3LGFA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k370me2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lgfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lgfA01
3OYLA 3ER0A 3S3OA 2YRVA 5KE3A 2R5AA 1M1KU 2RHIA 5IT9E 3L42A 3OYIA 3OYJA 3CC7T 3E9GA 4ZTFA 1BKBA 2GFUA 4FL6A 3OA6A 4X34A 1XTDA 3OMGA 4QQDA 3F70A 1KQSS 5DLQE 4GY5A 2EFIA 4UC4A 3CCLA 1WJQA 2LQ8A 1YJNT 5KCHA 1KHCA 4E7JA 3FLGA 3MEVA 1WJSA 4BD3A 1KD1U 2RJFA 3CPWA 3GOXA 3CPFA 3OS1A 3CPWS 5M9OA 2GFAA 5J26A 4HCZA 3CCMT 2EQKA 4PLLA 3MP8A 3ZEHA 3NTKA 3G71A 3A5ZB 1OZ3A 1YJ9A 2K3YA 4PL6A 4YTLA 1VQPA 1VQMT 3L2UA 4ZN3A 1YHQT 3L2QA 2WACA 3OYMA 3PMIA 1K73C 1VQOA 5D6YA 4OVAA 1VQ9A 1Q82U 3FEOA 5KCOA 2X35A 3P8DA 4IUQA 4A4GA 1YJWA 3CMAT 3PIPA 3G6ET 2E6ZA 1XNIA 1MHNA 1VQ5A 3NTHA 5C0MA 2KVQG 4PLIA 1OZ2A 2X4YA 1Q7YC 3CCVT 3C4SA 1Q86C 1VQ7A 5LL6S 3DB4A 3ASKA 3OYAA 3UWNA 2F5KA 3KBGA 1RI0A 1NPPA 5FRMA 2QEXT 2NLUA 3CCST 3I55T 2BKDN 2MWOA 3UT1A 2EQJA 3OB9A 2VYTA 4NS5A 3CCRT 4C5GA 3OQ5A 3J80E 1Q81C 1KC8C 2RJDA 3DB3A 3G4SA 1VQKT 3JAME 1VQ8A 5DM7R 2HQXA 4C5EA 3CCQT 4II1A 1VQLA 3NTIA 5D6XA 1M1GA 5KH6A 2RO0A 1M90C 4QQGA 4Q5WA 1X6OA 1G5VA 1YBYA 1W2BA 3CCET 2O4XA 1YITA 3CC2A 3OYCA 2R57A 1YIJA 2RHZA 5D6WA 2X4XA 3QIIA 2OTJA 3H8ZA 2LVMA 4B9WA 3DLLA 4BE1A 4IUUA 2OTLA 2DIQA 3LX7A 2MI6A 2GF7A 1YI2A 5IN1A 4N4HA 3EAEA 3LH0A 3CCLT 4IUPA 3CMEA 2LCCA 2O4XB 2PQWA 2EQUA 3MEUA 2JZ2A 1UEBA 1OYXA 4TVRA 1K9MC 1K9MU 3LGFA 1NZ9A 1VQMA 3Q1JA 2MWPA 1K73U 4E7HA 1VQ6A 5FROA 3SD4A 3PNWC 1YJ9T 1VQPT 3L2RA 3OY9A 4IKFA 1QVFA 3G6EA 2E70A 4E7KA 2BUDA 3PFSA 3S3NA 1VQ9T 1QVFS 2QQRA 4BDZA 1N27A 2D9TA 2QA4A 1Q7YU 1VQNA 3MP6A 1Q86U 3CCVA 1YJWT 4BDYA 4Z02A 2JNGA 3BDLA 5FRNA 1NJIC 1VQ5T 3CXCA 1VQ4A 2DO3A 3S6WA 3I56T 3CD6A 1S72A 3CXCS 2R5MA 2X4WA 1JJ2A 3LYIA 3P8BB 2RJEA 1VQ7T 2RHYA 5J3BA 1JJ2S 1Q81U 3PIOA 1KC8U 3CCUA 3HKSA 4E7LA 2JUFA 2DAQA 1VQKA 1QVGA 2G3RA 2LCLA 3OYKA 2L3RA 1QVGS 4N4IA 2K3XA 4A4HA 3FC3A 3KUFA 1M90U 4QQ6A 3G4ST 3CCJT 3CC4T 3CC7A 3OMCA 3J81E 1W2BS 1VQ8T 1K8AC 1K8AU 3MO8A 1VQLT 2XK0A 3OYNA 1M1KC 1WGSA 5IAYA 4C5HA 2M16A 5HY6A 1YITT 3CC2T 4FU6A 1YJNA 2JOYA 4BACA 1YIJT 2RI2A 3L2WA 1EIFA 1KQSA 2OTJT 2L8DA 2OTLT 5J39A 4A4EA 4LD6A 3DLMA 4QW2A 2RI5A 3OYBA 1H3ZA 3CCMA 3ME9A 1KD1C 3QBYA 1YI2T 1OI1A 3QJ6A 1N8RC 1N8RU 1YHQA 3PMTA 3OYGA 3J7AF 3CMET 2IG0A 4QVZA 4N4GA 3M9QA 3FDRA 4CRIA 5CIUA 3OW2A 2HQEA 4B9XA 2XDPA 3G71T 5A2QE 3E9FA 3OW2S 2EQMA 5C6SA 4IUTA 4RG2A 3MEWA 3CMAA 5FLXE 3OS2A 2RI3A 1VQOT 3OYHA 1VQ6T 3MEAA 2BIVA 2DIGA 1Q82C 3P8HA 4BE2A 2E6NA 2JVVA 3MP1A 3LGLA 3QKJA 2P0KA 3LLRA 2FHDA 3OYDA 1NJIU 4ZTJA 2QEXA 2KDSA 2RHXA 3META 1NPRA 3I55A 3CCSA 2RJCA 2XHCA 2EIFA 3O8VA 5KE2A 4ZN1A 3L2VA 3I56A 4EDUA 2QA4T 2CKKA 1VQNT 4IUVA 2E5QA 3OYFA 4A4FA 2EKOA 3CCRA 3OS0A 2LDMA 2M1HA 4BE0A 1RL2A 3S3MA 2JTFA 1VQ4T 3OYEA 2LTOA 2QQSA 2R58A 1IZ6A 3H6ZA 3OYYA 1SSFA 3CD6T 1S72T 4E7IA 2LRQA 4C5IA 2L89A 4L59A 2M0OA 3CCQA 2B8AA 4IURA 1KHIA 3CCUT 3CEYA 3TREA 3CCEA 1WJRA 2RHUA 3CCJA 3CC4A
chains in the Genus database with same CATH superfamily
1R0BG 1D09B 3S3OA 2X51A 1U1SA 5KE3A 2R5AA 3MCAB 1B34A 2V26A 3E9GA 4ZTFA 4FSSA 2V1RA 4FL6A 1I0CA 1ZBXA 3QYHB 1AHJB 3CQTA 4QQDA 5GMKi 4GY5A 2VWFA 4KUIA 5KYWB 4OF1A 4NL2A 3HRUA 3H9NA 2DMOA 3V8KA 3UDCA 2DERA 1WJSA 2O9SA 3EG3A 1GBQA 4PJOE 2MF2A 5D7UA 4JJCA 3G1JA 3OS1A 4E7SA 2DXCA 2DL4A 2GFAA 4Y28E 5J26A 2HEQA 1JQQA 2CP2A 4HCZA 4PJMA 4L6V5 5LJ3h 3CCEQ 5FWBA 2E10A 3ZEHA 3G71A 2IPOB 2I2LA 3RMQA 2J6OA 2YUOA 2FO0A 1VQPA 1CKBA 1YHQT 1B7TA 2A7YA 4J9DA 4JJBA 2EQIA 4F7UE 2DILA 1LJOA 1BCMA 4M7DA 2KY9A 2L2PA 4A4GA 1PHTA 4LE9A 2CDTA 3CMAT 3NMZC 1MMDA 4LD9K 4M75C 4M78G 1VQ5A 3HPWA 2K2VA 1SHGA 1OZ2A 1XOVA 2RQWA 1N6AA 3RKWA 3CCVT 2KK4A 3FIFA 4OMPA 2FG0A 1TTHB 4M7AD 3JB9G 3DB4A 2LP5A 3OYAA 1ZSZC 2KXDA 3UWNA 3KBGA 2NYSA 3A8LB 1RI0A 1IO6A 2L5QA 1K73R 2NLUA 3I55T 2RN8A 2K5FA 4F17A 4M7DC 4OMMA 5CKEA 1VQPQ 2XMFA 4PJOA 1WHJA 3MHXA 3TEEA 4M7DF 3G4SA 2QASA 4RTXA 1D0ZA 1UHFA 2D8HA 2K2MA 2BE7D 1VQ8A 2E4HA 4RCBA 2QTVA 4C5EA 1MMAA 4II1A 2VXFA 3WXMB 4EMGA 1M1GA 5KH6A 2RQTA 3QWYA 4M77G 1VQ5Q 4Y91A 1H641 3OYCA 2ZCFB 4F7UA 2XICA 2KSSA 3M59A 2RHZA 1YIJA 5L8RE 3EG9B 4PJOC 2P4RA 4OGCA 5LJ3f 2OTLA 3NGPA 4C92G 1SRLA 4XTWA 3M5AA 2DL7A 3JCMh 2K6DA 4BI3A 2DE0X 2LCSA 1M27C 1FX7A 4PJOF 2LX7A 3JRZA 2SRCA 4RKUE 3LH0A 1G3YA 5I2SA 1M90R 1A0NB 3CMEA 2A36A 2PQWA 2CH4W 4R0KA 2DETA 3GIBA 1UUEA 3G4SQ 1GCQA 4WF2A 3QSUA 1Q95G 3CC4Q 5FU6C 3VS3A 5A0LA 1UEBA 4C0GA 1VQ8Q 3QZ5B 1K9MC 3JCMJ 2DVEA 3SWNC 1ZSGA 3AHUA 2KGTA 4LXCA 4HA8A 4F7UF 3HL8A 4ATOA 1M30A 2EJGA 5DY9A 4V2SA 2O01E 1H92A 4HKEA 1RACB 1R0CB 1QKWA 2CZ0B 3EFRA 3G6EA 2FRYA 2OTLQ 2CUDA 2FB7A 1VYTA 1VQ9T 1BB9A 2KR3A 2QQRA 1GCQC 4C0ZA 1N9SA 4BDZA 2D9TA 1YWPA 1Q7YU 3UPUA 3MP6A 2KXCA 1Q86U 1YJWT 3PVLA 1KJWA 4BDYA 4Z02A 2JNGA 5GAOq 5FRNA 4FT4A 3MPUB 2RH2A 1VA7A 3CXCA 4C0DB 3CMEQ 1VQ4A 2DO3A 1SG5A 3I9QA 3CD6A 2PVOB 2KBTA 3CXCS 1NE8A 1Z9QA 1LCKA 4OB0B 1JJ2A 5GAMg 3JB9J 4ORZA 5J3BA 1JJ2S 1BU1A 1Q81U 4ME7A 2EWNA 1W1FA 2YUQA 4E7LA 2JUFA 3GF5A 5IHNA 3VRZA 2E3HA 3SDZA 2DAQA 4JPBW 2F2XA 1Q7YR 3H0IA 2LCLA 1Q86R 5HCKA 5KYYB 4C0FA 7AT1B 1G8XA 4JZ4A 2CT4A 3JCMf 3FC3A 4AFUC 2P0QA 3QXEB 2XD0A 5FU7C 3CCJT 2LT4A 3JCMb 4M75D 4AMCA 2DJQA 1W2BS 4Z8AA 2GQVA 1K8AC 2CZ1B 1ZUKA 1TG0A 1Q81R 3GP8A 1I07A 4RTVA 3OYNA 2DM1A 1NG2A 1GBRA 2L3SA 4C5HA 5LJ3g 2M0YA 2M16A 3SB2A 1TH7A 1QWFA 4M7DE 3CD6Q 4O6JA 2PNIA 3L2WA 1KQSA 5GAOr 5LJ5d 3RESA 4EMKB 3I5SA 2K5LA 2E5KA 4LD6A 5CK9A 3RERA 1HXDA 2RI5A 1M5Q1 1H3ZA 1M3AA 2KNBB 2NWMA 2CREA 4ESRA 3OBYA 2MIOA 1N8RC 3PMTA 1YHQA 2JS2A 1O75A 4QVZA 5CCAA 4M7AE 2GBQA 3G71T 4C8QC 3JCMW 5C6SA 2X9HA 4IUTA 4F14A 1FMWA 4M77B 3CMAA 1T3SA 2ROTA 1UE9A 2RI3A 4MZMA 1VQ6T 2JJ9A 2KRMA 2LQKA 2DIGA 3V7CA 1U1TA 3GLXA 1UG1A 3QKJA 4ELYC 1WZOA 3HTRA 1NJIU 1TUGB 2V8JA 3IQLA 3EHRA 2L3PA 3I55A 2EIFA 4JDSA 4LUDA 2RQRA 2QTXA 2CKKA 4D8KA 3RKXA 4BE0A 1M2VA 5A0GA 4F04B 3S3MA 1LOJA 1W70A 4LDYA 3L2ZA 2DEQA 1D0YA 2LRQA 2DF6A 3E1SA 2YT6A 3OSVA 4DBQA 2L89A 4LUEA 3TU4K 4F7UG 1H3HA 3CMAQ 4AT1B 3JCMP 1TU0B 4N0AA 3ZBDA 3TREA 1WJRA 3VYGA 2MK5A 1BIBA 1QVFP 4M7AA 2HKNA 2QA4Q 2AZSA 2YRVA 4KULA 3CCVQ 2DBMA 2CP7A 4Z89A 1LNXA 4Y92A 4FYXB 1JXMA 3VV0A 2RHIA 3OYIA 4XTZA 2AIRB 3OYJA 2ED0A 2FZGB 1BKBA 3M4YA 5GMKh 2GFUA 1S72Q 2NUZA 2ATCB 1XTDA 3A8HB 3OMGA 4EPCA 5CR2A 3F70A 3PE0A 2NUTA 2RM4A 1PRMC 2MMPA 4N0AC 4QKUA 3THKA 2LQ8A 4GLKA 5GJVB 1HJDA 3FB9A 2H3JA 4XU3A 5KYUA 4OB1B 3VS6A 4E7JA 2HL5C 2D8JA 3FLGA 3MEVA 1AVZC 2RQVA 1KD1U 3V7SA 3CPWA 1B34B 2PU9B 5GAMe 1QVGP 4OMFB 3CPFA 1G3SA 3CPWS 5M9OA 1BBZA 1M4ZA 4JLGA 2EJ9A 4M7AF 1CSKA 3HSBA 3VU3C 3CC7Q 3ZFJA 1X01A 1KK7A 4PLLA 3NTKA 1OZ3A 3A5ZB 4PL6A 4YTLA 1UGQB 2SEMA 1GRIA 3L2UA 1V1CA 4ZN3A 1KSWA 4XU1A 1OPKA 3OYMA 3VS0A 1VQOA 1EZZB 1GFCA 1VQ9A 3OSSC 1Q82U 2LQNA 5KCOA 1HD3A 2DXUA 2HQHA 4IUQA 1YJWA 1KD1R 3QWXX 1PWTA 4E2FB 2PZ1A 4JRPA 5IXBA 3E19A 1O9SA 3G6ET 2E6ZA 3ULRB 2DFUA 3EGDA 4RTWA 4KBMB 3C95A 1JRIA 5LJ3e 3NTHA 3LWHA 1W4SA 4PFPA 2JXBA 1MNDA 4IIMA 3EFSA 2YLBA 1UFFA 2X4YA 2XDDA 1Q7YC 2EYZA 2YHTA 1Q86C 2DNUA 4JJDA 2D0QB 1QKXA 5EC7A 2F5KA 4M75E 2QEXT 2H8HA 4XTVA 4M7DB 2YUPA 2MWOA 3UT1A 1OOTA 2VYTA 9ATCB 1WQWA 4NS5A 2VUBA 2LC4A 2HDAA 3OW2P 1BK2A 4ELZC 4C8QD 1Q81C 3PGGA 3VS5A 2P0PA 1X75C 1UJ0A 1UJYA 1NEBA 1YJWQ 2HL3A 2A28A 3T9NA 5AYFA 3C12A 4QQGA 1G5VA 2YRDA 4RTUA 2EYWA 3M0RA 5GANh 1AWXA 3URGA 1WFWA 4PJOB 3H8ZA 4B9WA 1SPKA 2ED1A 1QVPA 3DLLA 4BE1A 4AG2C 2DTOA 5CKFA 3VUZA 2MI6A 2JM8A 2HAXA 1YWOA 2CP3A 2YRCA 3JCMd 3EH2A 5EG2A 1MGQA 4N4HA 4M75A 3CCLT 1OV3A 1H8KA 3MKDA 3GNGA 5FU6B 4F7UB 1BYMA 3CCJQ 3PT9A 2EW3A 1NLPC 2JZ2A 4TVRA 2E41A 1BI2A 1G2BA 1NZ9A 4DEYA 1NLOC 3JB9H 1ZSZA 2EPDA 2BZYA 3A1PA 1VQMA 4J8OA 3Q1JA 1M8MA 2MWPA 1K73U 4FYWB 4E7HA 1ACMB 1VQ6A 5FROA 4OMLA 1J3TA 1PKSA 1UECA 2DKGA 3SD4A 4A63B 4AFQC 1YN8A 3PNWC 1YJ9T 1I5LA 3L2RA 4IIOA 5IHKA 2LNVA 1ABQA 2QQAA 4M78D 3HFNA 3PFSA 2KE9A 1PD0A 1YP5A 4FW1A 1IRXA 2Y90A 3VYHB 1QQJA 4M75F 2NUPA 5CQYA 2RMOA 2LJ3A 2HD0A 1NJIC 4FW2A 4BY6C 2EYQA 5GAN6 3S6WA 2EVRA 1UGPB 1YCSB 1QMCA 3LYIA 1HK9A 4AG1C 5GANj 2RJEA 3G71Q 3RIRA 1VQ7T 2C0IA 1Y57A 1UDLA 4M7AG 4WTOB 2AKKA 3D7SB 3QUIA 2C06A 1R8OB 1ZUYA 1K9AA 3OS5A 1KC8U 1NYFA 3HKSA 5GANf 3EG2A 4J7FA 3REAB 1BI1A 1VQ6Q 5LJ5g 1VQKA 4QT7A 3OYKA 2L3RA 1FXXA 3QG1A 1AZEA 1C0MA 4E47A 3KUFA 4DQ2A 1M90U 2GGRA 5FU7B 1NBEB 1X6GA 1PKTA 3M0SA 3PVQA 2KT8A 3JV3A 5KYNA 4X9CA 2DK3A 3RNJA 2JT4A 3MO8A 2J7IA 4DOWA 2EGCA 2IVWA 2QK0A 4R56A 1EFNA 4RG8A 3SWNA 1SHFA 2XK0A 1KC8R 1WGSA 3ZL7C 5IAYA 3V7RA 2J05A 1YITT 3CC2T 2K4YA 4HCBA 4HCKA 1D0XA 2HBWA 1EIFA 2OTJT 4J9CA 1MMGA 4KGZB 4A4EA 1QWEA 4PFZA 5I22A 3C0CA 4QW2A 5GMKl 2RPNA 3OYBA 1UHCA 1ZBJA 2YXYA 1I5OB 3QJYA 1VIEA 1KD1C 1OI1A 1SSHA 1WXUA 2M9UA 3QJ6A 3OYGA 5CO7A 4PFOA 3M53A 2IG0A 4N4GA 2EKHA 5CIUA 1LVKA 4MZTA 4FSXA 4B9XA 2XDPA 1G3WA 5A2QE 2CYZB 3QDFA 4RG2A 3VS1A 2DLPA 4PJJA 1YIJQ 6AT1B 1S1NA 2CS7A 5FLXE 1VQOT 2EGAA 2ZZDA 2CZ7B 1Q82C 4C8QE 4BE2A 2JVVA 3QZ9B 4PJLA 1UGSB 2O88A 5DLOA 3FRNA 3GBQA 1KQ2A 3OYDA 2C0TA 2QEXA 1NPRA 4J9IA 3L2VA 1VYUA 3I5RA 2FVUA 2HMAA 3I56A 4EDUA 1OPLA 2COYA 2E5QA 4IUVA 2EKOA 2DEUA 3OS0A 2LDMA 1SEMA 2E1HA 1RL2A 4MMLA 3H41A 5GAN4 2CUBA 2M51A 2COWA 2QQSA 1AWOA 2ROLA 2ABLA 1RAEB 1M3CA 2CZ6B 1KQ1A 2M0OA 1I4K1 2A3LA 3VS4A 2ZPGB 4IURA 5GAOn 1RI9A 2VVKA 3G6EQ 1E6HA 2EJFA 3VRYA 3OYLA 3ER0A 1WXTA 2F1LA 1M2VB 2O2OA 3E2UA 4J6WA 5CAIA 1BI0A 2D1XA 1M1KU 3M55A 4XU0A 4HT8A 2QEXQ 1WHKA 2ZPBB 1VQ4Q 4M75G 5KYXA 4C8QA 3I35A 3CXCP 2DYIA 2JMCA 4PNOA 1KQSS 5DLQE 1JJ2P 4UC4A 3CCLA 1WJQA 1D1CA 5CVIA 4M7AB 1YJNT 1PD1A 5KCHA 2K3BA 1CKAA 4BD3A 2RJFA 4M78E 3GOXA 4M7DG 1G3TA 2B86A 1M1KR 2M02A 4LDXA 2QI2A 3VUBA 3SFMA 3UF4A 5GMKe 4PK4A 2VB6A 5LJ5e 1U8RA 3A8MB 3MP8A 2PUKB 1W2BP 4CC7A 1YJ9A 1D1BA 4CC2A 1GFDA 1VQMT 2NUTB 3X26B 2WACA 4M4ZA 1ZA1B 3JCMV 1K73C 1T0JA 4OVAA 2OAUA 4J9FA 4C8QF 1AWWA 5CKDA 5KYUB 2ZGWA 1WHGA 3FEOA 2CSIA 3P8DA 2A08A 4DA4A 2YUNA 1P92A 3LWIA 3PIPA 2XU8A 1Y96A 1SKUB 1MHNA 5CQXA 4KRTA 4PJOG 3CCLQ 5C0MA 2QYZA 2DL3A 1V76A 4J9EA 2F5TX 1QCNA 1QCOA 1JU5C 3G7ZA 1VQ7A 4OB2B 3ASKA 2WSEE 5I11A 4ZGJB 1YHQQ 1OULA 5FRMA 3EFOA 3CCST 2BKDN 3X20B 1Y07A 5GAOl 2EQJA 2BZ8A 3OB9A 1UGRB 4C92E 3CCRT 3C94A 4C5GA 1YJ9Q 3OQ5A 4M78A 3J80E 2Y4XA 1Y7XA 4J5YA 3EGDB 3JCMg 1KC8C 2EYXA 3UA6A 3DB3A 2QDYB 2F2WA 1VQKT 2KT1A 4J9BA 2JTEA 4J6XA 4MDWA 4HVUA 4FYVB 2OAWA 3CCQT 3A8GB 4OB3B 2COZA 5D6XA 3NTIA 5IHIA 1M90C 1XQHA 1IREB 4Q5WA 4DBRA 1X27A 2O4XA 2YSQA 1YITA 3CC2A 3I55Q 4PKCC 3GNFB 3QIIA 2OTJA 4M78C 1TS9A 1VQ7Q 2LVMA 5GANd 5GAN7 1ZLMA 1ZX6A 4IUUA 2GNCA 2ZPHB 2PVDB 2MPXC 1VYVA 2BZXA 2PVGB 3V8LA 1WX6A 3CBPA 4M78F 1IHWA 4BUGA 2DL8A 3AT1B 4DBHA 5IN1A 1WXBA 2DXBA 3EAEA 2MCNA 2EAYA 1Y71A 4CI0C 4GBQA 1NYGA 2EQUA 5CKBA 1HYOA 3MEUA 2LJ0A 1PSEA 1OQKA 1RUWA 1UB4A 2DRKA 3LGFA 1K9MU 4C92A 4KT0E 2QAZA 2ESWA 3CCJA 1M2OA 3EGXA 1RLQC 2G6FX 1PSFA 5FWCA 4FYYB 1YITQ 2RD1A 1M9SA 3OY9A 4RTZA 2OTJQ 4IKFA 2RF0A 2L3QA 4M75B 4M77C 4JRKA 2E70A 1IB8A 1NM7A 2D0NA 2BUDA 3S3NA 2DPPB 4LDVA 2CP5A 1FMVA 2DX1A 1WDXA 1ZSZB 1MNEA 1K9MR 1X2KA 3X25B 4C92C 5IXFA 2CP0A 1OX8A 2K79A 2XDBA 4BY6B 1OU8A 3CPWP 1BI3A 1M3BA 3BY7A 3WVDB 3I56T 1AOJA 2LJ1A 2GTJA 2R5MA 2X4WA 1V29B 3P8BB 3N5BB 2RA2A 3PIOA 1C6VX 2BTTA 4GLMA 1JB0E 2L0AA 3NFCA 1VQOQ 1VQ9Q 1IHVA 2E3IA 3JB9I 1K4US 2KRSA 1QLYA 2C0OA 1C1AA 1YCYA 2LQWA 4JRIA 2NUPB 3JCMX 5GAOp 2K3XA 2VGMA 4XTYA 4C8QG 2FPEA 3EHQA 4QQ6A 3MJXA 3FJPA 1D1AA 1WPYA 4DBFA 1JEGA 2Y4YA 2JN0A 4HCCA 3OMCA 1JO8A 2E64A 3J81E 4BI4A 4D8DA 1K8AU 3M0PA 2P4TA 4KH0B 1VQLT 1AT1B 4NOYA 3X24B 5GAMh 3TQ7P 1M1KC 2EGEA 4RUGA 4FU6A 1YJNA 4HT9A 1PCXA 2P84A 2QGFB 4L5GA 5AT1B 4J83A 3REBB 4VUBA 1K0SA 1D3BA 4OMNA 3DLMA 1FWZA 1X2QA 2JW4A 2BE9B 4ZGDB 1K8AR 3INZA 2O9VA 1RADB 3QBYA 1YI2T 3SWNB 3SEMA 2WSFE 1N8RU 2LMJA 3JCMe 1X69A 1RAHB 4XK8E 3J7AF 2KI7A 5GJWB 1RAAB 4PJNA 3M0TA 3FDRA 2HQEA 3E9FA 2EQMA 4CC4B 1WLPB 2KMTA 1I1JA 3JSCA 4RTTA 4FM4B 1OU9A 3OYHA 4J6YA 3MEAA 2BIVA 2K7AA 2DZ9A 4OP0A 5HK0A 1RAFB 1YJNQ 3EG1A 3P8HA 3TSWA 2E6NA 2KEAA 3LGLA 2AK5A 1M1FA 3JB9D 4ZNXA 2FHDA 1N8RR 5GAN5 4ZTJA 2KDSA 2RJCA 3CCSA 2DBKA 3O8VA 2QA4T 4ZGEB 1VQNT 3OYFA 4A4FA 3QHSA 2ECZA 3CCRA 2M1HA 3LH5A 2XIDA 1VQMQ 3HFOA 2ENMA 5GAMj 1HSQA 2FZKB 2JTFA 3A98A 3M56A 2R58A 1IZ6A 3CBMA 2DD4A 1S72T 4E7IA 4D6WA 2YLCA 2LT1A 4XQ3A 4C5IA 2H3EB 2MOXA 3WVEB 5GAMf 4DEXA 3BFMA 3CCQA 1AZGB 3FJ5A 3EH1A 3CCUT 2QXFA 3VKIA 3CEYA 1GL5A 2DXTA 2K5IA 2RHUA 4KGVB 4M77D 4RCCA 5KYWA 3CC4A 1WHHA 2CT3A 4FT2A 3M57A 3KXTA 1TOVA 4A4KA 2RB6A 3JCMc 2HSEB 4A53A 2A0FB 5IT9E 3L42A 1RABB 4C92D 4WCIA 3M0UA 3CC7T 2J6FA 3CCSQ 5LJ3j 3GPLA 3OA6A 2F2VA 4X34A 2XKOC 2OX7A 3CCRQ 2J6KA 2EFIA 1AWJA 2KQWA 2J06A 3M58A 1I8FA 1VQKQ 1KHCA 2X4JA 1TXQA 1AD5A 4XTXA 3CCQQ 2VXEA 1JXOA 1KG1A 2CH4A 2FPFA 2DL5A 3CCMT 5KYXB 4C8QB 4FCYA 2ZAEA 2EQKA 1U06A 2OJ2A 2K3YA 1WIEA 2YDLA 1OEBA 1TUDA 1QP3A 3L2QA 2GTOA 2X3XD 2KROA 1UGVA 3PMIA 1X43A 1RAIB 3O5ZA 2OI3A 3H0FA 4J9HA 5D6YA 5ECAA 2V1QA 2X35A 2CSQA 1N5ZA 4XTUA 2CP6A 4J9GA 1PNJA 3RR6A 2FL7A 2W10A 2F69A 1U3OA 2YWWA 1BIAA 1XNIA 3L1AA 2KVQG 2GCXA 5I21A 4PLIA 3RBBB 3C4SA 3X28B 4E6RA 1MV3A 5LL6S 1ZA2B 3QDRB 1MV0B 2KAFA 1QW1A 2ZPEB 1NPPA 4ANJA 1FYNA 5GANg 3R6OA 4OGEA 1B3QA 4O5VA 2PTKA 4JRQA 1K76A 1WHMA 2FRWA 3TVTA 3EG9A 1Y96B 2HKQB 2EBPA 2RJDA 5GAN2 1K1ZA 1M8VA 2JS0A 3V8JA 3JAME 3NPFA 4LN2A 1VIFA 5DM7R 4EIKA 2JM9A 2HQXA 2FPDA 2X3WD 1VQLA 3HRTA 2RO0A 2DJZA 4JS4A 1Z9ZA 3EFOB 3TCJA 4R55A 1X6OA 3VS2A 1YBYA 3SHWA 3NHNA 2LX9A 1W2BA 3CCET 2FZCB 1TSFA 2AZVA 4HXJA 2XI9A 3I56Q 1K0XA 1IGQA 4BI8B 2R57A 3LW5E 5GMKm 5D6WA 2X4XA 4M78B 2RK2A 4XU2A 2HNIA 2E12A 2DIQA 3OBWA 1XJWB 3LX7A 1N9RA 3HHTB 3EGUA 4LNPA 2GF7A 4QVCA 1YFNA 2KYMA 1DJ7B 1YI2A 2PUOB 4M7DD 2RNAA 1WYXA 1T0HA 4IUPA 2LCCA 2O4XB 4Z88A 4LDUA 2HBPA 2IIMA 2QQ9A 2AKLA 1OYXA 1G83A 4CC3A 3CBOA 4F16A 5HK3A 1LPLA 1E7OA 2K57A 1JBMA 1YNZA 4AFZC 1VQLQ 3KFVA 3UATA 1RLPC 2DZCA 4KH1B 2K9GA 5FW9A 1VQPT 1TUCA 4FIBA 3VJPA 2VV5A 3RUXA 1WHLA 1E6GA 1QVFA 3RMSA 2WSCE 1KQSP 4OMOA 4E7KA 1NEGA 4PJOD 1QVFS 2VC8A 4P5NA 3QPHA 1N27A 2QA4A 4KUDK 1KFZA 1VQNA 4JS5A 1WA7A 2FYKA 3CCVA 4C92B 5KYYA 4M77E 3QO3A 1YI2Q 3BDLA 2JMAA 4RMOA 4MDXA 3EGXB 4AFSC 3PTAA 1WQ7A 2DD5A 1VQ5T 2W0ZA 2KRNA 4C0DC 1S72A 1PC0A 1MMNA 1IXDA 1QP2A 1IGUA 4EMHA 2RHYA 1GCPA 2Z0WA 3DKMA 8ATCB 2DTIA 3CCUA 2QQBA 3A8OB 2MYSA 8AT1B 4JJNK 5CKHA 4RTYA 4JUVA 2XG8D 1GXIE 1QVGA 2G3RA 1ZHIA 1QVGS 4DOVA 3JCMQ 4N4IA 4A4HA 2V8KA 3RKYA 1FMKA 1VUBA 1X6BA 2E65A 1PRLC 2DYBA 1NJIR 4EMKA 1WI7A 3G4ST 4BB7A 3CC4T 3CC7A 1Y0MA 1R77A 1VQ8T 4XAXB 4A54A 5IH2A 1VQNQ 4X9DA 5HKCA 2FEIA 1T3LA 2VGNA 2MAMA 2DTHA 1F1BB 5HY6A 1AEYA 5GAMd 1ABOA 3M4GA 4OMQA 4MZPA 2JOYA 3EG0A 4BACA 1YIJT 5LJ5h 3BE3A 2RI2A 2L8DA 5L23A 1SRMA 2D6FA 1MUZA 4M77A 3RDVA 4LDWA 2OTLT 5J39A 1W6XA 3JB9F 4EMKC 3CCUQ 2ZPIB 1ZQ1A 5GANe 2A37A 5I2MA 3CCMA 4M7AC 3ME9A 1VOMA 2LZ6B 3U23A 2DRMA 1KIKA 1PG5B 3UA7A 1WNLA 2O31A 3CMET 4JZ3A 3M9QA 5GAN3 4CRIA 4K11A 3OW2A 3CC2Q 3QYGB 4B6MA 2RK1A 1OX9A 4HVWA 2I0NA 2VASA 2HCKA 1B07A 3OW2S 3HRSA 3MEWA 5LJ3d 2GQIA 3R6NA 1ZUUA 3OS2A 1D3BB 2LNHB 3VS7A 1I81A 1EX4A 3BW1A 5GAN8 3MP1A 1RAGB 1TWBA 2ZPFB 4HVVA 4M77F 5GAOm 2HSPA 2P0KA 3LLRA 3H0HA 1U5SA 1QCFA 3META 2RHXA 1SF9A 5KE2A 2XHCA 4ZN1A 4QVDA 4C92F 1ARKA 3M0QA 1UTIA 3CCMQ 4JLIA 1PM3A 1BCOA 4MMKA 3TSZA 2DVJA 3BDUA 2QG9B 1VQ4T 3OYEA 2LTOA 2EYYA 3H6ZA 4J7IA 3OYYA 4E7ZA 1SSFA 3CD6T 2AT1B 1Q82R 4KGXB 2HZYA 5A0DA 3M54A 4X1VA 2AHJB 2JTMA 2QDLA 4L59A 5GMKj 2VKNA 5LJ5j 2DA9A 2B8AA 4NL3A 1KHIA 2QGGA 2V8IA 3HP9A 2KYBA 3CCEA 5LJ5f 2CGHA 2RQUA
chains in the Genus database with same CATH topology
4M7AA 3OYLA 4FT2A 3ER0A 3S3OA 3M57A 2YRVA 1U1SA 4KULA 3KXTA 5KE3A 2R5AA 4A4KA 2RB6A 3MCAB 1B34A 3JCMc 4A53A 4J6WA 1LNXA 5CAIA 1BI0A 1M1KU 3VV0A 2RHIA 5IT9E 3L42A 3OYIA 3M55A 4C92D 4XU0A 4XTZA 4HT8A 3OYJA 2ZPBB 3CC7T 3E9GA 4M75G 4ZTFA 1BKBA 3M4YA 4C8QA 2GFUA 5GMKh 4FL6A 5LJ3j 3OA6A 3GPLA 4X34A 1XTDA 2XKOC 1ZBXA 3QYHB 3A8HB 1AHJB 3OMGA 4EPCA 4QQDA 5CR2A 3F70A 5GMKi 4PNOA 1KQSS 4GY5A 2RM4A 5DLQE 2EFIA 4KUIA 4UC4A 2MMPA 2KQWA 3CCLA 4N0AC 4OF1A 1WJQA 4NL2A 3HRUA 3M58A 2LQ8A 4GLKA 5CVIA 4M7AB 1YJNT 3FB9A 2H3JA 1I8FA 4XU3A 5KCHA 4OB1B 1KHCA 3V8KA 4E7JA 3FLGA 3MEVA 1WJSA 3UDCA 4BD3A 2RJFA 2X4JA 3V7SA 1KD1U 4M78E 3CPWA 3GOXA 4PJOE 1B34B 2PU9B 5GAMe 4M7DG 2MF2A 1G3TA 1QVGS 4OMFB 4XTXA 3CPFA 2VXEA 3OS1A 1G3SA 3CPWS 5M9OA 1M4ZA 2DXCA 1KG1A 4LDXA 4JLGA 2EJ9A 2GFAA 4M7AF 2QI2A 4Y28E 3VUBA 3SFMA 5J26A 4HCZA 5GMKe 4L6V5 5LJ3h 3CCMT 3HSBA 3VU3C 5LJ5e 4C8QB 3ZFJA 1X01A 3A8MB 1U8RA 2EQKA 4PLLA 2E10A 3MP8A 3NTKA 3ZEHA 2PUKB 1OZ3A 3A5ZB 3G71A 4PL6A 2K3YA 1YJ9A 4YTLA 2I2LA 1UGQB 3RMQA 1VQPA 1VQMT 3X26B 3L2UA 1QP3A 4ZN3A 1YHQT 3L2QA 2WACA 4XU1A 3OYMA 2A7YA 3PMIA 3JCMV 1K73C 1VQOA 5D6YA 4OVAA 2OAUA 4C8QF 1VQ9A 3OSSC 4F7UE 5CKDA 1Q82U 2ZGWA 3FEOA 1LJOA 5KCOA 4M7DA 2DXUA 2X35A 2KY9A 3P8DA 4IUQA 4A4GA 1YJWA 4XTUA 4DA4A 3CMAT 1P92A 4JRPA 2FL7A 3E19A 3LWIA 3PIPA 1O9SA 2F69A 1Y96A 2E6ZA 2XU8A 1BIAA 1MHNA 1XNIA 5CQXA 3G6ET 4LD9K 4M75C 4KBMB 4M78G 3C95A 1JRIA 3L1AA 4PJOG 5LJ3e 1VQ5A 3NTHA 3LWHA 3HPWA 5C0MA 2KVQG 2GCXA 1W4SA 2K2VA 5I21A 4PLIA 2F5TX 3EFSA 2YLBA 2XDDA 1OZ2A 2X4YA 1XOVA 1Q7YC 1N6AA 3RKWA 3CCVT 2KK4A 2YHTA 3C4SA 3FIFA 3G7ZA 3X28B 1Q86C 1VQ7A 2D0QB 5LL6S 4M7AD 3JB9G 4OB2B 3DB4A 3ASKA 3QDRB 3OYAA 2WSEE 2KAFA 1QW1A 2F5KA 3KBGA 4M75E 3UWNA 4ZGJB 2ZPEB 3A8LB 1RI0A 1NPPA 2L5QA 5FRMA 2QEXT 2NLUA 3R6OA 4XTVA 5GANg 3I55T 2BKDN 4OGEA 3CCST 3X20B 1Y07A 4M7DB 5GAOl 2MWOA 2K5FA 3UT1A 4M7DC 2EQJA 4O5VA 3OB9A 1UGRB 2VYTA 1WQWA 4NS5A 4JRQA 4C92E 5CKEA 2VUBA 2LC4A 3C94A 4C5GA 3CCRT 3OQ5A 4M78A 3J80E 2Y4XA 4ELZC 4PJOA 1Y96B 1Y7XA 4J5YA 4C8QD 1Q81C 3JCMg 3MHXA 1KC8C 3PGGA 2RJDA 3DB3A 3TEEA 5GAN2 4M7DF 2P0PA 2QDYB 3G4SA 1M8VA 3V8JA 1VQKT 3JAME 1VQ8A 1X75C 1VIFA 5DM7R 4RCBA 4J6XA 4MDWA 2HQXA 4C5EA 3CCQT 3A8GB 2VXFA 4II1A 4OB3B 5D6XA 3HRTA 3NTIA 3WXMB 1M1GA 5AYFA 3C12A 3T9NA 4EMGA 2RO0A 2DJZA 5KH6A 1M90C 4QQGA 1XQHA 4JS4A 1IREB 4Q5WA 3TCJA 4R55A 1X6OA 1G5VA 1YBYA 2O4XA 4M77G 2LX9A 1YITA 1W2BA 3CC2A 3CCET 4Y91A 1H641 3OYCA 2ZCFB 2XI9A 4F7UA 5GANh 4PKCC 3GNFB 2XICA 4BI8B 2KSSA 2R57A 3LW5E 3M59A 2RHZA 3URGA 5GMKm 5D6WA 1YIJA 2X4XA 3QIIA 4M78B 5L8RE 4PJOB 2OTJA 2RK2A 3H8ZA 4M78C 2LVMA 4PJOC 4XU2A 4B9WA 5GANd 1QVPA 3DLLA 5GAN7 4BE1A 4IUUA 2HNIA 4OGCA 2E12A 5LJ3f 2ZPHB 2OTLA 2DIQA 4C92G 2DTOA 3OBWA 4XTWA 3LX7A 3M5AA 2PVDB 5CKFA 1N9RA 3JCMh 3HHTB 3VUZA 4BI3A 2MI6A 2PVGB 2HAXA 3V8LA 2GF7A 4QVCA 3CBPA 1FX7A 4M78F 4PJOF 3JCMd 4BUGA 5EG2A 1DJ7B 1YI2A 1MGQA 3JRZA 5IN1A 2PUOB 4N4HA 4M7DD 2DXBA 3EAEA 4RKUE 3LH0A 1G3YA 2EAYA 5I2SA 4M75A 1Y71A 4CI0C 4IUPA 3CCLT 3CMEA 2LCCA 2O4XB 2PQWA 3GIBA 2EQUA 5CKBA 4LDUA 3GNGA 2HBPA 5FU6B 3MEUA 4WF2A 4F7UB 3QSUA 3PT9A 2QQ9A 1BYMA 5FU6C 2JZ2A 5A0LA 1OYXA 1PSEA 1UEBA 4C0GA 4TVRA 3CBOA 2E41A 3QZ5B 1BI2A 1K9MC 1UB4A 1K9MU 3LGFA 1NZ9A 4C92A 5HK3A 3JB9H 4KT0E 1VQMA 2K57A 2DVEA 3Q1JA 4J8OA 3SWNC 3JCMJ 3AHUA 3ZBDA 5LJ5f 1JBMA 3CCJA 2MWPA 1K73U 4E7HA 4HA8A 4F7UF 1PSFA 1VQ6A 5FROA 3HL8A 4ATOA 2DKGA 2DZCA 3SD4A 2EJGA 5DY9A 2RD1A 3PNWC 1YJ9T 4V2SA 1M9SA 1I5LA 1VQPT 2O01E 3L2RA 3OY9A 4FIBA 4HKEA 3VJPA 4IKFA 2VV5A 2CZ0B 4M75B 4M77C 3RUXA 4JRKA 3EFRA 1QVFA 3G6EA 2LNVA 3RMSA 2E70A 2WSCE 2QQAA 4E7KA 2BUDA 4M78D 3HFNA 2FB7A 3PFSA 3S3NA 4PJOD 1VQ9T 1QVFS 2VC8A 4P5NA 2QQRA 2DPPB 3QPHA 4C0ZA 1N9SA 4BDZA 1N27A 2D9TA 2QA4A 4KUDK 2Y90A 4LDVA 1Q7YU 3UPUA 3MP6A 4JS5A 1VQNA 3VYHB 2FYKA 1Q86U 3CCVA 1YJWT 4C92B 4BDYA 4Z02A 4M75F 4M77E 3X25B 4C92C 3QO3A 2JNGA 3BDLA 5GAOq 5FRNA 5CQYA 4RMOA 4MDXA 3PTAA 4FT4A 2XDBA 4BY6B 2HD0A 1NJIC 1WQ7A 2RH2A 2DD5A 4BY6C 3CXCA 4C0DB 2EYQA 1VQ5T 1BI3A 1VQ4A 3BY7A 5GAN6 3WVDB 4C0DC 2DO3A 3S6WA 3I56T 1UGPB 3CD6A 2PVOB 1S72A 3CXCS 2R5MA 1NE8A 4OB0B 2X4WA 3LYIA 3CCSA 1HK9A 1V29B 5GANj 1JJ2A 2RJEA 3P8BB 3RIRA 1VQ7T 1QP2A 5GAMg 3JB9J 3N5BB 4M7AG 4EMHA 2RHYA 3DKMA 2RA2A 3QUIA 5J3BA 1JJ2S 1Q81U 3PIOA 2EWNA 4ME7A 2C06A 1R8OB 2DTIA 3OS5A 1KC8U 3CCUA 3HKSA 1JB0E 2QQBA 4E7LA 2JUFA 3GF5A 3A8OB 5GANf 4J7FA 3NFCA 1BI1A 4JJNK 5CKHA 3SDZA 2DAQA 2XG8D 4JUVA 5LJ5g 1GXIE 1VQKA 1QVGA 3JB9I 2G3RA 1ZHIA 2LCLA 3OYKA 2L3RA 4DOVA 1YCYA 4C0FA 4JRIA 3JCMQ 1FXXA 3QG1A 4N4IA 3JCMX 5GAOp 2K3XA 2VGMA 4A4HA 2V8KA 4XTYA 3JCMf 4C8QG 3FC3A 4E47A 3RKYA 1VUBA 2E65A 3KUFA 4QQ6A 4DQ2A 1M90U 2P0QA 3QXEB 5FU7B 4EMKA 2XD0A 3FJPA 3G4ST 1WPYA 5FU7C 3CCJT 2Y4YA 2JN0A 4BB7A 3CC4T 3CC7A 2LT4A 3JCMb 3OMCA 4HCCA 2E64A 4M75D 2DK3A 4X9CA 3J81E 1W2BS 1VQ8T 2GQVA 4BI4A 4XAXB 4A54A 1K8AC 2CZ1B 1K8AU 3MO8A 2P4TA 4DOWA 4X9DA 2IVWA 4R56A 5HKCA 1VQLT 4RG8A 3SWNA 3GP8A 2XK0A 4NOYA 3OYNA 3X24B 5GAMh 1M1KC 1WGSA 2VGNA 4C5HA 5IAYA 3V7RA 2MAMA 2M16A 5LJ3g 2DTHA 5HY6A 1YITT 3CC2T 3SB2A 4FU6A 1YJNA 1TH7A 5GAMd 2K4YA 4HCBA 3M4GA 4HT9A 4M7DE 4MZPA 4O6JA 2JOYA 4BACA 1YIJT 4L5GA 5LJ5h 2RI2A 3L2WA 1EIFA 1KQSA 2L8DA 2OTJT 2D6FA 4M77A 4J83A 5GAOr 4LDWA 4VUBA 5J39A 5LJ5d 2OTLT 4A4EA 3RESA 4EMKB 2K5LA 1D3BA 4LD6A 3JB9F 4EMKC 3DLMA 5CK9A 2ZPIB 1ZQ1A 3RERA 5GANe 1FWZA 4QW2A 1HXDA 2RI5A 1M5Q1 5I2MA 5GMKl 3OYBA 1H3ZA 3CCMA 4M7AC 3ME9A 4ZGDB 3QJYA 1VIEA 3INZA 1KD1C 3QBYA 1YI2T 3SWNB 3OBYA 1OI1A 2M9UA 2WSFE 3QJ6A 1N8RC 3PMTA 1YHQA 1N8RU 1WNLA 3JCMe 3OYGA 5CO7A 4XK8E 1VQLA 3J7AF 1O75A 3CMET 3M53A 2IG0A 4QVZA 4N4GA 3M9QA 5CCAA 3FDRA 4CRIA 5GAN3 4M7AE 5CIUA 3OW2A 2HQEA 3QYGB 2RK1A 4FSXA 4MZTA 4B9XA 2XDPA 3G71T 1G3WA 3E9FA 5A2QE 4C8QC 3JCMW 2CYZB 2EQMA 3OW2S 5C6SA 4IUTA 4RG2A 3HRSA 3MEWA 2KMTA 5LJ3d 4M77B 3CMAA 2CS7A 5FLXE 3JSCA 3OS2A 1D3BB 2RI3A 4FM4B 1VQOT 3OYHA 4J6YA 2ZZDA 1I81A 3MEAA 2BIVA 2CZ7B 2DZ9A 2LQKA 4MZMA 1VQ6T 4OP0A 2DIGA 5HK0A 3V7CA 1Q82C 4C8QE 3BW1A 5GAN8 1U1TA 3P8HA 4BE2A 2E6NA 2JVVA 3MP1A 3QZ9B 3LGLA 2ZPFB 4M77F 1UGSB 3GLXA 5GAOm 3QKJA 1M1FA 4ELYC 5DLOA 3JB9D 2P0KA 3LLRA 2FHDA 3FRNA 5GAN5 1KQ2A 3OYDA 1NJIU 4ZTJA 2QEXA 2KDSA 2V8JA 2RHXA 3META 1NPRA 2RJCA 3I55A 5KE2A 2XHCA 2EIFA 3O8VA 4JDSA 4ZN1A 3L2VA 4QVDA 2FVUA 3I56A 4EDUA 2QTXA 4C92F 2QA4T 2CKKA 4ZGEB 1VQNT 4IUVA 2E5QA 3OYFA 4A4FA 4JLIA 2EKOA 3QHSA 3CCRA 3OS0A 2LDMA 3RKXA 2M1HA 4BE0A 4MMKA 2XIDA 5A0GA 2E1HA 1RL2A 4MMLA 1LOJA 3S3MA 3HFOA 5GAN4 3BDUA 5GAMj 4LDYA 3L2ZA 2DEQA 2JTFA 3M56A 3OYEA 2LTOA 2QQSA 2R58A 1IZ6A 1VQ4T 3CBMA 3H6ZA 4J7IA 3OYYA 2DD4A 1SSFA 3CD6T 1S72T 4E7IA 2LRQA 4D6WA 2YLCA 2LT1A 2CZ6B 3M54A 4XQ3A 4C5IA 5A0DA 3E1SA 1KQ1A 2AHJB 2JTMA 3OSVA 2L89A 3WVEB 4L59A 5GAMf 2M0OA 1I4K1 3BFMA 5GMKj 3TU4K 2A3LA 5LJ5j 2B8AA 3CCQA 4F7UG 2ZPGB 4IURA 5GAOn 4NL3A 1KHIA 3JCMP 3CCUT 2QXFA 2V8IA 3CEYA 3HP9A 2DXTA 4N0AA 3TREA 3VKIA 1WJRA 2K5IA 2EJFA 2RHUA 4M77D 4RCCA 1BIBA 3VYGA 3CCEA 2CGHA 3CC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYL A;  3ER0 A;  3S3O A;  2YRV A;  5KE3 A;  2R5A A;  1M1K U;  2RHI A;  5IT9 E;  3L42 A;  3OYI A;  3OYJ A;  3CC7 T;  3E9G A;  4ZTF A;  1BKB A;  2GFU A;  4FL6 A;  3OA6 A;  4X34 A;  1XTD A;  3OMG A;  4QQD A;  3F70 A;  1KQS S;  5DLQ E;  4GY5 A;  2EFI A;  4UC4 A;  3CCL A;  1WJQ A;  2LQ8 A;  1YJN T;  5KCH A;  1KHC A;  4E7J A;  3FLG A;  3MEV A;  1WJS A;  4BD3 A;  1KD1 U;  2RJF A;  3CPW A;  3GOX A;  3CPF A;  3OS1 A;  3CPW S;  5M9O A;  2GFA A;  5J26 A;  4HCZ A;  3CCM T;  2EQK A;  4PLL A;  3MP8 A;  3ZEH A;  3NTK A;  3G71 A;  3A5Z B;  1OZ3 A;  1YJ9 A;  2K3Y A;  4PL6 A;  4YTL A;  1VQP A;  1VQM T;  3L2U A;  4ZN3 A;  1YHQ T;  3L2Q A;  2WAC A;  3OYM A;  3PMI A;  1K73 C;  1VQO A;  5D6Y A;  4OVA A;  1VQ9 A;  1Q82 U;  3FEO A;  5KCO A;  2X35 A;  3P8D A;  4IUQ A;  4A4G A;  1YJW A;  3CMA T;  3PIP A;  3G6E T;  2E6Z A;  1XNI A;  1MHN A;  1VQ5 A;  3NTH A;  5C0M A;  2KVQ G;  4PLI A;  1OZ2 A;  2X4Y A;  1Q7Y C;  3CCV T;  3C4S A;  1Q86 C;  1VQ7 A;  5LL6 S;  3DB4 A;  3ASK A;  3OYA A;  3UWN A;  2F5K A;  3KBG A;  1RI0 A;  1NPP A;  5FRM A;  2QEX T;  2NLU A;  3CCS T;  3I55 T;  2BKD N;  2MWO A;  3UT1 A;  2EQJ A;  3OB9 A;  2VYT A;  4NS5 A;  3CCR T;  4C5G A;  3OQ5 A;  3J80 E;  1Q81 C;  1KC8 C;  2RJD A;  3DB3 A;  3G4S A;  1VQK T;  3JAM E;  1VQ8 A;  5DM7 R;  2HQX A;  4C5E A;  3CCQ T;  4II1 A;  1VQL A;  3NTI A;  5D6X A;  1M1G A;  5KH6 A;  2RO0 A;  1M90 C;  4QQG A;  4Q5W A;  1X6O A;  1G5V A;  1YBY A;  1W2B A;  3CCE T;  2O4X A;  1YIT A;  3CC2 A;  3OYC A;  2R57 A;  1YIJ A;  2RHZ A;  5D6W A;  2X4X A;  3QII A;  2OTJ A;  3H8Z A;  2LVM A;  4B9W A;  3DLL A;  4BE1 A;  4IUU A;  2OTL A;  2DIQ A;  3LX7 A;  2MI6 A;  2GF7 A;  1YI2 A;  5IN1 A;  4N4H A;  3EAE A;  3LH0 A;  3CCL T;  4IUP A;  3CME A;  2LCC A;  2O4X B;  2PQW A;  2EQU A;  3MEU A;  2JZ2 A;  1UEB A;  1OYX A;  4TVR A;  1K9M C;  1K9M U;  3LGF A;  1NZ9 A;  1VQM A;  3Q1J A;  2MWP A;  1K73 U;  4E7H A;  1VQ6 A;  5FRO A;  3SD4 A;  3PNW C;  1YJ9 T;  1VQP T;  3L2R A;  3OY9 A;  4IKF A;  1QVF A;  3G6E A;  2E70 A;  4E7K A;  2BUD A;  3PFS A;  3S3N A;  1VQ9 T;  1QVF S;  2QQR A;  4BDZ A;  1N27 A;  2D9T A;  2QA4 A;  1Q7Y U;  1VQN A;  3MP6 A;  1Q86 U;  3CCV A;  1YJW T;  4BDY A;  4Z02 A;  2JNG A;  3BDL A;  5FRN A;  1NJI C;  1VQ5 T;  3CXC A;  1VQ4 A;  2DO3 A;  3S6W A;  3I56 T;  3CD6 A;  1S72 A;  3CXC S;  2R5M A;  2X4W A;  1JJ2 A;  3LYI A;  3P8B B;  2RJE A;  1VQ7 T;  2RHY A;  5J3B A;  1JJ2 S;  1Q81 U;  3PIO A;  1KC8 U;  3CCU A;  3HKS A;  4E7L A;  2JUF A;  2DAQ A;  1VQK A;  1QVG A;  2G3R A;  2LCL A;  3OYK A;  2L3R A;  1QVG S;  4N4I A;  2K3X A;  4A4H A;  3FC3 A;  3KUF A;  1M90 U;  4QQ6 A;  3G4S T;  3CCJ T;  3CC4 T;  3CC7 A;  3OMC A;  3J81 E;  1W2B S;  1VQ8 T;  1K8A C;  1K8A U;  3MO8 A;  1VQL T;  2XK0 A;  3OYN A;  1M1K C;  1WGS A;  5IAY A;  4C5H A;  2M16 A;  5HY6 A;  1YIT T;  3CC2 T;  4FU6 A;  1YJN A;  2JOY A;  4BAC A;  1YIJ T;  2RI2 A;  3L2W A;  1EIF A;  1KQS A;  2OTJ T;  2L8D A;  2OTL T;  5J39 A;  4A4E A;  4LD6 A;  3DLM A;  4QW2 A;  2RI5 A;  3OYB A;  1H3Z A;  3CCM A;  3ME9 A;  1KD1 C;  3QBY A;  1YI2 T;  1OI1 A;  3QJ6 A;  1N8R C;  1N8R U;  1YHQ A;  3PMT A;  3OYG A;  3J7A F;  3CME T;  2IG0 A;  4QVZ A;  4N4G A;  3M9Q A;  3FDR A;  4CRI A;  5CIU A;  3OW2 A;  2HQE A;  4B9X A;  2XDP A;  3G71 T;  5A2Q E;  3E9F A;  3OW2 S;  2EQM A;  5C6S A;  4IUT A;  4RG2 A;  3MEW A;  3CMA A;  5FLX E;  3OS2 A;  2RI3 A;  1VQO T;  3OYH A;  1VQ6 T;  3MEA A;  2BIV A;  2DIG A;  1Q82 C;  3P8H A;  4BE2 A;  2E6N A;  2JVV A;  3MP1 A;  3LGL A;  3QKJ A;  2P0K A;  3LLR A;  2FHD A;  3OYD A;  1NJI U;  4ZTJ A;  2QEX A;  2KDS A;  2RHX A;  3MET A;  1NPR A;  3I55 A;  3CCS A;  2RJC A;  2XHC A;  2EIF A;  3O8V A;  5KE2 A;  4ZN1 A;  3L2V A;  3I56 A;  4EDU A;  2QA4 T;  2CKK A;  1VQN T;  4IUV A;  2E5Q A;  3OYF A;  4A4F A;  2EKO A;  3CCR A;  3OS0 A;  2LDM A;  2M1H A;  4BE0 A;  1RL2 A;  3S3M A;  2JTF A;  1VQ4 T;  3OYE A;  2LTO A;  2QQS A;  2R58 A;  1IZ6 A;  3H6Z A;  3OYY A;  1SSF A;  3CD6 T;  1S72 T;  4E7I A;  2LRQ A;  4C5I A;  2L89 A;  4L59 A;  2M0O A;  3CCQ A;  2B8A A;  4IUR A;  1KHI A;  3CCU T;  3CEY A;  3TRE A;  3CCE A;  1WJR A;  2RHU A;  3CCJ A;  3CC4 A; 
#chains in the Genus database with same CATH topology
 1R0B G;  1D09 B;  3S3O A;  2X51 A;  1U1S A;  5KE3 A;  2R5A A;  3MCA B;  1B34 A;  2V26 A;  3E9G A;  4ZTF A;  4FSS A;  2V1R A;  4FL6 A;  1I0C A;  1ZBX A;  3QYH B;  1AHJ B;  3CQT A;  4QQD A;  5GMK i;  4GY5 A;  2VWF A;  4KUI A;  5KYW B;  4OF1 A;  4NL2 A;  3HRU A;  3H9N A;  2DMO A;  3V8K A;  3UDC A;  2DER A;  1WJS A;  2O9S A;  3EG3 A;  1GBQ A;  4PJO E;  2MF2 A;  5D7U A;  4JJC A;  3G1J A;  3OS1 A;  4E7S A;  2DXC A;  2DL4 A;  2GFA A;  4Y28 E;  5J26 A;  2HEQ A;  1JQQ A;  2CP2 A;  4HCZ A;  4PJM A;  4L6V 5;  5LJ3 h;  3CCE Q;  5FWB A;  2E10 A;  3ZEH A;  3G71 A;  2IPO B;  2I2L A;  3RMQ A;  2J6O A;  2YUO A;  2FO0 A;  1VQP A;  1CKB A;  1YHQ T;  1B7T A;  2A7Y A;  4J9D A;  4JJB A;  2EQI A;  4F7U E;  2DIL A;  1LJO A;  1BCM A;  4M7D A;  2KY9 A;  2L2P A;  4A4G A;  1PHT A;  4LE9 A;  2CDT A;  3CMA T;  3NMZ C;  1MMD A;  4LD9 K;  4M75 C;  4M78 G;  1VQ5 A;  3HPW A;  2K2V A;  1SHG A;  1OZ2 A;  1XOV A;  2RQW A;  1N6A A;  3RKW A;  3CCV T;  2KK4 A;  3FIF A;  4OMP A;  2FG0 A;  1TTH B;  4M7A D;  3JB9 G;  3DB4 A;  2LP5 A;  3OYA A;  1ZSZ C;  2KXD A;  3UWN A;  3KBG A;  2NYS A;  3A8L B;  1RI0 A;  1IO6 A;  2L5Q A;  1K73 R;  2NLU A;  3I55 T;  2RN8 A;  2K5F A;  4F17 A;  4M7D C;  4OMM A;  5CKE A;  1VQP Q;  2XMF A;  4PJO A;  1WHJ A;  3MHX A;  3TEE A;  4M7D F;  3G4S A;  2QAS A;  4RTX A;  1D0Z A;  1UHF A;  2D8H A;  2K2M A;  2BE7 D;  1VQ8 A;  2E4H A;  4RCB A;  2QTV A;  4C5E A;  1MMA A;  4II1 A;  2VXF A;  3WXM B;  4EMG A;  1M1G A;  5KH6 A;  2RQT A;  3QWY A;  4M77 G;  1VQ5 Q;  4Y91 A;  1H64 1;  3OYC A;  2ZCF B;  4F7U A;  2XIC A;  2KSS A;  3M59 A;  2RHZ A;  1YIJ A;  5L8R E;  3EG9 B;  4PJO C;  2P4R A;  4OGC A;  5LJ3 f;  2OTL A;  3NGP A;  4C92 G;  1SRL A;  4XTW A;  3M5A A;  2DL7 A;  3JCM h;  2K6D A;  4BI3 A;  2DE0 X;  2LCS A;  1M27 C;  1FX7 A;  4PJO F;  2LX7 A;  3JRZ A;  2SRC A;  4RKU E;  3LH0 A;  1G3Y A;  5I2S A;  1M90 R;  1A0N B;  3CME A;  2A36 A;  2PQW A;  2CH4 W;  4R0K A;  2DET A;  3GIB A;  1UUE A;  3G4S Q;  1GCQ A;  4WF2 A;  3QSU A;  1Q95 G;  3CC4 Q;  5FU6 C;  3VS3 A;  5A0L A;  1UEB A;  4C0G A;  1VQ8 Q;  3QZ5 B;  1K9M C;  3JCM J;  2DVE A;  3SWN C;  1ZSG A;  3AHU A;  2KGT A;  4LXC A;  4HA8 A;  4F7U F;  3HL8 A;  4ATO A;  1M30 A;  2EJG A;  5DY9 A;  4V2S A;  2O01 E;  1H92 A;  4HKE A;  1RAC B;  1R0C B;  1QKW A;  2CZ0 B;  3EFR A;  3G6E A;  2FRY A;  2OTL Q;  2CUD A;  2FB7 A;  1VYT A;  1VQ9 T;  1BB9 A;  2KR3 A;  2QQR A;  1GCQ C;  4C0Z A;  1N9S A;  4BDZ A;  2D9T A;  1YWP A;  1Q7Y U;  3UPU A;  3MP6 A;  2KXC A;  1Q86 U;  1YJW T;  3PVL A;  1KJW A;  4BDY A;  4Z02 A;  2JNG A;  5GAO q;  5FRN A;  4FT4 A;  3MPU B;  2RH2 A;  1VA7 A;  3CXC A;  4C0D B;  3CME Q;  1VQ4 A;  2DO3 A;  1SG5 A;  3I9Q A;  3CD6 A;  2PVO B;  2KBT A;  3CXC S;  1NE8 A;  1Z9Q A;  1LCK A;  4OB0 B;  1JJ2 A;  5GAM g;  3JB9 J;  4ORZ A;  5J3B A;  1JJ2 S;  1BU1 A;  1Q81 U;  4ME7 A;  2EWN A;  1W1F A;  2YUQ A;  4E7L A;  2JUF A;  3GF5 A;  5IHN A;  3VRZ A;  2E3H A;  3SDZ A;  2DAQ A;  4JPB W;  2F2X A;  1Q7Y R;  3H0I A;  2LCL A;  1Q86 R;  5HCK A;  5KYY B;  4C0F A;  7AT1 B;  1G8X A;  4JZ4 A;  2CT4 A;  3JCM f;  3FC3 A;  4AFU C;  2P0Q A;  3QXE B;  2XD0 A;  5FU7 C;  3CCJ T;  2LT4 A;  3JCM b;  4M75 D;  4AMC A;  2DJQ A;  1W2B S;  4Z8A A;  2GQV A;  1K8A C;  2CZ1 B;  1ZUK A;  1TG0 A;  1Q81 R;  3GP8 A;  1I07 A;  4RTV A;  3OYN A;  2DM1 A;  1NG2 A;  1GBR A;  2L3S A;  4C5H A;  5LJ3 g;  2M0Y A;  2M16 A;  3SB2 A;  1TH7 A;  1QWF A;  4M7D E;  3CD6 Q;  4O6J A;  2PNI A;  3L2W A;  1KQS A;  5GAO r;  5LJ5 d;  3RES A;  4EMK B;  3I5S A;  2K5L A;  2E5K A;  4LD6 A;  5CK9 A;  3RER A;  1HXD A;  2RI5 A;  1M5Q 1;  1H3Z A;  1M3A A;  2KNB B;  2NWM A;  2CRE A;  4ESR A;  3OBY A;  2MIO A;  1N8R C;  3PMT A;  1YHQ A;  2JS2 A;  1O75 A;  4QVZ A;  5CCA A;  4M7A E;  2GBQ A;  3G71 T;  4C8Q C;  3JCM W;  5C6S A;  2X9H A;  4IUT A;  4F14 A;  1FMW A;  4M77 B;  3CMA A;  1T3S A;  2ROT A;  1UE9 A;  2RI3 A;  4MZM A;  1VQ6 T;  2JJ9 A;  2KRM A;  2LQK A;  2DIG A;  3V7C A;  1U1T A;  3GLX A;  1UG1 A;  3QKJ A;  4ELY C;  1WZO A;  3HTR A;  1NJI U;  1TUG B;  2V8J A;  3IQL A;  3EHR A;  2L3P A;  3I55 A;  2EIF A;  4JDS A;  4LUD A;  2RQR A;  2QTX A;  2CKK A;  4D8K A;  3RKX A;  4BE0 A;  1M2V A;  5A0G A;  4F04 B;  3S3M A;  1LOJ A;  1W70 A;  4LDY A;  3L2Z A;  2DEQ A;  1D0Y A;  2LRQ A;  2DF6 A;  3E1S A;  2YT6 A;  3OSV A;  4DBQ A;  2L89 A;  4LUE A;  3TU4 K;  4F7U G;  1H3H A;  3CMA Q;  4AT1 B;  3JCM P;  1TU0 B;  4N0A A;  3ZBD A;  3TRE A;  1WJR A;  3VYG A;  2MK5 A;  1BIB A;  1QVF P;  4M7A A;  2HKN A;  2QA4 Q;  2AZS A;  2YRV A;  4KUL A;  3CCV Q;  2DBM A;  2CP7 A;  4Z89 A;  1LNX A;  4Y92 A;  4FYX B;  1JXM A;  3VV0 A;  2RHI A;  3OYI A;  4XTZ A;  2AIR B;  3OYJ A;  2ED0 A;  2FZG B;  1BKB A;  3M4Y A;  5GMK h;  2GFU A;  1S72 Q;  2NUZ A;  2ATC B;  1XTD A;  3A8H B;  3OMG A;  4EPC A;  5CR2 A;  3F70 A;  3PE0 A;  2NUT A;  2RM4 A;  1PRM C;  2MMP A;  4N0A C;  4QKU A;  3THK A;  2LQ8 A;  4GLK A;  5GJV B;  1HJD A;  3FB9 A;  2H3J A;  4XU3 A;  5KYU A;  4OB1 B;  3VS6 A;  4E7J A;  2HL5 C;  2D8J A;  3FLG A;  3MEV A;  1AVZ C;  2RQV A;  1KD1 U;  3V7S A;  3CPW A;  1B34 B;  2PU9 B;  5GAM e;  1QVG P;  4OMF B;  3CPF A;  1G3S A;  3CPW S;  5M9O A;  1BBZ A;  1M4Z A;  4JLG A;  2EJ9 A;  4M7A F;  1CSK A;  3HSB A;  3VU3 C;  3CC7 Q;  3ZFJ A;  1X01 A;  1KK7 A;  4PLL A;  3NTK A;  1OZ3 A;  3A5Z B;  4PL6 A;  4YTL A;  1UGQ B;  2SEM A;  1GRI A;  3L2U A;  1V1C A;  4ZN3 A;  1KSW A;  4XU1 A;  1OPK A;  3OYM A;  3VS0 A;  1VQO A;  1EZZ B;  1GFC A;  1VQ9 A;  3OSS C;  1Q82 U;  2LQN A;  5KCO A;  1HD3 A;  2DXU A;  2HQH A;  4IUQ A;  1YJW A;  1KD1 R;  3QWX X;  1PWT A;  4E2F B;  2PZ1 A;  4JRP A;  5IXB A;  3E19 A;  1O9S A;  3G6E T;  2E6Z A;  3ULR B;  2DFU A;  3EGD A;  4RTW A;  4KBM B;  3C95 A;  1JRI A;  5LJ3 e;  3NTH A;  3LWH A;  1W4S A;  4PFP A;  2JXB A;  1MND A;  4IIM A;  3EFS A;  2YLB A;  1UFF A;  2X4Y A;  2XDD A;  1Q7Y C;  2EYZ A;  2YHT A;  1Q86 C;  2DNU A;  4JJD A;  2D0Q B;  1QKX A;  5EC7 A;  2F5K A;  4M75 E;  2QEX T;  2H8H A;  4XTV A;  4M7D B;  2YUP A;  2MWO A;  3UT1 A;  1OOT A;  2VYT A;  9ATC B;  1WQW A;  4NS5 A;  2VUB A;  2LC4 A;  2HDA A;  3OW2 P;  1BK2 A;  4ELZ C;  4C8Q D;  1Q81 C;  3PGG A;  3VS5 A;  2P0P A;  1X75 C;  1UJ0 A;  1UJY A;  1NEB A;  1YJW Q;  2HL3 A;  2A28 A;  3T9N A;  5AYF A;  3C12 A;  4QQG A;  1G5V A;  2YRD A;  4RTU A;  2EYW A;  3M0R A;  5GAN h;  1AWX A;  3URG A;  1WFW A;  4PJO B;  3H8Z A;  4B9W A;  1SPK A;  2ED1 A;  1QVP A;  3DLL A;  4BE1 A;  4AG2 C;  2DTO A;  5CKF A;  3VUZ A;  2MI6 A;  2JM8 A;  2HAX A;  1YWO A;  2CP3 A;  2YRC A;  3JCM d;  3EH2 A;  5EG2 A;  1MGQ A;  4N4H A;  4M75 A;  3CCL T;  1OV3 A;  1H8K A;  3MKD A;  3GNG A;  5FU6 B;  4F7U B;  1BYM A;  3CCJ Q;  3PT9 A;  2EW3 A;  1NLP C;  2JZ2 A;  4TVR A;  2E41 A;  1BI2 A;  1G2B A;  1NZ9 A;  4DEY A;  1NLO C;  3JB9 H;  1ZSZ A;  2EPD A;  2BZY A;  3A1P A;  1VQM A;  4J8O A;  3Q1J A;  1M8M A;  2MWP A;  1K73 U;  4FYW B;  4E7H A;  1ACM B;  1VQ6 A;  5FRO A;  4OML A;  1J3T A;  1PKS A;  1UEC A;  2DKG A;  3SD4 A;  4A63 B;  4AFQ C;  1YN8 A;  3PNW C;  1YJ9 T;  1I5L A;  3L2R A;  4IIO A;  5IHK A;  2LNV A;  1ABQ A;  2QQA A;  4M78 D;  3HFN A;  3PFS A;  2KE9 A;  1PD0 A;  1YP5 A;  4FW1 A;  1IRX A;  2Y90 A;  3VYH B;  1QQJ A;  4M75 F;  2NUP A;  5CQY A;  2RMO A;  2LJ3 A;  2HD0 A;  1NJI C;  4FW2 A;  4BY6 C;  2EYQ A;  5GAN 6;  3S6W A;  2EVR A;  1UGP B;  1YCS B;  1QMC A;  3LYI A;  1HK9 A;  4AG1 C;  5GAN j;  2RJE A;  3G71 Q;  3RIR A;  1VQ7 T;  2C0I A;  1Y57 A;  1UDL A;  4M7A G;  4WTO B;  2AKK A;  3D7S B;  3QUI A;  2C06 A;  1R8O B;  1ZUY A;  1K9A A;  3OS5 A;  1KC8 U;  1NYF A;  3HKS A;  5GAN f;  3EG2 A;  4J7F A;  3REA B;  1BI1 A;  1VQ6 Q;  5LJ5 g;  1VQK A;  4QT7 A;  3OYK A;  2L3R A;  1FXX A;  3QG1 A;  1AZE A;  1C0M A;  4E47 A;  3KUF A;  4DQ2 A;  1M90 U;  2GGR A;  5FU7 B;  1NBE B;  1X6G A;  1PKT A;  3M0S A;  3PVQ A;  2KT8 A;  3JV3 A;  5KYN A;  4X9C A;  2DK3 A;  3RNJ A;  2JT4 A;  3MO8 A;  2J7I A;  4DOW A;  2EGC A;  2IVW A;  2QK0 A;  4R56 A;  1EFN A;  4RG8 A;  3SWN A;  1SHF A;  2XK0 A;  1KC8 R;  1WGS A;  3ZL7 C;  5IAY A;  3V7R A;  2J05 A;  1YIT T;  3CC2 T;  2K4Y A;  4HCB A;  4HCK A;  1D0X A;  2HBW A;  1EIF A;  2OTJ T;  4J9C A;  1MMG A;  4KGZ B;  4A4E A;  1QWE A;  4PFZ A;  5I22 A;  3C0C A;  4QW2 A;  5GMK l;  2RPN A;  3OYB A;  1UHC A;  1ZBJ A;  2YXY A;  1I5O B;  3QJY A;  1VIE A;  1KD1 C;  1OI1 A;  1SSH A;  1WXU A;  2M9U A;  3QJ6 A;  3OYG A;  5CO7 A;  4PFO A;  3M53 A;  2IG0 A;  4N4G A;  2EKH A;  5CIU A;  1LVK A;  4MZT A;  4FSX A;  4B9X A;  2XDP A;  1G3W A;  5A2Q E;  2CYZ B;  3QDF A;  4RG2 A;  3VS1 A;  2DLP A;  4PJJ A;  1YIJ Q;  6AT1 B;  1S1N A;  2CS7 A;  5FLX E;  1VQO T;  2EGA A;  2ZZD A;  2CZ7 B;  1Q82 C;  4C8Q E;  4BE2 A;  2JVV A;  3QZ9 B;  4PJL A;  1UGS B;  2O88 A;  5DLO A;  3FRN A;  3GBQ A;  1KQ2 A;  3OYD A;  2C0T A;  2QEX A;  1NPR A;  4J9I A;  3L2V A;  1VYU A;  3I5R A;  2FVU A;  2HMA A;  3I56 A;  4EDU A;  1OPL A;  2COY A;  2E5Q A;  4IUV A;  2EKO A;  2DEU A;  3OS0 A;  2LDM A;  1SEM A;  2E1H A;  1RL2 A;  4MML A;  3H41 A;  5GAN 4;  2CUB A;  2M51 A;  2COW A;  2QQS A;  1AWO A;  2ROL A;  2ABL A;  1RAE B;  1M3C A;  2CZ6 B;  1KQ1 A;  2M0O A;  1I4K 1;  2A3L A;  3VS4 A;  2ZPG B;  4IUR A;  5GAO n;  1RI9 A;  2VVK A;  3G6E Q;  1E6H A;  2EJF A;  3VRY A;  3OYL A;  3ER0 A;  1WXT A;  2F1L A;  1M2V B;  2O2O A;  3E2U A;  4J6W A;  5CAI A;  1BI0 A;  2D1X A;  1M1K U;  3M55 A;  4XU0 A;  4HT8 A;  2QEX Q;  1WHK A;  2ZPB B;  1VQ4 Q;  4M75 G;  5KYX A;  4C8Q A;  3I35 A;  3CXC P;  2DYI A;  2JMC A;  4PNO A;  1KQS S;  5DLQ E;  1JJ2 P;  4UC4 A;  3CCL A;  1WJQ A;  1D1C A;  5CVI A;  4M7A B;  1YJN T;  1PD1 A;  5KCH A;  2K3B A;  1CKA A;  4BD3 A;  2RJF A;  4M78 E;  3GOX A;  4M7D G;  1G3T A;  2B86 A;  1M1K R;  2M02 A;  4LDX A;  2QI2 A;  3VUB A;  3SFM A;  3UF4 A;  5GMK e;  4PK4 A;  2VB6 A;  5LJ5 e;  1U8R A;  3A8M B;  3MP8 A;  2PUK B;  1W2B P;  4CC7 A;  1YJ9 A;  1D1B A;  4CC2 A;  1GFD A;  1VQM T;  2NUT B;  3X26 B;  2WAC A;  4M4Z A;  1ZA1 B;  3JCM V;  1K73 C;  1T0J A;  4OVA A;  2OAU A;  4J9F A;  4C8Q F;  1AWW A;  5CKD A;  5KYU B;  2ZGW A;  1WHG A;  3FEO A;  2CSI A;  3P8D A;  2A08 A;  4DA4 A;  2YUN A;  1P92 A;  3LWI A;  3PIP A;  2XU8 A;  1Y96 A;  1SKU B;  1MHN A;  5CQX A;  4KRT A;  4PJO G;  3CCL Q;  5C0M A;  2QYZ A;  2DL3 A;  1V76 A;  4J9E A;  2F5T X;  1QCN A;  1QCO A;  1JU5 C;  3G7Z A;  1VQ7 A;  4OB2 B;  3ASK A;  2WSE E;  5I11 A;  4ZGJ B;  1YHQ Q;  1OUL A;  5FRM A;  3EFO A;  3CCS T;  2BKD N;  3X20 B;  1Y07 A;  5GAO l;  2EQJ A;  2BZ8 A;  3OB9 A;  1UGR B;  4C92 E;  3CCR T;  3C94 A;  4C5G A;  1YJ9 Q;  3OQ5 A;  4M78 A;  3J80 E;  2Y4X A;  1Y7X A;  4J5Y A;  3EGD B;  3JCM g;  1KC8 C;  2EYX A;  3UA6 A;  3DB3 A;  2QDY B;  2F2W A;  1VQK T;  2KT1 A;  4J9B A;  2JTE A;  4J6X A;  4MDW A;  4HVU A;  4FYV B;  2OAW A;  3CCQ T;  3A8G B;  4OB3 B;  2COZ A;  5D6X A;  3NTI A;  5IHI A;  1M90 C;  1XQH A;  1IRE B;  4Q5W A;  4DBR A;  1X27 A;  2O4X A;  2YSQ A;  1YIT A;  3CC2 A;  3I55 Q;  4PKC C;  3GNF B;  3QII A;  2OTJ A;  4M78 C;  1TS9 A;  1VQ7 Q;  2LVM A;  5GAN d;  5GAN 7;  1ZLM A;  1ZX6 A;  4IUU A;  2GNC A;  2ZPH B;  2PVD B;  2MPX C;  1VYV A;  2BZX A;  2PVG B;  3V8L A;  1WX6 A;  3CBP A;  4M78 F;  1IHW A;  4BUG A;  2DL8 A;  3AT1 B;  4DBH A;  5IN1 A;  1WXB A;  2DXB A;  3EAE A;  2MCN A;  2EAY A;  1Y71 A;  4CI0 C;  4GBQ A;  1NYG A;  2EQU A;  5CKB A;  1HYO A;  3MEU A;  2LJ0 A;  1PSE A;  1OQK A;  1RUW A;  1UB4 A;  2DRK A;  3LGF A;  1K9M U;  4C92 A;  4KT0 E;  2QAZ A;  2ESW A;  3CCJ A;  1M2O A;  3EGX A;  1RLQ C;  2G6F X;  1PSF A;  5FWC A;  4FYY B;  1YIT Q;  2RD1 A;  1M9S A;  3OY9 A;  4RTZ A;  2OTJ Q;  4IKF A;  2RF0 A;  2L3Q A;  4M75 B;  4M77 C;  4JRK A;  2E70 A;  1IB8 A;  1NM7 A;  2D0N A;  2BUD A;  3S3N A;  2DPP B;  4LDV A;  2CP5 A;  1FMV A;  2DX1 A;  1WDX A;  1ZSZ B;  1MNE A;  1K9M R;  1X2K A;  3X25 B;  4C92 C;  5IXF A;  2CP0 A;  1OX8 A;  2K79 A;  2XDB A;  4BY6 B;  1OU8 A;  3CPW P;  1BI3 A;  1M3B A;  3BY7 A;  3WVD B;  3I56 T;  1AOJ A;  2LJ1 A;  2GTJ A;  2R5M A;  2X4W A;  1V29 B;  3P8B B;  3N5B B;  2RA2 A;  3PIO A;  1C6V X;  2BTT A;  4GLM A;  1JB0 E;  2L0A A;  3NFC A;  1VQO Q;  1VQ9 Q;  1IHV A;  2E3I A;  3JB9 I;  1K4U S;  2KRS A;  1QLY A;  2C0O A;  1C1A A;  1YCY A;  2LQW A;  4JRI A;  2NUP B;  3JCM X;  5GAO p;  2K3X A;  2VGM A;  4XTY A;  4C8Q G;  2FPE A;  3EHQ A;  4QQ6 A;  3MJX A;  3FJP A;  1D1A A;  1WPY A;  4DBF A;  1JEG A;  2Y4Y A;  2JN0 A;  4HCC A;  3OMC A;  1JO8 A;  2E64 A;  3J81 E;  4BI4 A;  4D8D A;  1K8A U;  3M0P A;  2P4T A;  4KH0 B;  1VQL T;  1AT1 B;  4NOY A;  3X24 B;  5GAM h;  3TQ7 P;  1M1K C;  2EGE A;  4RUG A;  4FU6 A;  1YJN A;  4HT9 A;  1PCX A;  2P84 A;  2QGF B;  4L5G A;  5AT1 B;  4J83 A;  3REB B;  4VUB A;  1K0S A;  1D3B A;  4OMN A;  3DLM A;  1FWZ A;  1X2Q A;  2JW4 A;  2BE9 B;  4ZGD B;  1K8A R;  3INZ A;  2O9V A;  1RAD B;  3QBY A;  1YI2 T;  3SWN B;  3SEM A;  2WSF E;  1N8R U;  2LMJ A;  3JCM e;  1X69 A;  1RAH B;  4XK8 E;  3J7A F;  2KI7 A;  5GJW B;  1RAA B;  4PJN A;  3M0T A;  3FDR A;  2HQE A;  3E9F A;  2EQM A;  4CC4 B;  1WLP B;  2KMT A;  1I1J A;  3JSC A;  4RTT A;  4FM4 B;  1OU9 A;  3OYH A;  4J6Y A;  3MEA A;  2BIV A;  2K7A A;  2DZ9 A;  4OP0 A;  5HK0 A;  1RAF B;  1YJN Q;  3EG1 A;  3P8H A;  3TSW A;  2E6N A;  2KEA A;  3LGL A;  2AK5 A;  1M1F A;  3JB9 D;  4ZNX A;  2FHD A;  1N8R R;  5GAN 5;  4ZTJ A;  2KDS A;  2RJC A;  3CCS A;  2DBK A;  3O8V A;  2QA4 T;  4ZGE B;  1VQN T;  3OYF A;  4A4F A;  3QHS A;  2ECZ A;  3CCR A;  2M1H A;  3LH5 A;  2XID A;  1VQM Q;  3HFO A;  2ENM A;  5GAM j;  1HSQ A;  2FZK B;  2JTF A;  3A98 A;  3M56 A;  2R58 A;  1IZ6 A;  3CBM A;  2DD4 A;  1S72 T;  4E7I A;  4D6W A;  2YLC A;  2LT1 A;  4XQ3 A;  4C5I A;  2H3E B;  2MOX A;  3WVE B;  5GAM f;  4DEX A;  3BFM A;  3CCQ A;  1AZG B;  3FJ5 A;  3EH1 A;  3CCU T;  2QXF A;  3VKI A;  3CEY A;  1GL5 A;  2DXT A;  2K5I A;  2RHU A;  4KGV B;  4M77 D;  4RCC A;  5KYW A;  3CC4 A;  1WHH A;  2CT3 A;  4FT2 A;  3M57 A;  3KXT A;  1TOV A;  4A4K A;  2RB6 A;  3JCM c;  2HSE B;  4A53 A;  2A0F B;  5IT9 E;  3L42 A;  1RAB B;  4C92 D;  4WCI A;  3M0U A;  3CC7 T;  2J6F A;  3CCS Q;  5LJ3 j;  3GPL A;  3OA6 A;  2F2V A;  4X34 A;  2XKO C;  2OX7 A;  3CCR Q;  2J6K A;  2EFI A;  1AWJ A;  2KQW A;  2J06 A;  3M58 A;  1I8F A;  1VQK Q;  1KHC A;  2X4J A;  1TXQ A;  1AD5 A;  4XTX A;  3CCQ Q;  2VXE A;  1JXO A;  1KG1 A;  2CH4 A;  2FPF A;  2DL5 A;  3CCM T;  5KYX B;  4C8Q B;  4FCY A;  2ZAE A;  2EQK A;  1U06 A;  2OJ2 A;  2K3Y A;  1WIE A;  2YDL A;  1OEB A;  1TUD A;  1QP3 A;  3L2Q A;  2GTO A;  2X3X D;  2KRO A;  1UGV A;  3PMI A;  1X43 A;  1RAI B;  3O5Z A;  2OI3 A;  3H0F A;  4J9H A;  5D6Y A;  5ECA A;  2V1Q A;  2X35 A;  2CSQ A;  1N5Z A;  4XTU A;  2CP6 A;  4J9G A;  1PNJ A;  3RR6 A;  2FL7 A;  2W10 A;  2F69 A;  1U3O A;  2YWW A;  1BIA A;  1XNI A;  3L1A A;  2KVQ G;  2GCX A;  5I21 A;  4PLI A;  3RBB B;  3C4S A;  3X28 B;  4E6R A;  1MV3 A;  5LL6 S;  1ZA2 B;  3QDR B;  1MV0 B;  2KAF A;  1QW1 A;  2ZPE B;  1NPP A;  4ANJ A;  1FYN A;  5GAN g;  3R6O A;  4OGE A;  1B3Q A;  4O5V A;  2PTK A;  4JRQ A;  1K76 A;  1WHM A;  2FRW A;  3TVT A;  3EG9 A;  1Y96 B;  2HKQ B;  2EBP A;  2RJD A;  5GAN 2;  1K1Z A;  1M8V A;  2JS0 A;  3V8J A;  3JAM E;  3NPF A;  4LN2 A;  1VIF A;  5DM7 R;  4EIK A;  2JM9 A;  2HQX A;  2FPD A;  2X3W D;  1VQL A;  3HRT A;  2RO0 A;  2DJZ A;  4JS4 A;  1Z9Z A;  3EFO B;  3TCJ A;  4R55 A;  1X6O A;  3VS2 A;  1YBY A;  3SHW A;  3NHN A;  2LX9 A;  1W2B A;  3CCE T;  2FZC B;  1TSF A;  2AZV A;  4HXJ A;  2XI9 A;  3I56 Q;  1K0X A;  1IGQ A;  4BI8 B;  2R57 A;  3LW5 E;  5GMK m;  5D6W A;  2X4X A;  4M78 B;  2RK2 A;  4XU2 A;  2HNI A;  2E12 A;  2DIQ A;  3OBW A;  1XJW B;  3LX7 A;  1N9R A;  3HHT B;  3EGU A;  4LNP A;  2GF7 A;  4QVC A;  1YFN A;  2KYM A;  1DJ7 B;  1YI2 A;  2PUO B;  4M7D D;  2RNA A;  1WYX A;  1T0H A;  4IUP A;  2LCC A;  2O4X B;  4Z88 A;  4LDU A;  2HBP A;  2IIM A;  2QQ9 A;  2AKL A;  1OYX A;  1G83 A;  4CC3 A;  3CBO A;  4F16 A;  5HK3 A;  1LPL A;  1E7O A;  2K57 A;  1JBM A;  1YNZ A;  4AFZ C;  1VQL Q;  3KFV A;  3UAT A;  1RLP C;  2DZC A;  4KH1 B;  2K9G A;  5FW9 A;  1VQP T;  1TUC A;  4FIB A;  3VJP A;  2VV5 A;  3RUX A;  1WHL A;  1E6G A;  1QVF A;  3RMS A;  2WSC E;  1KQS P;  4OMO A;  4E7K A;  1NEG A;  4PJO D;  1QVF S;  2VC8 A;  4P5N A;  3QPH A;  1N27 A;  2QA4 A;  4KUD K;  1KFZ A;  1VQN A;  4JS5 A;  1WA7 A;  2FYK A;  3CCV A;  4C92 B;  5KYY A;  4M77 E;  3QO3 A;  1YI2 Q;  3BDL A;  2JMA A;  4RMO A;  4MDX A;  3EGX B;  4AFS C;  3PTA A;  1WQ7 A;  2DD5 A;  1VQ5 T;  2W0Z A;  2KRN A;  4C0D C;  1S72 A;  1PC0 A;  1MMN A;  1IXD A;  1QP2 A;  1IGU A;  4EMH A;  2RHY A;  1GCP A;  2Z0W A;  3DKM A;  8ATC B;  2DTI A;  3CCU A;  2QQB A;  3A8O B;  2MYS A;  8AT1 B;  4JJN K;  5CKH A;  4RTY A;  4JUV A;  2XG8 D;  1GXI E;  1QVG A;  2G3R A;  1ZHI A;  1QVG S;  4DOV A;  3JCM Q;  4N4I A;  4A4H A;  2V8K A;  3RKY A;  1FMK A;  1VUB A;  1X6B A;  2E65 A;  1PRL C;  2DYB A;  1NJI R;  4EMK A;  1WI7 A;  3G4S T;  4BB7 A;  3CC4 T;  3CC7 A;  1Y0M A;  1R77 A;  1VQ8 T;  4XAX B;  4A54 A;  5IH2 A;  1VQN Q;  4X9D A;  5HKC A;  2FEI A;  1T3L A;  2VGN A;  2MAM A;  2DTH A;  1F1B B;  5HY6 A;  1AEY A;  5GAM d;  1ABO A;  3M4G A;  4OMQ A;  4MZP A;  2JOY A;  3EG0 A;  4BAC A;  1YIJ T;  5LJ5 h;  3BE3 A;  2RI2 A;  2L8D A;  5L23 A;  1SRM A;  2D6F A;  1MUZ A;  4M77 A;  3RDV A;  4LDW A;  2OTL T;  5J39 A;  1W6X A;  3JB9 F;  4EMK C;  3CCU Q;  2ZPI B;  1ZQ1 A;  5GAN e;  2A37 A;  5I2M A;  3CCM A;  4M7A C;  3ME9 A;  1VOM A;  2LZ6 B;  3U23 A;  2DRM A;  1KIK A;  1PG5 B;  3UA7 A;  1WNL A;  2O31 A;  3CME T;  4JZ3 A;  3M9Q A;  5GAN 3;  4CRI A;  4K11 A;  3OW2 A;  3CC2 Q;  3QYG B;  4B6M A;  2RK1 A;  1OX9 A;  4HVW A;  2I0N A;  2VAS A;  2HCK A;  1B07 A;  3OW2 S;  3HRS A;  3MEW A;  5LJ3 d;  2GQI A;  3R6N A;  1ZUU A;  3OS2 A;  1D3B B;  2LNH B;  3VS7 A;  1I81 A;  1EX4 A;  3BW1 A;  5GAN 8;  3MP1 A;  1RAG B;  1TWB A;  2ZPF B;  4HVV A;  4M77 F;  5GAO m;  2HSP A;  2P0K A;  3LLR A;  3H0H A;  1U5S A;  1QCF A;  3MET A;  2RHX A;  1SF9 A;  5KE2 A;  2XHC A;  4ZN1 A;  4QVD A;  4C92 F;  1ARK A;  3M0Q A;  1UTI A;  3CCM Q;  4JLI A;  1PM3 A;  1BCO A;  4MMK A;  3TSZ A;  2DVJ A;  3BDU A;  2QG9 B;  1VQ4 T;  3OYE A;  2LTO A;  2EYY A;  3H6Z A;  4J7I A;  3OYY A;  4E7Z A;  1SSF A;  3CD6 T;  2AT1 B;  1Q82 R;  4KGX B;  2HZY A;  5A0D A;  3M54 A;  4X1V A;  2AHJ B;  2JTM A;  2QDL A;  4L59 A;  5GMK j;  2VKN A;  5LJ5 j;  2DA9 A;  2B8A A;  4NL3 A;  1KHI A;  2QGG A;  2V8I A;  3HP9 A;  2KYB A;  3CCE A;  5LJ5 f;  2CGH A;  2RQU A; 
#chains in the Genus database with same CATH homology
 4M7A A;  3OYL A;  4FT2 A;  3ER0 A;  3S3O A;  3M57 A;  2YRV A;  1U1S A;  4KUL A;  3KXT A;  5KE3 A;  2R5A A;  4A4K A;  2RB6 A;  3MCA B;  1B34 A;  3JCM c;  4A53 A;  4J6W A;  1LNX A;  5CAI A;  1BI0 A;  1M1K U;  3VV0 A;  2RHI A;  5IT9 E;  3L42 A;  3OYI A;  3M55 A;  4C92 D;  4XU0 A;  4XTZ A;  4HT8 A;  3OYJ A;  2ZPB B;  3CC7 T;  3E9G A;  4M75 G;  4ZTF A;  1BKB A;  3M4Y A;  4C8Q A;  2GFU A;  5GMK h;  4FL6 A;  5LJ3 j;  3OA6 A;  3GPL A;  4X34 A;  1XTD A;  2XKO C;  1ZBX A;  3QYH B;  3A8H B;  1AHJ B;  3OMG A;  4EPC A;  4QQD A;  5CR2 A;  3F70 A;  5GMK i;  4PNO A;  1KQS S;  4GY5 A;  2RM4 A;  5DLQ E;  2EFI A;  4KUI A;  4UC4 A;  2MMP A;  2KQW A;  3CCL A;  4N0A C;  4OF1 A;  1WJQ A;  4NL2 A;  3HRU A;  3M58 A;  2LQ8 A;  4GLK A;  5CVI A;  4M7A B;  1YJN T;  3FB9 A;  2H3J A;  1I8F A;  4XU3 A;  5KCH A;  4OB1 B;  1KHC A;  3V8K A;  4E7J A;  3FLG A;  3MEV A;  1WJS A;  3UDC A;  4BD3 A;  2RJF A;  2X4J A;  3V7S A;  1KD1 U;  4M78 E;  3CPW A;  3GOX A;  4PJO E;  1B34 B;  2PU9 B;  5GAM e;  4M7D G;  2MF2 A;  1G3T A;  1QVG S;  4OMF B;  4XTX A;  3CPF A;  2VXE A;  3OS1 A;  1G3S A;  3CPW S;  5M9O A;  1M4Z A;  2DXC A;  1KG1 A;  4LDX A;  4JLG A;  2EJ9 A;  2GFA A;  4M7A F;  2QI2 A;  4Y28 E;  3VUB A;  3SFM A;  5J26 A;  4HCZ A;  5GMK e;  4L6V 5;  5LJ3 h;  3CCM T;  3HSB A;  3VU3 C;  5LJ5 e;  4C8Q B;  3ZFJ A;  1X01 A;  3A8M B;  1U8R A;  2EQK A;  4PLL A;  2E10 A;  3MP8 A;  3NTK A;  3ZEH A;  2PUK B;  1OZ3 A;  3A5Z B;  3G71 A;  4PL6 A;  2K3Y A;  1YJ9 A;  4YTL A;  2I2L A;  1UGQ B;  3RMQ A;  1VQP A;  1VQM T;  3X26 B;  3L2U A;  1QP3 A;  4ZN3 A;  1YHQ T;  3L2Q A;  2WAC A;  4XU1 A;  3OYM A;  2A7Y A;  3PMI A;  3JCM V;  1K73 C;  1VQO A;  5D6Y A;  4OVA A;  2OAU A;  4C8Q F;  1VQ9 A;  3OSS C;  4F7U E;  5CKD A;  1Q82 U;  2ZGW A;  3FEO A;  1LJO A;  5KCO A;  4M7D A;  2DXU A;  2X35 A;  2KY9 A;  3P8D A;  4IUQ A;  4A4G A;  1YJW A;  4XTU A;  4DA4 A;  3CMA T;  1P92 A;  4JRP A;  2FL7 A;  3E19 A;  3LWI A;  3PIP A;  1O9S A;  2F69 A;  1Y96 A;  2E6Z A;  2XU8 A;  1BIA A;  1MHN A;  1XNI A;  5CQX A;  3G6E T;  4LD9 K;  4M75 C;  4KBM B;  4M78 G;  3C95 A;  1JRI A;  3L1A A;  4PJO G;  5LJ3 e;  1VQ5 A;  3NTH A;  3LWH A;  3HPW A;  5C0M A;  2KVQ G;  2GCX A;  1W4S A;  2K2V A;  5I21 A;  4PLI A;  2F5T X;  3EFS A;  2YLB A;  2XDD A;  1OZ2 A;  2X4Y A;  1XOV A;  1Q7Y C;  1N6A A;  3RKW A;  3CCV T;  2KK4 A;  2YHT A;  3C4S A;  3FIF A;  3G7Z A;  3X28 B;  1Q86 C;  1VQ7 A;  2D0Q B;  5LL6 S;  4M7A D;  3JB9 G;  4OB2 B;  3DB4 A;  3ASK A;  3QDR B;  3OYA A;  2WSE E;  2KAF A;  1QW1 A;  2F5K A;  3KBG A;  4M75 E;  3UWN A;  4ZGJ B;  2ZPE B;  3A8L B;  1RI0 A;  1NPP A;  2L5Q A;  5FRM A;  2QEX T;  2NLU A;  3R6O A;  4XTV A;  5GAN g;  3I55 T;  2BKD N;  4OGE A;  3CCS T;  3X20 B;  1Y07 A;  4M7D B;  5GAO l;  2MWO A;  2K5F A;  3UT1 A;  4M7D C;  2EQJ A;  4O5V A;  3OB9 A;  1UGR B;  2VYT A;  1WQW A;  4NS5 A;  4JRQ A;  4C92 E;  5CKE A;  2VUB A;  2LC4 A;  3C94 A;  4C5G A;  3CCR T;  3OQ5 A;  4M78 A;  3J80 E;  2Y4X A;  4ELZ C;  4PJO A;  1Y96 B;  1Y7X A;  4J5Y A;  4C8Q D;  1Q81 C;  3JCM g;  3MHX A;  1KC8 C;  3PGG A;  2RJD A;  3DB3 A;  3TEE A;  5GAN 2;  4M7D F;  2P0P A;  2QDY B;  3G4S A;  1M8V A;  3V8J A;  1VQK T;  3JAM E;  1VQ8 A;  1X75 C;  1VIF A;  5DM7 R;  4RCB A;  4J6X A;  4MDW A;  2HQX A;  4C5E A;  3CCQ T;  3A8G B;  2VXF A;  4II1 A;  4OB3 B;  5D6X A;  3HRT A;  3NTI A;  3WXM B;  1M1G A;  5AYF A;  3C12 A;  3T9N A;  4EMG A;  2RO0 A;  2DJZ A;  5KH6 A;  1M90 C;  4QQG A;  1XQH A;  4JS4 A;  1IRE B;  4Q5W A;  3TCJ A;  4R55 A;  1X6O A;  1G5V A;  1YBY A;  2O4X A;  4M77 G;  2LX9 A;  1YIT A;  1W2B A;  3CC2 A;  3CCE T;  4Y91 A;  1H64 1;  3OYC A;  2ZCF B;  2XI9 A;  4F7U A;  5GAN h;  4PKC C;  3GNF B;  2XIC A;  4BI8 B;  2KSS A;  2R57 A;  3LW5 E;  3M59 A;  2RHZ A;  3URG A;  5GMK m;  5D6W A;  1YIJ A;  2X4X A;  3QII A;  4M78 B;  5L8R E;  4PJO B;  2OTJ A;  2RK2 A;  3H8Z A;  4M78 C;  2LVM A;  4PJO C;  4XU2 A;  4B9W A;  5GAN d;  1QVP A;  3DLL A;  5GAN 7;  4BE1 A;  4IUU A;  2HNI A;  4OGC A;  2E12 A;  5LJ3 f;  2ZPH B;  2OTL A;  2DIQ A;  4C92 G;  2DTO A;  3OBW A;  4XTW A;  3LX7 A;  3M5A A;  2PVD B;  5CKF A;  1N9R A;  3JCM h;  3HHT B;  3VUZ A;  4BI3 A;  2MI6 A;  2PVG B;  2HAX A;  3V8L A;  2GF7 A;  4QVC A;  3CBP A;  1FX7 A;  4M78 F;  4PJO F;  3JCM d;  4BUG A;  5EG2 A;  1DJ7 B;  1YI2 A;  1MGQ A;  3JRZ A;  5IN1 A;  2PUO B;  4N4H A;  4M7D D;  2DXB A;  3EAE A;  4RKU E;  3LH0 A;  1G3Y A;  2EAY A;  5I2S A;  4M75 A;  1Y71 A;  4CI0 C;  4IUP A;  3CCL T;  3CME A;  2LCC A;  2O4X B;  2PQW A;  3GIB A;  2EQU A;  5CKB A;  4LDU A;  3GNG A;  2HBP A;  5FU6 B;  3MEU A;  4WF2 A;  4F7U B;  3QSU A;  3PT9 A;  2QQ9 A;  1BYM A;  5FU6 C;  2JZ2 A;  5A0L A;  1OYX A;  1PSE A;  1UEB A;  4C0G A;  4TVR A;  3CBO A;  2E41 A;  3QZ5 B;  1BI2 A;  1K9M C;  1UB4 A;  1K9M U;  3LGF A;  1NZ9 A;  4C92 A;  5HK3 A;  3JB9 H;  4KT0 E;  1VQM A;  2K57 A;  2DVE A;  3Q1J A;  4J8O A;  3SWN C;  3JCM J;  3AHU A;  3ZBD A;  5LJ5 f;  1JBM A;  3CCJ A;  2MWP A;  1K73 U;  4E7H A;  4HA8 A;  4F7U F;  1PSF A;  1VQ6 A;  5FRO A;  3HL8 A;  4ATO A;  2DKG A;  2DZC A;  3SD4 A;  2EJG A;  5DY9 A;  2RD1 A;  3PNW C;  1YJ9 T;  4V2S A;  1M9S A;  1I5L A;  1VQP T;  2O01 E;  3L2R A;  3OY9 A;  4FIB A;  4HKE A;  3VJP A;  4IKF A;  2VV5 A;  2CZ0 B;  4M75 B;  4M77 C;  3RUX A;  4JRK A;  3EFR A;  1QVF A;  3G6E A;  2LNV A;  3RMS A;  2E70 A;  2WSC E;  2QQA A;  4E7K A;  2BUD A;  4M78 D;  3HFN A;  2FB7 A;  3PFS A;  3S3N A;  4PJO D;  1VQ9 T;  1QVF S;  2VC8 A;  4P5N A;  2QQR A;  2DPP B;  3QPH A;  4C0Z A;  1N9S A;  4BDZ A;  1N27 A;  2D9T A;  2QA4 A;  4KUD K;  2Y90 A;  4LDV A;  1Q7Y U;  3UPU A;  3MP6 A;  4JS5 A;  1VQN A;  3VYH B;  2FYK A;  1Q86 U;  3CCV A;  1YJW T;  4C92 B;  4BDY A;  4Z02 A;  4M75 F;  4M77 E;  3X25 B;  4C92 C;  3QO3 A;  2JNG A;  3BDL A;  5GAO q;  5FRN A;  5CQY A;  4RMO A;  4MDX A;  3PTA A;  4FT4 A;  2XDB A;  4BY6 B;  2HD0 A;  1NJI C;  1WQ7 A;  2RH2 A;  2DD5 A;  4BY6 C;  3CXC A;  4C0D B;  2EYQ A;  1VQ5 T;  1BI3 A;  1VQ4 A;  3BY7 A;  5GAN 6;  3WVD B;  4C0D C;  2DO3 A;  3S6W A;  3I56 T;  1UGP B;  3CD6 A;  2PVO B;  1S72 A;  3CXC S;  2R5M A;  1NE8 A;  4OB0 B;  2X4W A;  3LYI A;  3CCS A;  1HK9 A;  1V29 B;  5GAN j;  1JJ2 A;  2RJE A;  3P8B B;  3RIR A;  1VQ7 T;  1QP2 A;  5GAM g;  3JB9 J;  3N5B B;  4M7A G;  4EMH A;  2RHY A;  3DKM A;  2RA2 A;  3QUI A;  5J3B A;  1JJ2 S;  1Q81 U;  3PIO A;  2EWN A;  4ME7 A;  2C06 A;  1R8O B;  2DTI A;  3OS5 A;  1KC8 U;  3CCU A;  3HKS A;  1JB0 E;  2QQB A;  4E7L A;  2JUF A;  3GF5 A;  3A8O B;  5GAN f;  4J7F A;  3NFC A;  1BI1 A;  4JJN K;  5CKH A;  3SDZ A;  2DAQ A;  2XG8 D;  4JUV A;  5LJ5 g;  1GXI E;  1VQK A;  1QVG A;  3JB9 I;  2G3R A;  1ZHI A;  2LCL A;  3OYK A;  2L3R A;  4DOV A;  1YCY A;  4C0F A;  4JRI A;  3JCM Q;  1FXX A;  3QG1 A;  4N4I A;  3JCM X;  5GAO p;  2K3X A;  2VGM A;  4A4H A;  2V8K A;  4XTY A;  3JCM f;  4C8Q G;  3FC3 A;  4E47 A;  3RKY A;  1VUB A;  2E65 A;  3KUF A;  4QQ6 A;  4DQ2 A;  1M90 U;  2P0Q A;  3QXE B;  5FU7 B;  4EMK A;  2XD0 A;  3FJP A;  3G4S T;  1WPY A;  5FU7 C;  3CCJ T;  2Y4Y A;  2JN0 A;  4BB7 A;  3CC4 T;  3CC7 A;  2LT4 A;  3JCM b;  3OMC A;  4HCC A;  2E64 A;  4M75 D;  2DK3 A;  4X9C A;  3J81 E;  1W2B S;  1VQ8 T;  2GQV A;  4BI4 A;  4XAX B;  4A54 A;  1K8A C;  2CZ1 B;  1K8A U;  3MO8 A;  2P4T A;  4DOW A;  4X9D A;  2IVW A;  4R56 A;  5HKC A;  1VQL T;  4RG8 A;  3SWN A;  3GP8 A;  2XK0 A;  4NOY A;  3OYN A;  3X24 B;  5GAM h;  1M1K C;  1WGS A;  2VGN A;  4C5H A;  5IAY A;  3V7R A;  2MAM A;  2M16 A;  5LJ3 g;  2DTH A;  5HY6 A;  1YIT T;  3CC2 T;  3SB2 A;  4FU6 A;  1YJN A;  1TH7 A;  5GAM d;  2K4Y A;  4HCB A;  3M4G A;  4HT9 A;  4M7D E;  4MZP A;  4O6J A;  2JOY A;  4BAC A;  1YIJ T;  4L5G A;  5LJ5 h;  2RI2 A;  3L2W A;  1EIF A;  1KQS A;  2L8D A;  2OTJ T;  2D6F A;  4M77 A;  4J83 A;  5GAO r;  4LDW A;  4VUB A;  5J39 A;  5LJ5 d;  2OTL T;  4A4E A;  3RES A;  4EMK B;  2K5L A;  1D3B A;  4LD6 A;  3JB9 F;  4EMK C;  3DLM A;  5CK9 A;  2ZPI B;  1ZQ1 A;  3RER A;  5GAN e;  1FWZ A;  4QW2 A;  1HXD A;  2RI5 A;  1M5Q 1;  5I2M A;  5GMK l;  3OYB A;  1H3Z A;  3CCM A;  4M7A C;  3ME9 A;  4ZGD B;  3QJY A;  1VIE A;  3INZ A;  1KD1 C;  3QBY A;  1YI2 T;  3SWN B;  3OBY A;  1OI1 A;  2M9U A;  2WSF E;  3QJ6 A;  1N8R C;  3PMT A;  1YHQ A;  1N8R U;  1WNL A;  3JCM e;  3OYG A;  5CO7 A;  4XK8 E;  1VQL A;  3J7A F;  1O75 A;  3CME T;  3M53 A;  2IG0 A;  4QVZ A;  4N4G A;  3M9Q A;  5CCA A;  3FDR A;  4CRI A;  5GAN 3;  4M7A E;  5CIU A;  3OW2 A;  2HQE A;  3QYG B;  2RK1 A;  4FSX A;  4MZT A;  4B9X A;  2XDP A;  3G71 T;  1G3W A;  3E9F A;  5A2Q E;  4C8Q C;  3JCM W;  2CYZ B;  2EQM A;  3OW2 S;  5C6S A;  4IUT A;  4RG2 A;  3HRS A;  3MEW A;  2KMT A;  5LJ3 d;  4M77 B;  3CMA A;  2CS7 A;  5FLX E;  3JSC A;  3OS2 A;  1D3B B;  2RI3 A;  4FM4 B;  1VQO T;  3OYH A;  4J6Y A;  2ZZD A;  1I81 A;  3MEA A;  2BIV A;  2CZ7 B;  2DZ9 A;  2LQK A;  4MZM A;  1VQ6 T;  4OP0 A;  2DIG A;  5HK0 A;  3V7C A;  1Q82 C;  4C8Q E;  3BW1 A;  5GAN 8;  1U1T A;  3P8H A;  4BE2 A;  2E6N A;  2JVV A;  3MP1 A;  3QZ9 B;  3LGL A;  2ZPF B;  4M77 F;  1UGS B;  3GLX A;  5GAO m;  3QKJ A;  1M1F A;  4ELY C;  5DLO A;  3JB9 D;  2P0K A;  3LLR A;  2FHD A;  3FRN A;  5GAN 5;  1KQ2 A;  3OYD A;  1NJI U;  4ZTJ A;  2QEX A;  2KDS A;  2V8J A;  2RHX A;  3MET A;  1NPR A;  2RJC A;  3I55 A;  5KE2 A;  2XHC A;  2EIF A;  3O8V A;  4JDS A;  4ZN1 A;  3L2V A;  4QVD A;  2FVU A;  3I56 A;  4EDU A;  2QTX A;  4C92 F;  2QA4 T;  2CKK A;  4ZGE B;  1VQN T;  4IUV A;  2E5Q A;  3OYF A;  4A4F A;  4JLI A;  2EKO A;  3QHS A;  3CCR A;  3OS0 A;  2LDM A;  3RKX A;  2M1H A;  4BE0 A;  4MMK A;  2XID A;  5A0G A;  2E1H A;  1RL2 A;  4MML A;  1LOJ A;  3S3M A;  3HFO A;  5GAN 4;  3BDU A;  5GAM j;  4LDY A;  3L2Z A;  2DEQ A;  2JTF A;  3M56 A;  3OYE A;  2LTO A;  2QQS A;  2R58 A;  1IZ6 A;  1VQ4 T;  3CBM A;  3H6Z A;  4J7I A;  3OYY A;  2DD4 A;  1SSF A;  3CD6 T;  1S72 T;  4E7I A;  2LRQ A;  4D6W A;  2YLC A;  2LT1 A;  2CZ6 B;  3M54 A;  4XQ3 A;  4C5I A;  5A0D A;  3E1S A;  1KQ1 A;  2AHJ B;  2JTM A;  3OSV A;  2L89 A;  3WVE B;  4L59 A;  5GAM f;  2M0O A;  1I4K 1;  3BFM A;  5GMK j;  3TU4 K;  2A3L A;  5LJ5 j;  2B8A A;  3CCQ A;  4F7U G;  2ZPG B;  4IUR A;  5GAO n;  4NL3 A;  1KHI A;  3JCM P;  3CCU T;  2QXF A;  2V8I A;  3CEY A;  3HP9 A;  2DXT A;  4N0A A;  3TRE A;  3VKI A;  1WJR A;  2K5I A;  2EJF A;  2RHU A;  4M77 D;  4RCC A;  1BIB A;  3VYG A;  3CCE A;  2CGH A;  3CC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...