1NJIR

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1njiR00
1VQ7Q 1VQ6Q 1VQKQ 2QA4Q 1S72Q 1Q7YR 3G6EQ 3CCJQ 1KC8R 1VQ5Q 1KQSP 1K8AR 1VQ9Q 2OTJQ 1YJWQ 3G4SQ 1K73R 1K9MR 1N8RR 3I56Q 3CXCP 1Q86R 3CC2Q 1M1KR 1M90R 1YIJQ 1Q81R 1VQ4Q 3CC4Q 3CCVQ 1VQOQ 1NJIR 3CCSQ 1QVGP 3CC7Q 1YJ9Q 1Q82R 3CCEQ 1YI2Q 1VQNQ 3CCRQ 1YHQQ 2QEXQ 3CD6Q 1VQMQ 1YJNQ 1W2BP 1VQLQ 3CCMQ 1VQPQ 3I55Q 1KD1R 1JJ2P 1YITQ 1VQ8Q 1QVFP 3CMEQ 3CPWP 3CCLQ 3CCUQ 3OW2P 3CMAQ 3CCQQ 2OTLQ 3G71Q
chains in the Genus database with same CATH superfamily
2IVWA 4M7AA 1KQSA 1PD0A 3OMGA 3P8HA 1AT1B 4RCBA 1U3OA 2COYA 2A36A 2QI2A 1ACMB 2LNHB 3OYYA 2F1LA 2RMOA 2L3RA 3CBPA 4M77E 2XI9A 4XU2A 1M30A 2QEXQ 5GANe 3JCMW 1T0JA 2CT3A 2KQWA 4K11A 4C5IA 2K5LA 3PNWC 1RACB 4IKFA 5CKDA 3RNJA 4Z02A 1VYVA 2XDDA 3QDRB 4J83A 4PFPA 4KGVB 2OI3A 1VQNA 4XTUA 2JW4A 5FRMA 1VQKA 2J6OA 2QQRA 3CQTA 3G4SA 3BFMA 4RTZA 2NUPB 4OF1A 3LGFA 1RAEB 2JMAA 3I5SA 3M4GA 1YWOA 2K3BA 3SEMA 4DBFA 3JCMX 2E3IA 2LCSA 2I0NA 1GFCA 4NS5A 1R77A 4BD3A 3GLXA 1RI0A 5LJ5j 1NBEB 1UTIA 2JJ9A 1AWXA 1BI2A 1VIFA 2DJQA 1Y07A 2E6NA 1HSQA 1X69A 1UHCA 2DILA 4RTYA 3M5AA 4HT8A 3M56A 4E7SA 2WACA 3OYHA 5CKEA 5LJ5d 1KD1U 5KYWB 4E7KA 2RQVA 2EYZA 1JXMA 1NG2A 2DEUA 3V7SA 5M9OA 3H0IA 2RHXA 4J6XA 5D6WA 2FEIA 2HCKA 3EG3A 3SWNA 4AG2C 5GANj 3OYDA 5KYUB 2RH2A 1Q7YC 2M1HA 2X4XA 2XK0A 2RJDA 4D8KA 3VS3A 4MMLA 3THKA 3WVEB 4EMGA 3DLMA 3CCMA 2RNAA 1IGUA 3GF5A 3MEVA 4BI4A 2DO3A 3PGGA 3MEWA 1ZSGA 4NOYA 4AFSC 5GANd 3P8DA 3CPWP 2LQWA 1QVFA 2OTLQ 3KFVA 4OVAA 2QA4Q 2KR3A 4TVRA 2SEMA 5CQYA 4Z89A 3CCSA 1VOMA 3VYHB 3X25B 5CKFA 3I55T 2ED0A 3TU4K 1YITT 1U8RA 4ESRA 3PFSA 3S3OA 1G2BA 3VUBA 2ZAEA 2EQMA 2M16A 1Y96B 1NEBA 4M75A 3TSZA 3L2ZA 3VS1A 1WJRA 4RG2A 2HAXA 3OBWA 2K3XA 2CZ6B 5A0DA 4HCZA 5HY6A 1YJNA 3MP6A 1GRIA 3CCQT 4J9BA 1VQ6T 6AT1B 4PJOF 3QWYA 1TU0B 1SEMA 1MNEA 1WXTA 1GCQC 2D0QB 1W2BS 4F7UF 2FZGB 4O6JA 3CC2A 1V1CA 2ZPFB 1KC8R 1H92A 4ZN3A 2LT4A 5GAMh 1SRLA 2RO0A 1Q95G 4OMOA 3SB2A 5IHNA 3FEOA 1Q82R 3CCEQ 5D6YA 2W0ZA 1FWZA 4C8QG 5LJ3h 5D7UA 3EG2A 4RG8A 1S72A 9ATCB 2D8JA 1SHFA 5GMKl 2K79A 2R58A 3CCJQ 4JRQA 1KHIA 1RABB 4XTYA 1K73R 2GBQA 2JZ2A 2LMJA 4HA8A 1SRMA 3QG1A 3CCRA 2QXFA 1VQPA 4LXCA 2LP5A 4C0FA 2AZSA 3OYLA 4LNPA 1FMVA 3FIFA 4BY6C 1Q86U 2P4RA 2OAWA 4HVVA 4GY5A 3CCVT 1YJWQ 4JS4A 2P0KA 3EH1A 2EYWA 1ZHIA 2E4HA 2O01E 1N8RR 4II1A 4MZPA 3QPHA 2Y90A 4R0KA 2CZ1B 3PIOA 5GAOq 1G3YA 3V7RA 4F17A 2RHUA 2X4JA 3RDVA 2KE9A 1QCOA 1B07A 1VQ4A 2QQAA 1C0MA 1OEBA 1PG5B 4C92F 1C1AA 4C8QB 1HK9A 1YFNA 1YHQA 4HVUA 1NJIR 2E5KA 5C6SA 2KYMA 2L2PA 4XAXB 2OX7A 4ME7A 2D9TA 1X6GA 1BKBA 3LWHA 3VJPA 2MWOA 5GAN6 3OA6A 1AWOA 4RKUE 3JB9J 4DBHA 1OU8A 1NPRA 5L23A 3RKYA 3OW2A 2VXEA 4M75D 4O5VA 2KNBB 1VQ5Q 2QDYB 4JZ4A 2MWPA 4N4HA 4ELZC 1K8AC 2MOXA 3J80E 1ZSZC 1VQNT 5FU6B 2DVEA 1M90R 1OULA 2KMTA 2YT6A 3EHQA 1YP5A 1QP2A 1QVPA 3MCAB 4NL2A 1VQKT 4KGZB 3G4ST 1ZUUA 4EIKA 3MO8A 2VC8A 4FYXB 2B86A 3M53A 4RTUA 2V1RA 4LN2A 1JRIA 1PRLC 4M4ZA 5KCOA 4GLMA 1K9MR 1D0YA 1GCQA 4J9IA 4LE9A 1B34B 3QXEB 1X43A 2XU8A 4C0DC 2FHDA 4FSSA 3CD6A 1EX4A 4F7UE 1AVZC 1NZ9A 2X9HA 3C12A 3DB3A 2YHTA 2NUPA 1KFZA 2GF7A 3GPLA 5GAN7 1LPLA 1QKWA 3L2UA 2LCLA 4AG1C 1MMNA 2DETA 5CQXA 3HFOA 1KQSS 4M78C 1YJ9A 1X2QA 5IHIA 3EGUA 1IB8A 1WQWA 3ASKA 1K4US 1UGVA 2A3LA 3M58A 2KXDA 3NTKA 1BI1A 1VQMQ 3MEAA 3G1JA 1W70A 4N0AC 1QQJA 4PJNA 2RD1A 4ELYC 1VQ7Q 2RJEA 4FW2A 5FWCA 3V8KA 2ROTA 2MMPA 2X35A 3HHTB 4NL3A 2C06A 3UF4A 5KYWA 1PSEA 3CCMT 1UGQB 4Q5WA 2X4WA 3OS1A 5FLXE 5EG2A 1YWPA 1MMDA 2CKKA 3WXMB 4RTTA 2DJZA 1I0CA 5KYUA 1KD1C 2RPNA 4J5YA 1OU9A 4PFOA 5DY9A 1OV3A 4PJOG 3CCST 1Q81U 2G3RA 1T0HA 2CP2A 3GBQA 4F7UG 3FLGA 1M1KR 4M7DF 3E2UA 1MMAA 2EQKA 3CC4Q 1RAHB 5GANh 5CAIA 1GXIE 1UGRB 1YI2Q 2BE9B 3F70A 2OTLA 1W2BP 2QA4A 4M7AC 4A4EA 2AIRB 2DXUA 3E1SA 4J6YA 1N5ZA 2PVOB 3FDRA 4M77F 2P0QA 1U1SA 1W1FA 5GAOl 5HK0A 2KI7A 2ZGWA 2CGHA 4HXJA 2RM4A 4ZGDB 1N27A 1YJNT 1Y71A 1M3AA 2ZPHB 5DLOA 1Y96A 1F1BB 1QVGA 4XTVA 1IGQA 2BUDA 4FU6A 1PM3A 3H0HA 2K5IA 3C94A 4C0GA 1MGQA 5IAYA 2DLPA 2XDBA 1TOVA 1KQ2A 4PJJA 3CC2T 3KXTA 1BU1A 2M0YA 1A0NB 3FJPA 4OMQA 2E70A 4DBQA 2IG0A 1WHKA 1IREB 4BDYA 1WI7A 2FVUA 2QQSA 2MI6A 4MDXA 2WSEE 1TUDA 4PJOB 1AOJA 2C0OA 4KUIA 1WPYA 1T3SA 1S72T 2CSQA 2ATCB 2HQXA 3G6EA 4J9GA 2BZYA 1AWWA 3CMAQ 1PD1A 2CP5A 4FSXA 1PC0A 4J9HA 1OZ2A 2JM9A 1YN8A 1VQPT 1RLQC 3EGXB 2HL5C 4C92G 1W6XA 3C0CA 4XTWA 2X4YA 4PNOA 3OS0A 3QJ6A 1N9RA 1QLYA 4OB3B 2JS0A 2PNIA 3HKSA 2DL4A 1NLOC 1V76A 2DD4A 1ABQA 2O88A 2QTVA 1K1ZA 3VU3C 1Q7YR 2RHIA 1WXBA 2RQUA 3M0UA 1SSFA 2CDTA 2EYYA 3OS2A 2DEQA 1TG0A 2E1HA 2OJ2A 2RHZA 2ROLA 4XK8E 2ZCFB 2HQEA 1U5SA 1UECA 4ZTJA 3PMTA 3SWNC 4PL6A 3G71A 4JPBW 4IUVA 1YJWA 3CBMA 2JMCA 4XTZA 4FCYA 4BE1A 4ORZA 3QJYA 1YHQT 2A7YA 3CXCA 5GAN5 5A2QE 1Q86C 1UDLA 4LUEA 1ZBJA 4GBQA 1NYGA 2PVGB 3KBGA 2O2OA 2FZCB 3HPWA 4UC4A 3RBBB 1YNZA 2MIOA 1K76A 1Y57A 2AT1B 3UPUA 4C8QA 2LX7A 4C92B 2JUFA 5CKHA 4MZTA 4A53A 4E7ZA 3UWNA 2RJFA 5IT9E 4M75C 2LQ8A 5FU7C 5GAOn 2KRSA 1WHHA 3EGDB 1GL5A 1UUEA 4LDYA 1ZUKA 3E19A 5ECAA 1KQSP 1RI9A 2KRNA 3S3MA 2C0IA 1IZ6A 1KIKA 1WHLA 4RMOA 2DM1A 2FG0A 3CD6T 1VQOQ 1Z9ZA 1D1AA 2G6FX 1FMKA 3NTIA 2M51A 1UFFA 1WZOA 3M54A 2DL8A 3BE3A 4QVZA 1B34A 1EZZB 2JNGA 3IQLA 4RTXA 1NYFA 2MYSA 1YJ9T 2L89A 4MMKA 1YCSB 2FPDA 2KEAA 2XG8D 1VQLA 2A0FB 2BZXA 2EKHA 4B6MA 4M7DG 2JOYA 1I8FA 5J26A 4PLIA 1EFNA 1WNLA 4OGEA 4A54A 2HD0A 4M78D 3CCUQ 2VWFA 4XU0A 3C95A 2HL3A 1VIEA 5IH2A 1WGSA 1BK2A 2GCXA 1Q82U 2RQTA 4XTXA 1LCKA 4KGXB 4M77G 1XNIA 3DKMA 1VQMA 2ECZA 1NLPC 4M78E 3INZA 2LCCA 1FX7A 2VVKA 4J8OA 4E6RA 1VQ7A 4E7IA 1K73U 3VKIA 3CCLQ 4QKUA 2I2LA 4ANJA 1VQ9Q 2RJCA 2DA9A 3JSCA 4L59A 2LQKA 1K9AA 4RTWA 4E7LA 4X9DA 2OAUA 3TVTA 2EIFA 4JJBA 3V8LA 1SF9A 3RMQA 2OTLT 3EHRA 2QGFB 2QA4T 3JB9D 2M9UA 1WA7A 3PMIA 3QYHB 2HZYA 1UG1A 1JJ2A 1T3LA 3CPWA 3VV0A 3TREA 3OYGA 2BKDN 3M0SA 3CC4A 1QMCA 4HVWA 2GTJA 2R5AA 3RMSA 4M7DB 1C6VX 3QZ5B 3ZBDA 4M7AD 2KSSA 1Q81C 2LJ1A 4OMFB 3RERA 2ZPEB 1PNJA 3EFSA 3A98A 1QVFP 2V8IA 2OTJA 3HFNA 3CMEQ 2DBKA 2IIMA 4M7AE 1B7TA 2DF6A 3EG1A 2CH4A 3JAME 3JB9I 5EC7A 2ED1A 4OMNA 4R55A 3T9NA 4LD6A 1RLPC 1E6HA 1G83A 2H8HA 4EDUA 3G6ET 4VUBA 1BI0A 3I55Q 1YITQ 3A8HB 3PE0A 1M90U 2YLBA 3VYGA 2JTMA 1ZA2B 4PJOA 3ER0A 4A4GA 3HRTA 2AHJB 3QZ9B 5IXFA 5KE3A 1ZA1B 1M2VB 1PHTA 3X20B 3CMAA 2V1QA 3CBOA 4AT1B 1SG5A 3OYMA 3HSBA 3TSWA 5A0LA 4C5EA 1VQ6Q 2XHCA 1YIJT 2R5MA 2MCNA 3EGXA 1OX8A 3H8ZA 2L8DA 2J05A 2FRYA 1I5OB 3QUIA 3G71T 4FT2A 3PVLA 2LRQA 2E41A 1G8XA 2LX9A 2DIQA 2CP0A 3C4SA 1G3WA 2E12A 4X1VA 3MJXA 2ZZDA 3LYIA 4EMKB 2E10A 3H9NA 2FL7A 2F2XA 2DRKA 2HMAA 4WCIA 4J9FA 3LGLA 2XD0A 3RUXA 5GAN4 2CP7A 2J7IA 1GCPA 2LZ6B 2PUKB 3OSVA 2HDAA 2VXFA 2EFIA 1UEBA 1X6BA 4AMCA 2KBTA 3NMZC 5CR2A 3UATA 4IUUA 3M9QA 3CCVQ 3GNGA 2DD5A 2DE0X 1ZX6A 2M02A 1LVKA 1BI3A 1KSWA 1N6AA 1UB4A 1EIFA 1WYXA 2HBWA 4C92A 3MPUB 1M1KU 1D3BB 4F14A 5GMKm 3M57A 4QQDA 4CRIA 3CC7Q 2QEXA 3O5ZA 4QVDA 3A8GB 3I9QA 3EGDA 2EWNA 3CEYA 5I22A 1XQHA 2Z0WA 4M75E 2CH4W 1RADB 2KYBA 4FW1A 4CI0C 1G3SA 2EYQA 1U06A 2CSIA 2EBPA 2E5QA 3H6ZA 3HRUA 2BIVA 1I81A 2PVDB 3UA7A 4PJLA 3GOXA 1VQOA 1MNDA 3VS7A 2MPXC 3SDZA 2AKLA 2FRWA 1VQLT 3M0RA 1VQNQ 1M2OA 2W10A 1X27A 2V8JA 2CYZB 2A08A 4BE2A 1X01A 3ZL7C 2COWA 1VQKQ 1IHWA 4BI3A 2RF0A 5GMKe 1TH7A 3TQ7P 3I56Q 4L6V5 3M0PA 1SKUB 4FIBA 1G5VA 2A37A 3CCUA 1VQ7T 1XTDA 4BI8B 4JJCA 2K4YA 4J6WA 2XMFA 3JCMg 1XJWB 2YDLA 5CO7A 3UA6A 2JTEA 1OX9A 2H3JA 3MP8A 4IUQA 1Q86R 4BDZA 3JCMb 3X24B 5I11A 2K2VA 3A8LB 3LLRA 4E2FB 1VYTA 1WHJA 1Z9QA 3CCLA 1Q82C 3VS4A 2JT4A 2RK1A 3NHNA 3TCJA 1VQ9A 2KAFA 2ZPIB 1UJYA 4HCCA 2KROA 3CC4T 1AZGB 1WIEA 1BIBA 1M27C 2E6ZA 1JXOA 3RIRA 1HJDA 3A5ZB 1AEYA 1K73C 2CS7A 4JZ3A 2VASA 3H0FA 4PLLA 3X26B 2JS2A 5FWBA 3JCMf 4QQGA 3OBYA 4C8QC 1D1CA 2OTJT 1FMWA 2RI5A 5DM7R 1PWTA 2H3EB 4XQ3A 2EGEA 3LX7A 5KCHA 2J06A 4M7DA 2NUTB 5I21A 1NEGA 3VS0A 4C5GA 1JO8A 1MV0B 2KRMA 2KY9A 1CKAA 3PTAA 5GMKj 2LT1A 3CMEA 5FW9A 4FYWB 1IXDA 2QQ9A 1K0SA 5FU6C 2FPFA 3OS5A 1VQ8Q 4LDUA 2VYTA 2K6DA 1MV3A 1LJOA 1KQ1A 4D6WA 3P8BB 4DOWA 4F04B 3BW1A 4JJNK 3JCMP 1OI1A 2DXBA 4HCBA 2NWMA 1KG1A 3CMAT 1I4K1 2YUNA 4MDWA 5HK3A 2D8HA 1OPKA 4E7JA 4LUDA 4F7UB 1PKSA 2NLUA 2O4XB 2GTOA 1UE9A 1QVFS 1KJWA 1OPLA 3OYBA 1OZ3A 1M2VA 3EFRA 3CCEA 3CCRT 2YUQA 3OSSC 2JN0A 2F2WA 1M90C 4J9EA 1AD5A 5CKBA 4EMHA 4KULA 2QASA 2XIDA 4LD9K 2P4TA 5GAMg 1VQ6A 2KGTA 2DXCA 3CCJA 4FT4A 2HBPA 4M78F 1S72Q 2F5TX 2K3YA 2P0PA 3LWIA 1BCOA 5LJ3g 4PFZA 1VUBA 1SPKA 1M3BA 2DL7A 2DTHA 2DTOA 1I5LA 4EPCA 4J7IA 4A4FA 1WLPB 5J3BA 3HL8A 2EGAA 1QWEA 4ZGJB 3EG9B 1M9SA 2KVQG 2EW3A 3GNFB 2YUPA 3RKWA 1VQ4T 2DX1A 2QGGA 4EMKA 2EKOA 5GAMf 2CUBA 3NGPA 1Q81R 2YWWA 1QKXA 5IN1A 2KT1A 1E6GA 2E3HA 1GBRA 2EAYA 3A8OB 2L3SA 3PVQA 4KUDK 4QW2A 5LJ3f 3UDCA 3JB9F 5AYFA 1GBQA 5KYXB 1BB9A 3BDLA 5GAN8 1FYNA 3FC3A 3M4YA 4KRTA 2CUDA 1ZQ1A 1PKTA 5KYYB 2QG9B 2DZCA 2X3WD 2EQUA 3CXCP 2QEXT 4DOVA 4M7AF 2EQJA 1LNXA 3SFMA 1JBMA 1D3BA 3RESA 3N5BB 2F69A 2L5QA 1TTHB 1VQ5A 1TUGB 3H41A 1WDXA 1VQOT 4DBRA 2LJ3A 3CC7A 4DQ2A 5GJVB 4GLKA 1M1KC 2RQRA 4DEXA 2VUBA 1TWBA 3AHUA 4ATOA 3U23A 4JJDA 1M8VA 4ZN1A 2AZVA 1X2KA 4PJOC 3S6WA 2FZKB 1QWFA 1OOTA 3QYGB 3UT1A 4DEYA 2GQIA 4D8DA 2BZ8A 3QKJA 4PK4A 4ZGEB 1ZBXA 5FRNA 3CCUT 1VYUA 2A28A 2MF2A 2YRCA 3CD6Q 3JRZA 4QVCA 1KC8U 4V2SA 3HP9A 1ZLMA 2RI2A 2HKQB 3JV3A 2LNVA 3I56A 1ABOA 4IIOA 3OW2S 3DB4A 4HKEA 2MAMA 2QTXA 3VS6A 2MK5A 3L42A 1YJ9Q 3JCMh 3CCLT 1M1FA 1MHNA 4JUVA 3DLLA 1VQ9T 2F5KA 3S3NA 4IIMA 4B9WA 2RQWA 4KT0E 2XKOC 2YRDA 1RAFB 5I2MA 2M0OA 1VA7A 2FYKA 3J7AF 1X6OA 4AFZC 3R6OA 3M0QA 5CK9A 5LJ5g 3TEEA 1XOVA 4BY6B 2CZ7B 2P84A 2VGNA 1S1NA 4OB0B 2QDLA 4C0ZA 3E9FA 3X28B 1N8RU 3G7ZA 1R0CB 2KT8A 1X75C 1K8AR 3VS2A 4B9XA 4KH1B 1V29B 5A0GA 2K57A 1MUZA 5KYNA 4C8QD 2PZ1A 2CP6A 2DMOA 2DYIA 1YI2A 2GGRA 2WSCE 1K0XA 3CMET 4LDWA 4C92C 3L1AA 1Y0MA 5GAN2 1BYMA 2NUTA 2COZA 2CZ0B 3PIPA 1JJ2P 2EJFA 4FYYB 2DPPB 5GANg 4C8QE 5LJ5f 3REAB 1PSFA 4M77B 2DVJA 1FXXA 2D1XA 4IUTA 1NJIU 5KH6A 3QO3A 3EFOB 4M75F 4M78G 1E7OA 2RK2A 4RTVA 4R56A 1UGSB 1QW1A 2CREA 3JCMQ 1B3QA 4JRPA 1VQ8A 1QCFA 1WHGA 5HKCA 3LH5A 1NPPA 3A1PA 5GMKh 3OY9A 3QIIA 2CP3A 1I1JA 1NE8A 2AK5A 1ZSZB 2DYBA 1MMGA 2EJGA 3ULRB 2DTIA 2HNIA 3RKXA 3CCET 3OYNA 1W4SA 2R57A 2QK0A 5GANf 2X3XD 1UGPB 2K7AA 1ZUYA 4JRIA 3L2WA 3JCMJ 4P5NA 4F7UA 4FM4B 2O4XA 2DXTA 3CCJT 2LDMA 1K9MU 3CCQQ 4AFUC 4C0DB 3G6EQ 3ZEHA 3JB9G 4JRKA 4N4GA 1CKBA 2GFUA 3EAEA 1YBYA 3FJ5A 2HSEB 5GAOp 4JS5A 3OYKA 1BIAA 1QVGS 2DNUA 4FL6A 2L3PA 2EQIA 1KD1R 1YJWT 3NPFA 4M7AG 4M78B 1Y7XA 2PQWA 1SSHA 2JTFA 2LC4A 4CC4B 1HXDA 1M3CA 3BY7A 4IURA 2QYZA 5L8RE 1YIJQ 3EG9A 2HKNA 3SD4A 4Y91A 1N9SA 2KXCA 2ABLA 4WTOB 1M1GA 2Y4XA 1SHGA 1PRMC 2V26A 1D0ZA 3JCMe 2PU9B 4OP0A 4N4IA 1KK7A 2O9VA 1TXQA 3PT9A 3JCMV 5FROA 3G71Q 4BE0A 3AT1B 4OB1B 1WJSA 2DAQA 3V8JA 2EJ9A 3E9GA 2LQNA 3EG0A 4HT9A 4A63B 3WVDB 4A4KA 3MEUA 5KYXA 4M7DC 2ZPBB 8ATCB 1R0BG 3QBYA 1VQ5T 4J7FA 4XU1A 5I2SA 5KYYA 1RL2A 4Y92A 4OB2B 3CPFA 3CC7T 4OGCA 3QSUA 3KUFA 3URGA 2FPEA 2NUZA 1RAGB 4F16A 2QAZA 3OB9A 2D6FA 2C0TA 4M77C 3VRYA 2PUOB 4IUPA 4M7AB 2Y4YA 2O31A 2JVVA 1TUCA 2L3QA 3M0TA 2D0NA 4QQ6A 2RHYA 2DZ9A 3OYCA 2RB6A 1QP3A 3OQ5A 2LJ0A 3OW2P 2K5FA 4C5HA 3ME9A 3A8MB 2BE7D 2HQHA 3D7SB 5CCAA 3J81E 1TS9A 3OYFA 2GNCA 4L5GA 1RAIB 4FYVB 3R6NA 3CXCS 4PJOD 1KHCA 3FB9A 2QQBA 3MP1A 5KE2A 1WX6A 1OQKA 5GAN3 1UHFA 3I56T 1IRXA 2J6KA 1OYXA 3NFCA 4OMPA 4KBMB 2VKNA 3G4SQ 3OMCA 1JB0E 4PJOE 2KK4A 2DERA 2DFUA 2ENMA 3O8VA 3RR6A 5IHKA 1O9SA 3HRSA 1VQMT 5GMKi 3JB9H 5CVIA 1M5Q1 4RUGA 1VQLQ 5D6XA 5IXBA 2E65A 3JCMd 2YUOA 5LL6S 4HCKA 1KC8C 2VGMA 2WSFE 4CC7A 1UJ0A 2AKKA 4M75G 5GAMe 1WHMA 3FRNA 4WF2A 3Q1JA 1Q7YU 3I35A 8AT1B 4EMKC 5C0MA 5LJ5h 2X51A 5LJ3e 3L2RA 2DK3A 4E47A 3M55A 2FB7A 4PKCC 2GQVA 1H3ZA 1GFDA 2EVRA 3ZFJA 1YI2T 3V7CA 3SWNB 4RCCA 2PTKA 2GFAA 2LVMA 1I07A 3META 4OMMA 1HD3A 1BBZA 1D09B 4LDXA 4XU3A 1H3HA 3BDUA 2E64A 2JM8A 3CCMQ 5GAOr 1W2BA 2DL3A 2RA2A 1M4ZA 3OYJA 4BACA 5AT1B 2V8KA 4C92D 3OYEA 1J3TA 1QCNA 3SHWA 1IO6A 5GJWB 2BTTA 5CIUA 1N8RC 3CCSQ 4BB7A 1H641 1VQ8T 1HYOA 2JXBA 4M77A 2K9GA 2B8AA 4C92E 1H8KA 4JLIA 1CSKA 1JEGA 2XDPA 3EFOA 2RI3A 4QT7A 3VRZA 4X34A 4ZTFA 4JLGA 3QWXX 2OTJQ 4M75B 4Z88A 5FU7B 4MZMA 3I5RA 1NM7A 1DJ7B 2VB6A 1ARKA 1QVGP 2YXYA 4DA4A 2CT4A 7AT1B 3VUZA 3I55A 1NJIC 1YITA 4AFQC 2EGCA 1ZSZA 1YJNQ 2XICA 2HEQA 3OYAA 5GAMj 4OMLA 3VS5A 3JCMc 2IPOB 1JJ2S 2NYSA 3CPWS 2EYXA 3M59A 2L0AA 1RAAB 3CC2Q 3NTHA 2YLCA 5LJ3j 3OYIA 1WFWA 4X9CA 1WXUA 5GAMd 3CCQA 4CC3A 3MKDA 2SRCA 2ZPGB 4JDSA 4BUGA 4LDVA 2FO0A 2F2VA 1AWJA 3GP8A 1WJQA 2YRVA 2DIGA 5LJ3d 3MHXA 4YTLA 1U1TA 1WQ7A 1O75A 3EH2A 5HCKA 1K9MC 2VV5A 5GAOm 2DRMA 4CC2A 4M78A 5J39A 4Z8AA 3CCRQ 4E7HA 4A4HA 1PCXA 1TSFA 1VQPQ 1AZEA 1D1BA 2DKGA 4ZNXA 2ESWA 5DLQE 1YIJA 3L2QA 4N0AA 1P92A 3L2VA 4Y28E 1LOJA 2DL5A 2YSQA 1R8OB 1M8MA 2EPDA 2KDSA 2K2MA 4J9CA 3HTRA 1G3TA 4KH0B 1JU5C 1IHVA 3CCVA 1BCMA 1AHJB 2J6FA 3REBB 5LJ5e 4J9DA 4M7DD 3QHSA 2LTOA 1RUWA 1YCYA 2HSPA 1VQ4Q 1JQQA 4C8QF 3GIBA 1D0XA 2RN8A 4PJMA 2DBMA 3LW5E 2O9SA 1YHQQ 1K8AU 4M7DE 3LH0A 4M77D 3QDFA
chains in the Genus database with same CATH topology
1VQ7Q 1VQ6Q 1VQKQ 2QA4Q 1S72Q 1Q7YR 3G6EQ 3CCJQ 1KC8R 1VQ5Q 1KQSP 1K8AR 1VQ9Q 2OTJQ 1YJWQ 3G4SQ 1K73R 1K9MR 1N8RR 3I56Q 3CXCP 1Q86R 3CC2Q 1M1KR 1M90R 1YIJQ 1Q81R 1VQ4Q 3CC4Q 3CCVQ 1VQOQ 1NJIR 3CCSQ 1QVGP 3CC7Q 1YJ9Q 1Q82R 3CCEQ 1YI2Q 1VQNQ 3CCRQ 1YHQQ 2QEXQ 3CD6Q 1VQMQ 1YJNQ 1W2BP 1VQLQ 3CCMQ 1VQPQ 3I55Q 1KD1R 1JJ2P 1YITQ 1VQ8Q 1QVFP 3CMEQ 3CPWP 3CCLQ 3CCUQ 3OW2P 3CMAQ 3CCQQ 2OTLQ 3G71Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Q;  1VQ6 Q;  1VQK Q;  2QA4 Q;  1S72 Q;  1Q7Y R;  3G6E Q;  3CCJ Q;  1KC8 R;  1VQ5 Q;  1KQS P;  1K8A R;  1VQ9 Q;  2OTJ Q;  1YJW Q;  3G4S Q;  1K73 R;  1K9M R;  1N8R R;  3I56 Q;  3CXC P;  1Q86 R;  3CC2 Q;  1M1K R;  1M90 R;  1YIJ Q;  1Q81 R;  1VQ4 Q;  3CC4 Q;  3CCV Q;  1VQO Q;  1NJI R;  3CCS Q;  1QVG P;  3CC7 Q;  1YJ9 Q;  1Q82 R;  3CCE Q;  1YI2 Q;  1VQN Q;  3CCR Q;  1YHQ Q;  2QEX Q;  3CD6 Q;  1VQM Q;  1YJN Q;  1W2B P;  1VQL Q;  3CCM Q;  1VQP Q;  3I55 Q;  1KD1 R;  1JJ2 P;  1YIT Q;  1VQ8 Q;  1QVF P;  3CME Q;  3CPW P;  3CCL Q;  3CCU Q;  3OW2 P;  3CMA Q;  3CCQ Q;  2OTL Q;  3G71 Q; 
#chains in the Genus database with same CATH topology
 2IVW A;  4M7A A;  1KQS A;  1PD0 A;  3OMG A;  3P8H A;  1AT1 B;  4RCB A;  1U3O A;  2COY A;  2A36 A;  2QI2 A;  1ACM B;  2LNH B;  3OYY A;  2F1L A;  2RMO A;  2L3R A;  3CBP A;  4M77 E;  2XI9 A;  4XU2 A;  1M30 A;  2QEX Q;  5GAN e;  3JCM W;  1T0J A;  2CT3 A;  2KQW A;  4K11 A;  4C5I A;  2K5L A;  3PNW C;  1RAC B;  4IKF A;  5CKD A;  3RNJ A;  4Z02 A;  1VYV A;  2XDD A;  3QDR B;  4J83 A;  4PFP A;  4KGV B;  2OI3 A;  1VQN A;  4XTU A;  2JW4 A;  5FRM A;  1VQK A;  2J6O A;  2QQR A;  3CQT A;  3G4S A;  3BFM A;  4RTZ A;  2NUP B;  4OF1 A;  3LGF A;  1RAE B;  2JMA A;  3I5S A;  3M4G A;  1YWO A;  2K3B A;  3SEM A;  4DBF A;  3JCM X;  2E3I A;  2LCS A;  2I0N A;  1GFC A;  4NS5 A;  1R77 A;  4BD3 A;  3GLX A;  1RI0 A;  5LJ5 j;  1NBE B;  1UTI A;  2JJ9 A;  1AWX A;  1BI2 A;  1VIF A;  2DJQ A;  1Y07 A;  2E6N A;  1HSQ A;  1X69 A;  1UHC A;  2DIL A;  4RTY A;  3M5A A;  4HT8 A;  3M56 A;  4E7S A;  2WAC A;  3OYH A;  5CKE A;  5LJ5 d;  1KD1 U;  5KYW B;  4E7K A;  2RQV A;  2EYZ A;  1JXM A;  1NG2 A;  2DEU A;  3V7S A;  5M9O A;  3H0I A;  2RHX A;  4J6X A;  5D6W A;  2FEI A;  2HCK A;  3EG3 A;  3SWN A;  4AG2 C;  5GAN j;  3OYD A;  5KYU B;  2RH2 A;  1Q7Y C;  2M1H A;  2X4X A;  2XK0 A;  2RJD A;  4D8K A;  3VS3 A;  4MML A;  3THK A;  3WVE B;  4EMG A;  3DLM A;  3CCM A;  2RNA A;  1IGU A;  3GF5 A;  3MEV A;  4BI4 A;  2DO3 A;  3PGG A;  3MEW A;  1ZSG A;  4NOY A;  4AFS C;  5GAN d;  3P8D A;  3CPW P;  2LQW A;  1QVF A;  2OTL Q;  3KFV A;  4OVA A;  2QA4 Q;  2KR3 A;  4TVR A;  2SEM A;  5CQY A;  4Z89 A;  3CCS A;  1VOM A;  3VYH B;  3X25 B;  5CKF A;  3I55 T;  2ED0 A;  3TU4 K;  1YIT T;  1U8R A;  4ESR A;  3PFS A;  3S3O A;  1G2B A;  3VUB A;  2ZAE A;  2EQM A;  2M16 A;  1Y96 B;  1NEB A;  4M75 A;  3TSZ A;  3L2Z A;  3VS1 A;  1WJR A;  4RG2 A;  2HAX A;  3OBW A;  2K3X A;  2CZ6 B;  5A0D A;  4HCZ A;  5HY6 A;  1YJN A;  3MP6 A;  1GRI A;  3CCQ T;  4J9B A;  1VQ6 T;  6AT1 B;  4PJO F;  3QWY A;  1TU0 B;  1SEM A;  1MNE A;  1WXT A;  1GCQ C;  2D0Q B;  1W2B S;  4F7U F;  2FZG B;  4O6J A;  3CC2 A;  1V1C A;  2ZPF B;  1KC8 R;  1H92 A;  4ZN3 A;  2LT4 A;  5GAM h;  1SRL A;  2RO0 A;  1Q95 G;  4OMO A;  3SB2 A;  5IHN A;  3FEO A;  1Q82 R;  3CCE Q;  5D6Y A;  2W0Z A;  1FWZ A;  4C8Q G;  5LJ3 h;  5D7U A;  3EG2 A;  4RG8 A;  1S72 A;  9ATC B;  2D8J A;  1SHF A;  5GMK l;  2K79 A;  2R58 A;  3CCJ Q;  4JRQ A;  1KHI A;  1RAB B;  4XTY A;  1K73 R;  2GBQ A;  2JZ2 A;  2LMJ A;  4HA8 A;  1SRM A;  3QG1 A;  3CCR A;  2QXF A;  1VQP A;  4LXC A;  2LP5 A;  4C0F A;  2AZS A;  3OYL A;  4LNP A;  1FMV A;  3FIF A;  4BY6 C;  1Q86 U;  2P4R A;  2OAW A;  4HVV A;  4GY5 A;  3CCV T;  1YJW Q;  4JS4 A;  2P0K A;  3EH1 A;  2EYW A;  1ZHI A;  2E4H A;  2O01 E;  1N8R R;  4II1 A;  4MZP A;  3QPH A;  2Y90 A;  4R0K A;  2CZ1 B;  3PIO A;  5GAO q;  1G3Y A;  3V7R A;  4F17 A;  2RHU A;  2X4J A;  3RDV A;  2KE9 A;  1QCO A;  1B07 A;  1VQ4 A;  2QQA A;  1C0M A;  1OEB A;  1PG5 B;  4C92 F;  1C1A A;  4C8Q B;  1HK9 A;  1YFN A;  1YHQ A;  4HVU A;  1NJI R;  2E5K A;  5C6S A;  2KYM A;  2L2P A;  4XAX B;  2OX7 A;  4ME7 A;  2D9T A;  1X6G A;  1BKB A;  3LWH A;  3VJP A;  2MWO A;  5GAN 6;  3OA6 A;  1AWO A;  4RKU E;  3JB9 J;  4DBH A;  1OU8 A;  1NPR A;  5L23 A;  3RKY A;  3OW2 A;  2VXE A;  4M75 D;  4O5V A;  2KNB B;  1VQ5 Q;  2QDY B;  4JZ4 A;  2MWP A;  4N4H A;  4ELZ C;  1K8A C;  2MOX A;  3J80 E;  1ZSZ C;  1VQN T;  5FU6 B;  2DVE A;  1M90 R;  1OUL A;  2KMT A;  2YT6 A;  3EHQ A;  1YP5 A;  1QP2 A;  1QVP A;  3MCA B;  4NL2 A;  1VQK T;  4KGZ B;  3G4S T;  1ZUU A;  4EIK A;  3MO8 A;  2VC8 A;  4FYX B;  2B86 A;  3M53 A;  4RTU A;  2V1R A;  4LN2 A;  1JRI A;  1PRL C;  4M4Z A;  5KCO A;  4GLM A;  1K9M R;  1D0Y A;  1GCQ A;  4J9I A;  4LE9 A;  1B34 B;  3QXE B;  1X43 A;  2XU8 A;  4C0D C;  2FHD A;  4FSS A;  3CD6 A;  1EX4 A;  4F7U E;  1AVZ C;  1NZ9 A;  2X9H A;  3C12 A;  3DB3 A;  2YHT A;  2NUP A;  1KFZ A;  2GF7 A;  3GPL A;  5GAN 7;  1LPL A;  1QKW A;  3L2U A;  2LCL A;  4AG1 C;  1MMN A;  2DET A;  5CQX A;  3HFO A;  1KQS S;  4M78 C;  1YJ9 A;  1X2Q A;  5IHI A;  3EGU A;  1IB8 A;  1WQW A;  3ASK A;  1K4U S;  1UGV A;  2A3L A;  3M58 A;  2KXD A;  3NTK A;  1BI1 A;  1VQM Q;  3MEA A;  3G1J A;  1W70 A;  4N0A C;  1QQJ A;  4PJN A;  2RD1 A;  4ELY C;  1VQ7 Q;  2RJE A;  4FW2 A;  5FWC A;  3V8K A;  2ROT A;  2MMP A;  2X35 A;  3HHT B;  4NL3 A;  2C06 A;  3UF4 A;  5KYW A;  1PSE A;  3CCM T;  1UGQ B;  4Q5W A;  2X4W A;  3OS1 A;  5FLX E;  5EG2 A;  1YWP A;  1MMD A;  2CKK A;  3WXM B;  4RTT A;  2DJZ A;  1I0C A;  5KYU A;  1KD1 C;  2RPN A;  4J5Y A;  1OU9 A;  4PFO A;  5DY9 A;  1OV3 A;  4PJO G;  3CCS T;  1Q81 U;  2G3R A;  1T0H A;  2CP2 A;  3GBQ A;  4F7U G;  3FLG A;  1M1K R;  4M7D F;  3E2U A;  1MMA A;  2EQK A;  3CC4 Q;  1RAH B;  5GAN h;  5CAI A;  1GXI E;  1UGR B;  1YI2 Q;  2BE9 B;  3F70 A;  2OTL A;  1W2B P;  2QA4 A;  4M7A C;  4A4E A;  2AIR B;  2DXU A;  3E1S A;  4J6Y A;  1N5Z A;  2PVO B;  3FDR A;  4M77 F;  2P0Q A;  1U1S A;  1W1F A;  5GAO l;  5HK0 A;  2KI7 A;  2ZGW A;  2CGH A;  4HXJ A;  2RM4 A;  4ZGD B;  1N27 A;  1YJN T;  1Y71 A;  1M3A A;  2ZPH B;  5DLO A;  1Y96 A;  1F1B B;  1QVG A;  4XTV A;  1IGQ A;  2BUD A;  4FU6 A;  1PM3 A;  3H0H A;  2K5I A;  3C94 A;  4C0G A;  1MGQ A;  5IAY A;  2DLP A;  2XDB A;  1TOV A;  1KQ2 A;  4PJJ A;  3CC2 T;  3KXT A;  1BU1 A;  2M0Y A;  1A0N B;  3FJP A;  4OMQ A;  2E70 A;  4DBQ A;  2IG0 A;  1WHK A;  1IRE B;  4BDY A;  1WI7 A;  2FVU A;  2QQS A;  2MI6 A;  4MDX A;  2WSE E;  1TUD A;  4PJO B;  1AOJ A;  2C0O A;  4KUI A;  1WPY A;  1T3S A;  1S72 T;  2CSQ A;  2ATC B;  2HQX A;  3G6E A;  4J9G A;  2BZY A;  1AWW A;  3CMA Q;  1PD1 A;  2CP5 A;  4FSX A;  1PC0 A;  4J9H A;  1OZ2 A;  2JM9 A;  1YN8 A;  1VQP T;  1RLQ C;  3EGX B;  2HL5 C;  4C92 G;  1W6X A;  3C0C A;  4XTW A;  2X4Y A;  4PNO A;  3OS0 A;  3QJ6 A;  1N9R A;  1QLY A;  4OB3 B;  2JS0 A;  2PNI A;  3HKS A;  2DL4 A;  1NLO C;  1V76 A;  2DD4 A;  1ABQ A;  2O88 A;  2QTV A;  1K1Z A;  3VU3 C;  1Q7Y R;  2RHI A;  1WXB A;  2RQU A;  3M0U A;  1SSF A;  2CDT A;  2EYY A;  3OS2 A;  2DEQ A;  1TG0 A;  2E1H A;  2OJ2 A;  2RHZ A;  2ROL A;  4XK8 E;  2ZCF B;  2HQE A;  1U5S A;  1UEC A;  4ZTJ A;  3PMT A;  3SWN C;  4PL6 A;  3G71 A;  4JPB W;  4IUV A;  1YJW A;  3CBM A;  2JMC A;  4XTZ A;  4FCY A;  4BE1 A;  4ORZ A;  3QJY A;  1YHQ T;  2A7Y A;  3CXC A;  5GAN 5;  5A2Q E;  1Q86 C;  1UDL A;  4LUE A;  1ZBJ A;  4GBQ A;  1NYG A;  2PVG B;  3KBG A;  2O2O A;  2FZC B;  3HPW A;  4UC4 A;  3RBB B;  1YNZ A;  2MIO A;  1K76 A;  1Y57 A;  2AT1 B;  3UPU A;  4C8Q A;  2LX7 A;  4C92 B;  2JUF A;  5CKH A;  4MZT A;  4A53 A;  4E7Z A;  3UWN A;  2RJF A;  5IT9 E;  4M75 C;  2LQ8 A;  5FU7 C;  5GAO n;  2KRS A;  1WHH A;  3EGD B;  1GL5 A;  1UUE A;  4LDY A;  1ZUK A;  3E19 A;  5ECA A;  1KQS P;  1RI9 A;  2KRN A;  3S3M A;  2C0I A;  1IZ6 A;  1KIK A;  1WHL A;  4RMO A;  2DM1 A;  2FG0 A;  3CD6 T;  1VQO Q;  1Z9Z A;  1D1A A;  2G6F X;  1FMK A;  3NTI A;  2M51 A;  1UFF A;  1WZO A;  3M54 A;  2DL8 A;  3BE3 A;  4QVZ A;  1B34 A;  1EZZ B;  2JNG A;  3IQL A;  4RTX A;  1NYF A;  2MYS A;  1YJ9 T;  2L89 A;  4MMK A;  1YCS B;  2FPD A;  2KEA A;  2XG8 D;  1VQL A;  2A0F B;  2BZX A;  2EKH A;  4B6M A;  4M7D G;  2JOY A;  1I8F A;  5J26 A;  4PLI A;  1EFN A;  1WNL A;  4OGE A;  4A54 A;  2HD0 A;  4M78 D;  3CCU Q;  2VWF A;  4XU0 A;  3C95 A;  2HL3 A;  1VIE A;  5IH2 A;  1WGS A;  1BK2 A;  2GCX A;  1Q82 U;  2RQT A;  4XTX A;  1LCK A;  4KGX B;  4M77 G;  1XNI A;  3DKM A;  1VQM A;  2ECZ A;  1NLP C;  4M78 E;  3INZ A;  2LCC A;  1FX7 A;  2VVK A;  4J8O A;  4E6R A;  1VQ7 A;  4E7I A;  1K73 U;  3VKI A;  3CCL Q;  4QKU A;  2I2L A;  4ANJ A;  1VQ9 Q;  2RJC A;  2DA9 A;  3JSC A;  4L59 A;  2LQK A;  1K9A A;  4RTW A;  4E7L A;  4X9D A;  2OAU A;  3TVT A;  2EIF A;  4JJB A;  3V8L A;  1SF9 A;  3RMQ A;  2OTL T;  3EHR A;  2QGF B;  2QA4 T;  3JB9 D;  2M9U A;  1WA7 A;  3PMI A;  3QYH B;  2HZY A;  1UG1 A;  1JJ2 A;  1T3L A;  3CPW A;  3VV0 A;  3TRE A;  3OYG A;  2BKD N;  3M0S A;  3CC4 A;  1QMC A;  4HVW A;  2GTJ A;  2R5A A;  3RMS A;  4M7D B;  1C6V X;  3QZ5 B;  3ZBD A;  4M7A D;  2KSS A;  1Q81 C;  2LJ1 A;  4OMF B;  3RER A;  2ZPE B;  1PNJ A;  3EFS A;  3A98 A;  1QVF P;  2V8I A;  2OTJ A;  3HFN A;  3CME Q;  2DBK A;  2IIM A;  4M7A E;  1B7T A;  2DF6 A;  3EG1 A;  2CH4 A;  3JAM E;  3JB9 I;  5EC7 A;  2ED1 A;  4OMN A;  4R55 A;  3T9N A;  4LD6 A;  1RLP C;  1E6H A;  1G83 A;  2H8H A;  4EDU A;  3G6E T;  4VUB A;  1BI0 A;  3I55 Q;  1YIT Q;  3A8H B;  3PE0 A;  1M90 U;  2YLB A;  3VYG A;  2JTM A;  1ZA2 B;  4PJO A;  3ER0 A;  4A4G A;  3HRT A;  2AHJ B;  3QZ9 B;  5IXF A;  5KE3 A;  1ZA1 B;  1M2V B;  1PHT A;  3X20 B;  3CMA A;  2V1Q A;  3CBO A;  4AT1 B;  1SG5 A;  3OYM A;  3HSB A;  3TSW A;  5A0L A;  4C5E A;  1VQ6 Q;  2XHC A;  1YIJ T;  2R5M A;  2MCN A;  3EGX A;  1OX8 A;  3H8Z A;  2L8D A;  2J05 A;  2FRY A;  1I5O B;  3QUI A;  3G71 T;  4FT2 A;  3PVL A;  2LRQ A;  2E41 A;  1G8X A;  2LX9 A;  2DIQ A;  2CP0 A;  3C4S A;  1G3W A;  2E12 A;  4X1V A;  3MJX A;  2ZZD A;  3LYI A;  4EMK B;  2E10 A;  3H9N A;  2FL7 A;  2F2X A;  2DRK A;  2HMA A;  4WCI A;  4J9F A;  3LGL A;  2XD0 A;  3RUX A;  5GAN 4;  2CP7 A;  2J7I A;  1GCP A;  2LZ6 B;  2PUK B;  3OSV A;  2HDA A;  2VXF A;  2EFI A;  1UEB A;  1X6B A;  4AMC A;  2KBT A;  3NMZ C;  5CR2 A;  3UAT A;  4IUU A;  3M9Q A;  3CCV Q;  3GNG A;  2DD5 A;  2DE0 X;  1ZX6 A;  2M02 A;  1LVK A;  1BI3 A;  1KSW A;  1N6A A;  1UB4 A;  1EIF A;  1WYX A;  2HBW A;  4C92 A;  3MPU B;  1M1K U;  1D3B B;  4F14 A;  5GMK m;  3M57 A;  4QQD A;  4CRI A;  3CC7 Q;  2QEX A;  3O5Z A;  4QVD A;  3A8G B;  3I9Q A;  3EGD A;  2EWN A;  3CEY A;  5I22 A;  1XQH A;  2Z0W A;  4M75 E;  2CH4 W;  1RAD B;  2KYB A;  4FW1 A;  4CI0 C;  1G3S A;  2EYQ A;  1U06 A;  2CSI A;  2EBP A;  2E5Q A;  3H6Z A;  3HRU A;  2BIV A;  1I81 A;  2PVD B;  3UA7 A;  4PJL A;  3GOX A;  1VQO A;  1MND A;  3VS7 A;  2MPX C;  3SDZ A;  2AKL A;  2FRW A;  1VQL T;  3M0R A;  1VQN Q;  1M2O A;  2W10 A;  1X27 A;  2V8J A;  2CYZ B;  2A08 A;  4BE2 A;  1X01 A;  3ZL7 C;  2COW A;  1VQK Q;  1IHW A;  4BI3 A;  2RF0 A;  5GMK e;  1TH7 A;  3TQ7 P;  3I56 Q;  4L6V 5;  3M0P A;  1SKU B;  4FIB A;  1G5V A;  2A37 A;  3CCU A;  1VQ7 T;  1XTD A;  4BI8 B;  4JJC A;  2K4Y A;  4J6W A;  2XMF A;  3JCM g;  1XJW B;  2YDL A;  5CO7 A;  3UA6 A;  2JTE A;  1OX9 A;  2H3J A;  3MP8 A;  4IUQ A;  1Q86 R;  4BDZ A;  3JCM b;  3X24 B;  5I11 A;  2K2V A;  3A8L B;  3LLR A;  4E2F B;  1VYT A;  1WHJ A;  1Z9Q A;  3CCL A;  1Q82 C;  3VS4 A;  2JT4 A;  2RK1 A;  3NHN A;  3TCJ A;  1VQ9 A;  2KAF A;  2ZPI B;  1UJY A;  4HCC A;  2KRO A;  3CC4 T;  1AZG B;  1WIE A;  1BIB A;  1M27 C;  2E6Z A;  1JXO A;  3RIR A;  1HJD A;  3A5Z B;  1AEY A;  1K73 C;  2CS7 A;  4JZ3 A;  2VAS A;  3H0F A;  4PLL A;  3X26 B;  2JS2 A;  5FWB A;  3JCM f;  4QQG A;  3OBY A;  4C8Q C;  1D1C A;  2OTJ T;  1FMW A;  2RI5 A;  5DM7 R;  1PWT A;  2H3E B;  4XQ3 A;  2EGE A;  3LX7 A;  5KCH A;  2J06 A;  4M7D A;  2NUT B;  5I21 A;  1NEG A;  3VS0 A;  4C5G A;  1JO8 A;  1MV0 B;  2KRM A;  2KY9 A;  1CKA A;  3PTA A;  5GMK j;  2LT1 A;  3CME A;  5FW9 A;  4FYW B;  1IXD A;  2QQ9 A;  1K0S A;  5FU6 C;  2FPF A;  3OS5 A;  1VQ8 Q;  4LDU A;  2VYT A;  2K6D A;  1MV3 A;  1LJO A;  1KQ1 A;  4D6W A;  3P8B B;  4DOW A;  4F04 B;  3BW1 A;  4JJN K;  3JCM P;  1OI1 A;  2DXB A;  4HCB A;  2NWM A;  1KG1 A;  3CMA T;  1I4K 1;  2YUN A;  4MDW A;  5HK3 A;  2D8H A;  1OPK A;  4E7J A;  4LUD A;  4F7U B;  1PKS A;  2NLU A;  2O4X B;  2GTO A;  1UE9 A;  1QVF S;  1KJW A;  1OPL A;  3OYB A;  1OZ3 A;  1M2V A;  3EFR A;  3CCE A;  3CCR T;  2YUQ A;  3OSS C;  2JN0 A;  2F2W A;  1M90 C;  4J9E A;  1AD5 A;  5CKB A;  4EMH A;  4KUL A;  2QAS A;  2XID A;  4LD9 K;  2P4T A;  5GAM g;  1VQ6 A;  2KGT A;  2DXC A;  3CCJ A;  4FT4 A;  2HBP A;  4M78 F;  1S72 Q;  2F5T X;  2K3Y A;  2P0P A;  3LWI A;  1BCO A;  5LJ3 g;  4PFZ A;  1VUB A;  1SPK A;  1M3B A;  2DL7 A;  2DTH A;  2DTO A;  1I5L A;  4EPC A;  4J7I A;  4A4F A;  1WLP B;  5J3B A;  3HL8 A;  2EGA A;  1QWE A;  4ZGJ B;  3EG9 B;  1M9S A;  2KVQ G;  2EW3 A;  3GNF B;  2YUP A;  3RKW A;  1VQ4 T;  2DX1 A;  2QGG A;  4EMK A;  2EKO A;  5GAM f;  2CUB A;  3NGP A;  1Q81 R;  2YWW A;  1QKX A;  5IN1 A;  2KT1 A;  1E6G A;  2E3H A;  1GBR A;  2EAY A;  3A8O B;  2L3S A;  3PVQ A;  4KUD K;  4QW2 A;  5LJ3 f;  3UDC A;  3JB9 F;  5AYF A;  1GBQ A;  5KYX B;  1BB9 A;  3BDL A;  5GAN 8;  1FYN A;  3FC3 A;  3M4Y A;  4KRT A;  2CUD A;  1ZQ1 A;  1PKT A;  5KYY B;  2QG9 B;  2DZC A;  2X3W D;  2EQU A;  3CXC P;  2QEX T;  4DOV A;  4M7A F;  2EQJ A;  1LNX A;  3SFM A;  1JBM A;  1D3B A;  3RES A;  3N5B B;  2F69 A;  2L5Q A;  1TTH B;  1VQ5 A;  1TUG B;  3H41 A;  1WDX A;  1VQO T;  4DBR A;  2LJ3 A;  3CC7 A;  4DQ2 A;  5GJV B;  4GLK A;  1M1K C;  2RQR A;  4DEX A;  2VUB A;  1TWB A;  3AHU A;  4ATO A;  3U23 A;  4JJD A;  1M8V A;  4ZN1 A;  2AZV A;  1X2K A;  4PJO C;  3S6W A;  2FZK B;  1QWF A;  1OOT A;  3QYG B;  3UT1 A;  4DEY A;  2GQI A;  4D8D A;  2BZ8 A;  3QKJ A;  4PK4 A;  4ZGE B;  1ZBX A;  5FRN A;  3CCU T;  1VYU A;  2A28 A;  2MF2 A;  2YRC A;  3CD6 Q;  3JRZ A;  4QVC A;  1KC8 U;  4V2S A;  3HP9 A;  1ZLM A;  2RI2 A;  2HKQ B;  3JV3 A;  2LNV A;  3I56 A;  1ABO A;  4IIO A;  3OW2 S;  3DB4 A;  4HKE A;  2MAM A;  2QTX A;  3VS6 A;  2MK5 A;  3L42 A;  1YJ9 Q;  3JCM h;  3CCL T;  1M1F A;  1MHN A;  4JUV A;  3DLL A;  1VQ9 T;  2F5K A;  3S3N A;  4IIM A;  4B9W A;  2RQW A;  4KT0 E;  2XKO C;  2YRD A;  1RAF B;  5I2M A;  2M0O A;  1VA7 A;  2FYK A;  3J7A F;  1X6O A;  4AFZ C;  3R6O A;  3M0Q A;  5CK9 A;  5LJ5 g;  3TEE A;  1XOV A;  4BY6 B;  2CZ7 B;  2P84 A;  2VGN A;  1S1N A;  4OB0 B;  2QDL A;  4C0Z A;  3E9F A;  3X28 B;  1N8R U;  3G7Z A;  1R0C B;  2KT8 A;  1X75 C;  1K8A R;  3VS2 A;  4B9X A;  4KH1 B;  1V29 B;  5A0G A;  2K57 A;  1MUZ A;  5KYN A;  4C8Q D;  2PZ1 A;  2CP6 A;  2DMO A;  2DYI A;  1YI2 A;  2GGR A;  2WSC E;  1K0X A;  3CME T;  4LDW A;  4C92 C;  3L1A A;  1Y0M A;  5GAN 2;  1BYM A;  2NUT A;  2COZ A;  2CZ0 B;  3PIP A;  1JJ2 P;  2EJF A;  4FYY B;  2DPP B;  5GAN g;  4C8Q E;  5LJ5 f;  3REA B;  1PSF A;  4M77 B;  2DVJ A;  1FXX A;  2D1X A;  4IUT A;  1NJI U;  5KH6 A;  3QO3 A;  3EFO B;  4M75 F;  4M78 G;  1E7O A;  2RK2 A;  4RTV A;  4R56 A;  1UGS B;  1QW1 A;  2CRE A;  3JCM Q;  1B3Q A;  4JRP A;  1VQ8 A;  1QCF A;  1WHG A;  5HKC A;  3LH5 A;  1NPP A;  3A1P A;  5GMK h;  3OY9 A;  3QII A;  2CP3 A;  1I1J A;  1NE8 A;  2AK5 A;  1ZSZ B;  2DYB A;  1MMG A;  2EJG A;  3ULR B;  2DTI A;  2HNI A;  3RKX A;  3CCE T;  3OYN A;  1W4S A;  2R57 A;  2QK0 A;  5GAN f;  2X3X D;  1UGP B;  2K7A A;  1ZUY A;  4JRI A;  3L2W A;  3JCM J;  4P5N A;  4F7U A;  4FM4 B;  2O4X A;  2DXT A;  3CCJ T;  2LDM A;  1K9M U;  3CCQ Q;  4AFU C;  4C0D B;  3G6E Q;  3ZEH A;  3JB9 G;  4JRK A;  4N4G A;  1CKB A;  2GFU A;  3EAE A;  1YBY A;  3FJ5 A;  2HSE B;  5GAO p;  4JS5 A;  3OYK A;  1BIA A;  1QVG S;  2DNU A;  4FL6 A;  2L3P A;  2EQI A;  1KD1 R;  1YJW T;  3NPF A;  4M7A G;  4M78 B;  1Y7X A;  2PQW A;  1SSH A;  2JTF A;  2LC4 A;  4CC4 B;  1HXD A;  1M3C A;  3BY7 A;  4IUR A;  2QYZ A;  5L8R E;  1YIJ Q;  3EG9 A;  2HKN A;  3SD4 A;  4Y91 A;  1N9S A;  2KXC A;  2ABL A;  4WTO B;  1M1G A;  2Y4X A;  1SHG A;  1PRM C;  2V26 A;  1D0Z A;  3JCM e;  2PU9 B;  4OP0 A;  4N4I A;  1KK7 A;  2O9V A;  1TXQ A;  3PT9 A;  3JCM V;  5FRO A;  3G71 Q;  4BE0 A;  3AT1 B;  4OB1 B;  1WJS A;  2DAQ A;  3V8J A;  2EJ9 A;  3E9G A;  2LQN A;  3EG0 A;  4HT9 A;  4A63 B;  3WVD B;  4A4K A;  3MEU A;  5KYX A;  4M7D C;  2ZPB B;  8ATC B;  1R0B G;  3QBY A;  1VQ5 T;  4J7F A;  4XU1 A;  5I2S A;  5KYY A;  1RL2 A;  4Y92 A;  4OB2 B;  3CPF A;  3CC7 T;  4OGC A;  3QSU A;  3KUF A;  3URG A;  2FPE A;  2NUZ A;  1RAG B;  4F16 A;  2QAZ A;  3OB9 A;  2D6F A;  2C0T A;  4M77 C;  3VRY A;  2PUO B;  4IUP A;  4M7A B;  2Y4Y A;  2O31 A;  2JVV A;  1TUC A;  2L3Q A;  3M0T A;  2D0N A;  4QQ6 A;  2RHY A;  2DZ9 A;  3OYC A;  2RB6 A;  1QP3 A;  3OQ5 A;  2LJ0 A;  3OW2 P;  2K5F A;  4C5H A;  3ME9 A;  3A8M B;  2BE7 D;  2HQH A;  3D7S B;  5CCA A;  3J81 E;  1TS9 A;  3OYF A;  2GNC A;  4L5G A;  1RAI B;  4FYV B;  3R6N A;  3CXC S;  4PJO D;  1KHC A;  3FB9 A;  2QQB A;  3MP1 A;  5KE2 A;  1WX6 A;  1OQK A;  5GAN 3;  1UHF A;  3I56 T;  1IRX A;  2J6K A;  1OYX A;  3NFC A;  4OMP A;  4KBM B;  2VKN A;  3G4S Q;  3OMC A;  1JB0 E;  4PJO E;  2KK4 A;  2DER A;  2DFU A;  2ENM A;  3O8V A;  3RR6 A;  5IHK A;  1O9S A;  3HRS A;  1VQM T;  5GMK i;  3JB9 H;  5CVI A;  1M5Q 1;  4RUG A;  1VQL Q;  5D6X A;  5IXB A;  2E65 A;  3JCM d;  2YUO A;  5LL6 S;  4HCK A;  1KC8 C;  2VGM A;  2WSF E;  4CC7 A;  1UJ0 A;  2AKK A;  4M75 G;  5GAM e;  1WHM A;  3FRN A;  4WF2 A;  3Q1J A;  1Q7Y U;  3I35 A;  8AT1 B;  4EMK C;  5C0M A;  5LJ5 h;  2X51 A;  5LJ3 e;  3L2R A;  2DK3 A;  4E47 A;  3M55 A;  2FB7 A;  4PKC C;  2GQV A;  1H3Z A;  1GFD A;  2EVR A;  3ZFJ A;  1YI2 T;  3V7C A;  3SWN B;  4RCC A;  2PTK A;  2GFA A;  2LVM A;  1I07 A;  3MET A;  4OMM A;  1HD3 A;  1BBZ A;  1D09 B;  4LDX A;  4XU3 A;  1H3H A;  3BDU A;  2E64 A;  2JM8 A;  3CCM Q;  5GAO r;  1W2B A;  2DL3 A;  2RA2 A;  1M4Z A;  3OYJ A;  4BAC A;  5AT1 B;  2V8K A;  4C92 D;  3OYE A;  1J3T A;  1QCN A;  3SHW A;  1IO6 A;  5GJW B;  2BTT A;  5CIU A;  1N8R C;  3CCS Q;  4BB7 A;  1H64 1;  1VQ8 T;  1HYO A;  2JXB A;  4M77 A;  2K9G A;  2B8A A;  4C92 E;  1H8K A;  4JLI A;  1CSK A;  1JEG A;  2XDP A;  3EFO A;  2RI3 A;  4QT7 A;  3VRZ A;  4X34 A;  4ZTF A;  4JLG A;  3QWX X;  2OTJ Q;  4M75 B;  4Z88 A;  5FU7 B;  4MZM A;  3I5R A;  1NM7 A;  1DJ7 B;  2VB6 A;  1ARK A;  1QVG P;  2YXY A;  4DA4 A;  2CT4 A;  7AT1 B;  3VUZ A;  3I55 A;  1NJI C;  1YIT A;  4AFQ C;  2EGC A;  1ZSZ A;  1YJN Q;  2XIC A;  2HEQ A;  3OYA A;  5GAM j;  4OML A;  3VS5 A;  3JCM c;  2IPO B;  1JJ2 S;  2NYS A;  3CPW S;  2EYX A;  3M59 A;  2L0A A;  1RAA B;  3CC2 Q;  3NTH A;  2YLC A;  5LJ3 j;  3OYI A;  1WFW A;  4X9C A;  1WXU A;  5GAM d;  3CCQ A;  4CC3 A;  3MKD A;  2SRC A;  2ZPG B;  4JDS A;  4BUG A;  4LDV A;  2FO0 A;  2F2V A;  1AWJ A;  3GP8 A;  1WJQ A;  2YRV A;  2DIG A;  5LJ3 d;  3MHX A;  4YTL A;  1U1T A;  1WQ7 A;  1O75 A;  3EH2 A;  5HCK A;  1K9M C;  2VV5 A;  5GAO m;  2DRM A;  4CC2 A;  4M78 A;  5J39 A;  4Z8A A;  3CCR Q;  4E7H A;  4A4H A;  1PCX A;  1TSF A;  1VQP Q;  1AZE A;  1D1B A;  2DKG A;  4ZNX A;  2ESW A;  5DLQ E;  1YIJ A;  3L2Q A;  4N0A A;  1P92 A;  3L2V A;  4Y28 E;  1LOJ A;  2DL5 A;  2YSQ A;  1R8O B;  1M8M A;  2EPD A;  2KDS A;  2K2M A;  4J9C A;  3HTR A;  1G3T A;  4KH0 B;  1JU5 C;  1IHV A;  3CCV A;  1BCM A;  1AHJ B;  2J6F A;  3REB B;  5LJ5 e;  4J9D A;  4M7D D;  3QHS A;  2LTO A;  1RUW A;  1YCY A;  2HSP A;  1VQ4 Q;  1JQQ A;  4C8Q F;  3GIB A;  1D0X A;  2RN8 A;  4PJM A;  2DBM A;  3LW5 E;  2O9S A;  1YHQ Q;  1K8A U;  4M7D E;  3LH0 A;  4M77 D;  3QDF A; 
#chains in the Genus database with same CATH homology
 1VQ7 Q;  1VQ6 Q;  1VQK Q;  2QA4 Q;  1S72 Q;  1Q7Y R;  3G6E Q;  3CCJ Q;  1KC8 R;  1VQ5 Q;  1KQS P;  1K8A R;  1VQ9 Q;  2OTJ Q;  1YJW Q;  3G4S Q;  1K73 R;  1K9M R;  1N8R R;  3I56 Q;  3CXC P;  1Q86 R;  3CC2 Q;  1M1K R;  1M90 R;  1YIJ Q;  1Q81 R;  1VQ4 Q;  3CC4 Q;  3CCV Q;  1VQO Q;  1NJI R;  3CCS Q;  1QVG P;  3CC7 Q;  1YJ9 Q;  1Q82 R;  3CCE Q;  1YI2 Q;  1VQN Q;  3CCR Q;  1YHQ Q;  2QEX Q;  3CD6 Q;  1VQM Q;  1YJN Q;  1W2B P;  1VQL Q;  3CCM Q;  1VQP Q;  3I55 Q;  1KD1 R;  1JJ2 P;  1YIT Q;  1VQ8 Q;  1QVF P;  3CME Q;  3CPW P;  3CCL Q;  3CCU Q;  3OW2 P;  3CMA Q;  3CCQ Q;  2OTL Q;  3G71 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...