2ATCB

Crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
152
structure length
152
Chain Sequence
MTHNDKLQVAEIKRGTVINHIPAEIGFKLLSLFKLTETQDRITIGLNLPSGEMGRKDLIKIENTFLSEDEVDELALYAPQATVNRINDYEVVGKSRPSLPERNIDVLVCPDSNCISHAEPVSSSFAVRRADDIALKCKYCEKEFSHNVVLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
publication title Crystal and molecular structures of native and CTP-liganded aspartate carbamoyltransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (carbamoyl-p,aspartate)
total genus 6
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1982-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2atcB02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2atcB01
1R0BG 2AT1B 1RAHB 4AT1B 2FZGB 4FYVB 1RAEB 4KGZB 1RADB 4FYYB 4E2FB 2ATCB 4FYWB 1SKUB 2H3EB 2QGFB 2AIRB 1ACMB 4KH1B 1RAGB 4F04B 2BE9B 2YWWA 1F1BB 1RABB 1I5OB 8AT1B 1ZA2B 1RAAB 2FZKB 3MPUB 6AT1B 1XJWB 3AT1B 4KGVB 1RACB 4KGXB 1ZA1B 7AT1B 1AT1B 2IPOB 9ATCB 1Q95G 1TUGB 2QG9B 4AMCA 4FYXB 4WTOB 1TTHB 1EZZB 1RAFB 5AT1B 2BE7D 1D09B 2A0FB 8ATCB 4KH0B 2HSEB 2FZCB 1NBEB 1PG5B 3D7SB 1TU0B 1R0CB 1RAIB
chains in the Genus database with same CATH superfamily
1B3QA 3MGJA 4BBYA 2V69A 1U1LA 2LQ9A 2BM1A 3QKJA 1U24A 1U25A 1VQ4Q 2LXUA 4DUYJ 3L7UA 3RB3A 3DLLA 3M30A 5GAOp 4EK2A 2MWOA 4Z02A 1NKBA 3PW5A 5FWCA 3QIIA 1QSSA 1JQGA 3TJ9A 1U09A 5B0BA 1CJUA 2ZPGB 3GILA 2XS5A 4FP9A 3MXHP 1TMMA 3PJXA 4PKDB 4IR1A 3MUMP 1Q79A 1YHQS 4AG2C 3OUYB 3CJ2A 4NA3A 5CA5A 2F7VA 2DNMA 3NBPA 2KFNA 4XU1A 3WIUA 3OBIA 4NLYA 1T95A 4DF8A 4ZPVR 4JV5J 1WHXA 3EM1A 3J7YU 1URNA 2FB0A 4CTAB 4J9VA 3W2VA 3HP9A 4RG8A 1IKYA 1TKXB 4Q0BA 2FVPA 1M2VB 1LWFA 2BW7A 4PJOG 4PYAA 3N4WA 2DH7A 1SV5A 1KHWA 3ZZPA 3NNCA 3BQ2A 4IR9A 1IKWB 2CIMA 2H65B 1AD5A 3UFCX 4J90A 1JJ2A 1B64A 4UOFA 1LNXA 4EBEA 1KLMB 3ZEHA 2EFVA 4RTVA 4DDFA 2MCNA 1Y7XA 4XAXB 3CW2C 5DG8A 2WVEA 5AXKA 4KRTA 4JV2A 1UZDA 1DLOB 3RZAA 5CABA 4MMLA 3UE2A 3OMGA 2EFOA 4R0JA 4KH0B 2L3SA 1RQ0A 3QT6A 4TY9A 3LH0A 2QA1A 3K17A 3NNAA 1YHQQ 2DBBA 1N5TA 2MIOA 4DFKA 3D0IE 4HVWA 4K5SA 2YH1A 2CQ1A 2ACYA 2EKHA 1VQ7S 4I64A 2K7JA 3T1HF 1FDDA 1GFDA 3EGUA 4OX9J 4NX9A 3T3FA 1P9YA 4JJDA 2G0CA 5A76A 3OVAA 2FPHX 2OELA 4IUVA 1M2OA 5CKBA 3DLJA 2KYBA 2HS4A 4R0EA 1ZM9A 3NL0A 2CT3A 3V6DB 2ZWPA 3N9UC 4WIIA 4PPDA 4PWUA 1GEHA 1O75A 2HNDB 4J9EA 1OU8A 2V8KA 1XMOJ 3GIIA 5A8KA 4U6PA 2KHDA 2QEXA 2BZ8A 1X8DA 2FVCA 4B3OB 2UUBF 2EK1A 3JCMP 4M77B 4Y00A 1K9MC 4NOHA 3CCRQ 1ZBJA 4OYXA 3J7A1 3G71A 4G6VB 5KFAA 1QWFA 1SJ4P 5KTQA 3LW5E 2AGOA 4F67A 1TKTA 2D8HA 3SSSA 2C2DA 5KYYA 2L2PA 3UCGA 3OSVA 3ENVA 2HMIA 4CO5A 3M8RA 5K8OA 4M75C 1VQ7Q 4JRQA 2FC9A 3EFSA 3KLIB 4WK1A 5MLCV 2GC8A 2M4MA 5HMYA 1T0JA 2W2MP 2H48B 2WSEE 3QDRB 3P3DA 3Q23A 4A48A 4MZTA 1YJWQ 4M5LA 4MK8A 3RRHA 1XEZA 4C92G 2C0OA 3CC2A 2R4FA 2D1XA 2XY5A 4DU8A 1JJ2S 4KY3A 4XTYA 4FKYA 5C25B 4LR9A 1PD1A 1DFDA 3A4TA 1JRIA 2YKAA 1W26A 2M2BA 3EVOA 1Z9ZA 3QT7A 5KCHA 4J9BA 1WLPB 3FDSA 1QVFA 2J5AA 1PHTA 2L9WA 2ZH3A 2MKCA 3KKFA 1ROFA 1B07A 2BKPA 1S4EA 4JI1F 2YWEA 1UGSB 2COYA 4FPRA 4J9NA 1UFWA 2WBMA 1JMTA 3Q22A 2HNZB 1Q16B 1PKTA 3PNWC 2HBPA 5KG1A 2MQQA 1OSDA 2QDYB 3A8HB 1Z4UA 4C6AA 5LJ5e 4K4UA 1M1KU 4V2SA 4WBFA 3A1PA 1PYSB 1NSKL 2KZZA 2F5KA 5GAN6 2EC2A 1Y10A 1BBZA 3B82A 3OTCA 4F17A 4DS4A 1NK5A 1WHJA 4B3MJ 4DR7J 2PZ1A 1KJWA 3BDUA 1PJ6A 2R58A 4I6YA 4W92B 3DU6A 4OZ5A 4ZS6A 4A8SA 4JLIA 4KR0B 4CO1A 3L3CA 2MLZA 1KQKA 2LMIA 2QEXS 3GG1A 2D3ZA 2B56A 4F4KA 3OR1A 3Q89A 3MPWA 2MY8A 4ATNA 1PSFA 4A4HA 1D3BA 2ZPFB 1VRUB 3G71S 1I81A 2QO3A 4MZMA 3EG2A 2ATCB 1F3VA 2BZXA 1VK8A 4NRTA 3MTJA 2IAJA 1WI6A 3BYPA 4J7IA 3CB4A 1Q95G 4CH0S 1NKEA 3QJYA 3P8HA 4USVA 4ZTJA 4L6V5 5L8RE 1ZBTA 3BKFA 2LJ0A 3E2UA 2VXFA 5AXLA 3HX9A 4HL9A 4CI0B 5A8RB 4C0FA 3EFOA 4CYUB 3ZTSA 4URSA 4LF4J 4ID5A 4FIBA 1IB8A 1J5OB 4X66J 3VTIA 1S6QB 1PKUA 2JNGA 2GO8A 1QVFS 2V8DA 3BREA 1S6UA 3H42A 4B9LA 5LJ3f 3QFWA 1ZQ1A 1TKZB 2HBYB 1VGYA 1SUQB 3MHYA 5HQLA 4LF5F 4Z37A 4IOAQ 1TL1A 4DV2J 1TFYA 2JOYA 4K7QA 1UUEA 1VIEA 1SIWB 2AGQA 4G1IA 2CJBA 3KLEA 5F3ZA 2K4YA 3BKTA 5F0UA 2HHVA 1JLBB 2FTRA 3I5SA 2BV3A 2DL3A 3I82A 2J6KA 2CGHA 1FNOA 2BJEA 2H1YA 2DY9A 2ZHOA 3DC2A 2YNFB 5GANf 2O9VA 1Y3JA 3W5ZA 4UY8T 2JM8A 4HACB 1WOPA 2QSFA 4B3RF 3QIDA 4QW9A 1Q0NA 2FVRA 1U8RA 1PAEX 1N33F 4C0ZA 2P9CA 1RI9A 3UD5A 5KFMA 4E7HA 4ZVFA 4RW8A 1AEYA 1NAQA 4OX6A 3BO2A 3I9V9 4DOVA 1JB0E 2HQHA 3GIMA 4DR1F 4A4GA 4ITSA 3EVMA 3HJVA 3JB9k 2UZAA 5JUMA 2LCSA 3OW2R 4DR4F 4L75A 2W9AA 1EQ0A 3D6MB 4FXDA 1IN0A 2GFUA 3V4IA 4M78G 3X1LB 1FX4A 3OSNA 3CPWS 4TVAB 1YIJA 3RU0A 1W2BA 4X4PA 4X4NA 3SHWA 3P49B 2Z57B 3Q8YA 3MM8B 1H92A 1RTDA 1K47A 3G82B 4QOTA 4C11B 3J81Y 3TZXA 2JFKA 1HW9A 3NLCA 2A18A 3DFEA 4C8NA 2XMFA 2DYAA 4DV3F 2UUTA 4WK3A 3OS5A 4OJHA 3NAHA 1I1GA 2Q1LA 3BGFA 3LP1A 2DGVA 4WFAQ 2CG8A 2DVEA 1LWEB 2HHHJ 2PT0A 1CKBA 1A6LA 2I5JA 5I21A 4EMKB 4IKFA 1Y00A 3T9ZA 2XG8A 1NRKA 1GMVA 1WJ9A 5HLFB 1VYUA 3CCQT 3GV7B 1DTQB 2XMKA 3ZZ0A 5E3CA 1YRUA 2GMJA 3OB9A 4XK8C 5IT4A 4K4ZA 3W1YC 4GLKA 3H20A 4F14A 2A6OA 4FL6A 2CYYA 2R8JA 4K4YA 5GJVB 4A8KA 3B78A 2CZ9A 4KPYA 4YY3F 2D3UA 2PFDA 2BZ2A 3T41A 1XN9A 5J2PA 3SWNB 2J7KA 3ONQA 4A8XA 4PXCA 3DLGA 4AL6A 3TEHB 4LN2A 4DMZA 6FD1A 2LRQA 1ZZNA 2ESWA 1TK5A 2VG7B 2J05A 1Y0MA 4LJMA 2YHTA 3P6YC 4ZLNA 2KRSA 2YPYA 5KG2A 5FLXE 5KCOA 1N32F 3TARA 1GCPA 3DRSB 4RCBA 3KK1B 1UFFA 2H4YB 4ECZA 3GB0A 3OTOF 2VG5B 2KG0A 4K4WA 3M0RA 1T03A 2D3O1 2MYSA 4NCAA 3HHLD 4N4HA 1QLNA 5HP1B 4JS5A 2E1CA 2XSJA 1SH3A 2XMMA 5IAYA 3KJVA 2JLEA 3CWJA 1WC6A 1G8XA 3AOAA 1FK9A 1R27B 2X35A 4ZP8A 1IXKA 2DGXA 1H0HB 2JT4A 1VFJA 1R8AA 2KK4A 4NCGA 1O6XA 5E3QA 1NDCA 3QYHB 3MMBB 5KT3A 1KR4A 1T02A 1SJ3P 1CC8A 2GW8A 5HCKA 4JI4J 3D9BA 2HNYB 3E3XA 5J2NB 3ZTQA 2H51B 3GMGA 1BQNA 3C0CA 4USHA 1JLGA 3BDPA 1OX9A 4M5NA 4K50A 1YJTA 5EC7A 2DXFA 4KT0E 1VQKS 3GR1A 2R5AA 4B9UA 2YT6A 2HIQA 4DL0C 1RAJA 2WK4A 1KSWA 4QYRA 4A4FA 1QVGP 5C2GA 2VIHA 1LK5A 3MR5A 4O44B 3I96A 3C16B 1OYEA 5IS2A 3VV2B 2GHVC 4LF6J 3CIZA 5H9FK 2O5DA 4FBUA 2XMTA 4HVUA 3C95A 3RTVA 1WFWA 4OL8A 5HQMA 2P0PA 4I2QA 2D1CA 2CP5A 1HPZA 3Q8SB 1C4CA 1QLYA 2AZ1A 1T3NA 1U0HB 2IRYA 2CZ6B 5AXNA 2N3OA 3LP0A 1F2HA 4FU6A 4F0KA 2LECA 5KFBA 1SC4B 5A6WA 2GQQA 3JCMc 5H9EK 3L7PA 3I0RB 1VQKQ 3KUFA 2WSFE 1MHNA 2VGNA 1J27A 2DIVA 1RWVB 3JSCA 5I2SA 4JB8B 2DEIA 4QR0A 5CAAA 1HD3A 3MEEA 4M5GA 2V2ZA 2CSQA 4M7AC 1MWQA 2N3LA 3LP2A 3NMZC 3DOKB 3EE3A 2RNAA 3JS9A 1MUZA 2WVFA 3M30B 1ZM3A 4X64J 1XNIA 1NDKA 5KYWA 3HJFA 3HFOA 1QM9A 4RPFA 1RZMA 2DXUA 4C8LA 3DMJA 3HPWA 2EQUA 4DUZJ 2C2OB 5ETOA 2B9WA 3CCSA 1HI1A 4OB0B 2RU3A 3H2VE 5KT5A 1I5OB 5A0DA 3IS9B 5I3QA 4I6WA 2QYGA 2BMBA 1ZLMA 1Z9QA 1Q8KA 4ZGEB 3X3UA 5CYMA 4LF7J 3SZ2A 2X3XD 2DRAA 2K9GA 3HO1A 1HWLA 2NS1B 3VGVA 3I32A 4MDXA 4WTYA 3VUZA 5L1JA 5IC6B 3THTA 5A2QE 1IKYB 1N9RA 3J7ZT 4Q0BB 4OGCA 2DA9A 4B9TA 1TQLA 4RW9A 3GV5B 1GQEA 1YVFA 2G4BA 1K9AA 3PNIA 1GFCA 4JI2J 1XIQA 4EEYA 4CDIA 4WFYA 1S72S 3U27A 4TN2A 2DNRA 2RJDA 3QGGA 3WVEB 3NTHA 1NG2A 3LANA 1OZ3A 2GFAA 1VR6A 2BR0A 4B3TF 1NK7A 1MMDA 4WKRA 3JCMW 4USWA 1M90C 4I4BA 1B0VA 3TEEA 1NSPA 4PQUA 3CXCA 4WKYA 4A63B 5IQ6A 2EFPA 3BM7A 1WTFA 1H641 3KHRA 5CVIA 3OT9A 3KNAA 1O9SA 4DL4A 5HROB 2C28A 3ER0A 4QIGA 1BUXA 2FIUA 2V4QA 1X4EA 4UZBA 2VDIA 1JJCB 2XGQA 1YTYA 4C92B 1CSJA 3CCVS 2WACA 3EAEA 1VK3A 3A13A 2R7XA 4CH7A 3META 1VC6A 4ANCA 3WX4A 1FTRA 2XIDA 2DHXA 3CCJT 3GWCA 5LJ5j 3FSXA 1PWTA 4ZJOA 1NJZA 3CCSS 1S72Q 1R0AB 3CC4A 4B3SF 2CFXA 4RNHA 2NPIA 1D0EA 2WONA 2CUBA 4M77E 4A4EA 2CWXA 8RUCA 3ET6A 3EG0A 3OD2A 1VYVA 1JO8A 1VQYA 4KYZA 1VQNA 3I0SB 3NTIA 2FLLA 3GCXP 2QL7B 4LMZA 1N48A 5KFFA 1I94F 4C5EA 3QMQA 1UWAA 1YJNQ 2DO0A 4KFBB 1ZTTA 2ZBQA 4QWBA 2VH7A 3H9NA 4CH1A 1QUVA 1ACMB 2DH9A 4DR2F 3ILJA 3E01A 3R9LA 3OFHA 4OMMA 5GAMf 3CCVQ 4TNOA 2XMAA 4H4OB 5F9LA 3RB6A 1N34F 2DHHA 2Y1IA 1RP5A 2I38A 2ZVIA 3DOLA 3OYJA 4MKVA 3LAMA 3R7BB 2VODA 2FB7A 2I1RA 3QSIA 1CJKA 1FERA 3NKYA 4WJBA 3M2RA 2DR6A 2I6WA 2JH3A 3P4UB 1UGRB 2WTFA 3BSCA 4C8QF 4XTZA 1NCLA 3R6LB 1G4CA 2E9TA 4OIXA 1Y0HA 3T1HJ 1NM2A 1JLEA 3OVSA 4MMKA 3I55T 1E6YB 4IDKB 1A0OB 1YJRA 1PNJA 3MF5A 2DBMA 3R5JB 3CCQA 2LQNA 3PRVA 4C8ZA 3FZBA 2DJWA 2VICA 1FF2A 2RDIA 2NXNA 3ZZUA 1S1VA 2U1AA 3KK2A 4LRBA 5KAKA 3VUBA 3CC4S 2XY7A 2V2QA 2SRCA 2IHR1 4MYTA 3DU5A 1VQ5T 3HSJA 3GLXA 2QZ8A 2RS8A 4DWIA 4XTTA 2R8HA 2KFZA 3IC1A 3S01A 2AX1A 2MAMA 1UZHA 1X2KA 1MWYA 2ZBRA 2GTOA 4F16A 4AFSC 3M8ZA 3MPYA 3OJUA 5IV3A 2RNEA 1VQNS 1X9MA 4QVZA 3D67A 2QYCA 2B4OA 1SBRA 2FJAB 2K6DA 1D1AA 1OU9A 2WSCC 2C1EB 1FXLA 3X26B 3BSNA 2IAJB 4I6AA 4KULA 4L74A 3VQSA 2KU7A 3TCJA 3GQCA 1IBMF 4XU3A 3QWUA 1XNQF 3BYRA 4X4UA 2E5KA 4DEXA 3A8MB 1KQSA 2JL9A 3OXLA 1Q86C 5I42B 1XC9A 1YZ6A 2ZVSA 2KXNB 2Y0BB 5KFUA 2RHXA 3QWXX 3Q8VA 3I4HX 3R97A 1KKHA 2RHSB 1KQGB 3W63A 4DJBA 2QSWA 2ZBIA 1MU2B 3CC4Q 4BI8B 2LNVA 1NK9A 3IGVA 2R57A 3VVTA 3T6BA 4C9DA 3GYGA 3QFHA 5KFDA 2WW4A 5CKEA 5BJRA 1P9QC 4M78B 4X1VA 4IRKA 3UDLA 4JI1J 2Y8YA 4WF9Q 4EMDA 5B0GA 2EIFA 3LLRA 2K5LA 3MP6A 1AFIA 2XDBA 1VQNQ 2BYCA 1RWKB 3BR9A 1VJQA 3BQ1A 2KT1A 2GQ2A 5H1SV 4JUVA 4KBMB 4OLOA 3NGTA 3RKWA 4F36A 4J9DA 1G3TA 1M90R 3RRKA 1G3SA 2VQEF 2YKQA 3TVYA 3IFEA 1QVPA 3EX7B 4Z89A 2BEFA 3SFUA 4XPEA 1WG5A 1UJ0A 2RS2A 5KG7A 1VIXA 2IY5B 1UCNA 2F1LA 5F0WA 2RHYA 1Q81R 4RTTA 4ICLA 1X75C 4ZCIA 2QAZA 3Q8UA 4YR0A 1T3SA 4RW8B 3RMQA 1UEBA 2YNIA 4DHVA 1ITPA 1EETA 3ADAC 3EZUA 1LFPA 4LUBA 4J9GA 4BCAA 4B02A 1U7LA 4LRDA 1YLXA 3LGMA 2UV8G 3V4IB 1ZHIA 1HMVA 4OZ0A 2L5QA 1RWXB 1RB0A 2LCLA 3F0NA 5AE3A 1CQMA 5D8HB 1QVGR 1D0YA 4BE0A 2QV6A 3OPKA 1YITQ 1KQSS 2GJIA 4JI3F 1KFZA 1TUDA 1Q53A 5DJBA 3K89A 4NXNF 1VOMA 3FKBA 1RK8A 5D6GA 3HHLA 2BRKA 4RNMA 2ZDOA 1D9AA 3C66A 2DEUA 1RT1A 4DG1B 3OMCA 4JDSA 2FJWA 2YNHA 4RU9A 2B4UA 1U48A 1UHCA 2AJQA 4LF5J 3RGIA 3IAS9 1RACB 2K7AA 2V4JA 1TL7A 2PMHA 2LMJA 4OVAA 2MQOA 1NK8A 1ABQA 5T14A 1GMWD 3R27A 4PKCC 5GAN2 4PG8A 3QUIA 3HZEA 4J5YA 4CT9A 3OLBA 3OYKA 4EU0A 3GTYX 3QZ9B 3E19A 1ZZFA 5KOXA 2QLJB 1UE9A 4WFXA 4YB6A 1G2EA 2SXLA 1H7XA 5E41A 4RKUC 4B3RJ 2FJDB 1VQMT 1N33J 1RISA 3KK3A 4NPOA 2J6TA 1D09B 2E6ZA 2JWNA 3DLGB 3FEOA 1AYEA 4RJVA 1FDBA 2X1FA 2F8HA 2CPXA 4DR1J 4ZCKA 3AA8A 4RTUA 5DETA 1KVJA 1HW8A 2H5EA 2BQ3A 1N8RC 4DR4J 1JLFA 3I5RA 4KGZB 4YQWA 1YFNA 2JEFA 4OI0A 1X4AA 2AW0A 4OMQA 4DL6A 3IRWP 1OQKA 2BE2B 2X51A 2V4RA 3UD4P 3BH7B 1H8KA 2DXCA 5LJ3Y 4U7CA 4DBRA 1F5CA 2HKQB 1YG0A 4Y0FA 4J9LA 3J80E 2DT9A 4ZMMA 3BE3A 3TSWA 1RSCA 1CKAA 5JJBA 2JVRA 1N36F 3T1AA 4DV0F 2RF2A 4DV3J 2E1MC 4IH5A 1TXQA 2G0JA 1S0NA 3DLMA 2K2VA 1PSEA 2CUYA 4AUKA 4L73A 4ZHRA 5KFJA 2PTKA 2OI3A 3GFXA 4L5GA 3BB5A 5L23A 3L2WA 3TUZC 4YN3B 4OYPA 1BQNB 3JV3A 3QDFA 4M5IA 3WDOA 4PAAA 5E2QA 4WYLA 3CEYA 4MT1A 2B4PA 2QMUB 1K0SA 1YWXA 4DSJA 1SL2A 2WRMA 1LKZA 3CCJA 3R8YA 4X4RA 2MZTA 2Z2YB 4P72A 4DS5A 1NH7A 1M5OC 3UA7A 5CXTA 3D1QA 1K4US 4ANDA 4YY3J 2QLXA 4L72B 1C0UA 4U8VA 1UTAA 5BR8F 1HBOA 1JLAA 5HATA 4DV5F 4N8OA 2QGGA 3QZ8A 2H8HA 3UPUA 1NLOC 2NZ4A 2JW4A 4MTPA 1BE4A 2BBEA 1O5JA 3MM9A 2FGOA 2QLWA 2X1BA 4PL6A 4NA1A 3DYAB 1PAUB 5C24A 2OH2A 1WD6A 2ASDA 1ZUKA 3M4XA 1RYRA 1WF2A 2DR7A 1RWWB 2F65A 3OTOJ 1S57A 4C8KA 5D4OA 1EJ7L 3NWGA 4Y28C 4X65F 4J8OA 4LRAA 3DI6A 3IR7B 3EG9A 1VCTA 4M77D 5HBMA 1YWPA 2DKOB 1WYXA 1VI7A 1QVFR 5EHHA 3KUEA 4R25A 1W1FA 2R7RA 4Q5WA 3GSIA 1MW7A 2QI2A 4NEZA 1M0SA 3MEEB 5KFNA 1Q7LB 4KGXB 1YK9A 3CCMS 2CH4A 5KFTA 3GIKA 3AQPA 3H0HA 3NXZA 3C6TA 3LOUA 1NBEB 4BWMA 3U1LA 4ATOA 4DSIA 2ABYA 2DNYA 4C0DC 2QLBB 3JAME 1UEUA 4M7DD 2C0IA 3DMJB 4HCBA 1RHRB 2K8GA 5T7LB 1NEBA 4JI6J 1XQHA 2AEJA 2IIHA 3G6VA 4EO8A 3HT3A 1DY3A 3TNVA 4DOZA 2HK2A 4ZN3A 2IDEA 2VDHA 3MAAA 4MMOA 5CYMB 1U8WA 2F63A 1VQ5A 3RB0A 2XYPB 4KHMA 1VQ9T 3CPWR 2KDSA 2XM3A 3ULRB 4BACA 4NYPA 2LCCA 3QRQA 3IWLA 3CCMQ 2KJVA 2EFIA 2R3VA 4RW9B 2MQLA 4C0BA 3GYNA 3KNGA 1TU0B 4IYQA 1BQXA 5CH7B 5D6YA 2YRCA 4F3QA 3K5NA 1S10A 4LBIA 4DLEA 2QA4T 4RW6B 5ITHA 5LM7E 2CQIA 1WKJA 3UPFA 4TU7A 1UW4A 5KFLA 3A8GB 1KONA 2XWXA 4DI6A 4Q43A 1FWZA 2PD1A 4NLGA 2G2ZA 2F3JA 2IC3B 4KO0B 4LT6A 4IFYA 1X4FA 1N5SA 3BSOA 3KFVA 1WHYA 3GIBA 4HDGA 2P9EA 3Q83A 3FB9A 1BI1A 2YWGA 1RAFB 3KYLA 2LA4A 4NZ0A 3OBWA 1QKWA 4QR2A 4ZP9A 4C92E 5KG4A 1VIFA 2GJFA 4HEA9 2DL5A 3MDFA 4WFNQ 1LWXA 4C0GA 4UF4A 3KFWX 4WZMA 2KYXA 1TL5A 4ZK7M 3QJLA 2QK0A 2ADCA 2CP0A 3FFIA 2M8DB 1MV3A 3NS5A 1YJUA 4OI3A 4XTVA 1T05B 2Y4XA 3CJSA 1SQEA 3UF4A 2GQVA 2O66A 1IR1A 3R1HA 3EYZA 2R2SA 2YBVA 3S1TA 1KOOA 3FEZA 4RTWA 2HS3A 3MUTP 2R2RA 1LCKA 4LNPA 5KYUA 2CQ4A 4ELZC 3D6TB 3C6UA 1N4LA 3MOZA 2ROPA 3HF5A 5KG5A 2ADBA 1BYMA 1D3WA 2JTFA 4YMEA 4Y2KA 3M9OB 4O4GB 1B3TA 1WHMA 2VUBA 3N6LA 2OPQA 4HCKA 2FHDA 1KFDA 4HCZA 3MEGB 1HWJA 3RBEA 2DM1A 2JNJA 3TYTA 5K14B 3VCDA 2DERA 3TVKA 4OZLA 4B3TJ 3HLUA 3EGVA 3DOLB 2R42A 2BKNA 3L95X 4KGMA 2YNGA 3SMZA 2CPHA 1BMQB 2F4VF 2K2MA 3K58A 4B9WA 2FVQA 4CLPA 1CJKB 1LXJA 4ZKAA 2AV5A 4MYUA 4X4SA 5DM7Q 4EYIB 3KJFB 1VHIA 4OMNA 2FHJD 2V8GA 1NYFA 3IO1A 4WIQA 4M1KA 3M0SA 2E5HA 2OP5A 1J3TA 5HMZA 1VLYA 4OJ1A 3NS7B 4ILRA 5IC4B 1KVIA 1SHFA 1EIFA 3N01A 4ED4A 4EWTA 2EW9A 4RR5A 3CBOA 1FKOA 1Z2LA 5A0YA 3PYFA 4OB2B 3DM2A 4ANEA 4TY8B 4QKUA 3MM5A 4O3PA 5AJ3F 1P6TA 2MGZA 3B4DA 4B3SJ 2K57A 2YXLA 2QTWA 4U96A 4LSLA 1RCOB 3EGDA 4HYKA 3KK2B 2D7SA 4LF2A 1C0TB 1FJEB 3HTRA 1FE0A 2HAXA 1VQ6T 2LCWA 4Z2XA 3GV8B 1VQMA 1WEZA 4ZGJB 4LDVA 4TYAA 3D66A 4CQ1A 2HLUA 1QUPA 2OSRA 5B0FA 3W5XA 2AEFA 4ZPBA 2R2TA 3ZZOA 1ZPVA 4E8UA 4XO0A 1I94J 1N5YB 3H4BA 4CO0A 2CDTA 1X4CA 4U95A 2QA2A 2KQWA 2QE5A 3CJKA 1N5QA 1KD1U 1RWMB 3SI8A 1E7OA 4O3OA 2ZH9A 1NHVA 2JC0A 1Y96B 2HVHA 1WC5A 2EW3A 1RTJA 3GBQA 1S1TB 1N34J 2BXJA 1WI7A 2QTVA 1CULA 1BU1A 1KOHA 1B7FA 1HWIA 2QMXA 1G7CB 3C4SA 2W4PA 2DNQA 3ZNUA 2KN4A 1M1KR 3QRPA 3CDEA 4HT7A 1S5ZA 3N28A 1SCJB 1RKJA 2BANB 2RDJA 3Q2TC 1IBLF 2ZH7A 4M78E 2HCKA 3TUIC 5IWAF 5CCMA 1TSFA 2LDIA 1HQEB 3RMSA 1MN7A 2M5YA 2EYWA 4LSNA 1KK7A 2GZOA 4NWBA 4AFUC 3MMAA 3LALA 2P4TA 3H98A 2IRUA 1SJ1A 2YKMB 1HKAA 2W7PA 2IRXA 3RBDA 3SQGA 2JOQA 4RLEA 1N9SA 2N4CA 1TUGB 1X43A 5LJ3g 1K8AU 2J7WA 4N7TA 1VIOA 2XHWA 4PXDA 3LWMA 1HBNB 2X7IA 2W2QP 1H38A 4DCJB 1NU4A 4KV8A 2LP4A 2RILA 2EPDA 3OW2A 2DTJA 2K3IA 2NXUA 4KKOA 1BB9A 2RJEA 2DX1A 3L1AA 3SIPB 2K79A 4ICLB 1RT5A 1APSA 5GANg 1NLKL 1QE1A 3TZWA 1GMWA 5FWBA 3PACA 4J7CA 3T1YF 2CA9A 2IBOA 2ZH8A 1WF1A 3I5CA 1FWKA 2Z56B 2AHOB 5FJ4A 2OPRB 5L1IA 1IBMJ 3JQJA 3OYHA 3RRGA 4J9UE 2PO4A 3X25B 1XNQJ 3CJ3A 1JJ4A 1BK2A 4TQSA 3KLVA 1ZTWA 4Y34A 2CZ4A 3W3SA 2DPPB 3VR1A 4P6QA 2RI3A 2D9PA 2HFZA 5DDQC 1KQ1A 1FRJA 3G6ES 4G1QB 3CD0A 4X9CA 6AT1B 3M6XA 1OO0B 1VQ4T 1RT1B 4C8QG 3OUYA 3PW0A 4RTZA 1KSPA 1OSCA 1JXMA 1GRIA 4XQ3A 2RH2A 4OJ3A 3TAMA 2KH9A 2R7VA 4IG0B 2FL7A 1Q5YA 2V4JB 3FMBA 1PC4A 1OV3A 3GJTB 2F40A 1RTHA 2A28A 2UVVA 2MKKA 2KO1A 1NHUA 3IQLA 1TKXA 3M8QA 3Q8RB 4DN0A 4DSKA 2VQEJ 1FRHA 5CQGA 1M2VA 1RHQB 3QQCD 3M0PA 3H41A 4PFZA 5LL6d 1GT8A 1W6XA 1UVLA 3TU4K 2CQPA 4ZN1A 3OL6A 2AJ1A 1ZSZA 2E66A 4PJOD 2OIHA 2KR3A 1V9OA 5G0RB 4DR6F 2MQPA 2EI5A 1KLMA 4RL1A 3OW2S 2DRKA 3PMTA 4ED5A 4EDUA 4Q5VA 4C7QA 1Q5VA 1W2IA 2RU9A 2DR5A 1FO1A 3M53A 1VQ9A 3G6EQ 1Q1KA 4FYYB 4BC9A 3D5MA 3D0GE 4WP8A 3R2DJ 3J81U 3SV4A 2PI4A 2OFHX 1AZEA 5KE3A 1U1TA 4XDDA 2D0NA 3D3CJ 2ROEA 3O6QA 1H6KX 3MAHA 3HPOA 1K1SA 3NPFA 1U5SA 2JLGA 2EWNA 2CZVC 3QYGB 2H9ZA 4DBFA 3L2VA 4VUBA 3M55A 4WF2A 2DGQA 4OHVA 4CM2A 5IT9Y 3RERA 4M75F 1FJ7A 4JI3J 2QQ9A 4BY6C 4WXWA 3FBBA 2YWFA 1K0VA 1YHQT 1YGYA 2EEYA 4NXNJ 4DQPA 4A8YA 4NYOA 3V6DA 2LQ5A 2MPXC 4EIKA 5GADI 1OJ4A 2HEKA 3HVTB 1M90T 4UOGA 2HHQA 1X4BA 2XMUA 3A3NB 4B3OA 2D74B 4F4WA 2RN8A 4M77A 5LMNF 1M1HA 3CD6Q 4B9XA 1FFSB 1QDUB 1UGVA 4X9DA 1BCMA 1RI0A 1Q81T 1TL3B 3PJ9A 1YI2Q 4QR1A 5HVGA 3CDAA 1FYNA 5HVFA 2IBKA 3OYAA 1ZETA 2KE9A 1CEZA 2FPEA 3CBPA 4OI1A 3WBZA 1S1NA 3MFHA 3AD9C 2M51A 2OD6A 3ZXWA 1XTDA 4FT2A 2BACA 4Q7AA 1C0UB 4M7DA 3CCRT 2EC0A 1JLAB 3WVDB 3D1OA 3RAMA 2ZZNA 3WC2A 2Y9HA 5C25A 4W90B 4OGEA 4C92D 2DF6A 2ED0A 3JB9I 1AUDA 2HHPA 3HHLC 2B51A 3MUVP 1VQ7T 1M1FA 2LX7A 2DNOA 2DH8A 1WKLA 5C24B 3ENQA 2GVZB 2H54B 1BWVA 4P52A 4PEOA 3FC9A 2RB7A 4KBIA 3ZBDA 2VG6B 5GAHI 2R9LA 1YJWT 3CCLS 4M94A 4I2PB 1VRTB 2IJRA 1H2UX 2RAQA 2IG0A 4IIMA 2OFGX 1RU1A 3J80U 1Y5IB 3EG9B 2E3HA 4Y2MA 1JIHA 1T9YA 2HNZA 4GLMA 3BN7A 3IR5B 4OQJA 1ZH5A 1W70A 2GIRA 3BPSP 2DVIA 3MCSA 2MSTA 2IYIA 1N36J 4DV0J 1ARKA 2NUHA 4GC7A 4N0AA 4PLIA 4MKYA 3BF4A 2QQBA 4QWAA 4OHXA 2E1AA 2CJYB 4LREA 1KC8R 3JYTA 4IO1A 4N76A 3G1JA 3AY0A 1UW9A 4RW4A 2W2PP 3OS2A 1VRUA 4C0OC 1H2TZ 1RAGB 4XAKA 3KMQA 1SPBP 4OB1B 2J6OA 2P0KA 1VQSA 2AJ4A 1SKRA 3CCLQ 1YBAA 2FY8A 4A8OA 2K3BA 2UUAJ 3AH6A 2UVUA 2HFOA 1NK6A 2W8KA 3MAAB 2VOPA 2XI9A 2NZCA 2XYGB 3AB2B 3M6UA 1PC0A 1X5OA 2YWWA 3EHRA 5BR8J 1VQ6A 1EARA 2X4YA 4N56A 3MO8A 1Q81U 4AE5A 4DV5J 1OMSA 1EX8A 1GMUA 5KFYA 5A8RA 4N4GA 1I8FA 4NZ6A 4U8YA 4DCPB 2IJNA 4FXWA 1TUVA 4JJBA 3JSBA 3KBGA 2O01E 1M5VC 3Q8QB 1UPMB 1Z2ZA 3VAMA 2YDLA 3P5BP 3HRSA 1S6QA 2XTJP 1L3VA 1UTIA 2LQWA 3U7JA 2WVDA 4JP8A 4P9SA 4RBVA 1TKZA 3TP2A 4X65J 3LW5C 5M2UA 1SUQA 3PR4A 1PM3A 3V2UC 3ULHA 4BE1A 3LA0A 2ENMA 2MKHA 1DARA 4DU7A 2EK6A 1RDRA 2FJXA 2D41A 3MEVA 3V7SA 2DTIA 3PIOA 4IFYB 4IUFA 2WSEC 4URGA 1GFWB 1NZAA 2AJFE 4DXLA 2KTQA 1WJSA 2GVDB 2YNFA 1OPKA 1ZAWA 3AOCA 4HACA 2QGFB 1PBUA 3OA6A 1K1ZA 4IUQA 2YWKA 1NK0A 4NL3A 3KMSA 4ED2A 1SL1A 2B8AA 4PLLA 3PKMA 4AG1C 3MEWA 3HP6A 2Q6CA 4B9SA 1K73U 5IXUA 1AXQA 3V8LA 2QQRA 4LUEA 2A3JA 2FHJA 2ZNZA 3EDRB 2IJFA 3FJ5A 4FW1A 2HRUA 2HVEA 1YBTA 2KEAA 2FJVA 4E7KA 2ZE2B 1TUWA 4FF1A 2AYEA 3MECA 1UPPA 3OYDA 4AYBD 4X4OA 3R5CA 3M54A 3QT8A 5DO2A 1UHFA 3EGWB 2MZSA 4QIWD 2V94A 2YQ1A 2JMCA 4M78D 2ZBCA 1JXOA 3MM8A 5KYUB 3D3BJ 1TR0A 2VYTA 3M8SA 4E7JA 2W10A 1XMQF 1VQ6S 2JS0A 5A6PA 1H3HA 3G82A 4C11A 2DL4A 3CEDA 3QBYA 4HI2A 2CJQA 2XCAA 2W25A 2COZA 4J9PA 1W25A 3UO0A 4ZVRB 1JXLA 3UN3A 2BX6A 3PKYA 4AFQC 2VKRA 2QXFA 4FW2A 4ZJQA 3VHQA 2JXBA 1WGSA 4YB1P 4EMKA 1UP1A 5KFEA 2HK3A 4L59A 2O88A 1PYOB 3PX0A 2E9RX 4R5PA 4YR3A 4KIAA 5K5MA 1DTQA 3NFCA 3A8EA 2XMWA 3TOQA 2FHKA 5KFVA 2AF6A 4FF3A 5GAMg 3HULA 2LYVA 1QSYA 1UJ4A 2DNKA 4MJKA 2KRRA 2Z8QA 1JK9B 5L8RC 3V5RA 2MPUA 5HJXA 1IVZA 2KRNA 1OQ3A 1U49A 1H3DA 1VQ4A 1RT4B 4OMPA 4G1PA 3C2PA 1RT6B 4OYZA 1RU2A 3SWNA 3W2WA 3CULA 1FD2A 2MKIA 1FKOB 2HWHA 3GP8A 5A0YB 3LH2S 3DM2B 1IHVA 2HWIA 3CMES 2BA9A 5DGBA 3IRXA 3QO9B 2BE9B 2E64A 4CLFA 1X60A 3JSRA 4DQRA 2DXBA 3B8HA 3KJQB 4BWJA 4DV6J 3DRSA 3E9GA 3TX0A 1HNVB 2VG5A 4OHWA 3RBXA 1WHVA 2RHIA 5HP1A 3M32B 4CLUA 4OZNA 4P7TA 2DXDA 1P1LA 3R6GB 5KFXA 2FHMA 5CQXA 3CJ0A 3VGUA 2DEJA 1SPKA 3G4SS 1SHGA 4NZ7A 3W9JA 2X1AA 4LBHA 4LFAF 1GAOA 3W8GA 1HD0A 3H5XA 3R6NA 2HHUA 2LQBA 2PFFB 3MMBA 4AQYF 5D4PA 3G2XA 3UWNA 2K5FA 1HR0F 1UJ5A 1RT7B 5DQIA 1JB0C 2HNYA 3O5ZA 2HURA 1I4K1 3H6ZA 2HFVA 3CMEQ 2J8SA 4DX8H 3M7VA 4PNOA 2F4VJ 2KSSA 2HZVA 2CQ0A 4N4IA 4N5SA 2RQUA 3JB9H 2PMWA 1YHQA 3W7BA 5A8WA 2RMOA 4KSEB 3LGFA 4JI7F 3X28B 1CJVA 4K4SA 1I3OB 3TAPA 3CO9A 3G86A 2HYIB 1KNZA 4FYDA 4O44A 3NGPA 3C16A 2RHZA 4N41A 3UNGC 7AT1B 3LX7A 1VQ4S 3ILIA 2JZ2A 3MMAB 1LW2B 3G4SQ 1TS9A 5EX3A 3VRYA 2NUUG 1M3AA 2X3DA 1HSQA 1PJ5A 2XY6A 2GBQA 5AJ3J 3PFOA 5B09A 1FDAA 3L4BC 1I07A 1U0HA 3K5LA 1BHNA 1WNEA 4LF9F 1U1QA 3A5ZB 3J7AN 1K9MU 3A8JA 1WSRA 2NYIA 4KV8B 4C8QB 4I56A 4KKOB 1U47A 2RHQB 3BS9A 1RT5B 1S12A 4ER8A 3CCRA 1XMBA 1WG4A 2B9XA 3SDEB 4ECVA 3I0RA 2JN0A 5GJWB 1RT3B 3RUXA 2HZCA 1GX6A 1QVGA 2P6TA 3HI9A 3OTDA 3OR2B 3UQSA 3MEDB 4BUGA 4HKEA 4J9KA 1VQ7A 2DZCA 4CO2A 2MTLA 3HD1A 2ZWOA 3PYEA 1JX4A 2E12A 4PJOA 4NLRA 2O31A 1H3ZA 3QWYA 2C3YA 4O0IA 1M3BA 3DOKA 1YJWA 4RUHA 3US5A 2PU9B 2CZ1B 4OI2A 2GQCA 3L2RA 4Q8FA 1ZX6A 2R7WA 3CSKA 2HZYA 1VQKT 4F04B 3HXMA 2AZSA 5GMEA 1EQMA 1WOOA 2JJ9A 2CQBA 3C46A 1N0UA 1F5BA 1PCAA 1HNIB 4KHPF 5E3RA 5EWFA 3IS9A 1F9HA 3IP0A 4FXVA 1IBLJ 3JTOA 4YUDA 2A0FB 3C15A 1O0PA 4ZVHA 2E29A 1OPZA 5IWAJ 3ELHA 3MR3A 2PQWA 4F8RA 2LXIA 3BGRB 1NE8A 4F4YA 3G7ZA 3N6NA 3TAMB 3SDZA 2BTTA 1D1UA 5DM7R 2WVBA 4GO7X 3GJSB 5D6XA 1YJ9S 3QZ7A 4NXMF 1RTHB 2E5JA 3MZIA 4OYOA 3HVWA 4ZVTB 3M8QB 2N7YA 3PRBA 2G0IA 3QAUA 4QQGA 1MMLA 2QT7A 3JXOA 1OZ2A 4CNZA 1FJGJ 3H5YA 3AD7C 2NQPA 2MLYA 1ZSZB 3KG4A 4PYDA 4PZVA 4BD3A 1FVQA 5RUBA 3NMRA 1S1XB 4UZCA 4NLOA 4GKJF 5FDLA 1G2BA 1VDHA 4IQXA 1VISA 1V5IB 2CDQA 4KT0C 2IM2A 3OYYA 1UA1A 3CCRS 3T1YJ 3AA9A 3KLHA 3N79A 4H4MA 2RK2A 2EVZA 4J9CA 3REBB 1M1KT 4YB7A 3WXMB 1YBUA 1QVGS 3T5JA 3O1LA 1YKWA 2DYIA 3BPDA 2ZKTA 5DQHA 5HROA 2E6NA 3I56Q 3X24B 3UNYA 4FS1A 1L3UA 3T6JA 2C3MA 3ENWA 5KG3A 3KLFB 3DB3A 2O67A 3OHAA 1DBDA 1YJ9Q 1YJWS 5FRNA 4C92A 3FCVA 1NJIR 4LBPA 4UUWA 2CPIA 2Z4PA 2HVDA 2DISA 1KFSA 3TVZA 2W4DA 2VPWB 3BSAA 3LWIA 4DPOA 5F8HA 3QJ6A 2CH4W 3BGUA 3M0UA 5U47A 2M8HA 2V8VA 2YWHA 2BJ7A 1WOSA 2ALZA 1R0AA 2DPIA 3ZTPA 3NGUA 4HHUA 2MJNA 5DY9A 3MD3A 5GMKh 3GSDA 2GGPA 3UCUP 1VRQC 2WSFC 1K76A 1U2FA 3FSYA 5KG6A 4NLWA 4J6WA 1X5PA 3I0SA 2W9CB 3JB9F 3W62A 5KT7A 4MFBB 3MCAB 1WC1A 4K2XA 2V68A 1WZOA 5F8LA 4O3QA 3AJDA 1S72T 3S3OA 1LV5A 1YSJA 4FPIA 4FZVA 4KFBA 2HZAA 5L38A 1U1KA 3U1NA 1KDNA 3JSYA 2EWHA 4M7AD 3FLGA 4HTIA 2MOXA 4HHJA 4M7DB 5L9XA 3FRNA 4F4AA 4H4OA 5K8MA 4F2RA 4DR6J 4ZIVA 4E2FB 2OTJS 3RBBB 2KROA 1RBOB 4JBCA 3AQOA 1RLPC 2ZOFA 4HH0A 2OTLS 3MTKA 3GYXB 4OYMA 2RSQA 2H4WB 2FPDA 1YJNT 2PE8A 2OHDA 3PVXA 2VF3A 4J9HA 3W66A 1IZ6A 2DRMA 4ZOSA 2L9DA 4DSEA 4J9QA 1WXBA 3CCVT 3ISND 3KHGA 3GOXA 4Z88A 3PYGA 1E6YA 2QYZA 4AMCA 4IDKA 5HMWA 3OV7A 2FVSA 4F0HA 1HNZF 1PSDA 4HXJA 4GY5A 1PG5B 4M5HA 1B0PA 3MR7A 3CCST 5IQQA 1CS4B 4LIRA 2CQ2A 1IRXA 4C8OA 3TREA 1V1CA 4QWCA 4C92F 2DKGA 1AWJA 2A2DA 3QGIA 1RT2B 3MM6B 3OYGA 5FU6B 5LXYA 4WZQA 2DHSA 5I3PA 3FVYA 4L76A 3H7HB 3AHPA 1SKWA 3CCES 3M0QA 2CPYA 2OTJQ 2M7SA 5KFPA 5LMNJ 4IFVB 4KAIA 2Q43A 4WYWA 1IM6A 3JYTB 3C94A 3RNJA 5KT2A 3INZA 4DZDA 3RR8A 2WHOA 4JS4A 2OTLQ 2W9BB 2PMZD 2Y3YA 4RW4B 1YX2A 5EDWA 2KZMA 1QY7A 3QT5A 2LQ8A 1LEOA 4N47A 4QW2A 4CT8A 5KG0A 2E4HA 3CPWA 3H0IA 3MM7A 1OYXA 2RDDA 2DYBA 1S1UB 2C2RA 1LXNA 2F4FA 4QVCA 3V6JA 1KS2A 2L41A 2EGCA 4M5DB 4ZVEA 1TVRB 2V6AA 3SQOP 2AZVA 1IBKF 5I42A 1VC5A 2ERRA 2QN6B 3VAJA 2V5HG 1KTVA 1WHHA 1MU2A 3JCMf 4M77C 1R6VA 3CCEQ 3V8KA 2L08A 2XMJA 4URQU 2GMHA 1GK8A 2DNUA 2CQ3A 5KFGA 4M78A 3UW1A 4QU6A 1NZ9A 1OY8A 3FJ2A 4H4KC 2LC4A 3MKDA 2VU5A 4X4VA 5IHNA 4CM0A 1VQPA 3UVJB 3MEUA 4DX6A 3W61A 2M1HA 2XB2D 1SH2A 2L3RA 5J1EA 2QQAA 5EN1A 1SL0A 3PW2A 4M75G 2H3EB 2HQXA 1M5SA 3BQ0A 1NJXA 3CC4T 4NL5A 1VQLS 4M7DC 3CQTA 4RX6A 4B9MA 1S9GB 2LQJA 2L0AA 3A8IA 1WIEA 4MK7A 4Y2IA 3D2WA 4O5VA 5GAN7 1VQNT 3HDSA 2YX7A 4OYBA 2RE1A 4JOUA 1TV6A 1IBCB 4OX7A 4OMOA 1S77D 3UR3C 2FZGB 1Y71A 2F5GA 3CF5Q 3WHIA 3MECB 3HSDA 2FLPA 1C1BA 2DK2A 2OEKA 3H40A 3FJPA 3OQ2A 2O2OA 4KC5A 3OYCA 3PYDA 2W24A 4RBUA 3QLHB 3BY7A 2EYYA 3HZGA 1KBRA 3IXQA 2DR9A 1RADB 2V1QA 4PR6A 3GIJA 3MCOA 4OMLA 5IN1A 5GMKe 4DR7F 1VQLQ 3K8VA 1URRA 1QTMA 2E10A 4N0AC 1KQFB 3SYZA 3NCRA 5C42B 2FQQB 2JEGA 1L3KA 2BW2A 4BHQA 3BR8A 3OS1A 5ETLA 2RI2A 2C2NA 4UQGA 2POKA 4DG1A 2KVQE 2P0QA 1E6VB 1VLOA 1XR5A 2WAQD 1MROA 3G6XA 1IREB 3EGNA 3H90A 5SUHA 3JCMJ 3CC7Q 3VAHA 3F44A 3FBFA 4BI3A 3CD7A 1WHWA 4MH8A 3SV3A 2ASJA 3BW1A 1U45A 4R5PB 2W7OA 2NWMA 3N5BB 1KC8T 1VQKA 1R0BG 3BN4A 3EPIA 1VQPS 1Q82R 2G9OA 1TELA 4EMGA 2JSXA 1LWCA 4E0DA 5D0EA 3M2UB 1KIKA 4ZVQB 2ZH1A 1EHWA 4DV4F 1F60B 4R8UB 1X01A 2YRDA 1A0NB 4CI0C 4ZPDA 5CCLA 3QG1A 5JVHQ 4EUVA 4QYZK 3W2WB 4M5JA 5J2MB 2EJFA 5LSLA 4DV1F 2ZH4A 2MY7A 2O3DA 5CKDA 3M9QA 1A9NB 2Z30B 3FK4A 4QQDA 5T41A 3TVTA 2J0WA 2ATLA 1RWOB 3IRXB 2HQDA 3MURP 5IOLA 3KXDA 2G2YA 3MMCA 3LYIA 5KFOA 1HWUA 5LJ3d 2FG0A 2GV1A 3HD2A 2EKNA 4A54A 1WHLA 2GQIA 2BE2A 2ILZA 4TKTA 3TEGA 4B17A 1RTIB 4C8MA 1S76D 1VQPQ 3KLGB 1XMQJ 3EGXA 2AIRB 5LJ3h 2BJ1A 3CCUS 1SIZA 3TX8A 5GANd 2F2XA 2DMOA 5ETPA 4OV1A 4FS2A 3UATA 2YVSA 1B70B 2EQJA 3ILOA 2UP1A 3SCKE 2GJ2A 2ZH2A 3DXBA 5B0DA 2CG4A 1H72C 5CZXA 5GANh 2C3PA 1PYTA 1IKXA 3W9HA 2L3MA 3V6HA 4XTUA 2HGLA 3RW6A 5GAN8 3UI3A 4LE9A 1GXIE 2CPZA 1G6BA 5DDRC 1VBXA 4IUTA 4U7UK 3V81A 2OPSB 1RGVA 1GH8A 5D4NA 2XZTB 2KM8B 2OGUA 2HL3A 1OOTA 5A8WB 1XJWB 2EBPA 2DTOA 1CJVB 3QGHA 2NUPB 3V8JA 1NK4A 5B0EA 4C0HA 4ZVPB 2RQCA 5LSOA 1KG1A 3AJ1A 1NDPA 5DG9A 2ZPIB 1RWNB 1BKBA 3CCUQ 5HN0A 3J81j 1KC8U 2CPDA 3KDNA 4ZIWA 2V2VA 3T5LA 4DFMA 1RKIA 3HFVA 5D3GB 5ETMA 1XNRF 4NI2B 2MMPA 1FFWB 2X4XA 5GADU 2BOPA 1M5KC 1Y07A 5LMUF 3DYAA 1S72A 2ROGA 4EMKC 1KD1R 4DQQA 3DKMA 2DB1A 3TRGA 5K9FA 4C8QE 9ATCB 1V29B 4HA8A 4TYBA 2ZOMA 2PVGB 1BWEA 4J9RA 2X3GA 5GAGI 1UDLA 2E5GA 2LXFA 2PUOB 3G6YA 2CP3A 3S3MA 3QO3A 4NLPA 4ECRA 1SG5A 3PCOB 3KHLA 1UVKA 2V34A 4RUCA 4BC7A 2GIQA 1WORA 4LFAJ 2EKYA 1UB4A 1YJNA 2VBYA 3SWNC 4F02A 2I2LA 4D8KA 3SB2A 3Q2SC 4PJOB 3KUHA 3FGVA 1HIYA 2F9JA 3JTPA 2DL8A 2G6FX 4AQYJ 2ZUGA 5I22A 2DILA 3CCVA 3TO8A 1HR0J 1N52B 4J9OA 1QAIA 3EXYA 4EZ6A 1HLWA 1G3YA 1KHCA 1C1CB 1OY9A 2VC1A 4MKBA 8ATCB 4OZ2A 2HFNA 5T7LA 3THVA 1N27A 3DDNA 1K8AR 3FBCA 1QCNA 1N0VC 1BGXT 4RU2A 3LGNA 3KOAA 3EH1A 1Q8LA 3QATA 5GAHU 3C15B 4JI7J 2B7BB 1MN9A 3DDKA 3IBWA 4HT5A 4DR5F 4JYAF 5D78A 3H0PA 2GIFA 1S59A 1B7TA 4DFJA 2O4XB 3PXGa 1QD1A 5LJ5f 1RBAA 1U02A 2CQDA 2YUOA 2R7OA 2UU9F 2B9EA 2E1RA 2XBPA 1F3FA 5HKCA 5K20B 1FRMA 4FBTA 1HA1A 2JDJA 1BQMB 3ZC4A 3GR0A 4LQ9A 2YKNB 5DG7A 4F7UA 1DTTB 5FDLB 1UECA 3CT9A 3CTRA 1EX4A 4BDYA 4RW6A 2B0GA 3FRYA 4KH1B 3M5AA 1WWHA 3KLHB 4H4MB 1F9EB 1D8ZA 3CCMT 2IC3A 4KO0A 2R7UA 3C14B 2XQCA 2HG4A 4D8DA 2Y1RI 3MR2A 2FPFA 1S99A 1YJNS 1Q86U 4A53A 3MFIA 1TWBA 2HIYA 3HT0A 1RL2A 1SKUB 2DGUA 4ID8A 2EJGA 8AT1B 1Q81C 2WCXA 4O4RA 4GO5X 3EPGA 1ZSGA 2VZ9A 4Y3CA 3POTB 2XO6A 4OB3B 1H73A 3QIPB 1J5EF 2M3DA 1MMGA 4CLYA 4EBCA 2M52A 3DLEB 2CZ0B 5GMKa 3DHWC 2G1HA 3TWZA 4CLZA 1T05A 1AB8A 2CPEA 1S0VA 5LJ3e 2CQCA 2AP6A 1IHWA 3M0TA 4DEZA 1AWOA 5FLXY 5I2MA 2CVIA 3VS7A 2GGPB 1LW0B 2JMAA 3OYLA 4F7UG 4A8QA 1JEGA 3QJJA 4WU3A 1AW0A 2XLIA 2HVZA 2YUQA 2FVUA 2MJUA 4NXMJ 3URGA 5GANe 4PJOC 4CLSA 2M0GB 4DBHA 2QTXA 1XQIA 1PRLC 1S79A 4M7AG 2QDLA 4HR2A 2YXYA 4O4GA 1Q4RA 2ZZTA 5GAN4 2EG1A 2IM0A 4B9NA 2RQ4A 1RWPB 3MEGA 3GNFB 4M7DE 3HVAA 3LH5A 1Q7YR 7FD1A 5K14A 1X6GA 4OZ1A 3QJPA 2Q66A 3UT1A 3CJ4A 5ECAA 3PTWA 1X27A 1GL5A 1TK0A 3L09A 2NUTB 5B0AA 3UDEA 1K0XA 3MJXA 4FYVB 3OYBA 4I7FB 3MHXA 2DGSA 2NR0A 2KYMA 1OULA 4PJLA 1VQ8S 2XGPA 3M9MB 3L7OA 4NLUA 4LQ3A 4LSZB 3CD5A 1H98A 3O44A 3DOMB 2KT2A 4JV0A 4H54A 4ED0A 1TFWA 3H5UA 3EH2A 4ZGDB 3JRZA 2K5IA 3VGTA 1HFEL 1KQ2A 3ZTOA 3DRRA 2WZ1A 1FTCA 1C1AA 2BUDA 1X0PA 1YITA 3U02A 3QRRA 3TQEA 4TY8A 3IBFB 2MEWA 3RKYA 2COWA 3BV8A 2DNGA 1ZYQA 3Q24A 2L9NA 4C4WA 1U06A 4EBDA 4X4TA 3CMAQ 1KP6A 1T94A 2VC8A 1JWWA 1C0TA 2PN6A 5E0OA 5CD4A 3VGSA 2AYGA 2UUBJ 1YWOA 4ETXA 4DL3A 4CO4A 2MXYA 4LRFA 5D0RA 3PVQA 4KRWA 1M4ZA 2FLOA 1SH0A 1VQ8Q 2VFTA 4ED7A 3G8QA 3R5BA 1NXIA 3HHTB 1F1BB 1RABB 3GONA 5KE2A 3JB9J 3K2YA 3TSZA 3OQ5A 1BY9A 2P5VA 4AFFA 3DRXA 4OJGA 3HVRA 2KY9A 2LZ6B 1N5YA 4J9SA 2PIIA 4M75B 2W8LA 3VJPA 3MM7B 1N6QA 2RO0A 2DRBA 2G1DA 1HNXF 4C92C 3DKDA 4USTA 1Y96A 3H25A 1WXUA 3R7NB 1FMKA 2EGAA 1S1TA 3AJ2A 3QWPA 1OY6A 1WTBA 3VYHB 2UVWA 1VQOS 1N8RU 2LEBA 1RTZA 4FCYA 1NJIT 2EGEA 4O3RA 3H2LA 2FUG9 2MZRA 5GMKj 1FXDA 3PIPQ 1D1BA 1S4FA 4QCLA 3H0FA 2BANA 3SEOA 3QGPA 2UUCF 3I35A 2RMLA 2F9DA 3CE8A 5B0CA 2UV8A 1RI7A 1VC0A 2IM3A 5D0HA 4DSLA 2BKDN 1HQEA 5CCAA 1D9DA 3W60A 2E5QA 5F8GA 1I6JA 1V3SA 2DNHA 1HNZJ 2FHOB 2MYFA 3E1SA 4QIVA 2BM0A 2NSBA 2YKMA 5J1EB 1PO6A 4XDCA 4ZCLA 3RUBL 3H59A 1CBKA 4P74A 2OPPB 1VBZA 1YITS 4PABA 1HBNA 1HK9A 4ILMA 5GAMd 5BYRA 4CLWA 5A2QY 4JLGA 2CRLA 2JJ4D 3THKA 2AU0A 3I31A 2J8AA 2HPUA 4HH1A 2YQ3A 4YOEA 1WDTA 2KG1A 1HHSA 1SVDA 1Z1ZA 2M9KA 1AWWA 1G5VA 2BKOA 1VQOQ 1HJDA 2ZFHA 2MF2A 2F5TX 4ZNXA 2L8DA 3V6KA 5EWEA 2QX0A 5DLOA 5GAMh 1TV6B 5CHCB 2ZDPA 2CADA 4HCCA 2FO0A 4B08A 1I51B 1UFKA 5G4DA 3JB9G 4NLSA 2HKEA 4WCEQ 3T5KA 5D4LA 2VWFA 3HKWA 2YLBA 1LQ9A 2CYZB 3WX8A 1OPIA 3BO3A 1EKSA 3HSBA 3PM9A 4P5NA 2OPRA 3J81E 2W0ZA 1C1BB 5GAOn 2LFVA 1PBAA 2V67A 2JEJA 2RRBA 3SSQA 3H4DA 4NLXA 1P92A 3ZL7C 1C0MA 2JTEA 1IBKJ 3OSPA 2XULA 1ZA1B 1KHIA 3NMAA 2QIFA 2E7WA 3KTQA 4RCCA 2V9KA 2RJFA 4TVRA 3Q8PB 2Q6BA 4G1QA 5DQGA 1X2QA 4AXJA 2QQSA 3BGLA 2GS8A 1V3ZA 2DK3A 3ZTRA 4HDHA 2AK5A 2R7TA 2FJBB 2QFJA 1MROB 5KFWA 4FVCA 3EDQB 1WACA 4X2BA 5BYSA 4C8QD 1TAUA 1ZA2B 1NJIU 1PILA 1RBLA 4IG0A 4ENOA 4Y6IA 1AFJA 1K73R 3FC3A 1IQTA 4DX5A 5ETKA 3I87A 4NL2A 4DPUA 4JZ4A 2B5JA 1R8BA 3G9CA 1IKVA 1UFLA 5HQ8A 3DLLQ 1LWCB 2DVJA 2XZDB 3GP9A 1TG0A 3V4MA 2NYHA 3BKUA 2CQHA 4K5RA 5D15A 4Q8EA 1TUCA 4J9FA 3L2QA 2OSQA 1C2PA 3ETOA 1M8MA 4OMFG 5M2PA 4W98A 3G87A 4CC2A 3GFZA 5G0RA 4I68A 1RWUA 4KE5A 2AT1B 4LD6A 4PRFA 3IG1B 1Y5NB 1JU5C 3C19A 4WP9A 1MGQA 2CAJA 4F50A 3DRPB 3N6MA 2XD0A 2YPZA 4OI6A 4M78C 3MEAA 4O3SA 3MMCB 1TTHB 4QW8A 2DXEA 5HSPA 3LAKA 2HD0A 5E3AA 2HEQA 3TZYA 2ZGWA 3I4PA 2P8IA 2I0NA 1MG7A 4RUGA 2HKNA 2ZC4A 1O8BA 3EGXB 3TUPA 2GA7A 3B54A 5GAN5 5HL7Q 5M2RA 1B99A 2OMLA 3DLKA 4AT1B 3G6ET 2LT1A 4KHRA 9RUBA 2EQIA 1V6HA 3HMJG 3SFGA 1IM4A 4M95A 3CCMA 2ZD1B 3OTBA 4DOWA 4ECYA 1U3OA 4QPTA 4MIAA 2A2CA 3HVTA 5F8NA 2COLA 1BIBA 4F4ZA 4BS2A 4K8RA 1QTNB 1FFGB 5HI7A 2HQGA 2WOMB 1VA7A 2AEMA 1IKXB 1MMNA 1WQ7A 3SCLE 2VB6A 1R8HA 1ZPWX 1RAAB 3HFNA 1QJHA 3DDIA 1TL3A 3V81B 2J7UA 3NOGA 1TZ0A 2OD4A 3DNCA 2D3OR 2V9WA 3OLAA 5I3UB 4XU0A 2GTJA 1REVB 4J83A 3PY8A 3ZZYA 2EYXA 2C2KB 5CZVA 2K1RB 2QL5B 1UVJA 1FCAA 4DV4J 5IM0A 1GBRA 2R7SA 3CC2S 1QKXA 4R0KA 1UMJA 1S97A 3CD6T 3DB4A 4DV1J 4AD6A 1G1XA 2DO4A 3CCZA 3EMTA 5L1KA 4C2MA 2J7IA 2L3QA 5ETVA 1YI2T 4F0MA 2QEXQ 4ELVA 4PG7A 4PCQA 1H2VZ 1JXEA 2C3OA 1BI3A 4AFZC 4BDZA 3MP8A 1S48A 1N32J 2I9SA 4HT9A 2GVZA 5F8IA 3G71Q 4YR2A 4CIOA 2XS7A 2VG6A 2FEIA 1YDLA 1UL3A 4I2PA 1VRTA 1N56A 2CJ9A 3RAQA 2KXHA 3M2VA 4A4KA 4J9IA 3RR7A 1S7HA 2CNOB 1PCXA 3U23A 1EIYB 4PXBA 1LNQA 1Q78A 1JLQB 2DNNA 4MK9A 4PJMA 3EZ5A 5GAMe 4CRJA 3JSMB 3CDBA 4WFZA 3CC2Q 1Q82T 4PJOE 1YZ7A 4IIOA 5AE1A 3OL9A 4FSSA 1JLCB 1PRMC 3VS1A 2VPZB 3M8PB 5HK3A 2DFUA 5GAEI 3GLJA 1NB7A 1U26A 3LTOA 2HBWA 2CNNB 2QFIA 5ETQA 4CC4B 1HYSB 3QAEA 4WE1A 3T19A 5CYJA 2JVVA 2LX9A 2K3YA 1RUWA 3AT1B 3T9NA 4ESRA 4ANJA 1QQJA 4RW7B 2AKWB 5CYQB 2UXCF 4NOYA 2DNPA 3AXKA 1NM7A 2BJDA 2RHUA 1K9MR 4TXSA 2KRBA 1TOVA 1VUBA 1FWPA 3RR6A 2D8JA 1RHKB 4RWXA 2VV5A 3I9QA 5LJ3j 3A1YG 2GF7A 5L1LA 2KKHA 2JRSA 4RZRA 2CS7A 3IMQJ 4J9MA 4PUOA 3EJMA 4MIBA 1RLDA 4ZPCA 3I5AA 1M1KC 4ELYC 3QYYA 4ZVGA 4A47A 1HHTP 2B9YA 3IAM9 3S7RA 1XNRJ 2ZC3A 3CCLT 2VJUA 2J9CA 4PK4A 1G83A 5GANj 5C2CA 1S9EB 5LMUJ 3D0HE 3M1VB 4P7VA 5C6SA 3FDRA 4WP3A 2A3LA 3E9FA 2CQGA 1IXDA 4Q44A 4JI0F 2DITA 4F7UB 4LRCA 4FNHA 1PKSA 2HHSA 3B6BA 3VYGA 2IIMA 4QBUA 2DRDA 1OPLA 2PEBA 4LF8F 2HWTA 4BI4A 2PI5A 3HK2A 4GVLA 1JBMA 3RG6A 3TI0A 1HL6A 4DPYA 5E3PA 2GVDA 4K0KF 4M7AB 3F70A 2AKLA 1LOUA 4QT7A 3VZHA 2B7CB 1DURA 1C4AA 2R2UA 3L2ZA 1S6PA 1LJOA 2ZZMA 2XS2A 5GAOr 4XTXA 3L9ZA 4YFUA 1MLAA 1HXDA 3V7RA 1AA1B 3UCZP 2LJ1A 2ECZA 4LFBF 1IQZA 1Q82U 1UWBB 4HVVA 1TP7A 1UETA 2ZE2A 1T9VA 3D1HA 4NA2A 3FSIA 2RM4A 4M5MA 2KT8A 1YIJS 4U7UD 1QP2A 1W2BS 5IV4A 4DR5J 4JYAJ 3C8YA 4LUDA 3MPVA 1KD1T 1SSHA 1GCQA 4W4MA 4AL5A 2Y4YA 4KQZA 4PJNA 2RRAA 4I1TA 4O23A 3FBEA 1SJFA 2J0XA 2CNKB 4IURA 2BDPA 3A8LB 4YP3A 2MB0B 4OP0A 2UU9J 5J2QB 3J80Y 2M9UA 5KYXB 2Y1LB 5DLQE 3HHEA 4DEYA 3PR5B 2OX7A 5LOQA 5BYQA 4BDPA 3P5TL 4F7VA 5FU7B 1HBUB 3K8WA 4LVOP 4F4XA 3GNGA 1PJ7A 2CP7A 2LDMA 4JI6F 4QU7A 2XLKA 3PEJA 4A8MP 3OFGA 4R55A 2QMWA 2PSZA 2J9DA 2IYGA 3QZ5B 4DL2A 1R43A 2PGCA 2KGTA 4ERDA 1XK8A 1FKAF 2HHWA 2N7CA 1YIJQ 2DCUB 2F69A 2UUWA 2GCFA 1QP3A 1WA7A 3VS0A 2HGMA 3IWXA 1K8AT 3FCHA 3R5DA 1DHMA 4FYXB 1M30A 1RT4A 2R8IA 1RT6A 1J2VA 1X4GA 1ZOTA 3PX6A 4KUDK 4DL5A 2FYXA 3DRRB 2W01A 2VOOA 4IH6A 4ALZA 1J5EJ 2O01C 1X6BA 2DD4A 3R5GA 3THPA 2CKWA 1AZSB 5LJ5Y 3QO9A 1EB0A 4X34A 4ECSA 2M0YA 3RB4A 2GCXA 2IFXA 2N82B 1FDNA 4ES3A 3V7CA 1NSAA 2FD2A 4ZTFA 1HNVA 2HW3A 3HSZA 3D6HB 2KB2A 2M88A 4C8YA 1RCXB 1NO8A 3M32A 2J0QD 1LPLA 2DPJA 2R5MA 2CPFA 3EICA 2C22A 1K1QA 1R8CA 1AVZC 5KFQA 4GMKA 1YJVA 2ZH5A 2H3JA 4M75E 3IGNA 2DIGA 4DLGA 1VBKA 4LFCF 2KDOA 1N6QB 2P4RA 2X1GA 2RF0A 5DDOC 1DQ9A 3MWBA 2IVMA 4DR2J 2WW8A 1BXNA 2J6FA 1JJ2P 4LXCA 4FF4A 2J0SD 3PW4A 3REAB 1RAEB 2PEHA 2JS2A 4OZJA 4JRKA 4ZITA 4OYAA 2DR8A 1RT7A 3CJTA 2KRMA 3OL7A 1CJUB 2CVEA 4JJNK 2JZ5A 4QQBA 4PFPA 4DQIA 3ISNC 3DLBA 1VHFA 3HCXA 3JAMY 4J6XA 5I11A 3PHTA 3EXCX 3TZZA 3G6EA 1UA0A 3BDLA 2APOA 1U1NA 3NBPB 3EHQA 2DIQA 3OSSC 3M8YA 2SEMA 2FC8A 2GNKA 1AZGB 2CJXB 3HFZB 2JM9A 3BDEA 3W2VB 2BJ9A 1A7GE 2YKPA 2CNLB 2W7AA 2JC1A 3JCMg 1UJYA 1R0CB 1ABOA 3CMET 5F3TA 1LW2A 2E3IA 1LWFB 1F0XA 2VC0A 3CGIA 3M58A 1SV5B 3OBYA 4QIEA 1ZUYA 4R56A 3GJQB 4UTGA 5FU7C 3D4JA 4WTOB 2VASA 4CWBA 1K44A 4NASA 2ZM6F 1IUJA 1KLNA 2XDPA 3OYNA 4NEYA 1T7PA 3GFHA 3VS3A 1T11A 4C8QA 3A98A 3TA0A 2OMOA 3HKSA 3CD6A 3G4ST 3AFGA 3SDEA 1Q7YT 5ADZA 2LU2A 1X31C 4CP5A 4ZP6A 1RT3A 4MKAA 1JQQA 3CBMA 2GNCA 1YI2A 1Y57A 3PE0A 3OR2A 3MEDA 5HK0A 1P27B 5GAOq 2K7KA 1HNXJ 5AE2A 2HL5C 4IUPA 1EAYC 5IHIA 4WU2A 1U1PA 4OMFB 2AGPA 5LT5A 2ZH6A 2HS0A 2DCLA 1KC8C 1GTHA 5E7OB 4ZLLA 4RMOA 3O8VA 5DLGA 5KFKA 2HRTA 2VUGA 3S8SA 3C12A 3ZZZA 2PUKB 3W8PA 2RI5A 4PQAA 5A8KB 3R6OA 3UDCA 4PXEA 3OYMA 1R7IA 2ABLA 3MCNA 4GKKF 3TANA 1HNIA 1YJ7A 3VS4A 1QVFP 1FE4A 2GX8A 3GFYA 2V8PA 4AXIA 2UUCJ 1RAOA 2PA8D 3AOBA 3CDWA 1FA0A 2H5JB 2RQKA 4MIWA 4I69A 2LQKA 1LK7A 3EGZA 1TKTB 1NSQA 5GAGU 2RT3A 5KYYB 1SKSA 5DRKA 2HMIB 3BGRA 4ED1A 1WJRA 4GBQA 2DJQA 2XCPA 1WHGA 2BJ3A 1NPPA 4PWDA 3LWHA 2BOAA 1NJWA 4ME7A 2B5JB 4CC7A 1G3OA 3DGVA 2HLTA 1IKVB 4MZPA 2DJZA 1JJHA 4JUZA 2VD3A 4J91A 4NLDA 2MSSA 4L3NA 2BABA 4AL7A 3AXMA 4ED3A 3JQMA 4M8LA 2VL1A 3CCSQ 3MI7X 1EFNA 1BC6A 1S1XA 4XU2A 1VBYA 5CK9A 4UC4A 4OYWA 1DJ0A 2QC3A 5LXRA 1HD1A 2DE0X 1DQ8A 3CD6S 1B7YB 2E44A 5CR2A 3CXCS 5GMKi 1OYDA 3CPWP 2DLPA 1YI2S 3CCLA 2XO7A 1UGPB 3FCWA 3EVWA 4IG3A 1U1OA 1TKDA 2P9GA 3VS6A 3KUGA 4LD9K 1Q7YU 3AODA 3KLFA 2K06A 1S49A 3OFEA 1B0TA 4ZDNA 5IFMA 3VS5A 2MZQA 1NEEA 4U9RA 4X62F 1DRZA 4K11A 3DLKB 1UVNA 1OEBA 4USJC 4P2MA 4RTYA 2LNHB 2WB4A 2EQKA 3OR1B 5GAMj 3LGHA 3I56T 1V5VA 2RVJA 3M59A 3KG0A 3VU3C 1D3BB 1RHUB 2Z58B 2D9TA 3NS6A 1YJ9T 5FW9A 1B34A 4UQTA 2LLZA 4HVZA 1PC5A 1QAXA 3BEGB 2CP6A 1X7VA 2W9CA 4ELTA 4XK8E 1EKRA 4MFBA 4ZVOB 2DY1A 2YTCA 2I0XA 2EBGA 4KTQA 2XKOC 4LF1A 3ITHA 1XERA 2HQFA 2RK1A 5LL6S 1H74A 2VA2A 1T3LA 3O2IA 4YHHF 5KFCA 5IM0B 4V19X 3VKIA 2RRNA 3EFOB 3HKZD 3A8KA 2V63A 4FM4B 3RDVA 2ZKUA 3EZOA 1K0TA 1S0MA 1HI0P 4ID5B 2L89A 1RAHB 3NGSA 5IH2A 4IH7A 4ZCMA 3RKXA 4HT8A 2WB1D 3OFFA 3M4YA 1FXXA 1TL1B 3TJAA 4Y92A 3H5SA 3KLEB 1M9SA 1W2BP 3M2VB 4ECWA 2VJVA 1S9FA 2UVRA 2Z2ZA 3CCQS 1WX6A 2Y1JA 3EG1A 1CQNA 3TA1A 1CS4A 2DGOA 2D6FA 2DGTA 2AMCB 4DCOB 1XR7A 3ZFVA 4Z7CA 1K73T 2NCKL 1WSVA 2ROLA 3D54A 3OJSA 2CWKA 2L48A 5DLFA 1RT2A 3MM6A 2Y0SD 4USIA 3DRYA 3H2UB 3PO5A 1BI2A 4M63A 4EPCA 3JQKA 1Q8BA 4IFVA 1KRPA 2DL7A 3NNHA 3F73A 5C7PA 4WE1B 5AXMA 2W9BA 2R7QA 4KB7A 1FHTA 1XWLA 2Y8WA 1QMCA 4RNFA 4M77F 1ZM4A 1U1MA 1S6OA 1FJCA 1GNKA 1NHKL 4ES2A 3PZPA 4G65A 1AT1B 3LGLA 4USMA 3P8BB 1T9UA 3ME9A 5AYFA 1S1UA 2RQTA 1RLQC 3CCQQ 5KH6A 3DLHA 3VAFA 1RTDB 3I9ZA 2K2PA 2OTJT 4KUIA 1GX5A 4K4XA 1FRKA 4M5DA 1L5UA 1IO6A 1TVRA 4LR7A 4PUOB 3WC0A 2BIVA 1NYGA 2OTLT 2HFUA 5EX0A 1X6OA 2E5IA 4V1Ak 1R6YA 1IWAA 3LP1B 3S6WA 4Y2AA 1ULRA 2VBXA 4M7DF 4JI8F 2HSEB 5CAIA 4LDYA 1R8OB 2D9OA 2I5JB 3K7RA 2I2YA 3VVUA 4YDDB 5LJ5g 4CCHA 2VPYB 4HTJA 2C3UA 2J6SA 3D28A 2QG9B 3CJRA 4DBQA 3FZ2A 3UDVA 2A1BA 5D0GA 4F7UE 2P6SA 1T9TA 1ZAVA 4DV7F 1F2GA 2MKJA 4ZP7A 4J6YA 3UVJA 4DPXA 3RIRA 4B9VA 2RIJA 1JKHA 1VMBA 1NJYA 3GIRA 4M7AE 2R8KA 2JLFA 5J2PB 3CCET 4E6RA 2IA0A 3NAIA 4M75D 1XBWA 3FQLA 2KAFA 1RXOB 1S9GA 3OYIA 1OX8A 3LO3A 3LF0A 1S6PB 2VA3A 2E41A 4NLTA 2B8PA 4EZ9A 4C0DB 2RQMA 1OS5A 5AT1B 4FT4A 4ZA1A 1JJ2R 3CMEA 4G3IA 2EFQA 4C98A 1SC3B 4C3LA 4IRCA 3FRZA 1YBYA 3NRBA 2UXCJ 2CSIA 5J3BA 1T03B 5IXBA 3NWRA 5HMXA 1FX2A 3BBBA 4MDWA 3K59A 2VKNA 2XSJB 3PGGA 2ZHAA 4NLQA 3VALA 3KJVB 4P2SA 3O3LA 3JCMX 1BD6A 1MMAA 3NGKA 2ZOGA 1FK9B 3BBCA 2Z0GA 1UEKA 3QLHA 4D3GA 2CZ7B 3CJQA 4KGVB 4C5IA 1UAWA 4CO3A 3G4SA 2RQWA 4NCGB 4PG5A 2MWPA 3W64A 4TLQA 3SSRA 2R8GA 1W7WA 1X5SA 5C42A 2AJ0A 4LDXA 2FLNA 4BLGA 2B86A 5SZTA 1NUEA 2RUSA 1Q86R 5HJYA 2CJKA 5CO7A 2CUDA 1JLGB 2HRYA 1E6VA 4FKXA 4JI0J 2GFFA 1W4SA 5B08A 3OXFA 4ZLJA 2UUAF 3M8WA 3N5BA 1VQLT 4XPCA 3BZQA 4LF8J 1FRLA 5CIUA 3BJYA 1F6TA 1WNLA 2OKQA 2KHCA 4QQ6A 4NE9C 5CKFA 4K0KJ 3M2UA 4CC3A 5HO4A 1OI1A 3P96A 5KFHA 2QJ3A 3NCPA 4J5OA 4R8UA 2KL8A 3AAWB 1K9MT 2L3PA 3RESA 3PV8A 4CNYA 4EMHA 4I2QB 3CC7T 5FLXU 1E6GA 4L6V3 1HPZB 1X5TA 4NCBA 5J2MA 4WCIA 2KNBB 4QZVB 1T9WA 2EXUA 2BE7D 2K3KA 4IKAA 4ZVUB 2HAFA 1EP4A 3LP0B 3M9NB 2KMTA 5F8MA 1M5HA 4LFBJ 1TMJA 4NS5A 2FJEB 2NXCA 5DGAA 5KFZA 1SB6A 2OAUA 5C0MA 4OHZA 4OYIA 3BBFA 4OZ3A 2MZJA 3M6WA 3QPIA 2ZZDA 1R8PA 3UN5A 3HHDA 1WG1A 3UWTA 3AB4B 4OFZA 1QAYA 3FMWA 4TLRA 1LVKA 2HAIA 1ZBXA 3T5HA 3J7YI 1SF9A 3NOCA 1RTIA 2FGCA 1NJIC 1T3OA 3IWNC 4IQMA 4IOCQ 4RTXA 2A36A 3KLGA 3NGDA 3LP2B 3JTNA 2JUFA 2V8IA 2XNQA 2YX4A 2UXBF 2RKIA 3A3OB 3DXSX 2XWYA 4K4VA 4A8FA 4OHYA 3I55A 5KYWB 3LPYA 2YX1A 4CRIA 1JNRB 4Q2LA 1QAJA 2XEXA 2V1RA 2NREA 4GVBA 3UN2A 1N6AA 4WWSA 3UR0A 1CC7A 1OIAA 2E5LF 3D7SB 1VQPT 2X9HA 1L3TA 2LEAA 2AQ4A 2QRRA 2NUZA 4DUTA 2OPSA 3G8SA 3CCJS 3J7AF 5GMDA 2V50A 2PVDB 3NG8A 2FRYA 2X4WA 3DGPA 4A4JA 3CXCP 3FNNA 5ETSA 3OS0A 1GCQC 3R2CJ 2C2MB 5MAOA 2EG2A 1GXLA 3MP1A 2HBRB 2B6AA 2NSCA 5J39A 2YH0A 2NUPA 4DR3F 3B4MA 1NLPC 1WF0A 3RYLA 3I56A 2JEIA 2GAHC 2D0QB 4DN9A 2HVIA 2V8HA 3E2EA 1YJ9A 2JFDA 1X9WA 1TH7A 1V76A 2JVOA 3CUNA 3MPDA 5D3GA 1KHVA 4IOBA 5JXSA 4NI2A 4DSFA 4D6WA 2KT3A 1SSFA 4YDXA 4USUA 2C2ZB 1AHJB 3F56A 1FKPA 2ZBPA 1DJ7B 1FMWA 1SJRA 1GXTA 2V8JA 2MDAA 2LU1A 1XTZA 4IO9Q 2LVWA 3FEYB 3L2UA 3CCUT 2XMVA 5D77A 3CCJQ 2VXEA 5DS7A 4PQUB 2JX2A 1N8RR 4P75A 1ZAXA 2WSCE 3GG0A 1HWKA 2DNLA 2XK0A 1NPKA 3CMQA 4RO0A 2FDNA 4LFCJ 2UXDF 1HQUA 2W4CA 2JHEA 1BI0A 3LQVA 1FI4A 1U6BA 4IUUA 1WC4A 3DHXA 3I55S 2M02A 3GF5A 3EG3A 4P73A 5EG2A 2MQMA 2ZEJA 3PJWA 1SC6A 1X4DA 1LOJA 5HANA 5HAOA 4JI5F 1C1CA 2DETA 4E7IA 3CCWA 1ZUUA 2WONB 4DV6F 4UY85 5J1PA 2IA6A 2FY1A 3D68A 2MKYA 1CG2A 2VQFF 1SQGA 2DGWA 3S6EA 3ET6B 2DXTA 3HSGA 3BGOP 1NDLA 1VQ5S 4JZ3A 2RPNA 1D0XA 1JXVA 5A2QU 3G96A 1HI8A 3GJRB 4HHHA 1RHMB 2O9SA 4TU8A 3I56S 4ELUA 2O4XA 2Z0WA 4OF1A 2RUGA 5ETRA 1M5Q1 3RAXA 1W2BR 4PWDB 3AHUA 3E01B 2OO4A 3VV0A 2J06A 1WI8A 3MEKA 3GPLA 2DNZA 3I55Q 3M56A 3WZ0A 4YEAA 1YRTA 2ZM6J 3HHNB 4JRPA 1PD0A 1C6VX 5GAEU 1AWXA 3PG9A 5ETNA 1WC3A 1BQMA 1VYAA 2W2OP 3CVKA 4UW2A 3QSUA 3CJ8A 2GGRA 2HBZB 1REGX 1HNWF 1P8GA 3W5YA 2OTJA 2LT4A 4GC6A 1WJQA 1CVJA 1SJQA 4DA4A 5THWA 2MHNA 2YKNA 3PFEA 1DTTA 3WQPA 4DPTA 3M2RB 2VGMA 4C5GA 2OTLA 3QNWB 4FN5A 2C42A 4JJCA 2AYBA 1CJTA 1VQ5Q 1JLEB 2KYZA 3SEMA 3C14A 5EUHA 5IT9E 5DDPC 2EAYA 2WBRA 3CO0P 1B4SA 1YQHA 1L3SA 1WXTA 3ETMA 4IG3B 3R7SB 1UG1A 4O3NA 1TAQA 1U1RA 5B7WA 1KQSP 4WPAA 5K8NA 4YB5A 2NYSA 2XDDA 1S1WA 3POTA 3NTKA 4PJOF 1FRIA 1Y5LB 4LIWA 5BXIA 3O8WA 3QIPA 4CLLA 1N5ZA 3KHHA 1S1VB 1T8EA 2F8MA 2C0TA 5IXFA 3DLEA 1SRLA 2ZNYA 4TQRA 3IA0A 2M0OA 4GKKJ 2KVQG 4K2JA 1MWZA 3VF0B 4C8QC 4USKA 2IVYA 3GE9A 2ZHBA 3CCEA 1U2RA 3S3NA 2DZ9A 4RNNA 5M9OA 1HBMA 2ZUAA 5KFRA 3ZNJ1 1LW0A 3SXLA 1RYSA 3BFMA 3VZIA 4Y2CA 4F25A 1B34B 2QLFB 4TU9A 1QW1A 4Q45A 3TUJC 2HFSA 2ILYA 2NPFA 4FVMA 5HY6A 1SRMA 4II1A 2LVMA 3HFKA 2LEPA 3I5BA 4DUYF 1SI9A 2DO3A 1WKKA 3ITHB 3W9IA 2YKOA 4RKUE 4XIUA 4ECTA 2M16A 4PWWA 2LJ3A 1X4HA 1R3NA 5IT0A 1FD8A 4ZPWR 4C5HA 3GU0A 2MMYA 1Y9OA 4QIFA 2V0NA 2D69A 2N4DA 1KWMA 2FRWA 3PDNA 1P1TA 2DHGA 4N8NA 1WPYA 2NUTA 1HYOA 4I7FA 2XNRA 1Q82C 2HQIA 1IGUA 1FX7A 2B3TB 1ZM2A 4JV1A 1FEEA 3H8ZA 1IR0A 3TAQA 4DZ6A 4DQ2A 4UOCA 4LDUA 3DOMA 1NB2A 2KXDA 2EYQA 3L42A 2J76E 4JV5F 1UJ6A 3ILLA 3ZFJA 2PC6A 2A6MA 2ASLA 4V19J 5EGYA 5IHKA 2P2CB 4E7ZA 1HQ2A 2YRVA 1I5LA 1R89A 1FRXA 2A37A 4EI2A 5GAOm 2ASYA 4X62J 1MSWD 2EYZA 1CSKA 4BY6B 2CPJA 5HVHA 1Y7PA 1VQLA 1BLUA 4ZPTR 2E9ZA 3K0JA 1FJGF 5HK4A 2DD5A 1ZSZC 4F3OA 1FMVA 2A10A 2CREA 2XYHB 1WEXA 2DHAA 5GMKm 1IJEB 1UEVA 2P84A 5L46A 2YNIB 1EETB 1KEKA 1VQMS 2AKKA 3KXTA 3BH6B 3ENAA 2XSFA 4Q2MA 2DEQA 4J7FA 4RG2A 2BRLA 5FROA 3CC7A 3CJ5A 2B8QA 4LDWA 1HMVB 2FZCB 1U8SA 2AWZA 2BUNA 2G2OA 3LUYA 4M75A 3IBCB 1FNMA 4QPXA 3CMAT 5ETTA 4PG6A 3MPUB 5D6WA 4OX9F 4YHHJ 3PFSA 1FVSA 4RNOA 1WDDA 2JTMA 4NMLA 2EBEA 1XR6A 1NEGA 2RD1A 5K8PA 1VQ8T 4ZLPA 5D7UA 2HQCA 2ZJPQ 1U2CA 3HHLB 1XMOF 2YY3A 3CDUA 4CZCA 3RW7A 2EKOA 2M70A 1T0HA 4PPZA 2E1HA 2YNHB 3W65A 1VQMQ 2U2FA 3HL8A 2F8EX 4C3MA 1SEMA 2VPXB 2FYKA 4Y28E 1TL7B 4LVNP 1SXLA 4CTAA 5DM6Q 5KOWA 1PGZA 3ISZA 2E65A 4NYZA 2MZ1A 3OVBA 3JCMb 4LR8A 1D8YA 1RE1B 4EFAC 3MAQA 2DD8S 1Y4ZB 2MKSA 3K5MA 4JPBW 2IMWP 5J1NA 1JKHB 1IKWA 2OPPA 4C3KA 4P10A 2NXJA 3OHBA 3KK3B 1GXUA 2KXFA 1KD1C 2HMAA 3M6VA 5F41A 2VONA 3JCMV 1QSLA 2ZPEB 1R77A 3TR5A 2CDRB 2YUNA 2ZJQQ 5C5JA 1D1CA 1DLOA 5F8JA 2LKZA 5E5NA 1FNXH 4KJIA 3J7Z5 3CC7S 2XU8A 2F2WA 1JLFB 3ZZTA 2EQMA 5FD1A 4ED8A 1QCFA 1RAIB 2GMLA 3GCWP 3K5OA 4QJVA 2RJCA 3JB9D 2HHTA 2ZJRQ 4CLTA 4DF4A 1M1GA 3M57A 2QA4A 2NXEA 3PW7A 1FESA 3SCIE 1YP5A 1UGQB 3CXCR 1VYTA 2VFSA 4MAKA 3Q86A 1N88A 1VQOT 2B4VA 1SC1B 1H7WA 3EUNA 3CCUA 2RF2B 3KDOA 1DQAA 4WXOA 3R3TA 1OWXA 2HNDA 4B3MF 2GHWA 2HBQB 5FU6C 3N0VA 5J26A 1FWLA 4JI8J 3FUYA 2RD5C 1K8AC 5L39A 2XC9A 4ZHRB 2RB6A 2OEMA 1UVMA 1S7IA 2Z2MA 2KBTA 1YCSB 3PMIA 4E7LA 1SQFA 1HARA 4H4KA 2MQ8A 5JVGQ 2J9DE 3PRDA 4OI4A 4DV7J 1ICEB 3KLIA 4M78F 1NPRA 4DX7A 4E47A 1YITT 4EYHB 1IWGA 4X84A 3PHEA 4KPCA 2AJ2A 1WELA 2X3WD 4L3KA 3A12A