3LGFA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k370me2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lgfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lgfA01
1NPPA 1K9MC 4C5IA 3CCRA 2BIVA 1Q86C 2L3RA 1KD1U 1OZ2A 1QVFA 5J3BA 4IUPA 2RHYA 2JVVA 3P8DA 4QQGA 5D6XA 3SD4A 3PMTA 3DB4A 3OYFA 1YI2T 2JZ2A 1VQMA 2BKDN 3CCUA 2QA4T 3QJ6A 4A4FA 2R5MA 2X35A 4QW2A 3CXCS 1YI2A 3LX7A 4FU6A 1VQ6A 2GF7A 5FLXE 1YHQT 3CC7T 1KD1C 1EIFA 3G71A 3L2RA 4CRIA 2EIFA 3CCSA 5D6YA 2B8AA 3OYMA 4BDZA 4ZN3A 2YRVA 4A4HA 3CC2A 4B9WA 1YHQA 2HQXA 3MEUA 3CC7A 2BUDA 2X4YA 3CCET 1NZ9A 1WJSA 3NTIA 1S72T 3OYEA 1Q81U 2GFAA 3QBYA 3LYIA 1VQ5A 4A4EA 5KE2A 2EQUA 2RJFA 2M1HA 1KHCA 1VQ9A 5FROA 3OYGA 3CCLA 2RHUA 3L2VA 3META 3BDLA 3DLMA 3OMGA 2JUFA 3HKSA 3JAME 4ZN1A 5CIUA 5KCOA 3CCJA 3MEAA 3QIIA 1YJWT 1YJ9T 1KQSA 4QVZA 2IG0A 3KUFA 4IUTA 3UT1A 1YIJA 2LTOA 3L2QA 1K73U 3G4ST 3ER0A 3A5ZB 2JTFA 1Q82U 1VQLT 1OZ3A 2XHCA 4QQDA 2XK0A 3MEVA 2M0OA 2DO3A 2RI2A 2EQMA 2O4XB 3OB9A 3L2WA 3CEYA 1VQ4A 2MI6A 1VQLA 4B9XA 2E6ZA 2K3YA 1BKBA 2QQRA 4E7KA 1QVFS 1Q7YU 3NTHA 2RJCA 4BE1A 3CD6T 2R58A 3CCQA 2G3RA 1YITT 4L59A 3OYJA 1VQNT 1JJ2A 1MHNA 3E9FA 1G5VA 3CMET 2EFIA 1QVGA 3TREA 5D6WA 4IKFA 3J81E 4PLIA 3CMEA 4IUQA 3KBGA 3ME9A 3OW2A 3M9QA 4IUUA 2QA4A 2PQWA 3G6ET 3OYKA 1VQKT 4BACA 1K8AU 2QEXT 3MO8A 4PLLA 3OYAA 3OYYA 3MP6A 1N8RU 1M90U 5IAYA 4N4GA 3CMAT 3NTKA 1NPRA 2RHXA 3CPWA 4BE0A 2OTJT 2RI3A 2E5QA 3MP8A 2L8DA 3FDRA 3OYCA 4EDUA 1VQOT 3CCEA 1VQ7T 3OS1A 3I56T 3CMAA 3LH0A 1S72A 1YJNT 3H8ZA 5C6SA 4N4IA 2D9TA 1KQSS 5FRMA 3MP1A 1SSFA 1YJNA 4C5HA 1XNIA 4E7LA 1M1KU 1KHIA 3OYHA 5DM7R 1OI1A 1Q81C 4A4GA 2R57A 3I55T 3S3NA 4YTLA 1RI0A 2OTLT 3L2UA 3QKJA 1YJWA 1YJ9A 2LDMA 5LL6S 5A2QE 2EKOA 1WGSA 5FRNA 3LGLA 4C5GA 1X6OA 2RO0A 3S3OA 2OTLA 3G4SA 1K9MU 3L42A 1XTDA 1Q86U 3LLRA 5J26A 4RG2A 3GOXA 3ZEHA 3PIPA 1WJRA 1VQPT 1JJ2S 4X34A 4C5EA 2KDSA 3S6WA 3UWNA 3OYLA 2XDPA 3CCMT 4LD6A 2RJDA 3OYBA 2F5KA 4Z02A 3CC4T 3S3MA 1K73C 4UC4A 1QVGS 1W2BA 2E70A 1M1GA 1Q82C 3LGFA 3CCRT 1IZ6A 2RI5A 5KCHA 2EQJA 2LCLA 3CD6A 3PIOA 2LVMA 2E6NA 3H6ZA 1YITA 1VQNA 3OW2S 1N27A 2FHDA 3OYNA 1VQMT 3CCUT 1KC8U 3OA6A 2RHIA 1Q7YC 4PL6A 3P8HA 3CPFA 5HY6A 1VQ8T 4QQ6A 2O4XA 4E7HA 3PFSA 5C0MA 2RHZA 4TVRA 1VQ6T 3OMCA 5DLQE 2VYTA 2WACA 2NLUA 3J7AF 4OVAA 3OYIA 3J80E 3CPWS 3G71T 1VQ8A 3CCST 3G6EA 3OS2A 2LRQA 1OYXA 4II1A 1VQKA 3FLGA 3EAEA 2P0KA 1NJIU 3CXCA 2DAQA 2QEXA 3CC2T 2RJEA 3E9GA 3DLLA 1KC8C 2LCCA 3PNWC 1RL2A 3FC3A 1VQ5T 4HCZA 4NS5A 1UEBA 2OTJA 1VQ9T 3CCLT 4ZTJA 5IT9E 4IURA 3DB3A 1K8AC 3FEOA 1VQOA 1VQ7A 3I56A 2DIGA 3OQ5A 2DIQA 2CKKA 2X4WA 2JOYA 5KE3A 3MEWA 1N8RC 1M90C 4FL6A 2GFUA 3C4SA 1NJIC 3CCJT 2QQSA 3F70A 3PMIA 2MWOA 5KH6A 3O8VA 4E7JA 2M16A 1YBYA 2HQEA 1YIJT 4BD3A 3P8BB 4BE2A 5IN1A 3OYDA 2EQKA 3ASKA 3OS0A 1H3ZA 4Q5WA 5M9OA 3Q1JA 3I55A 3CCVT 2K3XA 2L89A 2R5AA 4IUVA 2X4XA 3OY9A 4BDYA 4GY5A 1VQ4T 2JNGA 1W2BS 3CCVA 1M1KC 5J39A 4N4HA 4E7IA 1WJQA 2KVQG 3CCQT 4ZTFA 1VQPA 2MWPA 3CCMA 2LQ8A 3CC4A
chains in the Genus database with same CATH superfamily
1VYTA 2OAWA 2VGMA 3UATA 1WYXA 2BIVA 1UDLA 4AFSC 1Q86C 1VQ5Q 1VOMA 5J3BA 2RHYA 2DXCA 3URGA 1M90R 3GNFB 3QDRB 1YNZA 3CBMA 4J9GA 5GANd 4F7UF 1G3TA 4C8QA 3HHTB 2QA4T 3M59A 2DETA 4M78F 5CKDA 4HT9A 5GAOq 4J9IA 1CKAA 4KUDK 2KGTA 4FU6A 2HDAA 2COZA 2DD4A 4DQ2A 1QWFA 3GPLA 1M2VA 3JRZA 1TU0B 4LE9A 3VYGA 2LJ0A 3OW2P 4RTYA 3WVEB 1IGUA 3G71A 1KG1A 4CRIA 3QZ9B 4F7UB 5GANe 3E1SA 4BDZA 4QT7A 4IIOA 4M78B 1YHQA 3MEUA 2O9SA 1VQ4Q 2QXFA 1X43A 2YLBA 2DK3A 4OB1B 4J9FA 3HPWA 4J6XA 2AKLA 2EQUA 1JXOA 3VU3C 2J6OA 2LQKA 5GAMh 2LNHB 4FYVB 1QWEA 2LT1A 2FB7A 2JMCA 4JJNK 2XD0A 3EG2A 4E6RA 1YJWT 2BE9B 1KQSA 5GANf 4M7DG 5KYUB 1I5LA 1WNLA 2KBTA 2YUPA 3G4ST 1MMDA 1QVPA 2JTFA 3A5ZB 1QP3A 1Q82U 1VQLT 3RESA 5GMKi 4PJOE 4QQDA 2ED0A 1KJWA 3QUIA 3V8KA 2DO3A 1U1SA 1AWWA 5I2SA 3OB9A 5KYWA 3CEYA 2MK5A 3HRTA 4LDVA 4B9XA 2E6ZA 1E6GA 1KQ1A 5CQYA 1YHQQ 2QQBA 4X9DA 1QVFS 3M0QA 2V1QA 3CBPA 2E12A 4BE1A 2R58A 2VGNA 1R77A 3M0RA 4C0DB 2C06A 1YITT 3VUBA 4L59A 5IXFA 4VUBA 1JJ2A 3EGXB 1MHNA 1RABB 1NYFA 2K2MA 2CSIA 1Z9ZA 4F7UE 3TVTA 3FIFA 4FIBA 4FYYB 3NPFA 2P4RA 4XTYA 1X6GA 1ZUKA 3J81E 3EFOB 2AK5A 1M9SA 4M78E 4IUQA 2EYQA 1D1AA 3OW2A 5CVIA 1S1NA 4AMCA 4D6WA 1SHGA 2QA4A 2ESWA 3G6ET 2FG0A 1FXXA 2GQVA 4RUGA 2E64A 1GCPA 1RUWA 3MO8A 2IVWA 3G7ZA 1ZSGA 5GAOn 1K1ZA 4P5NA 1WXBA 4PJOA 1NPRA 5LJ3g 1M1FA 2DLPA 3M0SA 3EGDB 1VQOT 3RBBB 1VQ7T 3CPWP 3CMAA 2M0YA 3QG1A 5C6SA 2RB6A 1ZBXA 4JLIA 3JCMV 1YCYA 3JCMb 4XTZA 1LPLA 1YJNA 2XICA 1VQNQ 2O01E 1OQKA 5EC7A 1KHIA 3LWIA 3OYHA 5DM7R 1Q81C 5GMKj 2RF0A 1NEGA 2BZ8A 2F2XA 4A4GA 2HQHA 2CUDA 3S3NA 2H3EB 4C8QG 3QKJA 1YJWA 2LDMA 2QA4Q 3PT9A 2KR3A 2EJFA 1SHFA 3LGLA 2D1XA 2DTIA 3A8OB 1X6OA 2RO0A 3S3OA 2OTLA 3G4SA 3N5BB 1U8RA 3L42A 1XTDA 2YDLA 1NM7A 1W6XA 2Y4YA 3C95A 3LLRA 2DYIA 1OU9A 1N6AA 3ZEHA 1G83A 3QHSA 3BY7A 2JN0A 2DF6A 5GAN4 2DILA 3UWNA 3ZFJA 3CCMT 1MGQA 3OYBA 2RH2A 1QVGS 2VUBA 1M1GA 3QYGB 1JU5C 3CCRT 3CMAQ 5GAMd 1PG5B 2EQJA 1YN8A 2LCLA 1IHVA 1YWOA 3NMZC 2OTJQ 2IIMA 5LJ3h 2DL8A 2LVMA 1YITA 4JDSA 4J9BA 1D0YA 4RCBA 2E3HA 3RMSA 1CSKA 2P4TA 1SG5A 3JB9J 2ECZA 2J06A 3SDZA 3SHWA 2DD5A 1YJNQ 3OA6A 3HL8A 1WPYA 2FZKB 4M7AE 4PL6A 2VV5A 2KE9A 2COWA 3CQTA 3CPFA 4QQ6A 4E7HA 3PFSA 4M77A 2SRCA 1VQ6T 5A0LA 3OMCA 1TOVA 3TQ7P 1G8XA 1YJWQ 1I0CA 2H3JA 5GJVB 2FZGB 2ZGWA 3OYIA 3J80E 2FEIA 5A0DA 3I9QA 4J9CA 3G6EA 2OTLQ 1RAFB 2Y90A 3G4SQ 1WA7A 3CXCA 2RJEA 4M4ZA 3DLLA 4J6YA 7AT1B 2KT8A 4BB7A 2KI7A 3PNWC 1AVZC 1RL2A 2CUBA 3FC3A 1VQ5T 5A0GA 2PU9B 1RLQC 1WQWA 2CT3A 1VQ9T 1GBQA 1GCQA 4XQ3A 5CKFA 2ZZDA 1K8AC 1Q82R 1VQOA 1VQ7A 1HK9A 2QTVA 3OQ5A 2CKKA 3A8HB 4C92C 5GAMf 5KE3A 3M4YA 1YITQ 2O2OA 1M90C 2V8KA 2QQAA 4NL3A 3PMIA 2HNIA 2I2LA 3M58A 1BCMA 4M78D 5I22A 2NUTA 3GLXA 2XDBA 5IHIA 4E7JA 1D1CA 1YBYA 4M75C 1IXDA 1YIJT 1XJWB 4RKUE 3EG9A 4BY6C 2LCSA 5IN1A 2EQKA 3OS0A 4ELYC 1GBRA 5CO7A 4K11A 1UJ0A 1RACB 2R5AA 3QO3A 4M7AA 2EVRA 3H0IA 3G6EQ 3M0UA 1VQ4T 1OPLA 3JV3A 1I4K1 1W2BS 1EX4A 3CCVA 5J39A 4DBRA 2M9UA 1MMAA 2DL4A 4V2SA 2KVQG 1LNXA 1OOTA 4PJOG 3CCQT 4ZTFA 2QASA 2QG9B 1Y7XA 3CCMA 2HEQA 1Y96B 2DBMA 2LX7A 4AG1C 4DOVA 3HSBA 2EBPA 1NPPA 4C5IA 2JS2A 2O9VA 2K57A 3CCRA 8ATCB 1VQ7Q 4OGEA 2QDYB 5ECAA 3V8JA 4ESRA 2DRMA 2OX7A 3P8DA 2MYSA 2D6FA 2VVKA 5HK3A 3VRYA 3D7SB 4A4FA 5AYFA 2KRMA 3CCJQ 3BFMA 2DL7A 4XTUA 1UHFA 4J7IA 3VS4A 9ATCB 1VQ6A 5FLXE 1YHQT 1PSEA 4JLGA 1AZEA 2MCNA 2DTHA 4PFPA 4A54A 5KYXB 3CCVQ 3OYMA 2DXBA 2QI2A 5GAOl 4OMQA 2HBWA 4JRPA 4B9WA 4AT1B 5FU6C 1NZ9A 2DE0X 3V7RA 4BI8B 2CZ6B 1LVKA 1WJSA 3NTIA 4RCCA 3OYEA 3QBYA 1U06A 1AEYA 4E47A 5LJ3d 1XOVA 2YSQA 3SWNB 4A4EA 3R6NA 1VQ5A 1T3SA 4C92F 2KK4A 2M1HA 1ZSZC 4XU1A 1VQ9A 1WHJA 3META 3CCRQ 2ROLA 2RD1A 4R0KA 2L3QA 1OX8A 2AZVA 1PHTA 3FRNA 4M75F 3JAME 3OS5A 5KCOA 1VIFA 4MDWA 2CP2A 1YJ9T 1G2BA 4QVZA 3EGUA 4C92B 2VC8A 4R55A 3OSVA 4J9HA 5GMKe 2A0FB 1YIJA 3EFSA 1D3BA 3C12A 4HCKA 2RPNA 1K73U 4M77G 1BI1A 2DERA 4LNPA 1BYMA 4M75B 4JJBA 2RI2A 4BY6B 2FVUA 3L2WA 4IIMA 2CH4W 1SF9A 2YXYA 2Z0WA 3VS2A 2MI6A 2LQWA 1VQ4A 4ZNXA 2MOXA 4Z8AA 3A8GB 2VKNA 1NG2A 2RM4A 3QWYA 1VYVA 3RNJA 2AHJB 1KFZA 2RJCA 3EH2A 3CD6T 3CCQA 2FRWA 3MJXA 1PSFA 1VQNT 5LJ3f 1VQ9Q 1WLPB 3SEMA 2CDTA 3E9FA 1G5VA 4PKCC 1X27A 2D0QB 4N0AC 1GCQC 1JJ2P 4OMOA 4KGVB 5D6WA 3WVDB 4L6V5 4PLIA 2K5LA 2A3LA 3CMEA 4ANJA 1E6HA 4F17A 3M9QA 4IUUA 3JSCA 5I11A 2JTEA 1TXQA 1YIJQ 1SPKA 1X01A 4FYWB 3OYKA 2WSCE 3SFMA 4BUGA 1VA7A 4M7AG 3PTAA 5LJ5j 2WSFE 3OYYA 2Y4XA 2LJ1A 3MP6A 1N8RU 5IAYA 1B7TA 3CMAT 2K5IA 4BI4A 1WIEA 4BE0A 2OTJT 2VXFA 2E5QA 1UHCA 2XG8D 2DBKA 4D8KA 2XU8A 5CKBA 3FDRA 3H0FA 4C92E 2QDLA 5GAN7 3OS1A 3I56T 3JB9G 3EG1A 4OMFB 3RUXA 3CCQQ 4Y91A 3M5AA 2L0AA 3H8ZA 1YJNT 2D8HA 4WCIA 2K6DA 5FU6B 4M75E 3TEEA 3MP1A 1SSFA 1BU1A 4OF1A 5DY9A 4EIKA 1PWTA 3H9NA 3M4GA 1J3TA 2V1RA 4EMGA 2DFUA 1GRIA 2O31A 1M3AA 3CMEQ 5KYYA 1RI0A 2OTLT 4HA8A 4M7DC 1YJ9A 3NFCA 4LD9K 2ZCFB 5LL6S 3V7CA 5A2QE 4KH0B 1MUZA 4C5GA 2DXUA 4KGZB 1UGQB 2EQIA 1MV3A 3V7SA 1K9MU 2FL7A 1IB8A 1W4SA 2NUPB 4EMKB 5J26A 4MMKA 3GOXA 2ZPGB 1WJRA 2FPDA 1B3QA 1D0XA 4X34A 1M4ZA 2XDPA 4OMNA 4LD6A 4O5VA 2KSSA 2E70A 2M02A 1Q82C 3LGFA 3G1JA 3QSUA 4KH1B 3M0PA 3CD6A 3PIOA 2E6NA 2J05A 1SSHA 3VV0A 1VQNA 4OMMA 3TCJA 4F14A 1Y71A 1T0HA 1R0BG 2L3PA 3EG0A 3C94A 1U3OA 3VKIA 2K2VA 1UB4A 3U23A 1KC8U 2KAFA 2O88A 1QCOA 2CP5A 2RHZA 2GGRA 4TVRA 4FSSA 2D8JA 5GAN6 4JRIA 3JCMX 1NYGA 1YJ9Q 2WACA 3REAB 2NLUA 3J7AF 2E4HA 4Y28E 2JT4A 3CPWS 2PVGB 1MNEA 2L5QA 4PJNA 3OS2A 3CCST 3I55Q 3HRUA 1WXUA 1BIAA 3FLGA 1K0XA 3IQLA 3RKYA 5FWCA 3E9GA 1RAGB 1EZZB 2JXBA 1X6BA 3PE0A 1UJYA 1KC8C 1YFNA 4FYXB 3CXCP 2OI3A 4OP0A 4PNOA 4ME7A 1FWZA 1BBZA 2BE7D 2ZPIB 4NS5A 3CBOA 2OTJA 1K73R 3INZA 4ZTJA 2HKNA 4IURA 3DB3A 1BK2A 3RDVA 4DBQA 1QKWA 1IHWA 3I56A 2EGAA 1WDXA 2DIQA 2CGHA 3CD6Q 4RTUA 1JRIA 4LXCA 2MPXC 4FL6A 1U5SA 4FT4A 1WZOA 2GFUA 4MZMA 3CCJT 4RG8A 3F70A 5KH6A 1BIBA 1TSFA 2KNBB 4ATOA 2PNIA 4F7UA 2JM9A 4R56A 4M7DF 3H41A 5GAOm 2A7YA 2M16A 2HQEA 2K4YA 4BE2A 4M78A 1VUBA 2C0IA 2ABLA 4C8QC 1H3ZA 2F1LA 2F2WA 1VQMQ 2QTXA 3CCUQ 3CCVT 2L89A 1YCSB 3JCMg 2K7AA 1TTHB 3ZL7C 2E10A 4BDYA 1ABOA 2PZ1A 4E2FB 2GQIA 2RNAA 2CSQA 1TUDA 2JNGA 5L23A 2OAUA 1X2QA 1AWJA 4M7DB 1K76A 1BB9A 4N4HA 3X26B 4C92D 1V1CA 2QQ9A 2NUZA 3FJ5A 4JJCA 3VS0A 2EW3A 2YT6A 1OU8A 3CC2Q 4Y92A 4RTXA 5KYUA 3EHRA 1UGPB 5GMKh 4M75D 4JPBW 3I56Q 4ZGJB 3RKXA 4RTTA 3FB9A 2L3RA 1KD1U 1QVFA 3QDFA 4C0GA 2JVVA 1N8RR 4QQGA 3NHNA 1NJIR 3T9NA 3DB4A 4HVVA 4DA4A 3M53A 2JZ2A 2BKDN 3QJ6A 2CS7A 1KIKA 2R5MA 2GBQA 3QXEB 2RQTA 4FSXA 1YI2A 2GF7A 4DEYA 4ORZA 1KD1C 2HL3A 4JRKA 4XU3A 1M5Q1 4Z88A 1EIFA 3EGXA 3OBWA 2CP0A 5GANj 3CCSA 1IRXA 2B8AA 2PUKB 3JCMh 3LW5E 5EG2A 1HSQA 2GTOA 2HQXA 2XDDA 3CC7A 2BUDA 4EPCA 1PCXA 1T0JA 3EFOA 4GLKA 4MMLA 1S72T 4AG2C 1JB0E 2GFAA 2X51A 2H8HA 3LYIA 5HK0A 1AOJA 5KE2A 2RJFA 1UUEA 2DL5A 1KHCA 4ZGEB 5FROA 3OYGA 2DM1A 2RHUA 3L2VA 1K9MR 2KY9A 4J8OA 1H3HA 1OULA 4MDXA 5GAN5 4Z89A 4M7DE 2JUFA 2K9GA 2GNCA 4CI0C 1M8VA 5CIUA 3AT1B 4HKEA 4OB3B 3MEAA 3CCJA 3QIIA 4C8QF 2HKQB 6AT1B 2EYXA 1OX9A 2LMJA 2COYA 3R6OA 2KXDA 4AFZC 4QKUA 2LTOA 2AT1B 2DX1A 2LQNA 3MKDA 1YI2Q 3EGDA 1TH7A 2CYZB 3H0HA 3UPUA 1M3BA 2XHCA 3BE3A 1F1BB 3MEVA 3HP9A 3KFVA 2EQMA 1RI9A 2YUOA 2O4XB 4GLMA 1KC8R 4C8QB 3CCSQ 4HXJA 1UTIA 2QQRA 5CCAA 3CC7Q 1B34B 4PJOC 1BI0A 1K0SA 1Q7YU 1GFCA 2AKKA 5GAN2 1M2VB 3GP8A 4JS5A 4MZTA 2A36A 2YUNA 3I5SA 5CR2A 1PRMC 3CMET 2EFIA 3JCMc 2EGCA 3E2UA 2VASA 4KRTA 1QVGA 1I1JA 4DOWA 3TREA 1OEBA 5GMKl 4IKFA 1WHKA 2LZ6B 2K3BA 3JCMW 8AT1B 3PVQA 2DZCA 3ME9A 2M51A 2BTTA 1I81A 2HMAA 1PNJA 4F7UG 1KSWA 4XTWA 1PD1A 2PQWA 4M78G 3VS5A 1ARKA 1JO8A 5IHKA 4OB0B 1QMCA 4KGXB 1G3WA 2ZPHB 4XTXA 2QEXT 1K4US 4PLLA 3OYAA 3SB2A 1UFFA 2DJZA 3NTKA 2RHXA 4A4KA 3BDUA 5DLOA 2RI3A 4XTVA 2X3XD 3MP8A 2L8DA 2QGGA 3X20B 3JCMJ 1IREB 3OYCA 4EDUA 4XU2A 4HCBA 1IGQA 3DKMA 3GNGA 5IXBA 1S72A 2PVOB 3L2ZA 2JM8A 5KYWB 2D9TA 1KQSS 5FRMA 1FYNA 3FJPA 2KROA 2XKOC 3X24B 4JS4A 3MPUB 1Y57A 1H8KA 4J7FA 1C1AA 4FM4B 5HKCA 1QKXA 2EJGA 1FX7A 1M1KU 1OI1A 2FO0A 1ZQ1A 2XI9A 3I55T 3L2UA 4LDWA 2L3SA 2FPEA 3X28B 2HCKA 4M77C 2EKOA 1WGSA 1ZUUA 5I21A 1KD1R 4AFUC 1WQ7A 3JCMd 2V8JA 5KYNA 1Q86U 2YHTA 4A53A 4RG2A 1X69A 1N9RA 1WX6A 4PJOF 1VQPT 1JJ2S 1AZGB 2DEQA 2KDSA 2XMFA 3OYLA 1D0ZA 1YWPA 2RJDA 4MZPA 1HXDA 4Z02A 2DNUA 2QYZA 4UC4A 1K73C 1W2BA 5FW9A 1B07A 1WFWA 2ZAEA 5KCHA 1IZ6A 4RTVA 2JJ9A 1S72Q 3JCMe 2LX9A 1V29B 2HBPA 1RAIB 2CP3A 2DMOA 1UE9A 4M7DD 4OMLA 3OW2S 5LJ5g 3EHQA 2FHDA 4PJOB 2BZYA 1VQMT 3CCUT 4KUIA 3ZBDA 4J6WA 1QLYA 1ZHIA 3P8HA 3VS7A 1SRLA 2O4XA 5C0MA 5GAMj 2PUOB 1TS9A 1HD3A 1Y0MA 2FYKA 3LH5A 3VS6A 2VYTA 3RR6A 4O6JA 4LDYA 2DZ9A 3THKA 1Y96A 1B34A 1VQ8A 2CP7A 4BI3A 2LRQA 1QCNA 4M7AC 4II1A 3V8LA 1NE8A 1NJIU 2QEXA 3OBYA 4D8DA 3CC2T 1QQJA 3JCMf 1ZA1B 2LCCA 1AWOA 2YWWA 2AIRB 2J6KA 3UA6A 4HVUA 4AFQC 1C0MA 4F04B 1UEBA 2I0NA 1I07A 3CCLT 2X9HA 2E5KA 1SKUB 2DA9A 3M55A 2DIGA 3M56A 1PKTA 2IPOB 1ZBJA 2JOYA 2YRCA 3CC4Q 1N8RC 3C4SA 2JMAA 1NJIC 1ZSZB 2DRKA 1G3YA 2KYMA 1X75C 5GAOr 5KYXA 2AZSA 2VWFA 2RA2A 3A8LB 1Q7YR 3P8BB 5LJ5h 5HCKA 3OYDA 3ASKA 4M77F 1M2OA 4Q5WA 5M9OA 2GCXA 3I55A 1GFDA 3O5ZA 1RAEB 4IUVA 2RK1A 4CC7A 3A8MB 3OY9A 1SEMA 4ZGDB 3SWNA 1ZA2B 3JCMQ 1VQ8Q 1FMVA 4CC2A 2KQWA 1W70A 1EFNA 2E3IA 4J9DA 1TUGB 5I2MA 1MV0B 2KMTA 4ELZC 2QEXQ 3RIRA 1WJQA 2CP6A 3G71Q 1P92A 4M77B 4LDUA 1M27C 2CH4A 5CAIA 5D7UA 2J7IA 1VQPA 2ATCB 2K5FA 2CT4A 1HJDA 4JJDA 1NLOC 2PTKA 2LQ8A 1WXTA 4B6MA 4C92A 4XAXB 4RTWA 3C0CA 3I5RA 3VS1A 1K9MC 1HYOA 4LUEA 1W1FA 4XU0A 1OZ2A 4IUPA 2EYYA 4C8QD 4XK8E 1MNDA 1WHMA 1AHJB 2EYZA 3E19A 4M75A 5D6XA 1QP2A 2CZ7B 3SD4A 4FT2A 3PMTA 1KK7A 3OYFA 1QVFP 1PM3A 1UECA 1YI2T 3L1AA 2HSEB 3QYHB 3VJPA 1VQMA 2DTOA 3CCUA 2X35A 2SEMA 4QW2A 2D0NA 3CXCS 1WHLA 1RADB 1SRMA 3LX7A 4M7AF 1O9SA 2DXTA 4DBFA 2E41A 2BZXA 2MMPA 4FW2A 3CC7T 3TSZA 2NUTB 3L2RA 4RTZA 2DKGA 2EIFA 5D6YA 1UGVA 1M1KR 1CKBA 3EG9B 4ZN3A 2YRVA 4A4HA 5GMKm 3CC2A 1BI3A 2X4YA 3CCET 3M54A 5CK9A 4CC3A 4PJJA 1C6VX 2DL3A 1IO6A 3JB9F 2DVJA 1VQPQ 4M7AB 1Q81U 4JUVA 2W10A 2ZPFB 3BW1A 3CCLA 3RERA 2LP5A 4PFOA 3BDLA 2YRDA 4E7ZA 1Q86R 3DLMA 3OMGA 4FCYA 4A63B 1OV3A 2HD0A 3HKSA 4ZN1A 3QPHA 4PK4A 2HL5C 2CZ0B 2P0PA 1UGSB 3JB9H 4M77E 2A37A 5LJ3j 3PVLA 3OSSC 2IG0A 5L8RE 1T3LA 3KUFA 2ZPEB 4IUTA 3UT1A 2YUQA 4QVDA 3L2QA 2DVEA 3X25B 3ER0A 3VS3A 1OZ3A 4J83A 2XK0A 4KT0E 3UA7A 1KQ2A 2M0OA 3HFOA 2EJ9A 2EYWA 4HVWA 2CZ1B 2KYBA 1VQLA 4OGCA 3EFRA 3REBB 1Z9QA 2K3YA 3LWHA 1ABQA 1BKBA 4C0ZA 4E7KA 1ZLMA 2RN8A 3NTHA 1ZSZA 1RAAB 1PC0A 2G3RA 2KEAA 3OYJA 1GXIE 1M3CA 3JB9I 3A1PA 1WHHA 2A08A 1X2KA 3CCLQ 3GF5A 4KULA 5GANg 4WF2A 2XIDA 1LOJA 2EKHA 3HTRA 1FMWA 3WXMB 5LJ5d 5FWBA 2NUPA 1QCFA 1QVGP 4EMKA 2PVDB 1N9SA 3KBGA 1PRLC 1ZX6A 2RQVA 2C0OA 5GAMe 1VQKT 4HT8A 3KXTA 1JEGA 2F5TX 4BACA 1K8AU 4PJOD 4F16A 5CQXA 4RMOA 2DJQA 5FU7C 1PD0A 2E65A 5LJ5e 2GTJA 2B86A 2HSPA 1M90U 5GJWB 4N4GA 2KRNA 3SWNC 2JS0A 2VXEA 2WSEE 5CKHA 3VUZA 4CC4B 3CPWA 1VQLQ 5IH2A 2ENMA 1D3BB 2EAYA 2FPFA 3GBQA 1G3SA 1M30A 3CCEA 2W0ZA 3EH1A 1R0CB 3LH0A 1Y07A 2ZPBB 2EPDA 4N0AA 3HFNA 1JBMA 2LC4A 4N4IA 4C92G 4JZ3A 4HCCA 3NGPA 1D1BA 1D09B 2QGFB 1OPKA 2CREA 4C5HA 1XNIA 4J9EA 1Q95G 4E7LA 3QWXX 4PJMA 4M75G 4PFZA 4X9CA 1LCKA 4NL2A 2R57A 2HZYA 5LJ5f 4YTLA 3MCAB 5GANh 2L2PA 4JRQA 2DPPB 3TU4K 1NLPC 5FRNA 4L5GA 4E7SA 1WHGA 1RAHB 3PIPA 4C5EA 3S6WA 4DEXA 5CKEA 2KXCA 1JXMA 2F5KA 3CC4T 3S3MA 1H92A 2KT1A 2X4JA 2OJ2A 1BI2A 2RK2A 3CCEQ 2J6FA 2RQRA 3EG3A 2RI5A 3TSWA 2VB6A 1W2BP 1QW1A 2RMOA 3H6ZA 3VYHB 1PKSA 3M0TA 1N27A 5GAOp 4C0FA 1VQOQ 3OYNA 2E1HA 3M57A 2F2VA 4JZ4A 3UF4A 2K79A 2X3WD 4M77D 1YP5A 3MHXA 2YLCA 4M7DA 2RHIA 1Q7YC 1UG1A 1Q81R 1AD5A 5HY6A 1VQ8T 4OB2B 2QK0A 5DLQE 4J5YA 4M78C 4OVAA 3G71T 3VRZA 1H641 2LNVA 1OYXA 2RQWA 1VQKA 4KBMB 1M8MA 3EAEA 2P0KA 3GIBA 2DAQA 1A0NB 3JCMP 1NBEB 1E7OA 2P84A 5KYYB 4LDXA 1R8OB 1GL5A 2C0TA 2MIOA 4EMHA 2P0QA 2FZCB 1ACMB 4HCZA 1MMNA 4QVCA 2HAXA 3PGGA 5FU7B 5IT9E 1NEBA 3FEOA 4DBHA 1I5OB 4PJLA 4NOYA 3CCMQ 3AHUA 4FW1A 2X4WA 2ED1A 2JTMA 1I8FA 3MEWA 4C8QE 2A28A 3ULRB 1VYUA 4GBQA 2QQSA 2MWOA 1V76A 1UGRB 1AT1B 2MAMA 3O8VA 1MMGA 1U1TA 4M7AD 2RQUA 2V8IA 4BD3A 2NWMA 2QAZA 1O75A 3HRSA 2F69A 3QZ5B 3Q1JA 4OMPA 1AWXA 1FMKA 5LJ3e 2V26A 2ROTA 2LJ3A 2K3XA 2EWNA 2X4XA 4EMKC 2G6FX 1N5ZA 4LN2A 2KRSA 3I35A 4GY5A 1KQSP 1TWBA 2LT4A 1DJ7B 3RKWA 4LUDA 5IHNA 1TUCA 1VQ6Q 1ZUYA 1VQKQ 2MF2A 1WI7A 4C0DC 1M1KC 3A98A 2EGEA 5AT1B 3JB9D 1BCOA 1TG0A 1VIEA 4E7IA 3UDCA 1LJOA 2DYBA 5GAN8 2DEUA 1JQQA 1K9AA 5GAMg 4WTOB 2NYSA 4X1VA 2JW4A 2FRYA 5GAN3 2MWPA 1XQHA 3QJYA 1RLPC 3CC4A 3RMQA 1K8AR
chains in the Genus database with same CATH topology
1UGPB 1NPPA 2VGMA 4M75D 5GMKh 1K9MC 4C5IA 2K57A 3CCRA 2BIVA 4ZGJB 3RKXA 3FB9A 1Q86C 4OGEA 1OZ2A 2L3RA 2QDYB 4XU0A 5J3BA 4IUPA 1KD1U 3V8JA 1QVFA 4C8QD 4XK8E 2RHYA 2DXCA 2JVVA 3URGA 1AHJB 4C0GA 3P8DA 3GNFB 4QQGA 2D6FA 3E19A 4M75A 3T9NA 5D6XA 1QP2A 2CZ7B 3SD4A 3QDRB 3PMTA 3DB4A 4FT2A 3OYFA 3CBMA 5HK3A 5GANd 1YI2T 3L1AA 4F7UF 4DA4A 1G3TA 3QYHB 4C8QA 3M53A 2JZ2A 2BKDN 3HHTB 2DTOA 3QJ6A 3VJPA 3CCUA 3M59A 2CS7A 2QA4T 1VQMA 4A4FA 2R5MA 5AYFA 2X35A 4M78F 5CKDA 4HT9A 4QW2A 5GAOq 3CXCS 3BFMA 3QXEB 4XTUA 4FSXA 3OYDA 4KUDK 1YI2A 3LX7A 4FU6A 4J7IA 4M7AF 1VQ6A 2DD4A 4DQ2A 2GF7A 3GPLA 1O9SA 2DXTA 3JRZA 2E41A 2MMPA 5FLXE 1YHQT 3VYGA 3CC7T 1KD1C 1PSEA 4XU3A 4JRKA 3WVEB 1M5Q1 4JLGA 1EIFA 3OBWA 3G71A 3L2RA 4CRIA 2DKGA 2EIFA 2DTHA 3QZ9B 4A54A 4F7UB 5GANe 3CCSA 5GANj 5D6YA 2B8AA 3E1SA 2PUKB 3OYMA 2DXBA 4BDZA 2QI2A 3JCMh 5GAOl 3LW5E 5EG2A 4ZN3A 2YRVA 4M78B 4A4HA 5GMKm 4JRPA 3CC2A 4B9WA 1YHQA 2HQXA 3MEUA 1BI3A 2XDDA 2BUDA 2X4YA 5FU6C 3CC7A 1NZ9A 3CCET 3M54A 5CK9A 3V7RA 4BI8B 4EPCA 2CZ6B 2QXFA 2YLBA 3JB9F 1WJSA 3NTIA 2DK3A 4GLKA 4MMLA 4RCCA 1S72T 4M7AB 4OB1B 3OYEA 1JB0E 2GFAA 3HPWA 3QBYA 4J6XA 4JUVA 3LYIA 4E47A 1Q81U 5LJ3d 1XOVA 3SWNB 4A4EA 5HK0A 1VQ5A 5KE2A 2EQUA 2RJFA 4C92F 2KK4A 2M1HA 1KHCA 2ZPFB 4ZGEB 4XU1A 5FROA 3OYGA 1VQ9A 3BW1A 3CCLA 3RERA 2RHUA 3L2VA 3VU3C 3META 2KY9A 2LQKA 5GAMh 3BDLA 2LT1A 2RD1A 2FB7A 3DLMA 3OMGA 4J8OA 4MDXA 5GAN5 4JJNK 3FRNA 2XD0A 4M7DE 2HD0A 4M75F 2JUFA 3HKSA 3JAME 4CI0C 4ZN1A 3QPHA 1M8VA 5CIUA 3OS5A 4HKEA 4OB3B 5KCOA 1VIFA 3MEAA 3CCJA 3QIIA 2CZ0B 2P0PA 4MDWA 1UGSB 3JB9H 4M77E 4C8QF 1YJWT 1YJ9T 5LJ3j 1KQSA 3OSSC 4QVZA 4C92B 2IG0A 5GANf 5L8RE 1I5LA 1WNLA 2VC8A 3KUFA 4M7DG 4R55A 3OSVA 2ZPEB 4IUTA 3R6OA 3UT1A 5GMKe 1YIJA 3EFSA 1D3BA 3C12A 2LTOA 4QVDA 3L2QA 2DVEA 3X25B 1K73U 4M77G 3G4ST 3ER0A 1QVPA 2JTFA 3A5ZB 1BI1A 1QP3A 1TH7A 2CYZB 1OZ3A 1Q82U 3RESA 5GMKi 4J83A 2XHCA 3UPUA 1VQLT 4PJOE 4QQDA 2XK0A 1BYMA 4KT0E 4M75B 1KQ2A 3MEVA 3QUIA 2M0OA 3HFOA 3V8KA 2DO3A 1U1SA 2RI2A 3HP9A 2EQMA 5I2SA 2EJ9A 2O4XB 4BY6B 2FVUA 3OB9A 3L2WA 4C8QB 3CEYA 1VQ4A 2MI6A 3HRTA 2CZ1B 4LDVA 1VQLA 4B9XA 2E6ZA 4OGCA 3EFRA 3A8GB 1KQ1A 2K3YA 3LWHA 5CQYA 4C0ZA 1BKBA 2QQBA 2QQRA 5CCAA 1B34B 4X9DA 2RM4A 4E7KA 1QVFS 4PJOC 1BI0A 1Q7YU 3NTHA 2AHJB 2RJCA 3CBPA 2E12A 4BE1A 3CD6T 2R58A 2VGNA 2G3RA 5GAN2 4C0DB 3CCQA 2C06A 3GP8A 4JS5A 4MZTA 1YITT 1PSFA 3VUBA 4L59A 3OYJA 1GXIE 1VQNT 4VUBA 3JB9I 1JJ2A 1MHNA 5LJ3f 3E9FA 1G5VA 5CR2A 4PKCC 3CMET 3GF5A 2D0QB 2EFIA 4KULA 4N0AC 3JCMc 5GANg 1QVGA 4WF2A 4DOWA 3TREA 4F7UE 2XIDA 3FIFA 4FIBA 1LOJA 5D6WA 5GMKl 4IKFA 4XTYA 3WVDB 3WXMB 5LJ5d 4L6V5 3J81E 1M9SA 4M78E 4PLIA 4EMKA 2K5LA 2A3LA 2PVDB 4IUQA 1N9SA 3KBGA 3CMEA 2DZCA 3JCMW 3ME9A 2EYQA 1I81A 5CVIA 4F7UG 3OW2A 4D6WA 3M9QA 4IUUA 3JSCA 4XTWA 2QA4A 2PQWA 1X01A 4M78G 3G6ET 3OYKA 5GAMe 1FXXA 2GQVA 2WSCE 1VQKT 3SFMA 2E64A 4OB0B 3KXTA 4HT8A 2F5TX 4BUGA 4BACA 1G3WA 1K8AU 2ZPHB 4XTXA 2QEXT 3MO8A 4PJOD 4M7AG 5CQXA 4PLLA 3OYAA 2IVWA 4RMOA 3PTAA 3G7ZA 2E65A 5FU7C 3SB2A 5LJ5j 5LJ5e 2WSFE 3OYYA 5GAOn 2Y4XA 3MP6A 1N8RU 1M90U 2DJZA 5IAYA 4N4GA 4P5NA 3CMAT 3NTKA 2K5IA 1NPRA 2RHXA 4BI4A 4PJOA 3SWNC 4A4KA 2VXEA 2WSEE 5CKHA 3BDUA 3VUZA 3CPWA 4BE0A 5DLOA 2RI3A 5LJ3g 4XTVA 2OTJT 2VXFA 2E5QA 1M1FA 3MP8A 2L8DA 2XG8D 1D3BB 2EAYA 2XU8A 5CKBA 3X20B 3FDRA 1G3SA 1IREB 3JCMJ 4C92E 5GAN7 3OYCA 4EDUA 4XU2A 1VQOT 3CCEA 1VQ7T 4HCBA 3OS1A 3I56T 3CMAA 3DKMA 3GNGA 3JB9G 4OMFB 3RUXA 3LH0A 4Y91A 1Y07A 2ZPBB 1S72A 3M5AA 3QG1A 2PVOB 3H8ZA 5C6SA 2RB6A 3L2ZA 4N0AA 1YJNT 1ZBXA 4JLIA 3HFNA 1JBMA 2LC4A 4N4IA 1YCYA 3JCMV 4C92G 2D9TA 1KQSS 5FRMA 5FU6B 4HCCA 3FJPA 4M75E 3TEEA 2XKOC 1SSFA 3MP1A 4OF1A 5DY9A 3X24B 4XTZA 3JCMb 4JS4A 3M4GA 4J7FA 4FM4B 1YJNA 2XICA 5HKCA 4C5HA 4EMGA 2EJGA 2O01E 1XNIA 4E7LA 1FX7A 1M1KU 1KHIA 3LWIA 4M75G 5DM7R 1OI1A 3OYHA 4X9CA 5GMKj 1Q81C 1ZQ1A 2XI9A 4NL2A 4A4GA 2R57A 5LJ5f 3I55T 3S3NA 4YTLA 1RI0A 3MCAB 2OTLT 5GANh 4HA8A 4M7DC 3L2UA 4C8QG 4JRQA 4LDWA 3QKJA 1YJWA 2LDMA 2DPPB 1YJ9A 3X28B 3NFCA 4LD9K 2ZCFB 5LL6S 3V7CA 3PT9A 2EJFA 4M77C 5A2QE 2EKOA 1WGSA 3TU4K 5FRNA 3LGLA 4C5GA 2DTIA 2DXUA 5I21A 3A8OB 1UGQB 1X6OA 4L5GA 2RO0A 3S3OA 2OTLA 1WQ7A 3JCMd 3G4SA 3N5BB 3V7SA 1K9MU 1U8RA 3L42A 2V8JA 2FL7A 1XTDA 3C95A 1W4SA 2Y4YA 3LLRA 4EMKB 2YHTA 5J26A 4MMKA 4A53A 4RG2A 1N6AA 3GOXA 1Q86U 2ZPGB 3ZEHA 3PIPA 3QHSA 1WJRA 1N9RA 3BY7A 2JN0A 4PJOF 1VQPT 1JJ2S 4X34A 5GAN4 1M4ZA 2DEQA 2KDSA 3S6WA 4C5EA 5CKEA 3UWNA 3OYLA 3ZFJA 2XDPA 3CCMT 4LD6A 1MGQA 2RJDA 3OYBA 2F5KA 1HXDA 4MZPA 2RH2A 4O5VA 4Z02A 3CC4T 3S3MA 2KSSA 4UC4A 1K73C 1QVGS 1W2BA 2E70A 2VUBA 1M1GA 2X4JA 1BI2A 3QYGB 2RK2A 1Q82C 3LGFA 5KCHA 1IZ6A 2RI5A 3CCRT 5GAMd 3QSUA 2EQJA 2LCLA 3JCMe 3CD6A 2LX9A 5LJ3h 3PIOA 1V29B 2E6NA 2HBPA 2LVMA 1QW1A 3H6ZA 1YITA 4JDSA 3VYHB 3VV0A 1VQNA 1N27A 4RCBA 3TCJA 5LJ5g 5GAOp 3OW2S 4M7DD 1Y71A 2FHDA 4C0FA 4PJOB 3RMSA 3OYNA 2P4TA 3JB9J 2E1HA 3M57A 3SDZA 3C94A 1VQMT 2DD5A 4M77D 3CCUT 4KUIA 3VKIA 2K2VA 1UB4A 3ZBDA 3OA6A 3MHXA 1KC8U 2KAFA 1WPYA 2YLCA 3HL8A 4J6WA 1ZHIA 4M7DA 2RHIA 1Q7YC 4M7AE 4PL6A 2VV5A 3P8HA 3CPFA 5HY6A 1VQ8T 4QQ6A 2O4XA 4E7HA 3PFSA 5C0MA 2RHZA 2PUOB 4TVRA 5GAMj 4M77A 4OB2B 1VQ6T 5A0LA 3OMCA 2FYKA 5GAN6 4JRIA 5DLQE 3JCMX 2VYTA 4J5YA 2H3JA 2WACA 4O6JA 2NLUA 2ZGWA 2DZ9A 4LDYA 4M78C 3J7AF 4OVAA 3OYIA 4Y28E 3J80E 3CPWS 1Y96A 5A0DA 1B34A 3G71T 2PVGB 2L5QA 1H641 3CCST 4BI3A 3OS2A 3G6EA 1VQ8A 2LRQA 3HRUA 4M7AC 2LNVA 1OYXA 4II1A 1VQKA 2Y90A 4KBMB 3FLGA 1BIAA 3V8LA 1NE8A 3EAEA 2P0KA 1NJIU 3GIBA 2DAQA 3CXCA 2QEXA 3OBYA 3RKYA 2RJEA 3JCMP 3CC2T 3E9GA 3DLLA 4J6YA 3JCMf 4LDXA 1KG1A 1KC8C 1R8OB 2LCCA 4BB7A 3PNWC 4OP0A 4PNOA 4EMHA 1RL2A 2P0QA 4ME7A 1FWZA 2ZPIB 3FC3A 1VQ5T 5A0GA 4HCZA 2PU9B 4NS5A 3CBOA 4QVCA 1WQWA 1UEBA 2HAXA 2OTJA 1VQ9T 3PGGA 3CCLT 4XQ3A 3INZA 5CKFA 5FU7B 5IT9E 4ZTJA 4IURA 2ZZDA 3DB3A 3FEOA 1K8AC 3M55A 1VQOA 1VQ7A 2DIGA 3I56A 1HK9A 3OQ5A 4NOYA 2DIQA 2CKKA 2CGHA 3M56A 3AHUA 1JRIA 2X4WA 3A8HB 2JOYA 4C92C 5GAMf 2JTMA 5KE3A 1I8FA 3M4YA 3MEWA 4C8QE 1N8RC 2V8KA 1M90C 4FL6A 2QQAA 4FT4A 2GFUA 3C4SA 1NJIC 4MZMA 2QQSA 4NL3A 3CCJT 4RG8A 2HNIA 2I2LA 3F70A 3M58A 2MWOA 3PMIA 4M78D 1G3YA 5KH6A 1BIBA 1UGRB 1X75C 3GLXA 4ATOA 2MAMA 3O8VA 5GAOr 2XDBA 4F7UA 4E7JA 4R56A 4M7DF 1U1TA 2A7YA 2M16A 1YBYA 4M75C 5GAOm 2HQEA 2RA2A 1YIJT 4M7AD 2V8IA 3A8LB 4RKUE 4BD3A 2K4YA 3P8BB 5LJ5h 4BE2A 4BY6C 4M78A 1O75A 1VUBA 3HRSA 2EQKA 3ASKA 2F69A 4M77F 5IN1A 4C8QC 4ELYC 3OS0A 1H3ZA 4Q5WA 3QZ5B 3Q1JA 5CO7A 5M9OA 2QTXA 2GCXA 5LJ3e 3I55A 3CCVT 2K3XA 2L89A 3JCMg 2EWNA 2R5AA 2RK1A 3QO3A 2X4XA 4IUVA 4EMKC 4M7AA 2E10A 3A8MB 3OY9A 4BDYA 4ZGDB 4GY5A 3SWNA 3JCMQ 2LT4A 1VQ4T 1DJ7B 3RKWA 2JNGA 1I4K1 2KQWA 2OAUA 1W2BS 2MF2A 4C0DC 3CCVA 5I2MA 5J39A 1M1KC 4M7DB 2KMTA 3JB9D 4ELZC 1VIEA 4N4HA 4E7IA 3UDCA 3X26B 3RIRA 1LJOA 1WJQA 5GAN8 2M9UA 1P92A 4M77B 4V2SA 4C92D 2KVQG 1LNXA 4LDUA 4PJOG 3CCQT 2QQ9A 5CAIA 5GAMg 4ZTFA 1VQPA 2K5FA 5GAN3 1Y7XA 2MWPA 3CCMA 2LQ8A 1Y96B 1XQHA 3QJYA 4DOVA 3CC4A 4C92A 3HSBA 3RMQA 4XAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPP A;  1K9M C;  4C5I A;  3CCR A;  2BIV A;  1Q86 C;  2L3R A;  1KD1 U;  1OZ2 A;  1QVF A;  5J3B A;  4IUP A;  2RHY A;  2JVV A;  3P8D A;  4QQG A;  5D6X A;  3SD4 A;  3PMT A;  3DB4 A;  3OYF A;  1YI2 T;  2JZ2 A;  1VQM A;  2BKD N;  3CCU A;  2QA4 T;  3QJ6 A;  4A4F A;  2R5M A;  2X35 A;  4QW2 A;  3CXC S;  1YI2 A;  3LX7 A;  4FU6 A;  1VQ6 A;  2GF7 A;  5FLX E;  1YHQ T;  3CC7 T;  1KD1 C;  1EIF A;  3G71 A;  3L2R A;  4CRI A;  2EIF A;  3CCS A;  5D6Y A;  2B8A A;  3OYM A;  4BDZ A;  4ZN3 A;  2YRV A;  4A4H A;  3CC2 A;  4B9W A;  1YHQ A;  2HQX A;  3MEU A;  3CC7 A;  2BUD A;  2X4Y A;  3CCE T;  1NZ9 A;  1WJS A;  3NTI A;  1S72 T;  3OYE A;  1Q81 U;  2GFA A;  3QBY A;  3LYI A;  1VQ5 A;  4A4E A;  5KE2 A;  2EQU A;  2RJF A;  2M1H A;  1KHC A;  1VQ9 A;  5FRO A;  3OYG A;  3CCL A;  2RHU A;  3L2V A;  3MET A;  3BDL A;  3DLM A;  3OMG A;  2JUF A;  3HKS A;  3JAM E;  4ZN1 A;  5CIU A;  5KCO A;  3CCJ A;  3MEA A;  3QII A;  1YJW T;  1YJ9 T;  1KQS A;  4QVZ A;  2IG0 A;  3KUF A;  4IUT A;  3UT1 A;  1YIJ A;  2LTO A;  3L2Q A;  1K73 U;  3G4S T;  3ER0 A;  3A5Z B;  2JTF A;  1Q82 U;  1VQL T;  1OZ3 A;  2XHC A;  4QQD A;  2XK0 A;  3MEV A;  2M0O A;  2DO3 A;  2RI2 A;  2EQM A;  2O4X B;  3OB9 A;  3L2W A;  3CEY A;  1VQ4 A;  2MI6 A;  1VQL A;  4B9X A;  2E6Z A;  2K3Y A;  1BKB A;  2QQR A;  4E7K A;  1QVF S;  1Q7Y U;  3NTH A;  2RJC A;  4BE1 A;  3CD6 T;  2R58 A;  3CCQ A;  2G3R A;  1YIT T;  4L59 A;  3OYJ A;  1VQN T;  1JJ2 A;  1MHN A;  3E9F A;  1G5V A;  3CME T;  2EFI A;  1QVG A;  3TRE A;  5D6W A;  4IKF A;  3J81 E;  4PLI A;  3CME A;  4IUQ A;  3KBG A;  3ME9 A;  3OW2 A;  3M9Q A;  4IUU A;  2QA4 A;  2PQW A;  3G6E T;  3OYK A;  1VQK T;  4BAC A;  1K8A U;  2QEX T;  3MO8 A;  4PLL A;  3OYA A;  3OYY A;  3MP6 A;  1N8R U;  1M90 U;  5IAY A;  4N4G A;  3CMA T;  3NTK A;  1NPR A;  2RHX A;  3CPW A;  4BE0 A;  2OTJ T;  2RI3 A;  2E5Q A;  3MP8 A;  2L8D A;  3FDR A;  3OYC A;  4EDU A;  1VQO T;  3CCE A;  1VQ7 T;  3OS1 A;  3I56 T;  3CMA A;  3LH0 A;  1S72 A;  1YJN T;  3H8Z A;  5C6S A;  4N4I A;  2D9T A;  1KQS S;  5FRM A;  3MP1 A;  1SSF A;  1YJN A;  4C5H A;  1XNI A;  4E7L A;  1M1K U;  1KHI A;  3OYH A;  5DM7 R;  1OI1 A;  1Q81 C;  4A4G A;  2R57 A;  3I55 T;  3S3N A;  4YTL A;  1RI0 A;  2OTL T;  3L2U A;  3QKJ A;  1YJW A;  1YJ9 A;  2LDM A;  5LL6 S;  5A2Q E;  2EKO A;  1WGS A;  5FRN A;  3LGL A;  4C5G A;  1X6O A;  2RO0 A;  3S3O A;  2OTL A;  3G4S A;  1K9M U;  3L42 A;  1XTD A;  1Q86 U;  3LLR A;  5J26 A;  4RG2 A;  3GOX A;  3ZEH A;  3PIP A;  1WJR A;  1VQP T;  1JJ2 S;  4X34 A;  4C5E A;  2KDS A;  3S6W A;  3UWN A;  3OYL A;  2XDP A;  3CCM T;  4LD6 A;  2RJD A;  3OYB A;  2F5K A;  4Z02 A;  3CC4 T;  3S3M A;  1K73 C;  4UC4 A;  1QVG S;  1W2B A;  2E70 A;  1M1G A;  1Q82 C;  3LGF A;  3CCR T;  1IZ6 A;  2RI5 A;  5KCH A;  2EQJ A;  2LCL A;  3CD6 A;  3PIO A;  2LVM A;  2E6N A;  3H6Z A;  1YIT A;  1VQN A;  3OW2 S;  1N27 A;  2FHD A;  3OYN A;  1VQM T;  3CCU T;  1KC8 U;  3OA6 A;  2RHI A;  1Q7Y C;  4PL6 A;  3P8H A;  3CPF A;  5HY6 A;  1VQ8 T;  4QQ6 A;  2O4X A;  4E7H A;  3PFS A;  5C0M A;  2RHZ A;  4TVR A;  1VQ6 T;  3OMC A;  5DLQ E;  2VYT A;  2WAC A;  2NLU A;  3J7A F;  4OVA A;  3OYI A;  3J80 E;  3CPW S;  3G71 T;  1VQ8 A;  3CCS T;  3G6E A;  3OS2 A;  2LRQ A;  1OYX A;  4II1 A;  1VQK A;  3FLG A;  3EAE A;  2P0K A;  1NJI U;  3CXC A;  2DAQ A;  2QEX A;  3CC2 T;  2RJE A;  3E9G A;  3DLL A;  1KC8 C;  2LCC A;  3PNW C;  1RL2 A;  3FC3 A;  1VQ5 T;  4HCZ A;  4NS5 A;  1UEB A;  2OTJ A;  1VQ9 T;  3CCL T;  4ZTJ A;  5IT9 E;  4IUR A;  3DB3 A;  1K8A C;  3FEO A;  1VQO A;  1VQ7 A;  3I56 A;  2DIG A;  3OQ5 A;  2DIQ A;  2CKK A;  2X4W A;  2JOY A;  5KE3 A;  3MEW A;  1N8R C;  1M90 C;  4FL6 A;  2GFU A;  3C4S A;  1NJI C;  3CCJ T;  2QQS A;  3F70 A;  3PMI A;  2MWO A;  5KH6 A;  3O8V A;  4E7J A;  2M16 A;  1YBY A;  2HQE A;  1YIJ T;  4BD3 A;  3P8B B;  4BE2 A;  5IN1 A;  3OYD A;  2EQK A;  3ASK A;  3OS0 A;  1H3Z A;  4Q5W A;  5M9O A;  3Q1J A;  3I55 A;  3CCV T;  2K3X A;  2L89 A;  2R5A A;  4IUV A;  2X4X A;  3OY9 A;  4BDY A;  4GY5 A;  1VQ4 T;  2JNG A;  1W2B S;  3CCV A;  1M1K C;  5J39 A;  4N4H A;  4E7I A;  1WJQ A;  2KVQ G;  3CCQ T;  4ZTF A;  1VQP A;  2MWP A;  3CCM A;  2LQ8 A;  3CC4 A; 
#chains in the Genus database with same CATH topology
 1VYT A;  2OAW A;  2VGM A;  3UAT A;  1WYX A;  2BIV A;  1UDL A;  4AFS C;  1Q86 C;  1VQ5 Q;  1VOM A;  5J3B A;  2RHY A;  2DXC A;  3URG A;  1M90 R;  3GNF B;  3QDR B;  1YNZ A;  3CBM A;  4J9G A;  5GAN d;  4F7U F;  1G3T A;  4C8Q A;  3HHT B;  2QA4 T;  3M59 A;  2DET A;  4M78 F;  5CKD A;  4HT9 A;  5GAO q;  4J9I A;  1CKA A;  4KUD K;  2KGT A;  4FU6 A;  2HDA A;  2COZ A;  2DD4 A;  4DQ2 A;  1QWF A;  3GPL A;  1M2V A;  3JRZ A;  1TU0 B;  4LE9 A;  3VYG A;  2LJ0 A;  3OW2 P;  4RTY A;  3WVE B;  1IGU A;  3G71 A;  1KG1 A;  4CRI A;  3QZ9 B;  4F7U B;  5GAN e;  3E1S A;  4BDZ A;  4QT7 A;  4IIO A;  4M78 B;  1YHQ A;  3MEU A;  2O9S A;  1VQ4 Q;  2QXF A;  1X43 A;  2YLB A;  2DK3 A;  4OB1 B;  4J9F A;  3HPW A;  4J6X A;  2AKL A;  2EQU A;  1JXO A;  3VU3 C;  2J6O A;  2LQK A;  5GAM h;  2LNH B;  4FYV B;  1QWE A;  2LT1 A;  2FB7 A;  2JMC A;  4JJN K;  2XD0 A;  3EG2 A;  4E6R A;  1YJW T;  2BE9 B;  1KQS A;  5GAN f;  4M7D G;  5KYU B;  1I5L A;  1WNL A;  2KBT A;  2YUP A;  3G4S T;  1MMD A;  1QVP A;  2JTF A;  3A5Z B;  1QP3 A;  1Q82 U;  1VQL T;  3RES A;  5GMK i;  4PJO E;  4QQD A;  2ED0 A;  1KJW A;  3QUI A;  3V8K A;  2DO3 A;  1U1S A;  1AWW A;  5I2S A;  3OB9 A;  5KYW A;  3CEY A;  2MK5 A;  3HRT A;  4LDV A;  4B9X A;  2E6Z A;  1E6G A;  1KQ1 A;  5CQY A;  1YHQ Q;  2QQB A;  4X9D A;  1QVF S;  3M0Q A;  2V1Q A;  3CBP A;  2E12 A;  4BE1 A;  2R58 A;  2VGN A;  1R77 A;  3M0R A;  4C0D B;  2C06 A;  1YIT T;  3VUB A;  4L59 A;  5IXF A;  4VUB A;  1JJ2 A;  3EGX B;  1MHN A;  1RAB B;  1NYF A;  2K2M A;  2CSI A;  1Z9Z A;  4F7U E;  3TVT A;  3FIF A;  4FIB A;  4FYY B;  3NPF A;  2P4R A;  4XTY A;  1X6G A;  1ZUK A;  3J81 E;  3EFO B;  2AK5 A;  1M9S A;  4M78 E;  4IUQ A;  2EYQ A;  1D1A A;  3OW2 A;  5CVI A;  1S1N A;  4AMC A;  4D6W A;  1SHG A;  2QA4 A;  2ESW A;  3G6E T;  2FG0 A;  1FXX A;  2GQV A;  4RUG A;  2E64 A;  1GCP A;  1RUW A;  3MO8 A;  2IVW A;  3G7Z A;  1ZSG A;  5GAO n;  1K1Z A;  4P5N A;  1WXB A;  4PJO A;  1NPR A;  5LJ3 g;  1M1F A;  2DLP A;  3M0S A;  3EGD B;  1VQO T;  3RBB B;  1VQ7 T;  3CPW P;  3CMA A;  2M0Y A;  3QG1 A;  5C6S A;  2RB6 A;  1ZBX A;  4JLI A;  3JCM V;  1YCY A;  3JCM b;  4XTZ A;  1LPL A;  1YJN A;  2XIC A;  1VQN Q;  2O01 E;  1OQK A;  5EC7 A;  1KHI A;  3LWI A;  3OYH A;  5DM7 R;  1Q81 C;  5GMK j;  2RF0 A;  1NEG A;  2BZ8 A;  2F2X A;  4A4G A;  2HQH A;  2CUD A;  3S3N A;  2H3E B;  4C8Q G;  3QKJ A;  1YJW A;  2LDM A;  2QA4 Q;  3PT9 A;  2KR3 A;  2EJF A;  1SHF A;  3LGL A;  2D1X A;  2DTI A;  3A8O B;  1X6O A;  2RO0 A;  3S3O A;  2OTL A;  3G4S A;  3N5B B;  1U8R A;  3L42 A;  1XTD A;  2YDL A;  1NM7 A;  1W6X A;  2Y4Y A;  3C95 A;  3LLR A;  2DYI A;  1OU9 A;  1N6A A;  3ZEH A;  1G83 A;  3QHS A;  3BY7 A;  2JN0 A;  2DF6 A;  5GAN 4;  2DIL A;  3UWN A;  3ZFJ A;  3CCM T;  1MGQ A;  3OYB A;  2RH2 A;  1QVG S;  2VUB A;  1M1G A;  3QYG B;  1JU5 C;  3CCR T;  3CMA Q;  5GAM d;  1PG5 B;  2EQJ A;  1YN8 A;  2LCL A;  1IHV A;  1YWO A;  3NMZ C;  2OTJ Q;  2IIM A;  5LJ3 h;  2DL8 A;  2LVM A;  1YIT A;  4JDS A;  4J9B A;  1D0Y A;  4RCB A;  2E3H A;  3RMS A;  1CSK A;  2P4T A;  1SG5 A;  3JB9 J;  2ECZ A;  2J06 A;  3SDZ A;  3SHW A;  2DD5 A;  1YJN Q;  3OA6 A;  3HL8 A;  1WPY A;  2FZK B;  4M7A E;  4PL6 A;  2VV5 A;  2KE9 A;  2COW A;  3CQT A;  3CPF A;  4QQ6 A;  4E7H A;  3PFS A;  4M77 A;  2SRC A;  1VQ6 T;  5A0L A;  3OMC A;  1TOV A;  3TQ7 P;  1G8X A;  1YJW Q;  1I0C A;  2H3J A;  5GJV B;  2FZG B;  2ZGW A;  3OYI A;  3J80 E;  2FEI A;  5A0D A;  3I9Q A;  4J9C A;  3G6E A;  2OTL Q;  1RAF B;  2Y90 A;  3G4S Q;  1WA7 A;  3CXC A;  2RJE A;  4M4Z A;  3DLL A;  4J6Y A;  7AT1 B;  2KT8 A;  4BB7 A;  2KI7 A;  3PNW C;  1AVZ C;  1RL2 A;  2CUB A;  3FC3 A;  1VQ5 T;  5A0G A;  2PU9 B;  1RLQ C;  1WQW A;  2CT3 A;  1VQ9 T;  1GBQ A;  1GCQ A;  4XQ3 A;  5CKF A;  2ZZD A;  1K8A C;  1Q82 R;  1VQO A;  1VQ7 A;  1HK9 A;  2QTV A;  3OQ5 A;  2CKK A;  3A8H B;  4C92 C;  5GAM f;  5KE3 A;  3M4Y A;  1YIT Q;  2O2O A;  1M90 C;  2V8K A;  2QQA A;  4NL3 A;  3PMI A;  2HNI A;  2I2L A;  3M58 A;  1BCM A;  4M78 D;  5I22 A;  2NUT A;  3GLX A;  2XDB A;  5IHI A;  4E7J A;  1D1C A;  1YBY A;  4M75 C;  1IXD A;  1YIJ T;  1XJW B;  4RKU E;  3EG9 A;  4BY6 C;  2LCS A;  5IN1 A;  2EQK A;  3OS0 A;  4ELY C;  1GBR A;  5CO7 A;  4K11 A;  1UJ0 A;  1RAC B;  2R5A A;  3QO3 A;  4M7A A;  2EVR A;  3H0I A;  3G6E Q;  3M0U A;  1VQ4 T;  1OPL A;  3JV3 A;  1I4K 1;  1W2B S;  1EX4 A;  3CCV A;  5J39 A;  4DBR A;  2M9U A;  1MMA A;  2DL4 A;  4V2S A;  2KVQ G;  1LNX A;  1OOT A;  4PJO G;  3CCQ T;  4ZTF A;  2QAS A;  2QG9 B;  1Y7X A;  3CCM A;  2HEQ A;  1Y96 B;  2DBM A;  2LX7 A;  4AG1 C;  4DOV A;  3HSB A;  2EBP A;  1NPP A;  4C5I A;  2JS2 A;  2O9V A;  2K57 A;  3CCR A;  8ATC B;  1VQ7 Q;  4OGE A;  2QDY B;  5ECA A;  3V8J A;  4ESR A;  2DRM A;  2OX7 A;  3P8D A;  2MYS A;  2D6F A;  2VVK A;  5HK3 A;  3VRY A;  3D7S B;  4A4F A;  5AYF A;  2KRM A;  3CCJ Q;  3BFM A;  2DL7 A;  4XTU A;  1UHF A;  4J7I A;  3VS4 A;  9ATC B;  1VQ6 A;  5FLX E;  1YHQ T;  1PSE A;  4JLG A;  1AZE A;  2MCN A;  2DTH A;  4PFP A;  4A54 A;  5KYX B;  3CCV Q;  3OYM A;  2DXB A;  2QI2 A;  5GAO l;  4OMQ A;  2HBW A;  4JRP A;  4B9W A;  4AT1 B;  5FU6 C;  1NZ9 A;  2DE0 X;  3V7R A;  4BI8 B;  2CZ6 B;  1LVK A;  1WJS A;  3NTI A;  4RCC A;  3OYE A;  3QBY A;  1U06 A;  1AEY A;  4E47 A;  5LJ3 d;  1XOV A;  2YSQ A;  3SWN B;  4A4E A;  3R6N A;  1VQ5 A;  1T3S A;  4C92 F;  2KK4 A;  2M1H A;  1ZSZ C;  4XU1 A;  1VQ9 A;  1WHJ A;  3MET A;  3CCR Q;  2ROL A;  2RD1 A;  4R0K A;  2L3Q A;  1OX8 A;  2AZV A;  1PHT A;  3FRN A;  4M75 F;  3JAM E;  3OS5 A;  5KCO A;  1VIF A;  4MDW A;  2CP2 A;  1YJ9 T;  1G2B A;  4QVZ A;  3EGU A;  4C92 B;  2VC8 A;  4R55 A;  3OSV A;  4J9H A;  5GMK e;  2A0F B;  1YIJ A;  3EFS A;  1D3B A;  3C12 A;  4HCK A;  2RPN A;  1K73 U;  4M77 G;  1BI1 A;  2DER A;  4LNP A;  1BYM A;  4M75 B;  4JJB A;  2RI2 A;  4BY6 B;  2FVU A;  3L2W A;  4IIM A;  2CH4 W;  1SF9 A;  2YXY A;  2Z0W A;  3VS2 A;  2MI6 A;  2LQW A;  1VQ4 A;  4ZNX A;  2MOX A;  4Z8A A;  3A8G B;  2VKN A;  1NG2 A;  2RM4 A;  3QWY A;  1VYV A;  3RNJ A;  2AHJ B;  1KFZ A;  2RJC A;  3EH2 A;  3CD6 T;  3CCQ A;  2FRW A;  3MJX A;  1PSF A;  1VQN T;  5LJ3 f;  1VQ9 Q;  1WLP B;  3SEM A;  2CDT A;  3E9F A;  1G5V A;  4PKC C;  1X27 A;  2D0Q B;  4N0A C;  1GCQ C;  1JJ2 P;  4OMO A;  4KGV B;  5D6W A;  3WVD B;  4L6V 5;  4PLI A;  2K5L A;  2A3L A;  3CME A;  4ANJ A;  1E6H A;  4F17 A;  3M9Q A;  4IUU A;  3JSC A;  5I11 A;  2JTE A;  1TXQ A;  1YIJ Q;  1SPK A;  1X01 A;  4FYW B;  3OYK A;  2WSC E;  3SFM A;  4BUG A;  1VA7 A;  4M7A G;  3PTA A;  5LJ5 j;  2WSF E;  3OYY A;  2Y4X A;  2LJ1 A;  3MP6 A;  1N8R U;  5IAY A;  1B7T A;  3CMA T;  2K5I A;  4BI4 A;  1WIE A;  4BE0 A;  2OTJ T;  2VXF A;  2E5Q A;  1UHC A;  2XG8 D;  2DBK A;  4D8K A;  2XU8 A;  5CKB A;  3FDR A;  3H0F A;  4C92 E;  2QDL A;  5GAN 7;  3OS1 A;  3I56 T;  3JB9 G;  3EG1 A;  4OMF B;  3RUX A;  3CCQ Q;  4Y91 A;  3M5A A;  2L0A A;  3H8Z A;  1YJN T;  2D8H A;  4WCI A;  2K6D A;  5FU6 B;  4M75 E;  3TEE A;  3MP1 A;  1SSF A;  1BU1 A;  4OF1 A;  5DY9 A;  4EIK A;  1PWT A;  3H9N A;  3M4G A;  1J3T A;  2V1R A;  4EMG A;  2DFU A;  1GRI A;  2O31 A;  1M3A A;  3CME Q;  5KYY A;  1RI0 A;  2OTL T;  4HA8 A;  4M7D C;  1YJ9 A;  3NFC A;  4LD9 K;  2ZCF B;  5LL6 S;  3V7C A;  5A2Q E;  4KH0 B;  1MUZ A;  4C5G A;  2DXU A;  4KGZ B;  1UGQ B;  2EQI A;  1MV3 A;  3V7S A;  1K9M U;  2FL7 A;  1IB8 A;  1W4S A;  2NUP B;  4EMK B;  5J26 A;  4MMK A;  3GOX A;  2ZPG B;  1WJR A;  2FPD A;  1B3Q A;  1D0X A;  4X34 A;  1M4Z A;  2XDP A;  4OMN A;  4LD6 A;  4O5V A;  2KSS A;  2E70 A;  2M02 A;  1Q82 C;  3LGF A;  3G1J A;  3QSU A;  4KH1 B;  3M0P A;  3CD6 A;  3PIO A;  2E6N A;  2J05 A;  1SSH A;  3VV0 A;  1VQN A;  4OMM A;  3TCJ A;  4F14 A;  1Y71 A;  1T0H A;  1R0B G;  2L3P A;  3EG0 A;  3C94 A;  1U3O A;  3VKI A;  2K2V A;  1UB4 A;  3U23 A;  1KC8 U;  2KAF A;  2O88 A;  1QCO A;  2CP5 A;  2RHZ A;  2GGR A;  4TVR A;  4FSS A;  2D8J A;  5GAN 6;  4JRI A;  3JCM X;  1NYG A;  1YJ9 Q;  2WAC A;  3REA B;  2NLU A;  3J7A F;  2E4H A;  4Y28 E;  2JT4 A;  3CPW S;  2PVG B;  1MNE A;  2L5Q A;  4PJN A;  3OS2 A;  3CCS T;  3I55 Q;  3HRU A;  1WXU A;  1BIA A;  3FLG A;  1K0X A;  3IQL A;  3RKY A;  5FWC A;  3E9G A;  1RAG B;  1EZZ B;  2JXB A;  1X6B A;  3PE0 A;  1UJY A;  1KC8 C;  1YFN A;  4FYX B;  3CXC P;  2OI3 A;  4OP0 A;  4PNO A;  4ME7 A;  1FWZ A;  1BBZ A;  2BE7 D;  2ZPI B;  4NS5 A;  3CBO A;  2OTJ A;  1K73 R;  3INZ A;  4ZTJ A;  2HKN A;  4IUR A;  3DB3 A;  1BK2 A;  3RDV A;  4DBQ A;  1QKW A;  1IHW A;  3I56 A;  2EGA A;  1WDX A;  2DIQ A;  2CGH A;  3CD6 Q;  4RTU A;  1JRI A;  4LXC A;  2MPX C;  4FL6 A;  1U5S A;  4FT4 A;  1WZO A;  2GFU A;  4MZM A;  3CCJ T;  4RG8 A;  3F70 A;  5KH6 A;  1BIB A;  1TSF A;  2KNB B;  4ATO A;  2PNI A;  4F7U A;  2JM9 A;  4R56 A;  4M7D F;  3H41 A;  5GAO m;  2A7Y A;  2M16 A;  2HQE A;  2K4Y A;  4BE2 A;  4M78 A;  1VUB A;  2C0I A;  2ABL A;  4C8Q C;  1H3Z A;  2F1L A;  2F2W A;  1VQM Q;  2QTX A;  3CCU Q;  3CCV T;  2L89 A;  1YCS B;  3JCM g;  2K7A A;  1TTH B;  3ZL7 C;  2E10 A;  4BDY A;  1ABO A;  2PZ1 A;  4E2F B;  2GQI A;  2RNA A;  2CSQ A;  1TUD A;  2JNG A;  5L23 A;  2OAU A;  1X2Q A;  1AWJ A;  4M7D B;  1K76 A;  1BB9 A;  4N4H A;  3X26 B;  4C92 D;  1V1C A;  2QQ9 A;  2NUZ A;  3FJ5 A;  4JJC A;  3VS0 A;  2EW3 A;  2YT6 A;  1OU8 A;  3CC2 Q;  4Y92 A;  4RTX A;  5KYU A;  3EHR A;  1UGP B;  5GMK h;  4M75 D;  4JPB W;  3I56 Q;  4ZGJ B;  3RKX A;  4RTT A;  3FB9 A;  2L3R A;  1KD1 U;  1QVF A;  3QDF A;  4C0G A;  2JVV A;  1N8R R;  4QQG A;  3NHN A;  1NJI R;  3T9N A;  3DB4 A;  4HVV A;  4DA4 A;  3M53 A;  2JZ2 A;  2BKD N;  3QJ6 A;  2CS7 A;  1KIK A;  2R5M A;  2GBQ A;  3QXE B;  2RQT A;  4FSX A;  1YI2 A;  2GF7 A;  4DEY A;  4ORZ A;  1KD1 C;  2HL3 A;  4JRK A;  4XU3 A;  1M5Q 1;  4Z88 A;  1EIF A;  3EGX A;  3OBW A;  2CP0 A;  5GAN j;  3CCS A;  1IRX A;  2B8A A;  2PUK B;  3JCM h;  3LW5 E;  5EG2 A;  1HSQ A;  2GTO A;  2HQX A;  2XDD A;  3CC7 A;  2BUD A;  4EPC A;  1PCX A;  1T0J A;  3EFO A;  4GLK A;  4MML A;  1S72 T;  4AG2 C;  1JB0 E;  2GFA A;  2X51 A;  2H8H A;  3LYI A;  5HK0 A;  1AOJ A;  5KE2 A;  2RJF A;  1UUE A;  2DL5 A;  1KHC A;  4ZGE B;  5FRO A;  3OYG A;  2DM1 A;  2RHU A;  3L2V A;  1K9M R;  2KY9 A;  4J8O A;  1H3H A;  1OUL A;  4MDX A;  5GAN 5;  4Z89 A;  4M7D E;  2JUF A;  2K9G A;  2GNC A;  4CI0 C;  1M8V A;  5CIU A;  3AT1 B;  4HKE A;  4OB3 B;  3MEA A;  3CCJ A;  3QII A;  4C8Q F;  2HKQ B;  6AT1 B;  2EYX A;  1OX9 A;  2LMJ A;  2COY A;  3R6O A;  2KXD A;  4AFZ C;  4QKU A;  2LTO A;  2AT1 B;  2DX1 A;  2LQN A;  3MKD A;  1YI2 Q;  3EGD A;  1TH7 A;  2CYZ B;  3H0H A;  3UPU A;  1M3B A;  2XHC A;  3BE3 A;  1F1B B;  3MEV A;  3HP9 A;  3KFV A;  2EQM A;  1RI9 A;  2YUO A;  2O4X B;  4GLM A;  1KC8 R;  4C8Q B;  3CCS Q;  4HXJ A;  1UTI A;  2QQR A;  5CCA A;  3CC7 Q;  1B34 B;  4PJO C;  1BI0 A;  1K0S A;  1Q7Y U;  1GFC A;  2AKK A;  5GAN 2;  1M2V B;  3GP8 A;  4JS5 A;  4MZT A;  2A36 A;  2YUN A;  3I5S A;  5CR2 A;  1PRM C;  3CME T;  2EFI A;  3JCM c;  2EGC A;  3E2U A;  2VAS A;  4KRT A;  1QVG A;  1I1J A;  4DOW A;  3TRE A;  1OEB A;  5GMK l;  4IKF A;  1WHK A;  2LZ6 B;  2K3B A;  3JCM W;  8AT1 B;  3PVQ A;  2DZC A;  3ME9 A;  2M51 A;  2BTT A;  1I81 A;  2HMA A;  1PNJ A;  4F7U G;  1KSW A;  4XTW A;  1PD1 A;  2PQW A;  4M78 G;  3VS5 A;  1ARK A;  1JO8 A;  5IHK A;  4OB0 B;  1QMC A;  4KGX B;  1G3W A;  2ZPH B;  4XTX A;  2QEX T;  1K4U S;  4PLL A;  3OYA A;  3SB2 A;  1UFF A;  2DJZ A;  3NTK A;  2RHX A;  4A4K A;  3BDU A;  5DLO A;  2RI3 A;  4XTV A;  2X3X D;  3MP8 A;  2L8D A;  2QGG A;  3X20 B;  3JCM J;  1IRE B;  3OYC A;  4EDU A;  4XU2 A;  4HCB A;  1IGQ A;  3DKM A;  3GNG A;  5IXB A;  1S72 A;  2PVO B;  3L2Z A;  2JM8 A;  5KYW B;  2D9T A;  1KQS S;  5FRM A;  1FYN A;  3FJP A;  2KRO A;  2XKO C;  3X24 B;  4JS4 A;  3MPU B;  1Y57 A;  1H8K A;  4J7F A;  1C1A A;  4FM4 B;  5HKC A;  1QKX A;  2EJG A;  1FX7 A;  1M1K U;  1OI1 A;  2FO0 A;  1ZQ1 A;  2XI9 A;  3I55 T;  3L2U A;  4LDW A;  2L3S A;  2FPE A;  3X28 B;  2HCK A;  4M77 C;  2EKO A;  1WGS A;  1ZUU A;  5I21 A;  1KD1 R;  4AFU C;  1WQ7 A;  3JCM d;  2V8J A;  5KYN A;  1Q86 U;  2YHT A;  4A53 A;  4RG2 A;  1X69 A;  1N9R A;  1WX6 A;  4PJO F;  1VQP T;  1JJ2 S;  1AZG B;  2DEQ A;  2KDS A;  2XMF A;  3OYL A;  1D0Z A;  1YWP A;  2RJD A;  4MZP A;  1HXD A;  4Z02 A;  2DNU A;  2QYZ A;  4UC4 A;  1K73 C;  1W2B A;  5FW9 A;  1B07 A;  1WFW A;  2ZAE A;  5KCH A;  1IZ6 A;  4RTV A;  2JJ9 A;  1S72 Q;  3JCM e;  2LX9 A;  1V29 B;  2HBP A;  1RAI B;  2CP3 A;  2DMO A;  1UE9 A;  4M7D D;  4OML A;  3OW2 S;  5LJ5 g;  3EHQ A;  2FHD A;  4PJO B;  2BZY A;  1VQM T;  3CCU T;  4KUI A;  3ZBD A;  4J6W A;  1QLY A;  1ZHI A;  3P8H A;  3VS7 A;  1SRL A;  2O4X A;  5C0M A;  5GAM j;  2PUO B;  1TS9 A;  1HD3 A;  1Y0M A;  2FYK A;  3LH5 A;  3VS6 A;  2VYT A;  3RR6 A;  4O6J A;  4LDY A;  2DZ9 A;  3THK A;  1Y96 A;  1B34 A;  1VQ8 A;  2CP7 A;  4BI3 A;  2LRQ A;  1QCN A;  4M7A C;  4II1 A;  3V8L A;  1NE8 A;  1NJI U;  2QEX A;  3OBY A;  4D8D A;  3CC2 T;  1QQJ A;  3JCM f;  1ZA1 B;  2LCC A;  1AWO A;  2YWW A;  2AIR B;  2J6K A;  3UA6 A;  4HVU A;  4AFQ C;  1C0M A;  4F04 B;  1UEB A;  2I0N A;  1I07 A;  3CCL T;  2X9H A;  2E5K A;  1SKU B;  2DA9 A;  3M55 A;  2DIG A;  3M56 A;  1PKT A;  2IPO B;  1ZBJ A;  2JOY A;  2YRC A;  3CC4 Q;  1N8R C;  3C4S A;  2JMA A;  1NJI C;  1ZSZ B;  2DRK A;  1G3Y A;  2KYM A;  1X75 C;  5GAO r;  5KYX A;  2AZS A;  2VWF A;  2RA2 A;  3A8L B;  1Q7Y R;  3P8B B;  5LJ5 h;  5HCK A;  3OYD A;  3ASK A;  4M77 F;  1M2O A;  4Q5W A;  5M9O A;  2GCX A;  3I55 A;  1GFD A;  3O5Z A;  1RAE B;  4IUV A;  2RK1 A;  4CC7 A;  3A8M B;  3OY9 A;  1SEM A;  4ZGD B;  3SWN A;  1ZA2 B;  3JCM Q;  1VQ8 Q;  1FMV A;  4CC2 A;  2KQW A;  1W70 A;  1EFN A;  2E3I A;  4J9D A;  1TUG B;  5I2M A;  1MV0 B;  2KMT A;  4ELZ C;  2QEX Q;  3RIR A;  1WJQ A;  2CP6 A;  3G71 Q;  1P92 A;  4M77 B;  4LDU A;  1M27 C;  2CH4 A;  5CAI A;  5D7U A;  2J7I A;  1VQP A;  2ATC B;  2K5F A;  2CT4 A;  1HJD A;  4JJD A;  1NLO C;  2PTK A;  2LQ8 A;  1WXT A;  4B6M A;  4C92 A;  4XAX B;  4RTW A;  3C0C A;  3I5R A;  3VS1 A;  1K9M C;  1HYO A;  4LUE A;  1W1F A;  4XU0 A;  1OZ2 A;  4IUP A;  2EYY A;  4C8Q D;  4XK8 E;  1MND A;  1WHM A;  1AHJ B;  2EYZ A;  3E19 A;  4M75 A;  5D6X A;  1QP2 A;  2CZ7 B;  3SD4 A;  4FT2 A;  3PMT A;  1KK7 A;  3OYF A;  1QVF P;  1PM3 A;  1UEC A;  1YI2 T;  3L1A A;  2HSE B;  3QYH B;  3VJP A;  1VQM A;  2DTO A;  3CCU A;  2X35 A;  2SEM A;  4QW2 A;  2D0N A;  3CXC S;  1WHL A;  1RAD B;  1SRM A;  3LX7 A;  4M7A F;  1O9S A;  2DXT A;  4DBF A;  2E41 A;  2BZX A;  2MMP A;  4FW2 A;  3CC7 T;  3TSZ A;  2NUT B;  3L2R A;  4RTZ A;  2DKG A;  2EIF A;  5D6Y A;  1UGV A;  1M1K R;  1CKB A;  3EG9 B;  4ZN3 A;  2YRV A;  4A4H A;  5GMK m;  3CC2 A;  1BI3 A;  2X4Y A;  3CCE T;  3M54 A;  5CK9 A;  4CC3 A;  4PJJ A;  1C6V X;  2DL3 A;  1IO6 A;  3JB9 F;  2DVJ A;  1VQP Q;  4M7A B;  1Q81 U;  4JUV A;  2W10 A;  2ZPF B;  3BW1 A;  3CCL A;  3RER A;  2LP5 A;  4PFO A;  3BDL A;  2YRD A;  4E7Z A;  1Q86 R;  3DLM A;  3OMG A;  4FCY A;  4A63 B;  1OV3 A;  2HD0 A;  3HKS A;  4ZN1 A;  3QPH A;  4PK4 A;  2HL5 C;  2CZ0 B;  2P0P A;  1UGS B;  3JB9 H;  4M77 E;  2A37 A;  5LJ3 j;  3PVL A;  3OSS C;  2IG0 A;  5L8R E;  1T3L A;  3KUF A;  2ZPE B;  4IUT A;  3UT1 A;  2YUQ A;  4QVD A;  3L2Q A;  2DVE A;  3X25 B;  3ER0 A;  3VS3 A;  1OZ3 A;  4J83 A;  2XK0 A;  4KT0 E;  3UA7 A;  1KQ2 A;  2M0O A;  3HFO A;  2EJ9 A;  2EYW A;  4HVW A;  2CZ1 B;  2KYB A;  1VQL A;  4OGC A;  3EFR A;  3REB B;  1Z9Q A;  2K3Y A;  3LWH A;  1ABQ A;  1BKB A;  4C0Z A;  4E7K A;  1ZLM A;  2RN8 A;  3NTH A;  1ZSZ A;  1RAA B;  1PC0 A;  2G3R A;  2KEA A;  3OYJ A;  1GXI E;  1M3C A;  3JB9 I;  3A1P A;  1WHH A;  2A08 A;  1X2K A;  3CCL Q;  3GF5 A;  4KUL A;  5GAN g;  4WF2 A;  2XID A;  1LOJ A;  2EKH A;  3HTR A;  1FMW A;  3WXM B;  5LJ5 d;  5FWB A;  2NUP A;  1QCF A;  1QVG P;  4EMK A;  2PVD B;  1N9S A;  3KBG A;  1PRL C;  1ZX6 A;  2RQV A;  2C0O A;  5GAM e;  1VQK T;  4HT8 A;  3KXT A;  1JEG A;  2F5T X;  4BAC A;  1K8A U;  4PJO D;  4F16 A;  5CQX A;  4RMO A;  2DJQ A;  5FU7 C;  1PD0 A;  2E65 A;  5LJ5 e;  2GTJ A;  2B86 A;  2HSP A;  1M90 U;  5GJW B;  4N4G A;  2KRN A;  3SWN C;  2JS0 A;  2VXE A;  2WSE E;  5CKH A;  3VUZ A;  4CC4 B;  3CPW A;  1VQL Q;  5IH2 A;  2ENM A;  1D3B B;  2EAY A;  2FPF A;  3GBQ A;  1G3S A;  1M30 A;  3CCE A;  2W0Z A;  3EH1 A;  1R0C B;  3LH0 A;  1Y07 A;  2ZPB B;  2EPD A;  4N0A A;  3HFN A;  1JBM A;  2LC4 A;  4N4I A;  4C92 G;  4JZ3 A;  4HCC A;  3NGP A;  1D1B A;  1D09 B;  2QGF B;  1OPK A;  2CRE A;  4C5H A;  1XNI A;  4J9E A;  1Q95 G;  4E7L A;  3QWX X;  4PJM A;  4M75 G;  4PFZ A;  4X9C A;  1LCK A;  4NL2 A;  2R57 A;  2HZY A;  5LJ5 f;  4YTL A;  3MCA B;  5GAN h;  2L2P A;  4JRQ A;  2DPP B;  3TU4 K;  1NLP C;  5FRN A;  4L5G A;  4E7S A;  1WHG A;  1RAH B;  3PIP A;  4C5E A;  3S6W A;  4DEX A;  5CKE A;  2KXC A;  1JXM A;  2F5K A;  3CC4 T;  3S3M A;  1H92 A;  2KT1 A;  2X4J A;  2OJ2 A;  1BI2 A;  2RK2 A;  3CCE Q;  2J6F A;  2RQR A;  3EG3 A;  2RI5 A;  3TSW A;  2VB6 A;  1W2B P;  1QW1 A;  2RMO A;  3H6Z A;  3VYH B;  1PKS A;  3M0T A;  1N27 A;  5GAO p;  4C0F A;  1VQO Q;  3OYN A;  2E1H A;  3M57 A;  2F2V A;  4JZ4 A;  3UF4 A;  2K79 A;  2X3W D;  4M77 D;  1YP5 A;  3MHX A;  2YLC A;  4M7D A;  2RHI A;  1Q7Y C;  1UG1 A;  1Q81 R;  1AD5 A;  5HY6 A;  1VQ8 T;  4OB2 B;  2QK0 A;  5DLQ E;  4J5Y A;  4M78 C;  4OVA A;  3G71 T;  3VRZ A;  1H64 1;  2LNV A;  1OYX A;  2RQW A;  1VQK A;  4KBM B;  1M8M A;  3EAE A;  2P0K A;  3GIB A;  2DAQ A;  1A0N B;  3JCM P;  1NBE B;  1E7O A;  2P84 A;  5KYY B;  4LDX A;  1R8O B;  1GL5 A;  2C0T A;  2MIO A;  4EMH A;  2P0Q A;  2FZC B;  1ACM B;  4HCZ A;  1MMN A;  4QVC A;  2HAX A;  3PGG A;  5FU7 B;  5IT9 E;  1NEB A;  3FEO A;  4DBH A;  1I5O B;  4PJL A;  4NOY A;  3CCM Q;  3AHU A;  4FW1 A;  2X4W A;  2ED1 A;  2JTM A;  1I8F A;  3MEW A;  4C8Q E;  2A28 A;  3ULR B;  1VYU A;  4GBQ A;  2QQS A;  2MWO A;  1V76 A;  1UGR B;  1AT1 B;  2MAM A;  3O8V A;  1MMG A;  1U1T A;  4M7A D;  2RQU A;  2V8I A;  4BD3 A;  2NWM A;  2QAZ A;  1O75 A;  3HRS A;  2F69 A;  3QZ5 B;  3Q1J A;  4OMP A;  1AWX A;  1FMK A;  5LJ3 e;  2V26 A;  2ROT A;  2LJ3 A;  2K3X A;  2EWN A;  2X4X A;  4EMK C;  2G6F X;  1N5Z A;  4LN2 A;  2KRS A;  3I35 A;  4GY5 A;  1KQS P;  1TWB A;  2LT4 A;  1DJ7 B;  3RKW A;  4LUD A;  5IHN A;  1TUC A;  1VQ6 Q;  1ZUY A;  1VQK Q;  2MF2 A;  1WI7 A;  4C0D C;  1M1K C;  3A98 A;  2EGE A;  5AT1 B;  3JB9 D;  1BCO A;  1TG0 A;  1VIE A;  4E7I A;  3UDC A;  1LJO A;  2DYB A;  5GAN 8;  2DEU A;  1JQQ A;  1K9A A;  5GAM g;  4WTO B;  2NYS A;  4X1V A;  2JW4 A;  2FRY A;  5GAN 3;  2MWP A;  1XQH A;  3QJY A;  1RLP C;  3CC4 A;  3RMQ A;  1K8A R; 
#chains in the Genus database with same CATH homology
 1UGP B;  1NPP A;  2VGM A;  4M75 D;  5GMK h;  1K9M C;  4C5I A;  2K57 A;  3CCR A;  2BIV A;  4ZGJ B;  3RKX A;  3FB9 A;  1Q86 C;  4OGE A;  1OZ2 A;  2L3R A;  2QDY B;  4XU0 A;  5J3B A;  4IUP A;  1KD1 U;  3V8J A;  1QVF A;  4C8Q D;  4XK8 E;  2RHY A;  2DXC A;  2JVV A;  3URG A;  1AHJ B;  4C0G A;  3P8D A;  3GNF B;  4QQG A;  2D6F A;  3E19 A;  4M75 A;  3T9N A;  5D6X A;  1QP2 A;  2CZ7 B;  3SD4 A;  3QDR B;  3PMT A;  3DB4 A;  4FT2 A;  3OYF A;  3CBM A;  5HK3 A;  5GAN d;  1YI2 T;  3L1A A;  4F7U F;  4DA4 A;  1G3T A;  3QYH B;  4C8Q A;  3M53 A;  2JZ2 A;  2BKD N;  3HHT B;  2DTO A;  3QJ6 A;  3VJP A;  3CCU A;  3M59 A;  2CS7 A;  2QA4 T;  1VQM A;  4A4F A;  2R5M A;  5AYF A;  2X35 A;  4M78 F;  5CKD A;  4HT9 A;  4QW2 A;  5GAO q;  3CXC S;  3BFM A;  3QXE B;  4XTU A;  4FSX A;  3OYD A;  4KUD K;  1YI2 A;  3LX7 A;  4FU6 A;  4J7I A;  4M7A F;  1VQ6 A;  2DD4 A;  4DQ2 A;  2GF7 A;  3GPL A;  1O9S A;  2DXT A;  3JRZ A;  2E41 A;  2MMP A;  5FLX E;  1YHQ T;  3VYG A;  3CC7 T;  1KD1 C;  1PSE A;  4XU3 A;  4JRK A;  3WVE B;  1M5Q 1;  4JLG A;  1EIF A;  3OBW A;  3G71 A;  3L2R A;  4CRI A;  2DKG A;  2EIF A;  2DTH A;  3QZ9 B;  4A54 A;  4F7U B;  5GAN e;  3CCS A;  5GAN j;  5D6Y A;  2B8A A;  3E1S A;  2PUK B;  3OYM A;  2DXB A;  4BDZ A;  2QI2 A;  3JCM h;  5GAO l;  3LW5 E;  5EG2 A;  4ZN3 A;  2YRV A;  4M78 B;  4A4H A;  5GMK m;  4JRP A;  3CC2 A;  4B9W A;  1YHQ A;  2HQX A;  3MEU A;  1BI3 A;  2XDD A;  2BUD A;  2X4Y A;  5FU6 C;  3CC7 A;  1NZ9 A;  3CCE T;  3M54 A;  5CK9 A;  3V7R A;  4BI8 B;  4EPC A;  2CZ6 B;  2QXF A;  2YLB A;  3JB9 F;  1WJS A;  3NTI A;  2DK3 A;  4GLK A;  4MML A;  4RCC A;  1S72 T;  4M7A B;  4OB1 B;  3OYE A;  1JB0 E;  2GFA A;  3HPW A;  3QBY A;  4J6X A;  4JUV A;  3LYI A;  4E47 A;  1Q81 U;  5LJ3 d;  1XOV A;  3SWN B;  4A4E A;  5HK0 A;  1VQ5 A;  5KE2 A;  2EQU A;  2RJF A;  4C92 F;  2KK4 A;  2M1H A;  1KHC A;  2ZPF B;  4ZGE B;  4XU1 A;  5FRO A;  3OYG A;  1VQ9 A;  3BW1 A;  3CCL A;  3RER A;  2RHU A;  3L2V A;  3VU3 C;  3MET A;  2KY9 A;  2LQK A;  5GAM h;  3BDL A;  2LT1 A;  2RD1 A;  2FB7 A;  3DLM A;  3OMG A;  4J8O A;  4MDX A;  5GAN 5;  4JJN K;  3FRN A;  2XD0 A;  4M7D E;  2HD0 A;  4M75 F;  2JUF A;  3HKS A;  3JAM E;  4CI0 C;  4ZN1 A;  3QPH A;  1M8V A;  5CIU A;  3OS5 A;  4HKE A;  4OB3 B;  5KCO A;  1VIF A;  3MEA A;  3CCJ A;  3QII A;  2CZ0 B;  2P0P A;  4MDW A;  1UGS B;  3JB9 H;  4M77 E;  4C8Q F;  1YJW T;  1YJ9 T;  5LJ3 j;  1KQS A;  3OSS C;  4QVZ A;  4C92 B;  2IG0 A;  5GAN f;  5L8R E;  1I5L A;  1WNL A;  2VC8 A;  3KUF A;  4M7D G;  4R55 A;  3OSV A;  2ZPE B;  4IUT A;  3R6O A;  3UT1 A;  5GMK e;  1YIJ A;  3EFS A;  1D3B A;  3C12 A;  2LTO A;  4QVD A;  3L2Q A;  2DVE A;  3X25 B;  1K73 U;  4M77 G;  3G4S T;  3ER0 A;  1QVP A;  2JTF A;  3A5Z B;  1BI1 A;  1QP3 A;  1TH7 A;  2CYZ B;  1OZ3 A;  1Q82 U;  3RES A;  5GMK i;  4J83 A;  2XHC A;  3UPU A;  1VQL T;  4PJO E;  4QQD A;  2XK0 A;  1BYM A;  4KT0 E;  4M75 B;  1KQ2 A;  3MEV A;  3QUI A;  2M0O A;  3HFO A;  3V8K A;  2DO3 A;  1U1S A;  2RI2 A;  3HP9 A;  2EQM A;  5I2S A;  2EJ9 A;  2O4X B;  4BY6 B;  2FVU A;  3OB9 A;  3L2W A;  4C8Q B;  3CEY A;  1VQ4 A;  2MI6 A;  3HRT A;  2CZ1 B;  4LDV A;  1VQL A;  4B9X A;  2E6Z A;  4OGC A;  3EFR A;  3A8G B;  1KQ1 A;  2K3Y A;  3LWH A;  5CQY A;  4C0Z A;  1BKB A;  2QQB A;  2QQR A;  5CCA A;  1B34 B;  4X9D A;  2RM4 A;  4E7K A;  1QVF S;  4PJO C;  1BI0 A;  1Q7Y U;  3NTH A;  2AHJ B;  2RJC A;  3CBP A;  2E12 A;  4BE1 A;  3CD6 T;  2R58 A;  2VGN A;  2G3R A;  5GAN 2;  4C0D B;  3CCQ A;  2C06 A;  3GP8 A;  4JS5 A;  4MZT A;  1YIT T;  1PSF A;  3VUB A;  4L59 A;  3OYJ A;  1GXI E;  1VQN T;  4VUB A;  3JB9 I;  1JJ2 A;  1MHN A;  5LJ3 f;  3E9F A;  1G5V A;  5CR2 A;  4PKC C;  3CME T;  3GF5 A;  2D0Q B;  2EFI A;  4KUL A;  4N0A C;  3JCM c;  5GAN g;  1QVG A;  4WF2 A;  4DOW A;  3TRE A;  4F7U E;  2XID A;  3FIF A;  4FIB A;  1LOJ A;  5D6W A;  5GMK l;  4IKF A;  4XTY A;  3WVD B;  3WXM B;  5LJ5 d;  4L6V 5;  3J81 E;  1M9S A;  4M78 E;  4PLI A;  4EMK A;  2K5L A;  2A3L A;  2PVD B;  4IUQ A;  1N9S A;  3KBG A;  3CME A;  2DZC A;  3JCM W;  3ME9 A;  2EYQ A;  1I81 A;  5CVI A;  4F7U G;  3OW2 A;  4D6W A;  3M9Q A;  4IUU A;  3JSC A;  4XTW A;  2QA4 A;  2PQW A;  1X01 A;  4M78 G;  3G6E T;  3OYK A;  5GAM e;  1FXX A;  2GQV A;  2WSC E;  1VQK T;  3SFM A;  2E64 A;  4OB0 B;  3KXT A;  4HT8 A;  2F5T X;  4BUG A;  4BAC A;  1G3W A;  1K8A U;  2ZPH B;  4XTX A;  2QEX T;  3MO8 A;  4PJO D;  4M7A G;  5CQX A;  4PLL A;  3OYA A;  2IVW A;  4RMO A;  3PTA A;  3G7Z A;  2E65 A;  5FU7 C;  3SB2 A;  5LJ5 j;  5LJ5 e;  2WSF E;  3OYY A;  5GAO n;  2Y4X A;  3MP6 A;  1N8R U;  1M90 U;  2DJZ A;  5IAY A;  4N4G A;  4P5N A;  3CMA T;  3NTK A;  2K5I A;  1NPR A;  2RHX A;  4BI4 A;  4PJO A;  3SWN C;  4A4K A;  2VXE A;  2WSE E;  5CKH A;  3BDU A;  3VUZ A;  3CPW A;  4BE0 A;  5DLO A;  2RI3 A;  5LJ3 g;  4XTV A;  2OTJ T;  2VXF A;  2E5Q A;  1M1F A;  3MP8 A;  2L8D A;  2XG8 D;  1D3B B;  2EAY A;  2XU8 A;  5CKB A;  3X20 B;  3FDR A;  1G3S A;  1IRE B;  3JCM J;  4C92 E;  5GAN 7;  3OYC A;  4EDU A;  4XU2 A;  1VQO T;  3CCE A;  1VQ7 T;  4HCB A;  3OS1 A;  3I56 T;  3CMA A;  3DKM A;  3GNG A;  3JB9 G;  4OMF B;  3RUX A;  3LH0 A;  4Y91 A;  1Y07 A;  2ZPB B;  1S72 A;  3M5A A;  3QG1 A;  2PVO B;  3H8Z A;  5C6S A;  2RB6 A;  3L2Z A;  4N0A A;  1YJN T;  1ZBX A;  4JLI A;  3HFN A;  1JBM A;  2LC4 A;  4N4I A;  1YCY A;  3JCM V;  4C92 G;  2D9T A;  1KQS S;  5FRM A;  5FU6 B;  4HCC A;  3FJP A;  4M75 E;  3TEE A;  2XKO C;  1SSF A;  3MP1 A;  4OF1 A;  5DY9 A;  3X24 B;  4XTZ A;  3JCM b;  4JS4 A;  3M4G A;  4J7F A;  4FM4 B;  1YJN A;  2XIC A;  5HKC A;  4C5H A;  4EMG A;  2EJG A;  2O01 E;  1XNI A;  4E7L A;  1FX7 A;  1M1K U;  1KHI A;  3LWI A;  4M75 G;  5DM7 R;  1OI1 A;  3OYH A;  4X9C A;  5GMK j;  1Q81 C;  1ZQ1 A;  2XI9 A;  4NL2 A;  4A4G A;  2R57 A;  5LJ5 f;  3I55 T;  3S3N A;  4YTL A;  1RI0 A;  3MCA B;  2OTL T;  5GAN h;  4HA8 A;  4M7D C;  3L2U A;  4C8Q G;  4JRQ A;  4LDW A;  3QKJ A;  1YJW A;  2LDM A;  2DPP B;  1YJ9 A;  3X28 B;  3NFC A;  4LD9 K;  2ZCF B;  5LL6 S;  3V7C A;  3PT9 A;  2EJF A;  4M77 C;  5A2Q E;  2EKO A;  1WGS A;  3TU4 K;  5FRN A;  3LGL A;  4C5G A;  2DTI A;  2DXU A;  5I21 A;  3A8O B;  1UGQ B;  1X6O A;  4L5G A;  2RO0 A;  3S3O A;  2OTL A;  1WQ7 A;  3JCM d;  3G4S A;  3N5B B;  3V7S A;  1K9M U;  1U8R A;  3L42 A;  2V8J A;  2FL7 A;  1XTD A;  3C95 A;  1W4S A;  2Y4Y A;  3LLR A;  4EMK B;  2YHT A;  5J26 A;  4MMK A;  4A53 A;  4RG2 A;  1N6A A;  3GOX A;  1Q86 U;  2ZPG B;  3ZEH A;  3PIP A;  3QHS A;  1WJR A;  1N9R A;  3BY7 A;  2JN0 A;  4PJO F;  1VQP T;  1JJ2 S;  4X34 A;  5GAN 4;  1M4Z A;  2DEQ A;  2KDS A;  3S6W A;  4C5E A;  5CKE A;  3UWN A;  3OYL A;  3ZFJ A;  2XDP A;  3CCM T;  4LD6 A;  1MGQ A;  2RJD A;  3OYB A;  2F5K A;  1HXD A;  4MZP A;  2RH2 A;  4O5V A;  4Z02 A;  3CC4 T;  3S3M A;  2KSS A;  4UC4 A;  1K73 C;  1QVG S;  1W2B A;  2E70 A;  2VUB A;  1M1G A;  2X4J A;  1BI2 A;  3QYG B;  2RK2 A;  1Q82 C;  3LGF A;  5KCH A;  1IZ6 A;  2RI5 A;  3CCR T;  5GAM d;  3QSU A;  2EQJ A;  2LCL A;  3JCM e;  3CD6 A;  2LX9 A;  5LJ3 h;  3PIO A;  1V29 B;  2E6N A;  2HBP A;  2LVM A;  1QW1 A;  3H6Z A;  1YIT A;  4JDS A;  3VYH B;  3VV0 A;  1VQN A;  1N27 A;  4RCB A;  3TCJ A;  5LJ5 g;  5GAO p;  3OW2 S;  4M7D D;  1Y71 A;  2FHD A;  4C0F A;  4PJO B;  3RMS A;  3OYN A;  2P4T A;  3JB9 J;  2E1H A;  3M57 A;  3SDZ A;  3C94 A;  1VQM T;  2DD5 A;  4M77 D;  3CCU T;  4KUI A;  3VKI A;  2K2V A;  1UB4 A;  3ZBD A;  3OA6 A;  3MHX A;  1KC8 U;  2KAF A;  1WPY A;  2YLC A;  3HL8 A;  4J6W A;  1ZHI A;  4M7D A;  2RHI A;  1Q7Y C;  4M7A E;  4PL6 A;  2VV5 A;  3P8H A;  3CPF A;  5HY6 A;  1VQ8 T;  4QQ6 A;  2O4X A;  4E7H A;  3PFS A;  5C0M A;  2RHZ A;  2PUO B;  4TVR A;  5GAM j;  4M77 A;  4OB2 B;  1VQ6 T;  5A0L A;  3OMC A;  2FYK A;  5GAN 6;  4JRI A;  5DLQ E;  3JCM X;  2VYT A;  4J5Y A;  2H3J A;  2WAC A;  4O6J A;  2NLU A;  2ZGW A;  2DZ9 A;  4LDY A;  4M78 C;  3J7A F;  4OVA A;  3OYI A;  4Y28 E;  3J80 E;  3CPW S;  1Y96 A;  5A0D A;  1B34 A;  3G71 T;  2PVG B;  2L5Q A;  1H64 1;  3CCS T;  4BI3 A;  3OS2 A;  3G6E A;  1VQ8 A;  2LRQ A;  3HRU A;  4M7A C;  2LNV A;  1OYX A;  4II1 A;  1VQK A;  2Y90 A;  4KBM B;  3FLG A;  1BIA A;  3V8L A;  1NE8 A;  3EAE A;  2P0K A;  1NJI U;  3GIB A;  2DAQ A;  3CXC A;  2QEX A;  3OBY A;  3RKY A;  2RJE A;  3JCM P;  3CC2 T;  3E9G A;  3DLL A;  4J6Y A;  3JCM f;  4LDX A;  1KG1 A;  1KC8 C;  1R8O B;  2LCC A;  4BB7 A;  3PNW C;  4OP0 A;  4PNO A;  4EMH A;  1RL2 A;  2P0Q A;  4ME7 A;  1FWZ A;  2ZPI B;  3FC3 A;  1VQ5 T;  5A0G A;  4HCZ A;  2PU9 B;  4NS5 A;  3CBO A;  4QVC A;  1WQW A;  1UEB A;  2HAX A;  2OTJ A;  1VQ9 T;  3PGG A;  3CCL T;  4XQ3 A;  3INZ A;  5CKF A;  5FU7 B;  5IT9 E;  4ZTJ A;  4IUR A;  2ZZD A;  3DB3 A;  3FEO A;  1K8A C;  3M55 A;  1VQO A;  1VQ7 A;  2DIG A;  3I56 A;  1HK9 A;  3OQ5 A;  4NOY A;  2DIQ A;  2CKK A;  2CGH A;  3M56 A;  3AHU A;  1JRI A;  2X4W A;  3A8H B;  2JOY A;  4C92 C;  5GAM f;  2JTM A;  5KE3 A;  1I8F A;  3M4Y A;  3MEW A;  4C8Q E;  1N8R C;  2V8K A;  1M90 C;  4FL6 A;  2QQA A;  4FT4 A;  2GFU A;  3C4S A;  1NJI C;  4MZM A;  2QQS A;  4NL3 A;  3CCJ T;  4RG8 A;  2HNI A;  2I2L A;  3F70 A;  3M58 A;  2MWO A;  3PMI A;  4M78 D;  1G3Y A;  5KH6 A;  1BIB A;  1UGR B;  1X75 C;  3GLX A;  4ATO A;  2MAM A;  3O8V A;  5GAO r;  2XDB A;  4F7U A;  4E7J A;  4R56 A;  4M7D F;  1U1T A;  2A7Y A;  2M16 A;  1YBY A;  4M75 C;  5GAO m;  2HQE A;  2RA2 A;  1YIJ T;  4M7A D;  2V8I A;  3A8L B;  4RKU E;  4BD3 A;  2K4Y A;  3P8B B;  5LJ5 h;  4BE2 A;  4BY6 C;  4M78 A;  1O75 A;  1VUB A;  3HRS A;  2EQK A;  3ASK A;  2F69 A;  4M77 F;  5IN1 A;  4C8Q C;  4ELY C;  3OS0 A;  1H3Z A;  4Q5W A;  3QZ5 B;  3Q1J A;  5CO7 A;  5M9O A;  2QTX A;  2GCX A;  5LJ3 e;  3I55 A;  3CCV T;  2K3X A;  2L89 A;  3JCM g;  2EWN A;  2R5A A;  2RK1 A;  3QO3 A;  2X4X A;  4IUV A;  4EMK C;  4M7A A;  2E10 A;  3A8M B;  3OY9 A;  4BDY A;  4ZGD B;  4GY5 A;  3SWN A;  3JCM Q;  2LT4 A;  1VQ4 T;  1DJ7 B;  3RKW A;  2JNG A;  1I4K 1;  2KQW A;  2OAU A;  1W2B S;  2MF2 A;  4C0D C;  3CCV A;  5I2M A;  5J39 A;  1M1K C;  4M7D B;  2KMT A;  3JB9 D;  4ELZ C;  1VIE A;  4N4H A;  4E7I A;  3UDC A;  3X26 B;  3RIR A;  1LJO A;  1WJQ A;  5GAN 8;  2M9U A;  1P92 A;  4M77 B;  4V2S A;  4C92 D;  2KVQ G;  1LNX A;  4LDU A;  4PJO G;  3CCQ T;  2QQ9 A;  5CAI A;  5GAM g;  4ZTF A;  1VQP A;  2K5F A;  5GAN 3;  1Y7X A;  2MWP A;  3CCM A;  2LQ8 A;  1Y96 B;  1XQH A;  3QJY A;  4DOV A;  3CC4 A;  4C92 A;  3HSB A;  3RMQ A;  4XAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...