2KAFA

Solution structure of the sars-unique domain-c from the nonstructural protein 3 (nsp3) of the severe acute respiratory syndrome coronavirus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, rna binding protein
total genus 12
structure length 67
sequence length 67
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.590 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kafA00
2KAFA 2KQWA
chains in the Genus database with same CATH superfamily
3G4SQ 2KSSA 3G7ZA 3M4YA 4ZN3A 1QMCA 2FHDA 1PC0A 1WHJA 3UA6A 4J6WA 5AT1B 1MMDA 2R5MA 4XU2A 2CZ0B 3REAB 2DBKA 3X25B 4JS4A 5HY6A 1EIFA 2RJEA 2C0TA 3OYNA 3VU3C 4Z89A 3CMAA 4PJLA 3QSUA 5KYUA 2JNGA 2KT1A 3G71A 5FU7B 4B9XA 2BZXA 1MMGA 2BUDA 4F7UE 1BKBA 3VYHB 1YJ9T 4CC7A 1XJWB 4M77B 2PVOB 4M4ZA 5CO7A 4PJJA 3PVQA 2B8AA 3IQLA 3QJ6A 2LCCA 3DB3A 3OYAA 3CCJA 3DKMA 4RTZA 1Y0MA 3QBYA 1WIEA 3A8GB 5GANf 4KGXB 2EJGA 3CCRA 4JPBW 3NTKA 2D6FA 3QZ5B 1V29B 3O5ZA 2QA4A 1PM3A 1HSQA 1NEGA 1UJYA 1QWEA 2PUKB 4EMKB 2DK3A 1MV3A 1I8FA 4PFOA 3THKA 4F14A 2R57A 3OY9A 2RJFA 2RK1A 5LJ3j 2RHIA 2MOXA 1SKUB 1WJRA 2YUNA 3RKWA 4JLGA 2ED0A 5CR2A 3T9NA 1YIJA 4JJDA 2CREA 4HVWA 3CCLQ 3TU4K 5LJ5h 2LX7A 4C92C 2H8HA 1U5SA 1VQ4T 1VQ6T 3SFMA 5GAMd 2BIVA 4MDXA 2DL5A 4R56A 1AZEA 1VQKA 3PE0A 2XU8A 1X6GA 1VQ9A 2K5FA 2DL7A 3M58A 2DXCA 3PVLA 4EMKA 3CCQQ 4M78F 4P5NA 4KH0B 1OU8A 4J9IA 5L8RE 3WXMB 2L2PA 1N8RR 5DY9A 2DYBA 2DIQA 4JZ3A 3QO3A 1WI7A 2QQRA 1VQ7A 3PIOA 2E12A 4J9CA 3CC4Q 2M51A 2P0KA 2WSCE 1G5VA 2M0OA 4C8QB 5M9OA 4LUDA 4OB1B 3CD6A 3CC2T 4M75D 3EG0A 1UE9A 1VQOA 3M0RA 2NUTB 4L6V5 2OTJQ 5HK3A 1SSHA 3OW2A 2QG9B 1N8RC 4J83A 5GMKi 5FROA 4Z02A 3CCMT 1SPKA 1VA7A 1TWBA 4FYVB 2KK4A 4N0AA 4DQ2A 2RQUA 4M7DE 1GCQC 4ZN1A 3NTIA 4PKCC 2CZ1B 3PMIA 4HCKA 5KCHA 2RM4A 5GAMg 1VQ5Q 1K73U 2GQIA 1X69A 3RMQA 4RCCA 1KD1U 3OBYA 2C0OA 4C8QA 3I5SA 3M0SA 1S72T 5CKHA 1ZUYA 2QDYB 2FZGB 2KNBB 1D0XA 1K8AU 3CXCA 2NUTA 2NYSA 3UDCA 2OTLA 5FRNA 1TSFA 3MEUA 5KH6A 1YJNT 4PK4A 1K9MR 4J7IA 4N4HA 4OGEA 1M30A 3JAME 4M7AG 2JW4A 5LJ3d 1B07A 1M3AA 4PJNA 4RG2A 4N4GA 1LJOA 4M78B 2L3PA 2L3SA 2JZ2A 1FMWA 1PWTA 5I11A 4AFQC 4IUPA 5CQYA 1K9MC 4C92F 2VGMA 3OSVA 4WCIA 3LLRA 2KRSA 1OU9A 2YLCA 2HQHA 2RI3A 1QVFP 4E7SA 2DTOA 2DMOA 2RQWA 4HVVA 2L3QA 1Q81R 2KI7A 1G3WA 3ZBDA 4F7UG 1IB8A 3QDRB 1LVKA 4C5IA 2K3YA 1YJ9A 3QXEB 3SWNB 2QDLA 3OMGA 3FIFA 4M75F 3REBB 2DA9A 2DZ9A 4D8KA 3QUIA 1Y7XA 3SDZA 1OX9A 4GLMA 3O8VA 4M78A 3I56A 1WHKA 4XU3A 2E1HA 4ZGJB 1G2BA 4BD3A 1U3OA 3V8JA 1M2VB 3CBPA 3M5AA 2CS7A 1M3BA 4N4IA 1PHTA 3FLGA 5FU6B 3MHXA 4RKUE 3KXTA 1Q81C 2MAMA 5HKCA 1VQPQ 3DB4A 5IXFA 2BE7D 2QEXT 5LJ3g 4IIOA 2KQWA 1IZ6A 2X51A 2HCKA 1WNLA 4BY6C 2GTOA 4IURA 5L23A 2DJQA 2LCSA 2QQSA 3SWNA 1WGSA 5FU7C 1F1BB 1R8OB 4L5GA 5I2SA 1Y07A 1H3ZA 4PJOD 2CUDA 2YXYA 3C12A 4WTOB 2DXUA 5GMKl 1M2VA 1VQ4A 1VQ6A 4M77C 1MMNA 3LH0A 3CPFA 3MPUB 1ACMB 3JCMb 2X3XD 2LMJA 4LNPA 3QIIA 1BI1A 3GNGA 4HT9A 3MO8A 3JCMQ 3CCUA 1R0BG 2RF0A 1W70A 4M77D 3JCMd 2HL5C 1T3SA 3M59A 1XQHA 3CEYA 2VGNA 3N5BB 4EMKC 3QPHA 1IO6A 2K2MA 1QP3A 4AFZC 4PJMA 1QKWA 5I21A 1ZA2B 2O9VA 2JTEA 3JV3A 3OYJA 7AT1B 4ZTJA 2PQWA 4CRIA 1YCYA 2GCXA 4J8OA 4A4GA 2KAFA 4KGVB 3CC2A 1N9RA 3UA7A 3BDUA 4M75B 1FWZA 1KHIA 1VQNT 3TREA 4FT2A 4EMHA 2EJFA 2EYYA 1A0NB 2D1XA 5GJVB 3E9GA 1QCFA 1UGVA 4QVDA 2EKOA 2K3XA 1QVPA 1JO8A 3CCMA 2XDDA 2AZSA 2DRKA 4E6RA 1YITT 3OYCA 4M7DG 1DJ7B 2DKGA 2KYBA 3I9QA 1OULA 3GLXA 1FX7A 1YJWQ 3OSSC 5LJ5f 4A4KA 4M78E 1YIJQ 2DBMA 1KQSP 2LDMA 3M54A 4IUTA 3OMCA 4N0AC 2XDPA 4R55A 1N8RU 3OYKA 4XTUA 1TUGB 4JUVA 1PNJA 2RK2A 2YRDA 1S72A 2VXFA 3L2ZA 1M1KC 1OQKA 1WA7A 1W2BA 4O5VA 3MEAA 4M75A 2IG0A 2JTMA 4JJNK 1Y71A 4J9HA 4E7KA 3BY7A 1H92A 3JCMg 1RAIB 2QYZA 4C8QC 3X26B 3TVTA 3A5ZB 1VQLT 3I55T 1I07A 1YJNA 2JTFA 2O01E 3CCST 2E10A 4HT8A 2ATCB 3QYHB 3CBMA 3A8OB 3JB9J 2X4YA 4XQ3A 2LQKA 2DF6A 4RCBA 1ZX6A 1AHJB 3I5RA 1MHNA 2XK0A 4C8QD 1K4US 3HRSA 3L2RA 4UC4A 2XI9A 1OZ2A 1VIEA 2PVDB 5CQXA 2HQEA 1UHCA 4DBQA 2KRNA 1K1ZA 3URGA 1W4SA 1RACB 1ABQA 1VQOQ 1RLPC 1GCQA 3EFSA 3TCJA 1ZLMA 1N27A 4PNOA 1NLOC 4XU0A 3NPFA 3OS0A 5KYYB 1MUZA 2K3BA 1OI1A 4M77F 4QQDA 1SRMA 3PGGA 3CMET 2FG0A 2HL3A 5IHIA 4KT0E 5IH2A 1AVZC 4C5EA 1NZ9A 3EGUA 1K9MU 2IVWA 1BIBA 1WHHA 4WF2A 1C1AA 2E3IA 2CGHA 3PTAA 1FXXA 5GAMj 3ULRB 1GBRA 2GTJA 3RERA 1SF9A 1WXTA 5GAMe 1HD3A 5GAN8 2JN0A 4J6YA 2GQVA 1WHGA 2OTLQ 4D6WA 2KXDA 2ECZA 4OMQA 3VRYA 2FO0A 2BTTA 3M0PA 1NE8A 5GJWB 4C92E 2YDLA 1QVFS 2E70A 3HRUA 1RADB 3VYGA 1QW1A 1AWWA 1YI2Q 1GCPA 2YHTA 2RHYA 1NG2A 2HDAA 1WQWA 3OW2P 3S3MA 3S6WA 2MF2A 3SHWA 1Q81U 4BE1A 3S3NA 5J26A 2JS0A 1IHWA 1RAGB 2ZPFB 4DBRA 2MYSA 4PJOB 4M75E 2GNCA 3V7RA 4LD9K 5IN1A 4MMLA 3SWNC 3UATA 4BY6B 1NEBA 3TSZA 1X6OA 3G4ST 1KQSA 5IT9E 3FEOA 1BIAA 4Z88A 3M4GA 3A8MB 1N5ZA 2KRMA 3C95A 4C8QF 4OB0B 2LT1A 1O9SA 1JXMA 5CKEA 5FU6C 1Y57A 3OS5A 3CXCP 2M16A 3MP1A 3G6EQ 2CT4A 1X27A 1G83A 1GFCA 1M90R 3PIPA 2L5QA 1G3YA 3I56T 1YP5A 2X4JA 1M1GA 3D7SB 2D8JA 2JM8A 3VS5A 4PJOA 4XTZA 2AKLA 2DILA 2JS2A 4QQ6A 1VQ8T 3HFNA 3MEWA 2OI3A 3H0IA 1VQNA 3LYIA 4MZTA 4ESRA 4RUGA 4FSSA 2FZKB 3JB9H 2DYIA 1BCOA 1XTDA 2WSEE 3CC7Q 1M90C 2O9SA 2LX9A 3H0HA 1YITA 2LNHB 2YLBA 4QT7A 4BDYA 2DO3A 1JU5C 2A7YA 3KBGA 3JSCA 4M77A 2QQ9A 3SB2A 5LJ3e 2P0PA 1YHQQ 2ZGWA 2HKNA 5CK9A 4C0DB 2DVJA 1UJ0A 1WQ7A 1I5OB 3X24B 1PCXA 3MEVA 1ZQ1A 3OB9A 2MWPA 1ABOA 1P92A 3OYIA 3VS4A 3R6NA 4LN2A 1X2QA 2CUBA 5DM7R 3CCVQ 4J7FA 1YNZA 3CCLT 2EYZA 2Y4YA 4OMOA 5CKFA 2K6DA 3CCUT 3JCMh 1VQLA 3I55A 1OX8A 3NFCA 1AWJA 3CCSA 2L0AA 4JJCA 1G8XA 2DL4A 3A98A 4M75C 1PD0A 3CCEQ 1X6BA 4EPCA 1M4ZA 4C0ZA 3M56A 2FRWA 3CCQT 1KQSS 2BZYA 4X9DA 4V2SA 1MV0B 2F69A 3H41A 1KK7A 3QWXX 3WVDB 1EFNA 4ME7A 1B34B 2RHUA 5A2QE 4M7AD 2KYMA 3V7SA 2XDBA 4ORZA 3BFMA 3CC4T 1E6HA 3L42A 2VB6A 2LJ1A 1SEMA 2DE0X 4Y91A 3CMEA 2Z0WA 2A28A 5LL6S 2EQIA 1AWOA 1D0ZA 1YCSB 3QKJA 2RN8A 3INZA 2M1HA 3GP8A 3F70A 2ED1A 4AMCA 2ZPBB 4ANJA 3OYLA 5D6YA 4JLIA 5FWCA 4LDWA 1KC8R 1U8RA 2R58A 1PG5B 2AK5A 1QCOA 1B34A 4E7HA 1YBYA 1ZHIA 1SRLA 5C0MA 3A8HB 1JBMA 2V1QA 2I2LA 3LH5A 4C92G 5LJ5j 1D1BA 1WZOA 4M77E 2WACA 3PNWC 3JCMe 1KC8C 4HKEA 1I4K1 1HXDA 2VKNA 2VXEA 4HA8A 1B3QA 3PT9A 2FPDA 2J6FA 2L8DA 2EAYA 2O31A 3P8DA 2QTXA 1M5Q1 2RD1A 4E7ZA 2V8JA 3H8ZA 1H8KA 4XTWA 5GMKm 2EPDA 4HCBA 5CKBA 1VYTA 1WHLA 1UEBA 1Q82R 3G4SA 2F1LA 2F2VA 2DETA 2RMOA 2DXBA 3L1AA 4RMOA 2DIGA 3OYFA 2F5KA 2CH4W 2PNIA 2EBPA 4R0KA 4KBMB 3J81E 2Y90A 4DA4A 3EFOB 3QHSA 4IUVA 1GRIA 1W2BP 4QW2A 4AT1B 2YUQA 5EC7A 1WFWA 2CP2A 4FT4A 3EGDB 3OW2S 4M7AF 3V8KA 3A8LB 1AZGB 2D0QB 1RAHB 4BB7A 2P0QA 2I0NA 1LPLA 1Q82C 2KXCA 2E3HA 1ZUKA 1KFZA 1TUDA 1ZSZB 2BE9B 1OYXA 2FPEA 3BW1A 3OYHA 2BZ8A 4E47A 3RDVA 1OEBA 4XTVA 1VQ8A 2ABLA 2D9TA 2F5TX 3CBOA 2EQJA 2RPNA 4GBQA 2QEXQ 4Z8AA 4PJOC 2MMPA 1T0HA 4HCCA 2CT3A 2D0NA 1UHFA 3EG3A 3EFOA 1RAEB 2LQWA 4MZMA 4RG8A 4BI4A 2EWNA 3OS2A 1VQPT 4OB2B 4JRPA 4F7UF 3QDFA 3CXCS 4ATOA 4C8QE 3EGDA 2V26A 2M0YA 1AEYA 3MP8A 4KH1B 1PSEA 2E41A 2MK5A 1YWPA 4EIKA 4M7DD 2FPFA 2CYZB 2V8KA 4LUEA 4AFSC 2YUPA 2E65A 1M90U 5D7UA 4E7IA 3VS7A 1M8MA 4AG1C 1YWOA 1ZUUA 3LW5E 1NPPA 4IUQA 1AD5A 3AT1B 3CMAQ 1X43A 2RQTA 3RUXA 2ESWA 3CCLA 2ZPEB 3G71Q 2DM1A 3GBQA 1SSFA 2E4HA 1U1TA 4J9GA 4IKFA 1JXOA 1TUCA 5J39A 5FRMA 5LJ5d 3MJXA 2J6KA 2CSQA 3S3OA 2JOYA 2K9GA 3JB9G 4Y92A 3C94A 2JJ9A 3C0CA 5KCOA 5AYFA 5HCKA 2KE9A 4LD6A 4J6XA 1UG1A 3EFRA 1WXBA 3CCQA 3EGXB 3CCJQ 2QK0A 2CDTA 4ZGEB 1VQMT 2A08A 1R0CB 4YTLA 3CCRQ 3SD4A 2IIMA 2VASA 2MI6A 3QJYA 4NOYA 2QA4Q 1GBQA 4M7AB 4FCYA 4C0DC 2CZ6B 3CC4A 1M1KR 3M0UA 5EG2A 4FYWB 2HSEB 2K7AA 2RHZA 1YFNA 5D6WA 2DJZA 4Y28E 2H3EB 4JRKA 3TQ7P 5GANj 1NJIR 2VUBA 3E2UA 2P4RA 5GAMh 2QTVA 3A1PA 3EGXA 2EYWA 1C0MA 5CCAA 2PUOB 2RJDA 4DBFA 3JCMW 1YJWT 1VQKQ 1N9SA 4F7UB 1VQ9Q 2YRVA 3JCMf 5LJ5g 1VQ5A 4M7AA 1M2OA 3M9QA 1U1SA 3G1JA 3FC3A 2RB6A 1G3SA 2KR3A 4FL6A 5GMKj 2G6FX 2CH4A 3PFSA 1NJIC 1IGUA 3EH1A 3GF5A 4OMLA 4C5HA 4PJOF 1OPKA 2X9HA 4KUIA 2KBTA 2DNUA 3OBWA 2FYKA 2QGGA 3CPWA 2HBWA 1KG1A 1VQ7Q 4J9BA 1WDXA 2FL7A 1K0SA 3HTRA 1NPRA 4PL6A 2LJ3A 1Q7YR 1BB9A 3JCMV 2ROTA 3H6ZA 4II1A 2COWA 2DX1A 1BI0A 4A4EA 3CD6Q 2CP7A 4FW1A 4F7UA 4RTYA 1IGQA 2ZPIB 1KC8U 2MWOA 4OMMA 4IUUA 2EIFA 2QXFA 3R6OA 5KE3A 2DVEA 4C0GA 3VUBA 4J9DA 4DBHA 5KE2A 6AT1B 1Q7YC 4D8DA 1WXUA 4ELYC 4J5YA 4HCZA 4DOWA 1QVGP 3I35A 2E5KA 5GAOp 1SG5A 5A0LA 1PD1A 2PTKA 4J9EA 3EHRA 5GAN4 4K11A 2RH2A 1M27C 2VV5A 3E19A 4FYXB 2W0ZA 2E64A 2FRYA 2NUZA 5KYYA 1OPLA 2W10A 3KUFA 2P4TA 4JS5A 2RI5A 2P84A 2HNIA 4OB3B 1NLPC 3GOXA 4JJBA 5LJ3h 2L89A 3UF4A 2FB7A 3ZL7C 1Q82U 4EMGA 2EFIA 2HAXA 5GAOq 2LVMA 1I81A 1VQPA 1W2BS 2E6NA 1KQ2A 2HMAA 5GANd 1U06A 3EH2A 1JEGA 2XD0A 1TG0A 1YI2T 1M8VA 3VS1A 1IXDA 2A36A 5GAOm 2DAQA 1AWXA 4M7AE 2DTIA 1E6GA 4M7DB 1RAAB 5KYXB 2EVRA 3P8HA 2KDSA 3CPWS 1WJQA 3JCMX 1KHCA 3NGPA 5CIUA 2XICA 2VWFA 4XAXB 2OAWA 2HEQA 1YN8A 2EYQA 1ARKA 3WVEB 2HZYA 4NL2A 4RTVA 4BI8B 1BI3A 1ZSZC 2K57A 4RTWA 3RESA 1H3HA 1YJ9Q 2DD5A 2YSQA 3HKSA 4X9CA 3RKXA 3CQTA 1XOVA 2LT4A 4NS5A 4C5GA 2GGRA 2GBQA 3I56Q 3M55A 1M3CA 3VS6A 3E9FA 1NYGA 1GFDA 2FVUA 1S1NA 2MCNA 4GLKA 4FSXA 4AG2C 3HSBA 3G6ET 5GAOr 1VQMA 4M7DA 5KYXA 4ELZC 4FYYB 3FJ5A 2KROA 3MKDA 1VQ8Q 1KIKA 1JJ2A 2HQXA 2AKKA 2DL3A 4LDXA 3BE3A 3LGLA 3UT1A 3RIRA 4OMPA 3JB9I 2PZ1A 4A4FA 2CP3A 1PKTA 1FYNA 4A4HA 1ZBXA 4QQGA 1K0XA 5GANg 4CC2A 3Q1JA 3OS1A 2J06A 1UECA 2F2XA 1NBEB 3HPWA 5IHNA 5CVIA 2ZCFB 4M78G 4XTXA 1RI9A 4BDZA 1O75A 4QVCA 4LXCA 2EGCA 1W1FA 1NYFA 2JMAA 4OMFB 3CC7T 4JRQA 1X2KA 3RKYA 2RQVA 5GAOl 1D3BB 1VQ4Q 1VQ6Q 4FU6A 1TXQA 4A54A 3L2UA 3HFOA 4XU1A 1YJWA 1QVGA 4F16A 1FMVA 1YHQT 3FJPA 1LCKA 3ZEHA 4KGZB 2KEAA 2LNVA 1WLPB 2EJ9A 2CZ7B 3HRTA 5D6XA 1QKXA 2HSPA 3CCUQ 3QYGB 9ATCB 2RI2A 1WJSA 3CCVT 4M7AC 5KYWB 1M1KU 2NLUA 1UB4A 3L2QA 1K9AA 2DD4A 3OYGA 3META 3EAEA 1GL5A 1IRXA 4C92D 3KFVA 2NWMA 3CCET 2H3JA 2AZVA 1D3BA 1G3TA 4MDWA 3CC2Q 1NJIU 1UDLA 4B6MA 3BDLA 4BUGA 2JUFA 5GAN5 1UGSB 2QASA 1Q86R 1XNIA 1E7OA 1TU0B 5CAIA 1ZBJA 1PSFA 4BE0A 1EX4A 4ZGDB 3CCMQ 2EKHA 1J3TA 1TOVA 2OTJT 2V8IA 5GAMf 5KYWA 3C4SA 2LQ8A 1I5LA 5ECAA 2QGFB 2J05A 1JJ2S 4PJOE 2DL8A 1BYMA 1RI0A 5A0DA 1Q86C 1HJDA 1S72Q 2FEIA 4FM4B 2DRMA 3L2VA 3M53A 2DERA 1TH7A 3HP9A 4FIBA 1VQ5T 2PVGB 1Q7YU 4QVZA 1X75C 1EZZB 1RL2A 2L3RA 3MP6A 1CKBA 2LC4A 3ME9A 5J3BA 2RHXA 3OYBA 2GFAA 3UWNA 2MPXC 3VKIA 3RBBB 1YJNQ 3QZ9B 1HK9A 3VJPA 2M02A 8ATCB 3TEEA 3TSWA 1HYOA 2COYA 5LJ5e 2QAZA 4E7LA 5FWBA 4LDUA 1WYXA 2ENMA 1QVGS 1OV3A 3JCMc 1D1CA 2QI2A 3J7AF 1VOMA 3OYYA 1ZSGA 2EW3A 3OYMA 2IPOB 4M75G 1QQJA 2X4WA 3VS3A 5FW9A 1YI2A 5GAN2 2C0IA 1V76A 2LRQA 3RMSA 2X4XA 2O88A 4OVAA 2QQAA 3E1SA 4RTXA 1BCMA 4AFUC 2GF7A 2HKQB 2D8HA 2VC8A 2K4YA 1CKAA 4F04B 1AT1B 3OA6A 1H641 2RO0A 2DEUA 1PKSA 1RABB 3H0FA 2CKKA 1W6XA 1Z9QA 4CC4B 4A63B 2OJ2A 2PU9B 2KY9A 2J6OA 1OZ3A 2OAUA 1SHGA 4OGCA 4RTUA 2EQKA 3EG2A 3JB9D 2LP5A 3G6EA 4LDYA 3OQ5A 3CPWP 2YWWA 1GXIE 2C06A 3NMZC 5IAYA 5LJ3f 1MNEA 3QWYA 5CKDA 1MNDA 3VRZA 2XG8D 3L2WA 1I0CA 1NM7A 4OF1A 2DTHA 2COZA 2DXTA 2JMCA 2KGTA 4M7DC 1WX6A 2ZZDA 2A37A 1VYVA 1BBZA 2SRCA 4BACA 1UGRB 4RTTA 1QLYA 5GANh 1BU1A 3RNJA 3LWHA 4EDUA 1WHMA 2FZCB 3LWIA 4VUBA 3CC7A 1ZSZA 1D09B 1UUEA 4JRIA 1RUWA 2GFUA 2QQBA 1CSKA 1JB0E 3ER0A 4HVUA 4NL3A 1YHQA 4JZ4A 5GMKh 3V8LA 2DZCA 3HHTB 5HK0A 2CP6A 1VIFA 4TVRA 2JXBA 5GAN3 1Q95G 1RAFB 3JRZA 4X1VA 3GPLA 2DPPB 4PFPA 3CMAT 3GNFB 3CCVA 3VS0A 2E5QA 3G71T 1IHVA 1SHFA 8AT1B 1D1AA 2DLPA 4Q5WA 2LCLA 4C92B 4XTYA 5I22A 2NUPB 4LDVA 3CCEA 1VQMQ 1FMKA 3ASKA 2RQRA 2XHCA 5DLOA 3UPUA 2CP0A 3P8BB 2LQNA 1VQNQ 3LX7A 3CCJT 1BK2A 2AIRB 4KRTA 3HL8A 4E7JA 3CCRT 2HBPA 2R5AA 1YITQ 2DFUA 3ZFJA 3EG9B 4IIMA 1T3LA 2O4XB 2RJCA 4MZPA 2QA4T 3DLMA 1JRIA 2OTJA 3NTHA 1JQQA 1T0JA 2EQUA 2B86A 2CP5A 2ZPHB 2J7IA 1AOJA 1N6AA 3GIBA 3DLLA 5C6SA 3JB9F 4LE9A 1UGPB 2K5IA 2M9UA 1TTHB 4PJOG 5IHKA 2EGEA 5GANe 4C92A 4OMNA 2NUPA 4F17A 4PLLA 2EYXA 2RNAA 3QG1A 4FW2A 1YIJT 4MMKA 2LZ6B 2YUOA 3SEMA 1QVFA 1VUBA 3FB9A 1Y96B 2X35A 4BE2A 1VQLQ 3I55Q 4CI0C 3JCMP 4KUDK 3AHUA 3CCSQ 1VQKT 3J80E 1Q86U 3EG9A 5GMKe 4M77G 1VQ9T 2O4XA 1UFFA 4M7DF 1BI2A 2JT4A 4GY5A 2A0FB 1JJ2P 5GAN7 1OOTA 3FRNA 1I1JA 2ZAEA 2Y4XA 2JM9A 1K73R 2HD0A 2YRCA 4DOVA 2LTOA 2OX7A 1QCNA 4PLIA 3VV0A 5A0GA 1KD1R 2KVQG 5GAOn 1Z9ZA 3LGFA 4DEXA 2K79A 1KQ1A 3VS2A 2WSFE 3OYDA 1WPYA 1VQ7T 3OYEA 5KYNA 1K8AR 2K2VA 3NHNA 2AHJB 3PMTA 2XKOC 1Y96A 3CMEQ 5FLXE 1TS9A 3CD6T 3V7CA 3M0TA 1VQOT 2F2WA 1M1FA 2MIOA 2XIDA 1IREB 1K73C 4QKUA 4PFZA 2EQMA 2KMTA 1K76A 4J9FA 3JCMJ 1KD1C 4CC3A 4ZNXA 1UGQB 1M9SA 2O2OA 2CSIA 1K8AC 1KSWA 1ZA1B 3X28B 2LJ0A 4A53A 2K5LA 4B9WA 4C0FA 5I2MA 1QWFA 1MMAA 1C6VX 1RLQC 5DLQE 1KJWA 3H9NA 2YT6A 3FDRA 1PRLC 1QP2A 4XK8E 2V1RA 1MGQA 2RA2A 4E2FB 1X01A 4BI3A 3MCAB 2VVKA 2BKDN 3RR6A 2X3WD 2OTLT 1LNXA 1PRMC 2ZPGB 3M57A 4JDSA 4M78C 4X34A 4C8QG 4DEYA 2E6ZA 1UTIA 2SEMA 1B7TA 4HXJA 5GAN6 5KYUB 3U23A 2KT8A 2XMFA 3X20B 2QEXA 2G3RA 3VUZA 2ROLA 4ZTFA 3EHQA 5IXBA 4L59A 3M0QA 2AT1B 2JVVA 2VYTA 4KULA 4O6JA 4OP0A 2EGAA 1VYUA 2A3LA 2DEQA 1D0YA 1LOJA 3EG1A 1R77A 1V1CA 4M78D
chains in the Genus database with same CATH topology
4XTUA 4JUVA 3BDLA 2KSSA 4BUGA 2JUFA 5GAN5 1UGSB 3G7ZA 2RK2A 1S72A 2VXFA 1OYXA 3M4YA 4ZN3A 3L2ZA 1N8RU 3BW1A 1XNIA 3OYHA 2FHDA 1M1KC 5CAIA 4E47A 4J6WA 4XTVA 1VQ8A 2R5MA 4XU2A 1PSFA 4BE0A 4ZGDB 2CZ0B 1W2BA 4O5VA 2D9TA 2F5TX 3MEAA 3CBOA 4M75A 2IG0A 2JTMA 3X25B 1Y71A 4JJNK 4E7KA 2EQJA 3BY7A 3JCMg 4JS4A 5HY6A 1EIFA 2RJEA 4PJOC 2MMPA 4C8QC 3X26B 3OYNA 2OTJT 3A5ZB 3VU3C 1VQLT 3I55T 3CMAA 1YJNA 2V8IA 5GAMf 4HCCA 3QSUA 2JTFA 3C4SA 2O01E 2LQ8A 3CCST 2JNGA 1I5LA 2E10A 4HT8A 3QYHB 3G71A 5FU7B 3CBMA 4MZMA 4RG8A 4B9XA 2EWNA 4BI4A 3OS2A 3A8OB 4OB2B 4JRPA 3JB9J 1VQPT 1JJ2S 4F7UF 3CXCS 4ATOA 2X4YA 4C8QE 4PJOE 1BYMA 1RI0A 2BUDA 1BKBA 4F7UE 4XQ3A 3VYHB 2LQKA 5A0DA 1YJ9T 1Q86C 3MP8A 4RCBA 1AHJB 1PSEA 1MHNA 2E41A 2XK0A 4C8QD 4FM4B 3HRSA 3L2RA 4UC4A 4M77B 2XI9A 3L2VA 1OZ2A 2PVOB 3M53A 5CO7A 1VIEA 2PVDB 1TH7A 3HP9A 4FIBA 5CQXA 4M7DD 1VQ5T 2HQEA 2PVGB 2V8KA 2CYZB 1Q7YU 4QVZA 2B8AA 1X75C 3URGA 2E65A 3QJ6A 1M90U 1RL2A 2L3RA 2LCCA 3MP6A 1W4SA 3DB3A 4E7IA 2LC4A 3ME9A 5J3BA 2RHXA 3OYBA 3OYAA 2GFAA 3DKMA 3LW5E 1NPPA 4IUQA 3UWNA 3QBYA 3VKIA 3CCJA 3TCJA 3EFSA 4PNOA 1N27A 3A8GB 4XU0A 5GANf 3QZ9B 3RUXA 1HK9A 3VJPA 3CCLA 3CCRA 2EJGA 3TEEA 3OS0A 2ZPEB 1OI1A 4M77F 3NTKA 4QQDA 1SSFA 2D6FA 3PGGA 3CMET 3QZ5B 1U1TA 1V29B 2QA4A 5LJ5e 4IKFA 5J39A 4E7LA 5FRMA 5LJ5d 2PUKB 4LDUA 4EMKB 2DK3A 3S3OA 2JOYA 1I8FA 4KT0E 4C5EA 3JB9G 1QVGS 3JCMc 1NZ9A 2R57A 2QI2A 3C94A 3OY9A 2RJFA 2RK1A 5LJ3j 5KCOA 5AYFA 2RHIA 1K9MU 2IVWA 1BIBA 1WJRA 4LD6A 3J7AF 3RKWA 4JLGA 4J6XA 3OYYA 3EFRA 4WF2A 4M75G 3OYMA 2X4WA 3CCQA 1YI2A 5CR2A 2CGHA 3T9NA 3PTAA 1YIJA 4ZGEB 1FXXA 5GAMj 5GAN2 1VQMT 4YTLA 2LRQA 3RMSA 3SD4A 1VQ7T 2MI6A 3RERA 3QJYA 4NOYA 2X4XA 3TU4K 5LJ5h 4C92C 4OVAA 5GAMe 5GAN8 2JN0A 2QQAA 4J6YA 4M7AB 1VQ4T 1VQ6T 3SFMA 2GQVA 2BIVA 3E1SA 4C0DC 5GAMd 2CZ6B 4MDXA 4R56A 3CC4A 2GF7A 4D6WA 1VQKA 2VC8A 4R55A 2XU8A 2K4YA 1VQ9A 5EG2A 2K5FA 4N0AC 1NE8A 4C92E 3OA6A 3M58A 1H641 1QVFS 2DXCA 2RO0A 2E70A 3HRUA 4EMKA 2RHZA 3VYGA 2CKKA 5D6WA 2DJZA 4Y28E 1QW1A 4M78F 4JRKA 4P5NA 5L8RE 2PU9B 2YHTA 2RHYA 5GANj 3WXMB 2VUBA 5DY9A 1WQWA 2KY9A 3S3MA 3S6WA 2MF2A 1OZ3A 2DIQA 5GAMh 2OAUA 3QO3A 1Q81U 4OGCA 2EQKA 2QQRA 5CCAA 4BE1A 2PUOB 3S3NA 1VQ7A 5J26A 2RJDA 3JB9D 3G6EA 4LDYA 3PIOA 2E12A 3OQ5A 3JCMW 2ZPFB 1GXIE 1YJWT 2C06A 2P0KA 2WSCE 4PJOB 2M0OA 1N9SA 4M75E 3V7RA 5LJ3f 4C8QB 2YRVA 4F7UB 5IAYA 4LD9K 5IN1A 3JCMf 5M9OA 4MMLA 4OB1B 3SWNC 5LJ5g 1VQ5A 4M7AA 4BY6B 3CD6A 3CC2T 3M9QA 5CKDA 1U1SA 4M75D 3FC3A 2RB6A 1X6OA 1G3SA 2XG8D 1VQOA 3L2WA 3G4ST 4FL6A 5GMKj 4OF1A 4L6V5 2DTHA 3FEOA 2DXTA 5HK3A 5IT9E 1KQSA 3PFSA 4M7DC 1BIAA 3OW2A 2ZZDA 3M4GA 3A8MB 1NJIC 1N8RC 4J83A 3GF5A 5GMKi 4C5HA 5FROA 4Z02A 4BACA 3C95A 3CCMT 4PJOF 4C8QF 1UGRB 4KUIA 4OB0B 1VQNT 2LT1A 3OBWA 1O9SA 2FYKA 2KK4A 5GANh 3CPWA 4N0AA 5CKEA 5FU6C 4DQ2A 3LWHA 4EDUA 1KG1A 3OS5A 4M7DE 2M16A 2FL7A 3MP1A 4ZN1A 3NTIA 1NPRA 4PKCC 3LWIA 2CZ1B 3PMIA 4PL6A 4VUBA 5KCHA 3CC7A 3JCMV 2RM4A 3PIPA 2L5QA 1G3YA 3H6ZA 4II1A 5GAMg 3I56T 1K73U 2X4JA 1M1GA 4A4EA 1BI0A 4JRIA 2GFUA 2QQBA 3RMQA 4RCCA 1KD1U 3OBYA 4PJOA 4C8QA 1JB0E 4XTZA 4F7UA 3ER0A 1S72T 4NL3A 5CKHA 1YHQA 2QDYB 4QQ6A 2ZPIB 5GMKh 1KC8U 3V8LA 2MWOA 3HFNA 3MEWA 2DZCA 3HHTB 1K8AU 1VQ8T 5HK0A 4IUUA 1VIFA 4TVRA 2EIFA 3CXCA 2QXFA 3R6OA 3LYIA 4MZTA 5GAN3 1VQNA 1G5VA 5KE3A 2DVEA 3JRZA 4C0GA 3UDCA 2OTLA 3GPLA 3VUBA 5FRNA 3JB9H 5KE2A 2DPPB 3MEUA 5KH6A 3CMAT 1YJNT 1Q7YC 3GNFB 1XTDA 4ELYC 3CCVA 2WSEE 4J5YA 1M90C 4HCZA 4DOWA 2E5QA 2LX9A 3G71T 4IUTA 1YITA 2YLBA 4BDYA 2DO3A 4J7IA 2A7YA 3KBGA 3JSCA 4N4HA 4M77A 2QQ9A 3SB2A 5LJ3e 4OGEA 5GAOp 4Q5WA 3JAME 2LCLA 4M7AG 4C92B 5A0LA 5LJ3d 2P0PA 4XTYA 2ZGWA 5GAN4 4LDVA 5CK9A 3CCEA 4C0DB 3ASKA 2RH2A 4RG2A 4N4GA 1WQ7A 2XHCA 5DLOA 3UPUA 2VV5A 1LJOA 3P8BB 3X24B 3E19A 3MEVA 4M78B 2E64A 2JZ2A 1ZQ1A 3OB9A 2MWPA 3LX7A 1P92A 3KUFA 4IUPA 3OYIA 3CCJT 5CQYA 2P4TA 1K9MC 5DM7R 4C92F 2VGMA 2RI5A 3HL8A 3OSVA 4JS5A 4E7JA 4J7FA 3CCLT 3LLRA 3CCRT 2HBPA 2HNIA 2R5AA 3ZFJA 2Y4YA 2YLCA 4OB3B 2O4XB 2RJCA 4MZPA 5CKFA 3GOXA 2RI3A 2QA4T 5LJ3h 3CCUT 2L89A 1JRIA 3DLMA 3NTHA 2OTJA 3JCMh 1VQLA 3I55A 2FB7A 2DTOA 2EQUA 2ZPHB 3NFCA 1Q82U 4EMGA 1N6AA 2EFIA 3GIBA 3DLLA 3CCSA 2HAXA 5GAOq 2LVMA 5C6SA 1I81A 4M75C 3JB9F 1UGPB 1VQPA 2K5IA 1W2BS 2M9UA 2E6NA 4PJOG 1G3WA 3ZBDA 4F7UG 3OMCA 4EPCA 5GANe 3QDRB 1KQ2A 4C5IA 1M4ZA 4C0ZA 2K3YA 4C92A 1YJ9A 5GANd 3QXEB 3M56A 3SWNB 3OMGA 3FIFA 3CCQT 4M75F 4PLLA 2XD0A 1KQSS 2DZ9A 3QG1A 3QUIA 1Y7XA 4X9DA 3SDZA 1YI2T 1YIJT 4V2SA 1M8VA 3O8VA 4MMKA 5GAOm 2DAQA 4M7AE 4M78A 2F69A 2DTIA 3I56A 4XU3A 4M7DB 2E1HA 3WVDB 1QVFA 4ZGJB 1Q81C 4ME7A 1B34B 2RHUA 1VUBA 3FB9A 3P8HA 1Y96B 5A2QE 4M7AD 2KDSA 2X35A 4BD3A 3CPWS 3V7SA 3V8JA 1WJQA 4BE2A 3JCMX 1KHCA 2XDBA 5CIUA 2XICA 3CBPA 4XAXB 4CI0C 3BFMA 3JCMP 3M5AA 3CC4T 2CS7A 2EYQA 4N4IA 4KUDK 3AHUA 3WVEB 1VQKT 3L42A 4NL2A 3FLGA 3J80E 5FU6B 5GMKe 1Q86U 3MHXA 4M77G 4RKUE 4BI8B 2MAMA 1BI3A 5HKCA 2O4XA 4Y91A 3KXTA 1VQ9T 3CMEA 2K57A 3DB4A 3RESA 2QEXT 5LJ3g 4M7DF 1BI2A 2KQWA 1IZ6A 4GY5A 5LL6S 5GAN7 2DD5A 3HKSA 4X9CA 3RKXA 3FRNA 1WNLA 2Y4XA 3QKJA 3GP8A 3INZA 2M1HA 4BY6C 2HD0A 1XOVA 2LT4A 3F70A 4NS5A 4IURA 4C5GA 2ZPBB 3M55A 4DOVA 2LTOA 2QQSA 4PLIA 3VV0A 5A0GA 2KVQG 3SWNA 5GAOn 3E9FA 3LGFA 1WGSA 3OYLA 2FVUA 5D6YA 4JLIA 1KQ1A 2WSFE 4LDWA 5FU7C 3OYDA 1R8OB 1WPYA 4GLKA 4FSXA 4L5GA 1U8RA 5I2SA 3OYEA 2R58A 3G6ET 1Y07A 5GAOr 3HSBA 1H3ZA 2K2VA 1VQMA 4PJOD 2AHJB 4M7DA 4ELZC 3PMTA 3C12A 1B34A 4E7HA 2XKOC 1YBYA 1Y96A 1JJ2A 2DXUA 2HQXA 4LDXA 5FLXE 5GMKl 3LGLA 3UT1A 3CD6T 3RIRA 3V7CA 1VQ4A 1VQ6A 3JB9I 4M77C 4A4FA 1VQOT 3LH0A 1M1FA 3CPFA 1ZHIA 4A4HA 2XIDA 5C0MA 1IREB 3A8HB 1K73C 1JBMA 2I2LA 1ZBXA 4QQGA 3JCMb 4C92G 5LJ5j 3QIIA 5GANg 2EQMA 2KMTA 1BI1A 3GNGA 3Q1JA 3OS1A 3JCMJ 1KD1C 4HT9A 4M77E 3HPWA 1UGQB 1M9SA 3MO8A 3JCMQ 2WACA 3PNWC 3CCUA 5CVIA 3JCMe 2ZCFB 4M78G 4XTXA 1KC8C 4HKEA 4BDZA 1O75A 1I4K1 4M77D 3JCMd 1K8AC 4QVCA 3X28B 1HXDA 4OMFB 3M59A 2K5LA 4A53A 1XQHA 3CEYA 2VXEA 4HA8A 4B9WA 3CC7T 3PT9A 4C0FA 2VGNA 3N5BB 4JRQA 4EMKC 3QPHA 1QP3A 5I2MA 3RKYA 2L8DA 2EAYA 5GAOl 3P8DA 5I21A 1D3BB 3OYJA 2QTXA 4FU6A 1M5Q1 5DLQE 4A54A 3L2UA 4ZTJA 3HFOA 2PQWA 2RD1A 2V8JA 4XU1A 3H8ZA 4CRIA 1YJWA 1YCYA 1QVGA 4XTWA 1YHQT 3FJPA 2GCXA 3ZEHA 3FDRA 5GMKm 4HCBA 4J8OA 1QP2A 4A4GA 2KAFA 2LNVA 5CKBA 2EJ9A 2CZ7B 4XK8E 3CC2A 3HRTA 5D6XA 1MGQA 1N9RA 2RA2A 1UEBA 3BDUA 4M75B 1FWZA 1KHIA 1X01A 3G4SA 4BI3A 3TREA 3MCAB 4FT2A 4EMHA 2EJFA 2BKDN 2DXBA 3QYGB 3L1AA 4RMOA 2OTLT 2DIGA 2RI2A 3OYFA 2F5KA 3E9GA 1LNXA 2ZPGB 3M57A 4QVDA 2EKOA 2K3XA 4JDSA 1QVPA 1WJSA 4M78C 4X34A 3CCVT 4C8QG 3CCMA 1M1KU 2NLUA 2E6ZA 4KBMB 3J81E 2XDDA 4M7AC 1UB4A 2Y90A 5GAN6 4DA4A 1YITT 3L2QA 4IUVA 3QHSA 3X20B 3OYCA 2QEXA 2DD4A 4M7DG 1DJ7B 2DKGA 2G3RA 3OYGA 3VUZA 4QW2A 3META 3EAEA 4ZTFA 4FT4A 4C92D 3GLXA 1FX7A 4L59A 3OSSC 5LJ5f 3OW2S 4A4KA 4M7AF 3V8KA 2JVVA 2VYTA 4KULA 4M78E 4O6JA 4OP0A 3A8LB 3CCET 2A3LA 2DEQA 2H3JA 2LDMA 1D3BA 1G3TA 3M54A 1LOJA 4MDWA 2D0QB 4BB7A 2XDPA 1NJIU 2P0QA 4M78D 3OYKA 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAF A;  2KQW A; 
#chains in the Genus database with same CATH topology
 3G4S Q;  2KSS A;  3G7Z A;  3M4Y A;  4ZN3 A;  1QMC A;  2FHD A;  1PC0 A;  1WHJ A;  3UA6 A;  4J6W A;  5AT1 B;  1MMD A;  2R5M A;  4XU2 A;  2CZ0 B;  3REA B;  2DBK A;  3X25 B;  4JS4 A;  5HY6 A;  1EIF A;  2RJE A;  2C0T A;  3OYN A;  3VU3 C;  4Z89 A;  3CMA A;  4PJL A;  3QSU A;  5KYU A;  2JNG A;  2KT1 A;  3G71 A;  5FU7 B;  4B9X A;  2BZX A;  1MMG A;  2BUD A;  4F7U E;  1BKB A;  3VYH B;  1YJ9 T;  4CC7 A;  1XJW B;  4M77 B;  2PVO B;  4M4Z A;  5CO7 A;  4PJJ A;  3PVQ A;  2B8A A;  3IQL A;  3QJ6 A;  2LCC A;  3DB3 A;  3OYA A;  3CCJ A;  3DKM A;  4RTZ A;  1Y0M A;  3QBY A;  1WIE A;  3A8G B;  5GAN f;  4KGX B;  2EJG A;  3CCR A;  4JPB W;  3NTK A;  2D6F A;  3QZ5 B;  1V29 B;  3O5Z A;  2QA4 A;  1PM3 A;  1HSQ A;  1NEG A;  1UJY A;  1QWE A;  2PUK B;  4EMK B;  2DK3 A;  1MV3 A;  1I8F A;  4PFO A;  3THK A;  4F14 A;  2R57 A;  3OY9 A;  2RJF A;  2RK1 A;  5LJ3 j;  2RHI A;  2MOX A;  1SKU B;  1WJR A;  2YUN A;  3RKW A;  4JLG A;  2ED0 A;  5CR2 A;  3T9N A;  1YIJ A;  4JJD A;  2CRE A;  4HVW A;  3CCL Q;  3TU4 K;  5LJ5 h;  2LX7 A;  4C92 C;  2H8H A;  1U5S A;  1VQ4 T;  1VQ6 T;  3SFM A;  5GAM d;  2BIV A;  4MDX A;  2DL5 A;  4R56 A;  1AZE A;  1VQK A;  3PE0 A;  2XU8 A;  1X6G A;  1VQ9 A;  2K5F A;  2DL7 A;  3M58 A;  2DXC A;  3PVL A;  4EMK A;  3CCQ Q;  4M78 F;  4P5N A;  4KH0 B;  1OU8 A;  4J9I A;  5L8R E;  3WXM B;  2L2P A;  1N8R R;  5DY9 A;  2DYB A;  2DIQ A;  4JZ3 A;  3QO3 A;  1WI7 A;  2QQR A;  1VQ7 A;  3PIO A;  2E12 A;  4J9C A;  3CC4 Q;  2M51 A;  2P0K A;  2WSC E;  1G5V A;  2M0O A;  4C8Q B;  5M9O A;  4LUD A;  4OB1 B;  3CD6 A;  3CC2 T;  4M75 D;  3EG0 A;  1UE9 A;  1VQO A;  3M0R A;  2NUT B;  4L6V 5;  2OTJ Q;  5HK3 A;  1SSH A;  3OW2 A;  2QG9 B;  1N8R C;  4J83 A;  5GMK i;  5FRO A;  4Z02 A;  3CCM T;  1SPK A;  1VA7 A;  1TWB A;  4FYV B;  2KK4 A;  4N0A A;  4DQ2 A;  2RQU A;  4M7D E;  1GCQ C;  4ZN1 A;  3NTI A;  4PKC C;  2CZ1 B;  3PMI A;  4HCK A;  5KCH A;  2RM4 A;  5GAM g;  1VQ5 Q;  1K73 U;  2GQI A;  1X69 A;  3RMQ A;  4RCC A;  1KD1 U;  3OBY A;  2C0O A;  4C8Q A;  3I5S A;  3M0S A;  1S72 T;  5CKH A;  1ZUY A;  2QDY B;  2FZG B;  2KNB B;  1D0X A;  1K8A U;  3CXC A;  2NUT A;  2NYS A;  3UDC A;  2OTL A;  5FRN A;  1TSF A;  3MEU A;  5KH6 A;  1YJN T;  4PK4 A;  1K9M R;  4J7I A;  4N4H A;  4OGE A;  1M30 A;  3JAM E;  4M7A G;  2JW4 A;  5LJ3 d;  1B07 A;  1M3A A;  4PJN A;  4RG2 A;  4N4G A;  1LJO A;  4M78 B;  2L3P A;  2L3S A;  2JZ2 A;  1FMW A;  1PWT A;  5I11 A;  4AFQ C;  4IUP A;  5CQY A;  1K9M C;  4C92 F;  2VGM A;  3OSV A;  4WCI A;  3LLR A;  2KRS A;  1OU9 A;  2YLC A;  2HQH A;  2RI3 A;  1QVF P;  4E7S A;  2DTO A;  2DMO A;  2RQW A;  4HVV A;  2L3Q A;  1Q81 R;  2KI7 A;  1G3W A;  3ZBD A;  4F7U G;  1IB8 A;  3QDR B;  1LVK A;  4C5I A;  2K3Y A;  1YJ9 A;  3QXE B;  3SWN B;  2QDL A;  3OMG A;  3FIF A;  4M75 F;  3REB B;  2DA9 A;  2DZ9 A;  4D8K A;  3QUI A;  1Y7X A;  3SDZ A;  1OX9 A;  4GLM A;  3O8V A;  4M78 A;  3I56 A;  1WHK A;  4XU3 A;  2E1H A;  4ZGJ B;  1G2B A;  4BD3 A;  1U3O A;  3V8J A;  1M2V B;  3CBP A;  3M5A A;  2CS7 A;  1M3B A;  4N4I A;  1PHT A;  3FLG A;  5FU6 B;  3MHX A;  4RKU E;  3KXT A;  1Q81 C;  2MAM A;  5HKC A;  1VQP Q;  3DB4 A;  5IXF A;  2BE7 D;  2QEX T;  5LJ3 g;  4IIO A;  2KQW A;  1IZ6 A;  2X51 A;  2HCK A;  1WNL A;  4BY6 C;  2GTO A;  4IUR A;  5L23 A;  2DJQ A;  2LCS A;  2QQS A;  3SWN A;  1WGS A;  5FU7 C;  1F1B B;  1R8O B;  4L5G A;  5I2S A;  1Y07 A;  1H3Z A;  4PJO D;  2CUD A;  2YXY A;  3C12 A;  4WTO B;  2DXU A;  5GMK l;  1M2V A;  1VQ4 A;  1VQ6 A;  4M77 C;  1MMN A;  3LH0 A;  3CPF A;  3MPU B;  1ACM B;  3JCM b;  2X3X D;  2LMJ A;  4LNP A;  3QII A;  1BI1 A;  3GNG A;  4HT9 A;  3MO8 A;  3JCM Q;  3CCU A;  1R0B G;  2RF0 A;  1W70 A;  4M77 D;  3JCM d;  2HL5 C;  1T3S A;  3M59 A;  1XQH A;  3CEY A;  2VGN A;  3N5B B;  4EMK C;  3QPH A;  1IO6 A;  2K2M A;  1QP3 A;  4AFZ C;  4PJM A;  1QKW A;  5I21 A;  1ZA2 B;  2O9V A;  2JTE A;  3JV3 A;  3OYJ A;  7AT1 B;  4ZTJ A;  2PQW A;  4CRI A;  1YCY A;  2GCX A;  4J8O A;  4A4G A;  2KAF A;  4KGV B;  3CC2 A;  1N9R A;  3UA7 A;  3BDU A;  4M75 B;  1FWZ A;  1KHI A;  1VQN T;  3TRE A;  4FT2 A;  4EMH A;  2EJF A;  2EYY A;  1A0N B;  2D1X A;  5GJV B;  3E9G A;  1QCF A;  1UGV A;  4QVD A;  2EKO A;  2K3X A;  1QVP A;  1JO8 A;  3CCM A;  2XDD A;  2AZS A;  2DRK A;  4E6R A;  1YIT T;  3OYC A;  4M7D G;  1DJ7 B;  2DKG A;  2KYB A;  3I9Q A;  1OUL A;  3GLX A;  1FX7 A;  1YJW Q;  3OSS C;  5LJ5 f;  4A4K A;  4M78 E;  1YIJ Q;  2DBM A;  1KQS P;  2LDM A;  3M54 A;  4IUT A;  3OMC A;  4N0A C;  2XDP A;  4R55 A;  1N8R U;  3OYK A;  4XTU A;  1TUG B;  4JUV A;  1PNJ A;  2RK2 A;  2YRD A;  1S72 A;  2VXF A;  3L2Z A;  1M1K C;  1OQK A;  1WA7 A;  1W2B A;  4O5V A;  3MEA A;  4M75 A;  2IG0 A;  2JTM A;  4JJN K;  1Y71 A;  4J9H A;  4E7K A;  3BY7 A;  1H92 A;  3JCM g;  1RAI B;  2QYZ A;  4C8Q C;  3X26 B;  3TVT A;  3A5Z B;  1VQL T;  3I55 T;  1I07 A;  1YJN A;  2JTF A;  2O01 E;  3CCS T;  2E10 A;  4HT8 A;  2ATC B;  3QYH B;  3CBM A;  3A8O B;  3JB9 J;  2X4Y A;  4XQ3 A;  2LQK A;  2DF6 A;  4RCB A;  1ZX6 A;  1AHJ B;  3I5R A;  1MHN A;  2XK0 A;  4C8Q D;  1K4U S;  3HRS A;  3L2R A;  4UC4 A;  2XI9 A;  1OZ2 A;  1VIE A;  2PVD B;  5CQX A;  2HQE A;  1UHC A;  4DBQ A;  2KRN A;  1K1Z A;  3URG A;  1W4S A;  1RAC B;  1ABQ A;  1VQO Q;  1RLP C;  1GCQ A;  3EFS A;  3TCJ A;  1ZLM A;  1N27 A;  4PNO A;  1NLO C;  4XU0 A;  3NPF A;  3OS0 A;  5KYY B;  1MUZ A;  2K3B A;  1OI1 A;  4M77 F;  4QQD A;  1SRM A;  3PGG A;  3CME T;  2FG0 A;  2HL3 A;  5IHI A;  4KT0 E;  5IH2 A;  1AVZ C;  4C5E A;  1NZ9 A;  3EGU A;  1K9M U;  2IVW A;  1BIB A;  1WHH A;  4WF2 A;  1C1A A;  2E3I A;  2CGH A;  3PTA A;  1FXX A;  5GAM j;  3ULR B;  1GBR A;  2GTJ A;  3RER A;  1SF9 A;  1WXT A;  5GAM e;  1HD3 A;  5GAN 8;  2JN0 A;  4J6Y A;  2GQV A;  1WHG A;  2OTL Q;  4D6W A;  2KXD A;  2ECZ A;  4OMQ A;  3VRY A;  2FO0 A;  2BTT A;  3M0P A;  1NE8 A;  5GJW B;  4C92 E;  2YDL A;  1QVF S;  2E70 A;  3HRU A;  1RAD B;  3VYG A;  1QW1 A;  1AWW A;  1YI2 Q;  1GCP A;  2YHT A;  2RHY A;  1NG2 A;  2HDA A;  1WQW A;  3OW2 P;  3S3M A;  3S6W A;  2MF2 A;  3SHW A;  1Q81 U;  4BE1 A;  3S3N A;  5J26 A;  2JS0 A;  1IHW A;  1RAG B;  2ZPF B;  4DBR A;  2MYS A;  4PJO B;  4M75 E;  2GNC A;  3V7R A;  4LD9 K;  5IN1 A;  4MML A;  3SWN C;  3UAT A;  4BY6 B;  1NEB A;  3TSZ A;  1X6O A;  3G4S T;  1KQS A;  5IT9 E;  3FEO A;  1BIA A;  4Z88 A;  3M4G A;  3A8M B;  1N5Z A;  2KRM A;  3C95 A;  4C8Q F;  4OB0 B;  2LT1 A;  1O9S A;  1JXM A;  5CKE A;  5FU6 C;  1Y57 A;  3OS5 A;  3CXC P;  2M16 A;  3MP1 A;  3G6E Q;  2CT4 A;  1X27 A;  1G83 A;  1GFC A;  1M90 R;  3PIP A;  2L5Q A;  1G3Y A;  3I56 T;  1YP5 A;  2X4J A;  1M1G A;  3D7S B;  2D8J A;  2JM8 A;  3VS5 A;  4PJO A;  4XTZ A;  2AKL A;  2DIL A;  2JS2 A;  4QQ6 A;  1VQ8 T;  3HFN A;  3MEW A;  2OI3 A;  3H0I A;  1VQN A;  3LYI A;  4MZT A;  4ESR A;  4RUG A;  4FSS A;  2FZK B;  3JB9 H;  2DYI A;  1BCO A;  1XTD A;  2WSE E;  3CC7 Q;  1M90 C;  2O9S A;  2LX9 A;  3H0H A;  1YIT A;  2LNH B;  2YLB A;  4QT7 A;  4BDY A;  2DO3 A;  1JU5 C;  2A7Y A;  3KBG A;  3JSC A;  4M77 A;  2QQ9 A;  3SB2 A;  5LJ3 e;  2P0P A;  1YHQ Q;  2ZGW A;  2HKN A;  5CK9 A;  4C0D B;  2DVJ A;  1UJ0 A;  1WQ7 A;  1I5O B;  3X24 B;  1PCX A;  3MEV A;  1ZQ1 A;  3OB9 A;  2MWP A;  1ABO A;  1P92 A;  3OYI A;  3VS4 A;  3R6N A;  4LN2 A;  1X2Q A;  2CUB A;  5DM7 R;  3CCV Q;  4J7F A;  1YNZ A;  3CCL T;  2EYZ A;  2Y4Y A;  4OMO A;  5CKF A;  2K6D A;  3CCU T;  3JCM h;  1VQL A;  3I55 A;  1OX8 A;  3NFC A;  1AWJ A;  3CCS A;  2L0A A;  4JJC A;  1G8X A;  2DL4 A;  3A98 A;  4M75 C;  1PD0 A;  3CCE Q;  1X6B A;  4EPC A;  1M4Z A;  4C0Z A;  3M56 A;  2FRW A;  3CCQ T;  1KQS S;  2BZY A;  4X9D A;  4V2S A;  1MV0 B;  2F69 A;  3H41 A;  1KK7 A;  3QWX X;  3WVD B;  1EFN A;  4ME7 A;  1B34 B;  2RHU A;  5A2Q E;  4M7A D;  2KYM A;  3V7S A;  2XDB A;  4ORZ A;  3BFM A;  3CC4 T;  1E6H A;  3L42 A;  2VB6 A;  2LJ1 A;  1SEM A;  2DE0 X;  4Y91 A;  3CME A;  2Z0W A;  2A28 A;  5LL6 S;  2EQI A;  1AWO A;  1D0Z A;  1YCS B;  3QKJ A;  2RN8 A;  3INZ A;  2M1H A;  3GP8 A;  3F70 A;  2ED1 A;  4AMC A;  2ZPB B;  4ANJ A;  3OYL A;  5D6Y A;  4JLI A;  5FWC A;  4LDW A;  1KC8 R;  1U8R A;  2R58 A;  1PG5 B;  2AK5 A;  1QCO A;  1B34 A;  4E7H A;  1YBY A;  1ZHI A;  1SRL A;  5C0M A;  3A8H B;  1JBM A;  2V1Q A;  2I2L A;  3LH5 A;  4C92 G;  5LJ5 j;  1D1B A;  1WZO A;  4M77 E;  2WAC A;  3PNW C;  3JCM e;  1KC8 C;  4HKE A;  1I4K 1;  1HXD A;  2VKN A;  2VXE A;  4HA8 A;  1B3Q A;  3PT9 A;  2FPD A;  2J6F A;  2L8D A;  2EAY A;  2O31 A;  3P8D A;  2QTX A;  1M5Q 1;  2RD1 A;  4E7Z A;  2V8J A;  3H8Z A;  1H8K A;  4XTW A;  5GMK m;  2EPD A;  4HCB A;  5CKB A;  1VYT A;  1WHL A;  1UEB A;  1Q82 R;  3G4S A;  2F1L A;  2F2V A;  2DET A;  2RMO A;  2DXB A;  3L1A A;  4RMO A;  2DIG A;  3OYF A;  2F5K A;  2CH4 W;  2PNI A;  2EBP A;  4R0K A;  4KBM B;  3J81 E;  2Y90 A;  4DA4 A;  3EFO B;  3QHS A;  4IUV A;  1GRI A;  1W2B P;  4QW2 A;  4AT1 B;  2YUQ A;  5EC7 A;  1WFW A;  2CP2 A;  4FT4 A;  3EGD B;  3OW2 S;  4M7A F;  3V8K A;  3A8L B;  1AZG B;  2D0Q B;  1RAH B;  4BB7 A;  2P0Q A;  2I0N A;  1LPL A;  1Q82 C;  2KXC A;  2E3H A;  1ZUK A;  1KFZ A;  1TUD A;  1ZSZ B;  2BE9 B;  1OYX A;  2FPE A;  3BW1 A;  3OYH A;  2BZ8 A;  4E47 A;  3RDV A;  1OEB A;  4XTV A;  1VQ8 A;  2ABL A;  2D9T A;  2F5T X;  3CBO A;  2EQJ A;  2RPN A;  4GBQ A;  2QEX Q;  4Z8A A;  4PJO C;  2MMP A;  1T0H A;  4HCC A;  2CT3 A;  2D0N A;  1UHF A;  3EG3 A;  3EFO A;  1RAE B;  2LQW A;  4MZM A;  4RG8 A;  4BI4 A;  2EWN A;  3OS2 A;  1VQP T;  4OB2 B;  4JRP A;  4F7U F;  3QDF A;  3CXC S;  4ATO A;  4C8Q E;  3EGD A;  2V26 A;  2M0Y A;  1AEY A;  3MP8 A;  4KH1 B;  1PSE A;  2E41 A;  2MK5 A;  1YWP A;  4EIK A;  4M7D D;  2FPF A;  2CYZ B;  2V8K A;  4LUE A;  4AFS C;  2YUP A;  2E65 A;  1M90 U;  5D7U A;  4E7I A;  3VS7 A;  1M8M A;  4AG1 C;  1YWO A;  1ZUU A;  3LW5 E;  1NPP A;  4IUQ A;  1AD5 A;  3AT1 B;  3CMA Q;  1X43 A;  2RQT A;  3RUX A;  2ESW A;  3CCL A;  2ZPE B;  3G71 Q;  2DM1 A;  3GBQ A;  1SSF A;  2E4H A;  1U1T A;  4J9G A;  4IKF A;  1JXO A;  1TUC A;  5J39 A;  5FRM A;  5LJ5 d;  3MJX A;  2J6K A;  2CSQ A;  3S3O A;  2JOY A;  2K9G A;  3JB9 G;  4Y92 A;  3C94 A;  2JJ9 A;  3C0C A;  5KCO A;  5AYF A;  5HCK A;  2KE9 A;  4LD6 A;  4J6X A;  1UG1 A;  3EFR A;  1WXB A;  3CCQ A;  3EGX B;  3CCJ Q;  2QK0 A;  2CDT A;  4ZGE B;  1VQM T;  2A08 A;  1R0C B;  4YTL A;  3CCR Q;  3SD4 A;  2IIM A;  2VAS A;  2MI6 A;  3QJY A;  4NOY A;  2QA4 Q;  1GBQ A;  4M7A B;  4FCY A;  4C0D C;  2CZ6 B;  3CC4 A;  1M1K R;  3M0U A;  5EG2 A;  4FYW B;  2HSE B;  2K7A A;  2RHZ A;  1YFN A;  5D6W A;  2DJZ A;  4Y28 E;  2H3E B;  4JRK A;  3TQ7 P;  5GAN j;  1NJI R;  2VUB A;  3E2U A;  2P4R A;  5GAM h;  2QTV A;  3A1P A;  3EGX A;  2EYW A;  1C0M A;  5CCA A;  2PUO B;  2RJD A;  4DBF A;  3JCM W;  1YJW T;  1VQK Q;  1N9S A;  4F7U B;  1VQ9 Q;  2YRV A;  3JCM f;  5LJ5 g;  1VQ5 A;  4M7A A;  1M2O A;  3M9Q A;  1U1S A;  3G1J A;  3FC3 A;  2RB6 A;  1G3S A;  2KR3 A;  4FL6 A;  5GMK j;  2G6F X;  2CH4 A;  3PFS A;  1NJI C;  1IGU A;  3EH1 A;  3GF5 A;  4OML A;  4C5H A;  4PJO F;  1OPK A;  2X9H A;  4KUI A;  2KBT A;  2DNU A;  3OBW A;  2FYK A;  2QGG A;  3CPW A;  2HBW A;  1KG1 A;  1VQ7 Q;  4J9B A;  1WDX A;  2FL7 A;  1K0S A;  3HTR A;  1NPR A;  4PL6 A;  2LJ3 A;  1Q7Y R;  1BB9 A;  3JCM V;  2ROT A;  3H6Z A;  4II1 A;  2COW A;  2DX1 A;  1BI0 A;  4A4E A;  3CD6 Q;  2CP7 A;  4FW1 A;  4F7U A;  4RTY A;  1IGQ A;  2ZPI B;  1KC8 U;  2MWO A;  4OMM A;  4IUU A;  2EIF A;  2QXF A;  3R6O A;  5KE3 A;  2DVE A;  4C0G A;  3VUB A;  4J9D A;  4DBH A;  5KE2 A;  6AT1 B;  1Q7Y C;  4D8D A;  1WXU A;  4ELY C;  4J5Y A;  4HCZ A;  4DOW A;  1QVG P;  3I35 A;  2E5K A;  5GAO p;  1SG5 A;  5A0L A;  1PD1 A;  2PTK A;  4J9E A;  3EHR A;  5GAN 4;  4K11 A;  2RH2 A;  1M27 C;  2VV5 A;  3E19 A;  4FYX B;  2W0Z A;  2E64 A;  2FRY A;  2NUZ A;  5KYY A;  1OPL A;  2W10 A;  3KUF A;  2P4T A;  4JS5 A;  2RI5 A;  2P84 A;  2HNI A;  4OB3 B;  1NLP C;  3GOX A;  4JJB A;  5LJ3 h;  2L89 A;  3UF4 A;  2FB7 A;  3ZL7 C;  1Q82 U;  4EMG A;  2EFI A;  2HAX A;  5GAO q;  2LVM A;  1I81 A;  1VQP A;  1W2B S;  2E6N A;  1KQ2 A;  2HMA A;  5GAN d;  1U06 A;  3EH2 A;  1JEG A;  2XD0 A;  1TG0 A;  1YI2 T;  1M8V A;  3VS1 A;  1IXD A;  2A36 A;  5GAO m;  2DAQ A;  1AWX A;  4M7A E;  2DTI A;  1E6G A;  4M7D B;  1RAA B;  5KYX B;  2EVR A;  3P8H A;  2KDS A;  3CPW S;  1WJQ A;  3JCM X;  1KHC A;  3NGP A;  5CIU A;  2XIC A;  2VWF A;  4XAX B;  2OAW A;  2HEQ A;  1YN8 A;  2EYQ A;  1ARK A;  3WVE B;  2HZY A;  4NL2 A;  4RTV A;  4BI8 B;  1BI3 A;  1ZSZ C;  2K57 A;  4RTW A;  3RES A;  1H3H A;  1YJ9 Q;  2DD5 A;  2YSQ A;  3HKS A;  4X9C A;  3RKX A;  3CQT A;  1XOV A;  2LT4 A;  4NS5 A;  4C5G A;  2GGR A;  2GBQ A;  3I56 Q;  3M55 A;  1M3C A;  3VS6 A;  3E9F A;  1NYG A;  1GFD A;  2FVU A;  1S1N A;  2MCN A;  4GLK A;  4FSX A;  4AG2 C;  3HSB A;  3G6E T;  5GAO r;  1VQM A;  4M7D A;  5KYX A;  4ELZ C;  4FYY B;  3FJ5 A;  2KRO A;  3MKD A;  1VQ8 Q;  1KIK A;  1JJ2 A;  2HQX A;  2AKK A;  2DL3 A;  4LDX A;  3BE3 A;  3LGL A;  3UT1 A;  3RIR A;  4OMP A;  3JB9 I;  2PZ1 A;  4A4F A;  2CP3 A;  1PKT A;  1FYN A;  4A4H A;  1ZBX A;  4QQG A;  1K0X A;  5GAN g;  4CC2 A;  3Q1J A;  3OS1 A;  2J06 A;  1UEC A;  2F2X A;  1NBE B;  3HPW A;  5IHN A;  5CVI A;  2ZCF B;  4M78 G;  4XTX A;  1RI9 A;  4BDZ A;  1O75 A;  4QVC A;  4LXC A;  2EGC A;  1W1F A;  1NYF A;  2JMA A;  4OMF B;  3CC7 T;  4JRQ A;  1X2K A;  3RKY A;  2RQV A;  5GAO l;  1D3B B;  1VQ4 Q;  1VQ6 Q;  4FU6 A;  1TXQ A;  4A54 A;  3L2U A;  3HFO A;  4XU1 A;  1YJW A;  1QVG A;  4F16 A;  1FMV A;  1YHQ T;  3FJP A;  1LCK A;  3ZEH A;  4KGZ B;  2KEA A;  2LNV A;  1WLP B;  2EJ9 A;  2CZ7 B;  3HRT A;  5D6X A;  1QKX A;  2HSP A;  3CCU Q;  3QYG B;  9ATC B;  2RI2 A;  1WJS A;  3CCV T;  4M7A C;  5KYW B;  1M1K U;  2NLU A;  1UB4 A;  3L2Q A;  1K9A A;  2DD4 A;  3OYG A;  3MET A;  3EAE A;  1GL5 A;  1IRX A;  4C92 D;  3KFV A;  2NWM A;  3CCE T;  2H3J A;  2AZV A;  1D3B A;  1G3T A;  4MDW A;  3CC2 Q;  1NJI U;  1UDL A;  4B6M A;  3BDL A;  4BUG A;  2JUF A;  5GAN 5;  1UGS B;  2QAS A;  1Q86 R;  1XNI A;  1E7O A;  1TU0 B;  5CAI A;  1ZBJ A;  1PSF A;  4BE0 A;  1EX4 A;  4ZGD B;  3CCM Q;  2EKH A;  1J3T A;  1TOV A;  2OTJ T;  2V8I A;  5GAM f;  5KYW A;  3C4S A;  2LQ8 A;  1I5L A;  5ECA A;  2QGF B;  2J05 A;  1JJ2 S;  4PJO E;  2DL8 A;  1BYM A;  1RI0 A;  5A0D A;  1Q86 C;  1HJD A;  1S72 Q;  2FEI A;  4FM4 B;  2DRM A;  3L2V A;  3M53 A;  2DER A;  1TH7 A;  3HP9 A;  4FIB A;  1VQ5 T;  2PVG B;  1Q7Y U;  4QVZ A;  1X75 C;  1EZZ B;  1RL2 A;  2L3R A;  3MP6 A;  1CKB A;  2LC4 A;  3ME9 A;  5J3B A;  2RHX A;  3OYB A;  2GFA A;  3UWN A;  2MPX C;  3VKI A;  3RBB B;  1YJN Q;  3QZ9 B;  1HK9 A;  3VJP A;  2M02 A;  8ATC B;  3TEE A;  3TSW A;  1HYO A;  2COY A;  5LJ5 e;  2QAZ A;  4E7L A;  5FWB A;  4LDU A;  1WYX A;  2ENM A;  1QVG S;  1OV3 A;  3JCM c;  1D1C A;  2QI2 A;  3J7A F;  1VOM A;  3OYY A;  1ZSG A;  2EW3 A;  3OYM A;  2IPO B;  4M75 G;  1QQJ A;  2X4W A;  3VS3 A;  5FW9 A;  1YI2 A;  5GAN 2;  2C0I A;  1V76 A;  2LRQ A;  3RMS A;  2X4X A;  2O88 A;  4OVA A;  2QQA A;  3E1S A;  4RTX A;  1BCM A;  4AFU C;  2GF7 A;  2HKQ B;  2D8H A;  2VC8 A;  2K4Y A;  1CKA A;  4F04 B;  1AT1 B;  3OA6 A;  1H64 1;  2RO0 A;  2DEU A;  1PKS A;  1RAB B;  3H0F A;  2CKK A;  1W6X A;  1Z9Q A;  4CC4 B;  4A63 B;  2OJ2 A;  2PU9 B;  2KY9 A;  2J6O A;  1OZ3 A;  2OAU A;  1SHG A;  4OGC A;  4RTU A;  2EQK A;  3EG2 A;  3JB9 D;  2LP5 A;  3G6E A;  4LDY A;  3OQ5 A;  3CPW P;  2YWW A;  1GXI E;  2C06 A;  3NMZ C;  5IAY A;  5LJ3 f;  1MNE A;  3QWY A;  5CKD A;  1MND A;  3VRZ A;  2XG8 D;  3L2W A;  1I0C A;  1NM7 A;  4OF1 A;  2DTH A;  2COZ A;  2DXT A;  2JMC A;  2KGT A;  4M7D C;  1WX6 A;  2ZZD A;  2A37 A;  1VYV A;  1BBZ A;  2SRC A;  4BAC A;  1UGR B;  4RTT A;  1QLY A;  5GAN h;  1BU1 A;  3RNJ A;  3LWH A;  4EDU A;  1WHM A;  2FZC B;  3LWI A;  4VUB A;  3CC7 A;  1ZSZ A;  1D09 B;  1UUE A;  4JRI A;  1RUW A;  2GFU A;  2QQB A;  1CSK A;  1JB0 E;  3ER0 A;  4HVU A;  4NL3 A;  1YHQ A;  4JZ4 A;  5GMK h;  3V8L A;  2DZC A;  3HHT B;  5HK0 A;  2CP6 A;  1VIF A;  4TVR A;  2JXB A;  5GAN 3;  1Q95 G;  1RAF B;  3JRZ A;  4X1V A;  3GPL A;  2DPP B;  4PFP A;  3CMA T;  3GNF B;  3CCV A;  3VS0 A;  2E5Q A;  3G71 T;  1IHV A;  1SHF A;  8AT1 B;  1D1A A;  2DLP A;  4Q5W A;  2LCL A;  4C92 B;  4XTY A;  5I22 A;  2NUP B;  4LDV A;  3CCE A;  1VQM Q;  1FMK A;  3ASK A;  2RQR A;  2XHC A;  5DLO A;  3UPU A;  2CP0 A;  3P8B B;  2LQN A;  1VQN Q;  3LX7 A;  3CCJ T;  1BK2 A;  2AIR B;  4KRT A;  3HL8 A;  4E7J A;  3CCR T;  2HBP A;  2R5A A;  1YIT Q;  2DFU A;  3ZFJ A;  3EG9 B;  4IIM A;  1T3L A;  2O4X B;  2RJC A;  4MZP A;  2QA4 T;  3DLM A;  1JRI A;  2OTJ A;  3NTH A;  1JQQ A;  1T0J A;  2EQU A;  2B86 A;  2CP5 A;  2ZPH B;  2J7I A;  1AOJ A;  1N6A A;  3GIB A;  3DLL A;  5C6S A;  3JB9 F;  4LE9 A;  1UGP B;  2K5I A;  2M9U A;  1TTH B;  4PJO G;  5IHK A;  2EGE A;  5GAN e;  4C92 A;  4OMN A;  2NUP A;  4F17 A;  4PLL A;  2EYX A;  2RNA A;  3QG1 A;  4FW2 A;  1YIJ T;  4MMK A;  2LZ6 B;  2YUO A;  3SEM A;  1QVF A;  1VUB A;  3FB9 A;  1Y96 B;  2X35 A;  4BE2 A;  1VQL Q;  3I55 Q;  4CI0 C;  3JCM P;  4KUD K;  3AHU A;  3CCS Q;  1VQK T;  3J80 E;  1Q86 U;  3EG9 A;  5GMK e;  4M77 G;  1VQ9 T;  2O4X A;  1UFF A;  4M7D F;  1BI2 A;  2JT4 A;  4GY5 A;  2A0F B;  1JJ2 P;  5GAN 7;  1OOT A;  3FRN A;  1I1J A;  2ZAE A;  2Y4X A;  2JM9 A;  1K73 R;  2HD0 A;  2YRC A;  4DOV A;  2LTO A;  2OX7 A;  1QCN A;  4PLI A;  3VV0 A;  5A0G A;  1KD1 R;  2KVQ G;  5GAO n;  1Z9Z A;  3LGF A;  4DEX A;  2K79 A;  1KQ1 A;  3VS2 A;  2WSF E;  3OYD A;  1WPY A;  1VQ7 T;  3OYE A;  5KYN A;  1K8A R;  2K2V A;  3NHN A;  2AHJ B;  3PMT A;  2XKO C;  1Y96 A;  3CME Q;  5FLX E;  1TS9 A;  3CD6 T;  3V7C A;  3M0T A;  1VQO T;  2F2W A;  1M1F A;  2MIO A;  2XID A;  1IRE B;  1K73 C;  4QKU A;  4PFZ A;  2EQM A;  2KMT A;  1K76 A;  4J9F A;  3JCM J;  1KD1 C;  4CC3 A;  4ZNX A;  1UGQ B;  1M9S A;  2O2O A;  2CSI A;  1K8A C;  1KSW A;  1ZA1 B;  3X28 B;  2LJ0 A;  4A53 A;  2K5L A;  4B9W A;  4C0F A;  5I2M A;  1QWF A;  1MMA A;  1C6V X;  1RLQ C;  5DLQ E;  1KJW A;  3H9N A;  2YT6 A;  3FDR A;  1PRL C;  1QP2 A;  4XK8 E;  2V1R A;  1MGQ A;  2RA2 A;  4E2F B;  1X01 A;  4BI3 A;  3MCA B;  2VVK A;  2BKD N;  3RR6 A;  2X3W D;  2OTL T;  1LNX A;  1PRM C;  2ZPG B;  3M57 A;  4JDS A;  4M78 C;  4X34 A;  4C8Q G;  4DEY A;  2E6Z A;  1UTI A;  2SEM A;  1B7T A;  4HXJ A;  5GAN 6;  5KYU B;  3U23 A;  2KT8 A;  2XMF A;  3X20 B;  2QEX A;  2G3R A;  3VUZ A;  2ROL A;  4ZTF A;  3EHQ A;  5IXB A;  4L59 A;  3M0Q A;  2AT1 B;  2JVV A;  2VYT A;  4KUL A;  4O6J A;  4OP0 A;  2EGA A;  1VYU A;  2A3L A;  2DEQ A;  1D0Y A;  1LOJ A;  3EG1 A;  1R77 A;  1V1C A;  4M78 D; 
#chains in the Genus database with same CATH homology
 4XTU A;  4JUV A;  3BDL A;  2KSS A;  4BUG A;  2JUF A;  5GAN 5;  1UGS B;  3G7Z A;  2RK2 A;  1S72 A;  2VXF A;  1OYX A;  3M4Y A;  4ZN3 A;  3L2Z A;  1N8R U;  3BW1 A;  1XNI A;  3OYH A;  2FHD A;  1M1K C;  5CAI A;  4E47 A;  4J6W A;  4XTV A;  1VQ8 A;  2R5M A;  4XU2 A;  1PSF A;  4BE0 A;  4ZGD B;  2CZ0 B;  1W2B A;  4O5V A;  2D9T A;  2F5T X;  3MEA A;  3CBO A;  4M75 A;  2IG0 A;  2JTM A;  3X25 B;  1Y71 A;  4JJN K;  4E7K A;  2EQJ A;  3BY7 A;  3JCM g;  4JS4 A;  5HY6 A;  1EIF A;  2RJE A;  4PJO C;  2MMP A;  4C8Q C;  3X26 B;  3OYN A;  2OTJ T;  3A5Z B;  3VU3 C;  1VQL T;  3I55 T;  3CMA A;  1YJN A;  2V8I A;  5GAM f;  4HCC A;  3QSU A;  2JTF A;  3C4S A;  2O01 E;  2LQ8 A;  3CCS T;  2JNG A;  1I5L A;  2E10 A;  4HT8 A;  3QYH B;  3G71 A;  5FU7 B;  3CBM A;  4MZM A;  4RG8 A;  4B9X A;  2EWN A;  4BI4 A;  3OS2 A;  3A8O B;  4OB2 B;  4JRP A;  3JB9 J;  1VQP T;  1JJ2 S;  4F7U F;  3CXC S;  4ATO A;  2X4Y A;  4C8Q E;  4PJO E;  1BYM A;  1RI0 A;  2BUD A;  1BKB A;  4F7U E;  4XQ3 A;  3VYH B;  2LQK A;  5A0D A;  1YJ9 T;  1Q86 C;  3MP8 A;  4RCB A;  1AHJ B;  1PSE A;  1MHN A;  2E41 A;  2XK0 A;  4C8Q D;  4FM4 B;  3HRS A;  3L2R A;  4UC4 A;  4M77 B;  2XI9 A;  3L2V A;  1OZ2 A;  2PVO B;  3M53 A;  5CO7 A;  1VIE A;  2PVD B;  1TH7 A;  3HP9 A;  4FIB A;  5CQX A;  4M7D D;  1VQ5 T;  2HQE A;  2PVG B;  2V8K A;  2CYZ B;  1Q7Y U;  4QVZ A;  2B8A A;  1X75 C;  3URG A;  2E65 A;  3QJ6 A;  1M90 U;  1RL2 A;  2L3R A;  2LCC A;  3MP6 A;  1W4S A;  3DB3 A;  4E7I A;  2LC4 A;  3ME9 A;  5J3B A;  2RHX A;  3OYB A;  3OYA A;  2GFA A;  3DKM A;  3LW5 E;  1NPP A;  4IUQ A;  3UWN A;  3QBY A;  3VKI A;  3CCJ A;  3TCJ A;  3EFS A;  4PNO A;  1N27 A;  3A8G B;  4XU0 A;  5GAN f;  3QZ9 B;  3RUX A;  1HK9 A;  3VJP A;  3CCL A;  3CCR A;  2EJG A;  3TEE A;  3OS0 A;  2ZPE B;  1OI1 A;  4M77 F;  3NTK A;  4QQD A;  1SSF A;  2D6F A;  3PGG A;  3CME T;  3QZ5 B;  1U1T A;  1V29 B;  2QA4 A;  5LJ5 e;  4IKF A;  5J39 A;  4E7L A;  5FRM A;  5LJ5 d;  2PUK B;  4LDU A;  4EMK B;  2DK3 A;  3S3O A;  2JOY A;  1I8F A;  4KT0 E;  4C5E A;  3JB9 G;  1QVG S;  3JCM c;  1NZ9 A;  2R57 A;  2QI2 A;  3C94 A;  3OY9 A;  2RJF A;  2RK1 A;  5LJ3 j;  5KCO A;  5AYF A;  2RHI A;  1K9M U;  2IVW A;  1BIB A;  1WJR A;  4LD6 A;  3J7A F;  3RKW A;  4JLG A;  4J6X A;  3OYY A;  3EFR A;  4WF2 A;  4M75 G;  3OYM A;  2X4W A;  3CCQ A;  1YI2 A;  5CR2 A;  2CGH A;  3T9N A;  3PTA A;  1YIJ A;  4ZGE B;  1FXX A;  5GAM j;  5GAN 2;  1VQM T;  4YTL A;  2LRQ A;  3RMS A;  3SD4 A;  1VQ7 T;  2MI6 A;  3RER A;  3QJY A;  4NOY A;  2X4X A;  3TU4 K;  5LJ5 h;  4C92 C;  4OVA A;  5GAM e;  5GAN 8;  2JN0 A;  2QQA A;  4J6Y A;  4M7A B;  1VQ4 T;  1VQ6 T;  3SFM A;  2GQV A;  2BIV A;  3E1S A;  4C0D C;  5GAM d;  2CZ6 B;  4MDX A;  4R56 A;  3CC4 A;  2GF7 A;  4D6W A;  1VQK A;  2VC8 A;  4R55 A;  2XU8 A;  2K4Y A;  1VQ9 A;  5EG2 A;  2K5F A;  4N0A C;  1NE8 A;  4C92 E;  3OA6 A;  3M58 A;  1H64 1;  1QVF S;  2DXC A;  2RO0 A;  2E70 A;  3HRU A;  4EMK A;  2RHZ A;  3VYG A;  2CKK A;  5D6W A;  2DJZ A;  4Y28 E;  1QW1 A;  4M78 F;  4JRK A;  4P5N A;  5L8R E;  2PU9 B;  2YHT A;  2RHY A;  5GAN j;  3WXM B;  2VUB A;  5DY9 A;  1WQW A;  2KY9 A;  3S3M A;  3S6W A;  2MF2 A;  1OZ3 A;  2DIQ A;  5GAM h;  2OAU A;  3QO3 A;  1Q81 U;  4OGC A;  2EQK A;  2QQR A;  5CCA A;  4BE1 A;  2PUO B;  3S3N A;  1VQ7 A;  5J26 A;  2RJD A;  3JB9 D;  3G6E A;  4LDY A;  3PIO A;  2E12 A;  3OQ5 A;  3JCM W;  2ZPF B;  1GXI E;  1YJW T;  2C06 A;  2P0K A;  2WSC E;  4PJO B;  2M0O A;  1N9S A;  4M75 E;  3V7R A;  5LJ3 f;  4C8Q B;  2YRV A;  4F7U B;  5IAY A;  4LD9 K;  5IN1 A;  3JCM f;  5M9O A;  4MML A;  4OB1 B;  3SWN C;  5LJ5 g;  1VQ5 A;  4M7A A;  4BY6 B;  3CD6 A;  3CC2 T;  3M9Q A;  5CKD A;  1U1S A;  4M75 D;  3FC3 A;  2RB6 A;  1X6O A;  1G3S A;  2XG8 D;  1VQO A;  3L2W A;  3G4S T;  4FL6 A;  5GMK j;  4OF1 A;  4L6V 5;  2DTH A;  3FEO A;  2DXT A;  5HK3 A;  5IT9 E;  1KQS A;  3PFS A;  4M7D C;  1BIA A;  3OW2 A;  2ZZD A;  3M4G A;  3A8M B;  1NJI C;  1N8R C;  4J83 A;  3GF5 A;  5GMK i;  4C5H A;  5FRO A;  4Z02 A;  4BAC A;  3C95 A;  3CCM T;  4PJO F;  4C8Q F;  1UGR B;  4KUI A;  4OB0 B;  1VQN T;  2LT1 A;  3OBW A;  1O9S A;  2FYK A;  2KK4 A;  5GAN h;  3CPW A;  4N0A A;  5CKE A;  5FU6 C;  4DQ2 A;  3LWH A;  4EDU A;  1KG1 A;  3OS5 A;  4M7D E;  2M16 A;  2FL7 A;  3MP1 A;  4ZN1 A;  3NTI A;  1NPR A;  4PKC C;  3LWI A;  2CZ1 B;  3PMI A;  4PL6 A;  4VUB A;  5KCH A;  3CC7 A;  3JCM V;  2RM4 A;  3PIP A;  2L5Q A;  1G3Y A;  3H6Z A;  4II1 A;  5GAM g;  3I56 T;  1K73 U;  2X4J A;  1M1G A;  4A4E A;  1BI0 A;  4JRI A;  2GFU A;  2QQB A;  3RMQ A;  4RCC A;  1KD1 U;  3OBY A;  4PJO A;  4C8Q A;  1JB0 E;  4XTZ A;  4F7U A;  3ER0 A;  1S72 T;  4NL3 A;  5CKH A;  1YHQ A;  2QDY B;  4QQ6 A;  2ZPI B;  5GMK h;  1KC8 U;  3V8L A;  2MWO A;  3HFN A;  3MEW A;  2DZC A;  3HHT B;  1K8A U;  1VQ8 T;  5HK0 A;  4IUU A;  1VIF A;  4TVR A;  2EIF A;  3CXC A;  2QXF A;  3R6O A;  3LYI A;  4MZT A;  5GAN 3;  1VQN A;  1G5V A;  5KE3 A;  2DVE A;  3JRZ A;  4C0G A;  3UDC A;  2OTL A;  3GPL A;  3VUB A;  5FRN A;  3JB9 H;  5KE2 A;  2DPP B;  3MEU A;  5KH6 A;  3CMA T;  1YJN T;  1Q7Y C;  3GNF B;  1XTD A;  4ELY C;  3CCV A;  2WSE E;  4J5Y A;  1M90 C;  4HCZ A;  4DOW A;  2E5Q A;  2LX9 A;  3G71 T;  4IUT A;  1YIT A;  2YLB A;  4BDY A;  2DO3 A;  4J7I A;  2A7Y A;  3KBG A;  3JSC A;  4N4H A;  4M77 A;  2QQ9 A;  3SB2 A;  5LJ3 e;  4OGE A;  5GAO p;  4Q5W A;  3JAM E;  2LCL A;  4M7A G;  4C92 B;  5A0L A;  5LJ3 d;  2P0P A;  4XTY A;  2ZGW A;  5GAN 4;  4LDV A;  5CK9 A;  3CCE A;  4C0D B;  3ASK A;  2RH2 A;  4RG2 A;  4N4G A;  1WQ7 A;  2XHC A;  5DLO A;  3UPU A;  2VV5 A;  1LJO A;  3P8B B;  3X24 B;  3E19 A;  3MEV A;  4M78 B;  2E64 A;  2JZ2 A;  1ZQ1 A;  3OB9 A;  2MWP A;  3LX7 A;  1P92 A;  3KUF A;  4IUP A;  3OYI A;  3CCJ T;  5CQY A;  2P4T A;  1K9M C;  5DM7 R;  4C92 F;  2VGM A;  2RI5 A;  3HL8 A;  3OSV A;  4JS5 A;  4E7J A;  4J7F A;  3CCL T;  3LLR A;  3CCR T;  2HBP A;  2HNI A;  2R5A A;  3ZFJ A;  2Y4Y A;  2YLC A;  4OB3 B;  2O4X B;  2RJC A;  4MZP A;  5CKF A;  3GOX A;  2RI3 A;  2QA4 T;  5LJ3 h;  3CCU T;  2L89 A;  1JRI A;  3DLM A;  3NTH A;  2OTJ A;  3JCM h;  1VQL A;  3I55 A;  2FB7 A;  2DTO A;  2EQU A;  2ZPH B;  3NFC A;  1Q82 U;  4EMG A;  1N6A A;  2EFI A;  3GIB A;  3DLL A;  3CCS A;  2HAX A;  5GAO q;  2LVM A;  5C6S A;  1I81 A;  4M75 C;  3JB9 F;  1UGP B;  1VQP A;  2K5I A;  1W2B S;  2M9U A;  2E6N A;  4PJO G;  1G3W A;  3ZBD A;  4F7U G;  3OMC A;  4EPC A;  5GAN e;  3QDR B;  1KQ2 A;  4C5I A;  1M4Z A;  4C0Z A;  2K3Y A;  4C92 A;  1YJ9 A;  5GAN d;  3QXE B;  3M56 A;  3SWN B;  3OMG A;  3FIF A;  3CCQ T;  4M75 F;  4PLL A;  2XD0 A;  1KQS S;  2DZ9 A;  3QG1 A;  3QUI A;  1Y7X A;  4X9D A;  3SDZ A;  1YI2 T;  1YIJ T;  4V2S A;  1M8V A;  3O8V A;  4MMK A;  5GAO m;  2DAQ A;  4M7A E;  4M78 A;  2F69 A;  2DTI A;  3I56 A;  4XU3 A;  4M7D B;  2E1H A;  3WVD B;  1QVF A;  4ZGJ B;  1Q81 C;  4ME7 A;  1B34 B;  2RHU A;  1VUB A;  3FB9 A;  3P8H A;  1Y96 B;  5A2Q E;  4M7A D;  2KDS A;  2X35 A;  4BD3 A;  3CPW S;  3V7S A;  3V8J A;  1WJQ A;  4BE2 A;  3JCM X;  1KHC A;  2XDB A;  5CIU A;  2XIC A;  3CBP A;  4XAX B;  4CI0 C;  3BFM A;  3JCM P;  3M5A A;  3CC4 T;  2CS7 A;  2EYQ A;  4N4I A;  4KUD K;  3AHU A;  3WVE B;  1VQK T;  3L42 A;  4NL2 A;  3FLG A;  3J80 E;  5FU6 B;  5GMK e;  1Q86 U;  3MHX A;  4M77 G;  4RKU E;  4BI8 B;  2MAM A;  1BI3 A;  5HKC A;  2O4X A;  4Y91 A;  3KXT A;  1VQ9 T;  3CME A;  2K57 A;  3DB4 A;  3RES A;  2QEX T;  5LJ3 g;  4M7D F;  1BI2 A;  2KQW A;  1IZ6 A;  4GY5 A;  5LL6 S;  5GAN 7;  2DD5 A;  3HKS A;  4X9C A;  3RKX A;  3FRN A;  1WNL A;  2Y4X A;  3QKJ A;  3GP8 A;  3INZ A;  2M1H A;  4BY6 C;  2HD0 A;  1XOV A;  2LT4 A;  3F70 A;  4NS5 A;  4IUR A;  4C5G A;  2ZPB B;  3M55 A;  4DOV A;  2LTO A;  2QQS A;  4PLI A;  3VV0 A;  5A0G A;  2KVQ G;  3SWN A;  5GAO n;  3E9F A;  3LGF A;  1WGS A;  3OYL A;  2FVU A;  5D6Y A;  4JLI A;  1KQ1 A;  2WSF E;  4LDW A;  5FU7 C;  3OYD A;  1R8O B;  1WPY A;  4GLK A;  4FSX A;  4L5G A;  1U8R A;  5I2S A;  3OYE A;  2R58 A;  3G6E T;  1Y07 A;  5GAO r;  3HSB A;  1H3Z A;  2K2V A;  1VQM A;  4PJO D;  2AHJ B;  4M7D A;  4ELZ C;  3PMT A;  3C12 A;  1B34 A;  4E7H A;  2XKO C;  1YBY A;  1Y96 A;  1JJ2 A;  2DXU A;  2HQX A;  4LDX A;  5FLX E;  5GMK l;  3LGL A;  3UT1 A;  3CD6 T;  3RIR A;  3V7C A;  1VQ4 A;  1VQ6 A;  3JB9 I;  4M77 C;  4A4F A;  1VQO T;  3LH0 A;  1M1F A;  3CPF A;  1ZHI A;  4A4H A;  2XID A;  5C0M A;  1IRE B;  3A8H B;  1K73 C;  1JBM A;  2I2L A;  1ZBX A;  4QQG A;  3JCM b;  4C92 G;  5LJ5 j;  3QII A;  5GAN g;  2EQM A;  2KMT A;  1BI1 A;  3GNG A;  3Q1J A;  3OS1 A;  3JCM J;  1KD1 C;  4HT9 A;  4M77 E;  3HPW A;  1UGQ B;  1M9S A;  3MO8 A;  3JCM Q;  2WAC A;  3PNW C;  3CCU A;  5CVI A;  3JCM e;  2ZCF B;  4M78 G;  4XTX A;  1KC8 C;  4HKE A;  4BDZ A;  1O75 A;  1I4K 1;  4M77 D;  3JCM d;  1K8A C;  4QVC A;  3X28 B;  1HXD A;  4OMF B;  3M59 A;  2K5L A;  4A53 A;  1XQH A;  3CEY A;  2VXE A;  4HA8 A;  4B9W A;  3CC7 T;  3PT9 A;  4C0F A;  2VGN A;  3N5B B;  4JRQ A;  4EMK C;  3QPH A;  1QP3 A;  5I2M A;  3RKY A;  2L8D A;  2EAY A;  5GAO l;  3P8D A;  5I21 A;  1D3B B;  3OYJ A;  2QTX A;  4FU6 A;  1M5Q 1;  5DLQ E;  4A54 A;  3L2U A;  4ZTJ A;  3HFO A;  2PQW A;  2RD1 A;  2V8J A;  4XU1 A;  3H8Z A;  4CRI A;  1YJW A;  1YCY A;  1QVG A;  4XTW A;  1YHQ T;  3FJP A;  2GCX A;  3ZEH A;  3FDR A;  5GMK m;  4HCB A;  4J8O A;  1QP2 A;  4A4G A;  2KAF A;  2LNV A;  5CKB A;  2EJ9 A;  2CZ7 B;  4XK8 E;  3CC2 A;  3HRT A;  5D6X A;  1MGQ A;  1N9R A;  2RA2 A;  1UEB A;  3BDU A;  4M75 B;  1FWZ A;  1KHI A;  1X01 A;  3G4S A;  4BI3 A;  3TRE A;  3MCA B;  4FT2 A;  4EMH A;  2EJF A;  2BKD N;  2DXB A;  3QYG B;  3L1A A;  4RMO A;  2OTL T;  2DIG A;  2RI2 A;  3OYF A;  2F5K A;  3E9G A;  1LNX A;  2ZPG B;  3M57 A;  4QVD A;  2EKO A;  2K3X A;  4JDS A;  1QVP A;  1WJS A;  4M78 C;  4X34 A;  3CCV T;  4C8Q G;  3CCM A;  1M1K U;  2NLU A;  2E6Z A;  4KBM B;  3J81 E;  2XDD A;  4M7A C;  1UB4 A;  2Y90 A;  5GAN 6;  4DA4 A;  1YIT T;  3L2Q A;  4IUV A;  3QHS A;  3X20 B;  3OYC A;  2QEX A;  2DD4 A;  4M7D G;  1DJ7 B;  2DKG A;  2G3R A;  3OYG A;  3VUZ A;  4QW2 A;  3MET A;  3EAE A;  4ZTF A;  4FT4 A;  4C92 D;  3GLX A;  1FX7 A;  4L59 A;  3OSS C;  5LJ5 f;  3OW2 S;  4A4K A;  4M7A F;  3V8K A;  2JVV A;  2VYT A;  4KUL A;  4M78 E;  4O6J A;  4OP0 A;  3A8L B;  3CCE T;  2A3L A;  2DEQ A;  2H3J A;  2LDM A;  1D3B A;  1G3T A;  3M54 A;  1LOJ A;  4MDW A;  2D0Q B;  4BB7 A;  2XDP A;  1NJI U;  2P0Q A;  4M78 D;  3OYK A;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...