2ATCB

Crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
152
structure length
152
Chain Sequence
MTHNDKLQVAEIKRGTVINHIPAEIGFKLLSLFKLTETQDRITIGLNLPSGEMGRKDLIKIENTFLSEDEVDELALYAPQATVNRINDYEVVGKSRPSLPERNIDVLVCPDSNCISHAEPVSSSFAVRRADDIALKCKYCEKEFSHNVVLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (carbamoyl-p,aspartate)
molecule keywords ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
publication title Crystal and molecular structures of native and CTP-liganded aspartate carbamoyltransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 6
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1982-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2atcB02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2atcB01
1RAEB 1EZZB 1ZA1B 1Q95G 3AT1B 1RAIB 1RAGB 1SKUB 1RACB 2ATCB 2HSEB 1I5OB 1PG5B 4KGXB 1XJWB 2AIRB 8AT1B 1ZA2B 8ATCB 1ACMB 1RAHB 2QG9B 1TU0B 4FYYB 1AT1B 1TUGB 1NBEB 2A0FB 1D09B 2AT1B 9ATCB 2YWWA 4E2FB 2FZCB 3D7SB 4FYXB 2FZGB 1TTHB 1F1BB 2IPOB 4F04B 1R0CB 1RAAB 4WTOB 2BE7D 2FZKB 1RAFB 4FYWB 4KH0B 4KH1B 4AT1B 4KGZB 1RADB 7AT1B 4AMCA 2BE9B 1R0BG 2H3EB 6AT1B 1RABB 3MPUB 5AT1B 4FYVB 4KGVB 2QGFB
chains in the Genus database with same CATH superfamily
3M9NB 3TX8A 2Z2LA 1RB0A 3W63A 2RRNA 3MPYA 1H7XA 2ZH1A 3MEGB 4PJJA 1DBDA 1MW7A 1OJ4A 1C1BB 2HD0A 3NLCA 1WHLA 3NP5A 2YWKA 2AYEA 3FBCA 2LEAA 1F0XA 2EQIA 5KG6A 3BO3A 4M75F 3EGDA 4EDUA 1K0SA 4DU8A 2RQUA 2NWMA 1VYVA 3O44A 1FKOB 5A8KA 2RIJA 2Q6BA 2MK5A 4DFKA 4ZPTR 4KRTA 2CG4A 3HVWA 2MY8A 2RI2A 4DOVA 5KE2A 4QQBA 3R7BB 1XMQF 4L75A 1OULA 2QJ3A 3KK2B 1X4AA 3BYRA 2HLUA 5HN0A 2HPUA 5CYJA 1S9GB 1G2EA 2ZPBB 3DLEB 2UUCF 4F2SA 3IG1A 3FCVA 3MMAA 2EIFA 3GCXP 4LSZB 4CC3A 1ARKA 4OI1A 5D6XA 2P9EA 3QDRB 5KYUB 4ANJA 3CXCR 2UXBJ 3EGVA 2L3MA 3R5DA 3QSUA 4B3SF 4O44A 5ETNA 1RYRA 4NLDA 1ZBJA 4IYQA 1RWVB 2DT9A 3EXCX 4PR6A 3PEHA 3QGIA 1HNVB 1WI8A 4CLTA 1FJ7A 4K4XA 1FRMA 2I0XA 2VPYB 3MKDA 3AQPA 4M7AC 1NE8A 3ZTQA 3CMEQ 3KLEB 2CJBA 2K4YA 3EGXB 2YX7A 4E0DA 2WVBA 2SRCA 2KZMA 1G2BA 4X34A 1NH8A 4M77F 1VQ9T 4C92D 5LM7E 2NYHA 4KJIA 4F67A 1R6VA 2L3PA 4ALZA 4IRCA 3I56Q 2PMHA 4WFNQ 2CDTA 1V1CA 2IY5B 1NZAA 2DNNA 2GJIA 1NZ8A 1Y11A 3CCES 1AHJB 3H98A 2RQWA 3BO2A 4A8SA 3T5JA 3KUHA 1LW0B 3HT0A 3W61A 2X51A 2YH1A 5HY6A 3MUVP 1N6AA 1SVDA 1NLKL 1WKLA 3ZEHA 5JMNA 1F6TA 1OY6A 3DLBA 2VG5B 4IO1A 3J81Y 3AJ1A 2G4BA 1B34B 3MR2A 2CJYB 3VUBA 2DIQA 5F3ZA 3UVJB 4D3HA 5FDLB 4Q5VA 2HQDA 3VAMA 1RHKB 5GAN2 4OZ2A 2DY9A 2PN6A 5GAN5 3M0SA 3R97A 3INZA 3I9V9 2CNOB 5HJXA 4O3PA 1PC4A 4LF6F 1D1BA 3OBWA 2APOA 4ZNXA 3NL0A 4FXDA 3A1YG 4KH0B 3M4XA 2Z0GA 4ZKAA 1K9MC 3M32B 3ZZZA 4YHHF 1BCMA 2HZCA 3AOCA 1KC8T 4NA2A 1RTHB 5GANj 2ZPGB 5B09A 2CZ4A 5CYQA 2KZZA 2EG2A 3UN3A 2HS0A 4Z89A 2C2KB 3CC7S 5IAYA 3SXLA 2I2YA 1VOMA 2W25A 2GIFA 4EK2A 2YSQA 4P2SA 3CCST 2G0CA 5T7LB 4LN2A 2DRKA 3RAQA 1KN6A 1M27C 1WA7A 4ED2A 1IXDA 4CLWA 3LGHA 3QPHA 4FYYB 1OYXA 4NI2B 5F3TA 1KQKA 3M53A 1Y0MA 1GK8A 4IH5A 3QIIA 3U1NA 4DV5F 2R3VA 2N4CA 1CQMA 5E41A 4QWDA 2XY6A 4B9UA 2P0KA 3RKYA 3JCMb 1S10A 4HCKA 2DO0A 2CPZA 2J6OA 2DTHA 4DV3J 4OI4A 1MMLA 1LXNA 2X4JA 4IOCQ 4DN0A 3G8QA 2HNZA 2K7KA 1QP2A 2KG0A 5FLXE 3DLKA 4IQMA 3HULA 1QVGA 5GAGU 1G7CB 1RKIA 3PFOA 3PYGA 2B3TB 2YQ3A 1U1PA 4IOAQ 3NBPB 1NK6A 3W5XA 2HVEA 4O3RA 2GMLA 1K9AA 3KLIA 2KL8A 3HLUA 2NZ4A 4UC4A 3H5UA 4CQ1A 3DHWC 3E9FA 4F4AA 1BQNA 2QGFB 4DS4A 4N56A 4NZ0A 4E7KA 3WBZA 5EX0A 1Y5LB 4M8LA 4OMOA 4Z88A 3V81A 3OFGA 2VA2A 2MKSA 2BANB 1VK3A 2BQUA 2DHHA 3PX4A 4ED5A 4RUGA 4PJOF 3ME9A 4YN3B 2NS1B 3ZTPA 1A6LA 3UWTA 3N5FA 4PFZA 3V4IB 1J5EJ 5GANh 3P8BB 5E5NA 2XB2D 3CCQA 1U2CA 1RAJA 4NZ7A 2RILA 5HK0A 4ZPCA 2Y0SD 3RKXA 4ED7A 5KFSA 4PQUA 1OV3A 2N3LA 2EPDA 2DNRA 3CVKA 4QYRA 3VS3A 3NMZC 3S3OA 4MMLA 2J7UA 4KT0E 2HHHF 2IJNA 2RSQA 4HHHA 2WVDA 5GAEI 4IIOA 5D0EA 9RUBA 3DYAB 3NGUA 1NBEB 1OX8A 4ZP7A 1OY9A 1VRQC 4BC9A 3Q89A 3ZNUA 2CVEA 1HYOA 4KE5A 3HHLB 2VBZA 1GL5A 4X66J 1WHHA 3HFNA 3QJ6A 5LMNJ 4L3NA 1VQ7Q 1O5JA 4PLLA 2HQXA 2GQ2A 4B3MJ 1MMGA 2GHPA 2XQCA 3RNJA 3M1VB 4DL0C 2FPDA 3MMBB 1HI0P 1HK9A 2MQPA 4ZLPA 1WG4A 1S1NA 1NLOC 4U9RA 3SQOP 5JXSA 5EHHA 1BXNA 3M8RA 3PX0A 2HZVA 3B78A 4YB6A 1S1XB 1MWQA 3Q8PB 3GE9A 1DLOA 3HKWA 2MHNA 4RR5A 2K3XA 2RD1A 2RE1A 4LF1A 1JNZB 1Q81U 1UZDA 5KFYA 4ZVFA 3FMWA 1K1SA 2EFQA 4J5OA 1VQ4Q 5KT6A 4E47A 5AJ3F 4QU7A 1S72T 2OMOA 1IWAA 1VBYA 4XDDA 1QVGS 3PCOB 1S0NA 2V8KA 1UL3A 2EYWA 4QW9A 4C3KA 1QVGP 3HJVA 4ECSA 2XY7A 4ZPBA 2CQHA 3MCSA 1DARA 4NRTA 3JCMg 3BS9A 5BR8F 3FJPA 1M4ZA 3MR3A 5GAMd 3L4BC 1YNZA 4YDXA 2C28A 3CPWS 1NO8A 1RHRB 4Z2XA 5A6WA 2KHDA 3CCTA 1H0HB 4PJMA 3B4MA 3QZ7A 2EQJA 4X4OA 1EQMA 2NSCA 3EG9A 3CBMA 2LXIA 3DRPA 3K0JA 2P2CB 2CH4A 4USKA 2RJZA 1YDLA 4R0JA 3PZPA 4M1KA 2BW7A 1RTIA 4PYAA 2XK0A 2PTKA 1WNLA 1M90T 3HSDA 4OI3A 4HT7A 3CCQS 4FS2A 1U6BA 2LCLA 3OSVA 1UJ5A 1FWLA 4ZHRB 1L5UA 4YY3J 3VR1A 1I4K1 2DHAA 2W7PA 3D68A 2IVMA 1FO1A 4LF8J 3KJFB 5MLCV 4A48A 3TCJA 4J5YA 3C16B 2QX0A 1U48A 1KIKA 1N9SA 5CYMA 2LT1A 2HGLA 2X35A 3R5AA 1Y0HA 3C14B 3TREA 2ZC4A 3OTCA 3VAKA 4GKJF 2ACYA 2YKMB 2W4CA 2XMTA 3EGNA 4S0MA 2BJ9A 2ZH8A 3MAHA 4KV8B 4WIQA 3PG9A 1ZA1B 2R42A 2A1BA 1VI7A 4TLQA 4RU2A 2HBPA 1M3AA 2LRQA 4M5DA 3NPFA 3AXMA 1S1WB 4LUDA 2Q6CA 2H1YA 1O8BA 2E3HA 2B6AA 2AMCB 3NG8A 4CLSA 2GFAA 2C0IA 3MM7B 2JT4A 2WVFA 1JLCB 3BSCA 2X1BA 3E3XA 3GIKA 5C7PA 5I42B 5KG4A 3I4HX 3ZC4A 2VIHA 1Q78A 4BY6C 5KYWB 5E0OA 1M90R 2FC9A 2KKHA 2NUUG 2B9EA 2EYZA 1IKYB 1WHVA 3DC2A 4F7UA 2F8MA 1OWXA 4TKTA 4RWWA 2D8JA 1RT7B 1RJJA 2FPHX 5CXTA 1UMJA 1QUPA 5A76A 2ED1A 4GO7X 2X1GA 4DCOB 2RS8A 1RBAA 1X0PA 3DOMA 2XO6A 4CLKA 2H4YB 2BQ3A 2CA9A 5C6SA 3W1YC 1AVZC 2MGZB 1U49A 3QYGB 3QAUA 1RWOB 1U0SA 2DEJA 1NDCA 3V6DB 2D1CA 5J3BA 3OSNA 2CWXA 2B9XA 4C48A 4HVVA 1L3VA 2XWYA 1JJCB 1SH2A 3BKFA 3A8IA 5FLXY 4NLGA 1UGPB 5L8RC 2VC1A 1BGXT 4NWBA 1X60A 3KFWX 4TU9A 2FYXA 2K7AA 4IFVA 4JOUA 4OX6A 4PAAA 2WSFE 3CCUA 4Y0FA 2QLBB 4RTVA 4W98A 5KFUA 4JJCA 1SEMA 4CDIA 2CG8A 1ZAXA 1I3OB 3MEDA 1Y9OA 4WFYA 4CTAA 4LD9K 1JJ2A 4BDZA 2ZD1A 4YB7A 3J81U 1U0HA 2NUPB 2RRBA 3MTKA 3TQEA 4OYBA 4M5GA 5B0GA 5D6YA 2GHWA 4LVNP 2OTLT 2OUGA 4XTWA 3HCXA 3ZTRA 5LJ3f 4QT7A 4EMKA 1JLGA 2DX1A 1TR0A 3OYBA 1CJUA 3QATA 2J6FA 2YNHB 3LANA 1TKDA 4OZ0A 5GAOl 3ZZYA 1BQMA 4C8QA 1C6VX 2FHDA 1JIHA 4USJC 1XEZA 2V34A 1XR6A 5KG7A 1CJTA 4M5HA 5CQGA 4C3MA 1VQOA 2O88A 3V5RA 2Q66A 2V1QA 2AHOB 3UN5A 1C0TB 2YY3A 1RT2B 2IJRA 2ROLA 2DAQA 4USIA 2Z57B 3K8WA 1RT4A 3MI7X 1GXTA 3TVYA 3M9MB 4ECZA 4PJLA 1UEKA 2IYGA 2W4DA 1PBAA 2AZ3A 1SH0A 2QG9B 2E4HA 3L2QA 3FFIA 3L9ZA 1LPLA 2YWEA 1FMKA 4B17A 4TU8A 3AJDA 4Z8AA 5KFPA 4LFAJ 3QJPA 4KH1B 4BB7A 3DMJA 2VKNA 6FDRA 3JTPA 1ZZNA 2V2QA 1T0TV 4X9DA 3DOKB 1WJRA 4WFBQ 3MMCA 4B6MA 4DR3J 1VIXA 3T1HF 4ANEA 1PM3A 3JB9F 3KJVB 3D7SB 5KYYA 3BBCA 1QTMA 3CCRS 1RQ0A 1H92A 1SC6A 4Y2AA 4CO4A 1SBRA 3CJ0A 2MQNA 1Q8BA 3EGDB 4M5JA 1RAOA 1IN0A 1KLMA 4HR2A 3LUYA 1MGQA 1J3TA 1JXLA 5IZHA 1QVPA 3K5NA 1RT6A 4LFCF 3CCUS 2VUGA 1RUWA 5A0LA 1H3HA 5I4MA 3GP8A 1S57A 4CZCA 1K44A 2MQ8A 1K73C 2C2ZB 2XLKA 1FTRA 4FKYA 5IHIA 2EJFA 4DQRA 1YJNA 1JJ2S 5K9FA 2KRNA 1ZUUA 2IM0A 2JRSA 1TS9A 2OX7A 1JJ2P 4ZGJB 4LNPA 1ZUYA 3VALA 4PABA 3MCNA 4C97A 1P1TA 1HNIA 1AT1B 2VU5A 1FJEB 3A12A 1C1AA 1D3WA 3KUFA 4U6PA 3MM8B 2RQRA 3T5LA 4RUBA 1F9FA 2YUOA 4X1VA 3B54A 2DXDA 4QIWD 3TU4K 2JEIA 5L9NA 5D4OA 1ZTWA 1G3TA 5CQYA 4WFXA 5IFMA 4F16A 5GADU 4DFPA 2AKLA 2ASLA 1WHGA 1UGQB 3G4SQ 2D9OA 3PR5B 1TZ0A 2UV8A 2E1AA 1KWMA 2X3XD 3JCMX 3OXGA 3BO4A 4J6XA 2WONB 1VQOS 4L72B 1M5Q1 2E64A 2RS2A 5H1SV 1S76D 1QWEA 3QAEA 4PFPA 4KGXB 1UUEA 1HBUA 4NLXA 1Z2ZA 3GIBA 2UXBF 5E3PA 4RKUC 1FNMA 3F0NA 4CM0A 1TAUA 4Q43A 4FN5A 5F8HA 3JB9H 5LJ5g 4JP8A 2RJFA 2PT0A 4M7AG 1OZ2A 1B4SA 3C15B 4P5NA 2C3PA 5FD1A 1R8PA 4K4UA 3LW5C 1KC8U 1YTYA 1BBZA 5HJYA 3OBYA 1YGYA 5K20B 5IWAJ 1SUQA 3DRRB 1ZAWA 1NEEA 1NH7A 2E5LJ 3M8SA 3RAMA 1E6GA 2PSZA 1NYFA 2CYYA 2V0NA 3K58A 1S48A 5K8NA 1UFFA 3CMAQ 4RNNA 4UY85 4N8NA 3EGWB 4EBCA 1VQPT 1NM2A 1I6JA 2QSWA 2V5HG 2XY5A 2XEXA 1A9NB 3Q23A 3IWNC 4DV4F 4O3QA 2KTQA 1LQ9A 3TQ7P 1ZQ1A 2ERRA 3OR2A 1WTFA 4XTZA 2DL8A 5GAN4 1AZSB 1YITQ 4OJ3A 1YJ9A 2PVGB 1JKHA 1YJNS 3BQ1A 4ZGDB 3P8DA 2XMUA 5GAGI 3JV3A 2W2MP 2MLZA 4N4GA 3MPDA 5FIIA 1PD0A 3EZOA 1PSDA 4OV1A 5C2CA 2ZBRA 3MPVA 5IT4A 5C24B 1PWTA 5CABA 2HNDA 5D3GA 3F56A 4I1TA 4UUWA 4OYOA 1WJ9A 2AV5A 3J80E 1I94J 4J9EA 3GPLA 2XIDA 3MDFA 1CS4A 1UW4A 4LF2A 1WKKA 3PMTA 3I55A 3A4TA 3W9JA 1K47A 1DHMA 5I3UA 1U8WA 2YNIA 4K4SA 4LD6A 2E70A 4C8OA 3IMQJ 1S1TA 4FZVA 1SIWB 1WKJA 4M7AE 1R0CB 1SC3B 5HVHA 2NLUA 1NSPA 2CSQA 2FGOA 2E5JA 2MYFA 1K0XA 3IQLA 4ERDA 4J7CA 4TNOA 4QWBA 1LXJA 4C0HA 4MDWA 1VIOA 1WSVA 2DNPA 5ETPA 2G2YA 1NG2A 4P2XA 1Q8KA 2FVSA 2RHSB 5KFRA 3CMET 2HKQB 1KRPA 1IBMJ 4OGEA 1P8GA 5DGBA 2OEKA 4DL4A 3A8HB 3MAAA 3CXCA 1B7TA 1BQNB 2OFHX 4DV3F 2DL3A 2J9CA 4ES2A 3V81B 3RDVA 4C92A 4I2PA 2FZKB 4YP3A 3FEYB 4WBFA 4J9BA 3R8YA 5IC6B 2W9AA 4V1Ak 5AXMA 3NMAA 3VAIA 3KK3A 4DV6J 4OF1A 3RZAA 4PWDB 2CH4W 2GVDA 2RHUA 3WX4A 1VJQA 4I56A 3PW0A 2J0WA 2DD4A 1F1BB 3AD7C 1VISA 4WU3A 1EJ7L 5KOXA 1PYTA 3RBEA 5DY9A 3TUZC 2JZ2A 1NJYA 3AD8C 3MWBA 3NGRA 4NEYA 2ZGWA 4WK3A 1X27A 4NEZA 5E2QA 1YJ9S 1T9VA 1CJKA 3DLHA 3FJ5A 2H3JA 1DTQB 1M1KC 3GG1A 1D1UA 3CEYA 2E7WA 1VQ5A 1KS2A 1PAEX 3MAQA 1Q79A 2E12A 2KMTA 2J7WA 4EO8A 5CAAA 1J5EF 2CJAA 2J76E 2DA9A 1NYGA 3V7SA 3OMGA 2Q43A 2QA4A 3GQCA 3M2RB 5FLXU 2BE7D 1U47A 2A2DA 3QT5A 1KONA 3I55S 1FK9B 4ZN3A 4F4WA 1M30A 5D4LA 2VB6A 4H54A 1IR0A 1YHQQ 3LTOA 1R77A 1IHVA 5A2QE 1U6FA 3BGRA 2DILA 1X9WA 3VKIA 1VQ9A 4DFJA 1M2OA 1T03A 4VUBA 1VQ6Q 4X66F 2IC3A 5KFGA 1WSRA 1TUVA 3SCKE 3FEXB 5LMNF 2PUOB 2FLOA 3CC4Q 3Q0AA 1VMBA 4B3MF 1QAIA 1IJEB 4DR2J 1Q81C 1PIEA 4CM2A 4NXMJ 4FS1A 4M78B 4HHJA 2H65B 5KFBA 2GCXA 4Q0BA 3CD6A 5HVFA 2FVQA 1L3KA 3NFCA 1Q82C 1O75A 5J1EB 2BUNA 1ZOTA 2A37A 3VQSA 4K4WA 2A0FB 2MQOA 4RWXA 3CXCS 1Z9ZA 5HCKA 3H41A 3CXCP 4C5IA 4KULA 4A4FA 3D2WA 5F41A 3T5HA 1OPZA 3DRPB 4ID5B 2CGHA 4LSNA 5DQHA 2YKOA 2GNCA 4ECYA 2MMYA 2HL5C 2LZ6B 1QAYA 2CNKB 3Q83A 4G1PA 2FPFA 2DGUA 1S1UA 5E33A 1AWOA 1RTIB 3MM6B 4U95A 3GFHA 2HG4A 3RW7A 5L9XA 4NCAA 1TQLA 2R8GA 3OD2A 2BXJA 5FRMA 3PW2A 2YWGA 3FQLA 3G6VA 1O0PA 4DL5A 4IG0B 3QRRA 1Y5NB 1SRMA 1TH7A 4JYAJ 3EG3A 5CR2A 2GGPA 2MKCA 5LJ3g 3BN4A 2VHGA 3VGTA 1VQ5S 3BR9A 2ZH7A 4NL2A 1JU5C 4M7DC 4OJGA 2CQCA 1IR1A 3DHXA 2A36A 3CCSA 2HS3A 2VPZB 3QT8A 3CCLQ 1VQNA 4ECQA 1VC6A 5KFHA 1XNIA 2ZH2A 2QA4S 2A08A 2Z2YB 2QQAA 3WXMB 4YY3F 4XO0A 3X3UA 3V2UC 3O2IA 1IBLF 1WQ7A 2LQJA 2VPWB 4LF8F 2PA8D 1EP4B 1REVB 1W25A 2V8DA 1GBRA 3JCMP 2ZH3A 3KWMA 2EG1A 2G2ZA 3AT1B 1Q95G 3FCWA 1GXLA 2IVWA 1L3TA 2MI6A 4LBPA 1KQ2A 1S1VB 1VQ9S 4QJVA 5KFMA 2HW3A 2MSSA 4C0ZA 2ZPFB 2XTJP 4OX7A 4OMLA 4I6WA 2B5JB 1VQ7T 2QYCA 3DGPB 1Q16B 3GZ7A 1HNXJ 3LA0A 2NUHA 4WJBA 3CCMA 4NLQA 1JB0C 3SDZA 1K9MR 2LQNA 5FROA 3CD6S 2QLWA 2CPIA 2CQBA 3KJQB 2YKQA 4EWTA 2W24A 4IUFA 4M75B 2L3RA 1C4AA 3FKBA 3HVTA 4PWUA 3ISNC 1KFSA 2J7IA 1Y7XA 3PVQA 4X65J 4RG2A 2LNVA 3KOAA 1VQ4T 2XZTB 2BKDN 2BBEA 4EYHB 4ZPWR 2YPYA 3IGVA 3D28A 4P71A 4JB8B 1M5VC 3NXZA 3A1PA 2F2VA 4FIBA 3GOXA 1EB0A 4CT9A 4C5EA 1HBMB 4YEAA 2UVWA 5IXUA 3RW6A 2D1XA 4ILRA 2MQLA 4HH0A 1WHWA 5A0YA 1QLNA 1U0HB 2ADCA 3OL8A 4NS5A 4HXJA 3QT7A 3CDBA 1M5OC 2D3ZA 4Z37A 3QHSA 3TI0A 1TTHB 4ZMMA 1VQKA 2LXUA 2HBWA 3WQPA 2V1RA 1WF1A 1NJZA 5KFAA 3CCSS 3VRYA 1VQNS 3TQ1A 1IKXA 2DRMA 1H98A 3BSOA 1H8KA 4UQGA 4M77B 1YI2A 2HLTA 2VF3A 4JI8J 2OPPA 3OYEA 1BQMB 3PO4A 3EZUA 3R5JB 2JEGA 4L76A 1RGVA 1D9AA 4P52A 1SCJB 2XHCA 1QCFA 2C3OA 4MFBA 1WORA 4JI0J 3HM9A 5CKHA 4EO6A 4C0DB 3PM9A 3QWXX 3FDRA 3H8YA 4OB2B 2DBBA 1S5ZA 2WACA 1W1FA 4UF4A 3FFIB 4XIUA 3CD7A 2VXFA 2D3O1 1PRLC 2VZ9A 2ZJPQ 3PKMA 4HCBA 1BWEA 4TLRA 2ALZA 4CO2A 3EAEA 1H6KX 1I51B 2C22A 3MZIA 1NKEA 2QDYB 5DZ6A 2V8JA 3CCMS 2D74B 3MMCB 3VS0A 2FTRA 3L2UA 3PRBA 2L0AA 1T3OA 1F5CA 2BE2A 1BI1A 4PXEA 1LW2B 4AXIA 2QA2A 4J9OA 2YDLA 3SYZA 4DR4J 1XQHA 1GCQA 1WD6A 2C3MA 2VDHA 4DBHA 1WIEA 3GLJA 2CP3A 3CE8A 4FKXA 4WYWA 4LIRA 5A2QY 5CZVA 2FZGB 3MCAB 2B4PA 3SWNB 3C6UB 4Q5WA 5CH7B 3TZZA 4C0GA 2ZE2B 3CCEQ 1WXTA 3HHNB 4M5NA 1EKRA 4LFAF 1SXLA 2ZUAA 3IC1A 3S6EA 4QIEA 3ZZ0A 1DURA 3HF5A 4DSKA 3GFYA 3P96A 2IVFB 4BI3A 2RK1A 5GJVB 5CD4H 4DR3F 5HL7Q 4C6AA 2VKRA 3HSZA 3OW2R 2Z2MA 3VS2A 1N5QA 3DKMA 1AD5A 1G5VA 2PI5A 3H90A 3HXMA 5L8RE 4L6V3 3DLLA 4C2MA 2ZOGA 1HR0F 1V3SA 2U2FA 1QM9A 5J1NA 4FCYA 4MK8A 5CVIA 3SDEA 2MKJA 1JXOA 1AEYA 3BSAA 2R2RA 4NCGA 2HFSA 2JJ9A 1VYUA 2LC4A 2CAJA 1VQKS 2VONA 4UUXA 4I7FB 3SFMA 2BM0A 1SC1B 2MXYA 4WXWA 3SB2A 1DQ8A 1XWLA 5B0FA 2R8HA 4A53A 4ES1A 1WG5A 1YI2S 3P5BP 3FEOA 2BUDA 2DGTA 3CC7Q 2ZH6A 2F7VA 1PILA 4YS2A 1EKSA 4ZJLA 2V9WA 4D6WA 2PNIA 3D66A 1PNJA 4M7DB 4PK4A 4R8UA 2KM8C 4NX9A 2W7AA 2OP5A 3PGGA 1T9YA 2KROA 3I32A 1SQFA 3DNCA 4WFAQ 4ZVPB 4PQAA 3QIPB 3GF5A 2AYBA 3H0IA 3R5GA 5B7WA 4A8XA 3KG0A 5HQMA 2CSIA 3CBOA 3QYYA 1FFWB 1UWAA 3NNAA 1XNRJ 2LMJA 7FDRA 4GLMA 2WBMA 1UHFA 4ZVOB 5GAN7 2WHOA 5AXKA 4OHVA 2I1RA 4M7AF 1JLAA 3MPUB 1VBZA 2XNQA 4D8KA 2FJEB 4HEA9 4FYDA 1NKCA 1TUDA 1CJVA 4EU0A 2A10A 2FHOB 1HYSB 5G0RA 1Y3JA 5I11A 2V8HA 1U1OA 4PJOB 2BR0A 1OQ3A 1KOOA 3M2UB 3OL9A 2XMKA 3MM9A 2AGPA 1G4CA 1J5OB 1ZH5A 5FWCA 4OB0B 1VQYA 1TAQA 2HSEB 3QG1A 5DQIA 2ZHAA 1VYTA 3LP2A 3MM5B 2I5JA 5ETLA 1LKZA 3E2UA 4NOYA 4FP9A 3K8VA 3JQKA 2OLWA 1XR5A 3MR5A 2K3BA 4ZTFA 2IBKA 4M5KA 1X5TA 1FTCA 3CCWA 3H2VE 2Y4XA 4KTQA 5GAMf 3M0PA 2XI2A 2HRTA 3U23A 2KY9A 3NGSA 3J7AF 5IWAF 4QVCA 4Q45A 2RDIA 5F8JA 1HBOA 2F63A 2FJAB 3BQ2A 3ZZRA 1RAFB 2E5LF 2PVOB 1UECA 1TKXB 1U1KA 2IA6A 2ROEA 3JSYA 3U02A 3D67A 4IO9Q 2W2NP 3OYMA 5DG9A 2Z30B 2ZJRQ 2FO0A 1XMBA 2OGUA 1N6QA 2J0QD 1PAUB 4JJNK 2IAJB 2JW4A 3V8LA 4PG5A 2J9DA 2W2OP 3CJQA 1HBNB 5LJ5Y 2HNYA 6AT1B 2ZH4A 3SEMA 3RBBB 1RL2A 3PJ9A 2E1RA 2LJ1A 4OGCA 4KC5A 3Q8UA 4OIXA 4OP0A 4FBUA 3LX7A 1OU9A 3OBIA 4DF4A 5KFJA 4C8MA 4F04B 5C5JA 3PEJA 2W4PA 3JCMW 4DUYJ 3H25A 2LJ3A 4E6RA 1FHTA 1X4DA 2HK3A 3RGIA 2V8GA 5CCAA 2BKPA 3DLMA 4O0IA 1H74A 2Z58B 1FXRA 3DB4A 4QR0A 2WSEC 2GQVA 3DCAA 4DG1A 3M6VA 4IURA 2E1PA 1I94F 4RLEA 2DGXA 3VV0A 4B9TA 4H4OA 4NXNJ 2E6NA 1MWZA 3M0RA 4LRAA 1JNRB 1TKZA 4RKUE 1XMQJ 3CDWA 5J2MB 1QTNB 1P6TA 1R0AA 1VK8A 1RTJB 1Q8LA 5HK4A 3E51A 4C8KA 3OYFA 3GMGA 3MEGA 3MFIA 1GX6A 2LA4A 3W2WB 1C1BA 2UUWA 3TUIC 4CI0C 2MQQA 3CC2Q 2IHR1 4MT1A 3LW5E 5J26A 4C11B 3QPIA 1S99A 1NKBA 2AYMA 3BF4A 4HA8A 2YVSA 4OMMA 2HMIB 1F3FA 1AYEA 3E1SA 3R9LA 1LVKA 3MPWA 3JS9A 4IUVA 3LP0B 3R6LB 5E3CA 3N9UC 2XS5A 1IBMF 1IKVB 1S0MA 3TYTA 1QD1A 4EUVA 1IO6A 1MNEA 5KCHA 4OHXA 3I82A 1X2KA 3SSQA 2LYVA 3ET6B 2A28A 3KDOA 3QO9B 3FIFA 2JOYA 2LQWA 2XG8A 1Q7LB 2NUZA 2ZUGA 4ZITA 2PDAA 3DLEA 1TL5A 4RBUA 2A7YA 2GF7A 2JEFA 4TY8B 4DV6F 2A2CA 1P27B 1B0TA 3RB3A 2QQRA 1K73T 3ZFVA 1UPMB 2QTWA 5KYUA 2RJCA 4NL5A 1LK7A 3CMAT 1NHVA 2KK4A 4WP8A 4YDDB 4DDFA 2AJFE 4A63B 2ATCB 3BKUA 2BQRA 3PNWC 1WHJA 1FD8A 1FEEA 1S77D 3FC3A 4M5LA 4OLPA 2HHTA 2MWPA 4DX7A 3ILLA 3KLEA 2QDLA 3DKDA 1F3VA 3LF0A 3EGXA 2F5GA 4AL5A 2LMIA 4LDVA 4BWJA 1APSA 3I35A 3WVEB 4BDPA 3EYZA 2MPUA 2L48A 4A8WA 1XJWB 2DCUB 3OHBA 2AK5A 2D9TA 1T03B 4ZGEB 4TYAA 1G6BA 2IC3B 1AFIA 2E41A 2DGOA 4I6YA 2C3UA 2LT4A 5CAIA 1W70A 3UD5A 4GBQA 2HKNA 3GSDA 2F4FA 1YRUA 4RUAA 4LF6J 5FU7C 1EX4A 4C5GA 2E9RX 3TO8A 1P92A 4DQQA 3MXHP 1QCNA 3UCZP 4HVWA 2EYQA 1Q7YU 1QLYA 2J05A 2LA6A 5LSOA 5KG1A 2ZZNA 4X4RA 1R8AA 5GAOr 4DR7J 2VG5A 4USTA 2XMMA 5L39A 1B34A 2V8IA 3RR7A 3MURP 4ILMA 3UVJA 3MR6A 3M2VB 1S1UB 2HQIA 3FB9A 1JXMA 1FT8A 4NXMF 2G1HA 2CREA 1AA1B 1FRHA 1FCAA 2EVZA 4RW4B 3H20A 3M32A 1FRXA 3PW4A 2DYIA 2O3DA 3T1YJ 3ZTSA 4HCZA 1RTHA 4R56A 4E7ZA 5GANf 2J0SD 4B02A 3L2WA 4OX9J 4OMFB 3AHPA 4J37A 2GGPB 1F9EB 3TAQA 3JXOA 4HCCA 3IP0A 4LDUA 4DX8H 2VQEJ 3JSBA 3L3CA 5T7LA 3THTA 5A2QU 1FVQA 4RCCA 2LEBA 3T19A 1N48A 2JS2A 1S72Q 2NXJA 1WC4A 1WXUA 2CQ0A 4UW2A 1IXKA 5A8WB 2C2EA 2AT1B 4RW9A 1X75C 3CCVT 1MLAA 1FX4A 2B7CB 5LJ5j 2RDDA 5LXRA 4IRDA 1X4CA 4HH1A 5KG2A 3G6YA 4M4ZA 2CPYA 3PY8A 1H7WA 2Y8WA 4WIIA 2DD5A 2QQ9A 1WC1A 5DJBA 4H4KA 2DNQA 4LRCA 3QDFA 1AW0A 1RT5B 3URGA 4I68A 3VS6A 2KRMA 3TJ9A 5KG3A 1LCKA 3HX9A 2L08A 2ZZTA 1VQMA 1VA7A 5DQGA 3JSRA 3LGLA 1TWBA 2BJ3A 2ZOFA 1C0MA 2DKGA 3JAME 2VV5A 2ROPA 1EFNA 3BFMA 2N82B 1H3ZA 2V4RA 3NBPA 2IBOA 3V6KA 1LFWA 4USMA 2DL5A 4ED6A 2ABLA 5LJ5e 1YBYA 1QMCA 1LNXA 3RKWA 2HHHJ 4NL3A 1NZ9A 3KYLA 1UFLA 3ICLA 4C8QC 4KGMA 3EH2A 4DEXA 1VQ6T 5HMWA 3M05A 5DDRC 4GY5A 2HEQA 2BANA 4JI4J 3I56A 4QIVA 1RTDB 1UVMA 3CC4T 1HNXF 4JPBW 3HTRA 1Q4RA 3HRTA 3A3PB 1ZS6A 3ETOA 1RT3A 4PUOB 2G6FX 1SI9A 4K4ZA 4HKQA 3H4BA 1WG1A 1YWOA 2KXNB 3V4IA 3MMJA 1UTIA 2M1HA 3EG1A 4AT1B 1FI4A 3NGPA 3CJTA 4X84A 3FEZA 5ETQA 1KQSA 4CI0B 1SH3A 3PYDA 4NLVA 3RMSA 4EPCA 5I3QA 3CCRQ 4JV1A 2KXCA 1EIYB 2XZWA 2VICA 5A6PA 2B9YA 4X65F 1NK4A 3JRZA 3W5ZA 2NR0A 3JCMd 5IT9E 3TWZA 4J9IA 3SFUA 1C0UB 4A8FA 3HHLA 2NXUA 5M9OA 4E7IA 3FSXA 1KHCA 4QWAA 1NJIC 3CCUQ 3MF5A 1HHTP 3E8OA 3VV2B 3IM8A 1M1KT 2OPQB 2F1LA 1JLQB 3GBQA 4RNOA 2IIHA 4KUIA 3W8GA 4M7DE 2DNGA 1C1CB 1IREB 2AJ0A 1TVRA 3MMBA 4F3MA 1X4HA 4LF9J 4MFBB 2OD6A 2V26A 1FKPA 4G3IA 2IRXA 3JQJA 3UDVA 1MMAA 4XPEA 1HPZB 2MZRA 4KGVB 3IRWP 5HBMB 4CLUA 2E5QA 3CCLT 1S9FA 1E6VB 3EPIA 2CZ7B 4QWCA 1VQMS 5J2QA 2E5HA 2FZCB 3Q8YA 4PXBA 4C98A 3KHRA 4DSFA 5HQ8A 4JI8F 2BYCA 4NYZA 1N56A 1FE0A 2RHIA 4ZVTB 2ZITA 2RKIB 4QIFA 1HWKA 2FLLA 3KBGA 4JI0F 2QEXT 3VAJA 2ROTA 4Y6IA 2QLJB 1LEOA 3QSIA 5GAOn 3BZQA 4MIBA 1FXXA 2NZCA 4I4BA 4L73A 1Q81T 3G6ET 1JB0E 4NLTA 5F0UA 2VL1A 1RLDA 4WU2A 2EFVA 1Q82T 3LP1A 2GQIA 2CP7A 1LOUA 2DZCA 3I56S 1T05B 3M0TA 4QQGA 1RSCA 2AD9A 1F5BA 2HAXA 3UD3P 4A4GA 2R5MA 3BGOP 3GONA 2VODA 4GC7A 1RWWB 4LSLB 3KK1B 4C8QD 6FD1A 1OEBA 3NAHA 1T0HA 3MJXA 2KO1A 2HRYA 4DV0J 2AU0A 4URQU 1KP6A 1KQSS 2W2PP 4DR4F 3GB0A 1VHIA 2CIMA 1M1GA 2CP2A 3C16A 1W2BR 1B7FA 1AWWA 2FG0A 3FBFA 4LQ9A 2R2TA 2P4RA 2XDPA 1FD2A 5DDOC 1YX2A 3POTB 2YKMA 2EJ9A 3HHKA 4KV8A 2JC1A 1SPKA 3LWIA 2RDJA 3DDKA 2B4VA 1M3CA 2YXYA 1GAOA 5HO4A 4IKFA 1ZSGA 1NEBA 2FDNA 4FF1A 1S1WA 1X5OA 1Q81R 3R2DJ 5DLQE 3I31A 2ZOMA 4ES3A 1FRIA 3OMCA 4P7VA 1B3TA 1EAYC 2L9NA 2FJBB 3MM7A 1YJNQ 3HT3A 3OYGA 3J81E 4XU1A 1JLCA 2XM3A 4DR6F 4R8UB 3I6PA 1T94A 2P6SA 2L41A 4MIAA 2YNFB 5I42A 1KD1U 1AB8A 1M5SA 1SJFA 3RUXA 5KYWA 1M8VA 4KB7A 4P2FA 3UWNA 3OY9A 3UR3C 2P84A 1IKYA 4FSXA 1SJ1A 3NS5A 2UUAJ 3TR5A 1Y5IB 3CJ3A 2HURA 5IT0A 1XTZA 3A8KA 2V8PA 3MO8A 3UI3A 2OTJS 1IQTA 4BUGA 4UOGA 4IFYB 3UATA 1FWPA 4DFMA 2W0ZA 1D3BB 2GVZA 2MGZA 4JI6J 4RW8B 1VRUA 3Q8VA 3A8MB 2G2OA 4OX8A 2OHDA 1PKUA 4RX6A 1XNRF 2BA9A 1UJ4A 1WHMA 1QKWA 4ER8A 1J27A 2C3YA 3ITHB 4MKYA 3JAMY 4IUUA 4BD3A 4J91A 2FJWA 5EGYA 1RISA 2BZXA 1LJOA 4LDXA 2CQ4A 4M5MA 3WVDB 1R31A 3Q86A 3RYLA 3RJMB 3J7ZT 3D6TB 2VFTA 4Y2KA 2FY1A 2BJDA 3QLHB 4J6WA 3CCJA 2Z56B 1XNQJ 4BE0A 2IVYA 2BZ8A 3ELHA 2W1BA 1GMVA 1NDPA 2NUPA 1QSYA 5LSLA 1TL7B 3CCET 1IM6A 2DXEA 2YQ0A 3G96A 4ELVA 1YWPA 1RUSA 1JX4A 1U02A 4ELZC 2ATLA 1T95A 2FVUA 2IM3A 3CNQP 3EVWA 4C92C 2DEIA 5LJ3e 4DEYA 1TP7A 3K17A 3QGHA 1CKBA 2LQBA 4KO0B 2YNHA 3EGZA 3IS9B 2B8PA 2DNOA 1YJ9Q 1J2VA 3MUTP 2VOOA 3KHGA 1M5KC 2CJKA 2J8AA 5ITHA 4PG7A 1C0TA 1KHWA 1RT2A 2DIVA 3VS4A 3GV7B 1DJ0A 4PPZA 3Q8RB 4O4GB 5IT9Y 1SB6A 1AWXA 2FVRA 5M2PA 1K0TA 1CULB 4JLGA 3GV5B 4FF3A 4DQSA 3GNFB 1RAHB 1BD6A 1VQPQ 1UJYA 3CC7T 3D1QA 2HK2A 2DVIA 1F60B 3R2CJ 3IAS9 1R0AB 4WP9A 3C66A 2Z8QA 1BHNA 1H2VZ 3M0QA 2XC9A 2D9PA 4DUYF 4GKKJ 1VYAA 3KJVA 2ZAEA 2NXNA 3Q24A 2W2QP 1EHWA 4ZLLA 1WQWA 2VPXB 4CO3A 4E2FB 2DXCA 1TKTA 3N6MA 2LTOA 5T41A 1HFEL 5F9LA 3K57A 3IR7B 3PIPQ 2YRDA 1GFDA 4F2RA 2QFIA 2RJDA 5GAMh 1ZBTA 4RNHA 3SSSA 3CPFA 1MMNA 1ZAVA 1K73U 1T11A 2C42A 2Y3YA 1OYEA 4NXNF 4QW2A 2DHGA 4IH7A 1YLXA 5GANg 2JMAA 2RA2A 2G1DA 4J8OA 4JI7F 2W8LA 2K1RB 1VIFA 4LT6A 4OJ1A 3GYGA 4A4JA 2GFUA 1N5ZA 2YQ1A 3VRZA 5HLFB 3MP6A 2VG6A 2CJQA 2X3GA 5LJ5d 4Y65A 4CIOA 4A47A 4CC4B 3CCJS 1QDUB 4U7CA 3V7CA 4F50A 2V9KA 2G0IA 5DG7A 4C4WA 1WFWA 3MP8A 2J6TA 1RBLA 2CS7A 4ELYC 1U7LA 4X9CA 2IJFA 3QRQA 3VAHA 2DL4A 2KR3A 1WELA 2CNNB 2E10A 1N27A 2RH3A 3OXLA 2JFKA 3MM8A 5EX3A 5AE3A 2DVJA 2HBYB 1AUSL 5SUHA 4LUEA 4FYWB 2LXFA 1RWXB 4NZ6A 1PKTA 1ZM3A 3QGPA 2F9DA 2WONA 2DEUA 4U7UK 3ENAA 2HFOA 3NKYA 3DFEA 2FJXA 2I38A 4I67A 2POKA 2F5KA 4J9MA 1VJWA 3TARA 3OW2P 3FSIA 2QA4Q 3MEWA 4LVOP 1LWXA 1T8EA 4C9DA 2LECA 3OTEA 3D54A 3PFSA 4N47A 1X69A 3L7OA 3O5TB 3H5XA 2DGSA 1VC5A 2FPEA 2Y9HA 5L1KA 2DTIA 2QQBA 2VUBA 3C15A 4ESRA 2XCPA 3M8PA 2R2SA 3HL8A 5IH2A 4DV4J 1GNKA 1U1LA 2M0OA 5LL6S 2WSEE 4TQRA 1E6YB 1U25A 2KN4A 3CO0P 4ZVQB 2DL7A 4F0KA 3BGFA 2G3RA 1Q7YC 1LWFB 2ZH5A 2LQ8A 4FL6A 2W9CB 3DRRA 2CJXB 3DI6A 3UR0A 5K14B 1HW8A 5EDWA 5LSRA 4OZ5A 2DVEA 4RNFA 2CPEA 2WSCC 2MJNA 3QGGA 3C12A 1N4LA 3UNGC 2BABA 3QFHA 3E19A 2DXUA 3CD6Q 3WZ0A 2P9GA 4AD6A 1S6PB 1LFPA 1TV6A 1G1XA 3BH7B 1NB7A 2OO4A 1R3NA 1OIAA 4P72A 3RERA 2HRUA 2COYA 5B0EA 4J9GA 4DR7F 1WLPB 1AZSA 3UCUP 3RBDA 4OZ1A 4ILLA 4QU6A 1NK5A 3CC2T 3H2UB 1PJ6A 4ELTA 4WP3A 2IYIA 5D77A 1VDHA 4DMZA 1QSLA 1IBCB 2ZPHB 2DBMA 1V3ZA 3DDIA 2EAYA 5C24A 4RW9B 1H2TZ 2CQPA 1UPPA 4YOEA 1GT8A 4DU7A 2V50A 3T1YF 3MHXA 1IKWB 4CLYA 4F7UG 2AZ1A 1JWWA 2YUQA 4P75A 5L1LA 1TFYA 2BACA 4OX9F 2YWHA 4MDXA 2FD2A 2DERA 4ZIWA 1EX8A 4F02A 4LDWA 4MKVA 1HXDA 4O6JA 2VQEF 3SV4A 2VFSA 3W5YA 3EH1A 2Q79A 2V69A 5A0GA 4C8NA 4KHPF 4M7DF 3A3NB 1KC8R 1VQNQ 4JZ4A 2NREA 2V8VA 5HP1A 1U06A 3SMZA 3T9NA 2F9JA 1BI2A 2FUG9 4DV1J 1CG2A 2CZVC 2A6OA 3BDUA 2HIYA 2EQUA 4ZS6A 1RACB 1X9SA 3N28A 1Y96A 2JLGA 3OYKA 3NS6A 1AFJA 2EC0A 2YNGB 4F17A 4WZQA 5DS7A 1RWUA 5KT7A 1LWEA 1VQLA 3NY0A 3W2VB 5GAOq 1UETA 3M30B 3G4SA 4JI2J 1UJ0A 2KDSA 1T9UA 2GX8A 3LH0A 5ETTA 1A0NB 2UVRA 3KXTA 3OR1B 2CADA 4DEZA 3PW5A 2YX4A 2CQGA 2FB7A 1SL0A 1FWKA 3GJSB 4PWDA 2K5LA 2PA3A 5EWFA 1RT3B 4OV6A 3OFHA 4RNMA 3CPWR 3H9NA 2B9WA 4JS5A 1YCYA 1HD0A 3CCMQ 1RBOB 4AFUC 4IDKB 3AAWB 3VWSA 2OD4A 2XSJB 4LBIA 3V8KA 1M1KU 3HHTB 4EFAC 2ZVSA 4Q2MA 1RTZA 2B4UA 3AB2B 3NAIA 2H4WB 2AGQA 1K76A 4C8QG 4FXVA 5C25B 3VYHB 2CUBA 5KFVA 1DTQA 4J7FA 3AJ2A 3G71A 4JI4F 1FXDA 2MLXA 1PJ5A 1OSDA 4O3SA 1GCQC 1JBMA 1Q53A 3JB9D 1T02A 3D0IE 5E7OB 3R7NB 5B08A 3MHYA 3L2VA 3M2RA 3J7Z5 4HHUA 1BK2A 4B3RJ 1TVRB 3JAMU 3R5CA 4J9VA 3OYCA 2K9GA 4LF4J 3LWMA 3V4MA 1FKPB 3ULRB 2BTTA 3QKJA 1FK9A 1HI8A 4EGLA 3IXQA 3V6JA 4X4VA 2FB0A 1Y3KA 3H0PA 1YITA 1VQKQ 4I6AA 1WJQA 4CRJA 5KT2A 1MU2B 4QPXA 2QMUB 1KBRA 4PG8A 4TVRA 1CBKA 5J2QB 1KNZA 4M7AB 3VGUA 1IR2A 1QUVA 1OOTA 1Q82U 1HNWJ 1YI2Q 2FQQB 3FC9A 2ZNZA 1XC9A 1XOVA 3VTIA 1R89A 2WRMA 4DOZA 1WHKA 5LJ3d 4OYWA 4DSJA 2HZYA 1YVFA 1NHUA 5H9EJ 4M78A 2XMJA 2M70A 4LF9F 2M4MA 1SJ4P 4B9NA 2M9UA 4UY8T 1OMSA 4ITSA 2MSTA 2EBEA 4FBTA 1G3YA 3SD4A 5J1EA 1VQLS 3UE2A 2LQ5A 1ZSZC 1UB4A 3G4SS 4CT8A 3RG6A 1VRTB 4PKDB 2Q3PA 2DNLA 3M6XA 3MD3A 3J81j 3LP1B 3TA2A 1MROB 4ID5A 3L2ZA 2Y4YA 4CP5A 4B9VA 5IT9U 3NCRA 3ENQA 3A5ZB 3A8GB 1N32J 2DNYA 1GX5A 1SIZA 3L42A 3MM6A 3NGKA 4C8QE 2BKNA 2E9TA 4YB5A 1B07A 3L7UA 3OTDA 1RU1A 5F8IA 1RT1B 1RADB 4TY9A 3GILA 1WOPA 1IBLJ 2W01A 3K2YA 1N5VA 4I2QB 4IG0A 2WB1D 2JM9A 1I07A 1AUDA 1B70B 4OJHA 2UV8G 2CWKA 2BRLA 2L89A 4RW6B 3G71S 1SSFA 3ULHA 1LV5A 4K50A 3WX8A 3OJUA 4ZP8A 1Q5VA 2AKWB 3DOLB 1FRJA 4ELUA 4N4HA 3I5RA 3HPWA 2GTOA 2D69A 4DV0F 3DGVA 2LKZA 4QR1A 2IRYA 3T41A 3DLLQ 2N4DA 1UP1A 5JVHQ 2RB6A 1WWHA 3PHEA 3N0VA 2PVDB 2XMFA 3CCRT 1D8ZA 3UA7A 2GBQA 3SEOA 1EP4A 4MIWA 1REVA 4ZVUB 4LF7J 3I5AA 4ZIVA 3QFWA 1IRXA 2HQ3A 4CYUB 1PCAA 4RUCA 1YITS 2QC3A 2EYYA 1HIYA 1WDDA 4H4MB 2RK2A 4CLPA 2HSPA 4LBHA 1S1VA 2QIFA 2EPIA 1T9XA 2KBTA 3M55A 1RE1B 3CCUT 3D9BA 4B9WA 1NB2A 1ACMB 1KD1C 1A0OB 2D41A 2ZKUA 4AFSC 2B5JA 2HBZB 3DGPA 1PC5A 4OHWA 1MMDA 2KSSA 2E1CA 1B0PA 1N36J 4R25A 2EI5A 2PO4A 2AX0A 2CKWA 1RCXB 3NHNA 2XO7A 1D9DA 3HRSA 4RU9A 4OZ3A 1OYDA 2GVZB 4M75A 4DBFA 2MKYA 1F2HA 1KTQA 1YHQA 1VRUB 2XMWA 2GFFA 3OQ5A 2E7VA 2VVKA 3CJSA 4DL6A 3KHHA 4USUA 2UUAF 1AWJA 4Q44A 2XCAA 1SJRA 1OPIA 1QJHA 1VQ6A 3PKYA 2BZYA 1ZYQA 2PE8A 3CBPA 2LFVA 2KNBB 3W9IA 4UOHA 4DS5A 5GAOp 1VQOT 5GMDA 2P0QA 3GIRA 2YBVA 3HMJG 2RVJA 2LLZA 1HBMA 3DXSX 3EDRB 2D8HA 2VBWA 2HNIA 3DRSB 5CKEA 1X2QA 3L7PA 3CQTA 4OYMA 4JI6F 1U8RA 3KLFA 3PDNA 2MKIA 2M0YA 4PXDA 3C3LA 3BGLA 4TXSA 3D4JA 2GO9A 4F3QA 3BV8A 3TVTA 3GR1A 2GA7A 3JCMV 1R7IA 1IVZA 2BDPA 2KVIA 2XLJA 3J7YU 2H3EB 4OMQA 5ECAA 1REGX 3E01B 4M77A 4JJBA 4OHYA 1YIJA 2M0GB 2LX7A 1YQHA 2K7JA 4ZVEA 4DZDA 4Y28C 5HMYA 2MY7A 1TL1B 2AYGA 3LGFA 5J1PA 1FXLA 5EG2A 2KFNA 3E9GA 2K57A 2H5EA 2GW8A 3VVTA 1NJIT 4NLRA 4J9FA 3CJKB 1XNQF 5F8MA 3SQGB 2I2LA 3OTOF 1TMMA 2JLFA 3N6NA 3DM2A 1WHYA 1N9RA 4P2MA 1U24A 3A13A 3H5SA 4RTTA 3UFCX 4C92G 4IRKA 2HL3A 3TUJC 3TJ8A 4ECXA 4ED0A 4X4PA 1ZLMA 2H51B 1KKHA 2ILZA 2MF2A 3CCLA 4JJDA 2JTMA 4KR0B 2DFUA 3DRXA 3PIOA 3CWJA 1SV5B 3AB4B 2DGVA 2VD3A 3C6TB 1YJNT 5HATA 1LW2A 4LFBJ 4FW1A 1N5YB 3TRGA 4NMLA 2Y8YA 1Q5YA 7AT1B 1TKTB 3NMRA 1HR0J 5M2UA 1QSSA 2YLBA 4BC7A 1V6HA 4KUDK 1YHQS 3SWNA 1RK8A 3C6UA 1RHQB 1WX6A 1DY3A 2UU9J 4NLSA 1N33J 3C4SA 2DR6A 2ZE2A 2Y1RI 5LMUJ 1RI9A 4DV2J 4PG6A 4OZLA 1LOJA 1VQ6S 5IS2A 3EFOB 5BYSA 1NPKA 4WE1B 1TOVA 1NJIR 3I87A 4ZK7M 4ZLNA 2PC6A 4GKKF 5KFKA 5K8PA 2QA4G 1VS3A 1UGSB 2XBPA 1HHSA 1ZZFA 2D3OR 2VG6B 2LEPA 1UWBB 2V68A 1I1JA 3KG1A 2VOPA 3M56A 5KG0A 3QUIA 2EKOA 3THVA 1HQUB 2EFOA 2E66A 2OEMA 2OJ3A 1TK0A 1W26A 3H42A 1JLBB 1Y10A 4I7FA 2O9SA 3EVMA 2CQDA 2JN0A 4AMCA 2DHSA 3ZO7A 4LDYA 1FMVA 4WKRA 2DHXA 4GVLA 4Y2MA 5KFZA 4C0FA 1R8CA 1WF2A 5CCLA 1YIJS 4EMDA 3PACA 2COZA 2B4OA 3EDQB 5KFCA 2O31A 3CJ4A 1S6QB 1UDLA 4C92E 2CUYA 2ZVIA 5J2NA 1ZM9A 3X28B 3IRXB 2M2BA 1V5VA 4QYZJ 2DR5A 3PNIA 4OYZA 2LP5A 3OTBA 1S97A 3GPAA 4ZCKA 1H3DA 3EJMA 4M7DA 4J9PA 4LMZA 2AQ4A 1GBQA 2HAIA 2PIIA 4GVBB 3D3BJ 5IHKA 4EZ9A 2HHSA 2DK2A 2XGPA 1UFKA 1S12A 1NEGA 3QIPA 3G1JA 5FU6C 4DUZJ 3RB6A 4TYBA 4A4KA 5F9NA 3F70A 5GAN3 3OL7A 1RWKB 4HACB 4HVZA 3R6NA 2GIQA 1ROFA 1YCSB 4Y92A 4II1A 3M8PB 3CCLS 4GRSA 2W9BB 1WZOA 1W2BP 4DR5J 1YJ9T 2OPRB 4BY6B 2KB2A 3G82B 2ZCFB 2XG8D 2VFUA 2R8KA 3HKSA 1HYSA 1WDXA 2JL9A 5ETSA 3DI6B 4PJOA 2UXCF 2HVIA 2AIRB 3M2UA 3TX0A 2R7RA 5HMZA 2J06A 3KG4A 3CF5Q 2OMLA 2O2OA 1J5OA 3FRZA 1U8SA 2P0PA 2VA3A 2KYMA 3WDOA 4J9KA 2RU3A 3JSMA 3FNNA 4H4KC 1I8FA 1UGRB 3MM5A 4RW7B 2P8IA 3I55T 3RRHA 3CD5A 5IN1A 4B9LA 1TV6B 2G13A 4HTJA 3GFZA 1XERA 4MKAA 4LR9A 1BU1A 1YBAA 4NRUA 1DAXA 2QASA 2R4FA 2K6DA 4LRDA 1OI1A 1TUWA 1TXQA 1I5OB 2RF2B 5ETRA 2OIHA 4XK8C 2RM4A 4O3NA 1TKXA 2PMZD 3EM1A 2B0GA 3HFKA 1VQ8Q 2XYPB 2RI5A 4OVAA 1S9EB 5CCMA 2YTCA 2IAJA 2DBKA 4JZ3A 1D0YA 3VAFA 4LJMA 1V76A 3GU0A 4ZLJA 3L2RA 3AHUA 3TAMA 1HBNA 4FDFA 2C0OA 4DF8A 1KR4A 2CUDA 2O5DA 5GMKa 3GLXA 1YJWA 5GAN6 3EG0A 4F25A 2QZ8A 4UT4A 2JX2A 3G86A 1NJXA 1F9HA 4O0NA 1DFDA 2HCKA 3GR0A 1XQIA 3W62A 4KFBB 4BDYA 5LL6d 4KSEB 4QVDA 4QR2A 4BHQA 2IG0A 5FJ4A 4IH6A 3SIPB 2FHKA 4HVUA 4DSEA 4OMNA 4Z7YA 4CLZA 2KT2A 5HP1B 2UVVA 1HQEB 1V5IB 1GMWA 4BI8B 3VGSA 2LX9A 4ICLA 4YR3A 2XWXA 1RLCL 4KYZA 2M3DA 2AX1A 1NSQA 5K5MA 3HFZB 2LDIA 1WJSA 4DXLA 3C46A 4XPCA 2WOMB 1Y96B 2KE9A 1JLEB 2FVCA 3HHLC 2C0TA 2F4VJ 1LWEB 4U7UD 2CNLB 4V19J 2DPPB 5J2MA 3KHLA 1MN9A 1RTJA 3I0SB 3GIIA 3CC7A 1VQ5T 1NLPC 1Q86U 3TA1A 1U3OA 3RIRA 2B86A 2EYXA 3KLHB 3W2WA 3IAM9 5DDQC 3B6BA 1VQMQ 1SHGA 4KHMA 4C11A 2BIVA 4RZRA 2QA4T 4JUVA 2BX6A 3PT9A 1IQZA 4DV1F 4HT9A 2HMIA 2DNZA 5HROB 4AFQC 2CDQA 2UVUA 2WAQD 3LP0A 3TNVA 5KFWA 2OH2A 4RTWA 3DU6A 3CCVQ 3MCOA 1IKVA 2WSCE 2GIRA 1SC4B 1EZZB 5J2PB 2DLPA 5D0RA 2DRBA 4C0BA 4JI2F 2PGCA 2K2PA 2RUGA 4DBRA 3ET6A 1UEVA 2A3JA 1T3SA 3QO9A 1U5SA 4C8QF 3TOQA 1Y4ZB 4JI1F 3CJ5A 1VHFA 3R6GB 5C2GA 4UZCA 5CA5A 4FPIA 4TY8A 2CT3A 2A3LA 4X62J 3UDCA 3IO1A 2GQCA 1Q8IA 2WVCA 2MDAA 5CKDA 1U1RA 2HHQA 3RUBL 3CD6T 2UUBF 1BLUA 3JTNA 4OZJA 1HKAA 2PI4A 3EG2A 3OHAA 3QRPA 3NOGA 3TA0A 1AOJA 2IM1A 1B3QA 2NCKL 1NK9A 1PG5B 1FRKA 1WNEA 4XTXA 3OLBA 3HP9A 1YJWS 5U47A 3THKA 3ADAC 1UA1A 4K5RA 1FVSA 2HFZA 2KI2A 4U8VA 2Y1JA 4DPUA 4E7LA 1SQEA 4A8YA 4DPTA 4JI5J 5GVQA 1KQ1A 3W8PA 4JLIA 3P6YC 1H72C 2QGGA 4ZN1A 4JS4A 3W9HA 3PJXA 3I5CA 2HIQA 4MJKA 2DXFA 2AHJB 2JVOA 2MYSA 4B3RF 4ED1A 2V6AA 2AKKA 1N34J 4LF4F 2HWTA 4Q8EA 4DX5A 3MECA 3OYYA 2GNKA 4B3TJ 2KJWA 1U2RA 3PMIA 1FERA 4JRQA 3CEDA 1P9YA 2ZH9A 2DZ9A 2MLYA 5FU6B 2O67A 4QVZA 4M5IA 1HMVA 2OFGX 3SCIE 1R0BG 2EGEA 3M8YA 2F40A 4MH8A 3Q1JA 5LXYA 4XQ3A 3SSRA 1VQNT 1GRIA 3HHLD 1SKUB 2FLPA 2RAQA 3MR7A 1HNWF 3BM7A 3M2VA 1GMUA 4AE5A 1K1QA 1UVKA 2OAWA 2CDRB 1Q7YT 3IBCB 4HI1A 1S6OA 4NLWA 1BKBA 5CK9A 4EZ6A 3OS5A 1V29B 2NSBA 3TP2A 4USVA 1KG1A 4RW4A 2A18A 1T3LA 2DRAA 2ECZA 2KAFA 2DK3A 2XGQA 4BE2A 3GCWP 1N88A 2OTJQ 2ZC3A 1VFJA 2OPSB 3WC0A 2X1AA 4BWMA 2K06A 1LNQA 1U1NA 3M4YA 1TELA 4OYIA 5GANe 2FJDB 3CDUA 3OL6A 2QSFA 2BE9B 1VBKA 4JRIA 4KKOB 2E1HA 3BGUA 3LPYA 1UVIA 1UW9A 2HBRB 4GLKA 2DGQA 3W65A 1RLPC 4M7AD 4DV7J 1QWFA 1N32F 3CC2A 3CCMT 1GCPA 4PFOA 4XDCA 3RRKA 3OUYB 3R27A 5KFOA 3TZWA 5A8WA 4FU6A 4NASA 5FWBA 1JLFB 1LWCA 4OI2A 1IZ6A 2DR8A 5LJ5f 3HVAA 3RR8A 4W92B 2QEXQ 2CPHA 3LH2S 3CPWA 2RT3A 4G1IA 3EVOA 3T6JA 3DN9A 3K89A 4ZTJA 2K8GA 3G6EQ 1Q7YR 2AEMA 1JJHA 3W64A 4EBDA 2ZZMA 1RT5A 2QL5B 3OJSA 4USHA 3N5BB 2D0QB 4JUZA 4G1QB 3HKZD 4OMPA 4CCHA 1ITPA 1PYSB 2DXBA 4EI2A 3E2EA 2M7SA 2CQ3A 8RUCA 2DNHA 3RB4A 5E3AA 3OV7A 2AJ2A 2YKNB 1I5LA 1XBWA 4LUBA 3D6MB 4LF7F 2H5JB 2V4JB 3BR8A 1NPPA 3AH6A 4WCEQ 4YUDA 2E65A 2K5IA 3JCMc 1UVNA 1NCLA 1VQKT 1R8BA 3N4WA 3HD2A 1RWMB 1MWYA 4N41A 2XKOC 3BDEA 2M16A 3BH6B 2K2VA 1YRTA 3J7YI 3CULA 5EUHA 1QCOA 2C2DA 2D7SA 1SHFA 1HD1A 2E5KA 2Z4PA 2X4WA 1WACA 4AYBD 1RTDA 1YI2T 5D0HA 1EETB 2WK4A 1SKRA 4PUOA 2EQMA 1N36F 4DX6A 2OJ2A 5D6GA 2CZ6B 1KLNA 1NUEA 4ZVRB 2VH7A 1H2UX 3ZZTA 1Y57A 4F4ZA 3PRDA 2C2RA 3MP1A 2YH0A 2N7YA 4EMHA 2HHXA 5CIUA 1NPRA 4C7QA 1I81A 3KLFB 2WVEA 1HHQA 2MZQA 3ZZOA 3G87A 2AJ1A 1NJIU 2KYXA 2ALYB 3SV3A 4KPYA 1R6YA 5THWA 2HHPA 4R0EA 1FMWA 2HDAA 4ZPVR 1RKJA 2AEFA 1KHIA 1UHCA 1M2VB 3FZBA 1U1TA 3CT9A 2IDLA 4OYPA 2QFJA 3CC2S 1C0UA 2DJZA 4ATOA 1UEBA 3I9QA 3KNAA 2XYGB 3C19A 1M1FA 4OB1B 1SRLA 4Q2LA 2OPQA 3CJRA 3X26B 2HGMA 1MNDA 3GJRB 4QW8A 2CXEA 2M8DB 4N77A 1JLQA 4TU7A 4FVMA 1KQGB 3PVLA 1C1CA 2VC8A 4NYPA 1WEYA 3THPA 2W7OA 2R8JA 4NLOA 3BW1A 3CCJQ 3RBXA 2M51A 3ETMA 3PTWA 3CPWP 1WF0A 1HPZA 3ONQA 3DM2B 4ZA1A 4DQIA 5HBMA 3LPEA 5KYXB 5DLFA 1VQSA 1KVIA 2OI3A 4C92F 3TSZA 1E6VA 5I2MA 5BJRA 5EWEA 1FESA 4F36A 5IQQA 3QWYA 3ZTOA 1WI6A 3QO3A 4DCJB 1S72A 4J9HA 4RBTA 3S7RA 4ED3A 2HFVA 3CSKA 2R7WA 1QE1B 5HSPA 1N5SA 2RKIA 4ANDA 2EBGA 1QVFR 1DQAA 3K5OA 2HQGA 4YR0A 2NYSA 3BREA 3VVUA 5IM0B 3QQCD 4CNYA 2OELA 2J9DE 2CPJA 1VC0A 2MWOA 4BBYA 3G7ZA 1T05A 2DR7A 2MZSA 3IWXA 2C2MB 5FW9A 2OEJA 1V9OA 3HHDA 4D8DA 4LSLA 4EIKA 3KK1A 5JUMA 2KFZA 2Y90A 4LFBF 3HZEA 3REAB 1FRLA 3EZ5A 5GMKj 2R7XA 2FC8A 1GXIE 1UCNA 4X4TA 1XR7A 5M2RA 4DR6J 3EMTA 3M57A 4URGA 5GAHU 2XNRA 3PFEA 4OLOA 4DL7A 1DRZA 1OSCA 2X1FA 3F73A 1KSPA 2LP4A 3AA9A 2UU9F 1N33F 5E3RA 5GJWB 3SZ2A 4U8YA 5LMUF 4DV2F 2XS2A 4HDHA 4A46A 2EKHA 1WPYA 3POTA 3L95X 2JVRA 1BI3A 2VGMA 2RQTA 3V7RA 4WK1A 4MMOA 4IOBA 1B64A 2JJ4D 4WTOB 3IR5B 3CMQA 4DPYA 1IM4A 1S6UA 5J2NB 4HYKA 4OYXA 5KYNA 1N52B 2UZAA 5KFNA 3QYHB 3D0GE 2L3QA 5GMKe 1KJWA 4ETZA 3F41A 1QAJA 4K4YA 1FDNA 2JZ5A 2YNFA 3CCRA 4AXJA 1N8RU 3TEEA 1OPLA 3W3SA 4Y28E 2E44A 3A3OB 1IWGA 1WI7A 1VLYA 1K8AU 2RD5C 3ENVA 4FVCA 1RAGB 4M94A 2WW4A 3VJPA 1WYXA 1E6HA 3ZBDA 4XU3A 1XN9A 4JV5F 2BVZA 4PLIA 4M63A 2WB4A 3OVSA 1CC8A 2XLIA 2VQFJ 1S72S 3US5A 5KG5A 1TL4A 3TVKA 2YRVA 3MEUA 4WF2A 1FDAA 1WTBA 3OVBA 2QQSA 2LVMA 2CFXA 5D7UA 1KD1T 3TAPA 1FX2A 1U4BA 3JCMe 5KH6A 4IFYA 2XZDB 1D3BA 3H5YA 3K5PA 2VG7A 2GAGC 2BJEA 3BE3A 2MKHA 3LGNA 2RU9A 5KOWA 4O23A 4DUZF 4RW8A 1HWUA 2V67A 4USWA 2J6KA 4B3OB 4XTVA 4XAXB 3JSMB 1OX9A 4U96A 5KFFA 2L2PA 5DGAA 5L46A 2JH3A 2JS0A 1HWIA 1YN8A 5HVGA 1KVKA 2DCLA 5GMKh 2DYAA 2VC0A 3ITHA 4DR5F 4F8RA 2NPFA 1H73A 4J9CA 4FNHA 2KEAA 2MB0B 2CJ9A 5KT3A 5AE1A 1B7YB 2EK6A 3ZL7C 1YBTA 2YKPA 4R5PB 1ZTTA 1X8DA 1N0UA 3C2PA 3QLHA 3HSGA 1D8YA 1TSFA 2JTFA 3LO3A 5KFXA 3A8LB 3JSCA 3VAGA 4N0AA 4IG3B 1TL7A 4IIMA 2JNGA 3MEEB 1X9MA 4CC2A 3H6ZA 4QZVB 2EW3A 2L3SA 3P49B 4WZMA 3PXGa 3RMQA 3SCJE 2DRDA 3TAMB 2JXBA 4DR1J 3IWLA 4X64J 2OTLA 2K79A 1KD1R 1NU4A 2QXFA 2OI2A 3JCMh 4KO0A 3B82A 2ZJQQ 4ECTA 3IS9A 4K0KJ 2LCWA 4RG8A 3META 5DETA 2ZM6J 3D5MA 1YWXA 3FDSA 3FLGA 2CZ9A 4K2XA 1X4GA 5IV3A 5ETOA 3CJ2A 5GANd 4FNIA 1FDDA 3CTRA 4NLYA 4L5GA 2JC0A 5KFTA 1GQEA 4O4GA 1UGVA 2YRCA 3QJYA 2LQ9A 3OYHA 3UQSA 4ICLB 4NLUA 5A8KB 3T6BA 3EFRA 1CULA 2IFXA 3OT9A 1ZX6A 2RPNA 2O01C 3X25B 3HPOA 5DLGA 3EPGA 1V3RA 1Q0NA 4JI7J 3HJFA 2I9SA 1YJVA 3FRYA 2F2WA 2FHJA 1KEKA 2XULA 1WC0A 4FYVB 4XU2A 4UOFA 3IG1B 1KFZA 1ZM4A 3MMAB 2COLA 3FK4A 4BLGA 1BIAA 5ETMA 1X6BA 3ASKA 2OSQA 1S79A 1N54B 2MHEA 4HT5A 5IHNA 5B0BA 4YFUA 2I0NA 4JV2A 2L5QA 3ISZA 1Q86C 2F5TX 2R58A 5KCOA 4O44B 2J5AA 4K4TA 3UF4A 2ZHBA 4ZVGA 3JYTA 3ER0A 2P6TA 1JQGA 2F4VF 1JO8A 3ENWA 3FVYA 3GYXB 4CRIA 1VQLQ 4L6V5 1BMQB 1XTDA 2K1RA 2BOPA 3MOZA 4KAIA 3UA6A 4MKBA 4K2JA 2K3YA 3PW7A 5HLFA 4M78C 2A6MA 3U1MA 2W10A 4A54A 3D6HB 2R7TA 1S7IA 1IBKJ 4ZVHA 4OQJA 1HA1A 2J7KA 5KFIA 2QE5A 2WCXA 2AJ4A 4FYXB 1ZM2A 1IUJA 3KDNA 1CEZA 2E9ZA 1JEGA 1MV3A 1H38A 1WDTA 4L59A 2J0XA 2EBPA 2DY1A 3CCQQ 4XK8E 3UNYA 1M1HA 2WZ1A 2X9HA 4PL6A 2OTLS 1P1LA 1FJGJ 3OYNA 2KT3A 3VQTA 3QBCA 2L9WA 3M59A 7FD1A 4GC6A 3IR6B 1PD1A 2NQPA 3I9ZA 3CB4A 3NTHA 1M0SA 3R6OA 3G71Q 3BDPA 1NDLA 5I22A 3M5AA 1X4FA 1ICEB 2YX1A 3I0RA 4X4QA 1YRXA 3PYFA 3VS7A 4X62F 9ATCB 1VQ8T 1Z1ZA 2HFNA 5K8OA 2F65A 1HL6A 2DH9A 2R5AA 4B9MA 4O5VA 3WIVA 1TMJA 2RHZA 3S01A 3PTAA 3BKTA 2FEIA 2KM8B 3R5BA 1Y00A 3MECB 4C8LA 2DM1A 1RDRA 4ID8A 3UPFA 1RHUB 4DJBA 1T3NA 5CYQB 3H8ZA 1WUUA 1NAQA 2BKOA 1E6YA 3EGUA 1HMVB 3WC2A 1K73R 3KKFA 4IUPA 3Q22A 1LWFA 2W9CA 4J90A 3HO1A 4JI5F 1XIQA 3DLJA 5K14A 4QQDA 1FNXH 3LH5A 3VGVA 3UD4P 3OPKA 4HLBA 1W6XA 2V63A 1NK0A 1N34F 4Y2IA 4CO0A 3LQVA 3EE3A 5CD4A 2QL9B 4AL7A 4TVAB 4WYLA 1RAAB 1S6PA 1A7GE 4B3TF 3S3MA 1UVLA 1PGZA 2KVQG 1VQPA 5L23A 4I64A 2KYBA 2HVDA 1HLWA 3H0HA 4DQ2A 3CUNA 3X1LB 3ZZUA 4K11A 2C2NA 5JJBA 1EARA 4P73A 5KFEA 1FX7A 4RBVA 3FJ2A 1PRMC 1VQMT 1X6GA 3QJJA 1RCOB 3N6LA 4NYOA 2HNZB 1PO6A 4WTYA 3P4UB 4KHPJ 2XYHB 3VS5A 3DLKB 2I8EA 4M75C 2MTLA 3PIPA 2KI7A 1ZPVA 3S3NA 2LCSA 4M78D 3UDLA 1Y07A 2XDBA 5AYFA 2DETA 3EXYA 2IRUA 2Y1IA 4PZVA 5LT5A 1X7VA 1LWCB 1IKWA 2F8HA 3KLIB 3PX6A 3M8ZA 2UXDJ 3NRBA 2XICA 2CQ2A 4EYIB 1KVJA 3SBMA 1VBXA 4IR1A 3TW0A 2BM1A 2FY8A 4E7JA 2J8SA 3VS1A 2EC2A 2Y1LB 4DPWA 4CC7A 2QYGA 3I56T 3PV8A 4MZMA 1ZBXA 3QZ5B 3ZXWA 1S0OA 1D0EA 2NXCA 4DV7F 2JTEA 1W2IA 2R9LA 2C1EB 3MOJB 1SJQA 1Z4UA 5JVGQ 2LU1A 4P7TA 2BW2A 2AGOA 5D6WA 2DH8A 4O3OA 3IBFB 3RU0A 3BBFA 2E5IA 2DTJA 2QL7B 5DM7Q 1SPBP 2PUKB 1S49A 4PKCC 1AXQA 3DRYA 4EMGA 1HW9A 1TFWA 2GGRA 4EMKC 3ZNJ1 1ELOA 1DZ5A 3FMBA 3B4DA 2YNGA 3RB0A 3PRVA 3EX7B 4PQUB 3CMEA 3FUYA 5FRNA 3W2VA 5HQLA 4M77C 4KBIA 4I69A 2M88A 3M30A 5LJ3Y 4PRFA 1N0VC 5GMKl 3OR1A 4IQXA 4E7SA 3C95A 2KVQE 3R1LA 2XMVA 3G6XA 2DE0X 5DLOA 2QTXA 5CHCB 1K0VA 1IB8A 2EVRA 2GZOA 1KK7A 2EEYA 2ZHOA 3D1OA 4C0DC 2YLCA 5D78A 5EWGA 4V19X 4OHZA 4AQYJ 3VUZA 2GO8A 4IDKA 4RO0A 4Q7AA 1VGYA 1FFSB 4QIGA 2XSJA 2PU9B 2PZ1A 4E98A 4PG4A 2ZNYA 5H9FK 5AXLA 2BMBA 2RQVA 2X4YA 2YHTA 3O5ZA 1VQPS 1HD3A 2EWNA 2CP6A 2PEHA 2ZBPA 1HQ2A 1KHVA 1KTVA 2MAMA 4TQSA 4IUQA 1DLOB 2NXEA 1CSJA 3KFVA 5C25A 1BYMA 2VDIA 3WHIA 3BY7A 2LJ0A 2GJFA 4ECVA 1IGQA 1KQSR 1W7WA 2Y0BB 3QWUA 4F7VA 3NNCA 3AY0A 2X3WD 1AROP 1RP5A 2B51A 3H0FA 3F44A 2AWZA 5K8MA 4ZCLA 2CP0A 5LJ5h 3CIZA 2FRYA 3SWNC 1D1CA 3H59A 3A8JA 3D1HA 4ZVSB 5G4DA 1HI1A 2OTJT 1M90U 1WGSA 4CH7A 1GFWB 3HVRA 1DQ9A 2ZWOA 4M75D 2MOXA 4FXWA 4EEYA 1G83A 1CQNA 4DCPB 1TK8A 1PCXA 2MPXC 4F0HA 2DD8S 3PO5A 3B8HA 5CQXA 3EG9B 4LXCA 2R7SA 1MU2A 2HZAA 2F69A 4HL9A 4M7AA 3H4DA 4N76A 2HEKA 1G3WA 1YIJQ 2BJ8A 4C5HA 2H9ZA 4Q8FA 3K5LA 3OLAA 2DYBA 4LE9A 5GAHI 1VQOQ 3PR4A 4ED8A 2KT8A 2XD0A 2SEMA 2DO4A 1IHWA 4F0MA 3GJTB 3CMES 2V4QA 3HI9A 1TL3A 2V2ZA 3NS7B 5CYMB 5ADZA 1K9MT 5GAN8 3FCHA 1VRTA 5FU7B 5B0CA 1M1KR 5KE3A 1FF2A 3M6WA 5D0GA 1MROA 3A98A 1RA7A 4PYDA 3BB5A 4P9SA 1BIBA 5GAMg 5IC4B 4JBCA 4M77D 3KMQA 4M5DB 1L3UA 3PIOQ 3UO0A 2B6AB 1BQXA 1U6ZA 4Y91A 2CKKA 2VKZG 4PJNA 1FDBA 1RT1A 5LOQA 3NWGA 4KRWA 1ABQA 3CJ8A 4KGZB 2VGNA 4I2QA 1WC3A 4J7IA 1F5AA 4PPDA 4MZTA 2XU8A 3OSSC 4N7TA 3UPUA 1P9QC 4B9XA 1S0VA 3FZ2A 4GMKA 4RW6A 3OS0A 2DKOB 1AZGB 4F4YA 1X5PA 4PJOC 1JMTA 3KMSA 4F7UB 3DOLA 4FF2A 1OQ6A 3LWHA 2W8KA 1WHXA 1N5TA 1SSHA 2YWFA 2EKNA 4YTLA 3OVAA 2M52A 3K5MA 3CIMA 3CW2C 3KLGA 3J80Y 3V8JA 2PFDA 3TSWA 1F2GA 2E1MC 5RUBA 4A8MP 4KGKA 3DOMB 2K3IA 1O6XA 2M02A 1Q82R 3OFEA 2KG1A 2BJ1A 1NMEB 2EGCA 3A8EA 5KT4A 1EIFA 3MTJA 4AL6A 2GMJA 4CYUA 4DPXA 4DOWA 4H4MA 3JB9k 4DSIA 4DPOA 1ZHIA 4UZBA 2VFVA 3R7SB 2RQMA 1N8RC 3HSBA 4IFVB 2QYZA 2GCFA 2RF0A 1K8AC 1VQ7A 2ZPEB 2AW0A 3CCZA 3JQMA 2XMAA 1ZETA 3QZ9B 2OSRA 1LK5A 3CCJT 3MEDB 4CTAB 4ECRA 2QO3A 4LR8A 2RI3A 4RUHA 2ZD1B 2ACMA 2OAUA 2MIOA 4AUKA 2VG7B 2JOQA 1M5HA 2SXLA 4RJVA 3VF0B 3VYGA 5DO2A 5LJ3j 2JMCA 2YUNA 3QWPA 3GV8B 2QLFB 4EMKB 1JLGB 1YJTA 5AT1B 1B99A 1U1SA 1U1QA 1VQ4A 4WKYA 1ZPWX 2JVVA 2VQFF 1CJUB 4A8KA 2X7IA 5KTQA 1T9TA 4ZDNA 1ZUKA 3MFHA 4C8QB 1VUBA 1QW1A 1URNA 1FJCA 4M7DD 1CJTB 4DWIA 3DRSA 2IMWP 2YUPA 5MAOA 2LVWA 2JHEA 8ATCB 4DUTA 2PQWA 1RT4B 3OTOJ 5IXBA 3M8QA 2HQEA 3NCQA 3G2XA 2FRWA 3P45B 4ZJOA 1MSWD 2ASDA 3UW1A 5H9EK 4XU0A 3DMJB 3CDAA 3BBBA 1QVFA 4PXCA 1PC0A 3FBBA 3UT1A 2QK0A 4NA3A 1OQKA 2DPIA 3E01A 3UDEA 2FJVA 4MYTA 5KFLA 4OB3B 2B8AA 1SKSA 4OYAA 1TL1A 4PJOD 5KYYB 1CC7A 2E29A 3OXFA 1Y7PA 4CWBA 4HKEA 2R8IA 5EC7A 2JWNA 3CJKA 1OY8A 3SQGA 5SZTA 4LQ3A 4N8OA 2CVIA 4X4NA 5HKCA 4HT8A 3OW2A 3G9CA 2L8DA 1KLMB 3T1AA 4DR1F 2HS4A 4ZCIA 4X64F 5GADI 4AFFA 4PCQA 3HFOA 4NPOA 3UN2A 3HK2A 1RT6B 1WOSA 3X24B 1TUGB 3I55Q 2MZTA 3ISND 1M5PC 3TUPA 4K0KF 1VQ7S 1YJWQ 1WEXA 1SV5A 2BZ2A 1SF9A 2ZM6F 4FPRA 3C6TA 1BI0A 2RNEA 1RAIB 2AJQA 4CH0S 1N5YA 4MAKA 5CKBA 4UQTA 2VJVA 3HDSA 5LJ3h 3SFGA 3IA0A 2ZDOA 3NEKA 5C42A 1HNIB 1HNZJ 2VBYA 3T5KA 4LF5J 3BJYA 1KOHA 2ZBIA 1HARA 2EKYA 3JYTB 4NCBA 1FKAF 1VQ4S 3OS2A 2R7UA 3EFOA 1NSAA 4WE1A 3K59A 2QMWA 3DLGA 1CKAA 5DRKA 1ZSZA 1OO0B 2P9CA 3ILIA 2R7QA 4NMXA 2WBRA 1YG0A 1D9FA 5F8NA 3CGIA 3OYAA 2NUTA 2KRSA 1UWBA 1RLQC 2XHWA 1HBUB 1GMWD 3BN7A 2DIGA 1YZ7A 1HQUA 4I0WA 3LYIA 3S6WA 4QBUA 3M58A 2QA1A 2GAHC 4X2BA 1X43A 3U1LA 1JLBA 1DTTA 2QRRA 1T7PA 4F3OA 2COWA 3KLVA 4JV0A 2GQQA 5I21A 4HDGA 1QVFS 2DH7A 3CDEA 3D0HE 1QVFP 5DG8A 3PVXA 3AOAA 2U1AA 3MD1A 3TVZA 2DEQA 3J7AN 3VHQA 1EQ0A 3N01A 2HWHA 4DQPA 2EFPA 4A8OA 1S6QA 1X31C 2ZDPA 1GTHA 3IRXA 4MZPA 4M78G 1SUQB 2ZKTA 1U2FA 5H9FJ 2RQCA 2RMLA 3GFXA 1DJ7B 1IBKF 1VQ5Q 3I0RB 2IDEA 4F14A 4GO5X 2DNKA 3H2LA 2CYZB 3L09A 4GVBA 2UXCJ 1XMOJ 3JB9I 1KC8C 1NHKL 3Q8QB 3HZGA 2AP6A 3OW2S 4QCLA 1FE4A 3U7JA 1ZA2B 3NWRA 4IKAA 4KBMB 1FJGF 2EGAA 2PFFB 3FSYA 4HACA 1UFWA 1GH8A 4ZOSA 4RTUA 5A8RA 1QY7A 2ABYA 1IJFB 4ZPAA 5IXFA 3JCMQ 2W9BA 1E7OA 1VLOA 1FFGB 3LGMA 4DA4A 3OR2B 1Y71A 2OPRA 4CLLA 4K5SA 2PD1A 3QJLA 3G82A 1CSKA 1GFCA 2LCCA 1BUXA 5HANA 1JKHB 1YBUA 2O01E 4NOHA 1VQ9Q 2EXUA 3IN5A 4N4IA 2VASA 2VJUA 2HFUA 4ECWA 2D3UA 2JLEA 2MMPA 1VIEA 4G65A 3M0UA 4G6VB 3QBYA 2RJEA 4P10A 4CNZA 3C94A 1RHMB 3EICA 1M8MA 2MQMA 2HNDB 4L74A 5D3GB 4RW7A 2K3KA 1T9WA 4JI3J 2DNUA 3CO9A 4R0KA 3R3TA 1CS4B 1NNDA 3GIJA 1MV0B 3HHEA 5E3QA 2ASYA 2G0JA 2CZ1B 1I0CA 2B43A 1K4US 2EK1A 5I3UB 2YNIB 2NYIA 1NJWA 2O4XA 1S1TB 4RMOA 2RF2A 4BACA 1G8XA 2DNMA 1Z2LA 3HP6A 5HAOA 3GNGA 4RTZA 3PYEA 4RCBA 1S9EA 1U26A 4M78E 2ROGA 2RMOA 2HGNA 2NPIA 2V94A 4E8UA 1O51A 3BSNA 1VQLT 4XTTA 2LQKA 1Q1KA 2KU7A 2YKAA 3G4ST 3MAAB 2CPDA 2KXHA 1KDNA 1X4EA 1SQGA 1R43A 3BQ0A 4ENOA 2KGTA 3NNHA 4C92B 4I2PB 4KFBA 2B7BB 3OB9A 4WPAA 2UUCJ 3ILOA 1YJUA 3CCSQ 4Y3CA 2E5GA 3KK3B 1ABOA 4Y00A 4M75G 1HQEA 2GVDB 3R1HA 3VZIA 4X4UA 3CCQT 2J9EA 4W4MA 1S4FA 5B0AA 1H641 1FKOA 1WC5A 2JSXA 3QNWB 4ZJQA 1ULRA 4B3SJ 3G8TA 2QV6A 2MZJA 4FT4A 2ZBQA 4L3KA 1MG7A 1KQFB 3SCLE 2WOMA 1JLEA 3I4PA 2UXDF 1PHTA 1Z9QA 3AXKA 2CT4A 3J80U 4CH1A 2DITA 1SJ3P 2D6FA 1QVGR 3KK2A 1NM7A 3G71T 1CJKB 4IUTA 3I0SA 3ZZPA 2KH9A 3T9ZA 1S9GA 3VCDA 1JQQA 2DTOA 1XK8A 3KLHA 4OI6A 1UVJA 1R8HA 3EWGA 2J6UA 4C8ZA 4JI1J 2M5YA 2F8EX 5BXIA 2LDMA 1QKXA 3C8YA 1RA6A 1D0ZA 1YP5A 1C4CA 3EUNA 1U09A 2EW9A 2HVZA 5BYRA 5GAOm 5J39A 2X3DA 4ECUA 4OZNA 4DN9A 5HROA 4DLGA 1UJ6A 2UUBJ 1HNVA 4HTIA 4QYZK 2R2UA 1YFNA 2BEFA 5DDPC 4BI4A 4J9QA 1Q86T 1CPZA 4J83A 5J2PA 4DZ6A 2YT6A 4M77G 1YITT 4YR2A 1RYSA 3RAXA 1NK7A 2R7OA 2DR9A 3LALA 3BGRB 4QQ6A 4MMKA 4WF9Q 3W60A 1R27B 4ZP9A 4F7UE 2EWHA 4F4KA 4RTYA 2FL7A 1HWLA 3HD1A 1OPKA 2IMOA 4AQYF 3NTKA 1MUZA 3PE0A 2VXEA 2KT1A 1OU8A 5C0MA 2HMAA 2JEJA 2ADBA 3CMAA 1PSEA 3KNGA 1LW0A 4PWWA 4Q0BB 3DU5A 2VYTA 4YHHJ 4CLFA 2DISA 4R55A 2AEJA 3PJWA 2DXTA 4M75E 1HWJA 2YPZA 5DM6Q 2VBXA 3X20B 2ZWPA 1RABB 1MN7A 3MEKA 2BJ7A 3QXEB 1BY9A 2HHVA 1M90C 3REBB 1RI7A 3ILJA 4LSNB 1K9MU 5L38A 5FDLA 4K4VA 5BYQA 2JUFA 1BB9A 3OA6A 1NDKA 5ETVA 3J7A1 4DR2F 1Q86R 2VWFA 1VQ8A 4C3LA 4KT0C 2N3OA 3SI8A 2DIUA 4WWSA 1RWPB 4ED4A 1RU2A 4YQWA 3GIMA 1FA0A 4DV5J 3DB3A 3I96A 2G9OA 4QWEA 2HQHA 1UG1A 3RESA 3O8VA 4URSA 3M9QA 2ZPIB 1TL3B 4K8RA 4DBQA 3LAMA 1JXEA 1CLFA 1HJDA 2DF6A 3K7RA 2ZFHA 1UAWA 2FLNA 4K7QA 2I6WA 4V2SA 2RHXA 2F3JA 1YJRA 4W90B 4M77E 3V6HA 4NI2A 3KTQA 2DJQA 4ZPDA 1M3BA 2DJWA 2RB7A 1YKWA 2KRBA 5I3PA 2CQ1A 4HI2A 5ETKA 4NLPA 2AZSA 1I1GA 4A4EA 2OPSA 3Q2TC 4JYAF 3BPSP 2JDJA 2XI3A 5KFDA 4Z7CA 2MEWA 3IFEA 3NOCA 5GMEA 2ED0A 3M7VA 3TZXA 4KKOA 1JXVA 3OS1A 2FIUA 3A8OB 2ENMA 2B8QA 1TUCA 3TJAA 4PNOA 4M7DG <