2CP6A

Solution structure of the 2nd cap-gly domain in human clip-170/restin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
172
structure length
172
Chain Sequence
GSSGSSGATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restin
publication title Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp6A01
2HL5C 2Z0WA 2E3HA 3E2UA 2CP6A 1WHGA 2HKNA 2HKQB 1WHJA 2CP2A 1IXDA 2HL3A 2CP0A 2QK0A 3RDVA 1TXQA 3TQ7P 2M02A 2MPXC 1WHMA 2CP7A 1WHKA 2COYA 1WHHA 2CP5A 2COWA 1TOVA 1WHLA 2COZA 4B6MA 2E4HA 2HQHA 2CP3A 2E3IA 1LPLA
chains in the Genus database with same CATH superfamily
2DNUA 2EGAA 4A4GA 2RQRA 3KUFA 3M0PA 2EYQA 4DEXA 3LGLA 3CCJA 5A0LA 1DJ7B 2PUKB 5CO7A 3L2WA 4FT4A 1B34A 4JS5A 3JB9H 2BE7D 4XTVA 1VQ7Q 1YHQA 1UG1A 1UHFA 3CCEA 3CPFA 4OMOA 4PFPA 4M7AF 1WA7A 4M7DE 3OYMA 2D9TA 1I8FA 1Z9ZA 3M57A 3RDVA 2XMFA 3PT9A 3C4SA 2F2XA 3CCQQ 4PJMA 3CPWP 3TCJA 3NFCA 5GMKh 3CC4Q 2XIDA 4O6JA 1UGSB 4O5VA 4JS4A 1X2QA 5I2MA 4M75A 3QIIA 1R0BG 4JRQA 2DXUA 1K8AR 2YUQA 2A37A 2LC4A 2P84A 4E7IA 3V8JA 5KE3A 3VYHB 1OZ2A 1PNJA 3MEWA 2PNIA 3CCMT 3VS3A 3OYLA 1VQKA 4D8KA 4RG8A 3ZFJA 1OEBA 2J6OA 3ULRB 1TG0A 3TQ7P 4ZN3A 5D7UA 3M56A 4Z88A 2PVDB 4FL6A 1OU8A 4GBQA 3BDLA 3PVLA 3PFSA 3M0TA 4JRIA 3L2UA 1BKBA 2F2VA 3PTAA 2QQBA 4IKFA 4Y91A 4FYYB 2V8IA 3KFVA 2KGTA 4L59A 3LW5E 3CC2T 2LCSA 4L5GA 5I21A 1D0YA 2LT1A 2YRDA 4KUDK 2VUBA 4ZTFA 3SD4A 3LH5A 5CR2A 1TUCA 3DLMA 3G4SA 3VS7A 1W2BS 4MDWA 1VQLT 3E19A 4HCBA 1ZSZA 2SRCA 4M78F 1D3BA 1WJQA 2DMOA 2RHXA 5I2SA 3RKWA 2QQSA 1ABOA 3EG3A 1BI2A 5DY9A 1YWOA 2L2PA 1PD1A 2EQJA 1JXOA 4R0KA 4LXCA 2G6FX 2RK2A 2BZXA 5KYWB 3I5RA 2FRWA 2EYYA 4E7SA 2EJ9A 1KK7A 1R8OB 1NG2A 3O8VA 3FRNA 2KEAA 3I5SA 3JCMQ 3RERA 2XD0A 1M2VA 2M0OA 3I35A 3FIFA 1QVFS 1M4ZA 2WACA 4HCKA 1OULA 1Q7YR 4F7UE 2G3RA 2JT4A 3A8OB 2PUOB 4CC2A 2E5KA 2LNHB 2RJFA 2RK1A 3EH2A 1VIFA 1ZUUA 1QVGS 3JCMc 1Q82U 1ZA2B 1HJDA 4CC7A 1E6GA 2FPEA 2C06A 3EG9A 4E7ZA 1VQMQ 5LJ3h 2K5FA 2M02A 1N8RR 1SG5A 1IGUA 1ZA1B 1KQ2A 5GAMg 4FU6A 2L3RA 2GF7A 3HL8A 5GAN5 2F5TX 4C0DC 2AHJB 4C5EA 1IO6A 5IHIA 4LDYA 3MHXA 2EKHA 1JRIA 2MWOA 3V7CA 4XU1A 5GAN6 1VYUA 4M75C 2XG8D 2DEQA 2R5AA 4WTOB 4A53A 1D1CA 4CRIA 3LGFA 3LH0A 4JUVA 2CS7A 3META 3SHWA 4XQ3A 3OYGA 1NEBA 5GMKe 1YJNA 4DEYA 4M75D 2QG9B 1M27C 4OGCA 4YTLA 4JJNK 5L23A 5IH2A 3CC2Q 1D09B 4WF2A 4J6YA 1JJ2A 2LMJA 1G3YA 3I55T 3OA6A 2C0TA 5GAOp 5DLQE 1Y07A 3RKXA 1N8RC 1YCSB 2EFIA 3CPWS 4C8QC 1Q81R 1OOTA 4OB0B 5GAMj 1AT1B 1VQLQ 3CXCA 1QCOA 1U3OA 1TXQA 4X9DA 1G8XA 1ZQ1A 1RUWA 1ZUKA 3OMGA 4NL2A 1VOMA 1AEYA 1TS9A 1AWWA 5CKFA 3M59A 2QDLA 2JNGA 3CMAT 3EFOB 4PFOA 4EDUA 1GCQA 4J8OA 4J7IA 4KH0B 3X28B 4OGEA 1IHWA 1AHJB 2P0QA 2O9SA 3L1AA 1JQQA 2DRKA 3A8HB 3G6ET 1U1TA 1BBZA 1ZSZC 1MNDA 2KAFA 4Y28E 2RQUA 1RLPC 2YUNA 1WHGA 3H0IA 4WCIA 5C6SA 4FT2A 2QK0A 3CCJT 1WDXA 1KQSS 2K3BA 3C94A 3CCSA 1KC8R 3OB9A 4C0DB 5ECAA 2DXBA 2VXFA 2F69A 1TUDA 2CT4A 4X1VA 1BCMA 4B6MA 2EYZA 3CCET 3QHSA 2KRSA 1MMNA 2I2LA 3P8DA 3QWYA 4M75B 1RAAB 4M7DC 3N5BB 2L5QA 3GPLA 3JCMP 2XDPA 1VQ8Q 4ZN1A 5CQYA 4BE2A 2X4XA 4C5HA 3EGUA 1HD3A 1NBEB 5GAN8 2XI9A 2RA2A 4AFSC 1K73R 4C5GA 2GTJA 4PJOE 4HVWA 1AWXA 1M5Q1 3EHQA 1ZUYA 2LTOA 1OX9A 1MMGA 2XU8A 4HA8A 3ASKA 4BI4A 4OP0A 5IHKA 1BI0A 3CC7A 2DXTA 1PSEA 1P92A 5KYUB 1WHKA 4JJDA 3EFRA 1UECA 4ZNXA 2R5MA 3M0RA 2O31A 4BY6C 4C8QB 2PTKA 5CQXA 2DL4A 3HRSA 1T0JA 2K3YA 1VQ4A 3EAEA 5LJ3e 1VQKT 4XTYA 2QDYB 3CCUQ 2YHTA 5A2QE 2VVKA 4KGXB 3QUIA 8AT1B 5GAOq 1UGQB 2O88A 2LJ0A 4PK4A 1Y57A 2DTOA 1WHLA 1X2KA 4BUGA 2PZ1A 1WPYA 2ZGWA 1EZZB 4ORZA 2ZCFB 3CMAQ 2CP2A 1I81A 4PJOG 1N5ZA 1G2BA 1TTHB 2BZ8A 4LN2A 1K73C 2LJ3A 4QQGA 4J9FA 1ZSZB 4FW2A 4FW1A 2VC8A 1FX7A 1D3BB 2JW4A 4RTVA 2IVWA 3G6EQ 4JRKA 3H6ZA 1GXIE 1W1FA 1SKUB 2ROTA 3G4ST 1Q95G 2QEXT 2GFUA 1VA7A 3ME9A 1HSQA 1VQ5Q 2CT3A 3FEOA 1G3WA 2K6DA 2A3LA 3OYAA 3CCJQ 3LWIA 1WX6A 3EGXB 5IAYA 1W2BP 2H3EB 3MKDA 1X75C 1VQ9A 1M2VB 4ZTJA 2GTOA 2VKNA 2IPOB 4RTZA 3EG0A 3OW2A 2HQHA 3CCEQ 4M7DB 1G3TA 2ZPEB 3NTHA 2CREA 4CC3A 4ZGDB 2HL3A 4JLIA 4PNOA 2GNCA 3UATA 4RMOA 3EG9B 1UGRB 2J7IA 1OX8A 5IT9E 2GFAA 2O9VA 2EQKA 3REBB 2YDLA 2M0YA 1UHCA 4E2FB 5A0GA 1QVFP 2VWFA 4XTZA 3VS6A 2RJCA 3D7SB 1WGSA 1EIFA 1JXMA 2HBWA 3QSUA 2OI3A 3OYYA 3OS0A 4RG2A 4LUEA 4BY6B 1CKAA 1NE8A 4PJOA 2AT1B 1QVGP 5GAMh 4F16A 3L2QA 3FJ5A 1SPKA 3VS4A 3WVDB 2JZ2A 3LLRA 3GNGA 4RTXA 2E3IA 2R58A 3RNJA 3FB9A 1VQKQ 1UGVA 5M9OA 1BYMA 5C0MA 5LJ5f 3OYDA 1VYTA 2DERA 1UEBA 4M78E 2RHUA 2P0PA 1I07A 4B9WA 1LCKA 1G5VA 3EGDA 3BFMA 2DM1A 3M9QA 2FO0A 2E5QA 3RR6A 1Y96B 3A1PA 4RCBA 1PRMC 3TVTA 3M53A 3OS1A 1M8MA 2K3XA 2KBTA 4C8QG 4B9XA 5GANf 2CDTA 5LJ5d 3CQTA 2COYA 2FZGB 2KROA 2E4HA 4EMHA 2BZYA 4QVCA 3R6NA 2OTLA 3G4SQ 4PLIA 2J05A 2FRYA 2QEXQ 1TH7A 2JTMA 3A8LB 2FG0A 5FLXE 2KDSA 2KI7A 4J9EA 3BW1A 2OTJT 2DE0X 3UPUA 2ABLA 4RTUA 4VUBA 2K57A 1RL2A 1WHHA 1JB0E 2K2VA 5GANd 4IIMA 1D1BA 3IQLA 3OYCA 2AKLA 1BU1A 1BI3A 2LNVA 3E2UA 4PLLA 3V7SA 2DYBA 4OVAA 1VQNA 4F7UB 2IG0A 3EG2A 1QVPA 2H8HA 3G71T 4FCYA 2CP7A 4BDZA 4PKCC 5GMKl 2OAUA 1H3ZA 2CP3A 1LPLA 3SFMA 2KNBB 1UJYA 3NTIA 4M75F 4EIKA 2VASA 1ARKA 1Q82R 3H9NA 2CP0A 3CCST 1YFNA 3LWHA 2DL5A 3INZA 3E9FA 3GF5A 5KYUA 3CCVA 2K7AA 4M7DG 2L3SA 3HKSA 4C8QA 1SEMA 2E10A 3GBQA 1KQSP 4ELZC 4XTXA 3MEUA 2EQMA 3F70A 4BB7A 1WJRA 2HMAA 3JB9J 1LVKA 2DKGA 2RI2A 1VQ6A 1OPKA 3PNWC 4MMLA 1U5SA 3RUXA 3CCLA 1IB8A 2C0OA 2VV5A 2L3QA 2DD5A 1RLQC 1UGPB 2X4WA 2ZPBB 3JCMh 3HRTA 2DF6A 1QKWA 4E7KA 1M3CA 3NTKA 2VGMA 5KYNA 3I56A 1BI1A 1YIJA 4PJOC 1O75A 2BIVA 3MP6A 1QWEA 4LUDA 3ZBDA 3CC7T 2M51A 2QI2A 1AZGB 3QZ9B 4KT0E 2GQVA 3BE3A 2PVOB 2XICA 1Q82C 4PJOD 2HSEB 1VQ7A 2X4YA 4LNPA 4C92E 3OSSC 3CMEA 1VYVA 4CC4B 5EG2A 1JBMA 5GAMe 3KXTA 3OBWA 4LD9K 1RAHB 2L0AA 1YN8A 3EGXA 4BE0A 2QA4A 1YBYA 1TWBA 2OTJQ 1VQOT 1M8VA 2ESWA 3CCQA 4Y92A 1KG1A 1RADB 3DKMA 1YJ9A 3CC4A 1GBRA 2VB6A 2KR3A 4M7DA 3M0UA 3HRUA 2HSPA 4M77E 2RH2A 3MCAB 5GAN2 2Z0WA 3V7RA 2Y90A 5CKBA 3ZEHA 3M0SA 4M4ZA 2W10A 1ABQA 2LDMA 3OYBA 3HP9A 1M1GA 4ZGJB 4QT7A 3JB9G 3G71Q 2DIGA 3HPWA 2K5LA 1YITA 2A28A 1TUGB 1Z9QA 3TREA 4AFUC 5GAN7 1GL5A 1XJWB 2MWPA 3CCMQ 2JJ9A 1UB4A 1WLPB 1M1FA 4V2SA 3UF4A 1IXDA 4C92G 5GMKi 4ELYC 4D6WA 3CCSQ 2D0QB 4HVUA 3VS2A 1GCPA 3EG1A 1X6OA 1NM7A 1VQ9T 4FYWB 2DYIA 3UDCA 4RCCA 4J9DA 3TSZA 3C12A 1X69A 2RHIA 1J3TA 3RBBB 2LX9A 1G3SA 4AG1C 4F7UG 3HFOA 1FYNA 2SEMA 4M77G 3VRZA 3PE0A 2F2WA 3GLXA 2ZPGB 2HQXA 2LCLA 2XKOC 4A54A 4OB3B 2FB7A 5D6YA 4PJOB 3FJPA 1KHCA 1WNLA 1M1KC 1QP3A 2MYSA 3OY9A 1Y96A 4DOVA 1BK2A 4RTWA 2KSSA 1PD0A 2CGHA 3V8LA 1H92A 2DA9A 1ZBXA 1GRIA 4TVRA 3CC7Q 3J7AF 2OJ2A 2HZYA 4LDVA 2LP5A 1KQ1A 2RB6A 1NEGA 5FU6C 1K4US 3UA6A 2HNIA 2CP5A 4K11A 2RI3A 5EC7A 2NUTB 4C8QD 3EGDB 1X01A 3EFSA 1I4K1 5GAOr 5GAN4 2E6NA 1I5OB 1QCFA 1QP2A 4XTUA 1M1KU 2MF2A 4MZPA 4OMPA 1NZ9A 2KVQG 2X9HA 4C92A 1AD5A 2MPXC 5KCHA 1VQOQ 1WHMA 2MIOA 3GP8A 2J6FA 1NPRA 2O4XA 2RI5A 1N9RA 4M78C 2DBKA 1M30A 2AZVA 3S3NA 3VYGA 4BI8B 3OYFA 1BIBA 2ENMA 1S72A 5FROA 3BDUA 2EKOA 2YUPA 1EFNA 3JCMe 4F7UA 1T0HA 1VQMA 1R0CB 2FPFA 2W0ZA 4M77A 1YI2A 2RHZA 4RTTA 2GGRA 4QKUA 2JUFA 4D8DA 2DZ9A 3SWNA 1XOVA 1YHQT 2LVMA 2YUOA 2EBPA 2OTLT 3QWXX 5KYXA 4Q5WA 1QKXA 4BE1A 2JVVA 1PM3A 2ZPFB 3JCMf 4JZ4A 2E65A 2K4YA 3QO3A 4QVZA 5J39A 4ANJA 2FZCB 2M1HA 5L8RE 1M3AA 1TU0B 1VQ9Q 2LRQA 4Z89A 2HEQA 1ZLMA 2KRMA 2PQWA 1OYXA 1SSFA 3ER0A 3CCRA 1UUEA 5KH6A 2YLCA 3QPHA 5GJWB 2L8DA 2JOYA 4M7DD 1BCOA 1VQNT 1NPPA 3MEVA 1XQHA 4QQDA 3RIRA 2RHYA 4C0GA 1IZ6A 1N9SA 2LX7A 3JCMd 2RF0A 5CIUA 4J5YA 3PMIA 3NPFA 1QMCA 3VU3C 3RMQA 2E41A 3OBYA 3L42A 2JTFA 3CBMA 4LDWA 2DEUA 3H41A 3I55Q 3QYGB 4NL3A 2E3HA 1B3QA 3NMZC 4PJLA 5FU6B 3MP8A 1C6VX 3HFNA 3CCVT 3H0HA 4HT8A 4AT1B 1W2BA 2CH4W 1X43A 4IIOA 4QW2A 8ATCB 2OX7A 3HSBA 2XDBA 2MMPA 3I9QA 2PU9B 3M54A 1VQ6T 1SF9A 5LJ3f 4OB2B 3OYHA 1FWZA 3A8GB 1KFZA 3CCLT 2DTHA 5FW9A 3GOXA 3PGGA 2EGCA 1QW1A 4M78B 5HCKA 2AZSA 1NJIC 4E47A 4M7AE 2C0IA 2O2OA 3I56T 2WSFE 1YJWA 1YIJT 5AYFA 2DAQA 2LZ6B 4J9HA 1RAEB 1KSWA 1WIEA 3QBYA 3SB2A 1FMKA 2QXFA 2WSCE 1QVGA 5LJ3d 2NLUA 2HCKA 3DB3A 4JJCA 1GFCA 2E6ZA 4RKUE 2E12A 3JCMW 2JXBA 4HKEA 4KH1B 4QQ6A 1VQ7T 1YWPA 2YRVA 1AZEA 1KD1C 1YHQQ 3CMET 4J9CA 3GNFB 1QLYA 3L2VA 1NJIU 2P4RA 5CK9A 5HY6A 2O01E 4C92C 3BY7A 2QA4T 3JB9D 4HT9A 5D6XA 2YSQA 4KGVB 3M55A 1U8RA 1VQ8A 1QQJA 2EQUA 3JSCA 2WSEE 3CC4T 1YJ9T 2DVJA 4MZMA 1WXBA 4JDSA 3L2RA 4C92D 3OYNA 4M7AG 2X3XD 1VQPA 2RO0A 2DL3A 3M0QA 4M77C 5HKCA 2VYTA 1K9MC 2L3PA 2ZAEA 2NWMA 4AMCA 1KD1U 3SWNC 1RI0A 4IUTA 1PRLC 2CZ6B 2LQWA 3VJPA 1YITT 3DB4A 3URGA 5HK0A 3Q1JA 2A0FB 2DBMA 1U06A 5KCOA 1X27A 2P0KA 2V1QA 4M77D 1D0ZA 1K1ZA 1GBQA 2JS0A 1IGQA 2LQ8A 3CBPA 1PC0A 4PL6A 2LJ1A 1E7OA 3CCUA 1Y7XA 1IRXA 1I5LA 3CCVQ 2EYWA 2HQEA 3CPWA 4XTWA 4PJOF 5GMKm 3X25B 1K9MU 1H641 2KQWA 2NUTA 5I22A 3WVEB 3V8KA 3VS5A 3FLGA 3T9NA 4PJNA 4DOWA 4KULA 1VQ6Q 3A5ZB 2P4TA 1EX4A 1N27A 4JLGA 1G83A 3CCLQ 1YJNT 3TEEA 3TU4K 2ECZA 3OSVA 4X34A 5IN1A 4L6V5 1JJ2S 3M4GA 1RAFB 2QAZA 1YNZA 3FDRA 1GFDA 1A0NB 1W6XA 2A7YA 1CKBA 3G6EA 1O9SA 5LJ5g 2FVUA 1XNIA 2DJZA 3VS0A 1PKSA 1OU9A 3FC3A 3CXCS 4DA4A 4JRPA 2XDDA 3QJ6A 4M7AA 1VQ5A 4DQ2A 4DBQA 4EMKA 2B8AA 2DJQA 1MV0B 2EAYA 2EWNA 2MI6A 3GIBA 2KY9A 3X20B 4J7FA 4A4HA 2RD1A 2DL8A 2MOXA 4E7HA 2JS2A 2D8HA 1U1SA 1KQSA 4C92B 5IXFA 3S3OA 2ED1A 4J9GA 1NLPC 2DK3A 2EW3A 2LQKA 3J80E 2COZA 4AFZC 2O4XB 2A36A 4CI0C 3CMEQ 1M90C 2KRNA 4M78G 1Q86C 5GANg 1X6BA 2YXYA 1T3LA 4GLKA 1MUZA 2QA4Q 2R57A 2K2MA 2AIRB 4XU0A 2MAMA 2Y4XA 4KGZB 1YJ9Q 3JAME 4BI3A 2F5KA 4QVDA 4M77B 1XTDA 4IURA 3UWNA 2CUDA 5FRMA 2CYZB 2YRCA 3RMSA 3OYJA 3SWNB 1K0SA 2YLBA 2D8JA 1S72T 5KYXB 2KT8A 3QDRB 4FSXA 2EJFA 1VQMT 3CD6A 2KXDA 1F1BB 2EGEA 4BD3A 4DBRA 1YI2T 4ATOA 2E70A 5LJ5j 1M90U 1UJ0A 4A4FA 1Q86U 1T3SA 3E1SA 4HCZA 5GAOl 2NYSA 3P8HA 1QWFA 4F04B 2M16A 1ZHIA 2LCCA 2JM9A 1YITQ 1V29B 3MP1A 1YP5A 1PKTA 2FHDA 5CKHA 5J3BA 5DLOA 2BE9B 2H3JA 2CP6A 1NYFA 2NUPB 3M4YA 5IXBA 1M3BA 2EIFA 4JPBW 5A0DA 1ZSGA 2CZ1B 2QASA 3JCMJ 3VKIA 4FYVB 4A4EA 4F17A 4BACA 1TSFA 1RACB 5GANj 3CCRT 4DBFA 1WFWA 4C8QF 1UFFA 5CCAA 2DX1A 2ATCB 4FIBA 5CKDA 2X4JA 1LOJA 3A98A 2GBQA 5FRNA 2J6KA 2ROLA 3LYIA 4M78A 4A4KA 2RQTA 1RI9A 1YJNQ 1AVZC 3QJYA 4LDXA 2V1RA 3S6WA 2KYMA 2RJDA 1KJWA 5CKEA 3EHRA 2VGNA 4C0ZA 4X9CA 3MPUB 1AWOA 1VQ4T 1K8AC 4EPCA 1W4SA 2QEXA 2JM8A 1OPLA 2DFUA 3P8BB 1OZ3A 4NOYA 1FMWA 1JU5C 3JCMV 2D0NA 4KRTA 3OYEA 2I0NA 2MCNA 2AK5A 4J83A 1RAGB 1ZX6A 5IHNA 2D6FA 4EMGA 3QYHB 5GAMf 4E7JA 1M1KR 4OMFB 1WQ7A 4LDUA 1K8AU 3SDZA 1WQWA 2HBPA 4Z02A 1YJWT 4M7AC 3UT1A 4C0FA 1Y0MA 4EMKC 3VRYA 4M7DF 2CUBA 2NUZA 1S72Q 1PSFA 2RQVA 2DPPB 4FSSA 4N4GA 2E1HA 3QZ5B 3E9GA 1X6GA 2YT6A 4A63B 3QG1A 4M7AD 1YI2Q 1C0MA 5GAMd 3OW2S 1V1CA 3MO8A 3AT1B 3H8ZA 4ZGEB 2RNAA 3G1JA 1AOJA 3RESA 3LX7A 1OI1A 4FYXB 2HDAA 4II1A 4KUIA 1MGQA 2V8KA 2A08A 5KYYA 4N0AA 2CH4A 2HKNA 2FPDA 4PJJA 1OQKA 1VQ8T 1K76A 1PCXA 3VV0A 4XU3A 4LD6A 3OYIA 1LNXA 1K9AA 2LQNA 2QQ9A 4OMNA 1ZBJA 3CCRQ 1H3HA 1VQPT 2FL7A 4XK8E 1VIEA 1CSKA 5DM7R 3JB9I 1YCYA 1K0XA 1OV3A 1B07A 1SHFA 1Q7YC 3PIOA 4N4HA 3G7ZA 1RAIB 4KBMB 3A8MB 2J06A 3VS1A 4OMLA 2RN8A 1JO8A 2CZ0B 4Z8AA 4XU2A 4J9BA 3VUZA 1MNEA 3PIPA 1D1AA 1VQ4Q 1PWTA 3PMTA 3CCUT 1SSHA 2EPDA 1RABB 4J9IA 2EJGA 3M58A 3DLLA 2OTJA 4RUGA 3JCMX 3H0FA 4HXJA 1WI7A 1Q7YU 4OB1B 5FU7C 2JN0A 5LL6S 3JB9F 3RKYA 2M9UA 2FEIA 3X26B 2RJEA 3M5AA 3QKJA 4M7AB 3X24B 5D6WA 1UE9A 4EMKB 5I11A 4C5IA 1N8RU 4M78D 2F1LA 4C92F 3J81E 4E7LA 5LJ5h 3G71A 1YJWQ 1B34B 2JTEA 4AFQC 1JJ2P 1R77A 2D1XA 2GQIA 1VQ5T 3OS2A 7AT1B 2QQAA 3CCMA 3QDFA 1I1JA 5J26A 3KBGA 3CXCP 2CZ7B 4F7UF 1ACMB 1QCNA 2DIQA 3QXEB 1AWJA 1IREB 4M77F 4ME7A 4R56A 2XK0A 2K9GA 2RPNA 1SHGA 4NS5A 1Q81C 3C0CA 4HVVA 3L2ZA 5GANh 1KHIA 2X51A 4UC4A 1NJIR 2CKKA 2EVRA 2HL5C 2NUPA 2DD4A 5AT1B 3S3MA 3JV3A 4MZTA 4PFZA 1WXTA 1LJOA 2QGFB 5GMKj 1MMAA 1Y71A 1N6AA 4ESRA 5FWBA 3CC2A 4E6RA 3JCMg 4RTYA 3EH1A 2B86A 3TSWA 1VQPQ 2HAXA 5GAN3 4IUUA 2V26A 6AT1B 3MJXA 3AHUA 5CVIA 1M2OA 3CD6T 2OAWA 2RMOA 1Q81U 2X35A 1HXDA 3OQ5A 4IUPA 1KD1R 1VQLA 2YWWA 2EQIA 2VXEA 1UTIA 2DO3A 1WZOA 4MMKA 3WXMB 4N0AC 2DRMA 4AG2C 3THKA 4LE9A 2JMAA 1KC8C 5HK3A 3CEYA 4JZ3A 4MDXA 2DVEA 2EYXA 4OF1A 4DBHA 2ZZDA 2V8JA 1MHNA 1H8KA 3VUBA 5FU7B 2E64A 3JRZA 1VQOA 2MK5A 1K9MR 4R55A 2FZKB 4JJBA 5KYWA 3R6OA 5FWCA 1QVFA 3CBOA 5KE2A 3OYKA 1PG5B 2FYKA 2ZPHB 2PVGB 1HYOA 2IIMA 5CAIA 1KC8U 1I0CA 1UDLA 2DILA 2QYZA 2RQWA 2Y4YA 5LJ3g 4J6WA 1WYXA 3HHTB 3OS5A 2DZCA 2COWA 2DTIA 1JEGA 3U23A 1SRMA 2DETA 2OTLQ 2DL7A 4GLMA 2AKKA 1W70A 1SRLA 1FMVA 1WHJA 2KE9A 2KYBA 3CCQT 1MV3A 4FM4B 1S1NA 4M75E 1D0XA 2QTXA 3MEAA 1GCQC 1K73U 4P5NA 3NHNA 1NLOC 5GAOn 2BTTA 3JCMb 1B7TA 2LT4A 3NGPA 3OMCA 2HKQB 1E6HA 1WJSA 1WXUA 2ZPIB 2GCXA 4IUQA 2BUDA 1VQNQ 2DXCA 1BIAA 2CSIA 3O5ZA 1NYGA 1V76A 2K5IA 4XAXB 1BB9A 2JMCA 3I55A 4C8QE 5LJ3j 1FXXA 3CD6Q 3HTRA 9ATCB 1PHTA 5KYYB 5LJ5e 1C1AA 2KMTA 4BDYA 1M90R 2QGGA 4OMMA 1Q86R 1VUBA 3ZL7C 2KT1A 3PVQA 2KK4A 2QTVA 2ED0A 1HK9A 1TOVA 4M75G 3OW2P 3SEMA 1MMDA 2HD0A 2L89A 1M9SA 2X3WD 1IHVA 3CMAA 4HCCA 5GAOm 4GY5A 2CSQA 5GJVB 5GANe 4F14A 1KIKA 4IUVA 2K79A 2QQRA 3UA7A 2DLPA 2RM4A 4J6XA 4N4IA 3I56Q 3C95A 2BKDN 3REAB 2KXCA 3EFOA 1YIJQ 2XHCA 4OMQA
chains in the Genus database with same CATH topology
2HL5C 2Z0WA 2E3HA 3E2UA 2CP6A 1WHGA 2HKNA 2HKQB 1WHJA 2CP2A 1IXDA 2HL3A 2CP0A 2QK0A 3RDVA 1TXQA 3TQ7P 2M02A 2MPXC 1WHMA 2CP7A 1WHKA 2COYA 1WHHA 2CP5A 2COWA 1TOVA 1WHLA 2COZA 4B6MA 2E4HA 2HQHA 2CP3A 2E3IA 1LPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL5 C;  2Z0W A;  2E3H A;  3E2U A;  2CP6 A;  1WHG A;  2HKN A;  2HKQ B;  1WHJ A;  2CP2 A;  1IXD A;  2HL3 A;  2CP0 A;  2QK0 A;  3RDV A;  1TXQ A;  3TQ7 P;  2M02 A;  2MPX C;  1WHM A;  2CP7 A;  1WHK A;  2COY A;  1WHH A;  2CP5 A;  2COW A;  1TOV A;  1WHL A;  2COZ A;  4B6M A;  2E4H A;  2HQH A;  2CP3 A;  2E3I A;  1LPL A; 
#chains in the Genus database with same CATH topology
 2DNU A;  2EGA A;  4A4G A;  2RQR A;  3KUF A;  3M0P A;  2EYQ A;  4DEX A;  3LGL A;  3CCJ A;  5A0L A;  1DJ7 B;  2PUK B;  5CO7 A;  3L2W A;  4FT4 A;  1B34 A;  4JS5 A;  3JB9 H;  2BE7 D;  4XTV A;  1VQ7 Q;  1YHQ A;  1UG1 A;  1UHF A;  3CCE A;  3CPF A;  4OMO A;  4PFP A;  4M7A F;  1WA7 A;  4M7D E;  3OYM A;  2D9T A;  1I8F A;  1Z9Z A;  3M57 A;  3RDV A;  2XMF A;  3PT9 A;  3C4S A;  2F2X A;  3CCQ Q;  4PJM A;  3CPW P;  3TCJ A;  3NFC A;  5GMK h;  3CC4 Q;  2XID A;  4O6J A;  1UGS B;  4O5V A;  4JS4 A;  1X2Q A;  5I2M A;  4M75 A;  3QII A;  1R0B G;  4JRQ A;  2DXU A;  1K8A R;  2YUQ A;  2A37 A;  2LC4 A;  2P84 A;  4E7I A;  3V8J A;  5KE3 A;  3VYH B;  1OZ2 A;  1PNJ A;  3MEW A;  2PNI A;  3CCM T;  3VS3 A;  3OYL A;  1VQK A;  4D8K A;  4RG8 A;  3ZFJ A;  1OEB A;  2J6O A;  3ULR B;  1TG0 A;  3TQ7 P;  4ZN3 A;  5D7U A;  3M56 A;  4Z88 A;  2PVD B;  4FL6 A;  1OU8 A;  4GBQ A;  3BDL A;  3PVL A;  3PFS A;  3M0T A;  4JRI A;  3L2U A;  1BKB A;  2F2V A;  3PTA A;  2QQB A;  4IKF A;  4Y91 A;  4FYY B;  2V8I A;  3KFV A;  2KGT A;  4L59 A;  3LW5 E;  3CC2 T;  2LCS A;  4L5G A;  5I21 A;  1D0Y A;  2LT1 A;  2YRD A;  4KUD K;  2VUB A;  4ZTF A;  3SD4 A;  3LH5 A;  5CR2 A;  1TUC A;  3DLM A;  3G4S A;  3VS7 A;  1W2B S;  4MDW A;  1VQL T;  3E19 A;  4HCB A;  1ZSZ A;  2SRC A;  4M78 F;  1D3B A;  1WJQ A;  2DMO A;  2RHX A;  5I2S A;  3RKW A;  2QQS A;  1ABO A;  3EG3 A;  1BI2 A;  5DY9 A;  1YWO A;  2L2P A;  1PD1 A;  2EQJ A;  1JXO A;  4R0K A;  4LXC A;  2G6F X;  2RK2 A;  2BZX A;  5KYW B;  3I5R A;  2FRW A;  2EYY A;  4E7S A;  2EJ9 A;  1KK7 A;  1R8O B;  1NG2 A;  3O8V A;  3FRN A;  2KEA A;  3I5S A;  3JCM Q;  3RER A;  2XD0 A;  1M2V A;  2M0O A;  3I35 A;  3FIF A;  1QVF S;  1M4Z A;  2WAC A;  4HCK A;  1OUL A;  1Q7Y R;  4F7U E;  2G3R A;  2JT4 A;  3A8O B;  2PUO B;  4CC2 A;  2E5K A;  2LNH B;  2RJF A;  2RK1 A;  3EH2 A;  1VIF A;  1ZUU A;  1QVG S;  3JCM c;  1Q82 U;  1ZA2 B;  1HJD A;  4CC7 A;  1E6G A;  2FPE A;  2C06 A;  3EG9 A;  4E7Z A;  1VQM Q;  5LJ3 h;  2K5F A;  2M02 A;  1N8R R;  1SG5 A;  1IGU A;  1ZA1 B;  1KQ2 A;  5GAM g;  4FU6 A;  2L3R A;  2GF7 A;  3HL8 A;  5GAN 5;  2F5T X;  4C0D C;  2AHJ B;  4C5E A;  1IO6 A;  5IHI A;  4LDY A;  3MHX A;  2EKH A;  1JRI A;  2MWO A;  3V7C A;  4XU1 A;  5GAN 6;  1VYU A;  4M75 C;  2XG8 D;  2DEQ A;  2R5A A;  4WTO B;  4A53 A;  1D1C A;  4CRI A;  3LGF A;  3LH0 A;  4JUV A;  2CS7 A;  3MET A;  3SHW A;  4XQ3 A;  3OYG A;  1NEB A;  5GMK e;  1YJN A;  4DEY A;  4M75 D;  2QG9 B;  1M27 C;  4OGC A;  4YTL A;  4JJN K;  5L23 A;  5IH2 A;  3CC2 Q;  1D09 B;  4WF2 A;  4J6Y A;  1JJ2 A;  2LMJ A;  1G3Y A;  3I55 T;  3OA6 A;  2C0T A;  5GAO p;  5DLQ E;  1Y07 A;  3RKX A;  1N8R C;  1YCS B;  2EFI A;  3CPW S;  4C8Q C;  1Q81 R;  1OOT A;  4OB0 B;  5GAM j;  1AT1 B;  1VQL Q;  3CXC A;  1QCO A;  1U3O A;  1TXQ A;  4X9D A;  1G8X A;  1ZQ1 A;  1RUW A;  1ZUK A;  3OMG A;  4NL2 A;  1VOM A;  1AEY A;  1TS9 A;  1AWW A;  5CKF A;  3M59 A;  2QDL A;  2JNG A;  3CMA T;  3EFO B;  4PFO A;  4EDU A;  1GCQ A;  4J8O A;  4J7I A;  4KH0 B;  3X28 B;  4OGE A;  1IHW A;  1AHJ B;  2P0Q A;  2O9S A;  3L1A A;  1JQQ A;  2DRK A;  3A8H B;  3G6E T;  1U1T A;  1BBZ A;  1ZSZ C;  1MND A;  2KAF A;  4Y28 E;  2RQU A;  1RLP C;  2YUN A;  1WHG A;  3H0I A;  4WCI A;  5C6S A;  4FT2 A;  2QK0 A;  3CCJ T;  1WDX A;  1KQS S;  2K3B A;  3C94 A;  3CCS A;  1KC8 R;  3OB9 A;  4C0D B;  5ECA A;  2DXB A;  2VXF A;  2F69 A;  1TUD A;  2CT4 A;  4X1V A;  1BCM A;  4B6M A;  2EYZ A;  3CCE T;  3QHS A;  2KRS A;  1MMN A;  2I2L A;  3P8D A;  3QWY A;  4M75 B;  1RAA B;  4M7D C;  3N5B B;  2L5Q A;  3GPL A;  3JCM P;  2XDP A;  1VQ8 Q;  4ZN1 A;  5CQY A;  4BE2 A;  2X4X A;  4C5H A;  3EGU A;  1HD3 A;  1NBE B;  5GAN 8;  2XI9 A;  2RA2 A;  4AFS C;  1K73 R;  4C5G A;  2GTJ A;  4PJO E;  4HVW A;  1AWX A;  1M5Q 1;  3EHQ A;  1ZUY A;  2LTO A;  1OX9 A;  1MMG A;  2XU8 A;  4HA8 A;  3ASK A;  4BI4 A;  4OP0 A;  5IHK A;  1BI0 A;  3CC7 A;  2DXT A;  1PSE A;  1P92 A;  5KYU B;  1WHK A;  4JJD A;  3EFR A;  1UEC A;  4ZNX A;  2R5M A;  3M0R A;  2O31 A;  4BY6 C;  4C8Q B;  2PTK A;  5CQX A;  2DL4 A;  3HRS A;  1T0J A;  2K3Y A;  1VQ4 A;  3EAE A;  5LJ3 e;  1VQK T;  4XTY A;  2QDY B;  3CCU Q;  2YHT A;  5A2Q E;  2VVK A;  4KGX B;  3QUI A;  8AT1 B;  5GAO q;  1UGQ B;  2O88 A;  2LJ0 A;  4PK4 A;  1Y57 A;  2DTO A;  1WHL A;  1X2K A;  4BUG A;  2PZ1 A;  1WPY A;  2ZGW A;  1EZZ B;  4ORZ A;  2ZCF B;  3CMA Q;  2CP2 A;  1I81 A;  4PJO G;  1N5Z A;  1G2B A;  1TTH B;  2BZ8 A;  4LN2 A;  1K73 C;  2LJ3 A;  4QQG A;  4J9F A;  1ZSZ B;  4FW2 A;  4FW1 A;  2VC8 A;  1FX7 A;  1D3B B;  2JW4 A;  4RTV A;  2IVW A;  3G6E Q;  4JRK A;  3H6Z A;  1GXI E;  1W1F A;  1SKU B;  2ROT A;  3G4S T;  1Q95 G;  2QEX T;  2GFU A;  1VA7 A;  3ME9 A;  1HSQ A;  1VQ5 Q;  2CT3 A;  3FEO A;  1G3W A;  2K6D A;  2A3L A;  3OYA A;  3CCJ Q;  3LWI A;  1WX6 A;  3EGX B;  5IAY A;  1W2B P;  2H3E B;  3MKD A;  1X75 C;  1VQ9 A;  1M2V B;  4ZTJ A;  2GTO A;  2VKN A;  2IPO B;  4RTZ A;  3EG0 A;  3OW2 A;  2HQH A;  3CCE Q;  4M7D B;  1G3T A;  2ZPE B;  3NTH A;  2CRE A;  4CC3 A;  4ZGD B;  2HL3 A;  4JLI A;  4PNO A;  2GNC A;  3UAT A;  4RMO A;  3EG9 B;  1UGR B;  2J7I A;  1OX8 A;  5IT9 E;  2GFA A;  2O9V A;  2EQK A;  3REB B;  2YDL A;  2M0Y A;  1UHC A;  4E2F B;  5A0G A;  1QVF P;  2VWF A;  4XTZ A;  3VS6 A;  2RJC A;  3D7S B;  1WGS A;  1EIF A;  1JXM A;  2HBW A;  3QSU A;  2OI3 A;  3OYY A;  3OS0 A;  4RG2 A;  4LUE A;  4BY6 B;  1CKA A;  1NE8 A;  4PJO A;  2AT1 B;  1QVG P;  5GAM h;  4F16 A;  3L2Q A;  3FJ5 A;  1SPK A;  3VS4 A;  3WVD B;  2JZ2 A;  3LLR A;  3GNG A;  4RTX A;  2E3I A;  2R58 A;  3RNJ A;  3FB9 A;  1VQK Q;  1UGV A;  5M9O A;  1BYM A;  5C0M A;  5LJ5 f;  3OYD A;  1VYT A;  2DER A;  1UEB A;  4M78 E;  2RHU A;  2P0P A;  1I07 A;  4B9W A;  1LCK A;  1G5V A;  3EGD A;  3BFM A;  2DM1 A;  3M9Q A;  2FO0 A;  2E5Q A;  3RR6 A;  1Y96 B;  3A1P A;  4RCB A;  1PRM C;  3TVT A;  3M53 A;  3OS1 A;  1M8M A;  2K3X A;  2KBT A;  4C8Q G;  4B9X A;  5GAN f;  2CDT A;  5LJ5 d;  3CQT A;  2COY A;  2FZG B;  2KRO A;  2E4H A;  4EMH A;  2BZY A;  4QVC A;  3R6N A;  2OTL A;  3G4S Q;  4PLI A;  2J05 A;  2FRY A;  2QEX Q;  1TH7 A;  2JTM A;  3A8L B;  2FG0 A;  5FLX E;  2KDS A;  2KI7 A;  4J9E A;  3BW1 A;  2OTJ T;  2DE0 X;  3UPU A;  2ABL A;  4RTU A;  4VUB A;  2K57 A;  1RL2 A;  1WHH A;  1JB0 E;  2K2V A;  5GAN d;  4IIM A;  1D1B A;  3IQL A;  3OYC A;  2AKL A;  1BU1 A;  1BI3 A;  2LNV A;  3E2U A;  4PLL A;  3V7S A;  2DYB A;  4OVA A;  1VQN A;  4F7U B;  2IG0 A;  3EG2 A;  1QVP A;  2H8H A;  3G71 T;  4FCY A;  2CP7 A;  4BDZ A;  4PKC C;  5GMK l;  2OAU A;  1H3Z A;  2CP3 A;  1LPL A;  3SFM A;  2KNB B;  1UJY A;  3NTI A;  4M75 F;  4EIK A;  2VAS A;  1ARK A;  1Q82 R;  3H9N A;  2CP0 A;  3CCS T;  1YFN A;  3LWH A;  2DL5 A;  3INZ A;  3E9F A;  3GF5 A;  5KYU A;  3CCV A;  2K7A A;  4M7D G;  2L3S A;  3HKS A;  4C8Q A;  1SEM A;  2E10 A;  3GBQ A;  1KQS P;  4ELZ C;  4XTX A;  3MEU A;  2EQM A;  3F70 A;  4BB7 A;  1WJR A;  2HMA A;  3JB9 J;  1LVK A;  2DKG A;  2RI2 A;  1VQ6 A;  1OPK A;  3PNW C;  4MML A;  1U5S A;  3RUX A;  3CCL A;  1IB8 A;  2C0O A;  2VV5 A;  2L3Q A;  2DD5 A;  1RLQ C;  1UGP B;  2X4W A;  2ZPB B;  3JCM h;  3HRT A;  2DF6 A;  1QKW A;  4E7K A;  1M3C A;  3NTK A;  2VGM A;  5KYN A;  3I56 A;  1BI1 A;  1YIJ A;  4PJO C;  1O75 A;  2BIV A;  3MP6 A;  1QWE A;  4LUD A;  3ZBD A;  3CC7 T;  2M51 A;  2QI2 A;  1AZG B;  3QZ9 B;  4KT0 E;  2GQV A;  3BE3 A;  2PVO B;  2XIC A;  1Q82 C;  4PJO D;  2HSE B;  1VQ7 A;  2X4Y A;  4LNP A;  4C92 E;  3OSS C;  3CME A;  1VYV A;  4CC4 B;  5EG2 A;  1JBM A;  5GAM e;  3KXT A;  3OBW A;  4LD9 K;  1RAH B;  2L0A A;  1YN8 A;  3EGX A;  4BE0 A;  2QA4 A;  1YBY A;  1TWB A;  2OTJ Q;  1VQO T;  1M8V A;  2ESW A;  3CCQ A;  4Y92 A;  1KG1 A;  1RAD B;  3DKM A;  1YJ9 A;  3CC4 A;  1GBR A;  2VB6 A;  2KR3 A;  4M7D A;  3M0U A;  3HRU A;  2HSP A;  4M77 E;  2RH2 A;  3MCA B;  5GAN 2;  2Z0W A;  3V7R A;  2Y90 A;  5CKB A;  3ZEH A;  3M0S A;  4M4Z A;  2W10 A;  1ABQ A;  2LDM A;  3OYB A;  3HP9 A;  1M1G A;  4ZGJ B;  4QT7 A;  3JB9 G;  3G71 Q;  2DIG A;  3HPW A;  2K5L A;  1YIT A;  2A28 A;  1TUG B;  1Z9Q A;  3TRE A;  4AFU C;  5GAN 7;  1GL5 A;  1XJW B;  2MWP A;  3CCM Q;  2JJ9 A;  1UB4 A;  1WLP B;  1M1F A;  4V2S A;  3UF4 A;  1IXD A;  4C92 G;  5GMK i;  4ELY C;  4D6W A;  3CCS Q;  2D0Q B;  4HVU A;  3VS2 A;  1GCP A;  3EG1 A;  1X6O A;  1NM7 A;  1VQ9 T;  4FYW B;  2DYI A;  3UDC A;  4RCC A;  4J9D A;  3TSZ A;  3C12 A;  1X69 A;  2RHI A;  1J3T A;  3RBB B;  2LX9 A;  1G3S A;  4AG1 C;  4F7U G;  3HFO A;  1FYN A;  2SEM A;  4M77 G;  3VRZ A;  3PE0 A;  2F2W A;  3GLX A;  2ZPG B;  2HQX A;  2LCL A;  2XKO C;  4A54 A;  4OB3 B;  2FB7 A;  5D6Y A;  4PJO B;  3FJP A;  1KHC A;  1WNL A;  1M1K C;  1QP3 A;  2MYS A;  3OY9 A;  1Y96 A;  4DOV A;  1BK2 A;  4RTW A;  2KSS A;  1PD0 A;  2CGH A;  3V8L A;  1H92 A;  2DA9 A;  1ZBX A;  1GRI A;  4TVR A;  3CC7 Q;  3J7A F;  2OJ2 A;  2HZY A;  4LDV A;  2LP5 A;  1KQ1 A;  2RB6 A;  1NEG A;  5FU6 C;  1K4U S;  3UA6 A;  2HNI A;  2CP5 A;  4K11 A;  2RI3 A;  5EC7 A;  2NUT B;  4C8Q D;  3EGD B;  1X01 A;  3EFS A;  1I4K 1;  5GAO r;  5GAN 4;  2E6N A;  1I5O B;  1QCF A;  1QP2 A;  4XTU A;  1M1K U;  2MF2 A;  4MZP A;  4OMP A;  1NZ9 A;  2KVQ G;  2X9H A;  4C92 A;  1AD5 A;  2MPX C;  5KCH A;  1VQO Q;  1WHM A;  2MIO A;  3GP8 A;  2J6F A;  1NPR A;  2O4X A;  2RI5 A;  1N9R A;  4M78 C;  2DBK A;  1M30 A;  2AZV A;  3S3N A;  3VYG A;  4BI8 B;  3OYF A;  1BIB A;  2ENM A;  1S72 A;  5FRO A;  3BDU A;  2EKO A;  2YUP A;  1EFN A;  3JCM e;  4F7U A;  1T0H A;  1VQM A;  1R0C B;  2FPF A;  2W0Z A;  4M77 A;  1YI2 A;  2RHZ A;  4RTT A;  2GGR A;  4QKU A;  2JUF A;  4D8D A;  2DZ9 A;  3SWN A;  1XOV A;  1YHQ T;  2LVM A;  2YUO A;  2EBP A;  2OTL T;  3QWX X;  5KYX A;  4Q5W A;  1QKX A;  4BE1 A;  2JVV A;  1PM3 A;  2ZPF B;  3JCM f;  4JZ4 A;  2E65 A;  2K4Y A;  3QO3 A;  4QVZ A;  5J39 A;  4ANJ A;  2FZC B;  2M1H A;  5L8R E;  1M3A A;  1TU0 B;  1VQ9 Q;  2LRQ A;  4Z89 A;  2HEQ A;  1ZLM A;  2KRM A;  2PQW A;  1OYX A;  1SSF A;  3ER0 A;  3CCR A;  1UUE A;  5KH6 A;  2YLC A;  3QPH A;  5GJW B;  2L8D A;  2JOY A;  4M7D D;  1BCO A;  1VQN T;  1NPP A;  3MEV A;  1XQH A;  4QQD A;  3RIR A;  2RHY A;  4C0G A;  1IZ6 A;  1N9S A;  2LX7 A;  3JCM d;  2RF0 A;  5CIU A;  4J5Y A;  3PMI A;  3NPF A;  1QMC A;  3VU3 C;  3RMQ A;  2E41 A;  3OBY A;  3L42 A;  2JTF A;  3CBM A;  4LDW A;  2DEU A;  3H41 A;  3I55 Q;  3QYG B;  4NL3 A;  2E3H A;  1B3Q A;  3NMZ C;  4PJL A;  5FU6 B;  3MP8 A;  1C6V X;  3HFN A;  3CCV T;  3H0H A;  4HT8 A;  4AT1 B;  1W2B A;  2CH4 W;  1X43 A;  4IIO A;  4QW2 A;  8ATC B;  2OX7 A;  3HSB A;  2XDB A;  2MMP A;  3I9Q A;  2PU9 B;  3M54 A;  1VQ6 T;  1SF9 A;  5LJ3 f;  4OB2 B;  3OYH A;  1FWZ A;  3A8G B;  1KFZ A;  3CCL T;  2DTH A;  5FW9 A;  3GOX A;  3PGG A;  2EGC A;  1QW1 A;  4M78 B;  5HCK A;  2AZS A;  1NJI C;  4E47 A;  4M7A E;  2C0I A;  2O2O A;  3I56 T;  2WSF E;  1YJW A;  1YIJ T;  5AYF A;  2DAQ A;  2LZ6 B;  4J9H A;  1RAE B;  1KSW A;  1WIE A;  3QBY A;  3SB2 A;  1FMK A;  2QXF A;  2WSC E;  1QVG A;  5LJ3 d;  2NLU A;  2HCK A;  3DB3 A;  4JJC A;  1GFC A;  2E6Z A;  4RKU E;  2E12 A;  3JCM W;  2JXB A;  4HKE A;  4KH1 B;  4QQ6 A;  1VQ7 T;  1YWP A;  2YRV A;  1AZE A;  1KD1 C;  1YHQ Q;  3CME T;  4J9C A;  3GNF B;  1QLY A;  3L2V A;  1NJI U;  2P4R A;  5CK9 A;  5HY6 A;  2O01 E;  4C92 C;  3BY7 A;  2QA4 T;  3JB9 D;  4HT9 A;  5D6X A;  2YSQ A;  4KGV B;  3M55 A;  1U8R A;  1VQ8 A;  1QQJ A;  2EQU A;  3JSC A;  2WSE E;  3CC4 T;  1YJ9 T;  2DVJ A;  4MZM A;  1WXB A;  4JDS A;  3L2R A;  4C92 D;  3OYN A;  4M7A G;  2X3X D;  1VQP A;  2RO0 A;  2DL3 A;  3M0Q A;  4M77 C;  5HKC A;  2VYT A;  1K9M C;  2L3P A;  2ZAE A;  2NWM A;  4AMC A;  1KD1 U;  3SWN C;  1RI0 A;  4IUT A;  1PRL C;  2CZ6 B;  2LQW A;  3VJP A;  1YIT T;  3DB4 A;  3URG A;  5HK0 A;  3Q1J A;  2A0F B;  2DBM A;  1U06 A;  5KCO A;  1X27 A;  2P0K A;  2V1Q A;  4M77 D;  1D0Z A;  1K1Z A;  1GBQ A;  2JS0 A;  1IGQ A;  2LQ8 A;  3CBP A;  1PC0 A;  4PL6 A;  2LJ1 A;  1E7O A;  3CCU A;  1Y7X A;  1IRX A;  1I5L A;  3CCV Q;  2EYW A;  2HQE A;  3CPW A;  4XTW A;  4PJO F;  5GMK m;  3X25 B;  1K9M U;  1H64 1;  2KQW A;  2NUT A;  5I22 A;  3WVE B;  3V8K A;  3VS5 A;  3FLG A;  3T9N A;  4PJN A;  4DOW A;  4KUL A;  1VQ6 Q;  3A5Z B;  2P4T A;  1EX4 A;  1N27 A;  4JLG A;  1G83 A;  3CCL Q;  1YJN T;  3TEE A;  3TU4 K;  2ECZ A;  3OSV A;  4X34 A;  5IN1 A;  4L6V 5;  1JJ2 S;  3M4G A;  1RAF B;  2QAZ A;  1YNZ A;  3FDR A;  1GFD A;  1A0N B;  1W6X A;  2A7Y A;  1CKB A;  3G6E A;  1O9S A;  5LJ5 g;  2FVU A;  1XNI A;  2DJZ A;  3VS0 A;  1PKS A;  1OU9 A;  3FC3 A;  3CXC S;  4DA4 A;  4JRP A;  2XDD A;  3QJ6 A;  4M7A A;  1VQ5 A;  4DQ2 A;  4DBQ A;  4EMK A;  2B8A A;  2DJQ A;  1MV0 B;  2EAY A;  2EWN A;  2MI6 A;  3GIB A;  2KY9 A;  3X20 B;  4J7F A;  4A4H A;  2RD1 A;  2DL8 A;  2MOX A;  4E7H A;  2JS2 A;  2D8H A;  1U1S A;  1KQS A;  4C92 B;  5IXF A;  3S3O A;  2ED1 A;  4J9G A;  1NLP C;  2DK3 A;  2EW3 A;  2LQK A;  3J80 E;  2COZ A;  4AFZ C;  2O4X B;  2A36 A;  4CI0 C;  3CME Q;  1M90 C;  2KRN A;  4M78 G;  1Q86 C;  5GAN g;  1X6B A;  2YXY A;  1T3L A;  4GLK A;  1MUZ A;  2QA4 Q;  2R57 A;  2K2M A;  2AIR B;  4XU0 A;  2MAM A;  2Y4X A;  4KGZ B;  1YJ9 Q;  3JAM E;  4BI3 A;  2F5K A;  4QVD A;  4M77 B;  1XTD A;  4IUR A;  3UWN A;  2CUD A;  5FRM A;  2CYZ B;  2YRC A;  3RMS A;  3OYJ A;  3SWN B;  1K0S A;  2YLB A;  2D8J A;  1S72 T;  5KYX B;  2KT8 A;  3QDR B;  4FSX A;  2EJF A;  1VQM T;  3CD6 A;  2KXD A;  1F1B B;  2EGE A;  4BD3 A;  4DBR A;  1YI2 T;  4ATO A;  2E70 A;  5LJ5 j;  1M90 U;  1UJ0 A;  4A4F A;  1Q86 U;  1T3S A;  3E1S A;  4HCZ A;  5GAO l;  2NYS A;  3P8H A;  1QWF A;  4F04 B;  2M16 A;  1ZHI A;  2LCC A;  2JM9 A;  1YIT Q;  1V29 B;  3MP1 A;  1YP5 A;  1PKT A;  2FHD A;  5CKH A;  5J3B A;  5DLO A;  2BE9 B;  2H3J A;  2CP6 A;  1NYF A;  2NUP B;  3M4Y A;  5IXB A;  1M3B A;  2EIF A;  4JPB W;  5A0D A;  1ZSG A;  2CZ1 B;  2QAS A;  3JCM J;  3VKI A;  4FYV B;  4A4E A;  4F17 A;  4BAC A;  1TSF A;  1RAC B;  5GAN j;  3CCR T;  4DBF A;  1WFW A;  4C8Q F;  1UFF A;  5CCA A;  2DX1 A;  2ATC B;  4FIB A;  5CKD A;  2X4J A;  1LOJ A;  3A98 A;  2GBQ A;  5FRN A;  2J6K A;  2ROL A;  3LYI A;  4M78 A;  4A4K A;  2RQT A;  1RI9 A;  1YJN Q;  1AVZ C;  3QJY A;  4LDX A;  2V1R A;  3S6W A;  2KYM A;  2RJD A;  1KJW A;  5CKE A;  3EHR A;  2VGN A;  4C0Z A;  4X9C A;  3MPU B;  1AWO A;  1VQ4 T;  1K8A C;  4EPC A;  1W4S A;  2QEX A;  2JM8 A;  1OPL A;  2DFU A;  3P8B B;  1OZ3 A;  4NOY A;  1FMW A;  1JU5 C;  3JCM V;  2D0N A;  4KRT A;  3OYE A;  2I0N A;  2MCN A;  2AK5 A;  4J83 A;  1RAG B;  1ZX6 A;  5IHN A;  2D6F A;  4EMG A;  3QYH B;  5GAM f;  4E7J A;  1M1K R;  4OMF B;  1WQ7 A;  4LDU A;  1K8A U;  3SDZ A;  1WQW A;  2HBP A;  4Z02 A;  1YJW T;  4M7A C;  3UT1 A;  4C0F A;  1Y0M A;  4EMK C;  3VRY A;  4M7D F;  2CUB A;  2NUZ A;  1S72 Q;  1PSF A;  2RQV A;  2DPP B;  4FSS A;  4N4G A;  2E1H A;  3QZ5 B;  3E9G A;  1X6G A;  2YT6 A;  4A63 B;  3QG1 A;  4M7A D;  1YI2 Q;  1C0M A;  5GAM d;  3OW2 S;  1V1C A;  3MO8 A;  3AT1 B;  3H8Z A;  4ZGE B;  2RNA A;  3G1J A;  1AOJ A;  3RES A;  3LX7 A;  1OI1 A;  4FYX B;  2HDA A;  4II1 A;  4KUI A;  1MGQ A;  2V8K A;  2A08 A;  5KYY A;  4N0A A;  2CH4 A;  2HKN A;  2FPD A;  4PJJ A;  1OQK A;  1VQ8 T;  1K76 A;  1PCX A;  3VV0 A;  4XU3 A;  4LD6 A;  3OYI A;  1LNX A;  1K9A A;  2LQN A;  2QQ9 A;  4OMN A;  1ZBJ A;  3CCR Q;  1H3H A;  1VQP T;  2FL7 A;  4XK8 E;  1VIE A;  1CSK A;  5DM7 R;  3JB9 I;  1YCY A;  1K0X A;  1OV3 A;  1B07 A;  1SHF A;  1Q7Y C;  3PIO A;  4N4H A;  3G7Z A;  1RAI B;  4KBM B;  3A8M B;  2J06 A;  3VS1 A;  4OML A;  2RN8 A;  1JO8 A;  2CZ0 B;  4Z8A A;  4XU2 A;  4J9B A;  3VUZ A;  1MNE A;  3PIP A;  1D1A A;  1VQ4 Q;  1PWT A;  3PMT A;  3CCU T;  1SSH A;  2EPD A;  1RAB B;  4J9I A;  2EJG A;  3M58 A;  3DLL A;  2OTJ A;  4RUG A;  3JCM X;  3H0F A;  4HXJ A;  1WI7 A;  1Q7Y U;  4OB1 B;  5FU7 C;  2JN0 A;  5LL6 S;  3JB9 F;  3RKY A;  2M9U A;  2FEI A;  3X26 B;  2RJE A;  3M5A A;  3QKJ A;  4M7A B;  3X24 B;  5D6W A;  1UE9 A;  4EMK B;  5I11 A;  4C5I A;  1N8R U;  4M78 D;  2F1L A;  4C92 F;  3J81 E;  4E7L A;  5LJ5 h;  3G71 A;  1YJW Q;  1B34 B;  2JTE A;  4AFQ C;  1JJ2 P;  1R77 A;  2D1X A;  2GQI A;  1VQ5 T;  3OS2 A;  7AT1 B;  2QQA A;  3CCM A;  3QDF A;  1I1J A;  5J26 A;  3KBG A;  3CXC P;  2CZ7 B;  4F7U F;  1ACM B;  1QCN A;  2DIQ A;  3QXE B;  1AWJ A;  1IRE B;  4M77 F;  4ME7 A;  4R56 A;  2XK0 A;  2K9G A;  2RPN A;  1SHG A;  4NS5 A;  1Q81 C;  3C0C A;  4HVV A;  3L2Z A;  5GAN h;  1KHI A;  2X51 A;  4UC4 A;  1NJI R;  2CKK A;  2EVR A;  2HL5 C;  2NUP A;  2DD4 A;  5AT1 B;  3S3M A;  3JV3 A;  4MZT A;  4PFZ A;  1WXT A;  1LJO A;  2QGF B;  5GMK j;  1MMA A;  1Y71 A;  1N6A A;  4ESR A;  5FWB A;  3CC2 A;  4E6R A;  3JCM g;  4RTY A;  3EH1 A;  2B86 A;  3TSW A;  1VQP Q;  2HAX A;  5GAN 3;  4IUU A;  2V26 A;  6AT1 B;  3MJX A;  3AHU A;  5CVI A;  1M2O A;  3CD6 T;  2OAW A;  2RMO A;  1Q81 U;  2X35 A;  1HXD A;  3OQ5 A;  4IUP A;  1KD1 R;  1VQL A;  2YWW A;  2EQI A;  2VXE A;  1UTI A;  2DO3 A;  1WZO A;  4MMK A;  3WXM B;  4N0A C;  2DRM A;  4AG2 C;  3THK A;  4LE9 A;  2JMA A;  1KC8 C;  5HK3 A;  3CEY A;  4JZ3 A;  4MDX A;  2DVE A;  2EYX A;  4OF1 A;  4DBH A;  2ZZD A;  2V8J A;  1MHN A;  1H8K A;  3VUB A;  5FU7 B;  2E64 A;  3JRZ A;  1VQO A;  2MK5 A;  1K9M R;  4R55 A;  2FZK B;  4JJB A;  5KYW A;  3R6O A;  5FWC A;  1QVF A;  3CBO A;  5KE2 A;  3OYK A;  1PG5 B;  2FYK A;  2ZPH B;  2PVG B;  1HYO A;  2IIM A;  5CAI A;  1KC8 U;  1I0C A;  1UDL A;  2DIL A;  2QYZ A;  2RQW A;  2Y4Y A;  5LJ3 g;  4J6W A;  1WYX A;  3HHT B;  3OS5 A;  2DZC A;  2COW A;  2DTI A;  1JEG A;  3U23 A;  1SRM A;  2DET A;  2OTL Q;  2DL7 A;  4GLM A;  2AKK A;  1W70 A;  1SRL A;  1FMV A;  1WHJ A;  2KE9 A;  2KYB A;  3CCQ T;  1MV3 A;  4FM4 B;  1S1N A;  4M75 E;  1D0X A;  2QTX A;  3MEA A;  1GCQ C;  1K73 U;  4P5N A;  3NHN A;  1NLO C;  5GAO n;  2BTT A;  3JCM b;  1B7T A;  2LT4 A;  3NGP A;  3OMC A;  2HKQ B;  1E6H A;  1WJS A;  1WXU A;  2ZPI B;  2GCX A;  4IUQ A;  2BUD A;  1VQN Q;  2DXC A;  1BIA A;  2CSI A;  3O5Z A;  1NYG A;  1V76 A;  2K5I A;  4XAX B;  1BB9 A;  2JMC A;  3I55 A;  4C8Q E;  5LJ3 j;  1FXX A;  3CD6 Q;  3HTR A;  9ATC B;  1PHT A;  5KYY B;  5LJ5 e;  1C1A A;  2KMT A;  4BDY A;  1M90 R;  2QGG A;  4OMM A;  1Q86 R;  1VUB A;  3ZL7 C;  2KT1 A;  3PVQ A;  2KK4 A;  2QTV A;  2ED0 A;  1HK9 A;  1TOV A;  4M75 G;  3OW2 P;  3SEM A;  1MMD A;  2HD0 A;  2L89 A;  1M9S A;  2X3W D;  1IHV A;  3CMA A;  4HCC A;  5GAO m;  4GY5 A;  2CSQ A;  5GJV B;  5GAN e;  4F14 A;  1KIK A;  4IUV A;  2K79 A;  2QQR A;  3UA7 A;  2DLP A;  2RM4 A;  4J6X A;  4N4I A;  3I56 Q;  3C95 A;  2BKD N;  3REA B;  2KXC A;  3EFO A;  1YIJ Q;  2XHC A;  4OMQ A; 
#chains in the Genus database with same CATH homology
 2HL5 C;  2Z0W A;  2E3H A;  3E2U A;  2CP6 A;  1WHG A;  2HKN A;  2HKQ B;  1WHJ A;  2CP2 A;  1IXD A;  2HL3 A;  2CP0 A;  2QK0 A;  3RDV A;  1TXQ A;  3TQ7 P;  2M02 A;  2MPX C;  1WHM A;  2CP7 A;  1WHK A;  2COY A;  1WHH A;  2CP5 A;  2COW A;  1TOV A;  1WHL A;  2COZ A;  4B6M A;  2E4H A;  2HQH A;  2CP3 A;  2E3I A;  1LPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...