1NJIR

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1njiR00
3CMEQ 3CD6Q 2OTLQ 2OTJQ 1W2BP 1Q81R 1VQ6Q 3G6EQ 3CPWP 1Q7YR 1NJIR 1KC8R 1M1KR 3CCLQ 1Q86R 1YITQ 1VQNQ 1VQ8Q 1M90R 3CCMQ 3CCVQ 3I56Q 3CC2Q 1KD1R 3CCUQ 1QVGP 2QEXQ 1VQPQ 1VQ4Q 3G4SQ 1S72Q 1YHQQ 1YJNQ 3CCRQ 1VQMQ 1YIJQ 3CCJQ 3CC7Q 1QVFP 1VQLQ 1YI2Q 3CCSQ 3CXCP 1YJ9Q 1VQ5Q 1YJWQ 3CCQQ 1VQ9Q 1Q82R 1K73R 3OW2P 1K8AR 1VQ7Q 3CCEQ 1K9MR 3CMAQ 1KQSP 1VQKQ 2QA4Q 1N8RR 1JJ2P 3I55Q 3G71Q 1VQOQ 3CC4Q
chains in the Genus database with same CATH superfamily
1MNDA 2E6ZA 4FW2A 3VS5A 4XU1A 1WJRA 4JZ3A 3FDRA 2CUBA 2KAFA 3MEUA 2L3PA 2CZ1B 1N6AA 2KQWA 1I4K1 3BY7A 1T0JA 4M75D 4IUQA 3RDVA 4NOYA 3JCMQ 1Y57A 3C4SA 4M7AF 1Q7YC 4LD9K 1Q86R 1HSQA 5LJ3e 2HL3A 2X9HA 1RADB 2EKOA 4JJBA 4EMHA 3CMAT 3LX7A 2L89A 1Q82U 3X24B 4QW2A 3JCMh 1JB0E 1ZUUA 5I2SA 2BE9B 4FCYA 4J6YA 1K8AR 3A8HB 2OTLQ 1M27C 2O31A 1Q81C 1X43A 3LW5E 4WTOB 2VV5A 1N9RA 1OZ3A 4M4ZA 1ZBXA 2E1HA 4AG1C 3JB9I 4HCZA 1F1BB 3CCMA 4A4HA 4C5EA 3L2ZA 2DD5A 5LJ3j 4KUDK 5CKFA 2LNVA 1RAHB 4M78G 2QK0A 3OMCA 2VVKA 3OS1A 1FMWA 5CQXA 1IO6A 4XTVA 3SHWA 1UGQB 2ZPBB 1PKSA 1LJOA 4PKCC 2MK5A 3L2RA 1OYXA 3EGXA 1VQMQ 5D6YA 4CRIA 2JW4A 1AEYA 2O9VA 2ZPFB 4OF1A 4MDWA 8ATCB 4PNOA 2HQHA 3RR6A 2QEXT 3OB9A 2M0OA 5CR2A 1ZSZC 2DETA 4ZN3A 1NYFA 3KFVA 4C92F 5CCAA 3M56A 4FSXA 4PK4A 1IGUA 7AT1B 3OYIA 1E7OA 2E3HA 2EWNA 1R8OB 2D1XA 4RUGA 2FZGB 2IPOB 2YRVA 3QXEB 5IHNA 2XKOC 2QGGA 4UC4A 3TQ7P 1YHQA 3CQTA 2HMAA 2ESWA 1KC8C 2MMPA 1PM3A 1YWOA 2LJ1A 1K0SA 5LJ5e 4FYXB 4XAXB 4C8QB 1NJIR 2V1QA 1M1KC 2E65A 4MZPA 3QHSA 2E41A 2QI2A 5GAN5 2MIOA 1D09B 2M51A 2A28A 3J7AF 2R5MA 1UE9A 1WX6A 4A4GA 3RNJA 1BI3A 2GTOA 2VB6A 2CSIA 1VQ8T 1PG5B 4HCBA 2WSEE 5M9OA 4FU6A 5GAMe 1WQ7A 1I81A 1NBEB 3CEYA 4M77C 2DJZA 2LCCA 2ROLA 1SHFA 2RI5A 4ATOA 3OYKA 2PVGB 3CCMQ 1WIEA 3LWHA 4J9HA 2PUKB 1UECA 4M75G 4A53A 4LDWA 4JLGA 4GLMA 4A4EA 4F16A 3PVQA 4KBMB 5LJ5j 2NUTA 2DD4A 3PFSA 3OYCA 2JMAA 1N8RU 1VYTA 4Y28E 2DTHA 2CZ7B 2AKLA 1U06A 4R56A 2XIDA 4J9EA 4AMCA 2X3WD 1YN8A 4J6WA 2JS0A 1VQ7T 1RAFB 2KEAA 5GAMj 2AIRB 3JCMc 1R77A 4J5YA 4ESRA 3D7SB 4M7DC 4PJJA 1M8MA 2M0YA 4L5GA 5GAOp 4N4IA 3G4ST 1X69A 3EG0A 1Z9ZA 2PZ1A 1M1GA 2O2OA 2J7IA 1X27A 1WPYA 2EKHA 1XJWB 4M78A 2WSFE 5KYWB 3URGA 2CSQA 3GLXA 1YFNA 1I0CA 2E64A 2A08A 1YHQQ 4FW1A 4XTUA 1PNJA 1Q82C 3M0TA 3EFRA 1ACMB 2XICA 4KUIA 3IQLA 4NL2A 1UGSB 1Q7YR 2YHTA 3GOXA 1JBMA 2VYTA 5FU6B 2DXTA 2NYSA 3ULRB 1QCOA 5I22A 2QQSA 1PC0A 2MOXA 3EGDB 1AWXA 4F7UE 4BE0A 4X9CA 1GCQA 1BI0A 4IUPA 1VQ9A 4XTZA 2JUFA 1Q81R 4ZN1A 1SKUB 3CMAA 1M90U 2LRQA 2EQJA 3SB2A 1HD3A 2A3LA 2ZAEA 2LZ6B 4RKUE 1IHVA 2K5LA 5AT1B 3ZFJA 2CZ6B 1QVFP 4EMKC 4JUVA 2EGEA 1ZHIA 2E10A 4M7AE 2DLPA 4HCKA 1ZLMA 1OULA 2R57A 2YUNA 3VS0A 2VGMA 2EBPA 4TVRA 3QG1A 1VYVA 4L59A 5A0GA 1S72T 4OGEA 4OMNA 1P92A 3CCST 4BI4A 5LJ3g 1NLPC 4GLKA 2GBQA 1N27A 4PL6A 4PJOG 1X75C 1JO8A 4M75A 3X20B 1K9MC 2KMTA 4NS5A 2LC4A 2DIGA 4OP0A 1UFFA 1PHTA 2HL5C 1PWTA 3JV3A 4F7UB 1LPLA 1SEMA 1QP2A 1AZGB 1U8RA 1WQWA 4ELYC 1WHLA 2L8DA 3JSCA 3CC2A 4N0AC 5CQYA 1KIKA 1D3BA 1GRIA 2L3RA 1OEBA 1PKTA 2ZCFB 3OYNA 2V8JA 1KC8R 2GFAA 1NE8A 5DY9A 1RI0A 1K1ZA 2KNBB 3JCMd 1UEBA 1M1KR 5GAOm 5CVIA 1YBYA 2B8AA 4OVAA 1PRLC 3TREA 3PT9A 2F5TX 3N5BB 1QWEA 3NFCA 1OI1A 4M7AB 1D0ZA 3CCLT 1VQ9Q 2WACA 1K73R 4C92E 2KY9A 3I35A 3CMAQ 5CKDA 4RG8A 2YUOA 4N0AA 4XU2A 3FJ5A 1YWPA 3EFOA 3VYGA 2DPPB 2KR3A 2YUQA 2XU8A 4OGCA 1WXBA 3HRSA 4RTVA 1LCKA 4KGZB 3OW2P 3CBOA 3OSVA 5CAIA 1QW1A 1MNEA 2B86A 1GXIE 2ED1A 5LJ5g 3CCJT 1BYMA 3JCMJ 5GAOq 1QLYA 2V8IA 2JVVA 4XTWA 4RTXA 5GAN2 1Y71A 3OYGA 3CXCP 1VQNT 3RKXA 1M2VA 1KQ1A 3HTRA 3OBWA 1S1NA 5GAMg 3JB9D 2YUPA 3DKMA 2RNAA 1VQ7A 5EC7A 5GAN3 4II1A 3OYDA 4C8QC 1WI7A 1K4US 3CC2Q 2VKNA 4C92B 1NYGA 1M5Q1 2PNIA 2CP0A 3DB4A 4JDSA 2FG0A 1UGPB 3R6OA 1WZOA 1ZX6A 1Y96B 4FYYB 2DL4A 4RMOA 2COWA 3HSBA 1RAIB 2CP6A 3OS0A 1B3QA 1KSWA 4M77D 2A36A 5GANe 2OTJA 5IXFA 2V1RA 3P8BB 2HZYA 3PMTA 3J80E 3JB9H 1WFWA 3PMIA 3VKIA 4EIKA 3OS5A 1VQ6T 1M3BA 2E3IA 3L2UA 1C1AA 2J6KA 1UJYA 2RJDA 4BY6B 3H0FA 4IIMA 4ELZC 4KGXB 1WJSA 2PVOB 1SSHA 2FPDA 5I21A 4F04B 2QQAA 1R0CB 2LQNA 4M75E 2KT8A 2EYWA 3UT1A 2HDAA 2DXUA 5GANj 2ECZA 2KYBA 1WGSA 4QVCA 5LJ3f 2DIQA 2RN8A 4M7DD 1ZSGA 1YIJT 4C5HA 2EAYA 1QVGA 3SEMA 1FXXA 2D6FA 2VASA 5GAOl 5DM7R 3O8VA 4PLIA 2E4HA 3JAME 1IGQA 2COZA 3M54A 1VQPA 3VYHB 4N4GA 1S72A 2RI3A 1G3TA 1VQ7Q 1K9MR 1MMGA 2F5KA 5IAYA 3CBMA 4JRQA 2DX1A 4OB1B 2JXBA 3L2QA 3E2UA 5KYXA 1UGRB 3M4GA 4J9DA 1RI9A 3MCAB 1OV3A 3LWIA 4FSSA 1I1JA 5FU7C 1RAAB 1M9SA 2SEMA 3SWNB 4OMMA 4B9XA 3M0RA 4GBQA 2FRYA 2R58A 5KCOA 5KYWA 2DJQA 1X6OA 2OTJQ 4XTXA 1Q95G 2KVQG 2XMFA 2L3SA 2EQUA 2CP3A 4LDUA 1K76A 2E6NA 5I11A 1QQJA 1QMCA 1AWJA 3JB9G 1QVPA 1O75A 2QGFB 5GMKh 1B7TA 2FYKA 1VQ5A 4LUEA 1QVGS 2DYBA 1KHCA 1IZ6A 4OMOA 5DLQE 1YJNT 4ZGJB 4J7FA 3QUIA 4DA4A 2BTTA 1WHKA 5KH6A 2XDPA 3G6EA 3CCLA 1H641 4OMQA 4X9DA 2JMCA 3FRNA 4ZNXA 3RKWA 1T0HA 5FW9A 3OYYA 4PFZA 3TSWA 5LJ5f 4V2SA 4M77G 4E7JA 2ED0A 4KULA 1YCSB 2EJGA 3RERA 1FX7A 2BZXA 3VUZA 2DTIA 2EIFA 1VQOA 3KXTA 2CP2A 2NUPB 1TU0B 1VQPQ 1S72Q 1TH7A 2DVEA 3J81E 1M3AA 5GAMf 3OYLA 4PJOE 2LX7A 1UDLA 3EG2A 1W1FA 2A37A 3JB9J 1UGVA 3X26B 4K11A 3H0IA 3QPHA 4E6RA 1U1SA 5GMKl 4M7DG 3M5AA 2DE0X 4DOVA 4M7AC 1I5LA 1C0MA 4FL6A 2DBMA 1QVGP 2P0PA 2LT1A 1HYOA 3I55A 1KD1U 1BBZA 2RJFA 2DERA 4P5NA 5L8RE 4LDVA 2BZYA 3CMET 2HQXA 2OAUA 2QDLA 1VQ5Q 1YITT 2J6FA 4XQ3A 2LVMA 4HA8A 1TXQA 3LH5A 1OOTA 4EDUA 4KGVB 2YRDA 3CCUT 2EYZA 2BE7D 2K79A 1QVFA 4RTZA 1RABB 4DBFA 3RBBB 3G6EQ 1UHFA 2YWWA 2KDSA 2DRMA 5IXBA 1TG0A 3CCLQ 1X2KA 4R0KA 3ZL7C 1VQKT 1ZSZA 1AD5A 1X6BA 4M78F 5D7UA 1IREB 3UWNA 2OX7A 2IG0A 4J9BA 4IIOA 1ZUYA 2ENMA 3CCVT 2ROTA 2MF2A 1U1TA 1V29B 1VQOQ 1VQLA 1XTDA 3H0HA 1SRMA 1FWZA 4HVVA 1SSFA 1MMNA 1B34A 5GANg 2AKKA 1HXDA 4C8QD 4DEYA 3OYBA 3HRTA 4C92C 4RTWA 5D6WA 1YIJA 4BD3A 1OPKA 3M0UA 2RQTA 3FC3A 2CKKA 5KYYA 2LCSA 2PQWA 1JJ2A 4IUUA 1O9SA 2KXCA 4M77A 3QZ9B 3A98A 5A2QE 3V7CA 4PFPA 2LMJA 2DA9A 4JJDA 1QVFS 1AWWA 3OA6A 1BIAA 2DL7A 2DL5A 2L5QA 1E6HA 3I55Q 9ATCB 5AYFA 1Q86U 3LH0A 4BY6C 2JTMA 3CC4A 3OYJA 1Y96A 2W10A 4LXCA 3UATA 2NUZA 5I2MA 5KYNA 3JCMX 3M0QA 2CS7A 2HSPA 2M16A 5GAN6 5GJVB 4LE9A 1K8AU 3H6ZA 4RG2A 4JZ4A 2E12A 3I56T 2RHIA 1WA7A 4M75F 5KYUB 2F1LA 4M7DA 3MEAA 2LP5A 3T9NA 1YI2T 4LDXA 3OW2A 3V8LA 1YJ9T 1NM7A 3LGFA 3QWXX 2FO0A 2BIVA 4RTUA 4MZMA 3REBB 2RJCA 3LYIA 1NG2A 2BUDA 4FYWB 1BU1A 1PSFA 1AVZC 1RLQC 4AFSC 3NTKA 2RHYA 4YTLA 2JTFA 2CT4A 1VQLQ 1WJQA 1LOJA 2KYMA 4Z88A 1ARKA 1EIFA 3JCMW 2O88A 4FYVB 3FJPA 1JJ2S 1KJWA 4QT7A 3V8KA 3CXCA 1OZ2A 1BIBA 5FWCA 2MWOA 3QBYA 1D0YA 3GF5A 3M58A 3NMZC 2AK5A 4PJMA 3WXMB 1YIJQ 3HL8A 1R0BG 2P84A 4QVZA 3F70A 4Q5WA 3SWNC 3RESA 2KSSA 1YP5A 2K6DA 2P0KA 2IVWA 3FB9A 2RMOA 4HKEA 3NTHA 2LQKA 3MP6A 1KD1C 2HSEB 3BE3A 2L0AA 2JZ2A 2VWFA 4J9IA 4IUTA 3UA6A 5CKBA 2DVJA 5J26A 1OX8A 2WSCE 1V1CA 1JRIA 3CBPA 3HRUA 3OW2S 3CC4Q 4EMKA 5GJWB 2HKQB 1NJIU 3SWNA 2ZGWA 1W2BS 1ZA1B 2AZSA 1U3OA 3QWYA 3BFMA 4E47A 4C8QG 5C6SA 3RMSA 3U23A 4E7ZA 3BDUA 1JU5C 1AZEA 4OB0B 1ABQA 2X51A 3OYHA 1VYUA 2C0TA 1MMDA 3EG1A 1WHMA 1WDXA 4QQ6A 2QEXA 4QVDA 3CXCS 3TEEA 1JJ2P 4BDZA 2CP5A 5EG2A 3VS1A 1KK7A 3RIRA 5KE3A 3EGXB 1Z9QA 2QTXA 5IHIA 5GAMh 3JCMf 2DXBA 2Y90A 4HT8A 2J05A 1G3YA 2D0NA 3O5ZA 2HNIA 1D1BA 1RUWA 4CC7A 3CCUA 3M55A 1AT1B 3C94A 4KH1B 1ZQ1A 2QAZA 3V8JA 1N8RC 4M77E 5LL6S 3HFNA 1WYXA 5GANf 2DF6A 3EFSA 3PE0A 4PJOF 1M1FA 1VQKA 1SPKA 3CCET 4EPCA 1CKAA 4MMLA 1VQ8A 2XDBA 3M0PA 1AWOA 2PVDB 3M0SA 1D1AA 3A8GB 2PU9B 2VXFA 4LNPA 2NUPA 3V7SA 2DTOA 1QCFA 2RO0A 4PLLA 3EGUA 4J9CA 1V76A 4M7AD 3UF4A 3EH2A 3ER0A 3S3OA 1W2BP 2FVUA 4M78E 3PVLA 3NHNA 3CCQT 3BDLA 1MUZA 4E7SA 1PSEA 2X3XD 4MMKA 4JRKA 5GMKe 3L42A 1BI2A 3A8OB 1KQ2A 2DFUA 4NL3A 4BI3A 3CCMT 4J9FA 1BKBA 4J9GA 1Q7YU 4L6V5 2CH4W 3WVDB 2NUTB 5C0MA 4E7LA 2HBWA 3P8DA 2GQIA 2RI2A 3DLLA 3JCMe 2QEXQ 2RM4A 2F2XA 1G3SA 3QYHB 1NEBA 3M53A 3G4SA 1Q82R 2XK0A 2E5QA 2W0ZA 5GAOr 4EMGA 1Q81U 2VUBA 3MJXA 1FMKA 3AT1B 4CC3A 2GF7A 1XOVA 5GMKj 3OYMA 1WHHA 2P0QA 3HPWA 2EJFA 2O01E 1RAEB 1M90C 1MMAA 2F2WA 4PJNA 3CCUQ 4JLIA 2LTOA 3I5SA 1RLPC 3I56A 4C8QA 2X4YA 4AFQC 1WLPB 1UG1A 4M78B 1VQKQ 1YJ9A 2J6OA 4C92D 1YHQT 2RQVA 3CPWS 5GMKm 1WHGA 1VQ8Q 2RH2A 4J7IA 1DJ7B 4BE1A 2EGCA 2V8KA 2HCKA 2YSQA 3I9QA 3HFOA 3PTAA 3EG3A 4XTYA 4C0DB 1GBRA 3GIBA 2MWPA 2P4RA 1OX9A 2Y4XA 5HKCA 4WCIA 3OYEA 2FHDA 2Z0WA 2DEUA 2QQ9A 5HCKA 2L2PA 1HJDA 2DL8A 4HCCA 4F7UG 3GNGA 4A63B 1VOMA 4RTYA 3G71T 1GCPA 2X4XA 1M4ZA 1OU8A 2XI9A 4XK8E 2RJEA 2D8HA 4LUDA 4ME7A 2KROA 3I5RA 1BCOA 1KC8U 1GFCA 5LJ3d 2EQIA 3CCSA 2MCNA 2GQVA 2YDLA 1M1KU 1C6VX 2DNUA 4AG2C 3QKJA 1AHJB 1VIFA 4BUGA 2K2MA 2CP7A 5FU6C 4A4FA 3G4SQ 1BB9A 4M7AG 2FZCB 1K73U 2QASA 4FT4A 3QDFA 3NTIA 3OYAA 4DBQA 2K3BA 2O9SA 1ABOA 5GAN4 4E7HA 1OU9A 1HK9A 3L2VA 2QQRA 2X4WA 3CPWP 3DB3A 1YJWT 1M3CA 5J3BA 4M75B 4ZTJA 3I56Q 4J83A 1ZBJA 4BI8B 2KK4A 4AFZC 2XD0A 1YJ9Q 2AZVA 2IIMA 1N8RR 3EGDA 2DL3A 2KE9A 2G3RA 3TU4K 1JQQA 2EFIA 5FRMA 2YXYA 4F17A 1D3BB 2KI7A 3MPUB 4ORZA 5GAN7 5A0DA 3EG9B 2X35A 5HK0A 2K5FA 3GP8A 2JM8A 1CKBA 4MZTA 2JJ9A 3EH1A 2RF0A 1K0XA 4R55A 4C0GA 2LQWA 1TUCA 2QDYB 1VQ4T 1W6XA 3CCEA 3CCRT 2EQKA 2CT3A 3LGLA 1IB8A 3CC7T 1VQ9T 2FL7A 8AT1B 3OBYA 4RCBA 2X4JA 3UDCA 2HKNA 1MGQA 2PTKA 3EFOB 4N4HA 4CC4B 4C92G 3CCSQ 5LJ5d 2A0FB 1VIEA 4WF2A 5CO7A 2H3EB 1TTHB 3CCJA 3FIFA 3ASKA 3CCQA 2LNHB 2DO3A 1H3ZA 2E5KA 3VS3A 2RK2A 4IURA 3JB9F 3L1AA 4FT2A 2MAMA 5HY6A 1H3HA 4VUBA 4C8QE 1VQNA 3L2WA 5GANh 4JRPA 5GAMd 1ZUKA 3G1JA 1Y7XA 3AHUA 4F7UA 2BKDN 3JCMP 2CGHA 3X28B 2HD0A 1I07A 3WVEB 2EGAA 2OI3A 1XQHA 3QJ6A 4JJCA 3ZEHA 4QQGA 2K9GA 1M90R 1MV3A 1M2VB 3JCMV 5J39A 2CH4A 4M77F 3SD4A 1KFZA 2JM9A 3SFMA 1IHWA 3QZ5B 3RUXA 2GFUA 5GAN8 1Y07A 3OS2A 1I8FA 1G3WA 3V7RA 3DLMA 2CDTA 3CC2T 1G2BA 4E7KA 3MP8A 2FRWA 3E19A 4M7AA 3C12A 1JXMA 2XDDA 2YLCA 3PNWC 1KG1A 3NGPA 1VQ6A 4Y91A 1NEGA 4PJOB 3JCMg 4IKFA 3Q1JA 2D0QB 2EPDA 1U5SA 2RD1A 1K9MU 4ZGEB 1N9SA 3VJPA 3CCEQ 2AHJB 1ZA2B 1KQSA 4M7DF 1UUEA 4JS5A 2QA4T 2G6FX 1WHJA 3H41A 1QKWA 4HVUA 1QP3A 3QDRB 3CD6T 5IH2A 3CCJQ 2O4XB 3CCQQ 1K73C 3KBGA 5CIUA 1K9AA 3NPFA 4D6WA 3EAEA 4PJOD 2DMOA 3VS4A 2FEIA 3S6WA 3EHRA 2HAXA 3G71A 2ZZDA 1VQNQ 3VU3C 1NLOC 3OYFA 1UHCA 1PD1A 1IRXA 2JNGA 2KBTA 5CKEA 2PUOB 1EFNA 4RTTA 2K5IA 3S3NA 2V26A 2VC8A 2C0IA 1G83A 1NPRA 4OB2B 2K7AA 1T3SA 3M9QA 4M78C 4C92A 3A5ZB 2DK3A 1N5ZA 5KE2A 2H8HA 4F14A 2DRKA 2Y4YA 4ZTFA 3MO8A 4X1VA 1KHIA 5LJ3h 1PCXA 1UTIA 1YNZA 5KYXB 4BDYA 2GTJA 1WNLA 2YT6A 2VXEA 4C0DC 4RCCA 1KQSS 2J06A 4BACA 4ZGDB 2RK1A 1YJWA 2E70A 2JT4A 4JJNK 2DEQA 4AFUC 1VQ6Q 2RB6A 3PIPA 2QXFA 2D9TA 4PJLA 1GCQC 4FIBA 2I2LA 1W2BA 4O6JA 2OTJT 1NPPA 3MKDA 1D1CA 2C0OA 3BW1A 1TOVA 2HEQA 3REAB 5KCHA 1YJNA 1GBQA 4LD6A 4C0FA 3JCMb 2GNCA 3C95A 2L3QA 2MI6A 3CPFA 2RPNA 3MEVA 4PFOA 4D8KA 4X34A 5FU7B 2YLBA 4DEXA 4DQ2A 3VRYA 2ZPEB 4JRIA 2EYYA 3HKSA 1RL2A 1MV0B 3VRZA 1BK2A 2KT1A 3EHQA 3QIIA 1VQ4A 3E9GA 3H8ZA 1GL5A 1UJ0A 2XG8D 3CC7A 3CCRA 4FM4B 3G71Q 3OQ5A 2H3JA 2A7YA 2JN0A 2ABLA 3GBQA 1B07A 3ZBDA 1W4SA 1A0NB 2F2VA 1X01A 4M75C 2OTLT 4JPBW 1GFDA 1EZZB 4OMLA 4C0ZA 5ECAA 1NZ9A 2DAQA 5IHKA 2SRCA 2JTEA 1KQSP 2YRCA 3G7ZA 1VQPT 3ME9A 3VV0A 3GPLA 2LJ0A 1LVKA 4BB7A 4CC2A 1G8XA 1FMVA 1PRMC 2LQ8A 2DKGA 5LJ5h 1SF9A 2RHUA 2GCXA 3A8MB 3GNFB 3R6NA 2M1HA 1IXDA 1JEGA 5DLOA 2K2VA 1YJWQ 6AT1B 1YCYA 3MEWA 5CK9A 1SRLA 4Z02A 1BCMA 5FRNA 1VQMT 1OQKA 3S3MA 3HHTB 2LJ3A 4O5VA 3CMEA 1CSKA 1T3LA 1RACB 3FLGA 1YITA 1Y0MA 1X6GA 2LX9A 1YJNQ 1LNXA 1QKXA 1BI1A 1I5OB 3EG9A 4MDXA 2JOYA 4Y92A 3META 1SG5A 2K3XA 1VQ5T 3TSZA 4QQDA 4KT0E 3JRZA 3KUFA 4A54A 3UPUA 2M9UA 3RKYA 1VQ4Q 3G6ET 3CCVA 3CCRQ 1SHGA 3CC7Q 4LDYA 2D8JA 2KXDA 4C8QF 2FZKB 2CREA 4DBHA 3VS7A 2ZPGB 1ZSZB 5GANd 1WXUA 2VGNA 3E9FA 3M59A 4HT9A 2EW3A 2QA4A 4JS4A 1Q86C 3HP9A 2QYZA 3CD6A 2MYSA 2DZCA 4OB3B 1J3TA 1VQOT 3VUBA 2DM1A 2F69A 1H92A 3CPWA 2RHXA 4B9WA 3THKA 2LDMA 2EJ9A 2DBKA 4HVWA 5FLXE 2P4TA 1B34B 4M7DE 2ZPHB 4DOWA 3OSSC 1K8AC 2QG9B 5A0LA 4B6MA 1AOJA 2OAWA 4J6XA 1M8VA 2GGRA 4KRTA 3QJYA 2EYQA 3OY9A 5IT9E 2KRSA 1UB4A 3M57A 2NLUA 4OMPA 1QWFA 1RAGB 3H9NA 5KYYB 4PJOC 1JXOA 2QQBA 1TSFA 4M77B 3VS6A 5GAOn 1PD0A 4DBRA 5D6XA 4XU3A 3CMEQ 3MP1A 3C0CA 3RMQA 2CYZB 1YITQ 2HQEA 3A8LB 1TUDA 4QKUA 3I55T 2OJ2A 4ANJA 2KRMA 3M4YA 5IN1A 2FB7A 4J8OA 1XNIA 2RHZA 2JS2A 1MHNA 3VS2A 2DYIA 2AT1B 2RQWA 1TS9A 3OMGA 2KGTA 1YI2A 4PJOA 3A1PA 3P8HA 4GY5A 2COYA 2MPXC 3E1SA 2EVRA 4XU0A 3CCVQ 1EX4A 2DXCA 4M7DB 3QO3A 3PIOA 4A4KA 2HBPA 3MHXA 4CI0C 2QTVA 1G5VA 2QA4Q 4OMFB 2DZ9A 4AT1B 3CD6Q 1E6GA 1TWBA 3FEOA 2O4XA 1VQLT 1NJIC 5L23A 4Z8AA 4M78D 3SDZA 1KD1R 2K4YA 1OPLA 4KH0B 2RA2A 1M2OA 4C5GA 1FYNA 2XHCA 1X2QA 3TCJA 2EYXA 4BE2A 4D8DA 2ATCB 1VUBA 3X25B 3QYGB 2OTLA 4HXJA 4C5IA 1VA7A 2CZ0B 2R5AA 2ZPIB 1WXTA 4E7IA 3UA7A 2LT4A 3LLRA 2DILA 1H8KA 5FWBA 2K57A 5HK3A 2I0NA 2LCLA 1QCNA 3PGGA 4LN2A 2C06A 2FPFA 2FPEA 2RQRA 1D0XA 2CUDA 5GMKi 1TUGB 2M02A 4Z89A 4IUVA 2BZ8A 2NWMA 3CC4T 4EMKB 3INZA 3QSUA 5CKHA 2K3YA 5KYUA 2EQMA 1YI2Q 1W70A 2KRNA 2RQUA 3TVTA 5FROA 4F7UF 4E2FB 1VQMA 1M30A
chains in the Genus database with same CATH topology
3CMEQ 3CD6Q 2OTLQ 2OTJQ 1W2BP 1Q81R 1VQ6Q 3G6EQ 3CPWP 1Q7YR 1NJIR 1KC8R 1M1KR 3CCLQ 1Q86R 1YITQ 1VQNQ 1VQ8Q 1M90R 3CCMQ 3CCVQ 3I56Q 3CC2Q 1KD1R 3CCUQ 1QVGP 2QEXQ 1VQPQ 1VQ4Q 3G4SQ 1S72Q 1YHQQ 1YJNQ 3CCRQ 1VQMQ 1YIJQ 3CCJQ 3CC7Q 1QVFP 1VQLQ 1YI2Q 3CCSQ 3CXCP 1YJ9Q 1VQ5Q 1YJWQ 3CCQQ 1VQ9Q 1Q82R 1K73R 3OW2P 1K8AR 1VQ7Q 3CCEQ 1K9MR 3CMAQ 1KQSP 1VQKQ 2QA4Q 1N8RR 1JJ2P 3I55Q 3G71Q 1VQOQ 3CC4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Q;  3CD6 Q;  2OTL Q;  2OTJ Q;  1W2B P;  1Q81 R;  1VQ6 Q;  3G6E Q;  3CPW P;  1Q7Y R;  1NJI R;  1KC8 R;  1M1K R;  3CCL Q;  1Q86 R;  1YIT Q;  1VQN Q;  1VQ8 Q;  1M90 R;  3CCM Q;  3CCV Q;  3I56 Q;  3CC2 Q;  1KD1 R;  3CCU Q;  1QVG P;  2QEX Q;  1VQP Q;  1VQ4 Q;  3G4S Q;  1S72 Q;  1YHQ Q;  1YJN Q;  3CCR Q;  1VQM Q;  1YIJ Q;  3CCJ Q;  3CC7 Q;  1QVF P;  1VQL Q;  1YI2 Q;  3CCS Q;  3CXC P;  1YJ9 Q;  1VQ5 Q;  1YJW Q;  3CCQ Q;  1VQ9 Q;  1Q82 R;  1K73 R;  3OW2 P;  1K8A R;  1VQ7 Q;  3CCE Q;  1K9M R;  3CMA Q;  1KQS P;  1VQK Q;  2QA4 Q;  1N8R R;  1JJ2 P;  3I55 Q;  3G71 Q;  1VQO Q;  3CC4 Q; 
#chains in the Genus database with same CATH topology
 1MND A;  2E6Z A;  4FW2 A;  3VS5 A;  4XU1 A;  1WJR A;  4JZ3 A;  3FDR A;  2CUB A;  2KAF A;  3MEU A;  2L3P A;  2CZ1 B;  1N6A A;  2KQW A;  1I4K 1;  3BY7 A;  1T0J A;  4M75 D;  4IUQ A;  3RDV A;  4NOY A;  3JCM Q;  1Y57 A;  3C4S A;  4M7A F;  1Q7Y C;  4LD9 K;  1Q86 R;  1HSQ A;  5LJ3 e;  2HL3 A;  2X9H A;  1RAD B;  2EKO A;  4JJB A;  4EMH A;  3CMA T;  3LX7 A;  2L89 A;  1Q82 U;  3X24 B;  4QW2 A;  3JCM h;  1JB0 E;  1ZUU A;  5I2S A;  2BE9 B;  4FCY A;  4J6Y A;  1K8A R;  3A8H B;  2OTL Q;  1M27 C;  2O31 A;  1Q81 C;  1X43 A;  3LW5 E;  4WTO B;  2VV5 A;  1N9R A;  1OZ3 A;  4M4Z A;  1ZBX A;  2E1H A;  4AG1 C;  3JB9 I;  4HCZ A;  1F1B B;  3CCM A;  4A4H A;  4C5E A;  3L2Z A;  2DD5 A;  5LJ3 j;  4KUD K;  5CKF A;  2LNV A;  1RAH B;  4M78 G;  2QK0 A;  3OMC A;  2VVK A;  3OS1 A;  1FMW A;  5CQX A;  1IO6 A;  4XTV A;  3SHW A;  1UGQ B;  2ZPB B;  1PKS A;  1LJO A;  4PKC C;  2MK5 A;  3L2R A;  1OYX A;  3EGX A;  1VQM Q;  5D6Y A;  4CRI A;  2JW4 A;  1AEY A;  2O9V A;  2ZPF B;  4OF1 A;  4MDW A;  8ATC B;  4PNO A;  2HQH A;  3RR6 A;  2QEX T;  3OB9 A;  2M0O A;  5CR2 A;  1ZSZ C;  2DET A;  4ZN3 A;  1NYF A;  3KFV A;  4C92 F;  5CCA A;  3M56 A;  4FSX A;  4PK4 A;  1IGU A;  7AT1 B;  3OYI A;  1E7O A;  2E3H A;  2EWN A;  1R8O B;  2D1X A;  4RUG A;  2FZG B;  2IPO B;  2YRV A;  3QXE B;  5IHN A;  2XKO C;  2QGG A;  4UC4 A;  3TQ7 P;  1YHQ A;  3CQT A;  2HMA A;  2ESW A;  1KC8 C;  2MMP A;  1PM3 A;  1YWO A;  2LJ1 A;  1K0S A;  5LJ5 e;  4FYX B;  4XAX B;  4C8Q B;  1NJI R;  2V1Q A;  1M1K C;  2E65 A;  4MZP A;  3QHS A;  2E41 A;  2QI2 A;  5GAN 5;  2MIO A;  1D09 B;  2M51 A;  2A28 A;  3J7A F;  2R5M A;  1UE9 A;  1WX6 A;  4A4G A;  3RNJ A;  1BI3 A;  2GTO A;  2VB6 A;  2CSI A;  1VQ8 T;  1PG5 B;  4HCB A;  2WSE E;  5M9O A;  4FU6 A;  5GAM e;  1WQ7 A;  1I81 A;  1NBE B;  3CEY A;  4M77 C;  2DJZ A;  2LCC A;  2ROL A;  1SHF A;  2RI5 A;  4ATO A;  3OYK A;  2PVG B;  3CCM Q;  1WIE A;  3LWH A;  4J9H A;  2PUK B;  1UEC A;  4M75 G;  4A53 A;  4LDW A;  4JLG A;  4GLM A;  4A4E A;  4F16 A;  3PVQ A;  4KBM B;  5LJ5 j;  2NUT A;  2DD4 A;  3PFS A;  3OYC A;  2JMA A;  1N8R U;  1VYT A;  4Y28 E;  2DTH A;  2CZ7 B;  2AKL A;  1U06 A;  4R56 A;  2XID A;  4J9E A;  4AMC A;  2X3W D;  1YN8 A;  4J6W A;  2JS0 A;  1VQ7 T;  1RAF B;  2KEA A;  5GAM j;  2AIR B;  3JCM c;  1R77 A;  4J5Y A;  4ESR A;  3D7S B;  4M7D C;  4PJJ A;  1M8M A;  2M0Y A;  4L5G A;  5GAO p;  4N4I A;  3G4S T;  1X69 A;  3EG0 A;  1Z9Z A;  2PZ1 A;  1M1G A;  2O2O A;  2J7I A;  1X27 A;  1WPY A;  2EKH A;  1XJW B;  4M78 A;  2WSF E;  5KYW B;  3URG A;  2CSQ A;  3GLX A;  1YFN A;  1I0C A;  2E64 A;  2A08 A;  1YHQ Q;  4FW1 A;  4XTU A;  1PNJ A;  1Q82 C;  3M0T A;  3EFR A;  1ACM B;  2XIC A;  4KUI A;  3IQL A;  4NL2 A;  1UGS B;  1Q7Y R;  2YHT A;  3GOX A;  1JBM A;  2VYT A;  5FU6 B;  2DXT A;  2NYS A;  3ULR B;  1QCO A;  5I22 A;  2QQS A;  1PC0 A;  2MOX A;  3EGD B;  1AWX A;  4F7U E;  4BE0 A;  4X9C A;  1GCQ A;  1BI0 A;  4IUP A;  1VQ9 A;  4XTZ A;  2JUF A;  1Q81 R;  4ZN1 A;  1SKU B;  3CMA A;  1M90 U;  2LRQ A;  2EQJ A;  3SB2 A;  1HD3 A;  2A3L A;  2ZAE A;  2LZ6 B;  4RKU E;  1IHV A;  2K5L A;  5AT1 B;  3ZFJ A;  2CZ6 B;  1QVF P;  4EMK C;  4JUV A;  2EGE A;  1ZHI A;  2E10 A;  4M7A E;  2DLP A;  4HCK A;  1ZLM A;  1OUL A;  2R57 A;  2YUN A;  3VS0 A;  2VGM A;  2EBP A;  4TVR A;  3QG1 A;  1VYV A;  4L59 A;  5A0G A;  1S72 T;  4OGE A;  4OMN A;  1P92 A;  3CCS T;  4BI4 A;  5LJ3 g;  1NLP C;  4GLK A;  2GBQ A;  1N27 A;  4PL6 A;  4PJO G;  1X75 C;  1JO8 A;  4M75 A;  3X20 B;  1K9M C;  2KMT A;  4NS5 A;  2LC4 A;  2DIG A;  4OP0 A;  1UFF A;  1PHT A;  2HL5 C;  1PWT A;  3JV3 A;  4F7U B;  1LPL A;  1SEM A;  1QP2 A;  1AZG B;  1U8R A;  1WQW A;  4ELY C;  1WHL A;  2L8D A;  3JSC A;  3CC2 A;  4N0A C;  5CQY A;  1KIK A;  1D3B A;  1GRI A;  2L3R A;  1OEB A;  1PKT A;  2ZCF B;  3OYN A;  2V8J A;  1KC8 R;  2GFA A;  1NE8 A;  5DY9 A;  1RI0 A;  1K1Z A;  2KNB B;  3JCM d;  1UEB A;  1M1K R;  5GAO m;  5CVI A;  1YBY A;  2B8A A;  4OVA A;  1PRL C;  3TRE A;  3PT9 A;  2F5T X;  3N5B B;  1QWE A;  3NFC A;  1OI1 A;  4M7A B;  1D0Z A;  3CCL T;  1VQ9 Q;  2WAC A;  1K73 R;  4C92 E;  2KY9 A;  3I35 A;  3CMA Q;  5CKD A;  4RG8 A;  2YUO A;  4N0A A;  4XU2 A;  3FJ5 A;  1YWP A;  3EFO A;  3VYG A;  2DPP B;  2KR3 A;  2YUQ A;  2XU8 A;  4OGC A;  1WXB A;  3HRS A;  4RTV A;  1LCK A;  4KGZ B;  3OW2 P;  3CBO A;  3OSV A;  5CAI A;  1QW1 A;  1MNE A;  2B86 A;  1GXI E;  2ED1 A;  5LJ5 g;  3CCJ T;  1BYM A;  3JCM J;  5GAO q;  1QLY A;  2V8I A;  2JVV A;  4XTW A;  4RTX A;  5GAN 2;  1Y71 A;  3OYG A;  3CXC P;  1VQN T;  3RKX A;  1M2V A;  1KQ1 A;  3HTR A;  3OBW A;  1S1N A;  5GAM g;  3JB9 D;  2YUP A;  3DKM A;  2RNA A;  1VQ7 A;  5EC7 A;  5GAN 3;  4II1 A;  3OYD A;  4C8Q C;  1WI7 A;  1K4U S;  3CC2 Q;  2VKN A;  4C92 B;  1NYG A;  1M5Q 1;  2PNI A;  2CP0 A;  3DB4 A;  4JDS A;  2FG0 A;  1UGP B;  3R6O A;  1WZO A;  1ZX6 A;  1Y96 B;  4FYY B;  2DL4 A;  4RMO A;  2COW A;  3HSB A;  1RAI B;  2CP6 A;  3OS0 A;  1B3Q A;  1KSW A;  4M77 D;  2A36 A;  5GAN e;  2OTJ A;  5IXF A;  2V1R A;  3P8B B;  2HZY A;  3PMT A;  3J80 E;  3JB9 H;  1WFW A;  3PMI A;  3VKI A;  4EIK A;  3OS5 A;  1VQ6 T;  1M3B A;  2E3I A;  3L2U A;  1C1A A;  2J6K A;  1UJY A;  2RJD A;  4BY6 B;  3H0F A;  4IIM A;  4ELZ C;  4KGX B;  1WJS A;  2PVO B;  1SSH A;  2FPD A;  5I21 A;  4F04 B;  2QQA A;  1R0C B;  2LQN A;  4M75 E;  2KT8 A;  2EYW A;  3UT1 A;  2HDA A;  2DXU A;  5GAN j;  2ECZ A;  2KYB A;  1WGS A;  4QVC A;  5LJ3 f;  2DIQ A;  2RN8 A;  4M7D D;  1ZSG A;  1YIJ T;  4C5H A;  2EAY A;  1QVG A;  3SEM A;  1FXX A;  2D6F A;  2VAS A;  5GAO l;  5DM7 R;  3O8V A;  4PLI A;  2E4H A;  3JAM E;  1IGQ A;  2COZ A;  3M54 A;  1VQP A;  3VYH B;  4N4G A;  1S72 A;  2RI3 A;  1G3T A;  1VQ7 Q;  1K9M R;  1MMG A;  2F5K A;  5IAY A;  3CBM A;  4JRQ A;  2DX1 A;  4OB1 B;  2JXB A;  3L2Q A;  3E2U A;  5KYX A;  1UGR B;  3M4G A;  4J9D A;  1RI9 A;  3MCA B;  1OV3 A;  3LWI A;  4FSS A;  1I1J A;  5FU7 C;  1RAA B;  1M9S A;  2SEM A;  3SWN B;  4OMM A;  4B9X A;  3M0R A;  4GBQ A;  2FRY A;  2R58 A;  5KCO A;  5KYW A;  2DJQ A;  1X6O A;  2OTJ Q;  4XTX A;  1Q95 G;  2KVQ G;  2XMF A;  2L3S A;  2EQU A;  2CP3 A;  4LDU A;  1K76 A;  2E6N A;  5I11 A;  1QQJ A;  1QMC A;  1AWJ A;  3JB9 G;  1QVP A;  1O75 A;  2QGF B;  5GMK h;  1B7T A;  2FYK A;  1VQ5 A;  4LUE A;  1QVG S;  2DYB A;  1KHC A;  1IZ6 A;  4OMO A;  5DLQ E;  1YJN T;  4ZGJ B;  4J7F A;  3QUI A;  4DA4 A;  2BTT A;  1WHK A;  5KH6 A;  2XDP A;  3G6E A;  3CCL A;  1H64 1;  4OMQ A;  4X9D A;  2JMC A;  3FRN A;  4ZNX A;  3RKW A;  1T0H A;  5FW9 A;  3OYY A;  4PFZ A;  3TSW A;  5LJ5 f;  4V2S A;  4M77 G;  4E7J A;  2ED0 A;  4KUL A;  1YCS B;  2EJG A;  3RER A;  1FX7 A;  2BZX A;  3VUZ A;  2DTI A;  2EIF A;  1VQO A;  3KXT A;  2CP2 A;  2NUP B;  1TU0 B;  1VQP Q;  1S72 Q;  1TH7 A;  2DVE A;  3J81 E;  1M3A A;  5GAM f;  3OYL A;  4PJO E;  2LX7 A;  1UDL A;  3EG2 A;  1W1F A;  2A37 A;  3JB9 J;  1UGV A;  3X26 B;  4K11 A;  3H0I A;  3QPH A;  4E6R A;  1U1S A;  5GMK l;  4M7D G;  3M5A A;  2DE0 X;  4DOV A;  4M7A C;  1I5L A;  1C0M A;  4FL6 A;  2DBM A;  1QVG P;  2P0P A;  2LT1 A;  1HYO A;  3I55 A;  1KD1 U;  1BBZ A;  2RJF A;  2DER A;  4P5N A;  5L8R E;  4LDV A;  2BZY A;  3CME T;  2HQX A;  2OAU A;  2QDL A;  1VQ5 Q;  1YIT T;  2J6F A;  4XQ3 A;  2LVM A;  4HA8 A;  1TXQ A;  3LH5 A;  1OOT A;  4EDU A;  4KGV B;  2YRD A;  3CCU T;  2EYZ A;  2BE7 D;  2K79 A;  1QVF A;  4RTZ A;  1RAB B;  4DBF A;  3RBB B;  3G6E Q;  1UHF A;  2YWW A;  2KDS A;  2DRM A;  5IXB A;  1TG0 A;  3CCL Q;  1X2K A;  4R0K A;  3ZL7 C;  1VQK T;  1ZSZ A;  1AD5 A;  1X6B A;  4M78 F;  5D7U A;  1IRE B;  3UWN A;  2OX7 A;  2IG0 A;  4J9B A;  4IIO A;  1ZUY A;  2ENM A;  3CCV T;  2ROT A;  2MF2 A;  1U1T A;  1V29 B;  1VQO Q;  1VQL A;  1XTD A;  3H0H A;  1SRM A;  1FWZ A;  4HVV A;  1SSF A;  1MMN A;  1B34 A;  5GAN g;  2AKK A;  1HXD A;  4C8Q D;  4DEY A;  3OYB A;  3HRT A;  4C92 C;  4RTW A;  5D6W A;  1YIJ A;  4BD3 A;  1OPK A;  3M0U A;  2RQT A;  3FC3 A;  2CKK A;  5KYY A;  2LCS A;  2PQW A;  1JJ2 A;  4IUU A;  1O9S A;  2KXC A;  4M77 A;  3QZ9 B;  3A98 A;  5A2Q E;  3V7C A;  4PFP A;  2LMJ A;  2DA9 A;  4JJD A;  1QVF S;  1AWW A;  3OA6 A;  1BIA A;  2DL7 A;  2DL5 A;  2L5Q A;  1E6H A;  3I55 Q;  9ATC B;  5AYF A;  1Q86 U;  3LH0 A;  4BY6 C;  2JTM A;  3CC4 A;  3OYJ A;  1Y96 A;  2W10 A;  4LXC A;  3UAT A;  2NUZ A;  5I2M A;  5KYN A;  3JCM X;  3M0Q A;  2CS7 A;  2HSP A;  2M16 A;  5GAN 6;  5GJV B;  4LE9 A;  1K8A U;  3H6Z A;  4RG2 A;  4JZ4 A;  2E12 A;  3I56 T;  2RHI A;  1WA7 A;  4M75 F;  5KYU B;  2F1L A;  4M7D A;  3MEA A;  2LP5 A;  3T9N A;  1YI2 T;  4LDX A;  3OW2 A;  3V8L A;  1YJ9 T;  1NM7 A;  3LGF A;  3QWX X;  2FO0 A;  2BIV A;  4RTU A;  4MZM A;  3REB B;  2RJC A;  3LYI A;  1NG2 A;  2BUD A;  4FYW B;  1BU1 A;  1PSF A;  1AVZ C;  1RLQ C;  4AFS C;  3NTK A;  2RHY A;  4YTL A;  2JTF A;  2CT4 A;  1VQL Q;  1WJQ A;  1LOJ A;  2KYM A;  4Z88 A;  1ARK A;  1EIF A;  3JCM W;  2O88 A;  4FYV B;  3FJP A;  1JJ2 S;  1KJW A;  4QT7 A;  3V8K A;  3CXC A;  1OZ2 A;  1BIB A;  5FWC A;  2MWO A;  3QBY A;  1D0Y A;  3GF5 A;  3M58 A;  3NMZ C;  2AK5 A;  4PJM A;  3WXM B;  1YIJ Q;  3HL8 A;  1R0B G;  2P84 A;  4QVZ A;  3F70 A;  4Q5W A;  3SWN C;  3RES A;  2KSS A;  1YP5 A;  2K6D A;  2P0K A;  2IVW A;  3FB9 A;  2RMO A;  4HKE A;  3NTH A;  2LQK A;  3MP6 A;  1KD1 C;  2HSE B;  3BE3 A;  2L0A A;  2JZ2 A;  2VWF A;  4J9I A;  4IUT A;  3UA6 A;  5CKB A;  2DVJ A;  5J26 A;  1OX8 A;  2WSC E;  1V1C A;  1JRI A;  3CBP A;  3HRU A;  3OW2 S;  3CC4 Q;  4EMK A;  5GJW B;  2HKQ B;  1NJI U;  3SWN A;  2ZGW A;  1W2B S;  1ZA1 B;  2AZS A;  1U3O A;  3QWY A;  3BFM A;  4E47 A;  4C8Q G;  5C6S A;  3RMS A;  3U23 A;  4E7Z A;  3BDU A;  1JU5 C;  1AZE A;  4OB0 B;  1ABQ A;  2X51 A;  3OYH A;  1VYU A;  2C0T A;  1MMD A;  3EG1 A;  1WHM A;  1WDX A;  4QQ6 A;  2QEX A;  4QVD A;  3CXC S;  3TEE A;  1JJ2 P;  4BDZ A;  2CP5 A;  5EG2 A;  3VS1 A;  1KK7 A;  3RIR A;  5KE3 A;  3EGX B;  1Z9Q A;  2QTX A;  5IHI A;  5GAM h;  3JCM f;  2DXB A;  2Y90 A;  4HT8 A;  2J05 A;  1G3Y A;  2D0N A;  3O5Z A;  2HNI A;  1D1B A;  1RUW A;  4CC7 A;  3CCU A;  3M55 A;  1AT1 B;  3C94 A;  4KH1 B;  1ZQ1 A;  2QAZ A;  3V8J A;  1N8R C;  4M77 E;  5LL6 S;  3HFN A;  1WYX A;  5GAN f;  2DF6 A;  3EFS A;  3PE0 A;  4PJO F;  1M1F A;  1VQK A;  1SPK A;  3CCE T;  4EPC A;  1CKA A;  4MML A;  1VQ8 A;  2XDB A;  3M0P A;  1AWO A;  2PVD B;  3M0S A;  1D1A A;  3A8G B;  2PU9 B;  2VXF A;  4LNP A;  2NUP A;  3V7S A;  2DTO A;  1QCF A;  2RO0 A;  4PLL A;  3EGU A;  4J9C A;  1V76 A;  4M7A D;  3UF4 A;  3EH2 A;  3ER0 A;  3S3O A;  1W2B P;  2FVU A;  4M78 E;  3PVL A;  3NHN A;  3CCQ T;  3BDL A;  1MUZ A;  4E7S A;  1PSE A;  2X3X D;  4MMK A;  4JRK A;  5GMK e;  3L42 A;  1BI2 A;  3A8O B;  1KQ2 A;  2DFU A;  4NL3 A;  4BI3 A;  3CCM T;  4J9F A;  1BKB A;  4J9G A;  1Q7Y U;  4L6V 5;  2CH4 W;  3WVD B;  2NUT B;  5C0M A;  4E7L A;  2HBW A;  3P8D A;  2GQI A;  2RI2 A;  3DLL A;  3JCM e;  2QEX Q;  2RM4 A;  2F2X A;  1G3S A;  3QYH B;  1NEB A;  3M53 A;  3G4S A;  1Q82 R;  2XK0 A;  2E5Q A;  2W0Z A;  5GAO r;  4EMG A;  1Q81 U;  2VUB A;  3MJX A;  1FMK A;  3AT1 B;  4CC3 A;  2GF7 A;  1XOV A;  5GMK j;  3OYM A;  1WHH A;  2P0Q A;  3HPW A;  2EJF A;  2O01 E;  1RAE B;  1M90 C;  1MMA A;  2F2W A;  4PJN A;  3CCU Q;  4JLI A;  2LTO A;  3I5S A;  1RLP C;  3I56 A;  4C8Q A;  2X4Y A;  4AFQ C;  1WLP B;  1UG1 A;  4M78 B;  1VQK Q;  1YJ9 A;  2J6O A;  4C92 D;  1YHQ T;  2RQV A;  3CPW S;  5GMK m;  1WHG A;  1VQ8 Q;  2RH2 A;  4J7I A;  1DJ7 B;  4BE1 A;  2EGC A;  2V8K A;  2HCK A;  2YSQ A;  3I9Q A;  3HFO A;  3PTA A;  3EG3 A;  4XTY A;  4C0D B;  1GBR A;  3GIB A;  2MWP A;  2P4R A;  1OX9 A;  2Y4X A;  5HKC A;  4WCI A;  3OYE A;  2FHD A;  2Z0W A;  2DEU A;  2QQ9 A;  5HCK A;  2L2P A;  1HJD A;  2DL8 A;  4HCC A;  4F7U G;  3GNG A;  4A63 B;  1VOM A;  4RTY A;  3G71 T;  1GCP A;  2X4X A;  1M4Z A;  1OU8 A;  2XI9 A;  4XK8 E;  2RJE A;  2D8H A;  4LUD A;  4ME7 A;  2KRO A;  3I5R A;  1BCO A;  1KC8 U;  1GFC A;  5LJ3 d;  2EQI A;  3CCS A;  2MCN A;  2GQV A;  2YDL A;  1M1K U;  1C6V X;  2DNU A;  4AG2 C;  3QKJ A;  1AHJ B;  1VIF A;  4BUG A;  2K2M A;  2CP7 A;  5FU6 C;  4A4F A;  3G4S Q;  1BB9 A;  4M7A G;  2FZC B;  1K73 U;  2QAS A;  4FT4 A;  3QDF A;  3NTI A;  3OYA A;  4DBQ A;  2K3B A;  2O9S A;  1ABO A;  5GAN 4;  4E7H A;  1OU9 A;  1HK9 A;  3L2V A;  2QQR A;  2X4W A;  3CPW P;  3DB3 A;  1YJW T;  1M3C A;  5J3B A;  4M75 B;  4ZTJ A;  3I56 Q;  4J83 A;  1ZBJ A;  4BI8 B;  2KK4 A;  4AFZ C;  2XD0 A;  1YJ9 Q;  2AZV A;  2IIM A;  1N8R R;  3EGD A;  2DL3 A;  2KE9 A;  2G3R A;  3TU4 K;  1JQQ A;  2EFI A;  5FRM A;  2YXY A;  4F17 A;  1D3B B;  2KI7 A;  3MPU B;  4ORZ A;  5GAN 7;  5A0D A;  3EG9 B;  2X35 A;  5HK0 A;  2K5F A;  3GP8 A;  2JM8 A;  1CKB A;  4MZT A;  2JJ9 A;  3EH1 A;  2RF0 A;  1K0X A;  4R55 A;  4C0G A;  2LQW A;  1TUC A;  2QDY B;  1VQ4 T;  1W6X A;  3CCE A;  3CCR T;  2EQK A;  2CT3 A;  3LGL A;  1IB8 A;  3CC7 T;  1VQ9 T;  2FL7 A;  8AT1 B;  3OBY A;  4RCB A;  2X4J A;  3UDC A;  2HKN A;  1MGQ A;  2PTK A;  3EFO B;  4N4H A;  4CC4 B;  4C92 G;  3CCS Q;  5LJ5 d;  2A0F B;  1VIE A;  4WF2 A;  5CO7 A;  2H3E B;  1TTH B;  3CCJ A;  3FIF A;  3ASK A;  3CCQ A;  2LNH B;  2DO3 A;  1H3Z A;  2E5K A;  3VS3 A;  2RK2 A;  4IUR A;  3JB9 F;  3L1A A;  4FT2 A;  2MAM A;  5HY6 A;  1H3H A;  4VUB A;  4C8Q E;  1VQN A;  3L2W A;  5GAN h;  4JRP A;  5GAM d;  1ZUK A;  3G1J A;  1Y7X A;  3AHU A;  4F7U A;  2BKD N;  3JCM P;  2CGH A;  3X28 B;  2HD0 A;  1I07 A;  3WVE B;  2EGA A;  2OI3 A;  1XQH A;  3QJ6 A;  4JJC A;  3ZEH A;  4QQG A;  2K9G A;  1M90 R;  1MV3 A;  1M2V B;  3JCM V;  5J39 A;  2CH4 A;  4M77 F;  3SD4 A;  1KFZ A;  2JM9 A;  3SFM A;  1IHW A;  3QZ5 B;  3RUX A;  2GFU A;  5GAN 8;  1Y07 A;  3OS2 A;  1I8F A;  1G3W A;  3V7R A;  3DLM A;  2CDT A;  3CC2 T;  1G2B A;  4E7K A;  3MP8 A;  2FRW A;  3E19 A;  4M7A A;  3C12 A;  1JXM A;  2XDD A;  2YLC A;  3PNW C;  1KG1 A;  3NGP A;  1VQ6 A;  4Y91 A;  1NEG A;  4PJO B;  3JCM g;  4IKF A;  3Q1J A;  2D0Q B;  2EPD A;  1U5S A;  2RD1 A;  1K9M U;  4ZGE B;  1N9S A;  3VJP A;  3CCE Q;  2AHJ B;  1ZA2 B;  1KQS A;  4M7D F;  1UUE A;  4JS5 A;  2QA4 T;  2G6F X;  1WHJ A;  3H41 A;  1QKW A;  4HVU A;  1QP3 A;  3QDR B;  3CD6 T;  5IH2 A;  3CCJ Q;  2O4X B;  3CCQ Q;  1K73 C;  3KBG A;  5CIU A;  1K9A A;  3NPF A;  4D6W A;  3EAE A;  4PJO D;  2DMO A;  3VS4 A;  2FEI A;  3S6W A;  3EHR A;  2HAX A;  3G71 A;  2ZZD A;  1VQN Q;  3VU3 C;  1NLO C;  3OYF A;  1UHC A;  1PD1 A;  1IRX A;  2JNG A;  2KBT A;  5CKE A;  2PUO B;  1EFN A;  4RTT A;  2K5I A;  3S3N A;  2V26 A;  2VC8 A;  2C0I A;  1G83 A;  1NPR A;  4OB2 B;  2K7A A;  1T3S A;  3M9Q A;  4M78 C;  4C92 A;  3A5Z B;  2DK3 A;  1N5Z A;  5KE2 A;  2H8H A;  4F14 A;  2DRK A;  2Y4Y A;  4ZTF A;  3MO8 A;  4X1V A;  1KHI A;  5LJ3 h;  1PCX A;  1UTI A;  1YNZ A;  5KYX B;  4BDY A;  2GTJ A;  1WNL A;  2YT6 A;  2VXE A;  4C0D C;  4RCC A;  1KQS S;  2J06 A;  4BAC A;  4ZGD B;  2RK1 A;  1YJW A;  2E70 A;  2JT4 A;  4JJN K;  2DEQ A;  4AFU C;  1VQ6 Q;  2RB6 A;  3PIP A;  2QXF A;  2D9T A;  4PJL A;  1GCQ C;  4FIB A;  2I2L A;  1W2B A;  4O6J A;  2OTJ T;  1NPP A;  3MKD A;  1D1C A;  2C0O A;  3BW1 A;  1TOV A;  2HEQ A;  3REA B;  5KCH A;  1YJN A;  1GBQ A;  4LD6 A;  4C0F A;  3JCM b;  2GNC A;  3C95 A;  2L3Q A;  2MI6 A;  3CPF A;  2RPN A;  3MEV A;  4PFO A;  4D8K A;  4X34 A;  5FU7 B;  2YLB A;  4DEX A;  4DQ2 A;  3VRY A;  2ZPE B;  4JRI A;  2EYY A;  3HKS A;  1RL2 A;  1MV0 B;  3VRZ A;  1BK2 A;  2KT1 A;  3EHQ A;  3QII A;  1VQ4 A;  3E9G A;  3H8Z A;  1GL5 A;  1UJ0 A;  2XG8 D;  3CC7 A;  3CCR A;  4FM4 B;  3G71 Q;  3OQ5 A;  2H3J A;  2A7Y A;  2JN0 A;  2ABL A;  3GBQ A;  1B07 A;  3ZBD A;  1W4S A;  1A0N B;  2F2V A;  1X01 A;  4M75 C;  2OTL T;  4JPB W;  1GFD A;  1EZZ B;  4OML A;  4C0Z A;  5ECA A;  1NZ9 A;  2DAQ A;  5IHK A;  2SRC A;  2JTE A;  1KQS P;  2YRC A;  3G7Z A;  1VQP T;  3ME9 A;  3VV0 A;  3GPL A;  2LJ0 A;  1LVK A;  4BB7 A;  4CC2 A;  1G8X A;  1FMV A;  1PRM C;  2LQ8 A;  2DKG A;  5LJ5 h;  1SF9 A;  2RHU A;  2GCX A;  3A8M B;  3GNF B;  3R6N A;  2M1H A;  1IXD A;  1JEG A;  5DLO A;  2K2V A;  1YJW Q;  6AT1 B;  1YCY A;  3MEW A;  5CK9 A;  1SRL A;  4Z02 A;  1BCM A;  5FRN A;  1VQM T;  1OQK A;  3S3M A;  3HHT B;  2LJ3 A;  4O5V A;  3CME A;  1CSK A;  1T3L A;  1RAC B;  3FLG A;  1YIT A;  1Y0M A;  1X6G A;  2LX9 A;  1YJN Q;  1LNX A;  1QKX A;  1BI1 A;  1I5O B;  3EG9 A;  4MDX A;  2JOY A;  4Y92 A;  3MET A;  1SG5 A;  2K3X A;  1VQ5 T;  3TSZ A;  4QQD A;  4KT0 E;  3JRZ A;  3KUF A;  4A54 A;  3UPU A;  2M9U A;  3RKY A;  1VQ4 Q;  3G6E T;  3CCV A;  3CCR Q;  1SHG A;  3CC7 Q;  4LDY A;  2D8J A;  2KXD A;  4C8Q F;  2FZK B;  2CRE A;  4DBH A;  3VS7 A;  2ZPG B;  1ZSZ B;  5GAN d;  1WXU A;  2VGN A;  3E9F A;  3M59 A;  4HT9 A;  2EW3 A;  2QA4 A;  4JS4 A;  1Q86 C;  3HP9 A;  2QYZ A;  3CD6 A;  2MYS A;  2DZC A;  4OB3 B;  1J3T A;  1VQO T;  3VUB A;  2DM1 A;  2F69 A;  1H92 A;  3CPW A;  2RHX A;  4B9W A;  3THK A;  2LDM A;  2EJ9 A;  2DBK A;  4HVW A;  5FLX E;  2P4T A;  1B34 B;  4M7D E;  2ZPH B;  4DOW A;  3OSS C;  1K8A C;  2QG9 B;  5A0L A;  4B6M A;  1AOJ A;  2OAW A;  4J6X A;  1M8V A;  2GGR A;  4KRT A;  3QJY A;  2EYQ A;  3OY9 A;  5IT9 E;  2KRS A;  1UB4 A;  3M57 A;  2NLU A;  4OMP A;  1QWF A;  1RAG B;  3H9N A;  5KYY B;  4PJO C;  1JXO A;  2QQB A;  1TSF A;  4M77 B;  3VS6 A;  5GAO n;  1PD0 A;  4DBR A;  5D6X A;  4XU3 A;  3CME Q;  3MP1 A;  3C0C A;  3RMQ A;  2CYZ B;  1YIT Q;  2HQE A;  3A8L B;  1TUD A;  4QKU A;  3I55 T;  2OJ2 A;  4ANJ A;  2KRM A;  3M4Y A;  5IN1 A;  2FB7 A;  4J8O A;  1XNI A;  2RHZ A;  2JS2 A;  1MHN A;  3VS2 A;  2DYI A;  2AT1 B;  2RQW A;  1TS9 A;  3OMG A;  2KGT A;  1YI2 A;  4PJO A;  3A1P A;  3P8H A;  4GY5 A;  2COY A;  2MPX C;  3E1S A;  2EVR A;  4XU0 A;  3CCV Q;  1EX4 A;  2DXC A;  4M7D B;  3QO3 A;  3PIO A;  4A4K A;  2HBP A;  3MHX A;  4CI0 C;  2QTV A;  1G5V A;  2QA4 Q;  4OMF B;  2DZ9 A;  4AT1 B;  3CD6 Q;  1E6G A;  1TWB A;  3FEO A;  2O4X A;  1VQL T;  1NJI C;  5L23 A;  4Z8A A;  4M78 D;  3SDZ A;  1KD1 R;  2K4Y A;  1OPL A;  4KH0 B;  2RA2 A;  1M2O A;  4C5G A;  1FYN A;  2XHC A;  1X2Q A;  3TCJ A;  2EYX A;  4BE2 A;  4D8D A;  2ATC B;  1VUB A;  3X25 B;  3QYG B;  2OTL A;  4HXJ A;  4C5I A;  1VA7 A;  2CZ0 B;  2R5A A;  2ZPI B;  1WXT A;  4E7I A;  3UA7 A;  2LT4 A;  3LLR A;  2DIL A;  1H8K A;  5FWB A;  2K57 A;  5HK3 A;  2I0N A;  2LCL A;  1QCN A;  3PGG A;  4LN2 A;  2C06 A;  2FPF A;  2FPE A;  2RQR A;  1D0X A;  2CUD A;  5GMK i;  1TUG B;  2M02 A;  4Z89 A;  4IUV A;  2BZ8 A;  2NWM A;  3CC4 T;  4EMK B;  3INZ A;  3QSU A;  5CKH A;  2K3Y A;  5KYU A;  2EQM A;  1YI2 Q;  1W70 A;  2KRN A;  2RQU A;  3TVT A;  5FRO A;  4F7U F;  4E2F B;  1VQM A;  1M30 A; 
#chains in the Genus database with same CATH homology
 3CME Q;  3CD6 Q;  2OTL Q;  2OTJ Q;  1W2B P;  1Q81 R;  1VQ6 Q;  3G6E Q;  3CPW P;  1Q7Y R;  1NJI R;  1KC8 R;  1M1K R;  3CCL Q;  1Q86 R;  1YIT Q;  1VQN Q;  1VQ8 Q;  1M90 R;  3CCM Q;  3CCV Q;  3I56 Q;  3CC2 Q;  1KD1 R;  3CCU Q;  1QVG P;  2QEX Q;  1VQP Q;  1VQ4 Q;  3G4S Q;  1S72 Q;  1YHQ Q;  1YJN Q;  3CCR Q;  1VQM Q;  1YIJ Q;  3CCJ Q;  3CC7 Q;  1QVF P;  1VQL Q;  1YI2 Q;  3CCS Q;  3CXC P;  1YJ9 Q;  1VQ5 Q;  1YJW Q;  3CCQ Q;  1VQ9 Q;  1Q82 R;  1K73 R;  3OW2 P;  1K8A R;  1VQ7 Q;  3CCE Q;  1K9M R;  3CMA Q;  1KQS P;  1VQK Q;  2QA4 Q;  1N8R R;  1JJ2 P;  3I55 Q;  3G71 Q;  1VQO Q;  3CC4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...