3LGFA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k370me2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lgfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lgfA01
3CXCA 1VQ4T 3PNWC 1VQLA 4E7LA 3ZEHA 4QW2A 3H8ZA 3GOXA 2HQEA 1Q82C 4LD6A 1VQ6A 2RHIA 3S3OA 3ME9A 2L3RA 3CCQT 1N27A 3OY9A 2DIQA 4IUTA 3CCRT 3DB4A 3G6ET 2RJEA 3S6WA 2RHZA 2EIFA 1KQSS 1NJIC 3NTIA 1XNIA 5IAYA 3CC2A 4N4GA 1Q82U 3CXCS 2EQMA 2RI5A 1VQ5A 2EQUA 4QVZA 3CCLT 3ASKA 3CCUA 4E7KA 3CCMT 3CCJA 4TVRA 3OYMA 1VQ9T 2LCCA 3OW2A 1YHQA 1YJNT 2O4XA 2JZ2A 3DLLA 2M16A 3CC4A 2M0OA 1WJSA 3I56A 5D6WA 2LVMA 2RI2A 4QQ6A 3LYIA 2RI3A 3LGFA 3NTKA 2OTLT 4IUVA 4OVAA 3CMEA 3OS0A 3PIOA 4E7HA 5DM7R 3P8DA 3G4ST 3OQ5A 4RG2A 1OI1A 1M1GA 1K8AC 3SD4A 2QQRA 3OYIA 2XHCA 3OW2S 4UC4A 2QA4T 3OYJA 4QQDA 4GY5A 3PIPA 4A4HA 3OYBA 1KC8C 2E70A 5DLQE 1VQ7A 5J39A 1VQOA 1K73U 1YBYA 2RHUA 3MP6A 3P8BB 2MWOA 3DLMA 5FROA 5D6XA 3A5ZB 3FEOA 4C5HA 2XK0A 3CEYA 3NTHA 3ER0A 3I55T 3OB9A 2RJDA 1VQNA 2L8DA 2OTJA 2D9TA 5KE3A 1KD1U 3MEAA 3L2RA 4FU6A 3CCVA 1YITA 2DO3A 2QEXA 3S3NA 3M9QA 3CMAT 3TREA 1VQ8T 2X4XA 1SSFA 1BKBA 5A2QE 3MP8A 5FRMA 4Q5WA 1YIJT 3CCEA 2CKKA 3E9GA 2HQXA 3MEWA 1EIFA 3QBYA 3FDRA 1VQ4A 2RHXA 1QVGS 3MP1A 3JAME 2O4XB 3CPWS 4HCZA 4BE2A 2EFIA 2PQWA 1S72T 1OZ3A 5J3BA 3E9FA 5FRNA 3CCQA 3MEVA 3L2UA 3L42A 4ZN3A 4B9XA 3CCRA 1Q81U 1QVFA 3H6ZA 3CD6T 3G6EA 4N4IA 1Q86U 5LL6S 4PL6A 4L59A 1KHIA 4IUUA 2IG0A 3Q1JA 3PMTA 5KE2A 1VQKT 3CCLA 2EQJA 3OYNA 3CCMA 3C4SA 1YJWT 2X4WA 2XDPA 2LQ8A 1VQ9A 1M90U 1RI0A 2JTFA 3FLGA 1YJNA 1K73C 3OMGA 1JJ2A 3QJ6A 5M9OA 3OMCA 2BUDA 4C5EA 4QQGA 1N8RU 5J26A 3UWNA 2K3XA 2KDSA 3PMIA 1G5VA 3LLRA 3OA6A 2X4YA 3O8VA 4A4EA 4PLIA 3G71T 3G4SA 5KCHA 2BIVA 4FL6A 2DAQA 1OZ2A 1VQPT 1KD1C 2F5KA 1YI2T 4IKFA 1K9MU 1RL2A 4C5GA 2QA4A 1VQMT 2MI6A 3OYFA 4ZN1A 1W2BA 5FLXE 1YJ9T 3OYEA 3EAEA 3OYLA 4IUPA 3OYGA 3CCST 4IURA 3FC3A 3QKJA 2VYTA 3CC7T 3KBGA 1VQLT 3KUFA 2GFUA 4BACA 2R58A 1X6OA 1MHNA 2E5QA 4C5IA 3I55A 3J7AF 3J80E 3S3MA 2RJFA 1VQ6T 1NPRA 2JOYA 2QQSA 1Q7YU 4EDUA 1W2BS 2LRQA 3DB3A 1Q81C 2JVVA 1Q86C 2R57A 1IZ6A 1OYXA 3CMAA 2B8AA 3CC2T 2P0KA 1VQ8A 1VQ5T 1XTDA 5D6YA 4B9WA 4E7JA 4ZTJA 3CCUT 4CRIA 1M1KU 3OYDA 3CCJT 4PLLA 1YIJA 2YRVA 4BE1A 2X35A 5HY6A 3PFSA 4X34A 2K3YA 1YHQT 1M90C 3CPFA 3LGLA 2WACA 2NLUA 3CC4T 1S72A 3BDLA 4II1A 5C6SA 2LTOA 3I56T 1WJRA 1KHCA 1N8RC 4BDYA 2RO0A 1NJIU 3CD6A 2BKDN 3CMET 3META 4IUQA 2LCLA 2DIGA 2JUFA 1QVFS 4BE0A 4A4GA 3OYAA 2LDMA 3P8HA 1VQKA 1NPPA 2R5MA 2E6NA 1K9MC 1YJWA 5KH6A 3OYHA 3L2VA 5CIUA 1VQ7T 1VQOT 2OTLA 2EQKA 1WJQA 3LH0A 3OYKA 2G3RA 2E6ZA 3J81E 4N4HA 4Z02A 3OS2A 2GF7A 3UT1A 3L2QA 2FHDA 4YTLA 5IN1A 1UEBA 1JJ2S 5KCOA 1VQNT 5IT9E 2OTJT 2R5AA 4NS5A 2JNGA 3HKSA 3G71A 5C0MA 2KVQG 2EKOA 3OYCA 1K8AU 4ZTFA 4A4FA 1H3ZA 3CCVT 1VQPA 1Q7YC 3MEUA 1YITT 2M1HA 1YI2A 3QIIA 3MO8A 2QEXT 1KC8U 2MWPA 1WGSA 3LX7A 1NZ9A 4BDZA 1VQMA 4BD3A 2RJCA 1YJ9A 4E7IA 3F70A 2RHYA 1QVGA 3OYYA 1KQSA 2L89A 3CCET 3OS1A 3CPWA 1M1KC 3CCSA 3L2WA 2GFAA 3CC7A
chains in the Genus database with same CATH superfamily
2DTHA 1VQ4T 1VQLA 5CAIA 1M8MA 4M78F 1AOJA 2CSQA 3ZEHA 2KT8A 4AG1C 2RH2A 2RNAA 3MHXA 2HQEA 1Q82C 3BY7A 2QDLA 4OMQA 2COWA 5GAN6 2EWNA 3S3OA 1VA7A 4RTUA 5GAOn 3EGXA 2ED0A 2CP3A 4FSXA 4M7AF 3BE3A 2J05A 3DB4A 1ARKA 5CQXA 1ZUKA 1OX8A 2I2LA 1GFDA 5KYXB 2DBKA 1YN8A 3CC2Q 1LCKA 4F04B 1VQ5A 3NGPA 3ASKA 3G1JA 3CCUQ 1U8RA 5EC7A 1JB0E 1M1FA 3GBQA 3H0FA 4TVRA 1QVGP 3OS5A 2K5FA 1TUGB 2Y4YA 4E6RA 4VUBA 4R0KA 3OW2A 2QYZA 2K57A 1YHQA 4XQ3A 2O4XA 1WNLA 5LJ5h 4ELYC 3QDFA 1N8RR 3I56A 5D6WA 2LVMA 3M57A 2FRYA 4M77B 2XMFA 3LYIA 1N6AA 2ATCB 2H3EB 1RLQC 3LGFA 3PT9A 1K73R 3WXMB 3FIFA 2O9SA 2J6KA 4OVAA 4DEXA 3QWXX 1HXDA 3PIOA 3CMEQ 2HL5C 1PSEA 3OQ5A 2ZZDA 5IXFA 2XI9A 1OI1A 1M1GA 3SD4A 1JEGA 2V1QA 4J8OA 2XHCA 2MIOA 5GAOq 4F14A 1RLPC 2QA4T 5LJ3h 3OYJA 1WHHA 4GY5A 3PIPA 1KC8C 3VKIA 2E70A 1WQWA 2M9UA 2DE0X 1TG0A 5GAMh 1YWPA 2HZYA 4M7DD 2A3LA 2KRMA 3MP6A 1W70A 1M9SA 1IHVA 3FEOA 2E5KA 2COZA 1OEBA 1GCQC 2XKOC 1V1CA 4HVWA 1TSFA 2DNUA 1LPLA 2NUZA 2KQWA 5I11A 1QCNA 4X9CA 4JLIA 1KIKA 3MEAA 3QDRB 4FU6A 3M53A 4KRTA 4Y91A 2V8KA 1NE8A 2QEXA 3S3NA 3M9QA 2E64A 3CMAT 2IVWA 4DQ2A 2YDLA 2OI3A 4M77F 5I2SA 1Z9QA 3MP8A 3T9NA 2MMPA 1K0XA 4DBFA 2JS2A 1UHCA 4AFQC 2BZYA 2GTOA 4M7AD 1VQ4A 1TTHB 2RHXA 1LJOA 2HSPA 3MP1A 2PVGB 3EGDB 2X3WD 3CPWS 4HCZA 2PQWA 3GNFB 4Y92A 1VQ5Q 2QG9B 5FRNA 2ED1A 2FVUA 5GMKj 4B9XA 1Q81U 1WHJA 3CD6T 4N4IA 3G6EQ 1QKXA 4NOYA 3TSWA 4RG8A 4KULA 1YHQQ 2KEAA 5GMKm 3Q1JA 2EQJA 2VGMA 2M0YA 1RAFB 3EG3A 1EX4A 4J6XA 4EMKA 4HT8A 1PWTA 4DOVA 5LJ5f 3SWNA 2Z0WA 2YUNA 1UUEA 4FYYB 4M7DA 2RQUA 1RI0A 1HSQA 5GAOl 2YUPA 1SKUB 4F7UE 4D8KA 1JJ2A 3OMCA 2BUDA 3E2UA 1M3AA 2CP6A 4XTZA 1X6BA 2ROLA 4BI4A 2EYQA 3M58A 4PJMA 3ZL7C 1GFCA 1PSFA 4PFOA 2K3XA 4OF1A 3M0QA 1WI7A 2L0AA 3O8VA 5FU6B 3O5ZA 2P4TA 4V2SA 5LJ3f 1BYMA 1WX6A 4PLIA 1A0NB 4PJLA 4ESRA 1VQPT 1X01A 5GAMf 3EFOA 1KC8R 4IKFA 1K9MU 2HKNA 2QA4A 4EMHA 4JZ3A 1VQMT 2QXFA 2MI6A 3VYGA 1M3CA 9ATCB 2ZPBB 5GANg 3QG1A 2FZGB 1D0XA 2DX1A 3FC3A 4M7AA 4M78E 2FPFA 3KUFA 4HCBA 2DL3A 1PD0A 4OGCA 2R58A 4PK4A 2QEXQ 2JMAA 2MK5A 1X6OA 5GAN5 3JCMd 2Y4XA 4M77D 3J80E 2RJFA 3RESA 3SWNC 3FB9A 4C0GA 1I1JA 4C92G 1NEBA 1Q7YU 3VS2A 1PRMC 3L2ZA 5A0GA 2LRQA 2DBMA 3DB3A 1Q81C 3DKMA 1VQ4Q 2JVVA 2VV5A 4J6WA 3CMAA 4OP0A 3CC2T 2P0KA 2XICA 2HSEB 5D6YA 3CCUT 2AKKA 2LQKA 2YRVA 4PFZA 1RAGB 2X51A 1YNZA 4D6WA 3UA6A 2KYMA 1BK2A 2D0QB 2VXFA 4MDWA 2P4RA 1ZSZC 4ME7A 2CH4W 2EGCA 3CC4T 1FXXA 3BDLA 1S72Q 2YRDA 1FMWA 2KMTA 3VUZA 1QKWA 1UHFA 2MPXC 4OGEA 4BDYA 3WVDB 2JS0A 2OAUA 3CD6A 2BKDN 2RK2A 3D7SB 3JCMc 3CMET 1U3OA 3JV3A 1G2BA 1PHTA 2YUQA 2E4HA 5KYXA 4CC3A 2O9VA 1QVFS 4M75G 4J9IA 2LDMA 4AFUC 2EW3A 1XOVA 1K9MC 1U1TA 2K5LA 2KAFA 1C1AA 3PVLA 2CDTA 3X24B 2EQKA 3LW5E 1I07A 1QVFP 1Q95G 2A0FB 1K8AR 4E7SA 3AHUA 2G3RA 4C92B 2E6ZA 3J81E 3VRZA 4Z02A 3V8KA 2ZGWA 1U1SA 4L6V5 3UT1A 4FW1A 1K9AA 4FYXB 3JCMh 2XG8D 1I5OB 4M77A 5IN1A 2IIMA 2FB7A 2C06A 3URGA 2GCXA 1JBMA 2YLBA 1HD3A 3OYCA 2DD5A 2LZ6B 1VQPA 1Q7YC 5GMKl 4JRIA 4PJJA 2EPDA 1NBEB 1NZ9A 1X6GA 1VQMA 3IQLA 4MZTA 1FX7A 2AHJB 3QZ5B 2KRSA 4E7IA 1QWFA 2VASA 2K2VA 1NYFA 1X2KA 3CCET 2PVDB 1GRIA 2DILA 1ZSGA 4MZPA 3L2WA 2HKQB 2E65A 1ABQA 4ZGEB 4JRPA 2LMJA 5GJVB 3M4YA 1Z9ZA 5IHKA 4A54A 4QW2A 2NUPB 4L5GA 2DXTA 7AT1B 2QK0A 4LD6A 1QWEA 2KXCA 1VQ6Q 2L3RA 3RKWA 4M75B 1Q81R 4C8QC 2GNCA 4IUTA 3E1SA 3G6ET 4J5YA 1OU9A 2KT1A 2RHZA 2NUTA 1TXQA 2CZ7B 1KQSS 4KGVB 3VS6A 4HCCA 2VWFA 1XNIA 1DJ7B 2DXBA 3R6OA 5IAYA 3CC2A 4N4GA 1Q82U 2MCNA 2KI7A 1UG1A 3CCLT 1ACMB 3CCUA 3VS1A 4DEYA 1FMKA 2EYXA 5CVIA 4DBRA 3GNGA 4OB3B 3OYMA 4LUDA 1Y0MA 4RCCA 1KQSP 3X25B 2ESWA 2JM9A 1VQ9T 3FRNA 5IH2A 1WA7A 2LCCA 4MMKA 2E41A 3EGDA 2JJ9A 2JZ2A 3OSSC 3DLLA 2M16A 4RTXA 2DTIA 1BI1A 1ZSZB 3CC4A 2M0OA 1WFWA 2C0OA 2GGRA 4ELZC 1G83A 3JB9F 1WHMA 2K79A 2RI3A 2WSCE 4AG2C 2RQWA 4EIKA 3CMEA 4E7HA 2DEQA 4XK8E 4FIBA 2CP5A 2P84A 1K9MR 1RACB 4ORZA 1RAHB 1NEGA 4OMLA 3OW2S 2D8HA 4UC4A 4NL3A 2EYZA 2QAZA 4C8QG 1AWJA 1UGQB 2HAXA 3G7ZA 3VUBA 5DLQE 2LCSA 4C0FA 1VQOQ 3MCAB 1X2QA 1YBYA 2MOXA 4FYWB 5A0DA 2V8JA 4PJOE 1WIEA 3HHTB 3OW2P 1E6GA 2CUBA 1VQPQ 5FROA 2YLCA 1JU5C 3PE0A 4C5HA 1UGVA 1ZX6A 5L23A 3RIRA 3CEYA 3NTHA 3ER0A 1VQMQ 1NLOC 3OB9A 2L2PA 2L8DA 2LNHB 1VQNQ 1Q7YR 2D9TA 5KE3A 3L2RA 3RMSA 3CCVQ 3MKDA 3OBYA 2L3QA 2DO3A 5LJ5g 4CC4B 3JCMP 1WYXA 2P0QA 2RA2A 1VYTA 2E1HA 5A2QE 1MMGA 4J6YA 2A28A 3WVEB 3CCEA 2QGFB 3OSVA 3E9GA 3MEWA 1EIFA 5CO7A 2DYIA 3FDRA 3UF4A 4F17A 1Y96B 2E3IA 5AT1B 3VV0A 1QVGS 3VU3C 4BE2A 1Y57A 4J9HA 5LJ3g 1S72T 1U06A 2ZCFB 2F2WA 3HFNA 1GCQA 3E9FA 2EGAA 1YCSB 3MEVA 5GAMg 3CCQQ 4RKUE 2FZCB 2H3JA 2KROA 3G6EA 4PL6A 1Q86U 1M90R 4C8QB 1T0HA 2PZ1A 1KHIA 3JCMe 1G3TA 3I5SA 1VYVA 4IUUA 4JS4A 4RTWA 4OMFB 3CCLA 1QCOA 3CC4Q 1PCXA 2HL3A 2CYZB 4MDXA 2HBWA 5FU6C 2XDPA 3JB9D 1IXDA 3VS7A 1VQ9A 4R55A 5KYYB 3QYGB 2JTFA 3HRUA 2EJ9A 1M3BA 4LXCA 1TS9A 1X69A 3VS3A 2X9HA 3QZ9B 5J26A 2O01E 3SFMA 3UWNA 4D8DA 1E7OA 3SB2A 2KDSA 4M75D 2KR3A 3LLRA 3OA6A 1YP5A 2X4YA 1I4K1 3REAB 1XJWB 3G4SQ 4B6MA 2XDDA 4FL6A 2DAQA 2G6FX 4Z8AA 4OB0B 3U23A 2O88A 4OMPA 2LC4A 1V29B 3HPWA 4PJOG 1MV0B 1UB4A 1BI3A 3OYEA 3EAEA 4IUPA 4LNPA 5CK9A 5L8RE 4C8QF 1AVZC 3OYGA 1WXBA 3QKJA 2ABLA 1GL5A 3C12A 2GFUA 4BACA 2FPEA 3RR6A 3L1AA 4QVDA 2GBQA 2E5QA 2CZ6B 1JO8A 2K6DA 2DF6A 1VQ6T 1BCMA 3M4GA 1D3BA 2DD4A 3CCEQ 4EPCA 1TH7A 5I2MA 3SHWA 1RAIB 1GCPA 2AKLA 1Q86C 1IZ6A 3H9NA 4XU2A 4N0AA 1Q82R 2YWWA 2SEMA 4ANJA 1VQ8Q 5DLOA 2VB6A 4E7JA 3OYDA 4PLLA 3CCJT 1N9RA 1ZUUA 1PKTA 2DPPB 2JTEA 5HY6A 2K3YA 1K0SA 1UGSB 2QASA 2EYWA 3LGLA 1S72A 2NUPA 4II1A 3I9QA 2QGGA 3CCLQ 3HSBA 2LTOA 4KBMB 1TWBA 1IGUA 4RTVA 4ZNXA 1WJRA 4GBQA 2EGEA 1SHFA 4M75A 2WSEE 3OBWA 1VUBA 2LJ3A 1VQ9Q 2LCLA 4C92C 4A4GA 3P8HA 2R5MA 1VQKQ 1H8KA 3A8HB 2E6NA 2PU9B 2ENMA 2RF0A 5GANd 3X26B 1QP3A 4FSSA 1VQ7T 1VQOT 4KH0B 2BE9B 3A8GB 4M7DE 1I81A 3LH0A 1KQ2A 3TCJA 1G3SA 4RTZA 4AT1B 2K7AA 2XDBA 3JCMQ 4N0AC 2O31A 4LN2A 1ZSZA 2HNIA 1RI9A 2KBTA 3L2QA 3QJYA 3BDUA 1KSWA 2OX7A 1VQNT 2EJGA 1MGQA 2KY9A 4JLGA 3VS0A 5IT9E 2OTJT 2M02A 4NS5A 2LQWA 4KH1B 4OMNA 4C8QD 4R56A 3CCVT 2DM1A 3MEUA 2KNBB 3QIIA 4J9BA 4XTWA 2FL7A 1RAEB 2HQHA 2A7YA 4BDZA 1WHKA 4JJBA 2QI2A 5GMKe 2DFUA 3F70A 4M75C 2DL5A 3OS1A 2J6OA 3H41A 3CPWA 3QYHB 3EH2A 2D1XA 4M7AE 3CXCA 3VS5A 3PNWC 1UGPB 4HA8A 1SPKA 4JJCA 1ZA2B 1ZHIA 2DRMA 2RD1A 3H8ZA 1D09B 4PKCC 2D8JA 1VQ6A 3TEEA 2DVEA 2QQAA 3CCQT 3OY9A 1UGRB 3AT1B 3BFMA 4RCBA 1Q86R 2RJEA 3S6WA 2EIFA 2DZ9A 4HCKA 3NTIA 2RQRA 1UDLA 2EJFA 5CKEA 5GMKi 4O6JA 2X4JA 2EQMA 1UJ0A 1OU8A 4QVZA 3JCMg 2K9GA 3NFCA 3HFOA 4E7KA 2M51A 3CCMT 3CCJA 3QPHA 1WHGA 3A1PA 3TQ7P 1EFNA 2GTJA 1MMNA 1Y96A 1CSKA 3MPUB 1M27C 1WLPB 1E6HA 3CBMA 1X43A 8ATCB 2CS7A 1NYGA 3FJ5A 3REBB 3V7RA 1WJSA 5FU7B 1Y71A 2RI2A 1OOTA 2ZPFB 3RBBB 5CR2A 5GAN4 1SG5A 4F7UG 2KYBA 4IUVA 2OTLT 5DY9A 4C8QA 3OS0A 3HRSA 1I5LA 3P8DA 3G4ST 4RG2A 2XIDA 3A8LB 2YSQA 2OJ2A 2PUKB 1HK9A 2QQRA 3OYIA 5IXBA 3V8JA 3A98A 2ZAEA 1G3YA 1YCYA 4M7DG 4QQDA 1ZUYA 4A4HA 2CT3A 1M5Q1 2HBPA 3GIBA 3EFRA 1VQ7A 2J7IA 1VQOA 4X9DA 1K73U 1YFNA 3LWIA 5KYYA 2J06A 3P8BB 4K11A 3DLMA 2X3XD 1M8VA 4WCIA 1C6VX 5D6XA 3A5ZB 4PJNA 2ROTA 4E7ZA 3A8MB 2DK3A 4M77E 1T3LA 2RJDA 2CT4A 4M78G 1VQNA 1MNEA 2OTJA 1G3WA 2CP0A 2K5IA 2AK5A 3CCVA 1H641 2GQIA 4J9EA 4FM4B 1T3SA 3JB9H 2PNIA 2D0NA 3KFVA 3TREA 1VQ8T 4PNOA 1BKBA 2KK4A 1YIJT 2CKKA 2HQXA 5CKBA 1IREB 1UJYA 2FEIA 1QQJA 1D1BA 4C92F 1HYOA 1GBQA 8AT1B 4F7UB 1PD1A 1MMAA 1VYUA 2HEQA 3ULRB 4JRQA 1LVKA 5GANj 5J3BA 4E47A 1Y07A 1K1ZA 3CCQA 2A36A 3CCJQ 2ECZA 1NG2A 1QVFA 3H6ZA 2CP2A 3CCRQ 1V76A 4XAXB 1OV3A 3EG2A 2F5TX 3C0CA 2A08A 3QXEB 2IG0A 4A4KA 2AZVA 3PMTA 1O75A 5KE2A 1VQKT 1QW1A 4QVCA 3OYNA 3CCMA 3C4SA 4FYVB 2DKGA 3RERA 3H0IA 2X4WA 4JPBW 5KYWB 2XU8A 4C0ZA 2RM4A 4J9FA 3SEMA 2HMAA 3FLGA 1AT1B 5FWBA 2E12A 1K73C 4IIOA 4JUVA 4M78B 2LJ1A 2YT6A 1TOVA 5M9OA 1B34B 3EFSA 4BI8B 4J83A 4M75F 1VQ7Q 4A4EA 3JB9J 2BTTA 3M0TA 3G71T 3G4SA 3JCMf 5KCHA 1OZ2A 2VKNA 2F5KA 1YI2T 2HCKA 5LJ5d 4GLKA 4F16A 2QTXA 4BUGA 2RK1A 3OYFA 4BB7A 4ZN1A 2QDYB 1JRIA 1W2BA 1O9SA 2XD0A 3VJPA 1UE9A 3MJXA 5EG2A 2OTJQ 2LQNA 3CCST 1IHWA 2VYTA 1M2VB 2W10A 4M77G 3C95A 1TU0B 3HRTA 5GANe 1BCOA 4KUDK 4LUEA 5LJ3d 2JMCA 1M30A 2JT4A 1R0CB 1OULA 2L5QA 3S3MA 4LDYA 5GAMd 1NPRA 2JOYA 5I22A 2C0TA 1CKBA 1PC0A 2P0PA 3I35A 3EG0A 4EDUA 3M54A 1BIBA 2FYKA 5HCKA 4J7FA 5GAOm 2R57A 4C92D 4BY6B 4RTTA 2LJ0A 1OYXA 2HDAA 1IO6A 5CQYA 1VQ8A 3NPFA 1N5ZA 5A0LA 2NYSA 4CRIA 1M1KU 2DERA 1YIJA 1VIFA 2RQVA 2DJZA 4WF2A 1LNXA 4XTVA 4XU0A 2BZXA 4PJOC 2X35A 3PFSA 3X20B 4X34A 1SRLA 2EYYA 5GMKh 2RN8A 3GF5A 1ZBXA 3V7SA 1BU1A 5C6SA 1HJDA 3R6NA 1WHLA 3CCMQ 1KHCA 4KT0E 1G8XA 2DJQA 1ZLMA 2RO0A 1NJIU 1MMDA 1QVPA 1X75C 4WTOB 4IUQA 1FYNA 5KYUB 4LE9A 1RABB 4BE0A 1J3TA 1VQKA 1MUZA 3M0SA 5CKDA 1B3QA 1PM3A 1YJWQ 1M2OA 3L2VA 1KFZA 1MV3A 3BW1A 4OMMA 2OTLQ 5HKCA 3GPLA 2YRCA 4N4HA 1SRMA 1KQ1A 2CH4A 2GF7A 4LDUA 1VIEA 2V26A 1UEBA 1JJ2S 2PVOB 1WZOA 5KCOA 4A53A 1D0ZA 2R5AA 1IRXA 2JNGA 2Y90A 1OPKA 3HKSA 3G71A 5C0MA 2V8IA 4OB2B 1K8AU 4A4FA 1H3ZA 4HKEA 3QUIA 4J7IA 1YITT 4C92A 1YI2A 3JCMb 1WGSA 3PTAA 3NHNA 1W4SA 3RKXA 4LDWA 2DL7A 4KGZB 2RJCA 1JJ2P 3EG9B 3LH5A 1YJ9Q 1SHGA 1QVGA 2L3PA 2YUOA 3CBOA 1M1KC 3CCSA 2GFAA 1BBZA 4OB1B 2NUTB 2OAWA 2LNVA 3M0UA 3CC7Q 2JW4A 2LP5A 4E7LA 1VQLQ 4M78D 4C92E 3UATA 3THKA 2AIRB 2E10A 1WPYA 1WDXA 1W1FA 4CC2A 3GOXA 2QTVA 4AMCA 2JN0A 3KXTA 4JJDA 1PG5B 2RHIA 3ME9A 2ZPHB 1N27A 1AWWA 2DIQA 1YIJQ 1AEYA 2DMOA 3CCRT 3QWYA 1SSHA 2CGHA 2K3BA 2YHTA 1NJIC 2SRCA 3QO3A 1B7TA 2FO0A 4M4ZA 5CKHA 3CXCS 2RI5A 5FU7C 2EQUA 3JSCA 2JXBA 2K2MA 4CI0C 1T0JA 1I8FA 3HTRA 2FPDA 1AWOA 2DA9A 4ZGJB 4Z89A 1BIAA 2MYSA 4X1VA 3CPWP 2FG0A 5LJ5j 4PJOB 3CXCP 1YJNT 5GJWB 2FRWA 4F7UA 3I5RA 1QMCA 1JQQA 2LX7A 5FW9A 4LDVA 3TU4K 2CSIA 2V1RA 4RUGA 3I56Q 1IB8A 4HXJA 4QQ6A 4M75E 4IIMA 2QQBA 2FZKB 2VXEA 1BI0A 3NTKA 1CKAA 3RNJA 1UTIA 4DOWA 3A8OB 4JJNK 5DM7R 1ZBJA 2A37A 2EKHA 3RKYA 1ZA1B 2MF2A 1AZEA 5LJ3j 2RPNA 1K8AC 2VVKA 3M0PA 2CZ0B 2CUDA 2EVRA 3OYBA 5GAMj 2F69A 1OQKA 2DYBA 5J39A 1K76A 1GXIE 5KYWA 2RHUA 1PKSA 2LT1A 3G71Q 4M78A 4J9DA 2MWOA 1D0YA 2RQTA 1B34A 3ZFJA 1QCFA 1YI2Q 6AT1B 2JM8A 2XK0A 3EHQA 5KYNA 1F1BB 1N9SA 2EBPA 2H8HA 2RMOA 2AT1B 4QT7A 3I55T 1FWZA 3EGUA 3EGXB 4QKUA 1KD1U 4XU3A 3HP9A 4PJOF 3CCSQ 3X28B 2YXYA 1NM7A 2HD0A 1YITA 2F2XA 2DZCA 1QLYA 1OX9A 2X4XA 1SSFA 4CC7A 4FT4A 1BI2A 4EMKC 5CCAA 2DXUA 2DEUA 1M1KR 2EAYA 1BB9A 5GAN8 5FRMA 4Q5WA 2DRKA 1S1NA 3SDZA 5LJ5e 4M7DC 3QBYA 5HK3A 1M2VA 2J6FA 2EQIA 2NWMA 2W0ZA 3JAME 4Z88A 2O4XB 2KRNA 1AWXA 2EFIA 3GP8A 3RMQA 4C0DC 1OZ3A 4AFSC 4LD9K 4PFPA 1R0BG 4FW2A 5GANh 3L2UA 1NJIR 3L42A 4ZN3A 3CCRA 1EZZB 1FMVA 4GLMA 2AZSA 1IGQA 3NMZC 5LL6S 5LJ3e 3JCMW 4M78C 4L59A 5ECAA 2LX9A 1KJWA 2KSSA 4Y28E 2K4YA 4MZMA 3INZA 1K4US 5GAMe 1JXOA 3JB9G 3PGGA 3PVQA 3VYHB 2PUOB 1ABOA 2DL8A 2IPOB 3M56A 4HVUA 1YJWT 3UA7A 2LQ8A 2F2VA 4M7AC 2C0IA 2RB6A 1M90U 1TUDA 4KGXB 1WQ7A 1QP2A 5CKFA 3JCMX 1VOMA 1YJNA 2KE9A 4J9GA 1U5SA 3OMGA 3QJ6A 4KUIA 4C5EA 4QQGA 1N8RU 3M0RA 1PRLC 4EMGA 4XTYA 1WXTA 3PMIA 1G5VA 4C8QE 4DBQA 5KYUA 2BIVA 4AFZC 3TSZA 3RDVA 1KD1C 1RADB 1AD5A 4RTYA 2MAMA 1RL2A 4C5GA 1LOJA 2QA4Q 4FCYA 4XTXA 4HT9A 1GBRA 5FLXE 1YJ9T 1X27A 5GAN2 3OYLA 2E3HA 1D3BB 5GAOp 4ZGDB 1RUWA 4IURA 3UDCA 1B07A 1WXUA 2DL4A 3CC7T 3KBGA 4PJOD 4BY6C 1VQLT 2LT4A 1YITQ 1NLPC 2ZPEB 1TUCA 1MHNA 1XQHA 1D1CA 3FJPA 4C5IA 3GLXA 3I55A 3J7AF 4M7AG 1AHJB 1I0CA 1R77A 2CREA 4HVVA 4ATOA 1R8OB 2DVJA 3V7CA 2VC8A 2QQSA 1W2BS 2O2OA 3QSUA 2GQVA 3M5AA 2VGNA 4DA4A 4J9CA 1H3HA 3JCMJ 2B86A 2B8AA 4XTUA 3RUXA 3LWHA 3CMAQ 4P5NA 1C0MA 5GAOr 1VQ5T 1XTDA 2CZ1B 3EG9A 2KXDA 3CQTA 4B9WA 5I21A 1SEMA 2JTMA 5IHIA 4ZTJA 2DXCA 3VRYA 4EMKB 1W2BP 4MMLA 4BE1A 3E19A 3SWNB 2D6FA 3TVTA 4M7DB 3EH1A 3HL8A 1YHQT 1OPLA 5GANf 1M90C 3CPFA 2L3SA 2WACA 2NLUA 4OMOA 4M77C 4C0DB 3I56T 2VUBA 4FT2A 3M59A 4JZ4A 3EG1A 3C94A 1N8RC 3H0HA 2ZPIB 4NL2A 2PTKA 5FWCA 3CD6Q 3META 1KG1A 5HK0A 2DIGA 1P92A 4LDXA 3EHRA 2JUFA 2DETA 1YJNQ 1AZGB 3EFOB 3OYAA 3VS4A 2BZ8A 1D1AA 1NPPA 2CP7A 2WSFE 1YWOA 3CBPA 4BI3A 5KH6A 4A63B 1KK7A 1YJWA 3OYHA 5CIUA 1Y7XA 2BE7D 3M55A 4JRKA 2OTLA 5D7UA 1WJQA 4M7AB 3OYKA 4PJOA 2KGTA 4E2FB 4RMOA 1H92A 4F7UF 1M4ZA 2COYA 3ZBDA 5GAN3 3OS2A 1RAAB 3QHSA 2QQ9A 2FHDA 3JRZA 4YTLA 1JXMA 1ZQ1A 5AYFA 3UPUA 3JB9I 4M7DF 1KD1R 5GAN7 2KVQG 2EKOA 4ZTFA 1PNJA 3V8LA 1MNDA 2M1HA 4DBHA 2DLPA 3MO8A 1UFFA 2QEXT 1KC8U 2MWPA 3LX7A 4JS5A 4JDSA 2F1LA 4BD3A 1W6XA 2ZPGB 2DTOA 3N5BB 1YJ9A 1UECA 2I0NA 1SF9A 4O5VA 4XU1A 2RHYA 3I55Q 3OYYA 1KQSA 2L89A 5IHNA 3JCMV 3CC7A
chains in the Genus database with same CATH topology
3CXCA 2LNVA 2DTHA 4JRPA 1VQ4T 3PNWC 1I5LA 5CAIA 4M78F 4E7LA 1VQLA 4M78D 4C92E 1UGPB 3ZEHA 3M4YA 4HA8A 2E10A 4A54A 1WPYA 1ZHIA 2RD1A 2RH2A 3H8ZA 4QW2A 3GOXA 3MHXA 4L5GA 2HQEA 2JN0A 4PKCC 3KXTA 1Q82C 3BY7A 2DXTA 4LD6A 2RHIA 5GAN6 3TEEA 2EWNA 3S3OA 1VQ6A 2DVEA 2QQAA 3ME9A 2L3RA 2ZPHB 1N27A 3CCQT 3RKWA 3OY9A 4M75B 1UGRB 2DIQA 4C8QC 3BFMA 5GAOn 4IUTA 3CCRT 4FSXA 4RCBA 4M7AF 3E1SA 3DB4A 2RJEA 3S6WA 4J5YA 3G6ET 2CGHA 2RHZA 5CQXA 2EIFA 2YHTA 2DZ9A 2CZ7B 1KQSS 1NJIC 2I2LA 3NTIA 4HCCA 1XNIA 3QO3A 1DJ7B 2EJFA 5GMKi 5CKEA 2DXBA 4O6JA 3R6OA 5CKHA 5IAYA 3CC2A 4N4GA 2X4JA 1Q82U 3CXCS 2EQMA 2RI5A 5FU7C 2EQUA 1VQ5A 4QVZA 3JCMg 3JSCA 3CCLT 3NFCA 3ASKA 3CCUA 3HFOA 4E7KA 3CCMT 3CCJA 3QPHA 4CI0C 1U8RA 1JB0E 1I8FA 1M1FA 5CVIA 3GNGA 4TVRA 4OB3B 3OYMA 3OS5A 4ZGJB 4RCCA 2K5FA 1BIAA 3X25B 2Y4YA 1VQ9T 1Y96A 3FRNA 4VUBA 2LCCA 4MMKA 3OW2A 5LJ5j 2K57A 1YHQA 4PJOB 4XQ3A 2E41A 1YJNT 2O4XA 2JZ2A 3CBMA 3OSSC 2CS7A 4F7UA 3DLLA 2M16A 1WNLA 5LJ5h 4ELYC 2DTIA 1BI1A 4LDVA 3CC4A 3TU4K 2M0OA 3V7RA 1WJSA 4ELZC 3I56A 5D6WA 5FU7B 1Y71A 2LVMA 2RI2A 3M57A 4QQ6A 2ZPFB 4M77B 3LYIA 3JB9F 1N6AA 4M75E 5CR2A 2QQBA 2RI3A 2WSCE 5GAN4 2VXEA 4F7UG 3LGFA 1BI0A 3NTKA 3PT9A 4IUVA 3WXMB 2OTLT 5DY9A 3FIFA 4C8QA 4OVAA 4DOWA 3CMEA 3OS0A 1HXDA 3A8OB 3PIOA 3HRSA 4JJNK 3P8DA 5DM7R 4E7HA 1PSEA 3OQ5A 2DEQA 2ZZDA 3G4ST 4RG2A 4ATOA 4XK8E 2XIDA 4FIBA 3RKYA 2MF2A 2XI9A 1OI1A 3A8LB 5LJ3j 1M1GA 2PUKB 3SD4A 1K8AC 1HK9A 2QQRA 3OYIA 4J8OA 2XHCA 3OW2S 3V8JA 2CZ0B 4UC4A 5GAOq 4NL3A 2QA4T 5LJ3h 1G3YA 3OYJA 1YCYA 4M7DG 4GY5A 4QQDA 3PIPA 4A4HA 4C8QG 3OYBA 5GAMj 1UGQB 1KC8C 2F69A 3VKIA 2HAXA 2E70A 1M5Q1 1WQWA 2HBPA 2M9UA 3GIBA 3G7ZA 3EFRA 3VUBA 5DLQE 5J39A 1VQ7A 5GAMh 1VQOA 1GXIE 4X9DA 4C0FA 1K73U 3LWIA 3MCAB 1YBYA 2RHUA 5A0DA 2LT1A 4M7DD 2A3LA 2V8JA 4PJOE 3MP6A 4M78A 3P8BB 3HHTB 2MWOA 3DLMA 5FROA 1M8VA 1M9SA 1B34A 2YLCA 3ZFJA 5D6XA 3A5ZB 3FEOA 4C5HA 2XK0A 3RIRA 3CEYA 1N9SA 3NTHA 2XKOC 3ER0A 3A8MB 2DK3A 2KQWA 3OB9A 3I55T 1FWZA 4M77E 4X9CA 2RJDA 4M78G 1VQNA 2L8DA 4JLIA 2OTJA 1G3WA 2D9TA 5KE3A 2K5IA 1KD1U 4XU3A 3MEAA 3HP9A 3QDRB 4PJOF 3L2RA 3X28B 4FU6A 3CCVA 1H641 3RMSA 3M53A 2HD0A 1YITA 4FM4B 3OBYA 4Y91A 3JB9H 2DO3A 2V8KA 5LJ5g 1NE8A 2QEXA 2DZCA 3S3NA 3M9QA 3JCMP 2E64A 3CMAT 2IVWA 4DQ2A 2P0QA 3TREA 1VQ8T 2X4XA 1SSFA 4PNOA 4FT4A 1BI2A 2RA2A 4EMKC 2DXUA 1BKBA 4M77F 2E1HA 5CCAA 5I2SA 5A2QE 2KK4A 2EAYA 3MP8A 3T9NA 4J6YA 5GAN8 5FRMA 4Q5WA 3WVEB 1YIJT 3CCEA 2MMPA 3SDZA 5LJ5e 3OSVA 2CKKA 3E9GA 4M7DC 2HQXA 3MEWA 5CKBA 1IREB 1EIFA 3QBYA 5CO7A 3FDRA 5HK3A 4M7AD 1VQ4A 1Y96B 2RHXA 3VV0A 1QVGS 1LJOA 3MP1A 4C92F 3JAME 2PVGB 3VU3C 2O4XB 3CPWS 4HCZA 4F7UB 4BE2A 2EFIA 3GP8A 2PQWA 3RMQA 4C0DC 5LJ3g 3GNFB 1S72T 4JRQA 2ZCFB 5GANj 3HFNA 1OZ3A 5J3BA 4E47A 3E9FA 1Y07A 5FRNA 4LD9K 3CCQA 2FVUA 3MEVA 5GAMg 5GANh 3L2UA 4RKUE 3L42A 4B9XA 4ZN3A 5GMKj 3H6ZA 3CCRA 1Q81U 2H3JA 1QVFA 3CD6T 4N4IA 3G6EA 4XAXB 4PL6A 5LL6S 5LJ3e 4C8QB 4NOYA 3JCMW 1Q86U 4RG8A 4KULA 4M78C 2F5TX 4L59A 1KHIA 3JCMe 2LX9A 1G3TA 2KSSA 4Y28E 3QXEB 4IUUA 2K4YA 4MZMA 2IG0A 4A4KA 3INZA 4JS4A 5GAMe 5GMKm 3Q1JA 3JB9G 3PMTA 4OMFB 1O75A 3PGGA 5KE2A 1VQKT 2EQJA 3CCLA 3VYHB 2VGMA 1QW1A 4QVCA 2PUOB 3OYNA 3CCMA 3C4SA 2CYZB 3M56A 2DKGA 3RERA 4J6XA 4EMKA 4MDXA 4HT8A 4DOVA 1YJWT 5LJ5f 5FU6C 2X4WA 2XDPA 3SWNA 2LQ8A 3JB9D 4M7AC 2RB6A 1VQ9A 2XU8A 4C0ZA 2RM4A 4M7DA 4R55A 5CKFA 3JCMX 1WQ7A 1QP2A 1RI0A 3QYGB 2JTFA 3HRUA 1M90U 3FLGA 5GAOl 2E12A 2EJ9A 1YJNA 1K73C 4JUVA 4M78B 3OMGA 4F7UE 5M9OA 3QJ6A 1JJ2A 1B34B 4KUIA 3OMCA 2BUDA 3EFSA 4C5EA 4QQGA 1N8RU 3QZ9B 5J26A 4XTZA 4BI4A 2O01E 3SFMA 2EYQA 4BI8B 3M58A 3UWNA 4EMGA 4J83A 1PSFA 4XTYA 2K3XA 4M75F 3SB2A 2KDSA 4OF1A 4M75D 3PMIA 1G5VA 3LLRA 3OA6A 2X4YA 3O8VA 5FU6B 1I4K1 2P4TA 4V2SA 5LJ3f 4A4EA 4C8QE 3JB9J 1BYMA 4PLIA 3G71T 3G4SA 3JCMf 2BIVA 5KCHA 2XDDA 4FL6A 2DAQA 1OZ2A 1VQPT 1KD1C 1X01A 2F5KA 5GAMf 1YI2T 5LJ5d 2MAMA 4GLKA 1K9MU 4IKFA 2QTXA 1RL2A 4BUGA 4C5GA 4OB0B 2QA4A 1LOJA 4EMHA 2RK1A 1VQMT 2QXFA 2LC4A 1V29B 2MI6A 3HPWA 4XTXA 3VYGA 4BB7A 3OYFA 4ZN1A 2QDYB 1JRIA 5FLXE 1W2BA 1O9SA 4PJOG 1YJ9T 2XD0A 2ZPBB 1UB4A 1BI3A 5GANg 3VJPA 5GAN2 3OYEA 3EAEA 3OYLA 1D3BB 3QG1A 4IUPA 5EG2A 5CK9A 5L8RE 4C8QF 4ZGDB 5GAOp 3OYGA 3CCST 4IURA 3FC3A 3QKJA 3UDCA 4M7AA 2VYTA 3CC7T 3KBGA 4PJOD 4M78E 3C12A 4BY6C 1VQLT 3KUFA 2GFUA 4HCBA 4M77G 2LT4A 3C95A 4OGCA 3HRTA 5GANe 2ZPEB 4BACA 2R58A 4KUDK 3L1AA 4QVDA 1X6OA 1MHNA 2E5QA 5LJ3d 1XQHA 4C5IA 3FJPA 2CZ6B 3GLXA 5GAN5 3I55A 3JCMd 3J7AF 4M7AG 1AHJB 2Y4XA 2L5QA 4M77D 3J80E 3S3MA 1R8OB 2RJFA 3RESA 3FB9A 3SWNC 4C0GA 3M4GA 1VQ6T 4C92G 3V7CA 1D3BA 4M7AE 4LDYA 5GAMd 1NPRA 2JOYA 2VC8A 2DD4A 2QQSA 1Q7YU 2P0PA 3L2ZA 4EDUA 4EPCA 1W2BS 3M54A 2LRQA 1TH7A 5A0GA 5I2MA 1BIBA 2FYKA 3QSUA 3DB3A 2GQVA 1Q81C 3DKMA 3M5AA 2VGNA 4DA4A 2JVVA 4J7FA 5GAOm 2R57A 2VV5A 4C92D 4BY6B 1Q86C 1IZ6A 4J6WA 4XU2A 1OYXA 4N0AA 3CMAA 3JCMJ 2B8AA 4OP0A 4XTUA 3RUXA 2P0KA 2XICA 3LWHA 3CC2T 4HT9A 4P5NA 5CQYA 1VQ8A 5GAOr 5A0LA 1XTDA 2CZ1B 1VQ5T 5DLOA 5D6YA 4B9WA 5I21A 4E7JA 4ZTJA 2JTMA 3CCUT 4CRIA 2DXCA 3OYDA 1M1KU 4PLLA 3CCJT 1N9RA 4EMKB 1VIFA 4MMLA 2DJZA 1YIJA 4WF2A 2LQKA 2YRVA 1LNXA 3E19A 4XTVA 4XU0A 3SWNB 4BE1A 2D6FA 4PJOC 4D6WA 2DPPB 2X35A 5HY6A 4M7DB 2D0QB 3PFSA 3X20B 2K3YA 2VXFA 4X34A 4MDWA 5GMKh 3HL8A 1YHQT 1UGSB 5GANf 4ME7A 1M90C 3GF5A 1ZBXA 3CPFA 3LGLA 2WACA 2NLUA 3V7SA 3CC4T 1FXXA 3BDLA 1S72A 4II1A 4M77C 5C6SA 3HSBA 2LTOA 4KBMB 4C0DB 3I56T 2VUBA 4FT2A 2KMTA 3M59A 3VUZA 1WJRA 1KHCA 3C94A 1N8RC 2ZPIB 4M75A 4KT0E 4OGEA 4BDYA 2WSEE 4NL2A 3OBWA 3WVDB 2RO0A 1H3ZA 2OAUA 1NJIU 3CD6A 2BKDN 2RK2A 2C06A 1QVPA 1VUBA 1X75C 3JCMc 3META 3CMET 1KG1A 4IUQA 2DIGA 2LCLA 1P92A 4C92C 5HK0A 4LDXA 2JUFA 1QVFS 4BE0A 4A4GA 3OYAA 4M75G 2LDMA 3P8HA 1VQKA 1NPPA 2R5MA 3A8HB 2WSFE 2E6NA 1XOVA 1K9MC 5CKDA 1U1TA 3CBPA 2PU9B 4BI3A 2K5LA 5KH6A 1YJWA 2KAFA 3OYHA 3L2VA 5GANd 3X26B 1QP3A 3BW1A 5CIUA 1VQ7T 3X24B 1Y7XA 3M55A 1VQOT 4JRKA 2OTLA 2EQKA 3LW5E 3A8GB 4M7DE 1I81A 1WJQA 3LH0A 4M7AB 3OYKA 4PJOA 5HKCA 1KQ2A 3TCJA 1G3SA 3GPLA 4RMOA 2XDBA 3JCMQ 2G3RA 3AHUA 4C92B 4N0AC 4F7UF 2E6ZA 1M4ZA 3J81E 4N4HA 4Z02A 2HNIA 2ZGWA 1U1SA 3V8KA 3ZBDA 1KQ1A 5GAN3 3OS2A 2GF7A 4L6V5 4LDUA 3UT1A 3QHSA 2QQ9A 3L2QA 2FHDA 3JRZA 3JCMh 3QJYA 4YTLA 1VIEA 2XG8D 1ZQ1A 3BDUA 4M77A 5IN1A 5AYFA 1UEBA 1JJ2S 2PVOB 3UPUA 3JB9I 5KCOA 1VQNT 2EJGA 1MGQA 2FB7A 2KY9A 4JLGA 5IT9E 2OTJT 4A53A 4M7DF 2R5AA 2Y90A 2JNGA 4NS5A 3HKSA 3URGA 5GAN7 3G71A 5C0MA 2V8IA 4C8QD 4OB2B 2KVQG 2EKOA 1JBMA 2GCXA 2YLBA 4R56A 3OYCA 4ZTFA 2DD5A 4A4FA 1K8AU 4HKEA 3QUIA 3CCVT 3V8LA 4J7IA 5GMKl 1VQPA 3MEUA 4JRIA 1Q7YC 1YITT 4C92A 2M1HA 1YI2A 3QIIA 3MO8A 3JCMb 2QEXT 1KC8U 4XTWA 2MWPA 1WGSA 2FL7A 3LX7A 4JDSA 1NZ9A 3PTAA 4JS5A 2A7YA 1W4SA 3RKXA 4BDZA 1VQMA 4MZTA 1FX7A 4LDWA 4BD3A 2RJCA 2AHJB 2ZPGB 3QZ5B 2DTOA 2QI2A 3N5BB 5GMKe 1YJ9A 4E7IA 2K2VA 3F70A 4O5VA 4XU1A 2RHYA 4M75C 1QVGA 3OYYA 1KQSA 2L89A 3CCET 3OS1A 2PVDB 3CBOA 3CPWA 3QYHB 1M1KC 3CCSA 4MZPA 3L2WA 3JCMV 2E65A 2GFAA 4OB1B 4ZGEB 3CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC A;  1VQ4 T;  3PNW C;  1VQL A;  4E7L A;  3ZEH A;  4QW2 A;  3H8Z A;  3GOX A;  2HQE A;  1Q82 C;  4LD6 A;  1VQ6 A;  2RHI A;  3S3O A;  3ME9 A;  2L3R A;  3CCQ T;  1N27 A;  3OY9 A;  2DIQ A;  4IUT A;  3CCR T;  3DB4 A;  3G6E T;  2RJE A;  3S6W A;  2RHZ A;  2EIF A;  1KQS S;  1NJI C;  3NTI A;  1XNI A;  5IAY A;  3CC2 A;  4N4G A;  1Q82 U;  3CXC S;  2EQM A;  2RI5 A;  1VQ5 A;  2EQU A;  4QVZ A;  3CCL T;  3ASK A;  3CCU A;  4E7K A;  3CCM T;  3CCJ A;  4TVR A;  3OYM A;  1VQ9 T;  2LCC A;  3OW2 A;  1YHQ A;  1YJN T;  2O4X A;  2JZ2 A;  3DLL A;  2M16 A;  3CC4 A;  2M0O A;  1WJS A;  3I56 A;  5D6W A;  2LVM A;  2RI2 A;  4QQ6 A;  3LYI A;  2RI3 A;  3LGF A;  3NTK A;  2OTL T;  4IUV A;  4OVA A;  3CME A;  3OS0 A;  3PIO A;  4E7H A;  5DM7 R;  3P8D A;  3G4S T;  3OQ5 A;  4RG2 A;  1OI1 A;  1M1G A;  1K8A C;  3SD4 A;  2QQR A;  3OYI A;  2XHC A;  3OW2 S;  4UC4 A;  2QA4 T;  3OYJ A;  4QQD A;  4GY5 A;  3PIP A;  4A4H A;  3OYB A;  1KC8 C;  2E70 A;  5DLQ E;  1VQ7 A;  5J39 A;  1VQO A;  1K73 U;  1YBY A;  2RHU A;  3MP6 A;  3P8B B;  2MWO A;  3DLM A;  5FRO A;  5D6X A;  3A5Z B;  3FEO A;  4C5H A;  2XK0 A;  3CEY A;  3NTH A;  3ER0 A;  3I55 T;  3OB9 A;  2RJD A;  1VQN A;  2L8D A;  2OTJ A;  2D9T A;  5KE3 A;  1KD1 U;  3MEA A;  3L2R A;  4FU6 A;  3CCV A;  1YIT A;  2DO3 A;  2QEX A;  3S3N A;  3M9Q A;  3CMA T;  3TRE A;  1VQ8 T;  2X4X A;  1SSF A;  1BKB A;  5A2Q E;  3MP8 A;  5FRM A;  4Q5W A;  1YIJ T;  3CCE A;  2CKK A;  3E9G A;  2HQX A;  3MEW A;  1EIF A;  3QBY A;  3FDR A;  1VQ4 A;  2RHX A;  1QVG S;  3MP1 A;  3JAM E;  2O4X B;  3CPW S;  4HCZ A;  4BE2 A;  2EFI A;  2PQW A;  1S72 T;  1OZ3 A;  5J3B A;  3E9F A;  5FRN A;  3CCQ A;  3MEV A;  3L2U A;  3L42 A;  4ZN3 A;  4B9X A;  3CCR A;  1Q81 U;  1QVF A;  3H6Z A;  3CD6 T;  3G6E A;  4N4I A;  1Q86 U;  5LL6 S;  4PL6 A;  4L59 A;  1KHI A;  4IUU A;  2IG0 A;  3Q1J A;  3PMT A;  5KE2 A;  1VQK T;  3CCL A;  2EQJ A;  3OYN A;  3CCM A;  3C4S A;  1YJW T;  2X4W A;  2XDP A;  2LQ8 A;  1VQ9 A;  1M90 U;  1RI0 A;  2JTF A;  3FLG A;  1YJN A;  1K73 C;  3OMG A;  1JJ2 A;  3QJ6 A;  5M9O A;  3OMC A;  2BUD A;  4C5E A;  4QQG A;  1N8R U;  5J26 A;  3UWN A;  2K3X A;  2KDS A;  3PMI A;  1G5V A;  3LLR A;  3OA6 A;  2X4Y A;  3O8V A;  4A4E A;  4PLI A;  3G71 T;  3G4S A;  5KCH A;  2BIV A;  4FL6 A;  2DAQ A;  1OZ2 A;  1VQP T;  1KD1 C;  2F5K A;  1YI2 T;  4IKF A;  1K9M U;  1RL2 A;  4C5G A;  2QA4 A;  1VQM T;  2MI6 A;  3OYF A;  4ZN1 A;  1W2B A;  5FLX E;  1YJ9 T;  3OYE A;  3EAE A;  3OYL A;  4IUP A;  3OYG A;  3CCS T;  4IUR A;  3FC3 A;  3QKJ A;  2VYT A;  3CC7 T;  3KBG A;  1VQL T;  3KUF A;  2GFU A;  4BAC A;  2R58 A;  1X6O A;  1MHN A;  2E5Q A;  4C5I A;  3I55 A;  3J7A F;  3J80 E;  3S3M A;  2RJF A;  1VQ6 T;  1NPR A;  2JOY A;  2QQS A;  1Q7Y U;  4EDU A;  1W2B S;  2LRQ A;  3DB3 A;  1Q81 C;  2JVV A;  1Q86 C;  2R57 A;  1IZ6 A;  1OYX A;  3CMA A;  2B8A A;  3CC2 T;  2P0K A;  1VQ8 A;  1VQ5 T;  1XTD A;  5D6Y A;  4B9W A;  4E7J A;  4ZTJ A;  3CCU T;  4CRI A;  1M1K U;  3OYD A;  3CCJ T;  4PLL A;  1YIJ A;  2YRV A;  4BE1 A;  2X35 A;  5HY6 A;  3PFS A;  4X34 A;  2K3Y A;  1YHQ T;  1M90 C;  3CPF A;  3LGL A;  2WAC A;  2NLU A;  3CC4 T;  1S72 A;  3BDL A;  4II1 A;  5C6S A;  2LTO A;  3I56 T;  1WJR A;  1KHC A;  1N8R C;  4BDY A;  2RO0 A;  1NJI U;  3CD6 A;  2BKD N;  3CME T;  3MET A;  4IUQ A;  2LCL A;  2DIG A;  2JUF A;  1QVF S;  4BE0 A;  4A4G A;  3OYA A;  2LDM A;  3P8H A;  1VQK A;  1NPP A;  2R5M A;  2E6N A;  1K9M C;  1YJW A;  5KH6 A;  3OYH A;  3L2V A;  5CIU A;  1VQ7 T;  1VQO T;  2OTL A;  2EQK A;  1WJQ A;  3LH0 A;  3OYK A;  2G3R A;  2E6Z A;  3J81 E;  4N4H A;  4Z02 A;  3OS2 A;  2GF7 A;  3UT1 A;  3L2Q A;  2FHD A;  4YTL A;  5IN1 A;  1UEB A;  1JJ2 S;  5KCO A;  1VQN T;  5IT9 E;  2OTJ T;  2R5A A;  4NS5 A;  2JNG A;  3HKS A;  3G71 A;  5C0M A;  2KVQ G;  2EKO A;  3OYC A;  1K8A U;  4ZTF A;  4A4F A;  1H3Z A;  3CCV T;  1VQP A;  1Q7Y C;  3MEU A;  1YIT T;  2M1H A;  1YI2 A;  3QII A;  3MO8 A;  2QEX T;  1KC8 U;  2MWP A;  1WGS A;  3LX7 A;  1NZ9 A;  4BDZ A;  1VQM A;  4BD3 A;  2RJC A;  1YJ9 A;  4E7I A;  3F70 A;  2RHY A;  1QVG A;  3OYY A;  1KQS A;  2L89 A;  3CCE T;  3OS1 A;  3CPW A;  1M1K C;  3CCS A;  3L2W A;  2GFA A;  3CC7 A; 
#chains in the Genus database with same CATH topology
 2DTH A;  1VQ4 T;  1VQL A;  5CAI A;  1M8M A;  4M78 F;  1AOJ A;  2CSQ A;  3ZEH A;  2KT8 A;  4AG1 C;  2RH2 A;  2RNA A;  3MHX A;  2HQE A;  1Q82 C;  3BY7 A;  2QDL A;  4OMQ A;  2COW A;  5GAN 6;  2EWN A;  3S3O A;  1VA7 A;  4RTU A;  5GAO n;  3EGX A;  2ED0 A;  2CP3 A;  4FSX A;  4M7A F;  3BE3 A;  2J05 A;  3DB4 A;  1ARK A;  5CQX A;  1ZUK A;  1OX8 A;  2I2L A;  1GFD A;  5KYX B;  2DBK A;  1YN8 A;  3CC2 Q;  1LCK A;  4F04 B;  1VQ5 A;  3NGP A;  3ASK A;  3G1J A;  3CCU Q;  1U8R A;  5EC7 A;  1JB0 E;  1M1F A;  3GBQ A;  3H0F A;  4TVR A;  1QVG P;  3OS5 A;  2K5F A;  1TUG B;  2Y4Y A;  4E6R A;  4VUB A;  4R0K A;  3OW2 A;  2QYZ A;  2K57 A;  1YHQ A;  4XQ3 A;  2O4X A;  1WNL A;  5LJ5 h;  4ELY C;  3QDF A;  1N8R R;  3I56 A;  5D6W A;  2LVM A;  3M57 A;  2FRY A;  4M77 B;  2XMF A;  3LYI A;  1N6A A;  2ATC B;  2H3E B;  1RLQ C;  3LGF A;  3PT9 A;  1K73 R;  3WXM B;  3FIF A;  2O9S A;  2J6K A;  4OVA A;  4DEX A;  3QWX X;  1HXD A;  3PIO A;  3CME Q;  2HL5 C;  1PSE A;  3OQ5 A;  2ZZD A;  5IXF A;  2XI9 A;  1OI1 A;  1M1G A;  3SD4 A;  1JEG A;  2V1Q A;  4J8O A;  2XHC A;  2MIO A;  5GAO q;  4F14 A;  1RLP C;  2QA4 T;  5LJ3 h;  3OYJ A;  1WHH A;  4GY5 A;  3PIP A;  1KC8 C;  3VKI A;  2E70 A;  1WQW A;  2M9U A;  2DE0 X;  1TG0 A;  5GAM h;  1YWP A;  2HZY A;  4M7D D;  2A3L A;  2KRM A;  3MP6 A;  1W70 A;  1M9S A;  1IHV A;  3FEO A;  2E5K A;  2COZ A;  1OEB A;  1GCQ C;  2XKO C;  1V1C A;  4HVW A;  1TSF A;  2DNU A;  1LPL A;  2NUZ A;  2KQW A;  5I11 A;  1QCN A;  4X9C A;  4JLI A;  1KIK A;  3MEA A;  3QDR B;  4FU6 A;  3M53 A;  4KRT A;  4Y91 A;  2V8K A;  1NE8 A;  2QEX A;  3S3N A;  3M9Q A;  2E64 A;  3CMA T;  2IVW A;  4DQ2 A;  2YDL A;  2OI3 A;  4M77 F;  5I2S A;  1Z9Q A;  3MP8 A;  3T9N A;  2MMP A;  1K0X A;  4DBF A;  2JS2 A;  1UHC A;  4AFQ C;  2BZY A;  2GTO A;  4M7A D;  1VQ4 A;  1TTH B;  2RHX A;  1LJO A;  2HSP A;  3MP1 A;  2PVG B;  3EGD B;  2X3W D;  3CPW S;  4HCZ A;  2PQW A;  3GNF B;  4Y92 A;  1VQ5 Q;  2QG9 B;  5FRN A;  2ED1 A;  2FVU A;  5GMK j;  4B9X A;  1Q81 U;  1WHJ A;  3CD6 T;  4N4I A;  3G6E Q;  1QKX A;  4NOY A;  3TSW A;  4RG8 A;  4KUL A;  1YHQ Q;  2KEA A;  5GMK m;  3Q1J A;  2EQJ A;  2VGM A;  2M0Y A;  1RAF B;  3EG3 A;  1EX4 A;  4J6X A;  4EMK A;  4HT8 A;  1PWT A;  4DOV A;  5LJ5 f;  3SWN A;  2Z0W A;  2YUN A;  1UUE A;  4FYY B;  4M7D A;  2RQU A;  1RI0 A;  1HSQ A;  5GAO l;  2YUP A;  1SKU B;  4F7U E;  4D8K A;  1JJ2 A;  3OMC A;  2BUD A;  3E2U A;  1M3A A;  2CP6 A;  4XTZ A;  1X6B A;  2ROL A;  4BI4 A;  2EYQ A;  3M58 A;  4PJM A;  3ZL7 C;  1GFC A;  1PSF A;  4PFO A;  2K3X A;  4OF1 A;  3M0Q A;  1WI7 A;  2L0A A;  3O8V A;  5FU6 B;  3O5Z A;  2P4T A;  4V2S A;  5LJ3 f;  1BYM A;  1WX6 A;  4PLI A;  1A0N B;  4PJL A;  4ESR A;  1VQP T;  1X01 A;  5GAM f;  3EFO A;  1KC8 R;  4IKF A;  1K9M U;  2HKN A;  2QA4 A;  4EMH A;  4JZ3 A;  1VQM T;  2QXF A;  2MI6 A;  3VYG A;  1M3C A;  9ATC B;  2ZPB B;  5GAN g;  3QG1 A;  2FZG B;  1D0X A;  2DX1 A;  3FC3 A;  4M7A A;  4M78 E;  2FPF A;  3KUF A;  4HCB A;  2DL3 A;  1PD0 A;  4OGC A;  2R58 A;  4PK4 A;  2QEX Q;  2JMA A;  2MK5 A;  1X6O A;  5GAN 5;  3JCM d;  2Y4X A;  4M77 D;  3J80 E;  2RJF A;  3RES A;  3SWN C;  3FB9 A;  4C0G A;  1I1J A;  4C92 G;  1NEB A;  1Q7Y U;  3VS2 A;  1PRM C;  3L2Z A;  5A0G A;  2LRQ A;  2DBM A;  3DB3 A;  1Q81 C;  3DKM A;  1VQ4 Q;  2JVV A;  2VV5 A;  4J6W A;  3CMA A;  4OP0 A;  3CC2 T;  2P0K A;  2XIC A;  2HSE B;  5D6Y A;  3CCU T;  2AKK A;  2LQK A;  2YRV A;  4PFZ A;  1RAG B;  2X51 A;  1YNZ A;  4D6W A;  3UA6 A;  2KYM A;  1BK2 A;  2D0Q B;  2VXF A;  4MDW A;  2P4R A;  1ZSZ C;  4ME7 A;  2CH4 W;  2EGC A;  3CC4 T;  1FXX A;  3BDL A;  1S72 Q;  2YRD A;  1FMW A;  2KMT A;  3VUZ A;  1QKW A;  1UHF A;  2MPX C;  4OGE A;  4BDY A;  3WVD B;  2JS0 A;  2OAU A;  3CD6 A;  2BKD N;  2RK2 A;  3D7S B;  3JCM c;  3CME T;  1U3O A;  3JV3 A;  1G2B A;  1PHT A;  2YUQ A;  2E4H A;  5KYX A;  4CC3 A;  2O9V A;  1QVF S;  4M75 G;  4J9I A;  2LDM A;  4AFU C;  2EW3 A;  1XOV A;  1K9M C;  1U1T A;  2K5L A;  2KAF A;  1C1A A;  3PVL A;  2CDT A;  3X24 B;  2EQK A;  3LW5 E;  1I07 A;  1QVF P;  1Q95 G;  2A0F B;  1K8A R;  4E7S A;  3AHU A;  2G3R A;  4C92 B;  2E6Z A;  3J81 E;  3VRZ A;  4Z02 A;  3V8K A;  2ZGW A;  1U1S A;  4L6V 5;  3UT1 A;  4FW1 A;  1K9A A;  4FYX B;  3JCM h;  2XG8 D;  1I5O B;  4M77 A;  5IN1 A;  2IIM A;  2FB7 A;  2C06 A;  3URG A;  2GCX A;  1JBM A;  2YLB A;  1HD3 A;  3OYC A;  2DD5 A;  2LZ6 B;  1VQP A;  1Q7Y C;  5GMK l;  4JRI A;  4PJJ A;  2EPD A;  1NBE B;  1NZ9 A;  1X6G A;  1VQM A;  3IQL A;  4MZT A;  1FX7 A;  2AHJ B;  3QZ5 B;  2KRS A;  4E7I A;  1QWF A;  2VAS A;  2K2V A;  1NYF A;  1X2K A;  3CCE T;  2PVD B;  1GRI A;  2DIL A;  1ZSG A;  4MZP A;  3L2W A;  2HKQ B;  2E65 A;  1ABQ A;  4ZGE B;  4JRP A;  2LMJ A;  5GJV B;  3M4Y A;  1Z9Z A;  5IHK A;  4A54 A;  4QW2 A;  2NUP B;  4L5G A;  2DXT A;  7AT1 B;  2QK0 A;  4LD6 A;  1QWE A;  2KXC A;  1VQ6 Q;  2L3R A;  3RKW A;  4M75 B;  1Q81 R;  4C8Q C;  2GNC A;  4IUT A;  3E1S A;  3G6E T;  4J5Y A;  1OU9 A;  2KT1 A;  2RHZ A;  2NUT A;  1TXQ A;  2CZ7 B;  1KQS S;  4KGV B;  3VS6 A;  4HCC A;  2VWF A;  1XNI A;  1DJ7 B;  2DXB A;  3R6O A;  5IAY A;  3CC2 A;  4N4G A;  1Q82 U;  2MCN A;  2KI7 A;  1UG1 A;  3CCL T;  1ACM B;  3CCU A;  3VS1 A;  4DEY A;  1FMK A;  2EYX A;  5CVI A;  4DBR A;  3GNG A;  4OB3 B;  3OYM A;  4LUD A;  1Y0M A;  4RCC A;  1KQS P;  3X25 B;  2ESW A;  2JM9 A;  1VQ9 T;  3FRN A;  5IH2 A;  1WA7 A;  2LCC A;  4MMK A;  2E41 A;  3EGD A;  2JJ9 A;  2JZ2 A;  3OSS C;  3DLL A;  2M16 A;  4RTX A;  2DTI A;  1BI1 A;  1ZSZ B;  3CC4 A;  2M0O A;  1WFW A;  2C0O A;  2GGR A;  4ELZ C;  1G83 A;  3JB9 F;  1WHM A;  2K79 A;  2RI3 A;  2WSC E;  4AG2 C;  2RQW A;  4EIK A;  3CME A;  4E7H A;  2DEQ A;  4XK8 E;  4FIB A;  2CP5 A;  2P84 A;  1K9M R;  1RAC B;  4ORZ A;  1RAH B;  1NEG A;  4OML A;  3OW2 S;  2D8H A;  4UC4 A;  4NL3 A;  2EYZ A;  2QAZ A;  4C8Q G;  1AWJ A;  1UGQ B;  2HAX A;  3G7Z A;  3VUB A;  5DLQ E;  2LCS A;  4C0F A;  1VQO Q;  3MCA B;  1X2Q A;  1YBY A;  2MOX A;  4FYW B;  5A0D A;  2V8J A;  4PJO E;  1WIE A;  3HHT B;  3OW2 P;  1E6G A;  2CUB A;  1VQP Q;  5FRO A;  2YLC A;  1JU5 C;  3PE0 A;  4C5H A;  1UGV A;  1ZX6 A;  5L23 A;  3RIR A;  3CEY A;  3NTH A;  3ER0 A;  1VQM Q;  1NLO C;  3OB9 A;  2L2P A;  2L8D A;  2LNH B;  1VQN Q;  1Q7Y R;  2D9T A;  5KE3 A;  3L2R A;  3RMS A;  3CCV Q;  3MKD A;  3OBY A;  2L3Q A;  2DO3 A;  5LJ5 g;  4CC4 B;  3JCM P;  1WYX A;  2P0Q A;  2RA2 A;  1VYT A;  2E1H A;  5A2Q E;  1MMG A;  4J6Y A;  2A28 A;  3WVE B;  3CCE A;  2QGF B;  3OSV A;  3E9G A;  3MEW A;  1EIF A;  5CO7 A;  2DYI A;  3FDR A;  3UF4 A;  4F17 A;  1Y96 B;  2E3I A;  5AT1 B;  3VV0 A;  1QVG S;  3VU3 C;  4BE2 A;  1Y57 A;  4J9H A;  5LJ3 g;  1S72 T;  1U06 A;  2ZCF B;  2F2W A;  3HFN A;  1GCQ A;  3E9F A;  2EGA A;  1YCS B;  3MEV A;  5GAM g;  3CCQ Q;  4RKU E;  2FZC B;  2H3J A;  2KRO A;  3G6E A;  4PL6 A;  1Q86 U;  1M90 R;  4C8Q B;  1T0H A;  2PZ1 A;  1KHI A;  3JCM e;  1G3T A;  3I5S A;  1VYV A;  4IUU A;  4JS4 A;  4RTW A;  4OMF B;  3CCL A;  1QCO A;  3CC4 Q;  1PCX A;  2HL3 A;  2CYZ B;  4MDX A;  2HBW A;  5FU6 C;  2XDP A;  3JB9 D;  1IXD A;  3VS7 A;  1VQ9 A;  4R55 A;  5KYY B;  3QYG B;  2JTF A;  3HRU A;  2EJ9 A;  1M3B A;  4LXC A;  1TS9 A;  1X69 A;  3VS3 A;  2X9H A;  3QZ9 B;  5J26 A;  2O01 E;  3SFM A;  3UWN A;  4D8D A;  1E7O A;  3SB2 A;  2KDS A;  4M75 D;  2KR3 A;  3LLR A;  3OA6 A;  1YP5 A;  2X4Y A;  1I4K 1;  3REA B;  1XJW B;  3G4S Q;  4B6M A;  2XDD A;  4FL6 A;  2DAQ A;  2G6F X;  4Z8A A;  4OB0 B;  3U23 A;  2O88 A;  4OMP A;  2LC4 A;  1V29 B;  3HPW A;  4PJO G;  1MV0 B;  1UB4 A;  1BI3 A;  3OYE A;  3EAE A;  4IUP A;  4LNP A;  5CK9 A;  5L8R E;  4C8Q F;  1AVZ C;  3OYG A;  1WXB A;  3QKJ A;  2ABL A;  1GL5 A;  3C12 A;  2GFU A;  4BAC A;  2FPE A;  3RR6 A;  3L1A A;  4QVD A;  2GBQ A;  2E5Q A;  2CZ6 B;  1JO8 A;  2K6D A;  2DF6 A;  1VQ6 T;  1BCM A;  3M4G A;  1D3B A;  2DD4 A;  3CCE Q;  4EPC A;  1TH7 A;  5I2M A;  3SHW A;  1RAI B;  1GCP A;  2AKL A;  1Q86 C;  1IZ6 A;  3H9N A;  4XU2 A;  4N0A A;  1Q82 R;  2YWW A;  2SEM A;  4ANJ A;  1VQ8 Q;  5DLO A;  2VB6 A;  4E7J A;  3OYD A;  4PLL A;  3CCJ T;  1N9R A;  1ZUU A;  1PKT A;  2DPP B;  2JTE A;  5HY6 A;  2K3Y A;  1K0S A;  1UGS B;  2QAS A;  2EYW A;  3LGL A;  1S72 A;  2NUP A;  4II1 A;  3I9Q A;  2QGG A;  3CCL Q;  3HSB A;  2LTO A;  4KBM B;  1TWB A;  1IGU A;  4RTV A;  4ZNX A;  1WJR A;  4GBQ A;  2EGE A;  1SHF A;  4M75 A;  2WSE E;  3OBW A;  1VUB A;  2LJ3 A;  1VQ9 Q;  2LCL A;  4C92 C;  4A4G A;  3P8H A;  2R5M A;  1VQK Q;  1H8K A;  3A8H B;  2E6N A;  2PU9 B;  2ENM A;  2RF0 A;  5GAN d;  3X26 B;  1QP3 A;  4FSS A;  1VQ7 T;  1VQO T;  4KH0 B;  2BE9 B;  3A8G B;  4M7D E;  1I81 A;  3LH0 A;  1KQ2 A;  3TCJ A;  1G3S A;  4RTZ A;  4AT1 B;  2K7A A;  2XDB A;  3JCM Q;  4N0A C;  2O31 A;  4LN2 A;  1ZSZ A;  2HNI A;  1RI9 A;  2KBT A;  3L2Q A;  3QJY A;  3BDU A;  1KSW A;  2OX7 A;  1VQN T;  2EJG A;  1MGQ A;  2KY9 A;  4JLG A;  3VS0 A;  5IT9 E;  2OTJ T;  2M02 A;  4NS5 A;  2LQW A;  4KH1 B;  4OMN A;  4C8Q D;  4R56 A;  3CCV T;  2DM1 A;  3MEU A;  2KNB B;  3QII A;  4J9B A;  4XTW A;  2FL7 A;  1RAE B;  2HQH A;  2A7Y A;  4BDZ A;  1WHK A;  4JJB A;  2QI2 A;  5GMK e;  2DFU A;  3F70 A;  4M75 C;  2DL5 A;  3OS1 A;  2J6O A;  3H41 A;  3CPW A;  3QYH B;  3EH2 A;  2D1X A;  4M7A E;  3CXC A;  3VS5 A;  3PNW C;  1UGP B;  4HA8 A;  1SPK A;  4JJC A;  1ZA2 B;  1ZHI A;  2DRM A;  2RD1 A;  3H8Z A;  1D09 B;  4PKC C;  2D8J A;  1VQ6 A;  3TEE A;  2DVE A;  2QQA A;  3CCQ T;  3OY9 A;  1UGR B;  3AT1 B;  3BFM A;  4RCB A;  1Q86 R;  2RJE A;  3S6W A;  2EIF A;  2DZ9 A;  4HCK A;  3NTI A;  2RQR A;  1UDL A;  2EJF A;  5CKE A;  5GMK i;  4O6J A;  2X4J A;  2EQM A;  1UJ0 A;  1OU8 A;  4QVZ A;  3JCM g;  2K9G A;  3NFC A;  3HFO A;  4E7K A;  2M51 A;  3CCM T;  3CCJ A;  3QPH A;  1WHG A;  3A1P A;  3TQ7 P;  1EFN A;  2GTJ A;  1MMN A;  1Y96 A;  1CSK A;  3MPU B;  1M27 C;  1WLP B;  1E6H A;  3CBM A;  1X43 A;  8ATC B;  2CS7 A;  1NYG A;  3FJ5 A;  3REB B;  3V7R A;  1WJS A;  5FU7 B;  1Y71 A;  2RI2 A;  1OOT A;  2ZPF B;  3RBB B;  5CR2 A;  5GAN 4;  1SG5 A;  4F7U G;  2KYB A;  4IUV A;  2OTL T;  5DY9 A;  4C8Q A;  3OS0 A;  3HRS A;  1I5L A;  3P8D A;  3G4S T;  4RG2 A;  2XID A;  3A8L B;  2YSQ A;  2OJ2 A;  2PUK B;  1HK9 A;  2QQR A;  3OYI A;  5IXB A;  3V8J A;  3A98 A;  2ZAE A;  1G3Y A;  1YCY A;  4M7D G;  4QQD A;  1ZUY A;  4A4H A;  2CT3 A;  1M5Q 1;  2HBP A;  3GIB A;  3EFR A;  1VQ7 A;  2J7I A;  1VQO A;  4X9D A;  1K73 U;  1YFN A;  3LWI A;  5KYY A;  2J06 A;  3P8B B;  4K11 A;  3DLM A;  2X3X D;  1M8V A;  4WCI A;  1C6V X;  5D6X A;  3A5Z B;  4PJN A;  2ROT A;  4E7Z A;  3A8M B;  2DK3 A;  4M77 E;  1T3L A;  2RJD A;  2CT4 A;  4M78 G;  1VQN A;  1MNE A;  2OTJ A;  1G3W A;  2CP0 A;  2K5I A;  2AK5 A;  3CCV A;  1H64 1;  2GQI A;  4J9E A;  4FM4 B;  1T3S A;  3JB9 H;  2PNI A;  2D0N A;  3KFV A;  3TRE A;  1VQ8 T;  4PNO A;  1BKB A;  2KK4 A;  1YIJ T;  2CKK A;  2HQX A;  5CKB A;  1IRE B;  1UJY A;  2FEI A;  1QQJ A;  1D1B A;  4C92 F;  1HYO A;  1GBQ A;  8AT1 B;  4F7U B;  1PD1 A;  1MMA A;  1VYU A;  2HEQ A;  3ULR B;  4JRQ A;  1LVK A;  5GAN j;  5J3B A;  4E47 A;  1Y07 A;  1K1Z A;  3CCQ A;  2A36 A;  3CCJ Q;  2ECZ A;  1NG2 A;  1QVF A;  3H6Z A;  2CP2 A;  3CCR Q;  1V76 A;  4XAX B;  1OV3 A;  3EG2 A;  2F5T X;  3C0C A;  2A08 A;  3QXE B;  2IG0 A;  4A4K A;  2AZV A;  3PMT A;  1O75 A;  5KE2 A;  1VQK T;  1QW1 A;  4QVC A;  3OYN A;  3CCM A;  3C4S A;  4FYV B;  2DKG A;  3RER A;  3H0I A;  2X4W A;  4JPB W;  5KYW B;  2XU8 A;  4C0Z A;  2RM4 A;  4J9F A;  3SEM A;  2HMA A;  3FLG A;  1AT1 B;  5FWB A;  2E12 A;  1K73 C;  4IIO A;  4JUV A;  4M78 B;  2LJ1 A;  2YT6 A;  1TOV A;  5M9O A;  1B34 B;  3EFS A;  4BI8 B;  4J83 A;  4M75 F;  1VQ7 Q;  4A4E A;  3JB9 J;  2BTT A;  3M0T A;  3G71 T;  3G4S A;  3JCM f;  5KCH A;  1OZ2 A;  2VKN A;  2F5K A;  1YI2 T;  2HCK A;  5LJ5 d;  4GLK A;  4F16 A;  2QTX A;  4BUG A;  2RK1 A;  3OYF A;  4BB7 A;  4ZN1 A;  2QDY B;  1JRI A;  1W2B A;  1O9S A;  2XD0 A;  3VJP A;  1UE9 A;  3MJX A;  5EG2 A;  2OTJ Q;  2LQN A;  3CCS T;  1IHW A;  2VYT A;  1M2V B;  2W10 A;  4M77 G;  3C95 A;  1TU0 B;  3HRT A;  5GAN e;  1BCO A;  4KUD K;  4LUE A;  5LJ3 d;  2JMC A;  1M30 A;  2JT4 A;  1R0C B;  1OUL A;  2L5Q A;  3S3M A;  4LDY A;  5GAM d;  1NPR A;  2JOY A;  5I22 A;  2C0T A;  1CKB A;  1PC0 A;  2P0P A;  3I35 A;  3EG0 A;  4EDU A;  3M54 A;  1BIB A;  2FYK A;  5HCK A;  4J7F A;  5GAO m;  2R57 A;  4C92 D;  4BY6 B;  4RTT A;  2LJ0 A;  1OYX A;  2HDA A;  1IO6 A;  5CQY A;  1VQ8 A;  3NPF A;  1N5Z A;  5A0L A;  2NYS A;  4CRI A;  1M1K U;  2DER A;  1YIJ A;  1VIF A;  2RQV A;  2DJZ A;  4WF2 A;  1LNX A;  4XTV A;  4XU0 A;  2BZX A;  4PJO C;  2X35 A;  3PFS A;  3X20 B;  4X34 A;  1SRL A;  2EYY A;  5GMK h;  2RN8 A;  3GF5 A;  1ZBX A;  3V7S A;  1BU1 A;  5C6S A;  1HJD A;  3R6N A;  1WHL A;  3CCM Q;  1KHC A;  4KT0 E;  1G8X A;  2DJQ A;  1ZLM A;  2RO0 A;  1NJI U;  1MMD A;  1QVP A;  1X75 C;  4WTO B;  4IUQ A;  1FYN A;  5KYU B;  4LE9 A;  1RAB B;  4BE0 A;  1J3T A;  1VQK A;  1MUZ A;  3M0S A;  5CKD A;  1B3Q A;  1PM3 A;  1YJW Q;  1M2O A;  3L2V A;  1KFZ A;  1MV3 A;  3BW1 A;  4OMM A;  2OTL Q;  5HKC A;  3GPL A;  2YRC A;  4N4H A;  1SRM A;  1KQ1 A;  2CH4 A;  2GF7 A;  4LDU A;  1VIE A;  2V26 A;  1UEB A;  1JJ2 S;  2PVO B;  1WZO A;  5KCO A;  4A53 A;  1D0Z A;  2R5A A;  1IRX A;  2JNG A;  2Y90 A;  1OPK A;  3HKS A;  3G71 A;  5C0M A;  2V8I A;  4OB2 B;  1K8A U;  4A4F A;  1H3Z A;  4HKE A;  3QUI A;  4J7I A;  1YIT T;  4C92 A;  1YI2 A;  3JCM b;  1WGS A;  3PTA A;  3NHN A;  1W4S A;  3RKX A;  4LDW A;  2DL7 A;  4KGZ B;  2RJC A;  1JJ2 P;  3EG9 B;  3LH5 A;  1YJ9 Q;  1SHG A;  1QVG A;  2L3P A;  2YUO A;  3CBO A;  1M1K C;  3CCS A;  2GFA A;  1BBZ A;  4OB1 B;  2NUT B;  2OAW A;  2LNV A;  3M0U A;  3CC7 Q;  2JW4 A;  2LP5 A;  4E7L A;  1VQL Q;  4M78 D;  4C92 E;  3UAT A;  3THK A;  2AIR B;  2E10 A;  1WPY A;  1WDX A;  1W1F A;  4CC2 A;  3GOX A;  2QTV A;  4AMC A;  2JN0 A;  3KXT A;  4JJD A;  1PG5 B;  2RHI A;  3ME9 A;  2ZPH B;  1N27 A;  1AWW A;  2DIQ A;  1YIJ Q;  1AEY A;  2DMO A;  3CCR T;  3QWY A;  1SSH A;  2CGH A;  2K3B A;  2YHT A;  1NJI C;  2SRC A;  3QO3 A;  1B7T A;  2FO0 A;  4M4Z A;  5CKH A;  3CXC S;  2RI5 A;  5FU7 C;  2EQU A;  3JSC A;  2JXB A;  2K2M A;  4CI0 C;  1T0J A;  1I8F A;  3HTR A;  2FPD A;  1AWO A;  2DA9 A;  4ZGJ B;  4Z89 A;  1BIA A;  2MYS A;  4X1V A;  3CPW P;  2FG0 A;  5LJ5 j;  4PJO B;  3CXC P;  1YJN T;  5GJW B;  2FRW A;  4F7U A;  3I5R A;  1QMC A;  1JQQ A;  2LX7 A;  5FW9 A;  4LDV A;  3TU4 K;  2CSI A;  2V1R A;  4RUG A;  3I56 Q;  1IB8 A;  4HXJ A;  4QQ6 A;  4M75 E;  4IIM A;  2QQB A;  2FZK B;  2VXE A;  1BI0 A;  3NTK A;  1CKA A;  3RNJ A;  1UTI A;  4DOW A;  3A8O B;  4JJN K;  5DM7 R;  1ZBJ A;  2A37 A;  2EKH A;  3RKY A;  1ZA1 B;  2MF2 A;  1AZE A;  5LJ3 j;  2RPN A;  1K8A C;  2VVK A;  3M0P A;  2CZ0 B;  2CUD A;  2EVR A;  3OYB A;  5GAM j;  2F69 A;  1OQK A;  2DYB A;  5J39 A;  1K76 A;  1GXI E;  5KYW A;  2RHU A;  1PKS A;  2LT1 A;  3G71 Q;  4M78 A;  4J9D A;  2MWO A;  1D0Y A;  2RQT A;  1B34 A;  3ZFJ A;  1QCF A;  1YI2 Q;  6AT1 B;  2JM8 A;  2XK0 A;  3EHQ A;  5KYN A;  1F1B B;  1N9S A;  2EBP A;  2H8H A;  2RMO A;  2AT1 B;  4QT7 A;  3I55 T;  1FWZ A;  3EGU A;  3EGX B;  4QKU A;  1KD1 U;  4XU3 A;  3HP9 A;  4PJO F;  3CCS Q;  3X28 B;  2YXY A;  1NM7 A;  2HD0 A;  1YIT A;  2F2X A;  2DZC A;  1QLY A;  1OX9 A;  2X4X A;  1SSF A;  4CC7 A;  4FT4 A;  1BI2 A;  4EMK C;  5CCA A;  2DXU A;  2DEU A;  1M1K R;  2EAY A;  1BB9 A;  5GAN 8;  5FRM A;  4Q5W A;  2DRK A;  1S1N A;  3SDZ A;  5LJ5 e;  4M7D C;  3QBY A;  5HK3 A;  1M2V A;  2J6F A;  2EQI A;  2NWM A;  2W0Z A;  3JAM E;  4Z88 A;  2O4X B;  2KRN A;  1AWX A;  2EFI A;  3GP8 A;  3RMQ A;  4C0D C;  1OZ3 A;  4AFS C;  4LD9 K;  4PFP A;  1R0B G;  4FW2 A;  5GAN h;  3L2U A;  1NJI R;  3L42 A;  4ZN3 A;  3CCR A;  1EZZ B;  1FMV A;  4GLM A;  2AZS A;  1IGQ A;  3NMZ C;  5LL6 S;  5LJ3 e;  3JCM W;  4M78 C;  4L59 A;  5ECA A;  2LX9 A;  1KJW A;  2KSS A;  4Y28 E;  2K4Y A;  4MZM A;  3INZ A;  1K4U S;  5GAM e;  1JXO A;  3JB9 G;  3PGG A;  3PVQ A;  3VYH B;  2PUO B;  1ABO A;  2DL8 A;  2IPO B;  3M56 A;  4HVU A;  1YJW T;  3UA7 A;  2LQ8 A;  2F2V A;  4M7A C;  2C0I A;  2RB6 A;  1M90 U;  1TUD A;  4KGX B;  1WQ7 A;  1QP2 A;  5CKF A;  3JCM X;  1VOM A;  1YJN A;  2KE9 A;  4J9G A;  1U5S A;  3OMG A;  3QJ6 A;  4KUI A;  4C5E A;  4QQG A;  1N8R U;  3M0R A;  1PRL C;  4EMG A;  4XTY A;  1WXT A;  3PMI A;  1G5V A;  4C8Q E;  4DBQ A;  5KYU A;  2BIV A;  4AFZ C;  3TSZ A;  3RDV A;  1KD1 C;  1RAD B;  1AD5 A;  4RTY A;  2MAM A;  1RL2 A;  4C5G A;  1LOJ A;  2QA4 Q;  4FCY A;  4XTX A;  4HT9 A;  1GBR A;  5FLX E;  1YJ9 T;  1X27 A;  5GAN 2;  3OYL A;  2E3H A;  1D3B B;  5GAO p;  4ZGD B;  1RUW A;  4IUR A;  3UDC A;  1B07 A;  1WXU A;  2DL4 A;  3CC7 T;  3KBG A;  4PJO D;  4BY6 C;  1VQL T;  2LT4 A;  1YIT Q;  1NLP C;  2ZPE B;  1TUC A;  1MHN A;  1XQH A;  1D1C A;  3FJP A;  4C5I A;  3GLX A;  3I55 A;  3J7A F;  4M7A G;  1AHJ B;  1I0C A;  1R77 A;  2CRE A;  4HVV A;  4ATO A;  1R8O B;  2DVJ A;  3V7C A;  2VC8 A;  2QQS A;  1W2B S;  2O2O A;  3QSU A;  2GQV A;  3M5A A;  2VGN A;  4DA4 A;  4J9C A;  1H3H A;  3JCM J;  2B86 A;  2B8A A;  4XTU A;  3RUX A;  3LWH A;  3CMA Q;  4P5N A;  1C0M A;  5GAO r;  1VQ5 T;  1XTD A;  2CZ1 B;  3EG9 A;  2KXD A;  3CQT A;  4B9W A;  5I21 A;  1SEM A;  2JTM A;  5IHI A;  4ZTJ A;  2DXC A;  3VRY A;  4EMK B;  1W2B P;  4MML A;  4BE1 A;  3E19 A;  3SWN B;  2D6F A;  3TVT A;  4M7D B;  3EH1 A;  3HL8 A;  1YHQ T;  1OPL A;  5GAN f;  1M90 C;  3CPF A;  2L3S A;  2WAC A;  2NLU A;  4OMO A;  4M77 C;  4C0D B;  3I56 T;  2VUB A;  4FT2 A;  3M59 A;  4JZ4 A;  3EG1 A;  3C94 A;  1N8R C;  3H0H A;  2ZPI B;  4NL2 A;  2PTK A;  5FWC A;  3CD6 Q;  3MET A;  1KG1 A;  5HK0 A;  2DIG A;  1P92 A;  4LDX A;  3EHR A;  2JUF A;  2DET A;  1YJN Q;  1AZG B;  3EFO B;  3OYA A;  3VS4 A;  2BZ8 A;  1D1A A;  1NPP A;  2CP7 A;  2WSF E;  1YWO A;  3CBP A;  4BI3 A;  5KH6 A;  4A63 B;  1KK7 A;  1YJW A;  3OYH A;  5CIU A;  1Y7X A;  2BE7 D;  3M55 A;  4JRK A;  2OTL A;  5D7U A;  1WJQ A;  4M7A B;  3OYK A;  4PJO A;  2KGT A;  4E2F B;  4RMO A;  1H92 A;  4F7U F;  1M4Z A;  2COY A;  3ZBD A;  5GAN 3;  3OS2 A;  1RAA B;  3QHS A;  2QQ9 A;  2FHD A;  3JRZ A;  4YTL A;  1JXM A;  1ZQ1 A;  5AYF A;  3UPU A;  3JB9 I;  4M7D F;  1KD1 R;  5GAN 7;  2KVQ G;  2EKO A;  4ZTF A;  1PNJ A;  3V8L A;  1MND A;  2M1H A;  4DBH A;  2DLP A;  3MO8 A;  1UFF A;  2QEX T;  1KC8 U;  2MWP A;  3LX7 A;  4JS5 A;  4JDS A;  2F1L A;  4BD3 A;  1W6X A;  2ZPG B;  2DTO A;  3N5B B;  1YJ9 A;  1UEC A;  2I0N A;  1SF9 A;  4O5V A;  4XU1 A;  2RHY A;  3I55 Q;  3OYY A;  1KQS A;  2L89 A;  5IHN A;  3JCM V;  3CC7 A; 
#chains in the Genus database with same CATH homology
 3CXC A;  2LNV A;  2DTH A;  4JRP A;  1VQ4 T;  3PNW C;  1I5L A;  5CAI A;  4M78 F;  4E7L A;  1VQL A;  4M78 D;  4C92 E;  1UGP B;  3ZEH A;  3M4Y A;  4HA8 A;  2E10 A;  4A54 A;  1WPY A;  1ZHI A;  2RD1 A;  2RH2 A;  3H8Z A;  4QW2 A;  3GOX A;  3MHX A;  4L5G A;  2HQE A;  2JN0 A;  4PKC C;  3KXT A;  1Q82 C;  3BY7 A;  2DXT A;  4LD6 A;  2RHI A;  5GAN 6;  3TEE A;  2EWN A;  3S3O A;  1VQ6 A;  2DVE A;  2QQA A;  3ME9 A;  2L3R A;  2ZPH B;  1N27 A;  3CCQ T;  3RKW A;  3OY9 A;  4M75 B;  1UGR B;  2DIQ A;  4C8Q C;  3BFM A;  5GAO n;  4IUT A;  3CCR T;  4FSX A;  4RCB A;  4M7A F;  3E1S A;  3DB4 A;  2RJE A;  3S6W A;  4J5Y A;  3G6E T;  2CGH A;  2RHZ A;  5CQX A;  2EIF A;  2YHT A;  2DZ9 A;  2CZ7 B;  1KQS S;  1NJI C;  2I2L A;  3NTI A;  4HCC A;  1XNI A;  3QO3 A;  1DJ7 B;  2EJF A;  5GMK i;  5CKE A;  2DXB A;  4O6J A;  3R6O A;  5CKH A;  5IAY A;  3CC2 A;  4N4G A;  2X4J A;  1Q82 U;  3CXC S;  2EQM A;  2RI5 A;  5FU7 C;  2EQU A;  1VQ5 A;  4QVZ A;  3JCM g;  3JSC A;  3CCL T;  3NFC A;  3ASK A;  3CCU A;  3HFO A;  4E7K A;  3CCM T;  3CCJ A;  3QPH A;  4CI0 C;  1U8R A;  1JB0 E;  1I8F A;  1M1F A;  5CVI A;  3GNG A;  4TVR A;  4OB3 B;  3OYM A;  3OS5 A;  4ZGJ B;  4RCC A;  2K5F A;  1BIA A;  3X25 B;  2Y4Y A;  1VQ9 T;  1Y96 A;  3FRN A;  4VUB A;  2LCC A;  4MMK A;  3OW2 A;  5LJ5 j;  2K57 A;  1YHQ A;  4PJO B;  4XQ3 A;  2E41 A;  1YJN T;  2O4X A;  2JZ2 A;  3CBM A;  3OSS C;  2CS7 A;  4F7U A;  3DLL A;  2M16 A;  1WNL A;  5LJ5 h;  4ELY C;  2DTI A;  1BI1 A;  4LDV A;  3CC4 A;  3TU4 K;  2M0O A;  3V7R A;  1WJS A;  4ELZ C;  3I56 A;  5D6W A;  5FU7 B;  1Y71 A;  2LVM A;  2RI2 A;  3M57 A;  4QQ6 A;  2ZPF B;  4M77 B;  3LYI A;  3JB9 F;  1N6A A;  4M75 E;  5CR2 A;  2QQB A;  2RI3 A;  2WSC E;  5GAN 4;  2VXE A;  4F7U G;  3LGF A;  1BI0 A;  3NTK A;  3PT9 A;  4IUV A;  3WXM B;  2OTL T;  5DY9 A;  3FIF A;  4C8Q A;  4OVA A;  4DOW A;  3CME A;  3OS0 A;  1HXD A;  3A8O B;  3PIO A;  3HRS A;  4JJN K;  3P8D A;  5DM7 R;  4E7H A;  1PSE A;  3OQ5 A;  2DEQ A;  2ZZD A;  3G4S T;  4RG2 A;  4ATO A;  4XK8 E;  2XID A;  4FIB A;  3RKY A;  2MF2 A;  2XI9 A;  1OI1 A;  3A8L B;  5LJ3 j;  1M1G A;  2PUK B;  3SD4 A;  1K8A C;  1HK9 A;  2QQR A;  3OYI A;  4J8O A;  2XHC A;  3OW2 S;  3V8J A;  2CZ0 B;  4UC4 A;  5GAO q;  4NL3 A;  2QA4 T;  5LJ3 h;  1G3Y A;  3OYJ A;  1YCY A;  4M7D G;  4GY5 A;  4QQD A;  3PIP A;  4A4H A;  4C8Q G;  3OYB A;  5GAM j;  1UGQ B;  1KC8 C;  2F69 A;  3VKI A;  2HAX A;  2E70 A;  1M5Q 1;  1WQW A;  2HBP A;  2M9U A;  3GIB A;  3G7Z A;  3EFR A;  3VUB A;  5DLQ E;  5J39 A;  1VQ7 A;  5GAM h;  1VQO A;  1GXI E;  4X9D A;  4C0F A;  1K73 U;  3LWI A;  3MCA B;  1YBY A;  2RHU A;  5A0D A;  2LT1 A;  4M7D D;  2A3L A;  2V8J A;  4PJO E;  3MP6 A;  4M78 A;  3P8B B;  3HHT B;  2MWO A;  3DLM A;  5FRO A;  1M8V A;  1M9S A;  1B34 A;  2YLC A;  3ZFJ A;  5D6X A;  3A5Z B;  3FEO A;  4C5H A;  2XK0 A;  3RIR A;  3CEY A;  1N9S A;  3NTH A;  2XKO C;  3ER0 A;  3A8M B;  2DK3 A;  2KQW A;  3OB9 A;  3I55 T;  1FWZ A;  4M77 E;  4X9C A;  2RJD A;  4M78 G;  1VQN A;  2L8D A;  4JLI A;  2OTJ A;  1G3W A;  2D9T A;  5KE3 A;  2K5I A;  1KD1 U;  4XU3 A;  3MEA A;  3HP9 A;  3QDR B;  4PJO F;  3L2R A;  3X28 B;  4FU6 A;  3CCV A;  1H64 1;  3RMS A;  3M53 A;  2HD0 A;  1YIT A;  4FM4 B;  3OBY A;  4Y91 A;  3JB9 H;  2DO3 A;  2V8K A;  5LJ5 g;  1NE8 A;  2QEX A;  2DZC A;  3S3N A;  3M9Q A;  3JCM P;  2E64 A;  3CMA T;  2IVW A;  4DQ2 A;  2P0Q A;  3TRE A;  1VQ8 T;  2X4X A;  1SSF A;  4PNO A;  4FT4 A;  1BI2 A;  2RA2 A;  4EMK C;  2DXU A;  1BKB A;  4M77 F;  2E1H A;  5CCA A;  5I2S A;  5A2Q E;  2KK4 A;  2EAY A;  3MP8 A;  3T9N A;  4J6Y A;  5GAN 8;  5FRM A;  4Q5W A;  3WVE B;  1YIJ T;  3CCE A;  2MMP A;  3SDZ A;  5LJ5 e;  3OSV A;  2CKK A;  3E9G A;  4M7D C;  2HQX A;  3MEW A;  5CKB A;  1IRE B;  1EIF A;  3QBY A;  5CO7 A;  3FDR A;  5HK3 A;  4M7A D;  1VQ4 A;  1Y96 B;  2RHX A;  3VV0 A;  1QVG S;  1LJO A;  3MP1 A;  4C92 F;  3JAM E;  2PVG B;  3VU3 C;  2O4X B;  3CPW S;  4HCZ A;  4F7U B;  4BE2 A;  2EFI A;  3GP8 A;  2PQW A;  3RMQ A;  4C0D C;  5LJ3 g;  3GNF B;  1S72 T;  4JRQ A;  2ZCF B;  5GAN j;  3HFN A;  1OZ3 A;  5J3B A;  4E47 A;  3E9F A;  1Y07 A;  5FRN A;  4LD9 K;  3CCQ A;  2FVU A;  3MEV A;  5GAM g;  5GAN h;  3L2U A;  4RKU E;  3L42 A;  4B9X A;  4ZN3 A;  5GMK j;  3H6Z A;  3CCR A;  1Q81 U;  2H3J A;  1QVF A;  3CD6 T;  4N4I A;  3G6E A;  4XAX B;  4PL6 A;  5LL6 S;  5LJ3 e;  4C8Q B;  4NOY A;  3JCM W;  1Q86 U;  4RG8 A;  4KUL A;  4M78 C;  2F5T X;  4L59 A;  1KHI A;  3JCM e;  2LX9 A;  1G3T A;  2KSS A;  4Y28 E;  3QXE B;  4IUU A;  2K4Y A;  4MZM A;  2IG0 A;  4A4K A;  3INZ A;  4JS4 A;  5GAM e;  5GMK m;  3Q1J A;  3JB9 G;  3PMT A;  4OMF B;  1O75 A;  3PGG A;  5KE2 A;  1VQK T;  2EQJ A;  3CCL A;  3VYH B;  2VGM A;  1QW1 A;  4QVC A;  2PUO B;  3OYN A;  3CCM A;  3C4S A;  2CYZ B;  3M56 A;  2DKG A;  3RER A;  4J6X A;  4EMK A;  4MDX A;  4HT8 A;  4DOV A;  1YJW T;  5LJ5 f;  5FU6 C;  2X4W A;  2XDP A;  3SWN A;  2LQ8 A;  3JB9 D;  4M7A C;  2RB6 A;  1VQ9 A;  2XU8 A;  4C0Z A;  2RM4 A;  4M7D A;  4R55 A;  5CKF A;  3JCM X;  1WQ7 A;  1QP2 A;  1RI0 A;  3QYG B;  2JTF A;  3HRU A;  1M90 U;  3FLG A;  5GAO l;  2E12 A;  2EJ9 A;  1YJN A;  1K73 C;  4JUV A;  4M78 B;  3OMG A;  4F7U E;  5M9O A;  3QJ6 A;  1JJ2 A;  1B34 B;  4KUI A;  3OMC A;  2BUD A;  3EFS A;  4C5E A;  4QQG A;  1N8R U;  3QZ9 B;  5J26 A;  4XTZ A;  4BI4 A;  2O01 E;  3SFM A;  2EYQ A;  4BI8 B;  3M58 A;  3UWN A;  4EMG A;  4J83 A;  1PSF A;  4XTY A;  2K3X A;  4M75 F;  3SB2 A;  2KDS A;  4OF1 A;  4M75 D;  3PMI A;  1G5V A;  3LLR A;  3OA6 A;  2X4Y A;  3O8V A;  5FU6 B;  1I4K 1;  2P4T A;  4V2S A;  5LJ3 f;  4A4E A;  4C8Q E;  3JB9 J;  1BYM A;  4PLI A;  3G71 T;  3G4S A;  3JCM f;  2BIV A;  5KCH A;  2XDD A;  4FL6 A;  2DAQ A;  1OZ2 A;  1VQP T;  1KD1 C;  1X01 A;  2F5K A;  5GAM f;  1YI2 T;  5LJ5 d;  2MAM A;  4GLK A;  1K9M U;  4IKF A;  2QTX A;  1RL2 A;  4BUG A;  4C5G A;  4OB0 B;  2QA4 A;  1LOJ A;  4EMH A;  2RK1 A;  1VQM T;  2QXF A;  2LC4 A;  1V29 B;  2MI6 A;  3HPW A;  4XTX A;  3VYG A;  4BB7 A;  3OYF A;  4ZN1 A;  2QDY B;  1JRI A;  5FLX E;  1W2B A;  1O9S A;  4PJO G;  1YJ9 T;  2XD0 A;  2ZPB B;  1UB4 A;  1BI3 A;  5GAN g;  3VJP A;  5GAN 2;  3OYE A;  3EAE A;  3OYL A;  1D3B B;  3QG1 A;  4IUP A;  5EG2 A;  5CK9 A;  5L8R E;  4C8Q F;  4ZGD B;  5GAO p;  3OYG A;  3CCS T;  4IUR A;  3FC3 A;  3QKJ A;  3UDC A;  4M7A A;  2VYT A;  3CC7 T;  3KBG A;  4PJO D;  4M78 E;  3C12 A;  4BY6 C;  1VQL T;  3KUF A;  2GFU A;  4HCB A;  4M77 G;  2LT4 A;  3C95 A;  4OGC A;  3HRT A;  5GAN e;  2ZPE B;  4BAC A;  2R58 A;  4KUD K;  3L1A A;  4QVD A;  1X6O A;  1MHN A;  2E5Q A;  5LJ3 d;  1XQH A;  4C5I A;  3FJP A;  2CZ6 B;  3GLX A;  5GAN 5;  3I55 A;  3JCM d;  3J7A F;  4M7A G;  1AHJ B;  2Y4X A;  2L5Q A;  4M77 D;  3J80 E;  3S3M A;  1R8O B;  2RJF A;  3RES A;  3FB9 A;  3SWN C;  4C0G A;  3M4G A;  1VQ6 T;  4C92 G;  3V7C A;  1D3B A;  4M7A E;  4LDY A;  5GAM d;  1NPR A;  2JOY A;  2VC8 A;  2DD4 A;  2QQS A;  1Q7Y U;  2P0P A;  3L2Z A;  4EDU A;  4EPC A;  1W2B S;  3M54 A;  2LRQ A;  1TH7 A;  5A0G A;  5I2M A;  1BIB A;  2FYK A;  3QSU A;  3DB3 A;  2GQV A;  1Q81 C;  3DKM A;  3M5A A;  2VGN A;  4DA4 A;  2JVV A;  4J7F A;  5GAO m;  2R57 A;  2VV5 A;  4C92 D;  4BY6 B;  1Q86 C;  1IZ6 A;  4J6W A;  4XU2 A;  1OYX A;  4N0A A;  3CMA A;  3JCM J;  2B8A A;  4OP0 A;  4XTU A;  3RUX A;  2P0K A;  2XIC A;  3LWH A;  3CC2 T;  4HT9 A;  4P5N A;  5CQY A;  1VQ8 A;  5GAO r;  5A0L A;  1XTD A;  2CZ1 B;  1VQ5 T;  5DLO A;  5D6Y A;  4B9W A;  5I21 A;  4E7J A;  4ZTJ A;  2JTM A;  3CCU T;  4CRI A;  2DXC A;  3OYD A;  1M1K U;  4PLL A;  3CCJ T;  1N9R A;  4EMK B;  1VIF A;  4MML A;  2DJZ A;  1YIJ A;  4WF2 A;  2LQK A;  2YRV A;  1LNX A;  3E19 A;  4XTV A;  4XU0 A;  3SWN B;  4BE1 A;  2D6F A;  4PJO C;  4D6W A;  2DPP B;  2X35 A;  5HY6 A;  4M7D B;  2D0Q B;  3PFS A;  3X20 B;  2K3Y A;  2VXF A;  4X34 A;  4MDW A;  5GMK h;  3HL8 A;  1YHQ T;  1UGS B;  5GAN f;  4ME7 A;  1M90 C;  3GF5 A;  1ZBX A;  3CPF A;  3LGL A;  2WAC A;  2NLU A;  3V7S A;  3CC4 T;  1FXX A;  3BDL A;  1S72 A;  4II1 A;  4M77 C;  5C6S A;  3HSB A;  2LTO A;  4KBM B;  4C0D B;  3I56 T;  2VUB A;  4FT2 A;  2KMT A;  3M59 A;  3VUZ A;  1WJR A;  1KHC A;  3C94 A;  1N8R C;  2ZPI B;  4M75 A;  4KT0 E;  4OGE A;  4BDY A;  2WSE E;  4NL2 A;  3OBW A;  3WVD B;  2RO0 A;  1H3Z A;  2OAU A;  1NJI U;  3CD6 A;  2BKD N;  2RK2 A;  2C06 A;  1QVP A;  1VUB A;  1X75 C;  3JCM c;  3MET A;  3CME T;  1KG1 A;  4IUQ A;  2DIG A;  2LCL A;  1P92 A;  4C92 C;  5HK0 A;  4LDX A;  2JUF A;  1QVF S;  4BE0 A;  4A4G A;  3OYA A;  4M75 G;  2LDM A;  3P8H A;  1VQK A;  1NPP A;  2R5M A;  3A8H B;  2WSF E;  2E6N A;  1XOV A;  1K9M C;  5CKD A;  1U1T A;  3CBP A;  2PU9 B;  4BI3 A;  2K5L A;  5KH6 A;  1YJW A;  2KAF A;  3OYH A;  3L2V A;  5GAN d;  3X26 B;  1QP3 A;  3BW1 A;  5CIU A;  1VQ7 T;  3X24 B;  1Y7X A;  3M55 A;  1VQO T;  4JRK A;  2OTL A;  2EQK A;  3LW5 E;  3A8G B;  4M7D E;  1I81 A;  1WJQ A;  3LH0 A;  4M7A B;  3OYK A;  4PJO A;  5HKC A;  1KQ2 A;  3TCJ A;  1G3S A;  3GPL A;  4RMO A;  2XDB A;  3JCM Q;  2G3R A;  3AHU A;  4C92 B;  4N0A C;  4F7U F;  2E6Z A;  1M4Z A;  3J81 E;  4N4H A;  4Z02 A;  2HNI A;  2ZGW A;  1U1S A;  3V8K A;  3ZBD A;  1KQ1 A;  5GAN 3;  3OS2 A;  2GF7 A;  4L6V 5;  4LDU A;  3UT1 A;  3QHS A;  2QQ9 A;  3L2Q A;  2FHD A;  3JRZ A;  3JCM h;  3QJY A;  4YTL A;  1VIE A;  2XG8 D;  1ZQ1 A;  3BDU A;  4M77 A;  5IN1 A;  5AYF A;  1UEB A;  1JJ2 S;  2PVO B;  3UPU A;  3JB9 I;  5KCO A;  1VQN T;  2EJG A;  1MGQ A;  2FB7 A;  2KY9 A;  4JLG A;  5IT9 E;  2OTJ T;  4A53 A;  4M7D F;  2R5A A;  2Y90 A;  2JNG A;  4NS5 A;  3HKS A;  3URG A;  5GAN 7;  3G71 A;  5C0M A;  2V8I A;  4C8Q D;  4OB2 B;  2KVQ G;  2EKO A;  1JBM A;  2GCX A;  2YLB A;  4R56 A;  3OYC A;  4ZTF A;  2DD5 A;  4A4F A;  1K8A U;  4HKE A;  3QUI A;  3CCV T;  3V8L A;  4J7I A;  5GMK l;  1VQP A;  3MEU A;  4JRI A;  1Q7Y C;  1YIT T;  4C92 A;  2M1H A;  1YI2 A;  3QII A;  3MO8 A;  3JCM b;  2QEX T;  1KC8 U;  4XTW A;  2MWP A;  1WGS A;  2FL7 A;  3LX7 A;  4JDS A;  1NZ9 A;  3PTA A;  4JS5 A;  2A7Y A;  1W4S A;  3RKX A;  4BDZ A;  1VQM A;  4MZT A;  1FX7 A;  4LDW A;  4BD3 A;  2RJC A;  2AHJ B;  2ZPG B;  3QZ5 B;  2DTO A;  2QI2 A;  3N5B B;  5GMK e;  1YJ9 A;  4E7I A;  2K2V A;  3F70 A;  4O5V A;  4XU1 A;  2RHY A;  4M75 C;  1QVG A;  3OYY A;  1KQS A;  2L89 A;  3CCE T;  3OS1 A;  2PVD B;  3CBO A;  3CPW A;  3QYH B;  1M1K C;  3CCS A;  4MZP A;  3L2W A;  3JCM V;  2E65 A;  2GFA A;  4OB1 B;  4ZGE B;  3CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...