5GMKl

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 13
structure length 82
sequence length 82
chains with identical sequence y
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
l PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkl00
5LJ3e 5LJ3j 3JCMh 5GAOp 4C92B 3JB9G 1Y96A 1M5Q1 1KQ1A 4F7UA 1I81A 5GAMh 2DXTA 2JN0A 2FB7A 3BFMA 4NOYA 4M7AA 2QTXA 4XTWA 1TH7A 3JB9F 3L2ZA 5GMKe 1D3BB 1JRIA 3VU3C 4QVDA 3JCMP 1X01A 4M7DC 1MGQA 2Y90A 5GAN5 4QVCA 1B34A 3HFNA 5LJ3g 1WPYA 2DTOA 1HXDA 4J6YA 4M78C 4MMLA 3RKYA 2VXEA 2EJFA 4A53A 2K57A 3RERA 4C8QC 4PJOD 3M4GA 4XTVA 1LNXA 5GANh 4HT9A 1N9SA 4M75C 2DTHA 3RESA 3BDUA 4F7UG 3QHSA 4EMKA 1KQ2A 1WNLA 4M7AG 4M78B 3JCMe 2E41A 4NL2A 4F7UF 4F7UE 3V8LA 4C8QB 1LJOA 2EJ9A 5CAIA 4M7AE 2E64A 3JB9D 1BIBA 3JCMX 1U1TA 4M75B 4XTUA 3HSBA 1BIAA 4XU0A 3JCMf 5GAOn 4XU3A 3SWNA 5GMKm 4C92A 3RKXA 2RA2A 1I5LA 2CGHA 5DY9A 5LJ5h 3RKWA 3JCMJ 5GMKj 1H641 3JCMV 4PJOC 3L1AA 1I4K1 3V8JA 4NL3A 4M77D 4M7AF 5GANe 3JCMd 2DVEA 1I8FA 2EAYA 4M77B 2YLBA 3GIBA 3EFSA 4N0AC 3EFRA 4JRIA 4M7DF 2YHTA 4J6XA 1Y96B 5GAOm 2E10A 5GANf 3QSUA 4M7AD 4PJOB 4OP0A 4C92G 2DZ9A 4A54A 2FYKA 5GAOr 2DJZA 4M7DA 5GAMe 5LJ3h 4C92F 4M78A 1JBMA 4C92E 3RUXA 3JB9J 4JRKA 1B34B 5GANd 4EMHA 1LOJA 4C8QA 2VXFA 4RCBA 2E1HA 1U1SA 4M77C 2DTIA 3V7CA 4M75A 3JCMW 2DEQA 2RB6A 5GAMf 4DQ2A 2HNIA 2ZGWA 3JCMg 5LJ5f 2RM4A 4EMKB 3QO3A 3V7RA 4PNOA 1YCYA 2EJGA 4X9DA 5GANj 4M7DG 4EMGA 4M7AC 3BY7A 1D3BA 3PGGA 4M78G 4M7DD 5GAMd 4V2SA 4X9CA 4C8QG 5LJ5d 2DKGA 2DXUA 4F7UB 4M78E 4M78F 4J6WA 4M75G 3SWNB 3V7SA 3QUIA 1HK9A 4M7AB 4WF2A 4MMKA 4C8QE 4C8QF 5GAN4 4PJOA 5GMKi 5GANg 4XTZA 4J5YA 2I2LA 3FIFA 2EWNA 4M75E 4M75F 5GAMj 4XQ3A 4EMKC 1N9RA 3FB9A 5LJ3f 5GMKl 3INZA 5LJ5j 5LJ5e 4Y91A 3V8KA 4XU2A 3JCMb 5GAN8 5GAN2 5GAN7 4N0AA 1M8VA 2YLCA 3JCMQ 3HFOA 3FJPA 4M77G 4RCCA 3RIRA 3SB2A 5GMKh 4HT8A 3BW1A 4JUVA 5GAN6 5LJ3d 5GAMg 4PJOG 4JLIA 3SWNC 4M77F 4M77E 5GAOq 2E65A 5GAN3 4M7DE 4M78D 4C92C 2RD1A 4M7DB 5LJ5g 2DZCA 5I21A 4XTYA 5GAOl 4XU1A 1WQWA 4PJOF 4XTXA 4C8QD 1WQ7A 3JB9I 3AHUA 4PJOE 3JB9H 4M77A 4M75D 4HA8A 4C92D 3JCMc 2VC8A
chains in the Genus database with same CATH superfamily
2QQRA 1YJNT 1OX9A 1VYVA 4DOVA 1Q7YU 2COZA 2LRQA 1HD3A 1H8KA 3I5RA 4A4FA 1IRXA 1X01A 2RK1A 2Y90A 1YI2A 2RK2A 3EH2A 4RTYA 3OYJA 1I07A 1VQ7A 1H3ZA 1T0JA 4IUUA 3O8VA 1Z9ZA 3SHWA 2DPPB 1CKAA 3TQ7P 4F7UE 5IXFA 4IUQA 1Y7XA 3V8LA 1WJRA 5KYUB 5A0GA 3X25B 5GMKm 3MEAA 5FROA 4II1A 3CC7T 2QG9B 4FIBA 3I56Q 4R0KA 1WLPB 1NLOC 2YUPA 1AOJA 4L6V5 3G7ZA 3CCLA 4J83A 2SEMA 1VQMQ 2CH4A 2W0ZA 1QCNA 3CPWS 1K8AR 1Q86C 2QDYB 2JM8A 2DTIA 2HMAA 2MWPA 3CMEA 3OA6A 1QVFP 3SFMA 2ATCB 4MDWA 3E1SA 4E7IA 4PKCC 2KNBB 1X75C 1E7OA 4M75E 1WYXA 2EYQA 5GAN7 3VS3A 5GJWB 4CRIA 4EPCA 2V1RA 1S72A 1NE8A 4BI8B 4XTYA 1VQ4Q 4ME7A 1BB9A 2DL4A 2JUFA 2KT1A 2DBKA 3OQ5A 2YXYA 1GL5A 2EKHA 4ZN3A 2C0TA 2ZPIB 2OX7A 4C0DC 3VU3C 1PRLC 2WSEE 2CYZB 4QVCA 2DL8A 1VQPT 4Y92A 1KJWA 1ZLMA 1XJWB 2F1LA 3F70A 1BU1A 4AG2C 3I55A 3NTIA 1M90U 1E6GA 1YHQT 1UFFA 3TU4K 2RA2A 5LJ5h 3A8GB 5D7UA 1AZEA 3CCMA 3DKMA 3TSWA 3SEMA 4M77B 3GNGA 2YLBA 5I2SA 2O9VA 2FG0A 2OTLT 1GBRA 4Q5WA 3CCUT 4C5HA 4OP0A 4OMOA 2JTMA 2LJ3A 1VQ8A 2YRDA 2CUBA 3CCQT 2ECZA 2EW3A 2X3WD 3JB9J 1I1JA 5CO7A 3G6EQ 2LP5A 3HP9A 5CK9A 2DYBA 4E47A 1VQ5T 4EMKB 1D0XA 2YRCA 5KYWA 2K2VA 2V8JA 3H8ZA 5GANj 4EMGA 3BY7A 2QEXA 1PCXA 1EIFA 4HCKA 3CCEQ 3EFOA 1VQOA 1Q86R 2HBPA 2K3BA 2DL3A 2DXUA 2ZPBB 4F7UB 4PJMA 2EYZA 1NLPC 4B9XA 2DLPA 3EH1A 1M8VA 2BUDA 1AWXA 4M77G 5KE3A 2P0KA 2VYTA 2CP6A 1X2KA 2OTJQ 5GAMg 4IUTA 1SRLA 1UGPB 1TU0B 3X28B 2MK5A 3M53A 3NMZC 2B8AA 2LCLA 2XK0A 1VYTA 3OSSC 1RLQC 2QA4Q 1ZHIA 2QASA 2X3XD 4M7AA 4OB1B 3L2ZA 5L8RE 1SF9A 3E19A 4M7DC 4MMLA 1MNDA 1UHFA 1NEBA 2KR3A 3M4GA 4HT9A 3NGPA 1NPPA 4F7UG 2MAMA 1U8RA 5CIUA 1JXMA 3UF4A 3CCVT 2E70A 3OW2P 2VVKA 2AKKA 4BDYA 4GY5A 1JJ2P 2XKOC 4M7AF 1ZUUA 4M75B 4RTTA 3OY9A 1AEYA 3M57A 3RKXA 2L3RA 4PJOC 4FW1A 4N4IA 3HKSA 4RTVA 4ZNXA 1ARKA 4J6XA 1EX4A 1PKTA 1VQ8Q 2IPOB 1VQ9Q 4A54A 1QVPA 1TS9A 2NUTB 3KXTA 3CQTA 3S6WA 2O9SA 1T3LA 2VXFA 2E1HA 2NUPB 3N5BB 3V7CA 4B9WA 2DEQA 5GAMf 4LDYA 2LJ0A 1WHJA 5A0DA 3JCMg 4O5VA 2KMTA 3VS4A 1WIEA 4X9DA 4N4GA 4RTWA 3THKA 1WXTA 1MMGA 4M75G 3QWYA 1AD5A 3I9QA 3UDCA 2EYYA 2FRWA 2FEIA 1UGSB 5LJ5e 5GMKl 2RJFA 4ZGDB 1O9SA 2GQIA 4KULA 2PUOB 4D6WA 5KYUA 2R5AA 3OS2A 5GMKh 1M4ZA 2HQEA 2LX7A 1D1CA 2VKNA 2E65A 2X4WA 3LWHA 2XDPA 2QTVA 2HBWA 5HK3A 1QVFA 3QIIA 1I0CA 3JB9I 3MP8A 3PVQA 3UA7A 1XNIA 2HQXA 2XHCA 3VYGA 1W1FA 1UEBA 4DOWA 2JN0A 2YUOA 1SKUB 3H9NA 2QTXA 4HCBA 3VUZA 1VIFA 5KE2A 3OBWA 2R57A 3QZ5B 4J9CA 2J7IA 3QG1A 1VQ7T 2HZYA 3MJXA 3C95A 2DTOA 3UWNA 2LVMA 5EG2A 1M8MA 4C8QC 2EPDA 4ORZA 3DB3A 3RESA 3EG9A 2DM1A 1UGVA 2F5TX 1X27A 3H6ZA 2PVDB 7AT1B 1KHIA 6AT1B 4M7AE 1BIBA 3HSBA 2KYMA 1SHGA 1KFZA 5CVIA 3JCMf 3A8HB 4QVZA 2YSQA 1SRMA 1OZ2A 1VQNQ 2HCKA 4PL6A 1X43A 2EYXA 4GLKA 4ZN1A 2M51A 1G3SA 3CBOA 1YJNQ 2GFUA 3M5AA 1K73U 2D1XA 4JRKA 2AZVA 2QGFB 2V8IA 1LOJA 5C0MA 3CMET 5IHNA 4UC4A 4JZ3A 1WHMA 2V26A 3QYGB 4L5GA 1GCQC 1FWZA 3PGGA 2EIFA 3OYNA 4X9CA 1V1CA 2D8JA 4J9HA 4A4GA 4Z89A 2KY9A 5GANg 1G3TA 1LVKA 3FB9A 4HVUA 1OQKA 4JRPA 4Y91A 3CC7Q 1HJDA 2DK3A 1HYOA 1S72T 1ZA1B 2ZPGB 2E6ZA 1VQ6A 2CZ1B 2C06A 3OYYA 2HKNA 3H0IA 4LUEA 1IREB 4M77A 3L42A 2JMCA 3U23A 1PWTA 1YCSB 4QQDA 3UA6A 3LW5E 1YJ9T 2RJCA 1KQSA 1TUDA 3M9QA 4OMPA 4R55A 3JCMP 1HXDA 2LCSA 8AT1B 1N9SA 2CZ7B 3I55T 1WJSA 3CC4A 4EMKA 2ESWA 2QQSA 1YITT 4E7ZA 1OV3A 3META 2A08A 2LX9A 1U1TA 1QQJA 2A36A 1UECA 4RUGA 3CCMT 2AZSA 2AIRB 5KYWB 1I5LA 2CGHA 4LUDA 1X69A 5J39A 4J8OA 3LGLA 3A98A 1T0HA 1I8FA 4AFZC 3QYHB 3I35A 3PTAA 1NEGA 3LWIA 1Y96B 5GANf 3FC3A 2EQJA 1VQKT 2C0IA 1M1GA 1MMNA 1UDLA 5GAOr 2IIMA 4M78A 3OW2A 2PUKB 3M0TA 1RADB 1JJ2A 1WXBA 3OYAA 2FRYA 1K8AC 2QEXT 1KK7A 1O75A 2J6KA 3CD6T 3I56A 5GAMd 1K9MC 3OS0A 4M78F 3TCJA 2FO0A 3SWNB 3QUIA 4M7AB 2MWOA 2ED1A 1BI3A 1VQMA 4JS5A 2JVVA 4J7IA 4MZPA 2BE7D 3AT1B 5CKBA 1M27C 1DJ7B 1QVGP 4J9DA 1NZ9A 5GAOq 2OTLQ 2RMOA 5CKHA 1WQWA 4FT2A 4C92D 3CCQQ 2XG8D 4JJBA 2FZKB 2AHJB 4JDSA 5GAMh 2H8HA 2NUTA 4XTWA 2L8DA 3RDVA 2DIQA 1MGQA 1VQ5Q 2ZZDA 4HVVA 3OMGA 4EIKA 3CC4Q 2QGGA 3ZEHA 1HSQA 4RTXA 2LTOA 1X6GA 4M7AG 5ECAA 2CSQA 2RQUA 1LJOA 2HEQA 3JB9D 3JCMX 1K4US 2VB6A 5AYFA 4PFZA 3MKDA 1B3QA 2L2PA 2E3HA 4C92A 3OYEA 2DD4A 2JOYA 1TTHB 3JCMV 2K4YA 4LXCA 3M4YA 3LYIA 3JCMd 1GCPA 4D8KA 1MMDA 1F1BB 1QW1A 4FU6A 4RG8A 1QVFS 4JPBW 2F5KA 4OGCA 4LN2A 3CXCP 2L3QA 3EAEA 1K0XA 4FSXA 1KC8C 4CC7A 5LJ3h 4C92F 1YBYA 2KXCA 4N4HA 1A0NB 2FZCB 5HCKA 1MMAA 2DVJA 4FYXB 3HL8A 4QKUA 2J6OA 2RHZA 2JTFA 3CCJT 2RQTA 2QDLA 3REBB 3NHNA 4LDUA 1D0ZA 2YWWA 1M3BA 2DKGA 4M78E 4AFQC 2P4RA 2CP3A 1RLPC 2R5MA 4DBRA 1T3SA 2EWNA 2HKQB 3CBPA 4AMCA 4DEYA 1ZBJA 2I0NA 4XU2A 3SD4A 3L2UA 3FJPA 1UG1A 3G6EA 4OVAA 4HT8A 3EG9B 1K9MR 2XU8A 4M7DD 4JLIA 4RKUE 5GAN3 2WSFE 3A5ZB 3AHUA 9ATCB 4XTXA 2DL7A 3PVLA 2KDSA 3CCEA 3M59A 1OU9A 2RPNA 3CCSQ 2DE0X 4NOYA 2NUZA 3MPUB 2RHIA 1C6VX 1K0SA 1N6AA 3R6OA 4BACA 2RHYA 1WFWA 1ZSZC 1FXXA 3S3MA 2CP2A 4PJOD 1LNXA 2DRMA 3L2QA 4M75C 2OTJA 2JJ9A 2X4XA 1KQ2A 4J9EA 4IIMA 1N8RC 1PKSA 1YFNA 2QXFA 4KGVB 2A37A 4OMQA 1MHNA 2QA4A 3QDRB 2KSSA 2GBQA 2EGEA 3RKWA 4IUVA 1YIJT 1G83A 5CR2A 3J80E 2HL3A 2RQRA 2KI7A 1UJYA 4M7DF 1MV0B 2CP5A 2YHTA 3VS5A 3L2WA 4OB2B 4O6JA 5I2MA 5GAMe 1KQSS 4C92E 4BB7A 2YT6A 3CEYA 5GANd 1NJIR 1TWBA 4KUIA 2QQ9A 3H0HA 4A4HA 2IG0A 4JLGA 4DQ2A 3J81E 2M16A 2WACA 3QO3A 2JS0A 3M56A 4PNOA 1R0BG 4MZMA 1G3WA 3VJPA 3VS6A 1KC8R 4KT0E 3PIPA 1MV3A 2MIOA 1H3HA 1PHTA 2MOXA 1K1ZA 1CSKA 3EG2A 2KRNA 4XK8E 3TREA 2Z0WA 5GMKi 4XTZA 1VQ9A 3CCRT 3M55A 5LJ5j 3V8KA 2DO3A 1M2VB 1ZA2B 1M9SA 1BK2A 1YWPA 1X2QA 1VQ6T 1B07A 1X6OA 3X24B 1YNZA 2VGNA 1K9AA 2LJ1A 4C8QD 4L59A 2O01E 2PVGB 3OW2S 5LJ3e 2LQ8A 1KQSP 1Y96A 1JJ2S 2DEUA 3CC2Q 3HPWA 1WDXA 1D1AA 1JRIA 4XAXB 3MCAB 2CT3A 5GAN5 3CMAQ 3LLRA 1YN8A 5KCOA 1UTIA 1Q82C 5J26A 2GNCA 4WCIA 1QVGA 3M58A 2PQWA 1M3CA 4M78B 4FT4A 3JCMe 1RI0A 1X6BA 3L2VA 4BE1A 5GAOn 3SWNA 4Z8AA 3EGDB 5IH2A 3OYGA 5L23A 3E9FA 3L2RA 1IZ6A 1KSWA 2VASA 2JW4A 3S3OA 4DBHA 1N8RR 4M7DE 1K76A 3EFRA 4AFUC 4ZGEB 1RAHB 1BCMA 1E6HA 1YJ9Q 5EC7A 4JJCA 1B34B 2CUDA 2RH2A 3I56T 2DXCA 1TSFA 3FJ5A 3JRZA 2DXBA 4M78G 3PIOA 1VQNA 1K8AU 2A28A 4P5NA 5IT9E 1KHCA 5KCHA 2YUNA 1YITQ 2J6FA 1VQMT 4CC2A 3UT1A 3G4SA 1ZSGA 1ZX6A 3CXCA 2BTTA 4PK4A 3GNFB 4BI4A 1YJNA 4J9BA 3JCMJ 3OYFA 1TG0A 3OYBA 3SB2A 4LDWA 4FL6A 1Q81R 1VQLT 4C0DB 1QLYA 5I21A 1VQKQ 1EZZB 1WHGA 3JCMc 4LE9A 3EGUA 3G71Q 4OMFB 5FRNA 2RHXA 4E7LA 4C92B 1YJWQ 2LQKA 2XMFA 3QJYA 3BFMA 3CC7A 3CD6Q 1P92A 2MMPA 2VXEA 2KQWA 1B7TA 1VOMA 3REAB 4C5GA 1Q95G 1UHCA 1VQ4T 3QBYA 5KYYA 2DYIA 2EJ9A 5CAIA 1Y07A 4RMOA 1JQQA 1Q82R 2QQAA 1YI2T 5GMKj 4BE0A 1Y0MA 3L1AA 4NL3A 2FPEA 2EQMA 5GANe 4A63B 2J05A 2O4XA 5CQXA 4JJNK 4NS5A 1ABOA 3VS7A 4C92G 2PNIA 3M0QA 3M0SA 1JBMA 3RUXA 1AHJB 1U1SA 2EQUA 2P4TA 3VUBA 1PNJA 3GBQA 1IO6A 2KVQG 2BZXA 4VUBA 3CCLT 5FU6C 2EJGA 3LH5A 4CC4B 4M7AC 3C94A 4X1VA 1PSFA 3G4SQ 4E7JA 5KYNA 1PG5B 4MMKA 4WTOB 2LCCA 1KD1C 1G8XA 2DJQA 3HRSA 1PC0A 4XQ3A 2DBMA 1N9RA 2F2XA 4N0AA 1M30A 1Q86U 5FW9A 2DF6A 2M02A 3G1JA 2CH4W 4OMNA 1M90C 4M7DB 3VRYA 4ELYC 5LJ5g 5CKDA 1PD1A 3CCET 3JB9H 2CP7A 4HA8A 3EGXB 1W70A 3ULRB 5GAOp 2DD5A 1KQ1A 2K79A 4FYWB 1BYMA 1SHFA 3IQLA 1D3BB 4IURA 2DRKA 1QKXA 2DFUA 1RAAB 2VGMA 1Z9QA 2RO0A 2K5LA 2CKKA 1AWOA 1LCKA 1XQHA 2HDAA 2AKLA 3ZL7C 1UE9A 2ZAEA 5J3BA 2OTLA 1LPLA 2DAQA 2M9UA 5IHIA 2FHDA 3CCUA 2A3LA 2PU9B 3MP1A 2QA4T 5IHKA 3CCQA 4KGXB 2QK0A 3QKJA 3E9GA 1AVZC 2JMAA 4PFPA 1J3TA 2EAYA 3NPFA 4DBQA 3EHRA 1M2VA 1VQ5A 2CSIA 3HRTA 2K2MA 2DZ9A 2DX1A 4C0GA 3DLLA 1NYFA 4E7HA 1NBEB 2X9HA 1H92A 1WX6A 2JT4A 4R56A 1RI9A 3JCMW 2JZ2A 3M0PA 1WGSA 5IAYA 5LJ5f 3C0CA 3V7RA 4PFOA 2CREA 1QVGS 3C4SA 3RNJA 1UGQB 3VS2A 1Y57A 1VQ8T 1ACMB 1IB8A 4OGEA 1VQ9T 1CKBA 2LZ6B 4WF2A 3PMTA 3DB4A 2AT1B 1GFCA 4ELZC 5HY6A 3HHTB 4RCCA 3RIRA 1QWEA 1VQPQ 1R8OB 2FL7A 4ZTFA 2P84A 3EGDA 1IGQA 1VQOT 1ZUKA 3TSZA 1KD1R 1UB4A 3URGA 1I5OB 2E5KA 4M75D 2XDDA 4LDVA 1YHQQ 2RNAA 2DXTA 2FB7A 1QP2A 1TH7A 2P0QA 2CDTA 1WJQA 1M90R 2X4JA 2GTJA 1B34A 2FZGB 1QKWA 3RKYA 2K5FA 2CZ6B 4XTVA 2DTHA 3A8LB 3CCUQ 3QHSA 1Q82U 3CXCS 2E5QA 2E41A 2IVWA 3ER0A 3BDLA 4PLLA 4QQGA 1BIAA 3P8HA 5FWBA 1D1BA 3CCRQ 2K3YA 4AFSC 4OMMA 2KXDA 3CCSA 3ME9A 2ROTA 3QJ6A 3ASKA 3BE3A 4LDXA 2F2WA 3QWXX 4BUGA 1TOVA 4F16A 5GAOm 2OAUA 5CKEA 2BE9B 2DETA 1GBQA 2P0PA 3I5SA 3UPUA 4FYVB 3WVDB 1BKBA 2NWMA 3QPHA 4B6MA 3QDFA 4M77C 2QI2A 2HNIA 1NJIC 2RJDA 2CZ0B 4F17A 4EDUA 2E6NA 2K5IA 4GBQA 4J6WA 4BY6B 1HK9A 2K6DA 2L0AA 2EQIA 4BI3A 3VS0A 2RI3A 2I2LA 3X20B 3OB9A 4EMKC 3JCMb 3LH0A 1ZQ1A 5GAN8 1KIKA 4FYYB 2KROA 3S3NA 2LMJA 3OYKA 5KYXA 1OEBA 5KYYB 2LQNA 2EBPA 2RD1A 2DERA 3A8MB 3PMIA 3WVEB 2L3SA 1W4SA 4JZ4A 3CBMA 3CCVQ 2CP0A 2M0YA 4MDXA 3OSVA 2OI3A 2R58A 5A2QE 1AWJA 5LJ3j 3JCMh 2V1QA 8ATCB 3GLXA 3TEEA 4J9IA 5FWCA 5I22A 3OYIA 2EVRA 3JB9F 2EFIA 2O4XB 3RMQA 2ZPHB 4M78C 3P8DA 2KYBA 1R77A 2G6FX 1BI1A 1M1FA 2M1HA 1K73C 2H3JA 2XI9A 4DA4A 1FMWA 3Q1JA 1NYGA 5FU7B 4DBFA 4KH0B 4CC3A 2XDBA 2COYA 3KFVA 4XU3A 5DY9A 3CC2A 1H641 3H41A 5CKFA 1I4K1 3V8JA 1VQLQ 2QQBA 3CMAA 3GIBA 1WHKA 2E10A 1V29B 1JO8A 2DNUA 2D0NA 2ROLA 4C0FA 4M7DA 2KK4A 1M3AA 3GP8A 3EGXA 1IHWA 2MYSA 1RAFB 1G5VA 2QAZA 2RM4A 1U3OA 1G2BA 3TVTA 2RQVA 1D3BA 1RAEB 1RUWA 4BE2A 2ENMA 2VV5A 5LJ5d 2A7YA 4JRQA 3CPWP 1W6XA 4RTZA 4PJOA 4ZTJA 2SRCA 1JB0E 2O31A 2PVOB 4J5YA 2RQWA 2ABLA 4HCCA 2HL5C 1YI2Q 3INZA 3JV3A 1YJ9A 2JM9A 2GTOA 4C5IA 2O88A 2YLCA 1KD1U 3PT9A 3HFOA 3X26B 4IUPA 2KEAA 4KRTA 1VQ7Q 2HAXA 1QCFA 1AZGB 1OYXA 2FVUA 5GAN6 2XD0A 1D09B 4C92C 2EQKA 4XU1A 4PJOF 1SSHA 1WQ7A 1GXIE 1Q81C 2YDLA 1YITA 4IKFA 1MUZA 1GRIA 4QVDA 1WA7A 2DILA 2YRVA 2H3EB 3HFNA 3CCLQ 2LNHB 2MPXC 2BIVA 1WHLA 5GANh 2HD0A 1BCOA 1YWOA 3RMSA 3KBGA 1VQKA 2L5QA 1RACB 5HK0A 3LGFA 4A4KA 2NLUA 3G71A 4M4ZA 3CMEQ 4C0ZA 1YJWA 2BZYA 4CI0C 1UUEA 4J7FA 4TVRA 4AG1C 3SDZA 1K73R 5FRMA 4OF1A 5CQYA 4HVWA 3CC4T 3CD6A 4MZTA 4M7AD 1OPKA 2F69A 4K11A 3M54A 4OB0B 5IXBA 2X35A 4LD9K 1ZBXA 2YUQA 2Y4YA 4EMHA 3ZFJA 4C8QA 1S72Q 2D9TA 1U06A 3KUFA 2ED0A 2GF7A 4BD3A 1SEMA 3R6NA 1FX7A 3MEUA 5GJVB 1NM7A 3OYDA 1W2BA 1ZUYA 2GCXA 2RF0A 1M1KC 2ZPFB 5DM7R 1XOVA 1BI2A 4C8QF 4ESRA 3D7SB 1D0YA 3H0FA 2DIGA 1R0CB 2OJ2A 2X4YA 3OYLA 5D6XA 3JCMQ 1ABQA 3VYHB 3EG0A 5HKCA 2MF2A 3OYMA 1M2OA 1VYUA 2BZ8A 2CS7A 2NYSA 2MCNA 5M9OA 2DZCA 3I55Q 5GAOl 4PJOE 1ZSZB 4HKEA 2DA9A 1SG5A 2JTEA 1OOTA 2VC8A 2XICA 1TXQA 2KE9A 1Q7YC 1FYNA 1XTDA 4PJJA 1GCQA 1K9MU 2D0QB 3CCMQ 3M0RA 1TUCA 5LJ3g 2KRMA 1OX8A 1WXUA 3FLGA 4E7SA 2D6FA 3EG3A 1WNLA 2M0OA 4D8DA 1N5ZA 4E6RA 1AWWA 2C0OA 2L89A 2XIDA 2PTKA 4YTLA 2E64A 4ZGJB 1C1AA 3PE0A 3CCST 3EG1A 5FLXE 2EKOA 1OULA 3JAME 4Z02A 3C12A 2QEXQ 4A4EA 3JSCA 2DVEA 1VQOQ 5C6SA 1G3YA 4LD6A 2EYWA 4JRIA 4ANJA 3CCJA 1UJ0A 3QZ9B 3QSUA 2FYKA 2LT1A 2DJZA 2MI6A 1PRMC 4RG2A 2GGRA 4QQ6A 2VUBA 4GLMA 3VRZA 5KYXB 2RB6A 2LNVA 5AT1B 2ZGWA 3E2UA 1OI1A 1JEGA 1BI0A 4FCYA 4V2SA 1NG2A 4ATOA 1NJIU 2FPDA 1VIEA 2E3IA 1YP5A 5IN1A 4C8QE 1U5SA 1UGRB 3FIFA 4Z88A 5LJ3f 5GAN2 3CPFA 4QW2A 1KC8U 3VV0A 4JJDA 2DMOA 3J7AF 4HCZA 4JUVA 1M1KR 2W10A 3SWNC 3NTKA 3GF5A 3UATA 2VWFA 2EGCA 3A1PA 1RAGB 3JB9G 3EHQA 1M5Q1 4JS4A 2LDMA 2LQWA 5DLQE 3CPWA 4OMLA 2CT4A 1VA7A 2F2VA 2RI5A 3G6ET 3RR6A 2E4HA 4C5EA 1PM3A 1KG1A 2V8KA 3NFCA 2A0FB 3OS5A 2COWA 4E2FB 1WPYA 1YIJA 2RN8A 2AK5A 1VQPA 1Q7YR 3BDUA 4Y28E 4NL2A 1QMCA 4RTUA 2ZCFB 1SPKA 3DLMA 2LT4A 4XU0A 3CC2T 1MNEA 1GFDA 4HXJA 1YHQA 3NTHA 3CMAT 4M77D 3O5ZA 2OTJT 3PFSA 3CCJQ 4PJLA 3FEOA 3EFSA 2JNGA 4PJOB 3OS1A 4FW2A 4FSSA 4BDZA 4OB3B 1RAIB 1N8RU 2RI2A 3CCRA 2ZPEB 1VUBA 2K7AA 4KH1B 4BY6C 2RHUA 4M7DG 2Y4XA 3V7SA 4IIOA 1WHHA 3QXEB 1C0MA 1QCOA 2QYZA 3FDRA 2GQVA 4F04B 2JS2A 3HRUA 3MHXA 5LL6S 4KGZB 2DL5A 4QT7A 4X34A 3BW1A 4PJOG 4M77F 2HSPA 2KGTA 4M78D 3VS1A 2KRSA 5D6WA 4AT1B 2HSEB 1IGUA 1JXOA 4F7UA 1I81A 1JU5C 3M0UA 1Q81U 5GMKe 2LC4A 3MEVA 1FMKA 1N27A 3RBBB 3ZBDA 1YIJQ 1WZOA 3EFOB 4J6YA 2K3XA 2EJFA 4A53A 2K57A 3RERA 4FM4B 5FU7C 2OAWA 5CCAA 1IHVA 1W2BS 4F7UF 4C8QB 1QWFA 4PJNA 3G71T 1OU8A 1IXDA 3HTRA 1YJWT 4XTUA 3CCVA 1OPLA 2HQHA 3LX7A 1Y71A 2KAFA 3OBYA 3FRNA 4LNPA 1V76A 1NPRA 4N0AC 1PD0A 2E12A 5D6YA 5FU6B 5I11A 4J9FA 3P8BB 5A0LA 1ZSZA 5KH6A 4PLIA 1RL2A 2BKDN 1BBZA 1WI7A 3GOXA 4RCBA 3MP6A 4M75A 1VQ6Q 4F14A 1SSFA 1TUGB 2X51A 1YCYA 2JXBA 1W2BP 1QP3A 2EGAA 3PNWC 2FPFA 2WSCE 3OMCA 1VQLA 5DLOA 4C8QG 2L3PA 3OYHA 4J9GA 1OZ3A 1S1NA 1PSEA 2GFAA 5GAN4 4KUDK 2G3RA 4M75F 5GAMj 3OYCA 2RJEA 2PZ1A 3MEWA 1M1KU 1AT1B 1EFNA 4DEXA 4E7KA 3WXMB 4KBMB 1FMVA 2B86A 2NUPA 3VKIA 2D8HA 2KBTA 1VQNT 2K9GA 5LJ3d 2O2OA 3A8OB 4M77E 3T9NA 3GPLA 3G4ST 2J06A 1RABB 3MO8A 1VQ4A 2KT8A
chains in the Genus database with same CATH topology
4OMFB 5FRNA 2RHXA 4QQDA 2QQRA 4C92B 4E7LA 1YITA 1YJNT 4IKFA 3LW5E 1YJ9T 2LQKA 2RJCA 3QJYA 3BFMA 1KQSA 4DOVA 3M9QA 1Q7YU 2LRQA 4R55A 4QVDA 4A4FA 3JCMP 1X01A 2RK1A 2Y90A 2YRVA 1YI2A 2RK2A 3HFNA 3CC7A 1HXDA 1P92A 3OYJA 2MMPA 2VXEA 1VQ7A 2BIVA 2KQWA 1H3ZA 4C5GA 5GANh 4IUUA 1N9SA 2CZ7B 2HD0A 3O8VA 3I55T 1WJSA 3CC4A 4EMKA 1VQ4T 3QBYA 3RMSA 2DPPB 2QQSA 1YITT 4F7UE 3KBGA 4IUQA 1Y7XA 3META 3V8LA 1VQKA 1WJRA 2EJ9A 1Y07A 2L5QA 5CAIA 2LX9A 1U1TA 5A0GA 4RMOA 5HK0A 3LGFA 3X25B 4A4KA 2NLUA 3G71A 5GMKm 3CCMT 2QQAA 3MEAA 5FROA 4C0ZA 1YI2T 1YJWA 4II1A 2CGHA 4CI0C 1I5LA 3CC7T 4J7FA 4TVRA 5GMKj 4FIBA 4BE0A 5J39A 3L1AA 4J8OA 4NL3A 3SDZA 5FRMA 2EQMA 5GANe 3LGLA 4OF1A 5CQYA 2O4XA 5CQXA 1I8FA 4L6V5 3QYHB 3CC4T 4JJNK 4NS5A 3G7ZA 3CCLA 4J83A 4MZTA 3PTAA 3CD6A 3LWIA 4HCBA 1Y96B 5GANf 3FC3A 2EQJA 4M7AD 1VQKT 4C92G 2F69A 1M1GA 5GAOr 3CPWS 3M54A 4OB0B 2X35A 4LD9K 4M78A 1JBMA 1ZBXA 3RUXA 3OW2A 1Q86C 2PUKB 2Y4YA 4EMHA 2QDYB 3ZFJA 4C8QA 1AHJB 1JJ2A 1U1SA 2EQUA 2DTIA 2P4TA 3OYAA 3VUBA 2MWPA 2D9TA 2QEXT 3CMEA 1K8AC 3KUFA 2KVQG 1O75A 2GF7A 4VUBA 4BD3A 3CCLT 3OA6A 3CD6T 5FU6C 2EJGA 3I56A 1FX7A 1VQNA 4M7AC 3C94A 3SFMA 1PSFA 5GAMd 4MDWA 3MEUA 3E1SA 1K9MC 3OYDA 1W2BA 4E7JA 3OS0A 2GCXA 4M78F 3TCJA 1M1KC 3SWNB 2ZPFB 3QUIA 5DM7R 4M7AB 1XOVA 1BI2A 4MMKA 4PKCC 4C8QF 2MWOA 2LCCA 4E7IA 1BI3A 1VQMA 1X75C 1KD1C 4M75E 4JS5A 3HRSA 2DIGA 4XQ3A 1N9RA 2X4YA 2EYQA 2JVVA 5GAN7 3OYLA 4N0AA 5D6XA 3JCMQ 4CRIA 4J7IA 4MZPA 4EPCA 3VYHB 5HKCA 1Q86U 2MF2A 3OYMA 5CKBA 1DJ7B 2CS7A 1S72A 1NE8A 1NZ9A 5GAOq 1M90C 4BI8B 4M7DB 4ELYC 5M9OA 5LJ5g 2DZCA 5CKDA 4XTYA 5CKHA 5GAOl 3CCET 1WQWA 4FT2A 4ME7A 4PJOE 4HKEA 2JUFA 3JB9H 3OQ5A 4HA8A 4C92D 2VC8A 2XICA 2XG8D 1Q7YC 4ZN3A 5GAOp 2DD5A 1XTDA 1KQ1A 2AHJB 4JDSA 5GAMh 2D0QB 1K9MU 1BYMA 2ZPIB 4XTWA 2L8DA 4C0DC 1D3BB 3VU3C 2DIQA 4IURA 1MGQA 2WSEE 2CYZB 4QVCA 2ZZDA 5LJ3g 1VQPT 2VGMA 2RO0A 3OMGA 2K5LA 2CKKA 5GMKl 3FLGA 1XQHA 3ZEHA 2D6FA 2LTOA 1WNLA 2M0OA 4M7AG 3F70A 5J3BA 2OTLA 2DAQA 2L89A 2M9UA 2FHDA 2XIDA 4YTLA 3I55A 3CCUA 3NTIA 2A3LA 1LJOA 1M90U 2E64A 3JB9D 3JCMX 2PU9B 3MP1A 2QA4T 4ZGJB 1YHQT 5AYFA 3CCQA 3CCST 5FLXE 3TU4K 4C92A 3OYEA 2RA2A 5LJ5h 2EKOA 2DD4A 2JOYA 3A8GB 3QKJA 4Z02A 3JAME 3JCMV 3E9GA 3CCMA 3C12A 3DKMA 2K4YA 4A4EA 3JSCA 3M4YA 3LYIA 3JCMd 2DVEA 2EAYA 3GNGA 2YLBA 4M77B 4RG8A 1QW1A 4FU6A 5C6SA 1VQ5A 1QVFS 1G3YA 5I2SA 4LD6A 3HRTA 4JRIA 2F5KA 4OGCA 2OTLT 4Q5WA 3QZ9B 3CCJA 1VQ4A 3CCUT 3QSUA 4C5HA 4OP0A 2DZ9A 2JTMA 4C0GA 3EAEA 2FYKA 2LT1A 3DLLA 1VQNT 4E7HA 2DJZA 1VQ8A 4FSXA 3CCQT 1KC8C 2MI6A 5LJ3h 4C92F 1YBYA 4RG2A 3JB9J 4N4HA 4QQ6A 5CO7A 2VUBA 4R56A 3HP9A 5CK9A 3JCMW 2RB6A 2LNVA 2JZ2A 1WGSA 3HL8A 2ZGWA 4E47A 5IAYA 5LJ5f 1OI1A 1VQ5T 4EMKB 3V7RA 2K2VA 2V8JA 3H8ZA 5GANj 2RHZA 2JTFA 4EMGA 3BY7A 3C4SA 1BI0A 2QEXA 3CCJT 1QVGS 1EIFA 4LDUA 4V2SA 1UGQB 4ATOA 1VQOA 2HBPA 1NJIU 2DKGA 2DXUA 2ZPBB 4F7UB 1VIEA 1VQ8T 4M78E 4OGEA 1VQ9T 3CCRT 5IN1A 4WF2A 4C8QE 2R5MA 4B9XA 1UGRB 3PMTA 3FIFA 2EWNA 3CBPA 3DB4A 5LJ3f 5GAN2 1M8VA 4XU2A 4ELZC 5HY6A 3CPFA 2BUDA 4QW2A 3SD4A 3HHTB 1KC8U 3L2UA 3FJPA 3VV0A 3G6EA 4M77G 4OVAA 4RCCA 2P0KA 3RIRA 2VYTA 5KE3A 4HT8A 1R8OB 3J7AF 4HCZA 2FL7A 2XU8A 4ZTFA 4JUVA 4M7DD 5GAMg 4IUTA 4JLIA 4RKUE 3SWNC 1UGPB 3NTKA 3GF5A 5GAN3 1VQOT 1UB4A 3URGA 2WSFE 3A5ZB 3X28B 3AHUA 3M53A 4XTXA 2XDDA 4M75D 2B8AA 2KDSA 2LCLA 2XK0A 3CCEA 4LDVA 3OSSC 3JB9G 1M5Q1 3M59A 4JS4A 2LDMA 5DLQE 3CPWA 2DXTA 2RI5A 1ZHIA 2FB7A 4NOYA 1QP2A 4M7AA 4OB1B 1TH7A 3G6ET 3L2ZA 2P0QA 5L8RE 4C5EA 1KG1A 2RHIA 2V8KA 1WJQA 3NFCA 2X4JA 1N6AA 3E19A 3R6OA 3OS5A 4BACA 2RHYA 4M7DC 1B34A 1WPYA 4MMLA 3RKYA 1YIJA 2K5FA 2CZ6B 1FXXA 3S3MA 4PJOD 3M4GA 4XTVA 1LNXA 1K8AU 3L2QA 4HT9A 1NPPA 1VQPA 4F7UG 4M75C 2DTHA 2MAMA 3BDUA 5CIUA 1U8RA 2OTJA 3A8LB 4Y28E 3QHSA 3JCMc 2X4XA 3OW2S 1Q82U 1KQ2A 3CXCS 3CCVT 2E5QA 2E41A 2E70A 4NL2A 2IVWA 1N8RC 3ER0A 4BDYA 4GY5A 2XKOC 4M7AF 2ZCFB 3BDLA 4M75B 4PLLA 4QQGA 1BIAA 3DLMA 3P8HA 2LT4A 2K3YA 4XU0A 3CC2T 2QXFA 3OY9A 2QA4A 1MHNA 3M57A 2L3RA 2KSSA 3QDRB 3RKXA 3RKWA 1YHQA 3CCSA 3NTHA 3ME9A 4IUVA 4PJOC 1YIJT 3QJ6A 2XD0A 3ASKA 4N4IA 3CMAT 4M77D 3HKSA 5CR2A 4LDXA 4BUGA 2OTJT 3PFSA 3J80E 3FEOA 3EFSA 4M7DF 2YHTA 2JNGA 2OAUA 4J6XA 5CKEA 5GAOm 4PJOB 4A54A 2P0PA 3OS1A 1QVPA 3L2WA 4OB2B 4O6JA 3UPUA 5I2MA 3WVDB 5GAMe 1KQSS 3KXTA 4C92E 1BKBA 4BDZA 3S6WA 4BB7A 3CEYA 5GANd 4OB3B 2VXFA 2E1HA 3QPHA 3N5BB 4KUIA 4M77C 2QQ9A 2QI2A 3V7CA 4A4HA 2DEQA 2IG0A 2RI2A 4B9WA 5GAMf 3CCRA 4JLGA 4LDYA 4DQ2A 5A0DA 3J81E 2ZPEB 2HNIA 4O5VA 1VUBA 3JCMg 2KMTA 2M16A 2WACA 3QO3A 3M56A 4PNOA 1NJIC 4MZMA 2RHUA 2RJDA 4X9DA 4N4GA 1G3WA 3VJPA 4BY6C 4M7DG 2CZ0B 4EDUA 4KT0E 3PIPA 2E6NA 2K5IA 2Y4XA 3V7SA 4J6WA 4M75G 4BY6B 1HK9A 4XK8E 3TREA 4BI3A 3UDCA 5GMKi 2RI3A 4XTZA 3QXEB 1VQ9A 2I2LA 3X20B 3FDRA 2GQVA 1UGSB 3OB9A 3M55A 3HRUA 3MHXA 3LH0A 2RJFA 4EMKC 4ZGDB 1O9SA 1ZQ1A 3V8KA 4KULA 2PUOB 2DO3A 5LJ5j 4D6WA 5GAN8 2R5AA 5LL6S 1M9SA 1VQ6T 3S3NA 3OS2A 5GMKh 1M4ZA 3OYKA 2HQEA 4X34A 3BW1A 1X6OA 4PJOG 4M77F 2E65A 3X24B 2X4WA 4M78D 2RD1A 3LWHA 3A8MB 3PMIA 2VGNA 2XDPA 3WVEB 5HK3A 1QVFA 3QIIA 1W4SA 4L59A 4C8QD 3JB9I 3CBMA 2O01E 3MP8A 2PVGB 5D6WA 4MDXA 3OSVA 1XNIA 5LJ3e 2LQ8A 2HQXA 2R58A 2XHCA 3VYGA 3JCMh 5LJ3j 5A2QE 1Y96A 4F7UA 1JJ2S 1I81A 3GLXA 1UEBA 4DOWA 2JN0A 3HPWA 3TEEA 2QTXA 3OYIA 3VUZA 1Q81U 1VIFA 5GMKe 5KE2A 2LC4A 2EFIA 2O4XB 3MEVA 3JB9F 1N27A 2R57A 1JRIA 3OBWA 2ZPHB 3MCAB 3QZ5B 3QG1A 4XAXB 3RMQA 3ZBDA 5GAN5 1VQ7T 3LLRA 3C95A 2DTOA 4M78C 4J6YA 2K3XA 3P8DA 5KCOA 5LJ5e 1Q82C 3UWNA 2EJFA 5J26A 2LVMA 4A53A 2K57A 3RERA 4FM4B 5EG2A 5FU7C 4C8QC 5CCAA 1BI1A 3DB3A 3RESA 1W2BS 1M1FA 2M1HA 1QVGA 2F5TX 2H3JA 1K73C 2XI9A 3M58A 2PQWA 3H6ZA 4M78B 4DA4A 2PVDB 4FT4A 3JCMe 4F7UF 1RI0A 1KHIA 3Q1JA 5FU7B 4C8QB 3G71T 4M7AE 1BIBA 1YJWT 4XTUA 3CCVA 3HSBA 3L2VA 4BE1A 5CVIA 3JCMf 5GAOn 2XDBA 3LX7A 4XU3A 3SWNA 3A8HB 4QVZA 5DY9A 1Y71A 3OYGA 3CC2A 1H641 2KAFA 5CKFA 1I4K1 3E9FA 3V8JA 1IZ6A 3L2RA 1OZ2A 3OBYA 3FRNA 3S3OA 2QQBA 3JCMb 4PL6A 3CMAA 1NPRA 3GIBA 4N0AC 3EFRA 4M7DE 2E10A 1V29B 4ZN1A 2E12A 4GLKA 5D6YA 5FU6B 1G3SA 4ZGEB 3CBOA 4C0FA 4M7DA 2GFUA 3P8BB 5A0LA 3M5AA 2KK4A 1K73U 5KH6A 4JRKA 4PLIA 1B34B 1RL2A 2BKDN 2V8IA 1LOJA 5C0MA 3GP8A 4RCBA 3MP6A 3GOXA 3CMET 4M75A 4UC4A 2RH2A 3I56T 2DXCA 1G5VA 1SSFA 3JRZA 2RM4A 3QYGB 4L5GA 2DXBA 1YCYA 1D3BA 1FWZA 3PGGA 1QP3A 2EIFA 3PNWC 4M78G 2WSCE 3PIOA 3OYNA 3OMCA 4P5NA 4BE2A 4X9CA 5DLOA 5IT9E 1KHCA 5KCHA 2VV5A 4C8QG 1VQLA 5LJ5d 2A7YA 4JRQA 1VQMT 4A4GA 3OYHA 3UT1A 2KY9A 1OZ3A 2GFAA 1PSEA 5GAN4 3G4SA 3CXCA 4PJOA 4ZTJA 5GANg 1G3TA 4KUDK 1JB0E 2G3RA 2PVOB 4J5YA 4M75F 3GNFB 5GAMj 4BI4A 3OYCA 2RJEA 4HCCA 3MEWA 1YJNA 3FB9A 1M1KU 3INZA 4JRPA 3JCMJ 4Y91A 4C5IA 1YJ9A 3OYFA 2DK3A 2YLCA 1KD1U 3PT9A 1N8RU 3HFOA 3X26B 4IUPA 4E7KA 1S72T 2HAXA 3OYBA 3SB2A 3WXMB 4KBMB 4LDWA 3VKIA 1OYXA 2FVUA 2ZPGB 4FL6A 2E6ZA 5GAN6 5LJ3d 2CZ1B 2C06A 1VQLT 3OYYA 4M77E 3A8OB 4C0DB 1VQ6A 3T9NA 4C92C 5I21A 3GPLA 2EQKA 4XU1A 4PJOF 1WQ7A 3G4ST 1IREB 4M77A 3MO8A 3L42A 1GXIE 1Q81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 e;  5LJ3 j;  3JCM h;  5GAO p;  4C92 B;  3JB9 G;  1Y96 A;  1M5Q 1;  1KQ1 A;  4F7U A;  1I81 A;  5GAM h;  2DXT A;  2JN0 A;  2FB7 A;  3BFM A;  4NOY A;  4M7A A;  2QTX A;  4XTW A;  1TH7 A;  3JB9 F;  3L2Z A;  5GMK e;  1D3B B;  1JRI A;  3VU3 C;  4QVD A;  3JCM P;  1X01 A;  4M7D C;  1MGQ A;  2Y90 A;  5GAN 5;  4QVC A;  1B34 A;  3HFN A;  5LJ3 g;  1WPY A;  2DTO A;  1HXD A;  4J6Y A;  4M78 C;  4MML A;  3RKY A;  2VXE A;  2EJF A;  4A53 A;  2K57 A;  3RER A;  4C8Q C;  4PJO D;  3M4G A;  4XTV A;  1LNX A;  5GAN h;  4HT9 A;  1N9S A;  4M75 C;  2DTH A;  3RES A;  3BDU A;  4F7U G;  3QHS A;  4EMK A;  1KQ2 A;  1WNL A;  4M7A G;  4M78 B;  3JCM e;  2E41 A;  4NL2 A;  4F7U F;  4F7U E;  3V8L A;  4C8Q B;  1LJO A;  2EJ9 A;  5CAI A;  4M7A E;  2E64 A;  3JB9 D;  1BIB A;  3JCM X;  1U1T A;  4M75 B;  4XTU A;  3HSB A;  1BIA A;  4XU0 A;  3JCM f;  5GAO n;  4XU3 A;  3SWN A;  5GMK m;  4C92 A;  3RKX A;  2RA2 A;  1I5L A;  2CGH A;  5DY9 A;  5LJ5 h;  3RKW A;  3JCM J;  5GMK j;  1H64 1;  3JCM V;  4PJO C;  3L1A A;  1I4K 1;  3V8J A;  4NL3 A;  4M77 D;  4M7A F;  5GAN e;  3JCM d;  2DVE A;  1I8F A;  2EAY A;  4M77 B;  2YLB A;  3GIB A;  3EFS A;  4N0A C;  3EFR A;  4JRI A;  4M7D F;  2YHT A;  4J6X A;  1Y96 B;  5GAO m;  2E10 A;  5GAN f;  3QSU A;  4M7A D;  4PJO B;  4OP0 A;  4C92 G;  2DZ9 A;  4A54 A;  2FYK A;  5GAO r;  2DJZ A;  4M7D A;  5GAM e;  5LJ3 h;  4C92 F;  4M78 A;  1JBM A;  4C92 E;  3RUX A;  3JB9 J;  4JRK A;  1B34 B;  5GAN d;  4EMH A;  1LOJ A;  4C8Q A;  2VXF A;  4RCB A;  2E1H A;  1U1S A;  4M77 C;  2DTI A;  3V7C A;  4M75 A;  3JCM W;  2DEQ A;  2RB6 A;  5GAM f;  4DQ2 A;  2HNI A;  2ZGW A;  3JCM g;  5LJ5 f;  2RM4 A;  4EMK B;  3QO3 A;  3V7R A;  4PNO A;  1YCY A;  2EJG A;  4X9D A;  5GAN j;  4M7D G;  4EMG A;  4M7A C;  3BY7 A;  1D3B A;  3PGG A;  4M78 G;  4M7D D;  5GAM d;  4V2S A;  4X9C A;  4C8Q G;  5LJ5 d;  2DKG A;  2DXU A;  4F7U B;  4M78 E;  4M78 F;  4J6W A;  4M75 G;  3SWN B;  3V7S A;  3QUI A;  1HK9 A;  4M7A B;  4WF2 A;  4MMK A;  4C8Q E;  4C8Q F;  5GAN 4;  4PJO A;  5GMK i;  5GAN g;  4XTZ A;  4J5Y A;  2I2L A;  3FIF A;  2EWN A;  4M75 E;  4M75 F;  5GAM j;  4XQ3 A;  4EMK C;  1N9R A;  3FB9 A;  5LJ3 f;  5GMK l;  3INZ A;  5LJ5 j;  5LJ5 e;  4Y91 A;  3V8K A;  4XU2 A;  3JCM b;  5GAN 8;  5GAN 2;  5GAN 7;  4N0A A;  1M8V A;  2YLC A;  3JCM Q;  3HFO A;  3FJP A;  4M77 G;  4RCC A;  3RIR A;  3SB2 A;  5GMK h;  4HT8 A;  3BW1 A;  4JUV A;  5GAN 6;  5LJ3 d;  5GAM g;  4PJO G;  4JLI A;  3SWN C;  4M77 F;  4M77 E;  5GAO q;  2E65 A;  5GAN 3;  4M7D E;  4M78 D;  4C92 C;  2RD1 A;  4M7D B;  5LJ5 g;  2DZC A;  5I21 A;  4XTY A;  5GAO l;  4XU1 A;  1WQW A;  4PJO F;  4XTX A;  4C8Q D;  1WQ7 A;  3JB9 I;  3AHU A;  4PJO E;  3JB9 H;  4M77 A;  4M75 D;  4HA8 A;  4C92 D;  3JCM c;  2VC8 A; 
#chains in the Genus database with same CATH topology
 2QQR A;  1YJN T;  1OX9 A;  1VYV A;  4DOV A;  1Q7Y U;  2COZ A;  2LRQ A;  1HD3 A;  1H8K A;  3I5R A;  4A4F A;  1IRX A;  1X01 A;  2RK1 A;  2Y90 A;  1YI2 A;  2RK2 A;  3EH2 A;  4RTY A;  3OYJ A;  1I07 A;  1VQ7 A;  1H3Z A;  1T0J A;  4IUU A;  3O8V A;  1Z9Z A;  3SHW A;  2DPP B;  1CKA A;  3TQ7 P;  4F7U E;  5IXF A;  4IUQ A;  1Y7X A;  3V8L A;  1WJR A;  5KYU B;  5A0G A;  3X25 B;  5GMK m;  3MEA A;  5FRO A;  4II1 A;  3CC7 T;  2QG9 B;  4FIB A;  3I56 Q;  4R0K A;  1WLP B;  1NLO C;  2YUP A;  1AOJ A;  4L6V 5;  3G7Z A;  3CCL A;  4J83 A;  2SEM A;  1VQM Q;  2CH4 A;  2W0Z A;  1QCN A;  3CPW S;  1K8A R;  1Q86 C;  2QDY B;  2JM8 A;  2DTI A;  2HMA A;  2MWP A;  3CME A;  3OA6 A;  1QVF P;  3SFM A;  2ATC B;  4MDW A;  3E1S A;  4E7I A;  4PKC C;  2KNB B;  1X75 C;  1E7O A;  4M75 E;  1WYX A;  2EYQ A;  5GAN 7;  3VS3 A;  5GJW B;  4CRI A;  4EPC A;  2V1R A;  1S72 A;  1NE8 A;  4BI8 B;  4XTY A;  1VQ4 Q;  4ME7 A;  1BB9 A;  2DL4 A;  2JUF A;  2KT1 A;  2DBK A;  3OQ5 A;  2YXY A;  1GL5 A;  2EKH A;  4ZN3 A;  2C0T A;  2ZPI B;  2OX7 A;  4C0D C;  3VU3 C;  1PRL C;  2WSE E;  2CYZ B;  4QVC A;  2DL8 A;  1VQP T;  4Y92 A;  1KJW A;  1ZLM A;  1XJW B;  2F1L A;  3F70 A;  1BU1 A;  4AG2 C;  3I55 A;  3NTI A;  1M90 U;  1E6G A;  1YHQ T;  1UFF A;  3TU4 K;  2RA2 A;  5LJ5 h;  3A8G B;  5D7U A;  1AZE A;  3CCM A;  3DKM A;  3TSW A;  3SEM A;  4M77 B;  3GNG A;  2YLB A;  5I2S A;  2O9V A;  2FG0 A;  2OTL T;  1GBR A;  4Q5W A;  3CCU T;  4C5H A;  4OP0 A;  4OMO A;  2JTM A;  2LJ3 A;  1VQ8 A;  2YRD A;  2CUB A;  3CCQ T;  2ECZ A;  2EW3 A;  2X3W D;  3JB9 J;  1I1J A;  5CO7 A;  3G6E Q;  2LP5 A;  3HP9 A;  5CK9 A;  2DYB A;  4E47 A;  1VQ5 T;  4EMK B;  1D0X A;  2YRC A;  5KYW A;  2K2V A;  2V8J A;  3H8Z A;  5GAN j;  4EMG A;  3BY7 A;  2QEX A;  1PCX A;  1EIF A;  4HCK A;  3CCE Q;  3EFO A;  1VQO A;  1Q86 R;  2HBP A;  2K3B A;  2DL3 A;  2DXU A;  2ZPB B;  4F7U B;  4PJM A;  2EYZ A;  1NLP C;  4B9X A;  2DLP A;  3EH1 A;  1M8V A;  2BUD A;  1AWX A;  4M77 G;  5KE3 A;  2P0K A;  2VYT A;  2CP6 A;  1X2K A;  2OTJ Q;  5GAM g;  4IUT A;  1SRL A;  1UGP B;  1TU0 B;  3X28 B;  2MK5 A;  3M53 A;  3NMZ C;  2B8A A;  2LCL A;  2XK0 A;  1VYT A;  3OSS C;  1RLQ C;  2QA4 Q;  1ZHI A;  2QAS A;  2X3X D;  4M7A A;  4OB1 B;  3L2Z A;  5L8R E;  1SF9 A;  3E19 A;  4M7D C;  4MML A;  1MND A;  1UHF A;  1NEB A;  2KR3 A;  3M4G A;  4HT9 A;  3NGP A;  1NPP A;  4F7U G;  2MAM A;  1U8R A;  5CIU A;  1JXM A;  3UF4 A;  3CCV T;  2E70 A;  3OW2 P;  2VVK A;  2AKK A;  4BDY A;  4GY5 A;  1JJ2 P;  2XKO C;  4M7A F;  1ZUU A;  4M75 B;  4RTT A;  3OY9 A;  1AEY A;  3M57 A;  3RKX A;  2L3R A;  4PJO C;  4FW1 A;  4N4I A;  3HKS A;  4RTV A;  4ZNX A;  1ARK A;  4J6X A;  1EX4 A;  1PKT A;  1VQ8 Q;  2IPO B;  1VQ9 Q;  4A54 A;  1QVP A;  1TS9 A;  2NUT B;  3KXT A;  3CQT A;  3S6W A;  2O9S A;  1T3L A;  2VXF A;  2E1H A;  2NUP B;  3N5B B;  3V7C A;  4B9W A;  2DEQ A;  5GAM f;  4LDY A;  2LJ0 A;  1WHJ A;  5A0D A;  3JCM g;  4O5V A;  2KMT A;  3VS4 A;  1WIE A;  4X9D A;  4N4G A;  4RTW A;  3THK A;  1WXT A;  1MMG A;  4M75 G;  3QWY A;  1AD5 A;  3I9Q A;  3UDC A;  2EYY A;  2FRW A;  2FEI A;  1UGS B;  5LJ5 e;  5GMK l;  2RJF A;  4ZGD B;  1O9S A;  2GQI A;  4KUL A;  2PUO B;  4D6W A;  5KYU A;  2R5A A;  3OS2 A;  5GMK h;  1M4Z A;  2HQE A;  2LX7 A;  1D1C A;  2VKN A;  2E65 A;  2X4W A;  3LWH A;  2XDP A;  2QTV A;  2HBW A;  5HK3 A;  1QVF A;  3QII A;  1I0C A;  3JB9 I;  3MP8 A;  3PVQ A;  3UA7 A;  1XNI A;  2HQX A;  2XHC A;  3VYG A;  1W1F A;  1UEB A;  4DOW A;  2JN0 A;  2YUO A;  1SKU B;  3H9N A;  2QTX A;  4HCB A;  3VUZ A;  1VIF A;  5KE2 A;  3OBW A;  2R57 A;  3QZ5 B;  4J9C A;  2J7I A;  3QG1 A;  1VQ7 T;  2HZY A;  3MJX A;  3C95 A;  2DTO A;  3UWN A;  2LVM A;  5EG2 A;  1M8M A;  4C8Q C;  2EPD A;  4ORZ A;  3DB3 A;  3RES A;  3EG9 A;  2DM1 A;  1UGV A;  2F5T X;  1X27 A;  3H6Z A;  2PVD B;  7AT1 B;  1KHI A;  6AT1 B;  4M7A E;  1BIB A;  3HSB A;  2KYM A;  1SHG A;  1KFZ A;  5CVI A;  3JCM f;  3A8H B;  4QVZ A;  2YSQ A;  1SRM A;  1OZ2 A;  1VQN Q;  2HCK A;  4PL6 A;  1X43 A;  2EYX A;  4GLK A;  4ZN1 A;  2M51 A;  1G3S A;  3CBO A;  1YJN Q;  2GFU A;  3M5A A;  1K73 U;  2D1X A;  4JRK A;  2AZV A;  2QGF B;  2V8I A;  1LOJ A;  5C0M A;  3CME T;  5IHN A;  4UC4 A;  4JZ3 A;  1WHM A;  2V26 A;  3QYG B;  4L5G A;  1GCQ C;  1FWZ A;  3PGG A;  2EIF A;  3OYN A;  4X9C A;  1V1C A;  2D8J A;  4J9H A;  4A4G A;  4Z89 A;  2KY9 A;  5GAN g;  1G3T A;  1LVK A;  3FB9 A;  4HVU A;  1OQK A;  4JRP A;  4Y91 A;  3CC7 Q;  1HJD A;  2DK3 A;  1HYO A;  1S72 T;  1ZA1 B;  2ZPG B;  2E6Z A;  1VQ6 A;  2CZ1 B;  2C06 A;  3OYY A;  2HKN A;  3H0I A;  4LUE A;  1IRE B;  4M77 A;  3L42 A;  2JMC A;  3U23 A;  1PWT A;  1YCS B;  4QQD A;  3UA6 A;  3LW5 E;  1YJ9 T;  2RJC A;  1KQS A;  1TUD A;  3M9Q A;  4OMP A;  4R55 A;  3JCM P;  1HXD A;  2LCS A;  8AT1 B;  1N9S A;  2CZ7 B;  3I55 T;  1WJS A;  3CC4 A;  4EMK A;  2ESW A;  2QQS A;  1YIT T;  4E7Z A;  1OV3 A;  3MET A;  2A08 A;  2LX9 A;  1U1T A;  1QQJ A;  2A36 A;  1UEC A;  4RUG A;  3CCM T;  2AZS A;  2AIR B;  5KYW B;  1I5L A;  2CGH A;  4LUD A;  1X69 A;  5J39 A;  4J8O A;  3LGL A;  3A98 A;  1T0H A;  1I8F A;  4AFZ C;  3QYH B;  3I35 A;  3PTA A;  1NEG A;  3LWI A;  1Y96 B;  5GAN f;  3FC3 A;  2EQJ A;  1VQK T;  2C0I A;  1M1G A;  1MMN A;  1UDL A;  5GAO r;  2IIM A;  4M78 A;  3OW2 A;  2PUK B;  3M0T A;  1RAD B;  1JJ2 A;  1WXB A;  3OYA A;  2FRY A;  1K8A C;  2QEX T;  1KK7 A;  1O75 A;  2J6K A;  3CD6 T;  3I56 A;  5GAM d;  1K9M C;  3OS0 A;  4M78 F;  3TCJ A;  2FO0 A;  3SWN B;  3QUI A;  4M7A B;  2MWO A;  2ED1 A;  1BI3 A;  1VQM A;  4JS5 A;  2JVV A;  4J7I A;  4MZP A;  2BE7 D;  3AT1 B;  5CKB A;  1M27 C;  1DJ7 B;  1QVG P;  4J9D A;  1NZ9 A;  5GAO q;  2OTL Q;  2RMO A;  5CKH A;  1WQW A;  4FT2 A;  4C92 D;  3CCQ Q;  2XG8 D;  4JJB A;  2FZK B;  2AHJ B;  4JDS A;  5GAM h;  2H8H A;  2NUT A;  4XTW A;  2L8D A;  3RDV A;  2DIQ A;  1MGQ A;  1VQ5 Q;  2ZZD A;  4HVV A;  3OMG A;  4EIK A;  3CC4 Q;  2QGG A;  3ZEH A;  1HSQ A;  4RTX A;  2LTO A;  1X6G A;  4M7A G;  5ECA A;  2CSQ A;  2RQU A;  1LJO A;  2HEQ A;  3JB9 D;  3JCM X;  1K4U S;  2VB6 A;  5AYF A;  4PFZ A;  3MKD A;  1B3Q A;  2L2P A;  2E3H A;  4C92 A;  3OYE A;  2DD4 A;  2JOY A;  1TTH B;  3JCM V;  2K4Y A;  4LXC A;  3M4Y A;  3LYI A;  3JCM d;  1GCP A;  4D8K A;  1MMD A;  1F1B B;  1QW1 A;  4FU6 A;  4RG8 A;  1QVF S;  4JPB W;  2F5K A;  4OGC A;  4LN2 A;  3CXC P;  2L3Q A;  3EAE A;  1K0X A;  4FSX A;  1KC8 C;  4CC7 A;  5LJ3 h;  4C92 F;  1YBY A;  2KXC A;  4N4H A;  1A0N B;  2FZC B;  5HCK A;  1MMA A;  2DVJ A;  4FYX B;  3HL8 A;  4QKU A;  2J6O A;  2RHZ A;  2JTF A;  3CCJ T;  2RQT A;  2QDL A;  3REB B;  3NHN A;  4LDU A;  1D0Z A;  2YWW A;  1M3B A;  2DKG A;  4M78 E;  4AFQ C;  2P4R A;  2CP3 A;  1RLP C;  2R5M A;  4DBR A;  1T3S A;  2EWN A;  2HKQ B;  3CBP A;  4AMC A;  4DEY A;  1ZBJ A;  2I0N A;  4XU2 A;  3SD4 A;  3L2U A;  3FJP A;  1UG1 A;  3G6E A;  4OVA A;  4HT8 A;  3EG9 B;  1K9M R;  2XU8 A;  4M7D D;  4JLI A;  4RKU E;  5GAN 3;  2WSF E;  3A5Z B;  3AHU A;  9ATC B;  4XTX A;  2DL7 A;  3PVL A;  2KDS A;  3CCE A;  3M59 A;  1OU9 A;  2RPN A;  3CCS Q;  2DE0 X;  4NOY A;  2NUZ A;  3MPU B;  2RHI A;  1C6V X;  1K0S A;  1N6A A;  3R6O A;  4BAC A;  2RHY A;  1WFW A;  1ZSZ C;  1FXX A;  3S3M A;  2CP2 A;  4PJO D;  1LNX A;  2DRM A;  3L2Q A;  4M75 C;  2OTJ A;  2JJ9 A;  2X4X A;  1KQ2 A;  4J9E A;  4IIM A;  1N8R C;  1PKS A;  1YFN A;  2QXF A;  4KGV B;  2A37 A;  4OMQ A;  1MHN A;  2QA4 A;  3QDR B;  2KSS A;  2GBQ A;  2EGE A;  3RKW A;  4IUV A;  1YIJ T;  1G83 A;  5CR2 A;  3J80 E;  2HL3 A;  2RQR A;  2KI7 A;  1UJY A;  4M7D F;  1MV0 B;  2CP5 A;  2YHT A;  3VS5 A;  3L2W A;  4OB2 B;  4O6J A;  5I2M A;  5GAM e;  1KQS S;  4C92 E;  4BB7 A;  2YT6 A;  3CEY A;  5GAN d;  1NJI R;  1TWB A;  4KUI A;  2QQ9 A;  3H0H A;  4A4H A;  2IG0 A;  4JLG A;  4DQ2 A;  3J81 E;  2M16 A;  2WAC A;  3QO3 A;  2JS0 A;  3M56 A;  4PNO A;  1R0B G;  4MZM A;  1G3W A;  3VJP A;  3VS6 A;  1KC8 R;  4KT0 E;  3PIP A;  1MV3 A;  2MIO A;  1H3H A;  1PHT A;  2MOX A;  1K1Z A;  1CSK A;  3EG2 A;  2KRN A;  4XK8 E;  3TRE A;  2Z0W A;  5GMK i;  4XTZ A;  1VQ9 A;  3CCR T;  3M55 A;  5LJ5 j;  3V8K A;  2DO3 A;  1M2V B;  1ZA2 B;  1M9S A;  1BK2 A;  1YWP A;  1X2Q A;  1VQ6 T;  1B07 A;  1X6O A;  3X24 B;  1YNZ A;  2VGN A;  1K9A A;  2LJ1 A;  4C8Q D;  4L59 A;  2O01 E;  2PVG B;  3OW2 S;  5LJ3 e;  2LQ8 A;  1KQS P;  1Y96 A;  1JJ2 S;  2DEU A;  3CC2 Q;  3HPW A;  1WDX A;  1D1A A;  1JRI A;  4XAX B;  3MCA B;  2CT3 A;  5GAN 5;  3CMA Q;  3LLR A;  1YN8 A;  5KCO A;  1UTI A;  1Q82 C;  5J26 A;  2GNC A;  4WCI A;  1QVG A;  3M58 A;  2PQW A;  1M3C A;  4M78 B;  4FT4 A;  3JCM e;  1RI0 A;  1X6B A;  3L2V A;  4BE1 A;  5GAO n;  3SWN A;  4Z8A A;  3EGD B;  5IH2 A;  3OYG A;  5L23 A;  3E9F A;  3L2R A;  1IZ6 A;  1KSW A;  2VAS A;  2JW4 A;  3S3O A;  4DBH A;  1N8R R;  4M7D E;  1K76 A;  3EFR A;  4AFU C;  4ZGE B;  1RAH B;  1BCM A;  1E6H A;  1YJ9 Q;  5EC7 A;  4JJC A;  1B34 B;  2CUD A;  2RH2 A;  3I56 T;  2DXC A;  1TSF A;  3FJ5 A;  3JRZ A;  2DXB A;  4M78 G;  3PIO A;  1VQN A;  1K8A U;  2A28 A;  4P5N A;  5IT9 E;  1KHC A;  5KCH A;  2YUN A;  1YIT Q;  2J6F A;  1VQM T;  4CC2 A;  3UT1 A;  3G4S A;  1ZSG A;  1ZX6 A;  3CXC A;  2BTT A;  4PK4 A;  3GNF B;  4BI4 A;  1YJN A;  4J9B A;  3JCM J;  3OYF A;  1TG0 A;  3OYB A;  3SB2 A;  4LDW A;  4FL6 A;  1Q81 R;  1VQL T;  4C0D B;  1QLY A;  5I21 A;  1VQK Q;  1EZZ B;  1WHG A;  3JCM c;  4LE9 A;  3EGU A;  3G71 Q;  4OMF B;  5FRN A;  2RHX A;  4E7L A;  4C92 B;  1YJW Q;  2LQK A;  2XMF A;  3QJY A;  3BFM A;  3CC7 A;  3CD6 Q;  1P92 A;  2MMP A;  2VXE A;  2KQW A;  1B7T A;  1VOM A;  3REA B;  4C5G A;  1Q95 G;  1UHC A;  1VQ4 T;  3QBY A;  5KYY A;  2DYI A;  2EJ9 A;  5CAI A;  1Y07 A;  4RMO A;  1JQQ A;  1Q82 R;  2QQA A;  1YI2 T;  5GMK j;  4BE0 A;  1Y0M A;  3L1A A;  4NL3 A;  2FPE A;  2EQM A;  5GAN e;  4A63 B;  2J05 A;  2O4X A;  5CQX A;  4JJN K;  4NS5 A;  1ABO A;  3VS7 A;  4C92 G;  2PNI A;  3M0Q A;  3M0S A;  1JBM A;  3RUX A;  1AHJ B;  1U1S A;  2EQU A;  2P4T A;  3VUB A;  1PNJ A;  3GBQ A;  1IO6 A;  2KVQ G;  2BZX A;  4VUB A;  3CCL T;  5FU6 C;  2EJG A;  3LH5 A;  4CC4 B;  4M7A C;  3C94 A;  4X1V A;  1PSF A;  3G4S Q;  4E7J A;  5KYN A;  1PG5 B;  4MMK A;  4WTO B;  2LCC A;  1KD1 C;  1G8X A;  2DJQ A;  3HRS A;  1PC0 A;  4XQ3 A;  2DBM A;  1N9R A;  2F2X A;  4N0A A;  1M30 A;  1Q86 U;  5FW9 A;  2DF6 A;  2M02 A;  3G1J A;  2CH4 W;  4OMN A;  1M90 C;  4M7D B;  3VRY A;  4ELY C;  5LJ5 g;  5CKD A;  1PD1 A;  3CCE T;  3JB9 H;  2CP7 A;  4HA8 A;  3EGX B;  1W70 A;  3ULR B;  5GAO p;  2DD5 A;  1KQ1 A;  2K79 A;  4FYW B;  1BYM A;  1SHF A;  3IQL A;  1D3B B;  4IUR A;  2DRK A;  1QKX A;  2DFU A;  1RAA B;  2VGM A;  1Z9Q A;  2RO0 A;  2K5L A;  2CKK A;  1AWO A;  1LCK A;  1XQH A;  2HDA A;  2AKL A;  3ZL7 C;  1UE9 A;  2ZAE A;  5J3B A;  2OTL A;  1LPL A;  2DAQ A;  2M9U A;  5IHI A;  2FHD A;  3CCU A;  2A3L A;  2PU9 B;  3MP1 A;  2QA4 T;  5IHK A;  3CCQ A;  4KGX B;  2QK0 A;  3QKJ A;  3E9G A;  1AVZ C;  2JMA A;  4PFP A;  1J3T A;  2EAY A;  3NPF A;  4DBQ A;  3EHR A;  1M2V A;  1VQ5 A;  2CSI A;  3HRT A;  2K2M A;  2DZ9 A;  2DX1 A;  4C0G A;  3DLL A;  1NYF A;  4E7H A;  1NBE B;  2X9H A;  1H92 A;  1WX6 A;  2JT4 A;  4R56 A;  1RI9 A;  3JCM W;  2JZ2 A;  3M0P A;  1WGS A;  5IAY A;  5LJ5 f;  3C0C A;  3V7R A;  4PFO A;  2CRE A;  1QVG S;  3C4S A;  3RNJ A;  1UGQ B;  3VS2 A;  1Y57 A;  1VQ8 T;  1ACM B;  1IB8 A;  4OGE A;  1VQ9 T;  1CKB A;  2LZ6 B;  4WF2 A;  3PMT A;  3DB4 A;  2AT1 B;  1GFC A;  4ELZ C;  5HY6 A;  3HHT B;  4RCC A;  3RIR A;  1QWE A;  1VQP Q;  1R8O B;  2FL7 A;  4ZTF A;  2P84 A;  3EGD A;  1IGQ A;  1VQO T;  1ZUK A;  3TSZ A;  1KD1 R;  1UB4 A;  3URG A;  1I5O B;  2E5K A;  4M75 D;  2XDD A;  4LDV A;  1YHQ Q;  2RNA A;  2DXT A;  2FB7 A;  1QP2 A;  1TH7 A;  2P0Q A;  2CDT A;  1WJQ A;  1M90 R;  2X4J A;  2GTJ A;  1B34 A;  2FZG B;  1QKW A;  3RKY A;  2K5F A;  2CZ6 B;  4XTV A;  2DTH A;  3A8L B;  3CCU Q;  3QHS A;  1Q82 U;  3CXC S;  2E5Q A;  2E41 A;  2IVW A;  3ER0 A;  3BDL A;  4PLL A;  4QQG A;  1BIA A;  3P8H A;  5FWB A;  1D1B A;  3CCR Q;  2K3Y A;  4AFS C;  4OMM A;  2KXD A;  3CCS A;  3ME9 A;  2ROT A;  3QJ6 A;  3ASK A;  3BE3 A;  4LDX A;  2F2W A;  3QWX X;  4BUG A;  1TOV A;  4F16 A;  5GAO m;  2OAU A;  5CKE A;  2BE9 B;  2DET A;  1GBQ A;  2P0P A;  3I5S A;  3UPU A;  4FYV B;  3WVD B;  1BKB A;  2NWM A;  3QPH A;  4B6M A;  3QDF A;  4M77 C;  2QI2 A;  2HNI A;  1NJI C;  2RJD A;  2CZ0 B;  4F17 A;  4EDU A;  2E6N A;  2K5I A;  4GBQ A;  4J6W A;  4BY6 B;  1HK9 A;  2K6D A;  2L0A A;  2EQI A;  4BI3 A;  3VS0 A;  2RI3 A;  2I2L A;  3X20 B;  3OB9 A;  4EMK C;  3JCM b;  3LH0 A;  1ZQ1 A;  5GAN 8;  1KIK A;  4FYY B;  2KRO A;  3S3N A;  2LMJ A;  3OYK A;  5KYX A;  1OEB A;  5KYY B;  2LQN A;  2EBP A;  2RD1 A;  2DER A;  3A8M B;  3PMI A;  3WVE B;  2L3S A;  1W4S A;  4JZ4 A;  3CBM A;  3CCV Q;  2CP0 A;  2M0Y A;  4MDX A;  3OSV A;  2OI3 A;  2R58 A;  5A2Q E;  1AWJ A;  5LJ3 j;  3JCM h;  2V1Q A;  8ATC B;  3GLX A;  3TEE A;  4J9I A;  5FWC A;  5I22 A;  3OYI A;  2EVR A;  3JB9 F;  2EFI A;  2O4X B;  3RMQ A;  2ZPH B;  4M78 C;  3P8D A;  2KYB A;  1R77 A;  2G6F X;  1BI1 A;  1M1F A;  2M1H A;  1K73 C;  2H3J A;  2XI9 A;  4DA4 A;  1FMW A;  3Q1J A;  1NYG A;  5FU7 B;  4DBF A;  4KH0 B;  4CC3 A;  2XDB A;  2COY A;  3KFV A;  4XU3 A;  5DY9 A;  3CC2 A;  1H64 1;  3H41 A;  5CKF A;  1I4K 1;  3V8J A;  1VQL Q;  2QQB A;  3CMA A;  3GIB A;  1WHK A;  2E10 A;  1V29 B;  1JO8 A;  2DNU A;  2D0N A;  2ROL A;  4C0F A;  4M7D A;  2KK4 A;  1M3A A;  3GP8 A;  3EGX A;  1IHW A;  2MYS A;  1RAF B;  1G5V A;  2QAZ A;  2RM4 A;  1U3O A;  1G2B A;  3TVT A;  2RQV A;  1D3B A;  1RAE B;  1RUW A;  4BE2 A;  2ENM A;  2VV5 A;  5LJ5 d;  2A7Y A;  4JRQ A;  3CPW P;  1W6X A;  4RTZ A;  4PJO A;  4ZTJ A;  2SRC A;  1JB0 E;  2O31 A;  2PVO B;  4J5Y A;  2RQW A;  2ABL A;  4HCC A;  2HL5 C;  1YI2 Q;  3INZ A;  3JV3 A;  1YJ9 A;  2JM9 A;  2GTO A;  4C5I A;  2O88 A;  2YLC A;  1KD1 U;  3PT9 A;  3HFO A;  3X26 B;  4IUP A;  2KEA A;  4KRT A;  1VQ7 Q;  2HAX A;  1QCF A;  1AZG B;  1OYX A;  2FVU A;  5GAN 6;  2XD0 A;  1D09 B;  4C92 C;  2EQK A;  4XU1 A;  4PJO F;  1SSH A;  1WQ7 A;  1GXI E;  1Q81 C;  2YDL A;  1YIT A;  4IKF A;  1MUZ A;  1GRI A;  4QVD A;  1WA7 A;  2DIL A;  2YRV A;  2H3E B;  3HFN A;  3CCL Q;  2LNH B;  2MPX C;  2BIV A;  1WHL A;  5GAN h;  2HD0 A;  1BCO A;  1YWO A;  3RMS A;  3KBG A;  1VQK A;  2L5Q A;  1RAC B;  5HK0 A;  3LGF A;  4A4K A;  2NLU A;  3G71 A;  4M4Z A;  3CME Q;  4C0Z A;  1YJW A;  2BZY A;  4CI0 C;  1UUE A;  4J7F A;  4TVR A;  4AG1 C;  3SDZ A;  1K73 R;  5FRM A;  4OF1 A;  5CQY A;  4HVW A;  3CC4 T;  3CD6 A;  4MZT A;  4M7A D;  1OPK A;  2F69 A;  4K11 A;  3M54 A;  4OB0 B;  5IXB A;  2X35 A;  4LD9 K;  1ZBX A;  2YUQ A;  2Y4Y A;  4EMH A;  3ZFJ A;  4C8Q A;  1S72 Q;  2D9T A;  1U06 A;  3KUF A;  2ED0 A;  2GF7 A;  4BD3 A;  1SEM A;  3R6N A;  1FX7 A;  3MEU A;  5GJV B;  1NM7 A;  3OYD A;  1W2B A;  1ZUY A;  2GCX A;  2RF0 A;  1M1K C;  2ZPF B;  5DM7 R;  1XOV A;  1BI2 A;  4C8Q F;  4ESR A;  3D7S B;  1D0Y A;  3H0F A;  2DIG A;  1R0C B;  2OJ2 A;  2X4Y A;  3OYL A;  5D6X A;  3JCM Q;  1ABQ A;  3VYH B;  3EG0 A;  5HKC A;  2MF2 A;  3OYM A;  1M2O A;  1VYU A;  2BZ8 A;  2CS7 A;  2NYS A;  2MCN A;  5M9O A;  2DZC A;  3I55 Q;  5GAO l;  4PJO E;  1ZSZ B;  4HKE A;  2DA9 A;  1SG5 A;  2JTE A;  1OOT A;  2VC8 A;  2XIC A;  1TXQ A;  2KE9 A;  1Q7Y C;  1FYN A;  1XTD A;  4PJJ A;  1GCQ A;  1K9M U;  2D0Q B;  3CCM Q;  3M0R A;  1TUC A;  5LJ3 g;  2KRM A;  1OX8 A;  1WXU A;  3FLG A;  4E7S A;  2D6F A;  3EG3 A;  1WNL A;  2M0O A;  4D8D A;  1N5Z A;  4E6R A;  1AWW A;  2C0O A;  2L89 A;  2XID A;  2PTK A;  4YTL A;  2E64 A;  4ZGJ B;  1C1A A;  3PE0 A;  3CCS T;  3EG1 A;  5FLX E;  2EKO A;  1OUL A;  3JAM E;  4Z02 A;  3C12 A;  2QEX Q;  4A4E A;  3JSC A;  2DVE A;  1VQO Q;  5C6S A;  1G3Y A;  4LD6 A;  2EYW A;  4JRI A;  4ANJ A;  3CCJ A;  1UJ0 A;  3QZ9 B;  3QSU A;  2FYK A;  2LT1 A;  2DJZ A;  2MI6 A;  1PRM C;  4RG2 A;  2GGR A;  4QQ6 A;  2VUB A;  4GLM A;  3VRZ A;  5KYX B;  2RB6 A;  2LNV A;  5AT1 B;  2ZGW A;  3E2U A;  1OI1 A;  1JEG A;  1BI0 A;  4FCY A;  4V2S A;  1NG2 A;  4ATO A;  1NJI U;  2FPD A;  1VIE A;  2E3I A;  1YP5 A;  5IN1 A;  4C8Q E;  1U5S A;  1UGR B;  3FIF A;  4Z88 A;  5LJ3 f;  5GAN 2;  3CPF A;  4QW2 A;  1KC8 U;  3VV0 A;  4JJD A;  2DMO A;  3J7A F;  4HCZ A;  4JUV A;  1M1K R;  2W10 A;  3SWN C;  3NTK A;  3GF5 A;  3UAT A;  2VWF A;  2EGC A;  3A1P A;  1RAG B;  3JB9 G;  3EHQ A;  1M5Q 1;  4JS4 A;  2LDM A;  2LQW A;  5DLQ E;  3CPW A;  4OML A;  2CT4 A;  1VA7 A;  2F2V A;  2RI5 A;  3G6E T;  3RR6 A;  2E4H A;  4C5E A;  1PM3 A;  1KG1 A;  2V8K A;  3NFC A;  2A0F B;  3OS5 A;  2COW A;  4E2F B;  1WPY A;  1YIJ A;  2RN8 A;  2AK5 A;  1VQP A;  1Q7Y R;  3BDU A;  4Y28 E;  4NL2 A;  1QMC A;  4RTU A;  2ZCF B;  1SPK A;  3DLM A;  2LT4 A;  4XU0 A;  3CC2 T;  1MNE A;  1GFD A;  4HXJ A;  1YHQ A;  3NTH A;  3CMA T;  4M77 D;  3O5Z A;  2OTJ T;  3PFS A;  3CCJ Q;  4PJL A;  3FEO A;  3EFS A;  2JNG A;  4PJO B;  3OS1 A;  4FW2 A;  4FSS A;  4BDZ A;  4OB3 B;  1RAI B;  1N8R U;  2RI2 A;  3CCR A;  2ZPE B;  1VUB A;  2K7A A;  4KH1 B;  4BY6 C;  2RHU A;  4M7D G;  2Y4X A;  3V7S A;  4IIO A;  1WHH A;  3QXE B;  1C0M A;  1QCO A;  2QYZ A;  3FDR A;  2GQV A;  4F04 B;  2JS2 A;  3HRU A;  3MHX A;  5LL6 S;  4KGZ B;  2DL5 A;  4QT7 A;  4X34 A;  3BW1 A;  4PJO G;  4M77 F;  2HSP A;  2KGT A;  4M78 D;  3VS1 A;  2KRS A;  5D6W A;  4AT1 B;  2HSE B;  1IGU A;  1JXO A;  4F7U A;  1I81 A;  1JU5 C;  3M0U A;  1Q81 U;  5GMK e;  2LC4 A;  3MEV A;  1FMK A;  1N27 A;  3RBB B;  3ZBD A;  1YIJ Q;  1WZO A;  3EFO B;  4J6Y A;  2K3X A;  2EJF A;  4A53 A;  2K57 A;  3RER A;  4FM4 B;  5FU7 C;  2OAW A;  5CCA A;  1IHV A;  1W2B S;  4F7U F;  4C8Q B;  1QWF A;  4PJN A;  3G71 T;  1OU8 A;  1IXD A;  3HTR A;  1YJW T;  4XTU A;  3CCV A;  1OPL A;  2HQH A;  3LX7 A;  1Y71 A;  2KAF A;  3OBY A;  3FRN A;  4LNP A;  1V76 A;  1NPR A;  4N0A C;  1PD0 A;  2E12 A;  5D6Y A;  5FU6 B;  5I11 A;  4J9F A;  3P8B B;  5A0L A;  1ZSZ A;  5KH6 A;  4PLI A;  1RL2 A;  2BKD N;  1BBZ A;  1WI7 A;  3GOX A;  4RCB A;  3MP6 A;  4M75 A;  1VQ6 Q;  4F14 A;  1SSF A;  1TUG B;  2X51 A;  1YCY A;  2JXB A;  1W2B P;  1QP3 A;  2EGA A;  3PNW C;  2FPF A;  2WSC E;  3OMC A;  1VQL A;  5DLO A;  4C8Q G;  2L3P A;  3OYH A;  4J9G A;  1OZ3 A;  1S1N A;  1PSE A;  2GFA A;  5GAN 4;  4KUD K;  2G3R A;  4M75 F;  5GAM j;  3OYC A;  2RJE A;  2PZ1 A;  3MEW A;  1M1K U;  1AT1 B;  1EFN A;  4DEX A;  4E7K A;  3WXM B;  4KBM B;  1FMV A;  2B86 A;  2NUP A;  3VKI A;  2D8H A;  2KBT A;  1VQN T;  2K9G A;  5LJ3 d;  2O2O A;  3A8O B;  4M77 E;  3T9N A;  3GPL A;  3G4S T;  2J06 A;  1RAB B;  3MO8 A;  1VQ4 A;  2KT8 A; 
#chains in the Genus database with same CATH homology
 4OMF B;  5FRN A;  2RHX A;  4QQD A;  2QQR A;  4C92 B;  4E7L A;  1YIT A;  1YJN T;  4IKF A;  3LW5 E;  1YJ9 T;  2LQK A;  2RJC A;  3QJY A;  3BFM A;  1KQS A;  4DOV A;  3M9Q A;  1Q7Y U;  2LRQ A;  4R55 A;  4QVD A;  4A4F A;  3JCM P;  1X01 A;  2RK1 A;  2Y90 A;  2YRV A;  1YI2 A;  2RK2 A;  3HFN A;  3CC7 A;  1HXD A;  1P92 A;  3OYJ A;  2MMP A;  2VXE A;  1VQ7 A;  2BIV A;  2KQW A;  1H3Z A;  4C5G A;  5GAN h;  4IUU A;  1N9S A;  2CZ7 B;  2HD0 A;  3O8V A;  3I55 T;  1WJS A;  3CC4 A;  4EMK A;  1VQ4 T;  3QBY A;  3RMS A;  2DPP B;  2QQS A;  1YIT T;  4F7U E;  3KBG A;  4IUQ A;  1Y7X A;  3MET A;  3V8L A;  1VQK A;  1WJR A;  2EJ9 A;  1Y07 A;  2L5Q A;  5CAI A;  2LX9 A;  1U1T A;  5A0G A;  4RMO A;  5HK0 A;  3LGF A;  3X25 B;  4A4K A;  2NLU A;  3G71 A;  5GMK m;  3CCM T;  2QQA A;  3MEA A;  5FRO A;  4C0Z A;  1YI2 T;  1YJW A;  4II1 A;  2CGH A;  4CI0 C;  1I5L A;  3CC7 T;  4J7F A;  4TVR A;  5GMK j;  4FIB A;  4BE0 A;  5J39 A;  3L1A A;  4J8O A;  4NL3 A;  3SDZ A;  5FRM A;  2EQM A;  5GAN e;  3LGL A;  4OF1 A;  5CQY A;  2O4X A;  5CQX A;  1I8F A;  4L6V 5;  3QYH B;  3CC4 T;  4JJN K;  4NS5 A;  3G7Z A;  3CCL A;  4J83 A;  4MZT A;  3PTA A;  3CD6 A;  3LWI A;  4HCB A;  1Y96 B;  5GAN f;  3FC3 A;  2EQJ A;  4M7A D;  1VQK T;  4C92 G;  2F69 A;  1M1G A;  5GAO r;  3CPW S;  3M54 A;  4OB0 B;  2X35 A;  4LD9 K;  4M78 A;  1JBM A;  1ZBX A;  3RUX A;  3OW2 A;  1Q86 C;  2PUK B;  2Y4Y A;  4EMH A;  2QDY B;  3ZFJ A;  4C8Q A;  1AHJ B;  1JJ2 A;  1U1S A;  2EQU A;  2DTI A;  2P4T A;  3OYA A;  3VUB A;  2MWP A;  2D9T A;  2QEX T;  3CME A;  1K8A C;  3KUF A;  2KVQ G;  1O75 A;  2GF7 A;  4VUB A;  4BD3 A;  3CCL T;  3OA6 A;  3CD6 T;  5FU6 C;  2EJG A;  3I56 A;  1FX7 A;  1VQN A;  4M7A C;  3C94 A;  3SFM A;  1PSF A;  5GAM d;  4MDW A;  3MEU A;  3E1S A;  1K9M C;  3OYD A;  1W2B A;  4E7J A;  3OS0 A;  2GCX A;  4M78 F;  3TCJ A;  1M1K C;  3SWN B;  2ZPF B;  3QUI A;  5DM7 R;  4M7A B;  1XOV A;  1BI2 A;  4MMK A;  4PKC C;  4C8Q F;  2MWO A;  2LCC A;  4E7I A;  1BI3 A;  1VQM A;  1X75 C;  1KD1 C;  4M75 E;  4JS5 A;  3HRS A;  2DIG A;  4XQ3 A;  1N9R A;  2X4Y A;  2EYQ A;  2JVV A;  5GAN 7;  3OYL A;  4N0A A;  5D6X A;  3JCM Q;  4CRI A;  4J7I A;  4MZP A;  4EPC A;  3VYH B;  5HKC A;  1Q86 U;  2MF2 A;  3OYM A;  5CKB A;  1DJ7 B;  2CS7 A;  1S72 A;  1NE8 A;  1NZ9 A;  5GAO q;  1M90 C;  4BI8 B;  4M7D B;  4ELY C;  5M9O A;  5LJ5 g;  2DZC A;  5CKD A;  4XTY A;  5CKH A;  5GAO l;  3CCE T;  1WQW A;  4FT2 A;  4ME7 A;  4PJO E;  4HKE A;  2JUF A;  3JB9 H;  3OQ5 A;  4HA8 A;  4C92 D;  2VC8 A;  2XIC A;  2XG8 D;  1Q7Y C;  4ZN3 A;  5GAO p;  2DD5 A;  1XTD A;  1KQ1 A;  2AHJ B;  4JDS A;  5GAM h;  2D0Q B;  1K9M U;  1BYM A;  2ZPI B;  4XTW A;  2L8D A;  4C0D C;  1D3B B;  3VU3 C;  2DIQ A;  4IUR A;  1MGQ A;  2WSE E;  2CYZ B;  4QVC A;  2ZZD A;  5LJ3 g;  1VQP T;  2VGM A;  2RO0 A;  3OMG A;  2K5L A;  2CKK A;  5GMK l;  3FLG A;  1XQH A;  3ZEH A;  2D6F A;  2LTO A;  1WNL A;  2M0O A;  4M7A G;  3F70 A;  5J3B A;  2OTL A;  2DAQ A;  2L89 A;  2M9U A;  2FHD A;  2XID A;  4YTL A;  3I55 A;  3CCU A;  3NTI A;  2A3L A;  1LJO A;  1M90 U;  2E64 A;  3JB9 D;  3JCM X;  2PU9 B;  3MP1 A;  2QA4 T;  4ZGJ B;  1YHQ T;  5AYF A;  3CCQ A;  3CCS T;  5FLX E;  3TU4 K;  4C92 A;  3OYE A;  2RA2 A;  5LJ5 h;  2EKO A;  2DD4 A;  2JOY A;  3A8G B;  3QKJ A;  4Z02 A;  3JAM E;  3JCM V;  3E9G A;  3CCM A;  3C12 A;  3DKM A;  2K4Y A;  4A4E A;  3JSC A;  3M4Y A;  3LYI A;  3JCM d;  2DVE A;  2EAY A;  3GNG A;  2YLB A;  4M77 B;  4RG8 A;  1QW1 A;  4FU6 A;  5C6S A;  1VQ5 A;  1QVF S;  1G3Y A;  5I2S A;  4LD6 A;  3HRT A;  4JRI A;  2F5K A;  4OGC A;  2OTL T;  4Q5W A;  3QZ9 B;  3CCJ A;  1VQ4 A;  3CCU T;  3QSU A;  4C5H A;  4OP0 A;  2DZ9 A;  2JTM A;  4C0G A;  3EAE A;  2FYK A;  2LT1 A;  3DLL A;  1VQN T;  4E7H A;  2DJZ A;  1VQ8 A;  4FSX A;  3CCQ T;  1KC8 C;  2MI6 A;  5LJ3 h;  4C92 F;  1YBY A;  4RG2 A;  3JB9 J;  4N4H A;  4QQ6 A;  5CO7 A;  2VUB A;  4R56 A;  3HP9 A;  5CK9 A;  3JCM W;  2RB6 A;  2LNV A;  2JZ2 A;  1WGS A;  3HL8 A;  2ZGW A;  4E47 A;  5IAY A;  5LJ5 f;  1OI1 A;  1VQ5 T;  4EMK B;  3V7R A;  2K2V A;  2V8J A;  3H8Z A;  5GAN j;  2RHZ A;  2JTF A;  4EMG A;  3BY7 A;  3C4S A;  1BI0 A;  2QEX A;  3CCJ T;  1QVG S;  1EIF A;  4LDU A;  4V2S A;  1UGQ B;  4ATO A;  1VQO A;  2HBP A;  1NJI U;  2DKG A;  2DXU A;  2ZPB B;  4F7U B;  1VIE A;  1VQ8 T;  4M78 E;  4OGE A;  1VQ9 T;  3CCR T;  5IN1 A;  4WF2 A;  4C8Q E;  2R5M A;  4B9X A;  1UGR B;  3PMT A;  3FIF A;  2EWN A;  3CBP A;  3DB4 A;  5LJ3 f;  5GAN 2;  1M8V A;  4XU2 A;  4ELZ C;  5HY6 A;  3CPF A;  2BUD A;  4QW2 A;  3SD4 A;  3HHT B;  1KC8 U;  3L2U A;  3FJP A;  3VV0 A;  3G6E A;  4M77 G;  4OVA A;  4RCC A;  2P0K A;  3RIR A;  2VYT A;  5KE3 A;  4HT8 A;  1R8O B;  3J7A F;  4HCZ A;  2FL7 A;  2XU8 A;  4ZTF A;  4JUV A;  4M7D D;  5GAM g;  4IUT A;  4JLI A;  4RKU E;  3SWN C;  1UGP B;  3NTK A;  3GF5 A;  5GAN 3;  1VQO T;  1UB4 A;  3URG A;  2WSF E;  3A5Z B;  3X28 B;  3AHU A;  3M53 A;  4XTX A;  2XDD A;  4M75 D;  2B8A A;  2KDS A;  2LCL A;  2XK0 A;  3CCE A;  4LDV A;  3OSS C;  3JB9 G;  1M5Q 1;  3M59 A;  4JS4 A;  2LDM A;  5DLQ E;  3CPW A;  2DXT A;  2RI5 A;  1ZHI A;  2FB7 A;  4NOY A;  1QP2 A;  4M7A A;  4OB1 B;  1TH7 A;  3G6E T;  3L2Z A;  2P0Q A;  5L8R E;  4C5E A;  1KG1 A;  2RHI A;  2V8K A;  1WJQ A;  3NFC A;  2X4J A;  1N6A A;  3E19 A;  3R6O A;  3OS5 A;  4BAC A;  2RHY A;  4M7D C;  1B34 A;  1WPY A;  4MML A;  3RKY A;  1YIJ A;  2K5F A;  2CZ6 B;  1FXX A;  3S3M A;  4PJO D;  3M4G A;  4XTV A;  1LNX A;  1K8A U;  3L2Q A;  4HT9 A;  1NPP A;  1VQP A;  4F7U G;  4M75 C;  2DTH A;  2MAM A;  3BDU A;  5CIU A;  1U8R A;  2OTJ A;  3A8L B;  4Y28 E;  3QHS A;  3JCM c;  2X4X A;  3OW2 S;  1Q82 U;  1KQ2 A;  3CXC S;  3CCV T;  2E5Q A;  2E41 A;  2E70 A;  4NL2 A;  2IVW A;  1N8R C;  3ER0 A;  4BDY A;  4GY5 A;  2XKO C;  4M7A F;  2ZCF B;  3BDL A;  4M75 B;  4PLL A;  4QQG A;  1BIA A;  3DLM A;  3P8H A;  2LT4 A;  2K3Y A;  4XU0 A;  3CC2 T;  2QXF A;  3OY9 A;  2QA4 A;  1MHN A;  3M57 A;  2L3R A;  2KSS A;  3QDR B;  3RKX A;  3RKW A;  1YHQ A;  3CCS A;  3NTH A;  3ME9 A;  4IUV A;  4PJO C;  1YIJ T;  3QJ6 A;  2XD0 A;  3ASK A;  4N4I A;  3CMA T;  4M77 D;  3HKS A;  5CR2 A;  4LDX A;  4BUG A;  2OTJ T;  3PFS A;  3J80 E;  3FEO A;  3EFS A;  4M7D F;  2YHT A;  2JNG A;  2OAU A;  4J6X A;  5CKE A;  5GAO m;  4PJO B;  4A54 A;  2P0P A;  3OS1 A;  1QVP A;  3L2W A;  4OB2 B;  4O6J A;  3UPU A;  5I2M A;  3WVD B;  5GAM e;  1KQS S;  3KXT A;  4C92 E;  1BKB A;  4BDZ A;  3S6W A;  4BB7 A;  3CEY A;  5GAN d;  4OB3 B;  2VXF A;  2E1H A;  3QPH A;  3N5B B;  4KUI A;  4M77 C;  2QQ9 A;  2QI2 A;  3V7C A;  4A4H A;  2DEQ A;  2IG0 A;  2RI2 A;  4B9W A;  5GAM f;  3CCR A;  4JLG A;  4LDY A;  4DQ2 A;  5A0D A;  3J81 E;  2ZPE B;  2HNI A;  4O5V A;  1VUB A;  3JCM g;  2KMT A;  2M16 A;  2WAC A;  3QO3 A;  3M56 A;  4PNO A;  1NJI C;  4MZM A;  2RHU A;  2RJD A;  4X9D A;  4N4G A;  1G3W A;  3VJP A;  4BY6 C;  4M7D G;  2CZ0 B;  4EDU A;  4KT0 E;  3PIP A;  2E6N A;  2K5I A;  2Y4X A;  3V7S A;  4J6W A;  4M75 G;  4BY6 B;  1HK9 A;  4XK8 E;  3TRE A;  4BI3 A;  3UDC A;  5GMK i;  2RI3 A;  4XTZ A;  3QXE B;  1VQ9 A;  2I2L A;  3X20 B;  3FDR A;  2GQV A;  1UGS B;  3OB9 A;  3M55 A;  3HRU A;  3MHX A;  3LH0 A;  2RJF A;  4EMK C;  4ZGD B;  1O9S A;  1ZQ1 A;  3V8K A;  4KUL A;  2PUO B;  2DO3 A;  5LJ5 j;  4D6W A;  5GAN 8;  2R5A A;  5LL6 S;  1M9S A;  1VQ6 T;  3S3N A;  3OS2 A;  5GMK h;  1M4Z A;  3OYK A;  2HQE A;  4X34 A;  3BW1 A;  1X6O A;  4PJO G;  4M77 F;  2E65 A;  3X24 B;  2X4W A;  4M78 D;  2RD1 A;  3LWH A;  3A8M B;  3PMI A;  2VGN A;  2XDP A;  3WVE B;  5HK3 A;  1QVF A;  3QII A;  1W4S A;  4L59 A;  4C8Q D;  3JB9 I;  3CBM A;  2O01 E;  3MP8 A;  2PVG B;  5D6W A;  4MDX A;  3OSV A;  1XNI A;  5LJ3 e;  2LQ8 A;  2HQX A;  2R58 A;  2XHC A;  3VYG A;  3JCM h;  5LJ3 j;  5A2Q E;  1Y96 A;  4F7U A;  1JJ2 S;  1I81 A;  3GLX A;  1UEB A;  4DOW A;  2JN0 A;  3HPW A;  3TEE A;  2QTX A;  3OYI A;  3VUZ A;  1Q81 U;  1VIF A;  5GMK e;  5KE2 A;  2LC4 A;  2EFI A;  2O4X B;  3MEV A;  3JB9 F;  1N27 A;  2R57 A;  1JRI A;  3OBW A;  2ZPH B;  3MCA B;  3QZ5 B;  3QG1 A;  4XAX B;  3RMQ A;  3ZBD A;  5GAN 5;  1VQ7 T;  3LLR A;  3C95 A;  2DTO A;  4M78 C;  4J6Y A;  2K3X A;  3P8D A;  5KCO A;  5LJ5 e;  1Q82 C;  3UWN A;  2EJF A;  5J26 A;  2LVM A;  4A53 A;  2K57 A;  3RER A;  4FM4 B;  5EG2 A;  5FU7 C;  4C8Q C;  5CCA A;  1BI1 A;  3DB3 A;  3RES A;  1W2B S;  1M1F A;  2M1H A;  1QVG A;  2F5T X;  2H3J A;  1K73 C;  2XI9 A;  3M58 A;  2PQW A;  3H6Z A;  4M78 B;  4DA4 A;  2PVD B;  4FT4 A;  3JCM e;  4F7U F;  1RI0 A;  1KHI A;  3Q1J A;  5FU7 B;  4C8Q B;  3G71 T;  4M7A E;  1BIB A;  1YJW T;  4XTU A;  3CCV A;  3HSB A;  3L2V A;  4BE1 A;  5CVI A;  3JCM f;  5GAO n;  2XDB A;  3LX7 A;  4XU3 A;  3SWN A;  3A8H B;  4QVZ A;  5DY9 A;  1Y71 A;  3OYG A;  3CC2 A;  1H64 1;  2KAF A;  5CKF A;  1I4K 1;  3E9F A;  3V8J A;  1IZ6 A;  3L2R A;  1OZ2 A;  3OBY A;  3FRN A;  3S3O A;  2QQB A;  3JCM b;  4PL6 A;  3CMA A;  1NPR A;  3GIB A;  4N0A C;  3EFR A;  4M7D E;  2E10 A;  1V29 B;  4ZN1 A;  2E12 A;  4GLK A;  5D6Y A;  5FU6 B;  1G3S A;  4ZGE B;  3CBO A;  4C0F A;  4M7D A;  2GFU A;  3P8B B;  5A0L A;  3M5A A;  2KK4 A;  1K73 U;  5KH6 A;  4JRK A;  4PLI A;  1B34 B;  1RL2 A;  2BKD N;  2V8I A;  1LOJ A;  5C0M A;  3GP8 A;  4RCB A;  3MP6 A;  3GOX A;  3CME T;  4M75 A;  4UC4 A;  2RH2 A;  3I56 T;  2DXC A;  1G5V A;  1SSF A;  3JRZ A;  2RM4 A;  3QYG B;  4L5G A;  2DXB A;  1YCY A;  1D3B A;  1FWZ A;  3PGG A;  1QP3 A;  2EIF A;  3PNW C;  4M78 G;  2WSC E;  3PIO A;  3OYN A;  3OMC A;  4P5N A;  4BE2 A;  4X9C A;  5DLO A;  5IT9 E;  1KHC A;  5KCH A;  2VV5 A;  4C8Q G;  1VQL A;  5LJ5 d;  2A7Y A;  4JRQ A;  1VQM T;  4A4G A;  3OYH A;  3UT1 A;  2KY9 A;  1OZ3 A;  2GFA A;  1PSE A;  5GAN 4;  3G4S A;  3CXC A;  4PJO A;  4ZTJ A;  5GAN g;  1G3T A;  4KUD K;  1JB0 E;  2G3R A;  2PVO B;  4J5Y A;  4M75 F;  3GNF B;  5GAM j;  4BI4 A;  3OYC A;  2RJE A;  4HCC A;  3MEW A;  1YJN A;  3FB9 A;  1M1K U;  3INZ A;  4JRP A;  3JCM J;  4Y91 A;  4C5I A;  1YJ9 A;  3OYF A;  2DK3 A;  2YLC A;  1KD1 U;  3PT9 A;  1N8R U;  3HFO A;  3X26 B;  4IUP A;  4E7K A;  1S72 T;  2HAX A;  3OYB A;  3SB2 A;  3WXM B;  4KBM B;  4LDW A;  3VKI A;  1OYX A;  2FVU A;  2ZPG B;  4FL6 A;  2E6Z A;  5GAN 6;  5LJ3 d;  2CZ1 B;  2C06 A;  1VQL T;  3OYY A;  4M77 E;  3A8O B;  4C0D B;  1VQ6 A;  3T9N A;  4C92 C;  5I21 A;  3GPL A;  2EQK A;  4XU1 A;  4PJO F;  1WQ7 A;  3G4S T;  1IRE B;  4M77 A;  3MO8 A;  3L42 A;  1GXI E;  1Q81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...