2CP6A

Solution structure of the 2nd cap-gly domain in human clip-170/restin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
172
structure length
172
Chain Sequence
b'GSSGSSGATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restin
molecule tags Protein binding
source organism Homo sapiens
publication title Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin
rcsb
total genus 5
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp6A01
2E3IA 1WHKA 2QK0A 2COZA 2Z0WA 2CP2A 1WHHA 2HKNA 2M02A 2HQHA 2HKQB 1IXDA 3RDVA 2E4HA 1TOVA 2CP5A 3TQ7P 2CP0A 2MPXC 1WHLA 3E2UA 2HL5C 2COYA 2CP6A 2HL3A 2COWA 2CP3A 1WHMA 2CP7A 1TXQA 2E3HA 1WHGA 1LPLA 1WHJA 4B6MA
chains in the Genus database with same CATH superfamily
3CCMT 2CDTA 1NYFA 2RHZA 3CC7T 1UUEA 2VUBA 3HPWA 2QAZA 1VQOQ 3S3NA 4OGCA 2DXTA 1Y7XA 2WACA 2DLPA 4JLGA 1VOMA 3VS6A 3MP6A 1RLQC 3OW2P 4F14A 1QKWA 5CQXA 1Y07A 2DM1A 1YJNQ 2QQRA 3BY7A 3H9NA 3V7RA 4DBFA 1VQMA 3G71T 2CT4A 3JCMd 2JOYA 2ZPEB 2NYSA 1X43A 3EGXB 3O8VA 4F16A 1YJ9A 4IUVA 5IH2A 2HZYA 2PVGB 5GAN5 2MOXA 4PJNA 1GCQC 2OTJT 3CMAA 4M75D 2EQUA 5J39A 3QXEB 4GLKA 4C92A 2F5TX 4J9HA 3OS1A 2AKLA 1X2QA 4M75F 2O31A 1YITT 2FRWA 1VQ5Q 4AG2C 1K4US 2IG0A 4J9IA 1NBEB 3RESA 1VQ6Q 1IXDA 4P5NA 3X28B 2J7IA 1QWFA 4QQ6A 3EFOB 5J26A 2DA9A 4C92G 3CCLA 2ROTA 3I5SA 3DB3A 5J3BA 3RR6A 3HSBA 3M4GA 1SF9A 3UWNA 3LGLA 2DE0X 1GL5A 1AWXA 5CKEA 4RTXA 4JRKA 3VKIA 3G71Q 1OV3A 2VWFA 3P8HA 2ATCB 3KXTA 2C0OA 1BI2A 3UDCA 1OQKA 4M7AB 2RHIA 4AFQC 1VQLQ 4RG2A 1E6HA 2VGMA 2DEQA 4BB7A 3CCQT 1BI0A 1YJNA 1WNLA 3D7SB 4M7AG 1M3CA 5CCAA 5KH6A 1I0CA 3M0PA 3R6NA 4M7DD 5GANe 1CSKA 2RQRA 2BZXA 4J6YA 1UGQB 3JAME 2E41A 5CKFA 3VJPA 4NS5A 2FZCB 4PJOA 5IXBA 2HSPA 3OS2A 1SHFA 1NEGA 1VQ7Q 1AVZC 2O9VA 2EQJA 1Q82U 1ZHIA 1JO8A 3L2UA 3CC4T 2COZA 2K79A 5CO7A 3JB9J 2O2OA 3L2QA 2HAXA 1UGPB 1MUZA 4HCBA 5GJVB 3PFSA 2ESWA 4M7DA 2QGFB 2QEXT 2SRCA 2QEXA 4QT7A 3H6ZA 1NE8A 2DXBA 4EMKB 5LJ3e 1D1CA 3I56Q 2EYXA 2E70A 2ROLA 4ATOA 1KC8C 4Q5WA 3MKDA 2JS0A 2P0QA 4PJOF 2DXCA 2LJ1A 1WX6A 2KNBB 1B34B 2VB6A 1UGRB 1TOVA 4JUVA 4A4KA 2XDPA 5GAMg 5KE3A 1J3TA 2PU9B 4ZGDB 1V1CA 1XOVA 1IB8A 2DD5A 2EYQA 4WTOB 4IUPA 2JVVA 1PD1A 5FW9A 3G6ET 1V29B 4PNOA 2D9TA 3EGXA 1WHGA 2K3YA 2G6FX 1EFNA 2IPOB 3VS1A 1RI0A 4D8KA 3OYIA 1UGSB 4M7DC 3QDRB 2V26A 4LUEA 2CZ6B 2FHDA 2D1XA 2DYIA 4J9DA 4HA8A 1RADB 4OMFB 1OX9A 2CYZB 2O01E 4C0DB 2A36A 3N5BB 1D09B 1KJWA 1C6VX 2JN0A 1WGSA 7AT1B 3HRSA 2AK5A 5AYFA 4FM4B 2FZGB 1M1KR 4JRPA 1Y57A 2VXFA 5CAIA 2OTLQ 2PUKB 4C5GA 3PT9A 4ORZA 4C0FA 3I56A 2GCXA 3VS7A 1H92A 4HVVA 2FRYA 2CGHA 1K8AU 5CKDA 3HTRA 2AIRB 2HSEB 3CPFA 5GAOr 1NJIR 1VQKA 2DD4A 5IHNA 3CMEQ 4DEYA 3CXCS 2KT1A 2ZPIB 4UC4A 1YFNA 1YCSB 4J9GA 4HCKA 4OMLA 4JS4A 1VQ4A 2O4XB 1W2BS 2R57A 2QDLA 1TH7A 1EX4A 2KVQG 4BE2A 1BBZA 2QASA 1G5VA 4RCBA 1YWOA 3X25B 1P92A 1FXXA 1OULA 2ABLA 2BZYA 4M7AC 2E64A 3OYGA 1ZBXA 2W0ZA 3OSVA 4MDXA 1WHKA 4PL6A 4X34A 3TSZA 1RAFB 2K3XA 2GF7A 5GAN8 2DJZA 1WHLA 2RB6A 2RN8A 2XI9A 1KIKA 2AT1B 3VRZA 2V8JA 1K9MR 1AZEA 1JB0E 1HJDA 3FB9A 3CCEA 4DOWA 1NJIU 1D1BA 1BIAA 1YITQ 1JU5C 3CC4Q 2Y90A 1BU1A 2LNVA 5KYUB 3TU4K 4M7DB 2EIFA 4C92F 3TQ7P 4JRQA 3L42A 3HP9A 2JZ2A 2KXCA 3LYIA 3G4SQ 4D8DA 2GBQA 2HL3A 2E6NA 2OJ2A 3L2ZA 1IHVA 3GOXA 3CCLT 3A8LB 1X6GA 3REBB 1M3BA 3BDLA 1KQ2A 4HXJA 2YLBA 5FWCA 3EFRA 1Q95G 5DLQE 3M56A 2RO0A 3M0RA 3OYJA 4M78G 5GAN4 3L2VA 5L23A 2MIOA 1WA7A 5HCKA 1NLOC 3ZL7C 1M5Q1 5KCOA 1S72A 1K9MC 4MZTA 4RUGA 3OB9A 4HVWA 5GJWB 5LJ5j 3LWHA 2WSEE 1VYTA 1WZOA 4FSXA 4EPCA 3PE0A 1Q86R 5FU7C 3OW2A 4LDVA 5A0DA 1GCQA 3H8ZA 2GFUA 4RMOA 2DJQA 2EQMA 5CKHA 5I2MA 1B3QA 2DPPB 2K6DA 4JZ4A 1PWTA 1YITA 2RM4A 2M16A 3KUFA 3ZEHA 3LGFA 3RKYA 3O5ZA 5LJ3f 3MCAB 5CKBA 3JCMX 1B34A 2LNHB 3LW5E 1WYXA 2E4HA 3CPWS 3JB9G 3NTHA 3I55A 3UPUA 1G3WA 3NTIA 5CVIA 2NUZA 5LJ5h 1VQ8T 1VQPA 2RF0A 2RI2A 5LJ3j 1UG1A 2KQWA 4NOYA 1WIEA 5FU6B 4JDSA 1WXUA 2ZAEA 4J9BA 4PJOG 2QA4Q 1JQQA 2K4YA 2CP2A 2HKNA 1MGQA 4DBRA 3I35A 2GFAA 4LDYA 4A54A 2L2PA 2AZVA 4AT1B 3M54A 3QJ6A 1M1KU 3OBYA 1VQPT 4LXCA 3RIRA 4XTUA 1I8FA 1U1TA 2E65A 1G3SA 1YHQQ 5LJ5f 3EG2A 1FX7A 2HCKA 4N0AA 3OYDA 2P0KA 2LQNA 4EDUA 1ZA1B 1Z9QA 4MMLA 1KD1C 1N6AA 1SRMA 2DKGA 4CC7A 2LQKA 2OTLA 3QZ5B 3V7SA 2K5IA 4C0ZA 1ZUUA 3CBMA 3CC7Q 4IUTA 3CCST 4ZNXA 4M78C 4C8QB 1VQOT 5GAMf 2YUNA 5GMKh 1FMKA 4BY6B 3TVTA 3QJYA 4QW2A 1GBRA 2CZ7B 2VGNA 3SB2A 1TTHB 4M7AF 5GAOm 2HBPA 1M90C 2JXBA 1Y71A 2CP3A 2I0NA 1ARKA 3JCMe 4N0AC 4AFSC 2M0OA 2L8DA 2LDMA 1BCOA 1ZUYA 3OYEA 1XTDA 2K9GA 1M2VB 1IHWA 4OP0A 3MJXA 2RD1A 2FG0A 1JRIA 1FMWA 2H3JA 1YJ9Q 2HD0A 2DK3A 2ED1A 2EQIA 4KBMB 4A4FA 2DETA 2A37A 4ESRA 4NL2A 1VQ7A 1LOJA 3ULRB 1C1AA 4M78B 4C8QC 3QHSA 2DYBA 3CD6A 1PKTA 4CC3A 3BW1A 3SWNC 1UFFA 3RUXA 2LJ3A 3HHTB 3OQ5A 3JSCA 2J6KA 2ZPGB 3M0SA 4DA4A 1F1BB 2DIQA 3C94A 2YT6A 4C5HA 3JB9D 2A7YA 3CCJT 4J9CA 1YIJT 1PRMC 1VQOA 3MP8A 5KYXA 2ZGWA 1KC8U 3GBQA 2RQTA 4DBQA 1VQ8A 1G8XA 2E1HA 4ZGEB 3FIFA 3OBWA 3V8LA 1N27A 4EMGA 4BDZA 2J06A 3REAB 4MZPA 3QYGB 2P4RA 5I2SA 1AD5A 3ER0A 4M78D 4F17A 1D3BB 2DVJA 2H8HA 1RACB 2BKDN 1KFZA 3SWNA 3RMSA 1GFCA 2PQWA 1X27A 3DLMA 4FCYA 4E7IA 2E12A 1SRLA 3CEYA 1VQ7T 2LP5A 5I11A 3VS0A 1QLYA 3NPFA 1NG2A 3PGGA 1Q7YU 1WDXA 2RI5A 3C95A 4E7JA 2X35A 1VQ5A 3RBBB 3A8MB 4QQGA 2YUPA 2JM9A 2GQIA 1PG5B 4IKFA 1BI3A 3A5ZB 2RH2A 1I5LA 3LH5A 3OYHA 4M4ZA 4RKUE 2COWA 1M9SA 3L2RA 2HQXA 2CREA 5FLXE 5GAMj 2LCSA 4GY5A 2QXFA 2JTMA 4LN2A 2JJ9A 1E7OA 4L59A 3CXCP 2KMTA 4X9CA 2EGEA 1JEGA 3HRTA 4J8OA 2MMPA 2C0IA 4JS5A 4XAXB 1PSFA 1PCXA 2DL3A 5KE2A 1KG1A 4LE9A 1N8RU 1M90U 2MWPA 2JW4A 1T0JA 4E7ZA 1B7TA 3VV0A 3EFOA 1JBMA 1VQMQ 1VIEA 1VQLA 4L6V5 5LJ5d 1UB4A 1UHCA 4Y28E 4XU0A 3THKA 1OPKA 5GANd 2V8KA 4JJDA 2R5MA 1BKBA 4LDXA 2EYZA 2XDBA 1KD1U 1W6XA 4M77A 1Y0MA 1AWWA 4XTVA 3EHQA 2FPFA 1M1FA 5GAOq 3M5AA 1K8AC 1KHIA 2NUTB 5KYNA 4M78E 4JZ3A 1R0BG 1G2BA 5GANf 1YNZA 2AHJB 4C92B 1H8KA 4F7UE 1NEBA 2QQBA 1GFDA 2BE7D 3CCMQ 3R6OA 3CCEQ 2HEQA 1IRXA 3A1PA 1WJQA 4LD9K 1VQMT 2KDSA 2M9UA 3MO8A 1D1AA 2KT8A 3PIOA 2CUBA 2QEXQ 3GNFB 5D6YA 4IUQA 5LL6S 1PRLC 4A4EA 2X4JA 2EPDA 1QVPA 1VQNQ 4OMOA 2LZ6B 3DB4A 1KK7A 4PK4A 2KYMA 2FO0A 4PLIA 5IAYA 1PNJA 3OYMA 4C92E 1H3HA 2JNGA 4PJJA 1OPLA 2HKQB 4KT0E 2X4WA 2G3RA 2E6ZA 1OU9A 3CPWA 1M1GA 3HL8A 4Y91A 3I55T 2LCCA 2RJEA 1OX8A 4C92D 2MAMA 4FT4A 2MCNA 5D6WA 1H641 3M58A 2BTTA 1A0NB 5GMKl 5FU7B 2KXDA 1Q81C 3MHXA 3ZBDA 2JMAA 4BACA 4JRIA 2EJFA 4FSSA 2L0AA 4Z89A 4PLLA 1T0HA 2CP7A 1ZSGA 3PMTA 2X3WD 2X51A 3CCJA 4ELYC 1QVFS 1QVGP 2X9HA 3CCUQ 1SKUB 1U3OA 2DX1A 2QG9B 1FWZA 1YI2Q 4KULA 3ME9A 3RKWA 2KYBA 3OYCA 1NLPC 4PFOA 2PZ1A 3GIBA 2E3HA 1VQPQ 3CC2A 5FU6C 2F2WA 3SEMA 3PNWC 2L89A 1K9AA 1WHHA 5A0GA 3URGA 4C0GA 2BE9B 2C0TA 4XK8E 4ZN3A 2AKKA 4X9DA 1MMNA 2KBTA 1H3ZA 2RJFA 3S3OA 2E5QA 2BUDA 3QKJA 2XD0A 4A4HA 2CT3A 1T3LA 3OA6A 3V8KA 4E7KA 5GMKj 3NGPA 5ECAA 2D8HA 5M9OA 4II1A 3G1JA 3EG3A 1N8RR 3SD4A 2OTJA 1EZZB 3CBOA 3QPHA 2K3BA 4F7UA 5C6SA 5KYYA 4EMKC 3JCMJ 3H0IA 1HYOA 2KROA 3QZ9B 3GNGA 4XU2A 1N8RC 1RAIB 1RI9A 4J9EA 1M1KC 2V8IA 1BIBA 3HRUA 4C8QG 3CCVQ 3Q1JA 2DRKA 2RHXA 3CQTA 3VRYA 4C8QF 2A08A 2W10A 4CC2A 3EG1A 4LDUA 2M1HA 4PKCC 5I21A 5GMKe 4HT9A 2NWMA 2RJCA 1VQ9Q 1TS9A 1WFWA 4GBQA 1PC0A 1RLPC 4FL6A 4PFZA 2XHCA 1KC8R 1M8VA 2VKNA 3I55Q 1MMGA 2J6OA 1X6OA 4DQ2A 1KD1R 3LH0A 3RKXA 2D0QB 2KRMA 4IIMA 4IIOA 4RTTA 3J80E 8ATCB 4AFZC 2KGTA 2EYYA 3OYFA 1MHNA 3UA7A 1W1FA 2Z0WA 3GLXA 1SG5A 4BDYA 1UGVA 4KGVB 2DL7A 1JJ2P 2LT4A 1D0YA 2OI3A 5EG2A 4C8QA 3EGUA 5GAMd 1VIFA 3OYLA 1Q7YC 5LJ3d 4M7AD 3META 1ZQ1A 1QVFP 2NUPB 1KSWA 2JM8A 2XK0A 1QWEA 4FYWB 1X01A 2YRCA 1Y96A 3OMGA 2JTFA 4M77B 3CD6Q 2J05A 4CRIA 5IT9E 3VS4A 1ZSZA 2DNUA 1CKBA 4QQDA 5D7UA 3JCMV 4XU1A 1YIJQ 1D0ZA 1Q86U 4ZTJA 2Y4XA 1M4ZA 2DF6A 5FROA 1QCOA 2K2VA 3M57A 4QKUA 1QVFA 2CP6A 3L1AA 1N9SA 4BD3A 3CMAT 1TXQA 2K2MA 1N9RA 3EG9B 3JCMg 2E3IA 4RTYA 4CI0C 3M9QA 4HT8A 3AHUA 4M75C 1IGQA 3M53A 2DTIA 5DM7R 2JUFA 3VU3C 1OZ3A 5HKCA 1R0CB 5DY9A 1NZ9A 2VASA 4OMPA 1SSHA 1MV0B 2ZZDA 4M78F 1NJIC 2DZCA 2IIMA 2ED0A 4PJOD 2CZ1B 4M77E 2GTJA 1S72Q 4ZTFA 1I07A 4R0KA 2L3PA 4IURA 1YHQA 3HKSA 3U23A 3C4SA 1JJ2A 2DVEA 4JJBA 3J7AF 2P84A 2XDDA 1VA7A 3SHWA 4O5VA 5KYUA 2LVMA 3E2UA 3TREA 3A8HB 3E19A 1G83A 2A28A 3DKMA 3JCMP 3P8DA 3RERA 4M75A 4M7DG 4M7DF 3CCVT 2X4YA 4E7HA 3EGDB 1O75A 3JCMh 1MNDA 1ZA2B 3TSWA 3E9FA 1C0MA 1W2BP 2DL8A 1YI2A 2D6FA 2RHYA 1NPRA 2SEMA 2RK2A 5LJ5e 2V1RA 4M7AA 3OW2S 2YLCA 4RTWA 2HBWA 3JB9F 1B07A 3CC2Q 5GAOn 1AOJA 3H0HA 4L5GA 1UJYA 2JTEA 4PJOC 1S72T 4E7SA 5FWBA 1LJOA 3PTAA 3GPLA 1E6GA 3EG9A 3C0CA 2ENMA 1Z9ZA 4RG8A 5KYXB 4B9XA 3I5RA 4FW2A 4J6WA 4ME7A 2EKOA 2GQVA 5KYWB 1VUBA 1YI2T 2F5KA 2LQ8A 4M77C 3CD6T 2FB7A 4TVRA 2L5QA 2KSSA 4PJLA 4J7IA 3QIIA 1U06A 2DBMA 5GAOl 2YWWA 5GAN7 1QVGS 1RAHB 1QP3A 1VYVA 2DBKA 3INZA 1YJWQ 4Z88A 3CCUT 1UECA 2YDLA 3P8BB 4OVAA 3BFMA 2CP0A 4KRTA 5CR2A 2MWOA 5GAN3 1WHMA 1YWPA 1GRIA 4C5IA 3UATA 4N4GA 3TEEA 3J81E 1K76A 5GANg 1TU0B 1WQ7A 4AFUC 2OAUA 2K7AA 2YUOA 2YHTA 2MPXC 1BK2A 2EW3A 4PJOE 4BI8B 2HL5C 1KQSA 1AEYA 2LMJA 1VQ8Q 2KR3A 2DL4A 3OYNA 1M3AA 1VQNA 3ASKA 2RMOA 1OU8A 3CCSA 2XMFA 1U5SA 1YJNT 2CH4W 2MYSA 2QDYB 2XIDA 3T9NA 1MNEA 3PMIA 1GXIE 1FMVA 3AT1B 3MPUB 4OB2B 3MP1A 2IVWA 1QW1A 2BIVA 1RL2A 3IQLA 2ZPHB 1OOTA 3BDUA 1R77A 5L8RE 3VS2A 4ELZC 1IGUA 4BI3A 2C06A 1AWJA 3VYGA 3FLGA 2DERA 2K57A 2HDAA 2KRNA 2QGGA 4BUGA 1AHJB 4MZMA 3V8JA 1M2VA 4HCCA 2DMOA 1WLPB 2J6FA 1M8MA 2RA2A 1U1SA 1W4SA 3G6EA 3CCQQ 1UHFA 3SWNB 4HCZA 2EAYA 4KH0B 5KCHA 3JB9I 3PVLA 5GANh 3CCET 3WVEB 2NLUA 3GF5A 4GLMA 1SSFA 2DL5A 1PKSA 1KHCA 4MDWA 4WF2A 5CQYA 2JT4A 3FC3A 3LX7A 2YRVA 3KBGA 1G3YA 1VQNT 1BYMA 2RHUA 9ATCB 2YXYA 2EFIA 2EGAA 3FRNA 2DO3A 4MMKA 3G71A 2ZPBB 1I81A 2FEIA 3QWXX 2V1QA 2VV5A 3UF4A 1UEBA 1HD3A 3M4YA 2YSQA 1YJ9T 1ABQA 4J7FA 2PVOB 2NUTA 1JXMA 4HKEA 1WI7A 4M78A 4EMKA 5GMKi 1NM7A 1M90R 4J6XA 1I5OB 2QK0A 4XTXA 1XQHA 4C0DC 2PUOB 5FRMA 5D6XA 5CK9A 2ECZA 2FVUA 2KEAA 1Q86C 2RI3A 1M2OA 2FYKA 1VQKT 1QQJA 3E9GA 4DEXA 1PHTA 2HMAA 1TUDA 2XG8D 3FJ5A 3HFOA 4BY6C 3H0FA 3I56T 1GCPA 1WJRA 3S3MA 2KE9A 4FYXB 1MMAA 1TSFA 1WXTA 2KK4A 4CC4B 1D0XA 2CH4A 1LCKA 4RTVA 3CCRA 2E10A 2EKHA 3MEAA 6AT1B 3CCRT 4J5YA 4ZGJB 1XJWB 1M30A 2F2XA 4F7UG 2M51A 3EFSA 3EAEA 1IZ6A 2CS7A 2LX7A 1UTIA 1OYXA 1OZ2A 1RAGB 1EIFA 4F7UB 1VQ5T 4Z02A 4RTUA 3OYBA 2DAQA 3VS5A 2GGRA 4BI4A 4E2FB 4E7LA 1VQKQ 4C8QD 2WSFE 4JPBW 4M77D 4FU6A 2DZ9A 3M0UA 4OF1A 3PIPA 3OYAA 4Y92A 3NFCA 4HVUA 4K11A 3NHNA 4Z8AA 3MEWA 1VQ4Q 3CMAQ 2DTHA 1ZSZB 1ZUKA 1ZSZC 2B86A 1QCFA 4LD6A 1V76A 2OX7A 5GAOp 1AWOA 2OAWA 3L2WA 2HQHA 5IXFA 1M27C 1Y96B 1DJ7B 1VQ6A 4XTWA 2JS2A 1G3TA 1BB9A 2D0NA 4M75E 1YCYA 2PTKA 1KQSP 3VS3A 2OTJQ 2DEUA 3CCLQ 2YRDA 4AMCA 1VQ4T 3A98A 1WHJA 5LJ3g 1YJWT 3CCJQ 3JCMW 1Q7YR 3CCMA 3EHRA 2D8JA 4O6JA 5A2QE 2EYWA 2O88A 3LWIA 3CCUA 4FT2A 1HXDA 3UA6A 4QVZA 1X2KA 2JMCA 2M0YA 2VC8A 3QG1A 2LCLA 4M7AE 1TUGB 1MMDA 2LTOA 4C92C 1OEBA 2R5AA 2K5FA 2LRQA 4M75B 2VXEA 5HK0A 5GMKm 4OB3B 4PJOB 3QBYA 4JJNK 1PM3A 2MK5A 2XU8A 4NL3A 3S6WA 5KYWA 5GANj 3KFVA 2B8AA 2KRSA 3G4SA 2F2VA 3X24B 4E47A 2KY9A 2CUDA 4ANJA 1LVKA 3NTKA 4RCCA 4LUDA 2EVRA 1Q82C 2LT1A 2F1LA 1ZLMA 3DLLA 1LPLA 2QQ9A 2RNAA 4KGXB 3VYHB 3M55A 2QTXA 1KQ1A 2Y4YA 3FEOA 5C0MA 2QQAA 1RABB 2QQSA 1UDLA 1KQSS 2WSCE 2KAFA 2O4XA 2OTLT 1CKAA 5GAMh 1K9MU 2EWNA 3OSSC 4J9FA 4C5EA 2CKKA 3MEVA 4XU3A 4KGZB 1R8OB 2L3QA 3SDZA 4BE0A 2YUQA 1YIJA 2FZKB 2X3XD 1UE9A 3FDRA 1ZX6A 4R55A 1LNXA 1VQ9A 1JXOA 3EG0A 1K73C 5IN1A 1BI1A 3OMCA 3C12A 3CCVA 2O9SA 2A0FB 1W2BA 4FYVB 1TG0A 3VUBA 3ZFJA 3QWYA 1U8RA 3OYKA 3CMEA 3OS5A 3X26B 5EC7A 1HSQA 3G4ST 1O9SA 2QYZA 2RJDA 1QKXA 1SHGA 2CSIA 2DILA 1K0SA 1RAAB 2EJGA 4ZN1A 1W70A 4B6MA 1RUWA 4EIKA 1GBQA 4LNPA 3QYHB 1BCMA 3JRZA 3HFNA 2FL7A 5IHIA 1VYUA 3JCMc 3G7ZA 1IO6A 4A4GA 1PSEA 3M0QA 3VUZA 3CMET 2LX9A 2P0PA 1K73R 2BZ8A 4M77G 3JCMQ 1Q82R 3OYYA 8AT1B 2XICA 3NMZC 3EGDA 2DXUA 4B9WA 1HK9A 1X6BA 2HNIA 1FYNA 2RQUA 3I9QA 1YN8A 4IUUA 3JCMf 4FYYB 4LDWA 4FW1A 3EH1A 4A53A 2NUPA 3FJPA 2E5KA 3MEUA 5KYYB 4RTZA 2P4TA 2GTOA 2LC4A 4FIBA 5LJ3h 4X1VA 2QA4A 4QVCA 2K5LA 4OGEA 4F7UF 3RNJA 1X75C 4J83A 2XKOC 1VQLT 1YBYA 2ZPFB 1AZGB 1I4K1 1SEMA 5CIUA 2KI7A 5HK3A 4PFPA 1K1ZA 2F69A 1IREB 1K73U 1S1NA 2M02A 3JB9H 4DOVA 4KUDK 2PVDB 3PVQA 2EGCA 2CP5A 2L3SA 3QO3A 1XNIA 4OB0B 1N5ZA 4N4HA 2MF2A 4N4IA 2COYA 4OB1B 2DTOA 3LLRA 1NPPA 3QDFA 4JJCA 2L3RA 5GAMe 1OI1A 2CSQA 2H3EB 3V7CA 1QVGA 2EBPA 1WXBA 3F70A 1ZBJA 1Q81R 1WJSA 2QI2A 4M75G 1YHQT 1PD0A 2AZSA 5AT1B 3CC4A 1I1JA 2EJ9A 1VQ6T 5FRNA 2DFUA 2GNCA 3WVDB 2VYTA 3CPWP 3G6EQ 3CCQA 3OY9A 3M0TA 4JLIA 5DLOA 2DRMA 3OS0A 3RMQA 4C8QE 3CC7A 4KUIA 1RAEB 1YP5A 3UT1A 3A8OB 2RPNA 4PJMA 3H41A 1K8AR 3QSUA 4F04B 3TCJA 1UJ0A 4D6WA 2QA4T 1QCNA 4EMHA 2EQKA 1ABOA 3E1SA 5LJ5g 5A0LA 1WQWA 3QUIA 2I2LA 4E6RA 2ZCFB 3WXMB 3EH2A 2RQVA 3CC2T 1T3SA 4VUBA 2HQEA 5HY6A 2FPEA 1WPYA 1K0XA 4OMMA 2FPDA 1ACMB 1TWBA 1AT1B 2RK1A 2X4XA 1MV3A 2LJ0A 2CZ0B 2QTVA 4QVDA 3BE3A 1Q81U 1SPKA 3JCMb 4AG1C 3SFMA 5GAN2 2MI6A 3X20B 4A63B 3M59A 4M77F 2LQWA 3CXCA 2DIGA 4XTZA 4KH1B 4R56A 2PNIA 1X69A 4DBHA 1YJWA 4XTYA 3JV3A 2R58A 1QP2A 2RQWA 1QMCA 5GAN6 5IHKA 4BE1A 4WCIA 3CCRQ 3RDVA 1NYGA 4OMQA 1VQ9T 4YTLA 3CBPA 5I22A 3GP8A 1D3BA 4XQ3A 2A3LA 4V2SA 4OMNA 1JJ2S 4M7DE 1TUCA 2VVKA 3A8GB 3CCSQ
chains in the Genus database with same CATH topology
2E3IA 1WHKA 2QK0A 2COZA 2Z0WA 2CP2A 1WHHA 2HKNA 2M02A 2HQHA 2HKQB 1IXDA 3RDVA 2E4HA 1TOVA 2CP5A 3TQ7P 2CP0A 2MPXC 1WHLA 3E2UA 2HL5C 2COYA 2CP6A 2HL3A 2COWA 2CP3A 1WHMA 2CP7A 1TXQA 2E3HA 1WHGA 1LPLA 1WHJA 4B6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3I A;  1WHK A;  2QK0 A;  2COZ A;  2Z0W A;  2CP2 A;  1WHH A;  2HKN A;  2M02 A;  2HQH A;  2HKQ B;  1IXD A;  3RDV A;  2E4H A;  1TOV A;  2CP5 A;  3TQ7 P;  2CP0 A;  2MPX C;  1WHL A;  3E2U A;  2HL5 C;  2COY A;  2CP6 A;  2HL3 A;  2COW A;  2CP3 A;  1WHM A;  2CP7 A;  1TXQ A;  2E3H A;  1WHG A;  1LPL A;  1WHJ A;  4B6M A; 
#chains in the Genus database with same CATH topology
 3CCM T;  2CDT A;  1NYF A;  2RHZ A;  3CC7 T;  1UUE A;  2VUB A;  3HPW A;  2QAZ A;  1VQO Q;  3S3N A;  4OGC A;  2DXT A;  1Y7X A;  2WAC A;  2DLP A;  4JLG A;  1VOM A;  3VS6 A;  3MP6 A;  1RLQ C;  3OW2 P;  4F14 A;  1QKW A;  5CQX A;  1Y07 A;  2DM1 A;  1YJN Q;  2QQR A;  3BY7 A;  3H9N A;  3V7R A;  4DBF A;  1VQM A;  3G71 T;  2CT4 A;  3JCM d;  2JOY A;  2ZPE B;  2NYS A;  1X43 A;  3EGX B;  3O8V A;  4F16 A;  1YJ9 A;  4IUV A;  5IH2 A;  2HZY A;  2PVG B;  5GAN 5;  2MOX A;  4PJN A;  1GCQ C;  2OTJ T;  3CMA A;  4M75 D;  2EQU A;  5J39 A;  3QXE B;  4GLK A;  4C92 A;  2F5T X;  4J9H A;  3OS1 A;  2AKL A;  1X2Q A;  4M75 F;  2O31 A;  1YIT T;  2FRW A;  1VQ5 Q;  4AG2 C;  1K4U S;  2IG0 A;  4J9I A;  1NBE B;  3RES A;  1VQ6 Q;  1IXD A;  4P5N A;  3X28 B;  2J7I A;  1QWF A;  4QQ6 A;  3EFO B;  5J26 A;  2DA9 A;  4C92 G;  3CCL A;  2ROT A;  3I5S A;  3DB3 A;  5J3B A;  3RR6 A;  3HSB A;  3M4G A;  1SF9 A;  3UWN A;  3LGL A;  2DE0 X;  1GL5 A;  1AWX A;  5CKE A;  4RTX A;  4JRK A;  3VKI A;  3G71 Q;  1OV3 A;  2VWF A;  3P8H A;  2ATC B;  3KXT A;  2C0O A;  1BI2 A;  3UDC A;  1OQK A;  4M7A B;  2RHI A;  4AFQ C;  1VQL Q;  4RG2 A;  1E6H A;  2VGM A;  2DEQ A;  4BB7 A;  3CCQ T;  1BI0 A;  1YJN A;  1WNL A;  3D7S B;  4M7A G;  1M3C A;  5CCA A;  5KH6 A;  1I0C A;  3M0P A;  3R6N A;  4M7D D;  5GAN e;  1CSK A;  2RQR A;  2BZX A;  4J6Y A;  1UGQ B;  3JAM E;  2E41 A;  5CKF A;  3VJP A;  4NS5 A;  2FZC B;  4PJO A;  5IXB A;  2HSP A;  3OS2 A;  1SHF A;  1NEG A;  1VQ7 Q;  1AVZ C;  2O9V A;  2EQJ A;  1Q82 U;  1ZHI A;  1JO8 A;  3L2U A;  3CC4 T;  2COZ A;  2K79 A;  5CO7 A;  3JB9 J;  2O2O A;  3L2Q A;  2HAX A;  1UGP B;  1MUZ A;  4HCB A;  5GJV B;  3PFS A;  2ESW A;  4M7D A;  2QGF B;  2QEX T;  2SRC A;  2QEX A;  4QT7 A;  3H6Z A;  1NE8 A;  2DXB A;  4EMK B;  5LJ3 e;  1D1C A;  3I56 Q;  2EYX A;  2E70 A;  2ROL A;  4ATO A;  1KC8 C;  4Q5W A;  3MKD A;  2JS0 A;  2P0Q A;  4PJO F;  2DXC A;  2LJ1 A;  1WX6 A;  2KNB B;  1B34 B;  2VB6 A;  1UGR B;  1TOV A;  4JUV A;  4A4K A;  2XDP A;  5GAM g;  5KE3 A;  1J3T A;  2PU9 B;  4ZGD B;  1V1C A;  1XOV A;  1IB8 A;  2DD5 A;  2EYQ A;  4WTO B;  4IUP A;  2JVV A;  1PD1 A;  5FW9 A;  3G6E T;  1V29 B;  4PNO A;  2D9T A;  3EGX A;  1WHG A;  2K3Y A;  2G6F X;  1EFN A;  2IPO B;  3VS1 A;  1RI0 A;  4D8K A;  3OYI A;  1UGS B;  4M7D C;  3QDR B;  2V26 A;  4LUE A;  2CZ6 B;  2FHD A;  2D1X A;  2DYI A;  4J9D A;  4HA8 A;  1RAD B;  4OMF B;  1OX9 A;  2CYZ B;  2O01 E;  4C0D B;  2A36 A;  3N5B B;  1D09 B;  1KJW A;  1C6V X;  2JN0 A;  1WGS A;  7AT1 B;  3HRS A;  2AK5 A;  5AYF A;  4FM4 B;  2FZG B;  1M1K R;  4JRP A;  1Y57 A;  2VXF A;  5CAI A;  2OTL Q;  2PUK B;  4C5G A;  3PT9 A;  4ORZ A;  4C0F A;  3I56 A;  2GCX A;  3VS7 A;  1H92 A;  4HVV A;  2FRY A;  2CGH A;  1K8A U;  5CKD A;  3HTR A;  2AIR B;  2HSE B;  3CPF A;  5GAO r;  1NJI R;  1VQK A;  2DD4 A;  5IHN A;  3CME Q;  4DEY A;  3CXC S;  2KT1 A;  2ZPI B;  4UC4 A;  1YFN A;  1YCS B;  4J9G A;  4HCK A;  4OML A;  4JS4 A;  1VQ4 A;  2O4X B;  1W2B S;  2R57 A;  2QDL A;  1TH7 A;  1EX4 A;  2KVQ G;  4BE2 A;  1BBZ A;  2QAS A;  1G5V A;  4RCB A;  1YWO A;  3X25 B;  1P92 A;  1FXX A;  1OUL A;  2ABL A;  2BZY A;  4M7A C;  2E64 A;  3OYG A;  1ZBX A;  2W0Z A;  3OSV A;  4MDX A;  1WHK A;  4PL6 A;  4X34 A;  3TSZ A;  1RAF B;  2K3X A;  2GF7 A;  5GAN 8;  2DJZ A;  1WHL A;  2RB6 A;  2RN8 A;  2XI9 A;  1KIK A;  2AT1 B;  3VRZ A;  2V8J A;  1K9M R;  1AZE A;  1JB0 E;  1HJD A;  3FB9 A;  3CCE A;  4DOW A;  1NJI U;  1D1B A;  1BIA A;  1YIT Q;  1JU5 C;  3CC4 Q;  2Y90 A;  1BU1 A;  2LNV A;  5KYU B;  3TU4 K;  4M7D B;  2EIF A;  4C92 F;  3TQ7 P;  4JRQ A;  3L42 A;  3HP9 A;  2JZ2 A;  2KXC A;  3LYI A;  3G4S Q;  4D8D A;  2GBQ A;  2HL3 A;  2E6N A;  2OJ2 A;  3L2Z A;  1IHV A;  3GOX A;  3CCL T;  3A8L B;  1X6G A;  3REB B;  1M3B A;  3BDL A;  1KQ2 A;  4HXJ A;  2YLB A;  5FWC A;  3EFR A;  1Q95 G;  5DLQ E;  3M56 A;  2RO0 A;  3M0R A;  3OYJ A;  4M78 G;  5GAN 4;  3L2V A;  5L23 A;  2MIO A;  1WA7 A;  5HCK A;  1NLO C;  3ZL7 C;  1M5Q 1;  5KCO A;  1S72 A;  1K9M C;  4MZT A;  4RUG A;  3OB9 A;  4HVW A;  5GJW B;  5LJ5 j;  3LWH A;  2WSE E;  1VYT A;  1WZO A;  4FSX A;  4EPC A;  3PE0 A;  1Q86 R;  5FU7 C;  3OW2 A;  4LDV A;  5A0D A;  1GCQ A;  3H8Z A;  2GFU A;  4RMO A;  2DJQ A;  2EQM A;  5CKH A;  5I2M A;  1B3Q A;  2DPP B;  2K6D A;  4JZ4 A;  1PWT A;  1YIT A;  2RM4 A;  2M16 A;  3KUF A;  3ZEH A;  3LGF A;  3RKY A;  3O5Z A;  5LJ3 f;  3MCA B;  5CKB A;  3JCM X;  1B34 A;  2LNH B;  3LW5 E;  1WYX A;  2E4H A;  3CPW S;  3JB9 G;  3NTH A;  3I55 A;  3UPU A;  1G3W A;  3NTI A;  5CVI A;  2NUZ A;  5LJ5 h;  1VQ8 T;  1VQP A;  2RF0 A;  2RI2 A;  5LJ3 j;  1UG1 A;  2KQW A;  4NOY A;  1WIE A;  5FU6 B;  4JDS A;  1WXU A;  2ZAE A;  4J9B A;  4PJO G;  2QA4 Q;  1JQQ A;  2K4Y A;  2CP2 A;  2HKN A;  1MGQ A;  4DBR A;  3I35 A;  2GFA A;  4LDY A;  4A54 A;  2L2P A;  2AZV A;  4AT1 B;  3M54 A;  3QJ6 A;  1M1K U;  3OBY A;  1VQP T;  4LXC A;  3RIR A;  4XTU A;  1I8F A;  1U1T A;  2E65 A;  1G3S A;  1YHQ Q;  5LJ5 f;  3EG2 A;  1FX7 A;  2HCK A;  4N0A A;  3OYD A;  2P0K A;  2LQN A;  4EDU A;  1ZA1 B;  1Z9Q A;  4MML A;  1KD1 C;  1N6A A;  1SRM A;  2DKG A;  4CC7 A;  2LQK A;  2OTL A;  3QZ5 B;  3V7S A;  2K5I A;  4C0Z A;  1ZUU A;  3CBM A;  3CC7 Q;  4IUT A;  3CCS T;  4ZNX A;  4M78 C;  4C8Q B;  1VQO T;  5GAM f;  2YUN A;  5GMK h;  1FMK A;  4BY6 B;  3TVT A;  3QJY A;  4QW2 A;  1GBR A;  2CZ7 B;  2VGN A;  3SB2 A;  1TTH B;  4M7A F;  5GAO m;  2HBP A;  1M90 C;  2JXB A;  1Y71 A;  2CP3 A;  2I0N A;  1ARK A;  3JCM e;  4N0A C;  4AFS C;  2M0O A;  2L8D A;  2LDM A;  1BCO A;  1ZUY A;  3OYE A;  1XTD A;  2K9G A;  1M2V B;  1IHW A;  4OP0 A;  3MJX A;  2RD1 A;  2FG0 A;  1JRI A;  1FMW A;  2H3J A;  1YJ9 Q;  2HD0 A;  2DK3 A;  2ED1 A;  2EQI A;  4KBM B;  4A4F A;  2DET A;  2A37 A;  4ESR A;  4NL2 A;  1VQ7 A;  1LOJ A;  3ULR B;  1C1A A;  4M78 B;  4C8Q C;  3QHS A;  2DYB A;  3CD6 A;  1PKT A;  4CC3 A;  3BW1 A;  3SWN C;  1UFF A;  3RUX A;  2LJ3 A;  3HHT B;  3OQ5 A;  3JSC A;  2J6K A;  2ZPG B;  3M0S A;  4DA4 A;  1F1B B;  2DIQ A;  3C94 A;  2YT6 A;  4C5H A;  3JB9 D;  2A7Y A;  3CCJ T;  4J9C A;  1YIJ T;  1PRM C;  1VQO A;  3MP8 A;  5KYX A;  2ZGW A;  1KC8 U;  3GBQ A;  2RQT A;  4DBQ A;  1VQ8 A;  1G8X A;  2E1H A;  4ZGE B;  3FIF A;  3OBW A;  3V8L A;  1N27 A;  4EMG A;  4BDZ A;  2J06 A;  3REA B;  4MZP A;  3QYG B;  2P4R A;  5I2S A;  1AD5 A;  3ER0 A;  4M78 D;  4F17 A;  1D3B B;  2DVJ A;  2H8H A;  1RAC B;  2BKD N;  1KFZ A;  3SWN A;  3RMS A;  1GFC A;  2PQW A;  1X27 A;  3DLM A;  4FCY A;  4E7I A;  2E12 A;  1SRL A;  3CEY A;  1VQ7 T;  2LP5 A;  5I11 A;  3VS0 A;  1QLY A;  3NPF A;  1NG2 A;  3PGG A;  1Q7Y U;  1WDX A;  2RI5 A;  3C95 A;  4E7J A;  2X35 A;  1VQ5 A;  3RBB B;  3A8M B;  4QQG A;  2YUP A;  2JM9 A;  2GQI A;  1PG5 B;  4IKF A;  1BI3 A;  3A5Z B;  2RH2 A;  1I5L A;  3LH5 A;  3OYH A;  4M4Z A;  4RKU E;  2COW A;  1M9S A;  3L2R A;  2HQX A;  2CRE A;  5FLX E;  5GAM j;  2LCS A;  4GY5 A;  2QXF A;  2JTM A;  4LN2 A;  2JJ9 A;  1E7O A;  4L59 A;  3CXC P;  2KMT A;  4X9C A;  2EGE A;  1JEG A;  3HRT A;  4J8O A;  2MMP A;  2C0I A;  4JS5 A;  4XAX B;  1PSF A;  1PCX A;  2DL3 A;  5KE2 A;  1KG1 A;  4LE9 A;  1N8R U;  1M90 U;  2MWP A;  2JW4 A;  1T0J A;  4E7Z A;  1B7T A;  3VV0 A;  3EFO A;  1JBM A;  1VQM Q;  1VIE A;  1VQL A;  4L6V 5;  5LJ5 d;  1UB4 A;  1UHC A;  4Y28 E;  4XU0 A;  3THK A;  1OPK A;  5GAN d;  2V8K A;  4JJD A;  2R5M A;  1BKB A;  4LDX A;  2EYZ A;  2XDB A;  1KD1 U;  1W6X A;  4M77 A;  1Y0M A;  1AWW A;  4XTV A;  3EHQ A;  2FPF A;  1M1F A;  5GAO q;  3M5A A;  1K8A C;  1KHI A;  2NUT B;  5KYN A;  4M78 E;  4JZ3 A;  1R0B G;  1G2B A;  5GAN f;  1YNZ A;  2AHJ B;  4C92 B;  1H8K A;  4F7U E;  1NEB A;  2QQB A;  1GFD A;  2BE7 D;  3CCM Q;  3R6O A;  3CCE Q;  2HEQ A;  1IRX A;  3A1P A;  1WJQ A;  4LD9 K;  1VQM T;  2KDS A;  2M9U A;  3MO8 A;  1D1A A;  2KT8 A;  3PIO A;  2CUB A;  2QEX Q;  3GNF B;  5D6Y A;  4IUQ A;  5LL6 S;  1PRL C;  4A4E A;  2X4J A;  2EPD A;  1QVP A;  1VQN Q;  4OMO A;  2LZ6 B;  3DB4 A;  1KK7 A;  4PK4 A;  2KYM A;  2FO0 A;  4PLI A;  5IAY A;  1PNJ A;  3OYM A;  4C92 E;  1H3H A;  2JNG A;  4PJJ A;  1OPL A;  2HKQ B;  4KT0 E;  2X4W A;  2G3R A;  2E6Z A;  1OU9 A;  3CPW A;  1M1G A;  3HL8 A;  4Y91 A;  3I55 T;  2LCC A;  2RJE A;  1OX8 A;  4C92 D;  2MAM A;  4FT4 A;  2MCN A;  5D6W A;  1H64 1;  3M58 A;  2BTT A;  1A0N B;  5GMK l;  5FU7 B;  2KXD A;  1Q81 C;  3MHX A;  3ZBD A;  2JMA A;  4BAC A;  4JRI A;  2EJF A;  4FSS A;  2L0A A;  4Z89 A;  4PLL A;  1T0H A;  2CP7 A;  1ZSG A;  3PMT A;  2X3W D;  2X51 A;  3CCJ A;  4ELY C;  1QVF S;  1QVG P;  2X9H A;  3CCU Q;  1SKU B;  1U3O A;  2DX1 A;  2QG9 B;  1FWZ A;  1YI2 Q;  4KUL A;  3ME9 A;  3RKW A;  2KYB A;  3OYC A;  1NLP C;  4PFO A;  2PZ1 A;  3GIB A;  2E3H A;  1VQP Q;  3CC2 A;  5FU6 C;  2F2W A;  3SEM A;  3PNW C;  2L89 A;  1K9A A;  1WHH A;  5A0G A;  3URG A;  4C0G A;  2BE9 B;  2C0T A;  4XK8 E;  4ZN3 A;  2AKK A;  4X9D A;  1MMN A;  2KBT A;  1H3Z A;  2RJF A;  3S3O A;  2E5Q A;  2BUD A;  3QKJ A;  2XD0 A;  4A4H A;  2CT3 A;  1T3L A;  3OA6 A;  3V8K A;  4E7K A;  5GMK j;  3NGP A;  5ECA A;  2D8H A;  5M9O A;  4II1 A;  3G1J A;  3EG3 A;  1N8R R;  3SD4 A;  2OTJ A;  1EZZ B;  3CBO A;  3QPH A;  2K3B A;  4F7U A;  5C6S A;  5KYY A;  4EMK C;  3JCM J;  3H0I A;  1HYO A;  2KRO A;  3QZ9 B;  3GNG A;  4XU2 A;  1N8R C;  1RAI B;  1RI9 A;  4J9E A;  1M1K C;  2V8I A;  1BIB A;  3HRU A;  4C8Q G;  3CCV Q;  3Q1J A;  2DRK A;  2RHX A;  3CQT A;  3VRY A;  4C8Q F;  2A08 A;  2W10 A;  4CC2 A;  3EG1 A;  4LDU A;  2M1H A;  4PKC C;  5I21 A;  5GMK e;  4HT9 A;  2NWM A;  2RJC A;  1VQ9 Q;  1TS9 A;  1WFW A;  4GBQ A;  1PC0 A;  1RLP C;  4FL6 A;  4PFZ A;  2XHC A;  1KC8 R;  1M8V A;  2VKN A;  3I55 Q;  1MMG A;  2J6O A;  1X6O A;  4DQ2 A;  1KD1 R;  3LH0 A;  3RKX A;  2D0Q B;  2KRM A;  4IIM A;  4IIO A;  4RTT A;  3J80 E;  8ATC B;  4AFZ C;  2KGT A;  2EYY A;  3OYF A;  1MHN A;  3UA7 A;  1W1F A;  2Z0W A;  3GLX A;  1SG5 A;  4BDY A;  1UGV A;  4KGV B;  2DL7 A;  1JJ2 P;  2LT4 A;  1D0Y A;  2OI3 A;  5EG2 A;  4C8Q A;  3EGU A;  5GAM d;  1VIF A;  3OYL A;  1Q7Y C;  5LJ3 d;  4M7A D;  3MET A;  1ZQ1 A;  1QVF P;  2NUP B;  1KSW A;  2JM8 A;  2XK0 A;  1QWE A;  4FYW B;  1X01 A;  2YRC A;  1Y96 A;  3OMG A;  2JTF A;  4M77 B;  3CD6 Q;  2J05 A;  4CRI A;  5IT9 E;  3VS4 A;  1ZSZ A;  2DNU A;  1CKB A;  4QQD A;  5D7U A;  3JCM V;  4XU1 A;  1YIJ Q;  1D0Z A;  1Q86 U;  4ZTJ A;  2Y4X A;  1M4Z A;  2DF6 A;  5FRO A;  1QCO A;  2K2V A;  3M57 A;  4QKU A;  1QVF A;  2CP6 A;  3L1A A;  1N9S A;  4BD3 A;  3CMA T;  1TXQ A;  2K2M A;  1N9R A;  3EG9 B;  3JCM g;  2E3I A;  4RTY A;  4CI0 C;  3M9Q A;  4HT8 A;  3AHU A;  4M75 C;  1IGQ A;  3M53 A;  2DTI A;  5DM7 R;  2JUF A;  3VU3 C;  1OZ3 A;  5HKC A;  1R0C B;  5DY9 A;  1NZ9 A;  2VAS A;  4OMP A;  1SSH A;  1MV0 B;  2ZZD A;  4M78 F;  1NJI C;  2DZC A;  2IIM A;  2ED0 A;  4PJO D;  2CZ1 B;  4M77 E;  2GTJ A;  1S72 Q;  4ZTF A;  1I07 A;  4R0K A;  2L3P A;  4IUR A;  1YHQ A;  3HKS A;  3U23 A;  3C4S A;  1JJ2 A;  2DVE A;  4JJB A;  3J7A F;  2P84 A;  2XDD A;  1VA7 A;  3SHW A;  4O5V A;  5KYU A;  2LVM A;  3E2U A;  3TRE A;  3A8H B;  3E19 A;  1G83 A;  2A28 A;  3DKM A;  3JCM P;  3P8D A;  3RER A;  4M75 A;  4M7D G;  4M7D F;  3CCV T;  2X4Y A;  4E7H A;  3EGD B;  1O75 A;  3JCM h;  1MND A;  1ZA2 B;  3TSW A;  3E9F A;  1C0M A;  1W2B P;  2DL8 A;  1YI2 A;  2D6F A;  2RHY A;  1NPR A;  2SEM A;  2RK2 A;  5LJ5 e;  2V1R A;  4M7A A;  3OW2 S;  2YLC A;  4RTW A;  2HBW A;  3JB9 F;  1B07 A;  3CC2 Q;  5GAO n;  1AOJ A;  3H0H A;  4L5G A;  1UJY A;  2JTE A;  4PJO C;  1S72 T;  4E7S A;  5FWB A;  1LJO A;  3PTA A;  3GPL A;  1E6G A;  3EG9 A;  3C0C A;  2ENM A;  1Z9Z A;  4RG8 A;  5KYX B;  4B9X A;  3I5R A;  4FW2 A;  4J6W A;  4ME7 A;  2EKO A;  2GQV A;  5KYW B;  1VUB A;  1YI2 T;  2F5K A;  2LQ8 A;  4M77 C;  3CD6 T;  2FB7 A;  4TVR A;  2L5Q A;  2KSS A;  4PJL A;  4J7I A;  3QII A;  1U06 A;  2DBM A;  5GAO l;  2YWW A;  5GAN 7;  1QVG S;  1RAH B;  1QP3 A;  1VYV A;  2DBK A;  3INZ A;  1YJW Q;  4Z88 A;  3CCU T;  1UEC A;  2YDL A;  3P8B B;  4OVA A;  3BFM A;  2CP0 A;  4KRT A;  5CR2 A;  2MWO A;  5GAN 3;  1WHM A;  1YWP A;  1GRI A;  4C5I A;  3UAT A;  4N4G A;  3TEE A;  3J81 E;  1K76 A;  5GAN g;  1TU0 B;  1WQ7 A;  4AFU C;  2OAU A;  2K7A A;  2YUO A;  2YHT A;  2MPX C;  1BK2 A;  2EW3 A;  4PJO E;  4BI8 B;  2HL5 C;  1KQS A;  1AEY A;  2LMJ A;  1VQ8 Q;  2KR3 A;  2DL4 A;  3OYN A;  1M3A A;  1VQN A;  3ASK A;  2RMO A;  1OU8 A;  3CCS A;  2XMF A;  1U5S A;  1YJN T;  2CH4 W;  2MYS A;  2QDY B;  2XID A;  3T9N A;  1MNE A;  3PMI A;  1GXI E;  1FMV A;  3AT1 B;  3MPU B;  4OB2 B;  3MP1 A;  2IVW A;  1QW1 A;  2BIV A;  1RL2 A;  3IQL A;  2ZPH B;  1OOT A;  3BDU A;  1R77 A;  5L8R E;  3VS2 A;  4ELZ C;  1IGU A;  4BI3 A;  2C06 A;  1AWJ A;  3VYG A;  3FLG A;  2DER A;  2K57 A;  2HDA A;  2KRN A;  2QGG A;  4BUG A;  1AHJ B;  4MZM A;  3V8J A;  1M2V A;  4HCC A;  2DMO A;  1WLP B;  2J6F A;  1M8M A;  2RA2 A;  1U1S A;  1W4S A;  3G6E A;  3CCQ Q;  1UHF A;  3SWN B;  4HCZ A;  2EAY A;  4KH0 B;  5KCH A;  3JB9 I;  3PVL A;  5GAN h;  3CCE T;  3WVE B;  2NLU A;  3GF5 A;  4GLM A;  1SSF A;  2DL5 A;  1PKS A;  1KHC A;  4MDW A;  4WF2 A;  5CQY A;  2JT4 A;  3FC3 A;  3LX7 A;  2YRV A;  3KBG A;  1G3Y A;  1VQN T;  1BYM A;  2RHU A;  9ATC B;  2YXY A;  2EFI A;  2EGA A;  3FRN A;  2DO3 A;  4MMK A;  3G71 A;  2ZPB B;  1I81 A;  2FEI A;  3QWX X;  2V1Q A;  2VV5 A;  3UF4 A;  1UEB A;  1HD3 A;  3M4Y A;  2YSQ A;  1YJ9 T;  1ABQ A;  4J7F A;  2PVO B;  2NUT A;  1JXM A;  4HKE A;  1WI7 A;  4M78 A;  4EMK A;  5GMK i;  1NM7 A;  1M90 R;  4J6X A;  1I5O B;  2QK0 A;  4XTX A;  1XQH A;  4C0D C;  2PUO B;  5FRM A;  5D6X A;  5CK9 A;  2ECZ A;  2FVU A;  2KEA A;  1Q86 C;  2RI3 A;  1M2O A;  2FYK A;  1VQK T;  1QQJ A;  3E9G A;  4DEX A;  1PHT A;  2HMA A;  1TUD A;  2XG8 D;  3FJ5 A;  3HFO A;  4BY6 C;  3H0F A;  3I56 T;  1GCP A;  1WJR A;  3S3M A;  2KE9 A;  4FYX B;  1MMA A;  1TSF A;  1WXT A;  2KK4 A;  4CC4 B;  1D0X A;  2CH4 A;  1LCK A;  4RTV A;  3CCR A;  2E10 A;  2EKH A;  3MEA A;  6AT1 B;  3CCR T;  4J5Y A;  4ZGJ B;  1XJW B;  1M30 A;  2F2X A;  4F7U G;  2M51 A;  3EFS A;  3EAE A;  1IZ6 A;  2CS7 A;  2LX7 A;  1UTI A;  1OYX A;  1OZ2 A;  1RAG B;  1EIF A;  4F7U B;  1VQ5 T;  4Z02 A;  4RTU A;  3OYB A;  2DAQ A;  3VS5 A;  2GGR A;  4BI4 A;  4E2F B;  4E7L A;  1VQK Q;  4C8Q D;  2WSF E;  4JPB W;  4M77 D;  4FU6 A;  2DZ9 A;  3M0U A;  4OF1 A;  3PIP A;  3OYA A;  4Y92 A;  3NFC A;  4HVU A;  4K11 A;  3NHN A;  4Z8A A;  3MEW A;  1VQ4 Q;  3CMA Q;  2DTH A;  1ZSZ B;  1ZUK A;  1ZSZ C;  2B86 A;  1QCF A;  4LD6 A;  1V76 A;  2OX7 A;  5GAO p;  1AWO A;  2OAW A;  3L2W A;  2HQH A;  5IXF A;  1M27 C;  1Y96 B;  1DJ7 B;  1VQ6 A;  4XTW A;  2JS2 A;  1G3T A;  1BB9 A;  2D0N A;  4M75 E;  1YCY A;  2PTK A;  1KQS P;  3VS3 A;  2OTJ Q;  2DEU A;  3CCL Q;  2YRD A;  4AMC A;  1VQ4 T;  3A98 A;  1WHJ A;  5LJ3 g;  1YJW T;  3CCJ Q;  3JCM W;  1Q7Y R;  3CCM A;  3EHR A;  2D8J A;  4O6J A;  5A2Q E;  2EYW A;  2O88 A;  3LWI A;  3CCU A;  4FT2 A;  1HXD A;  3UA6 A;  4QVZ A;  1X2K A;  2JMC A;  2M0Y A;  2VC8 A;  3QG1 A;  2LCL A;  4M7A E;  1TUG B;  1MMD A;  2LTO A;  4C92 C;  1OEB A;  2R5A A;  2K5F A;  2LRQ A;  4M75 B;  2VXE A;  5HK0 A;  5GMK m;  4OB3 B;  4PJO B;  3QBY A;  4JJN K;  1PM3 A;  2MK5 A;  2XU8 A;  4NL3 A;  3S6W A;  5KYW A;  5GAN j;  3KFV A;  2B8A A;  2KRS A;  3G4S A;  2F2V A;  3X24 B;  4E47 A;  2KY9 A;  2CUD A;  4ANJ A;  1LVK A;  3NTK A;  4RCC A;  4LUD A;  2EVR A;  1Q82 C;  2LT1 A;  2F1L A;  1ZLM A;  3DLL A;  1LPL A;  2QQ9 A;  2RNA A;  4KGX B;  3VYH B;  3M55 A;  2QTX A;  1KQ1 A;  2Y4Y A;  3FEO A;  5C0M A;  2QQA A;  1RAB B;  2QQS A;  1UDL A;  1KQS S;  2WSC E;  2KAF A;  2O4X A;  2OTL T;  1CKA A;  5GAM h;  1K9M U;  2EWN A;  3OSS C;  4J9F A;  4C5E A;  2CKK A;  3MEV A;  4XU3 A;  4KGZ B;  1R8O B;  2L3Q A;  3SDZ A;  4BE0 A;  2YUQ A;  1YIJ A;  2FZK B;  2X3X D;  1UE9 A;  3FDR A;  1ZX6 A;  4R55 A;  1LNX A;  1VQ9 A;  1JXO A;  3EG0 A;  1K73 C;  5IN1 A;  1BI1 A;  3OMC A;  3C12 A;  3CCV A;  2O9S A;  2A0F B;  1W2B A;  4FYV B;  1TG0 A;  3VUB A;  3ZFJ A;  3QWY A;  1U8R A;  3OYK A;  3CME A;  3OS5 A;  3X26 B;  5EC7 A;  1HSQ A;  3G4S T;  1O9S A;  2QYZ A;  2RJD A;  1QKX A;  1SHG A;  2CSI A;  2DIL A;  1K0S A;  1RAA B;  2EJG A;  4ZN1 A;  1W70 A;  4B6M A;  1RUW A;  4EIK A;  1GBQ A;  4LNP A;  3QYH B;  1BCM A;  3JRZ A;  3HFN A;  2FL7 A;  5IHI A;  1VYU A;  3JCM c;  3G7Z A;  1IO6 A;  4A4G A;  1PSE A;  3M0Q A;  3VUZ A;  3CME T;  2LX9 A;  2P0P A;  1K73 R;  2BZ8 A;  4M77 G;  3JCM Q;  1Q82 R;  3OYY A;  8AT1 B;  2XIC A;  3NMZ C;  3EGD A;  2DXU A;  4B9W A;  1HK9 A;  1X6B A;  2HNI A;  1FYN A;  2RQU A;  3I9Q A;  1YN8 A;  4IUU A;  3JCM f;  4FYY B;  4LDW A;  4FW1 A;  3EH1 A;  4A53 A;  2NUP A;  3FJP A;  2E5K A;  3MEU A;  5KYY B;  4RTZ A;  2P4T A;  2GTO A;  2LC4 A;  4FIB A;  5LJ3 h;  4X1V A;  2QA4 A;  4QVC A;  2K5L A;  4OGE A;  4F7U F;  3RNJ A;  1X75 C;  4J83 A;  2XKO C;  1VQL T;  1YBY A;  2ZPF B;  1AZG B;  1I4K 1;  1SEM A;  5CIU A;  2KI7 A;  5HK3 A;  4PFP A;  1K1Z A;  2F69 A;  1IRE B;  1K73 U;  1S1N A;  2M02 A;  3JB9 H;  4DOV A;  4KUD K;  2PVD B;  3PVQ A;  2EGC A;  2CP5 A;  2L3S A;  3QO3 A;  1XNI A;  4OB0 B;  1N5Z A;  4N4H A;  2MF2 A;  4N4I A;  2COY A;  4OB1 B;  2DTO A;  3LLR A;  1NPP A;  3QDF A;  4JJC A;  2L3R A;  5GAM e;  1OI1 A;  2CSQ A;  2H3E B;  3V7C A;  1QVG A;  2EBP A;  1WXB A;  3F70 A;  1ZBJ A;  1Q81 R;  1WJS A;  2QI2 A;  4M75 G;  1YHQ T;  1PD0 A;  2AZS A;  5AT1 B;  3CC4 A;  1I1J A;  2EJ9 A;  1VQ6 T;  5FRN A;  2DFU A;  2GNC A;  3WVD B;  2VYT A;  3CPW P;  3G6E Q;  3CCQ A;  3OY9 A;  3M0T A;  4JLI A;  5DLO A;  2DRM A;  3OS0 A;  3RMQ A;  4C8Q E;  3CC7 A;  4KUI A;  1RAE B;  1YP5 A;  3UT1 A;  3A8O B;  2RPN A;  4PJM A;  3H41 A;  1K8A R;  3QSU A;  4F04 B;  3TCJ A;  1UJ0 A;  4D6W A;  2QA4 T;  1QCN A;  4EMH A;  2EQK A;  1ABO A;  3E1S A;  5LJ5 g;  5A0L A;  1WQW A;  3QUI A;  2I2L A;  4E6R A;  2ZCF B;  3WXM B;  3EH2 A;  2RQV A;  3CC2 T;  1T3S A;  4VUB A;  2HQE A;  5HY6 A;  2FPE A;  1WPY A;  1K0X A;  4OMM A;  2FPD A;  1ACM B;  1TWB A;  1AT1 B;  2RK1 A;  2X4X A;  1MV3 A;  2LJ0 A;  2CZ0 B;  2QTV A;  4QVD A;  3BE3 A;  1Q81 U;  1SPK A;  3JCM b;  4AG1 C;  3SFM A;  5GAN 2;  2MI6 A;  3X20 B;  4A63 B;  3M59 A;  4M77 F;  2LQW A;  3CXC A;  2DIG A;  4XTZ A;  4KH1 B;  4R56 A;  2PNI A;  1X69 A;  4DBH A;  1YJW A;  4XTY A;  3JV3 A;  2R58 A;  1QP2 A;  2RQW A;  1QMC A;  5GAN 6;  5IHK A;  4BE1 A;  4WCI A;  3CCR Q;  3RDV A;  1NYG A;  4OMQ A;  1VQ9 T;  4YTL A;  3CBP A;  5I22 A;  3GP8 A;  1D3B A;  4XQ3 A;  2A3L A;  4V2S A;  4OMN A;  1JJ2 S;  4M7D E;  1TUC A;  2VVK A;  3A8G B;  3CCS Q; 
#chains in the Genus database with same CATH homology
 2E3I A;  1WHK A;  2QK0 A;  2COZ A;  2Z0W A;  2CP2 A;  1WHH A;  2HKN A;  2M02 A;  2HQH A;  2HKQ B;  1IXD A;  3RDV A;  2E4H A;  1TOV A;  2CP5 A;  3TQ7 P;  2CP0 A;  2MPX C;  1WHL A;  3E2U A;  2HL5 C;  2COY A;  2CP6 A;  2HL3 A;  2COW A;  2CP3 A;  1WHM A;  2CP7 A;  1TXQ A;  2E3H A;  1WHG A;  1LPL A;  1WHJ A;  4B6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...