5GMKl

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
b'NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 13
structure length 82
sequence length 82
chains with identical sequence y
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
l PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkl00
3JCMX 4M7AE 4PJOC 1Y96B 3RKXA 4M78G 2RD1A 1LNXA 2EWNA 5LJ5d 1U1TA 3JCMV 4C8QD 5LJ3j 3JB9I 4XU0A 5LJ5h 3M4GA 3JCMJ 2RM4A 2YLCA 4C92B 1I8FA 3JB9H 2E10A 3EFRA 1WQ7A 2DXTA 1BIAA 4WF2A 2DZCA 5GAOl 2QTXA 3QO3A 1M8VA 2E41A 2I2LA 4PNOA 5GMKl 5GAOr 1M5Q1 5GANd 4C8QG 4XQ3A 4DQ2A 4EMGA 2EAYA 4EMHA 1X01A 4M78D 4F7UE 1KQ2A 4MMKA 2YLBA 4M75E 5GANh 2FB7A 1B34A 3V7RA 3HFOA 3JCMd 3JB9D 3HSBA 1WQWA 3QHSA 5GAN7 3QUIA 2RA2A 5LJ5e 1BIBA 4PJOF 4F7UF 4HT8A 4M7DB 4A53A 5GAMg 3RUXA 1KQ1A 4M77D 4MMLA 1HK9A 3BY7A 4M78E 3V8JA 5GMKe 4PJOB 3FB9A 2DTHA 3JCMc 4OP0A 4NL2A 3JCMg 5GAOm 5LJ3d 5GMKm 3JB9G 4M7AF 2HNIA 1N9SA 4A54A 2DJZA 4M7AA 2DZ9A 2JN0A 5DY9A 5GAMe 4M7AC 5LJ3h 2VXFA 1WNLA 4M7AB 3JB9J 4M77G 4M7DG 2VC8A 4JRIA 3FJPA 4C92D 5GAN5 4EMKA 3SB2A 3JCMe 2RB6A 4EMKC 4JLIA 3JCMW 3RESA 5LJ5g 4NOYA 4XU3A 4C8QE 4QVCA 3JCMQ 4HT9A 5GAN2 4N0AA 4QVDA 1H641 4N0AC 4Y91A 4RCBA 4C92E 4C8QF 3V7SA 4C92G 2DTOA 1B34B 4C8QA 4XTYA 5GAN6 4J5YA 4F7UA 4M7DD 4M75F 5GANg 2E64A 4XU1A 4JUVA 4M75A 4F7UB 5GAMf 4M75C 5GMKj 4M75B 4XU2A 4PJOD 2DEQA 3L2ZA 4X9DA 3V8LA 1JBMA 4XTUA 4XTVA 4M78F 3JCMf 5GAOn 4M78A 5GANe 4M7DE 4M77E 3AHUA 3FIFA 5GAMj 4M78C 3QSUA 2DVEA 3JB9F 4M7AD 3BFMA 4HA8A 3BW1A 4XTZA 2EJGA 3VU3C 2VXEA 4PJOG 4NL3A 4EMKB 3RERA 2EJFA 1D3BA 5GMKi 4M77F 5LJ3g 3RKWA 1LJOA 4M77A 1TH7A 3V7CA 5LJ5f 5GAN4 2DTIA 1Y96A 2FYKA 4RCCA 3HFNA 3EFSA 5I21A 4M7AG 1YCYA 4J6XA 1I81A 1HXDA 4C8QC 2ZGWA 3PGGA 4C8QB 5LJ3e 1I4K1 5LJ5j 5GAN8 3V8KA 4C92F 3SWNA 2EJ9A 4M77B 4C92A 5GANf 3GIBA 2YHTA 3RKYA 3SWNC 4C92C 4X9CA 3SWNB 4M75D 1JRIA 4XTXA 5GAN3 5GAOp 3BDUA 3JCMP 5GMKh 1U1SA 5CAIA 3L1AA 4XTWA 5GAMd 5GANj 2DKGA 4M78B 4V2SA 3RIRA 2DXUA 4PJOE 3JCMb 4F7UG 5GAMh 4JRKA 2E65A 2K57A 3INZA 1I5LA 4M75G 2E1HA 1LOJA 2CGHA 4M7DF 1WPYA 2Y90A 5GAOq 4M7DA 1D3BB 4M7DC 1MGQA 4J6WA 4J6YA 1N9RA 4M77C 5LJ3f 3JCMh 4PJOA
chains in the Genus database with same CATH superfamily
1BI3A 2CZ0B 3RKXA 5FW9A 1VQ9A 3CBOA 2EIFA 2O01E 2EQMA 1KJWA 4XU0A 7AT1B 1WFWA 1HD3A 3G1JA 4ZGDB 2D8JA 1BIAA 1VQNQ 5IHIA 2E41A 1V1CA 4FIBA 1XNIA 2EQIA 4F7UE 1PSFA 1QP2A 2O31A 1SPKA 3HFOA 4R56A 3LX7A 3ZEHA 2V1RA 2HKNA 5GAMg 4MMLA 1BYMA 3LH5A 4Z8AA 1NYFA 1TSFA 5LJ3d 1MNEA 3SD4A 3L42A 2KAFA 3PMTA 4RMOA 3CCVQ 2DA9A 3U23A 4MDWA 2HDAA 5GAN2 1VYUA 4QVDA 4OGCA 3VS4A 2I0NA 2JS0A 1QLYA 3CMEA 1T0JA 3H9NA 4AFQC 4M7DD 1P92A 1GFDA 3G71T 2LCCA 1YJNQ 1WYXA 1X6GA 4LN2A 2LQWA 2DVEA 2EYZA 2KRSA 4PJMA 1K0SA 4A4HA 2EJGA 5I22A 4PFOA 1PRMC 3V7CA 5GAN4 2DYIA 3GP8A 1K73R 2HBPA 2ZPEB 2DFUA 5CKHA 1Y7XA 2L2PA 1OPKA 2YHTA 4X9CA 5A0DA 1NEBA 5GMKh 1QKXA 3CCET 2HSEB 3CPFA 3EG1A 1CKBA 1OX9A 2NWMA 1VQ5T 3I35A 2AIRB 1N9RA 1YJ9T 1NBEB 4DBRA 2Z0WA 2NUTA 2EWNA 1K8AC 2VB6A 3EHQA 3CD6Q 2RM4A 2ABLA 2Y4YA 4EIKA 4C92B 4BY6B 2COZA 4QQGA 1RAIB 1NLOC 4BI4A 5GANh 2FEIA 2OTLT 2QQAA 1NZ9A 1Q7YR 1K8AR 5A0GA 1BIBA 4JJBA 1FMKA 1VQMA 3EG2A 4M78E 1ZX6A 5LL6S 2F5TX 2FRWA 2EYQA 1Q82C 3NPFA 2NYSA 2O9SA 3EGDB 1Q81C 3CC7T 5ECAA 1YWPA 4JRIA 3MP8A 3JCMW 3RESA 4XU3A 4L59A 5L23A 2DEUA 3CEYA 2ZZDA 3FLGA 1WA7A 3LWHA 1GCPA 4OB2B 2LCLA 1X2KA 2EQJA 2K7AA 4J5YA 2J06A 1PC0A 1M2VA 3P8HA 5GANg 4OF1A 2PU9B 2QGFB 3N5BB 1VQLQ 4M75B 1MMDA 3URGA 2DIGA 1K0XA 4GLKA 2G6FX 3RERA 2X4WA 2V26A 3P8BB 2HQHA 5GMKi 4M77F 3CBPA 5FROA 4E7ZA 4N4HA 1Y96A 3PGGA 4C8QB 4GBQA 2LT1A 3GNGA 1PG5B 2QA4T 3V8KA 2X51A 1T3LA 2DXCA 2FL7A 3RNJA 2XU8A 4DA4A 2DM1A 1FXXA 3CC2T 4B6MA 2XKOC 5IN1A 2J6KA 2CP6A 1I5LA 3H0FA 2KRMA 1Q86U 1M1KC 2QYZA 1H3HA 1ZSZC 3EG3A 3G71Q 4DOWA 2FO0A 1WJSA 3GPLA 1QVFP 1MMGA 2KI7A 3E19A 3FEOA 1UUEA 2KYMA 4F14A 2RQVA 3EFRA 2CS7A 2I2LA 3ASKA 1WHJA 2DXBA 2E70A 4DQ2A 1M1KR 4MMKA 4J9DA 2Y4XA 1HSQA 4DBHA 2C06A 3I5SA 4RG2A 4M77D 3F70A 2GTJA 3E2UA 4E7KA 3CCEQ 2BUDA 4KT0E 4QVZA 4MZTA 4M7AC 4M77G 4IUTA 2GQVA 2CH4W 2DILA 1PD1A 3JCMQ 1RLPC 2QEXT 4N0AA 3ZFJA 1YJ9Q 2GFUA 4E47A 2VKNA 1IO6A 4D8DA 2EYYA 2JW4A 1KQSS 4A4KA 3CCMT 2M9UA 1WLPB 3O8VA 4DBFA 1OOTA 2ESWA 4KH1B 5J26A 3OB9A 2FZGB 4E6RA 2KK4A 2YT6A 2C0TA 5GAMj 2X9HA 2K3BA 3BW1A 2FRYA 3G7ZA 1X75C 3C4SA 5LJ5f 1ZUUA 2L3SA 3HFNA 1K9AA 1YCYA 1ZSGA 4A4FA 5LJ3e 1OPLA 1UHFA 2KQWA 3CC7Q 2QK0A 1GCQC 3OS5A 2J7IA 2J6FA 3DB3A 3VV0A 3EGXB 3L1AA 1QVGP 1I5OB 3HHTB 5I2MA 2OTJA 3ZL7C 4PLLA 2D9TA 3OYYA 3X24B 3OBYA 4P5NA 3OMCA 5KYNA 1YFNA 2BE7D 5I11A 2AKLA 4JJNK 2CUBA 1W1FA 3VS1A 4AG2C 1VIFA 2BE9B 1M3CA 4HCZA 2DPPB 3EFOB 1G2BA 3CMAT 2ED0A 1QCNA 2DE0X 4PJNA 3MEVA 4M75E 4RUGA 3UWNA 1RI9A 4BD3A 1UJ0A 4F7UF 1KQSA 2QA4Q 2DL8A 3L2VA 2A7YA 2NLUA 2IG0A 4OMMA 4X1VA 3C12A 5GAOm 1N9SA 2CZ7B 5DY9A 2MAMA 1ZHIA 2GQIA 2KY9A 3GOXA 2CDTA 3JCMe 4E2FB 4C8QE 2LT4A 3CBMA 4IKFA 4C5EA 3OYLA 3KUFA 3OSVA 3M53A 3OYBA 4PJJA 4AFUC 5A2QE 2OJ2A 2B86A 4FT4A 5GMKj 1JEGA 4NS5A 2X3XD 2ED1A 3VYGA 3CCVA 4LDXA 2QGGA 1M2OA 3LYIA 1H92A 1AOJA 5CR2A 1C1AA 1R0CB 1XQHA 1TU0B 1LCKA 2EBPA 2O88A 5L8RE 3WVEB 4FW2A 4J6XA 3M0PA 5FWBA 1X69A 4J9GA 1I4K1 1YJNA 4JRQA 4R55A 4C92A 2HQEA 2DO3A 2F69A 5CK9A 3RBBB 4Z02A 2KT8A 3ME9A 3VKIA 1U1SA 3FC3A 2K9GA 2QEXQ 1D0ZA 5GANj 4ANJA 2FPFA 4FL6A 4F7UG 4JRKA 2LJ1A 4J8OA 3T9NA 1VQOT 2CP7A 2ZCFB 1GXIE 2HCKA 4M7DC 3TVTA 4K11A 2X4XA 1ZSZB 4N4GA 2KT1A 1BKBA 3HPWA 4E7LA 5IHNA 3EGDA 3TCJA 5LJ5h 4A4GA 2YRCA 1QVFA 5GAOl 2LQ8A 3QYHB 3HRTA 3VJPA 1OV3A 2LZ6B 1WX6A 4XQ3A 1ZQ1A 2QQBA 4FSSA 1FMVA 3CCLT 1B07A 4ME7A 3V7RA 5GAN7 2RHIA 3OY9A 2RA2A 1Q7YU 1K8AU 2JT4A 1Q86R 4OMOA 2DL7A 1KC8C 1RAAB 1SF9A 1D1CA 2DK3A 3CD6A 3OYIA 4A4EA 5GJVB 2JN0A 4X34A 2RK2A 1T0HA 2LC4A 2VXFA 4M7AB 2ENMA 4IIMA 2CT3A 4CC2A 2JM9A 5LJ5g 1JO8A 2EYXA 3Q1JA 8AT1B 4LE9A 3QWXX 1RABB 1VQ4T 3FDRA 2WSFE 2DTOA 4C8QA 2KBTA 1Q81U 5FWCA 3QBYA 3L2ZA 4XTUA 5DLQE 3CMAQ 4XTVA 2KR3A 1UGSB 3IQLA 4Q5WA 2COYA 4HA8A 4C0ZA 3OYDA 2RMOA 2K5FA 5IHKA 4EMKB 1JU5C 1MUZA 3NFCA 2L8DA 2DTIA 4Y92A 4J83A 3A8HB 2DIQA 1VQLA 4FSXA 2K2VA 3I56Q 3GIBA 2KYBA 3SWNC 2L3RA 3CXCP 1JRIA 2QQRA 2DF6A 4GLMA 5GAN3 5CAIA 1G8XA 1RACB 1YIJQ 4M78B 4PK4A 1VQPT 1GL5A 3INZA 2CGHA 1OULA 3L2UA 3THKA 2GBQA 3OYGA 1NJIC 2DBKA 4M78G 2M16A 1AT1B 4RG8A 3H8ZA 4IUUA 3VS5A 2M02A 2LJ3A 2K3YA 1M8VA 4JJDA 1PM3A 2VUBA 3NGPA 1M1KU 3M0QA 3QDFA 2FB7A 2EKHA 1CKAA 4J7FA 3OYAA 2FHDA 4PJOB 1XTDA 3RDVA 2QQ9A 5GMKm 3HRSA 4O5VA 4RTVA 1ARKA 4RKUE 3A8OB 2RB6A 2CP2A 1VQOQ 1X6OA 1YI2T 3PT9A 1WHHA 1G83A 2LRQA 4BDZA 2EVRA 4LDWA 2A28A 3CCEA 2IPOB 3M55A 1IGUA 2YDLA 3SHWA 4F17A 3QZ5B 1YP5A 2K2MA 3JRZA 2V1QA 2QG9B 2KSSA 1QWFA 2M1HA 5FLXE 1YJWT 1YJ9A 1G3TA 1RAEB 2RJFA 2A36A 2HZYA 1BCOA 3EFSA 3CCJQ 1NEGA 4CC4B 4C92F 3CCST 1PKSA 2D8HA 3SDZA 1KG1A 4XTXA 2BKDN 2XI9A 4FU6A 4PJLA 5KYYB 3CCRA 2EFIA 3VS2A 1VQ4Q 5KYWA 5D6YA 1D3BB 1X6BA 3JCMX 4M7AE 3MPUB 3OS0A 2DL5A 1AWWA 3CC7A 1UDLA 1V29B 1TUDA 3JB9I 2X35A 4OVAA 1EX4A 5J39A 2DNUA 5GMKl 3CXCS 4KBMB 3NTIA 3NTHA 2C0IA 3JCMd 4XK8E 4DOVA 2EQUA 1ZUYA 3OYKA 4XAXB 2HQXA 3I55Q 1ABOA 4QT7A 3HRUA 3FJPA 4C92D 1VQPQ 4HXJA 1TWBA 5KCOA 4MZMA 2CSIA 1FWZA 1KQSP 2PVGB 1BB9A 2QA4A 4C8QF 4KGZB 4J9CA 4C92G 1B34B 2J6OA 4F7UA 2K5LA 1BCMA 4XU1A 1BU1A 4KRTA 3G4ST 4ORZA 1AVZC 4QW2A 4FYYB 3AHUA 4FT2A 1UGPB 2CH4A 3RMSA 1UFFA 2P84A 4JJCA 2EW3A 2K5IA 1Q82R 2FYKA 2K3XA 2X4JA 4JS4A 3P8DA 2OAWA 1GFCA 5LJ5j 2LVMA 4RTWA 3CCUT 1Q81R 1IREB 1E6HA 2VYTA 4ELYC 2CYZB 4QKUA 4M75D 4OB3B 3SWNB 1SRMA 4J9IA 3CXCA 5GAMd 1ZBJA 4FW1A 4PJOE 2V8JA 4M75G 2E1HA 3DLLA 1PRLC 2KROA 1WHLA 4KGXB 1D0YA 1JB0E 5CIUA 1KD1C 1RAFB 2NUZA 1M3AA 5KE2A 4OB1B 2XDDA 1R77A 4C8QD 1WXBA 2QEXA 1YJWQ 2QTXA 5FU6B 3A8MB 5IXBA 5GAOr 4C8QG 1KD1R 2A08A 2BZYA 3HSBA 2YUPA 2E4HA 1FYNA 1UGVA 2O9VA 2XIDA 1PSEA 1SKUB 2P0KA 3CCQA 3G6ET 2ROTA 3TEEA 2GFAA 3HKSA 2GNCA 2IVWA 5D6WA 3JSCA 3O5ZA 1EZZB 3DB4A 2IIMA 2JOYA 2X3WD 3WXMB 4BE1A 1SRLA 4VUBA 2RQWA 4EMKA 3PNWC 1YNZA 4J9FA 3EG9B 1H641 1KC8U 5EG2A 1AHJB 4E7HA 5CVIA 2E5QA 1B3QA 2E5KA 2PVDB 4JUVA 3TSWA 1JBMA 3C0CA 3J81E 3MEWA 5GAOn 2KDSA 4M78A 5KH6A 4M7DE 3DKMA 4UC4A 1ACMB 2ZPBB 1M30A 2DRMA 4XTZA 3VU3C 3FJ5A 2KXDA 1VQ5Q 2P0PA 3EHRA 2DAQA 1Y07A 1MMAA 4BB7A 3A1PA 5CCAA 2EYWA 2DRKA 2R58A 4D8KA 3CMAA 3OA6A 2RJCA 3VS6A 1ABQA 4JZ3A 3VS3A 2RI3A 5FU7C 1KHCA 1W70A 3JCMb 2OTLQ 3QJYA 1UE9A 1MGQA 1N6AA 5LJ3f 1M90C 5DLOA 4PJOA 2RF0A 3QJ6A 3G4SQ 3I56A 4RTUA 2RD1A 1KSWA 3UA6A 4TVRA 1YIJA 3MP6A 3QO3A 1M5Q1 1NE8A 3GNFB 5GANd 2EAYA 4AG1C 1NJIU 1IXDA 1ZA2B 2M0YA 2DLPA 5LJ5e 2KNBB 4HT8A 3CCUQ 3RUXA 4JS5A 3FB9A 3JCMc 4C5IA 4J9EA 4ESRA 4Z88A 1OEBA 2FZKB 1TS9A 2HNIA 1VOMA 2H3EB 2DL3A 4IUPA 4MDXA 2KXCA 5DM7R 5GAN5 3M0UA 1QP3A 3PE0A 4NOYA 3X26B 4CRIA 1IGQA 3OW2P 2E6ZA 4N0AC 3M57A 2YUQA 3CC4A 3V7SA 1QCFA 3M54A 2F2VA 5M9OA 2AT1B 4X9DA 4E7IA 1UG1A 3JCMf 1VQNA 2K79A 1Y57A 3CC2Q 4GY5A 1VQOA 2H3JA 2HAXA 1D3BA 2KVQG 1NM7A 2QQSA 4LD9K 3G6EQ 2DYBA 1N27A 3H6ZA 4LUDA 2PUKB 4OMNA 3A5ZB 1NLPC 3OBWA 2WACA 1VQKT 1YHQT 1UB4A 1M4ZA 2H8HA 3VRZA 4C0FA 3JCMP 1K9MC 3JV3A 2K57A 3CCJA 2OTJT 1GBQA 2E3IA 1VQ6T 3SFMA 4PFPA 1HJDA 1U1TA 2E6NA 2QI2A 2V8KA 3E9FA 5IT9E 2CZ6B 2EKOA 1VQ4A 1OZ2A 2NUPB 4J9HA 4DBQA 2YLBA 1B34A 1SHGA 3M0SA 2J05A 4WTOB 1KQ1A 3CCMQ 3AT1B 1D0XA 1OI1A 3QWYA 2DZ9A 2JS2A 5GAMe 5LJ3h 3JB9J 5C0MA 3M5AA 2LQNA 4LUEA 2MMPA 4ELZC 4CC3A 1SSHA 1T3SA 4LDVA 3QPHA 5KYXB 1N8RC 1NPRA 3LWIA 3M0RA 3OQ5A 1K1ZA 5GAN6 3QYGB 2P4TA 2PTKA 2E64A 3M58A 4M75A 3CPWS 3D7SB 3TSZA 4IURA 2K6DA 2GCXA 1CSKA 2L3PA 3I55A 1VQPA 4M78F 3MKDA 3UPUA 2CREA 4M7AD 4HVUA 2AK5A 3CCVT 4EDUA 3HL8A 3FRNA 5LJ3g 1D09B 1O9SA 1FX7A 1Q82U 1KC8R 2AHJB 4N4IA 3RMQA 3OW2S 4M7AG 2WSCE 2QAZA 3OYJA 1UGQB 2ZPGB 3H41A 3QDRB 4HCCA 4C92C 5GAOp 1YBYA 2PUOB 4ZGJB 4C0GA 1W2BS 4BY6C 4ATOA 2EQKA 2RHYA 5FU7B 2DKGA 1I0CA 4OMFB 2MWPA 4OMPA 2V8IA 2DX1A 1QMCA 1PNJA 3RR6A 3UA7A 3MEUA 4KUIA 3ZBDA 2CUDA 3MO8A 3JCMh 4PJOF 3OMGA 2CP5A 1WHMA 1E6GA 4IUQA 2R5MA 1ZUKA 1Y71A 2LTOA 1O75A 2JNGA 4OGEA 1VQ7T 3LLRA 2RN8A 4FYWB 1UTIA 4KULA 2JTFA 4QQ6A 1YCSB 1UHCA 3EG9A 5HK0A 5I2SA 4M78D 1OZ3A 1KD1U 2VGNA 2XK0A 4ZNXA 2LX9A 1PHTA 1VQKQ 1UJYA 1YHQQ 3BY7A 5GMKe 3CPWA 3EGUA 4OP0A 4KGVB 1QCOA 3JCMg 2YUNA 1V76A 1Z9QA 4A54A 2ROLA 1S72T 1XJWB 4BUGA 3NTKA 3C94A 5AYFA 2LX7A 1NJIR 1VQ6Q 3REAB 3OW2A 3G71A 2JMCA 1VYVA 1MMNA 2F2XA 2PNIA 4HKEA 4KUDK 2B8AA 1UGRB 4PJOD 3EH1A 1ZA1B 2GTOA 3V8LA 3VRYA 1W2BA 1U5SA 4O6JA 2XMFA 2LJ0A 1TUCA 5GANe 5J3BA 2XG8D 3BFMA 4QQDA 2RI5A 1K76A 2VXEA 4PJOG 4E7JA 3L2RA 3VYHB 3QXEB 2F2WA 4FM4B 2MIOA 1RLQC 4RCCA 5IXFA 5HY6A 5KCHA 4LDUA 5IH2A 1HYOA 1WIEA 1RL2A 3I9QA 3RKYA 3GF5A 1VQLT 4AFZC 3PIPA 3EGXA 2ZPHB 1VQ5A 3UF4A 3CCLQ 1IB8A 2E65A 1LOJA 2BZXA 3J80E 2JXBA 4M77C 4J6WA 2VVKA 1YITT 3PFSA 1ZBXA 2LNHB 5LJ5d 3OYCA 3JCMV 2MK5A 1RI0A 1QQJA 1U3OA 3LGFA 3EFOA 1H3ZA 2D1XA 2DXTA 3MCAB 2M51A 2OTLA 1M90U 3QZ9B 2X4YA 1VQ8T 2OI3A 1LPLA 1WDXA 1WQWA 2EGAA 4M7DB 2CKKA 3G4SA 4HVVA 2KRNA 3META 1U8RA 3M9QA 1K73C 1QKWA 1MNDA 2DJZA 4A63B 2LP5A 2C0OA 1VQ9T 1JJ2S 4M7DG 4FCYA 4HVWA 2A0FB 3R6NA 3LH0A 1QVPA 1MV0B 4ZTJA 1B7TA 1E7OA 1WJQA 3TU4K 2ATCB 4RCBA 3CCUA 2E3HA 1A0NB 4KH0B 1VQ7Q 4M75F 1IRXA 2PZ1A 3OS2A 1SEMA 3MHXA 2D6FA 1WHKA 3REBB 4RTYA 5D7UA 3PVQA 2EPDA 4FYXB 3A8LB 2DERA 1QW1A 4BI8B 1J3TA 2MOXA 1AEYA 3LW5E 3I5RA 1ZLMA 3GBQA 1Q7YC 2M0OA 4RTZA 4AFSC 3CMET 1S72Q 3OYHA 3CC2A 3BDUA 2NUPA 1QWEA 3NHNA 1M27C 3RIRA 1EIFA 4JZ4A 2DXUA 2JZ2A 1JQQA 3CCRT 2W0ZA 3G6EA 2YUOA 1WPYA 1ZSZA 3C95A 4AMCA 1NPPA 1K9MU 2CZ1B 3X28B 2DL4A 4WCIA 5LJ3j 4OMLA 1JJ2A 2YLCA 1RUWA 2YSQA 3H0HA 2D0QB 4WF2A 5C6SA 2AKKA 5KYXA 1YI2Q 4EMGA 1X01A 5EC7A 1AWJA 1KQ2A 4LNPA 2AZSA 2XICA 1PWTA 3QUIA 2DJQA 1OU9A 3SEMA 4A53A 1G3SA 2QTVA 4PLIA 1WXUA 2RQUA 2F1LA 4EPCA 1RAGB 3M0TA 4M7AA 2MCNA 1AWXA 1M1FA 1SG5A 4IIOA 3EH2A 2JTEA 5HK3A 4E7SA 1M3BA 2FZCB 1AD5A 2G3RA 2O4XB 1YITQ 1Q95G 1C6VX 1OU8A 1WZOA 1YWOA 2ECZA 3CCMA 3CCSQ 2HKQB 3OSSC 3S6WA 1VQMT 2ZAEA 2RQTA 5CQXA 1AZEA 2ZPIB 1N8RU 3FIFA 2PVOB 4FYVB 1VQ8Q 2OAUA 3GLXA 5HCKA 2JMAA 2EJFA 2JUFA 1TH7A 2P0QA 1G5VA 3LGLA 2BTTA 5I21A 4F04B 5GJWB 3PVLA 1AWOA 2ZGWA 3DLMA 2D0NA 4L6V5 2W10A 1VQ9Q 1GCQA 6AT1B 4C0DC 3X25B 2L0AA 5CKFA 4V2SA 1UECA 5GAOq 4JPBW 2YRDA 4J6YA 4M77B 1M8MA 4DEYA 2PQWA 4IUVA 1IZ6A 4J9BA 2EGEA 3OYNA 1RADB 2XHCA 3M4GA 3JCMJ 2E10A 2P4RA 1WQ7A 3TQ7P 5A0LA 3UT1A 2K4YA 1WJRA 1X27A 5KYUB 4AT1B 2LDMA 3QG1A 4ZGEB 2GGRA 1KK7A 4BDYA 2BZ8A 3VS0A 1W4SA 1K4US 1N5ZA 2JM8A 2MWOA 3EAEA 3KFVA 1OX8A 3CMEQ 3V8JA 2KGTA 1KIKA 1KHIA 2L3QA 3R6OA 3CCQT 5CKDA 3L2QA 2LQKA 1H8KA 4MZPA 4HCBA 1BK2A 2FVUA 2VC8A 2DETA 3E9GA 1GRIA 3SB2A 3CCRQ 4EMKC 2FPEA 1WHGA 1LVKA 1M90R 1VQKA 5CO7A 1IHWA 2MPXC 4C92E 1YHQA 3CPWP 1VA7A 4XTYA 1NG2A 3MJXA 1TG0A 3A98A 3QIIA 2YXYA 3M56A 4RTTA 3TREA 2DEQA 2RHXA 4II1A 1PCXA 2DD5A 2CP0A 4M78C 3QSUA 2L5QA 4JRPA 2KMTA 3J7AF 1JXMA 1VQ6A 2VWFA 1Y0MA 1U06A 5GAN8 3OYMA 5FRNA 1W2BP 4PFZA 3EG0A 1TUGB 2BIVA 5KYYA 2DVJA 3JAME 2LNVA 4BE0A 2VV5A 3VUZA 5KYWB 4YTLA 4M7DA 1D1BA 2LMJA 2FG0A 2RI2A 2DBMA 2JVVA 1UEBA 3NMZC 2YWWA 5CKBA 4PJOC 2RH2A 1VQMQ 2A37A 3OYEA 2JJ9A 1JXOA 2WSEE 2OX7A 3MP1A 4ZTFA 3S3NA 3OYFA 3I56T 3M59A 1M1GA 4ZN1A 3OS1A 2R5AA 1QVFS 2DZCA 2QDLA 3CCLA 2HL3A 1NYGA 3QKJA 4HCKA 1R0BG 3BE3A 1YIJT 2XDPA 4EMHA 1BI1A 1M9SA 4M4ZA 2COWA 2RHZA 3BDLA 2HBWA 2EGCA 2F5KA 4L5GA 1K9MR 2NUTB 4M7AF 1PKTA 2SRCA 1OYXA 3PMIA 1I07A 3S3OA 4C5GA 2MI6A 4QVCA 2RQRA 1D1AA 1KFZA 1WXTA 4Y91A 1SSFA 5AT1B 1K73U 4BI3A 4R0KA 3CC4T 2FPDA 4F7UB 5GAMf 1VIEA 1OQKA 2MF2A 4JDSA 1S1NA 4J7IA 4M77E 3JB9F 1WI7A 1VQNT 4NL3A 3M4YA 3RKWA 1LJOA 1SHFA 2SEMA 5CKEA 2XDBA 5KE3A 1VQ7A 3KBGA 3CCQQ 2E12A 4LD6A 2A3LA 1Q86C 1M2VB 4LDYA 3SWNA 3PIOA 1R8OB 1VYTA 2HL5C 4C0DB 3L2WA 3KXTA 1N8RR 2QXFA 4OB0B 4XTWA 2RPNA 3HP9A 3CQTA 1G3WA 2KE9A 1QVGS 2Y90A 1Z9ZA 4HT9A 4Y28E 4DEXA 1Y96B 2RK1A 2AZVA 3CCJT 1LNXA 1S72A 2CT4A 2QDYB 1TXQA 1DJ7B 2DD4A 3VS7A 1I8FA 1YJNT 3JB9H 2HEQA 1EFNA 4PNOA 2O2OA 4JLGA 1MHNA 1XOVA 2L89A 2O4XA 4Z89A 3JB9D 3QHSA 2RNAA 4BACA 5CQYA 4B9XA 1G3YA 1HK9A 1FMWA 2DTHA 1BBZA 1F1BB 2HD0A 2CP3A 1JJ2P 4NL2A 3S3MA 4LXCA 3JB9G 2CSQA 2QASA 1WNLA 1C0MA 1YI2A 1TTHB 3UDCA 1GBRA 1MV3A 4JLIA 9ATCB 2HSPA 1WGSA 4CI0C 5HKCA 2DMOA 4PKCC 4CC7A 2KEAA 5D6XA 3A8GB 1I1JA 1BI2A 4M75C 8ATCB 1RAHB 4XU2A 5IAYA 4F16A 2RO0A 3PTAA 1YJWA 2XD0A 3H0IA 1W6XA 2LCSA 3CD6T 3WVDB 1VUBA 1YN8A 3I55T 2RJDA 3VUBA 1YITA 2MYSA 1QVGA 2VGMA 4M77A 4OMQA 2OTJQ 3ER0A 4ZN3A 2RJEA 4RTXA 3X20B 4BE2A 2RHUA 3CCSA 1I81A 1HXDA 4C8QC 3UATA 1TOVA 1AZGB 2EJ9A 5GANf 2VASA 4D6WA 4PL6A 3MEAA 1VQ8A 3E1SA 5FU6C 5KYUA 1IHVA 5FRMA 2R57A 3ULRB 2JTMA 4C5HA 4B9WA 5GAMh 2HMAA 2YRVA 4M7DF 2GF7A 3HTRA 1PD0A 2ZPFB 1X2QA 3CC4Q 1X43A 1BI0A
chains in the Genus database with same CATH topology
1BI3A 2CZ0B 2X4XA 3QJ6A 3RKXA 4N4GA 3I56A 1VQ9A 2RD1A 1NPPA 1BKBA 2CZ1B 3CBOA 3HPWA 3X28B 4E7LA 1K9MU 2EIFA 5LJ3j 2O01E 3TCJA 2EQMA 4XU0A 5LJ5h 4A4GA 1JJ2A 2YLCA 1QVFA 4ZGDB 4TVRA 1YIJA 4WF2A 1BIAA 2D0QB 5C6SA 5GAOl 2LQ8A 3MP6A 3QO3A 2E41A 3QYHB 3HRTA 3VJPA 1M5Q1 1NE8A 3GNFB 4FIBA 5GANd 4XQ3A 4EMGA 1XNIA 1ZQ1A 1X01A 2EAYA 2QQBA 4F7UE 1NJIU 1PSFA 3CCLT 1QP2A 1KQ2A 4ME7A 2XICA 3HFOA 3V7RA 4R56A 5GAN7 2RHIA 3QUIA 2RA2A 3OY9A 1Q7YU 3LX7A 5LJ5e 3ZEHA 1K8AU 4HT8A 4A53A 5GAMg 3RUXA 4MMLA 1G3SA 4JS5A 1BYMA 4PLIA 3FB9A 1KC8C 3JCMc 4C5IA 3CD6A 2DK3A 3OYIA 5LJ3d 4A4EA 2HNIA 4EPCA 4IUPA 2JN0A 3SD4A 4X34A 3L42A 2RK2A 4M7AA 4MDXA 2LC4A 2KAFA 2VXFA 4M7AB 1M1FA 3PMTA 5DM7R 4RMOA 5GAN5 5LJ5g 1QP3A 4NOYA 4MDWA 3X26B 4CRIA 3Q1JA 5HK3A 5GAN2 2E6ZA 4QVDA 2G3RA 2O4XB 3M57A 4N0AC 4OGCA 1VQ4T 3FDRA 3CC4A 2WSFE 3V7SA 2DTOA 3M54A 4C8QA 3CMEA 3CCMA 5M9OA 4M7DD 1P92A 1Q81U 3G71T 3OSSC 3QBYA 2LCCA 3L2ZA 4X9DA 3S6WA 1VQMT 4XTUA 5DLQE 4E7IA 4XTVA 5CQXA 3JCMf 1VQNA 1UGSB 2ZPIB 1N8RU 3FIFA 2PVOB 2DVEA 4GY5A 2OAUA 4Q5WA 3GLXA 1VQOA 4HA8A 4C0ZA 3OYDA 4A4HA 2EJGA 2H3JA 2K5FA 4EMKB 2HAXA 2EJFA 1D3BA 2JUFA 2KVQG 1TH7A 3NFCA 3V7CA 2P0QA 2QQSA 5GAN4 4LD9K 1G5VA 2L8DA 2DTIA 1N27A 3H6ZA 3LGLA 2PUKB 5I21A 3A5ZB 4J83A 3A8HB 3GP8A 2HBPA 2DIQA 3OBWA 2WACA 2ZPEB 1VQKT 2ZGWA 1VQLA 3DLMA 4FSXA 2K2VA 4L6V5 5CKHA 1YHQT 1Y7XA 3GIBA 1UB4A 2YHTA 3SWNC 2L3RA 1M4ZA 4X9CA 1JRIA 2QQRA 5A0DA 5GAN3 4C0FA 4C0DC 3JCMP 5GMKh 1K9MC 3CCET 5CAIA 3X25B 5CKFA 3CPFA 4M78B 4V2SA 1VQPT 2K57A 3INZA 2CGHA 5GAOq 1VQ5T 3CCJA 4J6YA 1N9RA 4M77B 3L2UA 1YJ9T 2OTJT 3OYGA 1NJIC 3SFMA 1VQ6T 2PQWA 4M78G 2M16A 1IZ6A 4IUVA 4RG8A 2EWNA 1U1TA 3H8ZA 1K8AC 2E6NA 3OYNA 4IUUA 2XHCA 2QI2A 2V8KA 3E9FA 3M4GA 2RM4A 3JCMJ 2Y4YA 2K3YA 4C92B 5IT9E 2E10A 1WQ7A 2CZ6B 4BY6B 5A0LA 1M8VA 2EKOA 1VQ4A 3UT1A 1OZ2A 2K4YA 4QQGA 1WJRA 2VUBA 2LDMA 1M1KU 3QG1A 4ZGEB 4BI4A 4BDYA 2YLBA 5GANh 2FB7A 1W4SA 1B34A 2OTLT 2QQAA 4J7FA 1NZ9A 2MWOA 5A0GA 1BIBA 3EAEA 1VQMA 3OYAA 1KQ1A 2FHDA 4M78E 3V8JA 5LL6S 2F5TX 1XTDA 2EYQA 1Q82C 4PJOB 1KHIA 3R6OA 3CCQT 5GMKm 2QQ9A 5CKDA 1OI1A 2LQKA 4MZPA 3HRSA 3L2QA 2DZ9A 4O5VA 5GAMe 4HCBA 4RKUE 1Q81C 5LJ3h 3JB9J 5C0MA 3M5AA 2FVUA 3CC7T 2VC8A 4JRIA 2MMPA 4ELZC 3A8OB 3E9GA 3MP8A 3SB2A 2RB6A 4EMKC 3JCMW 3RESA 4XU3A 4LDVA 3QPHA 1X6OA 4L59A 1YI2T 1N8RC 3PT9A 3CEYA 1VQKA 5CO7A 2ZZDA 3FLGA 2LRQA 1NPRA 4BDZA 4C92E 3LWHA 3LWIA 4OB2B 1YHQA 2LCLA 3OQ5A 4XTYA 4LDWA 5GAN6 2EQJA 3QYGB 4J5YA 2P4TA 5GANg 3P8HA 2E64A 4OF1A 2PU9B 3M58A 4M75A 3CCEA 3QIIA 3CPWS 3M56A 3N5BB 4IURA 4M75B 3TREA 2GCXA 3M55A 2DEQA 3I55A 2RHXA 3URGA 3QZ5B 1VQPA 4II1A 4M78F 3JRZA 2DD5A 2DIGA 3UPUA 2KSSA 4M78C 3QSUA 2L5QA 4JRPA 4M7AD 2KMTA 2M1HA 4GLKA 3CCVT 3J7AF 5FLXE 4EDUA 1YJWT 3RERA 2X4WA 1YJ9A 1G3TA 3P8BB 3HL8A 1VQ6A 5GMKi 3FRNA 4M77F 5LJ3g 3CBPA 2RJFA 5FROA 1O9SA 1FX7A 4N4HA 1Q82U 1Y96A 2AHJB 4N4IA 3RMQA 3OW2S 3EFSA 4M7AG 2WSCE 3OYJA 3PGGA 1UGQB 2ZPGB 2LT1A 4C8QB 5GAN8 3OYMA 3GNGA 2QA4T 5FRNA 3V8KA 4C92F 3CCST 3QDRB 3SDZA 4HCCA 1KG1A 4C92C 5GAOp 4XTXA 2BKDN 1YBYA 2PUOB 4ZGJB 2DXCA 2XI9A 4FU6A 4BY6C 4C0GA 2FL7A 1W2BS 4ATOA 2BIVA 2EQKA 2XU8A 4DA4A 1FXXA 2RHYA 5FU7B 3JAME 2EFIA 3CCRA 2DKGA 3CC2T 2LNVA 4OMFB 2MWPA 2XKOC 5IN1A 4BE0A 2V8IA 2VV5A 3VUZA 5D6YA 1I5LA 4YTLA 3ZBDA 3MEUA 4KUIA 4M7DA 1D3BB 2RI2A 3MO8A 3JCMh 2JVVA 4PJOF 1Q86U 1M1KC 3OMGA 3JCMX 4M7AE 1UEBA 4PJOC 5CKBA 3OS0A 4DOWA 2RH2A 2R5MA 4IUQA 1Y71A 1WJSA 2LTOA 3OYEA 2WSEE 1O75A 3GPLA 2JNGA 4OGEA 3CC7A 1V29B 3MP1A 3JB9I 1VQ7T 3E19A 4M7DB 3LLRA 4ZTFA 3S3NA 3OYFA 3I56T 2X35A 3FEOA 3M59A 1M1GA 4ZN1A 3OS1A 2R5AA 4OVAA 1QVFS 3EFRA 4KULA 2DZCA 5J39A 2JTFA 2CS7A 3CCLA 2I2LA 3ASKA 5GMKl 2DXBA 3CXCS 3QKJA 4KBMB 4QQ6A 1YIJT 2E70A 3NTIA 2XDPA 4DQ2A 4EMHA 5I2SA 4M78D 1BI1A 1OZ3A 3NTHA 1KD1U 1M9SA 2VGNA 4MMKA 2XK0A 3JCMd 4XK8E 4DOVA 2LX9A 2Y4XA 2RHZA 3BDLA 2C06A 2EQUA 4RG2A 4M77D 2F5KA 3BY7A 5GMKe 3F70A 3CPWA 4L5GA 3OYKA 4OP0A 3JCMg 4E7KA 4M7AF 2BUDA 4XAXB 4KT0E 4QVZA 4MZTA 4A54A 4M7AC 1S72T 2HQXA 4M77G 4IUTA 1OYXA 3HRUA 3FJPA 4BUGA 3NTKA 4C92D 2GQVA 3PMIA 3S3OA 3C94A 5AYFA 2MI6A 4C5GA 4QVCA 3JCMQ 5KCOA 2QEXT 4MZMA 4N0AA 3ZFJA 1FWZA 2GFUA 2PVGB 4E47A 4Y91A 1SSFA 2QA4A 3OW2A 4C8QF 4C92G 1B34B 1K73U 3G71A 1KQSS 4BI3A 4F7UA 2K5LA 3CC4T 4KUDK 4XU1A 4HKEA 4F7UB 4A4KA 2B8AA 5GAMf 3CCMT 1UGRB 2M9UA 4PJOD 1VIEA 3O8VA 3G4ST 3V8LA 2MF2A 4QW2A 1W2BA 4JDSA 5J26A 3OB9A 4O6JA 4J7IA 2KK4A 5GANe 4M77E 5J3BA 3AHUA 2XG8D 5GAMj 4FT2A 1UGPB 3JB9F 3BFMA 3RMSA 4QQDA 2RI5A 3BW1A 1VQNT 4NL3A 2VXEA 4PJOG 4E7JA 3M4YA 3G7ZA 3RKWA 1LJOA 1X75C 3C4SA 3L2RA 5LJ5f 3VYHB 3QXEB 5CKEA 2K5IA 4FM4B 2XDBA 2FYKA 2K3XA 5KE3A 4RCCA 3HFNA 1VQ7A 5HY6A 1YCYA 2X4JA 4A4FA 4JS4A 3P8DA 3KBGA 5KCHA 4LDUA 5LJ3e 5LJ5j 2LVMA 2E12A 3CCUT 4LD6A 2A3LA 1Q86C 4LDYA 3SWNA 1RL2A 2KQWA 3PIOA 1IREB 3RKYA 2VYTA 3GF5A 4ELYC 2CYZB 3SWNB 4M75D 1R8OB 4OB3B 1VQLT 3PIPA 3VV0A 3OS5A 3DB3A 4C0DB 2ZPHB 3L2WA 3L1AA 3KXTA 3CXCA 2QXFA 4OB0B 4XTWA 5GAMd 3HP9A 1VQ5A 3HHTB 5I2MA 4PJOE 1G3WA 2V8JA 2OTJA 2E65A 4PLLA 4M75G 2E1HA 1LOJA 2D9TA 3DLLA 1QVGS 2Y90A 3J80E 3OYYA 3X24B 3OBYA 4J6WA 4M77C 4P5NA 4HT9A 1YITT 4Y28E 1JB0E 3OMCA 5CIUA 1KD1C 3PFSA 1Y96B 2RK1A 3CCJT 1ZBXA 5KE2A 1LNXA 4OB1B 1S72A 5LJ5d 2XDDA 3OYCA 3JCMV 4JJNK 4C8QD 2QDYB 1RI0A 1DJ7B 2DD4A 3LGFA 1VIFA 4HCZA 1I8FA 1YJNT 2DPPB 2QEXA 3JB9H 1H3ZA 2DXTA 2QTXA 3CMAT 5FU6B 3MCAB 4PNOA 3A8MB 5GAOr 4JLGA 1MHNA 2OTLA 5HK0A 1XOVA 2L89A 4C8QG 2O4XA 3QZ9B 1M90U 2X4YA 1VQ8T 3MEVA 4M75E 3HSBA 3UWNA 3JB9D 1WQWA 3QHSA 4BD3A 4F7UF 2CKKA 2XIDA 1PSEA 3G4SA 2P0KA 5CQYA 4B9XA 4BACA 1G3YA 3CCQA 1HK9A 3G6ET 3L2VA 2A7YA 2NLUA 3META 2IG0A 2DTHA 3TEEA 2HD0A 1U8RA 2GFAA 3HKSA 3C12A 4NL2A 2IVWA 3M9QA 5D6WA 3JSCA 5GAOm 3S3MA 3JB9G 1K73C 1N9SA 2DJZA 2CZ7B 3DB4A 5DY9A 1VQ9T 1JJ2S 1WNLA 2JOYA 4M7DG 3WXMB 4BE1A 2MAMA 4VUBA 1ZHIA 3UDCA 2KY9A 4EMKA 3GOXA 1YI2A 3JCMe 4JLIA 4C8QE 2LT4A 1WGSA 4CI0C 3PNWC 3CBMA 4IKFA 3LH0A 1QVPA 5HKCA 4ZTJA 4C5EA 1H641 1WJQA 3OYLA 3TU4K 4PKCC 5EG2A 1KC8U 1AHJB 3KUFA 4RCBA 3CCUA 4E7HA 5CVIA 3OSVA 3M53A 3OYBA 2E5QA 5D6XA 3A8GB 4M75F 5A2QE 2PVDB 4JUVA 3OS2A 4FT4A 1BI2A 4M75C 5GMKj 4XU2A 5IAYA 4NS5A 3MHXA 2RO0A 2D6FA 1JBMA 3VYGA 3J81E 3MEWA 3PTAA 3CCVA 5GAOn 1YJWA 2KDSA 4LDXA 4M78A 5KH6A 3LYIA 2XD0A 3CD6T 3WVDB 3DKMA 4M7DE 5CR2A 1VUBA 3I55T 4UC4A 2RJDA 1XQHA 2ZPBB 4XTZA 3A8LB 3VU3C 3VUBA 1QW1A 4BI8B 1YITA 1QVGA 2VGMA 2P0PA 5L8RE 4M77A 3WVEB 2DAQA 3ER0A 1Y07A 3LW5E 4BB7A 4ZN3A 2RJEA 3X20B 4BE2A 2RHUA 4J6XA 1I81A 3CCSA 1HXDA 4C8QC 5CCAA 1I4K1 1YJNA 1Q7YC 4JRQA 2R58A 2M0OA 4R55A 3CMET 2EJ9A 2HQEA 2DO3A 4C92A 4D6WA 2RJCA 5GANf 3OYHA 3OA6A 3CMAA 1KQSA 4PL6A 3CC2A 2F69A 3MEAA 3BDUA 5CK9A 1VQ8A 4Z02A 3E1SA 3ME9A 5FU6C 1U1SA 3VKIA 3FC3A 2RI3A 5FU7C 1KHCA 5GANj 4FL6A 2R57A 3RIRA 2JTMA 1EIFA 4C5HA 2DXUA 5FRMA 3JCMb 4F7UG 2JZ2A 4JRKA 4B9WA 5GAMh 3QJYA 4J8OA 3T9NA 3CCRT 2YRVA 3G6EA 4M7DF 2GF7A 1WPYA 1VQOT 2ZPFB 2ZCFB 1GXIE 4M7DC 1MGQA 1N6AA 5LJ3f 1M90C 1BI0A 5DLOA 3C95A 4PJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM X;  4M7A E;  4PJO C;  1Y96 B;  3RKX A;  4M78 G;  2RD1 A;  1LNX A;  2EWN A;  5LJ5 d;  1U1T A;  3JCM V;  4C8Q D;  5LJ3 j;  3JB9 I;  4XU0 A;  5LJ5 h;  3M4G A;  3JCM J;  2RM4 A;  2YLC A;  4C92 B;  1I8F A;  3JB9 H;  2E10 A;  3EFR A;  1WQ7 A;  2DXT A;  1BIA A;  4WF2 A;  2DZC A;  5GAO l;  2QTX A;  3QO3 A;  1M8V A;  2E41 A;  2I2L A;  4PNO A;  5GMK l;  5GAO r;  1M5Q 1;  5GAN d;  4C8Q G;  4XQ3 A;  4DQ2 A;  4EMG A;  2EAY A;  4EMH A;  1X01 A;  4M78 D;  4F7U E;  1KQ2 A;  4MMK A;  2YLB A;  4M75 E;  5GAN h;  2FB7 A;  1B34 A;  3V7R A;  3HFO A;  3JCM d;  3JB9 D;  3HSB A;  1WQW A;  3QHS A;  5GAN 7;  3QUI A;  2RA2 A;  5LJ5 e;  1BIB A;  4PJO F;  4F7U F;  4HT8 A;  4M7D B;  4A53 A;  5GAM g;  3RUX A;  1KQ1 A;  4M77 D;  4MML A;  1HK9 A;  3BY7 A;  4M78 E;  3V8J A;  5GMK e;  4PJO B;  3FB9 A;  2DTH A;  3JCM c;  4OP0 A;  4NL2 A;  3JCM g;  5GAO m;  5LJ3 d;  5GMK m;  3JB9 G;  4M7A F;  2HNI A;  1N9S A;  4A54 A;  2DJZ A;  4M7A A;  2DZ9 A;  2JN0 A;  5DY9 A;  5GAM e;  4M7A C;  5LJ3 h;  2VXF A;  1WNL A;  4M7A B;  3JB9 J;  4M77 G;  4M7D G;  2VC8 A;  4JRI A;  3FJP A;  4C92 D;  5GAN 5;  4EMK A;  3SB2 A;  3JCM e;  2RB6 A;  4EMK C;  4JLI A;  3JCM W;  3RES A;  5LJ5 g;  4NOY A;  4XU3 A;  4C8Q E;  4QVC A;  3JCM Q;  4HT9 A;  5GAN 2;  4N0A A;  4QVD A;  1H64 1;  4N0A C;  4Y91 A;  4RCB A;  4C92 E;  4C8Q F;  3V7S A;  4C92 G;  2DTO A;  1B34 B;  4C8Q A;  4XTY A;  5GAN 6;  4J5Y A;  4F7U A;  4M7D D;  4M75 F;  5GAN g;  2E64 A;  4XU1 A;  4JUV A;  4M75 A;  4F7U B;  5GAM f;  4M75 C;  5GMK j;  4M75 B;  4XU2 A;  4PJO D;  2DEQ A;  3L2Z A;  4X9D A;  3V8L A;  1JBM A;  4XTU A;  4XTV A;  4M78 F;  3JCM f;  5GAO n;  4M78 A;  5GAN e;  4M7D E;  4M77 E;  3AHU A;  3FIF A;  5GAM j;  4M78 C;  3QSU A;  2DVE A;  3JB9 F;  4M7A D;  3BFM A;  4HA8 A;  3BW1 A;  4XTZ A;  2EJG A;  3VU3 C;  2VXE A;  4PJO G;  4NL3 A;  4EMK B;  3RER A;  2EJF A;  1D3B A;  5GMK i;  4M77 F;  5LJ3 g;  3RKW A;  1LJO A;  4M77 A;  1TH7 A;  3V7C A;  5LJ5 f;  5GAN 4;  2DTI A;  1Y96 A;  2FYK A;  4RCC A;  3HFN A;  3EFS A;  5I21 A;  4M7A G;  1YCY A;  4J6X A;  1I81 A;  1HXD A;  4C8Q C;  2ZGW A;  3PGG A;  4C8Q B;  5LJ3 e;  1I4K 1;  5LJ5 j;  5GAN 8;  3V8K A;  4C92 F;  3SWN A;  2EJ9 A;  4M77 B;  4C92 A;  5GAN f;  3GIB A;  2YHT A;  3RKY A;  3SWN C;  4C92 C;  4X9C A;  3SWN B;  4M75 D;  1JRI A;  4XTX A;  5GAN 3;  5GAO p;  3BDU A;  3JCM P;  5GMK h;  1U1S A;  5CAI A;  3L1A A;  4XTW A;  5GAM d;  5GAN j;  2DKG A;  4M78 B;  4V2S A;  3RIR A;  2DXU A;  4PJO E;  3JCM b;  4F7U G;  5GAM h;  4JRK A;  2E65 A;  2K57 A;  3INZ A;  1I5L A;  4M75 G;  2E1H A;  1LOJ A;  2CGH A;  4M7D F;  1WPY A;  2Y90 A;  5GAO q;  4M7D A;  1D3B B;  4M7D C;  1MGQ A;  4J6W A;  4J6Y A;  1N9R A;  4M77 C;  5LJ3 f;  3JCM h;  4PJO A; 
#chains in the Genus database with same CATH topology
 1BI3 A;  2CZ0 B;  3RKX A;  5FW9 A;  1VQ9 A;  3CBO A;  2EIF A;  2O01 E;  2EQM A;  1KJW A;  4XU0 A;  7AT1 B;  1WFW A;  1HD3 A;  3G1J A;  4ZGD B;  2D8J A;  1BIA A;  1VQN Q;  5IHI A;  2E41 A;  1V1C A;  4FIB A;  1XNI A;  2EQI A;  4F7U E;  1PSF A;  1QP2 A;  2O31 A;  1SPK A;  3HFO A;  4R56 A;  3LX7 A;  3ZEH A;  2V1R A;  2HKN A;  5GAM g;  4MML A;  1BYM A;  3LH5 A;  4Z8A A;  1NYF A;  1TSF A;  5LJ3 d;  1MNE A;  3SD4 A;  3L42 A;  2KAF A;  3PMT A;  4RMO A;  3CCV Q;  2DA9 A;  3U23 A;  4MDW A;  2HDA A;  5GAN 2;  1VYU A;  4QVD A;  4OGC A;  3VS4 A;  2I0N A;  2JS0 A;  1QLY A;  3CME A;  1T0J A;  3H9N A;  4AFQ C;  4M7D D;  1P92 A;  1GFD A;  3G71 T;  2LCC A;  1YJN Q;  1WYX A;  1X6G A;  4LN2 A;  2LQW A;  2DVE A;  2EYZ A;  2KRS A;  4PJM A;  1K0S A;  4A4H A;  2EJG A;  5I22 A;  4PFO A;  1PRM C;  3V7C A;  5GAN 4;  2DYI A;  3GP8 A;  1K73 R;  2HBP A;  2ZPE B;  2DFU A;  5CKH A;  1Y7X A;  2L2P A;  1OPK A;  2YHT A;  4X9C A;  5A0D A;  1NEB A;  5GMK h;  1QKX A;  3CCE T;  2HSE B;  3CPF A;  3EG1 A;  1CKB A;  1OX9 A;  2NWM A;  1VQ5 T;  3I35 A;  2AIR B;  1N9R A;  1YJ9 T;  1NBE B;  4DBR A;  2Z0W A;  2NUT A;  2EWN A;  1K8A C;  2VB6 A;  3EHQ A;  3CD6 Q;  2RM4 A;  2ABL A;  2Y4Y A;  4EIK A;  4C92 B;  4BY6 B;  2COZ A;  4QQG A;  1RAI B;  1NLO C;  4BI4 A;  5GAN h;  2FEI A;  2OTL T;  2QQA A;  1NZ9 A;  1Q7Y R;  1K8A R;  5A0G A;  1BIB A;  4JJB A;  1FMK A;  1VQM A;  3EG2 A;  4M78 E;  1ZX6 A;  5LL6 S;  2F5T X;  2FRW A;  2EYQ A;  1Q82 C;  3NPF A;  2NYS A;  2O9S A;  3EGD B;  1Q81 C;  3CC7 T;  5ECA A;  1YWP A;  4JRI A;  3MP8 A;  3JCM W;  3RES A;  4XU3 A;  4L59 A;  5L23 A;  2DEU A;  3CEY A;  2ZZD A;  3FLG A;  1WA7 A;  3LWH A;  1GCP A;  4OB2 B;  2LCL A;  1X2K A;  2EQJ A;  2K7A A;  4J5Y A;  2J06 A;  1PC0 A;  1M2V A;  3P8H A;  5GAN g;  4OF1 A;  2PU9 B;  2QGF B;  3N5B B;  1VQL Q;  4M75 B;  1MMD A;  3URG A;  2DIG A;  1K0X A;  4GLK A;  2G6F X;  3RER A;  2X4W A;  2V26 A;  3P8B B;  2HQH A;  5GMK i;  4M77 F;  3CBP A;  5FRO A;  4E7Z A;  4N4H A;  1Y96 A;  3PGG A;  4C8Q B;  4GBQ A;  2LT1 A;  3GNG A;  1PG5 B;  2QA4 T;  3V8K A;  2X51 A;  1T3L A;  2DXC A;  2FL7 A;  3RNJ A;  2XU8 A;  4DA4 A;  2DM1 A;  1FXX A;  3CC2 T;  4B6M A;  2XKO C;  5IN1 A;  2J6K A;  2CP6 A;  1I5L A;  3H0F A;  2KRM A;  1Q86 U;  1M1K C;  2QYZ A;  1H3H A;  1ZSZ C;  3EG3 A;  3G71 Q;  4DOW A;  2FO0 A;  1WJS A;  3GPL A;  1QVF P;  1MMG A;  2KI7 A;  3E19 A;  3FEO A;  1UUE A;  2KYM A;  4F14 A;  2RQV A;  3EFR A;  2CS7 A;  2I2L A;  3ASK A;  1WHJ A;  2DXB A;  2E70 A;  4DQ2 A;  1M1K R;  4MMK A;  4J9D A;  2Y4X A;  1HSQ A;  4DBH A;  2C06 A;  3I5S A;  4RG2 A;  4M77 D;  3F70 A;  2GTJ A;  3E2U A;  4E7K A;  3CCE Q;  2BUD A;  4KT0 E;  4QVZ A;  4MZT A;  4M7A C;  4M77 G;  4IUT A;  2GQV A;  2CH4 W;  2DIL A;  1PD1 A;  3JCM Q;  1RLP C;  2QEX T;  4N0A A;  3ZFJ A;  1YJ9 Q;  2GFU A;  4E47 A;  2VKN A;  1IO6 A;  4D8D A;  2EYY A;  2JW4 A;  1KQS S;  4A4K A;  3CCM T;  2M9U A;  1WLP B;  3O8V A;  4DBF A;  1OOT A;  2ESW A;  4KH1 B;  5J26 A;  3OB9 A;  2FZG B;  4E6R A;  2KK4 A;  2YT6 A;  2C0T A;  5GAM j;  2X9H A;  2K3B A;  3BW1 A;  2FRY A;  3G7Z A;  1X75 C;  3C4S A;  5LJ5 f;  1ZUU A;  2L3S A;  3HFN A;  1K9A A;  1YCY A;  1ZSG A;  4A4F A;  5LJ3 e;  1OPL A;  1UHF A;  2KQW A;  3CC7 Q;  2QK0 A;  1GCQ C;  3OS5 A;  2J7I A;  2J6F A;  3DB3 A;  3VV0 A;  3EGX B;  3L1A A;  1QVG P;  1I5O B;  3HHT B;  5I2M A;  2OTJ A;  3ZL7 C;  4PLL A;  2D9T A;  3OYY A;  3X24 B;  3OBY A;  4P5N A;  3OMC A;  5KYN A;  1YFN A;  2BE7 D;  5I11 A;  2AKL A;  4JJN K;  2CUB A;  1W1F A;  3VS1 A;  4AG2 C;  1VIF A;  2BE9 B;  1M3C A;  4HCZ A;  2DPP B;  3EFO B;  1G2B A;  3CMA T;  2ED0 A;  1QCN A;  2DE0 X;  4PJN A;  3MEV A;  4M75 E;  4RUG A;  3UWN A;  1RI9 A;  4BD3 A;  1UJ0 A;  4F7U F;  1KQS A;  2QA4 Q;  2DL8 A;  3L2V A;  2A7Y A;  2NLU A;  2IG0 A;  4OMM A;  4X1V A;  3C12 A;  5GAO m;  1N9S A;  2CZ7 B;  5DY9 A;  2MAM A;  1ZHI A;  2GQI A;  2KY9 A;  3GOX A;  2CDT A;  3JCM e;  4E2F B;  4C8Q E;  2LT4 A;  3CBM A;  4IKF A;  4C5E A;  3OYL A;  3KUF A;  3OSV A;  3M53 A;  3OYB A;  4PJJ A;  4AFU C;  5A2Q E;  2OJ2 A;  2B86 A;  4FT4 A;  5GMK j;  1JEG A;  4NS5 A;  2X3X D;  2ED1 A;  3VYG A;  3CCV A;  4LDX A;  2QGG A;  1M2O A;  3LYI A;  1H92 A;  1AOJ A;  5CR2 A;  1C1A A;  1R0C B;  1XQH A;  1TU0 B;  1LCK A;  2EBP A;  2O88 A;  5L8R E;  3WVE B;  4FW2 A;  4J6X A;  3M0P A;  5FWB A;  1X69 A;  4J9G A;  1I4K 1;  1YJN A;  4JRQ A;  4R55 A;  4C92 A;  2HQE A;  2DO3 A;  2F69 A;  5CK9 A;  3RBB B;  4Z02 A;  2KT8 A;  3ME9 A;  3VKI A;  1U1S A;  3FC3 A;  2K9G A;  2QEX Q;  1D0Z A;  5GAN j;  4ANJ A;  2FPF A;  4FL6 A;  4F7U G;  4JRK A;  2LJ1 A;  4J8O A;  3T9N A;  1VQO T;  2CP7 A;  2ZCF B;  1GXI E;  2HCK A;  4M7D C;  3TVT A;  4K11 A;  2X4X A;  1ZSZ B;  4N4G A;  2KT1 A;  1BKB A;  3HPW A;  4E7L A;  5IHN A;  3EGD A;  3TCJ A;  5LJ5 h;  4A4G A;  2YRC A;  1QVF A;  5GAO l;  2LQ8 A;  3QYH B;  3HRT A;  3VJP A;  1OV3 A;  2LZ6 B;  1WX6 A;  4XQ3 A;  1ZQ1 A;  2QQB A;  4FSS A;  1FMV A;  3CCL T;  1B07 A;  4ME7 A;  3V7R A;  5GAN 7;  2RHI A;  3OY9 A;  2RA2 A;  1Q7Y U;  1K8A U;  2JT4 A;  1Q86 R;  4OMO A;  2DL7 A;  1KC8 C;  1RAA B;  1SF9 A;  1D1C A;  2DK3 A;  3CD6 A;  3OYI A;  4A4E A;  5GJV B;  2JN0 A;  4X34 A;  2RK2 A;  1T0H A;  2LC4 A;  2VXF A;  4M7A B;  2ENM A;  4IIM A;  2CT3 A;  4CC2 A;  2JM9 A;  5LJ5 g;  1JO8 A;  2EYX A;  3Q1J A;  8AT1 B;  4LE9 A;  3QWX X;  1RAB B;  1VQ4 T;  3FDR A;  2WSF E;  2DTO A;  4C8Q A;  2KBT A;  1Q81 U;  5FWC A;  3QBY A;  3L2Z A;  4XTU A;  5DLQ E;  3CMA Q;  4XTV A;  2KR3 A;  1UGS B;  3IQL A;  4Q5W A;  2COY A;  4HA8 A;  4C0Z A;  3OYD A;  2RMO A;  2K5F A;  5IHK A;  4EMK B;  1JU5 C;  1MUZ A;  3NFC A;  2L8D A;  2DTI A;  4Y92 A;  4J83 A;  3A8H B;  2DIQ A;  1VQL A;  4FSX A;  2K2V A;  3I56 Q;  3GIB A;  2KYB A;  3SWN C;  2L3R A;  3CXC P;  1JRI A;  2QQR A;  2DF6 A;  4GLM A;  5GAN 3;  5CAI A;  1G8X A;  1RAC B;  1YIJ Q;  4M78 B;  4PK4 A;  1VQP T;  1GL5 A;  3INZ A;  2CGH A;  1OUL A;  3L2U A;  3THK A;  2GBQ A;  3OYG A;  1NJI C;  2DBK A;  4M78 G;  2M16 A;  1AT1 B;  4RG8 A;  3H8Z A;  4IUU A;  3VS5 A;  2M02 A;  2LJ3 A;  2K3Y A;  1M8V A;  4JJD A;  1PM3 A;  2VUB A;  3NGP A;  1M1K U;  3M0Q A;  3QDF A;  2FB7 A;  2EKH A;  1CKA A;  4J7F A;  3OYA A;  2FHD A;  4PJO B;  1XTD A;  3RDV A;  2QQ9 A;  5GMK m;  3HRS A;  4O5V A;  4RTV A;  1ARK A;  4RKU E;  3A8O B;  2RB6 A;  2CP2 A;  1VQO Q;  1X6O A;  1YI2 T;  3PT9 A;  1WHH A;  1G83 A;  2LRQ A;  4BDZ A;  2EVR A;  4LDW A;  2A28 A;  3CCE A;  2IPO B;  3M55 A;  1IGU A;  2YDL A;  3SHW A;  4F17 A;  3QZ5 B;  1YP5 A;  2K2M A;  3JRZ A;  2V1Q A;  2QG9 B;  2KSS A;  1QWF A;  2M1H A;  5FLX E;  1YJW T;  1YJ9 A;  1G3T A;  1RAE B;  2RJF A;  2A36 A;  2HZY A;  1BCO A;  3EFS A;  3CCJ Q;  1NEG A;  4CC4 B;  4C92 F;  3CCS T;  1PKS A;  2D8H A;  3SDZ A;  1KG1 A;  4XTX A;  2BKD N;  2XI9 A;  4FU6 A;  4PJL A;  5KYY B;  3CCR A;  2EFI A;  3VS2 A;  1VQ4 Q;  5KYW A;  5D6Y A;  1D3B B;  1X6B A;  3JCM X;  4M7A E;  3MPU B;  3OS0 A;  2DL5 A;  1AWW A;  3CC7 A;  1UDL A;  1V29 B;  1TUD A;  3JB9 I;  2X35 A;  4OVA A;  1EX4 A;  5J39 A;  2DNU A;  5GMK l;  3CXC S;  4KBM B;  3NTI A;  3NTH A;  2C0I A;  3JCM d;  4XK8 E;  4DOV A;  2EQU A;  1ZUY A;  3OYK A;  4XAX B;  2HQX A;  3I55 Q;  1ABO A;  4QT7 A;  3HRU A;  3FJP A;  4C92 D;  1VQP Q;  4HXJ A;  1TWB A;  5KCO A;  4MZM A;  2CSI A;  1FWZ A;  1KQS P;  2PVG B;  1BB9 A;  2QA4 A;  4C8Q F;  4KGZ B;  4J9C A;  4C92 G;  1B34 B;  2J6O A;  4F7U A;  2K5L A;  1BCM A;  4XU1 A;  1BU1 A;  4KRT A;  3G4S T;  4ORZ A;  1AVZ C;  4QW2 A;  4FYY B;  3AHU A;  4FT2 A;  1UGP B;  2CH4 A;  3RMS A;  1UFF A;  2P84 A;  4JJC A;  2EW3 A;  2K5I A;  1Q82 R;  2FYK A;  2K3X A;  2X4J A;  4JS4 A;  3P8D A;  2OAW A;  1GFC A;  5LJ5 j;  2LVM A;  4RTW A;  3CCU T;  1Q81 R;  1IRE B;  1E6H A;  2VYT A;  4ELY C;  2CYZ B;  4QKU A;  4M75 D;  4OB3 B;  3SWN B;  1SRM A;  4J9I A;  3CXC A;  5GAM d;  1ZBJ A;  4FW1 A;  4PJO E;  2V8J A;  4M75 G;  2E1H A;  3DLL A;  1PRL C;  2KRO A;  1WHL A;  4KGX B;  1D0Y A;  1JB0 E;  5CIU A;  1KD1 C;  1RAF B;  2NUZ A;  1M3A A;  5KE2 A;  4OB1 B;  2XDD A;  1R77 A;  4C8Q D;  1WXB A;  2QEX A;  1YJW Q;  2QTX A;  5FU6 B;  3A8M B;  5IXB A;  5GAO r;  4C8Q G;  1KD1 R;  2A08 A;  2BZY A;  3HSB A;  2YUP A;  2E4H A;  1FYN A;  1UGV A;  2O9V A;  2XID A;  1PSE A;  1SKU B;  2P0K A;  3CCQ A;  3G6E T;  2ROT A;  3TEE A;  2GFA A;  3HKS A;  2GNC A;  2IVW A;  5D6W A;  3JSC A;  3O5Z A;  1EZZ B;  3DB4 A;  2IIM A;  2JOY A;  2X3W D;  3WXM B;  4BE1 A;  1SRL A;  4VUB A;  2RQW A;  4EMK A;  3PNW C;  1YNZ A;  4J9F A;  3EG9 B;  1H64 1;  1KC8 U;  5EG2 A;  1AHJ B;  4E7H A;  5CVI A;  2E5Q A;  1B3Q A;  2E5K A;  2PVD B;  4JUV A;  3TSW A;  1JBM A;  3C0C A;  3J81 E;  3MEW A;  5GAO n;  2KDS A;  4M78 A;  5KH6 A;  4M7D E;  3DKM A;  4UC4 A;  1ACM B;  2ZPB B;  1M30 A;  2DRM A;  4XTZ A;  3VU3 C;  3FJ5 A;  2KXD A;  1VQ5 Q;  2P0P A;  3EHR A;  2DAQ A;  1Y07 A;  1MMA A;  4BB7 A;  3A1P A;  5CCA A;  2EYW A;  2DRK A;  2R58 A;  4D8K A;  3CMA A;  3OA6 A;  2RJC A;  3VS6 A;  1ABQ A;  4JZ3 A;  3VS3 A;  2RI3 A;  5FU7 C;  1KHC A;  1W70 A;  3JCM b;  2OTL Q;  3QJY A;  1UE9 A;  1MGQ A;  1N6A A;  5LJ3 f;  1M90 C;  5DLO A;  4PJO A;  2RF0 A;  3QJ6 A;  3G4S Q;  3I56 A;  4RTU A;  2RD1 A;  1KSW A;  3UA6 A;  4TVR A;  1YIJ A;  3MP6 A;  3QO3 A;  1M5Q 1;  1NE8 A;  3GNF B;  5GAN d;  2EAY A;  4AG1 C;  1NJI U;  1IXD A;  1ZA2 B;  2M0Y A;  2DLP A;  5LJ5 e;  2KNB B;  4HT8 A;  3CCU Q;  3RUX A;  4JS5 A;  3FB9 A;  3JCM c;  4C5I A;  4J9E A;  4ESR A;  4Z88 A;  1OEB A;  2FZK B;  1TS9 A;  2HNI A;  1VOM A;  2H3E B;  2DL3 A;  4IUP A;  4MDX A;  2KXC A;  5DM7 R;  5GAN 5;  3M0U A;  1QP3 A;  3PE0 A;  4NOY A;  3X26 B;  4CRI A;  1IGQ A;  3OW2 P;  2E6Z A;  4N0A C;  3M57 A;  2YUQ A;  3CC4 A;  3V7S A;  1QCF A;  3M54 A;  2F2V A;  5M9O A;  2AT1 B;  4X9D A;  4E7I A;  1UG1 A;  3JCM f;  1VQN A;  2K79 A;  1Y57 A;  3CC2 Q;  4GY5 A;  1VQO A;  2H3J A;  2HAX A;  1D3B A;  2KVQ G;  1NM7 A;  2QQS A;  4LD9 K;  3G6E Q;  2DYB A;  1N27 A;  3H6Z A;  4LUD A;  2PUK B;  4OMN A;  3A5Z B;  1NLP C;  3OBW A;  2WAC A;  1VQK T;  1YHQ T;  1UB4 A;  1M4Z A;  2H8H A;  3VRZ A;  4C0F A;  3JCM P;  1K9M C;  3JV3 A;  2K57 A;  3CCJ A;  2OTJ T;  1GBQ A;  2E3I A;  1VQ6 T;  3SFM A;  4PFP A;  1HJD A;  1U1T A;  2E6N A;  2QI2 A;  2V8K A;  3E9F A;  5IT9 E;  2CZ6 B;  2EKO A;  1VQ4 A;  1OZ2 A;  2NUP B;  4J9H A;  4DBQ A;  2YLB A;  1B34 A;  1SHG A;  3M0S A;  2J05 A;  4WTO B;  1KQ1 A;  3CCM Q;  3AT1 B;  1D0X A;  1OI1 A;  3QWY A;  2DZ9 A;  2JS2 A;  5GAM e;  5LJ3 h;  3JB9 J;  5C0M A;  3M5A A;  2LQN A;  4LUE A;  2MMP A;  4ELZ C;  4CC3 A;  1SSH A;  1T3S A;  4LDV A;  3QPH A;  5KYX B;  1N8R C;  1NPR A;  3LWI A;  3M0R A;  3OQ5 A;  1K1Z A;  5GAN 6;  3QYG B;  2P4T A;  2PTK A;  2E64 A;  3M58 A;  4M75 A;  3CPW S;  3D7S B;  3TSZ A;  4IUR A;  2K6D A;  2GCX A;  1CSK A;  2L3P A;  3I55 A;  1VQP A;  4M78 F;  3MKD A;  3UPU A;  2CRE A;  4M7A D;  4HVU A;  2AK5 A;  3CCV T;  4EDU A;  3HL8 A;  3FRN A;  5LJ3 g;  1D09 B;  1O9S A;  1FX7 A;  1Q82 U;  1KC8 R;  2AHJ B;  4N4I A;  3RMQ A;  3OW2 S;  4M7A G;  2WSC E;  2QAZ A;  3OYJ A;  1UGQ B;  2ZPG B;  3H41 A;  3QDR B;  4HCC A;  4C92 C;  5GAO p;  1YBY A;  2PUO B;  4ZGJ B;  4C0G A;  1W2B S;  4BY6 C;  4ATO A;  2EQK A;  2RHY A;  5FU7 B;  2DKG A;  1I0C A;  4OMF B;  2MWP A;  4OMP A;  2V8I A;  2DX1 A;  1QMC A;  1PNJ A;  3RR6 A;  3UA7 A;  3MEU A;  4KUI A;  3ZBD A;  2CUD A;  3MO8 A;  3JCM h;  4PJO F;  3OMG A;  2CP5 A;  1WHM A;  1E6G A;  4IUQ A;  2R5M A;  1ZUK A;  1Y71 A;  2LTO A;  1O75 A;  2JNG A;  4OGE A;  1VQ7 T;  3LLR A;  2RN8 A;  4FYW B;  1UTI A;  4KUL A;  2JTF A;  4QQ6 A;  1YCS B;  1UHC A;  3EG9 A;  5HK0 A;  5I2S A;  4M78 D;  1OZ3 A;  1KD1 U;  2VGN A;  2XK0 A;  4ZNX A;  2LX9 A;  1PHT A;  1VQK Q;  1UJY A;  1YHQ Q;  3BY7 A;  5GMK e;  3CPW A;  3EGU A;  4OP0 A;  4KGV B;  1QCO A;  3JCM g;  2YUN A;  1V76 A;  1Z9Q A;  4A54 A;  2ROL A;  1S72 T;  1XJW B;  4BUG A;  3NTK A;  3C94 A;  5AYF A;  2LX7 A;  1NJI R;  1VQ6 Q;  3REA B;  3OW2 A;  3G71 A;  2JMC A;  1VYV A;  1MMN A;  2F2X A;  2PNI A;  4HKE A;  4KUD K;  2B8A A;  1UGR B;  4PJO D;  3EH1 A;  1ZA1 B;  2GTO A;  3V8L A;  3VRY A;  1W2B A;  1U5S A;  4O6J A;  2XMF A;  2LJ0 A;  1TUC A;  5GAN e;  5J3B A;  2XG8 D;  3BFM A;  4QQD A;  2RI5 A;  1K76 A;  2VXE A;  4PJO G;  4E7J A;  3L2R A;  3VYH B;  3QXE B;  2F2W A;  4FM4 B;  2MIO A;  1RLQ C;  4RCC A;  5IXF A;  5HY6 A;  5KCH A;  4LDU A;  5IH2 A;  1HYO A;  1WIE A;  1RL2 A;  3I9Q A;  3RKY A;  3GF5 A;  1VQL T;  4AFZ C;  3PIP A;  3EGX A;  2ZPH B;  1VQ5 A;  3UF4 A;  3CCL Q;  1IB8 A;  2E65 A;  1LOJ A;  2BZX A;  3J80 E;  2JXB A;  4M77 C;  4J6W A;  2VVK A;  1YIT T;  3PFS A;  1ZBX A;  2LNH B;  5LJ5 d;  3OYC A;  3JCM V;  2MK5 A;  1RI0 A;  1QQJ A;  1U3O A;  3LGF A;  3EFO A;  1H3Z A;  2D1X A;  2DXT A;  3MCA B;  2M51 A;  2OTL A;  1M90 U;  3QZ9 B;  2X4Y A;  1VQ8 T;  2OI3 A;  1LPL A;  1WDX A;  1WQW A;  2EGA A;  4M7D B;  2CKK A;  3G4S A;  4HVV A;  2KRN A;  3MET A;  1U8R A;  3M9Q A;  1K73 C;  1QKW A;  1MND A;  2DJZ A;  4A63 B;  2LP5 A;  2C0O A;  1VQ9 T;  1JJ2 S;  4M7D G;  4FCY A;  4HVW A;  2A0F B;  3R6N A;  3LH0 A;  1QVP A;  1MV0 B;  4ZTJ A;  1B7T A;  1E7O A;  1WJQ A;  3TU4 K;  2ATC B;  4RCB A;  3CCU A;  2E3H A;  1A0N B;  4KH0 B;  1VQ7 Q;  4M75 F;  1IRX A;  2PZ1 A;  3OS2 A;  1SEM A;  3MHX A;  2D6F A;  1WHK A;  3REB B;  4RTY A;  5D7U A;  3PVQ A;  2EPD A;  4FYX B;  3A8L B;  2DER A;  1QW1 A;  4BI8 B;  1J3T A;  2MOX A;  1AEY A;  3LW5 E;  3I5R A;  1ZLM A;  3GBQ A;  1Q7Y C;  2M0O A;  4RTZ A;  4AFS C;  3CME T;  1S72 Q;  3OYH A;  3CC2 A;  3BDU A;  2NUP A;  1QWE A;  3NHN A;  1M27 C;  3RIR A;  1EIF A;  4JZ4 A;  2DXU A;  2JZ2 A;  1JQQ A;  3CCR T;  2W0Z A;  3G6E A;  2YUO A;  1WPY A;  1ZSZ A;  3C95 A;  4AMC A;  1NPP A;  1K9M U;  2CZ1 B;  3X28 B;  2DL4 A;  4WCI A;  5LJ3 j;  4OML A;  1JJ2 A;  2YLC A;  1RUW A;  2YSQ A;  3H0H A;  2D0Q B;  4WF2 A;  5C6S A;  2AKK A;  5KYX A;  1YI2 Q;  4EMG A;  1X01 A;  5EC7 A;  1AWJ A;  1KQ2 A;  4LNP A;  2AZS A;  2XIC A;  1PWT A;  3QUI A;  2DJQ A;  1OU9 A;  3SEM A;  4A53 A;  1G3S A;  2QTV A;  4PLI A;  1WXU A;  2RQU A;  2F1L A;  4EPC A;  1RAG B;  3M0T A;  4M7A A;  2MCN A;  1AWX A;  1M1F A;  1SG5 A;  4IIO A;  3EH2 A;  2JTE A;  5HK3 A;  4E7S A;  1M3B A;  2FZC B;  1AD5 A;  2G3R A;  2O4X B;  1YIT Q;  1Q95 G;  1C6V X;  1OU8 A;  1WZO A;  1YWO A;  2ECZ A;  3CCM A;  3CCS Q;  2HKQ B;  3OSS C;  3S6W A;  1VQM T;  2ZAE A;  2RQT A;  5CQX A;  1AZE A;  2ZPI B;  1N8R U;  3FIF A;  2PVO B;  4FYV B;  1VQ8 Q;  2OAU A;  3GLX A;  5HCK A;  2JMA A;  2EJF A;  2JUF A;  1TH7 A;  2P0Q A;  1G5V A;  3LGL A;  2BTT A;  5I21 A;  4F04 B;  5GJW B;  3PVL A;  1AWO A;  2ZGW A;  3DLM A;  2D0N A;  4L6V 5;  2W10 A;  1VQ9 Q;  1GCQ A;  6AT1 B;  4C0D C;  3X25 B;  2L0A A;  5CKF A;  4V2S A;  1UEC A;  5GAO q;  4JPB W;  2YRD A;  4J6Y A;  4M77 B;  1M8M A;  4DEY A;  2PQW A;  4IUV A;  1IZ6 A;  4J9B A;  2EGE A;  3OYN A;  1RAD B;  2XHC A;  3M4G A;  3JCM J;  2E10 A;  2P4R A;  1WQ7 A;  3TQ7 P;  5A0L A;  3UT1 A;  2K4Y A;  1WJR A;  1X27 A;  5KYU B;  4AT1 B;  2LDM A;  3QG1 A;  4ZGE B;  2GGR A;  1KK7 A;  4BDY A;  2BZ8 A;  3VS0 A;  1W4S A;  1K4U S;  1N5Z A;  2JM8 A;  2MWO A;  3EAE A;  3KFV A;  1OX8 A;  3CME Q;  3V8J A;  2KGT A;  1KIK A;  1KHI A;  2L3Q A;  3R6O A;  3CCQ T;  5CKD A;  3L2Q A;  2LQK A;  1H8K A;  4MZP A;  4HCB A;  1BK2 A;  2FVU A;  2VC8 A;  2DET A;  3E9G A;  1GRI A;  3SB2 A;  3CCR Q;  4EMK C;  2FPE A;  1WHG A;  1LVK A;  1M90 R;  1VQK A;  5CO7 A;  1IHW A;  2MPX C;  4C92 E;  1YHQ A;  3CPW P;  1VA7 A;  4XTY A;  1NG2 A;  3MJX A;  1TG0 A;  3A98 A;  3QII A;  2YXY A;  3M56 A;  4RTT A;  3TRE A;  2DEQ A;  2RHX A;  4II1 A;  1PCX A;  2DD5 A;  2CP0 A;  4M78 C;  3QSU A;  2L5Q A;  4JRP A;  2KMT A;  3J7A F;  1JXM A;  1VQ6 A;  2VWF A;  1Y0M A;  1U06 A;  5GAN 8;  3OYM A;  5FRN A;  1W2B P;  4PFZ A;  3EG0 A;  1TUG B;  2BIV A;  5KYY A;  2DVJ A;  3JAM E;  2LNV A;  4BE0 A;  2VV5 A;  3VUZ A;  5KYW B;  4YTL A;  4M7D A;  1D1B A;  2LMJ A;  2FG0 A;  2RI2 A;  2DBM A;  2JVV A;  1UEB A;  3NMZ C;  2YWW A;  5CKB A;  4PJO C;  2RH2 A;  1VQM Q;  2A37 A;  3OYE A;  2JJ9 A;  1JXO A;  2WSE E;  2OX7 A;  3MP1 A;  4ZTF A;  3S3N A;  3OYF A;  3I56 T;  3M59 A;  1M1G A;  4ZN1 A;  3OS1 A;  2R5A A;  1QVF S;  2DZC A;  2QDL A;  3CCL A;  2HL3 A;  1NYG A;  3QKJ A;  4HCK A;  1R0B G;  3BE3 A;  1YIJ T;  2XDP A;  4EMH A;  1BI1 A;  1M9S A;  4M4Z A;  2COW A;  2RHZ A;  3BDL A;  2HBW A;  2EGC A;  2F5K A;  4L5G A;  1K9M R;  2NUT B;  4M7A F;  1PKT A;  2SRC A;  1OYX A;  3PMI A;  1I07 A;  3S3O A;  4C5G A;  2MI6 A;  4QVC A;  2RQR A;  1D1A A;  1KFZ A;  1WXT A;  4Y91 A;  1SSF A;  5AT1 B;  1K73 U;  4BI3 A;  4R0K A;  3CC4 T;  2FPD A;  4F7U B;  5GAM f;  1VIE A;  1OQK A;  2MF2 A;  4JDS A;  1S1N A;  4J7I A;  4M77 E;  3JB9 F;  1WI7 A;  1VQN T;  4NL3 A;  3M4Y A;  3RKW A;  1LJO A;  1SHF A;  2SEM A;  5CKE A;  2XDB A;  5KE3 A;  1VQ7 A;  3KBG A;  3CCQ Q;  2E12 A;  4LD6 A;  2A3L A;  1Q86 C;  1M2V B;  4LDY A;  3SWN A;  3PIO A;  1R8O B;  1VYT A;  2HL5 C;  4C0D B;  3L2W A;  3KXT A;  1N8R R;  2QXF A;  4OB0 B;  4XTW A;  2RPN A;  3HP9 A;  3CQT A;  1G3W A;  2KE9 A;  1QVG S;  2Y90 A;  1Z9Z A;  4HT9 A;  4Y28 E;  4DEX A;  1Y96 B;  2RK1 A;  2AZV A;  3CCJ T;  1LNX A;  1S72 A;  2CT4 A;  2QDY B;  1TXQ A;  1DJ7 B;  2DD4 A;  3VS7 A;  1I8F A;  1YJN T;  3JB9 H;  2HEQ A;  1EFN A;  4PNO A;  2O2O A;  4JLG A;  1MHN A;  1XOV A;  2L89 A;  2O4X A;  4Z89 A;  3JB9 D;  3QHS A;  2RNA A;  4BAC A;  5CQY A;  4B9X A;  1G3Y A;  1HK9 A;  1FMW A;  2DTH A;  1BBZ A;  1F1B B;  2HD0 A;  2CP3 A;  1JJ2 P;  4NL2 A;  3S3M A;  4LXC A;  3JB9 G;  2CSQ A;  2QAS A;  1WNL A;  1C0M A;  1YI2 A;  1TTH B;  3UDC A;  1GBR A;  1MV3 A;  4JLI A;  9ATC B;  2HSP A;  1WGS A;  4CI0 C;  5HKC A;  2DMO A;  4PKC C;  4CC7 A;  2KEA A;  5D6X A;  3A8G B;  1I1J A;  1BI2 A;  4M75 C;  8ATC B;  1RAH B;  4XU2 A;  5IAY A;  4F16 A;  2RO0 A;  3PTA A;  1YJW A;  2XD0 A;  3H0I A;  1W6X A;  2LCS A;  3CD6 T;  3WVD B;  1VUB A;  1YN8 A;  3I55 T;  2RJD A;  3VUB A;  1YIT A;  2MYS A;  1QVG A;  2VGM A;  4M77 A;  4OMQ A;  2OTJ Q;  3ER0 A;  4ZN3 A;  2RJE A;  4RTX A;  3X20 B;  4BE2 A;  2RHU A;  3CCS A;  1I81 A;  1HXD A;  4C8Q C;  3UAT A;  1TOV A;  1AZG B;  2EJ9 A;  5GAN f;  2VAS A;  4D6W A;  4PL6 A;  3MEA A;  1VQ8 A;  3E1S A;  5FU6 C;  5KYU A;  1IHV A;  5FRM A;  2R57 A;  3ULR B;  2JTM A;  4C5H A;  4B9W A;  5GAM h;  2HMA A;  2YRV A;  4M7D F;  2GF7 A;  3HTR A;  1PD0 A;  2ZPF B;  1X2Q A;  3CC4 Q;  1X43 A;  1BI0 A; 
#chains in the Genus database with same CATH homology
 1BI3 A;  2CZ0 B;  2X4X A;  3QJ6 A;  3RKX A;  4N4G A;  3I56 A;  1VQ9 A;  2RD1 A;  1NPP A;  1BKB A;  2CZ1 B;  3CBO A;  3HPW A;  3X28 B;  4E7L A;  1K9M U;  2EIF A;  5LJ3 j;  2O01 E;  3TCJ A;  2EQM A;  4XU0 A;  5LJ5 h;  4A4G A;  1JJ2 A;  2YLC A;  1QVF A;  4ZGD B;  4TVR A;  1YIJ A;  4WF2 A;  1BIA A;  2D0Q B;  5C6S A;  5GAO l;  2LQ8 A;  3MP6 A;  3QO3 A;  2E41 A;  3QYH B;  3HRT A;  3VJP A;  1M5Q 1;  1NE8 A;  3GNF B;  4FIB A;  5GAN d;  4XQ3 A;  4EMG A;  1XNI A;  1ZQ1 A;  1X01 A;  2EAY A;  2QQB A;  4F7U E;  1NJI U;  1PSF A;  3CCL T;  1QP2 A;  1KQ2 A;  4ME7 A;  2XIC A;  3HFO A;  3V7R A;  4R56 A;  5GAN 7;  2RHI A;  3QUI A;  2RA2 A;  3OY9 A;  1Q7Y U;  3LX7 A;  5LJ5 e;  3ZEH A;  1K8A U;  4HT8 A;  4A53 A;  5GAM g;  3RUX A;  4MML A;  1G3S A;  4JS5 A;  1BYM A;  4PLI A;  3FB9 A;  1KC8 C;  3JCM c;  4C5I A;  3CD6 A;  2DK3 A;  3OYI A;  5LJ3 d;  4A4E A;  2HNI A;  4EPC A;  4IUP A;  2JN0 A;  3SD4 A;  4X34 A;  3L42 A;  2RK2 A;  4M7A A;  4MDX A;  2LC4 A;  2KAF A;  2VXF A;  4M7A B;  1M1F A;  3PMT A;  5DM7 R;  4RMO A;  5GAN 5;  5LJ5 g;  1QP3 A;  4NOY A;  4MDW A;  3X26 B;  4CRI A;  3Q1J A;  5HK3 A;  5GAN 2;  2E6Z A;  4QVD A;  2G3R A;  2O4X B;  3M57 A;  4N0A C;  4OGC A;  1VQ4 T;  3FDR A;  3CC4 A;  2WSF E;  3V7S A;  2DTO A;  3M54 A;  4C8Q A;  3CME A;  3CCM A;  5M9O A;  4M7D D;  1P92 A;  1Q81 U;  3G71 T;  3OSS C;  3QBY A;  2LCC A;  3L2Z A;  4X9D A;  3S6W A;  1VQM T;  4XTU A;  5DLQ E;  4E7I A;  4XTV A;  5CQX A;  3JCM f;  1VQN A;  1UGS B;  2ZPI B;  1N8R U;  3FIF A;  2PVO B;  2DVE A;  4GY5 A;  2OAU A;  4Q5W A;  3GLX A;  1VQO A;  4HA8 A;  4C0Z A;  3OYD A;  4A4H A;  2EJG A;  2H3J A;  2K5F A;  4EMK B;  2HAX A;  2EJF A;  1D3B A;  2JUF A;  2KVQ G;  1TH7 A;  3NFC A;  3V7C A;  2P0Q A;  2QQS A;  5GAN 4;  4LD9 K;  1G5V A;  2L8D A;  2DTI A;  1N27 A;  3H6Z A;  3LGL A;  2PUK B;  5I21 A;  3A5Z B;  4J83 A;  3A8H B;  3GP8 A;  2HBP A;  2DIQ A;  3OBW A;  2WAC A;  2ZPE B;  1VQK T;  2ZGW A;  1VQL A;  3DLM A;  4FSX A;  2K2V A;  4L6V 5;  5CKH A;  1YHQ T;  1Y7X A;  3GIB A;  1UB4 A;  2YHT A;  3SWN C;  2L3R A;  1M4Z A;  4X9C A;  1JRI A;  2QQR A;  5A0D A;  5GAN 3;  4C0F A;  4C0D C;  3JCM P;  5GMK h;  1K9M C;  3CCE T;  5CAI A;  3X25 B;  5CKF A;  3CPF A;  4M78 B;  4V2S A;  1VQP T;  2K57 A;  3INZ A;  2CGH A;  5GAO q;  1VQ5 T;  3CCJ A;  4J6Y A;  1N9R A;  4M77 B;  3L2U A;  1YJ9 T;  2OTJ T;  3OYG A;  1NJI C;  3SFM A;  1VQ6 T;  2PQW A;  4M78 G;  2M16 A;  1IZ6 A;  4IUV A;  4RG8 A;  2EWN A;  1U1T A;  3H8Z A;  1K8A C;  2E6N A;  3OYN A;  4IUU A;  2XHC A;  2QI2 A;  2V8K A;  3E9F A;  3M4G A;  2RM4 A;  3JCM J;  2Y4Y A;  2K3Y A;  4C92 B;  5IT9 E;  2E10 A;  1WQ7 A;  2CZ6 B;  4BY6 B;  5A0L A;  1M8V A;  2EKO A;  1VQ4 A;  3UT1 A;  1OZ2 A;  2K4Y A;  4QQG A;  1WJR A;  2VUB A;  2LDM A;  1M1K U;  3QG1 A;  4ZGE B;  4BI4 A;  4BDY A;  2YLB A;  5GAN h;  2FB7 A;  1W4S A;  1B34 A;  2OTL T;  2QQA A;  4J7F A;  1NZ9 A;  2MWO A;  5A0G A;  1BIB A;  3EAE A;  1VQM A;  3OYA A;  1KQ1 A;  2FHD A;  4M78 E;  3V8J A;  5LL6 S;  2F5T X;  1XTD A;  2EYQ A;  1Q82 C;  4PJO B;  1KHI A;  3R6O A;  3CCQ T;  5GMK m;  2QQ9 A;  5CKD A;  1OI1 A;  2LQK A;  4MZP A;  3HRS A;  3L2Q A;  2DZ9 A;  4O5V A;  5GAM e;  4HCB A;  4RKU E;  1Q81 C;  5LJ3 h;  3JB9 J;  5C0M A;  3M5A A;  2FVU A;  3CC7 T;  2VC8 A;  4JRI A;  2MMP A;  4ELZ C;  3A8O B;  3E9G A;  3MP8 A;  3SB2 A;  2RB6 A;  4EMK C;  3JCM W;  3RES A;  4XU3 A;  4LDV A;  3QPH A;  1X6O A;  4L59 A;  1YI2 T;  1N8R C;  3PT9 A;  3CEY A;  1VQK A;  5CO7 A;  2ZZD A;  3FLG A;  2LRQ A;  1NPR A;  4BDZ A;  4C92 E;  3LWH A;  3LWI A;  4OB2 B;  1YHQ A;  2LCL A;  3OQ5 A;  4XTY A;  4LDW A;  5GAN 6;  2EQJ A;  3QYG B;  4J5Y A;  2P4T A;  5GAN g;  3P8H A;  2E64 A;  4OF1 A;  2PU9 B;  3M58 A;  4M75 A;  3CCE A;  3QII A;  3CPW S;  3M56 A;  3N5B B;  4IUR A;  4M75 B;  3TRE A;  2GCX A;  3M55 A;  2DEQ A;  3I55 A;  2RHX A;  3URG A;  3QZ5 B;  1VQP A;  4II1 A;  4M78 F;  3JRZ A;  2DD5 A;  2DIG A;  3UPU A;  2KSS A;  4M78 C;  3QSU A;  2L5Q A;  4JRP A;  4M7A D;  2KMT A;  2M1H A;  4GLK A;  3CCV T;  3J7A F;  5FLX E;  4EDU A;  1YJW T;  3RER A;  2X4W A;  1YJ9 A;  1G3T A;  3P8B B;  3HL8 A;  1VQ6 A;  5GMK i;  3FRN A;  4M77 F;  5LJ3 g;  3CBP A;  2RJF A;  5FRO A;  1O9S A;  1FX7 A;  4N4H A;  1Q82 U;  1Y96 A;  2AHJ B;  4N4I A;  3RMQ A;  3OW2 S;  3EFS A;  4M7A G;  2WSC E;  3OYJ A;  3PGG A;  1UGQ B;  2ZPG B;  2LT1 A;  4C8Q B;  5GAN 8;  3OYM A;  3GNG A;  2QA4 T;  5FRN A;  3V8K A;  4C92 F;  3CCS T;  3QDR B;  3SDZ A;  4HCC A;  1KG1 A;  4C92 C;  5GAO p;  4XTX A;  2BKD N;  1YBY A;  2PUO B;  4ZGJ B;  2DXC A;  2XI9 A;  4FU6 A;  4BY6 C;  4C0G A;  2FL7 A;  1W2B S;  4ATO A;  2BIV A;  2EQK A;  2XU8 A;  4DA4 A;  1FXX A;  2RHY A;  5FU7 B;  3JAM E;  2EFI A;  3CCR A;  2DKG A;  3CC2 T;  2LNV A;  4OMF B;  2MWP A;  2XKO C;  5IN1 A;  4BE0 A;  2V8I A;  2VV5 A;  3VUZ A;  5D6Y A;  1I5L A;  4YTL A;  3ZBD A;  3MEU A;  4KUI A;  4M7D A;  1D3B B;  2RI2 A;  3MO8 A;  3JCM h;  2JVV A;  4PJO F;  1Q86 U;  1M1K C;  3OMG A;  3JCM X;  4M7A E;  1UEB A;  4PJO C;  5CKB A;  3OS0 A;  4DOW A;  2RH2 A;  2R5M A;  4IUQ A;  1Y71 A;  1WJS A;  2LTO A;  3OYE A;  2WSE E;  1O75 A;  3GPL A;  2JNG A;  4OGE A;  3CC7 A;  1V29 B;  3MP1 A;  3JB9 I;  1VQ7 T;  3E19 A;  4M7D B;  3LLR A;  4ZTF A;  3S3N A;  3OYF A;  3I56 T;  2X35 A;  3FEO A;  3M59 A;  1M1G A;  4ZN1 A;  3OS1 A;  2R5A A;  4OVA A;  1QVF S;  3EFR A;  4KUL A;  2DZC A;  5J39 A;  2JTF A;  2CS7 A;  3CCL A;  2I2L A;  3ASK A;  5GMK l;  2DXB A;  3CXC S;  3QKJ A;  4KBM B;  4QQ6 A;  1YIJ T;  2E70 A;  3NTI A;  2XDP A;  4DQ2 A;  4EMH A;  5I2S A;  4M78 D;  1BI1 A;  1OZ3 A;  3NTH A;  1KD1 U;  1M9S A;  2VGN A;  4MMK A;  2XK0 A;  3JCM d;  4XK8 E;  4DOV A;  2LX9 A;  2Y4X A;  2RHZ A;  3BDL A;  2C06 A;  2EQU A;  4RG2 A;  4M77 D;  2F5K A;  3BY7 A;  5GMK e;  3F70 A;  3CPW A;  4L5G A;  3OYK A;  4OP0 A;  3JCM g;  4E7K A;  4M7A F;  2BUD A;  4XAX B;  4KT0 E;  4QVZ A;  4MZT A;  4A54 A;  4M7A C;  1S72 T;  2HQX A;  4M77 G;  4IUT A;  1OYX A;  3HRU A;  3FJP A;  4BUG A;  3NTK A;  4C92 D;  2GQV A;  3PMI A;  3S3O A;  3C94 A;  5AYF A;  2MI6 A;  4C5G A;  4QVC A;  3JCM Q;  5KCO A;  2QEX T;  4MZM A;  4N0A A;  3ZFJ A;  1FWZ A;  2GFU A;  2PVG B;  4E47 A;  4Y91 A;  1SSF A;  2QA4 A;  3OW2 A;  4C8Q F;  4C92 G;  1B34 B;  1K73 U;  3G71 A;  1KQS S;  4BI3 A;  4F7U A;  2K5L A;  3CC4 T;  4KUD K;  4XU1 A;  4HKE A;  4F7U B;  4A4K A;  2B8A A;  5GAM f;  3CCM T;  1UGR B;  2M9U A;  4PJO D;  1VIE A;  3O8V A;  3G4S T;  3V8L A;  2MF2 A;  4QW2 A;  1W2B A;  4JDS A;  5J26 A;  3OB9 A;  4O6J A;  4J7I A;  2KK4 A;  5GAN e;  4M77 E;  5J3B A;  3AHU A;  2XG8 D;  5GAM j;  4FT2 A;  1UGP B;  3JB9 F;  3BFM A;  3RMS A;  4QQD A;  2RI5 A;  3BW1 A;  1VQN T;  4NL3 A;  2VXE A;  4PJO G;  4E7J A;  3M4Y A;  3G7Z A;  3RKW A;  1LJO A;  1X75 C;  3C4S A;  3L2R A;  5LJ5 f;  3VYH B;  3QXE B;  5CKE A;  2K5I A;  4FM4 B;  2XDB A;  2FYK A;  2K3X A;  5KE3 A;  4RCC A;  3HFN A;  1VQ7 A;  5HY6 A;  1YCY A;  2X4J A;  4A4F A;  4JS4 A;  3P8D A;  3KBG A;  5KCH A;  4LDU A;  5LJ3 e;  5LJ5 j;  2LVM A;  2E12 A;  3CCU T;  4LD6 A;  2A3L A;  1Q86 C;  4LDY A;  3SWN A;  1RL2 A;  2KQW A;  3PIO A;  1IRE B;  3RKY A;  2VYT A;  3GF5 A;  4ELY C;  2CYZ B;  3SWN B;  4M75 D;  1R8O B;  4OB3 B;  1VQL T;  3PIP A;  3VV0 A;  3OS5 A;  3DB3 A;  4C0D B;  2ZPH B;  3L2W A;  3L1A A;  3KXT A;  3CXC A;  2QXF A;  4OB0 B;  4XTW A;  5GAM d;  3HP9 A;  1VQ5 A;  3HHT B;  5I2M A;  4PJO E;  1G3W A;  2V8J A;  2OTJ A;  2E65 A;  4PLL A;  4M75 G;  2E1H A;  1LOJ A;  2D9T A;  3DLL A;  1QVG S;  2Y90 A;  3J80 E;  3OYY A;  3X24 B;  3OBY A;  4J6W A;  4M77 C;  4P5N A;  4HT9 A;  1YIT T;  4Y28 E;  1JB0 E;  3OMC A;  5CIU A;  1KD1 C;  3PFS A;  1Y96 B;  2RK1 A;  3CCJ T;  1ZBX A;  5KE2 A;  1LNX A;  4OB1 B;  1S72 A;  5LJ5 d;  2XDD A;  3OYC A;  3JCM V;  4JJN K;  4C8Q D;  2QDY B;  1RI0 A;  1DJ7 B;  2DD4 A;  3LGF A;  1VIF A;  4HCZ A;  1I8F A;  1YJN T;  2DPP B;  2QEX A;  3JB9 H;  1H3Z A;  2DXT A;  2QTX A;  3CMA T;  5FU6 B;  3MCA B;  4PNO A;  3A8M B;  5GAO r;  4JLG A;  1MHN A;  2OTL A;  5HK0 A;  1XOV A;  2L89 A;  4C8Q G;  2O4X A;  3QZ9 B;  1M90 U;  2X4Y A;  1VQ8 T;  3MEV A;  4M75 E;  3HSB A;  3UWN A;  3JB9 D;  1WQW A;  3QHS A;  4BD3 A;  4F7U F;  2CKK A;  2XID A;  1PSE A;  3G4S A;  2P0K A;  5CQY A;  4B9X A;  4BAC A;  1G3Y A;  3CCQ A;  1HK9 A;  3G6E T;  3L2V A;  2A7Y A;  2NLU A;  3MET A;  2IG0 A;  2DTH A;  3TEE A;  2HD0 A;  1U8R A;  2GFA A;  3HKS A;  3C12 A;  4NL2 A;  2IVW A;  3M9Q A;  5D6W A;  3JSC A;  5GAO m;  3S3M A;  3JB9 G;  1K73 C;  1N9S A;  2DJZ A;  2CZ7 B;  3DB4 A;  5DY9 A;  1VQ9 T;  1JJ2 S;  1WNL A;  2JOY A;  4M7D G;  3WXM B;  4BE1 A;  2MAM A;  4VUB A;  1ZHI A;  3UDC A;  2KY9 A;  4EMK A;  3GOX A;  1YI2 A;  3JCM e;  4JLI A;  4C8Q E;  2LT4 A;  1WGS A;  4CI0 C;  3PNW C;  3CBM A;  4IKF A;  3LH0 A;  1QVP A;  5HKC A;  4ZTJ A;  4C5E A;  1H64 1;  1WJQ A;  3OYL A;  3TU4 K;  4PKC C;  5EG2 A;  1KC8 U;  1AHJ B;  3KUF A;  4RCB A;  3CCU A;  4E7H A;  5CVI A;  3OSV A;  3M53 A;  3OYB A;  2E5Q A;  5D6X A;  3A8G B;  4M75 F;  5A2Q E;  2PVD B;  4JUV A;  3OS2 A;  4FT4 A;  1BI2 A;  4M75 C;  5GMK j;  4XU2 A;  5IAY A;  4NS5 A;  3MHX A;  2RO0 A;  2D6F A;  1JBM A;  3VYG A;  3J81 E;  3MEW A;  3PTA A;  3CCV A;  5GAO n;  1YJW A;  2KDS A;  4LDX A;  4M78 A;  5KH6 A;  3LYI A;  2XD0 A;  3CD6 T;  3WVD B;  3DKM A;  4M7D E;  5CR2 A;  1VUB A;  3I55 T;  4UC4 A;  2RJD A;  1XQH A;  2ZPB B;  4XTZ A;  3A8L B;  3VU3 C;  3VUB A;  1QW1 A;  4BI8 B;  1YIT A;  1QVG A;  2VGM A;  2P0P A;  5L8R E;  4M77 A;  3WVE B;  2DAQ A;  3ER0 A;  1Y07 A;  3LW5 E;  4BB7 A;  4ZN3 A;  2RJE A;  3X20 B;  4BE2 A;  2RHU A;  4J6X A;  1I81 A;  3CCS A;  1HXD A;  4C8Q C;  5CCA A;  1I4K 1;  1YJN A;  1Q7Y C;  4JRQ A;  2R58 A;  2M0O A;  4R55 A;  3CME T;  2EJ9 A;  2HQE A;  2DO3 A;  4C92 A;  4D6W A;  2RJC A;  5GAN f;  3OYH A;  3OA6 A;  3CMA A;  1KQS A;  4PL6 A;  3CC2 A;  2F69 A;  3MEA A;  3BDU A;  5CK9 A;  1VQ8 A;  4Z02 A;  3E1S A;  3ME9 A;  5FU6 C;  1U1S A;  3VKI A;  3FC3 A;  2RI3 A;  5FU7 C;  1KHC A;  5GAN j;  4FL6 A;  2R57 A;  3RIR A;  2JTM A;  1EIF A;  4C5H A;  2DXU A;  5FRM A;  3JCM b;  4F7U G;  2JZ2 A;  4JRK A;  4B9W A;  5GAM h;  3QJY A;  4J8O A;  3T9N A;  3CCR T;  2YRV A;  3G6E A;  4M7D F;  2GF7 A;  1WPY A;  1VQO T;  2ZPF B;  2ZCF B;  1GXI E;  4M7D C;  1MGQ A;  1N6A A;  5LJ3 f;  1M90 C;  1BI0 A;  5DLO A;  3C95 A;  4PJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...