2CP6A

Solution structure of the 2nd cap-gly domain in human clip-170/restin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
172
structure length
172
Chain Sequence
GSSGSSGATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Restin
publication title Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin
rcsb
source organism Homo sapiens
total genus 5
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp6A01
2E4HA 2HQHA 3RDVA 2E3IA 1LPLA 2CP6A 2CP0A 1WHLA 2HL5C 2QK0A 2Z0WA 2CP5A 2COYA 1WHJA 2M02A 1IXDA 1WHKA 2CP3A 1WHHA 3E2UA 2COWA 2HKQB 1WHMA 2MPXC 2CP2A 4B6MA 2COZA 2HL3A 1TXQA 2CP7A 2E3HA 3TQ7P 2HKNA 1WHGA 1TOVA
chains in the Genus database with same CATH superfamily
1FWZA 2DTHA 1YJNT 1VQ9A 4JJNK 3TVTA 1PRLC 2NWMA 2DM1A 4A4HA 3META 1KC8R 2RQUA 5KYUA 1VQPA 4RTUA 1EZZB 3J7AF 2AKKA 2QTXA 4J9EA 5DY9A 4ZGEB 4J83A 2COWA 1AZEA 2COZA 3TREA 1Y96B 1K8AC 1ABOA 2KE9A 1VQKQ 2J6FA 2K5IA 1Q86R 2KSSA 5M9OA 3C0CA 1BKBA 1K73R 2PTKA 5I2SA 3VS2A 1T0HA 5LJ5f 1Q7YC 1D3BA 2EJ9A 4FT4A 3EG1A 2FPEA 1JO8A 3JCMQ 4XAXB 1VQ5T 2QA4A 1VQ4T 1D1BA 3RR6A 5GJWB 1E7OA 2HKNA 1PC0A 2RPNA 2X4WA 1PSFA 1VQMA 3E9GA 1KHIA 5LJ3f 4F04B 3G71T 2OTJT 3OYBA 4OMPA 3QUIA 3HTRA 4M7DA 1JJ2P 4ANJA 2FZGB 1E6HA 2RI5A 3HPWA 4HXJA 2ZCFB 2KVQG 1Y71A 2YT6A 2VYTA 3JB9F 2PNIA 2A7YA 1PRMC 4KGZB 2RJDA 2G6FX 3X20B 1ZQ1A 2H3EB 1K9AA 3EGDA 3H8ZA 5FLXE 4JRQA 4RKUE 2LDMA 1Q81R 3A98A 1VA7A 4P5NA 2KNBB 5GAMg 1OQKA 1T3SA 2C0OA 1ZUKA 3V8LA 3VUBA 1H8KA 2ZAEA 1WHHA 4JUVA 4NL2A 1QKXA 3VYGA 2F2WA 1YI2Q 2F69A 3M55A 4IUTA 2CP7A 4XU2A 3M9QA 4FYYB 1QP3A 4OB2B 4XTVA 1YITA 4C8QE 3G6EA 4RMOA 2V8KA 4X1VA 1PWTA 2FRWA 4XTZA 4A4FA 1JJ2A 3NFCA 3CCMQ 5D6WA 1WXTA 4ZGJB 4BB7A 2QXFA 1HSQA 1PNJA 2LCLA 3GBQA 3VS7A 4M7AF 5GANh 4C5EA 4FM4B 1YHQT 2AK5A 3CCLQ 3FC3A 4GY5A 2FPDA 4MZTA 4WF2A 2KBTA 3CC4A 2ZPEB 4ATOA 2MWPA 2RF0A 1SSHA 3H9NA 1AEYA 2DFUA 1T3LA 4J9HA 5A0LA 4FW2A 4J7FA 1PKSA 3JB9H 1WJQA 2JTFA 2QDLA 3UDCA 2FZCB 2E6NA 1IRXA 2MPXC 2M51A 1KC8C 4J9GA 4L5GA 4C5IA 3VYHB 2LQWA 4AFUC 1UB4A 3KXTA 5IN1A 4AMCA 1G3SA 2XMFA 5J39A 4J5YA 1Z9QA 2Y4YA 4HVVA 4JS4A 2GFAA 1AZGB 1Q86C 5A0GA 1M3BA 2E5KA 3A8GB 3CQTA 1AWOA 4RTXA 1W2BA 3ZBDA 3M54A 5GAN5 4JPBW 1K73C 1TUCA 3EG0A 4J9DA 1GCQA 5GAN2 3CMAA 3INZA 3HSBA 2DE0X 1VQNA 2HQHA 4KGXB 2CH4W 2FB7A 2XU8A 3QJYA 2D9TA 1VOMA 2JXBA 4CC3A 4BDYA 2SEMA 2JM9A 3M53A 4PJOB 2QG9B 3OS5A 3CXCP 3MCAB 3CC2Q 1VQLT 5GAOq 4DEYA 2RD1A 3OYDA 1GFCA 3VS1A 2K7AA 3EG3A 4FYWB 1G2BA 2X4XA 3TSWA 3JCMc 3SFMA 4M78E 1X01A 2IG0A 1VQKA 1QKWA 2RQVA 2VVKA 4X9DA 2BZYA 3VKIA 3WVEB 2F2VA 2KDSA 2V8IA 2OI3A 3OYIA 4AFZC 1Y0MA 2VUBA 5GAMe 3PVLA 1M2VA 4X9CA 2K9GA 1RI0A 5CQXA 4A53A 5GAOp 3EG9A 2GQIA 3ULRB 1ZUUA 4EMGA 4PJJA 1BI0A 2DNUA 2J05A 4OGCA 3LGFA 2D0NA 4F7UE 2RH2A 2EGCA 2RN8A 3CXCA 2QTVA 1RADB 5GANj 2KXDA 3GF5A 2M9UA 5I22A 2KAFA 2ZPFB 3THKA 4DBQA 1HD3A 1WA7A 1BCMA 4MZMA 2CUBA 4OMOA 1WFWA 2FVUA 2KR3A 4JZ4A 4QT7A 1RI9A 1M5Q1 3P8HA 3CD6Q 3F70A 3QO3A 2RI3A 1MMDA 2DILA 4EIKA 1ZSGA 4M7DG 3UF4A 4AG1C 2C06A 2E10A 3OBWA 2QYZA 2DO3A 4NOYA 1QVFA 1D3BB 2KRNA 3NPFA 3I55A 4A4GA 1GBQA 3JCMd 1WHGA 3UT1A 1YI2A 1UDLA 1M4ZA 2MAMA 1Q82U 3C12A 4JRPA 2X4YA 2X9HA 2LX7A 2QEXQ 5KE2A 1K1ZA 3NGPA 5LJ5j 1VQ7A 1PCXA 3NTHA 4R55A 3C95A 2YSQA 3L2ZA 1AD5A 1LVKA 8ATCB 3M0QA 3CCMA 1BU1A 3LX7A 1YJ9Q 2A36A 3I56A 1RAEB 1LJOA 2ZGWA 3CBPA 2H8HA 4OF1A 3CCLA 1WXUA 3ZEHA 4IIMA 2DIGA 3EGDB 3E2UA 4KGVB 1FXXA 1MUZA 2P0KA 5FU7C 2KROA 2KT8A 3NMZC 3OY9A 4BDZA 1TOVA 4E47A 1NEBA 1LNXA 2KYMA 1VQOQ 2AIRB 4M7DD 3QZ9B 2YRDA 2DX1A 2PU9B 1NPRA 3DB4A 4M7DC 1UGQB 3S3NA 3RMSA 2DERA 1IHVA 2W10A 3CCET 2K3YA 4F16A 2HCKA 4N4HA 2JN0A 2LC4A 1YIJT 5GANg 3OMCA 1CKBA 1D09B 3HRTA 1M9SA 1JRIA 1K0XA 3RESA 2DXUA 1GRIA 3I35A 3JSCA 1OZ2A 2LCCA 2CREA 3A8HB 1N6AA 2LJ1A 7AT1B 2HQXA 2EVRA 4PNOA 4OMQA 2QQ9A 4RTVA 3L2QA 5IHKA 1TH7A 4LD9K 3JB9I 3SWNB 1NYGA 3C4SA 2P0QA 1D0XA 1X2KA 2VV5A 2QEXT 2GFUA 1OULA 3VUZA 2MYSA 4QW2A 2O4XA 3G4SQ 1QCFA 3VJPA 2EBPA 1S1NA 1VQ9T 2I0NA 3CC2A 1I81A 2KK4A 1JU5C 3MJXA 3N5BB 1WJRA 2C0TA 1VQPT 2O31A 2PZ1A 3G1JA 2HSPA 1ZBXA 4L59A 4HVUA 3OYCA 1KD1R 1FX7A 1RLPC 1MV0B 1K9MR 2FZKB 4JLGA 3QDFA 3TU4K 5KCHA 3GLXA 4AT1B 5CKHA 2LQNA 4AG2C 4M77E 1VYTA 2JUFA 2AZSA 4LUEA 2D8JA 1YFNA 3JCMh 3VS5A 3SHWA 2J7IA 2SRCA 4MDXA 4Y28E 2QA4T 1IXDA 3M59A 2OAUA 4C0GA 2FYKA 1OPKA 3R6OA 4Q5WA 1CKAA 2KY9A 3EH2A 1KFZA 1VQMT 3PE0A 2EIFA 2RHXA 1I07A 3TQ7P 2KRMA 4C92A 1VQ8Q 4RG8A 4PJNA 4PJOA 1KC8U 3OYMA 3O8VA 1WHLA 2KYBA 4GLKA 3CD6A 1PSEA 1OPLA 2LJ3A 4LE9A 1GCQC 2XG8D 2ROLA 1UJ0A 3QYHB 2DL4A 3OBYA 1YWPA 1Q86U 3L2RA 2HAXA 2GNCA 2EJFA 3PFSA 1UEBA 2CZ6B 1K0SA 3JB9J 1K73U 5HCKA 2K5LA 1TWBA 2O9VA 2RMOA 3EG9B 1OOTA 2BE9B 2V1QA 1OV3A 2D1XA 4CRIA 4RCBA 4HKEA 1H3ZA 1UG1A 4CI0C 4BE0A 2FO0A 1BBZA 3E1SA 3M57A 1ABQA 1YITT 3E9FA 3G6ET 1N9SA 3M0TA 2D6FA 1N27A 1V76A 2CZ1B 2DL3A 2HBWA 4M7DF 1YJ9A 3DKMA 5GANe 2AHJB 5LJ5d 5I2MA 3D7SB 1GXIE 1WPYA 1SRLA 1S72Q 2RJEA 3QBYA 4GBQA 4V2SA 4E7SA 5FROA 1U06A 3X24B 2L8DA 3CC4T 3LGLA 2DZCA 3OYAA 1BI2A 4PFPA 4KRTA 2LRQA 1HK9A 2DVJA 1VQOA 5LJ3d 1U1SA 4CC4B 2LQ8A 1NLPC 2L89A 2OAWA 4RTYA 4E7JA 3ASKA 1H641 1QWFA 1M1KU 2RQTA 4FYVB 2D0QB 3LH0A 2LT1A 2DD5A 2YUOA 3EFRA 1KHCA 2QASA 2L5QA 3H41A 2CYZB 5J3BA 3RUXA 3KUFA 4PKCC 1WHJA 4WCIA 2K6DA 5HKCA 5LJ5e 2CP3A 3JCMW 1C0MA 5CKBA 4QVZA 4M75B 3PVQA 1OU9A 2LNVA 2G3RA 2QDYB 2VC8A 2JVVA 1JJ2S 2ATCB 2HMAA 4FU6A 5A0DA 1RAFB 1XOVA 1K9MC 4ME7A 1G5VA 2J6OA 4M78B 4M7AE 3OSSC 1NE8A 2HQEA 1C6VX 2K4YA 3CMAT 5LJ3e 2M1HA 3A8OB 2A37A 3I55Q 1VQNT 1MMNA 2YWWA 3S3MA 1N8RU 4J9FA 4D8DA 3NTIA 3G4SA 2W0ZA 1IGUA 1YCSB 1M8MA 2EAYA 2EW3A 2FEIA 1VYUA 4Z89A 3UWNA 1VQ7Q 2BIVA 3L2WA 4F7UB 3QJ6A 2EGAA 2PQWA 1M1FA 1QCOA 2DL8A 2D8HA 3KBGA 4DOWA 5CR2A 5CO7A 4PLIA 1TXQA 1LCKA 1OU8A 1UHFA 2EYZA 1VQKT 3I56Q 1JB0E 2XD0A 4DBFA 4LD6A 3CCQQ 2BZXA 1NJIU 4PFZA 2R5MA 3GIBA 1ZA2B 4OB0B 2PVDB 5GMKj 3EG2A 2A28A 4BI8B 6AT1B 3H0FA 2CSIA 1RACB 4JDSA 4DBRA 1W2BP 2YHTA 2EQMA 2ENMA 3VRYA 1MV3A 2EYWA 4FIBA 1U3OA 3SWNA 1W2BS 3HFNA 3A1PA 3QPHA 1Q95G 2O4XB 5EG2A 3Q1JA 4JJDA 2O88A 1OZ3A 1WQWA 2GTOA 3EFSA 1WQ7A 3ZL7C 4HT8A 2JMAA 2MMPA 1VQ8A 1IZ6A 2ABLA 4J9CA 2OTLQ 1IO6A 5AYFA 2GTJA 5AT1B 1KQSP 4TVRA 1GBRA 1AWJA 5L23A 1I0CA 2E1HA 3EFOB 4C92G 5LJ5h 4DQ2A 4PJOG 2ECZA 1RAAB 4HVWA 5DM7R 4ESRA 3OMGA 3RIRA 2JM8A 1KIKA 4PJLA 3CCSQ 3EHRA 1V1CA 1WJSA 4IUQA 3I55T 2EGEA 3JCMg 1UHCA 1BK2A 1QW1A 1RL2A 2JW4A 4XTXA 4LDUA 2JNGA 2HL3A 1YI2T 1X27A 2E5QA 5EC7A 4XTUA 1QLYA 5LJ3h 1NPPA 2PUOB 2VASA 3JCMP 2BUDA 3CPWA 2EPDA 4CC2A 5GAOm 3GNFB 1VQ7T 3URGA 3M4YA 3SB2A 3IQLA 4C92B 2IIMA 3CCMT 1KQSA 4MMKA 3OYEA 1GFDA 2DD4A 2PVGB 3I56T 1TU0B 3CXCS 3CCVQ 2M16A 4C8QA 3UA6A 3CCLT 5FWCA 1S72A 1UJYA 2YDLA 1NG2A 5IXFA 2CZ0B 3L2VA 5GAMf 5KE3A 3LWHA 3PIPA 1KK7A 1Q81C 1KG1A 3CMEQ 1M90U 3OA6A 1JXOA 5A2QE 4BACA 1QVFP 4C92D 4PJOD 4C92C 4PJOC 4B9WA 1PKTA 1QVFS 1B34B 2RI2A 3J80E 5C0MA 2JS0A 1U8RA 1G3WA 3QWXX 4ZTJA 4EMHA 2PUKB 1AT1B 2DYIA 3A8MB 3VU3C 1PHTA 2FL7A 3QZ5B 3RBBB 4FSXA 3A8LB 4HCBA 1ACMB 1U1TA 4C5HA 4O6JA 4IUVA 4Z8AA 2DBKA 2DK3A 3CCJA 3CCUQ 1G8XA 2XIDA 2AZVA 3FB9A 4ZNXA 4KT0E 2DXCA 4RTZA 2HSEB 2BZ8A 5ECAA 2P0PA 4QVCA 5FW9A 2P4TA 3J81E 3CCRQ 1WXBA 4UC4A 3MEWA 2P84A 3L42A 2LX9A 1F1BB 4Z88A 3FJPA 4MMLA 4M77B 1LPLA 1AWWA 2CP0A 4IKFA 1KQ2A 4J6XA 3VS0A 2EQKA 1AHJB 1OYXA 4QQDA 5CK9A 2M02A 4AFSC 1SEMA 4QVDA 3CC2T 1AOJA 2XICA 1IB8A 1Y7XA 2DJQA 5GMKm 1MMGA 2LT4A 4II1A 1ZSZB 3BFMA 3UA7A 1M27C 3LYIA 4FYXB 2F1LA 1K8AU 2K2VA 2DBMA 3CCQA 3VS4A 4M75A 2HBPA 4BD3A 4O5VA 2NUTB 2YUQA 2CT4A 1DJ7B 2DF6A 2DETA 5LJ3j 1M30A 2RHZA 2DLPA 4C0DB 2CUDA 4ORZA 1Q7YU 4J6YA 4M78A 1B07A 3JCMe 4OMNA 4A54A 4PFOA 2RK1A 4BI4A 3PMTA 3CC7Q 2HZYA 4RCCA 4OGEA 3X25B 1AVZC 2RB6A 1UFFA 5IT9E 2OTLA 2Y90A 1LOJA 5CCAA 3V7SA 1D1AA 4F7UA 2YLCA 3RKXA 4A4EA 3CD6T 2LQKA 1Q82R 4PJOE 2HEQA 1X6GA 1BI3A 1QVPA 4RG2A 1UGSB 5IHIA 5DLOA 3VS3A 1VQ6Q 2DXBA 3GNGA 4MZPA 5LL6S 2L2PA 2RJFA 3V7CA 4AFQC 3QG1A 3ZFJA 1J3TA 2LVMA 3M58A 4VUBA 3VRZA 3CCSA 2EKHA 4J9BA 5GAN4 2EFIA 1X6OA 2ED0A 4HA8A 4ELYC 3M0RA 3TEEA 4JRKA 4Z02A 2XDBA 1R77A 3AHUA 3ER0A 1FYNA 5GMKe 2CH4A 2RQWA 2DJZA 4JZ3A 3V7RA 1GCPA 3BE3A 2XHCA 3OYNA 3H6ZA 5FU6B 3MKDA 2KXCA 1UGRB 4BI3A 3HRUA 1I5OB 2DL7A 2ZPIB 4C92F 4PJOF 1FMVA 2HNIA 2MIOA 1YJ9T 1P92A 1YJWQ 2E4HA 2X35A 2E3IA 2DZ9A 5LJ5g 1BCOA 3CCVA 5L8RE 1CSKA 2QAZA 2EYQA 1HXDA 3GPLA 3EFOA 3O5ZA 1UE9A 2L0AA 4IURA 3GOXA 2EWNA 2LTOA 4XTWA 2AT1B 2E12A 5GAN3 4C8QG 4RUGA 3RERA 3SWNC 4OP0A 2NUPB 2JJ9A 1EFNA 3CMEA 1YJNQ 4C0FA 2DXTA 2DRKA 5LJ3g 1VQOT 1FMKA 1UGPB 4M7AB 4KH0B 2CP5A 1N5ZA 3C94A 5D6YA 3PNWC 5HK0A 3FRNA 1ZX6A 2YUPA 3MP6A 3PIOA 3JRZA 1EX4A 1X75C 1ZLMA 5CKFA 4BUGA 4LDWA 2YXYA 2DEQA 3FJ5A 2RA2A 2GQVA 3DB3A 1H92A 1PM3A 2VXFA 4J8OA 1IHWA 4E7KA 4C8QB 5HY6A 3JCMX 1JXMA 4E7HA 3CCUA 1N9RA 2DTIA 1VQ5Q 1G83A 1QCNA 4M7DE 2RK2A 1VQ4Q 3DLMA 3OW2P 2M0YA 1WIEA 1WNLA 3A5ZB 3OS1A 2DA9A 2KMTA 3RNJA 3CCRA 2YLBA 4HT9A 3T9NA 4F14A 4EMKB 3BY7A 2QQRA 3MEUA 2MWOA 2RNAA 3G71Q 2OTJQ 1G3YA 1QVGA 2L3QA 2EQJA 5KYYB 3P8BB 4XK8E 4CC7A 2JOYA 2L3PA 5GMKh 3G4ST 1YCYA 2HD0A 4IUUA 4C8QD 1XQHA 4C8QC 5KYWA 1B34A 3VV0A 5GANf 3I5SA 1RLQC 3EHQA 3QDRB 1ZUYA 3M0UA 3L2UA 4FL6A 1Q82C 3OW2A 4OVAA 4EPCA 1U5SA 2K79A 2CZ7B 4A63B 3EGUA 2F5TX 1Q81U 3KFVA 4M75G 1D0YA 1R8OB 2HL5C 4HCKA 2R58A 2OX7A 4KUDK 1VIFA 3OYJA 1NLOC 3CC7A 5KYNA 1M1GA 4LN2A 4M78G 4Y91A 4E7IA 4M77A 4JJBA 2E3HA 3H0HA 1YHQQ 5KH6A 3MPUB 2GBQA 1VQ8T 1V29B 4GLMA 3M0SA 2C0IA 5CKDA 1TTHB 3V8JA 5CAIA 4LUDA 2QI2A 4DBHA 4JRIA 1VQ6A 3OYLA 3QHSA 3HP9A 1ZSZA 4ELZC 4E7ZA 4ZN1A 1T0JA 1KD1C 4F7UG 3CCJQ 1M2OA 3LW5E 4OMMA 1O75A 4J6WA 2PVOB 4QKUA 2NUTA 3EAEA 1PD1A 3AT1B 1JEGA 1C1AA 2QK0A 2CSQA 2XKOC 2RM4A 2A0FB 2R57A 4IIOA 2DYBA 4JLIA 4JS5A 3JV3A 2L3SA 5IAYA 3JCMJ 2X3XD 1FMWA 2NYSA 4A4KA 3WXMB 1SKUB 4M75D 2RHIA 4M75C 3MEVA 3G7ZA 4FCYA 1YJWA 1QP2A 2VGMA 3V8KA 5I21A 1SF9A 3CBMA 3ME9A 3P8DA 3OS2A 3FLGA 4LNPA 2V1RA 4M78D 1K76A 2KEAA 1K4US 1M1KR 4M78C 1S72T 2K57A 1YN8A 3PMIA 1NBEB 3PTAA 5KYXA 3M5AA 3QIIA 2NUZA 1YJNA 3RKYA 1ZBJA 1QMCA 1VQLQ 3SEMA 4E7LA 4RTTA 3RMQA 2CT3A 1MGQA 3UPUA 5GAOr 3MP8A 4OMFB 4FW1A 3MP1A 1WZOA 2DKGA 3HL8A 3OS0A 3CPWP 1UUEA 2DRMA 3QYGB 1AWXA 4DA4A 2CDTA 4DEXA 3CPWS 1TUDA 3U23A 5DLQE 1MNEA 1IREB 4C8QF 1GL5A 3OSVA 1BB9A 2J6KA 1PG5B 3CCJT 1N8RR 5HK3A 1VQ5A 3H0IA 2RHYA 1KQSS 1JBMA 1VQ4A 4D6WA 3EGXB 3BDLA 2COYA 3OYYA 4BE1A 3HKSA 1YWOA 1BIBA 1OX9A 2WSEE 5GAN8 1WHKA 2ZPGB 1ZA1B 1RAIB 3G71A 2OTJA 2NUPA 3PGGA 3L1AA 1WX6A 3FIFA 1D1CA 2VKNA 4N4GA 5I11A 4NL3A 1MNDA 4M7AA 4HCCA 1IGQA 5GAN6 4NS5A 1W70A 3S3OA 1NJIR 2O01E 2EKOA 3MO8A 2K2MA 1QWEA 4LXCA 2EQIA 4LDVA 2KRSA 4K11A 2E6ZA 2HDAA 1X43A 2VXEA 5GAMd 2WSCE 3REBB 2H3JA 1X69A 1XNIA 2VWFA 4J9IA 3BW1A 3CCQT 4PJMA 3RDVA 2R5AA 2K3XA 2FHDA 1JQQA 1NM7A 2B86A 4E6RA 1VUBA 4M75E 1QQJA 2LZ6B 2ESWA 1R0BG 2FPFA 2E65A 3S6WA 4N0AA 2KT1A 4EMKA 1I8FA 3TSZA 3X26B 2E64A 2KGTA 1A0NB 2JTMA 1SSFA 5KYYA 1YHQA 4XU1A 5KYWB 2DL5A 4QQ6A 1W6XA 2B8AA 2XK0A 2RHUA 2OTLT 4FSSA 1WI7A 2XI9A 2MF2A 2LMJA 1WHMA 2CP2A 4M77G 1I4K1 4XQ3A 1WLPB 4R0KA 4KBMB 1Y57A 2E70A 2QQBA 1Y07A 2JS2A 4D8KA 2DAQA 2BKDN 2FRYA 5FWBA 4EDUA 4M75F 2MCNA 1M1KC 4OB3B 5IH2A 8AT1B 2RO0A 2ROTA 2EYXA 4OMLA 2JTEA 1OI1A 3CCST 1X6BA 1H3HA 1G3TA 5GAN7 2HKQB 2YUNA 2EYYA 4M78F 5KYUB 3CCEQ 3OYKA 2CS7A 2A3LA 3OYHA 3OQ5A 1YIJQ 3UATA 2IPOB 4R56A 2LCSA 5GJVB 2MK5A 3CBOA 3CPFA 2RJCA 2GCXA 4KH1B 3M0PA 5KCOA 2EQUA 1Y96A 3X28B 3PT9A 4M4ZA 1OEBA 1W1FA 1PD0A 5C6SA 4F7UF 3QXEB 1M90R 1WDXA 2V26A 4LDYA 1TS9A 3I9QA 1UECA 3CCVT 3GP8A 1EIFA 3MEAA 4RTWA 1TUGB 1E6GA 5FU7B 4QQGA 1N8RC 1HYOA 4KUIA 2DVEA 1VYVA 1NYFA 4M77D 2QGFB 1HJDA 3JCMf 2XDDA 4M77C 3CMET 1SHGA 1VQ9Q 4M7DB 2OJ2A 1VQLA 4F17A 4Y92A 1ARKA 5GAOl 4XU0A 2I2LA 1VQPQ 2DIQA 5FRNA 2X4JA 2LP5A 4C5GA 4HCZA 1OX8A 4KULA 1NJIC 1YBYA 2KQWA 1M3AA 1ZSZC 3HRSA 3SD4A 3JB9G 1O9SA 3E19A 2V8JA 1BYMA 1RUWA 2K3BA 5GAMh 1WYXA 3CCUT 4C92E 1KD1U 5KYXB 4C0DC 2QA4Q 4YTLA 1K9MU 2BE7D 1UGVA 2Y4XA 3CCRT 5CVIA 1VQMQ 1X2QA 2DPPB 1ZHIA 2A08A 1MMAA 2E41A 1B7TA 5CIUA 2RQRA 4DOVA 2ZPHB 1M8VA 3BDUA 1K8AR 2MOXA 5CQYA 3LH5A 3OB9A 2WSFE 1TSFA 1SRMA 4PK4A 4M7AG 2GF7A 4PL6A 3NTKA 3OYFA 1Q7YR 2MI6A 4JJCA 3HHTB 2ED1A 3JCMV 2Z0WA 1XTDA 1BIAA 2DMOA 2JT4A 4B9XA 2QQAA 1NEGA 3RKWA 1RABB 1YP5A 5J26A 1RAHB 2GGRA 1YITQ 3JB9D 4C0ZA 2QQSA 4FT2A 3G6EQ 3EGXA 1KQ1A 2P4RA 3NHNA 5GAOn 1D0ZA 4N4IA 1KSWA 2J06A 5FU6C 1I1JA 1I5LA 2X3WD 2YRCA 2ZPBB 2EJGA 2IVWA 3CC7T 2X51A 1QVGP 3QKJA 2CGHA 5GMKl 3QSUA 3M56A 3TCJA 2L3RA 5IHNA 4ZTFA 1W4SA 1MHNA 1QVGS 4PLLA 3CC4Q 2F5KA 3CEYA 1NZ9A 9ATCB 2AKLA 1WGSA 3FEOA 1M90C 1BI1A 2O9SA 1VQ6T 5GMKi 5FRMA 4X34A 3JAME 3OYGA 1UTIA 2FG0A 2KI7A 4E2FB 3LWIA 4XTYA 3I5RA 4XU3A 4M7AD 4WTOB 2K5FA 2WACA 2DTOA 5D6XA 4M7AC 3CCEA 1TG0A 2DEUA 4IUPA 3MHXA 4BE2A 1Z9ZA 3JCMb 4LDXA 2YRVA 2VGNA 3OW2S 1YIJA 4MDWA 4BY6B 5GANd 4L6V5 1M3CA 2VB6A 3M4GA 1XJWB 4ZN3A 1SPKA 5CKEA 2LJ0A 4M77F 2XDPA 3EH1A 1VIEA 2CKKA 5GAMj 2O2OA 1B3QA 1KJWA 1M2VB 1YJWT 3HFOA 3DLLA 2F2XA 2ZZDA 3R6NA 2CP6A 2BTTA 2M0OA 3QWYA 3VS6A 4ZGDB 1SG5A 3CMAQ 3FDRA 3REAB 2QGGA 3SDZA 4N0AC 4OB1B 4B6MA 4EMKC 2QEXA 1VQNQ 5D7UA 3LLRA 1YNZA 1SHFA 2LNHB 2JZ2A 5IXBA 3WVDB 4BY6C 2JMCA 2NLUA 1RAGB 1R0CB 4J7IA
chains in the Genus database with same CATH topology
2E4HA 2HQHA 3RDVA 2E3IA 1LPLA 2CP6A 2CP0A 1WHLA 2HL5C 2QK0A 2Z0WA 2CP5A 2COYA 1WHJA 2M02A 1IXDA 1WHKA 2CP3A 1WHHA 3E2UA 2COWA 2HKQB 1WHMA 2MPXC 2CP2A 4B6MA 2COZA 2HL3A 1TXQA 2CP7A 2E3HA 3TQ7P 2HKNA 1WHGA 1TOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4H A;  2HQH A;  3RDV A;  2E3I A;  1LPL A;  2CP6 A;  2CP0 A;  1WHL A;  2HL5 C;  2QK0 A;  2Z0W A;  2CP5 A;  2COY A;  1WHJ A;  2M02 A;  1IXD A;  1WHK A;  2CP3 A;  1WHH A;  3E2U A;  2COW A;  2HKQ B;  1WHM A;  2MPX C;  2CP2 A;  4B6M A;  2COZ A;  2HL3 A;  1TXQ A;  2CP7 A;  2E3H A;  3TQ7 P;  2HKN A;  1WHG A;  1TOV A; 
#chains in the Genus database with same CATH topology
 1FWZ A;  2DTH A;  1YJN T;  1VQ9 A;  4JJN K;  3TVT A;  1PRL C;  2NWM A;  2DM1 A;  4A4H A;  3MET A;  1KC8 R;  2RQU A;  5KYU A;  1VQP A;  4RTU A;  1EZZ B;  3J7A F;  2AKK A;  2QTX A;  4J9E A;  5DY9 A;  4ZGE B;  4J83 A;  2COW A;  1AZE A;  2COZ A;  3TRE A;  1Y96 B;  1K8A C;  1ABO A;  2KE9 A;  1VQK Q;  2J6F A;  2K5I A;  1Q86 R;  2KSS A;  5M9O A;  3C0C A;  1BKB A;  1K73 R;  2PTK A;  5I2S A;  3VS2 A;  1T0H A;  5LJ5 f;  1Q7Y C;  1D3B A;  2EJ9 A;  4FT4 A;  3EG1 A;  2FPE A;  1JO8 A;  3JCM Q;  4XAX B;  1VQ5 T;  2QA4 A;  1VQ4 T;  1D1B A;  3RR6 A;  5GJW B;  1E7O A;  2HKN A;  1PC0 A;  2RPN A;  2X4W A;  1PSF A;  1VQM A;  3E9G A;  1KHI A;  5LJ3 f;  4F04 B;  3G71 T;  2OTJ T;  3OYB A;  4OMP A;  3QUI A;  3HTR A;  4M7D A;  1JJ2 P;  4ANJ A;  2FZG B;  1E6H A;  2RI5 A;  3HPW A;  4HXJ A;  2ZCF B;  2KVQ G;  1Y71 A;  2YT6 A;  2VYT A;  3JB9 F;  2PNI A;  2A7Y A;  1PRM C;  4KGZ B;  2RJD A;  2G6F X;  3X20 B;  1ZQ1 A;  2H3E B;  1K9A A;  3EGD A;  3H8Z A;  5FLX E;  4JRQ A;  4RKU E;  2LDM A;  1Q81 R;  3A98 A;  1VA7 A;  4P5N A;  2KNB B;  5GAM g;  1OQK A;  1T3S A;  2C0O A;  1ZUK A;  3V8L A;  3VUB A;  1H8K A;  2ZAE A;  1WHH A;  4JUV A;  4NL2 A;  1QKX A;  3VYG A;  2F2W A;  1YI2 Q;  2F69 A;  3M55 A;  4IUT A;  2CP7 A;  4XU2 A;  3M9Q A;  4FYY B;  1QP3 A;  4OB2 B;  4XTV A;  1YIT A;  4C8Q E;  3G6E A;  4RMO A;  2V8K A;  4X1V A;  1PWT A;  2FRW A;  4XTZ A;  4A4F A;  1JJ2 A;  3NFC A;  3CCM Q;  5D6W A;  1WXT A;  4ZGJ B;  4BB7 A;  2QXF A;  1HSQ A;  1PNJ A;  2LCL A;  3GBQ A;  3VS7 A;  4M7A F;  5GAN h;  4C5E A;  4FM4 B;  1YHQ T;  2AK5 A;  3CCL Q;  3FC3 A;  4GY5 A;  2FPD A;  4MZT A;  4WF2 A;  2KBT A;  3CC4 A;  2ZPE B;  4ATO A;  2MWP A;  2RF0 A;  1SSH A;  3H9N A;  1AEY A;  2DFU A;  1T3L A;  4J9H A;  5A0L A;  4FW2 A;  4J7F A;  1PKS A;  3JB9 H;  1WJQ A;  2JTF A;  2QDL A;  3UDC A;  2FZC B;  2E6N A;  1IRX A;  2MPX C;  2M51 A;  1KC8 C;  4J9G A;  4L5G A;  4C5I A;  3VYH B;  2LQW A;  4AFU C;  1UB4 A;  3KXT A;  5IN1 A;  4AMC A;  1G3S A;  2XMF A;  5J39 A;  4J5Y A;  1Z9Q A;  2Y4Y A;  4HVV A;  4JS4 A;  2GFA A;  1AZG B;  1Q86 C;  5A0G A;  1M3B A;  2E5K A;  3A8G B;  3CQT A;  1AWO A;  4RTX A;  1W2B A;  3ZBD A;  3M54 A;  5GAN 5;  4JPB W;  1K73 C;  1TUC A;  3EG0 A;  4J9D A;  1GCQ A;  5GAN 2;  3CMA A;  3INZ A;  3HSB A;  2DE0 X;  1VQN A;  2HQH A;  4KGX B;  2CH4 W;  2FB7 A;  2XU8 A;  3QJY A;  2D9T A;  1VOM A;  2JXB A;  4CC3 A;  4BDY A;  2SEM A;  2JM9 A;  3M53 A;  4PJO B;  2QG9 B;  3OS5 A;  3CXC P;  3MCA B;  3CC2 Q;  1VQL T;  5GAO q;  4DEY A;  2RD1 A;  3OYD A;  1GFC A;  3VS1 A;  2K7A A;  3EG3 A;  4FYW B;  1G2B A;  2X4X A;  3TSW A;  3JCM c;  3SFM A;  4M78 E;  1X01 A;  2IG0 A;  1VQK A;  1QKW A;  2RQV A;  2VVK A;  4X9D A;  2BZY A;  3VKI A;  3WVE B;  2F2V A;  2KDS A;  2V8I A;  2OI3 A;  3OYI A;  4AFZ C;  1Y0M A;  2VUB A;  5GAM e;  3PVL A;  1M2V A;  4X9C A;  2K9G A;  1RI0 A;  5CQX A;  4A53 A;  5GAO p;  3EG9 A;  2GQI A;  3ULR B;  1ZUU A;  4EMG A;  4PJJ A;  1BI0 A;  2DNU A;  2J05 A;  4OGC A;  3LGF A;  2D0N A;  4F7U E;  2RH2 A;  2EGC A;  2RN8 A;  3CXC A;  2QTV A;  1RAD B;  5GAN j;  2KXD A;  3GF5 A;  2M9U A;  5I22 A;  2KAF A;  2ZPF B;  3THK A;  4DBQ A;  1HD3 A;  1WA7 A;  1BCM A;  4MZM A;  2CUB A;  4OMO A;  1WFW A;  2FVU A;  2KR3 A;  4JZ4 A;  4QT7 A;  1RI9 A;  1M5Q 1;  3P8H A;  3CD6 Q;  3F70 A;  3QO3 A;  2RI3 A;  1MMD A;  2DIL A;  4EIK A;  1ZSG A;  4M7D G;  3UF4 A;  4AG1 C;  2C06 A;  2E10 A;  3OBW A;  2QYZ A;  2DO3 A;  4NOY A;  1QVF A;  1D3B B;  2KRN A;  3NPF A;  3I55 A;  4A4G A;  1GBQ A;  3JCM d;  1WHG A;  3UT1 A;  1YI2 A;  1UDL A;  1M4Z A;  2MAM A;  1Q82 U;  3C12 A;  4JRP A;  2X4Y A;  2X9H A;  2LX7 A;  2QEX Q;  5KE2 A;  1K1Z A;  3NGP A;  5LJ5 j;  1VQ7 A;  1PCX A;  3NTH A;  4R55 A;  3C95 A;  2YSQ A;  3L2Z A;  1AD5 A;  1LVK A;  8ATC B;  3M0Q A;  3CCM A;  1BU1 A;  3LX7 A;  1YJ9 Q;  2A36 A;  3I56 A;  1RAE B;  1LJO A;  2ZGW A;  3CBP A;  2H8H A;  4OF1 A;  3CCL A;  1WXU A;  3ZEH A;  4IIM A;  2DIG A;  3EGD B;  3E2U A;  4KGV B;  1FXX A;  1MUZ A;  2P0K A;  5FU7 C;  2KRO A;  2KT8 A;  3NMZ C;  3OY9 A;  4BDZ A;  1TOV A;  4E47 A;  1NEB A;  1LNX A;  2KYM A;  1VQO Q;  2AIR B;  4M7D D;  3QZ9 B;  2YRD A;  2DX1 A;  2PU9 B;  1NPR A;  3DB4 A;  4M7D C;  1UGQ B;  3S3N A;  3RMS A;  2DER A;  1IHV A;  2W10 A;  3CCE T;  2K3Y A;  4F16 A;  2HCK A;  4N4H A;  2JN0 A;  2LC4 A;  1YIJ T;  5GAN g;  3OMC A;  1CKB A;  1D09 B;  3HRT A;  1M9S A;  1JRI A;  1K0X A;  3RES A;  2DXU A;  1GRI A;  3I35 A;  3JSC A;  1OZ2 A;  2LCC A;  2CRE A;  3A8H B;  1N6A A;  2LJ1 A;  7AT1 B;  2HQX A;  2EVR A;  4PNO A;  4OMQ A;  2QQ9 A;  4RTV A;  3L2Q A;  5IHK A;  1TH7 A;  4LD9 K;  3JB9 I;  3SWN B;  1NYG A;  3C4S A;  2P0Q A;  1D0X A;  1X2K A;  2VV5 A;  2QEX T;  2GFU A;  1OUL A;  3VUZ A;  2MYS A;  4QW2 A;  2O4X A;  3G4S Q;  1QCF A;  3VJP A;  2EBP A;  1S1N A;  1VQ9 T;  2I0N A;  3CC2 A;  1I81 A;  2KK4 A;  1JU5 C;  3MJX A;  3N5B B;  1WJR A;  2C0T A;  1VQP T;  2O31 A;  2PZ1 A;  3G1J A;  2HSP A;  1ZBX A;  4L59 A;  4HVU A;  3OYC A;  1KD1 R;  1FX7 A;  1RLP C;  1MV0 B;  1K9M R;  2FZK B;  4JLG A;  3QDF A;  3TU4 K;  5KCH A;  3GLX A;  4AT1 B;  5CKH A;  2LQN A;  4AG2 C;  4M77 E;  1VYT A;  2JUF A;  2AZS A;  4LUE A;  2D8J A;  1YFN A;  3JCM h;  3VS5 A;  3SHW A;  2J7I A;  2SRC A;  4MDX A;  4Y28 E;  2QA4 T;  1IXD A;  3M59 A;  2OAU A;  4C0G A;  2FYK A;  1OPK A;  3R6O A;  4Q5W A;  1CKA A;  2KY9 A;  3EH2 A;  1KFZ A;  1VQM T;  3PE0 A;  2EIF A;  2RHX A;  1I07 A;  3TQ7 P;  2KRM A;  4C92 A;  1VQ8 Q;  4RG8 A;  4PJN A;  4PJO A;  1KC8 U;  3OYM A;  3O8V A;  1WHL A;  2KYB A;  4GLK A;  3CD6 A;  1PSE A;  1OPL A;  2LJ3 A;  4LE9 A;  1GCQ C;  2XG8 D;  2ROL A;  1UJ0 A;  3QYH B;  2DL4 A;  3OBY A;  1YWP A;  1Q86 U;  3L2R A;  2HAX A;  2GNC A;  2EJF A;  3PFS A;  1UEB A;  2CZ6 B;  1K0S A;  3JB9 J;  1K73 U;  5HCK A;  2K5L A;  1TWB A;  2O9V A;  2RMO A;  3EG9 B;  1OOT A;  2BE9 B;  2V1Q A;  1OV3 A;  2D1X A;  4CRI A;  4RCB A;  4HKE A;  1H3Z A;  1UG1 A;  4CI0 C;  4BE0 A;  2FO0 A;  1BBZ A;  3E1S A;  3M57 A;  1ABQ A;  1YIT T;  3E9F A;  3G6E T;  1N9S A;  3M0T A;  2D6F A;  1N27 A;  1V76 A;  2CZ1 B;  2DL3 A;  2HBW A;  4M7D F;  1YJ9 A;  3DKM A;  5GAN e;  2AHJ B;  5LJ5 d;  5I2M A;  3D7S B;  1GXI E;  1WPY A;  1SRL A;  1S72 Q;  2RJE A;  3QBY A;  4GBQ A;  4V2S A;  4E7S A;  5FRO A;  1U06 A;  3X24 B;  2L8D A;  3CC4 T;  3LGL A;  2DZC A;  3OYA A;  1BI2 A;  4PFP A;  4KRT A;  2LRQ A;  1HK9 A;  2DVJ A;  1VQO A;  5LJ3 d;  1U1S A;  4CC4 B;  2LQ8 A;  1NLP C;  2L89 A;  2OAW A;  4RTY A;  4E7J A;  3ASK A;  1H64 1;  1QWF A;  1M1K U;  2RQT A;  4FYV B;  2D0Q B;  3LH0 A;  2LT1 A;  2DD5 A;  2YUO A;  3EFR A;  1KHC A;  2QAS A;  2L5Q A;  3H41 A;  2CYZ B;  5J3B A;  3RUX A;  3KUF A;  4PKC C;  1WHJ A;  4WCI A;  2K6D A;  5HKC A;  5LJ5 e;  2CP3 A;  3JCM W;  1C0M A;  5CKB A;  4QVZ A;  4M75 B;  3PVQ A;  1OU9 A;  2LNV A;  2G3R A;  2QDY B;  2VC8 A;  2JVV A;  1JJ2 S;  2ATC B;  2HMA A;  4FU6 A;  5A0D A;  1RAF B;  1XOV A;  1K9M C;  4ME7 A;  1G5V A;  2J6O A;  4M78 B;  4M7A E;  3OSS C;  1NE8 A;  2HQE A;  1C6V X;  2K4Y A;  3CMA T;  5LJ3 e;  2M1H A;  3A8O B;  2A37 A;  3I55 Q;  1VQN T;  1MMN A;  2YWW A;  3S3M A;  1N8R U;  4J9F A;  4D8D A;  3NTI A;  3G4S A;  2W0Z A;  1IGU A;  1YCS B;  1M8M A;  2EAY A;  2EW3 A;  2FEI A;  1VYU A;  4Z89 A;  3UWN A;  1VQ7 Q;  2BIV A;  3L2W A;  4F7U B;  3QJ6 A;  2EGA A;  2PQW A;  1M1F A;  1QCO A;  2DL8 A;  2D8H A;  3KBG A;  4DOW A;  5CR2 A;  5CO7 A;  4PLI A;  1TXQ A;  1LCK A;  1OU8 A;  1UHF A;  2EYZ A;  1VQK T;  3I56 Q;  1JB0 E;  2XD0 A;  4DBF A;  4LD6 A;  3CCQ Q;  2BZX A;  1NJI U;  4PFZ A;  2R5M A;  3GIB A;  1ZA2 B;  4OB0 B;  2PVD B;  5GMK j;  3EG2 A;  2A28 A;  4BI8 B;  6AT1 B;  3H0F A;  2CSI A;  1RAC B;  4JDS A;  4DBR A;  1W2B P;  2YHT A;  2EQM A;  2ENM A;  3VRY A;  1MV3 A;  2EYW A;  4FIB A;  1U3O A;  3SWN A;  1W2B S;  3HFN A;  3A1P A;  3QPH A;  1Q95 G;  2O4X B;  5EG2 A;  3Q1J A;  4JJD A;  2O88 A;  1OZ3 A;  1WQW A;  2GTO A;  3EFS A;  1WQ7 A;  3ZL7 C;  4HT8 A;  2JMA A;  2MMP A;  1VQ8 A;  1IZ6 A;  2ABL A;  4J9C A;  2OTL Q;  1IO6 A;  5AYF A;  2GTJ A;  5AT1 B;  1KQS P;  4TVR A;  1GBR A;  1AWJ A;  5L23 A;  1I0C A;  2E1H A;  3EFO B;  4C92 G;  5LJ5 h;  4DQ2 A;  4PJO G;  2ECZ A;  1RAA B;  4HVW A;  5DM7 R;  4ESR A;  3OMG A;  3RIR A;  2JM8 A;  1KIK A;  4PJL A;  3CCS Q;  3EHR A;  1V1C A;  1WJS A;  4IUQ A;  3I55 T;  2EGE A;  3JCM g;  1UHC A;  1BK2 A;  1QW1 A;  1RL2 A;  2JW4 A;  4XTX A;  4LDU A;  2JNG A;  2HL3 A;  1YI2 T;  1X27 A;  2E5Q A;  5EC7 A;  4XTU A;  1QLY A;  5LJ3 h;  1NPP A;  2PUO B;  2VAS A;  3JCM P;  2BUD A;  3CPW A;  2EPD A;  4CC2 A;  5GAO m;  3GNF B;  1VQ7 T;  3URG A;  3M4Y A;  3SB2 A;  3IQL A;  4C92 B;  2IIM A;  3CCM T;  1KQS A;  4MMK A;  3OYE A;  1GFD A;  2DD4 A;  2PVG B;  3I56 T;  1TU0 B;  3CXC S;  3CCV Q;  2M16 A;  4C8Q A;  3UA6 A;  3CCL T;  5FWC A;  1S72 A;  1UJY A;  2YDL A;  1NG2 A;  5IXF A;  2CZ0 B;  3L2V A;  5GAM f;  5KE3 A;  3LWH A;  3PIP A;  1KK7 A;  1Q81 C;  1KG1 A;  3CME Q;  1M90 U;  3OA6 A;  1JXO A;  5A2Q E;  4BAC A;  1QVF P;  4C92 D;  4PJO D;  4C92 C;  4PJO C;  4B9W A;  1PKT A;  1QVF S;  1B34 B;  2RI2 A;  3J80 E;  5C0M A;  2JS0 A;  1U8R A;  1G3W A;  3QWX X;  4ZTJ A;  4EMH A;  2PUK B;  1AT1 B;  2DYI A;  3A8M B;  3VU3 C;  1PHT A;  2FL7 A;  3QZ5 B;  3RBB B;  4FSX A;  3A8L B;  4HCB A;  1ACM B;  1U1T A;  4C5H A;  4O6J A;  4IUV A;  4Z8A A;  2DBK A;  2DK3 A;  3CCJ A;  3CCU Q;  1G8X A;  2XID A;  2AZV A;  3FB9 A;  4ZNX A;  4KT0 E;  2DXC A;  4RTZ A;  2HSE B;  2BZ8 A;  5ECA A;  2P0P A;  4QVC A;  5FW9 A;  2P4T A;  3J81 E;  3CCR Q;  1WXB A;  4UC4 A;  3MEW A;  2P84 A;  3L42 A;  2LX9 A;  1F1B B;  4Z88 A;  3FJP A;  4MML A;  4M77 B;  1LPL A;  1AWW A;  2CP0 A;  4IKF A;  1KQ2 A;  4J6X A;  3VS0 A;  2EQK A;  1AHJ B;  1OYX A;  4QQD A;  5CK9 A;  2M02 A;  4AFS C;  1SEM A;  4QVD A;  3CC2 T;  1AOJ A;  2XIC A;  1IB8 A;  1Y7X A;  2DJQ A;  5GMK m;  1MMG A;  2LT4 A;  4II1 A;  1ZSZ B;  3BFM A;  3UA7 A;  1M27 C;  3LYI A;  4FYX B;  2F1L A;  1K8A U;  2K2V A;  2DBM A;  3CCQ A;  3VS4 A;  4M75 A;  2HBP A;  4BD3 A;  4O5V A;  2NUT B;  2YUQ A;  2CT4 A;  1DJ7 B;  2DF6 A;  2DET A;  5LJ3 j;  1M30 A;  2RHZ A;  2DLP A;  4C0D B;  2CUD A;  4ORZ A;  1Q7Y U;  4J6Y A;  4M78 A;  1B07 A;  3JCM e;  4OMN A;  4A54 A;  4PFO A;  2RK1 A;  4BI4 A;  3PMT A;  3CC7 Q;  2HZY A;  4RCC A;  4OGE A;  3X25 B;  1AVZ C;  2RB6 A;  1UFF A;  5IT9 E;  2OTL A;  2Y90 A;  1LOJ A;  5CCA A;  3V7S A;  1D1A A;  4F7U A;  2YLC A;  3RKX A;  4A4E A;  3CD6 T;  2LQK A;  1Q82 R;  4PJO E;  2HEQ A;  1X6G A;  1BI3 A;  1QVP A;  4RG2 A;  1UGS B;  5IHI A;  5DLO A;  3VS3 A;  1VQ6 Q;  2DXB A;  3GNG A;  4MZP A;  5LL6 S;  2L2P A;  2RJF A;  3V7C A;  4AFQ C;  3QG1 A;  3ZFJ A;  1J3T A;  2LVM A;  3M58 A;  4VUB A;  3VRZ A;  3CCS A;  2EKH A;  4J9B A;  5GAN 4;  2EFI A;  1X6O A;  2ED0 A;  4HA8 A;  4ELY C;  3M0R A;  3TEE A;  4JRK A;  4Z02 A;  2XDB A;  1R77 A;  3AHU A;  3ER0 A;  1FYN A;  5GMK e;  2CH4 A;  2RQW A;  2DJZ A;  4JZ3 A;  3V7R A;  1GCP A;  3BE3 A;  2XHC A;  3OYN A;  3H6Z A;  5FU6 B;  3MKD A;  2KXC A;  1UGR B;  4BI3 A;  3HRU A;  1I5O B;  2DL7 A;  2ZPI B;  4C92 F;  4PJO F;  1FMV A;  2HNI A;  2MIO A;  1YJ9 T;  1P92 A;  1YJW Q;  2E4H A;  2X35 A;  2E3I A;  2DZ9 A;  5LJ5 g;  1BCO A;  3CCV A;  5L8R E;  1CSK A;  2QAZ A;  2EYQ A;  1HXD A;  3GPL A;  3EFO A;  3O5Z A;  1UE9 A;  2L0A A;  4IUR A;  3GOX A;  2EWN A;  2LTO A;  4XTW A;  2AT1 B;  2E12 A;  5GAN 3;  4C8Q G;  4RUG A;  3RER A;  3SWN C;  4OP0 A;  2NUP B;  2JJ9 A;  1EFN A;  3CME A;  1YJN Q;  4C0F A;  2DXT A;  2DRK A;  5LJ3 g;  1VQO T;  1FMK A;  1UGP B;  4M7A B;  4KH0 B;  2CP5 A;  1N5Z A;  3C94 A;  5D6Y A;  3PNW C;  5HK0 A;  3FRN A;  1ZX6 A;  2YUP A;  3MP6 A;  3PIO A;  3JRZ A;  1EX4 A;  1X75 C;  1ZLM A;  5CKF A;  4BUG A;  4LDW A;  2YXY A;  2DEQ A;  3FJ5 A;  2RA2 A;  2GQV A;  3DB3 A;  1H92 A;  1PM3 A;  2VXF A;  4J8O A;  1IHW A;  4E7K A;  4C8Q B;  5HY6 A;  3JCM X;  1JXM A;  4E7H A;  3CCU A;  1N9R A;  2DTI A;  1VQ5 Q;  1G83 A;  1QCN A;  4M7D E;  2RK2 A;  1VQ4 Q;  3DLM A;  3OW2 P;  2M0Y A;  1WIE A;  1WNL A;  3A5Z B;  3OS1 A;  2DA9 A;  2KMT A;  3RNJ A;  3CCR A;  2YLB A;  4HT9 A;  3T9N A;  4F14 A;  4EMK B;  3BY7 A;  2QQR A;  3MEU A;  2MWO A;  2RNA A;  3G71 Q;  2OTJ Q;  1G3Y A;  1QVG A;  2L3Q A;  2EQJ A;  5KYY B;  3P8B B;  4XK8 E;  4CC7 A;  2JOY A;  2L3P A;  5GMK h;  3G4S T;  1YCY A;  2HD0 A;  4IUU A;  4C8Q D;  1XQH A;  4C8Q C;  5KYW A;  1B34 A;  3VV0 A;  5GAN f;  3I5S A;  1RLQ C;  3EHQ A;  3QDR B;  1ZUY A;  3M0U A;  3L2U A;  4FL6 A;  1Q82 C;  3OW2 A;  4OVA A;  4EPC A;  1U5S A;  2K79 A;  2CZ7 B;  4A63 B;  3EGU A;  2F5T X;  1Q81 U;  3KFV A;  4M75 G;  1D0Y A;  1R8O B;  2HL5 C;  4HCK A;  2R58 A;  2OX7 A;  4KUD K;  1VIF A;  3OYJ A;  1NLO C;  3CC7 A;  5KYN A;  1M1G A;  4LN2 A;  4M78 G;  4Y91 A;  4E7I A;  4M77 A;  4JJB A;  2E3H A;  3H0H A;  1YHQ Q;  5KH6 A;  3MPU B;  2GBQ A;  1VQ8 T;  1V29 B;  4GLM A;  3M0S A;  2C0I A;  5CKD A;  1TTH B;  3V8J A;  5CAI A;  4LUD A;  2QI2 A;  4DBH A;  4JRI A;  1VQ6 A;  3OYL A;  3QHS A;  3HP9 A;  1ZSZ A;  4ELZ C;  4E7Z A;  4ZN1 A;  1T0J A;  1KD1 C;  4F7U G;  3CCJ Q;  1M2O A;  3LW5 E;  4OMM A;  1O75 A;  4J6W A;  2PVO B;  4QKU A;  2NUT A;  3EAE A;  1PD1 A;  3AT1 B;  1JEG A;  1C1A A;  2QK0 A;  2CSQ A;  2XKO C;  2RM4 A;  2A0F B;  2R57 A;  4IIO A;  2DYB A;  4JLI A;  4JS5 A;  3JV3 A;  2L3S A;  5IAY A;  3JCM J;  2X3X D;  1FMW A;  2NYS A;  4A4K A;  3WXM B;  1SKU B;  4M75 D;  2RHI A;  4M75 C;  3MEV A;  3G7Z A;  4FCY A;  1YJW A;  1QP2 A;  2VGM A;  3V8K A;  5I21 A;  1SF9 A;  3CBM A;  3ME9 A;  3P8D A;  3OS2 A;  3FLG A;  4LNP A;  2V1R A;  4M78 D;  1K76 A;  2KEA A;  1K4U S;  1M1K R;  4M78 C;  1S72 T;  2K57 A;  1YN8 A;  3PMI A;  1NBE B;  3PTA A;  5KYX A;  3M5A A;  3QII A;  2NUZ A;  1YJN A;  3RKY A;  1ZBJ A;  1QMC A;  1VQL Q;  3SEM A;  4E7L A;  4RTT A;  3RMQ A;  2CT3 A;  1MGQ A;  3UPU A;  5GAO r;  3MP8 A;  4OMF B;  4FW1 A;  3MP1 A;  1WZO A;  2DKG A;  3HL8 A;  3OS0 A;  3CPW P;  1UUE A;  2DRM A;  3QYG B;  1AWX A;  4DA4 A;  2CDT A;  4DEX A;  3CPW S;  1TUD A;  3U23 A;  5DLQ E;  1MNE A;  1IRE B;  4C8Q F;  1GL5 A;  3OSV A;  1BB9 A;  2J6K A;  1PG5 B;  3CCJ T;  1N8R R;  5HK3 A;  1VQ5 A;  3H0I A;  2RHY A;  1KQS S;  1JBM A;  1VQ4 A;  4D6W A;  3EGX B;  3BDL A;  2COY A;  3OYY A;  4BE1 A;  3HKS A;  1YWO A;  1BIB A;  1OX9 A;  2WSE E;  5GAN 8;  1WHK A;  2ZPG B;  1ZA1 B;  1RAI B;  3G71 A;  2OTJ A;  2NUP A;  3PGG A;  3L1A A;  1WX6 A;  3FIF A;  1D1C A;  2VKN A;  4N4G A;  5I11 A;  4NL3 A;  1MND A;  4M7A A;  4HCC A;  1IGQ A;  5GAN 6;  4NS5 A;  1W70 A;  3S3O A;  1NJI R;  2O01 E;  2EKO A;  3MO8 A;  2K2M A;  1QWE A;  4LXC A;  2EQI A;  4LDV A;  2KRS A;  4K11 A;  2E6Z A;  2HDA A;  1X43 A;  2VXE A;  5GAM d;  2WSC E;  3REB B;  2H3J A;  1X69 A;  1XNI A;  2VWF A;  4J9I A;  3BW1 A;  3CCQ T;  4PJM A;  3RDV A;  2R5A A;  2K3X A;  2FHD A;  1JQQ A;  1NM7 A;  2B86 A;  4E6R A;  1VUB A;  4M75 E;  1QQJ A;  2LZ6 B;  2ESW A;  1R0B G;  2FPF A;  2E65 A;  3S6W A;  4N0A A;  2KT1 A;  4EMK A;  1I8F A;  3TSZ A;  3X26 B;  2E64 A;  2KGT A;  1A0N B;  2JTM A;  1SSF A;  5KYY A;  1YHQ A;  4XU1 A;  5KYW B;  2DL5 A;  4QQ6 A;  1W6X A;  2B8A A;  2XK0 A;  2RHU A;  2OTL T;  4FSS A;  1WI7 A;  2XI9 A;  2MF2 A;  2LMJ A;  1WHM A;  2CP2 A;  4M77 G;  1I4K 1;  4XQ3 A;  1WLP B;  4R0K A;  4KBM B;  1Y57 A;  2E70 A;  2QQB A;  1Y07 A;  2JS2 A;  4D8K A;  2DAQ A;  2BKD N;  2FRY A;  5FWB A;  4EDU A;  4M75 F;  2MCN A;  1M1K C;  4OB3 B;  5IH2 A;  8AT1 B;  2RO0 A;  2ROT A;  2EYX A;  4OML A;  2JTE A;  1OI1 A;  3CCS T;  1X6B A;  1H3H A;  1G3T A;  5GAN 7;  2HKQ B;  2YUN A;  2EYY A;  4M78 F;  5KYU B;  3CCE Q;  3OYK A;  2CS7 A;  2A3L A;  3OYH A;  3OQ5 A;  1YIJ Q;  3UAT A;  2IPO B;  4R56 A;  2LCS A;  5GJV B;  2MK5 A;  3CBO A;  3CPF A;  2RJC A;  2GCX A;  4KH1 B;  3M0P A;  5KCO A;  2EQU A;  1Y96 A;  3X28 B;  3PT9 A;  4M4Z A;  1OEB A;  1W1F A;  1PD0 A;  5C6S A;  4F7U F;  3QXE B;  1M90 R;  1WDX A;  2V26 A;  4LDY A;  1TS9 A;  3I9Q A;  1UEC A;  3CCV T;  3GP8 A;  1EIF A;  3MEA A;  4RTW A;  1TUG B;  1E6G A;  5FU7 B;  4QQG A;  1N8R C;  1HYO A;  4KUI A;  2DVE A;  1VYV A;  1NYF A;  4M77 D;  2QGF B;  1HJD A;  3JCM f;  2XDD A;  4M77 C;  3CME T;  1SHG A;  1VQ9 Q;  4M7D B;  2OJ2 A;  1VQL A;  4F17 A;  4Y92 A;  1ARK A;  5GAO l;  4XU0 A;  2I2L A;  1VQP Q;  2DIQ A;  5FRN A;  2X4J A;  2LP5 A;  4C5G A;  4HCZ A;  1OX8 A;  4KUL A;  1NJI C;  1YBY A;  2KQW A;  1M3A A;  1ZSZ C;  3HRS A;  3SD4 A;  3JB9 G;  1O9S A;  3E19 A;  2V8J A;  1BYM A;  1RUW A;  2K3B A;  5GAM h;  1WYX A;  3CCU T;  4C92 E;  1KD1 U;  5KYX B;  4C0D C;  2QA4 Q;  4YTL A;  1K9M U;  2BE7 D;  1UGV A;  2Y4X A;  3CCR T;  5CVI A;  1VQM Q;  1X2Q A;  2DPP B;  1ZHI A;  2A08 A;  1MMA A;  2E41 A;  1B7T A;  5CIU A;  2RQR A;  4DOV A;  2ZPH B;  1M8V A;  3BDU A;  1K8A R;  2MOX A;  5CQY A;  3LH5 A;  3OB9 A;  2WSF E;  1TSF A;  1SRM A;  4PK4 A;  4M7A G;  2GF7 A;  4PL6 A;  3NTK A;  3OYF A;  1Q7Y R;  2MI6 A;  4JJC A;  3HHT B;  2ED1 A;  3JCM V;  2Z0W A;  1XTD A;  1BIA A;  2DMO A;  2JT4 A;  4B9X A;  2QQA A;  1NEG A;  3RKW A;  1RAB B;  1YP5 A;  5J26 A;  1RAH B;  2GGR A;  1YIT Q;  3JB9 D;  4C0Z A;  2QQS A;  4FT2 A;  3G6E Q;  3EGX A;  1KQ1 A;  2P4R A;  3NHN A;  5GAO n;  1D0Z A;  4N4I A;  1KSW A;  2J06 A;  5FU6 C;  1I1J A;  1I5L A;  2X3W D;  2YRC A;  2ZPB B;  2EJG A;  2IVW A;  3CC7 T;  2X51 A;  1QVG P;  3QKJ A;  2CGH A;  5GMK l;  3QSU A;  3M56 A;  3TCJ A;  2L3R A;  5IHN A;  4ZTF A;  1W4S A;  1MHN A;  1QVG S;  4PLL A;  3CC4 Q;  2F5K A;  3CEY A;  1NZ9 A;  9ATC B;  2AKL A;  1WGS A;  3FEO A;  1M90 C;  1BI1 A;  2O9S A;  1VQ6 T;  5GMK i;  5FRM A;  4X34 A;  3JAM E;  3OYG A;  1UTI A;  2FG0 A;  2KI7 A;  4E2F B;  3LWI A;  4XTY A;  3I5R A;  4XU3 A;  4M7A D;  4WTO B;  2K5F A;  2WAC A;  2DTO A;  5D6X A;  4M7A C;  3CCE A;  1TG0 A;  2DEU A;  4IUP A;  3MHX A;  4BE2 A;  1Z9Z A;  3JCM b;  4LDX A;  2YRV A;  2VGN A;  3OW2 S;  1YIJ A;  4MDW A;  4BY6 B;  5GAN d;  4L6V 5;  1M3C A;  2VB6 A;  3M4G A;  1XJW B;  4ZN3 A;  1SPK A;  5CKE A;  2LJ0 A;  4M77 F;  2XDP A;  3EH1 A;  1VIE A;  2CKK A;  5GAM j;  2O2O A;  1B3Q A;  1KJW A;  1M2V B;  1YJW T;  3HFO A;  3DLL A;  2F2X A;  2ZZD A;  3R6N A;  2CP6 A;  2BTT A;  2M0O A;  3QWY A;  3VS6 A;  4ZGD B;  1SG5 A;  3CMA Q;  3FDR A;  3REA B;  2QGG A;  3SDZ A;  4N0A C;  4OB1 B;  4B6M A;  4EMK C;  2QEX A;  1VQN Q;  5D7U A;  3LLR A;  1YNZ A;  1SHF A;  2LNH B;  2JZ2 A;  5IXB A;  3WVD B;  4BY6 C;  2JMC A;  2NLU A;  1RAG B;  1R0C B;  4J7I A; 
#chains in the Genus database with same CATH homology
 2E4H A;  2HQH A;  3RDV A;  2E3I A;  1LPL A;  2CP6 A;  2CP0 A;  1WHL A;  2HL5 C;  2QK0 A;  2Z0W A;  2CP5 A;  2COY A;  1WHJ A;  2M02 A;  1IXD A;  1WHK A;  2CP3 A;  1WHH A;  3E2U A;  2COW A;  2HKQ B;  1WHM A;  2MPX C;  2CP2 A;  4B6M A;  2COZ A;  2HL3 A;  1TXQ A;  2CP7 A;  2E3H A;  3TQ7 P;  2HKN A;  1WHG A;  1TOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...