1U3OA

Solution structure of rat kalirin n-terminal sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
SGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSTLCISHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Huntingtin-associated protein-interacting protein
publication title Regulation of RhoGEF Activity by Intramolecular and Intermolecular SH3 Domain Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 6
structure length 67
sequence length 67
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1u3oA01
1QKWA 3LH5A 2F2XA 1SHGA 3M0TA 1V1CA 2ED0A 1BU1A 2OAWA 1NLOC 2O9VA 4JPBW 2X3WD 1PWTA 2C0IA 2HEQA 2GTJA 2MCNA 1RUWA 2DL7A 2DMOA 1M8MA 4GBQA 1XOVA 1QWEA 2DRMA 1OPKA 2C0OA 2J6OA 4J9DA 2M51A 3KFVA 1NEGA 1JO8A 2A36A 5I11A 1IO6A 4RTYA 2HBWA 3VS4A 1GCQA 4OMNA 4OMLA 2EPDA 1NEBA 2JMCA 2F2VA 5FWBA 1JU5C 3I35A 1ZSGA 2DNUA 1AWJA 2HDAA 2JMAA 2DL4A 4DEYA 3VS2A 1X2QA 1UDLA 5L23A 2AZVA 4JJDA 2PZ1A 4F14A 4JJBA 2P4RA 1Z9QA 3A98A 1UE9A 1VYTA 2L3PA 2LJ3A 3NGPA 1WFWA 2O31A 3RBBB 2YSQA 3VRYA 2EGAA 1M3CA 2RNAA 2GTOA 2OJ2A 2AK5A 5IXFA 1MV0B 3M0PA 2K2MA 2CUBA 1PHTA 2LQWA 2KR3A 2DL5A 2RPNA 1UGVA 1YCSB 2DF6A 2FO0A 2YT6A 1QWFA 1B07A 1PRMC 4D8DA 2KYMA 4AG2C 2KGTA 2LMJA 2CUDA 1JEGA 1N5ZA 2EYZA 2C0TA 1QCFA 2DX1A 2EW3A 1SRLA 1ARKA 1K0SA 4RTVA 4OMMA 2PTKA 1KIKA 2SEMA 2O9SA 3EG3A 4ORZA 4A63B 1K0XA 1AWXA 4F17A 2G6FX 1TUCA 1NYFA 2W0ZA 2FPFA 1CKAA 5GJWB 1M30A 1WDXA 2JM8A 3ZL7C 2DYBA 1ZX6A 1FMKA 1YWOA 2H8HA 3M0SA 1B3QA 1LCKA 5FWCA 2NUZA 3ULRB 2LX7A 2AKLA 2A37A 4HCKA 1AWOA 2L0AA 1A0NB 2A08A 1ZUKA 1NLPC 1X43A 1KSWA 3UA6A 4AFZC 4F16A 2EQIA 5IHNA 3H41A 2ENMA 2D1XA 4X1VA 4RTTA 5EC7A 2YUOA 4JZ4A 1H8KA 2O2OA 3PVLA 4M4ZA 3H0FA 2LJ1A 1UFFA 1YP5A 3PE0A 3VS3A 1Z9ZA 2PNIA 4JJCA 2VWFA 1PKTA 2LQNA 2JTEA 4IIMA 1GBRA 2FEIA 1H3HA 2DVJA 2GNCA 1OPLA 1U3OA 1ZLMA 1GCPA 1K76A 4RTXA 1I1JA 3I5SA 1PKSA 2GQIA 2HCKA 2RF0A 2NWMA 3U23A 1GBQA 2RQUA 1ZBJA 2KEAA 2B86A 1X27A 2AKKA 2EGEA 1NM7A 5GJVB 4JZ3A 5HCKA 1E6GA 2VVKA 2FRWA 4K11A 3SHWA 4Z8AA 2L3SA 3SEMA 1YWPA 2LNHB 4OMQA 1BK2A 3EHRA 2CT3A 4Y92A 2JXBA 1WX6A 2DE0X 2K6DA 3THKA 4WCIA 2EGCA 1WXTA 4J9HA 1AOJA 1AVZC 2CH4A 3VS6A 1PRLC 2DRKA 1X6GA 1X6BA 3VS7A 2J05A 2DLPA 1KFZA 3O5ZA 3H0IA 2RMOA 2CREA 2DBMA 4AG1C 2V1RA 1NYGA 4J9CA 1M27C 3UATA 1Y57A 4CC7A 1QKXA 1VYVA 2AZSA 1GFDA 1WLPB 3QWYA 4CC2A 2BZYA 2KRNA 1AEYA 2YUQA 2ABLA 3I5RA 2K7AA 2YUNA 4HVVA 5FW9A 1WA7A 1TUDA 2RQVA 2CSIA 2KT1A 2BZ8A 2BZXA 1UUEA 1NG2A 1CKBA 2BTTA 1U06A 1T0HA 1M3AA 4OMPA 1YNZA 3EG2A 2JS0A 2CDTA 1FYNA 4HXJA 1RI9A 1UJ0A 2X3XD 2J06A 1CSKA 5IXBA 2YDLA 3UF4A 1GL5A 1KJWA 4J9FA 2J7IA 4J9GA 4DEXA 1SEMA 4LNPA 1HJDA 1SRMA 4HVUA 3M0UA 1YN8A 1HD3A 4LUDA 2KXCA 3VS0A 1UJYA 5ECAA 4FSSA 1UHFA 3I9QA 2QDLA 2ROLA 4QT7A 2RQWA 2FPDA 3R6NA 2L3QA 1U5SA 4R0KA 2DILA 1PNJA 4AFSC 1M3BA 1EFNA 1GCQC 2KXDA 4AFUC 1T3LA 2LCSA 1MUZA 2KBTA 2L2PA 2YUPA 4LN2A 4GLMA 2OI3A 1J3TA 5IHIA 3CQTA 2EYWA 4RTZA 1AZEA 2GGRA 2EYYA 4KRTA 1BB9A 4AFQC 4CC3A 1QLYA 2JS2A 3EG1A 2EYXA 3M0RA 2EBPA 2E5KA 2DL8A 2K3BA 4E6RA 2J6KA 1I0CA 2JW4A 2FPEA 2LP5A 1SHFA 3PVQA 4IIOA 1GFCA 2D0NA 1BBZA 2DL3A 1X69A 1RLQC 1UTIA 4EIKA 4Z88A 1AWWA 2DA9A 4RTUA 3IQLA 1UECA 3NMZC 1ZUYA 2KT8A 2SRCA 4LE9A 2O88A 1E7OA 3REAB 3TSWA 1JQQA 1OEBA 2ECZA 2V1QA 3NPFA 4ZNXA 5IH2A 1HSQA 1OV3A 3QWXX 2FG0A 2CT4A 4RUGA 1S1NA 5IHKA 4J9EA 2ROTA 3VS5A 2DJQA 2HSPA 1G83A 1AD5A 2I0NA 2CH4W 2DM1A 1GRIA 2RQTA 2D8HA 1WXUA 2EVRA 3UA7A 1AZGB 2VKNA 1VA7A 1UG1A 1WI7A 2W10A 1SPKA 1WXBA 3JV3A 3FJ5A 2CSQA 2KROA 2LJ0A 3EHQA 1T3SA 4J9IA 3VS1A 2IIMA 4CC4B 2RN8A 2MOXA 3TSZA 1JXMA 2FRYA 2M0YA 1UHCA 3REBB 1K4US 3VRZA 4RTWA 2LZ6B 1H92A 1WYXA 2K9GA 2RQRA 1W70A 3GBQA 4LUEA 1TG0A 2F2WA 3TVTA 1SSHA 1K1ZA 3RNJA 2ESWA 2KRMA 4Z89A 4ESRA 3EG0A 1Y0MA 3M0QA 2KRSA 2EKHA 2MIOA 4D8KA 1ABQA 3NHNA 2KNBB 3C0CA 5I22A 2JT4A 1K9AA 1G2BA 4OMOA 1ABOA 1VYUA 1ZUUA 2DBKA 3H0HA 1OOTA 1MV3A 2JM9A 1W6XA 1T0JA 2XMFA 3EGUA 1I07A 4HVWA 1W1FA 2KYBA 2KE9A 4J9BA 2K79A 2J6FA 1RLPC 1E6HA 2D8JA 1X2KA 2A28A 2ED1A 2GBQA 1WIEA 1JXOA
chains in the Genus database with same CATH superfamily
1QKWA 4Q5WA 5DY9A 3OY9A 3M0TA 1BU1A 2OAWA 4MZTA 1NLOC 4JPBW 2X3WD 3JCMf 1QVFS 1VQ5A 1M8MA 1HXDA 1XOVA 3GIBA 2DRMA 2MI6A 4ZGDB 2M02A 1QMCA 3CMAA 1IO6A 2NYSA 3G6ET 3MP8A 3VS4A 4OMLA 4JLIA 3A8GB 4C5GA 1N9SA 2DNUA 1Q7YC 1YJWT 2X4YA 3DLLA 2JMAA 2OTJT 4QVDA 5KYUB 1WQWA 1R8OB 2DEQA 2FL7A 4E7IA 5KE3A 5D6YA 3CCQA 2R57A 4PJOD 1WFWA 5FRNA 3VU3C 2WSCE 3L2VA 2RNAA 2A3LA 2OJ2A 2AK5A 3LW5E 3OSSC 3EFRA 1RAAB 1VOMA 2PU9B 3M0PA 4BY6C 4Y91A 4KUDK 4J5YA 4FW1A 2FVUA 2KR3A 4OB3B 3G7ZA 3VUZA 1VQ6A 2E6ZA 2X4XA 2RPNA 1MGQA 4FT4A 5DLQE 2FO0A 4ZTFA 4BE0A 1JJ2P 4C0FA 1B07A 2ZPEB 4J6YA 2A0FB 2EYZA 3GNFB 3G71A 5CIUA 2PTKA 2DZ9A 1KIKA 2SEMA 2ZPIB 4ORZA 4A63B 5KH6A 2W0ZA 3RIRA 1VQNA 1YJNQ 3X20B 1FMVA 1M30A 1WDXA 3HRUA 2JM8A 2F1LA 1ZX6A 1YWOA 3EH2A 4XTWA 5GANf 1LCKA 4PJOA 2NUZA 1Q86C 3TQ7P 3ULRB 2LX7A 4N0AC 2QI2A 3BFMA 4E7LA 3QDRB 1ZUKA 3CCMQ 1I5LA 1X43A 1KSWA 3M57A 4FW2A 3F70A 4F16A 2EQIA 3H41A 4E7SA 5GAOm 2D1XA 4JS4A 5CKDA 4RTTA 4JZ4A 2L8DA 1H8KA 4OB0B 4BI4A 5HK0A 3PVLA 4M4ZA 4PFPA 1VIEA 3I55T 4PJJA 1Z9ZA 2PNIA 1IB8A 3H8ZA 5CO7A 1N8RC 1PKTA 2JTEA 2COYA 3SWNA 8ATCB 2DVJA 1OPLA 1GCPA 3M58A 3I56T 4FU6A 4C5EA 3ZFJA 1Q81C 1BCOA 1BI1A 2HBPA 2YLBA 4MMLA 5LJ3f 1NM7A 2DXUA 3FC3A 2E64A 4JZ3A 3QXEB 1VQ8Q 3A5ZB 4KULA 3PGGA 1IGQA 1XNIA 3OS0A 1YHQT 1Y7XA 5GMKj 2JXBA 3CCET 4VUBA 4WCIA 2PQWA 1OULA 3M53A 1WXTA 1QQJA 3G6EA 4M7DC 2CH4A 2P84A 1X6GA 1X6BA 3RMSA 1Y96A 1YJWA 4RCCA 2OTJA 3H0IA 3VKIA 4BY6B 5KYYA 1M2VB 4AG1C 2V1RA 1X75C 3MJXA 1VQ9A 1WJSA 2R58A 4PNOA 1Y57A 2KVQG 3OW2A 1WLPB 2YUQA 2ABLA 3I5RA 1RAFB 2K7AA 4HVVA 4BI8B 1M1GA 1D0XA 3LGFA 4HCZA 4MDWA 1UUEA 4RCBA 1NG2A 2HQEA 2YLCA 1PD1A 1MMNA 3S3OA 2EAYA 2RM4A 1NJIR 3OYJA 4XTXA 4M7DE 4B9WA 2X3XD 1CSKA 1KJWA 3OYYA 3OYGA 5GAN7 2E3HA 4DEXA 3CC4Q 2LVMA 2RH2A 4LUDA 1WGSA 2CGHA 1UJYA 3M4YA 5J26A 3PT9A 5ECAA 1UHFA 3I9QA 2MYSA 2ROLA 2XDDA 2RQWA 2FPDA 4R0KA 3L2WA 1YI2Q 1B34B 2JTMA 2KXDA 4FCYA 3META 4RG2A 1WQ7A 1Q81U 1D0YA 4JRIA 2PVDB 1VQKQ 1J3TA 5LJ3h 2RHIA 4PFOA 2DKGA 2EYWA 1O75A 1VQ4Q 1QVFP 2RK1A 2GGRA 2COWA 3OYIA 2EYYA 2V26A 1YJ9A 4KRTA 1BB9A 3RMQA 4AFQC 2NUTA 3OYLA 2E5KA 3I55A 2NLUA 2JW4A 1IREB 5D7UA 4M7DF 1JBMA 2QEXQ 4M7DG 1X69A 2HKNA 1WJRA 1UTIA 1U1TA 3P8HA 3I56A 1Y07A 4MZPA 1S72Q 2EQKA 3V7RA 4RTUA 1RACB 2XKOC 3D7SB 3NMZC 3WVEB 2XDPA 4M7DB 3DB4A 2IPOB 2F5KA 4M78D 3PIPA 1OU9A 3OYKA 3C94A 2JUFA 1UGSB 4J8OA 2V1QA 5GAN5 4ZNXA 2QQSA 3CC7Q 5LJ5g 5IH2A 1HSQA 1OV3A 3MO8A 3OYBA 1QVPA 4CI0C 1YHQA 1M90C 3A8MB 2Y4XA 3OQ5A 3CCEA 4J9EA 3HTRA 3V7SA 1JJ2A 2ROTA 4KT0E 2HSPA 1AD5A 2LQKA 1ZQ1A 1C1AA 3UA7A 3CCLT 5GAN8 5I2MA 3EH1A 1K9MR 1NE8A 3FJ5A 4D6WA 1FXXA 3GNGA 8AT1B 4CC4B 3HP9A 2JTFA 3OMGA 3GP8A 3TSZA 2M0YA 2F5TX 2R5AA 1UHCA 4KUIA 5L8RE 3EFOA 5GAOr 1UB4A 1VQMT 1Q82C 1LJOA 1KD1C 5LJ5d 4M78A 3L1AA 3TEEA 1D1CA 4M77D 3VV0A 1W70A 3GBQA 1RL2A 2DO3A 4LUEA 2PVOB 2L89A 2HAXA 5IT9E 1LOJA 4ANJA 5FU6C 4PJLA 3WXMB 3RNJA 4M75C 3EG0A 1TWBA 3RKYA 4CRIA 2CYZB 1G3WA 1NPPA 1RAHB 3CMAQ 1M1FA 5GAN3 2EJFA 2KNBB 4HT9A 1IHWA 3C0CA 4RKUE 4JUVA 2EJGA 2JT4A 4ZN1A 1K9AA 4OMOA 2ZPFB 4UC4A 1K8AU 2X4WA 4A4EA 3CCJT 1RABB 3EGUA 4HVWA 1LPLA 3CCQQ 1K73C 2H3JA 2IVWA 2ED1A 2XD0A 2O4XA 2DJZA 1KQSP 2F2XA 3LH0A 2ZPGB 4M77A 2ED0A 3E9GA 3L42A 1BCMA 4C92D 1VQ6Q 1BI3A 4M75E 1IRXA 2DL7A 2DMOA 3G4ST 2DTHA 2CZ7B 1OPKA 2LC4A 2QA4T 4J6WA 2M51A 1JO8A 3G71Q 4XTZA 5GAOn 4RTYA 1KHIA 1GCQA 3JCMQ 4OMNA 1MHNA 5FRMA 2EPDA 1WZOA 2VC8A 4X9DA 3I35A 4DBFA 5CQYA 4ELYC 5EG2A 1VQNQ 4HCCA 1OI1A 2QTVA 2K5LA 4JJDA 3MEUA 4N4HA 2ZPBB 1Z9QA 4B9XA 5GAMj 1R0CB 1M2OA 1UE9A 4HKEA 1VYTA 2YSQA 3MKDA 2X4JA 3E1SA 1SKUB 3V7CA 1M3CA 2GTOA 5KCHA 3CCRT 1G5VA 1MV0B 2FB7A 5IAYA 1M1KR 5C6SA 1SF9A 2I2LA 4C92A 2CUBA 1WHHA 2LQWA 2DL5A 4AMCA 3LWHA 1YCSB 2YT6A 3CCLA 2QGGA 3E2UA 4M75F 4PL6A 2EKOA 4AG2C 3P8BB 1H641 1OYXA 1YIJT 3VJPA 1VQPT 1QCFA 1G3YA 2EW3A 1MMDA 1K0SA 1PM3A 5FU6B 3HPWA 1K0XA 2O9SA 3EG3A 2VXEA 4M75B 1YITQ 2WACA 1AWXA 2EFIA 4XQ3A 3VUBA 2CZ0B 1MMAA 1VQMA 1CKAA 5GJWB 3WVDB 2RJEA 3JCMV 5LJ5e 1UGQB 2H8HA 2XK0A 1ZA2B 3A8HB 4JRPA 3KBGA 2A37A 2K5FA 2L0AA 5GMKl 1A0NB 1JRIA 4WTOB 1QVFA 4XTYA 3G1JA 1QCNA 3EGDB 3G6EQ 3HFOA 2ENMA 5IN1A 3QBYA 4X1VA 5CKFA 2O2OA 3QHSA 3CCJA 2ZCFB 2JOYA 2RJCA 4IIMA 1BYMA 1VQ9Q 5I2SA 2FEIA 2JNGA 3VYGA 2GNCA 3AHUA 1ZSZC 3I5SA 4C8QD 2HCKA 2GQIA 3U23A 2RQUA 3KUFA 3TCJA 2B86A 5I21A 1X27A 2FZCB 2RB6A 3JRZA 2FRWA 1V29B 4K11A 1YWPA 3G4SA 1BK2A 1VQOQ 5LJ5f 3HKSA 1G3SA 2DE0X 5AYFA 4M7AD 1AOJA 1AVZC 3CCUT 1PRLC 2KQWA 4LDYA 3UWNA 2EQJA 2DLPA 3O5ZA 2D0QB 2OX7A 1VQ7T 1M8VA 2CREA 2DBMA 3V8KA 4FYVB 1IHVA 1EIFA 2Y90A 4N4GA 2LRQA 2RI5A 1M5Q1 4CC7A 1GFDA 4CC2A 4LXCA 1B7TA 4C8QA 4PJOC 1ZHIA 1KG1A 2VGMA 5FW9A 4NL3A 2KT1A 4FYXB 1WHMA 1CKBA 3CD6A 2BTTA 1M3AA 4OMPA 1YJ9Q 1YBYA 5CAIA 4FSXA 2JS0A 1VQLA 2CDTA 2FZGB 1D3BB 4XU0A 1RI9A 3I55Q 2XG8D 2J06A 4M7AA 1W4SA 4FIBA 1YIJA 2HNIA 3UDCA 1VQPA 1FX7A 3CCVT 3OS1A 2QDYB 4LNPA 1TXQA 2HD0A 1HD3A 3I56Q 3VS0A 2V8JA 2IG0A 4FSSA 5D6XA 2JJ9A 4QT7A 2JVVA 2L3QA 1OQKA 2DXCA 4J6XA 2LQ8A 4PJOE 2DILA 1PNJA 1ACMB 4GY5A 4F04B 3LX7A 2XHCA 3OB9A 3QZ9B 2P0KA 1YHQQ 4AFUC 2LCSA 2VUBA 4IUTA 5KYWA 1X01A 3CCEQ 1UGPB 3C4SA 5IHIA 4C0ZA 2CP5A 3X28B 1TOVA 4ELZC 1ZSZB 2YWWA 1N9RA 4OGCA 2F69A 1Q7YU 5GAOl 1KC8R 1QLYA 3M0RA 2EYXA 1MMGA 2DEUA 1UGRB 1YJNT 5GAOq 2K3BA 4E6RA 2J6KA 3FLGA 1I0CA 5LJ5h 1KQSS 2OTLQ 1KQ2A 1LVKA 3MEVA 4HT8A 5GANj 1SHFA 3DLMA 4IIOA 2DD4A 1BBZA 5CKHA 3RDVA 2E41A 3HRSA 3NTIA 1KQ1A 1M4ZA 2DD5A 4PKCC 1AWWA 1BKBA 2DA9A 5CVIA 4IUQA 3UPUA 1OU8A 4EMKC 3CCMT 1W2BP 2KT8A 2SRCA 2O88A 1PSEA 3PFSA 2LDMA 3REAB 4L5GA 3RKXA 5A0GA 1B34A 2DAQA 2HL3A 1QCOA 2RA2A 4PJOF 2FG0A 4XAXB 5CK9A 1NJIC 3VS5A 2LTOA 2DJQA 2DM1A 3CCUA 4LDXA 4PJOB 1GRIA 2DIQA 3RERA 2ZZDA 3JB9I 4Y28E 2BE9B 1WI7A 1VQ7A 2W10A 4OF1A 4FL6A 5LJ3j 2CSQA 2KROA 3EHQA 1T3SA 4J9IA 3VS1A 2RD1A 3SDZA 2QASA 1Q86U 4YTLA 5GAOp 2MWOA 2V8IA 5KYNA 1K4US 2AT1B 4RTWA 1WHKA 1H92A 2K9GA 2CP2A 2E3IA 3RKWA 5FLXE 3NTHA 2JZ2A 3DB3A 5D6WA 2F2WA 2HSEB 3JCMX 2RI2A 2KRMA 3OBYA 4Z89A 5A2QE 2YRCA 1N8RU 2K2VA 2KRSA 2EKHA 1IGUA 2MIOA 3CCVA 1VYUA 3NFCA 2DBKA 1PC0A 3CCST 1MV3A 1W6XA 1XJWB 2KK4A 1T0JA 2XMFA 5DLOA 1TH7A 2MF2A 2KYBA 2KE9A 3RESA 2J6FA 4IUUA 4JS5A 2D8JA 1Y96B 4O5VA 1JXOA 3FB9A 1OZ3A 1WIEA 2NUPA 3LLRA 4PJNA 2R5MA 4HA8A 3CPFA 2GTJA 2MCNA 3L2UA 3CC4T 3JB9D 2KSSA 4EMKB 2HQHA 1RUWA 3CCLQ 4GBQA 2XI9A 1YCYA 4OVAA 1YJNA 2C0OA 2J6OA 2JN0A 4J9DA 3EGXA 1NEGA 3JCMg 2ATCB 5I11A 2HBWA 3OYHA 5FWBA 1K9MC 1AWJA 2DL4A 3VS2A 1VQMQ 4BACA 1JB0E 3CCMA 2PZ1A 4F14A 4O6JA 5CCAA 5GAN4 2LX9A 2DXBA 2QYZA 2P4RA 1QP3A 4PFZA 4M78C 1K8AR 1OX8A 2LJ3A 3NGPA 2O31A 4QQ6A 2EGAA 1D0ZA 2RHYA 3QJ6A 4PLLA 2K2MA 1I81A 4ZN3A 3M4GA 2P4TA 4E7JA 3JCMd 1UGVA 2DF6A 3ZBDA 1EZZB 1PRMC 4D8DA 2KGTA 3CCJQ 1HK9A 3GPLA 4RG8A 2C0TA 3HHTB 3HFNA 1SRLA 2LCLA 1ARKA 2KI7A 3KXTA 1VQ5Q 3CC7T 1NYFA 4J83A 1MNEA 2NUTB 3H9NA 4IURA 3M54A 2FPFA 4M78E 4KGXB 3BDLA 3ZL7C 3M55A 3AT1B 1FMKA 5A0LA 2DVEA 1C0MA 4A4KA 4M77C 1B3QA 3GF5A 1ZBXA 4F7UE 5FWCA 4HCKA 2L3RA 4E7HA 1SG5A 1RAEB 2VASA 2A08A 4A4FA 2GFAA 3JCMP 3QSUA 5GANg 4AFZC 2H3EB 5IHNA 1G3TA 2K3YA 5EC7A 2YUOA 2DYIA 3CBMA 1UFFA 3CCSA 3MCAB 1YP5A 3SB2A 2GFUA 4JJCA 2VWFA 2EQMA 3GOXA 2LQNA 3FDRA 2CKKA 3FJPA 3EG9A 1ZLMA 5M9OA 1WPYA 4RTXA 1I1JA 1M90U 4FT2A 1AT1B 2NWMA 4M77E 1ZBJA 2KEAA 2EGEA 1TS9A 2EYQA 5GJVB 3CXCP 5HCKA 3CD6Q 4M78F 1E6GA 2E4HA 2VVKA 4MZMA 3QZ5B 4Z8AA 2L3SA 4M78G 3SHWA 5GANd 3CC4A 4C92C 2BE7D 4DQ2A 1M1KC 5LL6S 1VQLQ 3EFOB 4F7UF 3EHRA 3QIIA 5LJ3g 4Y92A 4F7UG 4EDUA 3OA6A 2K6DA 4M78B 1W2BS 1UEBA 2K57A 1VQPQ 3EGDA 3N5BB 3THKA 2EGCA 1WHLA 4J9HA 5HK3A 3VS6A 2DRKA 3CCQT 4F7UB 2J05A 3CPWS 1Q82U 2RMOA 1KD1U 2HL5C 1O9SA 3URGA 2QTXA 5KYXB 3PMIA 4J9CA 1M27C 3UATA 2BKDN 4IUPA 4KBMB 3QWYA 3ASKA 4FM4B 1AEYA 4MMKA 4JRQA 4M75G 1WA7A 1OZ2A 2CSIA 4JJNK 1NZ9A 2BZ8A 4C92E 5FU7C 2DERA 4MDXA 4QKUA 5LJ3d 4DOVA 4M77F 2MMPA 4XTUA 3X24B 1U06A 4M77G 1YNZA 3E9FA 3EG2A 2E5QA 3FIFA 1VUBA 5KYUA 3JCMe 2O4XB 1X6OA 1D1AA 1UJ0A 4M77B 3HRTA 3OW2P 5IXBA 3UF4A 3JCMW 4HVUA 1K73U 5GMKm 3M0UA 3RR6A 5KE2A 1MNDA 4XK8E 3L2ZA 2QDLA 3FEOA 1QP2A 4KH1B 1I8FA 2MPXC 3OYCA 3R6NA 1QVGS 3JCMc 1RAGB 1M3BA 3O8VA 2DIGA 2YHTA 1P92A 1YJWQ 2XDBA 2OTJQ 1EFNA 3CC2T 2V8KA 1T3LA 2FYKA 3OSVA 3EFSA 2L2PA 4KGVB 2YUPA 4GLMA 3J80E 2YXYA 1N6AA 4LD6A 3CCUQ 1RADB 2VYTA 1I5OB 1C6VX 4C92F 3HL8A 1M1KU 1YITT 4C92G 1VQ7Q 4V2SA 1RAIB 4ZTJA 1PG5B 3X26B 2LP5A 3A1PA 4C92B 2QXFA 2Y4YA 2D0NA 1XTDA 2DL3A 2KDSA 3NTKA 4QVZA 4Z88A 4HCBA 3IQLA 1UECA 2QA4A 1ZUYA 3OMCA 4QQDA 4A4GA 4C8QC 3LWIA 4DBRA 2RK2A 2QK0A 3UT1A 3TSWA 4RMOA 1JQQA 3M56A 1OEBA 2ECZA 3OYNA 7AT1B 5GANe 2LCCA 3QWXX 3CMET 4RUGA 4ME7A 3OYFA 5HY6A 3CCVQ 4JDSA 2L5QA 2I0NA 4N4IA 3GLXA 2CH4W 1VQ9T 5GMKe 3E19A 4M7AC 1ZSZA 1WXUA 2EVRA 1AZGB 4JLGA 2VKNA 3T9NA 1WXBA 3CCRA 5FU7B 4E7KA 1Q7YR 4QVCA 5J3BA 2K4YA 3SFMA 3FRNA 3INZA 5CKEA 3CBPA 1QW1A 2MK5A 2FRYA 3CBOA 2HKQB 2LNVA 4C8QE 5LJ5j 2E10A 2K5IA 4QW2A 1VQOT 3VRZA 2CZ1B 3JAME 4BDYA 1SSFA 3OYAA 4E47A 1TSFA 4L6V5 5LJ3e 2PUKB 3SWNC 1TG0A 2VXFA 3TVTA 3M5AA 2A7YA 2ESWA 3H6ZA 4J7IA 4ESRA 3M0QA 1M2VA 4C5HA 4M7AE 4A4HA 4A54A 1KC8C 4LDWA 3SD4A 1KQSA 2DK3A 5I22A 1ABOA 2RHXA 1OOTA 2BUDA 3MPUB 2JM9A 4NL2A 1W1FA 2K79A 2VV5A 1E6HA 1WHGA 3JCMh 1X2KA 5GMKi 1YJ9T 2RHUA 3CC2A 2A28A 3CXCA 1LNXA 2GBQA 1Q86R 3LH5A 5A0DA 1IZ6A 1SHGA 5J39A 2C06A 1V1CA 4C8QF 2HZYA 4N0AA 5GAMg 2O9VA 4C8QG 2KY9A 3HSBA 3MEAA 1PWTA 2C0IA 2HEQA 3JSCA 2CP6A 4PK4A 2QGFB 1YITA 4TVRA 4C8QB 1QWEA 2DETA 2XIDA 3BY7A 4M7DD 3KFVA 2E12A 1N27A 2A36A 1RI0A 4X34A 4C0GA 3CXCS 3JCMJ 4M7AF 1NEBA 2JMCA 2F2VA 1N8RR 3CPWP 1JU5C 3LGLA 4M7AG 1ZSGA 2HDAA 4DEYA 1X2QA 4PJOG 1UDLA 5L23A 2AZVA 2P0PA 4M7AB 3RUXA 4JJBA 3QUIA 3ME9A 3A98A 1Q81R 1Y71A 2L3PA 3BW1A 3RBBB 5GAMd 4NS5A 3VRYA 3TU4K 4C0DC 2D9TA 3CMEA 5DM7R 1Q95G 1ZA1B 5IXFA 4BDZA 5CKBA 3J7AF 2QQ9A 2OTLT 1YFNA 3OS2A 2VGNA 1VIFA 1PHTA 4OMFB 3MP6A 1VQ8T 2WSFE 4LD9K 4ZGJB 4EMKA 1BI2A 2QQBA 2HQXA 4P5NA 1QWFA 4EMGA 1IXDA 2DFUA 2KYMA 3CCSQ 2CZ6B 2LMJA 5KYWB 4M7DA 2CUDA 1JEGA 1N5ZA 1KC8U 2G3RA 4NOYA 2DX1A 1BIBA 3SWNB 4FYWB 2M0OA 3BDUA 4OMMA 4RTVA 4EPCA 5GANh 4F17A 2G6FX 1TUCA 4IKFA 4L59A 3R6OA 1VQOA 4R56A 1QVGP 2RJFA 3V8JA 2COZA 2DYBA 5GMKh 3CEYA 3OW2S 3M59A 3M0SA 4OGEA 3OYDA 2AKLA 1AWOA 2ZGWA 4PJMA 3MEWA 1FWZA 1D09B 3VYHB 1NLPC 4X9CA 2LT1A 3UA6A 4R55A 2FZKB 3X25B 3H0FA 2LJ1A 2GF7A 2DZCA 5KYYB 3PE0A 3VS3A 2Z0WA 2EIFA 3S3NA 1GBRA 3ZEHA 1NPRA 1R0BG 1WJQA 1H3HA 2EJ9A 1U3OA 1K76A 3QDFA 3L2QA 1PSFA 1PKSA 2RF0A 1GBQA 1K8AC 1NJIU 1AHJB 2DTOA 2AKKA 3A8LB 1YI2T 2EQUA 3SEMA 2LNHB 4OP0A 4AT1B 2M9UA 3QJYA 2E65A 4OMQA 1PCXA 2CT3A 5CQXA 1WX6A 5CR2A 3M9QA 3V8LA 1VQKT 4KH0B 3BE3A 3QO3A 1VQ4T 3OS5A 4C0DB 1GXIE 4GLKA 3VS7A 1KFZA 3QKJA 4B6MA 4C5IA 4ZGEB 2RHZA 2D6FA 4XU2A 1XQHA 1NYGA 2WSEE 2PUOB 1F1BB 2QEXT 1QKXA 3C95A 2AZSA 2BZYA 2KRNA 3L2RA 5GAMe 1S72T 2YUNA 1D1BA 1TUDA 2RQVA 2OTLA 4DOWA 2BZXA 1M9SA 4LDUA 2K3XA 4Z02A 1U8RA 1M90R 1VQ8A 1OX9A 1T0HA 2B8AA 4M75D 3OYMA 5KCOA 2P0QA 3J81E 1JJ2S 1FYNA 4HXJA 2NUPB 4BE1A 3A8OB 2YDLA 1GL5A 1WNLA 2E1HA 4J9FA 1NBEB 2DTIA 1I4K1 2J7IA 4J9GA 1SEMA 1HJDA 1SRMA 4F7UA 5C0MA 1YN8A 3DKMA 3G4SQ 2KXCA 3C12A 2QA4Q 1H3ZA 3P8DA 2YRVA 3MP1A 3EGXB 1TUGB 1Q82R 5KYXA 4OB1B 2KMTA 1U5SA 3QYHB 4QQGA 1KD1R 4DBQA 4AFSC 2QAZA 4E7ZA 2X9HA 1GCQC 2XICA 3PTAA 9ATCB 2PVGB 2AHJB 2GQVA 2XU8A 1MUZA 2KBTA 3QYGB 4LN2A 3JCMb 2OI3A 6AT1B 2E6NA 3CQTA 1K9MU 3TREA 4DBHA 1W2BA 2ZPHB 4RTZA 1AZEA 5GAMf 4M75A 2FHDA 5AT1B 2RO0A 1VQ5T 4CC3A 2JS2A 3JB9F 3EG1A 3CCRQ 2AIRB 2MAMA 2EBPA 3Q1JA 4DA4A 2DL8A 3JB9G 4A53A 3CPWA 2FPEA 3CMAT 3PVQA 1FMWA 1GFCA 2DPPB 2CP7A 5GAN6 3JB9J 3PNWC 1RLQC 3LYIA 4ATOA 4EIKA 1EX4A 4XU1A 2YRDA 1K73R 2VB6A 4LE9A 1YIJQ 3PIOA 1V76A 1E7OA 4E2FB 2EWNA 1U1SA 5FROA 1YI2A 4LDVA 3NPFA 3S6WA 2OAUA 4BI3A 4OB2B 1TTHB 2CT4A 1S1NA 5IHKA 1VQKA 4JRKA 5HKCA 1G83A 3QPHA 4XU3A 1VQ6T 2CP3A 2HMAA 2MWPA 2RI3A 2D8HA 2RQTA 1VQ4A 3JB9H 2LT4A 2GCXA 1VA7A 1UG1A 1SPKA 3JV3A 2DXTA 2LJ0A 1KHCA 3G71T 2IIMA 2CP0A 2QQAA 2RN8A 3CD6T 2MOXA 2QEXA 1JXMA 1QVGA 4II1A 1TU0B 3CC2Q 2O01E 1VQNT 1R77A 3REBB 1S72A 1VQLT 2LZ6B 1WYXA 2QG9B 4BE2A 2RQRA 2RJDA 1PD0A 4BD3A 4J7FA 2X35A 1BI0A 3EG9B 3CC7A 2QQRA 1SSHA 2CS7A 1K1ZA 4PLIA 4IUVA 1Y0MA 4BB7A 3OYEA 4D8KA 2ZAEA 1ABQA 1KK7A 3NHNA 3ER0A 2M16A 4FYYB 2BIVA 3OBWA 5GAMh 3PMTA 3S3MA 1G2BA 1ZUUA 3H0HA 4XTVA 3MHXA 1HYOA 1BIAA 1G8XA 3QG1A 1WHJA 1I07A 4EMHA 4BUGA 4J9BA 5GAN2 1RLPC 2M1HA 4KGZB 3EAEA 1DJ7B 2X51A 4WF2A 2E70A 3CMEQ 1VYVA 2KAFA 1D3BA
chains in the Genus database with same CATH topology
1QKWA 3LH5A 2F2XA 1SHGA 3M0TA 1V1CA 2ED0A 1BU1A 2OAWA 1NLOC 2O9VA 4JPBW 2X3WD 1PWTA 2C0IA 2HEQA 2GTJA 2MCNA 1RUWA 2DL7A 2DMOA 1M8MA 4GBQA 1XOVA 1QWEA 2DRMA 1OPKA 2C0OA 2J6OA 4J9DA 2M51A 3KFVA 1NEGA 1JO8A 2A36A 5I11A 1IO6A 4RTYA 2HBWA 3VS4A 1GCQA 4OMNA 4OMLA 2EPDA 1NEBA 2JMCA 2F2VA 5FWBA 1JU5C 3I35A 1ZSGA 2DNUA 1AWJA 2HDAA 2JMAA 2DL4A 4DEYA 3VS2A 1X2QA 1UDLA 5L23A 2AZVA 4JJDA 2PZ1A 4F14A 4JJBA 2P4RA 1Z9QA 3A98A 1UE9A 1VYTA 2L3PA 2LJ3A 3NGPA 1WFWA 2O31A 3RBBB 2YSQA 3VRYA 2EGAA 1M3CA 2RNAA 2GTOA 2OJ2A 2AK5A 5IXFA 1MV0B 3M0PA 2K2MA 2CUBA 1PHTA 2LQWA 2KR3A 2DL5A 2RPNA 1UGVA 1YCSB 2DF6A 2FO0A 2YT6A 1QWFA 1B07A 1PRMC 4D8DA 2KYMA 4AG2C 2KGTA 2LMJA 2CUDA 1JEGA 1N5ZA 2EYZA 2C0TA 1QCFA 2DX1A 2EW3A 1SRLA 1ARKA 1K0SA 4RTVA 4OMMA 2PTKA 1KIKA 2SEMA 2O9SA 3EG3A 4ORZA 4A63B 1K0XA 1AWXA 4F17A 2G6FX 1TUCA 1NYFA 2W0ZA 2FPFA 1CKAA 5GJWB 1M30A 1WDXA 2JM8A 3ZL7C 2DYBA 1ZX6A 1FMKA 1YWOA 2H8HA 3M0SA 1B3QA 1LCKA 5FWCA 2NUZA 3ULRB 2LX7A 2AKLA 2A37A 4HCKA 1AWOA 2L0AA 1A0NB 2A08A 1ZUKA 1NLPC 1X43A 1KSWA 3UA6A 4AFZC 4F16A 2EQIA 5IHNA 3H41A 2ENMA 2D1XA 4X1VA 4RTTA 5EC7A 2YUOA 4JZ4A 1H8KA 2O2OA 3PVLA 4M4ZA 3H0FA 2LJ1A 1UFFA 1YP5A 3PE0A 3VS3A 1Z9ZA 2PNIA 4JJCA 2VWFA 1PKTA 2LQNA 2JTEA 4IIMA 1GBRA 2FEIA 1H3HA 2DVJA 2GNCA 1OPLA 1U3OA 1ZLMA 1GCPA 1K76A 4RTXA 1I1JA 3I5SA 1PKSA 2GQIA 2HCKA 2RF0A 2NWMA 3U23A 1GBQA 2RQUA 1ZBJA 2KEAA 2B86A 1X27A 2AKKA 2EGEA 1NM7A 5GJVB 4JZ3A 5HCKA 1E6GA 2VVKA 2FRWA 4K11A 3SHWA 4Z8AA 2L3SA 3SEMA 1YWPA 2LNHB 4OMQA 1BK2A 3EHRA 2CT3A 4Y92A 2JXBA 1WX6A 2DE0X 2K6DA 3THKA 4WCIA 2EGCA 1WXTA 4J9HA 1AOJA 1AVZC 2CH4A 3VS6A 1PRLC 2DRKA 1X6GA 1X6BA 3VS7A 2J05A 2DLPA 1KFZA 3O5ZA 3H0IA 2RMOA 2CREA 2DBMA 4AG1C 2V1RA 1NYGA 4J9CA 1M27C 3UATA 1Y57A 4CC7A 1QKXA 1VYVA 2AZSA 1GFDA 1WLPB 3QWYA 4CC2A 2BZYA 2KRNA 1AEYA 2YUQA 2ABLA 3I5RA 2K7AA 2YUNA 4HVVA 5FW9A 1WA7A 1TUDA 2RQVA 2CSIA 2KT1A 2BZ8A 2BZXA 1UUEA 1NG2A 1CKBA 2BTTA 1U06A 1T0HA 1M3AA 4OMPA 1YNZA 3EG2A 2JS0A 2CDTA 1FYNA 4HXJA 1RI9A 1UJ0A 2X3XD 2J06A 1CSKA 5IXBA 2YDLA 3UF4A 1GL5A 1KJWA 4J9FA 2J7IA 4J9GA 4DEXA 1SEMA 4LNPA 1HJDA 1SRMA 4HVUA 3M0UA 1YN8A 1HD3A 4LUDA 2KXCA 3VS0A 1UJYA 5ECAA 4FSSA 1UHFA 3I9QA 2QDLA 2ROLA 4QT7A 2RQWA 2FPDA 3R6NA 2L3QA 1U5SA 4R0KA 2DILA 1PNJA 4AFSC 1M3BA 1EFNA 1GCQC 2KXDA 4AFUC 1T3LA 2LCSA 1MUZA 2KBTA 2L2PA 2YUPA 4LN2A 4GLMA 2OI3A 1J3TA 5IHIA 3CQTA 2EYWA 4RTZA 1AZEA 2GGRA 2EYYA 4KRTA 1BB9A 4AFQC 4CC3A 1QLYA 2JS2A 3EG1A 2EYXA 3M0RA 2EBPA 2E5KA 2DL8A 2K3BA 4E6RA 2J6KA 1I0CA 2JW4A 2FPEA 2LP5A 1SHFA 3PVQA 4IIOA 1GFCA 2D0NA 1BBZA 2DL3A 1X69A 1RLQC 1UTIA 4EIKA 4Z88A 1AWWA 2DA9A 4RTUA 3IQLA 1UECA 3NMZC 1ZUYA 2KT8A 2SRCA 4LE9A 2O88A 1E7OA 3REAB 3TSWA 1JQQA 1OEBA 2ECZA 2V1QA 3NPFA 4ZNXA 5IH2A 1HSQA 1OV3A 3QWXX 2FG0A 2CT4A 4RUGA 1S1NA 5IHKA 4J9EA 2ROTA 3VS5A 2DJQA 2HSPA 1G83A 1AD5A 2I0NA 2CH4W 2DM1A 1GRIA 2RQTA 2D8HA 1WXUA 2EVRA 3UA7A 1AZGB 2VKNA 1VA7A 1UG1A 1WI7A 2W10A 1SPKA 1WXBA 3JV3A 3FJ5A 2CSQA 2KROA 2LJ0A 3EHQA 1T3SA 4J9IA 3VS1A 2IIMA 4CC4B 2RN8A 2MOXA 3TSZA 1JXMA 2FRYA 2M0YA 1UHCA 3REBB 1K4US 3VRZA 4RTWA 2LZ6B 1H92A 1WYXA 2K9GA 2RQRA 1W70A 3GBQA 4LUEA 1TG0A 2F2WA 3TVTA 1SSHA 1K1ZA 3RNJA 2ESWA 2KRMA 4Z89A 4ESRA 3EG0A 1Y0MA 3M0QA 2KRSA 2EKHA 2MIOA 4D8KA 1ABQA 3NHNA 2KNBB 3C0CA 5I22A 2JT4A 1K9AA 1G2BA 4OMOA 1ABOA 1VYUA 1ZUUA 2DBKA 3H0HA 1OOTA 1MV3A 2JM9A 1W6XA 1T0JA 2XMFA 3EGUA 1I07A 4HVWA 1W1FA 2KYBA 2KE9A 4J9BA 2K79A 2J6FA 1RLPC 1E6HA 2D8JA 1X2KA 2A28A 2ED1A 2GBQA 1WIEA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  3LH5 A;  2F2X A;  1SHG A;  3M0T A;  1V1C A;  2ED0 A;  1BU1 A;  2OAW A;  1NLO C;  2O9V A;  4JPB W;  2X3W D;  1PWT A;  2C0I A;  2HEQ A;  2GTJ A;  2MCN A;  1RUW A;  2DL7 A;  2DMO A;  1M8M A;  4GBQ A;  1XOV A;  1QWE A;  2DRM A;  1OPK A;  2C0O A;  2J6O A;  4J9D A;  2M51 A;  3KFV A;  1NEG A;  1JO8 A;  2A36 A;  5I11 A;  1IO6 A;  4RTY A;  2HBW A;  3VS4 A;  1GCQ A;  4OMN A;  4OML A;  2EPD A;  1NEB A;  2JMC A;  2F2V A;  5FWB A;  1JU5 C;  3I35 A;  1ZSG A;  2DNU A;  1AWJ A;  2HDA A;  2JMA A;  2DL4 A;  4DEY A;  3VS2 A;  1X2Q A;  1UDL A;  5L23 A;  2AZV A;  4JJD A;  2PZ1 A;  4F14 A;  4JJB A;  2P4R A;  1Z9Q A;  3A98 A;  1UE9 A;  1VYT A;  2L3P A;  2LJ3 A;  3NGP A;  1WFW A;  2O31 A;  3RBB B;  2YSQ A;  3VRY A;  2EGA A;  1M3C A;  2RNA A;  2GTO A;  2OJ2 A;  2AK5 A;  5IXF A;  1MV0 B;  3M0P A;  2K2M A;  2CUB A;  1PHT A;  2LQW A;  2KR3 A;  2DL5 A;  2RPN A;  1UGV A;  1YCS B;  2DF6 A;  2FO0 A;  2YT6 A;  1QWF A;  1B07 A;  1PRM C;  4D8D A;  2KYM A;  4AG2 C;  2KGT A;  2LMJ A;  2CUD A;  1JEG A;  1N5Z A;  2EYZ A;  2C0T A;  1QCF A;  2DX1 A;  2EW3 A;  1SRL A;  1ARK A;  1K0S A;  4RTV A;  4OMM A;  2PTK A;  1KIK A;  2SEM A;  2O9S A;  3EG3 A;  4ORZ A;  4A63 B;  1K0X A;  1AWX A;  4F17 A;  2G6F X;  1TUC A;  1NYF A;  2W0Z A;  2FPF A;  1CKA A;  5GJW B;  1M30 A;  1WDX A;  2JM8 A;  3ZL7 C;  2DYB A;  1ZX6 A;  1FMK A;  1YWO A;  2H8H A;  3M0S A;  1B3Q A;  1LCK A;  5FWC A;  2NUZ A;  3ULR B;  2LX7 A;  2AKL A;  2A37 A;  4HCK A;  1AWO A;  2L0A A;  1A0N B;  2A08 A;  1ZUK A;  1NLP C;  1X43 A;  1KSW A;  3UA6 A;  4AFZ C;  4F16 A;  2EQI A;  5IHN A;  3H41 A;  2ENM A;  2D1X A;  4X1V A;  4RTT A;  5EC7 A;  2YUO A;  4JZ4 A;  1H8K A;  2O2O A;  3PVL A;  4M4Z A;  3H0F A;  2LJ1 A;  1UFF A;  1YP5 A;  3PE0 A;  3VS3 A;  1Z9Z A;  2PNI A;  4JJC A;  2VWF A;  1PKT A;  2LQN A;  2JTE A;  4IIM A;  1GBR A;  2FEI A;  1H3H A;  2DVJ A;  2GNC A;  1OPL A;  1U3O A;  1ZLM A;  1GCP A;  1K76 A;  4RTX A;  1I1J A;  3I5S A;  1PKS A;  2GQI A;  2HCK A;  2RF0 A;  2NWM A;  3U23 A;  1GBQ A;  2RQU A;  1ZBJ A;  2KEA A;  2B86 A;  1X27 A;  2AKK A;  2EGE A;  1NM7 A;  5GJV B;  4JZ3 A;  5HCK A;  1E6G A;  2VVK A;  2FRW A;  4K11 A;  3SHW A;  4Z8A A;  2L3S A;  3SEM A;  1YWP A;  2LNH B;  4OMQ A;  1BK2 A;  3EHR A;  2CT3 A;  4Y92 A;  2JXB A;  1WX6 A;  2DE0 X;  2K6D A;  3THK A;  4WCI A;  2EGC A;  1WXT A;  4J9H A;  1AOJ A;  1AVZ C;  2CH4 A;  3VS6 A;  1PRL C;  2DRK A;  1X6G A;  1X6B A;  3VS7 A;  2J05 A;  2DLP A;  1KFZ A;  3O5Z A;  3H0I A;  2RMO A;  2CRE A;  2DBM A;  4AG1 C;  2V1R A;  1NYG A;  4J9C A;  1M27 C;  3UAT A;  1Y57 A;  4CC7 A;  1QKX A;  1VYV A;  2AZS A;  1GFD A;  1WLP B;  3QWY A;  4CC2 A;  2BZY A;  2KRN A;  1AEY A;  2YUQ A;  2ABL A;  3I5R A;  2K7A A;  2YUN A;  4HVV A;  5FW9 A;  1WA7 A;  1TUD A;  2RQV A;  2CSI A;  2KT1 A;  2BZ8 A;  2BZX A;  1UUE A;  1NG2 A;  1CKB A;  2BTT A;  1U06 A;  1T0H A;  1M3A A;  4OMP A;  1YNZ A;  3EG2 A;  2JS0 A;  2CDT A;  1FYN A;  4HXJ A;  1RI9 A;  1UJ0 A;  2X3X D;  2J06 A;  1CSK A;  5IXB A;  2YDL A;  3UF4 A;  1GL5 A;  1KJW A;  4J9F A;  2J7I A;  4J9G A;  4DEX A;  1SEM A;  4LNP A;  1HJD A;  1SRM A;  4HVU A;  3M0U A;  1YN8 A;  1HD3 A;  4LUD A;  2KXC A;  3VS0 A;  1UJY A;  5ECA A;  4FSS A;  1UHF A;  3I9Q A;  2QDL A;  2ROL A;  4QT7 A;  2RQW A;  2FPD A;  3R6N A;  2L3Q A;  1U5S A;  4R0K A;  2DIL A;  1PNJ A;  4AFS C;  1M3B A;  1EFN A;  1GCQ C;  2KXD A;  4AFU C;  1T3L A;  2LCS A;  1MUZ A;  2KBT A;  2L2P A;  2YUP A;  4LN2 A;  4GLM A;  2OI3 A;  1J3T A;  5IHI A;  3CQT A;  2EYW A;  4RTZ A;  1AZE A;  2GGR A;  2EYY A;  4KRT A;  1BB9 A;  4AFQ C;  4CC3 A;  1QLY A;  2JS2 A;  3EG1 A;  2EYX A;  3M0R A;  2EBP A;  2E5K A;  2DL8 A;  2K3B A;  4E6R A;  2J6K A;  1I0C A;  2JW4 A;  2FPE A;  2LP5 A;  1SHF A;  3PVQ A;  4IIO A;  1GFC A;  2D0N A;  1BBZ A;  2DL3 A;  1X69 A;  1RLQ C;  1UTI A;  4EIK A;  4Z88 A;  1AWW A;  2DA9 A;  4RTU A;  3IQL A;  1UEC A;  3NMZ C;  1ZUY A;  2KT8 A;  2SRC A;  4LE9 A;  2O88 A;  1E7O A;  3REA B;  3TSW A;  1JQQ A;  1OEB A;  2ECZ A;  2V1Q A;  3NPF A;  4ZNX A;  5IH2 A;  1HSQ A;  1OV3 A;  3QWX X;  2FG0 A;  2CT4 A;  4RUG A;  1S1N A;  5IHK A;  4J9E A;  2ROT A;  3VS5 A;  2DJQ A;  2HSP A;  1G83 A;  1AD5 A;  2I0N A;  2CH4 W;  2DM1 A;  1GRI A;  2RQT A;  2D8H A;  1WXU A;  2EVR A;  3UA7 A;  1AZG B;  2VKN A;  1VA7 A;  1UG1 A;  1WI7 A;  2W10 A;  1SPK A;  1WXB A;  3JV3 A;  3FJ5 A;  2CSQ A;  2KRO A;  2LJ0 A;  3EHQ A;  1T3S A;  4J9I A;  3VS1 A;  2IIM A;  4CC4 B;  2RN8 A;  2MOX A;  3TSZ A;  1JXM A;  2FRY A;  2M0Y A;  1UHC A;  3REB B;  1K4U S;  3VRZ A;  4RTW A;  2LZ6 B;  1H92 A;  1WYX A;  2K9G A;  2RQR A;  1W70 A;  3GBQ A;  4LUE A;  1TG0 A;  2F2W A;  3TVT A;  1SSH A;  1K1Z A;  3RNJ A;  2ESW A;  2KRM A;  4Z89 A;  4ESR A;  3EG0 A;  1Y0M A;  3M0Q A;  2KRS A;  2EKH A;  2MIO A;  4D8K A;  1ABQ A;  3NHN A;  2KNB B;  3C0C A;  5I22 A;  2JT4 A;  1K9A A;  1G2B A;  4OMO A;  1ABO A;  1VYU A;  1ZUU A;  2DBK A;  3H0H A;  1OOT A;  1MV3 A;  2JM9 A;  1W6X A;  1T0J A;  2XMF A;  3EGU A;  1I07 A;  4HVW A;  1W1F A;  2KYB A;  2KE9 A;  4J9B A;  2K79 A;  2J6F A;  1RLP C;  1E6H A;  2D8J A;  1X2K A;  2A28 A;  2ED1 A;  2GBQ A;  1WIE A;  1JXO A; 
#chains in the Genus database with same CATH topology
 1QKW A;  4Q5W A;  5DY9 A;  3OY9 A;  3M0T A;  1BU1 A;  2OAW A;  4MZT A;  1NLO C;  4JPB W;  2X3W D;  3JCM f;  1QVF S;  1VQ5 A;  1M8M A;  1HXD A;  1XOV A;  3GIB A;  2DRM A;  2MI6 A;  4ZGD B;  2M02 A;  1QMC A;  3CMA A;  1IO6 A;  2NYS A;  3G6E T;  3MP8 A;  3VS4 A;  4OML A;  4JLI A;  3A8G B;  4C5G A;  1N9S A;  2DNU A;  1Q7Y C;  1YJW T;  2X4Y A;  3DLL A;  2JMA A;  2OTJ T;  4QVD A;  5KYU B;  1WQW A;  1R8O B;  2DEQ A;  2FL7 A;  4E7I A;  5KE3 A;  5D6Y A;  3CCQ A;  2R57 A;  4PJO D;  1WFW A;  5FRN A;  3VU3 C;  2WSC E;  3L2V A;  2RNA A;  2A3L A;  2OJ2 A;  2AK5 A;  3LW5 E;  3OSS C;  3EFR A;  1RAA B;  1VOM A;  2PU9 B;  3M0P A;  4BY6 C;  4Y91 A;  4KUD K;  4J5Y A;  4FW1 A;  2FVU A;  2KR3 A;  4OB3 B;  3G7Z A;  3VUZ A;  1VQ6 A;  2E6Z A;  2X4X A;  2RPN A;  1MGQ A;  4FT4 A;  5DLQ E;  2FO0 A;  4ZTF A;  4BE0 A;  1JJ2 P;  4C0F A;  1B07 A;  2ZPE B;  4J6Y A;  2A0F B;  2EYZ A;  3GNF B;  3G71 A;  5CIU A;  2PTK A;  2DZ9 A;  1KIK A;  2SEM A;  2ZPI B;  4ORZ A;  4A63 B;  5KH6 A;  2W0Z A;  3RIR A;  1VQN A;  1YJN Q;  3X20 B;  1FMV A;  1M30 A;  1WDX A;  3HRU A;  2JM8 A;  2F1L A;  1ZX6 A;  1YWO A;  3EH2 A;  4XTW A;  5GAN f;  1LCK A;  4PJO A;  2NUZ A;  1Q86 C;  3TQ7 P;  3ULR B;  2LX7 A;  4N0A C;  2QI2 A;  3BFM A;  4E7L A;  3QDR B;  1ZUK A;  3CCM Q;  1I5L A;  1X43 A;  1KSW A;  3M57 A;  4FW2 A;  3F70 A;  4F16 A;  2EQI A;  3H41 A;  4E7S A;  5GAO m;  2D1X A;  4JS4 A;  5CKD A;  4RTT A;  4JZ4 A;  2L8D A;  1H8K A;  4OB0 B;  4BI4 A;  5HK0 A;  3PVL A;  4M4Z A;  4PFP A;  1VIE A;  3I55 T;  4PJJ A;  1Z9Z A;  2PNI A;  1IB8 A;  3H8Z A;  5CO7 A;  1N8R C;  1PKT A;  2JTE A;  2COY A;  3SWN A;  8ATC B;  2DVJ A;  1OPL A;  1GCP A;  3M58 A;  3I56 T;  4FU6 A;  4C5E A;  3ZFJ A;  1Q81 C;  1BCO A;  1BI1 A;  2HBP A;  2YLB A;  4MML A;  5LJ3 f;  1NM7 A;  2DXU A;  3FC3 A;  2E64 A;  4JZ3 A;  3QXE B;  1VQ8 Q;  3A5Z B;  4KUL A;  3PGG A;  1IGQ A;  1XNI A;  3OS0 A;  1YHQ T;  1Y7X A;  5GMK j;  2JXB A;  3CCE T;  4VUB A;  4WCI A;  2PQW A;  1OUL A;  3M53 A;  1WXT A;  1QQJ A;  3G6E A;  4M7D C;  2CH4 A;  2P84 A;  1X6G A;  1X6B A;  3RMS A;  1Y96 A;  1YJW A;  4RCC A;  2OTJ A;  3H0I A;  3VKI A;  4BY6 B;  5KYY A;  1M2V B;  4AG1 C;  2V1R A;  1X75 C;  3MJX A;  1VQ9 A;  1WJS A;  2R58 A;  4PNO A;  1Y57 A;  2KVQ G;  3OW2 A;  1WLP B;  2YUQ A;  2ABL A;  3I5R A;  1RAF B;  2K7A A;  4HVV A;  4BI8 B;  1M1G A;  1D0X A;  3LGF A;  4HCZ A;  4MDW A;  1UUE A;  4RCB A;  1NG2 A;  2HQE A;  2YLC A;  1PD1 A;  1MMN A;  3S3O A;  2EAY A;  2RM4 A;  1NJI R;  3OYJ A;  4XTX A;  4M7D E;  4B9W A;  2X3X D;  1CSK A;  1KJW A;  3OYY A;  3OYG A;  5GAN 7;  2E3H A;  4DEX A;  3CC4 Q;  2LVM A;  2RH2 A;  4LUD A;  1WGS A;  2CGH A;  1UJY A;  3M4Y A;  5J26 A;  3PT9 A;  5ECA A;  1UHF A;  3I9Q A;  2MYS A;  2ROL A;  2XDD A;  2RQW A;  2FPD A;  4R0K A;  3L2W A;  1YI2 Q;  1B34 B;  2JTM A;  2KXD A;  4FCY A;  3MET A;  4RG2 A;  1WQ7 A;  1Q81 U;  1D0Y A;  4JRI A;  2PVD B;  1VQK Q;  1J3T A;  5LJ3 h;  2RHI A;  4PFO A;  2DKG A;  2EYW A;  1O75 A;  1VQ4 Q;  1QVF P;  2RK1 A;  2GGR A;  2COW A;  3OYI A;  2EYY A;  2V26 A;  1YJ9 A;  4KRT A;  1BB9 A;  3RMQ A;  4AFQ C;  2NUT A;  3OYL A;  2E5K A;  3I55 A;  2NLU A;  2JW4 A;  1IRE B;  5D7U A;  4M7D F;  1JBM A;  2QEX Q;  4M7D G;  1X69 A;  2HKN A;  1WJR A;  1UTI A;  1U1T A;  3P8H A;  3I56 A;  1Y07 A;  4MZP A;  1S72 Q;  2EQK A;  3V7R A;  4RTU A;  1RAC B;  2XKO C;  3D7S B;  3NMZ C;  3WVE B;  2XDP A;  4M7D B;  3DB4 A;  2IPO B;  2F5K A;  4M78 D;  3PIP A;  1OU9 A;  3OYK A;  3C94 A;  2JUF A;  1UGS B;  4J8O A;  2V1Q A;  5GAN 5;  4ZNX A;  2QQS A;  3CC7 Q;  5LJ5 g;  5IH2 A;  1HSQ A;  1OV3 A;  3MO8 A;  3OYB A;  1QVP A;  4CI0 C;  1YHQ A;  1M90 C;  3A8M B;  2Y4X A;  3OQ5 A;  3CCE A;  4J9E A;  3HTR A;  3V7S A;  1JJ2 A;  2ROT A;  4KT0 E;  2HSP A;  1AD5 A;  2LQK A;  1ZQ1 A;  1C1A A;  3UA7 A;  3CCL T;  5GAN 8;  5I2M A;  3EH1 A;  1K9M R;  1NE8 A;  3FJ5 A;  4D6W A;  1FXX A;  3GNG A;  8AT1 B;  4CC4 B;  3HP9 A;  2JTF A;  3OMG A;  3GP8 A;  3TSZ A;  2M0Y A;  2F5T X;  2R5A A;  1UHC A;  4KUI A;  5L8R E;  3EFO A;  5GAO r;  1UB4 A;  1VQM T;  1Q82 C;  1LJO A;  1KD1 C;  5LJ5 d;  4M78 A;  3L1A A;  3TEE A;  1D1C A;  4M77 D;  3VV0 A;  1W70 A;  3GBQ A;  1RL2 A;  2DO3 A;  4LUE A;  2PVO B;  2L89 A;  2HAX A;  5IT9 E;  1LOJ A;  4ANJ A;  5FU6 C;  4PJL A;  3WXM B;  3RNJ A;  4M75 C;  3EG0 A;  1TWB A;  3RKY A;  4CRI A;  2CYZ B;  1G3W A;  1NPP A;  1RAH B;  3CMA Q;  1M1F A;  5GAN 3;  2EJF A;  2KNB B;  4HT9 A;  1IHW A;  3C0C A;  4RKU E;  4JUV A;  2EJG A;  2JT4 A;  4ZN1 A;  1K9A A;  4OMO A;  2ZPF B;  4UC4 A;  1K8A U;  2X4W A;  4A4E A;  3CCJ T;  1RAB B;  3EGU A;  4HVW A;  1LPL A;  3CCQ Q;  1K73 C;  2H3J A;  2IVW A;  2ED1 A;  2XD0 A;  2O4X A;  2DJZ A;  1KQS P;  2F2X A;  3LH0 A;  2ZPG B;  4M77 A;  2ED0 A;  3E9G A;  3L42 A;  1BCM A;  4C92 D;  1VQ6 Q;  1BI3 A;  4M75 E;  1IRX A;  2DL7 A;  2DMO A;  3G4S T;  2DTH A;  2CZ7 B;  1OPK A;  2LC4 A;  2QA4 T;  4J6W A;  2M51 A;  1JO8 A;  3G71 Q;  4XTZ A;  5GAO n;  4RTY A;  1KHI A;  1GCQ A;  3JCM Q;  4OMN A;  1MHN A;  5FRM A;  2EPD A;  1WZO A;  2VC8 A;  4X9D A;  3I35 A;  4DBF A;  5CQY A;  4ELY C;  5EG2 A;  1VQN Q;  4HCC A;  1OI1 A;  2QTV A;  2K5L A;  4JJD A;  3MEU A;  4N4H A;  2ZPB B;  1Z9Q A;  4B9X A;  5GAM j;  1R0C B;  1M2O A;  1UE9 A;  4HKE A;  1VYT A;  2YSQ A;  3MKD A;  2X4J A;  3E1S A;  1SKU B;  3V7C A;  1M3C A;  2GTO A;  5KCH A;  3CCR T;  1G5V A;  1MV0 B;  2FB7 A;  5IAY A;  1M1K R;  5C6S A;  1SF9 A;  2I2L A;  4C92 A;  2CUB A;  1WHH A;  2LQW A;  2DL5 A;  4AMC A;  3LWH A;  1YCS B;  2YT6 A;  3CCL A;  2QGG A;  3E2U A;  4M75 F;  4PL6 A;  2EKO A;  4AG2 C;  3P8B B;  1H64 1;  1OYX A;  1YIJ T;  3VJP A;  1VQP T;  1QCF A;  1G3Y A;  2EW3 A;  1MMD A;  1K0S A;  1PM3 A;  5FU6 B;  3HPW A;  1K0X A;  2O9S A;  3EG3 A;  2VXE A;  4M75 B;  1YIT Q;  2WAC A;  1AWX A;  2EFI A;  4XQ3 A;  3VUB A;  2CZ0 B;  1MMA A;  1VQM A;  1CKA A;  5GJW B;  3WVD B;  2RJE A;  3JCM V;  5LJ5 e;  1UGQ B;  2H8H A;  2XK0 A;  1ZA2 B;  3A8H B;  4JRP A;  3KBG A;  2A37 A;  2K5F A;  2L0A A;  5GMK l;  1A0N B;  1JRI A;  4WTO B;  1QVF A;  4XTY A;  3G1J A;  1QCN A;  3EGD B;  3G6E Q;  3HFO A;  2ENM A;  5IN1 A;  3QBY A;  4X1V A;  5CKF A;  2O2O A;  3QHS A;  3CCJ A;  2ZCF B;  2JOY A;  2RJC A;  4IIM A;  1BYM A;  1VQ9 Q;  5I2S A;  2FEI A;  2JNG A;  3VYG A;  2GNC A;  3AHU A;  1ZSZ C;  3I5S A;  4C8Q D;  2HCK A;  2GQI A;  3U23 A;  2RQU A;  3KUF A;  3TCJ A;  2B86 A;  5I21 A;  1X27 A;  2FZC B;  2RB6 A;  3JRZ A;  2FRW A;  1V29 B;  4K11 A;  1YWP A;  3G4S A;  1BK2 A;  1VQO Q;  5LJ5 f;  3HKS A;  1G3S A;  2DE0 X;  5AYF A;  4M7A D;  1AOJ A;  1AVZ C;  3CCU T;  1PRL C;  2KQW A;  4LDY A;  3UWN A;  2EQJ A;  2DLP A;  3O5Z A;  2D0Q B;  2OX7 A;  1VQ7 T;  1M8V A;  2CRE A;  2DBM A;  3V8K A;  4FYV B;  1IHV A;  1EIF A;  2Y90 A;  4N4G A;  2LRQ A;  2RI5 A;  1M5Q 1;  4CC7 A;  1GFD A;  4CC2 A;  4LXC A;  1B7T A;  4C8Q A;  4PJO C;  1ZHI A;  1KG1 A;  2VGM A;  5FW9 A;  4NL3 A;  2KT1 A;  4FYX B;  1WHM A;  1CKB A;  3CD6 A;  2BTT A;  1M3A A;  4OMP A;  1YJ9 Q;  1YBY A;  5CAI A;  4FSX A;  2JS0 A;  1VQL A;  2CDT A;  2FZG B;  1D3B B;  4XU0 A;  1RI9 A;  3I55 Q;  2XG8 D;  2J06 A;  4M7A A;  1W4S A;  4FIB A;  1YIJ A;  2HNI A;  3UDC A;  1VQP A;  1FX7 A;  3CCV T;  3OS1 A;  2QDY B;  4LNP A;  1TXQ A;  2HD0 A;  1HD3 A;  3I56 Q;  3VS0 A;  2V8J A;  2IG0 A;  4FSS A;  5D6X A;  2JJ9 A;  4QT7 A;  2JVV A;  2L3Q A;  1OQK A;  2DXC A;  4J6X A;  2LQ8 A;  4PJO E;  2DIL A;  1PNJ A;  1ACM B;  4GY5 A;  4F04 B;  3LX7 A;  2XHC A;  3OB9 A;  3QZ9 B;  2P0K A;  1YHQ Q;  4AFU C;  2LCS A;  2VUB A;  4IUT A;  5KYW A;  1X01 A;  3CCE Q;  1UGP B;  3C4S A;  5IHI A;  4C0Z A;  2CP5 A;  3X28 B;  1TOV A;  4ELZ C;  1ZSZ B;  2YWW A;  1N9R A;  4OGC A;  2F69 A;  1Q7Y U;  5GAO l;  1KC8 R;  1QLY A;  3M0R A;  2EYX A;  1MMG A;  2DEU A;  1UGR B;  1YJN T;  5GAO q;  2K3B A;  4E6R A;  2J6K A;  3FLG A;  1I0C A;  5LJ5 h;  1KQS S;  2OTL Q;  1KQ2 A;  1LVK A;  3MEV A;  4HT8 A;  5GAN j;  1SHF A;  3DLM A;  4IIO A;  2DD4 A;  1BBZ A;  5CKH A;  3RDV A;  2E41 A;  3HRS A;  3NTI A;  1KQ1 A;  1M4Z A;  2DD5 A;  4PKC C;  1AWW A;  1BKB A;  2DA9 A;  5CVI A;  4IUQ A;  3UPU A;  1OU8 A;  4EMK C;  3CCM T;  1W2B P;  2KT8 A;  2SRC A;  2O88 A;  1PSE A;  3PFS A;  2LDM A;  3REA B;  4L5G A;  3RKX A;  5A0G A;  1B34 A;  2DAQ A;  2HL3 A;  1QCO A;  2RA2 A;  4PJO F;  2FG0 A;  4XAX B;  5CK9 A;  1NJI C;  3VS5 A;  2LTO A;  2DJQ A;  2DM1 A;  3CCU A;  4LDX A;  4PJO B;  1GRI A;  2DIQ A;  3RER A;  2ZZD A;  3JB9 I;  4Y28 E;  2BE9 B;  1WI7 A;  1VQ7 A;  2W10 A;  4OF1 A;  4FL6 A;  5LJ3 j;  2CSQ A;  2KRO A;  3EHQ A;  1T3S A;  4J9I A;  3VS1 A;  2RD1 A;  3SDZ A;  2QAS A;  1Q86 U;  4YTL A;  5GAO p;  2MWO A;  2V8I A;  5KYN A;  1K4U S;  2AT1 B;  4RTW A;  1WHK A;  1H92 A;  2K9G A;  2CP2 A;  2E3I A;  3RKW A;  5FLX E;  3NTH A;  2JZ2 A;  3DB3 A;  5D6W A;  2F2W A;  2HSE B;  3JCM X;  2RI2 A;  2KRM A;  3OBY A;  4Z89 A;  5A2Q E;  2YRC A;  1N8R U;  2K2V A;  2KRS A;  2EKH A;  1IGU A;  2MIO A;  3CCV A;  1VYU A;  3NFC A;  2DBK A;  1PC0 A;  3CCS T;  1MV3 A;  1W6X A;  1XJW B;  2KK4 A;  1T0J A;  2XMF A;  5DLO A;  1TH7 A;  2MF2 A;  2KYB A;  2KE9 A;  3RES A;  2J6F A;  4IUU A;  4JS5 A;  2D8J A;  1Y96 B;  4O5V A;  1JXO A;  3FB9 A;  1OZ3 A;  1WIE A;  2NUP A;  3LLR A;  4PJN A;  2R5M A;  4HA8 A;  3CPF A;  2GTJ A;  2MCN A;  3L2U A;  3CC4 T;  3JB9 D;  2KSS A;  4EMK B;  2HQH A;  1RUW A;  3CCL Q;  4GBQ A;  2XI9 A;  1YCY A;  4OVA A;  1YJN A;  2C0O A;  2J6O A;  2JN0 A;  4J9D A;  3EGX A;  1NEG A;  3JCM g;  2ATC B;  5I11 A;  2HBW A;  3OYH A;  5FWB A;  1K9M C;  1AWJ A;  2DL4 A;  3VS2 A;  1VQM Q;  4BAC A;  1JB0 E;  3CCM A;  2PZ1 A;  4F14 A;  4O6J A;  5CCA A;  5GAN 4;  2LX9 A;  2DXB A;  2QYZ A;  2P4R A;  1QP3 A;  4PFZ A;  4M78 C;  1K8A R;  1OX8 A;  2LJ3 A;  3NGP A;  2O31 A;  4QQ6 A;  2EGA A;  1D0Z A;  2RHY A;  3QJ6 A;  4PLL A;  2K2M A;  1I81 A;  4ZN3 A;  3M4G A;  2P4T A;  4E7J A;  3JCM d;  1UGV A;  2DF6 A;  3ZBD A;  1EZZ B;  1PRM C;  4D8D A;  2KGT A;  3CCJ Q;  1HK9 A;  3GPL A;  4RG8 A;  2C0T A;  3HHT B;  3HFN A;  1SRL A;  2LCL A;  1ARK A;  2KI7 A;  3KXT A;  1VQ5 Q;  3CC7 T;  1NYF A;  4J83 A;  1MNE A;  2NUT B;  3H9N A;  4IUR A;  3M54 A;  2FPF A;  4M78 E;  4KGX B;  3BDL A;  3ZL7 C;  3M55 A;  3AT1 B;  1FMK A;  5A0L A;  2DVE A;  1C0M A;  4A4K A;  4M77 C;  1B3Q A;  3GF5 A;  1ZBX A;  4F7U E;  5FWC A;  4HCK A;  2L3R A;  4E7H A;  1SG5 A;  1RAE B;  2VAS A;  2A08 A;  4A4F A;  2GFA A;  3JCM P;  3QSU A;  5GAN g;  4AFZ C;  2H3E B;  5IHN A;  1G3T A;  2K3Y A;  5EC7 A;  2YUO A;  2DYI A;  3CBM A;  1UFF A;  3CCS A;  3MCA B;  1YP5 A;  3SB2 A;  2GFU A;  4JJC A;  2VWF A;  2EQM A;  3GOX A;  2LQN A;  3FDR A;  2CKK A;  3FJP A;  3EG9 A;  1ZLM A;  5M9O A;  1WPY A;  4RTX A;  1I1J A;  1M90 U;  4FT2 A;  1AT1 B;  2NWM A;  4M77 E;  1ZBJ A;  2KEA A;  2EGE A;  1TS9 A;  2EYQ A;  5GJV B;  3CXC P;  5HCK A;  3CD6 Q;  4M78 F;  1E6G A;  2E4H A;  2VVK A;  4MZM A;  3QZ5 B;  4Z8A A;  2L3S A;  4M78 G;  3SHW A;  5GAN d;  3CC4 A;  4C92 C;  2BE7 D;  4DQ2 A;  1M1K C;  5LL6 S;  1VQL Q;  3EFO B;  4F7U F;  3EHR A;  3QII A;  5LJ3 g;  4Y92 A;  4F7U G;  4EDU A;  3OA6 A;  2K6D A;  4M78 B;  1W2B S;  1UEB A;  2K57 A;  1VQP Q;  3EGD A;  3N5B B;  3THK A;  2EGC A;  1WHL A;  4J9H A;  5HK3 A;  3VS6 A;  2DRK A;  3CCQ T;  4F7U B;  2J05 A;  3CPW S;  1Q82 U;  2RMO A;  1KD1 U;  2HL5 C;  1O9S A;  3URG A;  2QTX A;  5KYX B;  3PMI A;  4J9C A;  1M27 C;  3UAT A;  2BKD N;  4IUP A;  4KBM B;  3QWY A;  3ASK A;  4FM4 B;  1AEY A;  4MMK A;  4JRQ A;  4M75 G;  1WA7 A;  1OZ2 A;  2CSI A;  4JJN K;  1NZ9 A;  2BZ8 A;  4C92 E;  5FU7 C;  2DER A;  4MDX A;  4QKU A;  5LJ3 d;  4DOV A;  4M77 F;  2MMP A;  4XTU A;  3X24 B;  1U06 A;  4M77 G;  1YNZ A;  3E9F A;  3EG2 A;  2E5Q A;  3FIF A;  1VUB A;  5KYU A;  3JCM e;  2O4X B;  1X6O A;  1D1A A;  1UJ0 A;  4M77 B;  3HRT A;  3OW2 P;  5IXB A;  3UF4 A;  3JCM W;  4HVU A;  1K73 U;  5GMK m;  3M0U A;  3RR6 A;  5KE2 A;  1MND A;  4XK8 E;  3L2Z A;  2QDL A;  3FEO A;  1QP2 A;  4KH1 B;  1I8F A;  2MPX C;  3OYC A;  3R6N A;  1QVG S;  3JCM c;  1RAG B;  1M3B A;  3O8V A;  2DIG A;  2YHT A;  1P92 A;  1YJW Q;  2XDB A;  2OTJ Q;  1EFN A;  3CC2 T;  2V8K A;  1T3L A;  2FYK A;  3OSV A;  3EFS A;  2L2P A;  4KGV B;  2YUP A;  4GLM A;  3J80 E;  2YXY A;  1N6A A;  4LD6 A;  3CCU Q;  1RAD B;  2VYT A;  1I5O B;  1C6V X;  4C92 F;  3HL8 A;  1M1K U;  1YIT T;  4C92 G;  1VQ7 Q;  4V2S A;  1RAI B;  4ZTJ A;  1PG5 B;  3X26 B;  2LP5 A;  3A1P A;  4C92 B;  2QXF A;  2Y4Y A;  2D0N A;  1XTD A;  2DL3 A;  2KDS A;  3NTK A;  4QVZ A;  4Z88 A;  4HCB A;  3IQL A;  1UEC A;  2QA4 A;  1ZUY A;  3OMC A;  4QQD A;  4A4G A;  4C8Q C;  3LWI A;  4DBR A;  2RK2 A;  2QK0 A;  3UT1 A;  3TSW A;  4RMO A;  1JQQ A;  3M56 A;  1OEB A;  2ECZ A;  3OYN A;  7AT1 B;  5GAN e;  2LCC A;  3QWX X;  3CME T;  4RUG A;  4ME7 A;  3OYF A;  5HY6 A;  3CCV Q;  4JDS A;  2L5Q A;  2I0N A;  4N4I A;  3GLX A;  2CH4 W;  1VQ9 T;  5GMK e;  3E19 A;  4M7A C;  1ZSZ A;  1WXU A;  2EVR A;  1AZG B;  4JLG A;  2VKN A;  3T9N A;  1WXB A;  3CCR A;  5FU7 B;  4E7K A;  1Q7Y R;  4QVC A;  5J3B A;  2K4Y A;  3SFM A;  3FRN A;  3INZ A;  5CKE A;  3CBP A;  1QW1 A;  2MK5 A;  2FRY A;  3CBO A;  2HKQ B;  2LNV A;  4C8Q E;  5LJ5 j;  2E10 A;  2K5I A;  4QW2 A;  1VQO T;  3VRZ A;  2CZ1 B;  3JAM E;  4BDY A;  1SSF A;  3OYA A;  4E47 A;  1TSF A;  4L6V 5;  5LJ3 e;  2PUK B;  3SWN C;  1TG0 A;  2VXF A;  3TVT A;  3M5A A;  2A7Y A;  2ESW A;  3H6Z A;  4J7I A;  4ESR A;  3M0Q A;  1M2V A;  4C5H A;  4M7A E;  4A4H A;  4A54 A;  1KC8 C;  4LDW A;  3SD4 A;  1KQS A;  2DK3 A;  5I22 A;  1ABO A;  2RHX A;  1OOT A;  2BUD A;  3MPU B;  2JM9 A;  4NL2 A;  1W1F A;  2K79 A;  2VV5 A;  1E6H A;  1WHG A;  3JCM h;  1X2K A;  5GMK i;  1YJ9 T;  2RHU A;  3CC2 A;  2A28 A;  3CXC A;  1LNX A;  2GBQ A;  1Q86 R;  3LH5 A;  5A0D A;  1IZ6 A;  1SHG A;  5J39 A;  2C06 A;  1V1C A;  4C8Q F;  2HZY A;  4N0A A;  5GAM g;  2O9V A;  4C8Q G;  2KY9 A;  3HSB A;  3MEA A;  1PWT A;  2C0I A;  2HEQ A;  3JSC A;  2CP6 A;  4PK4 A;  2QGF B;  1YIT A;  4TVR A;  4C8Q B;  1QWE A;  2DET A;  2XID A;  3BY7 A;  4M7D D;  3KFV A;  2E12 A;  1N27 A;  2A36 A;  1RI0 A;  4X34 A;  4C0G A;  3CXC S;  3JCM J;  4M7A F;  1NEB A;  2JMC A;  2F2V A;  1N8R R;  3CPW P;  1JU5 C;  3LGL A;  4M7A G;  1ZSG A;  2HDA A;  4DEY A;  1X2Q A;  4PJO G;  1UDL A;  5L23 A;  2AZV A;  2P0P A;  4M7A B;  3RUX A;  4JJB A;  3QUI A;  3ME9 A;  3A98 A;  1Q81 R;  1Y71 A;  2L3P A;  3BW1 A;  3RBB B;  5GAM d;  4NS5 A;  3VRY A;  3TU4 K;  4C0D C;  2D9T A;  3CME A;  5DM7 R;  1Q95 G;  1ZA1 B;  5IXF A;  4BDZ A;  5CKB A;  3J7A F;  2QQ9 A;  2OTL T;  1YFN A;  3OS2 A;  2VGN A;  1VIF A;  1PHT A;  4OMF B;  3MP6 A;  1VQ8 T;  2WSF E;  4LD9 K;  4ZGJ B;  4EMK A;  1BI2 A;  2QQB A;  2HQX A;  4P5N A;  1QWF A;  4EMG A;  1IXD A;  2DFU A;  2KYM A;  3CCS Q;  2CZ6 B;  2LMJ A;  5KYW B;  4M7D A;  2CUD A;  1JEG A;  1N5Z A;  1KC8 U;  2G3R A;  4NOY A;  2DX1 A;  1BIB A;  3SWN B;  4FYW B;  2M0O A;  3BDU A;  4OMM A;  4RTV A;  4EPC A;  5GAN h;  4F17 A;  2G6F X;  1TUC A;  4IKF A;  4L59 A;  3R6O A;  1VQO A;  4R56 A;  1QVG P;  2RJF A;  3V8J A;  2COZ A;  2DYB A;  5GMK h;  3CEY A;  3OW2 S;  3M59 A;  3M0S A;  4OGE A;  3OYD A;  2AKL A;  1AWO A;  2ZGW A;  4PJM A;  3MEW A;  1FWZ A;  1D09 B;  3VYH B;  1NLP C;  4X9C A;  2LT1 A;  3UA6 A;  4R55 A;  2FZK B;  3X25 B;  3H0F A;  2LJ1 A;  2GF7 A;  2DZC A;  5KYY B;  3PE0 A;  3VS3 A;  2Z0W A;  2EIF A;  3S3N A;  1GBR A;  3ZEH A;  1NPR A;  1R0B G;  1WJQ A;  1H3H A;  2EJ9 A;  1U3O A;  1K76 A;  3QDF A;  3L2Q A;  1PSF A;  1PKS A;  2RF0 A;  1GBQ A;  1K8A C;  1NJI U;  1AHJ B;  2DTO A;  2AKK A;  3A8L B;  1YI2 T;  2EQU A;  3SEM A;  2LNH B;  4OP0 A;  4AT1 B;  2M9U A;  3QJY A;  2E65 A;  4OMQ A;  1PCX A;  2CT3 A;  5CQX A;  1WX6 A;  5CR2 A;  3M9Q A;  3V8L A;  1VQK T;  4KH0 B;  3BE3 A;  3QO3 A;  1VQ4 T;  3OS5 A;  4C0D B;  1GXI E;  4GLK A;  3VS7 A;  1KFZ A;  3QKJ A;  4B6M A;  4C5I A;  4ZGE B;  2RHZ A;  2D6F A;  4XU2 A;  1XQH A;  1NYG A;  2WSE E;  2PUO B;  1F1B B;  2QEX T;  1QKX A;  3C95 A;  2AZS A;  2BZY A;  2KRN A;  3L2R A;  5GAM e;  1S72 T;  2YUN A;  1D1B A;  1TUD A;  2RQV A;  2OTL A;  4DOW A;  2BZX A;  1M9S A;  4LDU A;  2K3X A;  4Z02 A;  1U8R A;  1M90 R;  1VQ8 A;  1OX9 A;  1T0H A;  2B8A A;  4M75 D;  3OYM A;  5KCO A;  2P0Q A;  3J81 E;  1JJ2 S;  1FYN A;  4HXJ A;  2NUP B;  4BE1 A;  3A8O B;  2YDL A;  1GL5 A;  1WNL A;  2E1H A;  4J9F A;  1NBE B;  2DTI A;  1I4K 1;  2J7I A;  4J9G A;  1SEM A;  1HJD A;  1SRM A;  4F7U A;  5C0M A;  1YN8 A;  3DKM A;  3G4S Q;  2KXC A;  3C12 A;  2QA4 Q;  1H3Z A;  3P8D A;  2YRV A;  3MP1 A;  3EGX B;  1TUG B;  1Q82 R;  5KYX A;  4OB1 B;  2KMT A;  1U5S A;  3QYH B;  4QQG A;  1KD1 R;  4DBQ A;  4AFS C;  2QAZ A;  4E7Z A;  2X9H A;  1GCQ C;  2XIC A;  3PTA A;  9ATC B;  2PVG B;  2AHJ B;  2GQV A;  2XU8 A;  1MUZ A;  2KBT A;  3QYG B;  4LN2 A;  3JCM b;  2OI3 A;  6AT1 B;  2E6N A;  3CQT A;  1K9M U;  3TRE A;  4DBH A;  1W2B A;  2ZPH B;  4RTZ A;  1AZE A;  5GAM f;  4M75 A;  2FHD A;  5AT1 B;  2RO0 A;  1VQ5 T;  4CC3 A;  2JS2 A;  3JB9 F;  3EG1 A;  3CCR Q;  2AIR B;  2MAM A;  2EBP A;  3Q1J A;  4DA4 A;  2DL8 A;  3JB9 G;  4A53 A;  3CPW A;  2FPE A;  3CMA T;  3PVQ A;  1FMW A;  1GFC A;  2DPP B;  2CP7 A;  5GAN 6;  3JB9 J;  3PNW C;  1RLQ C;  3LYI A;  4ATO A;  4EIK A;  1EX4 A;  4XU1 A;  2YRD A;  1K73 R;  2VB6 A;  4LE9 A;  1YIJ Q;  3PIO A;  1V76 A;  1E7O A;  4E2F B;  2EWN A;  1U1S A;  5FRO A;  1YI2 A;  4LDV A;  3NPF A;  3S6W A;  2OAU A;  4BI3 A;  4OB2 B;  1TTH B;  2CT4 A;  1S1N A;  5IHK A;  1VQK A;  4JRK A;  5HKC A;  1G83 A;  3QPH A;  4XU3 A;  1VQ6 T;  2CP3 A;  2HMA A;  2MWP A;  2RI3 A;  2D8H A;  2RQT A;  1VQ4 A;  3JB9 H;  2LT4 A;  2GCX A;  1VA7 A;  1UG1 A;  1SPK A;  3JV3 A;  2DXT A;  2LJ0 A;  1KHC A;  3G71 T;  2IIM A;  2CP0 A;  2QQA A;  2RN8 A;  3CD6 T;  2MOX A;  2QEX A;  1JXM A;  1QVG A;  4II1 A;  1TU0 B;  3CC2 Q;  2O01 E;  1VQN T;  1R77 A;  3REB B;  1S72 A;  1VQL T;  2LZ6 B;  1WYX A;  2QG9 B;  4BE2 A;  2RQR A;  2RJD A;  1PD0 A;  4BD3 A;  4J7F A;  2X35 A;  1BI0 A;  3EG9 B;  3CC7 A;  2QQR A;  1SSH A;  2CS7 A;  1K1Z A;  4PLI A;  4IUV A;  1Y0M A;  4BB7 A;  3OYE A;  4D8K A;  2ZAE A;  1ABQ A;  1KK7 A;  3NHN A;  3ER0 A;  2M16 A;  4FYY B;  2BIV A;  3OBW A;  5GAM h;  3PMT A;  3S3M A;  1G2B A;  1ZUU A;  3H0H A;  4XTV A;  3MHX A;  1HYO A;  1BIA A;  1G8X A;  3QG1 A;  1WHJ A;  1I07 A;  4EMH A;  4BUG A;  4J9B A;  5GAN 2;  1RLP C;  2M1H A;  4KGZ B;  3EAE A;  1DJ7 B;  2X51 A;  4WF2 A;  2E70 A;  3CME Q;  1VYV A;  2KAF A;  1D3B A; 
#chains in the Genus database with same CATH homology
 1QKW A;  3LH5 A;  2F2X A;  1SHG A;  3M0T A;  1V1C A;  2ED0 A;  1BU1 A;  2OAW A;  1NLO C;  2O9V A;  4JPB W;  2X3W D;  1PWT A;  2C0I A;  2HEQ A;  2GTJ A;  2MCN A;  1RUW A;  2DL7 A;  2DMO A;  1M8M A;  4GBQ A;  1XOV A;  1QWE A;  2DRM A;  1OPK A;  2C0O A;  2J6O A;  4J9D A;  2M51 A;  3KFV A;  1NEG A;  1JO8 A;  2A36 A;  5I11 A;  1IO6 A;  4RTY A;  2HBW A;  3VS4 A;  1GCQ A;  4OMN A;  4OML A;  2EPD A;  1NEB A;  2JMC A;  2F2V A;  5FWB A;  1JU5 C;  3I35 A;  1ZSG A;  2DNU A;  1AWJ A;  2HDA A;  2JMA A;  2DL4 A;  4DEY A;  3VS2 A;  1X2Q A;  1UDL A;  5L23 A;  2AZV A;  4JJD A;  2PZ1 A;  4F14 A;  4JJB A;  2P4R A;  1Z9Q A;  3A98 A;  1UE9 A;  1VYT A;  2L3P A;  2LJ3 A;  3NGP A;  1WFW A;  2O31 A;  3RBB B;  2YSQ A;  3VRY A;  2EGA A;  1M3C A;  2RNA A;  2GTO A;  2OJ2 A;  2AK5 A;  5IXF A;  1MV0 B;  3M0P A;  2K2M A;  2CUB A;  1PHT A;  2LQW A;  2KR3 A;  2DL5 A;  2RPN A;  1UGV A;  1YCS B;  2DF6 A;  2FO0 A;  2YT6 A;  1QWF A;  1B07 A;  1PRM C;  4D8D A;  2KYM A;  4AG2 C;  2KGT A;  2LMJ A;  2CUD A;  1JEG A;  1N5Z A;  2EYZ A;  2C0T A;  1QCF A;  2DX1 A;  2EW3 A;  1SRL A;  1ARK A;  1K0S A;  4RTV A;  4OMM A;  2PTK A;  1KIK A;  2SEM A;  2O9S A;  3EG3 A;  4ORZ A;  4A63 B;  1K0X A;  1AWX A;  4F17 A;  2G6F X;  1TUC A;  1NYF A;  2W0Z A;  2FPF A;  1CKA A;  5GJW B;  1M30 A;  1WDX A;  2JM8 A;  3ZL7 C;  2DYB A;  1ZX6 A;  1FMK A;  1YWO A;  2H8H A;  3M0S A;  1B3Q A;  1LCK A;  5FWC A;  2NUZ A;  3ULR B;  2LX7 A;  2AKL A;  2A37 A;  4HCK A;  1AWO A;  2L0A A;  1A0N B;  2A08 A;  1ZUK A;  1NLP C;  1X43 A;  1KSW A;  3UA6 A;  4AFZ C;  4F16 A;  2EQI A;  5IHN A;  3H41 A;  2ENM A;  2D1X A;  4X1V A;  4RTT A;  5EC7 A;  2YUO A;  4JZ4 A;  1H8K A;  2O2O A;  3PVL A;  4M4Z A;  3H0F A;  2LJ1 A;  1UFF A;  1YP5 A;  3PE0 A;  3VS3 A;  1Z9Z A;  2PNI A;  4JJC A;  2VWF A;  1PKT A;  2LQN A;  2JTE A;  4IIM A;  1GBR A;  2FEI A;  1H3H A;  2DVJ A;  2GNC A;  1OPL A;  1U3O A;  1ZLM A;  1GCP A;  1K76 A;  4RTX A;  1I1J A;  3I5S A;  1PKS A;  2GQI A;  2HCK A;  2RF0 A;  2NWM A;  3U23 A;  1GBQ A;  2RQU A;  1ZBJ A;  2KEA A;  2B86 A;  1X27 A;  2AKK A;  2EGE A;  1NM7 A;  5GJV B;  4JZ3 A;  5HCK A;  1E6G A;  2VVK A;  2FRW A;  4K11 A;  3SHW A;  4Z8A A;  2L3S A;  3SEM A;  1YWP A;  2LNH B;  4OMQ A;  1BK2 A;  3EHR A;  2CT3 A;  4Y92 A;  2JXB A;  1WX6 A;  2DE0 X;  2K6D A;  3THK A;  4WCI A;  2EGC A;  1WXT A;  4J9H A;  1AOJ A;  1AVZ C;  2CH4 A;  3VS6 A;  1PRL C;  2DRK A;  1X6G A;  1X6B A;  3VS7 A;  2J05 A;  2DLP A;  1KFZ A;  3O5Z A;  3H0I A;  2RMO A;  2CRE A;  2DBM A;  4AG1 C;  2V1R A;  1NYG A;  4J9C A;  1M27 C;  3UAT A;  1Y57 A;  4CC7 A;  1QKX A;  1VYV A;  2AZS A;  1GFD A;  1WLP B;  3QWY A;  4CC2 A;  2BZY A;  2KRN A;  1AEY A;  2YUQ A;  2ABL A;  3I5R A;  2K7A A;  2YUN A;  4HVV A;  5FW9 A;  1WA7 A;  1TUD A;  2RQV A;  2CSI A;  2KT1 A;  2BZ8 A;  2BZX A;  1UUE A;  1NG2 A;  1CKB A;  2BTT A;  1U06 A;  1T0H A;  1M3A A;  4OMP A;  1YNZ A;  3EG2 A;  2JS0 A;  2CDT A;  1FYN A;  4HXJ A;  1RI9 A;  1UJ0 A;  2X3X D;  2J06 A;  1CSK A;  5IXB A;  2YDL A;  3UF4 A;  1GL5 A;  1KJW A;  4J9F A;  2J7I A;  4J9G A;  4DEX A;  1SEM A;  4LNP A;  1HJD A;  1SRM A;  4HVU A;  3M0U A;  1YN8 A;  1HD3 A;  4LUD A;  2KXC A;  3VS0 A;  1UJY A;  5ECA A;  4FSS A;  1UHF A;  3I9Q A;  2QDL A;  2ROL A;  4QT7 A;  2RQW A;  2FPD A;  3R6N A;  2L3Q A;  1U5S A;  4R0K A;  2DIL A;  1PNJ A;  4AFS C;  1M3B A;  1EFN A;  1GCQ C;  2KXD A;  4AFU C;  1T3L A;  2LCS A;  1MUZ A;  2KBT A;  2L2P A;  2YUP A;  4LN2 A;  4GLM A;  2OI3 A;  1J3T A;  5IHI A;  3CQT A;  2EYW A;  4RTZ A;  1AZE A;  2GGR A;  2EYY A;  4KRT A;  1BB9 A;  4AFQ C;  4CC3 A;  1QLY A;  2JS2 A;  3EG1 A;  2EYX A;  3M0R A;  2EBP A;  2E5K A;  2DL8 A;  2K3B A;  4E6R A;  2J6K A;  1I0C A;  2JW4 A;  2FPE A;  2LP5 A;  1SHF A;  3PVQ A;  4IIO A;  1GFC A;  2D0N A;  1BBZ A;  2DL3 A;  1X69 A;  1RLQ C;  1UTI A;  4EIK A;  4Z88 A;  1AWW A;  2DA9 A;  4RTU A;  3IQL A;  1UEC A;  3NMZ C;  1ZUY A;  2KT8 A;  2SRC A;  4LE9 A;  2O88 A;  1E7O A;  3REA B;  3TSW A;  1JQQ A;  1OEB A;  2ECZ A;  2V1Q A;  3NPF A;  4ZNX A;  5IH2 A;  1HSQ A;  1OV3 A;  3QWX X;  2FG0 A;  2CT4 A;  4RUG A;  1S1N A;  5IHK A;  4J9E A;  2ROT A;  3VS5 A;  2DJQ A;  2HSP A;  1G83 A;  1AD5 A;  2I0N A;  2CH4 W;  2DM1 A;  1GRI A;  2RQT A;  2D8H A;  1WXU A;  2EVR A;  3UA7 A;  1AZG B;  2VKN A;  1VA7 A;  1UG1 A;  1WI7 A;  2W10 A;  1SPK A;  1WXB A;  3JV3 A;  3FJ5 A;  2CSQ A;  2KRO A;  2LJ0 A;  3EHQ A;  1T3S A;  4J9I A;  3VS1 A;  2IIM A;  4CC4 B;  2RN8 A;  2MOX A;  3TSZ A;  1JXM A;  2FRY A;  2M0Y A;  1UHC A;  3REB B;  1K4U S;  3VRZ A;  4RTW A;  2LZ6 B;  1H92 A;  1WYX A;  2K9G A;  2RQR A;  1W70 A;  3GBQ A;  4LUE A;  1TG0 A;  2F2W A;  3TVT A;  1SSH A;  1K1Z A;  3RNJ A;  2ESW A;  2KRM A;  4Z89 A;  4ESR A;  3EG0 A;  1Y0M A;  3M0Q A;  2KRS A;  2EKH A;  2MIO A;  4D8K A;  1ABQ A;  3NHN A;  2KNB B;  3C0C A;  5I22 A;  2JT4 A;  1K9A A;  1G2B A;  4OMO A;  1ABO A;  1VYU A;  1ZUU A;  2DBK A;  3H0H A;  1OOT A;  1MV3 A;  2JM9 A;  1W6X A;  1T0J A;  2XMF A;  3EGU A;  1I07 A;  4HVW A;  1W1F A;  2KYB A;  2KE9 A;  4J9B A;  2K79 A;  2J6F A;  1RLP C;  1E6H A;  2D8J A;  1X2K A;  2A28 A;  2ED1 A;  2GBQ A;  1WIE A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...