2EQKA

Solution structure of the tudor domain of tudor domain-containing protein 4
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGMIAAYENSKWEPVKWENDMHCAVKIQDKNQWRRGQIIRMVTDTLVEVLLYDVGVELVVNVDCLRKLEENLKTMGRLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor domain-containing protein 4
molecule tags Transcription
source organism Homo sapiens
publication title Solution structure of the TUDOR domain of Tudor domain-containing protein 4
rcsb
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqkA01
2RJEA 4EDUA 5D6YA 2LVMA 3PMTA 4BACA 3OYGA 1WJSA 3L2RA 2RO0A 3PFSA 5KE2A 4E7JA 2EQUA 4IKFA 2G3RA 5CIUA 3OYIA 4C5GA 4E7HA 3L2VA 3QJ6A 5C0MA 2BIVA 4ZTFA 2JZ2A 3LLRA 3UT1A 3OY9A 1G5VA 4N4IA 4IUQA 3ME9A 4IUTA 1OYXA 4A4GA 2EQKA 3QIIA 4QQGA 3MEWA 5FRNA 1OZ3A 2K3XA 3NTKA 4IUUA 4E7LA 2MWOA 2DIQA 2NLUA 3E9GA 4IUPA 4RG2A 5FROA 3DLMA 2RJFA 3O8VA 3OQ5A 3PMIA 4HCZA 3F70A 4FU6A 3L42A 1KHCA 2EKOA 2M16A 3MP1A 3OYHA 4PLLA 2X35A 4QQ6A 2M1HA 2R5AA 2R57A 2FHDA 3OYDA 4Z02A 3LGFA 2HQEA 3GOXA 5KCOA 2GFUA 2QQRA 2LDMA 4Q5WA 5IN1A 3FDRA 3L2UA 3MEVA 3MEAA 3MP8A 2XDPA 3BDLA 2IG0A 3DB3A 3P8DA 3LGLA 4II1A 4IURA 4N4GA 2HQXA 2D9TA 3LYIA 2P0KA 3UWNA 4NS5A 4PL6A 4C5HA 1H3ZA 5D6XA 3MP6A 3NTHA 5IAYA 2O4XA 2RHIA 2VYTA 2R5MA 2RHYA 3ZEHA 3OA6A 2LCCA 2YRVA 1RI0A 2DIGA 3FLGA 2RHXA 4IUVA 3H6ZA 3OYFA 3M9QA 3S3NA 4A4HA 3LX7A 2X4YA 3FC3A 4CRIA 3OMGA 2RHZA 4N4HA 3S3OA 2B8AA 3MO8A 4BE1A 5J39A 3OYAA 5KH6A 3OYEA 2LTOA 2GF7A 2DAQA 2X4XA 2EFIA 2L8DA 4OVAA 4B9XA 3OMCA 3CEYA 3H8ZA 1OI1A 2EQMA 3OB9A 4QVZA 2RI5A 4E7KA 3E9FA 3MEUA 4FL6A 2RJDA 4A4FA 2LRQA 3L2QA 4BDYA 3DB4A 2F5KA 3LH0A 3P8HA 5KCHA 4A4EA 4GY5A 3PNWC 5C6SA 4PLIA 4C5IA 3KUFA 3NTIA 1WGSA 2XK0A 3S3MA 4LD6A 2CKKA 2R58A 3QBYA 2K3YA 3OYKA 2O4XB 4BD3A 1MHNA 3OYJA 2QQSA 3S6WA 4QQDA 5J26A 1WJQA 3C4SA 3ASKA 2GFAA 2L89A 3META 3OYLA 4BDZA 4ZTJA 4UC4A 2BUDA 2RHUA 2X4WA 4E7IA 4L59A 2RJCA 3QKJA 2BKDN 5M9OA 3OYBA 4BE2A 4X34A 2WACA 2M0OA 3OS0A 1XNIA 3OYNA 3FEOA 3L2WA 4BE0A 2EQJA 2L3RA 1SSFA 2RI3A 2PQWA 1OZ2A 3SD4A 1WJRA 2MWPA 3EAEA 5D6WA 4C5EA 3OYMA 5FRMA 2RI2A 3Q1JA 2E6NA 2E5QA 4QW2A 3OS2A 3OYCA 2JTFA 3OS1A 4B9WA 1N27A 5KE3A
chains in the Genus database with same CATH superfamily
1VQOQ 1WJSA 2CP6A 5D7UA 4QVCA 4RTVA 1NPPA 1IZ6A 5C0MA 4PJNA 3JCMe 4ZTFA 3CCSQ 1Y96B 3JCMg 4V2SA 1M90R 2LCLA 3CMAT 3CMAQ 1YFNA 2ATCB 4OB0B 2RJFA 2DTIA 4AG2C 3QWXX 4JZ3A 4NOYA 2SEMA 2EAYA 1KQSS 4OMPA 1HD3A 2JTMA 5LJ3h 2XDDA 3CBOA 1QVFP 3LWIA 3I56T 2E12A 1MMAA 4C92E 1EZZB 3L2UA 4N4GA 1U06A 2DL8A 2DBMA 2YWWA 3P8DA 2K2MA 3JCMP 2FRWA 1PG5B 3RKXA 2ZPBB 1KG1A 2J7IA 3OW2A 1N8RU 1XTDA 1YI2Q 1WQWA 1G3SA 3OYFA 2H8HA 1GL5A 3VV0A 1HYOA 5KH6A 2CREA 4KRTA 3CEYA 3JCMJ 1X43A 1WZOA 3TREA 1KSWA 1GXIE 9ATCB 1BK2A 4GLMA 3WVDB 4XTZA 1K0XA 5HKCA 3OW2S 2O4XB 4BD3A 3JB9I 5AT1B 2XDBA 4BDZA 2K9GA 3U23A 1Y96A 4RKUE 1AWWA 4J9EA 4C92G 1S72T 1Q81R 3EGDA 1K8AU 1BBZA 3DLLA 1AWJA 1K8AR 1OZ2A 2DJZA 2O9VA 5FRMA 4M7AD 2JS0A 3OS2A 1TS9A 2JTFA 3I56Q 2MI6A 2E3IA 5GAOq 4KH1B 2HBWA 4RG8A 2G3RA 2DZCA 3RMSA 3X26B 2BIVA 2DVJA 5CQYA 2ROLA 2QQ9A 3GNFB 2RPNA 1B07A 3C94A 2PVOB 3OQ5A 1JB0E 2JMAA 2PZ1A 2K7AA 5IHKA 3OW2P 3M4YA 4O5VA 2DJQA 1H8KA 3HKSA 4ATOA 1UGVA 2DILA 1D1BA 1VQNA 1M2VB 5IN1A 5GMKi 2IVWA 4C5HA 4FYYB 2HQXA 2AK5A 1OPKA 3V8JA 1KJWA 4XAXB 1SPKA 3FRNA 4A4KA 4DBFA 2MF2A 1FYNA 4LDYA 3BW1A 1RI0A 3H6ZA 4A4HA 2FZGB 1I5LA 1G3TA 3MO8A 3OYAA 3HFOA 1PRLC 2MAMA 2LTOA 4PFPA 2EFIA 2L8DA 5LJ5j 3H8ZA 1OI1A 2P0PA 1MMNA 2H3JA 4A4FA 2FL7A 3JB9D 3CCMT 2EGEA 2VV5A 2CGHA 3QHSA 4WTOB 1WGSA 3EG0A 4PJOG 2V1RA 1IXDA 1VQMQ 1U5SA 1AWOA 7AT1B 1VQ9A 2Y4YA 4ZN1A 3CCMQ 1F1BB 1TTHB 3ULRB 3VS5A 1ZSZB 2DZ9A 3G4ST 3TQ7P 4KT0E 3SD4A 1WJRA 2A0FB 2DBKA 3QPHA 2YLCA 4IIOA 2RI2A 1UHFA 4MDWA 1AEYA 4QW2A 1RL2A 3OS1A 4OB3B 1N27A 2MIOA 3CCLT 3EHRA 2ZZDA 1PSEA 1B7TA 1WFWA 2CSQA 2JVVA 3JB9F 1VQ6T 1VYUA 1WHGA 2YUOA 3JB9G 2JZ2A 2EWNA 1OEBA 1OQKA 4TVRA 1X27A 4D8KA 5I2SA 2RK1A 3M0PA 4HVUA 4BY6B 1OULA 1X2KA 5FROA 4XTYA 3DLMA 3H9NA 2GQVA 3CPWP 1CSKA 3NHNA 2EVRA 2DRKA 4Z8AA 1VQ6A 4Y28E 3CCRT 4XU0A 1NYGA 3VYGA 3RERA 3EG1A 4RTZA 1VQ9Q 3JCMh 2DL7A 3LYIA 4MZMA 1I5OB 2K79A 5FWBA 1LVKA 4NS5A 4C0GA 2OTLT 3RNJA 3CCUQ 2JNGA 4PJOE 1Y0MA 3OA6A 4ME7A 5LL6S 2BE7D 3C0CA 2J6OA 4X1VA 3J81E 3SFMA 3QUIA 2DTOA 1X6OA 4JRKA 2RB6A 2PNIA 4OVAA 1WYXA 3CCLA 4J9CA 5KYNA 2DEUA 3MEUA 2D6FA 3LH0A 1ZSGA 5KCHA 1IREB 3JB9J 4C5IA 1PWTA 5HCKA 1T3LA 2ROTA 4QQDA 4M78B 1QKWA 1XJWB 2GFAA 4UC4A 2RHUA 4OMQA 4C8QA 4OGCA 1JQQA 4BE0A 4FSXA 3UATA 2MCNA 5GANd 3EFRA 1I07A 4LUDA 4OP0A 1NZ9A 4D6WA 2NWMA 3KBGA 4PFZA 4VUBA 1U8RA 5GJWB 2L2PA 4M7DA 3JB9H 1Q86C 1M9SA 5HK0A 1QP3A 4OF1A 2CZ7B 2VKNA 2RMOA 3MJXA 4M77B 4C0DC 1BCMA 2K3XA 1K4US 1JJ2S 1K73U 2OTLA 2F2VA 2CP0A 1RAFB 4PFOA 1HK9A 4CC7A 1WX6A 3JCMb 5GAN5 4DBQA 4RTTA 2XI9A 3LGFA 4X9CA 2X3XD 2E1HA 3EG3A 4J9FA 2DTHA 1R8OB 2X4JA 4A54A 4OMFB 2RHIA 2RQTA 2ENMA 5GANe 1FWZA 3RKWA 1TUDA 5DLOA 1S72A 1T3SA 4OMNA 4WF2A 1VQ8T 5AYFA 2CUDA 1WHHA 1M2VA 3PVLA 1KHIA 4KGVB 3HRTA 1KC8U 3P8HA 4C0ZA 1WI7A 4Z89A 1WDXA 4E2FB 3EG9A 1VQ7T 2DD5A 4C8QB 1WLPB 1BIBA 2EYWA 3CC4A 5IHIA 2P4RA 2QXFA 1R0BG 3DKMA 2ZPHB 5M9OA 2A3LA 4BI3A 4PJOD 2K4YA 3JCMf 2QGFB 1M30A 4HT8A 1KQSA 3CCST 5GANf 2M02A 2E6NA 1LNXA 1QCOA 2F2WA 2M0YA 2MMPA 1VQ8Q 3AT1B 2KI7A 2LJ1A 3TEEA 2RJEA 4HKEA 2CH4A 1I0CA 3HTRA 3THKA 4NL3A 1WHJA 4IKFA 5CIUA 1T0HA 3TCJA 4M75C 5GAOm 5IHNA 3A8GB 5J3BA 1YI2A 3E9GA 3EH1A 5GAMe 8AT1B 4J83A 4PJOA 2EKOA 3G71T 3I5SA 1N6AA 2EGAA 2BE9B 2YRDA 1EIFA 2ZAEA 1QVGS 1JEGA 3G6ET 1FMWA 1UGPB 1VQ7Q 1PC0A 3MEAA 3EG9B 4IURA 4JLGA 2P0KA 2LT4A 1D0ZA 4R55A 4EMHA 1M1KU 1WHKA 2RM4A 2LJ0A 1W2BA 4PJOB 1PM3A 1OX8A 4J6WA 3CMAA 1WXTA 2BZXA 1VYVA 2F1LA 3OMGA 4HVVA 1PKTA 4ZGJB 2CS7A 3CCJQ 2HDAA 2AIRB 1ZBJA 4C92C 4CC3A 3M53A 4M75F 1YJNQ 1VIEA 2OTJA 2CSIA 3V7CA 1O9SA 2XIDA 1U3OA 3HRUA 5CCAA 3S3MA 2GNCA 3V8KA 2QEXA 4LD9K 1HJDA 2OAWA 2X51A 3JCMd 2HD0A 2OJ2A 2JJ9A 2L0AA 4BE2A 3E19A 3UF4A 1XNIA 2EQJA 2MWPA 1UG1A 1UTIA 3D7SB 2DO3A 1BB9A 1BCOA 5GANh 3PMTA 4C8QD 1AHJB 1QWFA 2DL3A 5GMKh 1YJWQ 1M3AA 3JSCA 3UPUA 1X2QA 2W10A 2JM9A 1OYXA 3QIIA 4M75G 4F7UB 3ZL7C 4EPCA 1XQHA 1M3BA 1LCKA 2XHCA 4M7DD 1M2OA 2O9SA 5A2QE 2M16A 3QJYA 1C1AA 2J06A 5KYXA 1QKXA 2K57A 4XTVA 4HA8A 2XMFA 3CCJA 4JJCA 2GTOA 3M0UA 4J9GA 2ED0A 4D8DA 2XDPA 1MV3A 2FRYA 4F7UF 2NUPA 5LJ3e 4DA4A 4JLIA 3CCVA 4CC2A 2HAXA 4C8QF 5A0GA 5IT9E 2OTJQ 5KYUB 1IGUA 2BTTA 3A5ZB 1KK7A 1NLPC 1VQ7A 1N8RR 1UGQB 2K3BA 5I2MA 3G4SQ 3EGXB 2RF0A 3E9FA 1A0NB 3GNGA 2KK4A 5DY9A 4PJMA 1N9SA 3OSSC 3HRSA 2QQBA 2K2VA 3TSZA 4LD6A 3CCRQ 2AZSA 2JOYA 3CCVQ 3T9NA 2XICA 4RMOA 3HFNA 2DK3A 2VASA 2WACA 3ER0A 3FEOA 2KROA 3EGUA 4J5YA 1Q82R 2GGRA 5HK3A 2HL5C 2PQWA 4K11A 5D6WA 1CKAA 4C5EA 1RLPC 4ZNXA 2E10A 2WSEE 1ZA1B 2QA4A 3L2RA 1OV3A 4E7JA 5I22A 2PVDB 3UA7A 2QA4T 3LWHA 3JCMc 1VIFA 4FT4A 3CPWS 4QQGA 1VA7A 4OGEA 3MEWA 2VXFA 5FRNA 1AVZC 2M9UA 2NLUA 1AZEA 1MGQA 1G83A 4CC4B 3G71Q 1M8VA 3H0IA 2IPOB 2EPDA 1VQMT 1ZSZA 1W2BS 2R5AA 2CDTA 2YSQA 1K73C 1I4K1 5A0LA 1KQ1A 2HQEA 2GFUA 2JN0A 2EYXA 3M54A 4Z88A 1YJWA 2DNUA 2D9TA 3MP6A 2L5QA 3RBBB 2RHXA 3GPLA 4LN2A 1OU9A 1QVPA 2EJFA 1SF9A 1QCFA 1WPYA 5GANj 2RHZA 3VKIA 2QTXA 3CC2T 1TUGB 2JTEA 2RNAA 3OB9A 5CKEA 2QEXQ 4FL6A 1CKBA 5FU6B 1BI0A 1M1FA 3CQTA 4BDYA 1ZUYA 1SEMA 2G6FX 3VS7A 4PJJA 4QKUA 2WSFE 4J9IA 5GAMf 2LQ8A 1YJNA 1JJ2P 1D0YA 2NUTB 2LQWA 4XTWA 1YHQT 1K73R 2CYZB 5FWCA 1AWXA 1MMGA 3LW5E 5KYXB 2KYBA 1Y57A 5CVIA 4MMLA 1GCQC 1V29B 3EAEA 3PIOA 3CCRA 2FEIA 2JM8A 1YN8A 4M78G 4EDUA 2K6DA 5D6YA 2CP7A 2O2OA 4M7AC 2RN8A 4XU3A 2LQKA 4O6JA 1VQKQ 3QYHB 1KFZA 1NPRA 3HP9A 2E64A 2O01E 2A37A 3L1AA 1PCXA 4F7UE 4E7LA 2MWOA 1S72Q 4F04B 4RUGA 3CMET 3O8VA 4F17A 4J9BA 4HCZA 3F70A 4HCBA 1D1CA 4JPBW 1AD5A 2PU9B 1GBRA 2X35A 3CC7Q 2DVEA 2FG0A 1H641 1X6BA 3JCMX 3VYHB 3LH5A 4LDXA 2LDMA 2VB6A 3FDRA 3GBQA 3MEVA 3MP8A 1QMCA 4II1A 1KC8C 1BYMA 5IAYA 2O4XA 5LJ5d 2VYTA 3ZEHA 1OOTA 3QO3A 5FU7B 4E47A 2ZPFB 4KBMB 2LJ3A 4BI4A 3VS4A 3FC3A 2EIFA 4M7AF 5KYWA 5I11A 4M75B 1N8RC 1ZLMA 2GF7A 5EG2A 2EQMA 4E7KA 3EHQA 2RQVA 1VYTA 2XG8D 1LPLA 4PK4A 4M78E 2J05A 2HKNA 3IQLA 5GANg 2DE0X 2DXCA 4PLIA 2D8JA 1K9AA 2K3YA 3A8MB 1VQPT 4ELZC 4N0AC 3BFMA 1NYFA 3I55T 1VQNQ 1YWPA 3CCEA 1Z9QA 3MKDA 1RLQC 1MMDA 1B34B 4F7UG 2M51A 3CCET 4C8QG 5FLXE 1ZA2B 2C0OA 4OMMA 2YUPA 4F14A 2LVMA 3VU3C 1VQOT 4JJDA 2L3QA 2E6ZA 1QVFS 1AOJA 1HXDA 1ZSZC 3QJ6A 2KEAA 2RD1A 1ABQA 3OY9A 2RA2A 4XK8E 4C92F 4M7DG 2FZCB 4IUTA 2GQIA 2JMCA 1PNJA 1OZ3A 1UJYA 2DIQA 1X01A 2LX7A 2DL4A 1YITT 3RDVA 2KXDA 4KUDK 3CC2Q 3OYYA 2RK2A 3BY7A 1RAGB 3CD6Q 1ZUUA 3GLXA 4GBQA 3OYDA 1EFNA 1WQ7A 2YT6A 2COZA 1K9MU 2GBQA 2KMTA 4E7SA 2HSEB 1VQ6Q 4M7DE 3QZ5B 2KRNA 1W4SA 1PD1A 1W70A 1NJIU 4AT1B 3VS1A 3M57A 3X20B 4GLKA 1IRXA 2DIGA 4L5GA 1IGQA 1IB8A 3LX7A 3CMEA 1FMKA 2Z0WA 1P92A 4C92D 3KXTA 5J39A 1TUCA 2MOXA 2L3PA 3SHWA 4QVZA 2OX7A 4C8QE 4M7DF 1U1TA 4LE9A 2RJDA 1QW1A 4ORZA 1VQOA 1N9RA 2PVGB 1X75C 1M90C 5A0DA 1NJIC 2A28A 3NTIA 2XK0A 4LUEA 2F2XA 2E65A 3OYJA 1KC8R 2DF6A 1YCYA 2CT4A 1VQ5Q 2HQHA 4ZTJA 3R6NA 4DEXA 2QG9B 3REAB 5FW9A 4X34A 4MZTA 2M0OA 1ZX6A 3OYNA 3L2WA 3QSUA 2LCSA 3GF5A 2KGTA 3I56A 1WNLA 2J6KA 4JDSA 4C8QC 2E5QA 1G3YA 2ZGWA 4HXJA 3CC7T 2KYMA 2OAUA 1PHTA 4ZN3A 1KQ2A 3L2VA 1GRIA 2F5TX 2P84A 2SRCA 4M7AE 4M7DC 1UDLA 4FYVB 1FX7A 1E6HA 3I55A 2CT3A 1LOJA 1I1JA 2KVQG 3L42A 4JJBA 1PD0A 5DM7R 4PLLA 1TWBA 3PT9A 2R57A 1JU5C 4Z02A 1UHCA 2FPEA 4AFQC 1D0XA 1QP2A 2IG0A 3LGLA 4L6V5 3UWNA 2KRMA 2BZYA 3PGGA 3NTHA 2DL5A 1TG0A 2R5MA 1YBYA 5KYYA 5IXBA 1HSQA 2B86A 2YRVA 5GAN7 3I55Q 1Q86U 2YDLA 2X4YA 2DXBA 2ZPGB 4CRIA 2C0IA 5IXFA 2KDSA 3V7RA 3HSBA 1SKUB 1MV0B 3QDRB 1C6VX 3CD6A 3RKYA 3RUXA 2DRMA 1MNEA 2QYZA 4A53A 3UA6A 4AFZC 2K5IA 3JRZA 3OBWA 2CKKA 1G8XA 3OYKA 3CCUA 1M8MA 2JT4A 2BUDA 1SHGA 2DA9A 4E7IA 2A7YA 1WHLA 1KIKA 2WSCE 4RTYA 2FZKB 1SSFA 1E6GA 5LJ5h 2QDLA 1VQ5A 3X25B 5CKFA 2KT8A 1UFFA 3QDFA 3M4GA 4X9DA 1GCQA 5KE2A 1WHMA 2NUZA 4FSSA 4AG1C 1IHWA 4E7HA 2LMJA 3NGPA 2FPFA 2RQRA 3I35A 2E70A 1Q95G 3ZFJA 4FM4B 4N4IA 3V7SA 4EMKC 1UEBA 3VUBA 3VS6A 5CAIA 3CXCS 5GJVB 2KQWA 6AT1B 1M27C 2DFUA 2F69A 3INZA 3H0HA 4M75A 1Y07A 1KHCA 3OYHA 4KGXB 3R6OA 4QQ6A 1JXOA 4XU1A 3MHXA 2RQWA 5GAMj 4DEYA 2J6FA 1M90U 2C0TA 2DYBA 1H3ZA 3CBPA 3TU4K 3X24B 3RMQA 3SWNC 4PL6A 2PUOB 3CBMA 4EMKA 3CC2A 1K0SA 2QDYB 1QWEA 1GFCA 1VQMA 2DYIA 3VRZA 1MNDA 3P8BB 2CZ0B 4QVDA 1O75A 4J7FA 2AKKA 2LNVA 4M77D 4HVWA 1YIJT 4FW2A 4N4HA 3S3OA 1B34A 2B8AA 4JRIA 2QGGA 5CK9A 1NE8A 1NJIR 2HEQA 3OMCA 1Q7YC 4ANJA 1SG5A 3L2ZA 3L2QA 3CMEQ 2LRQA 2JW4A 3C95A 1KD1U 1QVFA 1NG2A 1WIEA 2CP5A 5GAMd 1BI1A 2HNIA 3M59A 1VQ5T 2ESWA 3QBYA 1MHNA 2XD0A 1KD1C 3AHUA 2MYSA 1VQKT 4ZGEB 3OYLA 1UJ0A 1FMVA 1AZGB 2AZVA 4AMCA 5HY6A 1TXQA 2KT1A 1VQKA 3OS5A 4M78D 3CCUT 4R0KA 2VUBA 3CCQQ 3I9QA 2ECZA 4M77F 4ZGDB 1K8AC 3CXCA 2FPDA 2AHJB 3E2UA 2DXUA 2HL3A 4M77G 3A8HB 2KY9A 5KE3A 3O5ZA 2XU8A 3M0RA 4J9DA 5CKBA 1IHVA 2DXTA 4FYWB 1KQSP 2E4HA 1X6GA 2VXEA 1M5Q1 3LLRA 3UT1A 4IUQA 4A4GA 2D1XA 2EQKA 2QAZA 2P0QA 1VQ4A 2QASA 5CR2A 5FU7C 4KGZB 4WCIA 5CQXA 4FW1A 1D3BA 4J8OA 2GTJA 4BI8B 3RESA 1JBMA 4M78F 3EGDB 1I8FA 2RH2A 4ESRA 1QVGA 3VUZA 5KCOA 1SSHA 2QQRA 2LT1A 3BDLA 5LJ5f 1ZUKA 1TH7A 1RAHB 4JZ4A 3FJ5A 2HBPA 4IUVA 3FLGA 3UDCA 2YUNA 2QK0A 3PE0A 2L3SA 2HCKA 3WVEB 1UGRB 5L8RE 3CCVT 1ZHIA 4B9XA 3CCEQ 2VWFA 5DLQE 5GAOr 3H41A 1MUZA 2H3EB 3A8LB 4BY6C 2F5KA 3MCAB 4MDXA 4HCCA 4FYXB 1VQLT 1W2BP 3CCJT 1NBEB 3NPFA 2R58A 2EQIA 3JCMV 2K5LA 1EX4A 1TOVA 3S6WA 3HHTB 1VUBA 3G7ZA 2EBPA 2CP3A 3CCSA 4XQ3A 1PSFA 1UECA 2KSSA 3URGA 4LXCA 5GMKl 2EKHA 2KNBB 4M7DB 2GCXA 5GAN3 3CC4T 3OYCA 1YJ9A 1YIJQ 3REBB 3GP8A 3CD6T 2RQUA 3VRYA 1YWOA 4OMOA 2RO0A 1X69A 2HZYA 2QI2A 2LP5A 2EGCA 2FO0A 3JV3A 1NM7A 3VS0A 1NEBA 4A63B 2O88A 2MK5A 2CH4W 2E5KA 5LJ3j 2CP2A 1Q82C 3JCMW 4IUPA 1RAIB 2LQNA 4CI0C 1SHFA 2CZ1B 2FB7A 2FHDA 2E41A 3V8LA 2OTJT 4P5NA 1VQLQ 1M1KC 2HMAA 2BZ8A 5KYUA 4N0AA 1YITA 2E3HA 1S1NA 2RHYA 3G71A 3KFVA 2VGNA 2K5FA 2AKLA 1K76A 2NUPB 4R56A 2VGMA 1UGSB 4DBRA 1VQPQ 2LC4A 4JS4A 4DBHA 4DOVA 5GMKe 2I2LA 5KYYB 2DAQA 2X4XA 3VJPA 1RADB 2V1QA 2ZPEB 3EFSA 3MPUB 5LJ5g 3CC7A 2RI5A 4C0FA 1Q82U 4JJNK 4EMKB 2FYKA 1R77A 2KRSA 4LDUA 3G6EA 1YHQQ 2YHTA 2NYSA 1YP5A 3PNWC 1R0CB 2DPPB 3VS2A 2LZ6B 4RTWA 4XTXA 2FVUA 4RTUA 1VQ4Q 5GAMg 1FXXA 4HT9A 2X4WA 4J6YA 3CXCP 2ABLA 1YI2T 1D1AA 1IO6A 2JUFA 3OYBA 5CKDA 1SRLA 2QTVA 1VQPA 4PKCC 1H3HA 1D09B 2KR3A 3OYMA 1BIAA 4MMKA 1V76A 3PTAA 3CPFA 4AFSC 4M78A 3OYGA 1PRMC 2LX9A 4C5GA 2AT1B 1Q86R 3NFCA 2YXYA 3ME9A 1VOMA 5FU6C 1M1KR 3N5BB 4LNPA 4B6MA 2EJ9A 3FB9A 1YJ9Q 2KBTA 4E7ZA 2W0ZA 2V8JA 1Y71A 3C12A 1NLOC 4F16A 4RTXA 1YJ9T 2DEQA 1BI3A 1ABOA 2XKOC 2ZPIB 3J80E 2X3WD 5CO7A 3A98A 5D6XA 2QA4Q 1ZBXA 3TSWA 2KXCA 4EMGA 4PJOF 1D3BB 1QCNA 1VQ8A 1K9MR 4KULA 5GAOl 3M58A 1WXBA 3M9QA 2PUKB 3S3NA 3G6EQ 1YHQA 2YLBA 1JRIA 4M7AA 2VVKA 4BE1A 1VQLA 4HCKA 1WXUA 4E6RA 3OYEA 3G1JA 4KH0B 5GAN8 3OBYA 3M0TA 2Y4XA 4C0DB 3A8OB 1QVGP 2KAFA 3SB2A 4A4EA 1OU8A 2DX1A 2V8KA 5EC7A 2EYYA 3M0SA 5GAOn 2I0NA 4Y92A 4BUGA 3C4SA 2L89A 2EYQA 2LNHB 3I5RA 2RJCA 1M1GA 5GMKj 3G4SA 1XOVA 2Y90A 2COYA 1LJOA 2O31A 2JXBA 2RI3A 4NL2A 4PJLA 4J6XA 2C06A 4M4ZA 2JS2A 4OB1B 1VQ9T 1T0JA 1OX9A 1Z9ZA 2YUQA 4PJOC 1UE9A 2D8HA 1JJ2A 3NMZC 4EIKA 4PNOA 1GCPA 3OYIA 1VQ4T 4M77E 2NUTA 1G5VA 2HSPA 1AT1B 1C0MA 1TSFA 5GMKm 4IUUA 3NTKA 5GAN4 1W6XA 4RG2A 4Y91A 1SRMA 2D0NA 2A08A 3M55A 4M75D 4LDWA 3MP1A 1YITQ 3BDUA 4QT7A 4F7UA 8ATCB 3J7AF 2D0QB 3EGXA 3GIBA 1BI2A 1W1FA 1U1SA 4C92A 4Q5WA 3TVTA 4BB7A 1ACMB 3QYGB 3DB3A 3RIRA 2OI3A 4LDVA 2V26A 4RCCA 4AFUC 4M77C 1ZQ1A 1Y7XA 2ZCFB 1M3CA 1BU1A 3WXMB 1RACB 1YNZA 5LJ3f 2ED1A 1YCSB 1G3WA 5GAN6 1RUWA 4M7AB 2COWA 2V8IA 5C6SA 2A36A 3PIPA 1JXMA 1YIJA 1Q81U 4J7IA 5I21A 4DQ2A 1WA7A 5IH2A 2QQSA 2EJGA 1KD1R 5J26A 1OPLA 5CKHA 3JAME 1PKSA 3ASKA 4M78C 4M7AG 4L59A 1UUEA 4YTLA 4DOWA 2BKDN 2DMOA 1YJNT 1RAAB 1QQJA 1B3QA 5KYWB 3CC4Q 1QLYA 2DM1A 1Q7YR 4OB2B 1GBQA 2DD4A 3Q1JA 1Q7YU 5LJ3g 4B9WA 5L23A 1J3TA 2VC8A 5LJ5e 1M4ZA 1GFDA 2QQAA 4BACA 3SWNA 4JUVA 3PFSA 4RCBA 2EQUA 4XTUA 3M56A 4OMLA 2KE9A 3QZ9B 1G2BA 4ELYC 5ECAA 2PTKA 4JRPA 2CZ6B 2EYZA 4FT2A 3M5AA 4XU2A 3EFOA 3PMIA 2HKQB 4FU6A 3EG2A 1YJWT 1RI9A 3SWNB 3FIFA 4J9HA 4KUIA 3X28B 2YRCA 3CCLQ 2M1HA 1E7OA 3SDZA 3E1SA 3GOXA 3CCMA 2CUBA 4IIMA 3HL8A 4MZPA 3QWYA 1NEGA 1BKBA 1Q81C 3QG1A 1I81A 3JCMQ 3FJPA 2LCCA 3QXEB 2OTLQ 3BE3A 1JO8A 5GAMh 1ARKA 1TU0B 3H0FA 5GAOp 5LJ3d 2P4TA 1DJ7B 3EH2A 2MPXC 4FIBA 1RABB 2DETA 3EFOB 3VS3A 4M75E 3DB4A 1K9MC 4FCYA 1VQNT 1H92A 1RAEB 3M0QA 4GY5A 3OSVA 3KUFA 2IIMA 4JS5A 2DLPA 3A1PA 2DKGA 3CCQA 1WJQA 2DERA 3META 4M77A 2X9HA 3QKJA 3HPWA 1V1CA 3OS0A 3ZBDA 2QEXT 2L3RA 4JRQA 5GAN2 1K1ZA 1UB4A 4C92B 3PVQA 1N5ZA 3RR6A 3CCQT 3CPWA 2EW3A 3SEMA
chains in the Genus database with same CATH topology
2RJEA 3CD6T 2LVMA 4HKEA 3VU3C 1WJSA 1VQOT 2RO0A 2E6ZA 4NL3A 2QI2A 1QVFS 4QVCA 1HXDA 4IKFA 1NPPA 1IZ6A 5CIUA 3QJ6A 5C0MA 3JCMe 4ZTFA 2RD1A 3OY9A 1Y96B 3JCMg 2RA2A 4XK8E 3TCJA 4C92F 4M7DG 4V2SA 4IUTA 2LCLA 4M75C 3CMAT 5GAOm 3A8GB 5J3BA 5LJ3j 1OZ3A 1YI2A 1Q82C 3E9GA 2DIQA 3JCMW 4IUPA 4OB0B 1X01A 2RJFA 2DTIA 5GAMe 4J83A 4PJOA 1YITT 4NOYA 4KUDK 4CI0C 1H3ZA 2EKOA 3G71T 2EAYA 3OYYA 1KQSS 2RK2A 1N6AA 3BY7A 2JTMA 2CZ1B 5LJ3h 2XDDA 2FB7A 3CBOA 3LWIA 1EIFA 3I56T 2E12A 2FHDA 2E41A 3GLXA 3OYDA 1QVGS 3V8LA 4C92E 3G6ET 2OTJT 1UGPB 4P5NA 1WQ7A 3L2UA 1M1KC 3MEAA 4N4GA 1K9MU 3P8DA 4IURA 4JLGA 2KMTA 2P0KA 2LT4A 4N0AA 1YITA 3JCMP 4M7DE 3RKXA 2ZPBB 4EMHA 4R55A 1M1KU 3QZ5B 2RHYA 1W4SA 2RM4A 1NJIU 3G71A 1W2BA 4PJOB 1KG1A 3M57A 3X20B 3OW2A 4GLKA 1N8RU 2DIGA 1XTDA 4L5GA 2VGNA 4J6WA 1WQWA 3CMAA 1G3SA 3OYFA 2K5FA 3LX7A 3CMEA 4R56A 4C92D 1P92A 2VGMA 3VV0A 3OMGA 3KXTA 1QVFA 1UGSB 5J39A 2LC4A 4JS4A 5KH6A 4DOVA 5GMKe 2I2LA 4ZGJB 2DAQA 2X4XA 3VJPA 2CS7A 2ZPEB 3EFSA 3CEYA 5LJ5g 4QVZA 4C8QE 3CC7A 2RI5A 4C0FA 4C92C 3JCMJ 3M53A 4JJNK 1Q82U 1U1TA 4M75F 4M7DF 2RJDA 3TREA 4EMKB 1QW1A 1VIEA 2FYKA 1GXIE 4LDUA 3G6EA 2OTJA 2YHTA 1VQOA 1N9RA 2PVGB 1X75C 3WVDB 4XTZA 3V7CA 3PNWC 1O9SA 2DPPB 2XIDA 5A0DA 1NJIC 1M90C 5CCAA 3HRUA 3NTIA 4XTXA 2XK0A 5HKCA 3S3MA 3OW2S 2FVUA 2O4XB 2E65A 4BD3A 3JB9I 3OYJA 3V8KA 2XDBA 1YCYA 2QEXA 3TU4K 5GAMg 4BDZA 1FXXA 4LD9K 4ZTJA 4HT9A 1Y96A 4RKUE 2X4WA 4J6YA 3JCMd 1YI2T 2HD0A 4C92G 2JUFA 3OYBA 4BE2A 4X34A 4MZTA 2M0OA 3E19A 5CKDA 1XNIA 1S72T 3OYNA 3L2WA 1K8AU 3QSUA 2EQJA 3DLLA 1VQPA 4PKCC 1OZ2A 2MWPA 3GF5A 2DJZA 3I56A 3OYMA 1WNLA 4JDSA 5FRMA 1BIAA 4MMKA 2DO3A 2E5QA 1G3YA 4C8QC 3OS2A 4M7AD 2JTFA 5GANh 2ZGWA 3PTAA 3CPFA 4M78A 3CC7T 2MI6A 3PMTA 5GAOq 2OAUA 3OYGA 4C8QD 4RG8A 1AHJB 4ZN3A 5GMKh 2LX9A 3JSCA 2G3RA 3UPUA 2DZCA 4C5GA 3L2VA 1KQ2A 3RMSA 3X26B 2BIVA 5CQYA 2F5TX 2QQ9A 3GNFB 3NFCA 4M7AE 3ME9A 4M7DC 1OYXA 3QIIA 5FU6C 4M75G 4F7UB 4EPCA 3N5BB 1FX7A 1XQHA 3C94A 3I55A 2PVOB 2EJ9A 3FB9A 2XHCA 3OQ5A 1JB0E 1LOJA 4M7DD 2KVQG 5A2QE 3L42A 2M16A 3M4YA 4O5VA 2V8JA 5DM7R 3QJYA 1Y71A 3C12A 4PLLA 1YJ9T 2K57A 3PT9A 3HKSA 2DEQA 1BI3A 4HA8A 4XTVA 2R57A 3CCJA 4ATOA 2XKOC 2ZPIB 4Z02A 1VQNA 5IN1A 5GMKi 2IVWA 3J80E 2XDPA 4C5HA 1QP2A 2IG0A 3LGLA 4L6V5 3UWNA 4F7UF 2HQXA 5CO7A 5LJ3e 3PGGA 5D6XA 3V8JA 4DA4A 3NTHA 1ZBXA 4JLIA 3CCVA 4XAXB 3FRNA 4A4KA 2HAXA 2R5MA 4C8QF 2MF2A 4EMGA 4PJOF 1D3BB 1YBYA 2YRVA 4LDYA 3BW1A 1RI0A 1VQ8A 4KULA 5GAN7 5GAOl 1Q86U 5A0GA 3M58A 3H6ZA 5IT9E 3M9QA 2PUKB 3S3NA 4A4HA 1YHQA 2X4YA 2DXBA 2ZPGB 2YLBA 1JRIA 4CRIA 1I5LA 4M7AA 1G3TA 2KDSA 3A5ZB 3V7RA 3MO8A 4BE1A 3OYAA 1VQ7A 1VQLA 3HFOA 3HSBA 2MAMA 1UGQB 2LTOA 3OYEA 3QDRB 2EFIA 2L8DA 5I2MA 5LJ5j 5GAN8 3CD6A 3H8ZA 1OI1A 3OBYA 2P0PA 2H3JA 3E9FA 3RKYA 2Y4XA 4A4FA 4C0DB 2FL7A 3A8OB 3RUXA 3JB9D 2KAFA 3CCMT 3GNGA 3SB2A 2KK4A 4A4EA 4A53A 5DY9A 2K5IA 1N9SA 2VV5A 2V8KA 2CGHA 3OSSC 3HRSA 2QQBA 2K2VA 3QHSA 1WGSA 3JRZA 3OBWA 4LD6A 2CKKA 2JOYA 4PJOG 5GAOn 3OYKA 3T9NA 3CCUA 4BUGA 3C4SA 2L89A 2XICA 2EYQA 4RMOA 2BUDA 3HFNA 2Y4YA 1VQ9A 2DK3A 4E7IA 2A7YA 4ZN1A 2RJCA 1M1GA 5GMKj 3G4SA 1XOVA 2WSCE 2WACA 2Y90A 1LJOA 3ER0A 3FEOA 4J5YA 1SSFA 2RI3A 2DZ9A 4NL2A 5LJ5h 5HK3A 3G4ST 2PQWA 4KT0E 3SD4A 1WJRA 3QPHA 5D6WA 2YLCA 4J6XA 4C5EA 3X25B 4OB1B 1VQ9T 1VQ5A 2C06A 2RI2A 4MDWA 5CKFA 4QW2A 2E10A 4PJOC 1RL2A 3OS1A 4OB3B 2WSEE 1N27A 3M4GA 1JJ2A 4X9DA 4PNOA 3CCLT 2QA4A 3L2RA 2ZZDA 1KD1U 1PSEA 5KE2A 4E7JA 2PVDB 3JB9F 2JVVA 4E7HA 3OYIA 1VQ6T 2QA4T 1VQ4T 3JB9G 2E70A 2JZ2A 4M77E 3ZFJA 2EWNA 3JCMc 4FM4B 4TVRA 5I2SA 1VIFA 4N4IA 2RK1A 3LWHA 4FT4A 3CPWS 1G5VA 3V7SA 4EMKC 1UEBA 4QQGA 3VUBA 4OGEA 4BY6B 3MEWA 2VXFA 5CAIA 5GMKm 3CXCS 5FRNA 2M9UA 3NTKA 4IUUA 2KQWA 5GAN4 2NLUA 5FROA 4RG2A 4XTYA 3DLMA 4Y91A 1MGQA 2GQVA 2F69A 3INZA 3M55A 4M75D 4M75A 1Y07A 4LDWA 1M8VA 1KHCA 3OYHA 3MP1A 1VQ6A 3BDUA 3R6OA 1VQMT 4F7UA 3J7AF 1W2BS 4QQ6A 2D0QB 2R5AA 4Y28E 3GIBA 4XU1A 3CCRT 1K73C 1I4K1 3MHXA 5A0LA 1KQ1A 2HQEA 1BI2A 4XU0A 1U1SA 2GFUA 2JN0A 4C92A 4Q5WA 5GAMj 3VYGA 4BB7A 1M90U 3QYGB 3M54A 3DB3A 3RERA 1YJWA 3RIRA 3JCMh 3LYIA 2D9TA 3CBPA 4MZMA 3X24B 4NS5A 4LDVA 4PL6A 3RMQA 2PUOB 3CBMA 3SWNC 4C0GA 2OTLT 3MP6A 4RCCA 4EMKA 3CC2A 2L5QA 2QDYB 1VQMA 4M77C 2JNGA 4PJOE 3OA6A 1ZQ1A 4ME7A 5LL6S 2RHXA 3P8BB 3GPLA 1Y7XA 2CZ0B 4QVDA 1O75A 2ZCFB 4J7FA 1QVPA 2EJFA 2LNVA 4M77D 1YIJT 1WPYA 5GANj 3J81E 4N4HA 2RHZA 3QUIA 1B34A 2B8AA 4JRIA 3SFMA 2DTOA 3VKIA 3WXMB 2QTXA 1X6OA 4JRKA 5CK9A 5LJ3f 2RB6A 3CC2T 1NE8A 4OVAA 3OMCA 1Q7YC 1G3WA 3OB9A 3CCLA 5CKEA 3MEUA 4FL6A 3L2ZA 1BI0A 5FU6B 2LRQA 5GAN6 1M1FA 3C95A 3L2QA 3LH0A 4BDYA 4M7AB 2D6FA 5KCHA 2V8IA 1IREB 3JB9J 5C6SA 4C5IA 3PIPA 5GAMd 1BI1A 1YIJA 2HNIA 3M59A 4J7IA 1Q81U 5I21A 2WSFE 1VQ5T 3QBYA 4DQ2A 1MHNA 2XD0A 2QQSA 2EJGA 5GAMf 1KD1C 2LQ8A 4QQDA 5J26A 1YJNA 5CKHA 3JAME 4M78B 3ASKA 2GFAA 4M78C 1VQKT 4ZGEB 3OYLA 3AHUA 4UC4A 2RHUA 4M7AG 4L59A 4XTWA 5HY6A 1YHQT 4YTLA 2CYZB 4DOWA 2BKDN 1VQKA 4C8QA 3OS5A 1YJNT 3LW5E 4OGCA 4BE0A 4M78D 3CCUT 2VUBA 4FSXA 5CVIA 4MMLA 1V29B 3EAEA 4OB2B 3PIOA 4M77F 2DD4A 3Q1JA 4ZGDB 3CXCA 3CCRA 1Q7YU 1K8AC 2AHJB 2DXUA 5LJ3g 4B9WA 4M77G 3A8HB 2KY9A 3EFRA 5KE3A 5GANd 2VC8A 4OP0A 2XU8A 5LJ5e 1M4ZA 1NZ9A 4M78G 3KBGA 4D6WA 4VUBA 5D6YA 4EDUA 1U8RA 2QQAA 4BACA 3SWNA 4M7AC 5CKBA 4JUVA 4M7DA 3PFSA 3JB9H 4RCBA 1Q86C 2EQUA 4XU3A 2LQKA 1M9SA 4O6JA 5HK0A 1QP3A 2DXTA 4XTUA 3M56A 4OF1A 2CZ7B 3QZ9B 3LLRA 2VXEA 1M5Q1 3UT1A 4M77B 3QYHB 1NPRA 4IUQA 4ELYC 4JRPA 3HP9A 2CZ6B 4A4GA 2EQKA 4C0DC 2E64A 2O01E 2P0QA 3L1AA 4FT2A 1VQ4A 3M5AA 4F7UE 4XU2A 2K3XA 5CR2A 4E7LA 2MWOA 5FU7C 3CMET 3O8VA 5CQXA 1JJ2S 3PMIA 1K73U 1D3BA 2OTLA 4HCZA 3F70A 4FU6A 4J8OA 1YJWT 3SWNB 4HCBA 3FIFA 4KUIA 4BI8B 3RESA 1HK9A 1JBMA 2PU9B 4M78F 3X28B 3JCMb 2X35A 1I8FA 2RH2A 2M1HA 5GAN5 2DVEA 1QVGA 1H641 2XI9A 3VUZA 3SDZA 3LGFA 3E1SA 3JCMX 3VYHB 4X9CA 5KCOA 3GOXA 2E1HA 2QQRA 2LDMA 3CCMA 4LDXA 3FDRA 3HL8A 3MEVA 4MZPA 3MP8A 2LT1A 3BDLA 4II1A 5LJ5f 2DTHA 1R8OB 1KC8C 2X4JA 4A54A 4OMFB 1BYMA 1BKBA 1TH7A 2O4XA 2RHIA 5IAYA 5LJ5d 1Q81C 2VYTA 3QG1A 1I81A 3ZEHA 5GANe 3FJPA 2LCCA 1FWZA 3RKWA 3JCMQ 3QXEB 3QO3A 5FU7B 4E47A 2HBPA 5DLOA 4IUVA 3FLGA 3UDCA 2ZPFB 1S72A 4KBMB 5GAMh 4BI4A 3FC3A 3WVEB 5GAOp 2EIFA 4WF2A 5LJ3d 1UGRB 1VQ8T 5AYFA 2P4TA 1DJ7B 3S3OA 4M7AF 5L8RE 4M75B 1N8RC 3CCVT 1ZHIA 4FIBA 2GF7A 4B9XA 1KHIA 5EG2A 3HRTA 2EQMA 5DLQE 4E7KA 5GAOr 3A8LB 4BY6C 1KC8U 4M75E 3DB4A 2F5KA 3MCAB 4MDXA 3P8HA 4C0ZA 2XG8D 1K9MC 4HCCA 1VQNT 4M78E 5GANg 1VQ7T 1VQLT 2DD5A 2DXCA 4GY5A 3OSVA 4PLIA 3CCJT 3KUFA 4C8QB 4JS5A 2R58A 3JCMV 2K3YA 2K5LA 3A8MB 1VQPT 1BIBA 4ELZC 3S6WA 2DKGA 3CCQA 3HHTB 1VUBA 1WJQA 3BFMA 3G7ZA 3META 4N0AC 3CC4A 3CCSA 4M77A 2QXFA 4XQ3A 3I55T 1PSFA 3CCEA 3DKMA 2ZPHB 3QKJA 5M9OA 2KSSA 3HPWA 3OS0A 2A3LA 3ZBDA 4BI3A 2QEXT 2K4YA 4PJOD 3URGA 1B34B 3JCMf 4F7UG 2L3RA 5GMKl 4JRQA 5GAN2 3CCET 4M7DB 1UB4A 2GCXA 5GAN3 4HT8A 1KQSA 3CCST 4C8QG 4C92B 5GANf 5FLXE 2E6NA 3CC4T 1LNXA 3OYCA 2MMPA 3CCQT 1YJ9A 3CPWA 3GP8A 3TEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJE A;  4EDU A;  5D6Y A;  2LVM A;  3PMT A;  4BAC A;  3OYG A;  1WJS A;  3L2R A;  2RO0 A;  3PFS A;  5KE2 A;  4E7J A;  2EQU A;  4IKF A;  2G3R A;  5CIU A;  3OYI A;  4C5G A;  4E7H A;  3L2V A;  3QJ6 A;  5C0M A;  2BIV A;  4ZTF A;  2JZ2 A;  3LLR A;  3UT1 A;  3OY9 A;  1G5V A;  4N4I A;  4IUQ A;  3ME9 A;  4IUT A;  1OYX A;  4A4G A;  2EQK A;  3QII A;  4QQG A;  3MEW A;  5FRN A;  1OZ3 A;  2K3X A;  3NTK A;  4IUU A;  4E7L A;  2MWO A;  2DIQ A;  2NLU A;  3E9G A;  4IUP A;  4RG2 A;  5FRO A;  3DLM A;  2RJF A;  3O8V A;  3OQ5 A;  3PMI A;  4HCZ A;  3F70 A;  4FU6 A;  3L42 A;  1KHC A;  2EKO A;  2M16 A;  3MP1 A;  3OYH A;  4PLL A;  2X35 A;  4QQ6 A;  2M1H A;  2R5A A;  2R57 A;  2FHD A;  3OYD A;  4Z02 A;  3LGF A;  2HQE A;  3GOX A;  5KCO A;  2GFU A;  2QQR A;  2LDM A;  4Q5W A;  5IN1 A;  3FDR A;  3L2U A;  3MEV A;  3MEA A;  3MP8 A;  2XDP A;  3BDL A;  2IG0 A;  3DB3 A;  3P8D A;  3LGL A;  4II1 A;  4IUR A;  4N4G A;  2HQX A;  2D9T A;  3LYI A;  2P0K A;  3UWN A;  4NS5 A;  4PL6 A;  4C5H A;  1H3Z A;  5D6X A;  3MP6 A;  3NTH A;  5IAY A;  2O4X A;  2RHI A;  2VYT A;  2R5M A;  2RHY A;  3ZEH A;  3OA6 A;  2LCC A;  2YRV A;  1RI0 A;  2DIG A;  3FLG A;  2RHX A;  4IUV A;  3H6Z A;  3OYF A;  3M9Q A;  3S3N A;  4A4H A;  3LX7 A;  2X4Y A;  3FC3 A;  4CRI A;  3OMG A;  2RHZ A;  4N4H A;  3S3O A;  2B8A A;  3MO8 A;  4BE1 A;  5J39 A;  3OYA A;  5KH6 A;  3OYE A;  2LTO A;  2GF7 A;  2DAQ A;  2X4X A;  2EFI A;  2L8D A;  4OVA A;  4B9X A;  3OMC A;  3CEY A;  3H8Z A;  1OI1 A;  2EQM A;  3OB9 A;  4QVZ A;  2RI5 A;  4E7K A;  3E9F A;  3MEU A;  4FL6 A;  2RJD A;  4A4F A;  2LRQ A;  3L2Q A;  4BDY A;  3DB4 A;  2F5K A;  3LH0 A;  3P8H A;  5KCH A;  4A4E A;  4GY5 A;  3PNW C;  5C6S A;  4PLI A;  4C5I A;  3KUF A;  3NTI A;  1WGS A;  2XK0 A;  3S3M A;  4LD6 A;  2CKK A;  2R58 A;  3QBY A;  2K3Y A;  3OYK A;  2O4X B;  4BD3 A;  1MHN A;  3OYJ A;  2QQS A;  3S6W A;  4QQD A;  5J26 A;  1WJQ A;  3C4S A;  3ASK A;  2GFA A;  2L89 A;  3MET A;  3OYL A;  4BDZ A;  4ZTJ A;  4UC4 A;  2BUD A;  2RHU A;  2X4W A;  4E7I A;  4L59 A;  2RJC A;  3QKJ A;  2BKD N;  5M9O A;  3OYB A;  4BE2 A;  4X34 A;  2WAC A;  2M0O A;  3OS0 A;  1XNI A;  3OYN A;  3FEO A;  3L2W A;  4BE0 A;  2EQJ A;  2L3R A;  1SSF A;  2RI3 A;  2PQW A;  1OZ2 A;  3SD4 A;  1WJR A;  2MWP A;  3EAE A;  5D6W A;  4C5E A;  3OYM A;  5FRM A;  2RI2 A;  3Q1J A;  2E6N A;  2E5Q A;  4QW2 A;  3OS2 A;  3OYC A;  2JTF A;  3OS1 A;  4B9W A;  1N27 A;  5KE3 A; 
#chains in the Genus database with same CATH topology
 1VQO Q;  1WJS A;  2CP6 A;  5D7U A;  4QVC A;  4RTV A;  1NPP A;  1IZ6 A;  5C0M A;  4PJN A;  3JCM e;  4ZTF A;  3CCS Q;  1Y96 B;  3JCM g;  4V2S A;  1M90 R;  2LCL A;  3CMA T;  3CMA Q;  1YFN A;  2ATC B;  4OB0 B;  2RJF A;  2DTI A;  4AG2 C;  3QWX X;  4JZ3 A;  4NOY A;  2SEM A;  2EAY A;  1KQS S;  4OMP A;  1HD3 A;  2JTM A;  5LJ3 h;  2XDD A;  3CBO A;  1QVF P;  3LWI A;  3I56 T;  2E12 A;  1MMA A;  4C92 E;  1EZZ B;  3L2U A;  4N4G A;  1U06 A;  2DL8 A;  2DBM A;  2YWW A;  3P8D A;  2K2M A;  3JCM P;  2FRW A;  1PG5 B;  3RKX A;  2ZPB B;  1KG1 A;  2J7I A;  3OW2 A;  1N8R U;  1XTD A;  1YI2 Q;  1WQW A;  1G3S A;  3OYF A;  2H8H A;  1GL5 A;  3VV0 A;  1HYO A;  5KH6 A;  2CRE A;  4KRT A;  3CEY A;  3JCM J;  1X43 A;  1WZO A;  3TRE A;  1KSW A;  1GXI E;  9ATC B;  1BK2 A;  4GLM A;  3WVD B;  4XTZ A;  1K0X A;  5HKC A;  3OW2 S;  2O4X B;  4BD3 A;  3JB9 I;  5AT1 B;  2XDB A;  4BDZ A;  2K9G A;  3U23 A;  1Y96 A;  4RKU E;  1AWW A;  4J9E A;  4C92 G;  1S72 T;  1Q81 R;  3EGD A;  1K8A U;  1BBZ A;  3DLL A;  1AWJ A;  1K8A R;  1OZ2 A;  2DJZ A;  2O9V A;  5FRM A;  4M7A D;  2JS0 A;  3OS2 A;  1TS9 A;  2JTF A;  3I56 Q;  2MI6 A;  2E3I A;  5GAO q;  4KH1 B;  2HBW A;  4RG8 A;  2G3R A;  2DZC A;  3RMS A;  3X26 B;  2BIV A;  2DVJ A;  5CQY A;  2ROL A;  2QQ9 A;  3GNF B;  2RPN A;  1B07 A;  3C94 A;  2PVO B;  3OQ5 A;  1JB0 E;  2JMA A;  2PZ1 A;  2K7A A;  5IHK A;  3OW2 P;  3M4Y A;  4O5V A;  2DJQ A;  1H8K A;  3HKS A;  4ATO A;  1UGV A;  2DIL A;  1D1B A;  1VQN A;  1M2V B;  5IN1 A;  5GMK i;  2IVW A;  4C5H A;  4FYY B;  2HQX A;  2AK5 A;  1OPK A;  3V8J A;  1KJW A;  4XAX B;  1SPK A;  3FRN A;  4A4K A;  4DBF A;  2MF2 A;  1FYN A;  4LDY A;  3BW1 A;  1RI0 A;  3H6Z A;  4A4H A;  2FZG B;  1I5L A;  1G3T A;  3MO8 A;  3OYA A;  3HFO A;  1PRL C;  2MAM A;  2LTO A;  4PFP A;  2EFI A;  2L8D A;  5LJ5 j;  3H8Z A;  1OI1 A;  2P0P A;  1MMN A;  2H3J A;  4A4F A;  2FL7 A;  3JB9 D;  3CCM T;  2EGE A;  2VV5 A;  2CGH A;  3QHS A;  4WTO B;  1WGS A;  3EG0 A;  4PJO G;  2V1R A;  1IXD A;  1VQM Q;  1U5S A;  1AWO A;  7AT1 B;  1VQ9 A;  2Y4Y A;  4ZN1 A;  3CCM Q;  1F1B B;  1TTH B;  3ULR B;  3VS5 A;  1ZSZ B;  2DZ9 A;  3G4S T;  3TQ7 P;  4KT0 E;  3SD4 A;  1WJR A;  2A0F B;  2DBK A;  3QPH A;  2YLC A;  4IIO A;  2RI2 A;  1UHF A;  4MDW A;  1AEY A;  4QW2 A;  1RL2 A;  3OS1 A;  4OB3 B;  1N27 A;  2MIO A;  3CCL T;  3EHR A;  2ZZD A;  1PSE A;  1B7T A;  1WFW A;  2CSQ A;  2JVV A;  3JB9 F;  1VQ6 T;  1VYU A;  1WHG A;  2YUO A;  3JB9 G;  2JZ2 A;  2EWN A;  1OEB A;  1OQK A;  4TVR A;  1X27 A;  4D8K A;  5I2S A;  2RK1 A;  3M0P A;  4HVU A;  4BY6 B;  1OUL A;  1X2K A;  5FRO A;  4XTY A;  3DLM A;  3H9N A;  2GQV A;  3CPW P;  1CSK A;  3NHN A;  2EVR A;  2DRK A;  4Z8A A;  1VQ6 A;  4Y28 E;  3CCR T;  4XU0 A;  1NYG A;  3VYG A;  3RER A;  3EG1 A;  4RTZ A;  1VQ9 Q;  3JCM h;  2DL7 A;  3LYI A;  4MZM A;  1I5O B;  2K79 A;  5FWB A;  1LVK A;  4NS5 A;  4C0G A;  2OTL T;  3RNJ A;  3CCU Q;  2JNG A;  4PJO E;  1Y0M A;  3OA6 A;  4ME7 A;  5LL6 S;  2BE7 D;  3C0C A;  2J6O A;  4X1V A;  3J81 E;  3SFM A;  3QUI A;  2DTO A;  1X6O A;  4JRK A;  2RB6 A;  2PNI A;  4OVA A;  1WYX A;  3CCL A;  4J9C A;  5KYN A;  2DEU A;  3MEU A;  2D6F A;  3LH0 A;  1ZSG A;  5KCH A;  1IRE B;  3JB9 J;  4C5I A;  1PWT A;  5HCK A;  1T3L A;  2ROT A;  4QQD A;  4M78 B;  1QKW A;  1XJW B;  2GFA A;  4UC4 A;  2RHU A;  4OMQ A;  4C8Q A;  4OGC A;  1JQQ A;  4BE0 A;  4FSX A;  3UAT A;  2MCN A;  5GAN d;  3EFR A;  1I07 A;  4LUD A;  4OP0 A;  1NZ9 A;  4D6W A;  2NWM A;  3KBG A;  4PFZ A;  4VUB A;  1U8R A;  5GJW B;  2L2P A;  4M7D A;  3JB9 H;  1Q86 C;  1M9S A;  5HK0 A;  1QP3 A;  4OF1 A;  2CZ7 B;  2VKN A;  2RMO A;  3MJX A;  4M77 B;  4C0D C;  1BCM A;  2K3X A;  1K4U S;  1JJ2 S;  1K73 U;  2OTL A;  2F2V A;  2CP0 A;  1RAF B;  4PFO A;  1HK9 A;  4CC7 A;  1WX6 A;  3JCM b;  5GAN 5;  4DBQ A;  4RTT A;  2XI9 A;  3LGF A;  4X9C A;  2X3X D;  2E1H A;  3EG3 A;  4J9F A;  2DTH A;  1R8O B;  2X4J A;  4A54 A;  4OMF B;  2RHI A;  2RQT A;  2ENM A;  5GAN e;  1FWZ A;  3RKW A;  1TUD A;  5DLO A;  1S72 A;  1T3S A;  4OMN A;  4WF2 A;  1VQ8 T;  5AYF A;  2CUD A;  1WHH A;  1M2V A;  3PVL A;  1KHI A;  4KGV B;  3HRT A;  1KC8 U;  3P8H A;  4C0Z A;  1WI7 A;  4Z89 A;  1WDX A;  4E2F B;  3EG9 A;  1VQ7 T;  2DD5 A;  4C8Q B;  1WLP B;  1BIB A;  2EYW A;  3CC4 A;  5IHI A;  2P4R A;  2QXF A;  1R0B G;  3DKM A;  2ZPH B;  5M9O A;  2A3L A;  4BI3 A;  4PJO D;  2K4Y A;  3JCM f;  2QGF B;  1M30 A;  4HT8 A;  1KQS A;  3CCS T;  5GAN f;  2M02 A;  2E6N A;  1LNX A;  1QCO A;  2F2W A;  2M0Y A;  2MMP A;  1VQ8 Q;  3AT1 B;  2KI7 A;  2LJ1 A;  3TEE A;  2RJE A;  4HKE A;  2CH4 A;  1I0C A;  3HTR A;  3THK A;  4NL3 A;  1WHJ A;  4IKF A;  5CIU A;  1T0H A;  3TCJ A;  4M75 C;  5GAO m;  5IHN A;  3A8G B;  5J3B A;  1YI2 A;  3E9G A;  3EH1 A;  5GAM e;  8AT1 B;  4J83 A;  4PJO A;  2EKO A;  3G71 T;  3I5S A;  1N6A A;  2EGA A;  2BE9 B;  2YRD A;  1EIF A;  2ZAE A;  1QVG S;  1JEG A;  3G6E T;  1FMW A;  1UGP B;  1VQ7 Q;  1PC0 A;  3MEA A;  3EG9 B;  4IUR A;  4JLG A;  2P0K A;  2LT4 A;  1D0Z A;  4R55 A;  4EMH A;  1M1K U;  1WHK A;  2RM4 A;  2LJ0 A;  1W2B A;  4PJO B;  1PM3 A;  1OX8 A;  4J6W A;  3CMA A;  1WXT A;  2BZX A;  1VYV A;  2F1L A;  3OMG A;  4HVV A;  1PKT A;  4ZGJ B;  2CS7 A;  3CCJ Q;  2HDA A;  2AIR B;  1ZBJ A;  4C92 C;  4CC3 A;  3M53 A;  4M75 F;  1YJN Q;  1VIE A;  2OTJ A;  2CSI A;  3V7C A;  1O9S A;  2XID A;  1U3O A;  3HRU A;  5CCA A;  3S3M A;  2GNC A;  3V8K A;  2QEX A;  4LD9 K;  1HJD A;  2OAW A;  2X51 A;  3JCM d;  2HD0 A;  2OJ2 A;  2JJ9 A;  2L0A A;  4BE2 A;  3E19 A;  3UF4 A;  1XNI A;  2EQJ A;  2MWP A;  1UG1 A;  1UTI A;  3D7S B;  2DO3 A;  1BB9 A;  1BCO A;  5GAN h;  3PMT A;  4C8Q D;  1AHJ B;  1QWF A;  2DL3 A;  5GMK h;  1YJW Q;  1M3A A;  3JSC A;  3UPU A;  1X2Q A;  2W10 A;  2JM9 A;  1OYX A;  3QII A;  4M75 G;  4F7U B;  3ZL7 C;  4EPC A;  1XQH A;  1M3B A;  1LCK A;  2XHC A;  4M7D D;  1M2O A;  2O9S A;  5A2Q E;  2M16 A;  3QJY A;  1C1A A;  2J06 A;  5KYX A;  1QKX A;  2K57 A;  4XTV A;  4HA8 A;  2XMF A;  3CCJ A;  4JJC A;  2GTO A;  3M0U A;  4J9G A;  2ED0 A;  4D8D A;  2XDP A;  1MV3 A;  2FRY A;  4F7U F;  2NUP A;  5LJ3 e;  4DA4 A;  4JLI A;  3CCV A;  4CC2 A;  2HAX A;  4C8Q F;  5A0G A;  5IT9 E;  2OTJ Q;  5KYU B;  1IGU A;  2BTT A;  3A5Z B;  1KK7 A;  1NLP C;  1VQ7 A;  1N8R R;  1UGQ B;  2K3B A;  5I2M A;  3G4S Q;  3EGX B;  2RF0 A;  3E9F A;  1A0N B;  3GNG A;  2KK4 A;  5DY9 A;  4PJM A;  1N9S A;  3OSS C;  3HRS A;  2QQB A;  2K2V A;  3TSZ A;  4LD6 A;  3CCR Q;  2AZS A;  2JOY A;  3CCV Q;  3T9N A;  2XIC A;  4RMO A;  3HFN A;  2DK3 A;  2VAS A;  2WAC A;  3ER0 A;  3FEO A;  2KRO A;  3EGU A;  4J5Y A;  1Q82 R;  2GGR A;  5HK3 A;  2HL5 C;  2PQW A;  4K11 A;  5D6W A;  1CKA A;  4C5E A;  1RLP C;  4ZNX A;  2E10 A;  2WSE E;  1ZA1 B;  2QA4 A;  3L2R A;  1OV3 A;  4E7J A;  5I22 A;  2PVD B;  3UA7 A;  2QA4 T;  3LWH A;  3JCM c;  1VIF A;  4FT4 A;  3CPW S;  4QQG A;  1VA7 A;  4OGE A;  3MEW A;  2VXF A;  5FRN A;  1AVZ C;  2M9U A;  2NLU A;  1AZE A;  1MGQ A;  1G83 A;  4CC4 B;  3G71 Q;  1M8V A;  3H0I A;  2IPO B;  2EPD A;  1VQM T;  1ZSZ A;  1W2B S;  2R5A A;  2CDT A;  2YSQ A;  1K73 C;  1I4K 1;  5A0L A;  1KQ1 A;  2HQE A;  2GFU A;  2JN0 A;  2EYX A;  3M54 A;  4Z88 A;  1YJW A;  2DNU A;  2D9T A;  3MP6 A;  2L5Q A;  3RBB B;  2RHX A;  3GPL A;  4LN2 A;  1OU9 A;  1QVP A;  2EJF A;  1SF9 A;  1QCF A;  1WPY A;  5GAN j;  2RHZ A;  3VKI A;  2QTX A;  3CC2 T;  1TUG B;  2JTE A;  2RNA A;  3OB9 A;  5CKE A;  2QEX Q;  4FL6 A;  1CKB A;  5FU6 B;  1BI0 A;  1M1F A;  3CQT A;  4BDY A;  1ZUY A;  1SEM A;  2G6F X;  3VS7 A;  4PJJ A;  4QKU A;  2WSF E;  4J9I A;  5GAM f;  2LQ8 A;  1YJN A;  1JJ2 P;  1D0Y A;  2NUT B;  2LQW A;  4XTW A;  1YHQ T;  1K73 R;  2CYZ B;  5FWC A;  1AWX A;  1MMG A;  3LW5 E;  5KYX B;  2KYB A;  1Y57 A;  5CVI A;  4MML A;  1GCQ C;  1V29 B;  3EAE A;  3PIO A;  3CCR A;  2FEI A;  2JM8 A;  1YN8 A;  4M78 G;  4EDU A;  2K6D A;  5D6Y A;  2CP7 A;  2O2O A;  4M7A C;  2RN8 A;  4XU3 A;  2LQK A;  4O6J A;  1VQK Q;  3QYH B;  1KFZ A;  1NPR A;  3HP9 A;  2E64 A;  2O01 E;  2A37 A;  3L1A A;  1PCX A;  4F7U E;  4E7L A;  2MWO A;  1S72 Q;  4F04 B;  4RUG A;  3CME T;  3O8V A;  4F17 A;  4J9B A;  4HCZ A;  3F70 A;  4HCB A;  1D1C A;  4JPB W;  1AD5 A;  2PU9 B;  1GBR A;  2X35 A;  3CC7 Q;  2DVE A;  2FG0 A;  1H64 1;  1X6B A;  3JCM X;  3VYH B;  3LH5 A;  4LDX A;  2LDM A;  2VB6 A;  3FDR A;  3GBQ A;  3MEV A;  3MP8 A;  1QMC A;  4II1 A;  1KC8 C;  1BYM A;  5IAY A;  2O4X A;  5LJ5 d;  2VYT A;  3ZEH A;  1OOT A;  3QO3 A;  5FU7 B;  4E47 A;  2ZPF B;  4KBM B;  2LJ3 A;  4BI4 A;  3VS4 A;  3FC3 A;  2EIF A;  4M7A F;  5KYW A;  5I11 A;  4M75 B;  1N8R C;  1ZLM A;  2GF7 A;  5EG2 A;  2EQM A;  4E7K A;  3EHQ A;  2RQV A;  1VYT A;  2XG8 D;  1LPL A;  4PK4 A;  4M78 E;  2J05 A;  2HKN A;  3IQL A;  5GAN g;  2DE0 X;  2DXC A;  4PLI A;  2D8J A;  1K9A A;  2K3Y A;  3A8M B;  1VQP T;  4ELZ C;  4N0A C;  3BFM A;  1NYF A;  3I55 T;  1VQN Q;  1YWP A;  3CCE A;  1Z9Q A;  3MKD A;  1RLQ C;  1MMD A;  1B34 B;  4F7U G;  2M51 A;  3CCE T;  4C8Q G;  5FLX E;  1ZA2 B;  2C0O A;  4OMM A;  2YUP A;  4F14 A;  2LVM A;  3VU3 C;  1VQO T;  4JJD A;  2L3Q A;  2E6Z A;  1QVF S;  1AOJ A;  1HXD A;  1ZSZ C;  3QJ6 A;  2KEA A;  2RD1 A;  1ABQ A;  3OY9 A;  2RA2 A;  4XK8 E;  4C92 F;  4M7D G;  2FZC B;  4IUT A;  2GQI A;  2JMC A;  1PNJ A;  1OZ3 A;  1UJY A;  2DIQ A;  1X01 A;  2LX7 A;  2DL4 A;  1YIT T;  3RDV A;  2KXD A;  4KUD K;  3CC2 Q;  3OYY A;  2RK2 A;  3BY7 A;  1RAG B;  3CD6 Q;  1ZUU A;  3GLX A;  4GBQ A;  3OYD A;  1EFN A;  1WQ7 A;  2YT6 A;  2COZ A;  1K9M U;  2GBQ A;  2KMT A;  4E7S A;  2HSE B;  1VQ6 Q;  4M7D E;  3QZ5 B;  2KRN A;  1W4S A;  1PD1 A;  1W70 A;  1NJI U;  4AT1 B;  3VS1 A;  3M57 A;  3X20 B;  4GLK A;  1IRX A;  2DIG A;  4L5G A;  1IGQ A;  1IB8 A;  3LX7 A;  3CME A;  1FMK A;  2Z0W A;  1P92 A;  4C92 D;  3KXT A;  5J39 A;  1TUC A;  2MOX A;  2L3P A;  3SHW A;  4QVZ A;  2OX7 A;  4C8Q E;  4M7D F;  1U1T A;  4LE9 A;  2RJD A;  1QW1 A;  4ORZ A;  1VQO A;  1N9R A;  2PVG B;  1X75 C;  1M90 C;  5A0D A;  1NJI C;  2A28 A;  3NTI A;  2XK0 A;  4LUE A;  2F2X A;  2E65 A;  3OYJ A;  1KC8 R;  2DF6 A;  1YCY A;  2CT4 A;  1VQ5 Q;  2HQH A;  4ZTJ A;  3R6N A;  4DEX A;  2QG9 B;  3REA B;  5FW9 A;  4X34 A;  4MZT A;  2M0O A;  1ZX6 A;  3OYN A;  3L2W A;  3QSU A;  2LCS A;  3GF5 A;  2KGT A;  3I56 A;  1WNL A;  2J6K A;  4JDS A;  4C8Q C;  2E5Q A;  1G3Y A;  2ZGW A;  4HXJ A;  3CC7 T;  2KYM A;  2OAU A;  1PHT A;  4ZN3 A;  1KQ2 A;  3L2V A;  1GRI A;  2F5T X;  2P84 A;  2SRC A;  4M7A E;  4M7D C;  1UDL A;  4FYV B;  1FX7 A;  1E6H A;  3I55 A;  2CT3 A;  1LOJ A;  1I1J A;  2KVQ G;  3L42 A;  4JJB A;  1PD0 A;  5DM7 R;  4PLL A;  1TWB A;  3PT9 A;  2R57 A;  1JU5 C;  4Z02 A;  1UHC A;  2FPE A;  4AFQ C;  1D0X A;  1QP2 A;  2IG0 A;  3LGL A;  4L6V 5;  3UWN A;  2KRM A;  2BZY A;  3PGG A;  3NTH A;  2DL5 A;  1TG0 A;  2R5M A;  1YBY A;  5KYY A;  5IXB A;  1HSQ A;  2B86 A;  2YRV A;  5GAN 7;  3I55 Q;  1Q86 U;  2YDL A;  2X4Y A;  2DXB A;  2ZPG B;  4CRI A;  2C0I A;  5IXF A;  2KDS A;  3V7R A;  3HSB A;  1SKU B;  1MV0 B;  3QDR B;  1C6V X;  3CD6 A;  3RKY A;  3RUX A;  2DRM A;  1MNE A;  2QYZ A;  4A53 A;  3UA6 A;  4AFZ C;  2K5I A;  3JRZ A;  3OBW A;  2CKK A;  1G8X A;  3OYK A;  3CCU A;  1M8M A;  2JT4 A;  2BUD A;  1SHG A;  2DA9 A;  4E7I A;  2A7Y A;  1WHL A;  1KIK A;  2WSC E;  4RTY A;  2FZK B;  1SSF A;  1E6G A;  5LJ5 h;  2QDL A;  1VQ5 A;  3X25 B;  5CKF A;  2KT8 A;  1UFF A;  3QDF A;  3M4G A;  4X9D A;  1GCQ A;  5KE2 A;  1WHM A;  2NUZ A;  4FSS A;  4AG1 C;  1IHW A;  4E7H A;  2LMJ A;  3NGP A;  2FPF A;  2RQR A;  3I35 A;  2E70 A;  1Q95 G;  3ZFJ A;  4FM4 B;  4N4I A;  3V7S A;  4EMK C;  1UEB A;  3VUB A;  3VS6 A;  5CAI A;  3CXC S;  5GJV B;  2KQW A;  6AT1 B;  1M27 C;  2DFU A;  2F69 A;  3INZ A;  3H0H A;  4M75 A;  1Y07 A;  1KHC A;  3OYH A;  4KGX B;  3R6O A;  4QQ6 A;  1JXO A;  4XU1 A;  3MHX A;  2RQW A;  5GAM j;  4DEY A;  2J6F A;  1M90 U;  2C0T A;  2DYB A;  1H3Z A;  3CBP A;  3TU4 K;  3X24 B;  3RMQ A;  3SWN C;  4PL6 A;  2PUO B;  3CBM A;  4EMK A;  3CC2 A;  1K0S A;  2QDY B;  1QWE A;  1GFC A;  1VQM A;  2DYI A;  3VRZ A;  1MND A;  3P8B B;  2CZ0 B;  4QVD A;  1O75 A;  4J7F A;  2AKK A;  2LNV A;  4M77 D;  4HVW A;  1YIJ T;  4FW2 A;  4N4H A;  3S3O A;  1B34 A;  2B8A A;  4JRI A;  2QGG A;  5CK9 A;  1NE8 A;  1NJI R;  2HEQ A;  3OMC A;  1Q7Y C;  4ANJ A;  1SG5 A;  3L2Z A;  3L2Q A;  3CME Q;  2LRQ A;  2JW4 A;  3C95 A;  1KD1 U;  1QVF A;  1NG2 A;  1WIE A;  2CP5 A;  5GAM d;  1BI1 A;  2HNI A;  3M59 A;  1VQ5 T;  2ESW A;  3QBY A;  1MHN A;  2XD0 A;  1KD1 C;  3AHU A;  2MYS A;  1VQK T;  4ZGE B;  3OYL A;  1UJ0 A;  1FMV A;  1AZG B;  2AZV A;  4AMC A;  5HY6 A;  1TXQ A;  2KT1 A;  1VQK A;  3OS5 A;  4M78 D;  3CCU T;  4R0K A;  2VUB A;  3CCQ Q;  3I9Q A;  2ECZ A;  4M77 F;  4ZGD B;  1K8A C;  3CXC A;  2FPD A;  2AHJ B;  3E2U A;  2DXU A;  2HL3 A;  4M77 G;  3A8H B;  2KY9 A;  5KE3 A;  3O5Z A;  2XU8 A;  3M0R A;  4J9D A;  5CKB A;  1IHV A;  2DXT A;  4FYW B;  1KQS P;  2E4H A;  1X6G A;  2VXE A;  1M5Q 1;  3LLR A;  3UT1 A;  4IUQ A;  4A4G A;  2D1X A;  2EQK A;  2QAZ A;  2P0Q A;  1VQ4 A;  2QAS A;  5CR2 A;  5FU7 C;  4KGZ B;  4WCI A;  5CQX A;  4FW1 A;  1D3B A;  4J8O A;  2GTJ A;  4BI8 B;  3RES A;  1JBM A;  4M78 F;  3EGD B;  1I8F A;  2RH2 A;  4ESR A;  1QVG A;  3VUZ A;  5KCO A;  1SSH A;  2QQR A;  2LT1 A;  3BDL A;  5LJ5 f;  1ZUK A;  1TH7 A;  1RAH B;  4JZ4 A;  3FJ5 A;  2HBP A;  4IUV A;  3FLG A;  3UDC A;  2YUN A;  2QK0 A;  3PE0 A;  2L3S A;  2HCK A;  3WVE B;  1UGR B;  5L8R E;  3CCV T;  1ZHI A;  4B9X A;  3CCE Q;  2VWF A;  5DLQ E;  5GAO r;  3H41 A;  1MUZ A;  2H3E B;  3A8L B;  4BY6 C;  2F5K A;  3MCA B;  4MDX A;  4HCC A;  4FYX B;  1VQL T;  1W2B P;  3CCJ T;  1NBE B;  3NPF A;  2R58 A;  2EQI A;  3JCM V;  2K5L A;  1EX4 A;  1TOV A;  3S6W A;  3HHT B;  1VUB A;  3G7Z A;  2EBP A;  2CP3 A;  3CCS A;  4XQ3 A;  1PSF A;  1UEC A;  2KSS A;  3URG A;  4LXC A;  5GMK l;  2EKH A;  2KNB B;  4M7D B;  2GCX A;  5GAN 3;  3CC4 T;  3OYC A;  1YJ9 A;  1YIJ Q;  3REB B;  3GP8 A;  3CD6 T;  2RQU A;  3VRY A;  1YWO A;  4OMO A;  2RO0 A;  1X69 A;  2HZY A;  2QI2 A;  2LP5 A;  2EGC A;  2FO0 A;  3JV3 A;  1NM7 A;  3VS0 A;  1NEB A;  4A63 B;  2O88 A;  2MK5 A;  2CH4 W;  2E5K A;  5LJ3 j;  2CP2 A;  1Q82 C;  3JCM W;  4IUP A;  1RAI B;  2LQN A;  4CI0 C;  1SHF A;  2CZ1 B;  2FB7 A;  2FHD A;  2E41 A;  3V8L A;  2OTJ T;  4P5N A;  1VQL Q;  1M1K C;  2HMA A;  2BZ8 A;  5KYU A;  4N0A A;  1YIT A;  2E3H A;  1S1N A;  2RHY A;  3G71 A;  3KFV A;  2VGN A;  2K5F A;  2AKL A;  1K76 A;  2NUP B;  4R56 A;  2VGM A;  1UGS B;  4DBR A;  1VQP Q;  2LC4 A;  4JS4 A;  4DBH A;  4DOV A;  5GMK e;  2I2L A;  5KYY B;  2DAQ A;  2X4X A;  3VJP A;  1RAD B;  2V1Q A;  2ZPE B;  3EFS A;  3MPU B;  5LJ5 g;  3CC7 A;  2RI5 A;  4C0F A;  1Q82 U;  4JJN K;  4EMK B;  2FYK A;  1R77 A;  2KRS A;  4LDU A;  3G6E A;  1YHQ Q;  2YHT A;  2NYS A;  1YP5 A;  3PNW C;  1R0C B;  2DPP B;  3VS2 A;  2LZ6 B;  4RTW A;  4XTX A;  2FVU A;  4RTU A;  1VQ4 Q;  5GAM g;  1FXX A;  4HT9 A;  2X4W A;  4J6Y A;  3CXC P;  2ABL A;  1YI2 T;  1D1A A;  1IO6 A;  2JUF A;  3OYB A;  5CKD A;  1SRL A;  2QTV A;  1VQP A;  4PKC C;  1H3H A;  1D09 B;  2KR3 A;  3OYM A;  1BIA A;  4MMK A;  1V76 A;  3PTA A;  3CPF A;  4AFS C;  4M78 A;  3OYG A;  1PRM C;  2LX9 A;  4C5G A;  2AT1 B;  1Q86 R;  3NFC A;  2YXY A;  3ME9 A;  1VOM A;  5FU6 C;  1M1K R;  3N5B B;  4LNP A;  4B6M A;  2EJ9 A;  3FB9 A;  1YJ9 Q;  2KBT A;  4E7Z A;  2W0Z A;  2V8J A;  1Y71 A;  3C12 A;  1NLO C;  4F16 A;  4RTX A;  1YJ9 T;  2DEQ A;  1BI3 A;  1ABO A;  2XKO C;  2ZPI B;  3J80 E;  2X3W D;  5CO7 A;  3A98 A;  5D6X A;  2QA4 Q;  1ZBX A;  3TSW A;  2KXC A;  4EMG A;  4PJO F;  1D3B B;  1QCN A;  1VQ8 A;  1K9M R;  4KUL A;  5GAO l;  3M58 A;  1WXB A;  3M9Q A;  2PUK B;  3S3N A;  3G6E Q;  1YHQ A;  2YLB A;  1JRI A;  4M7A A;  2VVK A;  4BE1 A;  1VQL A;  4HCK A;  1WXU A;  4E6R A;  3OYE A;  3G1J A;  4KH0 B;  5GAN 8;  3OBY A;  3M0T A;  2Y4X A;  4C0D B;  3A8O B;  1QVG P;  2KAF A;  3SB2 A;  4A4E A;  1OU8 A;  2DX1 A;  2V8K A;  5EC7 A;  2EYY A;  3M0S A;  5GAO n;  2I0N A;  4Y92 A;  4BUG A;  3C4S A;  2L89 A;  2EYQ A;  2LNH B;  3I5R A;  2RJC A;  1M1G A;  5GMK j;  3G4S A;  1XOV A;  2Y90 A;  2COY A;  1LJO A;  2O31 A;  2JXB A;  2RI3 A;  4NL2 A;  4PJL A;  4J6X A;  2C06 A;  4M4Z A;  2JS2 A;  4OB1 B;  1VQ9 T;  1T0J A;  1OX9 A;  1Z9Z A;  2YUQ A;  4PJO C;  1UE9 A;  2D8H A;  1JJ2 A;  3NMZ C;  4EIK A;  4PNO A;  1GCP A;  3OYI A;  1VQ4 T;  4M77 E;  2NUT A;  1G5V A;  2HSP A;  1AT1 B;  1C0M A;  1TSF A;  5GMK m;  4IUU A;  3NTK A;  5GAN 4;  1W6X A;  4RG2 A;  4Y91 A;  1SRM A;  2D0N A;  2A08 A;  3M55 A;  4M75 D;  4LDW A;  3MP1 A;  1YIT Q;  3BDU A;  4QT7 A;  4F7U A;  8ATC B;  3J7A F;  2D0Q B;  3EGX A;  3GIB A;  1BI2 A;  1W1F A;  1U1S A;  4C92 A;  4Q5W A;  3TVT A;  4BB7 A;  1ACM B;  3QYG B;  3DB3 A;  3RIR A;  2OI3 A;  4LDV A;  2V26 A;  4RCC A;  4AFU C;  4M77 C;  1ZQ1 A;  1Y7X A;  2ZCF B;  1M3C A;  1BU1 A;  3WXM B;  1RAC B;  1YNZ A;  5LJ3 f;  2ED1 A;  1YCS B;  1G3W A;  5GAN 6;  1RUW A;  4M7A B;  2COW A;  2V8I A;  5C6S A;  2A36 A;  3PIP A;  1JXM A;  1YIJ A;  1Q81 U;  4J7I A;  5I21 A;  4DQ2 A;  1WA7 A;  5IH2 A;  2QQS A;  2EJG A;  1KD1 R;  5J26 A;  1OPL A;  5CKH A;  3JAM E;  1PKS A;  3ASK A;  4M78 C;  4M7A G;  4L59 A;  1UUE A;  4YTL A;  4DOW A;  2BKD N;  2DMO A;  1YJN T;  1RAA B;  1QQJ A;  1B3Q A;  5KYW B;  3CC4 Q;  1QLY A;  2DM1 A;  1Q7Y R;  4OB2 B;  1GBQ A;  2DD4 A;  3Q1J A;  1Q7Y U;  5LJ3 g;  4B9W A;  5L23 A;  1J3T A;  2VC8 A;  5LJ5 e;  1M4Z A;  1GFD A;  2QQA A;  4BAC A;  3SWN A;  4JUV A;  3PFS A;  4RCB A;  2EQU A;  4XTU A;  3M56 A;  4OML A;  2KE9 A;  3QZ9 B;  1G2B A;  4ELY C;  5ECA A;  2PTK A;  4JRP A;  2CZ6 B;  2EYZ A;  4FT2 A;  3M5A A;  4XU2 A;  3EFO A;  3PMI A;  2HKQ B;  4FU6 A;  3EG2 A;  1YJW T;  1RI9 A;  3SWN B;  3FIF A;  4J9H A;  4KUI A;  3X28 B;  2YRC A;  3CCL Q;  2M1H A;  1E7O A;  3SDZ A;  3E1S A;  3GOX A;  3CCM A;  2CUB A;  4IIM A;  3HL8 A;  4MZP A;  3QWY A;  1NEG A;  1BKB A;  1Q81 C;  3QG1 A;  1I81 A;  3JCM Q;  3FJP A;  2LCC A;  3QXE B;  2OTL Q;  3BE3 A;  1JO8 A;  5GAM h;  1ARK A;  1TU0 B;  3H0F A;  5GAO p;  5LJ3 d;  2P4T A;  1DJ7 B;  3EH2 A;  2MPX C;  4FIB A;  1RAB B;  2DET A;  3EFO B;  3VS3 A;  4M75 E;  3DB4 A;  1K9M C;  4FCY A;  1VQN T;  1H92 A;  1RAE B;  3M0Q A;  4GY5 A;  3OSV A;  3KUF A;  2IIM A;  4JS5 A;  2DLP A;  3A1P A;  2DKG A;  3CCQ A;  1WJQ A;  2DER A;  3MET A;  4M77 A;  2X9H A;  3QKJ A;  3HPW A;  1V1C A;  3OS0 A;  3ZBD A;  2QEX T;  2L3R A;  4JRQ A;  5GAN 2;  1K1Z A;  1UB4 A;  4C92 B;  3PVQ A;  1N5Z A;  3RR6 A;  3CCQ T;  3CPW A;  2EW3 A;  3SEM A; 
#chains in the Genus database with same CATH homology
 2RJE A;  3CD6 T;  2LVM A;  4HKE A;  3VU3 C;  1WJS A;  1VQO T;  2RO0 A;  2E6Z A;  4NL3 A;  2QI2 A;  1QVF S;  4QVC A;  1HXD A;  4IKF A;  1NPP A;  1IZ6 A;  5CIU A;  3QJ6 A;  5C0M A;  3JCM e;  4ZTF A;  2RD1 A;  3OY9 A;  1Y96 B;  3JCM g;  2RA2 A;  4XK8 E;  3TCJ A;  4C92 F;  4M7D G;  4V2S A;  4IUT A;  2LCL A;  4M75 C;  3CMA T;  5GAO m;  3A8G B;  5J3B A;  5LJ3 j;  1OZ3 A;  1YI2 A;  1Q82 C;  3E9G A;  2DIQ A;  3JCM W;  4IUP A;  4OB0 B;  1X01 A;  2RJF A;  2DTI A;  5GAM e;  4J83 A;  4PJO A;  1YIT T;  4NOY A;  4KUD K;  4CI0 C;  1H3Z A;  2EKO A;  3G71 T;  2EAY A;  3OYY A;  1KQS S;  2RK2 A;  1N6A A;  3BY7 A;  2JTM A;  2CZ1 B;  5LJ3 h;  2XDD A;  2FB7 A;  3CBO A;  3LWI A;  1EIF A;  3I56 T;  2E12 A;  2FHD A;  2E41 A;  3GLX A;  3OYD A;  1QVG S;  3V8L A;  4C92 E;  3G6E T;  2OTJ T;  1UGP B;  4P5N A;  1WQ7 A;  3L2U A;  1M1K C;  3MEA A;  4N4G A;  1K9M U;  3P8D A;  4IUR A;  4JLG A;  2KMT A;  2P0K A;  2LT4 A;  4N0A A;  1YIT A;  3JCM P;  4M7D E;  3RKX A;  2ZPB B;  4EMH A;  4R55 A;  1M1K U;  3QZ5 B;  2RHY A;  1W4S A;  2RM4 A;  1NJI U;  3G71 A;  1W2B A;  4PJO B;  1KG1 A;  3M57 A;  3X20 B;  3OW2 A;  4GLK A;  1N8R U;  2DIG A;  1XTD A;  4L5G A;  2VGN A;  4J6W A;  1WQW A;  3CMA A;  1G3S A;  3OYF A;  2K5F A;  3LX7 A;  3CME A;  4R56 A;  4C92 D;  1P92 A;  2VGM A;  3VV0 A;  3OMG A;  3KXT A;  1QVF A;  1UGS B;  5J39 A;  2LC4 A;  4JS4 A;  5KH6 A;  4DOV A;  5GMK e;  2I2L A;  4ZGJ B;  2DAQ A;  2X4X A;  3VJP A;  2CS7 A;  2ZPE B;  3EFS A;  3CEY A;  5LJ5 g;  4QVZ A;  4C8Q E;  3CC7 A;  2RI5 A;  4C0F A;  4C92 C;  3JCM J;  3M53 A;  4JJN K;  1Q82 U;  1U1T A;  4M75 F;  4M7D F;  2RJD A;  3TRE A;  4EMK B;  1QW1 A;  1VIE A;  2FYK A;  1GXI E;  4LDU A;  3G6E A;  2OTJ A;  2YHT A;  1VQO A;  1N9R A;  2PVG B;  1X75 C;  3WVD B;  4XTZ A;  3V7C A;  3PNW C;  1O9S A;  2DPP B;  2XID A;  5A0D A;  1NJI C;  1M90 C;  5CCA A;  3HRU A;  3NTI A;  4XTX A;  2XK0 A;  5HKC A;  3S3M A;  3OW2 S;  2FVU A;  2O4X B;  2E65 A;  4BD3 A;  3JB9 I;  3OYJ A;  3V8K A;  2XDB A;  1YCY A;  2QEX A;  3TU4 K;  5GAM g;  4BDZ A;  1FXX A;  4LD9 K;  4ZTJ A;  4HT9 A;  1Y96 A;  4RKU E;  2X4W A;  4J6Y A;  3JCM d;  1YI2 T;  2HD0 A;  4C92 G;  2JUF A;  3OYB A;  4BE2 A;  4X34 A;  4MZT A;  2M0O A;  3E19 A;  5CKD A;  1XNI A;  1S72 T;  3OYN A;  3L2W A;  1K8A U;  3QSU A;  2EQJ A;  3DLL A;  1VQP A;  4PKC C;  1OZ2 A;  2MWP A;  3GF5 A;  2DJZ A;  3I56 A;  3OYM A;  1WNL A;  4JDS A;  5FRM A;  1BIA A;  4MMK A;  2DO3 A;  2E5Q A;  1G3Y A;  4C8Q C;  3OS2 A;  4M7A D;  2JTF A;  5GAN h;  2ZGW A;  3PTA A;  3CPF A;  4M78 A;  3CC7 T;  2MI6 A;  3PMT A;  5GAO q;  2OAU A;  3OYG A;  4C8Q D;  4RG8 A;  1AHJ B;  4ZN3 A;  5GMK h;  2LX9 A;  3JSC A;  2G3R A;  3UPU A;  2DZC A;  4C5G A;  3L2V A;  1KQ2 A;  3RMS A;  3X26 B;  2BIV A;  5CQY A;  2F5T X;  2QQ9 A;  3GNF B;  3NFC A;  4M7A E;  3ME9 A;  4M7D C;  1OYX A;  3QII A;  5FU6 C;  4M75 G;  4F7U B;  4EPC A;  3N5B B;  1FX7 A;  1XQH A;  3C94 A;  3I55 A;  2PVO B;  2EJ9 A;  3FB9 A;  2XHC A;  3OQ5 A;  1JB0 E;  1LOJ A;  4M7D D;  2KVQ G;  5A2Q E;  3L42 A;  2M16 A;  3M4Y A;  4O5V A;  2V8J A;  5DM7 R;  3QJY A;  1Y71 A;  3C12 A;  4PLL A;  1YJ9 T;  2K57 A;  3PT9 A;  3HKS A;  2DEQ A;  1BI3 A;  4HA8 A;  4XTV A;  2R57 A;  3CCJ A;  4ATO A;  2XKO C;  2ZPI B;  4Z02 A;  1VQN A;  5IN1 A;  5GMK i;  2IVW A;  3J80 E;  2XDP A;  4C5H A;  1QP2 A;  2IG0 A;  3LGL A;  4L6V 5;  3UWN A;  4F7U F;  2HQX A;  5CO7 A;  5LJ3 e;  3PGG A;  5D6X A;  3V8J A;  4DA4 A;  3NTH A;  1ZBX A;  4JLI A;  3CCV A;  4XAX B;  3FRN A;  4A4K A;  2HAX A;  2R5M A;  4C8Q F;  2MF2 A;  4EMG A;  4PJO F;  1D3B B;  1YBY A;  2YRV A;  4LDY A;  3BW1 A;  1RI0 A;  1VQ8 A;  4KUL A;  5GAN 7;  5GAO l;  1Q86 U;  5A0G A;  3M58 A;  3H6Z A;  5IT9 E;  3M9Q A;  2PUK B;  3S3N A;  4A4H A;  1YHQ A;  2X4Y A;  2DXB A;  2ZPG B;  2YLB A;  1JRI A;  4CRI A;  1I5L A;  4M7A A;  1G3T A;  2KDS A;  3A5Z B;  3V7R A;  3MO8 A;  4BE1 A;  3OYA A;  1VQ7 A;  1VQL A;  3HFO A;  3HSB A;  2MAM A;  1UGQ B;  2LTO A;  3OYE A;  3QDR B;  2EFI A;  2L8D A;  5I2M A;  5LJ5 j;  5GAN 8;  3CD6 A;  3H8Z A;  1OI1 A;  3OBY A;  2P0P A;  2H3J A;  3E9F A;  3RKY A;  2Y4X A;  4A4F A;  4C0D B;  2FL7 A;  3A8O B;  3RUX A;  3JB9 D;  2KAF A;  3CCM T;  3GNG A;  3SB2 A;  2KK4 A;  4A4E A;  4A53 A;  5DY9 A;  2K5I A;  1N9S A;  2VV5 A;  2V8K A;  2CGH A;  3OSS C;  3HRS A;  2QQB A;  2K2V A;  3QHS A;  1WGS A;  3JRZ A;  3OBW A;  4LD6 A;  2CKK A;  2JOY A;  4PJO G;  5GAO n;  3OYK A;  3T9N A;  3CCU A;  4BUG A;  3C4S A;  2L89 A;  2XIC A;  2EYQ A;  4RMO A;  2BUD A;  3HFN A;  2Y4Y A;  1VQ9 A;  2DK3 A;  4E7I A;  2A7Y A;  4ZN1 A;  2RJC A;  1M1G A;  5GMK j;  3G4S A;  1XOV A;  2WSC E;  2WAC A;  2Y90 A;  1LJO A;  3ER0 A;  3FEO A;  4J5Y A;  1SSF A;  2RI3 A;  2DZ9 A;  4NL2 A;  5LJ5 h;  5HK3 A;  3G4S T;  2PQW A;  4KT0 E;  3SD4 A;  1WJR A;  3QPH A;  5D6W A;  2YLC A;  4J6X A;  4C5E A;  3X25 B;  4OB1 B;  1VQ9 T;  1VQ5 A;  2C06 A;  2RI2 A;  4MDW A;  5CKF A;  4QW2 A;  2E10 A;  4PJO C;  1RL2 A;  3OS1 A;  4OB3 B;  2WSE E;  1N27 A;  3M4G A;  1JJ2 A;  4X9D A;  4PNO A;  3CCL T;  2QA4 A;  3L2R A;  2ZZD A;  1KD1 U;  1PSE A;  5KE2 A;  4E7J A;  2PVD B;  3JB9 F;  2JVV A;  4E7H A;  3OYI A;  1VQ6 T;  2QA4 T;  1VQ4 T;  3JB9 G;  2E70 A;  2JZ2 A;  4M77 E;  3ZFJ A;  2EWN A;  3JCM c;  4FM4 B;  4TVR A;  5I2S A;  1VIF A;  4N4I A;  2RK1 A;  3LWH A;  4FT4 A;  3CPW S;  1G5V A;  3V7S A;  4EMK C;  1UEB A;  4QQG A;  3VUB A;  4OGE A;  4BY6 B;  3MEW A;  2VXF A;  5CAI A;  5GMK m;  3CXC S;  5FRN A;  2M9U A;  3NTK A;  4IUU A;  2KQW A;  5GAN 4;  2NLU A;  5FRO A;  4RG2 A;  4XTY A;  3DLM A;  4Y91 A;  1MGQ A;  2GQV A;  2F69 A;  3INZ A;  3M55 A;  4M75 D;  4M75 A;  1Y07 A;  4LDW A;  1M8V A;  1KHC A;  3OYH A;  3MP1 A;  1VQ6 A;  3BDU A;  3R6O A;  1VQM T;  4F7U A;  3J7A F;  1W2B S;  4QQ6 A;  2D0Q B;  2R5A A;  4Y28 E;  3GIB A;  4XU1 A;  3CCR T;  1K73 C;  1I4K 1;  3MHX A;  5A0L A;  1KQ1 A;  2HQE A;  1BI2 A;  4XU0 A;  1U1S A;  2GFU A;  2JN0 A;  4C92 A;  4Q5W A;  5GAM j;  3VYG A;  4BB7 A;  1M90 U;  3QYG B;  3M54 A;  3DB3 A;  3RER A;  1YJW A;  3RIR A;  3JCM h;  3LYI A;  2D9T A;  3CBP A;  4MZM A;  3X24 B;  4NS5 A;  4LDV A;  4PL6 A;  3RMQ A;  2PUO B;  3CBM A;  3SWN C;  4C0G A;  2OTL T;  3MP6 A;  4RCC A;  4EMK A;  3CC2 A;  2L5Q A;  2QDY B;  1VQM A;  4M77 C;  2JNG A;  4PJO E;  3OA6 A;  1ZQ1 A;  4ME7 A;  5LL6 S;  2RHX A;  3P8B B;  3GPL A;  1Y7X A;  2CZ0 B;  4QVD A;  1O75 A;  2ZCF B;  4J7F A;  1QVP A;  2EJF A;  2LNV A;  4M77 D;  1YIJ T;  1WPY A;  5GAN j;  3J81 E;  4N4H A;  2RHZ A;  3QUI A;  1B34 A;  2B8A A;  4JRI A;  3SFM A;  2DTO A;  3VKI A;  3WXM B;  2QTX A;  1X6O A;  4JRK A;  5CK9 A;  5LJ3 f;  2RB6 A;  3CC2 T;  1NE8 A;  4OVA A;  3OMC A;  1Q7Y C;  1G3W A;  3OB9 A;  3CCL A;  5CKE A;  3MEU A;  4FL6 A;  3L2Z A;  1BI0 A;  5FU6 B;  2LRQ A;  5GAN 6;  1M1F A;  3C95 A;  3L2Q A;  3LH0 A;  4BDY A;  4M7A B;  2D6F A;  5KCH A;  2V8I A;  1IRE B;  3JB9 J;  5C6S A;  4C5I A;  3PIP A;  5GAM d;  1BI1 A;  1YIJ A;  2HNI A;  3M59 A;  4J7I A;  1Q81 U;  5I21 A;  2WSF E;  1VQ5 T;  3QBY A;  4DQ2 A;  1MHN A;  2XD0 A;  2QQS A;  2EJG A;  5GAM f;  1KD1 C;  2LQ8 A;  4QQD A;  5J26 A;  1YJN A;  5CKH A;  3JAM E;  4M78 B;  3ASK A;  2GFA A;  4M78 C;  1VQK T;  4ZGE B;  3OYL A;  3AHU A;  4UC4 A;  2RHU A;  4M7A G;  4L59 A;  4XTW A;  5HY6 A;  1YHQ T;  4YTL A;  2CYZ B;  4DOW A;  2BKD N;  1VQK A;  4C8Q A;  3OS5 A;  1YJN T;  3LW5 E;  4OGC A;  4BE0 A;  4M78 D;  3CCU T;  2VUB A;  4FSX A;  5CVI A;  4MML A;  1V29 B;  3EAE A;  4OB2 B;  3PIO A;  4M77 F;  2DD4 A;  3Q1J A;  4ZGD B;  3CXC A;  3CCR A;  1Q7Y U;  1K8A C;  2AHJ B;  2DXU A;  5LJ3 g;  4B9W A;  4M77 G;  3A8H B;  2KY9 A;  3EFR A;  5KE3 A;  5GAN d;  2VC8 A;  4OP0 A;  2XU8 A;  5LJ5 e;  1M4Z A;  1NZ9 A;  4M78 G;  3KBG A;  4D6W A;  4VUB A;  5D6Y A;  4EDU A;  1U8R A;  2QQA A;  4BAC A;  3SWN A;  4M7A C;  5CKB A;  4JUV A;  4M7D A;  3PFS A;  3JB9 H;  4RCB A;  1Q86 C;  2EQU A;  4XU3 A;  2LQK A;  1M9S A;  4O6J A;  5HK0 A;  1QP3 A;  2DXT A;  4XTU A;  3M56 A;  4OF1 A;  2CZ7 B;  3QZ9 B;  3LLR A;  2VXE A;  1M5Q 1;  3UT1 A;  4M77 B;  3QYH B;  1NPR A;  4IUQ A;  4ELY C;  4JRP A;  3HP9 A;  2CZ6 B;  4A4G A;  2EQK A;  4C0D C;  2E64 A;  2O01 E;  2P0Q A;  3L1A A;  4FT2 A;  1VQ4 A;  3M5A A;  4F7U E;  4XU2 A;  2K3X A;  5CR2 A;  4E7L A;  2MWO A;  5FU7 C;  3CME T;  3O8V A;  5CQX A;  1JJ2 S;  3PMI A;  1K73 U;  1D3B A;  2OTL A;  4HCZ A;  3F70 A;  4FU6 A;  4J8O A;  1YJW T;  3SWN B;  4HCB A;  3FIF A;  4KUI A;  4BI8 B;  3RES A;  1HK9 A;  1JBM A;  2PU9 B;  4M78 F;  3X28 B;  3JCM b;  2X35 A;  1I8F A;  2RH2 A;  2M1H A;  5GAN 5;  2DVE A;  1QVG A;  1H64 1;  2XI9 A;  3VUZ A;  3SDZ A;  3LGF A;  3E1S A;  3JCM X;  3VYH B;  4X9C A;  5KCO A;  3GOX A;  2E1H A;  2QQR A;  2LDM A;  3CCM A;  4LDX A;  3FDR A;  3HL8 A;  3MEV A;  4MZP A;  3MP8 A;  2LT1 A;  3BDL A;  4II1 A;  5LJ5 f;  2DTH A;  1R8O B;  1KC8 C;  2X4J A;  4A54 A;  4OMF B;  1BYM A;  1BKB A;  1TH7 A;  2O4X A;  2RHI A;  5IAY A;  5LJ5 d;  1Q81 C;  2VYT A;  3QG1 A;  1I81 A;  3ZEH A;  5GAN e;  3FJP A;  2LCC A;  1FWZ A;  3RKW A;  3JCM Q;  3QXE B;  3QO3 A;  5FU7 B;  4E47 A;  2HBP A;  5DLO A;  4IUV A;  3FLG A;  3UDC A;  2ZPF B;  1S72 A;  4KBM B;  5GAM h;  4BI4 A;  3FC3 A;  3WVE B;  5GAO p;  2EIF A;  4WF2 A;  5LJ3 d;  1UGR B;  1VQ8 T;  5AYF A;  2P4T A;  1DJ7 B;  3S3O A;  4M7A F;  5L8R E;  4M75 B;  1N8R C;  3CCV T;  1ZHI A;  4FIB A;  2GF7 A;  4B9X A;  1KHI A;  5EG2 A;  3HRT A;  2EQM A;  5DLQ E;  4E7K A;  5GAO r;  3A8L B;  4BY6 C;  1KC8 U;  4M75 E;  3DB4 A;  2F5K A;  3MCA B;  4MDX A;  3P8H A;  4C0Z A;  2XG8 D;  1K9M C;  4HCC A;  1VQN T;  4M78 E;  5GAN g;  1VQ7 T;  1VQL T;  2DD5 A;  2DXC A;  4GY5 A;  3OSV A;  4PLI A;  3CCJ T;  3KUF A;  4C8Q B;  4JS5 A;  2R58 A;  3JCM V;  2K3Y A;  2K5L A;  3A8M B;  1VQP T;  1BIB A;  4ELZ C;  3S6W A;  2DKG A;  3CCQ A;  3HHT B;  1VUB A;  1WJQ A;  3BFM A;  3G7Z A;  3MET A;  4N0A C;  3CC4 A;  3CCS A;  4M77 A;  2QXF A;  4XQ3 A;  3I55 T;  1PSF A;  3CCE A;  3DKM A;  2ZPH B;  3QKJ A;  5M9O A;  2KSS A;  3HPW A;  3OS0 A;  2A3L A;  3ZBD A;  4BI3 A;  2QEX T;  2K4Y A;  4PJO D;  3URG A;  1B34 B;  3JCM f;  4F7U G;  2L3R A;  5GMK l;  4JRQ A;  5GAN 2;  3CCE T;  4M7D B;  1UB4 A;  2GCX A;  5GAN 3;  4HT8 A;  1KQS A;  3CCS T;  4C8Q G;  4C92 B;  5GAN f;  5FLX E;  2E6N A;  3CC4 T;  1LNX A;  3OYC A;  2MMP A;  3CCQ T;  1YJ9 A;  3CPW A;  3GP8 A;  3TEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...