3G4SQ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g4sQ00
3G71Q 1VQKQ 1YITQ 1YJNQ 1VQ9Q 3CC2Q 3G6EQ 3CCQQ 1VQ6Q 3CCUQ 3CCVQ 1VQ8Q 1Q82R 3CC7Q 1VQ5Q 1QVFP 1VQ7Q 1W2BP 1M90R 3CMAQ 1K8AR 3CCLQ 1KQSP 2QEXQ 1JJ2P 1YI2Q 1Q7YR 3I55Q 1N8RR 1VQLQ 2OTJQ 3CCMQ 3CCEQ 3OW2P 1K9MR 1VQMQ 1YHQQ 1YJ9Q 1YIJQ 3CXCP 1K73R 1VQOQ 1KC8R 3G4SQ 3CMEQ 3CCJQ 3I56Q 3CPWP 1Q81R 2QA4Q 1NJIR 1Q86R 1QVGP 1YJWQ 1VQNQ 1KD1R 1VQ4Q 3CCSQ 3CD6Q 1M1KR 2OTLQ 3CC4Q 1VQPQ 1S72Q 3CCRQ
chains in the Genus database with same CATH superfamily
1RABB 4DEXA 1YP5A 2J7IA 2EJGA 3QG1A 4RKUE 1YJWA 1AWJA 1CKAA 1X6BA 3JCMf 4M78D 1Q7YC 2QTXA 4MDXA 3VS1A 1N8RU 1RLPC 1UB4A 2DFUA 5CVIA 1V76A 2LJ0A 1VQKT 1YITT 2LC4A 3HTRA 1M30A 2X4JA 1WHLA 3A8GB 1BYMA 4DBFA 4DQ2A 1QVFP 3GP8A 4PK4A 1PCXA 2WSFE 2OI3A 2ZPFB 1W2BP 5KE3A 5GANj 2PTKA 1H92A 3OYHA 3FRNA 2RM4A 1I1JA 2QA4T 1WXUA 4JRIA 3OW2A 4C5HA 2L89A 1K73C 2QYZA 4JLIA 1OU9A 2D8HA 1VQ9T 1RI9A 2DL5A 3S3MA 1KG1A 1JU5C 2GFAA 2QXFA 4M78F 1I4K1 5LJ3e 1QVGS 2JNGA 1PD1A 5IAYA 1M2VA 4C92C 2IVWA 1AD5A 2DL4A 5D6XA 1YHQT 1EZZB 3NTHA 3FDRA 3HFNA 2FZCB 3LYIA 4FL6A 1XTDA 2V1QA 2DZCA 4Y28E 1VUBA 5CAIA 3FJPA 3EGXA 4M7AB 2HSPA 1Q86R 2DRMA 3OY9A 3QYGB 3I9QA 2L8DA 1YJ9A 1X6OA 3M9QA 2EVRA 3HL8A 9ATCB 4X9DA 3X26B 2E65A 2VC8A 1CSKA 3JCMP 2OTLT 4M7AG 2GTOA 1LCKA 4L6V5 2QGFB 1OQKA 3MEWA 1HK9A 1VYUA 2VXEA 4XU3A 2LT1A 1E6HA 1RADB 1H8KA 2IIMA 4M77D 2VGMA 4NL2A 3ZBDA 4FT2A 2BE7D 3O5ZA 2E64A 2K79A 3OMCA 2EYXA 3IQLA 2COYA 4OB1B 1W4SA 1PG5B 1K1ZA 4N0AA 5GAOn 1OULA 4A4EA 5GMKm 4O6JA 2FVUA 2JTFA 4JS4A 4Z89A 2J05A 5KYUA 4JDSA 4E6RA 4BE0A 3RR6A 3CCMA 3CMAT 1AWXA 2X4WA 2E1HA 3EH1A 1VQOT 1GFDA 2KBTA 3RERA 3GLXA 4KUDK 1M8MA 4M77F 3BW1A 2CYZB 3WXMB 2KT8A 3ASKA 4C5EA 4IUPA 2D0QB 2RQVA 4XU0A 2QQAA 4Y91A 2QTVA 3U23A 4PJOC 1HXDA 1DJ7B 3UT1A 3I56A 2CUBA 4PJMA 2NLUA 1Y7XA 7AT1B 1BU1A 1YWOA 5LL6S 2E10A 2E5QA 5DY9A 2HBWA 1VQPT 4C92D 3CPWP 2L3PA 4EMGA 3GOXA 2YUOA 1M1KR 2FZGB 2V8IA 2VWFA 3I5SA 2E6NA 3M57A 1IZ6A 4C8QD 1VQNA 4BUGA 2DL7A 1WYXA 1ZSZA 1VQ7Q 2VV5A 3CD6A 5KYXA 3TQ7P 4M78B 2RPNA 3L2ZA 3P8HA 2JM8A 4DOVA 1Q81R 3CPWA 2HMAA 2HQXA 3HRTA 1WJSA 5GAOp 4HKEA 3OYKA 2HQHA 2YUPA 4C92F 3OYGA 2FL7A 3EG0A 4Z8AA 1HJDA 3OS2A 2D0NA 1JB0E 1M1FA 4M7AE 4MZMA 2GFUA 2GQVA 4FYVB 4HCBA 4C8QF 2FPFA 1WJRA 2B8AA 2EYWA 3LH0A 3CBPA 2VYTA 4GLMA 1D1CA 3GBQA 2K5FA 1Q82C 2O4XA 3NFCA 3X20B 4HT9A 4MZPA 4FM4B 2A3LA 4AT1B 1BI2A 1WPYA 2COWA 2G3RA 2G6FX 4PFPA 4BE2A 4NS5A 2YRVA 1KIKA 2P4TA 3EHQA 3J7AF 4J7IA 3OYNA 1YJNT 1GCPA 2LTOA 3CCUT 1MMNA 1YI2A 2L3QA 2OJ2A 2SEMA 2FPEA 4E2FB 4MZTA 1VQMT 2HQEA 4CRIA 2DYBA 4LDXA 4ATOA 1JRIA 1K9MC 4QQDA 4PJOD 3MPUB 2CH4W 2JMCA 3CC4T 1BBZA 3LWHA 2RJFA 2H3EB 2DD5A 3BY7A 4BI4A 3E9FA 1N9RA 3MEVA 3OS0A 1TUDA 5I11A 3OW2S 2DYIA 3M4YA 4E7JA 4J9EA 4M77B 4ZGEB 3OA6A 4BB7A 3MKDA 4KGXB 2AT1B 3NTKA 3QWYA 5KE2A 5CO7A 1WA7A 4J5YA 5IXBA 1TU0B 2K3YA 2X4YA 1KD1U 1VQ6T 2DTHA 1KFZA 2DXTA 4EMKA 5KCHA 1NBEB 3CXCS 4C0GA 2K57A 2CZ6B 3C12A 4F16A 4PJOF 1D0ZA 5GJVB 1K8AC 2ABLA 2RO0A 1TUCA 2X35A 2OTJT 5L23A 2KR3A 2HKQB 3CCVA 1PKSA 1QVGP 2CUDA 4JJNK 5FRNA 1VQ4Q 1QQJA 1MMDA 1OI1A 4J9GA 2YXYA 4QQGA 1G5VA 2NWMA 3QXEB 4R56A 2X51A 2QEXT 3MCAB 3UATA 2DTIA 1UHFA 1WNLA 2D1XA 3INZA 5KYNA 4M7AA 5EG2A 3CCJQ 4C92B 3MP8A 2DIQA 3ME9A 2EBPA 4LD6A 2J6OA 3G6EQ 2M16A 4ZGDB 1TUGB 1T0JA 1WQWA 1AEYA 2QQSA 3EGDB 4VUBA 3EFRA 1YIJT 3S3NA 1H641 1GL5A 2CP5A 1RACB 2M9UA 4B9XA 1K9MR 2EW3A 1BKBA 2F2WA 3SWNA 2HDAA 5CKHA 3PE0A 3QDFA 2RNAA 1IRXA 1BIBA 4M4ZA 2K3BA 1SHGA 2MOXA 3RESA 3OSSC 2A28A 1RUWA 3F70A 3VS5A 1D0XA 1VYTA 2YRCA 2KAFA 1M9SA 2QDLA 5A0LA 3VS3A 4JUVA 3BDUA 2X4XA 4C5IA 1JBMA 1VQ8A 5LJ5j 4PFOA 1PNJA 2HNIA 2K2VA 1F1BB 1IREB 3RDVA 3LW5E 3OBWA 3X28B 4M75C 3CPFA 3OYJA 2XK0A 4J9BA 3VS4A 2XU8A 3OYDA 1K8AR 1NLPC 2JN0A 1T0HA 2ZZDA 1N5ZA 4HA8A 3VUBA 3G71T 2K5LA 1UGRB 1NJIU 1VQ5A 4X1VA 2KEAA 4AFSC 2QASA 1ZHIA 3QKJA 1W1FA 1KSWA 2IPOB 1FXXA 3CCET 1VA7A 3CC2A 3SHWA 2XKOC 4PJOB 4A4GA 4C0ZA 1S72T 3BFMA 5FWBA 2DF6A 1RLQC 3LH5A 2DTOA 3KUFA 2L3RA 4PFZA 5LJ5e 1M2OA 1VQKQ 1YITQ 4FSXA 3J81E 2FYKA 2I0NA 3JAME 2VGNA 4PJOG 1D1AA 1G3TA 3MEAA 1U1SA 2FG0A 5GMKh 1QCNA 1ZUKA 1C6VX 3JSCA 4QKUA 5LJ3d 1T3SA 2QA4Q 2LVMA 1J3TA 3R6OA 4JLGA 3VKIA 4IURA 3P8BB 3EFSA 5GAMe 3HPWA 1WHGA 4KUIA 1VQ9Q 2GF7A 4J6WA 1X27A 1K76A 3CMEA 2CZ7B 4PLIA 4ELZC 4E7LA 1BI3A 3EHRA 1R0BG 2AZVA 4DBHA 2LRQA 2ROLA 3CCQA 1YHQQ 3UDCA 2CZ0B 5CKEA 2CP0A 2MMPA 3CC7A 3EH2A 2BTTA 1Q86C 1HYOA 1IB8A 2GCXA 4PLLA 5GAN2 2GNCA 1ACMB 5KYYA 5D6YA 2FRWA 3M0RA 3UA7A 1VQ4A 4M75D 4XTXA 1N8RR 1GCQA 3HSBA 3JCMV 1BB9A 3M0TA 1QCOA 1QW1A 2F5KA 2F2VA 2NUPB 1I07A 1UGVA 2VVKA 4LDUA 2OTLQ 5LJ3j 5KYWB 3CBOA 3CCJA 1TS9A 4OB3B 2L0AA 5GAN7 2JZ2A 2J6KA 1YJ9T 5I2SA 2FO0A 2DL8A 1WI7A 2XG8D 1XNIA 3OW2P 3CQTA 2MWPA 3NPFA 3RNJA 1KC8U 2P0QA 2WSCE 1LVKA 2KROA 3MEUA 4KRTA 3OQ5A 1B34B 3RKYA 5GAOm 4M75F 2RQWA 2NYSA 4C5GA 1R0CB 4NL3A 3G4SA 3META 2O31A 3CMAQ 5C6SA 3V8JA 2CREA 3X24B 1QP2A 3CXCP 3M5AA 2MK5A 1VQOQ 1QCFA 3O8VA 2EKOA 3JCMb 3JCMc 1FX7A 5CKFA 3DLLA 2J6FA 3CCLT 3M54A 3PVQA 3RMSA 5C0MA 2E41A 4Q5WA 3JCMe 3PIOA 3UPUA 3CCMT 1BI1A 4A63B 2OAWA 3SB2A 4PJOE 4FYXB 4F7UF 1N27A 2WACA 3MP1A 1PC0A 5GANf 3CXCA 2LQ8A 1M1KC 1AZEA 1YBYA 4GLKA 2DEQA 4C8QC 2YLCA 2CP7A 1VQPQ 2L3SA 2AKLA 4XTYA 2EAYA 2W10A 1NG2A 1MHNA 4AG1C 1OYXA 3A8OB 4PNOA 1D3BB 4BDYA 2LZ6B 5AYFA 4OGCA 2RI2A 4OMMA 4CC3A 2XDDA 5GANh 1Q81C 4BI8B 4FSSA 3L2VA 3EFOB 4XU2A 5GAOq 2EPDA 4N0AC 3OYCA 5GAN4 2ED0A 4MDWA 4D8KA 3TU4K 1VQNT 3PIPA 3PTAA 3RKXA 1PRMC 1QLYA 2A7YA 4XU1A 1B7TA 4JZ4A 2M51A 4BACA 4M7DA 1QKWA 1YWPA 2QQRA 3A8LB 1RAFB 1OZ2A 1TG0A 3N5BB 5AT1B 2P0PA 1V1CA 2ECZA 1G3WA 2JTEA 1LJOA 1NZ9A 3EG1A 2BIVA 2ZPBB 1K4US 5J39A 2GTJA 4AG2C 2HL5C 1IGUA 2XDPA 3QIIA 4OF1A 2RN8A 1FMVA 2V8JA 3QYHB 3NHNA 5GAN6 4FIBA 1YJNQ 3JB9D 1YHQA 3QO3A 3CCUQ 3T9NA 4XAXB 5A2QE 3CCSA 3OYEA 1ZLMA 1Q7YU 1VQLQ 4CC2A 1GBRA 1VQMQ 2CZ1B 2DO3A 4LUDA 4RTZA 1SRMA 4IIMA 4PJJA 5IH2A 3CC4Q 1ZSZC 2ZPHB 3I55A 3DB3A 2MPXC 1YI2T 2KT1A 3E9GA 2SRCA 4XQ3A 4EPCA 2EYZA 3A8HB 2C06A 1NM7A 1OPKA 5CQXA 2O9VA 1K73U 3JB9F 5FU7C 1BI0A 2LP5A 3G1JA 3CEYA 2QI2A 4ZGJB 4F7UB 5KCOA 2DMOA 1OZ3A 3M59A 1VQ6Q 2JMAA 4L5GA 4R55A 4HVVA 3UA6A 1PRLC 4M78G 2K3XA 1CKBA 1JQQA 5I21A 1PHTA 2D9TA 4KULA 1W70A 2LJ1A 4OGEA 4AFQC 1SPKA 1RAGB 3OYYA 4N4IA 2OTJQ 3FLGA 4A54A 2EQJA 1M1KU 4E7KA 1AWOA 2MYSA 1IGQA 1PM3A 4HCZA 1K9AA 2O9SA 2EFIA 1VQOA 3ULRB 5A0GA 1Y96B 1ZBXA 2KI7A 1ARKA 4JRQA 5FU6B 4OMLA 2QEXQ 1IO6A 2AZSA 4FYWB 2BE9B 3L1AA 4RG2A 4JPBW 1KHIA 1G8XA 1VIFA 2OX7A 3NTIA 1Z9ZA 1KQSS 2E70A 1M3BA 2HL3A 3CCVT 1HSQA 3VS2A 2DKGA 3L2WA 4RTWA 1WJQA 5LJ3g 1RAIB 1D0YA 1OX9A 4IUTA 2V26A 1H3ZA 3ZEHA 3EG2A 1NEGA 3RMQA 4OB0B 2NUPA 2JVVA 2NUTB 1MNEA 1YIJQ 3JV3A 3TCJA 4QT7A 2RK1A 3M4GA 1KD1R 3GNFB 4E47A 1ZA1B 5KYWA 2LCSA 2IG0A 2GGRA 2LJ3A 4EDUA 1ABOA 3X25B 3TREA 1ZX6A 3SD4A 1G3SA 4BE1A 3UWNA 3THKA 4AFUC 4XK8E 2DEUA 2ROTA 4EMKC 3JRZA 1UJ0A 5GANg 1ABQA 8ATCB 1TTHB 3OS5A 3VU3C 4M77G 1G83A 3JCMJ 4HXJA 3NMZC 4GY5A 4LE9A 2K5IA 1M90R 2EJ9A 2RHIA 1OU8A 4E7HA 4XTZA 3VS6A 2DXBA 1XQHA 1YN8A 1VQ8T 3G71Q 2QG9B 1EIFA 1ZSGA 5CQYA 2YWWA 2XI9A 3MHXA 3VJPA 1OX8A 2ENMA 4KH1B 3M56A 3VV0A 4XTWA 2PVDB 4M78E 4OVAA 4QVDA 1VYVA 2R5MA 2CP2A 4IUUA 3L2RA 3CCEQ 5LJ5d 4WF2A 2A08A 1UEBA 3AT1B 3OYFA 2BZ8A 2RD1A 1S72Q 3EGXB 1VQLA 3OYIA 1VQ5T 1LNXA 1MGQA 2KXDA 2E3IA 1GRIA 2MAMA 3M53A 3SWNC 3UF4A 4C8QB 4ZNXA 5IHNA 4ESRA 4EMHA 4FU6A 4LNPA 5GAMd 4C92G 3CC2T 1VQ7A 1AVZC 1B3QA 4XTUA 1TOVA 2YLBA 1U8RA 1UGPB 4C8QG 1RAEB 5FRMA 2YDLA 2F2XA 1Q82U 1ZQ1A 1P92A 2EIFA 4XTVA 3PT9A 1WDXA 2DD4A 1R77A 3DB4A 1VQ6A 4MMKA 4KGVB 1NJIR 1ZUYA 1MV3A 4QVZA 2J06A 1LPLA 2PUKB 1D09B 4OMPA 5KYUB 2XHCA 2CT3A 2OTJA 4RTYA 3QPHA 4JJBA 1N8RC 1FYNA 3C94A 3CMET 4NOYA 1K9MU 1WXBA 5HKCA 1SHFA 3JCMX 3CCRT 5GAMj 2KSSA 3CCQT 1OPLA 3QBYA 2QEXA 1GXIE 3CC7T 1YCYA 4M77E 2KY9A 4HT8A 5GMKl 3LWIA 3KFVA 2DXUA 3EAEA 3EGUA 2BZYA 3TVTA 2XD0A 2F69A 1VQ4T 1ZBJA 4RMOA 4JZ3A 2ATCB 1YJ9Q 2HKNA 4JRKA 1KQ2A 1Z9QA 1JJ2S 1WHJA 5LJ5h 3JB9H 1E6GA 5CIUA 1UUEA 2DILA 2RI5A 1PKTA 1UDLA 3G7ZA 3H41A 2K6DA 2DJQA 4M78A 1K8AU 5KH6A 2MWOA 1ZSZB 3PVLA 4V2SA 2EGAA 5KYXB 2DETA 2ZPGB 1YJWT 1O9SA 4LXCA 4AMCA 5J3BA 3BDLA 2M1HA 5IT9E 1KQ1A 3L2UA 3JCMd 1IHWA 1Y71A 1NPRA 3JCMQ 1BIAA 2VXFA 1W6XA 2RJEA 1Y0MA 3VS0A 4C0DC 5FU7B 4Z88A 4AFZC 5IXFA 2MF2A 4BDZA 3M0QA 2FZKB 3CCLQ 3FJ5A 3G4ST 2X3XD 2KXCA 3PMIA 4ZTJA 3CCMQ 1X69A 2DNUA 1WX6A 1U1TA 4QW2A 4C92E 4BY6C 1QMCA 1VIEA 3VYHB 1YNZA 4MMLA 2DRKA 2DBKA 3M55A 1KJWA 1Y96A 2K4YA 2EGEA 4C8QE 2FPDA 1GCQC 4L59A 4DBQA 1KQSP 2R5AA 1A0NB 1KC8R 5GMKi 2PNIA 5DLQE 2LX7A 3HKSA 3H9NA 1K0SA 2DE0X 1I0CA 4BD3A 2E12A 2NUZA 3LLRA 3CCEA 3C4SA 4J9DA 2K7AA 3PMTA 3OBYA 2DK3A 1KQSA 2NUTA 1NYFA 2XICA 3LGFA 3G6EA 2FHDA 2DX1A 1C1AA 4RCBA 2D6FA 3C95A 4M77A 5I22A 2M0YA 2BUDA 2MI6A 1UECA 5LJ3f 1BCMA 3QDRB 5GAN3 4B6MA 2PU9B 2RI3A 4ORZA 4CC7A 1JXOA 4FW2A 1G3YA 3V7RA 2QK0A 1GBQA 3VRYA 3S3OA 4RCCA 5DLOA 1I8FA 5IN1A 2DL3A 4OB2B 2AHJB 3SEMA 1UGQB 2WSEE 2DAQA 4EMKB 4FYYB 5LJ3h 1GFCA 2HCKA 8AT1B 1SRLA 4GBQA 1WLPB 2M0OA 3JCMh 3M0UA 3RBBB 3H6ZA 2BZXA 1SKUB 1AHJB 1Y07A 2Z0WA 4ME7A 4D8DA 2CDTA 2VUBA 4DEYA 4D6WA 2DIGA 2RQUA 2CT4A 2P0KA 2HEQA 3H0HA 4B9WA 5HK3A 1WHHA 3QSUA 1MMAA 1QVFA 1W2BA 5D6WA 1QKXA 4A4KA 2MIOA 1KK7A 2AIRB 2P84A 3KXTA 3I56T 3AHUA 1YI2Q 4FW1A 2KMTA 3Q1JA 3CCST 4C92A 4DOWA 2JS0A 3C0CA 1WQ7A 4J9HA 3SDZA 1M4ZA 1E7OA 2LQWA 2X9HA 4IIOA 4C8QA 3EGDA 2EYYA 3I55T 2QGGA 1AOJA 3OYAA 3MO8A 1TWBA 2DJZA 5GANe 1VQKA 4M7DC 1YITA 1SF9A 3CD6T 3DKMA 1LOJA 4RUGA 5GJWB 3L2QA 2YUNA 5FW9A 3SWNB 2KVQG 2C0TA 4R0KA 3TSWA 5FROA 3D7SB 1Q86U 3H0FA 1FMWA 5CKBA 2R58A 5LJ5g 3BE3A 1NE8A 2CSQA 3HRUA 4FCYA 3HHTB 3GIBA 2QA4A 4YTLA 3L42A 4IKFA 5FLXE 2QQ9A 4TVRA 1BCOA 1Q7YR 3VYGA 2HBPA 1AWWA 1VQ9A 2DZ9A 4OMFB 2LQKA 3J80E 3CCLA 1I5LA 4LDVA 1ZUUA 2RQRA 3V8LA 5HK0A 2ESWA 5GAMg 1TSFA 3CCVQ 2CGHA 2LX9A 2ED1A 1D1BA 2GBQA 3VRZA 2AKKA 1QWFA 4M75B 2H3JA 2CSIA 3QHSA 4J7FA 4DA4A 2EWNA 1K73R 5CR2A 1KD1C 4KH0B 2KRMA 4LDWA 2PZ1A 3OYMA 2B86A 2LCLA 2O88A 3GPLA 1XJWB 4J9IA 1OOTA 1AZGB 4M75G 1WGSA 4EIKA 2RHXA 1FMKA 2Y90A 4F14A 2OTLA 3QJYA 1UHCA 1JJ2P 2M02A 4E7SA 4PJOA 4J9CA 4J6YA 4E7IA 4O5VA 2KGTA 2QQBA 4A4HA 1NEBA 3V8KA 4HCCA 4LN2A 2C0IA 4JJCA 1YFNA 3QZ5B 1M90C 2PQWA 4K11A 4OMNA 3SFMA 1WZOA 3EG9B 3QWXX 1JJ2A 1AT1B 3RUXA 3OYLA 1V29B 2RH2A 1IHVA 2ZPEB 3QUIA 4F7UG 2JW4A 2LMJA 2YRDA 3CMAA 4M7DD 1NYGA 5HCKA 2LDMA 2E4HA 2RB6A 3MP6A 3ZFJA 2XMFA 1MV0B 2EKHA 2RJDA 1JEGA 1RI0A 1T3LA 4ELYC 3KBGA 1VQ8Q 3S6WA 2F1LA 2ZGWA 2JXBA 4RTUA 3H0IA 1QP3A 2FRYA 4RTTA 1XOVA 2DPPB 4C0DB 3JB9J 1X43A 1Q81U 2LCCA 2JOYA 4HCKA 5A0DA 1VOMA 3FC3A 2CP6A 3GNGA 4BY6B 5IHIA 1VQ5Q 3TSZA 5KYYB 1X75C 1JXMA 3JCMg 4KT0E 1VQPA 2RMOA 4QQ6A 4CC4B 3RIRA 2KNBB 4M7DF 1PSEA 2DERA 5CCAA 4WTOB 1O75A 1Y57A 4F04B 2DXCA 4A4FA 2EJFA 3M0SA 1C0MA 3PFSA 2V8KA 1BK2A 3CC2Q 1EFNA 5CK9A 3JB9I 1VQLT 2DVEA 2DBMA 2KYBA 3ER0A 4PKCC 4KGZB 5FWCA 1NJIC 1UG1A 1B07A 1X01A 1B34A 4QVCA 2HAXA 2BKDN 2EYQA 2Y4YA 4JRPA 5J26A 4HVUA 4PL6A 1VQ7T 1X6GA 3LGLA 4IUQA 3E1SA 4JS5A 3CBMA 4HVWA 4M75E 2CS7A 1WXTA 2RK2A 3A8MB 2CP3A 1X2KA 2O2OA 1QVFS 2HZYA 1W2BS 3A98A 2LQNA 3CMEQ 1UGSB 2FEIA 4Y92A 3OS1A 5I2MA 2XDBA 3CCRQ 3OB9A 2DM1A 2DA9A 4C0FA 3CCQQ 2VKNA 3ZL7C 2PVOB 2LNHB 3CC7Q 2QDYB 1UTIA 3M58A 1N9SA 4FT4A 4M7AC 1M2VB 1MNDA 5GAOl 1M8VA 2E3HA 1YJNA 2KRNA 1QWEA 4ANJA 1JO8A 3CCUA 1NPPA 2VB6A 2RHYA 2RHZA 3DLMA 4F7UE 5GAN8 3JB9G 2ZAEA 1MMGA 1D3BA 2K9GA 4RTVA 5EC7A 1VQMA 1Q82R 4WCIA 1M90U 2JM9A 2A37A 3CC4A 3VS7A 2LT4A 1PWTA 2YSQA 4J8OA 1M1GA 3HFOA 4IUVA 4LDYA 1QVGA 1YJWQ 4DBRA 3EFOA 1MUZA 4J6XA 5M9OA 1UJYA 2R57A 2H8HA 2RF0A 3V7CA 2CKKA 2EQMA 2A0FB 2E6ZA 4LD9K 2KE9A 2GQIA 1RAAB 1YCSB 3P8DA 1Q95G 4PJLA 1SG5A 3G4SQ 3PGGA 4A53A 4F17A 1OEBA 2YUQA 2QAZA 4M7DB 5D7UA 2F5TX 2RA2A 2KYMA 3A5ZB 2L5QA 4J83A 1U3OA 2W0ZA 4PJNA 1KC8C 2LNVA 2EQKA 2HSEB 5CKDA 5DM7R 2HD0A 3REAB 1WIEA 4M7DG 2JT4A 2EGCA 1KHCA 3REBB 5LJ5f 1EX4A 2AK5A 4OMOA 6AT1B 2P4RA 4N4HA 1M3CA 2PUOB 1RAHB 2JJ9A 3HRSA 5GMKj 4M75A 3R6NA 2CH4A 3LX7A 2JUFA 3RKWA 1U5SA 5IHKA 1IXDA 4II1A 2YT6A 4M7AD 3PNWC 2JTMA 2YHTA 4M78C 1UE9A 5GAMf 3OMGA 3E19A 3FB9A 2RHUA 3CPWS 2I2LA 4RG8A 3URGA 1YIJA 2ZPIB 2KQWA 1FWZA 4ZN3A 3FIFA 1N6AA 3CCJT 2VASA 2EQUA 4E7ZA 2ZCFB 2EQIA 2RQTA 5L8RE 2MCNA 3G6ET 4F7UA 3I5RA 5GAMh 1QVPA 3M0PA 3H8ZA 1M27C 4UC4A 1NLOC 3EG9A 4X34A 4ZN1A 1PD0A 2DLPA 4M7AF 2K2MA 1I81A 1U06A 5GMKe 1K0XA 4RTXA 2JS2A 2FB7A 2C0OA 2V1RA 1H3HA 3WVDB 2KK4A 2DVJA 2KDSA 3A1PA 3HP9A 4Z02A 4P5NA 3QJ6A 5FU6C 5HY6A 3I35A 1WHKA 2KRSA 1OV3A 1I5OB 1S1NA 4ZTFA 3MJXA 1G2BA 1TXQA 3TEEA 1TH7A 2O4XB 2X3WD 3GF5A 1PSFA 4OMQA 5GAN5 1R8OB 1SEMA 3CCRA 4KBMB 1M3AA 5ECAA 3QZ9B 3G71A 2PVGB 1M5Q1 1ZA2B 3FEOA 4X9CA 5GAOr 3JCMW 2L2PA 3I56Q 4LUEA 3CCSQ 1X2QA 4CI0C 3V7SA 1SSHA 3E2UA 2RJCA 4OP0A 3OYBA 2OAUA 5GANd 4BI3A 3WVEB 1RL2A 4N4GA 3OSVA 1UFFA 3NGPA 2XIDA 2E5KA 1S72A 3EG3A 3I55Q 2COZA 2Y4XA 3VUZA 1SSFA 4J9FA 1WFWA 4M77C 1VQNQ 2D8JA 2O01E 4JJDA 2A36A 4M7DE 3CD6Q 1WHMA 1HD3A
chains in the Genus database with same CATH topology
3G71Q 1VQKQ 1YITQ 1YJNQ 1VQ9Q 3CC2Q 3G6EQ 3CCQQ 1VQ6Q 3CCUQ 3CCVQ 1VQ8Q 1Q82R 3CC7Q 1VQ5Q 1QVFP 1VQ7Q 1W2BP 1M90R 3CMAQ 1K8AR 3CCLQ 1KQSP 2QEXQ 1JJ2P 1YI2Q 1Q7YR 3I55Q 1N8RR 1VQLQ 2OTJQ 3CCMQ 3CCEQ 3OW2P 1K9MR 1VQMQ 1YHQQ 1YJ9Q 1YIJQ 3CXCP 1K73R 1VQOQ 1KC8R 3G4SQ 3CMEQ 3CCJQ 3I56Q 3CPWP 1Q81R 2QA4Q 1NJIR 1Q86R 1QVGP 1YJWQ 1VQNQ 1KD1R 1VQ4Q 3CCSQ 3CD6Q 1M1KR 2OTLQ 3CC4Q 1VQPQ 1S72Q 3CCRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Q;  1VQK Q;  1YIT Q;  1YJN Q;  1VQ9 Q;  3CC2 Q;  3G6E Q;  3CCQ Q;  1VQ6 Q;  3CCU Q;  3CCV Q;  1VQ8 Q;  1Q82 R;  3CC7 Q;  1VQ5 Q;  1QVF P;  1VQ7 Q;  1W2B P;  1M90 R;  3CMA Q;  1K8A R;  3CCL Q;  1KQS P;  2QEX Q;  1JJ2 P;  1YI2 Q;  1Q7Y R;  3I55 Q;  1N8R R;  1VQL Q;  2OTJ Q;  3CCM Q;  3CCE Q;  3OW2 P;  1K9M R;  1VQM Q;  1YHQ Q;  1YJ9 Q;  1YIJ Q;  3CXC P;  1K73 R;  1VQO Q;  1KC8 R;  3G4S Q;  3CME Q;  3CCJ Q;  3I56 Q;  3CPW P;  1Q81 R;  2QA4 Q;  1NJI R;  1Q86 R;  1QVG P;  1YJW Q;  1VQN Q;  1KD1 R;  1VQ4 Q;  3CCS Q;  3CD6 Q;  1M1K R;  2OTL Q;  3CC4 Q;  1VQP Q;  1S72 Q;  3CCR Q; 
#chains in the Genus database with same CATH topology
 1RAB B;  4DEX A;  1YP5 A;  2J7I A;  2EJG A;  3QG1 A;  4RKU E;  1YJW A;  1AWJ A;  1CKA A;  1X6B A;  3JCM f;  4M78 D;  1Q7Y C;  2QTX A;  4MDX A;  3VS1 A;  1N8R U;  1RLP C;  1UB4 A;  2DFU A;  5CVI A;  1V76 A;  2LJ0 A;  1VQK T;  1YIT T;  2LC4 A;  3HTR A;  1M30 A;  2X4J A;  1WHL A;  3A8G B;  1BYM A;  4DBF A;  4DQ2 A;  1QVF P;  3GP8 A;  4PK4 A;  1PCX A;  2WSF E;  2OI3 A;  2ZPF B;  1W2B P;  5KE3 A;  5GAN j;  2PTK A;  1H92 A;  3OYH A;  3FRN A;  2RM4 A;  1I1J A;  2QA4 T;  1WXU A;  4JRI A;  3OW2 A;  4C5H A;  2L89 A;  1K73 C;  2QYZ A;  4JLI A;  1OU9 A;  2D8H A;  1VQ9 T;  1RI9 A;  2DL5 A;  3S3M A;  1KG1 A;  1JU5 C;  2GFA A;  2QXF A;  4M78 F;  1I4K 1;  5LJ3 e;  1QVG S;  2JNG A;  1PD1 A;  5IAY A;  1M2V A;  4C92 C;  2IVW A;  1AD5 A;  2DL4 A;  5D6X A;  1YHQ T;  1EZZ B;  3NTH A;  3FDR A;  3HFN A;  2FZC B;  3LYI A;  4FL6 A;  1XTD A;  2V1Q A;  2DZC A;  4Y28 E;  1VUB A;  5CAI A;  3FJP A;  3EGX A;  4M7A B;  2HSP A;  1Q86 R;  2DRM A;  3OY9 A;  3QYG B;  3I9Q A;  2L8D A;  1YJ9 A;  1X6O A;  3M9Q A;  2EVR A;  3HL8 A;  9ATC B;  4X9D A;  3X26 B;  2E65 A;  2VC8 A;  1CSK A;  3JCM P;  2OTL T;  4M7A G;  2GTO A;  1LCK A;  4L6V 5;  2QGF B;  1OQK A;  3MEW A;  1HK9 A;  1VYU A;  2VXE A;  4XU3 A;  2LT1 A;  1E6H A;  1RAD B;  1H8K A;  2IIM A;  4M77 D;  2VGM A;  4NL2 A;  3ZBD A;  4FT2 A;  2BE7 D;  3O5Z A;  2E64 A;  2K79 A;  3OMC A;  2EYX A;  3IQL A;  2COY A;  4OB1 B;  1W4S A;  1PG5 B;  1K1Z A;  4N0A A;  5GAO n;  1OUL A;  4A4E A;  5GMK m;  4O6J A;  2FVU A;  2JTF A;  4JS4 A;  4Z89 A;  2J05 A;  5KYU A;  4JDS A;  4E6R A;  4BE0 A;  3RR6 A;  3CCM A;  3CMA T;  1AWX A;  2X4W A;  2E1H A;  3EH1 A;  1VQO T;  1GFD A;  2KBT A;  3RER A;  3GLX A;  4KUD K;  1M8M A;  4M77 F;  3BW1 A;  2CYZ B;  3WXM B;  2KT8 A;  3ASK A;  4C5E A;  4IUP A;  2D0Q B;  2RQV A;  4XU0 A;  2QQA A;  4Y91 A;  2QTV A;  3U23 A;  4PJO C;  1HXD A;  1DJ7 B;  3UT1 A;  3I56 A;  2CUB A;  4PJM A;  2NLU A;  1Y7X A;  7AT1 B;  1BU1 A;  1YWO A;  5LL6 S;  2E10 A;  2E5Q A;  5DY9 A;  2HBW A;  1VQP T;  4C92 D;  3CPW P;  2L3P A;  4EMG A;  3GOX A;  2YUO A;  1M1K R;  2FZG B;  2V8I A;  2VWF A;  3I5S A;  2E6N A;  3M57 A;  1IZ6 A;  4C8Q D;  1VQN A;  4BUG A;  2DL7 A;  1WYX A;  1ZSZ A;  1VQ7 Q;  2VV5 A;  3CD6 A;  5KYX A;  3TQ7 P;  4M78 B;  2RPN A;  3L2Z A;  3P8H A;  2JM8 A;  4DOV A;  1Q81 R;  3CPW A;  2HMA A;  2HQX A;  3HRT A;  1WJS A;  5GAO p;  4HKE A;  3OYK A;  2HQH A;  2YUP A;  4C92 F;  3OYG A;  2FL7 A;  3EG0 A;  4Z8A A;  1HJD A;  3OS2 A;  2D0N A;  1JB0 E;  1M1F A;  4M7A E;  4MZM A;  2GFU A;  2GQV A;  4FYV B;  4HCB A;  4C8Q F;  2FPF A;  1WJR A;  2B8A A;  2EYW A;  3LH0 A;  3CBP A;  2VYT A;  4GLM A;  1D1C A;  3GBQ A;  2K5F A;  1Q82 C;  2O4X A;  3NFC A;  3X20 B;  4HT9 A;  4MZP A;  4FM4 B;  2A3L A;  4AT1 B;  1BI2 A;  1WPY A;  2COW A;  2G3R A;  2G6F X;  4PFP A;  4BE2 A;  4NS5 A;  2YRV A;  1KIK A;  2P4T A;  3EHQ A;  3J7A F;  4J7I A;  3OYN A;  1YJN T;  1GCP A;  2LTO A;  3CCU T;  1MMN A;  1YI2 A;  2L3Q A;  2OJ2 A;  2SEM A;  2FPE A;  4E2F B;  4MZT A;  1VQM T;  2HQE A;  4CRI A;  2DYB A;  4LDX A;  4ATO A;  1JRI A;  1K9M C;  4QQD A;  4PJO D;  3MPU B;  2CH4 W;  2JMC A;  3CC4 T;  1BBZ A;  3LWH A;  2RJF A;  2H3E B;  2DD5 A;  3BY7 A;  4BI4 A;  3E9F A;  1N9R A;  3MEV A;  3OS0 A;  1TUD A;  5I11 A;  3OW2 S;  2DYI A;  3M4Y A;  4E7J A;  4J9E A;  4M77 B;  4ZGE B;  3OA6 A;  4BB7 A;  3MKD A;  4KGX B;  2AT1 B;  3NTK A;  3QWY A;  5KE2 A;  5CO7 A;  1WA7 A;  4J5Y A;  5IXB A;  1TU0 B;  2K3Y A;  2X4Y A;  1KD1 U;  1VQ6 T;  2DTH A;  1KFZ A;  2DXT A;  4EMK A;  5KCH A;  1NBE B;  3CXC S;  4C0G A;  2K57 A;  2CZ6 B;  3C12 A;  4F16 A;  4PJO F;  1D0Z A;  5GJV B;  1K8A C;  2ABL A;  2RO0 A;  1TUC A;  2X35 A;  2OTJ T;  5L23 A;  2KR3 A;  2HKQ B;  3CCV A;  1PKS A;  1QVG P;  2CUD A;  4JJN K;  5FRN A;  1VQ4 Q;  1QQJ A;  1MMD A;  1OI1 A;  4J9G A;  2YXY A;  4QQG A;  1G5V A;  2NWM A;  3QXE B;  4R56 A;  2X51 A;  2QEX T;  3MCA B;  3UAT A;  2DTI A;  1UHF A;  1WNL A;  2D1X A;  3INZ A;  5KYN A;  4M7A A;  5EG2 A;  3CCJ Q;  4C92 B;  3MP8 A;  2DIQ A;  3ME9 A;  2EBP A;  4LD6 A;  2J6O A;  3G6E Q;  2M16 A;  4ZGD B;  1TUG B;  1T0J A;  1WQW A;  1AEY A;  2QQS A;  3EGD B;  4VUB A;  3EFR A;  1YIJ T;  3S3N A;  1H64 1;  1GL5 A;  2CP5 A;  1RAC B;  2M9U A;  4B9X A;  1K9M R;  2EW3 A;  1BKB A;  2F2W A;  3SWN A;  2HDA A;  5CKH A;  3PE0 A;  3QDF A;  2RNA A;  1IRX A;  1BIB A;  4M4Z A;  2K3B A;  1SHG A;  2MOX A;  3RES A;  3OSS C;  2A28 A;  1RUW A;  3F70 A;  3VS5 A;  1D0X A;  1VYT A;  2YRC A;  2KAF A;  1M9S A;  2QDL A;  5A0L A;  3VS3 A;  4JUV A;  3BDU A;  2X4X A;  4C5I A;  1JBM A;  1VQ8 A;  5LJ5 j;  4PFO A;  1PNJ A;  2HNI A;  2K2V A;  1F1B B;  1IRE B;  3RDV A;  3LW5 E;  3OBW A;  3X28 B;  4M75 C;  3CPF A;  3OYJ A;  2XK0 A;  4J9B A;  3VS4 A;  2XU8 A;  3OYD A;  1K8A R;  1NLP C;  2JN0 A;  1T0H A;  2ZZD A;  1N5Z A;  4HA8 A;  3VUB A;  3G71 T;  2K5L A;  1UGR B;  1NJI U;  1VQ5 A;  4X1V A;  2KEA A;  4AFS C;  2QAS A;  1ZHI A;  3QKJ A;  1W1F A;  1KSW A;  2IPO B;  1FXX A;  3CCE T;  1VA7 A;  3CC2 A;  3SHW A;  2XKO C;  4PJO B;  4A4G A;  4C0Z A;  1S72 T;  3BFM A;  5FWB A;  2DF6 A;  1RLQ C;  3LH5 A;  2DTO A;  3KUF A;  2L3R A;  4PFZ A;  5LJ5 e;  1M2O A;  1VQK Q;  1YIT Q;  4FSX A;  3J81 E;  2FYK A;  2I0N A;  3JAM E;  2VGN A;  4PJO G;  1D1A A;  1G3T A;  3MEA A;  1U1S A;  2FG0 A;  5GMK h;  1QCN A;  1ZUK A;  1C6V X;  3JSC A;  4QKU A;  5LJ3 d;  1T3S A;  2QA4 Q;  2LVM A;  1J3T A;  3R6O A;  4JLG A;  3VKI A;  4IUR A;  3P8B B;  3EFS A;  5GAM e;  3HPW A;  1WHG A;  4KUI A;  1VQ9 Q;  2GF7 A;  4J6W A;  1X27 A;  1K76 A;  3CME A;  2CZ7 B;  4PLI A;  4ELZ C;  4E7L A;  1BI3 A;  3EHR A;  1R0B G;  2AZV A;  4DBH A;  2LRQ A;  2ROL A;  3CCQ A;  1YHQ Q;  3UDC A;  2CZ0 B;  5CKE A;  2CP0 A;  2MMP A;  3CC7 A;  3EH2 A;  2BTT A;  1Q86 C;  1HYO A;  1IB8 A;  2GCX A;  4PLL A;  5GAN 2;  2GNC A;  1ACM B;  5KYY A;  5D6Y A;  2FRW A;  3M0R A;  3UA7 A;  1VQ4 A;  4M75 D;  4XTX A;  1N8R R;  1GCQ A;  3HSB A;  3JCM V;  1BB9 A;  3M0T A;  1QCO A;  1QW1 A;  2F5K A;  2F2V A;  2NUP B;  1I07 A;  1UGV A;  2VVK A;  4LDU A;  2OTL Q;  5LJ3 j;  5KYW B;  3CBO A;  3CCJ A;  1TS9 A;  4OB3 B;  2L0A A;  5GAN 7;  2JZ2 A;  2J6K A;  1YJ9 T;  5I2S A;  2FO0 A;  2DL8 A;  1WI7 A;  2XG8 D;  1XNI A;  3OW2 P;  3CQT A;  2MWP A;  3NPF A;  3RNJ A;  1KC8 U;  2P0Q A;  2WSC E;  1LVK A;  2KRO A;  3MEU A;  4KRT A;  3OQ5 A;  1B34 B;  3RKY A;  5GAO m;  4M75 F;  2RQW A;  2NYS A;  4C5G A;  1R0C B;  4NL3 A;  3G4S A;  3MET A;  2O31 A;  3CMA Q;  5C6S A;  3V8J A;  2CRE A;  3X24 B;  1QP2 A;  3CXC P;  3M5A A;  2MK5 A;  1VQO Q;  1QCF A;  3O8V A;  2EKO A;  3JCM b;  3JCM c;  1FX7 A;  5CKF A;  3DLL A;  2J6F A;  3CCL T;  3M54 A;  3PVQ A;  3RMS A;  5C0M A;  2E41 A;  4Q5W A;  3JCM e;  3PIO A;  3UPU A;  3CCM T;  1BI1 A;  4A63 B;  2OAW A;  3SB2 A;  4PJO E;  4FYX B;  4F7U F;  1N27 A;  2WAC A;  3MP1 A;  1PC0 A;  5GAN f;  3CXC A;  2LQ8 A;  1M1K C;  1AZE A;  1YBY A;  4GLK A;  2DEQ A;  4C8Q C;  2YLC A;  2CP7 A;  1VQP Q;  2L3S A;  2AKL A;  4XTY A;  2EAY A;  2W10 A;  1NG2 A;  1MHN A;  4AG1 C;  1OYX A;  3A8O B;  4PNO A;  1D3B B;  4BDY A;  2LZ6 B;  5AYF A;  4OGC A;  2RI2 A;  4OMM A;  4CC3 A;  2XDD A;  5GAN h;  1Q81 C;  4BI8 B;  4FSS A;  3L2V A;  3EFO B;  4XU2 A;  5GAO q;  2EPD A;  4N0A C;  3OYC A;  5GAN 4;  2ED0 A;  4MDW A;  4D8K A;  3TU4 K;  1VQN T;  3PIP A;  3PTA A;  3RKX A;  1PRM C;  1QLY A;  2A7Y A;  4XU1 A;  1B7T A;  4JZ4 A;  2M51 A;  4BAC A;  4M7D A;  1QKW A;  1YWP A;  2QQR A;  3A8L B;  1RAF B;  1OZ2 A;  1TG0 A;  3N5B B;  5AT1 B;  2P0P A;  1V1C A;  2ECZ A;  1G3W A;  2JTE A;  1LJO A;  1NZ9 A;  3EG1 A;  2BIV A;  2ZPB B;  1K4U S;  5J39 A;  2GTJ A;  4AG2 C;  2HL5 C;  1IGU A;  2XDP A;  3QII A;  4OF1 A;  2RN8 A;  1FMV A;  2V8J A;  3QYH B;  3NHN A;  5GAN 6;  4FIB A;  1YJN Q;  3JB9 D;  1YHQ A;  3QO3 A;  3CCU Q;  3T9N A;  4XAX B;  5A2Q E;  3CCS A;  3OYE A;  1ZLM A;  1Q7Y U;  1VQL Q;  4CC2 A;  1GBR A;  1VQM Q;  2CZ1 B;  2DO3 A;  4LUD A;  4RTZ A;  1SRM A;  4IIM A;  4PJJ A;  5IH2 A;  3CC4 Q;  1ZSZ C;  2ZPH B;  3I55 A;  3DB3 A;  2MPX C;  1YI2 T;  2KT1 A;  3E9G A;  2SRC A;  4XQ3 A;  4EPC A;  2EYZ A;  3A8H B;  2C06 A;  1NM7 A;  1OPK A;  5CQX A;  2O9V A;  1K73 U;  3JB9 F;  5FU7 C;  1BI0 A;  2LP5 A;  3G1J A;  3CEY A;  2QI2 A;  4ZGJ B;  4F7U B;  5KCO A;  2DMO A;  1OZ3 A;  3M59 A;  1VQ6 Q;  2JMA A;  4L5G A;  4R55 A;  4HVV A;  3UA6 A;  1PRL C;  4M78 G;  2K3X A;  1CKB A;  1JQQ A;  5I21 A;  1PHT A;  2D9T A;  4KUL A;  1W70 A;  2LJ1 A;  4OGE A;  4AFQ C;  1SPK A;  1RAG B;  3OYY A;  4N4I A;  2OTJ Q;  3FLG A;  4A54 A;  2EQJ A;  1M1K U;  4E7K A;  1AWO A;  2MYS A;  1IGQ A;  1PM3 A;  4HCZ A;  1K9A A;  2O9S A;  2EFI A;  1VQO A;  3ULR B;  5A0G A;  1Y96 B;  1ZBX A;  2KI7 A;  1ARK A;  4JRQ A;  5FU6 B;  4OML A;  2QEX Q;  1IO6 A;  2AZS A;  4FYW B;  2BE9 B;  3L1A A;  4RG2 A;  4JPB W;  1KHI A;  1G8X A;  1VIF A;  2OX7 A;  3NTI A;  1Z9Z A;  1KQS S;  2E70 A;  1M3B A;  2HL3 A;  3CCV T;  1HSQ A;  3VS2 A;  2DKG A;  3L2W A;  4RTW A;  1WJQ A;  5LJ3 g;  1RAI B;  1D0Y A;  1OX9 A;  4IUT A;  2V26 A;  1H3Z A;  3ZEH A;  3EG2 A;  1NEG A;  3RMQ A;  4OB0 B;  2NUP A;  2JVV A;  2NUT B;  1MNE A;  1YIJ Q;  3JV3 A;  3TCJ A;  4QT7 A;  2RK1 A;  3M4G A;  1KD1 R;  3GNF B;  4E47 A;  1ZA1 B;  5KYW A;  2LCS A;  2IG0 A;  2GGR A;  2LJ3 A;  4EDU A;  1ABO A;  3X25 B;  3TRE A;  1ZX6 A;  3SD4 A;  1G3S A;  4BE1 A;  3UWN A;  3THK A;  4AFU C;  4XK8 E;  2DEU A;  2ROT A;  4EMK C;  3JRZ A;  1UJ0 A;  5GAN g;  1ABQ A;  8ATC B;  1TTH B;  3OS5 A;  3VU3 C;  4M77 G;  1G83 A;  3JCM J;  4HXJ A;  3NMZ C;  4GY5 A;  4LE9 A;  2K5I A;  1M90 R;  2EJ9 A;  2RHI A;  1OU8 A;  4E7H A;  4XTZ A;  3VS6 A;  2DXB A;  1XQH A;  1YN8 A;  1VQ8 T;  3G71 Q;  2QG9 B;  1EIF A;  1ZSG A;  5CQY A;  2YWW A;  2XI9 A;  3MHX A;  3VJP A;  1OX8 A;  2ENM A;  4KH1 B;  3M56 A;  3VV0 A;  4XTW A;  2PVD B;  4M78 E;  4OVA A;  4QVD A;  1VYV A;  2R5M A;  2CP2 A;  4IUU A;  3L2R A;  3CCE Q;  5LJ5 d;  4WF2 A;  2A08 A;  1UEB A;  3AT1 B;  3OYF A;  2BZ8 A;  2RD1 A;  1S72 Q;  3EGX B;  1VQL A;  3OYI A;  1VQ5 T;  1LNX A;  1MGQ A;  2KXD A;  2E3I A;  1GRI A;  2MAM A;  3M53 A;  3SWN C;  3UF4 A;  4C8Q B;  4ZNX A;  5IHN A;  4ESR A;  4EMH A;  4FU6 A;  4LNP A;  5GAM d;  4C92 G;  3CC2 T;  1VQ7 A;  1AVZ C;  1B3Q A;  4XTU A;  1TOV A;  2YLB A;  1U8R A;  1UGP B;  4C8Q G;  1RAE B;  5FRM A;  2YDL A;  2F2X A;  1Q82 U;  1ZQ1 A;  1P92 A;  2EIF A;  4XTV A;  3PT9 A;  1WDX A;  2DD4 A;  1R77 A;  3DB4 A;  1VQ6 A;  4MMK A;  4KGV B;  1NJI R;  1ZUY A;  1MV3 A;  4QVZ A;  2J06 A;  1LPL A;  2PUK B;  1D09 B;  4OMP A;  5KYU B;  2XHC A;  2CT3 A;  2OTJ A;  4RTY A;  3QPH A;  4JJB A;  1N8R C;  1FYN A;  3C94 A;  3CME T;  4NOY A;  1K9M U;  1WXB A;  5HKC A;  1SHF A;  3JCM X;  3CCR T;  5GAM j;  2KSS A;  3CCQ T;  1OPL A;  3QBY A;  2QEX A;  1GXI E;  3CC7 T;  1YCY A;  4M77 E;  2KY9 A;  4HT8 A;  5GMK l;  3LWI A;  3KFV A;  2DXU A;  3EAE A;  3EGU A;  2BZY A;  3TVT A;  2XD0 A;  2F69 A;  1VQ4 T;  1ZBJ A;  4RMO A;  4JZ3 A;  2ATC B;  1YJ9 Q;  2HKN A;  4JRK A;  1KQ2 A;  1Z9Q A;  1JJ2 S;  1WHJ A;  5LJ5 h;  3JB9 H;  1E6G A;  5CIU A;  1UUE A;  2DIL A;  2RI5 A;  1PKT A;  1UDL A;  3G7Z A;  3H41 A;  2K6D A;  2DJQ A;  4M78 A;  1K8A U;  5KH6 A;  2MWO A;  1ZSZ B;  3PVL A;  4V2S A;  2EGA A;  5KYX B;  2DET A;  2ZPG B;  1YJW T;  1O9S A;  4LXC A;  4AMC A;  5J3B A;  3BDL A;  2M1H A;  5IT9 E;  1KQ1 A;  3L2U A;  3JCM d;  1IHW A;  1Y71 A;  1NPR A;  3JCM Q;  1BIA A;  2VXF A;  1W6X A;  2RJE A;  1Y0M A;  3VS0 A;  4C0D C;  5FU7 B;  4Z88 A;  4AFZ C;  5IXF A;  2MF2 A;  4BDZ A;  3M0Q A;  2FZK B;  3CCL Q;  3FJ5 A;  3G4S T;  2X3X D;  2KXC A;  3PMI A;  4ZTJ A;  3CCM Q;  1X69 A;  2DNU A;  1WX6 A;  1U1T A;  4QW2 A;  4C92 E;  4BY6 C;  1QMC A;  1VIE A;  3VYH B;  1YNZ A;  4MML A;  2DRK A;  2DBK A;  3M55 A;  1KJW A;  1Y96 A;  2K4Y A;  2EGE A;  4C8Q E;  2FPD A;  1GCQ C;  4L59 A;  4DBQ A;  1KQS P;  2R5A A;  1A0N B;  1KC8 R;  5GMK i;  2PNI A;  5DLQ E;  2LX7 A;  3HKS A;  3H9N A;  1K0S A;  2DE0 X;  1I0C A;  4BD3 A;  2E12 A;  2NUZ A;  3LLR A;  3CCE A;  3C4S A;  4J9D A;  2K7A A;  3PMT A;  3OBY A;  2DK3 A;  1KQS A;  2NUT A;  1NYF A;  2XIC A;  3LGF A;  3G6E A;  2FHD A;  2DX1 A;  1C1A A;  4RCB A;  2D6F A;  3C95 A;  4M77 A;  5I22 A;  2M0Y A;  2BUD A;  2MI6 A;  1UEC A;  5LJ3 f;  1BCM A;  3QDR B;  5GAN 3;  4B6M A;  2PU9 B;  2RI3 A;  4ORZ A;  4CC7 A;  1JXO A;  4FW2 A;  1G3Y A;  3V7R A;  2QK0 A;  1GBQ A;  3VRY A;  3S3O A;  4RCC A;  5DLO A;  1I8F A;  5IN1 A;  2DL3 A;  4OB2 B;  2AHJ B;  3SEM A;  1UGQ B;  2WSE E;  2DAQ A;  4EMK B;  4FYY B;  5LJ3 h;  1GFC A;  2HCK A;  8AT1 B;  1SRL A;  4GBQ A;  1WLP B;  2M0O A;  3JCM h;  3M0U A;  3RBB B;  3H6Z A;  2BZX A;  1SKU B;  1AHJ B;  1Y07 A;  2Z0W A;  4ME7 A;  4D8D A;  2CDT A;  2VUB A;  4DEY A;  4D6W A;  2DIG A;  2RQU A;  2CT4 A;  2P0K A;  2HEQ A;  3H0H A;  4B9W A;  5HK3 A;  1WHH A;  3QSU A;  1MMA A;  1QVF A;  1W2B A;  5D6W A;  1QKX A;  4A4K A;  2MIO A;  1KK7 A;  2AIR B;  2P84 A;  3KXT A;  3I56 T;  3AHU A;  1YI2 Q;  4FW1 A;  2KMT A;  3Q1J A;  3CCS T;  4C92 A;  4DOW A;  2JS0 A;  3C0C A;  1WQ7 A;  4J9H A;  3SDZ A;  1M4Z A;  1E7O A;  2LQW A;  2X9H A;  4IIO A;  4C8Q A;  3EGD A;  2EYY A;  3I55 T;  2QGG A;  1AOJ A;  3OYA A;  3MO8 A;  1TWB A;  2DJZ A;  5GAN e;  1VQK A;  4M7D C;  1YIT A;  1SF9 A;  3CD6 T;  3DKM A;  1LOJ A;  4RUG A;  5GJW B;  3L2Q A;  2YUN A;  5FW9 A;  3SWN B;  2KVQ G;  2C0T A;  4R0K A;  3TSW A;  5FRO A;  3D7S B;  1Q86 U;  3H0F A;  1FMW A;  5CKB A;  2R58 A;  5LJ5 g;  3BE3 A;  1NE8 A;  2CSQ A;  3HRU A;  4FCY A;  3HHT B;  3GIB A;  2QA4 A;  4YTL A;  3L42 A;  4IKF A;  5FLX E;  2QQ9 A;  4TVR A;  1BCO A;  1Q7Y R;  3VYG A;  2HBP A;  1AWW A;  1VQ9 A;  2DZ9 A;  4OMF B;  2LQK A;  3J80 E;  3CCL A;  1I5L A;  4LDV A;  1ZUU A;  2RQR A;  3V8L A;  5HK0 A;  2ESW A;  5GAM g;  1TSF A;  3CCV Q;  2CGH A;  2LX9 A;  2ED1 A;  1D1B A;  2GBQ A;  3VRZ A;  2AKK A;  1QWF A;  4M75 B;  2H3J A;  2CSI A;  3QHS A;  4J7F A;  4DA4 A;  2EWN A;  1K73 R;  5CR2 A;  1KD1 C;  4KH0 B;  2KRM A;  4LDW A;  2PZ1 A;  3OYM A;  2B86 A;  2LCL A;  2O88 A;  3GPL A;  1XJW B;  4J9I A;  1OOT A;  1AZG B;  4M75 G;  1WGS A;  4EIK A;  2RHX A;  1FMK A;  2Y90 A;  4F14 A;  2OTL A;  3QJY A;  1UHC A;  1JJ2 P;  2M02 A;  4E7S A;  4PJO A;  4J9C A;  4J6Y A;  4E7I A;  4O5V A;  2KGT A;  2QQB A;  4A4H A;  1NEB A;  3V8K A;  4HCC A;  4LN2 A;  2C0I A;  4JJC A;  1YFN A;  3QZ5 B;  1M90 C;  2PQW A;  4K11 A;  4OMN A;  3SFM A;  1WZO A;  3EG9 B;  3QWX X;  1JJ2 A;  1AT1 B;  3RUX A;  3OYL A;  1V29 B;  2RH2 A;  1IHV A;  2ZPE B;  3QUI A;  4F7U G;  2JW4 A;  2LMJ A;  2YRD A;  3CMA A;  4M7D D;  1NYG A;  5HCK A;  2LDM A;  2E4H A;  2RB6 A;  3MP6 A;  3ZFJ A;  2XMF A;  1MV0 B;  2EKH A;  2RJD A;  1JEG A;  1RI0 A;  1T3L A;  4ELY C;  3KBG A;  1VQ8 Q;  3S6W A;  2F1L A;  2ZGW A;  2JXB A;  4RTU A;  3H0I A;  1QP3 A;  2FRY A;  4RTT A;  1XOV A;  2DPP B;  4C0D B;  3JB9 J;  1X43 A;  1Q81 U;  2LCC A;  2JOY A;  4HCK A;  5A0D A;  1VOM A;  3FC3 A;  2CP6 A;  3GNG A;  4BY6 B;  5IHI A;  1VQ5 Q;  3TSZ A;  5KYY B;  1X75 C;  1JXM A;  3JCM g;  4KT0 E;  1VQP A;  2RMO A;  4QQ6 A;  4CC4 B;  3RIR A;  2KNB B;  4M7D F;  1PSE A;  2DER A;  5CCA A;  4WTO B;  1O75 A;  1Y57 A;  4F04 B;  2DXC A;  4A4F A;  2EJF A;  3M0S A;  1C0M A;  3PFS A;  2V8K A;  1BK2 A;  3CC2 Q;  1EFN A;  5CK9 A;  3JB9 I;  1VQL T;  2DVE A;  2DBM A;  2KYB A;  3ER0 A;  4PKC C;  4KGZ B;  5FWC A;  1NJI C;  1UG1 A;  1B07 A;  1X01 A;  1B34 A;  4QVC A;  2HAX A;  2BKD N;  2EYQ A;  2Y4Y A;  4JRP A;  5J26 A;  4HVU A;  4PL6 A;  1VQ7 T;  1X6G A;  3LGL A;  4IUQ A;  3E1S A;  4JS5 A;  3CBM A;  4HVW A;  4M75 E;  2CS7 A;  1WXT A;  2RK2 A;  3A8M B;  2CP3 A;  1X2K A;  2O2O A;  1QVF S;  2HZY A;  1W2B S;  3A98 A;  2LQN A;  3CME Q;  1UGS B;  2FEI A;  4Y92 A;  3OS1 A;  5I2M A;  2XDB A;  3CCR Q;  3OB9 A;  2DM1 A;  2DA9 A;  4C0F A;  3CCQ Q;  2VKN A;  3ZL7 C;  2PVO B;  2LNH B;  3CC7 Q;  2QDY B;  1UTI A;  3M58 A;  1N9S A;  4FT4 A;  4M7A C;  1M2V B;  1MND A;  5GAO l;  1M8V A;  2E3H A;  1YJN A;  2KRN A;  1QWE A;  4ANJ A;  1JO8 A;  3CCU A;  1NPP A;  2VB6 A;  2RHY A;  2RHZ A;  3DLM A;  4F7U E;  5GAN 8;  3JB9 G;  2ZAE A;  1MMG A;  1D3B A;  2K9G A;  4RTV A;  5EC7 A;  1VQM A;  1Q82 R;  4WCI A;  1M90 U;  2JM9 A;  2A37 A;  3CC4 A;  3VS7 A;  2LT4 A;  1PWT A;  2YSQ A;  4J8O A;  1M1G A;  3HFO A;  4IUV A;  4LDY A;  1QVG A;  1YJW Q;  4DBR A;  3EFO A;  1MUZ A;  4J6X A;  5M9O A;  1UJY A;  2R57 A;  2H8H A;  2RF0 A;  3V7C A;  2CKK A;  2EQM A;  2A0F B;  2E6Z A;  4LD9 K;  2KE9 A;  2GQI A;  1RAA B;  1YCS B;  3P8D A;  1Q95 G;  4PJL A;  1SG5 A;  3G4S Q;  3PGG A;  4A53 A;  4F17 A;  1OEB A;  2YUQ A;  2QAZ A;  4M7D B;  5D7U A;  2F5T X;  2RA2 A;  2KYM A;  3A5Z B;  2L5Q A;  4J83 A;  1U3O A;  2W0Z A;  4PJN A;  1KC8 C;  2LNV A;  2EQK A;  2HSE B;  5CKD A;  5DM7 R;  2HD0 A;  3REA B;  1WIE A;  4M7D G;  2JT4 A;  2EGC A;  1KHC A;  3REB B;  5LJ5 f;  1EX4 A;  2AK5 A;  4OMO A;  6AT1 B;  2P4R A;  4N4H A;  1M3C A;  2PUO B;  1RAH B;  2JJ9 A;  3HRS A;  5GMK j;  4M75 A;  3R6N A;  2CH4 A;  3LX7 A;  2JUF A;  3RKW A;  1U5S A;  5IHK A;  1IXD A;  4II1 A;  2YT6 A;  4M7A D;  3PNW C;  2JTM A;  2YHT A;  4M78 C;  1UE9 A;  5GAM f;  3OMG A;  3E19 A;  3FB9 A;  2RHU A;  3CPW S;  2I2L A;  4RG8 A;  3URG A;  1YIJ A;  2ZPI B;  2KQW A;  1FWZ A;  4ZN3 A;  3FIF A;  1N6A A;  3CCJ T;  2VAS A;  2EQU A;  4E7Z A;  2ZCF B;  2EQI A;  2RQT A;  5L8R E;  2MCN A;  3G6E T;  4F7U A;  3I5R A;  5GAM h;  1QVP A;  3M0P A;  3H8Z A;  1M27 C;  4UC4 A;  1NLO C;  3EG9 A;  4X34 A;  4ZN1 A;  1PD0 A;  2DLP A;  4M7A F;  2K2M A;  1I81 A;  1U06 A;  5GMK e;  1K0X A;  4RTX A;  2JS2 A;  2FB7 A;  2C0O A;  2V1R A;  1H3H A;  3WVD B;  2KK4 A;  2DVJ A;  2KDS A;  3A1P A;  3HP9 A;  4Z02 A;  4P5N A;  3QJ6 A;  5FU6 C;  5HY6 A;  3I35 A;  1WHK A;  2KRS A;  1OV3 A;  1I5O B;  1S1N A;  4ZTF A;  3MJX A;  1G2B A;  1TXQ A;  3TEE A;  1TH7 A;  2O4X B;  2X3W D;  3GF5 A;  1PSF A;  4OMQ A;  5GAN 5;  1R8O B;  1SEM A;  3CCR A;  4KBM B;  1M3A A;  5ECA A;  3QZ9 B;  3G71 A;  2PVG B;  1M5Q 1;  1ZA2 B;  3FEO A;  4X9C A;  5GAO r;  3JCM W;  2L2P A;  3I56 Q;  4LUE A;  3CCS Q;  1X2Q A;  4CI0 C;  3V7S A;  1SSH A;  3E2U A;  2RJC A;  4OP0 A;  3OYB A;  2OAU A;  5GAN d;  4BI3 A;  3WVE B;  1RL2 A;  4N4G A;  3OSV A;  1UFF A;  3NGP A;  2XID A;  2E5K A;  1S72 A;  3EG3 A;  3I55 Q;  2COZ A;  2Y4X A;  3VUZ A;  1SSF A;  4J9F A;  1WFW A;  4M77 C;  1VQN Q;  2D8J A;  2O01 E;  4JJD A;  2A36 A;  4M7D E;  3CD6 Q;  1WHM A;  1HD3 A; 
#chains in the Genus database with same CATH homology
 3G71 Q;  1VQK Q;  1YIT Q;  1YJN Q;  1VQ9 Q;  3CC2 Q;  3G6E Q;  3CCQ Q;  1VQ6 Q;  3CCU Q;  3CCV Q;  1VQ8 Q;  1Q82 R;  3CC7 Q;  1VQ5 Q;  1QVF P;  1VQ7 Q;  1W2B P;  1M90 R;  3CMA Q;  1K8A R;  3CCL Q;  1KQS P;  2QEX Q;  1JJ2 P;  1YI2 Q;  1Q7Y R;  3I55 Q;  1N8R R;  1VQL Q;  2OTJ Q;  3CCM Q;  3CCE Q;  3OW2 P;  1K9M R;  1VQM Q;  1YHQ Q;  1YJ9 Q;  1YIJ Q;  3CXC P;  1K73 R;  1VQO Q;  1KC8 R;  3G4S Q;  3CME Q;  3CCJ Q;  3I56 Q;  3CPW P;  1Q81 R;  2QA4 Q;  1NJI R;  1Q86 R;  1QVG P;  1YJW Q;  1VQN Q;  1KD1 R;  1VQ4 Q;  3CCS Q;  3CD6 Q;  1M1K R;  2OTL Q;  3CC4 Q;  1VQP Q;  1S72 Q;  3CCR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...