2ATCB

Crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
152
structure length
152
Chain Sequence
b'MTHNDKLQVAEIKRGTVINHIPAEIGFKLLSLFKLTETQDRITIGLNLPSGEMGRKDLIKIENTFLSEDEVDELALYAPQATVNRINDYEVVGKSRPSLPERNIDVLVCPDSNCISHAEPVSSSFAVRRADDIALKCKYCEKEFSHNVVLAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
molecule tags Transferase (carbamoyl-p,aspartate)
source organism Escherichia coli
publication title Crystal and molecular structures of native and CTP-liganded aspartate carbamoyltransferase from Escherichia coli.
pubmed doi rcsb
total genus 6
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1982-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2atcB02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2atcB01
1RAGB 1F1BB 1R0BG 1RAHB 1RAFB 1RAEB 2FZGB 2BE9B 1TUGB 1PG5B 4FYVB 1AT1B 4F04B 8AT1B 8ATCB 1Q95G 4KGZB 1EZZB 2QG9B 1TU0B 4WTOB 4KGVB 1RAAB 4KH1B 2HSEB 2QGFB 4E2FB 6AT1B 2BE7D 2FZCB 2YWWA 2ATCB 1RADB 2AIRB 3MPUB 1RACB 4FYYB 4KGXB 4AMCA 9ATCB 2AT1B 7AT1B 1D09B 2FZKB 4FYXB 1XJWB 1NBEB 1ACMB 1ZA2B 2IPOB 1RAIB 4FYWB 1R0CB 5AT1B 4AT1B 1RABB 3AT1B 1I5OB 1ZA1B 4KH0B 1TTHB 2H3EB 2A0FB 1SKUB 3D7SB
chains in the Genus database with same CATH superfamily
5HP1B 3SWNA 3S3OA 3FEYB 4FNIA 2CH4A 2DH8A 1X7VA 2ALZA 4K4ZA 1NBEB 3DXSX 1UJYA 1DFDA 2DH9A 3VUBA 1I5OB 2FRYA 2CZVC 3ME9A 5GMKe 1YJ7A 2D69A 1T05A 2QMUB 3JQMA 1VQKS 1SKWA 2RF0A 4YQWA 5A0LA 1LNQA 2FVUA 3PX4A 2RMLA 2OSRA 4M5GA 1HWLA 3FUYA 4DR7J 3TARA 4LT6A 2PFDA 3QGPA 2CZ0B 3U1NA 2HVIA 4AFFA 1B7FA 4I67A 1TV6B 2R57A 2VXFA 3MR7A 1LJOA 2VC8A 1CC7A 1TKXB 2AW0A 3L3CA 1VK8A 1G1XA 4PK4A 1G6BA 5GMKi 5BR8J 4OHZA 3MM6B 2VDHA 3EGXA 3HHDA 1KHIA 4Q2MA 2A2CA 3CNQP 2UVVA 2KXDA 3ICLA 4LIWA 3MPUB 5J1EB 4MZPA 4V1Ak 1S1TA 2ECZA 3MFIA 4E0DA 3ILLA 4MFBB 2QA4S 3MD3A 4M5NA 3CBMA 1L3SA 4Q43A 1JQGA 1S10A 3D68A 1CJTB 2B56A 1CJKA 1F9FA 2VG7B 4ANJA 3A12A 2ILYA 4A8XA 5GAMg 4DL5A 1CJUA 2CNNB 2DERA 3DOLB 4Q0BA 1H0HB 4NYZA 1TSFA 1T11A 4MKVA 2CRLA 2F8MA 2FB7A 4IG3A 4ED6A 2E12A 1PC5A 3SI8A 2DR8A 5D0EA 1S1UA 2K79A 1YJWQ 3M7VA 3ULHA 4UZCA 1VMBA 2V1QA 2VQEF 1NJIR 4WPAA 2R7UA 3B6BA 5KTQA 1VQMT 3BH7B 4O6JA 5FLXE 2Z2LA 1QVFS 4A4HA 1BKBA 1UA0A 5KFWA 5GAN4 2ZBQA 1PSFA 5GAOq 2KMTA 1IKYB 3FRZA 3VKIA 2CT4A 3A1PA 1K4US 4KGXB 2J9EA 1ICEB 1LWEA 3TZYA 4C8QG 1Q8IA 4GKKF 4DA4A 2KXFA 4Q45A 5I3QA 5KYUA 1U1RA 4LDWA 5A2QY 4IUFA 2CQCA 3C6UA 2FHKA 2PMWA 2V69A 4M7AE 4HCKA 1FHTA 1S59A 2E29A 3HHLD 4F25A 4M5DA 2L3SA 3V7RA 4P72A 3MEWA 5LSOA 2A37A 1SB6A 1VQKT 1TUVA 1TR0A 2KYZA 2NYIA 1J5OB 4QW2A 1RAOA 4OFZA 2ZFHA 3GV5B 3ZNJ1 3H2LA 2MKIA 3PKMA 2DEQA 1JXVA 1UETA 3IMQJ 1YHQS 1A9NB 3GIIA 3MEUA 5FIIA 2E66A 1ABQA 3A5ZB 4JI1J 2L3RA 5LJ3e 3TA2A 3CCRA 4TLQA 1K9MT 2KDOA 1RTZA 2DY1A 4U7UD 3EFRA 2R7XA 1DBDA 2ZCFB 4ETXA 3KFVA 3JYTB 3NPFA 2LP4A 5A8KA 1XN9A 4HL9A 1PGZA 1J2VA 1WHHA 4YMEA 3M55A 2B3TB 4ATNA 2HNZA 5C5JA 4B3MJ 2I38A 2EKOA 4EO8A 1M1KC 1GCPA 5AE3A 2C0TA 4U7UK 3C14A 1GNKA 1N34F 1IGQA 3U27A 4K4SA 3CMEA 3HSJA 2FVPA 2OPSB 1YJRA 1GX6A 1UAWA 2IMOA 1IBKF 2KG0A 5HSPA 2MKKA 4P52A 1BYMA 2VH7A 1UWAA 1K47A 4K4YA 3NY0A 4R0JA 3OFFA 4DPXA 1Z1ZA 1HNVA 1O6XA 3OPKA 2V8GA 1VIFA 1VK3A 2GQQA 4GO5X 4PJOD 3W7BA 1QY7A 3V5RA 4PJJA 5EUHA 1ZAVA 2X3XD 4LF6F 1Y96A 1VBKA 1RAHB 2B9XA 1IZ6A 2XI3A 1YI2Q 4FSSA 1IWAA 1LNXA 4B9VA 3RR7A 4I6WA 2XIDA 1NPKA 4LR7A 4LDUA 4FPRA 3CC2S 1ZA2B 2HZAA 2DHHA 4ZPAA 1ZZNA 1JLEA 2PGCA 1FXDA 5GAEI 5DDQC 2MGZA 3EPGA 2V2VA 4DBQA 3P96A 2P4TA 1LWCB 2EVRA 3BGLA 1QUPA 3LP1B 5FDLA 2DK3A 4RL1A 2QN6B 2R7QA 1SC3B 1KBRA 2BQ3A 3D0HE 2RJDA 1JJ2P 4LRDA 2FHOB 3GF5A 1VQ8S 1ZAWA 1KQSS 2BE2B 3BGRA 2ZEJA 2O2OA 1BI3A 1NK5A 1H6KX 3FJPA 2M9KA 4RMOA 1UFWA 5FWCA 3PDNA 3UD5A 5KFHA 4Q8FA 3IWNC 4K59A 1X4DA 3CC2Q 2M3DA 5B0DA 5GMKa 2AGQA 2FJAB 5LXYA 2M0OA 2CJ9A 2YWFA 2X3GA 2HEKA 3LANA 1NH7A 1N0VC 4DPUA 2LEBA 1VQNQ 2EK1A 3I56S 4LVNP 3DYAA 4LDYA 4PJMA 2OLWA 3G1JA 3IWXA 2V8HA 1VQYA 2AKWB 2MJNA 4DF8A 2PSZA 2LRQA 1TL1A 2P84A 1JIHA 3A8IA 4WCEQ 5HMXA 4OHWA 4EMHA 2IJNA 2BYCA 3JAMY 2HHHF 2BJ9A 2YX1A 2EYXA 2N3LA 4KGVB 2HQHA 1RT2B 5C24B 3GJSB 4C8QE 4J6WA 3J81E 4QYZJ 2VBZA 1RUWA 1WHGA 3OR2A 1K8AT 4B9TA 3KLEB 1U25A 1X8DA 2OPPA 3CCVS 2LU1A 1SL1A 1IN0A 2VWFA 4XTUA 3M8PA 3D3BJ 3TZXA 3OUYB 1VQ7Q 3VRZA 3OYHA 1VQ4S 3LF0A 4KHPF 4D6WA 4JS5A 4DZ6A 3K59A 1DJ7B 1B7TA 4OYOA 2G0IA 3V8JA 4GKKJ 4YN3B 3LW5C 1RWXB 2L48A 3AAWB 3MCNA 5LJ5d 2Z8QA 1HBOA 4NZ0A 1C6VX 4OZ3A 5LM7E 5DM6Q 1RYSA 4ZCMA 3CJ8A 1FFGB 3TAQA 3CC2A 2B8QA 2DRDA 4ZA1A 5HJXA 1VCTA 2JL9A 1RWMB 4GMKA 3ZL7C 1JMTA 4CYUA 3O3LA 2E5JA 1S6QB 2E3HA 4W98A 3GPLA 1RI7A 3H5XA 2DVEA 2DAQA 4JOUA 5HO4A 4F7VA 1HHTP 3C3LA 4DOWA 2V2ZA 1G3OA 4CC4B 2B6AB 1ZSZB 1RTIB 5HMYA 1TUGB 1R7IA 1TK0A 2L9DA 2H4WB 1YJVA 1VQ9Q 5MLCV 2KVQG 2AZ1A 1HL6A 1LWCA 1OPKA 4J91A 1S4FA 3R7NB 2QQ9A 2CA9A 4DL7A 2FLLA 2RS8A 1DQ9A 2LC4A 4YR2A 2XYPB 1TWBA 1X6BA 2HLTA 3FKBA 5K14B 2RMOA 2W2PP 2DHSA 2D3OR 4R5PB 4M7AC 3CD6T 3IR6B 2IDLA 4PAAA 4WCIA 4J9CA 4LF1A 4I56A 3EGXB 3VALA 1XWLA 5DLGA 5M2RA 1JLQA 4FW2A 1RUSA 5CQYA 1FCAA 3QLHA 2XTJP 2GMJA 3S01A 4C11A 4C8ZA 1QAIA 4YTLA 1WYXA 2KFYA 2QGGA 1B99A 4KV8B 5H1SV 3G6VA 3PHTA 3I0SA 2KGTA 3RB0A 2PUOB 3L2WA 1VYTA 2D9OA 2B86A 1X6GA 4OZ1A 4J9NA 2LCSA 4CM2A 2M88A 4ZN1A 4KH1B 4IURA 4PXBA 4RX6A 2YKOA 3G71Q 2DTIA 2CS7A 5KT6A 2FC9A 2B9WA 3NP5A 3R2CJ 1TG0A 2AU0A 4K4UA 5D77A 4V19X 1NJZA 2HLUA 4F7UA 1URNA 4X84A 1OU8A 4P73A 3K58A 1FRLA 3RR8A 1DTTA 3KLEA 2V4JA 3PTAA 2HVEA 3QJPA 3QPIA 4YUDA 2CADA 2M5YA 4E8UA 2VQEJ 2XGQA 4A4JA 2CPJA 4LDXA 2GAHC 1AZSA 1YGYA 3G8QA 2HFZA 5KFJA 3MP1A 5A6WA 4K7QA 3MXHP 2IRYA 1C1AA 5KT2A 1NJYA 3JB9D 3TA1A 4LMZA 3RB6A 3KKFA 5HMZA 2XHCA 3PVQA 1HQUB 3C0CA 3VQSA 1T9VA 2XO6A 3CXCR 2IYIA 1EHWA 3N9UC 2XO7A 1M2VB 4XIUA 3RB3A 1HFEL 3DOMB 1TELA 1X9SA 2QV6A 4JYAJ 1XNQF 3MURP 1VQ4T 4F14A 1Y3KA 1TKXA 2J76E 2D0QB 4OYMA 1NHKL 5DDOC 4JLGA 1Z9ZA 1VQ6Q 1WLPB 1BQNA 1K8AC 3BBBA 8RUCA 2DZ9A 4UTGA 4DR6J 1D1BA 4URQU 1E6VB 1NKEA 2OPRB 5KT3A 4M5HA 5LL6S 1N6QA 4QW9A 2L89A 1UVMA 1QTNB 2C2KB 4U95A 4ZVOB 4BHQA 2CUDA 3VAGA 3JCMg 1OIAA 5CYJA 4Y0FA 3BDLA 3DFEA 3HRSA 1NUEA 5C6SA 1ZPWX 4UY85 4CLTA 2CKKA 1YVFA 3I5BA 4HCBA 2C1EB 1UVKA 1MUZA 1QJHA 4F26A 1KWMA 2A3JA 3E8OA 3PCOB 3KHGA 3HKWA 2EFPA 2XCAA 1MMNA 4M7AF 4FT2A 2KFZA 3NEKA 2ZHOA 4A54A 3L1AA 1UW9A 5HANA 4FKXA 2FHJD 1Z2LA 3SEMA 4R0EA 1KJWA 3MR6A 1KFSA 2F5GA 2L2PA 4C8NA 1O5JA 1T9YA 2C3MA 3W61A 1YCYA 2J7KA 5ETSA 1F2HA 1E6GA 2VC1A 1VA7A 4FP9A 3BSOA 1IM6A 3MM5A 5D0HA 2OPQA 3I87A 1NB7A 2Y4YA 1RLPC 2ZPGB 3PMIA 1FI4A 4QCLA 1VLOA 3T41A 4WYWA 4OI6A 3Q1JA 4J7IA 3QDFA 2RB6A 5IWAJ 1R8AA 3SDZA 1NH8A 3REBB 2GHVC 4OX8A 3EZ5A 5IHIA 1M8MA 3X3UA 4I7FB 3RGIA 1S76D 3CJKA 5IXBA 2CPDA 3CMEQ 2RA2A 3AB2B 4DLEA 1GTHA 4C8KA 2LNVA 2YHTA 4ALZA 1SH0A 3OXLA 1U4BA 1HQEA 3L09A 4OMMA 3T9NA 4IUTA 4I6AA 2Y9HA 5DJBA 3DU5A 1UDLA 2VASA 5IFMA 3GNGA 3ET6A 3NHNA 4B08A 1VQ7T 2V8PA 3LW5E 1VBZA 1HWJA 1KHWA 4ZPBA 2VBXA 1S0OA 1B34B 3UQSA 1O51A 1GMWA 4N4IA 3CDAA 1M27C 4FYWB 1YJ9T 4B9XA 2M2BA 2GJFA 3JB9k 2L3PA 2CQ2A 1SF9A 4KGZB 1YWXA 4I2QB 2B9EA 1PJ6A 4X66F 2W9CA 4AFZC 1X60A 4FYDA 2DA9A 3S8SA 2VG5B 3MCAB 4M7DB 1T3NA 1VC5A 1VQOQ 4LDVA 3LGNA 1HBUB 4X1VA 4Z89A 3I32A 1N5ZA 4OI1A 4F04B 3QUIA 3MMAA 3U7JA 2FTRA 2L8DA 2R5MA 1YWOA 4IOAQ 1FE0A 4QIEA 4JJBA 4RW8B 2UXCF 2XZTB 2KXCA 4RTTA 2XLKA 4NXMJ 4Z37A 3FK4A 1B0VA 2BJDA 3A8HB 1EQ0A 1KQSP 2B7BB 3UNGC 4JDSA 2AEFA 1HNWJ 1KFZA 2X4YA 4U8YA 2ENMA 4TYBA 3FSXA 2Y8WA 2X4JA 1GCQA 1Q81C 2HFSA 4QQ6A 3MMJA 1HPZB 1ZYQA 2DIUA 4JS4A 4ER8A 4M75B 4ZHRA 1U09A 4C0DB 1UGQB 1APSA 3D4JA 3GILA 4YOEA 2QT7A 2AGPA 3PMTA 3LAMA 2H1YA 5KCHA 4MYTA 1ZTTA 2CPXA 1AD5A 1PKUA 4MDXA 4DCJB 3OS5A 5C42A 5D6YA 1GXTA 3D6FB 4EBDA 2D9PA 4P7TA 4C98A 4RNFA 3V81A 1D0EA 1SEMA 5M2PA 1JKHB 4HH1A 4QIVA 2IIMA 4JI2J 4ETZA 4WK3A 2EFQA 2LX9A 1FJGF 3P8DA 2EJGA 5JXSA 1U26A 2NSBA 1KFDA 3W66A 2KFNA 4QU6A 2EFVA 4I2QA 1S0NA 2F3JA 1S12A 3CJ0A 1QVGA 3OTOJ 1HNZF 3LWIA 1REVB 3HLUA 1Q81R 2HNZB 4OB3B 1MROA 5I2MA 4B3MF 2Q3PA 2OAUA 3DGVA 4QQGA 3HSBA 5F3ZA 1BB9A 4EI2A 3KK2B 1S77D 3BR8A 2YNIB 5IC6B 3M32A 2VPYB 2VKZG 4C6AA 1IREB 2VB6A 1MU2B 3K17A 4PNOA 2RQVA 4PPDA 1RI9A 1LXJA 4NA3A 2PN6A 3CCLS 4IR9A 2MZTA 1X0FA 3W9IA 1K8AR 1X6OA 1QUVA 5KFTA 4DU8A 4ZGDB 5DZ6A 1BCOA 1AHJB 2N7YA 4U96A 4IYQA 5I22A 3OR2B 3OYGA 1U3OA 4PLLA 5KOWA 1FKPB 2Z56B 3INZA 3OFHA 3GV8B 3MAHA 5I2SA 1WELA 3CD0A 1RCOB 2R8JA 5CKBA 2N82B 2P4RA 5IM0A 5E0OA 1BQMA 4CH7A 3SHWA 2CXEA 1SPKA 4KHPJ 2DR7A 5IT9U 1TXQA 3VGUA 3HD2A 5D6XA 1MHNA 2LDMA 2HFNA 3MZIA 2LXIA 1FTCA 5KFBA 1QSSA 1X4GA 3FC9A 3HD1A 3IR5B 4A4FA 2EYQA 5IXUA 2JXBA 4I0WA 1VQ4Q 3IS9A 3A3OB 1RLQC 3A4TA 3WXMB 3HJFA 2LMIA 5GAOl 5KFOA 4RBUA 3F41A 4N0AA 1NCLA 3HHLC 1UA1A 4X65F 4ZP7A 3KBGA 2VPXB 1YX2A 1NDCA 2R3VA 1H98A 2ZBIA 5I42B 2ZPEB 1HYSB 4NCGB 3M54A 4ZVUB 4EIKA 2D1CA 4AUKA 2HFVA 5EDWA 4BLGA 2CGHA 4C0HA 4EYHB 1T0HA 1Q16B 1JJ2A 1FWZA 1RHJB 4A8MP 2OGUA 2YWEA 4F7UF 1YJNS 2VICA 4ECQA 4X4OA 4HACB 1CKBA 1AUDA 1FERA 1CPZA 2CREA 2WSCE 4WJBA 1SCJB 2D8HA 2YKNB 1KLNA 4YS2A 3NCQA 4DXLA 2LCWA 3SQOP 1JKHA 3R1HA 4H54A 1VQ5T 3UPFA 2QRRA 2MLXA 1QWEA 2CUBA 1M90C 1VISA 2BMBA 2P6SA 1XMQJ 1BQNB 3CC7Q 4NS5A 4TU7A 1GX5A 3RIRA 2KNBB 4QQBA 5EC7A 3B78A 1LWFB 3O5ZA 3I5RA 3G96A 3FB9A 1TK5A 1Y07A 2C2NA 3NNAA 4J9QA 2GQVA 5F9NA 4WE1A 4IRKA 5JJBA 2HS0A 4KO0B 1NEGA 3TO8A 4JJCA 2OTLQ 3E9FA 4EWTA 5B0CA 2E5IA 3CJ2A 1FD2A 1FDNA 1YJWT 1Q1KA 1DTQA 3WVDB 2HL5C 5D15A 2EG2A 4DOZA 3JCMV 1VQKA 2G3RA 2W2QP 1N36J 3CMET 3M8SA 2GGRA 1LKZA 1N8RR 2HWIA 1HBMB 1G3TA 4C0FA 1PD1A 2K7AA 2O31A 4B6MA 1IXDA 3JCMP 3UN3A 1TS9A 1NSQA 2EQUA 5DGBA 4TU8A 1JJ2R 1VJQA 4MDWA 2RT3A 1VQ6A 2KQWA 4L75A 3GU0A 1U49A 5B0FA 2J8SA 4RWXA 4F4AA 5CAAA 3FEOA 4KBMB 4MMLA 4ED1A 2R4FA 1HW8A 1U0SA 1VS3A 3SCIE 2QYZA 5KYWA 3G87A 4O3OA 2X1AA 2XYGB 1RHRB 4J6XA 3OTBA 1XNIA 4H4OA 3G4SA 3QPHA 3HSZA 4PL6A 1HMVB 1WACA 4LIRA 2MGZB 2MKYA 1OX9A 3NCPA 2F8EX 1YRTA 1FX7A 2R5AA 1M1FA 5E3AA 4DL3A 3VAHA 2RSQA 5E7OB 3URGA 1ZUKA 5LMNF 2P9EA 4I1TA 2YWGA 3X24B 3GWCA 5CABA 2E7VA 1NYFA 3CCVQ 3BF4A 4HR2A 4GO7X 1HJDA 1FVQA 3ILIA 4QIGA 5CCAA 4Y3CA 5A0GA 1K0SA 4X62F 2E1AA 3UATA 3QZ7A 3KDNA 2RB7A 2M02A 2L0AA 1EKRA 1OPLA 1U47A 5ETMA 3IQLA 3UPUA 4F4YA 1VLYA 4P2XA 1G7CB 2JM8A 3CJ3A 1Y10A 5KFGA 1XQHA 1VQ7S 2R58A 2X1BA 4Y2MA 1M5OC 3DLKA 1K9MR 4TXSA 3C6TB 3HL8A 3OYKA 5KYNA 3MM5B 1XQIA 3FJ2A 3CDUA 2W9BB 2HK3A 4DSFA 1RDRA 4USTA 1WQ7A 5GAOr 1M1KU 1KP6A 1SI9A 4ILRA 1B0TA 5DY9A 3AD8C 5K5MA 3I5CA 2XLJA 1VQMQ 4OP0A 2MQNA 3C46A 2H65B 3OVAA 4DCPB 1KVIA 2YKPA 3SIPB 3ZZ0A 2ESWA 3G4SQ 1NZAA 5A0YB 4P2MA 4DX5A 3GONA 3HM9A 1HA1A 3KNAA 3RKWA 4WWSA 2GMLA 3VAFA 1IR0A 5T14A 2EW9A 2KT2A 1M1GA 2LEAA 4C92F 2EXUA 4D8KA 5FDLB 2UV8A 3CMES 4XK8E 3R5GA 5LT5A 2DL5A 3L7OA 1RK8A 4JI3F 2VFSA 2CZ1B 4RTYA 4RNMA 3NGSA 4ZJQA 2X1FA 2RDIA 4F7UE 3Q8SB 2W8LA 4K50A 4FF1A 3RW7A 5D6WA 2LMJA 3DXBA 2CZ4A 1F1BB 4OMNA 1U6ZA 2GIFA 4TVAB 4J9EA 3C15A 1NJIT 4PQAA 4DBRA 4DX7A 4A8FA 4CH0S 4ECWA 2Z30B 2HRUA 1KG1A 3M30A 5GAN8 2J6KA 3CC4Q 3C15B 4DUTA 2ZH2A 4G1PA 3SSSA 1VQ6T 3EGWB 2C0OA 2KXHA 3JSBA 1T94A 2LP5A 5KFVA 3KLHA 2WONA 4F67A 2CG4A 4FXWA 2YWWA 3ZXWA 1UEVA 2AKLA 2DFUA 3CVKA 2HVHA 4DV3F 2HMIB 2ABYA 4LF9J 4IDKB 1VBXA 1QVPA 3FZ2A 4A8KA 1NPRA 1AFJA 1WI8A 4YY3J 2KAFA 4E6RA 3NG8A 1BD6A 4Y2KA 3O1LA 1NK7A 4ED7A 4U67Q 4RPFA 1IKXA 3J7A1 1B70B 3EG9A 2EQMA 1BWEA 3THVA 2JJ4D 3QYYA 1PJ7A 4HVZA 3W3SA 2VBYA 1YP5A 2DYIA 3KWMA 3GLXA 1N33F 5FJ4A 1NZ9A 3UDLA 3UCZP 4WP9A 3HHLA 3MHYA 3PW4A 2FLOA 1MLAA 3QGGA 1SG5A 4EFAC 4GC6A 4CNZA 1QW1A 1YN8A 3GB0A 1PRLC 1MMLA 4N8NA 2FY1A 5J3BA 4ZS6A 4R56A 3CJRA 1OQ6A 1D9AA 4MTPA 2OH2A 4USIA 4ZPCA 2J9CA 4DV4J 4HCZA 3P45B 5CKEA 1N32J 5DQHA 4WU2A 1OYXA 3OMGA 2ERRA 4C3KA 4ZLNA 3L7PA 2YPYA 2QEXA 4G1QB 4DR4J 4JI0F 3FZBA 2FZKB 5H9FJ 3MTKA 2MEWA 4BS2A 3KUGA 1RA6A 2MY8A 2GS8A 5F8MA 3CMAT 5A0YA 4Z2XA 1PBAA 1HNIB 1BI2A 3ZBDA 4DU7A 2OFHX 1EETB 4EK2A 1CQNA 1NEBA 2WVCA 1NJIU 2NPFA 4PQUA 1ULRA 1WI7A 4QPXA 1CS4A 4ZNXA 1H7WA 3FQKA 3N6NA 1QKXA 2FO0A 1FD8A 1IM4A 5U47A 1UGRB 3M0UA 4PFPA 4DR7F 4PQUB 3WX4A 2AJ1A 4HYKA 4RJVA 2PQWA 1S9GA 1RTJB 1M3BA 2HHPA 1JXOA 1RTHA 3DOKA 2ATLA 3CCLT 4X4TA 3HVAA 2L3QA 1RLCL 1UVNA 4M5DB 2XICA 2X7IA 1NHUA 1YI2A 1TVRB 2KM8C 3C16A 1X43A 2JNJA 4K0KF 3QRQA 3M30B 3OL8A 3AHUA 1Q79A 3EH2A 2ROGA 3UA6A 3DKDA 4KBIA 1AXQA 1FNOA 5C0MA 2NXUA 1RWOB 5BYRA 1JJ2S 2FZCB 3HZGA 2DETA 1W25A 4MT1A 4C8QA 2IDEA 2LU2A 3HT3A 1IKXB 1BQMB 5KCOA 3M2RA 1NDLA 3RBEA 1NYGA 4PFOA 3CCLA 4CCHA 3OYYA 4DL0C 4JV2A 4JI4J 2HQIA 2P8IA 3J81j 1QSYA 2GC8A 1M90T 3LAKA 2G9OA 5HKCA 1DTQB 4ZP8A 1RA7A 1Y9OA 2NXNA 3UWTA 2J0SD 2OELA 4ECVA 1WC1A 4J9PA 1YITS 2WONB 1M1KR 2F69A 1MMGA 1OPZA 3FDRA 3EYZA 1R43A 2XMUA 1JRIA 3ZZYA 1UL3A 2DX1A 3P5BP 4NLDA 1M90R 2YX7A 1V5IB 2HHTA 2DJWA 4DV7F 2ZPHB 1VI7A 5HVGA 1B64A 3BDUA 3F70A 1T02A 2IFXA 3Q89A 3MM8B 4WFYA 1VYVA 4IFVB 1VQ9T 2BQRA 3CC7A 1PG5B 2C0IA 4J8OA 2LVWA 3DLEB 1PM3A 3OXGA 3GSIA 3QWPA 2V8KA 2NLWA 2HGNA 3K7RA 4L74A 4RUCA 1JEGA 4EPCA 2N4CA 1LV5A 3NS5A 4OX6A 1UEKA 2K2PA 5I3PA 3MD1A 2YKMB 2YUPA 2G13A 2GZOA 3NXZA 5JVGQ 1IBMF 4FKYA 1RTIA 3WX8A 1T8EA 2OTLA 4WE1B 1YIJT 2X4WA 1BQXA 3DDKA 1MW7A 2KRBA 4PG5A 4RW9B 1Q53A 2WSFC 4OX9F 1M90U 4J9VA 1JBMA 4NZ6A 4E47A 1WHJA 2X4XA 3ISNC 3CCUS 1QAYA 4B3RJ 4OB2B 1G4CA 1MNEA 2KYXA 4HHHA 3ENQA 4NLQA 3P8BB 2DJQA 3H4DA 1RACB 1SV5B 1FJGJ 2DGWA 1WG5A 5T7LA 5GMKm 4L3NA 3LPEA 3UWNA 4F36A 2UVUA 2QLFB 5CVIA 2J0QD 3R2DJ 4J6YA 2BBEA 4NMLA 4CNYA 2W9AA 4WZQA 4HHUA 3DOKB 2XQCA 3HXMA 2LDIA 3CW2C 2K3XA 4ZVTB 2ASDA 2VGNA 3CCJA 2Y4XA 1SC6A 2CT3A 3W2VA 2FG0A 3G71T 1NK8A 3VF0B 3AOBA 5LMUJ 2YQ3A 4WK1A 2C2ZB 3G71S 3DYAB 3J80Y 3HHLB 2VUGA 2KN4A 1N32F 5GANe 4IOBA 2DNZA 1DHMA 2AJFE 4MYUA 2OO4A 3MMAB 1OEBA 3CMAQ 2YQ1A 3MEDA 3EUNA 5E3RA 1ZETA 2RILA 4L3KA 3CCJS 1BXNA 4DL6A 2DL8A 4RR5A 1RT7A 5CZVA 3MEDB 1AFIA 2A0FB 5E2QA 2CVIA 1EIFA 1AZEA 4ZK7M 3NRBA 2W01A 2RDDA 1QP2A 2WVBA 1UPMB 3CXCS 4DV5J 2W7AA 3SCJE 3PW7A 5DZ7A 5EX0A 3M8QB 3CDEA 2D3ZA 4PR6A 1VR6A 2CVEA 1REVA 2ROTA 4JBCA 4G1QA 2RM4A 2MZJA 2KI2A 2QLXA 2E7XA 1IR1A 4ECRA 2GNCA 2JTMA 4ZDNA 2LQKA 4PWDB 1D8YA 4E7KA 3N5FA 1T7PA 3JB9H 4M7AA 3JCMQ 3DMJA 2V63A 2OP5A 3KHRA 4M78G 1SSHA 1R77A 1S72T 5KFFA 3CCVT 2VKNA 5K8MA 3T1YF 5I3UB 4X4RA 4MIWA 4DFKA 2A1BA 4O3PA 4TY8B 3O2IA 5ETQA 3NBPB 2O01E 2O5DA 2KBTA 1QAJA 5L9XA 4PFZA 3G82A 2XU8A 5K14A 3K2YA 4HH0A 4ZPDA 3CPWS 4CI0C 1OY9A 4GVBB 4JJNK 4RNOA 1X75C 2B6AA 1HI8A 3GBQA 4OZJA 2YY3A 4DLGA 3NNCA 2KVIA 4OYXA 1WEYA 3BS9A 1S7IA 3IRXB 2H54B 2HWTA 2CPHA 2EKYA 4DV1F 2A08A 1OQKA 2RF2B 5GADU 5CCLA 1NSPA 3CCTA 2JC1A 3AHPA 3WIVA 4PEOA 1UFKA 2IJRA 1WHYA 2PMHA 4AQYJ 2ZPBB 2MZRA 1HR0F 1IKYA 1YIJS 5J26A 4N0AC 2E5LJ 4PABA 4FW1A 4DV4F 1XNQJ 3DGPA 4O0IA 1P6TA 1IBKJ 4BE1A 4C0BA 2KJVA 2BJ3A 1HBNB 2RE1A 2UUBJ 4ZCKA 3KMSA 3MCMA 1RISA 2KTQA 1XMQF 1HIYA 4CYUB 2JFKA 2A10A 2FDNA 3R6LB 1FMWA 2E1MC 4FS2A 2HBZB 3TVTA 3HZEA 3QRPA 3TZZA 2O67A 2J6FA 3SB2A 3LH0A 1YJNA 2QLJB 4O5VA 4LF7F 3CC4S 2BUNA 2NUHA 2RKIA 2DGOA 1YJWA 1VQ5A 2ADCA 1L3UA 4ZITA 2M7SA 4B9WA 5GAMf 3NMZC 1ZM9A 5FROA 2OMLA 5ETKA 3G8SA 4FYVB 2HZCA 1TL1B 4X64F 1XC9A 2G6FX 1OI1A 5HCKA 1UUEA 3RAXA 4DCOB 4LRBA 4OL8A 1KQKA 1PNJA 4EZ9A 4JRIA 3QWXX 2K3YA 1RT7B 1RT2A 1AZGB 3J7YU 1DURA 1SC4B 4NZ7A 3MM9B 1S49A 1UHCA 2AJ0A 1RQ0A 5ETOA 2W4PA 2JMCA 4GRSA 3MMCA 3GCWP 1NK9A 5GADI 3V2UC 5FW9A 3KUHA 3GR1A 3G6YA 4LVOP 1S1UB 1Q86U 3MGJA 2WCXA 2FEIA 1MU2A 1M2OA 4FDFA 3D2WA 2OEKA 4J9IA 4H4KC 1W1FA 4K5SA 4U9RA 1CQMA 5F8GA 4XAKA 5GANd 2G0JA 3JAME 1WOOA 4Y91A 2B8AA 3Q8PB 3ZZTA 1X9WA 3CCMT 3PIOQ 3AA9A 4DL4A 2NYHA 3KDOA 4ECSA 5KT5A 1D0YA 1H7XA 2XMJA 1S9FA 3X25B 1S72Q 2ASLA 4CRIA 3BKFA 3SV3A 3MO8A 3CCQQ 2E5KA 3OYIA 1GXUA 3PACA 1R0AB 1GRIA 4ZLJA 5G0RB 1IWGA 2J05A 3MMBA 2QL9B 5LJ5f 1U45A 4OQJA 4ZMMA 2D7SA 2SEMA 1VQPT 4FBUA 2GCFA 1JLEB 3TI0A 4NA2A 1FT8A 2MQQA 3SMZA 3VS4A 4ZTJA 4WFNQ 4PCQA 2E9ZA 4F0MA 2ZBPA 4E7ZA 3VYHB 5KYYA 4AFUC 2DXCA 2IM1A 2MKCA 3OHBA 4J37A 2GBQA 3DI6B 1OX8A 3BYPA 3OFGA 4GVLA 1N88A 4QZVB 2N3OA 2OHDA 1VQLS 2MZQA 5AE2A 1W70A 3M9QA 5CD4H 2QC3A 4M8LA 5DLQE 3JQJA 1Q8BA 1C1BB 3JQKA 3LP0A 5HQLA 1NHVA 2O3DA 3M6VA 3M8WA 5KE3A 1SBRA 5KE2A 2IM2A 4E7SA 5IT0A 3CULA 2GW8A 2PVDB 1FK9A 1U24A 2GNKA 4OMPA 3QDRB 1Q78A 4JUZA 3FFIB 2AZSA 4ZPTR 3EDRB 4FIBA 4DPWA 4OGCA 1MG7A 4RW7B 1VQOA 1LW0A 3HHKA 4X4PA 3N28A 1JNZB 3PO4A 1ZHIA 1VQNS 1YTYA 4NLXA 1NLKL 2G2YA 3DLKB 2XMWA 1HARA 2YVSA 5EGYA 3CE8A 2AP6A 2RQUA 2HD0A 3DLHA 2K2VA 2V34A 4F3OA 4DFJA 2WVFA 3MI7X 3CCLQ 1WD6A 3LGLA 1AUSL 1SKUB 2ZOMA 4YEAA 2V26A 2HBYB 4C8QB 3M6WA 1WKLA 1M30A 3RKXA 4DR3F 3KG4A 2RQKA 3BFMA 4J7CA 5GANh 4J9RA 3T1HF 2OEMA 4GLKA 4CM0A 1FDDA 1S1VA 4TYAA 2YLBA 2CWXA 3TREA 2DNQA 1GMUA 4J9HA 3QT5A 2CZ9A 2XB2D 1IKWB 2HHSA 2H3EB 1G8XA 2PEHA 3UW1A 3QBCA 3ZO7A 4EUVA 1FJCA 1LCKA 4RTZA 2NSCA 5JMNA 1M1KT 4NLSA 2DRBA 3GFXA 4WIQA 2G2ZA 1UEUA 1Y0MA 4KFBB 2QK0A 2DK2A 1HBOB 5D4PA 4M7AG 5B09A 1WXBA 2F9JA 3GYXB 2M8DB 5D3GB 2IVMA 4Q5VA 1H2TZ 1F5AA 3H42A 5K9FA 3D54A 2GIQA 3R97A 4DSKA 2MJUA 3VGVA 5A8WA 4YDXA 4LNPA 4JI6J 3C6UB 3SYZA 1C1CB 1UTIA 1Q82U 1HQUA 4H4MA 3IBWA 3OQ2A 4IUPA 1GMWD 2BA9A 1W4SA 3UFCX 1OSCA 3ER0A 4DV5F 1ZM3A 2PUKB 2AQ4A 5AJ3F 2B4VA 4TKTA 2DIGA 3SQGB 5M2UA 5KG0A 2JOQA 3W65A 2LQNA 1W2BA 2MY7A 2WVDA 1DJ0A 1RT5A 3DM2A 1Y0HA 5L8RE 1JU5C 1VHFA 4C92D 5EG2A 4AL6A 4TVRA 3LP1A 2W8KA 5KG2A 2HNDA 1N5VA 2MCNA 3PX6A 5FLXY 4OYAA 4LFBJ 4B3OA 2LZ6B 2RK2A 2KE9A 2R8HA 1YIJQ 3TJAA 3MOZA 3VAIA 1HYSA 1X5PA 2XYHB 2RHYA 4FXDA 2J9DA 1SUQB 1S1WB 2FYKA 3W2WB 2DNGA 1JLQB 4DV0F 5LXRA 1ZUYA 2XLIA 2FL7A 1FKOB 3K8VA 4JI5J 2HNYB 3UCGA 1MNDA 2OI2A 4DF4A 2IIHA 2JVOA 4R25A 3ZTPA 4DUYJ 3MDFA 1WC4A 4JRPA 1WQWA 2KT5A 1S57A 1AWXA 2R7WA 3GP9A 2LQWA 4FM4B 1KC8R 2V8IA 4FF4A 4CRJA 4ICLB 4PJNA 5A8RA 2KRMA 2JRSA 3W9HA 4LBIA 1HNXF 3TSZA 2OTLT 1SJFA 3MR2A 2CJQA 4IFYA 3QXEB 4ES2A 1OULA 2ZBCA 4LFAJ 2KK4A 3TQEA 3KK2A 1UJ4A 2ZKTA 1BUXA 3QZ8A 3TUPA 5GAN5 2OD4A 2HGMA 2C2EA 4M4ZA 3QRRA 1Q82T 1REGX 5F0WA 2CKWA 4ZIVA 4ECUA 1RT5B 2WK4A 3QMQA 1OYDA 3QYGB 4OF1A 2DNHA 2VVKA 1M4ZA 1MGQA 1TTHB 1RHMB 5FD1A 2XNQA 3FSIA 3JSRA 2MYFA 2ZH4A 1N6AA 3I82A 2ZDOA 2MTLA 3ZFVA 4XU2A 2AZ3A 4Z02A 3BZQA 1D0XA 3BV8A 3OMCA 1VRTB 1GFCA 2J6SA 1I0CA 4NX9A 4K2XA 2M0GB 3DOMA 2LNHB 2PI5A 4A8OA 4GVBA 1QD1A 1KVJA 4CZCA 3Q23A 2E41A 2BVZA 3EFOB 3HO1A 2J7UA 2QA1A 1BC6A 1JLGA 4HHJA 3PKYA 2Y90A 4JUVA 3TYTA 3MPYA 1Y57A 1HYOA 1JLCA 1T03B 2CJBA 1VIOA 1WXUA 1UP1A 3IG1A 3W9JA 1W26A 4RWWA 5EWGA 3BQ1A 1RAIB 4M75G 3NFCA 3PT9A 5MAOA 4ED4A 1YI2S 2BDPA 4LF5F 1NU4A 4W90B 2UUAJ 2KEAA 5HP1A 2V50A 5KYUB 1JXLA 5GAN3 1QLNA 3I4PA 3FRNA 4HACA 5CH7B 3BJYA 4BI3A 4M78D 2GJ2A 4YY3F 5LJ5e 4UC4A 3T5LA 2ZBRA 1NG2A 1R8HA 2BOAA 2RJZA 4RLEA 4PPZA 4ZJOA 3HFNA 3OW2P 3GJRB 3N5BB 1GBRA 3MAQA 2W24A 3KLFB 1FRHA 5KFXA 4ZVPB 1I51B 1UMJA 2VGMA 2VU5A 1K0VA 4N4GA 4MFBA 4NMXA 1AW0A 2M1HA 1C0TA 5KFSA 1BE4A 3G4ST 1UE9A 5DG9A 4ECTA 2DT9A 4NXMF 1JLAA 2VC0A 2HQ3A 3M53A 2YNGA 4DV6F 1TQLA 2RHZA 4B9LA 3B4MA 1NLOC 4JI7J 1FFSB 1H3HA 2EGAA 1R89A 4C5EA 2C42A 1VDHA 3R5BA 4C5HA 5DDPC 3IFEA 3CCJT 4B3SJ 2W7PA 2Y1IA 6FD1A 4USWA 3CD6A 3QAEA 3KJNB 4KUDK 1XMBA 3I0RB 3HRUA 5EWEA 3KXDA 3TUZC 5E41A 3M8ZA 3CCMA 2OPRA 3I56Q 3A1YG 1LK5A 1HI1A 4NLRA 4C97A 1ZBXA 2X1GA 4L76A 5HL7Q 4CO0A 2IG0A 3OYNA 2XMFA 2E64A 2BZYA 1PBUA 4C8LA 1GTEA 1X2QA 4X4UA 3N79A 4M63A 3OHAA 3OJSA 3TVZA 2BACA 1NEEA 4N8OA 2W9CB 2JVVA 1VRTA 5L8RC 1QQJA 2EFIA 5CQXA 3AQOA 1TUDA 2QEXT 1RTHB 3QIDA 3PV8A 3E3XA 2WW8A 3PIPA 4ED0A 3AQPA 3EVOA 4LF9F 4F0KA 1UZHA 1JWWA 3QATA 3CCRT 4LBPA 3J80E 2Y1JA 4M77A 1SQFA 1PC0A 3L42A 4KT0E 4NLOA 3CB4A 4DV1J 2RRNA 1IUJA 3GCXP 3CPWR 1Q7YU 4GLMA 4QR1A 5CR2A 2DJZA 8ATCB 3UF4A 3GMGA 2AD9A 2AIRB 1PSEA 4DZDA 1RU1A 3BGRB 4NL5A 2DYAA 2DD5A 2KR3A 1K73C 2EJ9A 1KC8C 2HGLA 4ZKAA 3IP0A 1RTDA 2DD4A 3ZEHA 1AA1B 4IQMA 4DPOA 1KLMA 2XMMA 4J9UE 4AYBD 1JLBA 3E19A 4ES1A 4M75E 2ZOFA 5GMDA 4RW4A 4TQRA 2HHWA 3CJ4A 1V76A 2RJEA 4W92B 4KKOB 2KI7A 2M9UA 2XG8D 3PRVA 4L73A 2VYTA 3WDOA 2F4VJ 2JMAA 5IC4B 2RQWA 3G9CA 4FZVA 3PJ9A 1V5VA 4PG6A 2AZVA 2W1BA 3GFHA 2RD1A 4EMKC 3EGNA 1SHGA 1RBLA 2QASA 4A8YA 5THWA 4N47A 3GR0A 2HHVA 4TY8A 3DLLQ 2MQ8A 3H0PA 5C24A 1Q0NA 5F0UA 4UOCA 3RESA 1CJUB 4XTVA 2UUCJ 3QGHA 3EG0A 5D0RA 4X4NA 2G1DA 1AT1B 2ZUGA 2PO4A 2XSFA 2R9LA 5L46A 5KFEA 1RAAB 1TUWA 5GAMj 5IQ6A 1NK6A 3I96A 3NOGA 4LXCA 2L9WA 2QZ8A 2CP7A 5DQGA 4DR1F 1TFYA 2YXLA 2FPFA 4Q2LA 3UN2A 3J7AN 4DR4F 1ZZFA 2A36A 4UQGA 1T3LA 1VQSA 2CPYA 3TAMB 1TL3B 3KG1A 5CKHA 4UQTA 4DL2A 3GFYA 1R0AA 5ETRA 2D6FA 1RZMA 2B4UA 3JCMW 5HN0A 4EZ6A 1RHUB 1RLDA 4LSNA 2GQIA 2QQSA 1YCSB 4NRTA 3DRRA 3IG1B 2ZD1B 5AYFA 4K4WA 1KS2A 2AYBA 3A8GB 2C06A 2EKHA 1HI0P 5IAYA 4D3HA 3OFEA 4U6PA 2W9BA 5C2CA 4QW8A 2QIFA 3G82B 2UXCJ 2ALYB 2HQCA 2JC0A 1OO0B 5GAGU 4F4XA 4KJIA 1KN6A 2RF2A 4QYZK 2DRKA 4DSJA 3PFEA 2CYYA 1RAEB 3WC2A 1FMKA 1C0UA 1WZOA 2QJ3A 3CCUT 3SXLA 5I4MA 2MLZA 4KKOA 1PAUB 5GANj 1N5YA 2EGEA 1Y5IB 3CCET 2CFXA 4DSEA 2ZHAA 4B9SA 3GJQB 4RKUE 4X66J 3HJVA 3F0NA 1U8SA 1FKOA 4IQXA 3BN4A 3FLGA 3GIMA 3Q8QB 3G8TA 2DNOA 2LECA 4XDDA 2F8HA 3ZNUA 2NZ4A 3SCLE 2PDAA 3VZHA 3E2UA 2DKOB 3DKMA 5DS7A 3TVYA 1KRPA 1IKVB 2DNRA 2HG4A 4ELUA 2LEPA 4FXVA 3HPWA 3N6LA 2ZGWA 1HNVB 1PYTA 2J8AA 2BJ1A 5CZXA 3G4SS 2L9NA 1XNRF 2EBGA 1QCNA 2FPEA 2FJDB 5DETA 1S1WA 5HAOA 4ED2A 3DRYA 4PKCC 4PJOF 4R55A 3KXTA 4HDHA 1JXMA 3R3TA 1IBLJ 2XG8A 3R7BB 1YQHA 1KHCA 1RT4A 4USVA 3VHQA 1NAQA 3VAKA 1P1LA 1ZUUA 2UXBF 3D1HA 3W2VB 1D09B 3CCRQ 4QWBA 1YKWA 2V0NA 2OUGA 1WNEA 3TX8A 3IWLA 3K0JA 3DC2A 5B7WA 3UO0A 2ED0A 1RE1B 3JB9J 3P5TL 3GYNA 3C12A 4BACA 3H41A 1U2FA 2DXUA 2K3KA 4Y28E 4CO3A 5KFKA 1L3TA 2VJVA 5DM7Q 2DILA 4C92C 4OZNA 1XJWB 3CO0P 3FCVA 4FVMA 5ADZA 3OUYA 4DQSA 5I21A 2CUYA 1WHKA 3SZ2A 4HVWA 2DPIA 2JEFA 2VG6A 3DB4A 1D1UA 4HTJA 4B3RF 4ZIWA 2EBPA 4XU0A 2IHR1 3HDSA 2HRTA 4LQ9A 2HNIA 2PEBA 4RUGA 2JEIA 5KT4A 3D6TB 1YBTA 2PZ1A 2ZH9A 1N48A 4Y00A 2RO0A 4B17A 2HURA 2EFGA 3OSSC 1U8RA 2AMCB 2MMPA 3MCOA 3FSYA 4F0HA 2JLGA 1RJJA 1X27A 3UA7A 1S1XA 3DRSB 3HT0A 3SFGA 1D3BA 2FUG9 1SH3A 1HSQA 1WSVA 1KD1C 3WHIA 3Q2TC 2NR0A 5B0BA 4RW6A 2ZZMA 5BYQA 1WSRA 2V2QA 4KY3A 3M2VB 3TUJC 2DNUA 2AJQA 1V1CA 4P2SA 2FLNA 1LPLA 3BSAA 3POTA 3UI3A 2B0GA 2Q79A 3Q2SC 3M9NB 4WU3A 2D3UA 4LFCJ 4CLYA 3OYLA 4C8QC 3L2ZA 1IJEB 2QFJA 3BKUA 3UN5A 2R7OA 4JI0J 1FNXH 1O0PA 2MQPA 1GFDA 2BANA 5DDRC 4ECXA 1RAJA 2UUWA 3OA6A 3BKTA 2XD0A 1B34A 3J80U 1UFLA 3MECB 2BKNA 4JI6F 3OD2A 1J3TA 2GHWA 1A6LA 3RTVA 2C2OB 2Q6BA 4FYYB 2H48B 3L95X 4K4VA 4Z88A 4URGA 3FCHA 3MM9A 1YK9A 4OB1B 1Q82R 3G86A 2CQBA 2WOMA 3OBWA 2GGPB 4FS1A 2IVWA 1MN9A 3OXFA 1BGXT 2CJXB 2QA4A 1R8CA 3H25A 4WKRA 3CCUQ 2Q43A 3OYDA 2DL3A 2RJCA 5IT4A 1RI0A 1KD1U 2FB0A 3VGTA 2Y0BB 1A7GE 1IGUA 3C16B 3KJQB 2R42A 4KFBA 5GAEU 4DR3J 1IRXA 2DVIA 2XI9A 1C0TB 4JRQA 3OYMA 2O4XA 2XS7A 2DNYA 1S0VA 2YKNA 4KRTA 4C0ZA 1GXLA 1FKAF 2PFFB 1NM2A 2IRXA 4ORZA 4PJOA 1N4LA 2PVOB 3RAMA 4CH1A 3M58A 4DOVA 2AJ4A 4OB0B 2MWPA 3L9ZA 2HBQB 4NYOA 1S1VB 4E98A 5AXKA 3VQTA 3FMWA 4DV3J 2QQBA 5L1JA 2HBPA 2JVRA 5L1LA 1D9FA 3ETOA 2J7IA 1JB0C 4B3TF 1UWBA 2ZJPQ 3EH1A 2LXUA 4JB8B 1K1SA 4M5IA 3PJXA 1UCNA 3VTIA 3OVSA 3I56A 2CWKA 2BABA 4AG2C 2NXEA 4PKDB 3CCZA 1FX2A 1Q86C 2F9DA 1M5SA 4ZVRB 3IC1A 2WB4A 2VJUA 2KG1A 3V81B 1S5ZA 4Y65A 1NE8A 3CC4A 3MMCB 1IQTA 3CEYA 4N4HA 3H7HB 3MM7A 3T6JA 3KJFB 3HF5A 4BE0A 2CPFA 4O3RA 5I42A 2CQIA 4PZVA 4AFSC 2W0ZA 1OV3A 4NOYA 1C4AA 3O8WA 3DRSA 4LE9A 3TUIC 4UY8T 4KPYA 5IWAF 2YBVA 3SQGA 1H641 4HCCA 1F3FA 4PJOG 5HVHA 4A47A 2DYBA 4ZPVR 5CAIA 2FVSA 3GPAA 2MQMA 4C2MA 1E6VA 4DUZF 3VVUA 5F8JA 2ZJQQ 2KO1A 3MAAB 1FRJA 2D74B 3T5HA 3RRGA 2MAMA 4HT5A 1SIWB 5BJRA 4ELZC 1WORA 3IS9B 3T9ZA 4XPEA 1N5YB 1YLXA 4M75A 1V3SA 5IOLA 1RT1A 3MEEA 4OI3A 4M7AB 2K7KA 1YRUA 4MK7A 3BPDA 2KU7A 1FJEB 3HX9A 2NUTA 2EPIA 3ENAA 2NS1B 2EVZA 4OJ1A 3PR5B 4AG1C 2DE0X 1IQZA 4DV7J 1CJVB 2ZZTA 2XMKA 2QAZA 3CCEA 2FHJA 3EG9B 3JB9F 1FVSA 2V4JB 2I6WA 2JJ9A 4KQZA 5D7UA 1SRLA 2IJFA 3J7YI 4YHHF 2DEUA 7FDRA 3LYIA 2ZNYA 1WKKA 1U1QA 3EAEA 3CCMQ 3R5CA 1FDAA 1V29B 2IAJA 5GAN2 3BW1A 3PX0A 3LX7A 3V6KA 5CQGA 1J5EF 2VFTA 1XR6A 3JCMc 2FZGB 2VD3A 3OYJA 2DRMA 1HBMA 1YJNQ 4E7IA 3JCMX 4HEA9 2FGOA 2DM1A 3MPVA 2DR9A 3CD5A 4B3TJ 2OSQA 3VS1A 2KYMA 2GFFA 2CH4W 3MEGB 2L5QA 3UD4P 1WTFA 4RO0A 1T9TA 4O44A 3RAQA 3Q8RB 5CD4A 2D41A 4K0KJ 4LFAF 4M78F 3PRBA 5D4NA 4W4MA 3PIPQ 1BY9A 4X9CA 4WXWA 4PXDA 1YZ7A 3M8PB 3BYRA 1WI6A 2GJIA 3OR1A 4BUGA 1AROP 3HHEA 1QCFA 4JI7F 1KQSA 5LOQA 5HQ8A 3C4SA 4NE9C 3VUZA 2HQEA 1VOMA 4ZGEB 1NB2A 2RKIB 2MMYA 1RWWB 2CP0A 2JTFA 2PU9B 3M1VB 3BREA 3ITHA 4DN9A 1X2KA 3NL0A 2PA3A 5K8PA 1ZM4A 4M77G 4RKUC 4DJBA 4ANEA 2MZ1A 4HTIA 4LSLA 3H6ZA 2H8HA 2FJEB 2P6TA 2C22A 4DPYA 4UUWA 3SV4A 1UPPA 2ZM6F 1N56A 1RTDB 3IN5A 5E3QA 4Y2CA 2Z0WA 1Z4UA 5F41A 3L2UA 1I3OB 2VFVA 1RKJA 4GKJJ 2JS0A 4RTUA 4XTXA 1S9EA 1WHVA 2QEXQ 3CCQA 3KNGA 3M8RA 2ZM6J 4C8QF 2N4DA 4NWBA 2HHXA 2XM3A 3SDEB 3G6XA 1QVGP 1IXKA 1ZAXA 1R31A 2FD2A 5KG1A 2YTCA 1V9OA 2PIIA 5FWBA 1BWVA 4R0KA 3DN9A 3HHTB 2AWZA 2R8GA 2E4HA 2EIFA 3J7Z5 1JLFA 5LMNJ 4CO4A 1TL7B 1PIEA 1KONA 3GOXA 3BR9A 1KD1R 4DMZA 2L08A 3JSMA 1F0XA 3VJPA 1VQPQ 2H5EA 1HW9A 4C3LA 3BO2A 3TZWA 3M8QA 3A13A 1AYEA 4UOGA 4WTOB 2WBMA 4H4OB 4S0MA 2IM0A 2M52A 2XWYA 2ZH7A 2DD8S 3HCXA 4DV6J 3ENVA 4DR2J 4CIOA 3UVJA 1NSKL 2ROPA 1FRMA 4X65J 3PE0A 1Q86R 2B9YA 2PA8D 3TEGA 5HROB 2Q1LA 3JXOA 3NNHA 1DARA 2DGXA 2GF7A 1U1LA 2OD6A 2FHDA 5CXTA 4OZ0A 3H5SA 2E1HA 3N01A 4M78C 2K4YA 1DQ8A 2WRMA 1G2EA 4OMFB 3CD7A 2L3MA 3CJKB 1WIEA 5L39A 4X4SA 5GVQA 5DLOA 3CC2T 3L4BC 4O3SA 3PYEA 1NK0A 4YHHJ 1R0CB 4BY6B 2R2SA 3L7UA 2WACA 1RXOB 5KFAA 4J7FA 5KFIA 3ET6B 2XHWA 3SD4A 2BKOA 2RDJA 4ZPWR 2EWHA 2Z2ZA 2HHUA 1N9SA 3QJLA 2LFVA 2DB1A 3S1TA 3NKYA 2XY7A 4ZLPA 4CT9A 1BMQB 3JB9G 5A2QU 1N52B 3LP0B 3A8OB 2MB0B 4LJMA 2QA4G 3PTWA 1VQPA 4JLIA 2RIJA 3UDCA 2YSQA 4M78A 4CTAB 4XU3A 3V6HA 1WTBA 1SXLA 3GZ7A 3DOLA 5IZHA 4Q0BB 1JO8A 4K2JA 4ECYA 3V6DB 1JLGB 1KHVA 5GMKj 4QVDA 1G2BA 3S7RA 1X4FA 3H5UA 4QVCA 3EG3A 1IKWA 5CKDA 4MMOA 2LJ1A 1WOPA 4AE5A 4II1A 5DM7R 3THTA 4ED8A 1IR2A 1P9QC 5A0DA 4EMKA 3HTRA 2AK5A 2AX0A 5FRNA 3BQ2A 2DIVA 1YBYA 1T05B 4M77E 1ZX6A 2OFGX 4NLVA 1K73R 2HFUA 3JCMh 2Q66A 2RRBA 3CC4T 3JYTA 2LQ9A 2K1RA 1OOTA 5ITHA 5A2QE 5ETTA 3PYDA 1BI1A 3H9NA 1YIJA 4L6V5 2K1RB 2EKNA 1VRUA 2KVQE 1SJ3P 3SWNC 2QMWA 3GNFB 3GIJA 3D5MA 2QYGA 3PGGA 1HD1A 1P9YA 2RH2A 3MR5A 3CCJQ 2EPDA 5KAKA 4M7AD 1Y7PA 3VAJA 4K4TA 2EW3A 1U2RA 4YB1P 4J9OA 1O75A 4F2SA 4DR5J 2H5IB 2HMIA 2FPDA 3T1AA 4CC7A 2UXBJ 3GSDA 3JAMU 4KIAA 2JHEA 3SBMA 4E2FB 3QQCD 1RT6A 1WG1A 3PW2A 1VQMS 1NJIC 3RBDA 2UVRA 1WPYA 3W63A 4LF5J 4JPBW 3PVXA 3AT1B 1O9SA 1RWUA 4RUBA 4HKQA 2VXEA 3MEKA 3OYFA 2VKRA 1RKIA 1WFWA 1X4CA 5D0GA 5KG7A 1Q7LB 2DNLA 5KH6A 3CWJA 2E5QA 1PCXA 3NWGA 2VONA 2LKZA 2MQLA 2RVJA 3K89A 1MWQA 3EWGA 1KLMB 4MJKA 4U7CA 2CQHA 2E5HA 2K5IA 2J0XA 3M4XA 3SSRA 2YWHA 3MP8A 3D7SB 3MTJA 2DGQA 3MUVP 4USHA 2DNKA 1YJ9S 1TH7A 1WGSA 2H5JB 1EZZB 1VYAA 1WOSA 5HI7A 1NK4A 1IBMJ 2RRAA 2F2WA 3FIFA 2D9TA 3H59A 2YNIA 5F8LA 2I2LA 4LD9K 2EEYA 3IGVA 5KFLA 2QLWA 2BZXA 2D3O1 2IBOA 5GAMe 2ILZA 1S0MA 3MECA 1S6PA 2DMOA 1Q5VA 2GQCA 5LJ3f 1IHVA 2H51B 2UV8G 4QR2A 2QA4Q 3CJQA 4KB7A 4Z8AA 3CCUA 3OT9A 2E5GA 2RI5A 4CI0B 1EB0A 3WIUA 4BDYA 2LJ3A 2P5VA 4CO1A 5LMUF 5ETVA 1UVIA 3OW2R 1X0PA 2LJ0A 1UZDA 4IKAA 2B5JA 3R5JB 2CZ6B 1FRKA 1SIZA 4ZVEA 2R2TA 2Z2MA 1FXXA 4DHVA 1KQFB 3FFIA 3BM7A 4BC7A 5KFDA 1Q7YC 3CCVA 3HSDA 2WVEA 4ESRA 2V94A 1X01A 1WJSA 2C2RA 1C4CA 3HKSA 3CCQS 2ZPIB 2CPZA 3CCSA 4XDCA 1YHQQ 4YB6A 2EYZA 3ZZRA 1SL2A 1DRZA 3GJTB 1U1SA 9RUBA 1T9UA 2J0WA 2YQ0A 2OPPB 5DO2A 3P3DA 1SRMA 4M7DC 3LALA 4HI1A 4RTWA 1U1MA 5A6PA 2ASJA 4O4RA 1I94F 3EMTA 3NS7B 1YSJA 2HQDA 2P2CB 4I7FA 2ZITA 3KMQA 3MCSA 4B3SF 2KT8A 4M95A 2SXLA 1WG4A 3A8KA 1U0HB 2H9ZA 2OJ3A 1YZ6A 4NLGA 1S4EA 3DRRB 2VQFF 2CYZB 4JI1F 2K3IA 3QFHA 3I31A 3H0IA 4LSNB 2OTLS 4F8RA 3D6MB 1VQ8A 5F9LA 1B7YB 2LQJA 3GYGA 1W7WA 5K20B 1WEZA 5GAHU 4KTQA 2ATCB 2JSXA 4QOTA 2XBPA 4DFMA 4N76A 5LJ5g 4M7DA 2DXDA 3BBCA 4BI8B 2K9GA 2F2VA 2MHNA 1KTVA 3CTRA 3RUXA 1WXTA 2IC3B 2JEGA 2CQ4A 3N6MA 5B0EA 1Q86T 4PJLA 1RT3A 3D1QA 4C3MA 3QO9B 3NGPA 2GO9A 2PNIA 3CCEQ 1H72C 3CCSQ 1YHQA 4KO0A 4BCAA 2UUAF 2QL5B 1RL2A 4F7UG 1PO6A 4DI6A 2VL1A 1F2GA 3EHQA 1WJQA 2GVDB 2NREA 3CSKA 1G5VA 1PYSB 2HAFA 2DLPA 1M5Q1 3PYFA 1AEYA 1DZ5A 3CD6S 3KLGB 2VDIA 2YXYA 2R8KA 3QYHB 4RZRA 4ZLLA 3JCMf 5HK0A 2F63A 4J83A 2LT1A 4LF8J 2KH9A 2JFDA 1TMJA 2KY9A 4A8QA 4MKAA 2X51A 2V8VA 4KHRA 1PSDA 2BRKA 2VHGA 4ME7A 4DX8H 2M4MA 1U02A 2V8DA 4LF8F 1ELOA 4BE2A 4MMKA 5IV4A 1C0UB 3Q22A 1Z2ZA 3MOJB 2EJFA 3CC7T 3EE3A 4OIXA 1TP7A 4IR1A 3FEZA 4LR9A 4ZVQB 4C0DC 2V6AA 3GIRA 4JV5J 5L1KA 4NYPA 1CG2A 2YNFA 1YFNA 3NLCA 1W6XA 4FVCA 4PJOC 1FNMA 2HCKA 5HROA 2JS2A 2M0YA 2YKAA 5E3PA 4DSLA 1VQOS 1JQQA 1CSJA 3S6WA 5FRMA 1D1CA 4OYIA 5C25A 4AXJA 1YITQ 3U02A 1H3ZA 2PT0A 1K76A 3US5A 3RNJA 5J2QA 3C66A 2RI2A 2P0PA 4M5MA 2LYVA 1J5EJ 2F4FA 4I68A 2ZC4A 2OTJQ 4IG3B 3H2VE 2ZWOA 2CJYB 3VYGA 2D8JA 3P6YC 5AT1B 4I64A 1A0OB 3NOCA 3W1YC 4PJOB 5KG6A 3OTCA 3CIMA 5CCMA 3M1VA 1H2UX 1KK7A 1NDPA 2DXFA 4OJ3A 4OGEA 2RNEA 1F5BA 2BE7D 3LO3A 2XS5A 1VQMA 2DCLA 3AD7C 4DS5A 2HPUA 1VQLA 4O3NA 5AE1A 4TLRA 2DY9A 1KD1T 2JT4A 2GAGC 4QQDA 2FJBB 2RHQB 4R5PA 2MI6A 1LWFA 4C8OA 3DCAA 2CQ1A 3K5LA 3QT8A 4KGKA 2KL8A 4XAXB 3QJJA 1FWPA 3TWZA 4M75C 3MM7B 5EHHA 2VG6B 4A53A 1ZLMA 3I4HX 2C3UA 5B0AA 1ZBTA 1UGSB 2HWHA 2VV5A 2PI4A 4HI2A 3DNCA 1SHFA 4ZN3A 2V68A 3O6QA 5F8IA 1H92A 2KSSA 4MZTA 2UU9F 2FC8A 2OTJS 2AHOB 4KSEB 4RCBA 2CNKB 1SL0A 1OZ3A 1VIEA 1GFWB 2XZDB 5KFRA 3DGPB 4U8VA 4B9UA 1ABOA 3WQPA 1WHMA 3S6EA 2RI3A 5C25B 1I1GA 3TRGA 4IUVA 2BOPA 3FDSA 5A8KB 3UNYA 1Y3JA 2QEXS 1GL5A 1C1BA 4CP5A 3QKJA 1H74A 3FBEA 3L2RA 3OYEA 1NRKA 2ZH5A 2RHIA 1KSWA 5AXNA 3TA0A 2QTVA 2ACYA 2NUPA 2ZDPA 1JJCB 4P10A 2K2MA 3HULA 3SSQA 2YNHA 2DVJA 4QWEA 1VQLQ 2RQCA 3FEXB 5E3CA 5FU6C 1AWOA 2F5KA 1FJ7A 4NLPA 2EI5A 1R3NA 1U48A 5LJ5h 5LJ3g 2V9KA 2BXJA 2JDJA 2BV3A 3NBPA 4Q5WA 3N0VA 1FEEA 5IN1A 3MUTP 3B82A 2WOMB 4DEYA 4CLWA 4C0GA 3P8HA 4G1IA 1ZPVA 4OX7A 4RG2A 3AODA 3OLBA 1WF0A 2IBKA 3KUFA 1RWNB 1EP4B 4C48A 1M3AA 3OTOF 4DS4A 1N34J 3V8KA 2LA4A 2G1HA 5GMKh 1RT3B 2H4YB 3VU3C 3GG1A 2I0NA 1T95A 2BM1A 2O9SA 2JH3A 2W4DA 1VHIA 1QE1B 2K7JA 2F1LA 2BUDA 3H5YA 2JUFA 3EVWA 5GJWB 2CZ7B 2MKJA 1Q7YR 1CS4B 3C19A 2EQIA 3PJWA 1Y4ZB 1GT8A 2GIRA 4XTWA 4M94A 5KYXA 2BQUA 2W7OA 2IA0A 1M9SA 3FCWA 5CKFA 2E5LF 4J9FA 4KGMA 4BWMA 3IRXA 5GJVB 1QM9A 2QQRA 4HT9A 1TV6A 3QFWA 3CCSS 4OZ2A 3PO5A 4B02A 4F50A 1Y7XA 5DG8A 3OYCA 4ID5B 1K9MU 2B5JB 1G3YA 1EX8A 3R8YA 3QLHB 4CWBA 3GP8A 2KJWA 1BU1A 2BKDN 1R6VA 1CJVA 4RW7A 4LF6J 1JB0E 2JN0A 1FWLA 1WA7A 3VS0A 4F7UB 2KDSA 3FNNA 3V4MA 1G3WA 3RB4A 1TKTA 4DR2F 5GAHI 1IHWA 2XSJA 2C2MB 1SV5A 3CCES 1V6HA 2A6MA 2HQXA 1URRA 4HT7A 1L3VA 3G71A 2K5LA 4KPCA 2HBRB 3RBBB 3OW2A 3M6XA 1K9AA 2WBRA 4URSA 3LUYA 4PUOA 2BE9B 4MKBA 2AF6A 5IXFA 3C95A 2DGSA 1LEOA 3BBFA 4I69A 3HVTA 3G6EQ 1GMVA 4TY9A 3PEHA 1WJ9A 3D66A 2LTOA 2PMZD 4ANDA 2R7TA 3M05A 4JI3J 5F8HA 2QTWA 3WC0A 3KLIB 1TL5A 1SVDA 2ZKUA 4A4GA 1K44A 4C92A 3IM8A 1VQ7A 2MOXA 2ED1A 3Q8UA 5HK4A 3C6TA 1CLFA 4RG8A 3AJDA 4LR8A 4TN2A 5IQQA 1UECA 3X28B 3I5AA 1SJ4P 3KHHA 2ABLA 1FESA 3C8YA 3ZFJA 1TFWA 3ZTRA 3MM8A 3JCMb 1YBAA 4FT4A 2R2RA 2J06A 4Y92A 2O88A 2XY6A 1E6YB 4H4KA 2FPHX 3C14B 1P8GA 2V9WA 3H40A 3PG9A 4O0NA 2J7WA 1S72S 4A48A 1ZSZA 5G4DA 2ZH3A 1HNIA 4LF4J 3LGFA 4KV8A 1W2BS 2ASYA 1N36F 4LFCF 2LCCA 4MIAA 5J1NA 2YPZA 3M59A 1FXRA 3L2VA 4ES3A 5J2NB 5JVHQ 3O5TB 1OQ3A 3W60A 3BGOP 4O23A 2CSIA 3QT6A 5KFZA 3J7ZT 8AT1B 4ED3A 3NTHA 4E7LA 3BQ0A 3I56T 3P4UB 2GA7A 4JZ4A 3JCMe 1T3SA 5HLFA 4ID8A 4HDGA 2BIVA 4DG1B 3G7ZA 1C1CA 1JJ4A 3KK3A 4J9MA 5CIUA 3Q0AA 1K1QA 2C3PA 5KOXA 4LF7J 4J5OA 4J9GA 2RNAA 1WHLA 2DBKA 3ILJA 1UB4A 2WSEC 1JXEA 1DY3A 2Y8YA 2JLFA 1WDDA 3GFZA 1DQAA 3EFOA 5M9OA 4RU2A 4M77B 4OMQA 2P0QA 3VVTA 4C7QA 1KKHA 3LP2B 2RUGA 2LT4A 2L41A 3LA0A 2CP5A 2SRCA 1HNZJ 3V6JA 3AFGA 2QLBB 2AKKA 2HSEB 2UZAA 2CQGA 4C5IA 1AB8A 1GK8A 3I55T 1WEXA 3FQLA 1YRXA 2Z4PA 4CC3A 2CDRB 5J1PA 1KC8T 3ZZZA 2DH7A 1L3KA 1VQOT 2PE8A 1QKWA 5CO7A 1VUBA 2DGUA 1S9GB 5J2QB 3OTEA 1U1PA 5A76A 1SH2A 2A18A 1WNLA 1VRQC 3HVTB 2VUBA 1FK9B 1DAXA 4GKJF 3BY7A 2HW3A 4DBHA 3VS6A 2QYCA 3SCKE 4CLKA 2YRVA 1EP4A 2MKHA 1WHXA 3VAMA 3UVJB 1VJWA 1WC3A 4OYZA 4OI2A 2XKOC 4EDUA 2IYGA 1X31C 2CNOB 1LOUA 1LFWA 2EGCA 3V4IA 1VQ5S 5IT9E 3I5SA 2QTXA 4WXOA 4Z7YA 2OMOA 2HKNA 1X4BA 5E33A 3K57A 3OL6A 5IH2A 3L2QA 4OHVA 1HK9A 2D0NA 2COZA 3PW0A 2GHPA 4CT8A 3GLJA 2COYA 1GCQC 4FYXB 3VCDA 2DCUB 5B0GA 3R6NA 3P49B 2VOPA 4NL3A 1VYUA 1FYNA 4G3IA 1F9HA 1H2VZ 2OTJA 1OU9A 1NDKA 3CCWA 4ZOSA 4WP8A 2HQGA 1UW4A 1Y71A 2CQPA 4USKA 3AXKA 4PG7A 2UXDF 4IH5A 2OPSA 5GANf 2E65A 2B51A 2OIHA 5GMEA 2GMHA 3BO4A 1M0SA 1BIBA 4ERDA 2YT6A 5IHKA 1B0PA 3KOAA 2C2DA 3TU4K 2HBWA 4NI2B 3UE2A 2Z2YB 3JTNA 3JCMd 4J90A 4EBEA 1LFPA 1I94J 4OMLA 2QA4T 2KROA 2PC6A 1PKSA 4H4MB 5CK9A 3M9MB 4IKFA 1S6QA 2I9SA 1I4K1 3OSNA 1QVFP 4AD6A 4YB5A 3OBIA 4EYIB 1S7HA 3U1MA 2IPOB 1QWFA 4L5GA 4EMDA 2LXFA 1FFWB 2KZMA 2RQMA 4BDZA 2CP6A 1NSAA 2HKEA 1T03A 2E1CA 2E10A 4DV2F 4X2BA 1HQ2A 2IVYA 4AQYF 3NGKA 1HLWA 4CC2A 3LP2A 1MWZA 3V8LA 4LUBA 1NKBA 3KLHB 4DV2J 1RABB 4F3QA 4EMKB 3V7SA 2F40A 2HKQB 1YHQT 4NCAA 1HNXJ 2A28A 1TL7A 3R6GB 2MYSA 3MJXA 4L59A 1VQPS 2DGVA 2MPUA 3EX7B 2V1RA 1MN7A 3CF5Q 3RJMB 3KUEA 5CHCB 4XPCA 3OS2A 3PYGA 4XTYA 2O9VA 3ULRB 1N33J 4IO9Q 1SJRA 3BE3A 2Y1LB 3X1LB 3RRKA 1LW0B 5G0RA 2CPIA 2F4VF 4LRAA 5HVFA 3MAAA 4JV5F 3DLMA 3KK1A 4QWAA 3M32B 2V8JA 3EGZA 3G2XA 2X35A 1TKZA 1VFJA 2DF6A 4JJDA 1VQ8T 4FBTA 1LOJA 3JTOA 5GAOn 1U1KA 2U2FA 2COWA 4K4XA 3ITHB 2OPQB 3NAIA 3WBZA 3QSUA 3OS0A 4USJC 1V3RA 3A3PB 3H0HA 3K5NA 3CO9A 1XMOF 4RW6B 1F60B 4NPOA 1XBWA 2NQPA 2MIOA 2VFUA 5L1IA 3LH5A 4Y2AA 5KG3A 3ONQA 2ZZDA 1Q81U 1FDBA 1VIXA 4OV1A 3T5JA 1PJ5A 2I2YA 2Y3YA 3BDEA 1UJ0A 1VQLT 2EQJA 2DTOA 2JM9A 4I4BA 3SEOA 2F65A 1OWXA 1ZQ1A 1NLPC 4QPTA 1MV3A 3NGUA 4XTZA 5HMWA 3M2UA 3RZAA 5D3GA 2RU3A 3GIKA 5J2PA 4F4WA 2JNGA 3DLJA 3ETMA 3R6OA 2LQ5A 3Q86A 5FU6B 1HKAA 3TCJA 4ZGJB 2AV5A 3IO1A 1JJHA 5I3UA 4M77D 7FD1A 4A8WA 3I35A 3B8HA 4F16A 1NPPA 1WF2A 1ZSZC 1S72A 4FCYA 1Z9QA 2HVZA 3DI6A 4UOFA 3GV7B 4YFUA 1UEBA 3JCMJ 1XR7A 3EZUA 4MK9A 1QP3A 1EIYB 3EHRA 3ZTQA 3MEGA 3TANA 1LWEB 4C4WA 4RBTA 3JSMB 5GAGI 2RQTA 4P9SA 4ZVSB 3E9GA 4KH0B 1SUQA 2DIQA 4DUYF 3EPIA 2KRNA 2HMAA 1IB8A 3LQVA 1B4SA 2R7RA 2E6ZA 4RNNA 1HBUA 2HIYA 3UD3P 4JI5F 4PWDA 2HAXA 3THKA 2GX8A 4HA8A 1U8WA 2GTOA 2E6NA 3D3CJ 2NUPB 3T5KA 1SJ1A 2YDLA 4QWCA 1HMVA 2QMXA 3QZ5B 5J2MB 5FU7B 2YNFB 1OPIA 5K8OA 2DHGA 1FWKA 3LLRA 5GAMh 2RQRA 5RUBA 2QFIA 2CDQA 3BEGB 1TMMA 1K9MC 4EGLA 3PR4A 3A8LB 2I8EA 1P92A 5BXIA 1A0NB 4QU7A 4O4GB 1RADB 2YX4A 4N56A 1UFFA 5T41A 2AT1B 3ZTOA 1GH8A 1AOJA 4C9DA 2AJ2A 3EGUA 3EG1A 4QIWD 2EG1A 2KT1A 1WX6A 3KFWX 3M0SA 4CQ1A 2MSTA 3ZC4A 4X34A 3JV3A 4N41A 2BKPA 2HK2A 1N6QB 3JSYA 2XEXA 1KOHA 3GE9A 3B54A 1OSDA 4O44B 2XSJB 5DGAA 1WHWA 5J2NA 2GFAA 3QIPA 4LUDA 3VZIA 4NCBA 4RBVA 2O01C 2J6UA 3G6ET 2B7CB 5ETPA 2P9CA 2DPJA 5K8NA 1S97A 4AMCA 2IA6A 2J9DE 4QJVA 2DEIA 2DBMA 2QSWA 4NLWA 1VQNA 4ZCIA 2F7VA 2W25A 4HXJA 4ANCA 3FGVA 1N5SA 2AX1A 3E01A 1QLYA 3M4GA 1F5CA 2XS2A 3IAS9 3D6HB 5KYWB 3AY0A 2AYEA 1EARA 1TKZB 1X4HA 2QX0A 5SZTA 1UGPB 3IRWP 1PHTA 2RS2A 4DN0A 4C92E 3LGMA 2E70A 3S3MA 1D1AA 4EBCA 2ZE2A 3UT1A 4A8SA 2W2NP 5HJYA 3H8ZA 1FF2A 2LDYA 2R7SA 2IVFB 3K5MA 2OEJA 3RG6A 2POKA 3BH6B 1H73A 1U1NA 2XY5A 2GO8A 2QE5A 1O8BA 4PUOB 3IBCB 2FY8A 1TUCA 4M7DD 2ZVSA 4OLPA 2XNRA 5J1EA 3META 5I11A 4MK8A 1N9RA 5H9EK 1S1TB 2DPPB 4EO6A 3TP2A 1ZBJA 3TEHB 2E44A 4BC9A 3M4YA 2F5TX 2BJ7A 2WAQD 3HVWA 1XMOJ 3QO3A 4ZJLA 1MWYA 5HY6A 1KR4A 1M8VA 1PKTA 2V67A 1ZS6A 3VWSA 1IBCB 1S48A 5GAMd 1QVGR 1OMSA 4WF9Q 1K0XA 2UU9J 3CPWP 2R8IA 2GTJA 4A63B 3U1LA 3AB4B 5LSRA 3CMQA 3Q83A 3FJ5A 3X20B 2IAJB 3I6PA 1NJXA 4O4GA 4P75A 2B43A 1NM7A 1WC6A 1FO1A 1D0ZA 4RW9A 4UOHA 4CLFA 4HVUA 1SQGA 3ILOA 4DDFA 2WSFE 4CLLA 1Q8KA 3V6DA 3I9ZA 1SC1B 1UKUA 4OZ5A 3EG2A 3I55Q 4QIFA 3FVYA 2J6OA 4A4KA 3HMJG 4P6QA 4HVVA 3IR7B 2EWNA 4RNHA 1TL3A 1Y11A 2FJWA 2K57A 3BSNA 1C0MA 4DEZA 2CP3A 5J2MA 2YNGB 2X3WD 4IFVA 3RKYA 2ZC3A 4M5JA 4DV0J 5EWFA 1KVKA 3CDWA 4YR0A 1YJNT 2BEFA 1EAYC 1H3DA 3PW5A 4DG1A 3JSCA 4IRDA 1I5LA 2MHEA 1FRXA 3CCMS 4G65A 3IGNA 2LCLA 4TQSA 1HR0J 3C2PA 4PXEA 1RCXB 4ILMA 1XERA 3KYLA 2ACMA 2HSPA 5H9FK 4ELYC 3LOUA 3MPDA 1J27A 2IM3A 3REAB 3RBZA 1FX4A 1GEHA 1EKSA 2XCPA 3K5PA 3I9QA 3DRXA 3H0FA 1X5SA 3NCRA 2LA6A 2GVDA 3A3NB 4B3OB 1RWKB 4DFPA 4I2PA 3EICA 3DHWC 5B08A 2BW2A 4KRWA 4ELVA 2OX7A 2CP2A 3RR6A 1SKSA 4BWJA 2J5AA 1IKVA 3CT9A 3CUNA 1YWPA 2EFNA 2LQ8A 1I07A 1RB0A 3PY8A 2BTTA 3HRTA 3H20A 2QQAA 1ZH5A 1U6FA 2VIHA 4DPTA 1JLBB 9ATCB 3K5OA 2DBBA 2X3DA 1QCOA 4EMGA 3E51A 2JX2A 4QVZA 4PWWA 3F73A 3KLIA 3RMQA 3JTPA 4M1KA 1TKTB 2W2OP 4GBQA 1YITT 1I81A 2YLCA 3Q8YA 4PWUA 4YDDB 3DHXA 4JRKA 2YRCA 5ETNA 3WZ0A 1JX4A 2O4XB 2RD5C 3PFSA 4WZMA 3RUBL 2RUSA 1AVZC 1T0TV 4DUZJ 4LSLB 2QI2A 3TQ7P 3CJTA 4OYPA 3TR5A 3A8EA 2NLUA 3ISZA 3QJYA 5KG4A 4F4ZA 2GFUA 3EGDB 4BI4A 2KB2A 4QBUA 3ELHA 3KLVA 1I8FA 4CLZA 4OI0A 1RBOB 2ZNZA 4C5GA 3OS1A 3O8VA 4FN5A 4LBHA 3N4WA 2AEMA 2P9GA 4D3GA 3IM9A 3NTIA 3A8MB 3VV2B 3LH2S 1EX4A 4FNHA 4TU9A 1TK8A 4WBFA 3VV0A 3DRPB 1UJ6A 3EM1A 3SDEA 4OJGA 1SQEA 2DNNA 3VR1A 1XEZA 4VUBA 2E1PA 1ROFA 1XK8A 4AFQC 3TJ9A 2FRWA 4C8QD 1NXIA 3EXYA 1CULB 1CVJA 3CCRS 3DLBA 2DNPA 2JW4A 4PLIA 4X62J 4IUUA 1BHNA 4WFXA 2LVMA 2YH0A 2KXNB 1K73T 1XR5A 2A7YA 3D9BA 5F3TA 3MR3A 5HLFB 3CXCA 2DZCA 1Y96B 1FRIA 3MMBB 1SPBP 3MEVA 3DLGB 4NEZA 4PG4A 2KT3A 4DQPA 3CD6Q 3BDPA 1KIKA 3POTB 3LWMA 3W8PA 3K8WA 4Y2IA 1KTQA 2UXDJ 4CLSA 3J81U 3OB9A 2LLZA 1UGVA 3VS2A 3D28A 1KQ1A 4BD3A 6AT1B 1NNDA 3IXQA 4KULA 1KC8U 1UTAA 3O44A 1DLOB 2KYBA 2HHQA 1S6PB 4OHYA 4LFBF 5J2PB 4F02A 2HRYA 2X9HA 1UG1A 5KT7A 1RHKB 4X4QA 4PYAA 5LJ3j 4K8RA 2VPWB 2I5JA 2WTFA 2FJXA 1EJ7L 4OZLA 4IDKA 4E7HA 2VOOA 3RW6A 1YJUA 2CPEA 5KFPA 2JWNA 3GG0A 4JI2F 2I5JB 1JNRB 4I2PB 4P71A 3D0IE 2YRDA 2JZ2A 1U2CA 1HD0A 2MQOA 5IV3A 1UJ5A 1KNZA 4M78B 3H98A 2GVZA 4CDIA 1IBLF 5IHNA 4UUXA 1RT1B 3MEEB 2DITA 4C92B 3KG0A 2HZYA 1QVFR 1E7OA 3JRZA 2XGPA 1L5UA 2YUNA 2CQDA 1T3OA 1VQ6S 4RTVA 5ECAA 1J5OA 1MSWD 3LTOA 3KK1B 4JV1A 3AXMA 1G83A 3W8GA 4MIBA 3FBBA 1XOVA 3ZZUA 4PG8A 4WFBQ 2RJFA 3X26B 2CDTA 4WFAQ 3UR3C 4X64J 3DLEA 1NMEB 1CEZA 2DO4A 4WTYA 4HLBA 5HBMB 4X4VA 1I1JA 4BBYA 1PAEX 1RU2A 3TW0A 4B9NA 4ECZA 1HHQA 3NAHA 1TZ0A 1N5QA 1Y5NB 4Y6IA 3OTDA 3DRPA 4IIOA 4EEYA 5LL6d 2HFOA 2DXTA 3WVEB 2JZ5A 1RYRA 4RTXA 3CXCP 4BY6C 1M1HA 4ED5A 2G0CA 2QSFA 1EETA 1B3QA 3EFSA 3DLLA 2YUQA 3AOCA 2VZ9A 4WFZA 6FDRA 1LXNA 2DKGA 5EX3A 2XDBA 3PEJA 5JUMA 1SKRA 1PYOB 1XIQA 2MDAA 1KQ2A 4ENOA 2UUBF 2E9RX 1YDLA 1OS5A 4XO0A 1FA0A 3VGSA 1P27B 1YJTA 1T9WA 1GAOA 3TVKA 2EYWA 2WZ1A 3I9V9 3OR1B 2HDAA 2HS3A 3HFZB 2NCKL 1BLUA 4C11B 5D6GA 2YUOA 1KSPA 5DLFA 1OY8A 4F4KA 1OY6A 2IY5B 3W5ZA 3HVRA 2DXBA 3OSPA 3Q8VA 2GQ2A 4QR0A 3G6ES 2ZH1A 1CKAA 1OZ2A 1D3BB 1BBZA 1HHSA 2HZVA 3ASKA 1C2PA 5LSLA 4DR1J 3AJ2A 1LW2B 4IOCQ 4IRCA 2NXCA 3FBFA 3TEEA 3CMAA 2AHJB 2FQQB 2CJKA 2NPIA 1N27A 5KFMA 1K8AU 4DQIA 2XMTA 3FBCA 2JLEA 4B9MA 3W64A 4DWIA 2N7CA 4DEXA 3KJVB 4IH7A 2A3LA 3QWUA 3QWYA 4KHMA 4CTAA 2QDLA 2W2MP 2HYIB 4IG0A 1ACMB 3RDVA 2ZPFB 3GIBA 5L38A 4J9DA 2F1FA 4UZBA 3T1YJ 1X69A 5C7PA 3W2WA 5AXMA 3CCST 1GBQA 3VS3A 2QL7B 5KFCA 2ZJRQ 1QSLA 2F2XA 3EXCX 2B4PA 3N5BA 3NS6A 3ENWA 2HVDA 2UP1A 4M5KA 1W2BR 5FLXU 4RUHA 2ZOGA 3ISND 2RPNA 1HD3A 4P2FA 1CSKA 2BZ2A 4NI2A 1Q5YA 4ILLA 5IT9Y 4L72B 4M5LA 1WC0A 3VS5A 2R2UA 3CJSA 1RBAA 4K5RA 5EN1A 5KFQA 3M5AA 2V2KA 4C8YA 1QDUB 2KZZA 4FSXA 2YKQA 4GY5A 3I55S 3HFVA 4PRFA 3QNWB 5AJ3J 2OJ2A 1VBYA 1HWUA 1Q8LA 3GTYX 1VQ9A 2ZUAA 3PNIA 3E01B 1TOVA 3R7SB 4MKYA 3TSWA 5D4OA 1F6TA 1D8ZA 4ZHRB 2JTEA 3MM6A 4C8MA 3QIIA 1R8BA 3HSGA 1SSFA 3UDVA 3R5AA 1S99A 4O3QA 1WDXA 4M77F 1D9DA 1FTRA 4M7DF 4Q44A 1HQEB 3M0QA 3EJMA 3PFOA 4KR0B 3QIPB 2KHDA 5IM0B 3V4IB 1U5SA 2W10A 1RSCA 2OI3A 3NMAA 2RAQA 2DO3A 1FKPA 2IRUA 3TQ1A 2CQ3A 3OQ5A 3FC3A 2PVGB 2FIUA 3QGIA 1PC4A 2QG9B 3M2VA 5KYXB 4P7VA 2RN8A 3TJ8A 2DRAA 2APOA 1RP5A 3BGFA 5LJ3Y 3HPOA 2ROEA 2DL7A 3T1HJ 1CBKA 2MXYA 1N54B 2RHUA 3M2UB 3FRYA 1TAQA 4GC7A 4LSZB 1MV0B 4F2RA 3LGHA 3M9OB 4BDPA 4PYDA 3DDIA 2O1PA 3AA8A 3QG1A 1G3SA 3ZTSA 4ZP9A 1HXDA 3CCQT 4RCCA 2E9TA 3HHNB 2U1AA 2J6TA 4NL2A 2NZCA 3OY9A 4KAIA 2CSQA 2VA2A 2G4BA 3KJVA 3BSCA 2VODA 2FLPA 5AXLA 3PM9A 4XTTA 4MAKA 4WIIA 2FHMA 1E6YA 2ZH8A 4OLOA 3M6UA 3OV7A 4TNOA 3D0GE 4OJHA 1VQNT 1AWWA 2GCXA 2BM0A 3OSVA 3FMBA 3C94A 5HBMA 2ROLA 1B3TA 2FYXA 5IS2A 5CYMA 2PTKA 3PXGa 1IVZA 1HPZA 2VA3A 4RW4B 1LK7A 1QMCA 4DQ2A 2ZAEA 3PRDA 3CGIA 1XTZA 5DRKA 3PHEA 1SJQA 4F3MA 5KG5A 2NXJA 1BCMA 2BRLA 2EYYA 3HFKA 2KRSA 1RWPB 3IBFB 5DQIA 4QT7A 3OYAA 2VPZB 2DO0A 1JLAB 4WKYA 3H4BA 3CJ5A 2HNYA 1NO8A 5GAOm 4J9KA 4MZMA 4XK8C 1MMDA 2FVQA 4WF2A 5GAOp 4UW2A 1M5HA 4NLUA 2HL3A 3LPYA 2HIQA 3KLGA 4DSIA 3NWRA 2ZH6A 4NXNF 4ZVHA 2GGPA 2XK0A 4XQ3A 3M2RB 2EC2A 3B4DA 4NLTA 4OI4A 1XNRJ 5LJ3d 1HWKA 2VG5A 5HQMA 1RTJA 1Y5LB 2XDPA 1PCAA 2R7VA 2LQBA 4YP3A 2KKHA 4KC5A 2LX7A 4FPIA 2EK6A 2MSSA 1YJ9A 3UDEA 2QDYB 2CG8A 3M57A 4C92G 4LRCA 1K73U 2V5HG 3TAMA 2CQ0A 2UUTA 4Y34A 3CPWA 3QO9A 4RU9A 3MUMP 4L6V3 1H38A 2MZSA 1U0HA 3DM2B 2NUUG 2NUZA 5E5NA 2M8HA 2RK1A 2NUTB 2ZZNA 2EC0A 3CEDA 1N0UA 1D3WA 4ICLA 4UT4A 1Q82C 1CULA 4OV6A 1N8RC 2BE2A 1QE1A 3QBYA 1CJKB 2VG7A 3HKZD 2UVWA 2G2OA 3EDQB 1GXIE 4XU1A