1OV3A

Structure of the p22phox-p47phox complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
LGSPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase activator
molecule keywords Neutrophil cytosol factor 1
publication title Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ov3A01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ov3A02
1K76A 1PKSA 1IO6A 2EYZA 4J9GA 1X2QA 1BB9A 4D8KA 4AFSC 1SHFA 2EGCA 1ZLMA 4KRTA 1AWXA 4HCKA 3RBBB 1YWOA 3O5ZA 1QLYA 1M3BA 2IIMA 2JM9A 2LQNA 2ESWA 5FWCA 2FPDA 3NMZC 3TVTA 1M3AA 2VVKA 2KGTA 5IHKA 2CT4A 1VA7A 2AKKA 1Z9QA 1MV0B 1A0NB 1BU1A 3QWXX 1U3OA 2EYWA 2D8HA 1GFDA 1NLOC 1X2KA 4J9IA 1YCSB 1K0XA 2LJ3A 4IIOA 2HBWA 1VYVA 2KYMA 3QWYA 2DLPA 2O88A 3VS3A 1CSKA 2RPNA 2L3SA 3EG0A 3R6NA 1M30A 1UE9A 1UGVA 2OJ2A 1X6GA 1HJDA 2JS2A 4RTZA 1UJ0A 2LNHB 1UECA 3ULRB 4F14A 2RQWA 2H8HA 1G83A 1JEGA 2DL8A 2A08A 2W0ZA 1G2BA 2DMOA 2D1XA 2EGAA 1LCKA 2PNIA 1UTIA 2RNAA 1GCQC 2JXBA 1H8KA 2C0OA 3A98A 2KXCA 2FG0A 2KYBA 1T0JA 2YUQA 2JS0A 1PRMC 3M0TA 1KFZA 1N5ZA 1AWOA 4J9BA 2A28A 5GJVB 3LH5A 1RLPC 5HCKA 4J9EA 4AFZC 2BZ8A 3M0PA 2EVRA 4J9DA 4IIMA 2JMCA 1VYUA 1WLPB 2L0AA 2FO0A 1X6BA 3RNJA 2YUPA 1UG1A 2LJ1A 2JT4A 2E5KA 3VS6A 1MUZA 3I9QA 1J3TA 1AD5A 2DX1A 2NWMA 2KROA 2K3BA 2JTEA 1Y57A 2CH4W 1ARKA 4CC4B 5IXFA 2DE0X 2YSQA 1T3LA 5ECAA 1QWFA 1OPLA 2XMFA 3VS7A 1ZUYA 2GTOA 1S1NA 1WI7A 2CSIA 3REBB 2HEQA 2OI3A 4JJCA 4LNPA 4OMNA 4OMLA 3PE0A 1OOTA 1YN8A 2GNCA 4JJDA 4DEYA 2FRYA 2VKNA 1UHCA 3UF4A 3EHQA 2PTKA 5IHIA 1HSQA 3H0HA 3REAB 1W1FA 4R0KA 1H92A 2SRCA 1ZX6A 3FJ5A 2FPFA 1PWTA 5IXBA 4RTWA 2ECZA 4CC2A 4HXJA 3EHRA 1X43A 3EG2A 1PNJA 1Y0MA 2LJ0A 2ROTA 2DRKA 4JZ3A 2F2WA 4CC7A 1I0CA 4OMMA 3M0SA 3GBQA 1NYFA 2ROLA 2KT8A 4K11A 3H41A 2DA9A 2K79A 2GGRA 1KJWA 2FRWA 2L2PA 1V1CA 1JO8A 2O31A 5FWBA 1FYNA 4RTTA 1SRMA 2KRMA 2M0YA 4AFQC 4CC3A 1WA7A 1CKBA 1X27A 4OMQA 2K7AA 2O9VA 3NHNA 2CDTA 2GBQA 3JV3A 2RQTA 2RMOA 1RI9A 2EGEA 2FPEA 2JMAA 4LN2A 1RLQC 2M51A 1FMKA 1T0HA 1WXBA 2DILA 4JJBA 2P4RA 4ESRA 3I5RA 2AZVA 3NGPA 1U5SA 4Y92A 3H0IA 2DRMA 1M3CA 2BTTA 2F2VA 1JXOA 1WXUA 1GFCA 2JM8A 4J9FA 2LCSA 2YUOA 2DF6A 2QDLA 1UJYA 2NUZA 1NM7A 2DNUA 2O2OA 4J9CA 3VRYA 1AEYA 1QKXA 1ABOA 3VS1A 1OV3A 1AWWA 3NPFA 1YP5A 1YWPA 1QWEA 2KEAA 2PZ1A 1W6XA 2HDAA 2V1RA 5IHNA 3KFVA 4RTVA 4JPBW 2K6DA 1K4US 1NYGA 2D8JA 2EW3A 1XOVA 2I0NA 3VS0A 4RTXA 1WIEA 3M0RA 3UA6A 2MCNA 2GQIA 4E6RA 2D0NA 1TUDA 4F17A 2YUNA 1GBRA 1OEBA 2J05A 1YNZA 2HCKA 1ZUKA 1PRLC 3UA7A 1U06A 4Z8AA 1WX6A 3PVQA 4GBQA 1H3HA 2RQRA 2DVJA 2RQVA 4LUEA 4WCIA 3VRZA 3VS5A 3IQLA 1WXTA 2A37A 4DEXA 3I35A 2KBTA 1GCPA 1I1JA 1KIKA 2KR3A 1QKWA 1W70A 5I11A 1GCQA 1JQQA 2KT1A 1TUCA 4M4ZA 3ZL7C 1OPKA 1B3QA 1ABQA 1NEGA 3M0QA 4OMOA 1CKAA 1UHFA 2V1QA 2LMJA 2FEIA 1NLPC 2O9SA 2LP5A 1BBZA 1E6HA 1KSWA 1VYTA 2L3QA 1HD3A 2CREA 1GBQA 1K0SA 1E7OA 2DL7A 2KRNA 1GL5A 3SHWA 3UATA 2DBMA 3THKA 1EFNA 3M0UA 1PKTA 2W10A 3EG3A 4Z89A 1WYXA 4AFUC 1NEBA 2EYYA 4Z88A 1SEMA 3VS2A 2RN8A 1WFWA 2EPDA 1B07A 2AK5A 4OMPA 1JU5C 2MIOA 2OAWA 4GLMA 1SSHA 2EBPA 1JXMA 2VWFA 2RF0A 4RTYA 4ZNXA 1NG2A 1WDXA 1BK2A 2CUBA 2EQIA 2J6OA 1PHTA 5L23A 5EC7A 4JZ4A 2F2XA 2LX7A 2ED0A 4HVUA 1MV3A 3PVLA 4RTUA 1SHGA 2AZSA 2LZ6B 5FW9A 2YT6A 4RUGA 5I22A 1AOJA 2DL4A 1AZGB 1ZUUA 2J7IA 1QCFA 2X3WD 3EGUA 4X1VA 1M27C 2X3XD 2J6KA 2GTJA 1RUWA 2ABLA 2DBKA 2CT3A 2EYXA 2CSQA 2J06A 4AG1C 1ZBJA 4LUDA 3SEMA 2B86A 1X69A 2EKHA 2JW4A 2HSPA 2A36A 3U23A 1AVZC 3TSZA 2BZYA 1SPKA 2C0IA 4HVWA 2RQUA 3EG1A 2LQWA 4A63B 2MOXA 1SRLA 1ZSGA 4AG2C 1UUEA 4F16A 4J9HA 1UFFA 2CH4A 3C0CA 4HVVA 1T3SA 2CUDA 1M8MA 2DM1A 2KRSA 1GRIA 2K9GA 4D8DA 2AKLA 1UDLA 5IH2A 2L3PA 2DYBA 2KNBB 3CQTA 4FSSA 2K2MA 3H0FA 4EIKA 3TSWA 1AWJA 2KXDA 4LE9A 2KE9A 2YDLA 1K9AA 2C0TA 4ORZA 2DL3A 2DL5A 5GJWB 1E6GA 4QT7A 2ENMA 1AZEA 1I07A 2DJQA 2SEMA 1Z9ZA 3VS4A 1TG0A 2J6FA 2ED1A 3I5SA 2G6FX 1K1ZA 2BZXA
chains in the Genus database with same CATH superfamily
3QKJA 1KQSS 3RMQA 1IO6A 2MAMA 4M75G 4ZGDB 4E7HA 4D8KA 1BI0A 2VASA 1ZLMA 2BE7D 3JB9D 4F7UA 1M1KR 3CCJQ 2IIMA 2JM9A 3KXTA 2FPDA 3META 3TVTA 5GMKl 2E6NA 1D0XA 1VQ6A 4CI0C 2XG8D 1BU1A 1NBEB 1IHVA 2QA4A 5J39A 1YCSB 3I55Q 4MMLA 1K0XA 1TU0B 4J83A 5CK9A 3QWYA 2O88A 4IUTA 2X4XA 1YJ9A 1VQNA 3EG0A 4ELZC 3CCUA 3R6NA 2OJ2A 2MWOA 1X6GA 4M77F 4OB2B 2JS2A 1UJ0A 1UECA 1QCNA 5GAOr 3JCMV 3I56A 2EQMA 2ATCB 3VJPA 1VQOA 2ZCFB 1U1TA 1UTIA 1GCQC 2EJ9A 3URGA 2C0OA 3EGXB 3RR6A 2IG0A 3CC7Q 2R5AA 2ZPBB 2YUQA 1Y7XA 1KFZA 5GMKh 5KE3A 1N5ZA 3CC2T 1S72Q 3H6ZA 1QW1A 3A8HB 4RCBA 3MCAB 2R5MA 3EGDA 3WXMB 4M77E 1YJNQ 1Y71A 2QQ9A 4AFZC 3BDLA 5GANf 4HT9A 1SSFA 5GANg 3EG9B 1WLPB 4RG2A 3CMEQ 1U1SA 2HMAA 2YUPA 3EFOB 1UG1A 4C92D 2O01E 1M1GA 3VS6A 2QQRA 1N8RR 1MUZA 3GOXA 4D6WA 3JCMX 5GMKe 1VQ6T 1MNDA 3LWIA 2CH4W 4XAXB 1VQ8Q 5IXFA 1WHMA 2DFUA 1PC0A 2QA4T 1T3LA 2JJ9A 3C4SA 2K2VA 3GIBA 1QWFA 4M7AB 4M75A 3L2VA 1BCMA 3H8ZA 1YJ9T 4XU1A 1N9RA 1VQNT 4OMLA 3PE0A 3CCUT 4RCCA 4DEYA 4XTZA 2FRYA 1PSFA 4A53A 4JRQA 1EIFA 1KHIA 4XU0A 4ZTJA 3I56T 4JRIA 1PWTA 5IXBA 4RTWA 2DVEA 3LYIA 1VQOT 1ACMB 3EHRA 2E1HA 2YXYA 2F5KA 2GFAA 2X51A 2XKOC 4PJNA 3QHSA 1VQPT 2CS7A 4IKFA 1Y07A 4GLKA 1UGQB 2BE9B 2K3XA 2E41A 4ZGEB 1NJIR 4M75E 3H41A 1KD1R 5KYUA 1X01A 2FRWA 2L2PA 1V1CA 2RHUA 2M1HA 1JO8A 2O31A 1FYNA 4RTTA 1D1CA 1SRMA 2M0YA 5KCHA 1WA7A 1CKBA 2JVVA 2K7AA 2LT4A 3NHNA 1N6AA 2ZPIB 3RMSA 3CCRQ 1XJWB 3HRUA 2CP7A 4M77B 1D3BA 2BIVA 1T0HA 1BI1A 1WXBA 2DILA 3O8VA 3WVDB 4JJBA 4ESRA 4X9DA 1D09B 2M0OA 1HK9A 2QQAA 4PNOA 1IGUA 1VQLT 1JXOA 4J9FA 2YUOA 2QDLA 3MEAA 4JRKA 4C5HA 4J6WA 3LLRA 1Q7YC 3V7CA 1AWWA 4M78G 5IHNA 5LJ5j 5CKFA 9ATCB 1OZ2A 2K6DA 4LDWA 4XTYA 1NYGA 2LQ8A 3HRSA 4ELYC 1OYXA 2GQIA 2D0NA 5A0GA 1OEBA 2J05A 4JDSA 2Y90A 2HCKA 1W4SA 1ZUKA 2XICA 2L89A 3CCVA 4Z8AA 5GAMg 1D1BA 4PJOG 3OYGA 4M7DD 3CC7A 5KYXB 4GBQA 2RQRA 3VS5A 3IQLA 4A4GA 1VQKQ 1ZHIA 2F1LA 2KBTA 1S72A 5FRNA 1W2BP 4MZPA 1WGSA 1QVFP 5AT1B 4XTWA 4E7KA 1YJNA 1KQSA 2F5TX 1TUCA 2LDMA 5LJ3j 3ZL7C 2DJZA 4OMOA 2O4XA 2DXCA 3PFSA 1Q7YU 3AHUA 1NPPA 4OGCA 1NLPC 2O9SA 5GAOm 2XIDA 1YCYA 1E6HA 1KSWA 3OSSC 1GBQA 1K0SA 1SKUB 4AMCA 1E7OA 2YLCA 1N27A 1BI2A 3E1SA 1GL5A 1K8AR 1K9MR 1D1AA 3M0UA 1VQ8A 3RIRA 2W10A 4Z89A 2DIQA 4FSXA 1IXDA 4Z88A 1SEMA 3VS2A 2RN8A 5M9OA 1MGQA 4NL3A 1YJWQ 1B07A 3OYDA 1K73R 1SSHA 2CZ0B 3UWNA 2CUBA 1Y96A 2P0PA 3PGGA 2EAYA 2XDBA 2YHTA 1FMVA 1B34A 5KYWA 4KH0B 4C8QD 3OA6A 2AZSA 1O75A 3A8OB 2YT6A 1XTDA 1AOJA 2J7IA 3PTAA 3CCVT 1EZZB 3EGUA 3CXCA 3CC7T 2E10A 2G3RA 4F04B 4M78A 4M78F 1S72T 1R0BG 1Q82C 1OZ3A 3OB9A 1ZQ1A 1ZBJA 3AT1B 3QDRB 2XHCA 4A4EA 2G6FX 1YJNT 1C0MA 2HQEA 5KYNA 2HSPA 1AVZC 3TSZA 1YHQQ 2D6FA 3HP9A 4BACA 4QQ6A 2C0IA 4HVWA 3FEOA 3EG1A 1SRLA 4PJOA 4J9HA 1VQ8T 4HVVA 1T3SA 2CUDA 4C8QA 4QVCA 4M78E 1WJSA 2CP6A 2HD0A 2HL5C 2KRSA 4D8DA 2AKLA 4JS5A 5IH2A 1VQ7A 2K2MA 2CP3A 4EIKA 3SDZA 2HQHA 1BI3A 2KXDA 4LE9A 2YDLA 2C0TA 4M7AG 5GANd 4JJNK 2FZGB 3OW2S 3OYLA 3S3NA 2ENMA 2DJQA 5A2QE 1RADB 5GAOp 4DBHA 2DYIA 2GF7A 2J6FA 1Q82U 3M59A 1VQ9A 1K76A 2AT1B 2EYZA 4JUVA 1X2QA 1BB9A 1SHFA 2EQKA 4KRTA 2QGGA 1R0CB 4HCKA 3RBBB 2DXBA 3OS1A 2PVDB 2K5FA 5FWCA 2MWPA 2HL3A 5C0MA 1M1KC 1M3AA 5D6XA 4EMGA 1M9SA 3CMAQ 2CT4A 1VQKA 5GAN4 2QG9B 4JLIA 1Z9QA 4J7IA 2HBPA 3JCMc 3ER0A 2HKQB 2EWNA 2JNGA 2GCXA 2JZ2A 4VUBA 1OX9A 1MMNA 2LJ3A 4IIOA 4KGVB 2HBWA 1VYVA 3M55A 1CSKA 2VV5A 1M30A 4DQ2A 1UGVA 1HJDA 4HKEA 3OYJA 1KC8R 5GAOq 1KQ2A 4M77G 3EGXA 4XU3A 2DL8A 2DD5A 4JLGA 2BKDN 1VQ7T 3L2UA 1G2BA 2V8KA 1QCOA 3CCMQ 3NTHA 1H8KA 3X26B 2Z0WA 5CKDA 1MHNA 2KXCA 2QXFA 1PRMC 3EFSA 4BI8B 1Q86R 1N9SA 2FVUA 1M1KU 2CGHA 3EG9A 1VQ9T 4J9BA 5GJVB 3QXEB 3PT9A 1RLPC 5HCKA 3EFOA 4DBFA 4EPCA 4J9EA 2RJCA 1JB0E 2BZ8A 2EVRA 4J9DA 4KUIA 3PIOA 1VYUA 1MNEA 3CD6Q 4QVZA 1YITA 1F1BB 2P0QA 1X6BA 2F69A 5FRMA 3V8JA 4M7AA 3JCMh 2JTMA 1J3TA 1VQKT 1AD5A 2LX9A 2K3BA 2JTEA 1Y57A 3CCEQ 1ARKA 2RHXA 3CC4Q 4OB3B 3OBWA 4E2FB 5ECAA 3MEUA 2RI5A 2KDSA 4M77D 1ZUYA 2GTOA 4Y28E 5CQXA 4JJCA 2GNCA 4JJDA 3G6EA 1UHCA 4KT0E 5IHIA 4OP0A 1SG5A 3JCMe 3JCMd 3LGFA 5GAMe 5GAMd 2KMTA 1JJ2P 1W2BS 1WHLA 1AHJB 2ECZA 4M7AE 4CC2A 1QVFS 1PNJA 1WPYA 3TCJA 2YRVA 1Y0MA 3G4SA 2LJ0A 4CC7A 1B7TA 2RA2A 2VC8A 3GBQA 2ROLA 2KT8A 4K11A 2XK0A 2K79A 2WACA 5A0DA 1MMDA 4KH1B 1KJWA 2BUDA 4FYYB 1M2OA 1NJIC 2X4YA 3NTIA 4FM4B 4M77A 4ZN1A 4FW2A 1YITT 3FC3A 3VKIA 4N4GA 2RMOA 3HKSA 2EGEA 2FPEA 4O5VA 2A7YA 2M02A 1RLQC 3UT1A 1FMKA 2CYZB 2NLUA 2IPOB 4M75D 2P4RA 2DEQA 3I5RA 3NGPA 3CMAA 2DKGA 1IRXA 1VQPA 3X28B 3SWNC 2X35A 1VIEA 1U8RA 4OGEA 4ATOA 5I2MA 2JM8A 1GFCA 2LCSA 1YHQT 1ZSZC 1EX4A 2DNUA 4J9CA 5A0LA 1AEYA 4EMHA 1QKXA 1ABOA 3NPFA 4BB7A 3G6ET 1QWEA 5GAOl 4MMKA 3JB9F 3OYHA 2KEAA 2AIRB 2RD1A 5FLXE 3VYHB 1UEBA 3MJXA 4C5EA 1WJQA 1RAAB 7AT1B 1M8VA 1K4US 4E7JA 2D8JA 1VQ4Q 1XOVA 2I0NA 3VS0A 1NJIU 4RTXA 5LL6S 3OW2P 2RH2A 1M90C 2ZPHB 5KH6A 4C92C 5KYXA 3G4ST 2E65A 4L5GA 5DLQE 1TUDA 3LH0A 2NUPB 1WHHA 1PRLC 5CR2A 5AYFA 3OY9A 4E47A 1Q81R 3PVQA 2OTLQ 1VQLA 4LUEA 5EG2A 3CPWP 2A37A 4DEXA 3I35A 2D9TA 1GCPA 1I1JA 1KIKA 4J7FA 2GQVA 5I11A 1TTHB 2E64A 1GCQA 1YFNA 3ZEHA 3JB9J 1OPKA 4KGZB 1YIJQ 3CD6A 3HL8A 4OVAA 3QSUA 1RAIB 2L3QA 4QW2A 4E7SA 2MI6A 3SB2A 2YRDA 3VYGA 3CMAT 3PMIA 2KRNA 2DBMA 3THKA 1EFNA 1WYXA 4AFUC 3CC4A 1NEBA 3OMCA 1K9MC 2HSEB 1M90U 1BCOA 2HNIA 2EPDA 4B9XA 5GAN2 5IAYA 1UGSB 4R56A 3A8MB 4RTYA 1NG2A 3JB9I 4C92F 1K73C 1RAGB 3FRNA 3CEYA 3V7SA 5L23A 4J8OA 5EC7A 2QASA 2F2XA 2CZ6B 1BIBA 3CCJA 4RTUA 1SHGA 2L8DA 4PL6A 3DB3A 4XTUA 3CCLQ 3HFOA 3L2RA 1FMWA 2DL4A 1ZUUA 2LQKA 2KSSA 1M27C 2X3XD 2DXUA 2GTJA 2YLBA 4FYWB 5CKBA 3I55A 4BI3A 4LDXA 4PFOA 2DBKA 4OMFB 2CT3A 4C5IA 2J06A 2QQSA 4AG1C 1QVGP 2NYSA 3R6OA 1PD0A 2DK3A 4E7ZA 2DZCA 2X9HA 3L42A 1PD1A 1R77A 1K9MU 4IUQA 1SPKA 4ZTFA 3CD6T 5J26A 1YI2Q 4PKCC 4MZTA 3KBGA 4A63B 3L2WA 3OYYA 2V8JA 2DO3A 3MP6A 4PLIA 3GPLA 4F16A 3JCMf 1OX8A 1K73U 1UFFA 2CH4A 5GAMf 3JCMg 3CC4T 2V8IA 3BDUA 4BUGA 5HKCA 4A4FA 1GRIA 4M7DC 1R8OB 1TSFA 4L59A 4FSSA 4DOVA 4IUUA 1OI1A 3G1JA 2KE9A 2CP5A 1VIFA 1K9AA 1FXXA 1WHKA 4A4HA 2E6ZA 1Z9ZA 3VS4A 1TG0A 2K3YA 2LC4A 2EJGA 3CCJT 1XQHA 3CMEA 1K1ZA 2NUTB 1DJ7B 1VQ4A 2XD0A 4XTVA 2QAZA 1VOMA 5CCAA 2DXTA 4J9GA 5CKEA 4M78D 1QVFA 3LX7A 2PUOB 3CCSQ 3X25B 3SWNB 2OTJQ 1AWXA 1LJOA 2A0FB 2KQWA 4FL6A 5LJ5h 3V8KA 1ZSZB 2LQNA 4V2SA 2RJDA 3I55T 2ESWA 4BE2A 2VVKA 1JJ2S 2WSEE 1UGRB 1MV0B 1A0NB 3QWXX 1U3OA 4BY6C 5GAN7 1X2KA 2GFUA 4J9IA 4PJOD 5GANj 2DETA 3BFMA 8ATCB 2RO0A 2HZYA 4KBMB 2KYMA 3JCMW 4C92B 2DEUA 2RPNA 5LJ5e 5LJ5d 2EIFA 2P84A 4XTXA 4M7DF 4C8QC 2XDDA 1UE9A 3V8LA 3VUZA 2QQBA 4C0DC 3ULRB 4F14A 2PVGB 3GLXA 1RACB 3HPWA 2W0ZA 5J3BA 3FDRA 2DMOA 4A54A 3EFRA 1KC8C 1G3TA 2EGAA 5LJ3h 3FJPA 4XU2A 2RNAA 2JXBA 3LW5E 8AT1B 1OU8A 3A98A 3QPHA 4N0AC 3JRZA 2ZGWA 4EMKC 1WNLA 3OS2A 3MEWA 1RAEB 5IT9E 3DB4A 4II1A 3CMET 3MPUB 1VQ4T 3CCRA 3M5AA 2VXEA 2MPXC 3OYEA 3M0PA 4PJLA 3J7AF 4IIMA 1X6OA 1H641 3CBMA 4N4IA 2R58A 2L0AA 3CC2Q 1TS9A 2PU9B 3RNJA 4BDYA 2LJ1A 2E5KA 2DERA 1C6VX 3OYKA 3I9QA 2KROA 2DE0X 5D7UA 2QK0A 1OPLA 1MMAA 4XK8E 1KC8U 4OF1A 1S1NA 3CBOA 3UPUA 3BE3A 1YIJT 2HEQA 2OI3A 2RHZA 1VQ6Q 4OMNA 2Y4XA 3QZ5B 1V29B 1OOTA 1YN8A 2VKNA 3UF4A 3EHQA 2PTKA 3REAB 1HSQA 4TVRA 3CPWS 1W1FA 4FYVB 1H92A 4LD9K 4ANJA 1BKBA 2FZCB 2FPFA 5FROA 2P4TA 1VQNQ 3CCUQ 4MDXA 4HXJA 4DOWA 3JCMP 5FU6C 2L5QA 3EG2A 5CKHA 2ROTA 2DRKA 2F2WA 1I5LA 4WF2A 2RK2A 4OMMA 1NYFA 1PCXA 3EH1A 2VB6A 5KYYB 2DA9A 1VQOQ 2GGRA 2QTVA 3PIPA 3CCRT 4FU6A 1NPRA 3OYNA 2ZPFB 6AT1B 3M58A 4YTLA 3RKXA 4M7AD 1X27A 4LDVA 4OMQA 4Q5WA 3X20B 3T9NA 3TREA 5C6SA 2HKNA 3CCSA 3JV3A 5GAMj 4M7DB 2OTJA 2K5LA 1RI9A 2PVOB 4LN2A 2M51A 1YJWA 2RHYA 4DBRA 3S3OA 2AZVA 3ME9A 4PLLA 1QVPA 3H0IA 4Y92A 1VQMQ 1TH7A 2BTTA 2K57A 3P8DA 5KYWB 2F2VA 3A1PA 1Q82R 1WJRA 1BYMA 2DF6A 2NUZA 2DAQA 1NM7A 3VRYA 1G3WA 2XU8A 1YP5A 1YWPA 2VGNA 3GNFB 4PFPA 2PZ1A 1WHGA 2LCLA 3M57A 4C0GA 1LPLA 3KFVA 3JB9G 4JPBW 4Y91A 3D7SB 4N4HA 1OU9A 4BE1A 3QJYA 2NUPA 1HXDA 1QVGS 2WSCE 1TWBA 1M2VB 3M0RA 2AHJB 3E19A 2KVQG 5D6WA 2QDYB 4BI4A 3KUFA 4F17A 1GBRA 5DM7R 4L6V5 4QQDA 1N8RC 4C5GA 5CQYA 2K5IA 4BY6B 1U06A 4RKUE 2ZZDA 1WX6A 5DLOA 3DKMA 2RQVA 3VRZA 1YHQA 3Q1JA 1WXTA 1Q81C 3JSCA 2CZ1B 2KR3A 4HCBA 4C8QB 4C0DB 4HCCA 3E9GA 2K4YA 3C94A 2JN0A 3CCST 4M4ZA 1P92A 2CP2A 2OTJT 1ABQA 1CKAA 1UHFA 2V1QA 2LMJA 1NZ9A 1H3ZA 1RAHB 3A8GB 3OSVA 4LXCA 1VUBA 5LJ5f 3L1AA 2COYA 2E5QA 1YJWT 3NFCA 5LJ5g 1HD3A 2CREA 3GP8A 5GMKj 1I81A 4RG8A 3SHWA 4EMKB 4FW1A 1PKTA 4F7UF 3EG3A 1JJ2A 3OYIA 2EYYA 3LGLA 2X4WA 2AK5A 3QG1A 4OMPA 2OAWA 4GLMA 1RL2A 1N8RU 1KD1C 2YWWA 3OYFA 2VWFA 2RF0A 1KQ1A 4ZNXA 1KG1A 1WDXA 3MEVA 4AT1B 2IVWA 4JZ4A 1GXIE 4C92G 1Q81U 3OBYA 1MV3A 3PVLA 3L2ZA 3JB9H 2LZ6B 1YBYA 5FW9A 5LJ3f 5I22A 3VU3C 4F7UE 5LJ3g 1QCFA 2X3WD 4M75C 4LDUA 1I4K1 3HSBA 3OS0A 2ABLA 4NL2A 3CXCS 4J6XA 2CSQA 2LNVA 3CCVQ 4P5NA 4FT2A 2KK4A 2A36A 1KHCA 2COZA 3ZBDA 1WZOA 3MP1A 4J5YA 4E7LA 2KI7A 2FB7A 5FU7C 3CPFA 5FU6B 1KD1U 2MOXA 1NE8A 3FLGA 4AG2C 1UUEA 4XQ3A 3CCMA 4QKUA 3M54A 5L8RE 5KCOA 3C0CA 2E12A 2R57A 3L2QA 3CCQQ 1VQMA 2K9GA 3QO3A 2D0QB 5D6YA 4HT8A 3OW2A 2DYBA 3CQTA 3H0FA 2EQJA 3TSWA 1AWJA 2VGMA 3GNGA 1OQKA 2QYZA 2NUTA 5DY9A 2DL3A 5GJWB 1AZEA 1I07A 4OB1B 4C0ZA 3CPWA 2MK5A 2ED1A 3I5SA 3SWNA 4M75F 2LRQA 1PKSA 1ZSZA 4NOYA 4AFSC 2EGCA 3OYCA 3A8LB 3CCEA 3QYHB 3FIFA 3P8BB 1YWOA 3O5ZA 1QLYA 1M3BA 1K8AC 2CP0A 3M53A 4QQGA 2VXFA 3MHXA 3QZ9B 1G5VA 3NMZC 3PNWC 1VQ5Q 2KGTA 1PSEA 4BD3A 4F7UB 5IHKA 1VA7A 2AKKA 2YRCA 4RMOA 1XNIA 4C92A 2EYWA 2D8HA 3RKWA 1GFDA 1M1FA 1NLOC 1WQWA 3TQ7P 3J80E 3INZA 2DLPA 2Y4YA 1PG5B 3VS3A 2L3SA 4PK4A 3CCMT 2LCCA 2QEXQ 2FL7A 4RTZA 2LNHB 4M7DG 2RQWA 1VQMT 4MZMA 2H8HA 1G83A 1JEGA 2A08A 1O9SA 2D1XA 2WSFE 4JS4A 1LCKA 2PNIA 2EJFA 3WVEB 3MP8A 3E2UA 4C92E 4X9CA 2FG0A 2KYBA 2ZAEA 1T0JA 1X75C 2JS0A 3M0TA 1K8AU 4ZGJB 1G3YA 2LTOA 1VQ7Q 1AWOA 4BDZA 4IURA 5GMKm 2M9UA 2CZ7B 2A28A 3LH5A 5HK0A 1QVGA 3ASKA 1ZA2B 4LDYA 2JMCA 3CCET 1I8FA 3PMTA 1Q95G 3G71Q 2HAXA 1UGPB 1M90R 2FO0A 2RI2A 1VQ9Q 3EGDB 2L3RA 3QIIA 3EH2A 2RK1A 2JT4A 2MYSA 1WHJA 2DX1A 2NWMA 2KY9A 2V26A 4NS5A 2H3JA 3UDCA 4CC4B 1ZA1B 2YSQA 1KQSP 2RJEA 5HK3A 3VUBA 3TEEA 1OULA 2XMFA 3FB9A 3VS7A 3TU4K 3JCMQ 2CSIA 1WI7A 3REBB 2DTIA 4C8QG 4LNPA 2COWA 1W2BA 2EFIA 2B8AA 3MO8A 1QQJA 1TXQA 1M5Q1 3H0HA 3S6WA 2KAFA 3C95A 4M75B 4R55A 4M78C 4R0KA 2SRCA 1WQ7A 1ZX6A 3FJ5A 3VV0A 3JCMb 1TOVA 2OTLA 3CCQA 5KYYA 1X43A 5I2SA 4JZ3A 1I0CA 3M0SA 3N5BB 2LT1A 3BY7A 3QBYA 2MMPA 3HHTB 3OYAA 3HRTA 4PJOC 4EDUA 5FU7B 1YIJA 3SFMA 5CIUA 4M7DA 5FWBA 2KRMA 3SD4A 4AFQC 4FCYA 4CC3A 2CKKA 2QI2A 5KYUB 1G8XA 2O9VA 2QTXA 1RI0A 5GAN6 3CXCP 2EYQA 2CDTA 2GBQA 2C06A 2RQTA 1M4ZA 1BIAA 5GMKi 2JMAA 2LVMA 3HFNA 4HCZA 4OB0B 1VQ5A 1U5SA 1YITQ 3OQ5A 2DRMA 1M3CA 5CO7A 2DTHA 1Q7YR 1D3BB 1WXUA 1UJYA 1KK7A 2O2OA 4GY5A 3M4YA 5GAOn 3VS1A 3QJ6A 1OV3A 4M7DE 1Q86C 4O6JA 3EAEA 1M2VA 1W6XA 2HDAA 2V1RA 1QP2A 5LJ3d 5LJ3e 4RTVA 4B6MA 3CCLA 4X34A 1AT1B 2QEXA 4LD6A 5I21A 2EW3A 2OTLT 1C1AA 3CCQT 1TUGB 1WIEA 2RJFA 3UA6A 3G6EQ 2EKOA 5IN1A 5GANh 2MCNA 4E6RA 4B9WA 1IREB 2YUNA 1G3SA 2DIGA 2RM4A 4UC4A 4PJOF 3RERA 1YNZA 2FZKB 4WTOB 3UA7A 3OMGA 2JUFA 2XI9A 4C8QF 3P8HA 4E7IA 4A4KA 1H3HA 2DVJA 4WCIA 2XDPA 3S3MA 2ZPGB 4QVDA 3G4SQ 3NTKA 1YI2A 2PQWA 3MKDA 1QKWA 5GAN5 1V76A 2RB6A 1W70A 2QA4Q 4FYXB 5KE2A 5GANe 3ZFJA 4PJJA 1JQQA 3OYMA 4IUVA 2KT1A 3M9QA 4DBQA 2PUKB 1FX7A 1B3QA 4C0FA 1NEGA 3M0QA 5CAIA 4N0AA 2OX7A 3G71A 1YJ9Q 4EMKA 5HY6A 1Q86U 2FEIA 1FWZA 1JRIA 2LP5A 4PJOE 1ZBXA 1BBZA 1VYTA 1VQ5T 3DLLA 2OAUA 4JRPA 2QGFB 2I2LA 1RABB 3RDVA 2EQUA 2O4XB 2DL7A 1IHWA 4C8QE 3CBPA 3UATA 4PJMA 5GAN3 3RESA 3I56Q 4ME7A 2E70A 3M4GA 1LOJA 4F7UG 1WFWA 1IB8A 1D0YA 3JAME 1JU5C 2MIOA 1JXMA 2EBPA 1IGQA 1VQPQ 3OYBA 3CCLT 1LNXA 4DA4A 2H3EB 1BK2A 2QEXT 3C12A 3V7RA 2EQIA 2J6OA 3GF5A 1PHTA 3QUIA 1LVKA 1RAFB 3RUXA 4M7AC 4CRIA 2DTOA 1PM3A 4MDWA 2LX7A 2DPPB 2ED0A 4HVUA 2P0KA 3M56A 2JTFA 2VUBA 1Y96B 4RUGA 3QDFA 1AZGB 2ZPEB 2VYTA 3J81E 1B34B 1MMGA 4X1VA 1HYOA 2J6KA 2X4JA 1I5OB 2FHDA 5GAN8 1RUWA 1QP3A 1YI2T 3A5ZB 2RI3A 4Z02A 4ZN3A 2EYXA 4KGXB 4FT4A 2E3HA 4LUDA 3H9NA 3SEMA 2B86A 4J6YA 1X69A 2EKHA 2JW4A 4M78B 1JBMA 3U23A 1VQLQ 2M16A 3DLMA 3JCMJ 2BZYA 3G71T 3HTRA 2HQXA 2MF2A 4HA8A 2RQUA 2LQWA 4FIBA 3BW1A 1ZSGA 4PFZA 3X24B 4KULA 2E4HA 1D0ZA 2DD4A 1M8MA 3RKYA 2DM1A 4KUDK 2E3IA 1QMCA 4PJOB 1SF9A 1UDLA 5CVIA 3G7ZA 2L3PA 4M77C 2KNBB 4M7AF 5GAMh 1IZ6A 4IUPA 2JOYA 4BE0A 4ORZA 2A3LA 2FYKA 3F70A 2RHIA 2DL5A 1E6GA 4QT7A 3OS5A 1UB4A 2SEMA 2DZ9A 3CC2A 3LWHA 3QYGB 3E9FA 2BZXA
chains in the Genus database with same CATH topology
1K76A 1PKSA 1IO6A 2EYZA 4J9GA 1X2QA 1BB9A 4D8KA 4AFSC 1SHFA 2EGCA 1ZLMA 4KRTA 1AWXA 4HCKA 3RBBB 1YWOA 3O5ZA 1QLYA 1M3BA 2IIMA 2JM9A 2LQNA 2ESWA 5FWCA 2FPDA 3NMZC 3TVTA 1M3AA 2VVKA 2KGTA 5IHKA 2CT4A 1VA7A 2AKKA 1Z9QA 1MV0B 1A0NB 1BU1A 3QWXX 1U3OA 2EYWA 2D8HA 1GFDA 1NLOC 1X2KA 4J9IA 1YCSB 1K0XA 2LJ3A 4IIOA 2HBWA 1VYVA 2KYMA 3QWYA 2DLPA 2O88A 3VS3A 1CSKA 2RPNA 2L3SA 3EG0A 3R6NA 1M30A 1UE9A 1UGVA 2OJ2A 1X6GA 1HJDA 2JS2A 4RTZA 1UJ0A 2LNHB 1UECA 3ULRB 4F14A 2RQWA 2H8HA 1G83A 1JEGA 2DL8A 2A08A 2W0ZA 1G2BA 2DMOA 2D1XA 2EGAA 1LCKA 2PNIA 1UTIA 2RNAA 1GCQC 2JXBA 1H8KA 2C0OA 3A98A 2KXCA 2FG0A 2KYBA 1T0JA 2YUQA 2JS0A 1PRMC 3M0TA 1KFZA 1N5ZA 1AWOA 4J9BA 2A28A 5GJVB 3LH5A 1RLPC 5HCKA 4J9EA 4AFZC 2BZ8A 3M0PA 2EVRA 4J9DA 4IIMA 2JMCA 1VYUA 1WLPB 2L0AA 2FO0A 1X6BA 3RNJA 2YUPA 1UG1A 2LJ1A 2JT4A 2E5KA 3VS6A 1MUZA 3I9QA 1J3TA 1AD5A 2DX1A 2NWMA 2KROA 2K3BA 2JTEA 1Y57A 2CH4W 1ARKA 4CC4B 5IXFA 2DE0X 2YSQA 1T3LA 5ECAA 1QWFA 1OPLA 2XMFA 3VS7A 1ZUYA 2GTOA 1S1NA 1WI7A 2CSIA 3REBB 2HEQA 2OI3A 4JJCA 4LNPA 4OMNA 4OMLA 3PE0A 1OOTA 1YN8A 2GNCA 4JJDA 4DEYA 2FRYA 2VKNA 1UHCA 3UF4A 3EHQA 2PTKA 5IHIA 1HSQA 3H0HA 3REAB 1W1FA 4R0KA 1H92A 2SRCA 1ZX6A 3FJ5A 2FPFA 1PWTA 5IXBA 4RTWA 2ECZA 4CC2A 4HXJA 3EHRA 1X43A 3EG2A 1PNJA 1Y0MA 2LJ0A 2ROTA 2DRKA 4JZ3A 2F2WA 4CC7A 1I0CA 4OMMA 3M0SA 3GBQA 1NYFA 2ROLA 2KT8A 4K11A 3H41A 2DA9A 2K79A 2GGRA 1KJWA 2FRWA 2L2PA 1V1CA 1JO8A 2O31A 5FWBA 1FYNA 4RTTA 1SRMA 2KRMA 2M0YA 4AFQC 4CC3A 1WA7A 1CKBA 1X27A 4OMQA 2K7AA 2O9VA 3NHNA 2CDTA 2GBQA 3JV3A 2RQTA 2RMOA 1RI9A 2EGEA 2FPEA 2JMAA 4LN2A 1RLQC 2M51A 1FMKA 1T0HA 1WXBA 2DILA 4JJBA 2P4RA 4ESRA 3I5RA 2AZVA 3NGPA 1U5SA 4Y92A 3H0IA 2DRMA 1M3CA 2BTTA 2F2VA 1JXOA 1WXUA 1GFCA 2JM8A 4J9FA 2LCSA 2YUOA 2DF6A 2QDLA 1UJYA 2NUZA 1NM7A 2DNUA 2O2OA 4J9CA 3VRYA 1AEYA 1QKXA 1ABOA 3VS1A 1OV3A 1AWWA 3NPFA 1YP5A 1YWPA 1QWEA 2KEAA 2PZ1A 1W6XA 2HDAA 2V1RA 5IHNA 3KFVA 4RTVA 4JPBW 2K6DA 1K4US 1NYGA 2D8JA 2EW3A 1XOVA 2I0NA 3VS0A 4RTXA 1WIEA 3M0RA 3UA6A 2MCNA 2GQIA 4E6RA 2D0NA 1TUDA 4F17A 2YUNA 1GBRA 1OEBA 2J05A 1YNZA 2HCKA 1ZUKA 1PRLC 3UA7A 1U06A 4Z8AA 1WX6A 3PVQA 4GBQA 1H3HA 2RQRA 2DVJA 2RQVA 4LUEA 4WCIA 3VRZA 3VS5A 3IQLA 1WXTA 2A37A 4DEXA 3I35A 2KBTA 1GCPA 1I1JA 1KIKA 2KR3A 1QKWA 1W70A 5I11A 1GCQA 1JQQA 2KT1A 1TUCA 4M4ZA 3ZL7C 1OPKA 1B3QA 1ABQA 1NEGA 3M0QA 4OMOA 1CKAA 1UHFA 2V1QA 2LMJA 2FEIA 1NLPC 2O9SA 2LP5A 1BBZA 1E6HA 1KSWA 1VYTA 2L3QA 1HD3A 2CREA 1GBQA 1K0SA 1E7OA 2DL7A 2KRNA 1GL5A 3SHWA 3UATA 2DBMA 3THKA 1EFNA 3M0UA 1PKTA 2W10A 3EG3A 4Z89A 1WYXA 4AFUC 1NEBA 2EYYA 4Z88A 1SEMA 3VS2A 2RN8A 1WFWA 2EPDA 1B07A 2AK5A 4OMPA 1JU5C 2MIOA 2OAWA 4GLMA 1SSHA 2EBPA 1JXMA 2VWFA 2RF0A 4RTYA 4ZNXA 1NG2A 1WDXA 1BK2A 2CUBA 2EQIA 2J6OA 1PHTA 5L23A 5EC7A 4JZ4A 2F2XA 2LX7A 2ED0A 4HVUA 1MV3A 3PVLA 4RTUA 1SHGA 2AZSA 2LZ6B 5FW9A 2YT6A 4RUGA 5I22A 1AOJA 2DL4A 1AZGB 1ZUUA 2J7IA 1QCFA 2X3WD 3EGUA 4X1VA 1M27C 2X3XD 2J6KA 2GTJA 1RUWA 2ABLA 2DBKA 2CT3A 2EYXA 2CSQA 2J06A 4AG1C 1ZBJA 4LUDA 3SEMA 2B86A 1X69A 2EKHA 2JW4A 2HSPA 2A36A 3U23A 1AVZC 3TSZA 2BZYA 1SPKA 2C0IA 4HVWA 2RQUA 3EG1A 2LQWA 4A63B 2MOXA 1SRLA 1ZSGA 4AG2C 1UUEA 4F16A 4J9HA 1UFFA 2CH4A 3C0CA 4HVVA 1T3SA 2CUDA 1M8MA 2DM1A 2KRSA 1GRIA 2K9GA 4D8DA 2AKLA 1UDLA 5IH2A 2L3PA 2DYBA 2KNBB 3CQTA 4FSSA 2K2MA 3H0FA 4EIKA 3TSWA 1AWJA 2KXDA 4LE9A 2KE9A 2YDLA 1K9AA 2C0TA 4ORZA 2DL3A 2DL5A 5GJWB 1E6GA 4QT7A 2ENMA 1AZEA 1I07A 2DJQA 2SEMA 1Z9ZA 3VS4A 1TG0A 2J6FA 2ED1A 3I5SA 2G6FX 1K1ZA 2BZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  1PKS A;  1IO6 A;  2EYZ A;  4J9G A;  1X2Q A;  1BB9 A;  4D8K A;  4AFS C;  1SHF A;  2EGC A;  1ZLM A;  4KRT A;  1AWX A;  4HCK A;  3RBB B;  1YWO A;  3O5Z A;  1QLY A;  1M3B A;  2IIM A;  2JM9 A;  2LQN A;  2ESW A;  5FWC A;  2FPD A;  3NMZ C;  3TVT A;  1M3A A;  2VVK A;  2KGT A;  5IHK A;  2CT4 A;  1VA7 A;  2AKK A;  1Z9Q A;  1MV0 B;  1A0N B;  1BU1 A;  3QWX X;  1U3O A;  2EYW A;  2D8H A;  1GFD A;  1NLO C;  1X2K A;  4J9I A;  1YCS B;  1K0X A;  2LJ3 A;  4IIO A;  2HBW A;  1VYV A;  2KYM A;  3QWY A;  2DLP A;  2O88 A;  3VS3 A;  1CSK A;  2RPN A;  2L3S A;  3EG0 A;  3R6N A;  1M30 A;  1UE9 A;  1UGV A;  2OJ2 A;  1X6G A;  1HJD A;  2JS2 A;  4RTZ A;  1UJ0 A;  2LNH B;  1UEC A;  3ULR B;  4F14 A;  2RQW A;  2H8H A;  1G83 A;  1JEG A;  2DL8 A;  2A08 A;  2W0Z A;  1G2B A;  2DMO A;  2D1X A;  2EGA A;  1LCK A;  2PNI A;  1UTI A;  2RNA A;  1GCQ C;  2JXB A;  1H8K A;  2C0O A;  3A98 A;  2KXC A;  2FG0 A;  2KYB A;  1T0J A;  2YUQ A;  2JS0 A;  1PRM C;  3M0T A;  1KFZ A;  1N5Z A;  1AWO A;  4J9B A;  2A28 A;  5GJV B;  3LH5 A;  1RLP C;  5HCK A;  4J9E A;  4AFZ C;  2BZ8 A;  3M0P A;  2EVR A;  4J9D A;  4IIM A;  2JMC A;  1VYU A;  1WLP B;  2L0A A;  2FO0 A;  1X6B A;  3RNJ A;  2YUP A;  1UG1 A;  2LJ1 A;  2JT4 A;  2E5K A;  3VS6 A;  1MUZ A;  3I9Q A;  1J3T A;  1AD5 A;  2DX1 A;  2NWM A;  2KRO A;  2K3B A;  2JTE A;  1Y57 A;  2CH4 W;  1ARK A;  4CC4 B;  5IXF A;  2DE0 X;  2YSQ A;  1T3L A;  5ECA A;  1QWF A;  1OPL A;  2XMF A;  3VS7 A;  1ZUY A;  2GTO A;  1S1N A;  1WI7 A;  2CSI A;  3REB B;  2HEQ A;  2OI3 A;  4JJC A;  4LNP A;  4OMN A;  4OML A;  3PE0 A;  1OOT A;  1YN8 A;  2GNC A;  4JJD A;  4DEY A;  2FRY A;  2VKN A;  1UHC A;  3UF4 A;  3EHQ A;  2PTK A;  5IHI A;  1HSQ A;  3H0H A;  3REA B;  1W1F A;  4R0K A;  1H92 A;  2SRC A;  1ZX6 A;  3FJ5 A;  2FPF A;  1PWT A;  5IXB A;  4RTW A;  2ECZ A;  4CC2 A;  4HXJ A;  3EHR A;  1X43 A;  3EG2 A;  1PNJ A;  1Y0M A;  2LJ0 A;  2ROT A;  2DRK A;  4JZ3 A;  2F2W A;  4CC7 A;  1I0C A;  4OMM A;  3M0S A;  3GBQ A;  1NYF A;  2ROL A;  2KT8 A;  4K11 A;  3H41 A;  2DA9 A;  2K79 A;  2GGR A;  1KJW A;  2FRW A;  2L2P A;  1V1C A;  1JO8 A;  2O31 A;  5FWB A;  1FYN A;  4RTT A;  1SRM A;  2KRM A;  2M0Y A;  4AFQ C;  4CC3 A;  1WA7 A;  1CKB A;  1X27 A;  4OMQ A;  2K7A A;  2O9V A;  3NHN A;  2CDT A;  2GBQ A;  3JV3 A;  2RQT A;  2RMO A;  1RI9 A;  2EGE A;  2FPE A;  2JMA A;  4LN2 A;  1RLQ C;  2M51 A;  1FMK A;  1T0H A;  1WXB A;  2DIL A;  4JJB A;  2P4R A;  4ESR A;  3I5R A;  2AZV A;  3NGP A;  1U5S A;  4Y92 A;  3H0I A;  2DRM A;  1M3C A;  2BTT A;  2F2V A;  1JXO A;  1WXU A;  1GFC A;  2JM8 A;  4J9F A;  2LCS A;  2YUO A;  2DF6 A;  2QDL A;  1UJY A;  2NUZ A;  1NM7 A;  2DNU A;  2O2O A;  4J9C A;  3VRY A;  1AEY A;  1QKX A;  1ABO A;  3VS1 A;  1OV3 A;  1AWW A;  3NPF A;  1YP5 A;  1YWP A;  1QWE A;  2KEA A;  2PZ1 A;  1W6X A;  2HDA A;  2V1R A;  5IHN A;  3KFV A;  4RTV A;  4JPB W;  2K6D A;  1K4U S;  1NYG A;  2D8J A;  2EW3 A;  1XOV A;  2I0N A;  3VS0 A;  4RTX A;  1WIE A;  3M0R A;  3UA6 A;  2MCN A;  2GQI A;  4E6R A;  2D0N A;  1TUD A;  4F17 A;  2YUN A;  1GBR A;  1OEB A;  2J05 A;  1YNZ A;  2HCK A;  1ZUK A;  1PRL C;  3UA7 A;  1U06 A;  4Z8A A;  1WX6 A;  3PVQ A;  4GBQ A;  1H3H A;  2RQR A;  2DVJ A;  2RQV A;  4LUE A;  4WCI A;  3VRZ A;  3VS5 A;  3IQL A;  1WXT A;  2A37 A;  4DEX A;  3I35 A;  2KBT A;  1GCP A;  1I1J A;  1KIK A;  2KR3 A;  1QKW A;  1W70 A;  5I11 A;  1GCQ A;  1JQQ A;  2KT1 A;  1TUC A;  4M4Z A;  3ZL7 C;  1OPK A;  1B3Q A;  1ABQ A;  1NEG A;  3M0Q A;  4OMO A;  1CKA A;  1UHF A;  2V1Q A;  2LMJ A;  2FEI A;  1NLP C;  2O9S A;  2LP5 A;  1BBZ A;  1E6H A;  1KSW A;  1VYT A;  2L3Q A;  1HD3 A;  2CRE A;  1GBQ A;  1K0S A;  1E7O A;  2DL7 A;  2KRN A;  1GL5 A;  3SHW A;  3UAT A;  2DBM A;  3THK A;  1EFN A;  3M0U A;  1PKT A;  2W10 A;  3EG3 A;  4Z89 A;  1WYX A;  4AFU C;  1NEB A;  2EYY A;  4Z88 A;  1SEM A;  3VS2 A;  2RN8 A;  1WFW A;  2EPD A;  1B07 A;  2AK5 A;  4OMP A;  1JU5 C;  2MIO A;  2OAW A;  4GLM A;  1SSH A;  2EBP A;  1JXM A;  2VWF A;  2RF0 A;  4RTY A;  4ZNX A;  1NG2 A;  1WDX A;  1BK2 A;  2CUB A;  2EQI A;  2J6O A;  1PHT A;  5L23 A;  5EC7 A;  4JZ4 A;  2F2X A;  2LX7 A;  2ED0 A;  4HVU A;  1MV3 A;  3PVL A;  4RTU A;  1SHG A;  2AZS A;  2LZ6 B;  5FW9 A;  2YT6 A;  4RUG A;  5I22 A;  1AOJ A;  2DL4 A;  1AZG B;  1ZUU A;  2J7I A;  1QCF A;  2X3W D;  3EGU A;  4X1V A;  1M27 C;  2X3X D;  2J6K A;  2GTJ A;  1RUW A;  2ABL A;  2DBK A;  2CT3 A;  2EYX A;  2CSQ A;  2J06 A;  4AG1 C;  1ZBJ A;  4LUD A;  3SEM A;  2B86 A;  1X69 A;  2EKH A;  2JW4 A;  2HSP A;  2A36 A;  3U23 A;  1AVZ C;  3TSZ A;  2BZY A;  1SPK A;  2C0I A;  4HVW A;  2RQU A;  3EG1 A;  2LQW A;  4A63 B;  2MOX A;  1SRL A;  1ZSG A;  4AG2 C;  1UUE A;  4F16 A;  4J9H A;  1UFF A;  2CH4 A;  3C0C A;  4HVV A;  1T3S A;  2CUD A;  1M8M A;  2DM1 A;  2KRS A;  1GRI A;  2K9G A;  4D8D A;  2AKL A;  1UDL A;  5IH2 A;  2L3P A;  2DYB A;  2KNB B;  3CQT A;  4FSS A;  2K2M A;  3H0F A;  4EIK A;  3TSW A;  1AWJ A;  2KXD A;  4LE9 A;  2KE9 A;  2YDL A;  1K9A A;  2C0T A;  4ORZ A;  2DL3 A;  2DL5 A;  5GJW B;  1E6G A;  4QT7 A;  2ENM A;  1AZE A;  1I07 A;  2DJQ A;  2SEM A;  1Z9Z A;  3VS4 A;  1TG0 A;  2J6F A;  2ED1 A;  3I5S A;  2G6F X;  1K1Z A;  2BZX A; 
#chains in the Genus database with same CATH topology
 3QKJ A;  1KQS S;  3RMQ A;  1IO6 A;  2MAM A;  4M75 G;  4ZGD B;  4E7H A;  4D8K A;  1BI0 A;  2VAS A;  1ZLM A;  2BE7 D;  3JB9 D;  4F7U A;  1M1K R;  3CCJ Q;  2IIM A;  2JM9 A;  3KXT A;  2FPD A;  3MET A;  3TVT A;  5GMK l;  2E6N A;  1D0X A;  1VQ6 A;  4CI0 C;  2XG8 D;  1BU1 A;  1NBE B;  1IHV A;  2QA4 A;  5J39 A;  1YCS B;  3I55 Q;  4MML A;  1K0X A;  1TU0 B;  4J83 A;  5CK9 A;  3QWY A;  2O88 A;  4IUT A;  2X4X A;  1YJ9 A;  1VQN A;  3EG0 A;  4ELZ C;  3CCU A;  3R6N A;  2OJ2 A;  2MWO A;  1X6G A;  4M77 F;  4OB2 B;  2JS2 A;  1UJ0 A;  1UEC A;  1QCN A;  5GAO r;  3JCM V;  3I56 A;  2EQM A;  2ATC B;  3VJP A;  1VQO A;  2ZCF B;  1U1T A;  1UTI A;  1GCQ C;  2EJ9 A;  3URG A;  2C0O A;  3EGX B;  3RR6 A;  2IG0 A;  3CC7 Q;  2R5A A;  2ZPB B;  2YUQ A;  1Y7X A;  1KFZ A;  5GMK h;  5KE3 A;  1N5Z A;  3CC2 T;  1S72 Q;  3H6Z A;  1QW1 A;  3A8H B;  4RCB A;  3MCA B;  2R5M A;  3EGD A;  3WXM B;  4M77 E;  1YJN Q;  1Y71 A;  2QQ9 A;  4AFZ C;  3BDL A;  5GAN f;  4HT9 A;  1SSF A;  5GAN g;  3EG9 B;  1WLP B;  4RG2 A;  3CME Q;  1U1S A;  2HMA A;  2YUP A;  3EFO B;  1UG1 A;  4C92 D;  2O01 E;  1M1G A;  3VS6 A;  2QQR A;  1N8R R;  1MUZ A;  3GOX A;  4D6W A;  3JCM X;  5GMK e;  1VQ6 T;  1MND A;  3LWI A;  2CH4 W;  4XAX B;  1VQ8 Q;  5IXF A;  1WHM A;  2DFU A;  1PC0 A;  2QA4 T;  1T3L A;  2JJ9 A;  3C4S A;  2K2V A;  3GIB A;  1QWF A;  4M7A B;  4M75 A;  3L2V A;  1BCM A;  3H8Z A;  1YJ9 T;  4XU1 A;  1N9R A;  1VQN T;  4OML A;  3PE0 A;  3CCU T;  4RCC A;  4DEY A;  4XTZ A;  2FRY A;  1PSF A;  4A53 A;  4JRQ A;  1EIF A;  1KHI A;  4XU0 A;  4ZTJ A;  3I56 T;  4JRI A;  1PWT A;  5IXB A;  4RTW A;  2DVE A;  3LYI A;  1VQO T;  1ACM B;  3EHR A;  2E1H A;  2YXY A;  2F5K A;  2GFA A;  2X51 A;  2XKO C;  4PJN A;  3QHS A;  1VQP T;  2CS7 A;  4IKF A;  1Y07 A;  4GLK A;  1UGQ B;  2BE9 B;  2K3X A;  2E41 A;  4ZGE B;  1NJI R;  4M75 E;  3H41 A;  1KD1 R;  5KYU A;  1X01 A;  2FRW A;  2L2P A;  1V1C A;  2RHU A;  2M1H A;  1JO8 A;  2O31 A;  1FYN A;  4RTT A;  1D1C A;  1SRM A;  2M0Y A;  5KCH A;  1WA7 A;  1CKB A;  2JVV A;  2K7A A;  2LT4 A;  3NHN A;  1N6A A;  2ZPI B;  3RMS A;  3CCR Q;  1XJW B;  3HRU A;  2CP7 A;  4M77 B;  1D3B A;  2BIV A;  1T0H A;  1BI1 A;  1WXB A;  2DIL A;  3O8V A;  3WVD B;  4JJB A;  4ESR A;  4X9D A;  1D09 B;  2M0O A;  1HK9 A;  2QQA A;  4PNO A;  1IGU A;  1VQL T;  1JXO A;  4J9F A;  2YUO A;  2QDL A;  3MEA A;  4JRK A;  4C5H A;  4J6W A;  3LLR A;  1Q7Y C;  3V7C A;  1AWW A;  4M78 G;  5IHN A;  5LJ5 j;  5CKF A;  9ATC B;  1OZ2 A;  2K6D A;  4LDW A;  4XTY A;  1NYG A;  2LQ8 A;  3HRS A;  4ELY C;  1OYX A;  2GQI A;  2D0N A;  5A0G A;  1OEB A;  2J05 A;  4JDS A;  2Y90 A;  2HCK A;  1W4S A;  1ZUK A;  2XIC A;  2L89 A;  3CCV A;  4Z8A A;  5GAM g;  1D1B A;  4PJO G;  3OYG A;  4M7D D;  3CC7 A;  5KYX B;  4GBQ A;  2RQR A;  3VS5 A;  3IQL A;  4A4G A;  1VQK Q;  1ZHI A;  2F1L A;  2KBT A;  1S72 A;  5FRN A;  1W2B P;  4MZP A;  1WGS A;  1QVF P;  5AT1 B;  4XTW A;  4E7K A;  1YJN A;  1KQS A;  2F5T X;  1TUC A;  2LDM A;  5LJ3 j;  3ZL7 C;  2DJZ A;  4OMO A;  2O4X A;  2DXC A;  3PFS A;  1Q7Y U;  3AHU A;  1NPP A;  4OGC A;  1NLP C;  2O9S A;  5GAO m;  2XID A;  1YCY A;  1E6H A;  1KSW A;  3OSS C;  1GBQ A;  1K0S A;  1SKU B;  4AMC A;  1E7O A;  2YLC A;  1N27 A;  1BI2 A;  3E1S A;  1GL5 A;  1K8A R;  1K9M R;  1D1A A;  3M0U A;  1VQ8 A;  3RIR A;  2W10 A;  4Z89 A;  2DIQ A;  4FSX A;  1IXD A;  4Z88 A;  1SEM A;  3VS2 A;  2RN8 A;  5M9O A;  1MGQ A;  4NL3 A;  1YJW Q;  1B07 A;  3OYD A;  1K73 R;  1SSH A;  2CZ0 B;  3UWN A;  2CUB A;  1Y96 A;  2P0P A;  3PGG A;  2EAY A;  2XDB A;  2YHT A;  1FMV A;  1B34 A;  5KYW A;  4KH0 B;  4C8Q D;  3OA6 A;  2AZS A;  1O75 A;  3A8O B;  2YT6 A;  1XTD A;  1AOJ A;  2J7I A;  3PTA A;  3CCV T;  1EZZ B;  3EGU A;  3CXC A;  3CC7 T;  2E10 A;  2G3R A;  4F04 B;  4M78 A;  4M78 F;  1S72 T;  1R0B G;  1Q82 C;  1OZ3 A;  3OB9 A;  1ZQ1 A;  1ZBJ A;  3AT1 B;  3QDR B;  2XHC A;  4A4E A;  2G6F X;  1YJN T;  1C0M A;  2HQE A;  5KYN A;  2HSP A;  1AVZ C;  3TSZ A;  1YHQ Q;  2D6F A;  3HP9 A;  4BAC A;  4QQ6 A;  2C0I A;  4HVW A;  3FEO A;  3EG1 A;  1SRL A;  4PJO A;  4J9H A;  1VQ8 T;  4HVV A;  1T3S A;  2CUD A;  4C8Q A;  4QVC A;  4M78 E;  1WJS A;  2CP6 A;  2HD0 A;  2HL5 C;  2KRS A;  4D8D A;  2AKL A;  4JS5 A;  5IH2 A;  1VQ7 A;  2K2M A;  2CP3 A;  4EIK A;  3SDZ A;  2HQH A;  1BI3 A;  2KXD A;  4LE9 A;  2YDL A;  2C0T A;  4M7A G;  5GAN d;  4JJN K;  2FZG B;  3OW2 S;  3OYL A;  3S3N A;  2ENM A;  2DJQ A;  5A2Q E;  1RAD B;  5GAO p;  4DBH A;  2DYI A;  2GF7 A;  2J6F A;  1Q82 U;  3M59 A;  1VQ9 A;  1K76 A;  2AT1 B;  2EYZ A;  4JUV A;  1X2Q A;  1BB9 A;  1SHF A;  2EQK A;  4KRT A;  2QGG A;  1R0C B;  4HCK A;  3RBB B;  2DXB A;  3OS1 A;  2PVD B;  2K5F A;  5FWC A;  2MWP A;  2HL3 A;  5C0M A;  1M1K C;  1M3A A;  5D6X A;  4EMG A;  1M9S A;  3CMA Q;  2CT4 A;  1VQK A;  5GAN 4;  2QG9 B;  4JLI A;  1Z9Q A;  4J7I A;  2HBP A;  3JCM c;  3ER0 A;  2HKQ B;  2EWN A;  2JNG A;  2GCX A;  2JZ2 A;  4VUB A;  1OX9 A;  1MMN A;  2LJ3 A;  4IIO A;  4KGV B;  2HBW A;  1VYV A;  3M55 A;  1CSK A;  2VV5 A;  1M30 A;  4DQ2 A;  1UGV A;  1HJD A;  4HKE A;  3OYJ A;  1KC8 R;  5GAO q;  1KQ2 A;  4M77 G;  3EGX A;  4XU3 A;  2DL8 A;  2DD5 A;  4JLG A;  2BKD N;  1VQ7 T;  3L2U A;  1G2B A;  2V8K A;  1QCO A;  3CCM Q;  3NTH A;  1H8K A;  3X26 B;  2Z0W A;  5CKD A;  1MHN A;  2KXC A;  2QXF A;  1PRM C;  3EFS A;  4BI8 B;  1Q86 R;  1N9S A;  2FVU A;  1M1K U;  2CGH A;  3EG9 A;  1VQ9 T;  4J9B A;  5GJV B;  3QXE B;  3PT9 A;  1RLP C;  5HCK A;  3EFO A;  4DBF A;  4EPC A;  4J9E A;  2RJC A;  1JB0 E;  2BZ8 A;  2EVR A;  4J9D A;  4KUI A;  3PIO A;  1VYU A;  1MNE A;  3CD6 Q;  4QVZ A;  1YIT A;  1F1B B;  2P0Q A;  1X6B A;  2F69 A;  5FRM A;  3V8J A;  4M7A A;  3JCM h;  2JTM A;  1J3T A;  1VQK T;  1AD5 A;  2LX9 A;  2K3B A;  2JTE A;  1Y57 A;  3CCE Q;  1ARK A;  2RHX A;  3CC4 Q;  4OB3 B;  3OBW A;  4E2F B;  5ECA A;  3MEU A;  2RI5 A;  2KDS A;  4M77 D;  1ZUY A;  2GTO A;  4Y28 E;  5CQX A;  4JJC A;  2GNC A;  4JJD A;  3G6E A;  1UHC A;  4KT0 E;  5IHI A;  4OP0 A;  1SG5 A;  3JCM e;  3JCM d;  3LGF A;  5GAM e;  5GAM d;  2KMT A;  1JJ2 P;  1W2B S;  1WHL A;  1AHJ B;  2ECZ A;  4M7A E;  4CC2 A;  1QVF S;  1PNJ A;  1WPY A;  3TCJ A;  2YRV A;  1Y0M A;  3G4S A;  2LJ0 A;  4CC7 A;  1B7T A;  2RA2 A;  2VC8 A;  3GBQ A;  2ROL A;  2KT8 A;  4K11 A;  2XK0 A;  2K79 A;  2WAC A;  5A0D A;  1MMD A;  4KH1 B;  1KJW A;  2BUD A;  4FYY B;  1M2O A;  1NJI C;  2X4Y A;  3NTI A;  4FM4 B;  4M77 A;  4ZN1 A;  4FW2 A;  1YIT T;  3FC3 A;  3VKI A;  4N4G A;  2RMO A;  3HKS A;  2EGE A;  2FPE A;  4O5V A;  2A7Y A;  2M02 A;  1RLQ C;  3UT1 A;  1FMK A;  2CYZ B;  2NLU A;  2IPO B;  4M75 D;  2P4R A;  2DEQ A;  3I5R A;  3NGP A;  3CMA A;  2DKG A;  1IRX A;  1VQP A;  3X28 B;  3SWN C;  2X35 A;  1VIE A;  1U8R A;  4OGE A;  4ATO A;  5I2M A;  2JM8 A;  1GFC A;  2LCS A;  1YHQ T;  1ZSZ C;  1EX4 A;  2DNU A;  4J9C A;  5A0L A;  1AEY A;  4EMH A;  1QKX A;  1ABO A;  3NPF A;  4BB7 A;  3G6E T;  1QWE A;  5GAO l;  4MMK A;  3JB9 F;  3OYH A;  2KEA A;  2AIR B;  2RD1 A;  5FLX E;  3VYH B;  1UEB A;  3MJX A;  4C5E A;  1WJQ A;  1RAA B;  7AT1 B;  1M8V A;  1K4U S;  4E7J A;  2D8J A;  1VQ4 Q;  1XOV A;  2I0N A;  3VS0 A;  1NJI U;  4RTX A;  5LL6 S;  3OW2 P;  2RH2 A;  1M90 C;  2ZPH B;  5KH6 A;  4C92 C;  5KYX A;  3G4S T;  2E65 A;  4L5G A;  5DLQ E;  1TUD A;  3LH0 A;  2NUP B;  1WHH A;  1PRL C;  5CR2 A;  5AYF A;  3OY9 A;  4E47 A;  1Q81 R;  3PVQ A;  2OTL Q;  1VQL A;  4LUE A;  5EG2 A;  3CPW P;  2A37 A;  4DEX A;  3I35 A;  2D9T A;  1GCP A;  1I1J A;  1KIK A;  4J7F A;  2GQV A;  5I11 A;  1TTH B;  2E64 A;  1GCQ A;  1YFN A;  3ZEH A;  3JB9 J;  1OPK A;  4KGZ B;  1YIJ Q;  3CD6 A;  3HL8 A;  4OVA A;  3QSU A;  1RAI B;  2L3Q A;  4QW2 A;  4E7S A;  2MI6 A;  3SB2 A;  2YRD A;  3VYG A;  3CMA T;  3PMI A;  2KRN A;  2DBM A;  3THK A;  1EFN A;  1WYX A;  4AFU C;  3CC4 A;  1NEB A;  3OMC A;  1K9M C;  2HSE B;  1M90 U;  1BCO A;  2HNI A;  2EPD A;  4B9X A;  5GAN 2;  5IAY A;  1UGS B;  4R56 A;  3A8M B;  4RTY A;  1NG2 A;  3JB9 I;  4C92 F;  1K73 C;  1RAG B;  3FRN A;  3CEY A;  3V7S A;  5L23 A;  4J8O A;  5EC7 A;  2QAS A;  2F2X A;  2CZ6 B;  1BIB A;  3CCJ A;  4RTU A;  1SHG A;  2L8D A;  4PL6 A;  3DB3 A;  4XTU A;  3CCL Q;  3HFO A;  3L2R A;  1FMW A;  2DL4 A;  1ZUU A;  2LQK A;  2KSS A;  1M27 C;  2X3X D;  2DXU A;  2GTJ A;  2YLB A;  4FYW B;  5CKB A;  3I55 A;  4BI3 A;  4LDX A;  4PFO A;  2DBK A;  4OMF B;  2CT3 A;  4C5I A;  2J06 A;  2QQS A;  4AG1 C;  1QVG P;  2NYS A;  3R6O A;  1PD0 A;  2DK3 A;  4E7Z A;  2DZC A;  2X9H A;  3L42 A;  1PD1 A;  1R77 A;  1K9M U;  4IUQ A;  1SPK A;  4ZTF A;  3CD6 T;  5J26 A;  1YI2 Q;  4PKC C;  4MZT A;  3KBG A;  4A63 B;  3L2W A;  3OYY A;  2V8J A;  2DO3 A;  3MP6 A;  4PLI A;  3GPL A;  4F16 A;  3JCM f;  1OX8 A;  1K73 U;  1UFF A;  2CH4 A;  5GAM f;  3JCM g;  3CC4 T;  2V8I A;  3BDU A;  4BUG A;  5HKC A;  4A4F A;  1GRI A;  4M7D C;  1R8O B;  1TSF A;  4L59 A;  4FSS A;  4DOV A;  4IUU A;  1OI1 A;  3G1J A;  2KE9 A;  2CP5 A;  1VIF A;  1K9A A;  1FXX A;  1WHK A;  4A4H A;  2E6Z A;  1Z9Z A;  3VS4 A;  1TG0 A;  2K3Y A;  2LC4 A;  2EJG A;  3CCJ T;  1XQH A;  3CME A;  1K1Z A;  2NUT B;  1DJ7 B;  1VQ4 A;  2XD0 A;  4XTV A;  2QAZ A;  1VOM A;  5CCA A;  2DXT A;  4J9G A;  5CKE A;  4M78 D;  1QVF A;  3LX7 A;  2PUO B;  3CCS Q;  3X25 B;  3SWN B;  2OTJ Q;  1AWX A;  1LJO A;  2A0F B;  2KQW A;  4FL6 A;  5LJ5 h;  3V8K A;  1ZSZ B;  2LQN A;  4V2S A;  2RJD A;  3I55 T;  2ESW A;  4BE2 A;  2VVK A;  1JJ2 S;  2WSE E;  1UGR B;  1MV0 B;  1A0N B;  3QWX X;  1U3O A;  4BY6 C;  5GAN 7;  1X2K A;  2GFU A;  4J9I A;  4PJO D;  5GAN j;  2DET A;  3BFM A;  8ATC B;  2RO0 A;  2HZY A;  4KBM B;  2KYM A;  3JCM W;  4C92 B;  2DEU A;  2RPN A;  5LJ5 e;  5LJ5 d;  2EIF A;  2P84 A;  4XTX A;  4M7D F;  4C8Q C;  2XDD A;  1UE9 A;  3V8L A;  3VUZ A;  2QQB A;  4C0D C;  3ULR B;  4F14 A;  2PVG B;  3GLX A;  1RAC B;  3HPW A;  2W0Z A;  5J3B A;  3FDR A;  2DMO A;  4A54 A;  3EFR A;  1KC8 C;  1G3T A;  2EGA A;  5LJ3 h;  3FJP A;  4XU2 A;  2RNA A;  2JXB A;  3LW5 E;  8AT1 B;  1OU8 A;  3A98 A;  3QPH A;  4N0A C;  3JRZ A;  2ZGW A;  4EMK C;  1WNL A;  3OS2 A;  3MEW A;  1RAE B;  5IT9 E;  3DB4 A;  4II1 A;  3CME T;  3MPU B;  1VQ4 T;  3CCR A;  3M5A A;  2VXE A;  2MPX C;  3OYE A;  3M0P A;  4PJL A;  3J7A F;  4IIM A;  1X6O A;  1H64 1;  3CBM A;  4N4I A;  2R58 A;  2L0A A;  3CC2 Q;  1TS9 A;  2PU9 B;  3RNJ A;  4BDY A;  2LJ1 A;  2E5K A;  2DER A;  1C6V X;  3OYK A;  3I9Q A;  2KRO A;  2DE0 X;  5D7U A;  2QK0 A;  1OPL A;  1MMA A;  4XK8 E;  1KC8 U;  4OF1 A;  1S1N A;  3CBO A;  3UPU A;  3BE3 A;  1YIJ T;  2HEQ A;  2OI3 A;  2RHZ A;  1VQ6 Q;  4OMN A;  2Y4X A;  3QZ5 B;  1V29 B;  1OOT A;  1YN8 A;  2VKN A;  3UF4 A;  3EHQ A;  2PTK A;  3REA B;  1HSQ A;  4TVR A;  3CPW S;  1W1F A;  4FYV B;  1H92 A;  4LD9 K;  4ANJ A;  1BKB A;  2FZC B;  2FPF A;  5FRO A;  2P4T A;  1VQN Q;  3CCU Q;  4MDX A;  4HXJ A;  4DOW A;  3JCM P;  5FU6 C;  2L5Q A;  3EG2 A;  5CKH A;  2ROT A;  2DRK A;  2F2W A;  1I5L A;  4WF2 A;  2RK2 A;  4OMM A;  1NYF A;  1PCX A;  3EH1 A;  2VB6 A;  5KYY B;  2DA9 A;  1VQO Q;  2GGR A;  2QTV A;  3PIP A;  3CCR T;  4FU6 A;  1NPR A;  3OYN A;  2ZPF B;  6AT1 B;  3M58 A;  4YTL A;  3RKX A;  4M7A D;  1X27 A;  4LDV A;  4OMQ A;  4Q5W A;  3X20 B;  3T9N A;  3TRE A;  5C6S A;  2HKN A;  3CCS A;  3JV3 A;  5GAM j;  4M7D B;  2OTJ A;  2K5L A;  1RI9 A;  2PVO B;  4LN2 A;  2M51 A;  1YJW A;  2RHY A;  4DBR A;  3S3O A;  2AZV A;  3ME9 A;  4PLL A;  1QVP A;  3H0I A;  4Y92 A;  1VQM Q;  1TH7 A;  2BTT A;  2K57 A;  3P8D A;  5KYW B;  2F2V A;  3A1P A;  1Q82 R;  1WJR A;  1BYM A;  2DF6 A;  2NUZ A;  2DAQ A;  1NM7 A;  3VRY A;  1G3W A;  2XU8 A;  1YP5 A;  1YWP A;  2VGN A;  3GNF B;  4PFP A;  2PZ1 A;  1WHG A;  2LCL A;  3M57 A;  4C0G A;  1LPL A;  3KFV A;  3JB9 G;  4JPB W;  4Y91 A;  3D7S B;  4N4H A;  1OU9 A;  4BE1 A;  3QJY A;  2NUP A;  1HXD A;  1QVG S;  2WSC E;  1TWB A;  1M2V B;  3M0R A;  2AHJ B;  3E19 A;  2KVQ G;  5D6W A;  2QDY B;  4BI4 A;  3KUF A;  4F17 A;  1GBR A;  5DM7 R;  4L6V 5;  4QQD A;  1N8R C;  4C5G A;  5CQY A;  2K5I A;  4BY6 B;  1U06 A;  4RKU E;  2ZZD A;  1WX6 A;  5DLO A;  3DKM A;  2RQV A;  3VRZ A;  1YHQ A;  3Q1J A;  1WXT A;  1Q81 C;  3JSC A;  2CZ1 B;  2KR3 A;  4HCB A;  4C8Q B;  4C0D B;  4HCC A;  3E9G A;  2K4Y A;  3C94 A;  2JN0 A;  3CCS T;  4M4Z A;  1P92 A;  2CP2 A;  2OTJ T;  1ABQ A;  1CKA A;  1UHF A;  2V1Q A;  2LMJ A;  1NZ9 A;  1H3Z A;  1RAH B;  3A8G B;  3OSV A;  4LXC A;  1VUB A;  5LJ5 f;  3L1A A;  2COY A;  2E5Q A;  1YJW T;  3NFC A;  5LJ5 g;  1HD3 A;  2CRE A;  3GP8 A;  5GMK j;  1I81 A;  4RG8 A;  3SHW A;  4EMK B;  4FW1 A;  1PKT A;  4F7U F;  3EG3 A;  1JJ2 A;  3OYI A;  2EYY A;  3LGL A;  2X4W A;  2AK5 A;  3QG1 A;  4OMP A;  2OAW A;  4GLM A;  1RL2 A;  1N8R U;  1KD1 C;  2YWW A;  3OYF A;  2VWF A;  2RF0 A;  1KQ1 A;  4ZNX A;  1KG1 A;  1WDX A;  3MEV A;  4AT1 B;  2IVW A;  4JZ4 A;  1GXI E;  4C92 G;  1Q81 U;  3OBY A;  1MV3 A;  3PVL A;  3L2Z A;  3JB9 H;  2LZ6 B;  1YBY A;  5FW9 A;  5LJ3 f;  5I22 A;  3VU3 C;  4F7U E;  5LJ3 g;  1QCF A;  2X3W D;  4M75 C;  4LDU A;  1I4K 1;  3HSB A;  3OS0 A;  2ABL A;  4NL2 A;  3CXC S;  4J6X A;  2CSQ A;  2LNV A;  3CCV Q;  4P5N A;  4FT2 A;  2KK4 A;  2A36 A;  1KHC A;  2COZ A;  3ZBD A;  1WZO A;  3MP1 A;  4J5Y A;  4E7L A;  2KI7 A;  2FB7 A;  5FU7 C;  3CPF A;  5FU6 B;  1KD1 U;  2MOX A;  1NE8 A;  3FLG A;  4AG2 C;  1UUE A;  4XQ3 A;  3CCM A;  4QKU A;  3M54 A;  5L8R E;  5KCO A;  3C0C A;  2E12 A;  2R57 A;  3L2Q A;  3CCQ Q;  1VQM A;  2K9G A;  3QO3 A;  2D0Q B;  5D6Y A;  4HT8 A;  3OW2 A;  2DYB A;  3CQT A;  3H0F A;  2EQJ A;  3TSW A;  1AWJ A;  2VGM A;  3GNG A;  1OQK A;  2QYZ A;  2NUT A;  5DY9 A;  2DL3 A;  5GJW B;  1AZE A;  1I07 A;  4OB1 B;  4C0Z A;  3CPW A;  2MK5 A;  2ED1 A;  3I5S A;  3SWN A;  4M75 F;  2LRQ A;  1PKS A;  1ZSZ A;  4NOY A;  4AFS C;  2EGC A;  3OYC A;  3A8L B;  3CCE A;  3QYH B;  3FIF A;  3P8B B;  1YWO A;  3O5Z A;  1QLY A;  1M3B A;  1K8A C;  2CP0 A;  3M53 A;  4QQG A;  2VXF A;  3MHX A;  3QZ9 B;  1G5V A;  3NMZ C;  3PNW C;  1VQ5 Q;  2KGT A;  1PSE A;  4BD3 A;  4F7U B;  5IHK A;  1VA7 A;  2AKK A;  2YRC A;  4RMO A;  1XNI A;  4C92 A;  2EYW A;  2D8H A;  3RKW A;  1GFD A;  1M1F A;  1NLO C;  1WQW A;  3TQ7 P;  3J80 E;  3INZ A;  2DLP A;  2Y4Y A;  1PG5 B;  3VS3 A;  2L3S A;  4PK4 A;  3CCM T;  2LCC A;  2QEX Q;  2FL7 A;  4RTZ A;  2LNH B;  4M7D G;  2RQW A;  1VQM T;  4MZM A;  2H8H A;  1G83 A;  1JEG A;  2A08 A;  1O9S A;  2D1X A;  2WSF E;  4JS4 A;  1LCK A;  2PNI A;  2EJF A;  3WVE B;  3MP8 A;  3E2U A;  4C92 E;  4X9C A;  2FG0 A;  2KYB A;  2ZAE A;  1T0J A;  1X75 C;  2JS0 A;  3M0T A;  1K8A U;  4ZGJ B;  1G3Y A;  2LTO A;  1VQ7 Q;  1AWO A;  4BDZ A;  4IUR A;  5GMK m;  2M9U A;  2CZ7 B;  2A28 A;  3LH5 A;  5HK0 A;  1QVG A;  3ASK A;  1ZA2 B;  4LDY A;  2JMC A;  3CCE T;  1I8F A;  3PMT A;  1Q95 G;  3G71 Q;  2HAX A;  1UGP B;  1M90 R;  2FO0 A;  2RI2 A;  1VQ9 Q;  3EGD B;  2L3R A;  3QII A;  3EH2 A;  2RK1 A;  2JT4 A;  2MYS A;  1WHJ A;  2DX1 A;  2NWM A;  2KY9 A;  2V26 A;  4NS5 A;  2H3J A;  3UDC A;  4CC4 B;  1ZA1 B;  2YSQ A;  1KQS P;  2RJE A;  5HK3 A;  3VUB A;  3TEE A;  1OUL A;  2XMF A;  3FB9 A;  3VS7 A;  3TU4 K;  3JCM Q;  2CSI A;  1WI7 A;  3REB B;  2DTI A;  4C8Q G;  4LNP A;  2COW A;  1W2B A;  2EFI A;  2B8A A;  3MO8 A;  1QQJ A;  1TXQ A;  1M5Q 1;  3H0H A;  3S6W A;  2KAF A;  3C95 A;  4M75 B;  4R55 A;  4M78 C;  4R0K A;  2SRC A;  1WQ7 A;  1ZX6 A;  3FJ5 A;  3VV0 A;  3JCM b;  1TOV A;  2OTL A;  3CCQ A;  5KYY A;  1X43 A;  5I2S A;  4JZ3 A;  1I0C A;  3M0S A;  3N5B B;  2LT1 A;  3BY7 A;  3QBY A;  2MMP A;  3HHT B;  3OYA A;  3HRT A;  4PJO C;  4EDU A;  5FU7 B;  1YIJ A;  3SFM A;  5CIU A;  4M7D A;  5FWB A;  2KRM A;  3SD4 A;  4AFQ C;  4FCY A;  4CC3 A;  2CKK A;  2QI2 A;  5KYU B;  1G8X A;  2O9V A;  2QTX A;  1RI0 A;  5GAN 6;  3CXC P;  2EYQ A;  2CDT A;  2GBQ A;  2C06 A;  2RQT A;  1M4Z A;  1BIA A;  5GMK i;  2JMA A;  2LVM A;  3HFN A;  4HCZ A;  4OB0 B;  1VQ5 A;  1U5S A;  1YIT Q;  3OQ5 A;  2DRM A;  1M3C A;  5CO7 A;  2DTH A;  1Q7Y R;  1D3B B;  1WXU A;  1UJY A;  1KK7 A;  2O2O A;  4GY5 A;  3M4Y A;  5GAO n;  3VS1 A;  3QJ6 A;  1OV3 A;  4M7D E;  1Q86 C;  4O6J A;  3EAE A;  1M2V A;  1W6X A;  2HDA A;  2V1R A;  1QP2 A;  5LJ3 d;  5LJ3 e;  4RTV A;  4B6M A;  3CCL A;  4X34 A;  1AT1 B;  2QEX A;  4LD6 A;  5I21 A;  2EW3 A;  2OTL T;  1C1A A;  3CCQ T;  1TUG B;  1WIE A;  2RJF A;  3UA6 A;  3G6E Q;  2EKO A;  5IN1 A;  5GAN h;  2MCN A;  4E6R A;  4B9W A;  1IRE B;  2YUN A;  1G3S A;  2DIG A;  2RM4 A;  4UC4 A;  4PJO F;  3RER A;  1YNZ A;  2FZK B;  4WTO B;  3UA7 A;  3OMG A;  2JUF A;  2XI9 A;  4C8Q F;  3P8H A;  4E7I A;  4A4K A;  1H3H A;  2DVJ A;  4WCI A;  2XDP A;  3S3M A;  2ZPG B;  4QVD A;  3G4S Q;  3NTK A;  1YI2 A;  2PQW A;  3MKD A;  1QKW A;  5GAN 5;  1V76 A;  2RB6 A;  1W70 A;  2QA4 Q;  4FYX B;  5KE2 A;  5GAN e;  3ZFJ A;  4PJJ A;  1JQQ A;  3OYM A;  4IUV A;  2KT1 A;  3M9Q A;  4DBQ A;  2PUK B;  1FX7 A;  1B3Q A;  4C0F A;  1NEG A;  3M0Q A;  5CAI A;  4N0A A;  2OX7 A;  3G71 A;  1YJ9 Q;  4EMK A;  5HY6 A;  1Q86 U;  2FEI A;  1FWZ A;  1JRI A;  2LP5 A;  4PJO E;  1ZBX A;  1BBZ A;  1VYT A;  1VQ5 T;  3DLL A;  2OAU A;  4JRP A;  2QGF B;  2I2L A;  1RAB B;  3RDV A;  2EQU A;  2O4X B;  2DL7 A;  1IHW A;  4C8Q E;  3CBP A;  3UAT A;  4PJM A;  5GAN 3;  3RES A;  3I56 Q;  4ME7 A;  2E70 A;  3M4G A;  1LOJ A;  4F7U G;  1WFW A;  1IB8 A;  1D0Y A;  3JAM E;  1JU5 C;  2MIO A;  1JXM A;  2EBP A;  1IGQ A;  1VQP Q;  3OYB A;  3CCL T;  1LNX A;  4DA4 A;  2H3E B;  1BK2 A;  2QEX T;  3C12 A;  3V7R A;  2EQI A;  2J6O A;  3GF5 A;  1PHT A;  3QUI A;  1LVK A;  1RAF B;  3RUX A;  4M7A C;  4CRI A;  2DTO A;  1PM3 A;  4MDW A;  2LX7 A;  2DPP B;  2ED0 A;  4HVU A;  2P0K A;  3M56 A;  2JTF A;  2VUB A;  1Y96 B;  4RUG A;  3QDF A;  1AZG B;  2ZPE B;  2VYT A;  3J81 E;  1B34 B;  1MMG A;  4X1V A;  1HYO A;  2J6K A;  2X4J A;  1I5O B;  2FHD A;  5GAN 8;  1RUW A;  1QP3 A;  1YI2 T;  3A5Z B;  2RI3 A;  4Z02 A;  4ZN3 A;  2EYX A;  4KGX B;  4FT4 A;  2E3H A;  4LUD A;  3H9N A;  3SEM A;  2B86 A;  4J6Y A;  1X69 A;  2EKH A;  2JW4 A;  4M78 B;  1JBM A;  3U23 A;  1VQL Q;  2M16 A;  3DLM A;  3JCM J;  2BZY A;  3G71 T;  3HTR A;  2HQX A;  2MF2 A;  4HA8 A;  2RQU A;  2LQW A;  4FIB A;  3BW1 A;  1ZSG A;  4PFZ A;  3X24 B;  4KUL A;  2E4H A;  1D0Z A;  2DD4 A;  1M8M A;  3RKY A;  2DM1 A;  4KUD K;  2E3I A;  1QMC A;  4PJO B;  1SF9 A;  1UDL A;  5CVI A;  3G7Z A;  2L3P A;  4M77 C;  2KNB B;  4M7A F;  5GAM h;  1IZ6 A;  4IUP A;  2JOY A;  4BE0 A;  4ORZ A;  2A3L A;  2FYK A;  3F70 A;  2RHI A;  2DL5 A;  1E6G A;  4QT7 A;  3OS5 A;  1UB4 A;  2SEM A;  2DZ9 A;  3CC2 A;  3LWH A;  3QYG B;  3E9F A;  2BZX A; 
#chains in the Genus database with same CATH homology
 1K76 A;  1PKS A;  1IO6 A;  2EYZ A;  4J9G A;  1X2Q A;  1BB9 A;  4D8K A;  4AFS C;  1SHF A;  2EGC A;  1ZLM A;  4KRT A;  1AWX A;  4HCK A;  3RBB B;  1YWO A;  3O5Z A;  1QLY A;  1M3B A;  2IIM A;  2JM9 A;  2LQN A;  2ESW A;  5FWC A;  2FPD A;  3NMZ C;  3TVT A;  1M3A A;  2VVK A;  2KGT A;  5IHK A;  2CT4 A;  1VA7 A;  2AKK A;  1Z9Q A;  1MV0 B;  1A0N B;  1BU1 A;  3QWX X;  1U3O A;  2EYW A;  2D8H A;  1GFD A;  1NLO C;  1X2K A;  4J9I A;  1YCS B;  1K0X A;  2LJ3 A;  4IIO A;  2HBW A;  1VYV A;  2KYM A;  3QWY A;  2DLP A;  2O88 A;  3VS3 A;  1CSK A;  2RPN A;  2L3S A;  3EG0 A;  3R6N A;  1M30 A;  1UE9 A;  1UGV A;  2OJ2 A;  1X6G A;  1HJD A;  2JS2 A;  4RTZ A;  1UJ0 A;  2LNH B;  1UEC A;  3ULR B;  4F14 A;  2RQW A;  2H8H A;  1G83 A;  1JEG A;  2DL8 A;  2A08 A;  2W0Z A;  1G2B A;  2DMO A;  2D1X A;  2EGA A;  1LCK A;  2PNI A;  1UTI A;  2RNA A;  1GCQ C;  2JXB A;  1H8K A;  2C0O A;  3A98 A;  2KXC A;  2FG0 A;  2KYB A;  1T0J A;  2YUQ A;  2JS0 A;  1PRM C;  3M0T A;  1KFZ A;  1N5Z A;  1AWO A;  4J9B A;  2A28 A;  5GJV B;  3LH5 A;  1RLP C;  5HCK A;  4J9E A;  4AFZ C;  2BZ8 A;  3M0P A;  2EVR A;  4J9D A;  4IIM A;  2JMC A;  1VYU A;  1WLP B;  2L0A A;  2FO0 A;  1X6B A;  3RNJ A;  2YUP A;  1UG1 A;  2LJ1 A;  2JT4 A;  2E5K A;  3VS6 A;  1MUZ A;  3I9Q A;  1J3T A;  1AD5 A;  2DX1 A;  2NWM A;  2KRO A;  2K3B A;  2JTE A;  1Y57 A;  2CH4 W;  1ARK A;  4CC4 B;  5IXF A;  2DE0 X;  2YSQ A;  1T3L A;  5ECA A;  1QWF A;  1OPL A;  2XMF A;  3VS7 A;  1ZUY A;  2GTO A;  1S1N A;  1WI7 A;  2CSI A;  3REB B;  2HEQ A;  2OI3 A;  4JJC A;  4LNP A;  4OMN A;  4OML A;  3PE0 A;  1OOT A;  1YN8 A;  2GNC A;  4JJD A;  4DEY A;  2FRY A;  2VKN A;  1UHC A;  3UF4 A;  3EHQ A;  2PTK A;  5IHI A;  1HSQ A;  3H0H A;  3REA B;  1W1F A;  4R0K A;  1H92 A;  2SRC A;  1ZX6 A;  3FJ5 A;  2FPF A;  1PWT A;  5IXB A;  4RTW A;  2ECZ A;  4CC2 A;  4HXJ A;  3EHR A;  1X43 A;  3EG2 A;  1PNJ A;  1Y0M A;  2LJ0 A;  2ROT A;  2DRK A;  4JZ3 A;  2F2W A;  4CC7 A;  1I0C A;  4OMM A;  3M0S A;  3GBQ A;  1NYF A;  2ROL A;  2KT8 A;  4K11 A;  3H41 A;  2DA9 A;  2K79 A;  2GGR A;  1KJW A;  2FRW A;  2L2P A;  1V1C A;  1JO8 A;  2O31 A;  5FWB A;  1FYN A;  4RTT A;  1SRM A;  2KRM A;  2M0Y A;  4AFQ C;  4CC3 A;  1WA7 A;  1CKB A;  1X27 A;  4OMQ A;  2K7A A;  2O9V A;  3NHN A;  2CDT A;  2GBQ A;  3JV3 A;  2RQT A;  2RMO A;  1RI9 A;  2EGE A;  2FPE A;  2JMA A;  4LN2 A;  1RLQ C;  2M51 A;  1FMK A;  1T0H A;  1WXB A;  2DIL A;  4JJB A;  2P4R A;  4ESR A;  3I5R A;  2AZV A;  3NGP A;  1U5S A;  4Y92 A;  3H0I A;  2DRM A;  1M3C A;  2BTT A;  2F2V A;  1JXO A;  1WXU A;  1GFC A;  2JM8 A;  4J9F A;  2LCS A;  2YUO A;  2DF6 A;  2QDL A;  1UJY A;  2NUZ A;  1NM7 A;  2DNU A;  2O2O A;  4J9C A;  3VRY A;  1AEY A;  1QKX A;  1ABO A;  3VS1 A;  1OV3 A;  1AWW A;  3NPF A;  1YP5 A;  1YWP A;  1QWE A;  2KEA A;  2PZ1 A;  1W6X A;  2HDA A;  2V1R A;  5IHN A;  3KFV A;  4RTV A;  4JPB W;  2K6D A;  1K4U S;  1NYG A;  2D8J A;  2EW3 A;  1XOV A;  2I0N A;  3VS0 A;  4RTX A;  1WIE A;  3M0R A;  3UA6 A;  2MCN A;  2GQI A;  4E6R A;  2D0N A;  1TUD A;  4F17 A;  2YUN A;  1GBR A;  1OEB A;  2J05 A;  1YNZ A;  2HCK A;  1ZUK A;  1PRL C;  3UA7 A;  1U06 A;  4Z8A A;  1WX6 A;  3PVQ A;  4GBQ A;  1H3H A;  2RQR A;  2DVJ A;  2RQV A;  4LUE A;  4WCI A;  3VRZ A;  3VS5 A;  3IQL A;  1WXT A;  2A37 A;  4DEX A;  3I35 A;  2KBT A;  1GCP A;  1I1J A;  1KIK A;  2KR3 A;  1QKW A;  1W70 A;  5I11 A;  1GCQ A;  1JQQ A;  2KT1 A;  1TUC A;  4M4Z A;  3ZL7 C;  1OPK A;  1B3Q A;  1ABQ A;  1NEG A;  3M0Q A;  4OMO A;  1CKA A;  1UHF A;  2V1Q A;  2LMJ A;  2FEI A;  1NLP C;  2O9S A;  2LP5 A;  1BBZ A;  1E6H A;  1KSW A;  1VYT A;  2L3Q A;  1HD3 A;  2CRE A;  1GBQ A;  1K0S A;  1E7O A;  2DL7 A;  2KRN A;  1GL5 A;  3SHW A;  3UAT A;  2DBM A;  3THK A;  1EFN A;  3M0U A;  1PKT A;  2W10 A;  3EG3 A;  4Z89 A;  1WYX A;  4AFU C;  1NEB A;  2EYY A;  4Z88 A;  1SEM A;  3VS2 A;  2RN8 A;  1WFW A;  2EPD A;  1B07 A;  2AK5 A;  4OMP A;  1JU5 C;  2MIO A;  2OAW A;  4GLM A;  1SSH A;  2EBP A;  1JXM A;  2VWF A;  2RF0 A;  4RTY A;  4ZNX A;  1NG2 A;  1WDX A;  1BK2 A;  2CUB A;  2EQI A;  2J6O A;  1PHT A;  5L23 A;  5EC7 A;  4JZ4 A;  2F2X A;  2LX7 A;  2ED0 A;  4HVU A;  1MV3 A;  3PVL A;  4RTU A;  1SHG A;  2AZS A;  2LZ6 B;  5FW9 A;  2YT6 A;  4RUG A;  5I22 A;  1AOJ A;  2DL4 A;  1AZG B;  1ZUU A;  2J7I A;  1QCF A;  2X3W D;  3EGU A;  4X1V A;  1M27 C;  2X3X D;  2J6K A;  2GTJ A;  1RUW A;  2ABL A;  2DBK A;  2CT3 A;  2EYX A;  2CSQ A;  2J06 A;  4AG1 C;  1ZBJ A;  4LUD A;  3SEM A;  2B86 A;  1X69 A;  2EKH A;  2JW4 A;  2HSP A;  2A36 A;  3U23 A;  1AVZ C;  3TSZ A;  2BZY A;  1SPK A;  2C0I A;  4HVW A;  2RQU A;  3EG1 A;  2LQW A;  4A63 B;  2MOX A;  1SRL A;  1ZSG A;  4AG2 C;  1UUE A;  4F16 A;  4J9H A;  1UFF A;  2CH4 A;  3C0C A;  4HVV A;  1T3S A;  2CUD A;  1M8M A;  2DM1 A;  2KRS A;  1GRI A;  2K9G A;  4D8D A;  2AKL A;  1UDL A;  5IH2 A;  2L3P A;  2DYB A;  2KNB B;  3CQT A;  4FSS A;  2K2M A;  3H0F A;  4EIK A;  3TSW A;  1AWJ A;  2KXD A;  4LE9 A;  2KE9 A;  2YDL A;  1K9A A;  2C0T A;  4ORZ A;  2DL3 A;  2DL5 A;  5GJW B;  1E6G A;  4QT7 A;  2ENM A;  1AZE A;  1I07 A;  2DJQ A;  2SEM A;  1Z9Z A;  3VS4 A;  1TG0 A;  2J6F A;  2ED1 A;  3I5S A;  2G6F X;  1K1Z A;  2BZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...