2ATCB

Crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
152
structure length
152
Chain Sequence
MTHNDKLQVAEIKRGTVINHIPAEIGFKLLSLFKLTETQDRITIGLNLPSGEMGRKDLIKIENTFLSEDEVDELALYAPQATVNRINDYEVVGKSRPSLPERNIDVLVCPDSNCISHAEPVSSSFAVRRADDIALKCKYCEKEFSHNVVLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and molecular structures of native and CTP-liganded aspartate carbamoyltransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (carbamoyl-p,aspartate)
molecule keywords ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
total genus 6
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1982-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2atcB02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2atcB01
1RACB 4WTOB 2AIRB 4FYWB 4E2FB 4KH1B 1F1BB 4FYYB 3MPUB 3D7SB 1D09B 1RAGB 1RABB 1TUGB 1RADB 1ZA2B 1ZA1B 1AT1B 2FZGB 1Q95G 1TU0B 4KH0B 4KGXB 1RAEB 2AT1B 2ATCB 6AT1B 3AT1B 7AT1B 2QG9B 1R0CB 1TTHB 2YWWA 1EZZB 1R0BG 1XJWB 1PG5B 2IPOB 1RAAB 1RAIB 4F04B 4FYXB 2BE9B 4AMCA 1I5OB 1RAHB 1SKUB 2QGFB 9ATCB 2A0FB 4KGZB 8ATCB 1RAFB 4KGVB 2FZCB 4FYVB 1NBEB 4AT1B 2BE7D 2FZKB 8AT1B 2H3EB 5AT1B 1ACMB 2HSEB
chains in the Genus database with same CATH superfamily
1WX6A 1EFNA 2OPSA 4TYBA 1S57A 1EARA 3AOBA 3H25A 1ZTWA 4FVMA 2B8AA 4MKVA 2MZJA 2HS4A 5DGAA 4MKAA 1IBLJ 4O3SA 1YWPA 1ZAVA 2J6KA 4IG0B 1SH3A 2DMOA 1VJWA 1PSFA 3SQGB 1Z2ZA 2O9SA 3CPFA 2Y4YA 4DR5F 1QVFP 5IH2A 3G71S 3OVBA 1TXQA 1X0PA 4LQ9A 3VQTA 2LT4A 4HT5A 1N34F 4EEYA 2R58A 1P92A 2EYYA 5LM7E 1F5BA 4WIIA 5IHKA 3M0PA 3A13A 2XTJP 5E3AA 2MIOA 1H3DA 2FJDB 4PEOA 2GFUA 4ZVEA 4WU2A 4FT2A 4M78C 2BBEA 1EAYC 3HVAA 2RD1A 1JJHA 1HKAA 2YQ3A 1GK8A 2H4WB 4AFUC 3MCMA 4NLGA 1KQ2A 2DE0X 4J7IA 4R8UB 5IHIA 2DNKA 4ZVUB 1YFNA 3LW5C 1C1CA 2BM1A 4WFNQ 2X1AA 2VKZG 3WBZA 4OYPA 1YZ7A 4WFBQ 4F4KA 3NCQA 1CC7A 2ZWOA 5F8JA 4P2SA 5H9FJ 2PE8A 4J5YA 1JJ2P 4ZP7A 1FO1A 2MYFA 1X69A 4ZGEB 3K8WA 2W7OA 1U3OA 1OY8A 4QZVB 5I42B 5HMXA 2V63A 1FRMA 3DCAA 3KHHA 5IM0A 1FI4A 1U5SA 3R1LA 4K8RA 3B6BA 3B82A 2PI5A 3U1MA 3KG4A 4C8QC 5HKCA 4DX7A 2K3XA 1NE8A 4F4ZA 1MW7A 1NEGA 2RHYA 5IAYA 3QO9B 3US5A 5L46A 2RJFA 3I55S 1HBOB 3PYGA 4FKYA 4WK3A 2YSQA 5GJVB 3TARA 4YP3A 1S5ZA 2E7XA 2LZ6B 2AT1B 3ILOA 3SIPB 3MM6A 4JI7J 3BDLA 1RT1B 3TX0A 2UUTA 3DXBA 4NZ0A 1RAJA 1MMDA 2QL5B 3PVQA 4HHUA 2LCLA 2P0PA 1ROFA 4VUBA 1HARA 1NH8A 1IB8A 4G65A 4AFFA 3Q86A 4JI1J 3PW5A 5GAMd 3W5XA 3BN7A 2K3KA 1WXBA 3HHEA 3FSYA 2PNIA 3M8QB 4PG4A 4LREA 4IRDA 2A3LA 4P7VA 4HVVA 3M30A 4IOCQ 4LF6F 2GMLA 4B9WA 4RUCA 3FSXA 3WQPA 2J5AA 2HVIA 4DV3F 3ZZUA 2RF2A 4J9SA 2EGEA 2E6ZA 3EFSA 4DV6J 3AY0A 4TVAB 2KTQA 3CO9A 3UDVA 3VAKA 3MUTP 4J8OA 4ICLB 1F1BB 4RNMA 1P9YA 4ELZC 4N4GA 1ZAWA 4JYAJ 2VWFA 3CCVT 1NDPA 1W6XA 1HK9A 2SRCA 3AD8C 3SFGA 1YVFA 4J9LA 3QZ7A 1NYGA 4E8UA 1JJ2S 3VALA 4G6VB 4WWSA 4DV2F 2R7XA 4Y2KA 4M7AD 5C25A 1KNZA 1IREB 2CG4A 1K8AC 2FZGB 1HI1A 1SL0A 4EZ6A 4P2XA 1FCAA 2KDSA 3OSSC 3DM2A 2OFGX 3BM7A 5KT6A 2W2QP 4PXEA 4OP0A 3M4YA 3TJAA 2W2MP 2MQQA 3IXQA 5BXIA 4GVBA 4OJGA 1JLEB 5T41A 1WC5A 4BI4A 2EI5A 3CEDA 3Q22A 3T19A 1UJ6A 1QQJA 5LMNF 5FLXY 2X7IA 3QJ6A 4ALZA 2DGVA 4DI6A 1HPZB 1W2BR 1E6HA 3BKFA 1ZHIA 3IS9A 2EPIA 1NEBA 2W4PA 2J6FA 3R1HA 2WSFE 2NXUA 3PR5B 3CCRA 2CSQA 2V68A 2MDAA 3AXKA 2JNJA 3GPAA 2LMJA 2BM0A 3ONQA 1N33J 5GJWB 1SUQB 4DOWA 4PABA 2EJFA 2A2CA 1BQXA 1IXKA 2DIGA 5CQXA 2QA4A 4UZCA 4RW8A 1NZAA 3M9MB 3UNYA 5KYYA 4PG7A 5ETPA 5E7OB 2KO1A 4PFZA 2L9DA 4XIUA 5KFFA 1VQ7S 4F14A 2DM1A 5DM6Q 1V9OA 4UOGA 2WW8A 3MM8B 1XN9A 3QZ9B 3UO0A 3TAMB 1RAHB 1RWXB 2AZVA 1KQKA 3IM9A 4XTTA 2OHDA 3DI6A 1J5OA 2OO4A 3ETMA 4A8WA 3LW5E 1WC3A 2NYIA 4TLRA 1UUEA 2BUNA 3SD4A 4USUA 2WVDA 3QDRB 4GKKF 1YJUA 3VF0B 6FD1A 1F9FA 3G1JA 3MPWA 3UWTA 3K57A 3LGLA 1F3FA 3OVAA 1LEOA 1LWEB 3GR1A 2HNYB 4F67A 3SCKE 2JRSA 2QO3A 3CCZA 2R8GA 3GJQB 2J6TA 4EPCA 1TG0A 4CM0A 4ZDNA 2VFUA 2R42A 2CP2A 3QYYA 1YJNT 1H73A 5K5MA 5KFQA 1OMSA 3KWMA 3I56T 1Y9OA 2DNZA 4NXNJ 4I56A 2VDIA 1UDLA 2NQPA 1S1NA 1OQ6A 1DLOA 1IQTA 2X1FA 4TY8A 1F3VA 3C2PA 3UNGC 2DA9A 4CO2A 2UXBJ 4H4MB 1TVRB 4UUWA 3A8JA 2FPFA 3PNIA 1YITA 3IO1A 5ETRA 2RI5A 2BZXA 3NGRA 4OI3A 2C22A 1S9FA 5KFBA 1PKUA 1VQKT 5GANd 4LQ3A 2J8AA 4WCIA 2CQ4A 1WTBA 1SVDA 3VR1A 3S8SA 3JSYA 4WTYA 3HSZA 3H5UA 4LT6A 3PW4A 1IWAA 4J6XA 1QJHA 4WXOA 4NXNF 4QCLA 1R43A 2P5VA 5A2QY 3UN3A 4M7AB 1KHCA 2DT9A 2AEMA 4KFBB 2AF6A 4GVLA 3G7ZA 4X9DA 2OP5A 3TSWA 2MLYA 3MPVA 2LEBA 4M77G 4ZHRB 2YTCA 1P8GA 3QO9A 4JI5J 5HVGA 1Q86T 2CT4A 3CO0P 2EWHA 4NOYA 3JSMB 4ZVRB 3I82A 2DY9A 5HMZA 4M5JA 2DD5A 3F44A 4FKXA 2L3PA 4X66J 2ROEA 5C2CA 2OJ3A 2J06A 2F4VJ 2DNQA 3MCNA 2E1HA 2Y9HA 4K4SA 3D1HA 2I0NA 2KU7A 4LD9K 3KTQA 1RAAB 3P8BB 4K4TA 1WHLA 4GRSA 4LFAF 4IR9A 3LH2S 4FW1A 1PYSB 5GMDA 2XZTB 2I2LA 3BSCA 4LBIA 1NJIR 4EWTA 4JI0J 3OXLA 4C8QD 1B3TA 2OTLQ 2XMKA 2Z0GA 4ZVTB 2IIMA 4QPTA 4F02A 4OYOA 1V3ZA 2EGCA 1PCAA 1AFJA 4DBQA 3CDBA 2XQCA 2E4HA 4DSIA 2IPOB 4EMKB 1SH0A 1G4CA 1S1UB 4X34A 2BE9B 1WFWA 4M7DB 2OTJT 1GCQC 4N5SA 3CMAT 1QTMA 2DGUA 2AMCB 3ZNUA 5KT3A 1T9WA 4ID5B 2E44A 2DH9A 1QD1A 1H3ZA 2UUAJ 3X26B 5LL6d 2E5HA 2H48B 4WK1A 2HQIA 1RAFB 3CJ4A 3DOMA 1S6QA 5F9LA 3RUXA 3CBOA 2LDMA 4V19X 3JSRA 2M2BA 2QLJB 3PTWA 2DEIA 3MMBB 3CC7T 2X4YA 3X3UA 4Q8FA 2XLIA 4O44A 4USVA 1FWZA 3Q2SC 2ZM6J 3N28A 2IM1A 4N4HA 1NNDA 3NGKA 4XTXA 1N8RC 3CCEQ 1JIHA 2HG4A 5GMKa 4M78D 4FPIA 3SZ2A 2PQWA 3EPIA 4M75F 4RCCA 2HNZB 2E1AA 1NJIU 4J9GA 4DFMA 4DV3J 1U1QA 1HMVB 1FRHA 1L3SA 3DGPA 2GC8A 2QYGA 2XYGB 1RAOA 4TU9A 2WSCC 1N32J 2FVUA 1PAEX 4WIQA 4J9OA 5K8MA 4NRTA 4LF5F 3ZTPA 2UXCJ 4M77C 2WZ1A 1X43A 3I32A 2ZE2B 5RUBA 4YOEA 1XJWB 1BHNA 2JTMA 2KT5A 2R9LA 1AB8A 3NTKA 4I2PB 4DA4A 4IFYB 3ENAA 4CLPA 1JKHA 1BQNA 3M58A 5HAOA 4JJBA 1VQ8T 3ENVA 4GKJJ 2PTKA 4M5DA 3TUJC 5J26A 5J2MB 5DY9A 2RQVA 1PJ6A 4PK4A 2A37A 1ZX6A 1IR0A 3OQ2A 3FFIB 2BX6A 2HZAA 4DZ6A 2XNQA 1QMCA 1K9MR 2LECA 3CPWP 2VU5A 1WEZA 2B6AB 4QQDA 3G71A 2CQGA 5LSOA 1SJ1A 1CJTA 2CNLB 4U67Q 3UDLA 4C6AA 1VQ8A 4YS2A 4HTIA 3MCOA 3D6TB 2DL7A 1F9HA 5DDOC 2EVRA 2E9TA 1JRIA 2YX7A 3KUHA 2RU9A 4FXVA 1HSQA 3E2UA 5B0GA 3M0RA 5CVIA 1E6YB 1WOPA 4KR0B 2YKQA 3HPWA 1J5OB 1SRMA 4EO8A 4NL2A 1U8SA 1OPIA 2I2YA 1YWXA 4N8OA 5IWAF 1MV0B 3OYFA 3G4SQ 1WTFA 3VS4A 1UP1A 1JLCA 1FX2A 1NLPC 2G3RA 3EJMA 1CJKB 3NMZC 5FLXE 4KGVB 4FYVB 8AT1B 1HWKA 2HFNA 2DR7A 3M2UB 1B64A 2CH4A 3CXCA 1Q95G 4PYDA 1YHQA 2EKOA 2C0TA 3M32B 4N4IA 5DQIA 4RTUA 3P5BP 1DQ9A 4M78G 1W7WA 5C42B 3A8KA 3KHGA 3EFOB 3I5CA 1PD0A 3JTPA 3CCQQ 4WE1A 2QQ9A 4OX8A 1W25A 2XEXA 2B4UA 1SEMA 4PNOA 3HD2A 3M9NB 3SWNC 2WONB 3U1LA 4XTZA 1NZ8A 1Q5YA 2ZC4A 4OYMA 1VQOT 3FFIA 2CP0A 5KT7A 1YCSB 3NNCA 3N0VA 4L73A 3T5HA 5KFJA 5AXMA 1TTHB 1K9MT 3M59A 1TFYA 2QEXT 3DGVA 3GV8B 1HI8A 2F4VF 1PRMC 3TWZA 1JLBA 3IGVA 3CCQS 2CJ9A 4XTVA 4PFOA 3MCAB 1VQNS 1BGXT 1WF2A 2G0IA 3KJFB 3KJNB 4JI5F 3CNQP 3G6XA 2M52A 2PGCA 1U6BA 1TFWA 2CNKB 3P8HA 1OZ2A 4A8KA 1VFJA 2BOAA 3FC3A 4CLFA 1UG1A 5AJ3J 4ZNXA 4MMKA 1GX5A 4NLVA 1JEGA 2OEKA 5ADZA 4N7TA 4A54A 7FDRA 1RWMB 4LFBJ 2MMPA 5KFNA 4L6V3 4Z02A 2OFHX 1CQMA 1VQOQ 3F41A 4FF4A 2EJGA 3UVJA 3TP2A 2ROGA 5IT0A 4EYIB 1FNOA 3MP8A 1WDDA 3U7JA 4E7LA 1MN9A 2MQ8A 1O5JA 1D1UA 4OZ2A 2DL3A 1RTHA 1D9FA 2SXLA 3JCMP 2LQJA 3ITHB 2L5QA 2IFXA 1FJ7A 1JJ2A 3HHDA 3BH6B 3NTHA 2RS8A 2RB6A 4LRAA 1U24A 3OSVA 5KFAA 2BJDA 3H98A 2CXEA 3SDEB 3KXDA 2YNGB 1XNIA 4ELUA 4NMXA 5GAOp 1IZ6A 1M5OC 4Z88A 2VG6B 5GAN8 2C3MA 1RT3B 4OB2B 2O01E 2XS7A 2VXEA 5A8WA 3C0CA 4MYUA 1HQ2A 4EDUA 1VQMQ 1K1SA 3MMCB 4XO0A 3LP2A 1B7YB 2AYGA 2OPSB 1VQ9Q 1HW9A 2EWNA 3W8PA 4FF2A 3MM9A 1ZAXA 3UR0A 1QP3A 3EGXA 4URQU 3G4SA 4CC2A 3SFUA 4NCGB 2HFVA 3DOKB 4FNIA 1XC9A 1D0EA 2DD8S 4ZN3A 1WHJA 1X7VA 2MQMA 1LW2B 4DXLA 4NYPA 3EVOA 4C4WA 2M0GB 2Y0BB 4IURA 4RTZA 3N6NA 4QVDA 4LRCA 3ZC4A 3H7HB 4KBMB 3VS0A 1VQ7A 1UHCA 3NFCA 1MMLA 2DHXA 1IBCB 2E3HA 3CCST 2KVIA 2DXCA 3FNNA 4MYTA 3THVA 1Y3JA 2X3WD 2EQKA 4IO9Q 1I0CA 3LWIA 3WVDB 1JKHB 2VFVA 4C8LA 1KFDA 1ZSZC 1S0NA 4JRPA 5J39A 1C1CB 1LW0A 3GZ7A 3HFOA 2WCXA 4C0DB 4W90B 2RKIA 1MN7A 4DV7F 1L5UA 1Q16B 2JOYA 4LSZB 2BANB 1H2VZ 3G6ES 3JB9I 2OPRB 2NSBA 4OMNA 2RT3A 4QVCA 3CCSA 2DISA 4M5KA 2D0NA 3OS2A 1Q81U 3NGTA 3TI0A 3R7BB 1TAUA 1XR5A 1QVGS 5LJ5f 3OR1B 5LL6S 4PWWA 2FYXA 1NJWA 4KHPJ 1TKZA 3I0SB 3THKA 3ISZA 5GMKm 2LA4A 1U1SA 4C0GA 2AIRB 3PYDA 4EBEA 5L8RE 3IA0A 3P5TL 1N33F 1Q79A 2DGTA 2MY8A 2YH0A 5KFMA 1Z9ZA 1WKLA 2O2OA 4DEZA 1C0UB 1HNVA 4FDFA 1RT6A 4CC7A 4CC4B 3VAMA 3OVSA 3FCVA 2GAHC 2LQ9A 1R8HA 4B02A 4DSEA 2DGWA 2XYHB 1XR6A 2UUBJ 2AKLA 3KMQA 2HAXA 1FKAF 4F0HA 4USKA 1UFFA 3VS7A 2HNYA 5D6XA 1TKXA 3JB9F 2RM4A 4YHHJ 2D0QB 3BGOP 1YP5A 3OUYA 2CP7A 2A6MA 4IFVA 2F2XA 3TZYA 2PEBA 2P2CB 1GXLA 2IA0A 3AJ1A 1S4EA 1IR1A 3VGTA 4IUPA 4J9DA 1QE1B 2F5KA 3MR7A 1G2EA 1JXVA 2B7CB 3VHQA 5HROA 3H41A 2E3IA 3L3CA 4XAKA 3T5KA 1JXLA 5J2NA 3A12A 1M5VC 5CKEA 2D41A 4UT4A 2XY5A 3QIPB 4PJJA 2KM8C 4ZVOB 1FDDA 3MEKA 2Q6BA 2IM2A 1F9EB 5H9EJ 1NCLA 2L3QA 1UEBA 4QPXA 4MK9A 2KXCA 3FRNA 5GANg 4GVBB 5DLGA 3RYLA 1N52B 4HCZA 3KDOA 5CYMA 2DJWA 4EBCA 2RUSA 3K59A 1IKXA 4OX9J 3L9ZA 1KSPA 4KE5A 4A53A 2ZVIA 3QUIA 2XM3A 4AL7A 1URRA 4WFZA 2XDPA 4DV1F 1MUZA 3FEYB 5F8MA 5DZ6A 4M77D 2C2KB 4V19J 2QFJA 3TQ7P 3BREA 2ZHAA 4DDFA 1UPPA 2FTRA 3HFKA 3TNVA 3R5JB 5C6SA 3RR6A 4USJC 1Q82R 1SQGA 1PG5B 2MMYA 1S7IA 4ZCKA 4ZHRA 3VZHA 2YWKA 2KT2A 2ZBQA 4PG6A 3WIUA 5GAGI 1CS4A 4DS4A 2XSJB 3KKFA 3CJ0A 2LFVA 3VWSA 3QSYB 3EG9B 1SUQA 2RVJA 3RU0A 3TEGA 2Q66A 2GMHA 2M9KA 3OYBA 2J0SD 1PRLC 1C1BA 1UPMB 1VA7A 1FRKA 1T3OA 3EGDB 2Y3YA 2V4JB 1HNZJ 5GMKl 1M1FA 2GAGC 2KXHA 4I64A 1QAIA 4BBYA 2CUYA 2MHEA 1W2BA 3R27A 3RW6A 1FVSA 3LP0A 4OYZA 1MROB 4P73A 3TAPA 4PXDA 1IN0A 1Y11A 3D1OA 2R2SA 2GIFA 5KFXA 3DKDA 1WUUA 3A1PA 3KMSA 2L3MA 1RADB 1SC6A 3MTKA 1TL5A 3EE3A 4Q2MA 4KQZA 3KK2B 2CRLA 2B4VA 1UW4A 4ZCLA 3M2RB 1S6OA 2C2DA 1K1QA 4LUEA 3QWYA 1ZM4A 1UEUA 1RTJA 5LJ3j 1GMVA 3QRQA 2V8VA 2PN6A 4MK8A 2HFSA 2HBQB 2ZZNA 3JCMQ 2D9TA 4M77B 4ECVA 1FDBA 1WSVA 3I55Q 1DURA 1FKOB 1UVIA 3BDPA 2DRMA 1TL7B 2QMWA 3O6QA 1UA0A 4K7QA 5CH7B 5KFYA 3S3MA 4F4AA 3CJ5A 5BR8F 1IRXA 3M2VA 2COZA 2I38A 1VQ4A 4F16A 1KQSS 3D9BA 2QI2A 2DNNA 3OHAA 2HBPA 1HNIB 3N5BB 4QIWD 3CMES 4EMGA 5L1KA 1YSJA 4J90A 1VQ9S 1NSPA 2LNVA 3CC4A 3MM5B 1N36F 3W9IA 2OI2A 4EI2A 1M1GA 3GG0A 1JXEA 4FT4A 2HMAA 1Y71A 3T9ZA 2L48A 4L3KA 3CJTA 3GB0A 4Y0FA 5BYQA 1R89A 2QXFA 3OXFA 4M75C 4CWBA 4TY9A 2CQ3A 2B8PA 4OI2A 4ZVPB 3W2VB 3MO8A 1VQPQ 4EO6A 1RA7A 3ET6A 5DGBA 4F2RA 3ZZZA 4YB7A 1S9EA 1GTHA 1S1UA 4JI0F 1O51A 1I3OB 1SIZA 1WHMA 1VQLA 1UGSB 1X8DA 5GAN3 5I3QA 4YDXA 2OPRA 5HQMA 2K4YA 2N4DA 1RTJB 1YIJQ 3CXCS 4ED8A 2KDOA 2DILA 1VQ7Q 3BJYA 4BD3A 2CQCA 1U7LA 4HHHA 3VRYA 1RXOB 3WC0A 4ELYC 4OZ5A 4K0KJ 4KV8A 2PIIA 3SSRA 2PA3A 4OI1A 4DSLA 4IRKA 1K76A 2LJ1A 2E5GA 2XDDA 2VDHA 3C6UB 2D74B 2B86A 3GIKA 2Q6CA 1F5CA 2BQUA 4NCBA 1RZMA 1VBKA 1M1HA 3J7ZT 5E33A 2OUGA 2FC8A 2F8EX 4QVZA 3NEKA 2GVZA 2WACA 2VODA 3CB4A 1UA1A 4HH1A 4C0BA 3MTJA 5LT5A 5F0WA 1K47A 2V2QA 1T05A 3GIRA 1X9WA 3V2UC 4WBFA 4ZGDB 1PJ5A 1X5SA 2FQQB 1GMWD 2XBPA 3IGNA 2FJAB 1FF2A 2P6SA 3ZTOA 2AGQA 1DFDA 3V6HA 4O0IA 1U0HA 1QVFS 1CKAA 3CCMS 4I2QA 1UGVA 2RNEA 4RW4B 2DNYA 3BBCA 3EYZA 2GFAA 5F3TA 4LF4J 4YUDA 3W62A 1VQ6Q 1V29B 3GQCA 2LX9A 4L3NA 2A08A 2KR3A 1Q7YR 2RE1A 5IWAJ 1RLQC 2K8GA 4DQQA 3RMSA 1WHXA 4USMA 4MDXA 2H4YB 5HO4A 2DK3A 2BE2A 3CD5A 1N5QA 1SKWA 4IG0A 3QIPA 5CQYA 4G1QB 3KJQB 3IG1A 2D9OA 3SQGA 5A6WA 3HI9A 3TX8A 5KCHA 1CKBA 1BI0A 3W1YC 3C15B 2LU2A 4PWUA 5GAMh 3S3NA 1R0BG 4YQWA 2OTLT 3H0PA 3TUZC 1ZZNA 1XEZA 4DCJB 1W4SA 1I1JA 1WNEA 4TYAA 3WXMB 4DV5F 4ZPTR 1RJJA 1MHNA 1XTZA 3GJRB 2G2YA 3A8EA 2AHJB 3CCTA 4IH7A 1T11A 2XMTA 2PVGB 3CCVS 3DDKA 1TU0B 3MAAB 3CCLA 3CWJA 4BCAA 4Y2AA 3G9CA 3MURP 5SUHA 3Q83A 2K79A 2VONA 4I2PA 1NYFA 2WSEE 4LVNP 4NOHA 4JJNK 4IFYA 4F7UG 3G2XA 1ABQA 1SRLA 4L59A 8RUCA 2R7OA 1H7XA 2V6AA 5BR8J 2G6FX 1AVZC 2ZBIA 2FJVA 2RD5C 2YLCA 5KFSA 3VCDA 4GKJF 1TUVA 4JJCA 3L2ZA 4E0DA 3BKUA 2RPNA 3EX7B 2O66A 1KD1T 3AOAA 2MGZA 3EAEA 3VYGA 1G2BA 2L89A 4KUIA 1YKWA 2AV5A 5B0CA 4NASA 4RNOA 3HX9A 3AB2B 1C0TB 2QGGA 3EM1A 3OBIA 3TEHB 1RAIB 3ITHA 5LXRA 2B56A 5KG7A 1TV6A 4JI4F 3SBMA 2JL9A 4USTA 5KYWA 2L08A 2ZHOA 1Q82C 1K0SA 1HNWF 3PJ9A 4BC7A 5CCLA 2XCPA 2KK4A 1BIBA 4BDPA 3TSZA 3ZEHA 3MUVP 2BV3A 2DGOA 4HHJA 1N5YA 3N79A 1U09A 3DFEA 1HBOA 1JLAA 4C92B 1OOTA 3M6UA 3BGFA 1RHKB 2L9NA 2VPXB 2E1CA 2AX1A 3M55A 3I6PA 3JQJA 2ZM6F 1M5Q1 1S99A 1KQSR 3C15A 2DNLA 2E5IA 1SG5A 3IC1A 2ZJRQ 2QLFB 2R7QA 2UXCF 2ALZA 2CQDA 4USIA 2KAFA 2G4BA 1DBDA 1F6TA 4J9FA 4LD6A 2YRCA 3P4UB 1NK7A 7AT1B 1HHQA 4HDHA 4B9SA 3DDIA 3J7Z5 1IKYA 1BC6A 1YJ7A 2DIVA 3G82B 4QIVA 3HHLC 1U49A 1K9MU 3HKZD 3G6EQ 2K7KA 4F8RA 1C1AA 4RW7B 3EFOA 2DY1A 3CMAS 5IXFA 2WW4A 3HSBA 5A0YA 3BO4A 1AUSL 4Y34A 4WE1B 5IN1A 4I6YA 3PIPQ 2B8QA 3J81Y 2J7WA 2RJZA 3NXZA 2QMXA 1RYRA 2BE7D 1JLEA 3VGUA 3FKBA 1FXLA 3G6EA 1YJWQ 3IQLA 1M90U 2UUBF 2M4MA 1WA7A 4OGCA 4ECTA 3THPA 3M32A 2DYAA 3CCSS 2EVZA 2LP5A 2E5JA 2DBMA 2CQ1A 4YR2A 3M53A 3KFWX 3LWHA 3WIVA 2X1GA 4NA1A 4MJKA 4HDGA 1VQ9T 1OYDA 1JLBB 3D2WA 3CGIA 1FHTA 2JJ4D 4DS5A 4XU1A 3HL8A 2QLXA 2CGHA 1G8XA 3D0IE 2U2FA 2KRSA 2YKNB 4M63A 2HKQB 3X25B 2BJ1A 1S1WA 3DLGA 2ILYA 4QR2A 2GCXA 2HVZA 4IO1A 1VQ4T 3GCWP 3WDOA 1TUDA 3PKMA 3ZZRA 2HVEA 2XYPB 4MMOA 1AFIA 2P84A 3A1YG 2WRMA 2XDBA 2CNOB 4J9PA 4B3OB 2OELA 2XO6A 2IDLA 1UCNA 3EMTA 2JS0A 2HQGA 3EZUA 5A0DA 4B6MA 1IBLF 1ZLMA 1EQMA 1YJTA 3BPDA 5GAN6 2RMOA 2QA4Q 2W4CA 1FXRA 4FVCA 3NAHA 4Y28C 3C16B 3J7A1 2G2ZA 3CCUS 4PLIA 3HCXA 5K14B 5THWA 2QEXQ 2CJYB 4PUOA 2G1HA 1U45A 3AJ2A 2RDDA 1N34J 2OAWA 2VXFA 3AAWB 4CH0S 2JLFA 5ITHA 2RQCA 3MPDA 5IOLA 4RNFA 3KNAA 2BVZA 4KRWA 1FRXA 2LEPA 2HZVA 1H72C 2C1EB 1TL4A 4NL3A 3QGIA 3AT1B 1XERA 2HWTA 2UUAF 2D8JA 4CH7A 1ZSZA 1B70B 1DQ8A 2WK4A 2AYMA 3OW2R 2JT4A 4CTAB 3MEEA 2YNGA 4Z89A 4ESRA 4KGMA 5CO7A 4JV5F 4JRIA 1IXDA 3JB9D 1JNZB 5HK3A 1T0JA 2F2VA 5HROB 1JMTA 2ZH9A 1QLYA 2FPEA 4MAKA 1WPYA 3M8WA 3CD6Q 1PBAA 4ED0A 2L9WA 1MG7A 1NK9A 3OS1A 4UQGA 2AJ0A 2HHXA 2MK5A 2UXBF 1O75A 1NSKL 1K73C 1RWUA 2LMIA 3WZ0A 2PFDA 4QW8A 4MKBA 1NJIT 1NDCA 2I1RA 5H1SV 3A8GB 2LQBA 3CUNA 3VUZA 4DUZF 2W8LA 2C2ZB 2BDPA 3H9NA 4JS5A 4F7VA 5DDPC 3D1QA 1NH7A 3UD5A 4OMFB 4LRFA 4OI6A 1TZ0A 1KVKA 1VQ8Q 1IWGA 4X1VA 2F63A 2I8EA 1YGYA 5C7PA 4HI1A 2MOXA 2CJBA 2CQ2A 2WB4A 2G0JA 2BZ2A 1NK5A 2HCKA 4URGA 1NBEB 2YNFB 2FVRA 2OLWA 4PJMA 3TQEA 4DUZJ 1JQQA 1S4FA 2OAUA 4M75D 4QWEA 3GJTB 5IXBA 2KB2A 3I56A 5BYSA 2LA6A 4P6QA 3QAEA 1VQMA 3V5RA 3TUIC 3CPWA 2I9SA 1NJYA 3JSMA 4QWBA 1HI0P 4JBCA 3UCGA 1S49A 3CD7A 3KLGA 1S1XA 1FYNA 2XMAA 4AD6A 3BH7B 2ASDA 4WKRA 4OYIA 2OTJQ 2P6TA 1VQLQ 3Q8VA 4OB1B 5G0RA 3GFHA 1YRXA 2JH3A 4OZ1A 2B9WA 2I5JA 1OZ3A 4HCCA 2W7AA 2VL1A 2LVWA 4K0KF 1WLPB 1EIFA 4RW9A 2XGPA 2CH4W 5D4PA 1HWUA 1TK8A 2VJVA 2R7VA 2B51A 3ISND 1HWIA 4F36A 2JFKA 2KRMA 3OR2A 2E9RX 1L3KA 2VPZB 1FJCA 3PX4A 2JZ5A 5KCOA 2MQNA 2RKIB 1XQHA 4K50A 1T3LA 4M7DG 4D8DA 1HQUA 2QIFA 2MZSA 1N36J 3FSIA 1QLNA 1GCQA 1M1KC 4WZQA 1YIJS 1SL1A 3HULA 2UP1A 3LOUA 3AB4B 2K1RB 2DIQA 1KC8T 4JYAF 5LJ5e 4Y2CA 1QCOA 4J7CA 2ZPFB 4Q7AA 3OW2P 4CM2A 4X4UA 4TQRA 3W5ZA 4Y00A 3MOJB 4BC9A 3MECB 3CD6S 1WHKA 2W9CB 2MQLA 5EWGA 2RQRA 3O3LA 2FZCB 2B7BB 2R8HA 2ZZDA 3GYNA 2Y1LB 4A47A 1REVA 3N5BA 4LDUA 1OPZA 3IAM9 3ULHA 2MAMA 2MSSA 1S97A 1XBWA 3DRPA 3BR8A 1R6VA 4RNHA 1SC3B 4ITSA 3BFMA 2BA9A 3ENWA 2ZH2A 1K8AR 2YUOA 3P6YC 4KHRA 3ER0A 4GKKJ 4CO0A 1VYVA 2BZYA 1P1TA 4NLSA 1QAJA 4AG1C 3FMWA 4ANJA 1U26A 2ZE2A 3HHLD 2R2UA 2N7YA 4NLPA 2JTEA 2WOMA 1NEEA 3HHKA 1NK0A 3J81j 4LF9F 1IKWA 2ZJPQ 3MEGB 5LJ5j 1PYTA 4ME7A 4L74A 5KE2A 2FIUA 4ZMMA 5C2GA 5IM0B 1KRPA 1PYOB 1FKPA 1R8BA 3TVKA 1OX9A 4O6JA 4P72A 4Y6IA 1QVGR 4LF5J 1CEZA 3CJ2A 2JTFA 4C8QF 2AKWB 4J91A 3ZL7C 3GFYA 1RI9A 3OLBA 2GNCA 3TJ8A 2H3JA 3MAQA 1S9EB 1QM9A 2X9HA 2XG8A 3J7YI 1Q1KA 1JJ4A 2NXNA 4JI3J 2G2OA 3CDUA 2W9AA 1Q8LA 2C2NA 1NU4A 5C0MA 3HRUA 3MUMP 4K4XA 4DL6A 2KN4A 2RJEA 1TL1A 3FCWA 2XS2A 4ES2A 5GAOn 2K1RA 4CYUB 1AA1B 1X01A 1QVFA 1FJGF 3RW7A 2QL9B 4ED5A 2RRBA 2XICA 4KH0B 2RQUA 3A3PB 3ASKA 2Y8WA 3M0UA 1FE0A 3OPKA 1Q81C 2Z8QA 2ZD1B 4R25A 4M77A 1VQKS 1PIEA 1H38A 2MPUA 4OV1A 3IRXB 3OJUA 2CPHA 3MOZA 2WSEC 5HVFA 1V5IB 2XULA 1RTIB 3X20B 2AZSA 1Q5VA 3KK2A 1H641 5IC4B 2CQHA 3Q89A 1S0MA 4LSLA 3VTIA 3L2UA 2V4JA 2AP6A 2WONA 3CJ8A 2HHHF 2ZZTA 1WQWA 2RF0A 3JAMU 2OKQA 1RAGB 1I8FA 1SPBP 3CCVA 1TMMA 3QQCD 3FLGA 2RI3A 2HHPA 4X62J 1UVKA 2ZBRA 3CJRA 3VJPA 3H0IA 4TLQA 3SXLA 2ZOFA 2XZWA 4XPEA 2Z56B 2R8KA 4ZS6A 1QDUB 1RBLA 1U0SA 1K0VA 3Q2TC 3JRZA 4YFUA 4DBFA 1FD2A 4OMQA 4JV1A 5IV4A 4FM4B 3S6EA 4X64J 2E5QA 4R0JA 1BY9A 4JPBW 4II1A 1BU1A 4LDYA 3MF5A 2WSCE 2GJ2A 1R77A 1Y7XA 1TUGB 2DO0A 2ED1A 3NG8A 2C0IA 5CR2A 1EB0A 4OZ0A 4AFQC 2MJNA 5FRNA 3BZQA 3CCUT 3CJSA 4TNOA 2E5KA 3M4GA 3MM5A 4RR5A 4DCOB 2EW3A 3CCJS 3NKYA 5D4OA 2IVFB 1YN8A 2OSRA 5KFWA 2VQEF 1KJWA 1MMGA 3MR2A 3R7NB 2LKZA 2JWNA 2BIVA 1OV3A 1FK9B 3ILJA 4G1IA 2DK2A 2VFTA 3Q23A 2KSSA 1RTHB 4M7DE 2HHQA 4M78A 4RX6A 5JVHQ 4IR1A 2O4XA 4X4SA 1RP5A 3W2VA 5A8KB 1S72S 1K73U 3C6UA 1KSWA 1U8RA 4KO0A 1LXJA 1X2QA 3RGIA 4IUFA 3ET6B 4DPUA 2QYZA 3BKTA 1P1LA 3T5JA 3MR6A 2KE9A 1KOHA 1IUJA 1RGVA 1WI8A 4I4BA 3E19A 2E29A 4DV5J 3IBWA 3J80E 3H2LA 4MIAA 1A7GE 4DQRA 4P71A 2BRKA 1JLFA 4JV5J 4M8LA 3TVZA 3HJFA 1W70A 3BDUA 2JN0A 1KDNA 2EFPA 4DZDA 1GFWB 4L72B 2KZZA 1H98A 2WVCA 5DG8A 5EDWA 2RU3A 2XU8A 1B0PA 1NO8A 2K3BA 1B0TA 2DPIA 5KG6A 3D0GE 1KTVA 3DI6B 1KHVA 1PC4A 3DHWC 2HQXA 1TELA 1S1TA 5EX3A 2ADCA 5DQHA 1MMAA 3HO1A 3CQTA 4GLKA 3PRBA 3V8LA 1UJ4A 5M2UA 2VA2A 1VYAA 1XWLA 2FEIA 5D6WA 2ZDOA 1JU5C 3D3BJ 4LUDA 2R7RA 2OD6A 2HQEA 1ELOA 2NUUG 4WCEQ 4HVUA 1UGPB 1NK4A 1N56A 1SHGA 1RQ0A 5F8IA 4DOVA 3UE2A 1OY9A 3FQKA 5AXLA 1RT2A 4PWDA 2GQIA 5J1PA 4DFJA 3L2QA 5GANf 2MKSA 3ZTRA 3UA7A 1B99A 3CSKA 2JHEA 1WDTA 3MAHA 1H74A 1S1VB 2XMUA 2PSZA 2QA4S 4QU6A 5I2SA 4BE2A 3PCOB 1X4EA 1Q8KA 4LRBA 4LN2A 3DRYA 2RJCA 1YJ9S 3G6ET 2G1DA 2X3DA 2RQWA 3L7PA 3UI3A 3R9LA 2DKGA 2YWHA 2RH2A 3CC2A 3OLAA 3K89A 5GAN4 3MEWA 5FU6B 1T7PA 2EC0A 2ZKUA 2C3YA 6FDRA 4KO0B 2HRTA 2JXBA 3M0TA 4ER8A 2PMHA 1F60B 1UZHA 2QA1A 1YJWS 5GMKh 3G8TA 2MLXA 3VYHB 3NS7B 4E2FB 2W9BA 1SL2A 3AA8A 4QIEA 4CT9A 3LP1A 3KUGA 3JCMd 3EGXB 2NS1B 2J7IA 3VS3A 3F73A 5IT9E 3CC2T 2E41A 2L2PA 4U96A 4IG3A 3PW0A 3JAME 2L0AA 4DV4F 3KLEA 5M2RA 3MEAA 1U47A 2OPPA 2ZNYA 4EFAC 4PL6A 1JLGA 4EK2A 2HFZA 1XMQJ 3E2EA 1WGSA 2VGNA 4NPOA 4K2XA 5F8LA 3META 3HSDA 2DH8A 4WXWA 1G7CB 1Q82T 3E9FA 2XY6A 1RABB 1EP4B 1Q7YU 3NNHA 3CCJT 4HTJA 5HLFA 3PO5A 2QFIA 1VYTA 3ZFVA 1X5PA 1OS5A 3ME9A 4J6YA 4QIFA 4HKEA 3O44A 1U02A 1IHVA 1SBRA 3NAIA 2JEJA 1Q7YC 2KYBA 2JX2A 4OB0B 5F0UA 2RDJA 2PMWA 2LQWA 4LF8F 1DJ7B 2UV8A 2M8DB 3GF5A 4AL6A 2GQQA 5D7UA 3CCET 2YRVA 3G82A 2JW4A 5AXKA 3T1AA 1QAYA 1VQ8S 1HNXJ 2GV1A 1FE4A 4EMHA 3ISNC 2IYGA 5B0BA 1DTTA 3FGVA 2CNNB 1D0YA 3A5ZB 3KLIA 4RG8A 2GIQA 1TKXB 3TREA 3EHRA 2FUG9 3OL6A 1BLUA 2DLPA 3DNCA 2FVSA 3S3OA 3OUYB 3T9NA 4OHXA 1R7IA 4MZPA 2E5LF 3KLFA 2ZUGA 4KUDK 2B9EA 3MD1A 4A8FA 3J7YU 1HNVB 5K20B 2VBWA 2J6OA 2R5AA 4Q0BB 2PT0A 3GIBA 1OYXA 5J1EB 4R5PB 3EXYA 2IBOA 4LSNB 1E6GA 4KGKA 1VQPA 1FXDA 1FTCA 4WF2A 1RKIA 1T0HA 2DHGA 2WB1D 4DV0J 3JB9J 5HANA 1SSFA 3W2WA 4KPYA 1R8PA 1Q81T 3NWRA 3PM9A 3W64A 1XNQF 2FHJA 1K8AU 5GAOq 2HURA 2DH7A 4DPXA 3IRWP 4LR9A 3W63A 1JLQB 5ETSA 5HLFB 4Q5VA 4JDSA 4FS1A 4MFBB 2HS3A 1IBKF 3TYTA 4LF2A 1VQPT 2C42A 2J6SA 2VV5A 2X3XD 3PMIA 1RUWA 3GOXA 3QBCA 2HQDA 3ICLA 1FRJA 1BD6A 3NNAA 4RUHA 1F2GA 3K5MA 1M27C 2V26A 2YKNA 1N5ZA 1WACA 4ED4A 2KH9A 3R5CA 2KG0A 1RTZA 5LJ3g 4AXIA 3EGVA 4F17A 2A10A 1GQEA 2MKYA 4QIGA 4JUZA 3I9V9 1R0AA 1HBUA 1V5VA 4C92F 3JCMh 3NOCA 2ZJQQ 1R0CB 2KYZA 2CS7A 4MIBA 5G0RB 1EQ0A 4A4FA 2EKNA 4DX5A 5DJBA 5D8HB 3EUNA 2DJZA 3RNJA 1WC1A 3RUBL 1GNKA 4ICLA 4B9XA 3LA0A 1N5SA 1NG2A 3REBB 5KFTA 2YX4A 4L75A 3C95A 1X4FA 2YWFA 3I4PA 2OIHA 3OR2B 4PJOG 3CF5Q 2O31A 1WQ7A 2M1HA 5DG9A 2CKKA 3JQMA 2BZ8A 1HQUB 1Q82U 2K06A 4F0MA 4PKDB 4C8QG 2XSJA 3AFGA 4D3HA 4CLTA 2O67A 3EG9A 2P4TA 2IJFA 1QCFA 2FPHX 2EQMA 4J9KA 1YI2A 4UC4A 5HK0A 1PC5A 5FU7B 4C11A 1UWBA 2CDTA 3MEEB 4HA8A 1H2UX 1YJRA 2DZ9A 2G13A 4ZOSA 2JVRA 1DAXA 3V81B 4NYZA 3SSQA 3CCQT 3RB6A 3BQ2A 3H2VE 2AW0A 4X4TA 1RT2B 5FROA 2XMMA 4OHWA 2B9YA 2GFFA 3TU4K 2NUPB 3HHLB 4HEA9 3QRPA 5F8GA 1N5TA 5EGYA 2DR6A 2HIYA 1RT4A 3DC2A 3WX4A 3FJ5A 2D3O1 2HVDA 1VC0A 3MGJA 3P8DA 4J9RA 1OY6A 1QWEA 4AL5A 4OZJA 3QKJA 4AMCA 4BE1A 3SFMA 1H8KA 4OVAA 5HSPA 3LGFA 4DHVA 2NUZA 4JJDA 1BUXA 2P9GA 1L3VA 3LH5A 3IFEA 3RRGA 3ULRB 2QEXA 2W2PP 2ZCFB 2EFGA 2NYSA 2WOMB 1DZ5A 3BSNA 3DLMA 3H8YA 4C3KA 2VHGA 1M90C 2XMJA 1HD1A 5L23A 2GTJA 4M75E 3B4MA 2SEMA 1ZS6A 3T6BA 3UDCA 4P5NA 1KHIA 3DB4A 2GF7A 4OLPA 4JUVA 3ENQA 3CCES 4B3TF 3K2YA 1KC8U 1GX6A 4LFAJ 3BO2A 5KFCA 1KQFB 5CK9A 4I0WA 1NRKA 5KFPA 3V6JA 2BJ9A 4A8MP 3RIRA 5KYUA 5CYJA 3MD3A 2K2VA 3AJDA 4C11B 1P27B 2C0OA 1P6TA 3EGWB 3QT7A 3BDEA 3KHLA 3K5PA 1HHSA 2MKIA 4X84A 4OMMA 5J2PB 1FEHA 1M1KR 3H4BA 2QC3A 4M4ZA 1U25A 2UUWA 4E7JA 3QWXX 2ACYA 1WOSA 1FT8A 1NHVA 2FVPA 2CQBA 1I07A 2V8KA 4AFZC 3EDQB 3I0RB 1NB7A 4CLWA 1O6XA 1G3WA 3GLJA 4CDIA 1MSWD 1BWVA 2FJWA 5AE1A 2HQHA 2VJUA 4O4RA 4X66F 3FBCA 1W2IA 2QG9B 1S0VA 2DGXA 3GBQA 4F50A 3DOKA 4Q45A 1KIKA 4YDDB 3GG1A 2LJ0A 1VDHA 4PG5A 2DTJA 4CC3A 4Y2IA 5GANh 4U7UK 4M7DC 1AXQA 3DDNA 4PQUB 1S79A 1M3BA 3FIFA 3PZPA 5A8RB 2IM3A 5IT9Y 1UE9A 4AE5A 4M5HA 4BY6B 1YX2A 2A1BA 2RQ4A 2C3PA 1Y96A 1S59A 3MMCA 3GILA 3VAGA 4ATNA 1UETA 5GAHI 3CJKA 1RU1A 3CC7Q 1WORA 1YBAA 1O0PA 4ZIVA 4O4GA 1UVJA 2NUTB 4TY8B 5KG4A 2E10A 2GGRA 2VG7B 1TP7A 3TA1A 4ZVGA 4EU0A 4H4MA 2RSQA 4M7AA 2F7VA 1WELA 2DEUA 4RBTA 2UVRA 3I5SA 1B7TA 2IJNA 1TS9A 4DSKA 3HRTA 1SV5B 2DHAA 3ILIA 4QJVA 2D9PA 3MHYA 2GGPA 2KFZA 1GXUA 4DBRA 1UZDA 4FIBA 2GVDB 3H5SA 2EFNA 4WTOB 4C48A 3UQSA 3CC7S 1VS3A 4RKUE 4R55A 5CCAA 5B08A 3OL7A 3D4JA 4CI0C 1DRZA 5HMWA 1C0TA 1Q53A 2IRUA 4ZPAA 3G8SA 3UA6A 4PR6A 3EGUA 4RTYA 3FZ2A 4ZGJB 1Y3KA 4CLKA 4DQ2A 3D68A 4NLXA 2CJXB 1Y0HA 1REVB 3LQVA 1CJVB 3DOLA 3FZBA 3E01A 5E5NA 2BUDA 2PUOB 5GAMg 3DRPB 5EWFA 2O3DA 4UOFA 1T9TA 2IAJB 2CZVC 1RT5B 2K2PA 4PYAA 2DETA 2QK0A 1WJQA 1D8YA 4X65J 4YR3A 2YXYA 4ECZA 4O23A 5LXYA 4CCHA 3TUPA 2APOA 1G3YA 3R5AA 2P9CA 4BB7A 2DAQA 3BF4A 1TKDA 4JI6F 2W2NP 8ATCB 4YEAA 4LFCJ 1YITQ 4N0AC 4IFVB 3MEGA 2DCLA 4AQYJ 2ZH3A 5KT2A 2CJKA 1FKPB 2E7WA 1HBMB 4ZP6A 2Y1JA 1JXMA 4KT0E 3M7VA 1R6YA 4ILRA 3UPUA 2DEJA 2CVEA 3KYLA 3FJPA 2QZ8A 2XMVA 4M7DA 1HNZF 4DWIA 4EZ9A 5EN1A 1WWHA 1UTAA 1LK5A 5J2NB 3BB5A 2W0ZA 1QVPA 4WFAQ 2MGZB 1FJEB 4CRJA 1VQ6A 3D54A 2YNHA 1VIEA 3QIIA 2ZH4A 1PJ7A 2XG8D 1V6HA 1HMVA 3M8ZA 2QTWA 3D6HB 3FDRA 4F26A 1WKKA 1IHWA 4TN2A 3PW7A 4B3SF 2XKOC 1SXLA 2N7CA 4I7FB 2K9GA 4ILLA 2ZH5A 3M8SA 4RL1A 4DR4J 1T9XA 4D3GA 2UUCF 2K3YA 2KRBA 3DLHA 3HHLA 4ZA1A 1S12A 4ZVFA 4PAAA 3OYCA 3RR8A 2V8GA 1XNRJ 4ETXA 4F4XA 2HVHA 3UD3P 3M54A 3TRGA 3LO3A 4ZJOA 2ZOGA 1E7OA 1I4K1 1FDAA 4M7DF 5HN0A 1HBNB 5KAKA 2W9BB 5GMKi 2KXFA 1N48A 4X4NA 1EX8A 2MQPA 2HW3A 5ECAA 2E5LJ 3H2UB 3M8RA 4PQAA 3PE0A 4PFPA 1NKCA 3LGNA 1C4AA 2MEWA 2QAZA 3CC4T 3OV7A 4RW7A 4C0OC 3CMEA 1NXIA 3KUEA 3DLKB 4IYQA 2BW2A 1VQKQ 2CQPA 1TH7A 2DITA 2YXLA 4C9DA 2FLLA 4ZLNA 4M5MA 2LQ5A 1KQGB 1CS4B 1VJQA 1Y5IB 4QYRA 2X35A 1Z9QA 2EYQA 2VD3A 2FD2A 1JJ2R 4XU0A 3W66A 3VGVA 5C24B 3KJVA 1M90R 2DNGA 1S1TB 2W4DA 3T6JA 5KYUB 4AG2C 1R8AA 2J9DE 1OI1A 3OFEA 3SV4A 4BY6C 4ZPBA 3EZOA 5H9EK 4KKOA 3EGDA 2B3TB 1TUCA 1R8OB 1VQOA 5AE2A 1HD0A 3L2WA 4YR0A 5CAIA 1UVLA 1AUDA 1K0TA 5F8NA 1PNJA 1KVJA 1B34A 2FJBB 1O8BA 5AT1B 4TVRA 4IOBA 3VAHA 2P9EA 4PZVA 4M5IA 2DL8A 2RIJA 1LOUA 1RA6A 1LNXA 3F56A 5D3GA 1D3BA 3I4HX 1KC8C 5EC7A 2VPWB 4DQSA 2LXUA 3M56A 4YHHF 1LK7A 2M5YA 1WOOA 1ZBTA 3JS9A 4PJOE 2XC9A 2Z57B 2WVEA 4EIKA 2JM9A 1KG1A 3KLHA 2RS2A 2EQJA 3QYGB 5GAN5 1M9SA 2DHHA 4LBPA 5ETLA 3KLFB 1NHUA 3MMJA 4OYXA 2PI4A 4ECSA 3PHTA 1B4SA 3IWXA 3M57A 2HEQA 4HR2A 2HPUA 3MPYA 3OYLA 2EC2A 1SJQA 5KYNA 2KZMA 4J7FA 4CH1A 2DJQA 1UMJA 2GMJA 4JRQA 1I1GA 4CIOA 2ACMA 3PX6A 4LF7F 3H59A 3PW2A 4ZK7M 5CD4A 3TANA 2E9ZA 4Y3CA 4M77F 1NM7A 3CCRS 4ATOA 3QT6A 2BTTA 2XLJA 1OSDA 3GTYX 3JCMW 1ARKA 1ZA1B 1W2BS 5E3RA 3V8KA 3BSAA 3AHUA 3KK1B 3T5LA 2V4QA 4ANDA 3BBFA 2VKRA 5C24A 2NSCA 2K7AA 4NLUA 1D0XA 2PDAA 4J37A 1Q78A 5K8OA 4KKOB 3H4DA 3L7UA 4R0KA 1BQMA 2ECZA 2YDLA 2CPDA 1JBMA 3OB9A 3F70A 1SC1B 2YPYA 4C92E 4DMZA 3OTOJ 3CDEA 1IO6A 1Q86U 2YH1A 2Z2ZA 2DL4A 2POKA 2I0XA 1AHJB 3PTAA 3CCLS 5KOXA 3MM7B 1QY7A 4C0ZA 4GY5A 2D6FA 4C92C 2F3JA 3GLXA 2QL7B 1E6VA 3OS0A 2R5MA 4HVWA 1T9VA 4KIAA 1RISA 2RQTA 4J9VA 5E0OA 4PJLA 3Q8QB 3OA6A 1YZ6A 3E51A 1FX7A 1RHUB 2Z2YB 1NJIC 1CULB 3LP1B 1RBAA 5AXNA 4DPTA 1HW8A 5CCMA 2W7PA 2UV8G 1TQLA 1X4GA 3QT8A 2UU9J 5KFUA 1T9YA 4OQJA 1ZSGA 1KQSA 2C06A 3MI7X 9RUBA 3T3FA 3GYGA 2IJRA 3U27A 1Q7YT 3D5MA 3POTA 1H7WA 2D7SA 4C0FA 4ERDA 3OYAA 4K5SA 4DFKA 2DO4A 4PCQA 3SYZA 4AYBD 4U9RA 1S7HA 2XZDB 1UFKA 3M6WA 3RESA 5D4NA 2GVZB 3G6YA 1T03B 4PJOD 4RG2A 1WHWA 1AW0A 1WHHA 3NCPA 3BE3A 3S6WA 1V3RA 4DR3J 1YITS 2XLKA 3U02A 2QMUB 2QEXS 3R3TA 4OZLA 3RDVA 5A8WB 3LPEA 3DB3A 2MXYA 3LP2B 4CO3A 1W2BP 5KFKA 3N9UC 4LDWA 3M6VA 2XD0A 3ZZ0A 4ZCIA 4OZ3A 1A0OB 4ECYA 4NCAA 3M2UA 1H0HB 3CCSQ 3MFIA 3QXEB 4RNNA 3VVTA 4E7HA 1SC4B 3CCJQ 4HXJA 3DKMA 3RAMA 2K2MA 2IC3A 3VU3C 1IKWB 3AD9C 3CMQA 1DTTB 2YUQA 2W24A 2F4FA 1D09B 2JM8A 2HLTA 1N8RT 2MWPA 2KHDA 4OMFG 1GRIA 5A6PA 1M5PC 1F2HA 2FHDA 2HNDB 3J80U 1X4HA 4DR1J 1GFCA 1KONA 2BXJA 1FMVA 1WEXA 4Q0BA 5KFGA 3UR3C 3V4IA 2QLWA 1T3SA 2CPIA 1TV6B 1VIFA 1KVIA 2QQRA 4EYHB 5HP1B 4RUBA 2GHVC 3QWUA 5DQGA 2RRAA 1FFWB 2RQMA 2R7TA 5I3UB 4PKCC 3IR5B 4CNYA 5ETKA 4M77E 2AK5A 3MM8A 1EZZB 2J6UA 2HWIA 3A8IA 3N6MA 1K9MC 4D6WA 2E12A 4A48A 4QWAA 2E66A 4RTXA 1X31C 3FRZA 2HSEB 2DZCA 4J9HA 2RO0A 5FLXU 4FF3A 1YHQQ 5GAOr 1TOVA 5GAEI 2EEYA 1G6BA 3A8HB 4ZPCA 4DV0F 3A4TA 2OI3A 1OWXA 3K5LA 4UZBA 2V2KA 2QDYB 1UWBB 1RCOB 2EXUA 5ETTA 4FBUA 1LNQA 3C14A 4M78F 3HHTB 3UFCX 3IBCB 1RT6B 3T1YJ 3H90A 2HBYB 4KAIA 5GMKe 2DXBA 4OI0A 3Q8SB 2F8MA 3OSPA 3QGGA 5I3PA 3SV3A 2JLGA 3URGA 3IRXA 4DSJA 5E3CA 1RSCA 1T94A 3V6DA 2JEIA 4N76A 4C5GA 2D8HA 2M16A 3EWGA 3OTCA 4DLGA 1HXDA 2FHKA 2MCNA 3GFXA 2CT3A 1CBKA 4FF1A 2VOPA 2RH3A 5C5JA 1WSRA 3QZ5B 1PWTA 1N9RA 2LEAA 4DV1J 3LF0A 4UY8T 4DQPA 3VV0A 2E1PA 1Y5NB 4DR7F 1N6AA 1KWMA 5D77A 4QYZJ 3Q8RB 2FB0A 2RHZA 4DBHA 2ZD1A 1IVZA 1NUEA 1SQEA 4OX7A 2VBXA 4PXBA 2DRKA 3OBWA 4LF6J 5KFDA 2ZBCA 1YI2Q 1VLYA 2YKPA 2I6WA 2HQCA 1R31A 3BBBA 3K7RA 3HM9A 1PILA 1IQZA 2VOOA 4IUVA 2NXCA 5KFVA 2X51A 3M8YA 4BI3A 4MZMA 1XR7A 2ZZMA 4OGEA 3GJSB 2H3EB 4RCBA 1LWXA 2ZDPA 1RACB 3EDRB 5CYMB 3LALA 2EYWA 2ROLA 2M88A 2FLPA 3UCZP 3L4BC 1LW2A 1TR0A 5FWCA 2PC6A 2COYA 3TEEA 1AWJA 2M70A 4F0KA 3M9OB 3DRSA 3DU5A 1NJZA 5FIIA 2BABA 2H65B 3SEMA 2OPQB 3I31A 2KT1A 3HF5A 1BQMB 3CTRA 4A8XA 4JZ4A 1Q0NA 5FW9A 2LQ8A 1J5EJ 4FSXA 1JWWA 4FU6A 4M5DB 5EWEA 2M8HA 2NPFA 2N3OA 1NDLA 1Y00A 1TVRA 4X4OA 3INZA 1VQ6S 1U2CA 4RMOA 1JNRB 1RHJB 2RMLA 5I4MA 3JSBA 4F3MA 2ROPA 4QQGA 4DUTA 2CJQA 2V8PA 2J8SA 4MH8A 3D66A 1RI0A 3AQOA 2CG8A 1YRTA 2WHOA 2F1FA 2XHWA 3L09A 3MPUB 4DN9A 1BYMA 1JLFB 2HKEA 4DR5J 1Q4RA 4XAXB 2MI6A 4PLLA 4H4OA 2FRWA 1RWWB 1U1TA 1SJRA 5HQLA 2YQ0A 1UW9A 4ECXA 4M78B 5KOWA 1S6QB 2J7UA 2CPYA 2R7SA 4HT8A 2EBGA 1KFSA 2O4XB 4C8KA 4JI8F 3JCMX 1RWPB 2NUTA 2YVSA 5GAN2 1X5OA 3FBFA 2OTLA 1CC8A 3OS5A 4OFZA 2K3IA 4C92D 1HR0J 1ZSZB 3QO3A 3IBFB 3LANA 4KRTA 1T03A 1EHWA 1V1CA 1XTDA 1XK8A 2V8JA 4F7UA 1HWLA 4JI8J 3OYKA 4OHYA 1VQNQ 1WG4A 4ZLJA 5ETOA 4YB1P 4BS2A 4OYWA 2W2OP 5DZ7A 5IFMA 2HL3A 1U6FA 2H5EA 3DGPB 3HFNA 4WP9A 4CI0B 2U1AA 4M5NA 5A2QU 3DXSX 5FDLA 2XI9A 1BBZA 3SCJE 1KBRA 1AWXA 4A8QA 1QCNA 2VPYB 1VQNA 1FVQA 4NEYA 4DR3F 3PO4A 1ITPA 1RK8A 3QLHB 3JCMb 2BJ8A 4B3MF 3K58A 1VIXA 2V4RA 4Y2MA 4PJOC 1G3TA 2ZKTA 2DXFA 4C8QB 2JEFA 3LLRA 3G86A 3CCUA 5D15A 1GCPA 1VRTB 3H5YA 1VK3A 1TL3A 1JLGB 5HK4A 1U1OA 1SV5A 2EK6A 2IHR1 4RW6B 5LMNJ 1NHKL 3L1AA 2MKHA 2BJ7A 1HWJA 4ED6A 2GVDA 3CJKB 3OYMA 3CMET 2RHQB 5IC6B 3AD7C 4QBUA 4O4GB 4F7UE 4M94A 3HD1A 2GCFA 2OGUA 1PSDA 2YWWA 2AYEA 2I5JB 2ZH1A 5I21A 1GL5A 4IUUA 3PNWC 2UVWA 4IG3B 4WP3A 1WDXA 3C46A 3KXTA 1ZPVA 3NGPA 4Q44A 2LCCA 1OX8A 2D3ZA 1O9SA 3DLBA 4C8OA 3HPOA 3LWMA 1Y07A 2LU1A 4XTYA 4Y28E 2ZGWA 2HHTA 1GBQA 2GGPB 2KM8B 3VS6A 2NLUA 3M8QA 3OT9A 1REGX 1PAUB 4NCGA 2YQ1A 5IQQA 1H3HA 4K4VA 1HL6A 1YBTA 2X3GA 5GAEU 2OTJA 1M1KT 4F7UB 1HHTP 2J0QD 5L9NA 4A8YA 3RRKA 1JLCB 2QQAA 3HJVA 3A98A 5BYRA 4A4KA 4CLSA 1X6OA 5J1NA 2HEKA 3G8QA 5F8HA 4X64F 4NS5A 2DNHA 1OPLA 1FXXA 2ZOMA 4RWWA 1UL3A 2Q79A 4OB3B 3C14B 4KBIA 2KI7A 1RI7A 4WFXA 3EG3A 4GLMA 1M5KC 1CLFA 3CIZA 4RUGA 3JB9G 3K5OA 1G1XA 4I7FA 5IHNA 2CPFA 4QU7A 5J2MA 1L3UA 3QFHA 4R5PA 1EKSA 2HAIA 1YJNS 3BS9A 4B3SJ 2F5GA 3SDEA 2VC0A 5HI7A 1Q81R 4PJNA 3KLHB 5C25B 4LBHA 2RAQA 3DN9A 4NYOA 4ELVA 4JB8B 2KEAA 3WC2A 2DR8A 1RT3A 1N8RR 2KQWA 1VQKA 3BPSP 1NMEB 3JXOA 2GHPA 4N47A 2R7WA 4DR6J 2DVJA 1IBKJ 3MR5A 2A7YA 4S0MA 4FL6A 3E1SA 4C5EA 1CG2A 2HAFA 4RJVA 1WKJA 1YHQS 5K8NA 1UVNA 1FWLA 1X27A 5J1EA 1QSYA 4P52A 3UF4A 4J5OA 2W9CA 2FJXA 3VQSA 3HVRA 2C3OA 3HP9A 2UUCJ 3JCMc 1UWAA 4M7AG 3Q24A 1QVFR 1YDLA 2FC9A 2JVVA 5CZVA 4ILMA 4IDKB 2EKHA 1HQEA 3OYIA 4LE9A 2CJAA 2P4RA 2MSTA 2Z2MA 3KLIB 4G3IA 2XS5A 5GAMe 5L39A 3B4DA 2CA9A 3CMEQ 3KNGA 4KPCA 2MZQA 3FEXB 4FNHA 2HD0A 2HFOA 2EBEA 2DYBA 4M7AE 3VS1A 1RB0A 2ZVSA 1RBOB 2VUGA 1FNXH 3O5TB 2C2MB 2NLWA 2DNOA 2HQ3A 1NK8A 4KC5A 2O1PA 4RU2A 1X4BA 2EFIA 2HGNA 1WIEA 4C2MA 1I81A 2H5IB 1QVGA 2DNRA 1JX4A 2HQFA 3RBZA 4QQ6A 1WYXA 1OIAA 3WHIA 4B9MA 4FS2A 1N8RU 5T7LB 3GONA 3UW1A 1VQ5A 3IS9B 3GSIA 2XK0A 3DLKA 5GAMf 1LW0B 3L2RA 4KGZB 5L1LA 4P74A 1QKXA 3CCJA 2JZ2A 2QJ3A 1E6VB 4DJBA 4NEZA 2J0XA 2J9EA 3UD4P 1PCXA 4L6V5 3I5BA 2HRUA 3OXGA 1CULA 3HVTB 4DL2A 4LSLB 2VVKA 3NCRA 2XB2D 1S6PB 4NE9C 1ICEB 4JI4J 1S72A 2LRQA 4XPCA 4ETZA 3M6XA 5B09A 4U6PA 3VV2B 4LDVA 4DX8H 1RWVB 3I55T 4RKUC 1FERA 3R5GA 4DR1F 2NZ4A 4N56A 1CJUA 2NCKL 1JB0C 4M5GA 2HS0A 1U1NA 4ZPDA 2W25A 4KV8B 1VQ4Q 1U1RA 4USHA 4WU3A 3D67A 2CYYA 1UHFA 2JS2A 4JI7F 4OF1A 4F3QA 2ZHBA 2CUDA 1Y7PA 3OJSA 1RT7B 4B9NA 2QA4T 1QUPA 1N6QA 1TUWA 3SEOA 1J3TA 2FG0A 1UFLA 4KSEB 2DRBA 1DTQA 1Q8IA 2JLEA 1B0VA 2BRLA 4NLYA 1Y5LB 3THTA 2HLUA 1XMOJ 1N27A 2RA2A 4ORZA 4DL0C 3QGPA 1N32F 2AJFE 5D4LA 3NGUA 1A0NB 5FDLB 4UQTA 3DU6A 3E8OA 2ZAEA 2V8DA 5KTQA 2JMCA 1F0XA 1M2VA 1MGQA 3OD2A 4DOZA 4P9SA 3DLJA 5T7LA 1SIWB 3H6ZA 1PHTA 3G4SS 3CULA 4Y65A 3CCUQ 4NMLA 1UGRB 4K2JA 4EMKC 2AJ1A 4KB7A 4C8QA 1PKTA 1WI7A 2HGLA 2CPJA 3KK3A 1RLPC 4NA2A 3G71T 3KK1A 1VHFA 1OEBA 3H5XA 1KD1R 5L38A 3DMJA 1YJ9A 4AQYF 2HRYA 4RTWA 3VVUA 4YB6A 2LT1A 1SKSA 1RTDB 5CYQB 1WNLA 1EETA 5CHCB 3RAXA 3PYFA 4NZ7A 1ZUKA 4WYWA 1RLCL 3C16A 4RTVA 2GQCA 2LLZA 1UEKA 4PRFA 3M8PA 1QWFA 2IDEA 1YJWT 1FK9A 4PUOB 4FW2A 2O5DA 2EYZA 3CE8A 2XGQA 4DG1A 1U4BA 5BJRA 4DF4A 2C2EA 2FVCA 3ZTSA 3RB3A 2MTLA 2BQRA 3P3DA 4XDDA 3M5AA 1VR6A 5D0RA 3R5DA 1RWKB 3SWNB 4B3OA 1YJ9T 1PSEA 5FD1A 3BQ0A 1RYSA 3FC9A 4CO1A 4EUVA 2RILA 5L1IA 1NM2A 3M2VB 3RKXA 2V34A 3NWGA 4XK8E 1BI1A 3V7CA 5CABA 1N0VC 4DUYF 3KBGA 4CRIA 4PXCA 2J9DA 1M5SA 5CKDA 3GIMA 3TA0A 4E6RA 4NI2A 1K73T 3PHEA 5JUMA 3A8OB 3SCLE 4A8SA 4CZCA 3ZO7A 4DR2F 3ADAC 4QKUA 4B9UA 5CA5A 4OZNA 3FQLA 1KD1U 1Y0MA 3GP8A 1GTEA 3HHNB 4TQSA 4TU8A 3MHXA 2VG7A 1VRUB 1D8ZA 3CCRQ 4DU8A 1B07A 4C92G 1NZ9A 2QASA 4JRKA 5A0GA 4ID5A 1K0XA 3HSJA 4ELTA 3RKWA 4R8UA 3OYYA 3UN5A 4X2BA 4YMEA 4ZTJA 1WG5A 5B7WA 2CZ0B 4ANEA 1ZZFA 2EQIA 3DYAB 4ZJLA 4B9LA 1FWPA 3H8ZA 1QVGP 4KY3A 1TAQA 4PWDB 1FKOA 4DPYA 4FYWB 3CCVQ 3CXCP 4A4GA 2AU0A 4MKYA 2EBPA 1VYUA 1IKVB 1IKYB 2JJ9A 2UVVA 4CO4A 2XSFA 5F9NA 2KGTA 1MU2A 1VQ6T 1DQAA 1KK7A 3PJWA 3AXMA 2YNIA 3FVYA 2D1CA 2QX0A 1URNA 1U1KA 3AOCA 5KFHA 4Q2LA 2MQOA 1SJFA 5KFEA 4FSSA 4IUTA 2JNGA 4X62F 3R6LB 4BDZA 2FHMA 1ZBXA 1IJEB 3KLVA 1VUBA 3BGLA 2MZRA 2YNFA 3QRRA 1M8MA 5HP1A 4OLOA 3O8WA 3PFSA 2VG5A 1C2PA 5KT5A 5I3UA 3T1YF 3QPIA 2LXFA 3A8MB 4A46A 3REAB 4HT9A 2DXDA 2QSFA 1NSAA 1NSQA 2F5TX 1H2TZ 2HNDA 2IAJA 2GNKA 4BWMA 4H4KA 4Q5WA 3PDNA 4P75A 3M30B 4UOHA 5GADU 2IYIA 3L7OA 2HIQA 5CKFA 3R8YA 4OJ3A 3V7RA 1IM6A 1WC4A 3IM8A 3G87A 1Y57A 1G5VA 3V4IB 2GA7A 4U7CA 4L5GA 3K0JA 1YK9A 9ATCB 2KMTA 5JMNA 3P49B 4DN0A 1GXTA 2MKKA 3VS5A 1JXOA 1VQ5T 4JI2J 4UY85 1R8CA 3DLEA 4U8YA 3N01A 2QSWA 4ZITA 3GIIA 3UT1A 1YCYA 2DX1A 3RG6A 3PY8A 1C6VX 3G96A 1WD6A 1YJWA 4LSNA 1R27B 2R2TA 5C42A 2NREA 4HCBA 3K8VA 4G1PA 3CXCR 3TZZA 3PVXA 2FGOA 3E3XA 2FRYA 1WC0A 2YNIB 6AT1B 4GC6A 5J2QB 4NLOA 3R6GB 2ZPHB 2ALYB 4DR4F 3N6LA 4KJIA 3HFZB 1EJ7L 1DTQB 2B5JB 3HP6A 1T0TV 5LSLA 1JJCB 1RCXB 4ECQA 4NLQA 1ZQ1A 4U95A 1VQNT 1VQ7T 4CLLA 5DM7R 1QP2A 4NX9A 4F25A 4OX9F 2NXJA 4RW4A 1M90T 3QHSA 1QW1A 2V0NA 1ZM3A 2GTOA 4ZPVR 4GBQA 2V8IA 5M2PA 1LXNA 1MROA 2CQ0A 4K59A 5GAGU 1YIJT 1VBZA 1YG0A 4K4WA 2DCUB 3DRSB 2EK1A 2FVQA 3V6DB 2C2OB 2EFQA 2V1RA 1YI2S 3I56Q 5GANe 4X9CA 2OPQA 2OMLA 3CIMA 3LYIA 5CXTA 4CP5A 3HFVA 4ENOA 4I69A 1KN6A 2VBZA 3VKIA 3IG1B 3DLLQ 2DRAA 1TL3B 2DR9A 4OYBA 2K5IA 3BV8A 2B4OA 4AT1B 3M05A 1VQ4S 5T14A 2C3UA 1UECA 2M3DA 2EPDA 3U1NA 1HBNA 3CCRT 3TR5A 3QG1A 4W92B 3PIOA 4LVOP 2J7KA 1LVKA 4NLDA 1H6KX 2IRYA 2KFYA 1VOMA 1YJNQ 3NRBA 3W65A 3HKWA 4RW8B 2AGOA 1VQ9A 4MFBA 4RBVA 4TKTA 2AWZA 2YWGA 3PR4A 3ZXWA 2H51B 2XMFA 3R6OA 3MEDA 5DLQE 2RN8A 1VIOA 2W8KA 5KG1A 5GAMj 1IBMF 4J9MA 4K4YA 5EUHA 2ABYA 2FB7A 3SQOP 1KKHA 4USWA 2ABLA 3BR9A 3Q1JA 3QWPA 5EX0A 4XTWA 2P8IA 4LXCA 1X6GA 4LIWA 1S9GA 1EX4A 1VK8A 5LMUF 3QSIA 4ZN1A 5A0YB 1R0AB 3GPLA 2DVEA 1X4AA 4A4HA 3RB4A 3NHNA 1T8EA 4JV0A 4X4VA 1VQLS 2FYKA 3B78A 3A3NB 2CWKA 4LR8A 1VQPS 2HBWA 4UOCA 5DETA 4OYAA 2ENMA 2FLNA 4PJOF 1VC5A 1HLWA 3C3LA 3TZWA 5CIUA 4P2MA 2N82B 3R2DJ 5IT9U 5KYXA 3NTIA 4A63B 2K57A 4C5IA 4NI2B 2X4WA 3J80Y 2OD4A 2UU9F 3SDZA 2EW9A 1RTIA 2ASYA 4DPWA 3JCMJ 1ZH5A 4IH5A 1A6LA 3JCMg 2OH2A 1ULRA 4JP8A 1FNMA 2KVQE 1RHQB 2DNMA 2K5LA 1PBUA 1C4CA 1VBYA 5DDQC 1ZM2A 3GP9A 4BLGA 1GBRA 1YLXA 4MDWA 2ILZA 3CT9A 3GMGA 4X65F 2RUGA 4C0HA 2VIHA 1DY3A 1YQHA 5JJBA 3V81A 4YB5A 1IKXB 1LWEA 1XOVA 3PMTA 1AZSB 4MZTA 4E7IA 1X4CA 2HDAA 2ESWA 3JCMf 2W01A 2CREA 4O0NA 3L95X 3H20A 1K9AA 4FYYB 4MTPA 4JZ3A 2MZ1A 3OYEA 2ZUAA 1KLMB 1NKEA 3QJLA 4IDKA 1ZUUA 3E9GA 1M5HA 4M7AF 4O3RA 1HR0F 2BKDN 4RPFA 4ES3A 4GMKA 2A28A 5AYFA 4OHZA 1S0OA 3MFHA 4C0DC 4PJOA 2EFVA 2PU9B 2D3OR 4C98A 1U8WA 5K9FA 1RWNB 3DRRA 1CQNA 3NBPB 2O01C 4YY3F 5F3ZA 1YNZA 4EMDA 1UFWA 2BACA 2DIUA 4F4YA 1VISA 1HYSA 2VGMA 2D69A 4XTUA 2RB7A 4LMZA 3HT0A 2HZYA 2ADBA 2PFFB 2KFNA 3W9HA 1U0HB 3JCMe 2JEGA 2H8HA 5E41A 2BANA 5I11A 3HVWA 3JQKA 2DGSA 3MP1A 2Z0WA 3RB0A 2VF3A 2DNPA 4OL8A 1ABOA 3NS5A 1QTNB 1X2KA 2ZPBB 3MMAA 3I0RA 5A8KA 1PGZA 5HBMA 4Z37A 3NLCA 3HTRA 5CAAA 1BIAA 2AGPA 1C0UA 2L41A 4Z2XA 2YT6A 2C2RA 2M0YA 4DL4A 2XCAA 5GAOl 3NGSA 2ATLA 5L9XA 3HVTA 2E70A 1QUVA 5JXSA 5HY6A 3O5ZA 2DTOA 2RI2A 4XK8C 2ZNZA 2DD4A 1AD5A 2BOPA 1DHMA 2DB1A 4IQXA 2B0GA 2LXIA 1TL1B 4CT8A 2ZBPA 1CJUB 5A8RA 3C19A 3OYHA 4NXMJ 2YKMB 1TK0A 3PJXA 2W1BA 3W9JA 4LDXA 3W5YA 1OU8A 4J9UE 4LFBF 3CCMQ 3GV7B 2MKJA 4M75B 1BMQB 3Q8YA 2QV6A 3RBDA 1CVJA 4ZLLA 5AJ3F 4XDCA 4FBTA 2HK3A 4QOTA 4M7DD 1BCMA 2QTVA 2RHSB 3BSOA 2EJ9A 2CVIA 4FP9A 1XMOF 1GFDA 2X4XA 2Y1RI 5KH6A 2M51A 3M4XA 2ATCB 4IQMA 1TKTA 1T9UA 2J9CA 2GQ2A 4P7TA 2MZTA 4B9TA 2YKOA 1IGUA 1D1AA 3OQ5A 1FA0A 3NOGA 3LGMA 4CQ1A 4R56A 2AJ4A 4LUBA 1SJ3P 2JC0A 5HJXA 4N41A 3C94A 2YY3A 3EVWA 3KLGB 4WKYA 5I2MA 1S1VA 1RT1A 5E2QA 2YKAA 1SSHA 3CMAQ 5DLFA 1FESA 3AODA 2IIHA 4RO0A 2FO0A 1AWOA 5GMEA 1IR2A 3PEHA 2DHSA 2GQVA 2HNIA 4DL7A 3P96A 2JMAA 3KK3B 2YWEA 3D3CJ 2OMOA 3Q8UA 3RTVA 5KG5A 2ZPEB 4JS4A 4HCKA 2XIDA 3TW0A 3LPYA 1HYOA 2G0CA 4DLEA 1IM4A 2V94A 3NP5A 2P0QA 3BO3A 3GR0A 4GO5X 2XO7A 3D7SB 2A2DA 1NPRA 1GAOA 1NLOC 2QT7A 3C6TA 1BXNA 2B6AA 2VKNA 4A8OA 3H0HA 4N77A 3HXMA 4MMLA 4ZVSB 4QW2A 3MM6B 3A8LB 4RWXA 2ZH6A 3T1HF 2VYTA 4CNZA 4DF8A 1GMUA 3CEYA 1FMKA 1X4DA 3ZZYA 1LWCB 1HBMA 5LJ3e 3AA9A 2LVMA 1HQEB 1U2FA 3QYHB 2OPPB 2R57A 1IBMJ 2GIRA 2BW7A 1CJVA 1W1FA 3T1HJ 2VQFF 3LP0B 1KQSP 4C8YA 2IM0A 4O3QA 3WX8A 1RT5A 4IIOA 3BGUA 2D3UA 4JI6J 2C28A 3CCQA 2AD9A 4F3OA 5M9OA 1TWBA 1RT7A 2YX1A 1NDKA 3JYTA 4ECRA 2VC1A 2MJUA 1QSLA 1LCKA 4WJBA 3W7BA 4QT7A 3ZZPA 2HHWA 3OW2A 2YPZA 3ZNJ1 3M2RA 4CTAA 4JI3F 5HJYA 4DQIA 3FK4A 3QNWB 5HVHA 1GXIE 4C5HA 1OSCA 1P9QC 4RU9A 2AZ1A 1VCTA 1L3TA 1NPKA 4I1TA 1JK9B 1NK6A 5GVQA 4N8NA 5LOQA 1BE4A 3P45B 4OJ1A 5LJ3Y 3NL0A 3ZTQA 2HYIB 3DLLA 1RWOB 2DO3A 2LYVA 5AE3A 1VRUA 3J7AN 1MWZA 2BE2B 2LP4A 2AYBA 3PYEA 1AWWA 1XNRF 5DRKA 3Q8PB 4RUAA 2HZCA 2J05A 1HNXF 1UEVA 2BYCA 1ZBJA 4ZP9A 1N6QB 5D0EA 4QR0A 5SZTA 3HSGA 2DVIA 2M0OA 4FYXB 1AZEA 3IP0A 4E7SA 3OFHA 4PG8A 1CJKA 1RU2A 2GZOA 4C3MA 1XQIA 3SMZA 3TOQA 3GCXP 1RUSA 4ZPWR 3MEUA 1UVMA 4NWBA 5KG3A 3V6KA 3X1LB 4ZIWA 1IKVA 2J76E 2A18A 3VAIA 5KYYB 1NJXA 5D6YA 1TSFA 2CDQA 4W4MA 3ZBDA 2MWOA 3KDNA 1MU2B 1YJ9Q 1ZYQA 3ZZOA 3TA2A 3SSSA 3EICA 3R97A 1I6JA 2IY5B 3EPGA 4BUGA 2VQFJ 1G3SA 5LJ5g 3TQ1A 4HACA 1ZTTA 5IS2A 3MP6A 5DO2A 5KFLA 3EG2A 2IVYA 2CAJA 1RLDA 3SWNA 1UJ0A 1JLQA 2YRDA 4A4EA 5CQGA 2GO8A 2V8HA 5ETMA 1RL2A 2MPXC 3IMQJ 3EHQA 3PFEA 4JLIA 2A6OA 1OQKA 3EG1A 1WHGA 3KOAA 2A0FB 3FBBA 2FDNA 2KI2A 4I67A 1YI2T 2QYCA 5E3QA 4P10A 1BKBA 1MWYA 3N5FA 4HKQA 3R2CJ 1FWKA 5LJ3f 1S6UA 4QYZK 1U6ZA 4QQBA 3MJXA 3MMAB 1EKRA 1UGQB 3DHXA 4KYZA 4A4JA 4ZVQB 5HBMB 3VRZA 4XU3A 3FEOA 1M0SA 2E1RA 3NY0A 4K4UA 4TXSA 5FU6C 1WI6A 1FTRA 5DM7Q 1WJSA 4NLTA 3OTOF 4DV4J 2COWA 4DX6A 1WHVA 3I5RA 5CKBA 1DLOB 4E7KA 4IIMA 3I56S 1HFEL 2NPIA 2DL5A 3IAS9 2QRRA 1VQSA 1YHQT 1W26A 3UVJB 3FRYA 3JV3A 2VG6A 4ED1A 3OTBA 3H0FA 1TK5A 4C7QA 2V2ZA 3R5BA 4K5RA 5D78A 1VHIA 2CUBA 2CZ4A 5HL7Q 4K4ZA 2PVDB 1U1MA 2JOQA 3KHRA 3R6NA 5B0AA 1T3NA 4F04B 2CP6A 3OYNA 4FN5A 5MAOA 1S76D 2FZKB 1K44A 1B34B 2QQBA 2PO4A 2MYSA 2CFXA 1G83A 4YTLA 4J9IA 3W8GA 2FY8A 2M9UA 1WZOA 1BCOA 3PFOA 5KFRA 2F8HA 2B43A 4LF7J 3TZXA 3RR7A 1KP6A 3G4ST 4M5LA 2L3SA 2FPDA 3C12A 3UWNA 3EXCX 2VUBA 1KD1C 2F69A 1PM3A 3LUYA 5A2QE 3AQPA 1SH2A 5LJ5h 1T05B 2XHCA 1D1CA 3V7SA 1KOOA 1YIJA 5LJ5Y 3UPFA 4ZLPA 2HSPA 2L3RA 4X4PA 5DG7A 2BQ3A 3VUBA 3EVMA 1M1KU 2AQ4A 1JO8A 1UAWA 2CZ7B 3BYPA 2MKCA 1PC0A 3ZFJA 1VMBA 1SKRA 4I2QB 2HHVA 4QWCA 1M4ZA 1RT4B 1VI7A 2QDLA 5GAOm 2LTOA 1WF0A 3HT3A 1FDNA 1SF9A 3MAAA 1X9SA 2AEFA 3W60A 1I5OB 1S77D 2E6NA 3PEJA 4IRCA 3HLUA 3GWCA 1IJFB 4G1QA 3SCIE 2RDIA 2V9WA 1UKUA 2HBRB 2ZITA 5GAHU 3FUYA 3D28A 4J83A 2Z2LA 4WYLA 3JTNA 2EQUA 4H4KC 3RBBB 2HL5C 1YTYA 1M2OA 5ETNA 5HMYA 1Q86R 2AJQA 2WAQD 3MXHP 2A36A 3H42A 2ZEJA 4O5VA 1SB6A 4X4RA 2YUNA 4EGLA 1J2VA 1D9AA 1H92A 3NGDA 2QTXA 4CYUA 3I0SA 4C97A 4HH0A 4BDYA 1ZETA 2MB0B 3POTB 1U06A 4RZRA 4DUYJ 2JSXA 3SHWA 2PA8D 4OX6A 5LJ3d 1B7FA 3I96A 4LNPA 3OFGA 3QATA 1FRLA 2KRRA 4ED7A 2EGAA 3D6FB 2RK2A 4B3TJ 3PRVA 4O3NA 2EFOA 1ZA2B 1HBUB 5KFIA 3IR6B 3MWBA 3QDFA 3RKYA 3LH0A 3M1VA 2GHWA 3TJ9A 3CD0A 1KS2A 3M0QA 2AEJA 3KG0A 1YITT 1N0UA 3OYDA 2NWMA 1SI9A 3MDFA 5DS7A 4ECUA 2E7VA 1VQLT 2FHOB 5J3BA 1LKZA 1B3QA 3PIOQ 1DJ0A 2V50A 3DLEB 4O3PA 2VICA 1RDRA 2AHOB 2IRXA 2V2VA 1ZOTA 1ZM9A 2RRNA 3NS6A 1APSA 1WF1A 4ZVHA 1K8AT 2Q3PA 4C92A 4ZCMA 1MNEA 3CC2S 4NLRA 3L2VA 3A3OB 4HYKA 2BKOA 3ETOA 2DR5A 1OPKA 4TU7A 2AZ3A 2E65A 1HIYA 7FD1A 5IQ6A 2BJEA 4FXWA 2FL7A 4XQ3A 1AZSA 2DYIA 3DOMB 1V3SA 2WVFA 1OYEA 2LDYA 1WHYA 4C8MA 2B4PA 2BJ3A 4KGXB 4J9EA 1RKJA 2WBRA 1QE1A 1FX4A 4ZTFA 4Z7YA 2LC4A 1FD8A 2CADA 1PO6A 5MLCV 2DNUA 1CJTB 5IT4A 4OMLA 2GS8A 2LQNA 4Y91A 1VC6A 2IC3B 1ACMB 3UCUP 3CC2Q 4DU7A 3OSNA 2RNAA 4BHQA 1BQNB 5LSRA 1F5AA 1FRIA 1VQMT 3FBEA 5K8PA 2HNZA 5ETVA 2RHXA 3DLGB 4HACB 2CZ6B 4DV2J 1FMWA 2H5JB 4HI2A 3PKYA 2V1QA 2FHJD 1FEEA 3FJ2A 3VAFA 1AYEA 2EKYA 3RBXA 3I87A 1FJGJ 2VB6A 3QGHA 3EFRA 2Y4XA 2DERA 2LNHB 1BI2A 3M1VB 3VZIA 1NPPA 3GNGA 2N3LA 5KFOA 2YHTA 2RJDA 3PVLA 3IR7B 4I6AA 4LJMA 3RMQA 5I42A 1K1ZA 4Q8EA 4DV6F 3HZEA 1QAXA 1GEHA 1S6PA 2IA6A 2NXEA 4IOAQ 1LQ9A 2DBBA 2FJEB 1IGQA 3RERA 5B0DA 4B3RJ 1SJ4P 1WEYA 5K14A 1S1WB 3CW2C 1BB9A 1D3WA 2CPZA 2YBVA 3RZAA 2IVWA 1RHRB 1GH8A 4BE0A 3PT9A 2OX7A 2DPPB 4J9NA 1X75C 2EIFA 2W10A 1SQFA 4KHMA 5CKHA 1KHWA 3D6MB 2PZ1A 1Q8BA 1A9NB 3BGRA 4RLEA 4WFYA 2VBYA 1HJDA 2QE5A 3MCSA 2NZCA 4B3RF 2HK2A 2ZH7A 3KUFA 1XIQA 2PUKB 3BW1A 2NYHA 3C66A 3S1TA 1X5TA 5LJ3h 4HL9A 3TVTA 3FCHA 3MEDB 4J9BA 3G71Q 1U48A 1K4US 4M95A 2R7UA 1MWQA 3FEZA 2ZC3A 1S72Q 3QPHA 4WP8A 3I5AA 2Y0SD 4DV7J 1E6YA 4DSFA 2DRDA 2WTFA 1N5VA 2PD1A 4C8ZA 1WXTA 2MLZA 2GX8A 2HHUA 4LFCF 4I6WA 4Y92A 3JB9H 1CSKA 1HPZA 2VZ9A 2AX0A 1PD1A 2EG2A 3LX7A 2RK1A 4DFPA 3QIDA 4O3OA 3O2IA 5GANj 1DARA 2HMIB 3OFFA 4JI2F 2FGCA 4MT1A 2V67A 2R2RA 2IBKA 1RHMB 1NLKL 4KT0C 3EH2A 4KTQA 3V8JA 2OTLS 3B8HA 3HDSA 1S10A 2KT8A 3QJPA 1KEKA 4W98A 2CIMA 1MV3A 3WVEB 1TMJA 1SPKA 2A3JA 2DEQA 1EETB 2RHIA 2HWHA 3C4SA 2HGMA 4ED2A 3F0NA 4F4WA 2EAYA 3NPFA 2M7SA 1TL7A 3QT5A 3BQ1A 1QKWA 5KT4A 3OL9A 4HVZA 1UTIA 1KLNA 3CCMA 4B3MJ 5E3PA 4FYDA 1YBUA 1KTQA 1JQGA 2IVMA 1OU9A 3UATA 3C6TB 4WF9Q 3VAJA 4OJHA 2E64A 2BKPA 3OW2S 3UN2A 2XNRA 1AEYA 1OQ3A 1HYSB 3EG0A 4XU2A 2GJIA 1KFZA 5B0FA 4DL5A 1KC8R 3QZ8A 3TCJA 3I9QA 1K73R 1D0ZA 5GAN7 1M30A 2XI2A 3LAMA 2CZ1B 1N9SA 2KY9A 2KBTA 4UUXA 3CDWA 2DGQA 4H4OB 3OTEA 4PJOB 4DG1B 3TO8A 2ASJA 1YJVA 3X24B 1LV5A 2NUHA 2GJFA 1D9DA 3MZIA 1LPLA 3W61A 3HMJG 2WBMA 3BYRA 3E01B 4B17A 3O1LA 4M75A 1AT1B 5DLOA 4UTGA 3QBYA 4NA3A 3KJVB 3RAQA 1BI3A 2F1LA 2HHSA 2LX7A 1N54B 4J9QA 3QJYA 1S72T 3S01A 1VQ5Q 1M3CA 3I55A 2LCWA 2HMIA 5CYQA 1WC6A 3Q0AA 4B08A 2ASLA 5I22A 1I5LA 1YBYA 3HKSA 4LRDA 3CBPA 1MNDA 5A76A