1NJIR

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1njiR00
2OTJQ 1VQ5Q 3CC4Q 3CCEQ 3I55Q 3CMAQ 1KQSP 3I56Q 1M1KR 1W2BP 3G4SQ 3CCLQ 1NJIR 1N8RR 1YI2Q 1YJWQ 1VQLQ 1YIJQ 3CCVQ 1VQOQ 1KC8R 1M90R 3CXCP 1VQKQ 1YITQ 3CC7Q 1K8AR 1K9MR 3CPWP 3G6EQ 3CCSQ 3CCQQ 3CCRQ 1S72Q 1Q82R 1VQ9Q 3CCMQ 1YHQQ 1QVFP 1VQ6Q 1Q81R 1KD1R 1VQMQ 3CCJQ 1QVGP 1Q86R 1VQ7Q 3CC2Q 1JJ2P 3CCUQ 1VQPQ 3CD6Q 1K73R 2QEXQ 1VQ8Q 1Q7YR 1VQNQ 3G71Q 3CMEQ 2OTLQ 1VQ4Q 1YJNQ 1YJ9Q 3OW2P 2QA4Q
chains in the Genus database with same CATH superfamily
3JV3A 1PD0A 5KE2A 3C4SA 2KQWA 1KHIA 2EQIA 1LVKA 2LX7A 4BUGA 1Q86U 2YLBA 3BDUA 3ZFJA 3HL8A 3OSSC 1PCXA 2LJ0A 2XK0A 2YUQA 3QXEB 2ECZA 3M0TA 4LXCA 2LP5A 3IQLA 3JB9G 1CKAA 3QYHB 4L5GA 1VQLA 3PT9A 1IRXA 1D09B 2DK3A 1M27C 2FHDA 2EBPA 1S72A 2C06A 3M0RA 1N9RA 2VC8A 2J6FA 4NS5A 2DYBA 3CCJT 1W2BS 3I9QA 3QJ6A 2XHCA 4E47A 2W10A 1E6GA 3BY7A 1K4US 2O01E 2DEQA 3J81E 3OYJA 2OTJA 1QKXA 3MJXA 2JMAA 2RJEA 2OTLT 1IXDA 1QKWA 3LW5E 1KIKA 2V8KA 2A37A 2DL3A 5IN1A 1BCMA 4RTUA 1I1JA 1UJYA 3M0UA 1YCSB 3M57A 3A8OB 4J8OA 2CUBA 2MIOA 4HCCA 2DERA 2RQWA 3CC2A 1QMCA 3FIFA 2OJ2A 4PL6A 2RI3A 1J3TA 3CC4A 3CC7T 1A0NB 2VKNA 1QQJA 2A36A 3EH2A 4ELZC 2DL7A 1UDLA 3NTIA 2K9GA 3WXMB 1W2BA 2CS7A 1X2KA 2CGHA 2O2OA 4PJOD 4J7FA 1MMNA 1RLPC 2ZPFB 4J6YA 1ACMB 5EC7A 5LJ5j 3CXCS 1MGQA 1NLOC 1W4SA 3FB9A 4M77C 2GF7A 1BCOA 3A1PA 1WYXA 2D8JA 3TSZA 1VQPQ 1T3SA 3EG3A 2V8JA 3VU3C 2QG9B 1OX8A 2W0ZA 2O4XA 1WJSA 1TUGB 2AHJB 2RI2A 3GIBA 3QDFA 1E7OA 4A4FA 3RIRA 2ZPIB 2XKOC 2QK0A 4JDSA 2X4XA 1M2VB 3LYIA 4QQGA 5ECAA 4J9GA 1VQPT 3JCMf 1AZGB 4MMKA 2ZPGB 3QZ5B 4M7DE 4AMCA 1K9MU 3A98A 3MP8A 4M7DD 3QWYA 3S3MA 3CCVA 1UGSB 3EGXA 4M7DG 8ATCB 5KYNA 1VQMT 2E4HA 3EG9B 2ATCB 3V8KA 1VQ8T 5GMKh 2IIMA 1FYNA 3I55A 2COZA 3SWNC 2FPDA 3EHQA 1NPRA 1QW1A 4M75G 3G4SA 5HK3A 3VJPA 3GNFB 3G71Q 3QZ9B 4MZMA 1OOTA 5GAOl 4HKEA 4M77B 1XTDA 1NYGA 4FW1A 4RTXA 2V1QA 3JCMX 4BE1A 3LX7A 2RI5A 8AT1B 1GFCA 1VQ6T 3G7ZA 2DBMA 4FW2A 4LDUA 2K5FA 1RAGB 2D6FA 4HCKA 3VV0A 5CK9A 3HPWA 2DTHA 3VRYA 1IHWA 1XJWB 2HAXA 2EKOA 2K7AA 4OGEA 2DM1A 2DILA 2RHZA 5CO7A 2QQBA 3QSUA 1VQ9T 2RD1A 1GXIE 4AFQC 2DPPB 1MMAA 1RI9A 4C92D 3CCRQ 5DLOA 3GP8A 1ZX6A 1K0XA 4ORZA 4C0DB 3M53A 1N6AA 2E5QA 2DKGA 5FRNA 2XMFA 2RHYA 2LCSA 3CBPA 2AKKA 3RUXA 3VS3A 3S3OA 2QI2A 2PU9B 2A28A 4R55A 4EMKC 4B9WA 4QQ6A 3L2RA 1KQ2A 1AZEA 2JZ2A 3FDRA 4OMQA 2D0QB 2QEXQ 1K76A 1HYOA 3EHRA 2K2MA 4JZ3A 1KQSP 5IHNA 1SHFA 5CKEA 5GAN2 2QASA 4XTVA 1VQ5A 1QVFP 1UB4A 1M5Q1 2CZ0B 2Z0WA 3EG2A 3HHTB 2NUPA 1SG5A 3TU4K 1QVGA 3VS1A 1RADB 4WF2A 4M75C 4EMHA 4HT8A 1BK2A 1S1NA 1M30A 5GAOn 1QP3A 3TCJA 3KXTA 4M75D 4OMNA 2VVKA 4C92A 2DYIA 2VASA 2KRNA 5FLXE 6AT1B 3REAB 5GMKe 5GANj 1K73U 4M78E 3OYNA 4AFUC 2K79A 1YIJA 4VUBA 3DLMA 2XIDA 2PVGB 4M78G 2WACA 5IXBA 4ZGJB 3A5ZB 1VQ5Q 5I22A 3CCQA 3I55Q 4J9DA 2JOYA 3MKDA 3UDCA 2B8AA 3OB9A 4IURA 2JUFA 1UEBA 1ZUYA 4OVAA 5C0MA 3HSBA 1IGQA 3JCMW 3ZL7C 2VWFA 2YT6A 3SEMA 2RN8A 1GFDA 1ZSZC 3UPUA 2CP5A 2LCLA 1YJWQ 3E9GA 3L2ZA 1YJNA 2QGGA 2GQIA 2A3LA 3M0PA 2B86A 2DJZA 4D8KA 1QVGS 4N4IA 1XOVA 2KGTA 2EKHA 3KFVA 2DD4A 2BE9B 2P4TA 3SDZA 1H641 1WHJA 2KROA 3UA7A 2NUPB 2RQUA 1IREB 1JU5C 4MDXA 1RAHB 4C8QG 1TH7A 3INZA 5LJ3f 2OAWA 2HZYA 4PJJA 3A8HB 1VQ8A 4C8QE 3CCQQ 1WHHA 3HFOA 5GAN7 1FMVA 1Q86R 4M7AD 1VQOA 4RUGA 2LQ8A 2DAQA 4LDVA 4M75B 1TUDA 4OB2B 2EPDA 3UA6A 2QA4Q 4ZN1A 4LDYA 4C0GA 2K3YA 1UFFA 2MYSA 1W2BP 3I5SA 4DOVA 3KUFA 4KUDK 2LC4A 2G6FX 3V7RA 3VS4A 3V8LA 2QEXA 2P0QA 2HBPA 1HJDA 4C0FA 3VYHB 2D8HA 4E7KA 1QVFA 3OYHA 1T0JA 5A0GA 1K0SA 1VQKA 1IO6A 1M8MA 2HCKA 2DRKA 1UHCA 1YI2A 3MEUA 5FU7B 1ZA2B 2F69A 4KH1B 1D3BA 2K5IA 4J9EA 5A0LA 1RUWA 2LMJA 4QVCA 7AT1B 2L2PA 3CC7Q 2EFIA 4N4HA 1VQMQ 2HEQA 2SEMA 1OU9A 5GAOm 2E5KA 4EIKA 2HQHA 1G3TA 4L6V5 1VQ8Q 4R0KA 1R0CB 4AG1C 4BDYA 2QGFB 2RB6A 2BZ8A 4C0DC 4JS4A 2E3IA 3MHXA 1D0YA 4N0AA 3MEAA 3CQTA 4V2SA 2ABLA 1VQKQ 2KK4A 3OW2A 1U8RA 1YI2T 1PWTA 1U06A 3CCET 4ZGDB 3RESA 5FWCA 1N8RC 4M78D 1WGSA 3S6WA 3C94A 2XD0A 3CCJA 1T0HA 5CAIA 4LDWA 4Z89A 1G3SA 1EIFA 4PFZA 2RH2A 4IUVA 4BACA 2ZAEA 2HSPA 1M8VA 2OTLA 2KEAA 1VYTA 2JM8A 2CP7A 5EG2A 1TS9A 3R6OA 2LNVA 1VUBA 5IHKA 4QT7A 4HA8A 1PKSA 4BE2A 2HKQB 4JRKA 1GRIA 2JJ9A 3CCRA 2LQWA 1Q82C 2DRMA 1GCQC 2LQNA 2L3PA 3PFSA 1M1GA 3C12A 3Q1JA 1VIFA 5FWBA 5I2MA 1TOVA 2J6OA 5HY6A 1S72Q 4PFPA 4M4ZA 2KRSA 3GLXA 2NUZA 3UWNA 3JCMd 4JZ4A 3E2UA 3URGA 1VOMA 4RTWA 1D1AA 2HBWA 3ZEHA 3OYEA 3MPUB 4CC2A 1AWXA 2L5QA 2IG0A 2J06A 5GAMg 4HXJA 2K4YA 4PLLA 3JB9D 1K73C 1Y57A 2JMCA 3FLGA 4A4HA 1G2BA 3UF4A 3E9FA 3R6NA 1AEYA 5FU7C 4ZGEB 1WDXA 1M3AA 3OS2A 1GCQA 1X27A 3OS1A 3OA6A 2DF6A 2L3QA 2DZ9A 2YUNA 2GGRA 2ZCFB 2YRVA 1I81A 4E7LA 3SWNA 2K6DA 2E70A 2LCCA 1PSFA 1WHLA 2HQXA 4PJNA 4RCBA 1PSEA 4KT0E 1UG1A 1AOJA 4E7SA 3LGFA 3PVQA 2KXDA 1VQ6Q 1BI2A 1KK7A 4M77F 1KC8U 1JEGA 4Y91A 3CCVT 3I56A 2E64A 1VQ4Q 5IXFA 1Q81C 2KSSA 1W70A 1VQ7T 3CMAT 4XU2A 4D6WA 1Z9ZA 1OEBA 1DJ7B 1FMWA 4HVVA 1UHFA 1FMKA 1UE9A 3HRSA 2CP3A 4KH0B 3N5BB 3I55T 4LD6A 3QPHA 3O5ZA 1UGQB 5LJ3e 1MV3A 1B3QA 2MCNA 1AVZC 2XDDA 4CC7A 1VQ6A 3OYMA 4KGZB 4JLIA 1UGVA 1N5ZA 3LLRA 2OX7A 3OYDA 1K9MR 5KCHA 3SWNB 3PTAA 1BI0A 4Z8AA 4E7HA 1C0MA 2PUOB 1HK9A 1D0ZA 1G3WA 2WSCE 5GAOr 3OYFA 1ZSZA 4XK8E 3LGLA 5HCKA 2OTJQ 3JB9H 3WVEB 2CH4A 3OS0A 3VS6A 3RNJA 5KYYA 4HT9A 1MHNA 4OB1B 4HCZA 1B34B 1VQOQ 2CZ7B 4IUUA 2EWNA 4X34A 3H0IA 3JRZA 3CPWP 4WTOB 2ROLA 1X43A 2Y4XA 1WX6A 2A08A 4PJLA 4XTUA 4HCBA 4WCIA 5CKHA 1ZUKA 2EAYA 4MZPA 1WPYA 4EMKB 1XNIA 3JSCA 3JB9I 3CCRT 1WA7A 1AWJA 3H8ZA 5GAN3 3JCMJ 2FZCB 4A54A 3EGUA 2DL4A 1M2VA 4II1A 4QVZA 4CC4B 2EYZA 3NFCA 2JN0A 5GJWB 4M7DC 3F70A 2RPNA 1IHVA 3MEVA 2DIQA 1Q7YR 2AT1B 3QJYA 1M3CA 3E1SA 4M75A 1TU0B 1EX4A 1EFNA 2OTJT 1MMDA 1N8RR 2DJQA 3EG9A 2M9UA 2F2VA 3FJ5A 1SKUB 4AG2C 4EMGA 2SRCA 2P0KA 2PZ1A 4D8DA 3CCUT 1JJ2P 2EYXA 2VGMA 3CCLA 3H6ZA 1PRLC 2K3XA 1ZLMA 2RJDA 3VUBA 1JBMA 1YJ9T 4C0ZA 2LRQA 1BIBA 4MMLA 2WSFE 1VQNA 2DX1A 2JTMA 4PFOA 3HFNA 1H92A 5KH6A 1NZ9A 1PG5B 1TWBA 4RTYA 1YITT 4F14A 3OYGA 2ZPEB 3CMEQ 1SRMA 3NPFA 2F2XA 1KJWA 5KYWA 3OW2S 1FX7A 2GQVA 1SSFA 2LZ6B 4OF1A 1BBZA 3CCQT 2YXYA 5CKFA 4C92C 1U1TA 4IKFA 3OYBA 5D6YA 2AKLA 4ZN3A 2HDAA 4F7UE 2FO0A 4BE0A 1I0CA 1W6XA 4PJOE 2BUDA 3PMIA 2KE9A 3OW2P 1YBYA 1Q7YU 3G1JA 3M5AA 2VYTA 5LJ3d 4NL3A 2COWA 1X01A 2QQAA 4KGVB 1KD1U 2F5KA 1Z9QA 4J9HA 3JCMQ 2GFUA 4E7IA 4XTXA 3CPWA 2GTJA 5M9OA 2BZYA 3MP6A 3EFOB 3LH5A 3JCMV 2RJCA 3TVTA 3E19A 1UECA 2V26A 2M1HA 4KRTA 4KGXB 2LNHB 2L3RA 2L0AA 3O8VA 1R77A 2FPEA 4IUPA 2AZVA 1RLQC 2O9SA 2XDPA 1VQ7A 3CMEA 4DQ2A 5GANe 1P92A 4FYXB 4C5EA 4NL2A 3X20B 5GAN4 1PHTA 4PKCC 1NM7A 3A8LB 3OYYA 4A63B 2R5MA 2CP0A 2RHXA 2EQUA 5FRMA 2FEIA 4A4KA 1JXMA 2H3EB 1X6OA 4Y28E 4XQ3A 5LJ5g 1KG1A 3OY9A 2L89A 1Y96B 5CKDA 3L2QA 3BFMA 3GNGA 3LH0A 2KMTA 2KBTA 2PVDB 2QA4T 1WHKA 5D6XA 4C8QA 2DVJA 2JNGA 2RQTA 4EDUA 1M3BA 1VQ9A 1S72T 1QLYA 2MF2A 4KUIA 1WXTA 3M0SA 1KC8R 3G71T 2EYYA 3DLLA 3OYKA 1BYMA 2CUDA 1VQ7Q 4EPCA 4XTYA 1NLPC 1LJOA 1FXXA 4OB3B 2PVOB 4FYVB 1MUZA 5GAMe 1YHQA 2FVUA 4DBQA 5IH2A 2QA4A 2BZXA 3GPLA 2QTXA 1OZ3A 1YJ9A 1I5LA 1ABOA 1WHMA 2CREA 1SHGA 4A4GA 2R58A 1H3HA 3SFMA 2H3JA 2KR3A 2GTOA 4IIOA 4BI3A 3PNWC 3CC4T 3CC7A 1WXUA 1X69A 3CMAQ 4OMMA 2QYZA 2RK1A 1OI1A 4ATOA 4DA4A 2EW3A 2KAFA 3EAEA 4O6JA 3EH1A 4LUEA 1OU8A 2RHUA 3TEEA 4KULA 2CH4W 1OPKA 2KNBB 4P5NA 2RMOA 3TSWA 4J9FA 1OQKA 1KQ1A 3RBBB 2EGAA 3UATA 1VYUA 2FG0A 2YRDA 1RABB 4RTTA 4XTWA 1T3LA 3CCSQ 1MNEA 5L23A 2E6NA 5GANh 3BE3A 1VYVA 1HD3A 1QCOA 1VQ4T 1BI3A 5GAMh 2JS2A 1M1FA 3JCMg 1YITA 3X24B 4JLGA 2HL3A 3OMCA 1EZZB 1SPKA 1U1SA 4FM4B 4M7DA 5CR2A 2CT3A 4JPBW 4XU0A 2GNCA 2CP6A 2QDYB 5I21A 2J7IA 2O31A 5CVIA 4PLIA 4XAXB 4CI0C 3M59A 4M78F 1ZA1B 1AWWA 4FT2A 4M77D 5C6SA 1AWOA 2DIGA 1RAIB 1HSQA 2EJ9A 1LCKA 3EG0A 4GLMA 1V76A 2MWPA 2X9HA 3M55A 2ED1A 3DB3A 1YCYA 2AZSA 3SB2A 2OI3A 2CZ1B 3OBWA 5IHIA 1Y0MA 3CC2Q 2KT1A 3J7AF 1NJIC 4Q5WA 4LDXA 4J9CA 4E6RA 2LT4A 2C0TA 2MPXC 2XDBA 1KD1C 1AT1B 1K8AU 4JJNK 1YWPA 5LJ5d 2C0OA 3JCMh 3AT1B 4RG8A 5AT1B 1PD1A 1YN8A 1Q7YC 4M78B 3CMET 2DD5A 2E41A 2L8DA 2LJ1A 4C5IA 5DM7R 4C92F 5GANg 3HP9A 2E10A 2LT1A 2ESWA 2BTTA 1ZSGA 2FZKB 2L3SA 2IPOB 3LWHA 3OYLA 4M7AG 1VQPA 2YLCA 1I8FA 1R8OB 4M7AE 1O9SA 3FRNA 3L2VA 1VQLQ 2HD0A 5I11A 3L2UA 3CXCP 2PUKB 2J6KA 3VKIA 4FIBA 1M1KU 3TREA 1M90U 2F5TX 1WQ7A 3PE0A 1UGPB 2QDLA 2CDTA 4IUTA 2OTLQ 1KQSA 2JM9A 1VQLT 4OMPA 2COYA 1OYXA 1B34A 2KT8A 1WXBA 4HVWA 2HNIA 1KSWA 4F7UA 3OYAA 1D0XA 2E3HA 3M4YA 1TUCA 2KDSA 3G4ST 1Q81R 4M7DF 1H8KA 2I2LA 3DB4A 1VQ5T 3VRZA 1PC0A 4ZNXA 4C5HA 2YHTA 1UJ0A 3U23A 1G5VA 1YHQT 3ULRB 1VQKT 3CCEA 1MV0B 5CQYA 2JT4A 3CCMQ 1WNLA 4C92G 1Y07A 3CC2T 2DO3A 4FYWB 5LJ3j 3M56A 3G6ET 2DTIA 2NUTB 1RI0A 2EJFA 5J39A 2F1LA 1K9MC 4ESRA 3CC4Q 1OULA 2X4WA 5GAMj 2DE0X 2WSEE 4XU1A 4MZTA 3NMZC 2K2VA 2LVMA 5IAYA 1LOJA 5LJ3h 2DVEA 1BIAA 1MMGA 4DBRA 5DY9A 3PIPA 2MWOA 1NBEB 1K8AC 3GBQA 4X9CA 3VS2A 3EFRA 1G8XA 3CCEQ 2D1XA 1RAEB 2RK2A 4PJOG 3H0FA 1SF9A 3QUIA 5DLQE 1NE8A 4LUDA 4GY5A 1VQNT 1VA7A 2DEUA 2D9TA 3JAME 5I2SA 1X2QA 1Q82R 1YHQQ 1LNXA 5HK0A 1AD5A 3VS7A 2ZPHB 4DEXA 2QAZA 2DL8A 5FU6B 1KFZA 2JTEA 1YJ9Q 1PKTA 1B07A 1RAAB 4CC3A 2CT4A 2LJ3A 4PJOF 4JS5A 2DXTA 3RMSA 5J3BA 1WI7A 3MO8A 2RJFA 1XQHA 4MDWA 4X9DA 4N0AC 4C8QF 1JO8A 4QKUA 1KHCA 4ZTJA 1WHGA 1Q82U 1U3OA 1JJ2S 2DNUA 2X51A 3PMTA 3M9QA 2RA2A 2PTKA 3WVDB 2NLUA 2HMAA 2P4RA 1YIJT 2DZCA 1M9SA 1CKBA 2DFUA 2MI6A 3V7CA 2EQJA 4LD9K 3I56T 2J05A 1K1ZA 2MAMA 1GBRA 4LN2A 2K5LA 4XU3A 3EGDB 1I4K1 3X28B 5FU6C 3RERA 2DMOA 1LPLA 3FEOA 3H41A 1YI2Q 3S3NA 1M90R 5J26A 3EG1A 1C6VX 2A7YA 4OMOA 3P8HA 2HKNA 4PJMA 4Z88A 3VYGA 4DEYA 4OP0A 2PQWA 2G3RA 1KC8C 4TVRA 1UGRB 2FRYA 2KY9A 3BDLA 3EFOA 3OQ5A 1YJNQ 2RQVA 5LJ5f 3GF5A 2AK5A 2QTVA 1WQWA 1JRIA 2VGNA 2YRCA 4F16A 3HKSA 5FROA 1GBQA 3QO3A 1Y96A 2KRMA 2ROTA 2JS0A 2P84A 1YWOA 4O5VA 5FW9A 5KYUA 3CPFA 3CMAA 1JQQA 1NYFA 3CCMA 5L8RE 4ZTFA 2ZPBB 3TQ7P 3PIOA 3G6EA 5IT9E 3MP1A 2E65A 3ER0A 3CCST 4BY6B 2MOXA 3CCVQ 3RKYA 3L2WA 5GAMd 1ZBXA 2R57A 2GBQA 1UTIA 4PJOC 3G71A 1YJWT 1M1KC 4IUQA 4RG2A 4DOWA 5GAMf 5GAN5 4CRIA 4XTZA 1OPLA 1V29B 1M4ZA 2EYQA 5KYXA 2H8HA 2RHIA 1YIJQ 3JB9F 2Y90A 4JRQA 2DL5A 4J6XA 4L59A 4C92B 1QVFS 2VXFA 3CD6T 4KBMB 2CKKA 2GFAA 3CCSA 2O4XB 3EFSA 4IIMA 4M7AF 4M78C 4ANJA 1KQSS 3V8JA 2YUPA 3UT1A 4R56A 2A0FB 2GCXA 2O88A 4AFSC 3NTHA 3REBB 4JJBA 1F1BB 2QQ9A 3CD6Q 1PRMC 2NWMA 4F04B 3H9NA 2X35A 3JCMc 4JJDA 3EGDA 1H3ZA 3CCUQ 2CP2A 2JTFA 1K73R 4NOYA 1QVPA 3EGXB 2K57A 4K11A 4C8QB 2XG8D 1IGUA 3NGPA 1AHJB 3PGGA 2MMPA 2FL7A 4OMFB 2IVWA 5KCOA 2AIRB 2EGEA 4AT1B 1Y7XA 5CKBA 4BI8B 1W1FA 2M16A 2LDMA 2NYSA 3SHWA 1WJRA 4M7AB 2CSIA 4E2FB 1R0BG 5GJVB 4OMLA 1SSHA 5GMKj 2YWWA 4M78A 3OYCA 3QHSA 3I35A 3H0HA 4BY6C 4JJCA 4B6MA 2CYZB 3CCUA 5CQXA 2FYKA 2K3BA 2JXBA 4DBFA 4JRPA 5GAOp 1JXOA 1BKBA 4PJOA 2RNAA 1KD1R 2EGCA 2XICA 2EQKA 1QCNA 4FYYB 4BDZA 2VXEA 3PVLA 1TXQA 2DLPA 1VQOT 3RKXA 3A8GB 1PM3A 4LE9A 3QG1A 3CBMA 4M77G 4ME7A 3CEYA 1BU1A 3THKA 1RL2A 1FWZA 3FJPA 2HL5C 3V7SA 2KYMA 4Z02A 5LJ5e 3CPWS 5GMKm 1Q95G 4BB7A 4PK4A 1BB9A 2CSQA 1BI1A 2KXCA 1ARKA 4C92E 5GAN6 5GAOq 1VQNQ 2QQRA 3FC3A 3CCMT 1VQMA 2M51A 2FRWA 1YITQ 4J83A 5CIUA 1NEBA 4J6WA 2E1HA 1Y71A 3X26B 2XI9A 2HSEB 1B7TA 3RMQA 3RDVA 5GAN8 4RTVA 3M0QA 1YJWA 4GLKA 1X6BA 3JB9J 3HRTA 5GANd 3L1AA 1OX9A 1YNZA 2DXBA 1G83A 1RACB 4M77E 1K8AR 3M58A 4EMKA 2CZ6B 3CCJQ 1QVGP 2F2WA 4M75F 2VUBA 1TSFA 3ME9A 3JCMP 2FZGB 5KYXB 3JCMe 2RM4A 3VS0A 3CD6A 3X25B 2DBKA 1D1BA 3I56Q 1NJIR 1WZOA 4F7UB 1M2OA 1YP5A 4GBQA 1GCPA 4QVDA 4BD3A 1N27A 4M75E 2QQSA 4M7AA 3CBOA 3QBYA 1SEMA 4FSXA 2E6ZA 4JRIA 4QW2A 4QQDA 2EQMA 1X6GA 2I0NA 3A8MB 3G4SQ 1QP2A 3J80E 5KYUB 1GL5A 4A53A 5LJ3g 1WFWA 2VB6A 5AYFA 4FT4A 1VIEA 4RKUE 2BKDN 2DXUA 1YFNA 2V1RA 3QIIA 1MNDA 4ELYC 5D7UA 4F7UG 1N9SA 4OB0B 2BE7D 4AFZC 1ZBJA 2RQRA 3META 2D0NA 3G6EQ 4B9XA 1VQ9Q 4RMOA 1IB8A 3NHNA 2EYWA 5LJ5h 3AHUA 4M7AC 1V1CA 1Q81U 2RF0A 5LL6S 1QWEA 1WIEA 3CXCA 4PNOA 1QCFA 2M0YA 2VV5A 3D7SB 1ABQA 1WJQA 3C0CA 1TTHB 5GMKl 2RO0A 4OGCA 2DXCA 3T9NA 3KBGA 4C5GA 4BI4A 1VQ4A 1K9AA 4C8QC 2PNIA 3I5RA 1SRLA 1UUEA 3BW1A 3HRUA 4M77A 4C8QD 4FL6A 3M54A 1OV3A 4J7IA 2E12A 4UC4A 3LWIA 3MCAB 4FU6A 3QDRB 2DETA 1IZ6A 3QKJA 1D3BB 1PNJA 1NPPA 4RTZA 3ASKA 3CCLT 3OBYA 2QXFA 2EIFA 1QWFA 4FCYA 4J5YA 1C1AA 2NUTA 3OS5A 3VUZA 4LNPA 3P8DA 3QYGB 2KYBA 4J9BA 5CCAA 1YJNT 2JVVA 1E6HA 1M1KR 2LX9A 3CCLQ 4J9IA 3RKWA 3SD4A 3OYIA 2ENMA 3VS5A 2YUOA 2YSQA 1X75C 1OZ2A 2X3XD 2ZZDA 2X4YA 2M0OA 4FSSA 3OMGA 4Y92A 2V8IA 2MK5A 2YDLA 4RCCA 4A4EA 1N8RU 4PJOB 1I5OB 5A2QE 2DA9A 1D1CA 1CSKA 2HQEA 4E7JA 1NEGA 3QWXX 5KYWB 4F17A 2DTOA 5KYYB 2FPFA 1ZSZB 4HVUA 2X3WD 4F7UF 3MEWA 3P8BB 2C0IA 3OSVA 4X1VA 4M7DB 1TG0A 2EJGA 2KI7A 1U5SA 3JCMb 1NJIU 2M02A 5D6WA 5HKCA 4N4GA 4JUVA 4DBHA 2QEXT 2KVQG 1ZHIA 2R5AA 2XU8A 2P0PA 5A0DA 2ED0A 3NTKA 1NG2A 1ZQ1A 2X4JA 5KE3A 2JW4A 2LTOA 3GOXA 1RAFB 2EVRA 3C95A 3RR6A 2FB7A 3L42A 2O9VA 3DKMA 5GANf 1Q86C 2Y4YA 3M4GA 3HTRA 1G3YA 4E7ZA 2LQKA 1ZUUA 1JB0E 1O75A 1WLPB 1I07A 1HXDA 1JJ2A 2ZGWA 4YTLA 9ATCB 5GMKi 1M90C 2BIVA 2OAUA 3ZBDA
chains in the Genus database with same CATH topology
2OTJQ 1VQ5Q 3CC4Q 3CCEQ 3I55Q 3CMAQ 1KQSP 3I56Q 1M1KR 1W2BP 3G4SQ 3CCLQ 1NJIR 1N8RR 1YI2Q 1YJWQ 1VQLQ 1YIJQ 3CCVQ 1VQOQ 1KC8R 1M90R 3CXCP 1VQKQ 1YITQ 3CC7Q 1K8AR 1K9MR 3CPWP 3G6EQ 3CCSQ 3CCQQ 3CCRQ 1S72Q 1Q82R 1VQ9Q 3CCMQ 1YHQQ 1QVFP 1VQ6Q 1Q81R 1KD1R 1VQMQ 3CCJQ 1QVGP 1Q86R 1VQ7Q 3CC2Q 1JJ2P 3CCUQ 1VQPQ 3CD6Q 1K73R 2QEXQ 1VQ8Q 1Q7YR 1VQNQ 3G71Q 3CMEQ 2OTLQ 1VQ4Q 1YJNQ 1YJ9Q 3OW2P 2QA4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ Q;  1VQ5 Q;  3CC4 Q;  3CCE Q;  3I55 Q;  3CMA Q;  1KQS P;  3I56 Q;  1M1K R;  1W2B P;  3G4S Q;  3CCL Q;  1NJI R;  1N8R R;  1YI2 Q;  1YJW Q;  1VQL Q;  1YIJ Q;  3CCV Q;  1VQO Q;  1KC8 R;  1M90 R;  3CXC P;  1VQK Q;  1YIT Q;  3CC7 Q;  1K8A R;  1K9M R;  3CPW P;  3G6E Q;  3CCS Q;  3CCQ Q;  3CCR Q;  1S72 Q;  1Q82 R;  1VQ9 Q;  3CCM Q;  1YHQ Q;  1QVF P;  1VQ6 Q;  1Q81 R;  1KD1 R;  1VQM Q;  3CCJ Q;  1QVG P;  1Q86 R;  1VQ7 Q;  3CC2 Q;  1JJ2 P;  3CCU Q;  1VQP Q;  3CD6 Q;  1K73 R;  2QEX Q;  1VQ8 Q;  1Q7Y R;  1VQN Q;  3G71 Q;  3CME Q;  2OTL Q;  1VQ4 Q;  1YJN Q;  1YJ9 Q;  3OW2 P;  2QA4 Q; 
#chains in the Genus database with same CATH topology
 3JV3 A;  1PD0 A;  5KE2 A;  3C4S A;  2KQW A;  1KHI A;  2EQI A;  1LVK A;  2LX7 A;  4BUG A;  1Q86 U;  2YLB A;  3BDU A;  3ZFJ A;  3HL8 A;  3OSS C;  1PCX A;  2LJ0 A;  2XK0 A;  2YUQ A;  3QXE B;  2ECZ A;  3M0T A;  4LXC A;  2LP5 A;  3IQL A;  3JB9 G;  1CKA A;  3QYH B;  4L5G A;  1VQL A;  3PT9 A;  1IRX A;  1D09 B;  2DK3 A;  1M27 C;  2FHD A;  2EBP A;  1S72 A;  2C06 A;  3M0R A;  1N9R A;  2VC8 A;  2J6F A;  4NS5 A;  2DYB A;  3CCJ T;  1W2B S;  3I9Q A;  3QJ6 A;  2XHC A;  4E47 A;  2W10 A;  1E6G A;  3BY7 A;  1K4U S;  2O01 E;  2DEQ A;  3J81 E;  3OYJ A;  2OTJ A;  1QKX A;  3MJX A;  2JMA A;  2RJE A;  2OTL T;  1IXD A;  1QKW A;  3LW5 E;  1KIK A;  2V8K A;  2A37 A;  2DL3 A;  5IN1 A;  1BCM A;  4RTU A;  1I1J A;  1UJY A;  3M0U A;  1YCS B;  3M57 A;  3A8O B;  4J8O A;  2CUB A;  2MIO A;  4HCC A;  2DER A;  2RQW A;  3CC2 A;  1QMC A;  3FIF A;  2OJ2 A;  4PL6 A;  2RI3 A;  1J3T A;  3CC4 A;  3CC7 T;  1A0N B;  2VKN A;  1QQJ A;  2A36 A;  3EH2 A;  4ELZ C;  2DL7 A;  1UDL A;  3NTI A;  2K9G A;  3WXM B;  1W2B A;  2CS7 A;  1X2K A;  2CGH A;  2O2O A;  4PJO D;  4J7F A;  1MMN A;  1RLP C;  2ZPF B;  4J6Y A;  1ACM B;  5EC7 A;  5LJ5 j;  3CXC S;  1MGQ A;  1NLO C;  1W4S A;  3FB9 A;  4M77 C;  2GF7 A;  1BCO A;  3A1P A;  1WYX A;  2D8J A;  3TSZ A;  1VQP Q;  1T3S A;  3EG3 A;  2V8J A;  3VU3 C;  2QG9 B;  1OX8 A;  2W0Z A;  2O4X A;  1WJS A;  1TUG B;  2AHJ B;  2RI2 A;  3GIB A;  3QDF A;  1E7O A;  4A4F A;  3RIR A;  2ZPI B;  2XKO C;  2QK0 A;  4JDS A;  2X4X A;  1M2V B;  3LYI A;  4QQG A;  5ECA A;  4J9G A;  1VQP T;  3JCM f;  1AZG B;  4MMK A;  2ZPG B;  3QZ5 B;  4M7D E;  4AMC A;  1K9M U;  3A98 A;  3MP8 A;  4M7D D;  3QWY A;  3S3M A;  3CCV A;  1UGS B;  3EGX A;  4M7D G;  8ATC B;  5KYN A;  1VQM T;  2E4H A;  3EG9 B;  2ATC B;  3V8K A;  1VQ8 T;  5GMK h;  2IIM A;  1FYN A;  3I55 A;  2COZ A;  3SWN C;  2FPD A;  3EHQ A;  1NPR A;  1QW1 A;  4M75 G;  3G4S A;  5HK3 A;  3VJP A;  3GNF B;  3G71 Q;  3QZ9 B;  4MZM A;  1OOT A;  5GAO l;  4HKE A;  4M77 B;  1XTD A;  1NYG A;  4FW1 A;  4RTX A;  2V1Q A;  3JCM X;  4BE1 A;  3LX7 A;  2RI5 A;  8AT1 B;  1GFC A;  1VQ6 T;  3G7Z A;  2DBM A;  4FW2 A;  4LDU A;  2K5F A;  1RAG B;  2D6F A;  4HCK A;  3VV0 A;  5CK9 A;  3HPW A;  2DTH A;  3VRY A;  1IHW A;  1XJW B;  2HAX A;  2EKO A;  2K7A A;  4OGE A;  2DM1 A;  2DIL A;  2RHZ A;  5CO7 A;  2QQB A;  3QSU A;  1VQ9 T;  2RD1 A;  1GXI E;  4AFQ C;  2DPP B;  1MMA A;  1RI9 A;  4C92 D;  3CCR Q;  5DLO A;  3GP8 A;  1ZX6 A;  1K0X A;  4ORZ A;  4C0D B;  3M53 A;  1N6A A;  2E5Q A;  2DKG A;  5FRN A;  2XMF A;  2RHY A;  2LCS A;  3CBP A;  2AKK A;  3RUX A;  3VS3 A;  3S3O A;  2QI2 A;  2PU9 B;  2A28 A;  4R55 A;  4EMK C;  4B9W A;  4QQ6 A;  3L2R A;  1KQ2 A;  1AZE A;  2JZ2 A;  3FDR A;  4OMQ A;  2D0Q B;  2QEX Q;  1K76 A;  1HYO A;  3EHR A;  2K2M A;  4JZ3 A;  1KQS P;  5IHN A;  1SHF A;  5CKE A;  5GAN 2;  2QAS A;  4XTV A;  1VQ5 A;  1QVF P;  1UB4 A;  1M5Q 1;  2CZ0 B;  2Z0W A;  3EG2 A;  3HHT B;  2NUP A;  1SG5 A;  3TU4 K;  1QVG A;  3VS1 A;  1RAD B;  4WF2 A;  4M75 C;  4EMH A;  4HT8 A;  1BK2 A;  1S1N A;  1M30 A;  5GAO n;  1QP3 A;  3TCJ A;  3KXT A;  4M75 D;  4OMN A;  2VVK A;  4C92 A;  2DYI A;  2VAS A;  2KRN A;  5FLX E;  6AT1 B;  3REA B;  5GMK e;  5GAN j;  1K73 U;  4M78 E;  3OYN A;  4AFU C;  2K79 A;  1YIJ A;  4VUB A;  3DLM A;  2XID A;  2PVG B;  4M78 G;  2WAC A;  5IXB A;  4ZGJ B;  3A5Z B;  1VQ5 Q;  5I22 A;  3CCQ A;  3I55 Q;  4J9D A;  2JOY A;  3MKD A;  3UDC A;  2B8A A;  3OB9 A;  4IUR A;  2JUF A;  1UEB A;  1ZUY A;  4OVA A;  5C0M A;  3HSB A;  1IGQ A;  3JCM W;  3ZL7 C;  2VWF A;  2YT6 A;  3SEM A;  2RN8 A;  1GFD A;  1ZSZ C;  3UPU A;  2CP5 A;  2LCL A;  1YJW Q;  3E9G A;  3L2Z A;  1YJN A;  2QGG A;  2GQI A;  2A3L A;  3M0P A;  2B86 A;  2DJZ A;  4D8K A;  1QVG S;  4N4I A;  1XOV A;  2KGT A;  2EKH A;  3KFV A;  2DD4 A;  2BE9 B;  2P4T A;  3SDZ A;  1H64 1;  1WHJ A;  2KRO A;  3UA7 A;  2NUP B;  2RQU A;  1IRE B;  1JU5 C;  4MDX A;  1RAH B;  4C8Q G;  1TH7 A;  3INZ A;  5LJ3 f;  2OAW A;  2HZY A;  4PJJ A;  3A8H B;  1VQ8 A;  4C8Q E;  3CCQ Q;  1WHH A;  3HFO A;  5GAN 7;  1FMV A;  1Q86 R;  4M7A D;  1VQO A;  4RUG A;  2LQ8 A;  2DAQ A;  4LDV A;  4M75 B;  1TUD A;  4OB2 B;  2EPD A;  3UA6 A;  2QA4 Q;  4ZN1 A;  4LDY A;  4C0G A;  2K3Y A;  1UFF A;  2MYS A;  1W2B P;  3I5S A;  4DOV A;  3KUF A;  4KUD K;  2LC4 A;  2G6F X;  3V7R A;  3VS4 A;  3V8L A;  2QEX A;  2P0Q A;  2HBP A;  1HJD A;  4C0F A;  3VYH B;  2D8H A;  4E7K A;  1QVF A;  3OYH A;  1T0J A;  5A0G A;  1K0S A;  1VQK A;  1IO6 A;  1M8M A;  2HCK A;  2DRK A;  1UHC A;  1YI2 A;  3MEU A;  5FU7 B;  1ZA2 B;  2F69 A;  4KH1 B;  1D3B A;  2K5I A;  4J9E A;  5A0L A;  1RUW A;  2LMJ A;  4QVC A;  7AT1 B;  2L2P A;  3CC7 Q;  2EFI A;  4N4H A;  1VQM Q;  2HEQ A;  2SEM A;  1OU9 A;  5GAO m;  2E5K A;  4EIK A;  2HQH A;  1G3T A;  4L6V 5;  1VQ8 Q;  4R0K A;  1R0C B;  4AG1 C;  4BDY A;  2QGF B;  2RB6 A;  2BZ8 A;  4C0D C;  4JS4 A;  2E3I A;  3MHX A;  1D0Y A;  4N0A A;  3MEA A;  3CQT A;  4V2S A;  2ABL A;  1VQK Q;  2KK4 A;  3OW2 A;  1U8R A;  1YI2 T;  1PWT A;  1U06 A;  3CCE T;  4ZGD B;  3RES A;  5FWC A;  1N8R C;  4M78 D;  1WGS A;  3S6W A;  3C94 A;  2XD0 A;  3CCJ A;  1T0H A;  5CAI A;  4LDW A;  4Z89 A;  1G3S A;  1EIF A;  4PFZ A;  2RH2 A;  4IUV A;  4BAC A;  2ZAE A;  2HSP A;  1M8V A;  2OTL A;  2KEA A;  1VYT A;  2JM8 A;  2CP7 A;  5EG2 A;  1TS9 A;  3R6O A;  2LNV A;  1VUB A;  5IHK A;  4QT7 A;  4HA8 A;  1PKS A;  4BE2 A;  2HKQ B;  4JRK A;  1GRI A;  2JJ9 A;  3CCR A;  2LQW A;  1Q82 C;  2DRM A;  1GCQ C;  2LQN A;  2L3P A;  3PFS A;  1M1G A;  3C12 A;  3Q1J A;  1VIF A;  5FWB A;  5I2M A;  1TOV A;  2J6O A;  5HY6 A;  1S72 Q;  4PFP A;  4M4Z A;  2KRS A;  3GLX A;  2NUZ A;  3UWN A;  3JCM d;  4JZ4 A;  3E2U A;  3URG A;  1VOM A;  4RTW A;  1D1A A;  2HBW A;  3ZEH A;  3OYE A;  3MPU B;  4CC2 A;  1AWX A;  2L5Q A;  2IG0 A;  2J06 A;  5GAM g;  4HXJ A;  2K4Y A;  4PLL A;  3JB9 D;  1K73 C;  1Y57 A;  2JMC A;  3FLG A;  4A4H A;  1G2B A;  3UF4 A;  3E9F A;  3R6N A;  1AEY A;  5FU7 C;  4ZGE B;  1WDX A;  1M3A A;  3OS2 A;  1GCQ A;  1X27 A;  3OS1 A;  3OA6 A;  2DF6 A;  2L3Q A;  2DZ9 A;  2YUN A;  2GGR A;  2ZCF B;  2YRV A;  1I81 A;  4E7L A;  3SWN A;  2K6D A;  2E70 A;  2LCC A;  1PSF A;  1WHL A;  2HQX A;  4PJN A;  4RCB A;  1PSE A;  4KT0 E;  1UG1 A;  1AOJ A;  4E7S A;  3LGF A;  3PVQ A;  2KXD A;  1VQ6 Q;  1BI2 A;  1KK7 A;  4M77 F;  1KC8 U;  1JEG A;  4Y91 A;  3CCV T;  3I56 A;  2E64 A;  1VQ4 Q;  5IXF A;  1Q81 C;  2KSS A;  1W70 A;  1VQ7 T;  3CMA T;  4XU2 A;  4D6W A;  1Z9Z A;  1OEB A;  1DJ7 B;  1FMW A;  4HVV A;  1UHF A;  1FMK A;  1UE9 A;  3HRS A;  2CP3 A;  4KH0 B;  3N5B B;  3I55 T;  4LD6 A;  3QPH A;  3O5Z A;  1UGQ B;  5LJ3 e;  1MV3 A;  1B3Q A;  2MCN A;  1AVZ C;  2XDD A;  4CC7 A;  1VQ6 A;  3OYM A;  4KGZ B;  4JLI A;  1UGV A;  1N5Z A;  3LLR A;  2OX7 A;  3OYD A;  1K9M R;  5KCH A;  3SWN B;  3PTA A;  1BI0 A;  4Z8A A;  4E7H A;  1C0M A;  2PUO B;  1HK9 A;  1D0Z A;  1G3W A;  2WSC E;  5GAO r;  3OYF A;  1ZSZ A;  4XK8 E;  3LGL A;  5HCK A;  2OTJ Q;  3JB9 H;  3WVE B;  2CH4 A;  3OS0 A;  3VS6 A;  3RNJ A;  5KYY A;  4HT9 A;  1MHN A;  4OB1 B;  4HCZ A;  1B34 B;  1VQO Q;  2CZ7 B;  4IUU A;  2EWN A;  4X34 A;  3H0I A;  3JRZ A;  3CPW P;  4WTO B;  2ROL A;  1X43 A;  2Y4X A;  1WX6 A;  2A08 A;  4PJL A;  4XTU A;  4HCB A;  4WCI A;  5CKH A;  1ZUK A;  2EAY A;  4MZP A;  1WPY A;  4EMK B;  1XNI A;  3JSC A;  3JB9 I;  3CCR T;  1WA7 A;  1AWJ A;  3H8Z A;  5GAN 3;  3JCM J;  2FZC B;  4A54 A;  3EGU A;  2DL4 A;  1M2V A;  4II1 A;  4QVZ A;  4CC4 B;  2EYZ A;  3NFC A;  2JN0 A;  5GJW B;  4M7D C;  3F70 A;  2RPN A;  1IHV A;  3MEV A;  2DIQ A;  1Q7Y R;  2AT1 B;  3QJY A;  1M3C A;  3E1S A;  4M75 A;  1TU0 B;  1EX4 A;  1EFN A;  2OTJ T;  1MMD A;  1N8R R;  2DJQ A;  3EG9 A;  2M9U A;  2F2V A;  3FJ5 A;  1SKU B;  4AG2 C;  4EMG A;  2SRC A;  2P0K A;  2PZ1 A;  4D8D A;  3CCU T;  1JJ2 P;  2EYX A;  2VGM A;  3CCL A;  3H6Z A;  1PRL C;  2K3X A;  1ZLM A;  2RJD A;  3VUB A;  1JBM A;  1YJ9 T;  4C0Z A;  2LRQ A;  1BIB A;  4MML A;  2WSF E;  1VQN A;  2DX1 A;  2JTM A;  4PFO A;  3HFN A;  1H92 A;  5KH6 A;  1NZ9 A;  1PG5 B;  1TWB A;  4RTY A;  1YIT T;  4F14 A;  3OYG A;  2ZPE B;  3CME Q;  1SRM A;  3NPF A;  2F2X A;  1KJW A;  5KYW A;  3OW2 S;  1FX7 A;  2GQV A;  1SSF A;  2LZ6 B;  4OF1 A;  1BBZ A;  3CCQ T;  2YXY A;  5CKF A;  4C92 C;  1U1T A;  4IKF A;  3OYB A;  5D6Y A;  2AKL A;  4ZN3 A;  2HDA A;  4F7U E;  2FO0 A;  4BE0 A;  1I0C A;  1W6X A;  4PJO E;  2BUD A;  3PMI A;  2KE9 A;  3OW2 P;  1YBY A;  1Q7Y U;  3G1J A;  3M5A A;  2VYT A;  5LJ3 d;  4NL3 A;  2COW A;  1X01 A;  2QQA A;  4KGV B;  1KD1 U;  2F5K A;  1Z9Q A;  4J9H A;  3JCM Q;  2GFU A;  4E7I A;  4XTX A;  3CPW A;  2GTJ A;  5M9O A;  2BZY A;  3MP6 A;  3EFO B;  3LH5 A;  3JCM V;  2RJC A;  3TVT A;  3E19 A;  1UEC A;  2V26 A;  2M1H A;  4KRT A;  4KGX B;  2LNH B;  2L3R A;  2L0A A;  3O8V A;  1R77 A;  2FPE A;  4IUP A;  2AZV A;  1RLQ C;  2O9S A;  2XDP A;  1VQ7 A;  3CME A;  4DQ2 A;  5GAN e;  1P92 A;  4FYX B;  4C5E A;  4NL2 A;  3X20 B;  5GAN 4;  1PHT A;  4PKC C;  1NM7 A;  3A8L B;  3OYY A;  4A63 B;  2R5M A;  2CP0 A;  2RHX A;  2EQU A;  5FRM A;  2FEI A;  4A4K A;  1JXM A;  2H3E B;  1X6O A;  4Y28 E;  4XQ3 A;  5LJ5 g;  1KG1 A;  3OY9 A;  2L89 A;  1Y96 B;  5CKD A;  3L2Q A;  3BFM A;  3GNG A;  3LH0 A;  2KMT A;  2KBT A;  2PVD B;  2QA4 T;  1WHK A;  5D6X A;  4C8Q A;  2DVJ A;  2JNG A;  2RQT A;  4EDU A;  1M3B A;  1VQ9 A;  1S72 T;  1QLY A;  2MF2 A;  4KUI A;  1WXT A;  3M0S A;  1KC8 R;  3G71 T;  2EYY A;  3DLL A;  3OYK A;  1BYM A;  2CUD A;  1VQ7 Q;  4EPC A;  4XTY A;  1NLP C;  1LJO A;  1FXX A;  4OB3 B;  2PVO B;  4FYV B;  1MUZ A;  5GAM e;  1YHQ A;  2FVU A;  4DBQ A;  5IH2 A;  2QA4 A;  2BZX A;  3GPL A;  2QTX A;  1OZ3 A;  1YJ9 A;  1I5L A;  1ABO A;  1WHM A;  2CRE A;  1SHG A;  4A4G A;  2R58 A;  1H3H A;  3SFM A;  2H3J A;  2KR3 A;  2GTO A;  4IIO A;  4BI3 A;  3PNW C;  3CC4 T;  3CC7 A;  1WXU A;  1X69 A;  3CMA Q;  4OMM A;  2QYZ A;  2RK1 A;  1OI1 A;  4ATO A;  4DA4 A;  2EW3 A;  2KAF A;  3EAE A;  4O6J A;  3EH1 A;  4LUE A;  1OU8 A;  2RHU A;  3TEE A;  4KUL A;  2CH4 W;  1OPK A;  2KNB B;  4P5N A;  2RMO A;  3TSW A;  4J9F A;  1OQK A;  1KQ1 A;  3RBB B;  2EGA A;  3UAT A;  1VYU A;  2FG0 A;  2YRD A;  1RAB B;  4RTT A;  4XTW A;  1T3L A;  3CCS Q;  1MNE A;  5L23 A;  2E6N A;  5GAN h;  3BE3 A;  1VYV A;  1HD3 A;  1QCO A;  1VQ4 T;  1BI3 A;  5GAM h;  2JS2 A;  1M1F A;  3JCM g;  1YIT A;  3X24 B;  4JLG A;  2HL3 A;  3OMC A;  1EZZ B;  1SPK A;  1U1S A;  4FM4 B;  4M7D A;  5CR2 A;  2CT3 A;  4JPB W;  4XU0 A;  2GNC A;  2CP6 A;  2QDY B;  5I21 A;  2J7I A;  2O31 A;  5CVI A;  4PLI A;  4XAX B;  4CI0 C;  3M59 A;  4M78 F;  1ZA1 B;  1AWW A;  4FT2 A;  4M77 D;  5C6S A;  1AWO A;  2DIG A;  1RAI B;  1HSQ A;  2EJ9 A;  1LCK A;  3EG0 A;  4GLM A;  1V76 A;  2MWP A;  2X9H A;  3M55 A;  2ED1 A;  3DB3 A;  1YCY A;  2AZS A;  3SB2 A;  2OI3 A;  2CZ1 B;  3OBW A;  5IHI A;  1Y0M A;  3CC2 Q;  2KT1 A;  3J7A F;  1NJI C;  4Q5W A;  4LDX A;  4J9C A;  4E6R A;  2LT4 A;  2C0T A;  2MPX C;  2XDB A;  1KD1 C;  1AT1 B;  1K8A U;  4JJN K;  1YWP A;  5LJ5 d;  2C0O A;  3JCM h;  3AT1 B;  4RG8 A;  5AT1 B;  1PD1 A;  1YN8 A;  1Q7Y C;  4M78 B;  3CME T;  2DD5 A;  2E41 A;  2L8D A;  2LJ1 A;  4C5I A;  5DM7 R;  4C92 F;  5GAN g;  3HP9 A;  2E10 A;  2LT1 A;  2ESW A;  2BTT A;  1ZSG A;  2FZK B;  2L3S A;  2IPO B;  3LWH A;  3OYL A;  4M7A G;  1VQP A;  2YLC A;  1I8F A;  1R8O B;  4M7A E;  1O9S A;  3FRN A;  3L2V A;  1VQL Q;  2HD0 A;  5I11 A;  3L2U A;  3CXC P;  2PUK B;  2J6K A;  3VKI A;  4FIB A;  1M1K U;  3TRE A;  1M90 U;  2F5T X;  1WQ7 A;  3PE0 A;  1UGP B;  2QDL A;  2CDT A;  4IUT A;  2OTL Q;  1KQS A;  2JM9 A;  1VQL T;  4OMP A;  2COY A;  1OYX A;  1B34 A;  2KT8 A;  1WXB A;  4HVW A;  2HNI A;  1KSW A;  4F7U A;  3OYA A;  1D0X A;  2E3H A;  3M4Y A;  1TUC A;  2KDS A;  3G4S T;  1Q81 R;  4M7D F;  1H8K A;  2I2L A;  3DB4 A;  1VQ5 T;  3VRZ A;  1PC0 A;  4ZNX A;  4C5H A;  2YHT A;  1UJ0 A;  3U23 A;  1G5V A;  1YHQ T;  3ULR B;  1VQK T;  3CCE A;  1MV0 B;  5CQY A;  2JT4 A;  3CCM Q;  1WNL A;  4C92 G;  1Y07 A;  3CC2 T;  2DO3 A;  4FYW B;  5LJ3 j;  3M56 A;  3G6E T;  2DTI A;  2NUT B;  1RI0 A;  2EJF A;  5J39 A;  2F1L A;  1K9M C;  4ESR A;  3CC4 Q;  1OUL A;  2X4W A;  5GAM j;  2DE0 X;  2WSE E;  4XU1 A;  4MZT A;  3NMZ C;  2K2V A;  2LVM A;  5IAY A;  1LOJ A;  5LJ3 h;  2DVE A;  1BIA A;  1MMG A;  4DBR A;  5DY9 A;  3PIP A;  2MWO A;  1NBE B;  1K8A C;  3GBQ A;  4X9C A;  3VS2 A;  3EFR A;  1G8X A;  3CCE Q;  2D1X A;  1RAE B;  2RK2 A;  4PJO G;  3H0F A;  1SF9 A;  3QUI A;  5DLQ E;  1NE8 A;  4LUD A;  4GY5 A;  1VQN T;  1VA7 A;  2DEU A;  2D9T A;  3JAM E;  5I2S A;  1X2Q A;  1Q82 R;  1YHQ Q;  1LNX A;  5HK0 A;  1AD5 A;  3VS7 A;  2ZPH B;  4DEX A;  2QAZ A;  2DL8 A;  5FU6 B;  1KFZ A;  2JTE A;  1YJ9 Q;  1PKT A;  1B07 A;  1RAA B;  4CC3 A;  2CT4 A;  2LJ3 A;  4PJO F;  4JS5 A;  2DXT A;  3RMS A;  5J3B A;  1WI7 A;  3MO8 A;  2RJF A;  1XQH A;  4MDW A;  4X9D A;  4N0A C;  4C8Q F;  1JO8 A;  4QKU A;  1KHC A;  4ZTJ A;  1WHG A;  1Q82 U;  1U3O A;  1JJ2 S;  2DNU A;  2X51 A;  3PMT A;  3M9Q A;  2RA2 A;  2PTK A;  3WVD B;  2NLU A;  2HMA A;  2P4R A;  1YIJ T;  2DZC A;  1M9S A;  1CKB A;  2DFU A;  2MI6 A;  3V7C A;  2EQJ A;  4LD9 K;  3I56 T;  2J05 A;  1K1Z A;  2MAM A;  1GBR A;  4LN2 A;  2K5L A;  4XU3 A;  3EGD B;  1I4K 1;  3X28 B;  5FU6 C;  3RER A;  2DMO A;  1LPL A;  3FEO A;  3H41 A;  1YI2 Q;  3S3N A;  1M90 R;  5J26 A;  3EG1 A;  1C6V X;  2A7Y A;  4OMO A;  3P8H A;  2HKN A;  4PJM A;  4Z88 A;  3VYG A;  4DEY A;  4OP0 A;  2PQW A;  2G3R A;  1KC8 C;  4TVR A;  1UGR B;  2FRY A;  2KY9 A;  3BDL A;  3EFO A;  3OQ5 A;  1YJN Q;  2RQV A;  5LJ5 f;  3GF5 A;  2AK5 A;  2QTV A;  1WQW A;  1JRI A;  2VGN A;  2YRC A;  4F16 A;  3HKS A;  5FRO A;  1GBQ A;  3QO3 A;  1Y96 A;  2KRM A;  2ROT A;  2JS0 A;  2P84 A;  1YWO A;  4O5V A;  5FW9 A;  5KYU A;  3CPF A;  3CMA A;  1JQQ A;  1NYF A;  3CCM A;  5L8R E;  4ZTF A;  2ZPB B;  3TQ7 P;  3PIO A;  3G6E A;  5IT9 E;  3MP1 A;  2E65 A;  3ER0 A;  3CCS T;  4BY6 B;  2MOX A;  3CCV Q;  3RKY A;  3L2W A;  5GAM d;  1ZBX A;  2R57 A;  2GBQ A;  1UTI A;  4PJO C;  3G71 A;  1YJW T;  1M1K C;  4IUQ A;  4RG2 A;  4DOW A;  5GAM f;  5GAN 5;  4CRI A;  4XTZ A;  1OPL A;  1V29 B;  1M4Z A;  2EYQ A;  5KYX A;  2H8H A;  2RHI A;  1YIJ Q;  3JB9 F;  2Y90 A;  4JRQ A;  2DL5 A;  4J6X A;  4L59 A;  4C92 B;  1QVF S;  2VXF A;  3CD6 T;  4KBM B;  2CKK A;  2GFA A;  3CCS A;  2O4X B;  3EFS A;  4IIM A;  4M7A F;  4M78 C;  4ANJ A;  1KQS S;  3V8J A;  2YUP A;  3UT1 A;  4R56 A;  2A0F B;  2GCX A;  2O88 A;  4AFS C;  3NTH A;  3REB B;  4JJB A;  1F1B B;  2QQ9 A;  3CD6 Q;  1PRM C;  2NWM A;  4F04 B;  3H9N A;  2X35 A;  3JCM c;  4JJD A;  3EGD A;  1H3Z A;  3CCU Q;  2CP2 A;  2JTF A;  1K73 R;  4NOY A;  1QVP A;  3EGX B;  2K57 A;  4K11 A;  4C8Q B;  2XG8 D;  1IGU A;  3NGP A;  1AHJ B;  3PGG A;  2MMP A;  2FL7 A;  4OMF B;  2IVW A;  5KCO A;  2AIR B;  2EGE A;  4AT1 B;  1Y7X A;  5CKB A;  4BI8 B;  1W1F A;  2M16 A;  2LDM A;  2NYS A;  3SHW A;  1WJR A;  4M7A B;  2CSI A;  4E2F B;  1R0B G;  5GJV B;  4OML A;  1SSH A;  5GMK j;  2YWW A;  4M78 A;  3OYC A;  3QHS A;  3I35 A;  3H0H A;  4BY6 C;  4JJC A;  4B6M A;  2CYZ B;  3CCU A;  5CQX A;  2FYK A;  2K3B A;  2JXB A;  4DBF A;  4JRP A;  5GAO p;  1JXO A;  1BKB A;  4PJO A;  2RNA A;  1KD1 R;  2EGC A;  2XIC A;  2EQK A;  1QCN A;  4FYY B;  4BDZ A;  2VXE A;  3PVL A;  1TXQ A;  2DLP A;  1VQO T;  3RKX A;  3A8G B;  1PM3 A;  4LE9 A;  3QG1 A;  3CBM A;  4M77 G;  4ME7 A;  3CEY A;  1BU1 A;  3THK A;  1RL2 A;  1FWZ A;  3FJP A;  2HL5 C;  3V7S A;  2KYM A;  4Z02 A;  5LJ5 e;  3CPW S;  5GMK m;  1Q95 G;  4BB7 A;  4PK4 A;  1BB9 A;  2CSQ A;  1BI1 A;  2KXC A;  1ARK A;  4C92 E;  5GAN 6;  5GAO q;  1VQN Q;  2QQR A;  3FC3 A;  3CCM T;  1VQM A;  2M51 A;  2FRW A;  1YIT Q;  4J83 A;  5CIU A;  1NEB A;  4J6W A;  2E1H A;  1Y71 A;  3X26 B;  2XI9 A;  2HSE B;  1B7T A;  3RMQ A;  3RDV A;  5GAN 8;  4RTV A;  3M0Q A;  1YJW A;  4GLK A;  1X6B A;  3JB9 J;  3HRT A;  5GAN d;  3L1A A;  1OX9 A;  1YNZ A;  2DXB A;  1G83 A;  1RAC B;  4M77 E;  1K8A R;  3M58 A;  4EMK A;  2CZ6 B;  3CCJ Q;  1QVG P;  2F2W A;  4M75 F;  2VUB A;  1TSF A;  3ME9 A;  3JCM P;  2FZG B;  5KYX B;  3JCM e;  2RM4 A;  3VS0 A;  3CD6 A;  3X25 B;  2DBK A;  1D1B A;  3I56 Q;  1NJI R;  1WZO A;  4F7U B;  1M2O A;  1YP5 A;  4GBQ A;  1GCP A;  4QVD A;  4BD3 A;  1N27 A;  4M75 E;  2QQS A;  4M7A A;  3CBO A;  3QBY A;  1SEM A;  4FSX A;  2E6Z A;  4JRI A;  4QW2 A;  4QQD A;  2EQM A;  1X6G A;  2I0N A;  3A8M B;  3G4S Q;  1QP2 A;  3J80 E;  5KYU B;  1GL5 A;  4A53 A;  5LJ3 g;  1WFW A;  2VB6 A;  5AYF A;  4FT4 A;  1VIE A;  4RKU E;  2BKD N;  2DXU A;  1YFN A;  2V1R A;  3QII A;  1MND A;  4ELY C;  5D7U A;  4F7U G;  1N9S A;  4OB0 B;  2BE7 D;  4AFZ C;  1ZBJ A;  2RQR A;  3MET A;  2D0N A;  3G6E Q;  4B9X A;  1VQ9 Q;  4RMO A;  1IB8 A;  3NHN A;  2EYW A;  5LJ5 h;  3AHU A;  4M7A C;  1V1C A;  1Q81 U;  2RF0 A;  5LL6 S;  1QWE A;  1WIE A;  3CXC A;  4PNO A;  1QCF A;  2M0Y A;  2VV5 A;  3D7S B;  1ABQ A;  1WJQ A;  3C0C A;  1TTH B;  5GMK l;  2RO0 A;  4OGC A;  2DXC A;  3T9N A;  3KBG A;  4C5G A;  4BI4 A;  1VQ4 A;  1K9A A;  4C8Q C;  2PNI A;  3I5R A;  1SRL A;  1UUE A;  3BW1 A;  3HRU A;  4M77 A;  4C8Q D;  4FL6 A;  3M54 A;  1OV3 A;  4J7I A;  2E12 A;  4UC4 A;  3LWI A;  3MCA B;  4FU6 A;  3QDR B;  2DET A;  1IZ6 A;  3QKJ A;  1D3B B;  1PNJ A;  1NPP A;  4RTZ A;  3ASK A;  3CCL T;  3OBY A;  2QXF A;  2EIF A;  1QWF A;  4FCY A;  4J5Y A;  1C1A A;  2NUT A;  3OS5 A;  3VUZ A;  4LNP A;  3P8D A;  3QYG B;  2KYB A;  4J9B A;  5CCA A;  1YJN T;  2JVV A;  1E6H A;  1M1K R;  2LX9 A;  3CCL Q;  4J9I A;  3RKW A;  3SD4 A;  3OYI A;  2ENM A;  3VS5 A;  2YUO A;  2YSQ A;  1X75 C;  1OZ2 A;  2X3X D;  2ZZD A;  2X4Y A;  2M0O A;  4FSS A;  3OMG A;  4Y92 A;  2V8I A;  2MK5 A;  2YDL A;  4RCC A;  4A4E A;  1N8R U;  4PJO B;  1I5O B;  5A2Q E;  2DA9 A;  1D1C A;  1CSK A;  2HQE A;  4E7J A;  1NEG A;  3QWX X;  5KYW B;  4F17 A;  2DTO A;  5KYY B;  2FPF A;  1ZSZ B;  4HVU A;  2X3W D;  4F7U F;  3MEW A;  3P8B B;  2C0I A;  3OSV A;  4X1V A;  4M7D B;  1TG0 A;  2EJG A;  2KI7 A;  1U5S A;  3JCM b;  1NJI U;  2M02 A;  5D6W A;  5HKC A;  4N4G A;  4JUV A;  4DBH A;  2QEX T;  2KVQ G;  1ZHI A;  2R5A A;  2XU8 A;  2P0P A;  5A0D A;  2ED0 A;  3NTK A;  1NG2 A;  1ZQ1 A;  2X4J A;  5KE3 A;  2JW4 A;  2LTO A;  3GOX A;  1RAF B;  2EVR A;  3C95 A;  3RR6 A;  2FB7 A;  3L42 A;  2O9V A;  3DKM A;  5GAN f;  1Q86 C;  2Y4Y A;  3M4G A;  3HTR A;  1G3Y A;  4E7Z A;  2LQK A;  1ZUU A;  1JB0 E;  1O75 A;  1WLP B;  1I07 A;  1HXD A;  1JJ2 A;  2ZGW A;  4YTL A;  9ATC B;  5GMK i;  1M90 C;  2BIV A;  2OAU A;  3ZBD A; 
#chains in the Genus database with same CATH homology
 2OTJ Q;  1VQ5 Q;  3CC4 Q;  3CCE Q;  3I55 Q;  3CMA Q;  1KQS P;  3I56 Q;  1M1K R;  1W2B P;  3G4S Q;  3CCL Q;  1NJI R;  1N8R R;  1YI2 Q;  1YJW Q;  1VQL Q;  1YIJ Q;  3CCV Q;  1VQO Q;  1KC8 R;  1M90 R;  3CXC P;  1VQK Q;  1YIT Q;  3CC7 Q;  1K8A R;  1K9M R;  3CPW P;  3G6E Q;  3CCS Q;  3CCQ Q;  3CCR Q;  1S72 Q;  1Q82 R;  1VQ9 Q;  3CCM Q;  1YHQ Q;  1QVF P;  1VQ6 Q;  1Q81 R;  1KD1 R;  1VQM Q;  3CCJ Q;  1QVG P;  1Q86 R;  1VQ7 Q;  3CC2 Q;  1JJ2 P;  3CCU Q;  1VQP Q;  3CD6 Q;  1K73 R;  2QEX Q;  1VQ8 Q;  1Q7Y R;  1VQN Q;  3G71 Q;  3CME Q;  2OTL Q;  1VQ4 Q;  1YJN Q;  1YJ9 Q;  3OW2 P;  2QA4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...