3G4SQ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g4sQ00
3OW2P 1YITQ 3CC2Q 3CCRQ 3CD6Q 1VQ7Q 3CC7Q 1VQ6Q 1QVGP 3CCLQ 1YI2Q 1NJIR 2OTLQ 2QEXQ 1VQPQ 3CPWP 3CMEQ 1M90R 1VQNQ 1VQKQ 1YJWQ 1QVFP 3G71Q 1S72Q 1W2BP 1Q7YR 1YHQQ 1VQ4Q 3CCVQ 1YJ9Q 1YIJQ 1VQ5Q 1VQ8Q 1K73R 1VQLQ 1VQMQ 3CCJQ 2QA4Q 1KD1R 1N8RR 1Q86R 1KQSP 1M1KR 1VQ9Q 1VQOQ 1JJ2P 3G6EQ 3CCMQ 1Q81R 1K8AR 2OTJQ 3G4SQ 3I55Q 1Q82R 1K9MR 3CCSQ 3CC4Q 3CCUQ 3CCQQ 3CCEQ 3CMAQ 3CXCP 1KC8R 3I56Q 1YJNQ
chains in the Genus database with same CATH superfamily
1YHQT 1CKBA 4LDYA 5KYYA 3V7RA 3CMAA 1ABQA 2FPDA 3LGLA 3VS0A 3CCQA 5GANj 1G3SA 4C5GA 1ZQ1A 2RQVA 4PJJA 5ECAA 1AZEA 2LCSA 3X26B 3JB9J 3LLRA 3EHRA 2JN0A 1K9MR 1KC8C 1VQ6A 4PJOC 1M2OA 4A53A 3OW2P 3FRNA 2FEIA 1T3SA 5LJ3j 3OA6A 4DOVA 1C6VX 5LJ3e 2YUQA 1MMNA 2EQJA 4EDUA 3H8ZA 3MP6A 1PKTA 5HCKA 4C5EA 2L2PA 4F7UA 1VQLT 3H41A 1T0JA 1XQHA 4F04B 3HSBA 2HDAA 4E7KA 2C0TA 4HVUA 2X4XA 3CCSQ 2ATCB 4YTLA 4NOYA 3OYMA 2H8HA 5GAN3 4XU0A 4M7DD 3CCLT 3CPWA 3PGGA 3PVQA 2KRSA 3HRTA 1K4US 1HXDA 2DYIA 5C0MA 2JM8A 1O9SA 4L5GA 1UGRB 5GANe 1QP2A 1IHVA 4RKUE 5DY9A 1KD1C 1VQ9Q 5IHKA 3MP1A 4JJNK 2DTHA 2DZCA 2NLUA 3NGPA 1F1BB 1MV3A 2WACA 1QCOA 2QASA 3A8LB 4M78E 1WHHA 2JZ2A 4J6YA 2F1LA 1HSQA 4MZPA 2J06A 1UJ0A 3NTKA 3M9QA 3GNGA 1I07A 2A08A 1TS9A 2RI2A 1AD5A 1UGSB 4DBFA 5FU7C 2NUTB 2OAWA 1N8RU 4OMMA 2EJGA 4CC4B 3EG9B 2GTJA 4V2SA 2DL8A 5FW9A 3SFMA 5GAMj 4HA8A 3M53A 2XHCA 3CC7A 2JTEA 3CBMA 1TWBA 3E9GA 1SSHA 5GAMh 4J7IA 5J26A 3L1AA 3BW1A 1ACMB 3CPWP 1K1ZA 4MMKA 4PFOA 3EH1A 5GJWB 3OB9A 5CKDA 2MYSA 4PFZA 1QVGS 4XTYA 2LP5A 4ZTFA 2KVQG 1P92A 1Q7YU 3M0QA 3L2QA 2M02A 2JTFA 2RD1A 5FWCA 4HT9A 2KT8A 4ANJA 1N6AA 1H3HA 3A98A 3J80E 2ZCFB 2CGHA 4DBQA 2PQWA 1D09B 2ZAEA 2KBTA 3PMTA 3HFNA 3UDCA 4N0AA 2CP0A 1OX8A 3NTIA 1OI1A 2KQWA 3NTHA 1QVFA 3MEUA 1VOMA 2A3LA 2EKOA 1AZGB 5J3BA 2MIOA 4M75C 3BDUA 4OMOA 1AWWA 3R6NA 3VJPA 2F2XA 3DLMA 1VQPT 1ARKA 3H0HA 2EYWA 3CMAT 4RTYA 1Q7YR 1AVZC 1TXQA 4UC4A 2RB6A 4K11A 3EG9A 2FZKB 4E47A 3MHXA 2PNIA 4J9CA 2OAUA 3CCMQ 1D1AA 4M75F 3VS5A 2LJ3A 3S3NA 3N5BB 2V1QA 5CR2A 2E3HA 2NUPA 4C92E 3GF5A 3PT9A 1RAEB 2EQUA 3META 3J7AF 2KY9A 2FZCB 2LT4A 3OYNA 4IUQA 4N4GA 5GAN6 2JT4A 4MDXA 4J5YA 1WQWA 1TTHB 3CCUT 3ZEHA 2LCCA 1Q82C 4D6WA 2QK0A 2QEXA 3RDVA 4B9WA 1LCKA 1WHGA 2SRCA 1VQ8Q 4E7SA 3M0TA 2LZ6B 1NPPA 2BUDA 2QAZA 1UG1A 3PVLA 3MEVA 1ZHIA 2W10A 3I56Q 2Y4XA 1T3LA 3LW5E 2J7IA 1JU5C 1WXBA 2D0QB 2JW4A 3OYAA 3JB9D 1U3OA 1W2BS 2VWFA 1VQ5Q 3V8LA 4DEXA 1JQQA 3X20B 2CP6A 5GAOq 2J6FA 3RMQA 5CKEA 2DL4A 2GQVA 1TSFA 1WZOA 3JB9F 5A0DA 3C0CA 1I1JA 4M75A 4AFSC 1I5OB 3UPUA 1RAIB 2X4JA 2K3YA 3CC7Q 3I5RA 3CCEA 5LL6S 5DLQE 1M4ZA 2VC8A 2A0FB 2CUDA 1W2BP 5FROA 5GMKm 5FLXE 1RUWA 1VQ4T 5FRNA 4J6XA 2E41A 1VQLQ 5CQXA 3QO3A 5IH2A 5IT9E 2E64A 5IXBA 2LQNA 2MWPA 4M7AD 2KK4A 2KNBB 2P4TA 1RAHB 5HKCA 2CDTA 4M7DG 2EW3A 2QQ9A 1E7OA 1SPKA 2RPNA 1Q81C 2CKKA 3EG0A 3FIFA 3UA7A 2HQEA 2X9HA 4P5NA 5LJ5d 3CCJQ 1H92A 1X2KA 2RHXA 1MNEA 4OB3B 4PJOA 1Q7YC 3OQ5A 3QUIA 5CQYA 1TOVA 2QYZA 1QKWA 4F7UB 2DPPB 1MHNA 2RQRA 1VQNT 3A5ZB 1WHLA 4FT4A 3E19A 4OB1B 2GBQA 1KHIA 4M7AF 1UB4A 3EFOA 2E6ZA 2E4HA 2PVDB 3HTRA 1SRMA 2M9UA 3LH5A 3M58A 4LD6A 2RHUA 1B3QA 2JXBA 4Z88A 4IUUA 2JOYA 2OTJA 4OP0A 1C0MA 5A0GA 2F5TX 4IURA 3M0UA 3UA6A 4E7LA 3OW2S 2CP3A 1G5VA 5GMKh 2V8KA 3KFVA 1JO8A 3QHSA 3CBPA 4C5IA 1YNZA 2EBPA 3NHNA 2GCXA 2D8HA 1N5ZA 1G3TA 1SF9A 1IHWA 3CCRQ 1G8XA 1YI2A 3QPHA 1GCQC 1GXIE 4OGCA 3CC4T 2FRYA 2EAYA 4RTUA 5LJ5g 4C92F 2OJ2A 3G71A 4FCYA 3JCMh 1KHCA 2DJZA 1N9SA 2L3PA 3OYLA 2I2LA 2JS0A 1M3CA 1K9MC 2KSSA 2DA9A 2KYBA 2KGTA 2CP5A 2VXFA 5A0LA 2K5FA 1YJ9T 3G7ZA 4F14A 1MMAA 1WNLA 5GMKj 1JJ2S 3SHWA 4JRKA 4PLLA 2K79A 5CCAA 2EKHA 2CREA 5GMKe 3G71T 4HCBA 2EGAA 1I5LA 2E5QA 2DVEA 2FO0A 6AT1B 1A0NB 3CD6T 3L42A 2B86A 3QG1A 3D7SB 3QWYA 4X9DA 3TQ7P 4M7AE 4HXJA 1OULA 4A4HA 3Q1JA 1Q81R 2QTVA 4RTWA 2ZPHB 2ZZDA 4XTWA 3JCMe 2YUOA 4O6JA 4PJOF 3VS1A 2EVRA 2NYSA 4LUDA 3CCLQ 4BACA 2HCKA 3JCMV 2MWOA 3I55T 5CO7A 4AFUC 4DA4A 1ZSZA 1AOJA 3M59A 4WTOB 4B9XA 5IAYA 3ULRB 1VQOQ 2JNGA 1XJWB 3VUZA 1VQNA 1GBRA 3GIBA 2GTOA 4MZMA 1FYNA 2VGNA 1EIFA 2RJCA 1Q81U 4C8QE 2V8JA 2V1RA 1BKBA 4KGXB 4EIKA 3UWNA 3EFOB 3LWHA 4JDSA 2CS7A 3HL8A 1N8RR 1YITT 4AFZC 2RF0A 2SEMA 1OV3A 4QKUA 3OS5A 3CCEQ 1VQ7A 1YJNT 1KC8U 1RACB 1YIJT 1CKAA 4AG1C 5HK3A 4OMPA 1X2QA 2ZPFB 1OU8A 4J9HA 4Y92A 1BYMA 2E12A 3OYYA 4R0KA 4WF2A 2AK5A 1M1GA 1ZLMA 4M7AC 4IKFA 3NPFA 4BI3A 2RI5A 2RO0A 2HL5C 1YBYA 2O31A 3G4SQ 1B34B 3X28B 2BZYA 3DB3A 1O75A 3THKA 3L2ZA 5GANg 4F7UG 2OX7A 3ME9A 5KYUA 4QVDA 4LUEA 3GLXA 1KFZA 2RH2A 1YJWQ 2M16A 1PNJA 2QGFB 1VQ8A 4J9FA 3OYJA 5GAN5 5KYXA 2FYKA 2JJ9A 2CZ0B 3JCMP 2DE0X 2O2OA 1JJ2A 1RLPC 4JUVA 1Q82R 2DXCA 1V76A 1QMCA 2HD0A 2KRMA 3HRUA 1TUDA 1KQ2A 4C8QD 1AWJA 3CMEQ 4BDZA 3DKMA 3OBYA 1NLOC 2D1XA 2DKGA 2QGGA 1QKXA 3PTAA 4CC2A 3SWNC 2O4XB 4E2FB 1QCNA 1SEMA 3OMGA 4IIMA 5HY6A 4EPCA 2K3XA 1VQMT 4C0GA 3CC2T 2RQTA 1PRMC 1I4K1 1NEGA 1ZBXA 4HT8A 4RMOA 4C0DB 3FJ5A 1VQ7Q 1VQPQ 1G3WA 4VUBA 2HEQA 2DTOA 4C92G 1QVFP 2X3WD 2CH4W 1K9AA 2E1HA 2RN8A 5LJ5f 1U06A 3HFOA 4CC7A 3S6WA 2O4XA 2EWNA 1KK7A 3M56A 3I35A 1RAAB 1WA7A 4JZ3A 2L8DA 2LMJA 3MKDA 3RUXA 2BE7D 3BDLA 2LNHB 1IZ6A 1UECA 5IHNA 3OYFA 2HQHA 1WPYA 2DD4A 3H0IA 4MZTA 5IXFA 3URGA 1OOTA 1VQKQ 3PIOA 2F5KA 1X27A 5GAMf 3OY9A 2CP7A 2CZ7B 3OSSC 4PJOD 1BI1A 2K3BA 4J9DA 2HMAA 2XU8A 1KQSS 3V8JA 4M7DE 4LDVA 4A4FA 2WSCE 2BZ8A 3M5AA 2DXTA 1SKUB 2DIGA 2RK1A 2RK2A 4II1A 1WJQA 4CI0C 2ED0A 1JEGA 4IUVA 3VS2A 2DETA 3X25B 4BY6B 3VYGA 4BB7A 3ZFJA 2DXUA 1AT1B 3G6EQ 4E7HA 1AWXA 3H6ZA 2QA4A 3OYHA 3UATA 3A1PA 3I55A 1UGVA 1M27C 3I9QA 1ABOA 1R0BG 3P8HA 4QQDA 1SG5A 1ZUKA 2MAMA 2X35A 1WGSA 2FL7A 1FMWA 4M77B 4MMLA 2R58A 1HJDA 1WJSA 4WCIA 3MP8A 1IREB 4PLIA 2DL3A 3EG1A 2DFUA 2ESWA 2EQMA 1G83A 4IUPA 3P8DA 3SWNB 3CD6Q 2LQWA 2MOXA 2COZA 2P4RA 1GCQA 2QA4T 3M0PA 5GANh 4KH1B 2XIDA 4FU6A 1MV0B 2RNAA 1S72Q 4RTTA 3OMCA 1VQ4Q 1RADB 2MPXC 1NBEB 4O5VA 1NPRA 1M8VA 5KYWB 1OU9A 3M54A 5DLOA 2YRVA 3M0RA 2YRDA 2COYA 2GFAA 2C0IA 5GAN8 1C1AA 2R5AA 1PWTA 1YN8A 3ZL7C 3QIIA 2RI3A 2VVKA 1BI3A 3E1SA 1WQ7A 2D0NA 4M77D 1MNDA 4C0DC 4DQ2A 5GAN2 2DBMA 5FU6B 2A37A 2DYBA 1LVKA 3R6OA 5J39A 1JRIA 3H0FA 5GANf 5I21A 1MMDA 1YI2T 1SRLA 1M1FA 1VQNQ 3A8OB 4FYWB 5GAMd 4JZ4A 4IIOA 3HPWA 4ZGDB 1OZ3A 3CPFA 4D8KA 4XTZA 3RKWA 4RCBA 4FSXA 1AHJB 2AZSA 3CCET 4QW2A 1YJNQ 2QQSA 1N27A 3FEOA 5GANd 4QVZA 2J05A 3JSCA 2P84A 2ROTA 3RKYA 3CC2A 2KXDA 3L2RA 1RI9A 1K0SA 2Z0WA 3A8HB 4M7DA 3VKIA 1VQLA 2ROLA 1OPKA 4X1VA 2D8JA 4R56A 4JS4A 3JRZA 3CCRT 2PUKB 3EGDA 4M77A 3JCMX 1S1NA 3LWIA 4ZGEB 3OS2A 4C92A 2YLBA 1GBQA 1OEBA 5LJ5h 2KDSA 2GNCA 4ORZA 4CC3A 2CT4A 2LT1A 5GAOr 4J9GA 3EHQA 4N0AC 4PK4A 1JB0E 1QWFA 3FC3A 1IRXA 1K73C 1WIEA 4EMHA 4E7IA 3PE0A 1OX9A 1LNXA 3CCQT 4M7DB 3CMEA 3CPWS 4PKCC 2BE9B 3CCUA 4C8QC 4NL2A 2LQKA 3F70A 2DERA 1GFDA 4M78C 5CVIA 4ZN3A 5GAMg 4ATOA 4AT1B 3CCVQ 1YJ9Q 4HVVA 2QG9B 3JV3A 2ABLA 3JB9G 3H9NA 1VQMQ 2JTMA 2DZ9A 2V26A 1VQ4A 3QKJA 4ZNXA 1VQ7T 4OGEA 1OYXA 3C94A 1K76A 4C92D 4N4HA 4XTVA 3FB9A 1YITA 4BI8B 5AYFA 2KR3A 1M3BA 1VYTA 4M7AB 4N4IA 3GNFB 5I2SA 4LXCA 2JMCA 3JB9H 2MF2A 2YLCA 1PCXA 4BUGA 1FMKA 1PHTA 2XDPA 2QTXA 1NEBA 2EFIA 1KQ1A 4KT0E 3REAB 3L2VA 4KRTA 5CAIA 2LNVA 1UJYA 1VQKT 4PJMA 4J83A 3OYBA 1TG0A 3M0SA 3LGFA 3SWNA 3TCJA 5I22A 1YHQQ 4PJOG 1YWPA 1N9RA 2DL7A 3QSUA 1Y96B 2DTIA 5CIUA 5LJ3g 3JB9I 4HCCA 4QT7A 2AT1B 2EGEA 1IXDA 4EMKC 3S3OA 2P0QA 1E6HA 1KSWA 4M77F 1PG5B 2LVMA 2VGMA 3CCVA 2CYZB 1QVGA 1M90C 2MK5A 1D3BA 2AIRB 1H641 2I0NA 3QDFA 1K73U 1WHKA 2AZVA 1V29B 2RHYA 2X3XD 4M7DF 5FU7B 3KUFA 2P0PA 5EG2A 1G2BA 1X01A 4A4EA 1WJRA 2GQIA 1VQ6Q 2O88A 5GAOl 3RR6A 2EYQA 5AT1B 1KIKA 4Z8AA 3TU4K 1ZX6A 2DM1A 5A2QE 2E3IA 1HYOA 1GRIA 8ATCB 1QVFS 4GBQA 1RAGB 2GFUA 2HBPA 1VQMA 2HSEB 1UHFA 4OMQA 4M75D 3QZ5B 5IHIA 3CMAQ 3CXCP 4C92B 1Y71A 1W70A 1MGQA 1ZBJA 3OS0A 1UEBA 1YJWT 4XTUA 3CCMT 2MI6A 1WXUA 3LH0A 2CZ6B 1EZZB 3CCST 2VB6A 4RG2A 2RMOA 1KD1R 2ZGWA 4M7DC 5LJ3d 1KJWA 1PSFA 4ZGJB 1VQ5A 2X4WA 3GPLA 1VQ8T 1PRLC 3VS4A 4OB2B 3VRZA 1SHFA 1NJIC 1EFNA 3QWXX 2E65A 3EGDB 3BE3A 3I56T 1M2VB 2YT6A 3C12A 2BTTA 4M78F 2NUPB 5IN1A 4M78B 4PJOB 4E7JA 4BI4A 3NMZC 3JCMb 2ENMA 7AT1B 1VIFA 2HZYA 4KGZB 4ME7A 1RI0A 1YI2Q 4JJCA 4XU1A 1BK2A 1M5Q1 2YUPA 1IB8A 4X34A 2M0YA 2QI2A 4GLKA 1BCOA 4J6WA 3UT1A 3M55A 3HHTB 3CC7T 1OPLA 4EMKB 2QXFA 4XTXA 3SDZA 1WHMA 2JM9A 3OBWA 4BE1A 3V7CA 5LJ5e 1WDXA 1VQ5T 4C5HA 2OTLQ 2YUNA 1XNIA 3CEYA 4BE2A 2VYTA 5KYUB 2XD0A 1W2BA 2YXYA 1X43A 2COWA 4M78D 1WHJA 1LJOA 1JXMA 2E10A 2HSPA 1WLPB 1B07A 4KH0B 4M7AA 4DEYA 3C95A 4OF1A 2YHTA 3M57A 1Q82U 2O9SA 2BKDN 2KYMA 2FPEA 4FYVB 3QJYA 3G4SA 1NJIR 1Z9ZA 3EGXA 1I81A 2QQBA 2BZXA 4AG2C 1H8KA 1M2VA 1ZSZC 1TH7A 4R55A 3A8GB 3G6ET 4RTXA 5HK0A 2DVJA 2QQAA 3CCQQ 1LPLA 2O9VA 3JCMJ 4A63B 4M75E 3VU3C 1UUEA 4JLIA 1U8RA 3CCLA 3CCJT 2DEUA 2L3RA 2AHJB 3REBB 5KE2A 4OVAA 1PM3A 4F7UE 2NUTA 3CCVT 4KUDK 2KRNA 1Q86R 5LJ3f 3TVTA 5KYWA 1GFCA 1BU1A 3FJPA 2C0OA 5CKBA 3KXTA 1YJ9A 3VRYA 2AKKA 2FB7A 2VV5A 1D3BB 1D1CA 4M77C 3JAME 1VUBA 5EC7A 8AT1B 4C92C 2NUZA 4MDWA 1CSKA 4M77G 4ESRA 5D6XA 4OMFB 1VQKA 4J9BA 3ER0A 3RNJA 4JRIA 1YCYA 4Z89A 5KE3A 2LQ8A 3CC4A 1AWOA 2XICA 4C8QG 3MJXA 4M78A 2RJEA 3QYHB 3RMSA 2RJDA 5LJ3h 2EGCA 5D6WA 4HCKA 3MEAA 3L2WA 2LJ1A 2ZPBB 3OYKA 1Y0MA 4FT2A 2DF6A 2EYZA 2K4YA 4OMNA 3CC4Q 2XDDA 5CKHA 2PU9B 2HKQB 3EFRA 1G3YA 2A7YA 2ED1A 3P8BB 4CRIA 4F7UF 1U1TA 1Q86U 2H3JA 2K57A 1ZA2B 4A4KA 2D9TA 1B7TA 2YDLA 2E70A 1J3TA 2KROA 2RHIA 3M4GA 4PNOA 4PJOE 3VS7A 5GAN4 4QQGA 4LNPA 1Y07A 4A54A 2KE9A 3BY7A 4KBMB 4A4GA 2DNUA 4C0FA 2DRMA 3X24B 3VUBA 4FW2A 4DBHA 1NG2A 3JCMW 3QBYA 1S72A 1JBMA 3ASKA 4OB0B 4QVCA 2E5KA 2EJFA 4XK8E 2IIMA 3E2UA 4XU2A 5KH6A 2RJFA 2EYYA 2WSEE 1M3AA 3ZBDA 3RKXA 2HQXA 4B6MA 5C6SA 4PFPA 1VA7A 4FYYB 3OYCA 3QYGB 4J8OA 4KULA 4QQ6A 2YWWA 3JCMg 4JS5A 2GF7A 4PJNA 3G1JA 3VV0A 2R5MA 2DIQA 2CH4A 2JMAA 3TEEA 1XTDA 2OTJQ 1QCFA 2LJ0A 2DBKA 2DX1A 2GGRA 3U23A 2CSQA 1D0XA 2MCNA 2EQIA 2KT1A 2J6KA 1HD3A 1Y57A 4BE0A 1W4SA 5GJVB 3CXCS 1W1FA 3OW2A 3RESA 1N8RC 2C06A 1FMVA 3NFCA 2VKNA 2BIVA 2LCLA 2OTLA 4F17A 1V1CA 1QLYA 1NLPC 2XMFA 1NM7A 4NS5A 4FIBA 3VS6A 4ZN1A 3V8KA 1YWOA 2DJQA 2A36A 1HK9A 1FWZA 5I2MA 2IVWA 3HRSA 2H3EB 9ATCB 1UHCA 1U1SA 3S3MA 5GMKi 2K2MA 3C4SA 2RA2A 2B8AA 4BDYA 4PL6A 2VXEA 4Q5WA 2K2VA 3QJ6A 2EQKA 2KMTA 5FU6C 2QEXT 1H3ZA 2LTOA 4RUGA 3UF4A 4M78G 4JRPA 3JCMd 4IUTA 2LDMA 4ELYC 1RLQC 4FM4B 4BD3A 4RTZA 3E9FA 1VQOA 1JJ2P 1VQ9T 5KCHA 4LD9K 1SSFA 4L59A 2HBWA 1I8FA 3EG2A 2FZGB 4EMGA 3CC2Q 2FRWA 2FPFA 3IQLA 2M0OA 4LN2A 2DEQA 3PMIA 1M1KC 2V8IA 3OYEA 3PIPA 1BI0A 1NZ9A 1YJNA 2QDLA 4DBRA 3QXEB 1R0CB 1WFWA 1MUZA 1WXTA 1M9SA 1GL5A 5LJ5j 5CKFA 1KC8R 4DOWA 1VQ6T 2HAXA 1EX4A 3DLLA 1QVGP 1VQPA 4C8QA 1VYVA 2EIFA 3G71Q 3CCSA 4NL3A 3OYDA 3CCMA 1YJWA 4FL6A 3CQTA 3L2UA 2FHDA 3RERA 2HL3A 2R57A 4HKEA 1X69A 4JRQA 1YHQA 2NWMA 2A28A 2Y4YA 4HVWA 3MEWA 3V7SA 1YFNA 1TUGB 1X6GA 3OS1A 4AMCA 2K6DA 5KYXB 2JVVA 3GOXA 4J9EA 1PC0A 1D0ZA 3CXCA 4TVRA 4GLMA 1BIBA 3MCAB 2X4YA 3I55Q 3I5SA 2HKNA 1WX6A 1YITQ 3WXMB 3MPUB 1WI7A 3VS3A 2DO3A 2IPOB 2CP2A 4LDXA 4FSSA 1VQOT 3CD6A 2XK0A 5CK9A 1UDLA 2DL5A 3HKSA 1PSEA 1YIJQ 3PNWC 1D0YA 2DD5A 2E6NA 1OQKA 1QW1A 3RIRA 1ZSZB 2PZ1A 1D1BA 4RCCA 1K8AR 2WSFE 1BIAA 1PKSA 3OYGA 3KBGA 5FWBA 1T0HA 4XU3A 1NJIU 1BCMA 3JCMQ 3G4ST 2L3SA 2DILA 4GY5A 2F69A 2ZPGB 3BFMA 4ZTJA 2O01E 3JCMf 2K5IA 3HP9A 4KGVB 2QA4Q 1TU0B 3O8VA 2EYXA 3VYHB 1UE9A 3AT1B 1MMGA 1BBZA 1DJ7B 2L3QA 3SEMA 1YCSB 2F2WA 2LX7A 2OTLT 2YSQA 2J6OA 3EG3A 4F16A 5GAOp 4Z02A 3OYIA 1X6OA 2RHZA 4JPBW 1WYXA 2DAQA 4HCZA 4J7FA 4RG8A 3EAEA 3LYIA 5I11A 2CT3A 3OSVA 2M51A 2K7AA 3CCUQ 2JUFA 2AKLA 4E7ZA 5L23A 5KYYB 3TSZA 1BB9A 2CSIA 2LX9A 1U5SA 1QWEA 2KEAA 2QDYB 2DK3A 1GCPA 5GAOn 2FG0A 1I0CA 2XI9A 1NYGA 1K8AU 3GP8A 1M1KU 1RL2A 1VQ9A 4XQ3A 1ZUUA 1Y7XA 2HNIA 1UGPB 1RABB 3QZ9B 3EGUA 1QVPA 1YIJA 3CMET 4C8QB 2L5QA 2RM4A 1JXOA 1M1KR 3I56A 1VYUA 3EFSA 1YP5A 2DMOA 4LE9A 3FDRA 1M90R 3TREA 1R8OB 2YRCA 3A8MB 3TSWA 2OI3A 3T9NA 1NE8A 2ZPIB 2KAFA 4C8QF 4M7AG 1KD1U 2DRKA 1M90U 1KQSA 1UFFA 5GAMe 3O5ZA 3CCRA 3WVDB 4M75G 1B34A 3LX7A 1ZUYA 4M75B 1Q86C 1E6GA 1W6XA 2EJ9A 1FX7A 2G6FX 2VASA 2K9GA 4D8DA 2MMPA 3FLGA 4JLGA 1IO6A 4OMLA 1UGQB 4ELZC 3CBOA 2F2VA 1VIEA 2EPDA 2Y90A 1IGUA 1SHGA 5GMKl 2LC4A 3INZA 1PD0A 2L0AA 4FYXB 2M1HA 4J9IA 2PUOB 2QEXQ 2DXBA 1K9MU 1Z9QA 1M30A 2JS2A 5GAOm 1K73R 2P0KA 1TUCA 5KCOA 1KQSP 1BI2A 4Y91A 1ZA1B 4RTVA 2RQUA 1Q95G 2XKOC 1FXXA 1RAFB 2FVUA 5D7UA 1K0XA 1R77A 2VUBA 1IGQA 3WVEB 4AFQC 2CZ1B 4XAXB 3EGXB 4PJLA 5L8RE 1K8AC 3QDRB 4JJBA 3DB4A 1X6BA 1OZ2A 4Y28E 2XDBA 2PTKA 2L89A 3M4YA 1M8MA 5DM7R 1S72T 2W0ZA 1UTIA 2KXCA 2IG0A 2PVOB 2ZPEB 2G3RA 5D6YA 2QQRA 4M77E 3AHUA 5FRMA 2D6FA 2K5LA 2RQWA 4LDWA 3SD4A 3GBQA 1Y96A 2KI7A 1NYFA 1X75C 4C0ZA 4X9CA 5M9OA 4M4ZA 5GAN7 1ZSGA 2XG8D 3SB2A 1PD1A 1QQJA 2LRQA 3CCJA 3JCMc 3EH2A 3J81E 4LDUA 3PFSA 4EMKA 4L6V5 2CUBA 2ECZA 2DLPA 3G6EA 4KUIA 1AEYA 2X51A 1XOVA 3RBBB 2PVGB 5KYNA 4E6RA 1LOJA 1QP3A 2OTJT 1KG1A 3MO8A 4FW1A 4JJDA 4BY6C
chains in the Genus database with same CATH topology
3OW2P 1YITQ 3CC2Q 3CCRQ 3CD6Q 1VQ7Q 3CC7Q 1VQ6Q 1QVGP 3CCLQ 1YI2Q 1NJIR 2OTLQ 2QEXQ 1VQPQ 3CPWP 3CMEQ 1M90R 1VQNQ 1VQKQ 1YJWQ 1QVFP 3G71Q 1S72Q 1W2BP 1Q7YR 1YHQQ 1VQ4Q 3CCVQ 1YJ9Q 1YIJQ 1VQ5Q 1VQ8Q 1K73R 1VQLQ 1VQMQ 3CCJQ 2QA4Q 1KD1R 1N8RR 1Q86R 1KQSP 1M1KR 1VQ9Q 1VQOQ 1JJ2P 3G6EQ 3CCMQ 1Q81R 1K8AR 2OTJQ 3G4SQ 3I55Q 1Q82R 1K9MR 3CCSQ 3CC4Q 3CCUQ 3CCQQ 3CCEQ 3CMAQ 3CXCP 1KC8R 3I56Q 1YJNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 P;  1YIT Q;  3CC2 Q;  3CCR Q;  3CD6 Q;  1VQ7 Q;  3CC7 Q;  1VQ6 Q;  1QVG P;  3CCL Q;  1YI2 Q;  1NJI R;  2OTL Q;  2QEX Q;  1VQP Q;  3CPW P;  3CME Q;  1M90 R;  1VQN Q;  1VQK Q;  1YJW Q;  1QVF P;  3G71 Q;  1S72 Q;  1W2B P;  1Q7Y R;  1YHQ Q;  1VQ4 Q;  3CCV Q;  1YJ9 Q;  1YIJ Q;  1VQ5 Q;  1VQ8 Q;  1K73 R;  1VQL Q;  1VQM Q;  3CCJ Q;  2QA4 Q;  1KD1 R;  1N8R R;  1Q86 R;  1KQS P;  1M1K R;  1VQ9 Q;  1VQO Q;  1JJ2 P;  3G6E Q;  3CCM Q;  1Q81 R;  1K8A R;  2OTJ Q;  3G4S Q;  3I55 Q;  1Q82 R;  1K9M R;  3CCS Q;  3CC4 Q;  3CCU Q;  3CCQ Q;  3CCE Q;  3CMA Q;  3CXC P;  1KC8 R;  3I56 Q;  1YJN Q; 
#chains in the Genus database with same CATH topology
 1YHQ T;  1CKB A;  4LDY A;  5KYY A;  3V7R A;  3CMA A;  1ABQ A;  2FPD A;  3LGL A;  3VS0 A;  3CCQ A;  5GAN j;  1G3S A;  4C5G A;  1ZQ1 A;  2RQV A;  4PJJ A;  5ECA A;  1AZE A;  2LCS A;  3X26 B;  3JB9 J;  3LLR A;  3EHR A;  2JN0 A;  1K9M R;  1KC8 C;  1VQ6 A;  4PJO C;  1M2O A;  4A53 A;  3OW2 P;  3FRN A;  2FEI A;  1T3S A;  5LJ3 j;  3OA6 A;  4DOV A;  1C6V X;  5LJ3 e;  2YUQ A;  1MMN A;  2EQJ A;  4EDU A;  3H8Z A;  3MP6 A;  1PKT A;  5HCK A;  4C5E A;  2L2P A;  4F7U A;  1VQL T;  3H41 A;  1T0J A;  1XQH A;  4F04 B;  3HSB A;  2HDA A;  4E7K A;  2C0T A;  4HVU A;  2X4X A;  3CCS Q;  2ATC B;  4YTL A;  4NOY A;  3OYM A;  2H8H A;  5GAN 3;  4XU0 A;  4M7D D;  3CCL T;  3CPW A;  3PGG A;  3PVQ A;  2KRS A;  3HRT A;  1K4U S;  1HXD A;  2DYI A;  5C0M A;  2JM8 A;  1O9S A;  4L5G A;  1UGR B;  5GAN e;  1QP2 A;  1IHV A;  4RKU E;  5DY9 A;  1KD1 C;  1VQ9 Q;  5IHK A;  3MP1 A;  4JJN K;  2DTH A;  2DZC A;  2NLU A;  3NGP A;  1F1B B;  1MV3 A;  2WAC A;  1QCO A;  2QAS A;  3A8L B;  4M78 E;  1WHH A;  2JZ2 A;  4J6Y A;  2F1L A;  1HSQ A;  4MZP A;  2J06 A;  1UJ0 A;  3NTK A;  3M9Q A;  3GNG A;  1I07 A;  2A08 A;  1TS9 A;  2RI2 A;  1AD5 A;  1UGS B;  4DBF A;  5FU7 C;  2NUT B;  2OAW A;  1N8R U;  4OMM A;  2EJG A;  4CC4 B;  3EG9 B;  2GTJ A;  4V2S A;  2DL8 A;  5FW9 A;  3SFM A;  5GAM j;  4HA8 A;  3M53 A;  2XHC A;  3CC7 A;  2JTE A;  3CBM A;  1TWB A;  3E9G A;  1SSH A;  5GAM h;  4J7I A;  5J26 A;  3L1A A;  3BW1 A;  1ACM B;  3CPW P;  1K1Z A;  4MMK A;  4PFO A;  3EH1 A;  5GJW B;  3OB9 A;  5CKD A;  2MYS A;  4PFZ A;  1QVG S;  4XTY A;  2LP5 A;  4ZTF A;  2KVQ G;  1P92 A;  1Q7Y U;  3M0Q A;  3L2Q A;  2M02 A;  2JTF A;  2RD1 A;  5FWC A;  4HT9 A;  2KT8 A;  4ANJ A;  1N6A A;  1H3H A;  3A98 A;  3J80 E;  2ZCF B;  2CGH A;  4DBQ A;  2PQW A;  1D09 B;  2ZAE A;  2KBT A;  3PMT A;  3HFN A;  3UDC A;  4N0A A;  2CP0 A;  1OX8 A;  3NTI A;  1OI1 A;  2KQW A;  3NTH A;  1QVF A;  3MEU A;  1VOM A;  2A3L A;  2EKO A;  1AZG B;  5J3B A;  2MIO A;  4M75 C;  3BDU A;  4OMO A;  1AWW A;  3R6N A;  3VJP A;  2F2X A;  3DLM A;  1VQP T;  1ARK A;  3H0H A;  2EYW A;  3CMA T;  4RTY A;  1Q7Y R;  1AVZ C;  1TXQ A;  4UC4 A;  2RB6 A;  4K11 A;  3EG9 A;  2FZK B;  4E47 A;  3MHX A;  2PNI A;  4J9C A;  2OAU A;  3CCM Q;  1D1A A;  4M75 F;  3VS5 A;  2LJ3 A;  3S3N A;  3N5B B;  2V1Q A;  5CR2 A;  2E3H A;  2NUP A;  4C92 E;  3GF5 A;  3PT9 A;  1RAE B;  2EQU A;  3MET A;  3J7A F;  2KY9 A;  2FZC B;  2LT4 A;  3OYN A;  4IUQ A;  4N4G A;  5GAN 6;  2JT4 A;  4MDX A;  4J5Y A;  1WQW A;  1TTH B;  3CCU T;  3ZEH A;  2LCC A;  1Q82 C;  4D6W A;  2QK0 A;  2QEX A;  3RDV A;  4B9W A;  1LCK A;  1WHG A;  2SRC A;  1VQ8 Q;  4E7S A;  3M0T A;  2LZ6 B;  1NPP A;  2BUD A;  2QAZ A;  1UG1 A;  3PVL A;  3MEV A;  1ZHI A;  2W10 A;  3I56 Q;  2Y4X A;  1T3L A;  3LW5 E;  2J7I A;  1JU5 C;  1WXB A;  2D0Q B;  2JW4 A;  3OYA A;  3JB9 D;  1U3O A;  1W2B S;  2VWF A;  1VQ5 Q;  3V8L A;  4DEX A;  1JQQ A;  3X20 B;  2CP6 A;  5GAO q;  2J6F A;  3RMQ A;  5CKE A;  2DL4 A;  2GQV A;  1TSF A;  1WZO A;  3JB9 F;  5A0D A;  3C0C A;  1I1J A;  4M75 A;  4AFS C;  1I5O B;  3UPU A;  1RAI B;  2X4J A;  2K3Y A;  3CC7 Q;  3I5R A;  3CCE A;  5LL6 S;  5DLQ E;  1M4Z A;  2VC8 A;  2A0F B;  2CUD A;  1W2B P;  5FRO A;  5GMK m;  5FLX E;  1RUW A;  1VQ4 T;  5FRN A;  4J6X A;  2E41 A;  1VQL Q;  5CQX A;  3QO3 A;  5IH2 A;  5IT9 E;  2E64 A;  5IXB A;  2LQN A;  2MWP A;  4M7A D;  2KK4 A;  2KNB B;  2P4T A;  1RAH B;  5HKC A;  2CDT A;  4M7D G;  2EW3 A;  2QQ9 A;  1E7O A;  1SPK A;  2RPN A;  1Q81 C;  2CKK A;  3EG0 A;  3FIF A;  3UA7 A;  2HQE A;  2X9H A;  4P5N A;  5LJ5 d;  3CCJ Q;  1H92 A;  1X2K A;  2RHX A;  1MNE A;  4OB3 B;  4PJO A;  1Q7Y C;  3OQ5 A;  3QUI A;  5CQY A;  1TOV A;  2QYZ A;  1QKW A;  4F7U B;  2DPP B;  1MHN A;  2RQR A;  1VQN T;  3A5Z B;  1WHL A;  4FT4 A;  3E19 A;  4OB1 B;  2GBQ A;  1KHI A;  4M7A F;  1UB4 A;  3EFO A;  2E6Z A;  2E4H A;  2PVD B;  3HTR A;  1SRM A;  2M9U A;  3LH5 A;  3M58 A;  4LD6 A;  2RHU A;  1B3Q A;  2JXB A;  4Z88 A;  4IUU A;  2JOY A;  2OTJ A;  4OP0 A;  1C0M A;  5A0G A;  2F5T X;  4IUR A;  3M0U A;  3UA6 A;  4E7L A;  3OW2 S;  2CP3 A;  1G5V A;  5GMK h;  2V8K A;  3KFV A;  1JO8 A;  3QHS A;  3CBP A;  4C5I A;  1YNZ A;  2EBP A;  3NHN A;  2GCX A;  2D8H A;  1N5Z A;  1G3T A;  1SF9 A;  1IHW A;  3CCR Q;  1G8X A;  1YI2 A;  3QPH A;  1GCQ C;  1GXI E;  4OGC A;  3CC4 T;  2FRY A;  2EAY A;  4RTU A;  5LJ5 g;  4C92 F;  2OJ2 A;  3G71 A;  4FCY A;  3JCM h;  1KHC A;  2DJZ A;  1N9S A;  2L3P A;  3OYL A;  2I2L A;  2JS0 A;  1M3C A;  1K9M C;  2KSS A;  2DA9 A;  2KYB A;  2KGT A;  2CP5 A;  2VXF A;  5A0L A;  2K5F A;  1YJ9 T;  3G7Z A;  4F14 A;  1MMA A;  1WNL A;  5GMK j;  1JJ2 S;  3SHW A;  4JRK A;  4PLL A;  2K79 A;  5CCA A;  2EKH A;  2CRE A;  5GMK e;  3G71 T;  4HCB A;  2EGA A;  1I5L A;  2E5Q A;  2DVE A;  2FO0 A;  6AT1 B;  1A0N B;  3CD6 T;  3L42 A;  2B86 A;  3QG1 A;  3D7S B;  3QWY A;  4X9D A;  3TQ7 P;  4M7A E;  4HXJ A;  1OUL A;  4A4H A;  3Q1J A;  1Q81 R;  2QTV A;  4RTW A;  2ZPH B;  2ZZD A;  4XTW A;  3JCM e;  2YUO A;  4O6J A;  4PJO F;  3VS1 A;  2EVR A;  2NYS A;  4LUD A;  3CCL Q;  4BAC A;  2HCK A;  3JCM V;  2MWO A;  3I55 T;  5CO7 A;  4AFU C;  4DA4 A;  1ZSZ A;  1AOJ A;  3M59 A;  4WTO B;  4B9X A;  5IAY A;  3ULR B;  1VQO Q;  2JNG A;  1XJW B;  3VUZ A;  1VQN A;  1GBR A;  3GIB A;  2GTO A;  4MZM A;  1FYN A;  2VGN A;  1EIF A;  2RJC A;  1Q81 U;  4C8Q E;  2V8J A;  2V1R A;  1BKB A;  4KGX B;  4EIK A;  3UWN A;  3EFO B;  3LWH A;  4JDS A;  2CS7 A;  3HL8 A;  1N8R R;  1YIT T;  4AFZ C;  2RF0 A;  2SEM A;  1OV3 A;  4QKU A;  3OS5 A;  3CCE Q;  1VQ7 A;  1YJN T;  1KC8 U;  1RAC B;  1YIJ T;  1CKA A;  4AG1 C;  5HK3 A;  4OMP A;  1X2Q A;  2ZPF B;  1OU8 A;  4J9H A;  4Y92 A;  1BYM A;  2E12 A;  3OYY A;  4R0K A;  4WF2 A;  2AK5 A;  1M1G A;  1ZLM A;  4M7A C;  4IKF A;  3NPF A;  4BI3 A;  2RI5 A;  2RO0 A;  2HL5 C;  1YBY A;  2O31 A;  3G4S Q;  1B34 B;  3X28 B;  2BZY A;  3DB3 A;  1O75 A;  3THK A;  3L2Z A;  5GAN g;  4F7U G;  2OX7 A;  3ME9 A;  5KYU A;  4QVD A;  4LUE A;  3GLX A;  1KFZ A;  2RH2 A;  1YJW Q;  2M16 A;  1PNJ A;  2QGF B;  1VQ8 A;  4J9F A;  3OYJ A;  5GAN 5;  5KYX A;  2FYK A;  2JJ9 A;  2CZ0 B;  3JCM P;  2DE0 X;  2O2O A;  1JJ2 A;  1RLP C;  4JUV A;  1Q82 R;  2DXC A;  1V76 A;  1QMC A;  2HD0 A;  2KRM A;  3HRU A;  1TUD A;  1KQ2 A;  4C8Q D;  1AWJ A;  3CME Q;  4BDZ A;  3DKM A;  3OBY A;  1NLO C;  2D1X A;  2DKG A;  2QGG A;  1QKX A;  3PTA A;  4CC2 A;  3SWN C;  2O4X B;  4E2F B;  1QCN A;  1SEM A;  3OMG A;  4IIM A;  5HY6 A;  4EPC A;  2K3X A;  1VQM T;  4C0G A;  3CC2 T;  2RQT A;  1PRM C;  1I4K 1;  1NEG A;  1ZBX A;  4HT8 A;  4RMO A;  4C0D B;  3FJ5 A;  1VQ7 Q;  1VQP Q;  1G3W A;  4VUB A;  2HEQ A;  2DTO A;  4C92 G;  1QVF P;  2X3W D;  2CH4 W;  1K9A A;  2E1H A;  2RN8 A;  5LJ5 f;  1U06 A;  3HFO A;  4CC7 A;  3S6W A;  2O4X A;  2EWN A;  1KK7 A;  3M56 A;  3I35 A;  1RAA B;  1WA7 A;  4JZ3 A;  2L8D A;  2LMJ A;  3MKD A;  3RUX A;  2BE7 D;  3BDL A;  2LNH B;  1IZ6 A;  1UEC A;  5IHN A;  3OYF A;  2HQH A;  1WPY A;  2DD4 A;  3H0I A;  4MZT A;  5IXF A;  3URG A;  1OOT A;  1VQK Q;  3PIO A;  2F5K A;  1X27 A;  5GAM f;  3OY9 A;  2CP7 A;  2CZ7 B;  3OSS C;  4PJO D;  1BI1 A;  2K3B A;  4J9D A;  2HMA A;  2XU8 A;  1KQS S;  3V8J A;  4M7D E;  4LDV A;  4A4F A;  2WSC E;  2BZ8 A;  3M5A A;  2DXT A;  1SKU B;  2DIG A;  2RK1 A;  2RK2 A;  4II1 A;  1WJQ A;  4CI0 C;  2ED0 A;  1JEG A;  4IUV A;  3VS2 A;  2DET A;  3X25 B;  4BY6 B;  3VYG A;  4BB7 A;  3ZFJ A;  2DXU A;  1AT1 B;  3G6E Q;  4E7H A;  1AWX A;  3H6Z A;  2QA4 A;  3OYH A;  3UAT A;  3A1P A;  3I55 A;  1UGV A;  1M27 C;  3I9Q A;  1ABO A;  1R0B G;  3P8H A;  4QQD A;  1SG5 A;  1ZUK A;  2MAM A;  2X35 A;  1WGS A;  2FL7 A;  1FMW A;  4M77 B;  4MML A;  2R58 A;  1HJD A;  1WJS A;  4WCI A;  3MP8 A;  1IRE B;  4PLI A;  2DL3 A;  3EG1 A;  2DFU A;  2ESW A;  2EQM A;  1G83 A;  4IUP A;  3P8D A;  3SWN B;  3CD6 Q;  2LQW A;  2MOX A;  2COZ A;  2P4R A;  1GCQ A;  2QA4 T;  3M0P A;  5GAN h;  4KH1 B;  2XID A;  4FU6 A;  1MV0 B;  2RNA A;  1S72 Q;  4RTT A;  3OMC A;  1VQ4 Q;  1RAD B;  2MPX C;  1NBE B;  4O5V A;  1NPR A;  1M8V A;  5KYW B;  1OU9 A;  3M54 A;  5DLO A;  2YRV A;  3M0R A;  2YRD A;  2COY A;  2GFA A;  2C0I A;  5GAN 8;  1C1A A;  2R5A A;  1PWT A;  1YN8 A;  3ZL7 C;  3QII A;  2RI3 A;  2VVK A;  1BI3 A;  3E1S A;  1WQ7 A;  2D0N A;  4M77 D;  1MND A;  4C0D C;  4DQ2 A;  5GAN 2;  2DBM A;  5FU6 B;  2A37 A;  2DYB A;  1LVK A;  3R6O A;  5J39 A;  1JRI A;  3H0F A;  5GAN f;  5I21 A;  1MMD A;  1YI2 T;  1SRL A;  1M1F A;  1VQN Q;  3A8O B;  4FYW B;  5GAM d;  4JZ4 A;  4IIO A;  3HPW A;  4ZGD B;  1OZ3 A;  3CPF A;  4D8K A;  4XTZ A;  3RKW A;  4RCB A;  4FSX A;  1AHJ B;  2AZS A;  3CCE T;  4QW2 A;  1YJN Q;  2QQS A;  1N27 A;  3FEO A;  5GAN d;  4QVZ A;  2J05 A;  3JSC A;  2P84 A;  2ROT A;  3RKY A;  3CC2 A;  2KXD A;  3L2R A;  1RI9 A;  1K0S A;  2Z0W A;  3A8H B;  4M7D A;  3VKI A;  1VQL A;  2ROL A;  1OPK A;  4X1V A;  2D8J A;  4R56 A;  4JS4 A;  3JRZ A;  3CCR T;  2PUK B;  3EGD A;  4M77 A;  3JCM X;  1S1N A;  3LWI A;  4ZGE B;  3OS2 A;  4C92 A;  2YLB A;  1GBQ A;  1OEB A;  5LJ5 h;  2KDS A;  2GNC A;  4ORZ A;  4CC3 A;  2CT4 A;  2LT1 A;  5GAO r;  4J9G A;  3EHQ A;  4N0A C;  4PK4 A;  1JB0 E;  1QWF A;  3FC3 A;  1IRX A;  1K73 C;  1WIE A;  4EMH A;  4E7I A;  3PE0 A;  1OX9 A;  1LNX A;  3CCQ T;  4M7D B;  3CME A;  3CPW S;  4PKC C;  2BE9 B;  3CCU A;  4C8Q C;  4NL2 A;  2LQK A;  3F70 A;  2DER A;  1GFD A;  4M78 C;  5CVI A;  4ZN3 A;  5GAM g;  4ATO A;  4AT1 B;  3CCV Q;  1YJ9 Q;  4HVV A;  2QG9 B;  3JV3 A;  2ABL A;  3JB9 G;  3H9N A;  1VQM Q;  2JTM A;  2DZ9 A;  2V26 A;  1VQ4 A;  3QKJ A;  4ZNX A;  1VQ7 T;  4OGE A;  1OYX A;  3C94 A;  1K76 A;  4C92 D;  4N4H A;  4XTV A;  3FB9 A;  1YIT A;  4BI8 B;  5AYF A;  2KR3 A;  1M3B A;  1VYT A;  4M7A B;  4N4I A;  3GNF B;  5I2S A;  4LXC A;  2JMC A;  3JB9 H;  2MF2 A;  2YLC A;  1PCX A;  4BUG A;  1FMK A;  1PHT A;  2XDP A;  2QTX A;  1NEB A;  2EFI A;  1KQ1 A;  4KT0 E;  3REA B;  3L2V A;  4KRT A;  5CAI A;  2LNV A;  1UJY A;  1VQK T;  4PJM A;  4J83 A;  3OYB A;  1TG0 A;  3M0S A;  3LGF A;  3SWN A;  3TCJ A;  5I22 A;  1YHQ Q;  4PJO G;  1YWP A;  1N9R A;  2DL7 A;  3QSU A;  1Y96 B;  2DTI A;  5CIU A;  5LJ3 g;  3JB9 I;  4HCC A;  4QT7 A;  2AT1 B;  2EGE A;  1IXD A;  4EMK C;  3S3O A;  2P0Q A;  1E6H A;  1KSW A;  4M77 F;  1PG5 B;  2LVM A;  2VGM A;  3CCV A;  2CYZ B;  1QVG A;  1M90 C;  2MK5 A;  1D3B A;  2AIR B;  1H64 1;  2I0N A;  3QDF A;  1K73 U;  1WHK A;  2AZV A;  1V29 B;  2RHY A;  2X3X D;  4M7D F;  5FU7 B;  3KUF A;  2P0P A;  5EG2 A;  1G2B A;  1X01 A;  4A4E A;  1WJR A;  2GQI A;  1VQ6 Q;  2O88 A;  5GAO l;  3RR6 A;  2EYQ A;  5AT1 B;  1KIK A;  4Z8A A;  3TU4 K;  1ZX6 A;  2DM1 A;  5A2Q E;  2E3I A;  1HYO A;  1GRI A;  8ATC B;  1QVF S;  4GBQ A;  1RAG B;  2GFU A;  2HBP A;  1VQM A;  2HSE B;  1UHF A;  4OMQ A;  4M75 D;  3QZ5 B;  5IHI A;  3CMA Q;  3CXC P;  4C92 B;  1Y71 A;  1W70 A;  1MGQ A;  1ZBJ A;  3OS0 A;  1UEB A;  1YJW T;  4XTU A;  3CCM T;  2MI6 A;  1WXU A;  3LH0 A;  2CZ6 B;  1EZZ B;  3CCS T;  2VB6 A;  4RG2 A;  2RMO A;  1KD1 R;  2ZGW A;  4M7D C;  5LJ3 d;  1KJW A;  1PSF A;  4ZGJ B;  1VQ5 A;  2X4W A;  3GPL A;  1VQ8 T;  1PRL C;  3VS4 A;  4OB2 B;  3VRZ A;  1SHF A;  1NJI C;  1EFN A;  3QWX X;  2E65 A;  3EGD B;  3BE3 A;  3I56 T;  1M2V B;  2YT6 A;  3C12 A;  2BTT A;  4M78 F;  2NUP B;  5IN1 A;  4M78 B;  4PJO B;  4E7J A;  4BI4 A;  3NMZ C;  3JCM b;  2ENM A;  7AT1 B;  1VIF A;  2HZY A;  4KGZ B;  4ME7 A;  1RI0 A;  1YI2 Q;  4JJC A;  4XU1 A;  1BK2 A;  1M5Q 1;  2YUP A;  1IB8 A;  4X34 A;  2M0Y A;  2QI2 A;  4GLK A;  1BCO A;  4J6W A;  3UT1 A;  3M55 A;  3HHT B;  3CC7 T;  1OPL A;  4EMK B;  2QXF A;  4XTX A;  3SDZ A;  1WHM A;  2JM9 A;  3OBW A;  4BE1 A;  3V7C A;  5LJ5 e;  1WDX A;  1VQ5 T;  4C5H A;  2OTL Q;  2YUN A;  1XNI A;  3CEY A;  4BE2 A;  2VYT A;  5KYU B;  2XD0 A;  1W2B A;  2YXY A;  1X43 A;  2COW A;  4M78 D;  1WHJ A;  1LJO A;  1JXM A;  2E10 A;  2HSP A;  1WLP B;  1B07 A;  4KH0 B;  4M7A A;  4DEY A;  3C95 A;  4OF1 A;  2YHT A;  3M57 A;  1Q82 U;  2O9S A;  2BKD N;  2KYM A;  2FPE A;  4FYV B;  3QJY A;  3G4S A;  1NJI R;  1Z9Z A;  3EGX A;  1I81 A;  2QQB A;  2BZX A;  4AG2 C;  1H8K A;  1M2V A;  1ZSZ C;  1TH7 A;  4R55 A;  3A8G B;  3G6E T;  4RTX A;  5HK0 A;  2DVJ A;  2QQA A;  3CCQ Q;  1LPL A;  2O9V A;  3JCM J;  4A63 B;  4M75 E;  3VU3 C;  1UUE A;  4JLI A;  1U8R A;  3CCL A;  3CCJ T;  2DEU A;  2L3R A;  2AHJ B;  3REB B;  5KE2 A;  4OVA A;  1PM3 A;  4F7U E;  2NUT A;  3CCV T;  4KUD K;  2KRN A;  1Q86 R;  5LJ3 f;  3TVT A;  5KYW A;  1GFC A;  1BU1 A;  3FJP A;  2C0O A;  5CKB A;  3KXT A;  1YJ9 A;  3VRY A;  2AKK A;  2FB7 A;  2VV5 A;  1D3B B;  1D1C A;  4M77 C;  3JAM E;  1VUB A;  5EC7 A;  8AT1 B;  4C92 C;  2NUZ A;  4MDW A;  1CSK A;  4M77 G;  4ESR A;  5D6X A;  4OMF B;  1VQK A;  4J9B A;  3ER0 A;  3RNJ A;  4JRI A;  1YCY A;  4Z89 A;  5KE3 A;  2LQ8 A;  3CC4 A;  1AWO A;  2XIC A;  4C8Q G;  3MJX A;  4M78 A;  2RJE A;  3QYH B;  3RMS A;  2RJD A;  5LJ3 h;  2EGC A;  5D6W A;  4HCK A;  3MEA A;  3L2W A;  2LJ1 A;  2ZPB B;  3OYK A;  1Y0M A;  4FT2 A;  2DF6 A;  2EYZ A;  2K4Y A;  4OMN A;  3CC4 Q;  2XDD A;  5CKH A;  2PU9 B;  2HKQ B;  3EFR A;  1G3Y A;  2A7Y A;  2ED1 A;  3P8B B;  4CRI A;  4F7U F;  1U1T A;  1Q86 U;  2H3J A;  2K57 A;  1ZA2 B;  4A4K A;  2D9T A;  1B7T A;  2YDL A;  2E70 A;  1J3T A;  2KRO A;  2RHI A;  3M4G A;  4PNO A;  4PJO E;  3VS7 A;  5GAN 4;  4QQG A;  4LNP A;  1Y07 A;  4A54 A;  2KE9 A;  3BY7 A;  4KBM B;  4A4G A;  2DNU A;  4C0F A;  2DRM A;  3X24 B;  3VUB A;  4FW2 A;  4DBH A;  1NG2 A;  3JCM W;  3QBY A;  1S72 A;  1JBM A;  3ASK A;  4OB0 B;  4QVC A;  2E5K A;  2EJF A;  4XK8 E;  2IIM A;  3E2U A;  4XU2 A;  5KH6 A;  2RJF A;  2EYY A;  2WSE E;  1M3A A;  3ZBD A;  3RKX A;  2HQX A;  4B6M A;  5C6S A;  4PFP A;  1VA7 A;  4FYY B;  3OYC A;  3QYG B;  4J8O A;  4KUL A;  4QQ6 A;  2YWW A;  3JCM g;  4JS5 A;  2GF7 A;  4PJN A;  3G1J A;  3VV0 A;  2R5M A;  2DIQ A;  2CH4 A;  2JMA A;  3TEE A;  1XTD A;  2OTJ Q;  1QCF A;  2LJ0 A;  2DBK A;  2DX1 A;  2GGR A;  3U23 A;  2CSQ A;  1D0X A;  2MCN A;  2EQI A;  2KT1 A;  2J6K A;  1HD3 A;  1Y57 A;  4BE0 A;  1W4S A;  5GJV B;  3CXC S;  1W1F A;  3OW2 A;  3RES A;  1N8R C;  2C06 A;  1FMV A;  3NFC A;  2VKN A;  2BIV A;  2LCL A;  2OTL A;  4F17 A;  1V1C A;  1QLY A;  1NLP C;  2XMF A;  1NM7 A;  4NS5 A;  4FIB A;  3VS6 A;  4ZN1 A;  3V8K A;  1YWO A;  2DJQ A;  2A36 A;  1HK9 A;  1FWZ A;  5I2M A;  2IVW A;  3HRS A;  2H3E B;  9ATC B;  1UHC A;  1U1S A;  3S3M A;  5GMK i;  2K2M A;  3C4S A;  2RA2 A;  2B8A A;  4BDY A;  4PL6 A;  2VXE A;  4Q5W A;  2K2V A;  3QJ6 A;  2EQK A;  2KMT A;  5FU6 C;  2QEX T;  1H3Z A;  2LTO A;  4RUG A;  3UF4 A;  4M78 G;  4JRP A;  3JCM d;  4IUT A;  2LDM A;  4ELY C;  1RLQ C;  4FM4 B;  4BD3 A;  4RTZ A;  3E9F A;  1VQO A;  1JJ2 P;  1VQ9 T;  5KCH A;  4LD9 K;  1SSF A;  4L59 A;  2HBW A;  1I8F A;  3EG2 A;  2FZG B;  4EMG A;  3CC2 Q;  2FRW A;  2FPF A;  3IQL A;  2M0O A;  4LN2 A;  2DEQ A;  3PMI A;  1M1K C;  2V8I A;  3OYE A;  3PIP A;  1BI0 A;  1NZ9 A;  1YJN A;  2QDL A;  4DBR A;  3QXE B;  1R0C B;  1WFW A;  1MUZ A;  1WXT A;  1M9S A;  1GL5 A;  5LJ5 j;  5CKF A;  1KC8 R;  4DOW A;  1VQ6 T;  2HAX A;  1EX4 A;  3DLL A;  1QVG P;  1VQP A;  4C8Q A;  1VYV A;  2EIF A;  3G71 Q;  3CCS A;  4NL3 A;  3OYD A;  3CCM A;  1YJW A;  4FL6 A;  3CQT A;  3L2U A;  2FHD A;  3RER A;  2HL3 A;  2R57 A;  4HKE A;  1X69 A;  4JRQ A;  1YHQ A;  2NWM A;  2A28 A;  2Y4Y A;  4HVW A;  3MEW A;  3V7S A;  1YFN A;  1TUG B;  1X6G A;  3OS1 A;  4AMC A;  2K6D A;  5KYX B;  2JVV A;  3GOX A;  4J9E A;  1PC0 A;  1D0Z A;  3CXC A;  4TVR A;  4GLM A;  1BIB A;  3MCA B;  2X4Y A;  3I55 Q;  3I5S A;  2HKN A;  1WX6 A;  1YIT Q;  3WXM B;  3MPU B;  1WI7 A;  3VS3 A;  2DO3 A;  2IPO B;  2CP2 A;  4LDX A;  4FSS A;  1VQO T;  3CD6 A;  2XK0 A;  5CK9 A;  1UDL A;  2DL5 A;  3HKS A;  1PSE A;  1YIJ Q;  3PNW C;  1D0Y A;  2DD5 A;  2E6N A;  1OQK A;  1QW1 A;  3RIR A;  1ZSZ B;  2PZ1 A;  1D1B A;  4RCC A;  1K8A R;  2WSF E;  1BIA A;  1PKS A;  3OYG A;  3KBG A;  5FWB A;  1T0H A;  4XU3 A;  1NJI U;  1BCM A;  3JCM Q;  3G4S T;  2L3S A;  2DIL A;  4GY5 A;  2F69 A;  2ZPG B;  3BFM A;  4ZTJ A;  2O01 E;  3JCM f;  2K5I A;  3HP9 A;  4KGV B;  2QA4 Q;  1TU0 B;  3O8V A;  2EYX A;  3VYH B;  1UE9 A;  3AT1 B;  1MMG A;  1BBZ A;  1DJ7 B;  2L3Q A;  3SEM A;  1YCS B;  2F2W A;  2LX7 A;  2OTL T;  2YSQ A;  2J6O A;  3EG3 A;  4F16 A;  5GAO p;  4Z02 A;  3OYI A;  1X6O A;  2RHZ A;  4JPB W;  1WYX A;  2DAQ A;  4HCZ A;  4J7F A;  4RG8 A;  3EAE A;  3LYI A;  5I11 A;  2CT3 A;  3OSV A;  2M51 A;  2K7A A;  3CCU Q;  2JUF A;  2AKL A;  4E7Z A;  5L23 A;  5KYY B;  3TSZ A;  1BB9 A;  2CSI A;  2LX9 A;  1U5S A;  1QWE A;  2KEA A;  2QDY B;  2DK3 A;  1GCP A;  5GAO n;  2FG0 A;  1I0C A;  2XI9 A;  1NYG A;  1K8A U;  3GP8 A;  1M1K U;  1RL2 A;  1VQ9 A;  4XQ3 A;  1ZUU A;  1Y7X A;  2HNI A;  1UGP B;  1RAB B;  3QZ9 B;  3EGU A;  1QVP A;  1YIJ A;  3CME T;  4C8Q B;  2L5Q A;  2RM4 A;  1JXO A;  1M1K R;  3I56 A;  1VYU A;  3EFS A;  1YP5 A;  2DMO A;  4LE9 A;  3FDR A;  1M90 R;  3TRE A;  1R8O B;  2YRC A;  3A8M B;  3TSW A;  2OI3 A;  3T9N A;  1NE8 A;  2ZPI B;  2KAF A;  4C8Q F;  4M7A G;  1KD1 U;  2DRK A;  1M90 U;  1KQS A;  1UFF A;  5GAM e;  3O5Z A;  3CCR A;  3WVD B;  4M75 G;  1B34 A;  3LX7 A;  1ZUY A;  4M75 B;  1Q86 C;  1E6G A;  1W6X A;  2EJ9 A;  1FX7 A;  2G6F X;  2VAS A;  2K9G A;  4D8D A;  2MMP A;  3FLG A;  4JLG A;  1IO6 A;  4OML A;  1UGQ B;  4ELZ C;  3CBO A;  2F2V A;  1VIE A;  2EPD A;  2Y90 A;  1IGU A;  1SHG A;  5GMK l;  2LC4 A;  3INZ A;  1PD0 A;  2L0A A;  4FYX B;  2M1H A;  4J9I A;  2PUO B;  2QEX Q;  2DXB A;  1K9M U;  1Z9Q A;  1M30 A;  2JS2 A;  5GAO m;  1K73 R;  2P0K A;  1TUC A;  5KCO A;  1KQS P;  1BI2 A;  4Y91 A;  1ZA1 B;  4RTV A;  2RQU A;  1Q95 G;  2XKO C;  1FXX A;  1RAF B;  2FVU A;  5D7U A;  1K0X A;  1R77 A;  2VUB A;  1IGQ A;  3WVE B;  4AFQ C;  2CZ1 B;  4XAX B;  3EGX B;  4PJL A;  5L8R E;  1K8A C;  3QDR B;  4JJB A;  3DB4 A;  1X6B A;  1OZ2 A;  4Y28 E;  2XDB A;  2PTK A;  2L89 A;  3M4Y A;  1M8M A;  5DM7 R;  1S72 T;  2W0Z A;  1UTI A;  2KXC A;  2IG0 A;  2PVO B;  2ZPE B;  2G3R A;  5D6Y A;  2QQR A;  4M77 E;  3AHU A;  5FRM A;  2D6F A;  2K5L A;  2RQW A;  4LDW A;  3SD4 A;  3GBQ A;  1Y96 A;  2KI7 A;  1NYF A;  1X75 C;  4C0Z A;  4X9C A;  5M9O A;  4M4Z A;  5GAN 7;  1ZSG A;  2XG8 D;  3SB2 A;  1PD1 A;  1QQJ A;  2LRQ A;  3CCJ A;  3JCM c;  3EH2 A;  3J81 E;  4LDU A;  3PFS A;  4EMK A;  4L6V 5;  2CUB A;  2ECZ A;  2DLP A;  3G6E A;  4KUI A;  1AEY A;  2X51 A;  1XOV A;  3RBB B;  2PVG B;  5KYN A;  4E6R A;  1LOJ A;  1QP3 A;  2OTJ T;  1KG1 A;  3MO8 A;  4FW1 A;  4JJD A;  4BY6 C; 
#chains in the Genus database with same CATH homology
 3OW2 P;  1YIT Q;  3CC2 Q;  3CCR Q;  3CD6 Q;  1VQ7 Q;  3CC7 Q;  1VQ6 Q;  1QVG P;  3CCL Q;  1YI2 Q;  1NJI R;  2OTL Q;  2QEX Q;  1VQP Q;  3CPW P;  3CME Q;  1M90 R;  1VQN Q;  1VQK Q;  1YJW Q;  1QVF P;  3G71 Q;  1S72 Q;  1W2B P;  1Q7Y R;  1YHQ Q;  1VQ4 Q;  3CCV Q;  1YJ9 Q;  1YIJ Q;  1VQ5 Q;  1VQ8 Q;  1K73 R;  1VQL Q;  1VQM Q;  3CCJ Q;  2QA4 Q;  1KD1 R;  1N8R R;  1Q86 R;  1KQS P;  1M1K R;  1VQ9 Q;  1VQO Q;  1JJ2 P;  3G6E Q;  3CCM Q;  1Q81 R;  1K8A R;  2OTJ Q;  3G4S Q;  3I55 Q;  1Q82 R;  1K9M R;  3CCS Q;  3CC4 Q;  3CCU Q;  3CCQ Q;  3CCE Q;  3CMA Q;  3CXC P;  1KC8 R;  3I56 Q;  1YJN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...