1OV3A

Structure of the p22phox-p47phox complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
LGSPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neutrophil cytosol factor 1
publication title Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase activator
total genus 22
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ov3A01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ov3A02
3O5ZA 2LMJA 4AG1C 1H8KA 1N5ZA 1VYVA 1X6BA 2ECZA 3M0TA 1BK2A 2PZ1A 2K6DA 4RTTA 2KR3A 1WFWA 2YUPA 1VYUA 1CKBA 1ZLMA 2LJ3A 3EG3A 3SHWA 2MOXA 1W70A 4RUGA 2J06A 1BBZA 1E6GA 2DX1A 1UECA 1NYFA 2DM1A 2QDLA 2KE9A 3LH5A 3NHNA 3PVQA 2YT6A 1NG2A 1Y57A 5IXFA 2O88A 1TUDA 4QT7A 4HVWA 3VS7A 3NPFA 1NYGA 3I9QA 2KROA 3TVTA 2CSQA 4JPBW 1ARKA 1UJYA 1BU1A 2C0OA 3R6NA 2D1XA 2EW3A 3M0UA 2FO0A 1WYXA 1M8MA 1CKAA 2DE0X 3VS5A 1WDXA 4ORZA 2LQWA 3H0IA 1UHFA 1UJ0A 2F2XA 1RLQC 2EYZA 4CC2A 2K2MA 1PRMC 5I11A 2EVRA 2BZYA 1X2QA 1GFDA 3M0RA 3UA7A 2DL3A 1VYTA 3M0PA 4M4ZA 1OEBA 1LCKA 2FRYA 2B86A 1T3SA 1Z9QA 3FJ5A 2RF0A 4J9DA 2AKLA 4OMNA 1WXUA 1VA7A 2FPFA 2JMAA 3EG0A 1QLYA 4HCKA 5IHIA 2AKKA 2CUBA 2DA9A 4AFSC 3JV3A 1M3AA 4OMPA 4HVVA 4RTZA 2EYWA 2D0NA 1JU5C 2OI3A 2CH4A 2KT8A 1RUWA 1GRIA 1G83A 2GTOA 1M3CA 1KJWA 4FSSA 1I1JA 1JQQA 2I0NA 3VS0A 1FYNA 2V1QA 2SEMA 1GBQA 1GBRA 1KIKA 1XOVA 1QKWA 2KRMA 1HD3A 1SSHA 2D8HA 5IXBA 1NEBA 3NMZC 5HCKA 2O2OA 2RQRA 3VS6A 2DBKA 2J05A 1ABOA 4KRTA 4OMMA 4GBQA 1UTIA 2JMCA 1K9AA 1X27A 1Z9ZA 2LP5A 1NM7A 2OJ2A 2O9VA 2RNAA 2LJ0A 4JJBA 3GBQA 2GTJA 2P4RA 2A37A 2L3PA 1NEGA 1JO8A 2FEIA 2HBWA 3PVLA 2BTTA 4JZ4A 2FG0A 3RBBB 5FWBA 2DRKA 2V1RA 1HSQA 2GGRA 3VS2A 4OMQA 1U3OA 1U06A 2A36A 5FWCA 4RTXA 2EGAA 2HSPA 4IIMA 1AWWA 2LNHB 1GCQA 2ROLA 2J6KA 1AOJA 4F17A 3REBB 3A98A 2DYBA 1OPKA 2PNIA 1MUZA 1QCFA 1QKXA 2W0ZA 3UATA 1AEYA 2GNCA 3IQLA 3H0HA 2KXDA 1K76A 1X69A 1FMKA 2M51A 2EGCA 2CT3A 1A0NB 4DEXA 1WXTA 1ZUKA 2NUZA 2E5KA 2C0IA 2EKHA 5ECAA 1PNJA 4IIOA 1BB9A 5GJVB 1H92A 4A63B 1ABQA 2KYMA 2KEAA 3H41A 3I5RA 1K1ZA 3EG2A 2DRMA 1PKSA 2L3SA 1GCPA 4JJCA 1AWXA 2DL5A 2J7IA 1SEMA 2DF6A 2ENMA 4X1VA 3QWXX 2CT4A 4Z88A 3VRZA 2D8JA 1PRLC 1M27C 2GQIA 2M0YA 4AG2C 1WI7A 4F14A 2JM9A 2CH4W 3TSZA 1UGVA 2K7AA 3UA6A 2ED1A 2FPEA 2BZXA 2ESWA 2ED0A 1UUEA 4EIKA 2F2WA 4D8KA 1S1NA 4ZNXA 2LQNA 1JXMA 1QWEA 1WX6A 2CREA 4AFZC 2GBQA 3PE0A 2PTKA 2KXCA 1I0CA 1AD5A 1MV3A 1SRMA 1M30A 2DLPA 2YUQA 1JEGA 2J6OA 1SPKA 4J9HA 1RLPC 2AZVA 1ZBJA 3U23A 4LUEA 2VKNA 2KRSA 4LUDA 1GFCA 1PHTA 3UF4A 1IO6A 2A28A 2DBMA 2OAWA 2YUNA 1SHFA 3THKA 1GL5A 1YP5A 3I5SA 3EHRA 2YDLA 1RI9A 4J9EA 1UHCA 1PWTA 4CC3A 1AWOA 1W1FA 1E6HA 1KSWA 4K11A 1OOTA 2K3BA 1UDLA 4Z8AA 2G6FX 4LN2A 3VS3A 2JW4A 2AK5A 2RQTA 2L0AA 1T3LA 4J9FA 1K0SA 5GJWB 5IHNA 4LE9A 1TG0A 1B3QA 5IH2A 1JXOA 3M0QA 2LCSA 2EGEA 4AFQC 4Y92A 1AVZC 2JTEA 1AWJA 4GLMA 2RN8A 2ABLA 1UG1A 2YUOA 4RTVA 1YNZA 2C0TA 1B07A 1QWFA 2EBPA 2EYYA 2HDAA 2HCKA 1YWOA 4OMOA 2DILA 4E6RA 4CC4B 3VRYA 3C0CA 4JJDA 4OMLA 5I22A 4HVUA 1UE9A 2K9GA 2ROTA 3TSWA 2BZ8A 1K0XA 4RTUA 4RTWA 4F16A 2O31A 3QWYA 1U5SA 2DL4A 3H0FA 2DMOA 2JS2A 1T0JA 1OV3A 2W10A 2JM8A 1YWPA 2DVJA 4Z89A 3M0SA 1WLPB 2MIOA 1NLPC 2MCNA 4J9CA 1OPLA 2RQUA 1AZEA 2NWMA 1YN8A 1ZSGA 2H8HA 3VS1A 1SHGA 2CUDA 1WIEA 1HJDA 2JS0A 2LZ6B 3SEMA 3ZL7C 2KRNA 2RPNA 1I07A 2X3WD 2RMOA 2O9SA 1ZX6A 2J6FA 1UFFA 2FPDA 1Y0MA 2LX7A 2DJQA 2KT1A 3CQTA 2DL8A 2L3QA 3KFVA 4WCIA 3I35A 3EHQA 4ESRA 1X2KA 1YCSB 4JZ3A 3VS4A 4HXJA 1ZUYA 4CC7A 2EYXA 2DNUA 2EPDA 1AZGB 1MV0B 2F2VA 4R0KA 2RQVA 2A08A 1CSKA 1SRLA 1WA7A 1E7OA 1V1CA 1WXBA 1X43A 2VWFA 1NLOC 3RNJA 2EQIA 2IIMA 4J9BA 3EGUA 1T0HA 2VVKA 2RQWA 2X3XD 4AFUC 4J9IA 2L2PA 5EC7A 2JXBA 1ZUUA 4DEYA 2XMFA 4J9GA 5IHKA 2KNBB 2JT4A 2SRCA 2LJ1A 2DL7A 2KBTA 1GCQC 1KFZA 3NGPA 2CSIA 1W6XA 3EG1A 1K4US 1H3HA 2KGTA 2FRWA 1X6GA 1TUCA 1J3TA 5FW9A 3ULRB 4LNPA 2YSQA 4RTYA 5L23A 2K79A 2HEQA 1PKTA 4D8DA 2AZSA 3REAB 2KYBA 1M3BA 2CDTA 1EFNA 1G2BA
chains in the Genus database with same CATH superfamily
3CC7Q 3MP6A 3M56A 1X6BA 1VYVA 3OSSC 1OX8A 2MAMA 3FEOA 1TUGB 3M0TA 4PJOB 1HYOA 3C4SA 3JB9I 4A4FA 3JCMf 4M77B 3CCVQ 1KC8C 5GAOr 4RTTA 2EQUA 1D09B 2OAUA 3BDUA 1WFWA 1VYUA 1ZLMA 3QJYA 1RL2A 3SHWA 1WHMA 1QVFS 2LRQA 4HA8A 5CVIA 4C92D 1C0MA 1FWZA 2JJ9A 1O9SA 3CCRQ 3CC2T 1TWBA 3JCMb 2DD5A 4ZTJA 2QDLA 2KE9A 3INZA 4TVRA 2YT6A 1NG2A 4IUVA 3X25B 1R77A 1VQ5A 3CXCP 4HVWA 3VS7A 3I9QA 5GMKl 2CSQA 1MMNA 2M9UA 2RI5A 3M0UA 1VUBA 1M8MA 1CKAA 1W4SA 4M7DC 4ORZA 3OY9A 1D3BB 3G4SQ 5CO7A 1QCOA 1U1TA 2ZPBB 2K2MA 1GFDA 3EH1A 3M0RA 2FZKB 3UA7A 1V76A 2DL3A 3CCJT 4DBFA 1OEBA 3JCMe 1LCKA 4CI0C 1VQ5Q 3LW5E 4EMGA 3FJ5A 4FSXA 2FPFA 4JRQA 2JN0A 2KAFA 3JSCA 3JV3A 4AFSC 5HKCA 2HSEB 2KVQG 4OMPA 1VQNA 4FYWB 4PL6A 2OI3A 3L2VA 2CH4A 1GRIA 5D6XA 1I1JA 2I0NA 4N0AA 2BE9B 2LDMA 4KBMB 5C6SA 1XOVA 1QKWA 1HD3A 2D8HA 4OB2B 2O2OA 1I5LA 2CP2A 5LJ3g 3CCQA 3BW1A 2RHYA 1NJIU 5FU6C 1K9AA 2JOYA 1XJWB 1Z9ZA 2LT4A 1QMCA 1NM7A 2O9VA 4JJBA 2YLCA 3GOXA 1PM3A 2GTJA 2L3PA 1VQNQ 1QP2A 1JO8A 3KXTA 3RDVA 3EGDB 2FEIA 2PVGB 2HBWA 4JZ4A 5CQXA 2K3XA 3HTRA 1HSQA 5L8RE 5KCOA 5D6YA 3VS2A 2QI2A 1YI2A 3OA6A 4RTXA 2HSPA 5GMKj 4E7KA 2EIFA 1BI1A 3LH0A 3A98A 5J26A 5DLOA 1QCFA 1QKXA 5IT9E 4C8QF 1ZSZC 3X26B 3H0HA 4QVDA 1K76A 1X69A 1FMKA 2EWNA 2EGCA 4YTLA 2CT3A 4C8QG 2HNIA 1RAGB 1ZUKA 2EKHA 3HRTA 1UB4A 5AYFA 1PNJA 4IIOA 1QCNA 4A63B 2KYMA 2DRMA 4XTVA 2RK1A 5FU7C 2L3SA 4JJCA 3QKJA 4FCYA 1Q81R 4A4GA 4A53A 1JB0E 3LWHA 1TOVA 3MCAB 4E7LA 3S3OA 3MP8A 2RB6A 4F14A 2KY9A 1QVGS 3I56T 5LJ3h 5FRMA 1ACMB 2QQ9A 3M54A 3OYMA 2G3RA 3S3MA 1S1NA 3OS1A 1OQKA 2M1HA 1QWEA 3PTAA 2JUFA 4AFZC 5A0LA 2PTKA 5KE2A 1JBMA 1SRMA 4LDXA 1JEGA 3LGLA 1SPKA 4J9HA 1RLPC 4M7DA 2E65A 2AZVA 1ZBJA 3Q1JA 3U23A 3JCMX 3CPFA 2V8KA 4AT1B 3E19A 4E7SA 2YUNA 4JLGA 4KGVB 3MEUA 1YP5A 4FIBA 1UHCA 4CC3A 4E7IA 1BIAA 2XHCA 1M4ZA 5GAMd 3OYEA 1E6HA 3GNFB 2AHJB 4XU3A 1OOTA 3CCMQ 3OYKA 1VQ6T 3JCMc 1PG5B 1N8RC 2CGHA 4BI8B 1VQOA 2HAXA 2FB7A 2L0AA 4EMKC 4BD3A 4XU1A 5GJWB 4LE9A 1TG0A 5IH2A 4AMCA 2A7YA 1Y7XA 1N6AA 1VQ8T 1AVZC 1AWJA 3CXCS 4F7UF 4RTVA 4QQGA 3CD6A 1QWFA 3OQ5A 4M78D 3CCUA 5LJ5f 4IUPA 1YCYA 4J6XA 4F7UG 2EFIA 3VRYA 3JCMW 3C0CA 3RKYA 3PT9A 5GAN4 4N4HA 5D7UA 1QW1A 3FRNA 3TSWA 1VQOQ 4M7AC 2BZ8A 2XG8D 2EJ9A 1K0XA 3UWNA 1X01A 4O5VA 3X24B 3URGA 2DK3A 2O31A 4DA4A 2DXUA 2HBPA 5GAMg 1U5SA 3QSUA 2GF7A 2DMOA 2CS7A 1T0JA 1OV3A 1RABB 3I55T 1K73R 4WF2A 2DVJA 5GAN5 3E9GA 4J9CA 4GY5A 4IUQA 4PJOD 2DVEA 1AZEA 4JRKA 2VXFA 3CD6Q 4M77D 2CUDA 4LDVA 1HJDA 3CCUQ 3X28B 2QA4T 2LZ6B 1M90R 1I07A 4II1A 2X3WD 2O9SA 1UFFA 5GANf 1BCMA 1D0ZA 1ZSZA 5GAN8 3CQTA 5GAMj 1KC8U 3FJPA 3KFVA 1YJ9A 2H3EB 4PJMA 4JUVA 1K9MC 5LJ5e 3VS4A 3C94A 2F2VA 2IPOB 4BY6C 2RJDA 2QTXA 2A08A 2QYZA 1CSKA 4KUIA 1V1CA 3EGXA 1X43A 2VWFA 1SG5A 1MGQA 2LVMA 1YJWT 4AFUC 2KNBB 1UEBA 2GFUA 2HZYA 1YJNT 1KFZA 5KCHA 1YJ9Q 2KGTA 3QYHB 2DXCA 1N27A 3SFMA 3ULRB 5L23A 2K79A 4M7DE 4OP0A 1PKTA 2COWA 4D8DA 4JJNK 1VQPA 5GAMh 1PSEA 4JRIA 5GANe 2LCCA 4R55A 4F7UE 2BE7D 1N5ZA 2ECZA 1WNLA 1JJ2A 1W2BA 4E47A 5CK9A 1BK2A 1HXDA 3OYDA 5AT1B 2PZ1A 2K6DA 4J6YA 1RACB 2XD0A 2YUPA 3HL8A 4PJNA 2PVDB 2EJFA 4M7DB 2MOXA 3CCEA 5GAOq 2DX1A 4BUGA 4DQ2A 5C0MA 3LH5A 3PVQA 4ANJA 1Y57A 1WQ7A 1VQPQ 1VQ7A 1BI0A 4PKCC 4EMKA 3HP9A 4JRPA 2B8AA 2E3IA 2OTJQ 2DTOA 1UGRB 3R6NA 3UT1A 2P0QA 4N4IA 2PUOB 4M75F 5IAYA 1K8AC 1UHFA 3JCMd 4FYYB 3CMEA 2EYZA 2K2VA 4M75G 4MDXA 3CCEQ 2BZYA 3FDRA 3P8HA 3PMTA 4RKUE 3VU3C 4C8QC 4IURA 5CR2A 1Q86C 3RKXA 4M4ZA 3M0PA 4C0GA 4VUBA 3G6ET 1TSFA 4C5HA 1VQ7Q 1ZHIA 1T3SA 1D1AA 2RJCA 4J9DA 3CC7A 1QLYA 3META 4XTXA 4HCKA 5IHIA 2CUBA 3PNWC 5FU6B 3CMEQ 2Y90A 4BACA 2DEUA 1KJWA 4GLKA 3CBOA 2CP6A 2DFUA 3JCMQ 3VS0A 3AHUA 2V1QA 3HFNA 1KIKA 4BDZA 2OTLA 3NMZC 1VQ4T 2FZCB 4QVZA 2ZPIB 5CIUA 1KD1C 3JCMg 2PU9B 1PD1A 5A0DA 3OSVA 5GAOm 4HCCA 1UTIA 4M7AF 2JMCA 1X27A 1KD1R 5FROA 1NBEB 3EG9A 4M7AG 4PFPA 2DPPB 1I4K1 1Y96A 1ZSZB 2EQKA 4F04B 2YLBA 2FG0A 3RBBB 5KH6A 3G4SA 3M53A 2GGRA 5FWCA 1G3WA 2EGAA 1AWWA 1KQ2A 2RK2A 2ROLA 2OTLQ 4EPCA 5FU7B 3EGXB 3REBB 2DZ9A 2DYBA 1NPRA 1OPKA 4PFOA 2XDDA 4OB0B 1SKUB 2XU8A 1AEYA 2PVOB 2GNCA 2KXDA 3QG1A 2CYZB 2YWWA 3CPWA 3QBYA 3JB9F 1BI3A 5CQYA 3M55A 1WXTA 3NTIA 2E5KA 2C0IA 4M75E 2Y4XA 4QVCA 1H92A 3RMSA 3V7CA 4C0FA 2DAQA 1B7TA 3I5RA 3JB9G 3MEWA 1N8RU 4ME7A 3LX7A 1SEMA 8ATCB 2CZ1B 4BI4A 4X1VA 3QWXX 3CCVT 4IUTA 2CT4A 3NTKA 4J8OA 4Z88A 4AG2C 1WI7A 5GAN3 2JM9A 4J7IA 3TSZA 1M1KU 1KQSA 1AHJB 2FPEA 3EAEA 3CCRT 2HQXA 2VV5A 4X34A 3WVDB 4NOYA 1WHHA 3JCMh 4C0DC 3MO8A 2VASA 4D8KA 3ZBDA 2LQNA 1JXMA 3QZ9B 3CC4A 3L2ZA 3JCMJ 2DERA 1I0CA 1TXQA 5KYWA 1LNXA 2J6OA 4MZPA 3RESA 4PJJA 2DTIA 4IKFA 1QVFA 1FXXA 4LUEA 2KRSA 4X9CA 3S6WA 4XAXB 1JJ2P 1GFCA 4C92F 2MF2A 3UF4A 1W2BP 4BE1A 3FLGA 1YITA 4EMKB 3NTHA 1BKBA 2DEQA 1GL5A 1ZA1B 3EHRA 4C92G 2EJGA 4C8QA 4M7AE 3L2QA 1W1FA 9ATCB 4A4EA 3OYBA 3C95A 3RERA 4A4HA 5CKBA 1UDLA 5HK3A 1Q82U 4Z8AA 1Q7YC 3CC4Q 2E6ZA 1KHIA 5EG2A 1VQ5T 3OS0A 3LLRA 1Q7YR 2AK5A 2AT1B 1V29B 1K0SA 1I8FA 2LTOA 3J81E 2L8DA 1JXOA 3M0QA 5CKEA 2LCSA 4FYXB 2QAZA 2EGEA 2YRDA 3KUFA 4OVAA 4RCBA 1K9MU 3FIFA 4M7AB 3L2RA 1YITQ 2JTEA 2P84A 1R0BG 4PLIA 2WACA 3CEYA 1S72A 2X35A 1XTDA 2E12A 4EMHA 5LJ3f 2EAYA 2C0TA 1X6OA 4XU2A 4Z02A 2E3HA 3OW2P 2XDPA 2HQHA 4RMOA 2DILA 4E6RA 4QQ6A 3EFOB 1RAHB 1BI2A 3M4YA 1UE9A 2QGGA 4WTOB 2F69A 2K9GA 2ROTA 3KBGA 2JZ2A 1MMAA 2MYSA 2XIDA 3QWYA 5HY6A 1Q81C 2FVUA 1OU8A 5I21A 2E1HA 2X4JA 1VQNT 4A54A 3GPLA 3M0SA 4FW1A 1WLPB 2MIOA 3GNGA 1NPPA 1S72Q 1YFNA 2RHIA 1EIFA 3LYIA 4BY6B 3EG9B 2ZPHB 1RAFB 1TS9A 2P0KA 1Y96B 3CMAA 2J6FA 5LJ5d 3G1JA 1M1GA 1IB8A 3OYNA 2WSEE 2FPDA 3OMCA 1M9SA 3CCMA 4M7DD 5GMKh 4RG2A 2DL8A 1X75C 1O75A 4KUDK 2DIGA 3CCQT 1ZA2B 4ESRA 5J39A 4ZN3A 5LJ3e 3MHXA 3EFRA 4JZ3A 1YHQA 2X4XA 1AZGB 1MV0B 4DBRA 1M8VA 5DLQE 2FZGB 2RQVA 5KYXA 1E7OA 1NLOC 1IREB 4M75C 4F7UA 3HRSA 3RNJA 1QP3A 1YI2T 4L59A 1ZUUA 3CCSA 4DEYA 1RADB 1M2VA 3CMAQ 2RHXA 2SRCA 2KBTA 2JTMA 4ZGJB 3ASKA 1VQLA 1K8AU 1K4US 5GANd 1OYXA 1H3HA 3RMQA 1U1SA 3MJXA 1YHQQ 3REAB 4KULA 3CPWP 4XK8E 2CDTA 2NUPA 1PCXA 1Q86U 2RA2A 3OS2A 3O5ZA 1RAAB 2JNGA 2LMJA 2QQRA 1YIJA 1EX4A 4AG1C 4MDWA 2L3RA 3V7RA 3OS5A 2F1LA 2K57A 4C8QE 3A8MB 3CCSQ 3DB3A 3OYYA 4OGEA 3DLLA 3S3NA 3PMIA 2Y4YA 5KYWB 1CKBA 2LJ3A 1I81A 3BY7A 1VQLQ 1W70A 5LJ5j 1PD0A 1BBZA 3GLXA 3JCMV 1UECA 1NYFA 2DM1A 2DTHA 3NHNA 3OYFA 2VC8A 4FU6A 1K73C 6AT1B 4E2FB 4HT8A 5M9OA 2GQVA 5DY9A 4ELYC 1OX9A 2QGFB 1NYGA 3E9FA 4C8QB 2KROA 3TVTA 2FHDA 2L89A 3OYGA 4LDYA 1YIJQ 1N9RA 4JPBW 4LDWA 1ARKA 3N5BB 2C0OA 4MMKA 5GANg 3E1SA 1I5OB 2EW3A 2HKQB 1WHKA 1WYXA 1M90C 3VS5A 3M59A 1WDXA 5A0GA 1HK9A 4B6MA 1ZBXA 1G8XA 4RCCA 3OBWA 1VQKA 5I11A 2EVRA 1X2QA 3SWNC 1D1CA 3MEVA 1PSFA 4UC4A 4N4GA 1YJNQ 2R5MA 1JJ2S 2FRYA 4OMFB 5GANj 2VUBA 3PFSA 4RG8A 1NJIR 3MP1A 1Z9QA 2K5FA 2O4XA 1VIEA 3QDFA 4JS4A 5GAOp 2RF0A 2RHUA 1VQOT 1VA7A 4ZTFA 2YHTA 1OULA 3EG0A 2LX9A 2QEXA 2AKKA 1M3AA 4M78F 2WSFE 4HVVA 4RTZA 2EYWA 5GAN2 3X20B 1G83A 3VUBA 2GTOA 4FSSA 3G71A 4M78G 1JQQA 1VQKQ 3CD6T 5CKDA 3CCUT 1GBRA 4MZTA 4QKUA 3RUXA 1TH7A 4LDUA 2KRMA 5DM7R 2IVWA 1LJOA 5IXBA 1NEBA 1M2OA 3FB9A 2X4WA 3P8DA 4KRTA 4XTZA 2E70A 4M75D 1G3SA 4C5EA 2LP5A 2OTJA 1VQMA 5I2MA 3OW2S 4PJOF 2QEXQ 5I2SA 2F5KA 2PQWA 3GBQA 4M77F 2P4RA 5GANh 3OYCA 5GAMe 4M75A 2DYIA 4C92C 4PJOG 4OGCA 4M77G 5FWBA 2V1RA 3G71Q 1UGPB 1VQ9A 4OMQA 5D6WA 1SF9A 1U06A 2A36A 2EQMA 4JS5A 3A5ZB 4LXCA 4IIMA 5GAN6 2J6KA 2R57A 5KYXB 2DETA 2CP0A 3D7SB 1G5VA 2PNIA 4F7UB 1MUZA 1YJ9T 2M02A 3IQLA 4DBHA 1VQMQ 1LPLA 1M2VB 1BYMA 1A0NB 2DD4A 3QDRB 4DEXA 3OMGA 5ECAA 3CCLA 2GCXA 3TQ7P 5GJVB 4C0DB 3H41A 2KEAA 4CRIA 4B9WA 3VYHB 3EG2A 3V7SA 2DZCA 4X9DA 1PKSA 3T9NA 1VQ9Q 5KYYA 1AWXA 2DL5A 4M7AD 2QQBA 3HPWA 2DF6A 4A4KA 3H9NA 2NUPB 4FT2A 4NL3A 1Y71A 3VRZA 2D8JA 3CBMA 2GQIA 2M0YA 2COYA 2CH4W 4DBQA 4E7JA 2K7AA 3UA6A 2ED1A 3QYGB 4M7AA 2IG0A 2C06A 2BZXA 3CC2A 4LD9K 2X4YA 2ESWA 2ED0A 2LC4A 1UUEA 3G7ZA 2F2WA 4ZNXA 2KI7A 2CREA 3CCLQ 1VQPT 2GBQA 1BCOA 3PIPA 5GMKm 2VXEA 4OB3B 2KXCA 1M30A 2YUQA 3EFOA 3O8VA 4J7FA 1R0CB 4KGXB 1OZ2A 1QVPA 1FMWA 5J3BA 3LGFA 2BUDA 2VKNA 5CKHA 1PHTA 1G3YA 2A28A 1Q81U 2OAWA 4L6V5 2M16A 5KYNA 3CPWS 1SHFA 3THKA 3SWNA 1IGUA 2YDLA 1RI9A 4J9EA 3VYGA 1PWTA 2X9HA 3CCET 1DJ7B 2K5IA 2LNVA 3OYIA 3CC2Q 2NUTA 2QTVA 2CZ7B 2RJFA 2K3BA 3CCJA 1WHGA 7AT1B 1VQ7T 1TU0B 2JW4A 3HFOA 4J9FA 1T3LA 1SSFA 5IHNA 3V8JA 2ZGWA 1B3QA 1FX7A 4Y92A 3F70A 2O4XB 2VGMA 2RN8A 3CMET 2ABLA 3DLMA 2LCLA 2XKOC 1B07A 3ER0A 1P92A 2EBPA 3QHSA 2E64A 2EYYA 2HDAA 2QASA 4ATOA 4CC4B 3CCJQ 1KC8R 3UPUA 4OMLA 5CKFA 3OYLA 4XTWA 1ZQ1A 4QW2A 5GAN7 2CP5A 4F16A 3CC7T 3JB9H 1M1FA 4FW2A 3CBPA 2JS2A 4C92A 2JM8A 3V8KA 8AT1B 2RO0A 1YWPA 1NLPC 1RAIB 3J80E 2RQUA 2CP3A 3J7AF 3E2UA 1ZSGA 2H8HA 4ZGDB 3VS1A 1WIEA 2JS0A 3VUZA 1GXIE 3SEMA 5LJ3d 2RMOA 1ZX6A 2DIQA 2ZAEA 4M75B 5FRNA 2O01E 2OTLT 3BDLA 2DJQA 2KT1A 2L3QA 2RI3A 2CKKA 2E10A 3QXEB 2K4YA 3I35A 5GAOl 3EFSA 1YCSB 4HXJA 1ZUYA 4CC7A 2EPDA 1XNIA 4C8QD 1D0XA 4R0KA 4MMLA 2NYSA 2RH2A 1K73U 1IHWA 2A0FB 1WXBA 4C5IA 2EQIA 3G4ST 4J9BA 2BKDN 3EGUA 2HQEA 2VVKA 2RQWA 4ZGEB 4FT4A 4J9IA 5EC7A 1MNEA 2JXBA 2KMTA 2P0PA 4J9GA 3MKDA 2CP7A 2JT4A 1D1BA 3QPHA 1M90U 2LJ1A 2DL7A 3VKIA 1GCQC 2EYQA 3NGPA 4HKEA 2XDBA 1W6XA 2ZPEB 5KYYB 2FRWA 2F5TX 3I56A 1TUCA 1J3TA 4OF1A 5FW9A 4PLLA 2MWOA 4RTYA 2ZPFB 2AZSA 3DB4A 3L2WA 2KYBA 2DJZA 3GIBA 1M3BA 4JLIA 3AT1B 4M78C 1H8KA 2AIRB 2COZA 2E6NA 3M58A 3JB9J 2KSSA 4XTUA 2YXYA 3VJPA 1C6VX 3JCMP 2KR3A 3RKWA 2E5QA 3EG3A 1AT1B 5A2QE 3M5AA 5LJ3j 3PGGA 2K5LA 1VIFA 4NS5A 2LQ8A 3HSBA 4RUGA 3I56Q 2J06A 1E6GA 2V8JA 1B34A 4P5NA 4R56A 4HCBA 1VQ6A 3CC4T 5IXFA 2O88A 3CCQQ 4PJOC 3SWNB 1Q95G 1TUDA 4QT7A 3SD4A 3NPFA 4M77C 4BB7A 2ZZDA 3HKSA 2NUTB 2PUKB 1UJYA 1RI0A 1BU1A 1UGQB 2D1XA 2FO0A 4ZN1A 2DE0X 2P4TA 4E7ZA 1VQ8A 1YITT 2LQWA 3H0IA 3ZFJA 1UJ0A 4DOWA 2BIVA 2F2XA 1RLQC 1MHNA 4CC2A 1YI2Q 1WJRA 1PRMC 1MMDA 3SDZA 3L42A 3VV0A 1VYTA 1VQ6Q 4PNOA 5GMKe 2B86A 2JVVA 4C92E 4OB1B 4FM4B 1WJQA 2AKLA 3NFCA 1WXUA 4OMNA 5KE3A 3L2UA 2JMAA 1Y07A 4LD6A 1VOMA 2M0OA 1F1BB 3UDCA 3I55A 2DA9A 1VQ8Q 2MI6A 1OU9A 3A8HB 1JU5C 2D0NA 3A8OB 1RUWA 2KT8A 2MK5A 1U8RA 1S72T 1M3CA 2WSCE 2XK0A 4BE2A 1N9SA 1FYNA 2QA4A 2CZ6B 2SEMA 1GBQA 1EZZB 3R6OA 1H641 4C92B 3OYAA 2JTFA 4HT9A 4PFZA 1SSHA 3EH2A 1KK7A 2VB6A 2QXFA 5HCKA 2RQRA 3VS6A 2DBKA 2J05A 1ABOA 2V8IA 4J5YA 3P8BB 4OMMA 3QIIA 4GBQA 5LJ5g 1KG1A 4FL6A 2OJ2A 2RNAA 1G3TA 2LJ0A 2QG9B 3I55Q 1FMVA 2A37A 1NEGA 3PIOA 4L5GA 4DOVA 1QVGA 4XQ3A 1N8RR 2ZCFB 3PVLA 1BIBA 2BTTA 2NLUA 2DRKA 2RHZA 5KYUA 4M7DF 3HHTB 1U3OA 1YJWA 2QA4Q 4EDUA 1M1KC 1MNDA 5HK0A 2LNHB 1GCQA 3CMAT 4M7DG 1AOJA 1KQSP 4F17A 1M1KR 1YJNA 3CCMT 2K3YA 1WHLA 2VGNA 3A8LB 2GFAA 2W0ZA 3UATA 1UGSB 1NZ9A 3RIRA 3FC3A 2M51A 1YHQT 1KD1U 4D6WA 4M78A 2NUZA 1BB9A 3BE3A 3TCJA 1ABQA 1QVFP 4KGZB 4FYVB 1K1ZA 2HKNA 1GCPA 3QO3A 3L1AA 2E4HA 2J7IA 4PJLA 1YJWQ 2KK4A 2ENMA 2RJEA 5GMKi 3CCST 3QZ5B 1IRXA 2QK0A 1RAEB 5LL6S 1OI1A 5GAOn 2HL3A 2H3JA 1PRLC 1M27C 1NJIC 5IN1A 5GAMf 4BDYA 4Q5WA 1W2BS 1Q82C 1UGVA 1VQLT 2RD1A 3MEAA 1Q82R 1WHJA 4EIKA 5LJ5h 4PJOA 3CXCA 1WJSA 4M77A 3ME9A 3V8LA 1WX6A 4XTYA 3GP8A 3PE0A 2DO3A 1AD5A 1MV3A 2DLPA 3GF5A 1YIJT 4KH0B 1B34B 1K9MR 4Y91A 2FYKA 2MMPA 1KHCA 4LUDA 4NL2A 4B9XA 4O6JA 3OYHA 1IO6A 2YRCA 4QQDA 2DBMA 3LWIA 4BE0A 2EQJA 5CCAA 1IZ6A 1MMGA 3A8GB 1OZ3A 3I5SA 3ZEHA 1WGSA 4IUUA 1AWOA 1JRIA 1KSWA 1C1AA 4K11A 4BI3A 3G6EA 5CAIA 3DKMA 2G6FX 3OB9A 3OBYA 4LN2A 3VS3A 2E41A 1WQWA 2LT1A 4V2SA 3OYJA 1D3BA 2I2LA 2RQTA 2X51A 2CZ0B 3HRUA 2ZPGB 5FLXE 1WPYA 2LQKA 4AFQC 2KDSA 4C5GA 2HD0A 4GLMA 3TEEA 3H8ZA 2R58A 1UG1A 1KQ1A 2YUOA 1WZOA 2MWPA 4KT0E 1YNZA 2VYTA 2XI9A 3M9QA 1VQKT 2HCKA 1YWOA 4OMOA 4KH1B 4XU0A 3G6EQ 4JJDA 5I22A 4HVUA 1VQ4A 2ATCB 2D6FA 4ELZC 4RTUA 4RTWA 1IHVA 1Q7YU 2RI2A 2KQWA 2YRVA 2EKOA 2DL4A 3H0FA 4C0ZA 2QEXT 2D0QB 2DKGA 2W10A 4Z89A 2QQAA 3WXMB 2QDYB 2MCNA 1M5Q1 1QQJA 3TREA 1OPLA 3TU4K 4PK4A 2NWMA 3JRZA 3G71T 1YN8A 2MPXC 1LOJA 3WVEB 1SHGA 4HCZA 3BFMA 4N0AC 3ZL7C 2KRNA 2RPNA 1YBYA 3M57A 1Y0MA 3OW2A 1VQ4Q 2LX7A 1K8AR 4Y28E 1R8OB 1D0YA 2OX7A 3EGDA 3RR6A 5KYUB 4WCIA 4M78E 3EHQA 3SB2A 1X2KA 3JAME 4MZMA 2HL5C 2Z0WA 2OTJT 1H3ZA 1VQMT 1Q86R 2V26A 2EYXA 2DNUA 4J83A 1XQHA 3QJ6A 1NE8A 1SRLA 1WA7A 2L5QA 2DXTA 3M4GA 4E7HA 2D9TA 1QVGP 2IIMA 3JB9D 1VQ9T 1T0HA 3H6ZA 1IGQA 2X3XD 3MPUB 2L2PA 3CCVA 2DXBA 4M78B 1IXDA 2XMFA 4J6WA 1TTHB 4JDSA 5IHKA 2FL7A 3A1PA 2A3LA 2HMAA 4PJOE 4M77E 2CSIA 2RM4A 3EG1A 3C12A 3CCRA 1X6GA 3QUIA 4LNPA 2YSQA 2QQSA 1PC0A 2HEQA 1LVKA 2XICA 3CCLT 1KQSS 2R5AA 1EFNA 1G2BA
chains in the Genus database with same CATH topology
3O5ZA 2LMJA 4AG1C 1H8KA 1N5ZA 1VYVA 1X6BA 2ECZA 3M0TA 1BK2A 2PZ1A 2K6DA 4RTTA 2KR3A 1WFWA 2YUPA 1VYUA 1CKBA 1ZLMA 2LJ3A 3EG3A 3SHWA 2MOXA 1W70A 4RUGA 2J06A 1BBZA 1E6GA 2DX1A 1UECA 1NYFA 2DM1A 2QDLA 2KE9A 3LH5A 3NHNA 3PVQA 2YT6A 1NG2A 1Y57A 5IXFA 2O88A 1TUDA 4QT7A 4HVWA 3VS7A 3NPFA 1NYGA 3I9QA 2KROA 3TVTA 2CSQA 4JPBW 1ARKA 1UJYA 1BU1A 2C0OA 3R6NA 2D1XA 2EW3A 3M0UA 2FO0A 1WYXA 1M8MA 1CKAA 2DE0X 3VS5A 1WDXA 4ORZA 2LQWA 3H0IA 1UHFA 1UJ0A 2F2XA 1RLQC 2EYZA 4CC2A 2K2MA 1PRMC 5I11A 2EVRA 2BZYA 1X2QA 1GFDA 3M0RA 3UA7A 2DL3A 1VYTA 3M0PA 4M4ZA 1OEBA 1LCKA 2FRYA 2B86A 1T3SA 1Z9QA 3FJ5A 2RF0A 4J9DA 2AKLA 4OMNA 1WXUA 1VA7A 2FPFA 2JMAA 3EG0A 1QLYA 4HCKA 5IHIA 2AKKA 2CUBA 2DA9A 4AFSC 3JV3A 1M3AA 4OMPA 4HVVA 4RTZA 2EYWA 2D0NA 1JU5C 2OI3A 2CH4A 2KT8A 1RUWA 1GRIA 1G83A 2GTOA 1M3CA 1KJWA 4FSSA 1I1JA 1JQQA 2I0NA 3VS0A 1FYNA 2V1QA 2SEMA 1GBQA 1GBRA 1KIKA 1XOVA 1QKWA 2KRMA 1HD3A 1SSHA 2D8HA 5IXBA 1NEBA 3NMZC 5HCKA 2O2OA 2RQRA 3VS6A 2DBKA 2J05A 1ABOA 4KRTA 4OMMA 4GBQA 1UTIA 2JMCA 1K9AA 1X27A 1Z9ZA 2LP5A 1NM7A 2OJ2A 2O9VA 2RNAA 2LJ0A 4JJBA 3GBQA 2GTJA 2P4RA 2A37A 2L3PA 1NEGA 1JO8A 2FEIA 2HBWA 3PVLA 2BTTA 4JZ4A 2FG0A 3RBBB 5FWBA 2DRKA 2V1RA 1HSQA 2GGRA 3VS2A 4OMQA 1U3OA 1U06A 2A36A 5FWCA 4RTXA 2EGAA 2HSPA 4IIMA 1AWWA 2LNHB 1GCQA 2ROLA 2J6KA 1AOJA 4F17A 3REBB 3A98A 2DYBA 1OPKA 2PNIA 1MUZA 1QCFA 1QKXA 2W0ZA 3UATA 1AEYA 2GNCA 3IQLA 3H0HA 2KXDA 1K76A 1X69A 1FMKA 2M51A 2EGCA 2CT3A 1A0NB 4DEXA 1WXTA 1ZUKA 2NUZA 2E5KA 2C0IA 2EKHA 5ECAA 1PNJA 4IIOA 1BB9A 5GJVB 1H92A 4A63B 1ABQA 2KYMA 2KEAA 3H41A 3I5RA 1K1ZA 3EG2A 2DRMA 1PKSA 2L3SA 1GCPA 4JJCA 1AWXA 2DL5A 2J7IA 1SEMA 2DF6A 2ENMA 4X1VA 3QWXX 2CT4A 4Z88A 3VRZA 2D8JA 1PRLC 1M27C 2GQIA 2M0YA 4AG2C 1WI7A 4F14A 2JM9A 2CH4W 3TSZA 1UGVA 2K7AA 3UA6A 2ED1A 2FPEA 2BZXA 2ESWA 2ED0A 1UUEA 4EIKA 2F2WA 4D8KA 1S1NA 4ZNXA 2LQNA 1JXMA 1QWEA 1WX6A 2CREA 4AFZC 2GBQA 3PE0A 2PTKA 2KXCA 1I0CA 1AD5A 1MV3A 1SRMA 1M30A 2DLPA 2YUQA 1JEGA 2J6OA 1SPKA 4J9HA 1RLPC 2AZVA 1ZBJA 3U23A 4LUEA 2VKNA 2KRSA 4LUDA 1GFCA 1PHTA 3UF4A 1IO6A 2A28A 2DBMA 2OAWA 2YUNA 1SHFA 3THKA 1GL5A 1YP5A 3I5SA 3EHRA 2YDLA 1RI9A 4J9EA 1UHCA 1PWTA 4CC3A 1AWOA 1W1FA 1E6HA 1KSWA 4K11A 1OOTA 2K3BA 1UDLA 4Z8AA 2G6FX 4LN2A 3VS3A 2JW4A 2AK5A 2RQTA 2L0AA 1T3LA 4J9FA 1K0SA 5GJWB 5IHNA 4LE9A 1TG0A 1B3QA 5IH2A 1JXOA 3M0QA 2LCSA 2EGEA 4AFQC 4Y92A 1AVZC 2JTEA 1AWJA 4GLMA 2RN8A 2ABLA 1UG1A 2YUOA 4RTVA 1YNZA 2C0TA 1B07A 1QWFA 2EBPA 2EYYA 2HDAA 2HCKA 1YWOA 4OMOA 2DILA 4E6RA 4CC4B 3VRYA 3C0CA 4JJDA 4OMLA 5I22A 4HVUA 1UE9A 2K9GA 2ROTA 3TSWA 2BZ8A 1K0XA 4RTUA 4RTWA 4F16A 2O31A 3QWYA 1U5SA 2DL4A 3H0FA 2DMOA 2JS2A 1T0JA 1OV3A 2W10A 2JM8A 1YWPA 2DVJA 4Z89A 3M0SA 1WLPB 2MIOA 1NLPC 2MCNA 4J9CA 1OPLA 2RQUA 1AZEA 2NWMA 1YN8A 1ZSGA 2H8HA 3VS1A 1SHGA 2CUDA 1WIEA 1HJDA 2JS0A 2LZ6B 3SEMA 3ZL7C 2KRNA 2RPNA 1I07A 2X3WD 2RMOA 2O9SA 1ZX6A 2J6FA 1UFFA 2FPDA 1Y0MA 2LX7A 2DJQA 2KT1A 3CQTA 2DL8A 2L3QA 3KFVA 4WCIA 3I35A 3EHQA 4ESRA 1X2KA 1YCSB 4JZ3A 3VS4A 4HXJA 1ZUYA 4CC7A 2EYXA 2DNUA 2EPDA 1AZGB 1MV0B 2F2VA 4R0KA 2RQVA 2A08A 1CSKA 1SRLA 1WA7A 1E7OA 1V1CA 1WXBA 1X43A 2VWFA 1NLOC 3RNJA 2EQIA 2IIMA 4J9BA 3EGUA 1T0HA 2VVKA 2RQWA 2X3XD 4AFUC 4J9IA 2L2PA 5EC7A 2JXBA 1ZUUA 4DEYA 2XMFA 4J9GA 5IHKA 2KNBB 2JT4A 2SRCA 2LJ1A 2DL7A 2KBTA 1GCQC 1KFZA 3NGPA 2CSIA 1W6XA 3EG1A 1K4US 1H3HA 2KGTA 2FRWA 1X6GA 1TUCA 1J3TA 5FW9A 3ULRB 4LNPA 2YSQA 4RTYA 5L23A 2K79A 2HEQA 1PKTA 4D8DA 2AZSA 3REAB 2KYBA 1M3BA 2CDTA 1EFNA 1G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Z A;  2LMJ A;  4AG1 C;  1H8K A;  1N5Z A;  1VYV A;  1X6B A;  2ECZ A;  3M0T A;  1BK2 A;  2PZ1 A;  2K6D A;  4RTT A;  2KR3 A;  1WFW A;  2YUP A;  1VYU A;  1CKB A;  1ZLM A;  2LJ3 A;  3EG3 A;  3SHW A;  2MOX A;  1W70 A;  4RUG A;  2J06 A;  1BBZ A;  1E6G A;  2DX1 A;  1UEC A;  1NYF A;  2DM1 A;  2QDL A;  2KE9 A;  3LH5 A;  3NHN A;  3PVQ A;  2YT6 A;  1NG2 A;  1Y57 A;  5IXF A;  2O88 A;  1TUD A;  4QT7 A;  4HVW A;  3VS7 A;  3NPF A;  1NYG A;  3I9Q A;  2KRO A;  3TVT A;  2CSQ A;  4JPB W;  1ARK A;  1UJY A;  1BU1 A;  2C0O A;  3R6N A;  2D1X A;  2EW3 A;  3M0U A;  2FO0 A;  1WYX A;  1M8M A;  1CKA A;  2DE0 X;  3VS5 A;  1WDX A;  4ORZ A;  2LQW A;  3H0I A;  1UHF A;  1UJ0 A;  2F2X A;  1RLQ C;  2EYZ A;  4CC2 A;  2K2M A;  1PRM C;  5I11 A;  2EVR A;  2BZY A;  1X2Q A;  1GFD A;  3M0R A;  3UA7 A;  2DL3 A;  1VYT A;  3M0P A;  4M4Z A;  1OEB A;  1LCK A;  2FRY A;  2B86 A;  1T3S A;  1Z9Q A;  3FJ5 A;  2RF0 A;  4J9D A;  2AKL A;  4OMN A;  1WXU A;  1VA7 A;  2FPF A;  2JMA A;  3EG0 A;  1QLY A;  4HCK A;  5IHI A;  2AKK A;  2CUB A;  2DA9 A;  4AFS C;  3JV3 A;  1M3A A;  4OMP A;  4HVV A;  4RTZ A;  2EYW A;  2D0N A;  1JU5 C;  2OI3 A;  2CH4 A;  2KT8 A;  1RUW A;  1GRI A;  1G83 A;  2GTO A;  1M3C A;  1KJW A;  4FSS A;  1I1J A;  1JQQ A;  2I0N A;  3VS0 A;  1FYN A;  2V1Q A;  2SEM A;  1GBQ A;  1GBR A;  1KIK A;  1XOV A;  1QKW A;  2KRM A;  1HD3 A;  1SSH A;  2D8H A;  5IXB A;  1NEB A;  3NMZ C;  5HCK A;  2O2O A;  2RQR A;  3VS6 A;  2DBK A;  2J05 A;  1ABO A;  4KRT A;  4OMM A;  4GBQ A;  1UTI A;  2JMC A;  1K9A A;  1X27 A;  1Z9Z A;  2LP5 A;  1NM7 A;  2OJ2 A;  2O9V A;  2RNA A;  2LJ0 A;  4JJB A;  3GBQ A;  2GTJ A;  2P4R A;  2A37 A;  2L3P A;  1NEG A;  1JO8 A;  2FEI A;  2HBW A;  3PVL A;  2BTT A;  4JZ4 A;  2FG0 A;  3RBB B;  5FWB A;  2DRK A;  2V1R A;  1HSQ A;  2GGR A;  3VS2 A;  4OMQ A;  1U3O A;  1U06 A;  2A36 A;  5FWC A;  4RTX A;  2EGA A;  2HSP A;  4IIM A;  1AWW A;  2LNH B;  1GCQ A;  2ROL A;  2J6K A;  1AOJ A;  4F17 A;  3REB B;  3A98 A;  2DYB A;  1OPK A;  2PNI A;  1MUZ A;  1QCF A;  1QKX A;  2W0Z A;  3UAT A;  1AEY A;  2GNC A;  3IQL A;  3H0H A;  2KXD A;  1K76 A;  1X69 A;  1FMK A;  2M51 A;  2EGC A;  2CT3 A;  1A0N B;  4DEX A;  1WXT A;  1ZUK A;  2NUZ A;  2E5K A;  2C0I A;  2EKH A;  5ECA A;  1PNJ A;  4IIO A;  1BB9 A;  5GJV B;  1H92 A;  4A63 B;  1ABQ A;  2KYM A;  2KEA A;  3H41 A;  3I5R A;  1K1Z A;  3EG2 A;  2DRM A;  1PKS A;  2L3S A;  1GCP A;  4JJC A;  1AWX A;  2DL5 A;  2J7I A;  1SEM A;  2DF6 A;  2ENM A;  4X1V A;  3QWX X;  2CT4 A;  4Z88 A;  3VRZ A;  2D8J A;  1PRL C;  1M27 C;  2GQI A;  2M0Y A;  4AG2 C;  1WI7 A;  4F14 A;  2JM9 A;  2CH4 W;  3TSZ A;  1UGV A;  2K7A A;  3UA6 A;  2ED1 A;  2FPE A;  2BZX A;  2ESW A;  2ED0 A;  1UUE A;  4EIK A;  2F2W A;  4D8K A;  1S1N A;  4ZNX A;  2LQN A;  1JXM A;  1QWE A;  1WX6 A;  2CRE A;  4AFZ C;  2GBQ A;  3PE0 A;  2PTK A;  2KXC A;  1I0C A;  1AD5 A;  1MV3 A;  1SRM A;  1M30 A;  2DLP A;  2YUQ A;  1JEG A;  2J6O A;  1SPK A;  4J9H A;  1RLP C;  2AZV A;  1ZBJ A;  3U23 A;  4LUE A;  2VKN A;  2KRS A;  4LUD A;  1GFC A;  1PHT A;  3UF4 A;  1IO6 A;  2A28 A;  2DBM A;  2OAW A;  2YUN A;  1SHF A;  3THK A;  1GL5 A;  1YP5 A;  3I5S A;  3EHR A;  2YDL A;  1RI9 A;  4J9E A;  1UHC A;  1PWT A;  4CC3 A;  1AWO A;  1W1F A;  1E6H A;  1KSW A;  4K11 A;  1OOT A;  2K3B A;  1UDL A;  4Z8A A;  2G6F X;  4LN2 A;  3VS3 A;  2JW4 A;  2AK5 A;  2RQT A;  2L0A A;  1T3L A;  4J9F A;  1K0S A;  5GJW B;  5IHN A;  4LE9 A;  1TG0 A;  1B3Q A;  5IH2 A;  1JXO A;  3M0Q A;  2LCS A;  2EGE A;  4AFQ C;  4Y92 A;  1AVZ C;  2JTE A;  1AWJ A;  4GLM A;  2RN8 A;  2ABL A;  1UG1 A;  2YUO A;  4RTV A;  1YNZ A;  2C0T A;  1B07 A;  1QWF A;  2EBP A;  2EYY A;  2HDA A;  2HCK A;  1YWO A;  4OMO A;  2DIL A;  4E6R A;  4CC4 B;  3VRY A;  3C0C A;  4JJD A;  4OML A;  5I22 A;  4HVU A;  1UE9 A;  2K9G A;  2ROT A;  3TSW A;  2BZ8 A;  1K0X A;  4RTU A;  4RTW A;  4F16 A;  2O31 A;  3QWY A;  1U5S A;  2DL4 A;  3H0F A;  2DMO A;  2JS2 A;  1T0J A;  1OV3 A;  2W10 A;  2JM8 A;  1YWP A;  2DVJ A;  4Z89 A;  3M0S A;  1WLP B;  2MIO A;  1NLP C;  2MCN A;  4J9C A;  1OPL A;  2RQU A;  1AZE A;  2NWM A;  1YN8 A;  1ZSG A;  2H8H A;  3VS1 A;  1SHG A;  2CUD A;  1WIE A;  1HJD A;  2JS0 A;  2LZ6 B;  3SEM A;  3ZL7 C;  2KRN A;  2RPN A;  1I07 A;  2X3W D;  2RMO A;  2O9S A;  1ZX6 A;  2J6F A;  1UFF A;  2FPD A;  1Y0M A;  2LX7 A;  2DJQ A;  2KT1 A;  3CQT A;  2DL8 A;  2L3Q A;  3KFV A;  4WCI A;  3I35 A;  3EHQ A;  4ESR A;  1X2K A;  1YCS B;  4JZ3 A;  3VS4 A;  4HXJ A;  1ZUY A;  4CC7 A;  2EYX A;  2DNU A;  2EPD A;  1AZG B;  1MV0 B;  2F2V A;  4R0K A;  2RQV A;  2A08 A;  1CSK A;  1SRL A;  1WA7 A;  1E7O A;  1V1C A;  1WXB A;  1X43 A;  2VWF A;  1NLO C;  3RNJ A;  2EQI A;  2IIM A;  4J9B A;  3EGU A;  1T0H A;  2VVK A;  2RQW A;  2X3X D;  4AFU C;  4J9I A;  2L2P A;  5EC7 A;  2JXB A;  1ZUU A;  4DEY A;  2XMF A;  4J9G A;  5IHK A;  2KNB B;  2JT4 A;  2SRC A;  2LJ1 A;  2DL7 A;  2KBT A;  1GCQ C;  1KFZ A;  3NGP A;  2CSI A;  1W6X A;  3EG1 A;  1K4U S;  1H3H A;  2KGT A;  2FRW A;  1X6G A;  1TUC A;  1J3T A;  5FW9 A;  3ULR B;  4LNP A;  2YSQ A;  4RTY A;  5L23 A;  2K79 A;  2HEQ A;  1PKT A;  4D8D A;  2AZS A;  3REA B;  2KYB A;  1M3B A;  2CDT A;  1EFN A;  1G2B A; 
#chains in the Genus database with same CATH topology
 3CC7 Q;  3MP6 A;  3M56 A;  1X6B A;  1VYV A;  3OSS C;  1OX8 A;  2MAM A;  3FEO A;  1TUG B;  3M0T A;  4PJO B;  1HYO A;  3C4S A;  3JB9 I;  4A4F A;  3JCM f;  4M77 B;  3CCV Q;  1KC8 C;  5GAO r;  4RTT A;  2EQU A;  1D09 B;  2OAU A;  3BDU A;  1WFW A;  1VYU A;  1ZLM A;  3QJY A;  1RL2 A;  3SHW A;  1WHM A;  1QVF S;  2LRQ A;  4HA8 A;  5CVI A;  4C92 D;  1C0M A;  1FWZ A;  2JJ9 A;  1O9S A;  3CCR Q;  3CC2 T;  1TWB A;  3JCM b;  2DD5 A;  4ZTJ A;  2QDL A;  2KE9 A;  3INZ A;  4TVR A;  2YT6 A;  1NG2 A;  4IUV A;  3X25 B;  1R77 A;  1VQ5 A;  3CXC P;  4HVW A;  3VS7 A;  3I9Q A;  5GMK l;  2CSQ A;  1MMN A;  2M9U A;  2RI5 A;  3M0U A;  1VUB A;  1M8M A;  1CKA A;  1W4S A;  4M7D C;  4ORZ A;  3OY9 A;  1D3B B;  3G4S Q;  5CO7 A;  1QCO A;  1U1T A;  2ZPB B;  2K2M A;  1GFD A;  3EH1 A;  3M0R A;  2FZK B;  3UA7 A;  1V76 A;  2DL3 A;  3CCJ T;  4DBF A;  1OEB A;  3JCM e;  1LCK A;  4CI0 C;  1VQ5 Q;  3LW5 E;  4EMG A;  3FJ5 A;  4FSX A;  2FPF A;  4JRQ A;  2JN0 A;  2KAF A;  3JSC A;  3JV3 A;  4AFS C;  5HKC A;  2HSE B;  2KVQ G;  4OMP A;  1VQN A;  4FYW B;  4PL6 A;  2OI3 A;  3L2V A;  2CH4 A;  1GRI A;  5D6X A;  1I1J A;  2I0N A;  4N0A A;  2BE9 B;  2LDM A;  4KBM B;  5C6S A;  1XOV A;  1QKW A;  1HD3 A;  2D8H A;  4OB2 B;  2O2O A;  1I5L A;  2CP2 A;  5LJ3 g;  3CCQ A;  3BW1 A;  2RHY A;  1NJI U;  5FU6 C;  1K9A A;  2JOY A;  1XJW B;  1Z9Z A;  2LT4 A;  1QMC A;  1NM7 A;  2O9V A;  4JJB A;  2YLC A;  3GOX A;  1PM3 A;  2GTJ A;  2L3P A;  1VQN Q;  1QP2 A;  1JO8 A;  3KXT A;  3RDV A;  3EGD B;  2FEI A;  2PVG B;  2HBW A;  4JZ4 A;  5CQX A;  2K3X A;  3HTR A;  1HSQ A;  5L8R E;  5KCO A;  5D6Y A;  3VS2 A;  2QI2 A;  1YI2 A;  3OA6 A;  4RTX A;  2HSP A;  5GMK j;  4E7K A;  2EIF A;  1BI1 A;  3LH0 A;  3A98 A;  5J26 A;  5DLO A;  1QCF A;  1QKX A;  5IT9 E;  4C8Q F;  1ZSZ C;  3X26 B;  3H0H A;  4QVD A;  1K76 A;  1X69 A;  1FMK A;  2EWN A;  2EGC A;  4YTL A;  2CT3 A;  4C8Q G;  2HNI A;  1RAG B;  1ZUK A;  2EKH A;  3HRT A;  1UB4 A;  5AYF A;  1PNJ A;  4IIO A;  1QCN A;  4A63 B;  2KYM A;  2DRM A;  4XTV A;  2RK1 A;  5FU7 C;  2L3S A;  4JJC A;  3QKJ A;  4FCY A;  1Q81 R;  4A4G A;  4A53 A;  1JB0 E;  3LWH A;  1TOV A;  3MCA B;  4E7L A;  3S3O A;  3MP8 A;  2RB6 A;  4F14 A;  2KY9 A;  1QVG S;  3I56 T;  5LJ3 h;  5FRM A;  1ACM B;  2QQ9 A;  3M54 A;  3OYM A;  2G3R A;  3S3M A;  1S1N A;  3OS1 A;  1OQK A;  2M1H A;  1QWE A;  3PTA A;  2JUF A;  4AFZ C;  5A0L A;  2PTK A;  5KE2 A;  1JBM A;  1SRM A;  4LDX A;  1JEG A;  3LGL A;  1SPK A;  4J9H A;  1RLP C;  4M7D A;  2E65 A;  2AZV A;  1ZBJ A;  3Q1J A;  3U23 A;  3JCM X;  3CPF A;  2V8K A;  4AT1 B;  3E19 A;  4E7S A;  2YUN A;  4JLG A;  4KGV B;  3MEU A;  1YP5 A;  4FIB A;  1UHC A;  4CC3 A;  4E7I A;  1BIA A;  2XHC A;  1M4Z A;  5GAM d;  3OYE A;  1E6H A;  3GNF B;  2AHJ B;  4XU3 A;  1OOT A;  3CCM Q;  3OYK A;  1VQ6 T;  3JCM c;  1PG5 B;  1N8R C;  2CGH A;  4BI8 B;  1VQO A;  2HAX A;  2FB7 A;  2L0A A;  4EMK C;  4BD3 A;  4XU1 A;  5GJW B;  4LE9 A;  1TG0 A;  5IH2 A;  4AMC A;  2A7Y A;  1Y7X A;  1N6A A;  1VQ8 T;  1AVZ C;  1AWJ A;  3CXC S;  4F7U F;  4RTV A;  4QQG A;  3CD6 A;  1QWF A;  3OQ5 A;  4M78 D;  3CCU A;  5LJ5 f;  4IUP A;  1YCY A;  4J6X A;  4F7U G;  2EFI A;  3VRY A;  3JCM W;  3C0C A;  3RKY A;  3PT9 A;  5GAN 4;  4N4H A;  5D7U A;  1QW1 A;  3FRN A;  3TSW A;  1VQO Q;  4M7A C;  2BZ8 A;  2XG8 D;  2EJ9 A;  1K0X A;  3UWN A;  1X01 A;  4O5V A;  3X24 B;  3URG A;  2DK3 A;  2O31 A;  4DA4 A;  2DXU A;  2HBP A;  5GAM g;  1U5S A;  3QSU A;  2GF7 A;  2DMO A;  2CS7 A;  1T0J A;  1OV3 A;  1RAB B;  3I55 T;  1K73 R;  4WF2 A;  2DVJ A;  5GAN 5;  3E9G A;  4J9C A;  4GY5 A;  4IUQ A;  4PJO D;  2DVE A;  1AZE A;  4JRK A;  2VXF A;  3CD6 Q;  4M77 D;  2CUD A;  4LDV A;  1HJD A;  3CCU Q;  3X28 B;  2QA4 T;  2LZ6 B;  1M90 R;  1I07 A;  4II1 A;  2X3W D;  2O9S A;  1UFF A;  5GAN f;  1BCM A;  1D0Z A;  1ZSZ A;  5GAN 8;  3CQT A;  5GAM j;  1KC8 U;  3FJP A;  3KFV A;  1YJ9 A;  2H3E B;  4PJM A;  4JUV A;  1K9M C;  5LJ5 e;  3VS4 A;  3C94 A;  2F2V A;  2IPO B;  4BY6 C;  2RJD A;  2QTX A;  2A08 A;  2QYZ A;  1CSK A;  4KUI A;  1V1C A;  3EGX A;  1X43 A;  2VWF A;  1SG5 A;  1MGQ A;  2LVM A;  1YJW T;  4AFU C;  2KNB B;  1UEB A;  2GFU A;  2HZY A;  1YJN T;  1KFZ A;  5KCH A;  1YJ9 Q;  2KGT A;  3QYH B;  2DXC A;  1N27 A;  3SFM A;  3ULR B;  5L23 A;  2K79 A;  4M7D E;  4OP0 A;  1PKT A;  2COW A;  4D8D A;  4JJN K;  1VQP A;  5GAM h;  1PSE A;  4JRI A;  5GAN e;  2LCC A;  4R55 A;  4F7U E;  2BE7 D;  1N5Z A;  2ECZ A;  1WNL A;  1JJ2 A;  1W2B A;  4E47 A;  5CK9 A;  1BK2 A;  1HXD A;  3OYD A;  5AT1 B;  2PZ1 A;  2K6D A;  4J6Y A;  1RAC B;  2XD0 A;  2YUP A;  3HL8 A;  4PJN A;  2PVD B;  2EJF A;  4M7D B;  2MOX A;  3CCE A;  5GAO q;  2DX1 A;  4BUG A;  4DQ2 A;  5C0M A;  3LH5 A;  3PVQ A;  4ANJ A;  1Y57 A;  1WQ7 A;  1VQP Q;  1VQ7 A;  1BI0 A;  4PKC C;  4EMK A;  3HP9 A;  4JRP A;  2B8A A;  2E3I A;  2OTJ Q;  2DTO A;  1UGR B;  3R6N A;  3UT1 A;  2P0Q A;  4N4I A;  2PUO B;  4M75 F;  5IAY A;  1K8A C;  1UHF A;  3JCM d;  4FYY B;  3CME A;  2EYZ A;  2K2V A;  4M75 G;  4MDX A;  3CCE Q;  2BZY A;  3FDR A;  3P8H A;  3PMT A;  4RKU E;  3VU3 C;  4C8Q C;  4IUR A;  5CR2 A;  1Q86 C;  3RKX A;  4M4Z A;  3M0P A;  4C0G A;  4VUB A;  3G6E T;  1TSF A;  4C5H A;  1VQ7 Q;  1ZHI A;  1T3S A;  1D1A A;  2RJC A;  4J9D A;  3CC7 A;  1QLY A;  3MET A;  4XTX A;  4HCK A;  5IHI A;  2CUB A;  3PNW C;  5FU6 B;  3CME Q;  2Y90 A;  4BAC A;  2DEU A;  1KJW A;  4GLK A;  3CBO A;  2CP6 A;  2DFU A;  3JCM Q;  3VS0 A;  3AHU A;  2V1Q A;  3HFN A;  1KIK A;  4BDZ A;  2OTL A;  3NMZ C;  1VQ4 T;  2FZC B;  4QVZ A;  2ZPI B;  5CIU A;  1KD1 C;  3JCM g;  2PU9 B;  1PD1 A;  5A0D A;  3OSV A;  5GAO m;  4HCC A;  1UTI A;  4M7A F;  2JMC A;  1X27 A;  1KD1 R;  5FRO A;  1NBE B;  3EG9 A;  4M7A G;  4PFP A;  2DPP B;  1I4K 1;  1Y96 A;  1ZSZ B;  2EQK A;  4F04 B;  2YLB A;  2FG0 A;  3RBB B;  5KH6 A;  3G4S A;  3M53 A;  2GGR A;  5FWC A;  1G3W A;  2EGA A;  1AWW A;  1KQ2 A;  2RK2 A;  2ROL A;  2OTL Q;  4EPC A;  5FU7 B;  3EGX B;  3REB B;  2DZ9 A;  2DYB A;  1NPR A;  1OPK A;  4PFO A;  2XDD A;  4OB0 B;  1SKU B;  2XU8 A;  1AEY A;  2PVO B;  2GNC A;  2KXD A;  3QG1 A;  2CYZ B;  2YWW A;  3CPW A;  3QBY A;  3JB9 F;  1BI3 A;  5CQY A;  3M55 A;  1WXT A;  3NTI A;  2E5K A;  2C0I A;  4M75 E;  2Y4X A;  4QVC A;  1H92 A;  3RMS A;  3V7C A;  4C0F A;  2DAQ A;  1B7T A;  3I5R A;  3JB9 G;  3MEW A;  1N8R U;  4ME7 A;  3LX7 A;  1SEM A;  8ATC B;  2CZ1 B;  4BI4 A;  4X1V A;  3QWX X;  3CCV T;  4IUT A;  2CT4 A;  3NTK A;  4J8O A;  4Z88 A;  4AG2 C;  1WI7 A;  5GAN 3;  2JM9 A;  4J7I A;  3TSZ A;  1M1K U;  1KQS A;  1AHJ B;  2FPE A;  3EAE A;  3CCR T;  2HQX A;  2VV5 A;  4X34 A;  3WVD B;  4NOY A;  1WHH A;  3JCM h;  4C0D C;  3MO8 A;  2VAS A;  4D8K A;  3ZBD A;  2LQN A;  1JXM A;  3QZ9 B;  3CC4 A;  3L2Z A;  3JCM J;  2DER A;  1I0C A;  1TXQ A;  5KYW A;  1LNX A;  2J6O A;  4MZP A;  3RES A;  4PJJ A;  2DTI A;  4IKF A;  1QVF A;  1FXX A;  4LUE A;  2KRS A;  4X9C A;  3S6W A;  4XAX B;  1JJ2 P;  1GFC A;  4C92 F;  2MF2 A;  3UF4 A;  1W2B P;  4BE1 A;  3FLG A;  1YIT A;  4EMK B;  3NTH A;  1BKB A;  2DEQ A;  1GL5 A;  1ZA1 B;  3EHR A;  4C92 G;  2EJG A;  4C8Q A;  4M7A E;  3L2Q A;  1W1F A;  9ATC B;  4A4E A;  3OYB A;  3C95 A;  3RER A;  4A4H A;  5CKB A;  1UDL A;  5HK3 A;  1Q82 U;  4Z8A A;  1Q7Y C;  3CC4 Q;  2E6Z A;  1KHI A;  5EG2 A;  1VQ5 T;  3OS0 A;  3LLR A;  1Q7Y R;  2AK5 A;  2AT1 B;  1V29 B;  1K0S A;  1I8F A;  2LTO A;  3J81 E;  2L8D A;  1JXO A;  3M0Q A;  5CKE A;  2LCS A;  4FYX B;  2QAZ A;  2EGE A;  2YRD A;  3KUF A;  4OVA A;  4RCB A;  1K9M U;  3FIF A;  4M7A B;  3L2R A;  1YIT Q;  2JTE A;  2P84 A;  1R0B G;  4PLI A;  2WAC A;  3CEY A;  1S72 A;  2X35 A;  1XTD A;  2E12 A;  4EMH A;  5LJ3 f;  2EAY A;  2C0T A;  1X6O A;  4XU2 A;  4Z02 A;  2E3H A;  3OW2 P;  2XDP A;  2HQH A;  4RMO A;  2DIL A;  4E6R A;  4QQ6 A;  3EFO B;  1RAH B;  1BI2 A;  3M4Y A;  1UE9 A;  2QGG A;  4WTO B;  2F69 A;  2K9G A;  2ROT A;  3KBG A;  2JZ2 A;  1MMA A;  2MYS A;  2XID A;  3QWY A;  5HY6 A;  1Q81 C;  2FVU A;  1OU8 A;  5I21 A;  2E1H A;  2X4J A;  1VQN T;  4A54 A;  3GPL A;  3M0S A;  4FW1 A;  1WLP B;  2MIO A;  3GNG A;  1NPP A;  1S72 Q;  1YFN A;  2RHI A;  1EIF A;  3LYI A;  4BY6 B;  3EG9 B;  2ZPH B;  1RAF B;  1TS9 A;  2P0K A;  1Y96 B;  3CMA A;  2J6F A;  5LJ5 d;  3G1J A;  1M1G A;  1IB8 A;  3OYN A;  2WSE E;  2FPD A;  3OMC A;  1M9S A;  3CCM A;  4M7D D;  5GMK h;  4RG2 A;  2DL8 A;  1X75 C;  1O75 A;  4KUD K;  2DIG A;  3CCQ T;  1ZA2 B;  4ESR A;  5J39 A;  4ZN3 A;  5LJ3 e;  3MHX A;  3EFR A;  4JZ3 A;  1YHQ A;  2X4X A;  1AZG B;  1MV0 B;  4DBR A;  1M8V A;  5DLQ E;  2FZG B;  2RQV A;  5KYX A;  1E7O A;  1NLO C;  1IRE B;  4M75 C;  4F7U A;  3HRS A;  3RNJ A;  1QP3 A;  1YI2 T;  4L59 A;  1ZUU A;  3CCS A;  4DEY A;  1RAD B;  1M2V A;  3CMA Q;  2RHX A;  2SRC A;  2KBT A;  2JTM A;  4ZGJ B;  3ASK A;  1VQL A;  1K8A U;  1K4U S;  5GAN d;  1OYX A;  1H3H A;  3RMQ A;  1U1S A;  3MJX A;  1YHQ Q;  3REA B;  4KUL A;  3CPW P;  4XK8 E;  2CDT A;  2NUP A;  1PCX A;  1Q86 U;  2RA2 A;  3OS2 A;  3O5Z A;  1RAA B;  2JNG A;  2LMJ A;  2QQR A;  1YIJ A;  1EX4 A;  4AG1 C;  4MDW A;  2L3R A;  3V7R A;  3OS5 A;  2F1L A;  2K57 A;  4C8Q E;  3A8M B;  3CCS Q;  3DB3 A;  3OYY A;  4OGE A;  3DLL A;  3S3N A;  3PMI A;  2Y4Y A;  5KYW B;  1CKB A;  2LJ3 A;  1I81 A;  3BY7 A;  1VQL Q;  1W70 A;  5LJ5 j;  1PD0 A;  1BBZ A;  3GLX A;  3JCM V;  1UEC A;  1NYF A;  2DM1 A;  2DTH A;  3NHN A;  3OYF A;  2VC8 A;  4FU6 A;  1K73 C;  6AT1 B;  4E2F B;  4HT8 A;  5M9O A;  2GQV A;  5DY9 A;  4ELY C;  1OX9 A;  2QGF B;  1NYG A;  3E9F A;  4C8Q B;  2KRO A;  3TVT A;  2FHD A;  2L89 A;  3OYG A;  4LDY A;  1YIJ Q;  1N9R A;  4JPB W;  4LDW A;  1ARK A;  3N5B B;  2C0O A;  4MMK A;  5GAN g;  3E1S A;  1I5O B;  2EW3 A;  2HKQ B;  1WHK A;  1WYX A;  1M90 C;  3VS5 A;  3M59 A;  1WDX A;  5A0G A;  1HK9 A;  4B6M A;  1ZBX A;  1G8X A;  4RCC A;  3OBW A;  1VQK A;  5I11 A;  2EVR A;  1X2Q A;  3SWN C;  1D1C A;  3MEV A;  1PSF A;  4UC4 A;  4N4G A;  1YJN Q;  2R5M A;  1JJ2 S;  2FRY A;  4OMF B;  5GAN j;  2VUB A;  3PFS A;  4RG8 A;  1NJI R;  3MP1 A;  1Z9Q A;  2K5F A;  2O4X A;  1VIE A;  3QDF A;  4JS4 A;  5GAO p;  2RF0 A;  2RHU A;  1VQO T;  1VA7 A;  4ZTF A;  2YHT A;  1OUL A;  3EG0 A;  2LX9 A;  2QEX A;  2AKK A;  1M3A A;  4M78 F;  2WSF E;  4HVV A;  4RTZ A;  2EYW A;  5GAN 2;  3X20 B;  1G83 A;  3VUB A;  2GTO A;  4FSS A;  3G71 A;  4M78 G;  1JQQ A;  1VQK Q;  3CD6 T;  5CKD A;  3CCU T;  1GBR A;  4MZT A;  4QKU A;  3RUX A;  1TH7 A;  4LDU A;  2KRM A;  5DM7 R;  2IVW A;  1LJO A;  5IXB A;  1NEB A;  1M2O A;  3FB9 A;  2X4W A;  3P8D A;  4KRT A;  4XTZ A;  2E70 A;  4M75 D;  1G3S A;  4C5E A;  2LP5 A;  2OTJ A;  1VQM A;  5I2M A;  3OW2 S;  4PJO F;  2QEX Q;  5I2S A;  2F5K A;  2PQW A;  3GBQ A;  4M77 F;  2P4R A;  5GAN h;  3OYC A;  5GAM e;  4M75 A;  2DYI A;  4C92 C;  4PJO G;  4OGC A;  4M77 G;  5FWB A;  2V1R A;  3G71 Q;  1UGP B;  1VQ9 A;  4OMQ A;  5D6W A;  1SF9 A;  1U06 A;  2A36 A;  2EQM A;  4JS5 A;  3A5Z B;  4LXC A;  4IIM A;  5GAN 6;  2J6K A;  2R57 A;  5KYX B;  2DET A;  2CP0 A;  3D7S B;  1G5V A;  2PNI A;  4F7U B;  1MUZ A;  1YJ9 T;  2M02 A;  3IQL A;  4DBH A;  1VQM Q;  1LPL A;  1M2V B;  1BYM A;  1A0N B;  2DD4 A;  3QDR B;  4DEX A;  3OMG A;  5ECA A;  3CCL A;  2GCX A;  3TQ7 P;  5GJV B;  4C0D B;  3H41 A;  2KEA A;  4CRI A;  4B9W A;  3VYH B;  3EG2 A;  3V7S A;  2DZC A;  4X9D A;  1PKS A;  3T9N A;  1VQ9 Q;  5KYY A;  1AWX A;  2DL5 A;  4M7A D;  2QQB A;  3HPW A;  2DF6 A;  4A4K A;  3H9N A;  2NUP B;  4FT2 A;  4NL3 A;  1Y71 A;  3VRZ A;  2D8J A;  3CBM A;  2GQI A;  2M0Y A;  2COY A;  2CH4 W;  4DBQ A;  4E7J A;  2K7A A;  3UA6 A;  2ED1 A;  3QYG B;  4M7A A;  2IG0 A;  2C06 A;  2BZX A;  3CC2 A;  4LD9 K;  2X4Y A;  2ESW A;  2ED0 A;  2LC4 A;  1UUE A;  3G7Z A;  2F2W A;  4ZNX A;  2KI7 A;  2CRE A;  3CCL Q;  1VQP T;  2GBQ A;  1BCO A;  3PIP A;  5GMK m;  2VXE A;  4OB3 B;  2KXC A;  1M30 A;  2YUQ A;  3EFO A;  3O8V A;  4J7F A;  1R0C B;  4KGX B;  1OZ2 A;  1QVP A;  1FMW A;  5J3B A;  3LGF A;  2BUD A;  2VKN A;  5CKH A;  1PHT A;  1G3Y A;  2A28 A;  1Q81 U;  2OAW A;  4L6V 5;  2M16 A;  5KYN A;  3CPW S;  1SHF A;  3THK A;  3SWN A;  1IGU A;  2YDL A;  1RI9 A;  4J9E A;  3VYG A;  1PWT A;  2X9H A;  3CCE T;  1DJ7 B;  2K5I A;  2LNV A;  3OYI A;  3CC2 Q;  2NUT A;  2QTV A;  2CZ7 B;  2RJF A;  2K3B A;  3CCJ A;  1WHG A;  7AT1 B;  1VQ7 T;  1TU0 B;  2JW4 A;  3HFO A;  4J9F A;  1T3L A;  1SSF A;  5IHN A;  3V8J A;  2ZGW A;  1B3Q A;  1FX7 A;  4Y92 A;  3F70 A;  2O4X B;  2VGM A;  2RN8 A;  3CME T;  2ABL A;  3DLM A;  2LCL A;  2XKO C;  1B07 A;  3ER0 A;  1P92 A;  2EBP A;  3QHS A;  2E64 A;  2EYY A;  2HDA A;  2QAS A;  4ATO A;  4CC4 B;  3CCJ Q;  1KC8 R;  3UPU A;  4OML A;  5CKF A;  3OYL A;  4XTW A;  1ZQ1 A;  4QW2 A;  5GAN 7;  2CP5 A;  4F16 A;  3CC7 T;  3JB9 H;  1M1F A;  4FW2 A;  3CBP A;  2JS2 A;  4C92 A;  2JM8 A;  3V8K A;  8AT1 B;  2RO0 A;  1YWP A;  1NLP C;  1RAI B;  3J80 E;  2RQU A;  2CP3 A;  3J7A F;  3E2U A;  1ZSG A;  2H8H A;  4ZGD B;  3VS1 A;  1WIE A;  2JS0 A;  3VUZ A;  1GXI E;  3SEM A;  5LJ3 d;  2RMO A;  1ZX6 A;  2DIQ A;  2ZAE A;  4M75 B;  5FRN A;  2O01 E;  2OTL T;  3BDL A;  2DJQ A;  2KT1 A;  2L3Q A;  2RI3 A;  2CKK A;  2E10 A;  3QXE B;  2K4Y A;  3I35 A;  5GAO l;  3EFS A;  1YCS B;  4HXJ A;  1ZUY A;  4CC7 A;  2EPD A;  1XNI A;  4C8Q D;  1D0X A;  4R0K A;  4MML A;  2NYS A;  2RH2 A;  1K73 U;  1IHW A;  2A0F B;  1WXB A;  4C5I A;  2EQI A;  3G4S T;  4J9B A;  2BKD N;  3EGU A;  2HQE A;  2VVK A;  2RQW A;  4ZGE B;  4FT4 A;  4J9I A;  5EC7 A;  1MNE A;  2JXB A;  2KMT A;  2P0P A;  4J9G A;  3MKD A;  2CP7 A;  2JT4 A;  1D1B A;  3QPH A;  1M90 U;  2LJ1 A;  2DL7 A;  3VKI A;  1GCQ C;  2EYQ A;  3NGP A;  4HKE A;  2XDB A;  1W6X A;  2ZPE B;  5KYY B;  2FRW A;  2F5T X;  3I56 A;  1TUC A;  1J3T A;  4OF1 A;  5FW9 A;  4PLL A;  2MWO A;  4RTY A;  2ZPF B;  2AZS A;  3DB4 A;  3L2W A;  2KYB A;  2DJZ A;  3GIB A;  1M3B A;  4JLI A;  3AT1 B;  4M78 C;  1H8K A;  2AIR B;  2COZ A;  2E6N A;  3M58 A;  3JB9 J;  2KSS A;  4XTU A;  2YXY A;  3VJP A;  1C6V X;  3JCM P;  2KR3 A;  3RKW A;  2E5Q A;  3EG3 A;  1AT1 B;  5A2Q E;  3M5A A;  5LJ3 j;  3PGG A;  2K5L A;  1VIF A;  4NS5 A;  2LQ8 A;  3HSB A;  4RUG A;  3I56 Q;  2J06 A;  1E6G A;  2V8J A;  1B34 A;  4P5N A;  4R56 A;  4HCB A;  1VQ6 A;  3CC4 T;  5IXF A;  2O88 A;  3CCQ Q;  4PJO C;  3SWN B;  1Q95 G;  1TUD A;  4QT7 A;  3SD4 A;  3NPF A;  4M77 C;  4BB7 A;  2ZZD A;  3HKS A;  2NUT B;  2PUK B;  1UJY A;  1RI0 A;  1BU1 A;  1UGQ B;  2D1X A;  2FO0 A;  4ZN1 A;  2DE0 X;  2P4T A;  4E7Z A;  1VQ8 A;  1YIT T;  2LQW A;  3H0I A;  3ZFJ A;  1UJ0 A;  4DOW A;  2BIV A;  2F2X A;  1RLQ C;  1MHN A;  4CC2 A;  1YI2 Q;  1WJR A;  1PRM C;  1MMD A;  3SDZ A;  3L42 A;  3VV0 A;  1VYT A;  1VQ6 Q;  4PNO A;  5GMK e;  2B86 A;  2JVV A;  4C92 E;  4OB1 B;  4FM4 B;  1WJQ A;  2AKL A;  3NFC A;  1WXU A;  4OMN A;  5KE3 A;  3L2U A;  2JMA A;  1Y07 A;  4LD6 A;  1VOM A;  2M0O A;  1F1B B;  3UDC A;  3I55 A;  2DA9 A;  1VQ8 Q;  2MI6 A;  1OU9 A;  3A8H B;  1JU5 C;  2D0N A;  3A8O B;  1RUW A;  2KT8 A;  2MK5 A;  1U8R A;  1S72 T;  1M3C A;  2WSC E;  2XK0 A;  4BE2 A;  1N9S A;  1FYN A;  2QA4 A;  2CZ6 B;  2SEM A;  1GBQ A;  1EZZ B;  3R6O A;  1H64 1;  4C92 B;  3OYA A;  2JTF A;  4HT9 A;  4PFZ A;  1SSH A;  3EH2 A;  1KK7 A;  2VB6 A;  2QXF A;  5HCK A;  2RQR A;  3VS6 A;  2DBK A;  2J05 A;  1ABO A;  2V8I A;  4J5Y A;  3P8B B;  4OMM A;  3QII A;  4GBQ A;  5LJ5 g;  1KG1 A;  4FL6 A;  2OJ2 A;  2RNA A;  1G3T A;  2LJ0 A;  2QG9 B;  3I55 Q;  1FMV A;  2A37 A;  1NEG A;  3PIO A;  4L5G A;  4DOV A;  1QVG A;  4XQ3 A;  1N8R R;  2ZCF B;  3PVL A;  1BIB A;  2BTT A;  2NLU A;  2DRK A;  2RHZ A;  5KYU A;  4M7D F;  3HHT B;  1U3O A;  1YJW A;  2QA4 Q;  4EDU A;  1M1K C;  1MND A;  5HK0 A;  2LNH B;  1GCQ A;  3CMA T;  4M7D G;  1AOJ A;  1KQS P;  4F17 A;  1M1K R;  1YJN A;  3CCM T;  2K3Y A;  1WHL A;  2VGN A;  3A8L B;  2GFA A;  2W0Z A;  3UAT A;  1UGS B;  1NZ9 A;  3RIR A;  3FC3 A;  2M51 A;  1YHQ T;  1KD1 U;  4D6W A;  4M78 A;  2NUZ A;  1BB9 A;  3BE3 A;  3TCJ A;  1ABQ A;  1QVF P;  4KGZ B;  4FYV B;  1K1Z A;  2HKN A;  1GCP A;  3QO3 A;  3L1A A;  2E4H A;  2J7I A;  4PJL A;  1YJW Q;  2KK4 A;  2ENM A;  2RJE A;  5GMK i;  3CCS T;  3QZ5 B;  1IRX A;  2QK0 A;  1RAE B;  5LL6 S;  1OI1 A;  5GAO n;  2HL3 A;  2H3J A;  1PRL C;  1M27 C;  1NJI C;  5IN1 A;  5GAM f;  4BDY A;  4Q5W A;  1W2B S;  1Q82 C;  1UGV A;  1VQL T;  2RD1 A;  3MEA A;  1Q82 R;  1WHJ A;  4EIK A;  5LJ5 h;  4PJO A;  3CXC A;  1WJS A;  4M77 A;  3ME9 A;  3V8L A;  1WX6 A;  4XTY A;  3GP8 A;  3PE0 A;  2DO3 A;  1AD5 A;  1MV3 A;  2DLP A;  3GF5 A;  1YIJ T;  4KH0 B;  1B34 B;  1K9M R;  4Y91 A;  2FYK A;  2MMP A;  1KHC A;  4LUD A;  4NL2 A;  4B9X A;  4O6J A;  3OYH A;  1IO6 A;  2YRC A;  4QQD A;  2DBM A;  3LWI A;  4BE0 A;  2EQJ A;  5CCA A;  1IZ6 A;  1MMG A;  3A8G B;  1OZ3 A;  3I5S A;  3ZEH A;  1WGS A;  4IUU A;  1AWO A;  1JRI A;  1KSW A;  1C1A A;  4K11 A;  4BI3 A;  3G6E A;  5CAI A;  3DKM A;  2G6F X;  3OB9 A;  3OBY A;  4LN2 A;  3VS3 A;  2E41 A;  1WQW A;  2LT1 A;  4V2S A;  3OYJ A;  1D3B A;  2I2L A;  2RQT A;  2X51 A;  2CZ0 B;  3HRU A;  2ZPG B;  5FLX E;  1WPY A;  2LQK A;  4AFQ C;  2KDS A;  4C5G A;  2HD0 A;  4GLM A;  3TEE A;  3H8Z A;  2R58 A;  1UG1 A;  1KQ1 A;  2YUO A;  1WZO A;  2MWP A;  4KT0 E;  1YNZ A;  2VYT A;  2XI9 A;  3M9Q A;  1VQK T;  2HCK A;  1YWO A;  4OMO A;  4KH1 B;  4XU0 A;  3G6E Q;  4JJD A;  5I22 A;  4HVU A;  1VQ4 A;  2ATC B;  2D6F A;  4ELZ C;  4RTU A;  4RTW A;  1IHV A;  1Q7Y U;  2RI2 A;  2KQW A;  2YRV A;  2EKO A;  2DL4 A;  3H0F A;  4C0Z A;  2QEX T;  2D0Q B;  2DKG A;  2W10 A;  4Z89 A;  2QQA A;  3WXM B;  2QDY B;  2MCN A;  1M5Q 1;  1QQJ A;  3TRE A;  1OPL A;  3TU4 K;  4PK4 A;  2NWM A;  3JRZ A;  3G71 T;  1YN8 A;  2MPX C;  1LOJ A;  3WVE B;  1SHG A;  4HCZ A;  3BFM A;  4N0A C;  3ZL7 C;  2KRN A;  2RPN A;  1YBY A;  3M57 A;  1Y0M A;  3OW2 A;  1VQ4 Q;  2LX7 A;  1K8A R;  4Y28 E;  1R8O B;  1D0Y A;  2OX7 A;  3EGD A;  3RR6 A;  5KYU B;  4WCI A;  4M78 E;  3EHQ A;  3SB2 A;  1X2K A;  3JAM E;  4MZM A;  2HL5 C;  2Z0W A;  2OTJ T;  1H3Z A;  1VQM T;  1Q86 R;  2V26 A;  2EYX A;  2DNU A;  4J83 A;  1XQH A;  3QJ6 A;  1NE8 A;  1SRL A;  1WA7 A;  2L5Q A;  2DXT A;  3M4G A;  4E7H A;  2D9T A;  1QVG P;  2IIM A;  3JB9 D;  1VQ9 T;  1T0H A;  3H6Z A;  1IGQ A;  2X3X D;  3MPU B;  2L2P A;  3CCV A;  2DXB A;  4M78 B;  1IXD A;  2XMF A;  4J6W A;  1TTH B;  4JDS A;  5IHK A;  2FL7 A;  3A1P A;  2A3L A;  2HMA A;  4PJO E;  4M77 E;  2CSI A;  2RM4 A;  3EG1 A;  3C12 A;  3CCR A;  1X6G A;  3QUI A;  4LNP A;  2YSQ A;  2QQS A;  1PC0 A;  2HEQ A;  1LVK A;  2XIC A;  3CCL T;  1KQS S;  2R5A A;  1EFN A;  1G2B A; 
#chains in the Genus database with same CATH homology
 3O5Z A;  2LMJ A;  4AG1 C;  1H8K A;  1N5Z A;  1VYV A;  1X6B A;  2ECZ A;  3M0T A;  1BK2 A;  2PZ1 A;  2K6D A;  4RTT A;  2KR3 A;  1WFW A;  2YUP A;  1VYU A;  1CKB A;  1ZLM A;  2LJ3 A;  3EG3 A;  3SHW A;  2MOX A;  1W70 A;  4RUG A;  2J06 A;  1BBZ A;  1E6G A;  2DX1 A;  1UEC A;  1NYF A;  2DM1 A;  2QDL A;  2KE9 A;  3LH5 A;  3NHN A;  3PVQ A;  2YT6 A;  1NG2 A;  1Y57 A;  5IXF A;  2O88 A;  1TUD A;  4QT7 A;  4HVW A;  3VS7 A;  3NPF A;  1NYG A;  3I9Q A;  2KRO A;  3TVT A;  2CSQ A;  4JPB W;  1ARK A;  1UJY A;  1BU1 A;  2C0O A;  3R6N A;  2D1X A;  2EW3 A;  3M0U A;  2FO0 A;  1WYX A;  1M8M A;  1CKA A;  2DE0 X;  3VS5 A;  1WDX A;  4ORZ A;  2LQW A;  3H0I A;  1UHF A;  1UJ0 A;  2F2X A;  1RLQ C;  2EYZ A;  4CC2 A;  2K2M A;  1PRM C;  5I11 A;  2EVR A;  2BZY A;  1X2Q A;  1GFD A;  3M0R A;  3UA7 A;  2DL3 A;  1VYT A;  3M0P A;  4M4Z A;  1OEB A;  1LCK A;  2FRY A;  2B86 A;  1T3S A;  1Z9Q A;  3FJ5 A;  2RF0 A;  4J9D A;  2AKL A;  4OMN A;  1WXU A;  1VA7 A;  2FPF A;  2JMA A;  3EG0 A;  1QLY A;  4HCK A;  5IHI A;  2AKK A;  2CUB A;  2DA9 A;  4AFS C;  3JV3 A;  1M3A A;  4OMP A;  4HVV A;  4RTZ A;  2EYW A;  2D0N A;  1JU5 C;  2OI3 A;  2CH4 A;  2KT8 A;  1RUW A;  1GRI A;  1G83 A;  2GTO A;  1M3C A;  1KJW A;  4FSS A;  1I1J A;  1JQQ A;  2I0N A;  3VS0 A;  1FYN A;  2V1Q A;  2SEM A;  1GBQ A;  1GBR A;  1KIK A;  1XOV A;  1QKW A;  2KRM A;  1HD3 A;  1SSH A;  2D8H A;  5IXB A;  1NEB A;  3NMZ C;  5HCK A;  2O2O A;  2RQR A;  3VS6 A;  2DBK A;  2J05 A;  1ABO A;  4KRT A;  4OMM A;  4GBQ A;  1UTI A;  2JMC A;  1K9A A;  1X27 A;  1Z9Z A;  2LP5 A;  1NM7 A;  2OJ2 A;  2O9V A;  2RNA A;  2LJ0 A;  4JJB A;  3GBQ A;  2GTJ A;  2P4R A;  2A37 A;  2L3P A;  1NEG A;  1JO8 A;  2FEI A;  2HBW A;  3PVL A;  2BTT A;  4JZ4 A;  2FG0 A;  3RBB B;  5FWB A;  2DRK A;  2V1R A;  1HSQ A;  2GGR A;  3VS2 A;  4OMQ A;  1U3O A;  1U06 A;  2A36 A;  5FWC A;  4RTX A;  2EGA A;  2HSP A;  4IIM A;  1AWW A;  2LNH B;  1GCQ A;  2ROL A;  2J6K A;  1AOJ A;  4F17 A;  3REB B;  3A98 A;  2DYB A;  1OPK A;  2PNI A;  1MUZ A;  1QCF A;  1QKX A;  2W0Z A;  3UAT A;  1AEY A;  2GNC A;  3IQL A;  3H0H A;  2KXD A;  1K76 A;  1X69 A;  1FMK A;  2M51 A;  2EGC A;  2CT3 A;  1A0N B;  4DEX A;  1WXT A;  1ZUK A;  2NUZ A;  2E5K A;  2C0I A;  2EKH A;  5ECA A;  1PNJ A;  4IIO A;  1BB9 A;  5GJV B;  1H92 A;  4A63 B;  1ABQ A;  2KYM A;  2KEA A;  3H41 A;  3I5R A;  1K1Z A;  3EG2 A;  2DRM A;  1PKS A;  2L3S A;  1GCP A;  4JJC A;  1AWX A;  2DL5 A;  2J7I A;  1SEM A;  2DF6 A;  2ENM A;  4X1V A;  3QWX X;  2CT4 A;  4Z88 A;  3VRZ A;  2D8J A;  1PRL C;  1M27 C;  2GQI A;  2M0Y A;  4AG2 C;  1WI7 A;  4F14 A;  2JM9 A;  2CH4 W;  3TSZ A;  1UGV A;  2K7A A;  3UA6 A;  2ED1 A;  2FPE A;  2BZX A;  2ESW A;  2ED0 A;  1UUE A;  4EIK A;  2F2W A;  4D8K A;  1S1N A;  4ZNX A;  2LQN A;  1JXM A;  1QWE A;  1WX6 A;  2CRE A;  4AFZ C;  2GBQ A;  3PE0 A;  2PTK A;  2KXC A;  1I0C A;  1AD5 A;  1MV3 A;  1SRM A;  1M30 A;  2DLP A;  2YUQ A;  1JEG A;  2J6O A;  1SPK A;  4J9H A;  1RLP C;  2AZV A;  1ZBJ A;  3U23 A;  4LUE A;  2VKN A;  2KRS A;  4LUD A;  1GFC A;  1PHT A;  3UF4 A;  1IO6 A;  2A28 A;  2DBM A;  2OAW A;  2YUN A;  1SHF A;  3THK A;  1GL5 A;  1YP5 A;  3I5S A;  3EHR A;  2YDL A;  1RI9 A;  4J9E A;  1UHC A;  1PWT A;  4CC3 A;  1AWO A;  1W1F A;  1E6H A;  1KSW A;  4K11 A;  1OOT A;  2K3B A;  1UDL A;  4Z8A A;  2G6F X;  4LN2 A;  3VS3 A;  2JW4 A;  2AK5 A;  2RQT A;  2L0A A;  1T3L A;  4J9F A;  1K0S A;  5GJW B;  5IHN A;  4LE9 A;  1TG0 A;  1B3Q A;  5IH2 A;  1JXO A;  3M0Q A;  2LCS A;  2EGE A;  4AFQ C;  4Y92 A;  1AVZ C;  2JTE A;  1AWJ A;  4GLM A;  2RN8 A;  2ABL A;  1UG1 A;  2YUO A;  4RTV A;  1YNZ A;  2C0T A;  1B07 A;  1QWF A;  2EBP A;  2EYY A;  2HDA A;  2HCK A;  1YWO A;  4OMO A;  2DIL A;  4E6R A;  4CC4 B;  3VRY A;  3C0C A;  4JJD A;  4OML A;  5I22 A;  4HVU A;  1UE9 A;  2K9G A;  2ROT A;  3TSW A;  2BZ8 A;  1K0X A;  4RTU A;  4RTW A;  4F16 A;  2O31 A;  3QWY A;  1U5S A;  2DL4 A;  3H0F A;  2DMO A;  2JS2 A;  1T0J A;  1OV3 A;  2W10 A;  2JM8 A;  1YWP A;  2DVJ A;  4Z89 A;  3M0S A;  1WLP B;  2MIO A;  1NLP C;  2MCN A;  4J9C A;  1OPL A;  2RQU A;  1AZE A;  2NWM A;  1YN8 A;  1ZSG A;  2H8H A;  3VS1 A;  1SHG A;  2CUD A;  1WIE A;  1HJD A;  2JS0 A;  2LZ6 B;  3SEM A;  3ZL7 C;  2KRN A;  2RPN A;  1I07 A;  2X3W D;  2RMO A;  2O9S A;  1ZX6 A;  2J6F A;  1UFF A;  2FPD A;  1Y0M A;  2LX7 A;  2DJQ A;  2KT1 A;  3CQT A;  2DL8 A;  2L3Q A;  3KFV A;  4WCI A;  3I35 A;  3EHQ A;  4ESR A;  1X2K A;  1YCS B;  4JZ3 A;  3VS4 A;  4HXJ A;  1ZUY A;  4CC7 A;  2EYX A;  2DNU A;  2EPD A;  1AZG B;  1MV0 B;  2F2V A;  4R0K A;  2RQV A;  2A08 A;  1CSK A;  1SRL A;  1WA7 A;  1E7O A;  1V1C A;  1WXB A;  1X43 A;  2VWF A;  1NLO C;  3RNJ A;  2EQI A;  2IIM A;  4J9B A;  3EGU A;  1T0H A;  2VVK A;  2RQW A;  2X3X D;  4AFU C;  4J9I A;  2L2P A;  5EC7 A;  2JXB A;  1ZUU A;  4DEY A;  2XMF A;  4J9G A;  5IHK A;  2KNB B;  2JT4 A;  2SRC A;  2LJ1 A;  2DL7 A;  2KBT A;  1GCQ C;  1KFZ A;  3NGP A;  2CSI A;  1W6X A;  3EG1 A;  1K4U S;  1H3H A;  2KGT A;  2FRW A;  1X6G A;  1TUC A;  1J3T A;  5FW9 A;  3ULR B;  4LNP A;  2YSQ A;  4RTY A;  5L23 A;  2K79 A;  2HEQ A;  1PKT A;  4D8D A;  2AZS A;  3REA B;  2KYB A;  1M3B A;  2CDT A;  1EFN A;  1G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...