2KAFA

Solution structure of the sars-unique domain-c from the nonstructural protein 3 (nsp3) of the severe acute respiratory syndrome coronavirus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, rna binding protein
molecule keywords Non-structural protein 3
publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
total genus 12
structure length 67
sequence length 67
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.590 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kafA00
2KAFA 2KQWA
chains in the Genus database with same CATH superfamily
1ZSZB 4YTLA 2AZSA 2WSFE 2MI6A 1SSHA 2DTHA 1NEBA 2O01E 4OB0B 1BB9A 2JJ9A 3REBB 1QVPA 3V7SA 2O4XA 2E3IA 4RTWA 3CCLQ 2K2MA 4EMKC 1KQSP 1YHQA 3QYGB 3CCST 3MEAA 1H3HA 3QKJA 2DVEA 1VQ9Q 5LJ3h 3G7ZA 4HVUA 4FCYA 2OTLT 1K9MU 4QQ6A 1NM7A 2F2WA 4A54A 2EJFA 2CREA 2DXBA 5DY9A 4FSXA 1VQPQ 3S3MA 2QQAA 2RHZA 4F7UE 3INZA 2DETA 2NWMA 1AHJB 2KYMA 3SD4A 4AG1C 2EPDA 4AFUC 4J9DA 5CCAA 4BUGA 1OEBA 1D09B 4EMKB 3NHNA 2QEXQ 3I5SA 4OMPA 3CC4A 1XNIA 2HKQB 3H6ZA 3QO3A 1K73C 3I56T 1SRMA 3L42A 3I55T 5FWBA 2MOXA 2DL3A 9ATCB 2DMOA 2M0OA 1GFDA 2QTXA 2KY9A 1JQQA 2DYIA 2GCXA 4OP0A 1HJDA 3OSSC 3M54A 3EGXA 3THKA 1VQOQ 1K76A 2L5QA 1ACMB 2HDAA 2XMFA 1KC8R 1MMNA 2XKOC 1YP5A 5KYWB 1NLOC 2E41A 2C0OA 5CKBA 3OYIA 2CP6A 2K3XA 3M59A 5IT9E 3HKSA 2K9GA 1AWXA 2KR3A 2DILA 2OTJA 2J06A 3M0UA 1AZEA 1ZSGA 4LDXA 4IIOA 2AZVA 4AFQC 2GQIA 3CCET 5D6WA 3H0HA 2KI7A 2FPEA 1I81A 1I5OB 1BI2A 3JV3A 3SFMA 1NLPC 4GY5A 3KFVA 1VQNA 2H8HA 4PNOA 1CKAA 3H8ZA 3UT1A 1NBEB 2COZA 3C95A 1UDLA 3NPFA 3QWYA 4QKUA 3JCMg 2XK0A 4M77D 4RTTA 1YHQQ 2KT1A 3GOXA 2HQXA 3X20B 3KUFA 2VGNA 4FYWB 5CAIA 4ATOA 3IQLA 2KEAA 2RO0A 3I35A 2DRMA 4LUDA 4Z88A 4IUQA 1M5Q1 2C0IA 3EG9B 2QA4A 3OBYA 2RJDA 1XOVA 2QGFB 1I8FA 2MK5A 2DERA 1Q7YC 3S3NA 2C0TA 2RPNA 3VS1A 1OPKA 1M3AA 4FT4A 3CC4Q 1N8RR 4OF1A 1R0BG 1PSFA 4PJLA 2A3LA 3JB9G 3JB9F 5CQYA 2KRMA 2BIVA 4FW1A 3OYNA 1TS9A 3TQ7P 2EWNA 3CCSA 2QK0A 3OQ5A 4JRQA 4JRKA 5KE2A 1AD5A 2PUOB 5I2MA 3GF5A 3FC3A 1IRXA 4MZPA 1M27C 2E10A 2OTLA 1A0NB 2HCKA 2O31A 3LH5A 1YNZA 2YUNA 1ZHIA 1JBMA 3P8HA 2HAXA 1W70A 3DB4A 4C92G 4C92F 2JTMA 2OTJQ 1M1FA 2RM4A 1K9MR 4IURA 1AWJA 2HEQA 1VQNQ 1QP2A 4J9EA 2OI3A 1M1KR 5CKDA 5L8RE 1LPLA 3RMSA 1WYXA 2LJ3A 3PIPA 3I56A 3EFSA 4HVVA 3I55A 1MMGA 4BY6C 1EX4A 4XTYA 1SEMA 3HL8A 4OB3B 3E9GA 3NTKA 4P5NA 1OPLA 3FB9A 1YFNA 4OMFB 1HD3A 3OW2S 3EGDB 1RADB 2R5AA 3ZL7C 2B86A 3CXCS 4M77C 1K4US 2ZPGB 3LLRA 2RF0A 1VYUA 3OBWA 4EIKA 4ZGJB 1R77A 5IAYA 2CP7A 2CUDA 2LX9A 5CQXA 1UTIA 5A2QE 4C0ZA 2QA4Q 4M78G 2JOYA 5ECAA 4M78F 1OI1A 1SPKA 1VUBA 3MKDA 2K7AA 2EYYA 4N4HA 1N5ZA 2FZCB 3CCEA 4BE0A 2CDTA 2NUTA 1M8VA 5IXFA 4C8QD 4BY6B 2ENMA 4DBQA 3C4SA 4J7FA 2K6DA 4M7AD 5FWCA 4M75D 2X4XA 5KCHA 3CCRT 1ABOA 3CMET 2V8KA 5KYNA 5FLXE 2LNVA 1N9SA 3SWNB 1C0MA 1MHNA 3QUIA 2E65A 2EYWA 2DAQA 4M77B 3V8JA 1WXBA 6AT1B 2J6OA 3ULRB 4PLLA 5CO7A 4C8QE 2DXCA 3CCSQ 3TSWA 3CCLT 3UA6A 1KQ1A 1VA7A 4M7AE 4M75E 4MZMA 5FROA 2FHDA 2VVKA 2LQNA 2YRDA 2OTLQ 2PU9B 4J9IA 4A4FA 3NFCA 5KYYA 4BD3A 3MCAB 1WIEA 4RTYA 4RCCA 5LJ3e 4C92A 5GAMh 1FWZA 1Y57A 2EW3A 2E12A 3CC2T 2LJ1A 2YXYA 4GLKA 2X4JA 1KQSS 2KGTA 4QT7A 1FMKA 2RNAA 1R0CB 4F7UG 3JAME 4F7UF 4HCZA 4JS5A 3DKMA 3CPWA 1RABB 3HTRA 1UE9A 2J7IA 2XI9A 1V29B 1VQ7Q 4AMCA 2QEXT 3SB2A 1Q82C 3I56Q 3JCMc 2M02A 2IG0A 3I55Q 4X1VA 1Q86U 1X2QA 4PJNA 3NGPA 2D8HA 4RTVA 3GBQA 4EDUA 3V8KA 2DK3A 2ZPIB 1YITT 1LNXA 1PRMC 3JSCA 2LT1A 1W2BP 1M90U 1LVKA 2L0AA 1I1JA 1QVFA 1SSFA 1U06A 2LDMA 2BZ8A 2YUPA 4RMOA 4OMLA 2YUOA 1U1SA 3I9QA 3M0QA 1W6XA 1AWOA 3DLLA 1NYFA 4M78A 1UGRB 1IGQA 2XD0A 3CCEQ 2KK4A 3VS7A 1M2OA 3JB9J 2EAYA 3AT1B 1PG5B 4R56A 2ROTA 3FRNA 1CSKA 4BI3A 3VS2A 3OSVA 1Z9QA 4O6JA 1VQKT 3L2VA 5GMKm 3A8HB 3MHXA 2RK1A 3KBGA 4OGEA 4PL6A 5DM7R 3EG1A 2EKOA 3M53A 3RKYA 3RMQA 2H3JA 1QLYA 2F5TX 3A8MB 3META 3OMCA 3S6WA 4Y92A 1ZX6A 5GANf 3BW1A 4CC4B 5GMKi 2DO3A 2K2VA 5KYXB 1QVFP 4B6MA 5LJ5h 2CT3A 2DVJA 1R8OB 3OYAA 5J26A 3OYJA 1OULA 2NUPA 4NL2A 3AHUA 1BU1A 2PVOB 4F7UA 2A36A 4Q5WA 3U23A 1VOMA 3QXEB 4WCIA 3CCRA 3CMEA 4JDSA 1K8AC 4JJDA 2DL7A 3QJYA 3G6ET 3E2UA 2GTOA 1UJYA 4KGVB 1D1CA 2FPDA 1PD1A 4LDWA 1QVGA 4X34A 2EQIA 3M9QA 1UB4A 2IIMA 3OYFA 3TCJA 1XJWB 1WHKA 2FB7A 4Y91A 4IUUA 1MUZA 4R0KA 1WQ7A 2DE0X 5GAN8 5D6YA 2EQUA 3L2WA 1QMCA 3CC2A 1RACB 2RQTA 1MMAA 1ZUKA 2F2XA 4CI0C 3H41A 3QJ6A 1JXMA 4AG2C 2JVVA 1C1AA 3UDCA 2DEUA 4OVAA 4JJNK 3QG1A 2FZGB 2VKNA 3M4GA 2LC4A 3DLMA 1MNDA 4F14A 2LQKA 2C06A 2YT6A 1QWEA 2HZYA 5GANg 2GFAA 2GBQA 1YITA 3MEWA 2RI5A 4V2SA 5C0MA 2M1HA 1I07A 2HQEA 1QVGP 3RR6A 2MPXC 1Q86R 2LCLA 4ELYC 2BZYA 4KGXB 2OJ2A 2EYXA 5CK9A 1K73R 5GAOr 1TH7A 2NYSA 1XTDA 2DTIA 1Y71A 4DA4A 1G5VA 1VQ8T 3PMIA 3SWNA 4FW2A 1W4SA 3OB9A 1MV3A 2DM1A 4FU6A 5GAN2 1J3TA 2LJ0A 1M90R 3QIIA 4M77A 3SEMA 2FVUA 5D7UA 4PFOA 3MP8A 4E7JA 4PJOC 3RKWA 1NJIC 4HT8A 4ME7A 3CCRQ 1RAHB 2K3BA 3CMEQ 2KXDA 1WHLA 4HT9A 1NPPA 1VQKA 5GANj 2ED0A 4E47A 3WVDB 2GGRA 2ZPFB 4QVCA 2J05A 3L2UA 2HL5C 1JO8A 4JJCA 3CMAT 4KH0B 1ZUYA 2MCNA 2RQRA 4C8QG 4C8QF 1WHMA 1RLQC 4JRPA 4M7AG 4M75G 4M75F 1FXXA 2LX7A 1H92A 2KAFA 4ZGEB 4PJOB 1KD1C 4J6WA 3JCMf 3OYLA 3A8GB 3CC2Q 2MIOA 2M0YA 3CCVT 2FL7A 1M1KU 2QQRA 1E7OA 1CKBA 3LGLA 1VIFA 4ESRA 5GAMe 5EG2A 4JZ4A 2KSSA 4XTUA 1S72T 4FYVB 2O2OA 4QQDA 2EQJA 4JLGA 2D1XA 4J6YA 1V1CA 3G6EA 1VQ7T 2ECZA 5GMKj 1H8KA 2BE7D 4NS5A 4N4IA 2QTVA 1PWTA 3PMTA 1YITQ 1AVZC 4D8DA 5I21A 2DEQA 5GJWB 5GAOl 5GAN6 2LVMA 2D9TA 1WHJA 5HK3A 2K4YA 2EVRA 1LOJA 3CEYA 3HSBA 1TUCA 2RQWA 5KE3A 1ZBJA 5IN1A 1TWBA 3A5ZB 4OMQA 4HCCA 3M4YA 4CC3A 5D6XA 2H3EB 2RD1A 3O5ZA 1VQKQ 2FEIA 1W2BS 4ORZA 2YLCA 2JT4A 1D1AA 3QSUA 2ED1A 4HXJA 3VRZA 2SRCA 5GAN7 3VS0A 5CKHA 2HD0A 1LCKA 4C8QA 2RN8A 1GCQC 3CCMT 4M7AA 4KULA 4M75A 1OX9A 3LYIA 4PFZA 1Q81U 1VQ8A 4M77E 1X75C 2WSEE 3FIFA 4II1A 4RG8A 1NE8A 1BCMA 2HQHA 3FEOA 4XK8E 1AT1B 5LJ5e 2G3RA 3Q1JA 4PJMA 4GLMA 2ABLA 1GXIE 2OX7A 2HBPA 5M9OA 1NG2A 5LJ3g 3G71A 3P8BB 3G6EQ 4J6XA 2JM9A 2X35A 1PRLC 4DBFA 4ANJA 2AKLA 5DLOA 1WX6A 3EHRA 1QVFS 1E6HA 2YUQA 3VS3A 5FU7C 1BK2A 1H641 2E64A 1M9SA 3CMAA 4CC7A 4HKEA 2P0QA 4CC2A 1GRIA 4ZGDB 1TOVA 1KC8C 1BKBA 1G3WA 1FX7A 1M3CA 2YHTA 3EG2A 3G1JA 1WPYA 2WSCE 3M55A 1T3SA 2EJGA 3H9NA 3CCVA 1WZOA 2PNIA 1NEGA 2RQUA 1AOJA 3G4ST 3CC7T 2XDBA 3QPHA 3OYHA 2JS2A 5CKFA 1FMWA 5KYUA 1BYMA 5LJ3j 1VQLT 1Y0MA 1S72A 5FU7B 2DZCA 2DD4A 2VXEA 4LDYA 3M0SA 3SHWA 4XAXB 3UWNA 1GBRA 2BKDN 2V1RA 2X51A 1VQ7A 2KXCA 4Z89A 1YCSB 1RUWA 1WI7A 1ZA1B 2RQVA 3EH2A 2ZGWA 3TVTA 1M3BA 4LD6A 2D0NA 4LXCA 3FLGA 2Y4YA 4NOYA 3PFSA 5GAN4 5CIUA 1ZLMA 3L2QA 4C5IA 2CZ1B 2CKKA 1VQ8Q 5I22A 4E7LA 4M7DC 1UGQB 4J83A 2OAUA 1ZSZA 3V7CA 2BUDA 3VUBA 1P92A 1NYGA 4N0AA 2A28A 1UFFA 2ROLA 2P4TA 3GP8A 1D3BB 2NLUA 1QVGS 3G71Q 1N8RC 1X6OA 1OZ3A 1PM3A 2PUKB 4BDYA 2CP5A 2JN0A 1PCXA 3X25B 1G3YA 3CMAQ 3GNFB 2PZ1A 4M7DB 2A0FB 3UPUA 2RI2A 4J9CA 2LP5A 2HNIA 3CCMA 3ME9A 3F70A 4EMKA 2D6FA 1YJNA 1UG1A 3CCVQ 1SG5A 2FO0A 2E70A 1K9MC 2JNGA 1OZ2A 2MYSA 4BI8B 3RKXA 1YWPA 1S72Q 1G3SA 2JM8A 1Q81R 1Y07A 3BE3A 1M1KC 1HXDA 2KT8A 2CZ0B 4C5HA 3P8DA 4XTXA 2O4XB 2P0PA 2LCSA 2L3RA 4IUVA 1FMVA 1UECA 2O9SA 5KYWA 4O5VA 1Y7XA 5I2SA 2EFIA 2DL8A 1VQ4T 5GJVB 1KIKA 1ZQ1A 1K73U 4FM4B 3TEEA 2YLBA 3OMGA 1BI1A 4BE1A 1SF9A 2LT4A 2XICA 3LX7A 3PT9A 2GNCA 3OYGA 2X4WA 1X01A 3MP6A 2KRSA 3CBPA 1M8MA 1OV3A 4F17A 2W10A 1QWFA 5GAMf 3OS5A 1Y96B 2E6ZA 1AWWA 1IO6A 2M9UA 1KG1A 3G4SA 3CC7A 3J7AF 2AHJB 4FIBA 2AT1B 2A37A 3EAEA 3R6OA 2NUZA 1VQLA 2QGGA 3S3OA 1O9SA 3QDRB 1KJWA 2QQBA 3PTAA 1WJQA 1YCYA 1K0SA 3CPWP 2DYBA 4JLIA 2RHXA 4RKUE 5FU6C 5EC7A 4OMMA 4K11A 2VC8A 2QG9B 3EGXB 3GPLA 4QW2A 4E6RA 4ZNXA 2FYKA 3WVEB 4ZN1A 3EG9A 4HCBA 1PSEA 5GAOp 1DJ7B 2CP2A 4FYYB 2JW4A 2EGCA 3VV0A 4DQ2A 2JTEA 3CCMQ 3HFOA 3EFRA 1T3LA 3QYHB 1B7TA 5A0LA 1YJNQ 1X2KA 5KCOA 5GANd 2XDDA 2KROA 1N27A 5HY6A 4PJOD 2XG8D 3TSZA 4OGCA 3LWIA 2CP0A 2VASA 1WJSA 1GCQA 3RNJA 4M77G 1KFZA 4M77F 2O88A 2RJCA 2L3PA 4LN2A 5FU6B 1PC0A 1BI0A 3TREA 1VQ5Q 4RUGA 2ZZDA 1RI9A 4L6V5 2GQVA 3OYBA 3QZ9B 2CGHA 1Q7YU 1D0XA 2JXBA 3C12A 4PJOE 1NZ9A 3JB9D 2I2LA 3HRUA 5GAN5 4FT2A 5GAMg 2LRQA 1M30A 1T0JA 4IUTA 3NMZC 1RAAB 4B9WA 1KQ2A 5GAOm 1NJIR 1WGSA 4JRIA 3JRZA 1WJRA 1QCOA 4NL3A 1RAEB 1YI2A 1GFCA 1D1BA 3RESA 5DLQE 2RI3A 3QWXX 4ZTFA 2LCCA 5LJ5f 1F1BB 3M0TA 4OMOA 3G4SQ 3CC7Q 4MMLA 3QZ5B 4E7IA 3OYYA 1VQLQ 1U3OA 3LH0A 1OQKA 2P0KA 1WA7A 3NTIA 3OS2A 3EHQA 3V8LA 1G3TA 5L23A 4EMHA 2LNHB 3EGDA 2X3WD 5IHIA 4XU2A 4C0DC 2CUBA 5GAMj 5FRNA 2DZ9A 4EMGA 1SHGA 2PQWA 2L3QA 1T0HA 1VQ4A 3VUZA 4PK4A 1X43A 3M57A 2QYZA 3VU3C 2CH4W 1TTHB 3MP1A 1X69A 1N9RA 2DXUA 4CRIA 2E5QA 4ZTJA 1TUGB 1TU0B 2VXFA 2V8JA 4DBHA 1Q95G 1HSQA 1V76A 1WHGA 3EFOB 1QQJA 1NPRA 2HL3A 3MEVA 4C0DB 3OYKA 2G6FX 1MMDA 2E4HA 2PTKA 5AT1B 4A63B 4RTZA 1KSWA 5GAOq 4F04B 4JPBW 3O8VA 3CCUT 1KHIA 3G71T 4OMNA 5CVIA 2VWFA 5GAN3 2EYQA 4Z02A 3ZFJA 3MEUA 4J9GA 2AKKA 3FDRA 5LJ5g 4XQ3A 2RMOA 1JRIA 4RG2A 4FL6A 2JZ2A 2A7YA 3UATA 2QASA 1TSFA 2QI2A 1K0XA 4AFZC 5IHKA 5J3BA 3VS5A 3HRSA 1YI2Q 4M7AF 4J8OA 4D6WA 4A53A 1YJWT 1SRLA 1ZBXA 2DD5A 3CCQA 2HBWA 5GMKl 1QW1A 3JCMd 2EBPA 2NUTB 1QCNA 4C92C 4A4GA 1WLPB 1B34B 1WDXA 2GFUA 4JZ3A 3M0PA 4BB7A 2MWOA 3MJXA 1EIFA 4M4ZA 4E7ZA 2R58A 1SKUB 2Z0WA 1UGPB 1I4K1 2L8DA 5LJ5j 2YSQA 1VQ4Q 2DIQA 2M16A 1Y96A 1I5LA 1X27A 2EYZA 2K3YA 1Q82U 2DLPA 1Q7YR 5KYYB 1EZZB 2DKGA 3X24B 1Q86C 5LJ3f 5LJ3d 1QCFA 4C92B 3JCMW 4KH1B 1UGSB 4X9DA 3BFMA 1RI0A 2PVGB 3MO8A 3JB9H 3L2RA 1UUEA 1M90C 4GBQA 1WXUA 1UEBA 3FJ5A 1YIJT 2QQ9A 4M78C 2QDYB 4C5EA 2CH4A 2ZPEB 1JU5C 3J80E 4KBMB 2K5IA 3CQTA 1B07A 3LW5E 7AT1B 4JS4A 3R6NA 1VQ6A 4MDWA 3T9NA 4QVDA 4AT1B 4DBRA 2JMCA 2E6NA 4DEXA 5GANe 5KYXA 1VQMA 3N5BB 1WNLA 3RDVA 4WTOB 5C6SA 2MF2A 3CBMA 3GLXA 4M7DD 2KYBA 4XTWA 2QDLA 3VS6A 3MPUB 4PKCC 4M78B 3CCQQ 4KGZB 3PE0A 1OX8A 3CPWS 2CSQA 1YJNT 2AIRB 3JB9I 2CS7A 1D0YA 5FRMA 3A98A 1YBYA 2VV5A 2KE9A 3PIOA 1G83A 3VRYA 4E7HA 2K5LA 4M7DE 2EQKA 2ATCB 1VQ5T 1BCOA 3I5RA 3OY9A 2EGEA 2HSPA 3CCUA 4N4GA 3GNGA 3OS1A 3X26B 2MAMA 4AFSC 3CD6T 2E3HA 4J5YA 1H3ZA 2LQWA 4PJOG 3JCMV 4PJOF 3VYGA 1K8AU 1JJ2A 5GMKe 1BBZA 2LTOA 4WF2A 2YRVA 4LE9A 1YJ9T 2K79A 3HRTA 3RBBB 3CCJT 2P84A 4XU0A 3A8OB 2DBMA 2ZAEA 1YJWA 1KK7A 2P4RA 3D7SB 1WFWA 3M0RA 1IB8A 2EGAA 3L2ZA 3VS4A 4LD9K 1PHTA 2NUPB 2BTTA 4F7UB 1MGQA 1TG0A 1W1FA 2IPOB 4HCKA 4B9XA 1WQWA 3HFNA 2CT4A 1M2VB 1E6GA 3RIRA 4PJJA 1OU8A 2DL4A 2KNBB 5IHNA 2DF6A 3UF4A 3RUXA 1VQ6Q 1ZUUA 1UHCA 1VQMQ 1B3QA 1LJOA 2JMAA 2JTFA 2FG0A 3EFOA 1JJ2P 1UGVA 2A08A 2QQSA 2V26A 4A4KA 3M5AA 1ABQA 2RHIA 1Q82R 3EG3A 2RJEA 2XIDA 3OYDA 4KUIA 3LWHA 3CPFA 5FW9A 4FSSA 2I0NA 4LDUA 2V8IA 4C0FA 1JEGA 3NTHA 2DJZA 1U5SA 1UJ0A 2RB6A 4F16A 2ESWA 1YIJA 3SWNC 2DTOA 2W0ZA 1OU9A 2E1HA 3BDLA 1EFNA 2YRCA 2CP3A 3CBOA 4HA8A 2CYZB 4PFPA 4J9FA 3CCUQ 4J9HA 4XTZA 1QKXA 2K57A 3JCMP 4LDVA 1D0ZA 3KXTA 3HPWA 1RAFB 1YN8A 1Z9ZA 3ZEHA 4UC4A 1NJIU 2KBTA 3DB3A 1PKTA 4PJOA 2QAZA 5CR2A 2HMAA 3URGA 2BZXA 3JCMe 2MWPA 1G8XA 4ZN3A 3OYMA 2VGMA 1B34A 3PGGA 8AT1B 4QQGA 2EIFA 3JCMb 2LMJA 5J39A 1YJWQ 3JCMJ 1O75A 2O9VA 2K5FA 3OYCA 3OYEA 1YI2T 3E1SA 2F2VA 3E19A 4HVWA 1GL5A 3ASKA 4MDXA 5LL6S 4JJBA 4KT0E 2ZCFB 3EH1A 2FPFA 5HK0A 1KD1U 1QKWA 1W2BA 4IIMA 1OOTA 4DEYA 1FYNA 3JCMQ 1VQ5A 2DFUA 1VQ9T 2EJ9A 2FZKB 3V7RA 4KUDK 2IVWA 3OS0A 2Y90A 3E9FA 3CD6A 4EPCA 4R55A 3M58A 3BDUA 4L5GA 1ZA2B 3BY7A 2RK2A 1MNEA 5GAOn 3A1PA 2Y4XA 2KDSA 5IXBA 1RLPC 3UA7A 2D8JA 2RA2A 1S1NA 2COYA 1VQPT 3QHSA 5IH2A 1YJ9A 3C94A 1JB0E 2J6KA 4JUVA 3CCJA 3JCMX 2WACA 1VYVA 1K8AR 4TVRA 1HK9A 1M1GA 4FYXB 8ATCB 2DIGA 5GAMd 2XHCA 1OYXA 5I11A 2L2PA 1YIJQ 2EQMA 1RL2A 5HCKA 2CZ6B 2DL5A 4QVZA 1RAIB 1VQOT 2LQ8A 2CSIA 2L89A 1IHVA 2ZPHB 2KVQG 1GCPA 2YDLA 5GANh 4D8KA 2PVDB 2KQWA 5A0DA 5CKEA 2RJFA 4C0GA 4BE2A 2D0QB 2RHUA 1IZ6A 2JUFA 1K9AA 4A4EA 3M56A 3H0FA 3QBYA 4C8QC 1TUDA 2ZPBB 1XQHA 1X6GA 1IREB 1UHFA 3CCQT 4M7AC 1U8RA 4M75C 3ER0A 5KH6A 1BIBA 4J9BA 4MZTA 1TXQA 4DOVA 1IHWA 2DXTA 2MMPA 1YHQT 2DNUA 3TU4K 2J6FA 2AK5A 1Q81C 4BI4A 4M7DG 2F1LA 2RHYA 4E7SA 4M7DF 5AYFA 3OA6A 2QXFA 1BIAA 3CD6Q 1WHHA 4RTXA 1VIEA 2KRNA 4IUPA 1GBQA 5GMKh 3OW2A 1QP3A 3VJPA 2DX1A 4C8QB 3WXMB 4XU1A 2VB6A 2LZ6B 3L1AA 1AEYA 3CXCA 1YJ9Q 4M7AB 3EGUA 4M75B 1KHCA 4RTUA 3CCJQ 2DPPB 2DJQA 2JS0A 2VUBA 3CC4T 1HYOA 1M2VA 2V1QA 1IGUA 4C92D 3RERA 3C0CA 1KC8U 5LJ5d 4PLIA 2XDPA 5A0GA 3CCLA 2X3XD 3FJPA 3HP9A 4XTVA 2CZ7B 4E7KA 2HSEB 2DA9A 1PD0A 2HKNA 4Z8AA 4MMKA 1VQ9A 2DRKA 2F5KA 2M51A 3H0IA 3VYHB 4C92E 4L59A 2F69A 1I0CA 2VYTA 1KD1R 1PNJA 3EG0A 4ELZC 1C6VX 2GF7A 2OTJT 1VQ6T 2X4YA 3A8LB 4XU3A 3OW2P 1MV0B 2FRWA 1VQPA 1IXDA 3J81E 5HKCA 2B8AA 4BDZA 1AZGB 1VQMT 2YWWA 4IKFA 3CXCP 1VQNT 1M4ZA 1VYTA 2BE9B 3PNWC 1RAGB 2QEXA 1X6BA 4A4HA 3VKIA 3X28B 1D3BA 4LNPA 4OB1B 2EKHA 1G2BA 4M78D 1KQSA 4J7IA 4DOWA 5KYUB 4C5GA 2FRYA 2L3SA 4RCBA 1ARKA 2XU8A 2SEMA 1ZSZC 3SDZA 2R57A 3REAB 4X9CA 3GIBA 1JJ2S 1BI3A 3ZBDA 4E2FB 1VQOA 4Y28E 4N0AC 1PKSA 3LGFA 4M7DA 2OAWA 1K1ZA 4M78E 4OB2B 3HHTB 1JXOA 2COWA 4KRTA 2GTJA 3PVQA 3JCMh 2KMTA 2RH2A 3QDFA 2QA4T 1WXTA 1N8RU 2DBKA 1SHFA 1YWOA 4BACA 2E5KA 2X9HA 1U1TA 3PVLA 4LUEA 4VUBA 1N6AA 2R5MA
chains in the Genus database with same CATH topology
4YTLA 2WSFE 5LJ5h 3GNFB 1VQ5T 4M7DB 2MI6A 1R8OB 2DTHA 3OY9A 3CCUA 4OB0B 2O01E 4N4GA 3UPUA 3GNGA 3OS1A 3X26B 2RI2A 3OYAA 2MAMA 5J26A 3OYJA 1QVPA 3V7SA 3CD6T 2O4XA 2HNIA 3CCMA 4NL2A 4EMKC 3AHUA 3ME9A 4J5YA 2PVOB 1H3ZA 4F7UA 4Q5WA 1YHQA 3QYGB 3CCST 3F70A 4EMKA 4PJOG 3QXEB 3JCMV 2D6FA 4PJOF 3VYGA 3MEAA 3CCRA 1YJNA 3CMEA 1K8AU 4JDSA 3QKJA 1JJ2A 1K8AC 2DVEA 5LJ3h 3G7ZA 5GMKe 2LTOA 3QJYA 4WF2A 3G6ET 1K9MU 2OTLT 2E70A 2YRVA 4QQ6A 1K9MC 2JNGA 1OZ2A 1YJ9T 4A54A 3HRTA 4BI8B 2EJFA 3RKXA 2DXBA 3CCJT 5DY9A 1VQ8A 4XU0A 1G3SA 3A8OB 1Y07A 4FSXA 4LDWA 1YJWA 1QVGA 4X34A 1M1KC 3GIBA 3S3MA 2QQAA 1HXDA 2RHZA 3L2ZA 2CZ0B 3M9QA 4F7UE 4LD9K 1UB4A 3INZA 4C5HA 3OYFA 3P8DA 4XTXA 3TCJA 2O4XB 1AHJB 2P0PA 3SD4A 4F7UB 5CCAA 2L3RA 1MGQA 4IUVA 2FB7A 4Y91A 4O5VA 4BUGA 4EMKB 4B9XA 4IUUA 1Y7XA 5I2SA 1WQWA 2EFIA 1VQ4T 3CC4A 1WQ7A 1XNIA 5GAN8 5D6YA 3HFNA 2EQUA 1ZQ1A 3H6ZA 3L2WA 3QO3A 4FM4B 3RIRA 1K73U 3TEEA 1K73C 3CC2A 2YLBA 3I56T 3OMGA 1BI1A 4BE1A 3L42A 2LT4A 2XICA 3LX7A 3PT9A 3OYGA 3I55T 2X4WA 4CI0C 1X01A 2M0OA 3MP6A 3CBPA 3QJ6A 2QTXA 3RUXA 2KY9A 2JVVA 2GCXA 4OP0A 3UDCA 5GAMf 3OS5A 3M54A 1Y96B 2E6ZA 3OSSC 4OVAA 4JJNK 3QG1A 2M9UA 1LJOA 2L5QA 2JTFA 3M4GA 2LC4A 1KG1A 3DLMA 3G4SA 3CC7A 3J7AF 2AHJB 2XKOC 4FIBA 2E41A 3EAEA 2QQSA 2LQKA 5CKBA 3OYIA 2C06A 5GANg 2GFAA 2K3XA 4A4KA 3M59A 3M5AA 3R6OA 5IT9E 1VQLA 3HKSA 2RHIA 3S3OA 2OTJA 1O9SA 3QDRB 1YITA 2RJEA 2RI5A 3MEWA 4LDXA 2XIDA 5C0MA 2M1HA 2QQBA 4V2SA 3OYDA 1WJQA 2HQEA 4KUIA 3PTAA 3LWHA 3CCET 3CPFA 2LCLA 1YCYA 5D6WA 4ELYC 4LDUA 2V8IA 1I81A 4C0FA 4JLIA 3NTHA 2DJZA 2RHXA 1BI2A 4RKUE 5FU6C 3SFMA 2RB6A 5CK9A 4GY5A 1VQNA 2VC8A 1YIJA 5GAOr 1TH7A 3SWNC 1XTDA 2DTOA 2DTIA 4PNOA 2E1HA 4QW2A 1Y71A 3GPLA 3BDLA 4DA4A 1VQ8T 2FYKA 3H8ZA 3WVEB 4ZN1A 1G5VA 3UT1A 3PMIA 3SWNA 4HCBA 3CBOA 4HA8A 2CYZB 1PSEA 1W4SA 3OB9A 4XTZA 1DJ7B 3C95A 4FU6A 5GAN2 5GAOp 2K57A 3VV0A 3QIIA 4M77A 3JCMP 4LDVA 4DQ2A 3HFOA 3JCMg 3EFRA 3QYHB 2XK0A 3HPWA 3KXTA 2FVUA 4M77D 3ZEHA 5A0LA 4UC4A 3MP8A 4E7JA 1NJIU 4PJOC 3GOXA 2HQXA 3RKWA 1NJIC 4HT8A 4ME7A 3DB3A 5KCOA 3X20B 4PJOA 3KUFA 5GANd 5CR2A 2XDDA 3URGA 4HT9A 3JCMe 1NPPA 2VGNA 5CAIA 2MWPA 5HY6A 1N27A 1VQKA 4ATOA 2XG8D 4PJOD 5GANj 4OGCA 3LWIA 4E47A 4ZN3A 1WJSA 2RO0A 3OYMA 4M77G 3WVDB 2VGMA 4M77F 1B34A 5AYFA 2RJCA 3PGGA 2ZPFB 2EIFA 4QQGA 4IUQA 1BI0A 1M5Q1 5FU6B 3TREA 4QVCA 3L2UA 3JCMb 2ZZDA 5J39A 2QA4A 4L6V5 3JCMJ 3OBYA 2RJDA 1O75A 1XOVA 2K5FA 2GQVA 3OYCA 3OYEA 3CMAT 1YI2T 3OYBA 3E1SA 4C8QG 1I8FA 3QZ9B 3E19A 4C8QF 2CGHA 1Q7YU 1Q7YC 3C12A 3S3NA 4JRPA 4PJOE 4M7AG 3ASKA 4MDXA 1NZ9A 5LL6S 3JB9D 4M75G 4M75F 2I2LA 1FXXA 4KT0E 3HRUA 5GAN5 2KAFA 2ZCFB 4FT2A 4FT4A 4ZGEB 5HK0A 1KD1U 4PJOB 5GAMg 1KD1C 4J6WA 3JCMf 1W2BA 3OYLA 2LRQA 4IUTA 3JCMQ 4B9WA 3A8GB 1VQ5A 4OF1A 3CCVT 2FL7A 1VQ9T 2EJ9A 1PSFA 2QQRA 3V7RA 5GAOm 1M1KU 2IVWA 4KUDK 1KQ2A 3OS0A 2A3LA 1WGSA 2Y90A 3LGLA 3JB9G 1VIFA 4JRIA 3JRZA 3E9FA 5GAMe 5CQYA 3CD6A 3JB9F 2BIVA 5EG2A 1WJRA 4EPCA 4R55A 3M58A 3BDUA 4L5GA 3OYNA 4NL3A 2KSSA 3BY7A 2EWNA 2RK2A 4XTUA 5GAOn 3CCSA 1YI2A 2Y4XA 1S72T 4QQDA 2KDSA 3OQ5A 2EQJA 4JRKA 3RESA 5KE2A 4JRQA 5DLQE 2RI3A 4JLGA 2PUOB 2RA2A 2LCCA 5I2MA 5LJ5f 4ZTFA 3GF5A 4J6YA 3FC3A 1VQPT 3QHSA 4MZPA 2E10A 3G6EA 2OTLA 1YJ9A 1VQ7T 4MMLA 3QZ5B 4E7IA 1ZHIA 5GMKj 3OYYA 1JBMA 3C94A 3P8HA 1JB0E 4JUVA 2HAXA 3DB4A 4C92G 3JCMX 4NS5A 4N4IA 3CCJA 2WACA 4C92F 3LH0A 2JTMA 3PMTA 2P0KA 3OS2A 3NTIA 1M1FA 4TVRA 2RM4A 1HK9A 1M1GA 1G3TA 3V8LA 4EMHA 5I21A 4IURA 2DEQA 2DIGA 5GAMd 4XU2A 5GAOl 2XHCA 5GAN6 4C0DC 2LVMA 1OYXA 2D9TA 5GAMj 5FRNA 2DZ9A 4EMGA 1QP2A 2PQWA 2EQMA 1RL2A 5HK3A 1VQ4A 2K4YA 5L8RE 3VUZA 5CKDA 1LOJA 2CZ6B 3CEYA 3RMSA 4QVZA 3HSBA 3PIPA 3M57A 1VQOT 2LQ8A 5KE3A 3VU3C 3I56A 3EFSA 2L89A 5IN1A 3A5ZB 3I55A 2ZPHB 3MP1A 4HCCA 4BY6C 1N9RA 2KVQG 4XTYA 2DXUA 3HL8A 4OB3B 3E9GA 3NTKA 4P5NA 4CRIA 2E5QA 3FB9A 5GANh 3M4YA 4ZTJA 4OMFB 2VXFA 3OW2S 5D6XA 2PVDB 2RD1A 2KQWA 2V8JA 5A0DA 1W2BS 2R5AA 5CKEA 3CXCS 2YLCA 4M77C 2RJFA 2ZPGB 1NPRA 3LLRA 4C0GA 4BE2A 3OBWA 3MEVA 4C0DB 2D0QB 3OYKA 4ZGJB 3QSUA 2RHUA 5IAYA 1IZ6A 2JUFA 2LX9A 5CQXA 5A2QE 4A4EA 4C0ZA 3M56A 5GAOq 5GAN7 3QBYA 4M78G 2JOYA 5CKHA 4C8QC 4M78F 1OI1A 1VUBA 2ZPBB 2HD0A 1XQHA 3O8VA 1IREB 1KHIA 4N4HA 3CCUT 3CCQT 4C8QA 3CCEA 4BE0A 4M7AC 1U8RA 4M75C 3ER0A 5KH6A 3G71T 1M8VA 5CVIA 1BIBA 4MZTA 4C8QD 3CCMT 4DOVA 4BY6B 4M7AA 5GAN3 2EYQA 2DXTA 4KULA 4M75A 3MEUA 4Z02A 3C4SA 3ZFJA 4J7FA 2MMPA 1YHQT 3LYIA 4M7AD 3TU4K 4M75D 3FDRA 2X4XA 5KCHA 4M77E 5LJ5g 3CMET 2V8KA 4BI4A 3CCRT 1Q81C 1X75C 5FLXE 2LNVA 1N9SA 2WSEE 3FIFA 3SWNB 4M7DG 2RHYA 4XQ3A 4M7DF 1MHNA 1JRIA 3QUIA 4II1A 4FL6A 2JZ2A 4RG2A 4RG8A 1NE8A 2E65A 2A7YA 2QXFA 3OA6A 2DAQA 1BIAA 4M77B 3V8JA 1VIEA 3FEOA 2QI2A 4IUPA 4XK8E 4PLLA 5CO7A 5LJ5e 2G3RA 3Q1JA 2DXCA 5J3BA 4C8QE 3HRSA 4M7AF 4J8OA 4D6WA 4A53A 1QP3A 5GMKh 3CCLT 3OW2A 1GXIE 3VJPA 1KQ1A 1ZBXA 1YJWT 4M7AE 2DD5A 3CCQA 4M75E 2HBPA 4MZMA 4C8QB 5M9OA 5GMKl 5FROA 3WXMB 1QW1A 5LJ3g 3P8BB 2FHDA 4XU1A 3L1AA 3JCMd 3G71A 3CXCA 2PU9B 4A4FA 4J6XA 2X35A 3NFCA 4M7AB 4M75B 4BD3A 5DLOA 1KHCA 4C92C 4A4GA 3MCAB 1B34B 4RCCA 2DPPB 1QVFS 2GFUA 5LJ3e 5FU7C 2VUBA 4C92A 3CC4T 5GAMh 1H641 2E64A 1FWZA 1M9SA 4BB7A 2MWOA 2E12A 3CMAA 4C92D 3RERA 1EIFA 4HKEA 3CC2T 2P0QA 4GLKA 2X4JA 1KC8U 1KQSS 5LJ5d 4ZGDB 1KC8C 2R58A 1BKBA 4PLIA 1G3WA 2XDPA 1FX7A 1UGPB 4F7UG 3JAME 1I4K1 5A0GA 2L8DA 2YHTA 4F7UF 3FJPA 4HCZA 5LJ5j 3CCLA 3HP9A 4XTVA 2DIQA 2M16A 2CZ7B 4E7KA 4JS5A 1Y96A 3DKMA 3CPWA 1WPYA 2WSCE 1I5LA 2XI9A 3M55A 2K3YA 1Q82U 1V29B 1Q82C 2QEXT 2EJGA 4MMKA 3SB2A 3CCVA 1VQ9A 2F5KA 3JCMc 3VYHB 4C92E 3G4ST 3CC7T 2IG0A 2XDBA 1Q86U 2DKGA 4L59A 3X24B 1Q86C 5LJ3f 3QPHA 5LJ3d 2F69A 3OYHA 2VYTA 5CKFA 4C92B 3JCMW 1BYMA 4ELZC 5LJ3j 1UGSB 4X9DA 1VQLT 4EDUA 3BFMA 1S72A 1RI0A 2GF7A 3V8KA 5FU7B 2DK3A 2PVGB 3MO8A 2DZCA 2DD4A 2VXEA 2ZPIB 1Q81U 1VQ6T 4LDYA 1YITT 3JB9H 2OTJT 2X4YA 3A8LB 4XU3A 3L2RA 4XAXB 1VQPA 1LNXA 3UWNA 3J81E 5HKCA 2B8AA 2BKDN 3JSCA 4BDZA 2LT1A 1VQMT 1M90U 1VQ7A 4IKFA 1M90C 1UEBA 1VQNT 1QVFA 2ZGWA 1SSFA 1M4ZA 2LDMA 2QQ9A 2QDYB 3PNWC 4M78C 4C5EA 4RMOA 1YIJT 1U1SA 2QEXA 2ZPEB 4LD6A 3DLLA 3FLGA 4M78A 4A4HA 3VKIA 3X28B 2Y4YA 4NOYA 1D3BA 1UGRB 3PFSA 4KBMB 5GAN4 4OB1B 3J80E 2XD0A 2KK4A 4M78D 1KQSA 2K5IA 4J7IA 3JB9J 4DOWA 2EAYA 4C5GA 3LW5E 5CIUA 4RCBA 4R56A 4JS4A 2XU8A 1VQ6A 4MDWA 3T9NA 3FRNA 3SDZA 4C5IA 3L2QA 2CZ1B 2CKKA 4QVDA 4BI3A 2R57A 2E6NA 3OSVA 4E7LA 4M7DC 1UGQB 4X9CA 4J83A 5GANe 1JJ2S 1BI3A 2OAUA 4O6JA 1VQMA 3V7CA 2BUDA 3VUBA 1P92A 3ZBDA 3N5BB 1VQKT 3L2VA 1VQOA 4Y28E 1WNLA 4N0AC 3LGFA 4M7DA 5C6SA 5GMKm 3A8HB 4M78E 3MHXA 2MF2A 3CBMA 4OB2B 3GLXA 4N0AA 4M7DD 2RK1A 3HHTB 3KBGA 4OGEA 4PL6A 4XTWA 5DM7R 4PKCC 4M78B 2KMTA 3JCMh 2RH2A 2P4TA 3GP8A 2QA4T 1D3BB 2EKOA 2NLUA 3M53A 3RKYA 3RMQA 1QVGS 2H3JA 1N8RU 3CPWS 1X6OA 1N8RC 2F5TX 3A8MB 1YJNT 3JB9I 4BACA 1OZ3A 2CS7A 3META 3OMCA 5FRMA 2PUKB 1YBYA 2VV5A 1U1TA 1N6AA 4BDYA 2JN0A 3S6WA 3PIOA 4E7HA 4M7DE 2K5LA 5GANf 3BW1A 3X25B 5GMKi 4VUBA 2DO3A 1G3YA 2R5MA 2K2VA 2EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAF A;  2KQW A; 
#chains in the Genus database with same CATH topology
 1ZSZ B;  4YTL A;  2AZS A;  2WSF E;  2MI6 A;  1SSH A;  2DTH A;  1NEB A;  2O01 E;  4OB0 B;  1BB9 A;  2JJ9 A;  3REB B;  1QVP A;  3V7S A;  2O4X A;  2E3I A;  4RTW A;  3CCL Q;  2K2M A;  4EMK C;  1KQS P;  1YHQ A;  3QYG B;  3CCS T;  3MEA A;  1H3H A;  3QKJ A;  2DVE A;  1VQ9 Q;  5LJ3 h;  3G7Z A;  4HVU A;  4FCY A;  2OTL T;  1K9M U;  4QQ6 A;  1NM7 A;  2F2W A;  4A54 A;  2EJF A;  2CRE A;  2DXB A;  5DY9 A;  4FSX A;  1VQP Q;  3S3M A;  2QQA A;  2RHZ A;  4F7U E;  3INZ A;  2DET A;  2NWM A;  1AHJ B;  2KYM A;  3SD4 A;  4AG1 C;  2EPD A;  4AFU C;  4J9D A;  5CCA A;  4BUG A;  1OEB A;  1D09 B;  4EMK B;  3NHN A;  2QEX Q;  3I5S A;  4OMP A;  3CC4 A;  1XNI A;  2HKQ B;  3H6Z A;  3QO3 A;  1K73 C;  3I56 T;  1SRM A;  3L42 A;  3I55 T;  5FWB A;  2MOX A;  2DL3 A;  9ATC B;  2DMO A;  2M0O A;  1GFD A;  2QTX A;  2KY9 A;  1JQQ A;  2DYI A;  2GCX A;  4OP0 A;  1HJD A;  3OSS C;  3M54 A;  3EGX A;  3THK A;  1VQO Q;  1K76 A;  2L5Q A;  1ACM B;  2HDA A;  2XMF A;  1KC8 R;  1MMN A;  2XKO C;  1YP5 A;  5KYW B;  1NLO C;  2E41 A;  2C0O A;  5CKB A;  3OYI A;  2CP6 A;  2K3X A;  3M59 A;  5IT9 E;  3HKS A;  2K9G A;  1AWX A;  2KR3 A;  2DIL A;  2OTJ A;  2J06 A;  3M0U A;  1AZE A;  1ZSG A;  4LDX A;  4IIO A;  2AZV A;  4AFQ C;  2GQI A;  3CCE T;  5D6W A;  3H0H A;  2KI7 A;  2FPE A;  1I81 A;  1I5O B;  1BI2 A;  3JV3 A;  3SFM A;  1NLP C;  4GY5 A;  3KFV A;  1VQN A;  2H8H A;  4PNO A;  1CKA A;  3H8Z A;  3UT1 A;  1NBE B;  2COZ A;  3C95 A;  1UDL A;  3NPF A;  3QWY A;  4QKU A;  3JCM g;  2XK0 A;  4M77 D;  4RTT A;  1YHQ Q;  2KT1 A;  3GOX A;  2HQX A;  3X20 B;  3KUF A;  2VGN A;  4FYW B;  5CAI A;  4ATO A;  3IQL A;  2KEA A;  2RO0 A;  3I35 A;  2DRM A;  4LUD A;  4Z88 A;  4IUQ A;  1M5Q 1;  2C0I A;  3EG9 B;  2QA4 A;  3OBY A;  2RJD A;  1XOV A;  2QGF B;  1I8F A;  2MK5 A;  2DER A;  1Q7Y C;  3S3N A;  2C0T A;  2RPN A;  3VS1 A;  1OPK A;  1M3A A;  4FT4 A;  3CC4 Q;  1N8R R;  4OF1 A;  1R0B G;  1PSF A;  4PJL A;  2A3L A;  3JB9 G;  3JB9 F;  5CQY A;  2KRM A;  2BIV A;  4FW1 A;  3OYN A;  1TS9 A;  3TQ7 P;  2EWN A;  3CCS A;  2QK0 A;  3OQ5 A;  4JRQ A;  4JRK A;  5KE2 A;  1AD5 A;  2PUO B;  5I2M A;  3GF5 A;  3FC3 A;  1IRX A;  4MZP A;  1M27 C;  2E10 A;  2OTL A;  1A0N B;  2HCK A;  2O31 A;  3LH5 A;  1YNZ A;  2YUN A;  1ZHI A;  1JBM A;  3P8H A;  2HAX A;  1W70 A;  3DB4 A;  4C92 G;  4C92 F;  2JTM A;  2OTJ Q;  1M1F A;  2RM4 A;  1K9M R;  4IUR A;  1AWJ A;  2HEQ A;  1VQN Q;  1QP2 A;  4J9E A;  2OI3 A;  1M1K R;  5CKD A;  5L8R E;  1LPL A;  3RMS A;  1WYX A;  2LJ3 A;  3PIP A;  3I56 A;  3EFS A;  4HVV A;  3I55 A;  1MMG A;  4BY6 C;  1EX4 A;  4XTY A;  1SEM A;  3HL8 A;  4OB3 B;  3E9G A;  3NTK A;  4P5N A;  1OPL A;  3FB9 A;  1YFN A;  4OMF B;  1HD3 A;  3OW2 S;  3EGD B;  1RAD B;  2R5A A;  3ZL7 C;  2B86 A;  3CXC S;  4M77 C;  1K4U S;  2ZPG B;  3LLR A;  2RF0 A;  1VYU A;  3OBW A;  4EIK A;  4ZGJ B;  1R77 A;  5IAY A;  2CP7 A;  2CUD A;  2LX9 A;  5CQX A;  1UTI A;  5A2Q E;  4C0Z A;  2QA4 Q;  4M78 G;  2JOY A;  5ECA A;  4M78 F;  1OI1 A;  1SPK A;  1VUB A;  3MKD A;  2K7A A;  2EYY A;  4N4H A;  1N5Z A;  2FZC B;  3CCE A;  4BE0 A;  2CDT A;  2NUT A;  1M8V A;  5IXF A;  4C8Q D;  4BY6 B;  2ENM A;  4DBQ A;  3C4S A;  4J7F A;  2K6D A;  4M7A D;  5FWC A;  4M75 D;  2X4X A;  5KCH A;  3CCR T;  1ABO A;  3CME T;  2V8K A;  5KYN A;  5FLX E;  2LNV A;  1N9S A;  3SWN B;  1C0M A;  1MHN A;  3QUI A;  2E65 A;  2EYW A;  2DAQ A;  4M77 B;  3V8J A;  1WXB A;  6AT1 B;  2J6O A;  3ULR B;  4PLL A;  5CO7 A;  4C8Q E;  2DXC A;  3CCS Q;  3TSW A;  3CCL T;  3UA6 A;  1KQ1 A;  1VA7 A;  4M7A E;  4M75 E;  4MZM A;  5FRO A;  2FHD A;  2VVK A;  2LQN A;  2YRD A;  2OTL Q;  2PU9 B;  4J9I A;  4A4F A;  3NFC A;  5KYY A;  4BD3 A;  3MCA B;  1WIE A;  4RTY A;  4RCC A;  5LJ3 e;  4C92 A;  5GAM h;  1FWZ A;  1Y57 A;  2EW3 A;  2E12 A;  3CC2 T;  2LJ1 A;  2YXY A;  4GLK A;  2X4J A;  1KQS S;  2KGT A;  4QT7 A;  1FMK A;  2RNA A;  1R0C B;  4F7U G;  3JAM E;  4F7U F;  4HCZ A;  4JS5 A;  3DKM A;  3CPW A;  1RAB B;  3HTR A;  1UE9 A;  2J7I A;  2XI9 A;  1V29 B;  1VQ7 Q;  4AMC A;  2QEX T;  3SB2 A;  1Q82 C;  3I56 Q;  3JCM c;  2M02 A;  2IG0 A;  3I55 Q;  4X1V A;  1Q86 U;  1X2Q A;  4PJN A;  3NGP A;  2D8H A;  4RTV A;  3GBQ A;  4EDU A;  3V8K A;  2DK3 A;  2ZPI B;  1YIT T;  1LNX A;  1PRM C;  3JSC A;  2LT1 A;  1W2B P;  1M90 U;  1LVK A;  2L0A A;  1I1J A;  1QVF A;  1SSF A;  1U06 A;  2LDM A;  2BZ8 A;  2YUP A;  4RMO A;  4OML A;  2YUO A;  1U1S A;  3I9Q A;  3M0Q A;  1W6X A;  1AWO A;  3DLL A;  1NYF A;  4M78 A;  1UGR B;  1IGQ A;  2XD0 A;  3CCE Q;  2KK4 A;  3VS7 A;  1M2O A;  3JB9 J;  2EAY A;  3AT1 B;  1PG5 B;  4R56 A;  2ROT A;  3FRN A;  1CSK A;  4BI3 A;  3VS2 A;  3OSV A;  1Z9Q A;  4O6J A;  1VQK T;  3L2V A;  5GMK m;  3A8H B;  3MHX A;  2RK1 A;  3KBG A;  4OGE A;  4PL6 A;  5DM7 R;  3EG1 A;  2EKO A;  3M53 A;  3RKY A;  3RMQ A;  2H3J A;  1QLY A;  2F5T X;  3A8M B;  3MET A;  3OMC A;  3S6W A;  4Y92 A;  1ZX6 A;  5GAN f;  3BW1 A;  4CC4 B;  5GMK i;  2DO3 A;  2K2V A;  5KYX B;  1QVF P;  4B6M A;  5LJ5 h;  2CT3 A;  2DVJ A;  1R8O B;  3OYA A;  5J26 A;  3OYJ A;  1OUL A;  2NUP A;  4NL2 A;  3AHU A;  1BU1 A;  2PVO B;  4F7U A;  2A36 A;  4Q5W A;  3U23 A;  1VOM A;  3QXE B;  4WCI A;  3CCR A;  3CME A;  4JDS A;  1K8A C;  4JJD A;  2DL7 A;  3QJY A;  3G6E T;  3E2U A;  2GTO A;  1UJY A;  4KGV B;  1D1C A;  2FPD A;  1PD1 A;  4LDW A;  1QVG A;  4X34 A;  2EQI A;  3M9Q A;  1UB4 A;  2IIM A;  3OYF A;  3TCJ A;  1XJW B;  1WHK A;  2FB7 A;  4Y91 A;  4IUU A;  1MUZ A;  4R0K A;  1WQ7 A;  2DE0 X;  5GAN 8;  5D6Y A;  2EQU A;  3L2W A;  1QMC A;  3CC2 A;  1RAC B;  2RQT A;  1MMA A;  1ZUK A;  2F2X A;  4CI0 C;  3H41 A;  3QJ6 A;  1JXM A;  4AG2 C;  2JVV A;  1C1A A;  3UDC A;  2DEU A;  4OVA A;  4JJN K;  3QG1 A;  2FZG B;  2VKN A;  3M4G A;  2LC4 A;  3DLM A;  1MND A;  4F14 A;  2LQK A;  2C06 A;  2YT6 A;  1QWE A;  2HZY A;  5GAN g;  2GFA A;  2GBQ A;  1YIT A;  3MEW A;  2RI5 A;  4V2S A;  5C0M A;  2M1H A;  1I07 A;  2HQE A;  1QVG P;  3RR6 A;  2MPX C;  1Q86 R;  2LCL A;  4ELY C;  2BZY A;  4KGX B;  2OJ2 A;  2EYX A;  5CK9 A;  1K73 R;  5GAO r;  1TH7 A;  2NYS A;  1XTD A;  2DTI A;  1Y71 A;  4DA4 A;  1G5V A;  1VQ8 T;  3PMI A;  3SWN A;  4FW2 A;  1W4S A;  3OB9 A;  1MV3 A;  2DM1 A;  4FU6 A;  5GAN 2;  1J3T A;  2LJ0 A;  1M90 R;  3QII A;  4M77 A;  3SEM A;  2FVU A;  5D7U A;  4PFO A;  3MP8 A;  4E7J A;  4PJO C;  3RKW A;  1NJI C;  4HT8 A;  4ME7 A;  3CCR Q;  1RAH B;  2K3B A;  3CME Q;  2KXD A;  1WHL A;  4HT9 A;  1NPP A;  1VQK A;  5GAN j;  2ED0 A;  4E47 A;  3WVD B;  2GGR A;  2ZPF B;  4QVC A;  2J05 A;  3L2U A;  2HL5 C;  1JO8 A;  4JJC A;  3CMA T;  4KH0 B;  1ZUY A;  2MCN A;  2RQR A;  4C8Q G;  4C8Q F;  1WHM A;  1RLQ C;  4JRP A;  4M7A G;  4M75 G;  4M75 F;  1FXX A;  2LX7 A;  1H92 A;  2KAF A;  4ZGE B;  4PJO B;  1KD1 C;  4J6W A;  3JCM f;  3OYL A;  3A8G B;  3CC2 Q;  2MIO A;  2M0Y A;  3CCV T;  2FL7 A;  1M1K U;  2QQR A;  1E7O A;  1CKB A;  3LGL A;  1VIF A;  4ESR A;  5GAM e;  5EG2 A;  4JZ4 A;  2KSS A;  4XTU A;  1S72 T;  4FYV B;  2O2O A;  4QQD A;  2EQJ A;  4JLG A;  2D1X A;  4J6Y A;  1V1C A;  3G6E A;  1VQ7 T;  2ECZ A;  5GMK j;  1H8K A;  2BE7 D;  4NS5 A;  4N4I A;  2QTV A;  1PWT A;  3PMT A;  1YIT Q;  1AVZ C;  4D8D A;  5I21 A;  2DEQ A;  5GJW B;  5GAO l;  5GAN 6;  2LVM A;  2D9T A;  1WHJ A;  5HK3 A;  2K4Y A;  2EVR A;  1LOJ A;  3CEY A;  3HSB A;  1TUC A;  2RQW A;  5KE3 A;  1ZBJ A;  5IN1 A;  1TWB A;  3A5Z B;  4OMQ A;  4HCC A;  3M4Y A;  4CC3 A;  5D6X A;  2H3E B;  2RD1 A;  3O5Z A;  1VQK Q;  2FEI A;  1W2B S;  4ORZ A;  2YLC A;  2JT4 A;  1D1A A;  3QSU A;  2ED1 A;  4HXJ A;  3VRZ A;  2SRC A;  5GAN 7;  3VS0 A;  5CKH A;  2HD0 A;  1LCK A;  4C8Q A;  2RN8 A;  1GCQ C;  3CCM T;  4M7A A;  4KUL A;  4M75 A;  1OX9 A;  3LYI A;  4PFZ A;  1Q81 U;  1VQ8 A;  4M77 E;  1X75 C;  2WSE E;  3FIF A;  4II1 A;  4RG8 A;  1NE8 A;  1BCM A;  2HQH A;  3FEO A;  4XK8 E;  1AT1 B;  5LJ5 e;  2G3R A;  3Q1J A;  4PJM A;  4GLM A;  2ABL A;  1GXI E;  2OX7 A;  2HBP A;  5M9O A;  1NG2 A;  5LJ3 g;  3G71 A;  3P8B B;  3G6E Q;  4J6X A;  2JM9 A;  2X35 A;  1PRL C;  4DBF A;  4ANJ A;  2AKL A;  5DLO A;  1WX6 A;  3EHR A;  1QVF S;  1E6H A;  2YUQ A;  3VS3 A;  5FU7 C;  1BK2 A;  1H64 1;  2E64 A;  1M9S A;  3CMA A;  4CC7 A;  4HKE A;  2P0Q A;  4CC2 A;  1GRI A;  4ZGD B;  1TOV A;  1KC8 C;  1BKB A;  1G3W A;  1FX7 A;  1M3C A;  2YHT A;  3EG2 A;  3G1J A;  1WPY A;  2WSC E;  3M55 A;  1T3S A;  2EJG A;  3H9N A;  3CCV A;  1WZO A;  2PNI A;  1NEG A;  2RQU A;  1AOJ A;  3G4S T;  3CC7 T;  2XDB A;  3QPH A;  3OYH A;  2JS2 A;  5CKF A;  1FMW A;  5KYU A;  1BYM A;  5LJ3 j;  1VQL T;  1Y0M A;  1S72 A;  5FU7 B;  2DZC A;  2DD4 A;  2VXE A;  4LDY A;  3M0S A;  3SHW A;  4XAX B;  3UWN A;  1GBR A;  2BKD N;  2V1R A;  2X51 A;  1VQ7 A;  2KXC A;  4Z89 A;  1YCS B;  1RUW A;  1WI7 A;  1ZA1 B;  2RQV A;  3EH2 A;  2ZGW A;  3TVT A;  1M3B A;  4LD6 A;  2D0N A;  4LXC A;  3FLG A;  2Y4Y A;  4NOY A;  3PFS A;  5GAN 4;  5CIU A;  1ZLM A;  3L2Q A;  4C5I A;  2CZ1 B;  2CKK A;  1VQ8 Q;  5I22 A;  4E7L A;  4M7D C;  1UGQ B;  4J83 A;  2OAU A;  1ZSZ A;  3V7C A;  2BUD A;  3VUB A;  1P92 A;  1NYG A;  4N0A A;  2A28 A;  1UFF A;  2ROL A;  2P4T A;  3GP8 A;  1D3B B;  2NLU A;  1QVG S;  3G71 Q;  1N8R C;  1X6O A;  1OZ3 A;  1PM3 A;  2PUK B;  4BDY A;  2CP5 A;  2JN0 A;  1PCX A;  3X25 B;  1G3Y A;  3CMA Q;  3GNF B;  2PZ1 A;  4M7D B;  2A0F B;  3UPU A;  2RI2 A;  4J9C A;  2LP5 A;  2HNI A;  3CCM A;  3ME9 A;  3F70 A;  4EMK A;  2D6F A;  1YJN A;  1UG1 A;  3CCV Q;  1SG5 A;  2FO0 A;  2E70 A;  1K9M C;  2JNG A;  1OZ2 A;  2MYS A;  4BI8 B;  3RKX A;  1YWP A;  1S72 Q;  1G3S A;  2JM8 A;  1Q81 R;  1Y07 A;  3BE3 A;  1M1K C;  1HXD A;  2KT8 A;  2CZ0 B;  4C5H A;  3P8D A;  4XTX A;  2O4X B;  2P0P A;  2LCS A;  2L3R A;  4IUV A;  1FMV A;  1UEC A;  2O9S A;  5KYW A;  4O5V A;  1Y7X A;  5I2S A;  2EFI A;  2DL8 A;  1VQ4 T;  5GJV B;  1KIK A;  1ZQ1 A;  1K73 U;  4FM4 B;  3TEE A;  2YLB A;  3OMG A;  1BI1 A;  4BE1 A;  1SF9 A;  2LT4 A;  2XIC A;  3LX7 A;  3PT9 A;  2GNC A;  3OYG A;  2X4W A;  1X01 A;  3MP6 A;  2KRS A;  3CBP A;  1M8M A;  1OV3 A;  4F17 A;  2W10 A;  1QWF A;  5GAM f;  3OS5 A;  1Y96 B;  2E6Z A;  1AWW A;  1IO6 A;  2M9U A;  1KG1 A;  3G4S A;  3CC7 A;  3J7A F;  2AHJ B;  4FIB A;  2AT1 B;  2A37 A;  3EAE A;  3R6O A;  2NUZ A;  1VQL A;  2QGG A;  3S3O A;  1O9S A;  3QDR B;  1KJW A;  2QQB A;  3PTA A;  1WJQ A;  1YCY A;  1K0S A;  3CPW P;  2DYB A;  4JLI A;  2RHX A;  4RKU E;  5FU6 C;  5EC7 A;  4OMM A;  4K11 A;  2VC8 A;  2QG9 B;  3EGX B;  3GPL A;  4QW2 A;  4E6R A;  4ZNX A;  2FYK A;  3WVE B;  4ZN1 A;  3EG9 A;  4HCB A;  1PSE A;  5GAO p;  1DJ7 B;  2CP2 A;  4FYY B;  2JW4 A;  2EGC A;  3VV0 A;  4DQ2 A;  2JTE A;  3CCM Q;  3HFO A;  3EFR A;  1T3L A;  3QYH B;  1B7T A;  5A0L A;  1YJN Q;  1X2K A;  5KCO A;  5GAN d;  2XDD A;  2KRO A;  1N27 A;  5HY6 A;  4PJO D;  2XG8 D;  3TSZ A;  4OGC A;  3LWI A;  2CP0 A;  2VAS A;  1WJS A;  1GCQ A;  3RNJ A;  4M77 G;  1KFZ A;  4M77 F;  2O88 A;  2RJC A;  2L3P A;  4LN2 A;  5FU6 B;  1PC0 A;  1BI0 A;  3TRE A;  1VQ5 Q;  4RUG A;  2ZZD A;  1RI9 A;  4L6V 5;  2GQV A;  3OYB A;  3QZ9 B;  2CGH A;  1Q7Y U;  1D0X A;  2JXB A;  3C12 A;  4PJO E;  1NZ9 A;  3JB9 D;  2I2L A;  3HRU A;  5GAN 5;  4FT2 A;  5GAM g;  2LRQ A;  1M30 A;  1T0J A;  4IUT A;  3NMZ C;  1RAA B;  4B9W A;  1KQ2 A;  5GAO m;  1NJI R;  1WGS A;  4JRI A;  3JRZ A;  1WJR A;  1QCO A;  4NL3 A;  1RAE B;  1YI2 A;  1GFC A;  1D1B A;  3RES A;  5DLQ E;  2RI3 A;  3QWX X;  4ZTF A;  2LCC A;  5LJ5 f;  1F1B B;  3M0T A;  4OMO A;  3G4S Q;  3CC7 Q;  4MML A;  3QZ5 B;  4E7I A;  3OYY A;  1VQL Q;  1U3O A;  3LH0 A;  1OQK A;  2P0K A;  1WA7 A;  3NTI A;  3OS2 A;  3EHQ A;  3V8L A;  1G3T A;  5L23 A;  4EMH A;  2LNH B;  3EGD A;  2X3W D;  5IHI A;  4XU2 A;  4C0D C;  2CUB A;  5GAM j;  5FRN A;  2DZ9 A;  4EMG A;  1SHG A;  2PQW A;  2L3Q A;  1T0H A;  1VQ4 A;  3VUZ A;  4PK4 A;  1X43 A;  3M57 A;  2QYZ A;  3VU3 C;  2CH4 W;  1TTH B;  3MP1 A;  1X69 A;  1N9R A;  2DXU A;  4CRI A;  2E5Q A;  4ZTJ A;  1TUG B;  1TU0 B;  2VXF A;  2V8J A;  4DBH A;  1Q95 G;  1HSQ A;  1V76 A;  1WHG A;  3EFO B;  1QQJ A;  1NPR A;  2HL3 A;  3MEV A;  4C0D B;  3OYK A;  2G6F X;  1MMD A;  2E4H A;  2PTK A;  5AT1 B;  4A63 B;  4RTZ A;  1KSW A;  5GAO q;  4F04 B;  4JPB W;  3O8V A;  3CCU T;  1KHI A;  3G71 T;  4OMN A;  5CVI A;  2VWF A;  5GAN 3;  2EYQ A;  4Z02 A;  3ZFJ A;  3MEU A;  4J9G A;  2AKK A;  3FDR A;  5LJ5 g;  4XQ3 A;  2RMO A;  1JRI A;  4RG2 A;  4FL6 A;  2JZ2 A;  2A7Y A;  3UAT A;  2QAS A;  1TSF A;  2QI2 A;  1K0X A;  4AFZ C;  5IHK A;  5J3B A;  3VS5 A;  3HRS A;  1YI2 Q;  4M7A F;  4J8O A;  4D6W A;  4A53 A;  1YJW T;  1SRL A;  1ZBX A;  2DD5 A;  3CCQ A;  2HBW A;  5GMK l;  1QW1 A;  3JCM d;  2EBP A;  2NUT B;  1QCN A;  4C92 C;  4A4G A;  1WLP B;  1B34 B;  1WDX A;  2GFU A;  4JZ3 A;  3M0P A;  4BB7 A;  2MWO A;  3MJX A;  1EIF A;  4M4Z A;  4E7Z A;  2R58 A;  1SKU B;  2Z0W A;  1UGP B;  1I4K 1;  2L8D A;  5LJ5 j;  2YSQ A;  1VQ4 Q;  2DIQ A;  2M16 A;  1Y96 A;  1I5L A;  1X27 A;  2EYZ A;  2K3Y A;  1Q82 U;  2DLP A;  1Q7Y R;  5KYY B;  1EZZ B;  2DKG A;  3X24 B;  1Q86 C;  5LJ3 f;  5LJ3 d;  1QCF A;  4C92 B;  3JCM W;  4KH1 B;  1UGS B;  4X9D A;  3BFM A;  1RI0 A;  2PVG B;  3MO8 A;  3JB9 H;  3L2R A;  1UUE A;  1M90 C;  4GBQ A;  1WXU A;  1UEB A;  3FJ5 A;  1YIJ T;  2QQ9 A;  4M78 C;  2QDY B;  4C5E A;  2CH4 A;  2ZPE B;  1JU5 C;  3J80 E;  4KBM B;  2K5I A;  3CQT A;  1B07 A;  3LW5 E;  7AT1 B;  4JS4 A;  3R6N A;  1VQ6 A;  4MDW A;  3T9N A;  4QVD A;  4AT1 B;  4DBR A;  2JMC A;  2E6N A;  4DEX A;  5GAN e;  5KYX A;  1VQM A;  3N5B B;  1WNL A;  3RDV A;  4WTO B;  5C6S A;  2MF2 A;  3CBM A;  3GLX A;  4M7D D;  2KYB A;  4XTW A;  2QDL A;  3VS6 A;  3MPU B;  4PKC C;  4M78 B;  3CCQ Q;  4KGZ B;  3PE0 A;  1OX8 A;  3CPW S;  2CSQ A;  1YJN T;  2AIR B;  3JB9 I;  2CS7 A;  1D0Y A;  5FRM A;  3A98 A;  1YBY A;  2VV5 A;  2KE9 A;  3PIO A;  1G83 A;  3VRY A;  4E7H A;  2K5L A;  4M7D E;  2EQK A;  2ATC B;  1VQ5 T;  1BCO A;  3I5R A;  3OY9 A;  2EGE A;  2HSP A;  3CCU A;  4N4G A;  3GNG A;  3OS1 A;  3X26 B;  2MAM A;  4AFS C;  3CD6 T;  2E3H A;  4J5Y A;  1H3Z A;  2LQW A;  4PJO G;  3JCM V;  4PJO F;  3VYG A;  1K8A U;  1JJ2 A;  5GMK e;  1BBZ A;  2LTO A;  4WF2 A;  2YRV A;  4LE9 A;  1YJ9 T;  2K79 A;  3HRT A;  3RBB B;  3CCJ T;  2P84 A;  4XU0 A;  3A8O B;  2DBM A;  2ZAE A;  1YJW A;  1KK7 A;  2P4R A;  3D7S B;  1WFW A;  3M0R A;  1IB8 A;  2EGA A;  3L2Z A;  3VS4 A;  4LD9 K;  1PHT A;  2NUP B;  2BTT A;  4F7U B;  1MGQ A;  1TG0 A;  1W1F A;  2IPO B;  4HCK A;  4B9X A;  1WQW A;  3HFN A;  2CT4 A;  1M2V B;  1E6G A;  3RIR A;  4PJJ A;  1OU8 A;  2DL4 A;  2KNB B;  5IHN A;  2DF6 A;  3UF4 A;  3RUX A;  1VQ6 Q;  1ZUU A;  1UHC A;  1VQM Q;  1B3Q A;  1LJO A;  2JMA A;  2JTF A;  2FG0 A;  3EFO A;  1JJ2 P;  1UGV A;  2A08 A;  2QQS A;  2V26 A;  4A4K A;  3M5A A;  1ABQ A;  2RHI A;  1Q82 R;  3EG3 A;  2RJE A;  2XID A;  3OYD A;  4KUI A;  3LWH A;  3CPF A;  5FW9 A;  4FSS A;  2I0N A;  4LDU A;  2V8I A;  4C0F A;  1JEG A;  3NTH A;  2DJZ A;  1U5S A;  1UJ0 A;  2RB6 A;  4F16 A;  2ESW A;  1YIJ A;  3SWN C;  2DTO A;  2W0Z A;  1OU9 A;  2E1H A;  3BDL A;  1EFN A;  2YRC A;  2CP3 A;  3CBO A;  4HA8 A;  2CYZ B;  4PFP A;  4J9F A;  3CCU Q;  4J9H A;  4XTZ A;  1QKX A;  2K57 A;  3JCM P;  4LDV A;  1D0Z A;  3KXT A;  3HPW A;  1RAF B;  1YN8 A;  1Z9Z A;  3ZEH A;  4UC4 A;  1NJI U;  2KBT A;  3DB3 A;  1PKT A;  4PJO A;  2QAZ A;  5CR2 A;  2HMA A;  3URG A;  2BZX A;  3JCM e;  2MWP A;  1G8X A;  4ZN3 A;  3OYM A;  2VGM A;  1B34 A;  3PGG A;  8AT1 B;  4QQG A;  2EIF A;  3JCM b;  2LMJ A;  5J39 A;  1YJW Q;  3JCM J;  1O75 A;  2O9V A;  2K5F A;  3OYC A;  3OYE A;  1YI2 T;  3E1S A;  2F2V A;  3E19 A;  4HVW A;  1GL5 A;  3ASK A;  4MDX A;  5LL6 S;  4JJB A;  4KT0 E;  2ZCF B;  3EH1 A;  2FPF A;  5HK0 A;  1KD1 U;  1QKW A;  1W2B A;  4IIM A;  1OOT A;  4DEY A;  1FYN A;  3JCM Q;  1VQ5 A;  2DFU A;  1VQ9 T;  2EJ9 A;  2FZK B;  3V7R A;  4KUD K;  2IVW A;  3OS0 A;  2Y90 A;  3E9F A;  3CD6 A;  4EPC A;  4R55 A;  3M58 A;  3BDU A;  4L5G A;  1ZA2 B;  3BY7 A;  2RK2 A;  1MNE A;  5GAO n;  3A1P A;  2Y4X A;  2KDS A;  5IXB A;  1RLP C;  3UA7 A;  2D8J A;  2RA2 A;  1S1N A;  2COY A;  1VQP T;  3QHS A;  5IH2 A;  1YJ9 A;  3C94 A;  1JB0 E;  2J6K A;  4JUV A;  3CCJ A;  3JCM X;  2WAC A;  1VYV A;  1K8A R;  4TVR A;  1HK9 A;  1M1G A;  4FYX B;  8ATC B;  2DIG A;  5GAM d;  2XHC A;  1OYX A;  5I11 A;  2L2P A;  1YIJ Q;  2EQM A;  1RL2 A;  5HCK A;  2CZ6 B;  2DL5 A;  4QVZ A;  1RAI B;  1VQO T;  2LQ8 A;  2CSI A;  2L89 A;  1IHV A;  2ZPH B;  2KVQ G;  1GCP A;  2YDL A;  5GAN h;  4D8K A;  2PVD B;  2KQW A;  5A0D A;  5CKE A;  2RJF A;  4C0G A;  4BE2 A;  2D0Q B;  2RHU A;  1IZ6 A;  2JUF A;  1K9A A;  4A4E A;  3M56 A;  3H0F A;  3QBY A;  4C8Q C;  1TUD A;  2ZPB B;  1XQH A;  1X6G A;  1IRE B;  1UHF A;  3CCQ T;  4M7A C;  1U8R A;  4M75 C;  3ER0 A;  5KH6 A;  1BIB A;  4J9B A;  4MZT A;  1TXQ A;  4DOV A;  1IHW A;  2DXT A;  2MMP A;  1YHQ T;  2DNU A;  3TU4 K;  2J6F A;  2AK5 A;  1Q81 C;  4BI4 A;  4M7D G;  2F1L A;  2RHY A;  4E7S A;  4M7D F;  5AYF A;  3OA6 A;  2QXF A;  1BIA A;  3CD6 Q;  1WHH A;  4RTX A;  1VIE A;  2KRN A;  4IUP A;  1GBQ A;  5GMK h;  3OW2 A;  1QP3 A;  3VJP A;  2DX1 A;  4C8Q B;  3WXM B;  4XU1 A;  2VB6 A;  2LZ6 B;  3L1A A;  1AEY A;  3CXC A;  1YJ9 Q;  4M7A B;  3EGU A;  4M75 B;  1KHC A;  4RTU A;  3CCJ Q;  2DPP B;  2DJQ A;  2JS0 A;  2VUB A;  3CC4 T;  1HYO A;  1M2V A;  2V1Q A;  1IGU A;  4C92 D;  3RER A;  3C0C A;  1KC8 U;  5LJ5 d;  4PLI A;  2XDP A;  5A0G A;  3CCL A;  2X3X D;  3FJP A;  3HP9 A;  4XTV A;  2CZ7 B;  4E7K A;  2HSE B;  2DA9 A;  1PD0 A;  2HKN A;  4Z8A A;  4MMK A;  1VQ9 A;  2DRK A;  2F5K A;  2M51 A;  3H0I A;  3VYH B;  4C92 E;  4L59 A;  2F69 A;  1I0C A;  2VYT A;  1KD1 R;  1PNJ A;  3EG0 A;  4ELZ C;  1C6V X;  2GF7 A;  2OTJ T;  1VQ6 T;  2X4Y A;  3A8L B;  4XU3 A;  3OW2 P;  1MV0 B;  2FRW A;  1VQP A;  1IXD A;  3J81 E;  5HKC A;  2B8A A;  4BDZ A;  1AZG B;  1VQM T;  2YWW A;  4IKF A;  3CXC P;  1VQN T;  1M4Z A;  1VYT A;  2BE9 B;  3PNW C;  1RAG B;  2QEX A;  1X6B A;  4A4H A;  3VKI A;  3X28 B;  1D3B A;  4LNP A;  4OB1 B;  2EKH A;  1G2B A;  4M78 D;  1KQS A;  4J7I A;  4DOW A;  5KYU B;  4C5G A;  2FRY A;  2L3S A;  4RCB A;  1ARK A;  2XU8 A;  2SEM A;  1ZSZ C;  3SDZ A;  2R57 A;  3REA B;  4X9C A;  3GIB A;  1JJ2 S;  1BI3 A;  3ZBD A;  4E2F B;  1VQO A;  4Y28 E;  4N0A C;  1PKS A;  3LGF A;  4M7D A;  2OAW A;  1K1Z A;  4M78 E;  4OB2 B;  3HHT B;  1JXO A;  2COW A;  4KRT A;  2GTJ A;  3PVQ A;  3JCM h;  2KMT A;  2RH2 A;  3QDF A;  2QA4 T;  1WXT A;  1N8R U;  2DBK A;  1SHF A;  1YWO A;  4BAC A;  2E5K A;  2X9H A;  1U1T A;  3PVL A;  4LUE A;  4VUB A;  1N6A A;  2R5M A; 
#chains in the Genus database with same CATH homology
 4YTL A;  2WSF E;  5LJ5 h;  3GNF B;  1VQ5 T;  4M7D B;  2MI6 A;  1R8O B;  2DTH A;  3OY9 A;  3CCU A;  4OB0 B;  2O01 E;  4N4G A;  3UPU A;  3GNG A;  3OS1 A;  3X26 B;  2RI2 A;  3OYA A;  2MAM A;  5J26 A;  3OYJ A;  1QVP A;  3V7S A;  3CD6 T;  2O4X A;  2HNI A;  3CCM A;  4NL2 A;  4EMK C;  3AHU A;  3ME9 A;  4J5Y A;  2PVO B;  1H3Z A;  4F7U A;  4Q5W A;  1YHQ A;  3QYG B;  3CCS T;  3F70 A;  4EMK A;  4PJO G;  3QXE B;  3JCM V;  2D6F A;  4PJO F;  3VYG A;  3MEA A;  3CCR A;  1YJN A;  3CME A;  1K8A U;  4JDS A;  3QKJ A;  1JJ2 A;  1K8A C;  2DVE A;  5LJ3 h;  3G7Z A;  5GMK e;  2LTO A;  3QJY A;  4WF2 A;  3G6E T;  1K9M U;  2OTL T;  2E70 A;  2YRV A;  4QQ6 A;  1K9M C;  2JNG A;  1OZ2 A;  1YJ9 T;  4A54 A;  3HRT A;  4BI8 B;  2EJF A;  3RKX A;  2DXB A;  3CCJ T;  5DY9 A;  1VQ8 A;  4XU0 A;  1G3S A;  3A8O B;  1Y07 A;  4FSX A;  4LDW A;  1YJW A;  1QVG A;  4X34 A;  1M1K C;  3GIB A;  3S3M A;  2QQA A;  1HXD A;  2RHZ A;  3L2Z A;  2CZ0 B;  3M9Q A;  4F7U E;  4LD9 K;  1UB4 A;  3INZ A;  4C5H A;  3OYF A;  3P8D A;  4XTX A;  3TCJ A;  2O4X B;  1AHJ B;  2P0P A;  3SD4 A;  4F7U B;  5CCA A;  2L3R A;  1MGQ A;  4IUV A;  2FB7 A;  4Y91 A;  4O5V A;  4BUG A;  4EMK B;  4B9X A;  4IUU A;  1Y7X A;  5I2S A;  1WQW A;  2EFI A;  1VQ4 T;  3CC4 A;  1WQ7 A;  1XNI A;  5GAN 8;  5D6Y A;  3HFN A;  2EQU A;  1ZQ1 A;  3H6Z A;  3L2W A;  3QO3 A;  4FM4 B;  3RIR A;  1K73 U;  3TEE A;  1K73 C;  3CC2 A;  2YLB A;  3I56 T;  3OMG A;  1BI1 A;  4BE1 A;  3L42 A;  2LT4 A;  2XIC A;  3LX7 A;  3PT9 A;  3OYG A;  3I55 T;  2X4W A;  4CI0 C;  1X01 A;  2M0O A;  3MP6 A;  3CBP A;  3QJ6 A;  2QTX A;  3RUX A;  2KY9 A;  2JVV A;  2GCX A;  4OP0 A;  3UDC A;  5GAM f;  3OS5 A;  3M54 A;  1Y96 B;  2E6Z A;  3OSS C;  4OVA A;  4JJN K;  3QG1 A;  2M9U A;  1LJO A;  2L5Q A;  2JTF A;  3M4G A;  2LC4 A;  1KG1 A;  3DLM A;  3G4S A;  3CC7 A;  3J7A F;  2AHJ B;  2XKO C;  4FIB A;  2E41 A;  3EAE A;  2QQS A;  2LQK A;  5CKB A;  3OYI A;  2C06 A;  5GAN g;  2GFA A;  2K3X A;  4A4K A;  3M59 A;  3M5A A;  3R6O A;  5IT9 E;  1VQL A;  3HKS A;  2RHI A;  3S3O A;  2OTJ A;  1O9S A;  3QDR B;  1YIT A;  2RJE A;  2RI5 A;  3MEW A;  4LDX A;  2XID A;  5C0M A;  2M1H A;  2QQB A;  4V2S A;  3OYD A;  1WJQ A;  2HQE A;  4KUI A;  3PTA A;  3LWH A;  3CCE T;  3CPF A;  2LCL A;  1YCY A;  5D6W A;  4ELY C;  4LDU A;  2V8I A;  1I81 A;  4C0F A;  4JLI A;  3NTH A;  2DJZ A;  2RHX A;  1BI2 A;  4RKU E;  5FU6 C;  3SFM A;  2RB6 A;  5CK9 A;  4GY5 A;  1VQN A;  2VC8 A;  1YIJ A;  5GAO r;  1TH7 A;  3SWN C;  1XTD A;  2DTO A;  2DTI A;  4PNO A;  2E1H A;  4QW2 A;  1Y71 A;  3GPL A;  3BDL A;  4DA4 A;  1VQ8 T;  2FYK A;  3H8Z A;  3WVE B;  4ZN1 A;  1G5V A;  3UT1 A;  3PMI A;  3SWN A;  4HCB A;  3CBO A;  4HA8 A;  2CYZ B;  1PSE A;  1W4S A;  3OB9 A;  4XTZ A;  1DJ7 B;  3C95 A;  4FU6 A;  5GAN 2;  5GAO p;  2K57 A;  3VV0 A;  3QII A;  4M77 A;  3JCM P;  4LDV A;  4DQ2 A;  3HFO A;  3JCM g;  3EFR A;  3QYH B;  2XK0 A;  3HPW A;  3KXT A;  2FVU A;  4M77 D;  3ZEH A;  5A0L A;  4UC4 A;  3MP8 A;  4E7J A;  1NJI U;  4PJO C;  3GOX A;  2HQX A;  3RKW A;  1NJI C;  4HT8 A;  4ME7 A;  3DB3 A;  5KCO A;  3X20 B;  4PJO A;  3KUF A;  5GAN d;  5CR2 A;  2XDD A;  3URG A;  4HT9 A;  3JCM e;  1NPP A;  2VGN A;  5CAI A;  2MWP A;  5HY6 A;  1N27 A;  1VQK A;  4ATO A;  2XG8 D;  4PJO D;  5GAN j;  4OGC A;  3LWI A;  4E47 A;  4ZN3 A;  1WJS A;  2RO0 A;  3OYM A;  4M77 G;  3WVD B;  2VGM A;  4M77 F;  1B34 A;  5AYF A;  2RJC A;  3PGG A;  2ZPF B;  2EIF A;  4QQG A;  4IUQ A;  1BI0 A;  1M5Q 1;  5FU6 B;  3TRE A;  4QVC A;  3L2U A;  3JCM b;  2ZZD A;  5J39 A;  2QA4 A;  4L6V 5;  3JCM J;  3OBY A;  2RJD A;  1O75 A;  1XOV A;  2K5F A;  2GQV A;  3OYC A;  3OYE A;  3CMA T;  1YI2 T;  3OYB A;  3E1S A;  4C8Q G;  1I8F A;  3QZ9 B;  3E19 A;  4C8Q F;  2CGH A;  1Q7Y U;  1Q7Y C;  3C12 A;  3S3N A;  4JRP A;  4PJO E;  4M7A G;  3ASK A;  4MDX A;  1NZ9 A;  5LL6 S;  3JB9 D;  4M75 G;  4M75 F;  2I2L A;  1FXX A;  4KT0 E;  3HRU A;  5GAN 5;  2KAF A;  2ZCF B;  4FT2 A;  4FT4 A;  4ZGE B;  5HK0 A;  1KD1 U;  4PJO B;  5GAM g;  1KD1 C;  4J6W A;  3JCM f;  1W2B A;  3OYL A;  2LRQ A;  4IUT A;  3JCM Q;  4B9W A;  3A8G B;  1VQ5 A;  4OF1 A;  3CCV T;  2FL7 A;  1VQ9 T;  2EJ9 A;  1PSF A;  2QQR A;  3V7R A;  5GAO m;  1M1K U;  2IVW A;  4KUD K;  1KQ2 A;  3OS0 A;  2A3L A;  1WGS A;  2Y90 A;  3LGL A;  3JB9 G;  1VIF A;  4JRI A;  3JRZ A;  3E9F A;  5GAM e;  5CQY A;  3CD6 A;  3JB9 F;  2BIV A;  5EG2 A;  1WJR A;  4EPC A;  4R55 A;  3M58 A;  3BDU A;  4L5G A;  3OYN A;  4NL3 A;  2KSS A;  3BY7 A;  2EWN A;  2RK2 A;  4XTU A;  5GAO n;  3CCS A;  1YI2 A;  2Y4X A;  1S72 T;  4QQD A;  2KDS A;  3OQ5 A;  2EQJ A;  4JRK A;  3RES A;  5KE2 A;  4JRQ A;  5DLQ E;  2RI3 A;  4JLG A;  2PUO B;  2RA2 A;  2LCC A;  5I2M A;  5LJ5 f;  4ZTF A;  3GF5 A;  4J6Y A;  3FC3 A;  1VQP T;  3QHS A;  4MZP A;  2E10 A;  3G6E A;  2OTL A;  1YJ9 A;  1VQ7 T;  4MML A;  3QZ5 B;  4E7I A;  1ZHI A;  5GMK j;  3OYY A;  1JBM A;  3C94 A;  3P8H A;  1JB0 E;  4JUV A;  2HAX A;  3DB4 A;  4C92 G;  3JCM X;  4NS5 A;  4N4I A;  3CCJ A;  2WAC A;  4C92 F;  3LH0 A;  2JTM A;  3PMT A;  2P0K A;  3OS2 A;  3NTI A;  1M1F A;  4TVR A;  2RM4 A;  1HK9 A;  1M1G A;  1G3T A;  3V8L A;  4EMH A;  5I21 A;  4IUR A;  2DEQ A;  2DIG A;  5GAM d;  4XU2 A;  5GAO l;  2XHC A;  5GAN 6;  4C0D C;  2LVM A;  1OYX A;  2D9T A;  5GAM j;  5FRN A;  2DZ9 A;  4EMG A;  1QP2 A;  2PQW A;  2EQM A;  1RL2 A;  5HK3 A;  1VQ4 A;  2K4Y A;  5L8R E;  3VUZ A;  5CKD A;  1LOJ A;  2CZ6 B;  3CEY A;  3RMS A;  4QVZ A;  3HSB A;  3PIP A;  3M57 A;  1VQO T;  2LQ8 A;  5KE3 A;  3VU3 C;  3I56 A;  3EFS A;  2L89 A;  5IN1 A;  3A5Z B;  3I55 A;  2ZPH B;  3MP1 A;  4HCC A;  4BY6 C;  1N9R A;  2KVQ G;  4XTY A;  2DXU A;  3HL8 A;  4OB3 B;  3E9G A;  3NTK A;  4P5N A;  4CRI A;  2E5Q A;  3FB9 A;  5GAN h;  3M4Y A;  4ZTJ A;  4OMF B;  2VXF A;  3OW2 S;  5D6X A;  2PVD B;  2RD1 A;  2KQW A;  2V8J A;  5A0D A;  1W2B S;  2R5A A;  5CKE A;  3CXC S;  2YLC A;  4M77 C;  2RJF A;  2ZPG B;  1NPR A;  3LLR A;  4C0G A;  4BE2 A;  3OBW A;  3MEV A;  4C0D B;  2D0Q B;  3OYK A;  4ZGJ B;  3QSU A;  2RHU A;  5IAY A;  1IZ6 A;  2JUF A;  2LX9 A;  5CQX A;  5A2Q E;  4A4E A;  4C0Z A;  3M56 A;  5GAO q;  5GAN 7;  3QBY A;  4M78 G;  2JOY A;  5CKH A;  4C8Q C;  4M78 F;  1OI1 A;  1VUB A;  2ZPB B;  2HD0 A;  1XQH A;  3O8V A;  1IRE B;  1KHI A;  4N4H A;  3CCU T;  3CCQ T;  4C8Q A;  3CCE A;  4BE0 A;  4M7A C;  1U8R A;  4M75 C;  3ER0 A;  5KH6 A;  3G71 T;  1M8V A;  5CVI A;  1BIB A;  4MZT A;  4C8Q D;  3CCM T;  4DOV A;  4BY6 B;  4M7A A;  5GAN 3;  2EYQ A;  2DXT A;  4KUL A;  4M75 A;  3MEU A;  4Z02 A;  3C4S A;  3ZFJ A;  4J7F A;  2MMP A;  1YHQ T;  3LYI A;  4M7A D;  3TU4 K;  4M75 D;  3FDR A;  2X4X A;  5KCH A;  4M77 E;  5LJ5 g;  3CME T;  2V8K A;  4BI4 A;  3CCR T;  1Q81 C;  1X75 C;  5FLX E;  2LNV A;  1N9S A;  2WSE E;  3FIF A;  3SWN B;  4M7D G;  2RHY A;  4XQ3 A;  4M7D F;  1MHN A;  1JRI A;  3QUI A;  4II1 A;  4FL6 A;  2JZ2 A;  4RG2 A;  4RG8 A;  1NE8 A;  2E65 A;  2A7Y A;  2QXF A;  3OA6 A;  2DAQ A;  1BIA A;  4M77 B;  3V8J A;  1VIE A;  3FEO A;  2QI2 A;  4IUP A;  4XK8 E;  4PLL A;  5CO7 A;  5LJ5 e;  2G3R A;  3Q1J A;  2DXC A;  5J3B A;  4C8Q E;  3HRS A;  4M7A F;  4J8O A;  4D6W A;  4A53 A;  1QP3 A;  5GMK h;  3CCL T;  3OW2 A;  1GXI E;  3VJP A;  1KQ1 A;  1ZBX A;  1YJW T;  4M7A E;  2DD5 A;  3CCQ A;  4M75 E;  2HBP A;  4MZM A;  4C8Q B;  5M9O A;  5GMK l;  5FRO A;  3WXM B;  1QW1 A;  5LJ3 g;  3P8B B;  2FHD A;  4XU1 A;  3L1A A;  3JCM d;  3G71 A;  3CXC A;  2PU9 B;  4A4F A;  4J6X A;  2X35 A;  3NFC A;  4M7A B;  4M75 B;  4BD3 A;  5DLO A;  1KHC A;  4C92 C;  4A4G A;  3MCA B;  1B34 B;  4RCC A;  2DPP B;  1QVF S;  2GFU A;  5LJ3 e;  5FU7 C;  2VUB A;  4C92 A;  3CC4 T;  5GAM h;  1H64 1;  2E64 A;  1FWZ A;  1M9S A;  4BB7 A;  2MWO A;  2E12 A;  3CMA A;  4C92 D;  3RER A;  1EIF A;  4HKE A;  3CC2 T;  2P0Q A;  4GLK A;  2X4J A;  1KC8 U;  1KQS S;  5LJ5 d;  4ZGD B;  1KC8 C;  2R58 A;  1BKB A;  4PLI A;  1G3W A;  2XDP A;  1FX7 A;  1UGP B;  4F7U G;  3JAM E;  1I4K 1;  5A0G A;  2L8D A;  2YHT A;  4F7U F;  3FJP A;  4HCZ A;  5LJ5 j;  3CCL A;  3HP9 A;  4XTV A;  2DIQ A;  2M16 A;  2CZ7 B;  4E7K A;  4JS5 A;  1Y96 A;  3DKM A;  3CPW A;  1WPY A;  2WSC E;  1I5L A;  2XI9 A;  3M55 A;  2K3Y A;  1Q82 U;  1V29 B;  1Q82 C;  2QEX T;  2EJG A;  4MMK A;  3SB2 A;  3CCV A;  1VQ9 A;  2F5K A;  3JCM c;  3VYH B;  4C92 E;  3G4S T;  3CC7 T;  2IG0 A;  2XDB A;  1Q86 U;  2DKG A;  4L59 A;  3X24 B;  1Q86 C;  5LJ3 f;  3QPH A;  5LJ3 d;  2F69 A;  3OYH A;  2VYT A;  5CKF A;  4C92 B;  3JCM W;  1BYM A;  4ELZ C;  5LJ3 j;  1UGS B;  4X9D A;  1VQL T;  4EDU A;  3BFM A;  1S72 A;  1RI0 A;  2GF7 A;  3V8K A;  5FU7 B;  2DK3 A;  2PVG B;  3MO8 A;  2DZC A;  2DD4 A;  2VXE A;  2ZPI B;  1Q81 U;  1VQ6 T;  4LDY A;  1YIT T;  3JB9 H;  2OTJ T;  2X4Y A;  3A8L B;  4XU3 A;  3L2R A;  4XAX B;  1VQP A;  1LNX A;  3UWN A;  3J81 E;  5HKC A;  2B8A A;  2BKD N;  3JSC A;  4BDZ A;  2LT1 A;  1VQM T;  1M90 U;  1VQ7 A;  4IKF A;  1M90 C;  1UEB A;  1VQN T;  1QVF A;  2ZGW A;  1SSF A;  1M4Z A;  2LDM A;  2QQ9 A;  2QDY B;  3PNW C;  4M78 C;  4C5E A;  4RMO A;  1YIJ T;  1U1S A;  2QEX A;  2ZPE B;  4LD6 A;  3DLL A;  3FLG A;  4M78 A;  4A4H A;  3VKI A;  3X28 B;  2Y4Y A;  4NOY A;  1D3B A;  1UGR B;  3PFS A;  4KBM B;  5GAN 4;  4OB1 B;  3J80 E;  2XD0 A;  2KK4 A;  4M78 D;  1KQS A;  2K5I A;  4J7I A;  3JB9 J;  4DOW A;  2EAY A;  4C5G A;  3LW5 E;  5CIU A;  4RCB A;  4R56 A;  4JS4 A;  2XU8 A;  1VQ6 A;  4MDW A;  3T9N A;  3FRN A;  3SDZ A;  4C5I A;  3L2Q A;  2CZ1 B;  2CKK A;  4QVD A;  4BI3 A;  2R57 A;  2E6N A;  3OSV A;  4E7L A;  4M7D C;  1UGQ B;  4X9C A;  4J83 A;  5GAN e;  1JJ2 S;  1BI3 A;  2OAU A;  4O6J A;  1VQM A;  3V7C A;  2BUD A;  3VUB A;  1P92 A;  3ZBD A;  3N5B B;  1VQK T;  3L2V A;  1VQO A;  4Y28 E;  1WNL A;  4N0A C;  3LGF A;  4M7D A;  5C6S A;  5GMK m;  3A8H B;  4M78 E;  3MHX A;  2MF2 A;  3CBM A;  4OB2 B;  3GLX A;  4N0A A;  4M7D D;  2RK1 A;  3HHT B;  3KBG A;  4OGE A;  4PL6 A;  4XTW A;  5DM7 R;  4PKC C;  4M78 B;  2KMT A;  3JCM h;  2RH2 A;  2P4T A;  3GP8 A;  2QA4 T;  1D3B B;  2EKO A;  2NLU A;  3M53 A;  3RKY A;  3RMQ A;  1QVG S;  2H3J A;  1N8R U;  3CPW S;  1X6O A;  1N8R C;  2F5T X;  3A8M B;  1YJN T;  3JB9 I;  4BAC A;  1OZ3 A;  2CS7 A;  3MET A;  3OMC A;  5FRM A;  2PUK B;  1YBY A;  2VV5 A;  1U1T A;  1N6A A;  4BDY A;  2JN0 A;  3S6W A;  3PIO A;  4E7H A;  4M7D E;  2K5L A;  5GAN f;  3BW1 A;  3X25 B;  5GMK i;  4VUB A;  2DO3 A;  1G3Y A;  2R5M A;  2K2V A;  2EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...