1U3OA

Solution structure of rat kalirin n-terminal sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
SGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSTLCISHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Huntingtin-associated protein-interacting protein
publication title Regulation of RhoGEF Activity by Intramolecular and Intermolecular SH3 Domain Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 6
structure length 67
sequence length 67
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1u3oA01
4D8KA 2D8HA 2D8JA 4RTVA 5IH2A 2CT4A 1V1CA 2M0YA 1A0NB 1M3AA 3VRYA 3I9QA 2GGRA 2CSQA 4FSSA 4J9GA 5HCKA 2ROTA 4AG1C 4M4ZA 1E6HA 1YNZA 1T3LA 4JZ3A 2J6KA 1ZBJA 1UFFA 1H92A 1AVZC 4RTXA 1AWJA 1CKBA 1SHGA 3R6NA 4ESRA 1IO6A 2D1XA 4F17A 2EW3A 2YT6A 2JTEA 2DL4A 2LJ3A 1G83A 3I5SA 1T0JA 4RTUA 2CDTA 2A28A 1E6GA 5IHNA 2YDLA 2CT3A 2FPEA 5IXBA 2DX1A 4OMNA 2DRMA 2DLPA 4J9HA 1T0HA 1Z9QA 2EQIA 3REBB 4OMQA 1GCQC 1AOJA 1SHFA 1VA7A 3I5RA 2KNBB 2A37A 1TG0A 2BZXA 2DBKA 2DL3A 3NMZC 1KIKA 1HJDA 2SRCA 3M0RA 2DVJA 5I11A 1JXMA 3GBQA 1PHTA 4HVWA 1B07A 1NYGA 2PZ1A 2KR3A 3REAB 3VS3A 1KJWA 3TSWA 1U5SA 1ZUYA 2V1RA 2FPFA 3UA7A 2YUPA 1NEBA 1ABQA 4Z88A 2RQTA 2NUZA 4LUEA 2J7IA 2EGAA 4GBQA 1FYNA 4CC4B 1GRIA 1Y0MA 2CH4W 1K0SA 2F2WA 2PTKA 2K79A 2RPNA 2KBTA 1HSQA 2OI3A 2JW4A 4RTWA 1ZUUA 2DA9A 4A63B 1X2KA 4JJDA 5L23A 1JU5C 2O31A 4OMPA 1VYUA 3EGUA 4RUGA 2LZ6B 2GQIA 1GCQA 2FRWA 1K1ZA 3M0TA 3TVTA 1GBRA 2BZYA 2L0AA 2DILA 5GJVB 5FWBA 4AFZC 3O5ZA 4HVUA 3A98A 4Z8AA 3ZL7C 3QWXX 2GBQA 1UGVA 4CC7A 3EHQA 2LCSA 3VS0A 1SRMA 1E7OA 1ARKA 1X69A 2GTJA 2KXDA 2W10A 2YUQA 1X6BA 2EYWA 2KYBA 1AZGB 2ED0A 1WXUA 2EYZA 2AKLA 1I1JA 2DL5A 2RQUA 2LMJA 4Z89A 1JEGA 3H0FA 1Y57A 4OMOA 1X6GA 1M27C 2HCKA 3UATA 1BU1A 1YWPA 1SSHA 2LQNA 2CSIA 2AK5A 1UJYA 1KSWA 4RTYA 2KXCA 1WIEA 2JS0A 2RMOA 1U06A 2KEAA 2F2XA 1UE9A 2E5KA 4DEXA 2GTOA 4R0KA 5IHIA 1W6XA 2BTTA 1TUDA 1UG1A 2DBMA 3NGPA 1UTIA 2C0OA 4K11A 1QKWA 1WXTA 2J06A 2F2VA 2D0NA 1GCPA 1G2BA 1ZSGA 1WLPB 2JM9A 2X3WD 1MUZA 3CQTA 4JJCA 2VVKA 5EC7A 3TSZA 1VYVA 1K4US 2YSQA 2KROA 1WI7A 1NLPC 2M51A 3EG2A 4J9BA 1YP5A 2EKHA 1PKSA 1X27A 4DEYA 1SPKA 2HBWA 2W0ZA 1WYXA 2ESWA 4X1VA 2H8HA 3IQLA 1NG2A 3VS4A 2DJQA 3LH5A 1M30A 1SEMA 4HCKA 1B3QA 1LCKA 2KT1A 3C0CA 4CC3A 1AWXA 1VYTA 3M0UA 4AG2C 3VS1A 1QCFA 2J6FA 3H41A 2LP5A 1W70A 2KGTA 2ECZA 1Z9ZA 1QKXA 1RLQC 2ENMA 1WDXA 1NLOC 2V1QA 1N5ZA 4AFQC 1M8MA 2FG0A 2X3XD 2J6OA 3M0QA 1K9AA 3H0HA 1NEGA 1PWTA 4IIOA 4ZNXA 1RUWA 4WCIA 2K6DA 2RQVA 1AZEA 1FMKA 1BB9A 2CH4A 2K2MA 1GFCA 1X43A 3M0SA 4LN2A 2ED1A 4QT7A 1T3SA 3SHWA 2MOXA 2C0TA 3THKA 1PKTA 1QWEA 4GLMA 1J3TA 3SEMA 2RQRA 1YWOA 1M3CA 1MV3A 2DL8A 2FRYA 1BBZA 2VWFA 2G6FX 2I0NA 1I0CA 2KRMA 1ZX6A 3RNJA 3UA6A 2CUBA 1WX6A 1UUEA 2B86A 2FEIA 5IXFA 2ABLA 1OPKA 2K9GA 4RTZA 1PRMC 1AWWA 4J9CA 1I07A 1OPLA 2O9SA 2QDLA 3VS7A 1W1FA 1XOVA 4J9DA 1BK2A 1UJ0A 2IIMA 3VRZA 2CREA 2O2OA 3EG0A 4F14A 2LJ1A 3M0PA 3VS2A 1PNJA 2EGCA 3PVLA 2JS2A 2KRSA 2RQWA 2O9VA 5GJWB 3FJ5A 2DE0X 2DYBA 4ORZA 5ECAA 1CKAA 2LQWA 4J9IA 2EPDA 4Y92A 2DM1A 4IIMA 1OV3A 5I22A 2J05A 1SRLA 2JXBA 2JMAA 2RNAA 3I35A 4E6RA 2YUNA 1UHCA 2LNHB 2XMFA 3EG3A 4LUDA 1U3OA 2DL7A 2JM8A 1H8KA 2L3SA 2EYXA 1QWFA 1ABOA 3NPFA 3QWYA 2K7AA 1AD5A 1RI9A 1QLYA 4LE9A 1K76A 5IHKA 1PRLC 2NWMA 2OJ2A 2VKNA 3VS5A 2AZSA 2KE9A 2L3PA 2EBPA 2DMOA 4RTTA 1AEYA 3U23A 1TUCA 2FPDA 1ZUKA 3PVQA 2CUDA 2KRNA 1H3HA 3RBBB 4J9EA 1NYFA 3EG1A 1NM7A 1UDLA 1YN8A 2L2PA 1JQQA 1JXOA 2JMCA 2A36A 4JPBW 4CC2A 1YCSB 2YUOA 2SEMA 4JJBA 4F16A 2GNCA 1EFNA 2OAWA 4KRTA 4AFSC 2DNUA 4OMLA 4JZ4A 3H0IA 1HD3A 1WFWA 2MIOA 2O88A 3EHRA 2HSPA 2KYMA 1UECA 2MCNA 2L3QA 2HEQA 1OOTA 1M3BA 2JT4A 1RLPC 4D8DA 2DRKA 1GBQA 1CSKA 3KFVA 2EVRA 1ZLMA 2RN8A 1GL5A 1AWOA 2EGEA 1WA7A 2HDAA 3NHNA 1OEBA 2K3BA 5FWCA 4J9FA 3PE0A 1S1NA 2C0IA 1JO8A 1KFZA 2LJ0A 2LX7A 3UF4A 4LNPA 4AFUC 1K0XA 2PNIA 2ROLA 2P4RA 2FO0A 1X2QA 2AKKA 2DF6A 2EYYA 4HXJA 2AZVA 1UHFA 4OMMA 2RF0A 3JV3A 3ULRB 2BZ8A 5FW9A 3VS6A 1GFDA 2A08A 1WXBA 4HVVA 4EIKA 2KT8A 1MV0B
chains in the Genus database with same CATH superfamily
1OI1A 3QKJA 4QVDA 2AHJB 4RTVA 2CT4A 2M0YA 4J83A 2ZPIB 2GGRA 2CSQA 5GMKl 3CCMT 3T9NA 3VUBA 3M54A 3VYHB 1YI2T 2MYSA 4M78C 4JS5A 5LJ3j 1AWJA 1QP3A 3R6NA 4ESRA 1YJNQ 1IO6A 4L59A 2D1XA 3KXTA 1SSFA 2EW3A 2YT6A 2R5MA 1NJIU 1E6GA 2OTJA 1TTHB 3QO3A 2FB7A 1TU0B 4M77C 2CT3A 2DETA 1D1CA 2P0KA 2EQIA 1D3BA 3META 1N6AA 2XDDA 1VA7A 3J80E 2KNBB 3FDRA 3RDVA 3GOXA 4B9XA 2DL3A 2BZXA 4EMKC 1JXMA 1QVGP 1YITQ 4HVWA 1B07A 1TOVA 5FU6B 2KR3A 3TSWA 1WJRA 1U5SA 5GAN3 3UDCA 3MHXA 2YUPA 3PMIA 1W2BS 4BI4A 3QDRB 3UWNA 1ABQA 1MMGA 4BDYA 3KUFA 1R8OB 5D6XA 1KD1R 4ZTFA 3V8KA 3PTAA 5KYNA 4CC4B 2E6ZA 3OYAA 5GAN6 2F2WA 3JCMb 2XG8D 1KC8R 1M9SA 3PNWC 2K79A 4JLIA 2RPNA 3MEAA 4NOYA 2FZCB 4RTWA 1Y96A 1WNLA 3CPWS 2DA9A 3QIIA 2R5AA 4JJDA 3TU4K 1Q7YU 4RUGA 2GQIA 1GCQA 5LJ3d 1GBRA 4PJJA 2BZYA 2L0AA 1PM3A 5FWBA 4AFZC 3O5ZA 1QQJA 3CC4T 1AHJB 2GQVA 4M75B 2P4TA 2RI5A 1UGVA 2LCSA 1E7OA 2V8KA 1X69A 2FYKA 2GTJA 2KXDA 5DY9A 1X6BA 5CAIA 2CZ1B 2EQMA 5FRMA 2EYWA 4RCBA 3CMAT 2ED0A 4JS4A 2EYZA 1ZSZA 4J7FA 1RL2A 2EKOA 4PFPA 2P0QA 5GAN5 1D0YA 2LMJA 2XHCA 3CBMA 3E9GA 1Y57A 2V8IA 1S72A 4II1A 1YHQA 1BU1A 4IUUA 2MAMA 3UT1A 3CXCA 2WACA 1UJYA 4DBHA 1KQSS 3V7RA 2KXCA 1WIEA 3QYHB 3CCEQ 2QQRA 4DEXA 4OGCA 1TS9A 1RAEB 2BTTA 2RJEA 1UG1A 5FU7B 2DBMA 3CCQA 3NGPA 2C0OA 4DBRA 3C95A 1RI0A 4MDWA 4ZTJA 3RMQA 1W2BA 1Q82C 5LJ5h 3FC3A 3A8MB 1G2BA 1ZSGA 3J7AF 1WLPB 4C0GA 1BCMA 1V76A 1VQLA 4PFOA 4M7AG 1IRXA 1NJIR 1M1KU 3EG2A 3V8JA 1VQ4Q 2QTXA 4M7DA 3TREA 2OTJQ 2VB6A 2RHIA 1X27A 2E6NA 3AT1B 4DEYA 1VQKA 2W0ZA 4M7AD 1TUGB 2M16A 1WYXA 4M75F 1NG2A 2DJQA 1M30A 1SEMA 1B3QA 3MKDA 2RJCA 5LJ3h 4FYYB 1TSFA 3M0UA 4QQ6A 3VS1A 5A0GA 4HCCA 2YRVA 1ZA2B 5LJ5g 1QCNA 4AT1B 3CMEA 3H41A 2KGTA 2K2VA 1Z9ZA 2ENMA 1WDXA 4MZPA 4QW2A 2V1QA 2D9TA 1M8MA 3CD6Q 1VQOA 2X3XD 1VQ5A 5KH6A 3GP8A 4L6V5 5GAMj 5CO7A 5C6SA 4N4HA 1O75A 5CKHA 2OTLA 2FZKB 3OB9A 3QHSA 1PKTA 1QWEA 3MEUA 4GLMA 5LJ3g 1K9MU 1YWOA 2DL8A 4Y28E 3OMCA 2LNVA 1BBZA 2VWFA 3DB3A 1PSFA 5LJ5e 2I0NA 1YIJA 2KRMA 3RNJA 4B9WA 4NL3A 3X28B 1UUEA 3L2QA 2BIVA 1K73C 2EQUA 2OX7A 2DD5A 4J8OA 2YWWA 2EYQA 1AWWA 1I07A 1OULA 3E19A 5GAN4 3CC7T 2O9SA 2K5IA 2MMPA 1UJ0A 4M7AE 1G3SA 3VRZA 1Q95G 2CREA 2F5TX 2LC4A 2O2OA 5EG2A 3CXCP 2L8DA 1SF9A 1MGQA 3PVLA 5LJ3e 3X25B 4BI3A 3JCMP 1YHQQ 4KH1B 3PFSA 3L2ZA 4M7DB 3L2WA 2O9VA 4F04B 2X4YA 2BUDA 3LH0A 1JB0E 1Q86U 2RHYA 2DE0X 2DTOA 3CCUA 1CKAA 2PUKB 1WZOA 3HKSA 2LCCA 2JXBA 1YI2Q 1R0CB 2YUNA 4PJOA 3RESA 2ZPFB 1U3OA 5CQXA 1VQNT 4PJNA 4C92G 5CKDA 2NUTA 3JCMV 4KGXB 3BY7A 1OQKA 1QVPA 2EQJA 2V26A 2ATCB 3CC2T 3OYFA 3A8OB 4C92D 3MCAB 4ZN3A 2A0FB 3JB9F 3NFCA 2LQKA 2EBPA 4M78G 2M9UA 4EMGA 1EX4A 4XQ3A 2CUDA 3I55T 3RBBB 1VQKQ 5GAOq 3JRZA 4JRPA 5GMKi 1P92A 3G71T 2CP0A 3BDLA 1IXDA 1YJ9A 4JJBA 5IAYA 1BI3A 2GNCA 3CMEQ 2OAWA 4KRTA 1VQ7A 1EIFA 2DNUA 4X9DA 1G3WA 2DXBA 2F5KA 1N8RU 2D0QB 1VQ5Q 4M7DF 2KYMA 1BI0A 1UECA 5FROA 2MCNA 2L3QA 2HEQA 3OQ5A 3RKYA 3S3OA 3G4SA 2RK1A 1GBQA 3S3NA 2M0OA 2DTIA 5CCAA 2EGEA 3VUZA 5GANh 2QDYB 2C0IA 1RAHB 4XTXA 2DZCA 4BY6B 4MDXA 1KFZA 3UF4A 4OGEA 2G3RA 2VYTA 4KGVB 3CC4Q 4XU3A 2DERA 1I8FA 1X2QA 4JUVA 2H3EB 2EYYA 4HXJA 4C92E 3OBYA 4CRIA 3ULRB 4PJOB 3BE3A 5GAMh 2D6FA 3VS6A 1GFDA 2LVMA 1XTDA 3M59A 3PMTA 5I2SA 1YJWT 2KT8A 4JRQA 3CMAQ 1OU9A 2HBPA 4M7AC 1QP2A 1V1CA 4J9GA 4M78E 4AG1C 4M4ZA 4V2SA 2ZCFB 2AIRB 2RJDA 4LDVA 2VUBA 3QPHA 3FIFA 4RTXA 2EJFA 4X9CA 5J3BA 4FT2A 4NS5A 1IGUA 5GAN8 2QEXT 2QQ9A 2DPPB 3CCUQ 2DL4A 2GF7A 5GAMg 2ZPHB 1VQ8T 2CDTA 2A28A 4B6MA 4DBFA 2LX9A 2IVWA 2K4YA 1SG5A 2E70A 3ZFJA 4C8QB 3OYBA 4J9HA 1Z9QA 4UC4A 4OMQA 1AOJA 2JZ2A 5GANe 3HHTB 4E7KA 4N0AC 5KYXB 1VQ9T 4C0ZA 4HCBA 3M0RA 1KD1U 1QVFP 2DVJA 4QVCA 3GBQA 1PHTA 2KK4A 3VS3A 1KJWA 5CKBA 2V1RA 1IB8A 1VIEA 4DA4A 1KC8U 3CCST 2CYZB 1VQPA 2E12A 2RQTA 5GAMe 4M78A 4PJOF 2J7IA 4KGZB 4R55A 5IT9E 1GRIA 1Y0MA 3OW2P 1LPLA 3EFSA 1D0XA 1XNIA 1HSQA 2VGMA 4LD9K 1NPPA 2XICA 4A63B 5L23A 1JU5C 4OMPA 3EGUA 2E65A 2DILA 2DZ9A 3ER0A 2MWOA 2O4XB 4J6YA 1RABB 2E4HA 3OA6A 4EMKA 4C5EA 1ACMB 1M1FA 2IPOB 3C94A 4F7UG 3N5BB 1JBMA 1SRMA 5KYYA 3L42A 1M1KC 5LJ3f 2W10A 3M57A 1B34B 2KYBA 4MZMA 1WXUA 2PUOB 1N27A 3M53A 4PJLA 4C8QF 2RM4A 3CCEA 3OYKA 4C92C 2VASA 2RQUA 4O6JA 4OMOA 3CCVT 4J6WA 3A5ZB 3LGFA 1I5LA 3JB9G 3CC7Q 2P84A 4RTYA 3H9NA 3A1PA 2RMOA 5HKCA 1PCXA 2KEAA 3JB9D 1UE9A 2E5KA 2GTOA 2PVOB 2X35A 2YLCA 2JOYA 5KCOA 1OZ3A 1UTIA 3HRSA 3EFOB 3WVDB 2DVEA 3S6WA 3CCLT 1VQ4A 3CBOA 1ZA1B 1H3ZA 2J06A 2D0NA 5GAOr 1X75C 1NBEB 1KK7A 4JJCA 2X4XA 3HPWA 4N4IA 4ATOA 1VYVA 4C5GA 2KROA 2COZA 2DK3A 2EQKA 3QUIA 1VQNQ 2ZGWA 4HT8A 2GFUA 1M90C 2CZ6B 3JCMe 2YRDA 1RACB 2ESWA 4M77B 3IQLA 3CD6A 4HCKA 5LJ5d 5CIUA 2C06A 4CC3A 1C6VX 4F7UE 5GAN7 4FT4A 2XU8A 4AG2C 2J6FA 5IN1A 1IREB 4EMKB 1RLQC 1FX7A 1K73R 3I55Q 2RB6A 2XKOC 4AFQC 1N5ZA 3CEYA 5KYYB 4GLKA 2I2LA 1VQPQ 3EG9A 2J6OA 5KYWB 1FXXA 3BDUA 3G71Q 1Q86C 1RUWA 1BB9A 2ED1A 4QT7A 4AMCA 9ATCB 3EFRA 2MOXA 2C0TA 1I81A 3A8LB 3HFOA 3E2UA 4YTLA 1MV3A 4A4EA 4HA8A 2G6FX 4RG2A 4ZN1A 2NLUA 3JAME 3EH1A 5GMKm 1PD0A 3J81E 4E7JA 4EPCA 2HQHA 1F1BB 2XDBA 1BI1A 3OYNA 1IHVA 4P5NA 1I5OB 5IXFA 2ABLA 1OPKA 1X01A 4O5VA 5I21A 4RTZA 1OPLA 2MF2A 2O01E 2RHZA 2HZYA 1W1FA 4J9DA 3E1SA 1BK2A 2IIMA 2V8JA 5M9OA 3S3MA 2LJ1A 3CCMA 4HT9A 1D3BB 2WSFE 4M77F 2QXFA 2JS2A 3WXMB 3HRTA 1YJWQ 1YI2A 4PJMA 2NUPA 4D6WA 4LDXA 2DYBA 4OB3B 2LQWA 4Y92A 1X6OA 1OV3A 4FM4B 4DBQA 4A54A 3I56T 1N8RC 2JMAA 2RNAA 1KG1A 2QGFB 1UHCA 2HL5C 2LNHB 2XMFA 3EG3A 3R6OA 2DL7A 5GAN2 2EYXA 3INZA 2QEXQ 1QWFA 1ABOA 3QWYA 1JJ2S 4BACA 2K7AA 1AD5A 1QLYA 5IHKA 1K76A 1VQ8Q 1M2VA 3CPWA 2K5FA 3EG9B 1Y96B 5GAMf 1PRLC 3V8LA 1UB4A 1K8AC 2XDPA 2L3PA 4BD3A 4RTTA 2EFIA 3C12A 2L5QA 5GANj 2FPDA 3CCJT 3PVQA 1H3HA 4C0DC 3HSBA 2KAFA 3QZ5B 1VQ9Q 1VQ6T 1NYFA 2VXEA 4C5IA 1EZZB 4FYWB 2F1LA 3JB9H 2JMCA 2A36A 4C8QG 1HXDA 3CCSQ 2VV5A 4OB2B 4VUBA 1EFNA 1ZSZB 4RCCA 3SB2A 2JJ9A 2XK0A 4LXCA 4PLIA 4C8QD 3OYLA 2COWA 3JCMc 1G8XA 1YJ9T 3LLRA 4N4GA 2O88A 4IKFA 1QMCA 1OOTA 1KQSA 4OVAA 4D8DA 3CC4A 2DRKA 1XQHA 5KYUA 1ZLMA 1N9RA 1AWOA 2ZPGB 1WA7A 4OB0B 2HDAA 3NHNA 5J26A 1SKUB 3PE0A 1S1NA 3EH2A 2NUPB 1JO8A 4FU6A 2KI7A 3G4ST 2MK5A 4JRIA 3CMAA 2IG0A 3EGXA 1K0XA 4MZTA 2PNIA 2P4RA 2FO0A 2RI3A 2AKKA 3F70A 4OMMA 2RF0A 2Y4YA 2BZ8A 3M58A 2A08A 2EWNA 2HMAA 1YBYA 4EIKA 1UGQB 2NYSA 1KC8C 2LRQA 3NTKA 1MV0B 5GANd 4L5GA 4D8KA 2D8HA 2D8JA 3CCRT 4FSSA 3OYYA 5HCKA 2ROTA 2AT1B 3CCVQ 3HFNA 2FL7A 1YNZA 1T3LA 2DJZA 4JZ3A 3CCMQ 4XTVA 2HSEB 3M4GA 1UFFA 3RR6A 1W2BP 1YJNT 1AVZC 2XD0A 1RAIB 3ZBDA 5GAMd 1MHNA 4QQGA 2KSSA 2X4JA 2FZGB 3EGDA 3FRNA 1MNEA 1LVKA 2LJ3A 4LD6A 2L3RA 4RTUA 1PD1A 3OS5A 4XTYA 2DXCA 2OAUA 4FIBA 1N9SA 2E3IA 1VQMT 4BE1A 2BE9B 5IHNA 2YDLA 3CCLQ 2FPEA 5IXBA 2DX1A 4OMNA 2DRMA 1W4SA 2DLPA 3CPWP 2HQEA 1PG5B 1RADB 3HTRA 1Q81R 2CP2A 3DB4A 3I5RA 2YHTA 4E47A 1WHJA 1YITT 2A37A 3NMZC 4M7AA 1KIKA 2QA4T 1HJDA 2SRCA 1NPRA 1KHIA 2A7YA 4DOWA 3X26B 2FPFA 3UA7A 2M1HA 1LJOA 2DXTA 1NEBA 4ME7A 2QI2A 3MPUB 1UGSB 2Y90A 2NUZA 3HL8A 4LUEA 4GBQA 5AYFA 3SWNC 1FYNA 5FRNA 3LW5E 1K0SA 1ZQ1A 2PTKA 3EGXB 3OSSC 2LQ8A 2KBTA 2OI3A 2JW4A 1UGRB 2CP5A 1ZUUA 2A3LA 1X2KA 2E3HA 2O31A 4GY5A 1XJWB 1NJIC 1KQSP 3RKXA 2LZ6B 4C0FA 4FYVB 2DFUA 2FRWA 1K1ZA 3TVTA 3X20B 3G6ET 3GF5A 4N0AA 1QVGS 4J7IA 7AT1B 4HVUA 2RD1A 2GBQA 1OU8A 4CC7A 3OYDA 3VS0A 1ARKA 1G3YA 2YUQA 3CC7A 1RAAB 4IUVA 3MP8A 4E7LA 4FW2A 3EGDB 4E7IA 3GNGA 2NUTB 4Z89A 3ASKA 1X6GA 1M27C 2HCKA 1YWPA 4M75G 2LT4A 5GANg 4E7ZA 4RKUE 2LQNA 3MEWA 2AK5A 1KSWA 3JCMd 2JS0A 4M75D 3M5AA 2R57A 1D0ZA 1WHHA 4R0KA 5IHIA 1W6XA 2CP7A 4M7AB 1M1GA 3LWHA 1Q7YC 4K11A 1BIBA 1VQNA 2HQXA 1QKWA 2RJFA 3JB9J 1RAFB 1GCPA 4C8QC 4BDZA 1FMVA 2QYZA 3I56Q 2QQBA 2JNGA 2JM9A 2X3WD 3CQTA 5D6YA 4IUQA 2X9HA 3TSZA 2LTOA 4XU2A 1K4US 1C1AA 4IUTA 2OTJT 2YSQA 5FLXE 5A2QE 4C92A 1NLPC 2M51A 2JTMA 1IZ6A 2EKHA 1PKSA 1I4K1 3V7CA 1SPKA 5GMKe 3OBWA 1K73U 2LDMA 3I55A 3LH5A 2JN0A 1LCKA 4HCZA 3C0CA 2PQWA 1RAGB 1AWXA 1U1TA 1AT1B 1VYTA 1QVGA 1QCFA 3G71A 2K3XA 1DJ7B 3CCJQ 4EMHA 1W70A 5HY6A 1QKXA 1NLOC 2E5QA 5LJ5f 3M9QA 4E2FB 3OYJA 1K9AA 3OYIA 3OYCA 4LDUA 1YFNA 4ANJA 3GLXA 4M75E 4ZNXA 4WCIA 2K6DA 2RQVA 1AZEA 1FMKA 1X43A 1T3SA 2DEQA 4FL6A 8ATCB 2E10A 1M2OA 3QJYA 3ZEHA 4BI8B 2B8AA 3THKA 3AHUA 3CBPA 4M7AF 1J3TA 3SEMA 2JTFA 2QTVA 2XIDA 2FRYA 3JCMh 1WGSA 4QKUA 2QQSA 3TCJA 1U8RA 4FYXB 1I0CA 2ZPBB 5I2MA 1FWZA 2CUBA 1WX6A 4WTOB 2B86A 1Q82R 5L8RE 2FEIA 3OS1A 5AT1B 3OYEA 4J9CA 5D7UA 1YJWA 4FW1A 1O9SA 2QDLA 8AT1B 1WJSA 1XOVA 2H3JA 3ME9A 3M55A 4F14A 5HK0A 1D1AA 3M0PA 3VS2A 1PNJA 1R77A 1S72T 3MP6A 1YHQT 2QG9B 3JCMW 1K8AR 4PNOA 2K5LA 2KRSA 3JCMg 4C92B 2RQWA 2RHXA 1Y71A 1QCOA 1R0BG 1WQ7A 2LCLA 3FJ5A 3P8BB 1VIFA 3PGGA 3CCRQ 5GAOn 4M75A 4OF1A 2DYIA 4ORZA 2QEXA 1OZ2A 2EPDA 2DKGA 2DM1A 4IIMA 1G3TA 5I22A 2J05A 2DD4A 3CCQT 1VQ8A 3I35A 4E6RA 4M78B 3TQ7P 1K9MC 4LUDA 1WHGA 2JM8A 3QDFA 1NE8A 3LWIA 3V7SA 4M7DG 4PLLA 3G1JA 5FU6C 4OMFB 1RI9A 4LE9A 1VQLT 3A8HB 1VQ9A 3CXCS 4M7DD 3CC2Q 2OJ2A 1MNDA 1VQMQ 4FSXA 3RIRA 2KE9A 1AEYA 3U23A 3FB9A 1TUCA 1ZUKA 1VQKT 4KUIA 3CCSA 4PFZA 1WPYA 2QA4Q 4ZGEB 4J9EA 3OYMA 4QQDA 2L2PA 3MEVA 3CMET 4CC2A 1YCSB 4XU0A 1VQOT 4OMLA 1VQ5T 2X4WA 3H0IA 5CQYA 2CS7A 1WFWA 4OP0A 2MIOA 4C92F 5J39A 4M75C 2HKQB 3EHRA 3OSVA 3WVEB 3LGLA 3L2RA 4BUGA 1RLPC 2FVUA 2OTLT 2E41A 1CSKA 4JLGA 3M4YA 3O8VA 4JRKA 2WSEE 3QG1A 2WSCE 1OEBA 5GAOp 2K3BA 5FWCA 3QYGB 4J9FA 1TXQA 3DLLA 3PT9A 1LOJA 4M78F 1LNXA 3G6EQ 2LJ0A 2LX7A 1YIJT 3C4SA 4LNPA 4AFUC 3BW1A 4WF2A 1H641 4F7UA 4JJNK 4DOVA 4KH0B 2AZVA 1YCYA 2EIFA 3M56A 4M7DE 1HK9A 4KUDK 3CCVA 3GIBA 4XAXB 1UEBA 3OYGA 5FW9A 4KBMB 1Y7XA 1MMNA 1VUBA 1WXBA 4J5YA 2QAZA 3OY9A 5FU7C 5IH2A 1A0NB 1M3AA 3VRYA 3OS2A 3I9QA 5DLQE 1KQ1A 2JUFA 1BIAA 1E6HA 2CGHA 2ZZDA 3DLMA 5GAOl 1QW1A 2DAQA 2J6KA 3VV0A 1M4ZA 5GANf 1ZBJA 1H92A 4PJOG 4DQ2A 1CKBA 1SHGA 3CCLA 1WJQA 1M8VA 4ZGJB 4BE2A 3CCUT 4F17A 4PJOD 1Q81U 2JTEA 3NTHA 2Y4XA 1G83A 3I5SA 1T0JA 5KCHA 2PU9B 2RO0A 3JSCA 3VKIA 5CKEA 2L89A 1BKBA 3P8HA 1T0HA 2R58A 3REBB 1GCQC 4EDUA 4A4FA 1SHFA 4Y91A 1TG0A 2DBKA 2P0PA 5I11A 1NYGA 2PZ1A 1V29B 3REAB 1ZUYA 5GMKj 1M5Q1 4Z88A 1ZSZC 2DEUA 2BKDN 2K3YA 1B7TA 5DM7R 2EGAA 4KT0E 1U1SA 4C0DB 2CH4W 4MMLA 4F7UB 4XU1A 4E7HA 5KE2A 1FMWA 3OS0A 5DLOA 1VQ7T 5D6WA 1MMAA 3P8DA 5KE3A 1KQ2A 4ZGDB 1VYUA 3M0TA 1QVFS 5GJVB 5CK9A 3JB9I 4PJOE 3L2VA 1PSEA 3A98A 4R56A 4Z8AA 3ZL7C 3QWXX 3H6ZA 3EHQA 4Z02A 4JDSA 1Q7YR 4KULA 1KD1C 1Y07A 5GAOm 1AZGB 1M90U 4A53A 2AKLA 1I1JA 3OW2S 1BI2A 2DL5A 3SWNA 4M7DC 3BFMA 4RMOA 2BE7D 1JEGA 1JJ2A 3H0FA 3SDZA 3UATA 2EAYA 1M2VB 3E9FA 1SSHA 2RH2A 2CSIA 1IGQA 2E64A 3L2UA 4LDWA 2FHDA 1OX8A 4X34A 1U06A 2DTHA 3MJXA 3LYIA 2F2XA 2RI2A 2K57A 1S72Q 3FEOA 1KHCA 1TUDA 3I56A 1PC0A 4C8QE 3JCMf 3JCMQ 1WXTA 2F2VA 4F7UF 2DO3A 4IURA 3CCQQ 2HKNA 1MUZA 5EC7A 2VVKA 3G7ZA 4BB7A 2QK0A 4A4HA 1WI7A 1WQWA 3RERA 1VOMA 4J9BA 1YP5A 2MWPA 2VGNA 3CCJA 2LT1A 2CP3A 2HBWA 2RHUA 4X1VA 2H8HA 2RK2A 1VQLQ 3VS4A 1VQ6A 5KYUB 1OYXA 2QQAA 3QJ6A 4OB1B 1QVFA 2KT1A 3H8ZA 1M1KR 3A8GB 3DKMA 2VXFA 3MO8A 3RMSA 2LP5A 2CZ7B 2ECZA 3L1AA 4M78D 3UPUA 5A0DA 3VJPA 1VQPT 4J6XA 3HRUA 2GFAA 1JRIA 2FG0A 1WHMA 3M0QA 4M77G 4RG8A 3H0HA 4C8QA 1NEGA 1PWTA 4IIOA 2F69A 3OW2A 3HP9A 2YRCA 1G5VA 2CH4A 2K2MA 1GFCA 4M77D 3SWNB 3M0SA 4LN2A 2ZPEB 5C0MA 4BY6C 6AT1B 5KYXA 1Q82U 3SHWA 1VQOQ 1HYOA 4BE0A 2RQRA 1M3CA 4XTZA 5GMKh 3KBGA 4PJOC 1D1BA 4PKCC 2PVDB 2OTLQ 1ZX6A 3UA6A 1UGPB 2QASA 2K9GA 5CR2A 1K9MR 1PRMC 1K8AU 2PVGB 5HK3A 1WHLA 2KY9A 2KQWA 1YIJQ 4C5HA 3VS7A 1JJ2P 3SD4A 2QGGA 2Z0WA 3CCRA 3CCET 4MMKA 1M90R 3EG0A 3TEEA 2CKKA 1TWBA 2EGCA 1NZ9A 1TH7A 2XI9A 1OX9A 5CVIA 2KDSA 2O4XA 1C0MA 1YJNA 4ELZC 5GJWB 1BCOA 4CI0C 1ZHIA 4HKEA 5ECAA 1BYMA 4J9IA 4LDYA 1GXIE 2EJ9A 4IUPA 1SRLA 1B34A 3JCMJ 4PK4A 2MI6A 1WHKA 3CC2A 3URGA 1VQMA 4TVRA 1H8KA 2DIGA 2L3SA 1VQ4T 2EJGA 1Q86R 4M77E 5CKFA 3FLGA 3QBYA 1IHWA 3NPFA 2COYA 3GNFB 1YITA 2HNIA 2YXYA 2QA4A 2NWMA 2VC8A 3D7SB 2VKNA 3VS5A 3OYHA 2AZSA 3Q1JA 2DMOA 3GPLA 3LX7A 4QVZA 2KRNA 2KVQG 3EFOA 3CD6T 3X24B 4XK8E 3QZ9B 2YLBA 4FCYA 3SFMA 4E7SA 1D09B 3EG1A 1ZBXA 3RKWA 1VQ6Q 1NM7A 1UDLA 4A4KA 1YN8A 1JQQA 1JXOA 4JPBW 4Q5WA 2YUOA 1MMDA 2SEMA 4F16A 3VU3C 4AFSC 2X51A 4A4GA 4JZ4A 5A0LA 1HD3A 3QSUA 3OMGA 3JCMX 2HSPA 2DXUA 4XTWA 1YJ9Q 2E1HA 2KMTA 3PIOA 3G6EA 1M3BA 2M02A 2HL3A 4M77A 2JT4A 3MP1A 4PL6A 1Q81C 4NL2A 1VQ7Q 2DIQA 3KFVA 2EVRA 2GCXA 2RN8A 1GL5A 1N8RR 2JVVA 2ZAEA 2MPXC 3CPFA 3G4SQ 2ROLA 2CZ0B 2DF6A 2RA2A 5LJ5j 1UHFA 2CP6A 5LL6S 2HAXA 5KYWA 3PIPA 3FJPA 3JV3A 3EAEA 2HD0A 4ELYC 3QXEB 4XTUA 3RUXA 4HVVA 3VYGA 3NTIA
chains in the Genus database with same CATH topology
4D8KA 2D8HA 2D8JA 4RTVA 5IH2A 2CT4A 1V1CA 2M0YA 1A0NB 1M3AA 3VRYA 3I9QA 2GGRA 2CSQA 4FSSA 4J9GA 5HCKA 2ROTA 4AG1C 4M4ZA 1E6HA 1YNZA 1T3LA 4JZ3A 2J6KA 1ZBJA 1UFFA 1H92A 1AVZC 4RTXA 1AWJA 1CKBA 1SHGA 3R6NA 4ESRA 1IO6A 2D1XA 4F17A 2EW3A 2YT6A 2JTEA 2DL4A 2LJ3A 1G83A 3I5SA 1T0JA 4RTUA 2CDTA 2A28A 1E6GA 5IHNA 2YDLA 2CT3A 2FPEA 5IXBA 2DX1A 4OMNA 2DRMA 2DLPA 4J9HA 1T0HA 1Z9QA 2EQIA 3REBB 4OMQA 1GCQC 1AOJA 1SHFA 1VA7A 3I5RA 2KNBB 2A37A 1TG0A 2BZXA 2DBKA 2DL3A 3NMZC 1KIKA 1HJDA 2SRCA 3M0RA 2DVJA 5I11A 1JXMA 3GBQA 1PHTA 4HVWA 1B07A 1NYGA 2PZ1A 2KR3A 3REAB 3VS3A 1KJWA 3TSWA 1U5SA 1ZUYA 2V1RA 2FPFA 3UA7A 2YUPA 1NEBA 1ABQA 4Z88A 2RQTA 2NUZA 4LUEA 2J7IA 2EGAA 4GBQA 1FYNA 4CC4B 1GRIA 1Y0MA 2CH4W 1K0SA 2F2WA 2PTKA 2K79A 2RPNA 2KBTA 1HSQA 2OI3A 2JW4A 4RTWA 1ZUUA 2DA9A 4A63B 1X2KA 4JJDA 5L23A 1JU5C 2O31A 4OMPA 1VYUA 3EGUA 4RUGA 2LZ6B 2GQIA 1GCQA 2FRWA 1K1ZA 3M0TA 3TVTA 1GBRA 2BZYA 2L0AA 2DILA 5GJVB 5FWBA 4AFZC 3O5ZA 4HVUA 3A98A 4Z8AA 3ZL7C 3QWXX 2GBQA 1UGVA 4CC7A 3EHQA 2LCSA 3VS0A 1SRMA 1E7OA 1ARKA 1X69A 2GTJA 2KXDA 2W10A 2YUQA 1X6BA 2EYWA 2KYBA 1AZGB 2ED0A 1WXUA 2EYZA 2AKLA 1I1JA 2DL5A 2RQUA 2LMJA 4Z89A 1JEGA 3H0FA 1Y57A 4OMOA 1X6GA 1M27C 2HCKA 3UATA 1BU1A 1YWPA 1SSHA 2LQNA 2CSIA 2AK5A 1UJYA 1KSWA 4RTYA 2KXCA 1WIEA 2JS0A 2RMOA 1U06A 2KEAA 2F2XA 1UE9A 2E5KA 4DEXA 2GTOA 4R0KA 5IHIA 1W6XA 2BTTA 1TUDA 1UG1A 2DBMA 3NGPA 1UTIA 2C0OA 4K11A 1QKWA 1WXTA 2J06A 2F2VA 2D0NA 1GCPA 1G2BA 1ZSGA 1WLPB 2JM9A 2X3WD 1MUZA 3CQTA 4JJCA 2VVKA 5EC7A 3TSZA 1VYVA 1K4US 2YSQA 2KROA 1WI7A 1NLPC 2M51A 3EG2A 4J9BA 1YP5A 2EKHA 1PKSA 1X27A 4DEYA 1SPKA 2HBWA 2W0ZA 1WYXA 2ESWA 4X1VA 2H8HA 3IQLA 1NG2A 3VS4A 2DJQA 3LH5A 1M30A 1SEMA 4HCKA 1B3QA 1LCKA 2KT1A 3C0CA 4CC3A 1AWXA 1VYTA 3M0UA 4AG2C 3VS1A 1QCFA 2J6FA 3H41A 2LP5A 1W70A 2KGTA 2ECZA 1Z9ZA 1QKXA 1RLQC 2ENMA 1WDXA 1NLOC 2V1QA 1N5ZA 4AFQC 1M8MA 2FG0A 2X3XD 2J6OA 3M0QA 1K9AA 3H0HA 1NEGA 1PWTA 4IIOA 4ZNXA 1RUWA 4WCIA 2K6DA 2RQVA 1AZEA 1FMKA 1BB9A 2CH4A 2K2MA 1GFCA 1X43A 3M0SA 4LN2A 2ED1A 4QT7A 1T3SA 3SHWA 2MOXA 2C0TA 3THKA 1PKTA 1QWEA 4GLMA 1J3TA 3SEMA 2RQRA 1YWOA 1M3CA 1MV3A 2DL8A 2FRYA 1BBZA 2VWFA 2G6FX 2I0NA 1I0CA 2KRMA 1ZX6A 3RNJA 3UA6A 2CUBA 1WX6A 1UUEA 2B86A 2FEIA 5IXFA 2ABLA 1OPKA 2K9GA 4RTZA 1PRMC 1AWWA 4J9CA 1I07A 1OPLA 2O9SA 2QDLA 3VS7A 1W1FA 1XOVA 4J9DA 1BK2A 1UJ0A 2IIMA 3VRZA 2CREA 2O2OA 3EG0A 4F14A 2LJ1A 3M0PA 3VS2A 1PNJA 2EGCA 3PVLA 2JS2A 2KRSA 2RQWA 2O9VA 5GJWB 3FJ5A 2DE0X 2DYBA 4ORZA 5ECAA 1CKAA 2LQWA 4J9IA 2EPDA 4Y92A 2DM1A 4IIMA 1OV3A 5I22A 2J05A 1SRLA 2JXBA 2JMAA 2RNAA 3I35A 4E6RA 2YUNA 1UHCA 2LNHB 2XMFA 3EG3A 4LUDA 1U3OA 2DL7A 2JM8A 1H8KA 2L3SA 2EYXA 1QWFA 1ABOA 3NPFA 3QWYA 2K7AA 1AD5A 1RI9A 1QLYA 4LE9A 1K76A 5IHKA 1PRLC 2NWMA 2OJ2A 2VKNA 3VS5A 2AZSA 2KE9A 2L3PA 2EBPA 2DMOA 4RTTA 1AEYA 3U23A 1TUCA 2FPDA 1ZUKA 3PVQA 2CUDA 2KRNA 1H3HA 3RBBB 4J9EA 1NYFA 3EG1A 1NM7A 1UDLA 1YN8A 2L2PA 1JQQA 1JXOA 2JMCA 2A36A 4JPBW 4CC2A 1YCSB 2YUOA 2SEMA 4JJBA 4F16A 2GNCA 1EFNA 2OAWA 4KRTA 4AFSC 2DNUA 4OMLA 4JZ4A 3H0IA 1HD3A 1WFWA 2MIOA 2O88A 3EHRA 2HSPA 2KYMA 1UECA 2MCNA 2L3QA 2HEQA 1OOTA 1M3BA 2JT4A 1RLPC 4D8DA 2DRKA 1GBQA 1CSKA 3KFVA 2EVRA 1ZLMA 2RN8A 1GL5A 1AWOA 2EGEA 1WA7A 2HDAA 3NHNA 1OEBA 2K3BA 5FWCA 4J9FA 3PE0A 1S1NA 2C0IA 1JO8A 1KFZA 2LJ0A 2LX7A 3UF4A 4LNPA 4AFUC 1K0XA 2PNIA 2ROLA 2P4RA 2FO0A 1X2QA 2AKKA 2DF6A 2EYYA 4HXJA 2AZVA 1UHFA 4OMMA 2RF0A 3JV3A 3ULRB 2BZ8A 5FW9A 3VS6A 1GFDA 2A08A 1WXBA 4HVVA 4EIKA 2KT8A 1MV0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8K A;  2D8H A;  2D8J A;  4RTV A;  5IH2 A;  2CT4 A;  1V1C A;  2M0Y A;  1A0N B;  1M3A A;  3VRY A;  3I9Q A;  2GGR A;  2CSQ A;  4FSS A;  4J9G A;  5HCK A;  2ROT A;  4AG1 C;  4M4Z A;  1E6H A;  1YNZ A;  1T3L A;  4JZ3 A;  2J6K A;  1ZBJ A;  1UFF A;  1H92 A;  1AVZ C;  4RTX A;  1AWJ A;  1CKB A;  1SHG A;  3R6N A;  4ESR A;  1IO6 A;  2D1X A;  4F17 A;  2EW3 A;  2YT6 A;  2JTE A;  2DL4 A;  2LJ3 A;  1G83 A;  3I5S A;  1T0J A;  4RTU A;  2CDT A;  2A28 A;  1E6G A;  5IHN A;  2YDL A;  2CT3 A;  2FPE A;  5IXB A;  2DX1 A;  4OMN A;  2DRM A;  2DLP A;  4J9H A;  1T0H A;  1Z9Q A;  2EQI A;  3REB B;  4OMQ A;  1GCQ C;  1AOJ A;  1SHF A;  1VA7 A;  3I5R A;  2KNB B;  2A37 A;  1TG0 A;  2BZX A;  2DBK A;  2DL3 A;  3NMZ C;  1KIK A;  1HJD A;  2SRC A;  3M0R A;  2DVJ A;  5I11 A;  1JXM A;  3GBQ A;  1PHT A;  4HVW A;  1B07 A;  1NYG A;  2PZ1 A;  2KR3 A;  3REA B;  3VS3 A;  1KJW A;  3TSW A;  1U5S A;  1ZUY A;  2V1R A;  2FPF A;  3UA7 A;  2YUP A;  1NEB A;  1ABQ A;  4Z88 A;  2RQT A;  2NUZ A;  4LUE A;  2J7I A;  2EGA A;  4GBQ A;  1FYN A;  4CC4 B;  1GRI A;  1Y0M A;  2CH4 W;  1K0S A;  2F2W A;  2PTK A;  2K79 A;  2RPN A;  2KBT A;  1HSQ A;  2OI3 A;  2JW4 A;  4RTW A;  1ZUU A;  2DA9 A;  4A63 B;  1X2K A;  4JJD A;  5L23 A;  1JU5 C;  2O31 A;  4OMP A;  1VYU A;  3EGU A;  4RUG A;  2LZ6 B;  2GQI A;  1GCQ A;  2FRW A;  1K1Z A;  3M0T A;  3TVT A;  1GBR A;  2BZY A;  2L0A A;  2DIL A;  5GJV B;  5FWB A;  4AFZ C;  3O5Z A;  4HVU A;  3A98 A;  4Z8A A;  3ZL7 C;  3QWX X;  2GBQ A;  1UGV A;  4CC7 A;  3EHQ A;  2LCS A;  3VS0 A;  1SRM A;  1E7O A;  1ARK A;  1X69 A;  2GTJ A;  2KXD A;  2W10 A;  2YUQ A;  1X6B A;  2EYW A;  2KYB A;  1AZG B;  2ED0 A;  1WXU A;  2EYZ A;  2AKL A;  1I1J A;  2DL5 A;  2RQU A;  2LMJ A;  4Z89 A;  1JEG A;  3H0F A;  1Y57 A;  4OMO A;  1X6G A;  1M27 C;  2HCK A;  3UAT A;  1BU1 A;  1YWP A;  1SSH A;  2LQN A;  2CSI A;  2AK5 A;  1UJY A;  1KSW A;  4RTY A;  2KXC A;  1WIE A;  2JS0 A;  2RMO A;  1U06 A;  2KEA A;  2F2X A;  1UE9 A;  2E5K A;  4DEX A;  2GTO A;  4R0K A;  5IHI A;  1W6X A;  2BTT A;  1TUD A;  1UG1 A;  2DBM A;  3NGP A;  1UTI A;  2C0O A;  4K11 A;  1QKW A;  1WXT A;  2J06 A;  2F2V A;  2D0N A;  1GCP A;  1G2B A;  1ZSG A;  1WLP B;  2JM9 A;  2X3W D;  1MUZ A;  3CQT A;  4JJC A;  2VVK A;  5EC7 A;  3TSZ A;  1VYV A;  1K4U S;  2YSQ A;  2KRO A;  1WI7 A;  1NLP C;  2M51 A;  3EG2 A;  4J9B A;  1YP5 A;  2EKH A;  1PKS A;  1X27 A;  4DEY A;  1SPK A;  2HBW A;  2W0Z A;  1WYX A;  2ESW A;  4X1V A;  2H8H A;  3IQL A;  1NG2 A;  3VS4 A;  2DJQ A;  3LH5 A;  1M30 A;  1SEM A;  4HCK A;  1B3Q A;  1LCK A;  2KT1 A;  3C0C A;  4CC3 A;  1AWX A;  1VYT A;  3M0U A;  4AG2 C;  3VS1 A;  1QCF A;  2J6F A;  3H41 A;  2LP5 A;  1W70 A;  2KGT A;  2ECZ A;  1Z9Z A;  1QKX A;  1RLQ C;  2ENM A;  1WDX A;  1NLO C;  2V1Q A;  1N5Z A;  4AFQ C;  1M8M A;  2FG0 A;  2X3X D;  2J6O A;  3M0Q A;  1K9A A;  3H0H A;  1NEG A;  1PWT A;  4IIO A;  4ZNX A;  1RUW A;  4WCI A;  2K6D A;  2RQV A;  1AZE A;  1FMK A;  1BB9 A;  2CH4 A;  2K2M A;  1GFC A;  1X43 A;  3M0S A;  4LN2 A;  2ED1 A;  4QT7 A;  1T3S A;  3SHW A;  2MOX A;  2C0T A;  3THK A;  1PKT A;  1QWE A;  4GLM A;  1J3T A;  3SEM A;  2RQR A;  1YWO A;  1M3C A;  1MV3 A;  2DL8 A;  2FRY A;  1BBZ A;  2VWF A;  2G6F X;  2I0N A;  1I0C A;  2KRM A;  1ZX6 A;  3RNJ A;  3UA6 A;  2CUB A;  1WX6 A;  1UUE A;  2B86 A;  2FEI A;  5IXF A;  2ABL A;  1OPK A;  2K9G A;  4RTZ A;  1PRM C;  1AWW A;  4J9C A;  1I07 A;  1OPL A;  2O9S A;  2QDL A;  3VS7 A;  1W1F A;  1XOV A;  4J9D A;  1BK2 A;  1UJ0 A;  2IIM A;  3VRZ A;  2CRE A;  2O2O A;  3EG0 A;  4F14 A;  2LJ1 A;  3M0P A;  3VS2 A;  1PNJ A;  2EGC A;  3PVL A;  2JS2 A;  2KRS A;  2RQW A;  2O9V A;  5GJW B;  3FJ5 A;  2DE0 X;  2DYB A;  4ORZ A;  5ECA A;  1CKA A;  2LQW A;  4J9I A;  2EPD A;  4Y92 A;  2DM1 A;  4IIM A;  1OV3 A;  5I22 A;  2J05 A;  1SRL A;  2JXB A;  2JMA A;  2RNA A;  3I35 A;  4E6R A;  2YUN A;  1UHC A;  2LNH B;  2XMF A;  3EG3 A;  4LUD A;  1U3O A;  2DL7 A;  2JM8 A;  1H8K A;  2L3S A;  2EYX A;  1QWF A;  1ABO A;  3NPF A;  3QWY A;  2K7A A;  1AD5 A;  1RI9 A;  1QLY A;  4LE9 A;  1K76 A;  5IHK A;  1PRL C;  2NWM A;  2OJ2 A;  2VKN A;  3VS5 A;  2AZS A;  2KE9 A;  2L3P A;  2EBP A;  2DMO A;  4RTT A;  1AEY A;  3U23 A;  1TUC A;  2FPD A;  1ZUK A;  3PVQ A;  2CUD A;  2KRN A;  1H3H A;  3RBB B;  4J9E A;  1NYF A;  3EG1 A;  1NM7 A;  1UDL A;  1YN8 A;  2L2P A;  1JQQ A;  1JXO A;  2JMC A;  2A36 A;  4JPB W;  4CC2 A;  1YCS B;  2YUO A;  2SEM A;  4JJB A;  4F16 A;  2GNC A;  1EFN A;  2OAW A;  4KRT A;  4AFS C;  2DNU A;  4OML A;  4JZ4 A;  3H0I A;  1HD3 A;  1WFW A;  2MIO A;  2O88 A;  3EHR A;  2HSP A;  2KYM A;  1UEC A;  2MCN A;  2L3Q A;  2HEQ A;  1OOT A;  1M3B A;  2JT4 A;  1RLP C;  4D8D A;  2DRK A;  1GBQ A;  1CSK A;  3KFV A;  2EVR A;  1ZLM A;  2RN8 A;  1GL5 A;  1AWO A;  2EGE A;  1WA7 A;  2HDA A;  3NHN A;  1OEB A;  2K3B A;  5FWC A;  4J9F A;  3PE0 A;  1S1N A;  2C0I A;  1JO8 A;  1KFZ A;  2LJ0 A;  2LX7 A;  3UF4 A;  4LNP A;  4AFU C;  1K0X A;  2PNI A;  2ROL A;  2P4R A;  2FO0 A;  1X2Q A;  2AKK A;  2DF6 A;  2EYY A;  4HXJ A;  2AZV A;  1UHF A;  4OMM A;  2RF0 A;  3JV3 A;  3ULR B;  2BZ8 A;  5FW9 A;  3VS6 A;  1GFD A;  2A08 A;  1WXB A;  4HVV A;  4EIK A;  2KT8 A;  1MV0 B; 
#chains in the Genus database with same CATH topology
 1OI1 A;  3QKJ A;  4QVD A;  2AHJ B;  4RTV A;  2CT4 A;  2M0Y A;  4J83 A;  2ZPI B;  2GGR A;  2CSQ A;  5GMK l;  3CCM T;  3T9N A;  3VUB A;  3M54 A;  3VYH B;  1YI2 T;  2MYS A;  4M78 C;  4JS5 A;  5LJ3 j;  1AWJ A;  1QP3 A;  3R6N A;  4ESR A;  1YJN Q;  1IO6 A;  4L59 A;  2D1X A;  3KXT A;  1SSF A;  2EW3 A;  2YT6 A;  2R5M A;  1NJI U;  1E6G A;  2OTJ A;  1TTH B;  3QO3 A;  2FB7 A;  1TU0 B;  4M77 C;  2CT3 A;  2DET A;  1D1C A;  2P0K A;  2EQI A;  1D3B A;  3MET A;  1N6A A;  2XDD A;  1VA7 A;  3J80 E;  2KNB B;  3FDR A;  3RDV A;  3GOX A;  4B9X A;  2DL3 A;  2BZX A;  4EMK C;  1JXM A;  1QVG P;  1YIT Q;  4HVW A;  1B07 A;  1TOV A;  5FU6 B;  2KR3 A;  3TSW A;  1WJR A;  1U5S A;  5GAN 3;  3UDC A;  3MHX A;  2YUP A;  3PMI A;  1W2B S;  4BI4 A;  3QDR B;  3UWN A;  1ABQ A;  1MMG A;  4BDY A;  3KUF A;  1R8O B;  5D6X A;  1KD1 R;  4ZTF A;  3V8K A;  3PTA A;  5KYN A;  4CC4 B;  2E6Z A;  3OYA A;  5GAN 6;  2F2W A;  3JCM b;  2XG8 D;  1KC8 R;  1M9S A;  3PNW C;  2K79 A;  4JLI A;  2RPN A;  3MEA A;  4NOY A;  2FZC B;  4RTW A;  1Y96 A;  1WNL A;  3CPW S;  2DA9 A;  3QII A;  2R5A A;  4JJD A;  3TU4 K;  1Q7Y U;  4RUG A;  2GQI A;  1GCQ A;  5LJ3 d;  1GBR A;  4PJJ A;  2BZY A;  2L0A A;  1PM3 A;  5FWB A;  4AFZ C;  3O5Z A;  1QQJ A;  3CC4 T;  1AHJ B;  2GQV A;  4M75 B;  2P4T A;  2RI5 A;  1UGV A;  2LCS A;  1E7O A;  2V8K A;  1X69 A;  2FYK A;  2GTJ A;  2KXD A;  5DY9 A;  1X6B A;  5CAI A;  2CZ1 B;  2EQM A;  5FRM A;  2EYW A;  4RCB A;  3CMA T;  2ED0 A;  4JS4 A;  2EYZ A;  1ZSZ A;  4J7F A;  1RL2 A;  2EKO A;  4PFP A;  2P0Q A;  5GAN 5;  1D0Y A;  2LMJ A;  2XHC A;  3CBM A;  3E9G A;  1Y57 A;  2V8I A;  1S72 A;  4II1 A;  1YHQ A;  1BU1 A;  4IUU A;  2MAM A;  3UT1 A;  3CXC A;  2WAC A;  1UJY A;  4DBH A;  1KQS S;  3V7R A;  2KXC A;  1WIE A;  3QYH B;  3CCE Q;  2QQR A;  4DEX A;  4OGC A;  1TS9 A;  1RAE B;  2BTT A;  2RJE A;  1UG1 A;  5FU7 B;  2DBM A;  3CCQ A;  3NGP A;  2C0O A;  4DBR A;  3C95 A;  1RI0 A;  4MDW A;  4ZTJ A;  3RMQ A;  1W2B A;  1Q82 C;  5LJ5 h;  3FC3 A;  3A8M B;  1G2B A;  1ZSG A;  3J7A F;  1WLP B;  4C0G A;  1BCM A;  1V76 A;  1VQL A;  4PFO A;  4M7A G;  1IRX A;  1NJI R;  1M1K U;  3EG2 A;  3V8J A;  1VQ4 Q;  2QTX A;  4M7D A;  3TRE A;  2OTJ Q;  2VB6 A;  2RHI A;  1X27 A;  2E6N A;  3AT1 B;  4DEY A;  1VQK A;  2W0Z A;  4M7A D;  1TUG B;  2M16 A;  1WYX A;  4M75 F;  1NG2 A;  2DJQ A;  1M30 A;  1SEM A;  1B3Q A;  3MKD A;  2RJC A;  5LJ3 h;  4FYY B;  1TSF A;  3M0U A;  4QQ6 A;  3VS1 A;  5A0G A;  4HCC A;  2YRV A;  1ZA2 B;  5LJ5 g;  1QCN A;  4AT1 B;  3CME A;  3H41 A;  2KGT A;  2K2V A;  1Z9Z A;  2ENM A;  1WDX A;  4MZP A;  4QW2 A;  2V1Q A;  2D9T A;  1M8M A;  3CD6 Q;  1VQO A;  2X3X D;  1VQ5 A;  5KH6 A;  3GP8 A;  4L6V 5;  5GAM j;  5CO7 A;  5C6S A;  4N4H A;  1O75 A;  5CKH A;  2OTL A;  2FZK B;  3OB9 A;  3QHS A;  1PKT A;  1QWE A;  3MEU A;  4GLM A;  5LJ3 g;  1K9M U;  1YWO A;  2DL8 A;  4Y28 E;  3OMC A;  2LNV A;  1BBZ A;  2VWF A;  3DB3 A;  1PSF A;  5LJ5 e;  2I0N A;  1YIJ A;  2KRM A;  3RNJ A;  4B9W A;  4NL3 A;  3X28 B;  1UUE A;  3L2Q A;  2BIV A;  1K73 C;  2EQU A;  2OX7 A;  2DD5 A;  4J8O A;  2YWW A;  2EYQ A;  1AWW A;  1I07 A;  1OUL A;  3E19 A;  5GAN 4;  3CC7 T;  2O9S A;  2K5I A;  2MMP A;  1UJ0 A;  4M7A E;  1G3S A;  3VRZ A;  1Q95 G;  2CRE A;  2F5T X;  2LC4 A;  2O2O A;  5EG2 A;  3CXC P;  2L8D A;  1SF9 A;  1MGQ A;  3PVL A;  5LJ3 e;  3X25 B;  4BI3 A;  3JCM P;  1YHQ Q;  4KH1 B;  3PFS A;  3L2Z A;  4M7D B;  3L2W A;  2O9V A;  4F04 B;  2X4Y A;  2BUD A;  3LH0 A;  1JB0 E;  1Q86 U;  2RHY A;  2DE0 X;  2DTO A;  3CCU A;  1CKA A;  2PUK B;  1WZO A;  3HKS A;  2LCC A;  2JXB A;  1YI2 Q;  1R0C B;  2YUN A;  4PJO A;  3RES A;  2ZPF B;  1U3O A;  5CQX A;  1VQN T;  4PJN A;  4C92 G;  5CKD A;  2NUT A;  3JCM V;  4KGX B;  3BY7 A;  1OQK A;  1QVP A;  2EQJ A;  2V26 A;  2ATC B;  3CC2 T;  3OYF A;  3A8O B;  4C92 D;  3MCA B;  4ZN3 A;  2A0F B;  3JB9 F;  3NFC A;  2LQK A;  2EBP A;  4M78 G;  2M9U A;  4EMG A;  1EX4 A;  4XQ3 A;  2CUD A;  3I55 T;  3RBB B;  1VQK Q;  5GAO q;  3JRZ A;  4JRP A;  5GMK i;  1P92 A;  3G71 T;  2CP0 A;  3BDL A;  1IXD A;  1YJ9 A;  4JJB A;  5IAY A;  1BI3 A;  2GNC A;  3CME Q;  2OAW A;  4KRT A;  1VQ7 A;  1EIF A;  2DNU A;  4X9D A;  1G3W A;  2DXB A;  2F5K A;  1N8R U;  2D0Q B;  1VQ5 Q;  4M7D F;  2KYM A;  1BI0 A;  1UEC A;  5FRO A;  2MCN A;  2L3Q A;  2HEQ A;  3OQ5 A;  3RKY A;  3S3O A;  3G4S A;  2RK1 A;  1GBQ A;  3S3N A;  2M0O A;  2DTI A;  5CCA A;  2EGE A;  3VUZ A;  5GAN h;  2QDY B;  2C0I A;  1RAH B;  4XTX A;  2DZC A;  4BY6 B;  4MDX A;  1KFZ A;  3UF4 A;  4OGE A;  2G3R A;  2VYT A;  4KGV B;  3CC4 Q;  4XU3 A;  2DER A;  1I8F A;  1X2Q A;  4JUV A;  2H3E B;  2EYY A;  4HXJ A;  4C92 E;  3OBY A;  4CRI A;  3ULR B;  4PJO B;  3BE3 A;  5GAM h;  2D6F A;  3VS6 A;  1GFD A;  2LVM A;  1XTD A;  3M59 A;  3PMT A;  5I2S A;  1YJW T;  2KT8 A;  4JRQ A;  3CMA Q;  1OU9 A;  2HBP A;  4M7A C;  1QP2 A;  1V1C A;  4J9G A;  4M78 E;  4AG1 C;  4M4Z A;  4V2S A;  2ZCF B;  2AIR B;  2RJD A;  4LDV A;  2VUB A;  3QPH A;  3FIF A;  4RTX A;  2EJF A;  4X9C A;  5J3B A;  4FT2 A;  4NS5 A;  1IGU A;  5GAN 8;  2QEX T;  2QQ9 A;  2DPP B;  3CCU Q;  2DL4 A;  2GF7 A;  5GAM g;  2ZPH B;  1VQ8 T;  2CDT A;  2A28 A;  4B6M A;  4DBF A;  2LX9 A;  2IVW A;  2K4Y A;  1SG5 A;  2E70 A;  3ZFJ A;  4C8Q B;  3OYB A;  4J9H A;  1Z9Q A;  4UC4 A;  4OMQ A;  1AOJ A;  2JZ2 A;  5GAN e;  3HHT B;  4E7K A;  4N0A C;  5KYX B;  1VQ9 T;  4C0Z A;  4HCB A;  3M0R A;  1KD1 U;  1QVF P;  2DVJ A;  4QVC A;  3GBQ A;  1PHT A;  2KK4 A;  3VS3 A;  1KJW A;  5CKB A;  2V1R A;  1IB8 A;  1VIE A;  4DA4 A;  1KC8 U;  3CCS T;  2CYZ B;  1VQP A;  2E12 A;  2RQT A;  5GAM e;  4M78 A;  4PJO F;  2J7I A;  4KGZ B;  4R55 A;  5IT9 E;  1GRI A;  1Y0M A;  3OW2 P;  1LPL A;  3EFS A;  1D0X A;  1XNI A;  1HSQ A;  2VGM A;  4LD9 K;  1NPP A;  2XIC A;  4A63 B;  5L23 A;  1JU5 C;  4OMP A;  3EGU A;  2E65 A;  2DIL A;  2DZ9 A;  3ER0 A;  2MWO A;  2O4X B;  4J6Y A;  1RAB B;  2E4H A;  3OA6 A;  4EMK A;  4C5E A;  1ACM B;  1M1F A;  2IPO B;  3C94 A;  4F7U G;  3N5B B;  1JBM A;  1SRM A;  5KYY A;  3L42 A;  1M1K C;  5LJ3 f;  2W10 A;  3M57 A;  1B34 B;  2KYB A;  4MZM A;  1WXU A;  2PUO B;  1N27 A;  3M53 A;  4PJL A;  4C8Q F;  2RM4 A;  3CCE A;  3OYK A;  4C92 C;  2VAS A;  2RQU A;  4O6J A;  4OMO A;  3CCV T;  4J6W A;  3A5Z B;  3LGF A;  1I5L A;  3JB9 G;  3CC7 Q;  2P84 A;  4RTY A;  3H9N A;  3A1P A;  2RMO A;  5HKC A;  1PCX A;  2KEA A;  3JB9 D;  1UE9 A;  2E5K A;  2GTO A;  2PVO B;  2X35 A;  2YLC A;  2JOY A;  5KCO A;  1OZ3 A;  1UTI A;  3HRS A;  3EFO B;  3WVD B;  2DVE A;  3S6W A;  3CCL T;  1VQ4 A;  3CBO A;  1ZA1 B;  1H3Z A;  2J06 A;  2D0N A;  5GAO r;  1X75 C;  1NBE B;  1KK7 A;  4JJC A;  2X4X A;  3HPW A;  4N4I A;  4ATO A;  1VYV A;  4C5G A;  2KRO A;  2COZ A;  2DK3 A;  2EQK A;  3QUI A;  1VQN Q;  2ZGW A;  4HT8 A;  2GFU A;  1M90 C;  2CZ6 B;  3JCM e;  2YRD A;  1RAC B;  2ESW A;  4M77 B;  3IQL A;  3CD6 A;  4HCK A;  5LJ5 d;  5CIU A;  2C06 A;  4CC3 A;  1C6V X;  4F7U E;  5GAN 7;  4FT4 A;  2XU8 A;  4AG2 C;  2J6F A;  5IN1 A;  1IRE B;  4EMK B;  1RLQ C;  1FX7 A;  1K73 R;  3I55 Q;  2RB6 A;  2XKO C;  4AFQ C;  1N5Z A;  3CEY A;  5KYY B;  4GLK A;  2I2L A;  1VQP Q;  3EG9 A;  2J6O A;  5KYW B;  1FXX A;  3BDU A;  3G71 Q;  1Q86 C;  1RUW A;  1BB9 A;  2ED1 A;  4QT7 A;  4AMC A;  9ATC B;  3EFR A;  2MOX A;  2C0T A;  1I81 A;  3A8L B;  3HFO A;  3E2U A;  4YTL A;  1MV3 A;  4A4E A;  4HA8 A;  2G6F X;  4RG2 A;  4ZN1 A;  2NLU A;  3JAM E;  3EH1 A;  5GMK m;  1PD0 A;  3J81 E;  4E7J A;  4EPC A;  2HQH A;  1F1B B;  2XDB A;  1BI1 A;  3OYN A;  1IHV A;  4P5N A;  1I5O B;  5IXF A;  2ABL A;  1OPK A;  1X01 A;  4O5V A;  5I21 A;  4RTZ A;  1OPL A;  2MF2 A;  2O01 E;  2RHZ A;  2HZY A;  1W1F A;  4J9D A;  3E1S A;  1BK2 A;  2IIM A;  2V8J A;  5M9O A;  3S3M A;  2LJ1 A;  3CCM A;  4HT9 A;  1D3B B;  2WSF E;  4M77 F;  2QXF A;  2JS2 A;  3WXM B;  3HRT A;  1YJW Q;  1YI2 A;  4PJM A;  2NUP A;  4D6W A;  4LDX A;  2DYB A;  4OB3 B;  2LQW A;  4Y92 A;  1X6O A;  1OV3 A;  4FM4 B;  4DBQ A;  4A54 A;  3I56 T;  1N8R C;  2JMA A;  2RNA A;  1KG1 A;  2QGF B;  1UHC A;  2HL5 C;  2LNH B;  2XMF A;  3EG3 A;  3R6O A;  2DL7 A;  5GAN 2;  2EYX A;  3INZ A;  2QEX Q;  1QWF A;  1ABO A;  3QWY A;  1JJ2 S;  4BAC A;  2K7A A;  1AD5 A;  1QLY A;  5IHK A;  1K76 A;  1VQ8 Q;  1M2V A;  3CPW A;  2K5F A;  3EG9 B;  1Y96 B;  5GAM f;  1PRL C;  3V8L A;  1UB4 A;  1K8A C;  2XDP A;  2L3P A;  4BD3 A;  4RTT A;  2EFI A;  3C12 A;  2L5Q A;  5GAN j;  2FPD A;  3CCJ T;  3PVQ A;  1H3H A;  4C0D C;  3HSB A;  2KAF A;  3QZ5 B;  1VQ9 Q;  1VQ6 T;  1NYF A;  2VXE A;  4C5I A;  1EZZ B;  4FYW B;  2F1L A;  3JB9 H;  2JMC A;  2A36 A;  4C8Q G;  1HXD A;  3CCS Q;  2VV5 A;  4OB2 B;  4VUB A;  1EFN A;  1ZSZ B;  4RCC A;  3SB2 A;  2JJ9 A;  2XK0 A;  4LXC A;  4PLI A;  4C8Q D;  3OYL A;  2COW A;  3JCM c;  1G8X A;  1YJ9 T;  3LLR A;  4N4G A;  2O88 A;  4IKF A;  1QMC A;  1OOT A;  1KQS A;  4OVA A;  4D8D A;  3CC4 A;  2DRK A;  1XQH A;  5KYU A;  1ZLM A;  1N9R A;  1AWO A;  2ZPG B;  1WA7 A;  4OB0 B;  2HDA A;  3NHN A;  5J26 A;  1SKU B;  3PE0 A;  1S1N A;  3EH2 A;  2NUP B;  1JO8 A;  4FU6 A;  2KI7 A;  3G4S T;  2MK5 A;  4JRI A;  3CMA A;  2IG0 A;  3EGX A;  1K0X A;  4MZT A;  2PNI A;  2P4R A;  2FO0 A;  2RI3 A;  2AKK A;  3F70 A;  4OMM A;  2RF0 A;  2Y4Y A;  2BZ8 A;  3M58 A;  2A08 A;  2EWN A;  2HMA A;  1YBY A;  4EIK A;  1UGQ B;  2NYS A;  1KC8 C;  2LRQ A;  3NTK A;  1MV0 B;  5GAN d;  4L5G A;  4D8K A;  2D8H A;  2D8J A;  3CCR T;  4FSS A;  3OYY A;  5HCK A;  2ROT A;  2AT1 B;  3CCV Q;  3HFN A;  2FL7 A;  1YNZ A;  1T3L A;  2DJZ A;  4JZ3 A;  3CCM Q;  4XTV A;  2HSE B;  3M4G A;  1UFF A;  3RR6 A;  1W2B P;  1YJN T;  1AVZ C;  2XD0 A;  1RAI B;  3ZBD A;  5GAM d;  1MHN A;  4QQG A;  2KSS A;  2X4J A;  2FZG B;  3EGD A;  3FRN A;  1MNE A;  1LVK A;  2LJ3 A;  4LD6 A;  2L3R A;  4RTU A;  1PD1 A;  3OS5 A;  4XTY A;  2DXC A;  2OAU A;  4FIB A;  1N9S A;  2E3I A;  1VQM T;  4BE1 A;  2BE9 B;  5IHN A;  2YDL A;  3CCL Q;  2FPE A;  5IXB A;  2DX1 A;  4OMN A;  2DRM A;  1W4S A;  2DLP A;  3CPW P;  2HQE A;  1PG5 B;  1RAD B;  3HTR A;  1Q81 R;  2CP2 A;  3DB4 A;  3I5R A;  2YHT A;  4E47 A;  1WHJ A;  1YIT T;  2A37 A;  3NMZ C;  4M7A A;  1KIK A;  2QA4 T;  1HJD A;  2SRC A;  1NPR A;  1KHI A;  2A7Y A;  4DOW A;  3X26 B;  2FPF A;  3UA7 A;  2M1H A;  1LJO A;  2DXT A;  1NEB A;  4ME7 A;  2QI2 A;  3MPU B;  1UGS B;  2Y90 A;  2NUZ A;  3HL8 A;  4LUE A;  4GBQ A;  5AYF A;  3SWN C;  1FYN A;  5FRN A;  3LW5 E;  1K0S A;  1ZQ1 A;  2PTK A;  3EGX B;  3OSS C;  2LQ8 A;  2KBT A;  2OI3 A;  2JW4 A;  1UGR B;  2CP5 A;  1ZUU A;  2A3L A;  1X2K A;  2E3H A;  2O31 A;  4GY5 A;  1XJW B;  1NJI C;  1KQS P;  3RKX A;  2LZ6 B;  4C0F A;  4FYV B;  2DFU A;  2FRW A;  1K1Z A;  3TVT A;  3X20 B;  3G6E T;  3GF5 A;  4N0A A;  1QVG S;  4J7I A;  7AT1 B;  4HVU A;  2RD1 A;  2GBQ A;  1OU8 A;  4CC7 A;  3OYD A;  3VS0 A;  1ARK A;  1G3Y A;  2YUQ A;  3CC7 A;  1RAA B;  4IUV A;  3MP8 A;  4E7L A;  4FW2 A;  3EGD B;  4E7I A;  3GNG A;  2NUT B;  4Z89 A;  3ASK A;  1X6G A;  1M27 C;  2HCK A;  1YWP A;  4M75 G;  2LT4 A;  5GAN g;  4E7Z A;  4RKU E;  2LQN A;  3MEW A;  2AK5 A;  1KSW A;  3JCM d;  2JS0 A;  4M75 D;  3M5A A;  2R57 A;  1D0Z A;  1WHH A;  4R0K A;  5IHI A;  1W6X A;  2CP7 A;  4M7A B;  1M1G A;  3LWH A;  1Q7Y C;  4K11 A;  1BIB A;  1VQN A;  2HQX A;  1QKW A;  2RJF A;  3JB9 J;  1RAF B;  1GCP A;  4C8Q C;  4BDZ A;  1FMV A;  2QYZ A;  3I56 Q;  2QQB A;  2JNG A;  2JM9 A;  2X3W D;  3CQT A;  5D6Y A;  4IUQ A;  2X9H A;  3TSZ A;  2LTO A;  4XU2 A;  1K4U S;  1C1A A;  4IUT A;  2OTJ T;  2YSQ A;  5FLX E;  5A2Q E;  4C92 A;  1NLP C;  2M51 A;  2JTM A;  1IZ6 A;  2EKH A;  1PKS A;  1I4K 1;  3V7C A;  1SPK A;  5GMK e;  3OBW A;  1K73 U;  2LDM A;  3I55 A;  3LH5 A;  2JN0 A;  1LCK A;  4HCZ A;  3C0C A;  2PQW A;  1RAG B;  1AWX A;  1U1T A;  1AT1 B;  1VYT A;  1QVG A;  1QCF A;  3G71 A;  2K3X A;  1DJ7 B;  3CCJ Q;  4EMH A;  1W70 A;  5HY6 A;  1QKX A;  1NLO C;  2E5Q A;  5LJ5 f;  3M9Q A;  4E2F B;  3OYJ A;  1K9A A;  3OYI A;  3OYC A;  4LDU A;  1YFN A;  4ANJ A;  3GLX A;  4M75 E;  4ZNX A;  4WCI A;  2K6D A;  2RQV A;  1AZE A;  1FMK A;  1X43 A;  1T3S A;  2DEQ A;  4FL6 A;  8ATC B;  2E10 A;  1M2O A;  3QJY A;  3ZEH A;  4BI8 B;  2B8A A;  3THK A;  3AHU A;  3CBP A;  4M7A F;  1J3T A;  3SEM A;  2JTF A;  2QTV A;  2XID A;  2FRY A;  3JCM h;  1WGS A;  4QKU A;  2QQS A;  3TCJ A;  1U8R A;  4FYX B;  1I0C A;  2ZPB B;  5I2M A;  1FWZ A;  2CUB A;  1WX6 A;  4WTO B;  2B86 A;  1Q82 R;  5L8R E;  2FEI A;  3OS1 A;  5AT1 B;  3OYE A;  4J9C A;  5D7U A;  1YJW A;  4FW1 A;  1O9S A;  2QDL A;  8AT1 B;  1WJS A;  1XOV A;  2H3J A;  3ME9 A;  3M55 A;  4F14 A;  5HK0 A;  1D1A A;  3M0P A;  3VS2 A;  1PNJ A;  1R77 A;  1S72 T;  3MP6 A;  1YHQ T;  2QG9 B;  3JCM W;  1K8A R;  4PNO A;  2K5L A;  2KRS A;  3JCM g;  4C92 B;  2RQW A;  2RHX A;  1Y71 A;  1QCO A;  1R0B G;  1WQ7 A;  2LCL A;  3FJ5 A;  3P8B B;  1VIF A;  3PGG A;  3CCR Q;  5GAO n;  4M75 A;  4OF1 A;  2DYI A;  4ORZ A;  2QEX A;  1OZ2 A;  2EPD A;  2DKG A;  2DM1 A;  4IIM A;  1G3T A;  5I22 A;  2J05 A;  2DD4 A;  3CCQ T;  1VQ8 A;  3I35 A;  4E6R A;  4M78 B;  3TQ7 P;  1K9M C;  4LUD A;  1WHG A;  2JM8 A;  3QDF A;  1NE8 A;  3LWI A;  3V7S A;  4M7D G;  4PLL A;  3G1J A;  5FU6 C;  4OMF B;  1RI9 A;  4LE9 A;  1VQL T;  3A8H B;  1VQ9 A;  3CXC S;  4M7D D;  3CC2 Q;  2OJ2 A;  1MND A;  1VQM Q;  4FSX A;  3RIR A;  2KE9 A;  1AEY A;  3U23 A;  3FB9 A;  1TUC A;  1ZUK A;  1VQK T;  4KUI A;  3CCS A;  4PFZ A;  1WPY A;  2QA4 Q;  4ZGE B;  4J9E A;  3OYM A;  4QQD A;  2L2P A;  3MEV A;  3CME T;  4CC2 A;  1YCS B;  4XU0 A;  1VQO T;  4OML A;  1VQ5 T;  2X4W A;  3H0I A;  5CQY A;  2CS7 A;  1WFW A;  4OP0 A;  2MIO A;  4C92 F;  5J39 A;  4M75 C;  2HKQ B;  3EHR A;  3OSV A;  3WVE B;  3LGL A;  3L2R A;  4BUG A;  1RLP C;  2FVU A;  2OTL T;  2E41 A;  1CSK A;  4JLG A;  3M4Y A;  3O8V A;  4JRK A;  2WSE E;  3QG1 A;  2WSC E;  1OEB A;  5GAO p;  2K3B A;  5FWC A;  3QYG B;  4J9F A;  1TXQ A;  3DLL A;  3PT9 A;  1LOJ A;  4M78 F;  1LNX A;  3G6E Q;  2LJ0 A;  2LX7 A;  1YIJ T;  3C4S A;  4LNP A;  4AFU C;  3BW1 A;  4WF2 A;  1H64 1;  4F7U A;  4JJN K;  4DOV A;  4KH0 B;  2AZV A;  1YCY A;  2EIF A;  3M56 A;  4M7D E;  1HK9 A;  4KUD K;  3CCV A;  3GIB A;  4XAX B;  1UEB A;  3OYG A;  5FW9 A;  4KBM B;  1Y7X A;  1MMN A;  1VUB A;  1WXB A;  4J5Y A;  2QAZ A;  3OY9 A;  5FU7 C;  5IH2 A;  1A0N B;  1M3A A;  3VRY A;  3OS2 A;  3I9Q A;  5DLQ E;  1KQ1 A;  2JUF A;  1BIA A;  1E6H A;  2CGH A;  2ZZD A;  3DLM A;  5GAO l;  1QW1 A;  2DAQ A;  2J6K A;  3VV0 A;  1M4Z A;  5GAN f;  1ZBJ A;  1H92 A;  4PJO G;  4DQ2 A;  1CKB A;  1SHG A;  3CCL A;  1WJQ A;  1M8V A;  4ZGJ B;  4BE2 A;  3CCU T;  4F17 A;  4PJO D;  1Q81 U;  2JTE A;  3NTH A;  2Y4X A;  1G83 A;  3I5S A;  1T0J A;  5KCH A;  2PU9 B;  2RO0 A;  3JSC A;  3VKI A;  5CKE A;  2L89 A;  1BKB A;  3P8H A;  1T0H A;  2R58 A;  3REB B;  1GCQ C;  4EDU A;  4A4F A;  1SHF A;  4Y91 A;  1TG0 A;  2DBK A;  2P0P A;  5I11 A;  1NYG A;  2PZ1 A;  1V29 B;  3REA B;  1ZUY A;  5GMK j;  1M5Q 1;  4Z88 A;  1ZSZ C;  2DEU A;  2BKD N;  2K3Y A;  1B7T A;  5DM7 R;  2EGA A;  4KT0 E;  1U1S A;  4C0D B;  2CH4 W;  4MML A;  4F7U B;  4XU1 A;  4E7H A;  5KE2 A;  1FMW A;  3OS0 A;  5DLO A;  1VQ7 T;  5D6W A;  1MMA A;  3P8D A;  5KE3 A;  1KQ2 A;  4ZGD B;  1VYU A;  3M0T A;  1QVF S;  5GJV B;  5CK9 A;  3JB9 I;  4PJO E;  3L2V A;  1PSE A;  3A98 A;  4R56 A;  4Z8A A;  3ZL7 C;  3QWX X;  3H6Z A;  3EHQ A;  4Z02 A;  4JDS A;  1Q7Y R;  4KUL A;  1KD1 C;  1Y07 A;  5GAO m;  1AZG B;  1M90 U;  4A53 A;  2AKL A;  1I1J A;  3OW2 S;  1BI2 A;  2DL5 A;  3SWN A;  4M7D C;  3BFM A;  4RMO A;  2BE7 D;  1JEG A;  1JJ2 A;  3H0F A;  3SDZ A;  3UAT A;  2EAY A;  1M2V B;  3E9F A;  1SSH A;  2RH2 A;  2CSI A;  1IGQ A;  2E64 A;  3L2U A;  4LDW A;  2FHD A;  1OX8 A;  4X34 A;  1U06 A;  2DTH A;  3MJX A;  3LYI A;  2F2X A;  2RI2 A;  2K57 A;  1S72 Q;  3FEO A;  1KHC A;  1TUD A;  3I56 A;  1PC0 A;  4C8Q E;  3JCM f;  3JCM Q;  1WXT A;  2F2V A;  4F7U F;  2DO3 A;  4IUR A;  3CCQ Q;  2HKN A;  1MUZ A;  5EC7 A;  2VVK A;  3G7Z A;  4BB7 A;  2QK0 A;  4A4H A;  1WI7 A;  1WQW A;  3RER A;  1VOM A;  4J9B A;  1YP5 A;  2MWP A;  2VGN A;  3CCJ A;  2LT1 A;  2CP3 A;  2HBW A;  2RHU A;  4X1V A;  2H8H A;  2RK2 A;  1VQL Q;  3VS4 A;  1VQ6 A;  5KYU B;  1OYX A;  2QQA A;  3QJ6 A;  4OB1 B;  1QVF A;  2KT1 A;  3H8Z A;  1M1K R;  3A8G B;  3DKM A;  2VXF A;  3MO8 A;  3RMS A;  2LP5 A;  2CZ7 B;  2ECZ A;  3L1A A;  4M78 D;  3UPU A;  5A0D A;  3VJP A;  1VQP T;  4J6X A;  3HRU A;  2GFA A;  1JRI A;  2FG0 A;  1WHM A;  3M0Q A;  4M77 G;  4RG8 A;  3H0H A;  4C8Q A;  1NEG A;  1PWT A;  4IIO A;  2F69 A;  3OW2 A;  3HP9 A;  2YRC A;  1G5V A;  2CH4 A;  2K2M A;  1GFC A;  4M77 D;  3SWN B;  3M0S A;  4LN2 A;  2ZPE B;  5C0M A;  4BY6 C;  6AT1 B;  5KYX A;  1Q82 U;  3SHW A;  1VQO Q;  1HYO A;  4BE0 A;  2RQR A;  1M3C A;  4XTZ A;  5GMK h;  3KBG A;  4PJO C;  1D1B A;  4PKC C;  2PVD B;  2OTL Q;  1ZX6 A;  3UA6 A;  1UGP B;  2QAS A;  2K9G A;  5CR2 A;  1K9M R;  1PRM C;  1K8A U;  2PVG B;  5HK3 A;  1WHL A;  2KY9 A;  2KQW A;  1YIJ Q;  4C5H A;  3VS7 A;  1JJ2 P;  3SD4 A;  2QGG A;  2Z0W A;  3CCR A;  3CCE T;  4MMK A;  1M90 R;  3EG0 A;  3TEE A;  2CKK A;  1TWB A;  2EGC A;  1NZ9 A;  1TH7 A;  2XI9 A;  1OX9 A;  5CVI A;  2KDS A;  2O4X A;  1C0M A;  1YJN A;  4ELZ C;  5GJW B;  1BCO A;  4CI0 C;  1ZHI A;  4HKE A;  5ECA A;  1BYM A;  4J9I A;  4LDY A;  1GXI E;  2EJ9 A;  4IUP A;  1SRL A;  1B34 A;  3JCM J;  4PK4 A;  2MI6 A;  1WHK A;  3CC2 A;  3URG A;  1VQM A;  4TVR A;  1H8K A;  2DIG A;  2L3S A;  1VQ4 T;  2EJG A;  1Q86 R;  4M77 E;  5CKF A;  3FLG A;  3QBY A;  1IHW A;  3NPF A;  2COY A;  3GNF B;  1YIT A;  2HNI A;  2YXY A;  2QA4 A;  2NWM A;  2VC8 A;  3D7S B;  2VKN A;  3VS5 A;  3OYH A;  2AZS A;  3Q1J A;  2DMO A;  3GPL A;  3LX7 A;  4QVZ A;  2KRN A;  2KVQ G;  3EFO A;  3CD6 T;  3X24 B;  4XK8 E;  3QZ9 B;  2YLB A;  4FCY A;  3SFM A;  4E7S A;  1D09 B;  3EG1 A;  1ZBX A;  3RKW A;  1VQ6 Q;  1NM7 A;  1UDL A;  4A4K A;  1YN8 A;  1JQQ A;  1JXO A;  4JPB W;  4Q5W A;  2YUO A;  1MMD A;  2SEM A;  4F16 A;  3VU3 C;  4AFS C;  2X51 A;  4A4G A;  4JZ4 A;  5A0L A;  1HD3 A;  3QSU A;  3OMG A;  3JCM X;  2HSP A;  2DXU A;  4XTW A;  1YJ9 Q;  2E1H A;  2KMT A;  3PIO A;  3G6E A;  1M3B A;  2M02 A;  2HL3 A;  4M77 A;  2JT4 A;  3MP1 A;  4PL6 A;  1Q81 C;  4NL2 A;  1VQ7 Q;  2DIQ A;  3KFV A;  2EVR A;  2GCX A;  2RN8 A;  1GL5 A;  1N8R R;  2JVV A;  2ZAE A;  2MPX C;  3CPF A;  3G4S Q;  2ROL A;  2CZ0 B;  2DF6 A;  2RA2 A;  5LJ5 j;  1UHF A;  2CP6 A;  5LL6 S;  2HAX A;  5KYW A;  3PIP A;  3FJP A;  3JV3 A;  3EAE A;  2HD0 A;  4ELY C;  3QXE B;  4XTU A;  3RUX A;  4HVV A;  3VYG A;  3NTI A; 
#chains in the Genus database with same CATH homology
 4D8K A;  2D8H A;  2D8J A;  4RTV A;  5IH2 A;  2CT4 A;  1V1C A;  2M0Y A;  1A0N B;  1M3A A;  3VRY A;  3I9Q A;  2GGR A;  2CSQ A;  4FSS A;  4J9G A;  5HCK A;  2ROT A;  4AG1 C;  4M4Z A;  1E6H A;  1YNZ A;  1T3L A;  4JZ3 A;  2J6K A;  1ZBJ A;  1UFF A;  1H92 A;  1AVZ C;  4RTX A;  1AWJ A;  1CKB A;  1SHG A;  3R6N A;  4ESR A;  1IO6 A;  2D1X A;  4F17 A;  2EW3 A;  2YT6 A;  2JTE A;  2DL4 A;  2LJ3 A;  1G83 A;  3I5S A;  1T0J A;  4RTU A;  2CDT A;  2A28 A;  1E6G A;  5IHN A;  2YDL A;  2CT3 A;  2FPE A;  5IXB A;  2DX1 A;  4OMN A;  2DRM A;  2DLP A;  4J9H A;  1T0H A;  1Z9Q A;  2EQI A;  3REB B;  4OMQ A;  1GCQ C;  1AOJ A;  1SHF A;  1VA7 A;  3I5R A;  2KNB B;  2A37 A;  1TG0 A;  2BZX A;  2DBK A;  2DL3 A;  3NMZ C;  1KIK A;  1HJD A;  2SRC A;  3M0R A;  2DVJ A;  5I11 A;  1JXM A;  3GBQ A;  1PHT A;  4HVW A;  1B07 A;  1NYG A;  2PZ1 A;  2KR3 A;  3REA B;  3VS3 A;  1KJW A;  3TSW A;  1U5S A;  1ZUY A;  2V1R A;  2FPF A;  3UA7 A;  2YUP A;  1NEB A;  1ABQ A;  4Z88 A;  2RQT A;  2NUZ A;  4LUE A;  2J7I A;  2EGA A;  4GBQ A;  1FYN A;  4CC4 B;  1GRI A;  1Y0M A;  2CH4 W;  1K0S A;  2F2W A;  2PTK A;  2K79 A;  2RPN A;  2KBT A;  1HSQ A;  2OI3 A;  2JW4 A;  4RTW A;  1ZUU A;  2DA9 A;  4A63 B;  1X2K A;  4JJD A;  5L23 A;  1JU5 C;  2O31 A;  4OMP A;  1VYU A;  3EGU A;  4RUG A;  2LZ6 B;  2GQI A;  1GCQ A;  2FRW A;  1K1Z A;  3M0T A;  3TVT A;  1GBR A;  2BZY A;  2L0A A;  2DIL A;  5GJV B;  5FWB A;  4AFZ C;  3O5Z A;  4HVU A;  3A98 A;  4Z8A A;  3ZL7 C;  3QWX X;  2GBQ A;  1UGV A;  4CC7 A;  3EHQ A;  2LCS A;  3VS0 A;  1SRM A;  1E7O A;  1ARK A;  1X69 A;  2GTJ A;  2KXD A;  2W10 A;  2YUQ A;  1X6B A;  2EYW A;  2KYB A;  1AZG B;  2ED0 A;  1WXU A;  2EYZ A;  2AKL A;  1I1J A;  2DL5 A;  2RQU A;  2LMJ A;  4Z89 A;  1JEG A;  3H0F A;  1Y57 A;  4OMO A;  1X6G A;  1M27 C;  2HCK A;  3UAT A;  1BU1 A;  1YWP A;  1SSH A;  2LQN A;  2CSI A;  2AK5 A;  1UJY A;  1KSW A;  4RTY A;  2KXC A;  1WIE A;  2JS0 A;  2RMO A;  1U06 A;  2KEA A;  2F2X A;  1UE9 A;  2E5K A;  4DEX A;  2GTO A;  4R0K A;  5IHI A;  1W6X A;  2BTT A;  1TUD A;  1UG1 A;  2DBM A;  3NGP A;  1UTI A;  2C0O A;  4K11 A;  1QKW A;  1WXT A;  2J06 A;  2F2V A;  2D0N A;  1GCP A;  1G2B A;  1ZSG A;  1WLP B;  2JM9 A;  2X3W D;  1MUZ A;  3CQT A;  4JJC A;  2VVK A;  5EC7 A;  3TSZ A;  1VYV A;  1K4U S;  2YSQ A;  2KRO A;  1WI7 A;  1NLP C;  2M51 A;  3EG2 A;  4J9B A;  1YP5 A;  2EKH A;  1PKS A;  1X27 A;  4DEY A;  1SPK A;  2HBW A;  2W0Z A;  1WYX A;  2ESW A;  4X1V A;  2H8H A;  3IQL A;  1NG2 A;  3VS4 A;  2DJQ A;  3LH5 A;  1M30 A;  1SEM A;  4HCK A;  1B3Q A;  1LCK A;  2KT1 A;  3C0C A;  4CC3 A;  1AWX A;  1VYT A;  3M0U A;  4AG2 C;  3VS1 A;  1QCF A;  2J6F A;  3H41 A;  2LP5 A;  1W70 A;  2KGT A;  2ECZ A;  1Z9Z A;  1QKX A;  1RLQ C;  2ENM A;  1WDX A;  1NLO C;  2V1Q A;  1N5Z A;  4AFQ C;  1M8M A;  2FG0 A;  2X3X D;  2J6O A;  3M0Q A;  1K9A A;  3H0H A;  1NEG A;  1PWT A;  4IIO A;  4ZNX A;  1RUW A;  4WCI A;  2K6D A;  2RQV A;  1AZE A;  1FMK A;  1BB9 A;  2CH4 A;  2K2M A;  1GFC A;  1X43 A;  3M0S A;  4LN2 A;  2ED1 A;  4QT7 A;  1T3S A;  3SHW A;  2MOX A;  2C0T A;  3THK A;  1PKT A;  1QWE A;  4GLM A;  1J3T A;  3SEM A;  2RQR A;  1YWO A;  1M3C A;  1MV3 A;  2DL8 A;  2FRY A;  1BBZ A;  2VWF A;  2G6F X;  2I0N A;  1I0C A;  2KRM A;  1ZX6 A;  3RNJ A;  3UA6 A;  2CUB A;  1WX6 A;  1UUE A;  2B86 A;  2FEI A;  5IXF A;  2ABL A;  1OPK A;  2K9G A;  4RTZ A;  1PRM C;  1AWW A;  4J9C A;  1I07 A;  1OPL A;  2O9S A;  2QDL A;  3VS7 A;  1W1F A;  1XOV A;  4J9D A;  1BK2 A;  1UJ0 A;  2IIM A;  3VRZ A;  2CRE A;  2O2O A;  3EG0 A;  4F14 A;  2LJ1 A;  3M0P A;  3VS2 A;  1PNJ A;  2EGC A;  3PVL A;  2JS2 A;  2KRS A;  2RQW A;  2O9V A;  5GJW B;  3FJ5 A;  2DE0 X;  2DYB A;  4ORZ A;  5ECA A;  1CKA A;  2LQW A;  4J9I A;  2EPD A;  4Y92 A;  2DM1 A;  4IIM A;  1OV3 A;  5I22 A;  2J05 A;  1SRL A;  2JXB A;  2JMA A;  2RNA A;  3I35 A;  4E6R A;  2YUN A;  1UHC A;  2LNH B;  2XMF A;  3EG3 A;  4LUD A;  1U3O A;  2DL7 A;  2JM8 A;  1H8K A;  2L3S A;  2EYX A;  1QWF A;  1ABO A;  3NPF A;  3QWY A;  2K7A A;  1AD5 A;  1RI9 A;  1QLY A;  4LE9 A;  1K76 A;  5IHK A;  1PRL C;  2NWM A;  2OJ2 A;  2VKN A;  3VS5 A;  2AZS A;  2KE9 A;  2L3P A;  2EBP A;  2DMO A;  4RTT A;  1AEY A;  3U23 A;  1TUC A;  2FPD A;  1ZUK A;  3PVQ A;  2CUD A;  2KRN A;  1H3H A;  3RBB B;  4J9E A;  1NYF A;  3EG1 A;  1NM7 A;  1UDL A;  1YN8 A;  2L2P A;  1JQQ A;  1JXO A;  2JMC A;  2A36 A;  4JPB W;  4CC2 A;  1YCS B;  2YUO A;  2SEM A;  4JJB A;  4F16 A;  2GNC A;  1EFN A;  2OAW A;  4KRT A;  4AFS C;  2DNU A;  4OML A;  4JZ4 A;  3H0I A;  1HD3 A;  1WFW A;  2MIO A;  2O88 A;  3EHR A;  2HSP A;  2KYM A;  1UEC A;  2MCN A;  2L3Q A;  2HEQ A;  1OOT A;  1M3B A;  2JT4 A;  1RLP C;  4D8D A;  2DRK A;  1GBQ A;  1CSK A;  3KFV A;  2EVR A;  1ZLM A;  2RN8 A;  1GL5 A;  1AWO A;  2EGE A;  1WA7 A;  2HDA A;  3NHN A;  1OEB A;  2K3B A;  5FWC A;  4J9F A;  3PE0 A;  1S1N A;  2C0I A;  1JO8 A;  1KFZ A;  2LJ0 A;  2LX7 A;  3UF4 A;  4LNP A;  4AFU C;  1K0X A;  2PNI A;  2ROL A;  2P4R A;  2FO0 A;  1X2Q A;  2AKK A;  2DF6 A;  2EYY A;  4HXJ A;  2AZV A;  1UHF A;  4OMM A;  2RF0 A;  3JV3 A;  3ULR B;  2BZ8 A;  5FW9 A;  3VS6 A;  1GFD A;  2A08 A;  1WXB A;  4HVV A;  4EIK A;  2KT8 A;  1MV0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...