3G4SQ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g4sQ00
1K8AR 1VQ5Q 3CCEQ 1NJIR 1M1KR 1KC8R 3G6EQ 1QVGP 1KD1R 3CCLQ 3OW2P 3CD6Q 1Q81R 1VQ9Q 1YI2Q 1VQ7Q 3CCQQ 1VQLQ 3CMEQ 3CMAQ 1K73R 1VQMQ 1S72Q 1Q82R 1VQ8Q 3CXCP 3I56Q 3CCMQ 1YJWQ 1YHQQ 1YJNQ 1VQPQ 1Q7YR 1QVFP 2QA4Q 1N8RR 2QEXQ 3G71Q 3CC7Q 3CCSQ 1W2BP 2OTLQ 3CC2Q 1VQOQ 3CPWP 1KQSP 1M90R 3CCVQ 3I55Q 1JJ2P 1VQ6Q 1VQNQ 1Q86R 1YIJQ 1VQ4Q 3CCRQ 1YITQ 3CCUQ 3CC4Q 1K9MR 1VQKQ 1YJ9Q 2OTJQ 3G4SQ 3CCJQ
chains in the Genus database with same CATH superfamily
3SFMA 2A28A 2HNIA 1NJIC 2VUBA 2PU9B 5FU7C 3M55A 3QYGB 1JBMA 4OB0B 4E7LA 2L0AA 5GJVB 1K0SA 1N8RC 4C0ZA 3VS6A 4QVDA 2LRQA 1Y96B 2DNUA 1VQ6Q 4CRIA 4BI3A 1K9MU 3PNWC 4M78E 5CKHA 1KC8U 3UPUA 4PJJA 1WFWA 1SHGA 4RTVA 1VQMQ 4KGZB 4JJDA 4E7IA 1ACMB 4DA4A 2EQKA 1NLOC 4OMLA 1BB9A 1NE8A 4M78F 5J39A 2B86A 4M78C 5CKDA 3BFMA 3SDZA 5KYXA 4M75A 1TSFA 5GMKe 2ZAEA 1TS9A 4OB1B 5GAOn 3DLMA 1KD1R 3TSZA 4B9WA 4M7DF 1VQLQ 3CMEQ 4KH1B 2QTVA 4WF2A 2EQMA 2HL5C 4WCIA 2H3JA 1U06A 1TH7A 4X34A 3ZBDA 3RR6A 2E3HA 1YIJQ 2GTJA 4JUVA 2O88A 4QQ6A 2QI2A 1BI3A 3LH0A 2D1XA 4F04B 1NZ9A 2DTIA 4FSSA 2YLBA 1QVPA 3URGA 2XK0A 5L23A 4R56A 3H9NA 4JZ3A 2XDPA 3TQ7P 1K73C 4J9HA 2X4XA 3QYHB 1YCSB 4ZN3A 3A1PA 1JB0E 3G71A 2LT1A 1Y71A 2HQEA 1T0JA 2SRCA 4KGXB 1ABOA 1G3YA 3I5RA 3JB9D 4MMKA 3KUFA 1KHIA 2DM1A 2LDMA 4XQ3A 5GAMg 3CPWS 1GL5A 3EGDB 1I07A 4J9EA 4Y28E 3S3OA 2RI5A 3L2QA 1YI2T 1YHQA 4BE0A 3QG1A 5ECAA 4J6WA 1XOVA 1MMDA 5KE3A 3LLRA 2X3XD 3MEVA 5IH2A 1LVKA 1YN8A 1N5ZA 2DAQA 2R58A 4RTTA 2HSPA 3M0PA 1TXQA 1W4SA 4FW1A 2D0NA 3RKWA 3MHXA 4FL6A 2L8DA 1C6VX 1WXBA 4A4FA 3P8DA 5GAN3 2DIQA 4HCZA 1YJWA 2HL3A 1D1CA 1QVFA 2VWFA 2ROTA 3NPFA 3VUBA 2RQVA 2K7AA 1ZSZC 1XTDA 3CCEA 4C92B 5KYYB 1KD1U 2COZA 1T3SA 3PIOA 4A54A 3ZFJA 2YRDA 4C8QF 1NYGA 2XHCA 1BCOA 3LH5A 4ATOA 3LGLA 2XKOC 1FXXA 5IN1A 5CQXA 4PJOF 2DE0X 2YT6A 2JTEA 3HFNA 3CCUT 5EC7A 1D09B 2EPDA 3JCMg 4D8DA 2EYXA 2P0QA 3PT9A 1U8RA 4XTVA 5IT9E 3QHSA 2RN8A 1H3HA 2YLCA 3THKA 3GP8A 2W10A 3UA6A 5CQYA 1W2BP 2A37A 2XDBA 2F2WA 2HAXA 3I55A 5GAMj 5I2MA 4ZNXA 3SEMA 2EQIA 4HCCA 5FWCA 4IURA 1M27C 2AT1B 1JJ2S 2ABLA 1J3TA 2Y90A 2EGCA 1SKUB 5LJ5f 3H8ZA 2MF2A 2QA4Q 2HKQB 5I21A 4DBQA 2AIRB 5C6SA 3KBGA 1UB4A 3CPWP 1SHFA 1OX8A 3QXEB 4C92E 3RUXA 5GJWB 1ZX6A 2EW3A 1UTIA 5GAOl 2OTJA 3CCRT 1VQ6T 4A4KA 3HP9A 5HCKA 2FZKB 4C92C 3I56A 4J8OA 4LUDA 4DBRA 1VQMT 4OMNA 5GANg 1PM3A 4ZGEB 2VKNA 2CP6A 1Q86C 2KXCA 2MMPA 3CXCS 4MZTA 4PJMA 3ZL7C 1VQNT 1YCYA 1BU1A 2KYMA 2QDLA 2FRWA 1HXDA 4HCKA 3TEEA 1PD1A 3RKYA 2O01E 5DY9A 1NM7A 4FCYA 4MMLA 2CP5A 3G71T 4M7AE 1OZ2A 4AFZC 3CC4Q 3SWNC 4LUEA 2L5QA 1ZUKA 4AT1B 4KRTA 2BZ8A 1X6BA 9ATCB 2CSQA 5GAOm 1KFZA 2H8HA 1Q81R 3O8VA 2AZSA 1WXTA 4M77G 1OPKA 4M7AF 2VASA 3NHNA 4M7AC 2DD5A 2EKHA 3OSSC 2NUTA 1VIFA 3GPLA 1YHQT 4IKFA 1QKWA 3PVQA 5KCHA 2DO3A 2EKOA 1ARKA 2DPPB 4HVWA 2G6FX 3VJPA 1IGQA 4AMCA 2E5QA 4M75F 1M1KC 2ZGWA 3BDUA 2X51A 1YJWT 2CZ0B 1JJ2P 1I5LA 3SHWA 1D1AA 1MHNA 5HKCA 4C92D 1K0XA 5AT1B 4IUUA 2P4TA 2EJFA 3CCLA 2NYSA 5FWBA 3CCET 3GNFB 1RUWA 2VYTA 3R6NA 5IHKA 2FZGB 5KCOA 4J7IA 3JB9J 3G7ZA 2K57A 2YSQA 5GANj 2X4JA 2IIMA 4IUTA 3S6WA 4RCCA 3QJ6A 4BY6B 2CT3A 2VVKA 1PD0A 3EGXB 2YUQA 1YITA 1VQKQ 4BE1A 1G3TA 2F2VA 3NMZC 2KT8A 1M30A 2FO0A 1TUCA 4F7UE 2JMCA 1B07A 1B34A 3CXCP 4BDYA 1Q82C 3CC2Q 4RUGA 3EG1A 5CO7A 5GAOq 3H6ZA 4F7UF 1YJ9Q 2CZ6B 3I55T 4P5NA 3PVLA 3NGPA 3OYAA 1Q81U 5L8RE 4PK4A 2XD0A 2LCLA 2GQIA 4CC4B 3CCMA 1ZA2B 2JTMA 2OTLA 2E6NA 1F1BB 2XDDA 3E1SA 1Y96A 2J7IA 5M9OA 4PNOA 1VQ4A 4HCBA 2E1HA 1YNZA 4OGEA 2BIVA 3UF4A 1VQ5A 2OTJT 1AT1B 2OAWA 1DJ7B 3CD6A 1QP2A 2J6FA 5I11A 1QCFA 5CKBA 1OPLA 1TTHB 4EMKC 1TU0B 2QEXA 3A8HB 3I56T 2ZPHB 4OMFB 2RJDA 3FC3A 1BIAA 4F16A 4RTYA 2QA4T 4ZTFA 2DK3A 2D0QB 4A4GA 4RKUE 4KT0E 1HD3A 2Y4XA 5LJ3g 1YI2Q 2LX9A 2MYSA 2RB6A 4XU2A 2R57A 4ORZA 2DKGA 1GCQA 1S72A 1IZ6A 2L2PA 3LYIA 2YWWA 3CC7Q 1U5SA 2LQNA 1NLPC 1JEGA 4OB3B 4KH0B 3V8KA 1PWTA 1W2BA 5FU7B 2FB7A 2ED1A 2QAZA 2EGAA 1PCXA 2RM4A 1X43A 2BE9B 1FWZA 1I4K1 4F14A 3C12A 3OYKA 1AEYA 1E6GA 3A98A 3EFRA 1JRIA 2JNGA 4DEYA 1VQOT 1VOMA 3VS4A 4C0FA 3HRUA 3CPWA 4JRKA 2YRCA 2RJCA 4VUBA 2MK5A 4FT2A 3BY7A 4D8KA 3JCMX 1WXUA 3CC4T 2CUBA 3EFOB 4HKEA 3OS1A 2ED0A 2DYBA 4N4HA 5GAOr 4M78B 1YJNA 3A8GB 3OS2A 1M3CA 2PTKA 3DLLA 2CT4A 3X26B 1RL2A 2JOYA 3CCUQ 1EZZB 3O5ZA 1AD5A 2EQUA 3I9QA 4QT7A 2COYA 4M7DB 4YTLA 3V7SA 1K76A 2DERA 3OS0A 2XI9A 5GAMf 3GLXA 5HK3A 1NG2A 2DL7A 4NL3A 1PNJA 1VA7A 5FU6B 3MJXA 2M1HA 3UWNA 2GF7A 5LJ3j 1YITT 2KGTA 1PSFA 2NUPB 2JXBA 5KYYA 1RI9A 2LZ6B 2HEQA 2O9VA 1OULA 4J9FA 3BW1A 4JS4A 1G5VA 3EG9B 3BDLA 2JW4A 4GLKA 2QK0A 2BZYA 3CCRQ 2RHUA 5FLXE 1KJWA 4C5HA 3QUIA 1BI2A 3FJPA 1WIEA 1VQKT 1IRXA 1OU9A 1OZ3A 2J05A 2J6KA 2Z0WA 1BI1A 3INZA 2F5TX 3META 1JQQA 4J6XA 4N0AA 3OYIA 3PFSA 3CCMT 4M7DE 2RA2A 4CC7A 1SPKA 4HT8A 2EQJA 1VQNQ 2OTLT 3CC2T 5KH6A 1VQ4T 2CZ7B 1JJ2A 2V1QA 2EIFA 2RHZA 2FPDA 1WJQA 2HZYA 3OYCA 1YJ9T 3I5SA 1Y57A 1VQ5T 2W0ZA 3CCQA 4M7DC 3CD6T 2CYZB 3JCMf 4BI8B 1X2KA 3G71Q 2M51A 1ZSZB 3X24B 2QEXT 1U3OA 1NPRA 3L2VA 4K11A 4F17A 3A8OB 2GQVA 2B8AA 1SSFA 3QKJA 1OQKA 4NL2A 1WHKA 4GBQA 4C8QB 1JU5C 1W2BS 2CP0A 3G6EA 3RMSA 1B3QA 3VV0A 5FU6C 4Z89A 4HXJA 1YHQQ 2C06A 1S72T 4PJOB 3CXCA 1D1BA 1UGQB 4MZPA 3VS1A 3MPUB 3OSVA 3QWXX 2QQ9A 3WVDB 4MDWA 2KI7A 1UGPB 3OBYA 2L3PA 1NEGA 4M77F 2AK5A 2DMOA 4M77C 1Z9ZA 3M0SA 2EWNA 3QO3A 1UJ0A 4QW2A 4ZGJB 1YJWQ 3KFVA 2P0PA 4LN2A 3MO8A 3J7AF 1KHCA 1UE9A 2K9GA 1ZBXA 1NBEB 2AHJB 1YIJA 2ZPFB 1M90C 3CC7T 2PZ1A 2LQKA 5GANf 3QPHA 4XU1A 4QVZA 3CCEQ 2MIOA 2O4XB 3M0UA 4C5GA 3H41A 2PVGB 4M78D 2QQRA 5HK0A 3RNJA 3OA6A 2CDTA 2DTOA 3VS7A 3VS0A 3REBB 2A0FB 1VQPA 4DQ2A 1WHHA 4LDUA 4ANJA 1B7TA 4UC4A 1Q95G 4HT9A 1PRLC 4DOWA 4C8QE 3H0HA 4B9XA 4M7DD 1S1NA 1YP5A 3LGFA 3VYHB 1K9MC 2X4WA 4BUGA 4O5VA 2D6FA 2RJFA 2DIGA 1KC8C 3RBBB 2C0OA 4PJOE 4LDYA 3HRTA 4A4HA 1AHJB 2KSSA 2MWOA 2XIDA 3OYFA 4LD9K 1VUBA 4C8QC 2KRSA 1N6AA 3I55Q 4KGVB 2QGGA 1QQJA 2KVQG 4C5EA 4E6RA 4PJOC 1BI0A 3VRZA 5IXBA 1RAGB 2EVRA 4BI4A 2QQAA 1AWXA 5LJ5h 5IAYA 1TUGB 4JLGA 1TWBA 1XNIA 2I0NA 3JCMQ 1VQ7A 1N9SA 4R0KA 4RCBA 2YUOA 3C4SA 8AT1B 5KE2A 4OMMA 3SWNB 1WNLA 1OOTA 2HQHA 2EAYA 3AT1B 2PUKB 4EPCA 4AG2C 4X1VA 3L2RA 2AKKA 2QXFA 3OYMA 2OTJQ 3M9QA 3TSWA 4M7AB 3S3MA 4IIOA 1WI7A 3EG0A 2LVMA 4ESRA 3I56Q 4Q5WA 3JB9G 3FB9A 4HVVA 4N4IA 3IQLA 4ZTJA 2ZPGB 3ER0A 2JN0A 2L3SA 2EJGA 1QW1A 4M75B 2KNBB 2OI3A 2FRYA 2YUPA 2BZXA 1ZQ1A 2BTTA 2X35A 1I5OB 3WVEB 5GMKj 4FYVB 2GTOA 2M02A 4O6JA 3A8MB 3MP1A 3L2UA 2CH4A 1UGRB 1RADB 1X2QA 3HKSA 5GAOp 2C0TA 4XTXA 2FPEA 2HMAA 3LW5E 4BD3A 4C8QD 2CS7A 3M57A 1K8AR 5FRMA 1T0HA 2O9SA 1M5Q1 2GFUA 2DL5A 2QYZA 2DEQA 7AT1B 8ATCB 3CMAA 1AVZC 1D0XA 4PJOD 1R0CB 1M1GA 2MAMA 5KYUA 1VYUA 4Y92A 1VQOQ 5LJ5e 1IREB 2LJ3A 2OAUA 4GLMA 2DFUA 1W6XA 4FYXB 2RPNA 2LX7A 2F69A 5IHNA 5KYWB 1QVGP 2LTOA 1KD1C 2RO0A 2EYYA 2QQSA 1Y0MA 2PQWA 1BIBA 4M75E 4EIKA 1Y07A 1VYTA 4F7UB 3JCMb 3RMQA 5A0GA 2CZ1B 3OW2S 1OI1A 1D0ZA 2DZCA 1C1AA 2WACA 2LT4A 4J9BA 2ZPBB 2E5KA 3CCJA 2YUNA 1NPPA 3CCLQ 1RLPC 1M4ZA 1YWPA 2DYIA 1LPLA 2FYKA 2KROA 4M75C 3UT1A 1VQ9A 2FEIA 4L5GA 2HSEB 1IHVA 5LJ3f 2J6OA 2KBTA 1KIKA 3L1AA 1VQPT 3CCSA 2E41A 2RK1A 3E2UA 1YITQ 3L42A 2V26A 3X25B 4ZGDB 1I1JA 1NJIR 1JXMA 3QDRB 2MI6A 5I2SA 3EFOA 4EMKB 2RI3A 1E7OA 4OF1A 5DM7R 4JS5A 3A5ZB 4RG2A 4PFOA 3MP6A 2D8HA 2P4RA 5AYFA 3LWHA 4M78A 3PTAA 1N8RR 5LJ5d 2K6DA 2DRKA 4FYYB 4WTOB 5CAIA 1AOJA 3RDVA 1XQHA 1UG1A 1FMWA 4XTYA 5D6WA 3OYEA 1AZGB 2K5IA 3M0QA 2FL7A 5A2QE 1K8AU 2CGHA 5LJ5g 1JXOA 1H8KA 4IIMA 1YFNA 3M4YA 3JV3A 3I35A 2IG0A 2G3RA 2KYBA 2DLPA 4BB7A 3HHTB 3CCMQ 2FHDA 5FROA 1WQ7A 4XK8E 2OTLQ 3RERA 2DEUA 1M3AA 2DA9A 2QGFB 3TREA 4PFZA 2RHXA 3ASKA 2AZVA 2E12A 1VQ4Q 1WZOA 2V1RA 4HVUA 2M0OA 1WYXA 3VKIA 4M7AD 1LNXA 1VQ5Q 2RF0A 3CD6Q 6AT1B 1MV0B 3FLGA 3HFOA 2QASA 3PE0A 2DBMA 2QEXQ 4FSXA 1PKTA 4BACA 2DZ9A 3MEWA 3UDCA 2WSEE 4M75D 4PKCC 3OYJA 3QZ5B 1LCKA 4AG1C 3P8BB 2DVEA 2YXYA 4KULA 3JCMW 1EIFA 3G4SA 1RLQC 2VGMA 2SEMA 1RAIB 3M4GA 3OW2P 2KE9A 1UHCA 3G1JA 3HSBA 1K73R 5D6YA 1S72Q 5I22A 1OU8A 3OYYA 5J26A 1BKBA 2VB6A 2EBPA 1V1CA 1MV3A 1WLPB 2ZCFB 3CBOA 4FYWB 3HL8A 2PVDB 4OMOA 1X6GA 3CQTA 3OBWA 1ZUUA 2RQUA 1YBYA 3MCAB 3JCMV 1NJIU 1ZLMA 1KQSS 5GAN7 4IUPA 1M9SA 3OB9A 2KT1A 3CMAT 1N8RU 4C92G 3R6OA 3SB2A 1M90R 3M56A 1ZSZA 4OMPA 4BDZA 2A7YA 2Y4YA 5LJ5j 2FG0A 3CBMA 2DJQA 2IPOB 1UJYA 3ULRB 3OYBA 3HTRA 1Y7XA 4QVCA 1SRMA 4JPBW 1O75A 3RKXA 2F2XA 1QP3A 4KUIA 4OB2B 3UA7A 2DD4A 3VRYA 2NUTB 4EMHA 3GIBA 4X9DA 1WHJA 1QWEA 2R5MA 3OYHA 4PL6A 2BE7D 1MNDA 2LQ8A 3CBPA 4L6V5 1I81A 3EH1A 2JVVA 2CUDA 4ME7A 5A0DA 2DL4A 5GAMh 5FRNA 2JTFA 1YI2A 1UDLA 1WA7A 3OMGA 3EGUA 3EGDA 1K9AA 4XTWA 1VQ8A 1QWFA 1TOVA 4M7AG 3EFSA 2K79A 2MWPA 2K2VA 3CCVA 2LQWA 3CCST 1D0YA 3M0RA 2RD1A 1IO6A 3JRZA 2JZ2A 4J9IA 2XICA 2O4XA 4N4GA 1Q81C 4X9CA 4JDSA 1K73U 4C0GA 2QDYB 1MMNA 3CCLT 2JJ9A 3REAB 3C94A 1P92A 3FEOA 1QKXA 1TUDA 2DILA 2DF6A 1AZEA 3CPFA 3GBQA 1UECA 2NWMA 1KQ1A 1ABQA 3NTHA 3E9GA 2L3QA 2VV5A 3FIFA 1QCNA 1EFNA 4C92A 2E10A 3L2ZA 1OV3A 4C5IA 2DETA 2M0YA 2X3WD 2V8IA 1LJOA 1I0CA 1H641 3TCJA 2A08A 2CP7A 2R5AA 5IHIA 3LWIA 1GXIE 1KQSP 2BUDA 1M90U 5CKFA 2GGRA 2VXEA 3QBYA 3D7SB 4A53A 4M77B 4FT4A 3JCMh 4J7FA 1R77A 1NYFA 2LJ1A 4L59A 3CCQQ 4OVAA 3QIIA 4IUVA 3JB9F 2JMAA 3E19A 3OMCA 3SWNA 5GAMe 4FIBA 1GRIA 1Q86R 2C0IA 2RNAA 5A0LA 2KRMA 4J9CA 4F7UG 2KR3A 2COWA 3G6EQ 3G4ST 1M3BA 3QJYA 4GY5A 4M7AA 4RTXA 2YRVA 5KYNA 1SF9A 3GF5A 5C0MA 2JS2A 1QLYA 3TU4K 1Q7YC 4J83A 2E6ZA 4PLIA 3HRSA 2E70A 1I8FA 2DJZA 2LP5A 3CCRA 1VQ6A 4DBFA 3F70A 3EHQA 3MKDA 2ROLA 3NFCA 3JB9I 4JJCA 1U1SA 2DXBA 1ZSGA 3KXTA 2D8JA 2LNVA 1VQMA 2K3XA 2PNIA 4M77E 4LE9A 5GANh 1AWOA 1VQNA 2V8JA 2PVOB 3DB3A 3OYLA 4FM4B 4Z02A 1GCPA 1M1KR 3JSCA 2OJ2A 5LL6S 2A36A 4PFPA 1VQLA 3CMEA 3JCMc 2EYZA 1RAFB 1VQPQ 1ZHIA 4CC3A 2K3YA 5GAMd 2M16A 3V7RA 2JS0A 1PC0A 4R55A 1D3BB 1PG5B 3JCMe 3RESA 1UGVA 4LDWA 4JRQA 1V76A 1FMKA 4QKUA 4A4EA 5KYWA 2RQWA 2VGNA 4B6MA 4ELZC 2YDLA 2LJ0A 4E2FB 1GBQA 4RTUA 3OW2A 4LDXA 3VYGA 3Q1JA 4J5YA 1CKBA 2QG9B 1VQ8T 2WSCE 4F7UA 2EJ9A 1YJNT 2CP2A 1RABB 1Q86U 2LMJA 2GBQA 1AWWA 2NLUA 1BBZA 3M58A 1UGSB 3CCVT 3PMIA 1H3ZA 1ZBJA 5EG2A 1O9SA 4MZMA 5HY6A 3OQ5A 1VYVA 2MOXA 2ECZA 1LOJA 4DBHA 4BE2A 1VQ7Q 1SG5A 4RG8A 4CC2A 4LD6A 2F5KA 1Q82R 1UEBA 1WPYA 2HQXA 2MPXC 1QVGS 2RI2A 1M2VB 1GCQC 1SEMA 5CKEA 2J06A 2K5FA 2X9HA 2F1LA 1SSHA 1G83A 3EG3A 3VS3A 3AHUA 2X4YA 5GANe 4EMKA 3FDRA 4CI0C 3SD4A 3NTIA 4Y91A 3M54A 2D9TA 3JCMd 3M5AA 1PHTA 4M77D 1WX6A 2M9UA 3VU3C 3J81E 3EGXA 3EHRA 3L2WA 1G3WA 4A63B 2RHYA 1M1KU 4XU0A 1FYNA 4E7ZA 2EGEA 3CEYA 3PMTA 4IUQA 1GFCA 3FJ5A 1M8VA 2V8KA 4Z8AA 1WJSA 1WDXA 3EH2A 5GAN2 2KAFA 3JAME 1UFFA 1KSWA 5KYXB 4OGCA 2DXUA 1K1ZA 3QDFA 1U1TA 3C95A 3HPWA 2EFIA 4ELYC 3CMAQ 3MP8A 2VXFA 2DL8A 5IXFA 2CREA 3CCQT 4LDVA 2HCKA 2RK2A 3NTKA 3PIPA 3N5BB 2HBPA 2CP3A 1WQWA 1R8OB 3M53A 4M78G 1N27A 2PUOB 5GANd 3C0CA 1IXDA 4JJNK 2EYQA 1FMVA 1VIEA 4C92F 3G6ET 1Q82U 4M7DG 1EX4A 1IHWA 4AFUC 3JCMJ 2QA4A 3DB4A 1K4US 2RHIA 2I2LA 2ATCB 2BKDN 1NEBA 1R0BG 5GAN5 4EDUA 3P8HA 1KQSA 2L3RA 1C0MA 4MDXA 3CCJQ 3QZ9B 4RMOA 4TVRA 5LJ3h 2GNCA 4LNPA 1OEBA 4JJBA 1W1FA 4E7JA 1VQ9Q 1AWJA 1MGQA 4FU6A 2E4HA 1VQLT 3CMET 2QTXA 3CCSQ 2KQWA 1QMCA 2H3EB 2KK4A 4N0AC 1RAAB 1CSKA 4RTWA 2JUFA 4PJNA 2FPFA 4E7HA 5CVIA 5GAN6 1YIJT 2O2OA 1OX9A 1WGSA 2K3BA 3V8LA 3QSUA 1M8MA 3RIRA 1IB8A 3GOXA 1PRMC 2XMFA 3FRNA 2CSIA 2VC8A 3H0FA 1VQOA 1G2BA 3BE3A 2KDSA 3CC4A 3EAEA 2XG8D 2HD0A 1QVFS 1A0NB 2LC4A 4E7SA 2ZPEB 4E47A 1MUZA 2MCNA 1UUEA 3OYNA 5CCAA 1BK2A 2XU8A 2P0KA 4NOYA 2OX7A 2GFAA 2DVJA 3ME9A 1IGUA 5CR2A 5DLOA 2RJEA 4XU3A 2RH2A 2DRMA 4FW2A 2DTHA 4M7DA 2P84A 4XTZA 2NUZA 5D6XA 2K4YA 1X27A 5D7UA 3LX7A 1GFDA 4C0DB 2E3IA 2FZCB 1X75C 2JM8A 3E9FA 3GNGA 1VQ7T 1WHGA 3H0IA 4C8QG 1RI0A 5LJ3e 1RAHB 1KQ2A 3TVTA 1N9RA 2DXTA 3OS5A 4XAXB 3VUZA 3G4SQ 2CKKA 1JO8A 4PJOG 2JM9A 2NUPA 3ZEHA 2KXDA 2DBKA 5GMKi 1HK9A 3A8LB 1BCMA 1Q7YR 2ESWA 5J3BA 2YHTA 3JB9H 3EG9A 1RACB 1XJWB 5GMKl 5GAN4 2DXCA 5FW9A 1V29B 2RMOA 1VQKA 4M77A 1HYOA 1BYMA 3PGGA 2JT4A 3OY9A 5CIUA 2EYWA 3QWYA 2FVUA 3OYDA 1QCOA 4OP0A 3CC2A 2AKLA 4E7KA 1T3LA 4NS5A 3M59A 1YJ9A 2A3LA 2KEAA 5DLQE 4J9GA 2CH4W 2KRNA 4KUDK 4M4ZA 1SRLA 1ZUYA 3J80E 4AFQC 4PJLA 1QVFP 5KYUB 4C0DC 4EMGA 4QQDA 5LJ3d 1Z9QA 1PKSA 2ZZDA 1RAEB 5GMKm 4DEXA 2QQBA 1CKAA 4LXCA 1WJRA 5GAN8 4RTZA 2K2MA 4OMQA 4BY6C 1YWOA 1W70A 4C8QA 4JRIA 4ZN1A 3MEUA 2E65A 1HJDA 2K5LA 1VQ8Q 3V8JA 1YJNQ 4AFSC 1M1FA 2HKNA 3VS5A 1WHLA 2ZPIB 1KK7A 4PJOA 3CCVQ 4XTUA 4QQGA 4V2SA 1K9MR 2LNHB 1MMAA 1X6OA 4JRPA 3S3NA 2RQTA 1GBRA 4J6YA 1KC8R 1K8AC 2RQRA 3CCJT 2HDAA 2ENMA 2KY9A 2WSFE 1VQ9T 1Q7YU 2GCXA 4II1A 1PSEA 3M0TA 3CC7A 3DKMA 3VS2A 1D3BA 1ZA1B 5CK9A 1E6HA 3OYGA 3JCMP 2HBWA 1MNEA 1X69A 1M2OA 4KBMB 4M75G 3T9NA 2E64A 1OYXA 4JLIA 3X20B 5GMKh 2LCSA 2KMTA 2IVWA 1TG0A 1G8XA 4JZ4A 1WHMA 4J9DA 3EG2A 4Z88A 3V7CA 1G3SA 3UATA 4PLLA 3U23A 2LCCA 4D6WA 2L89A 1B34B 1X01A 1QVGA 3WXMB 1HSQA 2DL3A 1M2VA 1MMGA 2DX1A 1KG1A 4DOVA 2O31A 1UHFA 1FX7A 3CCUA 4HA8A 3X28B 3MEAA 1H92A
chains in the Genus database with same CATH topology
1K8AR 1VQ5Q 3CCEQ 1NJIR 1M1KR 1KC8R 3G6EQ 1QVGP 1KD1R 3CCLQ 3OW2P 3CD6Q 1Q81R 1VQ9Q 1YI2Q 1VQ7Q 3CCQQ 1VQLQ 3CMEQ 3CMAQ 1K73R 1VQMQ 1S72Q 1Q82R 1VQ8Q 3CXCP 3I56Q 3CCMQ 1YJWQ 1YHQQ 1YJNQ 1VQPQ 1Q7YR 1QVFP 2QA4Q 1N8RR 2QEXQ 3G71Q 3CC7Q 3CCSQ 1W2BP 2OTLQ 3CC2Q 1VQOQ 3CPWP 1KQSP 1M90R 3CCVQ 3I55Q 1JJ2P 1VQ6Q 1VQNQ 1Q86R 1YIJQ 1VQ4Q 3CCRQ 1YITQ 3CCUQ 3CC4Q 1K9MR 1VQKQ 1YJ9Q 2OTJQ 3G4SQ 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A R;  1VQ5 Q;  3CCE Q;  1NJI R;  1M1K R;  1KC8 R;  3G6E Q;  1QVG P;  1KD1 R;  3CCL Q;  3OW2 P;  3CD6 Q;  1Q81 R;  1VQ9 Q;  1YI2 Q;  1VQ7 Q;  3CCQ Q;  1VQL Q;  3CME Q;  3CMA Q;  1K73 R;  1VQM Q;  1S72 Q;  1Q82 R;  1VQ8 Q;  3CXC P;  3I56 Q;  3CCM Q;  1YJW Q;  1YHQ Q;  1YJN Q;  1VQP Q;  1Q7Y R;  1QVF P;  2QA4 Q;  1N8R R;  2QEX Q;  3G71 Q;  3CC7 Q;  3CCS Q;  1W2B P;  2OTL Q;  3CC2 Q;  1VQO Q;  3CPW P;  1KQS P;  1M90 R;  3CCV Q;  3I55 Q;  1JJ2 P;  1VQ6 Q;  1VQN Q;  1Q86 R;  1YIJ Q;  1VQ4 Q;  3CCR Q;  1YIT Q;  3CCU Q;  3CC4 Q;  1K9M R;  1VQK Q;  1YJ9 Q;  2OTJ Q;  3G4S Q;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 3SFM A;  2A28 A;  2HNI A;  1NJI C;  2VUB A;  2PU9 B;  5FU7 C;  3M55 A;  3QYG B;  1JBM A;  4OB0 B;  4E7L A;  2L0A A;  5GJV B;  1K0S A;  1N8R C;  4C0Z A;  3VS6 A;  4QVD A;  2LRQ A;  1Y96 B;  2DNU A;  1VQ6 Q;  4CRI A;  4BI3 A;  1K9M U;  3PNW C;  4M78 E;  5CKH A;  1KC8 U;  3UPU A;  4PJJ A;  1WFW A;  1SHG A;  4RTV A;  1VQM Q;  4KGZ B;  4JJD A;  4E7I A;  1ACM B;  4DA4 A;  2EQK A;  1NLO C;  4OML A;  1BB9 A;  1NE8 A;  4M78 F;  5J39 A;  2B86 A;  4M78 C;  5CKD A;  3BFM A;  3SDZ A;  5KYX A;  4M75 A;  1TSF A;  5GMK e;  2ZAE A;  1TS9 A;  4OB1 B;  5GAO n;  3DLM A;  1KD1 R;  3TSZ A;  4B9W A;  4M7D F;  1VQL Q;  3CME Q;  4KH1 B;  2QTV A;  4WF2 A;  2EQM A;  2HL5 C;  4WCI A;  2H3J A;  1U06 A;  1TH7 A;  4X34 A;  3ZBD A;  3RR6 A;  2E3H A;  1YIJ Q;  2GTJ A;  4JUV A;  2O88 A;  4QQ6 A;  2QI2 A;  1BI3 A;  3LH0 A;  2D1X A;  4F04 B;  1NZ9 A;  2DTI A;  4FSS A;  2YLB A;  1QVP A;  3URG A;  2XK0 A;  5L23 A;  4R56 A;  3H9N A;  4JZ3 A;  2XDP A;  3TQ7 P;  1K73 C;  4J9H A;  2X4X A;  3QYH B;  1YCS B;  4ZN3 A;  3A1P A;  1JB0 E;  3G71 A;  2LT1 A;  1Y71 A;  2HQE A;  1T0J A;  2SRC A;  4KGX B;  1ABO A;  1G3Y A;  3I5R A;  3JB9 D;  4MMK A;  3KUF A;  1KHI A;  2DM1 A;  2LDM A;  4XQ3 A;  5GAM g;  3CPW S;  1GL5 A;  3EGD B;  1I07 A;  4J9E A;  4Y28 E;  3S3O A;  2RI5 A;  3L2Q A;  1YI2 T;  1YHQ A;  4BE0 A;  3QG1 A;  5ECA A;  4J6W A;  1XOV A;  1MMD A;  5KE3 A;  3LLR A;  2X3X D;  3MEV A;  5IH2 A;  1LVK A;  1YN8 A;  1N5Z A;  2DAQ A;  2R58 A;  4RTT A;  2HSP A;  3M0P A;  1TXQ A;  1W4S A;  4FW1 A;  2D0N A;  3RKW A;  3MHX A;  4FL6 A;  2L8D A;  1C6V X;  1WXB A;  4A4F A;  3P8D A;  5GAN 3;  2DIQ A;  4HCZ A;  1YJW A;  2HL3 A;  1D1C A;  1QVF A;  2VWF A;  2ROT A;  3NPF A;  3VUB A;  2RQV A;  2K7A A;  1ZSZ C;  1XTD A;  3CCE A;  4C92 B;  5KYY B;  1KD1 U;  2COZ A;  1T3S A;  3PIO A;  4A54 A;  3ZFJ A;  2YRD A;  4C8Q F;  1NYG A;  2XHC A;  1BCO A;  3LH5 A;  4ATO A;  3LGL A;  2XKO C;  1FXX A;  5IN1 A;  5CQX A;  4PJO F;  2DE0 X;  2YT6 A;  2JTE A;  3HFN A;  3CCU T;  5EC7 A;  1D09 B;  2EPD A;  3JCM g;  4D8D A;  2EYX A;  2P0Q A;  3PT9 A;  1U8R A;  4XTV A;  5IT9 E;  3QHS A;  2RN8 A;  1H3H A;  2YLC A;  3THK A;  3GP8 A;  2W10 A;  3UA6 A;  5CQY A;  1W2B P;  2A37 A;  2XDB A;  2F2W A;  2HAX A;  3I55 A;  5GAM j;  5I2M A;  4ZNX A;  3SEM A;  2EQI A;  4HCC A;  5FWC A;  4IUR A;  1M27 C;  2AT1 B;  1JJ2 S;  2ABL A;  1J3T A;  2Y90 A;  2EGC A;  1SKU B;  5LJ5 f;  3H8Z A;  2MF2 A;  2QA4 Q;  2HKQ B;  5I21 A;  4DBQ A;  2AIR B;  5C6S A;  3KBG A;  1UB4 A;  3CPW P;  1SHF A;  1OX8 A;  3QXE B;  4C92 E;  3RUX A;  5GJW B;  1ZX6 A;  2EW3 A;  1UTI A;  5GAO l;  2OTJ A;  3CCR T;  1VQ6 T;  4A4K A;  3HP9 A;  5HCK A;  2FZK B;  4C92 C;  3I56 A;  4J8O A;  4LUD A;  4DBR A;  1VQM T;  4OMN A;  5GAN g;  1PM3 A;  4ZGE B;  2VKN A;  2CP6 A;  1Q86 C;  2KXC A;  2MMP A;  3CXC S;  4MZT A;  4PJM A;  3ZL7 C;  1VQN T;  1YCY A;  1BU1 A;  2KYM A;  2QDL A;  2FRW A;  1HXD A;  4HCK A;  3TEE A;  1PD1 A;  3RKY A;  2O01 E;  5DY9 A;  1NM7 A;  4FCY A;  4MML A;  2CP5 A;  3G71 T;  4M7A E;  1OZ2 A;  4AFZ C;  3CC4 Q;  3SWN C;  4LUE A;  2L5Q A;  1ZUK A;  4AT1 B;  4KRT A;  2BZ8 A;  1X6B A;  9ATC B;  2CSQ A;  5GAO m;  1KFZ A;  2H8H A;  1Q81 R;  3O8V A;  2AZS A;  1WXT A;  4M77 G;  1OPK A;  4M7A F;  2VAS A;  3NHN A;  4M7A C;  2DD5 A;  2EKH A;  3OSS C;  2NUT A;  1VIF A;  3GPL A;  1YHQ T;  4IKF A;  1QKW A;  3PVQ A;  5KCH A;  2DO3 A;  2EKO A;  1ARK A;  2DPP B;  4HVW A;  2G6F X;  3VJP A;  1IGQ A;  4AMC A;  2E5Q A;  4M75 F;  1M1K C;  2ZGW A;  3BDU A;  2X51 A;  1YJW T;  2CZ0 B;  1JJ2 P;  1I5L A;  3SHW A;  1D1A A;  1MHN A;  5HKC A;  4C92 D;  1K0X A;  5AT1 B;  4IUU A;  2P4T A;  2EJF A;  3CCL A;  2NYS A;  5FWB A;  3CCE T;  3GNF B;  1RUW A;  2VYT A;  3R6N A;  5IHK A;  2FZG B;  5KCO A;  4J7I A;  3JB9 J;  3G7Z A;  2K57 A;  2YSQ A;  5GAN j;  2X4J A;  2IIM A;  4IUT A;  3S6W A;  4RCC A;  3QJ6 A;  4BY6 B;  2CT3 A;  2VVK A;  1PD0 A;  3EGX B;  2YUQ A;  1YIT A;  1VQK Q;  4BE1 A;  1G3T A;  2F2V A;  3NMZ C;  2KT8 A;  1M30 A;  2FO0 A;  1TUC A;  4F7U E;  2JMC A;  1B07 A;  1B34 A;  3CXC P;  4BDY A;  1Q82 C;  3CC2 Q;  4RUG A;  3EG1 A;  5CO7 A;  5GAO q;  3H6Z A;  4F7U F;  1YJ9 Q;  2CZ6 B;  3I55 T;  4P5N A;  3PVL A;  3NGP A;  3OYA A;  1Q81 U;  5L8R E;  4PK4 A;  2XD0 A;  2LCL A;  2GQI A;  4CC4 B;  3CCM A;  1ZA2 B;  2JTM A;  2OTL A;  2E6N A;  1F1B B;  2XDD A;  3E1S A;  1Y96 A;  2J7I A;  5M9O A;  4PNO A;  1VQ4 A;  4HCB A;  2E1H A;  1YNZ A;  4OGE A;  2BIV A;  3UF4 A;  1VQ5 A;  2OTJ T;  1AT1 B;  2OAW A;  1DJ7 B;  3CD6 A;  1QP2 A;  2J6F A;  5I11 A;  1QCF A;  5CKB A;  1OPL A;  1TTH B;  4EMK C;  1TU0 B;  2QEX A;  3A8H B;  3I56 T;  2ZPH B;  4OMF B;  2RJD A;  3FC3 A;  1BIA A;  4F16 A;  4RTY A;  2QA4 T;  4ZTF A;  2DK3 A;  2D0Q B;  4A4G A;  4RKU E;  4KT0 E;  1HD3 A;  2Y4X A;  5LJ3 g;  1YI2 Q;  2LX9 A;  2MYS A;  2RB6 A;  4XU2 A;  2R57 A;  4ORZ A;  2DKG A;  1GCQ A;  1S72 A;  1IZ6 A;  2L2P A;  3LYI A;  2YWW A;  3CC7 Q;  1U5S A;  2LQN A;  1NLP C;  1JEG A;  4OB3 B;  4KH0 B;  3V8K A;  1PWT A;  1W2B A;  5FU7 B;  2FB7 A;  2ED1 A;  2QAZ A;  2EGA A;  1PCX A;  2RM4 A;  1X43 A;  2BE9 B;  1FWZ A;  1I4K 1;  4F14 A;  3C12 A;  3OYK A;  1AEY A;  1E6G A;  3A98 A;  3EFR A;  1JRI A;  2JNG A;  4DEY A;  1VQO T;  1VOM A;  3VS4 A;  4C0F A;  3HRU A;  3CPW A;  4JRK A;  2YRC A;  2RJC A;  4VUB A;  2MK5 A;  4FT2 A;  3BY7 A;  4D8K A;  3JCM X;  1WXU A;  3CC4 T;  2CUB A;  3EFO B;  4HKE A;  3OS1 A;  2ED0 A;  2DYB A;  4N4H A;  5GAO r;  4M78 B;  1YJN A;  3A8G B;  3OS2 A;  1M3C A;  2PTK A;  3DLL A;  2CT4 A;  3X26 B;  1RL2 A;  2JOY A;  3CCU Q;  1EZZ B;  3O5Z A;  1AD5 A;  2EQU A;  3I9Q A;  4QT7 A;  2COY A;  4M7D B;  4YTL A;  3V7S A;  1K76 A;  2DER A;  3OS0 A;  2XI9 A;  5GAM f;  3GLX A;  5HK3 A;  1NG2 A;  2DL7 A;  4NL3 A;  1PNJ A;  1VA7 A;  5FU6 B;  3MJX A;  2M1H A;  3UWN A;  2GF7 A;  5LJ3 j;  1YIT T;  2KGT A;  1PSF A;  2NUP B;  2JXB A;  5KYY A;  1RI9 A;  2LZ6 B;  2HEQ A;  2O9V A;  1OUL A;  4J9F A;  3BW1 A;  4JS4 A;  1G5V A;  3EG9 B;  3BDL A;  2JW4 A;  4GLK A;  2QK0 A;  2BZY A;  3CCR Q;  2RHU A;  5FLX E;  1KJW A;  4C5H A;  3QUI A;  1BI2 A;  3FJP A;  1WIE A;  1VQK T;  1IRX A;  1OU9 A;  1OZ3 A;  2J05 A;  2J6K A;  2Z0W A;  1BI1 A;  3INZ A;  2F5T X;  3MET A;  1JQQ A;  4J6X A;  4N0A A;  3OYI A;  3PFS A;  3CCM T;  4M7D E;  2RA2 A;  4CC7 A;  1SPK A;  4HT8 A;  2EQJ A;  1VQN Q;  2OTL T;  3CC2 T;  5KH6 A;  1VQ4 T;  2CZ7 B;  1JJ2 A;  2V1Q A;  2EIF A;  2RHZ A;  2FPD A;  1WJQ A;  2HZY A;  3OYC A;  1YJ9 T;  3I5S A;  1Y57 A;  1VQ5 T;  2W0Z A;  3CCQ A;  4M7D C;  3CD6 T;  2CYZ B;  3JCM f;  4BI8 B;  1X2K A;  3G71 Q;  2M51 A;  1ZSZ B;  3X24 B;  2QEX T;  1U3O A;  1NPR A;  3L2V A;  4K11 A;  4F17 A;  3A8O B;  2GQV A;  2B8A A;  1SSF A;  3QKJ A;  1OQK A;  4NL2 A;  1WHK A;  4GBQ A;  4C8Q B;  1JU5 C;  1W2B S;  2CP0 A;  3G6E A;  3RMS A;  1B3Q A;  3VV0 A;  5FU6 C;  4Z89 A;  4HXJ A;  1YHQ Q;  2C06 A;  1S72 T;  4PJO B;  3CXC A;  1D1B A;  1UGQ B;  4MZP A;  3VS1 A;  3MPU B;  3OSV A;  3QWX X;  2QQ9 A;  3WVD B;  4MDW A;  2KI7 A;  1UGP B;  3OBY A;  2L3P A;  1NEG A;  4M77 F;  2AK5 A;  2DMO A;  4M77 C;  1Z9Z A;  3M0S A;  2EWN A;  3QO3 A;  1UJ0 A;  4QW2 A;  4ZGJ B;  1YJW Q;  3KFV A;  2P0P A;  4LN2 A;  3MO8 A;  3J7A F;  1KHC A;  1UE9 A;  2K9G A;  1ZBX A;  1NBE B;  2AHJ B;  1YIJ A;  2ZPF B;  1M90 C;  3CC7 T;  2PZ1 A;  2LQK A;  5GAN f;  3QPH A;  4XU1 A;  4QVZ A;  3CCE Q;  2MIO A;  2O4X B;  3M0U A;  4C5G A;  3H41 A;  2PVG B;  4M78 D;  2QQR A;  5HK0 A;  3RNJ A;  3OA6 A;  2CDT A;  2DTO A;  3VS7 A;  3VS0 A;  3REB B;  2A0F B;  1VQP A;  4DQ2 A;  1WHH A;  4LDU A;  4ANJ A;  1B7T A;  4UC4 A;  1Q95 G;  4HT9 A;  1PRL C;  4DOW A;  4C8Q E;  3H0H A;  4B9X A;  4M7D D;  1S1N A;  1YP5 A;  3LGF A;  3VYH B;  1K9M C;  2X4W A;  4BUG A;  4O5V A;  2D6F A;  2RJF A;  2DIG A;  1KC8 C;  3RBB B;  2C0O A;  4PJO E;  4LDY A;  3HRT A;  4A4H A;  1AHJ B;  2KSS A;  2MWO A;  2XID A;  3OYF A;  4LD9 K;  1VUB A;  4C8Q C;  2KRS A;  1N6A A;  3I55 Q;  4KGV B;  2QGG A;  1QQJ A;  2KVQ G;  4C5E A;  4E6R A;  4PJO C;  1BI0 A;  3VRZ A;  5IXB A;  1RAG B;  2EVR A;  4BI4 A;  2QQA A;  1AWX A;  5LJ5 h;  5IAY A;  1TUG B;  4JLG A;  1TWB A;  1XNI A;  2I0N A;  3JCM Q;  1VQ7 A;  1N9S A;  4R0K A;  4RCB A;  2YUO A;  3C4S A;  8AT1 B;  5KE2 A;  4OMM A;  3SWN B;  1WNL A;  1OOT A;  2HQH A;  2EAY A;  3AT1 B;  2PUK B;  4EPC A;  4AG2 C;  4X1V A;  3L2R A;  2AKK A;  2QXF A;  3OYM A;  2OTJ Q;  3M9Q A;  3TSW A;  4M7A B;  3S3M A;  4IIO A;  1WI7 A;  3EG0 A;  2LVM A;  4ESR A;  3I56 Q;  4Q5W A;  3JB9 G;  3FB9 A;  4HVV A;  4N4I A;  3IQL A;  4ZTJ A;  2ZPG B;  3ER0 A;  2JN0 A;  2L3S A;  2EJG A;  1QW1 A;  4M75 B;  2KNB B;  2OI3 A;  2FRY A;  2YUP A;  2BZX A;  1ZQ1 A;  2BTT A;  2X35 A;  1I5O B;  3WVE B;  5GMK j;  4FYV B;  2GTO A;  2M02 A;  4O6J A;  3A8M B;  3MP1 A;  3L2U A;  2CH4 A;  1UGR B;  1RAD B;  1X2Q A;  3HKS A;  5GAO p;  2C0T A;  4XTX A;  2FPE A;  2HMA A;  3LW5 E;  4BD3 A;  4C8Q D;  2CS7 A;  3M57 A;  1K8A R;  5FRM A;  1T0H A;  2O9S A;  1M5Q 1;  2GFU A;  2DL5 A;  2QYZ A;  2DEQ A;  7AT1 B;  8ATC B;  3CMA A;  1AVZ C;  1D0X A;  4PJO D;  1R0C B;  1M1G A;  2MAM A;  5KYU A;  1VYU A;  4Y92 A;  1VQO Q;  5LJ5 e;  1IRE B;  2LJ3 A;  2OAU A;  4GLM A;  2DFU A;  1W6X A;  4FYX B;  2RPN A;  2LX7 A;  2F69 A;  5IHN A;  5KYW B;  1QVG P;  2LTO A;  1KD1 C;  2RO0 A;  2EYY A;  2QQS A;  1Y0M A;  2PQW A;  1BIB A;  4M75 E;  4EIK A;  1Y07 A;  1VYT A;  4F7U B;  3JCM b;  3RMQ A;  5A0G A;  2CZ1 B;  3OW2 S;  1OI1 A;  1D0Z A;  2DZC A;  1C1A A;  2WAC A;  2LT4 A;  4J9B A;  2ZPB B;  2E5K A;  3CCJ A;  2YUN A;  1NPP A;  3CCL Q;  1RLP C;  1M4Z A;  1YWP A;  2DYI A;  1LPL A;  2FYK A;  2KRO A;  4M75 C;  3UT1 A;  1VQ9 A;  2FEI A;  4L5G A;  2HSE B;  1IHV A;  5LJ3 f;  2J6O A;  2KBT A;  1KIK A;  3L1A A;  1VQP T;  3CCS A;  2E41 A;  2RK1 A;  3E2U A;  1YIT Q;  3L42 A;  2V26 A;  3X25 B;  4ZGD B;  1I1J A;  1NJI R;  1JXM A;  3QDR B;  2MI6 A;  5I2S A;  3EFO A;  4EMK B;  2RI3 A;  1E7O A;  4OF1 A;  5DM7 R;  4JS5 A;  3A5Z B;  4RG2 A;  4PFO A;  3MP6 A;  2D8H A;  2P4R A;  5AYF A;  3LWH A;  4M78 A;  3PTA A;  1N8R R;  5LJ5 d;  2K6D A;  2DRK A;  4FYY B;  4WTO B;  5CAI A;  1AOJ A;  3RDV A;  1XQH A;  1UG1 A;  1FMW A;  4XTY A;  5D6W A;  3OYE A;  1AZG B;  2K5I A;  3M0Q A;  2FL7 A;  5A2Q E;  1K8A U;  2CGH A;  5LJ5 g;  1JXO A;  1H8K A;  4IIM A;  1YFN A;  3M4Y A;  3JV3 A;  3I35 A;  2IG0 A;  2G3R A;  2KYB A;  2DLP A;  4BB7 A;  3HHT B;  3CCM Q;  2FHD A;  5FRO A;  1WQ7 A;  4XK8 E;  2OTL Q;  3RER A;  2DEU A;  1M3A A;  2DA9 A;  2QGF B;  3TRE A;  4PFZ A;  2RHX A;  3ASK A;  2AZV A;  2E12 A;  1VQ4 Q;  1WZO A;  2V1R A;  4HVU A;  2M0O A;  1WYX A;  3VKI A;  4M7A D;  1LNX A;  1VQ5 Q;  2RF0 A;  3CD6 Q;  6AT1 B;  1MV0 B;  3FLG A;  3HFO A;  2QAS A;  3PE0 A;  2DBM A;  2QEX Q;  4FSX A;  1PKT A;  4BAC A;  2DZ9 A;  3MEW A;  3UDC A;  2WSE E;  4M75 D;  4PKC C;  3OYJ A;  3QZ5 B;  1LCK A;  4AG1 C;  3P8B B;  2DVE A;  2YXY A;  4KUL A;  3JCM W;  1EIF A;  3G4S A;  1RLQ C;  2VGM A;  2SEM A;  1RAI B;  3M4G A;  3OW2 P;  2KE9 A;  1UHC A;  3G1J A;  3HSB A;  1K73 R;  5D6Y A;  1S72 Q;  5I22 A;  1OU8 A;  3OYY A;  5J26 A;  1BKB A;  2VB6 A;  2EBP A;  1V1C A;  1MV3 A;  1WLP B;  2ZCF B;  3CBO A;  4FYW B;  3HL8 A;  2PVD B;  4OMO A;  1X6G A;  3CQT A;  3OBW A;  1ZUU A;  2RQU A;  1YBY A;  3MCA B;  3JCM V;  1NJI U;  1ZLM A;  1KQS S;  5GAN 7;  4IUP A;  1M9S A;  3OB9 A;  2KT1 A;  3CMA T;  1N8R U;  4C92 G;  3R6O A;  3SB2 A;  1M90 R;  3M56 A;  1ZSZ A;  4OMP A;  4BDZ A;  2A7Y A;  2Y4Y A;  5LJ5 j;  2FG0 A;  3CBM A;  2DJQ A;  2IPO B;  1UJY A;  3ULR B;  3OYB A;  3HTR A;  1Y7X A;  4QVC A;  1SRM A;  4JPB W;  1O75 A;  3RKX A;  2F2X A;  1QP3 A;  4KUI A;  4OB2 B;  3UA7 A;  2DD4 A;  3VRY A;  2NUT B;  4EMH A;  3GIB A;  4X9D A;  1WHJ A;  1QWE A;  2R5M A;  3OYH A;  4PL6 A;  2BE7 D;  1MND A;  2LQ8 A;  3CBP A;  4L6V 5;  1I81 A;  3EH1 A;  2JVV A;  2CUD A;  4ME7 A;  5A0D A;  2DL4 A;  5GAM h;  5FRN A;  2JTF A;  1YI2 A;  1UDL A;  1WA7 A;  3OMG A;  3EGU A;  3EGD A;  1K9A A;  4XTW A;  1VQ8 A;  1QWF A;  1TOV A;  4M7A G;  3EFS A;  2K79 A;  2MWP A;  2K2V A;  3CCV A;  2LQW A;  3CCS T;  1D0Y A;  3M0R A;  2RD1 A;  1IO6 A;  3JRZ A;  2JZ2 A;  4J9I A;  2XIC A;  2O4X A;  4N4G A;  1Q81 C;  4X9C A;  4JDS A;  1K73 U;  4C0G A;  2QDY B;  1MMN A;  3CCL T;  2JJ9 A;  3REA B;  3C94 A;  1P92 A;  3FEO A;  1QKX A;  1TUD A;  2DIL A;  2DF6 A;  1AZE A;  3CPF A;  3GBQ A;  1UEC A;  2NWM A;  1KQ1 A;  1ABQ A;  3NTH A;  3E9G A;  2L3Q A;  2VV5 A;  3FIF A;  1QCN A;  1EFN A;  4C92 A;  2E10 A;  3L2Z A;  1OV3 A;  4C5I A;  2DET A;  2M0Y A;  2X3W D;  2V8I A;  1LJO A;  1I0C A;  1H64 1;  3TCJ A;  2A08 A;  2CP7 A;  2R5A A;  5IHI A;  3LWI A;  1GXI E;  1KQS P;  2BUD A;  1M90 U;  5CKF A;  2GGR A;  2VXE A;  3QBY A;  3D7S B;  4A53 A;  4M77 B;  4FT4 A;  3JCM h;  4J7F A;  1R77 A;  1NYF A;  2LJ1 A;  4L59 A;  3CCQ Q;  4OVA A;  3QII A;  4IUV A;  3JB9 F;  2JMA A;  3E19 A;  3OMC A;  3SWN A;  5GAM e;  4FIB A;  1GRI A;  1Q86 R;  2C0I A;  2RNA A;  5A0L A;  2KRM A;  4J9C A;  4F7U G;  2KR3 A;  2COW A;  3G6E Q;  3G4S T;  1M3B A;  3QJY A;  4GY5 A;  4M7A A;  4RTX A;  2YRV A;  5KYN A;  1SF9 A;  3GF5 A;  5C0M A;  2JS2 A;  1QLY A;  3TU4 K;  1Q7Y C;  4J83 A;  2E6Z A;  4PLI A;  3HRS A;  2E70 A;  1I8F A;  2DJZ A;  2LP5 A;  3CCR A;  1VQ6 A;  4DBF A;  3F70 A;  3EHQ A;  3MKD A;  2ROL A;  3NFC A;  3JB9 I;  4JJC A;  1U1S A;  2DXB A;  1ZSG A;  3KXT A;  2D8J A;  2LNV A;  1VQM A;  2K3X A;  2PNI A;  4M77 E;  4LE9 A;  5GAN h;  1AWO A;  1VQN A;  2V8J A;  2PVO B;  3DB3 A;  3OYL A;  4FM4 B;  4Z02 A;  1GCP A;  1M1K R;  3JSC A;  2OJ2 A;  5LL6 S;  2A36 A;  4PFP A;  1VQL A;  3CME A;  3JCM c;  2EYZ A;  1RAF B;  1VQP Q;  1ZHI A;  4CC3 A;  2K3Y A;  5GAM d;  2M16 A;  3V7R A;  2JS0 A;  1PC0 A;  4R55 A;  1D3B B;  1PG5 B;  3JCM e;  3RES A;  1UGV A;  4LDW A;  4JRQ A;  1V76 A;  1FMK A;  4QKU A;  4A4E A;  5KYW A;  2RQW A;  2VGN A;  4B6M A;  4ELZ C;  2YDL A;  2LJ0 A;  4E2F B;  1GBQ A;  4RTU A;  3OW2 A;  4LDX A;  3VYG A;  3Q1J A;  4J5Y A;  1CKB A;  2QG9 B;  1VQ8 T;  2WSC E;  4F7U A;  2EJ9 A;  1YJN T;  2CP2 A;  1RAB B;  1Q86 U;  2LMJ A;  2GBQ A;  1AWW A;  2NLU A;  1BBZ A;  3M58 A;  1UGS B;  3CCV T;  3PMI A;  1H3Z A;  1ZBJ A;  5EG2 A;  1O9S A;  4MZM A;  5HY6 A;  3OQ5 A;  1VYV A;  2MOX A;  2ECZ A;  1LOJ A;  4DBH A;  4BE2 A;  1VQ7 Q;  1SG5 A;  4RG8 A;  4CC2 A;  4LD6 A;  2F5K A;  1Q82 R;  1UEB A;  1WPY A;  2HQX A;  2MPX C;  1QVG S;  2RI2 A;  1M2V B;  1GCQ C;  1SEM A;  5CKE A;  2J06 A;  2K5F A;  2X9H A;  2F1L A;  1SSH A;  1G83 A;  3EG3 A;  3VS3 A;  3AHU A;  2X4Y A;  5GAN e;  4EMK A;  3FDR A;  4CI0 C;  3SD4 A;  3NTI A;  4Y91 A;  3M54 A;  2D9T A;  3JCM d;  3M5A A;  1PHT A;  4M77 D;  1WX6 A;  2M9U A;  3VU3 C;  3J81 E;  3EGX A;  3EHR A;  3L2W A;  1G3W A;  4A63 B;  2RHY A;  1M1K U;  4XU0 A;  1FYN A;  4E7Z A;  2EGE A;  3CEY A;  3PMT A;  4IUQ A;  1GFC A;  3FJ5 A;  1M8V A;  2V8K A;  4Z8A A;  1WJS A;  1WDX A;  3EH2 A;  5GAN 2;  2KAF A;  3JAM E;  1UFF A;  1KSW A;  5KYX B;  4OGC A;  2DXU A;  1K1Z A;  3QDF A;  1U1T A;  3C95 A;  3HPW A;  2EFI A;  4ELY C;  3CMA Q;  3MP8 A;  2VXF A;  2DL8 A;  5IXF A;  2CRE A;  3CCQ T;  4LDV A;  2HCK A;  2RK2 A;  3NTK A;  3PIP A;  3N5B B;  2HBP A;  2CP3 A;  1WQW A;  1R8O B;  3M53 A;  4M78 G;  1N27 A;  2PUO B;  5GAN d;  3C0C A;  1IXD A;  4JJN K;  2EYQ A;  1FMV A;  1VIE A;  4C92 F;  3G6E T;  1Q82 U;  4M7D G;  1EX4 A;  1IHW A;  4AFU C;  3JCM J;  2QA4 A;  3DB4 A;  1K4U S;  2RHI A;  2I2L A;  2ATC B;  2BKD N;  1NEB A;  1R0B G;  5GAN 5;  4EDU A;  3P8H A;  1KQS A;  2L3R A;  1C0M A;  4MDX A;  3CCJ Q;  3QZ9 B;  4RMO A;  4TVR A;  5LJ3 h;  2GNC A;  4LNP A;  1OEB A;  4JJB A;  1W1F A;  4E7J A;  1VQ9 Q;  1AWJ A;  1MGQ A;  4FU6 A;  2E4H A;  1VQL T;  3CME T;  2QTX A;  3CCS Q;  2KQW A;  1QMC A;  2H3E B;  2KK4 A;  4N0A C;  1RAA B;  1CSK A;  4RTW A;  2JUF A;  4PJN A;  2FPF A;  4E7H A;  5CVI A;  5GAN 6;  1YIJ T;  2O2O A;  1OX9 A;  1WGS A;  2K3B A;  3V8L A;  3QSU A;  1M8M A;  3RIR A;  1IB8 A;  3GOX A;  1PRM C;  2XMF A;  3FRN A;  2CSI A;  2VC8 A;  3H0F A;  1VQO A;  1G2B A;  3BE3 A;  2KDS A;  3CC4 A;  3EAE A;  2XG8 D;  2HD0 A;  1QVF S;  1A0N B;  2LC4 A;  4E7S A;  2ZPE B;  4E47 A;  1MUZ A;  2MCN A;  1UUE A;  3OYN A;  5CCA A;  1BK2 A;  2XU8 A;  2P0K A;  4NOY A;  2OX7 A;  2GFA A;  2DVJ A;  3ME9 A;  1IGU A;  5CR2 A;  5DLO A;  2RJE A;  4XU3 A;  2RH2 A;  2DRM A;  4FW2 A;  2DTH A;  4M7D A;  2P84 A;  4XTZ A;  2NUZ A;  5D6X A;  2K4Y A;  1X27 A;  5D7U A;  3LX7 A;  1GFD A;  4C0D B;  2E3I A;  2FZC B;  1X75 C;  2JM8 A;  3E9F A;  3GNG A;  1VQ7 T;  1WHG A;  3H0I A;  4C8Q G;  1RI0 A;  5LJ3 e;  1RAH B;  1KQ2 A;  3TVT A;  1N9R A;  2DXT A;  3OS5 A;  4XAX B;  3VUZ A;  3G4S Q;  2CKK A;  1JO8 A;  4PJO G;  2JM9 A;  2NUP A;  3ZEH A;  2KXD A;  2DBK A;  5GMK i;  1HK9 A;  3A8L B;  1BCM A;  1Q7Y R;  2ESW A;  5J3B A;  2YHT A;  3JB9 H;  3EG9 A;  1RAC B;  1XJW B;  5GMK l;  5GAN 4;  2DXC A;  5FW9 A;  1V29 B;  2RMO A;  1VQK A;  4M77 A;  1HYO A;  1BYM A;  3PGG A;  2JT4 A;  3OY9 A;  5CIU A;  2EYW A;  3QWY A;  2FVU A;  3OYD A;  1QCO A;  4OP0 A;  3CC2 A;  2AKL A;  4E7K A;  1T3L A;  4NS5 A;  3M59 A;  1YJ9 A;  2A3L A;  2KEA A;  5DLQ E;  4J9G A;  2CH4 W;  2KRN A;  4KUD K;  4M4Z A;  1SRL A;  1ZUY A;  3J80 E;  4AFQ C;  4PJL A;  1QVF P;  5KYU B;  4C0D C;  4EMG A;  4QQD A;  5LJ3 d;  1Z9Q A;  1PKS A;  2ZZD A;  1RAE B;  5GMK m;  4DEX A;  2QQB A;  1CKA A;  4LXC A;  1WJR A;  5GAN 8;  4RTZ A;  2K2M A;  4OMQ A;  4BY6 C;  1YWO A;  1W70 A;  4C8Q A;  4JRI A;  4ZN1 A;  3MEU A;  2E65 A;  1HJD A;  2K5L A;  1VQ8 Q;  3V8J A;  1YJN Q;  4AFS C;  1M1F A;  2HKN A;  3VS5 A;  1WHL A;  2ZPI B;  1KK7 A;  4PJO A;  3CCV Q;  4XTU A;  4QQG A;  4V2S A;  1K9M R;  2LNH B;  1MMA A;  1X6O A;  4JRP A;  3S3N A;  2RQT A;  1GBR A;  4J6Y A;  1KC8 R;  1K8A C;  2RQR A;  3CCJ T;  2HDA A;  2ENM A;  2KY9 A;  2WSF E;  1VQ9 T;  1Q7Y U;  2GCX A;  4II1 A;  1PSE A;  3M0T A;  3CC7 A;  3DKM A;  3VS2 A;  1D3B A;  1ZA1 B;  5CK9 A;  1E6H A;  3OYG A;  3JCM P;  2HBW A;  1MNE A;  1X69 A;  1M2O A;  4KBM B;  4M75 G;  3T9N A;  2E64 A;  1OYX A;  4JLI A;  3X20 B;  5GMK h;  2LCS A;  2KMT A;  2IVW A;  1TG0 A;  1G8X A;  4JZ4 A;  1WHM A;  4J9D A;  3EG2 A;  4Z88 A;  3V7C A;  1G3S A;  3UAT A;  4PLL A;  3U23 A;  2LCC A;  4D6W A;  2L89 A;  1B34 B;  1X01 A;  1QVG A;  3WXM B;  1HSQ A;  2DL3 A;  1M2V A;  1MMG A;  2DX1 A;  1KG1 A;  4DOV A;  2O31 A;  1UHF A;  1FX7 A;  3CCU A;  4HA8 A;  3X28 B;  3MEA A;  1H92 A; 
#chains in the Genus database with same CATH homology
 1K8A R;  1VQ5 Q;  3CCE Q;  1NJI R;  1M1K R;  1KC8 R;  3G6E Q;  1QVG P;  1KD1 R;  3CCL Q;  3OW2 P;  3CD6 Q;  1Q81 R;  1VQ9 Q;  1YI2 Q;  1VQ7 Q;  3CCQ Q;  1VQL Q;  3CME Q;  3CMA Q;  1K73 R;  1VQM Q;  1S72 Q;  1Q82 R;  1VQ8 Q;  3CXC P;  3I56 Q;  3CCM Q;  1YJW Q;  1YHQ Q;  1YJN Q;  1VQP Q;  1Q7Y R;  1QVF P;  2QA4 Q;  1N8R R;  2QEX Q;  3G71 Q;  3CC7 Q;  3CCS Q;  1W2B P;  2OTL Q;  3CC2 Q;  1VQO Q;  3CPW P;  1KQS P;  1M90 R;  3CCV Q;  3I55 Q;  1JJ2 P;  1VQ6 Q;  1VQN Q;  1Q86 R;  1YIJ Q;  1VQ4 Q;  3CCR Q;  1YIT Q;  3CCU Q;  3CC4 Q;  1K9M R;  1VQK Q;  1YJ9 Q;  2OTJ Q;  3G4S Q;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...