  1T3L A;  1TG0 A;  2FEI A;  2LCS A;  2HSP A;  3EG1 A;  2L3Q A;  1QKX A;  4OMN A;  1H3H A;  2P4R A;  3VS6 A;  1VYU A;  2JT4 A;  2V1Q A;  1NG2 A;  2LP5 A;  3VS2 A;  1X69 A;  1MUZ A;  2NWM A;  2DE0 X;  4A63 B;  1UJ0 A;  2JM8 A;  2EW3 A;  3PVL A;  2HDA A;  4J9H A;  1UUE A;  4ESR A;  1QLY A;  1UFF A;  2DIL A;  1WLP B;  1UTI A;  1X2Q A;  1AWW A;  2J6K A;  2LJ0 A;  4KRT A;  1HJD A;  2EGC A;  1PKT A;  2KGT A;  1T0H A;  2I0N A;  2RNA A;  4IIM A;  1K76 A;  3REB B;  1ZBJ A;  2D1X A;  1MV3 A;  2C0T A;  4CC4 B;  1M30 A;  1PKS A;  2LQN A;  3KFV A;  2H8H A;  2DNU A;  5IH2 A;  2L0A A;  1UEC A;  1HD3 A;  3ULR B;  1SHF A;  2DLP A;  3RNJ A;  1X6G A;  2AKL A;  1B3Q A;  4JZ3 A;  2RPN A;  3EG2 A;  2CUB A;  2GTJ A;  1JXM A;  3EHR A;  2F2W A;  4K11 A;  2K6D A;  2L3P A;  3I5S A;  1VYV A;  1PRM C;  2NUZ A;  2JTE A;  4HCK A;  1S1N A;  2HEQ A;  1K9A A;  1SRL A;  1QWF A;  1E6H A;  1ZUY A;  5IHI A;  3RBB B;  4HVV A;  1V1C A;  2KYM A;  2RQU A;  1UG1 A;  2MCN A;  5FWC A;  2FPF A;  2F2V A;  4J9D A;  2L2P A;  2CH4 W;  2AK5 A;  4AFQ C;  1M3C A;  2GQI A;  2YUP A;  2OAW A;  1NLP C;  1K0X A;  3VS4 A;  4RTU A;  3M0R A;  1NYG A;  1GBQ A;  1RI9 A;  4J9C A;  2DX1 A;  1HSQ A;  1YN8 A;  1AEY A;  5IXF A;  3NHN A;  1I1J A;  2K2M A;  2VWF A;  1TUC A;  4X1V A;  1AD5 A;  1NEG A;  1JU5 C;  3M0P A;  5GJV B;  1YP5 A;  2DL7 A;  2K79 A;  1VA7 A;  1UE9 A;  2SEM A;  1SPK A;  2KRO A;  2B86 A;  1PRL C;  1W70 A;  1WXT A;  4WCI A;  2F2X A;  3UA6 A;  2ENM A;  5HCK A;  5ECA A;  3M0Q A;  2EGA A;  5I22 A;  1ABO A;  2ECZ A;  2M0Y A;  1J3T A;  1OV3 A;  2KNB B;  4LUD A;  2DBK A;  1YNZ A;  4M4Z A;  1GFC A;  1X43 A;  1QKW A;  2A37 A;  2DM1 A;  2JS0 A;  4JJB A;  2RN8 A;  1YWP A;  2HBW A;  1WFW A;  3VS7 A;  2IIM A;  5IHK A;  1BB9 A;  2FPD A;  2DBM A;  3NMZ C;  2DMO A;  2ESW A;  2LNH B;  4RTT A;  1AZG B;  3QWX X;  2DL8 A;  1G2B A;  2MOX A;  3UF4 A;  1WA7 A;  1OOT A;  3VS5 A;  2BZ8 A;  1X6B A;  3FJ5 A;  1RLP C;  2PTK A;  2DYB A;  2YUN A;  2CT3 A;  2KRM A;  3SHW A;  2EKH A;  2FO0 A;  3EG3 A;  2KR3 A;  2L3S A;  2KRS A;  2O9S A;  3H0F A;  1AWO A;  4CC7 A;  3I35 A;  1NLO C;  4AG2 C;  1FYN A;  1GL5 A;  1LCK A;  1JEG A;  2E5K A;  4E6R A;  1NYF A;  3C0C A;  2EYY A;  1OPL A;  1GFD A;  2O2O A;  1KSW A;  3PVQ A;  3NGP A;  2ED0 A;  2YSQ A;  2BZY A;  4OMO A;  3A98 A;  2JXB A;  1GBR A;  1E7O A;  2KXD A;  2DL3 A;  1I0C A;  2LJ3 A;  1B07 A;  2DA9 A;  1Z9Q A;  1OEB A;  4F14 A;  4AFU C;  1CKA A;  2AZS A;  3IQL A;  2O31 A;  1UHC A;  2PNI A;  1JQQ A;  3M0T A;  4J9G A;  1ABQ A;  1U06 A;  1KIK A;  2GBQ A;  2SRC A;  2J6O A;  1UJY A;  4JJC A;  2YDL A;  4CC2 A;  2KT8 A;  1UDL A;  4LN2 A;  3QWY A;  4Y92 A;  1YCS B;  2J6F A;  1K4U S;  4Z89 A;  1GRI A;  2K3B A;  3VRZ A;  2W0Z A;  4HXJ A;  3EHQ A;  4J9F A;  2K7A A;  2CUD A;  2EYZ A;  2V1R A;  4RUG A;  2BZX A;  2JMA A;  5IXB A;  1WYX A;  3TSW A;  4D8D A;  1AZE A;  2J05 A;  2D8H A;  5EC7 A;  1T3S A;  4F16 A;  1PWT A;  1KJW A;  2DL5 A;  1GCQ C;  4R0K A;  2O9V A;  4RTY A;  4J9B A;  4Z88 A;  1H92 A;  2JM9 A;  1K0S A;  3REA B;  2JS2 A;  2X3X D;  2PZ1 A;  1SRM A;  3PE0 A;  5I11 A;  2LX7 A;  1GCP A;  3I9Q A;  1QCF A;  1ARK A;  2KRN A;  2KBT A;  2LMJ A;  1AWJ A;  2FRY A;  1SSH A;  2CRE A;  4HVW A;  2RF0 A;  4Z8A A;  1N5Z A;  1AVZ C;  1Y57 A;  2XMF A;  1BU1 A;  1WDX A;  3H0I A;  1EFN A;  4QT7 A;  1WIE A;  4DEX A;  2HCK A;  4JPB W;  3JV3 A;  3NPF A;  3VS0 A;  2LJ1 A;  3VS3 A;  1NM7 A;  1SHG A;  4GLM A;  3ZL7 C;  1QWE A;  1Y0M A;  5L23 A;  3UAT A;  2EVR A;  2JW4 A;  1U5S A;  1WXB A;  1AOJ A;  4EIK A;  2ABL A;  2LZ6 B;  1M27 C;  1YWO A;  2RQV A;  2RMO A;  2KT1 A;  1TUD A;  4GBQ A;  3VRY A;  2AZV A;  1M3B A;  1PNJ A;  3O5Z A;  1U3O A;  2A28 A;  1UGV A;  1UHF A;  2O88 A;  2ED1 A;  5FW9 A;  2C0O A;  4OMM A;  2KE9 A;  3EGU A;  1ZX6 A;  1W6X A;  2MIO A;  2FPE A;  1X27 A;  4ZNX A;  4AG1 C;  4J9E A;  1JO8 A;  2EYX A;  2X3W D;  2KXC A;  3M0S A;  2OJ2 A;  1FMK A;  2CT4 A;  1PHT A;  2CH4 A;  2DVJ A;  1ZUU A;  3THK A;  1CKB A;  1A0N B;  1M3A A;  1MV0 B;  1E6G A;  2EGE A;  2CSQ A;  1I07 A;  2OI3 A;  3R6N A;  1H8K A; 
#chains in the Genus database with same CATH topology
 2IPO B;  2X4Y A;  2P84 A;  3CBM A;  2XK0 A;  4RTW A;  2KQW A;  2Y4Y A;  3UA7 A;  3E9G A;  3CXC P;  3CCS T;  1JJ2 P;  1YJW Q;  2CDT A;  4AFS C;  2JMC A;  3JCM h;  3LGF A;  2GFA A;  1WXU A;  1X01 A;  1XTD A;  1XOV A;  3AT1 B;  2ZPF B;  3ER0 A;  4FSS A;  1I81 A;  2O4X B;  3VUB A;  4OMQ A;  2QDL A;  1WZO A;  5GMK m;  2C0I A;  1G3Y A;  2AKK A;  3MKD A;  2J06 A;  2K5F A;  4QQ6 A;  5CKF A;  3JAM E;  2BE7 D;  3M0U A;  3H41 A;  2ZAE A;  4C8Q E;  3TRE A;  2HQX A;  3PGG A;  3CCJ Q;  1N9S A;  3OB9 A;  1YI2 Q;  4M78 B;  2RQT A;  2OTJ T;  4D8K A;  1M1K U;  2BKD N;  1VIF A;  1Q7Y C;  3FIF A;  4RTX A;  3H0H A;  2YLB A;  4NS5 A;  2ZPB B;  3UPU A;  5CKH A;  3CPW A;  1Q81 C;  4ELZ C;  3LWI A;  3CCE T;  2QA4 Q;  1Y7X A;  2ATC B;  3V8L A;  4C5I A;  4J8O A;  2DJQ A;  3ZBD A;  4ORZ A;  1OPK A;  3CPF A;  5LJ5 f;  3V8J A;  2FEI A;  1M2V B;  3TQ7 P;  4C92 D;  1W2B S;  3CBP A;  3VS6 A;  5GAM d;  1NG2 A;  4M78 E;  3CME T;  2CP2 A;  3CCR Q;  2YRV A;  1MMA A;  1ZSZ B;  2LP5 A;  3JSC A;  2NWM A;  4IKF A;  4DOW A;  2DE0 X;  3PFS A;  4BDY A;  1UFF A;  2DIQ A;  2KGT A;  1T0H A;  1YHQ T;  3X24 B;  4IIM A;  4DBH A;  3REB B;  3QJ6 A;  4FU6 A;  5IT9 E;  3CCU Q;  2QEX A;  3UWN A;  3FB9 A;  2RI2 A;  3KFV A;  1VQ5 Q;  4KBM B;  3M55 A;  5I2S A;  3CCM A;  1M1K R;  3G1J A;  3OMC A;  3OYE A;  3BFM A;  4M78 G;  2DLP A;  4PJJ A;  1I5L A;  1UGR B;  2MF2 A;  2RJE A;  3MP6 A;  3LYI A;  1JXM A;  3N5B B;  3HKS A;  2BUD A;  4L6V 5;  2NUZ A;  2JTE A;  1S1N A;  4C92 E;  1FMW A;  3PMI A;  1VQO T;  1YBY A;  1QWF A;  1E6H A;  3RBB B;  2HAX A;  3NTH A;  2RQU A;  1BI0 A;  3M4Y A;  2F2V A;  4J9D A;  3DB4 A;  2RJF A;  2L2P A;  3H6Z A;  4AFQ C;  4M75 G;  2QQR A;  4IUP A;  1HSQ A;  2DVE A;  2EJG A;  2FZG B;  2XG8 D;  2WSF E;  2ZPI B;  3OBY A;  3CCU A;  4JS5 A;  1RAC B;  2HSE B;  2G3R A;  2O01 E;  3C95 A;  1QCN A;  4XQ3 A;  1NEG A;  2XD0 A;  4M7D D;  1YP5 A;  2DL7 A;  3OA6 A;  1KQ1 A;  1UE9 A;  4PLL A;  3I56 A;  3OYN A;  2F2X A;  2E6N A;  3CEY A;  2E1H A;  3CC2 A;  2ENM A;  1OZ2 A;  3M0Q A;  3OYA A;  2ECZ A;  3VU3 C;  4LDV A;  2DBK A;  1YNZ A;  4LUD A;  1GFC A;  2COW A;  3G4S T;  1QKW A;  2EQM A;  1M1F A;  2DM1 A;  3QUI A;  1YHQ Q;  1NE8 A;  2QQ9 A;  3NMZ C;  4F7U A;  3G6E T;  2ESW A;  3MEA A;  1LOJ A;  2MOX A;  1G2B A;  4ATO A;  3FJ5 A;  2X51 A;  3CMA A;  1RLP C;  5EG2 A;  3CCJ A;  2QA4 A;  2YUN A;  1XNI A;  2CT3 A;  4JDS A;  1GXI E;  3SHW A;  4DBF A;  3E19 A;  4LDW A;  2P4T A;  3GNF B;  2KRS A;  3MET A;  2K3X A;  2O9S A;  4CC7 A;  4E7Z A;  2LT1 A;  5GAN 5;  1VQL T;  3QKJ A;  2K2V A;  4AG2 C;  2MWP A;  1XQH A;  9ATC B;  2HQE A;  4XTW A;  4M7A C;  1D1B A;  4E6R A;  1IRX A;  4XAX B;  2M02 A;  2EYY A;  2CZ0 B;  3GP8 A;  1YFN A;  8ATC B;  4FL6 A;  5LJ3 f;  2L89 A;  3CCS A;  3NGP A;  4OMO A;  3OYM A;  4C5G A;  2VXF A;  2KXD A;  3OYB A;  1YJN Q;  4DBR A;  1N8R U;  1B07 A;  1OU8 A;  1Z9Q A;  3H8Z A;  3QXE B;  3CPW P;  3SD4 A;  5LJ3 h;  3IQL A;  2XIC A;  4LDX A;  4A4E A;  3O8V A;  4ZGJ B;  1ABQ A;  4EMK C;  3G7Z A;  1O9S A;  2J6O A;  1WQ7 A;  4JJC A;  4JRK A;  4CC2 A;  3OYK A;  1Q82 U;  4PJO B;  1YCS B;  2RHZ A;  2J6F A;  3RUX A;  1KC8 R;  4ELY C;  5GAM j;  4O6J A;  2K3B A;  3JCM e;  4HXJ A;  3S3N A;  2K7A A;  2CUD A;  1VQO Q;  4M7D A;  5LJ5 h;  1M90 R;  2J05 A;  2D8H A;  3ASK A;  4C0D B;  1GCQ C;  1B34 B;  1RL2 A;  4J9B A;  3RKY A;  1H92 A;  2E41 A;  2JM9 A;  1YIJ T;  1K8A C;  1K0S A;  2DZC A;  1SRM A;  2A0F B;  3GPL A;  1HK9 A;  2LX7 A;  4N4I A;  1GCP A;  1Q7Y R;  4F04 B;  1QCF A;  5HKC A;  2MI6 A;  1ARK A;  1IXD A;  3SWN C;  5DLO A;  2LMJ A;  1KD1 C;  1QCO A;  4IUR A;  2CRE A;  4Z8A A;  1F1B B;  2MMP A;  3CD6 A;  4X9C A;  4NL2 A;  1BCM A;  5LL6 S;  3H0I A;  1EFN A;  1IHW A;  5A0L A;  1WIE A;  2Y4X A;  1VQ6 A;  3OBW A;  1M90 U;  4JPB W;  2YRC A;  2ZGW A;  4OGE A;  4JRI A;  4BE2 A;  4NL3 A;  4GLM A;  3OYL A;  4C92 G;  1KQS A;  1QWE A;  4XU1 A;  3JCM P;  4M7A A;  3JCM X;  1VQ8 T;  1WXB A;  2EJF A;  3LH0 A;  1PCX A;  4X9D A;  3G4S A;  1M27 C;  2RQV A;  1U8R A;  3I55 A;  4GBQ A;  2QYZ A;  3CCV A;  1M3B A;  4PNO A;  2DKG A;  1B34 A;  1IZ6 A;  2QDY B;  2C0O A;  4M77 C;  3CC2 Q;  2MIO A;  2QQA A;  5GMK l;  2RA2 A;  1TSF A;  3PNW C;  3MP1 A;  3M0S A;  4RG2 A;  2OJ2 A;  2CT4 A;  1M2V A;  1LVK A;  1Y71 A;  4KGZ B;  2YRD A;  2LC4 A;  1BI1 A;  5J3B A;  1I07 A;  4MZM A;  1H8K A;  1G3W A;  4EMH A;  2VAS A;  4OF1 A;  4ZN1 A;  1LPL A;  4F7U G;  3HFO A;  1CSK A;  4KH0 B;  3OSS C;  3E2U A;  2YHT A;  3JB9 D;  4B9W A;  1WHJ A;  2MK5 A;  3DB3 A;  2DZ9 A;  2P0Q A;  2LDM A;  4HVU A;  1YJ9 T;  4M7D G;  2QI2 A;  2RK1 A;  2CSI A;  2YUQ A;  5FU7 C;  2OTL T;  3EFO A;  3FEO A;  1RUW A;  3VV0 A;  2K9G A;  5GAO m;  4DQ2 A;  2QQB A;  1PSF A;  2A36 A;  4HCB A;  2FG0 A;  2GNC A;  3PIO A;  3L2R A;  3HPW A;  1MMN A;  1RAG B;  1ZSG A;  5C6S A;  1G83 A;  2D0N A;  3SEM A;  5IHN A;  4RTV A;  4B6M A;  2DL4 A;  4A4H A;  4TVR A;  2OTL A;  4E7H A;  2ZPH B;  2F5K A;  5IAY A;  1ZLM A;  4E7K A;  1VQ4 A;  3I5R A;  1SEM A;  3LWH A;  3LW5 E;  4M78 D;  3E1S A;  4M75 B;  4L59 A;  1OI1 A;  1VQM Q;  2CP6 A;  2DRM A;  1RLQ C;  3CCQ A;  5CCA A;  2AT1 B;  1X2K A;  1RAA B;  1VYT A;  3CME A;  5GAM e;  2DF6 A;  1VIE A;  2H3J A;  3G71 T;  4IIO A;  2JNG A;  3CCL A;  3OY9 A;  5J26 A;  2D8J A;  1TXQ A;  4CC3 A;  2A08 A;  2FRW A;  4M78 A;  5GAN f;  3Q1J A;  4PFP A;  2XU8 A;  1RAE B;  4A4G A;  5GMK i;  1RAB B;  2LCS A;  4DA4 A;  2F69 A;  4OMN A;  1H3H A;  4HA8 A;  2RI3 A;  1PC0 A;  1VYU A;  2JT4 A;  1HYO A;  5FRO A;  2JM8 A;  2EW3 A;  3LGL A;  3OYJ A;  2WAC A;  4J9H A;  1PM3 A;  4ESR A;  1WHM A;  1K73 C;  1WLP B;  2K57 A;  4E7S A;  2YLC A;  2CP5 A;  1UTI A;  1AWW A;  4KRT A;  5KYY B;  3OS1 A;  2RNA A;  1G3T A;  1X75 C;  4A4F A;  1NJI C;  1M30 A;  2OTJ A;  2DNU A;  3V7C A;  5HK3 A;  4PJO D;  3L2Q A;  4C92 B;  1M5Q 1;  4HT9 A;  2CZ7 B;  2GFU A;  1HD3 A;  4M75 F;  3ZEH A;  4XTV A;  1VQL Q;  3RNJ A;  4QKU A;  1U1S A;  4ZGD B;  2DER A;  4M7D F;  5AT1 B;  2RPN A;  1EX4 A;  2NLU A;  2F2W A;  1FXX A;  3F70 A;  1PRM C;  1QQJ A;  5LJ5 j;  4N0A C;  3A5Z B;  4OVA A;  1AHJ B;  3DLL A;  1SRL A;  2X35 A;  1Q82 C;  5IHI A;  2PU9 B;  3JB9 F;  1C6V X;  5FWC A;  1D3B A;  1K9M R;  4HKE A;  5KYN A;  1K9M U;  1BYM A;  2YUP A;  1K0X A;  3VS4 A;  1JRI A;  1OQK A;  2K3Y A;  1NYG A;  1GBQ A;  2DO3 A;  1M90 C;  4M77 F;  4RCB A;  5IXF A;  1QVF P;  2DIG A;  3NHN A;  1MNE A;  3VUZ A;  2VWF A;  3CCV T;  2M1H A;  4BD3 A;  4Y28 E;  4BUG A;  3JB9 I;  4NOY A;  3MEV A;  4M7A D;  3VYH B;  1VQP Q;  1D0X A;  1SPK A;  2KRO A;  2KI7 A;  3EAE A;  1WQW A;  1WXT A;  4WCI A;  1LNX A;  1S72 Q;  2EFI A;  1IB8 A;  2XI9 A;  2EGA A;  1ABO A;  3GIB A;  1TUG B;  2IVW A;  5GAN e;  3WVE B;  4M4Z A;  1X43 A;  2GCX A;  4M7D B;  1VQ7 T;  1YWP A;  2HBW A;  5IHK A;  3LX7 A;  2FPD A;  2DMO A;  4RTT A;  3QYH B;  3UF4 A;  1WA7 A;  3VS5 A;  3VJP A;  2HBP A;  4UC4 A;  3HRS A;  2KRM A;  3WXM B;  4EDU A;  2E64 A;  3UDC A;  2AHJ B;  2LVM A;  3I35 A;  1NLO C;  5L8R E;  3OS0 A;  1FYN A;  3M54 A;  1GL5 A;  1OU9 A;  3OYH A;  4LXC A;  3VYG A;  1LCK A;  1JEG A;  1V29 B;  5FU6 C;  2VB6 A;  4XTY A;  1M9S A;  5A0G A;  2LCL A;  4KUI A;  4JRP A;  1WGS A;  1KSW A;  3RKX A;  1Y96 B;  5CKB A;  2ED0 A;  1PG5 B;  2FZC B;  1GBR A;  1UGS B;  1E7O A;  1W2B P;  1FX7 A;  2QGG A;  4YTL A;  4FYW B;  4RMO A;  1VQ5 A;  2QGF B;  1RAD B;  3BE3 A;  3FDR A;  4IUQ A;  3HTR A;  5KYX A;  3I55 Q;  4M75 D;  3JB9 G;  4XK8 E;  1VOM A;  2HNI A;  3CXC A;  1JJ2 A;  1TU0 B;  4PJO G;  1NPR A;  2WSE E;  4B9X A;  2A3L A;  2ZPE B;  2DD5 A;  4Y92 A;  4Z89 A;  1ACM B;  2EQJ A;  3D7S B;  1GRI A;  4FW2 A;  3VRZ A;  1YIT T;  3EHQ A;  3NTI A;  1O75 A;  2E4H A;  4CI0 C;  3JCM J;  2V1R A;  2JMA A;  4V2S A;  2OTJ Q;  1XJW B;  4MZP A;  1HXD A;  5GAM f;  2QEX Q;  1WHH A;  4F7U E;  4OB2 B;  5A0D A;  2D9T A;  3QII A;  4E47 A;  3A8L B;  2X4X A;  2OX7 A;  1K73 R;  4R0K A;  3EH2 A;  2O9V A;  4RTY A;  1TOV A;  3V8K A;  1YI2 A;  3MPU B;  1Y96 A;  3QYG B;  3REA B;  2E10 A;  2PZ1 A;  4XU2 A;  1TWB A;  4C92 F;  2DXB A;  3I9Q A;  1N8R R;  3RMS A;  2KRN A;  4Y91 A;  5LJ5 e;  3SB2 A;  5KYX B;  1OX8 A;  3G6E A;  4PKC C;  1H3Z A;  1SSH A;  3SWN A;  2RF0 A;  3QZ9 B;  4KUD K;  3CC7 T;  1BU1 A;  2QTX A;  1S72 T;  3M53 A;  3JV3 A;  2PUO B;  3PIP A;  3JB9 H;  3VS0 A;  3VS3 A;  2JOY A;  3RKW A;  1VQN T;  3KBG A;  2CGH A;  5CQY A;  5LJ3 e;  4C0D C;  4XU0 A;  1KG1 A;  1VUB A;  5GAN 6;  1M4Z A;  1YJW T;  2YXY A;  2L8D A;  4A4K A;  1KHI A;  2ABL A;  1QMC A;  1K9M C;  3BDU A;  3VKI A;  4ANJ A;  2AIR B;  1G8X A;  1TUD A;  1EIF A;  4EMG A;  1U3O A;  3URG A;  3OYC A;  2LQ8 A;  2DTI A;  1IGQ A;  5GAO l;  4PJO C;  1W6X A;  5CK9 A;  4ZNX A;  4PJO F;  5DY9 A;  2X9H A;  1JO8 A;  2Z0W A;  3OQ5 A;  1KHC A;  1OX9 A;  2X3W D;  4FCY A;  4BY6 B;  1PHT A;  3UT1 A;  2DVJ A;  1ZUU A;  3NTK A;  3THK A;  1A0N B;  3MEU A;  2CKK A;  1M3A A;  1MV0 B;  2EGE A;  2CSQ A;  3M57 A;  5GAN 3;  5KH6 A;  2DRK A;  2JTM A;  2YUO A;  3J80 E;  4RCC A;  1AWX A;  3CCS Q;  3L1A A;  2HL3 A;  1M8M A;  3C12 A;  1Z9Z A;  1QP2 A;  3A8M B;  4OML A;  3LLR A;  1D0Y A;  2VYT A;  2B8A A;  4C5H A;  2VC8 A;  3EGX A;  2GGR A;  3FJP A;  2M51 A;  3I55 T;  2JTF A;  3X28 B;  1KC8 U;  3HRT A;  4KGX B;  4HCZ A;  3TVT A;  1FMV A;  2EBP A;  3EGD B;  1B7T A;  3S6W A;  4AFZ C;  2BE9 B;  2EQU A;  1N6A A;  3CME Q;  1W1F A;  3M4G A;  2G6F X;  3GBQ A;  3CCM Q;  1YI2 T;  3M58 A;  3A8O B;  4JJD A;  5KYY A;  4R55 A;  1Q86 R;  3CQT A;  2R57 A;  3EG0 A;  4J7F A;  5GAN 7;  1YHQ A;  5KYW A;  4J9I A;  5GJW B;  4BI4 A;  2W10 A;  1NBE B;  1NZ9 A;  1ZSZ A;  2QXF A;  2RJC A;  3VS1 A;  2RO0 A;  1NEB A;  1JXO A;  1YJN T;  4AT1 B;  1D09 B;  3J81 E;  4FYX B;  2QTV A;  2ROL A;  2RQW A;  2RQR A;  3LH5 A;  1WI7 A;  4OMP A;  3OYY A;  1ZBX A;  2XHC A;  1BBZ A;  3PMT A;  4JZ4 A;  4E7L A;  1T0J A;  4X34 A;  2E3I A;  2HSP A;  2L3Q A;  5D6Y A;  1BI3 A;  2P4R A;  2XKO C;  3MP8 A;  1D1C A;  3QZ5 B;  3EGD A;  3CCR T;  4DBQ A;  3JCM b;  3CCL Q;  3GOX A;  1UGP B;  1YIT A;  1ZA2 B;  2ZZD A;  4A63 B;  1D3B B;  3BDL A;  2HDA A;  4F7U F;  1UUE A;  2LNV A;  2DIL A;  2EIF A;  1VQ8 A;  1X2Q A;  4JS4 A;  2M0O A;  5GAN j;  1KQS S;  3CD6 T;  2EGC A;  1PKT A;  3I56 Q;  4QVZ A;  1Q86 C;  3H9N A;  2JN0 A;  2I0N A;  4E7J A;  1K76 A;  1ZBJ A;  2D1X A;  1MV3 A;  2C0T A;  4C8Q F;  3SFM A;  4JUV A;  1VQ5 T;  1PKS A;  3X25 B;  1I8F A;  2H8H A;  5DLQ E;  2L3R A;  3CC4 T;  1YJN A;  4JRQ A;  3CC4 Q;  1RAI B;  2GF7 A;  3P8D A;  2CS7 A;  4M77 G;  1UEC A;  3L2W A;  2ZCF B;  3ULR B;  5CR2 A;  1TH7 A;  1X6G A;  2AKL A;  1B3Q A;  4JZ3 A;  1VQ7 A;  2CZ6 B;  1M8V A;  1NJI R;  3EG2 A;  3JCM f;  2E5Q A;  1WPY A;  2A7Y A;  3RDV A;  2K6D A;  3CCJ T;  5CKE A;  4ZGE B;  2L3P A;  5GAN g;  1VYV A;  2K5L A;  3INZ A;  4HCK A;  2HEQ A;  3M9Q A;  4PK4 A;  1K9A A;  1QVG A;  1KQS P;  1UG1 A;  1LJO A;  2FPF A;  4MML A;  4LDU A;  4C92 A;  5GAO n;  5C0M A;  2CH4 W;  2AK5 A;  1M3C A;  1C1A A;  2OAW A;  1NLP C;  1OZ3 A;  3M0R A;  4M75 C;  3OYD A;  1RI9 A;  4J9C A;  2DX1 A;  5GAN 8;  1ZSZ C;  3JRZ A;  1AEY A;  2CP7 A;  4OB1 B;  2KAF A;  4BI3 A;  3CCR A;  2K2M A;  4PFO A;  1TUC A;  4FT2 A;  1JU5 C;  3AHU A;  2QQS A;  2K79 A;  4WTO B;  2DEU A;  1K8A R;  3RMQ A;  2SEM A;  4FW1 A;  1PRL C;  1M2O A;  3CCL T;  1QVG P;  2COY A;  1KD1 U;  5ECA A;  2E12 A;  1QW1 A;  5I22 A;  3MEW A;  2LT4 A;  1VQN Q;  2QAS A;  1W4S A;  1OV3 A;  2KNB B;  2DXC A;  2WSC E;  4KH1 B;  7AT1 B;  3PTA A;  3P8B B;  1D1A A;  3QJY A;  1ZA1 B;  3CD6 Q;  2NUT B;  4QQD A;  2DPP B;  4R56 A;  2A37 A;  2H3E B;  4JJB A;  2XID A;  2RN8 A;  3OW2 A;  3RER A;  1WFW A;  3G6E Q;  2DBM A;  1VQO A;  3S3O A;  1YIJ Q;  1OOT A;  2XDB A;  2BZ8 A;  2C06 A;  2PTK A;  1R8O B;  2FO0 A;  6AT1 B;  3EG3 A;  2OAU A;  2KR3 A;  2L3S A;  3NFC A;  2LQK A;  3H0F A;  1AWO A;  5LJ3 d;  2FZK B;  3ZFJ A;  2K5I A;  4IUT A;  1VQ4 Q;  3SWN B;  3BW1 A;  1VQK Q;  1Q81 U;  2CP0 A;  5GAN 4;  3MO8 A;  2P0P A;  2E5K A;  1SF9 A;  2MYS A;  3CXC S;  1JJ2 S;  1NYF A;  3C0C A;  3GF5 A;  4M77 B;  2MPX C;  3JB9 J;  3X20 B;  5D6X A;  3OMG A;  1R77 A;  3I56 T;  3JCM V;  2R58 A;  4FT4 A;  2BZY A;  2DD4 A;  2RHI A;  3HL8 A;  4C8Q G;  1I0C A;  1SKU B;  2LJ3 A;  4F14 A;  4XTX A;  1TTH B;  4II1 A;  4PFZ A;  1CKA A;  1WHL A;  1H64 1;  4BB7 A;  2FL7 A;  2O31 A;  5GMK j;  3OSV A;  1UHC A;  1JQQ A;  3M0T A;  4J9G A;  3A8G B;  1U06 A;  2JUF A;  1MND A;  1UJY A;  2YDL A;  2KT8 A;  1UDL A;  4J83 A;  5KE2 A;  1K4U S;  2V26 A;  3G71 A;  4EMK B;  2KDS A;  2W0Z A;  2DFU A;  4C0Z A;  4M77 E;  4RUG A;  2BZX A;  4N0A A;  4P5N A;  1N27 A;  8AT1 B;  4MZT A;  1WYX A;  3TSW A;  3HHT B;  4D8D A;  2RHY A;  2E70 A;  3CC7 A;  1T3S A;  2HZY A;  1KJW A;  4C8Q C;  1KD1 R;  2E65 A;  2DEQ A;  3M59 A;  4M77 D;  5HK0 A;  3GNG A;  3OYI A;  4M7A F;  2DJZ A;  2JS2 A;  2X3X D;  4M7A B;  3CCQ Q;  3PE0 A;  3QHS A;  2VXE A;  1R0B G;  3L2V A;  5DM7 R;  2V8I A;  4ZTJ A;  5KE3 A;  3RIR A;  2KBT A;  4N4H A;  1AWJ A;  2FRY A;  2ZPG B;  3RES A;  1N5Z A;  1AVZ C;  3RR6 A;  1Y57 A;  4Z02 A;  1WDX A;  4M7D C;  2HL5 C;  5D7U A;  2DET A;  4PLI A;  2HCK A;  1KQ2 A;  3QG1 A;  3NPF A;  3KXT A;  4VUB A;  2RHX A;  3E9F A;  4C8Q A;  1M1G A;  3JCM d;  1YJ9 A;  4PJO E;  1ZQ1 A;  3EG9 B;  4RKU E;  2JW4 A;  2VUB A;  1AOJ A;  4E2F B;  4EIK A;  2LZ6 B;  3EGX B;  2PQW A;  1YWO A;  3V7S A;  2RMO A;  2KT1 A;  3QO3 A;  4QVD A;  3VRY A;  4M7A E;  1PNJ A;  3O5Z A;  1BIB A;  1UGV A;  2O88 A;  5M9O A;  2KY9 A;  2FVU A;  5FW9 A;  5FRM A;  1WJQ A;  1ZHI A;  2KE9 A;  3EGU A;  2FPE A;  1X27 A;  4J9E A;  2HD0 A;  2EYX A;  1BCO A;  4BI8 B;  2KXC A;  4J5Y A;  2CH4 A;  2X4W A;  2DXT A;  5J39 A;  4DOV A;  2DTO A;  2JVV A;  2FHD A;  1VQK A;  1E6G A;  2OI3 A;  4F17 A;  4BY6 C;  1NPP A;  2EPD A;  1PD1 A;  2EYQ A;  3TEE A;  2EYW A;  3R6O A;  4FYV B;  4O5V A;  2RHU A;  2GTO A;  2QK0 A;  1TS9 A;  2COZ A;  3EFO B;  3DKM A;  4RG8 A;  3T9N A;  3TCJ A;  2BTT A;  3BY7 A;  2PVO B;  1GCQ A;  4OP0 A;  2KMT A;  3A8H B;  2YT6 A;  3U23 A;  2F1L A;  4LE9 A;  1SSF A;  4LNP A;  4LUE A;  3FC3 A;  2ROT A;  5GAM g;  2KEA A;  2HKQ B;  5GAO p;  1OYX A;  3C94 A;  1QVF A;  2LQW A;  1K1Z A;  2PUK B;  1WX6 A;  4KUL A;  2LTO A;  1ZUK A;  2EQI A;  5LJ3 j;  1YIJ A;  2D0Q B;  2HKN A;  5GAN 2;  2CZ1 B;  4C5E A;  2VVK A;  1KFZ A;  2VKN A;  2GQV A;  4D6W A;  1Y07 A;  2LCC A;  5GMK e;  4C0F A;  4QQG A;  2EKO A;  3QDF A;  3X26 B;  2J7I A;  4E7I A;  4BAC A;  2M16 A;  4DEY A;  1NJI U;  5KCH A;  1IO6 A;  3G71 Q;  2KYB A;  3CC2 T;  3TSZ A;  3CMA Q;  1BK2 A;  5FWB A;  2O4X A;  2VGM A;  4RTZ A;  1VQP A;  2EJ9 A;  1T3L A;  1K8A U;  1TG0 A;  2PVD B;  3EG1 A;  1QKX A;  1IGU A;  2RI5 A;  5KYW B;  2V1Q A;  1VQ9 Q;  1BIA A;  3CPW S;  4M75 A;  3VS2 A;  1X69 A;  1MUZ A;  4OB3 B;  1UJ0 A;  3FRN A;  4HT8 A;  3PVL A;  5GAN h;  5CKD A;  1QLY A;  3HFN A;  5I21 A;  1HJD A;  2J6K A;  2KVQ G;  2LJ0 A;  1VQM A;  3C4S A;  4J6W A;  1G5V A;  1WNL A;  1FWZ A;  4CC4 B;  1YCY A;  4M78 C;  2LQN A;  4ME7 A;  3HP9 A;  5CO7 A;  5IH2 A;  5FRN A;  2L0A A;  3P8H A;  3L2U A;  2FB7 A;  2L5Q A;  1SHF A;  4FM4 B;  4QVC A;  4Q5W A;  1EZZ B;  2CUB A;  2GTJ A;  3EHR A;  4K11 A;  4JJN K;  5LJ5 g;  1WHG A;  2RM4 A;  3CC4 A;  3I5S A;  2KSS A;  3M56 A;  3M5A A;  5KYU B;  1VQ9 A;  4GY5 A;  1Q95 G;  1ZUY A;  4HVV A;  1V1C A;  2KYM A;  2MCN A;  3CBO A;  2XDD A;  4GLK A;  2CYZ B;  3HSB A;  1VQ7 Q;  1VQ8 Q;  2DAQ A;  3OW2 S;  4PL6 A;  2GQI A;  3SDZ A;  4KGV B;  4RTU A;  1R0C B;  2DTH A;  4IUV A;  3OS5 A;  4J6Y A;  5GMK h;  1KC8 C;  1YN8 A;  1WJR A;  3JCM g;  2FYK A;  1I1J A;  4JLI A;  1DJ7 B;  4FSX A;  1QP3 A;  3CCV Q;  2EAY A;  4X1V A;  1AD5 A;  2E6Z A;  3M0P A;  5GJV B;  4FIB A;  5CQX A;  2V8J A;  4M75 E;  4QW2 A;  2JZ2 A;  1VA7 A;  1WJS A;  4ZTF A;  2B86 A;  1VQ4 T;  1C0M A;  1W70 A;  4FYY B;  4M78 F;  3UA6 A;  5HCK A;  4J7I A;  5IN1 A;  3MJX A;  2M0Y A;  2RD1 A;  1MGQ A;  1J3T A;  5FU6 B;  3OW2 P;  3JCM Q;  2QG9 B;  5KCO A;  2RJD A;  5KYU A;  2VGN A;  4WF2 A;  1PD0 A;  3ME9 A;  2JS0 A;  2EWN A;  3A1P A;  3OS2 A;  4M7D E;  3VS7 A;  2IIM A;  1K73 U;  1BB9 A;  1Q86 U;  2LNH B;  3EH1 A;  1AZG B;  1VQN A;  3QWX X;  2DL8 A;  4L5G A;  2XDP A;  3CCQ T;  1JB0 E;  1X6B A;  2NYS A;  2QA4 T;  1Q81 R;  3CMA T;  2DYB A;  3TU4 K;  2EKH A;  5I2M A;  5GAO q;  2F5T X;  3KUF A;  2DYI A;  3MCA B;  5GAM h;  5HY6 A;  4EMK A;  5LJ3 g;  2K4Y A;  4A53 A;  1UB4 A;  2I2L A;  5LJ5 d;  3HRU A;  4OMF B;  4A54 A;  1VQ9 T;  2NUT A;  3CCM T;  3DLM A;  3QDR B;  2EQK A;  4MDW A;  2BIV A;  1UGQ B;  4LD6 A;  2QEX T;  2HQH A;  2Y90 A;  1OPL A;  2CP3 A;  4XTU A;  2QAZ A;  2LX9 A;  1GFD A;  3MHX A;  4M7A G;  1RAF B;  2O2O A;  3PVQ A;  1U1T A;  1G3S A;  2VV5 A;  2YSQ A;  5GAN d;  3A98 A;  4OB0 B;  2JXB A;  4PJM A;  2YWW A;  2DL3 A;  2DA9 A;  4LDY A;  4CRI A;  3OYF A;  1N9R A;  3CCU T;  1OEB A;  1BI2 A;  4AFU C;  5CIU A;  2AZS A;  4JLG A;  4KT0 E;  1JBM A;  2PNI A;  2IG0 A;  1KIK A;  1BKB A;  2GBQ A;  2SRC A;  3V7R A;  1P92 A;  5AYF A;  2MAM A;  4M77 A;  4LN2 A;  1M1K C;  3QWY A;  4IUU A;  1VQP T;  4EPC A;  1I4K 1;  5FLX E;  1YJW A;  3QSU A;  2HMA A;  1VQ6 Q;  4J9F A;  2EYZ A;  4PJL A;  4C8Q B;  4C0G A;  1IRE B;  3EG9 A;  5CVI A;  5IXB A;  1RI0 A;  2PVG B;  2KK4 A;  1AZE A;  3G4S Q;  1W2B A;  5EC7 A;  3L42 A;  4XU3 A;  4F16 A;  3GLX A;  1PWT A;  4OGC A;  1WHK A;  4F7U B;  1D0Z A;  2DL5 A;  1YJ9 Q;  2E3H A;  4MDX A;  3EFS A;  4Z88 A;  1RAH B;  2RB6 A;  4J6X A;  2RK2 A;  4N4G A;  2P0K A;  5A2Q E;  1AT1 B;  3CCE Q;  1X6O A;  5I11 A;  1S72 A;  4PJN A;  3S3M A;  4C92 C;  2R5M A;  2NUP A;  2D6F A;  1PSE A;  2DXU A;  4BE0 A;  1SG5 A;  2LRQ A;  3JCM c;  4HVW A;  1V76 A;  3WVD B;  2XMF A;  4BDZ A;  1Q82 R;  4QT7 A;  3QBY A;  1VQ6 T;  2DK3 A;  1Q7Y U;  4DEX A;  4PJO A;  1UEB A;  5D6W A;  4BE1 A;  3PT9 A;  1N8R C;  3L2Z A;  3QPH A;  4XTZ A;  2LJ1 A;  1VQL A;  1NM7 A;  1SHG A;  1QVG S;  3ZL7 C;  1Y0M A;  5L23 A;  1KK7 A;  2RH2 A;  3UAT A;  2EVR A;  1U5S A;  1VQM T;  2M9U A;  3OYG A;  1QVP A;  1MHN A;  4LD9 K;  1IHV A;  5GAO r;  2AZV A;  2OTL Q;  1MMG A;  2A28 A;  5FU7 B;  1I5O B;  1MMD A;  1UHF A;  2X4J A;  5CAI A;  2ED1 A;  2V8K A;  4OMM A;  2MWO A;  3CCE A;  1ZX6 A;  4ZN3 A;  4AG1 C;  2JJ9 A;  3J7A F;  4C8Q D;  2NUP B;  1FMK A;  2R5A A;  1YIT Q;  3EFR A;  3CC7 Q;  4AMC A;  1CKB A;  1VQK T;  4HCC A;  1QVF S;  3JCM W;  3R6N A;  3FLG A;  4MMK A;  1OUL A; 
#chains in the Genus database with same CATH homology
 4F17 A;  2DRK A;  2YUO A;  1AWX A;  4RTW A;  2EPD A;  1CSK A;  3UA7 A;  2EYW A;  2CDT A;  1M8M A;  2GTO A;  4AFS C;  4HVU A;  2JMC A;  1Z9Z A;  1WXU A;  2CSI A;  2YUQ A;  4OML A;  1XOV A;  2BTT A;  1RUW A;  2GGR A;  1GCQ A;  4FSS A;  2M51 A;  2K9G A;  4OMQ A;  2YT6 A;  2QDL A;  2A36 A;  3U23 A;  2C0I A;  4LE9 A;  2AKK A;  2FG0 A;  2GNC A;  4LNP A;  2J06 A;  4LUE A;  2EBP A;  3TVT A;  2ROT A;  2KEA A;  4AFZ C;  3M0U A;  3H41 A;  1ZSG A;  1G83 A;  2D0N A;  2LQW A;  1K1Z A;  1W1F A;  3SEM A;  5IHN A;  2G6F X;  3GBQ A;  4RTV A;  2DL4 A;  1WX6 A;  2RQT A;  1ZUK A;  2EQI A;  4D8K A;  4JJD A;  2VVK A;  1KFZ A;  2VKN A;  3CQT A;  3EG0 A;  1ZLM A;  3I5R A;  4J9I A;  1SEM A;  4RTX A;  5GJW B;  2W10 A;  3H0H A;  3VS1 A;  1NEB A;  1JXO A;  2DRM A;  1RLQ C;  2J7I A;  4DEY A;  2ROL A;  2RQW A;  2RQR A;  1X2K A;  1VYT A;  1IO6 A;  2DF6 A;  2DJQ A;  2KYB A;  3LH5 A;  1WI7 A;  4OMP A;  4IIO A;  3TSZ A;  4ORZ A;  1BBZ A;  1OPK A;  4JZ4 A;  1BK2 A;  2D8J A;  5FWB A;  4CC3 A;  4RTZ A;  2A08 A;  2FRW A;  1T0J A;  1T3L A;  1TG0 A;  2FEI A;  2LCS A;  2HSP A;  3EG1 A;  2L3Q A;  1QKX A;  4OMN A;  1H3H A;  2P4R A;  3VS6 A;  1VYU A;  2JT4 A;  2V1Q A;  1NG2 A;  2LP5 A;  3VS2 A;  1X69 A;  1MUZ A;  2NWM A;  2DE0 X;  4A63 B;  1UJ0 A;  2JM8 A;  2EW3 A;  3PVL A;  2HDA A;  4J9H A;  1UUE A;  4ESR A;  1QLY A;  1UFF A;  2DIL A;  1WLP B;  1UTI A;  1X2Q A;  1AWW A;  2J6K A;  2LJ0 A;  4KRT A;  1HJD A;  2EGC A;  1PKT A;  2KGT A;  1T0H A;  2I0N A;  2RNA A;  4IIM A;  1K76 A;  3REB B;  1ZBJ A;  2D1X A;  1MV3 A;  2C0T A;  4CC4 B;  1M30 A;  1PKS A;  2LQN A;  3KFV A;  2H8H A;  2DNU A;  5IH2 A;  2L0A A;  1UEC A;  1HD3 A;  3ULR B;  1SHF A;  2DLP A;  3RNJ A;  1X6G A;  2AKL A;  1B3Q A;  4JZ3 A;  2RPN A;  3EG2 A;  2CUB A;  2GTJ A;  1JXM A;  3EHR A;  2F2W A;  4K11 A;  2K6D A;  2L3P A;  3I5S A;  1VYV A;  1PRM C;  2NUZ A;  2JTE A;  4HCK A;  1S1N A;  2HEQ A;  1K9A A;  1SRL A;  1QWF A;  1E6H A;  1ZUY A;  5IHI A;  3RBB B;  4HVV A;  1V1C A;  2KYM A;  2RQU A;  1UG1 A;  2MCN A;  5FWC A;  2FPF A;  2F2V A;  4J9D A;  2L2P A;  2CH4 W;  2AK5 A;  4AFQ C;  1M3C A;  2GQI A;  2YUP A;  2OAW A;  1NLP C;  1K0X A;  3VS4 A;  4RTU A;  3M0R A;  1NYG A;  1GBQ A;  1RI9 A;  4J9C A;  2DX1 A;  1HSQ A;  1YN8 A;  1AEY A;  5IXF A;  3NHN A;  1I1J A;  2K2M A;  2VWF A;  1TUC A;  4X1V A;  1AD5 A;  1NEG A;  1JU5 C;  3M0P A;  5GJV B;  1YP5 A;  2DL7 A;  2K79 A;  1VA7 A;  1UE9 A;  2SEM A;  1SPK A;  2KRO A;  2B86 A;  1PRL C;  1W70 A;  1WXT A;  4WCI A;  2F2X A;  3UA6 A;  2ENM A;  5HCK A;  5ECA A;  3M0Q A;  2EGA A;  5I22 A;  1ABO A;  2ECZ A;  2M0Y A;  1J3T A;  1OV3 A;  2KNB B;  4LUD A;  2DBK A;  1YNZ A;  4M4Z A;  1GFC A;  1X43 A;  1QKW A;  2A37 A;  2DM1 A;  2JS0 A;  4JJB A;  2RN8 A;  1YWP A;  2HBW A;  1WFW A;  3VS7 A;  2IIM A;  5IHK A;  1BB9 A;  2FPD A;  2DBM A;  3NMZ C;  2DMO A;  2ESW A;  2LNH B;  4RTT A;  1AZG B;  3QWX X;  2DL8 A;  1G2B A;  2MOX A;  3UF4 A;  1WA7 A;  1OOT A;  3VS5 A;  2BZ8 A;  1X6B A;  3FJ5 A;  1RLP C;  2PTK A;  2DYB A;  2YUN A;  2CT3 A;  2KRM A;  3SHW A;  2EKH A;  2FO0 A;  3EG3 A;  2KR3 A;  2L3S A;  2KRS A;  2O9S A;  3H0F A;  1AWO A;  4CC7 A;  3I35 A;  1NLO C;  4AG2 C;  1FYN A;  1GL5 A;  1LCK A;  1JEG A;  2E5K A;  4E6R A;  1NYF A;  3C0C A;  2EYY A;  1OPL A;  1GFD A;  2O2O A;  1KSW A;  3PVQ A;  3NGP A;  2ED0 A;  2YSQ A;  2BZY A;  4OMO A;  3A98 A;  2JXB A;  1GBR A;  1E7O A;  2KXD A;  2DL3 A;  1I0C A;  2LJ3 A;  1B07 A;  2DA9 A;  1Z9Q A;  1OEB A;  4F14 A;  4AFU C;  1CKA A;  2AZS A;  3IQL A;  2O31 A;  1UHC A;  2PNI A;  1JQQ A;  3M0T A;  4J9G A;  1ABQ A;  1U06 A;  1KIK A;  2GBQ A;  2SRC A;  2J6O A;  1UJY A;  4JJC A;  2YDL A;  4CC2 A;  2KT8 A;  1UDL A;  4LN2 A;  3QWY A;  4Y92 A;  1YCS B;  2J6F A;  1K4U S;  4Z89 A;  1GRI A;  2K3B A;  3VRZ A;  2W0Z A;  4HXJ A;  3EHQ A;  4J9F A;  2K7A A;  2CUD A;  2EYZ A;  2V1R A;  4RUG A;  2BZX A;  2JMA A;  5IXB A;  1WYX A;  3TSW A;  4D8D A;  1AZE A;  2J05 A;  2D8H A;  5EC7 A;  1T3S A;  4F16 A;  1PWT A;  1KJW A;  2DL5 A;  1GCQ C;  4R0K A;  2O9V A;  4RTY A;  4J9B A;  4Z88 A;  1H92 A;  2JM9 A;  1K0S A;  3REA B;  2JS2 A;  2X3X D;  2PZ1 A;  1SRM A;  3PE0 A;  5I11 A;  2LX7 A;  1GCP A;  3I9Q A;  1QCF A;  1ARK A;  2KRN A;  2KBT A;  2LMJ A;  1AWJ A;  2FRY A;  1SSH A;  2CRE A;  4HVW A;  2RF0 A;  4Z8A A;  1N5Z A;  1AVZ C;  1Y57 A;  2XMF A;  1BU1 A;  1WDX A;  3H0I A;  1EFN A;  4QT7 A;  1WIE A;  4DEX A;  2HCK A;  4JPB W;  3JV3 A;  3NPF A;  3VS0 A;  2LJ1 A;  3VS3 A;  1NM7 A;  1SHG A;  4GLM A;  3ZL7 C;  1QWE A;  1Y0M A;  5L23 A;  3UAT A;  2EVR A;  2JW4 A;  1U5S A;  1WXB A;  1AOJ A;  4EIK A;  2ABL A;  2LZ6 B;  1M27 C;  1YWO A;  2RQV A;  2RMO A;  2KT1 A;  1TUD A;  4GBQ A;  3VRY A;  2AZV A;  1M3B A;  1PNJ A;  3O5Z A;  1U3O A;  2A28 A;  1UGV A;  1UHF A;  2O88 A;  2ED1 A;  5FW9 A;  2C0O A;  4OMM A;  2KE9 A;  3EGU A;  1ZX6 A;  1W6X A;  2MIO A;  2FPE A;  1X27 A;  4ZNX A;  4AG1 C;  4J9E A;  1JO8 A;  2EYX A;  2X3W D;  2KXC A;  3M0S A;  2OJ2 A;  1FMK A;  2CT4 A;  1PHT A;  2CH4 A;  2DVJ A;  1ZUU A;  3THK A;  1CKB A;  1A0N B;  1M3A A;  1MV0 B;  1E6G A;  2EGE A;  2CSQ A;  1I07 A;  2OI3 A;  3R6N A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...