2EQKA

Solution structure of the tudor domain of tudor domain-containing protein 4
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
GSSGSSGMIAAYENSKWEPVKWENDMHCAVKIQDKNQWRRGQIIRMVTDTLVEVLLYDVGVELVVNVDCLRKLEENLKTMGRLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Tudor domain-containing protein 4
publication title Solution structure of the TUDOR domain of Tudor domain-containing protein 4
rcsb
source organism Homo sapiens
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqkA01
1MHNA 2O4XA 4QVZA 2X4XA 5KCHA 2R58A 2EFIA 2RJCA 3P8DA 4PLLA 5D6WA 3FLGA 3MO8A 3NTIA 4B9XA 5D6XA 2EKOA 3OS0A 2RJDA 2EQUA 3QJ6A 4IKFA 3ZEHA 1G5VA 3EAEA 4C5IA 1RI0A 4N4IA 3NTHA 1OYXA 2LVMA 2LRQA 3ASKA 3DB4A 2DAQA 3MP1A 3LYIA 4IURA 5FRNA 3QKJA 3OY9A 5FROA 2X4WA 3FC3A 2RHUA 3PFSA 4C5EA 3O8VA 4C5HA 2HQEA 2K3XA 3PMIA 4HCZA 4OVAA 1OZ2A 3OMGA 3OYFA 4EDUA 2RJEA 1KHCA 2LTOA 4ZTFA 3OYAA 2E5QA 4E7HA 4IUPA 4IUTA 4BDZA 2M16A 3L2RA 2F5KA 3OYBA 3OYJA 3LGFA 3H8ZA 4L59A 4E7LA 3OQ5A 3LX7A 1WJRA 2EQMA 4E7KA 5D6YA 2IG0A 4FL6A 2L8DA 2XK0A 4QQDA 4Z02A 3SD4A 2RHIA 3OYNA 4UC4A 2HQXA 3MEWA 4E7JA 2EQJA 4X34A 2DIGA 4N4GA 3OYIA 3FDRA 4BE0A 3H6ZA 3QBYA 4NS5A 3OYHA 2L89A 2JZ2A 3S6WA 3UWNA 4A4GA 3F70A 4BD3A 3OA6A 3S3OA 1N27A 3Q1JA 2R5MA 2RHYA 1XNIA 3OS1A 1SSFA 3QIIA 4Q5WA 5CIUA 3OMCA 1WGSA 2RJFA 2X4YA 3OYCA 3L2VA 4E7IA 3P8HA 4A4FA 2LDMA 2M1HA 3MEAA 3M9QA 2O4XB 2NLUA 3GOXA 3DLMA 1OZ3A 1H3ZA 2WACA 2P0KA 4QW2A 5FRMA 2LCCA 2QQSA 4BDYA 2RO0A 3C4SA 3NTKA 1OI1A 2XDPA 3S3MA 2RI5A 2G3RA 2DIQA 4BACA 3L42A 3LH0A 2RHZA 2EQKA 3PNWC 4N4HA 3OYLA 3PMTA 3UT1A 2GFUA 3L2WA 4BE2A 4IUUA 2R57A 5C6SA 3OYDA 2MWPA 3CEYA 3MEUA 4LD6A 3DB3A 2FHDA 3L2UA 2GF7A 4A4EA 3OB9A 5IN1A 4IUVA 4IUQA 4FU6A 4GY5A 5J26A 2RI3A 3FEOA 5C0MA 5M9OA 2JTFA 2R5AA 2CKKA 3MEVA 3OYMA 3BDLA 4RG2A 4PLIA 4II1A 2YRVA 5KCOA 2E6NA 2RHXA 4PL6A 3LGLA 2RI2A 2MWOA 4BE1A 3MP8A 2X35A 3S3NA 3OYGA 2K3YA 2M0OA 2B8AA 2BIVA 2GFAA 3OYKA 2QQRA 1WJSA 3E9GA 3ME9A 5KE3A 4QQGA 2L3RA 4CRIA 3META 4ZTJA 3OYEA 3L2QA 3KUFA 2BKDN 4A4HA 4C5GA 4QQ6A 2VYTA 3LLRA 5IAYA 3MP6A 2D9TA 1WJQA 4B9WA 5KH6A 3OS2A 5J39A 2PQWA 3E9FA 2BUDA 5KE2A
chains in the Genus database with same CATH superfamily
1MMDA 3HL8A 4LNPA 5GAOr 4K11A 3OW2S 1I5OB 5CQYA 1ABOA 3QKJA 4XU2A 5CKEA 3CMAA 5D7UA 3PFSA 4O5VA 4M77F 4OVAA 2MCNA 2RQRA 5AT1B 2DRMA 1CKBA 2K3BA 4HCKA 5FWBA 1QKWA 1MMAA 2CGHA 1HJDA 4EMKC 4M7AE 2CH4W 3JCMg 1UECA 4Z02A 2ZPGB 2DYBA 4KH0B 3X25B 3CC7T 2K6DA 3QJYA 2QEXQ 1MV0B 3LWIA 1K0SA 3J81E 1PRMC 3TREA 3JCMc 2K57A 3GNFB 4PJOD 2JJ9A 1I4K1 3Q1JA 2EWNA 3A8LB 3MJXA 3EFOA 1FMVA 4JJDA 1R8OB 4A4FA 1X01A 1IREB 4J9FA 2YXYA 2KXDA 5CVIA 5FRMA 4QW2A 3M0SA 4MZMA 1QCNA 2QQAA 4L6V5 1UGQB 1TSFA 1GL5A 3VRYA 2EYYA 1K73C 2JN0A 1V76A 4NOYA 1R77A 5CKBA 4C92D 1WNLA 2M0OA 1YIJA 2A37A 4N0AA 3EGDA 3CCVA 4V2SA 4WTOB 1RLQC 4M7DC 2XKOC 2X4XA 4MDXA 1HYOA 2D0NA 1RACB 3CMEQ 2PUKB 2JM9A 4XTVA 3NTHA 5A2QE 2HBWA 1Z9ZA 2KVQG 3QWXX 5L8RE 2YUQA 2JMAA 1YFNA 4C5HA 1VA7A 1FWZA 2MF2A 1WX6A 4EDUA 1U06A 4CC3A 2E70A 1YNZA 6AT1B 1NZ9A 2CYZB 1MMNA 2LJ1A 1YI2T 2P0PA 1LJOA 1OU9A 2CP7A 1NEGA 4DBRA 1S1NA 4AFQC 2X51A 1N6AA 4M77C 3UA6A 1S72A 3UWNA 4J9EA 4A4GA 3F70A 1QVGS 2OAWA 3S3OA 4ZGEB 4F16A 3HRTA 4PJOF 2DF6A 2KT8A 2RJFA 1YHQQ 1SEMA 2M1HA 3CC4Q 2YHTA 4IIOA 5KYNA 1AD5A 5CAIA 4OB1B 3J80E 2KI7A 2AK5A 1W2BP 3UPUA 2PVGB 1K8AC 3NGPA 2ZAEA 2YLBA 3DB3A 2DMOA 5IN1A 3AT1B 2D6FA 1C6VX 3N5BB 1GCQC 2JS0A 3CMAT 2DL5A 1M90R 1Q81U 3A1PA 1M2VB 3MP8A 3CPWS 2EYWA 3VKIA 1VQNA 2L5QA 4JZ3A 3EG9A 2PVOB 3QG1A 4OB3B 4C92F 4D6WA 2J7IA 3RDVA 4J9DA 1M1GA 4J5YA 4ZTJA 4JLGA 3CC7Q 2V8JA 4EMKB 1MNDA 4O6JA 1TXQA 3SWNA 3I56A 3EG0A 4FW2A 2MPXC 4M7DG 1AWOA 3FLGA 2OI3A 2EKOA 2EAYA 1N9SA 1WQ7A 3EAEA 3L1AA 5I2MA 1KD1C 4FCYA 5KYUA 3QZ5B 5CKFA 2LNHB 1T3SA 3WXMB 2EJ9A 2KBTA 1OZ2A 3VUBA 2RJEA 2PVDB 1M5Q1 3V7SA 4LDXA 4DBFA 4IUTA 4BDZA 3M53A 4F7UA 3H8ZA 3CXCS 4AG2C 1BYMA 3OYNA 3M59A 1I0CA 2EQJA 1WYXA 1QW1A 2FRYA 2XI9A 2COWA 2QXFA 1BU1A 1X43A 3QZ9B 1IHVA 5J3BA 3CCMT 1K9MR 1XNIA 2LX7A 4M77G 3OSSC 4E7IA 3P8HA 1VQ9A 3EGXB 3RMQA 4C8QC 5GJVB 3M9QA 1YIJT 1BI1A 4FSXA 2J6OA 1FMKA 1Z9QA 5GAN3 3PNWC 3MCAB 3OYLA 1WXTA 1FXXA 5I11A 5LJ3j 4PJOC 1NG2A 4A4KA 2NWMA 3EH1A 5KCOA 3BE3A 2F2WA 2ZPFB 1K73U 2OAUA 2DRKA 4RUGA 2GFAA 2NUTA 2ECZA 4XTUA 2SEMA 1AEYA 2DK3A 1I81A 1YI2Q 4M78A 2BKDN 3JB9J 2MAMA 1TOVA 2VGMA 3OS2A 1QWFA 1M3BA 2DERA 1HK9A 3CD6T 1TH7A 2JS2A 1PD1A 5EG2A 1KK7A 1FX7A 2KMTA 2K5IA 2RQWA 1ARKA 3UDCA 1K0XA 4IURA 1CKAA 4FT4A 1MNEA 4M77B 3G6EA 2ZCFB 2K3XA 3GBQA 1M4ZA 4C92C 1MMGA 3FB9A 4XTZA 1OPKA 3VV0A 1RAAB 2O01E 2DE0X 1X2QA 3TQ7P 2Y4XA 1C1AA 9ATCB 1VQOT 4Y91A 4RKUE 5KYXB 2RM4A 1Q82U 3CMAQ 2WSEE 4NS5A 2YUOA 1VQPA 2JVVA 3TSZA 3OYCA 3M54A 2CZ7B 1W2BS 1T0JA 1PSFA 5GMKi 2F69A 3CCLA 3BFMA 3UT1A 3I56T 4E47A 4J7FA 1ZBXA 2JUFA 2GF7A 4GY5A 2AZSA 2JTFA 1AZGB 3MEVA 4JZ4A 3CBPA 1K8AU 4HKEA 1JB0E 4PJOG 2V1QA 1VQ4A 2K3YA 1BI0A 3M56A 2DETA 5A0DA 3M0QA 4XU0A 3M0RA 2CSIA 4Z89A 1TWBA 1T3LA 2JT4A 5IAYA 2LQNA 1X6GA 3VS6A 1PC0A 5J39A 4PJNA 3ZEHA 2HEQA 1RI9A 1AWJA 1MHNA 3E1SA 1OULA 3MO8A 2HL3A 1JQQA 4XU3A 3JAME 3CCMQ 1U1SA 4IKFA 4AFUC 4M75B 4PFPA 3PIPA 4FSSA 4ZN1A 1YIJQ 3ZL7C 2EYQA 2ZZDA 1D3BB 2DD4A 1B34A 1VQ9T 1NBEB 1KD1U 4C92G 3M4YA 4C8QB 1YJNT 3HPWA 4AMCA 4M7AA 2F5KA 1VUBA 4ZN3A 5I21A 1TTHB 5D6YA 4GBQA 2XIDA 2CZ6B 4E7ZA 1E6HA 2DTIA 2P0QA 3RNJA 4C0ZA 3MPUB 4PJMA 3S6WA 1BIBA 3M5AA 4M78F 3OBWA 2DVEA 1V1CA 1ZUYA 2E4HA 2ZPHB 1KFZA 1C0MA 3JCMJ 5GAN4 1OI1A 3CD6Q 2DXUA 2HSEB 1AHJB 2C0TA 1RADB 3LWHA 1RAEB 3TSWA 3A8OB 2K7AA 1UG1A 1M2OA 3EFRA 1IGQA 3M4GA 5GAN7 1UFFA 2C0IA 4OMFB 3G6ET 3VS1A 5GAN6 1ZUKA 2PTKA 4LDWA 1WHMA 3CC2A 4M7DE 1VQOQ 3VS5A 1M90C 3EG2A 4JUVA 3L2QA 3H0HA 2A0FB 3LLRA 1KIKA 1PHTA 2BUDA 2HAXA 1G8XA 1X2KA 3EFOB 2R58A 3UF4A 1D0YA 1BCMA 2E41A 2FZGB 3VU3C 3G4SA 1ZQ1A 2L3PA 3CCJA 4BI3A 1PWTA 3DB4A 1VQPT 3RESA 1QKXA 1N9RA 1PCXA 2DL4A 3QDFA 1I5LA 3GNGA 1W4SA 2P4RA 1NM7A 2DBKA 4BY6C 4KT0E 1YWPA 2XDDA 3CCEA 5GANh 1IXDA 3I56Q 4M75D 5CQXA 2EQMA 3CCLT 2OTLA 4GLKA 4RTWA 1VQMA 2K2MA 1FMWA 2DTHA 2LQKA 1E7OA 3V7RA 5LJ3h 4N4GA 4DA4A 5FU6C 3FDRA 3OYHA 3PTAA 1UUEA 3EGDB 4C8QD 1TG0A 5GAN5 3OS1A 2KY9A 3EFSA 2CDTA 1VQ4T 1KHIA 1AZEA 1K9MC 4FYYB 2QGFB 2H3JA 4RTUA 2V26A 1Y96A 4BACA 3G1JA 4KULA 2DKGA 3E19A 2QDYB 4LDUA 2ED1A 3CPFA 2V8KA 3JRZA 4LDVA 4JRKA 3JCMP 4M78C 2VV5A 1M3AA 1R0BG 1UGSB 1VQ7A 1VQ9Q 4J9BA 2XDBA 2KDSA 1YJNQ 2KAFA 3HRUA 2AT1B 5KYYA 1QVFA 2EJGA 3ME9A 2EVRA 1QMCA 3GP8A 2ATCB 4OMOA 3MP6A 4J9IA 4AFZC 3RR6A 5D6WA 3P8DA 3H0IA 2QGGA 2GGRA 3OS0A 3G71A 2QA4T 1QP3A 1IZ6A 3URGA 2A08A 3HP9A 3ASKA 2LVMA 5GANe 2VKNA 5LJ3f 4LUEA 2LCLA 2LT1A 3NPFA 3O8VA 2NUZA 1KQ1A 1OX8A 2DBMA 1KHCA 3OYAA 5LJ3e 1VYTA 3M0TA 1RUWA 4E7HA 2RPNA 2RMOA 1B7TA 3EG3A 3CCUA 5HK3A 5CCAA 2AKKA 4FYXB 2G6FX 4PNOA 2BZXA 1N5ZA 4E7JA 1RAHB 4M75F 1QLYA 2DIGA 1ZLMA 2BZYA 2BZ8A 1WPYA 5GMKm 4MZPA 3G6EQ 2K4YA 3SFMA 3ZBDA 2XD0A 2CUBA 2KRMA 4JRIA 1WGSA 4J6WA 5HK0A 4C8QF 1M1KR 3SWNB 3MEAA 1WHJA 4EMGA 2DJQA 5GAMh 3CC2T 4KUDK 4JJBA 1NLOC 2EBPA 5KYUB 3CCRA 1IO6A 2CP3A 5FW9A 2JM8A 3OW2A 4FYVB 1G2BA 2LT4A 1VQPQ 4PJOE 1RABB 1NPRA 3G4ST 2GTJA 3CCJT 4RG2A 2RQVA 4F04B 4F7UB 2JXBA 1Q86C 1BBZA 4EMHA 2K5FA 2X35A 5CKDA 3V8JA 5GANd 1YITA 3REAB 2OTJA 2X4JA 4OMPA 3CCLQ 4MMKA 3META 4BUGA 3I55A 3CCET 4BY6B 4D8KA 3NHNA 4B9WA 2GTOA 5I2SA 2E3IA 5LJ3d 2OTLT 5KE2A 1YJ9A 2RJCA 3JCMW 1PSEA 1M90U 2PNIA 3I5SA 3RKYA 4CC7A 4C92E 1VQ8A 4RTYA 5FU6B 2A7YA 4GLMA 3QSUA 3OY9A 1HXDA 4AFSC 2C0OA 2E3HA 3PGGA 1VQ4Q 2E65A 3I35A 4FM4B 3PMIA 2LQ8A 2AKLA 1WXBA 1OEBA 2LTOA 2Y4YA 2CZ0B 2M16A 3CCSA 1GCPA 3LGFA 2JTEA 4RCBA 3QDRB 2E5KA 3OQ5A 5GAOq 1JXMA 1M9SA 3SD4A 1Q81R 5L23A 1PNJA 2H3EB 3OSVA 2FRWA 2NUTB 3V8LA 3H6ZA 1X6BA 1WA7A 2JZ2A 4BD3A 4M78B 1VQ5A 2CUDA 1N27A 1GFDA 2V1RA 2O2OA 3LH5A 2JOYA 4JRQA 1X75C 1D0ZA 1NJIR 2VWFA 3T9NA 2DA9A 3AHUA 5A0LA 4Y92A 2CS7A 3I9QA 2CP5A 3PVLA 3JB9D 4M75C 3VS0A 2FB7A 5IH2A 2QA4Q 1K9MU 3L2WA 4OB2B 5C6SA 2LZ6B 4E6RA 1YN8A 5J26A 5C0MA 5M9OA 2PU9B 3E2UA 2DX1A 2E6NA 2F2VA 2QEXA 2ZPIB 1H3HA 3CCVT 1VYVA 2VASA 5GANj 2VC8A 1U1TA 1OX9A 1R0CB 1ZA2B 3CCUT 2K5LA 2VYTA 1WLPB 4L5GA 3H0FA 3UATA 2P4TA 1CSKA 2RQTA 2MYSA 1H8KA 4LN2A 2J6FA 4A54A 1ZSZC 3RBBB 2FZKB 1UGRB 5LJ5j 1WHKA 2KRSA 1QVPA 2RJDA 1G5VA 4BB7A 1M8MA 5GMKj 1KQSA 2DXTA 1N8RR 1QVFP 4C0GA 2XHCA 4E2FB 1J3TA 2KNBB 3CC2Q 4J8OA 4EMKA 3QXEB 4F17A 1D0XA 4OB0B 2E5QA 4NL2A 1JXOA 3ZFJA 2FPEA 2RQUA 4HT8A 3A5ZB 4E7LA 4J83A 2K9GA 3CCRT 5KYWB 3G4SQ 2GNCA 3CCJQ 1S72T 1UJ0A 3QYHB 3QBYA 2EJFA 4BI8B 1LVKA 4J9CA 1WIEA 4LDYA 2W10A 3OA6A 3VYHB 3QIIA 1G3YA 2O31A 5CIUA 2X4YA 1VQLA 1QQJA 1JO8A 3CCEQ 1HSQA 4J9HA 1WFWA 2VXEA 3DLMA 1OZ3A 3M55A 2DPPB 1B07A 2OTLQ 3HHTB 3JB9I 3IQLA 2DYIA 5IXBA 4FYWB 4M78D 4E7SA 1YJ9T 4M75G 3JB9F 2IPOB 2FHDA 4MMLA 7AT1B 3L2UA 1B34B 3OB9A 2CSQA 2RI3A 1VQ8T 1UGPB 2L2PA 2EIFA 1VQNT 3KBGA 1KJWA 3WVDB 5EC7A 2RHXA 2RI2A 2MWOA 2AIRB 4PK4A 1OPLA 2B8AA 4C8QG 1EX4A 1XTDA 1Y07A 4M7DA 1UTIA 3RMSA 1M27C 2YSQA 3CXCA 4JPBW 3OW2P 1Q86U 4XQ3A 1Q82R 2DL8A 5CR2A 2DNUA 4N0AC 3CC4A 1TS9A 5HY6A 2CREA 2D0QB 4B9XA 3KXTA 2HD0A 3SB2A 5DY9A 4ZGJB 4F7UF 3JCMX 5DLQE 2DAQA 3LYIA 5FRNA 5FROA 2JNGA 1VQ5T 3M0UA 2HQEA 1D1CA 3H9NA 5GAOm 3OYFA 5GAMj 4J9GA 1V29B 2ZGWA 2DXBA 3OYBA 3OYJA 2X9HA 2LJ0A 4FW1A 4J7IA 4OMLA 1RLPC 1WJRA 1SKUB 1G3WA 2L8DA 1U3OA 4M77A 1TUGB 1WDXA 1QCFA 1M30A 1WZOA 1D09B 4DBQA 4QT7A 2M51A 3OYIA 3CC7A 4IIMA 4J6YA 1OOTA 2COYA 3X24B 3CCVQ 3V7CA 2KXCA 3TEEA 4ELZC 1XQHA 1QWEA 2NUPA 1IHWA 1GXIE 3CCUQ 3NFCA 2KK4A 2P0KA 8ATCB 1KC8R 4CC4B 3TU4K 3OBYA 4JRPA 1AVZC 1M1KC 1UJYA 2KEAA 4IUUA 2R57A 1U5SA 3NMZC 3I5RA 3O5ZA 2LJ3A 4LD6A 1ZSZB 1KD1R 2OX7A 2AHJB 3OYMA 4JDSA 4II1A 3VS7A 1JJ2A 2DEUA 3OYGA 1W6XA 4LE9A 2GQVA 2QQRA 3QUIA 1TU0B 3M57A 1WJSA 1XOVA 1Q7YR 5GAOn 2LMJA 1YP5A 2YUPA 2HDAA 5ECAA 2EGCA 3CCRQ 3SEMA 3C0CA 2Y90A 4PFZA 1S72Q 2PQWA 4ORZA 1SF9A 1NLPC 1BI2A 2M0YA 4M7AD 2A36A 2DJZA 2O4XA 2FEIA 4HCCA 1QP2A 1E6GA 2HZYA 2J06A 2JTMA 2I2LA 3HFNA 1EFNA 2J05A 3SWNC 4PJJA 1UGVA 2X4WA 2RHUA 4C5EA 1OV3A 1Y96B 1GFCA 3LW5E 4AT1B 1WI7A 5A0GA 1AWWA 2E10A 1VQLT 2ABLA 5AYFA 3U23A 4JJNK 2P84A 1JU5C 4LUDA 3HFOA 1PRLC 1YJ9Q 1KQSP 2XK0A 3MEWA 2HSPA 1YI2A 4EIKA 1D3BA 1D1BA 4HVVA 2W0ZA 4A53A 1VQNQ 1ZBJA 5KYYB 4WF2A 1SRMA 1Q81C 2J6KA 3FJPA 3VJPA 2COZA 3JCMh 4TVRA 1UHCA 3OMCA 4PFOA 2ESWA 2MOXA 1M3CA 1NPPA 3C4SA 1NJIC 4PJLA 1WHLA 1PKSA 2QI2A 2L3SA 4M77E 2DILA 4XTXA 1SPKA 2EQKA 5LJ5h 4PKCC 4PJOA 1SHFA 2DZ9A 3CEYA 2HQHA 3R6NA 5GMKh 4A4EA 4XTWA 1VQ5Q 4IUVA 4IUQA 1Q95G 3VYGA 2CKKA 3EG1A 2MIOA 1WXUA 3BDLA 4XTYA 4KUIA 1WQWA 1ZHIA 4CI0C 4X9CA 1GBQA 3S3NA 1MUZA 2BIVA 3HSBA 2HCKA 2E12A 4KRTA 2ENMA 2V8IA 3SHWA 1IGUA 1VQKA 5CKHA 3BY7A 4QQGA 3OYEA 3KUFA 4QQ6A 2D9TA 2KR3A 3X20B 3C94A 4C0DB 2EFIA 3JB9G 4OMQA 1Y57A 3NTIA 5D6XA 3QJ6A 4M7AF 4C92A 2AZVA 3D7SB 1RI0A 4N4IA 2LRQA 5GANg 4F14A 3CXCP 4J6XA 2QG9B 2DM1A 2F2XA 4FT2A 4QVDA 3JCMf 4ME7A 2KSSA 1N8RC 2CP6A 2XICA 1XJWB 5LJ3g 5LJ5g 2EYXA 5GANf 2XU8A 2HKNA 3JCMe 4FL6A 2RHIA 2XMFA 1LOJA 2XG8D 5LJ5f 4HCBA 1G3SA 1W70A 3QWYA 4HVUA 4BE0A 1WHHA 2EGAA 4F7UG 1VYUA 3A8HB 3GF5A 1RAIB 4A63B 5GAOl 1VQ6A 4XAXB 3C12A 3PVQA 5LJ5e 3CCMA 1K9AA 1GRIA 2NLUA 5GMKe 3GOXA 3M58A 2WACA 4M75E 3QPHA 4RMOA 4ANJA 4AG1C 1T0HA 1X27A 2M02A 1MGQA 2DIQA 4MZTA 4OMNA 3LH0A 2RHZA 1I07A 2WSFE 3PMTA 4JLIA 3OYYA 3EG9B 4OGEA 2RN8A 1UE9A 3MEUA 5FU7C 2QK0A 4C8QE 4NL3A 1M1KU 3RERA 2R5AA 4DEXA 4ZNXA 2RB6A 4X9DA 3CBOA 2YRVA 4LXCA 1LPLA 1VQLQ 4VUBA 1NYGA 2CT3A 1K4US 4DOWA 1X6OA 4WCIA 1VIEA 2VUBA 3QO3A 4RTVA 2KRNA 4Z88A 2HKQB 3VS3A 4JS4A 1KG1A 3RKXA 1KSWA 1ABQA 3FRNA 3CCQA 2JMCA 2LX9A 3QHSA 3LGLA 3HKSA 2F5TX 2FO0A 2LQWA 5KCHA 1NE8A 2MI6A 2NYSA 4PLLA 1Q82C 1JJ2P 1YJWA 5IHNA 2BE7D 4M78G 3JCMQ 3CD6A 3JCMd 1RL2A 2MMPA 3TVTA 1DJ7B 5GAN8 4DOVA 3WVEB 3DLLA 1BIAA 1M1FA 1KQSS 1BKBA 4ZTFA 2LC4A 4D8DA 4HVWA 4IUPA 3L2RA 5LJ5d 2DTOA 2KYMA 4DQ2A 1VQMT 1TUCA 4FIBA 1I8FA 3SDZA 2YRCA 4M7AC 1VQOA 2ROTA 3BDUA 2HMAA 2D8JA 2QDLA 3JSCA 2X3WD 5GAMg 2CZ1B 3L2ZA 3G7ZA 1ZSGA 1EIFA 3CQTA 3GLXA 2K2VA 3REBB 4EPCA 2KQWA 4Q5WA 2BTTA 3QYGB 2BE9B 3V8KA 4R0KA 2O9VA 5GAMf 3EGUA 1VQKT 2K79A 2LCCA 3P8BB 3NTKA 2RH2A 1BK2A 2RI5A 2QQ9A 4B6MA 2KE9A 5HKCA 5GAMe 5IXFA 1KC8C 5GJWB 3J7AF 1NJIU 1UB4A 1VQ7T 1LNXA 3FEOA 2LCSA 2YRDA 4RTZA 2CH4A 4M4ZA 1NEBA 1EZZB 5FWCA 3BW1A 1W1FA 2X3XD 4DEYA 2VVKA 4OF1A 1VOMA 4YTLA 1K1ZA 1RAGB 2PZ1A 2Z0WA 3EH2A 3E9GA 5IT9E 1JBMA 3M0PA 4DBHA 2FVUA 2I0NA 4RTXA 2FPDA 1Q7YC 3E9FA 2E1HA 3G71T 1D1AA 2DD5A 2QASA 4KBMB 1QCOA 1OYXA 2DXCA 1AOJA 2YDLA 2DL3A 1VQ6T 4ELYC 1WHGA 1M8VA 3ER0A 1X69A 1SRLA 5IHIA 8AT1B 1PM3A 1YJNA 3LX7A 2DLPA 1M2VA 4E7KA 1N8RU 2LNVA 2IVWA 4UC4A 1QVGA 2FG0A 5IHKA 2DEQA 3JCMb 1JRIA 1K76A 4M7AG 2QYZA 1G3TA 4M7DB 4QKUA 2EQIA 5FU7B 5GAMd 4P5NA 5GAN2 1P92A 2O88A 2RHYA 3PT9A 3OS5A 2D1XA 2EGEA 3INZA 2LDMA 2GQIA 4OP0A 3UA7A 2G3RA 3CCQT 3L42A 1K73R 2YUNA 2HBPA 3GPLA 2RNAA 4BE2A 3OYDA 2GCXA 2MWPA 4R55A 1YJWT 2EYZA 2YLCA 3CPWA 4KGZB 1RAFB 5GAOp 2EW3A 3CMEA 2HNIA 4PLIA 4XK8E 4KH1B 1IB8A 1YITT 2RK2A 2DO3A 4OGCA 2OTJT 1ACMB 1G83A 4R56A 3I55T 1VQMQ 4XU1A 1ZUUA 5I22A 5DM7R 2L3RA 1JJ2S 2B86A 4ZGDB 5KH6A 1WJQA 1SSHA 3TCJA 3HTRA 5GMKl 4BI4A 3EGXA 2A3LA 1F1BB 1JEGA 4M7AB 1BCOA 2EQUA 2NUPB 3THKA 2FZCB 2HL5C 2KGTA 4ATOA 1OU8A 4HCZA 1VQKQ 3CBMA 1BB9A 1UHFA 3CCST 2IIMA 1ZX6A 1YHQA 2QTXA 3A8GB 2H8HA 2PUOB 5HCKA 2FL7A 1SHGA 4F7UE 1YCSB 2EKHA 2E6ZA 4QQDA 1VQ7Q 2F1LA 1O9SA 2HQXA 1A0NB 3PE0A 2LP5A 2DFUA 1O75A 2GBQA 1FYNA 2ZPBB 1Q86R 4HT9A 2R5MA 2VGNA 2WSCE 1SSFA 3MKDA 2L0AA 3L2VA 3VRZA 2RF0A 2FPFA 2O4XB 5KYWA 4HXJA 4C0DC 1K8AR 2OJ2A 2QQSA 2KROA 4BDYA 2RO0A 3G71Q 3S3MA 2VXFA 1B3QA 4RTTA 4M7DD 3RUXA 3EHQA 2GFUA 3MHXA 2RK1A 1SG5A 3PIOA 3KFVA 3JCMV 2RA2A 1VQ6Q 2QEXT 1KC8U 1AWXA 2D8HA 2RD1A 5CO7A 5KYXA 4LD9K 4BE1A 1I1JA 5FLXE 3X28B 3C95A 4QVCA 4CRIA 4RG8A 2YWWA 4M78E 4C5GA 3EHRA 1TUDA 3JV3A 1Y0MA 1HD3A 1GCQA 3VS2A 1YCYA 2L89A 2JW4A 2FYKA 4QVZA 1KQ2A 1AT1B 4C5IA 1UEBA 4M77D 1Q7YU 2QAZA 4CC2A 1PG5B 3MP1A 2QA4A 2ROLA 3FC3A 1YWOA 3RIRA 1Y71A 1IRXA 4KGXB 3OMGA 2QTVA 2DVJA 4PJOB 3CCQQ 3X26B 1QVFS 1LCKA 4OMMA 2QQBA 4L59A 4X1VA 2VB6A 3H41A 4ESRA 1U8RA 2IG0A 1H641 5CK9A 1YJWQ 3VS4A 1BI3A 2CT4A 1YBYA 1Y7XA 2L3QA 2CP2A 4X34A 3A98A 3FIFA 3GIBA 2KYBA 1YITQ 3FJ5A 2OTJQ 1H92A 1W2BA 3CMET 3I55Q 2SRCA 1VIFA 3HRSA 1ZA1B 4Z8AA 2ED0A 4M75A 1OQKA 4MDWA 1QVGP 1H3ZA 3VUZA 2A28A 3A8MB 4C92B 2XDPA 4JS5A 4C0FA 3JB9H 4HA8A 1VQ8Q 1UDLA 2M9UA 4N4HA 5LL6S 2YT6A 4M7DF 4C8QA 2C06A 1PD0A 4JJCA 2DL7A 2ZPEB 4FU6A 5DLOA 3CCSQ 2DZCA 2KT1A 1GBRA 4RCCA 4PL6A 3R6OA 2CP0A 3DKMA 2MK5A 3ULRB 4KGVB 3OYKA 5KE3A 1YHQT 1ZSZA 2EPDA 4A4HA 1MV3A 2E64A 3CPWP 3CC4T 4Y28E 1NYFA 3RKWA 2O9SA 1PKTA
chains in the Genus database with same CATH topology
4A54A 1MHNA 5KCHA 1NE8A 3E1SA 1UGRB 2MI6A 4PLLA 5LJ5j 1Q82C 3MO8A 1YJWA 4XU3A 1QVPA 2RJDA 3HL8A 4M78G 1U1SA 3JCMQ 3JAME 3JCMd 5GAOr 4IKFA 3OW2S 4M75B 3PIPA 1RL2A 1G5VA 4BB7A 5GMKj 1KQSA 2DXTA 2MMPA 4C0GA 2XHCA 5CQYA 4ZN1A 3QKJA 3CMAA 1DJ7B 4XU2A 5CKEA 5GAN8 4DOVA 3PFSA 4O5VA 4M77F 3WVEB 2EYQA 2ZZDA 3DLLA 1D3BB 4OVAA 1BIAA 4J8OA 4EMKA 2DD4A 1M1FA 1B34A 1VQ9T 1KQSS 3QXEB 1BKBA 4ZTFA 2LC4A 1KD1U 4C92G 4OB0B 2E5QA 3M4YA 4IUPA 4C8QB 1YJNT 4NL2A 3HPWA 3L2RA 2F5KA 4M7AA 2CGHA 2DTOA 1VUBA 3ZFJA 4ZN3A 4EMKC 4DQ2A 5LJ5d 1VQMT 4HT8A 4M7AE 3A5ZB 4E7LA 4J83A 5I21A 3JCMg 4FIBA 5D6YA 1I8FA 2XIDA 3SDZA 4Z02A 2CZ6B 2ZPGB 3X25B 3CCRT 4M7AC 1VQOA 3CC7T 3BDUA 3QJYA 3JSCA 1S72T 3LWIA 3J81E 3TREA 5GAMg 3QYHB 2CZ1B 3JCMc 3QBYA 2EJFA 2K57A 4BI8B 2DTIA 3G7ZA 2P0QA 3GNFB 3L2ZA 4C0ZA 3S6WA 4PJOD 1BIBA 1EIFA 4LDYA 3GLXA 3M5AA 1I4K1 2K2VA 3VYHB 4M78F 3OBWA 3Q1JA 3OA6A 2EWNA 3A8LB 2DVEA 4EPCA 2KQWA 1G3YA 3QIIA 4Q5WA 5CIUA 2X4YA 3QYGB 2ZPHB 1R8OB 4A4FA 1X01A 1IREB 1VQLA 3V8KA 5GAMf 5CVIA 2VXEA 3M55A 3DLMA 1OZ3A 3JCMJ 4QW2A 5GAN4 2LCCA 1VQKT 3P8BB 2DPPB 5FRMA 3HHTB 4MZMA 3NTKA 1OI1A 3JB9I 2RH2A 2DXUA 2RI5A 2QQ9A 2QQAA 1AHJB 4L6V5 5HKCA 5GAMe 4M78D 3LWHA 1KC8C 1UGQB 1YJ9T 3A8OB 4M75G 3JB9F 3J7AF 1NJIU 1UB4A 2FHDA 4MMLA 3L2UA 1VQ7T 1B34B 1K73C 3OB9A 1LNXA 3EFRA 2JN0A 2RI3A 3FEOA 3M4GA 1VQ8T 1UGPB 4NOYA 5GAN7 2EIFA 1VQNT 3KBGA 3WVDB 2RHXA 5CKBA 4OMFB 2RI2A 2MWOA 1WNLA 3BW1A 4C92D 3G6ET 2M0OA 2B8AA 4C8QG 5GAN6 1XTDA 1Y07A 4OF1A 1YIJA 4M7DA 4LDWA 4YTLA 3CC2A 4N0AA 3RMSA 3E9GA 5IT9E 4M7DE 3CXCA 1M90C 1JBMA 4JUVA 3CCVA 1Q86U 4XQ3A 3L2QA 2FVUA 4V2SA 3LLRA 5CR2A 4M7DC 2XKOC 1Q7YC 4N0AC 3E9FA 2BUDA 2E1HA 2HAXA 3G71T 3CC4A 5HY6A 2X4XA 4MDXA 2R58A 2DD5A 4KBMB 3KXTA 2D0QB 4B9XA 2HD0A 2E41A 2PUKB 5DY9A 3SB2A 4ZGJB 4F7UF 3VU3C 4XTVA 3G4SA 3NTHA 1ZQ1A 3JCMX 3CCJA 1OYXA 4BI3A 5A2QE 3DB4A 5DLQE 2DAQA 1VQPT 2KVQG 3LYIA 3RESA 5FRNA 5L8RE 1N9RA 2JNGA 5FROA 1VQ5T 2DXCA 4C5HA 2HQEA 3GNGA 1I5LA 1VQ6T 1W4SA 4ELYC 1FWZA 2MF2A 5GAOm 3OYFA 4EDUA 5GAMj 2E70A 4BY6C 1M8VA 3ER0A 4KT0E 2XDDA 1V29B 2ZGWA 2DXBA 3CCEA 3OYBA 1NZ9A 2CYZB 5GANh 3OYJA 4J7IA 1YJNA 1YI2T 3LX7A 1WJRA 2EQMA 4M75D 5CQXA 2P0PA 3CCLT 2LNVA 4E7KA 1G3WA 1LJOA 4GLKA 2L8DA 1N8RU 2OTLA 1VQMA 4M77A 2IVWA 4UC4A 2DTHA 1QVGA 2DEQA 2LQKA 3V7RA 3JCMb 1JRIA 5LJ3h 4N4GA 3OYIA 5FU6C 4DA4A 4M7AG 3FDRA 1G3TA 3CC7A 4M7DB 3OYHA 4J6YA 5FU7B 1N6AA 3PTAA 4M77C 4P5NA 5GAMd 3UWNA 5GAN2 1S72A 4A4GA 3F70A 1P92A 3X24B 1QVGS 3S3OA 4C8QD 4ZGEB 5GAN5 2RHYA 3PT9A 3OS1A 3OS5A 3HRTA 2KY9A 3EFSA 4PJOF 3V7CA 2RJFA 3TEEA 3INZA 4ELZC 1XQHA 1KHIA 2LDMA 2M1HA 1VQ4T 1GXIE 1K9MC 3NFCA 2KK4A 4OP0A 2P0KA 2YHTA 3TU4K 2H3JA 3OBYA 4JRPA 5CAIA 4OB1B 2G3RA 3J80E 1Y96A 3CCQT 3L42A 4BACA 1M1KC 4KULA 2DKGA 3E19A 2HBPA 2QDYB 4LDUA 3GPLA 2PVGB 4BE2A 3UPUA 3CPFA 2V8KA 4IUUA 2R57A 1K8AC 3JRZA 3OYDA 4LDVA 4JRKA 2GCXA 2MWPA 2YLBA 4LD6A 3DB3A 4R55A 1YJWT 2YLCA 3JCMP 5IN1A 3CPWA 4M78C 2VV5A 1UGSB 5GAOp 2AHJB 3OYMA 1VQ7A 3CMEA 2HNIA 4JDSA 4II1A 4PLIA 2D6FA 3N5BB 4XK8E 3CMAT 2XDBA 2KDSA 1YITT 2RK2A 2DO3A 1Q81U 3LGLA 4OGCA 1JJ2A 2OTJT 3MP8A 3CPWS 3OYGA 2KAFA 3VKIA 1VQNA 2GQVA 2L5QA 2QQRA 3QUIA 3HRUA 4R56A 3M57A 1WJSA 2PVOB 1XOVA 3QG1A 4OB3B 4C92F 4D6WA 3I55T 5GAOn 2EJGA 3ME9A 4XU1A 1QVFA 5DM7R 1M1GA 2L3RA 4J5YA 4ZTJA 1JJ2S 4ZGDB 3GP8A 3MP6A 4JLGA 5KH6A 1WJQA 3TCJA 2V8JA 4EMKB 2Y90A 5GMKl 2PQWA 4O6JA 4BI4A 1BI2A 3SWNA 3I56A 4M7AD 2DJZA 2A3LA 2O4XA 5D6WA 3P8DA 1QP2A 4HCCA 4M7DG 3FLGA 4M7AB 2EKOA 2JTMA 3OS0A 2EQUA 3G71A 2QA4T 1QP3A 2EAYA 1N9SA 1IZ6A 1WQ7A 2I2LA 3EAEA 3HFNA 3L1AA 3URGA 3HP9A 5I2MA 3ASKA 2LVMA 3SWNC 5GANe 1KD1C 5LJ3f 3QZ5B 5CKFA 2LCLA 2X4WA 2RHUA 2LT1A 4C5EA 4ATOA 3WXMB 3O8VA 1Y96B 2EJ9A 1KQ1A 4HCZA 1OZ2A 3CBMA 3LW5E 3VUBA 3CD6A 5A0GA 2RJEA 3CCST 2PVDB 1KHCA 1M5Q1 2E10A 3V7SA 3OYAA 1VQLT 5LJ3e 4LDXA 5AYFA 1YHQA 4JJNK 4E7HA 2QTXA 4IUTA 3A8GB 4BDZA 3M53A 2PUOB 4F7UA 3CCUA 3HFOA 3H8ZA 3CXCS 5HK3A 2FL7A 4F7UE 1BYMA 5CCAA 4PNOA 2E6ZA 4QQDA 2XK0A 3OYNA 1O9SA 2HQXA 3M59A 3MEWA 4E7JA 1YI2A 4M75F 2EQJA 1D3BA 1QW1A 2DIGA 2XI9A 4A53A 1O75A 2QXFA 1WPYA 5GMKm 4MZPA 2ZPBB 3QZ9B 4WF2A 1Q81C 5J3BA 2K4YA 3CCMT 3FJPA 3VJPA 4HT9A 2R5MA 3JCMh 2VGNA 3SFMA 1XNIA 3ZBDA 2XD0A 4M77G 2WSCE 1SSFA 4TVRA 4JRIA 3OMCA 1WGSA 4J6WA 5HK0A 4C8QF 3OSSC 3L2VA 3P8HA 4E7IA 1VQ9A 3RMQA 3SWNB 3MEAA 4C8QC 3M9QA 1YIJT 2O4XB 1BI1A 4EMGA 4FSXA 5GAMh 3CC2T 4C0DC 2QQSA 1NPPA 4BDYA 2RO0A 3C4SA 4KUDK 1NJIC 2QI2A 3S3MA 2VXFA 4M77E 4M7DD 4XTXA 3RUXA 5GAN3 3PNWC 2EQKA 3MCAB 3OYLA 5LJ5h 4PKCC 2GFUA 3CCRA 4PJOA 1FXXA 3MHXA 2DZ9A 4PJOE 2RK1A 3CEYA 2LT4A 3OW2A 5GMKh 4A4EA 4XTWA 3PIOA 4IUVA 4IUQA 3JCMV 3VYGA 2RA2A 5LJ3j 1NPRA 2CKKA 3G4ST 3CCJT 2QEXT 4PJOC 3BDLA 4RG2A 4XTYA 4A4KA 1KC8U 4F7UB 4KUIA 5KCOA 2RD1A 1WQWA 1ZHIA 5CO7A 4CI0C 4X9CA 1Q86C 4EMHA 4LD9K 2ZPFB 4BE1A 2K5FA 1K73U 2OAUA 2X35A 5CKDA 3S3NA 2BIVA 2GFAA 3V8JA 3HSBA 5FLXE 5GANd 2E12A 4XTUA 1YITA 2DK3A 2V8IA 2OTJA 2X4JA 3X28B 1VQKA 1I81A 5CKHA 3BY7A 3C95A 4M78A 4QQGA 4CRIA 4MMKA 3META 4RG8A 4BUGA 4QVCA 3OYEA 3KUFA 4M78E 2BKDN 4BY6B 3I55A 3JB9J 3CCET 4C5GA 4QQ6A 2MAMA 2VGMA 2D9TA 4B9WA 3CCUT 3X20B 3OS2A 5I2SA 1YCYA 5LJ3d 2OTLT 2L89A 5KE2A 1HK9A 3C94A 4C0DB 2FYKA 4QVZA 1YJ9A 1KQ2A 3CD6T 2EFIA 2RJCA 1PSEA 3JCMW 3JB9G 1TH7A 5EG2A 1M90U 3NTIA 3RKYA 5D6XA 3QJ6A 1FX7A 2KMTA 2K5IA 4M7AF 4C92A 4C5IA 1UEBA 1RI0A 4N4IA 4M77D 3UDCA 4C92E 1Q7YU 1VQ8A 2LRQA 4IURA 5FU6B 3MP1A 5GANg 4FT4A 2A7YA 2QA4A 3QSUA 3OY9A 1HXDA 4M77B 3PGGA 3FC3A 2E65A 4J6XA 3G6EA 2ZCFB 2K3XA 1M4ZA 4C92C 3FB9A 4FM4B 3PMIA 1Y71A 4XTZA 3RIRA 3OMGA 4FT2A 2LQ8A 4QVDA 3JCMf 4ME7A 2KSSA 1N8RC 2XICA 2LTOA 2Y4YA 3VV0A 4PJOB 5LJ3g 5LJ5g 2CZ0B 2O01E 3X26B 2M16A 3CCSA 1QVFS 5GANf 2XU8A 3LGFA 4RCBA 2QQBA 2Y4XA 4L59A 3QDRB 3OQ5A 1VQOT 3JCMe 5GAOq 1U8RA 2IG0A 1H641 4FL6A 1M9SA 4Y91A 5CK9A 3SD4A 2RHIA 1BI3A 1LOJA 4RKUE 1YBYA 1Y7XA 2XG8D 4X34A 3OSVA 5LJ5f 4HCBA 1G3SA 3V8LA 2RM4A 1Q82U 2WSEE 3H6ZA 3FIFA 4NS5A 4F7UG 4BE0A 3GIBA 3A8HB 3GF5A 1VQPA 2JZ2A 4BD3A 4M78B 1W2BA 1VQ5A 1N27A 3CMET 2JOYA 2JVVA 5GAOl 4JRQA 1VQ6A 1X75C 1VIFA 3C12A 4XAXB 5LJ5e 3HRSA 3OYCA 3M54A 3CCMA 3T9NA 4M75A 2CZ7B 1W2BS 2NLUA 5GMKe 4MDWA 3GOXA 1H3ZA 1PSFA 3M58A 2WACA 4M75E 3QPHA 3VUZA 5A0LA 5GMKi 3AHUA 4RMOA 2CS7A 3A8MB 4C92B 2XDPA 2F69A 4JS5A 4C0FA 1MGQA 2DIQA 4MZTA 3CCLA 3JB9H 4HA8A 3JB9D 4M75C 3BFMA 2FB7A 2M9UA 2RHZA 3LH0A 4N4HA 2WSFE 3PMTA 4JLIA 5LL6S 3UT1A 1K9MU 3OYYA 4OGEA 3L2WA 4OB2B 3I56T 4M7DF 4E47A 5C6SA 4J7FA 1ZBXA 4C8QA 2JUFA 2C06A 3MEUA 5FU7C 4C8QE 2GF7A 4NL3A 1M1KU 2ZPEB 4FU6A 4GY5A 5J26A 5C0MA 5DLOA 5M9OA 3RERA 2JTFA 2R5AA 3MEVA 3CBPA 1K8AU 4HKEA 2PU9B 2RB6A 4X9DA 3CBOA 1JB0E 2YRVA 2DZCA 2E6NA 4RCCA 4VUBA 4PL6A 3R6OA 3DKMA 4PJOG 2QEXA 4DOWA 1VQ4A 2K3YA 1BI0A 2ZPIB 3M56A 5A0DA 3OYKA 3CCVT 1X6OA 4XU0A 1VIEA 2VUBA 3QO3A 5KE3A 1YHQT 5GANj 2VC8A 4JS4A 1U1TA 1KG1A 3RKXA 4A4HA 5IAYA 2K5LA 2VYTA 2E64A 3FRNA 3CCQA 4L5GA 2LX9A 3CC4T 3QHSA 2P4TA 4Y28E 5J39A 3RKWA 3ZEHA 3HKSA 2F5TX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHN A;  2O4X A;  4QVZ A;  2X4X A;  5KCH A;  2R58 A;  2EFI A;  2RJC A;  3P8D A;  4PLL A;  5D6W A;  3FLG A;  3MO8 A;  3NTI A;  4B9X A;  5D6X A;  2EKO A;  3OS0 A;  2RJD A;  2EQU A;  3QJ6 A;  4IKF A;  3ZEH A;  1G5V A;  3EAE A;  4C5I A;  1RI0 A;  4N4I A;  3NTH A;  1OYX A;  2LVM A;  2LRQ A;  3ASK A;  3DB4 A;  2DAQ A;  3MP1 A;  3LYI A;  4IUR A;  5FRN A;  3QKJ A;  3OY9 A;  5FRO A;  2X4W A;  3FC3 A;  2RHU A;  3PFS A;  4C5E A;  3O8V A;  4C5H A;  2HQE A;  2K3X A;  3PMI A;  4HCZ A;  4OVA A;  1OZ2 A;  3OMG A;  3OYF A;  4EDU A;  2RJE A;  1KHC A;  2LTO A;  4ZTF A;  3OYA A;  2E5Q A;  4E7H A;  4IUP A;  4IUT A;  4BDZ A;  2M16 A;  3L2R A;  2F5K A;  3OYB A;  3OYJ A;  3LGF A;  3H8Z A;  4L59 A;  4E7L A;  3OQ5 A;  3LX7 A;  1WJR A;  2EQM A;  4E7K A;  5D6Y A;  2IG0 A;  4FL6 A;  2L8D A;  2XK0 A;  4QQD A;  4Z02 A;  3SD4 A;  2RHI A;  3OYN A;  4UC4 A;  2HQX A;  3MEW A;  4E7J A;  2EQJ A;  4X34 A;  2DIG A;  4N4G A;  3OYI A;  3FDR A;  4BE0 A;  3H6Z A;  3QBY A;  4NS5 A;  3OYH A;  2L89 A;  2JZ2 A;  3S6W A;  3UWN A;  4A4G A;  3F70 A;  4BD3 A;  3OA6 A;  3S3O A;  1N27 A;  3Q1J A;  2R5M A;  2RHY A;  1XNI A;  3OS1 A;  1SSF A;  3QII A;  4Q5W A;  5CIU A;  3OMC A;  1WGS A;  2RJF A;  2X4Y A;  3OYC A;  3L2V A;  4E7I A;  3P8H A;  4A4F A;  2LDM A;  2M1H A;  3MEA A;  3M9Q A;  2O4X B;  2NLU A;  3GOX A;  3DLM A;  1OZ3 A;  1H3Z A;  2WAC A;  2P0K A;  4QW2 A;  5FRM A;  2LCC A;  2QQS A;  4BDY A;  2RO0 A;  3C4S A;  3NTK A;  1OI1 A;  2XDP A;  3S3M A;  2RI5 A;  2G3R A;  2DIQ A;  4BAC A;  3L42 A;  3LH0 A;  2RHZ A;  2EQK A;  3PNW C;  4N4H A;  3OYL A;  3PMT A;  3UT1 A;  2GFU A;  3L2W A;  4BE2 A;  4IUU A;  2R57 A;  5C6S A;  3OYD A;  2MWP A;  3CEY A;  3MEU A;  4LD6 A;  3DB3 A;  2FHD A;  3L2U A;  2GF7 A;  4A4E A;  3OB9 A;  5IN1 A;  4IUV A;  4IUQ A;  4FU6 A;  4GY5 A;  5J26 A;  2RI3 A;  3FEO A;  5C0M A;  5M9O A;  2JTF A;  2R5A A;  2CKK A;  3MEV A;  3OYM A;  3BDL A;  4RG2 A;  4PLI A;  4II1 A;  2YRV A;  5KCO A;  2E6N A;  2RHX A;  4PL6 A;  3LGL A;  2RI2 A;  2MWO A;  4BE1 A;  3MP8 A;  2X35 A;  3S3N A;  3OYG A;  2K3Y A;  2M0O A;  2B8A A;  2BIV A;  2GFA A;  3OYK A;  2QQR A;  1WJS A;  3E9G A;  3ME9 A;  5KE3 A;  4QQG A;  2L3R A;  4CRI A;  3MET A;  4ZTJ A;  3OYE A;  3L2Q A;  3KUF A;  2BKD N;  4A4H A;  4C5G A;  4QQ6 A;  2VYT A;  3LLR A;  5IAY A;  3MP6 A;  2D9T A;  1WJQ A;  4B9W A;  5KH6 A;  3OS2 A;  5J39 A;  2PQW A;  3E9F A;  2BUD A;  5KE2 A; 
#chains in the Genus database with same CATH topology
 1MMD A;  3HL8 A;  4LNP A;  5GAO r;  4K11 A;  3OW2 S;  1I5O B;  5CQY A;  1ABO A;  3QKJ A;  4XU2 A;  5CKE A;  3CMA A;  5D7U A;  3PFS A;  4O5V A;  4M77 F;  4OVA A;  2MCN A;  2RQR A;  5AT1 B;  2DRM A;  1CKB A;  2K3B A;  4HCK A;  5FWB A;  1QKW A;  1MMA A;  2CGH A;  1HJD A;  4EMK C;  4M7A E;  2CH4 W;  3JCM g;  1UEC A;  4Z02 A;  2ZPG B;  2DYB A;  4KH0 B;  3X25 B;  3CC7 T;  2K6D A;  3QJY A;  2QEX Q;  1MV0 B;  3LWI A;  1K0S A;  3J81 E;  1PRM C;  3TRE A;  3JCM c;  2K57 A;  3GNF B;  4PJO D;  2JJ9 A;  1I4K 1;  3Q1J A;  2EWN A;  3A8L B;  3MJX A;  3EFO A;  1FMV A;  4JJD A;  1R8O B;  4A4F A;  1X01 A;  1IRE B;  4J9F A;  2YXY A;  2KXD A;  5CVI A;  5FRM A;  4QW2 A;  3M0S A;  4MZM A;  1QCN A;  2QQA A;  4L6V 5;  1UGQ B;  1TSF A;  1GL5 A;  3VRY A;  2EYY A;  1K73 C;  2JN0 A;  1V76 A;  4NOY A;  1R77 A;  5CKB A;  4C92 D;  1WNL A;  2M0O A;  1YIJ A;  2A37 A;  4N0A A;  3EGD A;  3CCV A;  4V2S A;  4WTO B;  1RLQ C;  4M7D C;  2XKO C;  2X4X A;  4MDX A;  1HYO A;  2D0N A;  1RAC B;  3CME Q;  2PUK B;  2JM9 A;  4XTV A;  3NTH A;  5A2Q E;  2HBW A;  1Z9Z A;  2KVQ G;  3QWX X;  5L8R E;  2YUQ A;  2JMA A;  1YFN A;  4C5H A;  1VA7 A;  1FWZ A;  2MF2 A;  1WX6 A;  4EDU A;  1U06 A;  4CC3 A;  2E70 A;  1YNZ A;  6AT1 B;  1NZ9 A;  2CYZ B;  1MMN A;  2LJ1 A;  1YI2 T;  2P0P A;  1LJO A;  1OU9 A;  2CP7 A;  1NEG A;  4DBR A;  1S1N A;  4AFQ C;  2X51 A;  1N6A A;  4M77 C;  3UA6 A;  1S72 A;  3UWN A;  4J9E A;  4A4G A;  3F70 A;  1QVG S;  2OAW A;  3S3O A;  4ZGE B;  4F16 A;  3HRT A;  4PJO F;  2DF6 A;  2KT8 A;  2RJF A;  1YHQ Q;  1SEM A;  2M1H A;  3CC4 Q;  2YHT A;  4IIO A;  5KYN A;  1AD5 A;  5CAI A;  4OB1 B;  3J80 E;  2KI7 A;  2AK5 A;  1W2B P;  3UPU A;  2PVG B;  1K8A C;  3NGP A;  2ZAE A;  2YLB A;  3DB3 A;  2DMO A;  5IN1 A;  3AT1 B;  2D6F A;  1C6V X;  3N5B B;  1GCQ C;  2JS0 A;  3CMA T;  2DL5 A;  1M90 R;  1Q81 U;  3A1P A;  1M2V B;  3MP8 A;  3CPW S;  2EYW A;  3VKI A;  1VQN A;  2L5Q A;  4JZ3 A;  3EG9 A;  2PVO B;  3QG1 A;  4OB3 B;  4C92 F;  4D6W A;  2J7I A;  3RDV A;  4J9D A;  1M1G A;  4J5Y A;  4ZTJ A;  4JLG A;  3CC7 Q;  2V8J A;  4EMK B;  1MND A;  4O6J A;  1TXQ A;  3SWN A;  3I56 A;  3EG0 A;  4FW2 A;  2MPX C;  4M7D G;  1AWO A;  3FLG A;  2OI3 A;  2EKO A;  2EAY A;  1N9S A;  1WQ7 A;  3EAE A;  3L1A A;  5I2M A;  1KD1 C;  4FCY A;  5KYU A;  3QZ5 B;  5CKF A;  2LNH B;  1T3S A;  3WXM B;  2EJ9 A;  2KBT A;  1OZ2 A;  3VUB A;  2RJE A;  2PVD B;  1M5Q 1;  3V7S A;  4LDX A;  4DBF A;  4IUT A;  4BDZ A;  3M53 A;  4F7U A;  3H8Z A;  3CXC S;  4AG2 C;  1BYM A;  3OYN A;  3M59 A;  1I0C A;  2EQJ A;  1WYX A;  1QW1 A;  2FRY A;  2XI9 A;  2COW A;  2QXF A;  1BU1 A;  1X43 A;  3QZ9 B;  1IHV A;  5J3B A;  3CCM T;  1K9M R;  1XNI A;  2LX7 A;  4M77 G;  3OSS C;  4E7I A;  3P8H A;  1VQ9 A;  3EGX B;  3RMQ A;  4C8Q C;  5GJV B;  3M9Q A;  1YIJ T;  1BI1 A;  4FSX A;  2J6O A;  1FMK A;  1Z9Q A;  5GAN 3;  3PNW C;  3MCA B;  3OYL A;  1WXT A;  1FXX A;  5I11 A;  5LJ3 j;  4PJO C;  1NG2 A;  4A4K A;  2NWM A;  3EH1 A;  5KCO A;  3BE3 A;  2F2W A;  2ZPF B;  1K73 U;  2OAU A;  2DRK A;  4RUG A;  2GFA A;  2NUT A;  2ECZ A;  4XTU A;  2SEM A;  1AEY A;  2DK3 A;  1I81 A;  1YI2 Q;  4M78 A;  2BKD N;  3JB9 J;  2MAM A;  1TOV A;  2VGM A;  3OS2 A;  1QWF A;  1M3B A;  2DER A;  1HK9 A;  3CD6 T;  1TH7 A;  2JS2 A;  1PD1 A;  5EG2 A;  1KK7 A;  1FX7 A;  2KMT A;  2K5I A;  2RQW A;  1ARK A;  3UDC A;  1K0X A;  4IUR A;  1CKA A;  4FT4 A;  1MNE A;  4M77 B;  3G6E A;  2ZCF B;  2K3X A;  3GBQ A;  1M4Z A;  4C92 C;  1MMG A;  3FB9 A;  4XTZ A;  1OPK A;  3VV0 A;  1RAA B;  2O01 E;  2DE0 X;  1X2Q A;  3TQ7 P;  2Y4X A;  1C1A A;  9ATC B;  1VQO T;  4Y91 A;  4RKU E;  5KYX B;  2RM4 A;  1Q82 U;  3CMA Q;  2WSE E;  4NS5 A;  2YUO A;  1VQP A;  2JVV A;  3TSZ A;  3OYC A;  3M54 A;  2CZ7 B;  1W2B S;  1T0J A;  1PSF A;  5GMK i;  2F69 A;  3CCL A;  3BFM A;  3UT1 A;  3I56 T;  4E47 A;  4J7F A;  1ZBX A;  2JUF A;  2GF7 A;  4GY5 A;  2AZS A;  2JTF A;  1AZG B;  3MEV A;  4JZ4 A;  3CBP A;  1K8A U;  4HKE A;  1JB0 E;  4PJO G;  2V1Q A;  1VQ4 A;  2K3Y A;  1BI0 A;  3M56 A;  2DET A;  5A0D A;  3M0Q A;  4XU0 A;  3M0R A;  2CSI A;  4Z89 A;  1TWB A;  1T3L A;  2JT4 A;  5IAY A;  2LQN A;  1X6G A;  3VS6 A;  1PC0 A;  5J39 A;  4PJN A;  3ZEH A;  2HEQ A;  1RI9 A;  1AWJ A;  1MHN A;  3E1S A;  1OUL A;  3MO8 A;  2HL3 A;  1JQQ A;  4XU3 A;  3JAM E;  3CCM Q;  1U1S A;  4IKF A;  4AFU C;  4M75 B;  4PFP A;  3PIP A;  4FSS A;  4ZN1 A;  1YIJ Q;  3ZL7 C;  2EYQ A;  2ZZD A;  1D3B B;  2DD4 A;  1B34 A;  1VQ9 T;  1NBE B;  1KD1 U;  4C92 G;  3M4Y A;  4C8Q B;  1YJN T;  3HPW A;  4AMC A;  4M7A A;  2F5K A;  1VUB A;  4ZN3 A;  5I21 A;  1TTH B;  5D6Y A;  4GBQ A;  2XID A;  2CZ6 B;  4E7Z A;  1E6H A;  2DTI A;  2P0Q A;  3RNJ A;  4C0Z A;  3MPU B;  4PJM A;  3S6W A;  1BIB A;  3M5A A;  4M78 F;  3OBW A;  2DVE A;  1V1C A;  1ZUY A;  2E4H A;  2ZPH B;  1KFZ A;  1C0M A;  3JCM J;  5GAN 4;  1OI1 A;  3CD6 Q;  2DXU A;  2HSE B;  1AHJ B;  2C0T A;  1RAD B;  3LWH A;  1RAE B;  3TSW A;  3A8O B;  2K7A A;  1UG1 A;  1M2O A;  3EFR A;  1IGQ A;  3M4G A;  5GAN 7;  1UFF A;  2C0I A;  4OMF B;  3G6E T;  3VS1 A;  5GAN 6;  1ZUK A;  2PTK A;  4LDW A;  1WHM A;  3CC2 A;  4M7D E;  1VQO Q;  3VS5 A;  1M90 C;  3EG2 A;  4JUV A;  3L2Q A;  3H0H A;  2A0F B;  3LLR A;  1KIK A;  1PHT A;  2BUD A;  2HAX A;  1G8X A;  1X2K A;  3EFO B;  2R58 A;  3UF4 A;  1D0Y A;  1BCM A;  2E41 A;  2FZG B;  3VU3 C;  3G4S A;  1ZQ1 A;  2L3P A;  3CCJ A;  4BI3 A;  1PWT A;  3DB4 A;  1VQP T;  3RES A;  1QKX A;  1N9R A;  1PCX A;  2DL4 A;  3QDF A;  1I5L A;  3GNG A;  1W4S A;  2P4R A;  1NM7 A;  2DBK A;  4BY6 C;  4KT0 E;  1YWP A;  2XDD A;  3CCE A;  5GAN h;  1IXD A;  3I56 Q;  4M75 D;  5CQX A;  2EQM A;  3CCL T;  2OTL A;  4GLK A;  4RTW A;  1VQM A;  2K2M A;  1FMW A;  2DTH A;  2LQK A;  1E7O A;  3V7R A;  5LJ3 h;  4N4G A;  4DA4 A;  5FU6 C;  3FDR A;  3OYH A;  3PTA A;  1UUE A;  3EGD B;  4C8Q D;  1TG0 A;  5GAN 5;  3OS1 A;  2KY9 A;  3EFS A;  2CDT A;  1VQ4 T;  1KHI A;  1AZE A;  1K9M C;  4FYY B;  2QGF B;  2H3J A;  4RTU A;  2V26 A;  1Y96 A;  4BAC A;  3G1J A;  4KUL A;  2DKG A;  3E19 A;  2QDY B;  4LDU A;  2ED1 A;  3CPF A;  2V8K A;  3JRZ A;  4LDV A;  4JRK A;  3JCM P;  4M78 C;  2VV5 A;  1M3A A;  1R0B G;  1UGS B;  1VQ7 A;  1VQ9 Q;  4J9B A;  2XDB A;  2KDS A;  1YJN Q;  2KAF A;  3HRU A;  2AT1 B;  5KYY A;  1QVF A;  2EJG A;  3ME9 A;  2EVR A;  1QMC A;  3GP8 A;  2ATC B;  4OMO A;  3MP6 A;  4J9I A;  4AFZ C;  3RR6 A;  5D6W A;  3P8D A;  3H0I A;  2QGG A;  2GGR A;  3OS0 A;  3G71 A;  2QA4 T;  1QP3 A;  1IZ6 A;  3URG A;  2A08 A;  3HP9 A;  3ASK A;  2LVM A;  5GAN e;  2VKN A;  5LJ3 f;  4LUE A;  2LCL A;  2LT1 A;  3NPF A;  3O8V A;  2NUZ A;  1KQ1 A;  1OX8 A;  2DBM A;  1KHC A;  3OYA A;  5LJ3 e;  1VYT A;  3M0T A;  1RUW A;  4E7H A;  2RPN A;  2RMO A;  1B7T A;  3EG3 A;  3CCU A;  5HK3 A;  5CCA A;  2AKK A;  4FYX B;  2G6F X;  4PNO A;  2BZX A;  1N5Z A;  4E7J A;  1RAH B;  4M75 F;  1QLY A;  2DIG A;  1ZLM A;  2BZY A;  2BZ8 A;  1WPY A;  5GMK m;  4MZP A;  3G6E Q;  2K4Y A;  3SFM A;  3ZBD A;  2XD0 A;  2CUB A;  2KRM A;  4JRI A;  1WGS A;  4J6W A;  5HK0 A;  4C8Q F;  1M1K R;  3SWN B;  3MEA A;  1WHJ A;  4EMG A;  2DJQ A;  5GAM h;  3CC2 T;  4KUD K;  4JJB A;  1NLO C;  2EBP A;  5KYU B;  3CCR A;  1IO6 A;  2CP3 A;  5FW9 A;  2JM8 A;  3OW2 A;  4FYV B;  1G2B A;  2LT4 A;  1VQP Q;  4PJO E;  1RAB B;  1NPR A;  3G4S T;  2GTJ A;  3CCJ T;  4RG2 A;  2RQV A;  4F04 B;  4F7U B;  2JXB A;  1Q86 C;  1BBZ A;  4EMH A;  2K5F A;  2X35 A;  5CKD A;  3V8J A;  5GAN d;  1YIT A;  3REA B;  2OTJ A;  2X4J A;  4OMP A;  3CCL Q;  4MMK A;  3MET A;  4BUG A;  3I55 A;  3CCE T;  4BY6 B;  4D8K A;  3NHN A;  4B9W A;  2GTO A;  5I2S A;  2E3I A;  5LJ3 d;  2OTL T;  5KE2 A;  1YJ9 A;  2RJC A;  3JCM W;  1PSE A;  1M90 U;  2PNI A;  3I5S A;  3RKY A;  4CC7 A;  4C92 E;  1VQ8 A;  4RTY A;  5FU6 B;  2A7Y A;  4GLM A;  3QSU A;  3OY9 A;  1HXD A;  4AFS C;  2C0O A;  2E3H A;  3PGG A;  1VQ4 Q;  2E65 A;  3I35 A;  4FM4 B;  3PMI A;  2LQ8 A;  2AKL A;  1WXB A;  1OEB A;  2LTO A;  2Y4Y A;  2CZ0 B;  2M16 A;  3CCS A;  1GCP A;  3LGF A;  2JTE A;  4RCB A;  3QDR B;  2E5K A;  3OQ5 A;  5GAO q;  1JXM A;  1M9S A;  3SD4 A;  1Q81 R;  5L23 A;  1PNJ A;  2H3E B;  3OSV A;  2FRW A;  2NUT B;  3V8L A;  3H6Z A;  1X6B A;  1WA7 A;  2JZ2 A;  4BD3 A;  4M78 B;  1VQ5 A;  2CUD A;  1N27 A;  1GFD A;  2V1R A;  2O2O A;  3LH5 A;  2JOY A;  4JRQ A;  1X75 C;  1D0Z A;  1NJI R;  2VWF A;  3T9N A;  2DA9 A;  3AHU A;  5A0L A;  4Y92 A;  2CS7 A;  3I9Q A;  2CP5 A;  3PVL A;  3JB9 D;  4M75 C;  3VS0 A;  2FB7 A;  5IH2 A;  2QA4 Q;  1K9M U;  3L2W A;  4OB2 B;  5C6S A;  2LZ6 B;  4E6R A;  1YN8 A;  5J26 A;  5C0M A;  5M9O A;  2PU9 B;  3E2U A;  2DX1 A;  2E6N A;  2F2V A;  2QEX A;  2ZPI B;  1H3H A;  3CCV T;  1VYV A;  2VAS A;  5GAN j;  2VC8 A;  1U1T A;  1OX9 A;  1R0C B;  1ZA2 B;  3CCU T;  2K5L A;  2VYT A;  1WLP B;  4L5G A;  3H0F A;  3UAT A;  2P4T A;  1CSK A;  2RQT A;  2MYS A;  1H8K A;  4LN2 A;  2J6F A;  4A54 A;  1ZSZ C;  3RBB B;  2FZK B;  1UGR B;  5LJ5 j;  1WHK A;  2KRS A;  1QVP A;  2RJD A;  1G5V A;  4BB7 A;  1M8M A;  5GMK j;  1KQS A;  2DXT A;  1N8R R;  1QVF P;  4C0G A;  2XHC A;  4E2F B;  1J3T A;  2KNB B;  3CC2 Q;  4J8O A;  4EMK A;  3QXE B;  4F17 A;  1D0X A;  4OB0 B;  2E5Q A;  4NL2 A;  1JXO A;  3ZFJ A;  2FPE A;  2RQU A;  4HT8 A;  3A5Z B;  4E7L A;  4J83 A;  2K9G A;  3CCR T;  5KYW B;  3G4S Q;  2GNC A;  3CCJ Q;  1S72 T;  1UJ0 A;  3QYH B;  3QBY A;  2EJF A;  4BI8 B;  1LVK A;  4J9C A;  1WIE A;  4LDY A;  2W10 A;  3OA6 A;  3VYH B;  3QII A;  1G3Y A;  2O31 A;  5CIU A;  2X4Y A;  1VQL A;  1QQJ A;  1JO8 A;  3CCE Q;  1HSQ A;  4J9H A;  1WFW A;  2VXE A;  3DLM A;  1OZ3 A;  3M55 A;  2DPP B;  1B07 A;  2OTL Q;  3HHT B;  3JB9 I;  3IQL A;  2DYI A;  5IXB A;  4FYW B;  4M78 D;  4E7S A;  1YJ9 T;  4M75 G;  3JB9 F;  2IPO B;  2FHD A;  4MML A;  7AT1 B;  3L2U A;  1B34 B;  3OB9 A;  2CSQ A;  2RI3 A;  1VQ8 T;  1UGP B;  2L2P A;  2EIF A;  1VQN T;  3KBG A;  1KJW A;  3WVD B;  5EC7 A;  2RHX A;  2RI2 A;  2MWO A;  2AIR B;  4PK4 A;  1OPL A;  2B8A A;  4C8Q G;  1EX4 A;  1XTD A;  1Y07 A;  4M7D A;  1UTI A;  3RMS A;  1M27 C;  2YSQ A;  3CXC A;  4JPB W;  3OW2 P;  1Q86 U;  4XQ3 A;  1Q82 R;  2DL8 A;  5CR2 A;  2DNU A;  4N0A C;  3CC4 A;  1TS9 A;  5HY6 A;  2CRE A;  2D0Q B;  4B9X A;  3KXT A;  2HD0 A;  3SB2 A;  5DY9 A;  4ZGJ B;  4F7U F;  3JCM X;  5DLQ E;  2DAQ A;  3LYI A;  5FRN A;  5FRO A;  2JNG A;  1VQ5 T;  3M0U A;  2HQE A;  1D1C A;  3H9N A;  5GAO m;  3OYF A;  5GAM j;  4J9G A;  1V29 B;  2ZGW A;  2DXB A;  3OYB A;  3OYJ A;  2X9H A;  2LJ0 A;  4FW1 A;  4J7I A;  4OML A;  1RLP C;  1WJR A;  1SKU B;  1G3W A;  2L8D A;  1U3O A;  4M77 A;  1TUG B;  1WDX A;  1QCF A;  1M30 A;  1WZO A;  1D09 B;  4DBQ A;  4QT7 A;  2M51 A;  3OYI A;  3CC7 A;  4IIM A;  4J6Y A;  1OOT A;  2COY A;  3X24 B;  3CCV Q;  3V7C A;  2KXC A;  3TEE A;  4ELZ C;  1XQH A;  1QWE A;  2NUP A;  1IHW A;  1GXI E;  3CCU Q;  3NFC A;  2KK4 A;  2P0K A;  8ATC B;  1KC8 R;  4CC4 B;  3TU4 K;  3OBY A;  4JRP A;  1AVZ C;  1M1K C;  1UJY A;  2KEA A;  4IUU A;  2R57 A;  1U5S A;  3NMZ C;  3I5R A;  3O5Z A;  2LJ3 A;  4LD6 A;  1ZSZ B;  1KD1 R;  2OX7 A;  2AHJ B;  3OYM A;  4JDS A;  4II1 A;  3VS7 A;  1JJ2 A;  2DEU A;  3OYG A;  1W6X A;  4LE9 A;  2GQV A;  2QQR A;  3QUI A;  1TU0 B;  3M57 A;  1WJS A;  1XOV A;  1Q7Y R;  5GAO n;  2LMJ A;  1YP5 A;  2YUP A;  2HDA A;  5ECA A;  2EGC A;  3CCR Q;  3SEM A;  3C0C A;  2Y90 A;  4PFZ A;  1S72 Q;  2PQW A;  4ORZ A;  1SF9 A;  1NLP C;  1BI2 A;  2M0Y A;  4M7A D;  2A36 A;  2DJZ A;  2O4X A;  2FEI A;  4HCC A;  1QP2 A;  1E6G A;  2HZY A;  2J06 A;  2JTM A;  2I2L A;  3HFN A;  1EFN A;  2J05 A;  3SWN C;  4PJJ A;  1UGV A;  2X4W A;  2RHU A;  4C5E A;  1OV3 A;  1Y96 B;  1GFC A;  3LW5 E;  4AT1 B;  1WI7 A;  5A0G A;  1AWW A;  2E10 A;  1VQL T;  2ABL A;  5AYF A;  3U23 A;  4JJN K;  2P84 A;  1JU5 C;  4LUD A;  3HFO A;  1PRL C;  1YJ9 Q;  1KQS P;  2XK0 A;  3MEW A;  2HSP A;  1YI2 A;  4EIK A;  1D3B A;  1D1B A;  4HVV A;  2W0Z A;  4A53 A;  1VQN Q;  1ZBJ A;  5KYY B;  4WF2 A;  1SRM A;  1Q81 C;  2J6K A;  3FJP A;  3VJP A;  2COZ A;  3JCM h;  4TVR A;  1UHC A;  3OMC A;  4PFO A;  2ESW A;  2MOX A;  1M3C A;  1NPP A;  3C4S A;  1NJI C;  4PJL A;  1WHL A;  1PKS A;  2QI2 A;  2L3S A;  4M77 E;  2DIL A;  4XTX A;  1SPK A;  2EQK A;  5LJ5 h;  4PKC C;  4PJO A;  1SHF A;  2DZ9 A;  3CEY A;  2HQH A;  3R6N A;  5GMK h;  4A4E A;  4XTW A;  1VQ5 Q;  4IUV A;  4IUQ A;  1Q95 G;  3VYG A;  2CKK A;  3EG1 A;  2MIO A;  1WXU A;  3BDL A;  4XTY A;  4KUI A;  1WQW A;  1ZHI A;  4CI0 C;  4X9C A;  1GBQ A;  3S3N A;  1MUZ A;  2BIV A;  3HSB A;  2HCK A;  2E12 A;  4KRT A;  2ENM A;  2V8I A;  3SHW A;  1IGU A;  1VQK A;  5CKH A;  3BY7 A;  4QQG A;  3OYE A;  3KUF A;  4QQ6 A;  2D9T A;  2KR3 A;  3X20 B;  3C94 A;  4C0D B;  2EFI A;  3JB9 G;  4OMQ A;  1Y57 A;  3NTI A;  5D6X A;  3QJ6 A;  4M7A F;  4C92 A;  2AZV A;  3D7S B;  1RI0 A;  4N4I A;  2LRQ A;  5GAN g;  4F14 A;  3CXC P;  4J6X A;  2QG9 B;  2DM1 A;  2F2X A;  4FT2 A;  4QVD A;  3JCM f;  4ME7 A;  2KSS A;  1N8R C;  2CP6 A;  2XIC A;  1XJW B;  5LJ3 g;  5LJ5 g;  2EYX A;  5GAN f;  2XU8 A;  2HKN A;  3JCM e;  4FL6 A;  2RHI A;  2XMF A;  1LOJ A;  2XG8 D;  5LJ5 f;  4HCB A;  1G3S A;  1W70 A;  3QWY A;  4HVU A;  4BE0 A;  1WHH A;  2EGA A;  4F7U G;  1VYU A;  3A8H B;  3GF5 A;  1RAI B;  4A63 B;  5GAO l;  1VQ6 A;  4XAX B;  3C12 A;  3PVQ A;  5LJ5 e;  3CCM A;  1K9A A;  1GRI A;  2NLU A;  5GMK e;  3GOX A;  3M58 A;  2WAC A;  4M75 E;  3QPH A;  4RMO A;  4ANJ A;  4AG1 C;  1T0H A;  1X27 A;  2M02 A;  1MGQ A;  2DIQ A;  4MZT A;  4OMN A;  3LH0 A;  2RHZ A;  1I07 A;  2WSF E;  3PMT A;  4JLI A;  3OYY A;  3EG9 B;  4OGE A;  2RN8 A;  1UE9 A;  3MEU A;  5FU7 C;  2QK0 A;  4C8Q E;  4NL3 A;  1M1K U;  3RER A;  2R5A A;  4DEX A;  4ZNX A;  2RB6 A;  4X9D A;  3CBO A;  2YRV A;  4LXC A;  1LPL A;  1VQL Q;  4VUB A;  1NYG A;  2CT3 A;  1K4U S;  4DOW A;  1X6O A;  4WCI A;  1VIE A;  2VUB A;  3QO3 A;  4RTV A;  2KRN A;  4Z88 A;  2HKQ B;  3VS3 A;  4JS4 A;  1KG1 A;  3RKX A;  1KSW A;  1ABQ A;  3FRN A;  3CCQ A;  2JMC A;  2LX9 A;  3QHS A;  3LGL A;  3HKS A;  2F5T X;  2FO0 A;  2LQW A;  5KCH A;  1NE8 A;  2MI6 A;  2NYS A;  4PLL A;  1Q82 C;  1JJ2 P;  1YJW A;  5IHN A;  2BE7 D;  4M78 G;  3JCM Q;  3CD6 A;  3JCM d;  1RL2 A;  2MMP A;  3TVT A;  1DJ7 B;  5GAN 8;  4DOV A;  3WVE B;  3DLL A;  1BIA A;  1M1F A;  1KQS S;  1BKB A;  4ZTF A;  2LC4 A;  4D8D A;  4HVW A;  4IUP A;  3L2R A;  5LJ5 d;  2DTO A;  2KYM A;  4DQ2 A;  1VQM T;  1TUC A;  4FIB A;  1I8F A;  3SDZ A;  2YRC A;  4M7A C;  1VQO A;  2ROT A;  3BDU A;  2HMA A;  2D8J A;  2QDL A;  3JSC A;  2X3W D;  5GAM g;  2CZ1 B;  3L2Z A;  3G7Z A;  1ZSG A;  1EIF A;  3CQT A;  3GLX A;  2K2V A;  3REB B;  4EPC A;  2KQW A;  4Q5W A;  2BTT A;  3QYG B;  2BE9 B;  3V8K A;  4R0K A;  2O9V A;  5GAM f;  3EGU A;  1VQK T;  2K79 A;  2LCC A;  3P8B B;  3NTK A;  2RH2 A;  1BK2 A;  2RI5 A;  2QQ9 A;  4B6M A;  2KE9 A;  5HKC A;  5GAM e;  5IXF A;  1KC8 C;  5GJW B;  3J7A F;  1NJI U;  1UB4 A;  1VQ7 T;  1LNX A;  3FEO A;  2LCS A;  2YRD A;  4RTZ A;  2CH4 A;  4M4Z A;  1NEB A;  1EZZ B;  5FWC A;  3BW1 A;  1W1F A;  2X3X D;  4DEY A;  2VVK A;  4OF1 A;  1VOM A;  4YTL A;  1K1Z A;  1RAG B;  2PZ1 A;  2Z0W A;  3EH2 A;  3E9G A;  5IT9 E;  1JBM A;  3M0P A;  4DBH A;  2FVU A;  2I0N A;  4RTX A;  2FPD A;  1Q7Y C;  3E9F A;  2E1H A;  3G71 T;  1D1A A;  2DD5 A;  2QAS A;  4KBM B;  1QCO A;  1OYX A;  2DXC A;  1AOJ A;  2YDL A;  2DL3 A;  1VQ6 T;  4ELY C;  1WHG A;  1M8V A;  3ER0 A;  1X69 A;  1SRL A;  5IHI A;  8AT1 B;  1PM3 A;  1YJN A;  3LX7 A;  2DLP A;  1M2V A;  4E7K A;  1N8R U;  2LNV A;  2IVW A;  4UC4 A;  1QVG A;  2FG0 A;  5IHK A;  2DEQ A;  3JCM b;  1JRI A;  1K76 A;  4M7A G;  2QYZ A;  1G3T A;  4M7D B;  4QKU A;  2EQI A;  5FU7 B;  5GAM d;  4P5N A;  5GAN 2;  1P92 A;  2O88 A;  2RHY A;  3PT9 A;  3OS5 A;  2D1X A;  2EGE A;  3INZ A;  2LDM A;  2GQI A;  4OP0 A;  3UA7 A;  2G3R A;  3CCQ T;  3L42 A;  1K73 R;  2YUN A;  2HBP A;  3GPL A;  2RNA A;  4BE2 A;  3OYD A;  2GCX A;  2MWP A;  4R55 A;  1YJW T;  2EYZ A;  2YLC A;  3CPW A;  4KGZ B;  1RAF B;  5GAO p;  2EW3 A;  3CME A;  2HNI A;  4PLI A;  4XK8 E;  4KH1 B;  1IB8 A;  1YIT T;  2RK2 A;  2DO3 A;  4OGC A;  2OTJ T;  1ACM B;  1G83 A;  4R56 A;  3I55 T;  1VQM Q;  4XU1 A;  1ZUU A;  5I22 A;  5DM7 R;  2L3R A;  1JJ2 S;  2B86 A;  4ZGD B;  5KH6 A;  1WJQ A;  1SSH A;  3TCJ A;  3HTR A;  5GMK l;  4BI4 A;  3EGX A;  2A3L A;  1F1B B;  1JEG A;  4M7A B;  1BCO A;  2EQU A;  2NUP B;  3THK A;  2FZC B;  2HL5 C;  2KGT A;  4ATO A;  1OU8 A;  4HCZ A;  1VQK Q;  3CBM A;  1BB9 A;  1UHF A;  3CCS T;  2IIM A;  1ZX6 A;  1YHQ A;  2QTX A;  3A8G B;  2H8H A;  2PUO B;  5HCK A;  2FL7 A;  1SHG A;  4F7U E;  1YCS B;  2EKH A;  2E6Z A;  4QQD A;  1VQ7 Q;  2F1L A;  1O9S A;  2HQX A;  1A0N B;  3PE0 A;  2LP5 A;  2DFU A;  1O75 A;  2GBQ A;  1FYN A;  2ZPB B;  1Q86 R;  4HT9 A;  2R5M A;  2VGN A;  2WSC E;  1SSF A;  3MKD A;  2L0A A;  3L2V A;  3VRZ A;  2RF0 A;  2FPF A;  2O4X B;  5KYW A;  4HXJ A;  4C0D C;  1K8A R;  2OJ2 A;  2QQS A;  2KRO A;  4BDY A;  2RO0 A;  3G71 Q;  3S3M A;  2VXF A;  1B3Q A;  4RTT A;  4M7D D;  3RUX A;  3EHQ A;  2GFU A;  3MHX A;  2RK1 A;  1SG5 A;  3PIO A;  3KFV A;  3JCM V;  2RA2 A;  1VQ6 Q;  2QEX T;  1KC8 U;  1AWX A;  2D8H A;  2RD1 A;  5CO7 A;  5KYX A;  4LD9 K;  4BE1 A;  1I1J A;  5FLX E;  3X28 B;  3C95 A;  4QVC A;  4CRI A;  4RG8 A;  2YWW A;  4M78 E;  4C5G A;  3EHR A;  1TUD A;  3JV3 A;  1Y0M A;  1HD3 A;  1GCQ A;  3VS2 A;  1YCY A;  2L89 A;  2JW4 A;  2FYK A;  4QVZ A;  1KQ2 A;  1AT1 B;  4C5I A;  1UEB A;  4M77 D;  1Q7Y U;  2QAZ A;  4CC2 A;  1PG5 B;  3MP1 A;  2QA4 A;  2ROL A;  3FC3 A;  1YWO A;  3RIR A;  1Y71 A;  1IRX A;  4KGX B;  3OMG A;  2QTV A;  2DVJ A;  4PJO B;  3CCQ Q;  3X26 B;  1QVF S;  1LCK A;  4OMM A;  2QQB A;  4L59 A;  4X1V A;  2VB6 A;  3H41 A;  4ESR A;  1U8R A;  2IG0 A;  1H64 1;  5CK9 A;  1YJW Q;  3VS4 A;  1BI3 A;  2CT4 A;  1YBY A;  1Y7X A;  2L3Q A;  2CP2 A;  4X34 A;  3A98 A;  3FIF A;  3GIB A;  2KYB A;  1YIT Q;  3FJ5 A;  2OTJ Q;  1H92 A;  1W2B A;  3CME T;  3I55 Q;  2SRC A;  1VIF A;  3HRS A;  1ZA1 B;  4Z8A A;  2ED0 A;  4M75 A;  1OQK A;  4MDW A;  1QVG P;  1H3Z A;  3VUZ A;  2A28 A;  3A8M B;  4C92 B;  2XDP A;  4JS5 A;  4C0F A;  3JB9 H;  4HA8 A;  1VQ8 Q;  1UDL A;  2M9U A;  4N4H A;  5LL6 S;  2YT6 A;  4M7D F;  4C8Q A;  2C06 A;  1PD0 A;  4JJC A;  2DL7 A;  2ZPE B;  4FU6 A;  5DLO A;  3CCS Q;  2DZC A;  2KT1 A;  1GBR A;  4RCC A;  4PL6 A;  3R6O A;  2CP0 A;  3DKM A;  2MK5 A;  3ULR B;  4KGV B;  3OYK A;  5KE3 A;  1YHQ T;  1ZSZ A;  2EPD A;  4A4H A;  1MV3 A;  2E64 A;  3CPW P;  3CC4 T;  4Y28 E;  1NYF A;  3RKW A;  2O9S A;  1PKT A; 
#chains in the Genus database with same CATH homology
 4A54 A;  1MHN A;  5KCH A;  1NE8 A;  3E1S A;  1UGR B;  2MI6 A;  4PLL A;  5LJ5 j;  1Q82 C;  3MO8 A;  1YJW A;  4XU3 A;  1QVP A;  2RJD A;  3HL8 A;  4M78 G;  1U1S A;  3JCM Q;  3JAM E;  3JCM d;  5GAO r;  4IKF A;  3OW2 S;  4M75 B;  3PIP A;  1RL2 A;  1G5V A;  4BB7 A;  5GMK j;  1KQS A;  2DXT A;  2MMP A;  4C0G A;  2XHC A;  5CQY A;  4ZN1 A;  3QKJ A;  3CMA A;  1DJ7 B;  4XU2 A;  5CKE A;  5GAN 8;  4DOV A;  3PFS A;  4O5V A;  4M77 F;  3WVE B;  2EYQ A;  2ZZD A;  3DLL A;  1D3B B;  4OVA A;  1BIA A;  4J8O A;  4EMK A;  2DD4 A;  1M1F A;  1B34 A;  1VQ9 T;  1KQS S;  3QXE B;  1BKB A;  4ZTF A;  2LC4 A;  1KD1 U;  4C92 G;  4OB0 B;  2E5Q A;  3M4Y A;  4IUP A;  4C8Q B;  1YJN T;  4NL2 A;  3HPW A;  3L2R A;  2F5K A;  4M7A A;  2CGH A;  2DTO A;  1VUB A;  3ZFJ A;  4ZN3 A;  4EMK C;  4DQ2 A;  5LJ5 d;  1VQM T;  4HT8 A;  4M7A E;  3A5Z B;  4E7L A;  4J83 A;  5I21 A;  3JCM g;  4FIB A;  5D6Y A;  1I8F A;  2XID A;  3SDZ A;  4Z02 A;  2CZ6 B;  2ZPG B;  3X25 B;  3CCR T;  4M7A C;  1VQO A;  3CC7 T;  3BDU A;  3QJY A;  3JSC A;  1S72 T;  3LWI A;  3J81 E;  3TRE A;  5GAM g;  3QYH B;  2CZ1 B;  3JCM c;  3QBY A;  2EJF A;  2K57 A;  4BI8 B;  2DTI A;  3G7Z A;  2P0Q A;  3GNF B;  3L2Z A;  4C0Z A;  3S6W A;  4PJO D;  1BIB A;  1EIF A;  4LDY A;  3GLX A;  3M5A A;  1I4K 1;  2K2V A;  3VYH B;  4M78 F;  3OBW A;  3Q1J A;  3OA6 A;  2EWN A;  3A8L B;  2DVE A;  4EPC A;  2KQW A;  1G3Y A;  3QII A;  4Q5W A;  5CIU A;  2X4Y A;  3QYG B;  2ZPH B;  1R8O B;  4A4F A;  1X01 A;  1IRE B;  1VQL A;  3V8K A;  5GAM f;  5CVI A;  2VXE A;  3M55 A;  3DLM A;  1OZ3 A;  3JCM J;  4QW2 A;  5GAN 4;  2LCC A;  1VQK T;  3P8B B;  2DPP B;  5FRM A;  3HHT B;  4MZM A;  3NTK A;  1OI1 A;  3JB9 I;  2RH2 A;  2DXU A;  2RI5 A;  2QQ9 A;  2QQA A;  1AHJ B;  4L6V 5;  5HKC A;  5GAM e;  4M78 D;  3LWH A;  1KC8 C;  1UGQ B;  1YJ9 T;  3A8O B;  4M75 G;  3JB9 F;  3J7A F;  1NJI U;  1UB4 A;  2FHD A;  4MML A;  3L2U A;  1VQ7 T;  1B34 B;  1K73 C;  3OB9 A;  1LNX A;  3EFR A;  2JN0 A;  2RI3 A;  3FEO A;  3M4G A;  1VQ8 T;  1UGP B;  4NOY A;  5GAN 7;  2EIF A;  1VQN T;  3KBG A;  3WVD B;  2RHX A;  5CKB A;  4OMF B;  2RI2 A;  2MWO A;  1WNL A;  3BW1 A;  4C92 D;  3G6E T;  2M0O A;  2B8A A;  4C8Q G;  5GAN 6;  1XTD A;  1Y07 A;  4OF1 A;  1YIJ A;  4M7D A;  4LDW A;  4YTL A;  3CC2 A;  4N0A A;  3RMS A;  3E9G A;  5IT9 E;  4M7D E;  3CXC A;  1M90 C;  1JBM A;  4JUV A;  3CCV A;  1Q86 U;  4XQ3 A;  3L2Q A;  2FVU A;  4V2S A;  3LLR A;  5CR2 A;  4M7D C;  2XKO C;  1Q7Y C;  4N0A C;  3E9F A;  2BUD A;  2E1H A;  2HAX A;  3G71 T;  3CC4 A;  5HY6 A;  2X4X A;  4MDX A;  2R58 A;  2DD5 A;  4KBM B;  3KXT A;  2D0Q B;  4B9X A;  2HD0 A;  2E41 A;  2PUK B;  5DY9 A;  3SB2 A;  4ZGJ B;  4F7U F;  3VU3 C;  4XTV A;  3G4S A;  3NTH A;  1ZQ1 A;  3JCM X;  3CCJ A;  1OYX A;  4BI3 A;  5A2Q E;  3DB4 A;  5DLQ E;  2DAQ A;  1VQP T;  2KVQ G;  3LYI A;  3RES A;  5FRN A;  5L8R E;  1N9R A;  2JNG A;  5FRO A;  1VQ5 T;  2DXC A;  4C5H A;  2HQE A;  3GNG A;  1I5L A;  1VQ6 T;  1W4S A;  4ELY C;  1FWZ A;  2MF2 A;  5GAO m;  3OYF A;  4EDU A;  5GAM j;  2E70 A;  4BY6 C;  1M8V A;  3ER0 A;  4KT0 E;  2XDD A;  1V29 B;  2ZGW A;  2DXB A;  3CCE A;  3OYB A;  1NZ9 A;  2CYZ B;  5GAN h;  3OYJ A;  4J7I A;  1YJN A;  1YI2 T;  3LX7 A;  1WJR A;  2EQM A;  4M75 D;  5CQX A;  2P0P A;  3CCL T;  2LNV A;  4E7K A;  1G3W A;  1LJO A;  4GLK A;  2L8D A;  1N8R U;  2OTL A;  1VQM A;  4M77 A;  2IVW A;  4UC4 A;  2DTH A;  1QVG A;  2DEQ A;  2LQK A;  3V7R A;  3JCM b;  1JRI A;  5LJ3 h;  4N4G A;  3OYI A;  5FU6 C;  4DA4 A;  4M7A G;  3FDR A;  1G3T A;  3CC7 A;  4M7D B;  3OYH A;  4J6Y A;  5FU7 B;  1N6A A;  3PTA A;  4M77 C;  4P5N A;  5GAM d;  3UWN A;  5GAN 2;  1S72 A;  4A4G A;  3F70 A;  1P92 A;  3X24 B;  1QVG S;  3S3O A;  4C8Q D;  4ZGE B;  5GAN 5;  2RHY A;  3PT9 A;  3OS1 A;  3OS5 A;  3HRT A;  2KY9 A;  3EFS A;  4PJO F;  3V7C A;  2RJF A;  3TEE A;  3INZ A;  4ELZ C;  1XQH A;  1KHI A;  2LDM A;  2M1H A;  1VQ4 T;  1GXI E;  1K9M C;  3NFC A;  2KK4 A;  4OP0 A;  2P0K A;  2YHT A;  3TU4 K;  2H3J A;  3OBY A;  4JRP A;  5CAI A;  4OB1 B;  2G3R A;  3J80 E;  1Y96 A;  3CCQ T;  3L42 A;  4BAC A;  1M1K C;  4KUL A;  2DKG A;  3E19 A;  2HBP A;  2QDY B;  4LDU A;  3GPL A;  2PVG B;  4BE2 A;  3UPU A;  3CPF A;  2V8K A;  4IUU A;  2R57 A;  1K8A C;  3JRZ A;  3OYD A;  4LDV A;  4JRK A;  2GCX A;  2MWP A;  2YLB A;  4LD6 A;  3DB3 A;  4R55 A;  1YJW T;  2YLC A;  3JCM P;  5IN1 A;  3CPW A;  4M78 C;  2VV5 A;  1UGS B;  5GAO p;  2AHJ B;  3OYM A;  1VQ7 A;  3CME A;  2HNI A;  4JDS A;  4II1 A;  4PLI A;  2D6F A;  3N5B B;  4XK8 E;  3CMA T;  2XDB A;  2KDS A;  1YIT T;  2RK2 A;  2DO3 A;  1Q81 U;  3LGL A;  4OGC A;  1JJ2 A;  2OTJ T;  3MP8 A;  3CPW S;  3OYG A;  2KAF A;  3VKI A;  1VQN A;  2GQV A;  2L5Q A;  2QQR A;  3QUI A;  3HRU A;  4R56 A;  3M57 A;  1WJS A;  2PVO B;  1XOV A;  3QG1 A;  4OB3 B;  4C92 F;  4D6W A;  3I55 T;  5GAO n;  2EJG A;  3ME9 A;  4XU1 A;  1QVF A;  5DM7 R;  1M1G A;  2L3R A;  4J5Y A;  4ZTJ A;  1JJ2 S;  4ZGD B;  3GP8 A;  3MP6 A;  4JLG A;  5KH6 A;  1WJQ A;  3TCJ A;  2V8J A;  4EMK B;  2Y90 A;  5GMK l;  2PQW A;  4O6J A;  4BI4 A;  1BI2 A;  3SWN A;  3I56 A;  4M7A D;  2DJZ A;  2A3L A;  2O4X A;  5D6W A;  3P8D A;  1QP2 A;  4HCC A;  4M7D G;  3FLG A;  4M7A B;  2EKO A;  2JTM A;  3OS0 A;  2EQU A;  3G71 A;  2QA4 T;  1QP3 A;  2EAY A;  1N9S A;  1IZ6 A;  1WQ7 A;  2I2L A;  3EAE A;  3HFN A;  3L1A A;  3URG A;  3HP9 A;  5I2M A;  3ASK A;  2LVM A;  3SWN C;  5GAN e;  1KD1 C;  5LJ3 f;  3QZ5 B;  5CKF A;  2LCL A;  2X4W A;  2RHU A;  2LT1 A;  4C5E A;  4ATO A;  3WXM B;  3O8V A;  1Y96 B;  2EJ9 A;  1KQ1 A;  4HCZ A;  1OZ2 A;  3CBM A;  3LW5 E;  3VUB A;  3CD6 A;  5A0G A;  2RJE A;  3CCS T;  2PVD B;  1KHC A;  1M5Q 1;  2E10 A;  3V7S A;  3OYA A;  1VQL T;  5LJ3 e;  4LDX A;  5AYF A;  1YHQ A;  4JJN K;  4E7H A;  2QTX A;  4IUT A;  3A8G B;  4BDZ A;  3M53 A;  2PUO B;  4F7U A;  3CCU A;  3HFO A;  3H8Z A;  3CXC S;  5HK3 A;  2FL7 A;  4F7U E;  1BYM A;  5CCA A;  4PNO A;  2E6Z A;  4QQD A;  2XK0 A;  3OYN A;  1O9S A;  2HQX A;  3M59 A;  3MEW A;  4E7J A;  1YI2 A;  4M75 F;  2EQJ A;  1D3B A;  1QW1 A;  2DIG A;  2XI9 A;  4A53 A;  1O75 A;  2QXF A;  1WPY A;  5GMK m;  4MZP A;  2ZPB B;  3QZ9 B;  4WF2 A;  1Q81 C;  5J3B A;  2K4Y A;  3CCM T;  3FJP A;  3VJP A;  4HT9 A;  2R5M A;  3JCM h;  2VGN A;  3SFM A;  1XNI A;  3ZBD A;  2XD0 A;  4M77 G;  2WSC E;  1SSF A;  4TVR A;  4JRI A;  3OMC A;  1WGS A;  4J6W A;  5HK0 A;  4C8Q F;  3OSS C;  3L2V A;  3P8H A;  4E7I A;  1VQ9 A;  3RMQ A;  3SWN B;  3MEA A;  4C8Q C;  3M9Q A;  1YIJ T;  2O4X B;  1BI1 A;  4EMG A;  4FSX A;  5GAM h;  3CC2 T;  4C0D C;  2QQS A;  1NPP A;  4BDY A;  2RO0 A;  3C4S A;  4KUD K;  1NJI C;  2QI2 A;  3S3M A;  2VXF A;  4M77 E;  4M7D D;  4XTX A;  3RUX A;  5GAN 3;  3PNW C;  2EQK A;  3MCA B;  3OYL A;  5LJ5 h;  4PKC C;  2GFU A;  3CCR A;  4PJO A;  1FXX A;  3MHX A;  2DZ9 A;  4PJO E;  2RK1 A;  3CEY A;  2LT4 A;  3OW2 A;  5GMK h;  4A4E A;  4XTW A;  3PIO A;  4IUV A;  4IUQ A;  3JCM V;  3VYG A;  2RA2 A;  5LJ3 j;  1NPR A;  2CKK A;  3G4S T;  3CCJ T;  2QEX T;  4PJO C;  3BDL A;  4RG2 A;  4XTY A;  4A4K A;  1KC8 U;  4F7U B;  4KUI A;  5KCO A;  2RD1 A;  1WQW A;  1ZHI A;  5CO7 A;  4CI0 C;  4X9C A;  1Q86 C;  4EMH A;  4LD9 K;  2ZPF B;  4BE1 A;  2K5F A;  1K73 U;  2OAU A;  2X35 A;  5CKD A;  3S3N A;  2BIV A;  2GFA A;  3V8J A;  3HSB A;  5FLX E;  5GAN d;  2E12 A;  4XTU A;  1YIT A;  2DK3 A;  2V8I A;  2OTJ A;  2X4J A;  3X28 B;  1VQK A;  1I81 A;  5CKH A;  3BY7 A;  3C95 A;  4M78 A;  4QQG A;  4CRI A;  4MMK A;  3MET A;  4RG8 A;  4BUG A;  4QVC A;  3OYE A;  3KUF A;  4M78 E;  2BKD N;  4BY6 B;  3I55 A;  3JB9 J;  3CCE T;  4C5G A;  4QQ6 A;  2MAM A;  2VGM A;  2D9T A;  4B9W A;  3CCU T;  3X20 B;  3OS2 A;  5I2S A;  1YCY A;  5LJ3 d;  2OTL T;  2L89 A;  5KE2 A;  1HK9 A;  3C94 A;  4C0D B;  2FYK A;  4QVZ A;  1YJ9 A;  1KQ2 A;  3CD6 T;  2EFI A;  2RJC A;  1PSE A;  3JCM W;  3JB9 G;  1TH7 A;  5EG2 A;  1M90 U;  3NTI A;  3RKY A;  5D6X A;  3QJ6 A;  1FX7 A;  2KMT A;  2K5I A;  4M7A F;  4C92 A;  4C5I A;  1UEB A;  1RI0 A;  4N4I A;  4M77 D;  3UDC A;  4C92 E;  1Q7Y U;  1VQ8 A;  2LRQ A;  4IUR A;  5FU6 B;  3MP1 A;  5GAN g;  4FT4 A;  2A7Y A;  2QA4 A;  3QSU A;  3OY9 A;  1HXD A;  4M77 B;  3PGG A;  3FC3 A;  2E65 A;  4J6X A;  3G6E A;  2ZCF B;  2K3X A;  1M4Z A;  4C92 C;  3FB9 A;  4FM4 B;  3PMI A;  1Y71 A;  4XTZ A;  3RIR A;  3OMG A;  4FT2 A;  2LQ8 A;  4QVD A;  3JCM f;  4ME7 A;  2KSS A;  1N8R C;  2XIC A;  2LTO A;  2Y4Y A;  3VV0 A;  4PJO B;  5LJ3 g;  5LJ5 g;  2CZ0 B;  2O01 E;  3X26 B;  2M16 A;  3CCS A;  1QVF S;  5GAN f;  2XU8 A;  3LGF A;  4RCB A;  2QQB A;  2Y4X A;  4L59 A;  3QDR B;  3OQ5 A;  1VQO T;  3JCM e;  5GAO q;  1U8R A;  2IG0 A;  1H64 1;  4FL6 A;  1M9S A;  4Y91 A;  5CK9 A;  3SD4 A;  2RHI A;  1BI3 A;  1LOJ A;  4RKU E;  1YBY A;  1Y7X A;  2XG8 D;  4X34 A;  3OSV A;  5LJ5 f;  4HCB A;  1G3S A;  3V8L A;  2RM4 A;  1Q82 U;  2WSE E;  3H6Z A;  3FIF A;  4NS5 A;  4F7U G;  4BE0 A;  3GIB A;  3A8H B;  3GF5 A;  1VQP A;  2JZ2 A;  4BD3 A;  4M78 B;  1W2B A;  1VQ5 A;  1N27 A;  3CME T;  2JOY A;  2JVV A;  5GAO l;  4JRQ A;  1VQ6 A;  1X75 C;  1VIF A;  3C12 A;  4XAX B;  5LJ5 e;  3HRS A;  3OYC A;  3M54 A;  3CCM A;  3T9N A;  4M75 A;  2CZ7 B;  1W2B S;  2NLU A;  5GMK e;  4MDW A;  3GOX A;  1H3Z A;  1PSF A;  3M58 A;  2WAC A;  4M75 E;  3QPH A;  3VUZ A;  5A0L A;  5GMK i;  3AHU A;  4RMO A;  2CS7 A;  3A8M B;  4C92 B;  2XDP A;  2F69 A;  4JS5 A;  4C0F A;  1MGQ A;  2DIQ A;  4MZT A;  3CCL A;  3JB9 H;  4HA8 A;  3JB9 D;  4M75 C;  3BFM A;  2FB7 A;  2M9U A;  2RHZ A;  3LH0 A;  4N4H A;  2WSF E;  3PMT A;  4JLI A;  5LL6 S;  3UT1 A;  1K9M U;  3OYY A;  4OGE A;  3L2W A;  4OB2 B;  3I56 T;  4M7D F;  4E47 A;  5C6S A;  4J7F A;  1ZBX A;  4C8Q A;  2JUF A;  2C06 A;  3MEU A;  5FU7 C;  4C8Q E;  2GF7 A;  4NL3 A;  1M1K U;  2ZPE B;  4FU6 A;  4GY5 A;  5J26 A;  5C0M A;  5DLO A;  5M9O A;  3RER A;  2JTF A;  2R5A A;  3MEV A;  3CBP A;  1K8A U;  4HKE A;  2PU9 B;  2RB6 A;  4X9D A;  3CBO A;  1JB0 E;  2YRV A;  2DZC A;  2E6N A;  4RCC A;  4VUB A;  4PL6 A;  3R6O A;  3DKM A;  4PJO G;  2QEX A;  4DOW A;  1VQ4 A;  2K3Y A;  1BI0 A;  2ZPI B;  3M56 A;  5A0D A;  3OYK A;  3CCV T;  1X6O A;  4XU0 A;  1VIE A;  2VUB A;  3QO3 A;  5KE3 A;  1YHQ T;  5GAN j;  2VC8 A;  4JS4 A;  1U1T A;  1KG1 A;  3RKX A;  4A4H A;  5IAY A;  2K5L A;  2VYT A;  2E64 A;  3FRN A;  3CCQ A;  4L5G A;  2LX9 A;  3CC4 T;  3QHS A;  2P4T A;  4Y28 E;  5J39 A;  3RKW A;  3ZEH A;  3HKS A;  2F5T X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...