2ATCB

Crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
152
structure length
152
Chain Sequence
MTHNDKLQVAEIKRGTVINHIPAEIGFKLLSLFKLTETQDRITIGLNLPSGEMGRKDLIKIENTFLSEDEVDELALYAPQATVNRINDYEVVGKSRPSLPERNIDVLVCPDSNCISHAEPVSSSFAVRRADDIALKCKYCEKEFSHNVVLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
publication title Crystal and molecular structures of native and CTP-liganded aspartate carbamoyltransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (carbamoyl-p,aspartate)
total genus 6
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1982-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2atcB02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2atcB01
1D09B 4KH1B 3MPUB 2IPOB 3AT1B 1F1BB 4F04B 1RAGB 4E2FB 2FZKB 1AT1B 7AT1B 1TTHB 1RACB 2AIRB 1RAFB 4FYXB 1ACMB 4AT1B 4FYYB 4KGVB 1I5OB 1Q95G 1RABB 2HSEB 1RAIB 2H3EB 2QGFB 1R0CB 2FZCB 2YWWA 9ATCB 1R0BG 2BE9B 1RAEB 1NBEB 1RAAB 1TUGB 2BE7D 1TU0B 3D7SB 4FYVB 1XJWB 8ATCB 2A0FB 2ATCB 2AT1B 8AT1B 2FZGB 1ZA1B 4KH0B 6AT1B 4KGXB 1EZZB 1PG5B 5AT1B 4FYWB 1RADB 1SKUB 4WTOB 1ZA2B 4KGZB 4AMCA 2QG9B 1RAHB
chains in the Genus database with same CATH superfamily
1SL0A 4TU8A 3GYXB 2JMCA 1XMOJ 1RE1B 4QQDA 4ECXA 1SHGA 3DDIA 3HHLD 2DX1A 4A8FA 2FVRA 2R8GA 4HI2A 1JLBB 3CCMT 2X51A 4OZLA 4DBFA 3MAAB 5LSLA 4ILLA 1C1AA 5CZXA 3SB2A 4ZP6A 2HQXA 2IPOB 2NUPA 1MW7A 5I2MA 4QYRA 2RQKA 4PFZA 4C0OC 4I68A 2FZCB 4WYWA 4PQUB 3URGA 5J2NA 4M4ZA 2R7TA 5THWA 1ZA1B 3CDBA 2QJ3A 2HSPA 4C0DB 1MU2B 5GJWB 1N32F 1HW8A 4DV7F 4JV5F 1KC8R 3W5YA 1C1BA 2F8EX 1N48A 2W25A 1WIEA 3PT9A 3AD9C 3OS1A 2FY1A 4DV2F 3EGZA 4A8WA 3RBDA 3MAAA 3VAFA 1I94F 3OFGA 2MI6A 1FRKA 4M78B 5F8JA 4GMKA 1ARKA 2NYHA 1E6HA 3HCXA 2XDPA 4N4HA 4X66F 4RUGA 3A8GB 1HNZF 2HAFA 1J5EJ 4P6QA 1N33J 1MU2A 2ZH6A 5FDLB 1HYSA 5F9LA 1PM3A 5GAN6 2NPIA 5HL7Q 1C6VX 1FTCA 3K17A 1G6BA 1N56A 1RB0A 2E1MC 2CT4A 3X3UA 1RT1B 4BY6C 3N01A 3I35A 4X64F 2ZH7A 4DN0A 4H4OA 3EGUA 3H2UB 3BO3A 1IQZA 1MV3A 5IT4A 2ZVSA 2RUSA 3REBB 1M90C 4MAKA 2CA9A 2QIFA 4TNOA 2JEJA 1R8PA 4PKCC 4BCAA 3CD6A 3CMEA 3MP8A 1IKXB 1MN7A 1KQGB 3JSMB 4NOHA 3GILA 3M2UB 5CQYA 1X4BA 2XKOC 5AT1B 5FDLA 3SCIE 4WXOA 1Q4RA 1U2CA 3MPVA 1Q81R 1M3BA 3OJSA 2L9DA 2YNGA 5KFVA 4QR1A 2MXYA 5LJ3e 1C2PA 1RT1A 5FU7C 1ZOTA 3QSIA 1VQ9A 3NGRA 3JCMQ 3DLKB 4ZVEA 4JOUA 4CH0S 4A4GA 4CLZA 3NP5A 2LTOA 2Y4XA 4B9WA 2YNHA 1APSA 2ZPIB 3P8HA 4JI2F 2DHXA 4EZ6A 2AJ2A 4J9HA 2MZJA 3SIPB 2HKNA 1WXTA 1WEXA 3AB2B 2MY7A 3NCPA 2ZKUA 2FC9A 5KFIA 5K8MA 2H3JA 5AE3A 3DKMA 4IRDA 3EGWB 3OYBA 2FVSA 3VR1A 4V2SA 1BYMA 3JSMA 2XZDB 3IBCB 2K1RB 4A4FA 1KNZA 2ZD1B 3NRBA 3S8SA 5A0YA 2ZE2A 2QGFB 4DBQA 3PNWC 5DQGA 1NBEB 4DZ6A 1FMVA 1YN8A 1EX8A 2L48A 4DV6F 1NLPC 2PSZA 4O3RA 1WYXA 3JQKA 2KDOA 4NMXA 4DG1A 3ZO7A 2DD4A 1YJTA 2BM1A 3NFCA 2CJQA 5F8LA 4ED1A 3C15A 2OD4A 2A2DA 2UUBJ 5DY9A 5L46A 2DNLA 2ZAEA 2H65B 2FYKA 1Q7YT 2HMIB 2IYIA 1T9YA 5GADI 2FJVA 4OX9J 4IFYA 2XO6A 5E7OB 1VQOT 3TQ7P 2R7OA 3TUIC 1UPMB 4M7DC 3OYEA 1CJVB 1GEHA 3H42A 2XSJB 2M0OA 1RT4B 5CYMB 4LD9K 4JYAJ 2ZD1A 1VA7A 2FHOB 1BWVA 3V4MA 2JJ9A 4ZPWR 1UDLA 3EG9B 2ZPHB 3B4MA 3PVXA 2KE9A 2KN4A 7AT1B 4F4WA 2YLCA 4Y2MA 1SJ1A 1TXQA 3Q1JA 2EFOA 2ROEA 2FUG9 3HJFA 4DEXA 2AW0A 2CVEA 4PG5A 4CO2A 2H48B 2MJNA 1N8RT 2KT8A 2FVPA 4USMA 3Q8RB 1GTHA 1HWJA 4WPAA 4CO5A 1N8RU 3QO9A 3FQLA 5L9NA 1ZM9A 1U26A 5CKFA 2XY6A 2JVOA 5KYYA 2G1HA 1CJVA 2D8HA 2BKOA 5D6WA 4BI4A 1FRJA 4YY3F 2XSJA 1JXVA 3HX9A 3LAKA 5CYMA 1FDDA 3VWSA 3QZ7A 3HT0A 2WSCE 4FF3A 2B0GA 2NUTB 4ZGJB 4AXJA 7FDRA 3EG9A 3U1LA 3CW2C 1X01A 4RNMA 2O88A 1F3FA 5B09A 1H3ZA 2R8IA 3QJYA 1IBLJ 2YXYA 3PR4A 2FVUA 3CJ3A 3VS0A 3FEOA 2NZ4A 4FNHA 2B4VA 3MM8B 2V26A 1B7FA 3RERA 2V34A 2VUBA 2LT1A 2ZOFA 5G4DA 3O8VA 2HZYA 3DGPB 4AL7A 4FVCA 1NK9A 4UY8T 3I4PA 3GZ7A 1TS9A 5KFRA 2M16A 3RBEA 1OY6A 2ZNZA 4DFPA 1SKWA 4NA1A 5L9XA 4EEYA 4IG3A 4R0JA 4ECZA 4G1PA 3MEEA 3N6LA 1K73R 3AHPA 5LJ5d 1U1NA 1DAXA 2ZBIA 2ZEJA 1N9SA 2NUTA 3HHNB 4DR5F 2FPDA 5CVIA 4Y2KA 2YH0A 4M75A 1DLOB 3P45B 4AT1B 3S6WA 1X5OA 3R6GB 4DR7F 1NSPA 3MM8A 1UFWA 3SFUA 1UW9A 2P0KA 1SJQA 4C92B 1CQMA 4C8QB 5C5JA 2R7XA 4FS1A 1JLQB 1XN9A 1G3OA 1YJNQ 3K2YA 4O3QA 4ZCLA 4UY85 1G1XA 4LFBJ 1IBKJ 2YWWA 1KHCA 1UVNA 2ZCFB 1NK0A 2IVYA 2YHTA 1K1SA 1TP7A 2EVZA 3C14B 2PNIA 2DBBA 4JI7J 1Y7PA 2C3UA 1FXXA 4CC2A 3CMQA 5DJBA 1TKXB 3VVTA 1VQMQ 2XMKA 4DR3J 2HBPA 4H4KA 2V8DA 1BQNB 2RH2A 1DLOA 3UR0A 4CH1A 4JRKA 2EQIA 2QLWA 5EUHA 2CQHA 2MOXA 3WIVA 2L3SA 1V9OA 1EETB 1P27B 4J5YA 1IBMJ 2CPHA 4ZPBA 3HSGA 2KH9A 2IC3B 4BWMA 1JIHA 1Y3JA 2DTIA 4C92A 1Y5NB 2YX7A 3AJDA 1NK7A 5GAMe 3TCJA 2H9ZA 3FZBA 1X60A 2H4YB 4L75A 1UGQB 4HKEA 2RU9A 5GMKa 1KFZA 1X43A 3KYLA 4DHVA 5HCKA 4P71A 2W4CA 2HS4A 1X0FA 2J76E 3NGTA 1TKXA 3OPKA 3MUVP 3GCXP 1O5JA 2XZTB 4RW9A 3QYHB 2DETA 3OVBA 1I0CA 1T9TA 3CCST 3NEKA 3AHUA 3BPDA 3JB9I 1CC7A 3I82A 1N5SA 2I5JB 3TVZA 9ATCB 3ISNC 4PEOA 4K8RA 2IC3A 2HNYB 2VC1A 2ZPBB 2NXEA 2VYTA 5F8IA 5KFMA 4KC5A 1B34A 1TL7B 3RZAA 2E5KA 2CZ6B 3JYTB 1WD6A 4IRCA 3HVRA 3PW0A 4IUVA 2JDJA 4JI5J 1H8KA 5K14B 1JLAA 4I1TA 1S1UA 1JJCB 3META 1FVQA 5KFTA 1MMNA 4OHWA 2J7KA 3OYHA 3DLGB 2OP5A 3I31A 4A8XA 2C2KB 1NU4A 2VWFA 3SXLA 2BOPA 5A2QE 1UGVA 4TY8A 1ZUYA 2LC4A 4U6PA 3K5PA 4IOCQ 3AD7C 2GFUA 2I5JA 4MK9A 2HFNA 2VUGA 2RUGA 5LJ5f 3PJXA 4NRUA 4CP5A 1S6OA 3L2WA 5HJYA 1RAFB 1X6GA 1BMQB 4KO0A 4BS2A 3ULRB 2E65A 4GKKJ 1DQAA 2D69A 3SBMA 3O5TB 1FDNA 2ZZNA 3AXMA 1K47A 4X4RA 3NS7B 4EMGA 5GAHI 3DMJB 3AOBA 4AFSC 2F3JA 5K14A 1H73A 4O5VA 5C42B 3JV3A 2EKYA 2LQ5A 3H4DA 3HSZA 1K0SA 1AWXA 2E70A 2KY9A 3DHXA 2COYA 4ILMA 1TVRB 1SB6A 4LF6F 4CCHA 2PN6A 4BE0A 1K8AR 4OYZA 3A8KA 2MKCA 1HHQA 4DOWA 1YJNS 3A1PA 2ROPA 1RTDA 2CSIA 1T9XA 2XS7A 4YR0A 4OHZA 4B9VA 1FD8A 2O2OA 4G3IA 2KM8C 2O3DA 4J8OA 2B5JB 4ZITA 1Y96A 4UW2A 5KE2A 5DO2A 4F3OA 1VQMS 2VFSA 5E33A 2G2ZA 2Z2LA 2DL3A 2EWHA 1VYAA 3DMJA 3MEWA 5C42A 1B7TA 2XMJA 2ZJQQ 1U45A 4I7FA 4LUBA 3TZXA 4OI0A 2CPJA 2GMLA 1ULRA 1WACA 3LPYA 4N4IA 2A3JA 5KYXB 2OFHX 5DQIA 2VG6B 3G6XA 2CPZA 2RHIA 3MEKA 3WZ0A 2OO4A 4I2PA 1N5ZA 3CGIA 3CIMA 2AGOA 1X4EA 1RK8A 5J2QB 4DV7J 2ASYA 3AA8A 4ZVSB 2VXFA 2AJ4A 1B70B 3ZTSA 3THVA 4CYUB 4KY3A 4P2MA 5D6XA 4PJOE 2DVEA 5IV4A 1HA1A 2B5JA 3BS9A 1EJ7L 4XDDA 2C2EA 3QGIA 2DXFA 2FB0A 5IQ6A 2QMUB 3OD2A 5CKBA 2L08A 1I94J 5ETOA 1FDBA 2G1DA 1S9GA 5A76A 3ER0A 1UFFA 2IFXA 4KAIA 4JRIA 2K8GA 4R8UB 3ILIA 4D8KA 5GAN7 4OI1A 3BREA 1OSDA 2I2YA 4FKXA 4E8UA 4ES1A 2CJKA 2OX7A 2EYYA 2VG6A 2RPNA 2I0NA 1NK8A 1WI8A 3N28A 3FUYA 4K7QA 4RWWA 1T05B 1PCXA 3A5ZB 5KFSA 4EDUA 2RN8A 3D6HB 1Y5LB 2ZBPA 4CYUA 3PKMA 3HHLC 4ELVA 1PD1A 2PGCA 3V4IA 4Z8AA 4RR5A 2DK2A 2DTHA 3B8HA 3VGTA 1K9MT 1TKZA 2DGOA 2UXCJ 1YWPA 2ERRA 2EPDA 3D1HA 4FNIA 3D6FB 4YB5A 4ELTA 1QMCA 1SSFA 3DOLB 4LQ9A 3VGVA 3S6EA 3K8VA 4F2SA 1TFWA 3CCQS 3A8HB 4K4ZA 2E9RX 4NA2A 4DR2F 8ATCB 4IQMA 2A0FB 4FS2A 2MHNA 3KHLA 4ANCA 5RUBA 2HLUA 4WBFA 3Q89A 5C0MA 2C2DA 1NZAA 1PAUB 4BACA 3DOMB 2CQCA 1U1LA 1HJDA 4RW4A 2D6FA 4Z02A 1VYTA 1T95A 1TL5A 2LQKA 4CNZA 1EP4A 1T05A 1QVGP 5DDPC 1QVPA 4A48A 2B9YA 1NO8A 2B3TB 2QT7A 3QJJA 1I1GA 4OGEA 4HH1A 3ZZZA 3M8YA 4IUFA 4OZ3A 3MPYA 1VQ7T 1DTTA 5HBMB 1NYGA 4Q2LA 1YJWQ 3TJ8A 4NZ7A 1R8CA 3T9ZA 2OSRA 1IXDA 3PHTA 3VS7A 1WEZA 2NUZA 5LXYA 4WP8A 3OTOF 2I2LA 2HCKA 2GQ2A 1Y0HA 5E3QA 2WVDA 4J9PA 1VISA 4J9LA 2RDDA 3SFMA 1QDUB 2LA4A 4W90B 3U27A 3CCLT 4KRTA 2G2YA 3DOMA 5IOLA 4NA3A 1VQPT 2JVRA 4DV4F 3QT8A 5A6WA 1YJNA 3HVAA 3GQCA 3EGNA 4DV6J 5HK3A 3AT1B 2IDEA 1FRXA 3CNQP 4OYBA 3BSCA 2LEAA 5LJ5e 2Y1JA 1RHMB 4EMDA 1S4EA 1LCKA 1VQNT 5CH7B 5A2QY 3GV8B 1WELA 3VCDA 2XMAA 2PFFB 4JUZA 3X26B 4DCOB 5U47A 3QZ5B 1VQ6Q 2MZ1A 4J6YA 1M5KC 2LXIA 3DXBA 2QMWA 3QT7A 2YX1A 2V9WA 1IO6A 2HHHJ 1TOVA 3KLFB 2E7VA 3QZ9B 4AE5A 3CC2T 1RCOB 2DNYA 3BBBA 3H4BA 3BH6B 4NLTA 2X3XD 1HXDA 2QGGA 4BD3A 3BZQA 4RW6B 2QQAA 1L3VA 2DVIA 1WG4A 2O9SA 1AWOA 1SRMA 5KFQA 1R6YA 3POTB 2RDJA 3V2UC 1UEBA 2PUKB 2QG9B 3SWNA 5L8RC 2QA4T 2M9KA 2LEPA 3OVAA 3K5MA 1M0SA 2CQ2A 3LQVA 1TUDA 2KRMA 5F41A 5H9EK 1DBDA 2BABA 2K79A 3M30A 2B8AA 1T7PA 4AUKA 4B3SF 4K59A 4M78E 4Y91A 2YWKA 4RG2A 3KLFA 4M7AB 3CJTA 3H5XA 3CCMS 2HIQA 2RJZA 1QAIA 1N27A 2WB1D 4YY3J 2DR5A 3HVTB 1NHUA 4K4VA 1RHKB 5KFNA 3OSPA 4M5DB 4XPEA 4HDHA 2HFOA 1KIKA 2V9KA 3HPWA 3OW2P 2COWA 1QSYA 2P8IA 2CYZB 1FD2A 3I9V9 5DLQE 3FQKA 1VQLT 3PW7A 1ZLMA 1RAJA 1JLEA 2ZWPA 3WIUA 2X4YA 2PTKA 2F8HA 4DLEA 4ZIWA 3RW7A 2XSFA 4QR0A 2QTWA 4ZHRA 2HVDA 4R0EA 2MQMA 2J9CA 3CCQA 3E51A 1YDLA 2L0AA 1AT1B 3L3CA 3Q2SC 2J8SA 3G1JA 3WQPA 1LFWA 4XTZA 2GV1A 3UN2A 5BXIA 1WQWA 2MKSA 1I1JA 2KGTA 4M5MA 4QQGA 5F3ZA 1GT8A 2CZ0B 2BRLA 3MHYA 1DURA 4M5DA 4LSZB 2VFVA 1SL2A 3SDEA 2LXUA 2DNGA 1KEKA 3MAQA 4DR5J 4ANDA 4USTA 3I56Q 1X4FA 1YJWS 4MDXA 5A6PA 5JUMA 5C6SA 4DBHA 4WU2A 3UATA 1BI2A 2ZITA 1PYOB 1X4HA 3O3LA 3KK1A 2A6MA 1WHMA 2UVWA 2GFFA 4UOHA 4ZN3A 1RTJB 2ZM6J 5KFJA 3BF4A 4R5PB 1PKTA 4OYAA 2OEMA 3D0HE 1YK9A 1EIFA 1NUEA 4Y0FA 4CT8A 1ICEB 2EW3A 5A2QU 4NXMF 2F69A 1JXLA 1M5SA 4ZVTB 2JM8A 4IOBA 4WK1A 2YWGA 4DI6A 4PUOB 4U7UD 3ME9A 4WCEQ 3ADAC 1D09B 1UEKA 5I3UB 1VI7A 3EX7B 1PKSA 1OULA 5DG9A 3E2EA 5LSOA 3B82A 1UVJA 2YSQA 2K2PA 2QL9B 4BI3A 3QJLA 3MF5A 2YKOA 3OJUA 1IKWA 4EO8A 5H1SV 1K44A 1F9HA 1R7IA 2BE2A 1EKSA 1U1QA 3BGFA 1Q82U 1KD1U 4LDWA 4R5PA 1KVIA 3JCMd 1T9VA 1M3AA 2RAQA 5K8OA 4UZCA 4Y2AA 1HWKA 3C4SA 4QQBA 3OA6A 5AXKA 1TR0A 4PUOA 2AX0A 2MKIA 3EVOA 2BE9B 5HMXA 4P2FA 1XMQJ 1GQEA 4L74A 4AQYF 2M02A 3VHQA 2EQKA 2GAHC 5I3UA 2JRSA 3RRGA 1UECA 4RBTA 1RADB 2RILA 3EGDB 2QMXA 3ETOA 3NAIA 2RH3A 3F44A 2E1HA 5KFZA 1VQ5T 3THKA 2HSEB 2C0TA 4E98A 4X4OA 3HSBA 4DSEA 5K9FA 3J7Z5 2VJUA 1HLWA 1YSJA 2J6OA 1JK9B 5ETLA 3FLGA 3CCMA 1H72C 2AF6A 1KC8T 2FJBB 1HPZB 2DXUA 1F60B 2KYMA 4C0HA 2J9DA 1BCMA 4F7UB 3MOZA 2JX2A 1RJJA 4M77G 1VMBA 3CEYA 1UETA 3Q2TC 1HD1A 2M4MA 1M2VA 4WWSA 2DD5A 1M1KU 2V69A 4M75E 1Z1ZA 3AQPA 3PVQA 4JUVA 1D8ZA 4WJBA 4VUBA 5FD1A 5B0GA 1Q0NA 1SL1A 1ITPA 1QAYA 4DS4A 2KT3A 3EXCX 5GAN2 2E5QA 1NK5A 2R5AA 3BV8A 4BB7A 1M4ZA 1YI2T 3JXOA 3W65A 1UE9A 4GKJJ 1T3NA 3JAME 2BACA 2EBGA 2WSCC 4MK7A 4U7UK 3I56S 5F8MA 3I96A 1HPZA 3PTAA 4USJC 1V3RA 4L5GA 1S7HA 1PHTA 2ATCB 3GBQA 1YZ6A 1V29B 4JV1A 4ZVPB 1T94A 2B4OA 3HD1A 1R0AA 2MYSA 3LGMA 3V5RA 1RT3B 2W8KA 5LMNF 4LF6J 1RQ0A 1YJWA 3LUYA 2ABYA 2MPXC 4G65A 1FJEB 4OMOA 4JB8B 4V19J 3Q86A 3T3FA 3QGHA 4PWDB 3TEEA 1RWKB 3G6EQ 2L9WA 2PDAA 1JQGA 4KIAA 3EWGA 5HK4A 3RG6A 1NEGA 2HRYA 4ZVGA 3FFIA 5AXNA 2MSTA 3CDUA 1ZAVA 4FXVA 1QSSA 4C0ZA 4JI1F 4C92E 4EU0A 4C8QE 4Q43A 3BN4A 4YDXA 1JB0E 2RK1A 1M5PC 3BKTA 1Q81T 1NKCA 1QVFP 1XMBA 4ED7A 2EYQA 2YUPA 5FLXE 3HRSA 4O4RA 3FEYB 1M1HA 5KT3A 1YHQT 2D41A 1XR7A 5L23A 1RI0A 2Q1LA 2DVJA 4I2QA 2RK2A 4KBIA 4ZLNA 1R6VA 2L3PA 5GANh 4HH0A 3KUEA 1S5ZA 2XWYA 2YWEA 3Q8QB 5F8GA 4JV2A 3M0PA 1O9SA 2KYBA 1K0XA 1U25A 2RRNA 2R8KA 4ITSA 3GJRB 2Y1RI 4N0AA 2HGNA 2JL9A 5HKCA 2Z2ZA 1U1PA 4BUGA 3G8QA 2RA2A 3PZPA 3GU0A 1NB7A 2XLJA 2CH4W 4CLFA 2XI2A 1DARA 3JCMX 2C1EB 3OSVA 2Y0BB 2OPQA 2KVQE 3M5AA 4A4JA 4X9CA 2M9UA 2LFVA 4KUDK 1WI7A 3LGHA 3M8RA 3AD8C 4PZVA 1LWEA 4WF2A 1TAUA 1E7OA 1LOJA 2M0YA 2OJ3A 2WW8A 1MGQA 4GBQA 2CJYB 2EFIA 3IGVA 1LWXA 2BQRA 4MH8A 2JSXA 4B9NA 4QIEA 2IJRA 2MGZA 1SPBP 4M75D 3PM9A 3IG1B 2VQEJ 2A37A 3UPFA 2H5JB 1IN0A 1RT5A 2D1CA 5LM7E 3M6XA 4ECTA 2EEYA 3IM9A 3OR2B 2E41A 2V94A 1SC6A 1JWWA 1RT2B 2VG7A 1SQFA 1PYSB 3QXEB 5KG3A 1M1GA 3BW1A 5DGAA 2EJGA 1UW4A 3ILJA 3RESA 2EG1A 4DV5J 1SG5A 3CQTA 2QLXA 1JJHA 4QVDA 3FEXB 4HACA 4EFAC 1OX9A 2YPZA 3WC0A 1TUWA 1FX4A 4KFBA 3MWBA 4IDKA 2D9TA 1GMUA 4DR2J 3X1LB 3V6JA 3R5CA 4X34A 4J6XA 1Q8KA 3LP1A 3SSQA 3MKDA 3ZEHA 1UZHA 4DQRA 4IOAQ 3IG1A 5KH6A 1KG1A 3QJ6A 2KT1A 1YBAA 1FKAF 4NXNJ 2RQRA 2DCLA 2L89A 3OR2A 2CDRB 1RGVA 2XDDA 2LJ3A 4P2SA 1RT2A 1GBQA 3TUPA 4XK8C 2R8JA 4Z7CA 3TEGA 3KLVA 2EW9A 1FRIA 1X75C 2GF7A 2HLTA 1WC4A 2XEXA 1LK7A 2C2RA 5GMKi 1JLGA 2LCCA 2UU9F 3CD6T 2NZCA 4K5RA 4PG4A 3I56A 2NWMA 2KRBA 4XDCA 5HQ8A 4AG2C 1QWFA 2MIOA 2DNKA 2E5IA 1RWUA 1OY9A 2RT3A 2RHSB 4LF9F 3UCUP 4KH0B 4RTWA 2DE0X 4LRDA 4ID8A 3G6ES 3HLUA 5IWAJ 1TAQA 1WKJA 1HWLA 3N5BB 3FC3A 2P6TA 4DV4J 3R9LA 4MT1A 2QTXA 1YRTA 1VQ9T 2O4XB 2RDIA 5H9FK 1U02A 2OAUA 4BBYA 3RB0A 4ED0A 3KK2A 3GCWP 5KFHA 1HKAA 4A8KA 5C7PA 1K73T 2V67A 4HTJA 3D5MA 3TI0A 1Q82C 1KD1C 2W2PP 4F36A 3MM5B 3P6YC 1K73U 4CT9A 2H8HA 2HHXA 2YLBA 3FC9A 5HATA 2GMHA 2FGOA 1HQEB 1VQ8Q 1RI9A 3JSRA 4DPWA 3QGGA 2Z0WA 3QWPA 1BI1A 1KTVA 1YP5A 4NLGA 1J5OB 1FWKA 3JAMY 4OYXA 4ZVRB 2DEQA 3L4BC 1LWCB 4I67A 3M59A 3N5BA 3EG0A 1C0MA 4BI8B 1AWWA 1BIAA 3D6MB 3VKIA 2PUOB 4P73A 2O4XA 1FFGB 4ESRA 2WB4A 1X2QA 5I22A 1TTHB 2HNDA 4QR2A 5J1EB 1HMVB 2MYFA 3P4UB 1D8YA 1UEVA 1G3YA 3MM5A 1PSDA 4X4PA 4KKOA 3K89A 4XPCA 4IUPA 1X69A 2CPEA 2DHHA 3KTQA 4MFBB 3DXSX 3RB4A 2W2OP 4BDPA 1HQEA 4HCCA 4Z89A 1HQUA 2JC1A 4CRJA 4QOTA 3GIIA 2A1BA 4NLVA 3QRQA 3NKYA 4JZ3A 1J5OA 1HBNB 5JVHQ 1UFLA 4ZGDB 1NJWA 1ZTTA 3VQSA 4YS2A 2ACMA 4A4EA 1WDXA 4C8LA 3M2RB 1M1KC 2RS8A 4PJOC 1VJQA 2HHQA 5IS2A 1QAXA 3L2UA 3HVWA 3K57A 1Y7XA 4J9DA 2QZ8A 2DYIA 4ZNXA 2J0WA 3OLBA 4LF5J 2VKRA 1HMVA 3IFEA 4ETXA 1QVGS 1WOSA 4NEZA 4F4YA 3I5AA 3EYZA 3QYYA 2UXDJ 3KK3B 4MFBA 1H3DA 1RAOA 3M8QA 3UDVA 3HI9A 3BH7B 4KQZA 1PJ7A 1S59A 4J5OA 2E66A 2IYGA 2XTJP 3W60A 1NM2A 3MM7A 2QX0A 1WKKA 4C8OA 1BQMA 2IRXA 3BDLA 2JNJA 2RKIB 3K8WA 1CS4A 1T3LA 1OPZA 1NJIU 2HFSA 3PV8A 1F6TA 2NYSA 4TVRA 1IR0A 2NLWA 2MHEA 2BEFA 4FCYA 3UDLA 4FSXA 2HBWA 1OZ2A 2QEXQ 5DQHA 2CAJA 3CE8A 4R55A 1HQ2A 3H40A 1MSWD 1Y4ZB 2VASA 3QLHB 1OPKA 1RP5A 1AUSL 4QIWD 2MWPA 1N54B 5A8RA 1PSEA 5GAN3 2IM1A 2DIVA 1SKSA 2GZOA 4Y00A 3DOKA 2RKIA 1HARA 2G13A 4CNYA 1WF2A 2NXCA 4MMLA 1P6TA 2F2WA 4EBCA 1RSCA 4IKAA 4F26A 2LMJA 1VQ8S 2DITA 3LANA 4CRIA 1NSKL 3MPUB 3JAMU 2O66A 3E01A 4ZCKA 2GIFA 2A7YA 3V7RA 4HDGA 4LR9A 3GFHA 4F8RA 1K8AT 2IVFB 2EAYA 3M8PB 4CIOA 1WX6A 2JC0A 4XTXA 1QUVA 1K8AU 4J9MA 3M0RA 2RO0A 2WBMA 4O4GA 5IQQA 1JKHB 2FB7A 5A0GA 3JQJA 4HCKA 1Q1KA 5IHIA 3IR7B 3HSJA 1L3UA 1I81A 5CABA 3PO5A 2D3UA 4O0IA 3HHTB 1X6BA 2JHEA 4NZ0A 4M95A 1I07A 1S57A 5KFOA 4N8OA 3M2VA 3EPGA 1X4AA 3OQ5A 3H2LA 1E6YA 3M54A 2AJ1A 5L1JA 2EBEA 5F0WA 3W66A 4DL3A 5A0LA 3OW2S 4F0HA 3G86A 1N36J 2BW2A 1RT7B 5IH2A 4DQQA 2EQJA 4F4KA 1GXTA 3MMCB 3SEMA 5FLXU 3M8PA 2WVEA 1LKZA 3FMWA 2NR0A 5MAOA 3W3SA 3PCOB 2KK4A 2O01E 5HMYA 4Z88A 1JKHA 1B0VA 3AFGA 3FKBA 2RU3A 1GMVA 3GWCA 3NBPA 2IM2A 4M7AE 2M0GB 3UI3A 4DR6F 4ECWA 3ICLA 2DD8S 4NLWA 1LW2A 5FIIA 2ZH4A 3SCLE 2G3RA 1SF9A 3SDZA 4WXWA 2KBTA 4M77B 3TX8A 1S1NA 1Q53A 1VRQC 4ZCMA 4F67A 5LJ3j 4QPTA 2CP3A 1KLMA 1QVGA 1JXMA 2J06A 5KFLA 1NEEA 2QLBB 1ZSZB 3AY0A 1P9QC 4M78C 1U0SA 2VDIA 1W2BR 3MMCA 3KJQB 3EDQB 2K3KA 2KZZA 5I42A 4FF4A 4JI8J 3LGFA 1Q78A 2FZGB 2COZA 4CH7A 2C28A 4C4WA 4DCPB 4R25A 3BY7A 4ECSA 1Q95G 2Y8WA 4CLKA 1FJCA 2QEXS 4M77A 3T1YJ 1TH7A 2HHSA 4PG8A 2FL7A 3DI6B 4NYPA 2VPYB 3MR5A 4KH1B 3CJ2A 1D1BA 1HI0P 2IAJB 2OTLQ 2HMAA 1NJXA 2KZMA 1YNZA 2EQMA 3RAXA 2GHPA 3EXYA 5CQXA 2XBPA 2XCPA 4JI1J 4DUYJ 1UB4A 2WRMA 4GC6A 1CG2A 2D3OR 1IQTA 1CJTB 3BFMA 3PFSA 4IR9A 2GIQA 2FYXA 3PXGa 1H98A 4N4GA 3PGGA 4DF8A 2VC0A 1D3WA 1J5EF 1N33F 4P75A 2CPYA 3IAM9 3U1NA 1KFDA 3DU5A 2XY7A 1DJ7B 4ZTFA 2MLXA 4QVCA 4X4SA 5A8KA 1KR4A 1VQ8A 4CM2A 1YJUA 4ZA1A 4J9SA 1X2KA 4DX5A 2P2CB 2IAJA 2HEQA 3VS5A 4P7VA 3TAMA 3HZGA 2KROA 2XU8A 2KDSA 4OGCA 3UDEA 5D6GA 3M4GA 2U1AA 2NLUA 4GY5A 3DDNA 2RI5A 2W8LA 4ZKAA 2HAIA 4IUQA 1CJTA 2HZCA 1JQQA 3FBFA 2GQQA 4ORZA 1FRHA 5EDWA 4O3OA 4L73A 1FCAA 2F1FA 2J9DE 1I4K1 1QP2A 2Y0SD 4Q8FA 4DS5A 5DG7A 3V8LA 5D4OA 2HNZB 2BR0A 3TSWA 2PI4A 2J6TA 3OW2A 1VRTA 1VQPA 4NL2A 2DTJA 5KYWB 4DMZA 1JLCB 3QBCA 2M70A 1DRZA 2Y1LB 1ROFA 3D6TB 5T7LB 2F4FA 4DL5A 2M51A 1NKEA 1QVGR 4X62J 3F41A 4NE9C 4TU7A 2ROTA 2YVSA 3QRPA 1HW9A 4DDFA 3EZUA 1FX2A 1Q8LA 1BU1A 5BJRA 4BHQA 3EG1A 5L39A 1N5QA 1VBZA 4XIUA 3PX0A 2WOMB 4X9DA 2E29A 3MCSA 1PKUA 4DFJA 2V4QA 1Y5IB 5E0OA 1AHJB 4RMOA 5CCLA 1HBMB 5A8WA 4ILRA 5K8NA 2MMYA 1DFDA 2QYGA 4F7UE 3I0SA 2VG5A 2NQPA 1NJIC 4U8YA 1M90R 2OTJQ 3PO4A 2QQRA 4LF2A 1M27C 4YB6A 2HNZA 2YKMB 1TV6A 4CO1A 4TXSA 4ZMMA 4OZ1A 2A2CA 2QYZA 5GANg 2L41A 3F70A 2LQ8A 4O44A 4YDDB 5GAMg 2XWXA 4CLSA 2AU0A 1TK5A 3IBWA 1RDRA 2UUBF 3QSYB 3GR0A 5GAHU 3J81E 2LDIA 3BYRA 4ES3A 4QIVA 1Q86U 4OX9F 2CADA 9RUBA 2DR7A 1HBOB 3P8DA 1S1VA 4ZVHA 1KHIA 1ZX6A 1VC0A 4D3GA 1G3SA 2WOMA 1MN9A 4L59A 2QEXA 2LJ0A 1QVFS 4IIMA 1PWTA 4YB1P 5FJ4A 2FPEA 1HBMA 1EQMA 3RBXA 2OTLS 2VPZB 2B7BB 4NL5A 1XK8A 4NASA 2GJFA 3PYFA 1OU8A 4KPCA 2CRLA 2E44A 4NI2B 2FO0A 1PC5A 5GANj 3X24B 4G1IA 5GAMj 1FXRA 2ZH3A 4ED6A 1QE1A 2QFJA 2WAQD 1TG0A 1QLNA 3O1LA 1FI4A 1JXEA 1QQJA 2AGQA 2AGPA 3CC4T 1Q7LB 5HVGA 1UPPA 2L2PA 4H4KC 3VYGA 3LH5A 3JB9F 3PEJA 2UUAJ 5B0FA 1AOJA 4J37A 2F1LA 3RGIA 3FCVA 3HRUA 3HKZD 5LJ3d 2RF2B 5AXLA 2W9AA 1UWBB 3PVLA 2W9CB 3T5JA 2EYWA 4ZVQB 1SSHA 2ASJA 3GB0A 3BB5A 4F4AA 4C92C 4RLEA 4C8QC 4NI2A 3JTOA 1JB0C 3SCKE 1VQKQ 4KUIA 1VQMT 1WF1A 3W2VA 6FDRA 3L2RA 2DPPB 1VBXA 1HNXF 3BGLA 2HBQB 2GX8A 3SD4A 2KXFA 3GFYA 3QPHA 2EFVA 3CJ0A 1TMJA 5KFGA 4C8ZA 3VAKA 3OW2R 3FZ2A 3GJSB 2R4FA 1M8VA 2RQWA 1WI6A 4O0NA 2XC9A 1VHIA 4JJCA 3PW2A 3SQGA 2XLIA 2NSCA 2DO0A 4PWUA 2E1PA 2Q6BA 2CJAA 2FLNA 2DL7A 1NJYA 3EPIA 3KHGA 4W4MA 2P6SA 1LJOA 4HVWA 3MTKA 1V5VA 5IHKA 5CA5A 4AL6A 2XK0A 3MP6A 1UWBA 4RNOA 4C8MA 4ZJOA 2ZH1A 1I51B 3KJVB 5IXBA 2QSWA 2CQDA 3CD0A 4IQXA 1U8RA 2FLPA 4QKUA 5CHCB 4K4UA 2CT3A 4Y2IA 4B3OA 2Z57B 1H0HB 3MCAB 1T0TV 2FEIA 4Y65A 3RAQA 4ED4A 1IBKF 1S9EB 3L2ZA 1CSJA 3CCET 2GBQA 1Q16B 1RHQB 2OTJS 3C12A 3LTOA 1AA1B 1V6HA 3HULA 2BOAA 2VXEA 4MJKA 1AZSB 3Q0AA 4DR3F 2E4HA 3QHSA 2PIIA 5HLFA 1RWMB 1U1RA 1LW0A 5KG4A 4DPYA 4MKAA 2CREA 1IHVA 1UWAA 1HNIA 3KMQA 2GQCA 3BSOA 4GO7X 2EKNA 4UF4A 3OMCA 5DG8A 1IBMF 3TEHB 2DJQA 2E6ZA 4C8NA 3U7JA 2HL3A 1UJ6A 4WK3A 1T03B 3C6TB 2G6FX 3DM2B 2JXBA 3HP9A 3AA9A 4J9UE 4RWXA 4FT4A 4CC4B 1S9EA 2KQWA 1AROP 3DRSB 4Q0BA 1T11A 4FW2A 4ZPTR 3ELHA 2HQDA 4OZ5A 4BDYA 2ZC3A 1QVFA 2W7PA 2KXHA 3TARA 3EVMA 5D8HB 5GMKh 1AZSA 4KE5A 3CIZA 3CJRA 1S0MA 1RAIB 4FF1A 4DR4J 4EMHA 1TU0B 3QZ8A 1W25A 1VOMA 4PJNA 4HCBA 5IZHA 3L42A 1OI1A 2PU9B 3ZFJA 3PMIA 4QIGA 5LJ3f 1WNEA 4F7VA 5LMUJ 5IHNA 3S1TA 4KSEB 1UGPB 2EIFA 4FVMA 1NCLA 3PMTA 3C6TA 3G6YA 3DM2A 5HMWA 2DK3A 3OLAA 3IO1A 2VIHA 1W6XA 4CTAA 1YJ9Q 1T9UA 4WYLA 5KFBA 4Y3CA 1SHFA 1WC5A 3DRSA 1RISA 3J81Y 1DTQB 4HT5A 4JI5F 1B64A 4LSNB 3QPIA 3A3PB 1HBUB 2OUGA 4DXLA 4F4ZA 5GAOn 2ESWA 4LFAJ 1VQKS 4JV0A 2MMPA 1IREB 1Z4UA 2DYAA 4TLRA 4OV6A 1JEGA 1PC4A 1VIEA 3ZC4A 2RMLA 3R6OA 3NS6A 4ANJA 1U47A 1IKYB 2XICA 3SV4A 2WCXA 2V8VA 3DRXA 2RIJA 3TR5A 1WG1A 2JFDA 1YIJQ 2A08A 3ZNUA 3DLBA 5CAAA 1JXOA 3WVEB 7FD1A 4GKKF 1X4GA 3H6ZA 3M8ZA 3CJKA 3T1AA 2YRVA 1HFEL 4DSKA 4KGMA 1GK8A 2FQQB 5CYQB 1DTQA 2NUPB 2PEHA 5GMKm 1HBUA 2K7AA 2ILZA 2K7KA 5M2RA 2J9EA 5J2NB 5KOWA 3R7BB 4DPTA 1Z2ZA 5GANd 4F0MA 2VFTA 1SKRA 5GAMd 1IKYA 1D1AA 2O1PA 2L8DA 1P9YA 2CWXA 5ADZA 2O5DA 2QRRA 3BGRA 3CCVQ 1I6JA 1C1BB 2C42A 3JCMV 2CVIA 1Q86C 2P0PA 4URQU 2R42A 3DB4A 3D2WA 1CQNA 1UVLA 3MR2A 2QA1A 3R2DJ 1ZQ1A 2N7YA 3AH6A 2OTJA 1IHWA 2AYBA 2HHUA 3GIKA 2C2ZB 1LNQA 5CYQA 1OYEA 5KFCA 3JSCA 4DU8A 4BE2A 1RYRA 4M7DF 3GIJA 2V4RA 4ZLPA 2IVWA 1UVKA 3GMGA 3J80E 1N5VA 2VBWA 1HYSB 1H38A 2R3VA 1QVFR 5B0DA 4NYZA 4B08A 4CO4A 1KONA 1R8AA 4XTWA 4OMFG 5D0RA 5LJ5j 3M4YA 1KQFB 3DDKA 4XTTA 4PXBA 3LW5E 2XDBA 2I1RA 1BKBA 2OI3A 3SYZA 5KFAA 4L72B 1NNDA 2ASLA 1FJGF 2F2XA 4H4OB 2CNLB 1M8MA 4MYUA 2OHDA 3ZFVA 2DIQA 1KQ2A 4TQSA 4QU7A 4E7KA 2FRWA 4NYOA 3LH2S 4PRFA 4ICLA 1YKWA 2DB1A 3B6BA 3LOUA 5DLOA 1YJWT 1CKBA 4XTYA 2CQPA 1Y3KA 3TAPA 1U0HA 2LLZA 2IM0A 2AEMA 2K3IA 4W98A 2B56A 1Z9ZA 1HK9A 2CG4A 3W61A 1YJ9S 3I5CA 2YNGB 1G4CA 2DA9A 3KHHA 4DLGA 3J81U 1OWXA 4BC9A 3VAHA 3GFZA 1TK8A 1ZAXA 3EMTA 4M5LA 5IT9Y 3SI8A 2UXCF 1ZBJA 1F9FA 2J7UA 1SVDA 1KBRA 4LUDA 5KT5A 3OXGA 3BQ1A 1WC0A 1NHKL 3W2WB 1I8FA 2BANB 2YNHB 5KE3A 1RBLA 1FKPA 2BV3A 1JBMA 2RQVA 1WFWA 4ZPDA 3W9HA 1E6GA 1UKUA 2ALZA 1VQKA 2UXBF 3H8YA 2J0QD 1YIJS 4JLIA 1VQ6T 2RM4A 2KO1A 3MJXA 4HYKA 2VBYA 3PACA 3CCTA 4CI0B 3CXCS 5A0YB 2ZE2B 1SH0A 2CQBA 1D1CA 2R2TA 2Y9HA 2E5LJ 2KYZA 4PYAA 3RR8A 4PJOG 1ZPVA 2KHCA 1O6XA 4DG1B 1FXLA 2DIUA 2OSQA 1FEHA 4ZLLA 4A4KA 3UFCX 2XMVA 4X1VA 3H5YA 5GANf 2X3WD 1NK6A 3C15B 3KG4A 2JJ4D 4RU9A 2R8HA 5GAMf 2AJQA 3C19A 3A8EA 2VPXB 3W2WA 1BBZA 2BANA 2C2OB 3UN5A 2X4WA 1S1XA 2DRDA 1KSPA 5F3TA 2DT9A 1MMDA 4IFYB 2LZ6B 3KDOA 4K2JA 3W8GA 2YNIA 3M0UA 4YUDA 1M30A 5EWFA 4HHHA 2DY9A 1NH8A 1K1ZA 2BKDN 1SXLA 2GHWA 2D9PA 4OYIA 4O3SA 1HWUA 3PE0A 3CCVS 1S1WA 4LE9A 1OU9A 3CCRQ 1S7IA 3CCJQ 3JCMW 4OX7A 3GV5B 2A18A 2QXFA 3IN5A 2G0IA 1WOPA 4M77E 3F0NA 1QCOA 1U8SA 1SKUB 3DU6A 5D78A 3DRYA 5JXSA 2V63A 4ZVFA 1M5VC 2O01C 3CC7Q 4D3HA 2DRBA 2FHJA 4LBPA 2XMWA 4M7AC 3C2PA 5GAOm 4OHVA 1M2OA 4MMOA 2CIMA 4F4XA 2VZ9A 3RAMA 1X5PA 3QO9B 1Q7YU 4RX6A 2HHHF 3I55Q 1WHLA 3HHDA 5J1PA 5KYYB 5CD4H 3MM9A 3RRKA 4RTZA 1RLQC 3MEGB 5GAN4 1OPLA 2BMBA 2HS3A 3MM6A 3M9OB 1LFPA 1P8GA 4C8KA 4Z7YA 4ZJQA 5ETKA 3QIIA 4MK8A 1WXBA 2DL8A 3VS1A 4OYOA 3AXKA 4ZN1A 5J2MA 5C25A 1L5UA 3BR9A 2OPSB 1SV5B 3BR8A 4DUTA 4UUXA 2BRKA 3I56T 2PT0A 2AT1B 5LJ3Y 4OLPA 5J1NA 1NLOC 1AZGB 3FMBA 3R5AA 8RUCA 2MLZA 4OJGA 2DIGA 1G7CB 1SC1B 4IG3B 1GXIE 1H6KX 3MEGA 4KGKA 3H2VE 3MEEB 3JB9J 1X9SA 4JI4J 2DGUA 5GAGU 1EX4A 4DV0F 2FY8A 1B07A 5GJVB 4JI0J 1VDHA 4X4QA 1YJ9A 1VGYA 2N4CA 3C94A 2VICA 3PX4A 4M75B 1A0NB 2DISA 5IAYA 3A8OB 4IKFA 1W1FA 3J80Y 3L7PA 2GW8A 3GR1A 4NS5A 2OPSA 1WHXA 1SV5A 2RD1A 2OJ2A 4AFZC 2D0QB 1U49A 4OFZA 2CP7A 2V8GA 2UV8G 2HHWA 1HNXJ 1G83A 1UJ0A 2OPRB 1BCOA 2DGSA 4Y34A 4LF4F 2CQ3A 1C0UA 4LR8A 3L9ZA 3E9GA 2HZVA 2V1RA 3A8MB 2XS5A 3VS6A 2DGWA 3PRVA 4OB0B 1EARA 3OBYA 2RQCA 1Y71A 4EWTA 2AP6A 2MZQA 1MHNA 1YIJA 4QWEA 4J7IA 4EYIB 4NRTA 1MWZA 4B9SA 3CD7A 4YHHJ 4M77D 1DQ8A 2AEFA 4K50A 2DH8A 2LECA 3OYCA 2MPUA 4J9RA 5BYQA 1UVMA 1X27A 1KFSA 6AT1B 3TA2A 2X3GA 3HO1A 2HAXA 1HD3A 2HL5C 4LBIA 1U4BA 2P4RA 3C8YA 4A46A 4R56A 2AD9A 3D1OA 2WHOA 3I0RB 2J6UA 3CC4Q 3BGOP 3ET6A 2OPRA 4RBUA 3MGJA 5HQLA 5CXTA 4MZTA 1JMTA 4M78G 2XZWA 4HKQA 5J2PA 2ZM6F 3KBGA 3VU3C 2PA8D 1UEUA 1VQ4Q 4ZPAA 3HJVA 2UVVA 3CCRS 4DV3J 3CCJS 1YVFA 4ENOA 1WUUA 3RYLA 1YG0A 3CCVA 3QBYA 3NPFA 2M8DB 4F2RA 3OYKA 4HA8A 1NPPA 4FT2A 2XD0A 1XTZA 3C3LA 4RW9B 2HYIB 3CC7S 2Z0GA 4PAAA 3TQEA 2H54B 3UVJB 4NLQA 4JLGA 4CLTA 5EN1A 3QAEA 3KWMA 1I3OB 2EYXA 1AD5A 5KAKA 3OBIA 4HLBA 4CC3A 4Y28C 2B8PA 2OELA 4RNNA 4Q8EA 3I0RA 3I55S 1L3TA 1SC3B 3PX6A 1RU1A 3HXMA 5GANe 4HL9A 2RSQA 5HI7A 4FSSA 4F25A 2MDAA 1B34B 5KCHA 2KKHA 1TUGB 4KULA 5G0RA 1QAJA 3C16A 5DS7A 1X8DA 1WKLA 3VGSA 1T3SA 4GRSA 2DNOA 1AUDA 2C2MB 1U2RA 2PMWA 2DNUA 3VALA 2P9CA 3G4SQ 1F5AA 4II1A 2VQFJ 1GFCA 1JLAB 3W64A 1S97A 3QIPA 1S1UB 3L1AA 3KXTA 1P92A 3TAQA 1RAEB 4ZVUB 4B9XA 2KMTA 3QNWB 4I6YA 4NCGA 2DO3A 3P49B 1XMQF 3UVJA 4TY8B 2MEWA 5IM0B 4LMZA 4C5GA 3GP8A 3G96A 1JJ2P 1PJ6A 3BDEA 1BI3A 2MKHA 2QE5A 2RHZA 3CCEQ 1N5TA 4PKDB 1BE4A 1VHFA 3SSRA 1UVIA 8AT1B 1UJ4A 3QGPA 1UHCA 3TO8A 1A6LA 4KO0B 1H74A 3SFGA 4E7ZA 2XQCA 1A9NB 4NMLA 3G6ET 3MCMA 4B17A 1H2UX 3DGVA 4A8MP 5KG0A 3J80U 2EK1A 3TW0A 1W7WA 3D0GE 5DLFA 1TL3A 2RE1A 2FJDB 3OYDA 2XULA 3S3NA 3VS4A 4YB7A 3B4DA 3SV3A 3CEDA 1KHVA 2CP2A 1TUCA 2XMMA 2BVZA 2BJ3A 2IHR1 5IM0A 3CXCR 4FPRA 1RTDB 4DX7A 4NLSA 3GYGA 3UO0A 2C0OA 3R3TA 1S6PA 2CXEA 5KG1A 5FRNA 4Y6IA 3KLHB 3Q8UA 1RABB 2H1YA 3KLIB 3HFOA 3LYIA 4P2XA 1KQSP 1Y96B 2IIMA 1FFWB 4GKJF 4ER8A 3AOCA 4OZ0A 5FROA 2BXJA 5GAEU 1VYUA 4K4YA 2DRMA 5CK9A 4H54A 4F3MA 3TVKA 3HHEA 1LEOA 1H7WA 2KRSA 1FXDA 5DDOC 3NLCA 1HI1A 2RHYA 1Y07A 4I7FB 4RTTA 1XR6A 4IURA 3KFWX 2C3PA 3CC4S 1B7YB 2LNVA 1F0XA 1HL6A 1W2BP 2W9BA 1PBUA 2HVEA 3KJFB 4FF2A 2BQ3A 4I2PB 2W2NP 4EGLA 3WXMB 1HIYA 4FKYA 2IMWP 5ETMA 1VQ4S 2R58A 2YUNA 4XAKA 3ZZPA 3EUNA 5BYSA 3H20A 1KSWA 3OFEA 2EJFA 3IR6B 3KLHA 2ZC4A 2JOQA 1S72Q 2ZH9A 4K11A 2DY1A 2JOYA 3KLIA 3R27A 3CMAQ 2AJFE 3QKJA 1Q7YC 4OX6A 4P74A 2EVRA 3OHAA 3CJ4A 3OL9A 1G8XA 5IT0A 3JS9A 3E1SA 2V0NA 1S9GB 2HFVA 4NLXA 3TVYA 1NJZA 3H0IA 2QAZA 3CC7A 4YR3A 5KCOA 2CNNB 3DLJA 1S9FA 3NGKA 4C6AA 1VLYA 2CPIA 3UNYA 1TL1A 1NZ9A 2VKZG 2VHGA 4CLWA 1RAAB 3TYTA 4WFZA 3IS9B 4TVAB 3I55A 4OMFB 2LA6A 3L09A 4B3TJ 1PIEA 4C3MA 1BQXA 2ZH8A 5IXUA 3G4SS 4ECRA 3V4IB 2BZ2A 4ZTJA 1U09A 2CP6A 1RACB 3N5FA 2KI7A 1TKZB 1N8RC 2DNMA 1FJGJ 1GAOA 1R0CB 4WP9A 1M90T 4JI3J 2MSSA 4B6MA 2XS2A 3CCUT 2W2QP 2GVZB 2KT2A 4WZMA 2KAFA 1IVZA 3MZIA 4H4MA 5AYFA 4WZQA 3HKSA 2AHOB 5HVHA 3GPAA 4LN2A 1O8BA 5L1LA 2BQUA 3NTIA 2GO8A 2V6AA 3CCES 3RKYA 2ZFHA 2WW4A 5CCMA 3CJQA 4DQ2A 2VQEF 1SJ3P 3UWNA 3FK4A 2AHJB 4RW4B 2Q79A 4A54A 2Y3YA 3PYGA 1EP4B 3IS9A 4FYXB 4DQSA 2J6FA 1TFYA 4USUA 3ISND 2K57A 4ECQA 4KV8A 5GVQA 4C8QG 4YEAA 3TQ1A 4XU1A 4JDSA 4DV5F 2JVVA 3HL8A 3GSDA 2W7OA 1DTTB 3VF0B 1K9MU 4PLIA 4C0BA 3L2VA 3CPWP 4NLPA 2J5AA 3E19A 3E3XA 3TP2A 2GVZA 3MP1A 2CPDA 4FBTA 4DPUA 1XERA 1IBCB 4PJMA 2UXBJ 3OYJA 2CZ4A 3MFHA 3DCAA 2X1FA 2HZAA 1HR0F 2LRQA 4QYZJ 1YWOA 1VQ8T 2FZKB 2YDLA 2ABLA 1WEYA 1S1TA 2GQIA 5F0UA 2LMIA 2CJ9A 3KMSA 1WDDA 2CQ0A 2VGNA 3OXLA 4NXNF 3KNAA 3M6UA 3NMZC 2F4VJ 4IR1A 3ASKA 3LPEA 3RB6A 3MEDA 5HVFA 3OYMA 2R7VA 2R7SA 3EVWA 4BWJA 2FD2A 2POKA 2GVDB 2PEBA 4D8DA 1TELA 4A4HA 2G2OA 2VU5A 2BZYA 2HQIA 2FDNA 2MK5A 4L6V3 2WZ1A 3N0VA 1BLUA 3PR5B 3OMGA 1RAHB 4CLLA 2ZOGA 4TY9A 2WONA 5ETQA 2JTEA 2HVHA 2UVRA 3CC4A 5IWAF 5SZTA 5CIUA 2ASDA 4ED3A 3FB9A 2XG8A 1S72S 1WA7A 3R6LB 3CMAS 1VQ4A 2FVQA 2D9OA 1CJKA 2GGPB 5HSPA 3H41A 4PJOA 4UOCA 1RLCL 3ZZTA 1NDKA 3LWMA 1PRMC 1MMGA 5LL6S 1UFKA 2RD5C 2V2ZA 3SWNB 2CQIA 1N6QB 2GMJA 2HDAA 2VOPA 4IUTA 3M4XA 2GVDA 1VQMA 2B9XA 2GJIA 2KFZA 2Z2MA 1ABQA 3MR7A 2PMZD 2HVZA 3QAUA 3M30B 3X28B 3UDCA 2A10A 4E6RA 2HFZA 1D1UA 4LDUA 1FK9A 2BTTA 3CCZA 5J39A 3EICA 4N5SA 4JJNK 3CO0P 3J7AN 4WIIA 2GJ2A 2YWHA 1DJ0A 3C6UA 5D0HA 2I9SA 1RZMA 2NPFA 1C0TA 2R2RA 4KHRA 2QDYB 1HNVA 2CDQA 4TKTA 1KVJA 3K5NA 4X4UA 4OHYA 1B0TA 2GGPA 5KFEA 2LYVA 2NXNA 4RTUA 3BBFA 4ZP9A 3G4SA 2ZBRA 1JLEB 1YLXA 4LDVA 2IJFA 3IC1A 3GF5A 3LALA 1N6QA 3V8KA 3ITHA 4PJLA 3CO9A 4ZHRB 1WHWA 3OHBA 3ZZ0A 3LP2B 3AOAA 4USKA 4C11A 2GNCA 1CJUB 3JCMh 4DCJB 2A3LA 1SPKA 2QEXT 4QZVB 1IM4A 4ERDA 1S0OA 1WHHA 2CJXB 3ZZYA 3VZHA 1RWOB 4NLYA 5HN0A 3CCEA 3QYGB 3R5DA 2HQ3A 1Q82R 1KD1R 4QU6A 2NSBA 3JB9G 3DLMA 1IR2A 1VJWA 3LW5C 1MWYA 3DLHA 2RI3A 5AJ3J 2AMCB 4DV0J 2K4YA 4OMQA 1J3TA 3SDEB 5BR8J 2ACYA 2PVGB 1YQHA 4PLLA 2P9EA 2PQWA 4YFUA 2D1XA 1FMKA 4LF5F 5CKDA 2HQGA 5HQMA 2F5KA 5AXMA 4NLRA 4OMMA 1YBUA 1U2FA 2OPPA 3FRNA 2DXBA 5KYNA 3LP2A 4UT4A 1VQSA 1PG5B 4WKYA 3KK1B 4LF4J 1RWPB 4R0KA 2UXDF 5LJ5Y 1M1FA 1CJUA 2MQLA 5L8RE 1UJ5A 2ZKTA 2RRBA 2ZZTA 3G87A 2KHDA 2OFGX 5CKHA 2APOA 2I6WA 3VUBA 3R2CJ 1I5LA 3O5ZA 4ED5A 3CBOA 3V7SA 3M9MB 1OQ3A 1RWWB 1YJ7A 2V5HG 1J2VA 5GAN8 4ELUA 2VGMA 5ETPA 2XLKA 2V2KA 4E7HA 3OR1A 1ELOA 2W4PA 1XNRJ 2DAQA 2KFYA 4QIFA 4K4WA 1NXIA 1MLAA 1BI0A 1ZAWA 1WTBA 1OS5A 3MI7X 4J90A 2DH7A 2RHUA 2L5QA 3J7YU 1JLBA 3NTKA 2UV8A 1PSFA 1IKWB 1M1KR 3A98A 2XHWA 2PZ1A 1IB8A 2BE2B 2M5YA 4S0MA 3G6VA 4KJIA 5HK0A 2VKNA 1NYFA 4ZP8A 3NWRA 1PNJA 1YBYA 4PQUA 1V76A 1AEYA 3WC2A 1VYVA 3VVUA 4C9DA 4OB2B 3RMSA 5FU6B 1KP6A 3PG9A 3O44A 3GG1A 2YXLA 1S72A 2CKWA 4OLOA 5IC6B 1U06A 3C95A 1H2VZ 1SH3A 4NWBA 2P0QA 1VIFA 3CMAA 4PPDA 1GL5A 2EGCA 4M5NA 4EIKA 1HNWF 1VQ6S 2EYZA 2P5VA 2XI3A 1NB2A 1NE8A 3UD5A 4RW7B 2N7CA 1DQ9A 2PVOB 3K7RA 3BN7A 4ATOA 5KG5A 3U23A 4PR6A 2HWTA 3CJSA 3U1MA 3ZZRA 1RCXB 4PFOA 2R2UA 4M78A 3CDEA 2HW3A 3MXHP 1M5HA 4GVLA 4C5IA 2C3MA 2WTFA 5J3BA 2W0ZA 2XMUA 3D7SB 2K5IA 4M77C 2RQMA 3D4JA 2QYCA 3K0JA 3KUFA 3I4HX 3ENWA 1S79A 4NCAA 4U9RA 3UF4A 4HT9A 2LCLA 2DKGA 1NLKL 1BXNA 2KG1A 2DBMA 1UUEA 1ZSZC 1ZTWA 4WE1B 1M2VB 3GJTB 1FWZA 2QV6A 2ZPFB 3K5LA 2VBZA 4L76A 5K20B 1NZ8A 1U24A 3IWXA 4RW7A 2BDPA 2XCAA 1N36F 3BEGB 1F2GA 1K9MC 5KOXA 3M6VA 5DZ7A 4RUAA 3CB4A 2MF2A 4CO3A 5KT4A 4C5EA 2CDTA 4RNFA 2OTLT 4N77A 2HGLA 4XU3A 1Y10A 1S12A 2RNEA 3CBMA 1IKXA 1U1TA 1UG1A 2B8QA 2SEMA 1KC8U 1NPRA 3S3MA 4OHXA 3M2UA 3HT3A 3C66A 2RMOA 4NEYA 1R0AB 3SEOA 2RJFA 1YTYA 1SJFA 2HQCA 1KLNA 3CF5Q 4WE1A 1EKRA 2AKWB 3OXFA 4WTYA 4AYBD 2JLEA 1K1QA 3D1QA 3N6MA 5IXFA 2FHJD 4M5JA 2DKOB 3DLKA 2KU7A 1GXUA 2DHSA 2MQOA 2R7UA 1R77A 3FFIB 2EXUA 4UOGA 2I0XA 2COLA 1QY7A 4JI8F 4OJ3A 4IO1A 3V6HA 1N5YB 5EX3A 2JLGA 2AYMA 5ETNA 1MMAA 2BKNA 3NGPA 4OB3B 3PEHA 4B9TA 2OMLA 3PFEA 1OYDA 2K1RA 3KUGA 5M2PA 4I2QB 3OL6A 3T1YF 1LXNA 4DR1J 2LQNA 3H0HA 1JO8A 1FWLA 1O51A 5I2SA 2NCKL 1QSLA 1U6BA 4N76A 1YGYA 2OEKA 5EWEA 4DOVA 1R27B 2I8EA 2HMIA 1WHYA 4J9IA 2O67A 4AD6A 4DUYF 4FM4B 1Q8IA 2OPQB 2ZBQA 2QDLA 3MOJB 3VAMA 3OSSC 4IUUA 1XQHA 4M7AG 3G71T 1IWGA 1R89A 4YP3A 1N5YA 1Q81U 1LWEB 4I0WA 4EYHB 1RT4A 1NM7A 2HS0A 3L7UA 4KHPJ 3GIBA 2MB0B 1JNRB 2XYHB 1FMWA 3OBWA 1U1OA 1EFNA 2V50A 4M7DG 2MGZB 1FNXH 4CQ1A 2MZRA 3UA6A 4UUWA 4LR7A 4DV1F 2UP1A 4DBRA 5ETTA 1VQ6A 3IWNC 2J7WA 4X2BA 2BJ9A 2ADCA 1RT5B 1FE4A 5GAGI 3NMAA 4P9SA 2Y1IA 1S10A 1S6UA 4QQ6A 4TU9A 2VG7B 3EJMA 2OTJT 4DUZJ 4OL8A 5LT5A 2DR9A 4C3LA 3TANA 1AWJA 2O31A 4QW2A 3MMBB 1JJ2S 4DL0C 2BUDA 4HEA9 2E3IA 3FSIA 4WCIA 1A7GE 4B3RJ 1TWBA 1KN6A 4HACB 4ETZA 2MKYA 3FJ5A 4A8QA 2X9HA 1M3CA 4KFBB 2KR3A 4IDKB 3HD2A 2HQEA 3QFWA 4RKUE 4EMKC 1XQIA 3FBBA 3LP1B 4QPXA 2DXDA 3WHIA 1SC4B 4K0KJ 4HHUA 1KQKA 1GCQA 2AKLA 1YCSB 1K0TA 4PJOF 1AYEA 5I11A 3NTHA 5I21A 5E5NA 3O2IA 1NRKA 3RMQA 1RHUB 3LA0A 2SXLA 4N56A 4P7TA 2RB6A 3DGPA 3WVDB 4ALZA 3Q83A 2YPYA 4WTOB 2ZDOA 3R8YA 4DFKA 4M94A 1OO0B 3HP6A 1GX6A 1CSKA 3MMBA 1CLFA 4I6AA 4X62F 1JLGB 3CWJA 2ROLA 1X9WA 4MDWA 3PKYA 1R8BA 3VAJA 3IR5B 3DB3A 1TQLA 1SUQB 2KI2A 1KQSS 2MLYA 3OS0A 5J26A 2ZHBA 2F2VA 3MECB 2HHTA 3EFOB 2CPXA 1KDNA 4M63A 1HR0J 1ZPWX 5L1IA 4G1QB 3R5GA 4WKRA 3PJWA 3IM8A 1PCAA 5A0DA 2Z56B 3IBFB 3CSKA 2EFQA 1W2BS 1ACMB 3CCUQ 3BSAA 3GIMA 4C8QA 3KK2B 3ZL7C 4I6WA 3O8WA 3AB4B 4PWWA 2BE7D 1JLQA 3A12A 1Q5YA 2WBRA 1UAWA 4O3NA 1UP1A 2MKKA 5KFWA 1VQKT 3D0IE 1SBRA 5ETSA 4L3NA 3C14A 1SUQA 3MECA 4HVZA 3VRYA 2GGRA 4RJVA 3EFOA 4XTUA 2VBXA 3HKWA 4OI3A 1R31A 3OSNA 4ED8A 1WHKA 2G9OA 5FWCA 3R1LA 4G1QA 1UMJA 1BQNA 5MLCV 2YY3A 3M53A 5D4LA 3ENQA 4L6V5 3PIOQ 2F7VA 2DXTA 3P96A 3R6NA 1EETA 5D77A 2GHVC 2ZHAA 2GO9A 5GMKe 2HNDB 3D67A 3DHWC 3W62A 3OB9A 2K5FA 1LK5A 4LF7J 1CVJA 1FX7A 3PRBA 2H5IB 3QDRB 4M5IA 1RA7A 1GMWA 4J9GA 2D0NA 1NJIR 3DLLQ 2KYXA 4K4SA 4JJDA 4GO5X 4XK8E 2DILA 4KKOB 4M5KA 3HMJG 3M9NB 1FYNA 1HQUB 3VTIA 4ECVA 2KEAA 1ZM4A 5D15A 4E7IA 2IM3A 2UUAF 4F7UG 2PD1A 4RTXA 3I5BA 2VA2A 1RBOB 5KFFA 1SIZA 2DHAA 5FW9A 2L3QA 2GS8A 2DPIA 3UQSA 1FF2A 2ZH2A 2CS7A 3CCQQ 5HROB 1WC1A 3MD1A 3GPLA 5CQGA 2RF0A 5D0GA 5EG2A 2LNHB 2PVDB 3IWLA 2CGHA 1XBWA 4JI6F 2F9JA 4DWIA 2HNYA 4RCBA 2CWKA 2DNZA 3OYNA 4P10A 2NYIA 4WFNQ 4N41A 1X5TA 2JN0A 1JJ2A 2HRTA 2DNRA 1TL7A 2QSFA 2X3DA 2XGPA 2JMAA 3OYLA 2VOOA 3JYTA 2CZ7B 1OX8A 2M1HA 2DL4A 5E3CA 3RBZA 3ZNJ1 2DFUA 1EIYB 3KXDA 3A8JA 1KC8C 3M8QB 2DGXA 1YRXA 1D0EA 4TYAA 4TLQA 3CPWS 4LFCF 1RTIB 3BBCA 2AZ1A 5KT7A 5FRMA 1Z9QA 5GAEI 3MM7B 3DLGA 3MDFA 3A1YG 2W10A 1PRLC 5CD4A 1YWXA 2Y8YA 5HROA 5LL6d 1BQMB 5DM6Q 2WSEE 4WFAQ 4OF1A 3MURP 3D3CJ 2LT4A 1CS4B 1PYTA 3KLGB 2DGQA 2DZ9A 1J27A 3H0PA 3NCQA 2P4TA 3T19A 2LKZA 2CP5A 1FNMA 1C4CA 1OQKA 3IRXB 2E3HA 5D0EA 3RU0A 2EQUA 4M78F 1R8HA 2C0IA 4E2FB 4NL3A 1EB0A 3VYHB 4OIXA 4NOYA 4PABA 1KQSA 2RI2A 5B0CA 1RUSA 2YNFB 2VVKA 3FEZA 3T9NA 4YOEA 5ECAA 4ATNA 3CTRA 3VJPA 1TVRA 2DR8A 5A8RB 1YJ9T 1RTIA 1BK2A 4FDFA 1JJ4A 2DO4A 1NG2A 2NUUG 2EGAA 3KG1A 3CCUS 2E5HA 4WU3A 2EGEA 3NNHA 4DN9A 3DOKB 3TX0A 3N9UC 4DU7A 1UGRB 2XGQA 1N32J 4JRPA 1FERA 1KKHA 4PJJA 3R1HA 4JV5J 3GG0A 1F9EB 3KLGA 1B3TA 3OTEA 1W2BA 2HNIA 3V6DB 3IRXA 3OL7A 1WQ7A 3RR7A 2YQ3A 3E01B 4DV2J 2N4DA 2X1GA 1YIJT 4OJHA 3EHRA 4MZMA 1Q81C 4A53A 3BO4A 3IP0A 3UNGC 3BGUA 1OMSA 3AAWB 3OTBA 2YNFA 4DPOA 4F17A 1QKWA 1V3ZA 4N47A 1G2EA 4O4GB 3G6EA 1ZS6A 4KHMA 1HYOA 1HHTP 3JCMg 4X66J 5KYXA 3UW1A 1RWNB 1HNZJ 2ATLA 3QUIA 2FTRA 4LUEA 2DYBA 4GLKA 4EZ9A 4WIQA 1KRPA 4DR4F 1OOTA 3X20B 5J2QA 1RTHB 2KL8A 4AFUC 2F9DA 3QRRA 3CCMQ 3M2VB 1HNWJ 1JU5C 2HWIA 2IRYA 2YKNB 1B99A 3TUZC 2WSFE 1E6YB 1QTMA 4WF9Q 4U95A 2AZSA 2OLWA 5LMUF 4RL1A 3V6DA 2ZZMA 3BDUA 3Q8SB 4AFFA 4X64J 3PYDA 3DKDA 4O3PA 3TA0A 3NNAA 1JRIA 3CCVT 2Y4YA 2AYEA 2BJ7A 3T5LA 3IGNA 4MIWA 1AFJA 3BYPA 2CFXA 1TSFA 3EE3A 1JJ2R 4R8UA 3UD3P 2KRRA 2LP5A 2ED0A 1YX2A 3MFIA 2CKKA 4DA4A 1G2BA 2E12A 1NH7A 3NBPB 4LFAF 3DRRB 2CYYA 2XHCA 1UA1A 4FYYB 1LW2B 3OS2A 1KTQA 3BQ0A 2FGCA 2E5GA 3M32B 3VAIA 1RTHA 1R3NA 2PC6A 4MKBA 3PTWA 4RU2A 4EPCA 2G0JA 1S0NA 3N6NA 2YKNA 1ZZNA 2RVJA 5JMNA 4FXWA 3DLEB 1YITT 3W8PA 3GV7B 4HHJA 1KLMB 4B9MA 2ENMA 5KYUB 2QO3A 5B0BA 2EFPA 2UUCF 2W4DA 1RYSA 4OYPA 4URSA 3DOLA 2K6DA 4BY6B 3G82B 3WX8A 5ITHA 1BGXT 4JI2J 2J0XA 1LWFB 5I42B 1WPYA 3B54A 1RAGB 2EG2A 4OYWA 3CPWA 1RLPC 2BZXA 4C0DC 4J7FA 3TREA 3CXCP 2MCNA 2XG8D 3A8LB 3DRRA 1KQSR 3A4TA 1XTDA 4KYZA 2IRUA 3OVSA 2KJWA 3HFNA 3M32A 2M8HA 3HTRA 4PJOD 1OYXA 4USHA 5E2QA 4C0GA 5CZVA 4J9VA 2QQBA 4OMLA 2OI2A 4HR2A 4LIWA 3DLEA 3T1HF 2JS0A 4ZIVA 5KYUA 2FHDA 1K4US 4HT7A 3EAEA 4DJBA 5HBMA 2W7AA 3UWTA 1X31C 1JX4A 1VC5A 3G82A 5FU7B 2DTOA 5D4NA 2XB2D 1LWFA 3KFVA 1DY3A 2B43A 2DERA 2IDLA 3OYAA 2ZNYA 3Q8VA 3CCUA 4XU2A 4OI4A 2E7XA 3A8IA 2K9GA 4M75F 4GC7A 4IH6A 3IQLA 3DN9A 5B7WA 1KK7A 3MEVA 1HWIA 1ZYQA 3NY0A 1X0PA 5A8KB 2K2VA 3GLJA 3LGLA 5DZ6A 2HKEA 4FIBA 3D66A 1K73C 3TAMB 5E3PA 3UN3A 2HPUA 1AB8A 1Y11A 2WVCA 3NGSA 2B9EA 2OH2A 4KT0E 2H5EA 2V8JA 1KOOA 2D8JA 2N82B 4AXIA 3PIOA 2ZDPA 1GBRA 3EG2A 3L7OA 5T14A 2F5TX 2B4PA 3THTA 4YR2A 3TOQA 3W63A 2J7IA 2AIRB 5L1KA 4CI0C 1IRXA 2YQ0A 1G3WA 1WLPB 1Q86R 4FN5A 2ZPEB 3NNCA 1ZBTA 4O6JA 2XMFA 4M7DB 3OYGA 5H9EJ 3DLLA 1WTFA 5I3QA 4QWAA 4RW6A 4DV1J 4C7QA 2A28A 1RWXB 5M2UA 5KT2A 3J7A1 2X1AA 1F3VA 3RRHA 3POTA 4CZCA 4C92F 4C8QF 1VRTB 1FO1A 2LVMA 2GNKA 1VQOQ 5KG2A 3CCRT 2VONA 3CCJT 4WP3A 1WSVA 2FLLA 4AMCA 5DLGA 4MKYA 4N7TA 4E7JA 3IAS9 5JJBA 3BM7A 1PAEX 1NHVA 2AJ0A 3BSNA 4M7AA 3CC7T 3Q23A 3X25B 1WG5A 3KJNB 3ZTRA 2JEFA 4CC7A 3HVTA 4QWBA 1W2IA 5LJ3h 4PXDA 3REAB 2VL1A 2AEJA 2BW7A 2KXCA 3UE2A 2V68A 4M7DA 1D3BB 2N3LA 5KFXA 5A8WB 3IRWP 3I55T 1RXOB 1RHRB 3I0SB 3CPWR 2VG5B 3NCRA 4P52A 1YRUA 2E5LF 1FRMA 3ZBDA 1GNKA 2RS2A 2LDYA 3I32A 1D9AA 1TV6B 3H5UA 4DR7J 5D4PA 3JSBA 5C2CA 3HM9A 1S49A 2J8AA 1AFIA 2JWNA 4O44B 2O9VA 1HI8A 2FC8A 3G71Q 3VS2A 2DNPA 5KG7A 5T41A 3TJ9A 5DRKA 2XNRA 3CPFA 4PPZA 3OYIA 1FEEA 4F14A 4ED2A 3R5JB 2QI2A 1UJYA 3J7YI 1GCPA 1S1VB 4WFXA 2LJ1A 2RQTA 1LVKA 4C48A 4HTIA 3S7RA 1R0BG 3FDRA 4B3MF 1D3BA 3OFFA 1XR5A 4IO9Q 4PG7A 2Q3PA 1M5Q1 4Q5VA 4MKVA 2BUNA 1QP3A 4CLUA 2BJEA 2DHGA 2VB6A 2B7CB 1IJEB 1NSQA 3FNNA 3J7ZT 4FZVA 2KB2A 3U02A 2B9WA 4NX9A 1KVKA 1Q82T 1KD1T 4M78D 1BC6A 4F0KA 3TZZA 1QE1B 2FHMA 1RTJA 4IH7A 5ETVA 2M3DA 2AYGA 2HD0A 5EHHA 2KTQA 4QW9A 4FBUA 1RA6A 2V8HA 3KG0A 3RBBB 1URRA 2Q66A 3W1YC 2FG0A 2MQQA 3LAMA 3JCMc 3VGUA 3GE9A 4M75C 2FJAB 1QWEA 2A6OA 4FYDA 4C2MA 4J83A 2E1AA 1CBKA 1U8WA 1X4DA 3T6BA 2J6KA 5DGBA 1WOOA 2DCUB 2V4JB 4NLDA 3LX7A 2CQ1A 2WVFA 4OV1A 2DXCA 1VK3A 2BM0A 2E9ZA 2HFUA 4F50A 4KGZB 2Z4PA 1QKXA 1DZ5A 3QMQA 2AZVA 2EFNA 1OV3A 3TZYA 3GNGA 3G9CA 3W2VB 2ZUGA 4KTQA 3NOCA 4RNHA 2YTCA 1N6AA 4Q44A 3M55A 2N3OA 3LWHA 2IY5B 2C3OA 4UZBA 2YKQA 1VK8A 1K8AC 2JEIA 2F5GA 2XIDA 2LQWA 3SQGB 3WDOA 3GOXA 2QLJB 2PFDA 5KTQA 3QJPA 5HAOA 4FW1A 1NMEB 4JI4F 2KJVA 1VQ4T 1VQOS 4Y2CA 2VFUA 1M1KT 4JI0F 3K5OA 2MZSA 3MPDA 2V4JA 1PO6A 4KB7A 1GX5A 2DEUA 2XY5A 1SJRA 2NXJA 4IG0B 4JI6J 1AW0A 1F2HA 4OZNA 4V1Ak 3EGDA 1FFSB 1AZEA 2HGMA 4A8SA 3QSUA 2IG0A 3EZ5A 3ZTPA 2J05A 1H7XA 1FT8A 3Q24A 4B3OB 5CAIA 4HT8A 1YZ7A 5GMDA 2E9TA 3M57A 3OTDA 1IGUA 2H51B 5HY6A 3KHRA 3T5KA 5KT6A 2LEBA 1UTAA 2CNKB 4C0FA 2W01A 3CCSQ 4F16A 2KT5A 4YHHF 4PL6A 5AE1A 4F7UA 3CCWA 4LFCJ 4UQTA 4F3QA 3S3OA 3DRPB 3ZZOA 3H9NA 1QW1A 5HLFB 3G71S 3A3OB 3G4ST 1WORA 1LW0B 4DZDA 1GRIA 4RUBA 1HNIB 2JNGA 3RW6A 4IG0A 4CWBA 3BDPA 1OJ4A 2EI5A 5DETA 3HZEA 3NHNA 3RTVA 3V8JA 2ZH5A 2VODA 4RKUC 1WZOA 2M7SA 1WF0A 3HF5A 1T0HA 4X4NA 3M0QA 4U96A 4DV3F 4C97A 3NG8A 3GYNA 5HJXA 1QJHA 4Q0BB 1UHFA 5CR2A 5FWBA 2QTVA 2XM3A 1F5CA 1H2TZ 4LF8F 1MMLA 3GP9A 2K7JA 2FIUA 1N0UA 4ANEA 4C98A 2D3O1 3DRPA 2A36A 1RT3A 3JCMf 5GAMh 1MG7A 4K4TA 3TJAA 5KFYA 1G3TA 3P3DA 2UUWA 1SRLA 4DX8H 5IT9E 3FGVA 2DM1A 1FNOA 1IJFB 4PWDA 1U7LA 1LNXA 3MAHA 5D3GB 2ZZDA 3M58A 4UOFA 1WJQA 3T6JA 3TVTA 2JM9A 3M0TA 1B0PA 1XNIA 1D9DA 2HBZB 3IMQJ 4ZJLA 2AWZA 2KM8B 3CT9A 3DFEA 3PYEA 1ZBXA 3VRZA 4CTAB 2CG8A 4J9EA 4ZS6A 1WHVA 5B0EA 5B0AA 1UTIA 4XAXB 2RQUA 3R5BA 4FXDA 1B4SA 2VQFF 5GMEA 1QCNA 3E9FA 1GXLA 2GA7A 2OTLA 3T5HA 5EGYA 1PILA 4NCBA 3I6PA 3D9BA 3P5TL 2KRNA 5E41A 2BYCA 1XNQF 4LREA 1U1KA 1FA0A 2V8PA 5D3GA 2WVBA 5IC4B 1NDPA 2OAWA 4C5HA 4IFVB 4ZPVR 1UA0A 6FD1A 2DMOA 2CPFA 4K5SA 2JS2A 2QK0A 2PO4A 3LO3A 4BLGA 3JSYA 2QA4G 1BHNA 2YWFA 3CJKB 4U7CA 1Y0MA 1FHTA 3VZIA 2CZ9A 3QWYA 1RWVB 2V1QA 4YQWA 1S72T 3R7NB 3CMAT 4N8NA 4XU0A 4OQJA 3HHKA 1NDLA 1VQOA 3QT6A 1BD6A 3UD4P 3PNIA 4ECUA 4Y92A 2DLPA 2LQ9A 4M5HA 1X6OA 4EBEA 2DZCA 4L3KA 3ILLA 4J9FA 1RL2A 3M56A 2YQ1A 3LP0B 4RZRA 4EK2A 1RKIA 5K8PA 1RU2A 2KFNA 4I4BA 4OJ1A 4QJVA 5EC7A 1TMMA 1CC8A 1FVSA 4C92D 2ALYB 2CNOB 4C8QD 3M8SA 2RB7A 3BGRB 3KNGA 2H3EB 4RCCA 4IFVA 2IJNA 3J81j 4LD6A 1FESA 3EGXB 3CCSS 1SQGA 3P8BB 1N4LA 3M0SA 4E7SA 4PQAA 1VIOA 2UUCJ 2CUBA 3HHLB 3CMET 3GTYX 3MUTP 1RKJA 1YJVA 4ELZC 5KFUA 1YFNA 3JQMA 2KXNB 3H7HB 3OTOJ 3W7BA 2DNQA 3PJ9A 1WSRA 4DL4A 4KGXB 3H98A 1H92A 1TZ0A 3QATA 3RR6A 1IWAA 3F73A 3G71A 1X9MA 4LBHA 1NPKA 2I38A 2RJEA 4LRAA 2YX4A 3LP0A 1MV0B 3HDSA 4JP8A 2R7RA 3SSSA 2HURA 3TWZA 3H90A 2QA2A 4CLPA 3LGNA 1VBKA 1RHJB 2ZPGB 3D68A 1GMWD 2MQNA 3T1HJ 3EGXA 1FWPA 3ULHA 1WC6A 3N79A 4OB1B 4FPIA 2JLFA 3CDAA 3EZOA 1ZM2A 3HHLA 4RBVA 3INZA 3NOGA 1IR1A 2HQFA 4M7AF 4YMEA 5H9FJ 2GQVA 2L3MA 2WSEC 3NS5A 2EKOA 4ICLB 4X65F 4J9QA 1MNDA 4ZGEB 4IYQA 3M6WA 3QFHA 4B9UA 2F65A 4USVA 2IA6A 4J9NA 1YITQ 3NMRA 3JCMb 1U0HB 3BKUA 2K06A 3LWIA 5E3RA 3DC2A 1H641 1VUBA 1VFJA 1FJ7A 1ZA2B 3AJ1A 1ZM3A 4JJBA 1VQ7Q 1T02A 1CEZA 3H8ZA 4B3TF 3VV0A 4UTGA 1VCTA 2C2NA 4Q45A 2P9GA 2X7IA 2UVUA 2FJXA 2U2FA 5E3AA 4FP9A 1Y9OA 3K58A 2KG0A 2QASA 1LXJA 2ILYA 4JI3F 3CCLQ 4EO6A 4IIOA 5GMKl 4M8LA 3RUBL 3EH2A 4HXJA 1FKPB 3PHEA 1VQPQ 3RKXA 4B3SJ 1TUVA 3RB3A 4FYVB 3MPWA 4F02A 3VV2B 2ZJRQ 1ZUUA 5HO4A 3MCOA 1IXKA 2HIYA 1LWCA 4ID5B 5FLXY 4X4TA 5GAOq 3JCMe 1Q7YR 1VQNQ 4LRFA 4ECYA 4MMKA 1VLOA 1VR6A 2DGTA 1VRUB 2D74B 2ZJPQ 2E7WA 5J1EA 2H4WB 2GFAA 4NLOA 2W24A 2EC2A 1U6FA 5IV3A 3M8WA 3CC2Q 4DSLA 2D7SA 4RG8A 2NUHA 1S76D 2EC0A 1WJRA 2ZOMA 1S1XB 1LOUA 3FDSA 2CP0A 2YNIB 3M7VA 2YUOA 4ZPCA 2VD3A 1NEBA 1HBNA 5C24B 3JB9D 1MNEA 2AKKA 1V5IB 1WHJA 3MO8A 1V3SA 1GH8A 1QLYA 2WSFC 4ID5A 3ENAA 3M2RA 1N8RR 1S1WB 1UL3A 2EPIA 5HMZA 1VC6A 1NJIT 4J9OA 3FJPA 2DRAA 2QA4Q 2OD6A 3BE3A 1PJ5A 2BZ8A 2Z8QA 3GNFB 1VRUA 3SWNC 3M05A 4D6WA 2BJDA 4CLYA 2F4VF 1HD0A 4RTVA 3GONA 3CCSA 2ZWOA 3UR3C 1SH2A 3OV7A 2LX7A 2AV5A 1V1CA 2DEJA 2JW4A 3OY9A 4AG1C 3KK3A 1ZH5A 2LVWA 1IM6A 1WXUA 1IUJA 2AX1A 4XQ3A 2HQHA 3A3NB 1Q79A 2IBKA 1NKBA 4WFYA 3RKWA 4PK4A 4LIRA 3TNVA 3MM9B 5C24A 2HKQB 2HVIA 1U1MA 4MZPA 5LJ5h 1VQLQ 3MM6B 2CUDA 1IGQA 4NXMJ 1QD1A 4B3MJ 3BKFA 5B08A 2ZGWA 1S77D 2MAMA 2W1BA 3IA0A 5L38A 2DL5A 3FVYA 2CJBA 4LRBA 2SRCA 2FJEB 2OGUA 3EDRB 2VJVA 3FRYA 5J2MB 5C25B 5GADU 3GFXA 2CH4A 1B3QA 3I9QA 3PIPQ 1S48A 3E8OA 4LJMA 1REVB 3EHQA 4Z2XA 1H3HA 3MTJA 3LH0A 4LDXA 1FTRA 2FLOA 4P72A 2ZUAA 2MKJA 1YITS 3QLHA 1ABOA 3THPA 1XC9A 1S0VA 2RHQB 2IIHA 2AK5A 4F7UF 1VQ7S 3PY8A 3JCMJ 3QIDA 4ZK7M 3WBZA 3LWLA 4JRQA 2PMHA 3HRTA 2R57A 2X1BA 3W5XA 4E7LA 2JT4A 1RI7A 4OZ2A 1U3OA 2L9NA 4RUCA 1WJSA 1BWEA 2DNHA 1OZ3A 5LJ3g 1OQ6A 4AQYJ 3CCLS 2DGVA 2DBKA 1OEBA 1I5OB 2GCXA 3FJ2A 5K5MA 1VQPS 3MR3A 4NLUA 3FBEA 3BQ2A 3ETMA 1REVA 3MMJA 4EBDA 3NGUA 1LQ9A 5IN1A 2R2SA 3PW4A 4A47A 1D0ZA 3UCZP 3JTNA 1XOVA 1JNZB 4RW8B 2EK6A 5DM7Q 4DL6A 2D3ZA 3NXZA 1C0UB 3UPUA 1FRLA 2V2VA 1VQNS 3PFOA 1ZHIA 2QN6B 3JB9H 3Q8PB 2M2BA 3AODA 3RJMB 3E2UA 4LXCA 3VAGA 1W4SA 3SMZA 3M9QA 3MEUA 4FU6A 1VQYA 1N34F 4PNOA 3SZ2A 5IT9U 1WWHA 2FVCA 4DL2A 2QLFB 5AJ3F 1IZ6A 5D6YA 1QTNB 5BR8F 4M7DE 4OX8A 3KLEB 4ZLJA 2LP4A 3MHXA 5GAOr 2ADBA 4ZCIA 1K0VA 1CPZA 2GIRA 4DSJA 3TU4K 3CC2S 4KT0C 2B6AB 1XMOF 2DF6A 5HP1B 4AL5A 5AE2A 1EZZB 4J9CA 4XO0A 1NAQA 1KJWA 2XMTA 3K59A 4GLMA 3SHWA 4MTPA 5GAOl 1RT7A 3CJ8A 2HK2A 4HVVA 1FDAA 1OPIA 3ET6B 4IH5A 2CZ1B 4RW8A 3SCJE 3TRGA 3CD5A 1WJ9A 4Q7AA 5J2PB 2QA4S 5FU6C 2V8KA 3HFZB 4RPFA 2G4BA 3C46A 2K5LA 2ZBCA 1WHGA 2DEIA 1N52B 1GFDA 1ZSGA 1P1TA 3CXCA 3O6QA 1T8EA 2HG4A 4X84A 4J7CA 3ZTQA 4G6VB 4MIBA 5KFPA 2DJWA 5LMNJ 3TZWA 3KLEA 4Q5WA 1YCYA 1N0VC 1VQ5Q 2CQ4A 3AQOA 1XNRF 4RTYA 4DEZA 3HFKA 4USWA 2B6AA 5HP1A 4EUVA 1ZSZA 3F56A 3M1VB 5LSRA 2E6NA 2YKAA 2XO7A 3OL8A 1PC0A 5JVGQ 1BY9A 1VQLS 2GCFA 4TYBA 3HPOA 5G0RB 3J7AF 3C16B 3W9IA 3G8SA 2YRDA 4OI6A 2BX6A 4DX6A 2FRYA 3H59A 1TL4A 3QT5A 4DQIA 1SIWB 3QIPB 1BIBA 4LF8J 2MY8A 1YJRA 2OMOA 4DFMA 2MQPA 4ELYC 1GFWB 3W9JA 4A8OA 3RNJA 3DYAB 3C0CA 3DI6A 2JFKA 4NCGB 3AJ2A 3B78A 2KXDA 2K3YA 3OTCA 1YI2Q 1L3KA 3NWGA 4PCQA 2YUQA 3V7CA 3M1VA 2F40A 3HFVA 4YN3B 2JZ2A 2YKPA 4BE1A 4DSIA 3TUJC 4DL7A 2X4JA 1LV5A 1YITA 1OIAA 4M7AD 2M52A 2C22A 2JTMA 1XJWB 2EJ9A 3ONQA 1DHMA 2BA9A 1VQ7A 2PI5A 3CDWA 1LPLA 5F8NA 4LVNP 4PYDA 4M7DD 2MQ8A 5C2GA 4W92B 1E6VB 2R7QA 3FRZA 1AVZC 1XEZA 2JTFA 3RIRA 1TL3B 4GVBB 4UQGA 2BJ8A 5D7UA 1YBTA 3DYAA 3Q8YA 1RUWA 3CCLA 4I64A 2XNQA 1KQ1A 3QQCD 1K9AA 4CO0A 3BJYA 5CKEA 1XNQJ 3UT1A 4ES2A 4KRWA 2UUTA 2HHPA 2IA0A