5GMKl

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
b'NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Rna binding protein/rna
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 13
structure length 82
sequence length 82
chains with identical sequence y
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
l PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkl00
5GAMd 4M7DE 4XTZA 4M75C 2RM4A 2DTHA 4EMHA 3JCMP 2DXTA 2JN0A 3EFRA 4X9DA 4M7AE 5GAOn 5GAN2 4C8QC 3JCMh 4M75F 5LJ3j 5GMKl 4EMKC 2YHTA 3L2ZA 2E41A 2YLCA 4N0AA 4A54A 5GMKj 5GANe 2EJGA 4M78G 5GAMg 4M7DA 1TH7A 3AHUA 3QHSA 1H641 2E1HA 4PJOG 3JB9G 4M75D 4OP0A 1WQ7A 3V7CA 3V7RA 3JB9I 4C8QE 4XTWA 1I4K1 3SWNA 1BIBA 2DJZA 1LJOA 2Y90A 4MMKA 4NL2A 3SWNC 3V8LA 2DZCA 4J6XA 4XTYA 4M77C 4A53A 3PGGA 4RCCA 3JCMc 3SB2A 5GMKh 5GAN5 5GAOp 3HSBA 4M7DC 3RKXA 1YCYA 4M7DD 5CAIA 4M7AB 1BIAA 1X01A 2DKGA 4M75B 4C92F 3JCMe 2I2LA 1JBMA 3JCMJ 3JB9F 3BY7A 4XU2A 4C8QF 3RERA 4EMKA 4C8QA 1D3BA 5GANd 3JB9D 3HFNA 2EJFA 3BFMA 4M77B 4C92D 3JB9J 3GIBA 5GMKe 5GAOr 2E10A 4XTVA 5GMKi 1I5LA 5GAN3 1I81A 1JRIA 4QVCA 4M7AC 4F7UB 5LJ3h 3RIRA 2RA2A 5GAMh 4XU3A 2VXEA 4M75E 3RKYA 5GAN8 1U1TA 1Y96B 4XQ3A 4PJOC 4C8QD 4M78B 2DZ9A 4X9CA 4M7AG 4M7AF 5GANh 3RESA 3HFOA 5LJ5j 3INZA 4EMGA 3JCMd 4C92G 2RB6A 1B34A 4M7DF 5GANf 1M8VA 4N0AC 4QVDA 1U1SA 4C92C 2DTIA 4HA8A 1N9SA 3RUXA 4M77G 2EAYA 4RCBA 4M78E 3FJPA 5LJ3d 4JLIA 5GANj 2EJ9A 5GAMj 5GANg 4PJOA 4PJOE 4MMLA 4C92E 3FB9A 4F7UF 4J5YA 4M7DG 2DEQA 4M78A 2QTXA 3L1AA 3JCMQ 4C92A 1Y96A 4M78C 1N9RA 5LJ5g 4F7UG 3JCMb 2VXFA 5I21A 2HNIA 5GMKm 2FYKA 3BDUA 2RD1A 5LJ3g 1WQWA 2VC8A 4M77D 4C92B 1I8FA 5GAOl 3V8KA 4M77A 2DXUA 4NOYA 4WF2A 4JRKA 5GAN7 5GAOq 4J6WA 4C8QB 3QUIA 4HT8A 4XU1A 5GAOm 4PJOB 5LJ3f 1M5Q1 4Y91A 5LJ3e 1KQ2A 3EFSA 3FIFA 3BW1A 3QO3A 2DTOA 4XTXA 4XU0A 4M75A 5DY9A 4M78D 4C8QG 5LJ5d 5LJ5f 4M7AA 5GAN4 5LJ5e 3JB9H 3VU3C 4M7AD 1HK9A 2E64A 1HXDA 4F7UE 1B34B 1LNXA 1KQ1A 4JUVA 4PJOD 4M75G 2EWNA 3JCMV 1MGQA 3SWNB 4M78F 3M4GA 2FB7A 3RKWA 3QSUA 2K57A 2E65A 3JCMf 4NL3A 2YLBA 4F7UA 3JCMX 3V7SA 3V8JA 4J6YA 5LJ5h 2DVEA 4HT9A 4M77F 4PJOF 4M7DB 4M77E 5GAN6 2CGHA 3JCMg 4DQ2A 3JCMW 1WNLA 1D3BB 4EMKB 5GAMe 1WPYA 4JRIA 4XTUA 4PNOA 1LOJA 5GAMf 4V2SA 2ZGWA
chains in the Genus database with same CATH superfamily
3NPFA 1PHTA 4X9DA 3NHNA 2QEXQ 2B8AA 4A4EA 2KXDA 1VQPT 3CCST 4JZ3A 4R56A 4M7DA 1TH7A 1KG1A 3CPWP 1N8RU 3A8GB 1AZGB 2EKHA 2NWMA 2KI7A 4A53A 1SKUB 1SF9A 3RKXA 3M53A 2DKGA 4J9HA 1QVFS 1E6GA 2Y4XA 1BB9A 1M3BA 1ZUUA 1RABB 2ESWA 3GLXA 3CCVT 1GFCA 3M58A 3CCRQ 3DKMA 3EFOA 5HCKA 5GAMh 5C6SA 4FIBA 1YIJA 2KDSA 2RJCA 1QCOA 2DL7A 3I55A 3OBWA 2CKKA 4J9GA 3M56A 2CUBA 3TREA 2MMPA 1I0CA 2KAFA 2QEXA 1VQOQ 1QMCA 3OYAA 1YWOA 1NEBA 3VRZA 3CCJQ 4RTZA 4MZMA 3OYLA 1AOJA 3CCQQ 4IKFA 2ZPGB 1XJWB 1VQ6A 1PM3A 1S72A 4JRKA 2EGEA 3J80E 4BDYA 1X43A 4RG2A 3G1JA 4QW2A 2QXFA 5FU6B 1QVGA 2RO0A 5LJ5d 2JZ2A 3SHWA 4RTUA 2CZ0B 3URGA 4M7AA 4E7JA 2QGGA 2JJ9A 1VQ5Q 3L2VA 2E3IA 2DF6A 2RQUA 2ZPFB 2LRQA 2O2OA 4ANJA 5LJ5h 4HT9A 3HHTB 2LNVA 1PCXA 2AZSA 4AFQC 5CK9A 1WXUA 2CGHA 1ABQA 3VUZA 3H9NA 2LQNA 2VUBA 3RBBB 3R6OA 2BKDN 3A8HB 1YWPA 5GAOn 3M4YA 5D6YA 1OQKA 2KT8A 5FLXE 3L2ZA 3L42A 5GMKj 1AWXA 5GANe 1I5OB 2EQKA 1UGQB 3NFCA 3HL8A 4OB2B 1Q86U 3MJXA 3CXCS 2LC4A 2EBPA 1LJOA 4J9BA 3PGGA 1MV3A 3CXCA 1VQNA 3CQTA 1YNZA 2COZA 2M1HA 1VQ7A 4M75B 2GTJA 1OX8A 4C8QF 5AYFA 1G83A 5FU7C 2KRNA 2CDTA 4M77B 3QYGB 3UWNA 4C92D 1XOVA 3TU4K 1C1AA 3META 1JRIA 5L8RE 3PIOA 5HK0A 5GJVB 2VXEA 5DLOA 4PJOC 1M1KU 3CC7T 2P0KA 3D7SB 1PD1A 3JCMd 5FRMA 2HZYA 1Y7XA 1U8RA 4N0AC 4P5NA 2EGAA 3E19A 3X26B 1VQMT 1N9SA 1JU5C 1SHGA 1IGQA 2RJFA 5CR2A 1WJSA 1RLPC 5KYUB 1T3SA 4HVWA 2Z0WA 4A63B 1K9MC 1I8FA 2DXUA 2M0OA 3MEAA 3QZ9B 1D0ZA 3G6EA 5FWBA 2QGFB 4C8QG 2DL5A 3EG2A 4AFSC 1HK9A 5FU7B 3VRYA 1VQ4T 1VQLA 1Q82C 3PMIA 5KYWA 2DRMA 2J05A 3VS0A 3V7SA 2XK0A 4M77F 3RNJA 3OYHA 2EW3A 5A0DA 1NPRA 5GAMe 4BY6B 4XTZA 3M54A 2E6NA 3G71Q 1M1GA 4M7AE 1TWBA 1B3QA 1UGVA 3UPUA 5GMKl 2YHTA 4C0DC 2K5LA 1YI2Q 1H641 2W10A 4PJMA 2J6FA 2Y90A 4F7UG 5D6WA 1SHFA 5GAN5 2HL5C 3I35A 4C92F 3CCSQ 2LJ1A 2LT4A 2RMOA 1QW1A 5GAOr 4XTVA 4AG2C 5GMKi 1ARKA 3REBB 1I81A 1K76A 1MMAA 2BIVA 4PJLA 3LW5E 4L59A 1U1SA 2EQIA 3VJPA 3CCEA 3H41A 1SSFA 1X6BA 2K6DA 1WHMA 1GL5A 1M90C 3JCMQ 2KXCA 4OF1A 2ZZDA 1LPLA 3TQ7P 2PQWA 1M4ZA 3CMAQ 1UEBA 2IPOB 3T9NA 4WF2A 2CSIA 1OI1A 5GAOm 3QIIA 4OMMA 4FW2A 2ZAEA 2HSEB 5GAN4 2MK5A 3I56Q 1VIEA 2RJDA 1LCKA 1KFZA 4PJOD 3M4GA 3RKWA 3OA6A 4HCCA 2K57A 2DD4A 3CD6Q 5FU6C 1PRLC 1Q81R 1TOVA 4OB3B 1TTHB 2K4YA 4LNPA 5GAMd 2BZ8A 2JTEA 2DYBA 2DERA 3HRSA 5C0MA 4AT1B 1D0YA 2D0NA 2KEAA 1T0HA 5A0GA 4ZGEB 2QK0A 1OULA 4MZPA 5KE2A 1YJ9Q 4OP0A 4C0DB 5CQXA 3WVDB 1UGRB 2DJZA 1KD1U 3CCVA 4RKUE 2PZ1A 3JCMc 2COWA 2H8HA 4PLLA 2K9GA 3PFSA 2CP6A 3QYHB 2I2LA 2L3QA 1JBMA 2M16A 3JB9F 2X3WD 2DLPA 3RMQA 1AHJB 2M0YA 2P0PA 2HQHA 1WX6A 2FPEA 5GMKe 3QXEB 3CC4T 1RLQC 3NGPA 4IIOA 5LJ3h 3THKA 4Y28E 1YITA 2A3LA 2D8JA 1UJ0A 2HKNA 4A4GA 2CH4A 2R5MA 1KIKA 4BACA 5CKDA 3LYIA 2XHCA 4PJOE 2X4JA 1UHCA 2K7AA 2WSFE 4C92E 3CC2A 1UGPB 1N9RA 3GNGA 2CP7A 2V1RA 2RJEA 1MMGA 1P92A 3J7AF 2ENMA 3OS5A 2FRWA 2O9VA 3ULRB 4HT8A 2D0QB 4FT4A 1Q95G 3CCQA 3BW1A 1M2VA 4XTXA 4KT0E 2PNIA 4FYYB 3OYGA 3S6WA 1M1KR 3FC3A 2CREA 3JCMV 2G6FX 2MF2A 1U5SA 1K73C 4PFPA 2FB7A 2PUKB 2V26A 4M7DB 5D6XA 1QKXA 3S3OA 2QQSA 2RHXA 5CVIA 1GXIE 2DRKA 2FZGB 4LDWA 2X9HA 4HCBA 2ZGWA 3ER0A 2GQIA 3N5BB 3JCMh 3M9QA 2OX7A 3G7ZA 1OV3A 1VQ8A 1AWJA 2DD5A 3M57A 1GFDA 8ATCB 1K1ZA 3SDZA 4XTYA 4BD3A 3MPUB 1W70A 5FWCA 1YCYA 3ASKA 3X24B 4EIKA 3VS4A 1HSQA 5IHKA 1NYFA 4AMCA 5HKCA 5ECAA 1AWWA 2YUOA 3M5AA 2LT1A 1VQ6T 3JB9D 4FSSA 5CKEA 2OTLQ 4QVCA 1UHFA 2E6ZA 1GCQA 1VIFA 1G3SA 2EYWA 3VS7A 1AZEA 1AT1B 1D09B 1TUDA 1WHJA 1YJNQ 4JDSA 2BE7D 2E4HA 4MZTA 1JJ2P 1RAFB 3OMCA 2HNIA 2F5TX 4ATOA 2LJ0A 5IN1A 4J9EA 1N8RC 4M77A 4CI0C 2L5QA 5LJ3e 2QAZA 1U06A 3EG0A 1ZBXA 3UA6A 3CCJT 2RK1A 3CCQT 2O88A 1X27A 1YJWQ 1UJYA 2LQWA 1S72T 3OSSC 1WA7A 4RTXA 4C5EA 1M90R 3DB3A 4BE2A 5GAN6 1RAHB 3LH5A 3JCMW 3O8VA 1ZX6A 2KMTA 1YP5A 1TU0B 4LXCA 1RACB 4EMHA 3CCUT 2BZYA 2X4YA 3RMSA 1E7OA 5LJ3j 4N4IA 1Q7YR 1ZBJA 8AT1B 4EMKC 2GF7A 4HCKA 2DXCA 4RUGA 4A54A 4XK8E 3OYFA 1HJDA 2MIOA 5KYYB 3VS2A 3LH0A 3DB4A 1NJIU 2LJ3A 2LP5A 3V7CA 5EC7A 1I4K1 3JCMJ 1PSFA 5GMKh 4LDYA 1TUGB 3CD6A 2LQKA 1BCMA 3LGLA 3FEOA 3CC7Q 4HXJA 1ZSGA 4E7LA 3A8LB 4FL6A 1VQNT 5CO7A 2E5QA 1RAAB 2E10A 1WHHA 4CC7A 1JB0E 2HAXA 2QQBA 1Q7YC 3NMZC 1U1TA 1Y96B 2P0QA 4OMQA 5GANh 3M0PA 5GANf 3SD4A 4ORZA 1Q81U 1WHKA 4HA8A 3RUXA 1M2VB 1ZQ1A 1X75C 7AT1B 4AG1C 4E47A 2HD0A 4MMLA 1WHLA 2BUDA 1EX4A 2GTOA 4GLMA 4M78C 1S72Q 3QJ6A 5FRNA 2YDLA 3H8ZA 4KRTA 4F17A 4JJDA 4M77D 4C92B 3MEVA 4C0GA 5GAN7 3EG9B 2ZPEB 4UC4A 1BKBA 4Y91A 1VQ5T 4AFUC 2MCNA 4M7AD 3MP1A 2EQJA 2RF0A 1X69A 2K2VA 1EZZB 1W1FA 1M9SA 3CCSA 1YIJT 3JCMf 2R57A 3JCMX 2QA4T 3PNWC 2DVEA 5J26A 1RAEB 2ZPBB 2A37A 3NTKA 3CC2T 3CC2Q 3SFMA 1WNLA 4KGXB 2MPXC 5IHNA 4M7DE 4OB0B 2RI5A 1YI2A 1H8KA 3R6NA 2O4XA 2EPDA 1N27A 4FCYA 1QP2A 4OMFB 1AWOA 4IUPA 3VUBA 5CKBA 3M59A 1WDXA 2LMJA 2WACA 4EPCA 4BB7A 2E1HA 4PJOG 2BZXA 2DBMA 2K5FA 4XTWA 3V8LA 2VYTA 3A1PA 4J6XA 3RERA 2OTLT 4E2FB 1TXQA 4R55A 2QTVA 1BIAA 2ABLA 4OGCA 4ELZC 4EMKA 4J9IA 4BE0A 1N6AA 1YHQA 1K9MU 3NTHA 3QG1A 3CCLA 1YJNT 3OYBA 4YTLA 3CEYA 1ZSZC 1CKAA 4J9CA 3CCLQ 3PT9A 3ZEHA 3OSVA 4NS5A 3MEUA 4EMGA 3CPWS 2V8IA 2H3EB 2GBQA 1BI0A 4M77G 1NM7A 2XMFA 3CMET 1VQKA 5GAMj 2P84A 4LUEA 1VQPQ 1BI1A 4FU6A 1RI0A 2HL3A 1H3ZA 4RG8A 5I2SA 1D1CA 2VC8A 5GAOl 2LTOA 2D6FA 3A5ZB 3KXTA 1VQ4A 4XU1A 2DETA 4FYWB 4CC2A 1ZHIA 2HQEA 1YI2T 1MMDA 1UUEA 2IG0A 3Q1JA 3BE3A 1ZSZA 1UDLA 3ZL7C 3SWNB 1KSWA 3O5ZA 2QA4A 2DL4A 2L8DA 4NL3A 4JS4A 1VQKQ 1D3BB 3CC4A 1WPYA 4ZGDB 4WCIA 4IURA 2RQRA 4C8QC 2DBKA 2CP5A 4ELYC 2XKOC 1QVFA 4DBHA 4FT2A 1E6HA 1BIBA 4HVVA 4HKEA 3TSWA 2VVKA 1LVKA 3CBMA 2RN8A 3VS5A 1GRIA 3P8DA 1OU8A 1YJ9T 3CC7A 2G3RA 2XIDA 2DYIA 4BE1A 3QDRB 5I2MA 3TSZA 1H92A 2RK2A 3G71T 3L2QA 4PFOA 1VQ9T 4M75E 4J9DA 1M90U 4OB1B 4PLIA 2CS7A 1VQNQ 1ZUKA 3QKJA 2EQMA 1MNDA 2LDMA 3CD6T 1BK2A 2L0AA 3OW2S 4PFZA 4B9WA 4QKUA 1SRLA 3EG3A 2MWPA 4PJOA 1VQ5A 2XDBA 3H0IA 4FYVB 2KNBB 3L1AA 2RPNA 1Q7YU 3NTIA 1D0XA 1KHCA 2AKKA 2ZCFB 3L2WA 1MUZA 3OMGA 3BDUA 1NG2A 2E12A 1GCPA 1WQWA 3I9QA 1NJIR 2KQWA 3GP8A 3GNFB 3QZ5B 3CCUQ 2F2XA 1N5ZA 1LNXA 2DVJA 1QWEA 2X4WA 4M78F 2MAMA 1KHIA 3QSUA 4C5IA 3KUFA 4F7UA 2CH4W 3UATA 2BTTA 2XDPA 1K4US 4M77E 4OVAA 2DJQA 4LD6A 1YN8A 4GLKA 1KQSA 1IXDA 4RMOA 1KC8U 4X34A 4M75F 4X1VA 1YJWA 2FZKB 2F5KA 1RUWA 3M0QA 3OS2A 2LZ6B 4M75D 4VUBA 3VV0A 4DEYA 1VQ9Q 1T0JA 4R0KA 2DX1A 2RHYA 4M7DD 1X01A 3I55Q 3I55T 1AD5A 4OMLA 2OAWA 1XNIA 2OTJQ 4C8QA 4J83A 3BFMA 3L2RA 1QWFA 3HP9A 1SSHA 1Y71A 1WHGA 1ZUYA 2DL8A 2FZCB 1NPPA 3EHRA 1PRMC 2VB6A 3CMEQ 1V1CA 4XQ3A 1UTIA 4X9CA 2EYZA 2D1XA 4O5VA 1WFWA 1ZLMA 4FW1A 2K2MA 3GBQA 3C0CA 3UA7A 3E9GA 3ZFJA 2EAYA 4RCBA 4A4FA 3FJPA 1YITT 2MI6A 1FWZA 3L2UA 1BU1A 2V8KA 4J5YA 3M0TA 3A98A 3EGXB 3MEWA 4JJBA 4JJNK 6AT1B 3JCMb 4KGVB 1UFFA 2XDDA 1WGSA 1VQPA 3TCJA 4ZNXA 5J3BA 1BYMA 2AHJB 3V8KA 4J6WA 3CCMQ 1QQJA 1Y57A 2KR3A 2PVGB 1W2BA 2JMCA 3QO3A 2DTOA 4LN2A 5DY9A 4JPBW 3CPFA 2GNCA 3JB9H 4J7FA 3G4ST 2QG9B 2E64A 4PJJA 4F7UE 3X25B 4WTOB 2LCLA 3H6ZA 1JJ2A 1AVZC 4OMNA 4IUVA 1Q86C 3OYMA 2ZPIB 4KH0B 3HTRA 4J6YA 1R77A 3OYCA 1YJNA 3OYYA 1S1NA 1OPKA 2F2WA 4PNOA 1K8AR 2C0TA 1IGUA 2E5KA 2V8JA 1ZA2B 2JNGA 4J7IA 4DEXA 3JCMP 2JN0A 1TG0A 2YRDA 2JS2A 2DILA 2K3BA 1VQ4Q 2OTJT 1QCNA 5J39A 2OTLA 2KYBA 2YLCA 4O6JA 4C0ZA 2RQTA 5IT9E 1RAIB 3A8MB 1PG5B 2YWWA 2DIGA 3CMAT 3CCLT 2FO0A 3SWNC 2GFUA 1NYGA 1RL2A 4LE9A 3G6EQ 2JXBA 2YUQA 4ZN3A 2KROA 5GANd 2AZVA 5KYXB 4ME7A 4F7UB 1JXMA 2P4RA 4LDXA 3MKDA 2QQAA 2L3PA 2COYA 4KUDK 4LDUA 2VV5A 3INZA 3QWYA 4C5HA 3VYHB 3CCET 1B34A 4M7DF 4PK4A 2MYSA 1MV0B 1NLOC 3LLRA 1JXOA 1JQQA 5IH2A 2EJ9A 3HRTA 3G4SQ 3BDLA 3OYEA 4M7DG 4RTWA 4D6WA 1X6GA 1SPKA 3GPLA 4PL6A 5GMKm 2RQVA 2FEIA 9ATCB 4DA4A 1YIJQ 1OOTA 4PJOB 4E7HA 2HCKA 2JTFA 2QYZA 1G5VA 3EFSA 3HKSA 1ABOA 1FX7A 3MHXA 5LJ5e 3CBOA 2EYXA 1HXDA 1B34B 4A4KA 2KRMA 3J81E 2K79A 3OYNA 4II1A 3OS1A 4PJNA 2FG0A 1UG1A 4IUTA 2OJ2A 4Z88A 5CKHA 1YJWT 3CCRA 5KYXA 1K0SA 5GAMf 2E3HA 2FL7A 1LOJA 1QVFP 4V2SA 3G6ET 2DMOA 5I11A 1IREB 2EKOA 2NUZA 2DXTA 4JZ4A 4D8DA 3VS3A 1U3OA 4HCZA 1XQHA 2E41A 2VGMA 2CP3A 2QI2A 2LX9A 4FSXA 5GAMg 3VKIA 1WQ7A 3E2UA 3JB9I 2JS0A 4C8QE 3M0UA 2R5AA 2DZCA 3H0FA 4FYXB 5HK3A 3CCJA 3JCMe 2F2VA 2LNHB 2EJFA 2EQUA 2F1LA 2RA2A 5KYNA 4M78B 2DZ9A 4M7AG 4M7AF 4IUUA 1IZ6A 2RB6A 3SEMA 1VQMA 2BE9B 3GF5A 2DO3A 2JUFA 2NLUA 2DIQA 2LVMA 5KCOA 3I5SA 1HD3A 1KC8R 5GANg 3EAEA 2JT4A 2VASA 2YRVA 2DEQA 2HSPA 2JM8A 4BDZA 5DM7R 1YBYA 3KBGA 1M3CA 5LJ5g 4JLGA 5I21A 2CUDA 4E7ZA 2PUOB 2A0FB 2FYKA 5LJ3g 2Y4YA 1X2QA 1R0CB 4AFZC 1RADB 1PC0A 1OZ3A 3M0SA 3QJYA 4M78D 4M75A 2RHIA 1VOMA 5LJ5f 2XD0A 1DJ7B 3OYKA 1G2BA 2ECZA 1J3TA 1WIEA 2YLBA 3EFOB 3V8JA 4MDXA 1UECA 4PJOF 1A0NB 2W0ZA 3EGDB 3RR6A 3LWHA 4J9FA 1NBEB 4CC4B 1PD0A 1M27C 4EMKB 5EG2A 3FRNA 1M30A 2RM4A 2DTHA 4A4HA 3EFRA 4XAXB 1VQMQ 2M51A 3JV3A 2EJGA 2O9SA 1KK7A 4F14A 3P8BB 3V7RA 5IAYA 3S3NA 4OGEA 3EH1A 2LCSA 1G8XA 1ZSZB 3JSCA 1NE8A 1WZOA 3CCVQ 4M7AB 1Z9ZA 2RHZA 2CZ6B 4BY6C 2X4XA 3BY7A 1VQ7T 2JVVA 1VQ7Q 1V76A 4KGZB 4QQDA 2K3XA 4Q5WA 3GIBA 2L89A 4LDVA 2AKLA 2WSEE 1WXBA 1SEMA 2V1QA 2XG8D 3ME9A 1B07A 2QQRA 4B9XA 2C0OA 2L3RA 3OYIA 2J7IA 2FHDA 2DTIA 2RQWA 1FYNA 2DPPB 1XTDA 4HVUA 1K8AU 3OQ5A 3PTAA 2D9TA 2QASA 3EG9A 4C92A 2AK5A 2FPFA 1FMVA 1OX9A 4PKCC 2YSQA 1VYUA 2EYQA 2RD1A 5KYUA 4KBMB 1GCQC 1I07A 1W4SA 1TS9A 4M4ZA 1WYXA 5I22A 1KD1R 2X3XD 1PKTA 5CCAA 1VQ8Q 3VU3C 3AT1B 2DL3A 4MDWA 2WSCE 2HMAA 2E65A 1WXTA 3E9FA 3OB9A 3PVLA 2AT1B 5KCHA 4F16A 2PU9B 4JRIA 2PTKA 2ZPHB 3CMEA 4QQ6A 4BUGA 1Q82R 1VQKT 4M75C 5CIUA 2YUNA 5GAN2 2I0NA 3M0RA 1UGSB 4ZN1A 2O01E 2XI9A 2C06A 1F1BB 2KYMA 1BBZA 2QEXT 4MMKA 3JAME 4FM4B 1YHQT 1QVGP 4RCCA 2JTMA 3QBYA 3VYGA 3DLLA 2LQ8A 3IQLA 2RNAA 2EYYA 1NZ9A 1M3AA 2PVOB 3MCAB 1GBQA 3MP8A 4C8QD 1WI7A 2CZ1B 1VQOT 1G3YA 3RESA 1BI3A 2LX7A 5LJ5j 5KH6A 4C92C 4RTYA 1JJ2S 5D7UA 1Q81C 5GANj 1PWTA 3FDRA 4E7SA 3OS0A 1B7TA 2VXFA 3OW2P 3FJ5A 1KD1C 3MP6A 2F69A 1CKBA 4C0FA 4BI3A 1QVGS 1FMKA 3C12A 4QVZA 2DA9A 2QDYB 1ZA1B 2R58A 2YXYA 3I5RA 4N4HA 1K0XA 5A0LA 1UE9A 3X28B 1M1FA 3C4SA 2EVRA 3RDVA 3OY9A 4M75G 1KC8C 2DK3A 2IVWA 2A08A 1NLPC 2J06A 4QQGA 3LGFA 1RI9A 2DXBA 1VQLT 4D8KA 4J8OA 4DQ2A 1K8AC 4XTUA 2YT6A 2C0IA 1K73U 5IXFA 2VGNA 5M9OA 2KBTA 1WJQA 4LUDA 2GFAA 3EGDA 4OMPA 2CP0A 1TUCA 4M77C 5GAOp 2OTJA 1EIFA 2JM9A 4EDUA 3CPWA 2M9UA 5FW9A 3F70A 3HFNA 2RI3A 1G3TA 3A8OB 1I5LA 2LCCA 2SEMA 5GAN3 3HRUA 2QDLA 4KULA 4IIMA 1SG5A 3PE0A 1VYVA 3EHQA 5GAN8 1M8VA 4JRPA 3RKYA 1VQLQ 1FXXA 2IIMA 1C0MA 2RHUA 2DAQA 1YITQ 2GQVA 2A36A 4QVDA 2AIRB 1NEGA 4DBQA 2NUTB 3QDFA 4N4GA 4RTVA 4F7UF 1M8MA 3G71A 1MNEA 2QTXA 3CCMT 1VQ8T 1MHNA 4DBFA 3GOXA 3QUIA 3REAB 4TVRA 4LD9K 2ROLA 1QP3A 1N8RR 5AT1B 1OU9A 1X6OA 1K9MR 4DOWA 1TSFA 1JO8A 2NUPB 4ESRA 5GJWB 3CXCP 4Z89A 1W2BS 2CSQA 1BCOA 1QVPA 2B86A 4OMOA 4GBQA 4B6MA 4ZTJA 3WXMB 2XU8A 3WVEB 2E70A 2CT3A 1D1AA 3OYDA 1M1KC 4E6RA 2SRCA 2HBWA 4M78G 1NJIC 1VQ9A 1WLPB 2CP2A 3AHUA 4ZTFA 3JRZA 2NUPA 3H0HA 1WJRA 4Z02A 5HY6A 2CZ7B 3SB2A 3LX7A 1BI2A 3HSBA 2ATCB 2HBPA 1YJ9A 2ROTA 1EFNA 1R8OB 5IXBA 4XU2A 2O31A 1IHVA 3CCUA 3PVQA 1D3BA 3JB9J 1C6VX 2X51A 3OW2A 1YHQQ 3CCEQ 1VYTA 4M7AC 3P8HA 2RH2A 3UT1A 2MOXA 4XU3A 1IO6A 2J6KA 2JOYA 5A2QE 2H3JA 4KH1B 3HFOA 2EFIA 3LWIA 2NYSA 3FLGA 3VS6A 1HYOA 3CBPA 1VUBA 1YCSB 1IB8A 4M78E 4JLIA 2L3SA 3KFVA 3OYJA 4L5GA 4RTTA 2FRYA 1ACMB 3QWXX 1Y96A 3PIPA 1GBRA 1Q86R 2EIFA 1RAGB 4QT7A 3VS1A 2QA4Q 3I56A 4DBRA 4JS5A 3I56T 3DLMA 3EGXA 1KQSP 4NOYA 5GAOq 2OAUA 2YRCA 3CC4Q 2ED0A 5L23A 1KQ2A 1Y07A 2FVUA 3E1SA 2XICA 1KJWA 1KQSS 1X2KA 1O75A 1KQ1A 4JUVA 5CQYA 1MGQA 3CMAA 1PNJA 3UDCA 1PSEA 2HQXA 4BI8B 3X20B 2JMAA 1OYXA 5KYYA 3JCMg 2FPDA 4DOVA 1SRMA 2HEQA 2QQ9A 4CC3A 3EGUA 4K11A 1QLYA 2DEUA 2CYZB 4Y92A 1O9SA 1JEGA 3PMTA 2YUPA 1AEYA 2DE0X 2GCXA 4N0AA 1FMWA 1T3LA 1IRXA 2KK4A 2M02A 2DFUA 3CCMA 1VA7A 1IHWA 2HKQB 1YFNA 2KE9A 3QHSA 3ZBDA 3JB9G 1PKSA 2D8HA 3SWNA 3TVTA 4NL2A 3G4SA 2X35A 4L6V5 1VQ6Q 4JJCA 3EG1A 4JRQA 2EGCA 2JW4A 4M7DC 5CAIA 2O4XB 1MMNA 1UB4A 2VKNA 3EH2A 4KUIA 2GGRA 1VQOA 2K5IA 1Z9QA 2ED1A 2KT1A 3C94A 1R0BG 3RIRA 1OZ2A 2VWFA 5KYWB 2A28A 3OBYA 2MWOA 4E7KA 1QCFA 5IHIA 1QKWA 1OPLA 1K9AA 4C5GA 2J6OA 2RI2A 5LJ3d 3M55A 5LL6S 1Y0MA 3U23A 1K73R 3FB9A 2KGTA 2KVQG 2L2PA 2KY9A 2OI3A 2KSSA 3QPHA 4M78A 2KRSA 3CCRT 1W2BP 1OEBA 4ZGJB 4CRIA 4IUQA 1Q82U 3S3MA 4F04B 5DLQE 2P4TA 4GY5A 1V29B 5CKFA 1G3WA 4C8QB 1I1JA 3HPWA 2NUTA 1M2OA 5LJ3f 1M5Q1 2A7YA 4E7IA 4Z8AA 3FIFA 1H3HA 1CSKA 3TEEA 2CT4A 4XU0A 3MO8A 3UF4A 2DNUA 3C95A 2EWNA 1D1BA 1W6XA 5FROA 5KE3A 2DM1A 2PVDB 2HDAA 4BI4A 2K3YA 4C92G
chains in the Genus database with same CATH topology
3CMEA 4QQ6A 4BUGA 1KC8U 1VQKT 4M75C 3ER0A 4X9DA 5CIUA 4X34A 2B8AA 4A4EA 3N5BB 5GAN2 3JCMh 3CCJT 3M9QA 4M75F 1YJWA 3G7ZA 2F5KA 1UGSB 1VQPT 4ZN1A 2O01E 4R56A 3CCST 2DD5A 2XI9A 1TH7A 3M57A 1VQ8A 3OS2A 2C06A 1N8RU 1KG1A 3A8GB 4M75D 4VUBA 3VV0A 2QEXT 4MMKA 3SDZA 3JAME 4M7DE 4FM4B 4A53A 4XTYA 4BD3A 1YHQT 4RCCA 2JTMA 2RHYA 3RKXA 1YCYA 3ASKA 3M53A 3QBYA 2DKGA 1X01A 3X24B 5HKCA 4M7DD 3I55T 3VYGA 3DLLA 3M5AA 2LQ8A 2LT1A 1QVFS 1XNIA 2Y4XA 1VQ6T 4C8QA 3JB9D 4J83A 3BFMA 3L2RA 3GLXA 3CCVT 3HP9A 1NZ9A 5CKEA 2PVOB 1Y71A 3M58A 3DKMA 4QVCA 1NPPA 3MCAB 5GAMh 2E6ZA 1VIFA 4XQ3A 3MP8A 4FIBA 4C8QD 5C6SA 4X9CA 1YIJA 2CZ1B 1VQOT 1G3YA 1G3SA 2KDSA 2RJCA 1BI3A 4O5VA 3RESA 5LJ5j 5KH6A 4C92C 3I55A 3OBWA 1JJ2S 2CKKA 3E9GA 2EAYA 4RCBA 3ZFJA 4A4FA 3FJPA 3M56A 4JDSA 5GANj 1Q81C 3TREA 2MMPA 1YITT 2MI6A 1FWZA 3L2UA 2KAFA 2QEXA 3FDRA 2V8KA 4J5YA 4MZTA 3OYAA 3MEWA 3OS0A 4JJNK 3JCMb 3OMCA 2VXFA 2XDDA 1WGSA 2HNIA 1KD1C 1VQPA 3OYLA 4MZMA 3MP6A 2F5TX 2F69A 3TCJA 4IKFA 2ZPGB 5J3BA 1BYMA 4C0FA 1VQ6A 4ATOA 5IN1A 1N8RC 2AHJB 3V8KA 4BI3A 4M77A 1S72A 3C12A 4CI0C 4JRKA 1QVGS 2L5QA 4J6WA 3J80E 4BDYA 4QVZA 2QDYB 2R58A 4RG2A 5LJ3e 2PVGB 4QW2A 2QXFA 5FU6B 1W2BA 1QVGA 4N4HA 1ZBXA 2RO0A 2DTOA 3QO3A 5DY9A 2JZ2A 2RK1A 3CPFA 2CZ0B 3URGA 5A0LA 3X28B 5LJ5d 4J7FA 3G4ST 1M1FA 3JB9H 4F7UE 2E64A 3CCQT 3C4SA 4E7JA 3X25B 2LCLA 3OY9A 4M75G 3H6ZA 1JJ2A 1KC8C 3G6ET 1S72T 3OSSC 4IUVA 3L2VA 1Q86C 2DK3A 4C5EA 3OYMA 2ZPIB 2IVWA 2ZPFB 4QQGA 2LRQA 4J6YA 3DB3A 3LGFA 5LJ5h 3HHTB 4BE2A 4HT9A 2LNVA 3OYCA 2DXBA 5GAN6 5CK9A 1YJNA 3OYYA 1VQLT 2CGHA 4J8OA 4DQ2A 3JCMW 1K8AC 3O8VA 3VUZA 4XTUA 4PNOA 2KMTA 2V8JA 1K73U 2JNGA 2VUBA 4J7IA 3CCUT 4EMHA 3R6OA 2BKDN 2JN0A 3A8HB 3JCMP 2VGNA 2X4YA 5M9OA 5GAOn 3RMSA 3M4YA 1WJQA 5D6YA 5LJ3j 4N4IA 5FLXE 4EMKC 2OTJT 2GF7A 5J39A 3L2ZA 2DXCA 3L42A 2YLCA 4O6JA 4C0ZA 4A54A 2GFAA 5GANe 5GMKj 3A8MB 4XK8E 3OYFA 5IT9E 2EQKA 1UGQB 3NFCA 3LH0A 3HL8A 3DB4A 4OB2B 2DIGA 1NJIU 3CMAT 3CCLT 1Q86U 3V7CA 3CXCS 2LC4A 1I4K1 1LJOA 3SWNC 2GFUA 3JCMJ 4M77C 1PSFA 3PGGA 1RL2A 5GAOp 5GMKh 3CXCA 2OTJA 1VQNA 4LDYA 1VQ7A 1EIFA 2M1HA 4M75B 2LQKA 3CD6A 3LGLA 3FEOA 4EDUA 4E7LA 4C8QF 3CPWA 3A8LB 4ZN3A 4FL6A 1VQNT 5CO7A 2M9UA 5AYFA 5GANd 5FU7C 3F70A 2E5QA 3HFNA 2RI3A 4M77B 3UWNA 3QYGB 4C92D 1G3TA 2E10A 3A8OB 4ME7A 1I5LA 2LCCA 1XOVA 5GAN3 3TU4K 3HRUA 3META 1JRIA 4KULA 5L8RE 5HK0A 3PIOA 4F7UB 1JB0E 2HAXA 5GAN8 4LDXA 1M8VA 2QQBA 2VXEA 3RKYA 5DLOA 1U1TA 1Y96B 2QQAA 4JRPA 2P0QA 1Q7YC 4KUDK 4PJOC 1M1KU 3CC7T 1FXXA 2P0KA 5GANh 4LDUA 2RHUA 2VV5A 3INZA 4C5HA 3VYHB 2DAQA 1B34A 4C92G 2GQVA 3JCMd 3CCET 5FRMA 1Y7XA 5GANf 3SD4A 4N0AC 4QVDA 4P5NA 3E19A 1U8RA 3LLRA 4HA8A 1Q81U 3X26B 1VQMT 1N9SA 3RUXA 1ZQ1A 1X75C 2EJ9A 3HRTA 4E47A 2HD0A 4MMLA 4N4GA 2RJFA 5CR2A 3BDLA 2BUDA 4F7UF 3OYEA 1WJSA 4M7DG 3G71A 2QTXA 4D6WA 4M78C 3QJ6A 5FRNA 3CCMT 1VQ8T 3GPLA 3H8ZA 4PL6A 5GMKm 1K9MC 4M77D 4C92B 3MEVA 1I8FA 1MHNA 4M7DA 4C0GA 3GOXA 2DXUA 5GAN7 4DA4A 2ZPEB 4UC4A 1BKBA 3QUIA 4PJOB 2M0OA 4E7HA 2JTFA 4TVRA 3MEAA 3QZ9B 4Y91A 4LD9K 1VQ5T 1G5VA 3EFSA 3HKSA 1QP3A 3G6EA 4C8QG 4M7AD 1FX7A 3MHXA 5LJ5e 3CBOA 1HK9A 1HXDA 1B34B 1X6OA 5FU7B 3MP1A 4A4KA 3J81E 3OYNA 1VQ4T 2EQJA 4II1A 1VQLA 4DOWA 3OS1A 1Q82C 2K2VA 1M9SA 3PMIA 4IUTA 3CCSA 1YIJT 3JCMf 5CKHA 2R57A 3JCMX 2QA4T 3V7SA 3PNWC 2DVEA 2XK0A 4M77F 1YJWT 5J26A 1W2BS 3OYHA 2ZPBB 5A0DA 1QVPA 3NTKA 1NPRA 3CCRA 3CC2T 3SFMA 1WNLA 5GAMf 5GAMe 2FL7A 1LOJA 4V2SA 4ZTJA 3WXMB 2XU8A 4OB0B 4XTZA 2RI5A 2E70A 3M54A 2E6NA 3WVEB 4BY6B 1IREB 2EKOA 1M1GA 1YI2A 2DXTA 2O4XA 4M7AE 3OYDA 1M1KC 1N27A 4HCZA 5GMKl 3UPUA 2YHTA 1QP2A 1XQHA 2E41A 4C0DC 4OMFB 2VGMA 2QI2A 4IUPA 3VUBA 2LX9A 4M78G 4FSXA 5GAMg 5CKBA 3M59A 1NJIC 3VKIA 1VQ9A 2K5LA 2WACA 4EPCA 4ZTFA 3AHUA 1H641 2E1HA 3JRZA 4PJOG 4BB7A 1WQ7A 3JB9I 2K5FA 4XTWA 4C8QE 1WJRA 2R5AA 3V8LA 2Y90A 4F7UG 2VYTA 2DZCA 4J6XA 4Z02A 5HY6A 2CZ7B 5D6WA 5HK3A 3CCJA 3SB2A 3LX7A 5GAN5 1BI2A 4R55A 2OTLT 3HSBA 2HBPA 1YJ9A 1BIAA 4C92F 1R8OB 4OGCA 3JCMe 4ELZC 4XU2A 3CCUA 2LT4A 4EMKA 1D3BA 4BE0A 1N6AA 2EJFA 2EQUA 1QW1A 1YHQA 3JB9J 5GAOr 4XTVA 5GMKi 1K9MU 3NTHA 3QG1A 3OW2A 1I81A 3CCLA 1YJNT 4M7AC 3OYBA 3P8HA 4YTLA 3CEYA 2RH2A 2RA2A 3UT1A 4XU3A 2JOYA 2BIVA 3PT9A 3ZEHA 5A2QE 4M78B 2DZ9A 3OSVA 2H3JA 3LW5E 4NS5A 4M7AG 4M7AF 4IUUA 1IZ6A 3HFOA 3MEUA 4M7AA 2EFIA 4EMGA 3LWIA 2RB6A 3FLGA 3CPWS 2V8IA 1VQMA 4L59A 1U1SA 2DO3A 2JUFA 2NLUA 3CBPA 1VUBA 3GF5A 2DIQA 1BI0A 2LVMA 3VJPA 4M77G 5KCOA 3CCEA 4M78E 4JLIA 3OYJA 1SSFA 4L5GA 3CMET 1VQKA 5GAMj 5GANg 3EAEA 2YRVA 1M90C 2DEQA 3JCMQ 1BI1A 1Y96A 3PIPA 5DM7R 4BDZA 1YBYA 2EIFA 3KBGA 5LJ5g 4FU6A 1RI0A 4JLGA 4OF1A 5I21A 1H3ZA 4RG8A 2PUOB 2ZZDA 3I56A 4JS5A 2FYKA 5LJ3g 2Y4YA 5I2SA 3DLMA 3I56T 2VC8A 2PQWA 5GAOl 1M4ZA 2LTOA 1UEBA 2D6FA 3A5ZB 3T9NA 4NOYA 4WF2A 5GAOq 3KXTA 1OI1A 4XU1A 5GAOm 3QIIA 2OAUA 1VQ4A 1KQ2A 1ZHIA 1Y07A 2HQEA 2FVUA 1OZ3A 3E1SA 1YI2T 3QJYA 2IG0A 4M78D 4M75A 2RHIA 5LJ5f 2XICA 3Q1JA 5GAN4 2XD0A 1KQSS 1VIEA 1O75A 2RJDA 1KQ1A 4JUVA 1DJ7B 5CQYA 3OYKA 4PJOD 1MGQA 3CMAA 3SWNB 3UDCA 1PSEA 3M4GA 3RKWA 3OA6A 2QA4A 2HQXA 4HCCA 2K57A 2L8DA 3X20B 2YLBA 4BI8B 4NL3A 4JS4A 2DD4A 3V8JA 1OYXA 4MDXA 4PJOF 3LWHA 5FU6C 3JCMg 4OB3B 1D3BB 4EMKB 4DOVA 1WPYA 3CC4A 2K4YA 4ZGDB 5EG2A 3FRNA 2QQ9A 5GAMd 2RM4A 2DTHA 4A4HA 4IURA 2CYZB 3EFRA 4XAXB 3HRSA 1O9SA 5C0MA 3PMTA 4C8QC 2GCXA 4ELYC 2XKOC 4N0AA 2EJGA 5A0GA 1QVFA 2KK4A 4ZGEB 3CCMA 3QHSA 4MZPA 5KE2A 3ZBDA 3JB9G 3P8BB 4OP0A 3V7RA 4C0DB 5IAYA 4FT2A 3S3NA 5CQXA 3SWNA 1BIBA 3WVDB 1UGRB 2DJZA 1KD1U 4NL2A 3G4SA 2X35A 4HKEA 3CCVA 4OGEA 4RKUE 3JCMc 4L6V5 4PLLA 3JSCA 1NE8A 4JRQA 3PFSA 4M7DC 4M7DF 5CAIA 4M7AB 2O4XB 2CZ6B 2RHZA 3QYHB 2I2LA 2M16A 1JBMA 1UB4A 3CBMA 4BY6C 3JB9F 2X4XA 3BY7A 3P8DA 1VQ7T 2JVVA 3RMQA 1YJ9T 1AHJB 4KUIA 3RERA 1VQOA 2P0PA 4QQDA 2K3XA 3CC7A 2K5IA 4Q5WA 3GIBA 2L89A 4LDVA 5GMKe 3QXEB 3CC4T 2G3RA 2WSEE 2XIDA 4BE1A 2XG8D 3C94A 3QDRB 5I2MA 2RK2A 3ME9A 5LJ3h 3G71T 3RIRA 4Y28E 3L2QA 1OZ2A 1VQ9T 4M75E 2QQRA 3OBYA 2MWOA 4OB1B 4E7KA 4PLIA 2A3LA 4B9XA 2CS7A 1YITA 1M90U 3QKJA 4A4GA 4C5GA 2EQMA 2L3RA 3OYIA 2LDMA 2FHDA 2DTIA 2R5MA 4BACA 2RI2A 3CD6T 2DPPB 1XTDA 1K8AU 5CKDA 5LJ3d 3OQ5A 3OW2S 3M55A 5LL6S 3PTAA 2D9TA 4B9WA 3LYIA 2XHCA 2MWPA 4PJOA 4PJOE 1VQ5A 2XDBA 2X4JA 2WSFE 4C92E 3FB9A 2KVQG 2KY9A 2KSSA 3QPHA 4M78A 3CCRT 3L1AA 3CC2A 4C92A 1Q7YU 1UGPB 1N9RA 4ZGJB 3NTIA 4CRIA 4PKCC 3GNGA 1KHCA 4IUQA 3S3MA 1Q82U 2ZCFB 2RJEA 2EYQA 3L2WA 3OMGA 3BDUA 1P92A 2E12A 2P4TA 2RD1A 5DLQE 1WQWA 3J7AF 4GY5A 1V29B 4KBMB 1W4SA 3OS5A 5CKFA 1G3WA 4HT8A 4C8QB 3HPWA 2KQWA 2D0QB 4FT4A 5LJ3f 3GNFB 1M5Q1 3QZ5B 3GP8A 2A7YA 3CCQA 4E7IA 3FIFA 3BW1A 4XTXA 3TEEA 4XU0A 4KT0E 5CCAA 3MO8A 2OTLA 3OYGA 3VU3C 3S6WA 1LNXA 3FC3A 3C95A 2EWNA 4MDWA 3JCMV 2MF2A 2X4WA 1K73C 4M78F 2MAMA 2FB7A 1KHIA 2WSCE 5FROA 2PUKB 5KE3A 2E65A 3E9FA 4C5IA 3KUFA 4F7UA 3QSUA 2XDPA 2PVDB 4M7DB 5D6XA 3OB9A 3S3OA 2QQSA 5KCHA 2RHXA 4M77E 5CVIA 4OVAA 1GXIE 4LD6A 4BI4A 4GLKA 2PU9B 4JRIA 4LDWA 1KQSA 4RMOA 2K3YA 2ZPHB 4HCBA 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM d;  4M7D E;  4XTZ A;  4M75 C;  2RM4 A;  2DTH A;  4EMH A;  3JCM P;  2DXT A;  2JN0 A;  3EFR A;  4X9D A;  4M7A E;  5GAO n;  5GAN 2;  4C8Q C;  3JCM h;  4M75 F;  5LJ3 j;  5GMK l;  4EMK C;  2YHT A;  3L2Z A;  2E41 A;  2YLC A;  4N0A A;  4A54 A;  5GMK j;  5GAN e;  2EJG A;  4M78 G;  5GAM g;  4M7D A;  1TH7 A;  3AHU A;  3QHS A;  1H64 1;  2E1H A;  4PJO G;  3JB9 G;  4M75 D;  4OP0 A;  1WQ7 A;  3V7C A;  3V7R A;  3JB9 I;  4C8Q E;  4XTW A;  1I4K 1;  3SWN A;  1BIB A;  2DJZ A;  1LJO A;  2Y90 A;  4MMK A;  4NL2 A;  3SWN C;  3V8L A;  2DZC A;  4J6X A;  4XTY A;  4M77 C;  4A53 A;  3PGG A;  4RCC A;  3JCM c;  3SB2 A;  5GMK h;  5GAN 5;  5GAO p;  3HSB A;  4M7D C;  3RKX A;  1YCY A;  4M7D D;  5CAI A;  4M7A B;  1BIA A;  1X01 A;  2DKG A;  4M75 B;  4C92 F;  3JCM e;  2I2L A;  1JBM A;  3JCM J;  3JB9 F;  3BY7 A;  4XU2 A;  4C8Q F;  3RER A;  4EMK A;  4C8Q A;  1D3B A;  5GAN d;  3JB9 D;  3HFN A;  2EJF A;  3BFM A;  4M77 B;  4C92 D;  3JB9 J;  3GIB A;  5GMK e;  5GAO r;  2E10 A;  4XTV A;  5GMK i;  1I5L A;  5GAN 3;  1I81 A;  1JRI A;  4QVC A;  4M7A C;  4F7U B;  5LJ3 h;  3RIR A;  2RA2 A;  5GAM h;  4XU3 A;  2VXE A;  4M75 E;  3RKY A;  5GAN 8;  1U1T A;  1Y96 B;  4XQ3 A;  4PJO C;  4C8Q D;  4M78 B;  2DZ9 A;  4X9C A;  4M7A G;  4M7A F;  5GAN h;  3RES A;  3HFO A;  5LJ5 j;  3INZ A;  4EMG A;  3JCM d;  4C92 G;  2RB6 A;  1B34 A;  4M7D F;  5GAN f;  1M8V A;  4N0A C;  4QVD A;  1U1S A;  4C92 C;  2DTI A;  4HA8 A;  1N9S A;  3RUX A;  4M77 G;  2EAY A;  4RCB A;  4M78 E;  3FJP A;  5LJ3 d;  4JLI A;  5GAN j;  2EJ9 A;  5GAM j;  5GAN g;  4PJO A;  4PJO E;  4MML A;  4C92 E;  3FB9 A;  4F7U F;  4J5Y A;  4M7D G;  2DEQ A;  4M78 A;  2QTX A;  3L1A A;  3JCM Q;  4C92 A;  1Y96 A;  4M78 C;  1N9R A;  5LJ5 g;  4F7U G;  3JCM b;  2VXF A;  5I21 A;  2HNI A;  5GMK m;  2FYK A;  3BDU A;  2RD1 A;  5LJ3 g;  1WQW A;  2VC8 A;  4M77 D;  4C92 B;  1I8F A;  5GAO l;  3V8K A;  4M77 A;  2DXU A;  4NOY A;  4WF2 A;  4JRK A;  5GAN 7;  5GAO q;  4J6W A;  4C8Q B;  3QUI A;  4HT8 A;  4XU1 A;  5GAO m;  4PJO B;  5LJ3 f;  1M5Q 1;  4Y91 A;  5LJ3 e;  1KQ2 A;  3EFS A;  3FIF A;  3BW1 A;  3QO3 A;  2DTO A;  4XTX A;  4XU0 A;  4M75 A;  5DY9 A;  4M78 D;  4C8Q G;  5LJ5 d;  5LJ5 f;  4M7A A;  5GAN 4;  5LJ5 e;  3JB9 H;  3VU3 C;  4M7A D;  1HK9 A;  2E64 A;  1HXD A;  4F7U E;  1B34 B;  1LNX A;  1KQ1 A;  4JUV A;  4PJO D;  4M75 G;  2EWN A;  3JCM V;  1MGQ A;  3SWN B;  4M78 F;  3M4G A;  2FB7 A;  3RKW A;  3QSU A;  2K57 A;  2E65 A;  3JCM f;  4NL3 A;  2YLB A;  4F7U A;  3JCM X;  3V7S A;  3V8J A;  4J6Y A;  5LJ5 h;  2DVE A;  4HT9 A;  4M77 F;  4PJO F;  4M7D B;  4M77 E;  5GAN 6;  2CGH A;  3JCM g;  4DQ2 A;  3JCM W;  1WNL A;  1D3B B;  4EMK B;  5GAM e;  1WPY A;  4JRI A;  4XTU A;  4PNO A;  1LOJ A;  5GAM f;  4V2S A;  2ZGW A; 
#chains in the Genus database with same CATH topology
 3NPF A;  1PHT A;  4X9D A;  3NHN A;  2QEX Q;  2B8A A;  4A4E A;  2KXD A;  1VQP T;  3CCS T;  4JZ3 A;  4R56 A;  4M7D A;  1TH7 A;  1KG1 A;  3CPW P;  1N8R U;  3A8G B;  1AZG B;  2EKH A;  2NWM A;  2KI7 A;  4A53 A;  1SKU B;  1SF9 A;  3RKX A;  3M53 A;  2DKG A;  4J9H A;  1QVF S;  1E6G A;  2Y4X A;  1BB9 A;  1M3B A;  1ZUU A;  1RAB B;  2ESW A;  3GLX A;  3CCV T;  1GFC A;  3M58 A;  3CCR Q;  3DKM A;  3EFO A;  5HCK A;  5GAM h;  5C6S A;  4FIB A;  1YIJ A;  2KDS A;  2RJC A;  1QCO A;  2DL7 A;  3I55 A;  3OBW A;  2CKK A;  4J9G A;  3M56 A;  2CUB A;  3TRE A;  2MMP A;  1I0C A;  2KAF A;  2QEX A;  1VQO Q;  1QMC A;  3OYA A;  1YWO A;  1NEB A;  3VRZ A;  3CCJ Q;  4RTZ A;  4MZM A;  3OYL A;  1AOJ A;  3CCQ Q;  4IKF A;  2ZPG B;  1XJW B;  1VQ6 A;  1PM3 A;  1S72 A;  4JRK A;  2EGE A;  3J80 E;  4BDY A;  1X43 A;  4RG2 A;  3G1J A;  4QW2 A;  2QXF A;  5FU6 B;  1QVG A;  2RO0 A;  5LJ5 d;  2JZ2 A;  3SHW A;  4RTU A;  2CZ0 B;  3URG A;  4M7A A;  4E7J A;  2QGG A;  2JJ9 A;  1VQ5 Q;  3L2V A;  2E3I A;  2DF6 A;  2RQU A;  2ZPF B;  2LRQ A;  2O2O A;  4ANJ A;  5LJ5 h;  4HT9 A;  3HHT B;  2LNV A;  1PCX A;  2AZS A;  4AFQ C;  5CK9 A;  1WXU A;  2CGH A;  1ABQ A;  3VUZ A;  3H9N A;  2LQN A;  2VUB A;  3RBB B;  3R6O A;  2BKD N;  3A8H B;  1YWP A;  5GAO n;  3M4Y A;  5D6Y A;  1OQK A;  2KT8 A;  5FLX E;  3L2Z A;  3L42 A;  5GMK j;  1AWX A;  5GAN e;  1I5O B;  2EQK A;  1UGQ B;  3NFC A;  3HL8 A;  4OB2 B;  1Q86 U;  3MJX A;  3CXC S;  2LC4 A;  2EBP A;  1LJO A;  4J9B A;  3PGG A;  1MV3 A;  3CXC A;  1VQN A;  3CQT A;  1YNZ A;  2COZ A;  2M1H A;  1VQ7 A;  4M75 B;  2GTJ A;  1OX8 A;  4C8Q F;  5AYF A;  1G83 A;  5FU7 C;  2KRN A;  2CDT A;  4M77 B;  3QYG B;  3UWN A;  4C92 D;  1XOV A;  3TU4 K;  1C1A A;  3MET A;  1JRI A;  5L8R E;  3PIO A;  5HK0 A;  5GJV B;  2VXE A;  5DLO A;  4PJO C;  1M1K U;  3CC7 T;  2P0K A;  3D7S B;  1PD1 A;  3JCM d;  5FRM A;  2HZY A;  1Y7X A;  1U8R A;  4N0A C;  4P5N A;  2EGA A;  3E19 A;  3X26 B;  1VQM T;  1N9S A;  1JU5 C;  1SHG A;  1IGQ A;  2RJF A;  5CR2 A;  1WJS A;  1RLP C;  5KYU B;  1T3S A;  4HVW A;  2Z0W A;  4A63 B;  1K9M C;  1I8F A;  2DXU A;  2M0O A;  3MEA A;  3QZ9 B;  1D0Z A;  3G6E A;  5FWB A;  2QGF B;  4C8Q G;  2DL5 A;  3EG2 A;  4AFS C;  1HK9 A;  5FU7 B;  3VRY A;  1VQ4 T;  1VQL A;  1Q82 C;  3PMI A;  5KYW A;  2DRM A;  2J05 A;  3VS0 A;  3V7S A;  2XK0 A;  4M77 F;  3RNJ A;  3OYH A;  2EW3 A;  5A0D A;  1NPR A;  5GAM e;  4BY6 B;  4XTZ A;  3M54 A;  2E6N A;  3G71 Q;  1M1G A;  4M7A E;  1TWB A;  1B3Q A;  1UGV A;  3UPU A;  5GMK l;  2YHT A;  4C0D C;  2K5L A;  1YI2 Q;  1H64 1;  2W10 A;  4PJM A;  2J6F A;  2Y90 A;  4F7U G;  5D6W A;  1SHF A;  5GAN 5;  2HL5 C;  3I35 A;  4C92 F;  3CCS Q;  2LJ1 A;  2LT4 A;  2RMO A;  1QW1 A;  5GAO r;  4XTV A;  4AG2 C;  5GMK i;  1ARK A;  3REB B;  1I81 A;  1K76 A;  1MMA A;  2BIV A;  4PJL A;  3LW5 E;  4L59 A;  1U1S A;  2EQI A;  3VJP A;  3CCE A;  3H41 A;  1SSF A;  1X6B A;  2K6D A;  1WHM A;  1GL5 A;  1M90 C;  3JCM Q;  2KXC A;  4OF1 A;  2ZZD A;  1LPL A;  3TQ7 P;  2PQW A;  1M4Z A;  3CMA Q;  1UEB A;  2IPO B;  3T9N A;  4WF2 A;  2CSI A;  1OI1 A;  5GAO m;  3QII A;  4OMM A;  4FW2 A;  2ZAE A;  2HSE B;  5GAN 4;  2MK5 A;  3I56 Q;  1VIE A;  2RJD A;  1LCK A;  1KFZ A;  4PJO D;  3M4G A;  3RKW A;  3OA6 A;  4HCC A;  2K57 A;  2DD4 A;  3CD6 Q;  5FU6 C;  1PRL C;  1Q81 R;  1TOV A;  4OB3 B;  1TTH B;  2K4Y A;  4LNP A;  5GAM d;  2BZ8 A;  2JTE A;  2DYB A;  2DER A;  3HRS A;  5C0M A;  4AT1 B;  1D0Y A;  2D0N A;  2KEA A;  1T0H A;  5A0G A;  4ZGE B;  2QK0 A;  1OUL A;  4MZP A;  5KE2 A;  1YJ9 Q;  4OP0 A;  4C0D B;  5CQX A;  3WVD B;  1UGR B;  2DJZ A;  1KD1 U;  3CCV A;  4RKU E;  2PZ1 A;  3JCM c;  2COW A;  2H8H A;  4PLL A;  2K9G A;  3PFS A;  2CP6 A;  3QYH B;  2I2L A;  2L3Q A;  1JBM A;  2M16 A;  3JB9 F;  2X3W D;  2DLP A;  3RMQ A;  1AHJ B;  2M0Y A;  2P0P A;  2HQH A;  1WX6 A;  2FPE A;  5GMK e;  3QXE B;  3CC4 T;  1RLQ C;  3NGP A;  4IIO A;  5LJ3 h;  3THK A;  4Y28 E;  1YIT A;  2A3L A;  2D8J A;  1UJ0 A;  2HKN A;  4A4G A;  2CH4 A;  2R5M A;  1KIK A;  4BAC A;  5CKD A;  3LYI A;  2XHC A;  4PJO E;  2X4J A;  1UHC A;  2K7A A;  2WSF E;  4C92 E;  3CC2 A;  1UGP B;  1N9R A;  3GNG A;  2CP7 A;  2V1R A;  2RJE A;  1MMG A;  1P92 A;  3J7A F;  2ENM A;  3OS5 A;  2FRW A;  2O9V A;  3ULR B;  4HT8 A;  2D0Q B;  4FT4 A;  1Q95 G;  3CCQ A;  3BW1 A;  1M2V A;  4XTX A;  4KT0 E;  2PNI A;  4FYY B;  3OYG A;  3S6W A;  1M1K R;  3FC3 A;  2CRE A;  3JCM V;  2G6F X;  2MF2 A;  1U5S A;  1K73 C;  4PFP A;  2FB7 A;  2PUK B;  2V26 A;  4M7D B;  5D6X A;  1QKX A;  3S3O A;  2QQS A;  2RHX A;  5CVI A;  1GXI E;  2DRK A;  2FZG B;  4LDW A;  2X9H A;  4HCB A;  2ZGW A;  3ER0 A;  2GQI A;  3N5B B;  3JCM h;  3M9Q A;  2OX7 A;  3G7Z A;  1OV3 A;  1VQ8 A;  1AWJ A;  2DD5 A;  3M57 A;  1GFD A;  8ATC B;  1K1Z A;  3SDZ A;  4XTY A;  4BD3 A;  3MPU B;  1W70 A;  5FWC A;  1YCY A;  3ASK A;  3X24 B;  4EIK A;  3VS4 A;  1HSQ A;  5IHK A;  1NYF A;  4AMC A;  5HKC A;  5ECA A;  1AWW A;  2YUO A;  3M5A A;  2LT1 A;  1VQ6 T;  3JB9 D;  4FSS A;  5CKE A;  2OTL Q;  4QVC A;  1UHF A;  2E6Z A;  1GCQ A;  1VIF A;  1G3S A;  2EYW A;  3VS7 A;  1AZE A;  1AT1 B;  1D09 B;  1TUD A;  1WHJ A;  1YJN Q;  4JDS A;  2BE7 D;  2E4H A;  4MZT A;  1JJ2 P;  1RAF B;  3OMC A;  2HNI A;  2F5T X;  4ATO A;  2LJ0 A;  5IN1 A;  4J9E A;  1N8R C;  4M77 A;  4CI0 C;  2L5Q A;  5LJ3 e;  2QAZ A;  1U06 A;  3EG0 A;  1ZBX A;  3UA6 A;  3CCJ T;  2RK1 A;  3CCQ T;  2O88 A;  1X27 A;  1YJW Q;  1UJY A;  2LQW A;  1S72 T;  3OSS C;  1WA7 A;  4RTX A;  4C5E A;  1M90 R;  3DB3 A;  4BE2 A;  5GAN 6;  1RAH B;  3LH5 A;  3JCM W;  3O8V A;  1ZX6 A;  2KMT A;  1YP5 A;  1TU0 B;  4LXC A;  1RAC B;  4EMH A;  3CCU T;  2BZY A;  2X4Y A;  3RMS A;  1E7O A;  5LJ3 j;  4N4I A;  1Q7Y R;  1ZBJ A;  8AT1 B;  4EMK C;  2GF7 A;  4HCK A;  2DXC A;  4RUG A;  4A54 A;  4XK8 E;  3OYF A;  1HJD A;  2MIO A;  5KYY B;  3VS2 A;  3LH0 A;  3DB4 A;  1NJI U;  2LJ3 A;  2LP5 A;  3V7C A;  5EC7 A;  1I4K 1;  3JCM J;  1PSF A;  5GMK h;  4LDY A;  1TUG B;  3CD6 A;  2LQK A;  1BCM A;  3LGL A;  3FEO A;  3CC7 Q;  4HXJ A;  1ZSG A;  4E7L A;  3A8L B;  4FL6 A;  1VQN T;  5CO7 A;  2E5Q A;  1RAA B;  2E10 A;  1WHH A;  4CC7 A;  1JB0 E;  2HAX A;  2QQB A;  1Q7Y C;  3NMZ C;  1U1T A;  1Y96 B;  2P0Q A;  4OMQ A;  5GAN h;  3M0P A;  5GAN f;  3SD4 A;  4ORZ A;  1Q81 U;  1WHK A;  4HA8 A;  3RUX A;  1M2V B;  1ZQ1 A;  1X75 C;  7AT1 B;  4AG1 C;  4E47 A;  2HD0 A;  4MML A;  1WHL A;  2BUD A;  1EX4 A;  2GTO A;  4GLM A;  4M78 C;  1S72 Q;  3QJ6 A;  5FRN A;  2YDL A;  3H8Z A;  4KRT A;  4F17 A;  4JJD A;  4M77 D;  4C92 B;  3MEV A;  4C0G A;  5GAN 7;  3EG9 B;  2ZPE B;  4UC4 A;  1BKB A;  4Y91 A;  1VQ5 T;  4AFU C;  2MCN A;  4M7A D;  3MP1 A;  2EQJ A;  2RF0 A;  1X69 A;  2K2V A;  1EZZ B;  1W1F A;  1M9S A;  3CCS A;  1YIJ T;  3JCM f;  2R57 A;  3JCM X;  2QA4 T;  3PNW C;  2DVE A;  5J26 A;  1RAE B;  2ZPB B;  2A37 A;  3NTK A;  3CC2 T;  3CC2 Q;  3SFM A;  1WNL A;  4KGX B;  2MPX C;  5IHN A;  4M7D E;  4OB0 B;  2RI5 A;  1YI2 A;  1H8K A;  3R6N A;  2O4X A;  2EPD A;  1N27 A;  4FCY A;  1QP2 A;  4OMF B;  1AWO A;  4IUP A;  3VUB A;  5CKB A;  3M59 A;  1WDX A;  2LMJ A;  2WAC A;  4EPC A;  4BB7 A;  2E1H A;  4PJO G;  2BZX A;  2DBM A;  2K5F A;  4XTW A;  3V8L A;  2VYT A;  3A1P A;  4J6X A;  3RER A;  2OTL T;  4E2F B;  1TXQ A;  4R55 A;  2QTV A;  1BIA A;  2ABL A;  4OGC A;  4ELZ C;  4EMK A;  4J9I A;  4BE0 A;  1N6A A;  1YHQ A;  1K9M U;  3NTH A;  3QG1 A;  3CCL A;  1YJN T;  3OYB A;  4YTL A;  3CEY A;  1ZSZ C;  1CKA A;  4J9C A;  3CCL Q;  3PT9 A;  3ZEH A;  3OSV A;  4NS5 A;  3MEU A;  4EMG A;  3CPW S;  2V8I A;  2H3E B;  2GBQ A;  1BI0 A;  4M77 G;  1NM7 A;  2XMF A;  3CME T;  1VQK A;  5GAM j;  2P84 A;  4LUE A;  1VQP Q;  1BI1 A;  4FU6 A;  1RI0 A;  2HL3 A;  1H3Z A;  4RG8 A;  5I2S A;  1D1C A;  2VC8 A;  5GAO l;  2LTO A;  2D6F A;  3A5Z B;  3KXT A;  1VQ4 A;  4XU1 A;  2DET A;  4FYW B;  4CC2 A;  1ZHI A;  2HQE A;  1YI2 T;  1MMD A;  1UUE A;  2IG0 A;  3Q1J A;  3BE3 A;  1ZSZ A;  1UDL A;  3ZL7 C;  3SWN B;  1KSW A;  3O5Z A;  2QA4 A;  2DL4 A;  2L8D A;  4NL3 A;  4JS4 A;  1VQK Q;  1D3B B;  3CC4 A;  1WPY A;  4ZGD B;  4WCI A;  4IUR A;  2RQR A;  4C8Q C;  2DBK A;  2CP5 A;  4ELY C;  2XKO C;  1QVF A;  4DBH A;  4FT2 A;  1E6H A;  1BIB A;  4HVV A;  4HKE A;  3TSW A;  2VVK A;  1LVK A;  3CBM A;  2RN8 A;  3VS5 A;  1GRI A;  3P8D A;  1OU8 A;  1YJ9 T;  3CC7 A;  2G3R A;  2XID A;  2DYI A;  4BE1 A;  3QDR B;  5I2M A;  3TSZ A;  1H92 A;  2RK2 A;  3G71 T;  3L2Q A;  4PFO A;  1VQ9 T;  4M75 E;  4J9D A;  1M90 U;  4OB1 B;  4PLI A;  2CS7 A;  1VQN Q;  1ZUK A;  3QKJ A;  2EQM A;  1MND A;  2LDM A;  3CD6 T;  1BK2 A;  2L0A A;  3OW2 S;  4PFZ A;  4B9W A;  4QKU A;  1SRL A;  3EG3 A;  2MWP A;  4PJO A;  1VQ5 A;  2XDB A;  3H0I A;  4FYV B;  2KNB B;  3L1A A;  2RPN A;  1Q7Y U;  3NTI A;  1D0X A;  1KHC A;  2AKK A;  2ZCF B;  3L2W A;  1MUZ A;  3OMG A;  3BDU A;  1NG2 A;  2E12 A;  1GCP A;  1WQW A;  3I9Q A;  1NJI R;  2KQW A;  3GP8 A;  3GNF B;  3QZ5 B;  3CCU Q;  2F2X A;  1N5Z A;  1LNX A;  2DVJ A;  1QWE A;  2X4W A;  4M78 F;  2MAM A;  1KHI A;  3QSU A;  4C5I A;  3KUF A;  4F7U A;  2CH4 W;  3UAT A;  2BTT A;  2XDP A;  1K4U S;  4M77 E;  4OVA A;  2DJQ A;  4LD6 A;  1YN8 A;  4GLK A;  1KQS A;  1IXD A;  4RMO A;  1KC8 U;  4X34 A;  4M75 F;  4X1V A;  1YJW A;  2FZK B;  2F5K A;  1RUW A;  3M0Q A;  3OS2 A;  2LZ6 B;  4M75 D;  4VUB A;  3VV0 A;  4DEY A;  1VQ9 Q;  1T0J A;  4R0K A;  2DX1 A;  2RHY A;  4M7D D;  1X01 A;  3I55 Q;  3I55 T;  1AD5 A;  4OML A;  2OAW A;  1XNI A;  2OTJ Q;  4C8Q A;  4J83 A;  3BFM A;  3L2R A;  1QWF A;  3HP9 A;  1SSH A;  1Y71 A;  1WHG A;  1ZUY A;  2DL8 A;  2FZC B;  1NPP A;  3EHR A;  1PRM C;  2VB6 A;  3CME Q;  1V1C A;  4XQ3 A;  1UTI A;  4X9C A;  2EYZ A;  2D1X A;  4O5V A;  1WFW A;  1ZLM A;  4FW1 A;  2K2M A;  3GBQ A;  3C0C A;  3UA7 A;  3E9G A;  3ZFJ A;  2EAY A;  4RCB A;  4A4F A;  3FJP A;  1YIT T;  2MI6 A;  1FWZ A;  3L2U A;  1BU1 A;  2V8K A;  4J5Y A;  3M0T A;  3A98 A;  3EGX B;  3MEW A;  4JJB A;  4JJN K;  6AT1 B;  3JCM b;  4KGV B;  1UFF A;  2XDD A;  1WGS A;  1VQP A;  3TCJ A;  4ZNX A;  5J3B A;  1BYM A;  2AHJ B;  3V8K A;  4J6W A;  3CCM Q;  1QQJ A;  1Y57 A;  2KR3 A;  2PVG B;  1W2B A;  2JMC A;  3QO3 A;  2DTO A;  4LN2 A;  5DY9 A;  4JPB W;  3CPF A;  2GNC A;  3JB9 H;  4J7F A;  3G4S T;  2QG9 B;  2E64 A;  4PJJ A;  4F7U E;  3X25 B;  4WTO B;  2LCL A;  3H6Z A;  1JJ2 A;  1AVZ C;  4OMN A;  4IUV A;  1Q86 C;  3OYM A;  2ZPI B;  4KH0 B;  3HTR A;  4J6Y A;  1R77 A;  3OYC A;  1YJN A;  3OYY A;  1S1N A;  1OPK A;  2F2W A;  4PNO A;  1K8A R;  2C0T A;  1IGU A;  2E5K A;  2V8J A;  1ZA2 B;  2JNG A;  4J7I A;  4DEX A;  3JCM P;  2JN0 A;  1TG0 A;  2YRD A;  2JS2 A;  2DIL A;  2K3B A;  1VQ4 Q;  2OTJ T;  1QCN A;  5J39 A;  2OTL A;  2KYB A;  2YLC A;  4O6J A;  4C0Z A;  2RQT A;  5IT9 E;  1RAI B;  3A8M B;  1PG5 B;  2YWW A;  2DIG A;  3CMA T;  3CCL T;  2FO0 A;  3SWN C;  2GFU A;  1NYG A;  1RL2 A;  4LE9 A;  3G6E Q;  2JXB A;  2YUQ A;  4ZN3 A;  2KRO A;  5GAN d;  2AZV A;  5KYX B;  4ME7 A;  4F7U B;  1JXM A;  2P4R A;  4LDX A;  3MKD A;  2QQA A;  2L3P A;  2COY A;  4KUD K;  4LDU A;  2VV5 A;  3INZ A;  3QWY A;  4C5H A;  3VYH B;  3CCE T;  1B34 A;  4M7D F;  4PK4 A;  2MYS A;  1MV0 B;  1NLO C;  3LLR A;  1JXO A;  1JQQ A;  5IH2 A;  2EJ9 A;  3HRT A;  3G4S Q;  3BDL A;  3OYE A;  4M7D G;  4RTW A;  4D6W A;  1X6G A;  1SPK A;  3GPL A;  4PL6 A;  5GMK m;  2RQV A;  2FEI A;  9ATC B;  4DA4 A;  1YIJ Q;  1OOT A;  4PJO B;  4E7H A;  2HCK A;  2JTF A;  2QYZ A;  1G5V A;  3EFS A;  3HKS A;  1ABO A;  1FX7 A;  3MHX A;  5LJ5 e;  3CBO A;  2EYX A;  1HXD A;  1B34 B;  4A4K A;  2KRM A;  3J81 E;  2K79 A;  3OYN A;  4II1 A;  3OS1 A;  4PJN A;  2FG0 A;  1UG1 A;  4IUT A;  2OJ2 A;  4Z88 A;  5CKH A;  1YJW T;  3CCR A;  5KYX A;  1K0S A;  5GAM f;  2E3H A;  2FL7 A;  1LOJ A;  1QVF P;  4V2S A;  3G6E T;  2DMO A;  5I11 A;  1IRE B;  2EKO A;  2NUZ A;  2DXT A;  4JZ4 A;  4D8D A;  3VS3 A;  1U3O A;  4HCZ A;  1XQH A;  2E41 A;  2VGM A;  2CP3 A;  2QI2 A;  2LX9 A;  4FSX A;  5GAM g;  3VKI A;  1WQ7 A;  3E2U A;  3JB9 I;  2JS0 A;  4C8Q E;  3M0U A;  2R5A A;  2DZC A;  3H0F A;  4FYX B;  5HK3 A;  3CCJ A;  3JCM e;  2F2V A;  2LNH B;  2EJF A;  2EQU A;  2F1L A;  2RA2 A;  5KYN A;  4M78 B;  2DZ9 A;  4M7A G;  4M7A F;  4IUU A;  1IZ6 A;  2RB6 A;  3SEM A;  1VQM A;  2BE9 B;  3GF5 A;  2DO3 A;  2JUF A;  2NLU A;  2DIQ A;  2LVM A;  5KCO A;  3I5S A;  1HD3 A;  1KC8 R;  5GAN g;  3EAE A;  2JT4 A;  2VAS A;  2YRV A;  2DEQ A;  2HSP A;  2JM8 A;  4BDZ A;  5DM7 R;  1YBY A;  3KBG A;  1M3C A;  5LJ5 g;  4JLG A;  5I21 A;  2CUD A;  4E7Z A;  2PUO B;  2A0F B;  2FYK A;  5LJ3 g;  2Y4Y A;  1X2Q A;  1R0C B;  4AFZ C;  1RAD B;  1PC0 A;  1OZ3 A;  3M0S A;  3QJY A;  4M78 D;  4M75 A;  2RHI A;  1VOM A;  5LJ5 f;  2XD0 A;  1DJ7 B;  3OYK A;  1G2B A;  2ECZ A;  1J3T A;  1WIE A;  2YLB A;  3EFO B;  3V8J A;  4MDX A;  1UEC A;  4PJO F;  1A0N B;  2W0Z A;  3EGD B;  3RR6 A;  3LWH A;  4J9F A;  1NBE B;  4CC4 B;  1PD0 A;  1M27 C;  4EMK B;  5EG2 A;  3FRN A;  1M30 A;  2RM4 A;  2DTH A;  4A4H A;  3EFR A;  4XAX B;  1VQM Q;  2M51 A;  3JV3 A;  2EJG A;  2O9S A;  1KK7 A;  4F14 A;  3P8B B;  3V7R A;  5IAY A;  3S3N A;  4OGE A;  3EH1 A;  2LCS A;  1G8X A;  1ZSZ B;  3JSC A;  1NE8 A;  1WZO A;  3CCV Q;  4M7A B;  1Z9Z A;  2RHZ A;  2CZ6 B;  4BY6 C;  2X4X A;  3BY7 A;  1VQ7 T;  2JVV A;  1VQ7 Q;  1V76 A;  4KGZ B;  4QQD A;  2K3X A;  4Q5W A;  3GIB A;  2L89 A;  4LDV A;  2AKL A;  2WSE E;  1WXB A;  1SEM A;  2V1Q A;  2XG8 D;  3ME9 A;  1B07 A;  2QQR A;  4B9X A;  2C0O A;  2L3R A;  3OYI A;  2J7I A;  2FHD A;  2DTI A;  2RQW A;  1FYN A;  2DPP B;  1XTD A;  4HVU A;  1K8A U;  3OQ5 A;  3PTA A;  2D9T A;  2QAS A;  3EG9 A;  4C92 A;  2AK5 A;  2FPF A;  1FMV A;  1OX9 A;  4PKC C;  2YSQ A;  1VYU A;  2EYQ A;  2RD1 A;  5KYU A;  4KBM B;  1GCQ C;  1I07 A;  1W4S A;  1TS9 A;  4M4Z A;  1WYX A;  5I22 A;  1KD1 R;  2X3X D;  1PKT A;  5CCA A;  1VQ8 Q;  3VU3 C;  3AT1 B;  2DL3 A;  4MDW A;  2WSC E;  2HMA A;  2E65 A;  1WXT A;  3E9F A;  3OB9 A;  3PVL A;  2AT1 B;  5KCH A;  4F16 A;  2PU9 B;  4JRI A;  2PTK A;  2ZPH B;  3CME A;  4QQ6 A;  4BUG A;  1Q82 R;  1VQK T;  4M75 C;  5CIU A;  2YUN A;  5GAN 2;  2I0N A;  3M0R A;  1UGS B;  4ZN1 A;  2O01 E;  2XI9 A;  2C06 A;  1F1B B;  2KYM A;  1BBZ A;  2QEX T;  4MMK A;  3JAM E;  4FM4 B;  1YHQ T;  1QVG P;  4RCC A;  2JTM A;  3QBY A;  3VYG A;  3DLL A;  2LQ8 A;  3IQL A;  2RNA A;  2EYY A;  1NZ9 A;  1M3A A;  2PVO B;  3MCA B;  1GBQ A;  3MP8 A;  4C8Q D;  1WI7 A;  2CZ1 B;  1VQO T;  1G3Y A;  3RES A;  1BI3 A;  2LX7 A;  5LJ5 j;  5KH6 A;  4C92 C;  4RTY A;  1JJ2 S;  5D7U A;  1Q81 C;  5GAN j;  1PWT A;  3FDR A;  4E7S A;  3OS0 A;  1B7T A;  2VXF A;  3OW2 P;  3FJ5 A;  1KD1 C;  3MP6 A;  2F69 A;  1CKB A;  4C0F A;  4BI3 A;  1QVG S;  1FMK A;  3C12 A;  4QVZ A;  2DA9 A;  2QDY B;  1ZA1 B;  2R58 A;  2YXY A;  3I5R A;  4N4H A;  1K0X A;  5A0L A;  1UE9 A;  3X28 B;  1M1F A;  3C4S A;  2EVR A;  3RDV A;  3OY9 A;  4M75 G;  1KC8 C;  2DK3 A;  2IVW A;  2A08 A;  1NLP C;  2J06 A;  4QQG A;  3LGF A;  1RI9 A;  2DXB A;  1VQL T;  4D8K A;  4J8O A;  4DQ2 A;  1K8A C;  4XTU A;  2YT6 A;  2C0I A;  1K73 U;  5IXF A;  2VGN A;  5M9O A;  2KBT A;  1WJQ A;  4LUD A;  2GFA A;  3EGD A;  4OMP A;  2CP0 A;  1TUC A;  4M77 C;  5GAO p;  2OTJ A;  1EIF A;  2JM9 A;  4EDU A;  3CPW A;  2M9U A;  5FW9 A;  3F70 A;  3HFN A;  2RI3 A;  1G3T A;  3A8O B;  1I5L A;  2LCC A;  2SEM A;  5GAN 3;  3HRU A;  2QDL A;  4KUL A;  4IIM A;  1SG5 A;  3PE0 A;  1VYV A;  3EHQ A;  5GAN 8;  1M8V A;  4JRP A;  3RKY A;  1VQL Q;  1FXX A;  2IIM A;  1C0M A;  2RHU A;  2DAQ A;  1YIT Q;  2GQV A;  2A36 A;  4QVD A;  2AIR B;  1NEG A;  4DBQ A;  2NUT B;  3QDF A;  4N4G A;  4RTV A;  4F7U F;  1M8M A;  3G71 A;  1MNE A;  2QTX A;  3CCM T;  1VQ8 T;  1MHN A;  4DBF A;  3GOX A;  3QUI A;  3REA B;  4TVR A;  4LD9 K;  2ROL A;  1QP3 A;  1N8R R;  5AT1 B;  1OU9 A;  1X6O A;  1K9M R;  4DOW A;  1TSF A;  1JO8 A;  2NUP B;  4ESR A;  5GJW B;  3CXC P;  4Z89 A;  1W2B S;  2CSQ A;  1BCO A;  1QVP A;  2B86 A;  4OMO A;  4GBQ A;  4B6M A;  4ZTJ A;  3WXM B;  2XU8 A;  3WVE B;  2E70 A;  2CT3 A;  1D1A A;  3OYD A;  1M1K C;  4E6R A;  2SRC A;  2HBW A;  4M78 G;  1NJI C;  1VQ9 A;  1WLP B;  2CP2 A;  3AHU A;  4ZTF A;  3JRZ A;  2NUP A;  3H0H A;  1WJR A;  4Z02 A;  5HY6 A;  2CZ7 B;  3SB2 A;  3LX7 A;  1BI2 A;  3HSB A;  2ATC B;  2HBP A;  1YJ9 A;  2ROT A;  1EFN A;  1R8O B;  5IXB A;  4XU2 A;  2O31 A;  1IHV A;  3CCU A;  3PVQ A;  1D3B A;  3JB9 J;  1C6V X;  2X51 A;  3OW2 A;  1YHQ Q;  3CCE Q;  1VYT A;  4M7A C;  3P8H A;  2RH2 A;  3UT1 A;  2MOX A;  4XU3 A;  1IO6 A;  2J6K A;  2JOY A;  5A2Q E;  2H3J A;  4KH1 B;  3HFO A;  2EFI A;  3LWI A;  2NYS A;  3FLG A;  3VS6 A;  1HYO A;  3CBP A;  1VUB A;  1YCS B;  1IB8 A;  4M78 E;  4JLI A;  2L3S A;  3KFV A;  3OYJ A;  4L5G A;  4RTT A;  2FRY A;  1ACM B;  3QWX X;  1Y96 A;  3PIP A;  1GBR A;  1Q86 R;  2EIF A;  1RAG B;  4QT7 A;  3VS1 A;  2QA4 Q;  3I56 A;  4DBR A;  4JS5 A;  3I56 T;  3DLM A;  3EGX A;  1KQS P;  4NOY A;  5GAO q;  2OAU A;  2YRC A;  3CC4 Q;  2ED0 A;  5L23 A;  1KQ2 A;  1Y07 A;  2FVU A;  3E1S A;  2XIC A;  1KJW A;  1KQS S;  1X2K A;  1O75 A;  1KQ1 A;  4JUV A;  5CQY A;  1MGQ A;  3CMA A;  1PNJ A;  3UDC A;  1PSE A;  2HQX A;  4BI8 B;  3X20 B;  2JMA A;  1OYX A;  5KYY A;  3JCM g;  2FPD A;  4DOV A;  1SRM A;  2HEQ A;  2QQ9 A;  4CC3 A;  3EGU A;  4K11 A;  1QLY A;  2DEU A;  2CYZ B;  4Y92 A;  1O9S A;  1JEG A;  3PMT A;  2YUP A;  1AEY A;  2DE0 X;  2GCX A;  4N0A A;  1FMW A;  1T3L A;  1IRX A;  2KK4 A;  2M02 A;  2DFU A;  3CCM A;  1VA7 A;  1IHW A;  2HKQ B;  1YFN A;  2KE9 A;  3QHS A;  3ZBD A;  3JB9 G;  1PKS A;  2D8H A;  3SWN A;  3TVT A;  4NL2 A;  3G4S A;  2X35 A;  4L6V 5;  1VQ6 Q;  4JJC A;  3EG1 A;  4JRQ A;  2EGC A;  2JW4 A;  4M7D C;  5CAI A;  2O4X B;  1MMN A;  1UB4 A;  2VKN A;  3EH2 A;  4KUI A;  2GGR A;  1VQO A;  2K5I A;  1Z9Q A;  2ED1 A;  2KT1 A;  3C94 A;  1R0B G;  3RIR A;  1OZ2 A;  2VWF A;  5KYW B;  2A28 A;  3OBY A;  2MWO A;  4E7K A;  1QCF A;  5IHI A;  1QKW A;  1OPL A;  1K9A A;  4C5G A;  2J6O A;  2RI2 A;  5LJ3 d;  3M55 A;  5LL6 S;  1Y0M A;  3U23 A;  1K73 R;  3FB9 A;  2KGT A;  2KVQ G;  2L2P A;  2KY9 A;  2OI3 A;  2KSS A;  3QPH A;  4M78 A;  2KRS A;  3CCR T;  1W2B P;  1OEB A;  4ZGJ B;  4CRI A;  4IUQ A;  1Q82 U;  3S3M A;  4F04 B;  5DLQ E;  2P4T A;  4GY5 A;  1V29 B;  5CKF A;  1G3W A;  4C8Q B;  1I1J A;  3HPW A;  2NUT A;  1M2O A;  5LJ3 f;  1M5Q 1;  2A7Y A;  4E7I A;  4Z8A A;  3FIF A;  1H3H A;  1CSK A;  3TEE A;  2CT4 A;  4XU0 A;  3MO8 A;  3UF4 A;  2DNU A;  3C95 A;  2EWN A;  1D1B A;  1W6X A;  5FRO A;  5KE3 A;  2DM1 A;  2PVD B;  2HDA A;  4BI4 A;  2K3Y A;  4C92 G; 
#chains in the Genus database with same CATH homology
 3CME A;  4QQ6 A;  4BUG A;  1KC8 U;  1VQK T;  4M75 C;  3ER0 A;  4X9D A;  5CIU A;  4X34 A;  2B8A A;  4A4E A;  3N5B B;  5GAN 2;  3JCM h;  3CCJ T;  3M9Q A;  4M75 F;  1YJW A;  3G7Z A;  2F5K A;  1UGS B;  1VQP T;  4ZN1 A;  2O01 E;  4R56 A;  3CCS T;  2DD5 A;  2XI9 A;  1TH7 A;  3M57 A;  1VQ8 A;  3OS2 A;  2C06 A;  1N8R U;  1KG1 A;  3A8G B;  4M75 D;  4VUB A;  3VV0 A;  2QEX T;  4MMK A;  3SDZ A;  3JAM E;  4M7D E;  4FM4 B;  4A53 A;  4XTY A;  4BD3 A;  1YHQ T;  4RCC A;  2JTM A;  2RHY A;  3RKX A;  1YCY A;  3ASK A;  3M53 A;  3QBY A;  2DKG A;  1X01 A;  3X24 B;  5HKC A;  4M7D D;  3I55 T;  3VYG A;  3DLL A;  3M5A A;  2LQ8 A;  2LT1 A;  1QVF S;  1XNI A;  2Y4X A;  1VQ6 T;  4C8Q A;  3JB9 D;  4J83 A;  3BFM A;  3L2R A;  3GLX A;  3CCV T;  3HP9 A;  1NZ9 A;  5CKE A;  2PVO B;  1Y71 A;  3M58 A;  3DKM A;  4QVC A;  1NPP A;  3MCA B;  5GAM h;  2E6Z A;  1VIF A;  4XQ3 A;  3MP8 A;  4FIB A;  4C8Q D;  5C6S A;  4X9C A;  1YIJ A;  2CZ1 B;  1VQO T;  1G3Y A;  1G3S A;  2KDS A;  2RJC A;  1BI3 A;  4O5V A;  3RES A;  5LJ5 j;  5KH6 A;  4C92 C;  3I55 A;  3OBW A;  1JJ2 S;  2CKK A;  3E9G A;  2EAY A;  4RCB A;  3ZFJ A;  4A4F A;  3FJP A;  3M56 A;  4JDS A;  5GAN j;  1Q81 C;  3TRE A;  2MMP A;  1YIT T;  2MI6 A;  1FWZ A;  3L2U A;  2KAF A;  2QEX A;  3FDR A;  2V8K A;  4J5Y A;  4MZT A;  3OYA A;  3MEW A;  3OS0 A;  4JJN K;  3JCM b;  3OMC A;  2VXF A;  2XDD A;  1WGS A;  2HNI A;  1KD1 C;  1VQP A;  3OYL A;  4MZM A;  3MP6 A;  2F5T X;  2F69 A;  3TCJ A;  4IKF A;  2ZPG B;  5J3B A;  1BYM A;  4C0F A;  1VQ6 A;  4ATO A;  5IN1 A;  1N8R C;  2AHJ B;  3V8K A;  4BI3 A;  4M77 A;  1S72 A;  3C12 A;  4CI0 C;  4JRK A;  1QVG S;  2L5Q A;  4J6W A;  3J80 E;  4BDY A;  4QVZ A;  2QDY B;  2R58 A;  4RG2 A;  5LJ3 e;  2PVG B;  4QW2 A;  2QXF A;  5FU6 B;  1W2B A;  1QVG A;  4N4H A;  1ZBX A;  2RO0 A;  2DTO A;  3QO3 A;  5DY9 A;  2JZ2 A;  2RK1 A;  3CPF A;  2CZ0 B;  3URG A;  5A0L A;  3X28 B;  5LJ5 d;  4J7F A;  3G4S T;  1M1F A;  3JB9 H;  4F7U E;  2E64 A;  3CCQ T;  3C4S A;  4E7J A;  3X25 B;  2LCL A;  3OY9 A;  4M75 G;  3H6Z A;  1JJ2 A;  1KC8 C;  3G6E T;  1S72 T;  3OSS C;  4IUV A;  3L2V A;  1Q86 C;  2DK3 A;  4C5E A;  3OYM A;  2ZPI B;  2IVW A;  2ZPF B;  4QQG A;  2LRQ A;  4J6Y A;  3DB3 A;  3LGF A;  5LJ5 h;  3HHT B;  4BE2 A;  4HT9 A;  2LNV A;  3OYC A;  2DXB A;  5GAN 6;  5CK9 A;  1YJN A;  3OYY A;  1VQL T;  2CGH A;  4J8O A;  4DQ2 A;  3JCM W;  1K8A C;  3O8V A;  3VUZ A;  4XTU A;  4PNO A;  2KMT A;  2V8J A;  1K73 U;  2JNG A;  2VUB A;  4J7I A;  3CCU T;  4EMH A;  3R6O A;  2BKD N;  2JN0 A;  3A8H B;  3JCM P;  2VGN A;  2X4Y A;  5M9O A;  5GAO n;  3RMS A;  3M4Y A;  1WJQ A;  5D6Y A;  5LJ3 j;  4N4I A;  5FLX E;  4EMK C;  2OTJ T;  2GF7 A;  5J39 A;  3L2Z A;  2DXC A;  3L42 A;  2YLC A;  4O6J A;  4C0Z A;  4A54 A;  2GFA A;  5GAN e;  5GMK j;  3A8M B;  4XK8 E;  3OYF A;  5IT9 E;  2EQK A;  1UGQ B;  3NFC A;  3LH0 A;  3HL8 A;  3DB4 A;  4OB2 B;  2DIG A;  1NJI U;  3CMA T;  3CCL T;  1Q86 U;  3V7C A;  3CXC S;  2LC4 A;  1I4K 1;  1LJO A;  3SWN C;  2GFU A;  3JCM J;  4M77 C;  1PSF A;  3PGG A;  1RL2 A;  5GAO p;  5GMK h;  3CXC A;  2OTJ A;  1VQN A;  4LDY A;  1VQ7 A;  1EIF A;  2M1H A;  4M75 B;  2LQK A;  3CD6 A;  3LGL A;  3FEO A;  4EDU A;  4E7L A;  4C8Q F;  3CPW A;  3A8L B;  4ZN3 A;  4FL6 A;  1VQN T;  5CO7 A;  2M9U A;  5AYF A;  5GAN d;  5FU7 C;  3F70 A;  2E5Q A;  3HFN A;  2RI3 A;  4M77 B;  3UWN A;  3QYG B;  4C92 D;  1G3T A;  2E10 A;  3A8O B;  4ME7 A;  1I5L A;  2LCC A;  1XOV A;  5GAN 3;  3TU4 K;  3HRU A;  3MET A;  1JRI A;  4KUL A;  5L8R E;  5HK0 A;  3PIO A;  4F7U B;  1JB0 E;  2HAX A;  5GAN 8;  4LDX A;  1M8V A;  2QQB A;  2VXE A;  3RKY A;  5DLO A;  1U1T A;  1Y96 B;  2QQA A;  4JRP A;  2P0Q A;  1Q7Y C;  4KUD K;  4PJO C;  1M1K U;  3CC7 T;  1FXX A;  2P0K A;  5GAN h;  4LDU A;  2RHU A;  2VV5 A;  3INZ A;  4C5H A;  3VYH B;  2DAQ A;  1B34 A;  4C92 G;  2GQV A;  3JCM d;  3CCE T;  5FRM A;  1Y7X A;  5GAN f;  3SD4 A;  4N0A C;  4QVD A;  4P5N A;  3E19 A;  1U8R A;  3LLR A;  4HA8 A;  1Q81 U;  3X26 B;  1VQM T;  1N9S A;  3RUX A;  1ZQ1 A;  1X75 C;  2EJ9 A;  3HRT A;  4E47 A;  2HD0 A;  4MML A;  4N4G A;  2RJF A;  5CR2 A;  3BDL A;  2BUD A;  4F7U F;  3OYE A;  1WJS A;  4M7D G;  3G71 A;  2QTX A;  4D6W A;  4M78 C;  3QJ6 A;  5FRN A;  3CCM T;  1VQ8 T;  3GPL A;  3H8Z A;  4PL6 A;  5GMK m;  1K9M C;  4M77 D;  4C92 B;  3MEV A;  1I8F A;  1MHN A;  4M7D A;  4C0G A;  3GOX A;  2DXU A;  5GAN 7;  4DA4 A;  2ZPE B;  4UC4 A;  1BKB A;  3QUI A;  4PJO B;  2M0O A;  4E7H A;  2JTF A;  4TVR A;  3MEA A;  3QZ9 B;  4Y91 A;  4LD9 K;  1VQ5 T;  1G5V A;  3EFS A;  3HKS A;  1QP3 A;  3G6E A;  4C8Q G;  4M7A D;  1FX7 A;  3MHX A;  5LJ5 e;  3CBO A;  1HK9 A;  1HXD A;  1B34 B;  1X6O A;  5FU7 B;  3MP1 A;  4A4K A;  3J81 E;  3OYN A;  1VQ4 T;  2EQJ A;  4II1 A;  1VQL A;  4DOW A;  3OS1 A;  1Q82 C;  2K2V A;  1M9S A;  3PMI A;  4IUT A;  3CCS A;  1YIJ T;  3JCM f;  5CKH A;  2R57 A;  3JCM X;  2QA4 T;  3V7S A;  3PNW C;  2DVE A;  2XK0 A;  4M77 F;  1YJW T;  5J26 A;  1W2B S;  3OYH A;  2ZPB B;  5A0D A;  1QVP A;  3NTK A;  1NPR A;  3CCR A;  3CC2 T;  3SFM A;  1WNL A;  5GAM f;  5GAM e;  2FL7 A;  1LOJ A;  4V2S A;  4ZTJ A;  3WXM B;  2XU8 A;  4OB0 B;  4XTZ A;  2RI5 A;  2E70 A;  3M54 A;  2E6N A;  3WVE B;  4BY6 B;  1IRE B;  2EKO A;  1M1G A;  1YI2 A;  2DXT A;  2O4X A;  4M7A E;  3OYD A;  1M1K C;  1N27 A;  4HCZ A;  5GMK l;  3UPU A;  2YHT A;  1QP2 A;  1XQH A;  2E41 A;  4C0D C;  4OMF B;  2VGM A;  2QI2 A;  4IUP A;  3VUB A;  2LX9 A;  4M78 G;  4FSX A;  5GAM g;  5CKB A;  3M59 A;  1NJI C;  3VKI A;  1VQ9 A;  2K5L A;  2WAC A;  4EPC A;  4ZTF A;  3AHU A;  1H64 1;  2E1H A;  3JRZ A;  4PJO G;  4BB7 A;  1WQ7 A;  3JB9 I;  2K5F A;  4XTW A;  4C8Q E;  1WJR A;  2R5A A;  3V8L A;  2Y90 A;  4F7U G;  2VYT A;  2DZC A;  4J6X A;  4Z02 A;  5HY6 A;  2CZ7 B;  5D6W A;  5HK3 A;  3CCJ A;  3SB2 A;  3LX7 A;  5GAN 5;  1BI2 A;  4R55 A;  2OTL T;  3HSB A;  2HBP A;  1YJ9 A;  1BIA A;  4C92 F;  1R8O B;  4OGC A;  3JCM e;  4ELZ C;  4XU2 A;  3CCU A;  2LT4 A;  4EMK A;  1D3B A;  4BE0 A;  1N6A A;  2EJF A;  2EQU A;  1QW1 A;  1YHQ A;  3JB9 J;  5GAO r;  4XTV A;  5GMK i;  1K9M U;  3NTH A;  3QG1 A;  3OW2 A;  1I81 A;  3CCL A;  1YJN T;  4M7A C;  3OYB A;  3P8H A;  4YTL A;  3CEY A;  2RH2 A;  2RA2 A;  3UT1 A;  4XU3 A;  2JOY A;  2BIV A;  3PT9 A;  3ZEH A;  5A2Q E;  4M78 B;  2DZ9 A;  3OSV A;  2H3J A;  3LW5 E;  4NS5 A;  4M7A G;  4M7A F;  4IUU A;  1IZ6 A;  3HFO A;  3MEU A;  4M7A A;  2EFI A;  4EMG A;  3LWI A;  2RB6 A;  3FLG A;  3CPW S;  2V8I A;  1VQM A;  4L59 A;  1U1S A;  2DO3 A;  2JUF A;  2NLU A;  3CBP A;  1VUB A;  3GF5 A;  2DIQ A;  1BI0 A;  2LVM A;  3VJP A;  4M77 G;  5KCO A;  3CCE A;  4M78 E;  4JLI A;  3OYJ A;  1SSF A;  4L5G A;  3CME T;  1VQK A;  5GAM j;  5GAN g;  3EAE A;  2YRV A;  1M90 C;  2DEQ A;  3JCM Q;  1BI1 A;  1Y96 A;  3PIP A;  5DM7 R;  4BDZ A;  1YBY A;  2EIF A;  3KBG A;  5LJ5 g;  4FU6 A;  1RI0 A;  4JLG A;  4OF1 A;  5I21 A;  1H3Z A;  4RG8 A;  2PUO B;  2ZZD A;  3I56 A;  4JS5 A;  2FYK A;  5LJ3 g;  2Y4Y A;  5I2S A;  3DLM A;  3I56 T;  2VC8 A;  2PQW A;  5GAO l;  1M4Z A;  2LTO A;  1UEB A;  2D6F A;  3A5Z B;  3T9N A;  4NOY A;  4WF2 A;  5GAO q;  3KXT A;  1OI1 A;  4XU1 A;  5GAO m;  3QII A;  2OAU A;  1VQ4 A;  1KQ2 A;  1ZHI A;  1Y07 A;  2HQE A;  2FVU A;  1OZ3 A;  3E1S A;  1YI2 T;  3QJY A;  2IG0 A;  4M78 D;  4M75 A;  2RHI A;  5LJ5 f;  2XIC A;  3Q1J A;  5GAN 4;  2XD0 A;  1KQS S;  1VIE A;  1O75 A;  2RJD A;  1KQ1 A;  4JUV A;  1DJ7 B;  5CQY A;  3OYK A;  4PJO D;  1MGQ A;  3CMA A;  3SWN B;  3UDC A;  1PSE A;  3M4G A;  3RKW A;  3OA6 A;  2QA4 A;  2HQX A;  4HCC A;  2K57 A;  2L8D A;  3X20 B;  2YLB A;  4BI8 B;  4NL3 A;  4JS4 A;  2DD4 A;  3V8J A;  1OYX A;  4MDX A;  4PJO F;  3LWH A;  5FU6 C;  3JCM g;  4OB3 B;  1D3B B;  4EMK B;  4DOV A;  1WPY A;  3CC4 A;  2K4Y A;  4ZGD B;  5EG2 A;  3FRN A;  2QQ9 A;  5GAM d;  2RM4 A;  2DTH A;  4A4H A;  4IUR A;  2CYZ B;  3EFR A;  4XAX B;  3HRS A;  1O9S A;  5C0M A;  3PMT A;  4C8Q C;  2GCX A;  4ELY C;  2XKO C;  4N0A A;  2EJG A;  5A0G A;  1QVF A;  2KK4 A;  4ZGE B;  3CCM A;  3QHS A;  4MZP A;  5KE2 A;  3ZBD A;  3JB9 G;  3P8B B;  4OP0 A;  3V7R A;  4C0D B;  5IAY A;  4FT2 A;  3S3N A;  5CQX A;  3SWN A;  1BIB A;  3WVD B;  1UGR B;  2DJZ A;  1KD1 U;  4NL2 A;  3G4S A;  2X35 A;  4HKE A;  3CCV A;  4OGE A;  4RKU E;  3JCM c;  4L6V 5;  4PLL A;  3JSC A;  1NE8 A;  4JRQ A;  3PFS A;  4M7D C;  4M7D F;  5CAI A;  4M7A B;  2O4X B;  2CZ6 B;  2RHZ A;  3QYH B;  2I2L A;  2M16 A;  1JBM A;  1UB4 A;  3CBM A;  4BY6 C;  3JB9 F;  2X4X A;  3BY7 A;  3P8D A;  1VQ7 T;  2JVV A;  3RMQ A;  1YJ9 T;  1AHJ B;  4KUI A;  3RER A;  1VQO A;  2P0P A;  4QQD A;  2K3X A;  3CC7 A;  2K5I A;  4Q5W A;  3GIB A;  2L89 A;  4LDV A;  5GMK e;  3QXE B;  3CC4 T;  2G3R A;  2WSE E;  2XID A;  4BE1 A;  2XG8 D;  3C94 A;  3QDR B;  5I2M A;  2RK2 A;  3ME9 A;  5LJ3 h;  3G71 T;  3RIR A;  4Y28 E;  3L2Q A;  1OZ2 A;  1VQ9 T;  4M75 E;  2QQR A;  3OBY A;  2MWO A;  4OB1 B;  4E7K A;  4PLI A;  2A3L A;  4B9X A;  2CS7 A;  1YIT A;  1M90 U;  3QKJ A;  4A4G A;  4C5G A;  2EQM A;  2L3R A;  3OYI A;  2LDM A;  2FHD A;  2DTI A;  2R5M A;  4BAC A;  2RI2 A;  3CD6 T;  2DPP B;  1XTD A;  1K8A U;  5CKD A;  5LJ3 d;  3OQ5 A;  3OW2 S;  3M55 A;  5LL6 S;  3PTA A;  2D9T A;  4B9W A;  3LYI A;  2XHC A;  2MWP A;  4PJO A;  4PJO E;  1VQ5 A;  2XDB A;  2X4J A;  2WSF E;  4C92 E;  3FB9 A;  2KVQ G;  2KY9 A;  2KSS A;  3QPH A;  4M78 A;  3CCR T;  3L1A A;  3CC2 A;  4C92 A;  1Q7Y U;  1UGP B;  1N9R A;  4ZGJ B;  3NTI A;  4CRI A;  4PKC C;  3GNG A;  1KHC A;  4IUQ A;  3S3M A;  1Q82 U;  2ZCF B;  2RJE A;  2EYQ A;  3L2W A;  3OMG A;  3BDU A;  1P92 A;  2E12 A;  2P4T A;  2RD1 A;  5DLQ E;  1WQW A;  3J7A F;  4GY5 A;  1V29 B;  4KBM B;  1W4S A;  3OS5 A;  5CKF A;  1G3W A;  4HT8 A;  4C8Q B;  3HPW A;  2KQW A;  2D0Q B;  4FT4 A;  5LJ3 f;  3GNF B;  1M5Q 1;  3QZ5 B;  3GP8 A;  2A7Y A;  3CCQ A;  4E7I A;  3FIF A;  3BW1 A;  4XTX A;  3TEE A;  4XU0 A;  4KT0 E;  5CCA A;  3MO8 A;  2OTL A;  3OYG A;  3VU3 C;  3S6W A;  1LNX A;  3FC3 A;  3C95 A;  2EWN A;  4MDW A;  3JCM V;  2MF2 A;  2X4W A;  1K73 C;  4M78 F;  2MAM A;  2FB7 A;  1KHI A;  2WSC E;  5FRO A;  2PUK B;  5KE3 A;  2E65 A;  3E9F A;  4C5I A;  3KUF A;  4F7U A;  3QSU A;  2XDP A;  2PVD B;  4M7D B;  5D6X A;  3OB9 A;  3S3O A;  2QQS A;  5KCH A;  2RHX A;  4M77 E;  5CVI A;  4OVA A;  1GXI E;  4LD6 A;  4BI4 A;  4GLK A;  2PU9 B;  4JRI A;  4LDW A;  1KQS A;  4RMO A;  2K3Y A;  2ZPH B;  4HCB A;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...